1XDIA

Crystal structure of lpda (rv3303c) from mycobacterium tuberculosis
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
465
structure length
459
Chain Sequence
VTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFHKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Rv3303c-lpdA
publication title Characterization of a New Member of the Flavoprotein Disulfide Reductase Family of Enzymes from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 142
structure length 459
sequence length 465
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2004-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF04820 Trp_halogenase Tryptophan halogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1xdiA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xdiA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xdiA02
4FX9A 2E1MA 2YG7A 1JRZA 1ZMCA 3AECA 3AYIA 2R9ZA 5HXIA 4YKGA 2IVEA 2C73A 4GCMA 4IA5A 2YG4A 2C3DA 2YM2A 1DOEA 5J60A 2R45A 1L9DA 3ALLA 1S3EA 2YR4A 4AT0A 5FS6A 3ABVA 3CN8A 3NNEA 4RG4A 3IHGA 3DK4A 3PS9A 3EPTA 2VZ2A 3AD8B 2BK3A 1K0JA 3DK8A 4B68A 4H4VA 4KPRA 3FMWA 2J3NA 2Q0LA 3ALJA 4J36A 4DSHA 1L9EA 3AEAA 4YKFA 5HYMA 1PBDA 2YLWA 1K0LA 4A79A 1PJ6A 4B69A 3KLJA 5GRTA 1KF6A 2GF3A 1GERA 4B67A 1VRQB 1YY5A 3AB1A 1CHUA 1D4EA 4YTNA 3ICRA 5TR3A 3ZYXA 1O5WA 4U8NA 1Y56B 2BA9A 5BULA 1TDKA 2QAEA 4UDRA 1RYIA 3AD7B 4WX1A 1CJ3A 3LZXA 4GDEA 1FEBA 2Y6RA 1XPQA 2I0ZA 2YLZA 3AE7A 4BURA 3NN6X 2XLUA 1D4DA 3II4A 1IUWA 1DJQA 3QSMA 5FS7A 2GR0A 3NK2X 4OVIA 1JU2A 3AE5A 3NRNA 1PXCA 3DGHA 4N9XA 4H4YA 1CJ2A 4TLXA 4TM3A 5L46A 1GXFA 2YVGA 3PVCA 3NT6A 4E0VA 4FK1A 3RP7A 2RGOA 1CL0A 3P4QA 2NVKX 3QVRA 1GOSA 2WDVA 4GUVA 4ZN0A 1SEZA 2ZBWA 3QSSA 3DJJA 1FOHA 2XVJA 2X8HA 1PBBA 4WCTA 3QSEA 2VRMA 2BXSA 3WE0A 1NAAA 4BJYA 2Q6UA 2FJDA 3UKFA 1Z6LA 2ZZBA 1YQ3A 5CKUA 1ONFA 3GWDA 1L0VA 2BYBA 3F8DA 3CGDA 2BCGG 2VQBA 4IVMB 4U2TA 3G5SA 5JCKA 1NHQA 2XCGA 3KA7A 4J56A 4EQSA 2C67A 2Z5YA 1S2QA 4H50A 1E1LA 3K7MX 2WU5A 3NKSA 2PYXA 4IVOB 3IHMA 2FBWA 1BGNA 1EL9A 1GRAA 1OJ9A 2R0PA 3H4KA 1H84A 4NEWA 1PXAA 3AE3A 3B3RA 1ZY8A 5EB5A 4Z26A 1ZDLA 2GEWA 2YR6A 1PN0A 1KSSA 1E39A 1GRFA 1GTEA 2WETA 3Q9TA 4EIQA 3CPHG 3UTEA 4H4UA 1N4UA 3AEGA 1N4WA 2X50A 4APNA 3S5WA 1CF3A 2VVLG 1RSGA 2V61A 3GYJA 1LJ1A 3NIXA 4K5RA 2GH5A 5M10A 1M6IA 3LXDA 1IJHA 2YM1A 3F8PA 4JY2A 5DBJA 4BJZA 4BV6A 2XDOA 2XVEA 3H8LA 2WHDA 1BGJA 2WEUA 4B63A 1CC2A 2Q0KA 4XWZA 1GV4A 1ELIA 2YG6A 1PHHA 1TDNA 2B9XA 1W4XA 4AT2A 4D04A 3DH9A 1F6MA 5BUKA 2FJEA 3CGCA 4I59A 2WPFA 1IUVA 1EBDA 1PBEA 3KPFA 1F8RA 4UDQA 3UTFA 2FJBA 5KVIA 3BNMA 4C3XA 1K0IA 1AOGA 3O0HA 3AYLA 1GRHA 5C3JA 5IQ4A 1NHRA 4PAAA 1GEUA 4EMWA 3SGLA 2UZZA 4UP3A 2B7RA 1GRGA 1Y56A 1ZK7A 2R4JA 3UTHA 3QFAA 5HY5A 1JEHA 1EL5A 2GQFA 3G5RA 3CGBA 4B66A 2X3NA 2V3AA 4H4QA 1LVLA 2R46A 3F8RA 1ZX9A 3AE1A 1GPEA 4C5OA 3K7QX 3UP5A 4LU6A 3EAOA 4A6NB 2YG3A 5KXJA 4U2LA 2Q7VA 2JB2A 4YT0A 2CFYA 3LZWA 3NTDA 2IVDA 1QLBA 2WDQA 3NTAA 1FEAA 4H2NA 4Z24A 4NEVA 4H4RA 1PBCA 4EIPA 5KOWA 3UP4A 2BS2A 2VQ7A 2EQ8A 1N4VA 3UKHA 3C4NA 1OJCA 1VG0A 2GB0A 2BK4A 3GD3A 3COXA 1PJ5A 3AXBA 2WU2A 1Q9IA 1RP0A 4DNAA 3ISHA 4U8PA 2H88A 1FECA 1QO8A 5GSNA 1JNZA 4USRA 2YQUA 3NK1X 2H89A 3DJDA 2R4EA 2OA1A 2EQ9A 4CY6A 3L1RA 4A7AA 3E1TA 1D7YA 2XLRA 3IWAA 1F3PA 3AE8A 4GRTA 1GTHA 1L9CA 2OLNA 2R0CA 3NYCA 4XWRA 4CBQA 1B5QA 4CRTA 1VG9A 4H2PA 4ECHA 4JNQA 4H4WA 1N1PA 5HHFA 4OPIA 3GMCA 4M52A 1PS9A 1B37A 1X31B 1IUUA 3BHKA 2WP5A 2V6OA 4Y4LA 5CQFA 3DMEA 2YVFA 5BVAA 1GT8A 4I58A 4J34A 3H8IA 2XVFA 2OALA 3DA1A 3DK9A 1ZOVA 3VQRA 1VQWA 4EM4A 4K7ZA 1JRXA 1JNRA 4U2SA 4OCGA 2BS4A 1YQ4A 1E1NA 4Z43A 3LJPA 2ARDA 1DJNA 3ICSA 3LOVA 5KVHA 1TRBA 3DGZA 3ALMA 3VRDB 4OPCA 4YSHA 5IQ1A 4MJWA 2W0HA 1D7LA 4REKA 2F5ZA 2VOUA 3V3NA 2XVHA 1COYA 3GMBA 2AAQA 3V3OA 3GYIA 4C77A 1EL8A 3BNUA 3FBSA 3CNPA 5JCNA 1H81A 1FL2A 3I6DA 2GR2A 4Z2RA 4JN9A 1IUTA 3FIMB 3ICTA 2FJAA 2GVCA 1NDAA 1NHSA 2YAUA 1EL7A 4YTMA 4K22A 1LQTA 2Z5XA 5EB4A 1M64A 1ZMDA 2OLOA 4CY8A 4BK2A 3NLCA 4EMJA 2VVMA 3IF9A 4YSYA 2BS3A 4RSLA 4OPDA 1GESA 2WOWA 1BKWA 1NEKA 4TLZA 4LA1A 4H2RA 2XVIA 3B6DA 4A6NA 1TYTA 2X8GA 4JNAA 2JB3A 3P1WA 4H4XA 3GRTA 1GNDA 2B9YA 2XFUA 1E1KA 1CBOA 3VR9A 2O9ZA 1F8WA 1CC4A 4O5UA 5BRTA 3AEFA 2GMJA 3K7TA 1LV0A 4P9SA 4ICYA 1O95A 1NPXA 1H86A 3AEDA 2XFPA 3UKQA 4NTDA 4YXDA 2IIDA 1D5TA 4Z2TA 1H82A 1NHPA 4H2QA 3AWIA 3AE2A 2B76A 5JCIA 3P4SA 4USQA 4IV9A 1TDFA 4K8DA 2AQJA 2C65A 3FPZA 4Y4MA 4K2XA 4J31A 3EF6A 4OPUA 4AOXA 4CCQA 1H6VA 3NH3X 3EANA 2E4GA 4TM4A 2JKCA 3NG7X 1Q1RA 2RGHA 3NHOX 1ZKQA 2OAMA 3CNDA 4HA6A 4AP1A 5J7XA 3REDA 3NN0X 1S2YA 3R9UA 3M12A 2DKIA 3NGCX 4GF7A 4B1BA 1ZP0A 2Y6QA 3KKJA 2C66A 1DNCA 2GV8A 4B64A 5KOXA 4BK1A 2APGA 3KU9A 2JAEA 3SM8A 3UOXA 4OPGA 3AE6A 2EQ7A 4X4JA 4Y4NA 2C64A 1JRYA 3OC4A 2YLRA 3QVPA 1Y0PA 3GRSA 2BXRA 4CNJA 2WS3A 1TDOA 3JSKA 3UCLA 3UTGA 3DJEA 2GR3A 1DOCA 1MXTA 3ATQA 2V5ZA 3BHFA 2YLTA 1NENA 2XLPA 5U63A 2XFOA 1HYUA 4H4SA 3CNJA 2B7SA 4U8KA 1P2EA 3UOZA 2PHHA 2CVJA 4HB9A 3S61A 3T37A 3D8XA 2VRLA 3SFEA 4YTPA 2JB1A 5FS9A 5KRQA 2GAHB 1PXBA 2YWLA 4TM0A 3GDPA 3QJ4A 2TMDA 3RNMA 3C96A 1YQZA 1TYPA 4H4PA 3HZLA 3OZ2A 4AP3A 1PBFA 4A9WA 4IA6A 2BABA 1LTXR 1Q1WA 2ZZCA 4YSXA 4DGKA 5LV9A 1UKVG 3SFDA 1TDEA 3LADA 2ACZA 5M0ZA 3UKAA 4X9MA 1OJAA 3BI4A 2WESA 1GSNA 2X8CA 2XLSA 4GDPA 3UOVA 5C2TA 2TPRA 1H7XA 3VRAA 4DSGA 3UOYA 5IPYA 1PDHA 1B4VA 2QCUA 2WDRA 4EQWA 2BC1A 3P4PA 2RGJA 1IUSA 1D4CA 3G5QA 1GREA 2E5VA 3AYJA 1VDCA 3RP6A 3RP8A 2GAGB 2HQMA 5JCMA 1O94A 2WP6A 2WP9A 1CC6A 4ZCDA 1FCDA 1V59A 5U25A 2A8XA 1B8SA 2C72A 1GETA 1K4QA 1S3BA 1DODA 4EQRA 2C3CA 1CJCA 4YWOA 3AE4A 3CIRA 3BI2A 2JK6A 2GQWA 1YKJA 1H83A 3FG2P 2C76A 1KSUA 3CNTA 3K30A 2BC0A 3CPJG 3ZDNA 3SQPA 2CDUA 2R0GA 4JY3A 5U1OA 2WOIA 4U8OA 1BZLA 4U8IA 1MOKA 1XDIA 4PABA 2V3BA 4U8MA 4LIIA 4X9NA 3NK0X 4RG3A 1H7WA 1QJDA 4O5QA 3BI5A 3M0OA 4B65A 3VRBA 3KVEA 2XYOA 1REOA 4Z25A 3DJGX 3GD4A 3KD9A 3NYFA 1NG4A 3C4AA 3AEBA 4CCRA 1DXLA 1LQUA 4FDCB 1KFYA 4OPLA 2YG5A 5FS8A 2AR8A 2YR5A 2YVJA 3D1CA 1CJ4A 1BWCA 3ATRA 4NTCA 4GR1A 4J57A 4EMIA 3AD9B 4JQ9A 3CNSA 2X99A 2QA2A 1BF3A 2WOVA 2C7GA 4Z44A 2EQ6A 3L8KA 2QA1A 3ITJA 1XHCA 5EBKA 4CNKA 4D03A 4ADWA 4EM3A 4KX6A 1KDGA 3Q6JA 4A5LA 4H4ZA 3IC9A 4A99A 3P9UA 4NTEA 2XFNA 1E6EA 4K5SA 2BCPA 2RABA 5JCLA 3LB8A 2WBAA 1JOAA 2BK5A 1E1MA 3UKPA 1PJ7A 4BK3A 3PO7A 3CGEA 4JDRA 3P4RA 3UKLA 1IUXA 3GDNA 4UDPA 3V76A 2GR1A 2DKHA 5ER0A 1E7PA 1F8SA 3VR8A 2BACA 4J2WA 2WQYA 4C3YA 4ZCCA 5KWFA 3I3LA 3URHA 1ZOYA 2B9WA 2YLXA 4FK1C 3CPIG 2A89A 2C75A 4H4TA 4Z2UA 1GALA 2GMHA 1OJTA 1XANA 1DOBA 2JBVA 2XLTA 2YLSA 2XFQA 2CULA 2GRTA 4XXGA 3M13A 4C74A 1GRTA 1MO9A 2ZZ0A 4EQXA 2A87A 2NPXA 2VVLA 2WPEA 1NG3A 5EOWA 2V60A 1GRBA 1KNPA 3QFBA 3RHAA 4U8JA 3CTYA 3GWFA 2C70A 3AEEA 4AOSA 2WPCA 3GSIA 4A65A 4J33A 4YSZA 3AE9A 4TM1A 1P2HA 1LPFA 3UKKA 1KNRA 4U8LA 5FMHA 3ADAB 3NYEA 4H7UA 4OPTA 4NZHA 1OJDA
