4DXKA

Crystal structure of an enolase (mandelate racemase subgroup, target efi-502086) from agrobacterium tumefaciens, with a succinimide residue, na and phosphate
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
400
structure length
364
Chain Sequence
MKITKLETVRVAERTNLLWVLVHTDEGITGLGETFFGAETVETYVHEYIAPRVIGRDPLQIDLLAQDLVGYLGFRSSGAEVRGNSAFDIALWDIFGKATNQPIAQLLGGFSRREIRTYNTRADELAHSLLEDGITAMKIWPFDAAAEKTRGQYISMPDLKSALEPFEKIRKAVGDKMDIMVEFHSMWQLLPAMQIAKALTPYQTFWHEDPIKMDSLSSLTRYAAVSPAPISASETLGSRWAFRDLLETGAAGVVMLDISWCGGLSEARKIASMAEAWHLPVAPHCTGPVVLCASTHLSLNAPNALVQESVRAFKTWYRDLVTALPEVKNGMITVPPGAGLGMELHPDIEKTFTVSRRFSDAASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an enolase (mandelate racemase subgroup, target EFI-502086) from Agrobacterium tumefaciens, with a succinimide residue, na and phosphate
rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
molecule keywords Mandelate racemase / muconate lactonizing enzyme family prot
total genus 125
structure length 364
sequence length 400
ec nomenclature ec 5.1.2.-:
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4dxkA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4dxkA01
2GGGA 4GFIA 1W6TA 2O56A 4E4UA 3MZNA 5FJOA 3UJEA 4JN7A 3NO1A 3CB3A 1MNSA 3VC6A 3ZVHA 1FHVA 3HPFA 1ONEA 1BKHA 1SJDA 3CAWA 1YEYA 3UJ2A 3UJSA 4HPNA 3DERA 1MDLA 2PPGA 1ELSA 3UGVA 4DX3A 3PK7A 3H70A 3VCNA 3OP2A 3R1ZA 3ES8A 3R0KA 2XH7A 4E8GA 3SN0A 4E4FA 2MNRA 2GDQA 2OQHA 3B97A 1NELA 3SN1A 3TJIA 2PMQA 5BOFA 2ONEA 4GIRA 1SJCA 3MY9A 1JPDX 4IT1A 4DYEA 3MQTA 2AL1A 3R11A 3QPEA 5EU9A 2GSHA 4ENLA 2HXUA 1SJAA 2GGEA 3FVDA 3IJLA 5FJPA 2NQLA 3D46A 3N6JA 1EBHA 1KD0A 3DG6A 5FJRA 1EC7A 2DW6A 2DW7A 4KT2A 4DWDA 4MGGA 3TWBA 3SQSA 3ZVHB 3BOXA 2OQYA 4K1WA 4J3ZA 3P3BA 4HCHA 1TZZA 4DHGA 3TCSA 2QGYA 2GL5A 4E5TA 3NFUA 3RGTA 2PTXA 4KEMA 7ENLA 2OX4A 3CYJA 3OZMA 3I4KA 4KWSA 1MDRA 3Q4DA 2PU0A 4JHMA 3V3WA 3DGBA 4HCLA 4GGHA 1FHUA 4IZGA 4GISA 3UJFA 3ZLFA 3JVAA 3N6HA 4ROPA 4DN1A 2PODA 3VCCA 2P88A 3RCYA 3R0UA 1F9CA 1XPYA 3MUCA 3VC5A 3QKEA 4A35A 1EC8A 4X2PA 3UCDA 2POZA 3RRAA 2QQ6A 3V5FA 4KPLA 1RVKA 3Q45A 3P93A 1KKRA 2FYMA 2RDXA 3D47A 4EWJA 3SBFA 4J1OA 3V5CA 3TTEA 3ZLGA 3UJRA 3TJ4A 1DTNA 3DG7A 2OFJA 3SN4A 3STPA 1JCTA 5FJUA 3DFYA 3CK5A 3GY1A 4MKSA 3BJSA 3H8AA 2OZ8A 1TE6A 3ZLHA 4IL0A 1P48A 4IP4A 1SJBA 2PTWA 3ENLA 2P8CA 2PA6A 2AL2B 6ENLA 1TKKA 2PGWA 1L8PA 3V4BA 2GGJA 2PS2A 2QJNA 1EC9A 3EEZA 3RR1A 2XSXA 3TOYA 2PGEA 3N4EA 3DIPA 1EBGA 4K2SA 3NZGA 3KUMA 3TW9A 3CT2A 3R25A 3FJ4A 2PTYA 2OZTA 4DXKA 3EKGA 2I5QA 3SJNA 4HCDA 2XH2A 2QDEA 3SSZA 3R10A 2QJJA 3T9PA 3MKCA 4Z1YA 3DDMA 1KKOA 4IHCA 3THUA 3T6CA 4A3RA 1JPMA 3GO2A 2P8BA 1WUFA 1IYXA 3CXOA 4A6GA 3NXLA 1E9IA 3QTPA 2OG9A 3VDGA 4HN8A 3P0WA 3DESA 2MUCA 3VA8A 3RO6A 2XH0A 2ZADA 3VFCA 1NU5A 1OEPA 2OKTA 4IP5A 5BOEA 3JW7A 2OZ3A 3OZYA 4Z17A 3S5SA 2HXTA 3IK4A 2PU1A 3MWCA 3H12A 3FYYA 4K8GA 1R0MA 3PWGA 2PTZA 4HYRA 3QLDA 3GC2A 2PP0A 1WUEA 3UXKA 3K1GA 4H19A 3TWAA 1MRAA 3OW1A 1PDYA 3DG3A 3N4FA 4HNCA 2PP1A 2GGHA 4ZA0A 2XH4A 4M0XA 1XS2A 2OVLA 2HNEA 3OPSA 4F4RA 2XGZA 3PWIA 2QDDA 2FKPA 2PCEA 1R6WA 3T4WA 3S47A 4HNLA 5J04A 4G7FA 3I6EA 4IL2A 4ZCWA 3H7VA 2GGIA 3PFRA 3T8QA 3DEQA 3I6TA 4JN8A 4GYPC 2QJMA 3GD6A 3BSMA 2AL2A 3UXLA 3IJIA 3FCPA 4G8TA 4H1ZA 3ZVIA 2OO6A 1JDFA 2CHRA 2P3ZA 3U4FA 1P43A 3JZUA 2ZC8A 3FXGA 4GMEA 3DFHA 1BQGA 2PSNA 2PP3A 4GYPA 3RITA 3TQPA 4FI4A 4GGBA 1KCZA 2HZGA 4H83A 4E6MA 1PDZA 3MSYA 4M6UA 3IJQA 3FV9A 2AKZA 4MMWA 3ES7A 1ECQA 3UCCA 4FP1A 2P0IA 5ENLA 2OPJA 1MUCA 2OLAA 3OTRA 2AKMA 4YWSA 2QVHA 5FJTA 4H2HA 5IDZA 3QN3A 3U9IA
chains in the Genus database with same CATH superfamily
2E1WA 1C3FA 4HIBA 1HKVA 1S3TC 4RXFA 2GDUA 4QHRA 2ACQA 3UJEA 2ZZBA 1XYMA 3CB3A 5A6SA 5K4ZA 3AIWA 2YVJA 5A8OA 3UA3A 3SRHA 1R7OA 4JAWA 1UH3A 4LYQA 2BVDA 2A7PA 2PDUA 3ATYA 2QAFA 4HZ8A 1F8MA 4DO7A 4PUMA 4S3EA 3QR3A 3B0UX 5AYZA 1CPUA 4NSBA 3E5BA 3AYVA 4PMRA 1JD7A 4IQEA 3RK8A 5DCEA 1WXJA 4K8EA 3ZT6A 2Q09A 4ORIA 2NX9A 1KXVA 2VDIA 3AIUA 1PTDA 5JMUA 1KCKA 3FJ6A 1FP9A 4MYXA 1LL4A 2AQOA 2Y2WA 4J4KA 2QUNA 3BWWA 3WLJA 2PMQA 1I8JA 3WO8A 4FA3A 1EEXA 4B5TA 2FZ9A 5ABHA 5LIXX 2WC7A 5DXXA 3PPHA 4ENLA 3CGBA 2GR3A 3OVQA 3KRBA 1K9DA 3M7SA 4QFUA 1V02A 1F2JA 3STGA 2OJPA 3TMQA 3QV9A 4KFOA 4WJ8A 2J75A 1QW7A 1H4PA 1R46A 3B9AA 2RDWA 4MNLA 5D2VA 3HGRA 1CXLA 4F9JA 2R8WA 2OQYA 4BWLC 3P3BA 4I8DA 4DWSD 2GL5A 1UUMA 1UR0A 2PTXA 4ZEPA 2W3RA 5KZEA 4DAIA 5I77A 3BARA 5K9XA 4L6OA 1W1VA 3CYJA 1Z69A 1MMFA 1QI5A 2XVKA 1V3KA 4LAOA 1VBRA 2Y8UA 2HS6A 1HJVA 4C7DA 2WZHA 4IZGA 4H50A 4OE7A 4GISA 4XK2A 3PZMA 2ISSA 1ADDA 2PDXA 4WXYA 3PSWA 4O0ZA 4XD6A 1RHCA 1PZ2A 2YIHA 2QIWA 2NPXA 2BY3A 2VELA 4QS6A 3KDOA 3HG3A 5AFDA 1NIUA 1DWIM 4D6FA 1SVDA 2D20A 4HZ6A 2XN2A 3DGRA 3VIFA 3ZSSA 5JBEA 3EOSA 1D3GA 3BURA 2Y0FA 3WNNA 4LAUA 4CU8A 3TC6A 2ZICA 3S2LA 3L5AA 3ZLGA 3W7DA 5AC7A 1RR2A 1WQ5A 3DFYA 4LUSB 3IIXA 4J40A 1TX0A 1E0UA 4RNJA 2PDWA 5IFTA 3ENLA 2CEQA 2P8CA 1WE5A 3COTA 1KFBA 1CWYA 3MUXA 4CU7A 3T0TA 3V4BA 4LCSA 4IJCA 2DUAA 3KOFA 5DY2A 4A8NA 1TCDA 3B9JB 3DZ1A 3R43A 4MKNA 3IIPA 2J66A 4RNHA 4ICCX 4H9VA 1FWWA 3B03A 5CH9A 2XVGA 2GVYA 4GBDA 4EXAA 2BGNE 5DANA 3S5NA 3B8SA 2IPWA 2B7NA 