3TTEA

Crystal structure of enolase brado_4202 (target efi-501651) from bradyrhizobium complexed with magnesium and mandelic acid
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
361
structure length
361
Chain Sequence
b'MMTTAAITGVTARAVITPMKRPLRNAFGVIDSGPLVLIDVTTDQGVTGHSYLFAYTRLALKPLVHLVEDIGRELAGKALVPVDLMKAMDAKFRLLGWQGLVGMAVSGLDMAFWDALGQLAGKPVVELLGGSARPIPAYDSYGVLDARDDERTLRTACDEHGFRAIKSKGGHGDLATDEAMIKGLRALLGPDIALMLDFNQSLDPAEATRRIARLADYDLTWIEEPVPQENLSGHAAVRERSEIPIQAGENWWFPRGFAEAIAAGASDFIMPDLMKVGGITGWLNVAGQADAASIPMSSHILPEASAHVLPVTPTAHFLEVLDFAGAILTEPLRVIDGKVTAKGPGLGLAWNESAVAKYQVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal Structure of Mandelate Racemase from Bradyrhizobium Sp. Ors278
rcsb
source organism Bradyrhizobium sp. ors 278
molecule tags Lyase
total genus 125
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature ec 5.1.2.2: Mandelate racemase.
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3tteA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3tteA01
4A6GA 2OLAA 2XH2A 3FYYA 4GGHA 3V5CA 2QGYA 1TE6A 3MSYA 2MUCA 2AKZA 4KPLA 3N4EA 2XH4A 2I5QA 3H12A 3TQPA 3VC6A 2GL5A 3UJSA 2ZC8A 3R10A 1E9IA 3VDGA 2PU1A 3BOXA 4E4UA 2FKPA 3IJIA 1SJCA 1EBHA 4DYEA 2QJJA 3VC5A 5FJRA 3CT2A 1DTNA 3GD6A 2GGHA 3FV9A 3RGTA 1RVKA 2P8CA 4M6UA 4FI4A 4HNLA 3TJ4A 3FXGA 2DW7A 3ZVHA 4DXKA 2PS2A 3I6TA 2QDDA 2PSNA 2OQHA 1PDYA 4HCDA 4E6MA 1ONEA 3R25A 3RCYA 4HCLA 1FHUA 3QLDA 4GISA 4ENLA 1MNSA 2XGZA 2POZA 4MMWA 2QQ6A 2PCEA 3OPSA 3TJIA 2OPJA 4GIRA 3D47A 3NFUA 3ZLGA 1XPYA 1EC8A 1TKKA 4GMEA 3QN3A 1MUCA 3IJLA 3BSMA 4ROPA 3T6CA 3KUMA 3ES7A 3SQSA 3DDMA 2O56A 3UJ2A 2OZTA 3V3WA 4DX3A 1EC9A 4K1WA 3P0WA 3MKCA 4FP1A 2OKTA 2QDEA 4Z17A 3RITA 3UXLA 4H1ZA 3UGVA 3MY9A 7ENLA 1EC7A 4F4RA 4MGGA 1IYXA 4J1OA 3SSZA 2NQLA 3P93A 4IL0A 2OQYA 3PFRA 3K1GA 1BKHA 3SN4A 4E5TA 3B97A 2PTYA 4KWSA 4HCHA 5EU9A 2AL2B 2GDQA 3QPEA 3EEZA 4KT2A 1WUFA 2OZ8A 2PA6A 1SJDA 3SJNA 2PGEA 4A35A 3PK7A 4E4FA 4DN1A 2CHRA 4JN7A 3SN0A 1BQGA 3DESA 4DWDA 3TW9A 3MUCA 3S5SA 1W6TA 2FYMA 3H7VA 2GGGA 3DG7A 4HN8A 4G7FA 5IDZA 4J3ZA 3DEQA 3UCDA 1SJBA 5BOEA 3GC2A 3Q45A 3STPA 3R11A 2GGIA 3DFHA 1XS2A 2QVHA 2XSXA 2OFJA 1MDRA 4H19A 4YWSA 3HPFA 2ONEA 2OG9A 4IL2A 4M0XA 4HNCA 4H2HA 1R6WA 3OTRA 3FCPA 4Z1YA 1WUEA 4X2PA 1P43A 4DHGA 2PP3A 1NU5A 3N4FA 3SBFA 3R1ZA 1F9CA 2DW6A 3VCCA 2OX4A 3DIPA 1PDZA 4IP5A 2QJMA 5J04A 5FJOA 3UJFA 3IK4A 3N6HA 4K2SA 1MRAA 1ECQA 4EWJA 3MZNA 2AKMA 4ZA0A 2HXUA 3R0UA 3CAWA 4HYRA 1ELSA 3PWIA 2HXTA 4JN8A 3Q4DA 2PU0A 3SN1A 3QKEA 4GFIA 3ZLHA 1NELA 1SJAA 2HNEA 3U9IA 3H8AA 2P3ZA 1KD0A 3ENLA 1FHVA 3I4KA 3OP2A 3OZMA 3VFCA 3RO6A 3I6EA 4IHCA 2GGJA 3PWGA 4MKSA 2P0IA 3MWCA 2OO6A 4IZGA 3ZVIA 2GGEA 3V5FA 1TZZA 4GYPA 3DG6A 3ES8A 6ENLA 1YEYA 2PTWA 3VCNA 3FJ4A 3THUA 4A3RA 4JHMA 3OZYA 2OVLA 5FJUA 3FVDA 1KCZA 1JPDX 3RR1A 2AL2A 4K8GA 1OEPA 3TWBA 1EBGA 3CB3A 3TOYA 3GO2A 3N6JA 3ZVHB 3ZLFA 3RRAA 1MDLA 1JCTA 3DGBA 2GSHA 1L8PA 2XH7A 5ENLA 3V4BA 2XH0A 2QJNA 4IT1A 4E8GA 3UCCA 2PPGA 3GY1A 2PTZA 1JPMA 3JW7A 3OW1A 2HZGA 2P8BA 3DFYA 3U4FA 2AL1A 5FJPA 3BJSA 3QTPA 2PP1A 3T8QA 3CYJA 3H70A 3R0KA 3T9PA 4GYPC 3TCSA 3DG3A 3P3BA 2MNRA 3EKGA 3TTEA 1KKOA 3D46A 3VA8A 3JVAA 2PTXA 5BOFA 3MQTA 3CK5A 4ZCWA 3NXLA 2PP0A 3UJEA 2PODA 2ZADA 2P88A 3DERA 3CXOA 3UXKA 5FJTA 1R0MA 1KKRA 4GGBA 2RDXA 4IP4A 3IJQA 4KEMA 2PMQA 3JZUA 1P48A 2PGWA 1JDFA 3S47A 4G8TA 3TWAA 3UJRA 3T4WA 3NZGA 4H83A 3NO1A 4HPNA 2OZ3A
chains in the Genus database with same CATH superfamily
4HK6A 3C2YA 1W5QA 4KFOA 3F5JA 2XIMA 5HPCA 1EYEA 4UQEA 3W02A 1E73M 2ZFAA 4LNYA 5IOBA 6CGTA 3VD5A 3QV7A 1YQZA 4LCRA 4CU7A 2HEJA 3S9IA 2WOVA 3P5YA 3L2IA 1XBZA 5G5HB 3BLKA 2FKPA 3LU2A 2DT2A 4M3PA 4CNNA 2CXEA 1QUMA 4XZWA 3HZ3A 3MPGA 5CZ0A 4WSHA 3LTYA 2GQAA 1M01A 2GWGA 2BSLA 5C9RA 1UH3A 1SFSA 2OYMA 3QHNA 4DY1A 2QUUA 3A7RA 1C8QA 1EO7A 1ZJBA 1TV8A 3R25A 3GH5A 1EJRC 1XSIA 1LUCA 2WBGA 3H2EA 1TTPA 2XGZA 1NPXA 1PBGA 4B2DD 1IIGA 3WH9A 4KEUA 2A3EA 3SGUA 3LERA 5CBBA 1BYCA 3G0SA 4CCZA 4FIRA 4CQAA 3NQ2A 4F2BA 5AFDA 1OT2A 3UJ2A 1Q7QA 1R2RA 8CGTA 5HULA 3RN6A 2WZTA 3BSGA 1W1YA 4LYQA 3N18A 4FXRA 4WJXA 2EXOA 7REQB 1IYXA 4EAYA 4S38A 3RMJA 4JGDA 2W4XA 1U1HA 1PTDA 1OJTA 3L4WA 5CG7A 3TOPA 1CCWB 2A2IA 3CWNA 2NXHA 3GHSA 4O17A 3WBAA 4UFJA 1GREA 3CAQA 1YPXA 3W1NA 1JZ3A 4OZOA 2V9DA 4GH3A 1W8GA 3AAMA 4H4XA 2Y5JA 1A49A 1KV8A 3CZEA 1E1CA 4GI6A 4HN8A 3JRKA 3UZYA 4BZYA 3GIYA 4MNJA 1WXZA 4RZ5A 1ZNNA 3HV9A 4H50A 5BOEA 4HU0A 1UZ4A 2BC1A 3EX2A 3MU7A 1XS2A 1HTIA 3HG5A 4GIAA 1S2VA 5RUBA 1B3OA 5DN1A 1IEVA 5CSUA 3WMLA 4YWSA 3L23A 1SZGA 3MP5A 1QOXA 3S6OA 5LHFA 3CZGA 4YCOA 3TZNA 2ISSA 3QW4B 1K3UA 3M0MA 4N0RA 3BSHA 1QT1A 3W1RA 1JDEA 4CD6A 2Z6IA 3NZ1A 1GZJA 4QSFA 3H2AA 3PBVA 2TRSA 5AC4A 2X8RA 5I3HA 5AOUA 4XUYA 2E8YA 3THQA 2P3EA 1VHCA 1TVLA 4U31A 2VD9A 5AVHA 4ES4A 5MKGA 3I65A 1TYGA 5A5WA 3R0UA 1R86A 2VQTA 1OD8A 3RDKA 3T08A 3I7RA 4FX8A 1HKJA 2J9XA 1EL3A 4CN6A 1F74A 4S2CA 1XJBA 1XC6A 3Q4DA 3KLKA 5I00A 2HNEA 3F2CA 4B5NA 1CECA 2XSBA 1JUKA 2XN1A 4DIAA 4L1XA 1Y5WA 2F2KA 4S3EA 4DO5A 1BWVA 2A7NA 4IJCA 2EPOA 2EG7A 1GKQA 1VF8A 3CHCA 3S5OA 1VRDA 3D6NA 4GK8A 2QDHA 2G50A 4R7OA 3CL8A 2B81A 3NL3A 2BVWA 