4DXKA

Crystal structure of an enolase (mandelate racemase subgroup, target efi-502086) from agrobacterium tumefaciens, with a succinimide residue, na and phosphate
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
400
structure length
364
Chain Sequence
MKITKLETVRVAERTNLLWVLVHTDEGITGLGETFFGAETVETYVHEYIAPRVIGRDPLQIDLLAQDLVGYLGFRSSGAEVRGNSAFDIALWDIFGKATNQPIAQLLGGFSRREIRTYNTRADELAHSLLEDGITAMKIWPFDAAAEKTRGQYISMPDLKSALEPFEKIRKAVGDKMDIMVEFHSMWQLLPAMQIAKALTPYQTFWHEDPIKMDSLSSLTRYAAVSPAPISASETLGSRWAFRDLLETGAAGVVMLDISWCGGLSEARKIASMAEAWHLPVAPHCTGPVVLCASTHLSLNAPNALVQESVRAFKTWYRDLVTALPEVKNGMITVPPGAGLGMELHPDIEKTFTVSRRFSDAASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an enolase (mandelate racemase subgroup, target EFI-502086) from Agrobacterium tumefaciens, with a succinimide residue, na and phosphate
rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
molecule keywords Mandelate racemase / muconate lactonizing enzyme family prot
total genus 125
structure length 364
sequence length 400
ec nomenclature ec 5.1.2.-:
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4dxkA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4dxkA01
2GGJA 5EU9A 2AKZA 3QPEA 4DX3A 1F9CA 2OKTA 2OPJA 1EC9A 4GYPC 3UJRA 3P0WA 3B97A 3MWCA 3RO6A 4JN8A 3PK7A 1KD0A 2OO6A 5FJOA 1JCTA 2XSXA 3N4EA 3MKCA 2OZTA 1YEYA 3MSYA 1TE6A 4E6MA 3JW7A 2QGYA 4DN1A 3CB3A 3SJNA 2OZ8A 4GMEA 2OQYA 3MY9A 1XPYA 3TJIA 3H70A 3TCSA 1R0MA 3FYYA 3MUCA 2NQLA 4HCDA 3H12A 3IK4A 2XH0A 4E4FA 2PTZA 3DDMA 1IYXA 2AL1A 4K2SA 3DGBA 3T6CA 4HN8A 3OP2A 1SJCA 2HXTA 3GO2A 2PU1A 2PU0A 2XH2A 3NXLA 2GDQA 2QVHA 3D46A 1ECQA 4KPLA 3SSZA 2POZA 3D47A 3EEZA 4HYRA 2OVLA 4ZA0A 4KEMA 3TOYA 4GGBA 2FKPA 1PDZA 2PSNA 1MDRA 3V4BA 3FCPA 3UGVA 3UXKA 2AKMA 1WUEA 4H2HA 3VA8A 3T4WA 4DYEA 3UJEA 3VDGA 2QJMA 1MUCA 3DERA 4G7FA 3R25A 2PGEA 2MNRA 3OPSA 3QTPA 3K1GA 4GISA 3BSMA 3UJSA 3SQSA 4IP4A 3TJ4A 2PPGA 4X2PA 1KCZA 3N4FA 2P8CA 4IL0A 5J04A 3PWIA 2ONEA 4FP1A 3OZMA 3QLDA 2DW6A 3VFCA 2HZGA 7ENLA 1R6WA 2QDDA 4EWJA 3R0KA 1ELSA 2PA6A 4MGGA 3RCYA 4JN7A 4K8GA 1OEPA 3H8AA 4JHMA 2ZC8A 1JPMA 1XS2A 3R1ZA 4HCHA 3R11A 3NFUA 2PODA 3PFRA 2I5QA 4HCLA 2OFJA 3HPFA 3I6TA 3GD6A 1NU5A 3I6EA 1JDFA 3S5SA 3ZVHB 4E5TA 3U9IA 2XGZA 3SN0A 1JPDX 3TQPA 3BJSA 2GL5A 3JVAA 3P3BA 4A35A 4J3ZA 4MKSA 3VCNA 3VCCA 3IJLA 2GGEA 4FI4A 4A3RA 4GYPA 2HNEA 2PMQA 3ES7A 2PTXA 4GIRA 4HNLA 3FXGA 3IJQA 2OX4A 4MMWA 4IZGA 1KKOA 3FVDA 3R10A 3CYJA 3RRAA 1SJAA 4YWSA 2P8BA 2QQ6A 3FJ4A 1RVKA 3CAWA 1MRAA 1L8PA 4DHGA 1ONEA 2P88A 2PP1A 3BOXA 3DG3A 1EC7A 5ENLA 1TKKA 3N6JA 2MUCA 2QJNA 1E9IA 3OZYA 3DG7A 3I4KA 3NO1A 4M0XA 3ZLFA 1SJBA 3UJFA 2OZ3A 3V3WA 4HPNA 2OLAA 3CT2A 4ZCWA 3DEQA 3VC6A 3KUMA 4IHCA 2GGGA 4IT1A 3UXLA 1MDLA 4ENLA 2PP0A 5FJRA 3V5FA 1P48A 2PP3A 1EBGA 2AL2A 3DIPA 4F4RA 2ZADA 4J1OA 4E4UA 2PCEA 2QJJA 2PS2A 3SN1A 3DESA 2P0IA 3FV9A 2FYMA 6ENLA 3THUA 3IJIA 4H83A 4Z17A 4KT2A 4A6GA 3T8QA 2PGWA 3SBFA 4Z1YA 2GGHA 1TZZA 3U4FA 3ENLA 4HNCA 1KKRA 1EBHA 3DFHA 3MQTA 2CHRA 3VC5A 4GFIA 4DWDA 2PTYA 2XH7A 3P93A 4M6UA 2GGIA 3DFYA 3ES8A 4DXKA 1P43A 3NZGA 4E8GA 3UCDA 3ZLHA 4GGHA 2OQHA 3QN3A 2P3ZA 4H19A 3SN4A 3ZVIA 4IL2A 3TTEA 4G8TA 1BKHA 5IDZA 3GY1A 4KWSA 4K1WA 3MZNA 3CXOA 3ZVHA 3TWAA 1NELA 3H7VA 3R0UA 3RGTA 1W6TA 3CK5A 1FHUA 4H1ZA 1BQGA 3EKGA 2PTWA 3OTRA 1FHVA 3QKEA 3T9PA 5FJPA 4ROPA 3TW9A 5BOFA 3GC2A 3V5CA 3ZLGA 2DW7A 3TWBA 2OG9A 3PWGA 2AL2B 3OW1A 3DG6A 3STPA 3RR1A 1MNSA 1WUFA 1EC8A 3S47A 5FJUA 3Q4DA 2XH4A 3UJ2A 1DTNA 2RDXA 1SJDA 2HXUA 3N6HA 2QDEA 3UCCA 1PDYA 4IP5A 5BOEA 3RITA 3Q45A 2GSHA 5FJTA 3JZUA 2O56A
chains in the Genus database with same CATH superfamily
1EA9C 5A8PA 5EU9A 2ISFA 4KGJA 1TJRA 4Q32A 3KTSA 3R13A 4IUOA 3CZKA 2OKTA 2RGLA 2NQ5A 3D6NA 3WL0A 1LUCB 2NUWA 4RE4A 1PKYA 5I6SA 3QC3A 1QI0A 2CZFA 3EWDA 2QVNA 3WH7A 2YQUA 4R3UA 4KFOA 1FWHC 2YW3A 1H4PA 1MQPA 1A4MA 3TYUA 3WX7A 1HTIA 1K8ZA 1FFQA 1E6XM 2QCHA 2ON3A 3CT7A 3NQMA 3KL3A 3O07A 1ZJBA 4LUJA 1CTNA 5HMEA 3P61A 1DOSA 2D0HA 3AYVA 3FAWA 1Q65A 1JAEA 4RW5A 1R0MA 4U4MA 1E0WA 3W7IA 1YXDA 4DVOA 3WQVA 1WQ5A 1UWQA 3C61A 4Z0SA 4B3LA 1LCOA 3A4AA 4DJDD 1Q8AA 1XV8A 4NAFB 4IMDA 2ESCA 2XPKA 4HN8A 2QLYA 3IUHA 5EKYA 4HHHA 2PU0A 2YW4A 3GSMA 3NXLA 1TREA 2BVYA 2B7QA 1CGWA 3N15A 2POZA 2XM2A 3PJXA 3RAOA 1PZ1A 5AHLA 2NQ9A 1DJGA 5DRIA 4KEMA 2E1WA 1RCXB 4MUZA 1PX8A 3A22A 3VAVA 3NQBA 3XIMA 1R3YA 2DT0A 3MMUA 3FCPA 1IQ8A 1S5TA 2CKRA 1I2OA 3FGCA 4DM2A 1CECA 2FIQA 3TTYA 4W8LA 1NP2A 1TYGA 1LBLA 2CLEA 3PY2A 1O5RA 4U5KA 4GISA 3BSMA 1XQKA 3UA4A 4I6KA 3N4FA 4AWUA 1KM2A 5J04A 1PVNA 2ASHA 3B8SA 2Z1XA 5I7GA 1NIUA 3J7HA 3GH7A 1VEOA 2B31A 3ZXWA 4JTIA 2NVAA 3WENA 2A85A 1NM9A 1SM9A 1UWRA 2BC0A 2PA6A 1PIGA 3HMJG 3TSDA 2GJLA 2F5ZA 1B3XA 2VMFA 1G7VA 2W9MA 2XZ7A 2J62A 5HJLA 3LPPA 4B5SA 2OZ0A 1GRBA 2J13A 4S3JA 2JE8A 1TMHA 3TQPA 1VYPX 2EQ8A 2PDQA 4WHBA 4BZYA 3TU9A 4YLWA 3DH9A 1NDWA 2VWTA 1N7KA 4H4RA 2BGQA 3GBDA 4BF7A 4JFWA 3CHFA 4GZ7A 1SFJA 2ZZ0A 4TV6A 2PMQA 3THDA 3B9EA 4HZ7A 1ZRQA 4C90A 5HUOA 4LH8A 3PZ9A 2PTXA 1E56A 3MYPA 4A05A 3G77A 5FESA 3M0MA 3IV3A 3MJYA 4N9EA 4F0HA 3MP3A 2WCAA 3LUTA 3S5OA 1E5NA 3CV7A 3QFBA 1OT1A 4YTRA 1YQ2A 2J27A 1SYTA 4IJBA 2ANUA 4I6VA 