4HCLA

Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium and l-lyxarohydroxamate
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
384
structure length
384
Chain Sequence
SHMIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isomerase/lactonizing enzyme
publication title CRYSTAL STRUCTURE OF D-GLUCARATE DEHYDRATASE FROM AGROBACTERIUM TUMEFACIENS complexed with magnesium and L-Lyxarohydroxamate
rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 139
structure length 384
sequence length 384
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hclA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hclA01
3ZLHA 4H2HA 1NU5A 3PWIA 2AL2B 2P88A 1JCTA 3T8QA 4FP1A 3OP2A 4KEMA 1FHUA 4GISA 4HPNA 2PU0A 1XPYA 2OQYA 4KPLA 3I6TA 3PFRA 4IL0A 2O56A 2PGEA 3TTEA 3IK4A 2GGHA 2HZGA 3QTPA 5BOEA 3VC6A 3GD6A 4G8TA 3TOYA 1WUFA 3UJFA 1MNSA 3MY9A 3P0WA 3R11A 2PTWA 2OQHA 3CYJA 4IZGA 3EEZA 4JN8A 1MDLA 3MWCA 4GYPC 4M6UA 1SJBA 2AL1A 3H7VA 5FJOA 1SJAA 3RCYA 3RR1A 3P93A 2PODA 3QLDA 3UGVA 3VDGA 3SN1A 4IP4A 7ENLA 3ZVHA 3DEQA 1L8PA 3NFUA 4H83A 2PMQA 2OPJA 3UXKA 4DN1A 3SQSA 2GGGA 2PP3A 2XH0A 3UJ2A 2GSHA 5J04A 4JN7A 3MUCA 4DHGA 3N6JA 3NO1A 2GGJA 3IJLA 1OEPA 1EBHA 3MZNA 4F4RA 4H1ZA 3U9IA 4KWSA 2GGEA 3BJSA 3RO6A 3DG7A 1P48A 2PTYA 3FV9A 5FJPA 2PA6A 3UXLA 1TE6A 2RDXA 3CAWA 1E9IA 4X2PA 1R0MA 3IJIA 3VC5A 1ONEA 3UJRA 3H70A 3MKCA 3I6EA 2HXUA 3R0KA 2ONEA 3TCSA 3N4FA 4K1WA 4Z17A 4A6GA 2AKMA 4HCDA 4GMEA 1NELA 2QDDA 3BOXA 3TWAA 2PCEA 1W6TA 4J3ZA 3GY1A 4J1OA 2QGYA 2OFJA 4GYPA 1EC9A 3DGBA 1KCZA 4ZCWA 4E4FA 3OPSA 4GFIA 2HNEA 3SSZA 4EWJA 2GDQA 3FVDA 4HCHA 2FYMA 3RGTA 3N6HA 1RVKA 2PGWA 2OVLA 5BOFA 3P3BA 1TZZA 2QDEA 3DDMA 2CHRA 4HCLA 3U4FA 1JPMA 1BKHA 3R10A 4A35A 3FXGA 3Q45A 3DESA 3VCNA 4DWDA 2PS2A 4YWSA 3V5CA 2P8BA 3NZGA 2P8CA 1SJCA 5ENLA 3HPFA 4MKSA 5FJTA 4E4UA 3CT2A 3H8AA 1KKOA 4MGGA 2QJMA 3I4KA 2AL2A 3TWBA 3TW9A 6ENLA 3QN3A 3CB3A 3MQTA 1TKKA 3DFYA 3OZMA 1KD0A 2OZTA 1DTNA 2DW6A 3R0UA 2P0IA 3EKGA 3QKEA 1YEYA 2NQLA 2GL5A 3CK5A 3RITA 3ZVIA 3DFHA 3MSYA 2PPGA 3PK7A 2XH2A 2OG9A 3SBFA 3ES8A 3UCCA 3THUA 3GC2A 3VCCA 1KKRA 3KUMA 4E5TA 4FI4A 4H19A 2DW7A 4KT2A 3S47A 2POZA 3NXLA 4K2SA 1MDRA 4A3RA 1MRAA 2OZ8A 2OKTA 1SJDA 3TJIA 4E8GA 3ZVHB 5FJUA 1P43A 2ZADA 1EC8A 2OX4A 2PSNA 1FHVA 4HNCA 3ZLFA 1PDZA 3R25A 2QJJA 1IYXA 3B97A 3PWGA 4K8GA 3V5FA 4DYEA 4M0XA 3OZYA 3DERA 3SN4A 3UJSA 2MUCA 3SJNA 3ES7A 3ZLGA 1EC7A 1BQGA 4ZA0A 2QVHA 4MMWA 2XH4A 1PDYA 1ECQA 4JHMA 4DX3A 2QJNA 2XGZA 3T4WA 4G7FA 2PP0A 3FYYA 3OW1A 3TJ4A 4IP5A 3T6CA 2OZ3A 1R6WA 3CXOA 3RRAA 3VFCA 3DIPA 3UJEA 4ENLA 2P3ZA 2XSXA 2AKZA 2OO6A 4E6MA 3OTRA 3VA8A 5IDZA 4HNLA 3JW7A 2ZC8A 1JPDX 2PP1A 4Z1YA 3BSMA 3JZUA 2OLAA 1MUCA 3STPA 4HN8A 3IJQA 1F9CA 3T9PA 4GGBA 3FJ4A 2PU1A 4ROPA 4IHCA 4GGHA 3V4BA 2PTXA 4HYRA 4GIRA 3D46A 1JDFA 4DXKA 4IL2A 2FKPA 2PTZA 3FCPA 5FJRA 1EBGA 3SN0A 3V3WA 3TQPA 2XH7A 3K1GA 3JVAA 3D47A 5EU9A 3QPEA 3Q4DA 2HXTA 1ELSA 1WUEA 3DG3A 3GO2A 2MNRA 3DG6A 2GGIA 2QQ6A 2I5QA 3S5SA 4IT1A 3H12A 1XS2A 3R1ZA 3ENLA 3N4EA 3UCDA
chains in the Genus database with same CATH superfamily
1ME8A 1ZSXA 2XWDA 4UOQA 1I2RA 4C7DA 1QO5A 2X7WA 3AUOA 5CPOA 4GY1A 3E6EA 3NEHA 4UQDA 2VJXA 2HCVA 1UCWA 5JCKA 1J5SA 1Z3NA 4JDBA 4DZ5A 4GISA 1AZ1A 4UQAA 4FEZA 1MW3A 4IM4A 2CEQA 3L4UA 2QR6A 3RR4A 4DY1A 4PUJA 3XIMA 4Q6XA 3M0VA 4O53A 4IPIA 3EXTA 1V97A 1OT2A 2CZVA 3R11A 4PMRA 4DVOA 5C7HA 2OEMA 4GBDA 4F40A 1V59A 2EXOA 3BGGA 3HIJA 5FF3A 5CZTA 4H6QA 2J7BA 3LGDA 4CCDA 4GKLA 5E5CA 4NF7A 2TODA 4NNBA 1D7YA 2IKGA 1WCGA 3W38A 4EKJA 3NPVA 3NM1A 4M80A 3UGVA 4LY4A 1JAEA 4IP4A 4AWSA 4MVAA 2E8ZA 1B3XA 2X09A 1R3YA 1G01A 3WL0A 4E8CA 2W55A 3PP7A 1GHSA 2PC4A 5J8LA 3UJ2A 5HAOA 4AVFA 3PTMA 1EJSC 4AH7A 4JIQA 3MUCA 2J3NA 3DFSA 3CTTA 3L2LA 1MOKA 1UC5A 2D24A 3O16A 4U3AA 2Q8ZA 1ZNNA 3UWUA 2OJPA 5JH2A 2E7FA 4W8AA 4NZ3A 1UOZA 3IV8A 1LOSA 5EB8A 1UC4A 1GJUA 4HU0A 3QV8A 4UTLA 3AC0A 3S9YA 1GRGA 1CXFA 4GI4A 4FXSA 2VO5A 3TJLA 3CZKA 3AICA 3W6YA 1IHIA 1HJXA 1ZU8A 1IZCA 4O19A 4MSSA 2Z1VA 1JZ3A 3E5BA 1X98A 3S2MA 3AHXA 5HOSA 4JHOA 2BOFX 2Z25A 1KRCC 2PCEA 4KERA 5G4HC 2BY0A 3W2LA 2WZTA 2V3AA 3GH7A 3R89A 4B5WA 4EQXA 3DGBA 4AXKA 4X61A 2C1GA 4QX4A 1T96A 1ZAIA 2ZWZA 1UMLA 1AL7A 2X2YA 4ATWA 2OLHA 5ER0A 2DZBA 3T78A 5DMYA 3C6CA 1PEZA 2FIQA 3BOFA 3H2NA 3ABZA 1K70A 4KIEA 1MO9A 5BXTA 1O5XA 3PG9A 1XIFA 4A8IA 3STGA 1GVQA 3N3TA 4B91A 3QPYA 5ABTA 3JU2A 1T8QA 1XGDA 2QT3A 4LVFA 2PURA 2QS8A 3VIHA 1OJXA 4ZXLA 5JIWA 2TYSA 3PNZA 3IV3A 2EPLX 2FH6A 2WCAA 3W7JA 2P0IA 3AIWA 3VKKA 1JZ4A 4IQEA 4HK5A 3VOIA 3RIKA 3QKEA 4DQWA 3P62A 3VOCA 1OBAA 3M64A 2PDFA 2FDMA 4RNHA 2ZVIA 4WKAA 5M03A 4IQJA 4W84A 3ZT7A 1D7KA 1LBLA 2PDCA 3RK8A 4GZ7A 1SFJA 1N7KA 4Q3MA 1O4UA 3G3DA 1RK6A 2NX3A 1AQFA 3O8AA 1AQ0A 1ESWA 2V5KA 3FAXA 4LVBA 5FL1A 4HZ7A 1GT8A 4DF0A 4E5TA 4EK7A 4FI4A 3OGVA 3DC8A 1AFSA 2E6AA 5C7VA 4G2DA 3W88A 1FA2A 4DBUA 3S6DA 1LORA 3H21A 3VGFA 1Y5VA 3EOEA 4HYVA 4KBXA 2XGIA 3S1VA 3EDFA 2GVYA 3MW7A 1IXOA 2Z0IA 5E6YA 4LW7A 2RUSA 3R94A 3SY8A 2VCAA 3NQ7A 3AMDA 2DPEA 4B2DD 4ZFCA 5A3HA 3M6DA 5I07A 1ZBKA 2W79A 4DBWA 4QGCA 4FO4A 3BLIA 4TXEA 1BKSA 4WEVX 