2WVSA 1Q3NA 3EB2A 1CLKA 3SRFA 1XBYA 4IZGA 3C5QA 2V3DA 3BG9A 5DF0A 5CC5A 3WQCA 2GOKA 3IPWA 3G77A 1DJQA 3CJPA 2ZIDA 4HNOA 3SAZA 1BD0A 1J10A 3T7VA 1LG2A 4JTIA 2ZE3A 2G5WA 4PH6A 1CTNA 1WBJA 2E9MA 1Q4NX 1E56A 3AXKA 1A5NC 1K4QA 3CB3A 3FYPA 3K5XA 3N6JA 4JYDA 3IVUA 3PB0A 1QDSA 1EJVC 1QBBA 4LIIA 3CIVA 3HURA 1SFTA 1RJRA 4DF0A 1J0HA 2Y6ZA 3HFYA 3S9YA 3ISIX 3HTWA 3ONBA 1VC4A 3FHAA 1JI1A 1B1YA 3E0IA 3MJMA 2VEKA 4XBSA 3FN9A 3EX3A 3AS3A 3PR2A 3U4FA 4LVFA 3K4WA 4MY1A 5FJPA 4AVNA 1P6CA 4AYGA 5DT7A 1KBIA 1PX3A 3NQ8A 1W32A 2WQPA 4M56A 3SM0A 1X6NA 4LCSA 4QJ1A 3CHFA 1Q6LA 3A7UA 4H8HA 2VCCA 2WMKA 2W79A 2DIJA 2QXWA 4U5IA 5AB3A 5LNRA 2WOWA 2FVLA 2VCBA 2VWTA 5DCEA 1WXYA 2FH6A 1XGEA 3LLXA 3MKKA 1TTQA 4D6FA 3BK0A 3GIPA 4IIBA 2J9YA 3LUTA 4N42A 2XVNA 3F2DA 2P50A 5XINA 4Z2JA 3LHZA 1R3WA 1R85A 1FWNA 1GV4A 5FF7A 2PE4A 4AZBA 1QW7A 2YLAA 3I6RA 2VX5A 3PZMA 2W0HA 2BVYA 2CZEA 4RLIA 4H4RA 4QR6A 4M6QA 4RPPA 4O19A 3SECA 1W17A 3S1VA 4ZTXA 2QUVA 3KWXA 5CSYA 2HK0A 4Q6JA 2QKFA 4PUEA 4KPLA 4BURA 1XWYA 4RE0A 2I1OA 3LOTA 4H4YA 5LNVA 4MLJA 3U7VA 1HJSA 1V97A 4NAFA 1UKTA 1AMKA 4K37A 1KGUA 3WLMA 4E4UA 3SB0A 4FX6M 1EDGA 2YXXA 2CYGA 2P8CA 2Z28A 4NX5A 2IPFA 3SCQA 4DUVA 1HL9A 3WQPA 4MIMA 3W7GA 5E70A 2NLIA 1JDDA 4TO8A 3URAA 1A5LC 3GRTA 2YL8A 3LX9A 4FR6A 3ARQA 2G41A 1RCOB 2V5JA 1DJNA 4IGSA 2FZDA 4CCDA 1JF5A 3WLRA 5ABGA 3ZLGA 2GJPA 3BJTA 4WRHA 1NDAA 3V18A 1E5NA 4ROPA 2EO7A 1XW8A 3HG3A 4FX9A 2C91A 1RXOB 3VIFA 1BVWA 1KTBA 2G8ZA 3DDMA 1GEQA 1B0IA 2PGRA 1WZMA 3DECA 1A53A 4ZB2A 3LHVA 2EJ1A 3EPMA 4R53A 4YMZA 3F7JA 5CSRA 3QV6A 3L21A 5D2TA 2QJGA 4QM1A 1MYRA 3MCNA 1EPXA 4M24A 5BRQA 2YL6A 2PCQA 4IUOA 3M07A 1OC6A 3MV11 1GRAA 1VJZA 1V3IA 3LQLA 3E0VA 1TMHA 3PFRA 4JNZA 2E1WA 4BEUA 5G1YA 4PRTA 2PTYA 3BCFA 1VQZA 2VI0A 4O10A 4JD4A 3DAQA 5FEXA 5FEZA 5EBUA 1IF2A 3HGSA 5EBAA 2W66A 3VIPA 4ACZB 1IT0A 1KTNA 4GOAA 2XM2A 2WPEA 4DN1A 1ZJHA 4JTTA 4PB4A 4XZHA 1K6WA 4GINA 2HS8A 2EF9A 2YBTA 2NT1A 4R88A 1XLCA 4IMCA 1W6TA 2ZUTA 4ADSA 3GFXA 3W2LA 2PRLA 4Y2WA 3KL3A 4P7QA 2QYGA 3ARUA 3LCFA 2RH9A 3LTSA 1JUEA 2GGIA 4AZCB 3OOQA 1HN1A 4Y7EA 3M1ZA 1MDRA 2WB5A 2TAAA 4D6IA 1VLWA 2X1RA 3BZJA 4TVDA 2ZCGA 2A5HA 1XG3A 2JEPA 3KOZA 1N7KA 3FCPA 1FHLA 1ME9A 1QNSA 2P1FA 4X2PA 3B3DA 3GAYA 4BEQA 3H23A 1V51A 3ZIZA 1V0LA 4B91A 3TTSA 2J79A 4I7UA 5D9OA 4GJ1A 3VCCA 4G7EB 1MO0A 3HPAA 3DIPA 2XSAA 3GXIA 1PDZA 1BGAA 3T0TA 2GQWA 1IWAA 2CXGA 4XZMX 5J04A 1GOMA 3CYVA 1H5YA 1JG9A 2AKMA 1TZ9A 3NNTA 4FLQA 1EJTC 1GOWA 1IWBA 2OGJA 2QCFA 5KEZA 5JU6A 3T0DA 2WMFA 4B9ZA 1NSJA 4Y8FA 1QJWA 1S2UA 1FWTA 2G0WA 4K36A 1NELA 3N12A 2WC3A 4IQLA 1GRBA 3GK0A 3AM9A 2WCGA 5HUOA 5FF4A 3S5YA 4HU3A 3DBPA 2P53A 4RX0A 3WEMA 4HNTA 4DJFA 5I6SA 1J8VA 3PJTA 3W2KA 2EAWA 1DQXA 4CQBA 2ZUSA 4TQTA 1G9HA 2GPTA 5E9AA 4XAZA 3AXIA 1FWFC 4QE5A 3IARA 3T4CA 3EA2A 3VU2A 3HG4A 4DAIA 1UC5A 4UC5A 1TIMA 2HE8A 4C7DA 1XH0A 3VKCA 3K4DA 3B9AA 2ISVA 3RYSA 2GVLA 1W37A 3GNXA 4Q4OA 4AMAA 2HQMA 2PDGA 5DQPA 2GUUA 2FFIA 1V08A 2CBIA 4JY9A 4LRSA 1S3HA 1FUYA 1S1RA 4OU1A 2Y7FA 3WF2A 1LRTA 1BEUA 3WK1A 5T9BG 1R3QA 1GTHA 4PMQA 1F4HA 4LRTA 3U2CA 4WK9A 4FOKA 4BS0A 2WV8A 3WUGA 4FDCB 3H70A 2PGFA 2D73A 4JXCA 1KFLA 3KL5A 3T78A 4S3KA 1M7PA 1KNWA 3NQ6A 4A22A 3GKAA 1A47A 5BOFA 2DEPA 4J56A 3CHVA 5AHLA 3DI1A 4KS0A 1CENA 4HMEA 2WKJA 2PODA 1K1DA 1JCXA 3R12A 2VQUA 3OLGA 6TAAA 4LNCA 4FALA 4BF9A 1L6WA 3MO7A 2GFTA 2QEZA 3VDBA 3IIPA 4UTLA 3ABQA 3BGAA 1NWTA 4K7YA 3WQ6A 3ZSTA 3ETRB 2GJNA 2Y7EA 3N9KA 2VZVA 3MBDA 2ACUA 2D0FA 3ZT7A 3SW6A 4WHBA 3L5AA 2CFFA 1EX5A 2XIJA 4ICMA 7TAAA 1ZZMA 3OBKA 3LCIA 4ALDA 3IJQA 2CZDA 2PMQA 4QITA 3TU9A 2CNCA 2XU2A 1TRDA 3UJRA 5LIKX 3U2EA 4WXZA 1VPXA 1CGXA 3MT1A 1UH2A 3M5VA 3LRLA 1NM9A 4CD7A 3QFWA 1LL7A 1J18A 3C61A 1J2WA 3WUFA 4O16A 2WPGA 1FFRA 2E6YA 5F2LA 2OZ0A 2FGBA 3C6CA 3MUAA 3IV3A 5HINA 1UA3A 3IIXA 1PKMA 5KINA 5EFFA 5FF2A 4W5UA 4ZE5A 1J12A 4PUJA 3VMNA 2VRQA 2CIPA 1SJCA 3QZAA 3MTWA 4DYEA 3VC5A 1XGDA 3CT2A 1XLBA 3UXDA 4MWAB 2ZUMA 4DJFC 2YAUA 2ALRA 1OVDA 4FF5A 3P62A 1H63A 3NURA 2PS2A 1S46A 2C8NA 1MW1A 2ZZ1A 1AJ2A 1F05A 1JFHA 5CLTA 2UBPC 3T42A 1BWLA 2VKZG 5KMYA 4MTVA 4CQ9A 4DBWA 1UR9A 2XG9A 1F3TA 1M41A 1E6QM 4FZIA 1DHKA 4J2PA 3OVQA 3N3TA 1Q6OA 3PAOA 1V79A 1E6ZA 1YX1A 2GUYA 1QNPA 2Q01A 1HO1A 4GIRA 4FPSA 2DT3A 1G4PA 2OEKA 1W9XA 3NZQA 3S5ZA 3VKDA 3S83A 5CBJA 3EB3A 1B90A 4BQ2A 1FOBA 2I9UA 3VYLA 3WX7A 4O1CA 3PZUA 3GYCA 3ABZA 4H9VA 3O07A 4DM1A 4TTUA 2OKTA 4O18A 1CXIA 2Z2UA 5GJMA 1I45A 3DHPA 3W22A 4LC8A 2J74A 3VDAA 1B3ZA 1N63C 4O14A 4NNAA 4UFHA 2NQLA 3T2QA 5BU9A 4ZOEA 4E8DA 2G95A 3M4HA 3NVWB 1I4NA 4JCMA 3K8KA 1FP8A 4Q3MA 4Y9OA 3GXNA 2IQTA 5IFPA 5F2GA 4IMEA 2PA6A 1RPKA 1RALA 1F3XA 2IUZA 2DZTA 2A1YA 4NYYA 3PK7A 4LGXA 1KM0A 5C2CA 1UMYA 2GJRA 1JYNA 3IGUA 3KZPA 3KP1A 4AZIA 4ZOCA 1ISVA 2J13A 4H8NA 3IRDA 2FYMA 4XG1A 1NHPA 2IXUA 4GUFA 3EBVA 5D2WA 5HDRA 4JQ4A 2D24A 4DB7A 3GC2A 2Z1WA 4A8NA 3IEBA 3AJXA 2CZFA 4HSOA 1MXGA 2PD9A 4C7FA 3W2UA 2EKGA 3UZWA 3NVVB 4GI9A 4S1FA 2GWNA 1J0IA 1DJHA 3N9RA 2G3JA 2PDCA 3E6EA 1EO5A 2D20A 2PI6A 1ME8A 3GBEA 2B7OA 2TPSA 5LIWX 4F0MA 4XVDA 1LM1A 4A3YA 4Q4QA 2E3TA 3QMRA 1REQB 3G1VA 2X8HA 1YDOA 2HJPA 2V63A 4I6VA 2VD8A 5E5CA 3PTKA 1B5TA 1N61C 4HZ8A 