2OPJA

Crystal structure of o-succinylbenzoate synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
311
structure length
294
Chain Sequence
SLTGRAFAIPLRTRFRGITVREGMLVRGAAGWGEFSPFAEYGPRECARWWAACYEAAELGWPAPVRDTVPVNATVPAVGPEEAARIVASSGCTTAKVKVAENDVARVEAVRDALGPRGRVRIDVNGAWDVDTAVRMIRLLDRFELEYVEQPCATVDELAEVRRRVSVPIAARVRDAEAADVVVLKVQPLGGVRAALRLAEECGLPVVVSSAVETSVGLAAGVALAAALPELPYACGLATLRLLHADVCDDPLLPVHGVLPVRRVDVSEQRLAEVEIDPAAWQARLAAARAAWEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-succinylbenzoate-CoA synthase
publication title Crystal structure of O-succinylbenzoate synthase
rcsb
source organism Thermobifida fusca
molecule tags Lyase
total genus 95
structure length 294
sequence length 311
ec nomenclature ec 4.2.1.-:
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
A PF18374 Enolase_like_N Enolase N-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2opjA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2opjA01
3DDMA 3FXGA 4GGBA 2PTXA 3IJLA 3U4FA 4DN1A 1XPYA 5FJUA 7ENLA 2OPJA 4KEMA 1NU5A 2PTWA 3DFYA 3TOYA 2MNRA 4FP1A 2OZ3A 4Z17A 2P8BA 3N4EA 3KUMA 3TJIA 3DESA 3V5FA 4IT1A 2QDDA 4JHMA 3P0WA 3V5CA 3DFHA 2GGEA 3R0UA 2PP0A 4K1WA 3ENLA 4E6MA 3TQPA 2FKPA 3SBFA 3CAWA 2PMQA 3RITA 4GISA 5IDZA 2HNEA 3TTEA 4H19A 3UCCA 1JPMA 2AKMA 4M6UA 2XH7A 3VCCA 3ZVHB 3DERA 2PPGA 3FYYA 3UJRA 4A6GA 3HPFA 1PDYA 3OZYA 3T6CA 4E5TA 1WUEA 3R25A 2XH4A 4GYPC 2DW6A 2ONEA 3N6HA 3NO1A 3DG3A 3OTRA 2P88A 2OFJA 2OVLA 3DEQA 3QN3A 5EU9A 4H1ZA 4YWSA 3VDGA 1TZZA 1MNSA 3QTPA 3GO2A 1SJAA 4H2HA 3K1GA 3VA8A 3RCYA 2NQLA 3THUA 1TKKA 1R6WA 2PP3A 2PTYA 3S47A 2PU0A 1TE6A 1P48A 2ZADA 2QJNA 2O56A 2OG9A 2QDEA 2P3ZA 3D47A 3UGVA 2FYMA 1E9IA 3GY1A 4GMEA 2XGZA 4G8TA 2GSHA 3MQTA 3VC5A 4X2PA 2HZGA 3N6JA 2DW7A 3JVAA 3H70A 3GC2A 3IJIA 1L8PA 3VCNA 3QKEA 3PFRA 2PODA 1FHUA 1WUFA 3CB3A 2OZ8A 2HXTA 3S5SA 3CXOA 2PU1A 2P0IA 4J1OA 2OLAA 3TW9A 3RRAA 1F9CA 3T9PA 3SN1A 5FJTA 2OX4A 2PCEA 2HXUA 4DHGA 1MUCA 4KPLA 3FV9A 2AL2A 3OPSA 3ZLGA 3MZNA 3NFUA 2MUCA 3SN0A 3DGBA 2XH2A 3UJ2A 3R0KA 3BOXA 3RO6A 2OZTA 1IYXA 3R10A 4HNCA 3UJSA 3FJ4A 2OO6A 3Q45A 1BKHA 2AL1A 3PWGA 3CYJA 4HCDA 2GGIA 3IJQA 3MKCA 3FVDA 1ELSA 3D46A 3ZVIA 2QVHA 3DG7A 4A35A 5FJOA 3SQSA 1EC7A 3CK5A 2CHRA 3P93A 3TWBA 4H83A 4IP4A 5J04A 2GGJA 3ES7A 4GIRA 3T4WA 4J3ZA 2POZA 4GYPA 1SJBA 3PK7A 4HNLA 3TCSA 2GDQA 4DWDA 3BSMA 3TJ4A 4HPNA 4ZA0A 4GFIA 1EC8A 1ECQA 2GGHA 3EEZA 1MRAA 1MDRA 3QLDA 4DXKA 1W6TA 3MSYA 3U9IA 3DIPA 3GD6A 4G7FA 2QGYA 2AKZA 5FJRA 3FCPA 3UXKA 3UXLA 2PSNA 1JDFA 2OKTA 1ONEA 3N4FA 4IZGA 4A3RA 4F4RA 2GL5A 4E4FA 4MGGA 1SJDA 2PTZA 2PGEA 3OP2A 3MY9A 1MDLA 3UCDA 4KWSA 4ENLA 3I6TA 2XSXA 3VC6A 1PDZA 3DG6A 3RGTA 4KT2A 3B97A 4MMWA 1P43A 4HYRA 2PA6A 4FI4A 3SJNA 6ENLA 3ZVHA 1KKOA 3IK4A 2PGWA 3V3WA 3H8AA 4HCHA 5FJPA 1YEYA 4IP5A 3NZGA 2OQYA 3R1ZA 1BQGA 1R0MA 3TWAA 1JCTA 3I4KA 4DYEA 1KD0A 3CT2A 2RDXA 4E4UA 3EKGA 4K2SA 1SJCA 3ZLFA 1EBGA 3H7VA 4ROPA 2OQHA 4HN8A 2XH0A 3QPEA 3BJSA 3OW1A 2AL2B 1JPDX 3JW7A 1EBHA 3VFCA 2I5QA 4M0XA 3JZUA 1DTNA 3V4BA 1RVKA 4IHCA 3R11A 2GGGA 3SN4A 2P8CA 2PP1A 3STPA 3ZLHA 1NELA 3MUCA 4GGHA 4IL0A 4DX3A 1KKRA 4ZCWA 2QQ6A 3H12A 5BOEA 4Z1YA 4MKSA 3MWCA 5ENLA 3I6EA 4EWJA 4K8GA 3UJEA 1KCZA 1FHVA 3SSZA 3NXLA 4IL2A 3RR1A 1OEPA 1XS2A 4JN8A 1EC9A 4HCLA 3OZMA 2QJMA 3Q4DA 3ES8A 4JN7A 2PS2A 3P3BA 5BOFA 3PWIA 4E8GA 2ZC8A 3UJFA 2QJJA 3T8QA
chains in the Genus database with same CATH superfamily
1MFVA 4JHZA 1FY6A 3NSMA 3WMBA 3V18A 1W9VA 1OX5A 2Y4SA 4UTTA 2GVEA 1TR1A 3AIWA 5IBXC 1VRDA 1Z3NA 1XGEA 1V0LA 1XH1A 3A9BA 4LS0A 3B0UX 3A7AA 1PHWA 2A3LA 3KCOA 4WDUA 1H51A 5AY7A 4F2UA 3PZIA 3M5XA 4PB5A 3RX4A 3OB8A 1CNVA 1X6UA 1ONXA 3GDRA 1EQPA 4KW2A 5I24A 2YCIX 1O66A 4MWAE 3MCMA 4YVXA 2WK2A 3P0WA 1FWRA 3W85A 1L6SA 4Z2GA 1RA0A 3DFHA 2J7FA 1LBFA 1EGVA 1S1PA 2BXVA 4BA0A 1LG2A 1REQA 3L5MA 1WQ5A 1OCQA 1EBDA 2VGGA 3L12A 4OVXA 2HCVA 4M6PA 5FS6A 3Q6JA 1E9YB 1I45A 3OA3A 5A6JA 2GQ8A 4GCAA 4MF4A 3QF0A 2HDJA 1DXFA 3C2RA 1RY0A 1O7AA 1KWKA 1AH4A 1PDYA 3MBDA 1XRSA 3GVVA 2WJEA 5LKYA 2D20A 2DW6A 1Z42A 3E0WA 1Q5MA 4CD6A 2V3BA 3BAYA 1A4LA 5MHBA 2F9RA 2OFJA 3WBWA 4AEFA 1C7SA 1X1OA 2ZICA 4E2BA 1P0DA 3GC4A 4JICA 1NQ6A 4DY1A 1T99A 1ZENA 2V30A 1R6WA 4LTSA 4F2BA 1KFWA 1Q66A 4WDWA 1YADA 4UFIA 4ZOBA 5RUBA 1U83A 3CAQA 1BTCA 5CBIA 4JY8A 3L5LA 2QDEA 5FEPA 4NZ5A 3W7IA 1NOWA 1TCDA 4JTTA 2VDGA 2DZXA 4AC7C 1ISZA 1U33A 3S1WA 3U2CA 4A3YA 4XD6A 4ZXOA 4ICCX 1A53A 1G4PA 1BG4A 3PZGA 1QWGA 3JVAA 4JQ1A 3ZT5A 4XTIA 2D22A 1OSEA 1R3RA 3CGDA 3KBJA 1E0XA 3TTQA 5C6MA 2Z6IA 1CGYA 4LYRA 2NVCA 1KGWA 1XJBA 3NTYA 4MKNA 1U22A 4IMGA 1VLIA 3TJLA 4DWSB 3UR7A 4OBSA 3LY0A 4PCSA 5BU9A 3W4RA 1MQPA 1UIPA 4DXXA 4JTQA 1VYRA 1NHRA 1ENUA 1WAWA 4MWAD 1SUXA 1XDLA 2GPTA 3NVDA 5LA1A 1YYAA 4RJEA 4PBGA 3VIMA 5IM51 3BSGA 2E6AA 3PY2A 2VL4A 4GC3A 3B9JB 3NQFA 2C16A 1LTDA 3IAQA 4O10A 5AVHA 1IF2A 3F2DA 1GYMA 3PSVA 3EF6A 3U0HA 3N2BA 4OUIA 3GRSA 3TTSA 4F9JA 2ON3A 2VT0A 5BOOA 2PWDA 3SY1A 1WDRA 1WXYA 1JZ4A 1W1ZA 2D23A 2R82A 1OYBA 5AHEA 1JCJA 3P93A 4PRRA 3GDBA 3RO8A 2XGBA 4HB7A 1CT5A 5ABFB 3VGBA 1M7XA 5H2ZA 1JYVA 1Q6FA 4AG0A 1J96A 2CWNA 3ANUA 4U5KA 3GE7A 1DV7A 4S3JA 5A94A 5JBEA 