3VOCA 4LUSA 4BI7A 2YXXA 4DY1A 2GR0A 2RKXA 5A95A 4JFSA 4GOAA 3BC9A 1SZGA 4JTRA 1U83A 3BURA 3RHGA 4CVUA 4H4YA 4G2DA 4LXFA 5IFTA 1K8XA 3PZOA 2CBVA 2OLAA 2BBFA 3A12A 3EXTA 4ADTA 2DV0A 2FZMA 4AQLA 3WEZA 2C7FA 2OX1A 3AMKA 3UXLA 2VHLA 4ATWA 2O4QA 3A13A 4IMAA 3RNMA 1VCFA 1N82A 4Q7BA 3W74A 4CU8A 3OVRA 2A3AA 3BSGA 2Y70A 1UR4A 3DESA 1UP2A 2BCPA 3RR4A 1UUMA 1EYEA 3II4A 5HQLA 4PSRA 4H83A 5G4HC 3AIRA 4PMVA 1ZLPA 3EWYA 1AD1A 1R3RA 1VP5A 2QW5A 3MKKA 4MB1A 3HGOA 3MCNA 5AHEA 3I3BA 3ARWA 5HUPA 1XDJA 4QLKA 5EPDA 3HURA 4PEEA 4IFRA 4ROQA 2CXEA 3HZ3A 2BOEX 1W8SA 1EA0A 4GFIA 3HW2A 4ZQMA 3EB2A 1UWTA 3P93A 3AM9A 4CEXC 4WZHA 3QFWA 2ZCGA 1ZALA 1MXSA 3EYPA 1W0MA 2A6LA 3CBWA 4GUGA 1SW7A 1NWSA 2YSWA 1J4EA 2F9RA 2IPWA 3WLTA 1HKJA 3HO8A 5E93A 2NXHA 3N19B 1JCMP 3MDUA 2J24A 2J8TA 4F40A 5BYWA 3DC8A 4Q4KA 1RAKA 3EX4A 2NVDA 2YFNA 3RM9A 2GSJA 3PULA 2IQ0A 3SY8A 3EDFA 2C16A 2E1DA 3ZR5A 5JQ9A 3SCOA 3VZYA 2A5HA 4H4SA 1R47A 1AOGA 5JCLA 1OG6A 3SRKA 1F6PA 4XVDA 1XCXA 1Z6KA 3R12A 2PWGA 5D8WA 4XAYA 5FAGA 5AHIA 3WFAA 4KS0A 3GBEA 4H6KA 1ZUAX 4Q8WA 5EMLA 4DUWA 3QM3A 3MS8A 1K7EA 3TJLA 1X98A 3BLLA 3WCZA 5HMSA 1DKWA 2Q3OA 2RDXA 4S3DA 3WUGA 1ZBCA 3MT1A 2VZVA 2NVKX 4WDWA 4PTDA 1BWKA 3FHAA 5BRBA 1I2QA 1LQ0A 5FCZA 2E3ZA 1XP3A 3N9RA 1KGWA 4H4PA 1X39A 3VM7A 1OBAA 1QATA 2PDFA 2WLZA 2X30A 4UTTA 2GRTA 3CTTA 1S5WA 3G0SA 4Y9NA 1SW0A 3SEPA 5K9DA 4N9CA 4Y6GA 1YTDA 1W3JA 2J7EA 4QJ5B 4U28A 4FA3A 5GJNA 3M1ZA 4QHRA 4DN1A 1IZKA 1OFPA 1G9HA 1K6AA 4HQVA 4H4WA 3MV11 3QY6A 3SJNA 3GM8A 2ACUA 3QPYA 3FDGA 5D33A 3ZJ6A 2V5CA 2OQYA 1JCLA 1AH3A 1AMKA 2WQPA 3QQ1A 4Q4SA 1OHLA 1DWAM 1BYAA 4X3ZA 4S3AA 3WLPA 4B3KA 1FBAA 1R9ZA 5CXPA 4ZQNA 3T6CA 4Y9AA 1J12A 4AD5A 1Q8JA 1GZGA 1VFMA 1K7XA 4XV0A 1UWAA 4I8DA 1EXPA 4HYRA 5AZ0A 4Q8OA 5LZLA 3EPNA 1EJSC 3VYLA 3F5JA 1PEZA 1RV8A 4C5YA 1PL9A 2WHJA 2WC3A 2WSRA 4ZTYA 2AAMA 2O9OA 4H2HA 3SGUA 5HR6A 4W88A 3VDGA 2WHLA 2QJMA 3LCXA 1MUCA 5A6TC 3LHWA 1TUFA 5DELA 1PHWA 1JD9A 4JFUA 4NEVA 4J4KA 4YHGA 2O7QA 3MC5A 1VFSA 3Q2DA 4GFSA 4F66A 3FSTA 2PPGA 5HK4A 3WK2A 4H9XA 3RLVA 4NT0A 4OGZA 4UFJA 1KRCC 1QASA 3WQCA 2DZTA 4JKLA 2NQJA 2WVVB 2PLKA 3UT0A 3TZFA 1VPXA 5AHMA 4XISA 4Q4PA 5D38A 1WO2A 1GNXA 3OEXA 3UWUA 3W2NA 1NOUA 3M07A 2BGNE 4GXPA 1KBJA 4YVVA 1FWDC 1EUAA 3QH2A 1WXJA 1F73A 3LGEA 1ZBVA 3LYEA 4OT7A 3C6CA 1AQMA 3R1ZA 3UGRA 2PWUA 3VE9A 4GIEA 1RBLA 4XKYA 4PB4A 4X9YA 1O1HA 5I5RA 2NQHA 3PZQA 3N3MA 1P1XA 2V2HA 5KZMA 1NU5A 3R5EA 4FLOA 5JH2A 4YJ5A 2YZRA 3VOGA 3KP0A 3U9IA 3LXCA 3SN0A 3KBNA 3U5YA 1GEHA 3M7SA 2BOGX 3FKRA 2ZUTA 5T9BG 3N04A 4IG2A 5CC7A 5D2WA 4OFCA 1HP5A 3EKLA 1KO0A 4Y90A 5AVNA 3N6QA 2X50A 4FOJA 1TCMA 4ZQRA 1GJUA 1MMFA 4P61A 1K77A 1W9PA 2A3LA 1ICQA 2A7PA 3TC6A 4NY2A 1BWLA 1GJPA 2Y88A 3THCA 1PBGA 4EMIA 3W70A 3NWRA 3WFZA 2R1LA 3M7WA 4AISA 1XCWA 3CLMA 1BVWA 1FCVA 2WSYA 5HR7A 1XLJA 1L8PA 4DHGA 1FP8A 3GG1A 4C6EA 3WSUA 3R58A 1FH9A 1FWWA 5C0QA 2JKPA 4D6DA 4ORMA 3P7YA 3QW3A 2VR5A 3NG3A 4PC8A 3N2MA 4HPNA 4CNUA 4CQBA 1WZMA 3C8FA 2Z0IA 3ITTA 4DJFD 1MDLA 3ZYZA 3N18A 6TIMA 3OIHA 2PP3A 1IHIA 3U8GA 3TSMA 1E9YB 3C0SA 4LAMA 4J1OA 1V3JA 2DZXA 3BQ5A 3PTDA 1KXVA 2Y62A 3REQA 4PFHA 3VFLA 1NAL1 2V3FA 2WMFA 5ABGA 3PUEA 5C71A 3W29A 4X0NA 2C71A 2ZIDA 1E6QM 1ZY9A 4PMJA 4Y7EA 1QHPA 3RLUA 4P7OA 1N60C 1SO6A 4B2DA 1J18A 1IT8A 2QCNA 1LOLA 3P82A 2FHCA 1XRFA 4CGTA 1IGWA 3T8LA 4ML9A 3URHA 5CSRA 2CHRA 4YMZA 4HMDA 4O16A 3W6YA 1DVJA 2A8XA 2WNWA 1MQQA 4DXKA 3NZGA 4N7QA 1JRCA 4FNQA 1K8YA 3SN4A 3DFTA 2X0YA 2D2GA 3QSTA 2V68A 1JUEA 4FB7A 4XO6A 1RPKA 3BXWA 6TAAA 3R79A 3QQ0A 1TIWA 1EYWA 4BY3A 1GVEA 4MVAA 3AN1A 2ZDSA 1X7FA 4NXKA 4GNKB 1BQGA 1MXGA 1R5YA 4D1IA 2BY1A 5HMDA 1D8CA 4H6EA 5CG7A 3CO8A 3WZ0E 1AVAA 2NV9A 1VCGA 3ZJ8A 3BH4A 3ARSA 4F0SA 1TPEA 3AZSA 3C0LA 3SUWA 1OCJA 2RJGA 1OGGA 4PCPA 5D05A 5DBUA 3CHCA 1LWJA 1F8WA 1VJIA 4CNSA 1V6TA 3PJUA 3EANA 4MNLA 4XIAA 1S2TA 1XSJA 4IPPA 4Y8EA 5G1MA 1M65A 2G3NA 3EEGA 2BMBA 4KESA 4PMYA 3IRSA 2VO5A 3EOUA 4NJGA 3WQDA 3JZUA 2OO0A 4ZTXA 3WDPP 3CPGA 1L6GA 4LEQA 2ZX8A 3R6IA 3A9BA 3EDKA 2JKEA 3WK1A 1RK5A 4LBUA 3SGGA 5IM51 2V69A 1OWQA 8CGTA 1YLVA 3AU2A 4MUPA 3W76A 1XI3A 3PN8A 1UD8A 5LA2A 1EOMA 1P1MA 3RMEA 3FHQA 3RYSA 4JEJA 3RCNA 3GDRA 2WJEA 5D4YA 3VU2A 2BASA 3E1F1 3N2OA 4KIEA 2WMKA 4S38A 4JFVA 1M7XA 1Y65A 1P6CA 1TUXA 1UA3A 4JFTA 3NL3A 1EX5A 3RX2A 4P8XA 1KM1A 1XIMA 3WK0A 2GH5A 4X2RA 3E3HA 1YE4A 1EDGA 1S39A 1XL9A 2X0HA 2VZOA 1WZKA 1I1WA 2Q71A 3O6YX 2A4AA 4UR7A 4REQB 4A2SA 4DNHA 3VMOA 2XFYA 3UR8A 3DGRA 3F4VA 3D46A 4JNZA 3RJXA 1MOKA 1XHCA 3FXYA 4YL2A 3O15A 3VGHA 3B0VC 1RBAA 3KBJA 4RNJA 4GI8A 1E71M 4L4OA 1QUMA 3IGHX 3EX1A 5JCMA 4FX6M 4XWUA 5A6SA 3W1NA 5EMYA 2XZ9A 1JCNA 2G3IA 3O6CA 2G97A 3O9NA 2P76A 3VIJA 1C8VA 3WQ8A 2RFGA 3MV01 3TQ0A 3PANA 5F4SA 1N8IA 4CCEA 5C6MA 3NRZB 4JTTA 2XVPA 5B7ZA 3N34A 3S6DA 3TW6A 3EOOA 5A6LA 2I9UA 1IEQA 2ONEA 2OYMA 2Y7DA 3GD3A 1JIBA 4I5RA 1VIWA 3O3RA 3HRDC 2DW6A 1IZJA 2GVEA 1GTHA 4B3ZA 1ONWA 1NDVA 1D2KA 4EWJA 1FQ0A 4WIWA 1NHPA 1Y5XA 4D6FA 3WD1A 3H4KA 3ABSA 4HK5A 2ISDA 3D0CA 1JZ5A 3OA5A 1JRPA 5I24A 1AL7A 1ME9A 3LENA 4U33A 4ECLA 1DXLA 3W4RA 1PJ9A 4C65A 4HCHA 3WJSA 1LQ2A 3BPWA 3O6AA 3CPRA 1IIHA 2J78A 3RU8X 1KTBA 2ZRWA 3I6EA 4DM1A 3ABOA 4H4UA 1QBBA 2DZUA 2ZUWA 