1DNCA 1B1YA 4QROA 3C2OA 4G6CA 4BI7A 4JTRA 4FF5A 1D3GA 4RE4A 8A3HA 3QJAA 4O17A 2AQWA 1WOBA 4JCLA 4AW7A 5EMJA 3W75A 3VNIA 4HOXA 2E5DA 2BNJA 2Y4SA 3HTWA 4TVUA 1DHKA 2ZQ0A 2PWVA 4C6QA 4OWGA 3MYPA 5KZ6A 3CV2A 4RV3A 4L4OA 2YDQA 1IWBA 3GXDA 4YVVA 1O5QA 2OQLA 4BHYA 3NCOA 2J77A 1F73A 1A0CA 4NL1A 2C13A 4LCQA 4JPGA 3WQOA 1MI3A 2WKJA 3ARRA 1SFTA 1ONXA 3NSNA 3AS3A 3K4DA 4GI9A 4ADTA 3QR1A 4X0VA 3E0VA 3KRSA 4OBSA 1CEOA 2QAFA 3WJSA 1A0EA 2BY3A 1KQYA 4KMQA 5GNZA 3BGJA 3OBAA 4L5ZA 3R79A 3AJXA 3FDGA 3H6OA 4LJ3A 4O18A 5MHBA 3AI0A 3W2JA 2DU2A 3WNOA 4PULA 3WNNA 1KBKA 2UWFA 1PKNA 5L6UA 1FRBA 1PSCA 4MWAE 2VGBA 3UZXA 4OOZA 2OOGA 2R91A 3CPRA 3R1ZA 3KE0A 1K7EA 3LENA 2Y5EA 3AHVA 5EPDA 4AY7A 3PG6A 2EHHA 3WD2A 4PTXA 4DLFA 3SGZA 4BR1A 1E0XA 2PDIA 3RX4A 3PBGA 3UESA 4GJ1A 4P7OA 4B92A 3QHNA 5I3GA 1P4CA 3BQ5A 4HPNA 1GEQA 1JGIA 1XPYA 3NDOA 4JS3A 4R7WA 1RA0A 4GQRA 2F6UA 3NQMA 3ZZ1A 2HK1A 3POCA 3PFMA 3SIZA 1OFBA 4UNLA 3IUDA 4HHPA 4MKNA 3S83A 1PX8A 4AZGA 1RJPA 3CT7A 3ABRA 5IXEA 2OQHA 3EEGA 3O6AA 2V82A 3EPOA 3MWCA 1VDVA 5A8GA 4FIQA 3UG5A 1TFVA 4HHHA 2CU0A 2ZX5A 5E93A 3QC3A 3RR1A 1KN0A 3TV8A 1ZJIA 5BXRA 3K13A 1KR1A 1JZ7A 2UV8G 3W4RA 5CG0A 1OF8A 1AJ0A 1XYMA 4L6OA 2GR1A 1W8SA 3NYDA 5FJJA 3WH8A 2WCGA 1DJZA 5A94A 3EANA 4PFMA 4JN7A 1QPNA 4XZNX 3NO1A 3TN4A 3N19B 1ISYA 2XU2A 2GJPA 1VFFA 5HINA 3VGEA 2VGFA 5DY3A 4NQ1A 2Y1HA 3QMRA 2Y7FA 3NQCA 3W7GA 4YMZA 2E5CA 1KV8A 4L64A 2Y8VA 1UJPA 1NY1A 3AZRA 3NDYA 4O8RA 3BLPX 5FF4A 3NVDA 1LF1A 2ICSA 1V6TA 3T55A 3QZEA 1LM1A 4EOUA 1Q8AA 5LIXX 4WSHA 1B0IA 4JQ4A 5DEZA 3GNNA 3RFAA 2DT3A 4HNOA 3VPLA 3QMTA 2ZWYA 3T0AA 3RU6A 3TYZA 1R2RA 4XVDA 5FEWA 3L0KA 1NDAA 2D2HA 2WNWA 1XBXA 3P2VA 4JIIX 4QQUA 1N8IA 3SCQA 3VNYA 3KZPA 1KV5A 3HFYA 4F0HA 2E09A 5A6JA 4XD4A 3KCLA 2ZA1A 3G8RA 2AGTA 1A0DA 4IFKA 4MDOA 4R9OA 4FHAA 2ZZ7A 2OWXA 2ODOA 3W29A 1P6BA 3ZM8A 1O60A 4HOZA 2YAUA 5I3KA 2PGWA 3RO8A 3NSXA 4LUIA 2WOIA 1TZZA 5AECA 2VR5A 3GTIA 3DZ1A 1ZJBA 4JTUA 3FXGA 2GDUA 1JDDA 2F5ZA 1K4QA 3TNOA 1E40A 1EFZA 4FAMA 1WDRA 3W00A 2WKGA 2CBJA 1STZA 4BF7A 3C2RA 1K6AA 2WSPA 1YW1A 3BPWA 1B31A 1N63C 3ABOA 6ENLA 1CPUA 3AIRA 4HK7A 1GOXA 3ZSTA 1WO2A 2FZDA 3CLMA 3W1NA 1BYAA 1FFQA 4IOTA 5ABGA 4FX9A 3L0GA 5KVHA 5G1TA 3SRHA 4F66A 5D9PA 2ZBTA 2F6XA 1J0YA 1XLHA 1G94A 3KZSA 1E6SM 3QR0A 3MANA 3TKFA 1V51A 3GNDA 1P0DA 5I23A 4HNVA 1K03A 4GFSA 3VK5A 3CMFA 1IZJA 3LNPA 1CXHA 1NWSA 4RZBA 1IIHA 3BLLA 3H26A 3MP4A 5CJMA 3RLGA 2OG9A 3SBFA 4B5XA 3H7UA 3THUA 2QEZA 2YA0A 3EPNA 3W74A 1EJWC 3VDAA 1QOQA 3RJYA 3GDTA 4BI5A 1VBJA 4EVZA 4KT2A 4DLMA 3S5ZA 3IACA 4P8UA 4JHZA 2C8NA 5D4YA 1WNOA 2CYGA 4NVTA 1XHCA 4O54A 5JCNA 3AXKA 3ZJ8A 1QI0A 3TJIA 1Q65A 5C71A 4Y2WA 2X99A 2J47A 4DJDD 2BBFA 3OGSA 4Z1BA 1DJYA 3CZ8A 2QJJA 1R3VA 4TX6A 3WEZA 2D3LA 3E5PA 3PB2A 2I9UA 4I7UA 2A6LA 1H3GA 1F07A 1FCBA 4M0XA 3EXSA 1H7XA 1OK6A 3GHTA 1SSGA 3DJGX 1BF6A 3PULA 2CXGA 4K7YA 4TV5A 3BSHA 3QZ6A 4Q7NA 5LGXA 5CC5A 1GEUA 3WEMA 1RQEA 1LUCA 4I7VA 4RW5A 1X8FA 3EWDA 4L4MA 2ZUVA 4BS0A 3GZAA 1IXQA 3A23A 3LHZA 3CWHA 4C6MA 1AODA 3CHCA 2GWGA 2HBXA 1TJ2A 2IPFA 1SZGA 2W9MA 1O1HA 3REQA 4E6MA 1WA3A 3W7IA 3PBUA 1I2NA 1XF0A 5DBTA 4I9AA 2JGYA 5ECVA 4Z1YA 4US5A 5A8MA 3GFXA 4QJ4B 1MUCA 3GU9A 3C0QA 1K8XA 3UR2A 1L6FA 3ID7A 3PZUA 4QE5A 4QLLA 5I00A 2NQ5A 4JTQA 5ABEA 4DZAA 1VFOA 2NT1A 1OYAA 2BG5A 2V0TA 3WLIA 4PODA 4L80A 4DAIA 3E2VA 3LZ3A 3NZPA 2VZUA 1W1YA 4MUZA 4WGHA 5J5DA 2ZX6A 3BV7A 3JVAA 4IFKB 3GR7A 3AYSA 2P1FA 3HPZA 1FFVC 2VP8A 1WOAA 2J75A 5A1AA 1VPXA 3DFTA 3DU0A 2YGYA 1P7TA 2A1YA 2NQJA 3DK4A 1QOXA 3JS3A 2CZ5A 4YS1A 1PO9A 2CLHA 3L5AA 2PBOA 1XANA 1CWYA 4WSJA 5IFPA 3TDFA 3DX5A 3I3EA 3B04A 3W24A 5FEXA 5FL0A 3R8GA 1EO7A 4H4RA 3F4WA 2PE4A 5T91A 2NLYA 5AC7A 1OC7A 3VILA 2J27A 1B5TA 5CSSA 3OB8A 1FH7A 2DH3A 3TLLA 4WJXA 1EA9C 3MP3A 1VH7A 3ITCA 3KVMA 2VFEA 2VGGA 2PGFA 5TNVA 2VELA 4KWWA 4H00A 2Z27A 3WMCA 4XD5A 4NAEA 3QR3A 3VNDA 1ZHAA 4JQ1A 1L2UA 1K8ZA 1YYAA 1BVNP 1ENUA 3JZEA 2V6AA 1V02E 3CUIA 4PMDA 3ZYZA 4B3KA 3D3FA 5G2IA 2QF8A 3WDJA 2PWUA 1R3QA 4L1GA 1EZ2A 2EKGA 2PMQA 1Q5MA 2B7OA 3OLGA 3TAOA 1XDMA 4ZOAA 2OLSA 5BROA 1ZB5A 4YPJA 3DH9A 4GO8A 6TAAA 2YFOA 1B90A 2Z1WA 2CLMA 4UNIA 1BD0A 3EDEA 3O1NA 3M44A 4MIMA 1A50A 1ONRA 3U2CA 4UFHA 3CQHA 3W71A 2UY5A 4Q4PA 2BGSA 5D30A 5H8UA 3LXDA 3MZ2A 2Z29A 2Z1KA 4G56A 2OMAA 5DO8A 5G2HA 3OG2A 1XSJA 4W93A 2ZX8A 1JQXA 4F2UA 3CQ0A 5FF2A 2WBKA 4IIFA 4MF4A 3EWYA 3MKCA 3TQKA 1EH9A 3K30A 4D6IA 1POJA 3LHWA 1Z89A 3REQB 3CL6A 1MQQA 1JDEA 1FQ0A 4GMEA 2Y2WA 1ISWA 4RE0A 1N82A 3M6YA 1RP8A 5LNVA 4N4QA 3TOPA 3GY1A 4ZQCA 4Q4SA 1XUZA 1S38A 2JALA 3AIBA 1LLOA 2DVUA 4GPNA 3F4VA 4W88A 4QAIA 2PDUA 4Z2JA 3HJZA 4J57A 3NL3A 4H8UA 1AQHA 3BAKA 1BKHA 3R10A 3QOMA 3Q45A 2FJUB 2OO0A 2X1TA 2PTDA 1WBJA 4DXVA 1BSLA 2WPFA 3ABQA 3PTDA 4GIYA 2H8ZA 1EXBA 5ENLA 3W81A 2OODA 3GG7A 5HJLA 2BOGX 2V3EA 4AVNA 1P7TB 3CEUA 1ZENA 4QS6A 3WQDA 5CGQA 4CD6A 3WIJA 3H2OA 4R27A 4BWLA 1GOOA 5C9WA 3MJMA 3LMZA 1TKKA 1D9EA 1PVNA 3A22A 1DTNA 2CETA 1M01A 4PTDA 3RG6A 1JEHA 4Y8FA 4FIRA 5EMKA 3EKGA 1QNSA 1TTPA 2NZLA 3PY2A 4JIRA 1ZJHA 1YE6A 1YEYA 1VJZA 4EX4A 4JTLA 3L4VA 4XZWA 1RY8A 3GXMA 2PBGA 1OABA 3ZVIA 2PLCA 1E4IA 