1WUEA

Crystal structure of protein gi:29375081, unknown member of enolase superfamily from enterococcus faecalis v583
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
370
structure length
370
Chain Sequence
GSHMNIQSIETYQVRLPLKTPFVTSYGRLEEKAFDLFVITDEQGNQGFGELVAFEQPDYVQETLVTERFIIQQHLIPLLLTEAIEQPQEVSTIFEEVKGHWMGKAALETAIWDLYAKRQQKSLTEFFGPTRRKIPVGISLGIQEDLPQLLKQVQLAVEKGYQRVKLKIRPGYDVEPVALIRQHFPNLPLMVDANSAYTLADLPQLQRLDHYQLAMIEQPFAADDFLDHAQLQRELKTRICLDENIRSLKDCQVALALGSCRSINLKIPRVGGIHEALKIAAFCQENDLLVWLGGMFESGVGRALNLQFASQPTFSFPGDISATERYFYEDIITEPFILEQGTMTVPQGLGIGVTLSQTNLLKYSQYQKIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords mandelate racemase/muconate lactonizing enzyme family protei
publication title Loss of quaternary structure is associated with rapid sequence divergence in the OSBS family
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 120
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1wueA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1wueA01
2HXUA 5J04A 3DGBA 3PK7A 3H8AA 2MUCA 3ZVIA 3UXLA 1FHUA 3N6HA 4H1ZA 2OLAA 3MUCA 3K1GA 3H12A 3GD6A 4K2SA 3DIPA 5FJOA 2QDEA 3Q4DA 3STPA 2I5QA 1EBGA 2RDXA 1IYXA 3QLDA 3TOYA 1ONEA 1EBHA 1MUCA 3THUA 2GGHA 4G8TA 3ZVHA 1NELA 4GIRA 3CXOA 2PU1A 2PA6A 1P43A 2XH4A 4JHMA 3SN1A 4K8GA 2GDQA 4E4FA 2OX4A 4M0XA 3ZLGA 3OZYA 3VCCA 4GGBA 3EEZA 1BQGA 2O56A 3ES7A 1RVKA 3P93A 3DG3A 5FJPA 4IP4A 3UCCA 3V3WA 2AKMA 2GSHA 4X2PA 1EC7A 3I6EA 4DWDA 3T4WA 3TJ4A 3UCDA 3UXKA 4YWSA 2DW6A 3PWIA 3RRAA 3VA8A 4EWJA 4ENLA 3PWGA 4IL2A 1JPDX 3SN4A 3TQPA 4K1WA 2XSXA 3CK5A 5BOFA 2PGWA 1XS2A 2PP0A 3H70A 1R0MA 4GISA 2P3ZA 4KT2A 3S47A 4F4RA 2AL2B 5FJTA 3V5CA 3RCYA 4FI4A 4A6GA 2OQHA 3NO1A 3T8QA 3KUMA 3ZLFA 1OEPA 3RITA 3ES8A 4GYPA 2QJJA 1MDLA 3P0WA 4H2HA 4ZCWA 3IK4A 1WUEA 2PU0A 2ZADA 3QPEA 3TCSA 2PTXA 3UJSA 5ENLA 3U9IA 3R25A 4Z17A 1NU5A 3OW1A 3P3BA 3V4BA 4DN1A 2P88A 4IL0A 5FJUA 4HPNA 1KKRA 1EC9A 1DTNA 3FXGA 1PDZA 2QGYA 3I4KA 4HCLA 3UJEA 2AL1A 2PPGA 4IP5A 3DG7A 4MMWA 4FP1A 4E8GA 3IJQA 3MWCA 3TW9A 4DXKA 2P0IA 2FYMA 2GL5A 3FVDA 2PS2A 3R11A 6ENLA 1TE6A 3NXLA 1SJBA 2QQ6A 4JN8A 3D47A 4J1OA 4MGGA 3UGVA 3SJNA 3CAWA 3OZMA 4GMEA 3CB3A 3TWBA 3VCNA 3UJFA 4DX3A 4A3RA 1SJAA 2XGZA 7ENLA 2XH2A 3R0UA 4ROPA 2GGIA 3ZLHA 4IZGA 3MY9A 3QN3A 1JCTA 3DFYA 2OKTA 2GGEA 2AKZA 3SQSA 2QJMA 1KKOA 3N4EA 3R10A 1EC8A 4H83A 1MDRA 3DG6A 3ENLA 4GYPC 2P8CA 1R6WA 1TKKA 3R1ZA 3EKGA 3SN0A 3VDGA 4DHGA 3MZNA 4JN7A 2PCEA 3FCPA 1FHVA 5BOEA 2OO6A 2QVHA 4HYRA 2AL2A 1E9IA 2XH7A 3QKEA 3Q45A 1KD0A 2QDDA 2PP3A 3JW7A 5EU9A 1WUFA 3CT2A 2HZGA 3QTPA 2QJNA 3BSMA 2PTYA 3RGTA 1L8PA 2DW7A 2PODA 3T6CA 2MNRA 3NZGA 1F9CA 3DFHA 3NFUA 4GFIA 2PMQA 2P8BA 4MKSA 4KWSA 5IDZA 3UJ2A 3ZVHB 3I6TA 3SSZA 2NQLA 2OVLA 3U4FA 3DESA 2PP1A 3V5FA 2OG9A 2PGEA 2XH0A 3TWAA 3GY1A 3OTRA 1ECQA 3CYJA 2ZC8A 3DEQA 1ELSA 2OZTA 4ZA0A 1TZZA 3FYYA 3FJ4A 3JZUA 2PTZA 3SBFA 3TTEA 4KPLA 3FV9A 4IT1A 1MRAA 1P48A 1JPMA 3RO6A 3GO2A 4E4UA 2OQYA 3BOXA 3DDMA 1SJDA 3IJLA 3VC5A 4DYEA 2GGGA 2GGJA 4E5TA 3IJIA 1YEYA 4J3ZA 4H19A 3GC2A 4M6UA 1SJCA 2OPJA 4IHCA 1BKHA 2OZ3A 4KEMA 3VC6A 4HCDA 3R0KA 1XPYA 4A35A 3S5SA 3DERA 2PTWA 4HCHA 2FKPA 1JDFA 2HXTA 2ONEA 3OPSA 1PDYA 1MNSA 3HPFA 3PFRA 1KCZA 3D46A 3BJSA 3VFCA 3MKCA 4GGHA 4Z1YA 4G7FA 3H7VA 3JVAA 3N4FA 3MQTA 3TJIA 2OFJA 4E6MA 3RR1A 2POZA 3MSYA 3T9PA 1W6TA 2PSNA 4HNLA 3B97A 2HNEA 4HNCA 2OZ8A 3N6JA 2CHRA 3OP2A 5FJRA 3UJRA 4HN8A
chains in the Genus database with same CATH superfamily
5AYIA 4OU1A 1A50A 2VGBA 3EDKA 4C60A 5I3FA 1ITUA 3T55A 3L5OA 4MPKA 3W00A 3MUCA 1RM6B 2G0WA 3QR3A 3CWHA 2G4JA 4K2SA 3WJZA 1A5UA 3Q6JA 2E6YA 3KBNA 1EXBA 5CPMA 2XIJA 4ROQA 1ONEA 4RNIA 3N17A 3W84A 1V7AA 5EB8A 2BTMA 4G8TA 3NGFA 3QSRA 5C6MA 3R8RA 3R5EA 5EA9A 4XZWA 3RCMA 3REQB 3LOTA 3S2NA 1ITQA 2YBTA 1E70M 2EPHA 3WBWA 3UCQA 4Z1CA 3D9XA 1R86A 1RJQA 3RU6A 4E4FA 4DXVA 1OBAA 3KVLA 3WF0A 4OBRA 4XG1A 3DBNA 4JOMA 3GS6A 1LOLA 3KDNA 5F1VA 3FKRA 1SW3A 1F61A 4GGBA 1S1PA 4ZBCA 4X22A 1VBHA 2BHYA 1B2YA 5CJNA 2EXOA 3JR2A 4XO7A 5HNRA 5B7YA 4R33A 4JQ9A 2A21A 1UKPA 4MG4A 1S2AA 3W1MA 2JKPA 3VFLA 1NP0A 4LAZA 3LCGA 1D3HA 3M0VA 4BEUA 3DAQA 5B7ZA 1EC7A 1W2PA 3BSGA 2XPKA 1LL7A 1QWGA 1OHLA 3T1GA 2PURA 3VKAA 4UFLA 1PBGA 1PX3A 3VA8A 4AWEA 5ER0A 3E0VA 2XN1A 4NZJA 3TCEA 3M7SA 4PB4A 3M0YA 1K7FA 1PZ2A 4X2RA 4UBPC 4IGMA 4JBRA 1PIIA 5DRIA 4EMJA 3GKAA 1ZDLA 4Z2KA 2W5FA 3GR4A 3LXAA 4IIDA 3A4AA 1W3LA 5C54A 2XISA 4L6HA 5BXPA 3P62A 4CQ8A 1DE6A 4ACZB 4GYPA 2DZPA 3AIBA 1CZ1A 4XISA 3ANVA 4ZCWA 1O7AA 1WUEA 1N61C 5BMWA 4FB7A 3DZ1A 2CLFA 1YMYA 1BWVA 2XWDA 4W88A 2GQAA 3V7PA 1G4TA 4DAFA 1JCXA 4GIEA 1KV5A 9XIAA 3W28A 2X8RA 3OVPA 4HPNA 3WLIA 1CCWB 1J6PA 4PUEA 5FF0A 4HA1A 3THAA 4Z0JA 3GTHA 3BJFA 2ATMA 4GUGA 2WMHA 4D6HA 4FP1A 2YLLA 3BLPX 3MWCA 3B0YA 1P0BA 4CCEA 3VDAA 1PYMA 1LL6A 4YYCA 5AFDA 3KVMA 1Q66A 3R7MA 1R3WA 9RUBA 3URQA 3OGRA 5CSYA 4QIUA 1V6VA 4C7FA 4QCFA 4QE1A 5F4SA 3BLLA 5JIWA 1XG3A 1P7TB 3CB3A 2OQLA 1FWCC 4DZ5A 4WX2A 1DTUA 3T0AA 1ZJHA 3S83A 1ZL1A 1GTHA 1VIWA 1LRNA 1EEPA 3LS9A 3EPNA 3W7GA 5HNTA 4HZMA 1XG4A 4HPGA 2C1GA 3FG2P 2GVLA 1XXXA 2GGEA 3WLOA 4AAJA 2WW5A 1FTXA 1EWEA 1SMDA 2VEGA 4OKDA 4AMCA 4YJ5A 3S2CA 