1XDIA

Crystal structure of lpda (rv3303c) from mycobacterium tuberculosis
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
465
structure length
459
Chain Sequence
VTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFHKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of a New Member of the Flavoprotein Disulfide Reductase Family of Enzymes from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords Rv3303c-lpdA
total genus 142
structure length 459
sequence length 465
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2004-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF04820 Trp_halogenase Tryptophan halogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1xdiA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xdiA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xdiA02
1FOHA 1ZMCA 1YQ4A 3B6DA 2OALA 3AYJA 4Y4LA 3UKFA 3UOZA 4UDRA 4B69A 3I3LA 5M0ZA 3AEFA 4YKGA 4B1BA 4U2TA 1E7PA 2B9XA 2JB2A 3DJJA 3L8KA 2BS3A 4GCMA 4EIPA 3RHAA 4YSXA 1GRAA 2ACZA 2XLRA 3LZXA 1L9CA 2GV8A 1S3BA 5EB5A 3B3RA 4EQSA 4EQXA 1PBFA 4CCQA 4BV6A 1RP0A 1P2EA 4H50A 4NZHA 1PXCA 4EMJA 1MO9A 5EBKA 1OJAA 2RABA 2VRMA 1BWCA 1D5TA 2JKCA 4GRTA 5DBJA 4USRA 3M13A 5L46A 3M12A 3SM8A 4C74A 3AECA 4LIIA 2WU5A 2XFPA 4K2XA 3ALJA 4H2NA 2QAEA 4JQ9A 1VG9A 3NKSA 1IUXA 1D4EA 2R46A 4EQWA 3ISHA 1ZOYA 4TLZA 4A79A 4U8MA 1GERA 2X3NA 3SGLA 3ATRA 5TR3A 4DGKA 1CF3A 2CULA 3G5QA 5GSNA 4UDQA 3H8LA 1B37A 2OLOA 5FS8A 5C2TA 1BGJA 1ZY8A 5KRQA 1IUVA 3PS9A 3ZYXA 2X8CA 2X8GA 1PBCA 4UDPA 4D04A 1H7XA 1KNPA 4DSHA 3DK4A 1EL7A 4J57A 3NLCA 3NT6A 1H6VA 1Y56B 1BKWA 1PS9A 4H2RA 4AP1A 1XANA 3E1TA 2BABA 2WP9A 1O5WA 4H4UA 4XXGA 3UKLA 3COXA 2R4JA 4JN9A 1ZOVA 2V6OA 3QSSA 5EB4A 3H8IA 4H4SA 1TYTA 3KU9A 2B9WA 5FMHA 3UTGA 4YTNA 3BHKA 2BK3A 1JU2A 1D7YA 2V60A 2R4EA 4X9NA 1D4DA 1YKJA 2EQ8A 1DJNA 1KSSA 1GRTA 5JCNA 2WETA 3AD9B 4OVIA 3VQRA 2WOIA 3IHMA 3UKQA 4H4XA 3VRAA 2QA2A 1QLBA 1S2YA 4ZCCA 5KOWA 2VVMA 5CKUA 1Z6LA 2IIDA 4U8OA 4B67A 4E0VA 4U2SA 3T37A 5HXIA 3UKKA 1H82A 2XVJA 2XYOA 4Z25A 5M10A 2E4GA 1NENA 2GR1A 2X8HA 2AR8A 1L9DA 2XFNA 1M6IA 5FS6A 3WE0A 2B7SA 1Q1RA 3IF9A 1DOEA 3NYEA 2YLSA 5IPYA 3CGDA 5KOXA 1FEBA 4Y4NA 1XPQA 2YG3A 5KWFA 2C73A 1DOBA 2EQ9A 5BVAA 3QFBA 1H7WA 4U8LA 2BCGG 4FX9A 1ZX9A 2YWLA 4A65A 3NYFA 3LXDA 5BUKA 1FL2A 1ZP0A 4FDCB 3K7TA 3PO7A 2WPCA 4IVMB 2GR2A 3V76A 1FCDA 4DSGA 5ER0A 3LADA 4RG4A 4IA6A 4TLXA 2A87A 4ICYA 4A5LA 4EMIA 2B9YA 2C67A 2YG4A 2GF3A 3GMBA 4Z2TA 3AE9A 1PJ5A 3LJPA 3KD9A 4USQA 4A6NB 1PN0A 4H4VA 4O5QA 3DGZA 1RYIA 2YLTA 2R0GA 4TM1A 2BYBA 2WDVA 1E1NA 2GH5A 3NGCX 2FJAA 2CFYA 4OPTA 4EM3A 1GV4A 1KSUA 2WOVA 3CGCA 4JNQA 2V5ZA 3AXBA 3S5WA 1MXTA 3LOVA 5JCIA 2X50A 3AE6A 1REOA 2WQYA 1F8SA 1NG4A 1GRGA 1M64A 2Y6QA 2XVFA 3C4NA 3AYIA 5IQ1A 4X9MA 1F3PA 3GD4A 4LA1A 3P9UA 4IV9A 2YLRA 3NN6X 3KKJA 3RP8A 4YSYA 1LPFA 2A8XA 3ADAB 1K0LA 3NK1X 5J7XA 3QVRA 2BC0A 4TM3A 3NK0X 1IUSA 1ZKQA 4K5SA 3NH3X 4YSHA 1FECA 4K8DA 2XCGA 3D1CA 1H83A 1KNRA 2BS2A 2CVJA 2WU2A 4AP3A 2OLNA 4OPGA 4U8JA 4B68A 1KF6A 4D03A 4U8KA 2A89A 3G5RA 1GALA 1JOAA 2WPFA 1GTEA 3P4RA 3UKAA 3UKHA 3VRDB 2DKHA 2Q6UA 5HY5A 2B7RA 2GRTA 2NPXA 1N4WA 3KLJA 3URHA 1NDAA 2EQ7A 2ZZ0A 4PABA 3UTHA 4C3XA 2NVKX 4I58A 4I59A 1S2QA 3EF6A 2X99A 4A99A 2XVHA 4YWOA 3BI2A 3CGBA 3CPIG 3GWFA 4NTEA 2BK4A 1QJDA 2V3BA 3V3OA 4Z43A 3R9UA 1GSNA 1ZMDA 1Q1WA 3C4AA 1DODA 4XWRA 3VR9A 3NG7X 4H2PA 2WHDA 3ALMA 1B8SA 3VRBA 4J31A 3IWAA 2Q0KA 2JBVA 1Q9IA 2HQMA 1CC2A 1YQ3A 4B65A 2GQWA 2XLSA 2YR6A 2WEUA 2XFOA 2YVFA 1CC4A 2H89A 4OPCA 1GOSA 3ZDNA 1GETA 3FIMB 2YM2A 1Y0PA 1TDEA 3CGEA 3DH9A 3H4KA 4J36A 1SEZA 1TDKA 4UP3A 4A6NA 4HB9A 2VZ2A 1K0IA 4J56A 2I0ZA 1PDHA 4A7AA 1NG3A 2YVGA 2F5ZA 4KPRA 3GMCA 2BXSA 1CJ4A 3ALLA 3P4QA 3GWDA 4Z44A 3AD7B 2BXRA 3ITJA 4GDPA 1L0VA 3DJGX 5GRTA 1K4QA 1OJ9A 5CQFA 3CNDA 4P9SA 4B66A 1NEKA 1XHCA 1GTHA 3AE7A 3AE8A 3P1WA 4BURA 4KX6A 3SFDA 3QVPA 1V59A 4IVOB 3S61A 1KFYA 1GRBA 2YM1A 2GB0A 3AB1A 5HHFA 2VOUA 3ABVA 4U8PA 3BI5A 4REKA 2PYXA 4YTPA 2XFQA 5LV9A 2R45A 2CDUA 1S3EA 2BK5A 3RP7A 1TYPA 2JK6A 3CTYA 3ICRA 4BJYA 4YKFA 4O5UA 1DXLA 1Y56A 3UP4A 5KVHA 3NN0X 4ZN0A 3AE1A 3CIRA 3Q6JA 1E39A 3KVEA 4X4JA 1ZDLA 4GF7A 2WP6A 3P4SA 4N9XA 3UKPA 1LJ1A 3K7QX 4OPIA 4WCTA 5HYMA 4ZCDA 3NYCA 1TDNA 1ONFA 3EANA 1GESA 2WPEA 3AEEA 4J33A 1KDGA 4YTMA 2WDRA 1OJDA 2TPRA 4K7ZA 1B5QA 3FMWA 2Q0LA 3RP6A 2WESA 2XFUA 4AT2A 3LB8A 1O95A 1PBDA 1PJ7A 3NTDA 1PBBA 1PHHA 1LV0A 2C66A 1NAAA 3FG2P 5U1OA 3DK8A 1ELIA 3ATQA 3UTEA 3DGHA 4LU6A 4C5OA 1P2HA 1E1KA 3GDPA 1NHQA 3KA7A 4NEWA 5JCMA 1GRFA 3AEAA 4Y4MA 2C65A 2RGOA 1DOCA 4B64A 2QCUA 1YQZA 3RNMA 4EQRA 2ZZBA 3F8PA 3DA1A 1GXFA 3GRSA 4BK3A 2Z5YA 2BC1A 4U8NA 3QFAA 4RG3A 1GEUA 3EAOA 2Q7VA 4K5RA 3DJEA 5FS7A 2YR4A 4AOXA 4U8IA 2C75A 3UCLA 4BJZA 4OCGA 3NK2X 2YG6A 3KPFA 2JB1A 3DJDA 2WS3A 3GDNA 2C64A 3GSIA 1N4UA 3GD3A 5JCLA 1N4VA 2YLZA 2E1MA 2BCPA 2R0CA 2WP5A 2V3AA 2YG7A 3M0OA 4TM4A 4CCRA 2GAHB 3K7MX 2VQ7A 1D4CA 3NHOX 4C77A 4OPDA 1VG0A 3BNMA 4HA6A 3NTAA 3REDA 1GRHA 2ARDA 2V61A 4JY3A 1CJCA 2Y6RA 4A9WA 4XWZA 2GVCA 3AWIA 4WX1A 4H4TA 2YG5A 1IJHA 4AT0A 2ZBWA 3AEDA 2H88A 2YR5A 4BK2A 1JRYA 5KXJA 4DNAA 2R0PA 4PAAA 3AE5A 4Z2RA 2ZZCA 1XDIA 1N1PA 4JNAA 1H81A 2GQFA 4OPLA 2JB3A 1JRZA 2RGHA 1EL9A 1E6EA 1O94A 2FJBA 2YVJA 4FK1A 1OJCA 3CNSA 1CC6A 2BACA 4OPUA 3BI4A 3UOYA 4H4WA 2C72A 1BF3A 4CY6A 2WBAA 2APGA 2GEWA 1K0JA 1EBDA 3VR8A 3CNJA 5BRTA 1DNCA 2GMJA 3Q9TA 1LQTA 4H4ZA 3QSEA 1W4XA 3CN8A 3V3NA 2WDQA 3OZ2A 4MJWA 3QJ4A 3FPZA 3GRTA 3QSMA 2GR0A 3CPHG 3JSKA 4CNJA 4YSZA 1ZK7A 5IQ4A 2R9ZA 5FS9A 3UOVA 3PVCA 3SQPA 1HYUA 1CJ2A 1H86A 1EL5A 2VVLG 1CJ3A 4K22A 3AEBA 3ICSA 4NTCA 3SFEA 3L1RA 1NHRA 3D8XA 2BA9A 2FJDA 3CNTA 2C7GA 4FK1C 1F8WA 1JNRA 2YLWA 3NRNA 4ADWA 1CHUA 1L9EA 3O0HA 3AE2A 3OC4A 2XDOA 4YXDA 1IUWA 4U2LA 4CBQA 3K30A 3NNEA 2GMHA 1COYA 2AAQA 1BGNA 1GNDA 1LVLA 1CL0A 1PJ6A 4EIQA 2FJEA 1VRQB 4J34A 1TDFA 4B63A 1JRXA 5KVIA 2XVEA 1F8RA 1NHPA 3IC9A 4Z26A 1UKVG 3FBSA 4NTDA 3CNPA 3P4PA 2BS4A 1E1MA 4CRTA 1MOKA 1AOGA 1OJTA 3AE3A 1PBEA 2JAEA 1PXBA 5U25A 3II4A 5BULA 3DMEA 4M52A 1H84A 1GPEA 1D7LA 2RGJA 2W0HA 4CNKA 2OAMA 4C3YA 1VQWA 4Z24A 3LZWA 2VQBA 2WOWA 5JCKA 4H7UA 2YLXA 4ECHA 4YT0A 5EOWA 4H4RA 3CPJG 1EL8A 5U63A 1DJQA 4EM4A 2GR3A 1NPXA 1IUUA 1GT8A 4Z2UA 1FEAA 3AD8B 2Z5XA 5J60A 1PXAA 1B4VA 1JEHA 3HZLA 2DKIA 2XLUA 2XVIA 2C70A 2VVLA 3NIXA 2IVDA 3AYLA 2TMDA 3AEGA 1X31B 1E1LA 2O9ZA 4GR1A 1YY5A 3I6DA 3AE4A 1NHSA 4H4YA 3GYJA 4H4QA 1VDCA 2J3NA 2FBWA 3ICTA 4IA5A 2C3DA 2IVEA 4JDRA 2C3CA 4RSLA 3GYIA 4EMWA 3IHGA 4TM0A 2GAGB 1TRBA 3G5SA 1QO8A 1F6MA 1LQUA 2YQUA 4NEVA 4CY8A 2C76A 2E5VA 1IUTA 1JNZA 3UTFA 4GUVA 4J2WA 2YAUA 4GDEA 4JY2A 2EQ6A 2XLPA 4H4PA 2OA1A 3UOXA 2XLTA 3BHFA 3F8DA 3BNUA 1BZLA 1TDOA 1RSGA 3F8RA 1CBOA 3UP5A 4APNA 2VRLA 2QA1A 3DK9A 1LTXR 4BK1A 5C3JA 2B76A 2PHHA 3EPTA 4AOSA 2AQJA 3C96A 2UZZA 4H2QA 1GREA
