4HCLA

Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium and l-lyxarohydroxamate
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
384
structure length
384
Chain Sequence
b'SHMIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isomerase/lactonizing enzyme
publication title CRYSTAL STRUCTURE OF D-GLUCARATE DEHYDRATASE FROM AGROBACTERIUM TUMEFACIENS complexed with magnesium and L-Lyxarohydroxamate
rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 139
structure length 384
sequence length 384
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hclA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hclA01
3TW9A 4H1ZA 3ZLFA 7ENLA 4DX3A 3Q4DA 3CT2A 3I4KA 3SJNA 2FKPA 3RO6A 1DTNA 1WUEA 3IJQA 3R0UA 4K2SA 2GSHA 3UGVA 1JDFA 3OP2A 3DG7A 1BKHA 2OZTA 3UJFA 4KEMA 2P0IA 4HCDA 3FVDA 3SN0A 2XGZA 1KCZA 2QDDA 3NFUA 3RITA 4A6GA 3BSMA 2OX4A 4HCLA 1MNSA 3UJ2A 3ZLGA 3DEQA 2OZ3A 4YWSA 3OW1A 3TTEA 3T9PA 3CXOA 1TZZA 3PK7A 4H83A 3RCYA 3K1GA 3TOYA 1IYXA 2QDEA 2OVLA 3UJSA 3JZUA 2OO6A 3UXLA 3TCSA 5ENLA 3CB3A 1NELA 3D46A 3THUA 3UJEA 3R25A 3BJSA 5J04A 3R11A 3MWCA 3I6EA 2GGEA 4E4UA 1R6WA 1FHVA 3DDMA 3VDGA 3U9IA 3UJRA 1RVKA 3N6HA 3SSZA 2PGWA 1SJAA 2P8BA 4ROPA 3OPSA 2DW6A 4HNLA 3RGTA 1EBGA 2OPJA 3D47A 3RRAA 3UCCA 2QVHA 2XH4A 4DHGA 4E8GA 2HNEA 4F4RA 3TWBA 1SJCA 3NXLA 4IL2A 4IP5A 4H2HA 4GGBA 3BOXA 4M0XA 2OZ8A 4E4FA 4Z1YA 4DXKA 4A3RA 3QN3A 3SN4A 4JN8A 4HN8A 1BQGA 3STPA 3OZMA 4MGGA 2HXUA 4Z17A 2GL5A 4H19A 3MZNA 3GO2A 2PPGA 3VCNA 2RDXA 3FYYA 5BOEA 4G7FA 2MNRA 4J3ZA 4G8TA 1PDYA 2ZADA 3PWIA 2GGHA 1W6TA 3MY9A 1EC7A 2QQ6A 6ENLA 3EKGA 4JHMA 2PA6A 5FJUA 1R0MA 1PDZA 2PS2A 4HYRA 1KD0A 2PCEA 4ZA0A 1MUCA 4FP1A 2PU1A 3VFCA 2PTXA 1KKRA 2OG9A 1P43A 3RR1A 3MQTA 1EC9A 5EU9A 4E6MA 2GGJA 1ECQA 2PTZA 3PWGA 4E5TA 2PTWA 2GGIA 1NU5A 3TWAA 3DESA 3DG3A 4MKSA 2GDQA 4GFIA 3DFYA 3ZVHB 2XH7A 5BOFA 4IZGA 3MUCA 4A35A 3P3BA 3IJLA 3GC2A 2AL1A 1SJDA 4DWDA 3TJIA 3ZVHA 3QPEA 2XH0A 3Q45A 2GGGA 4MMWA 3U4FA 1SJBA 5IDZA 4GIRA 3V4BA 1JCTA 4J1OA 4M6UA 2QJNA 3I6TA 3FCPA 2ZC8A 4IT1A 3VA8A 2XH2A 3FJ4A 3N6JA 4HCHA 5FJRA 3N4EA 3R10A 2PP3A 2QJJA 2I5QA 2OQYA 3H70A 1EC8A 3QTPA 2FYMA 2O56A 5FJOA 3PFRA 2P3ZA 2AKMA 3IK4A 3UXKA 2PODA 4ENLA 2PSNA 2PMQA 1MRAA 1JPMA 2OKTA 3DIPA 4X2PA 1YEYA 3SQSA 3DFHA 3H12A 2P8CA 3V5FA 4KT2A 3B97A 3ES7A 3SBFA 2OLAA 3T8QA 2HXTA 4K1WA 4IL0A 3FXGA 3OTRA 1L8PA 2NQLA 3CK5A 3T6CA 2AL2B 3TQPA 3H7VA 2PP0A 4EWJA 2PGEA 4GISA 1E9IA 2PTYA 3R1ZA 2AL2A 2XSXA 2PP1A 4K8GA 1KKOA 3ZLHA 4GYPA 3DERA 4IHCA 1FHUA 2DW7A 2P88A 3V3WA 4GGHA 3KUMA 1ONEA 2MUCA 4IP4A 2ONEA 3CAWA 3JW7A 3T4WA 4DN1A 3FV9A 1XS2A 4KWSA 2OQHA 3VCCA 3JVAA 3NO1A 3MKCA 3QKEA 4HPNA 3UCDA 1XPYA 4JN7A 4KPLA 3OZYA 3H8AA 3P93A 4DYEA 3DGBA 3GY1A 2AKZA 2HZGA 2OFJA 3ENLA 4FI4A 1MDRA 2QGYA 3EEZA 1EBHA 1F9CA 3CYJA 1WUFA 3VC6A 3S47A 3S5SA 1MDLA 3IJIA 3R0KA 3N4FA 3P0WA 1TKKA 1JPDX 2CHRA 4HNCA 5FJTA 2PU0A 3ZVIA 3QLDA 4GYPC 3SN1A 3ES8A 1P48A 2QJMA 3VC5A 3HPFA 2POZA 3DG6A 4GMEA 3GD6A 4ZCWA 3MSYA 1TE6A 1ELSA 3TJ4A 3V5CA 5FJPA 1OEPA 3NZGA
chains in the Genus database with same CATH superfamily
2QVNA 3GXPA 2QW5A 3FNDA 2YCLA 4I9AA 4UTHA 2Z26A 4F79A 3TZFA 1YW1A 4JICA 4B5UA 3O8AA 1EUAA 4O15A 1E4LA 5A8NA 3RJYA 2VM8A 4L9YA 4DO5A 1MEHA 2E8ZA 4FSAA 4ML9A 3MVIA 2OZ3A 4DWSC 3VX1A 3OW1A 4H8VA 2Q71A 3UVAA 1F3WA 2CLEA 5FSDC 1PO9A 1XICA 1BEUA 2YDSA 3KLLA 3LZ5A 2OVLA 3W27A 5G1TA 2QGHA 4QLKA 3LOTA 1H63A 3PS7A 2WKLA 3OQEA 4EVZA 1FEBA 1RJQA 1QMLA 3BL3A 2V6AA 1HZYA 2FTWA 3ARUA 1IZJA 1W5NA 3AWNA 6ALDA 4LS2A 2QEZA 3MUZ1 3I6EA 1GZJA 4JNYA 1EIXA 1WV2A 1Z6KA 3BAIA 5DANA 3DFTA 4YLWA 3MU7A 2DSKA 4TXEA 3T0AA 2E5DA 2D0FA 1XX1A 1E1CA 2VZTA 1HTIA 3UWVA 3SSJA 2XWDA 4PTVA 1MFVA 2YCEA 3EWYA 4Z1BA 1WXYA 3KS5A 2G41A 3S9YA 3RRAA 1BTCA 3WDQA 1EA0A 2VNCA 4GUFA 3A4XA 1Q13A 3VUPA 4PN2A 3NURA 3PUGA 4IUOA 1L2QA 3MCMA 4GX9A 3BOXA 4Z2JA 3QOMA 3IK2A 3ZSTA 4EWND 1V6YA 2Q02A 2V0TA 1HXJA 1SFJA 5HNTA 1RBOB 2TMDA 5D2VA 3O7UA 3REQB 4E2OA 1DYSA 3W29A 3VZXA 3EWDA 1FKXA 3OZMA 4JTQA 1AW5A 1FRBA 3QV6A 2OB3A 4WIWA 1A4MA 4L61A 2W3RA 3LXCA 1M6IA 3EANA 2BBFA 2HCVA 3E0WA 3EKZA 1I9CB 4QSHA 2OWXA 2ANUA 4G8TA 4KFPA 2HE8A 2TRSA 2J7EA 4PCNA 1K6AA 1FWIC 3OBAA 2D1ZA 2VEIA 3R6IA 1VBHA 3LGEA 1GUVA 2PA6A 3MP4A 2VEGA 2BY1A 4NAEB 2WPEA 4J2PA 3HM7A 4YHEA 1W5MA 1EGVA 1V3KA 1L2UA 3H4GA 3N12A 3VKAA 3PBVA 3H2NA 3SCTA 2ATSA 4PSPA 1ZY8A 3TW7A 2Y1HA 3K2GA 4F8XA 1YDYA 4TQTA 3S9ZA 3WH9A 1S38A 1WYGA 4C7GA 2VENA 2E09A 1JZ6A 2WZIA 3K13A 5AVNA 3B8UA 3PWGA 4ZXLA 3S8HA 4LBSA 1ZDLA 3TN3A 1DP0A 1RPXA 2GK1B 6CGTA 4KWVA 5A8MA 3LB0A 3WBAA 1TX0A 2ZRZA 1N5XA 2F6KA 4GUGA 1XYFA 2ZRVA 2IQ0A 5C2GA 3DBNA 3A24A 3TJIA 2L5HA 2OSWA 4M3PA 2WB5A 3AIVA 3IC9A 3NUKA 4QXIA 2WP5A 3FXYA 4ICNA 3A4AA 4UQDA 2QJNA 5CPNA 4WEVX 1AQHA 4AD5A 4LYQA 1PX4A 1VENA 2DVUA 4I7UA 1H7XA 2RDTA 3A6OA 1DWJM 4LF2A 2GQ3A 2HJPA 4ASTA 2Y61A 5BYWA 2PP3A 3QTGA 3LQLA 2BC0A 4IFKA 3HQOA 3GRTA 1R3VA 4QNEA 4XZLX 3B3DA 2XM1A 4G7EA 5DQPA 5JIPA 2VZOA 4XIMA 2VC5A 4IFRA 2BFGA 4GUHA 1H7OA 1LWJA 1DWHM 2XGBA 1QWKA 2NX3A 4G5DA 3BGAA 1PSCA 4IL0A 3PZQA 3OBKA 4JKKA 4QJ1A 1E40A 2JF7A 5DX7A 3HPZA 4W9TA 