4DXKA

Crystal structure of an enolase (mandelate racemase subgroup, target efi-502086) from agrobacterium tumefaciens, with a succinimide residue, na and phosphate
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
400
structure length
364
Chain Sequence
MKITKLETVRVAERTNLLWVLVHTDEGITGLGETFFGAETVETYVHEYIAPRVIGRDPLQIDLLAQDLVGYLGFRSSGAEVRGNSAFDIALWDIFGKATNQPIAQLLGGFSRREIRTYNTRADELAHSLLEDGITAMKIWPFDAAAEKTRGQYISMPDLKSALEPFEKIRKAVGDKMDIMVEFHSMWQLLPAMQIAKALTPYQTFWHEDPIKMDSLSSLTRYAAVSPAPISASETLGSRWAFRDLLETGAAGVVMLDISWCGGLSEARKIASMAEAWHLPVAPHCTGPVVLCASTHLSLNAPNALVQESVRAFKTWYRDLVTALPEVKNGMITVPPGAGLGMELHPDIEKTFTVSRRFSDAASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase / muconate lactonizing enzyme family prot
publication title Crystal structure of an enolase (mandelate racemase subgroup, target EFI-502086) from Agrobacterium tumefaciens, with a succinimide residue, na and phosphate
rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 125
structure length 364
sequence length 400
ec nomenclature ec 5.1.2.-:
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4dxkA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4dxkA01
2XH2A 2OLAA 1IYXA 2O56A 2GGEA 2PGEA 3OP2A 3I6EA 3T9PA 1KKOA 2P3ZA 4J3ZA 3H12A 3CYJA 3VC5A 3DFHA 3R25A 3STPA 4IZGA 3T8QA 2QVHA 3DERA 3OPSA 3CXOA 3RR1A 2ONEA 3FYYA 3R11A 4E5TA 3TWAA 2OQYA 3N6HA 1R0MA 3P93A 4M6UA 1SJBA 3CAWA 1RVKA 2XH7A 2OO6A 5FJTA 2ZADA 3NXLA 2QGYA 3SN0A 1P48A 4DHGA 3DIPA 2AKZA 2QQ6A 3RO6A 3DFYA 3UCDA 4GISA 3JVAA 4DXKA 3KUMA 3JW7A 1FHUA 4E6MA 3RITA 3UJSA 3MZNA 3R10A 1MDLA 4EWJA 3TJ4A 1FHVA 1WUEA 3R1ZA 3GC2A 3VCCA 3MQTA 3Q4DA 1EC9A 2ZC8A 3UJFA 4GGHA 2XSXA 4FI4A 2OFJA 1TKKA 1OEPA 3QPEA 4DWDA 3N4FA 1P43A 2PTZA 3TTEA 3MSYA 3N4EA 3ES8A 3ZVIA 2DW6A 3BJSA 3FCPA 4IL2A 4H19A 2NQLA 3IK4A 3S47A 3UJ2A 4X2PA 3ES7A 3U4FA 3CK5A 2AL2B 4DX3A 3FJ4A 4GFIA 1PDYA 4F4RA 3OTRA 3ZVHB 4HPNA 4IL0A 2MUCA 4G8TA 4Z17A 2HXUA 2DW7A 3V5CA 7ENLA 4HCDA 3I4KA 5BOEA 2PGWA 3ZLHA 4JN7A 3UGVA 2PA6A 2HZGA 4IHCA 3T4WA 2MNRA 1NU5A 3SN4A 2PTXA 1KD0A 4HNCA 1ONEA 1WUFA 2AL2A 1E9IA 3TOYA 1JCTA 5FJPA 4KEMA 5FJOA 1TE6A 3MUCA 3TWBA 1SJCA 1JPDX 3UJRA 2PS2A 3D47A 5BOFA 4GIRA 3GY1A 3GD6A 3K1GA 3TW9A 1L8PA 1NELA 3RCYA 3QKEA 3NO1A 1MDRA 2XH0A 3TCSA 3SSZA 2OKTA 3P0WA 5ENLA 2P8CA 2P0IA 3DG7A 2PU1A 3B97A 2OVLA 4IT1A 5J04A 3IJLA 3ZLFA 1DTNA 1MUCA 2PPGA 1BKHA 2GGIA 3JZUA 3IJQA 2QDEA 4A35A 1EC8A 4ZA0A 4GYPC 3FV9A 3MWCA 3R0UA 3ENLA 2OPJA 2OZ3A 4M0XA 1ECQA 1TZZA 1R6WA 5EU9A 3DG3A 1ELSA 4GYPA 3EEZA 3CB3A 3PWIA 4GMEA 2OG9A 2OX4A 3OW1A 4E8GA 3RGTA 3MKCA 3VFCA 2PCEA 3H8AA 3V4BA 3IJIA 3VC6A 4FP1A 1XPYA 1XS2A 2HNEA 2P8BA 2PP0A 5FJUA 3UCCA 3R0KA 2XGZA 4KPLA 4HYRA 4A6GA 3QN3A 2FYMA 3P3BA 3N6JA 3UXLA 3OZMA 3VDGA 2POZA 2AL1A 2OZ8A 3DEQA 3UJEA 1KKRA 3NFUA 2QJNA 4HN8A 4K1WA 2PTYA 3ZVHA 2QDDA 3THUA 2P88A 3FXGA 3PWGA 1PDZA 3TQPA 3S5SA 3MY9A 4K2SA 2PTWA 4YWSA 2GSHA 2PU0A 3QTPA 1MRAA 3H7VA 3TJIA 2PP3A 2PP1A 4ROPA 2RDXA 4IP5A 4J1OA 1F9CA 3Q45A 1JDFA 3VA8A 2PSNA 4MGGA 1MNSA 4A3RA 4DN1A 2PODA 4MMWA 1W6TA 3H70A 3FVDA 4IP4A 3PK7A 4HNLA 3SN1A 3DESA 3EKGA 1SJAA 3BOXA 1KCZA 2QJJA 3BSMA 4E4FA 4HCLA 1SJDA 4H2HA 3I6TA 2CHRA 2QJMA 3OZYA 5FJRA 4Z1YA 3ZLGA 5IDZA 3PFRA 2GDQA 2FKPA 3U9IA 4JN8A 1JPMA 4H1ZA 3UXKA 3DG6A 2I5QA 3D46A 3VCNA 2HXTA 1BQGA 4H83A 4G7FA 3SQSA 2GGGA 4HCHA 3NZGA 2GGHA 3QLDA 4KWSA 4ZCWA 3GO2A 3SBFA 4ENLA 3DDMA 4GGBA 2OQHA 3V5FA 2GL5A 1EC7A 3CT2A 2XH4A 3T6CA 3HPFA 4MKSA 6ENLA 1EBHA 3DGBA 4DYEA 3SJNA 2OZTA 4E4UA 2PMQA 1YEYA 3V3WA 1EBGA 4KT2A 3RRAA 2AKMA 2GGJA 4JHMA 4K8GA
chains in the Genus database with same CATH superfamily
3WL0A 4C5ZA 1OCQA 4GXMA 1GVIA 2CIPA 4WDUA 2VGIA 4LX4A 4BF9A 4Q7IA 1ZJAA 5M2FX 1C7SA 1G5AA 1MW2A 4FNRA 3NQBA 4HTYA 1WO2A 4QRNA 3BC9A 1ONFA 3RN6A 3LGGA 3T8LA 4GCXA 1GZJA 3DK9A 4PRWA 5DBTA 1I0BA 4CU7A 3R79A 4B5XA 3T08A 2BOGX 3FYYA 1MUMA 2RFGA 1VAHA 1R0MA 5HUOA 4HB7A 2UY3A 4QHRA 2WOWA 1LZOA 4MDOA 1RVKA 4M80A 3EXRA 2HBXA 3ZIZA 2WHLA 3QMSA 4HNUA 2WPCA 2XVKA 3ABRA 3LRLA 5LIWX 1S2UA 5JH2A 2W3ZA 1ZS2A 2ZZ4A 5BRBA 4RNFA 2IXUA 1Q1WA 3C2FA 4C6MA 2AAMA 2HEJA 1K8XA 2YA1A 3Q4DA 4ACZB 3SDOA 1ZJIA 3MMWA 3F4VA 3QJAA 3E0WA 3N4FA 1LQ0A 2CFFA 2HQAA 4L4OA 4UXDA 1RH9A 4KCTA 1UWQA 4GO8A 1V77A 3CZLA 4WJ8A 1PXGA 3FCPA 2AMXA 1SR0A 4MLJA 3R07C 3GRIA 3IPWA 5FAJA 4RDYA 2ZX5A 1EEPA 2DP3A 3R94A 1NF7A 1G94A 3GG1A 1ICSA 1LRTA 1JYNA 4GFIA 4UQ9A 1G4EA 3ZVHB 1RBAA 5K7JA 1DJZA 2G4FA 1FECA 1ME8A 3S5ZA 4PUNA 4H4YA 3PTDA 3H26A 4XD3A 1C92A 1E0XA 5DY3A 4PMRA 4DJDC 1OZQA 3W1TA 3W1AA 1PZ1A 1VEPA 4JTUA 1YMYA 1ZBKA 2VR4A 4MB5A 3ZM8A 4XKYA 1JFHA 3KVJA 1V3LA 4CD4A 3U6WA 5KETA 2WHJA 4YYFA 1R7OA 4J27A 2BHZA 3E12A 3C0LA 4KGLA 3MBDA 4NF7A 5AYXA 4A4AA 4S3BA 1ZCOA 1STZA 3I65A 4JNMA 1G6CA 5HXMA 2EHHA 1KFWA 2NV9A 3LQLA 1PWLA 3F4NA 3GD6A 4PUJA 4P2VA 1X6LA 1AODA 4JN6A 4BZYA 3CWOX 5CJ5A 5CQ1A 5L6UA 2UY4A 3GXNA 3A13A 3L8KA 1GW1A 2WAGA 4DI8A 2E28A 2GPTA 2OOGA 3RMEA 1CGUA 3VOGA 3KBSA 3WF4A 1G4PA 1MMFA 3OHIA 4LALA 4NI8A 3UP8A 3UW6A 3PUEA 4Q4SA 2W54A 1SSDA 2CLLA 4WVXA 3O6AA 1S2TA 3VDCA 1XHGA 4H8HA 1Q6DA 4CQ9A 5AN7A 3VNYA 1KXQA 3VIHA 2ZRZA 1SM9A 5AKQA 4M1RA 1V02E 3WH8A 1E40A 3PTQA 