chains in the Genus database with same CATH superfamily
2W54A 3T0KA 2E1MA 1JRZA 1ZMCA 2R9ZA 4YKGA 3BOXA 4GCMA 2YG4A 4M0XA 2YM2A 2R45A 1L9DA 3ALLA 3TOYA 3IHGA 3CT2A 4G9KA 4JN7A 3FMWA 2J3NA 3ALJA 4YKFA 2PP3A 1PJ6A 3KLJA 5GRTA 1GERA 4ZOHB 1CHUA 3ICRA 3SN1A 3CAWA 4NWZA 3AD7B 1CJ3A 2I0ZA 3AE7A 1R6WA 5BOEA 4DN1A 2HXUA 3RP7A 2RGOA 3TCSA 1CL0A 3P4QA 3DIPA 2NVKX 3QVRA 2WDVA 1SEZA 2XVJA 2X8HA 4WCTA 2BXSA 1NAAA 4BJYA 2Q6UA 1PDZA 2ZZBA 1ONFA 3SY4A 3D47A 1TZZA 4EQSA 1E1LA 3SX6A 4IVOB 1BGNA 2W3RA 2R0PA 1H84A 4NEWA 3B3RA 1ZDLA 1RSGA 2V61A 4TVYA 3NIXA 1FIQB 1XS2A 1M6IA 3HYXA 2FKPA 2XDOA 5KMRA 4B63A 4ZA0A 1ELIA 2YG6A 1TDNA 1W4XA 4D04A 4I59A 1IUVA 1F8RA 2FJBA 3ZLFA 3RCYA 1GEUA 4EMWA 3BJSA 1ZK7A 2R4JA 3G5RA 2V3AA 3NS1B 3IJLA 4A3RA 4H2NA 3DESA 4Z24A 4NEVA 4GAPA 2AL1A 1JPDX 2OLAA 2EQ8A 1RM6B 1VG0A 3RR1A 2WU2A 4K2SA 4DNAA 2H88A 1FECA 1JNZA 3HYVA 3FV9A 3NK1X 3KUMA 3L1RA 4A7AA 1SJAA 5JRBA 3K1GA 4GISA 2R0CA 4CBQA 1B5QA 1XPYA 4ECHA 4GYPC 1N1PA 3VC6A 1PS9A 4Y4LA 4II3A 2XVFA 2OALA 2OG9A 4K7ZA 4FI4A 2NQLA 1JNRA 1YQ4A 1E1NA 3TQPA 2ARDA 3DGZA 4MJWA 2W0HA 1D7LA 2F5ZA 3BNUA 3FBSA 3SYIA 1EC7A 2GR2A 4Z2RA 2FJAA 2GVCA 2YAUA 1NHSA 3I6TA 1EL7A 5EB4A 3V5CA 4BK2A 4EMJA 2VVMA 4YSYA 4RSLA 3SBFA 1GESA 3OTRA 4H2RA 4A6NA 3B6DA 2ZADA 5BOFA 2JB3A 3P1WA 4H4XA 4GGBA 1CBOA 3ES7A 1F8WA 2MUCA 4Z17A 3TJ4A 2PP0A 4YXDA 1D5TA 4Z2TA 1NHPA 3AWIA 5JCIA 4GYPA 4IV9A 1TDFA 3FPZA 4OPUA 2OKTA 3EANA 4TM4A 2RGHA 3CNDA 4AP1A 3HRDC 3REDA 1S2YA 2DKIA 2Y6QA 2C66A 1DNCA 4K8GA 3QLDA 4G74A 3DERA 2JAEA 4OPGA 4Y4NA 4ROPA 3OC4A 5KMSA 3GRSA 4CNJA 2WS3A 1TDOA 3JSKA 3MSYA 3UCLA 2QJNA 1HYUA 4U8KA 1P2EA 3AMZA 4HB9A 2CVJA 5FS9A 1WUEA 1PXBA 4TM0A 2GGIA 4GFIA 3HZLA 1Q1WA 4DGKA 3R11A 5LV9A 3SFDA 3LADA 5M0ZA 1SJDA 4X9MA 3T2YA 2QDEA 3BI4A 2GGEA 5C2TA 3H70A 4DSGA 1PDHA 3QPEA 3RP8A 5JCMA 4HNCA 4A6GA 3AN1A 2C72A 4IL0A 2GQWA 2C76A 2BC0A 2CDUA 4PABA 4U8MA 2V3BA 3NK0X 4RG3A 4O5QA 3M0OA 3VA8A 3H7VA 2OX4A 2P0IA 3AEBA 1KFYA 3D9XA 3DGBA 1CJ4A 4NTCA 3AD9B 4JQ9A 2WOVA 4Z44A 1YEYA 2QA1A 2XSXA 4H4ZA 2P88A 1R0MA 4K5SA 3UKPA 1E1MA 4HPNA 3PO7A 4JDRA 1IUXA 3GDNA 3NVYB 2BACA 4C3YA 3ZLGA 4FK1C 4Z2UA 2XLTA 2XFQA 3FCPA 2A87A 1MO9A 4EQXA 2NPXA 2VVLA 2WPEA 5EOWA 1KNPA 3QN3A 2C70A 4YSZA 4TM1A 4E6MA 3UKKA 1KNRA 3ADAB 4H7UA 4NZHA 1OJDA 2YG7A 4KT2A 3AM9A 1V97A 3H12A 1S3EA 3ABVA 2VZ2A 3NVVB 1K0JA 2BK3A 4B68A 2Q0LA 3AEAA 2W55A 1KF6A 3TW9A 2GF3A 3AB1A 4YTNA 3ZYXA 4U8NA 5BULA 1TDKA 3UCDA 2OFJA 3NN6X 2XLUA 1IUWA 1DJQA 1X2GA 5FS7A 1JPMA 3AE5A 3GC2A 1FFVC 3DGHA 4N9XA 3JW7A 1CJ2A 4TLXA 5EU9A 5L46A 3UGVA 3NT6A 4FK1A 2QDDA 3QSSA 1PBBA 4G73A 4MGGA 3QSEA 3UKFA 1Z6LA 5CKUA 3DG6A 1JDFA 1SB3B 3F8DA 4GGHA 2BCGG 3R1ZA 3VFCA 4U2TA 3KA7A 4J56A 2C67A 1S2QA 4H50A 2WU5A 1EL9A 3FJ4A 1PXAA 3AE3A 5EB5A 4Z26A 2YR6A 2XH4A 1E39A 1GRFA 1OEPA 4EIQA 1N4UA 4X2PA 3AEGA 1VQZA 4APNA 4K5RA 2GH5A 5M10A 1KN0A 4JY2A 4BJZA 5DBJA 4BV6A 2WEUA 1GV4A 2B9XA 4AT2A 3DH9A 5BUKA 3CGCA 1PBEA 4UDQA 3UTFA 5KVIA 1K0IA 5C3JA 2B7RA 1Y56A 3UTHA 1EL5A 1SJCA 2GQFA 3L5OA 1KD0A 2PTYA 2GL5A 3K7QX 3DDMA 3THUA 5KXJA 4U2LA 3SZCA 3P3BA 2IVDA 1QLBA 2WDQA 3NVZB 4H4RA 3MUCA 2BS2A 1N4VA 3UKHA 2GB0A 3GYXA 1Q9IA 4U8PA 2P8CA 4USRA 2EQ9A 2OQHA 2XLRA 1F3PA 3SQSA 4GRTA 1GTHA 1L9CA 2DW7A 4JNQA 5HHFA 4OPIA 4M52A 1X31B 4EWJA 5CQFA 4J34A 4G6GA 4IP4A 1DJNA 2GDQA 3ALMA 4OPCA 4HCLA 2VOUA 2AAQA 3V3OA 3OZYA 1H81A 1FL2A 3I6DA 2HNEA 3FIMB 3ICTA 2CHRA 4M6UA 4YTMA 2PS2A 3NLCA 1E9IA 3IF9A 4OPDA 1BKWA 2WOWA 4LA1A 2XVIA 3GRTA 2XFUA 3ZLHA 1E1KA 2O9ZA 5BRTA 1LV0A 1O95A 1H86A 3GO2A 5KNLA 3UKQA 4NTDA 3T14A 3A7AA 4K8DA 2C65A 3EF6A 4CCQA 1MDRA 2JKCA 1Q1RA 1EBHA 5J7XA 3M12A 1ZP0A 3I4KA 3T9PA 4B64A 4BK1A 3ZVHA 3SM8A 3UOXA 2EQ7A 3SZFA 1JRYA 2YLRA 2BXRA 3DJEA 1MXTA 3ATQA 2V5ZA 3BHFA 2XFOA 2B7SA 7ENLA 3D8XA 2VRLA 3SFEA 3GDPA 3QJ4A 2AL2B 2XH0A 3C96A 1YQZA 2MNRA 2BABA 2XGZA 4YSXA 1UKVG 2ACZA 2WESA 4GDPA 1B4VA 3P4PA 2RGJA 2E5VA 3AYJA 3MKCA 1O94A 1FCDA 3NZGA 5U25A 2A8XA 1K4QA 1S3BA 2C3CA 1ONEA 5G5HB 3BSMA 1YKJA 1KSUA 3CNTA 3K30A 3SQPA 3HW2A 2R0GA 4U8OA 4X9NA 4J1OA 1QJDA 2XYOA 4Z25A 3DJGX 3OPSA 3NYFA 4CCRA 4A35A 2YG5A 3N4FA 3D1CA 5FS8A 2AR8A 2YVJA 5FJUA 3D46A 3ITJA 1XHCA 4HN8A 5EBKA 4CNKA 4D03A 1KDGA 4JHMA 4A99A 3P9UA 2XFNA 3OZMA 5JCLA 4KWSA 1JOAA 3S5SA 3PFRA 3UKLA 3V76A 4DYEA 4J2WA 2WQYA 5KWFA 3I3LA 3RITA 1ZOYA 2P3ZA 3UJFA 2C75A 4H4TA 1GALA 1ECQA 2GMHA 1DOBA 2GRTA 3M13A 2POZA 1GRBA 2QQ6A 5FJOA 4TVWA 3SZWA 3RHAA 3AEEA 4AOSA 2WPCA 3GSIA 1P2HA 1LPFA 4U8LA 3TJIA 3A7RA 3AECA 3AYIA 5HXIA 3UXKA 2IVEA 2C73A 1DOEA 3SXIA 2YR4A 3CN8A 3NNEA 3PS9A 3DK8A 1NELA 4J36A 4DSHA 1L9EA 2DW6A 1PBDA 1EBGA 5FJRA 1VRQB 1YY5A 1D4EA 5TR3A 5FJPA 2BA9A 3CMMA 4UDRA 4WX1A 3UXLA 1XPQA 3R07C 3UJ2A 3II4A 4Z1YA 3QSMA 3NK2X 4OVIA 1PXCA 4H4YA 4JN8A 1GXFA 2PCEA 3PVCA 4E0VA 1GOSA 4GUVA 4ZN0A 2ZBWA 2HXTA 1STZA 2VRMA 1WUFA 2C4CA 1RVKA 3GWDA 1L0VA 2FYMA 4IVMB 1NHQA 2Z5YA 3K7MX 2BRYA 3NKSA 2PYXA 2FBWA 1GRAA 3R0UA 1WYGA 3DG7A 2WETA 3Q9TA 3UTEA 3S5WA 1CF3A 3T6CA 3LXDA 3F8PA 3H8LA 3T2KA 2WHDA 1BGJA 2Q0KA 4XWZA 1F6MA 2FJEA 2WPFA 4H19A 1EBDA 3RRAA 3KPFA 3BNMA 3B97A 1AOGA 3O0HA 3AYLA 1GRHA 5IQ4A 3SGLA 3JVAA 2UZZA 3FYYA 3NXLA 1GRGA 4G6HA 5HY5A 1JEHA 3UCCA 1BQGA 4B66A 3MY9A 3F8RA 4H4QA 2R46A 1ZX9A 4C5OA 3UP5A 4A6NB 3EAOA 2ZC8A 2Q7VA 2JB2A 2I5QA 3NTAA 2E5AA 4F4RA 1OJCA 2BK4A 3GD3A 1PJ5A 1RP0A 4E8GA 3I6EA 3DJDA 2R4EA 4CY6A 3T4WA 3EKGA 3MWCA 4CRTA 2QJJA 4H4WA 2PGWA 1B37A 2HZGA 1IUUA 3MZNA 2WP5A 2PSNA 1GT8A 2P8BA 4I58A 3SN0A 1ZOVA 3VQRA 1VQWA 3NFUA 4EM4A 1JRXA 4U2SA 1MUCA 3FVDA 3VRDB 3NVWB 4REKA 5G5GB 3V3NA 3UJSA 2XVHA 1COYA 2E3TA 2GSHA 4ENLA 3UJRA 3VCNA 4ZCWA 1LQTA 3V3WA 3SSZA 2BS3A 4TLZA 1N5WC 3V4BA 2X8GA 4JNAA 3DEQA 4O5UA 4P9SA 4GAVA 2XFPA 3TWAA 1H82A 3AE2A 4USQA 4Y4MA 2AQJA 4J31A 3CB3A 1H6VA 3SR6B 2E4GA 2BRAA 3GD6A 3NG7X 4DXKA 2OAMA 4HA6A 1SJBA 3CK5A 2ONEA 3NGCX 3KKJA 1FFUC 1KKRA 3KPKA 3KU9A 1N5XA 3AE6A 2OVLA 4X4JA 2C64A 1Y0PA 2XH7A 1KCZA 2GR3A 1FHVA 3EEZA 2YLTA 1NENA 1N61C 5U63A 3S47A 4H4SA 4IHCA 1EC9A 2W3SA 5KRQA 2GAHB 4K1WA 1PBFA 1LTXR 2AKMA 4HCDA 2ZZCA 5KMPA 3ETRB 3UKAA 3VCCA 1GSNA 3UOVA 2TPRA 3QKEA 3PK7A 5IPYA 3H8AA 2QCUA 4EQWA 2WDRA 1D4CA 3G5QA 2PTXA 1VDCA 2HQMA 2WP6A 2WP9A 1CC6A 3SJNA 5FJTA 4YWOA 3AE4A 3CIRA 1H83A 3RO6A 3CPJG 4MMWA 3PWIA 3VC5A 4JY3A 5U1OA 1MOKA 1XDIA 1S7MA 2XH2A 3KVEA 3DFHA 3GD4A 1NG4A 3VDGA 1LQUA 4FDCB 1BWCA 2OZTA 3R25A 4GR1A 4EMIA 4HCHA 2QA2A 2C7GA 2EQ6A 3OW1A 4ADWA 3Q6JA 4A5LA 1E6EA 2RABA 3LB8A 2BK5A 1PJ7A 1FHUA 3N6HA 3P0WA 3P4RA 3IJQA 2GR1A 4KEMA 2PU1A 5ER0A 1E7PA 1F8SA 2GGHA 3U9IA 3URHA 2B9WA 1JCTA 2A89A 1X2HA 3SZ0A 2ZZ0A 1MRAA 3P93A 2V60A 3A7UA 3PWGA 3IK4A 4U8JA 3GWFA 3AE9A 3NYEA 3UJEA 4OPTA 3R10A 4FX9A 4IA5A 2C3DA 3ES8A 5J60A 1P48A 4AT0A 5FS6A 4RG4A 3DK4A 1N60C 