4DXKA

Crystal structure of an enolase (mandelate racemase subgroup, target efi-502086) from agrobacterium tumefaciens, with a succinimide residue, na and phosphate
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
400
structure length
364
Chain Sequence
MKITKLETVRVAERTNLLWVLVHTDEGITGLGETFFGAETVETYVHEYIAPRVIGRDPLQIDLLAQDLVGYLGFRSSGAEVRGNSAFDIALWDIFGKATNQPIAQLLGGFSRREIRTYNTRADELAHSLLEDGITAMKIWPFDAAAEKTRGQYISMPDLKSALEPFEKIRKAVGDKMDIMVEFHSMWQLLPAMQIAKALTPYQTFWHEDPIKMDSLSSLTRYAAVSPAPISASETLGSRWAFRDLLETGAAGVVMLDISWCGGLSEARKIASMAEAWHLPVAPHCTGPVVLCASTHLSLNAPNALVQESVRAFKTWYRDLVTALPEVKNGMITVPPGAGLGMELHPDIEKTFTVSRRFSDAASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Mandelate racemase / muconate lactonizing enzyme family prot
publication title Crystal structure of an enolase (mandelate racemase subgroup, target EFI-502086) from Agrobacterium tumefaciens, with a succinimide residue, na and phosphate
rcsb
source organism Agrobacterium tumefaciens
total genus 125
structure length 364
sequence length 400
ec nomenclature ec 5.1.2.-:
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4dxkA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4dxkA01
2QJMA 5ENLA 2OQHA 2PS2A 3H12A 3NFUA 5BOEA 3RR1A 3Q4DA 3MUCA 4HNLA 2QJJA 1TKKA 5FJRA 3H8AA 4GYPA 4HPNA 3QKEA 1ONEA 3P0WA 2P88A 3I6EA 2GGJA 3MZNA 2PPGA 3THUA 3TQPA 2CHRA 3PK7A 1YEYA 4A3RA 3IJIA 3UXLA 3TJIA 4IHCA 3PWGA 3IJQA 4FI4A 3TJ4A 1EBHA 4IP4A 5EU9A 3UCDA 3ZLHA 3HPFA 3QN3A 1JCTA 1MRAA 3R0KA 1P43A 3VDGA 7ENLA 1EBGA 2O56A 4K2SA 3V5FA 3I6TA 3N6HA 5FJUA 2PP1A 4FP1A 2QQ6A 2PODA 1PDZA 3ES7A 2P0IA 3BOXA 3U4FA 4HCHA 3UXKA 4GGHA 1KKRA 3V4BA 3DG7A 1MDLA 2QGYA 3UJSA 2QJNA 3I4KA 3SN4A 3R11A 4MKSA 3MWCA 3NXLA 1F9CA 3FCPA 2HXUA 4ZA0A 3FVDA 3Q45A 1MNSA 3EKGA 4DX3A 4H19A 3H70A 4Z17A 4M6UA 4A6GA 2XH0A 2XSXA 3VC5A 3S5SA 3TTEA 3D46A 4IT1A 3SBFA 3TCSA 4H2HA 2OG9A 3VCCA 4KEMA 4EWJA 3B97A 3UJRA 4ZCWA 2PCEA 2PP0A 5BOFA 4E5TA 2OZ8A 2PGEA 4Z1YA 1R0MA 1JPMA 3DIPA 3QTPA 2P8CA 4JN8A 3DEQA 4KPLA 4A35A 3GY1A 2OX4A 4HCDA 1BQGA 4F4RA 3FJ4A 1BKHA 4GISA 1L8PA 3VCNA 3ZVHB 2PMQA 3KUMA 1R6WA 4YWSA 3RITA 3DG6A 2XH7A 2MNRA 3ENLA 3V3WA 4GGBA 1OEPA 3VA8A 2FYMA 3R0UA 3TWBA 3GC2A 3K1GA 4IP5A 5J04A 3RGTA 3RRAA 3OW1A 5IDZA 5FJOA 3JW7A 4DXKA 3N6JA 2FKPA 3OP2A 3JZUA 2HXTA 2OQYA 4X2PA 4DHGA 1KCZA 3MKCA 3FXGA 2MUCA 4GYPC 2DW6A 5FJPA 2GSHA 2PA6A 2RDXA 3OPSA 3ES8A 3STPA 4GIRA 4MMWA 1WUEA 4KT2A 4M0XA 5FJTA 3H7VA 3PWIA 2ZC8A 3N4EA 3DGBA 3GD6A 1SJCA 3T6CA 3CT2A 1SJAA 3RO6A 2PTYA 1MDRA 2HZGA 4E6MA 2P8BA 1KKOA 2GL5A 1MUCA 1FHUA 3BJSA 2AKZA 3R25A 3NZGA 2QVHA 1TZZA 2GGHA 1EC9A 3D47A 4J3ZA 3FV9A 3DERA 4HCLA 1XS2A 2OO6A 3S47A 3PFRA 3FYYA 4G7FA 2PTWA 3UCCA 3UJFA 4JHMA 2DW7A 4DN1A 2OFJA 2OVLA 3MQTA 1WUFA 4K1WA 3T4WA 3NO1A 2PU1A 3OZMA 2PSNA 1DTNA 1ECQA 1JPDX 3V5CA 2OPJA 3IJLA 2PU0A 3UJ2A 2OZTA 3JVAA 4KWSA 1XPYA 4GMEA 1JDFA 2AL2B 4IL0A 3CXOA 1IYXA 3DESA 1SJBA 2OLAA 3P93A 2AKMA 3IK4A 3ZLGA 4H83A 3SJNA 3DG3A 3OZYA 1NU5A 2PTXA 2AL2A 1PDYA 1EC7A 1P48A 3DFHA 2XH4A 4K8GA 3UGVA 1ELSA 3TWAA 3ZVHA 3N4FA 1RVKA 3QLDA 4IZGA 3R10A 4H1ZA 3DDMA 3T9PA 4HNCA 2OZ3A 2QDEA 3DFYA 1NELA 4E8GA 3T8QA 4ENLA 2P3ZA 3CB3A 2ZADA 2PTZA 3MSYA 3SSZA 3SN0A 4HN8A 3GO2A 3OTRA 4G8TA 3UJEA 3SN1A 1FHVA 2POZA 2OKTA 1TE6A 4ROPA 6ENLA 2XGZA 4J1OA 3ZVIA 4JN7A 2XH2A 4MGGA 3QPEA 1KD0A 2GGIA 4HYRA 3CAWA 3MY9A 3TOYA 1E9IA 4GFIA 2I5QA 3P3BA 3RCYA 2QDDA 4DWDA 2GGGA 2AL1A 2GGEA 3EEZA 2HNEA 3ZLFA 4IL2A 2NQLA 2PGWA 3CK5A 4E4UA 2PP3A 4DYEA 3BSMA 3VC6A 3SQSA 3CYJA 1W6TA 1EC8A 2GDQA 3VFCA 4E4FA 1SJDA 2ONEA 3TW9A 3R1ZA 3U9IA
chains in the Genus database with same CATH superfamily
3RYSA 5EGRA 3N3MA 4E0CA 2DORA 5T8GA 2Z6JA 4LF1A 1AZ1A 4CNUA 2ISVA 3FJ6A 4NJHA 5U25A 3BC9A 3KVKA 1UWTA 4QDWA 1T99A 4R3UA 2YJQA 1AH3A 2BOFX 3U2EA 4HNUA 1WDQA 2OXNA 3DFSA 2Y2WA 1JD9A 1OINA 1WXJA 2GGJA 3LYEA 1HL2A 4WXYA 1FWSA 3H2AA 1BKSA 2CHRA 1STZA 4GWEA 5LKYA 3RCNA 3K4AA 4FO4A 4F0SA 3P8IA 4ZB0A 3TJIA 4QJ5B 1OF8A 2NT1A 4AZCB 1NHPA 2DVXA 2YCEA 4GE8A 3A7RA 3SGGA 4I9JA 3NSXA 3N2MA 1M7XA 3MUIA 5EU9A 3CJPA 3ZLHA 3EANA 3DI0A 1ONWA 4ZQMA 3W37A 3EDJA 3GK0A 3PWAA 2WMGA 4P7RA 3VDGA 4W7UA 4D8ZA 3VDBA 1ZS2A 2GLKA 4GZJA 1TV2A 3GVWA 5XIMA 2V81A 4AF0A 7PTDA 1VZWA 3WH5A 2P3EA 1JL8A 2WPFA 2XN2A 2Y70A 3S6OA 3MWAA 4GGHA 4K39A 3MKKA 1MEWA 3MI6A 4E8DA 2YLLA 2V2HA 4MWAC 3H2OA 4ERIA 4MM1A 4FNSA 3QMRA 3Q67A 3SGZA 1XQKA 3RPTA 3H2MA 1CLKA 1QI2A 4JQ2A 4WDXA 1RK6A 2Q8LA 3IJ7A 1JZ2A 3L0KA 4Z17A 1KBIA 4LY4A 3ERPA 1TVNA 4AB4A 3V75A 1TE1A 1QU4A 3POCA 1R9XA 4FXFA 3L67A 4A29A 5GNXA 4Z42C 4JIIX 4KEVA 5REQB 1OYCA 3AISA 5U7SA 4P61A 1FHLA 5A6SA 4Z2IA 1WPCA 1E73M 1N60C 1R0MA 1PVNA 2YVJA 1WZLA 3TA6A 3GR4A 2TMDA 3CGDA 3W7RA 1WYGA 1RQEA 1R3YA 1UZ1A 1JQVA 3CGBA 1JEZA 3AAMA 4L1XA 4GO9A 3W7LA 4C7GA 1GPFA 4F0KA 1Q13A 1VCFA 4CU8A 3O0FA 3ZJ6A 4CD7A 4DNHA 1I9CB 1S1PA 1Q6FA 2ZX6A 1J0HA 4BHYA 2MNRA 5DCDA 5DMMA 4B91A 2Y7EA 3BXWA 3WX7A 4C6QA 3UNTA 5M5DA 1GESA 1C93A 4NZ3A 3GDMA 1TWIA 1UR8A 3TC7A 4XD4A 1OK4A 4PMDA 4O1CA 2PDPA 4ZB5A 3ZS4A 4H4TA 2G4JA 5FS8A 1RSCA 4JTQA 4XD6A 4H9VA 3OBEA 5AHMA 5DO8A 3NGJA 3L2IA 4MKVA 4OOZA 2VFFA 2VZVA 4W8LA 4WRHA 2GSHA 1AW1A 