3TTEA

Crystal structure of enolase brado_4202 (target efi-501651) from bradyrhizobium complexed with magnesium and mandelic acid
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
361
structure length
361
Chain Sequence
MMTTAAITGVTARAVITPMKRPLRNAFGVIDSGPLVLIDVTTDQGVTGHSYLFAYTRLALKPLVHLVEDIGRELAGKALVPVDLMKAMDAKFRLLGWQGLVGMAVSGLDMAFWDALGQLAGKPVVELLGGSARPIPAYDSYGVLDARDDERTLRTACDEHGFRAIKSKGGHGDLATDEAMIKGLRALLGPDIALMLDFNQSLDPAEATRRIARLADYDLTWIEEPVPQENLSGHAAVRERSEIPIQAGENWWFPRGFAEAIAAGASDFIMPDLMKVGGITGWLNVAGQADAASIPMSSHILPEASAHVLPVTPTAHFLEVLDFAGAILTEPLRVIDGKVTAKGPGLGLAWNESAVAKYQVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal Structure of Mandelate Racemase from Bradyrhizobium Sp. Ors278
rcsb
source organism Bradyrhizobium sp. ors 278
molecule tags Lyase
total genus 125
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature ec 5.1.2.2: Mandelate racemase.
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3tteA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3tteA01
3R0KA 2OFJA 1SJCA 1OEPA 4HN8A 3IJLA 3NZGA 4HCLA 3D47A 4KWSA 2PPGA 3V5FA 3SBFA 3N6HA 1R0MA 2PTXA 2PU0A 2OPJA 4DYEA 2QJMA 3OZMA 2AKMA 3PWGA 3RITA 4MMWA 2PTYA 3H12A 1E9IA 3PFRA 3IJIA 4E4FA 3H8AA 3TWBA 3N6JA 4GMEA 2OZ3A 2FYMA 1NU5A 3DGBA 3DDMA 1SJDA 3NXLA 3QKEA 3D46A 4KT2A 1TKKA 3KUMA 5BOFA 3CYJA 4HCHA 2PGWA 2OKTA 1ELSA 6ENLA 2GSHA 3V5CA 3I6TA 4DHGA 2PP1A 2DW7A 1KKOA 3DIPA 3UCCA 1XPYA 3BJSA 4H1ZA 3MUCA 4E6MA 3S47A 3SN4A 4X2PA 4DX3A 1MDRA 3R1ZA 2AKZA 4A6GA 5FJUA 3R0UA 1IYXA 2HZGA 3EKGA 1MRAA 4K2SA 3QN3A 3TQPA 3SQSA 2GGIA 3SN1A 3MY9A 3NO1A 4FP1A 4A35A 3ZLHA 2MUCA 3FCPA 3IJQA 3BOXA 4M0XA 3RO6A 3MWCA 4JHMA 3QTPA 1PDZA 2AL1A 2XH2A 1BQGA 3R11A 1KD0A 2PODA 3GC2A 5FJPA 2OO6A 3T6CA 3RR1A 3N4FA 4IP4A 4GISA 1FHVA 1PDYA 2RDXA 3GD6A 2NQLA 3VA8A 2PP3A 3FJ4A 2CHRA 4IHCA 4M6UA 2PSNA 4HCDA 4KPLA 2I5QA 2XH4A 5BOEA 2P8BA 2O56A 5FJOA 1EC7A 3S5SA 4E8GA 2GGHA 3VC6A 3N4EA 4H19A 1TE6A 2GGGA 4MGGA 4G7FA 4GFIA 3CXOA 1JCTA 2QGYA 3PK7A 3DG3A 4ROPA 3OP2A 1ECQA 4HNLA 4FI4A 3ZLGA 1EC8A 4DN1A 3MQTA 3QPEA 2XH7A 3UJFA 1W6TA 3MSYA 4KEMA 1ONEA 4G8TA 1L8PA 2PTZA 3RGTA 3VFCA 4JN7A 4J1OA 1EC9A 1MDLA 2PMQA 3PWIA 3T8QA 3I4KA 2GDQA 3V4BA 4GGBA 3UCDA 2PCEA 3UJSA 2PTWA 4IT1A 3BSMA 3CAWA 3JW7A 2OVLA 3TJIA 3P0WA 4E4UA 3OPSA 3DG7A 4GYPC 1EBHA 1F9CA 4Z1YA 2XGZA 3U4FA 5J04A 4IP5A 2P3ZA 3Q45A 2PS2A 3VC5A 3FYYA 2QVHA 1SJBA 3Q4DA 2QDDA 5FJRA 1KCZA 3GO2A 3DEQA 3P93A 1MNSA 3OZYA 4HPNA 2OX4A 4J3ZA 2ZADA 3RRAA 3ENLA 3VDGA 2OZTA 5FJTA 2GL5A 1R6WA 2AL2B 1JDFA 3B97A 2PU1A 2XSXA 2QJJA 3ZVIA 2P0IA 3P3BA 4EWJA 2OLAA 1EBGA 2PP0A 4GIRA 4GYPA 4F4RA 3IK4A 2HNEA 4MKSA 3SJNA 3TOYA 3U9IA 4JN8A 3CB3A 3TTEA 2P88A 3OTRA 3MKCA 2QDEA 3ES7A 2QQ6A 3UJRA 2FKPA 3VCNA 3DESA 3ZVHB 4IL0A 4GGHA 3RCYA 3V3WA 1P48A 1FHUA 3NFUA 4K8GA 3K1GA 3DFYA 3MZNA 4H83A 3STPA 3DG6A 2GGJA 3HPFA 4E5TA 3UJEA 1WUEA 1KKRA 3JZUA 2MNRA 2XH0A 4K1WA 4ZCWA 2GGEA 2POZA 3EEZA 1JPDX 3T9PA 2OG9A 1TZZA 3GY1A 3R10A 3CT2A 3TJ4A 4H2HA 1MUCA 1RVKA 2P8CA 4IZGA 4HNCA 2HXUA 2PA6A 2ZC8A 4A3RA 3UGVA 4DWDA 3UJ2A 3OW1A 1P43A 4YWSA 2AL2A 2QJNA 3ZLFA 3SN0A 2PGEA 3I6EA 7ENLA 4IL2A 1WUFA 3T4WA 1JPMA 3FXGA 3H70A 3FVDA 1SJAA 3SSZA 2DW6A 3CK5A 1XS2A 1NELA 3H7VA 2OZ8A 3QLDA 2HXTA 2ONEA 3THUA 4DXKA 3UXLA 1YEYA 3FV9A 3TW9A 3DERA 5IDZA 4HYRA 5ENLA 3TCSA 2OQYA 3DFHA 4ENLA 4Z17A 3TWAA 3ZVHA 3JVAA 1DTNA 2OQHA 5EU9A 3UXKA 3R25A 3VCCA 4ZA0A 3ES8A 1BKHA
chains in the Genus database with same CATH superfamily
2OSWA 2XINA 2E9BA 3GRSA 4REQA 4BQ5A 4NL1A 3FJ6A 2FB2A 5A69A 3O6DA 2GRTA 4R53A 3KS5A 1KW1A 1XICA 3UCQA 3ATZA 2A85A 1LOLA 4A8RA 3A7RA 3PWGA 2HVNA 3KBWA 3RITA 4MPQA 3ITTA 1UA7A 1G69A 3SY8A 1HW6A 4O12A 1CCWB 2BXYA 4OE7A 5IM51 1SW7A 1JL8A 4L4OA 4QJ5B 4ES4A 3QGKC 3INPA 1P5BA 1TKKA 5DRIA 1XCFA 4ORIA 3PTMA 3HIJA 2PGWA 2W3ZA 4AX6A 3NZPA 4JZ5A 3RK8A 1NP2A 4DHGA 2H3BA 5C8BB 3OVGA 2QW5A 3GKFA 1VBHA 1JYXA 4RL3A 2V81A 5I5RA 3UCCA 1GK8A 1CI1A 2ADAA 1THFD 1TYTA 3UQNA 3LHTA 3UESA 1AW1A 2W0HA 4ZODA 1XBVA 3R1ZA 3WDHA 2EF9A 2PF0A 3TR9A 5K9CA 2FHBA 1MRAA 4F40A 2IPFA 2NT1A 2HE8A 3KW3A 3MANA 1I2NA 4LEQA 3TYEA 3WJZA 4LY4A 1W1IE 3W4RA 1DWFM 2PD9A 1IGSA 3QY6A 3VAVA 1BYBA 3WBAA 3DFSA 3KL0A 1ZUAX 2GR1A 4U31A 3UT0A 4R9XA 1GVOA 2I9UA 4LVGA 5CGTA 3N18A 4M0XA 2XN2A 3MWCA 3KM8A 3AICA 4L1XA 3T81A 2PDYA 3STEA 3GZAA 5L9FA 1XIJA 1BRLB 3DI1A 1ZX9A 5BOOA 3GVGA 4WXZA 4IP4A 4UQAA 4PULA 1CXFA 1V6WA 3WBWA 4S3JA 2FDSA 4C6OA 1BXCA 2WMKA 3DFOA 2Z27A 4GQBA 4XTDA 2WQPA 1QI4A 2WMHA 3THDA 3GH4A 3QV8A 5DN1A 3XISA 3XINA 2YCLA 3IAPA 3L8KA 2QPXA 4Z1AA 1TRIA 3BXWA 3JS3A 5HJYA 3TJXA 3KL5A 3DCPA 2GGHA 3E0LA 1Z6KA 3PPFA 1BKSA 3BO9A 5REQA 3C2EA 1Q66A 4US6A 2ANUA 2BY1A 4IGHA 3QYQA 2G3IA 3ARWA 2R1PA 3EF6A 4NAFA 4DUOA 3W02A 1POJA 2FIQA 3CXOA 2FVMA 1HGWA 4BFAA 4C7GA 1JCTA 4PTVA 1P6CA 4L9YA 4CU8A 4D6JA 4H4VA 4H4XA 5LIUX 1FIQB 3EKLA 3ARYA 3RO8A 4UCFA 1O1ZA 4KWWA 1GJPA 2ZZ0A 4A3QA 3F5LA 3AO0A 3SCQA 2F9RA 3Q65A 4YJ5A 3VVGA 5JCMA 4DLFA 1BQCA 2AGKA 4X9SA 1K7XA 1JCXA 4KS0A 2TODA 4GGBA 3G3MA 4EP8C 2XYLA 4ZQOA 4I5UA 4W4QA 4AD2A 5A2CA 5CBBA 3CB8A 2OVLA 3MI6A 4OIFA 5HUPA 3GW0A 3KVJA 1A5MC 4LUTB 1Z89A 1KM5A 1GG1A 