4GXMA 2WM0A 3RNMA 2J25A 2BY0A 1GKPA 3T9PA 1XCWA 4RE4A 1PYFA 3AS0A 4URIA 2ZZ1A 5B7YA 1U5HA 4O53A 4M24A 2G3JA 3BCFA 4D1IA 3I7QA 1OM0A 1IE7C 4I9TA 2H3BA 1UWIA 1H1YA 2YCLB 1XKJA 2CLPA 4LSBA 4OQVA 3PBVA 1P6WA 1V59A 3RO6A 4IF2A 4WXZA 4B5SA 5A69A 2WOQA 4IP5A 2OLHA 3EKLA 1H6VA 1WKEA 5PTDA 1P6CA 5F1UA 1QT1A 2NWRA 1VCGA 2NXIA 4Q6XA 1NHSA 3MO7A 1G4SA 1IEIA 1R0MA 4F48A 1AH3A 2WZMA 4ZB2A 3IK2A 3EUB3 3KX6A 3QLDA 1WB0A 4W84A 2ASHA 2RH9A 4UQ9A 3TQ0A 2O92A 4NVTA 3PUOA 4PB4A 4QLJA 3YPIA 2NQ9A 1FHDA 1KFCA 2PGFA 1DXEA 2DZSA 4H8NA 5IBXA 3B3DA 2VP8A 4IMDA 4D6EA 4DO6A 1S3HA 4ZA0A 3M5VA 3NQ7A 1OFOA 4XB3A 4XG1A 1R87A 3IJ9A 3D3FA 3BOFA 1Z7AA 4J9JA 2OWCA 4PL2A 3S2CA 1O94A 1ZRQA 2W6RA 1VBHA 4IFKB 3A24A 3WH7A 4IMCA 4UMBA 3UCQA 4PFHA 1L6GA 4CNPA 1WX0A 3KVLA 1ZY9A 3GNRA 1JULA 4LAMA 3UWUA 4Q3MA 4R85A 1IWPA 1GZJA 1F61A 1NHQA 3IJIA 4PUEA 3WLLA 8A3HA 1EDQA 1X8FA 3RX2A 1XL9A 4IMEA 3EBVA 4GH1A 5CSSA 4X60A 3GH4A 2HRWA 4RPQA 4PZVA 3EKZA 4IMAA 3T78A 4FI4A 2BHUA 1W3IA 5BZAA 2PUZA 1A3HA 2BOFX 4F0SA 2FQIA 3T4CA 3IVUA 2P0IA 3D5HA 4DB7A 5K4XA 2BODX 1OGGA 3CS2A 3IVSA 3PJUA 3KAOA 5I09A 3URQA 1UIPA 1GRBA 3LTPA 4A22A 1AL7A 3LZ5A 4JS3A 3UPMA 2GGGA 3BAWA 4GFIA 2Z1WA 4M1BA 4CCZA 2DUZA 2BGSA 4L4PA 2GWGA 4LVDA 5I6SA 1FFRA 1CYGA 3P80A 5C7VA 4A8LA 4V33A 3CU2A 4Q7BA 4AW7A 1GRHA 4PTMA 1M53A 1HGYA 3WKZA 1Y8BA 1ZTVA 3LMZA 1SQ7A 2J88A 2ZRYA 3AIQA 2WWDA 1ELSA 4FX9A 5HWNA 4W93A 5KETA 1CT5A 1EX5A 2NUXA 1TJ0A 4N2YA 3PAOA 3G3DA 1XIIA 4F2BA 2P1FA 1GRGA 3M1ZA 3W29A 2Y8VA 4HU0A 3MUIA 4OKDA 1IEVA 5U25A 2VD8A 3TU9A 3WLTA 3LRLA 1VPQA 4JL2A 4H9YA 3TN5A 1G4PA 1VHNA 4YCPA 2I5IA 1KM0A 1G0CA 1WDQA 5EA9A 3D46A 2OXNA 2HK0A 2YCJA 1A50A 4Q4OA 3N2TA 4PBEA 3RF9A 4H00A 1Z8AA 2D73A 3QQ1A 3TR9A 4NI8A 3VVGA 4YIWA 2FZNA 3DK9A 4IPIA 2X99A 1QK0A 4S23A 3SUUA 1M68A 1WNOA 1RA5A 3NNTA 3QZEA 3WQ5A 1BYDA 4MGGA 1K9FA 4U3AA 2Q6ZA 5EBUA 2NV1A 3CH0A 2VDHA 4IM4A 2A2IA 2HTMA 1RPXA 3G1DA 3W7PA 3FA3A 1BTCA 2V6AA 1KTBA 1TE1A 3CUJA 1BXNA 1WV2A 4K38A 3MP5A 1TJ1A 4QX4A 4KWSA 5AYXA 5BXRA 3TYAA 4AF0A 1E73M 1V3IA 1V03A 4O1AA 4HCLA 1D2KA 1A5CA 1SSGA 1W1ZA 1J18A 2J7BA 3NVZB 4H6RA 1QAPA 3SQPA 5BMWA 3FHQA 5D32A 1T6MA 2E6AA 5AHFA 3VC5A 3MCMA 4S2CA 4UZUA 1ICQA 2OWXA 2XVPA 4AFYA 4KPLA 2WCGA 3QKZA 1KFKA 1R2RA 4DPQA 4XZIA 1PPIA 1PV8A 3ARUA 1UKTA 2RDXA 1U33A 3SBFA 4AIBA 3LNMA 4TIMA 2V2HA 2EPKX 1OCBA 4XKYB 1NSJA 3AS1A 1ZSXA 2NXGA 1G67A 3K46A 4XIMA 2G37A 5GRTA 3ZLHA 3CZJA 3EF6A 4PMUA 4L61A 3WD4A 4IL0A 4FX6M 1P48A 3PTQA 3FJNA 3GFYA 5HANA 3N17A 4OIFA 4FSAA 3UWYA 2FB2A 5B7ZA 4YHEA 4LNCA 4JTGA 2WVUA 4WDUA 1EBGA 3I3DA 2XSBA 3ITCA 3LERA 4HKPA 5D05A 1REQA 3NOYA 1XHCA 4M52A 4H9ZA 3UU0A 1XYLA 3KHDA 3VU2A 3SJNA 2IS7A 2ZE0A 2VFFA 1XC6A 2R1MA 5AB3A 4HNOA 4WY0B 4Y8FA 1XLBA 1WPCA 3L0GA 1TV8A 4P8UA 4MIMA 3MV11 2YLLA 3LV6A 1I0BA 1YQ2A 2MUCA 2Q01A 1WDPA 2G50A 2XH0A 1N61C 4AY7A 3M07A 3RJYA 3EMZA 3A3XA 1R2TA 1RQEA 3EXTA 2C71A 2DQWA 5AVHA 1MW3A 1TPUA 2PDLA 1UQZA 2WNNA 2D0GA 2YZRA 2CESA 4C6PA 4K8GA 2FGBA 2XWEA 4QE4A 4TX8A 3TR2A 4GX9A 4HD5A 3G77A 2C1HA 2FDMA 2A8XA 4MB3A 4ZOAA 4EPEC 1R3YA 1X6NA 2XFFA 5IXEA 3K8MA 3KEHA 4B5XA 2EQ6A 4HOWA 1X1ZA 2XN0A 2G3MA 4GJIA 2XGIA 1Q4NX 2GRTA 3WQGA 3BV4A 3ABSA 4KIRA 3OPSA 3NZQA 2X2YA 4FO4A 2YOCA 1F3EA 5BRPA 1GPFA 4BWLA 3FDKA 3WJXA 3S47A 1XSIA 2JKEA 5FACA 5A95A 2J3NA 5DFAA 2FZDA 4BK9A 4ZXOA 3W7MA 3TYDA 2VURA 2QCLA 2BB0A 4MNKA 3U2CA 4C6IA 3VDAA 1AMYA 1Q7MA 3WF2A 3K4WA 1EGVA 4LC8A 1OYAA 1S5VA 4G8TA 4AAJA 5HQEA 2P10A 4A2SA 1KFLA 3ZR4A 1LT7A 3CUHA 5D9OA 2WPEA 3IAPA 1GPWA 5F7UA 4BEQA 3DFHA 1L2UA 1JNDA 3N6QA 3PUGA 1NDAA 2HZGA 4AXKA 2RJHA 2HNHA 3LTSA 3G6LA 3SCUA 2I16A 3QXBA 3GS6A 1UZDA 4NI3A 2DZVA 1PL9A 4AZ7A 1GKQA 3AMCA 4IIFA 3N4AA 4H4PA 1FH7A 3G1HA 4C6QA 4HNUA 3EWBX 2Z2BA 3QBUA 2I1OA 2OMAA 4QJ1A 3CPGA 1YNYA 3ARYA 4W88A 1Q6EA 2RHGA 2OGJA 1KBIA 4LS1A 4AUBA 4JN7A 4L9XA 1TV7A 1GNXA 4JTCA 4QLKA 2W79A 4Z42C 1IZCA 3NQGA 3B9EA 3C8FA 2BS9A 4UR9A 5D9MA 1I2OA 5F4XA 3TKFA 4PMYA 3AIRA 3TCEA 2VVNA 5FF2A 1H7PA 4GPNA 3NL3A 4M56A 3SFWA 4WRHA 1K6AA 1TTIA 4M8UA 5HDRA 2Z2AA 3VCNA 1JRBA 3U2OA 1DOSA 3ES8A 1GHRA 4DM2A 1QI3A 2F84A 2X0HA 1PKLA 2ZA3A 3BVJA 1GCYA 4WZHA 5HUOA 2WPBA 1NQ6A 3NS1B 4DF1A 1E70M 2Z1XA 3RU6A 1EJVC 2Y7DA 4LBSA 5D8ZA 3V0TA 1R3TA 4NU7A 4HMDA 2YA2A 1EL3A 1FFQA 2XFYA 3N9SA 4TX6A 1F74A 2A3CA 2OT0A 2EPHA 5FEZA 5BYWA 1J2BA 3AUJA 4INFA 2Z25A 3DFPA 4IFRA 1WDSA 3L4TA 1IWBA 3Q58A 5CJMA 4OBTA 4PMOA 2QHAA 4MJZA 3JRKA 3CAQA 4QP0A 3U0HA 1GEQA 4EF9A 1XV8A 1TWSA 5BWAA 1QW9A 3B8WA 1HJSA 1BAGA 3TQVA 3NZ1A 1XDIA 5CC5A 1EJ7L 1FH9A 2XU2A 3MMUA 1CXKA 1LQAA 2CLKA 1Q5MA 1X39A 4C1NB 3BOXA 1UA3A 1DXIA 4AIUA 4US5D 1DJXA 2ZXBA 3MUY1 1XIBA 1GYLA 4EQSA 4K7YA 1I6NA 8CGTA 2C15A 1V3LA 4KEMA 2QCNA 5EKYA 3PZ9A 4XD5A 1XXXA 2YXXA 2A5HA 1MDRA 5FL1A 3LPPA 1JROA 1B30A 3O7UA 1MXSA 2FHFA 2YGYA 1QATA 4W5ZA 3M5XA 5FS6A 1OABA 3LSCA 2GJPA 4B4HA 1HNYA 2QAPA 4Z1CA 1LWHA 1UR8A 1XLKA 4MOZA 5EMJA 1N5WC 1N62C 1Y5WA 1BG4A 5CSUA 2BTMA 2DIJA 3AMKA 2FZ8A 2FGLA 2PWDA 1XM3A 1ME7A 4QITA 1SGJA 3V5FA 3N13A 2BGQA 4TX9A 1U22A 1NHRA 2VRQA 1J79A 2B7OA 4H4IA 3AAMA 4NASA 4EAMA 1JDCA 3TJ4A 2X50A 3ITXA 2OFJA 2WPGA 1OY0A 2WC3A 4HT3A 2OZ8A 3B06A 4HU8A 3P0XA 3AMGA 2DZAA 3LGEA 1PKYA 4B2DD 