4A3HA 4G1KA 3NGFA 4OBRA 4BEUA 3MSYA 3GW3A 3BO9A 2VQTA 4NAEB 3UCCA 1OADA 2GPTA 1V3HA 4KFPA 1D3CA 1PL9A 3KUMA 4Y9AA 4B5VA 1Z8AA 1YPXA 3TQVA 3C52A 4RXFA 3L8KA 3RM4A 1V3LA 3VOJA 3S4TA 4R5EA 4E8DA 4XZLX 2YYTA 3E0WA 5C8BB 1MDRA 4FNUA 3U2OA 3L12A 1W1ZA 4N9EA 1A5UA 5H91A 4UIOA 1UWRA 1VHNA 1S5VA 3RLHA 1O12A 3P5YA 1AVAA 1QT1A 3BK0A 1GKQA 3MUY1 3TTQA 1S3HA 2IQ0A 2QNEA 4Y9MA 4EANA 1A5KC 4GZJA 3AMZA 3RPDA 3PG8A 3F5JA 1F6YA 4ATDA 2C7FA 3LS9A 3MDWA 1QTWA 1TPFA 1UR0A 4EPDC 3DERA 5H1WA 2QCLA 5MKGA 3ES7A 4DJEA 5I0DA 1PS9A 2X16A 4Q6JA 4FK9A 4M24A 5A95A 3DOPA 3A3WA 1TA3A 1XYAA 2HQAA 4CD8A 2YZRA 1W5QA 1D3HA 3F2CA 3UJEA 1SZRA 1Q6EA 1VENA 4IMGA 1UD4A 4TV6A 4M1BA 1UWAA 3B8IA 3PM6A 2PP1A 4L6HA 3CUFA 1ZDLA 1JI2A 1IIGA 3F4CA 3M0HA 1GTEA 4ZE5A 3L4WA 3IJQA 1JDCA 2J7EA 1B30A 3SAZA 1DORA 3V0SA 1M65A 2G4JA 1XIDA 2PU1A 1M7PA 3BXWA 1A4MA 3S1XA 3MHUA 4DXKA 4IL2A 1F3TA 3BDKA 2FDSA 4AD4A 3UZWA 1E3XA 5FJRA 3NQ6A 3CHEA 2ZUMA 9XIAA 1GQJA 4LUJA 2X2GA 3H4XA 2VWSA 3W1TA 5HJYA 2DUAA 2W4XA 4IGMA 2DEPA 4PSPA 1UQYA 1GOWA 1Q2SA 1C9DA 3VD9A 4QSFA 1VCVA 4LRSA 2A3LA 2Z6JA 4IMFA 3IGHX 4NZCA 3UFYA 4GC3A 1BWVA 3NQEA 1FBAA 2H9AA 2EPKX 2XSAA 4JKMA 4U4MA 4OFCA 1J4EA 2O4QA 2PLKA 4CQCA 3O3RA 1KGUA 1UQZA 1OB0A 6XIMA 1LQ2A 1NU5A 3PWIA 4CU7A 1I0BA 2Q8XA 4E3VA 1AMYA 4X60A 2NV2A 1JCTA 3MMTA 2PDGA 1FP8A 2Z7GA 3CZGA 1QWGA 3VNKA 3NL5A 2NSXA 1C9WA 1NP2A 3PHAA 2DGAA 1ZRQA 5HMSA 1C90A 3R07C 3PZOA 3B4YA 4CQBA 2OX1A 2OQYA 4H01A 4AEOA 3O6CA 1UPMB 4FLRA 4JX4A 1XIMA 4JKLA 2ZRWA 4ZQMA 1DXFA 2AOSA 3HFTA 4G8TA 1MNSA 3H7RA 4DXXA 1VPYA 5A6BA 3P0WA 2FTWA 5IBXA 2OXNA 1VFHA 1E6PA 1DWAM 2E5AA 1Q13A 4DM2A 2CPUA 6A3HA 3CHFA 3UWVA 1RH9A 4GYPC 5E0KA 2J7FA 1VB9A 4H4QA 4UQ9A 1X7FA 4J35A 2EKCA 4HOWA 1J10A 3CAKA 2JEQA 4QTGA 4FX6M 3URBA 4F0RA 1J18A 4EF9A 4C6CA 3V16A 2O7QA 4KWUA 4HQVA 1GRBA 1XDIA 4KCVA 1LBMA 3LTSA 2WMIA 4JDRA 4E2OA 1F74A 2FZMA 4TX9A 3G1HA 5AYXA 3A47A 3VGDA 3VZYA 2ZA3A 3MZNA 1OCBA 4UTIA 4TR9A 2TMDA 2P53A 2AGKA 2J8TA 2QUTA 2BSLA 1AH3A 3IEBA 4UFKA 1A4LA 2WM1A 3N4AA 3WQ5A 5EY5A 4ZSUA 5D2WA 1VCFA 3HGOA 4LV4A 2GUBA 3GKAA 4OJYA 1CGTA 2J13A 4HPHA 1VLIA 3LXBA 3AUJA 1JAKA 1E6ZA 5HR6A 4ZMGA 3TK7A 4OU1A 1TA3B 5AC5A 4RV8A 4PTVA 2X41A 1QK2A 4C5YA 3M07A 1P5BA 4S2BA 3IWPA 4QLKA 2J78A 1JD7A 4IF2A 4PBFA 4YYFA 2XPKA 1Q2RA 4WOZA 1E0VA 4IPJA 3MSGA 4ZE4A 1XINA 5HXMA 1R87A 1JI1A 5GJNA 3DC0A 3WKZA 4A3UA 4HZMA 1EIBA 3W01A 1EJTC 4ZQRA 1IGSA 3DBPA 2Y61A 3G6MA 1MRQA 4GX9A 4Q8UA 3VO0A 1KXHA 4C6NA 1R2TA 4KQNA 3LA4A 4IGNA 2OVLA 3C3UA 4C6OA 5E0FA 4IFOA 2ZRYA 2CW6A 3WJXA 3PANA 1JEZA 1ITCA 4MAVA 3CH9A 3UVAA 1DJQA 2UY3A 2P8BA 4CQDA 3WLLA 4OE7A 4YTUA 1ODZA 2H9AB 1E43A 1XM3A 1RBOB 1G0CA 2CWXA 1Q6FA 1XXXA 2B31A 2NW0A 4DUWA 3LCFA 2PRLA 1UPPA 5IBXC 1G4SA 2PDMA 2OELA 2QDGA 1QPOA 2R6OA 3AS1A 5JUVA 1WKYA 2DORA 3OZOA 4M7SA 2X8HA 1E1CA 1OM0A 2ZXQA 3GX9A 3S5YA 3THDA 2NWSA 4ZODA 2ZUNA 2PPGA 3UD6A 2BDQA 4BQ4A 1ZMDA 2YKKA 2FPTA 4PMYA 3KCJA 1FIQB 4L1WA 1JOAA 3IC9A 4XAFA 1OGSA 3SQMA 4AZHA 2NWRA 5A6MA 2E1WA 2POZA 3QRHA 3H53A 1EWDA 4RDVA 1V6YA 3RAOA 1BHGA 4NNAA 5DMMA 1GTHA 3G5EA 1UKTA 5EKYA 2F2KA 4O1DA 3SZ8A 2PD5A 4TMCA 4K1GA 4NHVA 1XP3A 3THCA 4E8GA 4Z2GA 2X42A 3FEQA 4HTBA 4HNNA 4I3GA 1B9ZA 4LEQA 5CJNA 3S9ZA 3ANUA 2HPMA 3PPGA 3QV7A 4YWOA 3CLWA 4A8NA 2DVTA 4JEQA 4WIWA 4U3CA 1S5NA 3CHDA 4KWVA 4TU1A 3O05A 2OEKA 1IV8A 2WMIB 1Q63A 1Q6QA 2VUYA 5BZAA 3GHSA 5DMLA 3DK8A 4NRSA 3CIXA 4BURA 1KTBA 4RNIA 3L65A 2F6KA 4YYCA 3KWSA 4J40A 2E4TA 1FKWA 5I06A 2BOEX 3OA3A 2VEIA 2RDTA 3L68A 3AHZA 3RYSA 3B0XA 1M1BA 5D04C 1KM6A 2H3BA 4Y9NA 3MWAA 1F8MA 4XX6A 1GK8A 3RRAA 1UWUA 1HX0A 4EXQA 3C8FA 1H1NA 4XD6A 5G4WA 3ZSSA 3JW7A 4WVXA 1KBBA 1MEIA 5HUOA 2VZVA 3E3HA 2X0SA 3GG1A 5C2CA 1ME9A 3Q2DA 3TN5A 5I02A 2NUXA 4R53A 1FDZA 1XL9A 2YCLA 3IGSA 2ZX9A 4W7VA 3V0UA 4B3ZA 3STCA 4F0LA 2WC3A 1NPXA 3VMNA 4BK9A 2O55A 1TX0A 4KGJA 4QLJA 2OGYA 2A7RA 4HPJA 2WAGA 4GO9A 2PTZA 1QUMA 1EBGA 1GPWA 2X1UA 1SVDA 4ZVJA 3A4AA 5LXXA 1QW8A 3SIMA 3VIGA 4JY8A 4IQDA 4S1FA 3DKLA 2WC4A 1C8VA 4EWND 2INEA 3CB8A 4UFLA 3SURA 2BCPA 5F4SA 5JBFA 4PUDA 3VD3A 4RZ4A 4Q8MA 1UH2A 1SW7A 4LU0A 1L9WA 4HGXA 3EX6A 4MADA 1JYNA 4DPPA 4IT1A 1PKLA 1YIXA 3ENLA 4WDXA 4A8LA 1QBAA 3QF0A 4H6RA 3W84A 2CKSA 5CJ5A 1V79A 2DZPA 5A2AA 1S3TC 4JAWA 3GE7A 3LCGA 3MTWA 2P50A 4EXBA 3VU2A 3U48A 1OZMA 1TRDA 6CGTA 4TTGA 1E56A 1F6KA 2P76A 4MTVA 4NJIA 4O1EA 3NRZB 3MKVA 1VFTA 3WUGA 3LM7A 4J2PA 4LYRA 4H7CA 3IGXA 1MW0A 4ACZA 2YX0A 4LA1A 1O5RA 3AXXA 1HJWA 3MI2A 4QG9A 2WHKA 3ARXA 3I6TA 4ZQNA 1VJSA 2ZUSA 5FEPA 2XYLA 3F5LA 2BTMA 3NPWA 3SRKA 1XCXA 3FA5A 1E1CB 3BC9A 1XLCA 4PR4A 4G7EA 1LLZA 5AZ1A 4IZGA 4PUKA 4CNNA 4E2BA 5DF0A 4HA4A 1EYEA 2XN0A 1QASA 4MJ2A 4EAYA 1V0KA 4UNKA 3G0UA 3GQYA 5D03A 1X6LA 3T0TA 1EHAA 1H5VA 1PZ3A 2BHUA 1PIFA 1V6UA 4PMNA 3DN5A 3W7DA 1JF6A 3HZ3A 1K4HA 4AY8A 4NJJA 3PJWA 4K3ZA 2XZ9A 4GX8A 4C6FA 2NVKX 4EM3A 1Y5XA 1UW9A 1WAUA 3UBPC 1FCQA 5KZEA 3WDIA 2OYMA 1LWIA 2EJAA 3M0KA 3EUB3 3WFAA 1JUEA 4HU4A 2ZRUA 3S2NA 5JH1A 4YNGA 2YVGA 1V93A 1KFKA 3PJUA 2XIBA 3VXGA 2YDSA 3H24A 2YR1A 3KRBA 1OX5A 4BCEA 3WZ0E 3EMCA 3UG4A 4GC4A 3UXLA 5BMWA 1KQZA 3ARPA 2WNZA 1VCGA 5ABHA 4AC1X 