4HCLA

Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium and l-lyxarohydroxamate
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
384
structure length
384
Chain Sequence
SHMIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isomerase/lactonizing enzyme
publication title CRYSTAL STRUCTURE OF D-GLUCARATE DEHYDRATASE FROM AGROBACTERIUM TUMEFACIENS complexed with magnesium and L-Lyxarohydroxamate
rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 139
structure length 384
sequence length 384
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hclA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hclA01
3QKEA 3ES7A 4J1OA 2QJNA 3BOXA 3UGVA 3ENLA 6ENLA 1TZZA 3DFYA 2OX4A 1E9IA 3IJQA 3RO6A 4E6MA 3JW7A 4K1WA 3TWAA 5J04A 3BJSA 5FJRA 2HXUA 3CYJA 3N6HA 2OKTA 3VCCA 2HNEA 2OZ3A 3B97A 4E8GA 2DW7A 5IDZA 2PODA 4DX3A 1TKKA 2QDDA 4FI4A 3Q45A 3N6JA 3T9PA 5EU9A 3UCDA 2GGGA 4GFIA 2ZC8A 3NZGA 5FJPA 2PU0A 1KD0A 3DFHA 4X2PA 3I6EA 2P8CA 5ENLA 3QPEA 4HCHA 7ENLA 1TE6A 3V5FA 2P8BA 2PP1A 3R25A 3NO1A 3V4BA 3UJRA 3DIPA 2QJMA 5BOEA 1DTNA 3EKGA 5FJOA 3R0KA 3FVDA 4DHGA 3H7VA 1JDFA 3R1ZA 3QLDA 5BOFA 2PTWA 1BQGA 1FHUA 4H19A 4IP4A 4HCLA 1NU5A 3S5SA 1SJDA 3VC6A 2GGJA 1KKOA 2OFJA 1L8PA 4DYEA 3SN4A 1MUCA 2ZADA 4M0XA 3TTEA 4GISA 3D47A 1EC9A 2P88A 4IHCA 3MWCA 1OEPA 4HNCA 4J3ZA 3SN1A 3TCSA 3R11A 3BSMA 3GY1A 4HN8A 1W6TA 3MKCA 2AL2A 3RR1A 3CXOA 2PTZA 3THUA 3V3WA 4JHMA 4IL0A 3OPSA 3MQTA 2P3ZA 3T8QA 4DWDA 2XGZA 2QJJA 4ZCWA 3ZLGA 3VA8A 2GGHA 1MDRA 2GSHA 2XH7A 2FKPA 3QTPA 2OPJA 2PA6A 1MRAA 2HZGA 2PGWA 3PWIA 2PTXA 3DG3A 3K1GA 2CHRA 3VFCA 3P3BA 3NXLA 1P48A 3MZNA 4MGGA 2MNRA 1EBHA 3TW9A 4F4RA 3OZYA 4EWJA 2XH0A 2OZTA 2QDEA 2PSNA 2OQHA 1F9CA 3ZLHA 2OLAA 3IJLA 1RVKA 4A35A 2PPGA 2RDXA 2PMQA 1WUFA 1SJBA 1SJCA 3R10A 4G8TA 3STPA 1P43A 3FV9A 4GGHA 2DW6A 4ENLA 2AL2B 2PGEA 2NQLA 2OVLA 1ONEA 2OZ8A 3GC2A 3V5CA 4H1ZA 4M6UA 4IL2A 4JN8A 3PK7A 3DG6A 3FJ4A 3TQPA 4A6GA 4GIRA 3OZMA 4G7FA 3H12A 3SQSA 3UJFA 3S47A 1WUEA 2OO6A 3DERA 3VCNA 1ELSA 1MDLA 2PCEA 1EC8A 1XPYA 2OQYA 3NFUA 2QQ6A 2HXTA 3KUMA 1PDZA 3TOYA 2QVHA 4KWSA 2I5QA 3UCCA 2PP0A 4K8GA 3JZUA 3FXGA 1R6WA 3TJIA 3CK5A 3CAWA 3GO2A 3P0WA 2GDQA 1PDYA 4E5TA 3N4EA 1NELA 1EBGA 3CB3A 1JPMA 3EEZA 1KKRA 3ZVIA 4H2HA 3ZLFA 3DGBA 3TJ4A 3IJIA 4HNLA 3U9IA 2PS2A 2QGYA 3R0UA 4KPLA 2AKZA 2MUCA 4E4UA 4IZGA 2AKMA 1YEYA 3VC5A 4ZA0A 3JVAA 2P0IA 3HPFA 3RITA 3DEQA 3MUCA 3VDGA 4A3RA 2GGEA 1JCTA 2GGIA 2PU1A 3OP2A 2XH4A 3SBFA 3DESA 4KEMA 3DDMA 3IK4A 1MNSA 4FP1A 3ZVHB 3MY9A 3PWGA 3T4WA 3U4FA 4IP5A 3ES8A 4HYRA 4MMWA 3UXLA 2PP3A 4H83A 1EC7A 2XH2A 3CT2A 3RGTA 1XS2A 1JPDX 3SN0A 1R0MA 4GGBA 2AL1A 2FYMA 5FJUA 3GD6A 3RRAA 3UJSA 2POZA 2ONEA 3MSYA 5FJTA 1IYXA 1SJAA 4K2SA 3PFRA 3N4FA 2PTYA 3FCPA 3TWBA 3UJEA 3ZVHA 3P93A 3H70A 4ROPA 2O56A 4DXKA 3UJ2A 4DN1A 3SJNA 4GYPC 3T6CA 2XSXA 3RCYA 3I6TA 1KCZA 4GMEA 3D46A 3OW1A 4HPNA 4KT2A 3Q4DA 4GYPA 3SSZA 4YWSA 4Z1YA 3I4KA 1FHVA 4HCDA 4IT1A 3DG7A 3QN3A 4E4FA 3UXKA 4Z17A 2OG9A 4JN7A 3FYYA 1ECQA 1BKHA 3H8AA 2GL5A 4MKSA 3OTRA
chains in the Genus database with same CATH superfamily
4RNHA 3W2NA 4O50A 1M7OA 2Z00A 1V6VA 3BOXA 1Z89A 5HR6A 3OGVA 4MJ2A 3UGVA 2CLHA 3RNDA 2GOKA 1FH8A 2G3NA 4C6MA 1XDIA 2E3TA 1EGMA 4B92A 4DUVA 1TB3A 2F6UA 1JQVA 2QAFA 4KETA 3WNNA 1J2BA 2QCHA 4DBEA 3B04A 3OZPA 3ARYA 2V68A 3WDRA 3UESA 4Z2KA 2YCKX 4P8WA 3ITVA 1UR8A 3KHDA 3GTHA 3WUEA 4RV8A 1ZSXA 2CFFA 1QVBA 4N9BA 1OK6A 1BD0A 1GTEA 2QS8A 2VGBA 3LQLA 3MMTA 4FOUA 1LRTA 4HPHA 3H2OA 4O57A 1QMLA 2GVYA 3MDWA 4GJ1A 3GBDA 4JTSA 4FMVA 4KCWA 1NFGA 3EKGA 4HSHA 4EXQA 2Y7GA 1WZKA 3ARSA 3TYUA 4ZFMA 5FEWA 4DY1A 1RALA 3LZ3A 1W1YA 2VT0A 3DHDA 3W7HA 2GGJA 3TA9A 4NJJA 3NZRA 1F8MA 3QMRA 5G2HA 3VUSA 2WM0A 3LB0A 2OGJA 1GHSA 4IIGA 4Q4OA 1JG9A 5A2CA 2FZNA 3E74A 3VOFA 4WGXA 3TZFA 1U5VA 3DFNA 3T2PA 3UYCA 4HNCA 4IMGA 1KCLA 3DH9A 3H4GA 5JCNA 2O7SA 2B7OA 3QH2A 4ASTA 3H21A 2DH2A 4JHOA 4EKJA 3PF3A 3ANUA 3QOKA 4WCJA 1DJHA 2E8ZA 3PZIA 4Y9MA 4AIUA 4O17A 4MY8A 1U22A 2W4XA 3CZJA 3HIJA 1UZHA 1HL8A 1E72M 3KTCA 4CQ8A 3STEA 1E6PA 2CETA 1IHIA 3WD1A 3OVRA 2ODOA 3H4XA 4CU6A 2QV4A 2VUNA 3WJSA 1VGAA 3VVGA 3VIHA 2DGAA 2XFYA 1Q6OA 1EIBA 2ZVIA 3MTWA 3UG3A 1OCJA 1ONWA 4JAWA 1TV7A 4QFUA 4OGZA 1VFUA 3EMZA 4NQ1A 4Q6JA 4HK7A 1BFNA 1SZEA 4J56A 4GY1A 3F4WA 2CWXA 3PP7A 4KCTA 3W27A 3ALGA 2WPFA 3O7UA 2FZBA 3WF4A 4BQ5A 2O92A 4I9MA 4FNUA 2RDXA 5GNXA 3CWOX 3G1VA 4MKNA 3QR1A 3GX9A 4GH1A 1ZY9A 5I77A 1F3TA 3BICA 1MO9A 4GGHA 3UWVA 5BXTA 1ZLPA 2VM8A 2ZXQA 1W2VA 2PE4A 4H4RA 2NQLA 3UGRA 1R9XA 1JCMP 4GNVA 3GWQA 1UH2A 1GEHA 2DV0A 5KVIA 4S3GA 3BC9A 4F48A 4TX8A 3K5XA 3AZTA 3AICA 5D04C 1MI3A 2G95A 1UKTA 5AN7A 3SECA 2BCPA 1UWQA 1WAUA 2HSAA 2QJIA 1UZ1A 2PP0A 1ZUAX 2J27A 3EB3A 4DM1A 3C3UA 4JYEA 2D1ZA 4C6NA 1W9XA 4CGTA 3FHQA 3C2EA 3CAWA 4Q8NA 1K7FA 2NUWA 2ZDRA 2H8ZA 5LYRA 1YX1A 2R1NA 3G1AA 1M53A 3HMCA 3WH5A 3TX9A 1J6OA 1QOPA 5JBDA 3EOSA 4DO7A 2WZEA 3CTLA 1XIFA 4CD7A 5CZ0A 4FIQA 1TJ1A 3W70A 2AQVA 4IZGA 5A6BD 3S9YA 2CERA 3AXIA 4O12A 2QULA 2DT2A 3HPFA 3G0XA 3CL6A 4L1WA 4KEUA 4X3ZA 4UTUA 3CZEA 3WQCA 1N60C 4YU1A 1O5KA 4I5XA 4JFWA 2WJEA 3GE7A 2E5DA 