1KO0A 2EJ1A 2PA6A 3AIEA 3CGTA 4WEVX 4F0RA 3NVDA 2AOSA 4M0XA 2DSKA 2ESCA 2ZC8A 2O9TA 4HN4A 2I5IA 2ZYFA 2XSBA 5KZDA 3GD6A 7A3HA 1AQ0A 3E0IA 2W55A 4FS9A 1MQRA 4BURA 3W02A 1KBBA 3IUIA 4LXFA 1ZX9A 3BSHA 1EJ7L 5C9ZA 1MUCA 3UA4A 2OO0A 3AALA 4RXFA 4B4HA 3WK0A 2ADAA 4MYXA 5AVNA 4UC5A 2QPUA 3FKRA 3H4GA 4GVIA 2WOQA 4LX4A 4J3ZA 4D6GA 3DN5A 1NF7A 4GIYA 1ZJAA 3CIXA 4DRSA 5A8PA 2J78A 1PO9A 3BO9A 1T0OA 5BRPA 1EIXA 5A1AA 4GACA 1TYPA 4M52A 2BOEX 2OT1A 3G3DA 4KF1A 2PU1A 3LM3A 1QNQA 3W2UA 4UMAA 2Z0IA 4TTGA 3WQOA 3EUB3 3UD6A 2X7WA 1XW8A 4QNEA 2CZEA 4Q33A 3IIZA 1D2KA 4FPSA 3MCNA 3VE7A 1FFUC 1GRFA 2BV9A 1ENUA 4BWLA 1YNQA 2W3ZA 5A6BA 4PCTA 3QQWA 4LYQA 3IIOA 3NDOA 4XB3A 2PTDA 2X0SA 1L6YA 3QW3A 1Q66A 4HMDA 1R7OA 5ABTA 1EEXA 1OF6A 4FZIA 3RPMA 3TWAA 3VMNA 3WQVA 4CD6A 3UPMA 3M0VA 3GHSA 3S6DA 3AXKA 3MYOA 4C6OA 1XC6A 3SFKA 3V1HA 3CC1A 3BAYA 5CKSA 1B2YA 2HBXA 7TIMA 2WQPA 1A0EA 4O17A 2O7QA 2Y8UA 5F2MA 3W84A 3VGGA 1FCQA 1MRQA 3OHMB 1TJ1A 4Y7EA 4AG0A 3EA2A 3O0KA 5C70A 4JDYA 2IKHA 3S4TA 4J1OA 1OC6A 3FXYA 2PDUA 1JZ4A 3WBAA 5BOOA 4EF9A 4JN7A 2CYGA 3LCIA 3VDAA 1K70A 5A6JA 3GYEA 2OCZA 1Q6DA 1KGUA 5CSYA 3UWWA 3WG6A 4W93A 4JICA 1M68A 2IUZA 1EPVA 1FWGC 3W7HA 3LG3A 3MY9A 2W27A 1NFBA 3F03K 5FF0A 2RFGA 1Q6QA 3GTNA 1EXPA 4D2JA 1GW1A 4PTWA 4H7CA 3S5ZA 1I8JA 3PJTA 3GLCA 3QEZA 2I57A 4BQ5A 5J5DA 4CN1A 4DUOA 1VRXA 4ZSUA 1GQJA 2ACQA 2XVPA 2J9XA 1LVLA 1NWRA 3UF9A 1EDGA 3EKLA 3DUGA 4XX6A 2QCGA 2ISWA 1XGZA 1NDZA 2Q01A 1NDVA 2CLEA 8TIMA 4L9XA 1FFVC 2RABA 4J3XA 3S42A 4ZE4A 4QE4A 4K38A 1TKKA 5KTLA 1EA0A 2PWGA 4GYPA 1EUNA 1TZ9A 3TLQA 1XD0A 4GFSA 3TC6A 5M17A 5F1VA 4ZO9A 3MZNA 2X1IA 5HOSA 1UB3A 4KH2A 5CZJA 2D3LA 1OGSA 3FX4A 4JQ4A 1E1CA 4NJKA 5T26A 5BWAA 2BX7A 2VWSA 4MG4A 5HDRA 2JK2A 2WNWA 3W7NA 4V33A 5ER0A 3TU9A 1MW2A 2WCGA 4IIDA 3N6QA 5LXEA 3L8KA 4OT7A 3MW7A 3FAXA 4IM4A 1QNOA 3APTA 3TSDA 4IFKB 3EA1A 2PDQA 2HVOA 3GDBA 4F2UA 1NOUA 2WMJA 1VC4A 3WK3A 4F0LA 3B8WA 3PUDA 1H1NA 2J79A 1KBLA 3IJ8A 2OQLA 2YCJA 2EPNA 1VH7A 2QGYA 1JRBA 1ZTVA 4DF1A 4JYFA 1VYSX 4YMZA 1OGBA 1A5AA 3P2VA 1YTKA 3STFA 3OLDA 2DZBA 2OMAA 1KN0A 1TV8A 4ASTA 1VBUA 1TV4A 5EL1A 2J27A 1JPIA 1TUFA 3AIUA 2WZHA 3A23A 3QMSA 4C5ZA 3EB4A 1D7KA 4XISA 1AOGA 2HROA 5LA2A 4BI7A 1BGAA 1O5QA 1OYBA 1A5OC 3CUZA 1LL6A 3ARYA 1R3QA 1X7FA 4E5TA 3M5ZA 7REQB 2QDGA 4W7WA 3WQ4A 4B92A 4ZFCA 3C0JA 3QPZA 1Q8AA 1EJXC 5LNRA 3URAA 2P8CA 2XUCA 2VT0A 5CGMA 4OV4A 4JN8A 1XUUA 3G0UA 4REQB 1I6NA 1T5AA 1UOKA 4L4OA 4PODA 9XIAA 1VHNA 5HPOA 4Q6JA 4PTNA 1K9TA 1OBAA 1QOPA 2ZBTA 2ZUVA 4D71A 2BFGA 2IXUA 5FI8A 1CCWB 1UR2A 3TH6A 1K8CA 1LWHA 1FDYA 2E9BA 1ICPA 4LF2A 3LTYA 1F3WA 2W0HA 3AMZA 2Y7FA 3DHDA 3FY1A 5DY3A 3AHTA 3CZ8A 4D1IA 3IK2A 1HKKA 1P0EA 4G7EA 1EQCA 1ZFJA 1V6WA 3W1AA 4AD5A 1AQFA 4KBXA 1CXLA 3DGZA 1GOXA 3SUSA 1XQLA 3VD4A 2JBMA 4NY2A 4F48A 1F7BA 4LUSB 2RDXA 2Z25A 3HBLA 2G95A 3WDRA 2G3NA 3GAYA 4JX6A 3C61A 5EBUA 3V36A 2GVYA 1ISYA 3VNZA 3BANA 4NZ1A 4UXDA 5E6ZA 5A8OA 1J0ZA 1SFLA 1CXIA 3URNA 1FCVA 2IXVA 1MW3A 2FDSA 1BGGA 2HZGA 2V5DA 1FBAA 4JTRA 3OGRA 4TOQA 1IWAA 1GQNA 1KM4A 4EXQA 1DP0A 3NQMA 4FLRA 3VXGA 3T05A 4NHVA 1R3WA 3PFRA 4QDPA 2PDBA 5T91A 3ZJ7A 8CGTA 4MWAD 1X6UA 4UFHA 3UZZA 1YBQB 3IV3A 2EAWA 4GD0A 2VEFA 2VX4A 2QCMA 3I4EA 1DWAM 1K7XA 3DC8A 4GA8A 1A5BA 4H8UA 1JGMA 1G4TA 2QGHA 4XAFA 4HQVA 3WH6A 2OKOA 1Q65A 3L4YA 3G1FA 2QCDB 2OZTA 2Z2UA 3WMCA 1EHNA 2FLIA 4BA0A 4R33A 4GQBA 2GR0A 3IC9A 4O0QA 3WSUA 4H9XA 1UYQA 2A79A 3TVAA 3CXOA 3R5EA 4DBDA 1ADSA 5F4XA 1Y5XA 4MTVA 3VUSA 3O06A 1JFHA 4C6IA 3IK4A 1LOSA 1WO2A 4PSPA 3H4KA 3R0DA 3LCLA 3TN6A 1X39A 3W07A 3KLKA 1B31A 2YYTA 5JRBA 3T2OA 4WD0A 4DWSC 3VNLA 4WUIA 3OLIA 3AHXA 2OZ3A 4LV9A 1YNYA 3B8SA 3CZKA 2P3ZA 2YFOA 1DWGM 3VYLA 2J88A 3E3HA 1FWDC 2J74A 3PPCA 4MZYA 5AHEA 4KCWA 5I09A 2XYLA 3UG8A 3DZ1A 2Q02A 2DZWA 3RAOA 1CEOA 4X3ZA 4JIQA 2FVKA 1NDYA 3M5YA 4DLFA 2PGRA 5J5RA 2DSVA 5CZKA 1SYTA 3H24A 1DBTA 2E40A 3TSBA 4U2YA 1JDEA 1KFLA 1NOWA 4LAMA 1EP3A 1OZQA 1JCMP 4FNPA 4LAZA 1XDMA 1E56A 1FKXA 4AZBA 4NYYA 2QIIA 3L4TA 3BJTA 3DGRA 4DWDA 2WWCA 3LPOA 4LVAA 1W31A 4XIAA 2J8GA 2VFHA 4E2OA 4HA1A 4ZODA 4LUTB 5FSDC 1JAKA 4WY0F 1H1YA 4H04A 4PA8A 1CB2A 5IRPA 4UTWC 3QVQA 3WLMA 2ZTKA 3Q4DA 1HG3A 4LNCA 4WHBA 4NVTA 4NJJA 1N62C 3H8AA 3M64A 1HKIA 3UFYA 3C2VA 4Y8EA 1QBBA 1W1IE 4FLOA 1XX1A 1TX2A 2XTKA 4MNKA 4CVUA 1W3KA 1W56A 1DJGA 4LEQA 2Y88A 1UMYA 3IJIA 5I23A 3U2OA 1XG3A 1J0KA 4K3ZA 3TTYA 3U2CA 1UROA 3SFWA 1N5XA 1I2OA 5T9CE 3OQ8A 4I5XA 3VDCA 1SFTA 3ARXA 5AVHA 5FS7A 3KS5A 3TONA 3M5XA 4HSHA 1TCDA 5IHSA 5HINA 5DBTA 1OHLA 1M1BA 2YDQA 1XBVA 3NDYA 3QH2A 1XPGA 4O8AA 2B31A 3V0UA 1EBGA 3T78A 3B8VA 2Y62A 4YIWA 4OUEA 2XDFA 3MV11 5PTDA 1VPXA 3FYPA 1J0YA 2IQTA 5C2CA 4NJIA 2AQOA 4KFPA 3EEGA 1YPFA 4PMRA 5EYWA 3HOJA 1G7VA 2ZA3A 1E6QM 1XLJA 2BC0A 4MAZA 3BOXA 2XN1A 1E9ZB 2GUBA 2CWNA 4XZWA 4ZVJA 3V4BA 1T8XA 1TA3A 1A49A 2D2OA 2PF8A 3HRDC 2A7PA 3I10A 4MKSA 3W86A 3BV7A 1KR0A 2BG5A 1CBGA 3ABZA 3VIJA 1PZ3A 2DZPA 3NPUA 4DX3A 4MIMA 2GVJA 4H19A 1TMLA 5BXTA 4XZLX 2QZRA 2ZUNA 2QF8A 2YSWA 3VKDA 3GVGA 3OC4A 1UW9A 2ZC1A 1HXJA 1WKEA 3TCSA 1LRTA 3CUFA 1BG9A 2XGIA 1FEAA 3PZUA 2OG9A 4BF7A 2FZ8A 4ZCWA 2PCEA 4IUGA 3ZO9A 3VGHA 3AROA 1T96A 1NY1A 4RV8A 2QHAA 1IZKA 1S3HA 5CZ0A 4PULA 