3GYEA 5CPTA 3AMGA 1JULA 4MB4A 4UTWA 1XIIA 3UPBA 4UTIA 4IPJA 2R94A 2RHGA 2VTFA 2QNEA 3ARSA 1OGSA 3VMOA 3W7QA 4DUOA 2YSWA 4BWLA 3URQA 2V2DA 2Y85A 4O1FA 3IJ9A 1WDDA 1I1WA 3OIXA 1R3RA 4CD5A 3ZLHA 1JXJA 4HK7A 4M1RA 4P8WA 3VO0A 3A47A 3RPDA 9RUBA 4ICNA 3L2MA 1QHOA 3UPMA 4V2XA 3IJ8A 5LXEA 4GQBA 3M6YA 3CEPA 2BS9A 1H7OA 2E09A 5D37A 2PLCA 5A6TC 3W73A 4D8ZA 4F0HA 1MQQA 1PTGA 2UY3A 1PV8A 1AVAA 3ME3A 1CZ1A 3TN4A 4KFPA 4NRSA 5DCBA 4PMVA 1LROA 1RY0A 5FSDC 5BWAA 4CNSA 4CQCA 4EPDC 3G2GA 2ZE0A 4OHQA 4GRTA 6TIMA 1KCXA 2W3SA 2EEXA 3V75A 5A94A 2PC8A 3F5LA 3G6LA 4FLOA 1H6VA 4OOZA 4MJ4A 3OB8A 4S3DA 1LUCB 3WJZA 3TA6A 4KW2A 2XH0A 2QJNA 2PBOA 3GTFA 4S3CA 1IXOA 4LWWA 1Q6RA 4GUGA 1VFOA 1Q65A 2ISFA 5CGQA 2VGIA 5FJIA 1U5JA 5JH1A 1DNCA 3WNOA 3VD7A 1XH2A 2PB1A 1WO2A 1S5NA 2ISWA 3T8QA 1ISWA 1E0XA 1L6SA 4LUYA 1U5HA 1JQXA 2Z2BA 4DBEA 2X42A 3UZXA 1TJ0A 3ZR6A 2VR5A 2XIOA 1SM9A 2VZUA 4Y9PA 1FWHC 5CPMA 4N9BA 4LANA 5IHSA 3SCPA 1HX0A 2ZXDA 5I79A 3W71A 5HMSA 3WELA 3NQ7A 2PLMA 1ZS2A 2ZUWA 3MI3A 4RNFA 1SPQA 3PBMA 1QI3A 3T0CA 4KETA 1QCWA 1ZALA 5HQMA 4QIUA 1QAPA 2H3DA 4HPGA 3L5OA 1US0A 2R24A 3F4DA 1TX2A 2GH5A 5I3DA 3MSGA 1E3ZA 2BXVA 3VINA 1K77A 1A50A 4Z2IA 4KEVA 1OCJA 3GXDA 3S1GA 5A2BA 2WMIA 1E1CB 1GOQA 2JK6A 1OFBA 5GNXA 1XPGA 4UTWC 3TYZA 3PSWA 5D4YA 4FR1A 3W37A 2IQDA 2JKAA 2PTDA 5J8LA 2BASA 5LNUA 4BWLC 5CPLA 4HU8A 1XYAA 2OEJA 1FKWA 4LAUA 1N8WA 4UNIA 1KW1A 4UZSA 1XIMA 1FCQA 3ARZA 1XANA 4KIEA 3SSJA 1XIHA 2JIWA 1XCFA 3VI2A 1EBHA 1TYTA 3D9XA 2BGQA 1O66A 3MP3A 3QF0A 3DK8A 1UWUA 1SZNA 4HNLA 1EUAA 3TC6A 3KM8A 2BC0A 4KIRA 5I06A 1RHCA 3MMDA 4FXJA 4A3UA 5MKGB 3BVJA 3KTCA 3GD3A 3RCYA 2VOTA 4YIWA 1CB2A 1FHUA 3AIRA 1E40A 3ORWA 2QQ6A 2ZX9A 4OUIA 4AWSA 3OPSA 4B5TA 4ZQOA 1UG6A 1Y5XA 5REQA 1MXDA 3LTPA 3ZWTA 3B06A 4PFHA 4RZ6A 4UCFA 1XLKA 1J79A 4AUBA 4H7CA 3A23A 2ZKMX 3AZRA 3ONCA 3BJFA 3PPGA 1MO9A 5HR7A 3WQEA 3NSMA 4KCTA 3NEVA 1ZBVA 3UXLA 2QR6A 3NZRA 4E2BA 4IPIA 4HU4A 4HTBA 4F4RA 4P8VA 5ABTA 5CEWA 1BF2A 1HZYA 3C8FA 3L65A 3SSZA 3O06A 3T09A 4GKLA 1YXCA 1HP4A 4LBUA 2WSQA 3UETA 1E0TA 4L9YA 4QE4A 1WBHA 1KLYA 2V2HA 5D09A 3NPVA 3NRZB 4WGXA 1GKPA 4KT2A 1MZRA 5KVIA 5DMLA 5FSEC 4HOXA 3SJNA 3D3AA 2DV0A 1UWAA 1HKWA 4J3SA 4HMNA 4URIA 2PWGA 3O6AA 4JN7A 2YCEA 1UR1A 5T26A 3LCGA 1BQGA 3PJUA 4PODA 2NX9A 3BXWA 1AD1A 1QR7A 3VNYA 1ZMDA 1GZGA 3SO7A 1IT8A 4ERGA 4IP7A 3H7VA 1TPVA 5KZMA 1IEWA 3WK3A 2CLMA 3NWRA 2WNNA 3WO8A 3TN6A 1GHRA 4PMNA 1HIZA 4FF7A 2WM1A 4S3FA 4AC1X 3EWZA 2ZICA 3NM1A 2X0YA 3MZ2A 1GVRA 4PMJA 4MFDA 1A5UA 1I8JA 1PVNA 4CUCA 4JTJA 3E2VA 1OX6A 1WX0A 4JIIX 1SB3B 3VABA 2NV9A 1SQ7A 1ZENA 1XL9A 3VIMA 2WP6A 4LYRA 1VYRA 3WYZA 4ZO6A 3P82A 1F9CA 2V82A 1XLDA 1WDQA 1DIKA 3RM8A 5BRBA 3UY8A 3U8GA 4IP5A 4WGHA 4ZQRA 4B90A 4WSJA 1PO9A 4XAGA 2J9ZA 3TSMA 1BFNA 1HVXA 2C1HA 1F61A 3VZYA 3KBMA 5BXSA 1CXHA 3ZXWA 3GW3A 1R2SA 3BV4A 3GNOA 3UP8A 1UOZA 1D8CA 5HANA 3HBLA 1R3VA 5CXPA 3GDBA 1I0DA 1OFQA 3ARYA 1TVNA 2YA2A 3OZMA 3ZOAA 1PWMA 1YDNA 1X38A 3I6EA 4H4UA 4MLRA 2YZRA 1Q7MA 1W3TA 4JX5A 4FNPA 2FPVA 1JVNA 2OO6A 2VOMA 3DK9A 1HKIA 3UY7A 4P8XA 4NSBA 2CLLA 4XK2A 4AEOA 4ZMGA 4LVBA 1J5SA 4V1XA 4NAFB 1L6FA 1MEWA 4PTXA 3DJGX 3I7SA 1RK6A 4D1IA 1VFTA 3N04A 2DSZA 4WDXA 2WZMA 4GYFA 1O4UA 2JIEA 3VK5A 3BLEA 2ZRVA 1PWLA 1C8XA 3TWBA 4UUIA 3VD3A 4DLMA 2YVGA 3B03A 2NUYA 3MV01 2GR2A 2BXZA 4LPCA 4MY8A 5EMYA 3DGBA 3CTTA 4B16A 3AIWA 5I23A 1OX4A 5LIUX 2XGIA 2PZNA 2QAFA 5A3HA 4IF2A 5AYZA 1S5WA 1WNOA 2QV4A 6A3HA 1A5OC 3BO9A 3BAWA 7XIMA 5I3JA 3AIQA 1YTKA 4MKVA 2D2GA 3LCLA 1FWIC 4GZJA 4GWEA 3VGEA 1E6NA 1F3EA 1Y8BA 1YXYA 5E0FA 3R0KA 4H4WA 3VCRA 2I5GA 3HQNA 1UR8A 4OV4A 4GH1A 2V5DA 3UR7A 2EKCA 2CLKA 3TTEA 3ANUA 1W54A 3HN3A 3PWAA 1BYBA 3THAA 2PTXA 3KOYA 1H50A 3VD4A 2AQOA 2GZXA 4WDUA 3MDWA 4RV3A 1KR0A 3XIMA 4OJYA 1GHSA 5LA1A 2XPKA 3NQAA 2BHUA 1YADA 3NVZB 3VGDA 1SW0A 1TPH1 1GSNA 3BANA 3PBYA 2J7CA 3S5NA 1B3XA 4TXEA 1N2VA 3K4AA 1J11A 2C18A 4JFUA 1UPMB 3E2SA 1MZHA 3DKJA 4LVDA 3IIZA 4HA3A 4RXGA 1FA2A 3A7AA 3MW7A 4LYKA 3A13A 3BW2A 1UH4A 2OOFA 1CLXA 1NOFA 4UZUA 1H1NA 3G1RA 4ML9A 1ITCA 1FH8A 1HGYA 3UR8A 4PR4A 2VFIA 2DIKA 2CLPA 4XISA 1FY6A 4ERIA 3K8LA 4YYFA 3U2OA 3V5CA 1DWHM 3DFTA 1DHPA 1EIBA 1E9YB 1KRCC 1W3HA 3L67A 1PZ0A 1KM6A 5ECUA 2ISDA 4CKQA 3LXDA 4TVYA 3WKZA 3MHFA 1NDYA 1GCYA 1LQ2A 3LN3A 1H61A 2XJ7A 1OFPA 4PN2A 2A3BA 4JEJA 1ONXA 4PCNA 2R9ZA 3IC9A 1WDWA 5DO8A 1V0KA 2ZXAA 4PBEA 2NVCA 3SIMA 5BXTA 1CDGA 3NDZA 3UBPC 1BSIA 2BZNA 4QISA 2PDIA 3V0SA 5D8ZA 5CPSA 3ZM8A 3QMSA 1H7XA 3W26A 4JTCA 4ATLA 4NL1A 4ZQCA 4B2DA 1JAEA 5JCIA 1XLAA 3EWYA 1VHNA 4YN5A 4M29A 1F7BA 1XD1A 2WCSA 1R9YA 3A4XA 1OSEA 3EAOA 2CLOA 4Q8TA 4X60A 2XN2A 4ZOBA 4AF0A 4UTTC 4WR3A 3GAKA 1E51A 3KUMA 4E4PA 3CWOX 1RJQA 2QMKA 3RHGA 1DXIA 3UW6A 3UA4A 2ZXQA 3KLJA 4YHGA 4DJED 4QSHA 3UNDA 5HJLA 1GVSA 3E0WA 4F48A 3OJGA 2WJEA 5D2XA 1PIFA 1ME7A 4O1EA 3MUY1 4QRNA 3R79A 1OHLA 3UGVA 2G4JA 4GX9A 3CQKA 4C1NA 2NWSA 5GNZA 3L4VA 1ML1A 2A7PA 1FWDC 1P6WA 2JALA 3O6DA 1CGWA 2CBJA 3LI0A 3KX6A 1AQ0A 3LRKA 3KOXA 1TO3A 3SFWA 3CBWA 4C6IA 5JMUA 5AC7A 3OVGA 1GGOA 2OZ8A 4ML4A 4NILA 1OYAA 3L8KA 1XLHA 2V5LA 3VE9A 1XIFA 3MUIA 4HBKA 3TW7A 5F1UA 1CI1A 3GXMA 4G56A 1W91A 3DFQA 3JUGA 5FS8A 4KQNA 3EWDA 