2W61A 4H7ZA 3W9ZA 1JJKA 2G95A 3I6EA 3MYOA 1CXEA 3R0KA 4WQ6A 2WWDA 3SB0A 5CSYA 1VFSA 4XAPA 3RCMA 3RLUA 2WOVA 1U33A 5C2GA 5AOUA 4KEUA 1FWTA 3STFA 1XV8A 2QMKA 1DJNA 2NQHA 3KVKA 1W6TA 3KM8A 4AY1A 2YCLB 1UUOA 2YOCA 4MUPA 5E9AA 4CCEA 1VEMA 3P67A 1RLDA 2VMFA 4NILA 4EWJA 2GDQA 3HPAA 3RM8A 3VUSA 3LRKA 1MMFA 3C2YA 4EQWA 2PZ0A 4WDUA 1X1NA 1AL8A 3H23A 4UMBA 2O0TA 3GRIA 3SGUA 1B3YA 1XDLA 1XW8A 3P6LA 1QPRA 3RXZA 2QCMA 3LLFA 3NZGA 3G18A 3EA3A 4P7NA 1NARA 4XIMA 1XH1A 4IXHA 1CGUA 2AL2A 3UZ5A 3TZFA 3BLOA 2BY2A 4IMDA 5FF7A 1DIKA 3V18A 4XTIA 1L6YA 4MNMA 2VFGA 5J5RA 4FX8A 1GUVA 2YYUA 3GVWA 4JBRA 2W5FA 1R86A 2VCCA 3H4KA 1BPLB 1PKYA 5LNWA 2Y7DA 1J93A 3IJ8A 4V15A 3KOXA 5I3HA 1PCWA 3LERA 4XBJA 5FEZA 2VFHA 1TVPA 1IEVA 4ACZB 1TMHA 2QAPA 2VR4A 3LN3A 1S2TA 4JTSA 2JF6A 4NX0A 1GW1A 2IUZA 3NOEA 4N0RA 3PK7A 4LVDA 1Z48A 1NWTA 5GJMA 1ZXIC 3ES8A 1SMDA 3BLKA 3AU6A 2WJEA 2VRKA 4GD0A 2GJLA 4G7EB 5CPQA 2GQWA 2X1RA 3VDBA 2YL6A 1GJPA 5DELA 2FJKA 1NEYA 3QHOA 3S47A 4LUSA 1W17A 1LL7A 2WYSA 3N13A 3HW2A 4RDWA 3W2KA 2VCBA 2CKRA 3KAOA 4AD5A 1NHSA 2Y8KA 1QNVA 5FKYA 1VS1A 4JYEA 3WH5A 3RPMA 3N25A 2RAGA 3DECA 1RD5A 1L6SA 5E09A 2PSNA 1EF3A 2G3NA 4TO8A 3RN6A 1I2QA 2WNQA 3L4ZA 1RY0A 4GH1A 3HURA 4V27A 2CBIA 2XTKA 3W76A 2W27A 2FHFA 2W3RA 4M29A 1JZ5A 4OBTA 2WB5A 2E9MA 1UIOA 3M5YA 1OF6A 3QVQA 1BQGA 3EX4A 2QUUA 4ZA0A 3MA8A 3WD3A 2O7SA 4ZOCA 3WUFA 3KBSA 7XIMA 2GOKA 3TN6A 4C60A 2EQDA 3T4CA 4KCTA 3FK4A 3OW1A 4IP5A 1ZY9A 5AC8A 2VFIA 4LF2A 4N4PA 5HQMA 4EAMA 1DPMA 3MKKA 4DZIA 2P5NA 2FMNA 1S5WA 3WF1A 1XQKA 4CN6A 2CLOA 2FTPA 4O28A 1DXLA 3GU2A 1ZKQA 3L21A 3CL7A 2QUNA 4Y9PA 4U2YA 2WO5A 4DM1A 2Q02A 1XIBA 1FX6A 1XKJA 3K4AA 3H54A 2YQUA 2XIIA 3DHDA 4HZ6A 2QULA 3TJXA 2A7NA 3SCSA 4QJ5B 3K1GA 3M0ZA 2E8YA 2DZSA 4RLIA 3QFWA 1XIHA 1KM4A 1K9FA 3LYEA 5DLCA 1UMYA 3LSCA 4K8EA 2QCDA 3AALA 1EDTA 4AB4A 3AFBA 2ZOXA 3RU8X 3W25A 4C5ZA 3W1RA 3NXFA 3A12A 3UXIA 4CNOA 1U5HA 1GRFA 4YVXA 2AL2B 1UWTA 3AJ7A 3USBA 4AXNA 3TTYA 3FA3A 1GPFA 1KGXA 4K8DA 2DZTA 1AW5A 1M7JA 3NUKA 4LF1A 1XISA 2XISA 2PU0A 1L6GA 4MPKA 4WCJA 1RJQA 5AFDA 3PFRA 4Z1CA 4AG0A 3NQFA 1KM5A 4U31A 3KTCA 3OU8A 3TVAA 1S1PA 1BWCA 5KITA 3MV11 2VX5A 3N14A 1KO0A 3II4A 2QYGA 4FXJA 4HKPA 2Q6ZA 5GNYA 1MXGA 2PWHA 1VLWA 2IMRA 4D6CA 2E1DA 2J6XA 3G1SA 4FLQA 4LNYA 2J9XA 3L5OA 1U30A 1SJBA 1JVNA 1UZ1A 4GINA 4OTKA 3P93A 4O14A 3SDOA 4K7VA 4GCAA 3U6WA 3W37A 7CGTA 4DN1A 3UZZA 4QSHA 3W53A 4UQBA 4H4ZA 4JFTA 1QPQA 3WNKA 4RPQA 4JZ5A 2QAEA 1IT7A 3L7RA 5D38A 1SW3A 3N12A 5CGTA 3KDOA 2G37A 4XBKA 5K9DA 1OEPA 4RJEA 2Y24A 3MB9A 1EBHA 3FJLA 1KRAC 2GH5A 2VOTA 3AIUA 4A21A 2JKPA 2Y0FA 5FI8A 3HO8A 2GJXA 4NASA 2PI6A 4REQA 3LOTA 4NNCA 4I5UA 3FV9A 2VD8A 3I7SA 1Q6RA 2PA6A 1GQIA 1V3IA 3VX1A 2CFFA 2W92A 1TE6A 3CAWA 3SECA 1YX1A 3OEXA 2RGLA 4JTAA 4UTWC 1ONEA 5L9FA 4MKVA 3D9XA 5BNKA 2BZNA 3QV6A 4ORMA 1VC4A 1XICA 1PAMA 1V6WA 4GI6A 2W63A 2AKMA 4PMQA 4XV0A 3APGA 3QQ1A 5DRIA 3GR8A 3OYXA 3GLCA 2RGMA 2G5WA 3T81A 1DJIA 3H2CA 3NR0A 2VEMA 3SCTA 1KCZA 4AMCA 3WMBA 3WLHA 4JKKA 3AISA 3CO4A 2EQ9A 1E0WA 1EKOA 2BGQA 2W0HA 2D0FA 2HK0A 4S3DA 5T26A 1B3ZA 1GVIA 2NXIA 2QUMA 1UUMA 4LC6A 4DYKA 2ZC1A 2A8XA 4M82A 3U3HA 3VINA 3M0XA 4GKTA 1GYNA 5I2UA 4H04A 1FECA 3PWAA 1MQPA 4ICNA 1TYGA 3IUIA 4KCUA 3UZYA 2XVGA 4ZEPA 2A2IA 1ZAHA 2E9BA 1IWPA 4J3XA 2CLEA 4Y9OA 3EMQA 3N6QA 1QMLA 4I6KA 5FJTA 4E4UA 4YN5A 1SO4A 3GHRA 3E38A 5T9BG 1YTDA 1F5ZA 3LHYA 3Q58A 2TAAA 4DWSA 5CBBA 1FO4A 2QCDB 2AQVA 3M9YA 5HMDA 3HG4A 2IKIA 3P0XA 5LHEA 1YADA 4HIBA 2D2OA 3FA4A 3WH9A 1JFHA 1KR0A 2CESA 2F9RA 3ZR5A 3BJTA 3TQ0A 1F8IA 1OK4A 3R0UA 4KETA 2C1HA 3GFYA 2O4MA 3VFLA 1Q3NA 3KFTA 1JYWA 1D8CA 4J2MA 5CC3A 2GR3A 1E70M 1MZRA 3VM5A 1E71M 1TPVA 1S5MA 3P14A 5I6SA 1QXLA 1M03A 1S7MA 1FXQA 1DJWA 3RITA 1HIZA 3BQ6A 4AIOA 4OGZA 4D8ZA 5A6AA 1Q6GA 1XC4A 2OT0A 4ZFMA 4J27A 4XD3A 4RE3A 2NSOA 1NTHA 2R1NA 4ZGYA 3O9NA 4X9SA 2XH2A 3KDNA 4MWAC 1GRTA 5F1VA 4QRNA 5G1MA 5REQA 3VCCA 2G3FA 4AZIA 1GREA 3BW2A 1TJ1A 2WSKA 3DCPA 5GRTA 4JD4A 3ARQA 3NAVA 1HKJA 4MWAD 4DNHA 4QCEA 3MV01 1TWSA 4UMCA 4KCWA 3GD3A 4QQ3A 2C6QA 1XD0A 5BWAA 3PTKA 4JNYA 5G1YA 3T40A 3WN6A 4AD2A 3PN8A 1OCNA 1FWCC 3GR4A 4C6JA 2GVGA 2EBNA 3HV9A 4PRWA 2GWNA 2OSXA 3DYOA 1G4TA 4JX5A 1MXSA 3R8RA 3Q67A 3W28A 2VL4A 4S3GA 1PTGA 1FWDC 4Q4OA 1OD0A 4UOJA 1HJVA 3OHIA 4EQRA 1A3WA 2WVUA 3DFNA 5AHNA 1H6VA 2A3EA 3PSVA 5A2CA 5CPLA 5JQ9A 3I10A 4WKFA 3K8KA 4BV6A 4ZR8A 3MBFA 3EX2A 2GJXB 4REQB 4RCXA 2POTA 3M0JA 4F48A 4Q4KA 3ANYA 4FX7A 2QJNA 3LRMA 3T4WA 3WQVA 2V81A 1E51A 1SO5A 2DDXA 4W89A 1BAGA 2OZ3A 3MPGA 1R7OA 4DI8A 3VFCA 1SFLA 1FWEC 3KXQA 4J3SA 4L9YA 3FHAA 1K9TA 1DQWA 4UWMA 1LYXA 3WFZA 1RCQA 1XLAA 4FR6A 3KVJA 4OHQA 1YRRA 2V67A 4O52A 1OY0A 1NDYA 1CXIA 1LG1A 1SZFA 1GVYA 2DSZA 4FNRA 5TBOA 4ROPA 3HQPA 1DVJA 4U2ZA 5ECUA 3HMJG 2Z26A 5KEZA 4UQCA 4S3KA 4AAJA 4MB4A 3CIVA 3R0DA 4NRRA 1NWRA 5AC6A 3MS8A 1WQ5A 2I5IA 4MZ8A 3N73A 5D2VA 1U1UA 3IVSA 3HBLA 4OT7A 1RHCA 1X38A 3NSMA 2NV1A 3GFZA 1N5XA 1XD1A 5D05A 4CEXC 2OKOA 3UCDA 1DJHA 2VGIA 3HJEA 5A5WA 3VABA 2TRSA 3V75A 3IS4A 3VDCA 4DWSB 4ICMA 3W7CA 4D1JA 4JFSA 4JXCA 4AX7A 4JQ9A 4ML4A 4GZEA 3I4EA 4QITA 3BV4A 4JY9A 5CXPA 3WY1A 