chains in the Genus database with same CATH superfamily
1ZMCA 4UDRA 4B69A 3I3LA 2XH0A 2B9XA 3DJJA 4GCMA 4YSXA 2PA6A 5EB5A 3B3RA 4EQSA 4CCQA 4BV6A 4H50A 3PWGA 4GRTA 2DW7A 3MKCA 3M13A 3AECA 4LIIA 3ZVHA 2WU5A 4K2XA 4DX3A 1FHVA 3ISHA 3ES7A 4U8MA 2PTWA 5FS8A 3GY1A 2GDQA 1ZY8A 5KRQA 4UDPA 4D04A 1H7XA 4DSHA 3NT6A 2PMQA 1H6VA 1BKWA 4AP1A 4H2RA 1XANA 1O5WA 4XXGA 4JN9A 3QSSA 4H4SA 1TYTA 3VC5A 5FMHA 3UTGA 4FP1A 3NZGA 2R4EA 2EQ8A 3JW7A 3AD9B 3VQRA 2WOIA 1XPYA 3VRAA 2QA2A 1S2YA 5KOWA 3ENLA 4B67A 1H82A 1V97A 2XFNA 1M6IA 3T0KA 2PGWA 2YLSA 3CGDA 1FEBA 3TJIA 5KWFA 2C73A 4U8LA 1FL2A 3A7UA 3R10A 4FDCB 3MSYA 3PO7A 2GR2A 3V76A 3UXLA 1FCDA 3VCNA 2PODA 4RG4A 4ROPA 4EMIA 2B9YA 3L5OA 4USQA 4A6NB 4GYPA 5G5GB 2BYBA 2FJAA 1P48A 1GV4A 2WOVA 3CGCA 3S5WA 3LOVA 2HXTA 5JCIA 2X50A 1F8SA 1GRGA 1M64A 3ZLFA 3BJSA 1F3PA 3KKJA 4YSYA 3ADAB 1KKOA 3DFYA 3JVAA 3SN1A 1SJBA 4AP3A 4B68A 1KF6A 4D03A 1SJDA 3UKAA 4ZA0A 2B7RA 1N4WA 1NDAA 4C3XA 4G6GA 3BI2A 1E9IA 3CPIG 2PS2A 2BK4A 3V3OA 3T2ZA 4H2PA 3ALMA 4J31A 3IWAA 2JBVA 4B65A 2E3TA 2YVFA 1MNSA 3SZCA 3H4KA 4J36A 1JRPA 5KMQA 4GYPC 3ALLA 1XS2A 5GRTA 3ZVHB 1EC7A 4B66A 1GTHA 3SFDA 4E8GA 3DGBA 4IP5A 3NFUA 4A3RA 2PYXA 4YTPA 5LV9A 2R45A 1WYGA 5FJTA 3UP4A 3AE1A 3CIRA 3Q6JA 1ZDLA 4H19A 4WCTA 1ONFA 2WPEA 5KMPA 2XFUA 4AT2A 3SXIA 1LV0A 4DYEA 4C5OA 4KEMA 3A7AA 1RM6B 4IL0A 4NEWA 5JRBA 2C65A 1YQZA 3RNMA 2ZZBA 1GXFA 3IJIA 1BQGA 4RG3A 3V4BA 4K5RA 2YR4A 2YG6A 3GDNA 1N4UA 3GD3A 2V3AA 4CCRA 2GAHB 2VQ7A 4C77A 3BNMA 4HA6A 3REDA 1GRHA 3DG3A 1VQZA 3AWIA 4WX1A 2PP0A 1FFUC 3SN4A 2XH4A 3AE5A 3CYJA 1H81A 1EC8A 3STPA 1WUFA 1JRZA 2C4CA 1E6EA 4FK1A 3QPEA 1CC6A 2BACA 4OPUA 3T14A 2GEWA 1K0JA 3CNJA 3QSEA 4MJWA 1S7MA 1ZK7A 1YEYA 5IQ4A 1FIQB 2GGGA 4K22A 4ZCWA 3AEBA 4YWSA 4DXKA 4U2LA 5KMRA 4CBQA 3NNEA 1PJ6A 2OFJA 2XVEA 3P3BA 4X2PA 3FBSA 2PGEA 1OJTA 3AE3A 1PBEA 2JAEA 5U25A 3JZUA 4DHGA 1D7LA 4C3YA 2VQBA 4H7UA 3R07C 4H4RA 1DJQA 4EM4A 5J60A 1PXAA 4IT1A 1B4VA 1JEHA 3NO1A 3HZLA 2DKIA 2XLUA 2C70A 3AYLA 1JROA 2TMDA 1X31B 1VDCA 3H70A 2C3CA 2FYMA 3G5SA 1QO8A 1F6MA 2PP1A 5ENLA 3QTPA 1JNZA 2YAUA 4JY2A 2XLPA 2OA1A 3UOXA 3BHFA 1BZLA 1TDOA 1RSGA 3TQPA 4APNA 2VRLA 2QA1A 3DK9A 3AN1A 4H2QA 1GREA 3B6DA 2OALA 3UKFA 3AEFA 4U2TA 1E7PA 2JB2A 2BS3A 1L9CA 2GV8A 1PBFA 1RP0A 3OZYA 1PXCA 1MO9A 3I4KA 5EBKA 2MNRA 2VRMA 1BWCA 1D5TA 2JKCA 4USRA 5L46A 3M12A 4C74A 3MY9A 4H2NA 2QAEA 4JQ9A 1IUXA 4TLZA 1GERA 1VDVA 2XH2A 3ATRA 4JN7A 4DGKA 5GSNA 1B37A 5C2TA 2PTZA 4GISA 3ZLHA 2X8GA 3NLCA 1Y56B 3E1TA 1N5XA 2BABA 3COXA 1ZOVA 2V6OA 4Z1YA 4G6HA 2B9WA 4YTNA 3BHKA 2BK3A 1D7YA 1D4DA 1YKJA 4E6MA 5JCNA 2WETA 3CK5A 4ZCCA 2VVMA 1Z6LA 2IIDA 3DESA 4U2SA 1ONEA 2OQHA 3UKKA 5HXIA 4Z25A 5M10A 3UCCA 2GR1A 2OG9A 1W6TA 5FS6A 1DOEA 5IPYA 3U4FA 4Y4NA 1DOBA 2EQ9A 3QFBA 2BCGG 4A65A 3NYFA 3LXDA 2GGHA 3ES8A 2P8CA 4DSGA 5ER0A 3LADA 3CXOA 3PFRA 4TLXA 2A87A 1N61C 4Z2TA 3AE9A 1PN0A 2YLTA 1L8PA 2R0GA 2WDVA 3NGCX 3TCSA 3A7RA 1KSUA 5BOFA 1MXTA 2RDXA 1KD0A 3FXGA 3AYIA 5IQ1A 3RP8A 3OP2A 3NK1X 2BC0A 4TM3A 3NVVB 3OW1A 1IUSA 3GD6A 2XCGA 3D1CA 1KNRA 2BS2A 4OPGA 4U8KA 1GTEA 2GGJA 2OZTA 3V5CA 2MUCA 2GRTA 3KLJA 4PABA 2NVKX 3SX6A 4I58A 1S2QA 1NELA 3EF6A 4A35A 4YWOA 3CGBA 2PTYA 3GWFA 2V3BA 3R9UA 2W3RA 3N4EA 1ZMDA 3T4WA 3UJRA 1RVKA 3VR9A 3NRZB 2H89A 1Y0PA 3AMZA 4UP3A 1JDFA 2BRAA 4HCDA 3GMCA 3P4QA 4Z44A 4GDPA 1TZZA 3DJGX 1OJ9A 1R0MA 3T6CA 1NEKA 2AL2B 3AE8A 3P1WA 4KX6A 4NNJA 2AL2A 1V59A 4IVOB 3AB1A 2XFQA 2CDUA 1S3EA 2BK5A 3RP7A 4G73A 1TYPA 4O5UA 3HRDC 4ZN0A 3KVEA 2P3ZA 2WP6A 4DWDA 1LJ1A 3K7QX 4OPIA 5HYMA 3EANA 3N6JA 1KDGA 4YTMA 1OJDA 1B5QA 3FMWA 2Q0LA 2WESA 1PHHA 2C66A 3UJEA 3FG2P 5U1OA 3S5SA 2QDEA 1F9CA 1NHQA 3KA7A 4MGGA 5JCMA 1GRFA 3AEAA 4EQRA 3EKGA 4HCHA 3F8PA 3GRSA 2BC1A 3B97A 2AL1A 5FS7A 3OZMA 7ENLA 3UGVA 3NK2X 5JCLA 2YG7A 4TM4A 3NHOX 1VG0A 4GAPA 2V61A 2Y6RA 3SQSA 4XWZA 2GVCA 2I5QA 1FFVC 4H4TA 2YG5A 1IJHA 2ZBWA 4BK2A 2YR5A 5KXJA 4DNAA 1PDYA 4Z2RA 1XDIA 2PU0A 5EU9A 1N1PA 4OPLA 1EL9A 3IK4A 2FJBA 2YVJA 1OJCA 3DIPA 3UOYA 4K8GA 2C72A 4CY6A 4A6GA 4JHMA 5BRTA 3Q9TA 3CN8A 3OZ2A 3FPZA 2OKTA 3JSKA 4YSZA 2R9ZA 5FS9A 3UOVA 3PVCA 1HYUA 1H86A 3GO2A 4NTCA 2CHRA 2FJDA 3CNTA 4FK1C 1F8WA 4ADWA 2P0IA 2XDOA 1IUWA 3I6TA 1ECQA 3K30A 2QJJA 2OZ3A 1COYA 1BGNA 1CL0A 1VRQB 1TDFA 4B63A 5KVIA 3EUB3 3IC9A 4Z26A 3T8QA 4NTDA 2P8BA 3UJ2A 3P93A 1UKVG 3TJ4A 3P4PA 3PG6A 1PXBA 5BULA 4CNKA 1VQWA 2GL5A 2WOWA 3PK7A 4ECHA 2YLXA 4II2A 1EL8A 5U63A 4Z2UA 2PPGA 2Z5XA 3RRAA 2VVLA 2IVDA 1TKKA 2O9ZA 1YY5A 2HXUA 4HYRA 4H4YA 4H4QA 3ICTA 4IA5A 3MZNA 3VDGA 4TM0A 2YQUA 1IUTA 4GUVA 3CT2A 4GDEA 3F8DA 1CBOA 4AOSA 3I6DA 1FOHA 4Y4LA 3UOZA 3UXKA 5M0ZA 2QJMA 4YKGA 4B1BA 4EWJA 3L8KA 1KCZA 4EIPA 3RHAA 2OLAA 1GRAA 3Q45A 2ACZA 4E4FA 2XLRA 1OJAA 1IYXA 3FVDA 3T2KA 3IJQA 3SM8A 3NS1B 3H7VA 3GC2A 1EC9A 1D4EA 4A79A 1KKRA 2X3NA 5TR3A 1CF3A 2CULA 3G5QA 4TVYA 4UDQA 3THUA 4IZGA 1IUVA 1ELSA 2PCEA 1KNPA 3DK4A 3FJ4A 1EL7A 2FKPA 2HZGA 1PS9A 4H4UA 5EB4A 1X2GA 3DG7A 3KU9A 1JU2A 2V60A 4X9NA 1DJNA 2W3SA 1GRTA 4OVIA 3IHMA 4H4XA 3PWIA 5CKUA 3U9IA 2QJNA 3N6HA 3T37A 3SR6B 2X8HA 2AR8A 4GMEA 4HN8A 3NYEA 1N5WC 2ZADA 2YG3A 2OQYA 1EBGA 1H7WA 3NVWB 1ZX9A 1WUEA 5BUKA 4IVMB 4IHCA 3RR1A 1MDLA 4ENLA 4ICYA 4A5LA 3GMBA 3V3WA 3LJPA 1PJ5A 3KD9A 4H4VA 3DGZA 2BRYA 4TM1A 2AKZA 3AXBA 3SZ0A 4MKSA 3AE6A 2WQYA 1NG4A 2Y6QA 2XVFA 3P9UA 4LA1A 4IV9A 2YLRA 1LPFA 2A8XA 1K0LA 3QVRA 1ZKQA 3HYWA 5FJPA 3SZFA 2WU2A 4KWSA 5FJUA 3P4RA 1GALA 1JOAA 2WPFA 3UKHA 3VRDB 5HY5A 4I59A 2X99A 4A99A 1QJDA 4Z43A 1GSNA 4XWRA 3C4AA 1DODA 2WHDA 3FYYA 2Q0KA 1Q9IA 1CC2A 2NQLA 3HYVA 3DG6A 3ZDNA 3FIMB 2YM2A 1TDEA 3DH9A 4II3A 3KUMA 1SEZA 4A6NA 2VZ2A 1K0IA 3SZWA 4J56A 3K1GA 2I0ZA 4A7AA 1NG3A 2YVGA 2F5ZA 3VC6A 2BXSA 1CJ4A 3AD7B 2HNEA 1K4QA 3HW2A 5CQFA 4P9SA 4GAVA 1XHCA 3AE7A 3BSMA 3S61A 1KFYA 1GRBA 2GB0A 3H12A 2VOUA 3ABVA 4REKA 4BJYA 2JK6A 3CTYA 5KVHA 3BOXA 3DERA 4X4JA 4GF7A 1GESA 1MDRA 3AEEA 2WDRA 2TPRA 3ZVIA 1PJ7A 3R0UA 1NAAA 3MQTA 3UTEA 2OO6A 3DGHA 1P2HA 1R6WA 1FO4A 4J1OA 4B64A 3IJLA 2RGOA 4Y4MA 3DA1A 4BK3A 2Z5YA 1BKHA 3DJEA 3CMMA 3UCLA 4BJZA 4OCGA 2JB1A 3DJDA 1N4VA 2E1MA 2BCPA 2R0CA 2WP5A 3M0OA 1H2IA 2PTXA 4OPDA 2QQ6A 3MWCA 1CJCA 4A9WA 3QLDA 4GIRA 3AEDA 1JRYA 2R0PA 4PAAA 4JNAA 4M0XA 4GFIA 3UJSA 2RGHA 6ENLA 2W54A 3R1ZA 3T2YA 3BI4A 4H4WA 3R11A 2WBAA 1MRAA 2APGA 3VR8A 1DNCA 2XH7A 4M6UA 3CXBA 1W4XA 3V3NA 3QJ4A 3QSMA 4HNLA 3D47A 2VVLG 3ICSA 3SFEA 1NHRA 3T9PA 3SBFA 3NRNA 2YLWA 1CHUA 3AE2A 3OC4A 4YXDA 2GMHA 2ZC8A 1LVLA 4EIQA 1SB3B 3VCCA 4J34A 2GSHA 1JRXA 1F8RA 3CNPA 4MMWA 4CRTA 3CB3A 1FHUA 4TVWA 2O56A 3DMEA 2OAMA 4JN8A 5KNLA 4Z17A 2E5AA 4YT0A 2PU1A 5EOWA 4HCLA 1NPXA 1GT8A 3S47A 2XVIA 2OVLA 1N63C 4GR1A 3GYJA 2C3DA 2IVEA 4JDRA 4RSLA 3GYIA 2GAGB 1LQUA 3UTFA 4J2WA 3B9JB 3TWAA 4H4PA 3UP5A 3F8RA 4K2SA 