2I5GA 5AYBA 1B9ZA 5F2GA 2YA1A 3EOEA 5FKYA 4M19A 3Q67A 3GDLA 4W87A 1STZA 1R8LA 1ODUA 5C2XA 3K1DA 4D6EA 1TB3A 1T0OA 4M6QA 2J6XA 2OQLA 2QV5A 4O1DA 2JKAA 3IJ6A 1SW0A 1W9PA 2ONEA 2GJXB 1EZ2A 4JFUA 4NNBA 4JFTA 4UTIA 1QR7A 4WJ8A 1IWAA 4HVXA 1DE5A 4HOZA 4Z1DA 5D37A 4UNKA 3VOFA 2CXGA 2ZUMA 1OJXA 4HPNA 4P8UA 3ITYA 1DQXA 2PLJA 3GU9A 1AMKA 4QTGA 3GY1A 1W56A 3CLWA 4FX7A 4AD4A 2O55A 3L5AA 4J3UA 2NT0A 1Z41A 1IXNA 1KTCA 3TYUA 4EAMA 2NT1A 2D20A 3UY7A 2RHGA 2G97A 2HNHA 3IJIA 3N73A 3P0WA 3W74A 3ISIX 4Q8VA 1JYWA 4FB7A 1CGTA 2WM1A 4MJZA 1NOFA 2PU0A 3QLDA 2CZ5A 3ES8A 6REQA 2PLCA 4O11A 3RHGA 3EB4A 3MSYA 4AX7A 1FWWA 1BYBA 1UHVA 1CNVA 1EJRC 2ZZ1A 5BRPA 4R7WA 3ECQA 4RPPA 2W27A 2OWCA 4V2XA 4EACA 1TIWA 1UKQA 1J6PA 2J74A 4YU1A 2GSHA 1JDFA 2C3ZA 2VEPA 3ANYA 2ALDA 1U33A 5EGRA 2FMOA 3UJFA 5FL1A 3CL8A 3V0UA 3FVDA 3IGSA 4UFIA 1O5XA 3GRIA 3NCOA 1R3QA 3DOPA 2C3CA 1FVPA 4Q6XA 3SAZA 3LHTA 4XAFA 1TPVA 1VLIA 3P2VA 4W8LA 1TPEA 3LSBA 4P5UA 3BTNA 5KVIA 3SUVA 4UQ9A 2XYLA 3JZUA 1ZCCA 4LYPA 1JEHA 3NQMA 4A29A 1JI1A 2J79A 3K5XA 1NELA 3H4XA 1GT8A 2ZA2A 5A8PA 2Z7GA 5A1AA 1W32A 2DT3A 4GQRA 2BLEA 1V97A 3SB0A 3OVGA 3V75A 1DXIA 1DNCA 3DHDA 3QHOA 4Q8OA 4LVDA 4PUKA 3U9IA 2DT1A 1SFTA 4K7YA 2RGMA 3KTSA 1GOOA 4EP8C 1NF7A 3DXIA 4YTUA 1XCWA 2G3FA 5FAGA 1ZPTA 2YZ5A 5EBKA 5CSSA 1DIEA 3BLDA 1E72M 4B9YA 1UC5A 4RZBA 5LIKX 3WNLA 3UCCA 4H9VA 1O5KA 3WL0A 4S3KA 2FHCA 3W87A 3ABQA 1XD1A 4XD3A 3W7DA 5IRPA 2X1UA 3M0KA 3PAOA 1RPKA 3F4WA 1US3A 3KFTA 4J3WA 4M6VA 3SN4A 3W1QA 3EWWA 4K7VA 1V02E 1FWHC 1R3YA 1G9HA 4OJYA 4W7UA 1PKNA 1VBGA 1QK2A 4YIWA 2ZZ0A 4AY7A 3TDFA 1KFLA 1VCGA 4BA0A 4ADSA 1CTNA 4C5ZA 5EYWA 4OBTA 5T26A 2WO5A 4LXFA 1XJBA 2VL4A 1XWYA 5LIYX 2OGYA 3I3BA 1GJPA 2Z2UA 5EPDA 4FS9A 4F0MA 4CQAA 3G3DA 4JHMA 3GXDA 5T9CE 5CPQA 1RJPA 4QDWA 3EB2A 5FJUA 1QNPA 1R0MA 2XIIA 3GBEA 7ODCA 3AMDA 3NSMA 1KNWA 2YA2A 1E4IA 1UUOA 4TX8A 3IGUA 1JZ3A 3W7GA 1M7OA 3TYZA 2KX9A 2O9RA 1ZS2A 3NJ3A 4L4LA 1D7YA 4LUTA 1PYFA 2FZ9A 2HE5A 4TVCA 4EPBC 4NVTA 4UTMA 2F6XA 1JULA 3RPDA 1LWIA 4C6OA 3T08A 1QOQA 5C9RA 1ITQA 1ZMDA 2TSYA 2V5KA 1Q1WA 4JOMA 2WANA 5I77A 4WQ6A 4GYFA 4A35A 4EPDC 3P3BA 3P74A 3SY5A 3W76A 2H6RA 2JK2A 2ZC1A 4I5XA 1WAWA 3LU2A 3VU2A 3D6NA 5BXPA 3IS4A 4UTJA 4CUCA 3U4FA 4F0RA 4R7OA 3GE7A 4XB3A 4RE2A 1ESWA 3IRDA 1E43A 3CV6A 3LG3A 3S0CA 3BQ6A 1V6XA 3BW2A 4QQ3A 4P2VA 2PUZA 2V3FA 3W7OA 2I5QA 3H70A 2O56A 4KRUA 5FJOA 3R8GA 3W4RA 1EF2A 2AKMA 4MDOA 2RKXA 5A6AA 3ANUA 4MOZA 1R2SA 5EMMA 4DUWA 4PMVA 1JZ4A 3EEGA 1JZ8A 3RDKA 2Y6ZA 4O17A 3SEPA 2V3EA 1ZBCA 3B0YA 1AJ0A 4Q7NA 2WM0A 3W0KA 3MO7A 4OIFA 1FO4A 1X8FA 7REQA 3BAJA 4P7QA 5AHLA 2ZA1A 3DH9A 1QNOA 3B05A 2QT3A 5FOOA 2UBPC 5LSMA 4NI3A 4JDRA 3VCRA 4O4WA 2YDQA 5GVJA 1ECEA 1KM2A 2AL2A 4TTUA 1EEPA 2PDBA 3CUIA 1PKMA 2VVNA 1RVGA 4IXXA 1E6PA 5FMHA 2O9PA 3N2CA 3M5ZA 3WD1A 1XYLA 3UD6A 1EHAA 4KF1A 3BURA 1W31A 3BZJA 4XKYA 1EHNA 3WNPA 3SJ3A 1GRTA 5JCNA 1SGJA 1ZKQA 2JQXA 1V08A 2Q01A 3THQA 3VGDA 3T4WA 5HR7A 3ALFA 4K8HA 1YRRA 3N34A 5CBJA 1E0UA 1KA9F 4DJDD 4WZHA 1ZENA 8CGTA 3PPHA 1GTEA 4LOCA 3WZ0E 4D6JA 5HWNA 1D9EA 3UCDA 3PTKA 3CTTA 1Q6LA 5ABTA 1TPUA 2DV0A 3PNZA 2GJLA 3KVLA 2ISDA 2DVTA 5EY5A 4NX0A 4GD0A 3ENLA 2X2YA 3LPOA 4US6A 2INFA 3QY6A 5C2CA 2NQHA 1XRSA 1MZHA 1H5VA 2UZ9A 4ZE5A 3RPTA 4O54A 3W01A 2VX4A 1KXVA 3R8HA 2ADAA 4Q4QA 1UZHA 4JTLA 3W1TA 2BY3A 3CV7A 1RP8A 1PZ2A 3MMUA 2X1RA 4DI9A 1HKKA 4H9YA 3SIMA 2OZ0A 3UNDA 3VD3A 3QSRA 4MUZA 4PMXA 3AAMA 1Z48A 4O4VA 2EKCA 4N9EA 2ISWA 2G3NA 1JVNA 3DFNA 5FJPA 1K9DA 2GQ9A 1YTDA 3TW9A 4FLSA 3TONA 4UFLA 5LIWX 3Q4DA 2PWEA 4LCSA 3P82A 2HK0A 4KIEA 3GW0A 2ZFAA 2NXHA 4FNPA 3GW3A 3WFLA 1T6MA 6PTDA 2P0IA 4C6KA 2F5ZA 2Y62A 2J9YA 4IIEA 4C1NB 4Y6GA 1SFLA 3AM9A 2YX0A 3N19B 4JQ3A 1VPYA 1OYCA 1Q85A 3S1XA 3PK7A 2YJQA 3MW7A 4JTTA 2NPXA 3SUWA 1XLDA 5LHFA 2XFFA 1MXDA 5KMYA 4TOQA 1Z42A 5E9AA 2F84A 4AB4A 3S1GA 3AO0A 3S6TA 2CPUA 5J04A 2VOMA 4FOJA 1K8CA 4MWAA 3H2CA 4CNUA 4DUOA 3LENA 2E5AA 1OB0A 1SO5A 4DZHA 2PLKA 1DJGA 3W53A 5B7ZA 1MRQA 4ZR8A 3TX9A 1ZMCA 2I5IA 2W0HA 4UTWA 2GR0A 3LUTA 3GH4A 1J5SA 3T4CA 3DECA 3G1SA 3WEOA 2EPKX 4GI9A 5CJMA 3KL5A 3D47A 3ZJ7A 1AQMA 3WQ4A 4HP5A 3I7QA 2TAAA 3GC5A 4QE4A 2BC1A 1LTDA 2DZTA 4I7WA 5AECA 3GYCA 3B04A 1VQTA 1EPXA 4S2CA 2VP8A 1XGEA 2TYSA 1P6BA 3DFPA 2TPRA 3FGCB 2VR5A 4Q8MA 4A3RA 4IGMA 2DJLA 3GB6A 1DJWA 4TR9A 2NUWA 4QG9A 5CG0A 3P61A 2YQUA 4H4SA 3GO2A 4ZBCA 4L6HA 1XYZA 2UY5A 4B4HA 3C0JA 4E4PA 3AZRA 4YN5A 3BLLA 3C0QA 4AFYA 2ABAA 3V5OA 1PDYA 3KTXA 1S39A 4BI5A 1Q6CA 3GVWA 1N61C 4TUFA 4W89A 3M41A 1EC7A 2FB3A 5FI8A 1OFDA 4ZOAA 1RXOB 2CZEA 3CEPA 3KLKA 3DZ1A 1WB0A 1ZGDA 1PDZA 1ZUAX 2J24A 4LAZA 1UOKA 3G18A 5I3GA 1UWTA 3UZWA 4BWLA 2VRQA 1VCFA 1K03A 1KKRA 5CSYA 1VS1A 1IR1A 3A22A 2IS7A 5EU9A 4BFAA 1UA3A 4AZ5A 3EF6A 3FS2A 2CLPA 1GQJA 1S2CA 1SU5A 2EEXA 4E5TA 5AHFA 2YXGA 2W63A 3QEZA 1Y5WA 3R58A 4XAGA 4IJRA 1O6IA 2NSXA 4IPIA 5BXRA 3UG5A 4JXCA 2NQ9A 3AMGA 1Q8AA 1HVQA 5LXXA 4W8BA 3DENA 1E3ZA 2AL1A 3EDFA 6XIMA 2VFFA 3H21A 2YCKX 1OCNA 1VEMA 4CU7A 2XG9A 3S2CA 4MDPA 2GUUA 2PDQA 4M6UA 4K39A 3IV3A 3HV9A 3T2QA 3P7YA 1TMQA 4C65A 5CPSA 3UA3A 5BWFA 3L5LA 3C52A 2A7NA 2ACUA 1A47A 8XIMA 4Q3MA 