4HCLA

Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium and l-lyxarohydroxamate
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
384
structure length
384
Chain Sequence
SHMIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Isomerase/lactonizing enzyme
publication title CRYSTAL STRUCTURE OF D-GLUCARATE DEHYDRATASE FROM AGROBACTERIUM TUMEFACIENS complexed with magnesium and L-Lyxarohydroxamate
rcsb
source organism Agrobacterium tumefaciens
total genus 139
structure length 384
sequence length 384
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hclA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hclA01
3U9IA 3R0UA 4IP4A 1MUCA 4H1ZA 2P3ZA 1OEPA 3OTRA 3VC5A 2POZA 3SSZA 3V5CA 3UCCA 3R11A 2QJNA 4GMEA 3UGVA 3SN4A 3ZLGA 7ENLA 3ZVHA 1SJBA 4E5TA 1JCTA 4HCDA 2GGGA 4KEMA 5FJTA 3N6JA 3QN3A 3IJQA 3IK4A 3TWBA 3CXOA 3STPA 2ZC8A 3TCSA 3UJFA 1F9CA 3HPFA 4HNCA 2MNRA 3V4BA 3ZVHB 2HXTA 3R1ZA 3EKGA 1P43A 4X2PA 2OZ8A 2XH0A 2OG9A 2OLAA 2PU0A 4GISA 2OO6A 3UJ2A 1XPYA 2XGZA 4HN8A 2PODA 3OP2A 3N6HA 4HPNA 1YEYA 3RCYA 4A3RA 4JHMA 2HZGA 3DDMA 2OX4A 4F4RA 3NFUA 3BOXA 1WUFA 3P3BA 1ELSA 4IP5A 3GD6A 3SJNA 2P0IA 4HYRA 2PGWA 2OZTA 3P0WA 3T8QA 5ENLA 6ENLA 4Z1YA 2PTXA 2AKZA 3Q4DA 2GGIA 2PTZA 4H83A 1NELA 4GGBA 1MDRA 3SN1A 1KD0A 1TZZA 3MY9A 2P8BA 4GIRA 3H7VA 3R25A 4IT1A 1EBGA 2HXUA 2AKMA 2QVHA 2OVLA 3JVAA 5FJPA 3TTEA 4DHGA 4M6UA 3TW9A 3DG3A 3EEZA 4HNLA 2PMQA 2QDEA 4E4FA 4ZA0A 3S5SA 3D46A 2PTYA 4JN7A 3BJSA 3N4FA 3VCNA 3MKCA 3I4KA 2PU1A 3TQPA 1JPDX 3PK7A 4EWJA 4GYPA 1ECQA 1KKRA 2PPGA 3JZUA 2DW6A 3RRAA 1KCZA 3TJIA 3THUA 1FHVA 3RGTA 3MWCA 5FJUA 3FXGA 4A35A 5EU9A 3VC6A 4K8GA 2QQ6A 1PDYA 3V5FA 2P8CA 1KKOA 4DN1A 4GGHA 4K2SA 5J04A 2XSXA 1DTNA 2XH7A 4HCHA 2OKTA 1XS2A 3T4WA 2ONEA 3ES7A 3GC2A 4Z17A 3SBFA 3MQTA 2O56A 4IHCA 3TWAA 2PGEA 3R10A 3UXLA 3H70A 2XH2A 3U4FA 3UJSA 1BQGA 1W6TA 3FVDA 2PP3A 3D47A 1RVKA 3H12A 3QPEA 1EC9A 1P48A 3VCCA 3ZLHA 4DX3A 4G8TA 5IDZA 2PP1A 2QJJA 3UJRA 2GGEA 2ZADA 2QDDA 3Q45A 3JW7A 3TOYA 4DYEA 1JDFA 5BOFA 4K1WA 3QLDA 2OQHA 2FKPA 4A6GA 1TKKA 3FCPA 2PA6A 4M0XA 1SJDA 2AL1A 1EC8A 2PCEA 4JN8A 3QKEA 2OFJA 2NQLA 1PDZA 1BKHA 3B97A 3N4EA 4DXKA 2OPJA 4IL2A 1EBHA 3V3WA 3R0KA 4ROPA 1R6WA 1TE6A 4MGGA 3RO6A 2PS2A 3MUCA 3I6EA 2GDQA 4E8GA 3NO1A 4KPLA 2AL2A 1SJCA 3RR1A 4H2HA 3DERA 3NXLA 5BOEA 3S47A 3PWIA 3DFYA 2OQYA 2GGHA 3I6TA 2QGYA 3T9PA 2AL2B 1IYXA 3DESA 3VA8A 3OZYA 3DEQA 1R0MA 3CT2A 5FJRA 3VFCA 4DWDA 3PWGA 1FHUA 1WUEA 4HCLA 3PFRA 1MDLA 2DW7A 3ES8A 4MKSA 4GYPC 4ZCWA 3OW1A 3DG6A 3IJLA 4IZGA 4H19A 1MNSA 2CHRA 4KT2A 3CB3A 3DFHA 3K1GA 3QTPA 4KWSA 1SJAA 3SN0A 3H8AA 3ZVIA 2I5QA 3CK5A 3VDGA 3KUMA 4YWSA 2PTWA 3OPSA 2FYMA 3OZMA 1ONEA 3RITA 3FV9A 1EC7A 3MSYA 4MMWA 3ZLFA 1E9IA 3P93A 1JPMA 4E4UA 3UXKA 3CYJA 3IJIA 3ENLA 3FJ4A 2XH4A 2HNEA 1MRAA 5FJOA 2GGJA 3CAWA 3DG7A 4GFIA 3SQSA 3FYYA 4ENLA 4E6MA 2PSNA 2PP0A 2P88A 4G7FA 3DIPA 4IL0A 4J1OA 3UCDA 3TJ4A 3MZNA 2QJMA 3DGBA 2OZ3A 2GSHA 1L8PA 2MUCA 3GO2A 4FI4A 3BSMA 3GY1A 1NU5A 4J3ZA 3UJEA 3NZGA 4FP1A 3T6CA 2RDXA 2GL5A
chains in the Genus database with same CATH superfamily
4UR8A 3DZ1A 4G5DA 3MP5A 4M5PA 2QS8A 3SSZA 1Y5WA 3M0MA 4CU8A 2PRMA 1Q6GA 1MVYA 1L2QA 3PUDA 3V0UA 3LTSA 1SMAA 4GE8A 3P62A 5LXXA 4MNJA 1Q8JA 2PBGA 3VD7A 1IEQA 1O66A 3STPA 2WK2A 3UGRA 4WQ6A 1F9CA 1Y5XA 1A47A 1U2YA 3N2TA 3M1ZA 3V4BA 1K8ZA 2EXOA 2Y6ZA 4Z1CA 1RM6B 5CSRA 2YDAA 4BURA 2EO7A 1TTJA 3AISA 4ZQNA 3EKGA 5B7YA 2HROA 3CZEA 1JCJA 3W7MA 2KX9A 1UA3A 1K9DA 4UQAA 4AVNA 2VP8A 2JK2A 3T55A 2W63A 4RX0A 4HN8A 5CBBA 1E9ZB 1FVPA 3TU9A 3WNMA 1B3YA 3SCOA 3LPOA 3BWWA 1UMYA 3DN5A 1TTIA 1BG9A 3TC6A 1XI3A 2A6NA 1QU4A 1YW1A 4L9XA 3FGCB 5U1OA 2PTXA 1CI1A 5U7SA 3WEMA 1RCXB 3LTYA 1J93A 4HPXA 1WYGA 1RP8A 4W5UA 3CUZA 2YL6A 2WHMA 4JNYA 3FX4A 5LA0A 3RCNA 4ZFMA 2JF6A 3DH7A 1JZ5A 5BWFA 4Y9NA 4KFOA 1AH4A 1QRQA 4HJWA 1HP5A 3OODA 2Z1KA 2VEFA 5BRBA 2WB5A 4JAWA 4CD6A 5CC3A 1KGWA 4UCGA 1OX6A 1RVGA 2RDWA 2E8ZA 4YHGA 4BV6A 3TW9A 4PB5A 3LM3A 2J62A 4IXHA 3S46A 1MWOA 3OLGA 5HQMA 3EEZA 5D9OA 1KN0A 4QG8A 3U7BA 3DBNA 1F3WA 2EKCA 4KCVA 1FCVA 3I3DA 4ROQA 3F5LA 4AZCA 1KM3A 2BY3A 4KKXA 5H6HA 4XV0A 3N2XA 2VVSA 1W3JA 4HNUA 1G1YA 1QWGA 3WD4A 4GZIA 4JFUA 1PO9A 3VKJA 3WF0A 1VEOA 1W5OA 3WJZA 2OX1A 3OC4A 3D9XA 2AGTA 5BW6A 2OGJA 3ABSA 1MW0A 3HN3A 3MYPA 3I6RA 4XIMA 4GJ1A 3EWXA 4OBSA 1QATA 4XTDA 4YVPA 4HCHA 4A29A 1WCGA 2PDKA 3T4CA 1B3WA 2ONEA 4Z17A 3UP8A 3QR3A 1KTBA 6A3HA 2CZDA 5A95A 1RCQA 1SU5A 2OTDA 2ZZ0A 3W7LA 2VRKA 4PCFA 1Z48A 3VD5A 4FX6M 2YBTA 3C2OA 3KVJA 1XLJA 1Q2RA 3GTNA 3U4AA 4NJGA 4H7VA 4ZB5A 4M52A 1KFJA 3MW7A 4IWWA 1US3A 1W91A 1X7IA 4QLJA 4MAZA 3TSDA 3XISA 2Z2BA 4IQDA 4MB4A 1J8VA 3DHPA 5GJNA 3CGEA 1YXCA 2DUAA 2BOGX 3QV6A 3UZWA 4P7QA 3THDA 3ONBA 5G1MA 4WGXA 5AN7A 2GR2A 2HS6A 4HZ8A 3VIPA 2C71A 4XBKA 3TTOA 1OFBA 1JF5A 3O15A 3CGBA 2G41A 3D0CA 3P5YA 2QZRA 3F4VA 5C7HA 4F8XA 2J47A 5C71A 1HG3A 2HE8A 3VIFA 4S3JA 1RQBA 1F5ZA 1U5VA 5EMMA 3TUUA 1VEPA 2X2GA 1UG6A 2XVLA 4TR9A 2BGQA 5CLTA 3W7CA 2ZTJA 1UWSA 1ISZA 3W29A 4I8YA 3MP3A 3W7HA 3MANA 4B5TA 3EXSA 4AC7C 4Z2JA 2WO5A 3WLKX 1YPXA 3U2OA 3JS3A 4OOUA 4YTTA 1EOMA 5I77A 