1SFJA 3F2BA 1MW3A 2BGNE 3UCDA 5FD0A 3USBA 4A2RA 2Z2AA 1K8YA 2GQ3A 1BWKA 3VNMA 1R7AA 4J35A 2JGYA 1UCWA 1LBMA 5SWUA 3CWHA 2QVNA 4DJDD 3H2MA 1XUZA 4QROA 1F4AA 2Z24A 4DVOA 3KVMA 2YBVA 5KZEA 1TUFA 5U7SA 3LNPA 1IV8A 3WD1A 1KA9F 4OWGA 3SCTA 1P43A 3R94A 5HWNA 1VD6A 3KE0A 1XCWA 1PJ9A 3N4FA 2QCMA 5A6KA 4HHHA 4MZ8A 3WD4A 3TYBA 3QBUA 3AWNA 2J7EA 4H04A 3T40A 1C7SA 1UJQA 3UJFA 4LUSA 3M7SA 4XZLX 3BMXA 2F5ZA 7ODCA 2HXUA 1H49A 1W1VA 2VP8A 4GYKA 4HYRA 1ELSA 3PWIA 1CLVA 1BVNP 1VENA 3N9SA 4JN8A 2NVAA 3UR5A 3QKEA 4GFIA 1LQ0A 4UMCA 1KFWA 1E71M 5XIAA 2D1ZA 3CASA 1JRCA 3TR9A 1NWSA 2VX6A 4JIHA 1DXEA 1UR4A 1M6JA 3ICJA 2ABAA 1OQFA 1CNVA 1EB3A 5DX7A 5HAOA 1HNYA 4WXYA 1LLOA 3NQFA 2NWRA 2QCHA 3FDGA 5LYRA 2E6AA 2JK2A 1FCUA 3NQVA 4JICA 1D8WA 4YVPA 4F2TA 1VFFA 3B8IA 1YKWA 4C6DA 1ITXA 3BQ5A 3LCWA 1EUNA 3SJ3A 2XVPA 2GOUA 1DORA 4LVAA 1JPDX 3AU6A 4Q4SA 5LIYX 1E15A 1QI2A 3L4XA 3HMJG 1FVPA 4MADA 4GXPA 3SCSA 2YLLA 3LXAA 1FX6A 3NCOA 2X0SA 3VDCA 4AZHA 2WOIA 1DXFA 3MSDA 4ZOHB 2XH7A 1M68A 1TTIA 3EWUA 2X2YA 1V6TA 4UTKA 4XD5A 1JIBA 1G67A 3A12A 2HZGA 2DZUA 4GVGA 3VIGA 4JTFA 3L0NA 3UF9A 3LCHA 3NA8A 4WY0A 2D3LA 3GG8A 4WOQA 5A8GA 1XYMA 3WFLA 3M0HA 5DFAA 3OQEA 4MWAD 4GYPC 1UUOA 4MWAE 5I2UA 3NYZA 4JFWA 5JCMA 1YMYA 4H8UA 1KM5A 3E0FA 3LPOA 1HG3A 1GVOA 1KRBC 4S3BA 4XZBA 2PLJA 3ERPA 3SCOA 5I07A 1VLIA 3W72A 1VZWA 4LA1A 3KDNA 2W3RA 3T07A 3Q2DA 2YYUA 3AISA 2OMAA 4UNKA 2PWUA 1QI4A 4C6MA 4ATDA 3DH7A 3BAXA 3WBYA 3CZ8A 3UG8A 3HGJA 2IPGA 1Q66A 1AQFA 1W5OA 1N5XA 2WJFA 3U6WA 3W7RA 1SSDA 1GNXA 1VIWA 3LSCA 2G96A 2AOSA 4AQLA 1TMQA 4H2CA 4J2MA 4IP4A 3VZXA 1UASA 4O8RA 3LPGA 3CQIA 1GWJA 4M19A 5MHBA 5D9PA 1I6NA 3MUXA 4KEMA 4P7RA 4QJ5B 4FNUA 1AH0A 5I3KA 2UY4A 4PUMA 1R9XA 3P6LA 1W1ZA 1NHSA 3LLFA 4HPNA 3TYDA 2OZ3A 2Y61A 4A6GA 4P7LA 3L66A 3W70A 2QGYA 3C0JA 3UPWA 1IWPA 2IXVA 3EWWA 1X2HA 1QU4A 1JCNA 2I5QA 2XH4A 2J75A 1WYGA 3N2XA 3CMGA 3T2OA 4A3QA 4WDTA 3SGGA 4PUUA 2IW0A 4HPHA 4YHEA 4HMCA 4GQRA 2VVSA 1YE6A 2E4TA 2ZRYA 2ATMA 4DELA 3RMEA 1N8IA 4YTTA 3LS9A 3AQUA 2JFEX 3GB6A 3I68A 3J7HA 2VX7A 4HSHA 1E9LA 4I7WA 2DSVA 3FXGA 2DW7A 2AGKA 1KXHA 4GUHA 1YLVA 1XLGA 2WNWA 4GRSA 4UMBA 3UCQA 1UP3A 2ZUVA 3U57A 4UWMA 1EYWA 3CV2A 2BY1A 2FIQA 5AYYA 3OEXA 1PL9A 3NM3A 4RNJA 4HT3A 3WQ5A 2W67A 2E1DA 2QCNA 1EJWC 1GG1A 2V3BA 1Z44A 2OPJA 1FTXA 1LTDA 5G2IA 3EGJA 1XYLA 1EC8A 4XAPA 4V1YA 2R1NA 3W6LA 4AVFA 2POTA 1WYIA 2WLZA 3W24A 2C0HA 1E1EA 4XAYA 3VAVA 3OO2A 4TMBA 1T96A 2EGZA 3A5VA 1PIIA 2HE5A 3V3WA 3B8VA 2GYIA 3ARTA 1TX0A 1XBXA 2WC4A 4JHOA 4L6DA 1QOPA 1DJGA 4R27A 3R8GA 2DUZA 4WJEA 1J0ZA 4PTNA 1IGWA 3RPMA 2EQDA 5A6MA 7ENLA 2PDLA 1QPQA 4IX0A 3WLTA 3FW6A 3AZSA 4GJJA 3M0JA 1UZDA 1DL3A 3TMLA 1M1BA 1OZMA 1X39A 5E09A 4MDPA 3RILA 1BKHA 3RAOA 4JDYA 4Q7BA 5BROA 4R9XA 1TIWA 1QATA 4D6GA 4Y90A 1O7AA 4ZO9A 4R3UA 1SJDA 1PX8A 4ZL1A 1VRXA 4LV9A 2AQVA 3VD9A 1S1PA 4KPRA 2F7FA 2CESA 4IJRA 4E3TA 3EUB3 3TLLA 3TW9A 5MF5A 3W81A 3NTYA 4FNQA 3SZ8A 1UYQA 2C15A 3GH7A 1NAL1 3KAOA 3O6CA 5DLCA 4LY4A 1GK8A 1GQJA 1MWOA 1NARA 3PBWA 1VIZA 2YDAA 2WHJA 3BOFA 1NDZA 4MJMA 2ABBA 5H2ZA 5HPOA 1KGWA 1E43A 1UIPA 2Y5SA 1BPLB 1Z89A 4JHZA 3B0UX 2DVUA 1X7FA 2AGTA 3F4NA 2ADAA 2GQ9A 2V68A 3RLHA 1AW2A 1EF3A 3W1MA 3RX2A 1UD4A 4UR9A 1W1PA 1EXPA 2E5BA 1J6OA 4DHGA 2G3FA 1K02A 3KBJA 3STCA 9XIMA 2R1LA 1JPIA 1XFCA 4GLEA 1PHWA 2D2JA 1TJPA 3B4UA 2NZLA 4WJ8A 4B92A 3AMLA 3O0HA 3B9NA 1VJIA 4GQQA 1E5JA 3EX1A 2PEVA 2OX4A 5ABHA 1HO4A 3NXFA 1M7JA 1UR3M 1MRAA 2PDHA 1US2A 3WLPA 3AJ7A 3ALFA 3W7MA 3PZQA 4Q8MA 4W8LA 2X41A 3MBFA 3GBDA 1CGYA 2WMIB 3ECQA 3U5YA 2BY0A 5F4WA 4PMZA 1TCMA 3H53A 5FEWA 4OVXA 2ZZ4A 4CQ8A 3B0VC 2Z0IA 4FOJA 1I1XA 1BYDA 3UQNA 1QPRA 3G8RA 2FLIA 1W3JA 4Q7IA 2TODA 2B31A 1BZLA 5A6AA 3BH4A 3GNNA 3NVYB 3P0XA 3DG6A 3W1PA 3Q65A 1R9ZA 3QGVA 6ENLA 3SUUA 5D38A 2J77A 5T9CE 2Y7GA 2VEGA 4OTKA 2ESCA 3S42A 4RW5A 5FJUA 1A5MC 1LWIA 3VOCA 1PKYA 4C6CA 2VEFA 3GDKA 3T1GA 1UPPA 1BGGA 4LUTA 3IIVA 3URNA 1AW1A 1MDLA 2QV5A 5AN7A 3M0XA 1JZ2A 2J66A 3IJ7A 3ZZ1A 2BV9A 4AEEA 4MHBA 1CW2A 3BAIA 1AK5A 2SFPA 4ORMA 1SW3A 3K46A 3GR4A 1FWBC 3ID7A 2Y62A 6REQA 5FS7A 1KTCA 2QCDA 3IGXA 4EQWA 5REQB 4UB9A 1QHZA 4HQVA 2ZRWA 3LCXA 3WDHA 1FP9A 3CYJA 1V7AA 1FQ0A 1M7OA 3WD3A 1V6WA 2XZ9A 4PYSA 4D6HA 3W7OA 2AAMA 4BR1A 3DBNA 4H41A 1I9CB 4X3ZA 3S2LA 1R47A 4RKAA 3NSNA 5FJJA 1G0CA 3VNIA 4LBRA 5HBFA 4ICCX 3NEHA 1SW7A 1NTHA 3WIJA 4W8BA 1OZQA 2X40A 1GERA 4NX0A 3S6TA 3TFXA 2VT0A 4KBXA 3PUGA 2WBAA 4B5VA 1LDCA 3AALA 3FEQA 1XFBA 4TUFA 4RCXA 1F8IA 2GLKA 1B9BA 4EQSA 4MAZA 1OINA 2CC0A 3W27A 3H55A 1VEMA 2YKKA 5HXMA 2DT1A 1A5CA 4H7ZA 1T6MA 5LHEA 2CPUA 3I3DA 2DZVA 1TRIA 5JCLA 2B7QA 1F3WA 3SY5A 1UZHA 4ZQMA 3UWZA 2Y7DA 3HG2A 2QGHA 4TV5A 2DVTA 1K6AA 1PYFA 3HM7A 1DWIM 3A4WA 1C29A 4DF2A 1LT8A 5T91A 3FOKA 5U25A 1VGAA 2ZQ0A 3P74A 3PZIA 4GVHA 1JI2A 1BKSA 2ZZ6A 4LAZA 1W56A 1CGTA 4DBDA 1ZHAA 4L4OA 1H4PA 5FAJA 3QVQA 4GVIA 1QW9A 4XWUA 1ZQ5A 4WSKA 5I09A 2RJHA 3AHVA 5K2ZA 3TONA 4H9XA 1LF1A 2X05A 3TNOA 4I9MA 4F0SA 3URHA 2CFYA 4EIVA 4UTJA 5HOSA 2WLYA 4Q8UA 1J0YA 2VCAA 5C9UA 3GG1A 2HV5A 3SRKA 1LLWA 2NQJA 2I56A 3GLCA 4IJBA 1WDPA 1OFEA 4Q7NA 3FXYA 2PDMA 1ONEA 4IFKA 2OX1A 4H4QA 4GUJA 1PPIA 4ENLA 2YVFA 4PUWA 3B8UA 1W9DM 2FZNA 