4DYEA

Crystal structure of an enolase (putative sugar isomerase, target efi-502095) from streptomyces coelicolor, no mg, ordered loop
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
376
structure length
376
Chain Sequence
MMKITDVDVWVVNLPLVNPFTSSFETKTGETRTVVRVRTDSGVEGWGETMWGAPVAAIVRRMAPDLIGTSPFALEAFHRKQHMVPFFYGYLGYAAIAAVDVACWDAMGKATGQSVTDLLGGAVRDEVPITALITRADAPGATPADLPKAMAEHAVRVVEEGGFDAVKLKGTTDCAGDVAILRAVREALPGVNLRVDPNAAWSVPDSVRAGIALEELDLEYLEDPCVGIEGMAQVKAKVRIPLCTNMCVVRFEDFAPAMRLNAVDVIHGDVYKWGGIAATKALAAHCETFGLGMNLHSGGELGIATAAHLAVVSSTPVLSRAIDSMYYLHADDIIEPLHLENGRLRVPSGPGLGVSVDEDKLRHYAGVNERDGDLTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords isomerase
publication title Crystal structure of an enolase (putative sugar isomerase, target efi-502095) from streptomyces coelicolor, no mg, ordered loop
rcsb
source organism Streptomyces coelicolor
total genus 134
structure length 376
sequence length 376
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4dyeA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4dyeA01
3N4EA 3N6HA 3Q4DA 3H70A 3HPFA 3DIPA 3IJQA 3DFHA 3H7VA 4Z1YA 1KD0A 3ZLGA 5FJOA 1TZZA 3IJLA 2PA6A 3R0KA 4J3ZA 4E6MA 2PGEA 3SSZA 3OZMA 3DG7A 3UJEA 3T6CA 2DW7A 1PDZA 3SN0A 7ENLA 4IHCA 3RRAA 1OEPA 3DG3A 3OW1A 4GFIA 2POZA 4IZGA 3NZGA 1R0MA 2OO6A 3ZLFA 2HXTA 2XH7A 5FJUA 1PDYA 2QJJA 2ZADA 4MMWA 3GY1A 1EC7A 1NELA 2GGHA 3CB3A 3CAWA 3RITA 1EBGA 4K8GA 2PTXA 3V5CA 3OP2A 3MKCA 4GISA 2GGIA 2XH2A 4ENLA 5FJPA 1ELSA 1SJCA 2OVLA 3DG6A 3U9IA 3R11A 1P43A 2PTZA 1KKOA 5BOEA 4IP4A 3PK7A 3P0WA 5J04A 2PU0A 4HCLA 3EKGA 3OPSA 1TE6A 2GSHA 4A35A 2PMQA 4HCHA 3FV9A 1ONEA 3VFCA 3R1ZA 2RDXA 4DXKA 3IJIA 1MRAA 1JCTA 2XH4A 4IL2A 1KCZA 3FXGA 3SN1A 2XGZA 3TOYA 2QJNA 4FP1A 3TTEA 2QQ6A 4FI4A 2P8CA 3V4BA 