1XDIA

Crystal structure of lpda (rv3303c) from mycobacterium tuberculosis
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
465
structure length
459
Chain Sequence
VTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFHKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rv3303c-lpdA
publication title Characterization of a New Member of the Flavoprotein Disulfide Reductase Family of Enzymes from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 142
structure length 459
sequence length 465
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2004-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF04820 Trp_halogenase Tryptophan halogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1xdiA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xdiA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xdiA02
4E0VA 3L1RA 2NVKX 3ATQA 3JSKA 4GUVA 1KFYA 3H8IA 3AYJA 3P9UA 1TDEA 1YKJA 3UOYA 4ECHA 1JRYA 1TDFA 2JAEA 2YR5A 3QVPA 2TPRA 2CFYA 2V5ZA 3FPZA 3K7QX 2PHHA 1FOHA 1LV0A 4USQA 1QLBA 5EBKA 4PABA 4OPLA 5JCLA 1PHHA 2RABA 3M12A 1EL5A 1LJ1A 4C74A 1YQ4A 4B63A 2I0ZA 2O9ZA 4U2TA 1COYA 1JRXA 1N4VA 3GWDA 2XYOA 4AP3A 4YSHA 1ZY8A 1YY5A 5FS7A 1TRBA 2RGOA 4Z24A 3NH3X 1S3EA 3RP7A 1KNPA 1RSGA 4LA1A 2GMHA 2BABA 3GDNA 2YG7A 2YLXA 1B5QA 4H4QA 4J36A 1NG3A 2BK4A 2GF3A 2Q6UA 3AEEA 3AE2A 4UDRA 4CCRA 1PDHA 3K7TA 2YVJA 2BS2A 3AXBA 1GT8A 3CPJG 1BF3A 2VRMA 1DODA 2A8XA 1JNRA 2WQYA 4H2NA 3GD3A 1PXAA 3EANA 1XHCA 3G5SA 1NHQA 3CGEA 2WDQA 5BULA 4U8KA 4H4RA 2BS3A 2VOUA 1ZKQA 2C76A 4YWOA 3GMCA 1N4WA 3WE0A 1ZX9A 2Z5XA 4TM4A 4EIQA 2R9ZA 4H2RA 1QJDA 2AAQA 1N1PA 1GRBA 5JCIA 2B76A 3UKQA 4DGKA 5J60A 4IVOB 2CDUA 1TYPA 3NTAA 4CY8A 2EQ6A 5LV9A 3II4A 1KNRA 3AE7A 1REOA 3LZWA 3UKHA 1CF3A 1Y56A 2WESA 3CGBA 1IUVA 3AE5A 1MOKA 3AE3A 4K2XA 4X9NA 3V3NA 5FS8A 3NYFA 4XWRA 3C4NA 3QFAA 4H50A 1DOEA 4B66A 2R0PA 1H6VA 3IF9A 2XCGA 4YKFA 3QSSA 1ELIA 3BI5A 4C3XA 3BNUA 3QSEA 3SQPA 2ARDA 3ALMA 3ICRA 5KRQA 4UDPA 1F6MA 1Y56B 2BC1A 3DGHA 1H86A 4U8MA 1EL7A 2X50A 4I58A 4OCGA 4RSLA 3VQRA 3AEDA 2VQBA 1CC2A 1PBFA 3UKKA 4U2SA 2F5ZA 4C5OA 3DJDA 4J2WA 3L8KA 3RP6A 2R0CA 3CN8A 1XPQA 2NPXA 1D5TA 2C73A 4B1BA 2TMDA 4JY2A 4K5SA 4Z2UA 4A9WA 1E1MA 3QJ4A 2VQ7A 3ALJA 4Z25A 4H2PA 2E4GA 1ONFA 3F8RA 1FEBA 4J56A 1M64A 1LQTA 3NNEA 3B6DA 1PXBA 4B68A 2VVLA 3G5QA 1JEHA 2XLUA 3VRBA 2AQJA 2R46A 3OZ2A 1OJDA 1NPXA 3AD9B 5KWFA 3DGZA 2WPFA 1OJTA 1KSUA 5KOXA 1D7LA 4OPIA 1YQZA 3SM8A 2BK3A 4YTNA 4EMJA 5BUKA 2PYXA 5KVHA 4K7ZA 3DMEA 1H81A 1CJ2A 1Z6LA 4NTEA 3K30A 4JY3A 1IUSA 1Q1WA 1DXLA 5U25A 1IUWA 3UTFA 3Q6JA 3O0HA 1L9EA 2YG3A 3CIRA 4MJWA 2YG4A 2JB1A 3UKFA 2R4EA 3H4KA 2R45A 2XLPA 3NIXA 5M10A 3GRTA 3NK1X 4D04A 3E1TA 4YSYA 1MXTA 4EMIA 4XWZA 3C4AA 3PVCA 1VQWA 2B9WA 1LVLA 2FJAA 2GR0A 2YQUA 3UOXA 2R0GA 2YM1A 4UP3A 4IVMB 2WS3A 5M0ZA 2DKIA 1BKWA 4K22A 3V76A 3QFBA 4AOSA 3SFDA 1GTEA 1GETA 1GXFA 2ZZBA 5GRTA 3IHGA 2BS4A 1GRGA 3DJJA 2RGJA 3QSMA 5IQ4A 4TM0A 5KVIA 2GH5A 4U2LA 2GR3A 1B4VA 1DNCA 1IUUA 1NEKA 2Y6RA 1PJ7A 3G5RA 4OVIA 4U8NA 5EB4A 3KKJA 4YSZA 4A6NA 1E1NA 1CJ3A 2QA2A 3ABVA 2BXRA 2GAHB 4J34A 2VZ2A 5HXIA 1O5WA 2Q7VA 2A89A 4X9MA 5EB5A 4ZCDA 3BNMA 2X8GA 3S5WA 2WETA 3F8DA 4DSGA 5CKUA 3FG2P 2XFNA 4DSHA 4EQSA 3AECA 2C75A 4B67A 3CPIG 2W0HA 3I3LA 1FCDA 1VG9A 2C65A 1VRQB 4A5LA 3GRSA 1ZMDA 3AE9A 4U8PA 2XLRA 2B7RA 3AWIA 3VRDB 4AOXA 4REKA 4A79A 3AD7B 1ZOYA 3KVEA 1W4XA 2RGHA 4H4UA 2C66A 2E1MA 4AP1A 1ZMCA 2GEWA 3ATRA 4GDPA 1GTHA 5C3JA 1S3BA 4GCMA 4FK1A 2JKCA 2FJBA 3UTEA 2YLTA 3DH9A 1PN0A 2YM2A 4XXGA 2V3AA 2OLNA 3AE6A 4BURA 3S61A 3AYLA 4D03A 2GB0A 2X99A 1RP0A 4YSXA 4JQ9A 4GR1A 5J7XA 4J31A 1BZLA 5KOWA 3AE8A 3H8LA 2FJEA 2C3DA 3FIMB 2H88A 1F8RA 1HYUA 3D8XA 4ZCCA 3DK8A 1CL0A 1E1KA 2YLSA 3NHOX 1ZK7A 4JN9A 4TLZA 1GEUA 2IIDA 4YT0A 4NEWA 1GERA 3B3RA 1H83A 3P4QA 1D4CA 3KA7A 3GDPA 1H82A 3CTYA 1DOCA 5BRTA 2XLTA 1D7YA 3P1WA 4OPGA 3UKPA 3ZYXA 4OPDA 3ALLA 4CNJA 3UKAA 2GMJA 4H4ZA 2YR4A 2WOIA 2ZBWA 3FMWA 3GSIA 3VR9A 1LQUA 1TDOA 5FMHA 2FBWA 3M0OA 5HY5A 4N9XA 1P2EA 5KXJA 1GREA 2HQMA 2VRLA 4YXDA 2EQ8A 1JOAA 3AEGA 1JRZA 1JU2A 1KDGA 3I6DA 3NYEA 5JCMA 5JCNA 2ACZA 3K7MX 3AE1A 2YWLA 2X8CA 2XFQA 4JDRA 1PJ6A 2XVIA 3SGLA 1PXCA 2H89A 2WPEA 3COXA 1H84A 2V60A 2XLSA 4CCQA 3AD8B 2C64A 2B9XA 3SFEA 2WHDA 1ZOVA 5ER0A 2WBAA 1O94A 1MO9A 1GESA 4ADWA 4LU6A 4AT2A 3RNMA 4A65A 1H7XA 2X8HA 5U63A 3EAOA 2A87A 3OC4A 2WPCA 1B8SA 4Z43A 1X31B 4EIPA 1M6IA 1O95A 4J33A 3F8PA 3UP5A 2WU2A 2GQFA 2IVEA 4ZN0A 3ADAB 5GSNA 2GQWA 5JCKA 4B65A 4ICYA 5FS6A 3GWFA 1L0VA 3C96A 3LB8A 5CQFA 3CNDA 1S2QA 3UKLA 1P2HA 3RP8A 2GV8A 2WP5A 1GRFA 2XFOA 3ITJA 3DJGX 1K0IA 4Z2RA 3NK0X 4AT0A 3NG7X 4EM3A 3UTGA 1K0JA 4YKGA 1OJ9A 3IHMA 1DJQA 1ZDLA 4U8JA 2YG6A 4H4TA 3GMBA 4CBQA 4GRTA 1FL2A 1BWCA 1SEZA 4PAAA 4HA6A 3IC9A 1L9CA 1S2YA 3REDA 4FK1C 3AEAA 5FS9A 3CNTA 2JK6A 2YLZA 5BVAA 1E1LA 3NRNA 2ZZ0A 2GR1A 3KU9A 4H2QA 4H4WA 4OPCA 2OALA 1IUTA 2JB2A 4BV6A 2QAEA 4OPUA 1OJCA 4FX9A 1GPEA 2ZZCA 1AOGA 3GYJA 1F8SA 4NTCA 4OPTA 4GF7A 1F8WA 3LZXA 4Z44A 2C3CA 1B37A 1PBCA 4H4YA 4FDCB 3DA1A 4WX1A 4LIIA 5IQ1A 4A6NB 4KX6A 4K8DA 5EOWA 1Y0PA 3RHAA 2DKHA 2BC0A 3CNSA 1GSNA 5U1OA 4Y4MA 2YG5A 2FJDA 3BHFA 4H4XA 2B9YA 3DK9A 1GNDA 4EM4A 3CGDA 1OJAA 1RYIA 2X3NA 3KPFA 3PS9A 3ICSA 1FECA 3M13A 1FEAA 2WEUA 3KLJA 1EL8A 4TM1A 3NTDA 3BI4A 4DNAA 2JBVA 3QVRA 4I59A 4B69A 3BHKA 2J3NA 3AEBA 3EF6A 4APNA 3ICTA 4TLXA 2CULA 2OLOA 1IJHA 4YTPA 1NHRA 4TM3A 1GV4A 2UZZA 3PO7A 2V3BA 3T37A 4Y4NA 1E6EA 2APGA 3NK2X 3NKSA 1TYTA 1PBDA 4K5RA 3P4RA 1E7PA 2EQ7A 1XANA 2JB3A 1NHPA 4CY6A 4C3YA 1PBBA 2BXSA 2QCUA 2GR2A 2BCPA 4USRA 3UTHA 3DK4A 4UDQA 3V3OA 1GRAA 4CNKA 4EQXA 2BYBA 1BGNA 3IWAA 2C67A 4B64A 2WU5A 2XVEA 2GRTA 3AE4A 3URHA 4A99A 4X4JA 2YVFA 3P4SA 4BK2A 1KSSA 1UKVG 2BCGG 2VVLG 5HYMA 3VRAA 3NT6A 2Y6QA 4H4SA 4JNQA 2B7SA 1N4UA 2GAGB 4H4VA 3EPTA 1GOSA 3CGCA 1CC4A 1Q1RA 5TR3A 2WDRA 2XVFA 2YLWA 2YR6A 2V6OA 5IPYA 1PBEA 1YQ3A 3VR8A 2YVGA 3LADA 4J57A 4HB9A 4O5UA 4BK1A 4IA6A 3KD9A 1KF6A 1CHUA 2BA9A 3D1CA 1D4EA 2XFUA 2WOWA 2Z5YA 2WP6A 3UOVA 4Y4LA 2C70A 4U8OA 2YLRA 4M52A 4EMWA 4Z26A 1TDNA 4BJZA 3LJPA 2OAMA 1V59A 3ZDNA 4IA5A 1CJ4A 1L9DA 3ISHA 1XDIA 4U8LA 1VG0A 4WCTA 1LTXR 1NAAA 3GD4A 4O5QA 2OA1A 2BK5A 4A7AA 5C2TA 3UP4A 1ZP0A 3NN6X 2XDOA 2IVDA 1GRTA 3CPHG 4H7UA 1GALA 3NLCA 4YTMA 2WDVA 3DJEA 5HHFA 3FBSA 1D4DA 5DBJA 1BGJA 2XVHA 4Z2TA 3AB1A 1CBOA 4U8IA 1Q9IA 4BJYA 4RG4A 3HZLA 2E5VA 3CNJA 1H7WA 3AEFA 3UOZA 1DJNA 3P4PA 1EL9A 1NDAA 4H4PA 2R4JA 3BI2A 2Q0LA 4NZHA 1EBDA 1CJCA 1PJ5A 2Q0KA 4EQWA 2AR8A 1NENA 4RG3A 4IV9A 4KPRA 4GDEA 3R9UA 1TDKA 2WP9A 3LXDA 3UCLA 1PS9A 3NN0X 2QA1A 4P9SA 2V61A 4JNAA 1DOBA 2C72A 3LOVA 4EQRA 2C7GA 2XFPA 4BK3A 1NG4A 1JNZA 1E39A 2XVJA 2GVCA 3AYIA 2BACA 1K4QA 1IUXA 4NEVA 3CNPA 1QO8A 1VDCA 2VVMA 2YAUA 3NYCA 1CC6A 2EQ9A 1GRHA 3Q9TA 3GYIA 5L46A 3NGCX 1F3PA 4CRTA 4NTDA 1K0LA 1NHSA 2WOVA 1LPFA 2CVJA 4C77A