2H8ZA 3S4TA 3GXMA 3TONA 2WNZA 2PZ0A 4M80A 3TK7A 1TCMA 1I75A 3MI6A 1VDVA 1W31A 2PS2A 3UVIA 1BYCA 2CKRA 1DWJM 2QJHA 3N9RA 4JYEA 5A2AA 2IKHA 3TIMA 3S2MA 4KWOA 1E6QM 3AI0A 1ZAIA 4PCPA 1EXBA 1JCNA 3Q65A 3T42A 4MF4A 3DECA 4LUYA 1V0KA 3WNKA 3VM7A 1VFTA 2WJDA 4GXPA 1W9BM 1DWGM 3UXAA 2IXVA 4D6IA 4JZ5A 4MZ1A 4B4FA 4PN2A 4PTVA 3DFOA 2PRMA 4DQWA 3ZWSA 3GTHA 4NXKA 4LQ1A 1W2VA 2GPTA 1JI2A 2ALRA 3HOJA 3WK0A 1K7XA 4A6GA 1JDEA 3MCNA 1KRCC 2A21A 1DJQA 5KZDA 3BLKA 4HN8A 3P6LA 5FCZA 3GVQA 4MWAB 3AHXA 4DZAA 1GG1A 4HZMA 4PEEA 3WY1A 4C6MA 1ZJBA 1BPLB 1H62A 2W55A 4PMXA 1T99A 1KCLA 4OTKA 2PLCA 2ADAA 3BOLA 3FOKA 3JR2A 1GHSA 3WFAA 2PU1A 3MWCA 2RKXA 3AHZA 4RUBA 1F6KA 1QRQA 3NPUA 2TAAA 1Q45A 3H23A 2X1TA 4P7QA 1XPGA 4IICA 3VNZA 2PP0A 1UOKA 1VYRA 3N29A 3WMBA 2PBOA 4CN6A 2TRSA 3K1GA 2DJXA 1XFCA 4BURA 3OZOA 1KRMA 3OW1A 1CXHA 2PDGA 2Y7GA 1N8IA 2F6UA 4J5NA 1MQRA 3VUSA 4YS1A 3ALFA 2L5HA 3WNLA 4NP7A 1KBJA 4OJYA 3MSGA 1GOOA 2X16A 4IOTA 3TC3A 3VD7A 2ZDRA 3BZJA 4NAEA 1NOFA 3GNPA 1J0HA 4Q8PA 4LVBA 3UXIA 4UMCA 1UR3M 1UKSA 2PCEA 4IIBA 4RE0A 2G0WA 4WY0A 3LENA 3NO5A 4LRTA 1KM3A 2CLLA 1UWUA 4FXSA 2CWNA 3VNMA 2J7GA 4O15A 3PP7A 4ZCWA 3SRFA 4JTEA 3LHVA 3NQFA 1LBMA 3WDHA 4AMCA 4WIWA 1MXGA 2PURA 4AISA 3G3MA 3GXFA 4H4UA 1VIWA 1UR2A 3BSMA 4GRSA 3WBYA 4PCSA 3EYPA 5H6HA 4JTLA 1C7TA 5FF3A 3BK0A 4PRWA 4GKTA 4V1XA 4O14A 1RBLA 3UXDA 4R34A 2C7FA 4KCTA 1FBAA 1PVNA 3U4FA 1C9DA 1PZ1A 4JTFA 1B3WA 4UFLA 1OJTA 3SEPA 1R30A 2QCHA 1EP1A 1HJQA 4GYPA 5K9CA 1EPVA 4XTDA 1Q6CA 1O1HA 3VKDA 4LB4A 3EDFA 4UTTC 3W7KA 1QNOA 4QDMA 4MMWA 5ABFB 1AFSA 4EKJA 2OSXA 3QY8A 4MY9A 1XUUA 3EPOA 3NL2A 3OTRA 1V5XA 2AKMA 3QMSA 1ISZA 1CENA 5FJTA 1TUXA 4Q4RA 4OU1A 2TPRA 5JH1A 2GFTA 3CUFA 1M7XA 2W54A 1AD1A 2DQXA 1W1YA 1QFEA 4QNWA 5A5WA 2ZXAA 2HK1A 5BROA 3OA3A 1GETA 4PE8A 2VHLA 3P5ZA 2PC4A 1FHVA 1RP9A 5A1AA 3CQIA 2WHKA 3WJWA 4QISA 1LJYA 2EBNA 4RX0A 2FB3A 2UV8G 4C7GA 2VOTA 3C56A 2B7PA 3EWZA 4KWUA 2HVMA 4UQDA 2DSZA 4GVFA 3CLWA 3OP2A 4O54A 1R2SA 4IIEA 1QPQA 2B4GA 2BLEA 5D2XA 4B90A 1MW2A 3SCSA 3VOFA 1W54A 3G22A 3SY1A 1UH2A 3WSUA 5LNWA 3HG2A 3CWOX 3EMCA 4ACZB 1UZHA 4OV4A 3MY9A 1JPDX 3T0CA 2WM1A 4DYEA 4FNSA 1L9WA 4ERIA 3GG7A 1UW9A 1OIFA 3WG6A 2HXUA 1E6PA 4PODA 2W27A 2E1DA 1NF0A 2PTDA 3PZVA 3VMOA 5AHNA 2UY3A 5FJPA 4YWIA 4LUJA 1UBSA 2R9RA 3N2BA 1VPXA 1QVBA 4M19A 1VPYA 4P7NA 1YTEA 1KQYA 2Z24A 3IUDA 1DV7A 1IEXA 3WQDA 1US2A 5HK4A 3BLLA 1TZZA 2ISFA 4G56A 4B3LA 1OCJA 4LYPA 2W61A 1TB3A 3CEUA 3OZMA 1WCGA 1FHLA 3MP4A 1WDDA 1ZZMA 4MJ4A 1RJQA 4GGHA 2DP3A 1AJ0A 1EJSC 4NEWA 1WKYA 1ZHAA 1YKWA 2YB1A 3NL6A 1UMYA 2V68A 1Q2RA 4Q8OA 3NQCA 1UD5A 3RPDA 1S2CA 3AYRA 4H7ZA 3AXIA 6XIMA 3RNDA 4UTFA 3GXDA 1JFXA 3RLHA 3PN8A 3QR1A 2TODA 4GOAA 4EVZA 3TYZA 3DK8A 4X2RA 3GKAA 3FSTA 2OEJA 3P81A 5E6ZA 5A6KA 1KKRA 1TJ2A 2R1LA 3S1GA 1FTXA 2BASA 2WVSA 1LCOA 3TTEA 4A2RA 5C55A 1EJTC 4C5ZA 2X30A 1EEPA 3VNYA 1F6YA 3CK5A 4K8DA 4XISA 1LQ0A 3E2VA 5AC4A 1D7KA 5AYBA 2HQAA 5HMSA 3HMJG 4B5UA 2PD5A 2GK1B 1ZFJA 2YL8A 1LLOA 1I1XA 2BXYA 5ECUA 2DT0A 4IPJA 3M0VA 1MO0A 3W1AA 3M0HA 1X2HA 4JY8A 1DJIA 2Y88A 4WQ6A 3TOPA 3NPWA 3EEZA 3AMLA 1XANA 1QNQA 2WJZA 3GW0A 4F8XA 4PFMA 2CZFA 1R3QA 5CZTA 1SW0A 3WDQA 3ZXWA 5LNUA 1Z3NA 5GJPA 4WKHA 1VBGA 1DQXA 2ACRA 5BU9A 4JFTA 4UTWA 3A9IA 3A4AA 1F7BA 3MS8A 4O8AA 4DXKA 3ARRA 4N9CA 3NQDA 1TPB1 4CNTA 3WJZA 1SM9A 3TNOA 3QRHA 1M01A 2BX7A 4BKNA 4A21A 3G18A 4ZQMA 1TVLA 1GQNA 2F2KA 4JIPA 2NUYA 3O63A 1XH1A 2Z1VA 1LG2A 3CXOA 3QHNA 2IQ0A 1TWZA 2GR2A 2G3NA 3L5LA 5C70A 3QVQA 4HU4A 4Q4MA 5MHBA 1CLXA 4JQ3A 4UR7A 3K8LA 4Z1BA 3VX0A 4BF5A 4UQEA 2HV5A 4C6DA 1OEPA 5LXXA 5HMFA 1TZ7A 3G1AA 5JRBA 4R27A 4GWEA 4W8LA 1SR9A 3H12A 2VEMA 2Q8LA 4BF7A 3W4RA 1C8QA 1BGAA 3KBWA 4Y9MA 4WJEA 3O3RA 2QF7A 2V3GA 2DIEA 4LPCA 5JUVA 3W84A 1OF8A 1WZMA 3WX7A 3VIOA 3SCVA 2DT2A 5DMNA 4YYCA 1FWTA 1R9XA 1TV5A 2IKIA 3ZJ6A 1JCXA 1EOMA 3WUEA 4NZ5A 4R7WA 3MDWA 3R12A 3RPMA 1GOMA 4G1NA 1PSCA 1S2TA 3M0KA 5BMXA 4N9DA 4GQQA 1I0DA 6CGTA 2FFIA 4NNCA 3ARQA 2WSKA 4ZODA 4TVCA 4LIIA 4LY8A 4J7RA 5I3JA 3GRSA 4FX7A 3CHCA 1FWDC 1H61A 5L6UA 1TQXA 1B4EA 1W3KA 4YYFA 1XJBA 4HZ7A 5G2WA 3OBAA 3EDJA 3HQ1A 4N6FA 4O4WA 2DZPA 1OT1A 3GH7A 3S1XA 4GYPC 2XG9A 3GD6A 3LA4A 3ITYA 5HA7A 2E9BA 4OOUA 2OR2A 1F5ZA 1W37A 2DZXA 3VGFA 3W07A 5A8PA 2OO6A 5CGQA 2WVTA 2CHRA 5XIAA 1THFD 1VFLA 3SZ8A 1A5NC 1U1HA 1GOWA 3S6OA 1FX6A 4MLRA 4QDWA 3DI1A 3TQPA 4L1GA 3GBEA 3AALA 2PDQA 4Y9AA 3IPWA 4GHRA 3CGTA 5G4EA 3GTIA 3URHA 3LPOA 5D09A 4JL1A 4XSMA 1RQBA 3KWSA 3LV5A 1X6LA 3LK6A 1ZS2A 4RNFA 5G5GB 2VEGA 1ITUA 3WMCA 4EMIA 3K5XA 2YVFA 3ZR5A 1OG6A 1Q66A 1IZKA 3O0HA 4LYRA 2F7FA 3W1XA 4GACA 1UPMB 1W6TA 1MRQA 1POJA 2BVYA 3ONBA 1REQB 4FIQA 3QJAA 3MMWA 1NFBA 3EXRA 1FWSA 4JTKA 2F6KA 2VDGA 4L9ZA 3PNUA 1NFPA 5HJLA 3N73A 4GZ7A 1P0EA 4GZJA 5FAGA 5HMEA 3LPGA 3VMNA 3CAWA 1YEYA 3CL7A 3OZPA 3BAKA 2YYUA 1HUVA 4DX3A 2J7DA 3B8TA 4XQ6A 3PK7A 4YWOA 1VZWA 2TMDA 1FEAA 1E9YB 3SN0A 1B5TA 2MNRA 4YTUA 1DVJA 4XKYA 3TW6A 1ONXA 1B1YA 1PUDA 4W86A 1W5MA 2YFNA 3T2PA 4GQGA 3W2KA 1SUXA 1DJHA 1E55A 1U5JA 2CDUA 1UD6A 2R9ZA 3W70A 2XDFA 5EY5A 3TAKA 4NUWA 3H4GA 2FH8A 3M0XA 1P1MA 3GVGA 5DRIA 2O4QA 4JTDA 3PBGA 2GZXA 1H2IA 2CZDA 5FJRA 1YRRA 3Q37A 1A3WA 3ZVHB 2FTYA 4GI8A 3TTOA 