1BQGA 4GYPC 3RO6A 3ES8A 3ES7A 3CT2A 4A6GA 2QDDA 3RR1A 4JHMA 4ROPA 1RVKA 1YEYA 2FYMA 4E5TA 1DTNA 2P0IA 4HN8A 4DN1A 1EBHA 2HXUA 3VA8A 2PCEA 2MUCA 4KWSA 3FCPA 2PU1A 4A3RA 5IDZA 4ZCWA 3R10A 3MSYA 4KPLA 3MQTA 3TJ4A 3KUMA 2OG9A 3QKEA 4MKSA 3I4KA 1JPDX 3MZNA 1FHUA 3PWGA 3GC2A 3UGVA 4H1ZA 2GL5A 1JDFA 3JZUA 2OZ8A 3U4FA 2CHRA 5ENLA 2PTWA 3FYYA 5FJRA 2PP1A 1MUCA 2GDQA 3N6JA 3T8QA 4M0XA 4Z17A 3H8AA 3T9PA 3PFRA 2P88A 4KT2A 5FJTA 2OQYA 2PSNA 3ZLHA 4H19A 3QN3A 2QGYA 3NXLA 3JVAA 2PP0A 1F9CA 4MGGA 4IP5A 4DWDA 3B97A 3OZYA 2AL2B 2ZC8A 3CYJA 3I6EA 6ENLA 3OTRA 2I5QA 4H83A 4ZA0A 2AKMA 2OPJA 3FVDA 5EU9A 2XSXA 1W6TA 2PTYA 1MNSA 3IK4A 3P93A 3S5SA 1JPMA 2GGEA 3UXLA 3UJRA 3P3BA 2OZ3A 4X2PA 3QTPA 3TW9A 3R25A 3FJ4A 3UJSA 4HYRA 2NQLA 4H2HA 3SQSA 3ENLA 2QVHA 3TCSA 3UCCA 2PGWA 1MDLA 3R0UA 3K1GA 3V5FA 3ZVHB 1IYXA 4HNCA 2PS2A 3SJNA 2AKZA 4GYPA 3DEQA 2OLAA 3NO1A 3VC5A 1EC9A 2PPGA 2PP3A 4K2SA 1SJBA 4E8GA 1TKKA 3UJFA 1SJAA 2OKTA 2O56A 1FHVA 3T4WA 3MY9A 3V3WA 3DFYA 1L8PA 3GD6A 2QJMA 3QPEA 3DERA 3VDGA 4GGHA 4YWSA 3CXOA 4DYEA 2HZGA 2OX4A 3BJSA 1XS2A 4G8TA 4GMEA 1SJDA 2AL2A 3MUCA 1E9IA 1R6WA 4J1OA 1EC8A 3GO2A 3PWIA 3SN4A 4DX3A 4E4UA 4K1WA 3THUA 3CK5A 3NFUA 4IL0A 1P48A 3RGTA 2GGJA 3S47A 3H12A 2DW6A 2P3ZA 3N4FA 1XPYA 3D46A 3STPA 3I6TA 3RCYA 3DESA 3QLDA 2FKPA 5BOFA 1WUFA 2QDEA 4HNLA 4JN7A 3BSMA 3TJIA 4GIRA 3TWBA 4DHGA 1NU5A 2MNRA 2OFJA 2AL1A 4F4RA 2HNEA 3JW7A 2OQHA 2GGGA 3VCNA 1ECQA 2PODA 1BKHA 3Q45A 3DDMA 3TWAA 4EWJA 3EEZA 4M6UA 3SBFA 3TQPA 3VC6A 3ZVHA 2OZTA 4G7FA 3VCCA 1MDRA 3UXKA 2ONEA 1WUEA 3UCDA 2P8BA 4HPNA 3MWCA 4HCDA 3ZVIA 2XH0A 1KKRA 3D47A 4IT1A 4KEMA 4E4FA 3BOXA 4GGBA 4JN8A 3DGBA 3UJ2A
chains in the Genus database with same CATH superfamily