1LTXR 5C3JA 2B76A 3SY4A 4FI4A 5FJRA 3DEQA 1YQ4A 1JCTA 3AYJA 4G9KA 3QN3A 3LZXA 2OPJA 3FCPA 1S3BA 4EQXA 1P2EA 5J04A 4NZHA 1KN0A 4EMJA 2RABA 5DBJA 3MUCA 1TE6A 2XFPA 2AKMA 3ALJA 1VG9A 3NKSA 4HNCA 2R46A 4EQWA 1ZOYA 3SGLA 3H8LA 2OLOA 3Q4DA 2ONEA 1BGJA 3PS9A 3ZYXA 2X8CA 1PBCA 1EBHA 3D9XA 4J57A 4IL2A 4G74A 3TTEA 4H2HA 3UKLA 2WP9A 2R4JA 3H8IA 2XSXA 1NU5A 1OEPA 3CAWA 3I6EA 1KSSA 3KPKA 1MUCA 3UKQA 1QLBA 4E0VA 4U8OA 3SN0A 2XYOA 2XVJA 2E4GA 1NENA 3VA8A 1L9DA 3UJFA 3WE0A 3TOYA 2B7SA 1Q1RA 3IF9A 5KOXA 4DN1A 2QDDA 1XPQA 5FJOA 2PP3A 5BVAA 3VFCA 3RITA 4FX9A 2YWLA 4E5TA 1ZP0A 3K7TA 2GGIA 2WPCA 1T3QC 3SJNA 4IA6A 1JPDX 2XGZA 2C67A 2YG4A 2POZA 2GF3A 3HYXA 3RO6A 4O5QA 3HPFA 1RYIA 3N4FA 1E1NA 2GH5A 2CFYA 3NVYB 4OPTA 4EM3A 3TW9A 4JNQA 2V5ZA 3NXLA 1REOA 3C4NA 1P43A 3GD4A 4X9MA 3NN6X 3SSZA 2OX4A 5J7XA 3NK0X 5BOEA 4K5SA 3NH3X 4YSHA 1FECA 3P0WA 4K8DA 1H83A 2CVJA 1N62C 3AM9A 2OLNA 4U8JA 2A89A 3G5RA 2QVHA 2DKHA 2Q6UA 2NPXA 3URHA 4NWZA 3GYXA 2EQ7A 2ZZ0A 3UTHA 3ETRB 1N60C 3R0KA 2XVHA 4NTEA 1Q1WA 3NG7X 1B8SA 3V5FA 3VRBA 2HQMA 1YQ3A 2GQWA 2XLSA 1DTNA 2YR6A 2WEUA 2XFOA 1CC4A 4OPCA 1GOSA 3DDMA 1GETA 3CGEA 1TDKA 4HB9A 1PDHA 4KPRA 3UCDA 1L0VA 3GWDA 3OTRA 2BXRA 3ITJA 4IP4A 3CNDA 4BURA 3QVPA 1JPMA 2YM1A 5HHFA 4U8PA 3BI5A 2GGEA 3SYIA 3ICRA 4YKFA 1DXLA 1Y56A 3NN0X 3RCYA 3D46A 3RGTA 1E39A 3P4SA 4N9XA 3UKPA 1SJAA 4ZCDA 3NYCA 1TDNA 3OPSA 2W55A 3ZLGA 4J33A 4J3ZA 4K7ZA 3RP6A 3LB8A 1O95A 1PBDA 3NTDA 1PBBA 4HPNA 3DK8A 1ELIA 3ATQA 4LU6A 1E1KA 3GDPA 4H1ZA 1DOCA 2QCUA 4U8NA 3QFAA 1GEUA 3EAOA 2Q7VA 4AOXA 4U8IA 2C75A 1SJCA 3KPFA 2WS3A 3GSIA 2C64A 4E4UA 2YLZA 3K7MX 1D4CA 4K1WA 2QGYA 3NTAA 2ARDA 4JY3A 4G8TA 4AT0A 2H88A 4KPLA 5G5HB 2ZZCA 2GQFA 2JB3A 4GGHA 1O94A 3CNSA 5IDZA 1BF3A 4F4RA 2P88A 1EBDA 2GMJA 1LQTA 4H4ZA 2WDQA 1PDZA 3DFHA 3GRTA 2GR0A 3CPHG 4H83A 4CNJA 2PSNA 3SQPA 1CJ2A 1EL5A 1CJ3A 3L1RA 3D8XA 2BA9A 2C7GA 1JNRA 1L9EA 3O0HA 2AAQA 3H8AA 1GNDA 2FJEA 3NVZB 1NHPA 2BS4A 1E1MA 1MOKA 1AOGA 1ZXIC 3II4A 4M52A 3R25A 1H84A 4G7FA 3FV9A 1GPEA 2RGJA 2W0HA 3T31A 4Z24A 3LZWA 5JCKA 2DW6A 1STZA 3CPJG 4GGBA 2GR3A 1IUUA 1FEAA 3AD8B 1X2HA 5KMSA 3NIXA 3AEGA 1E1LA 3AE4A 4ZOHB 1NHSA 3QKEA 2FBWA 2J3NA 4EMWA 3IHGA 1TRBA 2OZ8A 4NEVA 4CY8A 2C76A 2E5VA 2EQ6A 2XLTA 3BNUA 3EEZA 3TWBA 4KT2A 4BK1A 2PHHA 3EPTA 2AQJA 3C96A 2UZZA
chains in the Genus database with same CATH topology
1FOHA 1ZMCA 1YQ4A 3B6DA 2OALA 3AYJA 4Y4LA 3UKFA 3UOZA 4UDRA 4G9KA 4B69A 3I3LA 5M0ZA 3AEFA 4YKGA 4B1BA 4U2TA 1E7PA 2B9XA 2JB2A 3DJJA 3L8KA 2BS3A 4GCMA 4EIPA 3RHAA 4YSXA 1GRAA 2ACZA 2XLRA 3LZXA 1L9CA 2GV8A 1S3BA 5EB5A 3B3RA 4EQSA 4EQXA 1PBFA 4CCQA 4BV6A 1RP0A 1P2EA 4H50A 4NZHA 1PXCA 1KN0A 4EMJA 1MO9A 5EBKA 1OJAA 2RABA 2VRMA 1BWCA 1D5TA 2JKCA 3T2KA 4GRTA 5DBJA 4USRA 3M13A 5L46A 3M12A 3SM8A 4C74A 3AECA 4LIIA 2WU5A 2XFPA 4K2XA 3ALJA 4H2NA 2QAEA 4JQ9A 1VG9A 3NKSA 1IUXA 1D4EA 2R46A 4EQWA 3ISHA 1ZOYA 4TLZA 4A79A 4U8MA 1GERA 2X3NA 3SGLA 3ATRA 5TR3A 4DGKA 1CF3A 2CULA 3G5QA 5GSNA 4UDQA 3H8LA 1B37A 2OLOA 5FS8A 5C2TA 1BGJA 1ZY8A 5KRQA 1IUVA 3PS9A 3ZYXA 2X8CA 2X8GA 1PBCA 4UDPA 4D04A 1H7XA 1KNPA 3D9XA 4DSHA 3DK4A 1EL7A 4J57A 3NLCA 3NT6A 1H6VA 1Y56B 4G74A 1BKWA 1PS9A 4H2RA 4AP1A 1XANA 3E1TA 2BABA 2WP9A 1O5WA 4H4UA 4XXGA 3UKLA 3COXA 2R4JA 4JN9A 1ZOVA 2V6OA 3QSSA 5EB4A 3H8IA 4H4SA 1TYTA 3KU9A 4G6HA 2B9WA 5FMHA 3UTGA 4YTNA 3BHKA 2BK3A 1JU2A 1D7YA 2V60A 2R4EA 4X9NA 1D4DA 1YKJA 2EQ8A 1DJNA 1KSSA 1GRTA 5JCNA 2WETA 3KPKA 3AD9B 4OVIA 3VQRA 2WOIA 3IHMA 3UKQA 4H4XA 3VRAA 2QA2A 1QLBA 1S2YA 4ZCCA 5KOWA 2VVMA 5CKUA 1Z6LA 2IIDA 4U8OA 4B67A 4E0VA 4U2SA 3T37A 5HXIA 3UKKA 1H82A 2XVJA 2XYOA 4Z25A 5M10A 2E4GA 1NENA 2GR1A 2X8HA 2AR8A 1L9DA 2XFNA 1M6IA 5FS6A 3T0KA 3WE0A 2B7SA 1Q1RA 3IF9A 1DOEA 3NYEA 2YLSA 5IPYA 3CGDA 5KOXA 1FEBA 4Y4NA 1XPQA 2YG3A 5KWFA 2C73A 1DOBA 2EQ9A 5BVAA 3QFBA 1H7WA 4U8LA 2BCGG 4FX9A 1ZX9A 2YWLA 4A65A 3NYFA 3LXDA 5BUKA 1FL2A 1ZP0A 4FDCB 3K7TA 3PO7A 2WPCA 4IVMB 2GR2A 3V76A 1FCDA 4DSGA 5ER0A 3LADA 4RG4A 4IA6A 4TLXA 2A87A 4ICYA 4A5LA 4EMIA 2B9YA 2C67A 2YG4A 2GF3A 3GMBA 3HYXA 3L5OA 4Z2TA 3AE9A 1PJ5A 3LJPA 3KD9A 4USQA 4A6NB 1PN0A 4H4VA 4O5QA 3DGZA 1RYIA 2YLTA 2R0GA 2BRYA 4TM1A 2BYBA 2WDVA 1E1NA 2GH5A 3NGCX 2FJAA 2CFYA 4OPTA 4EM3A 1GV4A 1KSUA 2WOVA 3CGCA 4JNQA 2V5ZA 3AXBA 3S5WA 3SZ0A 1MXTA 3LOVA 5JCIA 2X50A 3AE6A 1REOA 2WQYA 1F8SA 1NG4A 1GRGA 1M64A 2Y6QA 2XVFA 3C4NA 3AYIA 5IQ1A 4X9MA 1F3PA 3GD4A 4LA1A 3P9UA 4IV9A 2YLRA 3NN6X 3KKJA 3RP8A 4YSYA 1LPFA 2A8XA 3ADAB 1K0LA 3NK1X 5J7XA 3QVRA 2BC0A 4TM3A 3NK0X 1IUSA 1ZKQA 3HYWA 4K5SA 3NH3X 4YSHA 1FECA 4K8DA 2XCGA 3D1CA 3SZFA 1H83A 1KNRA 2BS2A 2CVJA 2WU2A 4AP3A 2OLNA 4OPGA 4U8JA 4B68A 1KF6A 4D03A 4U8KA 2A89A 3G5RA 1GALA 1JOAA 2WPFA 1GTEA 3P4RA 3UKAA 3UKHA 3VRDB 2DKHA 2Q6UA 5HY5A 2B7RA 2GRTA 2NPXA 1N4WA 3KLJA 3URHA 1NDAA 2EQ7A 2ZZ0A 3GYXA 4NWZA 4PABA 3UTHA 2NVKX 4C3XA 3SX6A 4I58A 4I59A 4G6GA 1S2QA 3EF6A 2X99A 4A99A 2XVHA 4YWOA 3BI2A 3CGBA 3CPIG 3GWFA 4NTEA 2BK4A 1QJDA 2V3BA 3V3OA 4Z43A 3R9UA 1GSNA 3T2ZA 1ZMDA 1Q1WA 3C4AA 1DODA 4XWRA 3VR9A 3NG7X 4H2PA 2WHDA 3ALMA 1B8SA 3VRBA 4J31A 3IWAA 2Q0KA 2JBVA 1Q9IA 2HQMA 1CC2A 1YQ3A 4B65A 2GQWA 2XLSA 3HYVA 2YR6A 2WEUA 2XFOA 2YVFA 1CC4A 2H89A 4OPCA 1GOSA 3ZDNA 1GETA 3FIMB 3SZCA 2YM2A 1Y0PA 1TDEA 3CGEA 3DH9A 4II3A 3H4KA 4J36A 1SEZA 1TDKA 4UP3A 4A6NA 4HB9A 2VZ2A 1K0IA 3SZWA 4J56A 2BRAA 2I0ZA 1PDHA 5KMQA 4A7AA 1NG3A 2YVGA 2F5ZA 4KPRA 3GMCA 2BXSA 1CJ4A 3ALLA 3P4QA 3GWDA 4Z44A 3AD7B 2BXRA 3ITJA 4GDPA 1L0VA 3DJGX 5GRTA 1K4QA 1OJ9A 5CQFA 3CNDA 4P9SA 4GAVA 1NEKA 1XHCA 4B66A 1GTHA 3AE7A 3AE8A 3P1WA 4BURA 4KX6A 4NNJA 3SFDA 3QVPA 1V59A 4IVOB 3S61A 1KFYA 1GRBA 2YM1A 2GB0A 3AB1A 5HHFA 2VOUA 3ABVA 4U8PA 3BI5A 4REKA 2PYXA 4YTPA 2XFQA 5LV9A 2R45A 2CDUA 1S3EA 2BK5A 3RP7A 3SYIA 4G73A 1TYPA 2JK6A 3CTYA 3ICRA 4BJYA 4YKFA 4O5UA 1DXLA 1Y56A 3UP4A 5KVHA 3NN0X 4ZN0A 3AE1A 3CIRA 3Q6JA 1E39A 3KVEA 4X4JA 1ZDLA 4GF7A 2WP6A 3P4SA 4N9XA 3UKPA 1LJ1A 3K7QX 4OPIA 4WCTA 5HYMA 4ZCDA 3NYCA 1TDNA 1ONFA 3EANA 1GESA 2WPEA 3AEEA 5KMPA 4J33A 1KDGA 4YTMA 2WDRA 1OJDA 2TPRA 4K7ZA 1B5QA 3FMWA 2Q0LA 3RP6A 2WESA 2XFUA 4AT2A 3LB8A 3SXIA 1O95A 1PBDA 1PJ7A 3NTDA 1PBBA 1PHHA 1LV0A 2C66A 1NAAA 3FG2P 5U1OA 3DK8A 1ELIA 3ATQA 3UTEA 3DGHA 4LU6A 4C5OA 1P2HA 1E1KA 3GDPA 1NHQA 5JRBA 4NEWA 5JCMA 3KA7A 1GRFA 3AEAA 4Y4MA 2C65A 2RGOA 1DOCA 4B64A 2QCUA 1YQZA 3RNMA 4EQRA 2ZZBA 3F8PA 3DA1A 1GXFA 3GRSA 4BK3A 2Z5YA 2BC1A 4U8NA 3QFAA 4RG3A 1GEUA 3EAOA 2Q7VA 4K5RA 3DJEA 5FS7A 2YR4A 3CMMA 4AOXA 4U8IA 2C75A 3UCLA 4BJZA 4OCGA 3NK2X 2YG6A 3KPFA 2JB1A 3DJDA 2WS3A 3GDNA 2C64A 3GSIA 1N4UA 3GD3A 5JCLA 1N4VA 2YLZA 2E1MA 2BCPA 2R0CA 2V3AA 2WP5A 2YG7A 3M0OA 4TM4A 4CCRA 2GAHB 1H2IA 2VQ7A 1D4CA 3K7MX 3NHOX 4C77A 4OPDA 1VG0A 4GAPA 3BNMA 4HA6A 3NTAA 3REDA 1GRHA 2ARDA 2V61A 4JY3A 1CJCA 2Y6RA 4A9WA 4XWZA 2GVCA 3AWIA 