3EPTA 3ENLA 3AD8B 2OPJA 4H4VA 4KPRA 2PA6A 5HYMA 2YLWA 1K0LA 4A79A 1H2IA 4DHGA 4B69A 4DWDA 3QTPA 4B67A 2OO6A 4G8TA 3IJIA 1T3QC 1O5WA 1Y56B 1DTNA 2QAEA 1RYIA 4GDEA 3LZXA 1FEBA 4HNLA 2Y6RA 3EUB3 2YLZA 4H83A 4BURA 1D4DA 3DG3A 2GR0A 3Q45A 1JU2A 3NRNA 4FP1A 4E4UA 4TM3A 2PTZA 4GMEA 2YVGA 3CXOA 4IZGA 4IT1A 3DJJA 1FOHA 4NNJA 3WE0A 2FJDA 1YQ3A 2BYBA 3CGDA 2RDXA 2VQBA 3G5SA 2GGGA 3PG6A 5JCKA 2XCGA 1NU5A 2PGEA 3IHMA 3NO1A 1JROA 1OJ9A 3H4KA 1ZY8A 5IDZA 2GEWA 1PN0A 1KSSA 1GTEA 4E4FA 3CPHG 4H4UA 1N4WA 2X50A 2VVLG 3GYJA 1LJ1A 3HYWA 2YM1A 1IJHA 1TE6A 2XVEA 1CC2A 1PHHA 3T8QA 4DX3A 4C3XA 1NHRA 4IL2A 4PAAA 4UP3A 3TWBA 3QFAA 3HPFA 3CGBA 2X3NA 3B9JB 1LVLA 3AE1A 1GPEA 4LU6A 2YG3A 1KKOA 4YT0A 3DFYA 2CFYA 3LZWA 3NTDA 1L8PA 1FEAA 1PBCA 4EIPA 5KOWA 3UP4A 3CXBA 2VQ7A 3C4NA 4II2A 3COXA 3AXBA 3ISHA 1QO8A 5GSNA 2YQUA 2H89A 2OA1A 1D7YA 2QVHA 6ENLA 3Q4DA 3IWAA 3AE8A 4XWRA 3NYCA 2OLNA 1ZXIC 1TKKA 1VG9A 4H2PA 3GMCA 2PODA 3ZVHB 3BHKA 3TTEA 2V6OA 3DMEA 2YVFA 3N6JA 1F9CA 5BVAA 3H8IA 3DA1A 3DK9A 3GY1A 4OCGA 2BS4A 4Z43A 2AKZA 1MDLA 1N63C 2GGJA 3LJPA 5J04A 3R0KA 3ICSA 3LOVA 3OP2A 5KVHA 3FXGA 1TRBA 4YSHA 5IQ1A 2PMQA 3GMBA 3GYIA 3SN4A 1EL8A 4C77A 3CNPA 5JCNA 4JN9A 1IUTA 2PU0A 1NDAA 4GIRA 2QJMA 4K22A 4E5TA 2Z5XA 1M64A 1ZMDA 2OLOA 4CY8A 1NEKA 1TYTA 3STPA 1GNDA 2B9YA 2PPGA 3VR9A 1CC4A 3AEFA 2GMJA 3K7TA 1BKHA 4ICYA 3NRZB 2OZ3A 3N4EA 1NPXA 4HYRA 3AEDA 3JZUA 2IIDA 4KPLA 4H2QA 2B76A 3P4SA 4K2XA 4H2HA 4AOXA 3NH3X 3CYJA 3T2ZA 3NHOX 1ZKQA 3NN0X 3R9UA 1MNSA 4GF7A 2O56A 4B1BA 3ZVIA 2GV8A 3MQTA 2OQYA 5KOXA 2APGA 3QVPA 3UTGA 1DOCA 4YWSA 2XLPA 3CNJA 3UOZA 2PHHA 3S61A 3T37A 4YTPA 2JB1A 2YWLA 2TMDA 4MKSA 3RNMA 1TYPA 4H4PA 3OZ2A 4AP3A 4H1ZA 4A9WA 4IA6A 1ELSA 1TDEA 1VDVA 1OJAA 3RGTA 2X8CA 2XLSA 1H7XA 3VRAA 3UOYA 2BC1A 1IUSA 1GREA 3RP6A 2GAGB 4IP5A 4ZCDA 1V59A 1B8SA 1EC8A 1GETA 2QGYA 1DODA 4EQRA 2PP1A 1CJCA 3BI2A 2JK6A 3FG2P 3ZDNA 1PDYA 2WOIA 1BZLA 4U8IA 4LIIA 1H7WA 4B65A 3BI5A 3VRBA 1REOA 3KD9A 3C4AA 1DXLA 4OPLA 2YR5A 3ATRA 4J57A 3CNSA 2X99A 2OZ8A 1BF3A 3T31A 3L8KA 4EM3A 4KX6A 3IC9A 4J3ZA 4NTEA 2BCPA 2WBAA 4BK3A 5ENLA 2PTWA 1W6TA 3CGEA 5KMQA 4UDPA 2DKHA 3VR8A 3U4FA 4ZCCA 2AL2A 2YLXA 1IYXA 1JRPA 3CPIG 2YLSA 3E1TA 1OJTA 1XANA 2JBVA 2CULA 4XXGA 4C74A 1GRTA 1P43A 3V5FA 1NG3A 4G7FA 3QFBA 1FO4A 1N62C 3CTYA 4A65A 4J33A 5FMHA
chains in the Genus database with same CATH topology
4FX9A 3T0KA 2E1MA 2YG7A 1JRZA 1ZMCA 3AECA 3AYIA 2R9ZA 5HXIA 4YKGA 2IVEA 2C73A 4GCMA 4IA5A 2YG4A 2C3DA 2YM2A 1DOEA 5J60A 2R45A 1L9DA 3ALLA 1S3EA 2YR4A 3SXIA 4AT0A 5FS6A 3ABVA 3CN8A 3NNEA 4RG4A 3IHGA 3DK4A 3PS9A 3EPTA 2VZ2A 3AD8B 2BK3A 1K0JA 3DK8A 4B68A 4H4VA 4G9KA 4KPRA 3FMWA 2J3NA 2Q0LA 3ALJA 4J36A 4DSHA 1L9EA 3AEAA 4YKFA 5HYMA 1PBDA 2YLWA 1K0LA 4A79A 1H2IA 1PJ6A 4B69A 3KLJA 5GRTA 1KF6A 2GF3A 1GERA 4B67A 1VRQB 1YY5A 3AB1A 1CHUA 1D4EA 4YTNA 3ICRA 5TR3A 3ZYXA 1O5WA 4U8NA 1Y56B 4NWZA 2BA9A 5BULA 1TDKA 2QAEA 3CMMA 4UDRA 1RYIA 3AD7B 4WX1A 1CJ3A 3LZXA 4GDEA 1FEBA 2Y6RA 1XPQA 2I0ZA 2YLZA 3AE7A 4BURA 3NN6X 2XLUA 1D4DA 3II4A 1IUWA 1DJQA 3QSMA 5FS7A 2GR0A 3NK2X 4OVIA 1JU2A 3AE5A 3NRNA 1PXCA 3DGHA 4N9XA 4H4YA 1CJ2A 4TLXA 4TM3A 5L46A 1GXFA 2YVGA 3PVCA 3NT6A 4E0VA 4FK1A 3RP7A 2RGOA 1CL0A 3P4QA 2NVKX 3QVRA 1GOSA 2WDVA 4GUVA 4ZN0A 1SEZA 2ZBWA 3QSSA 3DJJA 1FOHA 2XVJA 4NNJA 2X8HA 1PBBA 4G73A 4WCTA 3QSEA 2VRMA 2BXSA 3WE0A 1NAAA 4BJYA 2Q6UA 2FJDA 3UKFA 1Z6LA 2ZZBA 1YQ3A 2C4CA 5CKUA 1ONFA 3GWDA 3SY4A 1L0VA 2BYBA 3F8DA 3CGDA 2BCGG 2VQBA 4IVMB 4U2TA 3G5SA 3PG6A 5JCKA 1NHQA 2XCGA 3KA7A 4J56A 4EQSA 2C67A 2BRYA 1S2QA 4H50A 1E1LA 2Z5YA 3K7MX 3SX6A 2WU5A 3NKSA 2PYXA 4IVOB 3IHMA 2FBWA 1BGNA 1EL9A 1GRAA 1OJ9A 2R0PA 3H4KA 1H84A 4NEWA 1PXAA 3AE3A 3B3RA 1ZY8A 5EB5A 4Z26A 1ZDLA 2GEWA 2YR6A 1PN0A 1KSSA 1E39A 1GRFA 1GTEA 2WETA 3Q9TA 4EIQA 3CPHG 3UTEA 4H4UA 1N4UA 3AEGA 1N4WA 2X50A 4APNA 3S5WA 1CF3A 2VVLG 1RSGA 2V61A 3GYJA 1LJ1A 3HYWA 3NIXA 4K5RA 2GH5A 5M10A 1KN0A 1M6IA 3LXDA 1IJHA 2YM1A 3F8PA 4JY2A 3HYXA 5DBJA 4BJZA 4BV6A 2XDOA 2XVEA 3H8LA 3T2KA 5KMRA 2WHDA 1BGJA 2WEUA 4B63A 1CC2A 2Q0KA 4XWZA 1GV4A 1ELIA 2YG6A 1PHHA 1TDNA 2B9XA 1W4XA 4AT2A 4D04A 3DH9A 1F6MA 5BUKA 2FJEA 3CGCA 4I59A 2WPFA 1IUVA 1EBDA 1PBEA 3KPFA 1F8RA 4UDQA 3UTFA 2FJBA 5KVIA 3BNMA 4C3XA 1K0IA 1AOGA 3O0HA 3AYLA 1GRHA 5C3JA 5IQ4A 1NHRA 4PAAA 1GEUA 4EMWA 3SGLA 2UZZA 4UP3A 2B7RA 1GRGA 4G6HA 1Y56A 1ZK7A 2R4JA 3UTHA 3QFAA 5HY5A 1JEHA 1EL5A 2GQFA 3G5RA 3CGBA 4B66A 2X3NA 3L5OA 2V3AA 4H4QA 1LVLA 2R46A 3F8RA 1ZX9A 3AE1A 1GPEA 4C5OA 3K7QX 3UP5A 4LU6A 3EAOA 4A6NB 2YG3A 5KXJA 4U2LA 3SZCA 2Q7VA 2JB2A 4YT0A 2CFYA 3LZWA 3NTDA 2IVDA 1QLBA 2WDQA 3NTAA 1FEAA 4H2NA 4Z24A 4NEVA 4H4RA 4GAPA 1PBCA 4EIPA 5KOWA 3UP4A 2BS2A 2VQ7A 2EQ8A 1N4VA 3UKHA 3C4NA 1OJCA 4II2A 1VG0A 2GB0A 2BK4A 3GD3A 3COXA 3GYXA 1PJ5A 3AXBA 2WU2A 1Q9IA 1RP0A 4DNAA 3ISHA 4U8PA 2H88A 1FECA 1QO8A 5GSNA 1JNZA 4USRA 2YQUA 3HYVA 3NK1X 2H89A 3DJDA 2R4EA 2OA1A 2EQ9A 4CY6A 3L1RA 4A7AA 3E1TA 1D7YA 2XLRA 5JRBA 3IWAA 1F3PA 3AE8A 4GRTA 1GTHA 1L9CA 2OLNA 2R0CA 3NYCA 4XWRA 4CBQA 1B5QA 4CRTA 1VG9A 4H2PA 4ECHA 4JNQA 4H4WA 1N1PA 5HHFA 4OPIA 3GMCA 4M52A 1PS9A 1B37A 1X31B 1IUUA 3BHKA 2WP5A 2V6OA 4Y4LA 5CQFA 4II3A 3DMEA 2YVFA 5BVAA 1GT8A 4I58A 4J34A 3H8IA 2XVFA 2OALA 3DA1A 4G6GA 3DK9A 1ZOVA 3VQRA 1VQWA 4EM4A 4K7ZA 1JRXA 1JNRA 4U2SA 4OCGA 2BS4A 1YQ4A 1E1NA 4Z43A 3LJPA 2ARDA 1DJNA 3ICSA 3LOVA 5KVHA 1TRBA 3DGZA 3ALMA 3VRDB 4OPCA 4YSHA 5IQ1A 4MJWA 2W0HA 1D7LA 4REKA 2F5ZA 2VOUA 3V3NA 2XVHA 1COYA 3GMBA 2AAQA 3V3OA 3GYIA 4C77A 1EL8A 3BNUA 3FBSA 3SYIA 3CNPA 5JCNA 1H81A 1FL2A 3I6DA 2GR2A 4Z2RA 4JN9A 1IUTA 3FIMB 3ICTA 2FJAA 2GVCA 1NDAA 1NHSA 2YAUA 1EL7A 4YTMA 4K22A 1LQTA 2Z5XA 5EB4A 1M64A 1ZMDA 2OLOA 4CY8A 4BK2A 3NLCA 4EMJA 2VVMA 3IF9A 4YSYA 2BS3A 4RSLA 4OPDA 1GESA 2WOWA 1BKWA 1NEKA 4TLZA 4LA1A 4H2RA 2XVIA 3B6DA 4A6NA 1TYTA 2X8GA 4JNAA 2JB3A 3P1WA 4H4XA 3GRTA 1GNDA 2B9YA 2XFUA 1E1KA 1CBOA 3VR9A 2O9ZA 1F8WA 1CC4A 4O5UA 5BRTA 3AEFA 2GMJA 3K7TA 1LV0A 4GAVA 4P9SA 4ICYA 1O95A 1NPXA 1H86A 3AEDA 2XFPA 5KNLA 3UKQA 4NTDA 4YXDA 3T14A 2IIDA 1D5TA 4Z2TA 1H82A 1NHPA 4H2QA 3AWIA 3AE2A 2B76A 5JCIA 3P4SA 4USQA 4IV9A 1TDFA 4K8DA 2AQJA 2C65A 3FPZA 4Y4MA 4K2XA 4J31A 3EF6A 4OPUA 4AOXA 4CCQA 1H6VA 3NH3X 3EANA 2E4GA 2BRAA 4TM4A 2JKCA 3NG7X 3T2ZA 1Q1RA 2RGHA 3NHOX 1ZKQA 2OAMA 3CNDA 4HA6A 4AP1A 5J7XA 3REDA 3NN0X 1S2YA 3R9UA 3M12A 2DKIA 3NGCX 4GF7A 4B1BA 1ZP0A 2Y6QA 3KKJA 2C66A 1DNCA 2GV8A 4G74A 3KPKA 4B64A 5KOXA 4BK1A 2APGA 3KU9A 2JAEA 3SM8A 3UOXA 4OPGA 3AE6A 2EQ7A 4X4JA 4Y4NA 3SZFA 2C64A 1JRYA 3OC4A 2YLRA 3QVPA 1Y0PA 3GRSA 2BXRA 4CNJA 5KMSA 2WS3A 1TDOA 3JSKA 3UCLA 3UTGA 3DJEA 2GR3A 1DOCA 1MXTA 3ATQA 2V5ZA 3BHFA 2YLTA 1NENA 2XLPA 5U63A 2XFOA 1HYUA 4H4SA 3CNJA 2B7SA 4U8KA 1P2EA 3UOZA 2PHHA 2CVJA 4HB9A 3S61A 3T37A 3D8XA 2VRLA 3SFEA 4YTPA 2JB1A 5FS9A 5KRQA 