2QJIA 4ZSTA 2I17A 2ANUA 3SCRA 1VLWA 1Q63A 2BVDA 3WLTA 4AYSA 1QK0A 1ZL1A 1HJSA 2I9EA 3WL1A 1KGWA 1HIZA 1X96A 2ZZCA 4APNA 1RBOB 1S5MA 2ASHA 4ACZB 4DXXA 4JTGA 2QYGA 2NLIA 4PBGA 5I3HA 4Q4MA 3AIRA 2B4GA 3KOYA 2ACSA 1B30A 5G1YA 4MY8A 1O7AA 1KBKA 4QP0A 4MWAA 3L23A 2VCCA 3LPGA 4ZZ9A 3GVRA 2W63A 4ZOHB 3PUGA 3BAWA 4LIIA 1JF5A 2MUCA 3WH8A 4FDCB 3B06A 2YPIA 1TZ7A 3KS6A 3OPSA 1GKQA 4LEFA 1HKMA 8XIAA 1A5SA 4IJBA 3HO8A 4TIMA 4C90A 1Q4NX 5DX7A 2QAFA 4IX2A 5DCEA 1VPQA 1UR1A 1WZKA 2JFEX 2GDUA 3SY5A 1Y5VA 1OABA 1TCMA 5D4YA 4I9AA 1B3XA 4PUNA 2VKZG 4DUXA 5G4HC 1VENA 3MDWA 4GVGA 4KEZA 2V3AA 4QEHA 3QZEA 1FH7A 3OVGA 1TPWA 3GZAA 1NFGA 4WSJA 4HCLA 1YQ2A 2WWDA 4EE9A 2VM8A 1LUCB 2DW7A 3MBFA 4LANA 2XFWA 1WUFA 3CUXA 5HQEA 1Q45A 2AQVA 1UH2A 4WY0A 5LGXA 1ITUA 3UPWA 1AG1O 4DUVA 4US6A 3LXCA 4KIEA 2ZX7A 3UJ2A 4D72A 2HNHA 3P67A 1TQJA 2NT0A 4CD4A 4Y9PA 2XVLA 4QE5A 2OSWA 4K7YA 2AL2B 3LN3A 5G4WA 2C6QA 2TPRA 4OWGA 2X8HA 4LU0A 3PBUA 4KCVA 1HW6A 3UWYA 3APGA 1C8QA 4KETA 4PMXA 4GXWA 4PEKA 4KS0A 3UWEA 1YTDA 5ABHA 4R9OA 2D23A 4MHBA 2HRWA 5GJMA 4JN6A 3GNXA 4Q4OA 5E5CA 3PPGA 1U1HA 2WJDA 4PTXA 1UWRA 3PBGA 4E8GA 2Z7KA 1IXPA 4O12A 4GK8A 2NV9A 1RA0A 2HQAA 3GTFA 2TPSA 4IQLA 1XDLA 4ONVA 4WXZA 2BGNE 2I56A 3F1QA 3MUZ1 2ZUWA 4CEUC 2DU2A 4JY9A 3HA1A 1YRRA 4PUDA 3M43A 4GNKB 2E1WA 3TMQA 2X2YA 3EX3A 4HK6A 3LDVA 1W0MA 4OBRA 3W7JA 4R85A 4UTJA 2R24A 1QAPA 4S3FA 1YXCA 1GOKA 2Q6ZA 2ZZ2A 1T41A 2VO5A 3W24A 1H61A 4J3VA 2GGIA 4GXMA 4QITA 3VMOA 1OADA 5IXEA 3S83A 4O1DA 4CNPA 5MF5A 4HTYA 3G8RA 4YL2A 3CAWA 4PCPA 1GKRA 3NQEA 2VFGA 4CU6A 1OCBA 3PSWA 4PUWA 1D8WA 4HHHA 2AL1A 3U57A 4B16A 2NX3A 2GGEA 1OB0A 4ZQPA 4LS1A 1MMFA 1VEMA 3WNPA 4AC7C 5A2BA 4KPRA 3U9IA 4UIOA 4XWUA 3KX6A 4EKJA 3ZSSA 2YA0A 1HKJA 2G50A 3A5FA 3NM1A 2HPMA 4UMBA 4A3QA 4E3TA 2ZE3A 1QVBA 4MDPA 5IM51 2ZICA 1B90A 3RUBL 1JZ8A 3LPPA 5G4EA 3I6EA 4DF2A 2YLAA 1V08A 1RQBA 1UBSA 1GOIA 3ITOA 3QQ1A 4QISA 1BF6A 2X09A 2PLCA 4DJFA 3BAIA 2VELA 2XWEA 3EB3A 3DCPA 1RR2A 4Y9MA 3AU2A 1S5WA 3TZFA 1GG1A 4KRUA 4HPJA 2C79A 1WZMA 4PUJA 2X8RA 1DJQA 2INEA 1FCBA 3CB8A 2POTA 1QATA 3WJZA 1S38A 1UG6A 1LQAA 3AICA 3VIPA 2RHGA 4JZ5A 1F6PA 2CITA 4BEQA 2C7FA 1CXEA 4YTQA 3QW4B 3TX9A 1T40A 3SCSA 3MI2A 2QMKA 1P0KA 1O60A 3APYA 3KOFA 3N1AA 1MXSA 3FOKA 1XF0A 2X30A 4ZE5A 1Z32X 4MB4A 4CKQA 4JYEA 3WCZA 1Q7ZA 1XISA 1LRNA 1HJWA 3T2PA 3O2LA 1ZK7A 2Y5SA 4M29A 4I9TA 1GSNA 3AMGA 4RDZA 1KQYA 3WNMA 4IFOA 1XRVA 2IPJA 2NQZA 4M80A 2REQA 3PJWA 1K4QA 1TG7A 4Q7BA 2V9DA 1E3ZA 1OY0A 3ALGA 1GJUA 4QG8A 5H8PA 4RNHA 4LW7A 3TYBA 2FZ9A 1XLAA 2ACUA 2E5CA 4M24A 2GVLA 3LNPA 2VFEA 1ZENA 1H11A 3LY0A 1TJPA 4A22A 4QBXA 8RUCA 1AQHA 1YLVA 2A6NA 2Y7DA 3B8TA 4HD5A 1QNSA 3DENA 3N9SA 3HPXA 2PDGA 5I79A 3SQLA 1K77A 4GH3A 4JPGA 4HNTA 4H4QA 4H4RA 4S3AA 2B7PA 3VOGA 4GHRA 4HCDA 1OFPA 2CLPA 3PS7A 5E6YA 2W66A 1NQKA 2ZZ3A 1EJSC 3P81A 4QS5A 4XV0A 3SECA 4Y96A 3AHVA 3H7UA 3MBDA 1KM6A 4I6VA 1I1WA 5D05A 1VJIA 4F40A 3D5HA 2JIWA 3NO5A 4QR6A 2FHFA 1GUVA 1E4IA 1QFEA 3RGTA 2WK2A 2FTYA 1Q3NA 3TFXA 2BVTA 2BDQA 3WYZA 4KQNA 3HQOA 2GQ9A 2XWDA 3M9YA 1WKYA 1EGMA 2DP3A 3V16A 4B15A 2OSYA 3LLFA 2ZQ0A 1BTCA 4I7WA 2R94A 1Z3NA 2VRQA 1IEIA 2WANA 3LCGA 2YOCA 4HP5A 1HP5A 3UXAA 3PG9A 2VD8A 3HW2A 3LLDA 2FGBA 4KWOA 1DJZA 3NA8A 3E38A 4IPPA 3OOQA 2Z1VA 4JBRA 1WP6A 1GNXA 1GZJA 4QEEA 3T08A 1EDTA 1ADDA 4M7SA 5EFFA 1GZ1A 4CN4A 5MHBA 4IMAA 2WVUA 3WF0A 5FEXA 3CUGA 2WMIA 1LTDA 2J9YA 5DN1A 1ZBWA 1EXBA 2V5LA 3FYYA 1E72M 4AY7A 5AC8A 3USBA 1XYFA 2A3BA 5DQPA 3M6DA 3UY8A 1DTNA 4DO4A 3EWDA 4W5ZA 4MLRA 2VEPA 5D02A 3C3UA 2O7SA 3P5YA 1O94A 1KWKA 2XM2A 5I07A 3GIYA 4RZBA 3IS4A 3RM9A 4NZCA 1CNVA 2TODA 3H4WA 2OLAA 3PANA 3W26A 3CO4A 4LNYA 1BVNP 2ZRVA 4I5RA 1YADA 3G22A 4HZ6A 4H83A 3QRHA 1P5BA 3SCVA 2NZLA 3GIPA 5JU6A 2R1PA 2VYOA 3K4WA 3WQ8A 4LH8A 2YGYA 3AUOA 4LB4A 4K8GA 2Z1KA 1J5SA 1GQKA 1TIMA 3QLDA 5FF7A 3D3AA 5D32A 3BW4A 1OFRA 4JTKA 1ZLPA 4LCQA 1RY8A 1M5WA 5AKQA 5DEZA 5A6AA 2VFIA 3LPFA 3UR7A 3SSZA 2ZFAA 1IE7C 3CWOX 2YA1A 2ZDSA 3OO2A 3QR0A 1E6RA 3ZYZA 1LG1A 2FZNA 3EX2A 1FHVA 4OQVA 1AMYA 2OKTA 2O9OA 1E3XA 3B0UX 1OCJA 1U2YA 2DVTA 3CUJA 4B90A 3VD7A 4W7VA 1J4EA 1X6LA 1K1DA 3WDJA 3JUGA 1HKVA 1P1MA 4Q8NA 1TTPA 3OZPA 4S3JA 1OFOA 3VK5A 2VQTA 4WGXA 4RKAA 2PDNA 4GZIA 4CCZA 1Z41A 4GI6A 1XFCA 3RX4A 2BY0A 3N11A 4AH7A 2OEJA 1TTQA 3LHUA 2QUUA 5I7GA 3BSMA 2VVSA 3TOPA 4UZUA 3CYJA 5HWNA 2CLFA 1DXLA 3P80A 3LEPA 3W7PA 4YTSA 1FDJA 1JPKA 7CGTA 4GQQA 1Q6OA 3NEVA 1EOKA 2UY4A 2RDTA 1SO4A 1J96A 4DWSA 2J24A 2NQHA 4NXKA 3U4AA 3LMZA 2QR6A 3WBXA 4BI5A 1PTDA 2ZA2A 3T81A 3W38A 5D9NA 2C19A 1E0WA 2ZOXA 1QBAA 4RNIA 4JKKA 3MCOA 3CQHA 5JIWA 1RK5A 4A8LA 3TQPA 5G5GB 5IBXC 2GVGA 3B4YA 2C71A 1S2CA 3W27A 1PBGA 4FHAA 4B5VA 2QPSA 3N04A 1VFLA 4WSKA 3PWGA 3QGVA 1QPQA 4PMUA 3C2EA 4FI4A 4K1GA 2HVNA 5JCMA 2EPMX 4R27A 3W7DA 3PP7A 1J01A 2HSAA 4NQ1A 3Q58A 4AF0B 2WYSA 1XYMA 4UUIA 4MY9A 5CAKA 3PG6A 4BCEA 1QO2A 1FVPA 3BLOA 3CL7A 1EH9A 4P2VA 2GDVA 3HPZA 3OB8A 3AS1A 3WDQA 1B4EA 6CGTA 3VAVA 4K2SA 3QFEA 1BRLA 1WAWA 2PDXA 4LTSA 3L5MA 3W85A 4F8XA 3HU7A 3LERA 3QC3A 2O9PA 3U4FA 3B0XA 2FB3A 2Z1WA 2BOGX 3AIQA 3DG7A 4R7WA 1LBFA 1MFVA 4UTWA 3ARTA 2VD9A 1LQ2A 1ODUA 1F9CA 2BP1A 4WJEA 3KRSA 2Z29A 1X8CA 3Q45A 3B4UA 1CDGA 