1WUEA

Crystal structure of protein gi:29375081, unknown member of enolase superfamily from enterococcus faecalis v583
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
370
structure length
370
Chain Sequence
GSHMNIQSIETYQVRLPLKTPFVTSYGRLEEKAFDLFVITDEQGNQGFGELVAFEQPDYVQETLVTERFIIQQHLIPLLLTEAIEQPQEVSTIFEEVKGHWMGKAALETAIWDLYAKRQQKSLTEFFGPTRRKIPVGISLGIQEDLPQLLKQVQLAVEKGYQRVKLKIRPGYDVEPVALIRQHFPNLPLMVDANSAYTLADLPQLQRLDHYQLAMIEQPFAADDFLDHAQLQRELKTRICLDENIRSLKDCQVALALGSCRSINLKIPRVGGIHEALKIAAFCQENDLLVWLGGMFESGVGRALNLQFASQPTFSFPGDISATERYFYEDIITEPFILEQGTMTVPQGLGIGVTLSQTNLLKYSQYQKIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords mandelate racemase/muconate lactonizing enzyme family protei
publication title Loss of quaternary structure is associated with rapid sequence divergence in the OSBS family
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 120
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1wueA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1wueA01
3DDMA 4GISA 2XSXA 2XH4A 3MZNA 4GMEA 3TJ4A 4GYPA 2ZC8A 3H12A 4DHGA 2DW6A 3Q45A 2PA6A 3BSMA 2PGWA 4GGBA 4Z17A 1BQGA 4IL0A 4IT1A 3UJRA 2AL2B 4F4RA 1MNSA 3OW1A 3IJIA 3NFUA 3H7VA 3R10A 4HNCA 3CT2A 3V3WA 3UGVA 3CXOA 3U4FA 3CYJA 2POZA 2QGYA 3RGTA 4HYRA 1JCTA 4IL2A 3SN0A 1EC9A 4KPLA 3P3BA 3EEZA 3UXLA 2QDDA 3SSZA 2PTXA 3HPFA 2PGEA 2ONEA 2OQHA 2PSNA 5J04A 3QKEA 1EC8A 3CB3A 2OG9A 3MKCA 4HN8A 4Z1YA 3PFRA 5BOFA 2AKMA 3D47A 3RO6A 3UJ2A 3R1ZA 2ZADA 1SJAA 3B97A 3SN4A 1L8PA 4KT2A 4HCLA 1PDZA 4H19A 2AL1A 1R6WA 4JHMA 2GGGA 2OPJA 3P93A 1IYXA 2OX4A 4FI4A 1KKOA 4HCDA 4M0XA 1P48A 2PTWA 4KWSA 3OTRA 2PP0A 3RCYA 3IJQA 3N6HA 4HPNA 2QDEA 6ENLA 1PDYA 2OZTA 4ROPA 3TQPA 4E4FA 3SN1A 1KCZA 3MUCA 1RVKA 1F9CA 3FJ4A 2PCEA 4H2HA 5FJRA 4A3RA 3R11A 2OZ8A 3ZVHB 2RDXA 4HCHA 3MSYA 2MNRA 2PTZA 4G8TA 3UXKA 4K1WA 3UCDA 2PP1A 3P0WA 4A35A 2QJMA 3DGBA 2GGJA 3PK7A 5EU9A 3IK4A 3DEQA 1SJDA 3BJSA 2HZGA 2XH7A 1JPDX 1FHVA 1ELSA 2OQYA 2P3ZA 3ZLGA 3I4KA 2AKZA 2I5QA 3CAWA 1MRAA 1ECQA 2AL2A 3VDGA 2OLAA 2PU0A 1TE6A 3VCCA 5IDZA 4KEMA 3T9PA 3DIPA 3QLDA 1WUEA 3OZYA 2XH0A 4J1OA 2P8CA 3EKGA 3VA8A 2HXTA 2PU1A 4DWDA 2XGZA 4H83A 1TZZA 4GYPC 3DG3A 3DG7A 3THUA 3RITA 1MUCA 1ONEA 3QN3A 3S5SA 2GDQA 2NQLA 2QVHA 2XH2A 3BOXA 1W6TA 3D46A 3GD6A 3SBFA 2QJNA 4MGGA 2GL5A 3PWIA 3NO1A 2O56A 1TKKA 3DFHA 3ZVIA 3N6JA 3U9IA 4K2SA 3N4FA 3TCSA 3K1GA 1E9IA 4DYEA 2P88A 3ES8A 4DX3A 2FKPA 1EBGA 3FCPA 3QPEA 2PPGA 3MQTA 4JN8A 1NELA 3SQSA 3T4WA 2GSHA 2GGHA 4ZA0A 4MMWA 5ENLA 2DW7A 4E4UA 4E6MA 2OVLA 1WUFA 1XPYA 3GO2A 5FJTA 4IP5A 1P43A 3N4EA 4G7FA 3TJIA 3DESA 3VC5A 4EWJA 3I6TA 4E5TA 3TWBA 3FYYA 2OKTA 3I6EA 3ENLA 3ZVHA 3CK5A 3FXGA 3DFYA 4GIRA 2GGIA 4IHCA 3DG6A 2OFJA 3RR1A 3H8AA 1R0MA 2QQ6A 3MWCA 3T6CA 3Q4DA 3V5CA 2PTYA 4DXKA 3OPSA 1SJBA 3RRAA 3IJLA 4ZCWA 3ZLHA 3OP2A 3JVAA 3OZMA 3S47A 3V4BA 3UJSA 1XS2A 2CHRA 1FHUA 2GGEA 4GGHA 2PMQA 2QJJA 2PP3A 4DN1A 4E8GA 3FVDA 3STPA 1NU5A 3T8QA 1BKHA 3V5FA 3ZLFA 4IZGA 3QTPA 4JN7A 3GY1A 3R0UA 3UCCA 1JPMA 4M6UA 4GFIA 4HNLA 1MDRA 3NXLA 4YWSA 2HXUA 4X2PA 3GC2A 3VC6A 5FJUA 3NZGA 2PODA 3TW9A 4MKSA 5BOEA 3R25A 3JZUA 1KD0A 1DTNA 3UJEA 3ES7A 3R0KA 3VCNA 4H1ZA 3VFCA 7ENLA 1EBHA 1YEYA 4ENLA 2HNEA 3PWGA 5FJPA 3FV9A 4A6GA 1JDFA 1SJCA 1MDLA 3TOYA 3TTEA 4J3ZA 3DERA 3H70A 3KUMA 4FP1A 5FJOA 1KKRA 3TWAA 2OZ3A 1OEPA 3MY9A 4K8GA 2P8BA 3SJNA 2FYMA 2MUCA 3JW7A 2P0IA 3UJFA 1EC7A 2OO6A 4IP4A 2PS2A
chains in the Genus database with same CATH superfamily
4V1XA 4DJEC 5F2IA 3UERA 2VX7A 2W0HA 5D03A 5BZAA 3MBDA 4J27A 3TAKA 3LD5A 3Q37A 4KPRA 4Z17A 4LBRA 1RA5A 4US6A 1TPUA 2DSZA 4M24A 3EGJA 4XWUA 4GXPA 3CPRA 3NFUA 3OQ8A 1CXEA 5E0FA 1FFQA 2BX7A 1X7IA 2Z25A 2VC6A 1TTJA 4RZBA 4ICCX 4FIRA 2GSEA 3KBWA 1B54A 2YL8A 1OYAA 4EPBC 5HR7A 2FZMA 1KLZA 5ABFB 4FLSA 3WK0A 4NEWA 1B0IA 2BOEX 3RGTA 1IV8A 1HT6A 1R38A 2DSVA 3O16A 2NVDA 2VGIA 4EM3A 4MUPA 2DVUA 4WSKA 1GREA 3PZIA 1XRTA 2PFHA 2FJKA 5EY5A 1V5XA 3H7UA 2PGEA 1K6AA 4Q7NA 5AC5A 3WUGA 1E1CA 3GKFA 4XSMA 1G67A 3MKCA 2YSWA 3N3TA 1RQBA 3AROA 1GOIA 4LC6A 1I75A 4RPQA 4U2YA 1GK8A 2VEGA 4BQ4A 3L2IA 1KQYA 1TCDA 1XBVA 3TN3A 3GTNA 3P93A 3WX7A 2W3ZA 3AAMA 4I8DA 3GXMA 3TTSA 4ZQRA 2DZVA 1GVRA 4C6PA 4H4YA 3GFYA 9XIMA 2JGYA 1NJJA 4TTGA 2OZTA 1ESWA 4QG8A 1PEZA 2Z1SA 3ICJA 1P6WA 3O6DA 5IBXC 3N9KA 1SSGA 4F8XA 1T40A 3UPMA 4UFLA 4A3RA 1PZ1A 2VX4A 1B3OA 4OU1A 4HCHA 3KOXA 3HBLA 1G94A 3SW6A 3THDA 1JZ5A 4YVPA 3P0WA 4DVOA 4IQDA 3TIMA 3ZFHA 3WG6A 1RCOB 3GBEA 3QR3A 3NL5A 5FACA 1R3SA 8XIMA 3IWPA 4XD6A 3ARUA 3BW2A 1T99A 3OVQA 4B5VA 3ARSA 4RLIA 3V0SA 4JTUA 2Z1WA 3ARXA 2DZBA 1VZWA 1JCLA 1XYFA 1TPWA 3SUSA 5M2FX 5A8GA 3B0VC 3CZLA 2QAFA 1WAWA 1W0MA 3ARZA 2VTFA 3ZJ6A 3W1LA 1KBLA 3O0FA 4UWMA 2XIJA 3W24A 1PV8A 5EMYA 1TWIA 4GYPC 4RW5A 3TUUA 1EP3A 3DG3A 4YTUA 3U48A 2VFFA 1GG1A 1FCUA 1NWSA 4HGXA 3CZJA 3E96A 3WBYA 4TVCA 4HHLA 1TA3A 2A3BA 2Y2WA 4UR8A 3L5OA 1OX6A 2GL5A 1QR7A 3RHGA 3ZYZA 3LV6A 3VKAA 3DFHA 4H9ZA 3O2LA 1ISWA 1NTHA 3GHSA 1E5JA 3IGUA 3GVGA 3VZYA 5I24A 1BFNA 5LNRA 3RR4A 3UZWA 1B4KA 3PG8A 1HJWA 4DYEA 4QXIA 4AVNA 4NNBA 3RJXA 5G2IA 4HHMA 4FXJA 3W76A 2WKLA 4TOQA 1OF6A 5CLTA 1U5JA 2AGTA 4L5ZA 2WSKA 1LRQA 5H1WA 3QHOA 