4MMWA 3CGEA 3HW2A 4QE1A 4QS6A 3RU6A 2ZUUA 1YQ2A 5BNKA 2XFFA 3TKFA 2FPTA 2Y63A 3AC0A 1XPYA 1ZP4A 1IXPA 3H54A 3GVRA 5I77A 4QNWA 2V38A 1F6PA 3H2OA 3HQ1A 1B9ZA 2H9AA 5H1WA 4YWIA 2GSEA 2LLEA 5CGMA 3MKCA 3BAJA 2J47A 3BUVA 1JOAA 3G22A 3GFYA 4I9JA 2Q3RA 3B8WA 3E5PA 3QPYA 1XGZA 4GY0A 3W25A 2DFAA 1EC7A 3MMWA 3QEZA 3H7UA 4NUWA 3WF4A 1GETA 4XKMA 3KRBA 1ITQA 1ADSA 1UWQA 2FH8A 4A05A 3QQ0A 1FWSA 4KWSA 5A6BD 1QK2A 3GFZA 2DZSA 3U0HA 2CITA 4KRZA 1FEAA 4YU1A 8XIMA 4NZ3A 2W63A 5G5IA 1RPXA 1UUQA 1HJVA 1MW0A 3N2CA 3AICA 2FVKA 3KFTA 3M0ZA 2GUBA 3TUUA 1JZ8A 3WMSA 1OX4B 3B04A 3D0CA 4FIQA 3PJXA 3FA3A 2OWCA 2BXYA 3BDKA 4LJ3A 3MUCA 3F5KA 1OCQA 5I03A 1KCLA 1I60A 1UKPA 1VQTA 4PSRA 2CWNA 3WH7A 1NOWA 1XICA 4QTGA 1SJBA 2YOCA 3GG7A 3W2MA 1OF6A 1TQJA 3IIOA 3BPWA 4ADTA 1W3NA 4OQVA 2E40A 5FESA 1UBSA 3N15A 4FNSA 1E6RA 4K39A 4H8VA 1TREA 1CWYA 1BXNA 3A3WA 3GUWA 3SIZA 1PZ2A 3CUXA 3TYAA 4G1NA 2W92A 7TIMA 1S5VA 2IQ0A 2OSXA 2VFGA 1Y7VA 5DY2A 5JQ9A 1V3LA 1W9UA 3SUTA 1XV8A 3WUEA 1QK0A 3A21A 3OYXA 3EANA 3GVWA 4JL1A 1IHIA 1DEDA 2VFHA 5DXXA 5JCNA 3DHDA 2QJMA 4AB4A 5BOOA 4L9ZA 1JPHA 3N6HA 4K2SA 3WL1A 4EWJA 2XFWA 2B7PA 1TG7A 1LLZA 3ZJ6A 1AZ1A 3M0VA 3WBEA 1SR0A 3SN1A 4ZTYA 4CNTA 2CLIA 5HWJA 4IIEA 3B8TA 3W7JA 5EMLA 3U9IA 2R91A 3FGCA 4HZ6A 1GVIA 1KD0A 4ZODA 3AFBA 1FHVA 4ZFMA 4X0VA 5FF0A 3D3FA 2Z25A 5G1MA 2BWGA 1QNOA 1X8FA 2CHOA 4QG8A 3MI6A 3NDOA 1RSCA 2QPUA 1MRQA 3CT7A 4GG9A 1DWFM 3H4KA 2GGEA 2O7QA 3MMUA 2CLEA 3NL2A 3S2MA 4FLRA 1YEYA 4NAEA 3SY1A 3W6YA 3NUKA 2WSRA 3RCMA 3FFSA 1F8WA 2F9RA 2DZAA 1UZ1A 4C5ZA 3TAOA 3OA5A 4CD4A 5K9CA 2Z6JA 4GI4A 3DK4A 4KERA 2V2CA 1GVEA 1GJUA 3PG6A 4DNAA 3EMCA 2IS7A 3HGOA 1FWCC 4AMCA 3LHWA 3GRSA 4IX2A 2EQ7A 3LB8A 4LC6A 1GORA 2GSHA 3TXVA 3GD4A 3KS5A 4W93A 1X1OA 4CNOA 1BRLB 4B3LA 4LOCA 5HQEA 4E8GA 4UR8A 1IZJA 1HJUA 1VFSA 1RQBA 1ZX9A 2GDVA 1XDIA 3ITXA 1OD0A 4J3XA 5C71A 4AF0B 2Y0FA 3AYSA 1R7OA 1W31A 2EPKX 1I2OA 3VIOA 1GW1A 1YHTA 4JQ9A 1HKKA 1AG1O 5CAHA 4IQJA 3DG3A 1XI3A 1I2RA 2RDWA 3BLFA 4HNVA 2ZX8A 1JGMA 3V1HA 4PL2A 2HPIA 4DBSA 1QNVA 2EG6A 1OX5A 2WXDM 1UP2A 4NASA 3CUIA 3UD6A 1NF0A 3UWVA 3CS2A 5D05A 1NQ6A 3QZ6A 4C1NB 1KWKA 3EDEA 3A6OA 1XG4A 3P8JA 4QCEA 2QAPA 1XIJA 4RDWA 3W38A 1TMLA 5IHRA 3LK6A 2GVGA 1MQPA 2ICSA 1UP0A 1J93A 1E0UA 1NDWA 3WNKA 1RUSA 4AVOA 3KP0A 3NQCA 8RUCA 1JZ5A 3W83A 3A4AA 4JTKA 3FYOA 5HATA 2VDGA 1E4LA 4JTHA 2PF0A 2PDPA 2Q09A 3N2TA 1M03A 4Q8OA 2VC7A 2ZRXA 3MCMA 3WDJA 1PKLA 4IIHA 3ZT6A 1L6YA 1EGMA 1H7WA 4IFRA 1CXEA 2OLAA 3SQLA 3DYMA 2O55A 3P5ZA 5BXPA 3NQGA 4C6EA 4GBDA 5BXRA 2FDMA 3FA5A 3FAXA 1EDTA 1EWEA 1TPC1 2ZBTA 5LNWA 3VDGA 1K9EA 4NF7A 2PWVA 4H01A 4Q6XA 3UG5A 1AL8A 2O9RA 3EWXA 5M2FX 1XR2A 3WMBA 4JIPA 4O0QA 3WDQA 1DJZA 3BW3A 5E6ZA 1UKOA 4BA0A 1TWDA 4BI5A 3EDKA 2NQ5A 5G4HC 1F2JA 4NI3A 4EK7A 5CZTA 4AHPA 4E6MA 2V6OA 1OM0A 1FEBA 5I78A 5A6SA 4UTUA 4RR4A 4LUSB 3CV6A 1XLJA 4GISA 5C7VA 3DHFA 2ANUA 4QQ3A 2ATSA 3QXBA 1NQKA 1UD6A 3WNPA 1J6PA 3N29A 3SCUA 3H21A 4DZAA 4GMEA 1FXQA 3KOFA 5LGZA 4DO4A 4I5RA 3O1NA 3VNKA 3BSMA 4AC7C 2CEQA 2PDYA 2YPIA 1OF8A 1KGXA 1C7TA 3CUZA 1UWTA 3TZFA 5IRPA 1E0VA 4NG3A 2EQ9A 4M82A 4PSPA 4FP1A 1F73A 3IGHX 3COTA 3PNZA 3MB9A 4X0NA 1HKVA 3L12A 2Q3OA 3MWAA 4U3AA 3BW4A 1XHGA 3KW3A 4LFYA 2V81A 2BHYA 4QGCA 4LS0A 1XC4A 3B8SA 3ZWSA 4PCSA 4DLFA 3V36A 3UERA 1UD2A 3TCEA 1KO0A 5HJXA 1KM3A 1DJXA 3LM7A 4N9CA 4RNIA 4TVCA 3GDRA 2IKGA 2F84A 4WEVX 4AX7A 3GZ3A 3NZPA 4J4KA 3TVAA 3B9JB 4NYUA 5C6MA 2VGFA 4Y6GA 4YPJA 3SN0A 2BY2A 2DT0A 3AROA 2RFGA 3VM7A 3USZA 1NIUA 3UZZA 2A6LA 1LPFA 5U1OA 2CBVA 4RE3A 4F40A 1LWJA 3SFKA 3FEMA 2GGGA 2UZ9A 2A3AA 4TX6A 2PWDA 4IMDA 3H7RA 1GEHA 2YZ5A 2FB3A 1MXSA 3OG3A 2FHFA 4WY0B 3QHOA 3Q45A 3VFLA 2Y24A 1J96A 4Y9AA 1NF7A 3W86A 2WBKA 2V5BA 1XKJA 1QBAA 5G2WA 2E0PA 4S2BA 2WP5A 5EY5A 3NIYA 4GQGA 2CZ5A 1PCKA 3QHMA 3PS7A 3WG6A 3C56A 4MB1A 1VBHA 4QDMA 2YXGA 4NHVA 2QPSA 2PAJA 3AXXA 3L0GA 4UTHA 3LMZA 3H24A 4HZ7A 2PP3A 1XIBA 1JDAA 2HISA 8XIAA 4BK9A 4JYFA 1GUVA 1IXNA 3MDUA 3PVFA 2ZA2A 5EMKA 3C2VA 5TBOA 3H2NA 3C0QA 1TYPA 2KZHA 3G1YA 3DXIA 4IGHA 3TSBA 4GBUA 3F03K 4MG4A 1D7YA 4EMIA 2YIHA 3CUFA 1G69A 4PMDA 1W3KA 3THDA 4LY8A 5F7UA 4B4HA 1YW1A 1O68A 2GQ8A 2ZYFA 3MJYA 4ZB5A 1RAKA 3G8EA 1FXPA 4JL2A 3CV1A 3VFCA 1GQIA 2NX3A 1XRTA 2DJLA 5FF3A 2GGJA 2X09A 1W1TA 2E77A 1WP6A 1U30A 4QFUA 3EOOA 1AD4A 2IKIA 5D04C 1ZPTA 3PG8A 2VRJA 4Z0SA 1P0KA 2NVDA 3M7WA 4MZ1A 2E3ZA 1R30A 3PFMA 4JTDA 1BAGA 2XIIA 1OFDA 2ZZ0A 4JKLA 3FJ4A 2VENA 3BICA 1U5VA 1RA0A 1ZMCA 5FACA 2DORA 2ZZ3A 4MUZA 1A0EA 2E8ZA 3GR8A 4BKNA 3WLKX 3OQ8A 2O9OA 3DGHA 1Q6CA 3EDDA 2Y8UA 2GJXA 2ZZ2A 5A8NA 5KVHA 3A4JA 1VEPA 1PIGA 1UUMA 3INPA 5EPDA 3O3RA 4QBXA 1JCTA 1LCOA 3WK0A 3B9EA 1ITUA 1CXLA 3GG0A 1BHGA 1CGUA 4IT1A 4UQBA 2DDXA 2G97A 2OKOA 3WLNA 5M5DA 4N7QA 5IM51 2PTZA 2JQXA 2QF7A 4MYAA 4DWSD 2PDJA 4UTMA 1QNRA 1S3TC 1JRPA 3WQOA 2X1SA 2BP1A 3W1TA 2WOQA 5D2YA 3W82A 4K68A 3MVIA 5G2HA 2YX0A 1RD6A 3M43A 2VEIA 3FDKA 5GPRA 1W1IE 5F2MA 4IG2A 3VA8A 4DYJA 4BF5A 1RJPA 5FAGA 1SZEA 2HCVA 2Y5EA 3C86A 4MJ2A 2QIIA 3B4YA 3REQA 2OO0A 4I8DA 3AIEA 4HD5A 4D6DA 3BG3A 3O8AA 4JFSA 4QLJA 2FZ9A 5BMXA 1GPFA 2WJDA 4FO4A 2X99A 1EJUC 1DQUA 1C3FA 3QR3A 1SVDA 4E0CA 1QPNA 1AJZA 3U4AA 