2A7PA 3DN5A 1EC8A 3T2PA 1BXBA 3HGOA 2V82A 4FIQA 4I5UA 5EMJA 4HTBA 3W70A 1OD0A 1EDTA 3ARRA 3O0HA 1TRDA 3ONCA 5DT5A 3WLRA 2DEPA 3SQSA 3LBMA 3UZXA 1E51A 4AIBA 5A2CA 2D69A 2J9ZA 1CLVA 2BGQA 2P8CA 3RM9A 3CQJA 1VRDA 3PUOA 4MWAC 1KQZA 4L80A 4H7CA 3U2OA 5D9MA 3SBFA 3VD9A 4S38A 3GH7A 3T8QA 2C91A 1BVZA 1I6NA 2EPHA 3P14A 4LYKA 5LYRA 1BSIA 4UTWC 1KV8A 4EWJA 3D3FA 3B9NA 1E9IA 2W3ZA 4UIOA 1GJUA 2VDHA 2HROA 2VFIA 4PMZA 3F4CA 9XIMA 5AN7A 2PEVA 1Q7MA 4I9TA 5U1OA 3T40A 2KAUC 3I3DA 3WENA 3WLHA 4AEOA 2ESCA 3PANA 4U31A 3VIKA 4I3GA 1EPVA 1H0IA 2D2HA 3WUGA 3TAOA 4UTLA 3GWQA 1KRMA 4J9JA 2ZDSA 4DJED 3K4AA 3A9BA 3G1YA 5XIMA 5CZ0A 1G69A 4YVVA 2R9ZA 1AVAA 1O68A 3GR7A 3CT7A 5D03A 4IIFA 3ELFA 4JNZA 4DF2A 3QZ6A 1N7KA 3KZSA 1KTNA 4LAUA 2VWTA 3TXVA 1NIUA 2OLSA 1GGOA 3CPRA 1UBPC 1BF2A 2E0PA 4A8LA 3PP7A 4JHOA 3II4A 2Q3RA 1GJWA 4MB1A 3KCLA 4DXVA 4D8ZA 5AB3A 4J28A 3PBGA 2X1SA 1Q5MA 1X6NA 4EXAA 1KC7A 5C5YA 1WUFA 1TVLA 4BWLC 3EUB3 3SCRA 2VGBA 1MDLA 1XV8A 2HPMA 1J79A 1VHCA 3OVRA 3O07A 3FJNA 3C2FA 1T40A 1ENUA 2ACQA 3RK8A 4CU8A 3QMRA 4IX2A 1XIHA 2D2OA 5DMLA 3PTMA 3T0BA 1XH0A 5HBFA 5TAOA 1BTMA 1W3TA 3CGEA 1XYAA 5CLTA 5DN1A 1W3KA 3B40A 2OXNA 1XRTA 1N63C 2CZDA 1XUUA 2QF8A 7ENLA 1VF8A 1XDMA 3C86A 3CBWA 3CHFA 1HGYA 1QNVA 5AHEA 4LUSA 1EKOA 9XIAA 4MNJA 1LDCA 3GNXA 5JCMA 1TUXA 1JXKA 4FLRA 1OF6A 1QO2A 1QK0A 2ZTKA 3W6MA 3GU1A 2FZDA 4NRRA 3NWRA 3G0UA 4M29A 2GRTA 4LVBA 3ICJA 2NXGA 1XYMA 3HZ3A 1W1A1 3WBYA 3W84A 1XLEA 3E74A 4RX0A 4L4MA 3CUJA 3C8NA 5K4ZA 2A3AA 2FJUB 2F8QA 4BF9A 2G96A 4EF8A 1R9YA 1S3HA 3RRXA 3UXLA 3EX2A 1CGYA 5ENLA 4N9BA 2DQXA 3W2UA 1VIWA 1C9DA 3OHIA 5AFDA 4KWOA 3SR7A 3UJEA 1W91A 1GVRA 4CNNA 3CUXA 1AUSL 3EXRA 3HG5A 4H00A 1G5AA 3TSBA 1P7TA 3GNDA 4IPNB 5DCDA 2GGEA 4GVHA 4WHBA 2DUZA 1GKPA 3WF1A 1X8CA 3OPSA 1RA5A 4EE9A 1BWCA 2OPJA 1A4LA 1IE7C 3IIZA 3CWHA 5JXQA 4YYFA 2Y8UA 4KCVA 2CHNA 2J7FA 5IOBA 4YNGA 3T8LA 4M51A 4ERIA 3CMJA 4IL2A 5CPTA 4DAIA 1J0IA 3O0KA 2ZE3A 2ZVRA 3NQ8A 1S7MA 3IWPA 4N7QA 4O1FA 3E0LA 4HHPA 2WSYA 1A3WA 4PTNA 3WUFA 4AYSA 4YVXA 4XZMX 1UP3A 2WNNA 1BQGA 4H50A 1FWSA 1NDYA 1OD8A 5JCLA 4H19A 4WSHA 3KBVA 2RDXA 1XUZA 4QSFA 5KEZA 4PSRA 3BLEA 5I3IA 2MNRA 1GOIA 4Q4KA 1PCKA 1U1JA 4R9XA 5I24A 4UMBA 2DZWA 4D9PA 2CBIA 2CITA 4AWTA 3RG6A 3ZR5A 4BEUA 6TAAA 1W8SA 1W8GA 3QPYA 1Z9AA 1JZ5A 3SUUA 4GQ0A 3BGGA 5CZTA 3GTIA 4CNOA 1TFVA 2HQAA 1KLYA 4GO9A 1SZRA 3AU2A 5G4HC 4E6MA 4MTVA 1M41A 2PDKA 3R4IA 2P0OA 3CL7A 1LT8A 5T91A 4TMBA 1U5HA 4R3UA 1P0KA 3SCNA 2IPGA 4NEVA 4AG0A 4O1CA 4UCFA 2EQ6A 4LEFA 3TWAA 4MKSA 2GLKA 4UQEA 2BSLA 1GZGA 1A5SA 1G1YA 2QUNA 3ZVHB 3GXMA 3PFMA 4CVWA 2VO5A 3NEHA 2C1HA 3IJLA 1TE1A 3ALGA 3E2VA 4XKMA 3KDOA 5C9UA 2GGGA 4R34A 4HMDA 3FA5A 4AF0A 1V4YA 2BWGA 4LW7A 1UH4A 1G7UA 3VDBA 4IX0A 1HKMA 2ZC8A 3N9KA 4A2RA 2Z6IA 2OOGA 4ZQRA 4Q22A 3BDKA 1AH0A 3IJ9A 2Z1SA 3RNDA 2NV1A 1CXFA 1PX3A 2R8WA 2PF0A 3S6OA 3FAWA 4AUBA 1J9YA 2OQYA 3PY2A 3PFRA 3QV7A 4C6PA 5MKGB 4QLJA 5I23A 1B9BA 3WQWA 1I2OA 2C6QA 2QPUA 4D2JA 2OKTA 5AC5A 1TX2A 1Q2RA 4XSLA 1S46A 3L4VA 1B3OA 1FH7A 2A6NA 1H2JA 1V93A 3WH8A 2JKEA 3FHAA 5E5CA 1DV7A 2PDHA 2QULA 4GIEA 4ORMA 4GISA 4F0SA 4RE3A 1AL8A 1CLXA 3DU0A 1JCMP 1J0ZA 2GQWA 1U30A 1VBRA 3AWOA 3I7SA 1YYAA 3WFAA 4Z1AA 2X0YA 3D9XA 3C56A 3UG3A 3SFWA 3P80A 3IARA 5FF0A 1K7XA 1FWGC 4DO7A 2ALRA 4W8AA 3E02A 2XJ7A 4GZ7A 1W5QA 3BVJA 5GNYA 3DBPA 4ZO9A 3KUMA 3B9JB 1FP9A 3ABOA 3SY8A 3NVDA 1XQLA 3LRMA 4DN1A 3L4ZA 4BI7A 4AZCB 1KM3A 2OQHA 2DH3A 2WMJA 1VJSA 2G95A 3W7NA 3CTLA 4GRTA 4LB4A 4NF7A 4M80A 4DI8A 1GOQA 1J8VA 3CB8A 3MKCA 4V1YA 3UETA 1UYQA 1TA3B 2G3MA 3H8AA 4GY0A 4AD1A 1T7LA 1XIGA 2PC8A 4N4PA 3ZQ9A 2RUSA 2V5JA 1V8EA 3VDAA 4BZYA 1UCWA 4A3QA 1GYMA 4NJJA 1QWGA 1IZKA 2C0HA 4JTFA 2GVLA 1IEXA 1PX8A 3WLNA 3N2OA 1FHDA 1XBYA 2YSWA 3W1UA 4DM1A 2ZWZA 4XAZA 1BVWA 4HZMA 5LNUA 4B9ZA 1X97A 5G4EA 3LLDA 3SCSA 4ZEPA 2FFIA 2IQDA 3AUOA 2W91A 2WWDA 3UG4A 3R5EA 4A3YA 2ZX9A 1OX5A 2YBTA 3RX3A 3M0LA 2XPKA 3GD6A 1XIDA 2PAJA 3JUGA 5HQMA 1EWEA 4A8IA 1LL7A 3ZLFA 2ZUUA 1BRLB 3KVJA 2WMIA 3N11A 1QAPA 3ITTA 3QY7A 4C5YA 3I6RA 4K37A 3Q2DA 4WSKA 4C1LA 3CQIA 4DIAA 4UTFA 4HN4A 4U33A 1W9UA 3OP2A 1OK4A 2XU2A 4DJEC 5HA7A 1JI2A 4IIGA 5A6BA 3H7RA 4O0ZA 4MY1A 2V2DA 4EQSA 4UQCA 1XANA 4MPKA 1GV4A 1DIOA 4S3AA 1TJ0A 2GFTA 2YL5A 3EGJA 3THCA 2OX4A 3TUUA 3M0YA 2W66A 3H54A 1W3HA 4TTGA 2QDHA 1SW7A 2XFRA 3VE9A 2C1GA 4IJCA 1X38A 3U57A 3CXOA 1WYIA 4RE4A 4D6DA 3K1GA 1DORA 4I90A 2WAGA 4HQVA 3G1RA 3L2IA 2CNCA 1KBJA 1Q63A 4H2CA 5AYYA 4A3UA 2OSYA 2BXYA 3TCSA 2X40A 1CXEA 3OGRA 3W2KA 2F7FA 1TWDA 2VRKA 3LPFA 3R25A 3BJSA 3WBXA 2VFDA 5XINA 2MANA 1VFFA 3I3EA 3WK3A 1NQKA 3MWCA 4E4UA 2A2IA 3DDMA 2O0TA 4NXSA 2PBOA 1M7PA 2FH6A 1W9VA 1BZLA 3W02A 4CD8A 3CAQA 1XLFA 4JIQA 3PJWA 3RUBL 3IEBA 1N62C 1FWBC 4OKDA 5DLCA 1LZOA 1KCKA 1MVYA 1AW1A 2Y5SA 5U4NA 2BHZA 4HZ7A 4FEZA 1ONFA 2FTYA 3VKKA 4ZMGA 4S3EA 1DIDA 3M0JA 1HIZA 4EANA 1PEZA 2PDJA 1A0EA 4UCGA 1NWUA 4ZOCA 3S5OA 5D2YA 1VBUA 4PUEA 5HATA 2POTA 3CWOX 3TFXA 1S3TC 2B31A 3RR4A 3F5KA 3U4AA 2HQMA 3NOEA 4KIRA 5FIPA 3REQA 4HNUA 5I5RA 1AMYA 2O9TA 4UOQA 4J3ZA 1YMYA 4KCTA 2YFOA 3PAJA 2W54A 4IGNA 4HU4A 5EBAA 3ANVA 4JD4A 1B2YA 