1WUEA

Crystal structure of protein gi:29375081, unknown member of enolase superfamily from enterococcus faecalis v583
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
370
structure length
370
Chain Sequence
b'GSHMNIQSIETYQVRLPLKTPFVTSYGRLEEKAFDLFVITDEQGNQGFGELVAFEQPDYVQETLVTERFIIQQHLIPLLLTEAIEQPQEVSTIFEEVKGHWMGKAALETAIWDLYAKRQQKSLTEFFGPTRRKIPVGISLGIQEDLPQLLKQVQLAVEKGYQRVKLKIRPGYDVEPVALIRQHFPNLPLMVDANSAYTLADLPQLQRLDHYQLAMIEQPFAADDFLDHAQLQRELKTRICLDENIRSLKDCQVALALGSCRSINLKIPRVGGIHEALKIAAFCQENDLLVWLGGMFESGVGRALNLQFASQPTFSFPGDISATERYFYEDIITEPFILEQGTMTVPQGLGIGVTLSQTNLLKYSQYQKIM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords mandelate racemase/muconate lactonizing enzyme family protei
publication title Loss of quaternary structure is associated with rapid sequence divergence in the OSBS family
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 120
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1wueA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1wueA01
3FYYA 4DN1A 3VCNA 3MWCA 3P0WA 2PGEA 3ZVHA 4GYPC 2PS2A 4KEMA 2PP0A 3QLDA 4ENLA 3ZLGA 3UCDA 1KD0A 3MUCA 3ES7A 3R10A 3BOXA 4MKSA 1EC9A 2AL2B 3FVDA 2XH2A 3TJIA 4E4FA 2O56A 1JPDX 3DFYA 4A6GA 4JN7A 3EEZA 2AL2A 2PPGA 2OPJA 3R0UA 2ONEA 1TE6A 3UJ2A 2CHRA 3D46A 2P0IA 3R0KA 3U9IA 5BOEA 1TZZA 3SQSA 3SN0A 3N6JA 2GDQA 3UXLA 4H2HA 2FYMA 3MSYA 3DGBA 4M6UA 1L8PA 1P48A 3I4KA 7ENLA 2PODA 3JZUA 3I6EA 4K1WA 3B97A 3MZNA 1ECQA 3TOYA 2XH7A 3STPA 3THUA 2PP1A 2OZ8A 4J3ZA 1R0MA 4J1OA 2OVLA 2OX4A 5FJOA 4E4UA 1OEPA 1W6TA 2NQLA 4G7FA 2PMQA 1XS2A 2AKMA 3DG7A 1WUFA 1ONEA 4M0XA 3VDGA 5EU9A 4A3RA 4K8GA 4E5TA 1MRAA 3V5FA 3TJ4A 4HNLA 4IP5A 2MNRA 2QJNA 3NXLA 4IT1A 4X2PA 2QGYA 4F4RA 3UXKA 2OZTA 3FCPA 3CYJA 3JVAA 2OKTA 3DEQA 4DXKA 4Z1YA 2DW6A 4ZCWA 5FJPA 1MDLA 5FJTA 1KKRA 1RVKA 4IL2A 4H1ZA 2PCEA 3CAWA 3UJSA 3VC5A 2PGWA 4HPNA 3OTRA 3ENLA 3K1GA 1SJBA 2MUCA 4E8GA 3KUMA 3P3BA 3RCYA 3R1ZA 4KT2A 3MQTA 1EBGA 3PFRA 4JN8A 2P8CA 3TCSA 2GGJA 3VC6A 1R6WA 3IJLA 2OLAA 5FJUA 3T8QA 1TKKA 3OZYA 4GYPA 2I5QA 3H12A 2XH0A 2P8BA 3I6TA 2AL1A 1JCTA 4DX3A 1MDRA 2GGHA 3TQPA 3ES8A 3ZLFA 1BQGA 1PDZA 2QJJA 3GO2A 3RGTA 3EKGA 4HNCA 3T4WA 3GD6A 3P93A 3FJ4A 3CB3A 1DTNA 3NO1A 4MMWA 2PTYA 3FV9A 1PDYA 3RRAA 1KCZA 3QPEA 2QDDA 3QN3A 1NU5A 3JW7A 3SJNA 3UJFA 3Q45A 2HXUA 4E6MA 1P43A 4Z17A 1SJCA 3BJSA 2XSXA 3DG3A 2XGZA 1IYXA 3V3WA 1MUCA 2AKZA 3PWGA 2RDXA 4FP1A 1SJDA 1F9CA 4FI4A 4MGGA 5BOFA 2OG9A 4H19A 3SN1A 4IP4A 4DYEA 5J04A 4GISA 4G8TA 3GC2A 1KKOA 2PU0A 2P3ZA 3TWAA 3RR1A 3T6CA 1SJAA 3CK5A 1FHUA 3HPFA 5IDZA 2OZ3A 3OZMA 4GMEA 3S47A 3TW9A 3N6HA 3RITA 3CXOA 3Q4DA 4JHMA 3S5SA 1JPMA 2GGIA 2OO6A 5ENLA 3QTPA 3VA8A 2POZA 1EBHA 3U4FA 3ZLHA 2OQHA 3OPSA 4H83A 4EWJA 3DDMA 4HCDA 4KPLA 3UJEA 2HZGA 1FHVA 1BKHA 1ELSA 2OFJA 1WUEA 2FKPA 3DIPA 3OW1A 4A35A 3T9PA 3GY1A 4HCHA 4K2SA 2PTZA 3IK4A 1JDFA 3UJRA 3DFHA 3NFUA 3D47A 3CT2A 4ZA0A 3TTEA 2DW7A 1NELA 3IJIA 3DG6A 3NZGA 3PWIA 2HXTA 5FJRA 3TWBA 4HYRA 4DHGA 4KWSA 3V4BA 4IL0A 1EC7A 4DWDA 4YWSA 3VFCA 3DESA 3N4EA 1EC8A 2PA6A 2GL5A 3H70A 4ROPA 4GGHA 4HCLA 2QVHA 2PTXA 3H8AA 3PK7A 3H7VA 3MKCA 3UGVA 3SSZA 3IJQA 3MY9A 3RO6A 3UCCA 2ZC8A 3ZVIA 1E9IA 2OQYA 4GIRA 3BSMA 3SBFA 4IZGA 2PP3A 3DERA 2GGEA 2QDEA 3R25A 2PSNA 2HNEA 2QQ6A 2XH4A 3VCCA 2PU1A 1MNSA 2ZADA 2GSHA 3SN4A 1YEYA 6ENLA 4GGBA 3FXGA 2QJMA 3N4FA 3OP2A 3QKEA 2P88A 2GGGA 3ZVHB 3R11A 2PTWA 4GFIA 4IHCA 1XPYA 4HN8A 3V5CA
chains in the Genus database with same CATH superfamily
3IJ8A 1TV7A 3EX2A 4X61A 3FSTA 3KBJA 3P0WA 4ZQMA 5E70A 3HJEA 1W91A 1C9WA 4KEMA 2ICSA 1PTAA 4EVZA 4PCPA 3FVDA 1BXCA 2BHUA 3R8RA 4NQ1A 3V1PA 3LV5A 4UTUA 1KFBA 2NV2A 3RCMA 3ZR5A 4A6GA 5D05A 4WOZA 2PPGA 1FWFC 2HRWA 4H4QA 4YU1A 4PFHA 2Z1WA 1LRTA 1FWTA 5TAOA 1VHCA 2ZZ2A 1GRGA 2GWNA 2ALDA 2P0IA 1C8VA 4H9YA 3O6DA 2Z2AA 1IQ8A 4UWMA 3U9IA 2ZXAA 1X6LA 4EQRA 4TVDA 3GHTA 5MF5A 4AD2A 2FYMA 2YX0A 4HZMA 4ACZA 1BPLB 3FG2P 1UP2A 4O1BA 4LW7A 4XKYA 3GH7A 4H9MA 4F0KA 1R5YA 5DELA 4WY0F 2ZTKA 3NDOA 5XIMA 1TA3A 1W2VA 2FB3A 3L8KA 1C90A 3THUA 4IPJA 6CGTA 3LBMA 1XINA 3THQA 4QP0A 3NOEA 1XM3A 4IOTA 1J0ZA 3HFTA 4NKCA 1QPNA 2NLIA 4BWLC 2FQIA 3G1RA 4HOZA 1R85A 4Q3MA 1VEOA 5C9WA 2VVNA 4H4VA 4CEUC 5LNWA 3L4ZA 5JCIA 4QXIA 4AISA 4GUJA 2NQHA 2BS9A 3GG7A 5DXXA 1KLYA 1M1BA 2VQUA 3O05A 3TJ4A 1KXQA 1V8EA 2ZRYA 2O9RA 4IJBA 2E1DA 2MNRA 1XIJA 4JQ3A 1WYIA 4X63A 1M7OA 1GW9A 3RPDA 5JUVA 4ZSTA 2ZDRA 4MB5A 2V2HA 4S3JA 4ASTA 1GVOA 1XIIA 1B3YA 3T2PA 3W1XA 4ZE4A 3OIXA 3MI2A 3B8WA 4U3AA 3LPFA 4DUVA 3VD9A 4D8ZA 4EACA 1F4HA 3ZWTA 3CPGA 5TIMA 2X99A 1OT2A 2ZZBA 2F8QA 3TXVA 5LGXA 3SEPA 3ATYA 5D37A 1XHCA 2GVGA 4U5KA 4DNAA 3U5YA 3ZO9A 3PFRA 2V2DA 3B0VC 1TPC1 1A5CA 3G5EA 4KETA 3N34A 3VZZA 3WDHA 1T96A 4F0RA 1EYWA 3KBSA 1N61C 1TKKA 4P8UA 3MCNA 1AW2A 3VOCA 1G69A 3KZPA 4UMAA 4DIAA 3WK3A 4LS1A 3PNUA 1ODUA 3WENA 2D0FA 3TEVA 3L65A 3AHTA 3R8HA 1W32A 4J3VA 4KMQA 3AS0A 3FHQA 4PB3A 3LB0A 4P7OA 3W7GA 4DF2A 1B3ZA 3ID7A 3T4WA 1I1XA 1FWSA 3TFXA 1PKYA 2W63A 3NVVB 4JQ1A 1X1NA 2WSYA 3AWOA 5I03A 5D32A 3U5UA 4Z1DA 2J6VA 3LCLA 1ZBWA 1K1DA 2PDUA 3RRAA 1W5QA 2VUYA 3EEGA 4NJHA 2FJKA 4CNNA 1K4QA 3UJFA 3VGHA 2KX9A 5EMYA 2XUCA 1VEMA 4BA0A 