4MHBA 1FWIC 4MZYA 2C3CA 2V63A 3VC6A 4CCZA 3POHA 4JTJA 3BE7A 1EP1A 2Y8UA 4RXGA 2AMGA 3R2GA 2Z1XA 3W1PA 2ZZ0A 1SUXA 1CYGA 3E0LA 4UR9A 4EMWA 4O15A 1OWQA 3EEZA 2PDLA 9RUBA 4F0MA 1W1PA 5REQB 3D0CA 3W7OA 2XFWA 2HQMA 3RCYA 3GIPA 2WMGA 3S2JA 1YTKA 4QDPA 3MO4A 2XN1A 2XM1A 1LDCA 1RXOB 4XAZA 3MCOA 3DEQA 1L8PA 1G67A 4OKDA 5JBDA 1R3TA 1SU5A 4I5XA 2GGGA 2DFAA 2XH0A 3AWNA 1N55A 2GSHA 5AY7A 3WLRA 2QCCA 1XRTA 3BW4A 2FPVA 3OYZA 1NP0A 4AHOA 4PUWA 1Y65A 3EPMA 3IANA 4LOCA 3NZ1A 4DHGA 2NQZA 5HA7A 1SW0A 3BCJA 4NP7A 1UB3A 3GVRA 4V2XA 5FESA 3UPBA 3TIMA 4GZIA 4P2VA 1JCMP 2PWDA 3SUTA 3MMWA 5CZJA 1FWSA 4C6BA 1PZ0A 1QAPA 3C0SA 1VYPX 1KRBC 5AHIA 1E6RA 4NG3A 4B4HA 3GS6A 4AYGA 3ITTA 2GZXA 3E0FA 2ZTJA 1XYBA 7ODCA 3TCSA 4PL1A 3C86A 1MNZA 4GVHA 2C15A 2F7FA 3TN3A 4RPPA 1TV2A 3EDKA 5BRPA 4ERIA 1Q7MA 3BW3A 2D20A 3R6IA 3MO7A 3TR9A 3LBMA 1HTIA 5JRBA 1O6IA 4OECA 3KVLA 1Q6CA 4V1XA 3SSZA 1BVZA 1JUKA 4HSHA 4BI6A 4NYUA 1ZK7A 3BL3A 2GJRA 3E49A 4H3DA 4NX5A 4DYJA 3SFWA 5HJXA 2IPGA 1U5JA 1GJWA 3EWBX 1E4NA 4MB5A 5TAOA 4H50A 1M53A 3HPFA 1HJUA 3EKLA 3PBWA 4JTCA 1GG1A 2QDHA 2XZ7A 1B4EA 3B9OA 3M41A 3KHDA 1ZBWA 3GTHA 2EJ1A 5TQLA 5BCAA 1V08A 2FGLA 1E3ZA 2ISFA 5K4XA 3OOQA 2PWFA 3W26A 3IJ6A 4W8LA 3DHPA 4ILSA 1WKEA 1EL3A 3F4DA 1PIIA 1Q6LA 1UP3A 1AOGA 1FWJC 1UD5A 4ZO7A 4BJHA 5C54A 4XO6A 2NQLA 5E1QA 3CK5A 1Z44A 2PLJA 3IAPA 3WENA 2JKEA 5G5GB 1LQ0A 3VIIA 3HG3A 5IFTA 3RMJA 1X96A 2WZEA 3GM8A 5TIMA 1GQLA 4F9DA 3W27A 1U22A 3OIHA 1T41A 3BARA 3GC2A 1R30A 4WJ8A 1C8QA 3KBMA 3U57A 4KH2A 4IISA 1MUWA 3L4YA 4WXYA 2WHMA 3VI2A 1VBUA 4GA8A 2FPYA 3TA9A 3UETA 4XSLA 2C16A 2ZZ1A 2CZEA 1O5KA 1MRAA 2VD9A 3KP0A 1HL9A 1VRDA 4LBUA 1WB0A 2ACRA 3QQWA 3KOYA 4PB3A 1E5JA 1CGVA 3PJTA 1G4EA 2VZSA 4QBXA 3NIYA 2J62A 4FNQA 4XUGA 5HATA 2W0UA 4K36A 2QW5A 3WO8A 4M56A 3GXFA 1LROA 1K02A 3NOYA 1ISXA 3OZYA 3ZT5A 4PUNA 3QSTA 1GVFA 3QYSA 4H9XA 1GXFA 1AJZA 4W87A 2ZZ3A 1XRFA 4DO7A 4IP7A 1E72M 1H49A 4AD1A 1TMLA 2V69A 4AEFA 4GR1A 1LWJA 3N9SA 2BVYA 1VFMA 2CLLA 2Q3OA 3H2MA 4LQ1A 3N18A 2XDFA 1XIIA 1A80A 2RABA 5B80A 3W1LA 3F7JA 1WV2A 2G50A 3LHTA 4UUIA 3VA8A 2FVLA 3MMDA 3IIPA 3RPTA 1Q4WA 3NM3A 1QRQA 4NJKA 2WQPA 1TPH1 1H7NA 4AC7C 2OLAA 4KGLA 2I57A 4YWIA 2J7HA 2DUXA 4JQ2A 4C7FA 1RBAA 1RPKA 1OC6A 2DIJA 3T2PA 2PZNA 4GHRA 5LSMA 1CX9A 3E0IA 3FCPA 3V0TA 3DK9A 3AN1A 1RK5A 3BLFA 2SFPA 2QUVA 2V2HA 3VIJA 4MB3A 3RLVA 2Y63A 3EOSA 3QXBA 5TF0A 1A5SA 3BMVA 3I7QA 4B2DA 1LTDA 3GIQA 4B4FA 1F6PA 2MNRA 4S23A 1JQVA 1WXJA 3E2SA 1HW6A 5DBUA 1DIDA 4RZ5A 3MI3A 4PYSA 1UASA 5T8GA 1EPXA 1FCUA 4DAFA 2WJFA 3N1AA 3CXBA 5T9CE 1CW2A 4MNKA 5JCLA 4HP5A 4KESA 1DKWA 1XIEA 2X8RA 4AISA 4DO6A 2WZMA 3S0CA 4ZL1A 3RNMA 1BG9A 2P88A 1KBJA 1NWUA 9XIMA 4PN2A 4J9JA 1EIXA 3W7PA 4P7LA 4FNTA 2ZX7A 3KOZA 5EMMA 2AMXA 3QY8A 5BRQA 3PAJA 2HNHA 4AZ5A 4IL0A 3F4NA 3PUOA 2HVNA 2YLLA 2OT1A 1MZHA 1CDGA 2L5HA 2ZKMX 3UJFA 4HHMA 2WK2A 1JCYA 4ZOHB 1DIEA 1K4GA 5CZKA 3NZRA 4FF7A 3TONA 3AM9A 1VBHA 5H8PA 1KCLA 3CU2A 1MDLA 4YTQA 4H2CA 4NT0A 4PSRA 4QG8A 5A8NA 4QS5A 2PD9A 2FZ9A 2Y85A 3ATYA 3EWCA 3QLDA 4C91A 1XUUA 5D9OA 4IGSA 2KZHA 4HJWA 1JGMA 3CHVA 2GYIA 3NFUA 2OPJA 3URQA 3TYBA 1ZP3A 1BLIA 2PDYA 4FXFA 1K8CA 3IARA 4N9BA 1KNWA 2Y5SA 4OUIA 3VD5A 3WLTA 1WDPA 4IICA 2DT1A 2ESCA 1QJWA 2UY2A 3P8IA 1FWNA 5AVNA 4KWSA 1GRHA 1RJRA 3BJSA 4O16A 4BQ3A 1S2UA 1HJSA 3INPA 1LL6A 3FW6A 4AIEA 4LX4A 3B0VC 1JDAA 2GK1A 5CEWA 4CEUC 4WUIA 2V30A 3IRDA 3ALGA 1E0TA 3WEOA 3CGEA 1KLYA 2G41A 1YDYA 2RH9A 4RK8A 1Q66A 2C18A 4DRSA 1ZUAX 3S42A 3MDUA 1BSIA 3G1FA 4A6GA 3RM9A 3MUZ1 4M51A 3GDMA 4O4VA 3VMPA 4J1OA 5FJIA 3PC0A 2BHZA 1FFUC 3COTA 2YW4A 2ZZ6A 2HNEA 3TTOA 3VIOA 2PWEA 4L4PA 1QR7A 2D3NA 2CZFA 2VRQA 1IEIA 4IPLA 3W2MA 3DDMA 3LSBA 3EDDA 4I9JA 3QMSA 4N02A 3MUXA 1ISVA 2KX9A 2X8CA 3GTNA 4YIWA 1XBVA 1V3MA 4JNZA 8XIMA 2IQDA 2OSWA 2P8CA 3UY7A 1SJCA 4Z2IA 1Y5WA 4M7TA 1OGGA 3LMYA 5AHLA 3WH6A 5JMUA 1FWWA 4MGGA 6TIMA 4R33A 1HL8A 3CZLA 3LM3A 1UP0A 3URHA 4L4LA 5I24A 3UWYA 3CAVA 1UROA 1M6IA 1YXDA 1YNYA 3HPXA 1VD6A 2NXGA 3ANVA 3NPXA 3ARUA 3B9DA 3RILA 1J8VA 5I77A 1A5AA 3GVGA 1QNRA 1W91A 1EA0A 1G7UA 3KBNA 2BV9A 2W91A 4YLWA 3P61A 4K8HA 5CCZA 4WXZA 1F76A 4DBSA 2Q09A 4LPCA 1R38A 1KB3A 3LRLA 3S3GA 3KS5A 5DXYA 4S3JA 1DOSA 2ZE3A 3H4GA 2CDUA 1DXEA 3M46A 1JL8A 2JIEA 4PRTA 3WQWA 1TZ7A 3VIFA 1T40A 1S2AA 3BZGA 4R7JA 3OO2A 1GZJA 3CBWA 3APTA 4JQAA 4PTNA 5FJUA 2WPGA 3FGCA 3KLJA 3W0KA 3ATZA 4HTYA 2GVLA 5U1OA 1PDZA 1LJYA 4U33A 3AMCA 3B97A 1TE1A 1AQMA 3WLSA 3W7NA 4OOUA 4YU1A 1TSIA 1HFBA 3SY1A 4YHEA 5A8QA 4U28A 1ZFJA 2V68A 3G3MA 1JG9A 5HQLA 5C2XA 1VAHA 3AQUA 5CGMA 3G1YA 4NI8A 4GYKA 1UWQA 2BY1A 3FG2P 1SR0A 3ELFA 1NF7A 4KF1A 2E68A 4IUGA 1S2VA 4HHLA 1BZLA 4Q33A 3P82A 1K8YA 3M5ZA 1E0UA 2GK1B 4Q8NA 3DGRA 4EACA 3CXOA 2P3ZA 1WYIA 3VD7A 4GUHA 3ETRB 3N2OA 2WBGA 1B3WA 3F2DA 4Q8TA 1JFXA 4NKCA 2VKZG 1B3OA 2B4GA 1MQRA 3WK3A 5AYYA 2C1IA 2E3TA 1F9CA 2OR2A 1TREA 3QZAA 5M5DA 1K3UA 1EDQA 3AHTA 4GGHA 1FVPA 5A6KA 4GIRA 4PL2A 9CGTA 2ABBA 1UOKA 4UMAA 3D3AA 2FKPA 1YQ2A 3SCRA 2GRTA 2GVJA 4FOJA 3GNXA 3SN0A 1GOIA 1LPFA 1W1IE 4FLOA 3T42A 4F3HA 4B5SA 4LAUA 2XH7A 4LNCA 5BU9A 4E2DA 1FFRA 4DJDA 4LVAA 2Z6IA 5CSUA 1KXQA 5I79A 