3ONBA 4PRRA 4WSKA 4HPHA 4Q8MA 4H9ZA 4PMVA 1Q63A 5CPLA 3W88A 5HANA 1HP4A 1YTEA 4JR5A 1Q2RA 1BWLA 4RPPA 1XRFA 3QM3A 5HK4A 3MMDA 2V68A 1B3WA 4N9BA 1K70A 2J25A 5BZAA 3GHSA 4WK9A 3AUOA 5E5CA 4IQLA 3V1PA 4XWUA 1WUFA 4ZOHB 1ME7A 3XIMA 4M51A 1XFBA 3LM3A 2PD5A 4MWAC 2FZDA 3CQJA 2OGYA 4OUIA 2FHCA 3AZTA 2GR1A 3WEZA 1GZJA 2PDXA 1HKJA 1JUKA 4QAIA 3FOKA 3R8HA 1A5MC 2PCQA 3KL5A 3M6YA 1JJKA 4AC1X 2XH0A 3OQEA 2QUVA 1NARA 2D0HA 2Y8VA 1KGUA 2ZC8A 5A5WA 3VKCA 1GRTA 1RA5A 1DE5A 3JZUA 4DNMA 3CEUA 1VH7A 1PHWA 3KX6A 4O8RA 3RO6A 1NQ6A 3U48A 5HR6A 2D24A 2WZEA 1JF5A 5D2YA 4E4UA 1WX0A 1MI3A 1QNVA 1US2A 3IJLA 3IACA 1UMLA 3N4AA 3IJIA 4BS0A 3HGOA 4D6GA 1V6YA 3AXIA 3EWWA 4YTQA 3HG2A 4UFIA 4MIMA 1Z9AA 3CL8A 3W7IA 2C18A 3MBFA 2J6XA 3WJWA 2NQ9A 3WLTA 2ZZ6A 3WDHA 1VPQA 4ATDA 4GYFA 1F74A 4AD5A 3AYRA 3K2GA 3PUGA 9CGTA 1N8WA 3EPMA 3E0IA 3H2EA 4XSMA 5D8WA 1WDQA 3UZWA 1LT8A 2C7FA 4IJCA 3EBVA 3D5HA 4S2CA 3I3EA 3W7LA 1M03A 4ERAA 1JI2A 1TTJA 3S5ZA 5D9MA 1H1ZA 1U2YA 3WMLA 2BY1A 1CW2A 2DIEA 3DU0A 2BY3A 3SJ3A 2E6AA 4A8NA 3B97A 1MO0A 1P5BA 3QHOA 1LPFA 3N6JA 3P81A 4XZ9A 2CIPA 4UFHA 4FK9A 2WHMA 5I77A 4FR1A 2PTDA 2A2IA 1S2CA 2IPFA 3VNMA 5LNRA 1J9YA 3KHDA 3DFPA 3C3NA 1OC5A 4RNHA 1OYCA 3STPA 1B3ZA 1LWHA 2VFHA 2J66A 1J79A 1H2JA 3F03K 2ZC1A 1FRBA 4JFSA 4Y8FA 3T2OA 4AEFA 1A5AA 1Z42A 3C56A 5JCMA 5AHIA 8A3HA 3TA9A 1JGIA 1XI3A 3E0WA 3CHEA 4DO6A 2XSBA 1E6NA 1UH2A 2DY3A 4JHMA 2PDKA 4QG9A 4QCEA 3FW6A 3MS8A 2KAUC 1GG0A 1HO1A 1E9LA 3ARZA 1A5SA 2Q8XA 2WSYA 2XUCA 5FS9A 2VEPA 2YZ5A 2DSVA 1G01A 3AS0A 2W3ZA 2NVKX 1I1WA 3WH9A 4D9PA 2I14A 4PL1A 3O05A 2G97A 5D03A 4MKVA 3P93A 1XHGA 3VZXA 4WLCA 4R85A 1MFVA 2WJEA 1WDPA 2EO7A 4LBSA 2YLAA 2NVCA 1GONA 1C7TA 2HSAA 4FNQA 4PCSA 4Q32A 1I45A 1OT2A 3TONA 1FH8A 4CNTA 2YKKA 2QIIA 1WV2A 3TNOA 3RRAA 1KNWA 1HJSA 1BXBA 4I7VA 2YSWA 3SN4A 4K1WA 2NSXA 5CKSA 3WMCA 1H1NA 4DJFD 4LYPA 2PWVA 4O0QA 2P3EA 3ABXA 1JZ4A 3H4XA 4LNYA 3TZFA 2E7FA 3S47A 3NGJA 1E4NA 2FH6A 2H9AA 3OLGA 4A05A 4LCQA 4V28A 3ITVA 1OM0A 1G69A 5JXQA 1T3QC 1ZHAA 4H2HA 4E2BA 5FACA 4HNOA 1GRBA 2Y5JA 1ODZA 3U9IA 4OFCA 4Z17A 1OCQA 1PB0A 1F5ZA 3NQEA 1GKPA 1XDMA 3FKKA 4ML4A 2I1OA 3CH0A 3P3BA 5H6HA 5BMXA 3RMJA 4IL0A 4TMCA 1V59A 2PBGA 3DHDA 2EF9A 4LS2A 1ML1A 5FKYA 4KCTA 4PTMA 3OC4A 4MMWA 4JTCA 2J7FA 1BHGA 3TW9A 2BC0A 1UD4A 3K8LA 3A4JA 4BEQA 3AXXA 1U5JA 3WBEA 1X6LA 4O19A 3VDHA 4RJEA 3PNUA 3B8SA 3UXIA 3TEVA 3NPWA 3CAWA 4PUJA 1QUMA 3E38A 1MZHA 4JDYA 1OB0A 2XHYA 3TWBA 4B2DD 2HQMA 2EPKX 3SGZA 3V36A 4TVWA 1C29A 4NZ1A 3VE9A 2ZRYA 4WDWA 3O6AA 1WO2A 2Y89A 3ABZA 4R34A 4G7EB 4EPDC 3RYSA 4TX6A 1F7BA 2L5HA 2W27A 1JPHA 3ZWSA 2BNJA 2B0MA 5AHFA 3KRSA 1L6SA 1V6TA 2BX7A 3RRXA 3KLJA 2XVLA 4UIOA 3ITGA 4TXEA 1QCWA 2VQUA 4TOQA 1P0EA 2VWTA 2WVVB 3W76A 1FECA 1JDCA 2RGLA 4C6PA 1PTDA 1PJ9A 1V93A 4DHGA 1TRIA 4LNCA 4KEUA 2PWGA 5FJJA 1I2RA 1FHVA 2HMCA 3AMKA 1EDQA 1AJZA 4Y9NA 3RJXA 3ZJ8A 1VYSX 4JFTA 3CC1A 5M5DA 1LVLA 3WN6A 4HYRA 2PBOA 2GDUA 1M1BA 3CO4A 4MNJA 3MJYA 4Q4MA 4J27A 1DP0A 3IGXA 3LK6A 3KOZA 1VFLA 1X7IA 4D6JA 3G1RA 2OOFA 1W1YA 3RJYA 3B9EA 4QTGA 3LTPA 3NSMA 2OWCA 4QE5A 1W1B1 1WXJA 1QO5A 4KESA 2MNRA 4RE3A 2Q6ZA 3ZO9A 4PMRA 3SSJA 3UNDA 1WAWA 1KTBA 3UJ2A 3ZVHB 5C9RA 1CENA 1ZBKA 2PP1A 3C0JA 2OG9A 4HHPA 4UNIA 2VDIA 4Y6GA 4RL3A 1W5MA 1TTIA 1SR0A 1H7RA 4TUFA 4X61A 3KEHA 2WCAA 3VM5A 3PM6A 2BMBA 2SFPA 4IT1A 2VZUA 3L8KA 4FX7A 3LRLA 4K7YA 1HIZA 1Q4NX 1ZKQA 4O53A 3W85A 1TIWA 4RV8A 1V77A 4W85A 3ZJKA 3TUUA 2CKRA 4LVDA 5FIPA 1J0JA 4L1WA 4KETA 3WQGA 4NX0A 1SJCA 2QT3A 5M03A 2YDRA 3PULA 3V75A 4FXSA 4NEVA 2O9TA 5CBIA 3ITYA 5CSSA 4LV4A 1EJWC 5GVJA 3GXIA 4GA8A 2WSQA 4GK8A 1UWIA 5LA2A 3HU7A 1JDFA 4K8HA 4ZEPA 2E6FA 3IVSA 1QPOA 3LHUA 4AB4A 1R5YA 3IGSA 2G3IA 4K1GA 5GJMA 2I5IA 4ZB0A 4C6OA 3GXDA 5CZSA 1PAMA 4AY7A 3M5VA 3HPXA 1PSCA 1T5AA 3N4FA 3W38A 1IEWA 5A2AA 3PY2A 2JE8A 2ODOA 1DORA 5DELA 2V0TA 1XC4A 3KFTA 4K38A 5TF0A 3WMSA 1UPMB 2ZRXA 4E6MA 4CVUA 4NRRA 3W1LA 2IPWA 1TR1A 3NPXA 2PSNA 2WWDA 4H9YA 2NX1A 5C9WA 3QPYA 4NJGA 3ZJ7A 1XLAA 3AHYA 4HN8A 2AMGA 1ZENA 5IBXA 4X3ZA 2DH3A 1U22A 1OIFA 3IIXA 4H9TA 4WDUA 3ZT7A 1R3RA 3W25A 2ZE3A 3H12A 3QQ1A 2ZDRA 4OOUA 5EYWA 1DXFA 3A7RA 4D6DA 3Q4DA 1N62C 1UA7A 3ZSSA 3IJ9A 3B9AA 2P10A 1WP6A 1BPLB 3OHMB 1EBHA 1EP3A 4UQAA 1DHKA 5BU9A 1ZCOA 2DQXA 1XYZA 1J2WA 3MV11 3W53A 4Q3MA 5MF5A 1A3XA 2QXWA 2TSYA 2GK1B 4REQA 2OSYA 4GZJA 2Q3RA 2W3SA 4QROA 1GHRA 3N2TA 1DIEA 4M0XA 3ARUA 1DWGM 3TN3A 1GYMA 1QVBA 2IQTA 1Q6GA 3QV9A 4GYJA 1BQCA 3MBDA 4QS5A 5E9AA 4GINA 4P7LA 2H3BA 1RK6A 3DCPA 3GG1A 3IK2A 3EXTA 1IXOA 1F05A 2ZXAA 1UOZA 2E0PA 3R4IA 3QTGA 3VCRA 1QPRA 4NJHA 1FP8A 2WJZA 3V3WA 4AD1A 3C52A 3WQVA 2YW4A 1IGWA 4AW7A 2WPGA 2YDAA 1LUCB 3TR9A 4YCPA 4UQCA 4DPPA 3W7HA 4ENLA 5LHEA 3W37A 4ZOBA 1Q6OA 4DNAA 4YPJA 5HMSA 1LG2A 2EG6A 4DO4A 3SCVA 2DGAA 1Q6RA 2YIHA 4IUGA 5CJ5A 2Y4SA 1RH9A 1L2QA 4US5A 1CGXA 5I0DA 4KQNA 5LZLA 1VLWA 2X1TA 2WLYA 1P6BA 1MW1A 2OX1A 3AWNA 4JZ5A 2A5HA 4PUKA 1OINA 2WPCA 3BG3A 3M6DA 2HV5A 3UVAA 3FXYA 3HFYA 2C3DA 5LIYX 4FF7A 1KXHA 2DVXA 3RO8A 4IMFA 4HSOA 4PODA 3NDZA 1B9ZA 4DYKA 3PPGA 1A5NC 4PMZA 4WXYA 3MP5A 4UCFA 4H9MA 4DI9A 1CT5A 5F4WA 3LPFA 4GCXA 1TPEA 3U2ZA 1CXHA 1TPUA 4CN1A 2Z00A 1GUVA 1G7UA 3PJTA 1OC7A 