4WX1A 4H4TA 2YG5A 1IJHA 4AT0A 2ZBWA 3AEDA 2H88A 2YR5A 4BK2A 1JRYA 5KXJA 4DNAA 2R0PA 4PAAA 3AE5A 4Z2RA 2ZZCA 1XDIA 1N1PA 4JNAA 1H81A 2GQFA 4OPLA 2JB3A 1JRZA 2C4CA 2RGHA 1EL9A 1E6EA 1O94A 2FJBA 2YVJA 4FK1A 1OJCA 3CNSA 1CC6A 2BACA 4OPUA 3T2YA 3BI4A 3UOYA 4H4WA 2C72A 3T14A 1BF3A 4CY6A 2WBAA 2APGA 2GEWA 1K0JA 1EBDA 3VR8A 3CNJA 5BRTA 1DNCA 2GMJA 3Q9TA 1LQTA 4H4ZA 3QSEA 1W4XA 3CN8A 3V3NA 2WDQA 3OZ2A 4MJWA 3QJ4A 3FPZA 3GRTA 3QSMA 2GR0A 3CPHG 1S7MA 3JSKA 4CNJA 4YSZA 1ZK7A 5IQ4A 2R9ZA 5FS9A 3UOVA 3PVCA 3SQPA 1HYUA 1CJ2A 1H86A 1EL5A 2VVLG 1CJ3A 4K22A 3AEBA 3ICSA 4NTCA 3SFEA 3L1RA 1NHRA 3D8XA 2BA9A 2FJDA 3CNTA 2C7GA 4FK1C 1F8WA 1JNRA 2YLWA 3NRNA 4ADWA 1CHUA 1L9EA 3O0HA 3AE2A 3OC4A 2XDOA 4YXDA 1IUWA 4U2LA 5KMRA 4CBQA 3K30A 3NNEA 2GMHA 1COYA 2AAQA 1BGNA 1GNDA 1LVLA 1CL0A 1PJ6A 4EIQA 2FJEA 1VRQB 4J34A 1TDFA 4B63A 1JRXA 5KVIA 2XVEA 1F8RA 1NHPA 3IC9A 4Z26A 1UKVG 3FBSA 4NTDA 3CNPA 3P4PA 2BS4A 1E1MA 4CRTA 1MOKA 1AOGA 1OJTA 3PG6A 3AE3A 1PBEA 2JAEA 1PXBA 5U25A 3II4A 5BULA 3DMEA 4M52A 1H84A 1GPEA 1D7LA 2RGJA 3T31A 2W0HA 4CNKA 2OAMA 4C3YA 1VQWA 4Z24A 5KNLA 3LZWA 2VQBA 2WOWA 5JCKA 4H7UA 2YLXA 4ECHA 4YT0A 5EOWA 4H4RA 3CPJG 1EL8A 4II2A 5U63A 1DJQA 4EM4A 2GR3A 1NPXA 1IUUA 1GT8A 4Z2UA 1FEAA 3AD8B 2Z5XA 5J60A 1PXAA 1B4VA 1JEHA 3HZLA 2DKIA 2XLUA 2XVIA 5KMSA 2C70A 2VVLA 3NIXA 2IVDA 3AYLA 2TMDA 3AEGA 1X31B 1E1LA 2O9ZA 4GR1A 1YY5A 3I6DA 3AE4A 1NHSA 4H4YA 3GYJA 4H4QA 1VDCA 2J3NA 2FBWA 3ICTA 4IA5A 2C3DA 2IVEA 4JDRA 2C3CA 4RSLA 3GYIA 4EMWA 3IHGA 4TM0A 2GAGB 1TRBA 3G5SA 1QO8A 1F6MA 1LQUA 2YQUA 4NEVA 4CY8A 2C76A 2E5VA 1IUTA 1JNZA 3UTFA 4GUVA 4J2WA 2YAUA 4GDEA 4JY2A 2EQ6A 2XLPA 4H4PA 2OA1A 3UOXA 2XLTA 3BHFA 3F8DA 3BNUA 1BZLA 1TDOA 1RSGA 3F8RA 1CBOA 3UP5A 4APNA 2VRLA 2QA1A 3DK9A 1LTXR 4BK1A 5C3JA 2B76A 2PHHA 3EPTA 4AOSA 2AQJA 3C96A 2UZZA 4H2QA 1GREA 3SY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOH A;  1ZMC A;  1YQ4 A;  3B6D A;  2OAL A;  3AYJ A;  4Y4L A;  3UKF A;  3UOZ A;  4UDR A;  4B69 A;  3I3L A;  5M0Z A;  3AEF A;  4YKG A;  4B1B A;  4U2T A;  1E7P A;  2B9X A;  2JB2 A;  3DJJ A;  3L8K A;  2BS3 A;  4GCM A;  4EIP A;  3RHA A;  4YSX A;  1GRA A;  2ACZ A;  2XLR A;  3LZX A;  1L9C A;  2GV8 A;  1S3B A;  5EB5 A;  3B3R A;  4EQS A;  4EQX A;  1PBF A;  4CCQ A;  4BV6 A;  1RP0 A;  1P2E A;  4H50 A;  4NZH A;  1PXC A;  4EMJ A;  1MO9 A;  5EBK A;  1OJA A;  2RAB A;  2VRM A;  1BWC A;  1D5T A;  2JKC A;  4GRT A;  5DBJ A;  4USR A;  3M13 A;  5L46 A;  3M12 A;  3SM8 A;  4C74 A;  3AEC A;  4LII A;  2WU5 A;  2XFP A;  4K2X A;  3ALJ A;  4H2N A;  2QAE A;  4JQ9 A;  1VG9 A;  3NKS A;  1IUX A;  1D4E A;  2R46 A;  4EQW A;  3ISH A;  1ZOY A;  4TLZ A;  4A79 A;  4U8M A;  1GER A;  2X3N A;  3SGL A;  3ATR A;  5TR3 A;  4DGK A;  1CF3 A;  2CUL A;  3G5Q A;  5GSN A;  4UDQ A;  3H8L A;  1B37 A;  2OLO A;  5FS8 A;  5C2T A;  1BGJ A;  1ZY8 A;  5KRQ A;  1IUV A;  3PS9 A;  3ZYX A;  2X8C A;  2X8G A;  1PBC A;  4UDP A;  4D04 A;  1H7X A;  1KNP A;  4DSH A;  3DK4 A;  1EL7 A;  4J57 A;  3NLC A;  3NT6 A;  1H6V A;  1Y56 B;  1BKW A;  1PS9 A;  4H2R A;  4AP1 A;  1XAN A;  3E1T A;  2BAB A;  2WP9 A;  1O5W A;  4H4U A;  4XXG A;  3UKL A;  3COX A;  2R4J A;  4JN9 A;  1ZOV A;  2V6O A;  3QSS A;  5EB4 A;  3H8I A;  4H4S A;  1TYT A;  3KU9 A;  2B9W A;  5FMH A;  3UTG A;  4YTN A;  3BHK A;  2BK3 A;  1JU2 A;  1D7Y A;  2V60 A;  2R4E A;  4X9N A;  1D4D A;  1YKJ A;  2EQ8 A;  1DJN A;  1KSS A;  1GRT A;  5JCN A;  2WET A;  3AD9 B;  4OVI A;  3VQR A;  2WOI A;  3IHM A;  3UKQ A;  4H4X A;  3VRA A;  2QA2 A;  1QLB A;  1S2Y A;  4ZCC A;  5KOW A;  2VVM A;  5CKU A;  1Z6L A;  2IID A;  4U8O A;  4B67 A;  4E0V A;  4U2S A;  3T37 A;  5HXI A;  3UKK A;  1H82 A;  2XVJ A;  2XYO A;  4Z25 A;  5M10 A;  2E4G A;  1NEN A;  2GR1 A;  2X8H A;  2AR8 A;  1L9D A;  2XFN A;  1M6I A;  5FS6 A;  3WE0 A;  2B7S A;  1Q1R A;  3IF9 A;  1DOE A;  3NYE A;  2YLS A;  5IPY A;  3CGD A;  5KOX A;  1FEB A;  4Y4N A;  1XPQ A;  2YG3 A;  5KWF A;  2C73 A;  1DOB A;  2EQ9 A;  5BVA A;  3QFB A;  1H7W A;  4U8L A;  2BCG G;  4FX9 A;  1ZX9 A;  2YWL A;  4A65 A;  3NYF A;  3LXD A;  5BUK A;  1FL2 A;  1ZP0 A;  4FDC B;  3K7T A;  3PO7 A;  2WPC A;  4IVM B;  2GR2 A;  3V76 A;  1FCD A;  4DSG A;  5ER0 A;  3LAD A;  4RG4 A;  4IA6 A;  4TLX A;  2A87 A;  4ICY A;  4A5L A;  4EMI A;  2B9Y A;  2C67 A;  2YG4 A;  2GF3 A;  3GMB A;  4Z2T A;  3AE9 A;  1PJ5 A;  3LJP A;  3KD9 A;  4USQ A;  4A6N B;  1PN0 A;  4H4V A;  4O5Q A;  3DGZ A;  1RYI A;  2YLT A;  2R0G A;  4TM1 A;  2BYB A;  2WDV A;  1E1N A;  2GH5 A;  3NGC X;  2FJA A;  2CFY A;  4OPT A;  4EM3 A;  1GV4 A;  1KSU A;  2WOV A;  3CGC A;  4JNQ A;  2V5Z A;  3AXB A;  3S5W A;  1MXT A;  3LOV A;  5JCI A;  2X50 A;  3AE6 A;  1REO A;  2WQY A;  1F8S A;  1NG4 A;  1GRG A;  1M64 A;  2Y6Q A;  2XVF A;  3C4N A;  3AYI A;  5IQ1 A;  4X9M A;  1F3P A;  3GD4 A;  4LA1 A;  3P9U A;  4IV9 A;  2YLR A;  3NN6 X;  3KKJ A;  3RP8 A;  4YSY A;  1LPF A;  2A8X A;  3ADA B;  1K0L A;  3NK1 X;  5J7X A;  3QVR A;  2BC0 A;  4TM3 A;  3NK0 X;  1IUS A;  1ZKQ A;  4K5S A;  3NH3 X;  4YSH A;  1FEC A;  4K8D A;  2XCG A;  3D1C A;  1H83 A;  1KNR A;  2BS2 A;  2CVJ A;  2WU2 A;  4AP3 A;  2OLN A;  4OPG A;  4U8J A;  4B68 A;  1KF6 A;  4D03 A;  4U8K A;  2A89 A;  3G5R A;  1GAL A;  1JOA A;  2WPF A;  1GTE A;  3P4R A;  3UKA A;  3UKH A;  3VRD B;  2DKH A;  2Q6U A;  5HY5 A;  2B7R A;  2GRT A;  2NPX A;  1N4W A;  3KLJ A;  3URH A;  1NDA A;  2EQ7 A;  2ZZ0 A;  4PAB A;  3UTH A;  4C3X A;  2NVK X;  4I58 A;  4I59 A;  1S2Q A;  3EF6 A;  2X99 A;  4A99 A;  2XVH A;  4YWO A;  3BI2 A;  3CGB A;  3CPI G;  3GWF A;  4NTE A;  2BK4 A;  1QJD A;  2V3B A;  3V3O A;  4Z43 A;  3R9U A;  1GSN A;  1ZMD A;  1Q1W A;  3C4A A;  1DOD A;  4XWR A;  3VR9 A;  3NG7 X;  4H2P A;  2WHD A;  3ALM A;  1B8S A;  3VRB A;  4J31 A;  3IWA A;  2Q0K A;  2JBV A;  1Q9I A;  2HQM A;  1CC2 A;  1YQ3 A;  4B65 A;  2GQW A;  2XLS A;  2YR6 A;  2WEU A;  2XFO A;  2YVF A;  1CC4 A;  2H89 A;  4OPC A;  1GOS A;  3ZDN A;  1GET A;  3FIM B;  2YM2 A;  1Y0P A;  1TDE A;  3CGE A;  3DH9 A;  3H4K A;  4J36 A;  1SEZ A;  1TDK A;  4UP3 A;  4A6N A;  4HB9 A;  2VZ2 A;  1K0I A;  4J56 A;  2I0Z A;  1PDH A;  4A7A A;  1NG3 A;  2YVG A;  2F5Z A;  4KPR A;  3GMC A;  2BXS A;  1CJ4 A;  3ALL A;  3P4Q A;  3GWD A;  4Z44 A;  3AD7 B;  2BXR A;  3ITJ A;  4GDP A;  1L0V A;  3DJG X;  5GRT A;  1K4Q A;  1OJ9 A;  5CQF A;  3CND A;  4P9S A;  4B66 A;  1NEK A;  1XHC A;  1GTH A;  3AE7 A;  3AE8 A;  3P1W A;  4BUR A;  4KX6 A;  3SFD A;  3QVP A;  1V59 A;  4IVO B;  3S61 A;  1KFY A;  1GRB A;  2YM1 A;  2GB0 A;  3AB1 A;  5HHF A;  2VOU A;  3ABV A;  4U8P A;  3BI5 A;  4REK A;  2PYX A;  4YTP A;  2XFQ A;  5LV9 A;  2R45 A;  2CDU A;  1S3E A;  2BK5 A;  3RP7 A;  1TYP A;  2JK6 A;  3CTY A;  3ICR A;  4BJY A;  4YKF A;  4O5U A;  1DXL A;  1Y56 A;  3UP4 A;  5KVH