2GAHB 1PXBA 2YWLA 4TM0A 3GDPA 3QJ4A 2TMDA 3RNMA 3C96A 1YQZA 1TYPA 4H4PA 3HZLA 3OZ2A 4AP3A 1PBFA 4A9WA 4IA6A 2BABA 1LTXR 1Q1WA 5KMPA 2ZZCA 4YSXA 4DGKA 5LV9A 1UKVG 3SFDA 1TDEA 3LADA 2ACZA 5M0ZA 3UKAA 4X9MA 1OJAA 3T2YA 3BI4A 2WESA 1GSNA 2X8CA 2XLSA 4GDPA 3UOVA 5C2TA 2TPRA 1H7XA 3VRAA 4DSGA 3UOYA 5IPYA 1PDHA 1B4VA 2QCUA 2WDRA 4EQWA 2BC1A 3P4PA 2RGJA 1IUSA 1D4CA 3G5QA 1GREA 2E5VA 3AYJA 1VDCA 3RP6A 3RP8A 2GAGB 2HQMA 5JCMA 1O94A 2WP6A 2WP9A 1CC6A 4ZCDA 1FCDA 1V59A 5U25A 2A8XA 1B8SA 2C72A 1GETA 1K4QA 1S3BA 1DODA 4EQRA 2C3CA 1CJCA 4YWOA 3AE4A 3CIRA 3BI2A 2JK6A 2GQWA 1YKJA 1H83A 3FG2P 2C76A 1KSUA 3CNTA 3K30A 2BC0A 3CPJG 3ZDNA 3SQPA 2CDUA 2R0GA 4JY3A 5U1OA 2WOIA 4U8OA 1BZLA 4U8IA 1MOKA 1XDIA 4PABA 2V3BA 4U8MA 4LIIA 4X9NA 3NK0X 1S7MA 4RG3A 1H7WA 1QJDA 4O5QA 3BI5A 3M0OA 4B65A 3VRBA 3KVEA 2XYOA 1REOA 4Z25A 3DJGX 3GD4A 3KD9A 3NYFA 1NG4A 3C4AA 3AEBA 4CCRA 1DXLA 1LQUA 4FDCB 1KFYA 4OPLA 2YG5A 5FS8A 2AR8A 2YR5A 2YVJA 3D9XA 1CJ4A 1BWCA 3D1CA 3ATRA 4NTCA 4GR1A 4J57A 4EMIA 3AD9B 4JQ9A 3CNSA 2X99A 2QA2A 1BF3A 2WOVA 2C7GA 4Z44A 2EQ6A 3T31A 3L8KA 2QA1A 3ITJA 1XHCA 5EBKA 4CNKA 4D03A 4ADWA 4EM3A 4KX6A 1KDGA 3Q6JA 4A5LA 4H4ZA 3IC9A 4A99A 3P9UA 4NTEA 2XFNA 1E6EA 4K5SA 2BCPA 2RABA 5JCLA 3LB8A 2WBAA 1JOAA 2BK5A 1E1MA 3UKPA 1PJ7A 4BK3A 3PO7A 3CGEA 4JDRA 3P4RA 5KMQA 3UKLA 1IUXA 3GDNA 4UDPA 3V76A 2GR1A 2DKHA 5ER0A 1E7PA 1F8SA 3VR8A 2BACA 4J2WA 2WQYA 4C3YA 4ZCCA 5KWFA 3I3LA 3URHA 1ZOYA 2B9WA 2YLXA 4FK1C 3CPIG 2A89A 2C75A 4H4TA 4Z2UA 1GALA 2GMHA 1OJTA 1XANA 1DOBA 2JBVA 2XLTA 2YLSA 2XFQA 2CULA 2GRTA 4XXGA 3M13A 4C74A 3SZ0A 1GRTA 1MO9A 2ZZ0A 4EQXA 2A87A 2NPXA 2VVLA 2WPEA 1NG3A 5EOWA 2V60A 1GRBA 1KNPA 3QFBA 3RHAA 4U8JA 3SZWA 3CTYA 3GWFA 2C70A 3AEEA 4AOSA 2WPCA 3GSIA 4A65A 4J33A 4YSZA 3AE9A 4TM1A 1P2HA 1LPFA 3UKKA 1KNRA 4U8LA 5FMHA 3ADAB 3NYEA 4H7UA 4OPTA 4NZHA 1OJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FX9 A;  2E1M A;  2YG7 A;  1JRZ A;  1ZMC A;  3AEC A;  3AYI A;  2R9Z A;  5HXI A;  4YKG A;  2IVE A;  2C73 A;  4GCM A;  4IA5 A;  2YG4 A;  2C3D A;  2YM2 A;  1DOE A;  5J60 A;  2R45 A;  1L9D A;  3ALL A;  1S3E A;  2YR4 A;  4AT0 A;  5FS6 A;  3ABV A;  3CN8 A;  3NNE A;  4RG4 A;  3IHG A;  3DK4 A;  3PS9 A;  3EPT A;  2VZ2 A;  3AD8 B;  2BK3 A;  1K0J A;  3DK8 A;  4B68 A;  4H4V A;  4KPR A;  3FMW A;  2J3N A;  2Q0L A;  3ALJ A;  4J36 A;  4DSH A;  1L9E A;  3AEA A;  4YKF A;  5HYM A;  1PBD A;  2YLW A;  1K0L A;  4A79 A;  1PJ6 A;  4B69 A;  3KLJ A;  5GRT A;  1KF6 A;  2GF3 A;  1GER A;  4B67 A;  1VRQ B;  1YY5 A;  3AB1 A;  1CHU A;  1D4E A;  4YTN A;  3ICR A;  5TR3 A;  3ZYX A;  1O5W A;  4U8N A;  1Y56 B;  2BA9 A;  5BUL A;  1TDK A;  2QAE A;  4UDR A;  1RYI A;  3AD7 B;  4WX1 A;  1CJ3 A;  3LZX A;  4GDE A;  1FEB A;  2Y6R A;  1XPQ A;  2I0Z A;  2YLZ A;  3AE7 A;  4BUR A;  3NN6 X;  2XLU A;  1D4D A;  3II4 A;  1IUW A;  1DJQ A;  3QSM A;  5FS7 A;  2GR0 A;  3NK2 X;  4OVI A;  1JU2 A;  3AE5 A;  3NRN A;  1PXC A;  3DGH A;  4N9X A;  4H4Y A;  1CJ2 A;  4TLX A;  4TM3 A;  5L46 A;  1GXF A;  2YVG A;  3PVC A;  3NT6 A;  4E0V A;  4FK1 A;  3RP7 A;  2RGO A;  1CL0 A;  3P4Q A;  2NVK X;  3QVR A;  1GOS A;  2WDV A;  4GUV A;  4ZN0 A;  1SEZ A;  2ZBW A;  3QSS A;  3DJJ A;  1FOH A;  2XVJ A;  2X8H A;  1PBB A;  4WCT A;  3QSE A;  2VRM A;  2BXS A;  3WE0 A;  1NAA A;  4BJY A;  2Q6U A;  2FJD A;  3UKF A;  1Z6L A;  2ZZB A;  1YQ3 A;  5CKU A;  1ONF A;  3GWD A;  1L0V A;  2BYB A;  3F8D A;  3CGD A;  2BCG G;  2VQB A;  4IVM B;  4U2T A;  3G5S A;  5JCK A;  1NHQ A;  2XCG A;  3KA7 A;  4J56 A;  4EQS A;  2C67 A;  2Z5Y A;  1S2Q A;  4H50 A;  1E1L A;  3K7M X;  2WU5 A;  3NKS A;  2PYX A;  4IVO B;  3IHM A;  2FBW A;  1BGN A;  1EL9 A;  1GRA A;  1OJ9 A;  2R0P A;  3H4K A;  1H84 A;  4NEW A;  1PXA A;  3AE3 A;  3B3R A;  1ZY8 A;  5EB5 A;  4Z26 A;  1ZDL A;  2GEW A;  2YR6 A;  1PN0 A;  1KSS A;  1E39 A;  1GRF A;  1GTE A;  2WET A;  3Q9T A;  4EIQ A;  3CPH G;  3UTE A;  4H4U A;  1N4U A;  3AEG A;  1N4W A;  2X50 A;  4APN A;  3S5W A;  1CF3 A;  2VVL G;  1RSG A;  2V61 A;  3GYJ A;  1LJ1 A;  3NIX A;  4K5R A;  2GH5 A;  5M10 A;  1M6I A;  3LXD A;  1IJH A;  2YM1 A;  3F8P A;  4JY2 A;  5DBJ A;  4BJZ A;  4BV6 A;  2XDO A;  2XVE A;  3H8L A;  2WHD A;  1BGJ A;  2WEU A;  4B63 A;  1CC2 A;  2Q0K A;  4XWZ A;  1GV4 A;  1ELI A;  2YG6 A;  1PHH A;  1TDN A;  2B9X A;  1W4X A;  4AT2 A;  4D04 A;  3DH9 A;  1F6M A;  5BUK A;  2FJE A;  3CGC A;  4I59 A;  2WPF A;  1IUV A;  1EBD A;  1PBE A;  3KPF A;  1F8R A;  4UDQ A;  3UTF A;  2FJB A;  5KVI A;  3BNM A;  4C3X A;  1K0I A;  1AOG A;  3O0H A;  3AYL A;  1GRH A;  5C3J A;  5IQ4 A;  1NHR A;  4PAA A;  1GEU A;  4EMW A;  3SGL A;  2UZZ A;  4UP3 A;  2B7R A;  1GRG A;  1Y56 A;  1ZK7 A;  2R4J A;  3UTH A;  3QFA A;  5HY5 A;  1JEH A;  1EL5 A;  2GQF A;  3G5R A;  3CGB A;  4B66 A;  2X3N A;  2V3A A;  4H4Q A;  1LVL A;  2R46 A;  3F8R A;  1ZX9 A;  3AE1 A;  1GPE A;  4C5O A;  3K7Q X;  3UP5 A;  4LU6 A;  3EAO A;  4A6N B;  2YG3 A;  5KXJ A;  4U2L A;  2Q7V A;  2JB2 A;  4YT0 A;  2CFY A;  3LZW A;  3NTD A;  2IVD A;  1QLB A;  2WDQ A;  3NTA A;  1FEA A;  4H2N A;  4Z24 A;  4NEV A;  4H4R A;  1PBC A;  4EIP A;  5KOW A;  3UP4 A;  2BS2 A;  2VQ7 A;  2EQ8 A;  1N4V A;  3UKH A;  3C4N A;  1OJC A;  1VG0 A;  2GB0 A;  2BK4 A;  3GD3 A;  3COX A;  1PJ5 A;  3AXB A;  2WU2 A;  1Q9I A;  1RP0 A;  4DNA A;  3ISH A;  4U8P A;  2H88 A;  1FEC A;  1QO8 A;  5GSN A;  1JNZ A;  4USR A;  2YQU A;  3NK1 X;  2H89 A;  3DJD A;  2R4E A;  2OA1 A;  2EQ9 A;  4CY6 A;  3L1R A;  4A7A A;  3E1T A;  1D7Y A;  2XLR A;  3IWA A;  1F3P A;  3AE8 A;  4GRT A;  1GTH A;  1L9C A;  2OLN A;  2R0C A;  3NYC A;  4XWR A;  4CBQ A;  1B5Q A;  4CRT A;  1VG9 A;  4H2P A;  4ECH A;  4JNQ A;  4H4W A;  1N1P A;  5HHF A;  4OPI A;  3GMC A;  4M52 A;  1PS9 A;  1B37 A;  1X31 B;  1IUU A;  3BHK A;  2WP5 A;  2V6O A;  4Y4L A;  5CQF A;  3DME A;  2YVF A;  5BVA A;  1GT8 A;  4I58 A;  4J34 A;  3H8I A;  2XVF A;  2OAL A;  3DA1 A;  3DK9 A;  1ZOV A;  3VQR A;  1VQW A;  4EM4 A;  4K7Z A;  1JRX A;  1JNR A;  4U2S A;  4OCG A;  2BS4 A;  1YQ4 A;  1E1N A;  4Z43 A;  3LJP A;  2ARD A;  1DJN A;  3ICS A;  3LOV A;  5KVH A;  1TRB A;  3DGZ A;  3ALM A;  3VRD B;  4OPC A;  4YSH A;  5IQ1 A;  4MJW A;  2W0H A;  1D7L A;  4REK A;  2F5Z A;  2VOU A;  3V3N A;  2XVH A;  1COY A;  3GMB A;  2AAQ A;  3V3O A;  3GYI A;  4C77 A;  1EL8 A;  3BNU A;  3FBS A;  3CNP A;  5JCN A;  1H81 A;  1FL2 A;  3I6D A;  2GR2 A;  4Z2R A;  4JN9 A;  1IUT A;  3FIM B;  3ICT A;  2FJA A;  2GVC A;  1NDA A;  1NHS A;  2YAU A;  1EL7 A;  4YTM A;  4K22 A;  1LQT A;  2Z5X A;  5EB4 A;  1M64 A;  1ZMD A;  2OLO A;  4CY8 A;  4BK2 A;  3NLC A;  4EMJ A;  2VVM A;  3IF9 A;  4YSY A;  2BS3 A;  4RSL A;  4OPD A;  1GES A;  2WOW A;  1BKW A;  1NEK A;  4TLZ A;  4LA1 A;  4H2R A;  2XVI A;  3B6D A;  4A6N A;  1TYT A;  2X8G A;  4JNA