chains in the Genus database with same CATH superfamily
4E0VA 2NVKX 3JSKA 4GUVA 3H8IA 1JRYA 2YR5A 3QVPA 2AL1A 3K7QX 1FOHA 3SYIA 5EBKA 2O9ZA 1COYA 1YY5A 4E6MA 1FO4A 4Z24A 3SBFA 3HYXA 2GMHA 2YLXA 3HRDC 4H4QA 2OQYA 1NG3A 4CCRA 1GT8A 3CPJG 3VC6A 5BOEA 3DFYA 3UXLA 4H2NA 1XS2A 1NHQA 4U8KA 2BS3A 3R1ZA 3WE0A 4EIQA 1E9IA 4H2RA 4G74A 2B76A 3TCSA 4DGKA 5J60A 4IVOB 2CDUA 3NTAA 4CY8A 1BQGA 2EQ6A 3II4A 1KNRA 3AE7A 1JPDX 1CF3A 3AE5A 3CGBA 4K2XA 1MOKA 2GGGA 5FS8A 4XWRA 4H50A 1DOEA 1H6VA 1ELIA 3BI5A 3QSEA 3SQPA 1F6MA 1Y56B 3DGHA 1H86A 4U2SA 2C4CA 3L8KA 3S47A 2NPXA 2TMDA 1E1MA 3ALJA 4H2PA 4IHCA 5KMRA 3B6DA 1JROA 5ENLA 1PDZA 4E4UA 2ONEA 1NPXA 2HNEA 3THUA 2WPFA 5KOXA 1N61C 4OPIA 3VA8A 4GAPA 2PYXA 5KVHA 1H81A 1Z6LA 2HZGA 1DXLA 3UTFA 2YG4A 2R45A 3GRTA 5BOFA 3U4FA 3PVCA 2B9WA 2GR0A 4UP3A 2WS3A 2P8CA 4AOSA 1GTEA 5GRTA 3SR6B 5IQ4A 2RGJA 3QSMA 3TWAA 4U2LA 1DNCA 3G5RA 4U8NA 1SJBA 2Q7VA 3BNMA 3S5WA 3F8DA 4DSGA 4EQSA 3AECA 2C75A 3I3LA 1FCDA 2C65A 2P0IA 3IJQA 3AWIA 4MGGA 4A79A 3KVEA 2RGHA 4AP1A 3UCCA 2JKCA 1TKKA 3UTEA 2YLTA 2YM2A 2OO6A 1RM6B 4JQ9A 4J31A 3FIMB 4ZCCA 5J7XA 4H1ZA 4TLZA 1GEUA 3B3RA 1D4CA 3FJ4A 2ZC8A 3ALLA 4H4ZA 4F4RA 1TDOA 5HY5A 1P2EA 4YXDA 4TVYA 1JOAA 3AEGA 3I6DA 2OZTA 1KDGA 3NYEA 5JCMA 3K7MX 2MNRA 4J1OA 2X8CA 1PJ6A 1PXCA 3COXA 3TWBA 4CCQA 2OQHA 3AD8B 1O94A 4ADWA 4AT2A 3TW9A 1TE6A 2WPCA 1O95A 3R11A 2P88A 2IVEA 3FYYA 3UJEA 3C96A 2GV8A 3ITJA 3DJGX 3ZLFA 1K0IA 1OEPA 1K0JA 3GC2A 2XH4A 1ZDLA 1FL2A 1SEZA 2JK6A 2YLZA 3NRNA 2GR1A 3KU9A 4H4WA 4OPCA 1IUTA 4OPTA 1JPMA 4GF7A 4Z44A 2C3CA 1B37A 3R0UA 1PBCA 4H4YA 3DA1A 5IQ1A 4KX6A 2DKHA 2YG5A 2B9YA 2MUCA 1OJAA 3ICSA 3A7RA 5FJPA 4DNAA 4APNA 2OLOA 2APGA 3NKSA 1BKHA 4K5RA 3P4RA 1NHPA 1PBBA 3V3OA 1EC9A 2BYBA 1BGNA 2C67A 2XVEA 1EBHA 3P4SA 5HYMA 2BCGG 3SZWA 2B7SA 3SN0A 1MRAA 3SX6A 4ZCWA 3ZVHB 3EPTA 1CC4A 3H7VA 5TR3A 2WDRA 5FJTA 2V6OA 5IPYA 3VR8A 3KUMA 4BK1A 1KF6A 1D4EA 2C70A 2YLRA 4KEMA 1V59A 2W3SA 1L9DA 1XDIA 4WCTA 4A7AA 3IJLA 4H7UA 3L5OA 2PU1A 3R25A 5DBJA 3PWIA 2XH0A 3HZLA 3AEFA 3VC5A 3UOZA 1DJNA 3A7UA 1NDAA 3RGTA 4H4PA 2R4JA 4NZHA 2Q0LA 1PJ5A 4EQWA 2AR8A 4KPRA 3T0KA 3R9UA 3PFRA 3LXDA 3UCLA 1PS9A 3NN0X 2V61A 1DOBA 3LOVA 1JNZA 3CMMA 3RITA 5L46A 1F3PA 3VDGA 4NTDA 1K0LA 3L1RA 3ATQA 3QPEA 3SZ0A 2CFYA 2V5ZA 1LV0A 2PP0A 4USQA 3EUB3 4OPLA 2RABA 1EL5A 3T6CA 4C74A 3GWDA 2XYOA 1TRBA 2RGOA 3Q4DA 2BABA 4J36A 2AL2B 1PDHA 3K7TA 2BS2A 1T3QC 1BF3A 2WQYA 2O56A 3EANA 3CGEA 4FI4A 1N62C 2VOUA 2POZA 2C76A 4YWOA 3OW1A 1MUCA 3U9IA 2P8BA 3UJ2A 1GRBA 1JRPA 3UKQA 2BRYA 5LV9A 2PA6A 3AE3A 4HPNA 3QFAA 4YKFA 3QSSA 3JZUA 3UJSA 2ARDA 3ALMA 3BSMA 2BC1A 1EL7A 2X50A 4HYRA 4OCGA 3AEDA 3GYXA 4TVWA 3ZVIA 3UKKA 4H19A 4JN7A 3UCDA 4J2WA 1XPQA 4B1BA 4JY2A 5EU9A 3EKGA 1X2HA 4Z25A 3HYWA 4DHGA 3P3BA 4B68A 1JEHA 3NVWB 5KWFA 3AD9B 3DERA 2QVHA 1L8PA 1SJAA 3DMEA 4A3RA 4NTEA 1IUSA 5U25A 1IUWA 3Q6JA 3O0HA 2YG3A 3CIRA 4MJWA 3UKFA 3NK1X 4D04A 3E1TA 4YSYA 4EMIA 4XWZA 1R6WA 3T2KA 2YM1A 2DKIA 1BKWA 3TJIA 3ZLGA 3IHGA 1GXFA 2ZZBA 3P0WA 1GRGA 1NEKA 1PJ7A 3KKJA 4YSZA 2BXRA 4J34A 5HXIA 1O5WA 4ZCDA 2A89A 4X9MA 5EB5A 3BOXA 5CKUA 3FG2P 4DSHA 2W0HA 1VRQB 3AE9A 4U8PA 2XLRA 2B7RA 3VRDB 3AD7B 1ZOYA 1W4XA 3ATRA 4GDPA 3SJNA 4FK1A 3DG7A 3V5FA 2V3AA 3AYLA 2OFJA 3ZVHA 2FJEA 4HNLA 2H88A 1HYUA 3DK8A 1E1KA 1X2GA 2YLSA 1ZK7A 2IIDA 4YT0A 3H8AA 4NEWA 3P4QA 3FXGA 3JVAA 1DOCA 2P3ZA 1D7YA 3P1WA 4OPGA 2XH7A 3QKEA 1SB3B 1RVKA 2YR4A 3UKAA 2WOIA 1VDVA 1XPYA 4N9XA 5KXJA 3B97A 2HQMA 3SN1A 2EQ8A 3R07C 5JCNA 3T2ZA 3STPA 3AE1A 2YWLA 2XFQA 3SGLA 2HXUA 1H84A 3NRZB 2XLSA 4IZGA 4YWSA 3TQPA 2AKZA 1MO9A 4JHMA 3RO6A 4Z43A 3UP5A 2GQFA 3ADAB 5GSNA 2GQWA 3GWFA 1L0VA 1S2QA 4DWDA 3UKLA 3GY1A 2XFOA 3NFUA 1WYGA 4E4FA 1H2IA 4AT0A 2PS2A 3IHMA 3K1GA 3MY9A 1DJQA 1WUEA 4GRTA 1BWCA 4PAAA 4HA6A 1S2YA 1SJDA 3MUCA 3AM9A 1FHVA 3OP2A 2JB2A 4BV6A 2QAEA 2ZZCA 1F8SA 4NTCA 4IT1A 1YEYA 3LZXA 1Y0PA 3RHAA 2XH2A 4IL2A 4G6GA 3DK9A 1GNDA 4EM4A 2PTXA 2QJMA 3M13A 1EL8A 3NTDA 2JBVA 3QVRA 4I59A 2AL2A 3BHKA 4TLXA 3ICTA 1IJHA 1NHRA 1TYTA 1E7PA 4CY6A 4HCHA 2CHRA 3T8QA 4CNKA 4B64A 2GRTA 4A99A 3URHA 4BK2A 1KSSA 4M6UA 3H12A 2Y6QA 1MDLA 4H4VA 3CGCA 2XVFA 3RCYA 2YR6A 3LADA 4J57A 4HB9A 5KMSA 2OZ3A 3KD9A 1CHUA 2XFUA 2WOWA 2Z5YA 4Y4LA 4U8OA 2OPJA 4EMWA 4IA5A 3HW2A 3ISHA 4U8LA 1VG0A 3MQTA 1NAAA 4O5QA 5C2TA 3UP4A 1ZP0A 3NN6X 5FJRA 1JDFA 3IK4A 2WDVA 5HHFA 3FBSA 1D4DA 4G7FA 4Z2TA 1CBOA 2W3RA 1H7WA 2E5AA 3BI2A 4X2PA 1STZA 2GSHA 3FV9A 3MWCA 2XVJA 2GVCA 2BACA 1K4QA 4NEVA 2VVMA 1VDCA 3NYCA 2RDXA 2EQ9A 3R0KA 1NHSA 4E5TA 2CVJA 1FIQB 3AYJA 3UOYA 3SZFA 1YKJA 4ECHA 2PPGA 2AKMA 2TPRA 3FPZA 1TZZA 1PHHA 2W54A 3T2YA 5FS7A 3NH3X 3RP7A 1KNPA 1RSGA 4LA1A 3RR1A 2YG7A 1B5QA 2GF3A 2Q6UA 4MMWA 2YVJA 2VRMA 1DODA 2DW7A 2PGWA 1XHCA 2WDQA 4H4RA 1ZKQA 3UJRA 1QJDA 2AAQA 1N1PA 5JCIA 3ES8A 1TYPA 3CYJA 1REOA 3LZWA 3UKHA 2WESA 3NVZB 1Y56A 1IUVA 3NYFA 3HPFA 2R0PA 3IF9A 4C3XA 1FFVC 3ICRA 2QDDA 2XSXA 5KRQA 4NNJA 4U8MA 3S5SA 4RSLA 3VQRA 2VQBA 1CC2A 4GISA 4FP1A 3B9JB 3DJDA 4ROPA 1D5TA 2PGEA 1EBGA 3QJ4A 2E4GA 1ONFA 4J56A 1M64A 1PXBA 1JCTA 3KPKA 3G5QA 2R46A 3DDMA 3OZ2A 3H70A 3EEZA 2QQ6A 3DGZA 4A35A 1D7LA 4KT2A 2OLAA 3SY4A 2BK3A 4YTNA 4EMJA 2ZADA 1NU5A 4K7ZA 2PP1A 4G6HA 1Q1WA 4KPLA 3T31A 3CXOA 2JB1A 4A6GA 2R4EA 3H4KA 2XLPA 5M10A 3FVDA 4K8GA 3C4AA 1LVLA 5FJUA 2R0GA 1NELA 4IVMB 5M0ZA 4K22A 3SFDA 2BS4A 3DJJA 4TM0A 5KVIA 2GH5A 3I6EA 2GR3A 1B4VA 1IUUA 2XGZA 2QA2A 2GAHB 2VZ2A 2WETA 2OX4A 3OPSA 1N5WC 4B67A 1ZMDA 2QJNA 3RRAA 1ONEA 2GDQA 3DEQA 1ZMCA 4K2SA 5C3JA 1S3BA 4GCMA 3GD6A 1KKOA 2FJBA 4XXGA 1PN0A 4BURA 3S61A 2GB0A 2X99A 1RP0A 3N4FA 3OTRA 3AE8A 5G5HB 3D8XA 1CL0A 3D47A 2OZ8A 5IDZA 1H83A 3UJFA 1H82A 3CTYA 5BRTA 3UKPA 5J04A 1PDYA 3ENLA 2ZBWA 3FMWA 3VR9A 3MKCA 3M0OA 1GREA 1JRZA 1JU2A 2ACZA 2E3TA 1SJCA 2WPEA 2V60A 2PODA 2C64A 2WHDA 1ZOVA 5ER0A 1EC8A 2WBAA 3ETRB 3RNMA 3EAOA 3T9PA 1B8SA 4GMEA 1X31B 4EIPA 1M6IA 3F8PA 4ZN0A 4ICYA 5FS6A 3LB8A 6ENLA 5CQFA 3CNDA 1P2HA 3RP8A 3Q45A 1GRFA 4Z2RA 4H2HA 3NK0X 3NG7X 3DG3A 2PTZA 4U8JA 2YG6A 3GMBA 4M0XA 4CBQA 2HXTA 3REDA 1L9CA 4FK1C 1V97A 5BVAA 1E1LA 4H2QA 2OALA 4OPUA 2QJJA 1OJCA 4G73A 3GYJA 2NQLA 4IP5A 4A6NB 3CNSA 1GSNA 2OG9A 4H4XA 2X3NA 4IL0A 3CGDA 1RYIA 4GYPC 1FECA 4GFIA 1FEAA 3KLJA 3VFCA 3BI4A 3N6JA 4B69A 3AEBA 3QTPA 4TM3A 4DXKA 3PO7A 2V3BA 4Y4NA 1E6EA 3NK2X 5FJOA 3NXLA 3V4BA 3IJIA 4C3YA 2DW6A 2BRAA 2QCUA 2GR2A 4USRA 1IYXA 3MZNA 3DK4A 4H83A 1GRAA 2PTWA 3IWAA 3SXIA 2YVFA 1UKVG 2VVLG 3VRAA 3NT6A 4H4SA 4JNQA 3V5CA 4GYPA 1GOSA 3TOYA 1R0MA 2YLWA 3AN1A 3VCCA 1YQ3A 2YVGA 1S7MA 4IA6A 3D1CA 2BA9A 3DG6A 3UOVA 2I5QA 4Z26A 4Z17A 2OAMA 3ZDNA 1CJ4A 1LTXR 2OA1A 3NVYB 1WUFA 2IVDA 1EC7A 1GRTA 2PSNA 4EWJA 1GALA 4ZOHB 2XVHA 4Z1YA 3AB1A 4U8IA 4BJYA 4RG4A 5KMPA 1FFUC 4HNCA 3CNJA 