A;  3NN0 X;  4ZN0 A;  3AE1 A;  3CIR A;  3Q6J A;  1E39 A;  3KVE A;  4X4J A;  1ZDL A;  4GF7 A;  2WP6 A;  3P4S A;  4N9X A;  3UKP A;  1LJ1 A;  3K7Q X;  4OPI A;  4WCT A;  5HYM A;  4ZCD A;  3NYC A;  1TDN A;  1ONF A;  3EAN A;  1GES A;  2WPE A;  3AEE A;  4J33 A;  1KDG A;  4YTM A;  2WDR A;  1OJD A;  2TPR A;  4K7Z A;  1B5Q A;  3FMW A;  2Q0L A;  3RP6 A;  2WES A;  2XFU A;  4AT2 A;  3LB8 A;  1O95 A;  1PBD A;  1PJ7 A;  3NTD A;  1PBB A;  1PHH A;  1LV0 A;  2C66 A;  1NAA A;  3FG2 P;  5U1O A;  3DK8 A;  1ELI A;  3ATQ A;  3UTE A;  3DGH A;  4LU6 A;  4C5O A;  1P2H A;  1E1K A;  3GDP A;  1NHQ A;  3KA7 A;  4NEW A;  5JCM A;  1GRF A;  3AEA A;  4Y4M A;  2C65 A;  2RGO A;  1DOC A;  4B64 A;  2QCU A;  1YQZ A;  3RNM A;  4EQR A;  2ZZB A;  3F8P A;  3DA1 A;  1GXF A;  3GRS A;  4BK3 A;  2Z5Y A;  2BC1 A;  4U8N A;  3QFA A;  4RG3 A;  1GEU A;  3EAO A;  2Q7V A;  4K5R A;  3DJE A;  5FS7 A;  2YR4 A;  4AOX A;  4U8I A;  2C75 A;  3UCL A;  4BJZ A;  4OCG A;  3NK2 X;  2YG6 A;  3KPF A;  2JB1 A;  3DJD A;  2WS3 A;  3GDN A;  2C64 A;  3GSI A;  1N4U A;  3GD3 A;  5JCL A;  1N4V A;  2YLZ A;  2E1M A;  2BCP A;  2R0C A;  2WP5 A;  2V3A A;  2YG7 A;  3M0O A;  4TM4 A;  4CCR A;  2GAH B;  3K7M X;  2VQ7 A;  1D4C A;  3NHO X;  4C77 A;  4OPD A;  1VG0 A;  3BNM A;  4HA6 A;  3NTA A;  3RED A;  1GRH A;  2ARD A;  2V61 A;  4JY3 A;  1CJC A;  2Y6R A;  4A9W A;  4XWZ A;  2GVC A;  3AWI A;  4WX1 A;  4H4T A;  2YG5 A;  1IJH A;  4AT0 A;  2ZBW A;  3AED A;  2H88 A;  2YR5 A;  4BK2 A;  1JRY A;  5KXJ A;  4DNA A;  2R0P A;  4PAA A;  3AE5 A;  4Z2R A;  2ZZC A;  1XDI A;  1N1P A;  4JNA A;  1H81 A;  2GQF A;  4OPL A;  2JB3 A;  1JRZ A;  2RGH A;  1EL9 A;  1E6E A;  1O94 A;  2FJB A;  2YVJ A;  4FK1 A;  1OJC A;  3CNS A;  1CC6 A;  2BAC A;  4OPU A;  3BI4 A;  3UOY A;  4H4W A;  2C72 A;  1BF3 A;  4CY6 A;  2WBA A;  2APG A;  2GEW A;  1K0J A;  1EBD A;  3VR8 A;  3CNJ A;  5BRT A;  1DNC A;  2GMJ A;  3Q9T A;  1LQT A;  4H4Z A;  3QSE A;  1W4X A;  3CN8 A;  3V3N A;  2WDQ A;  3OZ2 A;  4MJW A;  3QJ4 A;  3FPZ A;  3GRT A;  3QSM A;  2GR0 A;  3CPH G;  3JSK A;  4CNJ A;  4YSZ A;  1ZK7 A;  5IQ4 A;  2R9Z A;  5FS9 A;  3UOV A;  3PVC A;  3SQP A;  1HYU A;  1CJ2 A;  1H86 A;  1EL5 A;  2VVL G;  1CJ3 A;  4K22 A;  3AEB A;  3ICS A;  4NTC A;  3SFE A;  3L1R A;  1NHR A;  3D8X A;  2BA9 A;  2FJD A;  3CNT A;  2C7G A;  4FK1 C;  1F8W A;  1JNR A;  2YLW A;  3NRN A;  4ADW A;  1CHU A;  1L9E A;  3O0H A;  3AE2 A;  3OC4 A;  2XDO A;  4YXD A;  1IUW A;  4U2L A;  4CBQ A;  3K30 A;  3NNE A;  2GMH A;  1COY A;  2AAQ A;  1BGN A;  1GND A;  1LVL A;  1CL0 A;  1PJ6 A;  4EIQ A;  2FJE A;  1VRQ B;  4J34 A;  1TDF A;  4B63 A;  1JRX A;  5KVI A;  2XVE A;  1F8R A;  1NHP A;  3IC9 A;  4Z26 A;  1UKV G;  3FBS A;  4NTD A;  3CNP A;  3P4P A;  2BS4 A;  1E1M A;  4CRT A;  1MOK A;  1AOG A;  1OJT A;  3AE3 A;  1PBE A;  2JAE A;  1PXB A;  5U25 A;  3II4 A;  5BUL A;  3DME A;  4M52 A;  1H84 A;  1GPE A;  1D7L A;  2RGJ A;  2W0H A;  4CNK A;  2OAM A;  4C3Y A;  1VQW A;  4Z24 A;  3LZW A;  2VQB A;  2WOW A;  5JCK A;  4H7U A;  2YLX A;  4ECH A;  4YT0 A;  5EOW A;  4H4R A;  3CPJ G;  1EL8 A;  5U63 A;  1DJQ A;  4EM4 A;  2GR3 A;  1NPX A;  1IUU A;  1GT8 A;  4Z2U A;  1FEA A;  3AD8 B;  2Z5X A;  5J60 A;  1PXA A;  1B4V A;  1JEH A;  3HZL A;  2DKI A;  2XLU A;  2XVI A;  2C70 A;  2VVL A;  3NIX A;  2IVD A;  3AYL A;  2TMD A;  3AEG A;  1X31 B;  1E1L A;  2O9Z A;  4GR1 A;  1YY5 A;  3I6D A;  3AE4 A;  1NHS A;  4H4Y A;  3GYJ A;  4H4Q A;  1VDC A;  2J3N A;  2FBW A;  3ICT A;  4IA5 A;  2C3D A;  2IVE A;  4JDR A;  2C3C A;  4RSL A;  3GYI A;  4EMW A;  3IHG A;  4TM0 A;  2GAG B;  1TRB A;  3G5S A;  1QO8 A;  1F6M A;  1LQU A;  2YQU A;  4NEV A;  4CY8 A;  2C76 A;  2E5V A;  1IUT A;  1JNZ A;  3UTF A;  4GUV A;  4J2W A;  2YAU A;  4GDE A;  4JY2 A;  2EQ6 A;  2XLP A;  4H4P A;  2OA1 A;  3UOX A;  2XLT A;  3BHF A;  3F8D A;  3BNU A;  1BZL A;  1TDO A;  1RSG A;  3F8R A;  1CBO A;  3UP5 A;  4APN A;  2VRL A;  2QA1 A;  3DK9 A;  1LTX R;  4BK1 A;  5C3J A;  2B76 A;  2PHH A;  3EPT A;  4AOS A;  2AQJ A;  3C96 A;  2UZZ A;  4H2Q A;  1GRE A; 
#chains in the Genus database with same CATH topology
 1ZMC A;  4UDR A;  4B69 A;  3I3L A;  2XH0 A;  2B9X A;  3DJJ A;  4GCM A;  4YSX A;  2PA6 A;  5EB5 A;  3B3R A;  4EQS A;  4CCQ A;  4BV6 A;  4H50 A;  3PWG A;  4GRT A;  2DW7 A;  3MKC A;  3M13 A;  3AEC A;  4LII A;  3ZVH A;  2WU5 A;  4K2X A;  4DX3 A;  1FHV A;  3ISH A;  3ES7 A;  4U8M A;  2PTW A;  5FS8 A;  3GY1 A;  2GDQ A;  1ZY8 A;  5KRQ A;  4UDP A;  4D04 A;  1H7X A;  4DSH A;  3NT6 A;  2PMQ A;  1H6V A;  1BKW A;  4AP1 A;  4H2R A;  1XAN A;  1O5W A;  4XXG A;  4JN9 A;  3QSS A;  4H4S A;  1TYT A;  3VC5 A;  5FMH A;  3UTG A;  4FP1 A;  3NZG A;  2R4E A;  2EQ8 A;  3JW7 A;  3AD9 B;  3VQR A;  2WOI A;  1XPY A;  3VRA A;  2QA2 A;  1S2Y A;  5KOW A;  3ENL A;  4B67 A;  1H82 A;  1V97 A;  2XFN A;  1M6I A;  3T0K A;  2PGW A;  2YLS A;  3CGD A;  1FEB A;  3TJI A;  5KWF A;  2C73 A;  4U8L A;  1FL2 A;  3A7U A;  3R10 A;  4FDC B;  3MSY A;  3PO7 A;  2GR2 A;  3V76 A;  3UXL A;  1FCD A;  3VCN A;  2POD A;  4RG4 A;  4ROP A;  4EMI A;  2B9Y A;  3L5O A;  4USQ A;  4A6N B;  4GYP A;  5G5G B;  2BYB A;  2FJA A;  1P48 A;  1GV4 A;  2WOV A;  3CGC A;  3S5W A;  3LOV A;  2HXT A;  5JCI A;  2X50 A;  1F8S A;  1GRG A;  1M64 A;  3ZLF A;  3BJS A;  1F3P A;  3KKJ A;  4YSY A;  3ADA B;  1KKO A;  3DFY A;  3JVA A;  3SN1 A;  1SJB A;  4AP3 A;  4B68 A;  1KF6 A;  4D03 A;  1SJD A;  3UKA A;  4ZA0 A;  2B7R A;  1N4W A;  1NDA A;  4C3X A;  4G6G A;  3BI2 A;  1E9I A;  3CPI G;  2PS2 A;  2BK4 A;  3V3O A;  3T2Z A;  4H2P A;  3ALM A;  4J31 A;  3IWA A;  2JBV A;  4B65 A;  2E3T A;  2YVF A;  1MNS A;  3SZC A;  3H4K A;  4J36 A;  1JRP A;  5KMQ A;  4GYP C;  3ALL A;  1XS2 A;  5GRT A;  3ZVH B;  1EC7 A;  4B66 A;  1GTH A;  3SFD A;  4E8G A;  3DGB A;  4IP5 A;  3NFU A;  4A3R A;  2PYX A;  4YTP A;  5LV9 A;  2R45 A;  1WYG A;  5FJT A;  3UP4 A;  3AE1 A;  3CIR A;  3Q6J A;  1ZDL A;  4H19 A;  4WCT A;  1ONF A;  2WPE A;  5KMP A;  2XFU A;  4AT2 A;  3SXI A;  1LV0 A;  4DYE A;  4C5O A;  4KEM A;  3A7A A;  1RM6 B;  4IL0 A;  4NEW A;  5JRB A;  2C65 A;  1YQZ A;  3RNM A;  2ZZB A;  1GXF A;  3IJI A;  1BQG A;  4RG3 A;  3V4B A;  4K5R A;  2YR4 A;  2YG6 A;  3GDN A;  1N4U A;  3GD3 A;  2V3A A;  4CCR A;  2GAH B;  2VQ7 A;  4C77 A;  3BNM A;  4HA6 A;  3RED A;  1GRH A;  3DG3 A;  1VQZ A;  3AWI A;  4WX1 A;  2PP0 A;  1FFU C;  3SN4 A;  2XH4 A;  3AE5 A;  3CYJ A;  1H81 A;  1EC8 A;  3STP A;  1WUF A;  1JRZ A;  2C4C A;  1E6E A;  4FK1 A;  3QPE A;  1CC6 A;  2BAC A;  4OPU A;  3T14 A;  2GEW A;  1K0J A;  3CNJ A;  3QSE A;  4MJW A;  1S7M A;  1ZK7 A;  1YEY A;  5IQ4 A;  1FIQ B;  2GGG A;  4K22 A;  4ZCW A;  3AEB A;  4YWS A;  4DXK A;  4U2L A;  5KMR A;  4CBQ A;  3NNE A;  1PJ6 A;  2OFJ A;  2XVE A;  3P3B A;  4X2P