1JG9A 2W6RA 4UTWA 4R9OA 4QSFA 2ZDSA 3W28A 1UH3A 4C5YA 4IZGA 1ZRQA 2V3GA 4O15A 4OHQA 3LQLA 3LHWA 2DZBA 2CFYA 3K1GA 2QMJA 1NJJA 4ZZ9A 3PUEA 3W1RA 2I5QA 3I3EA 1SR0A 4G2DA 2WNWA 4AHPA 1R7OA 1V0NA 3GHTA 2ODOA 5AYYA 1XHGA 4L64A 1B9ZA 4JQ2A 3K4WA 2NXIA 3MVTA 4EWND 4N6EA 3LCXA 1OBAA 4MB1A 2A3HA 3TQKA 3CYJA 2OLSA 4OT7A 3FKRA 3UETA 3BXWA 3EX2A 3BTNA 2C3CA 3WDPP 1PTDA 4IQJA 4QLKA 3GQYA 3N4AA 1VD6A 2VCBA 4Q6JA 3L4VA 2PP0A 7REQB 3R8GA 1XD0A 4Q8PA 1GK8A 3THQA 1S5NA 3H2MA 3GU9A 3K46A 2DEPA 1EB3A 3PVFA 4K7VA 4D6CA 2QCFA 4O1BA 5D8ZA 4M29A 3DK4A 3GO2A 1U5JA 1W5NA 5T8GA 2YLAA 3P6LA 3KOFA 3W4RA 3NO3A 2GL5A 4TTGA 5AKQA 5GJPA 4W9TA 1Q85A 3VC5A 3SUVA 3R11A 1GVQA 5I06A 3V0SA 5E0KA 3PNZA 4Z0JA 4RR4A 3GNPA 2UY5A 4C1LA 3S5NA 4LUTA 2V3FA 3EEGA 1AZ1A 4HCDA 3P2VA 1W5QA 5FJTA 2OEKA 4LFYA 3QN3A 3VKDA 3CAVA 3TWBA 1SSGA 1M3UA 5HULA 1GQKA 3PPFA 3RX4A 3TCSA 4HOWA 4ILSA 4ATWA 2RABA 3EF6A 4BQ4A 1NWSA 3PBWA 1D7YA 4AHQA 3PANA 3AIUA 3VNYA 3RYSA 5TR3A 3W7IA 2QJHA 3AS0A 1EGMA 4MLJA 1OJXA 3FJ6A 2BWGA 5D2XA 1N8IA 4DPPA 2XGZA 4UTWC 2FH8A 1N8FA 3KXQA 2Z1VA 1RD5A 1WDQA 4GY7A 3ORWA 4HJFA 3RILA 1H2JA 4FXFA 1K03A 3WQGA 1UWRA 1OFEA 4H8HA 4AVOA 4FAMA 1DXEA 5JXQA 4JYFA 2INFA 3G77A 1XH0A 2C0HA 1VFHA 5LIYX 3N9KA 5ENLA 5IHSA 2XHYA 5B80A 4RNFA 3HMCA 4H8NA 1GYMA 1KRCC 5C9UA 2A2IA 3CUIA 2NSOA 4U2ZA 5FEXA 4BJHA 4ZE4A 3NQBA 2OMAA 3QEZA 2SFPA 2NXGA 5E0FA 2JALA 3LY0A 1UH2A 3EA1A 3IV3A 2ZA1A 2IPWA 4D1IA 1FH8A 2YFNA 3EWBX 1UC4A 3B0PA 4I5UA 3V35A 4GI6A 3CZ8A 2Z2AA 1EF3A 3PTDA 4QCFA 3HGJA 4UCFA 1E70M 2OGYA 6CGTA 3QQWA 3UWVA 5KEZA 1PZ1A 1GKRA 4O1EA 1HTIA 3H26A 2AGKA 3T0AA 2XVPA 4NNBA 3M9YA 3WNPA 3L68A 4Q4PA 3MDUA 1Q65A 2E68A 3VABA 2WMIA 4PE8A 3ZJ7A 1EQPA 4L5ZA 1A3HA 4A35A 1VR6A 3DHUA 2VEIA 3M41A 4QTGA 3VDAA 1MZHA 2ACQA 1VCFA 2D24A 2J13A 3PHAA 3W74A 1O60A 4AVFA 3M47A 4WKAA 2BGSA 4QRNA 2E0PA 4NRRA 1DNCA 1ICSA 1LZOA 1FFUC 1NAL1 1JZ4A 4U3AA 2J27A 3TAKA 1AD4A 1HGWA 1RCOB 2ZVRA 5FIPA 2GK1B 1PTGA 3SBFA 3MSGA 2X05A 2INZA 1W31A 4IHCA 3W7OA 3BVJA 3UT0A 4QITA 4Y8EA 4DM2A 1GOIA 3AICA 2D3NA 1O5QA 2GSJA 3G22A 5M03A 1BYDA 4AZBA 4H50A 1WKDA 3QPEA 1WXYA 3SRHA 1XIEA 1AZ2A 4I9AA 3GVQA 2FPYA 4DX3A 3APTA 4Z08A 3V18A 3HGSA 3HO8A 2H8XA 1WZMA 1HN1A 1EF2A 3DCPA 3KZSA 4I6VA 4TXEA 2VWSA 5CCZA 4AYGA 3MB9A 4O16A 2C8NA 5KITA 4RJEA 4ES4A 3W75A 2OFJA 2WPBA 3MI2A 3EWZA 3CEPA 4RK8A 3CQHA 3OVQA 3IVTA 3GHSA 4NZ1A 3EGJA 4XVEA 3VOGA 3HGOA 3GVWA 4MWAB 4PMQA 1UWUA 1EUNA 4Q8MA 3S6TA 3LX9A 5JCMA 2J66A 1Q7MA 4M19A 3ANVA 4C6FA 4LPCA 1F8WA 2AOSA 2EPMX 3HFTA 4LAMA 4HKPA 4BF5A 1YX1A 3CV2A 1FWNA 3LDVA 1X6NA 2O0TA 3GIPA 4LRTA 1VHCA 4CD4A 5A69A 4DWSB 4WDTA 3Q65A 4QIUA 3MI6A 1EP2A 3AHZA 1DJWA 4BY3A 1GPWA 1TB3A 4WX2A 1CGWA 2G0WA 1ECEA 4JZ5A 5IXEA 4FOJA 3NAVA 1LG1A 3SGGA 1UP0A 2WNZA 5EFFA 4LAZA 5AYIA 4DY1A 2R24A 1FHUA 2D0HA 3PTQA 1W9VA 1JCLA 5B7ZA 9XIAA 3BO9A 1RK5A 2XFFA 4ZCWA 3T0CA 2J9ZA 1BWLA 1PWMA 1TREA 1TFVA 2D3LA 1AL7A 1E4IA 5HQLA 1H1ZA 3T0DA 1EKOA 3ARWA 3SEPA 4F2UA 1AMKA 4OBTA 3VDCA 1FWEC 1GTEA 4I9JA 4X60A 1OT2A 4IJBA 3EWWA 1KTNA 3IAQA 5CPNA 1TMQA 2VC9A 1OFRA 1B3OA 3OEXA 4RV8A 2A3CA 1FDZA 3R5EA 3LRLA 1LG2A 4UMCA 5XINA 1O12A 4LF2A 5LGZA 4O14A 1V6WA 3S3GA 4HPHA 4Z0SA 3AXIA 3DHFA 1WV2A 3URQA 2JGQA 3VM7A 3WJSA 4NY2A 3BK0A 1JD7A 2X1RA 4I90A 3FJ4A 2XH4A 3QMSA 3AAMA 1MXGA 6TAAA 2PWGA 2XPKA 1M1BA 3TC3A 3EB3A 1LWJA 4LUSA 1V02A 2VZSA 1VS1A 1HO4A 5DBUA 4JBRA 2CLKA 3SQSA 3R8HA 4E6MA 1ZKQA 2P88A 3MZ2A 4XBJA 3WZ0E 4CN1A 1X2GA 1HKMA 2JE8A 3NL6A 3NQ8A 3ZSSA 1PEZA 4M6PA 1KM1A 4WSHA 2J77A 3GX9A 3KL0A 1QNOA 2Y88A 2YA2A 4PSPA 3O06A 2Y5JA 2H8ZA 1J0ZA 3LADA 2YYUA 5BMWA 3W7GA 1K8CA 4Y9AA 1W5MA 3EXTA 2BY2A 3NDYA 4C6EA 5HMSA 2YCLA 3VDHA 4GPNA 5K7JA 1SJBA 4XO7A 2XIQA 3WQEA 3N19B 4PMUA 1I4NA 2V9DA 3HMJG 3USBA 3RIKA 2F61A 2NT0A 3LA4A 4W8LA 1HX0A 3N9RA 4XD5A 3ZVHB 4GQBA 3WUEA 1H7PA 4Z1BA 1OCBA 1ZJHA 2HXTA 1VCVA 3A23A 3SSJA 4M1RA 4FXRA 3SFWA 2DY3A 4XAGA 3SB0A 2W54A 3B03A 2E3TA 3U48A 3FNDA 1JYWA 3RPMA 2BX7A 2WSQA 1NFGA 3OP2A 3E0VA 4N4PA 1M41A 4NX0A 3QPYA 3UXIA 3EKLA 3F1QA 3TIMA 4P61A 1OINA 3SUUA 4Y7EA 3T05A 4HYRA 2OZTA 2Z6IA 3PB0A 1T99A 1X96A 3URNA 2E1DA 1P6BA 3GLCA 2X2YA 3M0YA 1WXJA 1TZ9A 5M5DA 1XW8A 2EHHA 3TR9A 4DI8A 2NQJA 1D7FA 2V63A 4GH3A 1FXPA 4CNSA 1CBGA 4FX9A 4JKLA 3ITVA 3WLTA 3TR2A 1CPUA 4KERA 4BR1A 4REQB 5AHEA 2WKGA 2GUBA 1VBHA 3G1SA 2YAUA 4MNKA 4DHGA 1LL4A 1ZS2A 1FWDC 3VX0A 3NSNA 4Q4MA 3MBDA 3TN3A 1CIUA 2J7HA 1TWSA 3VCNA 3CHDA 1IGSA 3QV7A 2FZ8A 2WOVA 3I4KA 3KHJA 1QO5A 2H6RA 1F4AA 3ALFA 1VB9A 3ARYA 1EJUC 1JPDX 2PPGA 3QYQA 2PDPA 3JZUA 2BZNA 1FWSA 3NNTA 3ALGA 2G97A 1WE5A 3BCFA 2ZICA 3RN6A 3RGTA 4PYSA 4HMCA 2YCEA 2X16A 5F7UA 2W61A 1ZB5A 1BTCA 4J56A 3MS8A 2WBKA 3G1DA 4FZIA 3O0FA 2EJ1A 4ZQMA 1P0EA 3LM7A 3FEMA 2V3EA 3S1XA 3NEHA 1JAEA 3NL3A 4FF5A 3NCOA 2ZXDA 4ZL1A 2FZNA 3CV7A 1UR2A 1JVNA 2GZXA 1JZ6A 1ZCOA 1TCMA 5AY7A 4IICA 3CQKA 1W6TA 3FVDA 1BHGA 2W91A 1NEYA 3ANUA 4W7WA 5FA5A 4IMDA 4IIBA 3C0JA 3T2QA 4WHBA 1F61A 3OVGA 3WYZA 3UD6A 3M7SA 4PEKA 5I07A 3KBJA 1OF8A 1FH7A 1I1XA 2E1WA 1Q6OA 4C5ZA 5EMYA 3UBPC 2OO0A 2FKPA 4G7EB 4O1AA 1NHQA 1V77A 2OYMA 1M53A 1EC8A 1Q6DA 1PB0A 3PM6A 1QPOA 