1E9YB 3TJXA 3OA3A 3MUXA 1A47A 5HNTA 3SW6A 2YL5A 3WLRA 1JOAA 4IOTA 2QCLA 4GJJA 4NAEA 5B80A 2HDJA 5EKYA 2GYIA 2DH3A 1REQB 5D8ZA 3IRDA 2EJAA 2VHLA 4CN6A 1FWEC 1V02A 4L65A 5CCZA 3TR2A 1EB3A 4GCAA 5C7HA 3K8KA 1EJUC 4UQEA 4W87A 3PFMA 3WNNA 3FLUA 1G5AA 4RE0A 1IR1A 1GHSA 1VQTA 2C3ZA 1U5VA 3EX4A 1XLFA 1BQGA 1TWSA 4TMBA 5BNKA 1AUSL 2GR1A 3KUMA 1UD6A 1G4EA 1W2PA 1X98A 3TV8A 4DO6A 1E55A 2DT1A 2G3IA 3UXDA 2J47A 2AAAA 4J3TA 3RMEA 1UBPC 1GRTA 3EXRA 4AIBA 1EP1A 3B9EA 2FVLA 4HT3A 3VNIA 1WV2A 2NWSA 3BJFA 4MNMA 3CUIA 5JH2A 2E25A 1LL7A 1G0CA 3OU8A 4ADUA 1IT7A 3RN6A 2YL9A 3WQFA 3GDRA 1G69A 5CPLA 4O1BA 1TR9A 1GT8A 1VLIA 4UFIA 3S2LA 1V93A 1W9UA 4L61A 5CPQA 3ES8A 4QNWA 5AOUA 4LQ1A 5HWMA 2HV5A 1KW1A 4HA3A 5I3IA 1T3QC 3LCFA 4EQSA 2BXYA 2HPIA 2FMNA 4HZMA 1SZRA 4UR9A 3LCHA 1XLDA 3PULA 1XRTA 3BJSA 2DZSA 5EB8A 4JTFA 1TWWA 3PNZA 3NVZB 1CZ1A 4G6CA 2VZUA 4PTDA 2QW5A 3DERA 1U5HA 3MUAA 4C1NA 1AJ0A 5MKGB 3IAQA 5HMEA 1OFDA 1TV7A 2WVVA 3EWWA 3DK4A 4CU7A 1DIOA 1TTJA 3OZMA 2O9RA 4J3WA 1HGWA 2X1RA 4GQRA 3V5CA 2DT3A 2OPJA 3M07A 1OFQA 5AHNA 2PU0A 3TW7A 1R5YA 5AYBA 3SRDA 1WKDA 4Q4QA 3B9DA 2I9UA 3HIJA 4DBWA 4H4XA 1JDFA 2HQMA 1ZAIA 4S2CA 1PKYA 3VDHA 3C0SA 1ZGDA 2V0TA 1SJBA 1LYXA 3OODA 2R9ZA 3GFZA 4JL2A 5FJJA 3SJNA 4AX6A 2IPFA 3OZYA 1CXFA 1E4LA 4C1KA 4KESA 4RPQA 1W1YA 3QC0A 5T9BG 4HA0A 1WDPA 1ELSA 4J5NA 5EMYA 3BOFA 3GZ3A 4HHLA 2ALRA 4Z0SA 3DFTA 1ALDA 4H4VA 4WKFA 3VKBA 4PRWA 1ZKQA 2J7EA 3GDTA 3W70A 1J2WA 4EPDC 1Y7VA 1UWIA 4YHEA 3RU8X 4NRRA 3W1TA 1QJWA 1Q6GA 3TAKA 3UVIA 2BY1A 3GO2A 1D3GA 4B4FA 3PBVA 1F6YA 2DUAA 1EJVC 4DNAA 1LL4A 1H7PA 2BHUA 4MNJA 3SN1A 4NF7A 3II1A 4LGXA 1VPYA 1W91A 4Q8UA 2QV5A 2Y8VA 4XAPA 4UWMA 1EDQA 4UQDA 5LIYX 2ZCGA 2P76A 1V7YA 3SZ8A 2ISSA 2VRKA 1NEYA 4NJGA 5HJLA 3KRBA 3KLJA 1UIOA 5CQ1A 5G2WA 3PTQA 2CERA 4C6CA 5A95A 4UZSA 1BWVA 4MJZA 3HPSA 1R9YA 1NJJA 5CSUA 2DVUA 1XH1A 3PB2A 1W9DM 4X0VA 2NWRA 3WQPA 2GGGA 4ZFMA 2PDHA 1KXTA 3CQKA 4I7VA 3W4RA 3DK8A 4DNMA 3GDKA 1C92A 2PGWA 1J5TA 2VC7A 2VDIA 3M0MA 5LYRA 2VC5A 4MNLA 4ERGA 1CGVA 1GW9A 3PBWA 2QJHA 3DH9A 3C2FA 4TV5A 3NFUA 1XIBA 2RKXA 2XIBA 1X97A 4FEZA 4PMQA 4CCCA 2YL8A 3M0JA 4GG9A 2EPLX 1I75A 1QOQA 3MUCA 4PMZA 3BAJA 2BHYA 1FWCC 3NNTA 1E1CB 2CLIA 4H01A 3URQA 1TMHA 1UD3A 3P0WA 1EF2A 4IH3A 3N2CA 3EMQA 4GABA 1QHOA 1OD8A 2PPGA 2JGQA 2XZ7A 3PK7A 1ZPTA 5EBKA 1YEYA 3QGAC 3JRKA 3M6YA 2PDLA 1LLZA 1MO9A 1KCXA 4JTIA 4Y90A 4G1KA 4LC6A 2E67A 3IJQA 4K6AA 4OV9A 2QUVA 1V0KA 4IP4A 1B9ZA 5D2YA 2PGFA 2WNQA 4GBDA 4ATWA 1JCNA 1OCNA 2IKGA 2DQXA 3JS3A 4C6JA 4GPNA 2GFTA 1A5KC 2HJPA 1KWGA 3R0KA 5E1QA 4Z2HA 4O1AA 4ORIA 5I00A 4IUOA 2JKEA 1K7FA 4CD8A 4GJ1A 4R9XA 2VEKA 1GEQA 2V6OA 3ITGA 1PB0A 2G3MA 3V5FA 3VCRA 1UUMA 5BU9A 3W7GA 5AN7A 3VIMA 3PNUA 3VNYA 2G3FA 2QDHA 4HJFA 4IPLA 3NEHA 4JEJA 1GTEA 5A6KA 4GRTA 2E09A 2ZWZA 3A13A 3NDZA 3B8UA 2GH5A 1BWCA 2CZ5A 4PE8A 4FNUA 2IMRA 4FR1A 2J77A 3WLKX 4K37A 4ECLA 3WBWA 3NL3A 1F5ZA 3CPRA 3SCUA 1ADOA 3VUPA 5C9WA 3ZQ9A 1WKFA 1TJRA 5C7VA 2DUZA 3H70A 3W1PA 3RNMA 4AZGA 2W0UA 3PAOA 4M6QA 4PBEA 2WMKA 3GUWA 3H26A 3W6MA 4GY7A 5CPMA 4M51A 1GOQA 3Q6JA 1UC5A 4DJED 1LQ0A 1H63A 4POCA 1PKMA 2PRLA 1F2JA 3ITLA 1JPMA 3DIPA 4UTIA 1PUDA 3VGEA 1NOFA 1AVAA 3T0BA 4C60A 4D6EA 3NQFA 4UFMA 4O1FA 2VX5A 5M1TA 1FCUA 1QUMA 3V1PA 5AC6A 3CT7A 1N7KA 1R6WA 4KFNA 2B7NA 1E40A 5E9AA 3THDA 8A3HA 1JROA 4L1GA 3T2QA 3GHRA 5TIMA 3VA8A 4BJHA 4PCFA 1KA9F 3A47A 1R46A 1OJTA 1SSGA 5E0KA 1P7TB 5BRQA 1EBDA 1YE4A 3LXBA 1W3LA 3KL5A 5CGQA 1M7PA 3UY7A 2G5WA 3S3GA 3GD4A 4AZCA 3W22A 4ERAA 1C9WA 2NXHA 1YDOA 4GYPC 3LM7A 1VD6A 2XIMA 2EPKX 2J7CA 4F3HA 3M41A 4DELA 3R2GA 4GIRA 3UZ5A 4EMIA 3CV1A 4CEXC 4PB4A 4D8LA 3HZ3A 3OZOA 3DGBA 1SJCA 1Q5MA 4XSLA 1YPXA 2YCKX 3E2QA 1UZHA 2BGSA 3QGKC 1W2VA 2WPGA 2NUXA 1UUQA 3S2CA 1V3LA 1UR0A 1FHUA 3GDLA 2DDXA 3ZR4A 3KM8A 4IQDA 2BODX 1M04A 2PLJA 2QVHA 1EC9A 4PMYA 4FLSA 4V1XA 1ECEA 1BAGA 3B40A 1PZ1A 1XS2A 3QZAA 4QQUA 3M1ZA 5FEWA 5HUOA 2J13A 3NZPA 3VE9A 4JHMA 1LLWA 3HN3A 4DN1A 2OFJA 2R91A 3GXIA 5DXYA 3L4UA 2EKCA 2NXGA 4B3KA 5I03A 5REQA 3BOLA 5BW6A 4TV6A 2PWHA 2PD5A 5I24A 3PTMA 3GE7A 3BICA 2GOKA 4WJ8A 4IICA 4PMJA 1WYIA 5E09A 5LHFA 1H3GA 1VGAA 4JTEA 1FP9A 1UWAA 4IP7A 4C6KA 3Q94A 3H2CA 3VIOA 4CQAA 2A3LA 3IJ9A 3DG3A 4DYJA 2PTXA 2WJEA 4TX9A 1GVSA 4O15A 1AJ2A 4KIRA 3DFHA 4J57A 1IHIA 3WQ6A 3UYIA 1NSJA 5A2AA 4GY1A 4H6QA 1FIQB 4HNCA 3EA3A 2VNCA 2QDEA 1RD5A 5HXMA 1Z7AA 3K13A 1EKOA 3NL6A 3NZRA 3SQPA 1Z6KA 1E0TA 1RCXB 2IKIA 4MJMA 3AS3A 4LT9A 1QMLA 4LCRA 1RLDA 3F4CA 1M9HA 2GPTA 1XYZA 4OUIA 1NHQA 3SQMA 1P6BA 5AZ0A 3VI2A 1IIHA 1KXVA 3PC0A 4B5WA 4A8RA 2QCNA 4AD2A 2OLSA 3MVTA 1TVLA 1OGGA 5JCIA 4H6EA 5C2GA 3MHFA 3A6OA 1NWUA 4RZ4A 3HURA 2PF0A 3ZM8A 3GB6A 4KWVA 3LCWA 3VOFA 4JTLA 4UTHA 2CEQA 4DB7A 1TYGA 3EZ4A 4AW7A 3ZJKA 4I6KA 1SZGA 3UG5A 1V6TA 2G97A 2V6AA 4PSRA 2HEJA 4PC8A 3ZLFA 2XM1A 3CK5A 2WPEA 1F61A 2VDHA 1XBXA 4GUJA 1SMAA 1XSJA 2Q71A 3MVIA 1W6TA 3W23A 3WEMA 1EQPA 4TVDA 5F2LA 2RGLA 2BNJA 3M46A 5ENLA 3E2SA 4F0HA 3FGCB 5EA9A 3ZXWA 3H12A 3RJXA 4H4WA 1JGIA 5CPSA 3VD3A 4Q8TA 4ZGYA 3URHA 2BVYA 1WDSA 2XPKA 3BGJA 3RDKA 1H5VA 3WMLA 5C9XA 5C71A 2OT0A 1TV5A 1VP5A 1E43A 3W9ZA 4CVWA 3RCMA 2F6XA 4LBSA 1EUAA 5AHFA 1RJQA 4GJIA 4UTUA 4OZOA 2XJ7A 