4B5UA 4LNYA 5EU9A 3VDHA 3WH5A 4LYQA 5F2IA 4V28A 1OFAA 3PVFA 5HJXA 4IIFA 2V67A 2JALA 4MM1A 1EXPA 1NHRA 1V8EA 3EX2A 4J9JA 1GRBA 1UWTA 3GDBA 5I09A 4AD1A 1UWRA 2WVTA 5CC7A 3FY1A 1JGMA 1PJ9A 1UR4A 3UCCA 1N82A 4JX4A 2EG6A 1NDAA 1H7OA 4N42A 3QW3A 1GQJA 4B5SA 3UWVA 4UTJA 5FSDC 3KRZA 3N1AA 3NNTA 4L6HA 3EOOA 4TR9A 2PZ0A 3WO8A 3BCFA 2WLZA 1ONWA 1FA2A 2X7WA 3GHTA 3L5MA 3VKCA 1KKRA 2YYUA 3NFUA 3DC8A 1ME9A 4W86A 5DCBA 3GXFA 4DF1A 4K1WA 2PTYA 4AISA 2WNWA 2Y63A 4I3GA 1P6WA 2YB1A 3PUDA 3NSMA 3LZ5A 4BJHA 5HBFA 4JPGA 3MZ2A 3TQPA 4W7UA 4C6DA 3G0UA 1DIKA 4XZWA 4PZVA 4JXCA 4WJEA 4Z2HA 2B31A 2FZNA 3W73A 1U22A 8XIAA 5CC5A 1Q85A 2PSNA 3SUVA 3UWQA 1LUCB 2J6XA 2J4GA 4L80A 1BYBA 4X61A 4NZ5A 1EJTC 1XGDA 3PF3A 3BSMA 3QC3A 3WMBA 2F6UA 2GOUA 3W7DA 1PUDA 4G2DA 5FJRA 5IDZA 2ZKMX 2H3BA 3VX1A 4CD6A 4JICA 3ZWSA 3S1WA 3CUJA 4OGZA 1P5BA 3BPWA 2WOQA 2I5QA 5AOUA 3UT0A 2VZVA 2I9EA 1GYNA 5BXRA 4R34A 4NT0A 3L5LA 3GD4A 3WK1A 5A6SA 2E68A 3SQSA 4NJKA 4XD6A 3CBWA 3DI1A 3W1LA 3L4TA 2O7QA 4I9AA 4OJYA 2PDJA 3UR2A 3N2OA 2GQ9A 2X1TA 3W7LA 1GJPA 3TROA 3G1DA 5FA5A 1W91A 4Q4RA 3HPFA 2KAUC 7XIMA 1FDZA 3NZ1A 1AUSL 4Y7EA 1VDVA 1RJRA 1KW1A 2Z0IA 1E6RA 2YCEA 2YPIA 3LXBA 4RX0A 3SSJA 2DUZA 1KM1A 1Q6GA 2GJXA 3PFMA 4FNUA 2C0AA 2VRJA 4GNKB 2YLAA 1UKQA 2EPOA 2WB5A 1VPYA 3AALA 3I6EA 2ZE3A 4G6CA 3W22A 2IQTA 4AXKA 3SRHA 3TVAA 5K9DA 4OV9A 1UD3A 1H1NA 1Z48A 4RZ5A 3KL0A 2CZEA 3A4XA 4NILA 4MWAB 1YXYA 5IFTA 3UA3A 3VE7A 2CYGA 3A4WA 1KM2A 2BASA 2D2JA 2ACRA 3DBPA 4JIQA 4CEUC 1SVDA 1J2WA 2JKAA 5FF7A 3NVDA 1G0CA 7REQB 3VNJA 2VFIA 3N25A 1NSJA 3IJ6A 3SCTA 1CXFA 1X38A 4JCLA 3M6YA 4JL1A 1T3QC 1CIUA 1O5QA 5G1YA 4I5RA 3ABZA 4E6MA 3MZNA 2WNZA 5JCNA 3E74A 1OYCA 4NZ3A 3L0KA 1M41A 1E6QM 2A0NA 3A23A 5E0KA 4LUSB 3QM3A 1MVYA 3N3MA 1PTDA 4KWVA 1TZ9A 3HQ1A 1B0IA 3TQ0A 4LBRA 2TPSA 3GHUA 1P43A 2J3NA 3ZFHA 4C6CA 1DTUA 3TU9A 1OGBA 2Z2BA 3E6EA 2OYLA 6TAAA 4JTLA 4EPKA 3UJ2A 2CBIA 3MTWA 3CK5A 4GJJA 2AL2B 4DPQA 3WNNA 2A1YA 4UIOA 2J62A 5ABEA 3LSCA 3ALFA 4INFA 1NEYA 2V5CA 3Q58A 2NUWA 2VX5A 4B3LA 1E9YB 4EPEC 4ACZA 4PRTA 4QG6A 7ODCA 1A5SA 2J9XA 2FPTA 3CPGA 4W93A 2YGYA 5GNZA 3N29A 1JVNA 4HCDA 2I16A 5HWNA 3UGVA 1K9FA 3FG2P 5HNNA 4JTHA 3PZVA 4TMBA 2CERA 4IXXA 1OC5A 2YBUA 1GOKA 3SCSA 2DZBA 3EA3A 4Y6GA 5FF4A 3DYMA 4L6OA 4QAWA 1AL7A 1E6SM 1SO6A 1FP8A 1E71M 3OZPA 1H63A 3CQJA 4JQ9A 1OGSA 3FN9A 3E49A 1V0KA 3H54A 3BDKA 3PZOA 1F3EA 1WKDA 3SURA 1AJZA 1RQHA 4GBUA 1SJCA 2J8TA 3OYZA 4GZEA 3UY8A 3W38A 4Y2WA 3UG5A 3IIXA 2QR6A 3KOXA 3S2LA 1S5NA 3BG3A 1L2UA 4YL2A 1TYGA 4PMYA 3KEHA 1UD8A 1ML1A 4GG9A 5A2BA 3DYPA 1EWDA 2EJAA 2C19A 1S2CA 2X16A 4XVDA 1RVGA 1QK2A 4JOMA 2ZUTA 1SW7A 3LGDA 4GX9A 3C56A 3HGRA 3KOFA 1C90A 1U1JA 1RP9A 2EPLX 3RLVA 5AC5A 3T0DA 1BLIA 3G22A 2XDFA 4YNGA 4JFVA 4IPPA 1R7AA 3ZR4A 5G2WA 1KNWA 2XTKA 3QYSA 1TJRA 3E1F1 3W7CA 2WPFA 1EOKA 5F1UA 1D2KA 2A79A 4LEFA 1UOZA 1A4LA 3CASA 3GW3A 3URHA 4DJEC 4WSHA 3LCXA 3QY7A 3CUFA 1P6CA 1UHVA 1TR1A 3QGKC 1GG1A 2ACUA 2FPVA 3SUSA 3HFTA 3NL5A 4ZENA 2Y85A 1VBRA 3CB3A 4TUFA 2O9TA 2ZZ2A 3MDUA 2A3AA 2FDSA 1KC7A 3W7IA 3UFYA 3H55A 3SGZA 4ORMA 4L4PA 1BWKA 4KRTA 3GQYA 1Y8BA 3N19B 3RUBL 5C2XA 4MNJA 5G4HC 3B06A 3LHVA 4W87A 1N5WC 4MF4A 2NV1A 3EB2A 1IEQA 2YXOA 3UZJA 3GW0A 1W3LA 1BD0A 4AVOA 1RJQA 3V75A 3ARSA 1IZCA 1TVNA 3RK8A 2XGZA 1ZB5A 2W66A 4GYFA 2NWRA 3SCWA 5HMDA 3TTSA 1FHLA 2CLPA 4K39A 4TU1A 2QCHA 1XLFA 4JTRA 3N6JA 4LGXA 1L9WA 1WB0A 1UR0A 1PYFA 2EXOA 3IANA 3O15A 5AYYA 3MCMA 4GOAA 4FNQA 3WH7A 1GEQA 2YCJA 4EK7A 1CENA 5BWFA 3AYRA 1PKLA 5I3FA 3DHDA 3FA5A 2IPFA 1K7FA 4RW5A 1MRAA 1WOAA 2V0TA 1GK8A 3MV11 1MQPA 2RDXA 4NYYA 1CGTA 3Q45A 3AMZA 1LJYA 5C8BB 2GWNA 3W70A 1TCDA 1NHSA 1HQTA 1W6TA 2BP1A 2VEFA 2ZICA 4MJMA 1GYLA 3WDHA 3ITCA 1KCZA 4QR6A 3OHMB 3SQLA 1W2PA 1XV8A 2OSWA 3RX4A 2VHLA 4QE5A 2ZTJA 2WBKA 3HGSA 1ICPA 1EP2A 4H4TA 3QEZA 1NARA 4A22A 4UWMA 1C8VA 2R1LA 2RGLA 2NVKX 1UP2A 1VJSA 2VFFA 3SY8A 2C3ZA 5J5DA 4WRHA 4F2BA 3R5EA 1UZ4A 4JBRA 1W54A 4P61A 5I00A 1OFBA 3O1NA 3RMJA 1W3HA 3TC3A 1BQGA 3A64A 4XAPA 1JOAA 2W5FA 3MVTA 4MPQA 4MFDA 1LUCA 1LOQA 3NZGA 4YPJA 1QO5A 4IUGA 5KSWA 2GJRA 4ENLA 4GGBA 4PCPA 2CKSA 1QNVA 1NDYA 3TC7A 5FEXA 1H61A 3NM1A 5I78A 3RM9A 2RDWA 1E0TA 5JCLA 4EF8A 4XIMA 3N4AA 4A3HA 3G1AA 3QKZA 2QCMA 4LAZA 1EF2A 5I79A 3RXZA 1H49A 1QT1A 1E3XA 1ZHAA 3TW7A 5GRTA 1EWEA 2W27A 1TV5A 4D9PA 3A4AA 3WLQA 1F3XA 2PURA 3OP2A 1UUQA 1GVOA 4W89A 2XIOA 4LY8A 3LV5A 2DVXA 4FOKA 4LJ3A 1ZZMA 4JL2A 3A4JA 4IZGA 3T8QA 4CCEA 4ZOBA 1KFCA 2BLEA 1V93A 4PFMA 1R3WA 1XLMA 2A4AA 3AMCA 4GIEA 1E55A 4WX2A 1V7AA 2CKRA 3MW7A 1P48A 5CPNA 4N4PA 3QW4B 3W85A 1VF8A 3PTMA 1CXIA 1XG3A 4V1YA 1TJ0A 4AIOA 3UJSA 3W7QA 4YCOA 4EM4A 3ELFA 4MWAA 4PUUA 3B8VA 3IJ9A 4B9ZA 5H6HA 1EUNA 5AHNA 2Z4GA 1K4GA 4BI7A 3IK2A 3BAKA 7REQA 5FAGA 4CCDA 4C1NA 1LRNA 1HKVA 1E4IA 2INZA 4ZB5A 1VQTA 1VBUA 2XINA 1QPOA 1UBSA 5BXTA 1PCKA 3LK6A 5RUBA 1DL3A 1XLKA 2VJXA 4LUSA 2WMHA 3NL6A 3O06A 3NQFA 5JCKA 4BCEA 3F7JA 5A6LA 3I4KA 2YZ5A 1I2QA 3BQ5A 1I9CB 1HN1A 2X09A 4TX9A 1TVLA 2GJLA 3WLIA 3DFQA 4HHLA 4WDWA 2UBPC 1PO9A 3OBKA 5CG7A 1X1OA 1F5ZA 3W7NA 5SWUA 3GNPA 1PVNA 2DIKA 1DWGM 4PTWA 3B05A 2Q3RA 5I0DA 5CAKA 2AL2A 1JNEA 1UMLA 4N0RA 4C6FA 1Q6FA 3DI0A 1ZJHA 1FWJC 4MVAA 2BC0A 