4O18A 3DG3A 1IYXA 5AVNA 2BLEA 3WJYA 3B8UA 3TA6A 4QJ5B 3KTXA 1J0YA 1XIDA 4QQUA 1PKNA 5C8BB 1SFTA 5I3DA 3W24A 1XIFA 4MOZA 3M64A 4Z1AA 3NS1B 3NPUA 4GVIA 4GXMA 3NQGA 4G8TA 1GOWA 4YTUA 4LRSA 1EXPA 4RZ5A 4AC1X 4Z1BA 3F2DA 2DJLA 5A1AA 2VDHA 1SW0A 3GBEA 1WYGA 3THAA 4BEUA 1F2JA 1UCWA 4HU0A 3MMDA 3LZ3A 5EYWA 1ME9A 2LLEA 2WZTA 1TWIA 1XBVA 1ML1A 3G2GA 3W2JA 2A6LA 1TRIA 3W75A 1UH2A 5G2HA 1GETA 1HJQA 2F38A 3M0XA 2EO7A 5GPRA 1ITUA 4LA1A 2ZUUA 3EAOA 4HNVA 1TV3A 4UQCA 4O52A 4A35A 1SFLA 3V0UA 4IF2A 4B4FA 1UD4A 4DO5A 2E5AA 2X8GA 2DIEA 3CLMA 3LA4A 1CXIA 2ZCGA 4JQ9A 3IJIA 3M0JA 1EIXA 1MXDA 2V8ZA 1OIMA 2I1OA 4HYRA 4YIWA 3UP8A 3N73A 4UTWC 1RCOB 3WLLA 4H9ZA 4XAGA 3ARUA 3EPOA 2R9RA 3TZFA 1FDZA 2Z4GA 2FGZA 1UQZA 4ONVA 1F8MA 3NQ8A 4W7VA 4I9TA 4H9TA 1D8CA 4WDTA 2DT1A 1NOWA 4V15A 3VUPA 4DPQA 3LPPA 1LPFA 1EZWA 3GVWA 7PTDA 2CYGA 3UG4A 1GESA 4GQGA 3TNBA 3O6YX 4IJRA 1EFZA 3S1UA 2ZTJA 5E0KA 3O07A 1J0KA 1S5WA 3A5FA 5FJJA 1H62A 1QVBA 3LGEA 4EQWA 3LENA 1A5NC 3VCCA 4R53A 1UBPC 3THDA 5FACA 3LLDA 1S5MA 4C90A 5T26A 4PB5A 3WUEA 3NZPA 3PG8A 3W01A 4HBKA 3GFZA 2PTWA 4L9XA 4DXXA 2OLHA 1REQA 3M0IA 3M0YA 3C4UA 3QGAC 1KM2A 4B5NA 4W8BA 4C6CA 1FWAC 1Z7AA 3W26A 1LCOA 3GXMA 1LL6A 4GI6A 2Q3OA 3SCNA 2FH8A 2WPEA 4Y9OA 3NO3A 1AW5A 1MOKA 3W28A 1EP3A 2EPLX 1VGAA 4N0RA 3WBXA 1KXHA 3N2MA 3MI3A 1BTCA 5A8NA 3L0NA 1CWYA 1X2HA 1Q6EA 5K2ZA 3ZIZA 4LYKA 2Z25A 1Q5MA 2CLEA 3W02A 4PYSA 4NP7A 4LQ1A 1US3A 3QY7A 2H9AB 5CSSA 4GVGA 3N2CA 3KVLA 4EAMA 4KCWA 4HT3A 1BWVA 2F2HA 1QI3A 1EWEA 4XAFA 2OCZA 1UOKA 5LIWX 1CCWB 2EQ8A 3R13A 1CTNA 4XD3A 1QNSA 4ML9A 1PZ2A 4WUIA 1CBGA 4J1OA 3KRUA 2G3IA 4NX0A 2OVLA 2QPXA 2DORA 2X7VA 3AIWA 5PTDA 4UTTC 4DM1A 3P5ZA 4Q6XA 4ZODA 1TQJA 2D2OA 3V7PA 3KZSA 1SSGA 4H4UA 3SY1A 3PBYA 1WO2A 3HA1A 1E1FA 1RR2A 4BZYA 4TV5A 3GR7A 1QHZA 1A3WA 3AM9A 3EX6A 1UZHA 4U2ZA 1DXLA 4IFRA 3HN3A 4FLQA 3OO2A 3HQNA 2E8ZA 3GD3A 5I3JA 3A7UA 1G4PA 2OR2A 1XYLA 2QT3A 4DELA 1ZX9A 1DE6A 4ORMA 4ZMGA 2J13A 2QJNA 2OKOA 1O5QA 1V6VA 2WK2A 3LQGA 2C91A 4M56A 4FX9A 1ZNNA 4L6DA 1HKJA 4TO8A 2GUYA 3JVAA 4K8HA 1N8WA 3T08A 3WF0A 3ITOA 3WH8A 1A5AA 1Q6GA 1XX1A 4AYGA 3LLFA 4JTIA 3PAJA 4OOUA 9CGTA 4UXDA 5A2CA 3SIZA 3ZSTA 1W1B1 3VC5A 4BF7A 1S2WA 4NYUA 3CUJA 4XG1A 2R1KA 1GYMA 3ENLA 2PLCA 2VNCA 1JZ5A 2O92A 1E55A 4Q8PA 1V3HA 1WDDA 3L5MA 4IMDA 2WC4A 1K6AA 3GC5A 1C91A 4JTTA 3CWHA 3R1ZA 3MQTA 3GE7A 1YDVA 3S2LA 3VKJA 1M6JA 2YXGA 3SCUA 1E70M 3G3MA 1WXZA 3UXAA 2PDQA 2EQ7A 4B2DA 3QMSA 2OEKA 4AD0A 1JI2A 3WH7A 1GQKA 4TXEA 2QCGA 2GGHA 1I45A 5TBOA 1AMYA 4C1NB 2CXEA 1QASA 4IIDA 1BQGA 3CHCA 4GKTA 5TF0A 3EWBX 3A3HA 3P93A 3U57A 1O6IA 1SU5A 3GYCA 1ZJAA 4GX8A 4H4SA 2C79A 2F2KA 4Q8VA 5E0CA 5A5WA 3PP7A 4G1NA 3UZXA 1W3KA 1L2UA 1KCZA 1R7OA 5JCMA 1JF5A 2V38A 1XISA 2BB0A 1R9YA 2XFYA 1A4LA 4IUGA 4PEKA 4W8LA 4XIAA 4MWAE 3MYOA 5XIAA 1XYAA 1W1A1 2O9TA 1GV4A 1LBFA 4GISA 2IQTA 4QCFA 4CCCA 4UQ9A 1Y5WA 4PMRA 3OHMB 1SQ7A 1XCWA 1DQXA 4CUCA 1FCBA 5HJYA 4OV9A 5BYWA 4QS5A 2E67A 4GLEA 1QATA 4MJ4A 5HWJA 1SFJA 1JZ7A 3RITA 1H11A 3WK2A 2A4AA 4MWAB 2J7HA 4H4TA 5CZTA 3DJJA 3ZJ6A 4S2CA 2WP5A 4PTXA 5EA9A 3E96A 2POZA 1YLVA 5G5IA 2A79A 3A21A 3UCQA 1EKOA 4ERGA 3U6WA 2B7PA 2GJRA 1K9DA 3WLMA 4GIEA 1NSJA 3PZ9A 3SCRA 1HZYA 3W7IA 5HNUA 1UH3A 2W27A 5AHIA 1J0HA 1XLHA 3DG6A 3VU2A 4Z2IA 2TMDA 2VGIA 4CKQA 1TUXA 3HF3A 3TTSA 2YL6A 3QV9A 1JG9A 3GC4A 4JKMA 5C2GA 3BCFA 1TJPA 1XSKA 2ZE0A 3DESA 4IMFA 2ABBA 1MI3A 2X0YA 1SO4A 1C3FA 1HKMA 1N5XA 1WZKA 4HCLA 4MNJA 3UW6A 2RJGA 3B04A 3BWWA 3N6QA 3C86A 1UWIA 3E49A 2VOMA 4RDZA 3O2LA 3VM5A 3KLKA 2C1IA 2ANUA 1FHLA 3SECA 3EBVA 2DGAA 4H7VA 4LY4A 1QK0A 4PR4A 4AEOA 1TTJA 4E2BA 1H5VA 3LNPA 3MSDA 4I3GA 4ZO7A 1FXQA 2NXHA 3WF3A 1ITQA 2V6AA 3B8TA 1ME8A 4EXBA 4XZIA 2VVSA 2PP3A 4MUZA 5FS8A 4XAYA 4K3ZA 3USZA 2P5NA 5AYBA 4PA8A 2ZADA 3W7OA 1QHOA 3LMZA 4MIMA 3DC0A 1I60A 4JTEA 1F5ZA 2ZRZA 1VFMA 1YTEA 2BGQA 1RALA 2ATMA 1WDRA 4ZQCA 1WKYA 3W6LA 1K77A 4IIHA 5G2WA 4GO8A 4P7RA 1VJZA 2NWRA 3MP5A 4FA3A 5FSEC 3HQPA 2WMGA 3PSVA 1KD0A 1Z89A 2DV0A 4L80A 1OCNA 1O1ZA 3TJIA 1R3TA 3MU7A 4WEVX 1Z48A 4I7UA 4I6VA 2FTPA 3BSGA 1TX0A 2X50A 2J3NA 4HPGA 3KLJA 3ARQA 2WZMA 1XIHA 3EA1A 1J6PA 2CHRA 3DH9A 3NDYA 2NVCA 3R0KA 1D3CA 3WQGA 4ZR8A 2OEJA 4F0SA 4H04A 4M5PA 4C6NA 3SN0A 1Q6FA 1TV8A 4JIQA 2WMJA 1TVLA 1R30A 1ZP3A 3VZXA 1W54A 4YYFA 1W17A 2RH9A 3N11A 3MPGA 5XINA 2H9AA 1B3VA 2DZXA 1W2PA 3W7NA 4W4QA 4CLMA 1DIKA 4XD6A 4M6PA 3ORWA 4A2SA 8RUCA 2AGKA 1XPGA 1PHQA 1UQYA 4S38A 2A21A 3L5AA 5CPSA 4H4ZA 2PDKA 5HMFA 1XDIA 1R47A 2WNQA 2PD9A 3IIOA 5HMDA 4XZWA 3UERA 5BXRA 1KR0A 2FTWA 3GUGA 2DT3A 3GKFA 4F48A 1EJUC 4N4QA 4PGLA 4IIBA 3DKLA 4KWVA 3SRHA 3AIRA 4XX6A 4Q4RA 3WO8A 4H6QA 2FHBA 4JOMA 4JTGA 2ALRA 5CPQA 4EMIA 4JYFA 1SR9A 1U30A 4MB4A 4AD5A 3CQKA 3SFWA 2W62A 3ZT5A 1LQAA 4IQDA 3ARSA 1DJQA 3W7MA 1MXGA 3UXKA 1AD4A 1ODZA 1UPMB 1YPIA 3UWWA 3TOPA 2OZTA 5HQLA 3REQB 1MNZA 4Z1CA 2E7FA 4MFDA 3QXBA 3TV8A 5FJIA 4PTMA 4FX7A 1Q6RA 3DEQA 5JBFA 1WKFA 5LXEA 3PJUA 2C8NA 4LY8A 3S3GA 3M5XA 4WY0B 2VFFA 3JUGA 3UA4A 3LBCA 1ZMCA 3R7MA 3GTFA 3QMTA 5C9ZA 1PV8A 4RDVA 3KBWA 1YYAA 2RDTA 4ZQPA 2INFA 3RCYA 6REQB 1U1HA 3CUFA 3IUIA 1ZRQA 2J4GA 4S3BA 4AUBA 1RK5A 3AMLA 4BHYA 3W6YA 1TX2A 3A64A 4B5VA 2QV5A 