2OPJA

Crystal structure of o-succinylbenzoate synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
311
structure length
294
Chain Sequence
SLTGRAFAIPLRTRFRGITVREGMLVRGAAGWGEFSPFAEYGPRECARWWAACYEAAELGWPAPVRDTVPVNATVPAVGPEEAARIVASSGCTTAKVKVAENDVARVEAVRDALGPRGRVRIDVNGAWDVDTAVRMIRLLDRFELEYVEQPCATVDELAEVRRRVSVPIAARVRDAEAADVVVLKVQPLGGVRAALRLAEECGLPVVVSSAVETSVGLAAGVALAAALPELPYACGLATLRLLHADVCDDPLLPVHGVLPVRRVDVSEQRLAEVEIDPAAWQARLAAARAAWEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords O-succinylbenzoate-CoA synthase
publication title Crystal structure of O-succinylbenzoate synthase
rcsb
source organism Thermobifida fusca
total genus 95
structure length 294
sequence length 311
ec nomenclature ec 4.2.1.-:
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
A PF18374 Enolase_like_N Enolase N-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2opjA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2opjA01
2OQYA 4KT2A 4H2HA 1MNSA 1ECQA 2GGIA 2PTXA 2ZADA 3Q45A 3ZVHA 3GD6A 5FJTA 4E8GA 2GGJA 3UCDA 3QN3A 3DFYA 4IP4A 7ENLA 3S5SA 2PMQA 3OP2A 4X2PA 3OZYA 3TCSA 3RGTA 3ZVHB 1OEPA 1R0MA 1IYXA 3UGVA 3MY9A 2AKZA 2PP1A 4FP1A 3OTRA 3ES7A 4M0XA 1KD0A 3QTPA 2P88A 1P43A 3R10A 3MQTA 4HN8A 3H8AA 3BOXA 4DX3A 4FI4A 4HPNA 3UXKA 6ENLA 3EEZA 4H83A 1TKKA 1JPDX 1WUEA 3NFUA 4H19A 4YWSA 3U4FA 2QJJA 5IDZA 3DESA 4MKSA 3I6TA 3ZLHA 2OLAA 3MZNA 2GGHA 3DG3A 3SJNA 3RO6A 4HNCA 4DN1A 3V5CA 3HPFA 2OZ3A 1E9IA 3U9IA 1FHUA 2I5QA 4MGGA 2P8CA 3TTEA 4JN7A 3VCCA 2PS2A 3ZLFA 2PP0A 3PWGA 2HNEA 3UXLA 2XGZA 4DWDA 2OKTA 4HCDA 2NQLA 4IL2A 3THUA 2GGGA 2GL5A 3P93A 5J04A 2OZ8A 3T4WA 2HXTA 3DERA 3DGBA 3IJIA 2GDQA 3T9PA 3SN4A 3N6JA 4DHGA 3PK7A 4HCHA 2FYMA 2XH4A 2OVLA 3DIPA 3V5FA 2OX4A 1MDLA 2HZGA 3GO2A 4H1ZA 2QQ6A 2XH2A 1YEYA 3FXGA 3NO1A 3SBFA 3UJEA 2OZTA 3SN1A 1BQGA 3RCYA 1ONEA 2FKPA 3T6CA 1KKOA 3STPA 4E5TA 1FHVA 3TJIA 3RRAA 3SQSA 3ZVIA 2XH7A 4GFIA 2QGYA 3MUCA 1MUCA 3IJLA 3P0WA 2PP3A 4MMWA 3FVDA 3CT2A 4HNLA 3T8QA 1SJDA 3KUMA 4HCLA 1W6TA 4GGBA 3JZUA 1SJCA 2PPGA 3V4BA 3OZMA 4HYRA 1NU5A 4GIRA 2HXUA 3TW9A 1SJBA 4J3ZA 3RR1A 4E4FA 3SN0A 2PCEA 1PDYA 1SJAA 4ZCWA 3N6HA 2GSHA 3MKCA 3VCNA 3BJSA 4GYPC 2MUCA 4GGHA 4ZA0A 2QJNA 3QKEA 2OG9A 3SSZA 1ELSA 2CHRA 2GGEA 1EBGA 2AL2A 4GMEA 4J1OA 1JDFA 1XS2A 4K2SA 5ENLA 2PTWA 3R11A 4JN8A 3PFRA 2PU1A 2PTYA 1R6WA 1MDRA 3N4EA 2AL2B 3UJ2A 4IT1A 3JVAA 2PU0A 2AKMA 3JW7A 3ZLGA 1NELA 3RITA 4A3RA 4JHMA 3IK4A 3CYJA 1EC8A 4IL0A 2XSXA 2MNRA 2DW7A 1F9CA 3B97A 3K1GA 3DG6A 3UJRA 4G7FA 5BOEA 2QVHA 3D46A 1WUFA 1EC7A 2OPJA 3H70A 3VFCA 1JPMA 3CB3A 2AL1A 3TWBA 4GISA 1MRAA 3MWCA 1KKRA 3GY1A 3I6EA 3FV9A 3R0KA 3DFHA 3R25A 2PTZA 5FJOA 2ONEA 2POZA 3VC6A 4DXKA 5FJRA 2ZC8A 3VDGA 2PSNA 4ENLA 4IZGA 1DTNA 3DDMA 3S47A 2P0IA 4Z17A 5EU9A 3R1ZA 3ENLA 4G8TA 1BKHA 4IP5A 5FJUA 3DG7A 4E4UA 4KWSA 1P48A 4Z1YA 3QPEA 2P3ZA 4KPLA 3QLDA 1JCTA 3H12A 3Q4DA 4ROPA 3UCCA 4KEMA 1TZZA 3DEQA 4A35A 1EC9A 2OFJA 4EWJA 3D47A 3NXLA 4M6UA 3OPSA 3EKGA 5FJPA 1TE6A 1KCZA 3CXOA 1L8PA 3ES8A 3FCPA 3TJ4A 2PA6A 4A6GA 4F4RA 2QJMA 2RDXA 2PGEA 3N4FA 1PDZA 3H7VA 3VA8A 2OQHA 3OW1A 4E6MA 4GYPA 3UJFA 2XH0A 2OO6A 3CAWA 1XPYA 3GC2A 3VC5A 2QDDA 1RVKA 3NZGA 3IJQA 2QDEA 3FYYA 3CK5A 5BOFA 3TOYA 2O56A 3I4KA 3R0UA 3BSMA 3MSYA 4IHCA 3FJ4A 4K8GA 4DYEA 3UJSA 3V3WA 3P3BA 3PWIA 4K1WA 2P8BA 3TWAA 3TQPA 2DW6A 2PODA 2PGWA 1EBHA
chains in the Genus database with same CATH superfamily
4HHLA 1V3HA 2ALDA 4LRSA 3WQWA 3LB8A 3M41A 3C52A 1W31A 3BOFA 4QLKA 2X0SA 1O95A 3N6QA 5FA5A 3IVTA 3LENA 4Q8PA 4ROQA 4GRTA 2W63A 3CUIA 3GD6A 4PE8A 1TYGA 1GJPA 3WBXA 1OK4A 1GVQA 3UNDA 4MUZA 4X2PA 1CLKA 1IYXA 1GTEA 3WQEA 2QCCA 1OK6A 4YYCA 5LA1A 5C8BB 5CC5A 3EKLA 4IIDA 1R38A 4RE3A 1GYMA 2F6XA 4R9XA 4ZOEA 4JZ5A 3L66A 4ZQOA 1V77A 4YWSA 2PWFA 5AYIA 1BYCA 4GD0A 1QHPA 1P5BA 2CNCA 3ZR6A 3V1HA 5I2UA 2A5HA 4ZBCA 5KVHA 2VX7A 3LK6A 3U9IA 2G4FA 2BP1A 4WR3A 2O92A 4KETA 4LUJA 3WBEA 4MWAA 4HA0A 2EQ7A 1O5RA 2PDMA 3TYBA 1UQZA 2ZBTA 1LF1A 4PMJA 4XV0A 3INPA 4LYKA 3VGHA 1PWLA 3R8HA 4PSRA 1Z8AA 1FWGC 4I5RA 4AF0A 3GDKA 3EANA 5EBKA 4YYFA 2J9YA 4KFOA 4P7LA 3VM5A 2GLKA 3MYPA 1TTJA 3NR0A 5DMNA 1EA0A 1ZCOA 3ATYA 3TA9A 3NSMA 2BY2A 5F4XA 1KFKA 4H1ZA 4DUOA 4FXFA 2I1OA 4IFKB 1OC5A 2HEJA 4XKMA 3MKKA 5HULA 4UQCA 2ZRWA 3VNYA 5A94A 3SR7A 4AD3A 4F0RA 2VGIA 3EF6A 4M52A 4LWWA 4UNLA 5I7GA 3T0DA 5FS7A 2PUZA 4MKVA 4O17A 4MJZA 5DANA 3N4AA 3T08A 4PTWA 4KPRA 4JNYA 2ATMA 3P5ZA 3STGA 2EQDA 3N11A 4NJJA 2C0HA 3TU9A 3GG7A 4WSHA 1OCJA 3MV11 1FFUC 4C6MA 1UB3A 4HK5A 2ZUSA 3T09A 1DJQA 1JRBA 4LC8A 2XIQA 2CHNA 3LM3A 4EKJA 4HA1A 2MANA 4D71A 3SCRA 1TIWA 2GSEA 3DYPA 3G1YA 2R9ZA 2QDHA 2ZTKA 2WP6A 2WB5A 3Q37A 3QFWA 2QCDB 1SYTA 4CNUA 3M0KA 3QSRA 3HW2A 3H2MA 4IX0A 4LUTB 1GEHA 2YDAA 4GWEA 4U5KA 3WLIA 1KGXA 2CKSA 1MUWA 2A3BA 4JL1A 3KXQA 1XHCA 4W88A 3VNDA 3P0XA 1HG3A 4AC1X 3O6AA 3NDZA 3WJXA 2FTWA 4TUFA 2TPRA 1J0KA 3JUGA 3NGJA 1Q6QA 4PFHA 2PD9A 4PUDA 5M5DA 4OV9A 4B90A 1CDGA 3JW7A 1RJPA 3NPXA 2JALA 1UH3A 5CGTA 1J9YA 1LLZA 3NL3A 4CKQA 1OG6A 1UWTA 2YVGA 3DK4A 4FF7A 3GXFA 4X61A 3VFCA 3CB3A 4HMCA 4J3VA 1SFLA 3V16A 1DWGM 2WWCA 1Z69A 4UTIA 2Y2WA 3L67A 1CXHA 2PWGA 1TCDA 1Z32X 3N9RA 