1K4GA 1TELA 1GQIA 1HKVA 1DJQA 3RK8A 2H9AA 1J6OA 3MP4A 3WMSA 5K9CA 3ERPA 5FAJA 4AZHA 3T08A 1XX1A 2DFAA 3PZOA 2VFDA 1FH9A 2O4MA 4PUUA 4O1FA 3WQVA 3ZR4A 3W00A 1XGDA 1QI2A 2C13A 1FIQB 1ZP4A 1W2VA 3ZZ1A 3RXZA 4H9MA 4IQEA 4EMIA 5FI8A 4JHOA 3GG1A 1IXNA 4UUIA 2AL2A 3RR1A 4IPLA 4H2HA 4Q6XA 3DH9A 1SW0A 6REQB 4FOUA 3CWOX 4H4TA 3MI3A 3KP1A 3GD4A 3CUGA 1E1FA 1RPKA 3DFYA 3JRKA 3IEBA 4KESA 5FF7A 5HWJA 1XYAA 3QFEA 3T9PA 2FPTA 3VA8A 1E6NA 4I7UA 2OR2A 3KE0A 3PZQA 2E67A 1B3XA 1E6SM 5EKYA 5HMEA 3K4DA 3USZA 7ODCA 2ZRWA 3CWHA 4MKSA 2I9EA 5LGXA 3SRFA 2AQOA 4IOTA 4X9SA 1QI3A 3A3XA 3IJLA 4ZTXA 3M5XA 3GXFA 4JTFA 5AB3A 2F9RA 4KT2A 4YWOA 5HNUA 4GQGA 1NQ6A 3VCRA 1BF6A 3CQJA 1P6WA 3H8AA 4U28A 5A6MA 2E77A 4GY0A 1RBLA 2E09A 4N2YA 2FGBA 2PTWA 4OWGA 4CQ8A 4PTXA 2CCRA 1KV8A 2XN0A 4KWUA 4O53A 3OZMA 1ONEA 1Z32X 4JDRA 3NUKA 4AX6A 4DO4A 2OOGA 3H2NA 1GERA 3TTYA 5C55A 3MPGA 1WBJA 2B0MA 1US2A 4B3KA 3N2MA 2W62A 4JNMA 1B3VA 5CGTA 1DTUA 2QUVA 3MSDA 1IQ8A 3GM8A 3EAUA 2H90A 4QSHA 4PUEA 1RY0A 3LEPA 3DUGA 4C6IA 2D2OA 4JTAA 3L0GA 4NJHA 4IMGA 1JF6A 4ZSUA 3IIZA 4AYSA 1VRXA 2W0UA 5AVNA 3WD0A 1VYSX 1V59A 1IIGA 2CIPA 1XKYA 2WC7A 2VC5A 1XG4A 3HV9A 3RPTA 4ZOAA 5E6ZA 3VKCA 3STGA 3W70A 3CNYA 3N13A 1S1PA 5CPTA 2GSHA 3BL3A 1J6PA 1S2TA 4KETA 4Y8FA 2ZZCA 3CHFA 3E9AA 1P1MA 1NVMA 4E2VA 4H4ZA 3NQCA 1E40A 3TROA 2WVUA 1L2UA 5K9XA 2B7QA 2VTFA 3EAOA 1F05A 1W1B1 1GETA 3CV6A 3HBLA 3K4AA 3WLHA 3ZLGA 1H09A 4Q4OA 1LYXA 4KWOA 1W1YA 5JMUA 4XBSA 1KLYA 3ZOAA 2V5KA 3VZZA 1IEIA 2VC6A 4OUIA 3WL1A 3U5YA 4MKNA 3BW4A 1YQ2A 4XO6A 4HBKA 1QPNA 3WQCA 3T2OA 4ATDA 4P8XA 4PL1A 2UY4A 4BI6A 4UFHA 4EM3A 1UKOA 2J7DA 4O1CA 4LYQA 3LBCA 1H60A 5AC6A 1OCQA 1L0PA 4AEFA 3MHGA 3LRMA 2OODA 4BFAA 4PTVA 5DBTA 2FHBA 2QCLA 4O10A 4CQCA 1OIMA 2PB1A 2NT1A 1I0BA 4KCUA 1ITQA 4M7TA 1U83A 3PZGA 1WUFA 1MNZA 2A6LA 3P3BA 1CT5A 5LHFA 4LIIA 3SJNA 3LXDA 5EMLA 1GYLA 2GOKA 4XD4A 2X1UA 3RMEA 1HW6A 4JIHA 1A3WA 2PI6A 5HJLA 4YCOA 2OWWA 3QOMA 3URBA 3NZ1A 4APNA 1GKQA 3L4WA 3M6DA 1KCKA 3FG2P 3K8KA 4K38A 1KD0A 4PUJA 5A2CA 3RJXA 3WLRA 4AIEA 3I3BA 3R25A 1FP8A 1GTHA 4UQEA 5ABEA 1A5NC 3AYSA 1EIXA 4B2DD 2OVLA 2WCAA 4C6JA 3TTEA 1J01A 3I68A 4B9ZA 1F7BA 5A6LA 1XIDA 4FF7A 1BYBA 1ZTVA 4XZHA 3QHNA 3ETRB 2OSWA 2BXVA 5M3WA 6PTDA 3N1AA 1JNEA 1YQZA 4YMZA 4QE5A 4OE7A 1T3QC 3W9ZA 1CGYA 4D71A 5IDIA 4GCXA 1KO0A 4L6DA 3M5YA 5FJUA 1GRFA 3ARVA 2NUWA 3FXGA 3KTXA 1MYRA 3WNOA 3TYZA 1QI4A 2PDJA 4QS6A 3C2VA 4MZ1A 1EYEA 4LEQA 3B4YA 2P1FA 3V5FA 3NPVA 4WUIA 3WFZA 1TJPA 1EA9C 4ML4A 1A80A 4KEVA 1TR9A 4F0HA 5AZ0A 5J04A 1UZ4A 1RSCA 1PS9A 4XISA 3LUTA 3UWUA 1QPRA 4CUCA 1XS2A 1XYBA 4QNWA 4KWVA 1X38A 2X50A 4XX6A 1EGZA 2ZX9A 1OSEA 5EMJA 5KZMA 1Q8AA 3UXLA 3H70A 2XH2A 4AD2A 1O4UA 1ZAIA 3BANA 3RG6A 3S5OA 2TSYA 3GXIA 4W7VA 3MUIA 1SVDA 1JPKA 4WY0F 2BVWA 2J7FA 4ZENA 4X61A 4AFYA 1O7AA 4CQDA 4PUWA 4TVDA 4XAZA 3W7RA 1TKKA 3CIVA 1SSDA 4FHAA 1SJDA 3ARZA 1V6UA 4V1YA 1UR4A 4IX2A 1ZJAA 3AI0A 4HNNA 3DGZA 3HU7A 3NYZA 2B4GA 4CGTA 2C3ZA 1J0JA 2HBXA 3AFBA 4JN6A 1ME9A 4ADSA 4TVWA 3HG5A 5A6JA 1JROA 4GO9A 1H7XA 4B4HA 2W66A 4X9YA 3OVRA 3AXHA 5G5GB 1IEVA 5CPOA 3VOJA 4ZBCA 5CC7A 1E3XA 5JH2A 2HVOA 3LCIA 1TPWA 3K2GA 3L2MA 3DFOA 2OQYA 2GVLA 1LM1A 4ZODA 3DENA 3VIGA 5F4SA 1YE4A 4A4AA 2PLJA 2BHUA 5BWAA 1A5KC 3G0UA 4J27A 1D8WA 3P7YA 1OX4A 2DT0A 2QT3A 5K4XA 5JCNA 1GHRA 4WKHA 4WJXA 4IFKB 1BWKA 1Q7ZA 3PWGA 5F2MA 4LTSA 4BS0A 3PFRA 4NXSA 1NHPA 1XGEA 4ZQRA 1P0NA 2G50A 4N9EA 2I5GA 3NTYA 4NYUA 4ZO7A 3GRIA 2XISA 3N73A 4PC8A 4M80A 1CEOA 3IS4A 2HK1A 1S7MA 1GV4A 4XZWA 5A6KA 3LCLA 2YCJA 5A5WA 1HVQA 2YDRA 3GTXA 2BY1A 4XZBA 3HPZA 1NHSA 1DP0A 1V97A 3NYDA 5A8OA 1AK5A 4C7DA 2VM8A 1TV8A 1W3HA 1H63A 3WF3A 1JXJA 4LALA 1JRBA 1RPXA 4H4VA 5M2FX 2XZ9A 3RM9A 4Q8VA 1X8CA 3W82A 4Z2IA 3GD3A 4Y9OA 3IGXA 5GRTA 2YZRA 3IAPA 3T2PA 4JX4A 3UWEA 4G1NA 3IK2A 1DHPA 3PAJA 3H2CA 4B9YA 2QXWA 4H4UA 5DQPA 2J8FA 1QAPA 3CAWA 5DMNA 4QNEA 4B5XA 4UFMA 4A3HA 2DQWA 4KRZA 5U25A 4E2OA 3NRZB 1UD3A 3CUFA 3FYYA 3LGDA 2UBPC 1Y0EA 2HVNA 1BRLA 5HQEA 1KTCA 3L4YA 2BC0A 2GFTA 1J0YA 3RLGA 1CGXA 3P67A 4YN5A 1P6CA 3EANA 3H6OA 4AD4A 3RM4A 3THCA 4J2MA 1L8PA 3I4EA 1C91A 2EQ9A 4POCA 1LQ2A 3QMTA 1W56A 4UTTA 3N3MA 3P8JA 3CGDA 4C1NA 2Y70A 3HPSA 3NZGA 5H8UA 3W25A 1R3WA 5FJIA 1TUFA 1V93A 4MF4A 4UNLA 2C1GA 4FB7A 4S1FA 3JR2A 1BVWA 3WLJA 4JQ9A 3LOTA 2QR6A 1FUYA 3VKAA 4MTVA 1GRAA 2P3EA 3H53A 4WY0B 1GZ1A 1L6FA 2PUZA 5FACA 2YGYA 1IT7A 2GGGA 4IIFA 4ML9A 4R85A 4A22A 5DANA 4PEEA 1T7LA 1HNYA 3CC1A 1TJ2A 2OSYA 1VFFA 3RLUA 2OELA 1V8EA 2PD9A 5DXXA 4ZVJA 4J40A 4GFSA 3W22A 5LZLA 4IIHA 4XZ9A 4DNMA 2Q3OA 2W4XA 2GVEA 3SJ3A 1S38A 3W85A 3W1UA 2YXGA 1RALA 4OIFA 1EA0A 3L67A 2ZUWA 3O9NA 1BEUA 2V69A 4BQ3A 1VH7A 3C2EA 4B5VA 3MKVA 4Q22A 1YNYA 2JIEA 1W0MA 1TTPA 1P0BA 1IXOA 2A7RA 1J96A 3LCFA 4D6GA 1TJ0A 1CZ1A 3SAZA 1U22A 1TPH1 1OYAA 4GLEA 3WMBA 2NUYA 3NVDA 4Z1YA 2AKZA 4GC3A 3G0XA 3WBAA 3Q4DA 3MVIA 2ZX6A 4YXGA 3PZUA 1C90A 2X42A 1P7TA 3LN3A 3BGGA 3L65A 3LI0A 4K7YA 3EMCA 1R3QA 5HNRA 2AAAA 3UVIA 3RMJA 3NURA 4JTHA 4JEQA 4J3SA 4DJDA 2ZOXA 3DBPA 1K6WA 4XZIA 4GX9A 5DX7A 1ONRA 5XIMA 3IACA 3U3HA 3ZJKA 1DXFA 2C79A 1XUZA 4MY9A 4R3UA 3L21A 5JU6A 