3E0VA 4U2YA 3NQAA 1EEPA 1KCXA 3UXIA 1OWQA 1AMKA 1GTHA 4FK9A 4NIRA 2AL1A 3OOQA 1Q65A 4F0LA 1IIGA 2G3JA 5REQB 5IHRA 2HVNA 5G5GB 3UG3A 1LL4A 3S1VA 1C92A 1OFQA 2QJJA 2V67A 9XIMA 3NURA 1RH9A 1WXJA 1QAPA 2V3FA 1DQWA 2VP8A 3CV1A 4R9XA 4C1NA 4JIHA 4NY2A 2WV8A 3SCVA 3MMWA 1OGSA 3C2RA 4YTQA 1E6RA 4JX5A 3W37A 5LA1A 3M0KA 3WQPA 4CGTA 1DHKA 4LBUA 1AOGA 4W5ZA 5C5YA 1YHTA 1JROA 3BAKA 4XBKA 1VR6A 3LZ5A 3VZYA 3P62A 4HHMA 4KGLA 4X3ZA 1XLFA 3PZVA 3AYTA 4C7DA 2QAEA 1SO6A 1EA0A 4HA3A 5A8QA 5T91A 4QSHA 3DHPA 1I0BA 4CCEA 1HJSA 3VIJA 1EUAA 1P6BA 2PDFA 1HT6A 4O54A 4H19A 1I2NA 1V6UA 3DYMA 4HN4A 3GWQA 4CQDA 3GC2A 1KKOA 1BAGA 1HN1A 3RLVA 1PZ0A 3AQUA 3WDPP 2G96A 3L4WA 3O6CA 2RUSA 1FHUA 1G6CA 1E51A 1OFRA 4DB7A 1SUXA 3WLRA 1QJWA 4US5A 2A7PA 4ICNA 3N6HA 3WFAA 1TR9A 1NPXA 3Q4DA 4O19A 1FIQB 1UA3A 5JCLA 1VAHA 4LC8A 1WBHA 3ZFHA 1XH1A 1X38A 5DT7A 3VA8A 1AODA 4DJFD 1QK2A 3W7CA 4AW7A 4MWAA 1S46A 4GABA 5E9AA 3W2MA 1E0XA 1TJ1A 3MCMA 3N9SA 3R12A 3M6YA 3AS1A 4K6AA 4UOZA 3OW1A 1IT8A 4XUYA 1KFCA 4QCEA 3IK4A 4GKLA 3VFLA 4OWGA 1POKA 4E2VA 3EX4A 3BANA 3R5EA 3CT2A 3URNA 5CZKA 3NZGA 5D38A 3AXHA 3NRZB 2JK6A 1LWHA 1VP5A 3KL5A 1LL7A 2X1RA 3V4BA 1B2YA 3UWEA 2CZVA 1P0DA 2VR2A 3N04A 3TQVA 5DMLA 1UOZA 2WCGA 3QZEA 4HKPA 4ICMA 5CSRA 1VH7A 5EBAA 1EDQA 3GVGA 3W9ZA 1HQTA 4V28A 1WDQA 2D22A 3OEXA 4DNMA 2J8TA 1KBBA 5KZMA 4KRUA 3F2CA 5LIUX 4W88A 4R7OA 4Y9PA 1U22A 3WH9A 2VZTA 2BXZA 1QPRA 5DCBA 4K37A 3IIVA 4DI8A 4OBTA 2YBUA 3M44A 3CAQA 4MNLA 2OQLA 2VUNA 3QPYA 1JCYA 3NAVA 5BRQA 3U2OA 3DC8A 1DJWA 1U33A 3PHAA 1HGYA 3L9CA 3LNMA 4LV4A 4QG6A 2CKSA 2X1IA 2EG8A 3TYEA 2QQ6A 1S5VA 3CC1A 4RNHA 3W85A 1ZS2A 1HIZA 1X7FA 2WKJA 4PCNA 2GGGA 1JYXA 4WSHA 3WNKA 4HN8A 4IXHA 1GXFA 4HA0A 2R1MA 1KWKA 4KESA 2ZZ5A 3KCOA 2CLPA 3DK4A 3BJFA 4S3EA 3KAOA 1O94A 1VFLA 3XINA 3IAPA 1VPQA 3NSXA 1MZRA 3E2VA 8TIMA 1FWGC 3EEZA 4Q32A 5A6LA 4WKFA 1CXHA 5ECUA 3HPSA 3M0LA 5HA7A 5DANA 2GJPA 4LFYA 3LHTA 1NHPA 2BY0A 4DY1A 3DK9A 2JEPA 2GDQA 2VX5A 1GCYA 3L21A 2ZUTA 3OLEA 4PE8A 4ORIA 3W82A 1V0LA 1GQIA 2XVNA 5ECVA 5CJNA 1OF6A 1OG0A 1UD5A 1VC4A 3KOFA 2PD5A 2HE5A 3B97A 2XYLA 1ECQA 3DENA 3PZGA 4LUJA 4QITA 4IQJA 5BMXA 3QSRA 5KVHA 3NM1A 1E3XA 3CHDA 3D3AA 4AZHA 3APGA 4JNMA 1KA9F 2OXNA 3EDEA 4D6IA 2IPGA 3TZNA 4QE5A 1UC4A 4CD8A 3NM3A 1T5AA 3QJAA 4MPKA 2XFWA 4D72A 4PTNA 5I06A 1L8NA 4NSBA 5AECA 2CZ5A 2BVTA 5JVLA 3SY5A 4XD5A 4OU1A 3VKDA 4M0XA 4JHZA 2YL9A 1EEXA 3S9ZA 2GUUA 2ZWYA 3EDDA 2X8CA 3A3WA 2V5BA 4UCGA 1RLDA 3HV8A 3CZ8A 3NDZA 3B05A 4J4KA 3VCRA 3CH0A 2WWCA 4IT1A 1RHCA 3PBUA 2WVTA 2B4GA 2C3CA 7XIMA 4LH8A 1XICA 3W86A 3A5VA 4DWSB 1VCFA 4DXKA 1W9XA 1W1TA 1P0NA 3RK8A 5D03A 2VHLA 5HK4A 3REQA 1MDLA 2WC3A 4DBEA 4KCTA 3DYPA 4IIGA 2WSKA 3ZT7A 1SW3A 3FVMA 3K8LA 2H3DA 1NP2A 3E2RA 4WY0A 2PDBA 5A6KA 3OQEA 2CFFA 4Y7EA 4OBSA 4Q8MA 2VM8A 2TODA 1ONWA 3HTWA 1JZ3A 4E8CA 3DU0A 2JF7A 2GGJA 3LCIA 1VPXA 3MSGA 1ICPA 4WDXA 1HP4A 4K38A 2C13A 5U1OA 2I5QA 4JYDA 3NQMA 1OJTA 1FCUA 2R8WA 4ZTXA 4L9YA 1EQCA 2R94A 1U5VA 5HWMA 1PJ9A 3B0YA 3M0MA 3TQPA 2DZAA 4Q7IA 1UWSA 1T41A 2DY3A 5REQA 3GO2A 5EY5A 4MKVA 2Z1KA 3CZGA 2DIKA 3C5QA 4NJIA 5M17A 3KE0A 3GG0A 2Z1VA 4LEQA 2Z2BA 3OZPA 3H54A 1DWGM 1HJWA 5BOOA 3GAYA 1GORA 2XVPA 3NQ6A 1N2VA 3RX2A 1TWSA 3LD5A 1B4KA 4B5XA 1ZMDA 2QDDA 3OC4A 1JEZA 3I4EA 3SJNA 3QM3A 3FYOA 4UOQA 3WFZA 2ZE3A 1EWDA 2ACRA 1N5WC 3WLOA 4H8VA 2X05A 4GCAA 4BK9A 5A2AA 4C7GA 4E0CA 1X98A 3PBMA 1MZHA 2ACQA 4MADA 4S3FA 4Z42C 5BZAA 4MGGA 2G5WA 4XUGA 2B31A 5JMUA 3UESA 4GNKB 1XYMA 4UTKA 1UWUA 3S83A 3NL6A 3CQJA 3GU9A 3KLLA 3UPWA 1D3HA 3TWAA 4H4RA 3LTSA 2GPTA 4P2VA 5IDZA 5KINA 1W8SA 1LRQA 3MUAA 3CO8A 3WFLA 2HBXA 1EA9C 1GOIA 4JHMA 4LVFA 1NDYA 3ITVA 3VM7A 4CNOA 4XIMA 2ZA3A 4QJ4B 2PGFA 4J57A 2R82A 5C54A 1V3KA 2WZHA 5EMKA 4BV6A 3GNPA 3LCFA 2HS6A 2GDVA 3AMKA 1PIFA 1JUBA 3U2ZA 3CTTA 2OFJA 4J56A 2Z7KA 5M5DA 2BHYA 1YXCA 2C0AA 4JFTA 2J25A 3UJRA 4I9MA 4JDRA 3KRSA 3BZGA 3LBOA 1OD8A 2F84A 4ILSA 3IARA 3MI6A 2Y63A 1B0IA 3VKKA 2IKGA 3B8IA 1UA7A 4DHGA 2ODOA 3A24A 3QF0A 4NHVA 1QNQA 3SM0A 3TE9A 4CQAA 3F1QA 5CJMA 1HX0A 1YPFA 1DPMA 2XVKA 3S5NA 1H1NA 3HGOA 1E6XM 1NJJA 4AEFA 3OB8A 1JYWA 3PUDA 2WZEA 1CB2A 1VFHA 4P8XA 5HNTA 1V3IA 4WK9A 1RBLA 4FF7A 4DI9A 1KV5A 1JZ2A 3CEPA 3I3DA 4G5DA 3STCA 3ZVIA 4RV3A 4AZGA 2J77A 3POCA 2XM2A 1GPWA 1W1IE 4ZQNA 5HUPA 2OQYA 1OJXA 3LRLA 2H90A 3VIPA 1FP8A 4UTJA 3T1GA 1M5WA 2D2JA 4G7EB 2GJLA 2QDEA 4JDYA 1TPWA 1UKTA 1XQKA 3HG3A 2QUNA 2Y70A 4F0MA 4R7WA 2GSHA 2V3AA 3EDKA 4KIRA 7ODCA 4C6PA 3TIMA 1EO7A 4PBGA 1S38A 3SUSA 3TONA 4N9DA 2CU0A 2Q8XA 2Y4SA 4JGDA 2EKGA 4GR1A 2PDIA 5AYYA 1SVDA 1WPCA 4GBDA 3P81A 2XZ9A 3S6OA 4JFVA 3GSMA 1FCVA 3B03A 4UTHA 4L1XA 3DXIA 2GSEA 3R10A 2GQ3A 2G95A 2WJFA 4HK5A 4MZ8A 3MO4A 2CLIA 3NUKA 2WHJA 3T09A 4JBRA 4JN7A 5B80A 4IPIA 4O17A 4WJEA 1MYRA 3CPUA 3WLHA 2JEQA 5DMYA 1TV2A 1KXVA 1AA1B 1KM5A 2WHLA 3WDIA 4Y8FA 4WSKA 1U5HA 3GQYA 4DVOA 1RUSA 3C2EA 4RV8A 1WA3A 4PULA 2R14A 1AQ0A 1HO1A 2PRMA 2J9ZA 5LNUA 1DJGA 3UBPC 3GVQA 2Q09A 1ZGDA 3I4KA 4YLWA 4D6JA 2XIIA 1FFVC 3NQBA 1XYFA 4NEVA 3GR8A 2PDHA 1IHIA 1F76A 1E4LA 2GUBA 3WQWA 3ZR6A 2R6OA 2IQ0A 3M7WA 3MWAA 5E0FA 1K4HA 1VBRA 2G3NA 3IGXA 5DRCA 2XIBA 3G22A 5M03A 2BCPA 2P3EA 1I2RA 4LB3A 2OGJA 4I5RA 