4DWSC 4FHAA 1VC4A 2Y7DA 3CZKA 1A5MC 2VTFA 3VO0A 4BY3A 2E8YA 5K4ZA 3QC3A 3RF9A 5I07A 1G4PA 3BAJA 1E5JA 3VMOA 3GKAA 1IE7C 3QOKA 3EWCA 4DYJA 2XJ7A 2BP1A 5D02A 4D8ZA 3STCA 1ADDA 2B4GA 1QR7A 3VIJA 3KLLA 4QAWA 3EB3A 1GJPA 1E6PA 1H7RA 3W81A 4UTTA 1EB3A 3BC9A 4PUKA 3D9XA 1HJQA 2W6RA 3CTTA 3CHDA 5LIXX 2W92A 4Q33A 2WLYA 1FWCC 3A4AA 4HYVA 3CEUA 3AXKA 2ON3A 1DJQA 1OADA 1TPWA 3U48A 1UR0A 4XZNX 1AQFA 4Z1AA 5HJYA 1GKPA 2GGHA 3L0GA 1EBGA 2FGBA 3HO8A 3L4WA 3OP2A 1PTDA 1OABA 3ONBA 4GISA 4HMNA 2E5DA 4JZ5A 2EHHA 2RABA 2G3FA 5C9ZA 1OJTA 2PDQA 2IQTA 4MB3A 4MJZA 2PRMA 3WH8A 2D23A 3UYCA 1S2UA 1A5NC 1Z69A 2A6NA 4MJ4A 1F73A 1BSLA 3GC4A 1Y7VA 4M51A 1UYQA 2F7FA 3AMKA 5A95A 4CEXC 3BXWA 2GOUA 5F2IA 1XPGA 4ZO9A 2UWFA 3W86A 4N9BA 4RE2A 4DQWA 4B5XA 4GUFA 2RGLA 5CPSA 2XIJA 1HJXA 4P8VA 2ZUWA 3QBUA 1H50A 4MPKA 2EXOA 4M7SA 3RPDA 4KCWA 5AYIA 3C2VA 4D9PA 1ITCA 5HR6A 3PB0A 4FX9A 1FDJA 1V0KA 1LLOA 4JQ1A 3VOIA 1R9YA 5KZMA 1L0PA 1VCGA 2XFRA 5D4YA 3NSXA 2E67A 1O95A 4IM4A 4JKKA 2J47A 4E0CA 3G18A 3DENA 5DMLA 4NASA 1XYFA 2BVTA 3QSTA 2VEPA 4L61A 1FWHC 4ATLA 2QIWA 4Y9AA 3W1PA 1SO4A 1JPDX 1NHPA 3WL1A 5EMMA 2A3BA 3LPGA 3G0SA 2GL5A 2QIIA 2OZ8A 2CHRA 1XF0A 2YXXA 2E6FA 4K37A 5E5CA 1QVBA 1AW2A 1UWSA 4Z17A 1WXYA 3F4CA 5FIPA 5U25A 3A47A 5HULA 1DIKA 3CV7A 2AQWA 4IJRA 1JPHA 3KBWA 4NZFA 2W0HA 3KCOA 1J0YA 1QJWA 4JDRA 2E7FA 1OFOA 1ZSXA 5EA9A 4Z2JA 4R27A 3MUXA 2EO7A 1OYAA 5DCBA 1HP5A 2WSQA 4H4VA 2VFEA 5CPTA 5E9AA 1F9CA 1YBQA 2A3EA 2ESCA 3WO8A 1QNPA 1OJXA 1KRMA 1IGSA 1F8IA 1JCJA 1TWWA 2J77A 4L4PA 4TVDA 4FOJA 1HP4A 4MLJA 1ZQ5A 1QK0A 4AXKA 2YOCA 4L7ZA 3VKAA 1XR2A 4PL1A 3CGTA 3PZ9A 1HJWA 3EOUA 2XSXA 1JZ6A 3UXIA 4WKAA 1K70A 3CMGA 3IK4A 4HU8A 1KGXA 4PBFA 1S39A 1W3HA 3W1XA 1DJXA 1F05A 2V2CA 3EPOA 1VYSX 2NX3A 3G6MA 2W27A 3W7CA 4IJCA 4DPQA 4ZEPA 1ZFJA 2Y0FA 4DRSA 3PWAA 4H6QA 4MZYA 4UFHA 2R1LA 4ZQNA 1TCMA 4GYPA 2C19A 3UD6A 4L1GA 