3BL3A 5DX7A 3K4WA 2OELA 4PUWA 1UKOA 1CPUA 3OG3A 1JI2A 1XR2A 3QMTA 3CH0A 3WQ5A 2GR3A 3ES7A 2XN0A 1QFEA 4P5UA 4ZQPA 4MDOA 3UNTA 3GWQA 4A8IA 2XIQA 1KC7A 2W54A 1YXYA 3O63A 1HN1A 4TX9A 1MZHA 4IZGA 3R10A 4IMFA 4W89A 2CBUA 1DQWA 2H90A 5M5DA 4J27A 3MMWA 1NPXA 5F2IA 3IAQA 2Q09A 1POJA 1UR2A 1TJ1A 2DUZA 2XJ7A 3H4XA 4AXKA 2P50A 3FA3A 1UROA 4LC8A 1PUDA 4GQRA 2MUCA 3P5YA 4MDPA 3O05A 3N17A 1RLCL 1DIEA 1TWIA 2IXUA 1JVNA 3V5OA 1HIZA 4NZ1A 1E6NA 3GAKA 1E6SM 1LUCA 3DEQA 1XYBA 1ONFA 1LVLA 5CLWA 2Z2AA 4APNA 1UUOA 1EZWA 1EQCA 2KX9A 1AA1B 1UD5A 1EBGA 4XBKA 3WLNA 1C8XA 4JTKA 2PS2A 3UG3A 3FLUA 3M0LA 4FEZA 3G0UA 1FP9A 2CKSA 1BYBA 1QPOA 2FYMA 4W8BA 2QULA 4F8XA 4A6GA 4L61A 4ZB0A 2Y8VA 2HQAA 3SAZA 5C8BB 3P14A 5MKGA 4BA0A 1DTUA 1RCQA 1GQKA 4KCVA 3L5AA 5CPMA 3V18A 3DFHA 4FF7A 4Z42C 4XKYB 3NQ2A 3MQTA 3FN9A 1PHQA 4AF0B 4IMGA 4QJ4B 3N73A 4ZOCA 2VX7A 4S2BA 4GABA 4L6HA 3ZLHA 4GGHA 5KVHA 1OJXA 1P5BA 3ZVIA 3KXQA 1AZ2A 4GZEA 4G8TA 3LN3A 9XIMA 5BCAA 4W85A 1J6OA 5G2WA 4MZYA 3JRKA 1KBKA 4MSSA 4CN1A 4GUFA 1UR8A 3L9CA 2IXVA 6CGTA 4O1DA 3QMSA 4K7ZA 3WH6A 4AZ5A 2DORA 3B8TA 4ICCX 4O0ZA 3HV9A 3GC2A 2D22A 4NZ5A 3ZLGA 3URAA 4CD7A 3ID7A 3K4DA 5GPRA 3MCMA 1KCKA 4H7CA 1XCFA 2WP6A 3MZ2A 3DG6A 3UWWA 3ZT7A 1SPQA 4KETA 1FDJA 2W3ZA 3TK7A 2GJRA 3PZIA 3S2LA 3A23A 2OYLA 4AIEA 1UD6A 4KEZA 2WSKA 3L65A 3KWSA 4WGXA 1J01A 2V3GA 4HYVA 1Q13A 4PL2A 4RNIA 3QSRA 3DBPA 1I75A 5A1AA 2X8GA 2WJDA 1PX4A 1CENA 1RJQA 3EB4A 4ZQCA 3ZOAA 2QZRA 3TMLA 3QC0A 1QAPA 1DXFA 5CZJA 1LYXA 2DVXA 2WVSA 2OO6A 2YPIA 5C9UA 3BOFA 3UPWA 1HKKA 4FR6A 4H01A 5F1VA 1WBJA 3PTKA 4IF2A 2VI0A 3GNRA 4TR9A 4CCZA 1NVMA 1GWJA 3LBOA 2I56A 3MSYA 4JN6A 3JW7A 3URBA 2B81A 3LS9A 1T8XA 2XDFA 1ZDLA 1HZYA 3TYDA 3H21A 3DFOA 4MY1A 1JYXA 3UQNA 4LV9A 4FS9A 1XYAA 1W31A 3TJIA 3H70A 2VELA 4JIPA 3LTYA 5E1QA 5CGMA 4K38A 1IIGA 3CWHA 3TYEA 3GDKA 3ARXA 4M80A 2VEKA 1VFOA 4TUFA 2YYUA 4BI5A 3DDMA 4NEWA 1XBYA 4IICA 2GLKA 4W87A 4YVPA 2EJAA 4BKNA 3WBEA 3GHSA 5LXEA 3WNKA 4C1NB 3USZA 2XVKA 3ABXA 3WNNA 3BW2A 3WQGA 3RILA 1EF2A 3BK0A 1HVQA 2FKPA 1F07A 2EHHA 2ACSA 1HO4A 1WUEA 3VA8A 3SCNA 2BXZA 3AALA 3S9YA 2W62A 2WMGA 5H8PA 2DY3A 4TMBA 4H9TA 1E1FA 1VLWA 7REQB 1F05A 4HKPA 4MB5A 1NFBA 1WDQA 4QDMA 4RPPA 3TYBA 1F8MA 2P8CA 1G0CA 4YTTA 1ME7A 2TPRA 1V77A 4H9VA 3H55A 3SUVA 4AXNA 2WMHA 7ENLA 2OT1A 3BG5A 1FCBA 4PBGA 4RDZA 1B30A 3FOKA 3PUGA 4O1CA 3B8DA 3OYZA 4JQ9A 1LRNA 1H3GA 2BG5A 4S39A 1W5MA 3OVQA 3WBWA 2ZE0A 2FPVA 5D2YA 2IPFA 5U1OA 4EIVA 1XRSA 4BV6A 3IWPA 1XISA 1ZK7A 1DV7A 1REQA 2EPHA 3RUBL 2GUYA 1ZCOA 1V51A 2CZEA 2Q8XA 1XFCA 4ADUA 4OOZA 2INZA 2FQIA 4LVDA 1JPDX 3VE7A 3T2PA 1Q6EA 1O1ZA 2GL5A 3KBWA 4PYSA 5IHRA 3FKKA 3UZ5A 3GU9A 5J5DA 3GFXA 1GOKA 4RZBA 1C9WA 3S2CA 5IXEA 3TN6A 4IPLA 1YIXA 4V33A 5DQPA 3S1UA 4EKJA 3CUGA 1BLIA 3KDOA 2HE8A 1XBXA 2DIJA 1XYZA 3V0TA 4UTIA 3WLHA 3L4YA 2DGAA 1MW2A 1ZBWA 1MVYA 1F3XA 4LCRA 2FB3A 1BD0A 3DG3A 4ZGYA 2VC7A 2DJXA 1G7UA 4NASA 2EPMX 4JYDA 4KIRA 1Q5MA 3SUSA 5A6MA 1OC7A 4G56A 4NXSA 1H61A 4HJWA 2DP3A 3LG3A 3IC9A 1BF2A 2OZ3A 2GQWA 3LRKA 1CB7B 1E3ZA 4WJ8A 2H3DA 4HZ6A 5DXYA 4V28A 2PURA 3MA8A 1GRFA 1M01A 3W23A 1DJXA 1GV4A 3HMCA 1OFDA 3BAJA 1RALA 1CGXA 3G1YA 4M52A 2VX5A 2WZMA 4GYKA 3MUY1 4BWLC 1HG3A 2GWNA 4I3GA 4GUIA 4CQDA 4FX9A 3LHTA 3V75A 1WXYA 3AS0A 4QG9A 2OT0A 3LXAA 3P8JA 4PMDA 4QBXA 2P10A 3E5BA 2ISVA 3OHMB 1KKRA 1ZPTA 1B1YA 3II1A 1LRTA 2L5HA 2D3NA 1A0CA 1S3HA 2XWDA 5D04C 1GYMA 3KCOA 4C6IA 1S2CA 3AIWA 3QR1A 4B5VA 4GHRA 1H0GA 1HJSA 4J28A 2WWDA 1BFNA 3SCVA 3TC3A 3TH6A 1QOQA 3OA3A 2DJLA 1RP8A 4NILA 3O16A 4QR6A 2C15A 3A5VA 4J56A 1Q85A 2FMOA 4R5EA 1EIBA 3IAPA 2WVVA 3S2JA 2YVGA 3IV8A 1ITQA 1ISVA 4JBRA 3IVTA 1DL3A 3VOJA 2VKZG 1MO0A 4PH6A 3HF3A 1R46A 1B2YA 3ITCA 1J2BA 3FK4A 2NV1A 1ZS2A 1VFTA 3GFYA 4KEVA 4IFKB 2PDKA 2ZBTA 4ZEPA 3AHTA 3RJYA 4IH3A 2MANA 3LHZA 3L8KA 1P7TA 4XZ9A 4QG6A 2BY0A 4M29A 4ALDA 4OIFA 4JTLA 3MVTA 3ZT6A 3TWBA 2OG9A 3VIGA 1L6FA 2WWCA 3CL6A 3KBMA 4JTGA 1FOBA 1C9DA 5FJUA 4QDWA 2ZXQA 4Q8PA 5I3KA 3ALGA 3G8EA 1V3MA 3GRIA 4CEUC 2WQDA 2O7SA 2VFDA 3UXAA 4IP5A 1LLZA 2F2KA 1XGDA 1SO4A 1IGSA 4UTWA 4E0CA 1CXIA 3E2QA 4NZ4A 1QPKA 3GXIA 2CXGA 5FEZA 3QPEA 3RG6A 5DLCA 1YPIA 4DB7A 1MWOA 4R85A 5CAKA 3UJRA 3QW4B 4EOUA 3W7EA 3BLIA 2CHOA 4C60A 4EQXA 4QE4A 1EUNA 1U1UA 3CZEA 1OYAA 1WKFA 1MO9A 1G69A 1TZ7A 3CGBA 4GXMA 3E0WA 3QMRA 2OZTA 3CPUA 1MUMA 4JDYA 1H09A 4E6MA 4M82A 1XJBA 1RXOB 1SZRA 4H4TA 3QVQA 3BVJA 1L9WA 2VR4A 1QI4A 3FYYA 2NQLA 4UWMA 4HCDA 2ABBA 3H12A 2QAPA 3EWZA 3WLQA 5K4ZA 2E6FA 4HSHA 2PDPA 3BMVA 4RKAA 5H6HA 4JTHA 3TA9A 3UA3A 1KLYA 1O95A 4WXYA 4GRTA 1W3HA 5FJJA 4NF7A 1C3FA 3I65A 3BTNA 2H8ZA 1SJCA 3EA3A 5HDRA 4Q6JA 4N6EA 4TVCA 1C93A 3OHIA 1LLOA 1W2PA 1Q2RA 1K9DA 1CLXA 1MW3A 3S4TA 1VBJA 3GXFA 4XSLA 1EGVA 3AYSA 1FWFC 4C1KA 4ZA0A 2CESA 1TYTA 3B8WA 1YTKA 1HJXA 2E0PA 4UNIA 1XBZA 4TMCA 2VDGA 3V4BA 3UXKA 3DZ1A 2EPLX 2AKMA 2VCAA 1OC6A 1JJKA 2BS9A 4AEFA 4PGLA 3QZ6A 4HHPA 1P0KA 4POCA 2MNRA 4NAEA 4H00A 5TAOA 1XIJA 3NPVA 3MHUA 1W3NA 4HSOA 2BGSA 1TCDA 1JFHA 1XLLA 3K8KA 3KOYA 3M47A 3BARA 1OYBA 4JPGA 4DPPA 4C6JA 3VFCA 2YBUA 1XICA 3ERPA 3PP7A 1E1EA 1A5MC 2X7WA 2FMNA 1WE5A 2I7GA 3L4ZA 4JCLA 3V1PA 1VFLA 4BCEA 4HU4A 4MGGA 1XKYA 3SJ3A 1ZP3A 3UEQA 3M5VA 