5C54A 2RUSA 3WUBA 2YL5A 4KWVA 4PMYA 3M9YA 5CAKA 3VKBA 1DV7A 1XLLA 5FJTA 2PBGA 2QCGA 2YVJA 2ZTJA 1TA3A 3PPFA 1XLMA 2BMBA 4YYCA 3AHXA 1VH7A 2AQWA 4GD0A 3L0KA 2WSPA 4JS3A 1IEQA 1KQZA 1DJWA 4WQ6A 5H8MA 1TPUA 3RXZA 4ZSTA 1GKRA 4IISA 4MF4A 2HBVA 3H4GA 2XM1A 2OELA 4GE8A 1XRVA 2PFHA 3E3HA 4E2OA 4KESA 3G1DA 2R8WA 2IPJA 1G7UA 4IIFA 3V5OA 1N5WC 1ADDA 3APTA 1ISXA 1KN0A 1JNEA 2PU1A 1CB7B 3DN5A 5F4SA 3W88A 1H2JA 3TQVA 5FJRA 1D3HA 3LENA 4XB3A 4QS5A 5EMMA 2XVLA 3P67A 3W7EA 3V7PA 4FI4A 3TROA 1PZ1A 4MPKA 2W3ZA 1ZJAA 1EHAA 4Q4KA 5CGTA 5A1AA 3T55A 1ZRQA 3IUHA 4XIAA 2A0NA 2DH2A 4BCEA 1MMFA 4H4VA 5L6UA 2DZBA 2WYSA 3TJIA 2ACSA 4UBPC 1LL6A 2JF6A 4L80A 4JFTA 2WZEA 1V3HA 2Q6ZA 1MUCA 4LU0A 5G1TA 4DJEA 1V02A 2Z29A 4AD3A 2F6KA 1EC9A 2Q02A 5EBKA 2EHHA 4YTRA 4HA1A 4HK5A 2HK1A 4J27A 5A2CA 2WO5A 3C4UA 4OFCA 1XHCA 1HL8A 5AZ1A 2YFOA 4MGGA 4LH8A 1KFEA 4Q33A 4IPPA 3VE7A 3BCJA 5JH2A 2GSJA 3SN4A 6PTDA 1XH1A 4QAWA 3NVTA 3HOJA 1QI5A 1V6YA 5E0KA 1KB3A 1POKA 3PBGA 3OC4A 3QC3A 1VAHA 3RNMA 4HIBA 4LUTB 1UR0A 1XLFA 2C3ZA 4DXXA 2ZZCA 5BRPA 3S46A 4J7RA 4K8HA 4YWOA 4C6KA 1NEYA 1V6VA 3VILA 1B4KA 4O4WA 4AD2A 4W7UA 3DKLA 3KRSA 1XQKA 3W87A 5GNYA 1IGSA 6REQB 3OHIA 2E6DA 5IDZA 4LBSA 1JZ7A 4ASTA 3AIVA 2JKEA 2PRMA 4LALA 1HVQA 3WLIA 2NV1A 1NP2A 1ZB5A 3LMYA 4WOZA 1X7IA 3KBNA 4WKHA 3KCLA 3NO3A 3HPFA 3AS0A 3IUDA 4I5UA 3AIBA 4HNCA 3DU0A 1ZLPA 2I9EA 4DXVA 1OC5A 1TV4A 4W9TA 2HVNA 2RGMA 3Q37A 1XM3A 3CZKA 2DU2A 5C55A 4W7VA 1LZOA 1DE5A 2XFRA 3E2QA 4WDWA 1CGVA 4FK9A 4MDOA 1UOKA 1W9BM 1KFBA 4K8EA 5CZJA 1WZLA 3HB9A 4HPXA 2PDXA 2R9RA 3R13A 3QFEA 2HQAA 1EPVA 4LX4A 3T81A 1U2YA 3WF0A 1ENUA 1SO5A 4H9YA 3W1AA 1XBVA 3UVIA 2VWSA 4FAMA 1Z8AA 4JIEA 2P76A 3WENA 2FFCA 1AZ2A 1Q6EA 2P3ZA 1NVMA 1TWZA 4IQDA 4AZGA 3M16A 4Y9MA 1S7MA 3UG3A 3FAWA 2DH3A 1KXQA 1G6CA 4XIMA 2CLHA 4Q4MA 3OP2A 5C7HA 1V6XA 3BMVA 4M1BA 5C5YA 2YBUA 1HKMA 2NW0A 1KRMA 4M52A 2YW3A 4MSSA 3BE7A 4EX4A 5CZSA 3V5FA 1RLCL 2GVYA 1YYAA 4HTYA 3B9OA 4MNMA 1AQMA 3NG3A 1E55A 3M64A 4F0RA 4DJEC 2TSYA 3CPRA 1TFVA 1JCYA 3OZYA 4BJHA 3KZSA 4JIQA 4DPPA 1KCZA 3BLIA 1ZAJA 3RR1A 2A3HA 2AL2A 3PPHA 1TTJA 3P7YA 3CGCA 3MANA 2BVDA 2UWFA 2YL9A 1RCXB 4A4AA 3CV7A 5C9ZA 3VNDA 4LSBA 2HVMA 1L8PA 4IFKB 4ILSA 4MJZA 1Q5MA 2E67A 1SO4A 2C13A 3A22A 4CNPA 1UIOA 4E3VA 1XD0A 3B9DA 2VMFA 3UCCA 4F9DA 1L9WA 3IACA 3QOKA 5CC7A 2TMDA 1B54A 2Q8ZA 2WMGA 3OW1A 3QYQA 4DEFA 4RE2A 1O5QA 1W2VA 4ZXLA 1E72M 4MWAA 3TW6A 2H9AB 3P3BA 5HK4A 3TCSA 1JD9A 3M6DA 1VYPX 1PUDA 4V27A 1TR9A 4QG6A 3TX9A 3CK5A 4ZCWA 4O0KA 3UJEA 5GVJA 1HXJA 1FKXA 3ITTA 2W6RA 2J78A 4IFOA 4H00A 3W01A 1FECA 3AO0A 5D8WA 1EFZA 3CXOA 1AJ0A 3TAKA 2ZOXA 4JOMA 3PTMA 2OSYA 4MOZA 4M5PA 1UKSA 4L4PA 2GK1A 2EPNA 2NVKX 3NL5A 3LPPA 3ITYA 3A5FA 1H7RA 3MSRA 2VX4A 3R2GA 4IXHA 2VC6A 3CTLA 5EB8A 2W5FA 4M6VA 3AMCA 4D72A 1ZY9A 3NO1A 1EX1A 3CQJA 4PCTA 1A3WA 1LOSA 4PRRA 1DIOA 2AAAA 5U4NA 1RQHA 1T41A 1GQKA 4NZJA 1OIMA 2PURA 2E68A 4IXXA 1OK4A 1YDVA 1O1HA 1EXBA 3N4EA 2BTMA 3A9IA 1ZDLA 1EOKA 2Q71A 3LM3A 4KWOA 3N13A 4YTSA 1ZK7A 4Y9NA 1MVYA 3BOXA 4KRUA 3O16A 3W1UA 2YXOA 5BWFA 1X6UA 4IMAA 1B3YA 3POHA 4AXKA 3GD6A 3FV9A 8A3HA 1UR2A 4M6UA 5JCKA 3TJ4A 1RBOB 2V3EA 1OB0A 5F4XA 2INFA 3I6TA 3RX4A 3CMJA 2PSNA 1KM1A 2XHYA 1Q6QA 3W1XA 1G7VA 2XISA 1MOKA 1ONRA 4AY7A 3DC0A 1OIFA 4KGLA 1Q2SA 2VR4A 1BWCA 4BV6A 1SMAA 2BHZA 5GRTA 4Z0JA 1C93A 1J2BA 4ORIA 4ZQPA 3VKKA 3U3HA 2X30A 4F9JA 1C90A 3FGCB 4UOQA 3L2LA 1Q6DA 4C6JA 3GWQA 1H1YA 1F76A 3E2RA 2OZTA 1EJSC 3LV5A 3SEPA 1MI3A 3GE7A 1JFXA 5IBXA 4EAMA 1WKDA 4M7SA 4ECLA 2A85A 2A21A 1R46A 2VUYA 4WY0F 3RITA 3ZSSA 2Z00A 4UQ9A 3KVJA 3UZ5A 1FCVA 1TQXA 1VCVA 3MY9A 4J1OA 4U28A 3C3UA 4FLSA 3H22A 1H2IA 2ON3A 1JF6A 3S8HA 2WK2A 5LA2A 3QY6A 4UXDA 1T99A 2X8GA 3EB4A 5DRCA 3PF3A 4Q4RA 2Z1KA 1F3PA 3EWCA 4YJ5A 3CGTA 3QZEA 5HJYA 3WMCA 4NJGA 2ZZBA 1XRSA 3QC0A 1JJKA 3EYPA 4H3DA 2VFDA 1VPYA 1WCGA 2XYLA 1VFHA 2PDBA 2WHMA 3DESA 4DWDA 1FWRA 1FWWA 3RX3A 2R14A 4UQDA 4UFIA 1S2WA 1PE1A 2C3DA 2BGSA 4LUJA 2V0TA 1QRQA 5AC5A 4DF1A 1ISZA 4GUIA 4AYSA 4NU7A 4WUIA 4PZVA 4MM1A 2I17A 1ZBWA 4EANA 3FSTA 2W9MA 3CHEA 2OFJA 3SCVA 2NT0A 1RVGA 3N11A 3MKVA 4YCPA 2VL4A 1XLEA 2PLKA 1BXCA 3CZLA 4OECA 3CM4A 4XSLA 3HV8A 4JQAA 4AXNA 3TMQA 4HOZA 3VMPA 5HMFA 4H4PA 4IQEA 1OY0A 2YGYA 4ATWA 1ESWA 2CKRA 1KFKA 3NGFA 4WKFA 3R1ZA 3VOHA 5TR3A 3PJWA 1CBGA 4QLKA 1SMDA 1PB0A 3KOWA 3NR0A 2UV8G 1YE4A 2Z27A 1RZMA 1IZCA 1GOXA 3VOFA 2HWGA 4OBTA 4NXKA 5HWMA 3CAWA 3HO8A 4P2VA 4RW3A 4XVEA 3SGZA 2HXTA 2Z1VA 4S3GA 2WC7A 1UKQA 2VXNA 3P60A 3M5YA 1FH9A 4JX6A 4YNGA 3ABRA 4RNHA 3APYA 3CQ0A 4UOZA 1S38A 2XVGA 4LEQA 4WD0A 3GVVA 1XSJA 4GR1A 4UFMA 3QH2A 2NPXA 2WQDA 4HPJA 4X63A 1DXLA 3N1AA 3WH6A 2OXNA 1E1FA 1IR1A 3PWGA 4GPNA 4MKSA 3E1F1 3FG2P 1TPDA 3MWCA 3CPUA 3GVGA 4R85A 5BMWA 1G4TA 3WH5A 4CU6A 1IEXA 1E6XM 5A95A 3WSUA 4US5A 3G24A 4ZGYA 3I10A 2FZMA 3NAVA 4WCJA 5EMJA 3C2RA 5D2VA 4Q8NA 3SADA 4UNLA 3ZQ9A 3IRSA 1QWKA 5IBXC 3TC7A 1P1XA 3Q94A 4H6KA 5A6JA 1ONFA 4QDWA 2YR1A 3SQMA 1X96A 3FK4A 1CIUA 3N34A 3NGJA 3OHMB 1JYWA 3I4EA 5TAOA 3VXGA 5JBEA 1H62A 2VYOA 3WBXA 4ZXOA 1DWAM 3LB0A 1EQPA 1KV5A 4Z1DA 5M03A 2VELA 1GZ1A 4TVUA 3WQFA 4H9MA 5D33A 1XIEA 3ARPA 3E38A 4Q8PA 2Z7GA 3SCNA 1JPMA 4Q8QA 