4B16A 4OV4A 2J8FA 3HRDC 3HM7A 1PB0A 2D0HA 4CNUA 1H7OA 1ZZMA 3DG6A 3WQCA 1TJ0A 3CEPA 1F3PA 4XUYA 4AHPA 4B15A 1T3QC 4UZUA 4BA0A 4UTFA 1RM6B 1TWWA 3FJ6A 4DB7A 4I5RA 3DI0A 2HROA 1TIMA 4PTWA 3ZXWA 1OG6A 2YDAA 4NYYA 2FFCA 3ZT6A 3NS1B 4JTDA 2G96A 3ITXA 3G6LA 4NEVA 4F79A 3E74A 1KXTA 1VYSX 1F8WA 2I1OA 3KTSA 2BFGA 3PS7A 3KRZA 1F05A 2E3ZA 2PAJA 1ADOA 3BAXA 5CQ1A 4F2BA 1KFBA 5FAGA 3NO5A 5K9XA 3QTPA 3DH7A 1E9YB 1OSEA 3TEVA 2YB1A 2PTWA 3QYQA 4B9ZA 3WQEA 3ECQA 3B8DA 3W83A 2O9OA 3CYJA 4ES4A 4S38A 4PMZA 3UZJA 3NVWB 4PEEA 1F61A 1EXPA 1THFD 4U5IA 2YB4A 3A4WA 1OZQA 4GY0A 3H7VA 1Q85A 1FH9A 2NX9A 4IWWA 1WDWA 4F2TA 5D2XA 1VBGA 1C91A 4H83A 2VVSA 1TPC1 2BXVA 3APYA 4ZOEA 3CO8A 3NEVA 3TSDA 2PGRA 3WLQA 2ACQA 4U5KA 1BWKA 3R7MA 3C2FA 2VDGA 5BXPA 3E2QA 3WQFA 4ERGA 3DKJA 4BF9A 1HJQA 3EX1A 4Q8PA 2B7QA 2YCIX 1Q7ZA 3FGCB 4MM1A 3CUHA 1FTXA 2QV5A 4IX0A 1P6CA 2JE8A 2IS7A 4CD5A 4YJ5A 4K38A 4YCOA 3W72A 1W3IA 2GSEA 4N9DA 1LRTA 1RR2A 3TC7A 2BLEA 4RNJA 2BX7A 4PMOA 4KIRA 1XR2A 3WFLA 3CGDA 3OBKA 2EG8A 1NH6A 4Z2KA 3UGRA 1FUYA 4HPGA 2CLIA 2OCZA 1HO4A 4AVOA 5LXEA 1X1ZA 2XVKA 2BVWA 1V3KA 3SY5A 1XYZA 1BYBA 1OFEA 5F1UA 4RL3A 4JR5A 2X7VA 2HS8A 3CL8A 1ZBVA 4TX8A 2NLIA 4QDMA 4BF5A 1GHRA 4W7WA 2HE5A 2ATSA 4DJDC 3A3XA 2CLPA 2BGNE 2J88A 4R9XA 2BHYA 3TWAA 4JFWA 1UKQA 5CSRA 4CNPA 4HMDA 1NOUA 8XIAA 1YDOA 1EC9A 5AVHA 3KWXA 4ZCWA 4TOQA 1JXKA 3DFPA 3SGGA 3ARZA 3OPSA 2JIWA 4EPKA 4HCHA 3IIXA 3SSJA 2XIQA 4ERAA 2CHRA 2VURA 5GQBA 1R8LA 1ZY8A 4A35A 2OYKA 1RA5A 2BODX 4LUTA 3WDHA 1XH0A 4O1FA 3V5CA 1UZ4A 3UERA 3L9CA 3C2VA 1NDZA 3TWBA 1ODUA 5FIPA 3E1F1 4MZ1A 2J8GA 2A0NA 1JXJA 3QTGA 4H9YA 1H5YA 3R5EA 4PMUA 1A5BA 1KRMA 3FSTA 1GORA 1K6WA 1VIWA 1ML1A 3IVTA 2ZUWA 4MJZA 1TWIA 4OQVA 3L67A 2EQ6A 4W9TA 2HE8A 1IEQA 4XKMA 1D8WA 3BAJA 1KCXA 4G5DA 3W7HA 4M6PA 4F0SA 1TR9A 3L2IA 3KLLA 1C3FA 1RQBA 1V0NA 3TZNA 1J9YA 1E15A 5BU6A 2CHOA 3GAKA 1H2IA 2H6RA 1TWDA 1R3WA 3GK0A 1QWKA 1M5WA 5KVIA 3K5XA 2QCNA 2QCGA 2R8WA 4JTKA 3S1UA 1HP5A 2HDJA 3QKZA 5LZLA 4PB5A 2E25A 4DJFC 2WJDA 2YIHA 5KINA 1F7BA 2GSJA 2IPJA 1QI3A 3VE7A 1SO6A 3LXAA 1KM1A 4AWUA 5I3FA 1NM9A 4DJFD 4KRUA 3ZLFA 1UBPC 4Q8QA 4HN4A 2NVDA 1Z69A 3U8GA 3LD5A 2J24A 1DWIM 2X40A 4JCMA 4K8GA 1OFDA 1VHCA 3UR7A 1MO0A 1PBGA 4DYEA 1A3HA 1YPFA 1DEDA 1WE5A 4FALA 4R88A 4N6EA 3WLNA 4YTTA 1PJ9A 4D6FA 1X2HA 4DPQA 3ZLGA 4F8XA 1H7RA 3WCZA 5BW6A 3P8JA 3RMEA 3LHUA 1O1ZA 1DTUA 4WY0A 2CITA 1XLJA 2D0GA 2QVHA 4MMWA 3NQBA 2C3ZA 1ECQA 3OQEA 5DY2A 2XGZA 1UG6A 3SW6A 4BKNA 2HJPA 1XLLA 3PBVA 1GRAA 1JNEA 2VENA 3TROA 2X50A 2VZOA 3N9RA 3D5HA 3BOLA 4HB7A 3U2ZA 3TC3A 2FVKA 3UA3A 3CAQA 3BTNA 2V3FA 1FWFC 4ZZ9A 5GVJA 4RUBA 1MW2A 3EAOA 1W1VA 1QI4A 3S1GA 4GQ0A 3PR2A 2Q71A 1WAWA 1HVQA 3TP4A 4LBSA 3NQAA 4HT3A 4H6EA 4QNWA 4QEHA 2PWGA 4U10A 3TQPA 1VRXA 3UYCA 3W7QA 4O0ZA 1JYVA 3AIQA 1O68A 3CC1A 2HXTA 3ARVA 5G5IA 3TLQA 2V5LA 2ALDA 4JNMA 1XDJA 1I45A 2QQ6A 3VNLA 1NFBA 3GWQA 1KBIA 3EWUA 1DWGM 1YE4A 1TO3A 1XC6A 2PDPA 4LUTB 2BMBA 3FIGA 2VC5A 4NAFA 5M17A 1QDSA 1E9ZB 3NVYB 5DN1A 2WZIA 4RE2A 5E0CA 4LCSA 8TIMA 3I3BA 1DBTA 4AEEA 1X97A 2Q01A 3WK2A 1SQ7A 1M6JA 2LLEA 4A4AA 3VKJA 3WQGA 3MHGA 3GRTA 5F2IA 1NDVA 3U7BA 2BWGA 2J74A 1RCXB 3CMJA 4PZVA 3TTEA 3HQ1A 5BOEA 3GD6A 3ME3A 3H22A 3LUTA 3NL6A 5FSEC 3MU7A 4FOUA 3G1DA 5AHFA 4EM4A 2J7DA 3QFEA 1TJRA 3S9IA 1LOLA 3T0DA 3WQ8A 1CECA 1ZPTA 1HP4A 3A9IA 3I6RA 3QBUA 5FJOA 1SJAA 4GUIA 5C9UA 4NJGA 2A3AA 1TYPA 1RAKA 4IPPA 4E38A 1KFWA 1TQJA 3WLJA 3K2GA 4GABA 4ZB5A 1X1OA 2O92A 1I2PA 3IAQA 3VM7A 4HYWA 5EMLA 1AH0A 3WQ6A 4A3YA 5XIAA 3L5LA 4E4PA 3LQLA 2J7CA 1U83A 2WKLA 3WYZA 4MDPA 2PRMA 4LAZA 1PTAA 1SYTA 3V35A 4JICA 5D8WA 4M8UA 2ZRVA 5A6TC 4KWOA 5FJPA 3PJXA 3AAMA 5G2WA 1W0MA 4WY0B 1TCDA 5M2FX 4GJIA 2WC7A 5FA5A 1XHGA 2WCSA 3M0IA 1GW9A 4O8AA 2PFHA 3CZJA 4N7QA 1RVGA 1LCOA 4ML9A 3F03K 3TMQA 3GVQA 3GRSA 4Q4MA 3GSMA 3SRDA 1DE6A 3NVTA 2HXUA 4LEFA 3L4TA 1UKSA 3XISA 4Z17A 1G5AA 3KBJA 4GVGA 3VGHA 4HCDA 2ABAA 2O9RA 3QHMA 2I14A 4C6LA 5JCIA 3FDKA 3M0LA 4AZ6A 4UC5A 3UG8A 1KXVA 2OFJA 4GYPA 3TE9A 3GXTA 3EX3A 1EF2A 1DIOA 2ANUA 5GJPA 1JNDA 1KFJA 3CUJA 5JCMA 2NT0A 2QCHA 1RVKA 3NDZA 4B3LA 3HMCA 3QLLA 3TXZA 1KTCA 2BVTA 1EP3A 4EMJA 4Z0JA 3PB0A 2AAQA 4ACYA 1KC7A 1H50A 1QCWA 4HNTA 1GESA 3WK1A 4YWSA 2NUWA 2E67A 2OGJA 4US6A 3T09A 4N2YA 5AN7A 5B7YA 3SADA 3TFCA 4CGTA 1J5TA 2OWCA 1HVXA 3CB3A 6XIAA 2HRWA 4NAFB 1JPHA 2DW6A 4H41A 3SUUA 1F4AA 1GQNA 2BVDA 2V3BA 1ADSA 5M1TA 1TB3A 4JIEA 3GAYA 3THQA 4FLSA 4RR4A 5K3VA 1TZ9A 3G2GA 2W6RA 4HA0A 1K7XA 2ZYFA 1XLMA 3O6YX 1R9ZA 2W67A 3UY8A 4E0CA 1P0KA 3S8HA 5AYZA 4RW3A 4HA1A 3RNDA 1V6VA 5JXQA 3GXPA 1ZQ5A 1JULA 4MLJA 4D9PA 4O10A 1LL4A 2Z2BA 3NXLA 4LT9A 1U5VA 3HOJA 4XK2A 3AXIA 4FS9A 2WSQA 4LH8A 3T0CA 4A3RA 1MXDA 1TPB1 3LI1A 1G69A 3LLDA 4UTTC 4WDWA 1QPKA 3XINA 3OLEA 3UG3A 1G7VA 4AD3A 3R25A 2A3HA 3KOFA 1IYXA 2ZCGA 3PWGA 2V9DA 1SM9A 3AS0A 3OIXA 1I8JA 2V3GA 4D71A 3UJSA 1F4HA 5LA1A 4GACA 1QNPA 2X0HA 1EC7A 1EX1A 3FKRA 4Z2HA 1XLGA 4L1XA 1J0JA 2EQ8A 2XH4A 3SCUA 5C55A 3EGJA 2RJHA 1DYSA 3M0MA 3GG8A 1EHNA 3BANA 5PTDA 1PX3A 3TJ4A 4ZQOA 1OHLA 3WLKX 1TVNA 1UA3A 1OYCA 2OO6A 4LS1A 4UXDA 4H4YA 4HNLA 5EBUA 1CENA 3WQPA 