2AGTA 2ZTKA 2HVOA 3L4ZA 2GUYA 3WDIA 3TMLA 2WMFA 1EL3A 2QDDA 3VNYA 5A8GA 5A8OA 5HMDA 4JTJA 2V6OA 3VYLA 1DJGA 4B2DA 1FTXA 4UIOA 5A6JA 4GI4A 5ECUA 2NPXA 2BCPA 1YADA 1O7AA 1T3QC 1OZMA 2EPHA 1XFCA 3ARVA 4H9ZA 3DUGA 2GPTA 1R6WA 2C1GA 3BJFA 4GZJA 3DFNA 4FLQA 3VIFA 2YXXA 2QJJA 4QLLA 2CLFA 4DJDD 3WLQA 5C9WA 5I24A 2VEIA 1LVLA 1CLXA 2CERA 4GIRA 3GVQA 1W3TA 3QFWA 5BYWA 1ZAJA 2OODA 3HJZA 3P5ZA 3QOMA 2V3FA 1UUOA 3NVDA 3O05A 2FPTA 4EXBA 1XCXA 4QNEA 3LD5A 3H7RA 3MO4A 4Y8FA 3GHTA 4J3TA 4K8EA 3ARXA 3QV9A 1CTNA 3QBUA 3C0QA 3W74A 2VGFA 5I6SA 1M04A 3OA3A 3NVTA 1PX4A 1XLCA 1PKNA 1L6YA 2V5CA 3W70A 1CGWA 1ONFA 3VXGA 1I60A 2DJXA 3W84A 1FEBA 1DORA 1B3XA 1NOFA 4UTMA 1XD0A 4LWWA 3S6OA 5HNTA 3EKZA 3B9NA 5H1WA 1RBAA 1F3PA 4IIEA 1K8XA 1D7KA 1JQXA 1MUCA 1HN1A 1C7TA 1R3WA 4FNTA 4UCGA 1XQLA 1JCMP 4YYCA 3HBLA 1MQQA 4JEQA 2JGQA 1S2AA 2VEPA 1E1FA 1E0VA 2XM1A 4LVBA 2DZWA 3VGBA 4IPJA 2DSKA 3CQKA 5D09A 2FLIA 3G5EA 2C0AA 1TSIA 4WGXA 1KFEA 1D2KA 4BQ3A 1W1VA 4GI6A 1W1YA 4NZFA 2CLHA 1RR2A 4M3PA 3O0HA 4CD7A 4F9DA 2ZZCA 4JTRA 5FF0A 1SZGA 2F38A 4XZMX 2EJ1A 2IQ0A 4ZE5A 1VYPX 3T0CA 4HZ6A 1EUAA 3IS4A 1DE6A 1YNYA 2GSEA 2ZRVA 3FV9A 3W76A 5DF0A 3AMDA 4PTWA 2ZA2A 4LCSA 4MJMA 1M3UA 4LBRA 2PWUA 1X7FA 2OQHA 1AUSL 1TQXA 1M41A 3OLEA 1HL2A 1QT1A 1JRBA 5EBAA 3VIGA 3WSUA 1WDRA 3O9NA 2HPIA 3DHPA 4NYUA 3IGUA 4B3ZA 2QPUA 4QDPA 5C2XA 2PBOA 3IJLA 5A8MA 1JYWA 3ABXA 4DJFA 4FNQA 3C2OA 1FX6A 4HOZA 3JU2A 2X41A 3MP4A 4NQ1A 2Q01A 4PUUA 4DPPA 1E5JA 1REQB 4XD4A 1WE5A 1N63C 4A29A 2IKJA 3KTSA 3BGAA 4R85A 5H8MA 2NSOA 2ZDRA 1X7IA 4IX2A 4TO8A 3N3MA 1V3IA 4HNVA 1OX6A 2VEMA 5LIKX 1AJZA 3IIXA 1EJWC 1OG0A 1XC6A 1HJXA 1ELSA 4PC8A 1W37A 2INFA 3ANYA 1J0IA 3MSGA 2WPBA 3UWEA 1FFUC 3B8VA 3WEMA 5FOOA 3OYZA 1RHCA 2JF6A 3B0YA 4NNCA 2ISDA 2J7HA 3EXTA 3SRFA 3FY1A 1AW2A 3NURA 4FA3A 5JIPA 1H7XA 3S5OA 5FF2A 3WLIA 1A5BA 2A5HA 4MADA 3KRSA 4HU0A 2V82A 5TQLA 3AMCA 1BG4A 1DYSA 1UWQA 4LC8A 3UERA 3L4XA 1V3KA 4G5DA 4J4KA 1BQGA 1XBYA 2P5NA 5CZKA 3QMTA 3GNXA 3CMFA 1KB3A 5B7ZA 4KWVA 3CYVA 4QTGA 3G2GA 2F2HA 4L4LA 1W9VA 2OELA 5FF4A 3UG4A 1WXJA 1YIXA 2BGQA 1JCLA 4MKNA 1UKSA 3S5NA 2GZXA 5LIWX 1K6WA 2BHZA 1AW5A 4M6UA 1UKPA 1J96A 3RDKA 4KPLA 1H5YA 3P62A 4YCOA 3KLLA 4FIQA 1B30A 4JTQA 1R46A 3GIQA 2H8ZA 4N0RA 2HQMA 2HBVA 5K4ZA 4ZTYA 3S1XA 5BWFA 3WL0A 2QCCA 3CZJA 5A1AA 5ECVA 5G1YA 4TMCA 4QFUA 4PBGA 3CBWA 1EDQA 3AOFA 3F4CA 4ROPA 3GAKA 1W3IA 1ECQA 3WX7A 3UWQA 7CGTA 1HJWA 4PRRA 1AK5A 4YIWA 1W2PA 1TPC1 1Z8AA 3DFPA 1F6KA 3GDRA 4NUWA 1OT2A 4ZBCA 1ONEA 3II4A 1ZGDA 3TAOA 1OX4A 4JN7A 4J1OA 3UJSA 3GIPA 1VEMA 3LM3A 3MP5A 5M3WA 1P7TA 3NPVA 4B5TA 4CNPA 2OLHA 3E5PA 4IMCA 1I4NA 4Q7BA 2NV2A 1HO1A 4A3UA 4XG1A 1GQNA 3G1AA 3WLHA 3VD9A 2LLEA 4RNIA 5J04A 3TZFA 4Y9PA 2E8YA 4XZBA 3Q45A 2QT3A 1EFZA 2WZTA 4HBKA 1SJBA 4LV4A 3V1HA 2O92A 1DQWA 1V7YA 2I7GA 4Q32A 3G6LA 4QLJA 2C3CA 2EKGA 1BYCA 1PHWA 4HPNA 5E70A 3LX9A 4N6FA 4P7RA 3VMNA 3A4JA 2NVKX 4LV9A 4WLCA 1WKYA 1PTDA 4RK8A 4QXIA 2P50A 4O1CA 2OTDA 3V1PA 5HWNA 1KXVA 1U5HA 2NQZA 4NSBA 1OFOA 2V2DA 4L61A 4C7FA 6REQB 1WDDA 2HNEA 2X40A 1FVPA 1NIUA 4UTKA 3U9IA 4AHPA 2PF8A 1G9HA 4YNGA 1PTGA 2WVVA 4R9OA 4PSRA 4GNVA 1V3HA 4WKFA 2ZVRA 5I02A 2CWXA 4MB3A 4XZNX 3T55A 3GFXA 4CN4A 3KLKA 3CTLA 2C0HA 3VE7A 6TIMA 1E0UA 2VX4A 1V3MA 1JYNA 2XWEA 3NPXA 2V5DA 1UMLA 1GKPA 1PX8A 3VINA 1O94A 3WLNA 3UYIA 1DHPA 3LM7A 2Q3OA 4PCSA 1V51A 3H26A 4CVWA 1RJPA 4CD5A 1KKRA 3AWNA 2XH0A 4QITA 2GGEA 3SRHA 2VOTA 1EP2A 1CGXA 1JPHA 1G4SA 2IUZA 1D3HA 1BWVA 4ZO6A 4JFSA 4H7ZA 3W2JA 2QDHA 3ATYA 3SGUA 1AD1A 3L66A 3AM9A 1TMLA 3S1VA 2Y7FA 2ZC8A 1F8WA 1FQ0A 1M7XA 4N9BA 1QW9A 3QY7A 4GUHA 2C13A 1OIMA 1OX5A 3EDEA 5JCIA 4AZCA 1N7KA 4MVAA 3W0KA 2E6AA 1YDNA 3O3RA 5AHNA 4B5NA 3SUTA 4C1KA 2HISA 3W24A 4W7WA 3C86A 3PJWA 1JZ7A 1U5VA 1EXPA 4HGXA 1VFOA 3T4WA 2Y8UA 1SR0A 3AXIA 3AYRA 3M07A 4IF2A 3URNA 4L1GA 1QPQA 4AMAA 1K9TA 4XZ9A 3EAUA 2GLKA 3CGBA 1UPMB 1E70M 2CU0A 1UKOA 3GDMA 3TTQA 1GETA 4BEUA 2QR6A 5I2UA 3IJ9A 2V67A 3E6EA 3BSGA 1A80A 4JQ3A 4GYFA 2UY4A 4NZ1A 3VUPA 4AZ5A 5F2IA 4FMVA 3EWCA 4RZ5A 3AALA 1RA0A 2C15A 1W31A 1JZ2A 1TA3B 1UR0A 5E0CA 1XXXA 3PBGA 1VKFA 3MC5A 2J47A 4KIRA 1Y8BA 5E9AA 4QP0A 1MUWA 4DYJA 3ZR5A 2Z1SA 5H6HA 1W3KA 1Q2SA 4L4PA 4L56A 1W56A 1EJRC 2C3DA 4HYVA 2PTXA 4H50A 3HQ1A 3S4TA 3IJIA 3WJXA 4Q33A 4WSHA 3CIWA 3RM9A 1KTNA 2V0TA 2Y0FA 4FF7A 1XV8A 4TIMA 3U2ZA 2YB4A 2WPGA 4MYXA 3QKEA 2ZZ4A 1HJVA 1UCWA 3LMZA 3CZKA 4WCJA 1HTIA 2PBGA 1ITCA 4F79A 1KGUA 3KCJA 2J25A 3W87A 2D69A 3NOYA 4KEVA 4NXKA 4TVYA 1XLKA 3ELFA 3RHGA 4F0RA 1JEZA 1QASA 2PLKA 5HA7A 4MLJA 3MV01 5C9ZA 2WNNA 4EQXA 1BAGA 2HZGA 1A5NC 4LUYA 3KLJA 2YL8A 2PZNA 1U1JA 2X2YA 4HJWA 1V3LA 1UQZA 2ACRA 5ABFA 1KTBA 3F2CA 3D3AA 4FP1A 3N17A 4JIPA 4A35A 4S38A 1FUYA 2HV5A 3IJQA 4OBRA 4KGLA 4BF9A 3GG1A 2P76A 1BEUA 1JPKA 4XIAA 2VHLA 2PDMA 3JR2A 3H53A 2ZXQA 3OBEA 3TSDA 1DOSA 4UFMA 3DHFA 1ZBWA 3AXKA 3LQGA 4X60A 5DRCA 3UA4A 1KGXA 4YPJA 5I3FA 3QZ6A 3KBSA 3PZQA 1OC7A 4NZ3A 1EB3A 3DK8A 4Q4PA 5HR7A 3QEZA 3QC3A 2W67A 1PKLA 1UR2A 2OX1A 1XH1A 4O16A 2RABA 1HXJA 4ADUA 3GFZA 1GREA 2YCEA 4DJED 1QK0A 4M1RA 4D71A 3DKJA 1FHDA 5I3HA 4MGGA 3EA2A 4GYJA 3SADA 1ZY8A 3VM7A 3UZ5A 3L4UA 4CD4A 5XIAA 3BOLA 3UXIA 3SSJA 