2FVLA 1P6BA 3CL7A 2BX7A 2I5IA 3FN9A 2GQ9A 3NOEA 1GOMA 3LCHA 5AKQA 4R5EA 1UHVA 3AALA 3YPIA 1W6TA 3UG5A 3H2OA 4XD3A 2BASA 4P7NA 3RNDA 1W37A 2D73A 3DCPA 3O0FA 1JQXA 5CSSA 4RV8A 4C6OA 4YTRA 4JGDA 4NAFA 2QZRA 3LM3A 5D05A 4GY0A 2WZHA 1Y5WA 4R53A 1UG6A 1TPDA 3B0PA 3SURA 1KXHA 2E7FA 2OOGA 3ARUA 1CZ1A 2WZEA 2YL6A 1HW6A 1PKNA 1X2HA 1KBJA 3MO4A 4QE4A 4PMOA 3QQ0A 1LOLA 1RBAA 1HJSA 3KL5A 2WNZA 4YTSA 1FCQA 1ZRQA 1MXSA 1KKOA 1W32A 1OG0A 4P7RA 4J3TA 4TMBA 5FJPA 3R89A 1LUCA 2VQTA 1ZAJA 4GRTA 4XAZA 2Q02A 2A3HA 3N19B 1EJWC 3TWAA 4OZOA 5D03A 2OO0A 3GBDA 3WF0A 1F74A 3S6TA 1GV4A 2PD9A 3GVQA 2ZRZA 3GIQA 1GXFA 1EJUC 2XH0A 4M5PA 1Q2RA 2HVMA 3H26A 1UWRA 5ECUA 1X39A 3WDHA 2QF8A 4U33A 4GH1A 4GIAA 3VKDA 1PIFA 1IZKA 4RK8A 4FLRA 8A3HA 5A6MA 1JCXA 4C7GA 2W79A 4ZTYA 1X2GA 2DV0A 2OXNA 6REQA 1K8YA 4PUNA 1KQZA 2X8CA 3EXTA 2P5NA 3W27A 3H12A 4F2TA 3WF1A 3UU0A 1UWTA 3LXCA 1J12A 3UJEA 2Y63A 1A5AA 4N9EA 3IUDA 3NXLA 2CZFA 4QJ1A 4NQ1A 3NZ1A 4U3AA 5LHFA 4RPQA 4M52A 3C3NA 1GEUA 3IV3A 4IG2A 3H55A 1SZEA 1QMLA 3L8KA 4LB3A 4OHQA 4H9UA 7REQA 4Y9AA 4IFKB 1KM3A 2ZC1A 4GNKB 3S83A 3AO0A 1X98A 3W22A 1TPUA 3WDRA 4JTRA 4KEMA 3E1F1 1VB9A 1YXDA 2WVSA 2B0MA 3LCIA 3PBGA 3LK6A 2OU4A 5DXYA 3URBA 1Q8JA 5KMYA 2Z7GA 3NO5A 3VKCA 3PZNA 4MB5A 2XSBA 3P62A 3I65A 3AAMA 3VCRA 1AG1O 4BS0A 2WCAA 1RVGA 1UBPC 5E6YA 3ZR4A 3WFLA 3NQDA 3SUTA 1C8XA 1QWKA 2VKZG 4GH3A 1Q65A 1ISXA 1F4AA 3OYZA 1Q4WA 3KDNA 4B4HA 4MHBA 3V0SA 4GQ0A 4RE0A 5CZSA 4DBWA 1HF6A 2HNEA 6TIMA 1E6XM 2AAQA 4D6EA 4H19A 2YDRA 3AYRA 2Y6ZA 4DM1A 3CV6A 4H4UA 2J9XA 2YFNA 4UMCA 2VD9A 2X05A 1DIOA 4KFPA 3A6OA 3W37A 2FZ9A 2Z1KA 1BG9A 1UQYA 4WSHA 3WEZA 3CIXA 1Q6DA 2BGNE 4BEQA 3LV6A 2AQOA 2J77A 3IIZA 1H1YA 2H90A 2YB1A 3KHDA 3OLDA 4E2OA 3BLFA 3H2EA 4D6JA 3SJ3A 2QR6A 1L8NA 2V3AA 2BNJA 1JUBA 4L4PA 3W2LA 1YMYA 2X09A 5I06A 4FLOA 2E9MA 3GNDA 2NQLA 1CXFA 3W3OA 4B2DD 2ZKMX 4FHAA 1R3QA 3I7RA 4H9VA 4Y9OA 2DIEA 5G2HA 3U4AA 2Q6ZA 1DXIA 3WJXA 3LGDA 3WD1A 1BGAA 5F7UA 5D04C 3ARXA 3AMKA 3RXZA 3SIZA 4GUGA 4DAIA 4Z0JA 1FCUA 2QCLA 3LCLA 4FX9A 2D2OA 3FNDA 3AFBA 4MNJA 4NRSA 4AY1A 3GY1A 3GTIA 2VHLA 1NVMA 4I7VA 1FECA 2D2JA 1OK4A 1QJWA 4JQAA 2YGYA 1L8PA 2E28A 3LTSA 4L1XA 1XSJA 3DFNA 1WX0A 1KR0A 4XAPA 3VNJA 1OINA 3U48A 1TPC1 2W3SA 2H9AB 3R2GA 4XD5A 3QC0A 1VPYA 3IVSA 3EWBX 2P0IA 2V63A 4DZHA 3KOWA 5F4SA 3PJUA 3LOTA 1GEQA 1IXQA 4JFSA 4PCNA 4PMJA 4BURA 5U4NA 1AQ0A 4L9YA 4XAGA 2A85A 1E15A 4QIUA 3VDAA 1WPCA 3EANA 1FQ0A 2DJLA 1RD6A 1BWCA 1Q1WA 2ZZBA 4HK6A 5JRBA 2H3DA 2HMCA 3VKJA 4L7ZA 5G5HB 4EPEC 3GHUA 4M80A 3E38A 4K37A 4YVVA 4EANA 1Q6GA 2W66A 4D1JA 4QJ3B 1VAHA 2QIWA 3ARQA 3M44A 1GT8A 4W87A 5BU6A 1J5SA 3S4TA 1W2PA 5M5DA 3PWGA 5T8GA 3KL3A 4L9ZA 4B5UA 3S5OA 3PAOA 1EUNA 4ERIA 2OLHA 4JTEA 1TV8A 1NF0A 3TOPA 1LT8A 1TZ9A 3G8EA 1SJBA 4IPLA 3KVMA 3OHMB 3IJ9A 4HOZA 2PZ0A 3ZJ6A 4HPNA 1UP0A 1UD5A 2YA0A 2WOQA 1M6JA 2AOSA 3SCVA 2CITA 4DJEC 1JFHA 1UR8A 3EWWA 3NZPA 2NSXA 3STFA 5FMHA 3QQ1A 2NUXA 3S2JA 5B7YA 2V38A 1GEHA 1ADOA 2FZDA 4M1RA 1GKQA 1DQXA 4B3KA 3E2VA 3KVKA 1Q7QA 1KWGA 5IFPA 1T5AA 2X1RA 3KBMA 2X30A 5D9PA 3LSCA 4OE7A 5I79A 4ZOAA 4CQAA 1W3TA 3VGFA 4H8NA 4IPNB 4QLJA 4KWSA 5HPOA 1E4NA 2IXUA 4NHVA 2PDQA 3VABA 1ZALA 3ZJKA 4K38A 4GR1A 3AMZA 3W7NA 3NURA 4JOMA 1RJPA 1R3VA 6ENLA 4MPKA 3C0SA 1G7VA 2VGBA 2PGWA 3H8AA 3RLHA 2X2GA 4TIMA 4FNUA 3W81A 4FXSA 1XSIA 1UB3A 2H8XA 3SCSA 4OUEA 4LF1A 2R9RA 2D3LA 1K6AA 1KM4A 1R3TA 5AYZA 5DRIA 3KP0A 2QMJA 3PTMA 4E4UA 2HNHA 4H4VA 5IRPA 3IACA 3A12A 3CGCA 2BOGX 2OQHA 4X2RA 3G24A 4AF0B 1PIGA 2WSRA 2A8XA 2FB3A 3MZ2A 4IF2A 4UQ9A 3REQA 1FA2A 3UERA 3DI1A 2I56A 1UUMA 1H7WA 3F4NA 4CVWA 4YNGA 3UZ5A 4CQ9A 4EKJA 3ARPA 3BLLA 1E1FA 4EXAA 1ECEA 4POCA 4EQWA 2ZTJA 3DFOA 2JF7A 4EMIA 4ZCWA 3TAOA 1PAMA 2GJXB 5I3DA 2QQ6A 4UTUA 4AZGA 3ARVA 3L4YA 2F6XA 1BXBA 2ZX5A 3GNPA 4S1FA 3ALGA 2J9ZA 4FO4A 7TIMA 2EPNA 3GIPA 1ICPA 2F2KA 3WD0A 1O6IA 3M1ZA 4KRUA 3G1DA 5EBKA 2QCCA 2V82A 5C2GA 1VBGA 3OVPA 5D37A 4GBDA 2ZC8A 1QT1A 2J7EA 2OZ0A 4PEEA 4IPPA 4QE1A 5F4XA 5FSEC 4LNCA 1A4MA 3GB6A 4RKAA 1IEVA 4HJFA 1GQJA 5AECA 5AC4A 5JIWA 3VE7A 1HN1A 4F0LA 4JR5A 3TFXA 1V0KA 2VI0A 3MWAA 3AM9A 3R07C 5FS7A 1AA1B 2BOEX 5CAHA 1EEXA 4G1KA 2OYMA 3EKLA 1VD6A 2UY3A 1ONRA 3W7PA 1ZSXA 2I16A 2R1NA 1GVSA 1OIMA 4S3EA 5JCNA 4UTMA 1NDYA 1VBRA 2GGEA 2PWGA 2WHJA 4PB3A 4K1WA 3OGRA 2YL9A 3M4HA 4E6MA 1HP5A 1XICA 3KWXA 3GIYA 4WEVX 3TQPA 3LV5A 2CWXA 2WQPA 2W6RA 1KGUA 4UTFA 5IDZA 3W25A 3ARRA 2EPHA 2XVLA 4JFTA 1WDDA 1JPIA 1XBVA 3W84A 2QJGA 4NI3A 2IQDA 4I7UA 4GIEA 4U28A 4XUYA 1M7JA 4GG9A 2JKAA 3CM4A 2VYOA 4Z08A 3CHCA 5C2CA 1VR6A 1TUXA 3CHVA 4AZIA 4DUOA 3VPLA 2EPOA 5D30A 2IS7A 3S2CA 2OWCA 3W76A 2PWEA 4E38A 1JCNA 1KBKA 1I2OA 4EQRA 1JD9A 2GR3A 4GKLA 3MYPA 4YWSA 4B5SA 1XYBA 3NRZB 3E96A 1NDZA 2EG7A 4G56A 3LI0A 3WQVA 1H49A 3JU2A 3EWZA 4H2HA 1UIOA 1RCQA 1V3LA 3B3DA 3THUA 4EE9A 1WNOA 3GHTA 2QCNA 3A21A 3VNZA 4WY0B 1SZGA 3DK4A 1TCMA 2BVDA 2Z29A 4AZCB 4Y9MA 1E4LA 2QPSA 3MC5A 4H2CA 4US5D 1E9IA 3BPWA 3W38A 4GMEA 4GVIA 4IJBA 1XIHA 1NTHA 4ACZB 3QMSA 5T9BG 4DBSA 4X2PA 2J13A 2QCGA 3EA2A 2ACQA 1ZBKA 3AZSA 4GY7A 5F2MA 3JS3A 2PODA 3GD3A 3BAIA 3H4GA 3N73A 1VPQA 3W1PA 1VFTA 5G1TA 2QPUA 4MFEA 2RH9A 1ZGDA 3UQNA 4DF0A 