3NM3A 3GNPA 4OECA 4HOZA 4LV4A 2XHYA 1GEUA 1O1HA 4IHCA 1SB3B 3EOSA 2GWGA 1ISZA 1EYEA 2QAEA 3CH9A 1PWLA 3TJ4A 3G6LA 1W1ZA 3AXXA 4O4WA 4GRSA 3SB0A 1FEBA 3BMXA 2UY3A 3S5NA 3TC3A 1JVNA 2C1IA 3VZXA 2FGZA 2OU4A 3MO7A 1MNZA 1TA3B 4UB9A 3WFAA 1K4HA 2B0MA 4MJ2A 4BV6A 3STEA 3WO8A 3LXAA 1BSIA 1J0IA 3OIXA 5FJUA 3DAQA 1TSIA 4IQJA 2WCAA 5AB3A 1WOAA 4JNZA 3A7AA 1V4YA 3M47A 5FS9A 2ZUUA 3UXKA 5K4ZA 1GYNA 1VFUA 1V77A 3MP4A 3LHWA 1R87A 3SN4A 3E0LA 2ZUSA 5KITA 2ZRXA 5JBFA 4C1LA 1HJUA 2OGJA 4O0KA 3CHEA 3WD1A 2JF7A 3LQGA 2A3EA 2VL4A 1XSKA 3RXZA 4FX8A 3ABRA 1XLHA 3B8DA 1DTUA 2YVGA 3MANA 3SO7A 3C3NA 2XSXA 3UPBA 1A0DA 2Y61A 1U33A 4AHOA 2QT3A 3QV8A 1LG2A 1ICQA 3UQNA 5LIWX 4L4LA 3UJRA 1Z48A 2CC0A 3UWUA 3R43A 1M7JA 3S9IA 3RF9A 1EHAA 1J0JA 2YDRA 4IMFA 4GO8A 2ODOA 3DOPA 1S7MA 3MC5A 2V8ZA 2YFNA 2WV8A 5JH1A 1NARA 4LJ3A 1EZ2A 3ZIZA 3A21A 4TQTA 2J6VA 3VKAA 1TPVA 1JXJA 2OGYA 3BCDA 3WY1A 3GD3A 4H4PA 1K02A 1X7IA 3IGXA 3GY1A 4O4VA 4B9YA 1BKHA 4GISA 1L8PA 3VCNA 3ZVHB 5ABGA 1IXQA 3CU2A 1DVJA 4MWAB 2CU0A 1W3JA 1HNYA 3QTGA 1UWUA 4JS3A 3GC2A 3W7OA 3BCFA 3KZPA 4N9DA 4I8YA 1YIXA 5HJYA 4H4ZA 1RH9A 4US5D 3W01A 1EX1A 3D0CA 3GX9A 3W74A 1BXCA 2OYKA 4EOUA 2DUXA 2OQYA 4AIUA 4JXCA 1TREA 2GJXA 2HWGA 3OHIA 5F4SA 5CZSA 4WR3A 4IPJA 5CPOA 3PTDA 3L4ZA 3GG8A 4IFKA 3SURA 2V3EA 3H7RA 1FRBA 2CCRA 3L4XA 3L7RA 1TYTA 4YXGA 4CQ8A 5DANA 4ZOBA 1UQZA 3ARRA 3C52A 1CGWA 1MWOA 4WCJA 1BYDA 1YHTA 2ABBA 4E6MA 3VIIA 3UESA 2HVMA 4M3PA 1KRCC 3L5OA 2GWNA 3GTHA 1QPRA 2OELA 1MEHA 3R7MA 5CBIA 4TXEA 5A8QA 3KLLA 1XLLA 4WY0B 4D9PA 2A4AA 1F76A 3F2BA 2V2CA 4Y9AA 3IIXA 1PZ0A 4S3KA 4Q3MA 1GERA 1OQFA 3LADA 4EQRA 3VKKA 3BLKA 1YDYA 3G1VA 4G2DA 4G1NA 1XIGA 3W0KA 2WJZA 4EF8A 2V3GA 3LRMA 2C15A 1XIJA 1R38A 2QUNA 3SGUA 3USZA 4FIRA 1R8LA 4WK9A 1H09A 4E2DA 1TJ2A 3MUY1 3CUHA 1VB9A 3HGSA 2NXIA 3KDNA 3JZEA 2VTFA 1FWTA 4IG2B 3VKJA 3W7CA 3LI1A 5FIPA 3W7MA 5F2IA 3KBJA 4LFYA 4GUIA 3VO0A 3ZLGA 1NVMA 2AMGA 4K7ZA 1JI1A 3S2MA 4LAUA 2YCLA 4GUGA 4REQA 4Q8OA 3UGVA 5B7YA 3UR8A 3N4FA 4RNFA 1GKPA 2GJLA 3IUDA 4U4MA 1A3XA 3BE7A 5D2XA 1NELA 2Y63A 3B05A 4PGLA 1DIDA 4ENLA 4XTIA 4NX5A 1TRIA 4DZ5A 2R9RA 4P7NA 3B0PA 2VX6A 3T0TA 1YDNA 1AD1A 4GIAA 2EKGA 1ZDLA 2RGMA 2I1OA 2W9MA 3LB8A 5D30A 2ZX9A 3DJGX 4QLKA 1EO5A 3MJMA 5D2TA 1BWKA 3UG4A 4MGGA 3BL3A 3DX5A 4LUSA 1Q6EA 3NQDA 3ME3A 3KTSA 4KWUA 1OC7A 3S2JA 3E5PA 3IIVA 3NRZB 2G0WA 2W62A 3GH7A 1HL9A 1SUXA 2VRJA 4A3HA 1LJYA 4H9UA 4HTBA 3CS2A 4AVNA 1OZMA 4EPEC 4J4KA 1KC7A 4IL2A 2Y7GA 3NVTA 3QKZA 3S9YA 5EMLA 4I90A 1DWIM 4YWOA 2YZRA 5DT5A 1KFEA 2YQUA 1W54A 1EC8A 1JNDA 3CV7A 4EX4A 3TW9A 3FFSA 5LNSA 1MUWA 5CG0A 2H3DA 3VZYA 2R6OA 3E0VA 2V38A 3FHQA 2FGLA 4GQ0A 2WO5A 3N73A 1FWRA 3L66A 4QG9A 1RCOB 3S5YA 1ZU8A 2A3HA 3MB9A 2X40A 1EA9C 3WNLA 3IACA 1V03A 3QY8A 3WUFA 4AWEA 1V51A 5C54A 5KEZA 3G5EA 3PBYA 5DRIA 3SUUA 3AI0A 4S39A 3VD9A 3O07A 4DAIA 4I5UA 3L9CA 4OTKA 1TPH1 4Z1AA 3ISIX 4LB3A 3QSTA 4XK2A 3TN4A 1JYNA 1LLOA 4AHPA 1V6VA 2XINA 3NQ2A 4KW2A 4WJXA 4PTVA 1SQ7A 2WJFA 1US2A 5D09A 3TFCA 4LOCA 3QLLA 3UG3A 1XICA 3I68A 4W84A 3LU2A 2CFFA 3MS8A 3LGEA 2QCEA 5CH9A 7ENLA 5HJXA 2OYMA 1S46A 2O56A 3S8HA 1E51A 1FFQA 1KRAC 3BK0A 4E3VA 5LZLA 2E6FA 2Y4SA 3NVVB 3N6HA 1Z8AA 3DK9A 4BF9A 3ITVA 3P5ZA 2JKAA 4IMGA 4DEFA 4HOXA 2EF9A 3NOYA 2JKPA 5FJIA 2DY3A 5I3KA 3RX3A 4O11A 4Y9NA 1XLBA 3LTSA 3ZWTA 4V28A 1X6NA 2VR2A 3H53A 3I4KA 3HGRA 4IIEA 4DIAA 2PWUA 4HVXA 1FKWA 3FCPA 1KM5A 1JXKA 3VZZA 3G1RA 3C8FA 4F79A 2UY2A 3BLDA 3GQYA 4X22A 2XH0A 1O5KA 2I16A 3B0YA 4C6BA 4IGMA 4US5A 3VU2A 2VR5A 4M19A 4FOKA 3MHUA 4L56A 5FA5A 2EHHA 3TN5A 4EWJA 1RPXA 2J7BA 2QUTA 4BQ3A 2PP0A 4FAMA 4CUCA 4LUTA 3H21A 1HTIA 2ATMA 1W9VA 3M0LA 4P8WA 4NZJA 4JIHA 2FHCA 3IVSA 3WN6A 2CDUA 1Q4WA 3DFQA 3XISA 4GYJA 1PL9A 3WUGA 3E2VA 4JTHA 1DJYA 1QO5A 3A9BA 3SCWA 2GRTA 1ME8A 1W5PA 1AFSA 1XL9A 3ZFHA 5C2XA 3T0AA 4Z1BA 4YWSA 1XLKA 3W53A 3VINA 4IJRA 5FF3A 5EFDA 4C6FA 4D6IA 1DJNA 4XZBA 3BG3A 1ICSA 1VEPA 1LDCA 3AMDA 4K8EA 4YVPA 2J4GA 3VOJA 7TAAA 5LA1A 2VOMA 4DZAA 1QDSA 2BVWA 3OBKA 1UKOA 4ZO8A 3CQ0A 4W4QA 1HUVA 3SJ3A 5IDZA 5FEPA 3EMZA 3U0HA 2BS9A 2QLYA 1V97A 3QMTA 5D9MA 2HXTA 3WEOA 3ANUA 2DH2A 2SFPA 3CV2A 1ZAHA 1H2JA 4BS0A 3UERA 1GJPA 3GRTA 2BXVA 4HMCA 3MMWA 3FJLA 2VUYA 1PCWA 1KM2A 5I3GA 3LHTA 1OX5A 1GPWA 1LOQA 4GZ7A 4J40A 4DJFC 1A80A 3SCQA 3GRIA 4P8VA 3SR7A 3FVMA 4RL3A 4M81A 3R13A 4CNNA 2A0NA 1F8WA 5IDIA 2D24A 3K5XA 4BR1A 3UW6A 1AK5A 3QHOA 2PD9A 1FXPA 4JFTA 4N2YA 5DT7A 3IANA 1SR9A 3GYCA 1E6SM 6REQB 2ZVRA 4G7FA 3AMLA 4LUIA 2ABAA 3UJFA 3I7QA 4PB3A 3DJJA 1X2HA 4N6FA 2GQ3A 5D9PA 4FX7A 4JDBA 1XH0A 1GRHA 4O54A 1CX9A 3ARZA 3N2OA 1W1B1 3TW6A 1XIFA 2YDAA 1EX5A 4AZIA 3GNNA 3AM9A 1ONRA 2YBUA 1W1TA 3LTPA 2X42A 2NSXA 1Q7MA 1HGYA 2AQWA 1TX0A 4W88A 2W3SA 4Q22A 3PR2A 2CHNA 3AXHA 1W1VA 4I3GA 1V3JA 3LMYA 4YYFA 1NHRA 4HPXA 2PDFA 1QNVA 1EC7A 2Y6ZA 3MT1A 4XD3A 2CZVA 5LSMA 3CH0A 3WQCA 4IZGA 4LRTA 4LVDA 1FX6A 3QF0A 2CBJA 4ACZA 2F84A 2NVDA 1K8YA 4K36A 3A3XA 4HIBA 4W8AA 2PWFA 3GBDA 3VIHA 4QE1A 5HA7A 3MMDA 3KBSA 4HN8A 1WOBA 3NQ7A 5AY7A 3QYQA 2J66A 3OTRA 4H4YA 1ZBKA 3PVFA 3KVJA 5FESA 1K6WA 4PB5A 2YAUA 4YS1A 4JD4A 3GXNA 2Z24A 4HSNA 2QKFA 4WDUA 3BGGA 1WZAA 4HPGA 3B9AA 3ZJ8A 4UQBA 1V5XA 3BSGA 3CPGA 2DJLA 1BZLA 