1OCJA 1AA1B 2Y24A 4ZO9A 2X16A 4KETA 3DG3A 1ICSA 3H2AA 2VDHA 4KFNA 2J9ZA 4E8DA 4HKPA 3CZGA 3W07A 2XU2A 3ANVA 1BSLA 1F05A 2BNJA 4XZHA 4L1WA 3FW6A 3G0SA 4UMAA 3UZWA 4ZZ9A 5CJ5A 4YTRA 2GDQA 5HWJA 3RMJA 4GJ1A 1PX3A 3FKKA 1GRGA 1O1HA 2WSPA 3QSTA 2VZVA 2QAPA 3B06A 1TVPA 4D6HA 3LY0A 2WKLA 3JW7A 1UWIA 4EACA 4CQBA 3TJIA 4F0SA 1JCNA 3BK0A 4ACYA 2NWSA 1JJKA 1XGEA 4GYPC 2HPMA 3PUGA 5LHEA 3VX1A 1QI5A 2BASA 2GJRA 3G22A 1PXGA 3S8HA 4DRSA 2W3SA 1F7BA 2PS2A 1RQBA 2R9ZA 4QG9A 1BLIA 1CXIA 1JD7A 4FOJA 1I1WA 4F66A 1UOKA 1TREA 3ZJ6A 3UPMA 3L12A 3DEQA 1JI1A 3N9RA 1KFWA 4BURA 4RV8A 5M5DA 2ZE3A 1W3JA 1K77A 2X8HA 4UTWA 4XVDA 2HNHA 2WM0A 4J3VA 4EE9A 5LA0A 2GOUA 1V7AA 1GVFA 4WKHA 4ZR8A 4AWTA 1UD4A 4DM1A 2XFFA 1S46A 1QR7A 4I90A 2Z1WA 1MXSA 3MBDA 4MKSA 3WD3A 1MQRA 1H09A 1TPVA 2G3FA 5I09A 1ISYA 1R2TA 5JRBA 3EDDA 5HANA 3DBNA 4M6VA 2DU2A 3RU6A 4O0QA 1XYLA 2OEKA 1FH9A 2PDLA 4IIHA 1FCQA 4MWAC 1EWDA 8XIAA 3SW6A 4KRUA 2NQJA 3N12A 4V2XA 4BCEA 4GX8A 4IWWA 5A6LA 4DWSB 1GYLA 2F6KA 5JBFA 3POHA 1QRQA 1V77A 5DXXA 2FJUB 1TTIA 4Q8VA 3E38A 1XKJA 3VD3A 1SM9A 4ICCX 4K1WA 5E5CA 2P3EA 1K8CA 1JPDX 3EEZA 3M47A 3QW4B 4N2YA 1OSEA 1O4UA 1WZAA 2V68A 4O0ZA 1QDSA 2V69A 1NSJA 4S3DA 2J4GA 2TPRA 1KV8A 1DVJA 1E56A 1F74A 1RK5A 4AWSA 4TX6A 1Q6CA 1Q85A 1XI3A 4NAEA 4R88A 4UOJA 1STZA 4W5ZA 4R7OA 1Q7MA 3CV6A 1OYCA 2J13A 2VD8A 4NY2A 4AVFA 4YCPA 3SM0A 1X1NA 3N13A 1PPIA 1XLAA 3H70A 1LBLA 3SURA 4W8AA 3WYZA 5GJPA 3QFBA 1VCGA 2OZ0A 1JVNA 4JYFA 1WBHA 2QS8A 5A6BA 3LRLA 3W00A 1WOBA 3UG3A 4GRTA 5AVHA 4GUIA 1L2QA 2BY3A 3GD4A 4A21A 2KX9A 1H2JA 1H7OA 4GY0A 3W1UA 4D6CA 1A53A 4JL1A 3NYZA 4IPLA 5D37A 4X3ZA 1LL4A 4ICMA 1JAKA 2ZXBA 4Q8QA 1XYCA 4AG0A 3HPZA 3LGEA 3TW6A 4LVAA 3P6LA 4QHRA 3C0SA 3EWYA 4N42A 2OU4A 1LBMA 3N6QA 2Z2BA 1OEPA 4U33A 2WBAA 3WJWA 4O54A 2YW4A 1WZMA 3BLOA 4JDBA 5MKGB 3DGHA 1ZU8A 2AKMA 3KVLA 5T8GA 3WQFA 3NQDA 2PLMA 2OB3A 5HMSA 3PHAA 4CQAA 1W2VA 3RF9A 3T0BA 5BRBA 1F3XA 2J27A 2JFEX 3LHVA 5CG0A 2E5DA 3KDOA 1PUDA 1UP2A 1UZDA 4CEUC 1NY1A 1S2VA 4JAWA 1GZ1A 1UH2A 3GM8A 4DLMA 3GH5A 1ZKQA 3MA8A 2YA2A 1ZBVA 3GR4A 3LCFA 1KCXA 2YOCA 2W3RA 1H0GA 4GWEA 3VGHA 3UZXA 4MUZA 2CLLA 2J8TA 1K9EA 1OK4A 5FL1A 3R6IA 1A50A 2ZE0A 5HBFA 4PL2A 4V15A 1P6BA 2V5BA 4MDOA 4P7LA 4A2RA 1WKEA 3SQSA 2VFEA 2W5FA 3W1MA 3QGVA 2PDCA 1XBXA 2ZUTA 5TBOA 3CAKA 1S2CA 3LXBA 3FCPA 1XWYA 4GZIA 1NQKA 1NWSA 3NQ6A 2DP3A 5CKSA 1JUEA 3LXAA 3TONA 2CXGA 1PDZA 4B2DD 5I06A 3R11A 1MW2A 1K4QA 4HSOA 3OJGA 1C9WA 4DXXA 2GQ9A 5EMLA 1POKA 2BDQA 4LVDA 4FNPA 4FF5A 3C5QA 4GISA 2I14A 4GHRA 3WLSA 1E9ZB 4LGXA 1DBTA 3AIEA 1ZRQA 1H2IA 4NJGA 1AH0A 4OGZA 3ZT7A 3NZ1A 2XVKA 4ZGYA 1T96A 1DWAM 1CBGA 1PS9A 1E6PA 1N60C 1SW0A 1TE6A 2OOGA 4MZYA 1XLBA 4JS3A 1Q6DA 4JQ9A 3LBCA 4R7JA 4MUPA 3ZJKA 5C9XA 3R4IA 3BMVA 3L23A 4MB4A 4NNAA 3CNYA 1OJXA 3O16A 2X1IA 3NL3A 2CZDA 4IPIA 3TN3A 4WDWA 5REQB 3CV7A 3AHXA 1CDGA 3C2YA 1H7PA 5E93A 4IP7A 2VRJA 4AWUA 4HTYA 4MJ4A 3I7QA 9CGTA 1GNXA 2A3AA 4X0NA 3CZLA 1GW9A 4B16A 4E3VA 4Y9NA 2IPJA 3T8QA 4Z0JA 4UNLA 5LHFA 3UCDA 2PCEA 2ZRUA 4S3BA 4C6EA 3BAIA 5KMYA 4KCUA 5FS8A 3GDTA 1TWSA 3IIZA 4AF0A 3V7PA 1SFTA 4DJDC 4Q3MA 2E9LA 2VEGA 1H4PA 2ACQA 5BNKA 2QCDA 3P2VA 3DHUA 4IP5A 3KS6A 3AWOA 1SZEA 2FGBA 3TC3A 5I78A 1N82A 3MWAA 4ZFMA 3WL1A 3OZYA 4MF4A 1EJSC 1US3A 2VFGA 2X30A 5D2VA 3KP0A 4OECA 2CFFA 3NO5A 4QQ3A 4G56A 2HE5A 3VDGA 1QW8A 4EM4A 5EPDA 4B4FA 1G4EA 4NHVA 3L2MA 3BCJA 3HM7A 2AL2B 3NL2A 1WO2A 1PE1A 4D8AA 1QWGA 5JBEA 1DJIA 1P1MA 4GJJA 3PJXA 3H23A 2V9DA 4UWMA 3TFXA 2RDUA 1F3WA 4ERAA 4DBEA 3IK2A 4FXSA 3VNKA 4GYPA 2I56A 2XM2A 4G1NA 2C16A 3LSBA 3M6YA 2XFRA 3SJNA 4EM3A 3GDBA 4H9UA 4P7OA 1KWGA 3WQ5A 2ZZ5A 4XISA 1N8FA 3WNOA 1JIBA 4OT7A 4Z2GA 2XSAA 2Z4GA 3EMZA 3M5YA 4MNMA 2ZOXA 4BQ2A 5FF7A 4AIUA 1VGAA 3LHYA 4PB4A 1ICQA 4CEXC 5I03A 1PV8A 4DJFD 3GRTA 3CQHA 4GUJA 4C6PA 3K1GA 2W66A 3ISIX 3ARPA 2YZRA 4RKAA 2VFFA 4LBUA 3THAA 2YKKA 4XBSA 1JPIA 2ISVA 4LQ1A 1J2BA 4OV4A 1NF7A 4C91A 3H6OA 1I0BA 4XX6A 2L5HA 4EAYA 3K30A 4PUKA 3QPZA 3CT2A 3T05A 3F4VA 4R33A 2OCZA 3QPYA 1UJQA 3M64A 3O2LA 1O5XA 1PIFA 2YX0A 1UYQA 2HXUA 3HW2A 4IJCA 1JFHA 3EX2A 4IMGA 5JIWA 3JRKA 3TDFA 3AHYA 1E73M 2NQ5A 5CJMA 4PMRA 1MFUA 3UVIA 1E72M 4CUCA 5KZEA 5CC3A 3WLOA 4UMBA 4G2DA 1EF2A 4ZOCA 3WBEA 4HK6A 4Z2LA 3LRKA 1YTDA 2QUTA 3Q37A 2H6RA 4J56A 4PMVA 2VJXA 2VZTA 2BXZA 2HK0A 1L6GA 3MMUA 3WMLA 1E4NA 3FDGA 1QWKA 2YYTA 1EBDA 3TSMA 1WV2A 4LYKA 4NZ5A 1J12A 1GTHA 3HG3A 3W1LA 5IDZA 3R7MA 4Z17A 1MO0A 4UTFA 3EWZA 3R07C 5U1OA 4JTUA 4Y9AA 3UNTA 5BU6A 3S6TA 5FL0A 4QGCA 3SB0A 2YGYA 3UY8A 1OFAA 2QJGA 4LCRA 1Q7ZA 2XVPA 1Q3NA 4EX4A 1ISVA 3C4UA 3MUAA 2XIIA 1JNEA 2WHJA 3U5YA 3NZGA 3D47A 1W54A 2QV4A 3G1XA 1IR1A 1I2RA 5CJNA 1DJQA 1BWCA 4LF2A 4K3ZA 3TYZA 4EPKA 3AS0A 2BLEA 2QJMA 3B0PA 3BDKA 3H2EA 1RD6A 2WNWA 3L4YA 3LTSA 3GBEA 1TX0A 3BQ6A 1IT8A 2ALRA 3RPMA 1FFRA 1TYPA 3U57A 1JDEA 4OKDA 5HWMA 4Q4QA 3BV7A 4WY0A 1OBAA 2NVCA 3CV1A 4HCHA 4MSSA 3WH5A 1GPWA 4UMCA 4D6GA 1EZ2A 4B5WA 1UWTA 1PZ0A 1X8CA 4D8ZA 2DFAA 4JTDA 1UP0A 2A2IA 3K1DA 1PB0A 4QRNA 1S5WA 2X1TA 1E6QM 3A6OA 4WR3A 1B4KA 5E1QA 4M8UA 5SWUA 3WCZA 3R8HA 3EKGA 3ITCA 1HJQA 3LCHA 3CUXA 1A49A 3G3DA 1LT8A 3CT7A 2W54A 3A24A 4QCFA 3CUGA 5D05A 2VC6A 