2NT1A 5EL1A 2NUYA 2NQHA 1A50A 2VD8A 1EGZA 3RRAA 4TX9A 1W3LA 3T1GA 4CLMA 2VRJA 1FDZA 3LCGA 4AWEA 4KWOA 3WDIA 2TAAA 1B1YA 2V3GA 3GW3A 2MUCA 4R7JA 4MG4A 4JTFA 2EKGA 1B3XA 1RV8A 4PFMA 3CUGA 3BOXA 5FOOA 3PFMA 2B7PA 2BY2A 1LQ2A 1W8SA 2PDGA 1EO7A 5HQMA 2DFAA 1PIIA 2DZWA 3DOPA 1IXOA 1CLXA 3AS2A 1QTWA 2AL1A 2DSVA 2V6AA 2ZRUA 4EQSA 4FR6A 1BGGA 2WZTA 2YA2A 4LC8A 3CK5A 4I9MA 4CEXC 1XCXA 3ES7A 3QMRA 1EX5A 5C5YA 2J79A 3NGJA 3NYZA 2QVNA 3AXHA 4GIRA 4HU0A 2PBGA 1SO5A 4PGLA 3KL0A 2Y2WA 5AB3A 1DIEA 1RY8A 1VKFA 3LPFA 2WNNA 3DUGA 4WJXA 1RJQA 3RPDA 1GESA 1FOBA 3EEZA 4XZBA 3RU6A 4DZAA 1HZYA 2BODX 3UZWA 4HPHA 1FHDA 1N5WC 1E6SM 1VFLA 3L67A 3CASA 4UIOA 3W1MA 2VZVA 1TTJA 1YTKA 4OT7A 1CENA 4BWLA 4K1GA 4X3ZA 4DLMA 3NPVA 5DY2A 3M0HA 3VD7A 4GXWA 2PTZA 5JCMA 2O0TA 3EKZA 2VFIA 3U6WA 5LSMA 1ZJAA 3UCDA 4QSFA 2WVUA 5HANA 3W1QA 4QNWA 5D4YA 5F2IA 4EQXA 4KT2A 5EGRA 2IUZA 3AIRA 4LF2A 4WGHA 1QI2A 3VIJA 1PJ9A 3CJPA 3CZGA 3FGCB 2QCHA 3WLHA 3MMUA 3G1AA 3S1XA 3QW4B 3CTTA 3XINA 5C71A 1YEYA 3HBLA 2VR4A 1N8FA 1Z41A 1XLLA 3C0QA 2WBKA 1EJSC 3KAOA 3MDWA 1Q7MA 3HN3A 1P5BA 4LAMA 1JZ6A 4UTWA 7CGTA 2JBMA 5CG0A 1JR1A 4HYWA 5DF0A 2CBVA 3HPXA 1KW1A 2EJAA 2XFYA 1M53A 1YNYA 1JPDX 4O0QA 3QY7A 1B9BA 1PTGA 4BI7A 1CXIA 1EOKA 1Y0EA 1D7KA 3MJMA 4L80A 4IJCA 1GQLA 2C7FA 5ABTA 1K7EA 1RSCA 3V16A 2A6LA 2FMNA 1HO1A 2Z24A 2VUNA 5FD0A 2WKJA 2DJXA 3R6IA 5CPLA 4M29A 4TVDA 1F5ZA 1HIZA 2WHLA 5BOEA 4Z1YA 3WO8A 3NAVA 2FLIA 3L7RA 3L4ZA 3VD9A 3P5YA 3SY5A 4LVDA 3BOLA 2PTDA 4XZMX 1FP9A 3LHUA 4J5NA 2GR0A 5AOUA 4QCEA 3BG9A 3G1HA 5A5WA 3RR4A 3FKRA 1XM3A 4Q7IA 1WZAA 4RZ4A 1FHLA 3GK0A 2Y61A 4ALDA 3DN5A 3T8QA 4V33A 2DZVA 5KZ6A 4D8LA 2J7DA 4K68A 3T0AA 1LWJA 4JYDA 2ZDRA 3DBPA 4XQ6A 4QS6A 3M0YA 3TOYA 1E4IA 2I57A 2CXGA 3OBKA 4C5YA 1HJQA 1UQZA 3NZRA 3KRZA 4DWSA 3UZYA 3TXVA 1US0A 3K4DA 3W7OA 4IGMA 2CPUA 1Q6LA 4Y96A 3A7RA 1A5MC 2IKIA 4IJRA 4ZSUA 2YW4A 1IEXA 1TR9A 3WK0A 2PRHA 2ZX8A 4KEVA 5BZAA 1CGXA 2ODOA 4HZ8A 1SR0A 4S2BA 3WJZA 2NX1A 3EWUA 3RN6A 4QLKA 1Q6EA 1S7MA 4NY2A 1TRIA 3ID7A 3WLTA 4UMBA 3CAKA 4F0MA 3VAVA 5LNRA 4DJFA 4I5UA 4Q7BA 2J7CA 2RDWA 1HXJA 6CGTA 3WLIA 4XZLX 5ABFA 4AHPA 1X97A 2JKPA 1AD1A 1GYLA 3U3HA 3WLKX 4F0RA 4NF7A 3VDHA 3QM3A 5U7SA 5EU9A 2W3ZA 3TLLA 3FJ6A 3G22A 3E0VA 4BI5A 1MO9A 2FPVA 1LG1A 1OT2A 4NYUA 1JRPA 1ZZMA 5G4WA 5BXSA 3U2OA 3W7RA 4KEZA 1XRTA 3WQEA 1I8JA 4IOTA 3AUJA 2PEVA 3W2UA 2UZ9A 2ZUSA 2A3BA 2C71A 4PN2A 2GQ3A 3A64A 3AS0A 2BBFA 2V2HA 2CKSA 1P48A 1JGIA 2ZUNA 3TV8A 4H4TA 1DBTA 2ZWZA 3BDKA 1UD3A 4HSOA 2ZA3A 2NX9A 3D47A 1HUVA 3AIUA 3GS6A 4Q4SA 2QKFA 1DTUA 4DNHA 3VC5A 3HG4A 1I0BA 1XKJA 5DCEA 1K4QA 1TV7A 2X8HA 3H70A 3GC2A 1BWLA 1EDGA 4C1NB 3A4XA 1PKYA 2ZZ0A 1HL9A 3MV01 4MB3A 1HFBA 4GI9A 3IGSA 3W01A 3MMWA 5JBFA 3PSWA 2WCSA 3OBAA 1WE5A 4L64A 2FH6A 5HR6A 2NV1A 1TPB1 5A6SA 3KBSA 2J24A 1T8XA 3AHYA 3UF9A 3C0LA 1W3KA 1YPIA 1I6NA 3C86A 5C55A 4MM1A 4MAVA 2FGBA 1WYGA 3FV9A 3I68A 4HP5A 5DCDA 3SUVA 5LZLA 3CEUA 3ZOAA 1GOQA 4ZTXA 5FF2A 3UJ2A 1GQNA 3TQVA 1FUYA 3FHQA 5E70A 1EEPA 5FS9A 4MOZA 1BVZA 3IJ6A 2BVWA 3GXTA 3L23A 1G4EA 3ZFHA 3AU2A 1QFEA 3O6YX 2DSZA 3A23A 1WYIA 2XN0A 3STCA 1FIQB 4AUBA 1L6FA 1OF6A 1KXVA 1YPXA 4BJHA 3EPNA 4FX6M 4MDOA 1ISWA 2PDJA 3MUAA 1W5NA 4AZ6A 4Q4KA 2ZZ3A 4IFKA 2WPGA 4M82A 1EP2A 3QSTA 1MNZA 3NOYA 4YYFA 1QOPA 1DJWA 2YBTA 3PP7A 3W75A 4J57A 4WLCA 2YSWA 1F73A 4N6EA 1XF0A 4HA4A 3QLDA 2XVNA 3EDJA 1V0MA 3AU6A 5E93A 2QGYA 3F4DA 3CUXA 4N42A 5BXRA 3H53A 3MI6A 4H4RA 4MWAC 3LGGA 4F4RA 2GL5A 4FIQA 1BXCA 3ZR5A 2XG9A 4LT9A 4OU1A 3UVAA 4Q4MA 1H7XA 4PUUA 1NQKA 2CZ5A 4D6HA 4DZIA 1HQTA 1H2JA 2A21A 3GU2A 4UFJA 1BZLA 5DO8A 4LY8A 3JRKA 2JFEX 3VOCA 2FFIA 5CSYA 3AUOA 4FXRA 5BRPA 2AQWA 4LANA 3VNDA 2BY3A 4JEQA 4P7QA 4KIRA 3PANA 3W7CA 4H8UA 3ZJ7A 1QO2A 1CLVA 1WA3A 1S5TA 1LOSA 4IP5A 3PVFA 3N6QA 3RIKA 5FESA 3KE0A 3CT2A 4PL1A 4NASA 4LCRA 4AD5A 5EFFA 2YFOA 2ACUA 3VKKA 1KR1A 3AYTA 4ROPA 3QEZA 4H9XA 4HYVA 3WQ4A 4ZE5A 4DQWA 1E1EA 2W4XA 2Z1XA 3LYEA 2E5CA 3SFWA 4QAIA 4CQCA 4PC8A 4JYEA 3PZ9A 2O92A 1BVNP 3KTXA 3PULA 3M5YA 3C56A 3KS5A 2A79A 1VENA 2WP6A 1NSJA 5FEWA 4L9XA 3AMLA 2VMFA 3MWCA 5ENLA 4M81A 3T4CA 1JD7A 3SSZA 4C6NA 4IL2A 3RR1A 3SUUA 3LM7A 1FWEC 3A13A 3OU8A 5DFAA 3NXFA 3U7BA 2BGSA 2PS2A 5H91A 2R94A 1FKXA 4I5RA 1VF8A 2UY2A 3B4UA 4J3WA 3VIHA 1FWJC 3QR1A 3CQKA 2XYLA 2H9AA 4JKMA 3ICJA 5LYRA 4LUYA 3POCA 3S46A 2IKHA 2X7WA 3QJAA 3BLDA 2I9EA 2PDPA 4XTDA 3ZT6A 3O63A 2C6QA 3W6MA 1R86A 2ZXBA 3VD5A 4DB7A 4OFCA 3T7VA 3GYCA 4UTHA 4NXSA 1NPXA 4J27A 1NEYA 3BLKA 3EZ4A 1RK5A 3LB8A 4XD4A 5AN7A 2PP0A 4UFHA 5A1AA 1UZDA 1R9ZA 4JN6A 4W7UA 5A6BD 3QVQA 1QK2A 5DXXA 3MI3A 1TRDA 1XXXA 3CQJA 4LWWA 3W1NA 3H21A 4P7OA 1ZBVA 4O16A 1V3JA 4V15A 1GVFA 3AHXA 1JPHA 4DO5A 1GYNA 1AJ2A 2J78A 2NV9A 3GDLA 1UJQA 3PB0A 3UJRA 3DFTA 4RZ5A 1OY0A 1UKSA 2E9LA 1XHCA 3UFYA 2WC4A 3B40A 1F6KA 3ARYA 2V5JA 2Y8UA 5HULA 4JTAA 3B04A 4YXGA 3CPGA 2YW3A 5DQPA 5FIPA 5HK4A 1W1PA 3VDGA 1XLKA 1WZLA 4UQAA 3Q58A 3BLIA 2G3NA 3WEOA 3PG8A 1IE7C 4MY1A 3L4TA 1VYSX 1FWHC 3L4XA 1XISA 4GI8A 1GWJA 1KRMA 1GVYA 4C1LA 4JX4A 4WKFA 1VHNA 3SSJA 3HURA 4PSPA 3SR7A 2QJNA 2NQ9A 3PB2A 1VFSA 1W1YA 4Z2IA 3TYZA 3H24A 3W87A 3IUHA 3O16A 1XYAA 2EPLX 3SCUA 5HPCA 2FDMA 