1T40A 3R4IA 4S3KA 1FWEC 1YDYA 2VGBA 4CKQA 1PX3A 4CNSA 1MYRA 3GSMA 2VEPA 4H9TA 3BV7A 3B9OA 2D22A 1JGIA 2C79A 1CGUA 4ZB5A 4DELA 3FJLA 4C6EA 5I3KA 1FWJC 3WK2A 3W7HA 4V1YA 2EPNA 4AEEA 3L7RA 2I9EA 1H0IA 4KS0A 3F5JA 3N6HA 1JYXA 2VGFA 1W2PA 5CC7A 1M7PA 3LBOA 1TPVA 3WNPA 1AODA 2VC5A 5EYWA 1W17A 4XWUA 1OG0A 4DZ5A 2CC0A 4C6NA 4EF8A 5CKSA 1Q8AA 4DBUA 1UC5A 1MEWA 8XIMA 1GWJA 4TMBA 3OHIA 2O9TA 3VINA 2PWEA 3E1F1 1PCWA 3B9DA 3D47A 1R9ZA 1NWUA 1S7MA 1E0TA 2ZXDA 3VE7A 3L5MA 2ZA2A 1Q3NA 1FWAC 1NFGA 3FY1A 4IUGA 1X96A 3SIZA 4PSPA 3UG4A 3OLGA 1T3QC 3WUGA 3SSJA 1H3GA 4LT9A 1SJBA 2DGAA 2C13A 4XAPA 1KXQA 4HJWA 3I7SA 3KBMA 4LCRA 2AAAA 4GUHA 1H63A 3LLXA 3QMRA 1IGSA 4NG3A 3VKJA 4AWUA 2QULA 1STZA 4BY3A 3V0UA 7TIMA 3F4DA 2X0YA 4S3FA 3IEBA 3WQCA 3W2NA 3W71A 3F4WA 4QTGA 3SUSA 1JOAA 5MF5A 4OT7A 5LXEA 1CXFA 3UA4A 3M0MA 4KWWA 3EEGA 4ZXLA 4FLQA 1GOQA 1H09A 3AMZA 3LLDA 1TRDA 1OVDA 1GW1A 3CZ8A 3K1DA 1GVEA 1EIBA 1WUFA 5IDIA 4EQRA 3MCOA 5REQB 5M17A 5BU6A 1PYMA 1H49A 3FYPA 3N9KA 3BAIA 5HR7A 4LV4A 1Q65A 3K30A 2HEJA 4XO7A 2YYTA 2PRLA 1WO2A 2WBGA 3RLVA 3A7UA 1FECA 5DBTA 4GNKB 3AIBA 2V3FA 2ANUA 2C8NA 1UWTA 4EE9A 5EFDA 4IXHA 4KGJA 4NAEB 1XW8A 4J3VA 5EBKA 1B57A 3GC2A 5CGMA 1UZ1A 1HT6A 1CGVA 2ATSA 3SURA 4IP7A 2WVVB 1S5TA 1JR1A 1YMYA 3O0KA 3WL0A 2XFRA 3LHZA 4ILSA 3B0PA 1J8VA 1MWOA 1ITXA 4HNCA 1JCJA 1OCNA 3NXFA 5J8LA 3G0XA 2BY1A 4M0XA 4BQ3A 1GT8A 4G7EB 4Z2LA 2EJAA 1A4MA 1IXNA 2V63A 3AISA 1GJWA 1HO1A 3DBPA 5LGXA 2DZTA 4S38A 1AQHA 1PJ9A 5H8MA 2PDMA 2W92A 5HPOA 2O7SA 3KP1A 5AHLA 1RJRA 3CQKA 5CPMA 5MKGA 1J11A 2X41A 3JS3A 3P84A 1C7SA 2GUUA 2INEA 3ARXA 3CAKA 3GHSA 2V3DA 5FD0A 3T8QA 2G4FA 4GY1A 1JVNA 1MUMA 4DJFC 1LZOA 3KOYA 4GQBA 1DJWA 3A64A 4WKFA 1IZJA 3FCPA 3N11A 3PG9A 3VD5A 1NARA 1K9EA 3IGHX 4DBEA 4MZ8A 5SWUA 1YDNA 2V30A 3OA5A 3LHTA 2OSYA 4F2UA 3IAQA 1UD8A 1BG9A 4W5UA 2C3DA 5HJXA 2ABBA 3W1MA 1GGOA 3PULA 2QEZA 3L2MA 4NIRA 5E93A 5LYRA 4H83A 2NVDA 1PDZA 3GNOA 5I7GA 5AECA 1ECQA 2BP1A 1TPC1 1M7OA 3F4VA 5CBIA 1W9VA 2NLIA 3HJEA 3I3BA 3W86A 2VCCA 1E72M 2QPSA 1W5OA 1TV3A 3NPVA 5M03A 3VOIA 5AOUA 2ISWA 1B2YA 5IDZA 3O05A 4FXRA 4GO8A 1DWAM 1SMDA 1H7OA 1DE5A 5C6MA 1LORA 3WF1A 4D6JA 1H60A 3E5PA 2FMNA 3NM1A 2VWTA 4E4UA 1VKFA 2XZ7A 1UHVA 3AHVA 3AO0A 5I3GA 4ZVJA 1MNSA 2YQUA 4M6QA 3ZVHA 1FDJA 3D0CA 1VJSA 4YJ5A 3KZPA 3HPFA 2DY3A 1G4TA 5HOSA 1TMLA 3QSRA 5ABFA 2DVXA 4POCA 1SJDA 2J13A 3UWVA 3QGKC 2PWFA 3VM5A 4FDCB 4K1GA 3PTKA 3N04A 4XBSA 3WD0A 3HA1A 3H70A 2D3NA 4GC4A 4HHLA 1UUOA 4MPKA 1C93A 1C29A 5ABTA 2MANA 1XFBA 3U4AA 3A5VA 1QO5A 1WOBA 3WQPA 1JZ3A 1ZUAX 1MFVA 4LNYA 5FJJA 1RD6A 1VP5A 3BLOA 2WSRA 4R7JA 1NWSA 4NAFB 3HQOA 3RUBL 5BOFA 3UNDA 3HZ3A 4AY8A 1HG3A 1QHPA 2CBUA 3KS6A 5EBAA 4RDWA 2ZZ2A 2JIWA 2OZ0A 2J24A 3A6OA 4HHPA 3VZYA 4A4AA 2I5GA 3AYTA 1EH9A 3WELA 2WVVA 5DMMA 5CG0A 3RLUA 4LYKA 1EJXC 3O6CA 1Z41A 4ADTA 3W2LA 3BMVA 1TYTA 2XIQA 1X97A 2Q8XA 1LRNA 4QJ3B 4EWND 3F2BA 1L6SA 2ZZ6A 4E4PA 3V18A 3CV7A 1OC6A 3H2FA 3NVTA 5JCIA 3S83A 3TWBA 4P2VA 2WSYA 1GV4A 2RGMA 2WPCA 3SUWA 5A6MA 2QGYA 2PFHA 4IPLA 5LNRA 3RM9A 4GZIA 2OX4A 2UBPC 3LM3A 3SUTA 2Y1HA 2PB1A 3MMTA 3MKVA 5T26A 1XCFA 3RPTA 3HG5A 4X0VA 4H6EA 4HHMA 1HQTA 1HO4A 4LV9A 1P4CA 2XIOA 3W83A 2HROA 4DUXA 3QFWA 2VFHA 6REQA 5BCAA 1OBAA 3LM7A 2P88A 4Z1AA 3UR7A 4JX6A 1QTWA 4PMDA 1A53A 3UR2A 4GABA 1RALA 5CLTA 4XAFA 4S1FA 1Q7QA 4QS5A 4QDPA 4KETA 4AWEA 2POZA 2FH6A 2E4TA 5C2XA 1JQVA 2B7QA 3Q45A 2VZOA 3QW4B 3WLHA 3H21A 4YLWA 1DBTA 3V5CA 4M7TA 3MB9A 3NTYA 3M6YA 4HMCA 4X63A 5DT5A 4LUTA 4WHBA 3KTCA 4CD8A 5TNVA 5CG7A 1JCTA 5F4SA 1TPH1 3S9YA 2D2GA 1LBLA 3PF3A 5A6JA 3MUAA 5HXMA 3F1QA 5E0KA 5EMYA 3GNNA 3LMYA 2V67A 4FF7A 5HR6A 4P5UA 2V2CA 5FL0A 3BC9A 4XO6A 4BZYA 1NPXA 2PWHA 1LWJA 1V6YA 3VIPA 3N4EA 3PUDA 3KOWA 1EZ2A 3CT2A 1ADOA 3GWQA 1BD0A 4AEFA 2HVOA 5CZKA 2FHCA 2X7WA 3DFTA 4RDYA 3LGDA 1TREA 1TV2A 2QNEA 3NVDA 3BSGA 3VOCA 2DVUA 1OX6A 3CIXA 4LVAA 4ZSTA 2KX9A 3USBA 3TJLA 3VKAA 1GRFA 2OELA 4TVDA 2JF6A 5D2YA 1J0ZA 1UP3A 3QFBA 4Y7EA 3SAZA 3IVTA 3ONCA 2A4AA 2HS8A 4O11A 1UQYA 5T91A 2WMGA 3VA8A 4NYYA 3E9AA 3TYBA 1MOKA 2CBIA 3VX1A 3WN6A 1CGXA 2QMKA 3E6EA 1VEOA 4TTUA 1DIOA 3OZYA 4NZ1A 2HXTA 3GB6A 4UR8A 2WYSA 1C9WA 1OD8A 3NJ3A 2H9AB 2WSQA 1PAMA 3BCJA 4XSLA 3GIQA 2NX3A 1UD4A 2D2OA 1KBLA 2XINA 3NZRA 4EOUA 4NQ1A 4DJDA 3R94A 4DWSB 1GVQA 1KC7A 3A7AA 4JTSA 2J7EA 1UC4A 7XIMA 3PPCA 3G5EA 1IT7A 4LGXA 3D3AA 3ZYZA 1R47A 3BO9A 3BMXA 3F2CA 3RX3A 5KEZA 1E15A 3BTNA 1MO9A 1EYWA 1UP0A 1VS1A 2VGIA 5JIPA 3QV7A 3U7BA 3JU2A 3P2VA 4J35A 1PKNA 3W6YA 3H7VA 4ES4A 1B9BA 3AZRA 1SZEA 3F2DA 3A9BA 3I4EA 1ALDA 4H1ZA 5JQ9A 2YCIX 3T08A 3ZVIA 1RD5A 3ZJKA 1OD0A 3STFA 3EX4A 4OUIA 1E4NA 2PDHA 2YW4A 3A47A 1O12A 1XRTA 1R5YA 1BHGA 5D33A 3P14A 3SCPA 3W25A 1HN1A 2NV9A 3MYPA 5M3WA 4JTUA 2OYLA 1W3HA 4MJ2A 1GRTA 3N2OA 3FV9A 2INZA 1NOWA 4NF7A 3ERPA 4PCFA 1SFSA 2HDJA 1UR9A 1DORA 3NM3A 1EQCA 3IJ8A 2OYMA 3A3HA 3TDFA 5GPRA 4R3UA 2W62A 4A05A 4AX6A 4NHVA 2ON3A 1ONWA 2HPIA 3EB2A 3WNOA 4KEUA 1EP2A 1VH7A 1ISWA 2WNWA 4JN6A 1OSEA 3K4DA 2YJQA 1FWNA 3ARZA 4H01A 4UOJA 3AC0A 1VB9A 2OOGA 3MUZ1 1XLAA 4TVYA 1JPKA 3TXZA 2CLMA 3NRZB 1HFBA 2P0OA 1HJUA 2V5DA 4BF9A 3E0IA 4XIAA 3GYCA 4O13A 3KRSA 1GVOA 4NJKA 1H7WA 1ZP3A 4XAGA 3UJSA 