A;  2JB3 A;  3P1W A;  4H4X A;  3GRT A;  1GND A;  2B9Y A;  2XFU A;  1E1K A;  1CBO A;  3VR9 A;  2O9Z A;  1F8W A;  1CC4 A;  4O5U A;  5BRT A;  3AEF A;  2GMJ A;  3K7T A;  1LV0 A;  4P9S A;  4ICY A;  1O95 A;  1NPX A;  1H86 A;  3AED A;  2XFP A;  3UKQ A;  4NTD A;  4YXD A;  2IID A;  1D5T A;  4Z2T A;  1H82 A;  1NHP A;  4H2Q A;  3AWI A;  3AE2 A;  2B76 A;  5JCI A;  3P4S A;  4USQ A;  4IV9 A;  1TDF A;  4K8D A;  2AQJ A;  2C65 A;  3FPZ A;  4Y4M A;  4K2X A;  4J31 A;  3EF6 A;  4OPU A;  4AOX A;  4CCQ A;  1H6V A;  3NH3 X;  3EAN A;  2E4G A;  4TM4 A;  2JKC A;  3NG7 X;  1Q1R A;  2RGH A;  3NHO X;  1ZKQ A;  2OAM A;  3CND A;  4HA6 A;  4AP1 A;  5J7X A;  3RED A;  3NN0 X;  1S2Y A;  3R9U A;  3M12 A;  2DKI A;  3NGC X;  4GF7 A;  4B1B A;  1ZP0 A;  2Y6Q A;  3KKJ A;  2C66 A;  1DNC A;  2GV8 A;  4B64 A;  5KOX A;  4BK1 A;  2APG A;  3KU9 A;  2JAE A;  3SM8 A;  3UOX A;  4OPG A;  3AE6 A;  2EQ7 A;  4X4J A;  4Y4N A;  2C64 A;  1JRY A;  3OC4 A;  2YLR A;  3QVP A;  1Y0P A;  3GRS A;  2BXR A;  4CNJ A;  2WS3 A;  1TDO A;  3JSK A;  3UCL A;  3UTG A;  3DJE A;  2GR3 A;  1DOC A;  1MXT A;  3ATQ A;  2V5Z A;  3BHF A;  2YLT A;  1NEN A;  2XLP A;  5U63 A;  2XFO A;  1HYU A;  4H4S A;  3CNJ A;  2B7S A;  4U8K A;  1P2E A;  3UOZ A;  2PHH A;  2CVJ A;  4HB9 A;  3S61 A;  3T37 A;  3D8X A;  2VRL A;  3SFE A;  4YTP A;  2JB1 A;  5FS9 A;  5KRQ A;  2GAH B;  1PXB A;  2YWL A;  4TM0 A;  3GDP A;  3QJ4 A;  2TMD A;  3RNM A;  3C96 A;  1YQZ A;  1TYP A;  4H4P A;  3HZL A;  3OZ2 A;  4AP3 A;  1PBF A;  4A9W A;  4IA6 A;  2BAB A;  1LTX R;  1Q1W A;  2ZZC A;  4YSX A;  4DGK A;  5LV9 A;  1UKV G;  3SFD A;  1TDE A;  3LAD A;  2ACZ A;  5M0Z A;  3UKA A;  4X9M A;  1OJA A;  3BI4 A;  2WES A;  1GSN A;  2X8C A;  2XLS A;  4GDP A;  3UOV A;  5C2T A;  2TPR A;  1H7X A;  3VRA A;  4DSG A;  3UOY A;  5IPY A;  1PDH A;  1B4V A;  2QCU A;  2WDR A;  4EQW A;  2BC1 A;  3P4P A;  2RGJ A;  1IUS A;  1D4C A;  3G5Q A;  1GRE A;  2E5V A;  3AYJ A;  1VDC A;  3RP6 A;  3RP8 A;  2GAG B;  2HQM A;  5JCM A;  1O94 A;  2WP6 A;  2WP9 A;  1CC6 A;  4ZCD A;  1FCD A;  1V59 A;  5U25 A;  2A8X A;  1B8S A;  2C72 A;  1GET A;  1K4Q A;  1S3B A;  1DOD A;  4EQR A;  2C3C A;  1CJC A;  4YWO A;  3AE4 A;  3CIR A;  3BI2 A;  2JK6 A;  2GQW A;  1YKJ A;  1H83 A;  3FG2 P;  2C76 A;  1KSU A;  3CNT A;  3K30 A;  2BC0 A;  3CPJ G;  3ZDN A;  3SQP A;  2CDU A;  2R0G A;  4JY3 A;  5U1O A;  2WOI A;  4U8O A;  1BZL A;  4U8I A;  1MOK A;  1XDI A;  4PAB A;  2V3B A;  4U8M A;  4LII A;  4X9N A;  3NK0 X;  4RG3 A;  1H7W A;  1QJD A;  4O5Q A;  3BI5 A;  3M0O A;  4B65 A;  3VRB A;  3KVE A;  2XYO A;  1REO A;  4Z25 A;  3DJG X;  3GD4 A;  3KD9 A;  3NYF A;  1NG4 A;  3C4A A;  3AEB A;  4CCR A;  1DXL A;  1LQU A;  4FDC B;  1KFY A;  4OPL A;  2YG5 A;  5FS8 A;  2AR8 A;  2YR5 A;  2YVJ A;  3D1C A;  1CJ4 A;  1BWC A;  3ATR A;  4NTC A;  4GR1 A;  4J57 A;  4EMI A;  3AD9 B;  4JQ9 A;  3CNS A;  2X99 A;  2QA2 A;  1BF3 A;  2WOV A;  2C7G A;  4Z44 A;  2EQ6 A;  3L8K A;  2QA1 A;  3ITJ A;  1XHC A;  5EBK A;  4CNK A;  4D03 A;  4ADW A;  4EM3 A;  4KX6 A;  1KDG A;  3Q6J A;  4A5L A;  4H4Z A;  3IC9 A;  4A99 A;  3P9U A;  4NTE A;  2XFN A;  1E6E A;  4K5S A;  2BCP A;  2RAB A;  5JCL A;  3LB8 A;  2WBA A;  1JOA A;  2BK5 A;  1E1M A;  3UKP A;  1PJ7 A;  4BK3 A;  3PO7 A;  3CGE A;  4JDR A;  3P4R A;  3UKL A;  1IUX A;  3GDN A;  4UDP A;  3V76 A;  2GR1 A;  2DKH A;  5ER0 A;  1E7P A;  1F8S A;  3VR8 A;  2BAC A;  4J2W A;  2WQY A;  4C3Y A;  4ZCC A;  5KWF A;  3I3L A;  3URH A;  1ZOY A;  2B9W A;  2YLX A;  4FK1 C;  3CPI G;  2A89 A;  2C75 A;  4H4T A;  4Z2U A;  1GAL A;  2GMH A;  1OJT A;  1XAN A;  1DOB A;  2JBV A;  2XLT A;  2YLS A;  2XFQ A;  2CUL A;  2GRT A;  4XXG A;  3M13 A;  4C74 A;  1GRT A;  1MO9 A;  2ZZ0 A;  4EQX A;  2A87 A;  2NPX A;  2VVL A;  2WPE A;  1NG3 A;  5EOW A;  2V60 A;  1GRB A;  1KNP A;  3QFB A;  3RHA A;  4U8J A;  3CTY A;  3GWF A;  2C70 A;  3AEE A;  4AOS A;  2WPC A;  3GSI A;  4A65 A;  4J33 A;  4YSZ A;  3AE9 A;  4TM1 A;  1P2H A;  1LPF A;  3UKK A;  1KNR A;  4U8L A;  5FMH A;  3ADA B;  3NYE A;  4H7U A;  4OPT A;  4NZH A;  1OJD A; 
#chains in the Genus database with same CATH topology
 2W54 A;  3T0K A;  2E1M A;  1JRZ A;  1ZMC A;  2R9Z A;  4YKG A;  3BOX A;  4GCM A;  2YG4 A;  4M0X A;  2YM2 A;  2R45 A;  1L9D A;  3ALL A;  3TOY A;  3IHG A;  3CT2 A;  4G9K A;  4JN7 A;  3FMW A;  2J3N A;  3ALJ A;  4YKF A;  2PP3 A;  1PJ6 A;  3KLJ A;  5GRT A;  1GER A;  4ZOH B;  1CHU A;  3ICR A;  3SN1 A;  3CAW A;  4NWZ A;  3AD7 B;  1CJ3 A;  2I0Z A;  3AE7 A;  1R6W A;  5BOE A;  4DN1 A;  2HXU A;  3RP7 A;  2RGO A;  3TCS A;  1CL0 A;  3P4Q A;  3DIP A;  2NVK X;  3QVR A;  2WDV A;  1SEZ A;  2XVJ A;  2X8H A;  4WCT A;  2BXS A;  1NAA A;  4BJY A;  2Q6U A;  1PDZ A;  2ZZB A;  1ONF A;  3SY4 A;  3D47 A;  1TZZ A;  4EQS A;  1E1L A;  3SX6 A;  4IVO B;  1BGN A;  2W3R A;  2R0P A;  1H84 A;  4NEW A;  3B3R A;  1ZDL A;  1RSG A;  2V61 A;  4TVY A;  3NIX A;  1FIQ B;  1XS2 A;  1M6I A;  3HYX A;  2FKP A;  2XDO A;  5KMR A;  4B63 A;  4ZA0 A;  1ELI A;  2YG6 A;  1TDN A;  1W4X A;  4D04 A;  4I59 A;  1IUV A;  1F8R A;  2FJB A;  3ZLF A;  3RCY A;  1GEU A;  4EMW A;  3BJS A;  1ZK7 A;  2R4J A;  3G5R A;  2V3A A;  3NS1 B;  3IJL A;  4A3R A;  4H2N A;  3DES A;  4Z24 A;  4NEV A;  4GAP A;  2AL1 A;  1JPD X;  2OLA A;  2EQ8 A;  1RM6 B;  1VG0 A;  3RR1 A;  2WU2 A;  4K2S A;  4DNA A;  2H88 A;  1FEC A;  1JNZ A;  3HYV A;  3FV9 A;  3NK1 X;  3KUM A;  3L1R A;  4A7A A;  1SJA A;  5JRB A;  3K1G A;  4GIS A;  2R0C A;  4CBQ A;  1B5Q A;  1XPY A;  4ECH A;  4GYP C;  1N1P A;  3VC6 A;  1PS9 A;  4Y4L A;  4II3 A;  2XVF A;  2OAL A;  2OG9 A;  4K7Z A;  4FI4 A;  2NQL A;  1JNR A;  1YQ4 A;  1E1N A;  3TQP A;  2ARD A;  3DGZ A;  4MJW A;  2W0H A;  1D7L A;  2F5Z A;  3BNU A;  3FBS A;  3SYI A;  1EC7 A;  2GR2 A;  4Z2R A;  2FJA A;  2GVC A;  2YAU A;  1NHS A;  3I6T A;  1EL7 A;  5EB4 A;  3V5C A;  4BK2 A;  4EMJ A;  2VVM A;  4YSY A;  4RSL A;  3SBF A;  1GES A;  3OTR A;  4H2R A;  4A6N A;  3B6D A;  2ZAD A;  5BOF A;  2JB3 A;  3P1W A;  4H4X A;  4GGB A;  1CBO A;  3ES7 A;  1F8W A;  2MUC A;  4Z17 A;  3TJ4 A;  2PP0 A;  4YXD A;  1D5T A;  4Z2T A;  1NHP A;  3AWI A;  5JCI A;  4GYP A;  4IV9 A;  1TDF A;  3FPZ A;  4OPU A;  2OKT A;  3EAN A;  4TM4 A;  2RGH A;  3CND A;  4AP1 A;  3HRD C;  3RED A;  1S2Y A;  2DKI A;  2Y6Q A;  2C66 A;  1DNC A;  4K8G A;  3QLD A;  4G74 A;  3DER A;  2JAE A;  4OPG A;  4Y4N A;  4ROP A;  3OC4 A;  5KMS A;  3GRS A;  4CNJ A;  2WS3 A;  1TDO A;  3JSK A;  3MSY A;  3UCL A;  2QJN A;  1HYU A;  4U8K A;  1P2E A;  3AMZ A;  4HB9 A;  2CVJ A;  5FS9 A;  1WUE A;  1PXB A;  4TM0 A;  2GGI A;  4GFI A;  3HZL A;  1Q1W A;  4DGK A;  3R11 A;  5LV9 A;  3SFD A;  3LAD A;  5M0Z A;  1SJD A;  4X9M A;  3T2Y A;  2QDE A;  3BI4 A;  2GGE A;  5C2T A;  3H70 A;  4DSG A;  1PDH A;  3QPE