2V3EA 1UW9A 3F03K 3C52A 4O52A 3VMNA 1ALDA 3PTDA 2WAGA 3A7UA 4K8HA 1EO5A 2E6FA 1J11A 3GO2A 2R1NA 1AH3A 3DFPA 2CFYA 1QNRA 4GNVA 1H49A 1BWVA 1UWSA 1Q6GA 3ERPA 3KHJA 1KWKA 3MUAA 3H4KA 1PS9A 3MKVA 4GUIA 3FYYA 1TWZA 3QH2A 1CYGA 1T8XA 2C3DA 3CAQA 3TQVA 3IRDA 3W1AA 3STCA 1HW6A 4GIRA 2W3RA 4PFMA 4BZYA 4M7TA 1EEXA 2UWFA 2Y85A 5DXXA 1SJBA 4P5UA 3NTYA 2OYLA 1E9YB 3TFCA 1LL4A 4DQWA 1H4PA 1WKYA 1LOQA 1OFEA 1C8XA 4RZ4A 3TX9A 1BPLB 3VNIA 1MI3A 2CW6A 3M5ZA 1H09A 5EBKA 2Y88A 4MNJA 1AZ2A 2YIHA 4JIIX 1IE7C 3ZS4A 5KZMA 4NJKA 4L4OA 3G1SA 4TMCA 3PN8A 2D73A 3EDDA 1OFOA 5DRIA 1R3RA 1F5ZA 3QTPA 2P1FA 1OG6A 3MT1A 3UWYA 4OV9A 3W85A 3CV2A 3MC5A 4PBFA 3APYA 4HNLA 4AZ5A 3CGTA 1S2WA 3THAA 3I3DA 1HVXA 4PB5A 2E6DA 1EP2A 3NPWA 3JRKA 2OEJA 3GUWA 3A3WA 2ZZ1A 3F4WA 4E3TA 4A8RA 3UQNA 3VFCA 1LVLA 3EDKA 4S2BA 2ZZ4A 3CQIA 1QHZA 1SQ7A 1N8IA 2VOMA 5FEZA 4N42A 2R24A 3E02A 1RCQA 1SJCA 1YRRA 2B7OA 3TOYA 3WEOA 1BF6A 3T2OA 1Q85A 3FA5A 4H6QA 3CWOX 4J56A 3H2AA 2J7HA 1I2QA 3ARYA 1O1ZA 3GG7A 2Y61A 4F2UA 3EYPA 2INFA 4G2DA 1G4PA 3NL3A 2OEMA 3MW7A 1KBKA 5CG7A 2G5WA 3U7VA 4WLCA 2CLHA 5IHSA 1Q7ZA 2RAGA 4PCTA 2BHZA 2Z4GA 3HQNA 2YCEA 4NQ1A 1RPXA 2PRLA 3IUIA 1E43A 4AC7C 2A79A 3U5YA 1G4EA 5CPOA 1NDVA 5C2GA 3NCOA 4F2TA 4YLWA 3AM9A 3UZ5A 3NZRA 2NXIA 5HWNA 3R89A 3OW1A 3GXFA 3V1HA 2G3NA 5HUPA 1EGZA 2GOUA 2YCJA 4O54A 3L23A 5FEPA 3MI6A 1MYRA 3CTTA 5JCMA 1BAGA 1F7BA 3M16A 4QCEA 1WPCA 3R4IA 1HNYA 3LZ3A 3W1XA 3ONBA 1EWEA 3NS1B 1V3JA 5HULA 4GNKB 3UD6A 1ZBVA 1VF8A 5AC8A 1EJRC 1Y7VA 1E1EA 2PTXA 3HQ1A 2XDFA 3L0GA 3S9ZA 4MY9A 3NOEA 3F4VA 2VNCA 3WLPA 4O50A 4V1YA 3APGA 2FZNA 3MTWA 4NAFB 2D2JA 4PMDA 3RX2A 1HKVA 2WJFA 2XUCA 3VUPA 1XYZA 5G1MA 3RYSA 5A6AA 5MKGA 1ZZMA 2D1ZA 1UMLA 4NSBA 3O7UA 1QT1A 3LERA 1RLDA 5F2MA 4DBSA 2YDRA 3VABA 1ML1A 4H19A 4JCMA 4MNLA 1P6CA 4DIAA 2PUZA 1UKOA 3BOLA 1JULA 5A8PA 2YL5A 3L68A 2X1SA 1UBPC 1F4HA 4IGNA 3AHVA 4GKTA 2Q8LA 3F5KA 2VMFA 4YVXA 2FZ8A 1EQCA 1Z44A 2VC5A 3N6HA 3G0XA 3PUOA 4WHBA 1SO3A 1OFDA 4ZE5A 4H9UA 7REQA 1KFJA 1OF8A 3AHYA 3VE9A 3LCHA 3M41A 3NO5A 1JUEA 3GTXA 3DYMA 4DJED 2ISVA 1IGWA 3PZNA 2XTKA 4ZQCA 1NM9A 4A22A 4NAEA 4A3HA 3BMVA 1FOBA 1W37A 1RP9A 3S42A 2W55A 4I7UA 3VOJA 2QNEA 3ABSA 5F1VA 3U2EA 3N73A 4O1EA 2D20A 4RW3A 2P3ZA 4J2PA 3TLLA 4E2VA 1OGSA 1F3PA 3B4UA 1W3LA 3GU2A 3L67A 3O0KA 3LCIA 2RJHA 3G0SA 5L6UA 2G3JA 4ICMA 5IHRA 4FLOA 4LYPA 2NLYA 2XH0A 2EBNA 3O05A 3G1YA 3LNPA 4IJCA 4JFUA 2DQXA 2JK2A 2Z29A 5AC4A 1E73M 1PBGA 3M0HA 1V6YA 3NQMA 3R7MA 1KM3A 5AFDA 3CO8A 1CWYA 2BY0A 2GQAA 3WKZA 2ZX6A 5A6LA 4BI5A 4Y8EA 1MFUA 3QBUA 5LHEA 1SO5A 1RY8A 4GO8A 1TKKA 1JZ3A 3TN5A 4WEVX 4GLEA 3N19B 2XINA 4CN6A 1W5MA 5HJLA 3KBNA 1DWGM 3TCSA 3UCQA 3DHFA 2FHBA 3BARA 2X50A 4NNAA 1I2OA 4P61A 3C61A 2V38A 2AQOA 1WDQA 1ENUA 1GKQA 1F73A 1TPH1 1NELA 2YBVA 2OSYA 5HPCA 5ABEA 1LUCA 3CHVA 3PZGA 5C9WA 1H1NA 2PF8A 4E6MA 1WYGA 1WUFA 3LNMA 2BHYA 1JGIA 6CGTA 1RK6A 3GNOA 2PDKA 3BCDA 3CHCA 4GY0A 1SFJA 1U2YA 1Q6OA 3LA4A 2WNWA 2DFAA 2IKGA 1WYIA 3IVSA 3WK2A 3N3MA 1MO9A 3KX6A 5JQ9A 4AY8A 1XH0A 3WLNA 3S1WA 4GIYA 1JUBA 1CENA 4I5RA 1PVNA 1XLCA 2PDIA 5EYWA 4FEZA 3UG5A 5M17A 3AS1A 3UWWA 4HOWA 3SQMA 1GZJA 1P0BA 4ZO6A 4L56A 4ZO9A 3W74A 1U30A 5J5DA 4PA8A 2ZUSA 4GJJA 2PDJA 3Q4DA 4YCOA 4AHOA 2PDYA 1IXNA 2BNJA 3SI9A 3EPMA 2OQLA 4LH8A 1DBTA 3EA3A 3KEHA 1P0EA 3M44A 1DWAM 4GFSA 2DT3A 3W7OA 2F2HA 3SB0A 3UT0A 4ZXLA 3C2EA 4P8UA 2DY3A 3ZR5A 4O1FA 6ALDA 1QNQA 4TU1A 1CX9A 1NU5A 2CLIA 3LN3A 3N34A 1XW8A 4JN7A 4YWIA 3DKLA 3IV3A 1V77A 3M1ZA 4S3GA 5AHLA 3AU6A 4XIMA 3JUGA 4A4AA 3CL7A 3VTRA 4R5EA 3B8WA 4KCTA 3D3FA 1ECEA 5JMUA 3F2DA 1HP5A 2FVLA 2X99A 4FOKA 2HS8A 3PTMA 1POJA 2VXNA 5IOBA 4O17A 4LJ3A 5KITA 3KZPA 1TV4A 3QY7A 1Q6QA 5DLCA 1J93A 4QHRA 5I3DA 3WQ8A 5KMYA 2WWDA 2Z1XA 4ML4A 3RLUA 2EQDA 2BTMA 3GKAA 1RLCL 1PZ3A 1P6BA 5D02A 2X30A 4IPNB 3RAOA 1W9VA 3VILA 2W63A 3UWEA 2BVWA 2YZ5A 4OIFA 4FA3A 1MW1A 2VP8A 3DHPA 2OODA 1W91A 1UP0A 2PLCA 2Z24A 2PDNA 4IGSA 1TO3A 3TAOA 3CUZA 3AI0A 2XSXA 2C16A 3WL1A 5B80A 3M0JA 2VQTA 3A64A 1XD0A 4YS1A 4BWLA 2Y7DA 1CGXA 3LMYA 1OM0A 4WUIA 3BSMA 3UZXA 4BF9A 1ZAHA 3PS7A 3EANA 3O07A 4GI8A 4IL0A 2VEFA 1EIBA 4RDVA 2AL2B 4L9ZA 1XLGA 1ZPTA 2RDWA 1TQXA 3H7VA 4MLRA 3TKFA 1LT7A 1OADA 1W1VA 2X7WA 1JD7A 3CH0A 3L4WA 5A6JA 2B0MA 1A5OC 1AJ2A 1FWEC 4LU0A 3S0CA 4W86A 1MMFA 1EB3A 5LXEA 1PCKA 1XBXA 1EPVA 4LUSB 4S3CA 1DP0A 4LCQA 3SN0A 3E38A 3MSDA 4NZ1A 3GD3A 2W9MA 4ATLA 3SCRA 3AN1A 1W3IA 1W9BM 4P2VA 4C6QA 5CPQA 1X39A 5BOOA 5GPRA 3QRHA 1AFSA 1F3XA 1R2RA 1M53A 1SR0A 3BLOA 3MMTA 4J57A 1YADA 2WVVB 3N11A 4JD4A 1PCWA 4L64A 3BK0A 1R6WA 4JHMA 3BMXA 3G77A 4BF7A 4RUBA 4WJXA 4B92A 3UZYA 2XZ9A 1IXOA 4XAFA 1QVBA 1SSDA 3OTRA 1NDYA 3PBVA 1S3HA 3E3HA 3LQGA 3IJ7A 4U4MA 2C1GA 1A47A 4DF2A 4F0LA 4KIEA 3T0TA 2GJLA 3E0FA 1KCZA 3PM6A 5A6SA 4ORMA 1RVKA 4B91A 2QCNA 3WQ6A 2EPOA 4D6CA 3GX9A 5CSUA 1HF6A 2PI6A 2Y7EA 1WZMA 4D8LA 4YTQA 3SFWA 4EWND 4Q4SA 4LUIA 3DK9A 1M5WA 1EGVA 3DGBA 2GGJA 5DY2A 1KGUA 3WDQA 4MHBA 2F9RA 3B4YA 4JY9A 1S1RA 3EXSA 5U1OA 3HURA 1EDGA 1ELSA 3KXQA 2VD9A 4DLMA 4IGMA 5IFTA 4RE2A 1US0A 3WNKA 1GSNA 1PKMA 5M1TA 4UTIA 1YE6A 4MKNA 4PYSA 3UETA 2FDMA 1P0NA 5CPLA 4AMCA 3EOEA 2WXDM 3U8GA 3T9PA 3BAIA 5DX7A 4K7YA 2YDQA 