3WH7A 4DYJA 2O7SA 5CSUA 3CHDA 1V3KA 1EJTC 4JDBA 1CEOA 3VCNA 4PCPA 4C6BA 2PD5A 2DVUA 3EYPA 3LXBA 4W7WA 1RBOB 1WKYA 2ADAA 4YU1A 3W29A 2WWCA 2HBXA 3UZJA 3LCWA 3CZJA 2PCQA 3S5SA 2VFFA 1SGJA 1JZ7A 3WUBA 1TELA 2B31A 5IBXA 1LT7A 1K77A 2NQZA 8XIMA 2Z1BA 3CGBA 1OJTA 1GJUA 4CUCA 4GY1A 2HK0A 4AF0A 4P2VA 1RPXA 1YRRA 3EEGA 4IXXA 1EYWA 3KTCA 2OSXA 1W0MA 4BFAA 2ZWYA 1KM1A 2RKXA 3COTA 4LAZA 1HKIA 2EG6A 2QHAA 3UXAA 4QBXA 2XIMA 2GJXA 5JQ9A 4UR9A 3WDQA 4FIRA 2OYKA 4M56A 5MKGB 1JYWA 3LHYA 2A6NA 3LENA 1ML1A 1W56A 1L6GA 3A24A 3ZJ8A 1NOUA 3K8MA 3WQ6A 4TOQA 3DKLA 3CYVA 7ODCA 2PF0A 2YVFA 1K7XA 4MB1A 1OFQA 1U30A 5HA7A 1WKDA 3LCXA 4HNLA 4IMAA 4D9PA 1QHZA 3HIJA 2BG5A 4YTUA 4AQLA 1XC4A 2FMOA 3GXFA 3PPCA 4GCXA 2ZUVA 1NIUA 2GGHA 4KCUA 4WXZA 2DUXA 2G3JA 1JG9A 3T81A 1GW1A 3C8NA 1NAL1 3DIPA 1XYMA 3MO7A 3P74A 3WCZA 3XISA 4DLFA 4IX0A 3AIBA 5A2BA 4NX5A 4UR8A 1DWIM 4CCDA 3BW3A 1A5NC 4H7VA 2PDWA 3GFZA 5LIYX 3BAKA 3O0HA 2WSQA 1SJDA 3POHA 3K4AA 2PGEA 4MDPA 2QPXA 3G0XA 2IKGA 1ADSA 1A80A 3MSGA 1YHTA 2XFRA 4ZGYA 4FNQA 1C29A 3H2FA 2O9RA 4J7RA 3LTPA 3LG3A 1WCGA 1XSKA 3N29A 1LORA 2ABBA 4WKHA 4JNMA 4HYRA 1CW2A 4H4QA 4MNKA 5KTLA 1SM9A 4KCTA 1V7AA 3L0KA 1KN0A 4S3GA 3MJYA 4HCHA 4IISA 4Y2WA 3HGOA 3RUBL 3DFQA 5DT7A 4AWUA 1GORA 1UH3A 1G94A 1AK5A 1FEBA 2CLFA 5AYXA 4H04A 3N1AA 4LNYA 3B9AA 3BCFA 1UD6A 3A4JA 3TN6A 3GKFA 3SRFA 3CO8A 3WNMA 1YDNA 4YVPA 3T0CA 4AD1A 3OHIA 4YTTA 1TPWA 3VMOA 2WOIA 1SR9A 1XLBA 2HS6A 3TP4A 2Y62A 4JTGA 1UOZA 3E2RA 5DRCA 2WMIB 4K7YA 3KTSA 3WD4A 1QI0A 4WY0A 1S2UA 1XHGA 4ZQCA 3N17A 1D2KA 3BLOA 4TV5A 4AZCA 1TWIA 1XS2A 3S2NA 1LPFA 4LQ1A 2YCJA 4ACZA 4JIHA 4ZOCA 5GJPA 1V97A 3ZWSA 3LA4A 2H3BA 3PJXA 1IWBA 3TA9A 2C8NA 3KLLA 1ICSA 3VGGA 1ISYA 3WNLA 1PEZA 4TTGA 3OGSA 4B5WA 3AICA 3OYXA 2A7RA 3DYPA 3TNBA 3WQPA 4GGBA 2BXYA 1J0HA 4I7WA 2CW6A 3WL1A 4F66A 7ENLA 4IX2A 2PTWA 5G1MA 1C8QA 3WK3A 4NI8A 4UUIA 3PN8A 4Z1CA 1TVPA 3GFYA 1WDWA 1A49A 1OFPA 1RLCL 4O0KA 1MW0A 3LQGA 4RV3A 2OMAA 4FP1A 1ESWA 1YLVA 3UG8A 1CPUA 3N4EA 1C9DA 1VJZA 8XIAA 3CXBA 1XR2A 1K02A 4W5ZA 5E9AA 3G18A 3HOJA 4C7DA 4A3UA 2QAEA 2PLKA 1VFUA 2FKPA 1XIMA 1S3TC 1E0TA 2V81A 4Z1DA 4Z2JA 3M0KA 4HPXA 3RLUA 3OA5A 3EX6A 4HQVA 4ZQPA 4UFKA 1LRNA 3SUSA 3NPUA 4BR1A 3I7QA 4N2YA 4W86A 3IWPA 2WHKA 3N9SA 4RE4A 1FCBA 2FIQA 3W00A 3LS9A 3T6CA 2NXGA 2E09A 4RDYA 2CC0A 4GYPC 1CGTA 3R8RA 5K9CA 3FSTA 2PWHA 2UY4A 3APGA 3WH8A 2P88A 1KM6A 5LIUX 2CHNA 4E2DA 2OVLA 1SU5A 3KW3A 2ZUMA 3VFLA 5I03A 2C14A 4NU7A 1J2BA 1KFBA 4LBUA 5CZ0A 2BY0A 2FGLA 1YQ2A 3W2NA 1A3WA 4KIEA 1AL7A 1CB7B 1DORA 3PPGA 2R1MA 3RCYA 4F0KA 2PWFA 3UEQA 2PP3A 3M0JA 3VU2A 4HOXA 4PZVA 2UBPC 3DX5A 4V27A 2I17A 1SFJA 3VMPA 4O0ZA 2P10A 3HV9A 2FFCA 7PTDA 1KO0A 1ITCA 3GFXA 3BSHA 1GVRA 4FF5A 1K8ZA 1PYMA 1FWFC 4OOUA 3MCOA 2XGZA 4H4PA 4R7OA 4ZFCA 4A4AA 9XIMA 3NDOA 3P60A 2YPIA 4IMCA 2JGQA 3FY1A 4AIBA 2VEGA 3W1UA 4TVWA 3B9NA 4KS0A 3INPA 3FGCA 3AMCA 3SGUA 2G3IA 4RDZA 1A47A 3W82A 3CQ0A 1Q2SA 5CC6A 2PU1A 1XUUA 2B7OA 1FP8A 1TQXA 2QF7A 1JYNA 4LVAA 5HJYA 3LZ5A 1BSIA 4RXGA 4HA1A 5FJTA 2NLIA 3PNUA 4Z2KA 4O50A 4KPRA 1JROA 2YJQA 4XZ9A 3EA1A 3TTYA 3NDZA 4WRHA 1HJUA 1KM2A 3GHRA 4CQBA 3LMZA 4MWAB 1DPMA 4DJDD 1TREA 2G5WA 4I6KA 4QS5A 4EF8A 2NVDA 2OO6A 1RXOB 2IKJA 1ZTVA 1AQHA 1XIJA 5AHMA 4DVOA 5CLWA 1XPGA 2GGIA 3TMQA 4RUBA 2E6YA 4AWTA 4AFYA 1S5NA 3AXKA 3ZVIA 3OIHA 1VBUA 5FJOA 2PLMA 5BRBA 3VOFA 2VC9A 1W1IE 1QPQA 4NZ3A 1J0IA 3WMLA 2CNCA 4HGXA 3T4WA 5FL1A 5LIXX 2GK1B 2WC3A 4OBTA 5I6SA 2A2IA 1XLFA 3WBYA 5D2XA 3B06A 3PZVA 1ZKQA 2Z6JA 3HZ3A 4XAYA 4WY0F 1H1ZA 4ZBCA 3HRDC 3VKBA 1N7KA 1GGOA 1MDRA 4H7CA 4PUEA 1MQQA 4TX6A 2VRQA 3EOEA 3AJXA 1R87A 5CAKA 4P8XA 2J74A 4JIEA 4OWGA 3TSDA 2HJPA 5D32A 3UXKA 3USBA 3VOHA 5FACA 1MRQA 4YJ5A 1JDFA 5I3KA 1JRBA 1AJZA 3TU9A 5CZTA 4TVCA 2X7VA 4KFNA 3L0NA 3S6DA 5F2GA 2VJXA 1E56A 4EPDC 4JS3A 3WD2A 4J2PA 4ENLA 4F79A 4I5XA 4ADWA 2RFGA 2PDBA 3B97A 2VO5A 2Y7DA 4O53A 1K1DA 4V2XA 4CNPA 1HJWA 1I1WA 4FI4A 4KEUA 3N14A 1XC6A 4ORIA 4WX2A 1V6VA 2WKLA 1V6UA 3LUTA 1VZWA 2RUSA 3CZ8A 4KETA 5F1VA 3TC6A 5CG7A 1DXLA 3VOIA 4HT3A 2X42A 3RNMA 1KLZA 1ZBWA 4O4WA 1SJCA 1OX4A 2Y88A 1W5OA 4YHGA 4XUGA 3GRTA 2WPBA 4JYFA 4WQ6A 5CZJA 3QPEA 3BK0A 1JRCA 2ZE0A 4UQDA 5AYIA 3SI9A 3UZXA 2VFGA 2WCGA 1QW8A 2X0HA 4GZEA 1ZAHA 3R11A 2JK6A 3EMCA 3SN4A 3WLLA 1E9ZB 4QROA 2CLHA 4GGHA 2WSKA 3BV4A 4P5UA 2YQUA 1GVOA 3FJLA 3WBEA 2NUWA 2DEPA 3V75A 2O9OA 2VELA 1SFSA 1JCMP 4KCVA 2PZNA 3MUXA 3IVTA 2V8ZA 3U7VA 4LA1A 3LERA 3W1RA 4W8AA 4K6AA 1GKRA 4RDVA 3BCDA 1SPQA 4LRTA 2YVJA 3ONBA 5C7HA 1A0DA 1S2CA 1W1TA 1XBZA 1V5XA 1L6YA 4LC6A 1F3XA 4F9DA 2RGLA 5EMYA 3E2SA 2OT0A 4C1NA 4JNYA 1E51A 1XANA 3HJEA 2OKOA 1FH7A 3GNXA 4UNLA 1BF6A 3PF3A 2NQ5A 1XPYA 5FJUA 4J56A 1A5KC 1TPFA 1YPFA 3LLXA 1YDVA 3CPRA 4XWUA 4O1BA 1WAUA 3BVJA 2ZA1A 3GBEA 1V51A 3QGKC 5ER0A 2P8BA 2VP8A 2YAUA 1DHPA 1H62A 4DJEA 1H1NA 4EAYA 1RQHA 4O13A 4ICNA 2BB0A 2Z27A 3V5FA 1WXZA 3UWWA 5FKYA 1JCLA 3GH5A 4P8UA 4CD4A 4JCLA 2YOCA 3ITTA 4Q8WA 4BCEA 5H8UA 4DI9A 4X22A 1UR9A 3UZZA 4MNMA 2JKEA 1GOXA 1JCYA 4XZHA 1FX6A 5CPSA 1Q6OA 3MW7A 4N02A 1DJYA 1C8VA 4M1BA 5FA5A 2CLOA 2DZTA 3I10A 1IIHA 1XLEA 1DIDA 2DY3A 4JHOA 1LBMA 2W0UA 1M5WA 4A6GA 2CFYA 3KFTA 3GXDA 