4I6KA 2ZDSA 4JHOA 2ZE3A 3UGVA 1G69A 1SYTA 5TD4A 4Z08A 1QUMA 3VOHA 5CJ5A 1OX4A 3TSMA 2OQHA 3NQVA 2DH2A 4RDVA 3IRSA 2IKGA 3WH5A 1EUNA 2BVTA 5A6BA 4IQLA 4MNMA 4M6VA 3WCZA 1TIWA 3LB8A 2AAMA 1GYMA 2ZZ0A 1WAUA 3VMPA 1HKKA 3W00A 3HV9A 2EEXA 1OX4B 1AVAA 5AHMA 2X1UA 1A5LC 2A3HA 4QRNA 4XBKA 1OFBA 4QLLA 2WZTA 4AD5A 1XG3A 4YMZA 3DG6A 4CD4A 3RILA 3KP0A 1FOBA 1ZJHA 3IS4A 3VIGA 4QAIA 5C5YA 1FCUA 4PMNA 2WHJA 3KBJA 4G9PA 2DW6A 5A8QA 1UA7A 2VEIA 4XV0A 2O9RA 4MUPA 4D2JA 5HQMA 1LP6A 5CPTA 4H4SA 1UIOA 1MW0A 3BAJA 4DLFA 1D3HA 1AMKA 1UYQA 3AIEA 3C2OA 4H8HA 3EA1A 3AS3A 4GNJA 4AZBA 2ACSA 5E0CA 3A21A 1M9HA 1AQ0A 2EXOA 3PC0A 1ZPTA 3BZGA 3UBPC 3FIGA 3TNBA 4MWAD 4CGTA 5C9UA 3ALGA 3LQGA 3MBFA 1XSKA 4XAZA 1QCWA 3BL3A 3M7WA 3KXQA 3GXTA 2E68A 3P8JA 4I9JA 2VC7A 2A1YA 3R0UA 5JCNA 1OX5A 4DNAA 1BXBA 1G7UA 2J4GA 1C92A 4HGXA 4WOZA 2PGRA 1E6RA 2QQ6A 2BVWA 1K70A 3K8KA 5G1TA 1TFVA 3F03K 3ZFHA 4J3SA 3WFZA 3L21A 1OZMA 1OFEA 3QFEA 4YPJA 5CSYA 1B4KA 3V7PA 1JZ4A 1J01A 2VRKA 3QGAC 3OLDA 2REQA 2Z00A 1XLLA 1XQKA 3W2JA 4UOZA 1AW1A 1TA3A 4C6CA 1V7AA 2W3ZA 3LNPA 1FIQB 2UY2A 4GR1A 4XAYA 5AYYA 1ITQA 5G5HB 1IT8A 3RMJA 3DGHA 3PTMA 3VPLA 5EB8A 3KL0A 4LS0A 1TKKA 1L8PA 3MSRA 4XZBA 2PDIA 5D9PA 4AH7A 1XLIA 2X09A 3CQ0A 3IJ6A 2PGEA 1XGEA 5HQLA 3WJSA 5IBXC 5JIWA 1TQJA 3R6IA 4DWSC 2RAGA 2ZX8A 3ABZA 3LSBA 3H7UA 2PTYA 4KCVA 3E2SA 1KFEA 4ZQPA 3TTSA 3IJDA 3VOJA 5C9RA 1VR6A 2I5QA 4DPPA 3S1WA 1YXDA 1GERA 2CHOA 1BYAA 4D8ZA 1FA2A 1NQKA 3THUA 1SFTA 3S42A 2V5KA 1AZ2A 2D3LA 1FKWA 3QTPA 4AHQA 1OK6A 4DUVA 3VNJA 1IV8A 5HJYA 1CXIA 3FA4A 3T1GA 4LB3A 3PG8A 4C1NA 2OKTA 2F6XA 2QCDB 3NYZA 1KN0A 1LT8A 2J9YA 3WFLA 2QUTA 1L6WA 4UTUA 3IK4A 4MZYA 1POKA 3AXMA 4Q8VA 5A6LA 4EQWA 4YTRA 1XWYA 4LEFA 3LU2A 1B3ZA 3ME3A 4JQ4A 1S2AA 2FIQA 3PZGA 3ANYA 4LU0A 4CCEA 3HBLA 3HPSA 5AHIA 4PTNA 3LB0A 1RP8A 1XC4A 2YDQA 2D69A 4NEVA 1PTGA 3H4WA 3AXKA 2OLSA 3H2MA 1PDYA 3VIJA 3GDLA 1UD3A 3KVMA 2DUXA 2PP1A 1Y0EA 2JF7A 2GVJA 3WQOA 1LUCB 2EKCA 2G5WA 2NUWA 2NQZA 2O0TA 4N4PA 4EPDC 3BH4A 4U5KA 3POHA 4ZO8A 3GBDA 5DBUA 3RYSA 1AUSL 4I3GA 3CWHA 3FLUA 3TZFA 3EGJA 1SPQA 4QM1A 4ZQOA 1QOXA 1ZCCA 2Y5EA 1OWQA 3BE7A 3I6EA 4FOJA 4LA1A 3SRDA 3GXNA 2WPFA 2NXHA 1HL8A 3GDTA 3O8AA 5CBBA 2GGIA 1ZB5A 4AD0A 3L66A 3HO8A 1YE4A 3EOLA 3I6TA 4ZBCA 1HW6A 4HA0A 4O10A 3SM0A 3L4YA 2ZZ5A 1P1XA 4YXGA 1TVNA 4LUTB 4H4ZA 1YNQA 2GDVA 3L4ZA 1QMLA 3QC3A 4J27A 5TIMA 2CLIA 5HULA 3F5KA 3CWNA 5I00A 7CGTA 1A5SA 1H5VA 3ZM8A 1GOXA 2XYLA 4TMCA 1KGXA 3V16A 4FNRA 3PZOA 2CYGA 1VRXA 2Y8KA 2Y61A 3PBUA 3NURA 1TPDA 4GC3A 5KVHA 1IIGA 4B9YA 1KWGA 1QXLA 3CQHA 3RU8X 1KCZA 4AIEA 4E6MA 1V4YA 2EO7A 2FVKA 1F3WA 1XLMA 2WOWA 4PB5A 3PM6A 5TF0A 4D8AA 1KRBC 2FTWA 3C86A 4H4WA 3QMTA 3TYEA 3GZ3A 3GYEA 1P0NA 4JIIX 2BBFA 2WMFA 1T7LA 3MANA 4HK5A 5C9ZA 1N8FA 4DJFA 5BNKA 2VCBA 1O95A 3GTXA 1AA1B 1EZWA 2Z0IA 3KLLA 1AL8A 4AG0A 3GZAA 5FJOA 1J5TA 2WJEA 1D7FA 4RZBA 3NO1A 1IT0A 3M44A 1B0IA 5DT7A 4XX6A 1E0XA 1JCYA 3OLIA 1DJYA 4IJRA 4X61A 5GQBA 5HNNA 1LG1A 4AWTA 2WZIA 4AWSA 1OC5A 4GI4A 1MDLA 1GZ1A 3RM4A 3E0LA 2A79A 5HATA 2Z6IA 3CHFA 2OKOA 3L4VA 3CGCA 3U48A 3R0DA 3W81A 4CQ9A 4H41A 3R79A 1JFHA 4C6BA 2F38A 2X1RA 2QKFA 3OO2A 3VK5A 1CEOA 1W5NA 4UCGA 3PTDA 5TAOA 1NELA 3BQ6A 5E70A 4QEEA 5A6AA 1RQHA 1JAEA 4WD0A 3BAXA 2EG7A 3HJZA 5XIMA 3H2OA 1IXQA 4JPGA 1HL2A 3R11A 2BDQA 1E5NA 1UOZA 1YLVA 1I9CB 3G1VA 3H26A 1TIMA 3PVFA 4Z1DA 3TUUA 2R94A 3PNZA 4DXVA 4UNLA 1BLIA 4A8RA 4LF1A 1BF2A 3LY0A 1EDTA 1KXHA 2A0NA 3GR7A 1EC7A 2ALDA 1ECEA 4HK6A 3UWWA 3GLCA 4HA4A 3ZQ9A 4GUJA 3AJXA 4JTAA 4DHGA 4LH8A 4QCEA 4D9PA 1FDZA 4W87A 3QFAA 1KR0A 3GUWA 2QZRA 3E0FA 1QNSA 4FS9A 2QXWA 3A3WA 3ICJA 4PB3A 1J0YA 3A7RA 1FEBA 3QR0A 4ALDA 1FHUA 2JKPA 4RDZA 3GNDA 1SFLA 1EJUC 1ZL1A 2IXUA 1G94A 3SDOA 5KVIA 2YPIA 5HNUA 3RCYA 1RH9A 4EXQA 3N25A 1K8CA 2PAJA 5I3IA 1PZ0A 1LL6A 2ZRZA 4LVFA 3H54A 2FFCA 3QY6A 3VZZA 3KWXA 1ISXA 3L9CA 3M64A 3QOKA 3UZZA 3P93A 3VXGA 4ROQA 4JQ1A 3EX3A 3SFKA 2P5NA 2Y6ZA 2YDSA 3QOMA 1DJNA 2VKZG 4GUGA 2QUUA 1DTNA 1GQKA 4L4LA 4RE3A 3MVIA 4GCXA 3Q2DA 2I9UA 5D2TA 1TTPA 3P62A 2J8TA 2PDBA 1K8XA 4WF7A 1XRVA 3W7RA 7PTDA 3DX5A 3DAQA 4UB9A 3H6OA 4RPPA 4GJJA 4PUKA 4ML9A 3QTGA 3HMCA 1UD2A 3PZQA 2XSXA 3CM4A 2J27A 1U2YA 3V36A 3TFCA 4JOMA 3PG6A 6PTDA 3L68A 3OC4A 3NPXA 3OIXA 3H2EA 4PGLA 3DXIA 3HQNA 4OBSA 4I6VA 1RBOB 3FKKA 5A3HA 2CETA 5T8GA 1EA0A 2J8FA 4HCDA 1TRIA 4LUSA 1UMLA 2VX7A 4PBFA 1XLJA 1UBPC 1X38A 4GX8A 1F4HA 2BNJA 2OT1A 1KKOA 2X1IA 5H8PA 4A3RA 1JPMA 1J93A 3M0YA 1E71M 4K6AA 4DO5A 1D9EA 3SUVA 2PF8A 3OG3A 4S3DA 3I3EA 4HMNA 1JRPA 3P0WA 4FNPA 3WZ0E 1F3PA 3OB8A 1XIDA 1I2NA 4H4VA 3JW7A 5DN1A 2D0FA 3ZMRA 3CT7A 1S5WA 3SCNA 2J6XA 3KLJA 4GE8A 2EG6A 3M5YA 1QNPA 4IXXA 3PWGA 3E0WA 1Q6RA 3T44A 4HYRA 3OVPA 4HN4A 1LLZA 2R1KA 2Z27A 4WUIA 1XCXA 4A3HA 1H1ZA 5C0QA 2PWVA 1KNWA 4QJ4B 2DSWA 4CQDA 1JXJA 1U5VA 4LEQA 4G7EA 2WHLA 2VEFA 1BQCA 4ATWA 1J0JA 5I78A 1PX8A 1NY1A 2XZ9A 1ZJAA 5HPCA 3H53A 2FKPA 4LS2A 3DU0A 2CPUA 2WXDM 3QV6A 3D6NA 3KOZA 2ZX6A 5J04A 1RXOB 2QV4A 3GR4A 3CPUA 4PR4A 2VUNA 1ZP4A 3T7VA 3WJYA 2QCGA 3GVVA 3L4XA 4IGSA 4YL2A 4IMFA 3NEVA 4NZ3A 1G9HA 3C2RA 2F61A 2GLKA 3HN3A 1F8IA 1QO2A 3IV8A 4ERGA 1E4LA 5I5RA 4RXGA 4LWWA 2NVCA 3EAUA 4M3PA 5H91A 3DFSA 3UXLA 5I0DA 