4K8DA 2J62A 1Y5WA 3TN4A 1XFCA 4JFUA 5MKGB 3HF3A 1OK4A 2BBFA 5BXSA 2X8HA 1UWUA 4MVAA 5F4SA 1GXFA 4IQJA 3T55A 3V7PA 1GUVA 3DZ1A 3GZ3A 4QDWA 4KEVA 1FWGC 2FJKA 4BHYA 3SM0A 2XN1A 3W7RA 4O15A 3J7HA 2I5GA 1J2WA 3GNNA 3VIMA 3CT2A 1A5SA 4E2DA 3GVWA 4M29A 4ZOBA 3I3BA 1D8WA 2X7VA 1TSIA 2A5HA 4I9TA 5EA9A 3UJSA 3VYLA 3GXTA 4J28A 1KM0A 1FBAA 4H50A 3MSYA 3OHIA 4A29A 5HBFA 1AH0A 1KBBA 4GI4A 2IKHA 4MWAB 1E4IA 3P61A 4HPXA 3IGXA 3SCTA 4LAUA 4OBSA 2ZFAA 4WKFA 3KRBA 1M3UA 1ZU8A 4ZBCA 3RM9A 2XZ7A 2R91A 1KLZA 4ZTYA 3H70A 4ZFCA 1PV8A 1OT2A 3W2MA 3GRSA 3RK8A 3STGA 2D23A 3M64A 2FIQA 3WD2A 1ODZA 4NNCA 4WJ8A 1WO2A 4B9ZA 1N8FA 3LTSA 5C5YA 1E4MM 4FK9A 4AWEA 1F6KA 4HA0A 4F2TA 3B40A 5DEZA 1UP2A 2DDXA 3O15A 1QPKA 2VCBA 5CSYA 3TU9A 1NHPA 3ZT6A 3AU6A 2X41A 3LN3A 4UCFA 4Y9OA 3FYYA 5LGZA 3B8SA 5HANA 1KTCA 2DP3A 4O4WA 3VPLA 3IJ6A 1LWJA 1SW3A 4FEZA 3N1AA 4PSRA 5REQA 4PODA 3FYOA 1TELA 1YLVA 2WZTA 4LVGA 5XINA 1PYFA 3DFYA 3W1QA 5CPQA 3LXCA 1E4NA 4K1WA 1A0CA 2JK2A 5J04A 4ZQOA 4CU7A 4GI6A 4LUTB 2WP5A 4EM3A 1IWPA 5EFFA 2WMFA 4H6EA 2YQUA 1XIMA 4DYJA 4G56A 4KRTA 4GLEA 6ALDA 1M68A 3W7JA 1VZWA 2J7FA 1H4PA 4JKKA 4FX6M 3WH6A 4XBKA 4FOKA 2G41A 2ABAA 4ICNA 4NASA 4IGHA 4QM1A 2FHFA 4X2PA 3B0XA 3T2OA 2EJ1A 4HCHA 4ERGA 4B5XA 4D1JA 3VGEA 4IQLA 4ZSTA 4DJFA 3GLCA 1G7VA 4GQRA 4AD5A 4TOQA 3AC0A 2QAPA 2PWHA 4D2JA 3DYOA 5I2UA 4R34A 2FMOA 1E3ZA 2PTWA 5FACA 3KRZA 4UWMA 5GRTA 4GACA 1NU5A 1Q13A 1R3TA 4ONVA 4DLMA 4WSKA 1H5VA 2BTMA 3IGSA 4A2SA 1EJTC 2BNJA 3RLVA 3UF9A 3FW6A 4IMDA 3IV3A 2OLSA 4DF1A 4D6HA 3KWSA 4AIBA 4H7CA 3VNKA 3M7SA 4KRUA 3N2XA 4MJ4A 3ANYA 4CQCA 2HNHA 1WA3A 1XRVA 4LNCA 4UZSA 2PI6A 3TP4A 3TAOA 1KV8A 3DCPA 3RR1A 1H7PA 1OM0A 1XH1A 4K7VA 3DU0A 3CUHA 5CC7A 2GVLA 4ZZ9A 5DCBA 3UVAA 5JCKA 4D6DA 1QBBA 3WIJA 4PTNA 2OWXA 1AD4A 4IPIA 2WHKA 2WVUA 1C8QA 2XH7A 3RM8A 4KGJA 5KZMA 2GOUA 3GU2A 1UJPA 5JMUA 3W82A 4UUIA 1J9YA 1G01A 4C6LA 3CUGA 4I7UA 4UFJA 1TIWA 3VFCA 3SY8A 4D9PA 3LPPA 2XM1A 1RLCL 3H2MA 1EF2A 3EYPA 1CB7B 1BEUA 3WDJA 2CLFA 3L4UA 4XKMA 3HN3A 3QMSA 4WSJA 1BVWA 3IJLA 2VOTA 3W7LA 1WUFA 5D32A 2QCLA 2JKAA 1CI1A 2E68A 4QBXA 1XIBA 4AC1X 2QVNA 3FV9A 3Q94A 3MI2A 1QU4A 3H26A 2NQ5A 2YA2A 4PTXA 3QM3A 4J40A 3V5CA 3WLTA 2QIIA 1FFQA 1XV8A 2G8ZA 3FDGA 1VIZA 3ITOA 1YNQA 4Q4MA 2PWDA 2F7FA 3BG5A 3W7EA 4Q22A 1KO0A 2OO6A 3AZSA 4GBDA 4GHRA 2Z2UA 3MUXA 3ARVA 5G1TA 4D6JA 1NVMA 1OY0A 1RQEA 3AIRA 1IT0A 2GWNA 4KWSA 1PHQA 2PDYA 4NAFA 4QQ3A 3EX1A 2BWGA 3IPWA 2UZ9A 3ARUA 4WXZA 1NF7A 4L4OA 1XYLA 4PUMA 1RK6A 3WKZA 2TAAA 3BLDA 2YJQA 2J75A 2V3AA 4H2HA 5AHEA 1OCBA 1K8YA 1RPKA 3IJIA 4CCCA 4D6CA 4MIMA 1TV8A 3R0UA 1P1XA 1VQZA 2R1PA 1SQ7A 2X1IA 4QG8A 4I5RA 4IX2A 4EQRA 4BY3A 1H7RA 5E6ZA 4LBUA 3CUFA 4JBRA 3DEQA 4RNFA 3BJTA 1A5MC 3ZOAA 1FWWA 2NQ9A 1BYBA 3PN8A 3FG2P 2VC6A 4E8DA 2WOIA 1XGZA 2EPMX 3OGRA 1XLAA 4DPQA 4TVYA 4IPJA 3WX7A 4DBWA 3KM8A 3EX6A 5AHMA 4ZMGA 1K4QA 1Z41A 4I8YA 4GINA 2PDWA 1PKNA 1XG3A 1YNYA 3U7VA 4BWLA 3NYDA 1NTHA 3BLFA 4EF8A 4G1KA 1A5KC 1UZ4A 3EB4A 1EKOA 2EPHA 4IMAA 1BYDA 1GZGA 3RX2A 3TYDA 3A9BA 1I2PA 3CAVA 1PE1A 2Z25A 5J5DA 2QDGA 4MB4A 4UQCA 3IRSA 3LGGA 4UFIA 4AZ6A 1KXQA 2ZZ6A 3F1QA 3RCNA 4AF0B 1A5BA 3BK0A 3ZVHA 1XH0A 2WNZA 4Q7BA 4DRSA 3P93A 4H9TA 3DKJA 1FWBC 3RLUA 2V5DA 2Q3RA 3CPGA 4CNPA 3NGFA 3OBEA 4GZJA 1N82A 2XG9A 4W9TA 5FESA 1DJXA 1HT6A 3I6TA 2XDFA 1H60A 2WLZA 4UMCA 4F2BA 4W86A 2BVDA 1KM3A 4QAIA 3SFWA 1TVLA 4KCUA 5DQPA 4CCZA 3SUVA 4OTKA 3VD4A 1POKA 1QOQA 1OQFA 1YYAA 1ICPA 2BXVA 1KQZA 3KCOA 1XANA 2VYOA 4ZQNA 1QI4A 5HWMA 3CPRA 2W9MA 4L1GA 2WC4A 3UY8A 3UPBA 3UW6A 3CIWA 4K37A 1ZENA 1PS9A 3V75A 5B7ZA 1W37A 1PIGA 3QSRA 4JIQA 3W87A 2EAWA 3U5YA 2PWVA 1P7TB 3M7WA 3RN6A 4C1NA 3G1DA 4E8GA 3POCA 2AAQA 4Y9NA 2DVTA 1EEPA 2Q8LA 1KWKA 1UH4A 2YL9A 3TLLA 5FL1A 1TZ9A 3P8JA 5FF4A 4PUWA 3HZ3A 1JFHA 4YLWA 2F5ZA 5A1AA 5EL1A 3AOFA 1ESWA 4LAZA 1J18A 2PAJA 2HDJA 3WNKA 1A0EA 4WOQA 3VGDA 1W1PA 2AGKA 5C70A 1V02A 4NP7A 2TYSA 2Z1WA 1BXNA 3OA5A 3FXYA 4NNBA 2R9RA 3NQCA 4QX4A 2NVDA 3R0KA 3TUUA 4GO9A 1IR1A 5BOFA 4PCPA 4PCNA 1TQJA 1TMLA 4WUIA 3EA1A 4IXXA 2QJHA 2BODX 2GSJA 3P0XA 4O4VA 4REQB 2GDVA 4H9UA 4ZOHB 3SN4A 1N5WC 3LENA 5DXXA 3U2OA 4E2VA 4JGDA 4AWTA 3ZO9A 1TPC1 4IG2A 5HR7A 2YW4A 5C9UA 3GH4A 3W73A 1F61A 4L64A 1AH4A 1J01A 1HKKA 3A6OA 5HA7A 1MZHA 5TBOA 3H54A 3TCSA 5DCEA 3REQA 4I3GA 3PUGA 1PUDA 4YTUA 2ISSA 1KM2A 3V3WA 4EACA 3RLGA 4KFNA 1HJSA 3H2FA 1LL6A 1I4NA 4D6EA 1NF0A 3USBA 4WQ6A 3KS6A 2CZFA 4BR1A 4W5ZA 4F0MA 3F5LA 1MDRA 3B0YA 2YOCA 4S3KA 2QUTA 3AIWA 2GVGA 2Z28A 3FIGA 2JFEX 3FAXA 5T9BG 2QUNA 1C3FA 2ZC1A 1W1A1 4BI7A 4AISA 1W8GA 3DG3A 4RZ5A 1WV2A 3GDMA 4GQQA 3NQEA 4LV9A 1SO4A 1E1EA 4MAVA 3P82A 1VP5A 1V3JA 2NUXA 1XD0A 2F2KA 3AM9A 3NQFA 3KTXA 4HTBA 4J2MA 5IDIA 3KP0A 2QLYA 2J7BA 4WY0F 2INEA 3LMYA 1JJKA 1F9CA 1O68A 3BV7A 1RVKA 4V1XA 1CGXA 3BPWA 5EMKA 3SW6A 4PGLA 3BDKA 4D72A 2E1DA 5DT7A 3U3HA 1B3ZA 3W26A 4C6JA 1QHZA 4NYUA 5A3HA 4LBSA 1E6ZA 2DW6A 3O63A 3II4A 2NT1A 1DJNA 2H9AA 2FZMA 1TJ2A 4HYVA 4B4FA 2QF8A 3DXIA 4BURA 3FJ4A 3IIPA 5KITA 3LADA 1XSKA 3RO8A 3WF0A 1ALDA 1FWFC 4IX0A 1IV8A 2BGQA 1IWBA 1ZP4A 4JX4A 1JUBA 4RDZA 1GZ1A 4WJEA 1UD8A 2QCMA 2CCRA 3CQJA 