3C86A 3GSMA 4K8HA 3PB0A 3MCOA 1A5LC 2VFEA 1ONXA 1JRPA 4Q33A 1KRBC 5CC3A 1BXCA 1E43A 3PZGA 4LWWA 2FMNA 1S2WA 3GYEA 1KV8A 3R89A 1QNSA 1L8PA 4KS0A 5A8OA 2ATSA 2V3GA 3NO1A 2X1SA 3PJXA 1KTBA 4MY1A 9CGTA 2BXVA 3MANA 4KEZA 2E3ZA 2DUAA 3LXAA 1JF5A 2HQMA 4PMJA 4KH2A 1A5KC 4FB7A 5CZJA 2GUBA 2H3DA 3OLDA 3TLLA 1D8CA 4LVFA 7CGTA 4S2BA 3B8WA 1J01A 3GNOA 5I3GA 4O52A 4ATLA 4CD7A 4QG9A 1ECQA 3KTSA 3UZXA 4ADWA 2WVUA 1W9DM 2PDLA 1OJTA 6TIMA 2IKIA 2OG9A 4IQEA 1E9ZB 1CX9A 3MKCA 1XWYA 4XKMA 1AVAA 2BFGA 2IS7A 5DFAA 2OXNA 4LV4A 3W2MA 3C8NA 3VMPA 3VC6A 4R27A 2J8FA 4UOQA 3KP1A 3HMJG 6PTDA 3QBUA 5BCAA 5I06A 4UTWC 1N5XA 3A7RA 5FJUA 3WX7A 2Y7GA 3LEPA 1WNOA 1JROA 1EO5A 5AC6A 1B3XA 4NASA 3VD3A 3TAKA 1NOFA 1V3IA 1JD7A 2E40A 3W88A 3GG0A 2C71A 5AC4A 3QZ6A 1AMKA 4NZ4A 4NZJA 4UNIA 2GYIA 3T07A 3V5OA 1QBAA 2VZOA 5A8PA 1J79A 2A3HA 4YJ5A 3UEQA 3O6YX 3ATYA 1XP3A 3M0IA 1CNVA 2VX7A 2CETA 3BLIA 5DMYA 3P61A 5GQBA 4HK7A 4RNJA 3EDFA 1PCWA 1WKYA 1VBHA 3TXVA 2C6QA 2J7EA 3WJWA 4KBXA 4UTIA 4PCNA 2BVWA 2NZLA 3N2BA 4EQRA 1EYEA 1ZJBA 4LAKA 2BHUA 3PSWA 3I3DA 1BVWA 3A12A 4NSBA 3UD6A 1BVNP 5HOSA 2YVFA 3VOJA 3IAQA 5HA7A 3G6MA 3FYOA 3UVAA 4Q6JA 1K6AA 3DBNA 3K8KA 2VVSA 4Z1BA 4QTGA 2VCBA 3UPMA 1JEHA 3EA2A 4MYXA 1M1BA 1Q7QA 4P7OA 1E6PA 1PBGA 2J24A 4LUTB 2FTWA 1L6FA 2R1KA 2JGYA 3BO9A 1DQWA 2AMGA 4HU3A 2QXWA 3N2CA 1OK6A 1G69A 1X96A 3WSUA 3KCOA 4EP8C 1W5NA 2CPUA 1R8LA 4E4FA 4H4ZA 2YZRA 4D6HA 3QMRA 4Z1YA 2A3CA 1NAL1 2YDSA 3LBCA 5JRBA 3SUWA 5G1TA 1IZJA 3AC0A 5IFPA 2QF8A 2PFHA 3RM8A 3D46A 4ZQPA 3FIGA 1HVQA 1ZMDA 4ACYA 4RK8A 4IFOA 3W3OA 1NQ6A 2NW0A 5C7VA 4I6KA 4ZR8A 1UH2A 4ICMA 1ZFJA 1KRMA 2NWSA 2WHMA 1VGAA 2CLOA 3LBMA 2JQXA 2OQHA 3U48A 3NL3A 4I8DA 5CBIA 5FSEC 3BSHA 2A21A 4DXVA 4LXFA 1RPXA 3L21A 2OGJA 1B4EA 3AS0A 3GH5A 3HG2A 4A8RA 4CGTA 3LN3A 3TKFA 2CHOA 2EG7A 2PMQA 3VCRA 1DJWA 4A29A 3WJSA 3DKLA 5C5YA 2PE4A 1W1ZA 1EFZA 4L6DA 5LGXA 3BTNA 4ZOEA 1J96A 3URNA 4LPCA 1UKOA 3L5OA 1UJQA 4AB4A 3WF0A 3AAMA 1OABA 4HU4A 2J79A 3GBDA 1M9HA 2WYSA 1XFCA 2EAWA 4HYVA 4IMGA 3R6IA 3WUGA 4D71A 1ZP4A 1GVSA 4WR3A 4IPNB 4YTTA 3LBOA 4H01A 4DZHA 1K9EA 3GTFA 3SY1A 3ARPA 5C9RA 2WVSA 3MYPA 3RO6A 3GTNA 5AYBA 2VEGA 4GISA 1E72M 4W8BA 4LANA 3PG9A 3SCPA 4URIA 2HS6A 4DBDA 4Q7NA 1F4AA 4H4RA 3DH9A 4DM2A 1ZL1A 1Q6QA 1TELA 2A7PA 1FIQB 2XGBA 2W91A 5I3HA 3VOIA 2W0HA 3NDYA 4KETA 4YTQA 3TJXA 3AUOA 4FNTA 5D2VA 4EE9A 3TIMA 3BGGA 1GOWA 4XK2A 3U8GA 1RBLA 3NTYA 3B8DA 3BLPX 4P7RA 4E2BA 3V0UA 2Z27A 1DIEA 3VD9A 4JYDA 3T2PA 4MIMA 1DIOA 1E5NA 1QDSA 5T91A 2HVOA 1FCQA 4YTUA 3QYQA 2Y88A 4B2DA 1V51A 2VGBA 4LCQA 5HUPA 1UWAA 4G8TA 4BQ3A 3GNDA 2YL6A 1R46A 3KRSA 1O5XA 1WBJA 3WN6A 3B03A 2C1IA 1KTNA 1L8NA 2VQTA 1CCWB 2HROA 2JF6A 5CPQA 1FTXA 3WG6A 1KWGA 2QCNA 1MZRA 4DJDA 4I9MA 2EBNA 2O92A 3CZJA 1VFMA 3UG8A 3C2RA 4PB5A 3N9SA 3LHZA 1AH3A 4GUIA 3QFWA 1AH0A 2DH3A 5K9CA 1EYWA 1BYCA 4YMZA 3T42A 4O19A 1NM9A 1D7FA 5AYZA 2XN2A 3NDZA 2VD8A 4QLLA 1FFQA 4X63A 3W7OA 2WOIA 1Q45A 4MY8A 5BOFA 1DE6A 2V5KA 3KS6A 5FIPA 3UWWA 4J3WA 4F0KA 4MNLA 3NVVB 1FH8A 1CLVA 5EGRA 3SFWA 4QQ3A 4KKXA 1DV7A 1GKPA 2DJLA 1YIXA 2QNEA 2PDNA 4HD5A 2XVPA 4NP7A 1DHKA 4AD4A 3GBEA 1DTNA 1HF6A 2ZUVA 3O7UA 3NQEA 1H60A 5G5IA 1H7XA 4AD2A 1TUXA 4A3QA 4PTNA 3DU0A 5KEZA 2DSKA 3CZEA 2PRHA 4GYKA 4CCCA 4M0XA 1VFSA 3TSDA 1R6WA 2P10A 1XR2A 3BZGA 1YADA 5REQB 1S2AA 2D2HA 3VD5A 3QPZA 4IMDA 1X97A 2Z1XA 5I03A 3M0XA 4ZOAA 4IIBA 1DJYA 2QAPA 4P7NA 4GABA 1H41A 2Z7KA 2PUZA 4QXIA 1XPYA 3EMQA 9RUBA 3LPPA 2WXDM 3VMNA 1J93A 7PTDA 2EEXA 2GJNA 5LXXA 1V6UA 3CGBA 1XH2A 3HPSA 2BXZA 3GVGA 1XG4A 4J40A 1H7RA 1QHPA 5ABTA 3AHVA 1QI5A 2BGNE 4MTVA 4WGHA 2FZMA 1N2VA 1ITQA 1UWSA 2GUUA 3BANA 4BF7A 3LLXA 1WX0A 3QV8A 3PZNA 4S3DA 3EAOA 3G1YA 1UH4A 3M43A 1LL6A 4YVVA 1UR8A 4N4QA 5E9XA 3L2LA 5DELA 4CQBA 3MO4A 2V3FA 3C0JA 2O9PA 1A5NC 1NVMA 2PU0A 1VRXA 1R2RA 1UKSA 1V6YA 2J7FA 4HA1A 4Q7BA 3HQNA 2RDUA 2YLLA 4GVGA 4OFCA 2CLHA 1K7XA 2J6VA 1WAWA 2PF8A 2BDQA 1PKNA 5HQLA 3VZXA 4JFSA 1S5TA 3GFYA 4MMWA 1JI2A 1TTJA 1B3WA 3QH2A 2H90A 1JZ4A 4V15A 4KEVA 4DLMA 4NU7A 1SSGA 1N8FA 2CZFA 4N2YA 4QGCA 3SUTA 5CH9A 3I3BA 4FAMA 4JTFA 3UESA 3LLFA 4US5A 4YXGA 3QR0A 3GZAA 4H1ZA 3WUBA 2X2YA 3DG6A 2ICSA 4PUWA 5CC6A 1P1MA 2YA0A 3GR8A 4TVWA 4FNSA 3E9AA 1EGMA 3KM8A 3UYCA 5FMHA 1OIFA 1WDPA 1PZ2A 4O1CA 2AQOA 1UMYA 5K4XA 5DQPA 4LUTA 4BI5A 4GIYA 1TPUA 2FJUB 1SW3A 1TMHA 1QPRA 3TFXA 2L5HA 1XD0A 2WMIB 4QJ1A 4DB7A 4ZQMA 1OFEA 4PSPA 4G56A 3AJXA 2ZUWA 1S38A 2Z25A 3GX9A 3LGEA 1RSCA 4D6DA 1J0ZA 3SJNA 2ZX9A 3UXDA 4UNKA 4ZODA 4E4UA 1ZMCA 1YEYA 3AYVA 2QIWA 4L9XA 2V5BA 1S7MA 3KHJA 2CXEA 4W4QA 3T7VA 1NPXA 1F05A 4K8GA 2QV4A 3BCDA 4O0KA 2WMKA 2OLAA 3HGJA 4GBDA 1PZ0A 1XFBA 3IVTA 4F8XA 1VFTA 2R91A 2BNJA 5A6BA 3MJMA 2I5GA 5C9XA 4ZQOA 1DBTA 2FH8A 3HN3A 1EEXA 1P0NA 1A5OC 4MNKA 1CGXA 2OOFA 3RR1A 3TWAA 4QS6A 1BF6A 3UZWA 2G5WA 3KTXA 3CAWA 3B0UX 4C65A 3EMZA 3CZKA 4ICNA 1BXNA 4IMFA 3AI0A 4CNTA 5I7GA 4FX6M 1GERA 5D37A 3UA4A 3QPYA 1X8CA 3LI1A 4FZIA 2DDXA 1Q4NX 3IJDA 3TOPA 4E8DA 3GDKA 1MDLA 4QJ3B 3REQB 1WUEA 4OECA 4CQ8A 1XC6A 2FHBA 3VCCA 4C7DA 5A95A 4HNVA 1XKYA 2Y5SA 3CGCA 5E0CA 2ABBA 4AX6A 1WAUA 4WCJA 4HA3A 4XBJA 3UWUA 3MSYA 3O0KA 3ES8A 4V1XA 1JCLA 2C7FA 3OA3A 3T09A 1GEHA 5F1VA 3QR1A 