3EX3A 2EPOA 2X7WA 5T9BG 1K9EA 1AQHA 2GR3A 4UR9A 3OG3A 1O1ZA 2FVLA 3CYVA 1NFPA 3NPUA 3C3NA 1LDCA 3W26A 1UZHA 1RBAA 4OU1A 3DFSA 2GVJA 5F1UA 2C3DA 4UTTC 1R85A 5A2BA 5AHNA 5H8MA 2DZTA 3AHTA 1S5VA 3B06A 3E5BA 1K9TA 3THUA 4W8BA 4IMEA 1EFZA 1LLZA 1E0WA 4TIMA 3VO0A 1F4HA 1M9HA 1YPIA 1CXKA 4ZO9A 4FNSA 1FWCC 3WLLA 3MA8A 1UZDA 4LEFA 2G4FA 4UTUA 4AF0B 3W6MA 5CSSA 2NVKX 1TX0A 3CWNA 2Z1XA 2BGNE 3VMOA 3OQ8A 2J7GA 4B90A 5FF0A 2D2GA 3GC2A 2YB4A 1BYAA 1J12A 2WLYA 3QGAC 3NM1A 2JIWA 3G5EA 5GVJA 4XIAA 3WLQA 1BFNA 1ZAJA 2YIHA 1L6WA 3UVAA 4GZEA 2QCCA 2ALRA 1HXJA 1ZPTA 4QGCA 3GK0A 4RE2A 3C5QA 1UWTA 2DZVA 5JCLA 1XDLA 1G4EA 1KBLA 5D4YA 5JBDA 2I1OA 5C9XA 3B8UA 2AQVA 4K1WA 1VLWA 5SWUA 1XYLA 2Y7FA 2OYLA 4CQBA 2CBUA 5JBFA 4JN8A 4Q4QA 3I7RA 3VXGA 2E25A 1GESA 2GUYA 1LP6A 1S5WA 2XVNA 5D2TA 1EBHA 2CC0A 1IR2A 1G01A 4H8UA 4GIAA 1JZ8A 2XIMA 2CDUA 3GDTA 1HFBA 1JFXA 3O0HA 1TV7A 1UHVA 3PS7A 1H0IA 2GDQA 1TUXA 4J3VA 3EX1A 4E8CA 3DERA 5JIWA 5CZ0A 2J9XA 2ZWYA 2Z00A 3NXLA 2YOCA 4NXKA 1JZ2A 1TV3A 1KM2A 1XD1A 3VNKA 4OV9A 4DYKA 3AXXA 5A6BA 3AIBA 4I5RA 1XM3A 3MO7A 1PBGA 3B8SA 3HJZA 1WX0A 1A0EA 1K8YA 3DYMA 3UERA 2ZZ5A 3UG5A 4CU7A 3DEQA 1XL9A 3WNLA 1T8XA 1ADSA 4XSLA 4F9JA 1VBGA 1XIGA 1U1JA 2VZOA 2X8GA 3AQUA 3TYBA 3QJAA 4L9ZA 3R4IA 2CZVA 3WDRA 2J8GA 4Q33A 4UQ9A 3R6IA 1U1UA 3QSTA 3VIKA 4DJDD 2PWHA 4W8AA 4XSMA 3ZVIA 1Y7VA 3TEVA 4PUNA 3B0VC 3ARTA 1ZALA 2VX4A 2AAQA 3KLJA 3OPSA 4AQLA 2CBIA 4F0SA 1IT0A 4J3TA 3EDJA 1TPC1 2YQUA 1FWWA 4L4PA 4IGHA 1H49A 1H11A 2Y61A 3ZLFA 1FA2A 3W2UA 3M0XA 4R7WA 1K02A 1W37A 3NJ3A 1VBUA 4PB3A 2L5HA 3VD4A 3IJIA 2WJEA 4HIBA 4LNCA 4OECA 4GC4A 4WSKA 2OKOA 1WXZA 3GR4A 1XYFA 3B9NA 4J57A 4LRSA 3LXBA 4AG0A 1FY6A 4GFIA 1VFTA 1GNXA 1ODUA 1NDYA 4AZGA 4R7JA 1WDRA 3RJYA 1Q63A 5D03A 1JJKA 2A3AA 4PRWA 4BEUA 5AC8A 3T0TA 3MBFA 7A3HA 1ZQ5A 1JPIA 1XLEA 3MZNA 1XJBA 5BXSA 1Q4WA 1RK6A 2PGFA 3CS2A 4PZVA 1V79A 1O5XA 1DWGM 3VKBA 3KOWA 8CGTA 1UOZA 3TW7A 3UZJA 1I2PA 1XLGA 1PUDA 3WK3A 1DJNA 1PKYA 2QJNA 4GMEA 3B40A 3EWYA 1OF6A 1JCTA 4Z42C 2VGBA 3N6JA 1JYNA 1JAKA 3BDKA 1ZP3A 3LI1A 2W27A 3CZLA 3QY8A 2WKJA 4MJ2A 4NJKA 1E4MM 3KBWA 3WH7A 3GDMA 3NPXA 4AY8A 2IQ0A 1DOSA 3W2NA 3OA5A 3ZR6A 5H1WA 2OG9A 1JULA 4GI8A 4QS5A 4HHPA 4IUGA 2GJLA 4H4IA 1FWJC 1E6PA 5CQ1A 4LCRA 3REQA 2PODA 2G3FA 4GI4A 3UFYA 4JFTA 1HZYA 3V36A 1R8LA 5F4WA 1F3EA 3PFMA 2HVMA 3SM0A 1DHKA 4EACA 3ZFHA 5I3FA 4P7RA 1KNWA 4GVGA 5D30A 4JTIA 4NYYA 3TYDA 3W7PA 1PZ2A 5ECVA 3MV11 2B31A 4HNOA 2HPMA 2E5BA 2XIIA 1QXLA 2Z6JA 2IKHA 4H9XA 1MFUA 5A6BD 2PRLA 3E2RA 1QMLA 3AZTA 4NAEA 3BE7A 2G95A 2ZRYA 3VM5A 4RE3A 4JTKA 2WMJA 3SN1A 4AMCA 3D6NA 1G0CA 5AYBA 1HJVA 2BMBA 3AO0A 5LA2A 1XLFA 1RH9A 4HMDA 4NG3A 4QJ4B 1KBKA 4O4VA 3AUJA 3KBNA 1TG7A 2YDSA 5CG7A 2NV1A 2R91A 1QPQA 2JEPA 4YHEA 2BFGA 3LRKA 4W88A 5ER0A 3SDOA 3LXAA 4M81A 3MKCA 3AROA 3RLHA 1YYAA 1G7VA 4LWWA 3S4TA 1ZMDA 4PCPA 5LIXX 4F0MA 3B0XA 4DEFA 4N42A 4Q8UA 3KBSA 1FWTA 2Q3RA 4YL2A 5I7GA 3VKKA 4AHOA 5TAOA 1SGJA 4O28A 3ARRA 5A6AA 2PWEA 4K8GA 4Z2KA 1QBAA 4ZO8A 5IHRA 3GVGA 1KLZA 5FS7A 4C6LA 4AZ5A 2QUNA 1J79A 2EPKX 5C5YA 4HP5A 5FF2A 1K70A 1BXNA 1VYRA 5LSMA 2ZCGA 3INPA 2Z1SA 3B05A 4IXXA 3TZNA 2V6AA 5DT5A 5KVIA 1WDWA 5AC5A 1A5UA 1MFVA 1MQRA 3IVUA 4MIMA 3ABOA 4NZJA 4PMJA 4WDUA 3SUSA 3U4FA 4OUEA 4EK7A 1E6QM 4KF1A 1S39A 2ZXBA 1EZ2A 3T7VA 4ZQCA 1JDAA 1E72M 5G5IA 4LVFA 1FKXA 1QNPA 3VCCA 2ZKMX 1ZX9A 2R1MA 5BNKA 2PLKA 1PCWA 5DMYA 3K13A 3E0LA 2F6XA 3VE7A 1A5BA 3KOYA 3HRDC 2EKGA 1FCQA 1WBHA 3W1NA 2ALDA 1C7SA 1PTAA 3M5VA 1OHLA 4H9TA 3V1PA 4DZIA 1CB7B 4O18A 4GUIA 4DXKA 3GXPA 4ICMA 4WIWA 1NWTA 4GKLA 4LBRA 1UWQA 1OCNA 5EBUA 1XBZA 2ZWZA 1OT1A 2ZUTA 1LPFA 2ZA3A 2YKKA 3I6EA 3WG6A 3SCRA 1PX4A 4OBRA 3PG6A 3LPPA 1TMLA 4M8UA 4J9JA 3WDIA 1HL2A 2PDXA 4XQ6A 3PWIA 4R27A 2GOUA 4X22A 3NO5A 4X63A 2CBVA 3I6TA 5C9RA 1G4PA 4BKNA 3N17A 1US0A 1LLOA 1KB3A 1YE6A 3PJTA 2OT0A 1FWIC 4CCZA 1FXQA 5BRQA 4MJMA 1EZWA 1U30A 2E9LA 3TNBA 3W27A 2YVFA 2HTMA 2BASA 2OSXA 2VFIA 1OK6A 1JRPA 1WUEA 4HCLA 3R8RA 3A9BA 1V0MA 4TX9A 4J5NA 3UR7A 1R3VA 2WWCA 3H2FA 5HUPA 3VGFA 1KXTA 2DZWA 2WVVB 4B5NA 2BVDA 5HPCA 3D3AA 4J3UA 3M64A 3UZYA 1FWGC 2WOQA 4AY7A 2FMNA 3L4ZA 5TNVA 2DV0A 3VDGA 1ZU8A 3VNDA 1GYNA 4UMBA 3C86A 2YBVA 3AS3A 4DO5A 4NJIA 4L9YA 2OZ0A 4L4OA 1B3ZA 4TV5A 1I6NA 2Z7GA 3WLOA 1E9IA 4TVUA 4ZO6A 2OLHA 1ZK7A 3GYEA 3UXKA 4KS0A 4D2JA 5JVLA 2DZXA 3PZIA 4K7ZA 5C6MA 3U5UA 3W83A 2XTKA 2ZZ7A 3TN5A 1EP3A 1RJPA 3LMZA 3ITGA 3G1YA 1GG1A 4R33A 4AISA 3U0HA 1HVXA 2E7FA 2PSNA 4PR4A 1ISWA 4EM4A 1W9XA 3WCZA 3VOIA 1JI2A 1LUCA 1GOMA 3P82A 4GD0A 4DB7A 4J1OA 4EF9A 3AWOA 2WNQA 2CKRA 1QNVA 3AALA 4LUIA 2J8TA 5T9CE 1R9YA 2VURA 3VU2A 2XG9A 4NRSA 3WNKA 1S5TA 2WJDA 2PDQA 3VUPA 2PZ0A 5JCKA 4FI4A 1OZMA 4NJJA 2PC8A 4C1KA 3W6YA 1T40A 4H6EA 1DIDA 2JK6A 1DIOA 2PLCA 2WMGA 4YPJA 1OABA 4K36A 4A8NA 5CGQA 1AODA 1GVOA 4IP4A 2ESCA 3QY6A 4AH7A 3O05A 1H7WA 4Q3MA 3E3HA 3PZVA 4Q8TA 2FTWA 2ZTKA 3TK7A 4F2TA 3SRDA 4QAWA 1EJ7L 1ZBWA 3TE9A 4UZSA 1IE7C 1KM4A 2X30A 2C6QA 2QHAA 1SR9A 4RDZA 1TA3A 4XUGA 1XIBA 3R07C 1QPKA 2DZPA 8A3HA 2TPRA 4AXNA 3OBAA 3M16A 5AOUA 1P43A 2OJPA 1NIUA 3L5LA 1GORA 3VYLA 1C9WA 2WMFA 5BMXA 3QFAA 