1HG3A 5FJUA 3QFAA 2YL8A 4NZCA 3WIJA 5BXRA 2GJXB 1RD6A 3FXGA 2PLMA 5GQBA 2GQ8A 3AU2A 4AXNA 4MSSA 3UJEA 1DWIM 2WXDM 4JIPA 4W5UA 4LUTB 1EEXA 3TTQA 4OOZA 5HMEA 3SUSA 2CBVA 3MANA 1Z48A 2X42A 1EJXC 1C8XA 1X8FA 1U5HA 3KZSA 5IDIA 4RV3A 4CNOA 4C65A 2ZZ3A 4HGXA 3GHRA 3DHFA 3DFTA 4AX7A 1ADOA 3KLLA 1XCXA 3ME3A 2PI6A 1BRLB 3BLKA 3QJAA 4V1YA 3SGUA 4EF8A 3NEVA 5G4HC 1W1A1 4IQDA 1CLXA 4Q4PA 5FL0A 5JIPA 4DELA 1RPKA 1H61A 3B8TA 3QN3A 1VBJA 1JCTA 1SR9A 4LFYA 3UD6A 4CEXC 4KGLA 5EKYA 1SGJA 3NQ2A 1XIHA 3UESA 4RK8A 3TC6A 3L4UA 4G7EA 4CD8A 3V0UA 1FXPA 2WNQA 1J8VA 4Q4OA 3SN0A 2Y2WA 3L2MA 4C6LA 2Y6ZA 3NZPA 1GOIA 1RBOB 5JMUA 3KBWA 3II4A 4OBTA 2WVVA 3WEMA 3JW7A 1OFDA 4L7ZA 3WK1A 1AH4A 2HZGA 2NXHA 4O1BA 4M6QA 1N5WC 2QJNA 5GNXA 1LWIA 4RR4A 3GUGA 2FMOA 4ZO9A 4UTWC 3W2NA 4ZL1A 3EOEA 3NZGA 1F9CA 8XIMA 1S1RA 4MKSA 3RUBL 4D8LA 4MWAA 4UFMA 1WYIA 3VNDA 4M52A 2VEMA 3V5FA 1O4UA 5H91A 4Z1BA 2E09A 4Y90A 3VGGA 2VZTA 1EGMA 1NF7A 3NVDA 1KR1A 1FWHC 1GOWA 2WMGA 2QF8A 1HZYA 4ZA0A 3UETA 1TQXA 5DMMA 3C2EA 3VUSA 2EQ8A 3LXCA 5FOOA 1S2TA 1EQCA 3PS7A 3WLMA 3WX7A 3P61A 1F3TA 6REQB 1Q65A 4AZCB 1M7XA 3BOXA 2OLSA 2ABBA 1BD0A 2FZ9A 1H0GA 4O8AA 1YEYA 4H19A 3T8LA 2E67A 4A22A 4DI8A 2HVOA 5KMYA 2VFFA 1AQFA 4PEKA 1VLIA 2YFOA 3CUJA 2ZFAA 2OEKA 1ADDA 4O57A 7CGTA 4O11A 5HPCA 3LY0A 3EOLA 2BDQA 2G3FA 3D3AA 2PDFA 1PWLA 3VTRA 1O5KA 2Y61A 1TR9A 2YR1A 4GI6A 5T9BG 1WQ5A 4G5DA 5EL1A 5I24A 2EG8A 1AUSL 4AZ6A 1NFBA 1QATA 2FKPA 1EPVA 3THQA 5CC7A 4JYFA 3LPPA 3OU8A 4INFA 2H8ZA 3PFRA 4MAVA 2EEXA 4JIQA 2P0OA 3OLDA 4JTRA 4RLIA 1RUSA 3LHVA 3AU6A 4RPQA 2R8WA 5HMFA 4P61A 5JVLA 3GTNA 4Q4SA 5D8ZA 1WZLA 4XVDA 4BI5A 2OFJA 5D2TA 4LX4A 2H8XA 4GX9A 3ITCA 1G67A 2CLPA 3H21A 3VU2A 1P0DA 2POZA 1P0KA 4AVNA 3ZR6A 1IWBA 4CQ9A 3U57A 4J28A 1TPH1 1AD1A 5FJRA 2NUYA 1CGUA 3UG8A 1Q2SA 1GVOA 2A7NA 3C61A 4K39A 6CGTA 2ZRVA 1XC6A 1KM2A 3GRSA 4ADWA 5AECA 2BHZA 3GD6A 4OHQA 1WBHA 2C1IA 3QY7A 3CBWA 4AIUA 2NW0A 2QDEA 4QFUA 4U5IA 3N11A 3CZJA 3IGUA 4DWSC 4O1AA 8XIAA 3WL0A 4IG2A 3WQ5A 1EUAA 3MJMA 4XD5A 1XR2A 4S1FA 4GIRA 4S3EA 4ZO6A 4KMQA 3QGAC 1D3CA 1QR7A 1VBGA 2BV9A 3VIIA 3IJDA 3SN1A 2EPMX 2BOFX 2PEVA 1HXJA 3S1WA 4MWAD 3W74A 4I7WA 4F79A 3KS5A 4PUDA 5LNUA 5JQ9A 1U33A 1MW3A 3UR2A 4C1KA 5HBFA 3F4VA 5HJYA 2O56A 3P8IA 2HDJA 3M44A 3AIQA 3UU0A 2GK1A 1J96A 5A6BD 1GEUA 4ICNA 4RCXA 3ZXWA 1G4SA 3I6EA 2R14A 3PTQA 5H2ZA 2Z2BA 5JCLA 3WFZA 2ZRUA 1I75A 3W72A 3WG6A 4YWSA 1FX6A 1FWGC 3LSCA 1EL3A 4FX6M 4HPJA 3SQPA 2IKGA 3BJTA 2O4QA 1KCLA 1KXTA 3CK5A 5M17A 5DANA 3MHFA 3LV6A 4Z2JA 3AQUA 4Y9PA 4ILSA 1H7PA 1JYVA 3SUTA 1W56A 4KS0A 1ICQA 3E5BA 1Q45A 2V81A 4KIRA 3N9KA 4GXWA 4U2YA 3T44A 1K8ZA 4V33A 1XIDA 1YBQB 5A8QA 4ATLA 1JZ7A 3BC9A 4A8LA 4AU0A 1H7OA 1B3XA 4FIRA 4H9VA 4WSHA 4TV6A 1GRAA 4N9DA 1XW8A 3BO9A 3GXPA 2YYUA 2X8GA 4GVGA 3UZJA 3NL5A 4XBKA 1CECA 3T05A 1TE1A 1LLWA 4MWAE 3MZ2A 3DFQA 1B54A 2YYTA 1YPIA 3KL3A 1EC9A 1YRRA 5I5RA 3TTYA 2WC3A 7TIMA 1BSLA 4XKYB 3RR4A 1Q6DA 1NDYA 2R6OA 4J9JA 3TN6A 3WLPA 2NQJA 1J12A 3LV5A 4L9XA 4B3LA 3NZ1A 1HKIA 4O15A 1X98A 5CPTA 2WWCA 4H6RA 3CMGA 4WJEA 3LD5A 1VGAA 1VJZA 2PS2A 4HN4A 3NXLA 5CLWA 3EWXA 3K46A 3MSGA 1FEAA 1S2WA 2WBKA 1D2KA 4LUTA 1XANA 4U31A 1AODA 1IE7C 1E9YB 2HS6A 1UB3A 2ZUNA 1AZ2A 5I3DA 4UOJA 2JIEA 2F6KA 4C90A 4U4MA 1H7WA 3TXVA 2G3JA 4BF5A 3NYDA 2WK2A 4Y2WA 1GT8A 1VF8A 1W9VA 1BRLA 3QYSA 3AXHA 1JAEA 3MY9A 4Y9AA 3A5FA 1TB3A 3RIKA 4F48A 3TKFA 3N4EA 1EC8A 1FP9A 4AZHA 2W0HA 5CSUA 1E5JA 1SFLA 2WVTA 3CL7A 1UQYA 1IF2A 4W5ZA 4X0NA 3WF1A 2WMFA 4JCLA 1L6GA 5BRBA 3LBOA 3UFYA 4BQ2A 1NY1A 4HU8A 1MNZA 2A4AA 1HKMA 5A6SA 1BFNA 2VT0A 3LI0A 4W9TA 3KP0A 2VHLA 1GZGA 2V5KA 4CNUA 2X09A 1IT0A 1YNYA 4DEFA 1BWCA 2O92A 3CPRA 1JG9A 1M6JA 2CNCA 5HINA 2ZQ0A 5DXXA 2DW7A 4JYEA 3ID7A 2EKGA 1NQKA 3QZ6A 1JCNA 2CERA 3DFHA 4CU6A 1HL8A 2D3LA 1KXVA 2IUZA 1CLKA 2R9ZA 1RR2A 1K9TA 1OD8A 4GVHA 3GC5A 4W4QA 2Q8ZA 2V5DA 4PBGA 4YXGA 3AXKA 3L2LA 2J8TA 1JYNA 1C9DA 3DEQA 1WDDA 4DUWA 2NXIA 2J8GA 3ATYA 3G1DA 1TZZA 3LPOA 3K13A 1DHPA 2RAGA 2ZE0A 2JFEX 1XLFA 4XZHA 1RQBA 2VDGA 3TQKA 5LKYA 3GO2A 1UYQA 3PB0A 1N5XA 4DBUA 1LT7A 3PBYA 2OWWA 4O18A 1XH0A 3GLCA 4M82A 2O0TA 2QPSA 3AM9A 4M6UA 2J79A 3AICA 2O7QA 1JUBA 1Y0EA 2YVJA 6REQA 1H50A 4FHAA 1HJUA 4AZCA 3DFOA 4AFYA 2A3EA 4HCDA 3R0KA 4AH7A 3DYMA 4GIYA 4H7ZA 2PDNA 4AYSA 4H7CA 2IMRA 4GHRA 4A3QA 1D7FA 1EX5A 2V9DA 2ONEA 1XIIA 4NJIA 3TSMA 1FWTA 1CBGA 3Q37A 4A29A 1XRSA 4D72A 5H1WA 1AQHA 5I3KA 3ABSA 2DIKA 3D46A 4H4VA 4B3KA 3BQ6A 4OT7A 4IQJA 3TJIA 5I78A 3WF3A 4XBJA 2X1IA 1GVQA 2GOKA 6TIMA 4QJ4B 2AQWA 3FIGA 2BY2A 4WHBA 1AQMA 3VMOA 4LVFA 4PMUA 2BVTA 4AZ5A 5DBTA 4HNLA 1A5CA 5GRTA 1Q5MA 2ZDSA 3R89A 5AHNA 1K03A 4RE0A 3WJSA 2Z0IA 1EO5A 1V6WA 3SUUA 2W9MA 2D1ZA 3CAKA 1EOKA 1FCBA 1EF3A 1QOQA 3GDBA 3TOYA 4DM2A 3PNZA 4J3TA 3Q94A 3MSRA 4GZ7A 1RAKA 2A3HA 3EUB3 3LHWA 1YNPA 1M6IA 4WR3A 3URNA 2ACUA 3IAQA 1ZJAA 4JAWA 3ALGA 3UWZA 2GDQA 1GYLA 3OYZA 2OX4A 3EGJA 1J0IA 1UWQA 1YPXA 1SB3B 4YVPA 3EEZA 1R3YA 2IW0A 2Z28A 4JEJA 4XK2A 4AIBA 4AWUA 4ERIA 3AJ7A 2ZRZA 1JNEA 2D73A 2NSOA 4Y96A 2TPSA 2W79A 1O5XA 4OECA 3NPVA 4HSNA 1PVNA 1H63A 2QCEA 3QC0A 1FUYA 5FJPA 5CLTA 2BVWA 1GOQA 1B31A 2GJRA 3WBAA 2VD8A 1SFTA 4D1IA 4IISA 3LI1A 3NM1A 4L4PA 