2R82A 3EB4A 4OHQA 3K4AA 3RF9A 2XWDA 3CB8A 3U4FA 3EPNA 5JQ9A 4W84A 3C5QA 5IXEA 3OIHA 3LLDA 2QPUA 1UR9A 3PN8A 1VFUA 1US2A 4F0SA 4RV3A 4Q4QA 3WDIA 1QWKA 1B3ZA 4DO4A 3EYPA 2OEMA 4O57A 3WF3A 4NNAA 2YCIX 1H2JA 3V1PA 3M5VA 2V68A 4JEJA 2O7SA 5CJNA 3EOLA 2BMBA 2D3NA 3QLLA 3W29A 4BEQA 1NQKA 2ODOA 4GZIA 1H0GA 3ABOA 1HJQA 3RJYA 3QFEA 4KCVA 3NVTA 5J5RA 1MNZA 1W8GA 3BLKA 2CZ5A 2VCAA 3ITVA 2WQDA 3FJNA 4HKPA 4Z1AA 1UH3A 4ZE5A 4D6IA 3CEPA 4ZO8A 3WNLA 4O54A 3EOUA 2WKJA 1S5MA 3SR7A 2Z28A 1MO0A 4PB3A 1X8FA 4QP0A 4GQRA 2OEJA 2QJIA 4FHAA 3QVQA 1ESWA 1EP3A 3NQMA 4UMAA 4CVUA 1RQEA 3SM0A 2GQ8A 1V79A 3GNRA 3EGJA 1W1A1 2P76A 1DP0A 5T9CE 5A69A 1H4PA 3R8GA 4PL2A 1R87A 1TTIA 1WXZA 2OQLA 5LKYA 4NKCA 2GQWA 4D8ZA 4L56A 4EOUA 6XIAA 4EXBA 4PC8A 4A8IA 4GHRA 4AH7A 4O18A 1RQBA 3HA1A 3THAA 1KRCC 3QRHA 1LBLA 1H7WA 3HQOA 4QIUA 2V3EA 2PLCA 4ZA0A 3H2NA 4AZ7A 3GU2A 3CV1A 4GC3A 2J27A 1YPFA 1QI3A 2Y2WA 3G1XA 3KOZA 4LC6A 5BOOA 5TAOA 1V97A 3EDJA 1QAPA 5A1AA 2QGHA 2PCQA 3P62A 3R12A 4HMDA 2Q02A 3SRDA 3C2EA 2NUYA 1B3OA 1EPXA 4DJEA 1OF8A 3MUXA 3M4HA 3BW4A 2NXIA 1W9BM 1H50A 3WQPA 4UFLA 4CCZA 3N13A 3T2OA 3K4DA 2ZXBA 2AOSA 3YPIA 1ZAIA 3ARQA 1B1YA 1V6XA 3JUGA 4PGLA 4ZGYA 3KVLA 4HYRA 1ZUAX 1QHZA 5TQLA 2VVNA 1U30A 5D2XA 1S2VA 3UXLA 4YWIA 1OBAA 3QFBA 2VL4A 3DUGA 5REQA 3S5NA 2DSZA 5C0QA 4FXSA 2PDMA 1W31A 2XG9A 1HJWA 3LX9A 5D2YA 4X9SA 5D9NA 3CWNA 1UWIA 3THUA 3IGUA 2P88A 3SEPA 2V63A 5G2IA 3ERPA 2OSYA 2E4TA 1Z8AA 3A21A 4GLEA 1TPFA 2C18A 4QDPA 5FEPA 3GXPA 3IS4A 3SW6A 4XAZA 4YWSA 2HBVA 2GSHA 1M3UA 1LORA 2HVNA 3M0LA 3W71A 3VD7A 3G5EA 4ZOCA 2HDJA 3H7VA 3TJIA 2PP3A 4XTIA 2Y62A 1GKQA 4G7EB 4MGGA 1E73M 1OCBA 3FDGA 1RM6B 3VOCA 2Z7GA 4IP4A 2RUSA 1WBHA 4MKVA 4JIHA 3V35A 4XUYA 1TE1A 2G95A 4GXWA 3TA9A 1SJAA 3FLUA 1XBXA 3JR2A 4XSMA 2WOVA 2BGSA 5FS8A 4PA8A 3W1QA 5D38A 1XI3A 2BY3A 2OTDA 2H6RA 1W1YA 1QVBA 4DBWA 4RNHA 5I3DA 1UC5A 1UWUA 2E25A 3VIOA 1U5JA 3LHYA 3E5BA 3P5YA 3NO5A 2ZIDA 2HS8A 2ZUNA 5TNVA 4K38A 1TWDA 1XIEA 3B40A 4H6QA 4UZSA 2D0GA 3E38A 4JY9A 2R14A 4PEEA 4XBKA 4BV6A 2WHKA 1G7UA 3AWNA 3WDRA 2RGMA 3CT2A 3CQHA 5IBXC 2XH4A 2E9LA 2BOEX 3OBAA 4TOQA 3UZYA 5IOBA 1EF3A 1GEUA 1FVPA 1DJIA 4GCAA 4KF1A 3V3WA 3MPGA 2OR2A 3B8UA 4GI4A 2WANA 2JKEA 1DJHA 4ZB2A 4A3YA 3RPTA 2J77A 4WF7A 1RXOB 3M0ZA 2HV5A 2CITA 2PDKA 1GVFA 3P14A 3N9RA 2J75A 4J56A 1RV8A 2ZRXA 4CQAA 2WMFA 3CYJA 3W4RA 3VU2A 2A5HA 3ZJ8A 2RH9A 2WMIA 5LNWA 4RV8A 2E3TA 4JQ4A 3SRFA 5FEWA 2ONEA 2XHYA 3TQVA 3C4UA 1CI1A 4OV4A 2NSXA 3HIJA 1A3HA 4UCGA 5FJTA 2PBGA 4S3GA 5EA9A 3M0VA 1TCMA 4AXNA 2DT3A 4X0NA 1IV8A 3FKRA 5JBFA 3TA6A 1IXPA 1Q3NA 3DHFA 4DXKA 3APGA 2FB3A 4N02A 5I02A 3AROA 4I8YA 1CGYA 3KUMA 2V6AA 3JW7A 1TSIA 1WP6A 1FWDC 3W07A 2YFOA 4PH6A 1GOQA 3R1ZA 1TUFA 1I1XA 2E5DA 4LYRA 4IMAA 4Y9MA 4C6JA 1JRCA 3NS1B 1ISVA 5U25A 3LI0A 4K8EA 1J0JA 2XSXA 4JGDA 2YYTA 3WQOA 3CV7A 4JX5A 2PC8A 4B90A 4Q8TA 4UFHA 4AYSA 3V18A 3PJUA 1RPKA 2E1WA 4OT7A 3UU0A 4E2OA 4IL2A 1K4HA 1JZ6A 2ZZ7A 1XLDA 4X2PA 1TA3B 3LCWA 4DX3A 1U83A 4E0CA 3ARVA 4F0RA 3FDKA 2WMGA 3HTWA 3REQA 1XIJA 1UYQA 1I2OA 2SFPA 2YCKX 4OTKA 3DCPA 5ABGA 1WDQA 2GSEA 1FWWA 3PJTA 3M5XA 1Q8JA 3BG5A 3PTKA 5AC7A 2BODX 1TX0A 4OOUA 2MNRA 3BQ6A 3LPFA 2ZZ1A 3WQ4A 4N6FA 1VYSX 2YB4A 2GQ3A 1XICA 4UR8A 4R33A 1PKMA 3CT7A 3ALGA 3R7MA 4TMCA 2E5BA 4ONVA 1O94A 1UKPA 1LWHA 1DPMA 4A3UA 4CVWA 4H4QA 3GE7A 4MWAE 4N9DA 5HNUA 2ZA3A 3N34A 1JYXA 2DPEA 1S5VA 1K9TA 5F7UA 1FH7A 2PDHA 1YRRA 4ZZ9A 2B0MA 2GVJA 3IUHA 1M53A 5D2TA 3FNDA 1AA1B 2EQ6A 2Y8VA 2PWUA 2Q09A 2QPSA 1X2HA 4MG4A 1ZTVA 2OKTA 4LS0A 4B16A 4DZ5A 2XVNA 4LS1A 2WCSA 3AICA 4PR4A 5I2UA 2UY5A 2PC4A 4FO4A 1MZHA 3TYEA 2F5ZA 3UG3A 1R2TA 5AVNA 3SJ3A 3ZLFA 2ADAA 1GORA 1MUCA 2F61A 3JZUA 2CEQA 2ZUSA 4NAEB 4A35A 4S23A 4LA1A 1Z32X 5CZKA 1K3UA 4UTLA 4Z1CA 2FVLA 3K8LA 3RHGA 1GRHA 4M24A 1ELSA 2QIIA 1T5AA 1KLYA 4B4FA 4ZFMA 2DSUA 1GRTA 4CNSA 4AVFA 2FFCA 1LDCA 2UV8G 2J7GA 3COTA 1BSIA 3IJIA 3AZSA 5H2ZA 4Q8MA 3E02A 1GRFA 1ZKQA 3STCA 3JZEA 1B5TA 1ECEA 3CHFA 2B4GA 2YVGA 3S46A 5D2WA 2EO7A 1F8WA 3NYZA 1V03A 1ZDLA 4M52A 4UTWA 1KTCA 1AQFA 3W25A 2POZA 3QC0A 4DF2A 2AL1A 1NFBA 4D1IA 3EANA 3LMZA 4TTGA 3A3WA 3UJEA 2D69A 2PDPA 3U5YA 4TXEA 2R94A 3CGDA 4MPKA 1ONRA 2AGKA 3EBVA 3LMYA 3CXBA 1VCVA 2PWHA 3L12A 4JTCA 2QF7A 3H7RA 1KN0A 2Q8LA 2GQAA 3GR7A 2O4MA 2XVLA 2IMRA 4K2SA 2VRKA 3H2MA 1A4MA 2FZDA 3SCRA 4AEFA 1JXKA 3H2OA 1SU5A 5A6JA 1BAGA 1W5OA 3W37A 3W1MA 4RE2A 2X8CA 3OOQA 4UQDA 1KA9F 3G2GA 2PBOA 1K02A 4PEKA 3FHQA 3DC0A 2GK1A 1HFBA 4MZ1A 4WZHA 4CNNA 1XX1A 1GKRA 5JMUA 3UXIA 4KCWA 4UQCA 1C7TA 2ACSA 3BOXA 1HL8A 3LSBA 3ZS4A 3NZQA 1TVPA 1YTEA 3BZJA 3FEQA 4JDYA 5G5HB 3G18A 4IJCA 4E2DA 1XLEA 1CW2A 1KB3A 2E77A 1BG4A 4JN8A 5CPMA 3BGAA 2YJQA 4G1NA 1T8QA 2WSYA 1WXYA 4DWSD 2X0YA 4MLRA 4R85A 4ZO7A 4O1AA 3V7PA 4Q4KA 1HKIA 3VGFA 3L2IA 2XISA 1XISA 3WLPA 2R9RA 1Z41A 1TIWA 4M81A 5XIAA 1B30A 1R3TA 2GGGA 4QEEA 1Y7VA 4JIEA 2J9ZA 4KWSA 4JTEA 4ZCWA 3GDLA 3BXWA 2ATMA 3C0QA 4P5UA 5A3HA 1EJUC 1O7AA 3VNDA 1E70M 4FLQA 3T6CA 3EX1A 1VLWA 3TJLA 5IHRA 3MI6A 3VD4A 2VFGA 3KWXA 4GH1A 4M3PA 3MHUA 3UETA 4QX4A 4OUIA 5FS6A 1HGYA 3CZ8A 3RX2A 4LVBA 4ERGA 2GGEA 4W88A 1YPXA 5CXPA 5I24A 3CMGA 3WBYA 4J3ZA 1GESA 4FR6A 3W2NA 3ME3A 1MXSA 4E5TA 4TVCA 