2QCDB 5F2GA 2E40A 4YPJA 2XGZA 3QC3A 4TV5A 3GR8A 5LA2A 1TZZA 3S1GA 3S5ZA 4AWTA 3VOCA 1VB9A 4JTEA 1IWPA 4CN4A 3U5UA 3TR9A 3U0HA 2C1IA 1QOXA 3W7IA 4UTMA 2VRQA 4MGGA 3MMUA 1MXGA 5H6HA 1BXNA 3QOKA 4LC8A 4GI6A 1BVZA 3ANUA 1Q6EA 3NQBA 2H8XA 3FFSA 4XIAA 1SZEA 4IIGA 5G1YA 1SFSA 4OVXA 1XSKA 4KRUA 3KZSA 1TB3A 5GNZA 3L7RA 2FKPA 2ATSA 2NSXA 5CGMA 4JFWA 3O6AA 3VD7A 1JZ6A 3UPWA 4MY8A 3NJ3A 3WN6A 1W54A 3SRKA 5ENLA 3TR2A 4KCWA 2YAUA 1KFKA 3HV8A 1ODUA 2QULA 2UBPC 4FIQA 5AYIA 4OQVA 4LFYA 4J5NA 5FS7A 2W61A 3NGFA 4W93A 4EQXA 4AQLA 1M9HA 4OV4A 3GD4A 1UZ1A 3UXIA 3UYCA 4TTUA 3LTSA 4S3BA 1E0TA 3DFNA 2A3AA 2Y8UA 1BSIA 4PMVA 3UWVA 3WQFA 2D0FA 4QLLA 2WC4A 3I65A 3WD0A 4KEVA 2OU4A 4Q4KA 3BMWA 2D2GA 3V5CA 2WKJA 2E77A 4DM2A 4ZQPA 4X2RA 4HU4A 1R7OA 2QR6A 2R6OA 5CPTA 1SMDA 2V9DA 1ADSA 3HZ3A 2CLEA 2V82A 3OZMA 1P7TB 2D2HA 4ADSA 3AQUA 1GOQA 3TEVA 4D1IA 3P82A 2V5JA 5BRBA 1O12A 1S39A 4MSSA 4NXKA 4PSRA 4CQ9A 4E8GA 1VAHA 2KAUC 1J96A 4I6VA 1W3KA 3H2EA 2VGFA 3KLLA 4A21A 5C54A 2CIPA 3IIZA 1O7AA 3WDJA 2INZA 3T8LA 1EZWA 4C60A 2Z26A 2WCAA 3STFA 4PE8A 2YXXA 3R0UA 4N6EA 3CIXA 4F9DA 1UC4A 1HJVA 3GFZA 4F0HA 4KCVA 4AZBA 4QLKA 1D8WA 1LDCA 1DJYA 2VFGA 2ZZ2A 1GW1A 5EFFA 2FH6A 2GR1A 2C79A 4DELA 4NX5A 2ZBTA 1OFQA 3SCVA 4I7VA 1EBHA 4L9YA 4GA8A 2HNEA 4H50A 4XTIA 1DIKA 2Y70A 4XAYA 2EAWA 4UOZA 4M51A 1IEQA 4PBGA 4MM1A 4RE3A 1I9CB 1Y65A 3W7QA 3HW2A 2P10A 1JGMA 1UWAA 1WZAA 5FJOA 2UY5A 4H4UA 3DGHA 2CCRA 1OFRA 5LNUA 4LY8A 4CU7A 5AKQA 3TYUA 1D7KA 1EC7A 3G1RA 5HMFA 1QWGA 2FGBA 3BH4A 3C6CA 2X0HA 2JF7A 1LP6A 3KVJA 3UY7A 4CN1A 3KM8A 3LRMA 2I5IA 3OJGA 4LBUA 5H8UA 3N1AA 3MP3A 1B1YA 3RU6A 1CNVA 5D2XA 2E0PA 4W7UA 5G5IA 2V67A 4AZ6A 4DBDA 1FHDA 1E9LA 4UQ9A 3U57A 3IJIA 3N12A 3KCLA 4GBUA 4NI3A 1RD5A 1XISA 4GNJA 1DQUA 2AMXA 1JRCA 3W1MA 1AD4A 1S7MA 3SGZA 1V6WA 3SDOA 3F1QA 2WOWA 3TU9A 5FJJA 1OD0A 1M6JA 2CKRA 5LHFA 3NQAA 3LBCA 1QI4A 3B9JB 2X16A 3KL5A 1AQMA 3GYCA 4MFDA 4NASA 1F61A 5LIXX 1XCWA 3ZXWA 1XLFA 2ZX8A 2ZC1A 2PSNA 1FVPA 4JQ3A 1I6NA 3SR6B 3QKEA 2E28A 1KM5A 3VNYA 2TAAA 3PAJA 4IMAA 1H7OA 3EKLA 3NSXA 2WM1A 3BWWA 1W2PA 2PLJA 3LQLA 5ABTA 3RPDA 1VKFA 1L2QA 1A53A 2ALDA 4A05A 1TIWA 3N2MA 1GKPA 3SUTA 4BK9A 1OSEA 2V2HA 1WX0A 2ZDRA 3BG9A 2PP0A 3AXKA 1XCXA 1TG7A 1UWQA 5FIPA 3R79A 3S3GA 2QDEA 3WLQA 2FFIA 1PDYA 2EF9A 3IEBA 4I9AA 3TQKA 4GUHA 1CGYA 2DDXA 3ETRB 2Y5EA 5D8WA 4CNUA 4FX9A 4IISA 4C1NB 1W3NA 2OZ8A 2VR2A 2J77A 1T41A 3FOKA 2BGQA 1J0KA 3QF0A 4D6HA 4X9SA 4CNNA 1W3JA 1UH2A 5F4XA 4A35A 4GJ1A 4UCGA 1DEDA 1FP8A 3QJAA 4ZR8A 3UVAA 3NURA 1VJZA 2NQHA 1SJDA 1O95A 4KESA 4KERA 1VFUA 1S5WA 1MW3A 2PDHA 1VC4A 1LRNA 3CTLA 4UTUA 1L0PA 3GNPA 1ZNNA 4S1FA 5F7UA 3CHDA 3FHQA 4HJWA 3ATZA 4DRSA 5A6BA 3QLDA 3QGKC 3OZYA 2EPLX 3PSVA 3QV6A 4MVAA 1PE1A 4FNRA 4JNYA 3WQGA 3MUXA 1E4NA 1J5TA 2PDXA 1OIMA 1UIPA 3QSRA 3VDHA 3N9SA 3M5XA 4ADTA 4BWLC 3NSNA 3TYEA 3T05A 4UTTC 3W0KA 1KR1A 3BLFA 3SBFA 3GHRA 1CLVA 3PWIA 2O56A 4JFVA 4NVTA 3IV8A 4PB4A 4WSJA 3CM4A 4QROA 3GW0A 3HMCA 4S39A 3A7RA 1VLIA 3VKBA 1PPIA 1BGAA 4GZ7A 5DBTA 3ZVIA 4Y2WA 2GSJA 4BQ3A 2JIEA 3GVVA 1ZK7A 1DNCA 3AXMA 3GRIA 1VHNA 4NAFA 4CCDA 2YW3A 3W02A 1MW0A 3RMEA 2GJPA 3M07A 1E6QM 2DZPA 4QDMA 4MF4A 5D32A 1KFEA 2ZWZA 1BXCA 1ZHAA 1O66A 3SQSA 5C5YA 1FDZA 2VZVA 4K8DA 4FLQA 3TMQA 2YBUA 2YQUA 4I90A 4H8VA 4O1DA 5FAGA 1UOZA 3T42A 3SQPA 4NXSA 3K46A 1NP0A 3WO8A 2J25A 3P7YA 1FWNA 3N4EA 4E2BA 4TMBA 3DESA 3B04A 3MHFA 4MWAC 2TODA 3I6TA 3TJXA 4I6KA 2P5NA 3ARVA 4U31A 3VKKA 2IPGA 3BAJA 1KFBA 3N2BA 5EL1A 3LLDA 3MUIA 4AVOA 1HZYA 3WNLA 3FXGA 1KCLA 1XLIA 2CZEA 5HINA 5A2AA 4QLJA 3RPTA 2ZX7A 2EQ6A 3AIUA 5LZLA 2OSXA 1LWHA 1TJRA 2PTYA 4DUWA 1OY0A 4S3FA 4LRTA 3T09A 2WCGA 1GTEA 1HTIA 4D6JA 4XZNX 3W2JA 1YE4A 1ZU8A 3UR5A 2J9XA 2I56A 5U7SA 3G6LA 1B3ZA 3ABQA 3FJ6A 1BTMA 2QJJA 1OX5A 1UASA 1MUMA 4E4PA 2AQWA 3ITYA 5D2WA 1BG9A 1W1TA 1A5KC 3ZLFA 1W1ZA 4FB7A 3GY1A 1Q1WA 1JPMA 4BFAA 4Z0JA 2OCZA 4TX9A 3ALFA 2VVSA 4Q8VA 2PODA 3QHMA 2JEQA 3DU0A 3M7WA 2HQAA 1GEQA 3E2SA 3VCNA 4PTWA 3URBA 3VMOA 2WB5A 1EUAA 3G1VA 3AO0A 2FMNA 3PC0A 2TMDA 2PRMA 1BKSA 2H9AB 2VX6A 2BCPA 3C2FA 5A8OA 2X7VA 3B0PA 1CXKA 1NSJA 1DL3A 1KGXA 4HSHA 4UNLA 3LI0A 1UP2A 2JKPA 1ZBWA 4GOAA 3AYVA 4IJBA 1JDEA 3WCZA 3E0LA 3WNPA 2ZZ6A 2KX9A 5D33A 4C6OA 3HGRA 3UP8A 4H4PA 1ZS2A 3SCTA 2ICSA 3PWAA 1NQ6A 2J6VA 5H8PA 2NVCA 4ROQA 4FMVA 3DDMA 4AD0A 5C71A 4O4WA 1QPOA 4EPEC 2ABAA 4OBRA 3C2VA 3OA3A 1IF2A 2D3LA 2QF8A 1ADDA 4C91A 1HGYA 1Z69A 4AD3A 2WMGA 3VINA 4GGBA 1CBGA 1BQGA 1QU4A 3CASA 3FLUA 4PFHA 1GVEA 1T6MA 4JTLA 1PKLA 5HWJA 3L5MA 1RD6A 1IWBA 4CNOA 2BFGA 5F4SA 1B3XA 3LRLA 4JTRA 2J7DA 4XV0A 3EDJA 4HPGA 3W2UA 4PTMA 2VHLA 4GYFA 1UHVA 1TPC1 2DZUA 3GG8A 3OG3A 4K7ZA 5CPMA 2YCIX 3RMJA 1UR8A 1MNZA 2QGYA 4HYRA 1KRCC 2QUVA 1ZAJA 2NLIA 3CO4A 1EC9A 1JAKA 1E3XA 2DJXA 4A8NA 4C6DA 5K3VA 1S2TA 1HO4A 4DJDC 2WKGA 4XZHA 1KM1A 1GOOA 3PG9A 1IWAA 3DECA 3PZQA 5KVHA 5DMYA 3H4WA 3A24A 4GINA 3G0UA 1YBQB 1XRSA 3NG3A 2C15A 3GG1A 1PL9A 1ZCCA 3MVIA 2VENA 2D0GA 3LUTA 1GXFA 4LS0A 1KFWA 3CGEA 1FWGC 1KTCA 3B97A 5CBJA 1O68A 3O0HA 1FCBA 4O28A 1DIDA 4QQUA 3GTHA 3GNXA 3W29A 1TV8A 1Z48A 1JROA 2XJ7A 2CHNA 3W07A 3EWZA 4MJ4A 1R8LA 3B9DA 1DOSA 1LWJA 2FIQA 2WNNA 2WPGA 4AISA 3FIGA 4IH3A 