2Q02A 4G9PA 3IVUA 4HNVA 5AC8A 2WHLA 3KBJA 3UPWA 3WCZA 1P0KA 3TN3A 4BEUA 1LWJA 3GYEA 4EXBA 3THDA 2CFYA 3MBDA 1P7TA 2BG5A 1ZJAA 3BSGA 1H7NA 2D2HA 2P0IA 1Q2SA 5EU9A 2YA2A 1D2KA 3GXNA 1QDSA 3DAQA 4E4UA 3CGCA 2WLYA 1UMYA 3EYPA 2Z29A 2P3ZA 2CZ5A 1P6WA 4D6DA 1LG1A 4KERA 2R82A 4YJ5A 4GC3A 3HGRA 1ME7A 1YXDA 1ITQA 4JCLA 3A24A 2AGKA 4EOUA 4Y7EA 1AA1B 1M04A 4ML9A 3GVVA 5A69A 4F0SA 1U5VA 3ICJA 3AIBA 3MPGA 4OUIA 4N02A 1SZNA 1US2A 2Q01A 1C90A 1YBQA 3CTTA 1EIXA 1LT8A 1V5XA 3TZFA 4XD3A 3A3HA 4M6VA 5EMYA 5IBXC 1H3GA 4RV3A 1GOQA 4NX5A 1UR9A 2PDCA 1YRRA 3DC0A 4Q8WA 5B7ZA 1XLDA 5I06A 1QK0A 1UC5A 4AZIA 3WUEA 3W7OA 3I3EA 3RMEA 1JXJA 5A6BA 3NZGA 3I65A 1W5QA 4Z2JA 2I16A 5BOFA 2WVUA 2NSXA 4NG3A 3NQEA 4YTSA 2ATSA 1HJVA 1WXJA 3CMGA 4NZ3A 1GOWA 4DYEA 3QOKA 4XAGA 2OO0A 1BKSA 4PRTA 4PMUA 4Q4PA 5CSUA 4XAYA 1XRVA 4XB3A 3FA5A 2BFGA 3VD3A 2RH9A 4PN2A 3BLPX 4JKMA 3LNPA 3NZ1A 1M41A 5HPCA 2Y1HA 1MRQA 4Q4RA 3S5ZA 3QJAA 4GOAA 4CU8A 3PTMA 3C3UA 4LS0A 2O7QA 3TIMA 4LVFA 1GERA 3EAUA 3GUGA 4AW7A 3TEVA 2CIPA 3EWZA 4QAWA 4IPPA 5DCDA 2WOWA 1OFAA 3AS1A 1H1NA 3ZVHA 1IXQA 4LBUA 5FF7A 4YMZA 2I5GA 3BURA 2CC0A 3BG3A 1FCBA 4HJWA 3URNA 3OZYA 2ACRA 3LERA 4MM1A 4N6FA 1A47A 3P5YA 4S3AA 4IFRA 5I3GA 2F6UA 2PP1A 3M5ZA 1FFVC 3FOKA 4EQRA 4U5IA 3NRZB 4UTTA 1TE1A 4W9TA 3O05A 4AC7C 4EMJA 4WEVX 1E6QM 3KZSA 2IXVA 6ENLA 2VFDA 3NVTA 1GW9A 4CD5A 4JHOA 4CCEA 3CWOX 3PAJA 1H6VA 4DUVA 4ERAA 1N5WC 3GDMA 3QY7A 2Y61A 2FHBA 4UR8A 1CECA 1XG4A 3LRMA 4IPLA 2OLAA 2GGHA 3DG3A 4B5SA 2QMJA 4ZL1A 4DN1A 2EKGA 1JZ2A 3BQ6A 3ME3A 4HBKA 4LOCA 4L56A 1OQFA 1VGAA 1JQVA 2ZOXA 4US5A 3FEMA 2HK1A 1Q4WA 2VCCA 3RLUA 1ZTVA 1LRTA 5A6LA 2V82A 3OC4A 2W0HA 3UESA 1TPWA 3ZQ9A 4F79A 4Z2IA 1ZZMA 3ALGA 1XHGA 2YVFA 1U1HA 4JFWA 4MWAB 4AY7A 3C8NA 3GUWA 4FNQA 3S2MA 3IGUA 2VUNA 2QCHA 3WSUA 5C2GA 3DENA 4MSSA 2EQ8A 1BWVA 4B15A 3GXPA 2WBKA 3AU6A 4RZ5A 4AF0B 2CEQA 4FNPA 2FYMA 5FMHA 3URHA 1OD0A 3QQ1A 1C3FA 1FCVA 3ARPA 3AYSA 2PDJA 5ABEA 1OX6A 2OOGA 4KGJA 5C7VA 4TVWA 4QX4A 4NZFA 3W53A 1ZU8A 3LZ5A 2ZX6A 3MTWA 1BEUA 4J3WA 4LY4A 3V36A 1W8GA 2WJDA 4Z2GA 3SQSA 1R46A 2YB1A 3BCJA 2BTMA 3WX7A 2OTDA 3L2IA 4NUWA 2WOVA 2PP3A 4MMWA 3VX0A 3FVDA 3CT2A 2Y70A 1CIUA 3LGGA 3I7QA 2H9AA 4HCLA 4QAIA 1U5JA 3K13A 4KWVA 5K2ZA 3T7VA 3LV6A 2PLMA 1A53A 3W7IA 1PX3A 2PWHA 3IUIA 1W3JA 4B2DA 2GOKA 4ERIA 4RNFA 1W9UA 1R8LA 4R7JA 3NQVA 3QLLA 2MUCA 3GE7A 4AVNA 2EPMX 1YPIA 5F4WA 1T96A 1Q45A 2ISVA 3G22A 5IXEA 3A3WA 1CXIA 3W07A 5F2MA 1PX4A 4G7EA 2NSOA 2I57A 3NQBA 1FVPA 5AB3A 3S4TA 3S1GA 4EF9A 2ZVIA 2F61A 4C65A 2R1MA 3WLJA 4JQ1A 2Z7GA 9CGTA 4N42A 2NZLA 4H9VA 1KQZA 3W29A 1N8IA 3KVMA 1E6PA 1GZ1A 1J6OA 4MIMA 1YTKA 3KL5A 2TODA 4QR6A 4Y96A 1MO9A 2A8XA 2DW7A 2DSZA 5BWFA 2REQA 4GRSA 4ECLA 4YVPA 1GVIA 4GFSA 3D46A 3HQNA 5FAGA 4DJDA 3NPUA 2H90A 4MWAE 2NV2A 3HG5A 1QNOA 2NWSA 3VKJA 2GPTA 1A5LC 1E73M 1FA2A 1KV8A 2ZUUA 2BCPA 1DKWA 2J9XA 1NFBA 4Y9PA 1KM2A 4WDTA 4A2SA 3T0TA 1E4NA 2YXGA 5ECVA 3OVRA 1B30A 4CNOA 4NYUA 2W55A 1WZAA 1WYIA 4TR9A 1EZWA 1TWWA 3VNMA 3MP4A 4JR5A 3C0JA 3LGDA 4TVYA 3WEMA 3GKAA 3OGSA 5FS9A 5AYYA 1P7TB 4NRSA 4KWSA 4GO9A 1FXQA 3QPEA 1JNDA 4Z1AA 3PBWA 1G4EA 5G5IA 3B4UA 4A35A 4K7ZA 1MSSA 2BHYA 4AZ6A 3APYA 3HPZA 2ISSA 4MB3A 5JUVA 1YDOA 3C2FA 2X2GA 3PSVA 4FNRA 3KWXA 4AD5A 5HNTA 1VRXA 3HGOA 3CXOA 2W67A 3PZVA 4TO8A 5DT7A 1ZS2A 4XIAA 5BXPA 4MY9A 3V7PA 5CZTA 1YBQB 3GW0A 4O15A 1A80A 4E6MA 5U7SA 1VLWA 3HV9A 2E8YA 1KB3A 4Q7IA 5F2IA 3BAJA 1TMHA 3W2UA 3M7WA 3WLMA 3R6IA 5CPQA 1KCKA 2YB4A 3L2MA 4NP7A 1UWAA 3VZZA 3EOEA 5CKSA 3N14A 3ARUA 3BMXA 4AD2A 2EAWA 2PDNA 3PVFA 1N82A 1GG0A 1JZ3A 3ZMRA 3W81A 3E0IA 3VDAA 3R13A 4UTLA 4GUFA 5FL1A 3TZNA 2E5AA 4C6PA 4HNUA 2Q3OA 1JVNA 1R7OA 4JTSA 2PDBA 1E6RA 1UWSA 3PJUA 3S5OA 1E9YB 4MUPA 3PHAA 3C86A 3WMLA 3IV3A 3QN3A 2A1YA 1ZCCA 2WPCA 4GBUA 2OGYA 4M80A 4PBEA 1ZENA 3ZVHB 4IIGA 1PL9A 4BHYA 2TMDA 3QW4B 3MY9A 3WF1A 4YNGA 1NPXA 2GUYA 1DXEA 3ES7A 3QV9A 3F4NA 1SMAA 4AG0A 1SSDA 2QV4A 3TQVA 1DJXA 2IMRA 3BOXA 4MWAD 2G96A 4DX3A 4KCVA 4AIEA 5HUPA 1JCXA 4DNHA 3F2CA 3M0MA 2VD9A 3G18A 1VHNA 3DESA 3KDNA 3II4A 1VFFA 1A4MA 2X41A 2OODA 2ZA1A 5EPDA 5TR3A 1HVQA 2EF9A 4B3LA 3BMVA 3LOTA 1C9DA 5LXXA 1OT2A 4LTSA 2XN2A 2OZ3A 1TJ0A 2VCAA 4W7VA 3DI1A 2GJPA 2I5QA 3DH7A 4NZ5A 3FDKA 4JNZA 3GH4A 4ZEPA 2PS2A 3CGTA 5C6MA 1W2PA 3RFAA 2OJPA 4JTUA 3OG2A 2H8ZA 3WUGA 3U2EA 4E3TA 2Z1BA 4DWDA 1JUKA 4LAOA 2YFOA 4PC8A 2GL5A 4FSAA 3AROA 4IOTA 3T4WA 3VNZA 4UMBA 4WX2A 3G1XA 1K6AA 3B3DA 3HURA 1KTBA 1ODZA 3ANUA 4JEJA 2O9PA 4MFDA 4DHGA 2DSWA 3G24A 1D3HA 1U5HA 4HCHA 3FYOA 4MNJA 4MG4A 3U7VA 2GR0A 2OX4A 4CQ9A 1UBPC 5IFPA 3MHFA 2W6RA 3N9KA 2DJXA 3OIHA 4O10A 4GIAA 3A4JA 1QOPA 1I2OA 3CNYA 3S1VA 1RBLA 5HDRA 2WQDA 4AD0A 2YJQA 2ZUNA 3CH9A 5HJYA 2OZTA 4J3UA 4JTFA 3VIIA 2Y7EA 4TVDA 4Q7BA 1ONEA 2VDHA 3T6CA 1E9LA 4PTXA 2YR1A 2JGQA 1UIOA 2DH3A 4Z2LA 1FWSA 4L9YA 3ZVIA 1P0NA 4DLFA 3G77A 1F6YA 3CV1A 4E2BA 3MZ2A 1MUCA 4L5ZA 3USBA 3HFYA 1K4GA 3KW3A 1T8XA 5HOSA 3QTGA 1HXJA 3CUGA 1W1TA 2BMBA 4PEKA 2J7HA 1AOGA 2B7OA 1ZGDA 5HWNA 2HV5A 1VPYA 4L4LA 3OZPA 2D0GA 1RY8A 1ONFA 3ITTA 3AIVA 4BF7A 5I09A 5HBFA 4S2CA 4J3ZA 2WNWA 2H9AB 2EEXA 2V5CA 2WKLA 4WUIA 3GVGA 4Y8FA 3VKKA 5HQLA 1SJAA 1YQZA 1G4SA 