2QCLA 2PTDA 1JFXA 2DUXA 4GA8A 4PZVA 2C18A 2Z24A 4UXDA 4AHOA 4UQAA 3CUXA 4IIFA 1FWTA 1HKWA 3E2VA 3H53A 3DOPA 3ITGA 2EGZA 1G94A 2YIHA 3KS5A 1GXFA 1TA3A 1O60A 4AHPA 1ZP4A 1SVDA 5H8MA 3EAUA 3DUGA 1Q1WA 3DCPA 3PZUA 4L65A 4MWAA 2O9PA 3N13A 4Q4OA 1XRTA 3E12A 1QW8A 4H50A 1QO5A 3NL2A 3DK4A 1A3WA 4Q4RA 1XDLA 5HA7A 4K8DA 3NZ1A 2VCBA 3IJLA 5D02A 3VOIA 5D2VA 4M8UA 1AL8A 4PMOA 2VFFA 1UBPC 2DVTA 3G5EA 2ZUSA 1WDWA 2ZQ0A 4MHBA 1EHAA 3RM4A 5JXQA 3WUEA 3A7AA 3QOMA 1OZMA 1XHGA 3A7RA 5A69A 3ARRA 4EANA 1KCXA 1NHRA 4C6BA 2GJXA 2EJ1A 2FH6A 3GZAA 4F0LA 3K4AA 4F79A 4AYGA 3W2KA 3GTNA 4E2OA 3C2OA 1A5UA 1FWSA 2GDUA 4DZAA 2E7FA 2WVUA 1HJVA 1E1CB 3WQ4A 4Q4MA 3FIGA 4OV9A 4ZFMA 1TB3A 2JALA 1ZXIC 4AIBA 2PE4A 4NG3A 4UTWC 2PI6A 4H4IA 5FJIA 3BOLA 1UZ1A 3PVFA 3UCQA 4NNCA 3LV5A 2WSPA 3VK5A 2ABAA 4XIMA 3AFBA 2GGGA 4IT1A 3V16A 3B4UA 4G9PA 1G4PA 3NCOA 2A1YA 1Y5VA 1UR0A 1BHGA 1KGUA 4CUCA 1A5NC 4QTGA 1VJSA 2HS6A 2R9ZA 2RAGA 1LQAA 1QNOA 3PBMA 4DO6A 4CLMA 2VGGA 1HKIA 3CHDA 1B90A 2J8FA 4QEEA 1X1ZA 3LADA 5A6AA 3E6EA 3VNZA 3IJIA 3E74A 3S6TA 1JZ2A 4Y8FA 1QOXA 2FDMA 2O9RA 2Y7GA 4WOQA 3KHJA 5AOUA 1ONRA 4EF9A 1Z32X 3MMDA 4RW3A 4HNCA 2NSOA 2J77A 4MYXA 5AYBA 1OD0A 1UZHA 1F3WA 3JU2A 1A80A 3WN6A 1I0BA 3B9AA 2D69A 5EFDA 4AZIA 1P43A 1DP0A 2OSWA 2F61A 2PUZA 1Q6GA 4IMCA 2NLIA 1IWPA 3V7PA 4ONVA 1WYGA 1UZ4A 1E4NA 3WDJA 3RPMA 2V67A 4O19A 4ZR8A 1KXHA 2OCZA 2OEJA 5CPOA 2QMJA 3ARTA 2D2HA 3EX3A 1V0NA 5G5GB 3TWAA 3AS3A 3H7VA 4GKLA 3ZMRA 4IJRA 3T2OA 2Y63A 1UR9A 1D7KA 4LAKA 4DYJA 5FJPA 3VNKA 3BLFA 3N9KA 1VCVA 3PJTA 1AQFA 3N2XA 4XVEA 3WUBA 1S5MA 4P8WA 5CJMA 3UNDA 1W3LA 4EPEC 1PZ2A 4DO5A 2VEPA 2Q8ZA 4XZWA 4KPRA 2NX1A 3HM7A 3O0FA 5HXMA 2A3BA 1DWJM 1R3VA 3L7RA 2FZNA 2VEFA 4E3TA 4H2CA 1S2UA 3F4CA 3AROA 1DXIA 3L68A 3KHDA 2FVKA 1PDYA 5H8UA 3O6DA 3GUGA 3ORWA 4O8RA 2AOSA 2DQWA 4Z1BA 2ZRVA 3AUOA 3GIYA 1GRTA 1U1JA 3HG3A 3TONA 1F9CA 1NF0A 1EC9A 1UC5A 3VKJA 1LORA 3S6OA 3K5XA 2P53A 1CEOA 1R3WA 2Z1KA 1SB3B 3G6LA 3UY7A 3QYQA 1TRIA 4A8LA 2VZSA 3QHOA 1BSLA 4NZ3A 1VR6A 3PPCA 1NWTA 4MZ8A 4HPHA 4JTSA 1MFUA 3I7RA 1Y7VA 2FZ9A 3NPXA 4DI9A 5EMMA 5BU6A 3DYOA 4LY8A 1B3WA 5LNWA 3WFLA 4ACZB 4PCNA 1G67A 1E73M 5BOOA 5GVJA 2YDQA 3IVUA 3BO9A 3U5UA 2PTZA 3HPXA 3AZRA 4ZOEA 3ISIX 1QMLA 2YCEA 1PKNA 3GO2A 1V59A 4FO4A 4PUUA 2V6OA 2C91A 2INFA 4DWSC 1ECQA 2IKJA 4PR4A 2SFPA 4EPDC 1GQNA 3W84A 4FLSA 1PTGA 3L5OA 1E72M 3P5ZA 1KM0A 1OX4A 5CAHA 4ES4A 4ASTA 4YXGA 4PSPA 7A3HA 3INPA 4ZE5A 4O17A 3I3EA 4FMVA 4AWSA 3QTPA 2YDSA 3A5FA 5U4NA 1D9EA 2WKJA 1WDSA 3TJ4A 5F7UA 4JQAA 3PUDA 1ZJHA 5M2FX 1NHQA 1TPH1 1YX1A 4WVXA 2Z7GA 1US3A 1DHPA 4UQBA 3W2UA 1W2VA 4GIYA 4Q8QA 1R6WA 2Z29A 1F76A 4QIUA 3W6LA 3LCLA 3WBAA 3RX3A 3QOKA 1CCWB 3LLDA 4C6DA 4XTDA 1OG0A 1RH9A 4QROA 5FAJA 5CG0A 2CWXA 4M6QA 4W7VA 1C90A 3UG5A 4F9DA 2GUBA 3WJYA 3ZZ1A 3GIQA 4FDCB 4LUTB 2FTWA 2AMGA 1NOWA 2E5CA 4BWLA 2XIJA 1PCWA 4HCLA 2OFJA 3KL5A 4Z1DA 3GD6A 3LHVA 4MY9A 1JDFA 3SFKA 3T0AA 3SCSA 5HANA 3ZQ9A 1WX0A 1PIIA 1LLWA 1TJ2A 1SU5A 3FX4A 3TLLA 2GR2A 5C7VA 3DHUA 3ECQA 4G5DA 2VX6A 5C5YA 4I7VA 3CUFA 3W22A 1S7MA 4WKAA 3GHTA 4GR1A 4YS1A 2JEQA 8A3HA 2W3RA 1K9FA 2ZUVA 1BTMA 1IEVA 1XG4A 4I9AA 3E5PA 1KB3A 4PMNA 4O52A 4WSHA 1KXQA 4QLJA 3IJQA 2CITA 1Q6LA 2E5AA 4MZ1A 3FVDA 3CYJA 3GE7A 3WD2A 4XBSA 2EQ6A 3DXIA 1GT8A 3DX5A 4JL1A 3DHFA 3SGZA 2XHYA 3QHNA 3BOXA 3CWOX 4O1EA 1BWVA 4PMXA 2YCLB 2XFFA 2ZX6A 5KEZA 2ZYFA 2J3NA 3I4KA 1OINA 2WPEA 4R53A 4GQGA 4LCSA 4M0XA 3ZLFA 3BE7A 4UQ9A 4DBSA 4G7EB 4HU3A 2J47A 1UUQA 2ATSA 4NJIA 1DJIA 3COTA 3STCA 1NQKA 3B9JB 2HBVA 3CT2A 1GEQA 1LROA 4UR9A 4QNWA 3H2FA 3MBFA 3DHDA 4KF1A 4ENLA 1ISYA 4QGCA 2DPEA 3IACA 1WB0A 5LA0A 2YB4A 3DIPA 5DMNA 3BMWA 2ZADA 4GYJA 4XK2A 4R27A 2PGRA 5CGTA 3ZO9A 1QNSA 5A8NA 4OKDA 3NVWB 1KQYA 1BG9A 1S46A 2TMDA 4IQDA 3UZYA 1TQJA 4UTFA 5A94A 3SR6B 4O1FA 2P0IA 4TVYA 4PBFA 5GQBA 1DXEA 1X2HA 1A4LA 2GQ3A 2PF8A 3P60A 3FDKA 1I2NA 4AY1A 3VOFA 1TZZA 3VIMA 3AXMA 1T96A 3ZIZA 3B8IA 1H51A 3NL5A 3NTYA 1XIIA 3V1HA 3VC5A 1E5JA 4HMNA 1S5VA 4M6UA 2X09A 1W1IE 1I2PA 1ZAJA 4PA8A 3B9NA 5FL0A 3P67A 3L2MA 3LTPA 5I3FA 3BG3A 4OJYA 4IQLA 2PWEA 2P3ZA 4ERIA 3NVDA 4K8HA 4IL2A 1E4IA 2VEGA 1B4EA 2F38A 5IDZA 1DNCA 3KBVA 1RY8A 1LT8A 4K8EA 3A64A 1QW9A 4GVHA 3F5KA 1XH0A 2FGZA 4I90A 1X96A 3A9IA 3EWUA 1FHUA 1RP9A 1VAHA 3NZPA 3GZ3A 3W7PA 3KOZA 2NT1A 1R9XA 2FHFA 1NTHA 1EHNA 2E67A 2CWNA 4GI9A 4IPJA 3QFAA 3HFYA 1G4TA 3WEOA 4W7UA 5JU6A 3LNMA 5EMKA 1SZEA 2YLLA 1CDGA 2D1ZA 5BWFA 3EMZA 3T08A 4UIOA 4AVOA 4MAVA 1IV8A 2ZUNA 4QLLA 1XWYA 2OTDA 1GESA 3IPWA 1T8QA 5EA9A 4Q8UA 1A5BA 4FX8A 6PTDA 2P1FA 1THFD 1R86A 1RR2A 2A6NA 2VFHA 4EPKA 2X0SA 5ABTA 2EKCA 3UYIA 2GSHA 5FJTA 4P2VA 5JCKA 5C2XA 3DKLA 4NAEB 4CNOA 1KM3A 2J8GA 3EWCA 5KETA 3MUZ1 3N9SA 2OU4A 3GTIA 2VX4A 3AXXA 2VL4A 1LOQA 4JQ2A 5E0KA 2VTFA 3DKJA 4I9JA 1W9BM 1R8LA 4LUSB 5DY2A 4DYKA 3T07A 1Q6QA 3TFXA 5G2HA 2HNHA 3W1PA 4KCWA 3G0XA 2BVDA 4HK6A 1YRRA 1GERA 1BTCA 4C6KA 1XLMA 2VFGA 3UG8A 4KCTA 1UCWA 2QDGA 2YKKA 2DZPA 2QUUA 4UQDA 4W4QA 3TYAA 4GYFA 3RX4A 4YVXA 1GVYA 1D7FA 5AC5A 1KFCA 4UQEA 1PYMA 3G1AA 1BVNP 1TVLA 2JBMA 3VIOA 1QPQA 2RDWA 4UFHA 5FI8A 2RDUA 3AICA 4E4FA 1CGYA 1TZ9A 3RLGA 1VIZA 2QPSA 2AL1A 2VUNA 4CKQA 3OP2A 4RDYA 4MWAB 4ML4A 4J3WA 