4AX7A 5DRIA 2V3BA 2YBUA 1XYCA 1HG3A 3ECQA 1XISA 4F2UA 5U1OA 3CMFA 4ORMA 2QV5A 2ZUMA 3NQ8A 4O1BA 3NPWA 4LSBA 1QT1A 2A21A 3LHVA 1EO5A 2NV2A 1JPMA 1OD0A 5A8NA 1A53A 3M4HA 1FQ0A 2PLJA 1TTPA 2JQXA 2WWCA 2HPMA 2G3MA 2JIEA 1GONA 3U9IA 2WMKA 2Z1XA 3GC5A 5G4HC 2ZRUA 4UTWA 2AKMA 4L9XA 4XD3A 3NOYA 1AD1A 4C7DA 2WXDM 2V69A 1C9DA 1OCNA 2JGYA 5EMLA 3FS2A 4CEUC 3GQYA 1Q7ZA 2XZ9A 3WL0A 3A4AA 4EQWA 3RPMA 3G3DA 3LZ5A 5E6YA 4XTDA 1XIDA 4G6CA 2Y7DA 2YYUA 1Q1RA 3QW4B 3GDKA 3GIPA 5GJNA 4KRZA 4C7GA 2IPJA 3ES8A 4LCRA 4ZOEA 2E0PA 3ITCA 3UQNA 3N14A 2B7QA 1XXXA 2ZX7A 2XH2A 4H4WA 1CWYA 1R9YA 3BSHA 2FH6A 3HJEA 4PEKA 1JPDX 3KAOA 5C55A 3S42A 2AL1A 3M9YA 4LRSA 1W1VA 3EX4A 4O16A 4E4PA 4AC7C 1J0ZA 3WUBA 1P0DA 4AZ5A 5IBXC 3SRDA 1M9HA 1PCKA 1TV4A 4L9YA 3N4AA 2C13A 2V6AA 4S2CA 5I7GA 3W4RA 1B57A 4HTYA 5T91A 1VB9A 4NJKA 3V5OA 4PCFA 2CIPA 1GERA 3CS2A 3G1RA 3DBPA 1YBQA 4UFHA 1JZ5A 2GWGA 4Q8MA 3GDLA 4FR1A 1I8JA 1KM1A 4YWSA 4MWAC 4HU0A 4DO4A 2ISVA 2DT3A 1G6CA 3PBVA 3C4UA 5D2WA 1GVYA 2ZE3A 1NP0A 1QI0A 3CTTA 3OA3A 3WNPA 2J66A 3ARRA 1V93A 4LGXA 2ZX8A 3SUTA 4P8UA 1AQFA 1UHVA 3EGJA 3BGAA 2BZNA 3W29A 1E5JA 1ZJIA 3E6EA 1UR1A 3UETA 2EQ9A 5C7HA 3EOOA 3O6DA 4F0LA 4A22A 3LXAA 3AAMA 3N18A 3GTNA 3RO6A 3EKLA 4GKLA 2VRJA 2OEJA 1U5HA 1OYAA 1PAMA 8A3HA 4WHBA 1E0VA 3LGDA 3H2AA 1ITQA 5TD4A 1K9EA 1ZS2A 4LV4A 4IIDA 3M16A 2XSBA 3GH7A 1XBYA 2PTDA 1MEWA 3NZGA 1QOXA 3WH7A 3W1LA 4RJEA 2V67A 5F2MA 3ZT5A 1XF0A 3SUSA 3BURA 3E2VA 4LEQA 3ATYA 1ZMDA 4WIWA 1XC6A 1VFSA 2J77A 3THDA 3TOPA 1FY6A 3QBUA 4PC8A 3N9KA 3KRUA 4IM4A 4W4QA 4RE4A 3LA4A 3LBMA 2HMCA 1E1FA 3R07C 3LPOA 5CGTA 5KINA 2Y5EA 4PRRA 2HVNA 4M52A 3TNBA 3DK8A 5BW6A 2CBJA 5I00A 3KBWA 4HU3A 1R9ZA 2JALA 4ML9A 1DOSA 4PCSA 5CPSA 3BL3A 3PNZA 1TA3A 3GBEA 1Q6QA 4M0XA 3IVSA 1CW2A 2QKFA 1O94A 5J8LA 3MKKA 3NM1A 4TQTA 3W38A 1HKMA 2P3EA 1OEPA 1P6CA 2D73A 1TX0A 2V5CA 2XIOA 4KIRA 4WY0A 3C0SA 4DZAA 2VWSA 4H9MA 4YTTA 1JRCA 4AZCB 3QR0A 1KTBA 1S2TA 2O55A 3JS3A 4ML4A 1Q6LA 1LCOA 5JVLA 4LH8A 1T6MA 2VNCA 1C91A 2YDSA 2XIBA 2I5IA 3SDOA 1DBTA 4EP8C 2C16A 3ZLGA 2ISDA 3K8LA 4B5TA 4FLSA 1UC4A 3CO8A 3CL7A 3L0NA 2YSWA 3E9AA 2CU0A 4JZ5A 5HNRA 4YWOA 1U83A 2NV1A 2OPJA 4IUGA 4FB7A 1K6AA 1U2YA 5DANA 1B90A 2WSYA 4MPKA 3TJLA 4GABA 2OT1A 3AS2A 4PTVA 3K1GA 1JVNA 3IIXA 2HQMA 1YKWA 1FEBA 2Z2BA 1UUOA 2QEZA 1S1RA 3H7RA 3TTQA 2ZCGA 1X6NA 2HE5A 2PDGA 2WHJA 3S3GA 2PWEA 1MMFA 4XUYA 3MZ2A 2W92A 2G3IA 4JTJA 2O0TA 1WCGA 4W8LA 3LYEA 3CPUA 4RL3A 2DSZA 1BVZA 4UIOA 1LYXA 4G8TA 4PFHA 1P43A 1R47A 5AC6A 1EP2A 4Z2JA 4ZGYA 1DHKA 1ITCA 2X05A 2PGEA 1D7YA 3KBVA 3QY7A 4LU0A 1ONEA 2ZQ0A 3W00A 1CDGA 3LS9A 2FDMA 3FJ6A 2V3GA 4EXAA 5LNSA 4P8XA 2X8CA 4JTTA 2VURA 1EQPA 2J79A 3CLMA 3OJGA 3DK9A 4XZBA 1E9LA 2HE8A 4RCXA 1J0HA 5D2VA 1HO1A 1AL7A 1ADDA 1X2GA 2DZTA 3C0LA 4MDOA 4DNMA 1TFVA 3LV5A 3S6TA 1B9ZA 2G97A 1RHCA 4UC5A 5CC5A 1EGVA 3QOMA 3LD5A 2ZRVA 1KRMA 1W9PA 4JS3A 1EYWA 4N6EA 1CCWB 3D0CA 2GDQA 1SB3B 1BGGA 4PMJA 2QPXA 1OT1A 1E1CA 1F6YA 1WP6A 2IPFA 3K46A 3NZ1A 5I06A 5A6TC 1PX8A 1MXGA 1TG7A 1TQXA 1V02E 1G0CA 3MSRA 3VD9A 1EWEA 8XIAA 3VAVA 3C0QA 3PTDA 4HZ8A 4Z0JA 4PBGA 3IJ7A 3RX3A 1F8IA 2PU1A 3RAOA 1XRSA 1K9TA 1EXPA 4RV3A 5E93A 3NVTA 3QYQA 1SO3A 1KGWA 1M6JA 5FF3A 1TCDA 3KE0A 4LQ1A 1XDMA 2C1IA 1GVSA 5G1YA 2ZZ5A 4JQ3A 2BOEX 3WFZA 3D5HA 5D8ZA 2VX6A 1LTDA 4DZHA 5GNZA 5CBIA 3THCA 1EBDA 1N61C 4TVDA 4TTGA 2GUYA 1ZTVA 1V0NA 2PB1A 4TU1A 3ARQA 1YXCA 3Q6JA 3TDFA 2YL5A 3VKDA 5CSSA 4OJYA 3UXDA 1GYNA 1S5VA 1T7LA 4HHPA 1BG4A 3VOGA 2J8TA 3W02A 1CIUA 4JY8A 5PTDA 5LGXA 2FPVA 3TVAA 2WC7A 4N6FA 3SJNA 4PMVA 3BO9A 2CDUA 3RG6A 3QYSA 1ZRQA 1REQB 5K9XA 3EXTA 3RCYA 1FKWA 4LCQA 3ZWSA 4RPPA 4M82A 4TVCA 4KT2A 1EJVC 2FDSA 1K9FA 4BJHA 1OWQA 5IM51 4BCEA 4HD5A 2INFA 4GI9A 3L12A 1JCNA 3WLRA 1B3OA 2OOFA 4QGCA 3TYCA 4LX4A 2TSYA 3CGCA 2ACQA 3E49A 4LF1A 3ISIX 1YPFA 1PX4A 3W88A 1EFZA 1AODA 1QNSA 1YDNA 3AI0A 3B8VA 3RMEA 1H09A 3VNLA 1J79A 3RX4A 1TJRA 1XIEA 1LBLA 2DQWA 1Q5MA 3ENLA 2I9UA 4QE5A 4GIAA 1TZZA 1JCJA 2NWSA 3K30A 1PX3A 3QGAC 4FOJA 1DPMA 3NO3A 4XBSA 2W62A 1LOLA 3M1ZA 2G50A 2DORA 2PDIA 2WSRA 1IXOA 1VBJA 2P5NA 2WAGA 1SGJA 1FWHC 1Q6CA 3AZRA 3M0KA 1W31A 4QSFA 4DNHA 2E28A 4LY8A 4DWSB 4F0SA 3R8RA 1KGXA 1FWRA 1V79A 2QAEA 2ZUNA 4XZNX 3FA3A 1TE1A 3I6EA 3IJ8A 2P8CA 3QMTA 3PNUA 3WH9A 1IF2A 4LYPA 2J25A 1L6YA 4F66A 3R25A 1UP3A 2GK1B 3DC0A 1U1UA 5HPOA 1C7SA 2NQHA 2BP1A 1IE7C 1DJWA 3BAJA 3PBGA 4MF4A 3W1XA 2A1YA 5D38A 1VQTA 1JDFA 1QW8A 3A3HA 1FWIC 3NSNA 3H4WA 1OCQA 3B8UA 3V0SA 1GGOA 3OYZA 3W75A 4GVHA 4DO6A 4JFVA 3UWEA 4QDPA 3EDDA 3S1WA 3HW2A 1TMQA 2ZWYA 3DECA 4LS1A 1TPEA 1X98A 4XZWA 3K8MA 3EOEA 4M6PA 1V4YA 3P14A 3ERPA 4NUWA 5JU6A 2YCEA 4QHRA 4IHCA 3GM8A 3B8DA 2HBVA 3QR3A 1P1MA 3UXIA 1UD6A 2WMIA 1Q3NA 2FVMA 3VE7A 4UTMA 4LA1A 4BQ2A 4TUFA 4HN8A 5DT5A 3GC4A 5FAGA 4H4ZA 2JKEA 2X1SA 4KGLA 1GOXA 1GW9A 2PD9A 2YL8A 3AALA 3NIYA 4WRHA 4FXSA 4UTTA 4PMXA 3RLHA 4ES4A 1PKMA 4PMDA 2ZE0A 3E5PA 1E9ZB 4ZE4A 3CQHA 5C9XA 3QF0A 2W0UA 2GPTA 2NXGA 1UIOA 1C8VA 2HZGA 3N2BA 3WJYA 2A3EA 3CXBA 5BOOA 5LKYA 4W89A 3TQ0A 3TYAA 2GJNA 4GIEA 3TZNA 5DBUA 1N62C 4L56A 9XIMA 1GJWA 3ABZA 1R38A 4HA3A 1JF5A 1H5YA 3MZNA 