3NO1A 1GCYA 2NW0A 4MB1A 1MZHA 1OCNA 3SI9A 2WLZA 3G24A 3KLKA 4EXAA 1MO9A 1I45A 4F9DA 2DPEA 4YCOA 2PF8A 4R9OA 3WQVA 4ZE5A 3I68A 3NIYA 3O6YX 4TOQA 2D3NA 2INFA 1JCLA 2IXVA 1S2WA 1QT1A 1W37A 3LNPA 3SY8A 8TIMA 4QLKA 1FWEC 5F2MA 5F4SA 4XVDA 1CYGA 4KIRA 3IGXA 2C0AA 4GABA 2WV8A 3TKFA 4E4UA 2HDJA 3W38A 3COTA 4GQRA 1AQHA 1TYTA 4JTJA 1JNEA 2DW6A 1AJ2A 1ISZA 1NWRA 3QLDA 1WUFA 1EZWA 1CLVA 3QY8A 4MNLA 1GVFA 4DUWA 4OIFA 3GU1A 4GJ1A 4X63A 5GJPA 2G37A 1U5VA 3T08A 3CH9A 1AD4A 1FWJC 5JCLA 2HCVA 4CQBA 2IKGA 1XD1A 1OC6A 3LYEA 9XIAA 3Q45A 1GPFA 1IWBA 2EQ6A 3NQ2A 4Y9MA 3GU9A 3CPUA 3SBFA 3DJJA 4B5NA 2NZLA 3EX6A 1WNOA 2ONEA 4H4RA 4CQCA 5CJMA 3V5OA 1FUYA 2J74A 3GRSA 4W7WA 2VL4A 2XVPA 1XIMA 1ALDA 3PG6A 4N9DA 3V0TA 1V3IA 4WY0F 1P6CA 3W84A 4ZL1A 3WX7A 1Q45A 1GJUA 2QJHA 2D2HA 2OEJA 1XYLA 3VIFA 3T2OA 3T09A 2WNZA 3DFHA 4XK2A 4Z1YA 3QFAA 3OVQA 1UD4A 1KD0A 1GHSA 1V59A 1AW1A 3P5ZA 3TN4A 5HOSA 1VJIA 2WVTA 4IJBA 2TODA 1I8JA 3LNMA 3R0KA 1FKWA 4PE8A 4J2PA 1WDQA 1QHZA 2H3DA 1MW3A 3VOHA 2HMCA 3TTOA 1KRAC 2C16A 3WBYA 2AMGA 4DI8A 2FPYA 3PZUA 5FJIA 3LBOA 4NNAA 3WYZA 7ENLA 5T9CE 3UW6A 1OEPA 3RM9A 3S2LA 1V79A 3LS9A 4CN1A 1E56A 1JRBA 1XBYA 4BFAA 2ZA3A 1M7JA 2CNCA 4K7VA 2JF7A 1NSJA 4N4PA 2V2HA 2W61A 2E4TA 5HPOA 3R58A 4MB4A 3CLWA 4LW7A 1ADOA 4ML4A 3R07C 4UMBA 2QKFA 4PCPA 2QGHA 1GVIA 1WZKA 4LU0A 3WJWA 3PZIA 4LAOA 5DBUA 1TTQA 3MUZ1 2DORA 4I3GA 3BZJA 2VX5A 4BQ5A 1MQRA 3C0JA 2I14A 2XIIA 1AK5A 3PK7A 2PDGA 2R1MA 4E3TA 2DZBA 4LB3A 5CQ1A 2INZA 2V3AA 1JYXA 4G7EA 2BDQA 4HA4A 3QR0A 4IUOA 4PULA 2GSHA 4YCPA 3TFCA 1B90A 3SM0A 1K9TA 3KL0A 1T96A 2DH3A 3MV01 1MRAA 1JCTA 3LRMA 2W4XA 3S1GA 3L7RA 3QQ1A 2V6AA 4PA8A 3VK5A 4F40A 4QFUA 3GXNA 2CFYA 4CNOA 4KKXA 4O4WA 3PN8A 3SUSA 1ZB5A 2FMNA 2PDHA 4IIHA 1QI4A 2JBMA 1W1IE 1YBQB 5G4HC 1ZHAA 1JL8A 2UZ9A 5F2GA 