5EB8A 1XIFA 2YIHA 3T7VA 1Z69A 3VUSA 2VCBA 1YQ2A 2FZ9A 4DVOA 1FWBC 1R3SA 4AZ7A 1EGZA 4ADSA 3EBVA 1UASA 2PDUA 3N4FA 1KR0A 3VOJA 3E2VA 3A21A 3N04A 1EOMA 1ITQA 1KFLA 3GD6A 1AQFA 2WCSA 3WMSA 3GQYA 5KZMA 4U28A 2E3ZA 2NXIA 3H4GA 3CGTA 3ID7A 5K7JA 2WOWA 3RX2A 1IEQA 1ISXA 3VIHA 3W7HA 4C6JA 2FFCA 4FSAA 1JGMA 1UWSA 4QDWA 3T78A 1QXLA 4FLSA 2UWFA 3E2SA 4MG4A 1OGGA 3WF1A 4A3HA 2PE4A 4APNA 2PGRA 4EIVA 2BBFA 4N9DA 3RLVA 4AIOA 2XPKA 3BJTA 5IXEA 7REQA 3OLDA 3LA4A 2ZUVA 4AX7A 4DXVA 3PK7A 2QUNA 1U30A 2CYGA 2X09A 4XAGA 3NJ3A 3GXTA 1FA2A 1Z44A 3QPEA 1OWQA 3L5AA 3A4AA 4NU7A 4KEMA 5C6MA 3VU2A 1TV3A 4GQGA 4KH2A 1E71M 4CNOA 1V3JA 5A6AA 4NEWA 1A3WA 3UZZA 1OFBA 1ZXIC 3JZEA 2X42A 2PTWA 4IFKA 4AIEA 3SR7A 3PZTA 2WZEA 3DH9A 1EH9A 5I3JA 1OX4B 2QHAA 3HZ3A 3TC7A 2E1DA 5CSYA 3QHOA 1XLLA 3UY7A 3VIKA 3TYBA 3TN4A 3GNOA 1KBKA 2DSZA 4CVUA 2A6NA 1SZFA 3LRMA 1CB2A 3HO8A 4O53A 3TTYA 1QNPA 2OZTA 4IG2B 3PPGA 3UG5A 1BTMA 4ZOAA 4WSKA 4EPEC 3NSXA 3KOWA 1UIOA 3DK4A 4O11A 3T09A 1HZYA 3W7KA 3WD0A 2VD9A 5HJXA 4HNOA 4DJDA 2ALDA 1RP9A 5AZ1A 3IJ8A 4KERA 5D9NA 4DM2A 3FOKA 3QQWA 3AMZA 1GPFA 5CSSA 3D3FA 4O15A 3ZYZA 3EYPA 1JD9A 3V16A 4FXRA 1M65A 3KEHA 1ZHAA 2VX7A 1RCQA 3A5FA 4JFUA 3NQFA 5LNVA 1S1RA 3WN6A 4GIYA 4UTJA 1R3VA 2VQUA 3DESA 1UZ4A 3YPIA 3A9IA 3B05A 4MPKA 4C6LA 3M0KA 5AY7A 1ME7A 2D20A 4N4PA 5IHSA 1TPB1 3L2LA 2V5LA 1E0XA 1B3YA 4ASTA 2CLKA 3W1TA 5AFDA 2ZUNA 5G1MA 1EJTC 4LUJA 3CHFA 4FR6A 5LIXX 1VENA 1BF2A 1J0JA 3GY1A 3E0IA 4FB7A 3WQ6A 3B0VC 2JK2A 1PWLA 2FH8A 1L9WA 2QF7A 2A7RA 1JR1A 3TXZA 3QR0A 2YDAA 1IT0A 1AJ0A 1HKJA 3MBFA 1LTDA 3MMDA 2QAFA 5JCLA 4GG9A 3T07A 2ZCGA 1P0DA 3NUKA 1KFJA 1TELA 4GNKB 4JHOA 5C55A 1W1TA 4XAPA 4IIGA 3GW3A 3WELA 3G18A 3T2PA 4MKVA 3W23A 3U7BA 3KVMA 2VXNA 4YTTA 4ZO7A 3R13A 5FI8A 3AROA 3AXXA 2ATMA 1E1CA 2E5CA 3QVQA 1B3WA 2V8ZA 5LA1A 1G94A 1TJ2A 1AMKA 3V18A 1PIIA 4JFVA 3PANA 3A5VA 4KF1A 4XZIA 1GRAA 1OFPA 4BA0A 2YXOA 1RPKA 3M0HA 1D7YA 1Y0EA 4J3XA 3DFHA 2FZMA 1US0A 2WMJA 4ATDA 3TOPA 2FFIA 4CNUA 3N9KA 1X6NA 1Q5MA 1V59A 1NOWA 3B9DA 3LSCA 3LOTA 4JDYA 3SCNA 3AHTA 4JNYA 2OFJA 2DVTA 1ONWA 4RDYA 4MFEA 3BGJA 1TIWA 1M1BA 3WZ0E 4I9MA 1VPQA 1JFXA 1J8VA 6CGTA 3N6HA 3WUEA 2OPJA 1V08A 4MMWA 4Q8UA 1KLYA 3I3EA 2C6QA 4LYQA 1Y5WA 1DWIM 7PTDA 2YL5A 4CU6A 1W1PA 4XV0A 3TQKA 1VFHA 4PGLA 5HJLA 4W93A 4KT2A 3SY5A 3EWWA 3N3TA 3V5CA 1T99A 2ODOA 3WD2A 2XZ9A 5F2GA 1FFVC 3L0NA 3NQ8A 1SGJA 1XC4A 1HQTA 4ZE4A 5KSWA 1R3QA 1OZQA 4O14A 3S6DA 4A6GA 5AB3A 3NVVB 4FX8A 4KQNA 2DSVA 4JOMA 1XM3A 4YWIA 4Q4MA 1CGTA 5DEZA 3N2TA 2J8GA 1RBOB 4DJEC 4NX5A 1WB0A 4MNLA 1KRBC 2I5IA 3PZMA 3N29A 3R0DA 5BMXA 2Y7EA 3GRIA 5J5RA 1XX1A 3QTPA 1H51A 3ARUA 1A3XA 5T26A 3AISA 2EG8A 2PODA 1PAMA 3W7CA 1ITXA 2ZZ2A 3GK0A 5M2FX 2IW0A 4DZHA 3EOSA 5U7SA 4JIHA 1QBAA 1X39A 2INEA 2Z6JA 3ZZ1A 5DQPA 3B0XA 5DLCA 4RE4A 1UP3A 2G50A 1FWJC 2I5QA 2WLYA 4V1XA 5D32A 3GVWA 3BE7A 1FHLA 5FJOA 1GSNA 4B5VA 1P4CA 1RXOB 2WSQA 3RXZA 4UFKA 3CWOX 2WC3A 2NVAA 1EDTA 4CNSA 3GTIA 5HPCA 3V0SA 3VD5A 1EJ7L 5CCZA 2PC4A 1XIHA 3WFLA 2YSWA 3WDPP 5CPLA 4EK7A 4FX9A 3PG6A 2BOFX 3R79A 2E7FA 3OP2A 1T7LA 2YFNA 2R1NA 4LA1A 5I00A 4LBSA 2CW6A 1QPRA 3GHUA 3DECA 3BW2A 1YHTA 2J9YA 1G5AA 4UQCA 5FS6A 3N25A 4HTBA 5AZ0A 3EDKA 5E6YA 1J0KA 3VABA 3GXDA 4I9AA 2V2CA 2X0HA 1WAUA 2YBUA 1QK2A 1Q6FA 2YB1A 3HQPA 2WZHA 3M46A 1B9BA 4UTTA 8CGTA 1JDDA 3K8LA 1JAEA 3CAWA 2DY3A 1CXKA 1H7NA 3AU2A 2BY2A 4OFCA 4N9EA 1F61A 1WDWA 5DX7A 3VKBA 1BYDA 4UUIA 4DF2A 2XGZA 4AY7A 1EXBA 1ZPTA 2B7NA 1V93A 3OGRA 3KXQA 1J18A 3DC0A 3KBNA 3AS2A 3SI9A 4L64A 4Q4OA 3EB3A 1T41A 1GUVA 2DH2A 5AC5A 1KBLA 4O28A 1JZ6A 1C7SA 5CZSA 3W6LA 3PR2A 1TX2A 4QEEA 1XUUA 4S39A 3OHMB 2ZRXA 1FKWA 1EP1A 3BMXA 3MCOA 1BYAA 1LLOA 5KETA 5A6BD 4H7VA 2YXGA 2CZVA 1VCVA 2AOSA 2O0TA 3VOHA 3V36A 1UD3A 4DBDA 1MW3A 2X1UA 2WJDA 4H6EA 3LNMA 5AYZA 1TV2A 2OLAA 4YHEA 4MNKA 1L6SA 4Y9MA 1F5ZA 4MY9A 5BRPA 1XLFA 3T0AA 3CEUA 1L6WA 3MCMA 1U1UA 3M0XA 1FWEC 4WD0A 3EEGA 1GOXA 2TRSA 1M01A 4LALA 2DUAA 4U5KA 2ISSA 3LHUA 4NJKA 4I9JA 2XVNA 1XL9A 2FKPA 1GEUA 5L6UA 3LN3A 4BS0A 1W9DM 2O4MA 1NFPA 4XIMA 3SO7A 2GVYA 3CAQA 4NKCA 2TYSA 2WZIA 4QG8A 2X2GA 4UR7A 3O0FA 3A64A 1ONRA 4IQLA 4NJJA 1LUCA 3K5XA 4Q8OA 2POZA 2BXVA 4PE8A 5G4WA 4TMBA 1ENUA 2ZZBA 4ADTA 1OYAA 1S2WA 3GG0A 3G8RA 1SFJA 3URBA 1KXHA 1FEAA 1WP6A 1OY0A 1MMFA 1N8IA 3L4VA 4WDUA 3MU7A 1S2TA 3IGHX 2G4FA 1ZCOA 2ZDSA 1JRCA 3BCDA 2VFHA 1VR6A 1NHQA 2Y2WA 2BVDA 1A3HA 3KHDA 1J5TA 3O6CA 3GNDA 4L5ZA 3RLHA 1QPOA 2Z24A 1RD5A 1LL7A 3A23A 1NDYA 3FXGA 4JEJA 4JL2A 2WMGA 3AZTA 4J40A 4HOXA 2EPMX 2JKAA 3GR8A 1Q6GA 1NWRA 4FZIA 1W9PA 2D0HA 1DQUA 2E0PA 1HKWA 4IUGA 1EZWA 1JZ4A 4LC6A 2XFWA 3S3GA 4CU7A 3VIOA 3BG3A 4Z2HA 1XHCA 4M24A 3PG9A 2P10A 2YCJA 1HP5A 5DO8A 3TWAA 4MM1A 3UGRA 3DYMA 1QOQA 3W7RA 1XDMA 2B0MA 4Z1DA 5IHRA 2YQUA 3WLMA 1Q63A 1E1EA 2BHUA 1TPDA 4Y96A 4I5XA 4CKQA 4L6HA 3DAQA 1E5NA 1M53A 1RV8A 1T0OA 6A3HA 3MVIA 3H54A 4HN8A 5LYRA 3CLWA 3V75A 2B31A 1LP6A 4JD4A 1QI2A 3G1VA 2WWCA 3NWRA 1UH4A 1EA0A 2X0YA 1V0KA 1VEPA 4MY8A 5CPOA 3RCMA 1MEIA 1AQMA 1JG9A 3IIOA 4E4FA 1FDZA 1OCBA 5AKQA 1LG1A 1ZMCA 3TWBA 4GPNA 4FLOA 2WJEA 4MNJA 5GRTA 2FYMA 1UWUA 3C2VA 2X05A 4PUNA 4DQWA 1WAWA 3GVVA 3CTTA 3WQ4A 5CGMA 2J74A 