2PU1A 4XD4A 2DH3A 1WNOA 4A3UA 4EQWA 2EO7A 4CD5A 3LU2A 1K4QA 3WDHA 3BGJA 1F61A 4MWAD 3GKAA 1HGYA 2RHGA 2OVLA 3WD0A 3PSVA 4JCMA 3W87A 5A6BD 4XUYA 5A8OA 5LSMA 3ITYA 1LL7A 2GFTA 1PB0A 4XAGA 3U3HA 9CGTA 3L0NA 3QEZA 2PDIA 3DHPA 5M1TA 1JUKA 4LYRA 2PGEA 3OPSA 2CLPA 1NQ6A 2R24A 5I06A 1V7YA 2PLMA 4YPJA 3MHGA 4I5UA 5LIKX 1QT1A 2I57A 2WB5A 4A29A 4L5ZA 1HT6A 2GJPA 3GKFA 3SFWA 2Q02A 3M5ZA 1H50A 3IEBA 5DCDA 1H1NA 2HZGA 4ZO7A 3RRXA 3M5YA 2Z1SA 4TQTA 3ETRB 3A3XA 3WD4A 4NQ1A 1W91A 1LPFA 4K7YA 1ZJAA 1V02E 1BZLA 2X99A 3CMFA 3F03K 2WNQA 1FDYA 3AQUA 1UH3A 1BG4A 2E77A 5DY3A 3SADA 2QV4A 4QJ1A 2XVGA 3GD4A 3EKZA 4C5ZA 1XW8A 3VKDA 5CPNA 1QNRA 3G6MA 1MW0A 5U25A 4EAMA 3W38A 4N02A 2HVNA 3ELFA 5CC3A 4MKVA 2V82A 1HVXA 1JDDA 3CMJA 2PBOA 3JVAA 3CV1A 3KL0A 5HNUA 2C3DA 2TYSA 2CZDA 2C0AA 3KRBA 1M68A 4AZGA 3P0XA 5HULA 4NVTA 4O15A 5HWNA 3ARPA 4GYPA 4L9ZA 4FX7A 4HYWA 2BDQA 3UZWA 3PAOA 3M41A 1XGZA 4AF0A 4HSNA 2E25A 2EXOA 3YPIA 2IW0A 2PAJA 1S2WA 3RRAA 3H4GA 3UPMA 3NEVA 3U4AA 3MP5A 4KFNA 4GNVA 4N2YA 1ZAIA 4O57A 2PP1A 3T0DA 4F0RA 4EWND 3VIKA 2CLOA 4L56A 1M6JA 4E2VA 3LEPA 4US5D 4AY7A 2XU2A 3OZYA 5AHNA 2CU0A 2E9BA 1Q6FA 3NO3A 3KRZA 1UASA 3VIPA 2PC4A 2G95A 3H26A 1H7NA 3UFYA 5REQB 3IS4A 4NJHA 4LS2A 2Y6ZA 3V0UA 3W86A 1FH7A 4O54A 2XYLA 3GC4A 3IANA 1ZQ5A 3R2GA 4NL1A 1PKLA 4LBSA 2XIOA 3HPSA 3W7NA 1ZY8A 5FJRA 1JEHA 1SZFA 3EX2A 3N3TA 3O0KA 1ISZA 2VVNA 2NUYA 1N55A 4LYPA 4GVIA 1UIPA 3SRHA 1UMLA 4Z2KA 3P6LA 3WH5A 1KW1A 1H2IA 3QY7A 4CN6A 3T55A 3CEUA 3S9IA 1JI1A 1YNYA 4CVWA 2PDGA 1MEWA 3KCJA 3G1VA 3TVAA 3TFCA 2F6XA 3F7JA 5D9NA 1K4GA 3VDCA 1QU4A 1K9EA 1LWHA 4JDBA 2QAFA 4H9ZA 1HQTA 3F2CA 4B15A 3GU2A 3SRDA 2Z2UA 4AEEA 3LZ3A 3I3DA 3W7GA 1VHNA 3UG4A 4C7FA 1CXKA 3T40A 2HJPA 5XIMA 4GXWA 3NPWA 3NUKA 4H19A 5I3IA 3S1XA 1NARA 4JS3A 1CWYA 2VVSA 3P2VA 4JKMA 2FPTA 3VCRA 3FJ6A 3TN5A 3AXKA 3G2GA 2FTPA 3NVYB 1W6TA 4K1GA 4UFKA 4CU7A 1XIBA 1O94A 3EKGA 5CJ5A 3OGRA 3TNOA 2XSBA 2NXGA 3O8AA 4MM1A 4Y2WA 5EMUA 1Z48A 1R87A 2E28A 3WF2A 1UHVA 4HU0A 4AVFA 1MEHA 4UQCA 4WUIA 4MLRA 1UYQA 4ZSTA 2V0TA 4I5XA 1WYIA 4K37A 2CDUA 1Z69A 4L80A 3TIMA 3OGVA 1XH1A 4BF5A 2IQTA 1W9XA 2Q6ZA 2V5JA 1EIXA 5IBXA 5ABEA 2FVLA 1GZ1A 1F5ZA 3NL6A 2HQMA 3BGGA 1A5CA 4X60A 2P5NA 3VINA 1C8YA 2QDEA 3BUVA 1U33A 2C13A 3VUSA 4HJFA 2G4JA 3GNNA 4FHAA 4B16A 4P8VA 1HX0A 4H41A 3C4UA 1VS1A 2AKZA 2F2HA 3VD9A 3GLCA 4WF7A 2OPJA 4GYPC 5EB8A 4PTMA 1DWIM 5I23A 1EKOA 1EO7A 2VGBA 5FJOA 1OSEA 5DMYA 3RM8A 3IIPA 2YCJA 5ECVA 4Z1AA 3W6MA 3W25A 5LIYX 1KFWA 1QR7A 1L6SA 2QGYA 4AMAA 3OU8A 3VI2A 1XYLA 2ACRA 4GINA 7ODCA 4HA4A 2OZ8A 3MKVA 3M6DA 2GSEA 5IDIA 1DJWA 2Z7KA 3TCSA 3SCWA 3LHYA 3MUAA 2W61A 4GCXA 2F6UA 1R3QA 4HNTA 3FEMA 2XG9A 3L5MA 5CBJA 3LCHA 1ZJIA 1Q1RA 4U2YA 1FEBA 1EB3A 1U1HA 5EBAA 2Y5SA 3GVGA 1UG6A 2TSYA 1JEZA 5AYXA 2D2JA 2HPIA 4JAWA 3PBUA 3D3FA 4JX6A 1MSSA 1TMQA 3QHMA 4EXQA 1ODUA 1TJ0A 4UOJA 4LUIA 1M7PA 2Y7EA 3NM1A 3AI0A 1LDCA 2ZE3A 1O12A 1J5SA 4U2ZA 3LRLA 3EWWA 4GO8A 4UMBA 2DUAA 5FF7A 3F4DA 2FB2A 3LDVA 3EZ4A 5LIWX 2ZZ4A 2ATMA 3ONBA 4ADSA 4QS6A 4DLMA 1W1ZA 1PKMA 1UPPA 1UKSA 4QSHA 5EYWA 5GNZA 1KCZA 2DSVA 7XIMA 2ISWA 4GE8A 3FNDA 3PWIA 3EPMA 4PE8A 1OFBA 1EL3A 3OZMA 4DXVA 2OWWA 1E6ZA 4G7EA 4JKKA 1BAGA 2QNEA 1AH0A 1G1YA 2FGBA 3N29A 5C9WA 4HTYA 1JD7A 2YLAA 3C2YA 1P0EA 2Q8LA 4JHZA 2ZC8A 4IP7A 4RDVA 3MANA 1ZCCA 3LX9A 1UKTA 1KTNA 1K70A 4D1JA 1DJYA 3W7HA 1ODZA 1TWZA 4Z2JA 7CGTA 3TEVA 3NSMA 2J75A 2ZZ3A 4D8AA 3DN5A 3S1WA 5M3WA 5XINA 2DIKA 3WG6A 1OB0A 3U7BA 1RUSA 2KZHA 1IE7C 1F4HA 1BXBA 2EF9A 3WF3A 3C52A 1F6KA 4MKSA 3MI2A 3AMDA 3K8LA 1VH7A 2YXOA 4TVDA 4PRWA 2G96A 4LF1A 3TUUA 4GH3A 2PDUA 1NF7A 4C6LA 1ITXA 3CAKA 1EWEA 4LFYA 3RO8A 2X1UA 3H2MA 5IOBA 1U5JA 3AC0A 1V3IA 2NWSA 4MJZA 3VD5A 4K7VA 1RVKA 1U5VA 3CQHA 1YDVA 2NW0A 4MJ4A 3EMCA 2ZXBA 4MADA 3W1UA 1XUUA 3AUJA 2PDYA 2GQAA 4H4XA 2WJFA 4M81A 1UWIA 2ZDRA 2DT1A 1ZU8A 3P8IA 1E9IA 2QF7A 1WOAA 2WOWA 2BLEA 3HQNA 3NO1A 1TWDA 3OQEA 3OGSA 1VD6A 4DJDA 1XD0A 4O1AA 3PFMA 4K68A 4TTGA 1W5NA 1GW1A 4JD4A 1K03A 1UKPA 1LBMA 1WDRA 1UQZA 1MZRA 1IT7A 4JTUA 3LTSA 4GY7A 3M6YA 5FF4A 4JTAA 3RK8A 1W8GA 3AHVA 4M24A 1QTWA 4BK9A 2BVTA 5JRBA 2QUNA 2AL2A 4J40A 2NUXA 3T1GA 1AJZA 1LL4A 4RLIA 3LQGA 3T05A 1DQUA 2HVMA 3E0LA 1OQFA 3UWYA 1R2TA 1DE6A 1YKWA 1GPWA 3VKAA 3GK0A 5BNKA 4EAYA 4JGDA 3G1XA 1GONA 1EJ7L 2I14A 3IUIA 4UMCA 1OIFA 4BF9A 4LWWA 4NZCA 4U5IA 1SQ7A 4GI6A 3W7RA 4LA1A 4PL1A 1PSCA 2QUMA 4GC4A 2J7GA 4N9BA 1WP6A 2V3DA 3GQYA 1XIFA 2FTYA 3VIHA 3W75A 2Q3RA 3WLMA 3PZMA 1XIEA 1XIGA 4FPSA 4H9YA 3WD3A 1O68A 5AC6A 3BJTA 4O4WA 4IUGA 1YHTA 3XISA 4Z2IA 3W02A 3HA1A 1P6BA 4AIUA 1GREA 5EBUA 3I6RA 2UY2A 1OZQA 2NVCA 4PRTA 4Y9PA 2YAUA 3M0HA 3KLKA 2I9EA 3LI1A 4J2PA 2CC0A 1RBOB 4B5NA 4H1ZA 3APTA 3WLOA 3GVVA 3WLKX 2VGFA 1UBSA 4QCFA 2UWFA 1FHVA 1DWHM 1E6RA 4ROPA 1ICPA 2FZ8A 5BOFA 1NEYA 3BWWA 3H2EA 2QJIA 3CC1A 1J0IA 2A79A 5HJYA 1R2SA 4Q4QA 4O4VA 3KTCA 4IWWA 2WOQA 4F0MA 1DIDA 4CN4A 5F4XA 3UPBA 7TAAA 4D6IA 3APGA 1HFBA 2OGJA 2J7CA 2JK2A 5AKQA 3TP4A 3VD3A 1FCQA 4V2XA 2E6AA 1Q6OA 3ANVA 2C19A 3PZNA 4PEKA 3L4WA 3WLSA 1XDIA 2FH8A 4NU7A 2C79A 2VC5A 4Q6XA 1IXOA 2GPTA 2AQVA 5LNUA 5FOOA 5DT5A 4JIEA 2INEA 1OIMA 3EUB3 4FNRA 3AIBA 3UZJA 1JCXA 4AZHA 4LGXA 3IGUA 3IGXA 4KRZA 