A;  3FBS A;  2PGE A;  1OJT A;  3AE3 A;  1PBE A;  2JAE A;  5U25 A;  3JZU A;  4DHG A;  1D7L A;  4C3Y A;  2VQB A;  4H7U A;  3R07 C;  4H4R A;  1DJQ A;  4EM4 A;  5J60 A;  1PXA A;  4IT1 A;  1B4V A;  1JEH A;  3NO1 A;  3HZL A;  2DKI A;  2XLU A;  2C70 A;  3AYL A;  1JRO A;  2TMD A;  1X31 B;  1VDC A;  3H70 A;  2C3C A;  2FYM A;  3G5S A;  1QO8 A;  1F6M A;  2PP1 A;  5ENL A;  3QTP A;  1JNZ A;  2YAU A;  4JY2 A;  2XLP A;  2OA1 A;  3UOX A;  3BHF A;  1BZL A;  1TDO A;  1RSG A;  3TQP A;  4APN A;  2VRL A;  2QA1 A;  3DK9 A;  3AN1 A;  4H2Q A;  1GRE A;  3B6D A;  2OAL A;  3UKF A;  3AEF A;  4U2T A;  1E7P A;  2JB2 A;  2BS3 A;  1L9C A;  2GV8 A;  1PBF A;  1RP0 A;  3OZY A;  1PXC A;  1MO9 A;  3I4K A;  5EBK A;  2MNR A;  2VRM A;  1BWC A;  1D5T A;  2JKC A;  4USR A;  5L46 A;  3M12 A;  4C74 A;  3MY9 A;  4H2N A;  2QAE A;  4JQ9 A;  1IUX A;  4TLZ A;  1GER A;  1VDV A;  2XH2 A;  3ATR A;  4JN7 A;  4DGK A;  5GSN A;  1B37 A;  5C2T A;  2PTZ A;  4GIS A;  3ZLH A;  2X8G A;  3NLC A;  1Y56 B;  3E1T A;  1N5X A;  2BAB A;  3COX A;  1ZOV A;  2V6O A;  4Z1Y A;  4G6H A;  2B9W A;  4YTN A;  3BHK A;  2BK3 A;  1D7Y A;  1D4D A;  1YKJ A;  4E6M A;  5JCN A;  2WET A;  3CK5 A;  4ZCC A;  2VVM A;  1Z6L A;  2IID A;  3DES A;  4U2S A;  1ONE A;  2OQH A;  3UKK A;  5HXI A;  4Z25 A;  5M10 A;  3UCC A;  2GR1 A;  2OG9 A;  1W6T A;  5FS6 A;  1DOE A;  5IPY A;  3U4F A;  4Y4N A;  1DOB A;  2EQ9 A;  3QFB A;  2BCG G;  4A65 A;  3NYF A;  3LXD A;  2GGH A;  3ES8 A;  2P8C A;  4DSG A;  5ER0 A;  3LAD A;  3CXO A;  3PFR A;  4TLX A;  2A87 A;  1N61 C;  4Z2T A;  3AE9 A;  1PN0 A;  2YLT A;  1L8P A;  2R0G A;  2WDV A;  3NGC X;  3TCS A;  3A7R A;  1KSU A;  5BOF A;  1MXT A;  2RDX A;  1KD0 A;  3FXG A;  3AYI A;  5IQ1 A;  3RP8 A;  3OP2 A;  3NK1 X;  2BC0 A;  4TM3 A;  3NVV B;  3OW1 A;  1IUS A;  3GD6 A;  2XCG A;  3D1C A;  1KNR A;  2BS2 A;  4OPG A;  4U8K A;  1GTE A;  2GGJ A;  2OZT A;  3V5C A;  2MUC A;  2GRT A;  3KLJ A;  4PAB A;  2NVK X;  3SX6 A;  4I58 A;  1S2Q A;  1NEL A;  3EF6 A;  4A35 A;  4YWO A;  3CGB A;  2PTY A;  3GWF A;  2V3B A;  3R9U A;  2W3R A;  3N4E A;  1ZMD A;  3T4W A;  3UJR A;  1RVK A;  3VR9 A;  3NRZ B;  2H89 A;  1Y0P A;  3AMZ A;  4UP3 A;  1JDF A;  2BRA A;  4HCD A;  3GMC A;  3P4Q A;  4Z44 A;  4GDP A;  1TZZ A;  3DJG X;  1OJ9 A;  1R0M A;  3T6C A;  1NEK A;  2AL2 B;  3AE8 A;  3P1W A;  4KX6 A;  4NNJ A;  2AL2 A;  1V59 A;  4IVO B;  3AB1 A;  2XFQ A;  2CDU A;  1S3E A;  2BK5 A;  3RP7 A;  4G73 A;  1TYP A;  4O5U A;  3HRD C;  4ZN0 A;  3KVE A;  2P3Z A;  2WP6 A;  4DWD A;  1LJ1 A;  3K7Q X;  4OPI A;  5HYM A;  3EAN A;  3N6J A;  1KDG A;  4YTM A;  1OJD A;  1B5Q A;  3FMW A;  2Q0L A;  2WES A;  1PHH A;  2C66 A;  3UJE A;  3FG2 P;  5U1O A;  3S5S A;  2QDE A;  1F9C A;  1NHQ A;  3KA7 A;  4MGG A;  5JCM A;  1GRF A;  3AEA A;  4EQR A;  3EKG A;  4HCH A;  3F8P A;  3GRS A;  2BC1 A;  3B97 A;  2AL1 A;  5FS7 A;  3OZM A;  7ENL A;  3UGV A;  3NK2 X;  5JCL A;  2YG7 A;  4TM4 A;  3NHO X;  1VG0 A;  4GAP A;  2V61 A;  2Y6R A;  3SQS A;  4XWZ A;  2GVC A;  2I5Q A;  1FFV C;  4H4T A;  2YG5 A;  1IJH A;  2ZBW A;  4BK2 A;  2YR5 A;  5KXJ A;  4DNA A;  1PDY A;  4Z2R A;  1XDI A;  2PU0 A;  5EU9 A;  1N1P A;  4OPL A;  1EL9 A;  3IK4 A;  2FJB A;  2YVJ A;  1OJC A;  3DIP A;  3UOY A;  4K8G A;  2C72 A;  4CY6 A;  4A6G A;  4JHM A;  5BRT A;  3Q9T A;  3CN8 A;  3OZ2 A;  3FPZ A;  2OKT A;  3JSK A;  4YSZ A;  2R9Z A;  5FS9 A;  3UOV A;  3PVC A;  1HYU A;  1H86 A;  3GO2 A;  4NTC A;  2CHR A;  2FJD A;  3CNT A;  4FK1 C;  1F8W A;  4ADW A;  2P0I A;  2XDO A;  1IUW A;  3I6T A;  1ECQ A;  3K30 A;  2QJJ A;  2OZ3 A;  1COY A;  1BGN A;  1CL0 A;  1VRQ B;  1TDF A;  4B63 A;  5KVI A;  3EUB 3;  3IC9 A;  4Z26 A;  3T8Q A;  4NTD A;  2P8B A;  3UJ2 A;  3P93 A;  1UKV G;  3TJ4 A;  3P4P A;  3PG6 A;  1PXB A;  5BUL A;  4CNK A;  1VQW A;  2GL5 A;  2WOW A;  3PK7 A;  4ECH A;  2YLX A;  4II2 A;  1EL8 A;  5U63 A;  4Z2U A;  2PPG A;  2Z5X A;  3RRA A;  2VVL A;  2IVD A;  1TKK A;  2O9Z A;  1YY5 A;  2HXU A;  4HYR A;  4H4Y A;  4H4Q A;  3ICT A;  4IA5 A;  3MZN A;  3VDG A;  4TM0 A;  2YQU A;  1IUT A;  4GUV A;  3CT2 A;  4GDE A;  3F8D A;  1CBO A;  4AOS A;  3I6D A;  1FOH A;  4Y4L A;  3UOZ A;  3UXK A;  5M0Z A;  2QJM A;  4YKG A;  4B1B A;  4EWJ A;  3L8K A;  1KCZ A;  4EIP A;  3RHA A;  2OLA A;  1GRA A;  3Q45 A;  2ACZ A;  4E4F A;  2XLR A;  1OJA A;  1IYX A;  3FVD A;  3T2K A;  3IJQ A;  3SM8 A;  3NS1 B;  3H7V A;  3GC2 A;  1EC9 A;  1D4E A;  4A79 A;  1KKR A;  2X3N A;  5TR3 A;  1CF3 A;  2CUL A;  3G5Q A;  4TVY A;  4UDQ A;  3THU A;  4IZG A;  1IUV A;  1ELS A;  2PCE A;  1KNP A;  3DK4 A;  3FJ4 A;  1EL7 A;  2FKP A;  2HZG A;  1PS9 A;  4H4U A;  5EB4 A;  1X2G A;  3DG7 A;  3KU9 A;  1JU2 A;  2V60 A;  4X9N A;  1DJN A;  2W3S A;  1GRT A;  4OVI A;  3IHM A;  4H4X A;  3PWI A;  5CKU A;  3U9I A;  2QJN A;  3N6H A;  3T37 A;  3SR6 B;  2X8H A;  2AR8 A;  4GME A;  4HN8 A;  3NYE A;  1N5W C;  2ZAD A;  2YG3 A;  2OQY A;  1EBG A;  1H7W A;  3NVW B;  1ZX9 A;  1WUE A;  5BUK A;  4IVM B;  4IHC A;  3RR1 A;  1MDL A;  4ENL A;  4ICY A;  4A5L A;  3GMB A;  3V3W A;  3LJP A;  1PJ5 A;  3KD9 A;  4H4V A;  3DGZ A;  2BRY A;  4TM1 A;  2AKZ A;  3AXB A;  3SZ0 A;  4MKS A;  3AE6 A;  2WQY A;  1NG4 A;  2Y6Q A;  2XVF A;  3P9U A;  4LA1 A;  4IV9 A;  2YLR A;  1LPF A;  2A8X A;  1K0L A;  3QVR A;  1ZKQ A;  3HYW A;  5FJP A;  3SZF A;  2WU2 A;  4KWS A;  5FJU A;  3P4R A;  1GAL A;  1JOA A;  2WPF A;  3UKH A;  3VRD B;  5HY5 A;  4I59 A;  2X99 A;  4A99 A;  1QJD A;  4Z43 A;  1GSN A;  4XWR A;  3C4A A;  1DOD A;  2WHD A;  3FYY A;  2Q0K A;  1Q9I A;  1CC2 A;  2NQL A;  3HYV A;  3DG6 A;  3ZDN A;  3FIM B;  2YM2 A;  1TDE A;  3DH9 A;  4II3 A;  3KUM A;  1SEZ A;  4A6N A;  2VZ2 A;  1K0I A;  3SZW A;  4J56 A;  3K1G A;  2I0Z A;  4A7A A;  1NG3 A;  2YVG A;  2F5Z A;  3VC6 A;  2BXS A;  1CJ4 A;  3AD7 B;  2HNE A;  1K4Q A;  3HW2 A;  5CQF A;  4P9S A;  4GAV A;  1XHC A;  3AE7 A;  3BSM A;  3S61 A;  1KFY A;  1GRB A;  2GB0 A;  3H12 A;  2VOU A;  3ABV A;  4REK A;  4BJY A;  2JK6 A;  3CTY A;  5KVH A;  3BOX A;  3DER A;  4X4J A;  4GF7 A;  1GES A;  1MDR A;  3AEE A;  2WDR A;  2TPR A;  3ZVI A;  1PJ7 A;  3R0U A;  1NAA A;  3MQT A;  3UTE A;  2OO6 A;  3DGH A;  1P2H A;  1R6W A;  1FO4 A;  4J1O A;  4B64 A;  3IJL A;  2RGO A;  4Y4M A;  3DA1 A;  4BK3 A;  2Z5Y A;  1BKH A;  3DJE A;  3CMM A;  3UCL A;  4BJZ A;  4OCG A;  2JB1 A;  3DJD A;  1N4V A;  2E1M A;  2BCP A;  2R0C A;  2WP5 A;  3M0O A;  1H2I A;  2PTX A;  4OPD A;  2QQ6 A;  3MWC A;  1CJC A;  4A9W A;  3QLD A;  4GIR A;  3AED A;  1JRY A;  2R0P A;  4PAA A;  4JNA A;  4M0X A;  4GFI A;  3UJS A;  2RGH A;  6ENL A;  2W54 A;  3R1Z A;  3T2Y A;  3BI4 A;  4H4W A;  3R11 A;  2WBA A;  1MRA A;  2APG A;  3VR8 A;  1DNC A;  2XH7 A;  4M6U A;  3CXB A;  1W4X A;  3V3N A;  3QJ4 A;  3QSM A;  4HNL A;  3D47 A;  2VVL