1XICA 2QUMA 5T9BG 2B0MA 3ZS4A 2VUYA 4JYFA 4XZWA 1MW1A 5DCBA 4GVIA 4V28A 1ONRA 5EMLA 4LALA 4F3HA 2VWSA 2ZC8A 5JCKA 4GVHA 2BXVA 1RLCL 4TU1A 3AHTA 3SGZA 3HPZA 4HA3A 3W74A 3ETRB 2PI6A 4WKAA 1NP2A 1L6FA 4GQRA 3DJGX 3W22A 1KXTA 1G4EA 5AY7A 3IJQA 2OOFA 3NQ8A 2YL9A 3DHDA 3IWPA 2V5BA 4YHGA 3WD1A 1TWDA 2OLAA 2E09A 3ANUA 2AQVA 3PFMA 4HTBA 4LRSA 4TV5A 3GXPA 1P0BA 4P7RA 1ZENA 2NV2A 3W7JA 2YA1A 4EM3A 1QPNA 1AJ2A 1E5JA 4Y9PA 4C91A 4LW7A 3QYSA 4U31A 3IARA 2YSWA 3DH7A 3PWAA 4IGMA 2IW0A 2IQDA 2ZFAA 3UG8A 3KL5A 4JFUA 2EGZA 2E5CA 2ZZ4A 7ODCA 3WF0A 3U6WA 4KW2A 5CLWA 4J3UA 2UY4A 2CWXA 1ZKQA 2E25A 2WQPA 3LYEA 1ZQ5A 3WENA 2XH7A 2BC1A 4AQLA 2ZUUA 3DKJA 3L2LA 4PUUA 3CEPA 3LBCA 4BA0A 4UQAA 4RW3A 2A3AA 3GD3A 3GIPA 1P7TB 5HNRA 3EOEA 3LI1A 2WANA 4MWAE 3PJTA 4N9BA 3LXDA 2V9DA 2WV8A 4W9TA 1GSNA 2ONEA 4Q8UA 2GJXB 5IHRA 1S39A 3CZKA 4NYUA 1E43A 3TSBA 3SR6B 3QPEA 2V69A 4K8HA 2XPKA 2GWNA 4A3QA 1X98A 1LUCA 3QW3A 3ZJ7A 2VFIA 4I90A 2GQAA 3EX2A 5ER0A 1XIMA 4JFSA 4D8LA 4NNAA 3APTA 2D1ZA 3R58A 5CPOA 3QC0A 1G7VA 1T41A 1V3MA 1LM1A 5AC8A 2ISVA 3SGUA 1Q6OA 4DWDA 3SQSA 1EB3A 3NGFA 4MM1A 4WDTA 3UZJA 3GDKA 2HJPA 3TCSA 1TSIA 2C0HA 3N2CA 3BDKA 3TLQA 4JKKA 3C3UA 2DU2A 3AOFA 2J7CA 5AZ1A 2D0HA 4UCFA 2GVLA 4UIOA 1I2RA 4M29A 4KH2A 4PRTA 3PANA 1Q7ZA 1JNEA 4C1LA 1S5NA 5I2UA 1TR1A 3JVAA 3T2OA 4DN1A 3VCCA 4WGHA 1LL7A 4XZ9A 3CUXA 1F9CA 2H6RA 2I56A 1XPYA 3NDOA 2P53A 4K3ZA 3QKEA 3LRKA 3GNXA 3WLKX 4NZCA 1EC8A 2ZA1A 1DYSA 3W73A 3VGBA 1XP3A 4BR1A 3LCFA 1WBJA 1FWFC 4JTRA 4BEUA 1B31A 1PB0A 2FYMA 2YL5A 4O19A 2NSOA 2G41A 1A0EA 3UJRA 3STPA 1S1RA 1EJRC 3AUOA 4Q22A 1EIXA 3BJSA 1YPXA 3TYCA 4H4QA 5E6YA 1RCOB 4U4MA 4IP4A 4JDRA 2JALA 1CECA 1TJRA 1R3RA 4PULA 4QE1A 2REQB 4I7WA 3LADA 1RK5A 1W3JA 4CD5A 4F0LA 2ZZCA 1HP5A 5EL1A 1TA3B 2XVLA 3N3TA 1WXYA 1M41A 2D23A 1MZRA 3GW3A 3W01A 1SZNA 3WQVA 2BC0A 4OZOA 3TW9A 3NG3A 2D2HA 1DEDA 3NYDA 3CHEA 5E09A 5AVNA 2OZTA 1XIHA 2X40A 1SW3A 2VOMA 2W3SA 1XD0A 3T81A 1VRDA 3SCOA 4OWGA 5A8GA 4AXNA 3R10A 2JE8A 4B2DA 1XX1A 3DJJA 3O9NA 1EO5A 2QR6A 3VCRA 1IYXA 3UT0A 1T8XA 1JXKA 2OEKA 4ZE5A 4FXJA 1XBXA 4UQCA 4ZFCA 1CBGA 3H22A 4S3AA 3H2AA 1XG4A 1I1WA 1BZLA 1O5QA 2V5LA 2VFEA 2YBTA 1UUQA 2XFWA 4H4XA 4PMZA 5LKYA 4N42A 3UWEA 4NJIA 4JR5A 4GVGA 3LHUA 2LLEA 3NVWB 1Q63A 3POCA 2AMGA 4F0KA 1JG9A 4JX5A 3HGJA 3TLLA 1BF6A 4LXFA 3DHPA 4IFKA 3BUVA 2CBJA 1E4MM 4NZFA 1NH6A 4L1WA 5JBDA 2C16A 2XWDA 1RM6B 3PR2A 4ZB0A 5HUPA 4G1KA 5E5CA 1KM5A 3J7HA 3LCLA 1K8ZA 4ZQCA 1Y5XA 4AX7A 3L67A 3WDRA 3THQA 4JX4A 5FF7A 4WDWA 1MQQA 4MYAA 2XGZA 3S5YA 3FKRA 2R6OA 4E2BA 4A29A 3QM3A 4Q4KA 3W72A 4YCOA 2VCAA 4PH6A 4PTXA 4E3VA 3GRTA 2OX1A 4FF5A 4V27A 3DKLA 4UNIA 4JN8A 3SQLA 2YDAA 1B54A 1TMQA 2VRJA 1C8XA 3LDVA 1EQPA 2CZ5A 4AIOA 1D3CA 2DJLA 2VX6A 1LDCA 1XQLA 1TWWA 4ML4A 2FTPA 3EX1A 1V8EA 2P3ZA 1LYXA 3A23A 4LAKA 9XIMA 3CUIA 3FXGA 1N55A 2HVNA 2O4MA 1VJZA 1GOKA 1T5AA 3UPWA 2CIPA 3WQ4A 5HWMA 4IX2A 1AH0A 1CLVA 3OOQA 4IWWA 1P7TA 3MSYA 3KHJA 3LOTA 2A7RA 3B05A 4L64A 1OGBA 1XRSA 2WQDA 3UCCA 4OUEA 3LCGA 4J3TA 5TQLA 1W1B1 4XUYA 1YQZA 1TG7A 4YWSA 2FMOA 2PLJA 1FXPA 3IUIA 3SECA 2WWCA 1S2VA 3GD4A 3K13A 4PEKA 4R88A 3RR4A 3U9IA 2A85A 3DFNA 3MU7A 1W9XA 1UWSA 1KR1A 2P3EA 2NT0A 4AZHA 1K8YA 3FS2A 3OGRA 3R07C 4ORMA 1TR9A 4B15A 4Y6GA 4UNKA 3WH9A 1W8SA 1H41A 1WXZA 4C6FA 2GOKA 3W1QA 3IGXA 5DO8A 2DT3A 4NX5A 3LS9A 1N63C 1CX9A 1OJXA 3R1ZA 2DZBA 1O6IA 3UD6A 3HF3A 4FR1A 4CN1A 5C9XA 3GR8A 3OU8A 4EX4A 9XIAA 1L0PA 3W1TA 3V35A 1H50A 3T05A 3TJIA 2D2JA 3AM9A 1OFRA 4GIRA 4AZ6A 7A3HA 3M0JA 3TMLA 1HTIA 5GNYA 2GQWA 1YHTA 3VOGA 3V1PA 3R5EA 4S3JA 4MUZA 3KTSA 5FSEC 4EK7A 2W9MA 1HKMA 3B0VC 5FF0A 2PDFA 1W1A1 4JY9A 1YDOA 5EPDA 4IG2B 3O16A 1OC7A 2YXGA 1F8WA 1MEHA 3EWDA 1AQMA 4ZENA 2EAWA 2ESCA 3THCA 4B5WA 3ITLA 4A3YA 3EX6A 4Y90A 1NWTA 4FNUA 5DXYA 4E5TA 1L2QA 1JCLA 4FK9A 1Q2SA 4XVDA 2H9AA 4AZIA 3UFYA 3AU6A 1LOSA 4I7VA 4F66A 1W3LA 4IIGA 3DFQA 1GK8A 3NQEA 3BG5A 1KRAC 1P0KA 5F2LA 1EJWC 4FB7A 3AMDA 5CZSA 1H7NA 3MW7A 3K2GA 6TIMA 3CZGA 2YFOA 2GQ9A 1DNCA 5I24A 3UY8A 4MWAA 3OJGA 3B4UA 3NSXA 2AQWA 1PEZA 2Z1BA 4F79A 5CEWA 4JQAA 3KTXA 2DZUA 1XI3A 3PJWA 1VLIA 2QV5A 5B80A 3C2YA 4E38A 1RVKA 2X7VA 4UFHA 1RY8A 3MI2A 9CGTA 3W7GA 1D8CA 1GKRA 2Y70A 3QLLA 1KFJA 4UFIA 4EWJA 4WR3A 1VFUA 4KIEA 1A4LA 1E9ZB 1AD4A 3RXZA 3UZXA 3BW2A 6ALDA 5F2IA 3B0YA 4BQ5A 2INFA 3H8AA 3VNDA 4CVUA 2VT0A 3HIJA 1R3VA 3STEA 4J57A 1QU4A 4AYSA 3G8EA 3MZ2A 1FFVC 2PA6A 3CL6A 3CUZA 4JEJA 1VFFA 6XIAA 1O68A 1HKJA 1ZU8A 1VFMA 4DVOA 4JHZA 3NIYA 1AJZA 4K2SA 4G6CA 3W23A 1EP3A 2NVAA 2F8QA 3NSNA 3MP3A 2CFFA 4RL3A 3AQUA 4X0NA 1BYBA 2WOVA 3GG1A 3BGGA 5LIUX 1TVPA 1XBZA 1H2JA 2XH2A 2HPMA 3WEOA 3SSZA 1W9UA 1OADA 2Z6JA 3GAYA 1OCQA 1E0VA 3QZ6A 4AVFA 2G3IA 3DYOA 2E9MA 5LIYX 3FX4A 2A3EA 1F4AA 2VR5A 1NU5A 3HM7A 4GINA 3PUEA 3P5YA 2AGTA 2C0AA 4MB4A 4FOKA 4CQBA 2VYOA 4ZMGA 1X7FA 2R1PA 1PCKA 2GVGA 2Y5SA 3WIJA 4K39A 4KWVA 8TIMA 1UKPA 3RX4A 4QJ5B 1WUEA 4WX2A 5AYIA 3UXKA 1BVNP 4WJXA 1JPIA 4CNNA 2PCQA 2FPVA 2Z1SA 3WBXA 3KM8A 4ZSUA 3E2QA 4MKVA 2E8YA 2CXGA 3WLPA 3BJFA 5EMKA 3UEQA 3WEMA 4UBPC 1AQFA 2OVLA 1EUAA 3HQPA 2UWFA 4UFKA 2NW0A 3CNYA 2J9XA 1JZ8A 2TPSA 4F4RA 4GYJA 3WLOA 1LVLA 5D03A 1RV8A 4GQ0A 1C8YA 3AFBA 1Q4WA 4WGXA 2P50A 