2V3AA 2VC9A 2J7FA 2CLMA 4WKHA 1X97A 4BJHA 2IQDA 4D6GA 1EZ2A 2BV9A 7TIMA 4PULA 4DF0A 4O28A 4L4PA 2UY4A 2VZTA 4ZODA 1YPXA 2VOTA 5FA5A 4QAIA 2PDLA 4H8VA 4OUIA 1GYLA 2HK1A 3STGA 2AQWA 3B0YA 3B3DA 3VUPA 1FIQB 3CV2A 3NJ3A 5ECUA 4AC7C 2JFEX 2C6QA 3L4XA 2X7VA 1FEAA 2WC7A 1E9ZB 5F2MA 2D24A 2CFFA 4JIQA 1KM5A 4GRSA 4IFKA 1UD2A 3ARVA 5H91A 3USBA 3BAKA 2YCLA 5FIPA 1TA3B 3W00A 3AXHA 4QRNA 3GRTA 1AODA 3LLFA 1FWEC 2WLYA 5KITA 1G01A 3KTXA 1YE6A 4WR3A 5HINA 3TQKA 1X6NA 4NJKA 4EP8C 3D47A 1DYSA 5FS7A 1FRBA 2GQ9A 2DSKA 3PPGA 1N61C 4RXGA 1ML1A 5DFAA 1D3CA 2J25A 2NV2A 4NSBA 1W1YA 3H6OA 1JZ3A 4CQAA 3SO7A 4EPBC 2YDAA 3CLWA 3BLDA 3CL7A 3H7RA 4WX2A 3SECA 3FAXA 1I2RA 1XYCA 1F7BA 3AMZA 4J7RA 1O6IA 3G8RA 5U7SA 4FOKA 4F9JA 4FNSA 4M6PA 4E2DA 3UJSA 2YDRA 1UZDA 3W7QA 4K39A 3WEMA 1O5QA 4CQ9A 1YPFA 3W27A 2A2IA 1B9ZA 5H2ZA 3MYOA 4DBUA 4KCUA 3BZJA 4N6FA 1DPMA 3K2GA 4IQJA 4R33A 4XTIA 2QDDA 3T0CA 3LB8A 3IGSA 5FL1A 5H1WA 3OLGA 3G24A 1BRLB 3B0XA 2YA1A 2WMIB 1EFZA 3S2MA 4WSKA 4QISA 3AWOA 1IXPA 1XS2A 3UZZA 1I0DA 1CYGA 2VR2A 3SQLA 1JDCA 1LG1A 1WZAA 4M7TA 3PZVA 2VEMA 4ZB2A 3SR7A 3MI6A 2G0WA 3WO8A 2G3FA 1OJTA 1SMDA 4C6FA 4UTLA 4W5ZA 2Z4GA 4M19A 3RPTA 3L21A 1FFRA 2BB0A 3R4IA 1HKVA 4DWSD 1L2UA 1X8FA 3MO7A 4IGMA 1BQCA 3CUZA 3CQ0A 1LOSA 2GGEA 5J8LA 3TQVA 5HJXA 4HP5A 3CIVA 2YA2A 5L6UA 1YDOA 4YYCA 1W1TA 2IMRA 5BU9A 1TV3A 3M0IA 3BSHA 3U2EA 3T4CA 2YVJA 2X40A 4YU1A 5C70A 4AZCB 4WJEA 4TU1A 1EGMA 2OGYA 1TPVA 2OJPA 2YZ5A 4LC6A 3C5QA 4XAZA 2G3MA 2D23A 4KEUA 3PZTA 4AZ6A 2TAAA 2DZBA 4FIQA 1P0NA 3CAWA 1GVQA 4H8UA 5F2GA 1MRAA 1KRAC 3T09A 4ADWA 3HBLA 2V5DA 2GVGA 2P88A 3QJAA 5EL1A 2OSYA 4ZMGA 1NOFA 2VUYA 1S1PA 2YCKX 3OBAA 2DEPA 3EBVA 1DJNA 1S3TC 3TTOA 1GYNA 3W85A 2E3TA 3OLDA 3QR3A 3L66A 5HPCA 3T0TA 1MYRA 3B9OA 1FXPA 1S2AA 2ZRXA 1WOBA 3RLHA 1H41A 2Z00A 1W54A 1QNQA 3AIEA 2CERA 4KFPA 3KUMA 1MRQA 1WV2A 2I5IA 3WKZA 4IX0A 2YCIX 3V5FA 3U0HA 3BW3A 4DJEA 1AG1O 4HZMA 1FWJC 4RL3A 1PYFA 3U57A 3EDEA 6REQA 3LGDA 1VBUA 2CZ5A 3G3DA 2QJJA 4E2BA 2J9XA 3VGEA 1H5YA 2NLYA 3Q6JA 7REQA 3MO4A 2JIEA 1WKYA 2CIPA 3RU6A 1W5QA 5CSSA 2Y61A 2QJHA 3CL8A 3LNPA 5K9CA 3SUUA 1A5LC 3WDIA 3A6OA 1PZ0A 3T8QA 1PV8A 1LP6A 1X6UA 5JCNA 3ENLA 2TRSA 1F3EA 2HCVA 1RSCA 1JOAA 4PUKA 1N5WC 1R3TA 1ISXA 4O11A 3KDNA 3JZEA 3ES8A 1KFBA 2VRJA 4URIA 3RF9A 1BEUA 1I45A 5AC4A 1JUBA 3ZSSA 3GDLA 2GYIA 3GY1A 4W9TA 4HA1A 1G4SA 4YNGA 9RUBA 1UR1A 1VB9A 4FLQA 4QDPA 4B9ZA 3MZNA 1PTAA 3CXOA 1J8VA 3SW6A 3STFA 3OBEA 2J66A 1WKEA 1KBLA 1ICSA 2R14A 3URQA 1GOMA 2ZUMA 2WMJA 4BQ4A 3EB3A 2XIBA 2FHBA 1GRGA 1YDYA 4X22A 4U10A 1FTXA 4GY0A 1EX1A 4X61A 4EM4A 3JUGA 3NZRA 4DJFC 1Z7AA 3NYZA 1S2VA 3WNLA 4AYSA 2EQ7A 4LNCA 2ZWZA 4QE1A 1TG7A 3ZWSA 3OW1A 3BV4A 3WMLA 3OOQA 1BKSA 3C3NA 2W27A 3LA4A 1MXDA 4IG2B 2BC1A 4OHQA 3UESA 4GBUA 2GVYA 1SJDA 2HXUA 3LOTA 4AHQA 4ERAA 3KW3A 1NH6A 2WK2A 3W28A 2TPSA 3A3HA 3M5XA 1KBIA 2WC4A 3WF1A 3WMCA 5A6KA 1XGEA 5JIPA 2A7RA 3NQCA 4AD2A 3WQ6A 4AZCA 5GNXA 4DX3A 2QIWA 3C56A 4DF2A 4N4QA 4BI6A 5IRPA 3HPZA 1V4YA 3PTMA 4YTQA 3C2VA 2WJZA 7PTDA 4X0VA 5E70A 1RD6A 1HUVA 2G8ZA 4CQ8A 1JNEA 4ORIA 5HWJA 3QLLA 1JCTA 4AD3A 5GJMA 2VENA 3W82A 4R9OA 1YEYA 3WH8A 1NJJA 4RPQA 5AYIA 3VGDA 1KN0A 1FA2A 4ERGA 3REQB 3HV8A 5D9MA 2PCQA 1TTJA 4GMEA 5F2LA 4DJFA 3GTHA 1O5XA 1US0A 4RR4A 2GQ8A 2IPJA 4JICA 3FYOA 4XKMA 2QR6A 1W56A 1K1DA 1FWIC 2XH0A 3VDBA 3SCPA 1KFEA 4GIAA 1CZ1A 2WNNA 4R7OA 1LRQA 2WZIA 3KRUA 2EEXA 3C2EA 3PG8A 4S3BA 3FA4A 5DCBA 5DO8A 4N4PA 3LXBA 5EY5A 2QVHA 3MBDA 1KBBA 4O12A 2YBVA 2G4FA 1E3XA 3TJXA 1K4HA 4O18A 5DMLA 1UH4A 1TWSA 1PDZA 1H7OA 1HXJA 3E96A 3PBVA 1TPB1 1B0IA 3UGVA 3ARUA 3HGJA 2EPOA 3PBYA 2CBIA 1FWAC 2YXGA 1Q2SA 3H2CA 2QF8A 2GUUA 4I7UA 2QV5A 4B5WA 4DXXA 1FWNA 3KZSA 4LOCA 3WDQA 2WKGA 5C2CA 1XLGA 3GAYA 4IPNB 2G5WA 1UOZA 1BYDA 4XZNX 4Q7NA 2NT0A 1F6YA 4H8HA 4J3UA 5TF0A 1M3UA 4V1YA 1GQIA 3NQ6A 4IXXA 1CXEA 4LW7A 3KP1A 2X1IA 2HTMA 5AN7A 5C55A 1HJWA 1H5VA 3CJPA 3WQPA 1CNVA 3C0QA 1HL9A 5K7JA 4RE0A 4UFMA 4Y9OA 4C7DA 4LS1A 1F3TA 3QXBA 1EP1A 4JHMA 5DBTA 2CNCA 4X9SA 3W26A 2WZEA 3U2ZA 4WDXA 3CZGA 1R38A 1VQTA 1XLFA 3KWXA 2BY2A 2WOIA 4GNJA 1KWKA 3VM5A 2YJQA 3KCLA 4NI8A 2CLHA 3S5SA 4CCCA 5EBKA 3BLPX 3GR7A 4H8NA 3W83A 1I9CB 3BAXA 4BS0A 4PUDA 4NYUA 3P3BA 1XD1A 3OVPA 2Y89A 1BSIA 1GVOA 3NNTA 4C1NA 4D72A 1OY0A 4WKFA 4J3ZA 5HWMA 1WDDA 2QCGA 1AQ0A 4IFOA 2QIIA 4JNYA 4RNHA 4A3RA 2J7BA 4RV3A 5CZ0A 4AD1A 3M43A 1HNYA 5HQEA 3UETA 4Z2LA 2J9ZA 4GX9A 1FECA 1RD5A 3IJDA 4FOUA 5D09A 4J2MA 3CQKA 5G1YA 4A3QA 3SB0A 4UNKA 1GETA 5LHFA 3GW0A 4C6QA 4PMQA 1XLDA 4ZE4A 4UTHA 1TWWA 2QQ6A 5BW6A 3WJXA 1C92A 4HIBA 1Z9AA 1IZCA 1ONEA 3HG2A 3HFTA 2XSAA 2ZZ1A 2X42A 3HGRA 2A3CA 2QXWA 4L9YA 4DLFA 1ZTVA 3BAWA 2POTA 2QJNA 1ITCA 3DG7A 3POCA 5CBBA 1U5HA 4QJ3B 3EAOA 1PO9A 3PR2A 1VYSX 2J9YA 1QI2A 3ZWTA 5I00A 1HP4A 3LY0A 4PUMA 3W24A 1XLBA 2YX0A 1YW1A 2H9AA 4FXRA 3GDTA 4V15A 2V5KA 5D2XA 2VD8A 4F4RA 3FEQA 1TTQA 4REQA 1W17A 1VBRA 3GTXA 5CLTA 3TC7A 3V35A 3UVIA 1JQVA 2ZICA 3TYCA 2CYGA 1V0MA 2VT0A 3HPAA 4F2TA 1W9UA 1TTPA 1H0IA 4QEHA 5C9XA 4CNTA 3THUA 1IEXA 3PUOA 3QR0A 4MWAE 2HE5A 4HNUA 3STEA 2I5GA 4O53A 2GGHA 1QXLA 2OXNA 1FWGC 1T41A 3AIVA 4LY4A 1T40A 1V93A 3DFYA 3UWZA 4OTKA 1QBAA 5FSDC 1UR3M 3BW4A 3OB8A 