4XO7A 3ZJ8A 4PEEA 2PBOA 1UR4A 2Z1VA 1ZDLA 4ROPA 3SN1A 4RV3A 3AMLA 4A8IA 2RFGA 5FSEC 1XC4A 4IMGA 5T26A 3IJ6A 2EPHA 2VOTA 2WBAA 4GIAA 1S1PA 4KKXA 1L6SA 2PZNA 1EJVC 1QRQA 2RDXA 1X6UA 4Q8QA 1KBBA 1FH8A 3GC5A 2D2OA 2PTZA 2CBJA 2YA2A 2V6OA 3GRTA 1UWUA 1RALA 4AFYA 3PK7A 2CLLA 4ZMGA 5KZDA 2CZVA 3IK4A 1W8GA 2XH7A 1F76A 4OE7A 5LXXA 5T9CE 4K37A 2OT1A 2PWEA 2AKZA 2NT1A 2HBVA 3NZQA 3V16A 1VBGA 3W83A 2XVKA 5I09A 4FNTA 2AL2A 1PZ2A 1VFMA 1DE6A 4F0SA 4MLJA 4MOZA 1XG3A 2J7BA 1OGBA 4FX6M 2BVTA 3PNZA 4PCFA 3ITOA 4J1OA 1B5TA 2ZA1A 4J2MA 4D8AA 1FWWA 4OKDA 1S2AA 1RXOB 3B06A 4XZMX 1A0DA 3PF3A 4RPPA 2BGSA 1TMHA 3UA3A 2E3TA 1S5MA 1F8WA 3B9AA 4LUSA 4KEUA 4V27A 3QLLA 3LLFA 4UOJA 3P2VA 1VFSA 2HISA 3BGAA 1MSSA 3IARA 3MV11 3A6OA 1TVPA 3C4UA 4FOJA 4EXQA 2J66A 3QR1A 4MPQA 2Y0FA 3EZ4A 3P8JA 1H61A 2QEZA 5LSMA 4LF2A 5RUBA 4US5A 3GH4A 3OG2A 1UR2A 4OHQA 1B3VA 6PTDA 5JBFA 4AW7A 2G3FA 3PB0A 2UY2A 3AMGA 1NFGA 4Z2KA 1KN0A 4ZQOA 1QW7A 2WVVA 2PDWA 3B05A 2NUWA 1E4MM 4JN8A 3SFKA 4GE8A 2WMKA 3T4WA 4XBSA 1EF2A 1Q6CA 3A5VA 4GQBA 2IKJA 3RLHA 4QSFA 4LV4A 3WQWA 3A4AA 4IMDA 1JI1A 1OVDA 3H2OA 4CLMA 5FJTA 4LVDA 4GIEA 1TX2A 1DJHA 2A7RA 8XIAA 3DAQA 1GVOA 4F3HA 4L7ZA 1VIZA 5HR6A 1BYCA 1ZJHA 4WKHA 3W7HA 3EWWA 1CXFA 4BHYA 4H9VA 1WKFA 1XI3A 1JF5A 4MDPA 3FGCB 4WR3A 3WF3A 3IGXA 4B5SA 1R0MA 3EDEA 5FF2A 4CU8A 1GYNA 4J3TA 2P0OA 3AWNA 4B9ZA 3SM0A 1B4EA 4PUEA 4Z08A 3HG4A 3IGSA 3IAPA 4G7EA 4Q8NA 3PUEA 3WBEA 1O60A 2GGEA 2OGYA 2E3ZA 3FAXA 1K02A 1RM6B 3ARWA 1M41A 3STPA 4E3VA 2A6NA 2OOFA 1TIMA 1X96A 3FYOA 2X8HA 2NQ9A 1YDNA 3BGJA 4B5XA 1OT1A 4P8XA 5DN1A 2FPVA 2QCDA 3GZAA 4A8LA 4LAMA 4QNWA 3W1TA 3F5JA 4R33A 2WP5A 1H1YA 2JKEA 3APTA 1Q7QA 3HA1A 3IUHA 4M82A 4TUFA 5FA5A 3VC6A 4ZXOA 1EH9A 3WK1A 3L12A 1B90A 3VIKA 3W26A 1GQNA 1TQJA 3BE7A 1J9YA 3CMJA 1E6PA 3VOGA 1HJUA 1YMYA 2GOKA 3WNOA 2IXUA 4QTGA 3WQ4A 1QHPA 5CPSA 1Y5XA 4Z1BA 4H4TA 1RR2A 4Y9NA 5JCNA 1W1IE 2XIOA 2GPTA 2O4MA 3VU2A 5AZ0A 4L1XA 4S23A 1TRDA 3MY9A 2BLEA 3NQ6A 4PB3A 3JW7A 4FPSA 5F4WA 1ZLPA 3TLQA 2WMFA 3QPZA 3H21A 1CEOA 1V7YA 1H50A 3EBVA 4XD5A 2XU2A 4PTDA 1W8SA 1V3MA 5KINA 4RDWA 5J8LA 1W9DM 1AG1O 1CGUA 1A80A 2VZTA 4PCNA 5HXMA 3OHMB 4C90A 3NQVA 1D3CA 3WH9A 4XO6A 1J18A 3G1HA 3S2NA 2RDUA 4JIPA 3LADA 2E8YA 4N4PA 3H2NA 2A8XA 1VBHA 5BU6A 4JFSA 2XVPA 3U4FA 2FTPA 3DX5A 3NQDA 4ZOCA 2JGQA 2QIIA 1GG0A 2I5GA 2EG6A 2GQ3A 3K8KA 3L21A 4WGHA 1RSCA 1WKDA 3PVFA 5HAOA 4JHZA 1DPMA 2Y5JA 1RH9A 5I2UA 5BRPA 3OB8A 1P7TA 1KV8A 2FLIA 2XM2A 1GRFA 1SZGA 2ZZBA 1UR3M 3WZ0E 3S8HA 1YW1A 3L9CA 1JAEA 1XPGA 2OMAA 1L6WA 5C9XA 4X61A 4KGLA 8A3HA 1SZRA 3NR0A 4BCEA 4NZCA 4HN8A 2QCMA 1GWJA 3RNDA 4FX7A 3SQLA 3MUY1 2YCLB 1VJIA 4PRRA 4GPNA 1PAMA 2ZADA 2NQZA 5C8BB 2ZZ0A 3W1QA 3AZRA 4C6EA 1C9DA 1TV3A 1CGVA 2ALRA 4EAYA 3OIXA 4C5ZA 3N15A 4B5UA 1T96A 2HVMA 4DYJA 3PFMA 3M5VA 4UB9A 3NSMA 1Z3NA 1OYBA 3UG8A 5C6MA 3IJQA 4OZOA 1NVMA 1OYCA 1Q2RA 3F2CA 2ZX5A 4DUXA 2RGMA 4LF1A 1JYWA 3BUVA 1K4GA 1ZSXA 3W6MA 2G95A 4N6FA 3UWZA 3GTFA 2ZWYA 4ILSA 4JX4A 4FXRA 3ARQA 4FLRA 4YHGA 3ZVHB 4PTNA 1LPFA 1Q63A 3C3NA 2IS7A 5DCEA 2CWNA 3BL3A 2PP1A 1R86A 4J35A 3QFEA 3KS5A 1FBAA 1TVLA 4LAZA 2YVFA 1UH4A 4ADWA 4Z2IA 1J01A 2H8ZA 1EJTC 2IQ0A 5CZSA 7TAAA 1NARA 1TTIA 5I78A 3KL3A 1TYTA 4O8RA 1XBZA 2X05A 3BJFA 2GQ9A 1MRAA 3S4TA 3ZT7A 3CV6A 5DMNA 5BWFA 4OTKA 5IDZA 3EB2A 1V6TA 4PUWA 1XUZA 4Z0SA 5B7YA 2PB1A 2XWDA 1CLXA 1WUEA 4YNGA 3G1FA 1QK0A 3IUDA 4GRSA 3MO7A 1SUXA 2E68A 3W2LA 1F6PA 2WPCA 3AIBA 1O6IA 4M7SA 4YCPA 5JRBA 3FHAA 3RITA 1MUCA 1EF3A 4GC4A 2C1HA 3SJ3A 5F1UA 2XH2A 3MS8A 4GC3A 4HPJA 2Z00A 4PMXA 3FXYA 5D30A 4AMAA 3LX9A 1X8CA 1MQRA 5F2LA 1J6OA 2WZIA 1VP5A 3FA3A 2VVNA 9XIAA 3AIVA 4CVUA 2VEPA 1GRTA 3USZA 1CCWB 4XAPA 3N6JA 3U9IA 3VIIA 4ZODA 4DUOA 4EF9A 1A3HA 1HN1A 3GVQA 4LYRA 3ZQ9A 2X8RA 9RUBA 3VYLA 3W73A 1W5NA 5K9DA 3F4DA 4I3GA 4J9JA 1UKPA 1EJWC 3KWXA 3L4ZA 4UTWC 1K9TA 2EEXA 3P14A 5TNVA 1XYLA 3T40A 2GR3A 3DCPA 4TIMA 5GRTA 1QNSA 3R6IA 4M19A 4AZGA 4M6VA 1A5MC 4L4MA 5HJXA 1UOKA 1UKSA 4Y96A 5CBBA 4PH6A 3H6OA 3P60A 3VC5A 4JIEA 3RO8A 2ASHA 3Q67A 3FSUA 3RK8A 1GORA 3NYZA 4CQCA 4PMOA 5BYWA 3UR8A 1ISZA 1NDWA 1VRDA 3CLMA 2IMRA 5IDIA 4C1NA 3WMBA 3W88A 1B3WA 4OECA 3IC9A 5BMXA 1KNWA 2WK2A 1VBJA 3U2OA 3MWCA 4IICA 3EEGA 1BZLA 1SZNA 1IGSA 4B4HA 1J10A 1VCGA 1TPB1 3CUGA 2GDUA 3EWYA 3VKDA 1Q6RA 1TR9A 3FNDA 3KTCA 4CCCA 2OB3A 5A8NA 3SCNA 1K03A 1IZKA 2QMJA 1E6NA 1GVIA 1M65A 1LM1A 1ZUAX 3KAOA 1FTXA 2WYSA 3STEA 3G1DA 4P7RA 3PZUA 3NL6A 4M1RA 1BWKA 1QCWA 5GJMA 3M64A 4QJ3B 1GJUA 3PSWA 3KDOA 3UR2A 3GHUA 2X1UA 4GI9A 3TN6A 4IQEA 1LBFA 1OC5A 4FK9A 5JXQA 3TTYA 1OT2A 3R5EA 1PKYA 5M3WA 4LB3A 1DTNA 3UJEA 4EKJA 4IIEA 3ARTA 2DH2A 1LYXA 2R1LA 7ENLA 5HQLA 3GNNA 3DGZA 2O7SA 1VR6A 4Q4OA 3NVVB 3T78A 4HK5A 1JDFA 1WDSA 2NVAA 1XWYA 2BASA 2YDAA 3RCMA 4XG1A 3WK3A 1XR2A 2G97A 3OVRA 3P84A 4JQAA 4XBKA 4A3QA 3GDKA 3GVWA 1H7RA 1GTHA 2I1OA 2NX1A 1O4UA 4W8BA 2MUCA 1HKMA 2OYKA 4MB4A 3AIQA 1OHLA 3HPZA 2W79A 2PS2A 3C5QA 4X0VA 1ZY9A 4R27A 4HK7A 1SM9A 4NY2A 4NYYA 2G3MA 3WD2A 3HO8A 5E9XA 1E3ZA 3NIYA 1JD9A 1PKNA 2EG8A 1EGMA 4WZHA 2PWGA 2F6UA 3AXXA 1Z6KA 1HJSA 3PPHA 2SFPA 1LLWA 3VOFA 2HV5A 1Z8AA 3R10A 4H00A 4JHOA 4PMUA 4K39A 1W2VA 5LNSA 2QJGA 2C71A 3CYJA 