2C14A 4M19A 3W7HA 3M5ZA 3BMXA 4OQVA 2DY3A 1ISWA 5T9BG 4ADSA 2GZXA 3H23A 3NXLA 1AW2A 3AQUA 2QGYA 4R7WA 1FKXA 1RHCA 2DZUA 3RU6A 1HP5A 4M82A 3H53A 3WF2A 5M5DA 4L4LA 1ZNNA 4KW2A 1I75A 2ZZ0A 3NO3A 3O0HA 3M7WA 3TUUA 1FHUA 3SZ8A 1KM5A 2BX7A 3R10A 1LLOA 4FIQA 1FHVA 4G5DA 3HU7A 2OO0A 4AY1A 1PS9A 2FFIA 3DFTA 5LIYX 1NOWA 3APTA 3RG6A 1EKOA 2ISDA 4NEVA 4I7UA 4UOZA 4YVPA 4XZHA 2RKXA 4GVIA 2CFYA 4UB9A 5GPRA 1UZ1A 3P81A 4H9YA 3RR4A 5E70A 1V6TA 3WEZA 3KL5A 1TWWA 1Z89A 3KBVA 1EPVA 1GZ1A 4KFNA 3W01A 1J18A 4JS3A 3M47A 2PDQA 5A6TC 1F3WA 3E0IA 1J0HA 1EJXC 3B9NA 1UIOA 4QLJA 3DJJA 2PEVA 1XIDA 5LNUA 2NX3A 2V9DA 2Z1WA 2WP6A 3O0FA 3O9NA 3TZNA 2V2CA 3BJFA 3E96A 3LB0A 3V36A 3TE9A 2DZAA 2DVUA 5A6MA 1WXJA 4U5KA 1GPWA 1IWPA 1LBMA 3EXTA 2ZVIA 2VMFA 1E4NA 3UF9A 1W1VA 3WLJA 4UTMA 1VBGA 4FXRA 1TA3A 1X39A 1AZ2A 3DHPA 4MUZA 4K6AA 4GQBA 4U3CA 1JCTA 4HHHA 2D1ZA 4K7VA 1EL3A 4DJED 4NZFA 4GPNA 4QLKA 3LNMA 1SR9A 1DWAM 1ITCA 5T26A 1OC7A 4IGMA 1R9YA 6CGTA 3Q6JA 4XAGA 4YLWA 3ETRB 4TO8A 1LTDA 1M7XA 2I5IA 2PS2A 3GU1A 4NXKA 1F3PA 3GYCA 4GIRA 3LADA 4HIBA 4PMZA 4BK9A 1IGSA 3IV8A 2DZXA 4DBUA 1XH1A 3ZJ6A 1JZ5A 1MDRA 1B2YA 3MYOA 3BAJA 3OO2A 1TWZA 3P0WA 3SRKA 1J11A 3TNBA 1W9UA 1XIBA 3GNXA 5FI8A 5HAOA 2EPMX 3BW2A 2OVLA 2Y4SA 3VFLA 1EDGA 4C91A 3W6MA 2JK2A 5EMUA 1KR1A 3S9ZA 1SFTA 3PPHA 1O95A 3PAOA 2DT0A 1BYAA 4XBSA 4EPDC 3A3XA 2QCCA 4DLFA 1RALA 4S3JA 2WJEA 1FWRA 3GVRA 3DG3A 3OVGA 3QV7A 1VLIA 2ZUUA 2FB2A 4ZO6A 2PDGA 1HJUA 3PWIA 3W23A 1BQCA 3EKLA 3MJYA 8RUCA 4DUWA 1SGJA 4OBRA 3CPRA 2Y1HA 4NQ1A 1T96A 2CBVA 4RL3A 1CYGA 4EACA 1N7KA 1ENUA 3G1RA 2HNEA 1V02A 4FXFA 3T0CA 4DO7A 3ZXWA 3LTYA 4IFKB 4NAEA 1SQ7A 4XQ6A 2Z1KA 1XYBA 3QN3A 3SECA 3L65A 3ZT7A 3VDGA 1G4TA 4FDCB 2VC6A 5BMXA 3RU8X 4B92A 1K8YA 5LA1A 2XIIA 2XSBA 5XINA 2QJNA 1QJWA 4EQXA 1JPHA 3LENA 4DXXA 4YVXA 4H9VA 4GRTA 3U7BA 3LCHA 4H4XA 3TN6A 2J7HA 3M0MA 2IUZA 4K68A 1R9ZA 3TONA 4U4MA 1Q4WA 2ZX8A 3STFA 1PKYA 3F2DA 4WEVX 5EYWA 4C6PA 5DRIA 1LWIA 5IM51 3AMLA 1XLJA 3ZR6A 4PN2A 4HOZA 3JRKA 1J5SA 1RA5A 1QHOA 2F7FA 2PP1A 3PAJA 4GD0A 1H1ZA 1P1XA 1DWJM 1MNSA 3CH0A 3KE0A 4IGHA 1FO4A 3IGSA 1WQ5A 2J7CA 4EPBC 1PE1A 2C79A 3O16A 1XHCA 3MKVA 2OJPA 3DGZA 3B0YA 2QJJA 4XO6A 4XZBA 3TP4A 2QZRA 1H7PA 1HGWA 3AM9A 1FQ0A 2OEKA 1R85A 3W82A 1L6GA 1Q2RA 4UZUA 4NZ1A 3AIUA 5GNXA 3UXAA 3LUTA 1I45A 3NOYA 4FLOA 1SZEA 4WXZA 3D3AA 4UR9A 4M6PA 1GOIA 4GX8A 2NUXA 4H83A 4IICA 3FX4A 1J6OA 4G7FA 1RLDA 1VRDA 3V5FA 4JX6A 3AISA 3W2LA 4Y96A 1KFBA 2V3BA 4GUGA 1KQZA 4MKSA 4TVDA 1DQUA 3G8EA 3GD3A 3W1RA 4WY0F 1MEWA 3LZ3A 4BWLC 4BI6A 3I3EA 5CBJA 3C3UA 2A6LA 2OYKA 1F8IA 3ZWTA 3W87A 3OG3A 4L9YA 3MMDA 4CNUA 3ITXA 2WC7A 2Y6ZA 2BWGA 3NQGA 4D6GA 4GY7A 1J6PA 1AD1A 1F8MA 4JFUA 4MJ4A 3DJGX 2PGEA 2HISA 3NVYB 1WE5A 4DJFD 3PPCA 2ZA1A 4GJIA 1IR1A 2I1OA 2P3ZA 4JFWA 3MHFA 3R25A 1EQCA 1TR9A 3FAWA 1U5HA 2QVHA 2B7OA 1X98A 4M1BA 1SO3A 1DJGA 4XUGA 1HT6A 2V5LA 4QITA 2ZCGA 2XH7A 4Y8FA 1B9BA 4O0ZA 1VP5A 4H4VA 1P0KA 4V27A 1YQZA 1IT8A 2QQ6A 2BTMA 3SO7A 4AMAA 1VFFA 1VEOA 1DWFM 5HMSA 2ZFAA 1VJZA 3VZZA 1JG9A 2HJPA 4R53A 4H9XA 5AFDA 4J2PA 2I56A 4HSHA 3KHDA 4QEHA 4O10A 2JFEX 4H4WA 4LUJA 1EC9A 1ME7A 1N61C 4AU0A 4UR7A 4JQ1A 3KCLA 1OEPA 3NJ3A 3PBGA 3MUY1 3FVMA 3O05A 3W6LA 5CZ0A 1E0VA 3N14A 3ZVIA 1JL8A 3OGSA 1KXTA 5HMFA 1TQXA 4PODA 2WW5A 1PPIA 1XRSA 4DAFA 2BY2A 1NIUA 4GR1A 1EJRC 2Y7EA 3CGEA 2ZUMA 4B5VA 3U2CA 5M3WA 4HNTA 2G4JA 1TG7A 3HF3A 3MV01 1XL9A 1UCWA 3V5CA 3ANUA 3WUFA 4IIEA 3ABXA 1JCMP 2C13A 2HPIA 5DEZA 3ZLHA 3EF6A 4H6EA 2VO5A 3B9EA 2GSJA 4DBEA 4Q8NA 3B8IA 1KFKA 2KX9A 3CTLA 4MB1A 1OFDA 5GJMA 3S2NA 7A3HA 4UTTC 1E9IA 3TOYA 1JZ7A 1SFLA 4IGNA 2XJ7A 3N9KA 1AQ0A 1OJXA 6XIMA 4NNCA 3LDVA 1E56A 2REQA 3I10A 1RCQA 4PCFA 3NG3A 4US6A 1F3TA 3RDKA 3TV8A 4AHOA 2Y8UA 3D47A 3DOPA 2Q3OA 3GG8A 4LYPA 3E2VA 4JIPA 4AZIA 4H04A 1NELA 1XSJA 5IHSA 1TV4A 3P7YA 1UR2A 1TYTA 1KBJA 4Y9OA 4YHGA 2VX6A 3NGFA 2C91A 4QE1A 5DF0A 3OA5A 5C9ZA 2DZPA 3E5PA 5U7SA 1VCGA 3GVQA 4DBSA 3MDWA 2QMJA 2RHGA 4XSLA 2H9AB 2VOTA 3T4CA 1J8VA 4OVXA 5HK4A 3IJQA 4HZ8A 4PMOA 1TPEA 1BVZA 2P1FA 3H4XA 3T55A 3NURA 4WHBA 4Q4OA 4NNBA 5FJJA 1LP6A 3W75A 2OX4A 4O12A 1XLHA 3ZT5A 3C3NA 1U1HA 3S6OA 1PL9A 1FFVC 4LB4A 1YX1A 3IUDA 4IQDA 3S9YA 3MUAA 5C2CA 2PWEA 4GKLA 3LRKA 3GU9A 3C8FA 2H8ZA 3NQ7A 2A7NA 2WKGA 3VXGA 1EBDA 3QXBA 3PZTA 4NZCA 3FJLA 2TRSA 3POHA 3M0KA 4O53A 5DANA 3M64A 3SCUA 3AXXA 8CGTA 1N60C 2EQ8A 1WV2A 1T99A 4NX5A 3NQDA 3PZ9A 2YDQA 4U2YA 2OSXA 3EEGA 4RZ4A 3S5OA 4IFKA 2TSYA 1WKFA 5KVHA 1A5AA 1CGVA 1FRBA 3MWAA 2XZ7A 4LT9A 4C1NB 1N8WA 4C6QA 4HK5A 3VKJA 1D8WA 3HZ3A 3TYUA 1X6NA 2BB0A 4AW7A 3IARA 3HW2A 1D9EA 2AQWA 3BAYA 1J2BA 3VIFA 4S1FA 3ITTA 4XISA 4HCLA 2IW0A 2CZVA 4H2HA 2PDCA 3UR5A 5GVJA 3DHUA 4UMCA 1Q13A 3WDPP 2C1HA 3D0CA 4JTDA 4BQ2A 4J3VA 2GDQA 4J35A 2EQ7A 3RCMA 2OELA 1OFQA 1JPMA 4LF1A 2VM8A 3A7UA 1R30A 1UJPA 5TIMA 1HUVA 4H2CA 4NX0A 4XZMX 3G77A 4PYSA 4APNA 1XLAA 1X1ZA 2XFRA 3EWXA 2WNQA 4RLIA 5DT5A 4FOJA 1KXHA 5XIMA 3SBFA 3NQ6A 3AHTA 2EPHA 3VOHA 1UB3A 3OZOA 1CB2A 3H7UA 4JAWA 3GUWA 4Q8UA 5J8LA 3L23A 3FAXA 3NPWA 3EA1A 1XC4A 4PTDA 5IBXA 5HULA 1M6IA 1XIFA 4NJJA 1D3HA 3PP7A 3U3HA 5LHEA 2VKZG 3WH9A 4RDWA 4AZCB 4HHMA 1XM3A 3GXIA 2G3FA 1S1PA 1JQVA 1KLZA 4H4IA 1LOSA 