1F4AA 5CSUA 2Y5JA 4QM1A 1D3CA 5J8LA 1XIMA 5C0QA 3BSHA 3AAMA 2PWFA 3MKKA 4Z2KA 5ER0A 2PDQA 5JH2A 4RX0A 4XVEA 4I8YA 1ZY9A 2ZUSA 3OG3A 1TWZA 2FZNA 1DJYA 2OYLA 2P1FA 3LEPA 3N73A 1ZALA 2W55A 5HNNA 3LG3A 3NPUA 1GZJA 4NI3A 1KFCA 1VYSX 3G1RA 1TVLA 3GU1A 3BVJA 4I7WA 3GHSA 3G1SA 3WFAA 4PSPA 3C2RA 5C7HA 3W6YA 3LQLA 3BOXA 3CV2A 5I0DA 3R94A 2CBUA 1XSKA 1UKTA 1OFEA 5MHBA 4O1AA 3MHUA 3DGRA 2VFIA 2HK1A 3R5EA 3W85A 1HGYA 1ZP3A 1HX0A 2Y62A 4N6EA 5LXXA 5CG7A 1JEHA 2W92A 4JY9A 3TUUA 3MYPA 3FJ4A 5CAHA 2ATSA 3EXSA 2G97A 3CJPA 3FA3A 3E0FA 3GSMA 1SPQA 2PURA 3IEBA 3LTPA 1X97A 3WFZA 4M1BA 4U4MA 1G7VA 3A47A 3MCNA 4DNHA 4C1LA 4IH3A 3KBJA 2V5KA 2WP6A 3FXYA 1EKOA 4IJRA 1FP8A 2VC9A 2Y4SA 4NX0A 1V79A 5ABTA 5FF3A 4N9CA 5DBTA 1C8YA 2CBJA 4RDWA 4V28A 3VDAA 5AHIA 5F7UA 2WPFA 2O7QA 1NDVA 2ZWYA 4QS6A 2J88A 3WEOA 3MDUA 5AHEA 1ZENA 2NV1A 2OEJA 3ZLGA 3RRXA 3R43A 3S1WA 1UR9A 4PCTA 2WBKA 3SECA 1V03A 3ITLA 4XKYB 2R1MA 1KFKA 1ODUA 4RW5A 4WUIA 3E0VA 1OB0A 1MDLA 1Y5VA 1A0EA 3V4BA 2AQVA 5EMMA 5JBDA 1FWIC 4WOZA 2OT0A 3IGSA 1EPXA 1GJWA 2ZUUA 2E6YA 3A7AA 5LGZA 3WLJA 3LLFA 3DG7A 3M1ZA 3M9YA 4JTSA 1UUQA 1HUVA 1EBHA 1C93A 5A8QA 1F9CA 3CZ8A 1Q7QA 4ZB5A 5KVHA 1BRLA 2FTWA 3BQ5A 1W1ZA 1MZRA 4LH8A 2Y7GA 4LPCA 5CGQA 1HKMA 2XIMA 1P0NA 1SYTA 4RE2A 3PB0A 2XIJA 4FEZA 2EBNA 2OWXA 3IUHA 4Z42C 3CH0A 4CQCA 1J0ZA 1QAPA 5DT7A 1TRDA 3DYOA 3AYTA 1SFLA 4PMNA 4DJFC 3LLXA 4EKJA 3QZAA 4GBUA 3DKLA 2Y63A 2Y85A 2GL5A 3RLUA 1H61A 4W9TA 2E1WA 3TKFA 4E3TA 7TAAA 4WGHA 4DAIA 4C6IA 3HGRA 1PIGA 2XN1A 2PP0A 1IZKA 1YDYA 2XZ7A 4LB4A 3WMBA 3ARSA 1FH7A 3LCIA 4MZ1A 1UROA 2FHFA 3KFTA 4HQVA 2P88A 3KX6A 2QCHA 2WNZA 4W8BA 4CQ9A 3BZJA 4KKXA 4Y8EA 1DEDA 2VUYA 4PFMA 3P8IA 2WANA 4HK5A 2PC8A 4W87A 4JICA 5M17A 3M7WA 3ZVHB 4GGHA 4DELA 4HMNA 3V3WA 4GR1A 4W89A 4J5NA 4K36A 4PTDA 2V3DA 1KNWA 4LUTA 4E8CA 4DUWA 3UP8A 2WMIB 3RAOA 5C5YA 2VELA 4ZO8A 2MNRA 3NYDA 1XRSA 1K4GA 3BLIA 1UC4A 1ZFJA 4YYFA 1HL9A 4YWOA 1B90A 5BRQA 4QLKA 1S1PA 2OR2A 3U8GA 2RGLA 4HA4A 2XIBA 4TU1A 5LNSA 3TFCA 5G5HB 1XYBA 1YXYA 3PS7A 4Q8NA 2B81A 1V0MA 1YW1A 3HRDC 1ECEA 3N15A 3BLFA 2HJPA 4GZEA 1OHLA 1V0LA 3ABZA 3QFAA 4LB3A 4EF9A 2TMDA 5JVLA 4OWGA 3U6WA 1XRVA 4UFIA 5FS9A 3MDWA 4H6QA 2FDMA 4FXFA 4CCEA 3CUJA 3F2BA 3PAJA 3VIJA 2E3TA 1EP3A 4JQAA 5F4SA 1Y65A 2V3GA 3AIWA 3DGZA 4Q6JA 3S46A 1Z42A 1EX5A 1CLVA 1GRFA 4C6CA 2UY5A 1SJAA 4M6PA 4MWAB 5D2YA 4AD4A 3GZ3A 1BGGA 3DYPA 3AXHA 1N55A 2V5JA 7XIMA 3C8NA 3MMTA 1O95A 3VD7A 3F2DA 3W2UA 2R94A 1BTCA 3RX3A 4XBJA 3W9ZA 2C1HA 3NCOA 1XSJA 3K46A 4WRHA 5LA2A 1DTNA 3G24A 5HMEA 3Q6JA 3C6CA 3EZ4A 4ZA0A 4WZHA 3BL3A 3A3HA 4XB3A 1TPUA 5GQBA 2ACSA 3UG8A 5A6MA 4MYAA 4OJYA 2CLIA 4QJ3B 3NQBA 3OBKA 4P8UA 1XP3A 1V0NA 4JQ2A 2G0WA 4RDVA 1VRDA 1EDGA 3UR8A 3MHFA 2VUNA 4IXXA 3W28A 1Q6QA 4GINA 3N2CA 1ICPA 1L2UA 1SO3A 3TQ0A 1UMYA 5D02A 4DF1A 4NNBA 2FB3A 4AVOA 1OFRA 2VDIA 1NP0A 4C6DA 3II1A 4MB1A 2OKTA 4C5YA 1G4PA 3PZIA 1FFQA 1OG6A 2OQLA 2Q8XA 2RJHA 3CHVA 2FHCA 4H1ZA 3RR4A 4X2PA 1VIWA 3W53A 4DX3A 2FMNA 3B8IA 1AOGA 4NF7A 4UQDA 2INZA 3O7UA 1XINA 1IYXA 2DEPA 1IEXA 2ZX6A 4OVXA 1TB3A 3H2FA 2GGIA 4K37A 2EEXA 3C0JA 3DHDA 3AQUA 3HJEA 3M44A 4HU8A 4ILSA 4OOZA 1VH7A 1DIEA 5FA5A 4I3GA 1XLDA 1B54A 3W1AA 4LJ3A 1M5WA 2NX3A 3SCWA 4JR5A 3HG4A 1YMYA 1FHVA 3PN8A 3KOXA 1QTWA 4X22A 3OVPA 4PB3A 5FEWA 1C92A 1REQA 3BUVA 4HCDA 4YVVA 4IFOA 5IDIA 1WBJA 1VD6A 1IE7C 2XH4A 4HJFA 4M80A 2P8BA 3EPOA 4PUDA 1EC7A 2NXHA 3HTWA 4AD0A 3ME3A 2VFDA 3N4EA 2QAEA 1S5MA 3UPBA 2DH3A 4PFHA 4GX9A 2GH5A 2Z26A 2VGGA 2IQTA 2XHYA 3S5YA 2YAUA 4K6AA 1TVNA 4W88A 3GXNA 2V6AA 5DBUA 3K4AA 3QQ0A 1UR4A 3VNLA 3PSWA 1RY0A 3W7LA 3OZPA 1E3ZA 3GYEA 1C9DA 4URIA 1B2YA 3KWSA 1XHGA 1B3OA 4P8VA 3V5OA 1TJ1A 5I23A 5HQLA 1J5SA 1TG7A 1ZQ5A 1G4TA 1D8CA 6XIAA 4RW3A 1T5AA 3MSYA 2EQDA 3NRZB 1V6XA 4Q8MA 2TSYA 3MJMA 4G8TA 1FWAC 3CQJA 4ZXOA 3QTGA 3QF0A 3PWAA 1RALA 2C1IA 3ARRA 1RAKA 2PRLA 4Y2WA 2X99A 1FCBA 4JGDA 2W0UA 3KRZA 5DCDA 1TUFA 4GH3A 4JTKA 1OJTA 1OC5A 3S2MA 3K8MA 4JTCA 1ZZMA 2E40A 5I77A 3NXFA 3W1RA 2P3ZA 3FYPA 5I3GA 5G4EA 4LAUA 3VGDA 3C8FA 1O68A 3FYYA 1J01A 7TIMA 1VFMA 5DANA 3P93A 1MNZA 3RNDA 3WQGA 3I68A 1M7PA 3VGEA 1LYXA 4HK7A 4ORMA 1H5VA 2VZUA 3FJLA 3WO8A 1MQPA 2GOKA 1IWBA 2J78A 3UF9A 3NEVA 4YU1A 3CL6A 4H9VA 4AEFA 5HUOA 5D9OA 1W5PA 2CFYA 5HR6A 4R27A 1H62A 4AISA 3SCOA 2VDGA 3P3BA 4UFLA 5AHLA 1VDVA 2PLJA 1TR9A 1VBJA 3R2GA 4S3GA 1PWMA 3E5BA 3LYEA 1Q6OA 3A4XA 5XIMA 1ZTVA 3G6MA 1KR1A 4JN6A 3WBXA 2E9MA 1C8VA 3BG9A 3ECQA 1HO4A 4B92A 2GUBA 4EQWA 4H41A 1WDSA 3UR2A 1GOQA 1OT1A 2PWDA 4FR1A 1VEOA 2HCVA 3IUDA 5HPOA 3GDLA 1OIFA 4PUWA 1UD8A 2GGJA 2PGFA 4F2BA 2ISWA 2F5ZA 4GA8A 3FLUA 1UKQA 3TK7A 2I57A 4K39A 4AU0A 5E0FA 3APYA 3T9PA 1E6SM 1TO3A 3GS6A 1LG2A 3O8AA 2DZVA 1IZCA 2Y1HA 3AJ7A 4PMOA 2E67A 3ZO9A 4WXYA 5LGXA 5EMJA 1VQTA 4OUEA 4RUBA 5CPMA 3LMYA 1JF6A 1ZP4A 1NEYA 3GWQA 1QW7A 2C91A 2EJAA 4FLRA 4S3EA 4H6KA 5I3IA 4LXFA 1VJSA 3OHIA 2AAQA 4QISA 2GWGA 5D8WA 1MXDA 4ALDA 4AD1A 1L0PA 4LNYA 4UBPC 1R86A 3A3XA 2HQAA 2CZFA 3E02A 4IIDA 4DI8A 6REQA 1UZHA 3FVDA 3FA4A 3BANA 2BP1A 2QCFA 3SSZA 1W9XA 4W7VA 4YHGA 1NDWA 3H7VA 4MOZA 1WX0A 1GRTA 2OWCA 1LRNA 4QROA 4HNUA 3MV11 3S2CA 2HXTA 5KITA 4RXFA 3THUA 3TX9A 4B9YA 3GUWA 