3CBWA 5D2WA 2NX3A 2YZ5A 3WDIA 1I6NA 1XIJA 2HWGA 3CZGA 3UEQA 3KWSA 2D3NA 4PMDA 3LCXA 1JL8A 2IKHA 2Z1WA 2DZAA 4OUEA 1V0KA 3GHSA 1IEWA 2D3LA 1MXGA 3M43A 5D04C 1DORA 1JG9A 3ERPA 5BZAA 2DZBA 1JDFA 1H51A 3UZXA 1NQKA 4AU0A 1VFUA 1K70A 2BHUA 2RJHA 2FJUB 5CG0A 1ZP4A 4C6LA 1CW2A 1EF2A 1KA9F 1R6WA 4UZSA 2TSYA 2KZHA 3BLEA 3WDQA 1F8IA 5CZKA 5G4HC 4DLMA 4UTWC 5H8UA 3KM8A 4G7EB 4RV8A 1W37A 4NHVA 2J3NA 4DJFA 1NELA 3RITA 4H00A 4K68A 3RRXA 4WJXA 2ZZ0A 2PDGA 5A8QA 3EDFA 1Q1WA 5BXSA 1GOIA 2X7WA 4J28A 5BNKA 1HJUA 2X09A 1GOMA 2AGTA 3P62A 4S38A 3CIVA 3H70A 2UY3A 1A5NC 1PKMA 3NUKA 1IT8A 3CV7A 5LNRA 2REQB 2QUUA 4JTGA 5CJMA 3W1LA 2V5BA 4OE7A 3HM7A 3R25A 5C9UA 4JHZA 3VC6A 4DXKA 1NAL1 4I9TA 5FJRA 2CZEA 1GXFA 4X63A 1TWIA 4K3ZA 3RHGA 4HK6A 4Z17A 1XLJA 2WBGA 1YADA 5AVHA 4Y9NA 4HGXA 4HZ8A 1C8QA 3DJGX 3P2VA 1TZZA 4L1GA 4RXGA 3P8JA 1WDSA 1EO5A 2R1PA 3WQFA 4B5VA 3V0SA 3D47A 4Z2KA 1UP0A 2D69A 3GDTA 1QNSA 1M5WA 3MP3A 4PYSA 3W7MA 4HPXA 1GRGA 5FF3A 2QW5A 3BSHA 4GQGA 4JFVA 2YYTA 2QJMA 1JXKA 2OLSA 1WDWA 4I7VA 2DZPA 1XQKA 3Q94A 5C0QA 1PDZA 3WFLA 4G2DA 3CHDA 1XGDA 2DDXA 3SR6B 3UR5A 1PCKA 2J7CA 2NQ9A 5G5GB 1TUFA 4H9UA 3QKZA 3RIKA 4HMEA 2FMNA 3VIMA 1ISYA 3QM3A 4GH3A 2C15A 2CXEA 2ZZ4A 3E02A 3CZKA 3R89A 2J4GA 4RNIA 2BY3A 1V6WA 3V5OA 4IM4A 1AJ0A 1E4MM 1XIHA 3NO3A 3DFSA 2A21A 4ZZ9A 3EWBX 3SCSA 1HGWA 3FJ6A 1CTNA 1Z89A 1AL8A 3QY6A 3SCOA 3P67A 5KEZA 2V3BA 4S3CA 4PRWA 1SSGA 1LVLA 3GTXA 4DJEA 3AICA 2GGIA 2VNCA 3BZJA 3SCQA 4L1WA 1LLWA 2W0UA 1GOXA 4JTAA 1H49A 2G5WA 1HFBA 1SO5A 4XKYA 3COTA 4M6PA 1AMYA 4QG9A 1VFMA 2D0HA 3OP2A 5AYXA 1JYWA 3RGTA 3VD7A 1V6YA 2J13A 2PAJA 2A3AA 4PA8A 4CCZA 1V93A 2QXWA 1C8YA 3QRHA 3ABRA 3H24A 4ILSA 2V2DA 2VQUA 3FKRA 1J0HA 3MQTA 3VAVA 3MO7A 3AMKA 3GNPA 3MMDA 3HQOA 3EEZA 1TTPA 1UUQA 1EXBA 2PGRA 1Q6LA 3WQ5A 1YPXA 1UA3A 3L0KA 2QJJA 2RDUA 5JH2A 3CQJA 4TMBA 4TX8A 1AD4A 1GKPA 3B8IA 2OX1A 3MZNA 1TUXA 4B3ZA 3QHOA 1YTDA 4PFMA 2YOCA 3F5LA 4BWLC 1VEOA 3P7YA 4JIRA 3WQVA 1HKJA 2G3FA 2UY2A 2V67A 3CT7A 3B0UX 1T40A 4GUGA 4OBTA 3AZTA 2E5BA 1RLDA 2F2HA 2EO7A 3CO8A 4MB5A 3L4ZA 2W91A 2J88A 3HGSA 1RJQA 3F2DA 5EFDA 3C2RA 3UXAA 5I3JA 4A3HA 3IV8A 1R3TA 1TR9A 3SN4A 3E74A 1L6SA 4C6KA 4KH2A 2YLLA 3RLGA 1AW2A 2VRQA 4LNCA 4L61A 4O19A 3NQAA 5FIPA 4EPEC 5CZSA 2PLKA 3ZZ1A 3U0HA 3RILA 1OZQA 1E1EA 3S6TA 2FB2A 2D1ZA 2CPUA 2BBFA 5CPLA 3WLLA 4ZE5A 4TX9A 3STPA 2QUTA 4B2DD 2BS9A 1QOQA 3WBWA 3GM8A 3WQGA 2HK0A 2ZKMX 1R30A 1GORA 2NXGA 3DCPA 4I3GA 1UHVA 1GRAA 2ZTJA 3WFZA 3UXIA 3T8QA 1EHNA 2F5ZA 2CITA 2NQHA 1A5OC 3WQCA 1E1CA 4LBRA 3UYCA 4RKAA 5U1OA 3QR1A 3KBMA 3ABZA 3LHUA 1KFJA 3OZMA 4XD6A 3W75A 2DZWA 3K8KA 3LA4A 3H2NA 3K4DA 5AZ0A 3FX4A 2XIJA 1RPKA 4AY1A 4KFPA 2GK1A 4IMCA 1HW6A 1ZSXA 1KGWA 1YNYA 1VR6A 4GYPC 3R8RA 4YTTA 2QJNA 2VYOA 1J93A 1TV2A 3MDUA 3QKEA 2PFHA 1OZMA 3CO4A 1ICPA 2B7NA 4O8AA 4QROA 2RGMA 1SM9A 4DJDD 2Y8VA 3MMTA 1MXSA 1QAPA 2JKPA 4GNJA 3SUSA 2B0MA 1UD6A 2WNZA 1J5SA 1GKQA 1VPQA 2Z6IA 4I7UA 3R7MA 1HTIA 4GNVA 3GC5A 2XJ7A 5A8MA 2IKGA 3BAKA 3S2LA 1S2UA 5D2YA 4BEQA 4IMFA 5J5DA 4IJBA 2PDUA 4ZOCA 5TAOA 3RK8A 3D3FA 3DG6A 1T99A 3ZWTA 2W79A 1S5NA 3TWBA 1JAEA 5ECUA 3MWCA 1KKRA 4M7SA 1SR0A 3AXXA 1P6CA 4LEQA 1FHLA 4R7WA 2BODX 1CENA 3G8RA 4AYSA 2XISA 4NYYA 3GAKA 3PTDA 4V28A 3ZT7A 1X6UA 4C6OA 3MA8A 3BW4A 1E51A 4C6NA 4Q6XA 3WK1A 3EX2A 3WKZA 3EX4A 4XZWA 3DDMA 3OBAA 3BAYA 1PYMA 1H62A 5K3VA 1GQJA 2QCGA 2OYKA 3ENLA 1FWIC 3DXIA 1JPHA 1P48A 3NEVA 4Z1YA 3VCRA 3VIHA 3AIQA 1RBAA 4KEMA 1GREA 4ICNA 2XGIA 3BGJA 2OYMA 1K9FA 3BGGA 1TPDA 3H55A 5A6TC 2YSWA 1AMKA 1OSEA 3WMBA 4M8UA 1PPIA 3NAVA 1MQRA 1JIBA 4JYFA 1KBJA 1WDPA 3VK5A 3EKGA 2HVNA 3H26A 1S5VA 3LPPA 1YKWA 1MI3A 5E6YA 1STZA 1FFQA 1EGZA 4FXRA 1GQKA 1QVBA 4LPCA 1XKYA 1OF8A 2FMOA 2PGEA 5C9XA 1RBOB 1JNEA 5A8OA 4RE4A 4EE9A 3KL0A 1Q63A 3SUUA 4C6EA 1EL3A 4HA4A 5DY3A 3WQDA 3ABSA 3AMGA 2WCGA 3M0JA 2Z28A 1H7PA 2RKXA 3CK5A 3TOYA 1XXXA 4U3AA 3KZPA 5JRBA 2FDSA 3FJ4A 2ZDSA 3R5EA 4YVXA 1X1OA 1R2RA 1MEIA 3CGBA 3B0VC 3LMYA 1X6NA 4KFNA 2WVTA 3VX1A 1I2RA 5AY7A 1NWUA 1EEPA 5I79A 3THAA 4UFKA 1CGXA 3AYTA 4GUIA 7TIMA 2Z25A 2I14A 1FWCC 5BRBA 3CUHA 1EIBA 4RW5A 3TX9A 4JY9A 3BICA 3QF0A 3MSGA 3Q65A 1L6GA 4G6CA 5D03A 3S6DA 3E2VA 1P1MA 4I6KA 3TCSA 2Y4SA 4RZ4A 3LBMA 4JX5A 1X39A 1UWUA 3N15A 2CZDA 3OGVA 4XKYB 1TPUA 3QTPA 1ISWA 1KRMA 4IIFA 4EQXA 1J0IA 2WMKA 1H2IA 3QZAA 3CGEA 2QPUA 2ZA2A 5I03A 1OIFA 3RXZA 3MKVA 1I1XA 1WBHA 3WUFA 4HOWA 4GI4A 3D5HA 2ALRA 4M82A 3SY8A 2OEMA 5JH1A 1F76A 3BANA 1P1XA 1RY0A 3ZLHA 1UCWA 3EWUA 4BV6A 4BQ2A 2FJKA 1FWTA 1KFEA 1OJTA 3A3XA 1L2QA 3EPNA 1R3QA 2OSWA 2O4MA 4C7FA 1L6FA 5HWMA 2YYUA 1E15A 4Z42C 4WCJA 1SB3B 1SZGA 2BGSA 3H21A 8RUCA 3WMSA 3MANA 4M29A 4I8DA 3LEPA 5TBOA 2GGGA 4KCWA 1QBBA 3K30A 3TDFA 4XAPA 2P0OA 3CL8A 1UZ1A 1PKLA 4CN4A 4UUIA 1NDYA 4HTBA 1MVYA 3M9YA 4FX6M 1I45A 3PZIA 5E70A 4A8RA 5GNXA 3URQA 3BAIA 1OFEA 1V3KA 4CU7A 1V7YA 2WC3A 2X1IA 4P5UA 4NJIA 3QOMA 5G2HA 3LQGA 1EXPA 3DIPA 3NEHA 3V5FA 1K02A 1F3EA 2FGZA 1ITUA 1YEYA 1G9HA 5E0FA 3QH2A 4CGTA 3OG3A 1NDAA 3MCMA 4KS0A 1EFZA 2J27A 4F8XA 2GVYA 1VBHA 4AY8A 4YPJA 5KETA 3G0SA 3DJJA 1GVOA 5TF0A 5HMFA 4HHPA 4WDWA 3T0BA 1LQ0A 3LDVA 1TV8A 3TNBA 1NWRA 1JFXA 1O68A 3LMZA 