3IK2A 4PCPA 4PCSA 2W6RA 1B9BA 2QCHA 3SIZA 4JTCA 3CXBA 1JCTA 4CUCA 1OIFA 2W67A 1V3LA 1RY0A 3B0XA 4TXEA 5K7JA 3BLKA 3VIOA 2WBKA 2QDDA 3KOZA 3HPFA 2YZRA 2P3EA 1T8QA 1UWTA 4H9YA 3TSMA 4Q8MA 3K13A 3S6TA 4GQRA 1QUMA 2XG9A 4RJEA 3NEVA 3W72A 5LA1A 2XN0A 1KFCA 4ZB0A 2YA0A 3T0DA 1OK6A 1NF0A 3VE7A 2B4GA 3RO6A 3R1ZA 3N2TA 2PDMA 3O6CA 3A9IA 5K9CA 3CUFA 4AUBA 5A6BD 3N6QA 4JL1A 3QXBA 1XHCA 2XVGA 2J75A 2C18A 1GW9A 5CC6A 2UV8G 1W3TA 4W8LA 1KM0A 3BGGA 1XUUA 1FH9A 2ISFA 3S5OA 1QOPA 1GQKA 3A12A 3ZM8A 2H9AA 1VQZA 4MYAA 1LT8A 5L9FA 1VFOA 1OCJA 4WK9A 4AG0A 2YR1A 4AXNA 2NZLA 3TH6A 3SECA 2WCSA 3GM8A 3NUKA 4BR1A 2FZDA 5FJRA 1IXPA 1J0YA 1XLLA 4NUWA 1KXVA 4DBUA 3IVTA 3LCWA 4O18A 3VDCA 4ATWA 5ER0A 5HNRA 3URAA 3SADA 3E74A 3KLKA 5A6TC 3XINA 3S2JA 1ZENA 3EPNA 2E6YA 1IZJA 3TV8A 1JXKA 4ZO8A 5EA9A 2HWGA 3LY0A 1ZBKA 3O06A 3O63A 2HROA 2HZGA 3W9ZA 3HM7A 5AHNA 2ISDA 3WEMA 4O4VA 3OBKA 5BCAA 2EKGA 3VNZA 3CGBA 2R91A 2XZ7A 4QJ5B 5DMMA 3NQ2A 3N14A 3CWNA 5AHMA 1H7PA 3HJEA 2ZA3A 2NW0A 1PO9A 4NKCA 2JK6A 2JEPA 1JCNA 2HXTA 4DWDA 4DBEA 3T81A 5AHEA 1BRLB 4H4ZA 3RX4A 3FX4A 7CGTA 2E8ZA 1JZ4A 1S46A 4XKMA 3MHUA 5AN7A 5CZ0A 1L6GA 2ACSA 2E5DA 1XKJA 5E70A 2GUUA 4GYKA 2XM1A 3HPAA 1ZCOA 1AA1B 2V5BA 3I3EA 4ZTYA 1N5WC 3G2GA 4IP7A 4H4VA 1YBQA 1QMLA 3DXIA 3AZSA 2RH9A 1V6XA 1GVFA 1V0MA 1X6LA 3B9NA 2FHCA 2P88A 2AQVA 3N13A 3EOUA 4HU8A 3GUGA 3B0YA 4WJEA 3A4XA 3BQ6A 3CL6A 1YPFA 3VUSA 3CT7A 2B81A 2QV5A 3GZ3A 4IFKB 3DFOA 4UMBA 3W28A 4BI6A 4CD8A 4O57A 2I16A 1CXHA 3P5ZA 4H9XA 2PZ0A 3LEPA 3M47A 4G7FA 4MFEA 3MO4A 3C56A 2GDVA 4PUDA 3CS2A 4ERIA 2O9PA 3WQVA 2X8GA 3XIMA 1D3HA 1M1BA 3OO2A 1ICPA 1MQPA 4E8CA 2OELA 4Z42C 2CETA 1UKQA 1LWIA 2BOFX 1PYFA 1KCKA 1EP1A 4IG2B 3E12A 1XIIA 4S3JA 4K68A 2RABA 2X8CA 4NHVA 2QQ6A 3HB9A 1DTUA 3TSBA 1UJQA 2WJDA 3TVAA 2WC3A 1TMQA 3GYEA 3V18A 1VFTA 3IJLA 4C6NA 4YYCA 5KTLA 1VEMA 1KWGA 1O5QA 3JVAA 3GLCA 4MWAE 4WGXA 1HL8A 3A3HA 2CHRA 3W7RA 1WA3A 5FAJA 2FPTA 4BY3A 5GNXA 4ICNA 1UD6A 3GDTA 3KCOA 4DPPA 1JOAA 5EMKA 4BURA 2CHOA 3P5YA 2W66A 3HFTA 2ZIDA 3L4YA 1N5XA 1O5KA 1EO7A 1XJBA 1EWDA 3VNMA 4PODA 2J78A 4UNIA 3IS4A 4D2JA 3LU2A 5CSRA 3AMZA 3GHTA 5LIKX 2XGIA 3EMCA 4ACZB 2UZ9A 2YB4A 3AYTA 4DJFA 5JU6A 1H51A 4O1AA 3VGEA 2WZEA 4ERAA 1UC5A 3LMZA 4HPHA 3ES7A 5HPOA 1N60C 3W23A 3W70A 3WQPA 3I7SA 4ZZ9A 1VCFA 4YIWA 4JTAA 3LB8A 1Z32X 2WNQA 1K9FA 4KW2A 1YEYA 2RHGA 3EX2A 3L0KA 2FZBA 3EOOA 4NRSA 3MI3A 3PBGA 2V63A 2C19A 1S2VA 1UD3A 5TQLA 1XG4A 4PULA 4UZUA 4J3SA 2JF6A 1A49A 3EA1A 5HNUA 2WLYA 3KUMA 3DC0A 5G4WA 1H62A 1TZ9A 4QNEA 5C7VA 3JZEA 1YXDA 2PLKA 1ZQ5A 1QI5A 1XYCA 5DT5A 3E2QA 4IP4A 5BOFA 1XHGA 4IPIA 4GISA 4GMEA 3DJGX 5HUOA 2XFFA 1ZJAA 4HZ8A 1CZ1A 3WENA 1YTDA 1AW2A 2I17A 1TVNA 2WLZA 3S1VA 1EJXC 2ZUVA 4IT1A 3PTKA 3NM3A 1VH7A 4AH7A 3EXRA 3MI2A 1RUSA 3EDFA 4AF0B 1KM6A 1I45A 1SW0A 4F2BA 3B8SA 2QS8A 1ME7A 1ISXA 3FGCA 4XZIA 1FXPA 3MP5A 4M80A 4E2DA 1FKXA 1DJWA 4ZO7A 4GVGA 4CD4A 4EMJA 5CZJA 2J13A 5FEWA 1XL9A 4NRRA 1XLKA 1EPXA 4DZAA 3ITXA 4AX7A 4IL2A 4IXXA 3N4AA 1F3EA 1PHWA 4H8UA 3R12A 2I9EA 4YTTA 5ABGA 1C92A 4NJHA 1YHTA 1I0BA 4GKLA 2CU0A 3GXNA 3BW4A 3LG3A 1EZ2A 3NDOA 5IM51 4RZ6A 1ZFJA 1EXPA 4ZOEA 1Q45A 4GXMA 3EXTA 2GVJA 1W9PA 4JQ2A 1OCQA 5C2CA 3RU8X 3KBJA 4RNFA 1KKOA 1V4YA 3PBUA 1GESA 1AJZA 1EJSC 5XINA 1DXEA 4PSPA 1NFBA 3UEQA 4HPNA 2DH3A 2F61A 4UFKA 3QMTA 4LXFA 2ZUUA 3V35A 3WLJA 1VIWA 5B7ZA 1UQZA 1ZAIA 3H2FA 1NDZA 2QZRA 1GZGA 4ERGA 3IRSA 1Z7AA 2PDCA 3TYAA 4TR9A 4WXYA 1LOLA 1IEXA 4HTYA 2G96A 4Q4QA 1TMLA 2MNRA 5HK4A 4F48A 4US5D 1E6XM 3KHDA 1TJ0A 3LLXA 1NF7A 1D9EA 1JRBA 5JIPA 2R94A 1Q13A 2QPSA 3EUB3 3ARPA 3VIJA 5FESA 1JJKA 4IMFA 3HRDC 2DIEA 3LGEA 4Q7BA 2VURA 3VVGA 5C55A 4C6CA 5TIMA 4IFOA 3H4GA 3FDGA 4CQ8A 5LNWA 1ECQA 4GG9A 1XDJA 2DVTA 3II4A 1F4AA 1DWHM 2J62A 3BAWA 4FOUA 1MFVA 2VX5A 2PWHA 2BWGA 3QGAC 1UPPA 4KFOA 2PU1A 3HIJA 3L5LA 5D9MA 4KWWA 6REQB 5EMJA 3N18A 1GOWA 1TJ1A 1XRFA 1SO4A 3IIVA 1UWRA 4Z2JA 1R3TA 1QBAA 5U4NA 1U83A 2O9TA 5E93A 4KWVA 5FKYA 4EACA 2DORA 3OGRA 5JUVA 2BVYA 2FFCA 3VIPA 1A3XA 1R3VA 1LZOA 1UYQA 2PTDA 4INFA 1G1YA 5AVNA 4JKKA 1UA3A 4DI8A 3FG2P 4DX3A 3W27A 1FO4A 2YCLA 4KCUA 5CSYA 3QPEA 2PPGA 3NGJA 3GIQA 4H04A 4ZFCA 1N8FA 1C8QA 4I5UA 3DZ1A 4NL1A 3L4TA 2OVLA 3EWBX 3OVGA 5KEZA 2EJ1A 4HOZA 4A2SA 3I3BA 2V30A 1B57A 3QZEA 1GJPA 2ON3A 1O1HA 2YYUA 5BXRA 2Y7GA 1T5AA 2YW4A 1NHQA 4O11A 4EF8A 2VWTA 1W1PA 2XYLA 1OINA 5EMUA 1JDDA 2ZXBA 4HYVA 1FWSA 1GZ1A 3I6EA 3ENLA 3ZVHA 3R8RA 1TTQA 3BW3A 3TTOA 3NZ1A 3BSHA 3JU2A 4Z1DA 3TYZA 1Q65A 3O15A 4URIA 4CU6A 3WFLA 2Y8KA 3LTPA 4LTSA 3V4BA 4EP8C 3RM8A 2BY3A 3HPSA 2R9ZA 4QX4A 4CQAA 3U2ZA 4DN1A 3MSGA 3VZZA 1JCYA 1EDQA 1T7LA 2J8TA 3EX6A 3JS3A 4DB7A 1BKHA 4LRSA 2FPYA 3LBMA 4ZSTA 1FDJA 3VM5A 4F66A 3QFAA 3L66A 3MHGA 4JXCA 3WH7A 1Q4NX 2O4QA 2W0UA 4JTQA 1F05A 2WQPA 4X2PA 5FJUA 4FS9A 3V36A 3GDRA 1EQPA 2IUZA 1KRBC 4C6LA 2INEA 3CUHA 4EQRA 2WJEA 1VDVA 4Q22A 1D3GA 2E1WA 1KCXA 4DUVA 4LV9A 2FB2A 5FJPA 4GUGA 2W27A 4BJHA 2C91A 1TRIA 5AHIA 4DLFA 4IX2A 4GX9A 3M0KA 3ITGA 3CJPA 5E0KA 4Q33A 2YX0A 4WF7A 3MMWA 3TA9A 4Z1CA 1KBIA 3TSDA 2ZUMA 4F40A 1G0CA 2Q01A 3TWAA 1Z9AA 2OZ3A 1OEPA 4K8GA 4JR5A 2AAMA 2QGHA 3S2LA 2WSYA 1S5VA 1XLDA 1OB0A 2CXGA 2BXZA 4QEHA 4WIWA 