5LNUA 1LBFA 1OCQA 3CM4A 3WEZA 4DXKA 3UXLA 2WLZA 4GKTA 3N11A 4NT0A 1PYFA 1QHZA 4HYRA 2NLYA 3MS8A 3ETRB 4YVPA 3VDHA 1MFVA 3WNMA 4XTIA 3RG6A 3MHGA 1E1CB 3U2EA 4QX4A 4O10A 1A5OC 2GSJA 3L4TA 3MVTA 3R25A 4MAVA 3UWVA 5HOSA 4GH1A 2ZA1A 2GR3A 1I6NA 3R0KA 1DQXA 1H63A 3W7PA 4NJHA 4G7EB 1IZJA 3M16A 3WQVA 3ARQA 1B3ZA 3NO3A 5CC7A 3TVAA 4HCLA 4P8WA 5E0KA 4KWSA 2DT0A 5C70A 2DVXA 3TV8A 3FN9A 1DP0A 3FHAA 1XCWA 1DJNA 3L0KA 3DGBA 3DDMA 4F2UA 3TYDA 2GYIA 1CB7B 3GU2A 4HSNA 2HBXA 3CU2A 3MUZ1 3PM6A 1VHNA 4O1EA 5LIYX 2W9MA 4UTWC 5C71A 1XJBA 4PMUA 4DBSA 2X0SA 3DIPA 3IVUA 5FKYA 2D23A 3EANA 5CH9A 2CZEA 5F1VA 4OU1A 4E0CA 5IRPA 4BV6A 1AQHA 4GLEA 1TYGA 3GLCA 4O4VA 2QCNA 1PO9A 4ACZB 1EF3A 1XBZA 2JQXA 1N5WC 3SN1A 4LUSA 3MY9A 3HV9A 4DO6A 3Q2DA 1M9HA 4HPJA 4UQEA 2MUCA 3PY2A 4NYYA 3RO6A 1E3XA 3AMLA 4KIEA 5CLTA 3GC4A 3O0KA 1YXCA 3IRSA 4F0MA 1RQEA 3ITVA 4TR9A 1F2JA 2GJXA 1Q45A 5BROA 3R89A 2B7QA 1PZ1A 5K9DA 4JIRA 3B0UX 4EMWA 1W3NA 3WQCA 1K7EA 1CXLA 1FWFC 5F1UA 3RU8X 2CHRA 2QJIA 1AG1O 4Z1CA 2NX1A 3MUY1 4JHZA 1J0YA 2ZKMX 4PUJA 1RBLA 3EPNA 4O0KA 4QE1A 1VJIA 1GGOA 3GTNA 3UFYA 3TYUA 3EA1A 4G7FA 1MEWA 2BB0A 5B7YA 2PAJA 2NX9A 3ZMRA 1TFVA 3MPGA 3WDRA 4GXPA 1VFSA 4A05A 4KEZA 3SR6B 3VMPA 1B1YA 3B8SA 2IXVA 3SRKA 4GQ0A 4QEHA 5H2ZA 1M7OA 2WQDA 3B4YA 2J7GA 3B40A 3A13A 4JBRA 2QEZA 5C54A 2QDGA 1H11A 4W5UA 2DORA 2GQ3A 3ZR4A 2IPGA 4V1YA 2GWNA 1VQZA 4NVTA 5C2CA 3IARA 4IIFA 3U48A 4TTUA 1ZK7A 9XIMA 2AAAA 3PAOA 2VP8A 3P5YA 2WXDM 3LPGA 1NARA 4C6NA 1NDZA 3M5ZA 1H0IA 1V6VA 1XYZA 1YPFA 3V0UA 1A47A 1KV5A 2DZUA 3TW7A 4PEKA 5DMNA 1ITUA 3O1NA 3T1GA 3SFWA 4HYWA 4NI8A 1NWUA 5GPRA 3EMQA 4AZ6A 2NT0A 1VPXA 3Q94A 1FECA 5BXSA 5G2IA 3KCOA 4RNFA 1C8XA 3GO2A 1KM4A 4DBWA 1MRQA 1OQFA 1UJPA 1ZBKA 4P7QA 4EWND 1MNSA 1R9YA 4UTHA 1QNVA 3CWNA 3OIXA 4LEFA 3WG6A 4J3WA 1VF8A 2E5AA 2GFTA 3VDCA 4PMZA 4Y90A 4AAJA 4YMZA 2C8NA 1AZ1A 2BC0A 3FGCB 3W1QA 5AYBA 1NH6A 3B97A 2QIIA 3PZGA 1BD0A 5AC7A 3OODA 1EBGA 1DWGM 1UB3A 4F4RA 5F2LA 3M4HA 2VVNA 1LQAA 1MOKA 1YBQA 1MSSA 3LV5A 3FK4A 3E74A 1OK6A 2WC4A 3GFYA 1PJ9A 2CNCA 4NP7A 2PCQA 1G01A 3NA8A 1FBAA 2VGBA 1E40A 4IMDA 1E9YB 2CKSA 1ZCCA 1R85A 3VTRA 5IFTA 1E51A 2C19A 4WX2A 4IL0A 4NASA 4GI8A 1AJ2A 2ASHA 4M81A 1P48A 1FHUA 1K1DA 4K8GA 1BVNP 6TAAA 3NOEA 2DQXA 3STPA 1TZ7A 1VFFA 3UD6A 5TIMA 3B4UA 5F4XA 1WUEA 1N61C 1BFNA 1LPFA 1K02A 1HG3A 1E6ZA 1ML1A 1ZJBA 3K8KA 4Y9OA 3BH4A 4OOUA 3QOKA 3R10A 3BTNA 2PDNA 3MJYA 4ATWA 3TJ4A 1DJHA 5BZAA 1Q65A 3HMCA 2CETA 4GACA 3GNRA 2ZX8A 4IMFA 4YTSA 1U83A 5FS7A 3PFMA 1F8IA 4P61A 3NQAA 2FZ8A 3ZWSA 4H00A 4J3UA 3BAWA 3LCXA 3P81A 4OHQA 1P43A 3EDFA 2JF7A 4JTEA 4YWSA 1ISWA 2XTKA 3OLGA 4TV5A 5JU6A 1RJRA 3QR1A 3LU2A 4DZIA 7ODCA 4O18A 3ZSSA 2ZYFA 2YVGA 4HA0A 4IIBA 1DPMA 1J4EA 4AZBA 2ZX5A 2DW6A 2Z2AA 4HP5A 2BFGA 3G8EA 3SAZA 2YBVA 1XRFA 1O66A 3WK0A 1RJQA 3FAWA 2Q02A 3W26A 4DBUA 2ZIDA 4XD5A 2Z00A 2GK1A 1IQ8A 1F3EA 1U1HA 1VJZA 5ENLA 2ABBA 4O50A 2ZBTA 1KM6A 1PCWA 3CQIA 2B7PA 2A1YA 1TV4A 1Q1WA 2YJQA 3VE9A 4DWSA 3GXFA 3DBPA 1LT7A 3MUXA 4H2CA 4BEQA 9RUBA 4KESA 2NXGA 3AUJA 4H8VA 1E0WA 2PPGA 1GVQA 3VIPA 3ABOA 2QPSA 3WH6A 1D7FA 4KGJA 4JKMA 1VLWA 3H12A 3WQPA 1I2OA 4DYKA 1IT7A 2PDPA 3TXVA 3HN3A 5GNZA 3S83A 3CL7A 1YE6A 3IAQA 3S1GA 8TIMA 5E9XA 2EQ9A 1JULA 2CWNA 1PYMA 4LYRA 3O6YX 1TJRA 3GTFA 4UTLA 3WF2A 4CN1A 1C3FA 3T40A 2E77A 3DU0A 1K70A 2PP1A 1HNYA 1T8XA 2YCKX 1XPYA 2W4XA 2YA1A 1JI2A 3LBOA 4HPHA 3WF0A 3KRBA 4IPNB 1HJSA 3OVQA 4PYSA 3WUBA 1G6CA 2NWRA 4MFDA 4R3UA 4O52A 3SZ8A 4AVNA 4K2SA 1NTHA 2WK2A 5FEXA 3FKRA 2AMGA 3QXBA 4DIAA 1TWWA 1H1NA 3NVYB 3LGGA 1YTKA 2FH6A 3M6DA 4GIAA 3B9OA 1IWPA 1I2QA 2XH2A 1UD6A 1R9ZA 1T40A 1Q6RA 1S5VA 4RR4A 1LOSA 5FJPA 5CPTA 1A4LA 3T6CA 2J6VA 3T44A 3NPWA 1PDYA 5BXRA 1DXLA 1A4MA 3MB9A 1LLZA 1Z41A 3RJXA 2WPCA 1MW0A 3CUZA 2Q09A 4F0HA 1XLMA 2ZFAA 3PF3A 2XFYA 2I9EA 1U33A 2OKOA 3W7GA 1XIIA 4KEUA 3QH2A 3KHJA 1CGYA 1EO5A 3DXIA 4H19A 4UQBA 4IQEA 2UY2A 2GGGA 4IX0A 4QQUA 2FZDA 5A2BA 3EDJA 4AEOA 2G37A 2X8CA 4Q8PA 3PZNA 3CAVA 5ABGA 3P82A 1LOQA 4ERIA 1Q8AA 4K8HA 5IBXA 1JDAA 1H50A 3S2NA 4QJ1A 1N62C 4H9XA 2WZMA 3L0GA 2OLSA 3GAYA 2X50A 3P7YA 5D4YA 4Q8TA 1W1B1 3COTA 3VDBA 2YVJA 5FEZA 1XIEA 5E6ZA 3KOYA 3P0XA 1ADSA 2QCMA 2GQWA 2DT2A 4HMCA 3SEPA 5EKYA 5HAOA 3N34A 2JALA 4JDRA 2BVYA 2Q71A 3OO2A 4H6RA 4BI6A 2QCGA 3FJNA 3W7QA 4D2JA 3NZQA 3HPSA 2NUYA 5AC6A 1UIPA 3KL3A 5FJRA 2RJGA 4PCNA 2DUXA 1QHPA 1JCYA 5HQEA 1R47A 5JUVA 1WXYA 3NDYA 4JTTA 2OX4A 4INFA 4EMJA 5HNUA 1X98A 1XUZA 3N9SA 3LCLA 2BVTA 4JNMA 1BF6A 3W7MA 3H21A 2GVGA 4O13A 1MYRA 3L5LA 2EG7A 1ZJIA 1ZAHA 3W29A 2BGNE 3PJUA 4C6BA 3KZSA 3UNDA 2P0IA 3M0MA 1QMLA 3A22A 2PDJA 2J77A 1KN0A 1DE5A 2P53A 1NOUA 1LWHA 4MTVA 6XIMA 2A3BA 4U2YA 3TYCA 2REQA 3HU7A 2CBVA 1UW9A 3KE0A 4PZVA 1ZB5A 1NHPA 2J6XA 1K8YA 2WHKA 4JX4A 2ZZ3A 2FMOA 1TV5A 1B57A 1PSCA 2WP5A 4DB7A 3IJ6A 3APTA 4BQ4A 3PULA 4M19A 2W27A 4Z0SA 3W2LA 3RCYA 2OYKA 5G1TA 3SCTA 1C8QA 4GABA 2JKEA 2R24A 3P8JA 2QGHA 3DFYA 1FP9A 4IICA 1LWJA 1R3RA 3DG6A 3REQA 4BY3A 3SUWA 5M03A 4REQB 1V02A 4E5TA 1H6VA 3WLPA 3OYXA 1TPFA 1BXNA 1TZZA 5TAOA 3BAYA 1QPNA 2KZHA 4UB9A 1LQ2A 3CL8A 2E5BA 5I79A 2EG6A 1RVKA 5K9XA 2X1RA 3URHA 1B4EA 1NHSA 5BXTA 2QCLA 1SMAA 2YBTA 