3P4PA 1EL9A 2PCEA 2Q0KA 1F9CA 1TDKA 3NZGA 4EQRA 2C7GA 2XFPA 4BK3A 1NG4A 1E39A 3AYIA 1N60C 1IUXA 3CNPA 4DN1A 1CC6A 3Q9TA 3GYIA 3DFHA 4CRTA 2WOVA 3NS1B 1LPFA 4C77A 3PG6A 5JRBA 1KFYA 3CB3A 3P9UA 1TDEA 1TDFA 2JAEA 2PHHA 1QLBA 4PABA 5JCLA 3M12A 1LJ1A 1YQ4A 4B63A 2I0ZA 4U2TA 4YSHA 1JRXA 1N4VA 4AP3A 4NWZA 1ZY8A 4G9KA 3QN3A 1S3EA 3UGVA 3GDNA 2OVLA 4II3A 2BK4A 3AEEA 3AE2A 4UDRA 5KNLA 3PK7A 3AXBA 1KCZA 2A8XA 1JNRA 3GD3A 4K1WA 3I6TA 1PXAA 3G5SA 5BULA 3TTEA 3GMCA 1N4WA 4G8TA 1ZX9A 2Z5XA 4TM4A 2R9ZA 3DIPA 4X9NA 3V3NA 3C4NA 1N63C 2PMQA 2GGEA 4B66A 2XCGA 3BNUA 4UDPA 4I58A 3CXBA 1PBFA 3V3WA 2F5ZA 4C5OA 3RP6A 3CN8A 2R0CA 4J3ZA 3TJ4A 2C73A 3BJSA 4K5SA 4Z2UA 4A9WA 2VQ7A 3NNEA 3F8RA 1FEBA 1LQTA 2VVLA 2XLUA 3VRBA 2AQJA 4DX3A 1OJDA 1OJTA 1KSUA 1YQZA 3SM8A 5BUKA 1CJ2A 3K30A 4JY3A 1L9EA 3NIXA 3OZYA 1MXTA 1VQWA 2FJAA 3UOXA 2YQUA 2GGJA 3V76A 3QFBA 1KD0A 2GGHA 1GETA 7ENLA 4E8GA 4OVIA 4GAVA 2Y6RA 4JN8A 5EB4A 4A6NA 1E1NA 1CJ3A 4HCDA 3ABVA 2X8GA 1ELSA 2XFNA 1P48A 3CPIG 1KN0A 4GIRA 1VG9A 4A5LA 3GRSA 4AOXA 4REKA 3SSZA 2FYMA 4H4UA 3FCPA 2C66A 2PTYA 2E1MA 2GEWA 1GTHA 2QDEA 2FKPA 3CK5A 4MKSA 3SZCA 3I4KA 3DH9A 2OLNA 3AE6A 4D03A 1MNSA 4YSXA 4GR1A 3T14A 1BZLA 5KOWA 3NO1A 3H8LA 2C3DA 1F8RA 3NHOX 4JN9A 3GO2A 4ZA0A 1GERA 1N5XA 3KA7A 3GDPA 2XLTA 3ZYXA 3AMZA 4OPDA 4CNJA 4II2A 2GMJA 3GSIA 1LQUA 5FMHA 2FBWA 1W6TA 2VRLA 5KMQA 1P43A 2XVIA 4JDRA 2H89A 2B9XA 3SFEA 1GESA 4LU6A 1FHUA 4A65A 4HN8A 1H7XA 3SQSA 2X8HA 5U63A 3A7AA 2A87A 3OC4A 4J33A 2WU2A 5JCKA 4B65A 3N4EA 2PU0A 2WP5A 1ZXIC 3R10A 4EM3A 3UTGA 4YKGA 1OJ9A 3JW7A 4H4TA 3IC9A 3AEAA 5FS9A 2GGIA 3CNTA 2ZZ0A 3D9XA 4FX9A 1GPEA 1AOGA 3VCNA 1F8WA 3T4WA 3PWGA 4IP4A 4HCLA 4FDCB 4WX1A 4LIIA 2QGYA 4K8DA 5EOWA 2BC0A 5U1OA 4Y4MA 2FJDA 3BHFA 3DGBA 3KPFA 2GL5A 3PS9A 2WEUA 4TM1A 2J3NA 3EF6A 2CULA 4YTPA 1GV4A 2UZZA 4DYEA 3DESA 3T37A 3CT2A 1PBDA 2OKTA 2EQ7A 1XANA 2JB3A 2BXSA 3HYVA 2BCPA 3UTHA 4UDQA 4EQXA 3ZLHA 2WU5A 3AE4A 4X4JA 1MDRA 1N4UA 2GAGB 3UXKA 3NVVB 1Q1RA 1PBEA 4O5UA 3N6HA 1KKRA 1ECQA 2WP6A 3SN4A 2W55A 4M52A 1TDNA 4BJZA 3LJPA 3ES7A 4GGHA 3GD4A 2BK5A 2XDOA 3CPHG 4KWSA 3NLCA 4YTMA 3DJEA 1BGJA 1Q9IA 3OZMA 2E5VA 1EBDA 3MSYA 1CJCA 4ENLA 4RG3A 1NENA 4IV9A 4GDEA 2WP9A 4P9SA 2QA1A 4JNAA 2C72A 1VQZA 3D46A 3QLDA 3CAWA 4GGBA 2PP3A 1QO8A 2YAUA 1GRHA 3P93A 5G5GB 1DTNA 3NGCX
chains in the Genus database with same CATH topology
4E0VA 3PG6A 3L1RA 2NVKX 5JRBA 3ATQA 3JSKA 4GUVA 1KFYA 3H8IA 3AYJA 3P9UA 1TDEA 1YKJA 3SZ0A 3SZFA 3UOYA 1JRYA 1TDFA 2JAEA 2YR5A 4ECHA 3QVPA 2TPRA 2CFYA 2V5ZA 3FPZA 3K7QX 2PHHA 1FOHA 1LV0A 4USQA 3SYIA 1QLBA 5EBKA 4PABA 4OPLA 5JCLA 1PHHA 2RABA 3M12A 1EL5A 1LJ1A 4C74A 1YQ4A 4B63A 2I0ZA 2O9ZA 4U2TA 1COYA 1JRXA 1N4VA 3GWDA 2XYOA 4NWZA 4AP3A 4YSHA 1ZY8A 4G9KA 1YY5A 3T2YA 5FS7A 1TRBA 2RGOA 4Z24A 3NH3X 1S3EA 3RP7A 1KNPA 3HYXA 1RSGA 4LA1A 2GMHA 2BABA 3GDNA 2YG7A 2YLXA 1B5QA 4H4QA 4J36A 1NG3A 4II3A 2BK4A 2GF3A 2Q6UA 3AEEA 3AE2A 4UDRA 4CCRA 5KNLA 1PDHA 3K7TA 2YVJA 2BS2A 3AXBA 1GT8A 3CPJG 1BF3A 2VRMA 1DODA 2A8XA 1JNRA 2WQYA 4H2NA 3GD3A 1PXAA 3EANA 1XHCA 3G5SA 1NHQA 3CGEA 2WDQA 5BULA 4U8KA 4H4RA 2BS3A 2VOUA 1ZKQA 2C76A 4YWOA 3GMCA 1N4WA 3WE0A 1ZX9A 2Z5XA 4TM4A 4EIQA 2R9ZA 4H2RA 1QJDA 2AAQA 1N1PA 1GRBA 4G74A 5JCIA 2B76A 3UKQA 4DGKA 5J60A 4IVOB 2CDUA 1TYPA 2BRYA 3NTAA 2EQ6A 4CY8A 5LV9A 3II4A 1KNRA 3AE7A 1REOA 3LZWA 3UKHA 1CF3A 1Y56A 2WESA 3CGBA 1IUVA 3AE5A 1MOKA 3AE3A 4K2XA 4X9NA 3V3NA 5FS8A 3NYFA 4XWRA 3C4NA 3QFAA 4H50A 1DOEA 4B66A 2R0PA 1H6VA 3IF9A 2XCGA 4YKFA 3QSSA 1ELIA 3BI5A 4C3XA 3BNUA 3QSEA 3SQPA 2ARDA 3ALMA 3ICRA 5KRQA 4UDPA 1F6MA 1Y56B 4NNJA 2BC1A 3DGHA 1H86A 4U8MA 1EL7A 2X50A 4I58A 4OCGA 4RSLA 3VQRA 3AEDA 3GYXA 2VQBA 1CC2A 1PBFA 3UKKA 4U2SA 2C4CA 2F5ZA 4C5OA 3DJDA 4J2WA 3L8KA 3RP6A 2R0CA 3CN8A 1XPQA 2NPXA 1D5TA 2C73A 4B1BA 2TMDA 4JY2A 4K5SA 4Z2UA 4A9WA 1E1MA 3QJ4A 2VQ7A 3ALJA 3HYWA 4H2PA 4Z25A 2E4GA 1ONFA 3F8RA 1FEBA 4J56A 1M64A 1LQTA 3NNEA 3B6DA 5KMRA 1PXBA 4B68A 2VVLA 3G5QA 3KPKA 1JEHA 2XLUA 3VRBA 2AQJA 2R46A 3OZ2A 1OJDA 1NPXA 3AD9B 5KWFA 3DGZA 2WPFA 1OJTA 1KSUA 5KOXA 1D7LA 4OPIA 1YQZA 3SM8A 3SY4A 2BK3A 4YTNA 4EMJA 4GAPA 2PYXA 5BUKA 5KVHA 4K7ZA 3DMEA 1H81A 1CJ2A 1Z6LA 4NTEA 3K30A 4JY3A 1IUSA 4G6HA 1Q1WA 1DXLA 5U25A 1IUWA 3UTFA 3Q6JA 3O0HA 1L9EA 3T31A 2YG3A 3CIRA 4MJWA 2YG4A 2JB1A 3UKFA 2R4EA 3H4KA 2R45A 2XLPA 3NIXA 5M10A 3GRTA 3NK1X 4D04A 3E1TA 4YSYA 1MXTA 4EMIA 4XWZA 3C4AA 3PVCA 1VQWA 2B9WA 3T2KA 1LVLA 2FJAA 2GR0A 2YQUA 3UOXA 2R0GA 2YM1A 4UP3A 4IVMB 2WS3A 5M0ZA 2DKIA 1BKWA 4K22A 3V76A 3QFBA 4AOSA 3SFDA 1GTEA 1GETA 1GXFA 2ZZBA 5GRTA 3IHGA 2BS4A 1GRGA 3DJJA 2RGJA 3QSMA 5IQ4A 4TM0A 5KVIA 2GH5A 4U2LA 2GR3A 1B4VA 1DNCA 1IUUA 1NEKA 2Y6RA 1PJ7A 3G5RA 4GAVA 4OVIA 4U8NA 3KKJA 5EB4A 4YSZA 4A6NA 1E1NA 1CJ3A 2QA2A 3ABVA 2BXRA 2GAHB 4J34A 2VZ2A 5HXIA 1O5WA 2Q7VA 2A89A 4X9MA 5EB5A 4ZCDA 3BNMA 2X8GA 3S5WA 2WETA 3F8DA 4DSGA 5CKUA 3FG2P 2XFNA 4DSHA 4EQSA 3AECA 2C75A 4B67A 3CPIG 1KN0A 2W0HA 3I3LA 1FCDA 1VG9A 2C65A 1VRQB 4A5LA 3GRSA 1ZMDA 3AE9A 4U8PA 2XLRA 2B7RA 3AWIA 3VRDB 4AOXA 4REKA 4A79A 3AD7B 1ZOYA 3KVEA 1W4XA 2RGHA 4H4UA 2C66A 2E1MA 4AP1A 1ZMCA 2GEWA 3ATRA 4GDPA 1GTHA 5C3JA 1S3BA 4GCMA 4FK1A 2JKCA 3SZCA 2FJBA 3UTEA 2YLTA 3DH9A 1PN0A 2YM2A 4XXGA 2V3AA 2OLNA 3AE6A 4BURA 3S61A 3AYLA 4D03A 2GB0A 2X99A 1RP0A 4YSXA 4JQ9A 4GR1A 5J7XA 3T14A 4J31A 1BZLA 5KOWA 3AE8A 3H8LA 2FJEA 2C3DA 3FIMB 2H88A 1F8RA 1HYUA 3D8XA 4ZCCA 3DK8A 1CL0A 1E1KA 2YLSA 3NHOX 1ZK7A 4JN9A 4TLZA 1GEUA 2IIDA 4YT0A 4NEWA 1GERA 3B3RA 1H83A 3P4QA 1D4CA 3KA7A 3GDPA 1H82A 3CTYA 1DOCA 5BRTA 2XLTA 1D7YA 3P1WA 4OPGA 3UKPA 3ZYXA 4OPDA 3ALLA 4CNJA 4II2A 2GMJA 4H4ZA 2YR4A 2WOIA 3UKAA 2ZBWA 3FMWA 3GSIA 3VR9A 1LQUA 1TDOA 5FMHA 2FBWA 3M0OA 5HY5A 4N9XA 1P2EA 5KXJA 1GREA 2HQMA 2VRLA 4YXDA 2EQ8A 1JOAA 3AEGA 1JRZA 1JU2A 1KDGA 3I6DA 3NYEA 5KMQA 5JCMA 5JCNA 2ACZA 3K7MX 3T2ZA 3AE1A 2YWLA 2X8CA 2XFQA 4JDRA 1PJ6A 2XVIA 3SGLA 1PXCA 2H89A 2WPEA 3COXA 1H84A 2V60A 2XLSA 4CCQA 3AD8B 2C64A 2B9XA 3SFEA 2WHDA 1ZOVA 5ER0A 2WBAA 1O94A 1MO9A 1GESA 4ADWA 4LU6A 4AT2A 3RNMA 4A65A 1H7XA 2X8HA 5U63A 3EAOA 2A87A 3OC4A 2WPCA 1B8SA 4Z43A 1X31B 4EIPA 1M6IA 1O95A 4J33A 3F8PA 3UP5A 2WU2A 2GQFA 2IVEA 4ZN0A 3ADAB 5GSNA 2GQWA 5JCKA 4B65A 4ICYA 5FS6A 3GWFA 1L0VA 3C96A 3LB8A 5CQFA 3CNDA 1S2QA 3UKLA 1P2HA 3RP8A 2GV8A 2WP5A 1GRFA 2XFOA 3ITJA 3DJGX 1K0IA 4Z2RA 3NK0X 1H2IA 4AT0A 3NG7X 4EM3A 3UTGA 1K0JA 4YKGA 1OJ9A 3IHMA 1DJQA 1ZDLA 4U8JA 2YG6A 4H4TA 3GMBA 4CBQA 4GRTA 1FL2A 1BWCA 1SEZA 4PAAA 4HA6A 3IC9A 1L9CA 1S2YA 3REDA 4FK1C 3AEAA 5FS9A 3CNTA 2JK6A 2YLZA 5BVAA 1E1LA 3NRNA 2ZZ0A 3D9XA 2GR1A 3KU9A 4H2QA 4H4WA 4OPCA 2OALA 1IUTA 2JB2A 4BV6A 2QAEA 4OPUA 1OJCA 4FX9A 1GPEA 2ZZCA 4G73A 1AOGA 3GYJA 1F8SA 4NTCA 4OPTA 4GF7A 1F8WA 3LZXA 4Z44A 2C3CA 1B37A 1PBCA 4H4YA 4FDCB 3DA1A 4WX1A 4LIIA 5IQ1A 