3PZMA 1NHSA 1PS9A 3FS2A 3W1AA 1BTCA 4GFIA 4J27A 4F9DA 1XG3A 3DGRA 1G7UA 3A5FA 4W8LA 3P0WA 2EKCA 1E70M 1UH4A 1X7IA 4HD5A 5DCEA 5AYZA 3W24A 3B40A 7XIMA 1ZBVA 1DJNA 4URIA 3ETRB 1J5TA 4H7CA 2Y7FA 3JZUA 4DBWA 4LALA 1FBAA 4NZ4A 1W3TA 2GUBA 3NL2A 3AJ7A 5CPOA 3RJXA 2EHHA 4JQ2A 5C70A 2CHOA 3F03K 3E3HA 3HPXA 4HYVA 1E1CB 4O0KA 5FSEC 1QNRA 1NOUA 5L9FA 1CGWA 3RR1A 3L5MA 4CVUA 2XFWA 3BLFA 2NWRA 3IVSA 3UA4A 5EBAA 2J7FA 4QDWA 4JGDA 2R6OA 4YXGA 6XIMA 3MCNA 1LWIA 4ZA0A 4LYRA 3STCA 1DHPA 3CPRA 4MNKA 5CBIA 2GK1B 1CYGA 5EB8A 1R47A 2GGEA 3GNDA 3M16A 1I75A 2ACUA 3OHIA 4O1CA 3NM3A 1EJRC 2PTYA 4S3BA 1QASA 3UW6A 2G3IA 1XSIA 5M2FX 2PWEA 1GPFA 1H7XA 1OF6A 2D22A 3K4AA 5IHRA 4QITA 4GIEA 2AKMA 4QHRA 1OIMA 3LTSA 5DXYA 3E6EA 2J75A 2EPLX 3A7RA 1KR1A 3VGEA 2QF7A 1N61C 5BWAA 1QUMA 1EUAA 3CYJA 3O3RA 5E5CA 4IL0A 4W84A 3R8GA 1QI0A 3T2OA 2IS7A 4P8XA 2JKEA 1RQEA 4EQWA 5B80A 2VZUA 3II1A 1KTNA 3L4VA 4L6HA 4S3JA 4W86A 1T5AA 4UMAA 1ZDLA 4V27A 1XLMA 4RK8A 3HMJG 1MWOA 4XG1A 3WQ4A 1ZP3A 3ITVA 1Q8JA 1KRCC 5I23A 1IEQA 2DT1A 2DUZA 4UR7A 4FEZA 3OLDA 5AN7A 3GVQA 3WDJA 4RUBA 3LXCA 1N5XA 1XBVA 3STFA 4GK8A 2IKIA 4K36A 4H4YA 1H7OA 5K9DA 4YWIA 1HF6A 1VCFA 5I3DA 4AXKA 4C6DA 1XLGA 3WJZA 4PB3A 5IOBA 2F2KA 3H12A 3MBFA 1RXOB 1ITCA 4IGMA 4LANA 3KCJA 1XIEA 1TTQA 4Q4OA 2PI6A 3W27A 2ZRXA 1RK6A 3VTRA 4UFIA 3V1PA 3OA5A 3NQMA 3UXDA 1XQLA 3BLLA 1V6UA 3WEZA 5FEWA 3PBYA 5FJPA 5AFDA 3PG6A 1O7AA 2ZCGA 1GW1A 3FHAA 3POHA 5D38A 2P50A 3PS7A 1JYVA 4C6QA 1E72M 5DXXA 4GJ1A 4XVEA 3N4FA 4HPHA 2B7PA 4FLOA 3SCNA 1E71M 3E5BA 1XWYA 3IRDA 2WSPA 4DBSA 4FZIA 2XGBA 3QR0A 3HFTA 3FJLA 1RVKA 4LT9A 3BW2A 4DJED 5JBEA 1BVNP 2H3BA 2WMJA 4XBSA 3VPLA 3WD1A 4FMVA 1N8WA 4QSHA 2YW4A 4BURA 3EX3A 4DO6A 1NDVA 3MSYA 4IHCA 1O60A 3O0FA 3REQA 2NV1A 4JICA 3GTNA 2VZVA 3NVDA 2W27A 5D9PA 4AEEA 4H2HA 1A3WA 3T07A 4CNNA 2J7GA 1G4TA 4DUXA 4Y9MA 4KMQA 4HVXA 3LI1A 1CCWB 4IQDA 4QRNA 2ADAA 2CZVA 1QBAA 4ICMA 3A4XA 3MVTA 4WF7A 1OEPA 1R0MA 4W85A 3SQMA 1GCYA 2AKZA 2HNHA 3QC3A 2B4GA 4CNTA 3LTYA 2R14A 1I2QA 1RP8A 2ZXAA 3I3DA 2OOFA 1QATA 1KLZA 1W9VA 2QR6A 4HN4A 3IIVA 4DEFA 3ITCA 4NRRA 4PTNA 3EA2A 2GJRA 4A4AA 4JYEA 5K7JA 5IDZA 5JCLA 3MT1A 3VM7A 3B8DA 5LHFA 5T26A 4XAZA 1NF7A 2VMFA 3QMSA 2Z2UA 3WK2A 2YX0A 4UFLA 2A3LA 4NI3A 3OQEA 3RLVA 5BXRA 3GFZA 4DQWA 1VJIA 5LYRA 4B5TA 6ALDA 4BZYA 3EOOA 3W7KA 3LYEA 4LF1A 1VRDA 1S39A 4K8HA 1SFTA 4XK2A 3UY7A 3WQ8A 4B3KA 3LBOA 4IL2A 1NP0A 1PB0A 4O11A 2C1HA 3NTYA 4HOZA 2V8ZA 4IIHA 3ZSTA 4B5XA 4W7WA 4X2RA 4KRTA 5BXTA 4UMCA 5GJPA 1H7WA 1XCWA 2VWTA 1BVWA 3W6MA 1QU4A 4HNOA 3DBNA 1CXLA 2ZUVA 4D6GA 1J0JA 1BSIA 2QGHA 4JDYA 4IGNA 5I5RA 2C19A 2QJHA 2WMIA 3UWEA 2CXGA 3DYMA 5E93A 1L2UA 4DI8A 2J79A 5XIAA 4F0MA 3CIWA 1K8CA 1Y5VA 2Y24A 4FX7A 3UJEA 3GR8A 1VCGA 3R2GA 2PGFA 3M6DA 3F5JA 5TD4A 4KWOA 4GABA 3V0TA 4H4XA 4W8AA 3AISA 1Q6RA 4J40A 1D7FA 2X05A 3PPHA 4FR6A 1PTAA 5AZ1A 2VX6A 1KM6A 1ZAJA 2IQTA 3AMCA 2HJPA 2J24A 4MAZA 3PTQA 1XIIA 1H50A 2VEFA 4HNLA 1NQ6A 4GZIA 4HA3A 4Q4KA 2Y8KA 1THFD 1HZYA 4ZSUA 1W6TA 1MEWA 1C9WA 2DVXA 4FIQA 3SUVA 2Y5SA 3APGA 1UWQA 3MUXA 2E28A 1VS1A 3GZAA 3W1PA 1SVDA 4HSOA 1UPMB 3VMPA 1OFOA 2H8XA 3EPMA 1IR2A 1LL6A 2JKAA 2C1GA 5AHIA 1TPFA 4OOUA 2PE4A 2PWVA 4Q4QA 3HOJA 3TXVA 1PKNA 2PDXA 1QW7A 2GYIA 2VJXA 4Z0JA 4WLCA 1W5MA 2ANUA 1W1ZA 3OEXA 3UWWA 3UZWA 3W2NA 1FCQA 2XG9A 3M6YA 1MDRA 4GYKA 3UJ2A 3URAA 3IIXA 1OM0A 5A2BA 1GRBA 2WHJA 4CQ8A 2IPJA 1GPWA 3WYZA 3ZLGA 3B06A 4JPGA 2GDUA 3LXDA 4HYWA 3GRSA 3DFQA 1WPCA 3HO8A 5H2ZA 1JDEA 4H4VA 3T55A 2A85A 2XSXA 3AJXA 3LTPA 3GG8A 5MF5A 1PCWA 1TO3A 3D0CA 3F1QA 3FKKA 2VFEA 5HINA 3VIOA 4E2DA 1MRAA 1ZQ5A 3ZOAA 1UW9A 3FV9A 3UG8A 4JIPA 4E8DA 3EMCA 3GC4A 4YCOA 2PCQA 3PSWA 1M7OA 1VQTA 3B0YA 4S3KA 2AAQA 4PZVA 1J18A 3QV6A 4IZGA 5EY5A 2Z26A 1EOMA 2CWXA 2DVTA 4G1NA 4B91A 4B9YA 3VNIA 3CGDA 5G2IA 1UYQA 1G69A 2VR5A 5TNVA 2X1UA 5FJUA 3VIPA 1KV5A 3LCHA 5G4EA 4S1FA 2CZFA 1JDDA 1M6JA 3ONBA 1YTEA 4OHQA 3RNMA 2BVYA 5HNRA 2FZ9A 1W3HA 3S3GA 3DEQA 3IWPA 1XLBA 1DXIA 3GU9A 3W87A 3TYCA 3IEBA 2YFNA 4HPGA 4EAYA 3GDBA 5DBTA 2Z00A 4H9MA 4Q8UA 4UQ9A 4LH8A 1LORA 1UD8A 4PEEA 3AM9A 4TU1A 4XZHA 3VGBA 3IGHX 2XFFA 5DCBA 2C7FA 3LPGA 3R94A 4JQ9A 1KRAC 4U10A 2VFIA 2UY5A 3WF4A 1XC6A 5A6JA 2OQHA 1AQ0A 4AZBA 2XH0A 3MI2A 2PC4A 1WKFA 5H1WA 3QC0A 1TPVA 1U1JA 2WHKA 4PL2A 1WDQA 4KF1A 3KOXA 1GT8A 2RUSA 4LAKA 5K4ZA 4ZSTA 1M7XA 3GW3A 2YCEA 4FXSA 4GVFA 3CLWA 2YQUA 5A8NA 2OELA 2C14A 2W3SA 2HE5A 2BB0A 1H5YA 4K1WA 2NPXA 3GIQA 3C3NA 4CQDA 2ZYFA 1EJTC 3AWOA 2E5DA 3W3OA 5I78A 2PGWA 4QJ1A 3REQB 1IXOA 4TIMA 4IUOA 1XLIA 4D2JA 1IGWA 3W2MA 2IQ0A 4QIUA 2QF8A 1KC7A 1TV3A 2PURA 4J5NA 1S3TC 4FLQA 4L4OA 3MVIA 3T2QA 4AIOA 5FAJA 1Z6KA 1RUSA 2NX1A 2GQ3A 2WANA 4KW2A 1GYNA 3DZ1A 2VM8A 3VNJA 3NOYA 4O53A 2NUYA 5D2XA 4FP1A 1IWPA 1E43A 1OVDA 3SIMA 2ZUMA 4H6QA 3KP1A 2VEKA 3GX9A 1XV8A 3TSBA 5FOOA 2O9TA 5DO8A 3KEHA 2BHZA 3EBVA 4H6KA 5I0DA 3KTXA 4GUHA 4YIWA 1G4PA 2PEVA 4ZFCA 4K7YA 3UBPC 3GD3A 3KX6A 1F8MA 4H2CA 5LXEA 2J66A 2BXVA 4PMQA 5HNNA 1XYBA 2J47A 1H63A 4HU8A 4FAMA 4KGLA 3CS2A 4IXHA 4MGGA 1R3VA 3QHNA 3LSBA 4Q3MA 3CC1A 4UCFA 1AG1O 3T8LA 3FEQA 1IZJA 5IBXA 1J6PA 3HV8A 3PC0A 1ECEA 2VD8A 4XSMA 3C56A 4J4KA 4HJFA 3W28A 3W73A 