1CZ1A 5F2IA 2CLLA 4ZOEA 3STFA 5CAKA 1UR2A 1OFPA 1UPPA 3BE7A 3MMDA 4EOUA 4WOZA 1YBQB 4Q7IA 1YQZA 3WF4A 1ODZA 1O7AA 4I8DA 1G4SA 4F2TA 3TQ0A 3AOFA 4G6CA 4FP1A 1T96A 4B5NA 2OWWA 1ALDA 2GVYA 2VGGA 3HIJA 1AZ1A 4L4OA 5FAJA 4NAEA 3K30A 3PULA 1EUNA 4GNVA 2YLLA 1S5TA 2FH8A 4GH3A 2YBVA 4PEKA 3H55A 3WQ5A 1HL2A 4TX6A 1XG3A 1P6WA 5I79A 1NU5A 3WD3A 2W0UA 2Z24A 2C8NA 3M64A 4X9SA 4GFIA 4UOZA 3JRKA 2XWEA 2E5CA 3EPMA 3QYSA 4NZFA 5A8OA 5GRTA 1TYTA 1R3RA 4D71A 2BODX 4GACA 3RX4A 2XN0A 1M68A 3VE7A 2GK1A 4EM4A 2E28A 1OBAA 8RUCA 3DKJA 3VGGA 2NSOA 3QPEA 1DXFA 2B4GA 5I09A 1F4AA 2D22A 4TU1A 1ZHAA 1POJA 1XFCA 2EPMX 3AIQA 2WMHA 3TMQA 4O1AA 1XLKA 5HXMA 1LP6A 1GRFA 4JTCA 3FN9A 5GJNA 4K8EA 4JFWA 2WSRA 1K8ZA 4PTDA 4LPCA 4ZQOA 4JYEA 2CBUA 1E73M 1EQPA 4XUGA 1QXLA 1SMAA 1RD5A 1B90A 1UD8A 2R1LA 3IV8A 5GPRA 1Q65A 3HRDC 2VMFA 4GKLA 2OLAA 1LLZA 2B7PA 2CDUA 4E2BA 3AXHA 3ZT7A 2WHLA 3WMLA 1MO0A 2VR2A 1T3QC 1MXGA 2OR2A 4DNAA 3WD4A 3WL1A 4KEVA 4APNA 3VGFA 2DPEA 5HDRA 4XUYA 3GYEA 3CGCA 1W9DM 1A5AA 3SRDA 2GJNA 3IJ7A 4GYPA 4ATWA 5F4SA 3UWUA 3WDPP 1HT6A 4J57A 1X7FA 1ONEA 1ZAIA 1YE4A 1YQ2A 4JNMA 3RPMA 1D2KA 4PCFA 3FV9A 3BXWA 1KCLA 5H6HA 4OT7A 1JZ7A 4M81A 4UFJA 1HO4A 2WJDA 4OFCA 4UMAA 3Q58A 3M44A 2XFYA 1NHPA 4PODA 4QM1A 1UWAA 2GJXA 1DQWA 2CWXA 1IXOA 3ARYA 1VHNA 3LY0A 3T0TA 1I0BA 3H23A 1FFRA 2R24A 3VOIA 4HTYA 3C2YA 4YMZA 2J4GA 6TIMA 1JYVA 4DWSB 3WBEA 3S9IA 2CLFA 3S83A 1K3UA 4H9XA 1H0GA 4DO6A 4GI6A 2Y88A 4DBUA 1XD0A 1WDWA 2Q09A 2YCIX 4TV6A 5CC6A 1E55A 1A50A 1VJIA 3R0KA 3VKCA 3LBOA 4NAFB 5FJTA 3RIKA 1I60A 7A3HA 2PFHA 2PWUA 3LSCA 4IQDA 1VFOA 2WVVB 5LNRA 1D3CA 4H4PA 3HGJA 4EF9A 3DG6A 1GQKA 3G8RA 1TG7A 2VFEA 5HMDA 1EF3A 3HGRA 3KRZA 1QHOA 4RDVA 1DJQA 3IANA 4JQ9A 4BJHA 1PZ1A 2ZZ7A 1V3MA 3UR2A 4OHQA 1DPMA 5DO8A 1MI3A 3CT2A 4CCDA 2QIWA 3FEQA 1KBIA 2Y63A 4CNPA 4C6FA 2YOCA 5BMWA 1N8FA 1GOXA 1EP3A 3CASA 1TREA 1FDYA 2VWSA 3AMZA 4HCDA 2DU2A 3LCGA 4AEFA 3MMTA 2G3JA 1JRPA 1MNSA 3HGSA 3BG3A 4HYWA 1ZXIC 1E6NA 4EX4A 2WCAA 3HPSA 1UZ1A 4H83A 3KX6A 2XN2A 1LBLA 1QHZA 2J47A 2BGNE 4OV4A 4L1WA 3MI2A 3Q94A 1AQFA 4B5SA 3HFYA 4OGZA 2OO6A 4BCEA 4MY9A 4MHBA 3VNYA 3STGA 4KCWA 4NYUA 1VR6A 3E5PA 4KCUA 5FEZA 1J96A 2P53A 5ABFB 1YX1A 3W23A 4PUNA 1WBHA 3L9CA 3D46A 4Q8QA 4KQNA 4WXYA 4KETA 3THUA 2CBVA 5AZ0A 1S2TA 4HNNA 1L0PA 3GS6A 3PM6A 3OLDA 1G67A 3ARQA 1DWFM 3FW6A 4V1XA 5KZDA 3VD5A 1L8NA 1DQUA 3RM4A 3HN3A 3TYDA 1O60A 2GQ8A 4I8YA 5A6LA 3AXMA 2EG8A 5AYZA 5FS9A 2XH4A 1NP0A 1VYPX 2E40A 3LTPA 4XD5A 3TWBA 2YDAA 4PMDA 5PTDA 1M01A 3EDDA 4XG1A 3UESA 4GGBA 4C60A 2OMAA 5B7YA 4A3HA 1WPCA 3CHDA 1XH2A 1KGUA 1F76A 3P5YA 1T8XA 4DXKA 1CGWA 2V9DA 2QYGA 3WH7A 4UTTC 3CYVA 2X7VA 4WDWA 3GK0A 4A8NA 1Q4NX 4IISA 3L21A 4HYVA 3FYYA 3B06A 1MQPA 4NZCA 4PYSA 2Y24A 3N3TA 3HBLA 3A21A 3P5ZA 1HJXA 3WH6A 3KWSA 1T41A 3GU2A 3W7CA 3ARTA 4H7ZA 2GGHA 2INZA 1GYLA 2ON3A 3ARWA 4ERAA 3E6EA 2W61A 3I65A 1ZL1A 4JIHA 4L65A 2ZCGA 4CQCA 3GDKA 1MEWA 1XL9A 3W7EA 3SY1A 2IKHA 1B3XA 2VQUA 3AMCA 4NASA 5IM51 3VYLA 3CEUA 1MFUA 1P43A 4W88A 3WLMA 3SR6B 1KRCC 1A49A 4X9YA 1Q1RA 2X41A 3TTYA 1JOAA 4LAMA 5HNUA 1X1OA 4REQB 1ZY9A 2PTZA 1I2QA 2NUXA 1JROA 1KFJA 5A5WA 5I00A 1OM0A 1UPMB 2P5NA 1LG1A 3KBJA 1F74A 1L6WA 2E8YA 3T05A 1TCMA 4AHPA 2P3EA 3DFYA 1PBGA 2ZUNA 4E38A 1QPRA 1K6WA 2DQWA 3AXIA 3GC2A 2VXNA 1UKSA 4GRSA 5TNVA 2CERA 3T0DA 4E3TA 3MPGA 1ZX9A 4JTEA 3BMWA 2WP6A 1M03A 1QW8A 3B9DA 1ZJHA 3C2EA 1P4CA 2VC7A 2Z2BA 3GXTA 1H7RA 1GOKA 3L0GA 4IT1A 4QG8A 1BAGA 1TRIA 1FWJC 4S3JA 1QOPA 3EXTA 4FR1A 3N6JA 4GNKB 2CFFA 3N4AA 3R10A 2QUUA 3SADA 3CQ0A 3FAXA 5CKSA 1GVIA 4U10A 1VYSX 5A3HA 2WKGA 1MRAA 2ZWYA 1JPMA 2ZX5A 7TAAA 1NQ6A 2V3AA 2RABA 1EX1A 4KH2A 4LV4A 2J7HA 1QT1A 1TYGA 3ES7A 4BR1A 3V0TA 4AZ6A 4AD3A 2DY3A 3T6CA 4C1KA 3CH9A 4L56A 1AA1B 1W1PA 5KZMA 3CQKA 1JDDA 2OO0A 1X2HA 1CX9A 4YXGA 3L65A 4J27A 4NYYA 3W38A 4GQBA 3M0VA 4H4TA 2Y7DA 3KBMA 4WGHA 1HKIA 1FFVC 2A8XA 1LORA 3PZMA 2CKSA 1B3ZA 3G1XA 2CKRA 2ZUVA 4OV9A 3UWEA 3V3WA 2PWVA 3L23A 2EQ8A 5DEZA 1RQBA 2MUCA 1F8IA 3CAWA 3NQ2A 1OT2A 3JW7A 3MBDA 2OODA 4FAMA 1KRAC 1C91A 4RDYA 3C8FA 4RE0A 1GQNA 4N4QA 4GK8A 3E3HA 3N13A 4R88A 3RLUA 4FLOA 4DF1A 1WOBA 2W62A 1OX6A 1JRCA 2Q6ZA 4MZ1A 1EJXC 4WOQA 2ZRUA 3W7MA 3TC3A 1GERA 2E5BA 3L4XA 3VTRA 2GVJA 2OCZA 3MYPA 1FWCC 3C2RA 4QITA 4XAYA 3DHUA 4GNJA 2XM2A 4F0HA 2PTDA 5G4WA 3Q6JA 2XTKA 2PWFA 3GIPA 3S1WA 3CMGA 2Y2WA 4DZIA 1ZK7A 3V36A 4JEQA 1UROA 3RCMA 3AHZA 2J75A 3MHUA 3W1AA 1UQZA 4Z2GA 2XVPA 1VLWA 4PRRA 3QV8A 2NVDA 5M03A 1LL6A 2WLZA 3NM3A 4RNIA 1Y5VA 4QS6A 1DKWA 1OFOA 2A4AA 5TF0A 3UZ5A 3SURA 3VMPA 2ZZ5A 3WJXA 1I0DA 4NNCA 3S2MA 4ORIA 5EMLA 1NDWA 4ZCWA 2VZVA 4AZIA 1JDEA 1XLIA 2GDVA 3UU0A 1EBDA 4LC6A 2GR2A 5LGXA 4U5IA 1OEPA 3HG4A 1E1EA 5CH9A 4QP0A 4HHLA 1EGMA 5I2UA 4H04A 3E9AA 1Q45A 2A3EA 4IJBA 1L6YA 4KKXA 2VELA 1OWQA 2PZ0A 4D6IA 5KTLA 2V3GA 4MADA 4ATDA 4XBSA 2OZTA 4TMCA 1AJ2A 1Q4WA 3GBDA 1XIJA 1YADA 4ZTXA 2ODOA 2P10A 1R3TA 2IKGA 3AQUA 3ETRB 4A6GA 1UR0A 1W54A 1IGSA 3AS2A 3PBMA 1J2BA 4V15A 3NPVA 3BLFA 4HA4A 1G6CA 2Q3OA 1UWRA 3MMWA 2B0MA 4AIOA 1RCXB 3TQKA 3WLJA 4JYDA 1NFBA 4QAWA 1P1XA 1F4HA 1RBAA 4C1NA 3B8SA 4I6KA 1OADA 2QS8A 2FIQA 