4LJ3A 2NVKX 4WLCA 3E2RA 2ACUA 3TVAA 4KESA 3CXBA 3CUGA 4IL2A 5M2FX 2IUZA 1H5YA 2XIJA 3BXWA 1GREA 1US3A 1I60A 3CASA 5JU6A 1G01A 3DH9A 3W1LA 3W7EA 1DJGA 4YN5A 2WKGA 1J0KA 3CHVA 2HSAA 5A8NA 4IPNB 3UZWA 1H1NA 3GXIA 1QPKA 3R8GA 4BJHA 3M9YA 3JZUA 5JCMA 2Q71A 4EXBA 3EWCA 1GG0A 2EQ7A 4DM1A 4JFWA 3RMEA 2VTFA 4GGBA 3M0IA 4E2OA 4ATLA 4BQ4A 1EGMA 4DUWA 2X8RA 4PBGA 2JK2A 4W7VA 1XLGA 3GC4A 4REQB 4QQUA 3M46A 2Z4GA 5A2CA 4M5PA 2ZKMX 1L6YA 2Z7KA 3W1RA 1M6JA 3GRIA 4JIRA 3VABA 3GX9A 3S0CA 1NDVA 1ML1A 3E0VA 3WF3A 5CC3A 1KV8A 2CCRA 2WP5A 1VFSA 3MZNA 4ASTA 2XIIA 3W26A 2VFDA 1QOQA 2ZBTA 3IIVA 4JQ2A 8XIAA 4Z0SA 3RG6A 4C90A 4I9AA 2HBXA 3F7JA 5CC6A 3KL3A 4WCJA 3TA9A 1ONEA 2FPTA 4P61A 2OYKA 5ABEA 1BKHA 2O7QA 3CH9A 1CDGA 4B9ZA 2EG8A 3AXHA 2OQLA 3DERA 1NDWA 4IUOA 4GH3A 1ZBCA 1E40A 3HPXA 4KRTA 5FEPA 2BY2A 4C7FA 1D7YA 2I14A 4MNJA 2R1NA 1A5MC 4E8GA 4I9MA 3SO7A 4Q6JA 4PTDA 4Z2KA 3LXCA 3VGGA 2E5BA 4AZ5A 3LTYA 1J9YA 1VLWA 4GNVA 4WVXA 3D9XA 3MJYA 3TQKA 4EQXA 5U4NA 4KGLA 5HINA 5G1MA 1B3XA 5C54A 1GVYA 1AOGA 1W32A 3T40A 2V6OA 4QSHA 1O5KA 3L12A 2YXOA 4L65A 2Y7FA 1TV4A 4Q4SA 3IJLA 1N2VA 1ZMCA 5DQPA 3PAJA 4L7ZA 5GJMA 3N6JA 1OFAA 2QCMA 3AICA 5CSRA 3VKKA 4GY0A 2NT1A 1IR2A 3WH6A 3ABOA 1JF5A 3L0NA 4I7UA 1A49A 2OODA 4LFYA 7REQB 3KW3A 3PZTA 3W2UA 1TWIA 2GQ8A 1JZ2A 1W5QA 3CMFA 3ANVA 3URBA 4FHAA 4Q32A 2VD9A 4BHYA 1KM4A 2W5FA 5I23A 4JFVA 3VTRA 1W1PA 2C1IA 4H9UA 3V3WA 1GTEA 3DGBA 2GJLA 3VDCA 3HTWA 1HKIA 1ADSA 1WZKA 2PODA 1RY0A 2Q8ZA 4CCCA 5U7SA 1N8WA 3IRDA 4RK8A 1QPOA 4N0RA 1XSJA 1NEYA 5FI8A 2ZRXA 4JD4A 5DY3A 4UTHA 3UCDA 3C2EA 1K4GA 5D38A 1C8VA 2V8ZA 3SCRA 1ZLPA 5DEZA 3FGCB 4MADA 2YA0A 4D6DA 5LNVA 2NX1A 1T0OA 2E0PA 2VC6A 1SO4A 4XZNX 4D6GA 2GSEA 3Q6JA 1ZGDA 3SN4A 4JDYA 3W1UA 4BV6A 1AK5A 1VENA 4HYVA 4TVWA 2TSYA 2BOGX 4WY0F 1ZXIC 1FWIC 1H7XA 3LHWA 4KPRA 1JL8A 3OQ8A 3LLFA 4U2ZA 5G1YA 1V6UA 1VAHA 2FJUB 4R5EA 3KBNA 2DT1A 4H4YA 3VKCA 2EQ9A 2QJNA 3RR1A 3VUPA 1HXJA 1SR0A 5T9CE 2J62A 2C91A 3REQB 2PDJA 4L4OA 4C60A 4I5UA 4H04A 1QWKA 2O9OA 1W91A 2FVLA 3LEPA 4DYJA 1UWRA 4JXCA 3W9ZA 3ZO9A 3N1AA 5GNXA 2GQ3A 1ME8A 3CZLA 4JCLA 4RCXA 3L5OA 3HFYA 3F4NA 1HL9A 4WSJA 2ZUMA 2QUVA 3T6CA 1A5KC 4HPJA 3SI9A 3TFXA 3FN9A 3WQWA 2VX4A 1S46A 2YKKA 4LF2A 3UY7A 4N9EA 4C1KA 4F0HA 4GIAA 2DPEA 2ZADA 3KFTA 2WKLA 3C0LA 4QGCA 5ECVA 4NJJA 3WF4A 5LSMA 4LC6A 3T0DA 4ONVA 1KLYA 3G8RA 3NGJA 1OIMA 3CMJA 4Z17A 1QWGA 1CI1A 3S8HA 5G5IA 4UTMA 4O1BA 4Q4PA 1TX2A 4ZFMA 3N34A 3DOPA 1IF2A 1TYGA 1KLZA 3OLEA 1IQ8A 4EMJA 1HJXA 1DPMA 3FW6A 3DHFA 4H19A 1W9PA 3AXXA 1EO7A 1CZ1A 4HYWA 2ABAA 2B81A 2VM8A 4R33A 4ZO9A 2WZEA 3NVYB 4PMVA 3VIKA 1XBVA 1BXCA 1BGGA 1E3XA 5C2CA 4GXWA 2W67A 4WOQA 2JKAA 1JJKA 1O1ZA 1KBKA 1EWDA 1OGSA 2XIBA 2PDYA 4RV3A 1V7YA 3MKKA 1DKWA 1JUKA 1V08A 4K36A 2V3BA 3MYOA 1NOUA 1U1JA 3EPMA 3NL5A 1MQPA 5D04C 3CV6A 3PWIA 3ZWTA 2QF8A 1BVWA 4B92A 2CW6A 1EPXA 3W24A 4IIHA 2EHHA 3KLKA 3CGEA 3N2MA 3N12A 4GFSA 5DLCA 5XINA 1TMHA 1PE1A 3MHUA 4PC8A 4DYKA 3T55A 2BXZA 3PFRA 3WDJA 2ZOXA 4U33A 4CD7A 5LNSA 3RDKA 4ZOBA 2FHBA 1FWCC 3IUHA 5U1OA 3E74A 4XTIA 3G1XA 1UCWA 4E0CA 3GVRA 5JBFA 1P43A 4FIRA 4DUOA 3URNA 3BANA 1FCVA 2CLEA 1VC4A 1RSCA 3LN3A 1EHAA 1DHPA 3LGGA 2YBUA 2J7FA 3HGOA 4E3TA 2VEKA 4IISA 5LA1A 5DCDA 3N14A 2BFGA 3B9NA 4NJGA 1U1UA 3WQ6A 1GVFA 4QBXA 4B3ZA 3UR8A 1JPHA 1OF6A 3W27A 2IKJA 4AYGA 4QR6A 4UXDA 1PIFA 3WEZA 1VHCA 4FNTA 4Y8EA 1ODUA 4U2YA 4FOUA 3EPNA 3WMSA 2CXEA 1QHZA 2NLYA 5I02A 5CQ1A 4XZHA 2J79A 1LOQA 4XUGA 3EOOA 3TROA 1A5AA 2RUSA 3S5OA 2WMHA 4DZIA 1FQ0A 3HU7A 5KITA 1MXDA 3PZUA 5HMDA 3C2FA 4QG8A 3UGRA 5D02A 3M0ZA 3SCWA 2KZHA 4JIEA 3MVTA 1TPEA 1A5UA 1K7FA 1E0WA 3BMWA 4UQBA 3MHGA 1I2QA 3UJ2A 5K9DA 3GK0A 2V2DA 1CXEA 1R38A 2KAUC 3MT1A 3W38A 1PXGA 2ZVRA 1QDSA 1TPWA 1UJPA 4N6EA 2C18A 2FZBA 3SGGA 4DJFD 1I4NA 2BZNA 2GUBA 1S5MA 3WQFA 1ENUA 2EPOA 2C19A 4RNIA 2QPUA 2ZC1A 1JYNA 3T09A 5DMYA 2XTKA 4Z0JA 4IIDA 1WYGA 4H7VA 3ECQA 3L4UA 1IXOA 1WZLA 1SO3A 4HSHA 2QAEA 5EU9A 2E6DA 4AC1X 3GU9A 1SJAA 2ZQ0A 2PE4A 1UASA 2YBVA 3OYXA 1VQZA 4DXXA 2R91A 3W1PA 4V2XA 3RO8A 2XVNA 3G1SA 2H90A 1DTUA 3U57A 2J74A 1F3TA 2DW7A 4DBSA 4KT2A 4NZ4A 2WSPA 4AD2A 4E2DA 4NRRA 3PS7A 5DELA 4JIQA 4PYSA 1KFWA 3U2EA 3ZR6A 2PDCA 7ENLA 1KW1A 4PSRA 3W75A 1K3UA 2D24A 3GHTA 2Y85A 5CZJA 3CTTA 2DSVA 2V3AA 3EWYA 4X9SA 3RCMA 2PDKA 3LG3A 1DIEA 4ZOCA 4I5XA 2WW5A 3LCIA 4CNOA 1IEQA 5K3VA 3QEZA 4TV6A 5HWJA 3V0SA 5HAOA 3B4YA 3CYVA 5G4WA 1BWCA 1VIZA 1FCBA 5I03A 2DZWA 4A35A 1V6VA 3E02A 4Q8QA 2V3EA 1LTDA 3TN3A 1K77A 4R53A 3PHAA 4DBDA 1NJJA 3L0KA 1YNPA 5FAJA 1MZHA 1CW2A 4QG9A 1K7EA 2A6LA 1J2WA 3BICA 2JQXA 2A7NA 2CLOA 3ORWA 4FNQA 4ERAA 3FAWA 5TBOA 2OWWA 4MKSA 2IPFA 1YDVA 3OYZA 2VI0A 2QLYA 4Q33A 2GH5A 3DYMA 4O8RA 4UTJA 3MA8A 3GFZA 2RGLA 1GRAA 2IPGA 3DC0A 4NKCA 2QJGA 2ATMA 2PRHA 4CNUA 1FY6A 2ZUVA 1O5XA 3QQWA 5GVJA 4RE2A 3TOYA 4P7LA 3WD3A 5F4WA 1OB0A 3USZA 5C71A 1W0MA 2FZMA 2FJKA 4KCUA 3KUMA 4F0MA 2YCEA 3DYPA 1PKMA 1SFJA 1KB3A 5FIPA 5LZLA 4W4QA 5E1QA 3QHOA 1E56A 1A5OC 5IM51 2OU4A 2NQJA 2Y62A 5FEXA 5H2ZA 1W56A 3TSDA 5BWFA 3UZ5A 4DIAA 3BLEA 3R8HA 3MKCA 4Z1YA 3DDMA 1N60C 3W0KA 4REQA 2CFYA 1EGZA 4AHPA 4EPBC 1JRCA 2VC9A 5F2MA 1PHQA 3VDGA 5BW6A 4GD0A 4HTYA 4M1RA 2CLFA 1GUVA 4GCAA 3TX9A 