G;  3ICS A;  3SFE A;  1NHR A;  3T9P A;  3SBF A;  3NRN A;  2YLW A;  1CHU A;  3AE2 A;  3OC4 A;  4YXD A;  2GMH A;  2ZC8 A;  1LVL A;  4EIQ A;  1SB3 B;  3VCC A;  4J34 A;  2GSH A;  1JRX A;  1F8R A;  3CNP A;  4MMW A;  4CRT A;  3CB3 A;  1FHU A;  4TVW A;  2O56 A;  3DME A;  2OAM A;  4JN8 A;  5KNL A;  4Z17 A;  2E5A A;  4YT0 A;  2PU1 A;  5EOW A;  4HCL A;  1NPX A;  1GT8 A;  3S47 A;  2XVI A;  2OVL A;  1N63 C;  4GR1 A;  3GYJ A;  2C3D A;  2IVE A;  4JDR A;  4RSL A;  3GYI A;  2GAG B;  1LQU A;  3UTF A;  4J2W A;  3B9J B;  3TWA A;  4H4P A;  3UP5 A;  3F8R A;  4K2S A;  1LTX R;  5C3J A;  2B76 A;  3SY4 A;  4FI4 A;  5FJR A;  3DEQ A;  1YQ4 A;  1JCT A;  3AYJ A;  4G9K A;  3QN3 A;  3LZX A;  2OPJ A;  3FCP A;  1S3B A;  4EQX A;  1P2E A;  5J04 A;  4NZH A;  1KN0 A;  4EMJ A;  2RAB A;  5DBJ A;  3MUC A;  1TE6 A;  2XFP A;  2AKM A;  3ALJ A;  1VG9 A;  3NKS A;  4HNC A;  2R46 A;  4EQW A;  1ZOY A;  3SGL A;  3H8L A;  2OLO A;  3Q4D A;  2ONE A;  1BGJ A;  3PS9 A;  3ZYX A;  2X8C A;  1PBC A;  1EBH A;  3D9X A;  4J57 A;  4IL2 A;  4G74 A;  3TTE A;  4H2H A;  3UKL A;  2WP9 A;  2R4J A;  3H8I A;  2XSX A;  1NU5 A;  1OEP A;  3CAW A;  3I6E A;  1KSS A;  3KPK A;  1MUC A;  3UKQ A;  1QLB A;  4E0V A;  4U8O A;  3SN0 A;  2XYO A;  2XVJ A;  2E4G A;  1NEN A;  3VA8 A;  1L9D A;  3UJF A;  3WE0 A;  3TOY A;  2B7S A;  1Q1R A;  3IF9 A;  5KOX A;  4DN1 A;  2QDD A;  1XPQ A;  5FJO A;  2PP3 A;  5BVA A;  3VFC A;  3RIT A;  4FX9 A;  2YWL A;  4E5T A;  1ZP0 A;  3K7T A;  2GGI A;  2WPC A;  1T3Q C;  3SJN A;  4IA6 A;  1JPD X;  2XGZ A;  2C67 A;  2YG4 A;  2POZ A;  2GF3 A;  3HYX A;  3RO6 A;  4O5Q A;  3HPF A;  1RYI A;  3N4F A;  1E1N A;  2GH5 A;  2CFY A;  3NVY B;  4OPT A;  4EM3 A;  3TW9 A;  4JNQ A;  2V5Z A;  3NXL A;  1REO A;  3C4N A;  1P43 A;  3GD4 A;  4X9M A;  3NN6 X;  3SSZ A;  2OX4 A;  5J7X A;  3NK0 X;  5BOE A;  4K5S A;  3NH3 X;  4YSH A;  1FEC A;  3P0W A;  4K8D A;  1H83 A;  2CVJ A;  1N62 C;  3AM9 A;  2OLN A;  4U8J A;  2A89 A;  3G5R A;  2QVH A;  2DKH A;  2Q6U A;  2NPX A;  3URH A;  4NWZ A;  3GYX A;  2EQ7 A;  2ZZ0 A;  3UTH A;  3ETR B;  1N60 C;  3R0K A;  2XVH A;  4NTE A;  1Q1W A;  3NG7 X;  1B8S A;  3V5F A;  3VRB A;  2HQM A;  1YQ3 A;  2GQW A;  2XLS A;  1DTN A;  2YR6 A;  2WEU A;  2XFO A;  1CC4 A;  4OPC A;  1GOS A;  3DDM A;  1GET A;  3CGE A;  1TDK A;  4HB9 A;  1PDH A;  4KPR A;  3UCD A;  1L0V A;  3GWD A;  3OTR A;  2BXR A;  3ITJ A;  4IP4 A;  3CND A;  4BUR A;  3QVP A;  1JPM A;  2YM1 A;  5HHF A;  4U8P A;  3BI5 A;  2GGE A;  3SYI A;  3ICR A;  4YKF A;  1DXL A;  1Y56 A;  3NN0 X;  3RCY A;  3D46 A;  3RGT A;  1E39 A;  3P4S A;  4N9X A;  3UKP A;  1SJA A;  4ZCD A;  3NYC A;  1TDN A;  3OPS A;  2W55 A;  3ZLG A;  4J33 A;  4J3Z A;  4K7Z A;  3RP6 A;  3LB8 A;  1O95 A;  1PBD A;  3NTD A;  1PBB A;  4HPN A;  3DK8 A;  1ELI A;  3ATQ A;  4LU6 A;  1E1K A;  3GDP A;  4H1Z A;  1DOC A;  2QCU A;  4U8N A;  3QFA A;  1GEU A;  3EAO A;  2Q7V A;  4AOX A;  4U8I A;  2C75 A;  1SJC A;  3KPF A;  2WS3 A;  3GSI A;  2C64 A;  4E4U A;  2YLZ A;  3K7M X;  1D4C A;  4K1W A;  2QGY A;  3NTA A;  2ARD A;  4JY3 A;  4G8T A;  4AT0 A;  2H88 A;  4KPL A;  5G5H B;  2ZZC A;  2GQF A;  2JB3 A;  4GGH A;  1O94 A;  3CNS A;  5IDZ A;  1BF3 A;  4F4R A;  2P88 A;  1EBD A;  2GMJ A;  1LQT A;  4H4Z A;  2WDQ A;  1PDZ A;  3DFH A;  3GRT A;  2GR0 A;  3CPH G;  4H83 A;  4CNJ A;  2PSN A;  3SQP A;  1CJ2 A;  1EL5 A;  1CJ3 A;  3L1R A;  3D8X A;  2BA9 A;  2C7G A;  1JNR A;  1L9E A;  3O0H A;  2AAQ A;  3H8A A;  1GND A;  2FJE A;  3NVZ B;  1NHP A;  2BS4 A;  1E1M A;  1MOK A;  1AOG A;  1ZXI C;  3II4 A;  4M52 A;  3R25 A;  1H84 A;  4G7F A;  3FV9 A;  1GPE A;  2RGJ A;  2W0H A;  3T31 A;  4Z24 A;  3LZW A;  5JCK A;  2DW6 A;  1STZ A;  3CPJ G;  4GGB A;  2GR3 A;  1IUU A;  1FEA A;  3AD8 B;  1X2H A;  5KMS A;  3NIX A;  3AEG A;  1E1L A;  3AE4 A;  4ZOH B;  1NHS A;  3QKE A;  2FBW A;  2J3N A;  4EMW A;  3IHG A;  1TRB A;  2OZ8 A;  4NEV A;  4CY8 A;  2C76 A;  2E5V A;  2EQ6 A;  2XLT A;  3BNU A;  3EEZ A;  3TWB A;  4KT2 A;  4BK1 A;  2PHH A;  3EPT A;  2AQJ A;  3C96 A;  2UZZ A; 
#chains in the Genus database with same CATH homology
 1FOH A;  1ZMC A;  1YQ4 A;  3B6D A;  2OAL A;  3AYJ A;  4Y4L A;  3UKF A;  3UOZ A;  4UDR A;  4G9K A;  4B69 A;  3I3L A;  5M0Z A;  3AEF A;  4YKG A;  4B1B A;  4U2T A;  1E7P A;  2B9X A;  2JB2 A;  3DJJ A;  3L8K A;  2BS3 A;  4GCM A;  4EIP A;  3RHA A;  4YSX A;  1GRA A;  2ACZ A;  2XLR A;  3LZX A;  1L9C A;  2GV8 A;  1S3B A;  5EB5 A;  3B3R A;  4EQS A;  4EQX A;  1PBF A;  4CCQ A;  4BV6 A;  1RP0 A;  1P2E A;  4H50 A;  4NZH A;  1PXC A;  1KN0 A;  4EMJ A;  1MO9 A;  5EBK A;  1OJA A;  2RAB A;  2VRM A;  1BWC A;  1D5T A;  2JKC A;  3T2K A;  4GRT A;  5DBJ A;  4USR A;  3M13 A;  5L46 A;  3M12 A;  3SM8 A;  4C74 A;  3AEC A;  4LII A;  2WU5 A;  2XFP A;  4K2X A;  3ALJ A;  4H2N A;  2QAE A;  4JQ9 A;  1VG9 A;  3NKS A;  1IUX A;  1D4E A;  2R46 A;  4EQW A;  3ISH A;  1ZOY A;  4TLZ A;  4A79 A;  4U8M A;  1GER A;  2X3N A;  3SGL A;  3ATR A;  5TR3 A;  4DGK A;  1CF3 A;  2CUL A;  3G5Q A;  5GSN A;  4UDQ A;  3H8L A;  1B37 A;  2OLO A;  5FS8 A;  5C2T A;  1BGJ A;  1ZY8 A;  5KRQ A;  1IUV A;  3PS9 A;  3ZYX A;  2X8C A;  2X8G A;  1PBC A;  4UDP A;  4D04 A;  1H7X A;  1KNP A;  3D9X A;  4DSH A;  3DK4 A;  1EL7 A;  4J57 A;  3NLC A;  3NT6 A;  1H6V A;  1Y56 B;  4G74 A;  1BKW A;  1PS9 A;  4H2R A;  4AP1 A;  1XAN A;  3E1T A;  2BAB A;  2WP9 A;  1O5W A;  4H4U A;  4XXG A;  3UKL A;  3COX A;  2R4J A;  4JN9 A;  1ZOV A;  2V6O A;  3QSS A;  5EB4 A;  3H8I A;  4H4S A;  1TYT A;  3KU9 A;  4G6H A;  2B9W A;  5FMH A;  3UTG A;  4YTN A;  3BHK A;  2BK3 A;  1JU2 A;  1D7Y A;  2V60 A;  2R4E A;  4X9N A;  1D4D A;  1YKJ A;  2EQ8 A;  1DJN A;  1KSS A;  1GRT A;  5JCN A;  2WET A;  3KPK A;  3AD9 B;  4OVI A;  3VQR A;  2WOI A;  3IHM A;  3UKQ A;  4H4X A;  3VRA A;  2QA2 A;  1QLB A;  1S2Y A;  4ZCC A;  5KOW A;  2VVM A;  5CKU A;  1Z6L A;  2IID A;  4U8O A;  4B67 A;  4E0V A;  4U2S A;  3T37 A;  5HXI A;  3UKK A;  1H82 A;  2XVJ A;  2XYO A;  4Z25 A;  5M10 A;  2E4G A;  1NEN A;  2GR1 A;  2X8H A;  2AR8 A;  1L9D A;  2XFN A;  1M6I A;  5FS6 A;  3T0K A;  3WE0 A;  2B7S A;  1Q1R A;  3IF9 A;  1DOE A;  3NYE A;  2YLS A;  5IPY A;  3CGD A;  5KOX A;  1FEB A;  4Y4N A;  1XPQ A;  2YG3 A;  5KWF A;  2C73 A;  1DOB A;  2EQ9 A;  5BVA A;  3QFB A;  1H7W A;  4U8L A;  2BCG G;  4FX9 A;  1ZX9 A;  2YWL A;  4A65 A;  3NYF A;  3LXD A;  5BUK A;  1FL2 A;  1ZP0 A;  4FDC B;  3K7T A;  3PO7 A;  2WPC A;  4IVM B;  2GR2 A;  3V76 A;  1FCD A;  4DSG A;  5ER0 A;  3LAD A;  4RG4 A;  4IA6 A;  4TLX A;  2A87 A;  4ICY A;  4A5L A;  4EMI A;  2B9Y A;  2C67 A;  2YG4 A;  2GF3 A;  3GMB A;  3HYX A;  3L5O A;  4Z2T A;  3AE9 A;  1PJ5 A;  3LJP A;  3KD9 A;  4USQ A;  4A6N B;  1PN0 A;  4H4V A;  4O5Q A;  3DGZ A;  1RYI A;  2YLT A;  2R0G A;  2BRY