4ZQCA 4RNHA 1TSIA 1ZXIC 3VMNA 3SEPA 3P82A 2VOMA 3MMWA 4ML4A 3TUUA 2QUNA 1LL4A 2Q6ZA 1Q1RA 4TV6A 4PCSA 3ATZA 3C5QA 3MB9A 2QQ6A 3E49A 3KBWA 3IJ6A 4JL2A 4M1BA 2EPKX 3L4TA 4DO7A 3NL5A 4WY0F 1JGMA 3EWWA 3OVGA 5F4SA 3W6LA 9RUBA 3UA3A 3LLFA 3SN1A 5E9AA 2WNQA 3LU2A 2FKPA 3UETA 3KBVA 3H2AA 1LUCA 1U2YA 4MY8A 4E5TA 1VHCA 1R86A 1Q5MA 1A5AA 3BCDA 1F3XA 3GFXA 2J7DA 1SPQA 5BU6A 4DWSB 3A9BA 3G1VA 1S5MA 2QUVA 1Y5XA 1PZ1A 4IIEA 4OWGA 1H41A 3W7NA 5EMLA 4GA8A 1EEXA 4MKNA 2V69A 2VEGA 3KUMA 1EX1A 1TMLA 4YLWA 1XBYA 1ENUA 2HMCA 2Y5EA 4XTDA 4Q6JA 3EWXA 3PM6A 1J8VA 1B4EA 4H3DA 4I9MA 2X42A 2DT2A 3BMWA 1TZ7A 4GZ7A 3PR2A 1FEAA 2C13A 3QGKC 3T42A 1WZLA 2C91A 1NF0A 2DZTA 2PDYA 1V02A 3TAOA 2FLIA 3DC8A 1DQUA 2WCSA 3QYQA 1JD7A 1IQ8A 2V68A 5K4XA 1H61A 3ZIZA 3EA1A 1GGOA 1TVPA 3W71A 4HMDA 1GVYA 3VUPA 1QJWA 4YTUA 4AZ5A 3WJYA 3N2CA 3SSZA 1EO7A 1VPXA 5JCKA 3W0KA 2CLFA 2ZXBA 4EACA 3R11A 2ISWA 4KESA 1Z41A 3GTHA 2DORA 4LVGA 3DK8A 2BVTA 1Q3NA 4BFAA 3VD4A 4MYXA 1EF3A 3JVAA 4Y90A 1UR4A 1XUUA 2BOGX 1XBZA 1DE5A 1DVJA 1IEIA 4A3RA 1BQCA 1PJ9A 3G8EA 3PUDA 4NNBA 3VGFA 2TAAA 2WW5A 1XSJA 1PIFA 3WLKX 2ZWYA 1YE4A 1QMLA 4G1KA 2VO5A 3ELFA 3W84A 1NFPA 2HVMA 3FW6A 3CXBA 2OPJA 1B57A 3ANVA 3FGCA 1J0YA 2DGAA 2J8GA 3LHZA 4GYJA 4J9JA 4A3YA 4H4WA 1QT1A 1NY1A 2PRHA 1EDGA 4JTCA 4MY1A 4FB7A 3GNRA 1ZAHA 2ON3A 4B5WA 1R3YA 2PTZA 1AQMA 4UBPC 3IS4A 4XUYA 3C2EA 3SUTA 2ZC8A 1B3WA 3HG4A 3GXTA 2Z1SA 2VEPA 1O1ZA 3IIPA 1VBJA 2WJZA 4H6RA 1Q8AA 2OWXA 4RZBA 3TXZA 1VENA 2W92A 3G1SA 3R1ZA 4O13A 4H8VA 4YHEA 2Y5JA 1XYLA 3GHRA 5HXMA 3B05A 5AHEA 1TRDA 1G7VA 1MOKA 4GKTA 4WY0A 3RX3A 4R34A 1GZJA 4EWJA 4Y8EA 1HL8A 2NLYA 5MHBA 2X1SA 3NDYA 1C29A 3E96A 5IM51 3B9EA 1X8CA 3GVWA 3GNNA 4MDOA 2QCFA 2BC0A 1AW5A 1B2YA 3TJ4A 1TELA 2D2JA 1DIKA 2V5LA 3VE7A 2PA6A 3RPTA 5C9WA 3LSCA 1IF2A 4N2YA 4GLEA 3BO9A 5U4NA 3AHXA 3N2MA 1T8QA 3EB2A 4JTQA 3SIZA 4YTRA 1HGYA 7TAAA 5LNUA 3EOLA 1F05A 2ZZ5A 2PD5A 1B90A 1WQ5A 5G1MA 5D02A 2ZVRA 1TA3A 1E4LA 1PYFA 4PUKA 1J79A 3B9AA 2C8NA 3B0XA 4J35A 4E3VA 1WKEA 3SADA 1NSJA 1EA9C 3J7HA 5HATA 1KO0A 3KTCA 4OZOA 3SRFA 5EFFA 1NOFA 1B9ZA 1FCUA 4ZXLA 4ZQPA 2ZX7A 3QXBA 3E1F1 4FLRA 2P8BA 2PODA 4PUWA 1E0WA 1X2GA 5T9BG 4GQ0A 2QAFA 1KNWA 1JFHA 1KBLA 1F2JA 2EPNA 1Q66A 2D24A 5EYWA 2ZADA 4RXFA 1H1YA 3IIZA 2WVSA 3AC0A 3U48A 1ZX9A 5CQ1A 3VUSA 1TJ2A 3TSDA 5AHFA 3R0DA 3QPZA 5EA9A 3WH8A 4ACZA 1PSCA 1ODUA 2ZWZA 3IJDA 4OECA 9XIAA 5KINA 1XYAA 2WBAA 5TIMA 3AHZA 4QG8A 5KSWA 1UKPA 3TW7A 4IXXA 4O4VA 1UD5A 4H41A 4Q8VA 3GU1A 2V3EA 4Y9OA 4RPPA 3MSRA 5I00A 3TKFA 1POKA 1M3UA 2ZXQA 3WH5A 2UV8G 3GIYA 4XZNX 3FHQA 5FJIA 4DIAA 1Y0EA 3SZ8A 3BC9A 3RO6A 1XLCA 3B0PA 4FOJA 1UUMA 1GWJA 1UJPA 4E8CA 4E2OA 1K7FA 2X50A 5JCMA 3RF9A 3JU2A 4CD8A 4LUSA 3M5VA 3PWGA 3DFNA 3ZR5A 3R4IA 2X0HA 3GH7A 4GJIA 4JY8A 4KWUA 1B3OA 2OKTA 1TG7A 4DZAA 1O5KA 2PLCA 4GY0A 4ZO8A 4B5UA 3O9NA 4BY3A 3IUDA 5E6ZA 3LADA 1XGEA 5CC3A 4OFCA 1MNZA 1MFVA 3IJIA 1J4EA 1OYBA 4IGHA 4H4QA 4H4ZA 1H60A 1FTXA 1UD4A 2DSKA 1XLLA 1RM6B 4D9PA 2XH4A 4AB4A 1YXYA 3CWNA 4W89A 1UR1A 4IMGA 4U33A 4LJ3A 1XRTA 1V0MA 2DFAA 1SW0A 2X7VA 2XIIA 4P7OA 3SBFA 3SCPA 2FDMA 1W3NA 3CV6A 4LV9A 4QJ3B 1LRQA 2VR4A 1EP1A 1DBTA 1I0DA 2QCEA 4MJMA 5T8GA 2QS8A 2HISA 1KKOA 1V3IA 1NM9A 2EG6A 2XVKA 4RNJA 1KBKA 3POCA 2WSQA 1ZMDA 1RHCA 4IPJA 1HL2A 1GHRA 1KM5A 2VGGA 2GJLA 3P74A 3R79A 1LUCB 2JEPA 2OB3A 3W01A 1GTHA 5A8PA 2V38A 3BAWA 4GKLA 3OZOA 2E5CA 3L5AA 4JXCA 1FQ0A 4RX0A 3DHFA 4GGBA 3WN6A 4JTLA 1MQQA 5LIYX 3W6YA 2B81A 4K37A 5C9ZA 3SQPA 6REQA 3MUAA 4EPDC 7CGTA 1NU5A 3NQ8A 3LRLA 2UBPC 1VAHA 4E2VA 1DQXA 1LOLA 4DNAA 3DFPA 5KZ6A 4UFMA 1PDYA 5KZDA 4ZCWA 2XVLA 3N6HA 4IPNB 1HVXA 1TRIA 3FSUA 3VE9A 3G2GA 3N3TA 1M7PA 4ZB5A 3ID7A 1SZFA 5BW6A 2E1WA 3NS1B 1VKFA 3VD5A 1FH8A 5D9MA 1UZDA 2BXYA 3RCMA 2VUYA 3U5UA 3NQDA 1HJXA 4LW7A 1VJSA 4YCPA 4LIIA 2WNNA 2G3MA 2ZZ1A 1WYGA 2NVCA 4JN8A 1C8VA 3AS3A 3CM4A 2IKJA 2JK6A 3W83A 3U57A 4M24A 1TTIA 4KKXA 4W5UA 1OCBA 2V3AA 2WYSA 1QO2A 1FHDA 4BF5A 3SO7A 3D3AA 4JHMA 4QE4A 4V33A 3I6RA 4GC4A 3E5PA 2Z1KA 4XZIA 1JZ5A 1E55A 4QISA 4PTVA 5D2VA 4C6BA 4DZ5A 1WB0A 3CYVA 4WKFA 3M0ZA 2PDQA 1JPMA 1PHQA 3U2ZA 4UB9A 4V2XA 4M6QA 3V75A 3TYDA 3GR7A 3SGZA 3UYIA 2HROA 2OEJA 3FGCB 3A4AA 3EXRA 2V0TA 1WA3A 4GY7A 4O1BA 4MTVA 1F6KA 2RABA 5BROA 2DVUA 4XBKA 4AZGA 3CQKA 3LHVA 2BXZA 5FEZA 1UR3M 1FOBA 1YDNA 3R12A 4HNNA 2A7RA 3VIFA 1SO3A 3W1UA 1G5AA 4JDRA 3ONCA 3IAPA 1EC9A 5RUBA 2Q3RA 1ZLPA 3NIYA 4PUUA 4UC5A 4GH1A 4P7NA 3E2QA 1C93A 1V4YA 1JYNA 1B9BA 4ZTXA 7A3HA 2WWDA 1TWSA 4DVOA 1RA0A 4WY0B 5AC6A 2J62A 4UTKA 5PTDA 3LCIA 4DRSA 3E12A 1HQTA 4CNSA 1W2VA 4LCSA 3PG8A 1PXGA 4F40A 3GD4A 4FNSA 4CNPA 3RM8A 1P4CA 2ZX8A 4KBXA 1DXFA 3PBUA 3VYLA 4M81A 4WDXA 3H7VA 4ZXOA 3AIEA 4HU0A 4PB4A 1TJ1A 2YA1A 1WXYA 1EJXC 3SM0A 3E9AA 3L4YA 2WZIA 4WSJA 1B0IA 1BGAA 1UH2A 3VKCA 2QDEA 3FAXA 1V02E 2VQTA 2WM0A 1G1YA 4NY2A 1JZ7A 4Y9AA 2NV9A 3F4CA 4P8VA 4XUGA 3IJ9A 2V5DA 3I4KA 3CLMA 5CEWA 4NT0A 1BWLA 4UTWA 1ZNNA 3EOUA 1TA3B 4K8GA 1VYRA 1ZJBA 2VFGA 5I02A 3PWIA 4NJGA 2BOEX 3LBCA 2G8ZA 5A2AA 2C16A 3VGDA 3BAXA 1CX9A 4KT2A 3RU8X 1I9CB 3HJZA 4NNCA 1OYAA 1MNSA 1IIGA 1JF5A 1TYPA 3NQGA 2G4JA 1XFCA 1XANA 2PTXA 3I10A 1WDRA 3KRSA 2J8TA 4QFUA 