1N7KA 1RQHA 4HU8A 4ZXOA 3AHYA 1DQXA 2BOFX 3QV9A 4GUFA 3AJXA 4KEUA 1UKPA 2WMHA 3LYEA 3WQDA 1ELSA 1EXBA 2HPIA 3CO4A 3LS9A 4WZHA 2D20A 3AIRA 3T8QA 4I8DA 2CLMA 2BV9A 3PG9A 1KXVA 1HJQA 3KLKA 1LROA 3O6YX 5GNYA 4XAFA 4ZOEA 1OY0A 4NZCA 1MUWA 1YTEA 3WENA 3U8GA 4AIBA 3DFQA 2VUNA 3U7VA 3VD3A 3NSMA 5DY3A 4LOCA 2J79A 5D2WA 1TQJA 1EBGA 4YTRA 2QV4A 4AIUA 1UQYA 2I17A 3O6AA 1F73A 5EYWA 3CUHA 4HPGA 7XIMA 5HXMA 1TWDA 3UESA 1UR8A 3GUWA 2VKZG 4V1XA 3Q6JA 2DIJA 5E70A 3H23A 3ATZA 4DAFA 2VC7A 3S5SA 5KINA 1STZA 3N4FA 1W3KA 3ARPA 3S1UA 1QHPA 4ADUA 2WJFA 1LRQA 4CU6A 1ECQA 1R5YA 5HUOA 4QG9A 4GINA 5DMLA 3TSMA 3PUOA 1A5SA 5MKGB 2ATSA 4DLMA 2YVJA 3SCSA 1DJIA 2PDIA 1REQB 1DWIM 3L66A 1QJWA 1RJQA 3UWZA 2FDSA 5FEZA 4DN1A 3WQOA 1VAHA 1W1TA 2YR1A 4PFMA 3M0KA 1BG4A 3ABXA 3FVMA 2PE4A 4UTLA 4PMXA 3AM9A 1IWPA 4MADA 1PXGA 1IEXA 2O56A 4PTMA 3B9AA 3W01A 3PC0A 2ZA2A 5CEWA 1W1VA 3HIJA 4I7VA 4YYFA 1KGUA 2CXGA 2PP3A 4YVXA 3LCGA 1TE1A 4C7FA 1EC9A 3LCHA 1Z41A 2WAGA 3A7UA 3SQPA 4JD4A 5I24A 1WQ5A 4B5SA 4CNUA 2GGEA 2ZADA 5HA7A 3UPWA 1U5HA 1SQ7A 2FZDA 1ESWA 2ISWA 4N7QA 1GQLA 4EAMA 5ABFB 3IARA 1BTMA 1D3CA 1E1CA 1PDZA 1U33A 1EEPA 3AS1A 4HK5A 3FK4A 1TIMA 3MMTA 4RPQA 3BLIA 3FY1A 3R43A 3WEOA 1XDIA 3BCJA 1W9UA 1FP9A 5I3GA 4K68A 4G6CA 4UFKA 5I2UA 3E02A 2RDUA 5AYZA 2QDGA 2PWVA 3L5OA 2NPXA 2GDUA 4E2BA 1MW3A 1CWYA 2XIJA 1GVFA 4MHBA 1MEHA 1GG0A 3QGVA 3CHVA 5D37A 4PA8A 5KSWA 3NQDA 2Z7KA 1MXSA 4IH3A 5CSUA 4RW5A 3HZ3A 4GVHA 1IYXA 2A4AA 1GZGA 2XN1A 1TVPA 1E0VA 1ONWA 3VFCA 1FWFC 1DJYA 3OIXA 2DVTA 2ZUUA 5LYRA 1OM0A 4MSSA 1TX2A 3RX3A 4KGLA 4H41A 3EXRA 3H22A 3OW1A 4LF1A 4LAUA 3VOHA 3VD9A 3UPMA 1R86A 2WPGA 4H9VA 1G9HA 2CHRA 2NLYA 5LNUA 3R89A 2OEJA 3GDKA 3NG3A 4KFPA 3QTPA 1E6XM 2E5DA 2WXDM 3C8FA 4EAYA 3A47A 3ARQA 1E15A 3FA5A 1GOOA 4HVXA 4GQRA 4UTFA 1FBAA 3LXCA 3APYA 1KWKA 1RAKA 1Q6EA 2ZE0A 1JUBA 2WBGA 3KFTA 5CKSA 4U33A 3L4UA 1ICQA 2CHNA 1SW7A 3EOUA 2CPUA 3AS2A 4NQ1A 4FLQA 1YBQA 2QCHA 2E40A 3POHA 3TMLA 3VNIA 4JL1A 1PHWA 3R0DA 1MRAA 3WF2A 1M68A 2BB0A 3NGFA 4UTKA 4DIAA 3SCPA 1A0CA 1B2YA 1M7PA 1SFJA 3S2LA 4JQ3A 4ENLA 1HJUA 1DL3A 3P81A 1TYTA 1QHZA 4AW7A 1LQAA 1CXFA 2V5BA 3V7PA 1W5PA 1PL9A 3BMXA 1EH9A 3GHUA 3BAKA 1KFEA 2MUCA 3BSMA 3GY1A 3L5AA 4ORMA 1GRHA 2DP3A 1VBJA 3J7HA 2YSWA 3K30A 3S2CA 3OU8A 3EX6A 4H1ZA 1OEPA 1J0IA 1ZBVA 4U31A 1AD1A 1B54A 3SN4A 3OOQA 2VR4A 3TLLA 3V5OA 2R8WA 3T42A 2NX9A 5EY5A 2YYTA 4E5TA 1PPIA 2R9ZA 2TMDA 3SCTA 1C8QA 8XIMA 2WCGA 4LB4A 3A4AA 1R3RA 3LHZA 1VJZA 1XKJA 4J35A 3WO8A 3B8WA 4AMAA 4ADWA 4XKYB 3QZEA 3NZPA 4DNAA 1KRMA 4JIEA 3CH0A 2YZ5A 2XDFA 3N2OA 4HK7A 4MY8A 1OFPA 3MC5A 3S83A 2PU0A 5KZ6A 3WH5A 3UG3A 1YEYA 1QW9A 1SO6A 3RCYA 1KA9F 3DDMA 2V3DA 3BAXA 3G1RA 4ZXLA 3OZPA 1R2RA 3DK8A 4H2CA 2O9OA 1QOQA 4AZ6A 4FXJA 4YIWA 3GKAA 1Q13A 3A3WA 1H5VA 5EBAA 4DJFA 4GJJA 2D69A 3GD6A 1H7NA 3ISIX 1SZFA 1AA1B 5HANA 2J6VA 5BU6A 1J5SA 4MJ4A 3W2LA 2V3BA 3PWAA 1GW1A 2NQHA 4XD6A 3LHUA 4RNIA 2VD8A 3B0UX 4ERAA 4AEEA 1MDRA 4O50A 3JZEA 3RFAA 3UCQA 5TF0A 1G6CA 3H2EA 3HM7A 1ITCA 1EBDA 2LLEA 3RNDA 1O68A 1FFVC 4TUFA 2ZIDA 3W0KA 4EXQA 3FIGA 2C7FA 3EDDA 3PBUA 2R14A 1GCYA 2PAJA 3I10A 1X2HA 4MYAA 1FHLA 2Z26A 5LNSA 4H4XA 3EWDA 1KFKA 4IIEA 4M1BA 2EQ6A 3W7NA 1QWKA 1WDDA 3GIQA 2HISA 1ADOA 4EWJA 1YTDA 4IMCA 2VT0A 1BGAA 1LORA 4O13A 2FFCA 2X09A 2GJNA 1UPPA 3WQ5A 3II1A 2WSPA 4IP7A 5CZJA 3S0CA 4JQAA 4CNTA 4HZ7A 2E4TA 4FIQA 3WQ8A 1ISYA 5LXEA 3IANA 3T78A 4J7RA 4GXPA 4JTRA 2X1SA 3CIXA 3N14A 4R5EA 3CZJA 3NOEA 2ANUA 2WWDA 2V38A 1JEHA 1CCWB 4CCEA 2W3SA 1F3XA 3UXDA 4I6KA 2RHGA 1XLCA 2VO5A 2DSVA 2Z27A 3BLDA 2V0TA 3CAQA 1EUAA 1RVKA 1K9FA 2XYLA 1P48A 1KCLA 1I75A 1RZMA 1SUXA 1QCWA 3MHUA 3N29A 4W85A 3Q45A 3CH9A 3TJLA 3JW7A 5BXRA 4DYEA 4Q7BA 3FDKA 3KAOA 3QLDA 1CLKA 3SCWA 7CGTA 3FCPA 1PV8A 5DT7A 4YS1A 2V8ZA 2E5CA 2BCPA 2AL1A 1JI1A 2DVUA 1W17A 2QNEA 2PCEA 4KBXA 4PBFA 3EOOA 5HNTA 1XLIA 1VF8A 2NQLA 2PEVA 2GWNA 3AU6A 1BKHA 4DJFC 3S1VA 4NVTA 3IGHX 3V3WA 3AZSA 3VZXA 2BHYA 5L6UA 4AXKA 1G69A 4C6BA 2V2DA 4C90A 3E1F1 3DFPA 3W7JA 1OFOA 3NQ6A 3HQ1A 2GRTA 3M7WA 1R9ZA 5E93A 4UFIA 3BMVA 2CESA 4KIEA 4BQ2A 4PN2A 2X8CA 1BSLA 3W02A 5HR6A 5I3HA 3UXAA 2ZZ2A 1TVLA 1J0HA 1B31A 1OFAA 5H8PA 1D3HA 3G6LA 1NDVA 3BMWA 3IV8A 4DVOA 4O4WA 1M04A 4HZ6A 3KHDA 3W7DA 4AC1X 4DZAA 4DJFD 4UOJA 2ISSA 1NH6A 1NY1A 4H9YA 1Q1RA 3CT2A 2DIEA 3A21A 3EA3A 4PB4A 4LVAA 4I3GA 3GAKA 1J2WA 1FCBA 3ZIZA 1J2BA 2DW7A 3A4JA 3NQ2A 2CBJA 1QUMA 5G2HA 1W32A 3VNZA 5G5HB 2IMRA 1UH4A 3STFA 3OYXA 1ME8A 3GNXA 4KWSA 3IRDA 2WM1A 1FCUA 1GRTA 3PG8A 1MW2A 3MSRA 2ZBTA 3F5KA 3C2YA 2XN2A 4MZYA 3QPZA 2IW0A 4GCAA 4MNMA 3TJXA 2DUZA 3WBEA 1EC7A 2V68A 4RE0A 3NVYB 3LU2A 5JH1A 1DWFM 3MU7A 4AWTA 1JPMA 3UR5A 4IMAA 7REQA 1DJZA 5IFTA 4AD0A 4F9DA 4ECLA 4JQ4A 3A64A 3S5ZA 3LCWA 3N15A 1FDYA 2F38A 3N9SA 5LNRA 2GJXB 4IJCA 4BWLA 5PTDA 1OG6A 1TPEA 5GQBA 3B9JB 2CHOA 1UR0A 4PBGA 4XAYA 2VRQA 4DJED 4V15A 2FJUB 1LT8A 3ZMRA 4A05A 1XBYA 3HURA 4BHYA 4YVVA 1Q6QA 2UZ9A 2TRSA 3QLLA 2BDQA 2V5LA 2C91A 2CFFA 1L9WA 1UOKA 3FFSA 3I7SA 3P84A 4QJ1A 3R12A 2HNHA 5T91A 1NWUA 4J3ZA 1VQZA 1I8JA 3FKKA 1TIWA 4DPQA 1GEUA 3IJ8A 3WQPA 4ZB0A 1JNDA 4O19A 1T8QA 3BLEA 4QISA 4QFUA 4Q4RA 5H91A 2DJLA 4PMOA 4L1WA 3AZRA 2QCMA 4TX8A 5KZDA 2W5FA 3GDLA 3PN8A 3TLQA 2ZRXA 3B8IA 3ANYA 2ABAA 1UMLA 4LUYA 2DVXA 4LB3A 2QLYA 4EKJA 1XLKA 1EJWC 2JKPA 5AVHA 1XCXA 2WC3A 4HNTA 1O94A 2EPNA 4IG2B 1KFLA 4UMAA 2HK0A 3W38A 2QF8A 4TVYA 2PDGA 3CQ0A 2A3EA 1FFQA 4IIGA 1JQVA 3VOFA 4TX6A 3CASA 3RHGA 5CAKA 4S2CA 1JYVA 2VFEA 4PBEA 5G1TA 2PF8A 1VENA 1AUSL 1V51A 3KRBA 2ZUSA 4MPQA 2GQAA 1F6KA 5MF5A 3HG2A 1H3GA 4TO8A 3MUXA 4MUZA 2V30A 1WDPA 3W1MA 2P0IA 2WP5A 2V67A 3NQVA 4LA1A 1PJ9A 4ZEPA 4LT9A 2VR5A 5REQB 3VNMA 3U2ZA 3VFLA 4FDCB 3PSWA 3GSMA 1FFRA 3F4NA 1NELA 1IHIA 4LXFA 4MB3A 4QXIA 2F2HA 3BGAA 1W3IA 3THAA 3KTCA 1MUMA 3W23A 2JQXA 3E74A 3E2VA 4IT1A 1BQCA 2O9TA 1XQKA 4IGMA 5C70A 5FJPA 1H50A 4A8RA 1ODZA 4BWLC 3H4XA 2V6OA 3W1PA 2OWXA 3UNDA 2YBUA 4D6JA 1TWZA 2DORA 3UNTA 3VILA 1K3UA 4QG6A 5D38A 3VGDA 4GYFA 1RA0A 3UY8A 3UG4A 1A5CA 3BOLA 4AD3A 3EMZA 4GYPA 1C92A 2BLEA 2DPEA 4O52A 2Q6ZA 2F2KA 1ZMCA 1DV7A 2YA0A 1OB0A 4BF7A 2PDHA 2REQB 1KQZA 4AZIA 3EPNA 2VEKA 5D05A 2GK1A 3VIIA 1WPCA 5EA9A 4U3CA 3II4A 1KKOA 3SURA 3H2OA 4GGHA 3WH6A 4YJ5A 3B04A 5CSYA 3C2FA 5LNWA 3AMGA 1A50A 1A5OC 4MY1A 1SPQA 5F1VA 3LTPA 5A1AA 3MT1A 1OD8A 4XK2A 3VX1A 3ZT7A 4M7SA 4H4RA 3ZO9A 2PWFA 3KEHA 2VEPA 3R10A 1B30A 2BXZA 4QDWA 4QP0A 4WKFA 4EF8A 1TSIA 2VX7A 3OJGA 4H01A 3OBEA 1QNQA 1X98A 4C65A 5CH9A 3SCNA 1B5TA 1M7XA 1XDMA 3VGHA 2UWFA 2WYSA 4G8TA 3A3HA 3UJRA 3UYIA 1FWBC 3H4WA 3WQ6A 4GI9A 3W07A 2XM1A 4B15A 3AU2A 5I78A 3F7JA 3T40A 3AXKA 3EOSA 2VDIA 4MWAA 2EEXA 3O8AA 4LAOA 1PZ3A 1K7FA 2ZX7A 2Y5SA 2HJPA 4LBSA 1W3NA 3C6CA 1G94A 3B9EA 3BZGA 4ZSTA 1XSJA 4FO4A 1M03A 1A49A 4CEXC 4PULA 2R6OA 1YHTA 1WDSA 2ADAA 3M4HA 4KMQA 4UQBA 4DWSA 1A4MA 1UYQA 3A24A 5HMFA 4LCSA 3P14A 5E9AA 4W84A 3HW2A 1PWLA 5BZAA 3IIOA 5JUVA 1POJA 2ATMA 2E3ZA 4IPPA 1UASA 1OYCA 3W87A 3ITXA 2V5CA 2PWUA 1EWEA 1E3ZA 3MTWA 1EPVA 3H7RA 1M6JA 3ZQ9A 3S9ZA 2QCEA 1FTXA 2VZTA 4ZMGA 2JBMA 2E8YA 2GH5A 5D2YA 3SCQA 2RGLA 3DESA 2CLHA 1V02E 1HF6A 3L0NA 1OJTA 2EG8A 1JQXA 4MJZA 3W81A 5HWMA 2XJ7A 1WA3A 4RXFA 2DZSA 2YL9A 4BQ5A 4GYPC 2BNJA 1RY8A 1TJRA 4PTDA 4LJ3A 3PBYA 4JPGA 2P0OA 3LHVA 4KEZA 1NDZA 2GWGA 2VUYA 1SJAA 1VZWA 2CLFA 4NUWA 4LVDA 1CYGA 1OGBA 1JOAA 4JTGA 2B7OA 3DJGX 1R30A 3ITYA 2PC4A 2QCDB 2QIIA 1MSSA 2A7PA 3VVGA 4JR5A 4DAIA 1UCWA 2H3DA 1VHNA 2J4GA 4R7OA 3ITTA 5F4XA 4V33A 5DLCA 1XC4A 4CQ9A 3T07A 1UQZA 2DGAA 4P8VA 3ME3A 3VUSA 5CGMA 4FS9A 3ENLA 4X3ZA 2HE5A 3BJTA 1I2RA 3FHQA 2RJGA 1GQJA 1NARA 4G9PA 2CU0A 3WMCA 5BCAA 2GR1A 1P0KA 4W87A 4JCLA 2Y85A 4GYKA 3E5PA 4ACZB 4LVBA 1K4HA 4MWAC 4UQCA 2HCVA 3WLPA 1LJYA 4NP7A 1EHAA 4S3GA 1RHCA 4P2VA 4CD5A 3L0KA 3GBDA 3MO4A 3DJJA 3BG3A 3HQNA 2WKLA 1UROA 3WBYA 2NV2A 5DF0A 1DYSA 1ZHAA 3O1NA 1MUCA 4ZFCA 1AFSA 1MQQA 2POZA 1C29A 1DIEA 5D8WA 2I7GA 3MCNA 3ARXA 1A0DA 3K8MA 2G96A 3ZVHA 2C15A 4AB4A 2XIOA 2F84A 3AMZA 1CXEA 2FFIA 2O9RA 1GOQA 3STEA 2IKJA 5ABGA 4MWAD 2UY3A 1O6IA 3DKJA 1V0LA 3GW0A 4KRUA 3L4TA 4XG1A 1WP6A 1M6IA 2CW6A 2QUMA 2C14A 2R1NA 4Z1AA 2WHJA 2OZ8A 3A4XA 2XH0A 2C1IA 1UD8A 1H7RA 5KMYA 3UZ5A 4HHLA 4EMWA 2CXEA 4LW7A 4QLLA 2CZ5A 3EB4A 4AU0A 4DWSD 3EBVA 3N6HA 1E71M 2WZTA 4C6KA 2PDWA 4K39A 5GJMA 4JHMA 2HZGA 4S3AA 4F4RA 3NFUA 4JIRA 3GB6A 1W2PA 5H2ZA 2E6FA 3BARA 4JX6A 2OXNA 4HQVA 3P0WA 2Q8ZA 1KGXA 3FJLA 1D7KA 3KTSA 1IIHA 2Z29A 2D2HA 4E38A 2WM0A 3CPUA 3L5MA 5U4NA 4REQA 3SGUA 4WSJA 3YPIA 2GJPA 2F6UA 3W86A 4RZ4A 3CQIA 4GYJA 1PIFA 3HFYA 2R9RA 4GVIA 3DFTA 4GIRA 4D8LA 1QTWA 4NI3A 3W88A 3GZ3A 4Z1DA 4GA8A 2OQLA 4B91A 1R38A 1U1HA 4MFDA 1I1WA 3CXBA 1TRDA 5DMMA 3UPBA 4XZNX 1XC6A 3HF3A 3M0VA 5EGRA 1K4QA 4B16A 2Q71A 4K37A 3PJWA 3W1QA 5CZKA 5HOSA 1KWGA 3TAOA 3MKKA 1YDOA 1NP2A 1J10A 5CPQA 4JN7A 1TR1A 4D9PA 3BJSA 2IXVA 4DUXA 3BQ5A 1MEWA 2Q8XA 4ZOBA 1MO0A 3QGKC 2V2HA 3S9IA 3TQPA 2VDGA 1KW1A 4I9MA 3CM4A 3GFZA 3WL0A 1BSIA 1LL6A 2QV5A 3ARUA 3GH4A 4JGDA 2DW6A 2BY0A 3GW3A 3R2GA 3MWCA 4JS3A 2XSAA 2E6DA 4F3HA 4E3VA 4HA1A 5G4EA 2BOEX 2RFGA 1RA5A 3GU2A 4AZCB 3IPWA 3N18A 3TONA 1EP1A 3I7QA 3DC8A 4DO7A 1UR1A 1ZDLA 1GVEA 2Y24A 2ZQ0A 3QVQA 4B2DA 3PP7A 3VOCA 1GREA 3S6OA 5LHEA 4S3FA 5G2WA 4ZE5A 3NDOA 1C3FA 3BG5A 3NSXA 1JD9A 1DBTA 1Q6LA 4V27A 2PDLA 3WLIA 1BQGA 3W84A 4UWMA 4B5UA 1GGOA 4MLRA 2BSLA 1F2JA 4RCXA 4G7EA 1K1DA 1T41A 3JU2A 4KRTA 4MFEA 4HK6A 3KCJA 1TWIA 4L65A 3IUHA 1GPFA 1GJWA 1S5MA 2QJJA 2QF7A 3S1WA 2EQ7A 3VIOA 1B1YA 1UR3M 2V5DA 4UFJA 5FAGA 3WBXA 4L6OA 3SIZA 1S2WA 1E5NA 5G4WA 3TOYA 4HHHA 2V3AA 2WC4A 1UIOA 4O8RA 3TX9A 4HU4A 3W2JA 3F03K 4GX8A 1JCMP 3SQLA 4F2BA 1XBVA 3CMFA 1ADDA 3NQGA 3N4EA 3Q94A 3T1GA 1S46A 3FOKA 3ZYZA 1GSNA 4MKVA 4EXBA 2O55A 3NL5A 1X39A 6REQA 3UU0A 4UTHA 3GWQA 3P74A 2C0AA 3M07A 1EDTA 1QNRA 1JDDA 3QY7A 1ZBCA 3GBEA 5C0QA 1LVLA 2O7SA 4MZ8A 3W53A 1K7XA 4IF2A 1XIJA 1AMYA 3CJPA 1CW2A 1V4YA 2YB1A 2WV8A 2X8RA 2YL8A 1GVSA 2CLPA 3S47A 3AYVA 5HWNA 4Q8OA 2NWRA 3QXBA 3WD2A 2QCGA 2VZVA 1V3IA 4PMZA 3A5VA 4GO8A 4H4YA 5DXYA 1JRCA 2WSKA 1EOKA 1HT6A 3ITLA 3TA6A 4J3XA 3WDJA 1MDLA 2UY2A 1V3MA 1VJSA 2E6YA 3TTSA 3CHEA 2BODX 4PRRA 3PTKA 3G1FA 2B7PA 1CGVA 3G1HA 1JPHA 2E9BA 1H1NA 2ZE3A 2Q02A 1VKFA 3M0LA 3ZS4A 3FEQA 2Y8UA 4WEVX 3WK0A 4MAVA 2Y2WA 4AIOA 