3UWVA 3AC0A 2YW4A 4AC1X 3A4AA 3UGRA 4AZ6A 2YXOA 4MLJA 4M7TA 5I78A 2FHBA 4Y6GA 4M8UA 4JOMA 4PN2A 1H7OA 1TB3A 4XKMA 3VC6A 4IIHA 2EQDA 4LYKA 4NYUA 4H6KA 1B0IA 4EIVA 4K68A 1J12A 1HF6A 2WB5A 2C1GA 1XYAA 4MB3A 5C9RA 3LX9A 5BOEA 4JTSA 2G4FA 2PDWA 3PJXA 4LYPA 1H7NA 2WPBA 1PS9A 3CGCA 4WGHA 1MVYA 3A5VA 4RPPA 1XGDA 4YJ5A 3QKEA 1FWWA 3G1AA 2P88A 3HV9A 4AD3A 1PX4A 3QOKA 3PZNA 1SZNA 3PHAA 1QW7A 3TLLA 3AXMA 2JEPA 5KVHA 3N4AA 2BY3A 2ZXAA 2V2DA 3LA4A 1H51A 2NV2A 4Z1CA 1EEPA 4YN5A 4TVCA 3WZ0E 1XDIA 1ZHAA 1BRLB 3EGJA 3L12A 1F3TA 4CQ9A 2XSAA 1P43A 3STGA 4L64A 3NZ1A 2Z2BA 1B1YA 2Q3OA 1XLMA 5KETA 1N5WC 4YNGA 3DYMA 4U28A 5ABEA 1AQMA 4X63A 2Q8ZA 2R14A 2JGYA 1KXQA 3ZWSA 2VDGA 1WXZA 3O16A 1Q6LA 4O16A 3R12A 3LENA 2PWVA 3NQVA 1H7WA 3R11A 5I77A 4DJDC 1L8NA 4DZHA 2ZUMA 2WAGA 3E49A 3IAPA 3EWBX 1NDAA 3W6YA 1ZP4A 4RE4A 3CHFA 1R85A 3K8LA 1N82A 3ALFA 3W87A 3NVYB 5I02A 1T6MA 2RDWA 3W00A 3VPLA 3BG5A 3OIHA 1LM1A 2VGFA 2C18A 4UTMA 4AX7A 4H2CA 4PFMA 5CG7A 2FH6A 4XZNX 5A6LA 3A22A 4W9TA 4L4MA 1KM1A 1MZRA 4QSFA 3GHUA 3HG5A 4XZMX 2Y89A 4TO8A 3ZZ1A 3CWHA 2PDCA 3B9JB 3IGUA 1YKWA 4KERA 1RLCL 1KFCA 3TR9A 1XLGA 3UVAA 3O7UA 4D6CA 2Q3RA 3A7UA 1JRPA 4NSBA 2CKSA 1JCXA 4S3CA 3M0KA 1RQHA 3WF2A 3IGHX 3RITA 4D6HA 1JG9A 2CFYA 3CAQA 4PL2A 4GGBA 6ALDA 2PWEA 3K1DA 4GY0A 4O10A 3W73A 4IISA 1W3IA 3NL5A 1EL3A 3KCOA 4NNCA 1OX6A 3W7QA 4GKTA 7XIMA 3A9IA 2W6RA 3DFPA 1A0CA 5DMNA 1PIIA 1NWTA 2PFHA 1RXOB 2VEGA 3LB0A 4XBJA 3R89A 6XIMA 4UBPC 3OP2A 1Y65A 1JYWA 3PZGA 3SADA 3CEPA 4H7ZA 4DHGA 1KCZA 1SFJA 4O52A 1H60A 1XHGA 5CJ5A 1BEUA 2DSUA 3BGAA 5I3JA 1LP6A 3WUBA 3NQ6A 3AZTA 2ZZ7A 1TTIA 4HJWA 4RXGA 3L2MA 1QW9A 3LGGA 4UCFA 3NXFA 1SJAA 3RO6A 5IFPA 1V6YA 1IEQA 3ONBA 2OTDA 2QCCA 5LNWA 1WX0A 2DSZA 4DY1A 3GRSA 3RPDA 1DHKA 4XZIA 1G7UA 4C1NB 4U5IA 1EO7A 1F73A 4NAFA 1VFTA 1W5OA 3V35A 4DLMA 9XIMA 1PAMA 4BZYA 3NR0A 4ZTYA 3LD5A 1R2TA 2XIQA 3K30A 1CTNA 2OSXA 3QQ0A 3N29A 2F5ZA 2A5HA 1O68A 5J8LA 1HKWA 4OHQA 3TK7A 4CCEA 4G56A 1XM3A 4EAYA 2DV0A 2TSYA 5A8MA 1FHDA 4ZR8A 2ATSA 5H91A 1B3YA 2RDUA 2PE4A 4OBTA 1QCWA 4IL0A 4JNMA 1TPEA 4FXSA 4B9ZA 3C0QA 5LA0A 5BYWA 2XIIA 2GOUA 5FF4A 2Z1BA 4O13A 3E12A 2WZMA 4C6NA 1QWKA 1V6UA 4PFHA 5I06A 1JYXA 3REQA 1F8MA 3MHGA 3RU6A 2WSKA 1HJVA 4AHQA 1QTWA 4DUWA 2Z28A 3BLLA 5E0FA 1IF2A 2OR2A 2CHOA 3GR8A 4J27A 1O4UA 3I7RA 1E1EA 4BKNA 1B4KA 3HJZA 3MMTA 2ISFA 1JUKA 3KCLA 1AW5A 2C3DA 2YA2A 3CM4A 3RO8A 3W7IA 4QAIA 3T09A 1AL8A 1VDVA 3T8QA 3RLHA 1KTCA 4M82A 4ZXOA 4LY8A 2QPXA 3LS9A 4GLEA 2ZZBA 2J62A 3N19B 1UR4A 3V7PA 1J79A 3DKLA 5AYZA 2YB4A 4Q8MA 4FR6A 1SW0A 2EQ6A 3QJAA 3WBYA 3G0SA 3L21A 1ZUAX 4JHZA 1X8FA 1Y0EA 2POZA 2VZSA 1PIGA 4AUBA 1LORA 5I6SA 4HMNA 3LZ5A 1XBZA 1GZGA 3WUEA 2Z7GA 1U22A 5FEZA 3ZT6A 1QRQA 4KRTA 3AYTA 3VGFA 2WC4A 2FB2A 1SO5A 3QV9A 6PTDA 1JAEA 6A3HA 4M1BA 5FF2A 1WNOA 2YXXA 4IFRA 1IWBA 3FA3A 4FXRA 4DJFD 3LSCA 2PLKA 4IF2A 3ABXA 3SQSA 4B2DD 3U48A 4Q8WA 1HVQA 4Z1DA 5H2ZA 2GDQA 2WC3A 1SJDA 2A8XA 4OIFA 1K4GA 1ZY9A 3R1ZA 3N25A 3V0TA 4PEEA 5E93A 1WB0A 1A3WA 3NSMA 2PC8A 5HNNA 4LSBA 4ZOEA 1IWPA 4XUYA 4BEUA 2NPXA 3TZNA 2WQDA 3W88A 3GXFA 5KSWA 4QX4A 4ICCX 3KBWA 4ZB2A 3AO0A 5BU6A 2J9ZA 1N8IA 3GU2A 5A5WA 1C90A 4M6PA 4NL1A 3TP4A 4XO6A 1UMLA 3S5OA 2NQJA 3ARPA 2J7GA 3BQ5A 3CASA 4MPQA 4BI6A 2VVNA 3WLIA 1F3PA 2FPYA 3IRSA 4TMCA 3W2LA 3GSMA 4UOQA 1DE5A 2OOFA 3N2BA 4YTRA 3Q2DA 2VENA 3G2GA 3N12A 3GBEA 3P14A 4GX9A 2A2IA 4H4UA 5LGZA 3W1LA 4DO7A 1CPUA 1I2QA 3WNKA 5A8GA 1FWBC 2VC6A 1PIFA 3WJYA 1PTAA 4AEOA 1ONXA 5EMJA 1B3ZA 1EBHA 3KDOA 2H9AB 3SIZA 4AVFA 1IZJA 4EM3A 4WKAA 3ITXA 1NAL1 5HQMA 2J7DA 2E5DA 3TUUA 5LXXA 5F2GA 1K6AA 1KB3A 2WOIA 3HB9A 3EWUA 3P82A 3CAVA 2PC4A 2G3JA 1Y8BA 2NX1A 1EF3A 4EP8C 5BMWA 4JFVA 4QROA 5DRCA 2CNCA 3AIWA 1LBMA 2F7FA 4L1WA 1QNRA 3H54A 5AYIA 3TROA 1I2PA 1LOLA 3DYOA 4ES4A 1GHRA 2VZOA 1IT0A 4HYWA 3OJGA 1PE1A 1W32A 3UJSA 4QJ4B 3GC5A 3L68A 3J7HA 3V0SA 4RK8A 3VGDA 1XIEA 2FZMA 4ZA0A 5GNYA 4QIUA 1LWIA 5G2IA 2VFDA 2YBVA 1YYAA 2QMJA 1GORA 3URBA 1D7YA 2C16A 1X1OA 1U5JA 2P10A 5TAOA 2PBGA 1Q85A 4E4PA 2WMHA 1NQ6A 4C7FA 3D46A 3ZT7A 1JEHA 4IT1A 3PAJA 3G24A 3A64A 2XZ9A 1J2BA 4YU1A 1L2QA 2Y5EA 4LAOA 4LUYA 2NQ9A 3WLLA 1S5NA 1QASA 3O6DA 5JXQA 4WIWA 4OBSA 4C6PA 3HFTA 5FL1A 2G41A 5ECUA 4GI4A 1QPOA 3M5VA 2ZRYA 2OX4A 3B03A 3VNDA 3GFYA 4NEVA 2QAPA 3QBUA 4QAWA 2V82A 2Q8XA 4XAZA 3O1NA 1V8EA 2WKJA 3QFBA 4FB7A 4O53A 3WK2A 3DHPA 3ENLA 1EIBA 2D3NA 2VR4A 4GOAA 3EYPA 3AZRA 3SUTA 4IP5A 3BV4A 4GX8A 3WLNA 3PSVA 4MFEA 4H9MA 5I3DA 1CXKA 3LHZA 1VIZA 3IGSA 3EX6A 2HE5A 1FA2A 1YDVA 3B3DA 1W9XA 4DXKA 3N6JA 1BHGA 3FS2A 1QHPA 1FH8A 3THQA 4TR9A 1J10A 4E2VA 1PTGA 2H6RA 4N9EA 4CQBA 1VBRA 2RJHA 1XKJA 3MPGA 4L9ZA 4R7OA 5JIPA 3FXGA 2Z2AA 2X0HA 2DW6A 2OWXA 4WLCA 3UZWA 2R1LA 6TAAA 2D2HA 3C6CA 4UNKA 1TPFA 4O28A 2EG7A 1SU5A 2GZXA 3OEXA 3OA5A 4MFDA 1OIMA 2FTPA 1MEIA 2WPCA 5D33A 1PCKA 3RX2A 3CT2A 1P4CA 4OKDA 3G18A 1F8IA 2PTYA 4HZ7A 4ZOAA 1X1ZA 1SZEA 2WHLA 1YE6A 4W8BA 4GR1A 1TZZA 4MDOA 2GGHA 3AS0A 4FSAA 5ABFA 3NAVA 1GETA 3VD5A 1Q1RA 3WLPA 3T8LA 1R86A 3LBMA 1FTXA 3CHVA 5FOOA 2X50A 3PB0A 2B81A 4NKCA 3RLGA 1UP0A 4HU0A 3WIJA 4DJDD 4RZ6A 1KLYA 1E0UA 5KZEA 3H23A 4JX4A 2YKKA 3HG3A 4AU0A 1VFMA 4Q4PA 5G5HB 2DGAA 2C14A 3FA4A 1REQA 