3W38A 3MUY1 5LGZA 2CLOA 2VXNA 1M68A 3YPIA 3VABA 1WZKA 3PAOA 1YMYA 1M01A 1GVRA 3W1TA 2FFCA 3UGVA 3HPAA 3OTRA 5HAOA 6TAAA 4BS0A 4NEVA 1LJYA 2WCAA 1RCQA 3UPBA 5E9XA 4ACZB 5ABFA 4APNA 4IMEA 3QZ6A 4W93A 3LUTA 2OKOA 2B31A 2WPGA 4FI4A 1JDCA 1AD1A 2D0FA 1G01A 1TKKA 1C8XA 3IANA 3K8LA 3M44A 3QV7A 1TX0A 3EDDA 3N17A 3TYEA 4Q8QA 4M51A 1AODA 2HS8A 6PTDA 4QQ3A 3CWHA 1PEZA 3ARRA 5LNWA 2XSAA 3L5OA 3GH5A 3NO5A 1K9EA 1QRQA 1Q6OA 3NGFA 3PBVA 4GYFA 1DJGA 2OGJA 5E0KA 3WLHA 4JQ3A 4R33A 4C6JA 2ZIDA 4XZBA 4FHAA 2WPBA 2CLMA 5FCZA 1FP8A 3GS6A 4K7VA 4LUSB 4NXKA 8XIAA 3WD4A 1OB0A 5FD0A 3ARQA 3MCOA 4JKLA 3DERA 3JRKA 1FY6A 4AAJA 4XTIA 2A79A 3AIRA 5G1TA 4N4PA 3THQA 2EG8A 5K9CA 2WJEA 1SR9A 4UQDA 2OVLA 3O06A 3M1ZA 2WP5A 1C91A 3FXGA 3NO1A 1H11A 1K03A 4RDZA 1RD5A 1PVNA 2E40A 4NL1A 1MYRA 2W66A 2FVLA 3W88A 3TONA 3FN9A 2R1NA 4ACYA 2W5FA 3QGVA 2OWCA 3ARSA 1Z3NA 5E1QA 1FUYA 2JIWA 4AH7A 1E40A 2JF7A 3MS8A 4O16A 2XH7A 2PDWA 3GYCA 3UWYA 3ARZA 3W7JA 3O7UA 1BLIA 4CQAA 4QTGA 3W74A 1T3QC 3M0IA 3N2OA 1HKWA 4AD4A 3B8TA 1QK2A 3NCOA 1QNQA 5FJJA 2QAPA 1Y8BA 3PP7A 1WKYA 2WSYA 1NVMA 5LSMA 4W7UA 3GVRA 2ZFAA 3QZEA 3ARVA 1ZMCA 2W3RA 3SI9A 1RR2A 1SJBA 4F0HA 3BPWA 2Y62A 4PCFA 3L12A 4XO6A 2PCEA 2D73A 1OFDA 1DIDA 4TMCA 8CGTA 3KHJA 5CAKA 4ZO9A 2XTKA 4IH3A 6REQB 2J7BA 2WKJA 1DWAM 5JMUA 1DEDA 2GSHA 3ZXWA 1XYFA 1PAMA 3VINA 3WEOA 1JQXA 3B8WA 4GGHA 2ZE0A 3MJYA 2J7EA 2XM1A 1TREA 2VURA 3SW6A 3G1FA 3W7LA 1XCFA 1XS2A 3IPWA 1DWIM 4K2SA 1ME9A 3WUBA 4IJCA 3WO8A 1Z48A 2W4XA 3KBNA 4BWLA 4C90A 2QKFA 1JYXA 4GI6A 2IPGA 3GR4A 1YLVA 1ISZA 3N4EA 4Z2HA 5HR6A 4QEHA 4J7RA 2ZZ2A 2FZMA 1LZOA 2XHYA 4P7QA 3UPMA 2WC4A 2AQVA 5G1YA 3G0UA 2V81A 1NEYA 2VC7A 1XYMA 4OJYA 1PV8A 2XFRA 4F2TA 4X0VA 1CPUA 3TW6A 3UFYA 3IAQA 1LPFA 3TH6A 1SO6A 2QVHA 1TPC1 4AISA 2OLHA 5IRPA 2AL1A 1FEBA 1J2WA 4GISA 2O55A 1ZRQA 4ICCX 4PMVA 4H01A 3GTIA 1GRTA 3R0KA 4JEQA 3WLPA 3DFHA 4C1LA 3H4KA 2BY1A 2WOQA 4JFUA 1V59A 5C2XA 1VFOA 1C92A 4DZIA 3TP4A 5CC6A 4RJEA 1NDWA 3BLIA 3H7UA 4ENLA 1EP3A 2YKKA 3UG4A 4LX4A 1JDAA 1WAWA 3WIJA 3IRSA 2RFGA 3KRBA 2J77A 2E3ZA 4ZOBA 1MFUA 1Y5WA 2Z7KA 2A4AA 7ODCA 1NP2A 4FS9A 3SGUA 1BFNA 3LCWA 3QLDA 2PTDA 4R9OA 4ERGA 4GO8A 4L80A 4IX2A 2CESA 3AWNA 1DXLA 4DXXA 1YX1A 4DF2A 4LFYA 5D37A 5L6UA 5I07A 2WZTA 3AXIA 1XH1A 4GUJA 3TLLA 3CEUA 2AMXA 3LCGA 1H0GA 3U5YA 3VKDA 2NLIA 2YXOA 4ADSA 3QGAC 2I9UA 1CGTA 3LLDA 3NPVA 3SSJA 2PDKA 3XIMA 4AWUA 4HTYA 4F4RA 1LROA 1ZY9A 4PCTA 2R8WA 2KAUC 3OQ8A 1K3UA 1TIMA 3WQPA 2QNEA 4CD4A 2WXDM 3M0YA 4GYPA 3MUZ1 3T05A 3WNKA 1QI2A 2OO6A 2WLZA 4GQQA 2ZZ3A 1ICQA 4YHGA 3S5YA 4CD7A 4ZO6A 3JR2A 1JF6A 3F5KA 3NYZA 2BSLA 2ZRVA 3FYYA 3THCA 4H7ZA 3VVGA 4P8UA 1XH2A 3KRZA 4XWUA 1QPOA 2HPMA 2GR2A 3UGRA 2QPSA 3GK0A 5A6KA 1J10A 3BQ5A 4Q7NA 3M7SA 4PUMA 3HQPA 3K2GA 3SAZA 2GH5A 4H7VA 1ME8A 1NWTA 2DIKA 1Q85A 3KOYA 1QW9A 4JTTA 3TWAA 1VD6A 3CAKA 2INFA 3L4XA 1ADOA 6A3HA 3N73A 3FVMA 1WX0A 2G50A 1NDZA 3BTNA 4LAUA 1OHLA 1W9DM 3AUJA 3BUVA 3V0UA 2R9RA 3H2FA 4C91A 1ECQA 1W5OA 2Q71A 3W86A 1BWCA 3F2BA 4J3XA 4JFSA 5A2CA 1YDVA 2C3CA 1H0IA 1JCJA 3TN6A 1V0NA 2DV0A 3TMQA 1UROA 1SMDA 1X98A 3F4WA 3TR2A 3NXFA 2NX9A 1KLYA 3DU0A 2P88A 3GRTA 4ORMA 1ONRA 3U2OA 1Q4NX 1FO4A 1F6PA 5A1AA 3RU6A 3ABQA 3DX5A 3G1RA 3PPGA 3GHUA 4XIMA 4S3GA 2IQDA 3NFUA 5HMEA 3WBYA 4LSBA 2NQJA 5AOUA 3U4FA 1A3XA 5ABFB 2HS6A 1W0MA 3TYUA 1BXNA 4AD1A 4J3SA 4HPJA 3L0NA 3NWRA 1DWFM 5H8PA 4EMIA 3GG0A 4Q4SA 3WLNA 4I5UA 1O4UA 4HNCA 3V5CA 1JRCA 5DMMA 3MDWA 1LG2A 1K1DA 1KFLA 3AMDA 1AUSL 4L65A 4JN7A 3VCCA 1UOZA 3C2OA 1S2CA 3NURA 5FS6A 1X7FA 4OV4A 1IXPA 4LB4A 1U1UA 4IPIA 2NQLA 2V5JA 2EQ6A 3B8SA 1YHTA 1R9XA 1DV7A 4EXAA 3LB0A 3B9JB 1CZ1A 5HANA 3UZJA 5A8GA 3UZ5A 1Q7ZA 4MLJA 2HXTA 3W1NA 3AXKA 3DGBA 1CB7B 4AIBA 2NVAA 2YCJA 4ZTYA 4ATWA 5EMKA 2WC7A 2E77A 3WNOA 2Y7GA 2HVOA 4U31A 1VJZA 4CN1A 1D9EA 1R7AA 3BVJA 2VP8A 4LAMA 4C6CA 4J57A 3W22A 1K4QA 3ABXA 3BG5A 3GTFA 1EDTA 1TPEA 1NHQA 2YL8A 1UR0A 3OHMB 2PDIA 1IV8A 3I68A 3E0LA 4X0NA 1E3XA 3PUOA 3QPYA 1TV7A 2P5NA 4C1NA 2QIIA 2E3TA 1BPLB 1K7XA 3B8UA 5A6MA 2E67A 2FIQA 1SW7A 4GQBA 2JFEX 5FEXA 3WJWA 4O28A 2VOTA 2CFFA 3PBGA 2ACSA 3LV5A 3PG9A 2XWDA 2PRMA 3WELA 1SJDA 2ZC1A 4GVIA 3FFSA 3EPOA 1SFJA 2Z27A 4PBFA 3T0CA 3QMRA 2NW0A 3VZXA 2KX9A 4B92A 2PB1A 4DBDA 4E4FA 5FI8A 2DT3A 3NSXA 3GBDA 3O6YX 1KRBC 1DJWA 1KGUA 1LRNA 4QEEA 4GNKB 5A6BD 1PUDA 2INEA 2J25A 1UUOA 3IIOA 1IT0A 3T0AA 4EANA 4PMRA 3LQLA 2CHRA 1N62C 1ICSA 4ASTA 1WDDA 1VP5A 1QPRA 1ONWA 1RA5A 2E7FA 4HKPA 2CYGA 5ENLA 3W72A 2G95A 3QHMA 3BDKA 3IUHA 2V3FA 2CDUA 4JQ4A 3SB0A 3N18A 3PNUA 1F61A 4TOQA 1RV8A 3BG9A 2PU0A 3OODA 4Q8MA 1K77A 3QFBA 4ZOHB 4AZHA 1XI3A 2YL5A 1A4LA 7PTDA 2B7QA 3P14A 3NQ6A 2IPFA 3M07A 3BK0A 4LV4A 2MNRA 3G1AA 3QMTA 4L6OA 4MAVA 3OYZA 1UPPA 2YCLA 4UQBA 1XBXA 3F7JA 4DELA 1KCLA 5BOEA 1XM3A 1X6LA 4EPBC 4UTJA 3A21A 2QCMA 1P0EA 1N8FA 5BOOA 4K38A 1H2JA 3WQOA 1X38A 2PZ0A 3STEA 5F1VA 4JTIA 2D20A 3WNNA 2J74A 2FPYA 3VILA 2DU2A 3EB4A 1W1B1 1XH0A 2POZA 5DX7A 1UP3A 4H04A 2HBVA 3LN3A 3QFAA 2WZMA 2YBUA 3VDGA 1XX1A 4IMAA 1AJ2A 1S3HA 1ZBCA 1V08A 3RMJA 4Q4MA 1VFHA 2DZXA 3HN3A 4X9SA 1R2SA 1WE5A 3KDOA 4FR1A 2ZZCA 3MJMA 3WH7A 5LIXX 2PLJA 3OA3A 2ESCA 1V03A 1RD6A 2EJ1A 