4ZQPA 4DUOA 1WOBA 2BVWA 2Z6JA 3KOZA 1RCOB 3W2KA 2ZUVA 3CB8A 4H8VA 5FKYA 4W87A 1ZK7A 2VD8A 4GPNA 2PURA 4RK8A 2ADAA 3JZEA 4BI6A 1GRBA 3LXDA 3DI1A 2VEPA 4C1KA 1JOAA 1OFOA 3L4ZA 4GZEA 4B5UA 2DZXA 1JFXA 4U5KA 2QCDB 2VZTA 4BFAA 3VDAA 1JDAA 1MFVA 4HNVA 1LF1A 2BVTA 3SCUA 1RLDA 1KWGA 1T40A 3AMGA 2E67A 4OV9A 3KOWA 2DSUA 7XIMA 4RUBA 5EFDA 1QWGA 2G96A 3W3OA 3OZMA 3E0VA 3PUOA 1B31A 2FB3A 3CZGA 2OQYA 1LLZA 2PDFA 4XV0A 3C5QA 1CGVA 1PYMA 3KUMA 1AQHA 2RKXA 4XAFA 4KWWA 5D37A 3NGJA 4P61A 3ZXWA 1H2IA 3WEZA 1X39A 4AG0A 3NTYA 3W37A 3F4VA 1K6WA 1RVGA 2IPGA 3U6WA 2F8QA 4HNNA 4F9JA 3KLKA 3TJ4A 3WQ6A 4R88A 3ZYZA 4HHMA 2OSXA 1VHNA 4GD0A 2IMRA 2AKZA 2WCSA 4LYRA 3S2JA 4IUOA 3WBYA 1EHNA 4O54A 1B4KA 1U5JA 3P81A 2P0IA 4S2BA 1RXOB 4J27A 4L65A 1Q6GA 4H8NA 3VGGA 1MFUA 2DZUA 3C2RA 4QJ1A 2XFWA 3EWDA 1EB3A 2P10A 1M7XA 1WDRA 3DDMA 2D0HA 1EOKA 4LEFA 5HJYA 3P60A 3T4WA 1RBAA 3EDFA 3EPOA 1GKRA 2WSKA 1Q6DA 5ABEA 1FEAA 1I9CB 4JQAA 3GYEA 5U25A 3JRKA 1XYAA 4C5ZA 5BZAA 3LB8A 3M44A 1UA3A 3VOJA 4HHHA 4MNMA 4PB5A 5C0QA 1LWHA 5G2IA 4DJDC 3G8EA 3HV9A 3RU6A 3HGJA 5CC3A 2Y8UA 2OSYA 2NZLA 1NIUA 3O0KA 2X99A 4MY9A 3OZOA 4EOUA 3GG1A 1XKYA 3TWBA 3T0AA 4BI5A 1JAEA 3WNOA 3MJMA 3BZGA 3G6MA 5A6AA 1B54A 1KXHA 1V6WA 4Q8QA 4IH3A 4AD4A 4S3JA 3UJ2A 4Q8VA 2EPKX 2XSXA 4JTAA 3L4YA 1XIIA 2Z2AA 3GUWA 3TQKA 5TQLA 4KFPA 1J5SA 2KAUC 5A2BA 3EB2A 2ZUWA 2O9OA 2YDRA 1TPB1 3WQ5A 3L5LA 3SRKA 4E4FA 1UWIA 4L6HA 1GHRA 2BDQA 5I79A 1DEDA 3DFSA 5AECA 1HJWA 5KZEA 4FNSA 4JN7A 3B9AA 3PZUA 2WP6A 2QUVA 1TX2A 3TN6A 3WQOA 4ACZA 3M0YA 1OIFA 3GNXA 1J0YA 1J5TA 4S3DA 3NPVA 1JYNA 2WOQA 4YL2A 2VZUA 1WYIA 1W5PA 3W83A 3PAOA 2P50A 4WVXA 3NDZA 1ZY8A 5G5GB 3MUZ1 2GJXA 3BMVA 3QC3A 1N5XA 4H4SA 2YBVA 4IWWA 4XSMA 5JBFA 4LRTA 2OZ3A 1LOSA 3G1SA 5AOUA 3T44A 1XCXA 4DM2A 1L6GA 1AZ1A 4AZ7A 1JDCA 5DFAA 3KOFA 1JEZA 4CUCA 4US6A 3E1F1 3APYA 3EWZA 3T9PA 1IWAA 5FS8A 4C6QA 2BHUA 2HVMA 2PU0A 4QE1A 4NZJA 1X38A 4L80A 3WQGA 3VOHA 4ZSUA 2QW5A 5KSWA 2W6RA 4UQBA 1EX1A 1CXFA 3U7BA 4RDYA 2R8WA 2F84A 5LA1A 3A5VA 5DXYA 1ZMCA 4L61A 1OVDA 1TV3A 4Q7NA 3DIPA 3WFAA 5EGRA 1RP8A 1BWVA 3W1TA 1GVRA 2V5JA 4DHGA 4NSBA 4V2XA 3M0JA 3ZSSA 4DI9A 5BRQA 1KA9F 1RSCA 1QNVA 2AAMA 2WM1A 3M07A 5AYZA 5JRBA 5REQB 3MO7A 2D2JA 1Y8BA 2E5AA 1VHCA 1GESA 3KXQA 4B90A 3GTXA 3AIQA 4PYSA 4PFMA 3KVMA 4HHLA 5G1MA 4EPEC 4HMNA 1G7UA 1ZP3A 3DENA 4YHGA 3O9NA 1EC9A 5GQBA 1RD6A 2WPGA 1LOQA 3R89A 1POJA 3F4CA 4S3AA 4WXYA 5CZKA 4B5NA 4X22A 4E0CA 5XIMA 4CNSA 1DIDA 3VKCA 3PB2A 1F4HA 5G5IA 1XBVA 3NPXA 3WBEA 3AN1A 3FYPA 3L4TA 3THUA 1IEQA 4JHMA 1BTMA 3WJXA 2P3ZA 2YGYA 3BAWA 4C65A 2DZPA 2G5WA 3EWXA 3MC5A 1UKQA 1GQNA 5AYXA 3C6CA 3B05A 4J7RA 2Z27A 3WCZA 1VDVA 3S6OA 1DQUA 4B5VA 3QZ6A 1ZBKA 5A6MA 1Q4NX 4CEXC 1GK8A 4A2RA 2VEKA 2YKKA 4JY9A 2ZXBA 1DIEA 1K02A 3NNTA 1AW5A 3NQ2A 1VPXA 1LLWA 1JF6A 4B3LA 1VCVA 3U4AA 1LVLA 2XH0A 4V27A 4ICMA 4UNKA 2ZYFA 1IQ8A 2BOFX 5CZJA 3CEPA 1K1DA 1UW9A 1OF8A 3E2RA 4LS0A 1W0MA 2FFIA 4LUSB 3TE9A 2RH9A 4J2PA 5FI8A 3F03K 1G1YA 1PHWA 1XD1A 4UZUA 1OFDA 1QNPA 1KN0A 2HS8A 1ME8A 1H61A 3V1PA 3CQ0A 1MW3A 4GJJA 1H0IA 3QC0A 3GAYA 2XWDA 2OZ8A 4GYFA 2E6FA 4QROA 3GIYA 4H1ZA 4IL2A 1JCLA 1Y7VA 3IARA 3MANA 2WPCA 4RPQA 2FZ8A 3M0VA 3DH7A 3HG3A 1JD9A 4M1RA 5C6MA 3OODA 3PB0A 4B2DA 3VNYA 3Q67A 4QJ4B 4W7UA 2QXWA 3URHA 1SYTA 3W81A 3BE7A 3N04A 1CYGA 3SCPA 3SR6B 1V8EA 1X1ZA 1WDSA 3B3DA 2WZIA 4BQ3A 3P8IA 1XLMA 1UR9A 3TROA 3BLOA 3WF2A 4ZVJA 1FWTA 4OU1A 3O1NA 4Q4QA 1VBGA 1JNEA 2DSKA 3EDEA 2XSAA 4LF2A 1JYXA 4R3UA 2ZIDA 5B80A 3SB0A 5HK4A 4H4XA 3WLKX 1A5LC 5CXPA 3PBYA 5EPDA 5D2YA 4PR4A 4V15A 3BW2A 3R4IA 1GEQA 3PG9A 1ECEA 1U30A 5JXQA 3V0TA 1GT8A 2Y89A 3P62A 1V6YA 1J96A 4GX8A 9CGTA 1FHLA 3GZAA 5C54A 5DX7A 2F61A 1OZMA 1BRLA 2XGBA 4HP5A 2O9PA 1XG4A 2AAAA 3LRKA 3VM5A 1V5XA 5T26A 1CGUA 3U4FA 1F7BA 3LOTA 2RDWA 5JQ9A 1GQJA 5CLWA 4UMBA 2A7PA 3UG8A 2ZZ7A 2QR6A 1XLFA 4K38A 1EJ7L 1SZNA 1MQQA 4AAJA 4NAFB 1NWSA 1KB3A 2YW3A 3VNDA 5G4EA 1HP4A 4H7ZA 1CECA 2OYLA 4AW7A 5A69A 3R8GA 3MV01 1FWEC 4XVEA 5FJUA 2EJAA 3KBMA 3ZIZA 1US3A 1E6SM 3EWBX 1W3HA 2WQPA 1OIMA 4Y8FA 2PDPA 1FWNA 1V6XA 5E5CA 3CUJA 4LUJA 3OGSA 3B8TA 4I9JA 3S8HA 3DFQA 1GWJA 4Q4KA 5JBEA 4QAWA 3V16A 3FVMA 4RKAA 5IBXA 1GOOA 1NQKA 1D3HA 2VMFA 4PH6A 3C3NA 4CLMA 2EQDA 3IK2A 1XIHA 3BH4A 2I1OA 2Z7GA 1EDQA 3BJFA 5C71A 4ROQA 2E5CA 3MPGA 3KRSA 4PEEA 5DRCA 2HVOA 2OJPA 1TREA 5I07A 3GDRA 2C91A 2C1HA 2PDQA 1R30A 1XSIA 4AD2A 4Z17A 3A3WA 3APTA 3MW7A 4MWAA 3CYVA 4TV5A 4M81A 3HPAA 1OD8A 4G9PA 5JH2A 1YTEA 2VQUA 4AB4A 1XRTA 2WWDA 3ITTA 1S39A 3SRHA 1V0MA 1DE5A 4LT9A 3GU9A 2C15A 2J74A 4XWUA 3EDKA 3A7RA 3SCWA 6ENLA 2NQJA 2ASHA 4HGXA 2ZX6A 3TK7A 3MWAA 3IJ9A 1KCKA 3I65A 2A6LA 1HJQA 1XUUA 4A8IA 3CYJA 1C8YA 4C90A 3SCVA 5IDZA 1MVYA 4Z2LA 4OUIA 1LQ0A 3TSDA 3NQMA 1TKKA 4MTVA 3S5NA 1EX5A 4RDVA 4U28A 2OR2A 1YE6A 2Z1BA 3ABXA 2IS7A 1W1TA 1ZFJA 2VRQA 4H3DA 4AUBA 1NOFA 2PD5A 4QS6A 3MHGA 1Z42A 4C6KA 3ABSA 1GREA 4O8RA 5D8WA 5HXMA 1YRRA 2CZVA 3W22A 3MUAA 1JDDA 3O0FA 4W88A 1QDSA 1OFPA 5AVHA 2EG8A 1JYVA 4NZ4A 3R1ZA 5DMNA 4GRTA 3CT7A 3EPNA 5E1QA 4H19A 5JH1A 3DOPA 4KESA 5LA2A 2Y6ZA 3FN9A 5EB8A 1Z48A 3IS4A 1KKOA 3SCOA 3N13A 4LIIA 