2WM0A 4AMAA 4GMEA 4OJYA 4JCLA 2CZDA 2WHMA 1CXHA 3UR2A 1VS1A 2YIHA 1E5NA 1WBJA 5HBFA 4TVWA 3DESA 1VYRA 2PUZA 3D6NA 1UKSA 3A4WA 1WCGA 3W28A 2ZXBA 3CLMA 4EQWA 3TTSA 3T44A 1DIKA 1F74A 4XTDA 1UASA 3NPVA 4Z0JA 4OVXA 3W1MA 1DQXA 4CLMA 1ME9A 1A5UA 2GSEA 4GVHA 1OSEA 3GNRA 4I7UA 4YWIA 4J3UA 1JF6A 3OBAA 2QJGA 1L6FA 3CB3A 4A3UA 4B2DA 1Y5WA 4PZVA 5ECVA 1Z44A 6XIAA 2E4TA 4C91A 5TNVA 5CC7A 1UD5A 3MCMA 3RFAA 4PUEA 2BTMA 2XGBA 3B04A 3UJEA 4X9SA 2X05A 4LVGA 1AH4A 1RBAA 2HS8A 4DWSD 1RCQA 4NU7A 1OFBA 3IUHA 1H6VA 1DOSA 2UY5A 3R58A 4I9MA 4L6DA 1QNPA 4ADWA 2Z1XA 3WDHA 4AEEA 5GNZA 1BXBA 2HK1A 2JIEA 1Q6RA 2HBVA 1FY6A 1VFHA 4ZQRA 3GXMA 2I5QA 2ZRZA 3SAZA 3P8JA 1B9BA 2O4MA 3EDEA 5CJNA 1V0NA 1OD0A 3EKZA 5U1OA 4JTDA 2GK1A 3FW6A 2Y8KA 1V59A 1OG6A 3PPFA 3PUEA 5C0QA 5A69A 1ZALA 2EBNA 3ANYA 3GKAA 1NWSA 3CMJA 3UT0A 5BXPA 1QK2A 2PS2A 1N61C 4O1EA 5MKGA 4PR4A 1ZXIC 4P5UA 2VURA 1G67A 4QLJA 3ITCA 1WDRA 3GW0A 4IGSA 2ZRWA 5L9FA 1SSDA 1RAKA 4JNYA 4LS0A 4MJ4A 3KEHA 3ID7A 4U10A 3TE9A 1FWFC 4MY1A 2E7FA 1C9DA 2WLYA 3QPYA 3NSNA 2J75A 3ECQA 4C6EA 4L80A 3NO3A 4P8XA 3M4HA 1E71M 4BF5A 4MVAA 1DIEA 4WF7A 3F5KA 2AGKA 1XXXA 4XD5A 3SSJA 1E6NA 4X61A 3UCDA 1BF2A 4LVBA 1J8VA 5BRBA 5EMKA 1LZOA 1MRAA 3T07A 3AS2A 3ZR6A 1V0LA 1XGEA 4RZ5A 3E5BA 3UZYA 1D7FA 1F3XA 1EGVA 2X7VA 3QM3A 4LPCA 4EQXA 4JFSA 4HB7A 2QQ6A 1IEXA 5CJMA 2C0HA 3KXQA 3RMJA 3U5UA 4AISA 1KTBA 2R8WA 4PUKA 3HQPA 3KBNA 3EDKA 3OG3A 2HS6A 1WAUA 4AWUA 3FVDA 2BZNA 5HWJA 4N0RA 2EG6A 3TTQA 1E6XM 4L6HA 2P53A 3S1VA 1PPIA 5HNUA 1ZNNA 1NIUA 2P0OA 3WQWA 1FDZA 1FUYA 3RNDA 2YR1A 4GVFA 3VCCA 3UZJA 5AFDA 1L2UA 5HQLA 4GBUA 3SUWA 3WD0A 3QR3A 5BOFA 4DYKA 5AC7A 4L7ZA 4HMEA 4AEFA 1H5YA 3I3EA 3BURA 3SDOA 4FF5A 1GQLA 4C6MA 1PKNA 4WX2A 4H8VA 1SO3A 4TX8A 4KPLA 1H50A 4U33A 1QI5A 3NJ3A 2DZAA 3LHVA 2QNEA 4YCPA 4EMWA 1GEHA 1DL3A 4YPJA 1OEPA 3JU2A 4OGZA 3DGHA 4K8DA 1R3SA 2X8CA 3AMCA 1TMQA 1KGXA 3C2RA 4WSHA 2GJXB 5IOBA 2R1NA 1XIIA 4WOQA 1VEOA 1FWJC 1TPB1 4DJDA 2A3AA 1XRFA 3SI9A 3OLEA 1DJIA 4X2PA 1Z9AA 2A7NA 3O8AA 2AMXA 4MKNA 1R9ZA 4IGNA 5EPDA 5RUBA 2Y5JA 2WSRA 3P60A 3M0YA 4MMWA 4GI8A 3H7VA 1IQ8A 1KRBC 3GG0A 3FNDA 3G1HA 2P1FA 4A8NA 1H41A 1JDDA 4QCEA 2F6UA 5AYYA 1WBHA 1CGUA 1UP2A 4PUUA 4AZ7A 4EPBC 2P8BA 1F4AA 3ETRB 2A1YA 2E8ZA 1SMDA 1Z69A 2PZ0A 1DKWA 1UJPA 4CGTA 4XIMA 4ACYA 3ZMRA 3EWXA 4DPQA 2NX9A 1FP8A 3II4A 1J18A 4H7VA 3NL2A 3MZ2A 3TMLA 2QIWA 3DBNA 4UNIA 3HF3A 4JFUA 2PDJA 5CSSA 1OX4B 4KCUA 1J11A 1I1XA 3WJSA 4AAJA 3UA3A 5I2UA 3P7YA 3BAKA 5AECA 2GQWA 1GJWA 4NUWA 3W6LA 1V3IA 2X1TA 3GKFA 5JCKA 1GK8A 2V5JA 1FO4A 1ZQ5A 3PZ9A 2BWGA 1JPDX 5EMMA 1WDWA 2W67A 3G1SA 4HK5A 3O63A 4J7RA 4ZEPA 2A6LA 2WBAA 2YCLB 3AYRA 1JRCA 4UMCA 4XQ6A 4WKHA 3HMCA 1F6KA 4JTCA 3L5AA 1TFVA 3GNOA 3CMGA 2BHZA 3CIWA 4Y9OA 3P93A 2AKMA 1L9WA 4NX0A 3TIMA 1BLIA 1RY0A 3FSTA 3IJDA 3XINA 3PZVA 1E4MM 2OEMA 1P48A 3TYUA 4JTJA 4HBKA 3R6IA 1BTMA 4LVFA 1N2VA 1RVKA 2D0FA 3R10A 4Z2GA 4PBFA 3W82A 4EXAA 1FOBA 3NWRA 1CB7B 2W91A 1AJZA 3OGVA 2PDIA 3W81A 4FALA 2BGQA 3O6AA 3NQCA 4O57A 2ZXQA 3IPWA 4INFA 1P7TA 2J25A 2BY2A 3SN0A 3RR4A 3AUJA 2Y85A 1W5NA 1S3TC 2ON3A 5K9XA 3BCJA 2V67A 5CSRA 3GIQA 3GUGA 3S1XA 3EF6A 4YYCA 1HQTA 2WZTA 2RJGA 4RE2A 1P1XA 5CZTA 4IX0A 4JQAA 2DZUA 5K4XA 2WP6A 3WF1A 1XC4A 1GRBA 3GVQA 4O0ZA 3RRXA 1KM3A 2PAJA 5CEWA 1VRDA 2XFFA 2E3ZA 1O1ZA 3UZXA 3BW2A 4KEUA 3PZMA 1O6IA 3LNMA 2W92A 2WSYA 2PDYA 1Q1WA 5D03A 3A4XA 1F4HA 5CPTA 3TNOA 2E6AA 5A94A 4P8UA 1KFWA 3B8IA 4RDWA 5CC6A 2X8GA 4GZEA 2WCSA 3L0NA 3G1XA 4O14A 3V5OA 3BZJA 3MI3A 3QFAA 3KVLA 2VJXA 2CLOA 1X2GA 3H2FA 3C2OA 5A6MA 4HPNA 4QDMA 3CTTA 4S2BA 2VP8A 3CAKA 3W1XA 3G1YA 5GQBA 4B3LA 4Q8VA 1EWEA 2W54A 4JGDA 1DJWA 3EPMA 3VFLA 3UU0A 1B3VA 2LLEA 4B5TA 1BG4A 3PZIA 1BSLA 4DAFA 1XBYA 3POHA 4NILA 3FN9A 2INFA 3VM5A 3U8GA 4RW3A 3E2RA 3HV8A 1J93A 3KZSA 1W1PA 2VUNA 3HPFA 1CLXA 1ZMDA 4DM1A 2GR3A 1VKFA 3FK4A 3F5LA 4AD1A 1IEVA 1OT1A 2ZVIA 3N2XA 1V3KA 2NLYA 2X41A 2D0GA 1NH6A 1HJXA 1JULA 3ES7A 2P0IA 4D6FA 3NQBA 3GNDA 3RM4A 2C0AA 3LQLA 1FQ0A 1VBJA 1UC4A 1KQZA 1OFEA 3MMUA 5AZ1A 4LUJA 2O55A 3AHYA 3KWSA 2WXDM 3R4IA 5CBBA 2F38A 3FHAA 2HXUA 1JQXA 2VQUA 3EB2A 3OG2A 4NI8A 2MANA 1ZMCA 1MQQA 1MNSA 3EKGA 1X1NA 2D20A 3FAWA 2YDSA 2WKGA 4YVXA 4E38A 2ZRUA 3S5SA 4JIPA 3WD4A 4P7QA 3W83A 4CNTA 4WVXA 5K3VA 3KRZA 2EXOA 4KEMA 3HQNA 3I7SA 4DBSA 3U3HA 1ITXA 2ZZ0A 3TXVA 2OZ8A 1S1RA 4Z1YA 4EM4A 4KRZA 5DF0A 5H8UA 1IIGA 5BROA 3T55A 1PSCA 1YPIA 3FGCA 2DEPA 1O5RA 4FF7A 3AOFA 3G3MA 4H9ZA 4A35A 3SY1A 1O5XA 4QCFA 4JAWA 3B0VC 1DJXA 4ICMA 3MDUA 4A21A 4ORMA 1M3UA 5FD0A 1H0IA 2DFAA 1ZJIA 2XH7A 1N8FA 1XCFA 1W3HA 1DORA 1EYWA 4MWAE 2I14A 3N34A 2ZDRA 2XG9A 4WQ6A 2NVCA 3R0UA 3K1GA 3KWXA 3GVVA 2BMBA 3WJXA 2BCPA 1W5QA 2RUSA 4QS6A 1XUZA 2FFIA 3BVJA 1LROA 3L65A 2XN0A 3CTLA 4HZ8A 4KWWA 3GTXA 3JW7A 3EPNA 1LRQA 2JK6A 1XYCA 3VOHA 2CLKA 2YW3A 3I3DA 4H00A 1XFBA 4Q6XA 4IJCA 2WBGA 3FJNA 1WUEA 3FDKA 5D2WA 3WDPP 4AIEA 4E8CA 1J9YA 4TVYA 4N02A 1Q8JA 1W8SA 4L9YA 3T6CA 3QY7A 1JI2A 5JBEA 1OVDA 1H0GA 4UTTC 4R7JA 4HU8A 1IXNA 2GL5A 1MFUA 2C8NA 3VNKA 3AJ7A 3NCOA 3R25A 3NZGA 5EMUA 3GH4A 5XINA 3D47A 4ZTXA 2OO6A 3GG1A 2WM1A 3WQDA 4AMCA 4RR4A 1VHCA 4F0MA 3WLQA 2EQ9A 2DIEA 3W1RA 2F61A 3LXDA 2PEVA 5FAJA 3T4WA 4HNNA 2E9MA 