4MSSA 4AX7A 3G1SA 2GJPA 5C6MA 4KESA 1NWSA 1L0PA 2ZZ5A 3AZTA 5G2HA 3WFLA 3NPXA 2W61A 5KVIA 4H4PA 4CU8A 3GH4A 2GH5A 3DERA 4XAFA 2D2OA 3IEBA 4AFYA 3W1XA 5D9OA 3GXDA 3AXKA 4M6UA 5A6KA 5FESA 1IXNA 3NPVA 4IM4A 3T40A 2YBTA 3UNDA 1TPB1 4EQWA 3F5KA 4D6JA 3EWCA 2X99A 3ATZA 1XDLA 4EMIA 3DIPA 3U57A 2AKZA 4DI9A 3CU2A 4UFIA 3TCEA 5E6ZA 5FD0A 3FSUA 4ZMGA 3G3MA 1UPMB 3WQEA 1ZBWA 1WZKA 1F6PA 2OZ0A 5LIUX 3I7QA 1MRQA 4GE8A 4TVUA 3UY7A 1WDWA 4UC5A 4AQLA 3FXYA 4FALA 2WSQA 4RE4A 1E6ZA 4AC1X 3DN5A 1I6NA 3BUVA 4EM3A 2WJFA 1QNQA 4IOTA 1MFVA 2MANA 3PBYA 1FDYA 1BPLB 6REQB 3CL6A 1FKWA 3KWSA 1XF0A 3BJSA 2FGBA 2G3JA 1BSLA 3M1ZA 2TMDA 2ZYFA 4TVYA 3VK5A 1S39A 4XZIA 4QNEA 4U2ZA 3ES7A 1Q6EA 2QUVA 1V0NA 4OWGA 3PNUA 2WBGA 3WDQA 4GZJA 5D8ZA 1W3IA 1XIMA 1FWCC 2JIWA 1Q63A 1XCXA 4BEUA 3U2ZA 5CBBA 4E4PA 5D9PA 2FTPA 1BWLA 3OTRA 1ZY8A 1ZQ5A 4D8AA 1EO7A 3FW6A 3PBVA 4E3TA 5FOOA 3H6OA 1TTQA 2XIMA 1XPGA 4FEZA 1OZMA 4C6LA 4NAFB 1CXEA 3W72A 1ZRQA 4KWUA 1E4MM 1UA7A 4IF2A 2R1PA 3B9JB 3RILA 5HNRA 4HHPA 4J3XA 3SN4A 2WV8A 2GR2A 1AW1A 3H4KA 4I5UA 2V3DA 2X40A 4ADTA 1OT1A 1EHAA 4LOCA 1WZAA 1QI4A 3IAPA 5D03A 3TWBA 2PWFA 3OLGA 4TX6A 3PUGA 8TIMA 3LB8A 4H9MA 1EDQA 4X0VA 4DYJA 3RFAA 4YN5A 4JR5A 3WDJA 5A2CA 3GY1A 2VNCA 3L0GA 4MZ8A 3TW9A 4HN4A 2VOMA 3A5VA 2GVGA 2YVJA 3GTIA 3OBEA 1WDSA 4HNNA 1D7KA 4H8UA 2E6FA 5L9FA 2CC0A 1WDRA 4O28A 3L5AA 5D4YA 4UFKA 1NWTA 3B97A 3UBPC 2VTFA 4DQWA 2ZWZA 3TTYA 1VQZA 1BRLB 4BY3A 3CYVA 4ATWA 2GGIA 3VOFA 3QHMA 4O8AA 4OE7A 1QW8A 3DFNA 1CXHA 2QLYA 3F5JA 5TBOA 1P0BA 3BAWA 2FZ9A 5LSMA 2OODA 1VJIA 3Q2DA 3WLHA 4AWSA 1V3MA 1Y5WA 3VNKA 1VCFA 3TN4A 2VR2A 5K4ZA 5CGTA 3LM7A 1YNPA 4LB3A 3LYEA 1U1UA 2F84A 1XKJA 3L4VA 5HATA 2BXYA 4XG1A 4N6EA 4Z2IA 4M5PA 2H9AA 3IACA 2OKOA 4REQB 1BGAA 1OY0A 5FKYA 3L4XA 3QSRA 3HJZA 3MMTA 4J57A 3TH6A 2ASHA 5A8MA 4A6GA 2C8NA 1RJPA 3USBA 3GHRA 2V69A 4HJWA 2W79A 4WDXA 4Y9NA 1I2NA 5AVHA 2Y0FA 3NGJA 3WLTA 2YDAA 1FFRA 1A80A 4NVTA 3AMKA 1PHWA 3ICJA 2LLEA 2WJDA 1ZP3A 2GLKA 4AWTA 1SO5A 5LNRA 3KBMA 1OC6A 3PWGA 2OB3A 3W83A 4GJ1A 2Z24A 4GZ7A 1MOKA 2QS8A 5BXPA 4RXGA 4FX7A 4GNJA 4ASTA 1K8CA 2JBMA 4IGSA 2PD5A 5DMLA 2YA2A 2VGFA 1O5KA 1QXLA 1GPFA 3FKKA 1FX6A 1I1WA 4QG8A 3F4CA 5LZLA 4IP5A 4J1OA 4WUIA 4J5NA 4Q8QA 1R3VA 3HJEA 3EWZA 1LG2A 3AIQA 3H70A 1J5TA 5FEZA 1YKWA 4HNLA 1N8IA 4NJIA 2FHCA 2X8HA 4AY7A 3P80A 3H4WA 3K4WA 5JCIA 3ITOA 4ZL1A 3AS1A 2HVMA 3RJXA 3OQEA 4PCSA 3MB9A 4MDPA 1AJ2A 3TYDA 4AC7C 3QTGA 3UR7A 1LCOA 5CLWA 3BE7A 4AD0A 1M5WA 3LG3A 2CW6A 4PMDA 1E4LA 2WLYA 4M6VA 4G1KA 4L7ZA 2FGLA 3WQVA 2VRQA 4BS0A 2CNCA 3HV9A 3NZPA 1P7TB 2W9MA 1UZHA 3BOFA 4JIRA 3GO2A 3GLCA 1Q8AA 4PB4A 5MHBA 1EC7A 3DZ1A 2PDUA 4GK8A 3CL7A 4EXAA 4EF9A 5F4XA 3W7RA 2PF0A 4ZSTA 4S3CA 3R4IA 1KBLA 3KRBA 3EWUA 4IJBA 5HR6A 2YDRA 4KT2A 5DCEA 1LL4A 3IIOA 1B90A 3CLMA 1QO2A 2PWDA 3NR0A 1VIZA 4AZBA 4WKAA 2B81A 2GWGA 2DV0A 1CB7B 4JTIA 5GJPA 3PZUA 3H12A 4S3KA 5HMEA 1XGZA 3T0BA 1HKWA 4WSKA 2PDYA 4F9DA 3OODA 3N17A 4ZB0A 3KL3A 4GUHA 3R11A 2DUXA 1FWEC 3N6HA 1VYPX 4RPPA 3KW3A 4UTFA 5KZEA 1SPQA 3M44A 4AZCA 3L66A 3R13A 4I9TA 5EMYA 4HPXA 1T8XA 1AQHA 1Q7MA 2XZ9A 2OCZA 2WJZA 3LPOA 1KQYA 2RAGA 5LXEA 1KM4A 1BTCA 1W9VA 3VIGA 1F4HA 4FIRA 3WD0A 4QAIA 5C7HA 1BKSA 1OADA 1Q6OA 3AO0A 3WQGA 3OGVA 2ZXDA 2WMJA 3S4TA 2ISWA 4Q22A 1W5MA 4GXPA 3L0NA 2OWWA 1YDNA 2G37A 3CAVA 1K70A 1F76A 1K6WA 2NQLA 4GUJA 1Q2SA 1NTHA 2VEIA 1IIGA 3LCFA 3WLNA 1BG9A 3GS6A 3NVZB 4R3UA 4W8AA 2MUCA 3PG8A 2PGFA 2PWGA 4C6EA 5EMLA 4Z0SA 4Z2JA 3GKFA 4F0LA 4RXFA 2UZ9A 2ISVA 2PDIA 5ABHA 1JULA 1XLGA 4JHOA 5FCZA 3ARUA 4Z0JA 3ARTA 6REQA 4AMCA 2BBFA 4HZ6A 1VB9A 1E9LA 1NY1A 3IIZA 3LRMA 4IPJA 1REQA 3XINA 1EX5A 2X30A 1B54A 1DJXA 1MI3A 1LT8A 3MVIA 4XX6A 2ANUA 1ONEA 5K3VA 4JTGA 4QDWA 3RLGA 3PBUA 2DFAA 4MKNA 1AW5A 2NLIA 1KM0A 1VFHA 3EB3A 5BYWA 2JK6A 4RR4A 1W5PA 1JRBA 1R3RA 3DH7A 1V6WA 3LERA 3UJRA 5A2AA 1HJXA 3B9DA 1PYMA 1WKEA 4NAFA 2CLMA 1W1IE 3M6DA 4X9YA 2E6AA 3L4UA 4AZ6A 1XJBA 2G3NA 3UG4A 5I3JA 3QKEA 3S2CA 2RJHA 2Q6ZA 4H8VA 4LNCA 1RR2A 1XRFA 4LS2A 5CAHA 3IRDA 3QFAA 1ALDA 1JPIA 2A8XA 3A5FA 3CPUA 4AZ5A 3QHNA 4W7VA 1VEMA 1PX3A 4I5XA 1KXVA 1B57A 5J04A 5CLTA 3V1HA 1UD2A 1XDJA 1GSNA 3TAOA 4F0HA 4C1KA 3VGGA 2PRLA 1KM6A 1LQAA 1BGGA 1V6VA 3KLKA 4GYPC 5KITA 3IJ7A 3G0SA 2CHNA 2VXNA 4DO6A 6A3HA 1QPQA 1TYPA 3TYAA 2QCEA 5E5CA 4F40A 4L64A 3I4EA 3KS5A 1U5VA 2BVYA 2Z1BA 2XU2A 4HBKA 4WOZA 4PMUA 5EBAA 2INEA 1FH9A 1SMAA 1JUEA 4LIIA 4IIGA 1CTNA 2PCEA 4S2CA 5KZMA 3II1A 3CTTA 4IPIA 2HTMA 1BRLA 1EJ7L 2EQ9A 2QJGA 2XN0A 4WGXA 2J74A 3BH4A 2Y5EA 3J7HA 3R43A 3HURA 4QS5A 1SB3B 4A21A 1Z44A 4H7ZA 1A53A 3TW6A 2E8YA 3GZ3A 2D20A 1V08A 4JTTA 5F2MA 1TPVA 3VIIA 4AEEA 4K8DA 1QU4A 3MSRA 4U33A 6ALDA 3M0YA 3N15A 1S5WA 4ZE4A 3SY5A 2O4QA 2V2DA 4DAIA 1UD4A 4GA8A 5AB3A 3FXGA 5ABFB 1WZLA 2ZRWA 3DKJA 4LUIA 1BHGA 1F73A 4WOQA 4TV6A 3S5SA 3MY9A 1H0IA 1W1TA 3VNLA 3WY1A 1TO3A 2F38A 3CHEA 3DECA 1GONA 3D6NA 5E1QA 4REQA 1NDVA 2X1IA 2X8GA 5I3IA 5I3KA 5MKGB 1OFPA 4Y8EA 2PWVA 3BWWA 4I9JA 5D02A 4JCMA 2RJGA 5BROA 3NWRA 5D04C 3A9BA 4GVFA 4BR1A 3C61A 3VM5A 3CUIA 1UZDA 4A3RA 1EXBA 2PODA 1HP4A 2IPJA 2WO5A 4XIAA 4OOZA 1YHTA 3U4AA 1R9XA 1HO1A 3D5HA 3UWZA 5C9WA 4IPLA 2QHAA 4EQSA 4AHQA 3OZYA 4F48A 4QDMA 3GTXA 