A;  3RP8 A;  5JCM A;  4HNC A;  4A6G A;  3AN1 A;  2C72 A;  4IL0 A;  2GQW A;  2C76 A;  2BC0 A;  2CDU A;  4PAB A;  4U8M A;  2V3B A;  3NK0 X;  4RG3 A;  4O5Q A;  3M0O A;  3VA8 A;  3H7V A;  2OX4 A;  2P0I A;  3AEB A;  1KFY A;  3D9X A;  3DGB A;  1CJ4 A;  4NTC A;  3AD9 B;  4JQ9 A;  2WOV A;  4Z44 A;  1YEY A;  2QA1 A;  2XSX A;  4H4Z A;  2P88 A;  1R0M A;  4K5S A;  3UKP A;  1E1M A;  4HPN A;  3PO7 A;  4JDR A;  1IUX A;  3GDN A;  3NVY B;  2BAC A;  4C3Y A;  3ZLG A;  4FK1 C;  4Z2U A;  2XLT A;  2XFQ A;  3FCP A;  2A87 A;  1MO9 A;  4EQX A;  2NPX A;  2VVL A;  2WPE A;  5EOW A;  1KNP A;  3QN3 A;  2C70 A;  4YSZ A;  4TM1 A;  4E6M A;  3UKK A;  1KNR A;  3ADA B;  4H7U A;  4NZH A;  1OJD A;  2YG7 A;  4KT2 A;  3AM9 A;  1V97 A;  3H12 A;  1S3E A;  3ABV A;  2VZ2 A;  3NVV B;  1K0J A;  2BK3 A;  4B68 A;  2Q0L A;  3AEA A;  2W55 A;  1KF6 A;  3TW9 A;  2GF3 A;  3AB1 A;  4YTN A;  3ZYX A;  4U8N A;  5BUL A;  1TDK A;  3UCD A;  2OFJ A;  3NN6 X;  2XLU A;  1IUW A;  1DJQ A;  1X2G A;  5FS7 A;  1JPM A;  3AE5 A;  3GC2 A;  1FFV C;  3DGH A;  4N9X A;  3JW7 A;  1CJ2 A;  4TLX A;  5EU9 A;  5L46 A;  3UGV A;  3NT6 A;  4FK1 A;  2QDD A;  3QSS A;  1PBB A;  4G73 A;  4MGG A;  3QSE A;  3UKF A;  1Z6L A;  5CKU A;  3DG6 A;  1JDF A;  1SB3 B;  3F8D A;  4GGH A;  2BCG G;  3R1Z A;  3VFC A;  4U2T A;  3KA7 A;  4J56 A;  2C67 A;  1S2Q A;  4H50 A;  2WU5 A;  1EL9 A;  3FJ4 A;  1PXA A;  3AE3 A;  5EB5 A;  4Z26 A;  2YR6 A;  2XH4 A;  1E39 A;  1GRF A;  1OEP A;  4EIQ A;  1N4U A;  4X2P A;  3AEG A;  1VQZ A;  4APN A;  4K5R A;  2GH5 A;  5M10 A;  1KN0 A;  4JY2 A;  4BJZ A;  5DBJ A;  4BV6 A;  2WEU A;  1GV4 A;  2B9X A;  4AT2 A;  3DH9 A;  5BUK A;  3CGC A;  1PBE A;  4UDQ A;  3UTF A;  5KVI A;  1K0I A;  5C3J A;  2B7R A;  1Y56 A;  3UTH A;  1EL5 A;  1SJC A;  2GQF A;  3L5O A;  1KD0 A;  2PTY A;  2GL5 A;  3K7Q X;  3DDM A;  3THU A;  5KXJ A;  4U2L A;  3SZC A;  3P3B A;  2IVD A;  1QLB A;  2WDQ A;  3NVZ B;  4H4R A;  3MUC A;  2BS2 A;  1N4V A;  3UKH A;  2GB0 A;  3GYX A;  1Q9I A;  4U8P A;  2P8C A;  4USR A;  2EQ9 A;  2OQH A;  2XLR A;  1F3P A;  3SQS A;  4GRT A;  1GTH A;  1L9C A;  2DW7 A;  4JNQ A;  5HHF A;  4OPI A;  4M52 A;  1X31 B;  4EWJ A;  5CQF A;  4J34 A;  4G6G A;  4IP4 A;  1DJN A;  2GDQ A;  3ALM A;  4OPC A;  4HCL A;  2VOU A;  2AAQ A;  3V3O A;  3OZY A;  1H81 A;  1FL2 A;  3I6D A;  2HNE A;  3FIM B;  3ICT A;  2CHR A;  4M6U A;  4YTM A;  2PS2 A;  3NLC A;  1E9I A;  3IF9 A;  4OPD A;  1BKW A;  2WOW A;  4LA1 A;  2XVI A;  3GRT A;  2XFU A;  3ZLH A;  1E1K A;  2O9Z A;  5BRT A;  1LV0 A;  1O95 A;  1H86 A;  3GO2 A;  5KNL A;  3UKQ A;  4NTD A;  3T14 A;  3A7A A;  4K8D A;  2C65 A;  3EF6 A;  4CCQ A;  1MDR A;  2JKC A;  1Q1R A;  1EBH A;  5J7X A;  3M12 A;  1ZP0 A;  3I4K A;  3T9P A;  4B64 A;  4BK1 A;  3ZVH A;  3SM8 A;  3UOX A;  2EQ7 A;  3SZF A;  1JRY A;  2YLR A;  2BXR A;  3DJE A;  1MXT A;  3ATQ A;  2V5Z A;  3BHF A;  2XFO A;  2B7S A;  7ENL A;  3D8X A;  2VRL A;  3SFE A;  3GDP A;  3QJ4 A;  2AL2 B;  2XH0 A;  3C96 A;  1YQZ A;  2MNR A;  2BAB A;  2XGZ A;  4YSX A;  1UKV G;  2ACZ A;  2WES A;  4GDP A;  1B4V A;  3P4P A;  2RGJ A;  2E5V A;  3AYJ A;  3MKC A;  1O94 A;  1FCD A;  3NZG A;  5U25 A;  2A8X A;  1K4Q A;  1S3B A;  2C3C A;  1ONE A;  5G5H B;  3BSM A;  1YKJ A;  1KSU A;  3CNT A;  3K30 A;  3SQP A;  3HW2 A;  2R0G A;  4U8O A;  4X9N A;  4J1O A;  1QJD A;  2XYO A;  4Z25 A;  3DJG X;  3OPS A;  3NYF A;  4CCR A;  4A35 A;  2YG5 A;  3N4F A;  3D1C A;  5FS8 A;  2AR8 A;  2YVJ A;  5FJU A;  3D46 A;  3ITJ A;  1XHC A;  4HN8 A;  5EBK A;  4CNK A;  4D03 A;  1KDG A;  4JHM A;  4A99 A;  3P9U A;  2XFN A;  3OZM A;  5JCL A;  4KWS A;  1JOA A;  3S5S A;  3PFR A;  3UKL A;  3V76 A;  4DYE A;  4J2W A;  2WQY A;  5KWF A;  3I3L A;  3RIT A;  1ZOY A;  2P3Z A;  3UJF A;  2C75 A;  4H4T A;  1GAL A;  1ECQ A;  2GMH A;  1DOB A;  2GRT A;  3M13 A;  2POZ A;  1GRB A;  2QQ6 A;  5FJO A;  4TVW A;  3SZW A;  3RHA A;  3AEE A;  4AOS A;  2WPC A;  3GSI A;  1P2H A;  1LPF A;  4U8L A;  3TJI A;  3A7R A;  3AEC A;  3AYI A;  5HXI A;  3UXK A;  2IVE A;  2C73 A;  1DOE A;  3SXI A;  2YR4 A;  3CN8 A;  3NNE A;  3PS9 A;  3DK8 A;  1NEL A;  4J36 A;  4DSH A;  1L9E A;  2DW6 A;  1PBD A;  1EBG A;  5FJR A;  1VRQ B;  1YY5 A;  1D4E A;  5TR3 A;  5FJP A;  2BA9 A;  3CMM A;  4UDR A;  4WX1 A;  3UXL A;  1XPQ A;  3R07 C;  3UJ2 A;  3II4 A;  4Z1Y A;  3QSM A;  3NK2 X;  4OVI A;  1PXC A;  4H4Y A;  4JN8 A;  1GXF A;  2PCE A;  3PVC A;  4E0V A;  1GOS A;  4GUV A;  4ZN0 A;  2ZBW A;  2HXT A;  1STZ A;  2VRM A;  1WUF A;  2C4C A;  1RVK A;  3GWD A;  1L0V A;  2FYM A;  4IVM B;  1NHQ A;  2Z5Y A;  3K7M X;  2BRY A;  3NKS A;  2PYX A;  2FBW A;  1GRA A;  3R0U A;  1WYG A;  3DG7 A;  2WET A;  3Q9T A;  3UTE A;  3S5W A;  1CF3 A;  3T6C A;  3LXD A;  3F8P A;  3H8L A;  3T2K A;  2WHD A;  1BGJ A;  2Q0K A;  4XWZ A;  1F6M A;  2FJE A;  2WPF A;  4H19 A;  1EBD A;  3RRA A;  3KPF A;  3BNM A;  3B97 A;  1AOG A;  3O0H A;  3AYL A;  1GRH A;  5IQ4 A;  3SGL A;  3JVA A;  2UZZ A;  3FYY A;  3NXL A;  1GRG A;  4G6H A;  5HY5 A;  1JEH A;  3UCC A;  1BQG A;  4B66 A;  3MY9 A;  3F8R A;  4H4Q A;  2R46 A;  1ZX9 A;  4C5O A;  3UP5 A;  4A6N B;  3EAO A;  2ZC8 A;  2Q7V A;  2JB2 A;  2I5Q A;  3NTA A;  2E5A A;  4F4R A;  1OJC A;  2BK4 A;  3GD3 A;  1PJ5 A;  1RP0 A;  4E8G A;  3I6E A;  3DJD A;  2R4E A;  4CY6 A;  3T4W A;  3EKG A;  3MWC A;  4CRT A;  2QJJ A;  4H4W A;  2PGW A;  1B37 A;  2HZG A;  1IUU A;  3MZN A;  2WP5 A;  2PSN A;  1GT8 A;  2P8B A;  4I58 A;  3SN0 A;  1ZOV A;  3VQR A;  1VQW A;  3NFU A;  4EM4 A;  1JRX A;  4U2S A;  1MUC A;  3FVD A;  3VRD B;  3NVW B;  4REK A;  5G5G B;  3V3N A;  3UJS A;  2XVH A;  1COY A;  2E3T A;  2GSH A;  4ENL A;  3UJR A;  3VCN A;  4ZCW A;  1LQT A;  3V3W A;  3SSZ A;  2BS3 A;  4TLZ A;  1N5W C;  3V4B A;  2X8G A;  4JNA A;  3DEQ A;  4O5U A;  4P9S A;  4GAV A;  2XFP A;  3TWA A;  1H82 A;  3AE2 A;  4USQ A;  4Y4M A;  2AQJ A;  4J31 A;  3CB3 A;  1H6V A;  3SR6 B;  2E4G A;  2BRA A;  3GD6 A;  3NG7 X;  4DXK A;  2OAM A;  4HA6 A;  1SJB A;  3CK5 A;  2ONE A;  3NGC X;  3KKJ A;  1FFU C;  1KKR A;  3KPK A;  3KU9 A;  1N5X A;  3AE6 A;  2OVL A;  4X4J A;  2C64 A;  1Y0P A;  2XH7 A;  1KCZ A;  2GR3 A;  1FHV A;  3EEZ A;  2YLT A;  1NEN A;  1N61 C;  5U63 A;  3S47 A;  4H4S A;  4IHC A;  1EC9 A;  2W3S A;  5KRQ A;  2GAH B;  4K1W A;  1PBF A;  1LTX R;  2AKM A;  4HCD A;  2ZZC A;  5KMP A;  3ETR B;  3UKA A;  3VCC A;  1GSN A;  3UOV A;  2TPR A;  3QKE A;  3PK7 A;  5IPY A;  3H8A A;  2QCU A;  4EQW A;  2WDR A;  1D4C A;  3G5Q A;  2PTX A;  1VDC A;  2HQM A;  2WP6 A;  2WP9 A;  1CC6 A;  3SJN A;  5FJT A;  4YWO A;  3AE4 A;  3CIR A;  1H83 A;  3RO6 A;  3CPJ G;  4MMW A;  3PWI A;  3VC5 A;  4JY3 A;  5U1O A;  1MOK A;  1XDI A;  1S7M A;  2XH2 A;  3KVE A;  3DFH A;  3GD4 A;  1NG4 A;  3VDG A;  1LQU A;  4FDC B;  1BWC A;  2OZT A;  