1N82A 3QFAA 4NZJA 4IMFA 3P80A 2G4FA 1TE1A 4EK7A 2A3CA 3NO1A 4GACA 4H3DA 3G3DA 3DXIA 4S3FA 1QXLA 2J9YA 1TZZA 5D09A 4PMDA 1DYSA 1OJXA 4LIIA 3F5KA 4W84A 3W7QA 3GO2A 1RQEA 3K1GA 2GDUA 2V5BA 3RCMA 3EX1A 2XU2A 4G6CA 4HU3A 3KBWA 1QNRA 1LDCA 5D33A 2WJFA 4LUTB 1JEZA 2C3CA 4GZJA 3I3DA 1UKQA 1IHIA 4DAFA 2WJDA 1JZ5A 5DT5A 4JTHA 1DJGA 2UWFA 3GNRA 3VUSA 1HVXA 3B8SA 4CEUC 1GSNA 3OG3A 5C9WA 2HPMA 1S39A 1ZS2A 2HZGA 2DW7A 1POKA 4EIVA 3UPWA 3HGRA 4QCFA 5IXEA 2XM1A 1UKPA 3PFRA 2Y5JA 1U5HA 1EPXA 4JL2A 2G0WA 2VDIA 3CB3A 3VK5A 2VEIA 4UC5A 1JDDA 4ZO9A 2GVGA 1G1YA 3G0SA 1KQYA 1L6WA 5D9OA 4GLEA 3F03K 2VFEA 3KS6A 1VCGA 4AIEA 5EY5A 4CCEA 4F0SA 2DZSA 1LWIA 1EP1A 2I14A 3CH9A 4LGXA 3UYCA 1G01A 1QHOA 2WO5A 3AS3A 2GUBA 1MWOA 2NVAA 2V2DA 2WLZA 4LCSA 1MOKA 1EIBA 4S3BA 3I7SA 2INEA 2XINA 5GQBA 2CBJA 4ONVA 3A4WA 4AYSA 3U2EA 1TPVA 1BVWA 1XH0A 2RGMA 1E43A 1OF8A 4ILSA 2PDXA 5LHEA 3GU9A 4F48A 3H7RA 4H6QA 3WMSA 2ZZCA 4FOUA 4WOZA 1IEIA 1ZPTA 3SFKA 2J8TA 4Q4QA 1W3JA 3W7LA 5TF0A 2D69A 3F1QA 1MFUA 2H8ZA 3B8DA 4ORMA 1WO2A 3PZMA 1RAKA 2JALA 3MP3A 1EC7A 3EDFA 3VZXA 1CXHA 5IHSA 3K2GA 3AZRA 2V0TA 4JTLA 3WLPA 3UNTA 3M7WA 4CNTA 1W5MA 4W7VA 5JCLA 1JI1A 1UBSA 2ZYFA 4LW7A 3PK7A 4WCJA 2YXXA 4LAKA 3MSRA 2FHFA 3UY8A 1G9HA 1FFQA 1QK0A 2PDUA 3DK8A 1F61A 3BV7A 3TYAA 3WDJA 1XGZA 4EM3A 4DXKA 5A8NA 4GQBA 2FQIA 3EXSA 4MJMA 2BDQA 4AD0A 2R9ZA 4DEFA 1E0VA 3N3TA 3NDYA 3CL8A 2Z2AA 4UFLA 4M3PA 2XJ7A 1FWNA 1FDJA 2OKTA 1JXKA 1DJNA 1LLWA 1BWVA 3W23A 2ZE3A 4AZHA 3E5BA 3B8IA 3L21A 3V7PA 2IPFA 3GC5A 1S2AA 1NDWA 4FALA 3VOJA 1EJVC 4ZE4A 2YKKA 1R7OA 2XSXA 1FWBC 3ABSA 1N63C 1VDVA 3HGSA 4AISA 4WJ8A 3EX3A 5A3HA 3FFSA 4R9OA 3A5VA 1GRGA 4XVEA 3EOOA 3H2CA 3PUDA 1PO9A 1RA5A 1GHRA 2OEJA 5HQLA 2NW0A 2L5HA 1DJZA 2VM8A 1EF3A 2C18A 3N34A 1O5XA 4JBRA 4QX4A 5F4WA 1PWLA 2DSUA 4FEZA 1EBGA 1POJA 1VYPX 4KCWA 3R8GA 4ICMA 4IPJA 2MANA 3NNTA 3MS8A 7XIMA 3GM8A 3NO3A 5HWMA 2I5QA 2Q8XA 3MU7A 2TRSA 3KDOA 4HSNA 3ZLHA 3RLVA 3CWNA 3ZXWA 4M19A 1LLZA 4H9ZA 2EPMX 1PB0A 4MSSA 3TVAA 5HBFA 2QIIA 1K3UA 1BKSA 3LHWA 5HMDA 1EC9A 1H09A 4W9TA 3U5UA 1V02A 3UW6A 2VEPA 3TEVA 4HVXA 3ZYZA 1IR1A 4UTKA 3IGXA 2HQMA 4JD4A 4RNJA 4JX5A 1ZJHA 1QCWA 1SZRA 2OEKA 3M0MA 1ZU8A 4JFWA 4DN1A 5HATA 3BMWA 4JPGA 1I60A 1J4EA 4LEFA 3FK4A 2OELA 2OZ3A 7TAAA 5C8BB 3T78A 1EOMA 2V68A 4DF2A 1D3HA 3H23A 2ISFA 5ECVA 3TJIA 2QXWA 1XLMA 3VD3A 4IFRA 3NQ8A 4JQ3A 1N61C 1UKOA 2ZBTA 3H54A 1KFCA 2WAGA 1AD4A 4ZB0A 3MVIA 3ANVA 3FHAA 4K39A 3SQPA 3LX9A 1QNSA 2XIJA 4FZIA 3C2OA 2GOKA 1S3HA 3GH7A 3LU2A 3M5ZA 4Q8MA 2WBGA 1E1CB 5LNUA 4NP7A 4QHRA 4LS1A 2VR5A 3BMXA 1T8QA 1B3YA 3STGA 4M6UA 4IQEA 1DE6A 1YIXA 3G6MA 3PWAA 4LS2A 3M0ZA 4MYAA 5MKGA 2XPKA 4GINA 3LRMA 2I1OA 6A3HA 3UPMA 4NJHA 1OWQA 5IOBA 5DY3A 1M9HA 5G4HC 4C90A 3NIYA 2HQAA 2ONEA 3SCWA 4JKKA 2E5AA 1WDPA 1E6RA 3ZWTA 3QZEA 2DP3A 2D24A 2YIHA 4I8DA 2VGIA 2DDXA 3N11A 4CGTA 6ALDA 2VEFA 2XZ7A 3MHUA 3E6EA 3FG2P 4NL1A 2NZLA 1YNPA 2WPEA 2J25A 1DQWA 1BRLB 4HD5A 1GK8A 3CLMA 4D6DA 4J35A 5IDIA 3SEPA 5LA0A 2CERA 1ZNNA 4O12A 1G5AA 3BICA 3R0DA 5LIKX 4Q8TA 2GR1A 4Q6XA 3WUGA 1OD0A 1SO6A 4R9XA 3O2LA 5XIMA 4O11A 3WNPA 1XCFA 5B80A 3D3FA 1XDIA 1PCKA 4K8HA 3TZNA 2J66A 1RBLA 1LF1A 2ZXQA 2QJIA 3LNPA 2BV9A 3HTWA 4D71A 4CNSA 4YL2A 4W8LA 1A5UA 1XWYA 4H4WA 1QI3A 3TW9A 3Q67A 1UJPA 4OBRA 4LUSB 3HJZA 1UH2A 3ZT7A 5FAJA 4DHGA 5JCKA 2Z00A 4KPLA 5REQB 1ODUA 4Z0SA 1TUFA 2YXGA 3WFAA 3W7HA 3VD4A 2TPRA 4U2YA 3RRXA 3F2BA 1I0DA 2XIOA 3UR8A 4GNVA 4GUFA 1O1ZA 2CYGA 3KX6A 2FDSA 2X2YA 3LMYA 1VCFA 3GXPA 1IYXA 2WMIA 3N2CA 4UOZA 3L65A 3WLMA 2ALRA 1C91A 5H6HA 3WH6A 3GU1A 3AZTA 3BURA 4ES4A 1PX3A 3T05A 3WQFA 1XG3A 3T09A 1VQTA 1MXGA 2R1LA 3QXBA 4RXFA 4QJ4B 2IQ0A 3TJXA 4LCQA 3L4UA 1ZUAX 3JZEA 1Q6RA 1J0ZA 1ONWA 2KAUC 4H83A 4DO7A 5J04A 5HUOA 2W27A 1GZGA 3O0KA 3W6LA 5D2YA 4YLWA 3CWOX 1Z69A 3TQKA 4L1WA 2W0HA 2J8FA 3GKAA 3NVVB 4CCZA 1BYBA 1UD2A 2JQXA 3CUIA 1KCLA 3NQVA 1XX1A 1MRAA 1W17A 1H61A 1QOXA 2EQ7A 4GIYA 1EF2A 2PSNA 1EGMA 1ONEA 4TQTA 4AHOA 1FXPA 3CMJA 3EAUA 1W9XA 2YX0A 3E9AA 1TJRA 2Q3OA 4L6DA 1XIFA 3MY9A 1SZNA 3NWRA 2ZFAA 4LFYA 4QLLA 4XX6A 1V3IA 3DC8A 3L5AA 3IANA 3HO8A 2WYSA 1DHKA 1HKJA 1XL9A 3TH6A 2BS9A 2OJPA 3LDVA 4W4QA 5DANA 1H7OA 4DM2A 3QBUA 5GNZA 4XZNX 1LL4A 1BLIA 2VCBA 5DLCA 4PR4A 5BW6A 1N8WA 2R91A 4HA0A 1NWRA 1ME7A 1NFPA 4G7EB 1E0WA 4UQBA 1BQGA 3R58A 3IIXA 4ROQA 3OZPA 3IJDA 3MHFA 3IV8A 4A8NA 1E4MM 4H01A 2XFFA 4RDWA 4K2SA 1KRAC 1F6PA 3M41A 4PRWA 2VR2A 4PMNA 4S38A 2VWTA 1S5MA 3VIPA 3OW1A 4LYQA 4GO9A 4CN1A 1CI1A 1D8CA 4DNMA 1DTNA 1V6XA 1S5WA 1WV2A 1E9LA 1ZJIA 2DH2A 3STPA 3GRIA 1F07A 5I3HA 4KBXA 1CBGA 1XLGA 3L68A 4EMWA 2Q8LA 4R7WA 3CV7A 3UYIA 2OTDA 3BANA 1S1RA 4HCLA 3TTOA 1XYCA 2QJMA 2BC1A 3WSUA 2ACSA 3Q4DA 4LXFA 6TAAA 3DECA 5HAOA 2GJNA 4ZQNA 1UWIA 3CWHA 1GNXA 4JXCA 4IICA 1E6ZA 3V1HA 3GG7A 1PV8A 2G3FA 3S1UA 1J01A 3IJLA 5HMSA 1WKEA 4B15A 4NSBA 5AZ0A 4H4XA 4JQ4A 1KRBC 4MFDA 3K1DA 3QHMA 3TN4A 4ZMGA 3DFPA 4L5ZA 1D7FA 1HX0A 1EIXA 4Z17A 2C19A 4I3GA 2R14A 1TWWA 3GH4A 2QCEA 1W9DM 1JFXA 1GZ1A 4FOJA 4IT1A 2GUUA 4IMEA 5I07A 1PX8A 3BLPX 2W67A 2ASHA 3DK9A 1P0BA 3P84A 1K8XA 3H2NA 3LZ3A 4MWAA 4V28A 3ERPA 3ENLA 3GWQA 3GAYA 1Z8AA 1KFJA 4MUPA 4YN5A 1C92A 2PMQA 