1RSCA 1WDSA 3IJ6A 4A8RA 2IQ0A 4L80A 1ZBCA 3FJ6A 3TOPA 2WSKA 1GK8A 2Q3OA 1XS2A 3SCPA 1R85A 4PCNA 1FWFC 1AG1O 3T81A 3N6QA 3LYEA 1J10A 5JH2A 1S5WA 2DZVA 4LPCA 4ZVJA 2EGZA 3BANA 1SW7A 3GBEA 4B5WA 3GDTA 3HBLA 1VHNA 4LBUA 2YL6A 3LZ5A 4ZSTA 2YBUA 1WOAA 1NOFA 3NURA 4HOWA 1B90A 3CIXA 2GR3A 3LLDA 1ZXIC 1N8IA 3ZOAA 4I7UA 3NG3A 2UV8G 4QRNA 3WH8A 4UOZA 4WY0A 3UPBA 1BF2A 3E2QA 2C13A 1GYNA 1W9DM 4W86A 3FA5A 3FYPA 3ECQA 2BG5A 1CI1A 4LSBA 1EHNA 3OLEA 3LCHA 1DXLA 3DGHA 3W73A 1J2BA 2OSWA 3FNDA 3WK3A 4IP5A 1O6IA 1FO4A 3DK4A 1KQZA 3G1SA 4RX0A 4L9ZA 1E72M 3SCWA 2X50A 4LYQA 4XUYA 3TTSA 4DBEA 3WH7A 1VQTA 3AO0A 5DY3A 3B8VA 3R0DA 2P0IA 2QQ6A 4HSHA 2ISSA 3O9NA 2REQB 2DUAA 1IR1A 3ANYA 1ZBVA 2Z24A 5A2CA 3MT1A 3E5PA 4BJHA 4ERGA 3SRFA 4ZGYA 2NLYA 5E1QA 1F8IA 1GOXA 2J75A 5C55A 1PTGA 3I65A 3HW2A 1CLVA 1US3A 2VMFA 2WC4A 1JZ3A 1FOBA 1XLCA 4N2YA 3DFYA 3ARVA 4J3WA 3RLUA 2PUZA 3LLXA 1LCOA 1B4EA 3DGRA 4S3FA 2ALRA 1UUOA 3M0JA 4W7VA 3W2MA 3OO2A 4PCPA 1KM1A 2ZZ5A 4M6PA 5HA7A 1PZ1A 3EKGA 4GYKA 3BQ5A 3GIPA 1BXNA 1ONRA 4HMEA 1QO2A 3NL2A 2PDBA 4LB4A 2FH8A 4BI6A 3DJJA 3LBCA 2IPGA 5D2WA 4MUPA 5HWMA 1K77A 2P1FA 1KD0A 5EPDA 2BGQA 1NWRA 5REQA 4EPEC 3VGFA 4QQ3A 5D05A 2EPNA 2B31A 4NAFA 2ZA2A 3BSMA 2GVEA 4WEVX 1OD0A 2OZ0A 1F8WA 4NZ4A 3VNLA 3WDPP 1EZWA 3ZS4A 1BTMA 5C71A 3LRMA 3KL0A 2HQAA 2CXEA 4FF5A 1TJPA 4K7VA 4FOKA 3HA1A 2ICSA 1KTNA 4UTWA 5A8GA 4GZIA 5IHRA 1DWHM 1EFZA 1N8FA 1JFHA 2QUNA 2QDHA 2NVDA 1GRFA 1D8WA 3TYCA 3WQCA 2D2HA 2EQDA 3DHPA 5DCDA 5HDRA 3CIWA 3ALFA 3FJ4A 4CD7A 1TPC1 1UW9A 2NUWA 4AD4A 2DT3A 3L12A 4LYRA 3RXZA 3FV9A 1MRAA 1P48A 1VS1A 3M47A 4XIMA 4MADA 4BA0A 5HPOA 4U28A 4ZOAA 3GVVA 3CV7A 1U83A 3AI0A 4I5XA 4TU1A 3LX9A 3V0SA 2VR5A 2GGGA 4IIEA 3S9ZA 3GR7A 3LMYA 4NNBA 3BLDA 1M7OA 5AY7A 4Z1DA 2PWDA 1ISXA 4IHCA 5U4NA 5ABFB 2VRJA 4H4IA 3B0UX 4AZ7A 3VX0A 3GDLA 5JBDA 2POTA 3C0LA 1OFBA 2G50A 4NL1A 2A0NA 3NZRA 3H2CA 4TR9A 1HQTA 4N7QA 2BB0A 2HVNA 3VINA 3KOXA 1PDYA 3GVGA 4C6FA 1MUMA 4AQLA 2IS7A 2OELA 4JICA 1ISWA 3WMBA 2ZXBA 3WLLA 4JTKA 1ECEA 4NZ5A 3VFCA 1E6XM 4JIIX 1K6AA 4BZYA 3RX4A 2FFCA 4WDTA 1UKQA 2O4MA 3BICA 5G4WA 1ZMDA 3T2QA 4LAMA 4UOQA 3IEBA 3LTSA 1SFSA 3MSYA 1XBVA 3ARQA 1LOQA 1V7YA 1Q6EA 1OZQA 4JFVA 1ZAHA 1ZBWA 3EX4A 3GAYA 1FKWA 3PK7A 1SU5A 2MUCA 2GYIA 1GEHA 3BLFA 1RCOB 2H6RA 3NAVA 1A53A 1CEOA 4NXKA 4S38A 1RK5A 3BOFA 1QHPA 2G37A 1IYXA 1W8GA 3I7QA 2FHFA 2YA2A 3WENA 3CUZA 2O7SA 1LBLA 3TV8A 1SZRA 4GRSA 3WDRA 5GNZA 4IFOA 4O1CA 4DWSA 2V3DA 3IRSA 2UZ9A 1WKFA 5A6TC 2PLKA 5TAOA 2JGQA 2YXXA 2F84A 3B8WA 4TV5A 1JD9A 4M24A 1PCKA 3HPZA 1RD5A 4XTDA 2CFFA 1KRCC 1BVWA 4F0LA 3GDRA 5KZEA 2GQ3A 2XFRA 2D20A 5CC6A 4PCTA 2G8ZA 5CZJA 1EWDA 1UHVA 1NWUA 1BYAA 2VX4A 4LU0A 1REQB 1RBAA 1OJTA 2ASHA 3QFBA 3GE7A 1A3WA 3M0MA 2AKMA 2GUUA 4X2PA 3T78A 4GH3A 5E9XA 2QUUA 3W7KA 2QDGA 2C79A 2V38A 4FLOA 3P5YA 4EWJA 3PR2A 3BV7A 1LWJA 3M0HA 3QFEA 1AZ1A 8TIMA 3TC7A 4DJDD 3ZZ1A 5BOFA 4CN4A 3CH9A 1LG1A 4J40A 3PVFA 2BOGX 2J88A 4ADSA 1OQFA 2EPLX 4IF2A 3TQVA 3I7RA 3V5CA 2QCLA 1JD7A 3GG7A 4A6GA 3NJ3A 3WF4A 1TV4A 4H4TA 4YWOA 1AMKA 2XVGA 2UBPC 3AYTA 3UWWA 1W54A 1JCLA 2Z1SA 4NSBA 1H7XA 3FA3A 3QOMA 5I03A 1U1JA 1MDLA 3MVTA 1QW7A 5C9XA 3CQIA 3O06A 3GH7A 2AOSA 4CQBA 1FXQA 3W22A 1E1FA 1NU5A 1FFVC 3NR0A 2X41A 3PAJA 2QZRA 3OW1A 1MYRA 3K8MA 3M5XA 3PJWA 1XIGA 3R58A 3IWPA 2YL9A 5G2HA 3HMJG 1FCVA 3CAQA 3K1DA 3I3DA 4F2UA 4ZQCA 3QW4B 4HOXA 2X0SA 1H5YA 1DTNA 1QHZA 4GE8A 1W1VA 3AIUA 1RCQA 1Y65A 4DYJA 2NQHA 2AL1A 5JH1A 1WZMA 2XJ7A 1EA9C 1F3XA 4M5PA 3BVJA 4O10A 4AY1A 2GVGA 3KVKA 1JZ8A 4QJ5B 3CMJA 1WNOA 5FF4A 1J0HA 5F2MA 1TE6A 3G6MA 3VIMA 2OODA 1NTHA 3O0KA 4W87A 1KR0A 1T40A 4DJFC 1OT1A 3PWAA 3LDVA 1Y5WA 4PE8A 3SRKA 5A94A 1FFQA 3FHQA 4TTGA 2Z7GA 2B81A 1KFLA 2Y24A 1IWAA 1EP1A 4GC4A 1ZY8A 2J8FA 1F4HA 2CPUA 4A3UA 3M0KA 4R88A 5CBBA 4MAZA 1J5TA 4EQSA 4PTVA 1W0MA 2GGIA 3HRDC 4JHZA 3SFWA 3EMQA 3L0KA 3GXFA 1RP9A 4ZR8A 1V3KA 1J6OA 1UWTA 1XLBA 4H83A 3VKDA 3DG6A 3B8UA 2WP6A 2MANA 1FFRA 5HJXA 3ENLA 5U25A 1R6WA 4A21A 5MHBA 2V3BA 3EOUA 4NZFA 2ZZBA 1AH3A 4WGXA 5FCZA 1YQZA 3HM7A 4KH2A 4HJFA 1FDYA 3Q65A 3A6OA 1Z41A 1EXPA 2HBVA 1EX1A 3RG6A 4P7RA 3BURA 2NXGA 1YE6A 2ON3A 2VX6A 3RNDA 3U2EA 1R9YA 3QTPA 4MNLA 1KO0A 3AWOA 3T07A 1XKJA 1VHCA 3NVTA 4PMDA 1UWAA 2PODA 4GXMA 3KCOA 2NLIA 2PWUA 4F9DA 4HB7A 1KN0A 2B7NA 4KEZA 1S5TA 2CZEA 4L6OA 2DSZA 3VNIA 1LRTA 4LXFA 2WM1A 3SSZA 2NQLA 3E02A 4B92A 4Q8UA 3M1ZA 5H8PA 1RCXB 4CGTA 2PC4A 2X0HA 3GX9A 4Q7BA 2WOVA 3SR6B 3B0VC 2X99A 1ECQA 4UQ9A 3MUZ1 2JF7A 1FEBA 1ELSA 2OZTA 3C2RA 3GXTA 1OX4A 1TJ0A 4Y9OA 2PAJA 1PZ3A 2ZX9A 2Q09A 3CPGA 5A8PA 4PCFA 3J7HA 4QLJA 2C1HA 3SR7A 4FPSA 3CQ0A 1DJGA 2DV0A 4XBSA 3V16A 1SVDA 1YKWA 2QCDA 4I9MA 1VEOA 4AVOA 3CGDA 4RZBA 5HOSA 3LHYA 1TWIA 1VJIA 1QTWA 4ML9A 4PMOA 1XPYA 4G2DA 3VKBA 1KM4A 5LIWX 2DSKA 4C6BA 3WDIA 3PJXA 2OR2A 3OPSA 3TNBA 1UR3M 4GKLA 4H41A 5C0QA 2QV4A 2J3NA 1GCYA 1YXDA 3KBJA 3HV9A 1EH9A 3MKCA 4GGHA 4BCEA 4Z1YA 4ECLA 4GKTA 1MEWA 2ZZ2A 2NZLA 4DJEC 1FWIC 1GW9A 2A6LA 4QEEA 1DQWA 1GVFA 2AGKA 3CHVA 3N3MA 4S3AA 2CBIA 1Q6QA 3N2BA 3ZT5A 4NKCA 3VMNA 1UP0A 1ITXA 4RDZA 5H8UA 4HU3A 1B4KA 2CDUA 4W84A 4M6VA 1OADA 3F4CA 5KZMA 2XIIA 4QITA 1UD5A 1B1YA 4KIEA 4F2TA 2CLKA 1VFUA 