4A6NB 4KX6A 4K8DA 5EOWA 1Y0PA 3RHAA 2DKHA 2BC0A 3CNSA 1GSNA 4G6GA 5U1OA 4Y4MA 2YG5A 2FJDA 3BHFA 4H4XA 2B9YA 3DK9A 1GNDA 4EM4A 3CGDA 1OJAA 1RYIA 2X3NA 3KPFA 3PS9A 3ICSA 1FECA 3M13A 1FEAA 2WEUA 3KLJA 1EL8A 4TM1A 3NTDA 3BI4A 4DNAA 2JBVA 3QVRA 4I59A 4B69A 3BHKA 2J3NA 3AEBA 3EF6A 4APNA 3ICTA 4TLXA 2CULA 2OLOA 1IJHA 4YTPA 1NHRA 4TM3A 1GV4A 2UZZA 3PO7A 2V3BA 3T37A 4Y4NA 1E6EA 2APGA 3NK2X 3NKSA 1TYTA 1PBDA 4K5RA 3P4RA 1E7PA 2EQ7A 1XANA 2JB3A 1NHPA 4CY6A 4C3YA 1PBBA 2BRAA 2BXSA 2QCUA 3HYVA 2GR2A 2BCPA 4USRA 3UTHA 3DK4A 4UDQA 3V3OA 1GRAA 4CNKA 4EQXA 2BYBA 1BGNA 3IWAA 2C67A 4B64A 2WU5A 2XVEA 2GRTA 3AE4A 3URHA 4A99A 4X4JA 3SXIA 2YVFA 3P4SA 4BK2A 1KSSA 1UKVG 2BCGG 2VVLG 5HYMA 3SZWA 3VRAA 3NT6A 2Y6QA 4H4SA 4JNQA 2B7SA 1N4UA 2GAGB 3SX6A 4H4VA 3EPTA 1GOSA 3CGCA 1CC4A 1Q1RA 5TR3A 2WDRA 2XVFA 2YLWA 2YR6A 2V6OA 5IPYA 1PBEA 1YQ3A 3VR8A 2YVGA 1S7MA 3LADA 4J57A 4HB9A 4O5UA 4BK1A 4IA6A 5KMSA 3KD9A 1KF6A 1CHUA 2BA9A 3D1CA 1D4EA 2XFUA 2WOWA 2Z5YA 2WP6A 3UOVA 4Y4LA 2C70A 4U8OA 2YLRA 4M52A 4EMWA 4Z26A 1TDNA 4BJZA 3LJPA 2OAMA 1V59A 3ZDNA 4IA5A 1CJ4A 1L9DA 3ISHA 1XDIA 4U8LA 1VG0A 4WCTA 1LTXR 1NAAA 3GD4A 4O5QA 2OA1A 2BK5A 4A7AA 5C2TA 3UP4A 1ZP0A 3NN6X 2XDOA 2IVDA 1GRTA 3CPHG 4H7UA 1GALA 3NLCA 4YTMA 2WDVA 3DJEA 5HHFA 3FBSA 1D4DA 3L5OA 5DBJA 1BGJA 2XVHA 4Z2TA 3AB1A 1CBOA 4U8IA 1Q9IA 4BJYA 4RG4A 3HZLA 2E5VA 5KMPA 3CNJA 1H7WA 3AEFA 3UOZA 1DJNA 3P4PA 1EL9A 1NDAA 4H4PA 2R4JA 3BI2A 2Q0LA 4NZHA 1EBDA 1CJCA 1PJ5A 2Q0KA 4EQWA 2AR8A 1NENA 4RG3A 4IV9A 4KPRA 3T0KA 4GDEA 3R9UA 1TDKA 2WP9A 3LXDA 3UCLA 1PS9A 3NN0X 2QA1A 4P9SA 2V61A 4JNAA 1DOBA 2C72A 3LOVA 4EQRA 2C7GA 2XFPA 4BK3A 1NG4A 1JNZA 1E39A 3CMMA 2XVJA 2GVCA 3AYIA 2BACA 1K4QA 1IUXA 4NEVA 3CNPA 1QO8A 1VDCA 2VVMA 2YAUA 3NYCA 1CC6A 2EQ9A 1GRHA 3Q9TA 3GYIA 5L46A 3NGCX 1F3PA 4CRTA 4NTDA 1K0LA 1NHSA 2WOVA 1LPFA 2CVJA 4C77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E0V A;  3L1R A;  2NVK X;  3ATQ A;  3JSK A;  4GUV A;  1KFY A;  3H8I A;  3AYJ A;  3P9U A;  1TDE A;  1YKJ A;  3UOY A;  4ECH A;  1JRY A;  1TDF A;  2JAE A;  2YR5 A;  3QVP A;  2TPR A;  2CFY A;  2V5Z A;  3FPZ A;  3K7Q X;  2PHH A;  1FOH A;  1LV0 A;  4USQ A;  1QLB A;  5EBK A;  4PAB A;  4OPL A;  5JCL A;  1PHH A;  2RAB A;  3M12 A;  1EL5 A;  1LJ1 A;  4C74 A;  1YQ4 A;  4B63 A;  2I0Z A;  2O9Z A;  4U2T A;  1COY A;  1JRX A;  1N4V A;  3GWD A;  2XYO A;  4AP3 A;  4YSH A;  1ZY8 A;  1YY5 A;  5FS7 A;  1TRB A;  2RGO A;  4Z24 A;  3NH3 X;  1S3E A;  3RP7 A;  1KNP A;  1RSG A;  4LA1 A;  2GMH A;  2BAB A;  3GDN A;  2YG7 A;  2YLX A;  1B5Q A;  4H4Q A;  4J36 A;  1NG3 A;  2BK4 A;  2GF3 A;  2Q6U A;  3AEE A;  3AE2 A;  4UDR A;  4CCR A;  1PDH A;  3K7T A;  2YVJ A;  2BS2 A;  3AXB A;  1GT8 A;  3CPJ G;  1BF3 A;  2VRM A;  1DOD A;  2A8X A;  1JNR A;  2WQY A;  4H2N A;  3GD3 A;  1PXA A;  3EAN A;  1XHC A;  3G5S A;  1NHQ A;  3CGE A;  2WDQ A;  5BUL A;  4U8K A;  4H4R A;  2BS3 A;  2VOU A;  1ZKQ A;  2C76 A;  4YWO A;  3GMC A;  1N4W A;  3WE0 A;  1ZX9 A;  2Z5X A;  4TM4 A;  4EIQ A;  2R9Z A;  4H2R A;  1QJD A;  2AAQ A;  1N1P A;  1GRB A;  5JCI A;  2B76 A;  3UKQ A;  4DGK A;  5J60 A;  4IVO B;  2CDU A;  1TYP A;  3NTA A;  4CY8 A;  2EQ6 A;  5LV9 A;  3II4 A;  1KNR A;  3AE7 A;  1REO A;  3LZW A;  3UKH A;  1CF3 A;  1Y56 A;  2WES A;  3CGB A;  1IUV A;  3AE5 A;  1MOK A;  3AE3 A;  4K2X A;  4X9N A;  3V3N A;  5FS8 A;  3NYF A;  4XWR A;  3C4N A;  3QFA A;  4H50 A;  1DOE A;  4B66 A;  2R0P A;  1H6V A;  3IF9 A;  2XCG A;  4YKF A;  3QSS A;  1ELI A;  3BI5 A;  4C3X A;  3BNU A;  3QSE A;  3SQP A;  2ARD A;  3ALM A;  3ICR A;  5KRQ A;  4UDP A;  1F6M A;  1Y56 B;  2BC1 A;  3DGH A;  1H86 A;  4U8M A;  1EL7 A;  2X50 A;  4I58 A;  4OCG A;  4RSL A;  3VQR A;  3AED A;  2VQB A;  1CC2 A;  1PBF A;  3UKK A;  4U2S A;  2F5Z A;  4C5O A;  3DJD A;  4J2W A;  3L8K A;  3RP6 A;  2R0C A;  3CN8 A;  1XPQ A;  2NPX A;  1D5T A;  2C73 A;  4B1B A;  2TMD A;  4JY2 A;  4K5S A;  4Z2U A;  4A9W A;  1E1M A;  3QJ4 A;  2VQ7 A;  3ALJ A;  4Z25 A;  4H2P A;  2E4G A;  1ONF A;  3F8R A;  1FEB A;  4J56 A;  1M64 A;  1LQT A;  3NNE A;  3B6D A;  1PXB A;  4B68 A;  2VVL A;  3G5Q A;  1JEH A;  2XLU A;  3VRB A;  2AQJ A;  2R46 A;  3OZ2 A;  1OJD A;  1NPX A;  3AD9 B;  5KWF A;  3DGZ A;  2WPF A;  1OJT A;  1KSU A;  5KOX A;  1D7L A;  4OPI A;  1YQZ A;  3SM8 A;  2BK3 A;  4YTN A;  4EMJ A;  5BUK A;  2PYX A;  5KVH A;  4K7Z A;  3DME A;  1H81 A;  1CJ2 A;  1Z6L A;  4NTE A;  3K30 A;  4JY3 A;  1IUS A;  1Q1W A;  1DXL A;  5U25 A;  1IUW A;  3UTF A;  3Q6J A;  3O0H A;  1L9E A;  2YG3 A;  3CIR A;  4MJW A;  2YG4 A;  2JB1 A;  3UKF A;  2R4E A;  3H4K A;  2R45 A;  2XLP A;  3NIX A;  5M10 A;  3GRT A;  3NK1 X;  4D04 A;  3E1T A;  4YSY A;  1MXT A;  4EMI A;  4XWZ A;  3C4A A;  3PVC A;  1VQW A;  2B9W A;  1LVL A;  2FJA A;  2GR0 A;  2YQU A;  3UOX A;  2R0G A;  2YM1 A;  4UP3 A;  4IVM B;  2WS3 A;  5M0Z A;  2DKI A;  1BKW A;  4K22 A;  3V76 A;  3QFB A;  4AOS A;  3SFD A;  1GTE A;  1GET A;  1GXF A;  2ZZB A;  5GRT A;  3IHG A;  2BS4 A;  1GRG A;  3DJJ A;  2RGJ A;  3QSM A;  5IQ4 A;  4TM0 A;  5KVI A;  2GH5 A;  4U2L A;  2GR3 A;  1B4V A;  1DNC A;  1IUU A;  1NEK A;  2Y6R A;  1PJ7 A;  3G5R A;  4OVI A;  4U8N A;  5EB4 A;  3KKJ A;  4YSZ A;  4A6N A;  1E1N A;  1CJ3 A;  2QA2 A;  3ABV A;  2BXR A;  2GAH B;  4J34 A;  2VZ2 A;  5HXI A;  1O5W A;  2Q7V A;  2A89 A;  4X9M A;  5EB5 A;  4ZCD A;  3BNM A;  2X8G A;  3S5W A;  2WET A;  3F8D A;  4DSG A;  5CKU A;  3FG2 P;  2XFN A;  4DSH A;  4EQS A;  3AEC A;  2C75 A;  4B67 A;  3CPI G;  2W0H A;  3I3L A;  1FCD A;  1VG9 A;  2C65 A;  1VRQ B;  4A5L A;  3GRS A;  1ZMD A;  3AE9 A;  4U8P A;  2XLR A;  2B7R A;  3AWI A;  3VRD B;  4AOX A;  4REK A;  4A79 A;  3AD7 B;  1ZOY A;  3KVE A;  1W4X A;  2RGH A;  4H4U A;  2C66 A;  2E1M A;  4AP1 A;  1ZMC A;  2GEW A;  3ATR A;  4GDP A;  1GTH A;  5C3J A;  1S3B A;  4GCM A;  4FK1 A;  2JKC A;  2FJB A;  3UTE A;  2YLT A;  3DH9 A;  1PN0 A;  2YM2 A;  4XXG A;  2V3A A;  2OLN A;  3AE6 A;  4BUR A;  3S61 A;  3AYL A;  4D03 A;  2GB0 A;  2X99 A;  1RP0 A;  4YSX A;  4JQ9 A;  4GR1 A;  5J7X A;  4J31 A;  1BZL A;  5KOW A;  3AE8 A;  3H8L A;  2FJE A;  2C3D A;  3FIM B;  2H88 A;  1F8R A;  1HYU A;  3D8X A;  4ZCC A;  3DK8 A;  1CL0 A;  1E1K A;  2YLS A;  3NHO X;  1ZK7 A;  4JN9 A;  4TLZ A;  1GEU A;  2IID A;  4YT0 A;  4NEW A;  1GER A;  3B3R A;  1H83 A;  3P4Q A;  1D4C A;  3KA7 A;  3GDP A;  1H82 A;  3CTY A;  1DOC A;  5BRT A;  2XLT A;  1D7Y A;  3P1W A;  4OPG A;  3UKP A;  3ZYX A;  4OPD A;  3ALL A;  4CNJ A;  3UKA A;  2GMJ A;  4H4Z A;  2YR4 A;  2WOI A;  2ZBW A;  3FMW A;  3GSI A;  3VR9 A;  1LQU A;  1TDO A;  5FMH A;  2FBW A;  3M0O A;  5HY5 A;  4N9X A;  1P2E A;  5KXJ A;  1GRE A;  2HQM A;  2VRL A;  4YXD A;  2EQ8 A;  1JOA A;  3AEG A;  1JRZ A;  1JU2 A;  1KDG A;  3I6D A;  3NYE A;  5JCM A;  5JCN A;  2ACZ A;  3K7M X;  3AE1 A;  2YWL A;  2X8C A;  2XFQ A;  4JDR A;  1PJ6 A;  2XVI A;  3SGL A;  1PXC A;  2H89 A;  2WPE A;  3COX A;  1H84 A;  2V60 A;  2XLS A;  4CCQ A;  3AD8 B;  2C64 A;  2B9X A;  3SFE A;  2WHD A;  1ZOV A;  5ER0 A;  2WBA A;  1O94 A;  1MO9 A;  1GES A;  4ADW A;  4LU6 A;  4AT2 A;  3RNM A;  4A65 A;  1H7X A;  2X8H A;  5U63 A;  3EAO A;  2A87 A;  3OC4 A;  2WPC A;  1B8S A;  4Z43 A;  1X31 B;  4EIP A;  1M6I A;  1O95 A;  4J33 A;  3F8P A;  3UP5 A;  2WU2 A;  2GQF A;  2IVE A;  4ZN0 A;  3ADA B;  5GSN A;  2GQW A;  5JCK A;  4B65 A;  4ICY A;  5FS6 A;  3GWF A;  1L0V A;  3C96 A;  3LB8 A;  5CQF A;  3CND A;  1S2Q A;  3UKL A;  1P2H A;  3RP8 A;  2GV8 A;  2WP5 A;  1GRF A;  2XFO A;  3ITJ A;  3DJG X;  1K0I A;  4Z2R A;  3NK0 X;  4AT0 A;  3NG7 X;  4EM3 A;  3UTG A;  1K0J A;  4YKG A;  1OJ9 A;  3IHM A;  1DJQ A;  1ZDL A;  4U8J A;  2YG6 A;  4H4T A;  3GMB A;  4CBQ A;  4GRT A;  1FL2 A;  1BWC A;  1SEZ A;  4PAA A;  4HA6 A;  3IC9 A;  1L9C A;  1S2Y A;  3RED A;  4FK1 C;  3AEA A;  5FS9 A;  3CNT A;  2JK6 A;  2YLZ A;  5BVA A;  1E1L A;  3NRN A;  2ZZ0 A;  2GR1 A;  3KU9 A;  4H2Q A;  4H4W A;  4OPC A;  2OAL A;  1IUT A;  2JB2 A;  4BV6 A;  2QAE A;  4OPU A;  1OJC A;  4FX9 A;  1GPE A;  2ZZC A;  1AOG A;  3GYJ A;  1F8S A;  4NTC A;  4OPT A;  4GF7 A;  1F8W A;  3LZX A;  4Z44 A;  2C3C A;  1B37 A;  1PBC A;  4H4Y A;  4FDC B;  3DA1 A;  4WX1 A;  4LII A;  5IQ1 A;  4A6N B;  4KX6 A;  4K8D A;  5EOW A;  1Y0P A;  3RHA A;  2DKH A;  2BC0 A;  3CNS A;  1GSN A;  5U1O A;  4Y4M A;  2YG5 A;  2FJD A;  3BHF A;  4H4X A;  2B9Y A;  3DK9 A;  1GND A;  4EM4 A;  3CGD A;  1OJA A;  1RYI A;  2X3N A;  3KPF A;  3PS9 A;  3ICS A;  1FEC A;  3M13 A;  1FEA A;  2WEU A;  3KLJ A;  1EL8 A;  4TM1 A;  3NTD A;  3BI4 A;  4DNA A;  2JBV A;  3QVR A;  4I59 A;  4B69 A;  3BHK A;  2J3N A;  3AEB A;  3EF6 A;  4APN A;  3ICT A;  4TLX A;  2CUL A;  2OLO A;  1IJH A;  4YTP A;  1NHR A;  4TM3 A;  1GV4 A;  2UZZ A;  3PO7 A;  2V3B A;  3T37 A;  4Y4N A;  1E6E A;  2APG A;  3NK2 X;  3NKS A;  1TYT A;  1PBD A;  4K5R A;  3P4R A;  1E7P A;  2EQ7 A;  1XAN A;  2JB3 A;  1NHP A;  4CY6 A;  4C3Y A;  1PBB A;  2BXS A;  2QCU A;  2GR2 A;  2BCP A;  4USR A;  3UTH A;  3DK4 A;  4UDQ A;  3V3O A;  1GRA A;  4CNK A;  4EQX A;  2BYB A;  1BGN A;  3IWA A;  2C67 A;  4B64 A;  2WU5 A;  2XVE A;  2GRT A;  3AE4 A;  3URH A;  4A99 A;  4X4J A;  2YVF A;  3P4S A;  4BK2 A;  1KSS A;  1UKV G;  2BCG G;  2VVL G;  5HYM A;  3VRA A;  3NT6 A;  2Y6Q A;  4H4S A;  4JNQ A;  2B7S A;  1N4U A;  2GAG B;  4H4V A;  3EPT A;  1GOS A;  3CGC A;  1CC4 A;  1Q1R A;  5TR3 A;  2WDR A;  2XVF A;  2YLW A;  2YR6 A;  2V6O A;  5IPY A;  1PBE A;  1YQ3 A;  3VR8 A;  2YVG A;  3LAD A;  4J57 A;  4HB9 A;  4O5U A;  4BK1 A;  4IA6 A;  3KD9 A;  1KF6 A;  1CHU A;  2BA9 A;  3D1C A;  1D4E A;  2XFU A;  2WOW A;  2Z5Y A;  2WP6 A;  3UOV A;  4Y4L A;  2C70 A;  4U8O A;  2YLR A;  4M52 A;  4EMW A;  4Z26 A;  1TDN A;  4BJZ A;  3LJP A;  2OAM A;  1V59 A;  3ZDN A;  4IA5 A;  1CJ4 A;  1L9D A;  3ISH A;  1XDI A;  4U8L A;  1VG0 A;  4WCT A;  1LTX R;  1NAA A;  3GD4 A;  4O5Q A;  2OA1 A;  2BK5 A;  4A7A A;  5C2T A;  3UP4 A;  1ZP0 A;  3NN6 X;  2XDO A;  2IVD A;  1GRT A;  3CPH G;  4H7U A;  1GAL A;  3NLC A;  4YTM A;  2WDV A;  3DJE A;  5HHF A;  3FBS A;  1D4D A;  5DBJ A;  1BGJ A;  2XVH A;  4Z2T A;  3AB1 A;  1CBO A;  4U8I A;  1Q9I A;  4BJY A;  4RG4 A;  3HZL A;  2E5V A;  3CNJ A;  1H7W A;  3AEF A;  3UOZ A;  1DJN A;  3P4P A;  1EL9 A;  1NDA A;  4H4P A;  2R4J A;  3BI2 A;  2Q0L A;  4NZH A;  1EBD A;  1CJC A;  1PJ5 A;  2Q0K A;  4EQW A;  2AR8 A;  1NEN A;  4RG3 A;  4IV9 A;  4KPR A;  4GDE A;  3R9U A;  1TDK A;  2WP9 A;  3LXD A;  3UCL A;  1PS9 A;  3NN0 X;  2QA1 A;  4P9S A;  2V61 A;  4JNA A;  1DOB A;  2C72 A;  3LOV A;  4EQR A;  2C7G A;  2XFP A;  4BK3 A;  1NG4 A;  1JNZ A;  1E39 A;  2XVJ A;  2GVC A;  3AYI A;  2BAC A;  1K4Q A;  1IUX A;  4NEV A;  3CNP A;  1QO8 A;  1VDC A;  2VVM A;  2YAU A;  3NYC A;  1CC6 A;  2EQ9 A;  1GRH A;  3Q9T A;  3GYI A;  5L46 A;  3NGC X;  1F3P A;  4CRT A;  4NTD A;  1K0L A;  1NHS A;  2WOV A;  1LPF A;  2CVJ A;  4C77 A; 
#chains in the Genus database with same CATH topology
 4E0V A;  2NVK X;  3JSK A;  4GUV A;  3H8I A;  1JRY A;  2YR5 A;  3QVP A;  2AL1 A;  3K7Q X;  1FOH A;  3SYI A;  5EBK A;  2O9Z A;  1COY A;  1YY5 A;  4E6M A;  1FO4 A;  4Z24 A;  3SBF A;  3HYX A;  2GMH A;  2YLX A;  3HRD C;  4H4Q A;  2OQY A;  1NG3 A;  4CCR A;  1GT8 A;  3CPJ G;  3VC6 A;  5BOE A;  3DFY A;  3UXL A;  4H2N A;  1XS2 A;  1NHQ A;  4U8K A;  2BS3 A;  3R1Z A;  3WE0 A;  4EIQ A;  1E9I A;  4H2R A;  4G74 A;  2B76 A;  3TCS A;  4DGK A;  5J60 A;  4IVO B;  2CDU A;  3NTA A;  4CY8 A;  1BQG A;  2EQ6 A;  3II4 A;  1KNR A;  3AE7 A;  1JPD X;  1CF3 A;  3AE5 A;  3CGB A;  4K2X A;  1MOK A;  2GGG A;  5FS8 A;  4XWR A;  4H50 A;  1DOE A;  1H6V A;  1ELI A;  3BI5 A;  3QSE A;  3SQP A;  1F6M A;  1Y56 B;  3DGH A;  1H86 A;  4U2S A;  2C4C A;  3L8K A;  3S47 A;  2NPX A;  2TMD A;  1E1M A;  3ALJ A;  4H2P A;  4IHC A;  5KMR A;  3B6D A;  1JRO A;  5ENL A;  1PDZ A;  4E4U A;  2ONE A;  1NPX A;  2HNE A;  3THU A;  2WPF A;  5KOX A;  1N61 C;  4OPI A;  3VA8 A;  4GAP A;  2PYX A;  5KVH A;  1H81 A;  1Z6L A;  2HZG A;  1DXL A;  3UTF A;  2YG4 A;  2R45 A;  3GRT A;  5BOF A;  3U4F A;  3PVC A;  2B9W A;  2GR0 A;  4UP3 A;  2WS3 A;  2P8C A;  4AOS A;  1GTE A;  5GRT A;  3SR6 B;  5IQ4 A;  2RGJ A;  3QSM A;  3TWA A;  4U2L A;  1DNC A;  3G5R A;  4U8N A;  1SJB A;  2Q7V A;  3BNM A;  3S5W A;  3F8D A;  4DSG A;  4EQS A;  3AEC A;  2C75 A;  3I3L A;  1FCD A;  2C65 A;  2P0I A;  3IJQ A;  3AWI A;  4MGG A;  4A79 A;  3KVE A;  2RGH A;  4AP1 A;  3UCC A;  2JKC A;  1TKK A;  3UTE A;  2YLT A;  2YM2 A;  2OO6 A;  1RM6 B;  4JQ9 A;  4J31 A;  3FIM B;  4ZCC A;  5J7X A;  4H1Z A;  4TLZ A;  1GEU A;  3B3R A;  1D4C A;  3FJ4 A;  2ZC8 A;  3ALL A;  4H4Z A;  4F4R A;  1TDO A;  5HY5 A;  1P2E A;  4YXD A;  4TVY A;  1JOA A;  3AEG A;  3I6D A;  2OZT A;  1KDG A;  3NYE A;  5JCM A;  3K7M X;  2MNR A;  4J1O A;  2X8C A;  1PJ6 A;  1PXC A;  3COX A;  3TWB A;  4CCQ A;  2OQH A;  3AD8 B;  1O94 A;  4ADW A;  4AT2 A;  3TW9 A;  1TE6 A;  2WPC A;  1O95 A;  3R11 A;  2P88 A;  2IVE A;  3FYY A;  3UJE A;  3C96 A;  2GV8 A;  3ITJ A;  3DJG X;  3ZLF A;  1K0I A;  1OEP A;  1K0J A;  3GC2 A;  2XH4 A;  1ZDL A;  1FL2 A;  1SEZ A;  2JK6 A;  2YLZ A;  3NRN A;  2GR1 A;  3KU9 A;  4H4W A;  4OPC A;  1IUT A;  4OPT A;  1JPM A;  4GF7 A;  4Z44 A;  2C3C A;  1B37 A;  3R0U A;  1PBC A;  4H4Y A;  3DA1 A;  5IQ1 A;  4KX6 A;  2DKH A;  2YG5 A;  2B9Y A;  2MUC A;  1OJA A;  3ICS A;  3A7R A;  5FJP A;  4DNA A;  4APN A;  2OLO A;  2APG A;  3NKS A;  1BKH A;  4K5R A;  3P4R A;  1NHP A;  1PBB A;  3V3O A;  1EC9 A;  2BYB A;  1BGN A;  2C67 A;  2XVE A;  1EBH A;  3P4S A;  5HYM A;  2BCG G;  3SZW A;  2B7S A;  3SN0 A;  1MRA