3R25 A;  4GR1 A;  4EMI A;  4HCH A;  2QA2 A;  2C7G A;  2EQ6 A;  3OW1 A;  4ADW A;  3Q6J A;  4A5L A;  1E6E A;  2RAB A;  3LB8 A;  2BK5 A;  1PJ7 A;  1FHU A;  3N6H A;  3P0W A;  3P4R A;  3IJQ A;  2GR1 A;  4KEM A;  2PU1 A;  5ER0 A;  1E7P A;  1F8S A;  2GGH A;  3U9I A;  3URH A;  2B9W A;  1JCT A;  2A89 A;  1X2H A;  3SZ0 A;  2ZZ0 A;  1MRA A;  3P93 A;  2V60 A;  3A7U A;  3PWG A;  3IK4 A;  4U8J A;  3GWF A;  3AE9 A;  3NYE A;  3UJE A;  4OPT A;  3R10 A;  4FX9 A;  4IA5 A;  2C3D A;  3ES8 A;  5J60 A;  1P48 A;  4AT0 A;  5FS6 A;  4RG4 A;  3DK4 A;  1N60 C;  3EPT A;  3ENL A;  3AD8 B;  2OPJ A;  4H4V A;  4KPR A;  2PA6 A;  5HYM A;  2YLW A;  1K0L A;  4A79 A;  1H2I A;  4DHG A;  4B69 A;  4DWD A;  3QTP A;  4B67 A;  2OO6 A;  4G8T A;  3IJI A;  1T3Q C;  1O5W A;  1Y56 B;  1DTN A;  2QAE A;  1RYI A;  4GDE A;  3LZX A;  1FEB A;  4HNL A;  2Y6R A;  3EUB 3;  2YLZ A;  4H83 A;  4BUR A;  1D4D A;  3DG3 A;  2GR0 A;  3Q45 A;  1JU2 A;  3NRN A;  4FP1 A;  4E4U A;  4TM3 A;  2PTZ A;  4GME A;  2YVG A;  3CXO A;  4IZG A;  4IT1 A;  3DJJ A;  1FOH A;  4NNJ A;  3WE0 A;  2FJD A;  1YQ3 A;  2BYB A;  3CGD A;  2RDX A;  2VQB A;  3G5S A;  2GGG A;  3PG6 A;  5JCK A;  2XCG A;  1NU5 A;  2PGE A;  3IHM A;  3NO1 A;  1JRO A;  1OJ9 A;  3H4K A;  1ZY8 A;  5IDZ A;  2GEW A;  1PN0 A;  1KSS A;  1GTE A;  4E4F A;  3CPH G;  4H4U A;  1N4W A;  2X50 A;  2VVL G;  3GYJ A;  1LJ1 A;  3HYW A;  2YM1 A;  1IJH A;  1TE6 A;  2XVE A;  1CC2 A;  1PHH A;  3T8Q A;  4DX3 A;  4C3X A;  1NHR A;  4IL2 A;  4PAA A;  4UP3 A;  3TWB A;  3QFA A;  3HPF A;  3CGB A;  2X3N A;  3B9J B;  1LVL A;  3AE1 A;  1GPE A;  4LU6 A;  2YG3 A;  1KKO A;  4YT0 A;  3DFY A;  2CFY A;  3LZW A;  3NTD A;  1L8P A;  1FEA A;  1PBC A;  4EIP A;  5KOW A;  3UP4 A;  3CXB A;  2VQ7 A;  3C4N A;  4II2 A;  3COX A;  3AXB A;  3ISH A;  1QO8 A;  5GSN A;  2YQU A;  2H89 A;  2OA1 A;  1D7Y A;  2QVH A;  6ENL A;  3Q4D A;  3IWA A;  3AE8 A;  4XWR A;  3NYC A;  2OLN A;  1ZXI C;  1TKK A;  1VG9 A;  4H2P A;  3GMC A;  2POD A;  3ZVH B;  3BHK A;  3TTE A;  2V6O A;  3DME A;  2YVF A;  3N6J A;  1F9C A;  5BVA A;  3H8I A;  3DA1 A;  3DK9 A;  3GY1 A;  4OCG A;  2BS4 A;  4Z43 A;  2AKZ A;  1MDL A;  1N63 C;  2GGJ A;  3LJP A;  5J04 A;  3R0K A;  3ICS A;  3LOV A;  3OP2 A;  5KVH A;  3FXG A;  1TRB A;  4YSH A;  5IQ1 A;  2PMQ A;  3GMB A;  3GYI A;  3SN4 A;  1EL8 A;  4C77 A;  3CNP A;  5JCN A;  4JN9 A;  1IUT A;  2PU0 A;  1NDA A;  4GIR A;  2QJM A;  4K22 A;  4E5T A;  2Z5X A;  1M64 A;  1ZMD A;  2OLO A;  4CY8 A;  1NEK A;  1TYT A;  3STP A;  1GND A;  2B9Y A;  2PPG A;  3VR9 A;  1CC4 A;  3AEF A;  2GMJ A;  3K7T A;  1BKH A;  4ICY A;  3NRZ B;  2OZ3 A;  3N4E A;  1NPX A;  4HYR A;  3AED A;  3JZU A;  2IID A;  4KPL A;  4H2Q A;  2B76 A;  3P4S A;  4K2X A;  4H2H A;  4AOX A;  3NH3 X;  3CYJ A;  3T2Z A;  3NHO X;  1ZKQ A;  3NN0 X;  3R9U A;  1MNS A;  4GF7 A;  2O56 A;  4B1B A;  3ZVI A;  2GV8 A;  3MQT A;  2OQY A;  5KOX A;  2APG A;  3QVP A;  3UTG A;  1DOC A;  4YWS A;  2XLP A;  3CNJ A;  3UOZ A;  2PHH A;  3S61 A;  3T37 A;  4YTP A;  2JB1 A;  2YWL A;  2TMD A;  4MKS A;  3RNM A;  1TYP A;  4H4P A;  3OZ2 A;  4AP3 A;  4H1Z A;  4A9W A;  4IA6 A;  1ELS A;  1TDE A;  1VDV A;  1OJA A;  3RGT A;  2X8C A;  2XLS A;  1H7X A;  3VRA A;  3UOY A;  2BC1 A;  1IUS A;  1GRE A;  3RP6 A;  2GAG B;  4IP5 A;  4ZCD A;  1V59 A;  1B8S A;  1EC8 A;  1GET A;  2QGY A;  1DOD A;  4EQR A;  2PP1 A;  1CJC A;  3BI2 A;  2JK6 A;  3FG2 P;  3ZDN A;  1PDY A;  2WOI A;  1BZL A;  4U8I A;  4LII A;  1H7W A;  4B65 A;  3BI5 A;  3VRB A;  1REO A;  3KD9 A;  3C4A A;  1DXL A;  4OPL A;  2YR5 A;  3ATR A;  4J57 A;  3CNS A;  2X99 A;  2OZ8 A;  1BF3 A;  3T31 A;  3L8K A;  4EM3 A;  4KX6 A;  3IC9 A;  4J3Z A;  4NTE A;  2BCP A;  2WBA A;  4BK3 A;  5ENL A;  2PTW A;  1W6T A;  3CGE A;  5KMQ A;  4UDP A;  2DKH A;  3VR8 A;  3U4F A;  4ZCC A;  2AL2 A;  2YLX A;  1IYX A;  1JRP A;  3CPI G;  2YLS A;  3E1T A;  1OJT A;  1XAN A;  2JBV A;  2CUL A;  4XXG A;  4C74 A;  1GRT A;  1P43 A;  3V5F A;  1NG3 A;  4G7F A;  3QFB A;  1FO4 A;  1N62 C;  3CTY A;  4A65 A;  4J33 A;  5FMH A; 
#chains in the Genus database with same CATH homology
 4FX9 A;  3T0K A;  2E1M A;  2YG7 A;  1JRZ A;  1ZMC A;  3AEC A;  3AYI A;  2R9Z A;  5HXI A;  4YKG A;  2IVE A;  2C73 A;  4GCM A;  4IA5 A;  2YG4 A;  2C3D A;  2YM2 A;  1DOE A;  5J60 A;  2R45 A;  1L9D A;  3ALL A;  1S3E A;  2YR4 A;  3SXI A;  4AT0 A;  5FS6 A;  3ABV A;  3CN8 A;  3NNE A;  4RG4 A;  3IHG A;  3DK4 A;  3PS9 A;  3EPT A;  2VZ2 A;  3AD8 B;  2BK3 A;  1K0J A;  3DK8 A;  4B68 A;  4H4V A;  4G9K A;  4KPR A;  3FMW A;  2J3N A;  2Q0L A;  3ALJ A;  4J36 A;  4DSH A;  1L9E A;  3AEA A;  4YKF A;  5HYM A;  1PBD A;  2YLW A;  1K0L A;  4A79 A;  1H2I A;  1PJ6 A;  4B69 A;  3KLJ A;  5GRT A;  1KF6 A;  2GF3 A;  1GER A;  4B67 A;  1VRQ B;  1YY5 A;  3AB1 A;  1CHU A;  1D4E A;  4YTN A;  3ICR A;  5TR3 A;  3ZYX A;  1O5W A;  4U8N A;  1Y56 B;  4NWZ A;  2BA9 A;  5BUL A;  1TDK A;  2QAE A;  3CMM A;  4UDR A;  1RYI A;  3AD7 B;  4WX1 A;  1CJ3 A;  3LZX A;  4GDE A;  1FEB A;  2Y6R A;  1XPQ A;  2I0Z A;  2YLZ A;  3AE7 A;  4BUR A;  3NN6 X;  2XLU A;  1D4D A;  3II4 A;  1IUW A;  1DJQ A;  3QSM A;  5FS7 A;  2GR0 A;  3NK2 X;  4OVI A;  1JU2 A;  3AE5 A;  3NRN A;  1PXC A;  3DGH A;  4N9X A;  4H4Y A;  1CJ2 A;  4TLX A;  4TM3 A;  5L46 A;  1GXF A;  2YVG A;  3PVC A;  3NT6 A;  4E0V A;  4FK1 A;  3RP7 A;  2RGO A;  1CL0 A;  3P4Q A;  2NVK X;  3QVR A;  1GOS A;  2WDV A;  4GUV A;  4ZN0 A;  1SEZ A;  2ZBW A;  3QSS A;  3DJJ A;  1FOH A;  2XVJ A;  4NNJ A;  2X8H A;  1PBB A;  4G73 A;  4WCT A;  3QSE A;  2VRM A;  2BXS A;  3WE0 A;  1NAA A;  4BJY A;  2Q6U A;  2FJD A;  3UKF A;  1Z6L A;  2ZZB A;  1YQ3 A;  2C4C A;  5CKU A;  1ONF A;  3GWD A;  3SY4 A;  1L0V A;  2BYB A;  3F8D A;  3CGD A;  2BCG G;  2VQB A;  4IVM B;  4U2T A;  3G5S A;  3PG6 A;  5JCK A;  1NHQ A;  2XCG A;  3KA7 A;  4J56 A;  4EQS A;  2C67 A;  2BRY A;  1S2Q A;  4H50 A;  1E1L A;  2Z5Y A;  3K7M X;  3SX6 A;  2WU5 A;  3NKS A;  2PYX A;  4IVO B;  3IHM A;  2FBW A;  1BGN A;  1EL9 A;  1GRA A;  1OJ9 A;  2R0P A;  3H4K A;  1H84 A;  4NEW A;  1PXA A;  3AE3 A;  3B3R A;  1ZY8 A;  5EB5 A;  4Z26 A;  1ZDL A;  2GEW A;  2YR6 A;  1PN0 A;  1KSS A;  1E39 A;  1GRF A;  1GTE A;  2WET A;  3Q9T A;  4EIQ A;  3CPH G;  3UTE A;  4H4U A;  1N4U A;  3AEG A;  1N4W A;  2X50 A;  4APN A;  3S5W A;  1CF3 A;  2VVL G;  1RSG A;  2V61 A;  3GYJ A;  1LJ1 A;  3HYW A;  3NIX A;  4K5R A;  2GH5 A;  5M10 A;  1KN0 A;  1M6I A;  3LXD A;  1IJH A;  2YM1 A;  3F8P A;  4JY2 A;  3HYX A;  5DBJ A;  4BJZ A;  4BV6 A;  2XDO A;  2XVE A;  3H8L A;  3T2K A;  5KMR A;  2WHD A;  1BGJ A;  2WEU A;  4B63 A;  1CC2 A;  2Q0K A;  4XWZ A;  1GV4 A;  1ELI A;  2YG6 A;  1PHH A;  1TDN A;  2B9X A;  1W4X A;  4AT2 A;  4D04 A;  3DH9 A;  1F6M A;  5BUK A;  2FJE A;  3CGC A;  4I59 A;  