4A05A 3S6TA 1JDAA 1GVYA 2YW4A 1K4QA 4C6KA 3VCNA 3WYZA 1DXIA 2PI6A 3CUHA 1PIIA 2X2GA 3TEVA 5LHFA 4X3ZA 2PTDA 2BV9A 5TF0A 3UWEA 2CU0A 5DRCA 1M7JA 2Y8KA 2G50A 3KTCA 3QLDA 2EPNA 1J12A 3VIPA 4D2JA 2FZ8A 3O2LA 1G4SA 1EJVC 5KMYA 1MEIA 2OU4A 1UBPC 3KZSA 1F6KA 5H8UA 1WOBA 3QZAA 4KFOA 2FVKA 3GRSA 4DYEA 3NQ2A 3S3GA 1F61A 4D6EA 1IHIA 4KRZA 5G4EA 1OQFA 1WCGA 4UUIA 1A5BA 2O9RA 4HPHA 2F8QA 4BWLA 1N55A 1ADSA 2BVTA 2OWXA 1GQNA 1P7TA 1KKOA 1RBOB 1MQQA 2EKGA 1XLLA 3GC5A 2WZMA 4GNVA 2X0SA 1V0MA 3HB9A 3INPA 5FF2A 3LCLA 2E9MA 2CLEA 8A3HA 3G0XA 2E5AA 2J13A 3OPSA 3N2XA 4UBPC 4CQDA 3M5YA 3F4DA 2X1UA 1W8SA 1XYAA 2QUNA 4J7RA 4ZXOA 1MO9A 1AJ0A 1DQXA 2H8XA 2YKKA 3ECQA 1JQXA 1FCUA 3VPLA 1UP3A 3W81A 5D05A 4QFUA 3ARYA 4YWOA 3GC2A 4CEXC 2WCAA 4HMNA 2ZC1A 3WMCA 4MYAA 1J0KA 3FGCB 4HA0A 4JKKA 3U5UA 4XV0A 3WD1A 2ZXQA 3IRSA 3THQA 4J3SA 3WBXA 3QPEA 3B04A 4B3ZA 3FS2A 2FZBA 4WXYA 2DW6A 1XYLA 2VCCA 1B31A 1XQLA 3CL8A 4O0QA 3IK4A 3KDNA 1OIMA 3OLIA 3VNIA 1KBKA 1KCKA 1MFUA 4UCFA 4H41A 2R24A 3QY6A 1UPPA 4KWWA 3ARWA 5G4WA 2B7QA 1P4CA 7TAAA 3FHAA 3NXFA 1FWGC 1ZY9A 3NOEA 2Z6JA 3B9AA 4F4RA 1THFD 7TIMA 1UC4A 3G8RA 1O12A 1GVQA 4DF0A 3QGVA 3IJ8A 4DIAA 2NVDA 3VGDA 2X1RA 4ZFCA 4FR1A 1VENA 2EGZA 2Z2AA 4JYEA 3S42A 3WLKX 3DXIA 3NAVA 3E2SA 4C7FA 4ICCX 5ECUA 2YXXA 3THCA 3EWBX 1EIBA 2AGTA 2Z6IA 1V5XA 4MAVA 3GXTA 5A8NA 3O3RA 1OT2A 1OYAA 5GNYA 4DWSC 2G8ZA 4PBEA 1TE6A 2XGIA 3MUCA 2PD9A 1ZCCA 4IUOA 5BMWA 2VX4A 4UTTA 2G3IA 3W7MA 4N9BA 1YBQB 3BSGA 1IWBA 4DY1A 4UQAA 3NZRA 3L2MA 1KV5A 3ANYA 1KGUA 5JBEA 1K7EA 4UTUA 3GB6A 4UNLA 1HXJA 3NCOA 2XH0A 3NA8A 1PZ3A 1TRIA 3MCNA 4B9YA 1BTMA 2GVEA 1R47A 2IPGA 3C2VA 1HL2A 3L4ZA 2ZDSA 3H2CA 4OBSA 3CMFA 1RZMA 3HQPA 1Z42A 3HPZA 2FH6A 1H62A 2Q8XA 1HKJA 4EIVA 1UIPA 1FEAA 2EPKX 1OF6A 2QPXA 4LVGA 1BKHA 5HNTA 2WP5A 1EGZA 4AF0B 3WJXA 4F2TA 1PEZA 2YL5A 5C2GA 4AWUA 3FV9A 1JDCA 3FA3A 3BCJA 4B5NA 3PJWA 1IE7C 4P8UA 4YIWA 3WL1A 4PULA 3C0SA 1X1NA 3LOTA 3OW1A 4PTXA 3AIBA 1H09A 2VURA 4GH3A 2WVVB 1CXKA 3VFCA 1GQIA 2DQXA 4A2RA 2XSAA 3SCOA 1U2YA 4GI8A 5T8GA 4W5UA 3TYBA 3PSVA 2WWDA 2QKFA 4R5EA 2YBVA 2Z26A 2DQWA 2C3DA 2PP0A 1OX6A 3CC1A 1TREA 1FCBA 4NUWA 1ADDA 4MWAD 3ZOAA 1BZLA 3T0TA 4HZ7A 1MEHA 3EOEA 4X22A 1XH0A 1XLCA 2G0WA 2IKHA 4QROA 4PUEA 3HM7A 3OZMA 1W17A 1OM0A 4P8WA 4ZTXA 2WCGA 1F07A 3FA4A 3MU7A 5DMNA 3EWWA 1CWYA 4LF2A 2PDWA 3LD5A 3ZVHA 2D23A 5IDIA 1LBFA 3O07A 3K5XA 2E0PA 3KBWA 1A5UA 2W0UA 4QNWA 2D73A 3FSTA 4JQAA 1YDVA 2DU2A 1LOLA 3VKAA 2NQ5A 5D9MA 4PBFA 1TWSA 3AZRA 2FLIA 4ROPA 1M6JA 1R3QA 2GVLA 3PZMA 4W85A 1ZX9A 5KZ6A 1OX4B 3SI9A 4C6OA 2DT1A 1JDFA 3T05A 3HGOA 4IXHA 4DN1A 1JI1A 4CU6A 1C9DA 1HJSA 1O1HA 3WD2A 3ORWA 1WPCA 1E1FA 3B9OA 1XBVA 3EKGA 1G9HA 3W9ZA 5EB8A 3G1VA 4PUDA 3AYSA 5ABFA 2E6YA 4M8UA 1JAKA 3MBFA 5CGQA 3I6TA 3VM7A 5HQEA 3ZLGA 1Y65A 1GJWA 2BY1A 1XD1A 3K46A 4IQLA 2ESCA 3APYA 3GFXA 3UXKA 4DRSA 5MKGA 3W7PA 1V3KA 3R8HA 1KRAC 3GR4A 4HQVA 2YOCA 4FK9A 3V16A 3TTOA 1US0A 1SZGA 3RNDA 1QATA 4RKAA 3POCA 1A47A 4NG3A 2X05A 3ABQA 4HCHA 3RIKA 3TDFA 1F2JA 1SYTA 1AFSA 4BQ4A 1DXEA 4I90A 3ZO9A 3H24A 4QJ4B 1PTAA 4GY0A 4R88A 4P7QA 4KERA 4POCA 1IEXA 1GOXA 1RY8A 4PTVA 3T1GA 3RPDA 1JUKA 2B7PA 2GGJA 1GV4A 2FTYA 1EQPA 1XCFA 2W92A 2NXHA 3V0TA 2XH2A 2O56A 4BHYA 3IGHX 4HPGA 1K1DA 3AJ7A 4JKLA 2O55A 4LYKA 3R58A 3W1NA 1ZXIC 3R0DA 3BLEA 3VO0A 1FDJA 4HU0A 3URQA 1DJNA 4J3TA 4HMEA 3P84A 3AOFA 3CXOA 1RP8A 3BV7A 1ITXA 1FWSA 5D8WA 1SJBA 1SUXA 2R8WA 4KWOA 2Z1SA 4DM1A 3KLJA 2ZOXA 3Q67A 4FLRA 1CEOA 3AYTA 3NQVA 4DHGA 3OGRA 3WLLA 2ZX7A 4QBXA 1H51A 1ISZA 3UCDA 3W7JA 1UP0A 3LV6A 1XIIA 4I7WA 3BV4A 1YYAA 3IGXA 1QW9A 3BLLA 2ALRA 2NT0A 5DCDA 1YE6A 1Z7AA 5LYRA 2P0OA 4ES4A 2W62A 1IR2A 2VC9A 3PPFA 4AZHA 1GOOA 3P74A 1PHQA 3VUSA 1CGWA 3N4EA 2OYMA 4GQQA 3OU8A 4HSNA 3S1GA 3H2FA 4H00A 4K7YA 1FY6A 1MXDA 5I77A 4L9ZA 1T6MA 1PDYA 3KXQA 4JTJA 3M7SA 2I57A 5JUVA 1E0WA 3LM3A 1C8QA 2IKJA 1W9XA 3FGCA 4HT3A 5FF3A 5BW6A 4O13A 1LT7A 4D6FA 4J28A 3KP0A 4DVOA 3SQPA 2ZDRA 2CDUA 2HZGA 3WZ0E 3T4WA 1AH4A 1PB0A 2WQPA 1YLVA 1KGWA 2DZTA 5CPLA 1MWOA 2ZQ0A 1P0EA 2GK1B 1BEUA 3GDMA 4W5ZA 3DFPA 3E0VA 2Z2UA 4U31A 5B7YA 3UQNA 2HK1A 5M17A 2P50A 2GDUA 4L61A 4HOXA 1G01A 2C0HA 3VDAA 3OJGA 2FMOA 4P8XA 3NSXA 3EAUA 1NJJA 4O15A 4D8LA 3V0SA 3GG7A 2Y89A 3UPBA 3AFBA 2PB1A 3WD4A 4Z1DA 3K13A 5CKSA 3RO8A 3GHSA 2JKPA 3RCYA 3QZEA 1YDYA 2VZSA 3CQKA 1POKA 3M0HA 4D6CA 2OT1A 4H4UA 3NRZB 5ENLA 1UG6A 1IGWA 2WNNA 1LROA 2ZXAA 3ONBA 1MSSA 1OD8A 2EG8A 1OK4A 1H2IA 3MUIA 1A50A 2GOKA 4KIEA 4FX9A 4GI6A 2HMCA 4A8LA 4BURA 2PZNA 2YL8A 4QQUA 3KX6A 1WDDA 1YNQA 3VTRA 4DJFC 2QDEA 3ISIX 1YBQA 4W7WA 3E0FA 3SCVA 3RYSA 1V7YA 1QNOA 2D24A 3NQ8A 4LV9A 3O6DA 2HWGA 2Q01A 4KPRA 1TZZA 1XINA 3F2BA 1JIBA 3ARXA 1Y0EA 3B4UA 3N11A 3ABSA 4GMEA 3MHGA 4H50A 1LG1A 4JKMA 4F3HA 5CCZA 4GQGA 4Z2GA 3CIXA 1VHNA 5DT7A 3EUB3 3MMUA 1HKMA 1GHSA 3A7AA 4FP1A 2UY2A 3WELA 1YQ2A 1M7OA 1XRTA 3P6LA 2DH2A 5CZTA 1A3WA 4LRSA 3H4GA 4AF0A 3H2AA 4UQBA 3R0KA 1U33A 5CSUA 4LCSA 4WQ6A 5CZSA 4MAZA 2VWSA 1LF1A 3CQ0A 1QTWA 4H9ZA 1UD5A 3UZ5A 3B0PA 3ZJ7A 2YFNA 3R8RA 2F2KA 2GDVA 3AU6A 1W2VA 1GW9A 5B7ZA 1E1CB 1O4UA 3KCJA 2DIEA 1ZBVA 3N2TA 2WVVA 2NT1A 2ABAA 1MW3A 2ISFA 3CAKA 3KZPA 4PSRA 1L2QA 4H7VA 2XUCA 1VZWA 1PDZA 