4GHRA 3UJSA 3UZJA 4IFOA 1QHPA 1PE1A 3PG9A 3VO0A 4D6GA 2VDGA 1M1BA 3WLTA 1FWDC 1VB9A 5E0FA 3K4WA 4LALA 4Q32A 1R30A 2VI0A 2XVGA 1E4NA 4IUGA 4IIHA 4CD7A 3DGRA 4NZJA 1QNQA 1PXGA 4DZ5A 1RV8A 1SFSA 5C0QA 3F4NA 3TEVA 2C3DA 2RFGA 1GXFA 1R6WA 2XISA 5A6TC 3WF3A 3T78A 5LHEA 3GFZA 1K70A 1G0CA 4Z0JA 1JNEA 1TPB1 5J5DA 2EQ9A 1JG9A 3PZIA 1F3XA 1C29A 3RXZA 2QVHA 4J5NA 1E9YB 4O12A 2I1OA 2WVSA 4DRSA 7CGTA 4WK9A 4BURA 4WX2A 4JYFA 2J66A 3UR5A 4K6AA 3H24A 2KZHA 1IWPA 4KRZA 3WSUA 3NQDA 2ZOXA 2V69A 4E4FA 3VKDA 4Z1YA 2Y4SA 3VD4A 4JN8A 1FWAC 5D38A 2GL5A 3APTA 3W73A 4AVFA 1HNYA 3VCNA 4N42A 1J10A 1ICQA 2G0WA 5BU6A 4FXFA 3KLJA 3FGCA 2ASHA 2WZTA 3TV8A 2DGAA 3GUWA 3ZJ6A 3HURA 1HKVA 4OBRA 3CZLA 1TTQA 1JCJA 2ZX6A 2QMKA 4AHOA 1OG0A 3UBPC 3VM7A 3K8LA 2XVNA 5IFPA 2VX7A 4OBSA 5DT7A 3LS9A 4ZA0A 1C9WA 1M9HA 3G22A 5LGZA 2C79A 1UH3A 2YKKA 1ECQA 1GW9A 3L2LA 5HMEA 2ZUTA 3TR9A 1LCOA 4RNFA 3KW3A 1M3UA 1UH2A 3IVUA 3A7AA 4OECA 3L68A 1CW2A 2FJKA 2R1MA 2Y7FA 4HZ6A 4RZ5A 1DTUA 1IHIA 2Z1WA 2BNJA 1FP8A 4B3KA 2YBUA 4B16A 2R1KA 1PWMA 1V6VA 3I68A 1GG0A 4WDXA 4UNIA 2YGYA 3I7RA 4Z42C 3LNPA 4M5PA 3ATYA 1H60A 2OU4A 3A3XA 3CUGA 5DRCA 4EAYA 3KOFA 3SGUA 5IHSA 3NYDA 2D23A 1D8CA 3TTQA 1E6XM 4DY1A 3A5VA 4DZAA 5F4WA 4JY9A 2VVSA 5JH2A 1FECA 3CU2A 2PD5A 2QCMA 1ZALA 1D8WA 4HNVA 3RFAA 5B80A 1NOWA 3EDEA 3SECA 2QNEA 1K1DA 5A95A 2QKFA 1CXKA 5AC4A 2G8ZA 3WJZA 3LPPA 2DZUA 1DWAM 4GUJA 3G1HA 2PMQA 1XGZA 4DQWA 2IKIA 1KM4A 1RA0A 1QATA 3TJXA 3LHYA 4G1KA 1OF8A 4KEUA 4M7SA 2EHHA 4X2RA 5CQ1A 1D3GA 3S4TA 4GA8A 5AYXA 5C9XA 1TR1A 2CZFA 4NZ4A 1YE6A 3GM8A 3B8WA 4NJHA 5A8GA 4MFDA 4P7OA 2X50A 5DMYA 2J3NA 3E38A 1B3VA 2G4JA 4LAOA 2PTYA 1OCJA 3S2LA 1KR1A 1QBBA 2IW0A 1UBSA 3NPXA 1MW3A 1JF5A 5G1YA 1UR3M 3PJUA 1E5NA 3CL6A 2ZDRA 3M6DA 3SDOA 4GGHA 2WZMA 1TWSA 1RZMA 3R7MA 4D6CA 3EAOA 1J18A 1ME9A 2TPSA 4ZB5A 2ZXBA 1BLIA 2WPBA 3TROA 2EJ1A 1L9WA 3EA3A 3T0CA 4NP7A 3VIPA 5D2TA 1FH9A 4GG9A 1R87A 5K9CA 5D9NA 3JVAA 3JZEA 4R7JA 2FHBA 4Q4SA 4ALDA 1RALA 3PC0A 1JGIA 1LF1A 4Z2LA 1QPKA 1Z8AA 1H1YA 5HJLA 3NOYA 1FWTA 5HAOA 1XLCA 4HD5A 5G2HA 3O2LA 4FI4A 3AHYA 3BANA 3KHDA 1OZMA 3OOQA 1IIGA 1YXCA 3BJFA 3NL5A 3LCHA 3ITVA 3UYCA 3E96A 4B90A 3ZWSA 1TV8A 5XIAA 2AQOA 2WPFA 1JCYA 2X16A 8A3HA 3WEZA 1K9TA 4CGTA 3PUDA 1UMLA 3S6DA 3UY8A 4F9DA 5LZLA 2A85A 1WZKA 2WBKA 3RM8A 2AQWA 1SVDA 4HZ8A 3BAWA 4R33A 5I3HA 4ZB2A 3BSHA 3ME3A 4LUIA 1G7VA 3ABSA 4QE5A 4YTQA 4MJMA 3V5CA 5C70A 3EOOA 2J7BA 4ADWA 1F8WA 2FDMA 2BVTA 3TK7A 1A5LC 2WMFA 4DPQA 3GH5A 4ATLA 1MW0A 2E6YA 1BKHA 4KEMA 3MYOA 2AQVA 3SN0A 3WLIA 3B0PA 4PGLA 1PIIA 3MI3A 3NVVB 4YWOA 3W00A 3UPBA 3H2FA 4PA8A 1FY6A 1D7KA 1WP6A 3BARA 2J9XA 1PKLA 2PE4A 1CB2A 5HMFA 1J2WA 1OFRA 2E9MA 4Q6JA 4QBXA 4UNLA 3ITXA 1U2YA 1TQXA 3IIOA 3PZVA 3G5EA 7PTDA 1DXLA 4FLQA 3OIHA 3ZYZA 5FS7A 1UP2A 1OC7A 5CZSA 3MDWA 1V3HA 4TV5A 5BROA 3L4TA 4UC5A 1UUQA 4MWAE 5CC5A 4LY4A 3HB9A 4NX5A 3LPGA 3ITLA 3O06A 1BVNP 1NDAA 5I03A 3FHQA 4PZVA 4FNRA 2QJIA 2PWHA 2F2HA 3BGJA 4ZQPA 2YYUA 3R79A 5C7HA 5FL0A 3KEHA 3WQVA 3FA4A 3PG8A 5E0KA 4H3DA 3NO5A 5DY3A 3E1F1 4GZJA 3GTNA 1CLKA 3AALA 2EBNA 1RD6A 3KTCA 1SJCA 3A4WA 3KE0A 3GRSA 2NLYA 4RDZA 3WD0A 2NXIA 2OTDA 4OOZA 4Q8UA 2H8ZA 3WIJA 4ZFMA 1DXEA 4XSMA 4E0CA 3C0LA 3EWXA 2PRLA 3GG8A 1UR9A 3N15A 3TVAA 4H4RA 1YPIA 4AMCA 3OLEA 3R43A 1ADOA 3EXSA 4LYRA 1AODA 2I16A 4D6HA 4IQLA 2W4XA 4UZUA 3PPGA 1PV8A 3D5HA 4UWMA 4IXHA 3VNMA 2QF7A 4HA0A 1ONRA 1EJVC 5HJYA 1K8XA 3WNOA 1LOQA 3DX5A 3SRKA 1O4UA 3QFWA 3V35A 4H9ZA 2QQ6A 1XKYA 5LKYA 4JTSA 5I0DA 1KCXA 2Y5JA 1DJXA 1V6UA 4OU1A 1YDNA 1FCVA 2BVDA 2REQB 1KD0A 2V3DA 1IV8A 3CQHA 4G56A 3F7JA 3AIRA 1JUEA 4YVPA 1BWKA 1H7WA 1ZU8A 3LM3A 4MB4A 2GR1A 2J13A 5GJMA 2GSJA 2GGJA 3BCJA 1N60C 1R2TA 1QCWA 1GKRA 1J11A 2DH2A 1I2RA 4Y96A 1V5XA 4RXFA 4JBRA 4RUBA 2PD9A 4PMUA 3TH6A 1US0A 5C9WA 4O1EA 2PDLA 4IMGA 1XBVA 4BY3A 3SCPA 1IT8A 4NL1A 2I9UA 1V0LA 2E9LA 2Y7EA 5F7UA 2Z4GA 4F9JA 1GVFA 3IIXA 3GXFA 4E8CA 2YLAA 1EZWA 9RUBA 4H4QA 4GY7A 2Y89A 4GR1A 1VKFA 3ZVHA 3KBWA 4PCSA 4XVDA 3N14A 2X1TA 5E0CA 4KRTA 5CGMA 2WQPA 2YA0A 2GH5A 5H2ZA 5BCAA 5C7VA 2WBGA 1A0CA 3VMOA 1DOSA 1KM5A 1TPDA 4QCFA 4WUIA 4ZTYA 3VA8A 3RN6A 1GPWA 3E49A 4LUJA 1BF6A 1W5OA 3UWYA 4U3CA 2XH2A 3GAKA 4HCHA 1U5JA 3I10A 5HOSA 3H53A 1GHRA 2VCBA 3BAKA 3IK4A 4ENLA 2PSNA 4MAVA 1UZ4A 1TPWA 2DT2A 4OUEA 2W5FA 3SIZA 3QR3A 1UKOA 4DJFA 4JIPA 3DFHA 1PTGA 3C3UA 5MKGA 1FTXA 3A9IA 4DBWA 3LTSA 4DUXA 2C13A 3UW6A 4AXNA 3GVQA 1R9XA 5E9XA 1OFQA 1DVJA 2A21A 1GEUA 2WWCA 3H7VA 1H50A 3CUZA 1OCBA 1GOWA 3N1AA 3GIYA 1ITXA 4MNKA 3BLOA 4PFHA 3ERPA 1ADSA 2A79A 2WK2A 4E8DA 1AH4A 1ZNNA 3A7RA 5I06A 4H4ZA 3UCQA 2P88A 4C7FA 1SW3A 5D04C 2VJXA 3KBNA 4AZBA 1BYDA 1CPUA 1UKTA 2AAQA 1UWQA 2PI6A 3N04A 1YNYA 3C2OA 5M1TA 3AMLA 4PTXA 2WNQA 3T44A 3MI6A 1K4QA 2ACRA 3K8MA 4JQ4A 2I7GA 4F0LA 5CSUA 5BXTA 3NNTA 4AZCA 2XFWA 1PHQA 4GIYA 1UD3A 2GVGA 3RLVA 1OT1A 2VCCA 5TD4A 3W2MA 1V3LA 4HOXA 4AVOA 1UJQA 3KM8A 1TA3A 1U1HA 2JEPA 1LOSA 3O6DA 3LMYA 4LCQA 4JIEA 3GDMA 1Z89A 4O28A 4WKHA 1VH7A 2HK1A 1FKWA 2XIOA 4QIUA 1JAEA 4HSOA 3P0XA 2QAEA 1FQ0A 3G1AA 3WELA 1VFMA 4XTDA 4LQ1A 4JX4A 1AZ2A 2IKJA 3SN1A 1PVNA 2J88A 1NFGA 1X1ZA 