2WPF A;  1IUV A;  1EBD A;  1PBE A;  3KPF A;  1F8R A;  4UDQ A;  3UTF A;  2FJB A;  5KVI A;  3BNM A;  4C3X A;  1K0I A;  1AOG A;  3O0H A;  3AYL A;  1GRH A;  5C3J A;  5IQ4 A;  1NHR A;  4PAA A;  1GEU A;  4EMW A;  3SGL A;  2UZZ A;  4UP3 A;  2B7R A;  1GRG A;  4G6H A;  1Y56 A;  1ZK7 A;  2R4J A;  3UTH A;  3QFA A;  5HY5 A;  1JEH A;  1EL5 A;  2GQF A;  3G5R A;  3CGB A;  4B66 A;  2X3N A;  3L5O A;  2V3A A;  4H4Q A;  1LVL A;  2R46 A;  3F8R A;  1ZX9 A;  3AE1 A;  1GPE A;  4C5O A;  3K7Q X;  3UP5 A;  4LU6 A;  3EAO A;  4A6N B;  2YG3 A;  5KXJ A;  4U2L A;  3SZC A;  2Q7V A;  2JB2 A;  4YT0 A;  2CFY A;  3LZW A;  3NTD A;  2IVD A;  1QLB A;  2WDQ A;  3NTA A;  1FEA A;  4H2N A;  4Z24 A;  4NEV A;  4H4R A;  4GAP A;  1PBC A;  4EIP A;  5KOW A;  3UP4 A;  2BS2 A;  2VQ7 A;  2EQ8 A;  1N4V A;  3UKH A;  3C4N A;  1OJC A;  4II2 A;  1VG0 A;  2GB0 A;  2BK4 A;  3GD3 A;  3COX A;  3GYX A;  1PJ5 A;  3AXB A;  2WU2 A;  1Q9I A;  1RP0 A;  4DNA A;  3ISH A;  4U8P A;  2H88 A;  1FEC A;  1QO8 A;  5GSN A;  1JNZ A;  4USR A;  2YQU A;  3HYV A;  3NK1 X;  2H89 A;  3DJD A;  2R4E A;  2OA1 A;  2EQ9 A;  4CY6 A;  3L1R A;  4A7A A;  3E1T A;  1D7Y A;  2XLR A;  5JRB A;  3IWA A;  1F3P A;  3AE8 A;  4GRT A;  1GTH A;  1L9C A;  2OLN A;  2R0C A;  3NYC A;  4XWR A;  4CBQ A;  1B5Q A;  4CRT A;  1VG9 A;  4H2P A;  4ECH A;  4JNQ A;  4H4W A;  1N1P A;  5HHF A;  4OPI A;  3GMC A;  4M52 A;  1PS9 A;  1B37 A;  1X31 B;  1IUU A;  3BHK A;  2WP5 A;  2V6O A;  4Y4L A;  5CQF A;  4II3 A;  3DME A;  2YVF A;  5BVA A;  1GT8 A;  4I58 A;  4J34 A;  3H8I A;  2XVF A;  2OAL A;  3DA1 A;  4G6G A;  3DK9 A;  1ZOV A;  3VQR A;  1VQW A;  4EM4 A;  4K7Z A;  1JRX A;  1JNR A;  4U2S A;  4OCG A;  2BS4 A;  1YQ4 A;  1E1N A;  4Z43 A;  3LJP A;  2ARD A;  1DJN A;  3ICS A;  3LOV A;  5KVH A;  1TRB A;  3DGZ A;  3ALM A;  3VRD B;  4OPC A;  4YSH A;  5IQ1 A;  4MJW A;  2W0H A;  1D7L A;  4REK A;  2F5Z A;  2VOU A;  3V3N A;  2XVH A;  1COY A;  3GMB A;  2AAQ A;  3V3O A;  3GYI A;  4C77 A;  1EL8 A;  3BNU A;  3FBS A;  3SYI A;  3CNP A;  5JCN A;  1H81 A;  1FL2 A;  3I6D A;  2GR2 A;  4Z2R A;  4JN9 A;  1IUT A;  3FIM B;  3ICT A;  2FJA A;  2GVC A;  1NDA A;  1NHS A;  2YAU A;  1EL7 A;  4YTM A;  4K22 A;  1LQT A;  2Z5X A;  5EB4 A;  1M64 A;  1ZMD A;  2OLO A;  4CY8 A;  4BK2 A;  3NLC A;  4EMJ A;  2VVM A;  3IF9 A;  4YSY A;  2BS3 A;  4RSL A;  4OPD A;  1GES A;  2WOW A;  1BKW A;  1NEK A;  4TLZ A;  4LA1 A;  4H2R A;  2XVI A;  3B6D A;  4A6N A;  1TYT A;  2X8G A;  4JNA A;  2JB3 A;  3P1W A;  4H4X A;  3GRT A;  1GND A;  2B9Y A;  2XFU A;  1E1K A;  1CBO A;  3VR9 A;  2O9Z A;  1F8W A;  1CC4 A;  4O5U A;  5BRT A;  3AEF A;  2GMJ A;  3K7T A;  1LV0 A;  4GAV A;  4P9S A;  4ICY A;  1O95 A;  1NPX A;  1H86 A;  3AED A;  2XFP A;  5KNL A;  3UKQ A;  4NTD A;  4YXD A;  3T14 A;  2IID A;  1D5T A;  4Z2T A;  1H82 A;  1NHP A;  4H2Q A;  3AWI A;  3AE2 A;  2B76 A;  5JCI A;  3P4S A;  4USQ A;  4IV9 A;  1TDF A;  4K8D A;  2AQJ A;  2C65 A;  3FPZ A;  4Y4M A;  4K2X A;  4J31 A;  3EF6 A;  4OPU A;  4AOX A;  4CCQ A;  1H6V A;  3NH3 X;  3EAN A;  2E4G A;  2BRA A;  4TM4 A;  2JKC A;  3NG7 X;  3T2Z A;  1Q1R A;  2RGH A;  3NHO X;  1ZKQ A;  2OAM A;  3CND A;  4HA6 A;  4AP1 A;  5J7X A;  3RED A;  3NN0 X;  1S2Y A;  3R9U A;  3M12 A;  2DKI A;  3NGC X;  4GF7 A;  4B1B A;  1ZP0 A;  2Y6Q A;  3KKJ A;  2C66 A;  1DNC A;  2GV8 A;  4G74 A;  3KPK A;  4B64 A;  5KOX A;  4BK1 A;  2APG A;  3KU9 A;  2JAE A;  3SM8 A;  3UOX A;  4OPG A;  3AE6 A;  2EQ7 A;  4X4J A;  4Y4N A;  3SZF A;  2C64 A;  1JRY A;  3OC4 A;  2YLR A;  3QVP A;  1Y0P A;  3GRS A;  2BXR A;  4CNJ A;  5KMS A;  2WS3 A;  1TDO A;  3JSK A;  3UCL A;  3UTG A;  3DJE A;  2GR3 A;  1DOC A;  1MXT A;  3ATQ A;  2V5Z A;  3BHF A;  2YLT A;  1NEN A;  2XLP A;  5U63 A;  2XFO A;  1HYU A;  4H4S A;  3CNJ A;  2B7S A;  4U8K A;  1P2E A;  3UOZ A;  2PHH A;  2CVJ A;  4HB9 A;  3S61 A;  3T37 A;  3D8X A;  2VRL A;  3SFE A;  4YTP A;  2JB1 A;  5FS9 A;  5KRQ A;  2GAH B;  1PXB A;  2YWL A;  4TM0 A;  3GDP A;  3QJ4 A;  2TMD A;  3RNM A;  3C96 A;  1YQZ A;  1TYP A;  4H4P A;  3HZL A;  3OZ2 A;  4AP3 A;  1PBF A;  4A9W A;  4IA6 A;  2BAB A;  1LTX R;  1Q1W A;  5KMP A;  2ZZC A;  4YSX A;  4DGK A;  5LV9 A;  1UKV G;  3SFD A;  1TDE A;  3LAD A;  2ACZ A;  5M0Z A;  3UKA A;  4X9M A;  1OJA A;  3T2Y A;  3BI4 A;  2WES A;  1GSN A;  2X8C A;  2XLS A;  4GDP A;  3UOV A;  5C2T A;  2TPR A;  1H7X A;  3VRA A;  4DSG A;  3UOY A;  5IPY A;  1PDH A;  1B4V A;  2QCU A;  2WDR A;  4EQW A;  2BC1 A;  3P4P A;  2RGJ A;  1IUS A;  1D4C A;  3G5Q A;  1GRE A;  2E5V A;  3AYJ A;  1VDC A;  3RP6 A;  3RP8 A;  2GAG B;  2HQM A;  5JCM A;  1O94 A;  2WP6 A;  2WP9 A;  1CC6 A;  4ZCD A;  1FCD A;  1V59 A;  5U25 A;  2A8X A;  1B8S A;  2C72 A;  1GET A;  1K4Q A;  1S3B A;  1DOD A;  4EQR A;  2C3C A;  1CJC A;  4YWO A;  3AE4 A;  3CIR A;  3BI2 A;  2JK6 A;  2GQW A;  1YKJ A;  1H83 A;  3FG2 P;  2C76 A;  1KSU A;  3CNT A;  3K30 A;  2BC0 A;  3CPJ G;  3ZDN A;  3SQP A;  2CDU A;  2R0G A;  4JY3 A;  5U1O A;  2WOI A;  4U8O A;  1BZL A;  4U8I A;  1MOK A;  1XDI A;  4PAB A;  2V3B A;  4U8M A;  4LII A;  4X9N A;  3NK0 X;  1S7M A;  4RG3 A;  1H7W A;  1QJD A;  4O5Q A;  3BI5 A;  3M0O A;  4B65 A;  3VRB A;  3KVE A;  2XYO A;  1REO A;  4Z25 A;  3DJG X;  3GD4 A;  3KD9 A;  3NYF A;  1NG4 A;  3C4A A;  3AEB A;  4CCR A;  1DXL A;  1LQU A;  4FDC B;  1KFY A;  4OPL A;  2YG5 A;  5FS8 A;  2AR8 A;  2YR5 A;  2YVJ A;  3D9X A;  1CJ4 A;  1BWC A;  3D1C A;  3ATR A;  4NTC A;  4GR1 A;  4J57 A;  4EMI A;  3AD9 B;  4JQ9 A;  3CNS A;  2X99 A;  2QA2 A;  1BF3 A;  2WOV A;  2C7G A;  4Z44 A;  2EQ6 A;  3T31 A;  3L8K A;  2QA1 A;  3ITJ A;  1XHC A;  5EBK A;  4CNK A;  4D03 A;  4ADW A;  4EM3 A;  4KX6 A;  1KDG A;  3Q6J A;  4A5L A;  4H4Z A;  3IC9 A;  4A99 A;  3P9U A;  4NTE A;  2XFN A;  1E6E A;  4K5S A;  2BCP A;  2RAB A;  5JCL A;  3LB8 A;  2WBA A;  1JOA A;  2BK5 A;  1E1M A;  3UKP A;  1PJ7 A;  4BK3 A;  3PO7 A;  3CGE A;  4JDR A;  3P4R A;  5KMQ A;  3UKL A;  1IUX A;  3GDN A;  4UDP A;  3V76 A;  2GR1 A;  2DKH A;  5ER0 A;  1E7P A;  1F8S A;  3VR8 A;  2BAC A;  4J2W A;  2WQY A;  4C3Y A;  4ZCC A;  5KWF A;  3I3L A;  3URH A;  1ZOY A;  2B9W A;  2YLX A;  4FK1 C;  3CPI G;  2A89 A;  2C75 A;  4H4T A;  4Z2U A;  1GAL A;  2GMH A;  1OJT A;  1XAN A;  1DOB A;  2JBV A;  2XLT A;  2YLS A;  2XFQ A;  2CUL A;  2GRT A;  4XXG A;  3M13 A;  4C74 A;  3SZ0 A;  1GRT A;  1MO9 A;  2ZZ0 A;  4EQX A;  2A87 A;  2NPX A;  2VVL A;  2WPE A;  1NG3 A;  5EOW A;  2V60 A;  1GRB A;  1KNP A;  3QFB A;  3RHA A;  4U8J A;  3SZW A;  3CTY A;  3GWF A;  2C70 A;  3AEE A;  4AOS A;  2WPC A;  3GSI A;  4A65 A;  4J33 A;  4YSZ A;  3AE9 A;  4TM1 A;  1P2H A;  1LPF A;  3UKK A;  1KNR A;  4U8L A;  5FMH A;  3ADA B;  3NYE A;  4H7U A;  4OPT A;  4NZH A;  1OJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...