3O3RA 1OC5A 1QT1A 1R87A 1EO5A 1IZCA 4M6VA 2IKIA 2I5IA 3DYOA 4S3KA 4DBEA 4LQ1A 1AG1O 1WZLA 1R3YA 3NZRA 4PUMA 4JXCA 2OT1A 2VCAA 2FGLA 5FJOA 3NQAA 4O17A 1GEQA 3FHAA 3W7KA 5E1QA 4G7FA 1XANA 3AIVA 1TYPA 2YW3A 2X40A 1NOUA 4JTQA 4XZLX 2CITA 2EAWA 1DE6A 3O0KA 3TJ4A 1UJPA 2BTMA 3VINA 1XFCA 3IIVA 3SY1A 3WF1A 2GQ9A 1R2SA 4B92A 1SZRA 2Y7EA 3V75A 2J88A 1NU5A 3AWNA 1DXLA 3LV5A 5D33A 3U9IA 3BCDA 2CLEA 4ZQOA 1ZENA 1BXBA 5A8PA 3STCA 4P7LA 3C2RA 1ICPA 1LF1A 5D9MA 1OX5A 1FKWA 1EJSC 7ENLA 3E0FA 4LY8A 3IWPA 4QJ3B 2QYGA 3FLUA 4URIA 3VAVA 4N6FA 2VJXA 5HATA 1NFBA 3IJQA 4KGJA 1N5WC 3ELFA 3OYZA 3E0WA 5IBXA 3N6QA 1Q2SA 3UJFA 2F7FA 4H4QA 1TV2A 2ZXAA 4LUTB 1ML1A 3EPOA 4LU0A 1GW9A 5EMKA 4GBUA 4YTUA 3CTLA 4US5A 3H21A 1XICA 2VEMA 5JQ9A 4OVXA 3OGVA 1E73M 3HPAA 1OK4A 3HB9A 2CEQA 4R88A 1FEBA 1GWJA 1NHRA 3H4GA 3O6DA 2OX4A 1PKMA 2Z25A 1YPFA 2ZX8A 4IPJA 3GS6A 1UZ1A 5KETA 4DF0A 1X1OA 4HPJA 4YTQA 3MUZ1 4M56A 5JBEA 5F2IA 3DI0A 2DSUA 1MXDA 1BAGA 3Q67A 1EDQA 2VGGA 2Z1BA 3MMUA 1H62A 4GGBA 4G1KA 3NVZB 4HSHA 2ZRZA 2P8BA 1IZJA 3TFCA 4XZMX 1N61C 4FR6A 4XAPA 1AH0A 1XH1A 1QK0A 4QQUA 1XUUA 4DBSA 4ERGA 3CLMA 3JVAA 5I00A 3U6WA 3PTMA 2GUUA 4JIIX 3LBOA 1JDEA 2GVYA 2QDEA 1BWVA 1R9XA 5FCZA 4GWEA 3KX6A 4WRHA 2ACUA 1QOXA 1DJHA 2CZEA 3CUXA 3PJXA 3OHIA 1KFWA 5TBOA 1ITUA 3PK7A 2XM2A 2D2JA 4ZTYA 1W9BM 4FNPA 4WJEA 2X1TA 3RRAA 3SUWA 1KCZA 4AWUA 3TYCA 4D6IA 3VMNA 1D3GA 2D1ZA 4DBUA 1EJXC 1V03A 3VC6A 4NZ3A 3OGRA 1HUVA 4UQDA 1SM9A 1FO4A 2QUUA 4PSRA 1AH3A 1PDYA 1RLDA 2ZUMA 2CLIA 3GNRA 5FL1A 5A94A 4H8VA 4ONVA 1CXIA 2WMIB 4NNAA 1SZGA 1DTNA 3GC5A 4HYWA 3PULA 3MJYA 2DT3A 3WJXA 1MEIA 3PPCA 1XV8A 5FD0A 5IBXC 1JCYA 5E09A 4HU3A 1D9EA 3A7AA 3EZ4A 2DQXA 4LANA 2IS7A 3UJSA 1I9CB 3RUBL 1QK2A 3T09A 4HGXA 2J9YA 5CC5A 3APGA 3D47A 5CG0A 4EOUA 1YXDA 2QAFA 2QEZA 3VGEA 4MPKA 4Q7NA 4EPKA 2PP1A 3FAXA 2ZUNA 3GXDA 1M7OA 1AW2A 3LSCA 3LHTA 4F0KA 5BOFA 2BC1A 3WBWA 1EIBA 2PA6A 1EX5A 4HA0A 4M0XA 3PZTA 1XCWA 4LNYA 3CU2A 3FYOA 3E12A 3PZ9A 2NXHA 1GXFA 3RDKA 1LOLA 1WZAA 2VGIA 3PSVA 4HMNA 4Y9PA 3RAOA 3CBWA 1MI3A 4TMCA 3NZQA 1F3TA 1OCJA 2XUCA 4ROPA 3KDOA 3NS1B 3WF4A 2CLLA 4EPDC 1UD5A 1HKIA 1CENA 4F79A 3ITCA 3POCA 2J75A 4QEHA 1DIKA 4PMRA 1EJRC 4US5D 3OG2A 4LS2A 3WN6A 2WCSA 1SJCA 3W1TA 5M1TA 3DGRA 1WNOA 1QNSA 1FDJA 1SZEA 3WUFA 4O57A 1HO1A 1V3JA 4IFKA 1H2IA 1G4TA 4HOXA 3H55A 2VX5A 3R13A 3SCVA 3QC3A 1V08A 3KDNA 4UBPC 4LYPA 4GKTA 4I7WA 1XIHA 3IJ6A 4NAFA 2CETA 2GJRA 3M5ZA 5K4ZA 1Q6RA 3UG8A 2WBAA 1R0MA 3LERA 4F66A 1RP9A 4JYDA 1JZ3A 5FESA 4DQWA 2PGRA 3PPGA 3DI1A 4GH1A 1DWJM 1ZL1A 2BP1A 4CKQA 4JTLA 2FZBA 1BD0A 1NTHA 2ZDRA 1J5TA 2YJQA 4EANA 3CL8A 1J11A 4D6DA 1UBSA 4GNKB 3CK5A 5IOBA 4E0CA 4IGNA 3PJUA 2TPSA 5HK4A 1OADA 3FW6A 2G3JA 4HOZA 5C54A 1IWBA 1LT7A 1X8FA 5CZTA 4NT0A 3RF9A 1GJPA 3TN4A 3TNOA 3B8DA 1RV8A 3FV9A 3D5HA 4GQ0A 4N9DA 2NSXA 1UJQA 4PFHA 4K1GA 3RR4A 3C52A 4D8AA 2WW5A 1ZCCA 1BPLB 3P93A 1GZJA 4QBXA 3DC0A 4RZ6A 1E6ZA 3M43A 3G2GA 5BROA 4X0VA 5CPSA 1B9BA 3WH8A 2EQ8A 1L6GA 1UP3A 3IJ9A 3ZWSA 1POKA 4CEUC 4FNTA 1WKEA 4IFOA 3UQNA 4XD3A 1ISXA 4NU7A 1T5AA 4B3LA 1A5MC 3K8LA 2XWDA 1THFD 4BI7A 1XH2A 4F40A 3N25A 4LBUA 2CERA 4D6EA 4LUSB 1EDGA 3DGBA 3TDFA 3GH7A 5BXTA 1RR2A 3T8LA 4WY0A 2RDXA 7PTDA 2YFOA 3NGJA 3UCCA 2VFGA 3TZFA 1SO3A 1AQFA 3FS2A 4A3UA 2YXOA 1CXLA 2VFHA 4PGLA 1OC6A 2WPFA 4C6CA 2ISDA 1JZ7A 2XSBA 1MRQA 2ON3A 4QROA 1N63C 4A21A 4HSOA 4M51A 2YCLB 2C1HA 3PZMA 4DO6A 4CVUA 4UOZA 3F2DA 2MNRA 4DZHA 1XHCA 4Q4SA 4KCWA 4XVDA 2PRHA 1OC7A 1UBPC 4M24A 4X2PA 3CV1A 3BPWA 3OGSA 4S3BA 4H4PA 4UZUA 1XQLA 3DXIA 3QH2A 4PL2A 1NWRA 1HKWA 3QF0A 1KRAC 5C2CA 2WZMA 2WOWA 1OFDA 1C9DA 2QMKA 3LPGA 2QPSA 1OYBA 3OIHA 4WVXA 5AHMA 1I45A 4JICA 1O1HA 1VIZA 2F5ZA 1F6PA 4QEEA 2R1PA 3BOXA 1BZLA 1OWQA 4IIDA 1X1NA 4IJRA 3OHMB 3Q58A 4C6PA 5JIPA 4DUVA 4ZQPA 3ID7A 5DCEA 1DEDA 6ENLA 2TYSA 1R47A 4UFLA 4IISA 5A8NA 4GXMA 1HGYA 4R9XA 3CL7A 2FIQA 1XFBA 3KRZA 1JYXA 4WXYA 5A2AA 5I09A 2V2CA 2PDCA 1LOSA 4DF1A 2RUSA 3KZPA 2P10A 1DVJA 1QBBA 5HBFA 2IKGA 1HJWA 4A2SA 5CAHA 4WLCA 4RZBA 1PE1A 3PAOA 5KVHA 4DUWA 2IXUA 3KLLA 4YLWA 3NQ7A 1J4EA 5TQLA 1D2KA 1A53A 4E4FA 3KS5A 4RE4A 3MCOA 1QI0A 2I9UA 2DDXA 4OOZA 3MUY1 4DJDC 4E4PA 3WDHA 3TYUA 2PU1A 2X1IA 1Z3NA 3QMRA 5A6TC 2DZUA 2VVNA 1P5BA 4AF0A 3PPHA 3VTRA 2YCKX 1Q45A 3WUBA 1PVNA 3TJIA 5HNNA 3CPRA 2RH9A 4NIRA 2DIKA 3FN9A 1VPYA 4WCJA 2R1LA 3AYTA 4C7GA 4C60A 5HJXA 4AAJA 4MNLA 3IC9A 1DPMA 2P8CA 4X0NA 3OZOA 3NWRA 1XLLA 3HGRA 2I56A 5F2LA 3SZ8A 1RXOB 2XH7A 4FK9A 1C7TA 2OKTA 3FJNA 1VGAA 1KM0A 3FA3A 3DX5A 4C6NA 1XYCA 1VIWA 2AMXA 4DBWA 3ES7A 3VI2A 5I3JA 3AMKA 3TWAA 5HMDA 5J8LA 4GR1A 2TAAA 3G3MA 4MYXA 3TMQA 1CLVA 3AMCA 4J4KA 5K3VA 3CAKA 3WELA 1GVRA 2WP6A 1XGZA 5IDZA 1GT8A 4W93A 1Z9AA 3KVKA 2QULA 3EKZA 4EQXA 1LTDA 4TU1A 1H6VA 2XGBA 2B7NA 4KIRA 1QI5A 4LVGA 2Q09A 4JIQA 2J74A 1UPMB 4LYRA 3RCMA 1W8SA 3KS6A 3A9IA 4QQ3A 3KWSA 4X2RA 3NVTA 1BLIA 1XRSA 2NQ5A 3LPFA 2ZZ3A 1FWAC 4Y9MA 2VR2A 1L6SA 3DECA 1H7OA 4WR3A 1TE6A 3LB8A 2O4QA 1XYZA 2G3NA 4MGGA 2HMCA 5AHFA 5I3DA 4EXAA 2WZHA 1UKTA 1PX3A 3TCEA 3AOFA 3MUCA 4N0RA 3WFLA 4GHRA 2HQMA 1GRBA 2H9AB 4E8GA 3NO1A 3R94A 1Y65A 1GVYA 3LLXA 1B4KA 4Q32A 