4H9MA 2OLSA 2OQHA 1QRQA 2W67A 4JNMA 2WSQA 4BURA 3FY1A 3IIXA 4K1WA 1V02A 4FNPA 3O0HA 2J79A 1IF2A 1NELA 1FWBC 1A5SA 3R8HA 3ITXA 3CMGA 4QFUA 1BF6A 4FSAA 3QKEA 1XUZA 1W9DM 8TIMA 3TR9A 2PDNA 5M03A 3A47A 1QK2A 4DUOA 4NJJA 3RPDA 2ZX7A 4JTJA 4DBDA 1M03A 1Q6RA 1GQJA 1EWDA 4IIBA 4GZJA 3PWGA 3S0CA 5D32A 2AAQA 3UR5A 4S3GA 1J0ZA 3STPA 1WUFA 3SCRA 3VILA 3N1AA 3OBKA 4TOQA 2HMCA 2BHUA 2JIWA 2E40A 1KR0A 5CPQA 5D9OA 2XH4A 2V81A 2UZ9A 4MOZA 5ER0A 3L12A 4M5PA 5AYYA 2DFAA 2X05A 1JCJA 4UTKA 3UCCA 3TR2A 3G22A 2FDSA 3AMLA 2WANA 3FFSA 4MYAA 1I60A 1XX1A 1V5XA 4S3FA 1ZMCA 2CBJA 4YWIA 4MY8A 5G2IA 2GGJA 1QI3A 2Y4SA 1RJPA 4HOWA 3VGBA 1CXHA 2GK1A 3EXSA 2GOUA 3LQLA 3P0WA 4WXZA 3UU0A 3B97A 4R7JA 1J0HA 3O06A 3VKCA 2X1SA 1I8JA 2JQXA 5D2TA 1X1NA 5CZKA 5FKYA 5LNSA 2XSXA 5ABHA 1OYCA 3VNYA 3GC5A 3BZGA 1OFOA 2DIEA 2XN2A 4D6HA 3GDBA 6XIMA 3EX6A 1OD8A 5T91A 1H7WA 3MSDA 4CD4A 4OQVA 5MKGB 3M44A 5HBFA 5AVHA 4J3TA 4WDUA 5CGQA 3MUCA 3HB9A 1QDSA 3B04A 4JX4A 3TYZA 4PB5A 1C91A 3AIUA 1QW7A 4PTNA 3MSRA 1XLCA 3W3OA 4C6CA 3PAJA 4A3YA 1J5TA 2R8WA 2D20A 1RJRA 2ZFAA 1TSIA 4OVXA 3NAVA 4B9YA 3ARYA 1YYAA 4YWOA 1VGAA 4RJEA 1R7OA 4K36A 1I1XA 1RM6B 1DIKA 2GDQA 3GX9A 3T2QA 4IIGA 5EGRA 4U3CA 4NNBA 3PPHA 3U2CA 3KOXA 3HOJA 4DWSA 3ANYA 4HMCA 4A8RA 2X8CA 3ITOA 3TROA 4O1BA 3AZTA 3CQJA 4GVFA 4DELA 5CH9A 3O7UA 4XBJA 3GXDA 3WUFA 1NWRA 2HK0A 2WAGA 1BVZA 2VYOA 1KNWA 3T4WA 1JDEA 4S3CA 4KGLA 4MJMA 4DEFA 2PZNA 1W1VA 3HGSA 3DERA 4Y9MA 5A3HA 2Y5JA 3VABA 4B4FA 1A3HA 4GQ0A 3DYPA 1W3KA 4OOUA 3LPFA 3WNMA 3IJ7A 3W1LA 1VHCA 1KV8A 5HNNA 4FP1A 1LZOA 2A0NA 4HHLA 3N2TA 5I2UA 1E0UA 2VXNA 2ALRA 1Q7QA 2X8HA 1VBGA 2W0UA 4GI4A 5A2CA 2QCCA 2EPNA 3CUIA 1JAKA 1ELSA 3QV9A 4LNYA 2Y8KA 4AW7A 2FPYA 4C6MA 4AWTA 3QPZA 3KFTA 4MAZA 3B9DA 4A22A 1JXJA 2YB1A 2REQA 3LMYA 3DU0A 3NYDA 1JG9A 2EQ9A 1K3UA 4GQQA 3W81A 5C2GA 1UW9A 3CIXA 3TTQA 3CGTA 2V3EA 2VURA 3PFRA 5HOSA 4YCPA 3VD4A 3NQEA 4JQ3A 1RY0A 3FA5A 3HPFA 1GORA 4V1XA 1IXQA 3LB0A 1GVFA 1J10A 1VF8A 1LF1A 4PODA 4E5TA 1F74A 4QITA 5ABFA 1FHDA 4C7GA 3ANUA 3FG2P 2P3EA 4JTQA 4FXJA 2WV8A 2RUSA 3S46A 3VCCA 3ZJ7A 4ZL1A 4W7WA 2YBTA 5EFFA 3F4NA 3H2NA 1OGBA 3NO5A 4EQSA 5KZEA 3A4JA 3NQ7A 4LSBA 2XGIA 3D9XA 4HK7A 3UWQA 1C8QA 3B0UX 3MWAA 2OYKA 4H4VA 2YL6A 2D73A 1KKOA 5KVIA 1D3GA 2DU2A 4MWAC 1L2QA 1N8WA 4MTVA 4QP0A 5AECA 1J11A 3GHUA 2J6XA 4I9MA 5CCZA 4HOZA 4WY0A 4Q8TA 2RJHA 1JNDA 2BHZA 2PWFA 4UCFA 5E0CA 3ME3A 3MMTA 2GK1B 2CLFA 1CXLA 3G1FA 4R9XA 3VC6A 1AUSL 3THQA 4FAMA 3POHA 1QHOA 4AC1X 1NY1A 3SIMA 1P48A 3CZ8A 4WOZA 2V5BA 1CGUA 1PX3A 5CSUA 3ZR6A 3OG2A 4L7ZA 3TW7A 4F2BA 2XIMA 1OX6A 4HZ8A 1SO5A 4WK9A 2A7NA 5E6YA 1EEPA 4J57A 1PWMA 2XFWA 4HHMA 1ECEA 3CNYA 3KLLA 4IIDA 5KSWA 4EF8A 3VXGA 2R1MA 1J0JA 1SR0A 2VFIA 4ZVJA 3U4FA 1YXCA 5E5CA 3GH4A 5E9XA 3ABRA 2PDCA 1FKWA 1UC4A 4DWDA 3P84A 5LIXX 1ZAHA 3UXIA 4GZIA 4QCEA 4Q8NA 4M1RA 2Z1BA 1ZNNA 4DUVA 1KXTA 4HBKA 1Q45A 1T5AA 5KTLA 1N8FA 2XISA 1OGSA 3H22A 3VD7A 1RVGA 1Q4WA 3TN3A 3U48A 1E1CA 3BQ6A 1TPFA 9XIAA 1QVBA 1RQBA 1EQPA 3CK5A 1OC5A 3U6WA 3WNPA 4ILSA 4JZ5A 4L4MA 1CIUA 2QCDA 1YADA 5FF2A 3MW7A 1Q3NA 2VRKA 4NIRA 1H6VA 3WQFA 3E0IA 1TIMA 1E0VA 2JF7A 1HKMA 2WZHA 3W7DA 3NURA 4LVBA 3IJ8A 3EXRA 2EBNA 3WNOA 1US2A 3C0JA 4F0KA 5BROA 2JKAA 3S47A 5GJPA 3NDYA 4MLJA 1A3XA 1KGXA 3IJ9A 1ESWA 2PB1A 4DZ5A 2WM0A 2D3LA 3QF0A 3AMGA 1ADOA 3Q94A 4NZJA 3S9ZA 3AJXA 1DBTA 1DJZA 1JGMA 5GRTA 1XRVA 3AO0A 4PN2A 3WY1A 4Z2HA 1WKDA 3AJ7A 3EWBX 1W3TA 1NDAA 1F3PA 4ACYA 2AGTA 1H60A 5A2BA 1CLVA 5BXSA 2IKGA 4RE3A 2Y0FA 5ABFB 3DECA 4CU6A 3DYMA 2AAAA 2EAWA 4C6PA 1JQXA 4MFEA 3MWCA 4QE5A 3UP8A 4B4HA 1D8WA 2H6RA 4H04A 4MPQA 1FY6A 1GOIA 4PMUA 3N4EA 5KINA 4G6CA 3KZPA 3PG6A 3PWAA 3VX1A 1GG0A 1FKXA 4M1BA 1E4MM 2NPXA 4B91A 4D8ZA 3B4YA 4N42A 1B3ZA 3MY9A 4JYEA 3C8NA 3NZQA 3W7LA 3BG9A 2G41A 2Y5EA 4ZO6A 1IWBA 3MJMA 4L9XA 5E9AA 3DAQA 1T6MA 1B3OA 4W93A 4K2SA 1BPLB 3DGBA 4LEFA 1E70M 3IUDA 4PCTA 1F4AA 3L2IA 2R94A 2OKOA 2WBGA 5HAOA 4FK9A 1VEPA 1ZZMA 2RDTA 3NDOA 4J5NA 1QI5A 1GHRA 3AHXA 1OFEA 3GFZA 3SSZA 1F2JA 2ZRUA 1A0EA 4ZOAA 3QY8A 1BXCA 3TOYA 5FEPA 1TJPA 3E49A 4RZ4A 2Z1VA 1GVRA 4WCJA 1FFUC 3CGDA 3S2NA 3IIZA 4FF5A 2YL8A 3LK6A 1P7TB 3UJEA 1JYWA 3EF6A 3M0VA 1CX9A 2WKLA 3ITLA 2H3BA 4Y96A 2W4XA 3G3MA 1OCBA 3SQSA 4IP4A 2C1GA 1FXQA 4HT3A 4NP7A 3SCQA 1JYVA 1RHCA 2BXYA 3LSCA 3WYZA 4MNKA 3VTRA 2JEPA 3VIIA 4LAZA 5DT7A 3CEPA 5AY7A 1HGWA 4IISA 1MFVA 1Z44A 2XVLA 4GUHA 1IR2A 1VC4A 1XH2A 2ZWYA 3GTFA 3OC4A 3MTWA 5TNVA 1K6WA 5BXRA 1XC6A 5C9RA 1OFRA 1YTEA 3ZR4A 3WQOA 3H8AA 1YQZA 1T3QC 2Y7FA 4PTVA 1TV7A 4I9TA 3AYRA 3R11A 3TXZA 3NFUA 3GRSA 4JDRA 1VRXA 3GS6A 2CLLA 4LAUA 1LT7A 1IT0A 3GH5A 4HNVA 1M7OA 1OK4A 2QMKA 2B0MA 2HV5A 2E5DA 1N2VA 3M64A 4CD8A 5FACA 4AFYA 2PDBA 2R9RA 1FUYA 1VEMA 1E0XA 3QGVA 4GKTA 3TAOA 4GPNA 4A35A 1TX0A 1HL2A 5A8GA 5CQ1A 1H1ZA 1XDMA 4C6NA 2BWGA 3DI0A 4FI4A 4PB3A 5LKYA 3TZNA 1MNZA 3HJZA 1VQZA 1C29A 5MF5A 2WP5A 4GBDA 1CBGA 2EKGA 1EJRC 3PNUA 1AW5A 1GRHA 4GIRA 2V30A 4J35A 5LGXA 2BODX 1B3YA 2PC8A 3R94A 5FF3A 5DEZA 4M3PA 4AH7A 1GPFA 3CUHA 4JHOA 3GNOA 1LL6A 1GJWA 1TR1A 3GR4A 3WH9A 4JYFA 3QZAA 3NVTA 4HPGA 1A49A 2VJXA 2NZLA 5BXPA 2ACQA 3C86A 1V79A 4YIWA 1ZGDA 2WZTA 4ZO9A 4QQUA 3OVGA 3KVLA 4QQ3A 2JF6A 3UJFA 