4HMNA 5I79A 1JQVA 1L2UA 4QP0A 2QCHA 2YAUA 4YS1A 5CC3A 2O55A 3PG9A 4CLMA 4CQDA 5HQEA 3USZA 3QSTA 4XX6A 1GV4A 5JBEA 2V2CA 2CLHA 5JU6A 3W2KA 1UR9A 3UR5A 3V5OA 2Y5SA 5I3GA 4UR8A 3HGJA 5LIKX 3L5AA 2ANUA 1ZY9A 2RKXA 3P6LA 5FEXA 1L6YA 3PSVA 1NJJA 1PXGA 1I2PA 4ZXOA 4G9PA 2CHNA 4WCJA 3R6IA 2TMDA 4AY8A 2TAAA 3PF3A 4YVXA 2BXVA 1G9HA 4R7JA 1VFTA 3W1UA 3L0GA 3CL6A 1V5XA 3W7DA 2LLEA 1CGVA 5EMMA 3FDGA 3CV1A 2JF6A 4O17A 1EIBA 4HVXA 3A9BA 4D6EA 1REQA 1XRTA 2Z25A 1UWUA 1XLLA 1FVPA 2F8QA 1ICSA 3OJGA 1JPDX 3D0CA 4YIWA 2BC1A 5E6YA 4AEEA 2PP0A 2NT1A 3CPUA 3AHXA 4EIVA 2EG7A 3E2RA 4WXZA 4GISA 1W1PA 4KT2A 2VEIA 5BRPA 5BRQA 3DI1A 4LCRA 3BAXA 3W0KA 2Y7GA 3VD7A 2ZZ4A 1JDAA 3RCYA 2BGSA 1XYMA 3GNPA 2CWXA 1E55A 1TV3A 1E9ZB 2OQHA 2CZVA 3CB8A 3VUPA 3NYZA 3T8QA 2DVUA 3NSXA 4M7SA 4PB5A 2CITA 1TPB1 1TUFA 4RXFA 3MYPA 2VYOA 3A3HA 4LAKA 1K3UA 2C71A 4D1JA 1RJRA 2INFA 4HHLA 3ZQ9A 4JGDA 2NUXA 5D04C 5ABGA 6XIMA 4BK9A 5CAHA 1GGOA 4HQVA 4ZMGA 3CZ8A 1X2HA 3QH2A 4GQBA 2CC0A 4HTBA 1Z7AA 3I10A 1KQYA 4RDVA 4WQ6A 1MQPA 3QHNA 3BAWA 4GRTA 1I60A 1NM9A 3WEOA 1OABA 1TTQA 3WNPA 1E0WA 4RDWA 1F6YA 1GJUA 1A49A 3IJQA 3UY7A 3E2VA 2FTPA 3RPMA 3GW0A 3BGJA 1I2OA 1NF0A 3APTA 1W1TA 3H4WA 1TA3B 3ORWA 2HPIA 2HISA 5CAKA 1XBXA 3B04A 1ZJIA 3TJXA 1Z6KA 3CU2A 3BV4A 1AA1B 4LALA 1YQ2A 2J47A 1G5AA 3VGEA 4DX3A 4QQUA 2XGZA 4EXBA 2GSEA 2TPRA 3GFZA 1XH2A 3E6EA 4J2PA 2OT1A 3AS2A 1WCGA 3E0LA 1EYWA 5FEWA 5G2WA 1VKFA 2UWFA 2GJLA 4RUBA 2YVGA 1V3HA 1NDZA 3VIOA 4NP7A 5XINA 5D2VA 1ONXA 1GKQA 3CQHA 3DN5A 3UQNA 3R1ZA 1OFAA 1KBBA 2G5WA 3VOJA 3BW2A 2G41A 4QGCA 1XYLA 2TODA 2WMIB 3DFNA 4V2XA 1KB3A 1QBBA 3GG0A 5HATA 1LL4A 3VIKA 4DNHA 1O95A 5D02A 1W3JA 3MVIA 1HGWA 1L8PA 1NHSA 3NL6A 4UMBA 3NZQA 2QCFA 5BWFA 3HV8A 1BGAA 2G4FA 3FEQA 3N14A 4R27A 3NFUA 1RQHA 4Q4QA 4O52A 1IT8A 5HNUA 3RLHA 4XV0A 1HN1A 2QCMA 2J7HA 1NHRA 1YYAA 1G4EA 1MXDA 1TV7A 1UP2A 2WM0A 1OFPA 3GYCA 1U1UA 3BWWA 3CHDA 4XZMX 1TELA 3TW7A 2PGFA 3NM3A 3H55A 3W81A 2BWGA 5FF3A 3OVRA 4PTWA 3SUWA 3KTXA 4LT9A 2WANA 5TR3A 5HWJA 3RM9A 1UD3A 3KCLA 3GXMA 1VFMA 4IPNB 2GJNA 3LGGA 1ZPTA 4QHRA 2XGIA 1H1YA 2QJIA 5CQ1A 3IUDA 3VOCA 3YPIA 1Q85A 2ZX6A 2WPEA 4AISA 2W91A 2BFGA 1XSJA 2PDUA 4JQ3A 3BDKA 3DENA 2WOIA 4XIAA 1TREA 2ZUSA 3U7BA 3NQAA 1POKA 1V4YA 1JZ6A 1MQRA 4QLLA 2HK0A 4MJZA 2OLHA 1IGSA 2PTWA 1KM5A 2D0GA 2WJFA 4HNVA 3FHAA 2ZYFA 4H9XA 4XB3A 2H9AB 2XZ7A 1OFOA 3EWDA 4JTDA 5BROA 4BFAA 1PCWA 1WPCA 7XIMA 5C2GA 3AMLA 3G18A 3JVAA 4HT3A 3MQTA 1EJRC 1HJVA 4JTLA 2X7VA 3EF6A 3TVAA 5EY5A 3M41A 4UR9A 4C6IA 4PTNA 1GXFA 3KWXA 3Q67A 1S2VA 2OMAA 4YU1A 2OZ8A 4X60A 2GZXA 1ONWA 4UTUA 3A64A 1IEIA 3L68A 3R79A 1SUXA 3BSHA 2IXVA 2JKAA 3AJXA 1GVYA 2V2HA 5BYWA 3SUVA 1VD6A 2FLIA 1JYXA 3BL3A 5E0KA 5FJOA 1M41A 3C2YA 3L4WA 3M43A 5DLCA 4NG3A 3PC0A 3BOLA 4F0RA 4O16A 3EX1A 3THUA 1GW1A 4EKJA 1KCKA 2VRQA 3QY8A 3FSUA 4E3VA 1AL7A 2WZHA 5U7SA 5A69A 3HQNA 2XINA 3G1XA 5KTLA 1K1DA 4UTMA 4QNWA 4XUGA 2XG9A 4IM4A 5XIMA 3G8RA 3NWRA 3PANA 3FJNA 3AOFA 5KITA 4F9JA 2DIJA 3BUVA 5HWNA 4MZ8A 2GLKA 1W5NA 5FI8A 1YW1A 4EMIA 5DT5A 2VQTA 4HK7A 1VJSA 4CQAA 2HE5A 4LUIA 1S5VA 3ABQA 3KZPA 4NIRA 2WJDA 1DXEA 2VGGA 4W7UA 1P6CA 4MJ4A 4POCA 4ZTYA 3DXIA 3GQYA 3HF3A 1FWWA 1LBMA 2GSHA 3HURA 1EO7A 4NNAA 4J3UA 5LXEA 3NO3A 8RUCA 4EOUA 4D6FA 2YPIA 5C9ZA 5C8BB 1TJRA 1LQ2A 3II1A 3BAKA 1QJWA 3UW6A 8CGTA 5AC4A 3O3RA 1KWGA 3DKLA 3IUHA 2OYLA 3LERA 5LYRA 2Z1XA 2JQXA 1V3JA 5CH9A 3U4AA 4UUIA 5FJTA 4DM1A 3PPFA 4XQ6A 1VFSA 3R13A 2F6UA 3URAA 3HGRA 2GVJA 4UTIA 4ZOCA 1Q1WA 1PKMA 1SSGA 2PLCA 2X1UA 1H49A 2R1KA 3OQ8A 1QDSA 1ZP3A 1BG9A 1JULA 3CHCA 3A3XA 3WUEA 2J9XA 2VGFA 3AIRA 4HMCA 4S3CA 1JF6A 5EMJA 1Z69A 3UJSA 5ENLA 3UXAA 1PV8A 1ZGDA 2PWFA 2VFDA 4H4RA 3G3DA 1GEQA 3LEPA 2QCGA 4HZ6A 4BR1A 3PP7A 4GCAA 2BHUA 4EANA 4PBEA 3GU9A 3HFTA 5G1YA 3TXZA 4J7RA 3W7JA 5CPOA 6ALDA 3QR0A 2ZCGA 3WLQA 1GZ1A 3S1UA 4MZYA 1A80A 1VB9A 3W01A 5FSEC 3OZPA 1H4PA 4GO8A 3EB3A 1PPIA 1VBRA 3STCA 1BVZA 1EHAA 2FYMA 6ENLA 3EZ4A 3CWOX 1E1CB 2FB3A 5BU6A 4WOQA 3M0LA 2KX9A 3AFBA 1T8QA 3VIFA 4C5YA 2HK1A 1TV5A 3KLKA 2BY0A 3SCQA 3T42A 3UJFA 4KKXA 3S1XA 4QDMA 2EBNA 7ENLA 3QGVA 2WHJA 1TA3A 4DJFA 1QI0A 4MB4A 3TZNA 2DP3A 2CLEA 1QOXA 4PH6A 1L6WA 2GUYA 1UASA 3GZAA 1R9ZA 3FK4A 3LG3A 3F2CA 2J6VA 2QUTA 4GI8A 3G5EA 1JDDA 5DN1A 3NVZB 4IH3A 3SY5A 4A2RA 3ITTA 2ZTKA 4K68A 1JRCA 5AYZA 2FGBA 1XH1A 4AF0A 1KFCA 4GYPC 2PGRA 2J7EA 2ISWA 3A13A 3LCIA 3MUXA 4P8WA 4BQ3A 2TRSA 4GXPA 4JN7A 4F0SA 3H23A 2V5JA 5IFPA 1UP3A 1FWNA 4P7QA 3BCJA 3DOPA 3STGA 1IIHA 2IQDA 3WD1A 1TWZA 3BAJA 4D8AA 4WKAA 4BI7A 4HA4A 2ISVA 3TYBA 3W7QA 2AL2A 4W7WA 4UTHA 1TPVA 2XH7A 4UCGA 4R7WA 3RNMA 2PP3A 1R30A 3GNNA 2O9RA 1GTEA 3ITLA 3PUOA 4B9YA 5CC5A 2NT0A 2GQWA 2FZNA 1WZAA 3RX2A 5LIXX 4XO6A 1XF0A 4QSFA 4H4XA 3RGTA 2WMIA 4JTTA 4E38A 4JS3A 1BF6A 3MU7A 4IX0A 4K8DA 5GNYA 2BP1A 4DB7A 4ZFCA 3L2IA 1H11A 2OVLA 2R1MA 1K02A 3W1RA 4JX5A 3TWAA 4GY1A 1K9FA 4FXJA 4REQB 2QAFA 5I02A 2W0UA 4L4OA 3BAYA 1H6VA 4B2DA 2FVKA 3WQ6A 1V03A 3WK0A 2OSXA 2WSRA 1US0A 4EACA 4I5UA 2DPEA 3KRUA 3R12A 1XLJA 2PDCA 3PUDA 2VC5A 6XIAA 6PTDA 3L4YA 5A6AA 5I6SA 2FTWA 3CAVA 4E5TA 4GNKB 3MW7A 3VI2A 1UUMA 4FOUA 2ISFA 1HTIA 3GVRA 3RF9A 2OZ3A 2GVYA 1Q6LA 2WOQA 3VNYA 2R1PA 