2UBPC 1W6TA 4LS0A 3UU0A 1XS2A 3N4AA 5C9UA 1I2QA 2C71A 3FJ6A 5GJPA 1CW2A 4LRTA 1P4CA 2GK1B 4K8GA 4ZVJA 3VIKA 2QKFA 4AY7A 1WAUA 4G6CA 1VENA 3I3BA 3KBMA 1XLKA 1TREA 3WCZA 1DQUA 3ICJA 3B4YA 4GC3A 1NAL1 2AAQA 4XSLA 1GRFA 1TUFA 4RUBA 3WQVA 1KC7A 3RG6A 3QW3A 4LVGA 4Z1YA 3CGEA 3F2BA 2NT1A 2I9EA 3TSBA 2WKGA 2WQPA 2YDSA 4DWSA 2AOSA 3PUEA 3Q65A 1JZ4A 4RZ4A 4X9YA 2OX1A 3SRDA 3N29A 3K1GA 4UB9A 3D5HA 2XIOA 5AFDA 3B0UX 4XD4A 3UNTA 3UYIA 1JFXA 1XYCA 1G4EA 3V18A 1FWRA 1G67A 1FDYA 1RD5A 1DKWA 3ZJ7A 3VC6A 1VIWA 2D0HA 1RM6B 3BC9A 3QGKC 2HQMA 4D6FA 1JZ8A 1IGSA 1KFKA 3W70A 1R46A 5CPOA 5DBUA 1XQLA 3O0HA 4JTDA 3MP4A 5AZ0A 2JK2A 1X1ZA 4W7WA 4ZXOA 1IT7A 4IM4A 3NWRA 3NPVA 1E56A 4CCZA 1DP0A 4PMOA 3HQOA 3I65A 4FIRA 1GQLA 1JYNA 1EJSC 2ZVIA 4GX9A 4Q7NA 2OYLA 2OWCA 3UZYA 1PDZA 2PBGA 3H2FA 1TV4A 1Q7MA 4UCFA 3LERA 4YN5A 3EKGA 3QGVA 4LXFA 3BMWA 4GJIA 3OHIA 4CD6A 1LBLA 3FA3A 2YA2A 1Q7ZA 4B2DD 4MMWA 2PAJA 1YE6A 3Q2DA 4JTQA 4L4LA 2J7FA 2PTYA 3CEUA 2NX3A 4GFSA 3T2QA 3VINA 4AC7C 1IXPA 3DI0A 3CHFA 2NVKX 3K30A 3Q45A 1I1WA 1RCXB 1DWHM 5FAGA 4MNMA 2XGZA 4FB7A 2VD9A 2TPRA 2WVVB 1UR8A 4DPPA 3RPTA 1OCBA 2EQDA 2JIWA 3HU7A 4FSAA 3BLEA 4LALA 1C8XA 1F73A 1W3NA 4OUIA 1DJHA 4BWLA 5J04A 2BOFX 4B5TA 3RR1A 1CX9A 3CK5A 2J74A 4K68A 4YHEA 4S2BA 3TC6A 2V82A 4HYWA 3RM9A 4GMEA 2W6RA 1GONA 3TW9A 3RHGA 1NQKA 3H6OA 1JPMA 4M1BA 2DT0A 4V2XA 5I78A 4L1WA 1TVNA 3UWZA 1WKDA 2QUUA 3RJYA 1DVJA 2V69A 3AJ7A 4FXSA 4FNPA 1GK8A 3WJSA 2GR1A 1WZLA 5BU6A 1QMLA 1ISYA 3WF2A 2X16A 3N25A 1MUWA 4FLSA 2YVGA 1WZMA 2DUAA 4I7VA 3P7YA 4Q4SA 1XBZA 1XV8A 1OX4B 3LSBA 3WUBA 2HNHA 3K4WA 4NXSA 2C18A 4GH3A 3FJNA 4Z2GA 4UUIA 5AB3A 4Y96A 1EC7A 4FHAA 4N02A 1OBAA 4MYXA 3LGGA 3N4EA 1EC8A 2V81A 3GHRA 2PA6A 4FLOA 1PKMA 1WNOA 4KERA 4ROPA 3KWXA 4JIIX 2VR4A 4JHOA 2PLMA 2PZ0A 3KM8A 1OC7A 3SUUA 1AH0A 3IJQA 1H60A 1M04A 2BTMA 1F6PA 1E0TA 4NZJA 3H4XA 3GZAA 1L2QA 3WUGA 3K1DA 1GPFA 2JKPA 2EJ1A 3IJ9A 2ABAA 2QJGA 4BKNA 1JRCA 3RLUA 3SCPA 1H7NA 3VYLA 4MJMA 4G7EA 1UG6A 1J93A 3TAOA 2FFCA 1UROA 1PIIA 1PKLA 4ZL1A 3R11A 4GUGA 3L0KA 3NVWB 3VX1A 1E1CB 1QUMA 2ZUVA 4H6EA 1DIDA 4S3KA 5CPMA 1ZB5A 3VOIA 1OK6A 1FH9A 1MSSA 4KWWA 2YIHA 3BOXA 1QHPA 3UZZA 3EDJA 4MJ2A 4POCA 3Q6JA 4HTYA 3ITLA 2IXUA 2RAGA 2VZUA 1X97A 3TSMA 1T8QA 1GEUA 1ZCCA 3KTCA 1GVYA 3K4AA 2ZRVA 4DJEC 3CXBA 3UD6A 3QHOA 3TR9A 4LV9A 3T78A 1WXYA 2JIEA 3ABXA 3D46A 4BFAA 1ZJBA 4ZXLA 3SUVA 2DZVA 1R87A 3T8LA 3GNRA 4M52A 2ZBTA 3BLIA 4GH1A 1NARA 3UQNA 2WJZA 2I7GA 3TKFA 1EOKA 3CUZA 5I23A 3WK1A 3SRKA 5ABTA 2JALA 4HGXA 3BLPX 4QFUA 4JNZA 5SWUA 1BSLA 1V0NA 1QPQA 5C70A 4YCOA 3PNZA 3QR0A 4AF0B 2YFNA 2PI6A 3G18A 1ADSA 2PEVA 1P7TB 2JE8A 1Q1RA 3GS6A 3E1F1 4AEEA 2PWVA 2WMHA 2Z1BA 4Z2LA 4NNCA 1IEIA 4DUXA 2W66A 4X2RA 4MLRA 4Q4OA 4UTWA 1Q1WA 2ZZ7A 3BAWA 3NVTA 1I75A 4MHBA 4PMXA 4YS1A 2Y5EA 5HQMA 4S39A 1CDGA 1CLXA 4QROA 2QIIA 7REQB 1NF0A 2NWSA 5CLTA 4KW2A 2GK1A 2BASA 2FDMA 2WJDA 1O60A 3AHYA 1V0KA 3S6TA 1WDSA 3P8IA 1ZXIC 3ONCA 2DZPA 1AH3A 4ZCWA 5KZEA 3OGRA 3LPGA 4DBUA 1SO5A 1TPUA 1JXJA 2NZLA 5FJTA 1E1EA 1KKRA 4YTTA 1RVKA 4XK2A 4H1ZA 2JBMA 1EHNA 1W31A 3EOOA 1H61A 3OTRA 4OGZA 3AXIA 1NF7A 3E0WA 3OVRA 3MMTA 4MG4A 3SUWA 2QCMA 3G6MA 1WAWA 1KFJA 2YYTA 2VZVA 3LS9A 1XD0A 2TRSA 1V08A 3NPXA 4GPNA 2P8CA 1QOPA 3TN4A 4W9TA 2W3ZA 4J7RA 4R34A 4BEQA 3A4JA 3URBA 4OIFA 5CZJA 3EX1A 1NH6A 3RMJA 3STEA 1XLJA 4GOAA 2RKXA 5AHFA 4C6EA 2DZUA 2CLFA 1THFD 5CH9A 2B7NA 5F7UA 4GIYA 4PMDA 1AG1O 2QVNA 2B7OA 2Y61A 4C6JA 1YPXA 4M1RA 3VMOA 4D1JA 2CHOA 1CGXA 1KR1A 3BO9A 1VRDA 3AROA 2VC5A 2QCEA 1Q4NX 1DORA 1TWZA 4CNPA 4LAKA 3TN6A 5FEZA 1DTNA 3ELFA 4LVDA 1TWWA 1YTDA 4B9YA 1OFBA 1KM1A 2YZRA 3EA2A 5G4WA 3BG5A 2ISWA 4GY0A 4K7ZA 2ZDSA 3ZJKA 3WDQA 4IGNA 2X40A 3GNOA 1JQXA 1H49A 3PANA 3GW0A 1IV8A 5MKGA 3TMLA 3ITXA 1DE5A 1KTBA 2Y7EA 4AQLA 2XSXA 3EWZA 1ITCA 1JF6A 3N2OA 4HYVA 1AL7A 4D71A 4IG2B 3ARTA 2VDIA 4FP1A 5HNNA 3IUHA 4MDPA 1F8WA 3AN1A 3AZRA 2AGTA 4RW3A 4TUFA 1Q85A 4P5UA 4HZ6A 1F07A 1E6NA 5EL1A 2YXOA 4UTTA 2WVVA 4IP4A 1Q66A 5AHNA 1FBAA 2XN0A 2FB2A 1XLCA 1A3HA 4I9JA 1RAKA 2BVDA 5K7JA 3O15A 2WKLA 4IISA 3KXQA 3W2NA 5I3IA 1NHRA 3I3EA 3VNMA 1GJWA 4ZB0A 3OZMA 2BC1A 4G1KA 1U5JA 1AJZA 1W1VA 4H01A 4ZOHB 2HSAA 4O1EA 1VCVA 1S2TA 3R94A 3G0XA 4QG9A 3DUGA 5AHEA 2Y85A 5BWFA 2DSZA 3VPLA 4C1KA 3ETRB 3T44A 2YYUA 4L4MA 1K9FA 2VYOA 3H53A 4WDWA 1Q45A 1A3XA 3DIPA 2G4FA 3T9PA 4CN6A 1GOXA 4C6MA 4GXWA 3VABA 1UD8A 2PTZA 4US5D 3EPMA 3BMXA 5LNVA 4H8NA 1KGXA 3S46A 2GJXB 4EE9A 3VNZA 4NF7A 4JR5A 4C91A 2PE4A 4K7VA 1JCJA 1C9DA 5JU6A 3NVZB 3RNMA 1H3GA 1XD1A 3VGGA 2VEFA 3W1UA 4ZOEA 4MWAD 1OX4A 3M41A 1VDVA 1MMFA 4N6FA 2VCBA 3IRDA 3GDBA 1TA3B 3BCJA 1JDEA 2VKZG 2F6KA 4AZCB 4QLKA 3PB2A 2PTXA 2R9ZA 5HDRA 1GVEA 3A3XA 3W2KA 1TFVA 2D23A 1XBYA 1V02A 3M7SA 5CZSA 1A5UA 4JTAA 2UY5A 3XISA 4LUIA 1XGDA 2BBFA 1JGIA 2D73A 4NILA 3CZJA 3RXZA 2E3ZA 1IEXA 2ZC1A 3GDRA 4U5IA 4LYPA 3UR7A 3WF1A 5EMMA 3NSNA 1MEHA 1ZUAX 1EO5A 1AUSL 2XINA 4GC4A 5BXPA 1UMLA 4IICA 1Y8BA 3SN4A 1DJXA 3WLKX 4QDPA 4L64A 3WQ8A 2P88A 4EKJA 2ZA1A 4XZBA 1PHWA 3VGFA 4I90A 1NDZA 4Q4KA 3U2CA 4OJYA 3FYYA 3EWCA 3CB8A 2Y6ZA 2PWFA 2CLHA 4UOJA 2J9YA 3CHVA 4ENLA 2V30A 3VE7A 1LOSA 1M03A 2F9RA 2V63A 3TLQA 3CAVA 2VR5A 2CITA 