3WF0A 3MI6A 3L65A 3VOHA 5DMYA 4US5D 3WK3A 4U2YA 3E2RA 3KBSA 3OGRA 1CBGA 3K46A 1ZKQA 1HIZA 1LM1A 5C55A 5LGXA 4TVUA 5REQA 1R3SA 1EWDA 4GX8A 3O2LA 3NJ3A 3AUOA 1UD3A 2VZOA 1FWNA 4J2MA 4R53A 3HRDC 1UR2A 5JIPA 1RCOB 3KRUA 2GQ9A 4EK7A 2ZRUA 3W02A 4A29A 3SURA 3TCEA 3CHCA 2VVNA 3CPUA 4AHQA 2QT3A 2TYSA 4J56A 4UR9A 1V3JA 1RK5A 2FZBA 3OW1A 4QDMA 5LKYA 2VC9A 1UA7A 4JIQA 1CNVA 2YL6A 4D6IA 3L0GA 1LDCA 2X1RA 4L9ZA 1GSNA 2Y63A 3ARXA 2C79A 1U22A 3UT0A 3W25A 5DT5A 3EA3A 3WH6A 3DGHA 1OFBA 3TNOA 3BSMA 4WRHA 3WD2A 3TVAA 4Y2WA 3B8VA 4MOZA 4HSNA 3UJSA 2GDVA 2PRLA 1IEXA 4UIOA 3VXGA 4P61A 5HPOA 1W5PA 2NQ5A 1KFCA 5D09A 1TFVA 1LL7A 4N6EA 1XYCA 3A23A 1AZ2A 2A6LA 2WOIA 1TQJA 2OU4A 5EL1A 4H8HA 4QCEA 3MHUA 3DBPA 4LB3A 3Q67A 1QR7A 1LTDA 3FIGA 5BRQA 3OU8A 1J96A 3WDPP 5IFTA 1EJSC 3UY8A 1E3ZA 3PZGA 3N3MA 4K6AA 3ALFA 5D30A 3GB6A 2GGJA 5IDIA 3G3DA 1HNYA 3KOFA 5D9OA 3VIGA 1E1FA 3UD6A 1TPH1 1TQXA 2ZZ7A 4QE5A 3M4HA 3LRKA 1JGIA 5AHMA 2DIEA 2WZEA 1ZBKA 1IZKA 4LQ1A 1HJWA 1T7LA 3KLLA 3USZA 1GJUA 4R3UA 3O0HA 1NTHA 4P8WA 3E0FA 4ZE4A 4LS1A 3TOPA 4N9CA 1WUEA 4QCFA 5FACA 1LYXA 1RCXB 3SUWA 3CB8A 4XD4A 4DBEA 2YL9A 1KM1A 1I60A 4MKSA 1DP0A 2I9EA 5XINA 4LUIA 1KR0A 4JN6A 2CERA 4GPNA 1B3VA 3DK9A 3DFTA 3URBA 3B4YA 4A3QA 1WO2A 1JCLA 4IMDA 1PZ2A 1GVEA 1CLVA 2CW6A 2HBXA 2GQAA 4MHBA 2CLLA 4Q8OA 3JS3A 2NVDA 3W7GA 3BL3A 1UP2A 3WY1A 1U83A 2XGZA 3WD0A 4GXWA 1IEVA 4KQNA 5J04A 1KBBA 5SWUA 4RDYA 3AMZA 2YLAA 2E6YA 3CIXA 2GVJA 4DAFA 3TQKA 3U7BA 2DPEA 5A6SA 4P2VA 5GRTA 3EDJA 3A12A 4UOZA 3GXDA 5HNUA 1W9XA 3UVAA 4EWND 5GJMA 5CPNA 4H8NA 2VC5A 1DL3A 1EGVA 2ZX9A 4BCEA 3WLOA 3PWAA 4NASA 4PRRA 2YCKX 1R87A 1ALDA 3M0LA 4O8RA 3N12A 3HPSA 3DH9A 4UZUA 4FOKA 1EJ7L 4GBDA 3W2KA 4Q32A 2VELA 1KBIA 3TJIA 1ZL1A 2ZZBA 3RRAA 2VTFA 3M5YA 4I9JA 1XDLA 3WNMA 3FYPA 4CD6A 1KW1A 3TSMA 3NQFA 3H2OA 2A7NA 2YAUA 3LD5A 4OQVA 1EOKA 4C1NB 2AQOA 3G1DA 5CZ0A 1XLAA 1YYAA 2X40A 2F84A 4X22A 5I3FA 1VIZA 1GNXA 1VFLA 4IIBA 2GJNA 1KM3A 2NT1A 4J3TA 3A7UA 4HYRA 1EYWA 3CHEA 2FVMA 5D32A 1I2PA 3GQYA 1DIOA 4DZHA 5KITA 1XLKA 1E0XA 3W1XA 4UXDA 5F7UA 1OX4A 4N9EA 1OCQA 2AAAA 4O0QA 2JQXA 3W23A 1VBGA 5FESA 2X99A 4HOXA 3CU2A 2OWWA 1QNVA 1F74A 3ZSSA 2XVPA 2FZNA 2UY4A 1K9TA 2JIEA 2E1DA 2AL2A 3N2BA 3BH4A 1E4IA 5CSRA 4ZQMA 2GWNA 1FP9A 3FA4A 2E9BA 4H9ZA 4MZ8A 4O1EA 5JBFA 3KVLA 4PMYA 3RPMA 2C71A 3PJWA 3NVVB 3EDKA 4CEXC 4AQLA 2IUZA 4YL2A 4JAWA 4H50A 2BZNA 4Z0SA 1Q65A 1EP2A 2YXXA 4W4QA 4PMZA 1GOOA 5FF0A 2AOSA 2XVGA 4NU7A 1FWFC 3S83A 1JI1A 3SDOA 1L0PA 1EPVA 1F73A 2Z0IA 1V6TA 3NZQA 3LPFA 3W9ZA 3PB0A 3W7EA 4MJ4A 2QCNA 1WOAA 1F07A 2C1IA 4ORIA 2SFPA 2YCLB 1TJPA 5GVJA 4RDWA 4RCXA 1NARA 4QE1A 1FWJC 2YIHA 4LYPA 4NEWA 2P3EA 4M5PA 3VOGA 3ZWSA 1IIHA 2BY0A 4JX6A 2C3ZA 3QW3A 1TYTA 3HU7A 1WKDA 1MMFA 1AL7A 1UZHA 3CEPA 3G0XA 4TTGA 1K6WA 3CQHA 3JZEA 2I56A 1DE6A 1GEQA 1OCNA 1B54A 3BXWA 2WKGA 3RAOA 1OADA 3AAMA 3GU2A 4U3CA 4ROPA 1WOBA 3O07A 1RP9A 4KRZA 3RM9A 3ITOA 1XJBA 4NJHA 2F7FA 2OXNA 5AHNA 3TJXA 2WVVA 4M6UA 5DY2A 3PFMA 4UOQA 4H4SA 2R24A 1KXHA 1FWRA 3EMZA 4MWAC 3ABOA 5DQPA 3PF3A 1S38A 1VDVA 1KQYA 5REQB 3AFBA 5CBBA 4AUBA 4YU1A 5CJ5A 4A6GA 4BI7A 1BZLA 1HT6A 1MZHA 1A50A 2HQMA 3WNLA 3KS6A 4DM1A 1JULA 3MHGA 5E0CA 3T1GA 4Z1BA 2DUAA 3TTOA 4GZJA 5C71A 2AQWA 3QY8A 3W2JA 1GUVA 1AH3A 4GVHA 3UZZA 1KFBA 1UG6A 2Z24A 1WP6A 1VFSA 1D8WA 1F3TA 4GQRA 1UASA 4ATDA 3CZ8A 1FDJA 2O9RA 4PCPA 7REQA 3DUGA 3W4RA 3TYAA 4F0LA 5KZEA 1F7BA 3KLKA 4ATLA 3E38A 1O12A 2OQYA 1FWHC 3SRDA 4O52A 2C0AA 2CETA 1F3PA 2PWDA 1O5QA 2NUWA 1SZEA 1W54A 1I2NA 3BCFA 2A2IA 3CZEA 2CU0A 2J9ZA 3DKLA 2C6QA 3UNTA 4BI5A 2GFTA 1A0EA 2GR3A 4OOZA 1O5XA 1RQBA 3A4WA 4EF8A 4AFYA 3VDHA 2WSKA 1V97A 4MVAA 1ZAIA 2RAGA 3PPFA 1YDYA 4UFJA 1CT5A 2TPSA 1EQCA 3E0VA 3GXIA 3S1XA 3H8AA 1HUVA 5MKGA 1KWKA 2JEQA 2VL4A 4AMAA 1XPGA 3M46A 1B1YA 4A2RA 3OOQA 3VOFA 3W1MA 3KOWA 3LX9A 3NVZB 3CASA 1E0VA 3I6TA 1G67A 1H4PA 1U33A 5DLCA 2OQLA 4DF0A 2OZ0A 4DJFD 1QPNA 4LNYA 1F4HA 1MXDA 3HA1A 2PC8A 2ZUWA 4RZ6A 3B04A 1UWIA 3OBKA 1YPFA 3W7QA 5ABHA 3S9IA 5I3KA 3ZO9A 4MNLA 1BTMA 3VDCA 2GQWA 2Y8UA 3THUA 4N9BA 3P93A 2X8GA 4FALA 1BYBA 2ISFA 2UZ9A 4ZFMA 5CPTA 4O1AA 3WBAA 4DO5A 1GVFA 4U4MA 1LLOA 3T9PA 3ZR4A 3I3BA 5FSDC 4C7GA 3W37A 3AN1A 5GJNA 1N55A 4LCRA 3EUB3 5DELA 2XWEA 1OJXA 1Z44A 4WD0A 4KWWA 3O15A 3T44A 2V6OA 1P0BA 4MZYA 4WJ8A 4QP0A 3GDRA 2BX7A 4ALDA 4FPSA 1HKKA 1BQGA 2Y89A 1JR1A 1W1YA 1SQ7A 1FHVA 3NQ7A 2HCVA 1UMLA 1W1IE 4S2BA 4EPKA 5CZJA 5JQ9A 1YE6A 2GR1A 2Q8LA 1DWJM 3NL6A 2E09A 3K1DA 1AH4A 1Q6EA 3P61A 3TLQA 4UTUA 3HQ1A 3UZYA 4JBRA 3ISIX 3G5EA 4AXNA 3VNLA 5D9NA 2E4TA 1EX5A 5FEPA 2R1LA 4O12A 4UOJA 4Q22A 1FH9A 5CGQA 3OIXA 4PSPA 3CUFA 1TMQA 4NF7A 4N4QA 2VEIA 4CCCA 3A22A 2PDLA 4EAMA 3GDLA 4LBSA 4AHPA 2RGLA 5DF0A 1CXEA 4D72A 3C2VA 4KIEA 4TVCA 5H6HA 3WLRA 1RJRA 1S2WA 1CGYA 1LBLA 1WV2A 3FDGA 4JTHA 4EVZA 3VCNA 2CLHA 1LWHA 1JROA 8XIMA 3AXMA 3I7RA 1OX4B 4R5EA 2OG9A 3H22A 3TQ0A 4GMEA 1E5NA 4J1OA 2VX4A 3VO0A 4ADUA 4PTDA 3S9YA 1XDMA 2XM2A 3MSDA 4L64A 2NUXA 2PTWA 2PU1A 2IW0A 2J6XA 2DZSA 2X16A 3P60A 1J12A 2DUXA 1UKTA 1HJQA 2AL2B 2W54A 3NOEA 3EGJA 1Q13A 4Z08A 4IT1A 4W87A 1HP4A 4GI9A 2X0YA 4KEZA 4O50A 3FLUA 3PN8A 2X8RA 4AYGA 1GESA 3W2LA 4GY1A 