A;  3SX6 A;  4ZCW A;  3ZVH B;  3EPT A;  1CC4 A;  3H7V A;  5TR3 A;  2WDR A;  5FJT A;  2V6O A;  5IPY A;  3VR8 A;  3KUM A;  4BK1 A;  1KF6 A;  1D4E A;  2C70 A;  2YLR A;  4KEM A;  1V59 A;  2W3S A;  1L9D A;  1XDI A;  4WCT A;  4A7A A;  3IJL A;  4H7U A;  3L5O A;  2PU1 A;  3R25 A;  5DBJ A;  3PWI A;  2XH0 A;  3HZL A;  3AEF A;  3VC5 A;  3UOZ A;  1DJN A;  3A7U A;  1NDA A;  3RGT A;  4H4P A;  2R4J A;  4NZH A;  2Q0L A;  1PJ5 A;  4EQW A;  2AR8 A;  4KPR A;  3T0K A;  3R9U A;  3PFR A;  3LXD A;  3UCL A;  1PS9 A;  3NN0 X;  2V61 A;  1DOB A;  3LOV A;  1JNZ A;  3CMM A;  3RIT A;  5L46 A;  1F3P A;  3VDG A;  4NTD A;  1K0L A;  3L1R A;  3ATQ A;  3QPE A;  3SZ0 A;  2CFY A;  2V5Z A;  1LV0 A;  2PP0 A;  4USQ A;  3EUB 3;  4OPL A;  2RAB A;  1EL5 A;  3T6C A;  4C74 A;  3GWD A;  2XYO A;  1TRB A;  2RGO A;  3Q4D A;  2BAB A;  4J36 A;  2AL2 B;  1PDH A;  3K7T A;  2BS2 A;  1T3Q C;  1BF3 A;  2WQY A;  2O56 A;  3EAN A;  3CGE A;  4FI4 A;  1N62 C;  2VOU A;  2POZ A;  2C76 A;  4YWO A;  3OW1 A;  1MUC A;  3U9I A;  2P8B A;  3UJ2 A;  1GRB A;  1JRP A;  3UKQ A;  2BRY A;  5LV9 A;  2PA6 A;  3AE3 A;  4HPN A;  3QFA A;  4YKF A;  3QSS A;  3JZU A;  3UJS A;  2ARD A;  3ALM A;  3BSM A;  2BC1 A;  1EL7 A;  2X50 A;  4HYR A;  4OCG A;  3AED A;  3GYX A;  4TVW A;  3ZVI A;  3UKK A;  4H19 A;  4JN7 A;  3UCD A;  4J2W A;  1XPQ A;  4B1B A;  4JY2 A;  5EU9 A;  3EKG A;  1X2H A;  4Z25 A;  3HYW A;  4DHG A;  3P3B A;  4B68 A;  1JEH A;  3NVW B;  5KWF A;  3AD9 B;  3DER A;  2QVH A;  1L8P A;  1SJA A;  3DME A;  4A3R A;  4NTE A;  1IUS A;  5U25 A;  1IUW A;  3Q6J A;  3O0H A;  2YG3 A;  3CIR A;  4MJW A;  3UKF A;  3NK1 X;  4D04 A;  3E1T A;  4YSY A;  4EMI A;  4XWZ A;  1R6W A;  3T2K A;  2YM1 A;  2DKI A;  1BKW A;  3TJI A;  3ZLG A;  3IHG A;  1GXF A;  2ZZB A;  3P0W A;  1GRG A;  1NEK A;  1PJ7 A;  3KKJ A;  4YSZ A;  2BXR A;  4J34 A;  5HXI A;  1O5W A;  4ZCD A;  2A89 A;  4X9M A;  5EB5 A;  3BOX A;  5CKU A;  3FG2 P;  4DSH A;  2W0H A;  1VRQ B;  3AE9 A;  4U8P A;  2XLR A;  2B7R A;  3VRD B;  3AD7 B;  1ZOY A;  1W4X A;  3ATR A;  4GDP A;  3SJN A;  4FK1 A;  3DG7 A;  3V5F A;  2V3A A;  3AYL A;  2OFJ A;  3ZVH A;  2FJE A;  4HNL A;  2H88 A;  1HYU A;  3DK8 A;  1E1K A;  1X2G A;  2YLS A;  1ZK7 A;  2IID A;  4YT0 A;  3H8A A;  4NEW A;  3P4Q A;  3FXG A;  3JVA A;  1DOC A;  2P3Z A;  1D7Y A;  3P1W A;  4OPG A;  2XH7 A;  3QKE A;  1SB3 B;  1RVK A;  2YR4 A;  3UKA A;  2WOI A;  1VDV A;  1XPY A;  4N9X A;  5KXJ A;  3B97 A;  2HQM A;  3SN1 A;  2EQ8 A;  3R07 C;  5JCN A;  3T2Z A;  3STP A;  3AE1 A;  2YWL A;  2XFQ A;  3SGL A;  2HXU A;  1H84 A;  3NRZ B;  2XLS A;  4IZG A;  4YWS A;  3TQP A;  2AKZ A;  1MO9 A;  4JHM A;  3RO6 A;  4Z43 A;  3UP5 A;  2GQF A;  3ADA B;  5GSN A;  2GQW A;  3GWF A;  1L0V A;  1S2Q A;  4DWD A;  3UKL A;  3GY1 A;  2XFO A;  3NFU A;  1WYG A;  4E4F A;  1H2I A;  4AT0 A;  2PS2 A;  3IHM A;  3K1G A;  3MY9 A;  1DJQ A;  1WUE A;  4GRT A;  1BWC A;  4PAA A;  4HA6 A;  1S2Y A;  1SJD A;  3MUC A;  3AM9 A;  1FHV A;  3OP2 A;  2JB2 A;  4BV6 A;  2QAE A;  2ZZC A;  1F8S A;  4NTC A;  4IT1 A;  1YEY A;  3LZX A;  1Y0P A;  3RHA A;  2XH2 A;  4IL2 A;  4G6G A;  3DK9 A;  1GND A;  4EM4 A;  2PTX A;  2QJM A;  3M13 A;  1EL8 A;  3NTD A;  2JBV A;  3QVR A;  4I59 A;  2AL2 A;  3BHK A;  4TLX A;  3ICT A;  1IJH A;  1NHR A;  1TYT A;  1E7P A;  4CY6 A;  4HCH A;  2CHR A;  3T8Q A;  4CNK A;  4B64 A;  2GRT A;  4A99 A;  3URH A;  4BK2 A;  1KSS A;  4M6U A;  3H12 A;  2Y6Q A;  1MDL A;  4H4V A;  3CGC A;  2XVF A;  3RCY A;  2YR6 A;  3LAD A;  4J57 A;  4HB9 A;  5KMS A;  2OZ3 A;  3KD9 A;  1CHU A;  2XFU A;  2WOW A;  2Z5Y A;  4Y4L A;  4U8O A;  2OPJ A;  4EMW A;  4IA5 A;  3HW2 A;  3ISH A;  4U8L A;  1VG0 A;  3MQT A;  1NAA A;  4O5Q A;  5C2T A;  3UP4 A;  1ZP0 A;  3NN6 X;  5FJR A;  1JDF A;  3IK4 A;  2WDV A;  5HHF A;  3FBS A;  1D4D A;  4G7F A;  4Z2T A;  1CBO A;  2W3R A;  1H7W A;  2E5A A;  3BI2 A;  4X2P A;  1STZ A;  2GSH A;  3FV9 A;  3MWC A;  2XVJ A;  2GVC A;  2BAC A;  1K4Q A;  4NEV A;  2VVM A;  1VDC A;  3NYC A;  2RDX A;  2EQ9 A;  3R0K A;  1NHS A;  4E5T A;  2CVJ A;  1FIQ B;  3AYJ A;  3UOY A;  3SZF A;  1YKJ A;  4ECH A;  2PPG A;  2AKM A;  2TPR A;  3FPZ A;  1TZZ A;  1PHH A;  2W54 A;  3T2Y A;  5FS7 A;  3NH3 X;  3RP7 A;  1KNP A;  1RSG A;  4LA1 A;  3RR1 A;  2YG7 A;  1B5Q A;  2GF3 A;  2Q6U A;  4MMW A;  2YVJ A;  2VRM A;  1DOD A;  2DW7 A;  2PGW A;  1XHC A;  2WDQ A;  4H4R A;  1ZKQ A;  3UJR A;  1QJD A;  2AAQ A;  1N1P A;  5JCI A;  3ES8 A;  1TYP A;  3CYJ A;  1REO A;  3LZW A;  3UKH A;  2WES A;  3NVZ B;  1Y56 A;  1IUV A;  3NYF A;  3HPF A;  2R0P A;  3IF9 A;  4C3X A;  1FFV C;  3ICR A;  2QDD A;  2XSX A;  5KRQ A;  4NNJ A;  4U8M A;  3S5S A;  4RSL A;  3VQR A;  2VQB A;  1CC2 A;  4GIS A;  4FP1 A;  3B9J B;  3DJD A;  4ROP A;  1D5T A;  2PGE A;  1EBG A;  3QJ4 A;  2E4G A;  1ONF A;  4J56 A;  1M64 A;  1PXB A;  1JCT A;  3KPK A;  3G5Q A;  2R46 A;  3DDM A;  3OZ2 A;  3H70 A;  3EEZ A;  2QQ6 A;  3DGZ A;  4A35 A;  1D7L A;  4KT2 A;  2OLA A;  3SY4 A;  2BK3 A;  4YTN A;  4EMJ A;  2ZAD A;  1NU5 A;  4K7Z A;  2PP1 A;  4G6H A;  1Q1W A;  4KPL A;  3T31 A;  3CXO A;  2JB1 A;  4A6G A;  2R4E A;  3H4K A;  2XLP A;  5M10 A;  3FVD A;  4K8G A;  3C4A A;  1LVL A;  5FJU A;  2R0G A;  1NEL A;  4IVM B;  5M0Z A;  4K22 A;  3SFD A;  2BS4 A;  3DJJ A;  4TM0 A;  5KVI A;  2GH5 A;  3I6E A;  2GR3 A;  1B4V A;  1IUU A;  2XGZ A;  2QA2 A;  2GAH B;  2VZ2 A;  2WET A;  2OX4 A;  3OPS A;  1N5W C;  4B67 A;  1ZMD A;  2QJN A;  3RRA A;  1ONE A;  2GDQ A;  3DEQ A;  1ZMC A;  4K2S A;  5C3J A;  1S3B A;  4GCM A;  3GD6 A;  1KKO A;  2FJB A;  4XXG A;  1PN0 A;  4BUR A;  3S61 A;  2GB0 A;  2X99 A;  1RP0 A;  3N4F A;  3OTR A;  3AE8 A;  5G5H B;  3D8X A;  1CL0 A;  3D47 A;  2OZ8 A;  5IDZ A;  1H83 A;  3UJF A;  1H82 A;  3CTY A;  5BRT A;  3UKP A;  5J04 A;  1PDY A;  3ENL A;  2ZBW A;  3FMW A;  3VR9 A;  3MKC A;  3M0O A;  1GRE A;  1JRZ A;  1JU2 A;  2ACZ A;  2E3T A;  1SJC A;  2WPE A;  2V60 A;  2POD A;  2C64 A;  2WHD A;  1ZOV A;  5ER0 A;  1EC8 A;  2WBA A;  3ETR B;  3RNM A;  3EAO A;  3T9P A;  1B8S A;  4GME A;  1X31 B;  4EIP A;  1M6I A;  3F8P A;  4ZN0 A;  4ICY A;  5FS6 A;  3LB8 A;  6ENL A;  5CQF A;  3CND A;  1P2H A;  3RP8 A;  3Q45 A;  1GRF A;  4Z2R A;  4H2H A;  3NK0 X;  3NG7 X;  3DG3 A;  2PTZ A;  4U8J A;  2YG6 A;  3GMB A;  4M0X A;  4CBQ A;  2HXT A;  3RED A;  1L9C A;  4FK1 C;  1V97 A;  5BVA A;  1E1L A;  4H2Q A;  2OAL A;  4OPU A;  2QJJ A;  1OJC A;  4G73 A;  3GYJ A;  2NQL A;  4IP5 A;  4A6N B;  3CNS A;  1GSN A;  2OG9 A;  4H4X A;  2X3N A;  4IL0 A;  3CGD A;  1RYI A;  4GYP C;  1FEC A;  4GFI A;  1FEA A;  3KLJ A;  3VFC A;  3BI4 A;  3N6J A;  4B69 A;  3AEB A;  3QTP A;  4TM3 A;  4DXK A;  3PO7 A;  2V3B A;  4Y4N A;  1E6E A;  3NK2 X;  5FJO A;  3NXL A;  3V4B A;  3IJI A;  4C3Y A;  2DW6 A;  2BRA A;  2QCU A;  