1TWWA 1V6UA 1C9WA 1PTGA 4B2DD 1E6NA 5I6SA 4AD0A 1QXLA 3QV8A 1XCWA 2J6VA 3W7IA 1XGEA 1GJUA 3UWZA 3H4KA 1QPNA 4O52A 3MWCA 1UQZA 2OWCA 4PUKA 1WKYA 3EAUA 2ZICA 3G1YA 3BOLA 3WN6A 4XO6A 3L68A 1BPLB 3BCJA 3WK0A 4GXPA 2YCIX 1OGGA 1RJPA 1JNDA 3AIEA 2YBTA 1IZCA 2FTYA 3RUBL 4BS0A 1PL9A 4GYJA 3JU2A 4IL0A 1Q6FA 2UV8G 4KWUA 3T8LA 1DNCA 3A12A 4EMJA 2CXGA 4DWDA 2QJJA 8TIMA 4JDBA 3TR2A 3VA8A 1FXQA 2I7GA 3H23A 4KIEA 2CC0A 4Q32A 5BXPA 5CPMA 3MV11 1I0BA 2DZWA 5HWJA 1KGUA 1EZ2A 4TMBA 1DWJM 2UY5A 2FGBA 4XAGA 2PGWA 4U33A 1ML1A 4NY2A 3D6NA 1UWRA 3B03A 5ABFA 4X61A 2DU2A 2EG7A 3GR8A 4UTHA 2J8GA 3LEPA 2GSEA 1P48A 4QG6A 1W54A 2MNRA 1CXEA 1TWZA 1T0OA 3OZYA 7CGTA 1QHOA 1V97A 4OUEA 4O10A 4XZLX 1QASA 4UOQA 4HOXA 4AXNA 2J7EA 1GRHA 4I7VA 4XSLA 2ZX5A 4KW2A 3K8KA 2E6DA 3NXFA 1Q7QA 2P0OA 5EY5A 2WBKA 2WHLA 4JKLA 4S1FA 4O19A 2WKGA 4TXEA 4ENLA 4X9YA 3C61A 4WKAA 3W7OA 3QGKC 4FLRA 3G77A 2WCAA 4S38A 2WMHA 5HPCA 3PK7A 1YXDA 2BY2A 1PZ2A 2D24A 3ARTA 1XWYA 3IC9A 4G7FA 3SQMA 1C92A 3H7UA 4JFSA 1ELSA 1MDLA 2PCEA 1TZ7A 3NM3A 3W1MA 4OBTA 3TOYA 4JD4A 1EUNA 1S5WA 4R7JA 1HO4A 2VGFA 1IZJA 4Z2IA 1BWCA 2E25A 5M5DA 1RBOB 3K1DA 2YYTA 3ZJ7A 1XHCA 1US2A 2JIWA 3W7GA 2TMDA 3BAYA 5IFPA 1S2UA 4E5TA 2D22A 2VD9A 5A8QA 4C6PA 3CIXA 3WJWA 3NZPA 3WY1A 3ARWA 2AOSA 4GCXA 4FHAA 4MYXA 3S83A 1F74A 5D02A 4IFOA 1PKYA 2AQWA 4CKQA 4NRRA 3K2GA 1MSSA 2H3DA 1FVPA 1FCQA 2CFYA 2DZVA 1G5AA 3KL3A 3A7AA 3MYOA 2UWFA 4L4PA 5E0KA 3NWRA 4IXHA 5FSDC 1RUSA 6TAAA 3B4YA 1SFSA 5BYWA 4GUGA 3M6DA 5FCZA 1YDOA 2YLAA 3WSUA 3KEHA 3EANA 1UR2A 1PKLA 2ZRWA 4I6KA 4MMWA 2SFPA 3G0SA 1WKEA 4H9ZA 3LLDA 3K13A 3P67A 1DJYA 2CW6A 4DIAA 4JTRA 1JCYA 4AZIA 1ZCOA 4G7EA 2ZRYA 3IVTA 3GD4A 1XSJA 4M7TA 1BF2A 2E40A 2WLYA 2XN0A 3GR4A 3TC3A 5FS6A 3RRAA 3GXNA 3N2CA 3EZ4A 4IQEA 1CLXA 3NURA 3NDOA 3N12A 2I16A 2JEPA 2BMBA 4DUWA 1FWCC 1NOWA 2E6YA 1AQ0A 2BB0A 2A7NA 4HOZA 3W7QA 2DUXA 2XN2A 5FS9A 2D3NA 1HKWA 1PTDA 4LXFA 3QGVA 3T05A 3GB6A 2VFHA 2GR1A 4DBUA 1S5TA 3VK5A 3CH0A 3W1RA 1DP0A 2WB5A 4KPRA 1Q8AA 1W5OA 1ONXA 4DAIA 2FB2A 3GFZA 3Q4DA 4LAOA 3M5VA 4FLOA 2Y2WA 3T78A 4JN6A 3COTA 2VFEA 3LQGA 4AXKA 3W2JA 3FEMA 1GKQA 1LG2A 4PRTA 3W1UA 1SSGA 3MDUA 1X7FA 1QW9A 4BA0A 3N15A 5E9AA 3MT1A 5H8MA 2A3CA 3AYVA 3TN3A 2OYKA 5H6HA 2XTKA 2V8ZA 1W5NA 3B4UA 3TYEA 1XPGA 3PZTA 3H55A 5I0DA 3HBLA 2FMNA 2ZVRA 2D2OA 4DXVA 4MUPA 3HG2A 2Y85A 4AY7A 3A23A 1L6WA 2VGGA 4QQUA 2OKTA 1I6NA 3BAXA 1ISVA 2DW7A 2BHYA 2V81A 4H9YA 4NJGA 4GX9A 4FI4A 3AHVA 5D2XA 1AL8A 1KCXA 5C7VA 1DWIM 5EU9A 1TPWA 4I90A 2C18A 1SFTA 4Q4SA 2PZNA 4XZHA 2ZC8A 3W7KA 3MP3A 4GH3A 3NAVA 1VCFA 2GUUA 4NI8A 3VKKA 1YBQB 4GXWA 2OYMA 3LCWA 1XLEA 2XU2A 5ENLA 1CXHA 3ZR4A 5CAKA 3M46A 1SZGA 5E70A 1WKFA 2C71A 3NO1A 4IPLA 4B9YA 2WVSA 4MB3A 1WOAA 2XVNA 2XYLA 1Z3NA 4PRWA 1ZQ5A 4AEEA 2EO7A 1EWDA 4HCLA 3EXSA 3SRFA 2R14A 1ZJAA 2NX1A 1C90A 1X8FA 1Q85A 4W84A 3TA6A 3OIHA 3HU7A 1L8PA 3URAA 2PF0A 3VDHA 4O11A 3ARZA 4FNQA 1VF8A 1VH7A 2NLYA 4LJ3A 1XYBA 2ZADA 1B4EA 5A8MA 2DUAA 5F2GA 3ZQ9A 3VIFA 2OB3A 4DWSD 2VZVA 1JROA 2QUMA 4ZR8A 3UFYA 3BUVA 4S3EA 3WLQA 4FLQA 2FFCA 3BSMA 3QQ1A 3O16A 2C0AA 3NSXA 2XVLA 1IT7A 1B0IA 2VHLA 5G2WA 4GVGA 2VVSA 1S7MA 3RDKA 4IIHA 4M3PA 4PMUA 4GXMA 3I7QA 3IANA 3PZ9A 4UFLA 3ANVA 4FNTA 3T08A 1BYCA 2VELA 4AD3A 3PZQA 2FH8A 1ZGDA 2OSWA 4H6KA 1TPVA 1VLIA 1C93A 3T0CA 3RJXA 4GE8A 3VIOA 2JK6A 4GC3A 1RCXB 2WYSA 1TVPA 4E2BA 4XG1A 2ON3A 2A8XA 3CC1A 1SFJA 1SW7A 3T0TA 3R0DA 1NDAA 1AG1O 3QTGA 5B7YA 4AMAA 5E9XA 4F4RA 3SGUA 3W2UA 2XWEA 2WOWA 5I3JA 1K7EA 4FX7A 3ZLHA 3L0GA 2OLAA 3EKZA 2PDJA 3W9ZA 4F40A 1HJUA 4XQ6A 3M0ZA 3GVGA 2G0WA 3USZA 1EUAA 3MS8A 3JR2A 1VPYA 3CV7A 3BAIA 1A5UA 1ZXIC 4N42A 1E3XA 3V18A 3HMJG 1K77A 2IKGA 3E5BA 4X0NA 3E38A 4Y8EA 1A47A 4GJIA 1YQZA 3R13A 2NUYA 5I24A 5IOBA 2X2YA 4D6FA 4LANA 2Z7KA 2OKOA 3VGHA 1XICA 5F1UA 3KX6A 3UG4A 3OQ8A 1EC8A 3NFUA 4BF5A 3W86A 5EKYA 5BWAA 1TMHA 3GXIA 2G37A 3LCFA 1DJZA 1R3SA 4M6VA 3MO4A 5FIPA 3TJIA 4XIAA 2V3DA 4MNKA 3UPMA 1E6RA 1PWMA 4MZ8A 2NW0A 1JXKA 3P0WA 1HNYA 1VFTA 2QCGA 3TV8A 3H53A 5I5RA 4UOZA 1NELA 1VEMA 1E0XA 3VNJA 4BV6A 1KRAC 1VJZA 2J9YA 1GYMA 1ICQA 4NYYA 1XDLA 3A4XA 4DEFA 2DVUA 5FEXA 5IHSA 5LIXX 1OF6A 1R3VA 2A0NA 2JF7A 4C60A 1RM6B 4LS2A 3AJ7A 3RITA 4QCFA 4XZ9A 3VDGA 4HZ6A 1YNPA 3A21A 3SURA 2ACRA 3PHAA 3WLSA 3RFAA 2P76A 2J7DA 1NWRA 2XH4A 4PA8A 1IEXA 4O8AA 4XIMA 5F4WA 2ZZ4A 4AZGA 1VRXA 2Y5SA 3LRMA 3WDIA 2E4TA 2BGNE 4IGMA 4XKYA 4EAYA 3W28A 5IXEA 4JL2A 1UYQA 4HNOA 5CLTA 1TRIA 3T2QA 2PP3A 1LL7A 1UUMA 1B3WA 2Q3OA 2VC5A 3P80A 2NSOA 1K70A 5FJJA 1HXJA 3WQ8A 2B31A 1OFBA 5CKSA 5D9NA 1AH3A 4M80A 5FJTA 2F9RA 4O0KA 3INPA 5D03A 1E1CB 2YXOA 3THAA 3RRXA 1UQYA 1LLOA 4QLKA 4DJDA 4BEQA 1M1BA 3U2ZA 4H9VA 3CGEA 3UJEA 3WDHA 1A3HA 1DORA 2DSWA 1T5AA 4H4QA 1OX6A 1DWHM 1UD5A 1VJSA 3N19B 1MWOA 4ADUA 4WEVX 3VD7A 3CL8A 1GSNA 1QO5A 1BZLA 2L5HA 5HUOA 5DMLA 4O53A 1U1HA 1P0EA 3WQPA 4FX9A 3AMDA 3DC8A 4GWEA 1O4UA 2OELA 2EPOA 4JNZA 4YXGA 1PTAA 4Z1YA 3A9IA 3R7MA 4DJEC 3C8FA 1SR9A 1VFMA 3WK1A 4DF0A 1VBUA 1CBGA 3KP1A 2HCVA 3OO2A 3AIVA 2WNNA 4NZ5A 4MY1A 1AJ0A 1W5MA 2GH5A 4Z1CA 6XIMA 1H6VA 7A3HA 2QJNA 3R5EA 4FALA 3MCMA 3TEVA 1WDQA 5TF0A 2W5FA 3ZMRA 