1B9ZA 3ITCA 3AC0A 2VUYA 1QATA 3THDA 4APNA 1HNYA 2QS8A 4XKYB 1QDSA 2P3EA 4O1FA 1TV2A 5C2XA 3IEBA 4R85A 1NM9A 1EHNA 3EDDA 1EJXC 4HPJA 4C6IA 2G8ZA 4K7VA 3VM7A 3VDCA 4JAWA 4RE3A 3KZPA 3EMQA 1BYAA 3W70A 2GK1A 4BQ2A 1ZP4A 4QDPA 4HNTA 1B3VA 4HIBA 2VOTA 3DEQA 3APYA 3C2VA 5IHRA 2J7HA 3BUVA 3HPSA 1FBAA 1F6YA 1MZHA 3IGUA 1Q45A 4UTLA 4PB4A 1R3WA 2VQUA 4MY9A 4BF5A 3PZQA 1K9FA 1B57A 1R47A 5A6LA 4LUJA 2V2CA 1E6PA 4DBUA 1V93A 4B3ZA 1C7TA 1HGWA 4B3LA 2O56A 3NVYB 2QGHA 1O1HA 3F2CA 4MTVA 1BQCA 4AY8A 4RNIA 3MBFA 2HISA 4G8TA 1Y5XA 1LQ0A 2ZX9A 1R30A 2ICSA 4H9TA 1JZ8A 5K9DA 3CV1A 5GRTA 1R7AA 3SCNA 2JEQA 3PZUA 3SRDA 1FHUA 3N12A 1WUFA 3NYDA 1XQLA 5LNWA 1JQVA 2GFTA 1LOQA 1DL3A 3G2GA 5CKSA 4DI8A 2QJHA 2PFHA 4GJIA 5CJNA 1CXLA 5CGTA 1V0NA 2ZUWA 1NFGA 3SR6B 1FWSA 3LSBA 2W62A 5XINA 2PCEA 3PAJA 3E12A 1Z6KA 5CBBA 1QPNA 2V5KA 1OC5A 3ITGA 3WNNA 3A5FA 3WLSA 5CC7A 4MY8A 1TX0A 3LQLA 1QAPA 1KC7A 1J2WA 1E55A 1ZB5A 1AH3A 1US3A 5KZMA 3G1VA 3E0IA 5CPOA 5C54A 1N8IA 3VX0A 3KOXA 3MPGA 4GYJA 1UZ4A 3WL0A 4A21A 1XIGA 1KBIA 2J47A 1KTCA 1LJYA 1OD8A 1IT7A 3VOGA 4AZ7A 1TX2A 1LRTA 4ATDA 3MKCA 3UNDA 1XD1A 2HVNA 2Z7KA 2QVHA 4GX8A 4Q8QA 1W9BM 4NYYA 4W88A 2ZUTA 1DJHA 1OFAA 4IIHA 4QM1A 1W5PA 1F3TA 3BO9A 1QHPA 4JTCA 5CSRA 1VJSA 3TN3A 4ZB5A 2Z28A 5KEZA 1Q85A 3KEHA 4OJYA 3NQ7A 4XG1A 4U5IA 2Q09A 4Z1BA 5C70A 1DJQA 2E8ZA 3TKFA 2NVKX 4QTGA 4KRTA 3M7SA 4H6KA 3AWNA 1W8GA 3GD6A 4HTYA 3SB0A 3WLJA 3QSRA 3W6YA 3R13A 3W73A 2YCLB 4PMXA 1VFOA 4LAUA 2GUYA 3Q37A 1O94A 1R2RA 1HVQA 3NL2A 2XVKA 1R85A 5A2CA 2CZDA 4QG9A 3CC1A 3B0VC 4O4VA 1MQRA 3RPMA 1CXKA 1NH6A 3CU2A 1D9EA 5D2TA 4QNEA 2D2HA 4DJDC 8RUCA 5LXEA 3KRBA 3AJ7A 1R2SA 3LCFA 1J6OA 5E0KA 4LJ3A 1XIEA 1EXPA 3HMJG 5HR7A 2BOFX 2WNQA 1MXDA 1QPRA 1F2JA 4PA8A 1R0MA 3TONA 4AD2A 3M46A 1ITUA 1AQMA 2WM1A 4W85A 4WR3A 3ZLFA 2C0AA 1HT6A 4JTJA 4JTKA 1J8VA 4MUZA 3NR0A 2OWWA 5JXQA 1ZY9A 4XBSA 1KA9F 1UC5A 2PWVA 1VIWA 1SW7A 3WG6A 1K4HA 1S2VA 1CWYA 2X99A 4HNNA 2Z0IA 4O1EA 4GO8A 5BCAA 3LPOA 4EAMA 1TPH1 3NG3A 3ATYA 3CL6A 4C7FA 3VM5A 3OLEA 3W1LA 1STZA 3P82A 1CTNA 2XWDA 4LUTA 2CKRA 2DIJA 1Q4NX 2BTMA 3TC3A 3PUEA 3Q2DA 3LD5A 2X40A 3QV7A 4FX7A 1O68A 4RL3A 4MAZA 2QAFA 3LB0A 4BF9A 3EB4A 3NQAA 4FSAA 3PC0A 1V7YA 4HHHA 1QPKA 2F7FA 4B92A 1W1VA 3AMGA 1UWUA 3PWIA 5BWAA 3WQCA 2A7NA 3AHTA 2WW5A 1BAGA 3KXQA 1W1B1 3T0DA 3U4FA 4WGXA 4RNFA 1NDAA 4H4ZA 1YQZA 4JQ2A 2VRKA 2DUAA 1V79A 4X61A 3W88A 1H41A 1ONFA 1FTXA 2VCAA 2B7QA 2BLEA 4WUIA 1VS1A 1LQAA 3KUMA 4PSRA 2WP5A 2YBVA 4HA3A 3N25A 1UZ1A 3ZM8A 5D8ZA 2DGAA 3VIFA 3B8WA 4FPSA 5GPRA 3CAVA 1B90A 2WLYA 3DKJA 5M2FX 3PTKA 4UTIA 3C8FA 1XKYA 5A2AA 3TSBA 1R46A 3RF9A 1RCXB 2V5LA 2DPEA 1FVPA 5JCIA 2JEPA 5I3JA 3MDUA 2TSYA 2E5DA 1E0UA 2YYTA 1F7BA 3MB9A 1P1XA 3P8IA 3ETRB 4X9SA 4XIAA 3E49A 4PEKA 3BAWA 1KBBA 2E3TA 3D9XA 2XVPA 1JF6A 1UPPA 4GABA 1PTDA 4E0CA 3NVZB 2E9BA 4PUDA 3GXMA 2DVTA 3SM0A 1R2TA 3SGGA 1QPOA 1M1BA 3EDEA 3GAKA 2INFA 5D8WA 1Q63A 3APTA 5CPMA 3BMVA 2Y1HA 4NZFA 2G41A 2QYGA 2NWRA 1TYTA 3CZLA 5HUPA 5M17A 1J0KA 5EFDA 3UWZA 3M43A 3RJYA 3PG6A 2Q71A 4HU8A 1AJ0A 3N04A 2C79A 1ICQA 1DNCA 4KF1A 1ZBCA 3W7KA 3IGHX 3QV8A 4ZOHB 4HNUA 2PBOA 1K7FA 4MYXA 4Y7EA 2OWXA 1A5LC 3THAA 1LVLA 1M04A 4UNKA 2Q01A 3VIGA 3HG2A 2WPFA 1TIWA 3N6JA 1EQCA 3VO0A 1W54A 2GRTA 2Y7FA 1HKMA 1SFTA 3G0UA 2NPXA 3MUZ1 2EQDA 3M0VA 3R94A 3ATZA 2WBAA 3W7DA 4M7SA 1T6MA 1V6YA 4ERAA 2IXVA 3PTQA 4WHBA 2HXTA 2JIWA 3BGGA 3BJFA 1P6CA 3QPZA 1Y7VA 2NSOA 4ECLA 3OG2A 2XDFA 1T41A 1J5TA 2XWEA 2OLAA 1G7UA 5HNNA 3IARA 1X96A 5BYWA 4NKCA 1GQIA 3TYDA 4C6QA 1OT1A 3PJTA 3WUEA 5DMNA 3V0UA 4CU7A 4IIDA 3ARZA 5HNUA 2J7BA 3OC4A 3NFUA 1F3EA 3DGBA 4ATWA 1G0CA 1QVBA 1EJRC 2VOMA 4Y9PA 3R0KA 5JH1A 5CPQA 2XSAA 3C61A 3RO6A 5K4XA 5FS8A 2EQ6A 1VPXA 3IC9A 2O9PA 2EF9A 1SMAA 4D6CA 5GNXA 4LEQA 2J6XA 4NX0A 3KP1A 3ITLA 3TYBA 1U5JA 4AC1X 3OVQA 1GVEA 1OHLA 4LALA 2GZXA 3LTYA 2XTKA 1TSIA 1XLIA 2WWDA 3G1FA 5HXMA 4AIUA 5EBAA 3FVDA 3MUIA 2F61A 1PBGA 3DG7A 1WZMA 4KKXA 4S3DA 4L4MA 1JPKA 3NQGA 4TX8A 2F6UA 5KETA 2WNWA 4O1CA 2BSLA 5CQ1A 3RX2A 2HROA 2PDIA 3G1XA 4GOAA 1YDYA 5M1TA 3O1NA 3THCA 2E1WA 4HMCA 4BKNA 4GYPA 1NFBA 2YCEA 4M24A 1SQ7A 3CH0A 4GFSA 1K9TA 4FF7A 1JNDA 4CU6A 2V6OA 3L2LA 3QC3A 5TBOA 1T0OA 4GFIA 4J3SA 3BAJA 1TV4A 1WOBA 1OGSA 2PDHA 1RLDA 1KGXA 2YDSA 2WMJA 3FYPA 2FHCA 1GOKA 4A8LA 5FJRA 2OQLA 4H6RA 1EUAA 3TZFA 4CKQA 2BWGA 4FDCB 5I23A 1GRHA 4Q8UA 5FJJA 5J5RA 3PG9A 1QO5A 3NM1A 1H3GA 1MDLA 4NVTA 1AODA 1VEMA 3W53A 4PBEA 2WZIA 1E1CA 1JDAA 1PDZA 3DG6A 4QISA 1ZL1A 3GSMA 3CS2A 2Z2BA 3T2OA 3VTRA 4HHMA 1A5CA 3OBEA 1DXEA 5I02A 5KZDA 3URNA 2IPWA 1BF2A 1ALDA 2WVVB 3CZKA 1KFEA 4E2VA 4YYCA 3URQA 3FIGA 1YX1A 3R1ZA 4JFVA 4U4MA 1VEPA 5HOSA 1M01A 1ZCOA 3DENA 1P4CA 1EZWA 3ALFA 1LL7A 2OSYA 1V8EA 1JZ2A 1RUSA 5D02A 5F2LA 1JUEA 3CHEA 4LVGA 1ZQ5A 3LXDA 3BJSA 4NJGA 7A3HA 4NNAA 2Z2UA 2CU0A 2GJPA 2FZNA 1E70M 1DE5A 3ONCA 5K7JA 2X50A 5CGQA 2GQWA 1EO5A 1P7TB 3FJNA 1K6WA 2WM0A 1H4PA 3R79A 4IL0A 1BRLA 3AI0A 3CZEA 2VXNA 3BL3A 4ZL1A 3TW7A 4MKSA 2FGZA 3SZ8A 2IQTA 2C1IA 4IQLA 4GQGA 1ZP3A 4AXNA 2Y8VA 2IPGA 4S2CA 2CLKA 1XW8A 4QQUA 3GVGA 5CEWA 3ES8A 4IIEA 3L2MA 2IPJA 4D1IA 4US5A 3SECA 4LH8A 5BOFA 3WNKA 2GVLA 1TV5A 3WD3A 3VMNA 