5TR3A 5G4EA 4DLMA 3A9IA 2CC0A 2QMJA 3CTLA 2CXGA 3BZJA 2QV4A 3R43A 1TVPA 4GJ1A 3T0CA 4GVFA 3ZWSA 3R0UA 3RDKA 2PDYA 4CVWA 4DEFA 4U28A 3UJ2A 3UT0A 3QY8A 2C1HA 2CZFA 5CLWA 5HOSA 1A5SA 5BOEA 3QH2A 2R1NA 1K6WA 1GG1A 3N6JA 2CERA 4RPPA 3P2VA 4GZEA 2XFFA 1VYRA 3NQDA 1SO3A 1WP6A 1JPHA 2VD8A 2VCAA 1NY1A 1P1XA 4M6UA 5C9XA 1L8PA 3NEHA 4YVXA 4DF1A 4JCLA 4QSFA 2ADAA 3AI0A 1GG0A 3KVMA 4FNUA 3C0QA 4NXKA 2NVDA 1GRBA 1F8IA 2C0HA 3HO8A 3HPXA 4Q22A 3QRHA 3WMBA 3M46A 7CGTA 5HUOA 3G1SA 4ZQOA 7A3HA 3O06A 4R27A 3FN9A 1TPVA 4JYEA 2GRTA 4UR9A 4EPDC 1J96A 4J3SA 2UZ9A 4C6IA 4AF0A 3URHA 2Y89A 2NQLA 4F9JA 1P7TA 2VDGA 1VS1A 5I00A 3CZKA 5IFPA 4HNNA 2CFYA 3MUXA 3N3MA 4MB1A 1HKWA 4XZLX 2G3MA 4S3DA 1CT5A 2ZZ3A 3VILA 3I6RA 2OGYA 2V3DA 1IWBA 1Z8AA 2EEXA 3TYAA 1FECA 2WW5A 7REQA 3NL5A 3VDCA 1Q8JA 3MKVA 4H8UA 5CG7A 4AWUA 1ONXA 3BMVA 1TMLA 4AMAA 2Q02A 4UNKA 4D6GA 1XCXA 5HMSA 1FRBA 4BQ3A 1JXKA 4HPNA 3LYEA 4H41A 1DBTA 5AYXA 2NQ5A 4ZEPA 5HQEA 1BXBA 3FDGA 1UR1A 4LOCA 3OG3A 2F5ZA 3BLLA 4H50A 1GOKA 3KUMA 4KT2A 3H7UA 5IOBA 4GZJA 4JN8A 1GJPA 2DVXA 5E93A 3GU1A 1ZAIA 2W0UA 2GH5A 4HVXA 1ZL1A 1BF2A 3OZYA 1XGZA 4TTGA 4QAWA 1ZKQA 3NVDA 3S2MA 4GUIA 3P61A 3TUUA 5DQPA 2CLMA 1EGMA 4LUSB 2L5HA 3NGFA 2YBVA 3K2GA 4O15A 4O8AA 1JCLA 3NZRA 2QCFA 2EBNA 1TCDA 1VFUA 3W7HA 1N8IA 3L66A 4JTUA 1VD6A 1HVXA 3VNDA 2YVFA 5DLCA 2YBTA 4AVFA 3VOJA 4PUDA 3WQ5A 1UASA 3PBVA 2DEPA 3SZ8A 4E38A 2Z29A 3ABSA 2OSXA 1H7RA 1B9BA 2A7RA 4DJDC 4Y8EA 3IPWA 4I9AA 3WQFA 3PULA 1FH8A 4B5SA 2P50A 3G6LA 3PPCA 2PGRA 4YTRA 4IFKB 2CNCA 2VI0A 2EKCA 3CMGA 4XQ6A 2BV9A 2EG6A 3QFWA 4HJWA 3UY7A 1W9BM 3TW7A 3SCSA 5I3FA 1SJCA 1XG3A 1A53A 4C7FA 3A9BA 3NQ7A 1B30A 3GG8A 1JL8A 1JPIA 3N1AA 1I2PA 2ZRUA 3PS7A 1PVNA 1B4EA 1NEYA 2X09A 5D9MA 1PBGA 3EA3A 1XKYA 1WV2A 4HU3A 1MFUA 5FF3A 1A5KC 4IG2A 3AS3A 2NSXA 1ZBKA 5LIYX 2CBVA 2PLKA 4UNLA 3I7SA 3SDOA 3GLCA 2PU0A 4FR1A 3PPFA 3T6CA 1VZWA 3NEVA 9RUBA 2CWXA 5J8LA 1T99A 4L65A 3CGCA 1OG6A 3UWQA 2X7WA 3DFNA 3EB3A 3AIEA 3VX0A 3GM8A 4KFNA 4HNOA 1W1PA 4GUHA 3ARYA 4LIIA 1ONFA 3D3FA 3TMQA 3NQCA 5F1UA 3M5ZA 1MQQA 4ADSA 3OZOA 4WKAA 2HROA 1W0MA 4H83A 3QHMA 5G1YA 3VD3A 3ARPA 4BI5A 1ISVA 2XN2A 3QR3A 3G8EA 3GTHA 3KEHA 3OQ8A 4JTJA 3GG1A 2WSPA 4HCHA 4AYSA 3CAKA 5E5CA 3B8SA 4JEJA 4V33A 5BXSA 1QNPA 2NQ9A 3TTEA 5A6JA 4MVAA 1YNPA 5C0QA 2DW7A 3BXWA 2BGSA 1G4SA 2BSLA 4GINA 2IQDA 1B1YA 4UMCA 1XF0A 4IL0A 4PMYA 4A2RA 3WYZA 2GJXA 3WQ4A 2QULA 4DWDA 3GTNA 4AMCA 4QNWA 1S7MA 3FKKA 2NT0A 3H70A 4PUWA 4UZSA 2BC0A 3LI1A 1AVAA 4Y90A 2YJQA 3K8MA 5AC4A 5KEZA 2EXOA 2IPWA 3WLPA 4FNTA 1EIBA 2VEMA 1M68A 3G1AA 4AZCA 4O1DA 1L9WA 2CBIA 3T0BA 4HA1A 3LK6A 2E6YA 2WAGA 4GUFA 5H8MA 4CU6A 3E12A 5HPOA 2VGFA 1M3UA 4ZE5A 3CLWA 2YFOA 4IFOA 1H09A 3S1XA 3O1NA 3EAUA 2WSRA 3PBWA 4Q4QA 1WCGA 1CXLA 4HNTA 1E0UA 3GH5A 4E3VA 5K9CA 4JDBA 2QUMA 4FF5A 3PZTA 4W86A 1ZALA 3BLKA 4HHPA 3SB0A 3IJ7A 1GTEA 3NZQA 2XZ7A 8CGTA 3T7VA 3WH5A 4DO7A 3EOSA 4WGHA 2YDRA 1BYDA 1G7UA 4A3YA 4IHCA 1JAKA 2ZZ6A 1XSIA 1CGVA 4Q8OA 4P7QA 1ZP4A 3SR6B 3GVVA 1VEPA 4XZMX 4H9UA 3M4HA 3UCDA 4V1XA 3GZ3A 1EC9A 1E6PA 4PMZA 3RMEA 3VIGA 1H1YA 3ARXA 4D6DA 2YB1A 3C0LA 1PYFA 1JFHA 5A8OA 1OM0A 1QBAA 4WF7A 2D3NA 1EJTC 1AQFA 2RGLA 1O95A 1R86A 1BSIA 4XBJA 3HMJG 3IGUA 5E1QA 3AXMA 4QR6A 5C9RA 3NXFA 1QO2A 3W7LA 2GVYA 1DXFA 1IGWA 3AHVA 1MFVA 2VC9A 1QW7A 4QRNA 1J18A 2F6XA 2RHGA 2HDJA 1KM6A 1TZ7A 4UNIA 5FS7A 3SGUA 1ZTVA 3U7BA 3ARVA 2GZXA 2WB5A 2XH7A 3CIVA 1A5OC 3T0AA 5ABGA 4ZTYA 3DGRA 3W27A 4FLRA 1X1OA 1ZJHA 3AMCA 3DYOA 2ISVA 1E4MM 2BX7A 2DZTA 3A4AA 5TNVA 1OEPA 2X2GA 2I14A 3CIWA 4A8NA 4KWUA 3DBNA 2AKMA 3VD7A 4TX6A 2EPOA 4PUEA 3IACA 1GWJA 3A6OA 1JNDA 5DBTA 1SZEA 2FVKA 1JCNA 1LJYA 4B9ZA 4E5TA 1KRMA 5FA5A 1NDVA 4LF1A 4CNTA 4IP5A 2D3LA 1S39A 4QX4A 3LDVA 1W5PA 3ZMRA 4ADWA 3LPOA 1XLEA 3LU2A 1PCWA 1L6YA 2BXVA 3BGJA 4WKHA 1QNRA 4QAIA 3RAOA 3M43A 3S5OA 1DWAM 1R38A 2QCCA 3A23A 4LBSA 2DZBA 4QM1A 4CD7A 3DCPA 2FZ8A 5EFFA 1SGJA 1G01A 1MVYA 4DZHA 2YCLB 3GX9A 2WNZA 1C7SA 1YNYA 4IP7A 1PEZA 1RZMA 4UBPC 4UFMA 1EQPA 4LC6A 1TTIA 2W0HA 1T40A 1CECA 4ERAA 1KTCA 5F2GA 1XYBA 4TVUA 2VWSA 2D69A 2Z27A 3PTQA 1VB9A 4DZ5A 3TCSA 1FEBA 1P6CA 1NIUA 4L6HA 2BXYA 3EPNA 5BU9A 5FJUA 4ZOCA 3RM4A 3P8JA 4DWSD 3PB0A 2CZDA 4N7QA 1GZJA 3E0IA 2YOCA 3EF6A 3O3RA 3L5OA 3H2OA 1O12A 3SFKA 5A69A 2VMFA 4WJXA 5FF4A 4PTVA 3S9IA 4KIEA 2BVWA 4J35A 4WRHA 3LB8A 3BOFA 1OGBA 4JEQA 5EBKA 4E2OA 5A6BA 1BYCA 1CB7B 1TELA 4LUSA 3SR7A 2G8ZA 1JEHA 3TTQA 1QNOA 1X6UA 4WXYA 4A4AA 3DBPA 3JU2A 1RCQA 1K7XA 3T4CA 1GYLA 2UWFA 1JD9A 4O14A 3N9RA 5KETA 3AZSA 4M80A 3ABQA 2J47A 1BVWA 3DFOA 5GRTA 4R7JA 4GYJA 5I2UA 4Q8NA 3VVGA 1UP0A 4RXGA 2BG5A 1T7LA 1FDJA 4URIA 1C93A 4QTGA 5LKYA 3ABOA 1EXBA 2A3AA 2ZQ0A 3R2GA 4A21A 2Z24A 4GZ7A 1WB0A 1K8XA 4G56A 4IFKA 2PWUA 4JD4A 4PTDA 4R9OA 1ZSXA 1VBUA 3GBDA 1MUCA 1K8ZA 5FF7A 4OV4A 5HJXA 4KCUA 3B9JB 4UTIA 4AXKA 2CBUA 2AMGA 4FI4A 3QZ6A 4L5ZA 5CSUA 3P80A 3IV8A 1PS9A 4UZUA 1F6KA 5GQBA 3A13A 5HANA 1VBJA 3QYQA 3CWOX 1B54A 4KEUA 4BY3A 4UFIA 2J7EA 4O13A 1V03A 3HPFA 4EF8A 1XGEA 3N2TA 4TV6A 5DCEA 4GA8A 3GDMA 1BG9A 4MZ1A 3RX3A 1VHNA 3TNOA 3W7KA 3R58A 3M07A 4N9CA 3U4FA 2GR3A 4QE4A 3DDMA 3WDRA 4GQRA 4HCDA 4WOQA 3MUZ1 1WOAA 4N4PA 1ELSA 1C8QA 