3CAQA 4W5UA 3VIPA 2GLKA 1CXKA 2PLCA 1ZPTA 3CWHA 4DZ5A 3M0MA 1ZJHA 4UQAA 3LCIA 2C3DA 3NVWB 2PODA 5A95A 1FWDC 2X0HA 2VO5A 4M6QA 4YVXA 2HK0A 2D20A 3Q45A 1XL9A 5LSMA 1SR0A 4GFIA 2X2GA 1V0KA 1H2JA 3AMLA 2GVEA 5K9CA 2B7NA 2O4MA 3VTRA 1YDYA 1ZZMA 4W7VA 4CU8A 3LCHA 3V5FA 4UQEA 7REQA 2DUZA 1I1WA 2PP1A 1E0WA 3CZLA 1S2WA 1HN1A 1GPWA 1M5WA 3PSVA 2J3NA 3N73A 1WDPA 1EZWA 4RE0A 4JEJA 2GZXA 4PN2A 1MZRA 4PMOA 3NO5A 3HPZA 3K4AA 3APGA 4L6OA 1LROA 3UG5A 5A2AA 3BQ6A 3UEQA 1JDEA 4INFA 2A3LA 2OQLA 1JD7A 3L23A 2OTDA 2NPXA 1MUCA 4DAFA 3KWXA 1RCQA 4LVBA 4YYCA 1DVJA 3NQDA 1GVEA 4GISA 2GQ9A 1P0NA 4O0QA 4Z1DA 1EA0A 3VOCA 3HG4A 1D9EA 4UQ9A 1F05A 1VFLA 1OG0A 1V6TA 3GNRA 3Q2DA 3AIBA 2RDTA 1QNRA 3SN1A 4K1GA 4PMZA 1F3XA 3PBWA 2ZBTA 1MW0A 2WK2A 3BCDA 2AL2A 1H51A 1NPXA 1ZKQA 5RUBA 2WPBA 2CXEA 1AW2A 1X1OA 1UWAA 4RZ4A 3T8QA 4Z2HA 2XGZA 3V36A 1XBXA 4ZCWA 1Q1WA 4P2VA 4QCEA 2CZEA 5BU6A 3NQ7A 4D6GA 3CHDA 3YPIA 2P53A 2VCCA 4HJWA 2FKPA 3QTPA 5AFDA 3GHRA 3GNDA 3W74A 1AA1B 3IAQA 4GR1A 4AZCA 4ZL1A 1IT8A 5I09A 1GOMA 1X1NA 1H1NA 2V5KA 1XM3A 4A3QA 1A4MA 3C56A 2QMKA 4AIEA 4H6RA 2OZTA 4U31A 4QG9A 1UP0A 4WZHA 2P1FA 4A35A 6REQA 1O12A 4NAEA 2WMIB 2DY3A 3A24A 3L2MA 2CBUA 4PMYA 4MADA 1W3KA 3FKRA 2INZA 5AYBA 4MJZA 4NEWA 4Q33A 4DJFD 1AW1A 1OX5A 4H4YA 3M0IA 3TCEA 2NWRA 4PL1A 1JZ2A 2BVYA 1UD3A 4YN5A 3UJFA 3S47A 2QT3A 4FS9A 1UR4A 5FOOA 2QVHA 2I5QA 1J4EA 1GZJA 3HQNA 4WDUA 3P7YA 4JTQA 1JAKA 1IGSA 4A21A 3AXHA 1AMYA 3OG3A 3AHYA 3R6IA 3STFA 4XVDA 3W24A 5CZSA 3HPSA 4RW3A 4ERIA 2DFAA 1IXNA 4AWUA 3R12A 1JZ4A 3VUPA 2WJDA 1JPHA 4J3UA 1MXSA 2F6KA 2ESCA 4QTGA 4E4UA 4GQ0A 1T3QC 2TPSA 5DN1A 3ELFA 3JVAA 3ZR6A 4WLCA 2Z24A 2QCFA 1UKSA 4UR7A 5CG0A 3C8NA 2D0FA 3T81A 3M0LA 2VP8A 4NJHA 1GQKA 3S1GA 1HZYA 2Y61A 1D3CA 3W1AA 5A8PA 1OADA 2R1MA 2W67A 4E3TA 2ZRXA 1QPQA 2PWFA 4IFKA 4HK5A 1JI1A 4KEMA 3DUGA 1QUMA 3IK4A 3KOXA 1L2QA 2EQ6A 3AWOA 4O1EA 2OGYA 2VOMA 4C91A 2X8GA 3DX5A 3GVQA 3F2BA 5AY7A 4G2DA 3KLJA 4QR6A 4H4PA 3A64A 4QLLA 2YDQA 1ITUA 5ER0A 3BMXA 4ZO6A 3PZMA 5KVHA 2Y62A 3EWCA 3LBCA 3C0JA 3F4NA 4MFDA 5HWNA 3R2GA 5ECVA 2YZ5A 3GTFA 4B91A 3S0CA 1OJTA 4Q7IA 3TMQA 4GK8A 3LMZA 1JPKA 1H11A 4EANA 3Q58A 5ECUA 4JTGA 3MI6A 5EMJA 1TPFA 1RR2A 3CEUA 4X9SA 2O56A 5CGQA 4DXKA 3CQIA 1XIGA 3VNZA 3V0UA 2FGZA 4PL2A 1WQ5A 2FHCA 3G1FA 3OW1A 4HPNA 2PDXA 2OWWA 1KQYA 4L9ZA 3W7DA 4EK7A 1FHVA 2PWUA 4HCDA 4JIHA 3WDPP 3UA4A 3WBAA 5LA0A 2RFGA 3NSMA 3RPTA 2OG9A 4CNTA 1MEIA 3H8AA 4NT0A 3F2DA 4JTHA 5K4XA 4ZO8A 3P6LA 1LUCA 3GDTA 3ARXA 1ZCCA 3PFMA 4Z08A 5LNUA 4J57A 3WMCA 1XLIA 3BLEA 2I56A 3PPCA 1XQLA 1LT7A 3NL3A 3ID7A 1REQA 4XBJA 4GVIA 3TWAA 1LM1A 4QIUA 1VR6A 4QLJA 3GKAA 4DVOA 3WZ0E 2QCCA 3N6HA 4NZFA 1KFKA 4RZ6A 2XFFA 4HB7A 1HKVA 4CVWA 3VZZA 2D2GA 5H1WA 3EWUA 3WQ4A 1OC7A 1FCBA 1ZJBA 4H00A 1B3XA 4P7QA 3UYIA 5FF0A 3M5YA 2FZDA 1EL3A 1PVNA 3LTYA 3BGJA 5DBTA 4AHQA 1FFUC 1XLCA 1DIKA 4A4AA 6A3HA 3B9DA 5C9ZA 3TNOA 4XZMX 2CZDA 1XBZA 1ZAHA 1BSLA 2YZRA 3MUY1 3LPGA 5AC4A 4XUGA 3WLLA 3QLDA 3ICJA 2RHGA 4ACZB 4CN4A 1QTWA 4CVUA 3S46A 2X30A 1S46A 5D9MA 3TONA 4DYEA 1FDJA 5D9PA 4EPDC 4XD5A 3F5JA 4MZ1A 2CLEA 5EMUA 3P5YA 2B0MA 2QCEA 2WCGA 4ADWA 3S9IA 1UWSA 2P88A 1B9BA 3PUDA 5LIUX 3LTPA 4PBEA 3S9ZA 3VGFA 2YVJA 5D30A 1PZ1A 1UASA 4QNEA 1GTHA 1G4EA 1AFSA 1F8WA 1SZRA 3R11A 3PZGA 5DMMA 1CXIA 4WGHA 1E55A 2PDHA 3LHWA 3TAKA 3CLWA 4IGSA 4U2YA 4UOJA 4CQDA 1E40A 2DH3A 1IEIA 1QFEA 5A6BA 4GUFA 5DF0A 1ME9A 3TW6A 3M0XA 5BRBA 4OZOA 4O1AA 3VGBA 2CKRA 2J4GA 1R85A 3QPZA 2TRSA 4HA1A 2XJ7A 1R5YA 3B9EA 1SSDA 1CEOA 3S5ZA 4K7ZA 3PWIA 2PTXA 2HQAA 1B5TA 4IMCA 3OG2A 1T8QA 5I03A 1HQTA 2QCNA 4S23A 1BTCA 4KWOA 2MANA 3P3BA 1YPXA 4QP0A 3BWWA 1NWTA 5DLCA 3FAWA 2PF8A 2ZOXA 2Z1SA 4ACYA 1NM9A 4G5DA 1PSCA 2Y8VA 3LLFA 4RW5A 3RYSA 2Y1HA 3N34A 4EAMA 2OEKA 3OVGA 3ETRB 2I14A 1E51A 2PMQA 2ABBA 3L5AA 3MCOA 3ALFA 3PS7A 4FDCB 1FDYA 1SJBA 4JX6A 1M01A 2RABA 3IGHX 3N11A 2H8XA 1PJ9A 3DAQA 3N9RA 4KKXA 4K6AA 4AZBA 4PBFA 4HIBA 1R3QA 2PUZA 3T0DA 2VFFA 3IIVA 2E09A 4C6DA 4APNA 1A3XA 4H9XA 3DG6A 4US5A 3TQPA 1XYMA 4GIRA 4GA8A 1J12A 5E09A 2PDUA 3CV6A 3TXVA 7TAAA 1UZDA 4R9OA 7ODCA 2NLIA 3GVVA 4GZIA 1N63C 5FEZA 1IEVA 4R85A 1K9DA 2A4AA 1GRFA 2UY3A 3UCCA 4AYGA 2PLKA 5HNUA 2C19A 2BGSA 1W3LA 4C5YA 2QCDA 4JDRA 2OXNA 3GO2A 2WMJA 1M04A 3ITXA 1S2AA 3SGGA 4IGNA 2VX4A 5D05A 1VEPA 1JPIA 2BX7A 5FA5A 3LSBA 8RUCA 2PS2A 2QGYA 1N55A 3AMZA 2MUCA 1T96A 1HJXA 1R3WA 3VC5A 3N6QA 5M17A 4AYSA 2Q8ZA 4X60A 3T40A 3WENA 1F07A 3WO8A 3KS5A 2CBVA 5MF5A 2BV9A 3N3TA 2GGEA 3N25A 3O07A 1RV8A 1SM9A 2C7FA 3WYZA 3URNA 1GOKA 3E2SA 1WDWA 4FP1A 4QISA 5BMWA 1W1ZA 1RZMA 4OECA 4GCAA 3DKLA 1H41A 1MOKA 1P6WA 2RUSA 4JTIA 2AQOA 5A6JA 2BY1A 3IIOA 3EDJA 4GC4A 4Y96A 1G94A 1QR7A 1UMYA 1W91A 5AC7A 1F76A 1BVNP 1RBLA 3M6YA 4JYFA 1XRFA 1DXFA 3HGSA 3UWUA 3CIVA 2PRHA 3DGHA 1SJAA 5D33A 2DEPA 2PDCA 1VKFA 2PTYA 5U7SA 2ATSA 2VJXA 4GNJA 3XINA 1AJ2A 4JTFA 1S2CA 5JCMA 4F3HA 2PCQA 3U48A 1KBIA 2DT1A 4K7YA 3IV8A 4XAPA 6CGTA 2G4JA 1TPUA 1DV7A 3T6CA 2UBPC 1LRQA 1NH6A 3SJ3A 3NPUA 1HUVA 3VXGA 2XVKA 3S2CA 4ADTA 1BRLB 1FWSA 1JRPA 1QPRA 3B9OA 4AD1A 3MBFA 2V2HA 3WLMA 4IT1A 1Q2RA 1QWKA 2DVXA 1KFWA 1W3IA 1ADSA 