1I1XA 4DBDA 3JZUA 2DY3A 1FWHC 3HF3A 2RDWA 4J3VA 1VJIA 1B57A 1GGOA 4JX6A 2Z7KA 4R3UA 1KFEA 2ZZ2A 2YPIA 3V4BA 5IHSA 2R1LA 1K77A 2EG6A 1WZAA 3FOKA 2Q3RA 1V7YA 2D69A 3WBAA 4AIBA 3WF0A 1E5NA 1XLFA 4ZQPA 4GUFA 1L8NA 1PZ1A 5XIMA 4W85A 2FZNA 3WJWA 5MF5A 1XFCA 4KW2A 4Q8WA 3LG3A 1GYMA 1LBFA 1WPCA 2PC8A 1ZLPA 1W8GA 2AAAA 2XIJA 3W7LA 1ONFA 4LC8A 1FY6A 3H12A 4HJFA 5DT7A 3UXDA 1FEAA 3I65A 1U2YA 4LTSA 1YLVA 3CUXA 3GKFA 1ITXA 3LEPA 1Y7VA 2YW3A 2CERA 1GSNA 1HZYA 3CV6A 2PDBA 1PIGA 1W3NA 2V5JA 1DHPA 3MSRA 4FP1A 1CZ1A 4S3EA 3O06A 4XZMX 5AKQA 5DFAA 1OIFA 1EJRC 1FHUA 1HGWA 2JQXA 1EUNA 4MG4A 3ZR6A 3H2EA 5C6MA 4XB3A 3EOUA 3TYDA 2ADAA 2QLYA 3TAKA 3M7SA 3RX2A 4DNAA 1QNQA 5FMHA 2R94A 3U2EA 3OZPA 1DJGA 1W1TA 3A6OA 2HZGA 4X3ZA 2DZXA 4CUCA 3VKDA 4XAYA 3BICA 3ITYA 1A47A 4FXRA 3K8MA 5E9XA 3WLOA 2VI0A 3AWOA 2JF7A 1XX1A 4GQGA 4H4TA 1AJ2A 2QPXA 1HXJA 1JRCA 3TYCA 4BEQA 5CPMA 1H7WA 1L2QA 1EWEA 2PODA 4UCFA 1UR3M 1MW1A 1ZALA 2ZZCA 5G5HB 3ZVHA 1JPIA 3LDVA 4PBGA 1NAL1 3LGGA 2XFRA 3VMOA 1GV4A 2FB2A 5J04A 1EEXA 2XG9A 3H2AA 1IZKA 3VIKA 4H4IA 2WSRA 4IIBA 2VC6A 3MMUA 3VNZA 1CIUA 4A8RA 3IJLA 5D9NA 1FCVA 4GJJA 4JTIA 1W9BM 1AG1O 2E40A 4QAWA 3GVVA 3BURA 1O66A 2JFEX 5GPRA 1JRPA 3CQKA 3MBDA 1LZOA 1O94A 1W3JA 3NVVB 1PV8A 1TR1A 4GIEA 1M41A 1HNYA 1HO1A 3WBXA 3VAVA 4HNUA 2RDXA 1LT7A 2F8QA 4HMCA 4Q4QA 3UJRA 1TG7A 3H70A 5LGZA 4CQ8A 5I3JA 2CFYA 3UXAA 2ZE0A 1S5TA 3BWWA 3B9NA 2RFGA 3GH5A 1H1YA 3N4FA 5HNTA 1KGWA 4H8VA 4Q8OA 3GB6A 1DXIA 3GTXA 3NG3A 1EUAA 3UPMA 2DIKA 4IQLA 4H9UA 3FEMA 3PZQA 1N2VA 2TPRA 3LLXA 5CAHA 1IXPA 3E96A 1BG4A 1F3WA 2QGYA 3VZXA 1JZ8A 1PKMA 5HULA 1HKIA 1P1XA 4O1BA 4TMBA 1J01A 5LA2A 1OT1A 3ARTA 3LBCA 3N6HA 2FFIA 1V77A 3S46A 3WNMA 1W31A 3P3BA 3PZNA 2I9EA 4Q7BA 1JROA 3U4FA 4CNTA 1XCWA 3W86A 2QKFA 2CLFA 4ZENA 3F1QA 2B81A 4QG6A 1HKWA 3AYRA 3G24A 1EYWA 3AHYA 4M6VA 1N5WC 5CZ0A 4FB7A 2FVMA 4J5NA 2QJMA 4PGLA 1UUQA 1Y8BA 1Z32X 2WOQA 3C0JA 1Q7QA 3W23A 3G8EA 1UBSA 3QH2A 4ZO6A 5A2BA 3FX4A 1AUSL 1J2BA 4JDYA 3QGKC 3DFYA 3N17A 3N34A 3LCLA 2OZTA 2V5BA 1N8FA 4XWUA 1UWIA 1XSKA 4RNFA 5EBAA 2KAUC 3C8NA 2GL5A 4H7VA 5H2ZA 4WR3A 3EB2A 3DFHA 3URNA 5HMFA 1FWAC 3EZ4A 3G1VA 3O0HA 1BF2A 2OYLA 3A7RA 3OC4A 4P7QA 3JR2A 5DXXA 3GNPA 1I1WA 4QE4A 5LIKX 1OFPA 1XLBA 2E6FA 1KKRA 1E73M 1FWGC 1EO5A 3IIZA 3O7UA 1QVBA 4QFUA 2R1KA 1NJJA 3HN3A 1IF2A 3GXNA 3EB3A 3QQ0A 1UKOA 1GVSA 2ZFAA 4P8VA 2X1SA 5LIWX 2J25A 2C3DA 1N60C 1WKFA 4PRRA 1GYLA 1SJDA 2OOFA 3WUEA 5LKYA 1U1JA 3R4IA 4LS0A 3ZVHB 5LNRA 2X0YA 2VDIA 1SSDA 1E4MM 1EC8A 3WK0A 4HK6A 3RCNA 3W1MA 2XWEA 1EPVA 1FHVA 4NZ5A 2Z2UA 4DO4A 1POKA 1OCJA 3TCEA 4P5UA 5DMNA 4PEKA 1VQZA 2H3DA 5TR3A 1TPEA 3C4UA 4I8YA 1R9XA 1B9BA 3B9AA 2YBUA 2G3JA 4O57A 2ZZ4A 1S1RA 1HN1A 4RDYA 3W82A 2A3BA 3S6TA 1M3UA 2J66A 4BZYA 4WKHA 3TH6A 3LPOA 2VX4A 1PDYA 2YXOA 3FYYA 3PVFA 1R85A 2W3SA 3M43A 3IUHA 3TU9A 1GKRA 4QJ3B 3A4JA 2WPCA 4ENLA 3OVPA 4MPQA 2WWCA 5CPNA 1GZ1A 1B3VA 1JCJA 3TX9A 3BG5A 4WD0A 3STPA 4K37A 4GGBA 1EP2A 2G8ZA 4LBRA 4IHCA 5HDRA 4HYRA 3D46A 2C91A 3VCRA 1DL3A 4Y8EA 3ZJ7A 1X6NA 4EE9A 3UVIA 1UJQA 1YXYA 2IKJA 1A5MC 4OV9A 1AK5A 4EIVA 2X1IA 1LVLA 2C79A 1T7LA 5FF0A 3N2MA 3PF3A 3BZJA 3CMGA 4LS2A 5RUBA 3QPEA 3NNTA 4C90A 5C70A 1PHQA 1FHDA 3G1AA 1W54A 6PTDA 4YTRA 4JQ3A 1IEWA 2QIIA 3W6MA 2ATMA 4UCGA 3A24A 1EQPA 4A29A 1XS2A 5DCEA 4CCCA 4WRHA 4NY2A 2EPMX 1XSIA 2EF9A 4O11A 4NZFA 3JUGA 2GQ8A 1KBLA 1XFBA 4KRZA 1NQ6A 3B03A 4H2HA 4Q8VA 4INFA 4MFEA 3W1XA 4A3QA 1Q6DA 4LYPA 2BC1A 3WNPA 1J96A 4GXWA 4W4QA 3W7EA 2WMKA 5CPTA 3R12A 5E6ZA 4MOZA 1WXYA 3C5QA 4CVUA 1GERA 1UA7A 3C56A 2NV9A 2PGEA 2W66A 3ORWA 1UR4A 3IK4A 2XFYA 3LI0A 4RX0A 3O0KA 1V8EA 1QW9A 3MY9A 4QNEA 4CVWA 2QJHA 4NJHA 3OVQA 2WOWA 2YA2A 2HEJA 3IJ7A 4B9YA 1R3RA 4O13A 1RSCA 2EPOA 3KRUA 1UD3A 4MJMA 1F2JA 3IJDA 4UFJA 4H9MA 1YMYA 3HGSA 5U25A 4ALDA 1D7FA 1OJTA 1YXCA 2ISDA 2FHCA 1GVEA 2BB0A 1A3XA 5I09A 1LRQA 1OQFA 4R7OA 3MUAA 1I2OA 4PBEA 4GY7A 2PP3A 4NUWA 3KEHA 3T1GA 3SUSA 2DP3A 2O9TA 1I4NA 2ZDRA 3MC5A 3NO3A 4GBUA 2YSWA 2GGJA 3LCHA 2PDHA 4BFAA 1R5YA 5KZMA 2Y5JA 3RF9A 4H1ZA 1ONWA 4KEVA 3UQNA 2HV5A 1T99A 2YJQA 4P8WA 5HANA 3DG7A 3GW0A 3WL1A 3CWNA 2ZTKA 1Z9AA 4DEFA 2Z1SA 4CKQA 3U4AA 4QE1A 3LBOA 2QMJA 3F2BA 4PE8A 1E9IA 4NXKA 3IJIA 3NURA 4ZB2A 1N61C 3VD4A 4UFMA 1MUMA 2INZA 3ITGA 2HBVA 4X63A 5HK4A 1NOWA 3EOOA 1OGBA 4WF7A 3EA1A 2DSUA 3OQ8A 2NQ9A 4Y96A 3A5VA 3EA2A 3BUVA 3N29A 4KEZA 3SEPA 4Z08A 1N62C 2P3EA 4CU8A 4IMEA 4M52A 5BOOA 3II1A 2YLAA 1BXNA 4XZBA 1H0IA 2MANA 2RKXA 1XH2A 3GYEA 3ITOA 2YBTA 1P0EA 3LV6A 1JCNA 4ONVA 2I16A 1ALDA 1ZJAA 4CQ9A 4YXGA 3LB0A 4IX2A 3VVGA 4MYAA 1O7AA 3AZTA 7PTDA 1UR9A 4JL1A 4O12A 1GEHA 2CHNA 2VX7A 4IIGA 1KM3A 1X39A 4D6HA 3N2CA 3DESA 3ZS4A 3KL3A 2A7PA 2HVOA 1DWHM 3WJZA 4FSAA 1US0A 4LY8A 1WYGA 3KBVA 4MKSA 1CNVA 1GKPA 5CG7A 3VUPA 4YTSA 5LHFA 1KFLA 3PAOA 4F0KA 1OFRA 3N11A 2WW5A 3QN3A 4DO5A 1X6UA 1G6CA 5CBJA 4PCFA 2OWWA 4IXXA 3ARYA 4AHQA 3UF9A 1CLXA 1ICPA 5K2ZA 4CU6A 4FR1A 1GETA 1VIZA 1IXNA 1TJPA 1V5XA 4ORIA 3LY0A 1Q45A 3MSDA 4UTWA 3CPGA 2IXVA 1WP6A 1EJ7L 2WPBA 3A4XA 2YCJA 2CBVA 4Y7EA 4PMXA 2V6OA 5D8ZA 2VHLA 3O2LA 1EJUC 1EBDA 1A5NC 2NPXA 3SCVA 1W9XA 1CGXA 