4AUBA 1CXFA 1E6QM 3GD4A 2VM8A 2RJGA 3S5SA 4A8IA 1A47A 3APYA 2HBXA 4LS0A 2VZSA 3FS2A 4QS6A 5A1AA 1KCZA 1IWPA 5D33A 1G1YA 4Z2IA 4P7OA 1TQJA 3UWQA 1U1HA 3LGDA 2VCAA 2J9YA 1FFUC 3F7JA 5BW6A 4QLKA 3MPGA 2PDIA 1FWAC 3LB0A 1GVIA 3TW6A 3ABOA 3VILA 3M16A 3TSDA 5AKQA 1DKWA 5EBUA 4HP5A 1SO3A 5CPNA 3SEPA 2CHRA 5DMYA 4AIEA 4FR6A 3S5YA 4NYUA 2XWEA 3AXMA 3UY8A 4FLRA 1XUZA 3GH4A 1N7KA 3MCNA 3Q58A 3CASA 3S1VA 1KRAC 2OLAA 4E0CA 1YDNA 3A4XA 3W2UA 3WQDA 1OWQA 4IX2A 1DJWA 3QF0A 2D69A 1HF6A 4RZ5A 5C2XA 2WO5A 4ZQNA 5K9XA 4ZODA 4AD3A 4I6VA 2X16A 4V15A 1KXQA 1CXLA 4GD0A 3VO0A 1GRGA 4WRHA 2Z1VA 1XQKA 3PBUA 1TIMA 4E8CA 1GQKA 1S3HA 3M64A 1Q3NA 3AUJA 1S7MA 2P50A 4GUIA 3T0DA 4XD6A 1LQAA 3CUGA 4NXSA 3VK5A 1T96A 1GESA 1EF2A 3W4RA 4QEHA 1L6FA 2NV2A 1K8XA 4WDXA 1D9EA 3ARRA 4Q7NA 3C2FA 3GNXA 5CPQA 1YTKA 3LZ3A 5HUPA 4OZOA 4MY9A 3TSBA 3UF9A 1AOGA 1SZEA 3UCDA 3EDDA 4M1BA 2XDFA 3PWIA 3OVQA 3GM8A 2PFHA 4MLJA 2OEMA 4JTSA 3UWEA 4IL2A 4Q8TA 4PRTA 2PDQA 3N19B 3OEXA 2ZZ7A 2PGWA 1MW0A 2E5AA 3JU2A 4LH8A 2JALA 4DBSA 4UNLA 3GRTA 4DO5A 1XIEA 5CG7A 3TX9A 2CU0A 3O8AA 3MSDA 1E0UA 1VCGA 1UROA 3KWSA 2C3CA 1T6MA 1WB0A 1X39A 3B9NA 2VENA 4EPBC 2YCJA 3TAOA 3KUMA 1E6PA 3ZLFA 3MI3A 4HNNA 4AVFA 3E96A 3KDOA 1TWWA 4CVWA 1WBJA 3LA4A 2DH2A 2EJ1A 4JQ2A 4IMCA 1QFEA 4R3UA 4MWAB 1R7AA 1ZFJA 1WAUA 3PZNA 4XAGA 1WA3A 1E4LA 1R47A 2G96A 3P80A 4ZQRA 4DN1A 3U6WA 1CNVA 4ZO8A 2QUMA 1ALDA 4DJED 4GJJA 3MKVA 4UTJA 4S3JA 1UZ4A 1FA2A 4JYDA 1XDIA 1JFXA 3N2OA 2WC7A 3W1TA 4E3TA 4C6KA 3WK2A 4PZVA 2HS8A 3E2SA 2EJAA 3N15A 4B90A 1VCVA 1I2NA 4I8YA 1WKYA 2OWXA 1YADA 2XVPA 2FVMA 4GQ0A 3NQMA 1I0BA 2W6RA 3G2GA 4YHEA 3WNKA 3SJNA 2XFWA 5L9FA 1JVNA 3ITXA 1DQUA 4Z2GA 2YBVA 1GVSA 1WKDA 5A3HA 3C4UA 1ZALA 3BTNA 1F6KA 4V1XA 4YVVA 1E1CA 4EP8C 4JDBA 5CZTA 4MB5A 3QR1A 3UPMA 5AC8A 1M7PA 2ZRWA 4L4MA 3IPWA 1KA9F 3WQEA 1J0ZA 5G5GB 3E1F1 3GVQA 4KCUA 1KRBC 1B3YA 3L5LA 4C7GA 1ADSA 4C1NB 4GX8A 2WKJA 3G0UA 3QZAA 3H54A 4I5RA 1VFHA 2UY2A 3U3HA 2Q71A 1UWRA 1AL8A 1C8YA 5IRPA 1EYEA 4NYYA 4F0HA 7REQB 3EAOA 1T0OA 3AN1A 3LGEA 2ZWZA 1XHCA 2YA1A 1HJQA 1V3IA 2OU4A 1E15A 4HYVA 2XU2A 4EPKA 4TVDA 5I23A 3QKEA 1F8MA 1VRDA 3AIVA 1B57A 2E5DA 2VFEA 5TBOA 1LQ0A 4M3PA 2RJHA 1UH4A 1W31A 3LCXA 4IGNA 2X7WA 1QI2A 3NCOA 3W1AA 1CIUA 4H8HA 4B4HA 2GOUA 2WVSA 4IG2B 5A6LA 2PDYA 3H53A 1MO9A 3TROA 3KW3A 4KWSA 4PFHA 1EGVA 5HJLA 1EUNA 1W1ZA 1FWBC 4HMDA 1RY0A 4LGXA 4UFKA 3B8IA 1UWSA 3PG8A 3CYJA 1GOOA 3E0FA 4DLMA 2V3AA 3GBDA 1OF8A 2VX5A 1BGGA 1XWYA 3WSUA 3U2CA 3PHAA 3PZGA 4BF9A 1TRDA 4K6AA 3HO8A 1PKYA 3F1QA 4U10A 3WUFA 3T08A 1X1ZA 1SQ7A 1JPIA 4IPLA 2QEZA 1XCWA 3HG4A 2W63A 3B8DA 2R9RA 4YTTA 4ICMA 5T9CE 2CBUA 4HTYA 5FJIA 4JY9A 2DZUA 4FX8A 1H3GA 2V67A 3O7UA 3CUXA 4H4UA 5F7UA 3N9SA 5CEWA 4MF4A 3U8GA 4CEUC 1SW0A 3N29A 2J78A 4IXXA 2E77A 1XYAA 5A2BA 5JCNA 4JFUA 1J18A 1SZNA 3T0CA 5K4ZA 5IFTA 5HXMA 1O5QA 1QXLA 3SECA 3CUHA 1JNDA 2WP5A 5AC5A 3MI6A 5K2ZA 1SMAA 1A5KC 3FEMA 3UR8A 1RLCL 1Q13A 3R07C 3VE7A 3GTXA 3WD2A 1BTCA 4JXCA 3A23A 4WY0F 3T40A 1OK6A 5C70A 4M56A 2PDLA 2X8HA 1DPMA 3S9IA 3DX5A 1RV8A 4C6JA 2EPOA 2AAMA 2WCGA 3Q2DA 3FJLA 1XDLA 1NDWA 1XLKA 2A8XA 2ATSA 3A7UA 4HOZA 1FHLA 3R2GA 5HUOA 3AMGA 2X1SA 2DEPA 1W5PA 2QCNA 4UTKA 3IGHX 4C6NA 4GIAA 1TYPA 3T7VA 1NP2A 4KPRA 1JPKA 2W92A 3RK8A 2V8ZA 2JEQA 4PGLA 1UPPA 1B30A 3UXLA 4GUFA 3PJUA 3K1GA 4XZNX 4LYKA 3GB6A 2ISDA 1KBKA 1PO9A 3ATZA 1ZQ5A 4JTUA 1IEVA 3SIMA 3ZJ6A 5FS7A 3AMCA 2I5QA 5F1UA 4JKMA 3S2LA 1XD1A 2VEKA 1ZX9A 4H01A 2EKCA 1FWDC 1LBFA 2WBGA 1NELA 1W5OA 3OA5A 1TMHA 5G2IA 1I2QA 2XIBA 3KE0A 3MHUA 1CYGA 2PU1A 4PSRA 4PUWA 3TLQA 2PC8A 3RAOA 2XH4A 2QNEA 5I3IA 1M9HA 3L67A 4KCWA 4DXXA 1LTDA 4KWWA 3SFKA 1TFVA 3F5LA 4UTTC 5KETA 3SCSA 4JQAA 1SM9A 2ABAA 1UKTA 5DMNA 1BQGA 1Q8JA 2VCCA 3APGA 4IGSA 3RLVA 5DMLA 3W3OA 1V0NA 1IEXA 3NIYA 4HNTA 3H22A 2F61A 1JDEA 2X2YA 3BZJA 4Q6JA 2I57A 1A5BA 3O16A 4JIEA 4IIGA 5FS8A 4MY1A 1DWFM 4B5XA 3W27A 3U0HA 3N2CA 5G1TA 1GQNA 5RUBA 4PUMA 3N9RA 1QASA 4OJYA 3QY6A 2VR4A 1VIZA 3N34A 2ZUVA 3C8NA 1E4MM 3GSMA 2Q01A 4LF2A 1C93A 1DBTA 2E40A 1I8JA 5JCKA 1E4IA 4LAOA 3VD4A 3VIHA 1AD4A 1Z32X 4GI9A 3RITA 3PZMA 3ES8A 3BMWA 2QJJA 3P0WA 3WNNA 4LA1A 4ZB5A 1V97A 2ZADA 1PX4A 3TCSA 1MZRA 4FS9A 2J7BA 3V0TA 3R25A 2ZICA 3JS3A 3W6MA 5CZ0A 3EANA 4V27A 2V30A 3U7VA 1KM0A 3GRIA 3VGDA 3IJ8A 1W3NA 3W1XA 1PS9A 4PTDA 1UZ1A 4PEEA 1VENA 3EXSA 2Y7FA 4J57A 2P88A 4EF9A 1Y5VA 1BAGA 1RPXA 4P2VA 3NA8A 5BOOA 2E5CA 1OCBA 2VC7A 3DH7A 5E6ZA 2PDWA 4LF1A 2E9LA 3VGBA 5A95A 1KLYA 4GBDA 3M7WA 2H90A 4ZQOA 2IKJA 3F5KA 3WLRA 5A6BA 1SJBA 1IEQA 2ZA1A 3UG3A 4Z42C 4J1OA 1G7VA 3BG9A 3UGVA 3TDFA 4MY8A 1QMLA 1F07A 1WXZA 3VIJA 4DJDC 3QV6A 3GC4A 5I07A 2FB2A 3PN8A 2ZUTA 1R9XA 4NASA 2PWHA 3G1FA 1V79A 2I17A 2XM1A 1C8QA 2HE8A 3R43A 1EDGA 3I6RA 4D71A 3IIPA 2QGHA 3IANA 1M01A 4IZGA 4RDYA 4DBDA 3RCNA 3MMTA 1HJWA 1V0MA 2AKZA 2FQIA 4KRZA 4LOCA 4QJ1A 2HVMA 1U5VA 1YDVA 1MDRA 2ACRA 4HA0A 3WNMA 2ZTJA 3OGSA 2WAGA 4R5EA 4HU0A 4ZQPA 4DUOA 3MZNA 5IM51 4C1NA 4NVTA 3VXGA 1XISA 4RW3A 1EPXA 4W8LA 3WZ0E 4B16A 2OO6A 5FEZA 1FQ0A 3IC9A 1PEZA 1CGTA 4IIBA 4FO4A 5I3JA 1TV2A 1E9IA 4YLWA 3DBPA 2QDDA 1VEMA 3B06A 1PKLA 3A12A 4US6A 1GNXA 3XISA 2HPMA 4EQWA 1RHCA 7REQA 1TPFA 1IXQA 