3F4WA 1B4KA 1I2RA 1V6TA 4OECA 3FXGA 4RW3A 1TJPA 4RX0A 2PTXA 1JXJA 2P0OA 3WQWA 1RZMA 3CUHA 2VNCA 2FHBA 1JOAA 2OPJA 1NU5A 1UD8A 3PUOA 2ISWA 2Z4GA 2YR1A 3DFYA 2EQ8A 3A3HA 3VIKA 5CJMA 1U2YA 3GDKA 2CEQA 1MMFA 4LUSA 1IGSA 4S3CA 5DBUA 1UOKA 3LRKA 2XISA 2HRWA 1FWGC 1OC7A 3N9RA 5HNTA 1I2PA 2E6DA 5REQA 2ZRVA 1H2IA 5AHIA 5FF4A 5HINA 1RP8A 1UR2A 4JTIA 2W3RA 1NARA 2CZEA 2QDHA 1AFSA 3B9EA 1R9YA 3C2YA 1FH9A 4Q8VA 4JCMA 1RPKA 3PBYA 1XP3A 1FH8A 3WEMA 3SQMA 3T2PA 3E3HA 5E09A 1GKPA 1YBQB 2OODA 4PUWA 4B9ZA 1XUZA 2AKMA 1O5KA 3FYOA 4HZ6A 3PZTA 2POTA 1NOFA 4H4YA 2P1FA 3FW6A 3TYUA 2PPGA 1YE4A 4TUFA 4EF9A 1O5QA 1R3YA 4Q8PA 5DMLA 3HQOA 1N5XA 3T44A 1TMHA 2X1IA 2XGIA 1CYGA 4Z1AA 1UR3M 3FA3A 4E5TA 3R25A 2J75A 1XRFA 1FWAC 1ZLPA 5I78A 3TMLA 9CGTA 2GH5A 4QR6A 4GYKA 3M0IA 3AYVA 1LROA 1EXBA 1YDOA 2QW5A 1S46A 2O4MA 3P67A 4A2RA 2ISDA 2CXEA 2QV4A 3AISA 4LSBA 1X7IA 2YCKX 3DC0A 1RM6B 1H50A 1ZCCA 3NVTA 3QTPA 3OQ8A 2ZCGA 2X8GA 2HV5A 5I3IA 3NQBA 3S3GA 5L6UA 2CZVA 1MUMA 1UPMB 2DU2A 4I9AA 5LGXA 4QFUA 3BXWA 3LGEA 3VNLA 1Q7ZA 1VBHA 2DVXA 5CH9A 2OG9A 1A5SA 4L4LA 4HNOA 3IJ8A 1F8IA 3HU7A 1MO0A 3DI0A 3BE7A 3KWSA 3ZIZA 3TIMA 3HM7A 4Z2HA 3DAQA 1J6PA 1PXGA 2P76A 1YTEA 3U57A 2B81A 2Q8ZA 1P0KA 3E0FA 5J8LA 2OZ8A 5ABEA 3OGVA 4D6IA 1XH2A 1WDSA 5A8MA 4F0HA 4AD4A 3LBOA 4WJEA 2D2GA 5EKYA 2ALDA 2ZZ6A 4G7EA 1GERA 3N3MA 2PURA 2R8WA 2OGJA 3LLFA 4TU1A 2ZQ0A 4M7TA 3PNZA 4GVHA 4ADSA 4UQCA 1KLYA 2OX4A 3N4AA 3R43A 2H6RA 2AGTA 4AB4A 3GG0A 1MUCA 3VZYA 5E5CA 3OPSA 2TODA 2ZUUA 3MZNA 3CUZA 3EWCA 4D6GA 2BVTA 1JYXA 3DJJA 4IMDA 3MYOA 1CXEA 6XIMA 4BZYA 3UVIA 1EB3A 1LZOA 3P0XA 1SVDA 2DQWA 4ADTA 3O15A 4KFOA 2B7NA 5DMYA 3FJ4A 2WJZA 1UR0A 1TV3A 3EX2A 3M0LA 3II4A 5KSWA 3PPHA 1UUQA 3M0XA 5LNSA 1E73M 3LBCA 4IPIA 3WF3A 2SFPA 4HCDA 3RK8A 2Z26A 3UD6A 3B9OA 3H4XA 4QAWA 4B16A 4PMUA 4N7QA 5BNKA 3N2TA 1T40A 2CHRA 5H8PA 2ZZ2A 2VWSA 2GGJA 3BW2A 1T96A 2GYIA 4FNPA 4HU4A 3IK2A 4LOCA 2AMGA 1BYCA 1IXPA 1RALA 2HK1A 3FEQA 3GLCA 1JULA 3MKKA 3TJ4A 4ZEPA 5CGMA 5I09A 3KOYA 2PWUA 4PRTA 4IIGA 3O3RA 3WIJA 1BWKA 4NAEB 4JIIX 3MSYA 2F2HA 2CLPA 3KHJA 3BJTA 1FWIC 2W5FA 2VZTA 3STEA 4H00A 4YHEA 2VTFA 5JIPA 4ZO8A 4PMVA 4REQB 1DWJM 5T26A 3QOMA 2W91A 4LRSA 3AROA 4H8VA 4P8WA 4A8RA 2DT1A 1JL8A 5CXPA 5D2VA 5HJXA 1B31A 2CLIA 2UY5A 4UZSA 2WB5A 1GZJA 3JR2A 1QNOA 3ZZ1A 2F8QA 4J3UA 1TZ7A 4XKYA 4ASTA 3ZSSA 3OOQA 2W92A 4CQ8A 3MMDA 2EHHA 4HK7A 4L56A 4DO4A 1YW1A 2CCRA 5DELA 3SJNA 1BPLB 5GNYA 1JEHA 4Z42C 1X38A 3B03A 4GC4A 2VZOA 4UOJA 4L1GA 2YDAA 3WDPP 2HVOA 2RDXA 4DO6A 3JUGA 1KBLA 5A95A 3DHDA 4GHRA 4AU0A 1UC4A 3W1AA 3P7YA 1NF7A 1GUVA 3AXXA 3M16A 4WVXA 4JTSA 3VFCA 3LBMA 2BC0A 4GVFA 4QE5A 4IIFA 1RVKA 3EDKA 1DOSA 2EGZA 4Q7NA 4GUIA 4OGZA 1NELA 4CNOA 5A6AA 2EBNA 3MP5A 3C0JA 2ZVIA 1QW9A 4X63A 3EWXA 5AYYA 1I1XA 1UWQA 4RW5A 1GREA 4XZIA 4FS9A 4RR4A 4FAMA 2HBVA 4WSJA 1H11A 3C6CA 3W7MA 3H4WA 4AVNA 2JF6A 3HB9A 2VCCA 4I90A 4AVFA 3RM8A 3GXNA 3WY1A 1XIIA 2E68A 4E8GA 3SW6A 4FNSA 1Y5VA 1H7RA 4S39A 1SB3B 5JMUA 2D0GA 1OB0A 1XCWA 4G9PA 4C6JA 1NJJA 2Z1VA 3WELA 3AXIA 2Y24A 3HPAA 3VKAA 4XV0A 4UR7A 2W63A 4H9MA 2BVYA 4XK2A 4WKAA 2ZTKA 2ZXAA 3UGRA 3GG8A 4U3CA 1FFUC 5AHNA 3L0GA 3J7HA 2MNRA 2FJKA 3NCOA 4KRZA 5SWUA 2PDCA 2PDNA 8TIMA 3R4IA 4XISA 3T8LA 1QU4A 2GOUA 3AIQA 3FDGA 4N4PA 3TX9A 2QDGA 5EBUA 4FXJA 2FTWA 1ADDA 3PS7A 2QULA 3CIWA 5GJNA 1OFEA 3UR5A 4HTBA 4NZ4A 3NJ3A 4C6FA 1OGGA 1QASA 3S5YA 2WANA 3A47A 3GTNA 4OIFA 1FFVC 3C2FA 5CC3A 1MVYA 2BZNA 3U5YA 1XG4A 3UCCA 1XBYA 4UZUA 3S2LA 1Q6CA 5TD4A 1BD0A 2OLSA 1VHCA 3BG5A 4W89A 3VCCA 2EQ9A 1EX1A 3UWUA 2INZA 5E1QA 3ZVHB 3FYYA 2PLJA 4O28A 1DKWA 4QDMA 3WBAA 1DP0A 5KITA 5JH2A 4FLQA 2XH4A 2R1PA 3NSXA 3LI1A 4BY3A 1U1JA 3FA4A 4LBRA 4CNNA 3VNKA 1V59A 4OTKA 2ATMA 4KESA 3QN3A 4DBEA 3LPPA 5AZ1A 3SUWA 1H60A 4XO7A 4Q6JA 2JIEA 4U31A 4AX6A 4O8RA 2C1GA 2PE4A 1GTEA 2FH8A 2YCLA 4M51A 4I9JA 5MF5A 3EUB3 1GCYA 3AHVA 4MJ4A 5TAOA 1ME9A 1RK6A 3ITVA 3DH9A 5G2IA 3UBPC 2P3ZA 2RJGA 3DGHA 2FYMA 2QCFA 5DMMA 1XDMA 3HFYA 3S5NA 3WMCA 3ORWA 1UKTA 1W9UA 2QT3A 2REQB 3G3MA 2WQDA 4Z2LA 1W3HA 1V08A 1LM1A 5FSDC 4CN4A 3IRDA 1RQBA 4TVUA 4AX7A 1QNQA 2C91A 1K4GA 2WHMA 4S23A 1MZRA 3TW6A 5A8GA 4DWSD 1R3SA 3IIVA 1GJPA 3TR9A 3CTLA 1I4NA 2FZBA 3WQGA 1F9CA 3T9PA 3SN1A 2Y8KA 4MVAA 1CGVA 4O14A 1BHGA 4Y6GA 4AZBA 1X8CA 3SN0A 1UR4A 4QRNA 1D3CA 2W55A 3H7UA 3AHZA 4MB4A 4WF7A 3GQYA 4AXKA 3F4CA 3EMZA 4O57A 4AAJA 4HK5A 5KINA 3T42A 1U1UA 4K7ZA 4NUWA 1VP5A 1QBAA 1H5VA 5E6ZA 3NSNA 5JBDA 5EYWA 2RABA 4LV4A 4DJFD 1IWPA 4ZXLA 2CLLA 4IUOA 1ELSA 1SW0A 4I9TA 4FX8A 3GR4A 3FS2A 1GVIA 3DJGX 3ARSA 4LYPA 3TE9A 3TWBA 3PUGA 2FPYA 2VX4A 1UA3A 4MIMA 1FCVA 3HFTA 3MI2A 3FOKA 4J3ZA 3CGTA 2C15A 1WZKA 4UTTC 1OADA 3IJ7A 4QSHA 3NQ2A 2PB1A 3K8KA 2E0PA 3KCLA 4AWSA 5CPTA 3BSMA 1NHPA 5D9NA 5EA9A 4ACYA 5BMXA 3O07A 3PBWA 3QFWA 2VEMA 2QCDB 2ZRYA 4J3VA 2XVGA 1DWHM 4EVZA 3BLEA 4LV9A 4L4OA 5FL0A 3PZOA 4G7FA 4J3XA 1UW9A 2BY1A 3OLGA 2X16A 3MHGA 1FWTA 4YCOA 2W54A 1XRVA 3EOLA 3FKKA 2ZA2A 2D0HA 3BH4A 3ZO9A 1CIUA 5DBTA 4URIA 2UV8G 5DX7A 1P1MA 3PPFA 2VC5A 3DHUA 1ME8A 5KZEA 4ML4A 3W72A 4AEOA 2V69A 2QUVA 4EP8C 4PYSA 1H63A 5A6BA 1OZQA 3W1XA 2ISSA 2BCPA 5HNRA 2HE5A 1X6NA 2ISVA 1H7PA 1O12A 1GOIA 