2PA6A 4H8HA 2W79A 3F03K 1LDCA 4AZGA 3BLPX 2W62A 4GYKA 2W61A 4GE8A 1VPYA 2VO5A 5MF5A 3MP3A 4WHBA 2AL2A 1UR1A 2BC1A 1EYEA 2G5WA 3QQ1A 3TLQA 2EAWA 5AN7A 5FEPA 4KRTA 1B0IA 1N2VA 3GDKA 3N1AA 5FMHA 2NUWA 2WCGA 4RV3A 3NVZB 2PWHA 4G1KA 3L9CA 2XIOA 3TA9A 1LROA 1QNQA 2PLCA 1PCKA 1KFBA 4MWAE 4ZOEA 3WDJA 3GG7A 4D6DA 2XJ7A 1RK6A 3CUIA 2Q3RA 3TW9A 3L7RA 1QO2A 3QR3A 2OQYA 1XD1A 2O9PA 4LIIA 1VIZA 2WM1A 1SB3B 4L9ZA 3CS2A 1TQJA 1QI3A 3BLLA 4JFWA 1DXIA 2WOVA 2G41A 4QNWA 3SY1A 3DZ1A 4O19A 2EPKX 3POCA 4XUYA 2BS9A 2WKJA 1SJCA 4HZMA 2BHYA 5CQ1A 3NTYA 4ZQPA 3S2LA 2ZZ7A 3SIZA 1US2A 1F8MA 3RIKA 4QE4A 1PBGA 2HWGA 4AMCA 1ZS2A 3PUDA 2YCLB 4JQ4A 4FDCB 1XPGA 1TZ9A 2PTYA 1JUKA 2WSYA 4RPQA 3UXDA 1E55A 3LXCA 3PP7A 1EWEA 3CUHA 2E09A 1NF0A 1NU5A 3GR7A 5EBKA 2PDKA 3NXLA 3D46A 4A8LA 2QCEA 4NXSA 5U4NA 4NAFB 3W6MA 3DJGX 1WXZA 4CD6A 4JX6A 3ITOA 2DW7A 1H41A 1HKIA 3CGCA 3LCWA 3PPCA 1A5UA 3BJSA 1SO5A 4E6MA 3TYAA 1AH3A 2WJFA 4QG6A 2UZ9A 2R6OA 2VC5A 4CCZA 1WZKA 5FJUA 3AN1A 2YL9A 2YDRA 4PRTA 4CN6A 3OLIA 1FKXA 1OINA 4KMQA 4WY0F 2JK6A 3AS1A 4UR8A 4FAMA 2WAGA 1H7RA 3CWHA 4ZMGA 4LAOA 5D9PA 1BVWA 4H9TA 4DI9A 3NR0A 3WIJA 4LS0A 5DY2A 3ERPA 5TNVA 1EEPA 1X6UA 4S2CA 1LL6A 3RR1A 3LB8A 1W3HA 2QUMA 1I1XA 5GNYA 3MYOA 3ALFA 1GKRA 1GOIA 4D72A 1OFDA 1XYAA 1TJPA 2E4TA 3TN6A 1WQ5A 4IISA 4ADWA 4E2OA 3H7UA 5G5IA 4AFYA 2NUXA 1RM6B 3HPAA 1JYVA 3TAKA 3AFBA 3CQ0A 3URQA 4US5A 1E4IA 2A4AA 2EQ8A 3S42A 3LI0A 4L7ZA 3T2QA 3LZ3A 1F73A 5K3VA 1EOKA 3NQMA 1K03A 5D04C 1VLIA 3B8UA 4EXAA 1X2GA 3SUSA 3W75A 3GHRA 4LANA 4XAZA 4AD3A 1CXHA 1GONA 1PEZA 1KCLA 2QULA 4Q7NA 5D33A 4E2VA 4NZCA 1EGMA 4CNNA 4FI4A 4J2MA 5C2GA 1UBSA 3MUIA 4NIRA 2XGBA 4LSBA 5EMYA 2NQ9A 2GVLA 3PTDA 1V6UA 3RGTA 4F8XA 2Y5EA 2Z1BA 2EPOA 4LYPA 1XIBA 4YTQA 3LNPA 5GJNA 1ZL1A 2OGYA 1SSGA 3W83A 3BG5A 1IWAA 3WH7A 5H8UA 1XG4A 3RUBL 4ICNA 3BSMA 1WDQA 1EO7A 2QMKA 3P67A 3VKJA 3B8WA 4I8DA 3CIXA 2BGSA 1RSCA 2VCCA 1IXPA 2YLLA 3OA5A 3M0YA 4ROQA 5T9CE 1DWHM 1OADA 4A22A 3S1UA 1G7UA 3EWDA 3UWUA 4D6IA 2FGZA 2J7CA 2VURA 3PNZA 1JGIA 1VCFA 1E43A 3EPMA 2CCRA 3PZ9A 4ZQNA 1P6WA 2D1ZA 1GQKA 3W86A 4HB7A 1HFBA 2YFOA 2ZQ0A 3J7HA 1F6PA 3UETA 1ADDA 4J3ZA 2ZADA 1TPEA 4POCA 4UTIA 3BGGA 1DL3A 4L80A 3WENA 1GEHA 4XD6A 3WF3A 4DO4A 5BCAA 1Z9AA 3WLLA 5JMUA 4QCEA 1R38A 4GKLA 4H4IA 1YYAA 2XSXA 1FOBA 3QZEA 1VS1A 3R12A 1UR3M 3EGJA 4UFHA 1HKKA 2VCAA 1FRBA 2WB5A 1MXGA 3DFTA 3VNZA 1GVYA 3LENA 3UU0A 3TOYA 3LGDA 4ML9A 4HPXA 4PUMA 5CZTA 4BZYA 3W01A 2VRQA 2O55A 3VGGA 1PHQA 3L2IA 3BAXA 4WF7A 1K9FA 3MKCA 3NGFA 2QQ6A 4HPGA 1XIGA 2PDXA 4PODA 3DH7A 5FJJA 3AYSA 1KBJA 3NL5A 4CCCA 2E8ZA 4O1DA 3UVAA 3LUTA 3DOPA 2PFHA 1J93A 2QV5A 5J5DA 4TOQA 3GG8A 4HMDA 2WNQA 4H4PA 1ADOA 2WSKA 3I3BA 1N5XA 1V5XA 3E9AA 4ZCWA 5CBJA 1SVDA 3IACA 2HROA 3QV6A 4YN5A 2OT1A 3KOZA 3WLTA 2P8CA 4B9ZA 5AC4A 4QSFA 2A3EA 2WHMA 5ABEA 3CGEA 2GJPA 4A3RA 3VZXA 3UJ2A 1YX1A 2E6FA 3WF4A 4IG2A 1IF2A 1QPKA 5CC6A 1X96A 5C7VA 1CW2A 5CEWA 5LNWA 2C79A 4IL2A 2IXUA 3I6RA 1VFTA 1GYMA 1JPMA 1F3TA 3DC8A 1OC6A 1H49A 3CK5A 1XS2A 2Y88A 4TVWA 3VOFA 3TSBA 3BV4A 2H9AA 2ONEA 4J35A 3CHCA 3AUOA 1KM1A 1FDJA 2Z1VA 4K1GA 1GOWA 5GNXA 1FO4A 4JPGA 2QNEA 1B9ZA 4D9PA 3LI1A 2VKZG 1LF1A 5IFPA 2PRMA 1UH3A 4PEEA 3S2JA 1T8QA 4TVUA 4EANA 3L4WA 1YQZA 5DELA 3ZJ7A 5HMFA 3ZIZA 2D24A 1FDYA 2DT3A 3H2MA 1FWSA 4UTTC 1KGWA 1UPPA 2ACUA 3FS2A 4Y6GA 3W73A 5JCNA 2PDFA 4CNTA 4Q8WA 5HXMA 3VNJA 1YNPA 3UZJA 4KRZA 3OZMA 3VO0A 2Y8VA 1KRCC 2YL6A 4MIMA 3U2CA 1MO9A 3CMGA 1TTQA 2PWGA 1R30A 3N6JA 1CYGA 1OF6A 1QNSA 2ZRZA 2VM8A 4W84A 2F6XA 4GQQA 1OFQA 1VRXA 4C1NA 1GYNA 8A3HA 3KUMA 3VNMA 1RH9A 1P0BA 1GERA 1WKFA 4EVZA 4JY8A 1N8WA 3ZJ8A 3O06A 3I6TA 3WLKX 3G0UA 1DJXA 3A3WA 1OM0A 4ATLA 3LADA 2GVJA 1QU4A 1MDRA 1IEWA 1MEHA 3GB6A 2DIJA 1KM0A 1OF8A 2BG5A 2PWVA 3WK1A 2FJKA 3GU9A 3I3DA 1S2UA 2WJZA 3EXRA 4M5PA 2IS7A 4F48A 2Y61A 4GY1A 3U7VA 1UZ1A 2DGAA 1TJ0A 3AYVA 3EX3A 3NM1A 3B8DA 3DI0A 1MZHA 4Q4KA 1AH4A 2BTMA 1P7TB 2EO7A 3UWWA 1TCMA 3W7JA 2XN0A 4D1IA 1S3HA 3SUVA 2VWTA 4HD5A 4LUSB 5LXEA 5A95A 4DUXA 2QZRA 3P60A 1R2RA 3QC0A 2DZSA 2O4QA 4FPSA 3TROA 4J27A 2EQ6A 1AMYA 5D30A 3LTYA 1AODA 5BOEA 1QOPA 4LRSA 1CGUA 1WDPA 2GJXB 3M43A 4E8GA 3R8RA 4CGTA 1RLDA 5BXPA 4I7UA 1GT8A 3WNNA 4JTGA 3G1DA 1GOOA 1S38A 4QJ4B 3LS9A 3F4DA 3FFSA 2VZSA 4D6EA 2VENA 4N7QA 2JEPA 2Q6ZA 1BXBA 2A6LA 4H4UA 3QV7A 2J7EA 4FHAA 3SCPA 4AIBA 9XIAA 5G2HA 3W38A 4ZOHB 3OQ8A 1E6RA 3QMSA 2W6RA 2WVVB 3L68A 5FJIA 3NDZA 2QF8A 4XKMA 4OTKA 4LT9A 1W8GA 1WZLA 1CEOA 4XZLX 4WSJA 1L8PA 2PTZA 3WD1A 1KA9F 1QI0A 3CUFA 4CLMA 3PBVA 4U5IA 2C14A 3I4KA 4H4SA 3UR5A 3LHZA 4R7WA 3LZ5A 4H01A 4TVCA 4EAMA 2QLYA 4PMQA 3HQNA 3W7IA 3P0WA 4E4UA 2BWGA 3M7SA 4BWLC 1FWGC 3U4FA 2E6DA 1R9XA 3VC5A 4GK8A 4RE3A 4IMEA 2FQIA 4H3DA 4PMDA 2RHGA 3IC9A 1CGVA 2H8XA 1JDCA 5AYYA 1BSIA 4RLIA 2OYMA 1GESA 4BF5A 2ZX9A 4ZSUA 3KTCA 4EPDC 2I16A 2QYGA 1IXQA 1O5QA 1X8FA 1XYFA 5RUBA 2D3NA 3HGJA 1TTPA 5CZJA 3STFA 2GVEA 2QMJA 2Z28A 4K7VA 1SU5A 4AZCB 4AY8A 1JDFA 3LV6A 3TR2A 2PD5A 2A0NA 1YE4A 2CDUA 2GR0A 1H60A 3B04A 2QIWA 3PVFA 5A94A 1O5RA 1W9UA 1JROA 2CLOA 2PWEA 4DF0A 3CPUA 3GXIA 4LS1A 4B5XA 4L9XA 3W22A 3BAJA 1UQYA 4JN8A 3TN5A 3AU6A 5BMWA 4DWSD 1HVXA 1IEIA 1B31A 1QO5A 4PB5A 