3LOTA 4ZTXA 4C1KA 2ZXAA 2VT0A 4L1GA 1A5SA 3MZNA 3VKJA 2A85A 2XIQA 1YKWA 3MBFA 3PULA 2VWSA 1KV5A 4HIBA 1XLMA 1XGDA 2YVJA 1K9DA 2F7FA 5FD0A 3URNA 1XICA 1VS1A 3QOMA 2Z27A 1DV7A 1NOFA 1BYAA 1F3WA 3LHYA 2FH8A 2Q8XA 1OABA 1OFPA 4JOMA 2GUYA 4MAVA 4IIHA 3LZ5A 5AC7A 2WP6A 1EJUC 1XD1A 4ZL1A 4A2RA 1M7JA 3ZT6A 2C14A 4CQDA 1BWCA 5LGZA 1S2CA 5I79A 4QG6A 2DU2A 3WLLA 1V51A 1ISYA 1FWHC 2G41A 1M04A 4PUKA 3MSRA 1VENA 1KTBA 3P3BA 3HMJG 3FK4A 3VGDA 3BCFA 2ZQ0A 3NXFA 1FCVA 3OGSA 4PRTA 1JL8A 3O1NA 3UPBA 1E6SM 1N7KA 3E5PA 1TJPA 3ZR6A 4B9YA 4D72A 3P74A 4O14A 4QP0A 1YPXA 4X3ZA 1HO1A 3HGOA 1W1YA 3PFRA 1SW7A 4LVAA 4W5ZA 2RGLA 4UUIA 2AKMA 4FHAA 3KWSA 2HJPA 1BEUA 2R1MA 2D69A 2J9YA 3U3HA 2KZHA 1TPEA 4MZ1A 1XXXA 3PUGA 5FJIA 4HNOA 3PJUA 4KT2A 3WYZA 4E2OA 2NPXA 3VDAA 4OFCA 3WJXA 1XIDA 3UWQA 4NEVA 4UFJA 4M0XA 3CPUA 1LRTA 2G50A 3W22A 4XTDA 1HJQA 5D04C 2Y5SA 3CHFA 4YU1A 2P50A 4RNHA 4ZQMA 2QAEA 6ENLA 3GXDA 4I7WA 3W7PA 1J0JA 2QHAA 4RL3A 4FO4A 3EOLA 3LS9A 3MUCA 3W6YA 4MG4A 1J0ZA 4BS0A 1OK4A 3FJ4A 3VDBA 1DORA 1MXSA 1WO2A 4DJFC 1G4SA 2E4TA 4HYWA 2A7NA 3QV7A 3W7MA 5AB3A 1H1ZA 4AVFA 3GIPA 2EHHA 5KVIA 4DPQA 2QJMA 3LSBA 3J7HA 1F8IA 1H0GA 5EMMA 4Q4MA 2NV9A 1UH3A 2E5CA 2G8ZA 1QI0A 3S5NA 1FWAC 3LGDA 3THQA 1SFTA 1UZHA 2X40A 1QTWA 2BC0A 4D6IA 4LUJA 3DIPA 3M6DA 4L65A 3VA8A 2HE8A 4FR6A 4J40A 3E2VA 4FR1A 4TX6A 3OGVA 3U2CA 1UZ4A 3NZPA 4XVEA 4UTFA 3NQ8A 3BSGA 3GBDA 3OHIA 2WO5A 2NQLA 2JFEX 2E1DA 1R5YA 3RFAA 4MKVA 4G56A 2QJNA 3TZNA 4QG9A 4DWSB 3G3DA 2VDHA 2W4XA 4L6OA 4HT3A 4PUNA 1OX4B 1J12A 2A7PA 4AZHA 3KLJA 4AHQA 2V8ZA 1XFCA 5HMEA 1HG3A 3FA4A 5CCZA 3LDVA 1GOKA 3S46A 1GPFA 4LAUA 5ECUA 1QPRA 3PTQA 3IJ9A 4JYDA 4MADA 2MANA 5CH9A 1ZMCA 5XIMA 1HL9A 4TV6A 4KBXA 3S9IA 2X1IA 1MZHA 3F4NA 4WCJA 3W7DA 4Z1AA 4UZSA 1PWLA 1JRPA 1KRMA 3BO9A 1LQ2A 4L1WA 2QCGA 2V3FA 2HBXA 3CV1A 3WQDA 3M0XA 1SW3A 5CLWA 3POCA 1H6VA 1FWBC 1X8FA 4WDWA 3NQEA 4J7RA 1DJQA 1I4NA 3TWBA 1XIEA 2J7FA 4BEUA 1RPKA 2JQXA 4KFNA 1OZMA 1HXJA 3MDUA 2HE5A 2UY3A 4B16A 4WDTA 1WB0A 6TAAA 2X09A 5CGTA 1L6YA 4GZIA 2B7NA 5I23A 5MHBA 4IMCA 2HNHA 3E0WA 4QQ3A 4QBXA 1E70M 4OOZA 2UY4A 3S47A 3UJSA 5E5CA 5LIUX 4W85A 1XS2A 2GWNA 2O7QA 1P1MA 4GGHA 1XGZA 4RV8A 2PMQA 3UF9A 3LHVA 2P76A 3FVDA 1FUYA 4DM1A 4P8VA 3EAUA 2ANUA 4H9MA 5AHFA 1GCYA 1H2IA 2Y4SA 4GR1A 4UIOA 3WEZA 5HBFA 5G2HA 2B31A 4W7WA 3CU2A 1BRLA 3AHTA 3VK5A 5FF3A 1OGGA 2HXUA 4U5KA 3NZGA 4XUGA 3W2KA 4DZHA 3GFXA 3TFXA 3IJDA 3EPOA 1DWFM 3YPIA 1QJWA 4LB4A 5A6KA 2NX3A 3R0KA 3E49A 2QDHA 2Z7KA 3GU1A 3UNTA 3DENA 4IIFA 3FY1A 2FDSA 2VFIA 4G9PA 2VZSA 4UOQA 3LSCA 4HA0A 1ITUA 2PDBA 4CNSA 1RBLA 1YIXA 3PWGA 1A5NC 1QFEA 3MB9A 3BC9A 1ONRA 4C6FA 4AEOA 4RK8A 3PBWA 4AX6A 5CQ1A 3URQA 3DHUA 4M5PA 3FKKA 4AZ7A 1I60A 3VGGA 2VCBA 3MU7A 5CJ5A 1P4CA 2J7EA 3COTA 3AYRA 3TXVA 1S2UA 4FNQA 3BZGA 2BXVA 2YFOA 4IFKA 1XLEA 1GQJA 1EJ7L 1NWUA 1UB3A 4EQWA 4UXDA 5JH1A 1R87A 1U5HA 3AMKA 1YLVA 2Q02A 4R9OA 4MDOA 3VNJA 3USBA 3WLRA 3K30A 3AJ7A 2HK0A 1Z42A 3OIHA 1POKA 3A21A 1OC7A 1QNVA 3CWHA 4YTRA 4JTHA 3UJRA 1D7FA 2Y89A 2FZ9A 3FW6A 3CT2A 4XBJA 4G7EB 3REQA 3TNOA 3V75A 1ZP3A 4IG2A 1VYPX 3W7EA 3XISA 2GQ8A 1N2VA 4DF0A 2YXGA 2WM0A 2XHYA 4O15A 2HMCA 3ANVA 3QZ6A 3M46A 4AD1A 5C9UA 3AYSA 4MTVA 1EIXA 3SCWA 3WQOA 4X63A 4KPLA 5PTDA 4QR6A 3NDYA 3GWQA 1R2SA 4MWAB 1YQ2A 3A5FA 3BQ5A 3QFBA 2G0WA 2WHLA 4ZGYA 3BZJA 3LM7A 1HL2A 2WSPA 3QC0A 2ZE3A 5FOOA 1MRQA 3VGFA 1ISVA 4GH1A 2QIWA 3W84A 5T8GA 1FRBA 3OBEA 5GJPA 4ACZA 2OOGA 1ZJBA 1HKJA 4DNAA 4LOCA 2X0YA 1OJTA 1UR0A 2GGGA 3PP7A 4AD5A 1EEPA 2OWCA 2GVGA 1MQQA 5BW6A 4WOQA 3GU9A 4BQ5A 1LQAA 3WJYA 3BDKA 3IAQA 3RLVA 5CAKA 4YWOA 3IIXA 4IPPA 1D7YA 2V68A 3AOFA 3LYEA 5GQBA 4NZ5A 5DRCA 2OLHA 5I06A 1W9XA 3L2MA 2OJPA 1WQ5A 1ZTVA 3FJLA 3ORWA 4AZIA 4I9JA 1PX8A 2XSAA 3NPUA 4EPKA 2J74A 4CD5A 3AFBA 2WPFA 4EMIA 2CLKA 3WQCA 5IRPA 4AZCB 1JNEA 4NILA 3MCOA 2REQB 3TYDA 4U28A 3QM3A 3GDLA 4RCXA 3RG6A 1FHVA 5DANA 3OLDA 1VCVA 3U6WA 4HSNA 3AIRA 4XZWA 1KRAC 4PTVA 3I4KA 3RNMA 1TWWA 4BI7A 3R0DA 1P1XA 4AF0A 3CV7A 3G8RA 3VDGA 3SUWA 1TE6A 4QCFA 2VGBA 4V28A 4AAJA 1KQZA 3SIMA 4XISA 3KVLA 1DXLA 2BODX 3GNRA 2V5CA 2TYSA 2BBFA 4JTTA 4DY1A 2GUBA 4UCFA 1N82A 3DG7A 1J79A 2NVKX 3KBVA 1KR0A 1ICSA 3S5SA 3M0IA 3MMDA 4NZ3A 2QVHA 3W25A 1YQZA 4CD7A 4V33A 3NAVA 3GK0A 2YVGA 4H7VA 2ZRZA 1P0DA 3MDWA 3UG3A 2PDPA 2VJXA 4C6JA 5EGRA 2VZUA 3ID7A 2EQ8A 1DJNA 1XCFA 3I7RA 1NDAA 1K8ZA 3WD4A 5C0QA 3WF2A 4N9EA 2J24A 1EBGA 1ZALA 1KFLA 3EWDA 2YLLA 2J8FA 1R9XA 1W1A1 1A5AA 3T0BA 4HPXA 3HG5A 2YL9A 3EX1A 1BWLA 3DUGA 5CJNA 2GR0A 5REQB 4HZ6A 3VD5A 1JFHA 3VD3A 2C0AA 3LPPA 3S83A 3SUUA 2G37A 5TF0A 4LEQA 2D22A 1XPYA 1B31A 2V81A 2YA1A 1LG1A 3G22A 2ODOA 2QV4A 2CPUA 2PDLA 4JFTA 3NWRA 4DJFD 3LGGA 4S3AA 3EA2A 3HJZA 3NEHA 2WOQA 1OWQA 3QGVA 1CB7B 5A5WA 5FF0A 4F0RA 2HPMA 3DHDA 3L4UA 4AIEA 2F8QA 2W3SA 5D2TA 1CTNA 4G5DA 1C7SA 4WKAA 1E4LA 5I02A 3I4EA 4Q4RA 1ME8A 2HVOA 4IHCA 2QF7A 2BHUA 1AUSL 2PE4A 2Z2AA 3VPLA 1NHPA 4GZJA 3T6CA 4MAZA 3RLGA 4YJ5A 3VIFA 4AWUA 5LGXA 4FNUA 3T07A 3VIHA 4C6MA 3DOPA 1GRBA 3H54A 5FCZA 4UQEA 3H2CA 3ECQA 4LALA 1EYWA 1GHRA 2BMBA 3GRSA 1JVNA 1KLYA 5HQMA 3G8EA 4UMCA 1O5RA 4K1GA 2WBGA 4FXFA 2X41A 4L6HA 3JR2A 1E51A 2NUYA 1AH4A 1M01A 3T8QA 3NVZB 