1LUCB 4US5D 2VNCA 1TCMA 3CNYA 1WDDA 4D8AA 1AA1B 4H19A 4GRTA 1ZGDA 3TW7A 4QEEA 1MYRA 4S3BA 4JTEA 2QV4A 1G1YA 2VOMA 2XM2A 1IE7C 2ZDSA 4D2JA 3VNMA 3BJFA 2DQXA 1H41A 1XJBA 4IH3A 1CXKA 1EB3A 4IJCA 2P10A 5KMYA 3QY7A 2XJ7A 3BLDA 4M6QA 2CXEA 5EGRA 3BCDA 1DWJM 2UBPC 1PE1A 4AFYA 2XINA 3KL5A 3V5FA 2GQ9A 2Y89A 4FMVA 4GYJA 4L9XA 4L56A 1LG2A 3W6LA 1C29A 3V36A 1MSSA 1EEPA 4QJ1A 4URIA 3H2FA 4XAGA 4NSBA 3O07A 4LANA 1J0KA 1GVRA 4L65A 3B8UA 1TTIA 1AW2A 2VFDA 3KW3A 1SZNA 4DX3A 1UKPA 1SR9A 1FDJA 3MHFA 1WXZA 4MY1A 1R6WA 2D23A 3U5YA 4X2RA 4CD7A 5HWNA 5K7JA 3S1WA 3WDRA 1H4PA 2QCFA 3OTRA 4UB9A 4L7ZA 3ABSA 4UOZA 4XKYA 2Y70A 4KKXA 4HMEA 4GXMA 1V0MA 2WJZA 3BSMA 2FHBA 3M4HA 1E1FA 3N04A 4MWAA 2XSBA 4JFUA 3NA8A 3DGZA 4XO7A 4HZ8A 3CJPA 3W7MA 2J7GA 1JDFA 4XG1A 4GI8A 4NI3A 1G9HA 1M7XA 3VYLA 2IPWA 3WBWA 2WVSA 3QPZA 1J6PA 1IWAA 3W1AA 1OYBA 3D47A 3VZZA 2CBUA 3SR6B 2Z28A 4Z1DA 4S3AA 4AZBA 1VEPA 2E0PA 3IK2A 1I6NA 1QATA 2VEGA 2O9PA 1YPIA 3PBMA 3R8HA 3KP1A 4GG9A 3WBYA 3UYIA 1J6OA 1W32A 1A53A 1OX4A 2XGBA 4LIIA 1NHPA 1CXLA 4IFRA 4JTHA 2WMJA 2X30A 1XQLA 3QV9A 4AZCA 4LYQA 3PBYA 1H0GA 1HQTA 1VGAA 4HD5A 4JOMA 3QOKA 4Z2LA 3V1HA 4WOQA 3CS2A 1B4KA 3L5MA 4HPXA 4H4XA 2WP6A 2XVPA 3KCOA 4EPEC 4KPLA 1NDWA 3VGGA 2RJGA 3MT1A 1HT6A 1R2SA 1S39A 1J0IA 4Y6GA 4D6JA 3WX7A 1PXGA 1TPWA 3FYPA 2WHJA 1QI2A 2GJNA 4KFOA 2X8GA 3UEQA 1W2VA 2J9YA 1XG4A 1DJXA 3Q94A 3IPWA 1YNPA 3K8LA 3WJYA 5D9MA 1H7PA 2AL1A 3TFXA 3UWZA 3LADA 2E9LA 3R13A 3BH4A 2PEVA 2CNCA 3ZIZA 3M0YA 5KTLA 1VFLA 2WZHA 1VPQA 1W3TA 3CTLA 3LZ5A 4P61A 3UXKA 4M19A 2WQDA 3T05A 1M7OA 1LP6A 3W22A 4PFHA 2WNNA 2DSWA 4O1CA 7TIMA 1K9DA 1TTQA 4N9CA 4KS0A 1H51A 4R34A 1KWGA 3ZJKA 3HQNA 4J3TA 4GRSA 3BAWA 2CCRA 1H2JA 2QZRA 3GC5A 4QP0A 4BWLC 6ALDA 1VFUA 1T8XA 1ZMCA 1NOFA 2WHLA 2JK6A 5F2LA 1GCYA 1T0OA 5CLWA 3IIVA 4TVCA 3WF2A 1AMKA 4HVXA 5I7GA 2J79A 1NF0A 5KZDA 2H8XA 1ZAJA 3AIVA 2ZXAA 2QXWA 3STEA 1AZ2A 4ASTA 2CC0A 2AAMA 2GQAA 2V2DA 3LCXA 3VC5A 4B5NA 4EF8A 1FDYA 4APNA 7TAAA 7A3HA 2ONEA 2V3DA 3UT0A 1FH8A 5FOOA 4K1WA 3VIMA 1JZ6A 2GVEA 3SCNA 5F4WA 4XKYB 3N15A 2QDDA 2NXHA 2JGQA 2QPUA 1XYLA 4ZOBA 4MWAB 4Z0SA 4LCRA 4OZOA 1GOKA 5CH9A 3URAA 4E4FA 1RLCL 3LCWA 2EPNA 4GFIA 2CWNA 3DYPA 3LPFA 3FVDA 3RGTA 4C1KA 1DP0A 4KRTA 5EBKA 2XIMA 1XLEA 3CUGA 4L6DA 3ICJA 4FOKA 4C6KA 5IOBA 1X8CA 5A8OA 2PS2A 5IM51 1WDQA 5I5RA 2PDKA 3P7YA 4ZTXA 3P84A 1XYFA 4QDWA 4E3TA 2ZRXA 2REQA 4A2RA 3H8AA 2A3CA 3B8VA 4DJEC 3WH7A 2G3IA 4B5UA 1ZTVA 4C6EA 3G77A 3ZR4A 2EQ7A 1OX4B 3E9AA 4HU3A 3W85A 3W07A 4W86A 4MNLA 4DJED 2OSYA 3DBNA 1A49A 4TQTA 3TC6A 3B9JB 4AZCB 2R1PA 3RUBL 1K7FA 1UHVA 3FKKA 3T0BA 2B7NA 4HA3A 3UWQA 5I3IA 2HVMA 1GG0A 4K6AA 4GYFA 1YKWA 3U5UA 4FZIA 5K9CA 2A6NA 1HKKA 1UZDA 5MKGB 1Z6KA 2VRJA 5FD0A 2ZICA 2IKHA 3M5XA 1UP2A 4KPRA 2VTFA 4AWEA 2FMOA 1QBBA 1ZP4A 5IRPA 2YVJA 1R7AA 3M16A 2Z24A 2OZ0A 5H8MA 2X05A 4WHBA 4JGDA 4K68A 5HUPA 1ME7A 1T5AA 2D1ZA 5HQEA 3GNOA 3ISIX 1TQXA 1KLZA 4GVIA 1IT0A 1US3A 4POCA 4YHGA 3FN9A 1OG0A 5FS8A 2OKTA 3OBEA 1H11A 1KW1A 3KOWA 2DIEA 2OX4A 2C19A 2CZDA 1VKFA 5JU6A 1HGYA 4HNCA 4C6PA 2W3ZA 4LSBA 1LWHA 4TUFA 2VYOA 3IIOA 3SCOA 5D37A 2Y6ZA 1X2GA 1KTNA 1SO3A 3GUWA 3VOHA 1EGZA 5AZ0A 1EJXC 2ISSA 3AOFA 4WLCA 1PUDA 1JPKA 1MWOA 1P6WA 3BSGA 3N2BA 4RDZA 5C9ZA 1S46A 4M5PA 2GR2A 1EDGA 3CWOX 4PA8A 2QPSA 1ICSA 2VR2A 3CV7A 1I60A 4I9TA 3T6CA 2Y7GA 2PCQA 2NX1A 1BXBA 2Z2AA 1QU4A 1G4PA 3EMZA 2XSXA 4FPSA 3U0HA 2W54A 1XLDA 3OHMB 3E02A 1PZ2A 3WQ4A 3PUDA 2ZC8A 2WPEA 2DJLA 2DUZA 1UR1A 3P81A 3CIWA 1TPDA 3CASA 3PZMA 4WJEA 1TV7A 3HG5A 5HNNA 2BP1A 3T9PA 5A6BD 2NUYA 3EWXA 3EOLA 1J12A 4PCTA 4PMJA 4QHRA 2VX6A 5A8PA 4FA3A 3OLIA 4GUJA 1E1EA 4V28A 3VOFA 3EKZA 4XBSA 3Q65A 3C61A 2E6DA 1C7SA 2R14A 5I78A 4H8NA 1ELSA 5CC6A 1H09A 5U4NA 2HS6A 1ITQA 3P60A 1WUEA 3DG3A 5D2YA 1OVDA 4PH6A 5FCZA 2I5QA 3S5SA 5BWFA 4JTTA 4MFDA 3DUGA 3R58A 1QHOA 3BG9A 4LVGA 3AXHA 1LT8A 8CGTA 2WLYA 3FJNA 1TPUA 2REQB 4J28A 3ZLHA 4LYKA 5A69A 5BRBA 3W2UA 3TXVA 3SCWA 1BTCA 4QXIA 2YBVA 4KEMA 2ZA2A 4DF2A 1I9CB 3VKBA 3WDPP 4LRTA 1V02A 2R82A 3A9BA 2GUYA 1UZHA 1CGWA 2VEKA 1REQA 3WDQA 1FWRA 3B40A 2VZTA 1W56A 3ZQ9A 4ZB0A 1IEXA 2QF7A 3I3DA 2H90A 5KSWA 3N3MA 1XBZA 2EAWA 4J7RA 2YDRA 4JTFA 1PWLA 3VE9A 3K46A 3PPHA 4JYFA 4M81A 4JIHA 2WV8A 4MY9A 5E70A 1J79A 4D6DA 1VR6A 1XCFA 4AU0A 2BXZA 1RP9A 5AYIA 1VYRA 3S5OA 5HPOA 4LFYA 3WD4A 2WBAA 1BFNA 1BYCA 4FNPA 4I90A 4DUVA 7ENLA 3LPPA 3AMLA 5BMXA 3G1XA 5F4XA 4PCSA 1R47A 3SQSA 3ABXA 3MI6A 3KBWA 3PSWA 3MUIA 3N2TA 4ROQA 3CM4A 4C1NA 2EPHA 4ATLA 3W70A 4YVPA 3ZJ6A 1YNQA 3E2RA 1H62A 1RALA 1D2KA 1N8WA 3AO0A 3RHGA 3GDLA 4TVYA 4R85A 1M68A 2YL5A 2ON3A 3TYUA 2ZIDA 3VGBA 1RBLA 5K4ZA 1IR2A 4C6DA 1JF5A 1C92A 1W2PA 5HWJA 3PUEA 4WZHA 4CN1A 1QK0A 1EJVC 2E77A 1W5MA 4XTDA 5EMYA 1EGMA 1KCKA 4GH3A 3P5ZA 1FWBC 4C1LA 1AD4A 3BVJA 2E5BA 5HWMA 4IMAA 2OU4A 1EX5A 3QGVA 4IMCA 3PZGA 4UTUA 1LRNA 3P80A 4ICCX 2FZBA 3SUVA 2JK2A 3OVRA 4IIHA 3T07A 5EFDA 3A5FA 1C8YA 1VF8A 2I56A 3LNMA 3CV1A 1UD2A 1R3SA 4EMIA 1PHWA 4H6KA 3IGUA 1NELA 4DBEA 2IW0A 3BOXA 1UD6A 5LA0A 2YL8A 5D09A 2DV0A 2VUNA 5M3WA 1RQHA 3ITVA 3FHQA 1TV5A 1BYDA 3DHUA 2A5HA 3PPFA 1QHZA 5AYBA 3V7PA 4GK8A