3O06A 1XIJA 3U2CA 3N19B 2WVSA 3W71A 3KDNA 4PZVA 5K3VA 4NZ1A 3WF2A 2ZA2A 3UZ5A 4TQTA 2GJXA 3AUJA 2C79A 3GHUA 3LCIA 5C71A 3A3HA 1V6UA 1RJPA 1K8ZA 3M5XA 3UWUA 4C5YA 2OGYA 3E0VA 4BKNA 2PTDA 1LOLA 3B3DA 4M52A 3LTPA 4W8LA 4X0NA 1IR1A 1ISWA 3MZNA 3W7JA 1S5VA 1I75A 4PUWA 2KZHA 1XFCA 5TNVA 1IV8A 3IARA 2BC0A 1SO3A 3UQNA 3FHAA 2X0SA 4MWAD 2PWUA 2W0UA 2X41A 3GRIA 4ZQCA 3QH2A 1NP0A 4J5NA 4YHGA 4R53A 1K02A 3H8AA 3SAZA 4UQDA 2ZIDA 2HRWA 4FR6A 4EMWA 3NYZA 3OB8A 1CBGA 5DANA 2VRKA 2BY0A 2WSKA 1JF6A 1Z3NA 2OQYA 1IIGA 5GPRA 4EAYA 4K3ZA 3IUDA 1ITQA 4A05A 5C7HA 1FQ0A 5IOBA 1KBBA 2V9DA 1MO0A 1GEHA 3O1NA 1Q6CA 1GVSA 4JTQA 1FWDC 1KBIA 5D8ZA 4APNA 2DSKA 1GRGA 3IEBA 1TQXA 4PMQA 4GX8A 1EYWA 3S2JA 1JRPA 4LCQA 2PDFA 2ATSA 3SUUA 2E9BA 4PB3A 1B9BA 1XCXA 3A3XA 2OPJA 5AY7A 1Z41A 3HIJA 2ISDA 4AAJA 3UXLA 1V3HA 1VAHA 1H09A 3F5JA 3WKZA 1LT7A 2G4JA 2ZX8A 3H26A 3M0IA 4YTQA 4B16A 5JBDA 1MYRA 4GI4A 3GBEA 1S5TA 3SQSA 4O15A 3W85A 3UCCA 4MZ8A 1OHLA 1ZJHA 3H2EA 4DJFA 4H9ZA 1HW6A 4JQAA 1R46A 3CL8A 4OV4A 2ZE0A 1LL7A 1ITUA 5E09A 3ZFHA 3HTWA 2PAJA 5D32A 3ZT6A 4QDWA 4XBSA 3EOEA 3W7KA 3NO5A 4IQEA 4QEHA 1DIEA 4H6EA 3FJNA 5FCZA 3PZMA 1KM5A 4S3GA 3T44A 3M0HA 2GFTA 3NVYB 3FK4A 3VDGA 1EWDA 3R94A 4HVXA 4JEJA 3N2MA 4PRWA 4WXYA 3LEPA 4PFMA 1V51A 3CO4A 3WDHA 2WP5A 1J6PA 1TWZA 2F61A 4EE9A 4O13A 3CK5A 5CG7A 5DY2A 3TCEA 1UR8A 2HSAA 3ANVA 3DHDA 2VFDA 1E70M 4ORMA 5D38A 4YPJA 1GQKA 3TYCA 3E0FA 3WF4A 3M0LA 4GI8A 2INEA 5JCMA 4M3PA 1O68A 2ALDA 3VM5A 2Z28A 2PC8A 3AUOA 4HU4A 3PUEA 3NL5A 4Q6JA 1GESA 2FTWA 5D2WA 3BW2A 4DO6A 1YW1A 1TX0A 1DORA 1Y5VA 1KQZA 4LUSA 3AMZA 4WXZA 2Y5SA 3NQAA 1J01A 2JKEA 2XN2A 3W2UA 4H7CA 4CNSA 2BLEA 1T99A 2NVCA 3NZQA 1X2GA 3M6DA 3VD7A 1W3KA 2W63A 5CBBA 3AMLA 3O16A 1ZU8A 2G3IA 2WSPA 4UZUA 4QG6A 4G7EB 1XLMA 2GR0A 4IQJA 4RNIA 2YL6A 