2DY3A 3EXTA 2P8BA 1L6GA 2C1GA 4Z1BA 4C90A 4LYPA 1V4YA 2AL1A 4QP0A 2NUWA 2P5NA 3G1XA 3R58A 2PRHA 1UJPA 4QQUA 3GR7A 1K7FA 2VNCA 3EDFA 3E5BA 5HNTA 3ANVA 3L4YA 1KKOA 2YCLA 1X1NA 2O0TA 3U5UA 1EIXA 1W0MA 1KBKA 1VFUA 1E3XA 3GTNA 3WLJA 4K38A 2ZA1A 5AKQA 4DYKA 3MHUA 4PB5A 4LXFA 1GRHA 3EA3A 3RUBL 4HN4A 1B2YA 2EG8A 4O0ZA 3ARRA 4RPQA 1A5BA 3C2FA 3PZGA 3GU2A 4U4MA 1ZBKA 3B0PA 5FIPA 2E25A 4X22A 4C6PA 4O52A 2DUXA 4PTMA 3DGRA 3EX4A 1VPQA 2XWEA 5L9FA 3F4WA 4AZ7A 3M46A 1Q4WA 5CC3A 3LRMA 3MA8A 1K9FA 4OGZA 4TOQA 4J57A 1F07A 4DPQA 4CEXC 2QW5A 3O0FA 2OJPA 2Z7KA 1EWDA 2PGWA 3L7RA 3OLIA 3PZNA 5FS9A 3FHQA 5FA5A 1TPFA 2ZWZA 1EGZA 2KAUC 3WJWA 4WVXA 1OWQA 1DTUA 3QW3A 4XZIA 1CEOA 3KXQA 1C8VA 2QIWA 2F38A 3TTOA 4AAJA 3WD0A 1VYSX 3UNTA 2OU4A 1LWHA 5I02A 3A64A 3TQPA 4DZHA 3AS2A 1JUBA 4JQ2A 2ZVIA 3PUDA 2WZIA 2REQA 3ATYA 5M1TA 2ZRZA 1BXBA 1L2QA 4U5KA 3UZJA 3EKLA 5DY3A 2Y4SA 3ALGA 1H51A 3EOSA 1C9WA 1ZCCA 3UWYA 3VZZA 3WLHA 1VJSA 4DXKA 3EEGA 1UA7A 3I3BA 2DIEA 2ZX6A 1CYGA 1KM4A 3SRHA 1RP9A 3RFAA 1Z6KA 3ANYA 3LLDA 3WEZA 1LT7A 2JKPA 4GNJA 5D9NA 3GTHA 4Z2LA 3VTRA 3IWPA 1H7PA 2QUTA 1FBAA 2PCEA 6XIAA 3F1QA 3ITCA 3NFUA 4RJEA 4GX8A 2OOGA 3TYCA 3QN3A 3RJYA 4N02A 4JDBA 1FWGC 1XQLA 1XDJA 1Q8JA 4E2VA 1TWSA 2BG5A 3SQSA 4UFLA 3TNBA 1QNQA 1VFLA 3GXTA 4H4SA 3UXIA 3CL6A 2A7RA 2W54A 1PS9A 1YNQA 4M81A 1KQYA 1GG0A 2C7FA 4Z2GA 2XINA 3W29A 5AECA 1RD5A 1CPUA 4M7TA 5E9XA 3TEVA 4A3HA 2OQYA 5A6BA 1EDQA 3RRXA 4D1JA 3EA1A 1WB0A 2VJXA 3QPEA 2J62A 3KVKA 1GRGA 1Z32X 5T8GA 4ADUA 2GJXB 1O5RA 4FS9A 2EPMX 3LGEA 3MHGA 4OKDA 3WF3A 4TIMA 3THCA 3MC5A 2PZ0A 3O0KA 4R5EA 3G18A 5AZ0A 5FS6A 4AIOA 4GZEA 1THFD 4YTUA 1M04A 4OBRA 1XIGA 2VHLA 3VKAA 3OZPA 3LXCA 3ZMRA 3PPCA 4JYEA 4LS2A 5B7YA 5I7GA 1ZAHA 4ZVJA 3VOIA 4HKPA 1W5NA 3W2NA 3KDOA 2X50A 1ISYA 3O2LA 3OIHA 4PCPA 1EEXA 4CVUA 1OG6A 4LV4A 2PWHA 1Z7AA 4GZIA 4IPLA 5KZ6A 2QVHA 3ARWA 3W7DA 3W85A 3M5ZA 4Q22A 1DOSA 3GZAA 4GQ0A 4IG2B 4IL2A 3VX1A 2E9BA 5JIPA 1O5XA 2KX9A 3CUJA 1CXKA 1UHVA 3VIJA 3WH8A 1LL4A 2ZRUA 3ZO9A 2CERA 3R8RA 2OT1A 3DFNA 3REQB 2A3LA 4MB3A 2YJQA 3TFCA 3FKRA 4NNCA 2DW6A 3FKKA 4IIDA 2G3IA 3AHZA 2IKJA 3PUEA 5FJOA 3T0BA 4ACYA 3MZNA 3ZJ7A 4US6A 5A8QA 2WKGA 3W84A 4N6EA 2VO5A 3K8MA 2J88A 1TA3B 2L5HA 3HRDC 5EFDA 1C91A 3W3OA 1JZ4A 2PF8A 3OA3A 3WEOA 1SJAA 3H8AA 3N3MA 5D03A 4O11A 4ZR8A 4AIEA 3W7LA 3S9ZA 3OVRA 2VC5A 1KRAC 3R07C 2P0IA 4QNEA 1A5SA 2X2GA 4D8LA 1U1JA 4J5NA 4V28A 3QOMA 3QV8A 2C3CA 4QHRA 3XISA 4BFAA 1V03A 1EJ7L 1QO5A 4Z1AA 1JZ6A 2CHNA 3A9BA 3WJYA 3QSRA 4EP8C 3KHJA 2PTWA 3PSVA 3SQPA 1PHQA 2VZSA 3MI2A 2P10A 5K9XA 1K4HA 3TH6A 1EEPA 3P2VA 1I75A 4BI6A 1AW5A 4NNBA 1RH9A 1SZRA 4EMJA 2ALDA 4K8GA 3MO4A 2X16A 1IQ8A 1B3WA 3PULA 4NQ1A 1DIDA 3ZLFA 3QMTA 2HROA 4XKYA 3NPXA 3L4UA 4JQ1A 4H4TA 1WKYA 5ENLA 4TV6A 1HT6A 1TZ7A 1GVQA 2RKXA 1UQZA 3GY1A 3UVAA 3GQYA 5A2AA 4AX6A 4JFVA 2GR1A 3KL0A 1JYXA 3UXAA 1ZXIC 1K9DA 5D9MA 1OBAA 3BG5A 4PL1A 2W61A 1BLIA 4D71A 2ZWYA 1U1UA 1B30A 2MNRA 2QDGA 4J40A 1NY1A 2WCAA 4O1AA 1GTEA 4XBJA 3D46A 1B4EA 4LF1A 1AOGA 2GR0A 3VGHA 2G3NA 1KXVA 2E28A 1KFCA 3CL7A 3A3XA 3IVSA 5TQLA 5CKSA 3K30A 4L64A 4O57A 3W75A 5HNRA 3DERA 3A3HA 2WAGA 3FY1A 2FHCA 4HHMA 1E6PA 3N14A 3CAKA 2RABA 2WPFA 3QPZA 3UXKA 3FVMA 1NHRA 3TSDA 1FWAC 1QPOA 4XD4A 1Q6GA 3UG4A 6XIMA 3N25A 4F66A 3IJDA 2PDKA 4RV8A 3VUSA 2OLHA 2V6AA 1WOAA 3KVLA 4L6HA 4HYVA 4LAKA 1J4EA 3I7QA 2I57A 2AAQA 1LYXA 3QFAA 2J8TA 4G8TA 4APNA 2FZ8A 4B5UA 4C1LA 4EOUA 2J8FA 4GIEA 9CGTA 1OFOA 4GGHA 4HHLA 2OLSA 1TE6A 3MSYA 2MUCA 1GONA 1TELA 2JBMA 1A0CA 2J4GA 5ABEA 1TB3A 4AZ5A 1OK6A 2ZC8A 3R10A 5HNNA 3W76A 3VNJA 1A4LA 2ZXBA 5C9WA 4WIWA 1UD3A 4BQ5A 3GXPA 2PWFA 2RDTA 2DZPA 3UWQA 3GU1A 2B4GA 3MYPA 4M51A 4FSAA 4G9PA 4EMWA 3V16A 1PCWA 1ICPA 1RVKA 2BLEA 1D2KA 1DKWA 3ZVHA 3GXFA 2CETA 2YW4A 2G3MA 2C79A 5AHIA 2B0MA 1F6YA 1BTCA 3WFAA 4AIBA 4OOUA 3QLDA 1JCLA 3U7BA 3BAKA 3SRDA 5CJ5A 1NP0A 2J27A 2WANA 4JTUA 2GVEA 4M6PA 4W7WA 3TK7A 3TA9A 4DI8A 5A8OA 1FRBA 1WDSA 3R6IA 3PZTA 3C0LA 4LEFA 2WVTA 3ES7A 2FZBA 3WDIA 3WY1A 4CN4A 5LGXA 1R87A 3HU7A 4AD5A 4LW7A 4DX3A 5B80A 1KLZA 1MEIA 2QHAA 1HW6A 1DJIA 4HNUA 3K1DA 4B3ZA 2NUXA 1AUSL 2CWXA 2WMHA 2PDFA 3UWWA 4X2RA 4JTEA 4H1ZA 1IE7C 2XTKA 5FL1A 3G1HA 2QF8A 4WLCA 3UA3A 2FJUB 3UWUA 2VC9A 1G01A 3WDPP 5DELA 3IV8A 7PTDA 3LYEA 3V0UA 3NJ3A 4W84A 4HCHA 4ZFCA 2AL2B 3EOLA 3BZGA 5AVNA 3H6OA 1TPB1 3G1SA 5K3VA 4DI9A 1GYMA 2OGYA 4TMCA 4HMDA 3STFA 4X9SA 5C9XA 4TVWA 3GS6A 5EYWA 3S5SA 1STZA 5IXEA 1XYFA 1TE1A 3W07A 1ALDA 1V8EA 3DG7A 3NYDA 3U48A 4HP5A 2R82A 2I5IA 1EP3A 2OR2A 4O1BA 2G37A 3STPA 2ZZ7A 2R1KA 4QDPA 2XSXA 2FTYA 3HF3A 4FB7A 3T44A 2QS8A 1SU5A 1XRFA 3ITGA 1PTAA 1A3HA 3AWOA 4C6OA 1PAMA 3W7NA 1R6WA 2YDQA 2WMJA 1A5AA 1CXFA 4JN6A 3W0KA 4IH3A 3NS1B 5CCZA 3HPSA 4JZ5A 2QUNA 4N4PA 4C6QA 3ZT5A 1DQWA 3P14A 2YDRA 4QEHA 4IUGA 2DQWA 4F79A 4XUGA 4HNNA 1DBTA 4XQ6A 5CPNA 4W8AA 3AOFA 3IK4A 3G1AA 3E96A 2V3GA 4RE4A 1J01A 1Q63A 2GK1B 5FKYA 4UMAA 4UIOA 4WZHA 4RDYA 4GO9A 4KEZA 4D8AA 3T2PA 3PNUA 2CZVA 2PU0A 4H6EA 1EHNA 3N2BA 4BHYA 1DYSA 3KBSA 5DT5A 4LT9A 1WV2A 1JL8A 1TV5A 1S5TA 4C7GA 4I9AA 3JZEA 1SUXA 4NKCA 3S1WA 4I3GA 1W3LA 4J3WA 1TV3A 1HJXA 1RK5A 1XYZA 4RZBA 3S1XA 4A8LA 5FMHA 4PMRA 4PTVA 