3FA3A 2QJGA 2POZA 1IEQA 3RU6A 3SCOA 3RAOA 3P81A 1TE6A 1FDZA 3G6LA 1XR2A 4X60A 2X8RA 3NR0A 2PDFA 1XI3A 5C55A 1ISWA 1CT5A 1YKWA 2DZXA 1SO3A 1K4HA 4GCXA 1TELA 4S39A 5DMMA 4BHYA 3I4KA 4NILA 4UR8A 4XZBA 2FKPA 1K4GA 5FJJA 3CZKA 3UGVA 4PUUA 2PF8A 3DG7A 1S2AA 1BRLA 1PKYA 3UERA 4XX6A 3LGDA 1TPC1 3R0DA 2GQAA 2C19A 1XIBA 4EIVA 2XGZA 2QDDA 3RITA 1XSJA 2BV9A 3M43A 5AZ1A 2D0GA 3GDBA 3ZLGA 1GVYA 3W75A 1UIPA 4AD2A 1HKWA 5D2XA 1YIXA 3WO8A 1MWOA 2V5BA 3U48A 5FEXA 4MWAD 4QRNA 4Y2WA 1NOUA 4ZZ9A 1PUDA 1E6RA 3W7QA 2VUNA 3CM4A 4XBJA 5KITA 4F40A 1Y65A 4RCXA 3MJYA 4K7ZA 2FGBA 3M5YA 1UC4A 3W83A 3TC7A 3TYCA 4H9MA 5IHRA 2PC4A 3A12A 1V3JA 3EDJA 4NJIA 2C16A 1QNRA 4AEEA 3WMCA 1WCGA 1A3XA 1LYXA 1GKQA 1JQXA 4GCAA 2ACSA 3L5OA 2WLYA 1FFQA 3WQOA 3GDTA 4ZSTA 4IPLA 1XKJA 1XLBA 4MF4A 1RUSA 1SJAA 5KZ6A 1EP2A 4ROPA 5FEWA 3VXGA 1FBAA 2FZMA 3B9AA 3GIQA 3MC5A 1S5MA 1FXPA 1X96A 4MPQA 3VM5A 1KTBA 5I3JA 2PDYA 1YLVA 3W6LA 3WY1A 4OZOA 3WQEA 2AAAA 5ABEA 5IDIA 4O53A 1OZQA 1BYAA 1CDGA 4QJ4B 5KINA 5LA0A 3HF3A 3CMFA 1Z32X 3ZZ1A 3QN3A 4HN8A 3STPA 2HMCA 4MGGA 4KPRA 4P8XA 3VGHA 1R5YA 1G4PA 3NZ1A 3CS2A 2W9MA 1HW6A 4AWEA 3MTWA 2BMBA 3HPXA 3QV9A 1N8IA 2WKJA 2Y85A 4EMJA 1QNSA 3B0UX 2DVXA 3E2SA 3EA1A 3A3HA 1RLDA 3NL2A 2W3SA 4KERA 2I57A 3ZJ8A 3TP4A 1O5QA 4Z1CA 3PR2A 3EX6A 3E0VA 4S23A 1W3LA 2PDUA 3POCA 1GTHA 3QW4B 4H6QA 6ENLA 3EKGA 5AHIA 2F61A 4PUDA 1ZB5A 1JPHA 1P6CA 1DIKA 1Q6FA 3GNNA 3OA3A 2OG9A 1T5AA 1GOMA 4TVDA 5KVHA 4H9TA 1YBQA 1DWGM 1FOBA 4JCMA 4ZOBA 1DJYA 2QAPA 2YAUA 1KO0A 3FEMA 3MUY1 5AVHA 4H4YA 2PTWA 3TSMA 2NX9A 1V3IA 2GGIA 5AC7A 3MUAA 1EYWA 1GORA 2A3HA 2VEFA 2Z25A 3P8JA 2GWNA 1XHGA 3VZZA 4MLRA 1KRBC 3A5FA 4KFNA 1KBLA 1HG3A 4HU8A 2E25A 3LHZA 4L7ZA 3NDZA 2W67A 1KFWA 4W85A 1TWZA 3RU8X 4CN6A 2PRHA 5LNVA 4H4VA 3WBWA 2RAGA 4RNHA 4GIRA 3W3OA 3MO4A 3KS6A 2OT0A 3I6TA 3AICA 3NA8A 3ZFHA 3TMLA 4ZODA 4N9CA 5FF2A 1YDOA 3DK9A 2ZRWA 4GX8A 3NQGA 1B57A 1NWTA 2NVAA 3QJAA 2O4QA 2UWFA 2QJJA 3Q65A 5K3VA 1B4KA 4FO4A 4PL2A 4EQRA 2VYOA 3LA4A 4FDCB 2DSZA 5E1QA 3APYA 5CPMA 1YNQA 3R12A 1HVXA 2A3CA 4XD6A 1K9FA 2QDGA 4GI8A 1OSEA 5AC6A 5I7GA 3TIMA 2EO7A 1GZ1A 4AC7C 5G5GB 2HXTA 4K1WA 4AWSA 4UOJA 4YL2A 3CK5A 4JEJA 5HUPA 4AZGA 4NJGA 4IPJA 3EWZA 3L0NA 2FDSA 4PEEA 4DYKA 3TC6A 4FMVA 1CEOA 1FX6A 3VDHA 1BXNA 3OZOA 3IVTA 3NAVA 4HPGA 1A5UA 4J7RA 4MSSA 2C18A 1MEIA 4CNTA 1KKOA 2BP1A 2DZAA 3TKFA 1GW1A 4PULA 1R7OA 4ILSA 1NM9A 1M53A 2D73A 3LXBA 4IP7A 2YB4A 2ZXQA 3WMSA 4IP4A 2G37A 4YPJA 3V18A 4W93A 2Y8KA 3RJXA 2TODA 1PPIA 3W7RA 1HX0A 3CIXA 1QI5A 2XSAA 3L4YA 2D3NA 2EQ7A 2BXVA 5JBFA 3BG5A 3E0FA 3NO3A 3DH7A 2GOUA 3NO1A 1H7PA 3VPLA 3BJTA 4GC4A 2RDUA 3P8IA 4U2YA 5F1UA 5K2ZA 3NVYB 2QR6A 3SQPA 3CLMA 2HZGA 4M52A 3G1DA 1V7AA 2J7GA 5MF5A 3CZGA 1F9CA 3OLGA 1OY0A 4H8NA 4OUIA 1K7FA 4ZSUA 1FWFC 4DWSA 2Z1KA 1BKSA 3S47A 4ZO6A 4NU7A 3LHVA 3QYQA 4AQLA 1EJ7L 2CHRA 3FVMA 3B0VC 4HNCA 1ISVA 4LSBA 4B4FA 4CU6A 1I1WA 3M47A 3UYIA 2WOWA 4IGHA 4YTTA 5CJNA 4UQAA 3RLGA 4NAFA 5JBEA 1OGSA 1GVQA 5DXXA 3W1LA 1LLWA 3U0HA 1ELSA 3TJ4A 5DCBA 1B4EA 3OGVA 1SZNA 3H2MA 2WVVA 2WHMA 3FFSA 4HA1A 4NXKA 4W84A 3LLXA 2Q8ZA 3HA1A 3T09A 3WUBA 1OVDA 1WXZA 1WX0A 4K2SA 5AYIA 3SZ8A 1XH1A 3T07A 2J78A 3V1PA 5FF3A 3S46A 2JKPA 1T99A 2WJFA 3K8KA 1L6GA 4ZENA 2ATMA 2QJHA 5A69A 3COTA 3NSXA 2RH9A 4HCLA 2YVJA 1DWIM 3UNTA 1VEOA 2ZE0A 2EG7A 1LG2A 4D8AA 3AU6A 1UWIA 1KM6A 2YW4A 1GRGA 3T9PA 4MFEA 4GJJA 1JCXA 4LGXA 3VNDA 2NVCA 3IUIA 4GXPA 3WLPA 3W7KA 3VNJA 3HG2A 4PC8A 1K8YA 1KWKA 4QR6A 3RLHA 3NZRA 5FS8A 1U22A 3A3WA 4KGJA 5JCIA 1D3HA 1MO9A 2QCLA 3N2TA 3R8RA 1IXQA 4S3CA 2RJHA 2DZBA 4GVFA 3NQEA 8TIMA 2DORA 3ZOAA 2BX7A 3PZ9A 1MXSA 3N3MA 3LN3A 5ABFA 4MYAA 1IZCA 4NZ3A 1IEIA 3EPNA 3HPAA 1S5WA 1WQ5A 2BHUA 3TN5A 5FS6A 1S2WA 3DGZA 2EAWA 1BXCA 4NEWA 2IPWA 1W3IA 2NV9A 3WQGA 4DEFA 2ZZBA 2XIQA 1W0MA 3GKFA 5I07A 3IAPA 2BGSA 2F2KA 4V27A 3L8KA 1W3NA 3NXLA 1ZBWA 5DCEA 1BQCA 3MHFA 2A3BA 1ONXA 3PB2A 2Z7KA 4DF0A 1LRTA 3BUVA 2XIJA 5A6SA 4IMAA 3USBA 4QDMA 4TX9A 1GRAA 3LI0A 2IUZA 1T8QA 3CV1A 3BG9A 3C4UA 2JBMA 1GREA 3PPCA 4LB3A 4IOTA 3HV8A 4J56A 1QI3A 2BOFX 1E9ZB 3NVTA 4W5UA 4HMEA 3UP8A 4AHQA 1I1XA 1UA7A 3AIWA 4HPXA 2JIWA 4O19A 4EPKA 3G24A 2ZUSA 1W37A 3LMZA 1WAUA 1A5KC 3EX4A 3EX1A 2OEJA 4C6CA 2DT0A 4H7VA 2WHKA 4A05A 3GC4A 4ADUA 4H4WA 1DHPA 1YHTA 2YL6A 4CEUC 4URIA 3MBFA 3W86A 1KW1A 4OE7A 3W28A 1Y8BA 2R1NA 2ISFA 2PDGA 1QFEA 3TN6A 3FG2P 1GRHA 1LQAA 4UBPC 1MUCA 2NZLA 4CD6A 2OEMA 3ZIZA 4KWWA 1V59A 4QQUA 3W25A 4D1IA 3WFZA 3AIEA 3AHTA 3SI9A 1XC4A 1QW9A 1EC9A 2WXDM 4CN4A 4GABA 2VHLA 2GOKA 5LIXX 1Q6DA 4FXRA 3W72A 3C3NA 3DESA 2GDQA 4XVEA 3NGFA 4REQA 3CO4A 4JL1A 2PDCA 4NI8A 2YVFA 1B0IA 4PMQA 1BPLB 2GUBA 2WC3A 1H1NA 4F0KA 7TIMA 4US5D 3QW3A 2ZZ4A 3VINA 4PUJA 1YXYA 4MMWA 5IDZA 2J62A 3OB8A 2X2GA 3VFLA 3IRSA 4J1OA 1WDRA 1C8VA 3WKZA 3CGTA 4M82A 3DI1A 2AAMA 1HP5A 1QPNA 1O66A 4LUYA 5D33A 1TZ9A 2NQJA 4OQVA 3URNA 3SRFA 1QI2A 4KESA 1A80A 4WD0A 4PRTA 3UZZA 1XSIA 4X63A 4IGSA 2YXXA 1EOKA 1YPXA 1M65A 1RCQA 2H3DA 4EKJA 2YIHA 2YYTA 3HQ1A 1E6SM 3QMTA 4X2PA 1SQ7A 3N9RA 4EXBA 1FWEC 5D8ZA 1D7FA 3B97A 3WNMA 2ZZCA 2WJZA 1C3FA 1GEHA 1OYBA 4FF7A 3DI0A 2BHYA 3TQPA 1LRQA 