4JDRA 4LW7A 1K6WA 3SO7A 1AD1A 3UCCA 6REQA 5FS9A 3UR7A 1GERA 3OA5A 2QPXA 4YWSA 4HMDA 5AVHA 3SY1A 3IGHX 4WDXA 2DEPA 4S3DA 1H3GA 4QE5A 5E09A 3K4WA 1UUQA 1IEVA 1GQLA 1NP2A 4PMZA 5K4ZA 2GVEA 1WDPA 3Q2DA 4APNA 1QNPA 4JIQA 4NYUA 3BV7A 1BXBA 3FV9A 5I3IA 1E72M 4LWWA 3GR4A 1JPKA 3TTEA 3BLPX 3W81A 3CYVA 4GZEA 1IT7A 3LHWA 3G1AA 2CERA 3IACA 3H70A 4FP1A 1E0UA 4GD0A 1JPHA 4P7NA 4KWUA 4IFRA 5BRQA 1CGWA 2PWVA 1WAUA 1MXDA 3E1F1 1AQ0A 3WF0A 4N02A 3SGUA 3UA4A 4Y7EA 3ANYA 2XH4A 1FWDC 3QSTA 1Q2SA 3G3MA 4X9YA 3ZWTA 4CCEA 3EOSA 2DW6A 1AH0A 4U33A 5A1AA 3CGDA 3TE9A 3UZJA 4ORIA 1O94A 3C0SA 2AAAA 1K8CA 4BKNA 3AZTA 1TTPA 2E9LA 1G69A 3SSJA 4EK7A 1MNSA 4NU7A 1Q8AA 2Z1BA 1TUXA 2R1KA 3C2YA 4QJ4B 4QE4A 2CC0A 2QW5A 1A4LA 3NNTA 3R58A 2GVYA 4HU0A 4UQAA 1BVWA 4YMZA 5EBUA 3NL2A 2E7FA 1DVJA 1VEPA 2VKZG 2Y62A 4DF1A 3NQ7A 3WBAA 3O6YX 2AGKA 3BOFA 1YTEA 1BQCA 3V0TA 3TQ0A 2Z28A 3GDBA 7A3HA 1GRAA 3KTXA 4QS5A 1STZA 1MWOA 1K9EA 3SCSA 4HVXA 2ESCA 1PIGA 1J2BA 1ITCA 1HIZA 2CXEA 3CLWA 2E5BA 4AHPA 4UR9A 3B03A 1HKIA 1GOXA 3E0IA 4WY0F 4C1LA 4BF5A 4LS2A 1FECA 3MA8A 2D24A 4GH3A 3UJ2A 3ZJ7A 1CIUA 3K4DA 2ZZCA 1TELA 4KS0A 4EANA 3EWCA 1OCNA 3C0LA 1RA0A 3CH9A 1FEBA 1CXLA 3B9OA 2PTWA 2VYOA 4O10A 4I8YA 4XAZA 3DJJA 2V3DA 3H53A 3EMZA 4UQCA 3HFYA 3GXIA 1NH6A 3M0YA 4E4FA 3E2RA 1QI3A 4JTGA 3S1UA 5EKYA 1PTDA 3WFAA 5FI8A 2VR4A 1EOMA 1OFAA 3DH9A 1Q6LA 3CB8A 3VX0A 3VO0A 2PD5A 3T44A 5C7HA 2DGAA 1PX3A 1K77A 4JIHA 3RM9A 4D6DA 2WV8A 1NAL1 1V8EA 2E9BA 4JICA 4ZEPA 1KW1A 1WE5A 3R43A 3MCNA 3DKJA 2Y24A 3BJTA 3KE0A 3WD1A 5G5GB 3GS6A 4PZVA 4JS3A 3RILA 3KP0A 3BJSA 5HMDA 3URHA 4HA4A 1XV8A 1G6CA 1JPDX 2CZFA 2WMHA 2VEMA 3VIGA 1P5BA 2A4AA 3VGBA 4AWSA 1DHPA 4AC1X 3QMRA 4AYSA 2CESA 3CAWA 3PZ9A 3GAYA 4P7OA 4LEFA 4H4WA 3EWUA 5FS6A 5T9BG 2OLAA 5D2VA 3AXHA 3HF3A 1GONA 1V02E 4RZ5A 1E4IA 1YDVA 1TSIA 1RP8A 4GBDA 1J0HA 1FFVC 4IQLA 4C7GA 1XDIA 1REQB 1ONEA 1EL3A 5CSSA 3BOXA 2OWWA 2BGNE 2G4JA 1CI1A 2V6AA 4EIVA 3ATYA 5H91A 2I7GA 1WDDA 1VGAA 4B5WA 2NUXA 2WJZA 2WNZA 3G6MA 4HHHA 2POTA 3Q58A 2Y8VA 4YN5A 1XIJA 1J0IA 2IPWA 4KWOA 5C9ZA 4Q8WA 2VDGA 1FWCC 1KXQA 3NQFA 4UFIA 2XWEA 1QW9A 1FA2A 1R3QA 4AXKA 3LXBA 2A3HA 2A3EA 2Z6IA 1DQXA 4OT7A 2RDTA 3IPWA 3NQGA 4KH2A 5BMWA 1XLHA 3FEQA 3LBOA 4R53A 1SU5A 1E1FA 1IIGA 4EXAA 4LA1A 2HTMA 5HMSA 1KO0A 1X1OA 1AW1A 4QAWA 1EXBA 3W00A 4H8NA 1C91A 4ZOAA 2VGGA 3O9NA 3DFQA 1RJPA 2AOSA 2ZKMX 4LNYA 2BS9A 4CD6A 3P8IA 3UW6A 3PHAA 1E56A 5AY7A 1PB0A 3VXGA 5CBIA 5AYXA 5K4XA 5JBDA 4WQ6A 3INPA 1NHSA 3DFYA 3DK4A 2NWSA 3ZIZA 4Z2HA 3LXCA 1N62C 2J6XA 4NJJA 1DIEA 1R47A 2D3NA 1CGTA 4R88A 3OPSA 3RRAA 1ZB5A 4GCXA 3MPGA 3U4AA 1W5OA 5D8ZA 3W7JA 5CG0A 4AD2A 1WOAA 3STGA 1I1WA 1F3TA 1AVAA 1FHUA 4TQTA 4GCAA 4P7LA 3BLIA 2JE8A 2FQIA 4S2CA 1CB2A 4JQ9A 4ES4A 1MEHA 1KGWA 3B8VA 5A95A 3ABZA 1HVQA 4NI8A 4GQGA 2OEKA 1V79A 3T7VA 5IFPA 1FY6A 4IZGA 3AIEA 4KEZA 4C6IA 2VI0A 3H55A 4XZBA 1MDRA 2CWXA 3NXLA 2TSYA 3WNMA 1RV8A 2F6XA 2WWCA 2W91A 3P0XA 3R25A 4CEXC 4FAMA 5D09A 3AUJA 1EDTA 3ZT5A 1ZJIA 4AEFA 3EAOA 4DWSA 1OX4A 4LX4A 2Z7GA 3GXPA 4OUIA 2ACRA 1JYXA 2Q09A 3W1UA 2CBIA 4WRHA 2ZX9A 3CZ8A 1VYRA 4J3ZA 4JEQA 3VX1A 3A7AA 4A3YA 1TFVA 4OBSA 2QLYA 1B2YA 4JY8A 5A6MA 1DXFA 5I6SA 2FYMA 2LLEA 1PX4A 2VC7A 2HCVA 3RPMA 1MOKA 1WZLA 4JBRA 4AY7A 1ONWA 5CJMA 1VYSX 5GNYA 3TJ4A 2VFHA 4QDPA 2Z2BA 1BD0A 5JIWA 4P8WA 3CZKA 1NPXA 1H7WA 1DYSA 4ZOBA 4QSHA 2HK1A 1OG0A 1ZBCA 1FWTA 2DSUA 3Q45A 2PGWA 1KXHA 1XX1A 7XIMA 3T2PA 1ZP4A 4K38A 1DWIM 3B8UA 2BDQA 2D23A 3ITLA 2J8GA 1GEHA 2ATMA 2ZZ5A 3UZZA 2PRHA 3V3WA 4Q6XA 4IIBA 1UG6A 1XYBA 2FTWA 2V3GA 4ZVJA 1E0VA 3GW3A 1DJIA 3D9XA 4FDCB 3CEUA 3SY8A 1GHSA 4JNMA 1WNOA 3OU8A 5LKYA 3T0AA 3UXLA 3FN9A 3CMGA 3UESA 3KVKA 2WMJA 4HSOA 1MW2A 1UZDA 2BSLA 1XIGA 4DZIA 4JDBA 2O0TA 4Y9MA 1F8MA 4HZMA 3ZZ1A 5BROA 5J04A 3CB3A 1R3WA 1NQKA 3A13A 4Z1YA 2HDJA 4NZJA 1R9ZA 1V3HA 1L6FA 3BG3A 4S3KA 5TR3A 1GJWA 2FHFA 3OEXA 3D6NA 1SJAA 2WVTA 3L4XA 1I1XA 1PDZA 1TWDA 1Y0EA 5FEXA 1NIUA 4FSAA 3HG3A 1K7XA 3TA6A 3LXDA 4XZLX 5A69A 1M03A 4OOUA 1BYDA 1LTDA 1U1UA 1HQTA 4GWEA 3WLOA 1L8NA 1AZ1A 5DF0A 3UWUA 2ZRVA 3W6LA 1F9CA 3CQJA 4R7WA 3TYBA 3ITVA 2DV0A 4IOTA 4H2HA 4LUTB 4G1NA 4YYFA 4PEKA 2ZA2A 4FNSA 3H26A 3NPXA 2EPKX 4W88A 3GR7A 4UTTA 4GUJA 4Y9OA 4G6CA 4G8TA 1Q7MA 2X1RA 2ZTJA 4W9TA 1UUOA 3I6RA 3UG4A 3DFTA 8RUCA 3DEQA 4LSBA 1WXJA 4RR4A 4PMYA 4GXWA 4ML9A 4HOXA 1BG4A 1PIFA 2GH5A 1K7FA 1IZCA 3D3AA 2FJUB 1QOQA 2YOCA 1PWMA 1QPQA 2XVLA 3TC6A 3QQWA 1V3KA 1GVYA 3WMSA 1IIHA 1X98A 1Y8BA 3WBXA 4Y9PA 2PU0A 2ZZ3A 1JDCA 4LQ1A 4KEMA 2R14A 4Y9AA 5D38A 2J79A 3ZR4A 3EKGA 4N9DA 3C2RA 3AIWA 3W71A 4HNTA 4H4QA 3R2GA 4CGTA 2CBVA 1D8CA 2YKKA 2AAQA 2Z1KA 2BY2A 1PTGA 2NX9A 1EA0A 1JQXA 2QPUA 2XN1A 3QN3A 4JAWA 3K8MA 1M7PA 3PZOA 2CLPA 3S9YA 1XRVA 4R34A 2BY1A 3D46A 2IQDA 2Q8ZA 3T55A 4M1BA 4O19A 4MWAA 2C8NA 3WELA 3GB6A 2C7FA 3S6DA 4IPLA 4KFPA 2IPJA 3N2OA 3W2MA 5KZ6A 1MEWA 3HV9A 3QTGA 3W7KA 1EKOA 2PAJA 3DYPA 3N4FA 3DI1A 3HTWA 3KVMA 4D9PA 2V2DA 3WJSA 3CAVA 3ALGA 4NG3A 1XP3A 3M43A 4B3LA 4JIRA 3L0NA 1EUNA 1FWJC 4XK2A 2VL4A 3BVJA 5TD4A 2PCQA 4TO8A 1QHOA 2GSHA 4B5NA 2GGHA 4Z2GA 4M56A 4Y8FA 1VPXA 2C3ZA 4HHPA 3UBPC 1I2RA 3KL0A 3SUVA 3N2XA 4AD4A 1U1HA 1VLWA 3PPFA 3WJWA 2WANA 