3RJXA 4JTAA 3D5HA 1W3IA 3QQ1A 3QY7A 4K8DA 4O1DA 1JXKA 3PHAA 3THUA 2ZVRA 3M0YA 4A3RA 2DP3A 4NEVA 2C19A 2QMJA 3AU2A 3NQBA 4DAFA 3ZJKA 1X98A 1FDZA 2RGLA 3ITOA 4GA8A 3KLLA 3TJLA 1VP5A 3CPGA 5JUVA 1W5PA 1PXGA 4GNKB 3E49A 3VGGA 3GO2A 3BLOA 5LA0A 2D0HA 4EQRA 2OYLA 3STEA 1ODZA 4KF1A 1M65A 2Z1XA 2WW5A 4KKXA 2O92A 4PUKA 4XO7A 3EMZA 4FNRA 4DWSA 4QLLA 1NOUA 3GRIA 5JBFA 2JGQA 3W7CA 2PC4A 3BJSA 2YQUA 5I5RA 1B3VA 1W2PA 3DYPA 3AYRA 4ZZ9A 5C2XA 2XVKA 3MCOA 3DFPA 1VCGA 2C14A 1HJQA 1W9PA 1QO2A 2DQXA 4DO6A 4JTSA 1MFVA 1BG4A 4B5XA 2UY5A 3MQTA 3IS4A 3AUJA 3PUOA 5CJNA 1KFJA 2F8QA 4EPEC 2WVVA 1WE5A 4H6RA 3EXSA 4XX6A 4D2JA 4JTQA 3DH9A 2D0GA 4LAOA 4PBGA 1S2AA 2O4QA 2ZADA 1CX9A 2X7VA 1H11A 5K9DA 3AMZA 1YNYA 5HMEA 3VNLA 2E6FA 1KWGA 2V3FA 4TTGA 3TXZA 2W55A 1DJYA 4QCFA 4XZNX 3OZOA 4NIRA 1TJRA 1R0MA 1KKRA 1VBJA 2HTMA 4AW7A 4AIUA 1T40A 4F2UA 2WJZA 1FIQB 1N8FA 2XIQA 4GJIA 3POCA 1W5MA 5CZKA 4C6FA 1MNZA 2NSOA 1EBDA 4MUPA 4H83A 1H7NA 4EXBA 3PY2A 1AH3A 1SO3A 4ZENA 1UW9A 3FYYA 3UU0A 2WNZA 4NEWA 2AKZA 1LORA 3CZJA 1Z9AA 3IANA 3QV9A 3H12A 4KRTA 3VC6A 4HA4A 3L9CA 4JTRA 5CLWA 1Q13A 4RK8A 1W8SA 4OV9A 4NZ1A 4QG9A 3R43A 5F1VA 2FQIA 2GGHA 3Q58A 1QWGA 4MYXA 3HQPA 3FS2A 1O95A 2BNJA 3BAYA 4L6OA 2QLYA 3WZ0E 2J3NA 4REQA 3GHRA 3P81A 4GABA 3KHDA 2Z1BA 5M3WA 2QDDA 3S0CA 5EKYA 4Q8VA 3M41A 2OQHA 1UWSA 1ZKQA 4H7VA 3ITVA 4GIYA 3K13A 4D6CA 4HCLA 3E9AA 4LVGA 1MNSA 3PTDA 2POZA 1AL7A 4JX4A 2Y2WA 3URBA 1VS1A 3FNDA 3AMDA 3OBAA 4Z1CA 3D47A 3GH4A 3GU9A 3QFBA 3RO8A 4GYJA 1N60C 4DUXA 4HB7A 1E4MM 3E0LA 3NQMA 5BCAA 4ZB0A 3VNZA 1TVPA 3HJEA 5E6YA 3H2FA 2H3BA 1UWRA 5BYWA 1RA5A 1KR1A 2DUAA 4O50A 5KZDA 1G1YA 2ACRA 5XIMA 3N19B 4Z17A 2QAEA 4DWSC 3E12A 1K8XA 4V33A 3LA4A 1IZKA 4AISA 3H4XA 4XTDA 1GQNA 2PDWA 3V1PA 3FA4A 1H0GA 1GEUA 4L56A 3P93A 4IL0A 5FOOA 2EJAA 1VDVA 4PE8A 3LADA 4JQ3A 2NLYA 3S6DA 2BOFX 2GDQA 3QSTA 4GO8A 2BDQA 3UT0A 4RDVA 5M17A 4JDRA 4FOUA 2QCLA 4V15A 3KS6A 5FCZA 3GNPA 3KCOA 3SCWA 4KFNA 5KETA 4RXFA 2OTDA 3ZFHA 4BY3A 5H91A 2W62A 1RBAA 4AWEA 2ZX7A 1N62C 4AWTA 4XD6A 1WQ5A 2D3NA 2OB3A 5A69A 1XKYA 2ZDSA 3HIJA 1XYBA 3LG3A 2H8XA 1SSGA 5CJMA 2NV2A 1BF6A 1DP0A 3H2CA 3SUVA 1EF2A 3DFHA 3RG6A 1K7XA 4UQCA 4YL2A 1XX1A 3KWSA 1MSSA 1MUWA 4BI7A 5E0CA 1H0IA 2YCLB 4NZ5A 2CLFA 1L8NA 1GVYA 3G6MA 3B40A 2X1UA 2PDNA 5J5DA 3CUHA 3BURA 1WOBA 2J7GA 3GTIA 1T0OA 7CGTA 4PUDA 3GC5A 3N6QA 2DSKA 1NJJA 1YPFA 4INFA 4F3HA 4NJKA 2UY2A 4K1GA 2ZZ5A 4S23A 3RM9A 3TC3A 5DMYA 1E4IA 4C6BA 1GOIA 1DIEA 2QULA 3W7KA 4N6FA 3QM3A 1XP3A 1ZUAX 1BTMA 1LRNA 1V3KA 1A80A 1LQAA 5I24A 5EMUA 1YDYA 4X61A 4I7VA 3ITLA 3VOGA 1U83A 5FEPA 2C71A 1XDMA 3LNMA 4F0KA 1FO4A 3T0AA 3FJLA 1SZFA 3W7IA 1YNPA 2BOEX 3NPUA 2YB1A 1Y65A 3QY8A 2BY3A 3SR6B 4E8CA 1KC7A 3G3DA 3L4ZA 3P8IA 1K8CA 1V0MA 4AHQA 5H6HA 3ABSA 1TZZA 4KCVA 5HA7A 1C8YA 4GHRA 2REQB 2J8GA 1XLIA 2RAGA 4NZFA 1NWRA 1I0BA 3BLDA 1VBUA 3TTYA 3OBEA 3N4AA 3TOYA 3W00A 5IDIA 2D2OA 3P84A 4U10A 4PTWA 4ERAA 4R34A 1ODUA 3KEHA 4IIGA 1XINA 1S2TA 2ZTKA 4JPGA 2VM8A 2FTPA 1K7EA 3R4IA 2GVJA 3V4BA 5DMNA 3N2MA 1WAUA 3N17A 3LXBA 2XUCA 2PPGA 4CEUC 4RUBA 3RNDA 4L4MA 1XIDA 3NOYA 2A3CA 1Q1WA 3HFTA 4X9YA 3DJJA 4UTFA 3DFYA 1ZU8A 3EOEA 4ZEPA 3QTPA 4EF8A 2OT0A 2O9PA 1SFLA 5IFTA 3R89A 1HF6A 2BBFA 1P7TA 3W2JA 1RQEA 1Z3NA 3CUGA 5A8MA 4GXWA 1Z42A 3JVAA 4C6NA 4AZ6A 3TDFA 3VDHA 3ARXA 5EGRA 3AMKA 3BGGA 1PKNA 3N73A 2BB0A 2O4MA 1PSCA 1YBQA 1ZCOA 1JR1A 1J5TA 4HJWA 4IPNB 4EXAA 5GJNA 4P61A 3NSXA 4JAWA 1WZKA 4LCQA 2E7FA 2WPBA 4KCWA 4LQ1A 1X2GA 1V0NA 3AYVA 3LZ5A 3LV6A 4POCA 3DX5A 4AWUA 4FHAA 4E38A 2DGAA 5AC8A 3QYSA 4OUEA 2R1MA 1FWEC 2FB2A 4JEQA 1O5KA 4O28A 1WAWA 3UESA 2V5CA 1UQYA 1OFRA 3JU2A 5A6LA 1JDFA 4NRRA 5J5RA 1O60A 1G94A 4S39A 4YLWA 2A79A 3TWAA 3W4RA 2NX1A 2Q8XA 3MYOA 2CKSA 1GT8A 1DVJA 1YXDA 3CQHA 2XH2A 4GZ7A 2C16A 2VVNA 4L9XA 1DE6A 3GDMA 1NH6A 1TJ2A 3O9NA 3AZTA 2J24A 3HJZA 3UWEA 4UTTA 4M80A 4LTSA 1I2PA 4PBFA 3BCDA 4H4IA 3RIKA 2GL5A 4PULA 1JNDA 2PUZA 2YA1A 3ZYZA 3SI9A 3M0LA 1E70M 2CDUA 3DZ1A 2RJGA 2CBUA 3RGTA 3GM8A 4A21A 1TPWA 3UGRA 1FDJA 3UYCA 4MY9A 3VUPA 3XINA 1HL2A 3V35A 3M0IA 5EL1A 1PDYA 4HCDA 1P4CA 2V30A 4W87A 2WPCA 4I6KA 5LXXA 4DBUA 3SY8A 4I5XA 4A8IA 1PEZA 2DPEA 3G0UA 3F4VA 3IUIA 1U22A 2HBXA 4PRWA 3TE9A 5CBIA 1H1ZA 2NXGA 3U2ZA 5TF0A 2AMGA 3A24A 2V8ZA 2V5KA 3HPZA 3PM6A 5K7JA 3BGJA 3EKZA 3FX4A 2WM0A 4G1KA 1OGGA 2XIBA 2YA0A 4DZ5A 4PB3A 3NQEA 5TD4A 2O56A 2F2HA 1KBLA 3VOJA 5ABFA 4O53A 4IOTA 5LNSA 3RLUA 1N55A 1GRFA 4IICA 3LD5A 2ODOA 1XYCA 2W27A 4A29A 5JBDA 1SR9A 3OGSA 3S2JA 4B4FA 4DNHA 4GFSA 1DWJM 4BQ4A 1F6KA 2OWXA 2BVTA 2EBNA 1R2TA 3RR4A 4A2SA 5H8PA 5AHEA 1A3XA 3WQ4A 1K9TA 2FGZA 1LBFA 2OWWA 2OQLA 2YFNA 1HP5A 4W85A 3R8HA 2PGEA 3AXHA 4XKYB 4A35A 3E74A 1GOOA 2PWEA 1VBGA 2YCIX 3OYZA 5DEZA 1WA3A 3EMQA 2YCKX 1W1B1 4CQDA 1L0PA 2NQZA 4J3ZA 3S2CA 3EWBX 3GW0A 4EWND 1FWJC 5K4ZA 2V69A 4MNLA 3QTGA 2TPRA 2A6NA 3CGDA 1V59A 4JTLA 4JKKA 3SR7A 1ZBCA 3IVTA 3DFOA 1M5WA 4YTQA 4AG0A 2YDSA 3DENA 2QJIA 2Y89A 3C3NA 3VM5A 3QGAC 1H5VA 1W1A1 4M0XA 1P6BA 4NJJA 3VGBA 1AQHA 4H2HA 1D3GA 1HJWA 3NL6A 2VUNA 4FX7A 1BRLA 3OTRA 5BU6A 4MB5A 4LUIA 1FH7A 2Z1SA 2H8ZA 4NZ4A 2HPMA 1NU5A 4KCUA 3SBFA 1OFAA 1HGWA 2EPLX 1GJPA 4JCLA 4JY8A <