3W2LA 1A5BA 5IXEA 2B81A 2VD8A 3V16A 1QPQA 2JK6A 2PGEA 3WH5A 4ZO8A 1K02A 1UR1A 4BQ4A 1W1VA 3O6YX 3R1ZA 5EKYA 1WZAA 3ABRA 5M3WA 5FD0A 1RY0A 1G4EA 5T9BG 4LS0A 1A0DA 4S3GA 3WQDA 3VIIA 3PHAA 4O0KA 3ZLHA 4ZB0A 5I78A 2FLIA 4D1JA 5BWAA 1TTJA 4O8RA 4DXXA 4Q4PA 4Q4RA 1YTEA 4O0QA 3UWWA 5MHBA 4AX6A 1REQB 3GHUA 4QISA 4JQ1A 2OSXA 5TR3A 2FFCA 3FK4A 5AHNA 3BCFA 2OYMA 1JUKA 5L9FA 1WOAA 3KOWA 1E6ZA 1GETA 3EB3A 4QNWA 4U4MA 4H41A 4MY8A 5E6YA 4XAPA 3LX9A 3LLFA 2WSQA 3O3RA 1E3XA 4QGCA 2XHYA 2OFJA 3FDKA 3OA5A 3POHA 3S5ZA 2E1DA 4IMFA 5CBBA 1UR8A 2OYLA 3CYJA 4L64A 1HL8A 1GVOA 4MVAA 4MZ8A 3TTSA 2WCGA 4MB5A 4ZL1A 3GG0A 4TO8A 1JPIA 2QUMA 1G01A 3LI1A 4WF7A 1ADDA 4EK7A 3UXIA 5FESA 4HSNA 1XIIA 2VKZG 4U5KA 3HPFA 2IXVA 1DL3A 1LBFA 5A6BD 4FHAA 1C90A 4PMOA 2GPTA 1OFEA 2D3LA 2PGFA 1QRQA 1F3PA 1GVEA 1HUVA 3W1RA 2WV8A 3U5YA 1JUBA 3SJNA 3R94A 1IIHA 1TMLA 1WZLA 2E1WA 2PGRA 4JN6A 3NS1B 5E6ZA 3GAYA 3BAXA 2Q8XA 1QPOA 2X8CA 2D0HA 1XC6A 4JTUA 1XLLA 1M04A 3GKAA 3LCWA 1WKDA 2DUAA 1EOMA 1TV4A 4JPGA 3ZR4A 3WLKX 1UD5A 3UJ2A 2ISVA 1C92A 1MNZA 5RUBA 3W7PA 4MKNA 2X8GA 3TTEA 3OIXA 1LL4A 4HU3A 3RCYA 1L6SA 3FSUA 3ZO9A 1H11A 3QC0A 1TV5A 4RV8A 2IPJA 2ZTJA 3MDUA 2V67A 1DJHA 3TYEA 2VFGA 5E93A 2FTPA 2BY0A 4DB7A 3F5JA 1C8YA 3BLKA 3N2XA 3PTQA 1GWJA 1LT7A 1Z44A 2VX5A 4PCPA 1EYEA 4FNTA 4U3AA 4GQQA 3R11A 2JF6A 3VK5A 3W9ZA 2FPYA 3G6MA 5E70A 4GWEA 2OEKA 3ZWTA 4YWIA 3PJXA 1U5VA 2WHJA 1I4NA 4NZ1A 2V38A 3F2DA 1X6UA 3TQVA 3PBWA 3KAOA 3LCFA 1AK5A 3AJ7A 2PDNA 2NWSA 3RGTA 1EBGA 1GNXA 3DC8A 1XPGA 3OYZA 1LLOA 2JE8A 4H4UA 4L5ZA 1GPFA 1PTAA 5CZKA 4PMNA 5D02A 1TV2A 3QM3A 4N0RA 3TCEA 4Q4MA 3W37A 1CI1A 4H6KA 4IP5A 1XLGA 2Z2AA 3CNYA 4US5A 1VQZA 3Q37A 3TA6A 4DVOA 4JR5A 3L4WA 1N8WA 2VGFA 3GX9A 1E1FA 2WOVA 2OZ8A 1NFPA 3O05A 4J3VA 1EXBA 1XLMA 2V2HA 4WGXA 5H8MA 3ZJKA 1GQLA 1YNPA 2CLKA 1IT7A 2PPGA 4CCZA 1HP4A 1RLCL 1LM1A 3GQYA 3BW4A 3SUTA 4LNYA 1IR2A 1ZZMA 2WC7A 2CHOA 1R86A 2GYIA 1Y7VA 1WXJA 5AC8A 5DELA 2CLOA 3NQCA 5CC7A 2DZSA 3NQVA 1FCUA 1W6TA 2GUYA 3QC3A 5JU6A 5A2AA 2WMGA 3DYOA 4XQ6A 2HDJA 5EA9A 5ECUA 4RR4A 3QZAA 1EJSC 3NGJA 1VC4A 2CBJA 3WQFA 1HJSA 2XVLA 2GJRA 3MSDA 4L1XA 3NRZB 4GXWA 3KXQA 1ZP4A 5EFFA 2XUCA 1TJ1A 2WOIA 5EMKA 3NPWA 1TWWA 4KWUA 4RNJA 2DP3A 4QJ3B 1SZFA 3GZ3A 5EB8A 2CLMA 1R2RA 2DSWA 3TU9A 4MLJA 3TFCA 2PDIA 4RJEA 1TJPA 3TA9A 1OYAA 3V1HA 2GSEA 4ZOHB 2Y8VA 4O1BA 3NTYA 1SJBA 1PIFA 1EB3A 1JCTA 3TYAA 1YXDA 3LEPA 4C6EA 1IT0A 1EDQA 1LOLA 3AUJA 4YHGA 3QXBA 4K3ZA 1FWRA 2V5DA 2CU0A 3EWBX 4JTGA 4Q7BA 4JTDA 1VJZA 5JH1A 3V0SA 3WLQA 3DJGX 1I2PA 3EDKA 4BQ3A 2XN1A 3QTPA 3H26A 3VVGA 4YTSA 2CESA 2ABBA 3HQNA 1PWLA 3WG6A 1KGWA 4KFOA 4WJXA 3FJ6A 3QF0A 1BFNA 5KZEA 3KP1A 4WKAA 2BASA 3CZJA 1SO6A 2ZQ0A 1X2GA 3AC0A 2WMKA 3OZPA 4UR7A 2VQTA 2HVNA 3PJTA 4TIMA 4WXZA 1EWDA 4AZHA 1F6YA 5A6JA 3WK0A 1W9XA 5ABGA 3PSWA 4R5EA 1NY1A 4MG4A 3CHEA 1E0WA 3GVGA 1FCQA 4V28A 4NHVA 1H1ZA 5G1MA 2ZXDA 4AYGA 2XSBA 5ER0A 4HT3A 4P8VA 4DAFA 4RKAA 2XSXA 1BD0A 4IQJA 1A53A 5HULA 3LCIA 2Z6JA 4Z0SA 1S5NA 3KVKA 5J8LA 1MSSA 2Z00A 3WLSA 4B5WA 2Z1BA 4DBEA 3CXBA 2DW7A 3NXFA 2ZKMX 3WDRA 3QQ0A 4JTKA 2PCQA 3UR8A 2CFYA 1VPQA 4JGDA 3OU8A 3RX2A 4L9XA 3FKKA 3PN8A 3U3HA 2CETA 4RK8A 1J0YA 1H61A 2QCDB 1AL7A 1PHWA 3G3MA 1LROA 4CLMA 4GINA 4WY0B 5C8BB 4QFUA 5K9XA 3THAA 1EL3A 1NPXA 4N6EA 1MMFA 4ZQNA 1XQKA 1OGGA 1J4EA 5BU9A 2OKOA 1EBHA 4QHRA 4X0VA 3QR0A 1IF2A 2WSKA 4ML4A 5D32A 1VDVA 1EO7A 3SCWA 3QR1A 3ZXWA 2IQTA 1OFBA 3IGXA 3MT1A 4HK7A 3N4FA 7XIMA 2VEMA 3EYPA 3B9EA 2R91A 3CZ8A 5ABHA 1ONWA 4YCOA 1FH8A 1K9EA 3APGA 2HWGA 1WBJA 1UZDA 1JYXA 3L7RA 2QCEA 1UD4A 4A21A 2FVLA 3EZ4A 2EXOA 3E0IA 3DKLA 4NNAA 1OX4B 4R53A 3AROA 1WKFA 1GRBA 3A47A 1IQ8A 4DX3A 3FLUA 5HWJA 4Y9AA 4WSJA 1KV5A 4PH6A 1Q6EA 1TZ7A 1F05A 3RO6A 1LRNA 1DTNA 4NJKA 3VDCA 1RQEA 4J3XA 4F2UA 2AMGA 3SCVA 1TJRA 1JXJA 1TUFA 3M9YA 4UFMA 3EKLA 4WRHA 3AS1A 1XGDA 5J5RA 4M56A 4XTIA 4NSBA 3AZSA 3ITOA 1XLAA 2Z28A 3GR4A 4RDWA 4L1GA 4Q8TA 3IJDA 1QO5A 1Q2SA 3NIYA 3IJ8A 1SB3B 3AYTA 2X30A 4P7RA 2ZRYA 1H6VA 1FUYA 2HEJA 2G5WA 1E0TA 3QFEA 4LBUA 3T2OA 1P5BA 4Y90A 1WDDA 4WKFA 1GCYA 1AD1A 4CQBA 4ACZB 1BG4A 1UB3A 1EJUC 3ZT5A 5DXYA 3SCQA 4RPQA 2WBAA 4CVUA 4K38A 3OQ8A 1FCBA 3VDGA 3W7IA 3NL3A 3UJRA 1RVKA 2PGWA 4JY8A 3E2RA 2WCSA 2P8BA 1S5VA 1NHQA 1KWGA 4Y9PA 4ACYA 2YL8A 4EQXA 5DFAA 4H4XA 4A2SA 1OINA 4GBDA 1THFD 1H49A 1GHSA 3DHPA 3LERA 5U7SA 1H5YA 4MJ4A 3AFBA 3OYXA 2CZVA 5FF4A 4WR3A 2PBGA 3ID7A 1DE6A 2D2GA 4ERGA 4J40A 5C71A 4W5ZA 1HJVA 1V0MA 4B2DD 2C0AA 3OC4A 3LZ3A 3IIPA 2IMRA 2I14A 1HO1A 1ZP3A 3R07C 2QUVA 2HXUA 1NP2A 1EQCA 3H2OA 3U7BA 3GTXA 2GVEA 3AI0A 4D8LA 5HINA 3LGGA 3VGEA 5KSWA 4G7FA 5LA1A 3ITGA 1NWSA 3ZM8A 1HGWA 4GC3A 3CGDA 4AAJA 8XIAA 2GJPA 4JCLA 1FA2A 3LXDA 2CXEA 5REQB 3THDA 4GE8A 4DBDA 4GH1A 3NQBA 4AWUA 3S5NA 3FKRA 1EX5A 3B4YA 2O7SA 5JRBA 4ES4A 2R1PA 3BSGA 3A23A 3ARXA 2BOGX 3VILA 1IGWA 4LRTA 2A5HA 2VDIA 3LV6A 3LCLA 1VFLA 9CGTA 3AISA 4P7LA 1XCFA 2B7OA 1KFEA 2REQA 4UMCA 3UWZA 2X99A 2W6RA 1X1NA 3KOXA 3M16A 3PF3A 3VIJA 4E3VA 1PJ9A 3W24A 2A3LA 4XWUA 3GNPA 3PVFA 4BEQA 2QPXA 2G4FA 1V51A 3D3AA 3OODA 1A5NC 1RQHA 2H9AB 1FEAA 4NT0A 1MQRA 5GQBA 5BOFA 5A6KA 2FVMA 