3NQEA 1QOQA 3QHOA 3VILA 4QXIA 4M6VA 4BQ4A 3GZ3A 2V5DA 3SY8A 2OQYA 1FRBA 4ZSTA 1KB3A 3CQIA 3K5XA 2J6VA 4Q8NA 3GX9A 2ATSA 2VZSA 3W24A 2X0SA 3PHAA 3WLRA 1PCWA 1NWTA 1W3IA 3LXAA 1AUSL 2X0YA 2ZRXA 1IT8A 1A3HA 5HJLA 1GVQA 4C1KA 1I2NA 3JW7A 1TYGA 1KTNA 4NILA 4RLIA 2QLYA 4OOZA 3GDTA 3EX4A 2G96A 3URHA 4MJZA 2P8CA 2PP1A 4XKMA 3LLDA 4GUJA 3GUWA 3W7GA 2V67A 1BXNA 1GPWA 3BG3A 3UWEA 4ML9A 3A9IA 5CCZA 1OFBA 1W91A 2DZUA 4DX3A 4KWWA 5I00A 1KKRA 4QEHA 3N18A 4GUHA 4N9BA 2YVGA 4IH3A 5I2UA 1DWGM 2DSKA 4ERGA 2Y70A 4N9CA 2NT0A 2DZPA 4IWWA 2NV2A 1SSDA 2OYLA 3OLIA 4BQ3A 2VFHA 1CCWB 3UT0A 3P3BA 3RYSA 4NJIA 5HDRA 3NQCA 1JAKA 4IM4A 1DEDA 4GPNA 3NL3A 4QJ5B 3OVGA 4ZR8A 4CD5A 1TIMA 3CV2A 3CEPA 1T7LA 1Q6QA 2VVNA 1XINA 4DUXA 1TJ0A 2BP1A 4BV6A 4OQVA 2WZMA 3VINA 2G95A 2PRMA 3FX4A 4O54A 2QV5A 2CLEA 2XIBA 3PBUA 4N6FA 3S8HA 1HKKA 3HF3A 1D7YA 4ZQRA 5FEZA 4K8DA 4DUVA 1EJ7L 3R12A 3GZAA 5KVIA 1GHSA 1OABA 4JHMA 1PZ3A 3T08A 5C0QA 5G5GB 3V5CA 2I5GA 3R0UA 1IQ8A 1XGDA 1L2UA 2GDVA 5E0CA 1QNPA 2YBUA 3CAWA 3RITA 4NJKA 1C90A 4FA3A 3CNYA 1FWCC 1I75A 1JPMA 3EB3A 1HGYA 1KCKA 3IAPA 2RHGA 1IEQA 4HMEA 3CQHA 2XH7A 3SO7A 4I8YA 1M03A 4Q4PA 2HS8A 4Q8OA 1XQKA 3LRLA 3NQ6A 3G6LA 3SADA 2VFDA 3L4VA 3VVGA 3GNOA 4DXVA 3OZYA 4ZB2A 3ABOA 3UWYA 1GG0A 3W2MA 3BAXA 2CFFA 5LIWX 3P6LA 4LX4A 3PBVA 3OTRA 3GW0A 2E25A 4GZIA 3A4AA 3RDKA 3DGRA 1AH0A 4YWIA 4AD3A 1BYDA 4HSHA 1OYAA 5CZKA 1Q13A 4RZ6A 1EZ2A 1WDQA 3VX1A 4K36A 3VA8A 3ARWA 5I7GA 4E3VA 1TJ1A 1MSSA 2PTYA 2Y7GA 2PU0A 3Q65A 4HBKA 5BWFA 1TWSA 1V6WA 1L9WA 5FEXA 1JVNA 4CD8A 2ZADA 1FXQA 2CHOA 4FK9A 3S9YA 5G5IA 2G97A 4RNHA 1DQUA 4Y90A 3QY6A 3AYSA 4GJJA 4B5XA 1J0JA 4OV4A 3UGVA 1YKWA 9XIAA 2GSHA 1XBXA 5F1UA 4PH6A 4J4KA 4D2JA 4GBUA 2E3ZA 3DBNA 3H2AA 4HZ7A 3N2XA 3W86A 4AHQA 1PX4A 2G37A 6XIAA 4PFHA 4BEUA 5JUVA 1VFMA 1M41A 4CNUA 1HL8A 3V5OA 1LCOA 4GQRA 4Y9NA 2WVVA 1UZHA 3KCJA 1OG6A 3KRUA 2E8YA 2PAJA 4KH2A 4B4FA 4GK8A 4QITA 1UR1A 1P0NA 4BK9A 3OJGA 5HMFA 5A6TC 3C5QA 3II1A 1VGAA 2HXUA 1AOGA 1QR7A 3B0XA 3WENA 1CDGA 2O9TA 2G50A 3QOKA 1M65A 5JU6A 3IIPA 2WPCA 1J11A 3G1YA 2XH2A 1KV5A 3LNMA 4ATLA 3EXRA 1TJ2A 2ZRWA 2CESA 1P7TA 1G69A 1KCXA 3FAWA 4XB3A 1DJXA 2JK2A 4PUMA 4MZYA 2EKCA 2AGKA 3UJSA 3TQ0A 3WQDA 2CDUA 1BKHA 3F5LA 1OX4B 5I77A 2YXOA 1PVNA 1PKMA 1XFCA 3T55A 4BI6A 5C9ZA 3CB8A 3P14A 4A35A 4V1XA 1ZMCA 4R34A 2RDUA 4NG3A 2G4JA 1H7NA 1FWWA 1NHSA 1HKVA 3GG1A 4O19A 3MTWA 3WH5A 1TA3B 4UWMA 1US2A 4P61A 4TVYA 3OODA 4EPBC 3B8TA 2GDQA 4FMVA 1GRTA 3EGJA 1OVDA 3SCPA 2BMBA 1EDQA 3B8VA 1EHAA 3D6NA 1W2VA 4KERA 4UFMA 3MP4A 4AZ5A 3PBMA 1OCBA 3U9IA 2AAAA 3DHFA 2BXZA 3AQUA 3FCPA 3GTHA 5BRQA 3IS4A 2NLYA 4TR9A 4UQEA 4ZENA 2GVYA 4E4FA 1DWAM 4UCGA 4ZZ9A 4MGGA 1H5YA 4TMCA 1GRFA 1GOWA 3C2EA 1V3HA 3GD4A 1KNWA 1V3MA 3RM4A 5DN1A 3S6OA 1PZ2A 5KVHA 2Y89A 3P2VA 2HTMA 2HSAA 2Y5EA 3SCQA 3I6RA 1YBQA 3HW2A 1PZ1A 1C8YA 3FA5A 2DSWA 2CBIA 3CIVA 3DU0A 3FXYA 1K9EA 2R1KA 1RHCA 4NNCA 1TVNA 4K3ZA 3W74A 4QQ3A 2BGQA 1E5NA 3HG3A 4TO8A 1HL2A 4A29A 3E5PA 3EKGA 3VGDA 1WXJA 1Q1RA 1VC4A 1B2YA 2DQXA 5BROA 1YTDA 3KLKA 2NXHA 1NWUA 5EPDA 3W07A 2AL2B 2C3DA 3MUY1 4M0XA 2QCMA 3V4BA 3BW4A 3CMFA 2GGGA 2X8RA 1EP3A 3QPYA 3MUCA 1V03A 1JF5A 3B0YA 4H9YA 1TFVA 1Z44A 4IP7A 4IIBA 3QV6A 2OT1A 4RPPA 4EWJA 2PDFA 3CBWA 3KZSA 4HMNA 1EL3A 1KCZA 1FHVA 2OGYA 4UMAA 3WH9A 2FZMA 2QUTA 1X8FA 4JN8A 2YZ5A 4KGLA 2QUNA 1X1NA 4GQQA 1RR2A 1F8MA 3I3BA 2JGYA 4NNBA 4S3KA 1XYZA 3VGHA 1QI5A 1E3XA 4AH7A 4YTQA 5G4EA 4M6QA 1OX6A 1MEHA 3UP8A 1O60A 3EPOA 3D5HA 4DPPA 4PTWA 1AZ2A 5U25A 1FO4A 3L66A 3TFCA 1CGUA 5GJMA 3PTDA 4DIAA 3KBVA 3RMJA 3UXIA 1PL9A 4PMZA 5FF3A 1B3ZA 4G2DA 2XHYA 4ZFMA 1VRXA 3TK7A 1BTMA 3TYEA 1IZCA 1MEIA 3W1TA 4CQDA 3QFEA 2E77A 1Q3NA 5D9MA 3RAOA 3EAOA 1OZMA 4DUWA 2QDDA 1XD0A 3L4WA 4B5NA 2AMXA 2BHZA 4MZ8A 5EMUA 4JZ5A 3THQA 2E1DA 4C65A 4C6KA 3AN1A 4EMJA 1UASA 4A05A 2WSPA 1FKWA 2PLCA 4J40A 4GISA 1VCVA 4EPKA 1EWDA 2WKGA 1OK6A 3B4YA 4DJDA 2FJUB 5LNVA 1HP4A 2AQVA 3DH7A 4XAFA 3V35A 4PUKA 4D8AA 3CLWA 1JDEA 3AIVA 4UNIA 3T07A 3A22A 2V3FA 1Z9AA 1QBBA 4WOQA 1TMLA 1K03A 1A0CA 3Q94A 3QGAC 3R7MA 3HPFA 4PMRA 1O95A 4N0RA 1WUEA 3EA3A 3VNYA 1ZJBA 2YA1A 3NL6A 1F8WA 2V9DA 1XI3A 3UWQA 3AMDA 3KVJA 3LN3A 4ZVJA 1MYRA 3ELFA 2FVMA 3SRKA 4HHLA 3VIOA 3WZ0E 2P50A 2V3EA 4XVDA 4A22A 4C6DA 4PCTA 4JY9A 5D38A 4B90A 4GYFA 3GYEA 3RPTA 1THFD 2R24A 1XLAA 4C6LA 3GXIA 1KXTA 3E74A 3RHGA 2WMFA 1VFHA 4NAEA 1TKKA 4X9YA 4IGSA 2W9MA 2O7QA 1IT0A 1ZHAA 2WXDM 1SYTA 3P8JA 4DPQA 2Z25A 3SCOA 3SAZA 4KGJA 1G4SA 1UROA 3W7JA 4REQA 3RMEA 2CETA 4Q4OA 2DIKA 3GTXA 1LP6A 4QEEA 1MUWA 5E9XA 1ZDLA 3S9IA 4WSKA 4NT0A 1BSLA 3QR0A 2VEKA 4YS1A 4PBFA 4E8DA 3MQTA 1Z48A 2DZAA 4LB4A 3QHNA 4HZMA 4JNZA 4GKTA 3WLQA 2F5ZA 3QKEA 5BMWA 1PPIA 1YNQA 2R6OA 3WYZA 3ME3A 2FTYA 2ZZ5A 3FAXA 4HHPA 3F7JA 3ISIX 4GWEA 3BC9A 1WP6A 3UXDA 1X6LA 4J1OA 4D6FA 3UWVA 1X1ZA 1ITQA 5DEZA 1J79A 3NPXA 3M6DA 5CLTA 2FTPA 4L6HA 4WK9A 4A8IA 1OIFA 3M64A 3FLUA 4JTUA 4UTJA 3FDKA 3SGZA 2GJRA 1AL8A 2DZBA 1YE6A 2FZ8A 3LHVA 4CU8A 3ZLGA 2OR2A 2YZRA 3BCJA 2PDMA 1AW5A 2EPKX 3SDOA 3RLGA 1A5BA 4AMAA 2X41A 3UESA 3M9YA 4CD7A 2YL8A 4WZHA 2NWSA 1C9WA 1PUDA 1REQB 1OBAA 3BTNA 3E0LA 4RE2A 3QW3A 5M03A 4IFOA 1TWZA 4F3HA 4N9DA