1VIZA 4ML4A 1VFOA 4K2SA 3CZLA 1T6MA 4TVWA 2CLKA 2HVOA 3WDJA 4IMEA 1GQNA 4GNJA 4IH3A 3PF3A 4H3DA 2PZNA 2EPNA 2YLAA 3HGRA 2QF8A 1BD0A 3PWIA 3CT7A 2CBJA 3TWBA 4QEEA 1UZDA 1R3WA 4PRWA 3QSTA 4WSJA 4XKMA 2WQDA 1GRAA 3KP1A 1NVMA 1YNQA 1XW8A 1W1YA 4G2DA 2E5CA 5BW6A 5M2FX 2VC6A 3BICA 2WM1A 4JFUA 3H8AA 3N14A 3H7VA 2QJHA 4HSNA 2TAAA 5D33A 1DWIM 5CAHA 1XRFA 2V9DA 3U4AA 4ZB5A 3XIMA 3BE7A 1RP8A 2A3HA 1I4NA 4DM2A 2ZZ4A 2YZ5A 3W23A 2VFDA 2Z1SA 4M3PA 4TQTA 3ALGA 1TE1A 4LAOA 4B4HA 1OF8A 4HTBA 1FWHC 3PJTA 3VD4A 1HJXA 3W22A 2W91A 4P7LA 2OSWA 1NFPA 3W38A 1RJRA 3WJWA 4AWEA 2H8XA 4NG3A 4PCTA 3CL7A 1BYBA 2D24A 1S1PA 3F03K 1ISXA 3BG9A 3WJZA 4CQ8A 1YEYA 1H50A 2XIJA 1FWIC 2J7BA 2O7QA 1VRXA 3U0HA 4W87A 4MY1A 1DNCA 3SQPA 3HQ1A 3VOHA 4GFIA 1EZ2A 5AYZA 2CESA 3GDKA 3QPZA 4B91A 3EOEA 1OYAA 2XIQA 1EH9A 4DN1A 2PDXA 2QMKA 3VCNA 3R07C 3I68A 1P6WA 1TTPA 4HU4A 3NL2A 3GU2A 3W81A 1SZGA 4KF1A 4ZFMA 4PUNA 3TR2A 4OKDA 1CYGA 2D20A 3W7PA 3QV6A 4LSBA 3WX7A 2YKKA 4E4FA 5D4YA 1M41A 4K39A 3QQ1A 3UWYA 3UVAA 3TA9A 3PPGA 3A12A 2WHKA 1VFTA 4KFOA 3CH9A 1J9YA 2I5GA 1JYVA 3GHUA 1PSCA 3FX4A 2MANA 1EPVA 3PFMA 3WJXA 3STGA 5CGMA 4JL2A 1H7WA 2V0TA 9XIAA 5CXPA 2A1YA 3DGBA 1CENA 4OBRA 3NTYA 4KWOA 2PODA 2VTFA 2WVUA 5HBFA 3JZUA 4QQ3A 3BAJA 3FGCB 3I6EA 2D2GA 4K1WA 4ZOAA 2PWEA 3U8GA 1SZRA 1VFSA 5LSMA 3E5BA 3W88A 3KHJA 5FIPA 3UA3A 3B06A 1TMQA 4BS0A 1J8VA 2YVJA 3GIQA 1S2AA 4W5UA 5FJOA 3W7RA 3CQIA 3WEZA 3WLJA 2VFEA 4ZBCA 1L0PA 2J7GA 4OT7A 4NX5A 1MEWA 1EPXA 1RA0A 1RQEA 3OBEA 2X8HA 5DCDA 4IWWA 2QNEA 3KRZA 4UFHA 3C2OA 3C3NA 1LTDA 4HJFA 5MHBA 2FIQA 1TPEA 4X2PA 3V0TA 2W3SA 1DIOA 4HMEA 1K3UA 4AU0A 4CQBA 4L4OA 4QE1A 1VKFA 3VIMA 3ZM8A 2YQUA 1OCJA 3SAZA 4KGJA 1T8XA 1N82A 4NUWA 1S2UA 3GKAA 3JRKA 3MJMA 3H21A 4GHRA 3M16A 1QWGA 1UMYA 1EBDA 4WD0A 3OODA 5KZDA 4IL2A 3BPWA 5FKYA 2J8FA 2ZXBA 1TB3A 4HQVA 4M6VA 4R85A 3BGGA 4UC5A 2YCLA 2E68A 4EX4A 2BNJA 3LGDA 1XUUA 3A47A 3NJ3A 1NDWA 2PDWA 4JQ2A 3LTYA 1RSCA 1C29A 1UD2A 2R1PA 3SURA 4GQ0A 2BFGA 4O28A 4WJ8A 1FEAA 2HQAA 1K9EA 1LLWA 2E6AA 1BWLA 3I6TA 1W9UA 4XO6A 4MSSA 4XWUA 1CGYA 2EHHA 3EMQA 2J7DA 2X30A 3B9AA 2OWXA 1XHGA 3AIBA 4F9DA 3OGVA 1GVRA 4PRRA 2NQJA 2ZA2A 4FAMA 3PZUA 5CSYA 3CWNA 3FJ4A 2SFPA 2GQWA 1NDAA 2ZKMX 1KFWA 2VO5A 3C2VA 3U7VA 3UR5A 3NSMA 2Y1HA 1BVNP 5FOOA 1VQZA 3I7QA 1W1ZA 5DFAA 1CI1A 3A7RA 4E6MA 4J40A 3CZEA 4O57A 3V3WA 3APYA 2DUXA 1UR3M 3UFYA 1V7AA 3PWGA 3KDOA 1H2JA 1PTDA 5CBJA 1XP3A 4TOQA 5D2TA 4AY8A 1C8YA 1UUOA 4JTHA 2FVLA 4NAFB 4PBFA 4JKLA 2J8GA 2Y5SA 4CQ9A 1EDTA 4E2DA 3FEMA 2ISSA 4FS9A 3PG6A 1ZY8A 5E9XA 1PYMA 4LVBA 3VNLA 1UHVA 5A8GA 4JICA 3NR0A 3N19B 2W54A 1ZJIA 5I7GA 2WPCA 2V5KA 1QPKA 1GW1A 3H4KA 3GHSA 3GNDA 2YAUA 3IJDA 3T0DA 3E9AA 4A22A 1X39A 4AX6A 1V6WA 4RNFA 1ALDA 3C8FA 2WM0A 4GY1A 3PAOA 1QOXA 4WR3A 4A3HA 2NSOA 2WO5A 4A3QA 3WG6A 3TYBA 5U25A 5GJMA 4AWSA 2W4XA 2I17A 1M01A 2BDQA 2FDSA 3LSCA 4JTLA 3AU6A 2GR0A 3S8HA 1IZJA 2IPFA 1EP2A 2P1FA 1Y5VA 1GRHA 4PSPA 3C8NA 3IIXA 4FOJA 1IEVA 4J2MA 1RY0A 3SSJA 1SW7A 1E0WA 3EWDA 1AZ2A 2WP6A 3KVJA 4UFLA 1H41A 4CCDA 5IDIA 5CKSA 3CIXA 4AZ7A 4X22A 3FSUA 3MKCA 1P1MA 3IK2A 4NYYA 3MY9A 3E74A 3AIQA 3LM7A 3B9DA 5BRPA 1KGWA 4EAYA 5IBXC 4Z0SA 1EUNA 3DI1A 5G2IA 5DEZA 4R5EA 5H8UA 4TX8A 3WQCA 2YSWA 5G1MA 4B5WA 3BARA 4PSRA 4IZGA 1LLZA 5LGZA 3LN3A 1EHAA 3GNXA 1GREA 1RA5A 3DFQA 4EXAA 1KCLA 3WY1A 1Q63A 4D8AA 4J3UA 1G94A 4H6KA 2DIJA 3FXGA 3UETA 2QJMA 1XH2A 3N4FA 1RD6A 1RQBA 1Q8AA 1VCGA 1EL3A 3CUHA 4F79A 6TIMA 2VRQA 3CM4A 4XISA 1L6SA 1TG7A 1PIGA 5AZ1A 3QLDA 1AQMA 4QLLA 3WK0A 3BAXA 2PDMA 1G7VA 2XH2A 3DHDA 3O16A 1X6NA 8XIMA 4L1GA 2CKRA 2BZNA 2GQ8A 2A2IA 1Y0EA 1DXEA 1PUDA 1X7IA 1WE5A 4LU0A 1Y65A 3GUWA 3LV6A 4C6DA 1GOQA 1SSDA 3DECA 1RJQA 1RP9A 4WIWA 4EM4A 1R7AA 1JULA 3S5ZA 1BLIA 1VLIA 4LYQA 3FJLA 1AD1A 5BCAA 4H6RA 4AIUA 3T2OA 6A3HA 1P48A 5D04C 1FWBC 1O5XA 4HZ7A 4ZO6A 3UPBA 3S5YA 4NL1A 1BZLA 4LJ3A 3SY8A 3H2MA 3WQOA 3H24A 1GEHA 3IANA 3L68A 3TOYA 1XL9A 2XISA 3QV7A 3MVIA 3ZQ9A 2WHMA 1J2WA 2PP1A 3KX6A 4J3ZA 2C3ZA 4AXNA 3FGCA 1WOBA 3OIHA 2C14A 4IMCA 3EB4A 2Z6IA 1OHLA 3TQ0A 3UVIA 1Q13A 4BI6A 1V93A 4ADUA 4G7FA 4J2PA 5DN1A 3R79A 3W1NA 1CPUA 5FL1A 2QCDB 1LWJA 1WUFA 4FPSA 1EJXC 3AMZA 4QBXA 2I56A 4FDCB 5DO8A 1TYPA 2ISDA 1UKPA 3OYZA 1ECEA 3V5FA 1Y5XA 2YL5A 1IF2A 2PDCA 4WGXA 4TU1A 1D7KA 5FD0A 1SZNA 4BF9A 1OC5A 1KXTA 5T9CE 1V79A 3CS2A 5CQ1A 3QTGA 3C52A 4GG9A 3SI9A 1UZ4A 2OKTA 3EWWA 2IKJA 3RRXA 4M24A 4YXGA 4A8IA 5JXQA 1YMYA 3P84A 3VIIA 3W6MA 4PL2A 1OK4A 4GCXA 1Q6LA 2WLZA 1LLOA 3S0CA 1O68A 2QGHA 1XDLA 1XLGA 4TTUA 5AHMA 2VJXA 1J10A 1CZ1A 3PSWA 3AFBA 1QNVA 3IJLA 5EMJA 2OLAA 5DX7A 3QBUA 4A8LA 1GNXA 2PDNA 1UR9A 3H12A 3K13A 2OT0A 4RNIA 1VFFA 2P8BA 3BDKA 5J5RA 4J27A 4HPHA 2VZSA 4LGXA 1A5BA 3I10A 1QOQA 2OTDA 1PB0A 3QZAA 1XLBA 4YCPA 2Y2WA 3L7RA 5K4ZA 3SIMA 1WDWA 3ABZA 5F2MA 4O12A 1FUYA 7TIMA 1XCFA 2XIMA 1ZAJA 4DJEA 4IGSA 3V35A 1LORA 4YHGA 5EKYA 4S3CA 3HGSA 3LXAA 2KZHA 3SCOA 2OYMA 2A7NA 4JFWA 3KFTA 5JIWA 1CGUA 3GAKA 3O7UA 2Z00A 2Y7FA 2FPYA 1EGZA 3CHEA 4IMGA 1ME7A 4MUPA 1E3ZA 3IIZA 5AC5A 5A6SA 3P0XA 2O7SA 1TR1A 1E71M 3GTIA 3FXYA 3E02A 4FOKA 5HJLA 3JW7A 3MVTA 3F5LA 2G97A 3HPZA 5AHLA 4IXXA 3FEQA 4OTKA 4KPRA 4JTRA 1KM3A 3WMSA 1YDOA 