3SUWA 1CGWA 1D2KA 1BKHA 4W7WA 5BROA 1MRQA 4B3KA 3STCA 1W17A 3BTNA 1IEWA 1NAL1 3WQVA 2ZZ0A 3GXDA 2YPIA 3HM7A 2XUCA 3GIQA 4J5NA 3VZXA 3WQFA 2XVPA 5C2GA 2OX4A 2CBIA 2YCJA 3EX3A 5AC8A 4PUEA 4LALA 3RM4A 2CLIA 1F3WA 1NARA 5GVJA 2PC4A 4FNPA 5D09A 2REQA 5F2LA 1DQWA 1J93A 3VILA 3TIMA 2FJUB 1G69A 3TTOA 3UCDA 1X8CA 3CZ8A 4UTJA 2QHAA 2ZZ2A 4DBSA 1Y0EA 2V5LA 4QXIA 3VINA 3URQA 1NJJA 4ECLA 1TRDA 2BXZA 1EJXC 5FF7A 4V28A 4FAMA 1X97A 4WX2A 2QPSA 3CV1A 2BFGA 2FVKA 2YVFA 1PCWA 1O5QA 1XKJA 1O60A 2ZWZA 4PE8A 1DTNA 4HQVA 4RLIA 4EM4A 3KCLA 3H7VA 3LPFA 2DQXA 1TO3A 2YR1A 4WD0A 4I5UA 3K4DA 3PR2A 1CZ1A 4US5D 3QHOA 5U4NA 2W54A 1XC4A 1VD6A 5DCDA 3VM7A 2V3EA 4NNAA 1ZHAA 4MUZA 5KMYA 1W5QA 1DJGA 1O66A 4ALDA 1OZQA 2VENA 3DFTA 2EHHA 2V82A 2WKJA 4LWWA 2E1WA 3NZQA 4J3SA 4IMEA 3H2EA 3PG8A 2ISFA 1ONFA 3GY1A 2Q8XA 3W72A 1K4HA 1JL8A 3PJTA 3DJGX 4I9AA 2J13A 3LY0A 1UMLA 3OB8A 3GNPA 2DIEA 3MA8A 3WK3A 5M03A 1ZAIA 3OPSA 3CGDA 3MQTA 3SCRA 4UR9A 3A22A 2BHZA 3SAZA 3UERA 2HISA 5HMEA 2GGHA 3LUTA 4CNUA 2ZX9A 1TR1A 1V03A 3WF3A 2A3BA 4Q8UA 4ZXLA 5HQLA 4QSHA 3UZ5A 2HWGA 2HTMA 1UUQA 3SY5A 3LDVA 2E9LA 4NIRA 3W6YA 1WXYA 3PAJA 2W66A 4DQWA 3NXLA 4R7WA 4MGGA 1EBHA 3TW9A 3NJ3A 4FXRA 2PSNA 2ALDA 5KZ6A 1I0DA 4TX9A 1VRDA 4HNTA 1FH9A 3MYPA 1CX9A 4OKDA 3HJZA 1EJSC 1X6LA 3C2YA 4CNOA 4PUNA 3CHEA 1E73M 1A5NC 3NG3A 4X63A 3M5ZA 1QJWA 1VIWA 3S6DA 2I57A 1C7TA 2DJLA 3QRHA 3LHUA 2OVLA 3UNDA 4OWGA 3GC2A 1H63A 3N9SA 4Y9AA 2V30A 1PBGA 4V1YA 5K3VA 3Q65A 4JN8A 2DIKA 3O05A 3OVPA 3MHFA 1H7WA 4IIBA 3WLHA 5JIWA 1KFLA 3IACA 2RGLA 1CB2A 2VX5A 5I3HA 1QPOA 2Z1VA 2C3CA 1XI3A 2NVKX 3W0KA 3RILA 3NVYB 1E70M 2HXTA 3W6LA 3SQLA 2Z29A 4BK9A 1FOBA 4K8GA 4LUSA 2YX0A 1Z8AA 1RJQA 5ABFB 3DFPA 4OE7A 4HZMA 1W1B1 5EBKA 2GQ8A 3AS1A 2F6XA 3ZVIA 4UTTC 2H3BA 1EPXA 5A94A 3UWYA 3U0HA 3ARPA 4A05A 3HGRA 4FA3A 3OC4A 1MUMA 3BG3A 3G0UA 1J10A 3OLEA 4IPPA 6TIMA 4RE2A 4MAZA 2VR4A 5I3FA 4HBKA 4KPLA 1XLGA 4ZO7A 4DZIA 2PBGA 4CN6A 4F9DA 1GEUA 4EF9A 4JIPA 3H2CA 1RPXA 2VZOA 4S3BA 2OOGA 3L8KA 4A3RA 3PZOA 1O95A 4PULA 4ZO9A 2XIMA 3G18A 4E38A 2X1UA 4V33A 1UJQA 5HATA 4XZIA 3FX4A 3GW0A 3BLKA 2LLEA 2AGTA 4M24A 2E6AA 4RZBA 4JICA 1FXPA 1CT5A 4NU7A 1L0PA 5FMHA 1PEZA 3FGCA 1WBHA 2ZZCA 4IP5A 3WLIA 4TIMA 1Z7AA 3EXRA 1W9VA 5FL0A 1J0KA 1J6PA 2ICSA 4H83A 3B0UX 2Q6ZA 5LNWA 4JTCA 1GOWA 3EX2A 4H8UA 2J9XA 5CPNA 4YTQA 1WX0A 3SN0A 1R3RA 4YCPA 3KVJA 1W9DM 3AHZA 2WVVB 2J24A 1V7YA 4MYAA 1EDGA 4MB1A 4NVTA 4RXGA 2GQ3A 3PUEA 2WV8A 1IYXA 1FWAC 1BWLA 3TFXA 3FCPA 2OODA 4D71A 5HDRA 5LZLA 2PRLA 4A3UA 1QI2A 5FF2A 1SW0A 3ABOA 3PTQA 4HU4A 4UTLA 2A2IA 1Q63A 3FDKA 3E0LA 3PTKA 2HROA 1ZBCA 4GYPC 3LCLA 4NZCA 1QI3A 2ZXDA 1ONRA 2YCLA 4Q4PA 1OX4A 1KCZA 1S5MA 5FEPA 1OFAA 1KM5A 4JDYA 3S5YA 3DFOA 1U33A 4ERAA 2TODA 4XK2A 3QXBA 2QJGA 3WMBA 1OC5A 3DG7A 2RGMA 3CO4A 3PZVA 1GKPA 2C79A 4J3VA 4LPCA 3BGGA 3FOKA 4AQLA 4DJEA 3G2GA 3GD3A 4G7EB 4NX0A 2CITA 3ES7A 2V63A 3E02A 4Q3MA 5CG7A 2A6NA 1OFEA 2ISWA 3GKFA 4AY8A 1T41A 4PUJA 3BG9A 3UCQA 4QJ3B 3IJQA 2X0SA 4OBRA 3JW7A 4DBDA 2XFRA 3BJSA 5FJRA 4ZB2A 2W3ZA 1Y65A 3RHGA 3T4CA 4IFRA 3GTIA 3TXZA 2EGZA 5AZ1A 5C9WA 2QDDA 3KLLA 3NVZB 2C0HA 4O1DA 4ORIA 2FHBA 3XIMA 5HNNA 3SO7A 5BCAA 5K7JA 4UTIA 1R7OA 1UKOA 4KWVA 3TKFA 3G22A 4ZB5A 2VDGA 1TJPA 4FF5A 3SZ8A 2J6XA 1JCXA 3N17A 1AQMA 4LVFA 3UZWA 5C9RA 4OT7A 4GRSA 5H91A 2YB1A 5A8GA 3V4BA 3UZXA 3HO8A 4YHEA 3CUZA 2C1GA 1JULA 1BSIA 2V3FA 2YL6A 3D9XA 2WC3A 3ITYA 3FVDA 2A79A 1FHUA 4U3CA 3VZYA 1V3LA 4DLFA 2WNWA 3L9CA 1GETA 3O3RA 1DWFM 1DIOA 1B3YA 1UPMB 1D3GA 3W1PA 3AUJA 3UWWA 5T9CE 1FH7A 4E2OA 3D47A 1N2VA 1FO4A 4NHVA 4J3ZA 3T0BA 1WPCA 3PJUA 3THQA 1I45A 2D69A 1GG1A 3SFKA 3LX9A 1VFFA 4KH2A 1FRBA 3CUXA 4N02A 1RAKA 1BXBA 3TJXA 5HMSA 2BASA 3CASA 2CZ5A 2D3LA 4ATLA 2X1RA 1H7NA 2XIQA 4JQ4A 3W25A 2EPLX 1ADOA 2NQZA 1DQXA 5A5WA 3U57A 2CNCA 4WSHA 4RX0A 3UR7A 4GQBA 4L5ZA 3URBA 3UWQA 5I23A 3TFCA 3UZYA 3U8GA 4C6IA 4E8CA 2QNEA 5CAHA 1YPIA 3LHTA 2O7QA 1XP3A 2ZDSA 1XQKA 2VX7A 1ZX9A 1G4SA 3AXKA 3RCMA 4C7FA 1B2YA 4D8LA 3TTYA 3F7JA 3UVIA 4C6FA 4LB3A 1FP9A 4BKNA 5F1VA 3LNMA 4NF7A 4TR9A 2VVNA 1GYLA 4DUXA 2O9TA 3FLUA 5DO8A 4EWJA 3IEBA 3KVKA 3NQVA 2PWGA 4KFOA 5A6SA 2QZRA 4FZIA 3VIJA 1O1ZA 2ZKMX 1GG0A 3A4JA 1AVAA 5BU9A 3WH8A 1MNZA 3IWPA 1W3TA 4AIOA 5HULA 1FFVC 4MHBA 2X40A 1DXIA 4M56A 3CGBA 3N3MA 1WXJA 1KW1A 4Y7EA 5HOSA 4WF7A 3VIKA 1Z44A 1L6FA 2W27A 4AFYA 4TMCA 1XDJA 2CLLA 3UNTA 5LXXA 1GRAA 2E3ZA 4I6VA 3A47A 2DZAA 1Q6RA 1GRGA 2PLMA 4B15A 3O6CA 3VMPA 3TLQA 2X7WA 1I75A 4NXSA 4WOZA 3OLGA 1UA7A 3PULA 4HZ7A 3U2CA 1JI2A 1EEXA 1XPYA 5HUPA 3M41A 1IIHA 3ZJKA 3W2LA 2WMGA 4RNJA 4A3YA 2BY0A 4IIEA 1LRNA 2PDBA 2V2DA 1LWIA 5ABHA 2PDMA 3OBKA 1H0GA 3LBOA 3A13A 3S2MA 3WG6A 1EBGA 1TJ0A 3CB3A 4JX5A 2DSVA 1KKRA 2WW5A 3EEZA 4H2CA 3ITLA 3QW3A 2X1TA 1CLVA 3B8WA 3DGBA 2IPWA 4J3TA 1WZAA 4Z1AA 4QDMA 2JF6A 3S1UA 3HPXA 4DJED 1D7FA 1V3IA 2VR5A 3VNIA 3W7PA 4FPSA 4HOWA 4HMEA 3VDCA 3WEOA 3E12A 1UKPA 4LVDA 2HRWA 3QVQA 5CPLA 3WBXA 3QLLA 1LQ2A 3RJYA 4WDWA 3GXFA 1HKJA 3W23A 2WJFA 2Y7FA 1J0IA 3I6RA 3LU2A 3H22A 1I1XA 3IUHA 2W3SA 3UZJA 2HS6A 3NVVB 4QEHA 4F0RA 1S3TC 3F4DA 5A6KA 4RDWA 4EVZA 1SVDA 3PPHA 4C6OA 