5C9ZA 2X0SA 1EX1A 4DLFA 3SQMA 3PF3A 1TPVA 2GGHA 2QKFA 3GKFA 4GOAA 4W4QA 4A3YA 1BVNP 1R3SA 5CBIA 2AL2B 4GRTA 2HS8A 3HOJA 4HTBA 2WNNA 2EBNA 4L6HA 3EWCA 1NP0A 1A3XA 4S3DA 1XLBA 3RM8A 3PR2A 1XIFA 1IXQA 5LA1A 4NNCA 1AOGA 2FB2A 3LK6A 1PAMA 1WB0A 2C16A 2ZC1A 4Z2HA 2XU2A 4HSNA 4K8DA 1V0KA 5I03A 4EP8C 4Q4KA 2XFWA 3SN0A 4BCEA 5AHLA 1KRBC 5BYWA 1YNQA 3LG3A 4YWSA 1VQTA 4L4LA 4H04A 4JIPA 3FSTA 3VNLA 4V28A 2FTYA 2Z2UA 2KAUC 3LENA 4MMWA 3NVVB 3AMDA 1NF0A 1Q1WA 3GFXA 1HQTA 1Q6FA 5DCBA 1KM5A 4NZ5A 3WKZA 1V7AA 2POTA 1SW3A 3GRTA 1GKPA 2A85A 2Y62A 4FX7A 3O07A 4N9BA 1FECA 1C8YA 6TIMA 3LLFA 3G3DA 4PMYA 1V3LA 3DG7A 3ZWTA 1R7AA 5HR7A 4WD0A 3A5FA 2JFEX 2J25A 3W1LA 4XWUA 1TV4A 4RNJA 2HQAA 3L2IA 3QR1A 3B8VA 4DF2A 4IL0A 1Z8AA 3BAIA 1HKJA 1GOWA 1S2UA 1G5AA 5LNVA 1J9YA 4PH6A 3UCDA 4EIVA 4UNIA 2QJMA 1SZNA 2OZ3A 1VJIA 1SO4A 3QQ0A 5D2VA 8TIMA 1CNVA 4NZ4A 3HG4A 2PDYA 3LD5A 4HTYA 3KL5A 1LOQA 2RAGA 1BYCA 3P0XA 4JFSA 2X0HA 2HEJA 3GTFA 2PDUA 2P3ZA 3ITOA 3OTRA 3GXMA 1S2VA 1VEMA 3EDEA 3GTIA 4P8WA 4NILA 1R46A 2FHFA 1ZZMA 4QE1A 1F07A 3BSHA 4PODA 4R53A 1E4NA 5FL0A 2YL5A 4GXWA 3NEVA 3TKFA 1O5RA 2RKXA 5CJNA 1JUEA 4WJ8A 4HNCA 3ICJA 4MVAA 1KBJA 1WYIA 1WOBA 4QE4A 1GOKA 2VI0A 3LBMA 3ABZA 3BLLA 2F8QA 4GUJA 4AD1A 1DE5A 3G1VA 4U10A 4PCTA 2ASHA 3UZXA 3GG8A 3PBMA 1JCNA 4A3RA 4PTWA 3O6CA 4MDOA 4RXGA 3M44A 3UWWA 3EMQA 3LGGA 3UF9A 4QDMA 4JKKA 4IP5A 1V6XA 3S8HA 2DU2A 2O92A 4S3CA 5L9FA 3KRUA 4ZR8A 2VD9A 1ZJIA 1SFSA 1QVBA 1AQ0A 3B3DA 2YDQA 1YADA 2FDMA 4TQTA 3ECQA 3GG7A 5AHIA 5A6SA 2Y8KA 3F4WA 3EDKA 5M17A 1GEHA 1UR9A 1KR0A 2W55A 4JDYA 3SIMA 4O0KA 2D22A 4DBDA 3G1AA 1PCKA 4CN6A 3QW3A 3TYEA 1GQNA 1JGIA 1ZSXA 1NF7A 3BV4A 5I5RA 3W2KA 3GG0A 4JNZA 3IUIA 3QTGA 1C93A 3CO8A 2DSZA 3KOXA 2UV8G 1BWCA 3CZKA 1V5XA 3CTTA 4HD5A 5I3IA 4U4MA 3CHCA 1TWWA 1VPQA 1HJXA 3UA3A 4FLRA 3BW2A 2GSEA 3C61A 1KXQA 2OCZA 1VCGA 4FNRA 4MG4A 1E0TA 1Z89A 2INEA 4IGSA 1F74A 5BU9A 2ZZ4A 1W9DM 4OKDA 3E49A 3VIMA 1IWAA 3ZR5A 4CN4A 2G5WA 1TQXA 4BK9A 4GZJA 3QFWA 3C4UA 3T4WA 4EVZA 3EOLA 2DT1A 5CXPA 1GHSA 4LX4A 5IFPA 3VIJA 3H24A 4AWSA 4YU1A 3W76A 4MDPA 4Q8NA 1UUQA 1V6TA 3L2LA 4S23A 4RLIA 1I0DA 1UD2A 4E8DA 1IV8A 1WOAA 4ASTA 2E28A 2NLIA 3MDWA 3UY7A 5DFAA 3TSBA 4BA0A 5K2ZA 2Y89A 4J2PA 4QM1A 1BVZA 3AJ7A 1TMHA 1EEXA 2QCNA 3CLWA 3RRXA 3RU6A 2HRWA 1HL9A 3U2CA 1I60A 3GE7A 3UWYA 4JY9A 1UD6A 5D32A 5TIMA 1JFHA 1XYMA 2GPTA 3B97A 3ZM8A 3SUTA 3PY2A 4AEOA 2WVSA 3TYAA 5LIWX 2WPCA 3WD3A 3TN6A 2VXNA 4JTDA 1W9PA 2VELA 2YA1A 4GG9A 3RO6A 2PBOA 3DYPA 4JTJA 2Z0IA 1OG0A 3AHVA 4IPNB 4H4WA 4JX5A 1R3TA 3N34A 3WK2A 4CNNA 2TODA 1YDYA 5MHBA 4U5KA 1C8VA 3F4DA 3OBKA 4ACYA 3SY5A 4WK9A 3W24A 3SR6B 2Y8VA 2VNCA 5C2GA 4AX7A 2FQIA 4LSBA 4UXDA 4EE9A 3LMYA 4ERIA 4Y6GA 1IT8A 4FEZA 1RJRA 2QGYA 2P50A 2Y1HA 4P7NA 5FS8A 5G4HC 4L1GA 2W3ZA 2X41A 2X8HA 8XIAA 3S6DA 4YTSA 4ICCX 1TJ1A 2VQTA 5AFDA 3PBGA 2WVVA 4DWDA 2DT2A 3B9OA 1V3HA 1IXPA 1OGSA 4OZOA 2XGIA 5HJYA 3MV01 3Q37A 6ALDA 4XUYA 2PZNA 4HA3A 2OB3A 3V1HA 5JRBA 3CMJA 3VK5A 3FSUA 1RD6A 3NA8A 2ICSA 2BHZA 4JKMA 3WSUA 1OX4B 2F6KA 5ABHA 6XIMA 4C6QA 3DFNA 4YNGA 2ZUVA 2Y0FA 4FOKA 3BSGA 3QBUA 3N2CA 1EJTC 4A8LA 2G37A 3KUMA 5FF4A 1NOFA 2D0FA 1XLHA 1KCXA 1OZQA 2FYMA 2PDNA 3A12A 4M82A 1E0UA 3S2MA 1LL7A 2E5AA 3WLMA 2VMFA 4F0LA 4TOQA 3W7QA 1EQCA 4LH8A 1IR1A 3SFKA 3BAWA 2ZRUA 2PLMA 3R7MA 4FLSA 5GNZA 3PB2A 1BGGA 3R79A 4IPIA 1FEAA 4H4SA 3QW4B 1TZ7A 2WZIA 3S42A 3PUGA 1X1ZA 4DUOA 3E2SA 3CEUA 3OLEA 1IZKA 9RUBA 3E96A 5FOOA 4E2DA 4H7ZA 2CKSA 9XIMA 2C19A 2BXYA 3KL3A 3QFBA 5KZEA 1GONA 2IPFA 3E0IA 5D04C 2W3RA 3OQEA 4H6QA 4QR6A 4BF9A 3L4XA 3LNPA 2A5HA 1YMYA 4J3WA 2A0NA 4HMEA 1BRLB 1UC5A 3UJEA 3UEQA 1F3PA 1FQ0A 3GU1A 4Q8WA 4P8UA 2Q01A 4NL1A 4MM1A 2ISVA 1XPGA 2XZ7A 1M7JA 3KBVA 4CVWA 5GNXA 4O11A 3FA4A 3TQ0A 1S2AA 2B81A 1LBFA 1BKSA 4C1NB 1E9YB 4EMJA 1P4CA 2WOIA 1HKKA 4KEMA 5DRCA 4W89A 1W54A 2JF7A 1EHNA 3HPXA 3S2NA 2PDFA 1AJ0A 3NQMA 3HPFA 4OGZA 4NAFB 2BG5A 1IF2A 2Y7DA 2CYGA 1UW9A 4I5XA 4RUBA 1MO9A 1H0GA 3RNMA 3R1ZA 3EDFA 2FJKA 1E6RA 4CCCA 4HYVA 4FLOA 1WO2A 1N60C 2OLAA 3GNDA 2WQDA 4GIYA 2J24A 1RUSA 5LIUX 3UJ2A 2X7VA 4QJ5B 4ZB2A 2FVMA 1QOPA 3F2BA 5AZ1A 3K1DA 2FVKA 2QUTA 1XSKA 3OLIA 4R34A 4DELA 4MOZA 4QCEA 4DZ5A 3ABQA 3QZAA 2NVDA 1WKFA 4DXXA 2GGIA 3SADA 3AUOA 4H83A 3NPWA 5EB8A 1CECA 4YCPA 3ZT6A 3VDBA 2P5NA 5EMUA 4Y90A 2YW4A 2OWCA 2DUXA 4KWWA 1AJZA 4WGHA 1CGTA 3ZJ6A 4JQ1A 3W6LA 1QASA 1S3TC 2AKMA 3GIYA 1P7TB 1B90A 3W7EA 5A8MA 1QR7A 3H54A 2J3NA 1YLVA 3P5ZA 3SW6A 3WQFA 4M6UA 1JUKA 1E0XA 2I16A 3B0YA 3NOYA 1Y8BA 4FALA 5MKGA 4XKMA 3SGZA 3O2LA 4ZA0A 3D46A 1UUMA 3G24A 1REQA 4JTSA 2JEQA 2GR0A 4GACA 4LAKA 1G4SA 1QO2A 3NR0A 4XB3A 2CWNA 3VZYA 1S3HA 4L61A 2G3MA 2V5JA 1DORA 3GR7A 4O0ZA 3E6EA 3ONCA 2QGHA 3KVMA 1OFQA 2VZUA 3KBMA 1ME7A 4K2SA 4LS0A 1I2QA 1PSCA 4L7ZA 2A3LA 3GDRA 2Y63A 2PDMA 3OO2A 3LSBA 4JTUA 3M6YA 3MQTA 4IX0A 2OU4A 1F76A 5LIKX 1XG3A 3KWXA 2PGEA 2VGFA 1Q4NX 3CT7A 3JUGA 5G2IA 2QJGA 4LC8A 2FTPA 4LS1A 2OEMA 2IPJA 5T26A 4QHRA 5ABFA 4S39A 3BICA 4GABA 1JEZA 4JOMA 3ZLHA 1ENUA 3BZJA 4TV6A 4A6GA 1GRGA 1H41A 1JL8A 1XSIA 1EL3A 2QAPA 3AIEA 2GLKA 3G1XA 4OV4A 5D09A 2PDBA 1EPXA 3AIWA 2NV9A