2GR2 A;  4USR A;  1IYX A;  3MZN A;  3DK4 A;  4H83 A;  1GRA A;  2PTW A;  3IWA A;  3SXI A;  2YVF A;  1UKV G;  2VVL G;  3VRA A;  3NT6 A;  4H4S A;  4JNQ A;  3V5C A;  4GYP A;  1GOS A;  3TOY A;  1R0M A;  2YLW A;  3AN1 A;  3VCC A;  1YQ3 A;  2YVG A;  1S7M A;  4IA6 A;  3D1C A;  2BA9 A;  3DG6 A;  3UOV A;  2I5Q A;  4Z26 A;  4Z17 A;  2OAM A;  3ZDN A;  1CJ4 A;  1LTX R;  2OA1 A;  3NVY B;  1WUF A;  2IVD A;  1EC7 A;  1GRT A;  2PSN A;  4EWJ A;  1GAL A;  4ZOH B;  2XVH A;  4Z1Y A;  3AB1 A;  4U8I A;  4BJY A;  4RG4 A;  5KMP A;  1FFU C;  4HNC A;  3CNJ A;  3P4P A;  1EL9 A;  2PCE A;  2Q0K A;  1F9C A;  1TDK A;  3NZG A;  4EQR A;  2C7G A;  2XFP A;  4BK3 A;  1NG4 A;  1E39 A;  3AYI A;  1N60 C;  1IUX A;  3CNP A;  4DN1 A;  1CC6 A;  3Q9T A;  3GYI A;  3DFH A;  4CRT A;  2WOV A;  3NS1 B;  1LPF A;  4C77 A;  3PG6 A;  5JRB A;  1KFY A;  3CB3 A;  3P9U A;  1TDE A;  1TDF A;  2JAE A;  2PHH A;  1QLB A;  4PAB A;  5JCL A;  3M12 A;  1LJ1 A;  1YQ4 A;  4B63 A;  2I0Z A;  4U2T A;  4YSH A;  1JRX A;  1N4V A;  4AP3 A;  4NWZ A;  1ZY8 A;  4G9K A;  3QN3 A;  1S3E A;  3UGV A;  3GDN A;  2OVL A;  4II3 A;  2BK4 A;  3AEE A;  3AE2 A;  4UDR A;  5KNL A;  3PK7 A;  3AXB A;  1KCZ A;  2A8X A;  1JNR A;  3GD3 A;  4K1W A;  3I6T A;  1PXA A;  3G5S A;  5BUL A;  3TTE A;  3GMC A;  1N4W A;  4G8T A;  1ZX9 A;  2Z5X A;  4TM4 A;  2R9Z A;  3DIP A;  4X9N A;  3V3N A;  3C4N A;  1N63 C;  2PMQ A;  2GGE A;  4B66 A;  2XCG A;  3BNU A;  4UDP A;  4I58 A;  3CXB A;  1PBF A;  3V3W A;  2F5Z A;  4C5O A;  3RP6 A;  3CN8 A;  2R0C A;  4J3Z A;  3TJ4 A;  2C73 A;  3BJS A;  4K5S A;  4Z2U A;  4A9W A;  2VQ7 A;  3NNE A;  3F8R A;  1FEB A;  1LQT A;  2VVL A;  2XLU A;  3VRB A;  2AQJ A;  4DX3 A;  1OJD A;  1OJT A;  1KSU A;  1YQZ A;  3SM8 A;  5BUK A;  1CJ2 A;  3K30 A;  4JY3 A;  1L9E A;  3NIX A;  3OZY A;  1MXT A;  1VQW A;  2FJA A;  3UOX A;  2YQU A;  2GGJ A;  3V76 A;  3QFB A;  1KD0 A;  2GGH A;  1GET A;  7ENL A;  4E8G A;  4OVI A;  4GAV A;  2Y6R A;  4JN8 A;  5EB4 A;  4A6N A;  1E1N A;  1CJ3 A;  4HCD A;  3ABV A;  2X8G A;  1ELS A;  2XFN A;  1P48 A;  3CPI G;  1KN0 A;  4GIR A;  1VG9 A;  4A5L A;  3GRS A;  4AOX A;  4REK A;  3SSZ A;  2FYM A;  4H4U A;  3FCP A;  2C66 A;  2PTY A;  2E1M A;  2GEW A;  1GTH A;  2QDE A;  2FKP A;  3CK5 A;  4MKS A;  3SZC A;  3I4K A;  3DH9 A;  2OLN A;  3AE6 A;  4D03 A;  1MNS A;  4YSX A;  4GR1 A;  3T14 A;  1BZL A;  5KOW A;  3NO1 A;  3H8L A;  2C3D A;  1F8R A;  3NHO X;  4JN9 A;  3GO2 A;  4ZA0 A;  1GER A;  1N5X A;  3KA7 A;  3GDP A;  2XLT A;  3ZYX A;  3AMZ A;  4OPD A;  4CNJ A;  4II2 A;  2GMJ A;  3GSI A;  1LQU A;  5FMH A;  2FBW A;  1W6T A;  2VRL A;  5KMQ A;  1P43 A;  2XVI A;  4JDR A;  2H89 A;  2B9X A;  3SFE A;  1GES A;  4LU6 A;  1FHU A;  4A65 A;  4HN8 A;  1H7X A;  3SQS A;  2X8H A;  5U63 A;  3A7A A;  2A87 A;  3OC4 A;  4J33 A;  2WU2 A;  5JCK A;  4B65 A;  3N4E A;  2PU0 A;  2WP5 A;  1ZXI C;  3R10 A;  4EM3 A;  3UTG A;  4YKG A;  1OJ9 A;  3JW7 A;  4H4T A;  3IC9 A;  3AEA A;  5FS9 A;  2GGI A;  3CNT A;  2ZZ0 A;  3D9X A;  4FX9 A;  1GPE A;  1AOG A;  3VCN A;  1F8W A;  3T4W A;  3PWG A;  4IP4 A;  4HCL A;  4FDC B;  4WX1 A;  4LII A;  2QGY A;  4K8D A;  5EOW A;  2BC0 A;  5U1O A;  4Y4M A;  2FJD A;  3BHF A;  3DGB A;  3KPF A;  2GL5 A;  3PS9 A;  2WEU A;  4TM1 A;  2J3N A;  3EF6 A;  2CUL A;  4YTP A;  1GV4 A;  2UZZ A;  4DYE A;  3DES A;  3T37 A;  3CT2 A;  1PBD A;  2OKT A;  2EQ7 A;  1XAN A;  2JB3 A;  2BXS A;  3HYV A;  2BCP A;  3UTH A;  4UDQ A;  4EQX A;  3ZLH A;  2WU5 A;  3AE4 A;  4X4J A;  1MDR A;  1N4U A;  2GAG B;  3UXK A;  3NVV B;  1Q1R A;  1PBE A;  4O5U A;  3N6H A;  1KKR A;  1ECQ A;  2WP6 A;  3SN4 A;  2W55 A;  4M52 A;  1TDN A;  4BJZ A;  3LJP A;  3ES7 A;  4GGH A;  3GD4 A;  2BK5 A;  2XDO A;  3CPH G;  4KWS A;  3NLC A;  4YTM A;  3DJE A;  1BGJ A;  1Q9I A;  3OZM A;  2E5V A;  1EBD A;  3MSY A;  1CJC A;  4ENL A;  4RG3 A;  1NEN A;  4IV9 A;  4GDE A;  2WP9 A;  4P9S A;  2QA1 A;  4JNA A;  2C72 A;  1VQZ A;  3D46 A;  3QLD A;  3CAW A;  4GGB A;  2PP3 A;  1QO8 A;  2YAU A;  1GRH A;  3P93 A;  5G5G B;  1DTN A;  3NGC X; 
#chains in the Genus database with same CATH homology
 4E0V A;  3PG6 A;  3L1R A;  2NVK X;  5JRB A;  3ATQ A;  3JSK A;  4GUV A;  1KFY A;  3H8I A;  3AYJ A;  3P9U A;  1TDE A;  1YKJ A;  3SZ0 A;  3SZF A;  3UOY A;  1JRY A;  1TDF A;  2JAE A;  2YR5 A;  4ECH A;  3QVP A;  2TPR A;  2CFY A;  2V5Z A;  3FPZ A;  3K7Q X;  2PHH A;  1FOH A;  1LV0 A;  4USQ A;  3SYI A;  1QLB A;  5EBK A;  4PAB A;  4OPL A;  5JCL A;  1PHH A;  2RAB A;  3M12 A;  1EL5 A;  1LJ1 A;  4C74 A;  1YQ4 A;  4B63 A;  2I0Z A;  2O9Z A;  4U2T A;  1COY A;  1JRX A;  1N4V A;  3GWD A;  2XYO A;  4NWZ A;  4AP3 A;  4YSH A;  1ZY8 A;  4G9K A;  1YY5 A;  3T2Y A;  5FS7 A;  1TRB A;  2RGO A;  4Z24 A;  3NH3 X;  1S3E A;  3RP7 A;  1KNP A;  3HYX A;  1RSG A;  4LA1 A;  2GMH A;  2BAB A;  3GDN A;  2YG7 A;  2YLX A;  1B5Q A;  4H4Q A;  4J36 A;  1NG3 A;  4II3 A;  2BK4 A;  2GF3 A;  2Q6U A;  3AEE A;  3AE2 A;  4UDR A;  4CCR A;  5KNL A;  1PDH A;  3K7T A;  2YVJ A;  2BS2 A;  3AXB A;  1GT8 A;  3CPJ G;  1BF3 A;  2VRM A;  1DOD A;  2A8X A;  1JNR A;  2WQY A;  4H2N A;  3GD3 A;  1PXA A;  3EAN A;  1XHC A;  3G5S A;  1NHQ A;  3CGE A;  2WDQ A;  5BUL A;  4U8K A;  4H4R A;  2BS3 A;  2VOU A;  1ZKQ A;  2C76 A;  4YWO A;  3GMC A;  1N4W A;  3WE0 A;  1ZX9 A;  2Z5X A;  4TM4 A;  4EIQ A;  2R9Z A;  4H2R A;  1QJD A;  2AAQ A;  1N1P A;  1GRB A;  4G74 A;  5JCI A;  2B76 A;  3UKQ A;  4DGK A;  5J60 A;  4IVO B;  2CDU A;  1TYP A;  2BRY A;  3NTA A;  2EQ6 A;  4CY8 A;  5LV9 A;  3II4 A;  1KNR A;  3AE7 A;  1REO A;  3LZW A;  3UKH A;  1CF3 A;  1Y56 A;  2WES A;  3CGB A;  1IUV A;  3AE5 A;  1MOK A;  3AE3 A;  4K2X A;  4X9N A;  3V3N A;  5FS8 A;  3NYF A;  4XWR A;  3C4N A;  3QFA A;  4H50 A;  1DOE A;  4B66 A;  2R0P A;  1H6V A;  3IF9 A;  2XCG A;  4YKF A;  3QSS A;  1ELI A;  3BI5 A;  4C3X A;  3BNU A;  3QSE A;  3SQP A;  2ARD A;  3ALM A;  3ICR A;  5KRQ A;  4UDP A;  1F6M A;  1Y56 B;  4NNJ A;  2BC1 A;  3DGH A;  1H86 A;  4U8M A;  1EL7 A;  2X50 A;  4I58 A;  4OCG A;  4RSL A;  3VQR A;  3AED A;  3GYX A;  2VQB A;  1CC2 A;  1PBF A;  3UKK A;  4U2S A;  2C4C A;  2F5Z A;  4C5O A;  3DJD A;  4J2W A;  3L8K A;  3RP6 A;  2R0C A;  3CN8 A;  1XPQ A;  2NPX A;  1D5T A;  2C73 A;  4B1B A;  2TMD A;  4JY2 A;  4K5S A;  4Z2U A;  4A9W A;  1E1M A;  3QJ4 A;  2VQ7 A;  3ALJ A;  3HYW A;  4H2P A;  4Z25 A;  2E4G A;  1ONF A;  3F8R A;  1FEB A;  4J56 A;  1M64 A;  1LQT A;  3NNE A;  3B6D A;  5KMR A;  1PXB A;  4B68 A;  2VVL A;  3G5Q A;  3KPK A;  1JEH A;  2XLU A;  3VRB A;  2AQJ A;  2R46 A;  3OZ2 A;  1OJD A;  1NPX A;  3AD9 B;  5KWF A;  3DGZ A;  2WPF A;  1OJT A;  1KSU A;  5KOX A;  1D7L A;  4OPI A;  1YQZ A;  3SM8 A;  3SY4 A;  2BK3 A;  4YTN A;  4EMJ A;  4GAP A;  2PYX A;  5BUK A;  5KVH A;  4K7Z A;  3DME A;  1H81 