3VIOA 1W9BM 4LU0A 2O7QA 3BLPX 4JZ5A 3GFXA 4DUVA 3R89A 1SR9A 1W2VA 4XISA 1SMDA 1CYGA 1YTKA 1GONA 4Z2KA 3C2VA 3KCJA 5HK4A 1E0VA 4HMCA 4AU0A 4ZQCA 1E6QM 3V4BA 5I3FA 4J4KA 2QCGA 4NIRA 1KLZA 3VGBA 3L4UA 1I2NA 2ZRXA 2FMNA 1ZRQA 3CHCA 2ZX8A 4WCJA 2V6OA 3FYOA 1JAKA 1TTPA 3PB0A 3GHRA 3BO9A 3LHWA 1V6TA 5M2FX 1MUMA 4ZVJA 4GKTA 3N4EA 2Z27A 1E9LA 1RBLA 4QLLA 1SSGA 1LUCB 3STEA 1J5TA 1F3EA 2CWNA 4KW2A 5I3KA 4H4IA 5A94A 3TYBA 4AC1X 4BKNA 3GR8A 1TPFA 1J0HA 1WO2A 5AHMA 2PRMA 2BZNA 3KRUA 4WY0F 2J25A 1XDLA 3QHMA 3M46A 4I7VA 1KB3A 1TMHA 3NQ7A 4JDYA 3FXGA 2NQLA 5I3DA 1XDIA 4O14A 1TVPA 3ARZA 2PP0A 3L0KA 3SGGA 1CWYA 5C9ZA 1XCXA 3GHSA 3OVPA 1M6JA 4L6DA 4PRWA 1JFHA 3AXXA 4DELA 5CPLA 5BZAA 2NW0A 1M5WA 2YXOA 4R9OA 2HPIA 4I9JA 1TO3A 4QG6A 4IHCA 1FHUA 4AY1A 5K4XA 1VFSA 3MB9A 1XISA 3IIVA 4C6LA 2ZVIA 3B8TA 4PUWA 4BF7A 3KOYA 1BYCA 5LNSA 4LAKA 1EDGA 2V5CA 4L4PA 2B7NA 2VR4A 3VCCA 3HOJA 3QSTA 5H91A 1XYBA 5DBUA 3MHGA 3GDRA 1RCOB 2X7WA 1XRVA 4H8UA 3IVSA 1PAMA 3UVIA 1FIQB 4RXGA 2WQDA 1E56A 2B7QA 3OZYA 4K68A 3SM0A 3P93A 1VZWA 4FZIA 2DDXA 2WSPA 5DF0A 1UKPA 4DJDA 1WA3A 1BHGA 4EM3A 3SRHA 1X39A 4IG2B 2QGYA 3M1ZA 3C5QA 2OT1A 4MZYA 1HQTA 1CBGA 4LANA 2FB2A 4HIBA 2NLIA 1DJNA 1NH6A 5EFDA 1WNOA 1KFCA 1IWBA 5CCZA 3B4UA 1WKYA 3WLOA 2Z1VA 1J93A 2FHFA 1R47A 3HO8A 2HTMA 4FR6A 4GYPC 3OVQA 4RZ4A 4FALA 3O16A 1HJWA 3AIBA 4HK6A 5AY7A 5CAHA 1L6FA 2YVGA 2YCLB 2V5LA 4HMNA 1F6KA 1B3YA 3N29A 4PFMA 1Q7QA 3QGVA 3PG6A 3GHTA 1KQYA 3NZGA 4D6FA 1DBTA 1MW1A 4PBGA 3QZEA 3JS3A 3M0MA 1TQJA 4FOUA 3WDJA 4JX6A 3R0UA 1NHRA 1DHKA 1ZAJA 2HVOA 3EWCA 2OELA 3ARSA 2C14A 2F6UA 4M6PA 1H7NA 2QXWA 4MUPA 4B2DA 3VIMA 1OHLA 4QS5A 1OC5A 3VD7A 2NVKX 3T1GA 2Z29A 1JGMA 2PWDA 1KCZA 1Y0EA 3CH0A 1XXXA 4CD5A 2Q8LA 1LQ2A 1V6WA 1HL9A 1NAL1 5U25A 1QI4A 2ZIDA 3FOKA 4U28A 2E9BA 2QDEA 3BPWA 4H6RA 1JRBA 2X1IA 1WKEA 5D8WA 2OLHA 2R9RA 3M7SA 3W81A 2VFHA 1W5PA 3ARPA 4AD0A 5G5IA 4N02A 3E2QA 3G1VA 2V2CA 3AJXA 5L6UA 2VT0A 3AS3A 2QCCA 4EQWA 3JU2A 4GI4A 3TJLA 3URHA 2D24A 1G4TA 5CGQA 1E1CB 2RDWA 3G0SA 3P60A 3DCPA 3ABXA 4PL1A 3QGAC 2ZA3A 4IIBA 1O1HA 3G1FA 2J6VA 2X8HA 4JAWA 3DYPA 3MS8A 5IBXA 1BWVA 1N5WC 1NARA 1OC6A 1TVNA 1PB0A 3DYMA 3O63A 4M1BA 2DW6A 2GR3A 1QASA 4O10A 3UFYA 4GXMA 4IMDA 4HNLA 3LTYA 2BG5A 4MM1A 2CLHA 5HPCA 5AKQA 1VFTA 4F4RA 2JGYA 4CKQA 2NQ5A 4Q8WA 2HSAA 4IF2A 2H3BA 2SFPA 3SGZA 3W1XA 1XINA 5TBOA 5JQ9A 3QOKA 5CJ5A 1GK8A 1M7XA 2I17A 3M5XA 1F07A 4M0XA 3BV7A 2BXZA 4PTMA 2WW5A 4KBXA 3AMKA 4XZ9A 4DLMA 1XW8A 5D30A 1NWRA 4Z17A 1V02A 2YB1A 1S1PA 3MZNA 3BLIA 1TYPA 2UY3A 4W4QA 2AGTA 5HMSA 3PZTA 1JD7A 3VOJA 3BOLA 3W6YA 1NF0A 2RJGA 4DJDC 4OTKA 3PWIA 4O52A 2VOTA 3MSRA 1P0DA 4FIRA 3UR7A 4RLIA 4NZ5A 1P0BA 4QDPA 4EPEC 3MUXA 3UA4A 5JIWA 3NM1A 3VKBA 3PTDA 2XIMA 3T7VA 4GPNA 1HFBA 3MQTA 3W07A 1QI0A 2YW3A 2EPOA 2Y7GA 4UFKA 4HJFA 4GOAA 2XZ9A 2XVKA 2E77A 4CN1A 4LT9A 1SR0A 5HANA 1UD2A 3WF0A 1JL8A 3WCZA 4PB5A 3BMXA 3WK2A 3GXIA 2E6FA 5G5HB 3MUCA 4XIAA 5K7JA 3KRSA 3KRBA 4B5VA 2EJAA 1F61A 2E6AA 2CC0A 2HBXA 4WJEA 4DWDA 2DIJA 1UD6A 4AW7A 2WYSA 3URQA 2WPGA 1ISZA 3W85A 3W1PA 3B9OA 1R85A 3WQCA 4E2DA 1EIBA 3O9NA 2HV5A 2NUYA 5K9DA 3FCPA 4IFKB 3LXAA 5EMYA 3W1NA 3NSNA 4PUMA 4HOWA 2CCRA 4K1GA 2W55A 4X22A 4ICMA 4C6IA 3DK8A 1CGUA 1W1TA 4G7EB 1W1IE 3L67A 3HQPA 3UXKA 2DZVA 1B54A 1JCLA 1MZRA 4QROA 1GSNA 1SZGA 3DIPA 1B30A 2CLIA 3RF9A 3V5FA 4GYJA 4CQDA 4H9UA 4Y8FA 3DJJA 1F6PA 4IQEA 1I45A 4XBKA 1L8PA 4DO4A 3GLCA 5IBXC 2EG6A 1CIUA 3M4HA 1KM0A 3DC0A 4NUWA 1KM1A 1KBBA 2I56A 4B91A 3BAYA 4J3TA 4POCA 1OG6A 4PBFA 3QVQA 1JF6A 4MNLA 3AHVA 2I9EA 3TSDA 4E2VA 3HMJG 4B5XA 2BOEX 2VRJA 3EX3A 2H90A 1F5ZA 1R7AA 1OIFA 3LDVA 1R3SA 2JFEX 3E5BA 4XO6A 1RK6A 1S2UA 4W7WA 4PCTA 2OOFA 3WJSA 3M6YA 4X3ZA 1O94A 4S2BA 5CGTA 3MKKA 3NQFA 3DFQA 5HPOA 2XDFA 1SYTA 3KDNA 3PNUA 4IMEA 1QW7A 5C6MA 4LVFA 4KMQA 1XPYA 4KPLA 3UGRA 2A1YA 1J0KA 5TIMA 4YYCA 3VOCA 3F2CA 1J0JA 3PSVA 3CWNA 2A6LA 3B8IA 4DJEA 2PDWA 3QH2A 3F1QA 3GVRA 1MW2A 1Z3NA 3CIVA 1WZMA 2PLMA 1AQ0A 1W1ZA 2EF9A 4IM4A 5HQEA 3U7VA 2O9OA 6REQB 4XV0A 3WLLA 2F38A 3KL3A 3TN4A 2OYKA 1QOXA 1JPDX 4HHHA 5G2WA 3RMEA 1FFUC 2Y70A 3WDIA 3UPWA 2J8FA 3XISA 1ISXA 2YDRA 1J01A 1V03A 4GY1A 3O6AA 2QJMA 3VC5A 3II1A 1TTIA 3PWAA 3CO8A 4BK9A 2EPLX 4B3ZA 3EEZA 3WX7A 1Z69A 3L5MA 3N9SA 5KETA 4I6VA 1JEZA 3QKZA 4H01A 1R46A 3OO2A 1NEYA 4LRSA 3U8GA 1GQIA 3IJQA 4GVIA 4DBSA 3QFBA 1AH3A 1LJYA 4CCEA 2WZHA 1HJQA 3O0FA 4ECLA 5F2LA 1A5MC 4LS1A 1KFBA 4M1RA 1HF6A 1EGZA 2VZUA 1C8XA 1XLJA 3MANA 4JTIA 1TZZA 5A8QA 1JD9A 3IUHA 2IXUA 3HJZA 1ZJIA 1RJRA 4J35A 3VUSA 3T42A 3ZS4A 3CB3A 4BQ5A 2P76A 4FX8A 2HBVA 1VYRA 3W7LA 5JUVA 4JTRA 3NPUA 1BWLA 1UQYA 2BB0A 4MB3A 1W1B1 1FXQA 1TR9A 2ZXAA 2VTFA 5HNRA 3H4KA 2PDPA 3N6HA 4G1NA 3RMJA 3AS0A 1J6OA 1KXTA 4K36A 1ZLPA 3O6CA 1Y5XA 4LCRA 3DGHA 1UR4A 3DUGA 3GVVA 3M0IA 4JFVA 2BY2A 2E3ZA 4CEXC 3QHNA 4DHGA 1AOGA 2UY4A 3VABA 5TQLA 4HPHA 1VGAA 4GZEA 3W1MA 2O92A 5D09A 5FCZA 2V81A 3QLLA 3PPFA 1QUMA 2GZXA 1JDCA 4Y7EA 3S2NA 5BNKA 1HJUA 1LVLA 3KBSA 4G9PA 3ATZA 1QDSA 2C7FA 1JJKA 4ROQA 1JFXA 4LH8A 3U2CA 1KBKA 1K7EA 2ZX7A 2XINA 4RV3A 3M0HA 1H3GA 3ORWA 3LV5A 3PZNA 5JBDA 3UPMA 4FX6M 3NVZB 5F4XA