5D9NA 4ECLA 3HW2A 1J96A 2WNQA 4GRTA 1EYEA 2XISA 3UETA 2ZCGA 1XIGA 3M4HA 1V0LA 3RLGA 1FFUC 1LRQA 4NNBA 2PTZA 3P61A 5ABGA 5IOBA 3G1YA 5I06A 1ICPA 1A0CA 4IX0A 3ITVA 3O0FA 3TWAA 2Z28A 4LTSA 1MRAA 4ACYA 3E3HA 1UKOA 2XGBA 3ID7A 2V5CA 4LOCA 2WP6A 3MO4A 4HMEA 1O66A 4D71A 4CD6A 4FPSA 4O1CA 3PPGA 5GNZA 1KO0A 2G96A 4H2CA 4AB4A 1YIXA 4QNEA 4HOXA 5H8UA 4Q4QA 4CQCA 5C9WA 3W7LA 5FA5A 1E1FA 2W63A 3RRXA 2V5JA 4JKLA 1M7JA 2WBAA 3IACA 1F73A 3OG2A 4H8UA 1GQJA 4O1FA 4J56A 4XD4A 2WB5A 4G7FA 1FVPA 2CU0A 3PBWA 3VIIA 3KBSA 4L9YA 1K1DA 2HBVA 3A12A 3I65A 5A6TC 3MC5A 3CIVA 3M5ZA 1A5BA 2X8GA 3C52A 4PUNA 5LHFA 2E40A 3WD2A 5DRCA 2EPLX 3BW3A 1XUZA 3CPRA 5LA2A 3ITOA 1IGWA 1Q13A 1QOPA 2GJXA 3GFXA 3RITA 1V93A 3GIYA 4KCWA 5HBFA 2ISDA 4LVGA 1JZ7A 3W37A 2AMXA 2BSLA 4M6UA 3M6DA 4JNZA 3Q67A 3HGSA 3O6DA 3ITTA 1XLCA 2A6NA 2ZVIA 5KMYA 1S1PA 2ZUWA 1M3UA 1KCXA 3LRMA 1ZX9A 4HJFA 1V3HA 4RZ4A 3BPWA 1IWAA 1Y7VA 1M04A 1Q6DA 1V97A 1E4IA 4PA8A 1W1IE 1RVGA 3LQLA 2HE8A 2QMJA 3LXBA 2J77A 3ITGA 1US0A 4HU3A 3E96A 1DIKA 4K68A 4W85A 3LZ3A 2FVMA 3RIKA 3FGCA 1BSIA 1QPRA 2VZUA 4DF2A 3ARTA 3EOUA 3W7CA 5JH2A 3VGDA 1XYBA 2AAQA 2E6FA 1CTNA 1DWHM 4O4VA 3NDZA 3CO8A 3F4CA 5KTLA 2E9LA 3C0JA 1WDRA 4H9XA 3CLMA 4LUIA 4AY1A 3H7RA 4S3GA 4GYFA 4FAMA 5FKYA 3ATZA 1Z89A 4RV8A 4O50A 5KSWA 2GR0A 4NX0A 4YNGA 3KZSA 1W5PA 2VNCA 3V1HA 4RR4A 3OODA 1XIFA 2QIIA 2Z2UA 3RHGA 4AVOA 3E38A 4HA1A 4WSHA 5GJNA 4EP8C 1JUBA 3W3OA 4RLIA 4K7ZA 2YX0A 3KE0A 4U28A 3W7NA 3SR7A 2PC8A 3INPA 2GR1A 3AROA 4BFAA 3H2CA 4JQ9A 3DK4A 4GLEA 1Q1RA 4ZTXA 2EPMX 1M6IA 1JYWA 3S2NA 1XGZA 3BJTA 5LA0A 1OFDA 3BLPX 3NA8A 3WLMA 4E2VA 1HX0A 3SIMA 4HCHA 2ZUTA 3GDRA 2G4JA 5I3DA 3CB8A 3C5QA 5CCZA 2BV9A 1XH0A 1KM6A 1TUFA 2CHNA 3GM8A 4O16A 1OK4A 4JNYA 3B8VA 3H2NA 1M03A 4L6DA 2PU0A 3ISIX 4GYKA 4ZL1A 3WYZA 5KZ6A 2PEVA 3EDDA 4C6OA 3PY2A 4TXEA 4ATDA 1NWRA 2CBVA 4PMQA 1PWMA 4MFDA 4MWAC 3HFTA 3NQAA 3GE7A 4MHBA 1WA3A 1UWQA 1ZAHA 2OTDA 3QSTA 2VX5A 1XYCA 3I68A 4F9DA 3OGVA 4KBXA 2X0SA 2Y63A 5F1VA 4ICNA 5BXPA 1O5RA 4LCQA 4MSSA 4R9XA 5G2HA 1B9ZA 3LCXA 2VQTA 1IIHA 2C6QA 1QNVA 2E3TA 2GYIA 3QV8A 2O55A 1H0GA 1IXPA 1DQWA 2VR4A 3CBWA 1SW7A 4C6JA 1IHIA 1O60A 3G0SA 3GG8A 3LPFA 2Y5JA 4MTVA 1TTQA 4GK8A 4B5VA 3B8DA 1BEUA 3BLIA 5EGRA 2ZYFA 1UG6A 3K4AA 2QCFA 4GY7A 1JAKA 1E6NA 2ZX5A 1E3ZA 1CLKA 4YVXA 1XDLA 4S39A 4WEVX 2NSXA 2DVTA 2QYGA 1LPFA 3EA2A 3SB0A 4QXIA 6TAAA 4ZGYA 3ZJ8A 3UZYA 3DIPA 3SY8A 5M5DA 4KEZA 2QJIA 1HKWA 4KF1A 4V15A 3DBNA 1KGUA 4LX4A 4E8CA 2QGHA 2VR2A 3AZTA 1ZBKA 3A4XA 2QW5A 1LROA 1VFHA 4BQ2A 3A4WA 3THDA 3TW7A 4O52A 1O4UA 1XYZA 1NHPA 2X1SA 3OHMB 4S2BA 2JGQA 2QDEA 2GJNA 3DHUA 4DJEC 2PWUA 1LOLA 2QJJA 7TAAA 5MKGB 2R14A 4XVEA 3BAYA 4IHCA 2YAUA 2ZX9A 4FZIA 2B31A 4H6KA 3R13A 2X42A 5A2BA 2DH3A 1XHGA 5DMLA 3TTYA 1KTCA 3U8GA 2ZIDA 1UPPA 1KV5A 4M6PA 1WKDA 4Q8NA 3WK1A 3VO0A 1YTDA 2CKSA 5BOEA 4B16A 3UG5A 1GTHA 4EAYA 3MSDA 3O6YX 4Z2GA 4WSKA 3S5SA 4MPQA 1J5SA 1OFQA 3G0UA 4CVWA 4QG6A 2X8CA 1BWKA 2EQ8A 3AJ7A 4PCTA 3S3GA 1S2WA 3WBEA 4AEOA 2IMRA 5C7HA 3NUKA 3NZPA 3W6LA 1KBBA 3U2ZA 3B8IA 3AIVA 2XHYA 2ZX7A 4L6HA 4JTIA 2VZVA 3MBDA 2Z1KA 4MJMA 1VBUA 1KM1A 4UTKA 3WBWA 2JBMA 2HNEA 3FAXA 3O6AA 5FMHA 1OFPA 3FK4A 3FXYA 1XDMA 4FLSA 4ADUA 1BSLA 2NWSA 1XF0A 4J28A 1EOKA 1Z42A 3R89A 1V02E 2V38A 2HISA 3VDBA 1JDAA 1YXYA 2E5DA 1EF3A 3N3MA 3OBKA 3AHYA 4HB7A 1E6XM 5AZ0A 2NQ5A 4PTWA 4JTHA 4DRSA 1QBAA 4NZJA 2VENA 1DL3A 4JEQA 4AU0A 1U83A 2AL2A 3AYSA 4F0RA 3S9ZA 1UP2A 2XM1A 4PMJA 4ZOHB 4W8BA 1TELA 4N4QA 3UYCA 3WL1A 2X8HA 4JBRA 4KRUA 5AKQA 5RUBA 4MB5A 5C8BB 1FXQA 4GBUA 3KOXA 4EACA 4GMEA 2PD9A 3IIOA 1X2GA 2SFPA 4GUIA 1IEWA 1V0MA 1K03A 3W87A 4OV9A 1Q6GA 4KMQA 2GOUA 1QBBA 3CMGA 4IGHA 3ARSA 1KTNA 1GVIA 3KBVA 2CZVA 3PPFA 4ZO6A 3B40A 4AZGA 4F40A 4GJ1A 2G95A 1ISYA 5ENLA 1EF2A 1MUCA 4R7OA 5JCLA 1BWVA 3P82A 3VFLA 1ITCA 4H2HA 2OSWA 5JVLA 4F2TA 4MB1A 3VILA 1GQIA 2QDHA 4OVXA 1WDWA 2F9RA 5EMUA 2ZUSA 4KERA 5J5DA 1MUWA 1ME9A 1XLEA 3T07A 1V6TA 4FLRA 1V0NA 1SU5A 1Q6FA 1XLFA 3STCA 3H24A 3GHRA 1UWAA 3W28A 5E0FA 1SZGA 1T96A 4IG2A 3FHAA 4H9MA 1WBHA 2PPGA 3OIHA 1H7RA 4IJBA 1Q6QA 2XN1A 3KRZA 3CV1A 4UTIA 3R0KA 5D8WA 3UW6A 5KINA 3ELFA 1RK6A 3WUBA 1L8NA 4RW5A 4Z2HA 3WH8A 3B97A 1F3XA 2E67A 4J2PA 3VYLA 1JYVA 2JFEX 2PLMA 3BQ5A 3RM8A 4MG4A 1NVMA 4DI8A 1YYAA 2QCEA 3A4JA 4GKLA 3VAVA 1CB2A 1N82A 2YB4A 1FCQA 1GYNA 4JIHA 1SJCA 2ZWYA 4H8VA 1JD9A 4IT1A 5E9XA 4TQTA 3H4KA 1X6UA 4TTGA 2GSHA 1JIBA 1TTJA 1EFZA 3MMDA 4G2DA 4PL1A 2Q3OA 5CPQA 1R9YA 3TZNA 1OHLA 4M81A 4O12A 1GXFA 2NQLA 1XKYA 3S6TA 2OO0A 3GG0A 1TPFA 1VGAA 2EJ1A 2C3CA 1VD6A 4NL1A 1QI2A 4BS0A 1XYFA 2DEPA 3OQEA 1OZQA 4JTJA 1I45A 5L9FA 1OYCA 2GSJA 3HG4A 4K1WA 2ZZ7A 5I3FA 5D30A 4CCDA 4W7WA 3UERA 2XIMA 5K7JA 4X22A 2YDRA 1PWLA 1E6SM 4DI9A 3AWNA 3KVKA 4ACZA 3NEHA 1V51A 3N2XA 4NY2A 1V3JA 2YCKX 2ZRWA 3QF0A 1C90A 3KCOA 3VIHA 3IANA 2JK6A 4DJED 4QROA 2YR1A 3UJFA 1CB7B 4NILA 5LIKX 2J8GA 3GQYA 1TYPA 4JCMA 3LD5A 4QAWA 4H4RA 1KWKA 4AZCB 1XYAA 4L56A 4X2PA 2WKJA 1S38A 1K02A 3FA5A 3CHDA 2R24A 1FWHC 3GU2A 3SRKA 5E9AA 1FO4A 1E51A 3RAOA 1ZALA 3LBMA 1X7IA 1LF1A 2W0HA 2QS8A 1ZK7A 1C91A 3EDKA 1JQXA 4AZCA 3DG7A 2UZ9A 1UH4A 2YZ5A 1NDYA 1OT2A 1R3SA 2RDTA 3M41A 3SCTA 2BHZA 1ESWA 3ZOAA 1Q8JA