4GJ1A 2NQ5A 2FMNA 4PC8A 1E3ZA 3VOIA 4FZIA 3VYLA 3T6CA 3WQ4A 3NQCA 2OO0A 4GFIA 5D9PA 4D6IA 3I3BA 4CUCA 4IICA 5A8MA 3S1GA 3VDBA 1TX2A 2VR2A 1TMQA 3S6OA 1IV8A 1OCNA 1Q7ZA 3SQMA 3DESA 2J24A 4WD0A 3NRZB 2YZRA 1H5VA 3GY1A 4UR7A 1UZHA 2R24A 5IHSA 2YCEA 4D2JA 4IQEA 4YWIA 3M9YA 2OB3A 1SZFA 1XKYA 1UBPC 4LVAA 4YTSA 3SCNA 4KPLA 1V08A 2WSPA 2JKEA 1C92A 1NEYA 3K5XA 4L56A 3O07A 3H2AA 5CPSA 1AW5A 3A22A 5ECVA 4GWEA 4DYEA 4P5UA 1OZMA 2DT1A 4LEQA 4J3ZA 1BVNP 1UR1A 2QMKA 5GJNA 1BKHA 3ONCA 1R3SA 3O2LA 2DSWA 4DAIA 2CZFA 1I1XA 4LIIA 4O50A 2PF8A 3GH5A 3WD0A 4KF1A 5A6MA 2VURA 3SDOA 2I9EA 3DERA 3LTYA 1YXCA 2XM2A 1L0PA 1ZB5A 2DZBA 4HK6A 5T91A 3VVGA 2WMJA 4IFKA 4HCHA 4F2BA 4ATWA 4ZO7A 2EQ6A 3F4WA 4LY4A 3S0CA 1GVRA 3UGRA 5EMKA 3GK0A 4JNZA 5F2GA 4PMYA 1RALA 3H7VA 4G7FA 1UC4A 2EQ9A 5I3HA 1W3TA 4LRTA 5EBKA 5EMLA 5FMHA 4WZHA 3E12A 3SCUA 4BURA 4A4AA 2F38A 4IGHA 3C6CA 3WDJA 4DY1A 3UPWA 5LA1A 4RXGA 4OV4A 4JKKA 2OYMA 4WSJA 4IMGA 1M7JA 3OBEA 1BYCA 5DX7A 2HNEA 1W8SA 4HNCA 4LUYA 4WY0B 3TYDA 2YGYA 3L65A 1E73M 4IIFA 5FSDC 3N25A 2RFGA 1H09A 1FHUA 3DUGA 4H1ZA 5KSWA 3MP3A 3XINA 5M3WA 2HRWA 4PUNA 1YIXA 5CXPA 2NQZA 2RDXA 2FPVA 3VIGA 3H2MA 1PIGA 2OOGA 4B91A 2CLMA 2DUZA 4L4LA 3CV2A 2QS8A 4AWSA 2W3RA 3WKZA 2RHGA 1E0TA 2YCKX 4JD4A 3NOYA 4A3YA 1K9DA 3GWQA 1QNOA 4UXDA 3UA3A 3NDOA 3NQFA 2E9MA 4L5ZA 3WJXA 4K8GA 1XQLA 5ABHA 2QIWA 5C5YA 3OZYA 3POCA 3UG4A 3ZSTA 3QHMA 2WPBA 3ARWA 5AYBA 2V3GA 3TA6A 5F2LA 1O66A 1TSIA 1XSIA 4H6KA 1IHIA 1VBUA 2W66A 3UZ5A 3LHTA 4BWLC 3CV6A 3BE7A 2V2DA 3TC3A 2E5BA 1TPDA 4AHOA 2DZWA 1W9XA 4AWTA 3UZYA 4J3VA 1RY8A 3W7OA 5G1MA 4DVOA 2DW6A 3CQKA 3LUTA 2EHHA 3L4XA 4EE9A 3QVQA 2WLZA 3U5UA 4WKHA 4X9YA 2AAAA 1SO5A 4JTAA 5G4EA 3UZZA 2AMXA 3FGCB 1SZGA 4HNUA 1THFD 1EB3A 1JCMP 2RH9A 4QM1A 5D4YA 5CBJA 5FAGA 4N4QA 3TQ0A 5REQB 3H26A 2I7GA 5DY2A 4NAFB 2OXNA 1K7XA 1XIFA 3OYXA 3SIZA 3WJYA 3UA4A 1TPWA 1W37A 2PU0A 3B03A 3WQPA 4DO7A 4AX6A 1YNQA 1N63C 1JOAA 1TV8A 1NAL1 3G8EA 4ZENA 1MSSA 1B3OA 3PZOA 4JEQA 2E1WA 4EXAA 3NVYB 2Y0FA 1H0IA 3F2BA 1V0KA 1XBZA 4S3DA 3AMZA 2W55A 5LGZA 3MC5A 2NX3A 3CZEA 2CZ5A 2AGTA 2XFFA 2V69A 3IVUA 3QQWA 4JKLA 5ECUA 1OG6A 4HYWA 2OGJA 3WYZA 2BXYA 3B4UA 3ARTA 3R94A 5DT7A 2VUNA 3CTTA 3R11A 1OGGA 3G1AA 3REQA 5AYXA 4C1LA 2R94A 3F4DA 7TAAA 2F7FA 2FJKA 4PUUA 3IARA 4L64A 2E8YA 3QYQA 3H4GA 2DDXA 3AZRA 4GMEA 3CWNA 1YXYA 4H4YA 5LIUX 4JTGA 2VDHA 2P5NA 1LJYA 3MUY1 3G3MA 1TVPA 1X1NA 4GUHA 2CHOA 4FMVA 3A4WA 4F40A 4MOZA 3ANUA 3PZVA 3ZLHA 2V63A 4B15A 4MB1A 2Y62A 3UT0A 4EMWA 4XSLA 3JUGA 3BCFA 1C7SA 3LN3A 3W1QA 4IWWA 1PE1A 1XLEA 1EBDA 3QPZA 2NWRA 1E40A 3B40A 3C2VA 3L0NA 4JPGA 2IKHA 1K8CA 3NUKA 4Q6XA 2C19A 2EAWA 2QVHA 3WQWA 4H4QA 4BF7A 4NT0A 4UWMA 2W61A 4M81A 4EM4A 1YPFA 2FZ8A 3RFAA 5AZ0A 1TG7A 5DO8A 5E70A 1UBSA 2CESA 2HWGA 1T99A 3DECA 1O5RA 4ACZA 1BLIA 3TIMA 3WELA 2IXUA 3MP4A 1IIGA 4WKFA 5CG0A 7ODCA 2HTMA 1MFUA 3WUGA 1EIXA 4J3SA 4N6FA 1TYTA 1Q7MA 4DWSB 3U4FA 5I7GA 3SY1A 3ZIZA 2A3CA 3MA8A 3OTRA 4Y9MA 2E28A 3RPDA 4IMDA 5C7VA 5KZDA 3O63A 3FYYA 3QRHA 4QXIA 4DBWA 2PTZA 3QZEA 3RN6A 1KCXA 1H41A 1PHQA 1LDCA 2IPJA 2QPUA 3LQGA 1FDZA 1KRMA 1TYGA 3RMEA 1NWTA 2D2OA 2YCLB 1NOUA 5LXXA 3A5VA 1VPYA 5C7HA 4OBSA 1LYXA 1AFSA 2FJUB 1ZJBA 4Z08A 4KFNA 1Y8BA 1L8NA 1P7TA 3EDEA 3USBA 2DFAA 3CEPA 3HQPA 4NAEB 3C5QA 2X05A 4GNVA 5F2IA 2NVAA 1C3FA 4ONVA 4YN5A 4C6MA 5HR7A 4IUOA 1IXNA 4ZSUA 4PSPA 4BHYA 4L9YA 4NHVA 4I9JA 1QNSA 3DI0A 3S2MA 1GWJA 1LROA 3HPFA 1T41A 3WLKX 5DCEA 1A5OC 5AB3A 2YW3A 3TR2A 3CGEA 4LEFA 3NPUA 2INEA 3EKLA 1AQ0A 3UEQA 2E68A 4UMAA 3W6LA 4U5KA 4PMXA 3QMSA 5MKGB 1EZ2A 1XFCA 3ISIX 2DSUA 2C8NA 2CFYA 3CNYA 2TYSA 4AZGA 4LY8A 1ODUA 3U5YA 1GSNA 1QNRA 3COTA 3ELFA 2HXUA 1GJPA 3DGBA 3H8AA 2BSLA 4C6DA 4L1XA 2V3FA 3VX1A 2GFTA 3SW6A 3ARYA 2WQPA 3QMTA 4AEOA 2RABA 5AOUA 4ZB2A 2OEJA 1A0EA 4RZ4A 4UQDA 4TO8A 2HJPA 3TYAA 2B7PA 1OCJA 1GREA 1JRPA 4YHGA 3GHUA 1MUCA 2GGHA 4UNKA 2WNWA 4LWWA 3W07A 1P43A 2E8ZA 3DHUA 4DZAA 2XGBA 1EGZA 1HUVA 4IPJA 1FHDA 1I9CB 1QW9A 4XKMA 1MRQA 1QI4A 1NDVA 3VNJA 1VR6A 2J27A 4UTTA 2BASA 1RVKA 3GD3A 2G95A 4FNSA 5A6KA 4I9TA 3IIVA 4GACA 1EDTA 3DYPA 3MCOA 3PUEA 4I6KA 3G0XA 4NI8A 4LJ3A 3W7CA 1YLVA 3QOKA 2A1YA 1CXKA 3AHZA 1JUEA 2E3ZA 5AVNA 1ZAIA 3EWCA 3STEA 3G22A 2ZX8A 4S3KA 1N55A 5HMDA 3W71A 4A2SA 2XSXA 2A3LA 1X8CA 3B3DA 2R82A 4H2CA 2ACQA 1NH6A 2GSJA 5KVIA 3K4WA 3WQ8A 4MLRA 1UIOA 5AYYA 4KRTA 2P3ZA 2ZIDA 1DOSA 3TFCA 4UC5A 4HHMA 4TVYA 3LSBA 3KRZA 3FGCA 3S4TA 2G3NA 1GVEA 4BV6A 3WBYA 4HZ7A 3QFWA 4CNPA 2BVDA 1LLOA 1VCFA 2PTXA 2ZZCA 3GXNA 5AC6A 3KAOA 3ZWTA 4GY0A 1HL2A 3OIHA 4FLSA 3DH9A 1VP5A 4APNA 2PDGA 2YCIX 1ZZMA 1F76A 3HN3A 4L65A 3HQOA 4TX8A 2YDSA 3WF2A 3QXBA 1KKRA 1UH3A 4NQ1A 1DJIA 1OX4B 3WFLA 2XN2A 4NZ3A 4JCMA 1PDZA 4WGHA 3KHJA 3VPLA 5LNSA 1ISVA 3BG5A 2ZVRA 1XV8A 1CB2A 2PRMA 1W3HA 3VOGA 1KFWA 1E6SM 4DZIA 3CM4A 3CXBA 3B0XA 1FWRA 4DXKA 1ZUAX 2QCDB 3FVDA 3D47A 3CLMA 3EX3A 3AYSA 1MQQA 3NOEA 1JEZA 2OCZA 3RX3A 5DBUA 3VNZA 4HD5A 2AAQA 1QPQA 1E6ZA 1I4NA 3M5ZA 1QHOA 1JEHA 1MVYA 1MMFA 3GW3A 5EFFA 4DJDA 3ICJA 3HB9A 1SO4A 4QG6A 4ROPA 1NFGA 3DYOA 5D09A 2GRTA 4CCCA 2FVLA 1W3IA 2AQOA 3PZ9A 1OFQA 3WQOA 3KCJA 3NQVA 5E09A 3EDJA 3QGKC 3H6OA 5C9UA 2QAPA 3OBAA 3EYPA 1P0NA 