2H6RA 5G4HC 1SJDA 2CZEA 4BCEA 1JPKA 3MBFA 1GVIA 1GOOA 1B9ZA 4MYAA 1H4PA 1MRQA 1G1YA 4PTWA 1UC5A 5JRBA 4Q8WA 1J11A 1FFRA 4CN4A 4NAFA 3FOKA 2NV9A 2NV1A 3S1GA 2PWGA 2J79A 3NQVA 3B8VA 5BMWA 1EJVC 2O0TA 5JBDA 1EB3A 1E15A 1PO9A 2WBGA 1XI3A 2OO6A 4ROQA 3TP4A 2V68A 3PY2A 3VDHA 3OPSA 3MB9A 2PC8A 2X1SA 2HS8A 1UKQA 3UJEA 3F4VA 1BKHA 5JBEA 4B15A 1KN0A 3KCLA 5DF0A 5CC3A 4FNSA 4C1LA 1I9CB 3ARWA 3EMZA 1XUZA 1KQZA 4K8DA 1PXGA 4RPQA 3D47A 3FA5A 1FFQA 3CGTA 2VEGA 3AO0A 3E0LA 2ZX5A 4ZFCA 1AK5A 3H26A 4DO4A 3AISA 3AIVA 2ASHA 3P82A 5I77A 2F61A 4ZZ9A 4U3CA 3EZ4A 2YB4A 4GVHA 2DFAA 5HPCA 1LQ0A 3O9NA 4X60A 1ISWA 5M1TA 2QVHA 3TYZA 4LCRA 1V97A 1F3EA 1N7KA 3M47A 2BMBA 1CXFA 3LCGA 4HOXA 1Q6QA 4E3TA 1W5OA 1PTGA 1GJUA 4YNGA 2DSUA 1V59A 1V5XA 4Z2JA 2AQWA 3WIJA 2VWTA 1QI5A 2DSVA 1YE4A 3M0HA 4LTSA 3DERA 3KOXA 3LXDA 3SJ3A 2HNEA 1J5TA 4HOWA 2WYSA 4H4YA 1SB3B 4DYJA 4DUWA 2H8ZA 3NYZA 4MPQA 1QTWA 2Y88A 2FPVA 5HATA 2A3CA 1E6ZA 2BODX 2PF0A 4KFPA 3BTNA 3D0CA 5D30A 3ZVHB 1TMHA 5FEXA 3DFTA 3BW3A 5H6HA 2X1UA 2PWDA 1B90A 3VI2A 3C2YA 2PGEA 3M9YA 2JGYA 4RE4A 3GDTA 3EUB3 3OGSA 3S42A 4DAIA 4MKSA 4QLJA 2Q8LA 4N2YA 2XJ7A 4FALA 4MF4A 4UQDA 2XWEA 2A3EA 1VYSX 1OIFA 1XG4A 2V5CA 3KWSA 4LUYA 2NUWA 1E6QM 1HP5A 3EOUA 5JH2A 3HMCA 1TE6A 4PH6A 2J7CA 2YL8A 5LNRA 4G9PA 2QEZA 3QFBA 2YCEA 3L4TA 1U2YA 4AZ6A 1W3HA 4LUTB 2VL4A 2WZIA 3ARRA 1RXOB 1E5NA 2G0WA 1QFEA 1GZGA 4GNVA 2Q3RA 3E6EA 2Z7GA 3WKZA 3H55A 3IGSA 4FX8A 2ZUMA 1KRAC 4NZ3A 2OZ8A 3W7DA 3GYEA 1ICSA 3Q94A 2DVTA 1JOAA 3DFSA 3SRFA 4LAMA 3HM7A 1UKSA 4K7YA 2GVEA 4E4UA 1JD7A 4QGCA 1S2VA 3R6IA 4K8EA 4Z2HA 3LHUA 1SMDA 4HNUA 1LRNA 5HNRA 1K7FA 4ZENA 2R24A 3E3HA 1XXXA 2YR1A 3C61A 4AZ5A 2QCDA 2VELA 2BVYA 3B4UA 4EOUA 2OYKA 4YWOA 5FL0A 5E6YA 1OINA 2GJNA 5HR7A 1OFAA 2OWWA 4U33A 3W25A 3MDWA 1OABA 2X0SA 3OA5A 4A8RA 4F2TA 2BGNE 2V3BA 2HISA 4A05A 1PAMA 1EOMA 3NOYA 2OELA 2YCKX 2DSKA 4PMNA 1JAEA 4U31A 4C60A 2OO0A 4F0HA 1TCMA 2PCEA 1K4GA 4JPGA 2DP3A 4ZOBA 3KRBA 4J5NA 3VKCA 2GR2A 1WDPA 1JDDA 1FXPA 4CD5A 1UUMA 1VPYA 3UZ5A 1IR2A 3IJ6A 5LNSA 1UJPA 4IGHA 1EF3A 3WLTA 3P3BA 1YBQB 4XO7A 5CZ0A 2WPGA 3KVKA 2FZNA 4WQ6A 2YLLA 4LT9A 1K7EA 1C7TA 1XLDA 1U1JA 5EGRA 3KBNA 3MZ2A 4JTCA 5HR6A 1KM4A 4ZB2A 2OOGA 1XRVA 1DOSA 4DBWA 5H2ZA 1DJYA 1HUVA 3ES8A 5AC8A 4GD0A 4FO4A 3SCWA 2WSQA 2NVAA 1RV8A 3W2LA 1AQHA 2VFGA 2I9UA 3VOFA 1EGVA 2CW6A 4MZYA 1F05A 3LCXA 3QYSA 1KCKA 3WLSA 4MJZA 3W4RA 4EPEC 3GD6A 3CUIA 3M6DA 2FZ9A 4MM1A 2A6NA 5JQ9A 1W9DM 1O4UA 5FEPA 1MXSA 3N15A 2WOWA 3FV9A 2ZZ0A 1IXOA 5A6BD 2P10A 1R2RA 1JCXA 2WXDM 3C2FA 4F2BA 1BGGA 1Q6DA 4TVCA 3W7QA 3VNJA 3W3OA 1KBKA 4D9PA 1HW6A 3TCEA 3KHDA 3LOTA 1VQTA 4UR7A 1S5NA 2QDHA 4AHPA 3CL8A 3L4XA 2NXIA 2QCLA 3GRSA 2ATSA 3AYRA 1PX8A 2XVGA 3AXXA 4L9ZA 4LX4A 1B3WA 3NYDA 2VGGA 3KCJA 4RJEA 3F5JA 3MBDA 1XDMA 2CETA 2YA1A 4PUKA 5D9PA 3DAQA 4BQ2A 1US0A 3AHXA 4UQAA 1D9EA 3ITGA 5I24A 3MHFA 3VTRA 3NL3A 1W3JA 4OUEA 1KB3A 1IZKA 3H22A 1I6NA 1LBMA 4XVDA 4EWJA 5LIXX 3RLHA 4NI3A 1UW9A 4XZNX 2J6XA 4DYKA 4Y9NA 3TW6A 1FHDA 3GXPA 3E2QA 3URQA 3DFHA 4HD5A 2GLKA 3R8GA 3MHGA 1JGMA 4I5UA 4MY9A 2B7QA 4JTSA 3GIPA 4I6KA 1HTIA 1QR7A 4US6A 4HA4A 5L9FA 3ABRA 3QQWA 1NTHA 4H4IA 1LQ2A 2QPSA 4NAEB 1VF8A 3OVQA 2JGQA 5DMNA 2PURA 2E3TA 1NHQA 1E5JA 3LQLA 3M0VA 1LYXA 4BURA 2EPMX 3UG5A 2RDUA 4PMJA 5LZLA 1OZMA 3HW2A 1SM9A 4IJCA 4JN6A 3RO6A 3H7RA 3MP3A 3QKZA 4BQ4A 4A29A 3QOKA 4CEXC 1J5SA 3BJTA 2VEKA 4GIRA 2CCRA 2FTYA 3PJXA 2XHYA 1H51A 4ZGYA 3HG4A 2HMCA 3R25A 5GNXA 2WMFA 1E40A 5CGTA 2FH6A 1YADA 2FLIA 2IUZA 3N17A 5D8WA 3LHVA 4DJDA 2J27A 3WD2A 3K5XA 4QNEA 1D8WA 4UTLA 3G1HA 1QO5A 3S2JA 2JF6A 1UIPA 1R2SA 2PTDA 1F4AA 1XPYA 1N60C 5FS6A 1MUMA 3V5CA 3V0SA 3MWCA 1OFEA 2ZRXA 3ZVHA 4GYPC 2PS2A 1MW3A 1QI4A 4B92A 3MO7A 2PP0A 4MNKA 2QW5A 2EAWA 2Y8UA 5IRPA 3WUFA 1ZLPA 1DV7A 1W3LA 3RFAA 1JPDX 2Y5JA 3CQHA 4C6OA 3L4UA 1W37A 1AH4A 2ZFAA 1A4MA 2XGBA 3FKRA 2IW0A 4F66A 5EMLA 2WMIB 3UY8A 1PX3A 1CGWA 1XWYA 1TTQA 4J28A 1TIWA 1NOFA 3SCTA 2FZMA 4NNBA 3MA8A 2OZ0A 2V3EA 3UXLA 3VGBA 1RBOB 4H2HA 3ITYA 4C6BA 2QYGA 1O7AA 3F4CA 5D2XA 1XKJA 1ZENA 2Z2UA 4O16A 4EWND 4LUTA 4O0QA 3W1PA 5B7YA 3HRDC 2ZYFA 1A49A 4ES4A 5A3HA 3VGDA 4D6CA 1J2BA 3WNNA 3OLIA 3MZNA 3IVUA 3M5YA 1DTUA 1HKIA 3WQDA 5ABEA 4B3LA 2ESCA 5K9XA 4DRSA 3BAIA 1MEIA 4AFYA 3GFYA 4DO6A 1RLCL 4DJFC 3V16A 2G50A 3LTPA 3L0GA 2PMQA 4AD1A 4D1IA 1R3SA 4HK6A 3K8KA 5MKGB 3CO4A 3PZOA 3G0SA 3DG7A 4KEVA 4AVNA 1S5TA 4PEEA 3DHFA 5KMYA 1FY6A 2D0GA 4M8UA 4IIFA 1L6WA 1BWCA 4B16A 3OLGA 3PJWA 3RCNA 3UF9A 2W92A 3TROA 5CBBA 2QGYA 3B0XA 2E5DA 1HG3A 4N42A 1YKWA 2Y62A 3RJXA 3I7RA 3ZT6A 1YQ2A 2QZRA 5FJPA 1IXNA 3A4WA 4FXFA 5CJ5A 4V27A 4Q8UA 3W71A 4LVAA 3FAXA 4O10A 2Y0FA 3WD0A 2VZOA 1QXLA 3PG9A 4PMUA 3LI0A 1PWLA 3OLDA 2MUCA 2YW4A 3VKAA 4TMBA 3AS2A 4P8VA 2AAAA 2WLYA 4FNRA 1R6WA 3KW3A 1UP3A 3NQ2A 1SMAA 2QPUA 4HMDA 1YBQA 2VCCA 4MY8A 2XH0A 3P14A 1BG4A 4RZBA 3TH6A 1G5AA 1BWKA 1E0VA 6ALDA 3PUGA 5HULA 3ANVA 3TN3A 1H0GA 1MDRA 2WPFA 2VGBA 3QR1A 3GRIA 3M5VA 1IIHA 5CCZA 5IFTA 3KDNA 1GVQA 2DVUA 5T9BG 2WC7A 3ECQA 3MMUA 2G3FA 4DZIA 4NU7A 1PZ1A 3RF9A 1E4IA 4HNCA 1E9LA 3F4NA 3FLUA 1B3OA 4LCSA 3APTA 5I0DA 2DJXA 3AWNA 5G1TA 3OA3A 1ZAHA 4Q4PA 2WCAA 1KV8A 5H8PA 3EXRA 3UZJA 