A;  4TM1 A;  2BYB A;  2WDV A;  1E1N A;  2GH5 A;  3NGC X;  2FJA A;  2CFY A;  4OPT A;  4EM3 A;  1GV4 A;  1KSU A;  2WOV A;  3CGC A;  4JNQ A;  2V5Z A;  3AXB A;  3S5W A;  3SZ0 A;  1MXT A;  3LOV A;  5JCI A;  2X50 A;  3AE6 A;  1REO A;  2WQY A;  1F8S A;  1NG4 A;  1GRG A;  1M64 A;  2Y6Q A;  2XVF A;  3C4N A;  3AYI A;  5IQ1 A;  4X9M A;  1F3P A;  3GD4 A;  4LA1 A;  3P9U A;  4IV9 A;  2YLR A;  3NN6 X;  3KKJ A;  3RP8 A;  4YSY A;  1LPF A;  2A8X A;  3ADA B;  1K0L A;  3NK1 X;  5J7X A;  3QVR A;  2BC0 A;  4TM3 A;  3NK0 X;  1IUS A;  1ZKQ A;  3HYW A;  4K5S A;  3NH3 X;  4YSH A;  1FEC A;  4K8D A;  2XCG A;  3D1C A;  3SZF A;  1H83 A;  1KNR A;  2BS2 A;  2CVJ A;  2WU2 A;  4AP3 A;  2OLN A;  4OPG A;  4U8J A;  4B68 A;  1KF6 A;  4D03 A;  4U8K A;  2A89 A;  3G5R A;  1GAL A;  1JOA A;  2WPF A;  1GTE A;  3P4R A;  3UKA A;  3UKH A;  3VRD B;  2DKH A;  2Q6U A;  5HY5 A;  2B7R A;  2GRT A;  2NPX A;  1N4W A;  3KLJ A;  3URH A;  1NDA A;  2EQ7 A;  2ZZ0 A;  3GYX A;  4NWZ A;  4PAB A;  3UTH A;  2NVK X;  4C3X A;  3SX6 A;  4I58 A;  4I59 A;  4G6G A;  1S2Q A;  3EF6 A;  2X99 A;  4A99 A;  2XVH A;  4YWO A;  3BI2 A;  3CGB A;  3CPI G;  3GWF A;  4NTE A;  2BK4 A;  1QJD A;  2V3B A;  3V3O A;  4Z43 A;  3R9U A;  1GSN A;  3T2Z A;  1ZMD A;  1Q1W A;  3C4A A;  1DOD A;  4XWR A;  3VR9 A;  3NG7 X;  4H2P A;  2WHD A;  3ALM A;  1B8S A;  3VRB A;  4J31 A;  3IWA A;  2Q0K A;  2JBV A;  1Q9I A;  2HQM A;  1CC2 A;  1YQ3 A;  4B65 A;  2GQW A;  2XLS A;  3HYV A;  2YR6 A;  2WEU A;  2XFO A;  2YVF A;  1CC4 A;  2H89 A;  4OPC A;  1GOS A;  3ZDN A;  1GET A;  3FIM B;  3SZC A;  2YM2 A;  1Y0P A;  1TDE A;  3CGE A;  3DH9 A;  4II3 A;  3H4K A;  4J36 A;  1SEZ A;  1TDK A;  4UP3 A;  4A6N A;  4HB9 A;  2VZ2 A;  1K0I A;  3SZW A;  4J56 A;  2BRA A;  2I0Z A;  1PDH A;  5KMQ A;  4A7A A;  1NG3 A;  2YVG A;  2F5Z A;  4KPR A;  3GMC A;  2BXS A;  1CJ4 A;  3ALL A;  3P4Q A;  3GWD A;  4Z44 A;  3AD7 B;  2BXR A;  3ITJ A;  4GDP A;  1L0V A;  3DJG X;  5GRT A;  1K4Q A;  1OJ9 A;  5CQF A;  3CND A;  4P9S A;  4GAV A;  1NEK A;  1XHC A;  4B66 A;  1GTH A;  3AE7 A;  3AE8 A;  3P1W A;  4BUR A;  4KX6 A;  4NNJ A;  3SFD A;  3QVP A;  1V59 A;  4IVO B;  3S61 A;  1KFY A;  1GRB A;  2YM1 A;  2GB0 A;  3AB1 A;  5HHF A;  2VOU A;  3ABV A;  4U8P A;  3BI5 A;  4REK A;  2PYX A;  4YTP A;  2XFQ A;  5LV9 A;  2R45 A;  2CDU A;  1S3E A;  2BK5 A;  3RP7 A;  3SYI A;  4G73 A;  1TYP A;  2JK6 A;  3CTY A;  3ICR A;  4BJY A;  4YKF A;  4O5U A;  1DXL A;  1Y56 A;  3UP4 A;  5KVH A;  3NN0 X;  4ZN0 A;  3AE1 A;  3CIR A;  3Q6J A;  1E39 A;  3KVE A;  4X4J A;  1ZDL A;  4GF7 A;  2WP6 A;  3P4S A;  4N9X A;  3UKP A;  1LJ1 A;  3K7Q X;  4OPI A;  4WCT A;  5HYM A;  4ZCD A;  3NYC A;  1TDN A;  1ONF A;  3EAN A;  1GES A;  2WPE A;  3AEE A;  5KMP A;  4J33 A;  1KDG A;  4YTM A;  2WDR A;  1OJD A;  2TPR A;  4K7Z A;  1B5Q A;  3FMW A;  2Q0L A;  3RP6 A;  2WES A;  2XFU A;  4AT2 A;  3LB8 A;  3SXI A;  1O95 A;  1PBD A;  1PJ7 A;  3NTD A;  1PBB A;  1PHH A;  1LV0 A;  2C66 A;  1NAA A;  3FG2 P;  5U1O A;  3DK8 A;  1ELI A;  3ATQ A;  3UTE A;  3DGH A;  4LU6 A;  4C5O A;  1P2H A;  1E1K A;  3GDP A;  1NHQ A;  5JRB A;  4NEW A;  5JCM A;  3KA7 A;  1GRF A;  3AEA A;  4Y4M A;  2C65 A;  2RGO A;  1DOC A;  4B64 A;  2QCU A;  1YQZ A;  3RNM A;  4EQR A;  2ZZB A;  3F8P A;  3DA1 A;  1GXF A;  3GRS A;  4BK3 A;  2Z5Y A;  2BC1 A;  4U8N A;  3QFA A;  4RG3 A;  1GEU A;  3EAO A;  2Q7V A;  4K5R A;  3DJE A;  5FS7 A;  2YR4 A;  3CMM A;  4AOX A;  4U8I A;  2C75 A;  3UCL A;  4BJZ A;  4OCG A;  3NK2 X;  2YG6 A;  3KPF A;  2JB1 A;  3DJD A;  2WS3 A;  3GDN A;  2C64 A;  3GSI A;  1N4U A;  3GD3 A;  5JCL A;  1N4V A;  2YLZ A;  2E1M A;  2BCP A;  2R0C A;  2V3A A;  2WP5 A;  2YG7 A;  3M0O A;  4TM4 A;  4CCR A;  2GAH B;  1H2I A;  2VQ7 A;  1D4C A;  3K7M X;  3NHO X;  4C77 A;  4OPD A;  1VG0 A;  4GAP A;  3BNM A;  4HA6 A;  3NTA A;  3RED A;  1GRH A;  2ARD A;  2V61 A;  4JY3 A;  1CJC A;  2Y6R A;  4A9W A;  4XWZ A;  2GVC A;  3AWI A;  4WX1 A;  4H4T A;  2YG5 A;  1IJH A;  4AT0 A;  2ZBW A;  3AED A;  2H88 A;  2YR5 A;  4BK2 A;  1JRY A;  5KXJ A;  4DNA A;  2R0P A;  4PAA A;  3AE5 A;  4Z2R A;  2ZZC A;  1XDI A;  1N1P A;  4JNA A;  1H81 A;  2GQF A;  4OPL A;  2JB3 A;  1JRZ A;  2C4C A;  2RGH A;  1EL9 A;  1E6E A;  1O94 A;  2FJB A;  2YVJ A;  4FK1 A;  1OJC A;  3CNS A;  1CC6 A;  2BAC A;  4OPU A;  3T2Y A;  3BI4 A;  3UOY A;  4H4W A;  2C72 A;  3T14 A;  1BF3 A;  4CY6 A;  2WBA A;  2APG A;  2GEW A;  1K0J A;  1EBD A;  3VR8 A;  3CNJ A;  5BRT A;  1DNC A;  2GMJ A;  3Q9T A;  1LQT A;  4H4Z A;  3QSE A;  1W4X A;  3CN8 A;  3V3N A;  2WDQ A;  3OZ2 A;  4MJW A;  3QJ4 A;  3FPZ A;  3GRT A;  3QSM A;  2GR0 A;  3CPH G;  1S7M A;  3JSK A;  4CNJ A;  4YSZ A;  1ZK7 A;  5IQ4 A;  2R9Z A;  5FS9 A;  3UOV A;  3PVC A;  3SQP A;  1HYU A;  1CJ2 A;  1H86 A;  1EL5 A;  2VVL G;  1CJ3 A;  4K22 A;  3AEB A;  3ICS A;  4NTC A;  3SFE A;  3L1R A;  1NHR A;  3D8X A;  2BA9 A;  2FJD A;  3CNT A;  2C7G A;  4FK1 C;  1F8W A;  1JNR A;  2YLW A;  3NRN A;  4ADW A;  1CHU A;  1L9E A;  3O0H A;  3AE2 A;  3OC4 A;  2XDO A;  4YXD A;  1IUW A;  4U2L A;  5KMR A;  4CBQ A;  3K30 A;  3NNE A;  2GMH A;  1COY A;  2AAQ A;  1BGN A;  1GND A;  1LVL A;  1CL0 A;  1PJ6 A;  4EIQ A;  2FJE A;  1VRQ B;  4J34 A;  1TDF A;  4B63 A;  1JRX A;  5KVI A;  2XVE A;  1F8R A;  1NHP A;  3IC9 A;  4Z26 A;  1UKV G;  3FBS A;  4NTD A;  3CNP A;  3P4P A;  2BS4 A;  1E1M A;  4CRT A;  1MOK A;  1AOG A;  1OJT A;  3PG6 A;  3AE3 A;  1PBE A;  2JAE A;  1PXB A;  5U25 A;  3II4 A;  5BUL A;  3DME A;  4M52 A;  1H84 A;  1GPE A;  1D7L A;  2RGJ A;  3T31 A;  2W0H A;  4CNK A;  2OAM A;  4C3Y A;  1VQW A;  4Z24 A;  5KNL A;  3LZW A;  2VQB A;  2WOW A;  5JCK A;  4H7U A;  2YLX A;  4ECH A;  4YT0 A;  5EOW A;  4H4R A;  3CPJ G;  1EL8 A;  4II2 A;  5U63 A;  1DJQ A;  4EM4 A;  2GR3 A;  1NPX A;  1IUU A;  1GT8 A;  4Z2U A;  1FEA A;  3AD8 B;  2Z5X A;  5J60 A;  1PXA A;  1B4V A;  1JEH A;  3HZL A;  2DKI A;  2XLU A;  2XVI A;  5KMS A;  2C70 A;  2VVL A;  3NIX A;  2IVD A;  3AYL A;  2TMD A;  3AEG A;  1X31 B;  1E1L A;  2O9Z A;  4GR1 A;  1YY5 A;  3I6D A;  3AE4 A;  1NHS A;  4H4Y A;  3GYJ A;  4H4Q A;  1VDC A;  2J3N A;  2FBW A;  3ICT A;  4IA5 A;  2C3D A;  2IVE A;  4JDR A;  2C3C A;  4RSL A;  3GYI A;  4EMW A;  3IHG A;  4TM0 A;  2GAG B;  1TRB A;  3G5S A;  1QO8 A;  1F6M A;  1LQU A;  2YQU A;  4NEV A;  4CY8 A;  2C76 A;  2E5V A;  1IUT A;  1JNZ A;  3UTF A;  4GUV A;  4J2W A;  2YAU A;  4GDE A;  4JY2 A;  2EQ6 A;  2XLP A;  4H4P A;  2OA1 A;  3UOX A;  2XLT A;  3BHF A;  3F8D A;  3BNU A;  1BZL A;  1TDO A;  1RSG A;  3F8R A;  1CBO A;  3UP5 A;  4APN A;  2VRL A;  2QA1 A;  3DK9 A;  1LTX R;  4BK1 A;  5C3J A;  2B76 A;  2PHH A;  3EPT A;  4AOS A;  2AQJ A;  3C96 A;  2UZZ A;  4H2Q A;  1GRE A;  3SY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...