A;  1CJ2 A;  1Z6L A;  4NTE A;  3K30 A;  4JY3 A;  1IUS A;  4G6H A;  1Q1W A;  1DXL A;  5U25 A;  1IUW A;  3UTF A;  3Q6J A;  3O0H A;  1L9E A;  3T31 A;  2YG3 A;  3CIR A;  4MJW A;  2YG4 A;  2JB1 A;  3UKF A;  2R4E A;  3H4K A;  2R45 A;  2XLP A;  3NIX A;  5M10 A;  3GRT A;  3NK1 X;  4D04 A;  3E1T A;  4YSY A;  1MXT A;  4EMI A;  4XWZ A;  3C4A A;  3PVC A;  1VQW A;  2B9W A;  3T2K A;  1LVL A;  2FJA A;  2GR0 A;  2YQU A;  3UOX A;  2R0G A;  2YM1 A;  4UP3 A;  4IVM B;  2WS3 A;  5M0Z A;  2DKI A;  1BKW A;  4K22 A;  3V76 A;  3QFB A;  4AOS A;  3SFD A;  1GTE A;  1GET A;  1GXF A;  2ZZB A;  5GRT A;  3IHG A;  2BS4 A;  1GRG A;  3DJJ A;  2RGJ A;  3QSM A;  5IQ4 A;  4TM0 A;  5KVI A;  2GH5 A;  4U2L A;  2GR3 A;  1B4V A;  1DNC A;  1IUU A;  1NEK A;  2Y6R A;  1PJ7 A;  3G5R A;  4GAV A;  4OVI A;  4U8N A;  3KKJ A;  5EB4 A;  4YSZ A;  4A6N A;  1E1N A;  1CJ3 A;  2QA2 A;  3ABV A;  2BXR A;  2GAH B;  4J34 A;  2VZ2 A;  5HXI A;  1O5W A;  2Q7V A;  2A89 A;  4X9M A;  5EB5 A;  4ZCD A;  3BNM A;  2X8G A;  3S5W A;  2WET A;  3F8D A;  4DSG A;  5CKU A;  3FG2 P;  2XFN A;  4DSH A;  4EQS A;  3AEC A;  2C75 A;  4B67 A;  3CPI G;  1KN0 A;  2W0H A;  3I3L A;  1FCD A;  1VG9 A;  2C65 A;  1VRQ B;  4A5L A;  3GRS A;  1ZMD A;  3AE9 A;  4U8P A;  2XLR A;  2B7R A;  3AWI A;  3VRD B;  4AOX A;  4REK A;  4A79 A;  3AD7 B;  1ZOY A;  3KVE A;  1W4X A;  2RGH A;  4H4U A;  2C66 A;  2E1M A;  4AP1 A;  1ZMC A;  2GEW A;  3ATR A;  4GDP A;  1GTH A;  5C3J A;  1S3B A;  4GCM A;  4FK1 A;  2JKC A;  3SZC A;  2FJB A;  3UTE A;  2YLT A;  3DH9 A;  1PN0 A;  2YM2 A;  4XXG A;  2V3A A;  2OLN A;  3AE6 A;  4BUR A;  3S61 A;  3AYL A;  4D03 A;  2GB0 A;  2X99 A;  1RP0 A;  4YSX A;  4JQ9 A;  4GR1 A;  5J7X A;  3T14 A;  4J31 A;  1BZL A;  5KOW A;  3AE8 A;  3H8L A;  2FJE A;  2C3D A;  3FIM B;  2H88 A;  1F8R A;  1HYU A;  3D8X A;  4ZCC A;  3DK8 A;  1CL0 A;  1E1K A;  2YLS A;  3NHO X;  1ZK7 A;  4JN9 A;  4TLZ A;  1GEU A;  2IID A;  4YT0 A;  4NEW A;  1GER A;  3B3R A;  1H83 A;  3P4Q A;  1D4C A;  3KA7 A;  3GDP A;  1H82 A;  3CTY A;  1DOC A;  5BRT A;  2XLT A;  1D7Y A;  3P1W A;  4OPG A;  3UKP A;  3ZYX A;  4OPD A;  3ALL A;  4CNJ A;  4II2 A;  2GMJ A;  4H4Z A;  2YR4 A;  2WOI A;  3UKA A;  2ZBW A;  3FMW A;  3GSI A;  3VR9 A;  1LQU A;  1TDO A;  5FMH A;  2FBW A;  3M0O A;  5HY5 A;  4N9X A;  1P2E A;  5KXJ A;  1GRE A;  2HQM A;  2VRL A;  4YXD A;  2EQ8 A;  1JOA A;  3AEG A;  1JRZ A;  1JU2 A;  1KDG A;  3I6D A;  3NYE A;  5KMQ A;  5JCM A;  5JCN A;  2ACZ A;  3K7M X;  3T2Z A;  3AE1 A;  2YWL A;  2X8C A;  2XFQ A;  4JDR A;  1PJ6 A;  2XVI A;  3SGL A;  1PXC A;  2H89 A;  2WPE A;  3COX A;  1H84 A;  2V60 A;  2XLS A;  4CCQ A;  3AD8 B;  2C64 A;  2B9X A;  3SFE A;  2WHD A;  1ZOV A;  5ER0 A;  2WBA A;  1O94 A;  1MO9 A;  1GES A;  4ADW A;  4LU6 A;  4AT2 A;  3RNM A;  4A65 A;  1H7X A;  2X8H A;  5U63 A;  3EAO A;  2A87 A;  3OC4 A;  2WPC A;  1B8S A;  4Z43 A;  1X31 B;  4EIP A;  1M6I A;  1O95 A;  4J33 A;  3F8P A;  3UP5 A;  2WU2 A;  2GQF A;  2IVE A;  4ZN0 A;  3ADA B;  5GSN A;  2GQW A;  5JCK A;  4B65 A;  4ICY A;  5FS6 A;  3GWF A;  1L0V A;  3C96 A;  3LB8 A;  5CQF A;  3CND A;  1S2Q A;  3UKL A;  1P2H A;  3RP8 A;  2GV8 A;  2WP5 A;  1GRF A;  2XFO A;  3ITJ A;  3DJG X;  1K0I A;  4Z2R A;  3NK0 X;  1H2I A;  4AT0 A;  3NG7 X;  4EM3 A;  3UTG A;  1K0J A;  4YKG A;  1OJ9 A;  3IHM A;  1DJQ A;  1ZDL A;  4U8J A;  2YG6 A;  4H4T A;  3GMB A;  4CBQ A;  4GRT A;  1FL2 A;  1BWC A;  1SEZ A;  4PAA A;  4HA6 A;  3IC9 A;  1L9C A;  1S2Y A;  3RED A;  4FK1 C;  3AEA A;  5FS9 A;  3CNT A;  2JK6 A;  2YLZ A;  5BVA A;  1E1L A;  3NRN A;  2ZZ0 A;  3D9X A;  2GR1 A;  3KU9 A;  4H2Q A;  4H4W A;  4OPC A;  2OAL A;  1IUT A;  2JB2 A;  4BV6 A;  2QAE A;  4OPU A;  1OJC A;  4FX9 A;  1GPE A;  2ZZC A;  4G73 A;  1AOG A;  3GYJ A;  1F8S A;  4NTC A;  4OPT A;  4GF7 A;  1F8W A;  3LZX A;  4Z44 A;  2C3C A;  1B37 A;  1PBC A;  4H4Y A;  4FDC B;  3DA1 A;  4WX1 A;  4LII A;  5IQ1 A;  4A6N B;  4KX6 A;  4K8D A;  5EOW A;  1Y0P A;  3RHA A;  2DKH A;  2BC0 A;  3CNS A;  1GSN A;  4G6G A;  5U1O A;  4Y4M A;  2YG5 A;  2FJD A;  3BHF A;  4H4X A;  2B9Y A;  3DK9 A;  1GND A;  4EM4 A;  3CGD A;  1OJA A;  1RYI A;  2X3N A;  3KPF A;  3PS9 A;  3ICS A;  1FEC A;  3M13 A;  1FEA A;  2WEU A;  3KLJ A;  1EL8 A;  4TM1 A;  3NTD A;  3BI4 A;  4DNA A;  2JBV A;  3QVR A;  4I59 A;  4B69 A;  3BHK A;  2J3N A;  3AEB A;  3EF6 A;  4APN A;  3ICT A;  4TLX A;  2CUL A;  2OLO A;  1IJH A;  4YTP A;  1NHR A;  4TM3 A;  1GV4 A;  2UZZ A;  3PO7 A;  2V3B A;  3T37 A;  4Y4N A;  1E6E A;  2APG A;  3NK2 X;  3NKS A;  1TYT A;  1PBD A;  4K5R A;  3P4R A;  1E7P A;  2EQ7 A;  1XAN A;  2JB3 A;  1NHP A;  4CY6 A;  4C3Y A;  1PBB A;  2BRA A;  2BXS A;  2QCU A;  3HYV A;  2GR2 A;  2BCP A;  4USR A;  3UTH A;  3DK4 A;  4UDQ A;  3V3O A;  1GRA A;  4CNK A;  4EQX A;  2BYB A;  1BGN A;  3IWA A;  2C67 A;  4B64 A;  2WU5 A;  2XVE A;  2GRT A;  3AE4 A;  3URH A;  4A99 A;  4X4J A;  3SXI A;  2YVF A;  3P4S A;  4BK2 A;  1KSS A;  1UKV G;  2BCG G;  2VVL G;  5HYM A;  3SZW A;  3VRA A;  3NT6 A;  2Y6Q A;  4H4S A;  4JNQ A;  2B7S A;  1N4U A;  2GAG B;  3SX6 A;  4H4V A;  3EPT A;  1GOS A;  3CGC A;  1CC4 A;  1Q1R A;  5TR3 A;  2WDR A;  2XVF A;  2YLW A;  2YR6 A;  2V6O A;  5IPY A;  1PBE A;  1YQ3 A;  3VR8 A;  2YVG A;  1S7M A;  3LAD A;  4J57 A;  4HB9 A;  4O5U A;  4BK1 A;  4IA6 A;  5KMS A;  3KD9 A;  1KF6 A;  1CHU A;  2BA9 A;  3D1C A;  1D4E A;  2XFU A;  2WOW A;  2Z5Y A;  2WP6 A;  3UOV A;  4Y4L A;  2C70 A;  4U8O A;  2YLR A;  4M52 A;  4EMW A;  4Z26 A;  1TDN A;  4BJZ A;  3LJP A;  2OAM A;  1V59 A;  3ZDN A;  4IA5 A;  1CJ4 A;  1L9D A;  3ISH A;  1XDI A;  4U8L A;  1VG0 A;  4WCT A;  1LTX R;  1NAA A;  3GD4 A;  4O5Q A;  2OA1 A;  2BK5 A;  4A7A A;  5C2T A;  3UP4 A;  1ZP0 A;  3NN6 X;  2XDO A;  2IVD A;  1GRT A;  3CPH G;  4H7U A;  1GAL A;  3NLC A;  4YTM A;  2WDV A;  3DJE A;  5HHF A;  3FBS A;  1D4D A;  3L5O A;  5DBJ A;  1BGJ A;  2XVH A;  4Z2T A;  3AB1 A;  1CBO A;  4U8I A;  1Q9I A;  4BJY A;  4RG4 A;  3HZL A;  2E5V A;  5KMP A;  3CNJ A;  1H7W A;  3AEF A;  3UOZ A;  1DJN A;  3P4P A;  1EL9 A;  1NDA A;  4H4P A;  2R4J A;  3BI2 A;  2Q0L A;  4NZH A;  1EBD A;  1CJC A;  1PJ5 A;  2Q0K A;  4EQW A;  2AR8 A;  1NEN A;  4RG3 A;  4IV9 A;  4KPR A;  3T0K A;  4GDE A;  3R9U A;  1TDK A;  2WP9 A;  3LXD A;  3UCL A;  1PS9 A;  3NN0 X;  2QA1 A;  4P9S A;  2V61 A;  4JNA A;  1DOB A;  2C72 A;  3LOV A;  4EQR A;  2C7G A;  2XFP A;  4BK3 A;  1NG4 A;  1JNZ A;  1E39 A;  3CMM A;  2XVJ A;  2GVC A;  3AYI A;  2BAC A;  1K4Q A;  1IUX A;  4NEV A;  3CNP A;  1QO8 A;  1VDC A;  2VVM A;  2YAU A;  3NYC A;  1CC6 A;  2EQ9 A;  1GRH A;  3Q9T A;  3GYI A;  5L46 A;  3NGC X;  1F3P A;  4CRT A;  4NTD A;  1K0L A;  1NHS A;  2WOV A;  1LPF A;  2CVJ A;  4C77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...