3NOEA 2XVGA 1W9UA 4GUJA 4H6QA 1RD5A 4P7LA 3GYCA 4MDPA 3PJXA 3L4VA 1EQCA 3RU8X 5IFTA 1P4CA 3EOLA 4N9DA 5DMYA 1NY1A 3VCRA 1XYFA 5HQEA 3BXWA 1BYAA 2VC7A 1RJRA 3GFYA 3T42A 3ONBA 3BANA 4TX6A 2RDUA 4L7ZA 2WZMA 1M65A 5TR3A 4MNJA 3QHMA 4POCA 4PMRA 3PZNA 5LIKX 2WBGA 2ZZBA 4K2SA 3QV6A 4XX6A 2CKSA 2VDHA 2NSXA 3ITGA 3GHSA 5CPTA 4Z2GA 4QEEA 4M51A 3UPWA 2C3ZA 4H4IA 4IPNB 4UFMA 2YXGA 3HFYA 3VFLA 4HNUA 4GZ7A 3VX0A 4MLJA 2BY3A 5I3GA 4UNIA 4H7VA 5CBBA 1Z32X 3I3EA 3O06A 4RNIA 7PTDA 3VO0A 1EF3A 2Z4GA 3G1XA 3L7RA 1AMKA 2JBMA 5HQMA 3SSZA 4LBRA 2QDHA 2IUZA 2NVAA 4FR6A 1L6SA 4YVPA 3D3FA 1E71M 2FZ9A 4ILSA 1KC7A 3UXKA 2E77A 3GXPA 4XKYB 5BRPA 4MM1A 1DL3A 4JCLA 4DXXA 4BQ4A 3ZJ8A 1IR2A 2EF9A 3TYZA 4O13A 5LIYX 4MKSA 3WJZA 3DHUA 4Z1BA 1TIMA 1STZA 3M47A 2OU4A 3BOFA 2PDNA 1NWUA 2AMXA 5FD0A 3MUIA 2R1KA 3HTWA 1IXPA 2VEGA 1G4PA 4AVOA 2IXVA 1V3KA 1XX1A 3M43A 4D8ZA 1MEHA 1KV5A 3DN5A 3VX1A 4CD4A 2HNEA 4KBXA 2W63A 4XISA 1TWSA 3UZZA 4JPGA 2DZBA 2IXUA 4J3XA 5CZTA 4J35A 2YAUA 2EQ7A 1QK0A 1Q66A 4O1CA 3BAKA 2H6RA 1L9WA 5TAOA 1TTIA 3T09A 1LJYA 3NEVA 2Q09A 5JUVA 1VPQA 4N2YA 5LXEA 2J7HA 2DT0A 1KR0A 1UG6A 1OC6A 2DZSA 3VKBA 1HL9A 3KVLA 1RA5A 1EJRC 1EXBA 4EMIA 7ENLA 3OOQA 1TE6A 3UXAA 1RY8A 4CCDA 1GCYA 2ZA1A 2P8BA 1KBJA 1WB0A 2GR0A 1M03A 4J4KA 1I2QA 1R7AA 2QJMA 4OHQA 1Z69A 2D0GA 3W76A 1TPH1 3ABQA 4IOTA 4DF2A 1ISWA 1EO7A 4LUIA 4K8HA 1X2HA 4AHOA 1SJDA 1CLKA 3VIIA 3B06A 3HRDC 4JOMA 1I2OA 3B0VC 4RE3A 4GNKB 4NRSA 3AIUA 1WKDA 5HAOA 3EWYA 1JZ3A 3U5UA 2BOGX 4PCTA 4QNWA 4CQ9A 1H1ZA 3UD6A 4ICCX 1I2NA 4JTLA 4DNAA 1Q4WA 3G3MA 3CZKA 4UMAA 1TTQA 3UP8A 3LV6A 3DI0A 3G6LA 1HIZA 1UR0A 3DGRA 1HGWA 4QE4A 3A4WA 3FY1A 1UR3M 3FJLA 3IRDA 4NILA 5HNTA 5GNYA 2Z6IA 1RP9A 7REQB 1GOQA 5GPRA 5D2TA 1C8XA 1V7AA 4EIVA 2GUBA 2GSHA 1HL2A 2E9BA 3PANA 3W7CA 1ZDLA 5CQ1A 1SMDA 2Y5JA 2C6QA 3LGEA 1OBAA 2VI0A 1M41A 2GFTA 4GBUA 1ISZA 1AZ2A 1Y5XA 1A0DA 3AHTA 2V38A 1QBAA 1BG9A 3GH5A 2W79A 4WK9A 3ZR5A 3QV9A 2ZZ1A 1WNOA 3CHFA 5CPOA 2YVGA 3L66A 1ZBVA 3L0KA 3WD3A 5H2ZA 3GXMA 1A80A 4N0RA 1NEYA 1A50A 2IKJA 1OYCA 1OABA 1TVNA 2A3HA 4Q8TA 3AS3A 3T07A 2PPGA 3VKAA 2VWTA 1UD4A 5CH9A 3PG6A 4L1XA 1F5ZA 2C14A 2AL2B 3WNMA 1KM6A 3C2FA 1XIJA 4PSPA 1JEHA 5A8OA 5MKGA 3V35A 4H8HA 1E6XM 3AMKA 4URIA 1HX0A 1FCVA 2HPIA 4FXJA 4Z42C 3HQPA 4ZXOA 1XCFA 2A85A 2CHOA 4BEUA 3WBWA 3NYZA 5BXRA 4UNLA 3NS1B 2H90A 1OGBA 3TSBA 1P6BA 3OIXA 5I3KA 4PTMA 1L2UA 3CK5A 3QY6A 3SCSA 5AYIA 3SCNA 2CLPA 4U10A 4TTUA 3VE9A 4AX6A 3PM6A 3MSDA 3AS0A 1E15A 2VEFA 2UY2A 2GR3A 3NL5A 3EWWA 3N2MA 3WUFA 4GVFA 3TMLA 5KZDA 4Q8PA 1DWGM 4MFEA 2ATMA 4YJ5A 3Q37A 4Z0SA 4HPGA 2XINA 6REQB 1QK2A 4NAEB 2B7PA 4MSSA 3NEHA 3T1GA 4YMZA 5FS7A 1XLLA 4IJBA 5CJMA 3MB9A 1KXTA 3GUGA 4Y9PA 1QRQA 3MUCA 4AEFA 1TR9A 4EQXA 2PDKA 1F3PA 2CYGA 2GGIA 4PTWA 4IQDA 2NX9A 3MSGA 5JIPA 4MJMA 3OP2A 3GRIA 2PRMA 4ADSA 3AXMA 3WLNA 1H50A 2PGRA 1EYEA 3ZVHB 4UCGA 2GJRA 3R8HA 3BLPX 1EA9C 4M5PA 1X96A 3KFTA 3OHMB 3AYTA 2OLHA 1DJQA 4D1IA 4L4LA 1U1JA 2WBAA 3DJJA 3BARA 1I2RA 3TC7A 4GI8A 2Q01A 4R9XA 1P5BA 1XLBA 3IAPA 4F0KA 4B5SA 1MYRA 4AZHA 4JKMA 4JIIX 2ONEA 1EOMA 3O8AA 2YIHA 4P5UA 4GIYA 3GG8A 2ZA3A 3I7SA 2JKPA 5T8GA 3PFRA 1B1YA 5CGMA 4LUTA 2W61A 4LAMA 4FIRA 2Y88A 5G5HB 4DWSC 2ZUTA 2V6OA 4HMDA 4HT3A 3KBJA 3CH9A 1YADA 2ZZ3A 4J9JA 3GSMA 5HJXA 3IGUA 5CSRA 1BKSA 3FFSA 4YTRA 2DPEA 4LYQA 3XISA 1AOGA 1FFRA 3M0HA 4CQBA 1CGTA 1T99A 1ZL1A 2G3FA 3GW3A 4IFKB 3EEGA 1CNVA 4YYFA 2EPNA 2IW0A 3KBSA 3LNPA 4C1NB 2D2HA 4C1LA 4GKTA 3ZM8A 1NHQA 1FCUA 3TYBA 1VBHA 4WKHA 4H01A 1ISYA 4F79A 1VYPX 2E5BA 3IJDA 4I7WA 1GJPA 2HK1A 1JYWA 1RY0A 1BQCA 4A8LA 4LTSA 2VCAA 3NVDA 2VFIA 4J1OA 5CEWA 3AROA 3I4EA 3RF9A 3FEQA 2OO0A 1WDDA 2ZTJA 4E6MA 4G1NA 4Y90A 3HOJA 1XLKA 3R94A 4AH7A 3LG3A 3VCCA 5LNRA 5LHEA 3D3AA 3L65A 4MNLA 2FVLA 3GFXA 3OVQA 3EMQA 3QHNA 3B0PA 4FX8A 3SIMA 3MP5A 3CGTA 5E0CA 1CENA 1GOIA 3BLLA 4GG9A 3WLOA 2VZSA 1KD0A 3P5ZA 2I9EA 3KOYA 4IG2B 1XR2A 1HF6A 2VEMA 5G4WA 2PZ0A 3KDOA 2YA0A 1FKXA 3GR7A 5LNVA 3HGOA 4GOAA 2X09A 1ENUA 4A8NA 3REQB 5ABGA 3N2OA 3OEXA 1BQGA 1G9HA 2GVJA 1LUCB 4IP4A 1DE6A 4C6CA 1QHPA 3WMSA 2ZTKA 4B16A 4UTFA 1Q8JA 1UB3A 2OFJA 4AY1A 3RXZA 1THFD 3EAOA 1V0LA 4ZODA 2POTA 4O28A 3CWNA 2B81A 1TTJA 3MBDA 4HJFA 1NDZA 4IJCA 4GUIA 1MQRA 2GQAA 4EX4A 2QMJA 2BC0A 2BSLA 3BCFA 2XM2A 1GW1A 1UD2A 3DYPA 3GNOA 3WLPA 5IRPA 8CGTA 2OX1A 3ATZA 4AVNA 1UPPA 3WMLA 1B30A 3TC6A 3MKVA 2PTZA 5I02A 4MWAD 4C6BA 5LIWX 4XD6A 1FX6A 3BW3A 4GFSA 3CV2A 4XD4A 5L9FA 1VENA 4L4MA 4NKCA 5GJPA 4DELA 2VRKA 3FK4A 1GORA 2J9ZA 1XINA 1NOUA 1PXGA 1DKWA 1YXYA 1TCMA 4Q4RA 4YWIA 1R46A 4ZQMA 2PA6A 3AO0A 3OLDA 4DB7A 2CWNA 1R8LA 1O6IA 2OZ0A 3I10A 2H9AB 1E43A 2OMAA 4JTKA 1E6QM 4MB5A 1TWDA 3L5MA 4FO4A 2X16A 4R7OA 2VEIA 4OVXA 1YHTA 1FTXA 5F7UA 4WDXA 3GRTA 3W01A 3MP4A 2QDEA 2Z0IA 2GR2A 2VTFA 2OQHA 3UY7A 4M19A 3S2NA 3EF6A 1ODUA 5GJMA 5I3DA 3LI0A 3KTSA 1GQIA 4XTIA 2PDLA 1VEOA 4KQNA 1LBFA 1UCWA 1Q7MA 3R10A 1LL4A 3BMWA 1K4GA 4OFCA 3GG7A 3PBMA 1EGZA 9RUBA 1Y5VA 3LI1A 1NDYA 4JR5A 2IQ0A 4IJRA 8XIMA 1N8WA 1JXJA 5SWUA 3KL0A 3NA8A 1YE4A 3DK4A 4WR3A 3T7VA 1SUXA 3UR5A 4A6GA 3S4TA 3E0IA 3P74A 3G5EA 4AMCA 2PBOA 1W3NA 1JR1A 4O14A