3FY1A 3SRHA 3RPDA 1EC8A 5I3IA 3PZ9A 4K1GA 1F9CA 1F5ZA 2V63A 1OG0A 4IQEA 1TB3A 1X96A 2HDJA 4QS6A 1I1WA 5G4WA 2OEKA 1OWQA 1HKVA 2RHGA 4AVOA 4PUJA 1W5NA 3N2XA 3TE9A 1KCXA 2CBJA 3C0LA 3IC9A 3HZ3A 3DECA 1Q2RA 3AHTA 4PMOA 4FLSA 4K8DA 2QJGA 1ZB5A 2V2CA 4UQAA 3G3MA 3MYOA 4UTTC 2BGQA 4KIRA 3TYZA 1PZ0A 2VRKA 1GQIA 1DTNA 4AHOA 3CUXA 1NHRA 4DF1A 5DN1A 3MUIA 4PMXA 1GETA 3WENA 1UBSA 2BDQA 1BWKA 4R7OA 3KTSA 4YVVA 3Q4DA 4JOMA 3TTSA 3UCCA 1S5WA 1X1NA 2YCIX 3GLCA 1Y65A 3L21A 3PJXA 3W7DA 2E6DA 2WZHA 2JK2A 2I5IA 3WZ0E 3ZFHA 3NXLA 2G37A 3VOJA 3OVQA 3UR2A 3VU2A 2EBNA 1BYDA 2YGYA 3T40A 1A5UA 3SCWA 1V51A 3AXHA 4D6EA 3ZS4A 2WVVB 3TA6A 1H1ZA 1FWWA 2I17A 2BC1A 4QS5A 2ZX5A 3H4XA 2RDXA 3EX6A 5EMUA 4FNTA 1KXTA 4PUNA 5J8LA 3OJGA 2CLKA 3U3HA 2JE8A 3C0SA 1G94A 1BHGA 2JGYA 2DZVA 3TMLA 4XD5A 4OTKA 2WK2A 1S2VA 3LY0A 4RE0A 2QDDA 3ORWA 3UP8A 3QVQA 4JIEA 3DGZA 4UNKA 3RX2A 1QNPA 5U25A 3IJQA 1IT7A 1I0BA 2WMGA 1M53A 4GACA 4NIRA 1X1ZA 4JTJA 2OT1A 3PY2A 3KCLA 3PPCA 5C7HA 1A5CA 2OYLA 4GZEA 1TWZA 3FG2P 1HL9A 4D1IA 1KFWA 2Y85A 3VDBA 4OBRA 4S3DA 1W8SA 1GZGA 1ITXA 1LOQA 3SECA 4JYDA 2WPFA 1EBHA 2P1FA 1A5MC 3VZYA 7REQB 3NPWA 2ZDRA 1YNPA 2G0WA 5JBDA 1OC7A 3GNOA 3UR8A 3P6LA 2XYLA 3WQ6A 2OR2A 3Q45A 4DWSA 3QQ0A 1D8CA 3V18A 1UWRA 3DFYA 2FPTA 1ZUAX 2Q8XA 1L8NA 5BCAA 3S6OA 3EAOA 2DSUA 1UOKA 1J01A 1PHWA 3GWQA 4PCNA 3DKJA 2RDWA 1E6NA 2NQZA 4MLRA 4D6CA 4US6A 1EWEA 1IE7C 1JUEA 1P43A 3R10A 3HBLA 4FXJA 2FFIA 4EP8C 3P80A 4AIUA 4IWWA 3H4WA 4GXPA 4C60A 2RDTA 3GRIA 3AQUA 4HPNA 3UXKA 1TV4A 2INZA 3W7CA 4PH6A 3IARA 3LHWA 3VKAA 4RW3A 3S2JA 1G6CA 1W9PA 4AWEA 4WVXA 2DP3A 1FWDC 5MKGB 3TN4A 1BF2A 1ZJHA 3OB8A 1DHKA 3SJNA 5M1TA 1LP6A 4XO7A 3KHDA 3IACA 1NJJA 1E9IA 4IFOA 1FHUA 3TC7A 2EQ9A 2G3JA 5ABTA 1PX8A 3K8MA 1BVZA 2V5KA 4WKHA 3TTEA 1MW0A 2FH8A 3CZLA 3PUGA 1I4NA 4AWSA 1EJVC 2FZDA 3H4GA 3KL3A 4A05A 1YW1A 3F4DA 3LG3A 4HCDA 2J78A 4IQJA 3S42A 2ZQ0A 3S46A 2VT0A 4FA3A 1FDYA 2GVLA 2V3DA 5LNSA 5A3HA 2O9OA 2VHLA 4REQA 3UVIA 4DJDC 3IJ8A 4NAEA 1E5JA 1A5SA 3AHVA 2ACQA 2QPXA 2W9MA 5C5YA 2V6AA 3LNMA 3U8GA 3FJNA 5JU6A 2VZSA 1UKQA 4TXEA 3L9CA 3SQLA 2XH2A 4BQ4A 2F9RA 3DN5A 2BLEA 3S9ZA 5C2CA 2VC6A 4GCAA 1NWSA 4JD4A 3RCYA 4B9ZA 3CUJA 4GJJA 3ARWA 3WDRA 4Q8NA 5CAHA 1PIGA 2DSVA 3R43A 3WDHA 1M9HA 2EPHA 4DB7A 5HMDA 3G6LA 3WF3A 4AX7A 3P81A 3M47A 3TTQA 1W32A 2XU2A 3MUCA 5BYWA 3VD9A 1FRBA 5CH9A 4IP7A 5C9RA 2VGFA 3PZTA 1FWAC 3ZJKA 1A3HA 2OCZA 4YWOA 4L1XA 4TQTA 2XN0A 4GIRA 3SGGA 5LHEA 3TW9A 1GJWA 4EMWA 3U2CA 1DJYA 2D2OA 4Z1DA 4H9YA 4JQAA 2YVJA 1J11A 2YBTA 3NYDA 3L7RA 2E8ZA 2ZICA 1EUNA 2QULA 3MKCA 1O6IA 1HO4A 3BJSA 4BR1A 4Y6GA 3AI0A 2EXOA 2CBUA 4E4PA 1KM0A 1OABA 2XFYA 5F2GA 5AC4A 1QPQA 1EBGA 4PB5A 1VF8A 5D05A 5HWJA 1P6BA 4A8NA 3PANA 5AHLA 3H6OA 1K9DA 3OLEA 3BLDA 4LUYA 3UERA 5AKQA 2VEMA 3H53A 3CL6A 1JCYA 1R85A 4CLMA 1ADDA 1S2AA 4FX8A 2YDRA 4XZLX 2FGBA 4DBUA 2J6VA 4FOUA 1VFTA 2Q09A 2YBVA 1AQHA 4PUEA 4ZMGA 5D8WA 5GNZA 2X2YA 1TCMA 4FO4A 1E6ZA 3I7SA 5D33A 3B97A 3UJRA 1FECA 3MU7A 4LF2A 3BGAA 4G7FA 1XFBA 2QDGA 1D3GA 1POJA 4WIWA 3HIJA 1KWGA 4S23A 4K39A 2VFHA 2VFFA 3ITYA 1W3LA 2YW3A 1L6WA 1AW1A 4H4RA 1DWHM 4LXFA 4DAIA 3IGSA 3KAOA 4OT7A 1QI3A 3ARTA 1V79A 3WJSA 1R2TA 3QV8A 1JPIA 1JUBA 1MEHA 1S46A 2V2HA 2YZRA 1JPKA 2R94A 5LIUX 4QQUA 5XIMA 1QTWA 3R58A 1TZ9A 1XD1A 4KPLA 4JTDA 1JCTA 1CI1A 2EG7A 4R88A 1QXLA 2WO5A 4LGXA 2PDPA 2OFJA 4IGSA 1IHIA 2DQWA 4Q33A 1NFGA 4UTMA 1LQAA 4DY1A 2FB3A 2Y7DA 3NNTA 4C5YA 3L2LA 1OY0A 3CHFA 4DO4A 3F4VA 3UU0A 3EWYA 4QJ5B 4H8UA 2QCLA 2GQ8A 3AALA 4OU1A 3Q58A 1JCMP 1F8WA 2BV9A 1E6SM 1MO0A 2IPWA 3B9OA 2QUMA 4O1FA 1JI2A 4D8LA 1HN1A 3S2NA 2FHCA 3AS2A 3DHPA 1CGUA 4WK9A 4HT3A 2QZRA 4FF5A 4LEFA 3QYSA 3XISA 4CU6A 3UJFA 3AMLA 2CKRA 3GC2A 4J2PA 5DRIA 3XINA 4NILA 2VENA 4JIIX 1DOSA 4WGHA 3IK2A 3L4WA 3LXBA 3UQNA 1JD9A 1F3WA 3SCTA 1M6IA 1MQPA 3AO0A 5EKYA 3ITLA 5HA7A 4V1XA 3M5XA 1R3WA 4JIHA 5M03A 1ZY8A 1BRLA 3TC6A 2XN1A 1YQ2A 4MNMA 1OBAA 5GPRA 3AYVA 4FIRA 1ONXA 4CCDA 3GIPA 4NJKA 1A5BA 5A6AA 1T41A 4HHMA 3TV8A 3UWVA 4RDVA 3NZRA 4HZMA 3QQWA 4MFEA 1IXNA 6CGTA 3W7PA 1BXCA 3HJEA 3CV2A 4LAZA 2Z4GA 5FJTA 4YN5A 2GVEA 5CLWA 3UG5A 2TRSA 2NT0A 5DRCA 4AWTA 1MW3A 4DPQA 1PO9A 5CSYA 4LVBA 4RR4A 1X8FA 2HQAA 5HQMA 1F4AA 1ZK7A 3BV7A 3QFEA 3RUBL 4C5ZA 3A64A 4M0XA 4NAFA 2GZXA 1JEZA 4IG2A 1NHPA 5ABGA 3KOZA 3ZYZA 4ONVA 1TJRA 4M1RA 4QM1A 1YNQA 2E0PA 1E56A 3QSTA 3LCFA 2O0TA 1S1RA 3VIJA 4I90A 3G1HA 2HPIA 1XD0A 4GIYA 1XISA 4MF4A 4X9YA 1KTCA 3C8FA 3EX1A 3EOSA 1US3A 3NM1A 2QMKA 2HRWA 1KN0A 2QJIA 3T4CA 3O1NA 1Q6DA 3CQIA 1VB9A 2W62A 4MDPA 4B4HA 3WNPA 4CVWA 1SO4A 3MW7A 3PNZA 1Z42A 3PZUA 9XIMA 3CL7A 1HJSA 3PBMA 5JCIA 2HNEA 3UXLA 4NXSA 2OSXA 4DJFC 4KRUA 4R27A 2ABAA 2GUUA 2VDIA 1K7EA 3O0KA 3TC3A 1QI4A 1UJQA 1ZPTA 2OZ8A 3UR7A 3AIWA 4ZO7A 1UQYA 2E68A 3W70A 3EXSA 3BLKA 2FTYA 1QWKA 3TTYA 3MWAA 2PWUA 5G2WA 3GO2A 4REQB 4DUWA 1JOAA 4NAEB 2EJAA 4RE2A 1OGSA 2PBGA 3AYRA 4F3HA 4LS2A 1VCVA 5KVIA 1TWDA 2Z1XA 2JF6A 3GKFA 1Y7VA 4I5XA 2Z6JA 2DH2A 2ZRZA 3SJ3A 1E9ZB 5CJNA 3VMOA 1D3CA 3PTKA 1XYZA 4UQEA 4AZCA 4I8YA 4AZ7A 2Z2AA 1K8YA 2W3ZA 4AEOA 2QLYA 2HTMA 3D6NA 3P8IA 1BYAA 4FK9A 3GSMA 2QEZA 2QGYA 4R85A 4F66A 4YS1A 4QG6A 3NSNA 4CUCA 4N7QA