3WLQA 1Z42A 1R3VA 2WVSA 4Q8QA 3W7EA 5A8MA 4EMWA 3CU2A 1H7OA 2VX6A 3BJSA 1H5YA 1B3XA 1O5RA 3NG3A 3DFPA 1NWSA 1GHSA 4JX6A 1R9ZA 2A0NA 1FWJC 2AQVA 5E6ZA 3LM3A 1JNEA 5H91A 3GK0A 5HWNA 1UWTA 3B40A 3TDFA 3DKJA 1EJWC 3LADA 2XFRA 3RYSA 4YYCA 4LANA 2P3ZA 4XTIA 1KTNA 4NJKA 2DSWA 1CLVA 3QFEA 4PUJA 2OOFA 1NWTA 2UY4A 5AY7A 4NNAA 3AYVA 2HTMA 4UQEA 1RK6A 1V51A 3GFXA 2QF7A 2GGIA 4GE8A 1GRTA 2IS7A 5FAJA 5KITA 1HO4A 3EDFA 1NP0A 1RJPA 2DT2A 4M51A 5FF0A 3NPWA 1H63A 3LRKA 3TQKA 4OVXA 1FCQA 3IV3A 2IKHA 2YDAA 3O6AA 1X2GA 3GW3A 3GY1A 2ZWZA 2WOIA 3FDKA 4XVEA 4XZ9A 2OB3A 3NFUA 1FFUC 4AZIA 1Q6OA 4QEHA 4FMVA 3MV11 3JR2A 4O53A 5D09A 5LXXA 5FJRA 3VO0A 2VFIA 4O4VA 4KWSA 5JCKA 2ZXQA 3CL6A 5I5RA 4NEWA 2ZX9A 3OJGA 5F4XA 5LIKX 2CHNA 4ERIA 1HL2A 4FZIA 2NX1A 5FCZA 2IXVA 5CBIA 3O8AA 5HAOA 4NAEA 4GGHA 4JCMA 3ZSSA 2CPUA 4HPJA 4L4PA 5A8PA 1W5MA 3CJPA 1UWAA 5F1VA 3UGVA 3B9EA 3SSZA 2FMNA 3T05A 3BW4A 4B90A 3WEOA 4GACA 1XJBA 1SYTA 2ZZCA 1AJ2A 1F3WA 1I8JA 3LRMA 1QU4A 4CVUA 4QHRA 5CPLA 4DLFA 2WMKA 3KTSA 3ERPA 2E6FA 4RL3A 1POJA 2W9MA 3GVRA 4U4MA 1MNSA 4JXCA 1A5LC 5C71A 2ZUNA 3UNDA 3W76A 3W1TA 3BV7A 3ISIX 3QKEA 4BF5A 3USBA 1H7XA 1XC4A 4FNQA 2ISFA 1OSEA 3N13A 4Y2WA 4F40A 2EPKX 3N12A 2Y8VA 2QIWA 1SR0A 2CWNA 4JIPA 3EX3A 4M6QA 3EKZA 2J88A 5DY2A 5JH1A 4W93A 2C6QA 1J0JA 2EG7A 1QDSA 1LM1A 4S1FA 2O56A 1YDNA 4YMZA 3WNPA 1XFCA 1JQVA 3EXSA 3NIYA 5I3KA 3WBYA 2NW0A 2EPHA 4P8WA 1K03A 3BLOA 3LLXA 4D6EA 4RE3A 3MYPA 1KLZA 4Q6JA 3EKLA 1O1HA 5CC6A 3A7AA 3EWXA 5C2XA 2GVLA 1G9HA 3MS8A 2RFGA 2WMIA 1GVFA 1E9YB 4JAWA 2E9MA 2I57A 1FQ0A 3FYPA 1KBLA 3R4IA 3P67A 6TAAA 5BXTA 4LPCA 3QVQA 1YTKA 2VENA 3GXIA 4JQAA 3C0SA 3FA4A 5I79A 4WHBA 3TAKA 1J6OA 1PE1A 2A5HA 3V5OA 1ZFJA 3BCDA 2VQTA 3MV01 4UQBA 4N9BA 2GSJA 3VIOA 1WQ5A 5DT5A 3RPMA 1TWDA 1OB0A 1L6FA 3SCQA 1XLAA 1VBGA 1UB3A 3CBWA 4LNCA 5H1WA 1J79A 3CQ0A 3F4DA 3GB6A 4ATLA 5K3VA 1H0IA 3HPAA 1F3PA 4LWWA 1HGWA 1ZBCA 3GXDA 1XLLA 1E4NA 4KKXA 3R89A 3EYPA 1WKEA 3UWUA 4O50A 1EJRC 8A3HA 1WBJA 5U4NA 5C7HA 1GKQA 2REQB 4UR8A 4JZ5A 1ONEA 2AMXA 4P7NA 4GK8A 1OYCA 1NWRA 4PMQA 5EU9A 3TN5A 2FZBA 2O55A 4HNLA 4QDMA 4GJJA 4W89A 3WSUA 1DYSA 1BHGA 3BGAA 4BJHA 4L61A 1M6IA 3CUGA 3H4WA 4F4RA 5D2WA 1MW1A 1V7YA 3V75A 4RXFA 1BVZA 3NZ1A 1BF6A 4BQ5A 3FNDA 3CMFA 3RLGA 3CYJA 2CLLA 1W8GA 2EQ6A 2DW6A 5I07A 3PPHA 3FS2A 4RKAA 2V5JA 3PWAA 3PUOA 2FGBA 4YTSA 3CV7A 3SQMA 3STFA 4FR6A 1XR2A 3OG2A 2Z0IA 5CC5A 2DDXA 1BEUA 1HXJA 4E8GA 4GRTA 4XAPA 3ANUA 3TFCA 4PCFA 2FPTA 1EBGA 4R33A 1ZCOA 4HU8A 3HIJA 2E5BA 4CD4A 2CLOA 3ATZA 4V1YA 3Q37A 3WNOA 3TJXA 3TTOA 3AMDA 5AKQA 1UWRA 3SGZA 5KSWA 1K8CA 3WLNA 1GT8A 3MJYA 4EPKA 3H2EA 2QCNA 4JIEA 3KOZA 1PL9A 4IGMA 1ZBVA 2C7FA 3HG5A 7TAAA 1A50A 1FVPA 1Q2SA 3DGHA 4CN1A 1K9TA 3D9XA 1MW2A 3RO8A 1MWOA 5D2YA 3ALFA 1ZQ5A 4GYKA 4NJJA 4W85A 2F7FA 1PDYA 2X41A 3C56A 2A3LA 3W1RA 3L2IA 4LF2A 4DJED 2FHCA 1A0CA 2BY2A 5I02A 3T07A 1ITXA 2E4TA 1LOLA 2AKZA 3PN8A 5TQLA 3EWUA 5M3WA 3VNYA 5F4SA 4H4PA 2WOVA 2OG9A 3ITTA 3S1WA 4DYEA 2D1ZA 3INPA 3VDAA 2PDJA 2WJEA 3FY1A 5K4XA 3CNYA 3DN5A 3W72A 1Q4WA 4GRSA 1YW1A 4RK8A 3P6LA 3LXBA 1CIUA 1M65A 1XRSA 5C7VA 2Z28A 1XBXA 3AICA 2VOTA 5JIPA 3BUVA 1FWCC 1JUKA 4C6KA 4GI8A 1GERA 1RY8A 3ZLHA 1F3TA 2X0HA 1FKWA 2OQHA 4A3UA 3N18A 3QFAA 4GBUA 3MHUA 2OODA 1AZ1A 1JR1A 2YCIX 5K9DA 3WQEA 5C2CA 1OY0A 3H4GA 4RR4A 4EQXA 6REQA 5FF2A 5EFDA 2A8XA 4Z0JA 4H7CA 3DX5A 4NZFA 4E4PA 1CLKA 4Y6GA 4FEZA 1A47A 5F2LA 4ZA0A 3F7JA 3YPIA 5A2BA 3KL3A 2QS8A 1XSJA 2XN1A 3AHZA 4C6LA 2YXXA 4NZCA 1PX4A 1LF1A 3GRTA 1TPDA 4WDUA 4C6FA 2Q6ZA 3ANYA 3PZQA 3HZ3A 4YVPA 4LCQA 4OOZA 3NVYB 2C19A 3TTYA 3LG3A 1V6YA 3GXTA 3WBWA 2JKEA 1FP9A 1J0IA 3RUBL 3L2MA 5AN7A 1NWUA 1NHSA 1CXKA 5AC7A 3W00A 2VXNA 4O0KA 2DPEA 3EOLA 2V5DA 3WL1A 1HFBA 3L12A 4GY7A 1EX5A 3S9YA 4PC8A 1M9HA 2JQXA 5A95A 4QG8A 1OX6A 3POHA 1X96A 3HJZA 1D7YA 1N63C 3LCWA 4XZHA 2VC7A 4APNA 3MCOA 2PSNA 1GVSA 1IT0A 1XH0A 2WBKA 5DMMA 4H4XA 1QI2A 1KBJA 4R3UA 1GKPA 4HP5A 1V3JA 4GWEA 4QJ1A 2ZX6A 1KM0A 4S3AA 2OU4A 3CYVA 1UPPA 2B81A 5C55A 3G8RA 4NI8A 1R3YA 1F6YA 1DJNA 4ZO8A 2DZWA 4JL1A 4K36A 1UBSA 3V36A 2QAFA 2G37A 3O0KA 2AL2B 1AFSA 2VFHA 5L6UA 1Y7VA 4CNSA 3DFYA 3LHWA 3K4DA 4AD4A 3BG3A 5AOUA 1ISZA 2OPJA 1V6XA 3T40A 4JKKA 3L4VA 3BVJA 4AIOA 4JQ4A 3HGJA 1AJ0A 2QUVA 4OE7A 2O9PA 2GOKA 3WMCA 1V3LA 1OC6A 1TZZA 3SQSA 4ALDA 1GHRA 2E9LA 2F6UA 4PFMA 4HMCA 3FHAA 2PWHA 3LCHA 3NNTA 3ZXWA 1HKVA 5U7SA 2GDUA 3EGJA 3WD1A 2R91A 4D2JA 7ENLA 1O66A 2UY3A 2TPSA 3BV4A 3WNMA 5FMHA 4H7ZA 3RX4A 1EF2A 5D8ZA 1SPQA 4MDOA 4CU7A 4XAZA 1QPOA 2FVMA 3N3TA 5A94A 3EMCA 1JJKA 3IUDA 1R0MA 1V0MA 4M7SA 5FSDC 3MANA 2PCQA 2VX7A 3RIKA 1LG1A 2E77A 1AL8A 2PDPA 1MO9A 1Z3NA 4H9VA 1JUEA 5D9OA 4IPPA 4DUOA 4QISA 1TYGA 4PL1A 1YDYA 4C5ZA 1TPB1 3WBAA 2EQ9A 3SUTA 2HPIA 1DJZA 2HE8A 1QWKA 4WXZA 1X8FA 2REQA 4XBSA 2XSBA 3UXDA 2E8YA 1KW1A 4WVXA 3LX9A 4W8AA 3QHNA 3OBAA 1BRLB 2NUXA 5IBXA 1OCQA 3CV2A 2NUYA 1FKXA 3QQ0A 2I16A 3WNLA 1TJ2A 4YJ5A 4GI4A 3O0FA 5A6AA 3UGRA 2BY1A 4GI9A 5BWAA 2Z26A 1VJSA 4AHQA 3PBGA 5HINA 3CMJA 4Y9AA 4EP8C 1IR1A 1HL9A 1S3TC 1H1ZA 4FX6M 3UJSA 1W9PA 4LAUA 2PGWA 1Z9AA 4PCSA 4O1AA 3HV9A 1KRBC 1SJBA 1EDGA 1LWIA 2YGYA 2HBVA 1XFBA 4PUUA 4AD3A 3RR4A 3TK7A 2QUTA 2NPXA