3NO1A 1ZCCA 1JNEA 5H8MA 1UA7A 4RNJA 3EDDA 1XCXA 1H1ZA 1UPPA 3PUOA 3C0LA 1XKYA 2BC1A 3GU1A 3T1GA 3CQIA 2DIJA 3K8MA 3GH5A 1R30A 1X38A 1OFAA 1UP3A 1IYXA 3TYEA 3EWYA 4TVUA 1OJXA 1ISVA 2ICSA 2BASA 1OK6A 4N4QA 3W7EA 4PCSA 3IIPA 3BW3A 1UUOA 2QV4A 4D6DA 1C91A 2W79A 1UCWA 1PDYA 3CZLA 4Q4RA 3EOOA 3OLGA 4GC4A 5H6HA 3NZQA 3ZVHA 1ONFA 3KTXA 4PMVA 2XFRA 3DDMA 3LK6A 1QPKA 1UQYA 5KZMA 7ODCA 2NVAA 3INPA 1G01A 3IV8A 3T40A 4WDWA 3PJUA 2VMFA 4ATLA 1G9HA 2F9RA 4QQ3A 1PWMA 1XSIA 4A2RA 1V7AA 3G0XA 4J56A 2PDMA 3AIVA 3GW3A 4TUFA 3ATZA 3BG9A 4HGXA 3N14A 3THCA 4GCXA 3TOYA 1VBHA 1E9IA 1O66A 5AHIA 3F4WA 4LAKA 1Q7QA 3RCYA 4YHGA 3AIBA 4DVOA 4EACA 3SRHA 5AC5A 1KV8A 2DPEA 3L4WA 4A4AA 1MQPA 1M01A 3PPHA 1R2RA 2NQLA 1JZ3A 2PP3A 1ZP3A 4DYEA 3I65A 3TYDA 3WD2A 3U5YA 4XKYA 2H3BA 5DELA 2TYSA 3COTA 3NYZA 1SFSA 4GH1A 1SO6A 3VNJA 3CV6A 2Y24A 4JCMA 4MZ8A 1JDAA 1WE5A 3AQUA 3SIMA 3RR1A 3GR7A 1R3TA 2V5BA 3LSBA 3Q37A 1GVOA 3NQGA 1LT7A 2KAUC 1GONA 3TCEA 1IT8A 1TRDA 1HN1A 2FVMA 3THUA 3S2NA 1KR1A 4IG2A 2RAGA 3A3WA 4A3RA 4G7EB 2XVGA 3O15A 1E0XA 5FACA 4EAMA 2WZIA 4RW5A 4RUBA 1RM6B 3F2CA 1JPHA 3TDFA 3EX1A 2YB1A 1JCTA 5C5YA 4HOWA 3AZSA 1XP3A 4ML9A 1ZCOA 3KHJA 5E9XA 1EGZA 1UWSA 3W3OA 4JX5A 4UR7A 4Q8PA 4A05A 4J2MA 4C5YA 1W8GA 3I6TA 1U1JA 4N6EA 4PRTA 3KL3A 2EPOA 4FP1A 1PDZA 3GXTA 2PZNA 1MUMA 4HCHA 3PN8A 1NP0A 3MYPA 1MDLA 2C91A 3GU9A 5D38A 3MTWA 4A8IA 4X9YA 4EMJA 2R1KA 5EY5A 2CWXA 3HMJG 4Q7IA 5EBAA 4HNOA 2FZDA 3PG8A 1PX8A 5GPRA 1CLVA 2ZXDA 1XG4A 3EAUA 4IXXA 1LBLA 4URIA 4ILSA 5JUVA 4M6UA 2CXEA 1H4PA 2ZZ5A 4A6GA 3AJXA 2V3FA 1TPC1 1VAHA 2J8TA 1DXIA 4LYRA 2CBIA 4N9BA 2NW0A 4IIGA 4H4SA 5F1UA 4EVZA 5LIXX 4O18A 4QXIA 4NZFA 1ZB5A 2J6XA 2XVKA 2C13A 4WZHA 1Z42A 3TYAA 3QTPA 3BMVA 1A5LC 3SM0A 3ARSA 5BXSA 1P0NA 1CGYA 1K9EA 1UZ4A 3DEQA 3WL0A 5CPNA 1E4NA 3LGDA 4R34A 3B9NA 3CL8A 1BVWA 4RCXA 1US0A 2HE8A 4Q8QA 3L2LA 2DZXA 3QY6A 1H2IA 1K7EA 2VC9A 3DECA 3NPWA 4MOZA 2VCAA 3RHGA 3DG6A 5FL0A 2VXNA 1A3HA 3E96A 3V3WA 2AGTA 4L4PA 5SWUA 3K4DA 4XZHA 1ZRQA 2CW6A 4W85A 3TWBA 3OVPA 1QI4A 5FMHA 1DV7A 1CW2A 2WNNA 3RRAA 1DJHA 2FMOA 1OYAA 4UTLA 4JQ9A 2HMCA 1FWHC 3H2EA 4AZHA 5K9DA 1QHZA 1SGJA 3RK8A 3ARVA 2Z26A 4Q32A 3W7KA 3L0GA 5BCAA 4PCNA 4S3GA 4KT2A 5CXPA 1DEDA 4KGLA 1W9PA 4FA3A 2E3TA 3EMCA 1EZWA 2CESA 2YXGA 3NQ8A 4H3DA 1Q2SA 4NAFB 2V68A 1XANA 2BB0A 1GCYA 3BQ6A 3UNDA 2E0PA 4FMVA 2HTMA 3O6YX 4GKLA 2P50A 4IPIA 1MDRA 2WZEA 4LRSA 1OM0A 4Q4SA 2EEXA 2ZWYA 4FXJA 4ZQOA 3AFBA 4JYDA 3GG7A 1OC5A 1HZYA 2PLMA 2UV8G 3FV9A 1M6IA 3AWNA 2RH9A 4UFKA 3W2KA 1N55A 5K2ZA 1XRSA 1TELA 4JHOA 3MQTA 3QHNA 3PTKA 4K1WA 3RLUA 1BWLA 2WW5A 1GVEA 3C86A 3HTWA 2PSNA 3VNMA 2WVSA 2PWDA 4JTUA 4UFJA 3REQB 2X1UA 3T0CA 2OB3A 3CMFA 3M44A 4AD4A 1E70M 1KLZA 1XPYA 3UEQA 2IPGA 2V30A 3DFNA 5AHLA 1G4PA 3DKJA 1FWAC 1C3FA 3WLHA 3R79A 1RD6A 4YVVA 1BYCA 4HA4A 3T4CA 3IJ6A 2W5FA 4AQLA 5DCBA 4FNQA 1ZAJA 1CENA 1BYBA 2QCFA 1NU5A 1NTHA 1IGSA 3H2NA 3ORWA 1VFFA 1TPUA 3MV01 3NURA 4J2PA 2G96A 1UD2A 2BBFA 4ZXLA 4MAVA 1I2NA 3E9AA 1PKLA 1GXFA 1F05A 3W75A 2WC7A 3ARQA 3EXTA 4QSHA 3VKCA 2ZADA 5L6UA 1LT8A 3QR1A 1POKA 1BXNA 4V2XA 3BMWA 1XWYA 2C3CA 1MI3A 3T42A 1I0DA 4JKLA 4AD0A 3R8HA 1I60A 5FSEC 4B5NA 3UXIA 2DQWA 3QOMA 3WELA 5DMLA 1ISWA 3M16A 3W29A 3EWZA 3WQEA 2Y1HA 3AHZA 4OE7A 3WD3A 2CPUA 1GTHA 2Z4GA 4V27A 5JCLA 5GRTA 3ZVIA 2D0HA 4XAYA 1CI1A 5I0DA 1GV4A 4YTUA 1HT6A 5DXXA 2FIQA 3DBPA 1E0VA 3F4NA 1RP9A 4H8HA 1IR2A 3TKFA 2PI6A 4IQEA 1YX1A 1AA1B 4PMOA 2NUWA 5TBOA 1EOMA 4B5XA 4Z2JA 3VIKA 3M7SA 2OLHA 3LLXA 3P3BA 2X99A 5C6MA 2QDDA 3F2DA 3ZT5A 1VFOA 3U2ZA 1HO1A 3L5LA 3EEZA 2HNEA 4N9CA 3BLFA 1EJTC 4D1JA 1ML1A 1M53A 3KBVA 1XH2A 2D1ZA 3OVQA 5TF0A 3VFCA 2ZE0A 4U3AA 1N63C 2V3DA 6REQA 2ISDA 1H7XA 4YTTA 3EPOA 2OQHA 1W1A1 3AYSA 1M7OA 3MP3A 1WXYA 2NQ5A 5KVIA 1ITQA 3HGOA 4QJ3B 5U4NA 2DT0A 3NGFA 3TYZA 2WOWA 4S38A 1FWIC 1LCOA 1Q6CA 4YLWA 4ADSA 2QJJA 2C1HA 2KX9A 2P5NA 5FJRA 2B7OA 4CCDA 4TU1A 1ONEA 1ZBCA 2ZZ1A 2KZHA 1JDCA 1P0BA 4LA1A 1PYMA 3ONCA 2XIOA 3U7VA 4XO7A 4GNVA 3OYZA 3ZSTA 4XUGA 2PBOA 3TN3A 3SUVA 1H62A 2WNZA 4P7LA 3UXLA 1JUEA 1MZHA 4J28A 4EPKA 3GM8A 2BLEA 1FXQA 1LWJA 4DM2A 4AZ5A 3GS6A 2CIPA 1M65A 3UR5A 2R1MA 5A2CA 1ZZMA 4GINA 4NG3A 3U7BA 2GJPA 4S3BA 1R2SA 1C7TA 2NVKX 3SR6B 4FX9A 2PURA 1LPFA 4W86A 3PZTA 5LIKX 1YW1A 3HG2A 2EGZA 2F2KA 4FIQA 1VJZA 3EWCA 1OCQA 4JR5A 3UCQA 1JZ7A 4ZQCA 4G5DA 2PP1A 4DQWA 1W17A 1K8ZA 1I2RA 1SZFA 3LBCA 3E74A 1Q2RA 1GRAA 3P6LA 1S39A 3P74A 4NNAA 1KKRA 5D2VA 3DC0A 3NS1B 4NIRA 2WKLA 3MWCA 3MP5A 3H4XA 5JBDA 4DJEC 1QT1A 2YZ5A 5HATA 3TNBA 1V3MA 1XIHA 4NXSA 4D8AA 1TJ0A 2YX0A 1A4MA 4TTUA 4E2BA 5JCNA 2GVEA 1V02E 5HAOA 4DI9A 3TTEA 1UKPA 2E6DA 2ZUTA 1VR6A 4GQGA 3SBFA 1UPMB 4H2HA 4UCGA 2NSOA 5TD4A 4U3CA 3RJYA 5K9CA 4NRSA 4FOUA 4AY1A 3C2YA 3IVTA 1ZBVA 4M5PA 1DHPA 2X0YA 3O6CA 4LC8A 4GYFA 4MUZA 2DJXA 3N18A 3KTCA 2WLZA 4XG1A 4F4RA 1CGTA 3FJ4A 2A3CA 4Z2KA 2OODA 5KINA 5DBUA 7REQA 5G5IA 3BZGA 4X2RA 4ML4A 4EWND 5KMYA 4IIFA 3RIKA 3CWNA 2OZ0A 4J9JA 3UWQA 2D73A 3C8NA 4CQDA 2FYMA 2QVNA 3H6OA 1ZY8A 3S0CA 3TQKA 3K46A 3VIGA 3G77A 1DE6A 4O8RA 3OW1A 4UNLA 1P6CA 1OIFA 1QI3A 1UR9A 3WH7A 2OWWA 1XLCA 1XLEA 1RALA 3MKCA 3EAOA 3AU6A 3WKZA 4ROQA 4ZO7A 1JCLA 3TEVA 3IEBA 1GG0A 4UQCA 1KFBA<