2R82A 3IANA 3ITCA 1H7NA 4ZB5A 5BU9A 5E6YA 4IP5A 3W1RA 1EHNA 1UIOA 4IUGA 3DK8A 3TJIA 4M6QA 3P67A 4YL2A 2H6RA 2ZCGA 4YVVA 1Y5VA 1JG9A 5CAHA 1MEIA 3LENA 1ODZA 1SVDA 4FF7A 4EPDC 1QK2A 2QDGA 4KGJA 4QE1A 1GOMA 1U33A 3AC0A 4GY7A 1XINA 1C7TA 4YHEA 3HG2A 3NVYB 2BG5A 5I3HA 4CQBA 8CGTA 1V03A 2OFJA 4HN4A 2PC4A 3SRDA 3RR1A 1PYMA 1R7AA 3BAXA 3EF6A 2GJXB 2R8WA 3K5XA 1YYAA 2C6QA 3FEMA 5FF4A 3H4XA 4AZCA 3G1XA 4Q8UA 1QO5A 2REQA 3VCRA 1TR1A 3VNLA 2DIKA 3KRBA 2ACUA 4MJMA 5I5RA 3ELFA 4HMCA 2VM8A 3PJWA 4GABA 2ZTKA 5ABFA 3GTIA 4GYJA 1H5VA 3KRSA 1XIHA 3ARRA 1J2WA 2GK1B 4B2DA 3C8FA 2XIMA 5HJYA 4KRZA 3AISA 3QYQA 3T0CA 4HNUA 2CEQA 3H23A 4M6UA 1C3FA 4W7VA 4GFIA 3QMSA 3UU0A 3P6LA 1A0CA 4TVYA 3GC2A 2WSQA 5CKSA 2NQ5A 3K1DA 1CXIA 3MWAA 1RBAA 2XISA 1KD0A 3ABOA 1UROA 2XFRA 3CUXA 3MYOA 3W7LA 2EPNA 1UD8A 2Q3RA 1AK5A 3PAOA 2DT0A 4ENLA 4GRTA 4NNCA 1UA7A 4UTKA 3EWXA 2WZMA 3S6OA 5DT7A 3CC1A 3W1PA 1EA9C 1V6VA 2OR2A 1TV2A 3M5YA 2ZICA 4LANA 3QZAA 3AMCA 5G4HC 3CIWA 3GXTA 3V5OA 3EB3A 3M9YA 1RAKA 4PN2A 3VMPA 1E5NA 4NJGA 3B40A 1JYVA 3FSTA 2TPSA 3MCMA 2YJQA 3THCA 1A50A 4Q32A 3M0LA 4MNMA 2P0IA 3HQPA 4WJ8A 1H60A 4UC5A 5M5DA 1Q66A 5REQA 3RDKA 4DJDA 4DO6A 5LNVA 3E5BA 4YXGA 3A23A 4LT9A 2E5AA 2EQ9A 4EM4A 3H12A 1UBSA 2PWFA 1NWRA 1PSCA 1BHGA 4H41A 4JN6A 4RX0A 4UTHA 3P62A 4GI4A 1SR9A 3FJNA 5DBUA 3SURA 2J9ZA 1V0LA 3CQ0A 4R9XA 4Q8PA 1F74A 4JPGA 1LOSA 1Q3NA 2QCLA 1JQVA 7ODCA 4RXFA 2DT2A 3S2MA 2DIJA 2VRKA 4JTFA 1LORA 3A9BA 3UGVA 4Z2LA 1VBUA 2QYGA 6XIMA 3NRZB 2ZZ7A 1JEHA 3SCQA 1N55A 1X1NA 2QCFA 4HNNA 5DMLA 4XKYB 4J28A 3LI1A 2VUYA 3K2GA 3NVDA 2A1YA 5AYBA 5ECVA 1XDLA 2BC1A 3BXWA 1OCBA 1FIQB 3P61A 1TJ2A 1TWSA 4L9XA 1CDGA 1XH1A 1UD2A 2ONEA 3I10A 4XUYA 3MVTA 3QW4B 1RBOB 4PMRA 3BICA 1CT5A 2A3CA 2OG9A 5I0DA 1K1DA 1IHIA 4Y90A 3C0QA 1G01A 5HNTA 3CBWA 4DYKA 2GVLA 2EJAA 1JPIA 4F79A 4HCLA 2H3BA 2OTDA 2IXVA 1K3UA 2OPJA 3M7SA 1IYXA 1Q4WA 3WMLA 4CKQA 4FI4A 3OVPA 2GZXA 1H2JA 4HCDA 4H6KA 1C9WA 5HATA 1YPIA 4X0NA 2DUZA 2P53A 3GC4A 2CZDA 4LVBA 4W8AA 4GHRA 4HKPA 1JZ7A 4W87A 1ZY8A 4N7QA 2D0HA 7PTDA 3TROA 3O8AA 4ZBCA 2V5KA 2CBUA 2PCEA 5FL1A 3WLTA 2E09A 4M52A 2ZRWA 2IKHA 4REQB 1A5UA 1W5QA 2FTYA 1KBJA 1XQKA 2IQTA 3PANA 3UXKA 4K1WA 2HQMA 2VRJA 3VOIA 4OJYA 1B3YA 4DWSC 3PUDA 3PG6A 4NF7A 3II1A 5DCDA 4IXHA 2ZDSA 1E6ZA 4GVIA 4RXGA 4HMEA 1THFD 1W32A 4JNZA 4AWEA 5KSWA 3IVUA 4NX0A 3KBMA 5GVJA 1UWIA 6XIAA 1A3WA 2I5QA 2W5FA 5I3GA 2E67A 2V2CA 2R9RA 1WXZA 1K70A 4O0KA 4QEEA 2ZFAA 1HKWA 3VM7A 2P8CA 2VEKA 4D71A 4O16A 3HPXA 4WY0B 1XQLA 2YLAA 3A4JA 4H83A 4M29A 4ACYA 3LCXA 1GNXA 3MP4A 3AJXA 3GSMA 1VFFA 5FL0A 1V93A 2GDQA 3SCPA 4XAGA 1W6TA 5AYYA 2B7PA 2OGJA 1NOUA 1E0WA 3AS0A 3M0VA 1X6NA 3LPGA 3SGGA 3FKRA 3TJLA 2IW0A 3M6YA 4B3ZA 3T1GA 1XFBA 1LLZA 4JYFA 1OZQA 1XSIA 2QUNA 1E9IA 3BANA 3CNYA 2XIIA 4QRNA 2OKOA 2DP3A 4U10A 5DXYA 4O1CA 4DI9A 4FNPA 1LQ0A 2O92A 2PLMA 4C7FA 1DJXA 4MB1A 3I7QA 3P80A 4RE4A 3WLKX 3GDMA 4LYKA 1WDWA 4LGXA 1LROA 4PUJA 2PGRA 4MMWA 2WQDA 1XSJA 4M8UA 1E9ZB 3DGRA 1PJ9A 4GJIA 3Q94A 4W84A 4F9JA 3VKCA 1ZXIC 3C3UA 3H2MA 4MPKA 4QIUA 3RUBL 5H2ZA 3NO3A 2GFTA 3W82A 3VNDA 1UJPA 1LBLA 3PBMA 5ABHA 1VPQA 3FDKA 1A0EA 1GUVA 2NSOA 1FDYA 3EMQA 1XIMA 1QXLA 3BLDA 3ITTA 3BURA 1K8XA 1XLJA 1WBHA 5EBAA 3Q6JA 4O12A 3AUOA 4JYEA 4ZSUA 4NZ4A 4WVXA 4KF1A 1W56A 2QCCA 2FVMA 1FXQA 3H8AA 3ONCA 4XD3A 4LYQA 1CPUA 8TIMA 1V6UA 3PNUA 2ZRYA 4CVWA 1YX1A 1X1ZA 4ZCWA 4PBEA 2B7QA 4TVDA 4TVUA 4C65A 5D9PA 4PC8A 4J3UA 1KM4A 3OP2A 3WMCA 4D6FA 5HQEA 2I14A 5EMLA 1J5SA 3PPGA 2XSBA 5H8MA 1CECA 1JDAA 4CNTA 3TN4A 2RKXA 1YNQA 5A94A 1S3TC 1X97A 4IF2A 5I03A 2VO5A 1RQEA 4H4SA 4DO4A 2VC9A 1U5VA 1PIIA 4EAMA 1JI2A 3OLEA 4TX8A 3QHNA 5D05A 3LTYA 1REQA 2C13A 4AIOA 4DXXA 4C6KA 3VAVA 2QUTA 1ZGDA 1VBRA 1K4QA 1SGJA 5BOEA 1H7XA 2V0TA 3NVWB 4B5TA 1LF1A 4UFHA 4FALA 1OFBA 1QO2A 3Q65A 2VCCA 1KTNA 1HFBA 1K7EA 3W75A 5FSDC 3DN5A 1GV4A 1LG2A 4DEFA 4K6AA 3KOYA 4DO5A 4WDUA 5CC5A 2A6LA 3WSUA 1G7VA 3L8KA 5AC6A 1GVQA 4XD4A 3W4RA 4GY1A 3IIOA 1B9ZA 4QJ1A 3OLGA 4OUEA 3BLEA 2Y63A 2OZ0A 1F07A 2P8BA 2CITA 1FWIC 3WLIA 1BGGA 4GK8A 3UJFA 1M7OA 3M4HA 1IT8A 3UVIA 4UFMA 2WW5A 1O5XA 4F0MA 4KETA 1ZL1A 3N29A 1TZ7A 4DHGA 4NJIA 2VEIA 4Q3MA 1ITXA 1UMYA 2YBTA 1R46A 3CHEA 2PA6A 1DIOA 3B9EA 3G24A 3OYZA 4IUOA 3LPOA 4O0QA 4JTKA 5A8MA 3B3DA 2OO0A 2PDQA 3ZMRA 1DJGA 4HNCA 3QV9A 4I9TA 3TDFA 2YGYA 1AOGA 2VFEA 1E71M 1DKWA 4PGLA 4FX8A 1HKKA 2DZAA 3E6EA 1R30A 5A2BA 4RNIA 1BYBA 5HOSA 5FF7A 1YTKA 4PRWA 3SRFA 2IKIA 3ZWSA 1WKEA 4L4PA 2C0HA 1FCQA 4ZB2A 2ACQA 4E8DA 1W3HA 3M0ZA 5I7GA 3TTQA 1QDSA 1BTCA 3LHZA 1FQ0A 1Q6DA 2DSKA 4JTDA 3QY6A 1TPFA 3N25A 1PHQA 4S38A 4ASTA 1N63C 4AYGA 1MUWA 4EE9A 1EC8A 4NT0A 4B15A 2ZUTA 4R7JA 2C3CA 2VELA 2EXOA 4J3WA 4QGCA 4G1KA 1M6IA 1TYGA 4LCSA 3QKZA 2ABBA 2X2GA 4PMNA 1MZRA 2Z0IA 3SN4A 1JXJA 1ZX9A 4U5IA 5JH2A 3MUZ1 1M7XA 4Q8OA 2OX4A 4JEJA 2A3LA 3F2BA 2EPMX 4DZ5A 3SR7A 4IMEA 4CCZA 1P48A 1QI2A 3C0JA 5K2ZA 3LHUA 1JFXA 3OZPA 3F4CA 1QATA 2NV1A 3PY2A 4WX2A 3TXZA 4EMWA 4BA0A 3W7NA 1HX0A 3B8DA 3AWOA 3UY8A 1C90A 3E0VA 1V3IA 4JQ1A 5CPNA 2OWXA 3G5EA 3BAYA 4GUFA 3TQPA 5XIAA 2QUUA 3PPCA 1EHAA 4YTSA 3AS2A 3S5YA 1B30A 5CC7A 4Q4PA 1FHLA 5LA0A 3GAKA 3R11A 4R7OA 4CEUC 1VD6A 5U25A 3CUJA