1QWKA 1HJQA 2O92A 5T8GA 3LCGA 3RFAA 3MB9A 1JZ8A 3BLEA 4DNMA 4EK7A 4IHCA 4HOXA 4XB3A 5HNRA 5JH1A 2QPUA 3H54A 3DFNA 3V0SA 3AIQA 3CAVA 2E8YA 5IHSA 2DH2A 4JTEA 2PCEA 4DJDC 3V36A 3N14A 2PDXA 1OCQA 3Q67A 4Z0JA 3L4VA 4R34A 4P7QA 4LBRA 3VMNA 3G1RA 2D0GA 5F4WA 4KT2A 2VD9A 2EPKX 4Z1CA 5I0DA 3EPOA 4MJ2A 1JPKA 1E4LA 1KTCA 1GOXA 4JY8A 4EX4A 3UF9A 4RV8A 2GGIA 1SZNA 3NM3A 3WJWA 4E8GA 4Q8VA 3AU6A 1EJUC 1ISWA 3L0GA 3QN3A 1GG1A 5FEWA 1TV4A 3PS7A 1GOWA 4HNOA 5D03A 1GRAA 5A8MA 4IJCA 2BP1A 1XBVA 1BKHA 2C0HA 3SCTA 2WYSA 4AX6A 1EBDA 1T99A 3LLXA 1AH4A 4XSMA 2E6YA 1XYFA 3WJZA 1J0KA 3UVAA 2CEQA 4H6RA 4NHVA 4O8AA 1EJTC 1ZENA 3ABZA 4XD3A 2C3ZA 4J3SA 3CZLA 3L67A 3TW9A 3L5LA 4E8CA 3M0JA 3V5CA 1GOOA 4F48A 2ZA2A 1SFLA 5TBOA 4LB3A 3VVGA 2CPUA 4CCDA 1KM4A 3SY5A 3LCFA 3WDRA 2BVWA 2WO5A 4QM1A 4DAFA 2ZTKA 4JQ1A 4EXBA 4DBWA 4BR1A 1EC8A 4UBPC 2GJXB 4FZIA 1PIFA 1FDZA 4AX7A 3LV6A 3BAIA 4NRRA 4DRSA 2VOMA 4S3EA 1SMAA 1VJZA 4XQ6A 1KCLA 5BOEA 1CB2A 3Q45A 1YBQB 4E8DA 4YYFA 5CPLA 4H3DA 1UJQA 4L1XA 3WLLA 1E40A 4MNJA 5AC8A 6A3HA 2WBKA 3PPFA 3TSBA 4Z2GA 4PCFA 4YTUA 2QCEA 3H4WA 2FZDA 2Z1WA 1SW3A 3RO6A 2W5FA 5D30A 3F4WA 4J3VA 3W73A 3S1VA 3GVWA 1GGOA 3GR8A 4UTJA 3NOYA 3GIPA 1W37A 4JOMA 3H23A 1UWUA 5TQLA 1ZBKA 3L4UA 1FHLA 5XIAA 4WSJA 1E15A 2CZVA 1YDNA 3B0PA 5LNRA 2V8ZA 3DFQA 4MB4A 2PWVA 1VYRA 1QK0A 3EDJA 4WDTA 1ZL1A 4X63A 4W8AA 3GYEA 4NUWA 3WF4A 3EA1A 1DJHA 3WLJA 4EE9A 4NRSA 2PD5A 4M51A 1XPGA 3BDKA 1ZHAA 3A4XA 3ATZA 1WCGA 3ARQA 4FNTA 3FJLA 1IYXA 1V6WA 1HJUA 1M04A 2E4TA 3IARA 3TOPA 1MQRA 1E0TA 2GDVA 3I4EA 4D6EA 2ZTJA 2R1KA 3SCUA 1XLIA 3M0YA 3EDDA 1V3LA 3CU2A 3HQOA 3KVJA 4NZFA 4QX4A 5HQMA 3EEZA 3UD6A 5AB3A 1GTEA 4YHEA 1Q7MA 1Z3NA 3SUTA 2EG6A 4GG9A 1IWAA 2FFCA 4GGBA 3W7KA 4UTTC 4XZHA 3GU1A 1T0OA 1VBHA 3W71A 1MW1A 5I3JA 3F1QA 3KE0A 1TVPA 1Y8BA 2WNZA 3K8MA 3L4TA 3UW6A 1MEIA 2HWGA 5CSYA 3SY1A 5BRQA 4FIRA 4KQNA 3UY8A 3OJGA 3R25A 1UWSA 2DSZA 4B5XA 3K1GA 3MI3A 1EP3A 1GVIA 3LCWA 5JBFA 2ZZ5A 4DO4A 4HA3A 5PTDA 4TVWA 3CH9A 4O0QA 4GY1A 3LXDA 4WY0B 3GB6A 4G1NA 2OWCA 1MUWA 4AWEA 1LM1A 2EG8A 4HPXA 3DFSA 2BZNA 5AC7A 3VMPA 5I77A 2XFRA 1NSJA 5SWUA 5CC6A 1XFBA 1XG3A 4IMEA 2AMXA 2ZZ6A 3GVRA 1W9VA 3W07A 1GSNA 4NI3A 2GVLA 3KVMA 1M7JA 2XTKA 4LIIA 2VM8A 1XLEA 1GKPA 4Z08A 4W84A 3G18A 4BQ2A 2NWRA 4NYYA 4YCOA 1CGTA 4RE2A 2HVOA 1B5TA 4NAFA 5I03A 3EMQA 1VDVA 3AS1A 1TO3A 3IIVA 3M9YA 2ZRZA 1JYNA 3TNBA 3KS6A 1A5AA 3BJFA 2BTMA 4XZBA 1GKRA 3UWVA 2W92A 3I7QA 4IPIA 4P8UA 5I3DA 1TPDA 2D0FA 4LRTA 1OADA 2C14A 2PRMA 2R1NA 3VOHA 1XIDA 2BX7A 4AIOA 1EDTA 2HNEA 3KBSA 1U30A 3UWEA 2VGIA 2JGQA 3B03A 5T26A 3PF3A 2PDJA 2ZXDA 4JR5A 2E9MA 1EEXA 2GJNA 4RZ6A 3OO2A 5DRCA 2R82A 3FJ4A 1A5OC 1JCYA 3ALFA 3PHAA 1FX6A 1A50A 3UR2A 4ZENA 4RK8A 2ZXAA 3L0KA 4LU0A 1E55A 5LGZA 2ALDA 1EC7A 1TKKA 2B7PA 3TTSA 3NSNA 3RNDA 1X8CA 1J2WA 3QGKC 1FFVC 3OIXA 3W53A 2HROA 3BV7A 2OOFA 4NX0A 1XQLA 3VNIA 2TODA 4OBRA 8XIMA 3IRDA 4UC5A 5FS9A 3LZ5A 4FXFA 2Z2BA 2O55A 1XF0A 1K8CA 1TPC1 2XUCA 3CHVA 3TAKA 2X1TA 2BY3A 4MIMA 3GVQA 2UV8G 3KEHA 4LRSA 3DGZA 2R6OA 4XUGA 1NHSA 3P80A 4US6A 4WQ6A 2Z25A 1KR1A 3GG8A 4BEQA 2OODA 3M46A 1KFKA 4Z17A 3SRFA 4HTBA 2PGWA 1O7AA 2B7OA 3SBFA 2CLKA 4GO9A 4LV4A 4JTCA 2HISA 3H24A 1XKJA 4QXIA 3CV6A 1D7YA 1IEWA 1J96A 4G1KA 5CC5A 2ZKMX 3WBXA 4XZMX 4C1LA 1A47A 4HVXA 1HW6A 1J93A 2YFOA 4WEVX 3VDHA 4I8YA 3AISA 1Q4NX 4US5A 1AJ0A 2QUTA 1KV5A 5K3VA 1H11A 3AS2A 5E6ZA 1FVPA 3P81A 1I4NA 1K02A 3GYCA 4KWSA 3F2BA 1QCWA 3XINA 3OQ8A 3VGFA 3W2MA 2QGHA 1I6NA 5C9ZA 3ZVHA 1PCKA 3RGTA 4KERA 4EM3A 1J0YA 5G5IA 4ZZ9A 1JDAA 3OTRA 2Q01A 4PFMA 2PLJA 3QQWA 1LG2A 2FVMA 3FS2A 1V97A 3W1MA 3I7SA 5DN1A 2REQB 4HU8A 4KRTA 3KOFA 1TYPA 4L64A 3SQPA 3RMJA 1Y0EA 3O2LA 1ITUA 2ZC1A 1L0PA 2DW7A 4ZXOA 2VC6A 4N9DA 2B4GA 1AW1A 1TR9A 4IGHA 3ZS4A 4NKCA 2WBAA 1VFHA 2WHMA 2WOVA 4XAPA 4GCAA 4HMEA 4LX4A 4H7VA 4LANA 4JQ4A 2ZZCA 3MSGA 4IM4A 2AGKA 3A7UA 3HIJA 5BWAA 2ZRYA 4DZHA 1B31A 3CZJA 4LPCA 1EGZA 2YL9A 4QAWA 2Z28A 2DVUA 1IR1A 5GNYA 3DH7A 4CNPA 1JROA 4MKNA 5JVLA 3A3WA 4GJJA 1MI3A 1TELA 4GC3A 1ZFJA 4JN8A 3PK7A 1GK8A 3EOLA 1EO5A 3D3AA 3FW6A 1PZ3A 3AOFA 3GXPA 4A2RA 1M1BA 2R91A 3G1HA 2NX3A 1TE6A 1DWFM 5KMYA 3TKFA 1TVNA 1H7XA 2ZX9A 4KWUA 1JL8A 3QZEA 1GUVA 4IGNA 3VNLA 1XPYA 4DZIA 4H4QA 2G3JA 3MDWA 4L1WA 1N5XA 4QNEA 2J4GA 3DK8A 4O0KA 5D8ZA 5KZDA 3K46A 4NX5A 2VZUA 3NA8A 4OZOA 3K30A 4LF2A 2D2OA 4A8NA 3BANA 5JUVA 5LHEA 1V6YA 3W88A 3B06A 1GKQA 1JZ7A 4BFAA 3ZT5A 5AZ1A 3NGFA 5RUBA 4S2CA 4EQRA 3BMXA 3TCEA 5CPTA 3GHRA 4JXCA 1ALDA 4Q3MA 8RUCA 2BFGA 1O66A 3SDOA 2OEKA 2WPFA 4LYKA 1ZMDA 4XZIA 1L6YA 1SR9A 2V6AA 4LVFA 3QFEA 3HJEA 4AU0A 4DUXA 2W66A 1XSIA 2O9TA 3THAA 3GW3A 3L23A 4WRHA 4G7FA 3CASA 1XIHA 3S8HA 2QPXA 1CGVA 1SFTA 2A21A 1FWRA 2PWDA 2WPCA 1FH8A 1NFPA 1DORA 2E5BA 1POKA 4IL0A 3GXTA 1LJYA 5FF0A 2RH9A 1UP0A 1PWLA 3HG5A 3AAMA 1OX5A 2QDHA 3N2BA 3CO4A 4B92A 1KA9F 1XSKA 3QLDA 2NX9A 4W5UA 3W7MA 4YTSA 4RUBA 5DCEA 2RGMA 3RXZA 3LBMA 3QBUA 3WMSA 3W2JA 3T78A 1QWGA 1R9YA 1QPNA 4K3ZA 1TTIA 4JN7A 3LM7A 1Q6CA 1A0DA 2OEMA 3KAOA 3VX0A 1JPMA 3A4WA 4UR8A 1CW2A 2NXIA 2I5QA 2GZXA 1TRDA 3NVVB 4H4ZA 4KW2A 3ZJKA 4ZQOA 4KWWA 2WCSA 3LHUA 2QAEA 3BJSA 4UB9A 3E9AA 4UUIA 4DBEA 4M56A 4S3KA 4DNAA 3W2LA 3FSUA 3QV7A