4DUVA 1V4YA 4B2DD 2D0FA 4PCTA 2NV2A 1UROA 4HTBA 1KWKA 4XWUA 5GJNA 5CJMA 4RPQA 2XM2A 1LLWA 1JYWA 3EOSA 4WKHA 1KBIA 3T0AA 2ZZ6A 4Y9PA 1BWVA 1AD4A 3FEMA 5DXXA 4IIHA 4LVDA 1D3GA 3WLOA 3MT1A 4H4SA 2Y61A 4Q8PA 1V3HA 2V82A 3CWHA 4DJDD 2AAAA 4JDBA 3GM8A 4UQEA 5JCMA 4O1BA 3PS7A 5G5GB 3DFOA 1GRGA 1KO0A 4JQ2A 1C8XA 5C9UA 1GETA 3LCIA 3UGRA 1ZK7A 2O9OA 1VPXA 5JIPA 2ZRUA 1KBBA 2FVMA 4RE0A 3FFSA 3WFAA 1QRQA 4JTSA 2CBUA 2QW5A 3DGRA 3KDOA 3QQWA 3NDOA 4LC8A 1OX4A 3HMCA 1HZYA 1L6WA 1UUMA 5AHLA 3PNZA 1I2RA 5EBUA 1A0DA 1BYDA 2VC5A 3KFTA 2F6XA 3CUZA 1G7VA 4XTDA 4O4VA 2P5NA 1EDTA 2ZA2A 5LIKX 5HWMA 4LAOA 1MW0A 2QEZA 3W2KA 4AG0A 2BOFX 6ENLA 1TTPA 2HCVA 1IEWA 4TQTA 4YCPA 4C60A 3QMTA 3GAYA 3RPMA 1X2GA 5H91A 4JQ3A 3DFSA 4JHMA 2GUYA 5HJYA 1IYXA 5LNVA 3CV6A 2G3MA 3T9PA 4EAMA 1A0CA 4O14A 1TJ2A 3GC4A 5D32A 2ISSA 4ILSA 3GAKA 1DE5A 4TTUA 5HR7A 1CECA 1PAMA 4HA4A 3CIWA 1M7PA 1GUVA 2YR1A 2FDMA 1NOUA 3GIPA 3AXMA 1XYMA 1RY0A 2QDGA 3P93A 5F4SA 3WD3A 4K36A 4BQ5A 1KFJA 3VILA 4MB3A 1A5CA 1SMDA 5AZ0A 2E9BA 4OU1A 2C15A 1DWIM 2EKCA 1SFSA 4FLSA 3L9CA 1GGOA 4O1FA 3ZZ1A 4Z08A 4NXSA 1FUYA 2QCFA 1PV8A 2HE8A 2DZVA 1SZRA 1I4NA 4X60A 2ZRYA 4EWJA 5BU9A 4HPJA 3UNTA 1X7FA 1Z69A 3N18A 3PBWA 4A2SA 1YDOA 2X41A 4AD3A 1QFEA 2DEPA 3PANA 4GGHA 3F03K 4DPPA 1UUOA 3NQCA 3FYPA 1TKKA 2FPYA 4BA0A 2IQDA 3IUIA 1GYMA 5BU6A 3WIJA 3E0LA 3OYXA 1S3HA 1XDIA 2TPRA 2D2GA 4GVHA 3WQDA 4ROQA 1GG0A 2ZWYA 2XFWA 4FOUA 4A8NA 4IH3A 3S47A 3BMVA 3VIKA 4WJXA 2Y5JA 9XIAA 2V81A 3HG4A 1XW8A 3FJ4A 3S6DA 4HMCA 4GI9A 2J7DA 1O6IA 1FCVA 2EF9A 1NHQA 4IL0A 1S46A 4DNHA 3NSNA 1JGIA 2J7BA 2QULA 3TX9A 1TJ1A 1UASA 2A6NA 2XIQA 2V8ZA 4DWSB 3VIMA 1OD0A 2OLSA 1QASA 2IPWA 1R3SA 1ADOA 3W1PA 1W3JA 3W27A 5H8PA 1KFLA 1C3FA 1TX2A 4GKTA 2PA6A 1TPWA 2CWNA 2W6RA 1S3TC 5A5WA 3W76A 4US5D 2PRMA 1NU5A 2XVGA 3IIVA 1NF0A 4AAJA 5KZDA 1TPH1 4UTKA 3OEXA 2R6OA 1WUFA 2WZIA 2Y7DA 1ZAJA 3MP4A 3TXZA 3SFKA 4H6RA 4B4HA 3EKZA 4OBTA 2C16A 4KCUA 4FX8A 1F74A 2RABA 1FP9A 4NJHA 1EP1A 3S0CA 3S1XA 3PPGA 3S8HA 1QW7A 3WMLA 3IWPA 4HOWA 3GIYA 1LYXA 4EMWA 1N62C 1XSIA 4H8NA 3TLQA 2W67A 1K9DA 1QI2A 2WZHA 2GR0A 1TV2A 1ISYA 4IWWA 1TPDA 3SR6B 3H22A 3DG7A 5JU6A 2PU1A 3LQGA 1HNYA 1QOQA 3W84A 1CPUA 1ZALA 5E0FA 4AD5A 4KFPA 4M6QA 4XZLX 2YAUA 2NLYA 1EIXA 1O1ZA 1FFUC 1XSKA 4ZTYA 2VENA 4FPSA 2NX9A 5A6BD 1W32A 2PPGA 4JZ5A 5BZAA 1T40A 1UQYA 3SQMA 1DOSA 3CIVA 1VYRA 1EC8A 4HGXA 2VC7A 4N9EA 3MWCA 3EWYA 4XAYA 1PSCA 1F7BA 5D09A 1OFRA 1HVXA 3N12A 3CQIA 3WEMA 3P0XA 2YSWA 1V0LA 3N2MA 1XYZA 3KBNA 4GYPA 3P8IA 2Z00A 1J9YA 3LY0A 3GKAA 2Y7FA 3T2QA 5CSYA 3V4BA 3W7KA 1RA0A 4EXQA 1TRDA 1QNPA 3HOJA 3VINA 1XS2A 4MNMA 5HJLA 2BZNA 5CPSA 1NDWA 3KBJA 1X6UA 1DHPA 3VGBA 4EANA 1NP0A 5JBDA 1T0OA 4GUFA 4PUMA 5M03A 1OG6A 2UWFA 1C9WA 4O11A 1C8YA 3T44A 2V30A 4CD5A 5HDRA 3SB0A 3CLWA 1R86A 3LA4A 3SIMA 1AK5A 1VS1A 2ZZBA 1NH6A 4FF7A 1UR3M 3C52A 2A3BA 1KM3A 2BVDA 4L1XA 1JFXA 1DYSA 1LLZA 4GYJA 3WLRA 4NEWA 3MSDA 1BXBA 2F6KA 1GXFA 2DSWA 3NM3A 4LUYA 4L65A 2Z1VA 4RZBA 3ZQ9A 1Q1RA 3AWOA 3HFYA 3WH6A 3QTPA 4XD4A 4HJFA 5AY7A 1GQLA 1KCXA 1XCWA 4V33A 2NSOA 1FWNA 4QSFA 1Q66A 4ZQNA 2X42A 1E1CA 2W3SA 4J4KA 2X7VA 4MB4A 4GY1A 3WLMA 1IT7A 4I6VA 3S1VA 3GTHA 1G67A 1JZ8A 3CO4A 1TV8A 2R1NA 3BAIA 3DESA 2V5DA 1I60A 5CG0A 3PZQA 3PHAA 4PL1A 5LGZA 2Q8ZA 2QJMA 4Q32A 3U2OA 3A47A 1ZSXA 3HV8A 5M1TA 3SCNA 3WJZA 3NPUA 2NVCA 3QV6A 4GQ0A 4EKJA 4WK9A 3LTSA 2V2HA 3DYOA 2VFHA 1TZ7A 4L1GA 1FBAA 1M01A 3CJPA 3CZGA 5I5RA 4YTSA 1HIZA 3URBA 1H5YA 1VPQA 2HXTA 3AXIA 2EQDA 1W1B1 3O6CA 1XIGA 1JYVA 3CHVA 3WQ6A 1OX5A 1VFOA 1IF2A 3D3FA 1WYGA 2X8RA 4CUCA 3SCQA 4OIFA 2GL5A 1B3YA 1L6YA 2REQB 4BKNA 3MA8A 3A9IA 1LWJA 3W86A 3DGBA 1ZBCA 1FWTA 2OZTA 1TV3A 4JD4A 5DN1A 4MFEA 1OWQA 3RRAA 4GC4A 4GWEA 4ZEPA 5I07A 1RAKA 3SUUA 3BICA 3WFZA 3CM4A 5A6AA 4R7JA 2ON3A 1XYCA 2J25A 3LPGA 1XBZA 4FF5A 3P67A 5EPDA 1JCJA 3G1HA 4S39A 4TV5A 4J3UA 3VDBA 1E0UA 1TQJA 1LRQA 3WNKA 3SAZA 5AHIA 4ERAA 2ZRVA 2Z29A 3WLSA 4H3DA 4MJZA 1O68A 3CO8A 3F1QA 4IMCA 4KQNA 3I6RA 3HG5A 2G97A 1QPNA 3QQ1A 5DLCA 3RLHA 3I7RA 3HRDC 4ZOHB 3NEVA 2A7RA 4FS9A 1TPC1 3NIYA 3UZZA 4B5TA 2QMKA 2E7FA 4R7OA 3FOKA 3RITA 1HL9A 4WKFA 4C6NA 1FXPA 3F4WA 3TJ4A 2VGGA 4O16A 2CLIA 1Q6LA 4MZYA 3M9YA 1PWMA 3AMGA 3IV3A 5H1WA 3OVPA 5U1OA 1ISXA 4U28A 1X7IA 3UJFA 3L7RA 3GH7A 3K2GA 4O17A 1DWHM 2DJXA 1EJSC 4R9OA 3ONCA 2A3EA 2RDTA 3SIZA 3VABA 5HPCA 3PG6A 1TV7A 3TTEA 1EJWC 3W00A 1C93A 3S83A 3Q94A 4C5YA 1GNXA 2NXGA 1AOGA 3WQ5A 3GVVA 2YW3A 3TNOA 3TMLA 1LM1A 4WD0A 1HG3A 3CGTA 3OVQA 3VGHA 1CBGA 2QV5A 3ARRA 2NX1A 3NQAA 3RLUA 3AUJA 1AMYA 3EDDA 4RNIA 3E2RA 5BXSA 3RX3A 4W9TA 2HXUA 1XRVA 2AAQA 1EOMA 3SGUA 4JNZA 4JN7A 3PWAA 2QT3A 3NL2A 2VDGA 2V6OA 1EB3A 4NL1A 2C1GA 1ZPTA 2A85A 3CEUA 3A22A 5K2ZA 1MUWA 1KD0A 4HNCA 1R38A 2W63A 4CKQA 4ZBCA 5HWJA 3LXDA 1OVDA 1QCWA 4FSAA 5FJPA 1LVLA 2YCLB 1OGGA 2B7NA 4PMNA 1PIFA 3WQCA 5A8QA 4ERIA 4AEOA 4DEFA 1TIMA 2HSAA 4DWSA 1E3ZA 3JU2A 1MYRA 1OHLA 4M7TA 3F2CA 1SW0A 3BURA 3T81A 3K1GA 4TX8A 4E8CA 3BARA 3GDTA 5EFFA 5HINA 3KVKA 2VEKA 4LRTA 3QR3A 3SSZA 5HQMA 1I0DA 1ZENA 3FK4A 5BRPA 1YW1A 3GNNA 4ORIA 1NFGA 4QSHA 3U2EA 5IRPA 1XGEA 3A6OA 2ZBTA 3PB2A 4PMQA 3UWYA 1UOKA 1CDGA 1OCJA 3K8MA 4AZGA 1JD9A 1GZGA 3WNOA 1POJA