4X0VA 3TTEA 1NQ6A 3OGVA 3W7NA 1F4HA 1KBIA 4TV6A 4IMAA 1TUXA 4S2BA 4A8IA 2GDUA 4TVDA 5AOUA 2A7PA 1KXQA 1KRAC 3M0IA 3O15A 1YBQB 2FTYA 3LCGA 1U2YA 1YDOA 5D2XA 2DSUA 3MO7A 4GO9A 2OJPA 2WHLA 4AYGA 1R8LA 4H83A 4U3CA 1GVSA 1UUMA 3VZZA 4B5UA 3HURA 3UBPC 4BHYA 4WK9A 4P5UA 4H4YA 1TMHA 1RQHA 3PG8A 1O12A 2QKFA 1K4HA 5AYIA 2ZA3A 3DK9A 2D2HA 4K7YA 3PZUA 4AY1A 3PBUA 4H2HA 4GNJA 2V3EA 2G96A 3EOEA 3OBAA 4XAYA 2ON3A 1YRRA 4IZGA 4PTXA 5A5WA 3PC0A 2NLIA 3HA1A 4UFJA 3LLDA 4WOQA 4B91A 2Q8ZA 4D1JA 4DWDA 4AD5A 4F0KA 3TA6A 3W82A 1UA3A 4O8RA 3ZSTA 1KQZA 1JOAA 4AH7A 4YXGA 3DJJA 4RJEA 3NSMA 1CX9A 2B7OA 4LX4A 3ZLFA 3HG2A 2WSRA 1GRHA 2PGEA 5BW6A 5D2WA 4GVGA 5M1TA 4M29A 1RCOB 1RUSA 2QXWA 4JYDA 5GJMA 2ZWZA 2UY3A 5FSEC 2OGJA 2O9RA 5FACA 2W63A 4JKLA 2PI6A 2X1SA 3NAVA 4HHMA 5AHMA 4WQ6A 2WYSA 4E2BA 3QJAA 4AB4A 3CO8A 3CPRA 4F9JA 3QLDA 3FHQA 3NL6A 1I45A 3TC6A 4LTSA 5KTLA 3SDOA 1F76A 5ABFB 2WOIA 2VQTA 3IUIA 5TD4A 4S23A 1CZ1A 4JYEA 3WNKA 1RCXB 4GY7A 2JBMA 2TPSA 3WD4A 2XIQA 3D6NA 1R3TA 3BOFA 1YTEA 2Z25A 3VCCA 1FH8A 2GDVA 2EQ7A 3ES8A 1BKHA 2R91A 3VCRA 1GVIA 1KCKA 4S1FA 3GTHA 2GK1B 1GZGA 3W2MA 2A8XA 3QFEA 3QRHA 4AXNA 4JIQA 2WCAA 2R1KA 3N19B 5EMUA 3KBVA 1ZDLA 2PU0A 4J3SA 1O6IA 4U2ZA 1XH0A 1RP8A 2FPVA 3Q58A 4AZIA 1EJUC 4GMEA 1G1YA 4M7SA 4GRSA 2X8GA 2IKHA 2G95A 5AECA 2CC0A 3HB9A 3GIYA 1FWNA 2ZXDA 4XUGA 3EMCA 3NQVA 2JGYA 4UR9A 3RNMA 4AXKA 2J79A 3KCLA 5C9RA 1KKOA 4PA8A 5AVNA 3S47A 4HHLA 1H7WA 4XAFA 3MMWA 3USZA 4JQ1A 3GTXA 2CHNA 4AYSA 4AC7C 4FNSA 4YL2A 4ZENA 5DFAA 3GYCA 1LWIA 1DJZA 5HULA 2J3NA 5A8PA 3NQEA 1FWCC 1A5CA 3TIMA 3UEQA 1AL7A 3VOCA 4XK2A 3W88A 4XD3A 4C6KA 1DWJM 2R82A 5A8NA 2ZRYA 3PZVA 1E0TA 4JHMA 2AL1A 2WPEA 2DPEA 4LRTA 4DO7A 3C52A 3GC2A 2OO6A 2VR5A 4UOQA 1AVAA 2J62A 3HGSA 5HK4A 1XLIA 5KZ6A 4WEVX 4Y7EA 1XLHA 4BI7A 5LNRA 1V6TA 1NWTA 3EOUA 4FOKA 1P0EA 4DUVA 1GEQA 3VX0A 3IGXA 3KDNA 3NEHA 3HMJG 4AC1X 2PSNA 5KINA 2DJLA 3SUUA 3OG2A 4O4WA 2YDQA 4GVHA 3STCA 1RA5A 1ZJAA 1HKVA 2D2OA 1Q6EA 3VC6A 3U0HA 1XG3A 5FIPA 5JQ9A 3S9YA 2CITA 1BHGA 3QHNA 3CIVA 5HDRA 1Z32X 4M82A 5CXPA 5EL1A 4ZXLA 3Q67A 3WQ8A 2XISA 1F6YA 3BZGA 1BG9A 3JUGA 3NDOA 3FA5A 2X7WA 2PUZA 4S3AA 3U4AA 3KVKA 2OO0A 1SO6A 3WK2A 2BMBA 4GC4A 2RUSA 1S5TA 1MUMA 5IOBA 4ZQCA 1JQVA 3ARTA 4BI5A 1EC9A 1XR2A 2P0OA 1M6IA 1XANA 2A7NA 1IHIA 3ZFHA 4PMYA 2XVLA 1RPXA 5F2MA 1NVMA 2DZPA 3FX4A 5LKYA 5JCKA 4UOZA 1GHRA 4M52A 3CMJA 4KWUA 4I6VA 2J7DA 3WKZA 3OIHA 4CQ8A 2GR2A 2VRKA 3G0XA 4JCLA 1VC4A 4OBTA 3SJ3A 1NAL1 3AIQA 3GC5A 3IV3A 3C61A 2I5GA 2QVHA 2UV8G 3Q4DA 3W71A 3PTQA 1XSIA 1KCZA 3OVRA 1KRMA 3BLKA 1W32A 5AYXA 4M7TA 5GVJA 3E2QA 3SCRA 5A6TC 4GXWA 4MY1A 2R8WA 4S3FA 2VWSA 3AZRA 4NZ4A 4PMXA 3IIPA 4AHQA 3NQ2A 1QATA 5FJTA 5D8ZA 1X1OA 3TTSA 4NAEB 1V97A 1DHKA 2F61A 4O1FA 3M0LA 4JXCA 1UG6A 2ZVIA 1K9DA 3P14A 4G9PA 3QKZA 1WYIA 1G0CA 3BARA 3H4XA 3IK4A 2RDTA 4BWLA 1EPVA 3IVTA 1GV4A 2AQWA 1E4LA 1MVYA 3T42A 5EYWA 3SRDA 4H8UA 3C2FA 4GZ7A 2V63A 3O63A 3VNIA 2VTFA 3L65A 2OSXA 4LU0A 2XSBA 4PMJA 3VD4A 3P80A 4J2PA 3T0TA 1VBGA 4XKYA 2O9TA 3MT1A 3L5OA 3GX9A 4X9YA 3IJDA 4LCQA 4C5ZA 1GW1A 3UJRA 2C7FA 3URAA 3ITXA 2VVSA 4RXGA 2D0GA 3TP4A 4MB5A 4QR6A 1K3UA 4L65A 5CAKA 4GJIA 1P0KA 2F7FA 2PEVA 2REQB 3T8LA 2ZICA 4TUFA 1GVEA 1H1ZA 1EUNA 3AHVA 2NVDA 1SMDA 1GJUA 4C6FA 3M0JA 2FTPA 3S5ZA 1CENA 4LY8A 5DCBA 4FALA 4UTUA 3EX6A 3HOJA 2BOGX 2CIPA 2YCIX 4ZQMA 4GOAA 3ZR6A 2HEJA 1YDVA 4OUIA 1W0MA 1MW1A 4ZVJA 3REQB 4NILA 4HOWA 3HG5A 1BVZA 3I65A 4KWOA 1XF0A 3F5JA 2B4GA 1YNQA 1R87A 2CZ5A 4HU4A 2TAAA 3GD3A 3FSUA 2O9OA 1F07A 3VGFA 4B90A 1ODZA 4H9YA 1B3VA 2QUVA 3L5MA 3L67A 3CGDA 3M41A 1DIKA 4XQ6A 3SFKA 2R1LA 2ZXAA 1HT6A 4K38A 3RCNA 1KC7A 3IWPA 1WUFA 3E0WA 3IJ7A 4E2DA 4GUFA 4S3KA 4ZB2A 4YS1A 2D2GA 1PZ2A 3C56A 8XIMA 3B9EA 4MJZA 3FEMA 5K4XA 1WKDA 4P2VA 1LRQA 1TWDA 1M68A 5FCZA 1XGDA 1TMQA 2YPIA 3UPWA 4LUIA 3ZVHA 4QDMA 4LF1A 4D6FA 2G3JA 3CZEA 4CQDA 1IIHA 4TXEA 4Q6XA 2BX7A 4A2SA 2EPLX 5D03A 1CWYA 2WMIA 4US5D 3AMGA 1RZMA 1UD5A 1EX1A 3W72A 1PZ3A 1TPH1 1AD4A 2Z1XA 4LS2A 3SBFA 4UNIA 3OQEA 1SFSA 4FK9A 1W5QA 1KTCA 4QAWA 2E25A 2OZ3A 3UW6A 4UQ9A 3T08A 5FSDC 1JNDA 3WY1A 2VEKA 1V8EA 5EY5A 3AIRA 1SJDA 1TV7A 1TR1A 5DMYA 4QBXA 4QAIA 3TLLA 3BC9A 4XSMA 4LVFA 3BLDA 2GSHA 4AW7A 3L21A 5EFDA 3PUOA 1CNVA 4K7ZA 3QSRA 1UOZA 3AHZA 3GE7A 2PZ0A 2FVLA 4ZQRA 2G3MA 2X8RA 3SN4A 1G67A 2VOMA 5A6SA 4NJIA 1Q8JA 1JF5A 3BMWA 4MWAA 5XINA 3H4KA 2GQAA 3QYSA 2JIEA 3WQOA 5JXQA 5A3HA 2GJLA 1A0DA 4DZ5A 3ZM8A 4O8AA 3LB0A 2Q8LA 4JIIX 4GIEA 2I1OA 2D2JA 3GKAA 4X63A 3QN3A 1GG0A 2PDBA 4C60A 3U5UA 3S9IA 3S9ZA 1BPLB 1V02E 4MLRA 4M51A 3KP1A 4RZ6A 3HQOA 3F7JA 1OGSA 3ZLHA 2Z7GA 4AF0B 1Q2RA 1U22A 4WKAA 4EOUA 3CLMA 5I7GA 3LBMA 4H4WA 3KOFA 3WBYA 3R58A 3D0CA 4FO4A 2QCDB 4LAKA 1VFLA 1A5LC 4LOCA 2A3CA 4IPPA 3R8GA 4LW7A 2J66A 1EEXA 4NZJA 2R14A 1NDAA 2J8FA 3N14A 4I6KA 1TTJA 5H91A 3MKVA 1Z48A 4X61A 3ABSA 3WQEA 1PTAA 1GORA 1HVQA 1M03A 4J57A 4UZSA 3UR7A 3W25A 3RPDA 4W8LA 2D3LA 1ZAIA 1XFBA 3GXPA 2Z7KA 2KAUC 6PTDA 4O57A 2VX5A 3F5KA 3E12A 4IOTA 4DO5A 2YW3A 1HP4A 1A0CA 4GFIA 1IV8A 4F0LA 1D9EA 1VB9A 5LZLA 2FPYA 2CHOA 4YLWA 1ZMDA 4OZOA 7A3HA 2RDWA 2AAMA 2IMRA 3WLRA 3UXAA 2D22A 1KXTA 4LNCA 3VKKA 3PJTA 1FWWA 1EC8A 1ZJH