1XGZA 1DNCA 2Y5EA 4FIQA 3KOFA 5FAJA 5DF0A 4XAZA 3IS4A 2BLEA 2PCEA 1CTNA 1S5MA 4B5UA 4R7OA 4PL2A 1XLHA 2D3NA 1KFEA 4GPNA 1WOBA 3VDCA 3GYEA 2XSAA 1F6PA 3W83A 5EU9A 4MVAA 4FLQA 3CT2A 4LBRA 4W8BA 4YL2A 2QMJA 2FPYA 1VDVA 2ADAA 4BQ5A 2RGMA 4N4PA 3RM8A 3MMWA 3L5MA 1XPGA 4D8ZA 5AHMA 1TZ9A 1VC4A 2XIQA 2DJXA 2WQDA 3C0SA 4I3GA 3PFMA 3BW3A 2A79A 4JY8A 2PGEA 2VL4A 4QISA 2F2KA 3TN5A 4PYSA 3GAKA 3NS1B 1C9WA 3AIWA 3HJZA 1CWYA 1V3MA 2O9PA 2UY4A 2F2HA 2YXGA 2GR0A 5AHEA 2CKSA 4JNYA 4UMCA 5D37A 2J7GA 1JPMA 1LP6A 1OGBA 2F5ZA 2VVNA 1SJDA 3NXFA 4G56A 4XAFA 5BNKA 3P74A 4WJ8A 1OF6A 2Y88A 1GOMA 1ONFA 2ZX7A 1R38A 2PDPA 4OGZA 4TVUA 4PRWA 4QDPA 1ITCA 2J4GA 2YCLA 1XGEA 3URBA 5HAOA 3P14A 2WYSA 4XZBA 2YQUA 1RLDA 2D2GA 2ZX5A 3BH4A 5PTDA 1NVMA 4JX4A 3C86A 2HXTA 1RBLA 1JR1A 1W32A 4K3ZA 3IJ7A 1E51A 4NAEA 1MNSA 2W67A 3QKZA 3BCDA 4FNPA 1E6RA 5D32A 2J13A 5L6UA 3WH6A 1QW8A 1XL9A 2BOEX 4MDPA 5FS6A 1XICA 5DFAA 3M5YA 2E3TA 3P60A 4J3XA 1TX0A 1OC6A 2FGZA 1UIPA 3BGAA 4RW5A 2YA0A 3EAUA 3AMDA 2DT0A 5EMUA 2WNZA 1JGMA 3WLJA 3LCWA 4HK5A 4ZTXA 5AC7A 5CSRA 1OIMA 5T26A 2XIOA 5J5RA 2GH5A 4US5D 3UJRA 4Z2LA 2C16A 3F4NA 3UWVA 5MKGA 3DK9A 3VKJA 2V5CA 1K4HA 3AALA 2CWNA 2D0FA 3BLEA 1PL9A 3A9IA 2R1NA 3M0XA 4Q7IA 4PN2A 1EP2A 4QE4A 1WE5A 4UTFA 4NUWA 2WV8A 3ZVHA 3B05A 3LMZA 3NTYA 3VOHA 3CXOA 4S3BA 4UFJA 1V0LA 4ORMA 5BCAA 4H8NA 1D7KA 2C3ZA 2PE4A 1MWOA 4EX4A 1QI5A 1DJYA 2BBFA 1AH0A 4CQCA 4EAMA 4YYFA 3CHFA 5H8MA 2CZDA 3UWYA 3SCTA 4JTIA 1M68A 3ES7A 5TD4A 2FHBA 1X38A 3WLSA 5KVHA 1AVAA 1TVNA 3KOYA 2NX9A 3DG3A 3LQLA 3H2FA 3LNMA 4UB9A 1G0CA 3W1PA 4HHHA 3ARPA 1DJHA 3VD9A 5BXSA 1OFEA 3B0PA 4LUSB 1GHSA 2P76A 4E2OA 2VELA 4BWLA 4R9XA 4ADUA 4ALDA 1M53A 4YNGA 2YXOA 3CIVA 3KS6A 2PWEA 3CGBA 4LS1A 3MO7A 3H70A 2A3AA 4AIOA 3NDYA 3W1NA 3W9ZA 1YTDA 3IVTA 2ZUMA 4ZE5A 4F4RA 1SSDA 5I00A 5DEZA 1QPNA 2I9UA 3B4YA 4C5ZA 1FWJC 1Z89A 3URHA 5CGTA 4H8UA 4LUJA 4LAUA 3MUAA 3GR8A 1UCWA 3UYCA 2J7CA 2JK2A 2ZXDA 1XLMA 4JTHA 1XSKA 4JL1A 4YCOA 3VGHA 4EVZA 1OSEA 1H62A 3EKZA 4H4WA 3HG5A 4IIHA 3W2LA 3TH6A 4B5TA 2CEQA 3V4BA 3TK7A 3AHVA 2X40A 1KTCA 2PF0A 3ZFHA 2NV1A 1OY0A 4E2VA 3N13A 1A3HA 2GJPA 5I2UA 1VYRA 1WDWA 4E8DA 2VC6A 3N2MA 1B5TA 2QGYA 1HFBA 1O94A 3I4KA 1J5SA 1A0DA 1NOWA 1KV8A 4GY7A 4M8UA 3KOWA 4C6QA 3GDKA 4A3HA 1BWKA 1S5NA 1AJ2A 2PRHA 4MZ1A 3W26A 5DRCA 1DJXA 2AQVA 1Q4WA 3GU2A 3S6TA 4KFPA 3WD3A 4XAYA 4KFOA 3D6NA 3TE9A 4HZ8A 1UKSA 4J4KA 1ISYA 1AK5A 1OK4A 1DIKA 4CU7A 1POJA 3BARA 3M46A 1I6NA 1W2VA 3C0QA 3GFYA 2BZNA 4AMAA 4WF7A 2FIQA 4KWUA 5CJMA 4JDRA 4MDOA 3A7AA 3RM4A 4CN6A 3LHZA 4O0KA 2OKTA 1G6CA 3VIPA 2DJLA 3SQSA 2QJMA 3AC0A 3W70A 5KEZA 2WZTA 2BVYA 2CLLA 1LUCA 3A3WA 4LRSA 3KTSA 2CYGA 2FZBA 3UR7A 1HL9A 1TKKA 1VFFA 2ZBTA 4JX6A 4PR4A 4TIMA 1V51A 2Y70A 3FCPA 1HVQA 2VX7A 2Z1KA 4Z1AA 2I16A 3WCZA 2QKFA 1GERA 3BGGA 1OYBA 2DZSA 2WBAA 2RDUA 3E3HA 1P1MA 4QX4A 1JXJA 2ESCA 1R87A 2A3BA 4E4PA 2DVTA 1A0CA 2V82A 3N1AA 2PTYA 4FDCB 1HVXA 1S38A 1VAHA 1DJQA 4OTKA 3GTFA 3E74A 1J4EA 3N18A 4FXFA 1PTAA 3G77A 1S2UA 3M4HA 3CLWA 1RA0A 2J74A 1ME8A 4Q33A 3WLNA 4OUEA 3I6TA 2VJXA 1AW2A 2OKOA 2JEPA 4N02A 3NNTA 1LLZA 4MFEA 3WNLA 2Z26A 4FNRA 1LORA 2VZVA 3TFXA 4F3HA 2GJXA 3MUIA 2Y7DA 3GTIA 3NEHA 3EMZA 3TTEA 3WL1A 3AYVA 1K4QA 1OGSA 5KZ6A 1RXOB 3VZYA 4X0VA 4I90A 2GR2A 2WKGA 1J0YA 3AISA 4FEZA 3M07A 4DUXA 5JRBA 4K8EA 3EXRA 3O1NA 3MMUA 1DEDA 3IIOA 4IMAA 4XTIA 2CW6A 5T8GA 4FA3A 3EA2A 3PBWA 3G1YA 3K30A 4GQQA 5E0CA 4PBFA 1UJQA 1LOSA 4ES4A 3L66A 3S3GA 4NEWA 3N12A 5A8NA 4UQBA 2QJHA 1UC5A 3K4AA 3AHTA 2JBMA 1F3EA 1NIUA 1ISZA 4QG8A 2VD9A 4IXHA 3S5OA 5LGXA 1HKVA 3H2OA 4GFSA 3A21A 2DZAA 3GIQA 2Y7EA 4PTXA 4DF2A 5BXTA 2G3MA 4PULA 1QAPA 4PFMA 4JTJA 4JFWA 4DF1A 3I7SA 2E6DA 3SCRA 4J35A 4LC8A 1BZLA 3DGZA 1F4AA 1F3PA 3RR1A 4P8XA 1JYWA 3LU2A 4WVXA 1KW1A 2FZMA 4MYAA 5J5DA 1O1HA 3PZQA 1TZ7A 1TJ2A 1JIBA 3BXWA 4KEVA 5J04A 1QK2A 4GNJA 1DJZA 4DRSA 4EAYA 3S9YA 1XIBA 4FALA 1UKOA 4JNMA 3H4KA 4PA8A 3RPTA 4YTUA 2JIWA 1ENUA 5K4XA 2YDQA 4NJJA 4Q8PA 4RNFA 2F9RA 2X8CA 1X96A 2OJPA 2Z4GA 1K4GA 4CKQA 3P2VA 4I8DA 4AZIA 4QSHA 4EM3A 4CCZA 1PZ0A 1STZA 1LM1A 3CYVA 4HU4A 3G1HA 4FSAA 4C6CA 1D8CA 2PA6A 4L6DA 4MTVA 3JZEA 3M0ZA 1NPXA 3W7NA 3CS2A 1GJWA 4UZUA 4MKNA 2PB1A 4Z2HA 3W02A 3ZLGA 1S46A 1IZKA 1UR8A 4GR1A 4JTFA 1ZRQA 3IV8A 3PBMA 5B80A 1ZTVA 3S46A 4F8XA 2INZA 4JQ1A 4KWVA 2H3DA 3THDA 4MFDA 4S23A 2JGYA 5M2FX 4DLFA 2YFNA 1OJXA 1E5NA 1W9PA 1I0DA 3QBUA 1IZJA 4IP4A 3UCCA 3C2OA 4DWDA 1Q6CA 1N2VA 3STFA 3NQDA 3EX2A 4GLEA 1W91A 4AF0B 4XZIA 1R8LA 2ZWYA 3JRKA 2FFIA 1QWKA 1GORA 5AHLA 3P67A 1XP3A 2QR6A 1PKNA 1D3GA 1TUXA 3SZ8A 1R0MA 2YL5A 4LUSA 3WH5A 1XIMA 1CB7B 4W8AA 3EPOA 1EA0A 1NHPA 2AL2B 2WZMA 3V18A 2XIMA 3TN4A 1G94A 3NO1A 2Z7KA 3TTOA 1E1EA 3SRHA 3AROA 3INPA 1X7FA 5D38A 1TWSA 1EJVC 3LLFA 3WBXA 4FOJA 5K9CA 1J0KA 4GOAA 1UJPA 2E1DA 3UYIA 1QBAA 3IIZA 2CETA 1OFRA 3KM8A 3N73A 1X1OA 3AIEA 2V6AA 2Y8UA 2QULA 1A4LA 4ZOEA 1EJUC 5M1TA 3NQ6A 3KBMA 3T0TA 4DPQA 1QNQA 3V35A 2ZVIA 2PPGA 3TYUA 3MDUA 4TQTA 1BXCA 1TO3A 2PRLA 3KXQA 1AW1A 4E8GA 2Z2AA 3FN9A 3OG3A 3OHIA 1ZSXA 4IFRA 2VOMA 3QW3A 2VUYA 2OYKA 3LADA 3TYZA 1B3VA 1M65A 4ZXLA 2OTDA 2YJQA 2VC9A 3FA4A 4JIRA 1IZCA 4PMQA 2CCRA 2BS9A 3SGGA 4M80A 1JAKA