2F6KA 1R3QA 2VYOA 3TVAA 3L4UA 1P0DA 2E40A 3H2OA 3YPIA 2WZMA 1SM9A 1TREA 3T0BA 3TYEA 3SCVA 2J3NA 2QXWA 3I65A 2WVUA 2P1FA 2CLEA 1XX1A 3GG0A 1GZ1A 4DJFD 3TTYA 3UJEA 1GV4A 4S3JA 5BROA 1UA3A 3AIVA 2Q01A 1E43A 3R8GA 1BKSA 5I3JA 1YRRA 2Y1HA 2XISA 4A8RA 1LRQA 4Q8NA 1DXIA 4K6AA 1B2YA 3TTQA 2Z2UA 3MDUA 2V5LA 3C5QA 2ISFA 2DT1A 1H61A 1OGBA 2XTKA 3VVGA 3LDVA 2Z1BA 3LY0A 5AECA 2DVTA 1Q65A 4U31A 1B57A 2RJGA 7ODCA 4ENLA 4Y9NA 4ZO8A 3ONCA 5DT7A 1U33A 3A7RA 1SJCA 3B9JB 1KNWA 1JDDA 1V6XA 2IKHA 2V6OA 1KKOA 4IP4A 3UWVA 4HKPA 4HMEA 3LG3A 3AWNA 1TSIA 3BSHA 1QHOA 4MWAE 3ZT5A 1OT2A 2YXGA 2C3ZA 3W7IA 2CBJA 2F6XA 4H6KA 1V7AA 1JZ3A 1R3VA 1VH7A 2YB1A 3FXYA 2Z4GA 3PJWA 3GFYA 4PUMA 3P82A 4LUIA 3IJIA 1E3ZA 4UC5A 3SCNA 1E6ZA 3ITCA 2WCAA 2QDGA 4X2RA 2P8CA 3MHFA 2DZVA 1CB7B 4TX6A 1XWYA 2X1TA 2E8ZA 3FW6A 2R82A 3R5EA 4GH1A 2F2KA 2PDBA 4MKNA 3RHGA 3RR1A 5F1UA 1EXBA 3IPWA 1XLCA 1MQQA 2DIKA 3BMXA 2WSRA 4M6PA 1HXJA 3GD4A 4DN1A 4H04A 3UZWA 4Z2HA 1CXKA 3VZYA 2PDMA 5LIYX 3T78A 4UCFA 3AHVA 4HQVA 1Z9AA 1S38A 3VIPA 1RCOB 3B40A 1M53A 5FACA 4ONVA 1VFSA 3ZXWA 1M7PA 1EA0A 4IOTA 3UGVA 3FN9A 4DAFA 1JDFA 4KBXA 1ISVA 3RXZA 3CAKA 2C3DA 1EJXC 4OWGA 3VOGA 1JQVA 2XYLA 4F0KA 1SMDA 2D0GA 4AU0A 3EAOA 1M7OA 1VBGA 2J8TA 4W4QA 1BXBA 1JUKA 3GWQA 5A6MA 5EKYA 1AQ0A 3EX1A 3UVIA 3KLJA 3QC0A 2G4FA 2DQWA 4N0RA 4JNMA 3U7BA 3L5OA 4FX6M 4UIOA 1V4YA 3LCWA 3V0SA 3AIQA 2QGYA 2J7DA 3R8RA 1AH0A 5G5IA 5I2UA 2C71A 4H9YA 1R9ZA 3NQCA 1EO7A 1XD0A 3F4NA 5DY3A 4UTUA 3SRFA 3J7HA 4H83A 1K77A 3W37A 2ZWYA 2Y88A 3NEHA 4JNZA 1CXLA 5C2GA 2O9TA 2R8WA 2Z1SA 1W6TA 2XZ9A 3P93A 2VEMA 4OQVA 2CU0A 5BNKA 3E0IA 3MYPA 2WP6A 2KAUC 3VNIA 2NXHA 3LB8A 3C6CA 1WA3A 5CPLA 3IACA 4CD6A 4H2HA 1IT0A 1FECA 4AHPA 3TDFA 3OVRA 4YN5A 4LUSB 1A5UA 3SFKA 2PE4A 1Q1RA 1TA3A 4EXBA 1EWEA 3WQGA 1KLZA 1H0GA 1V3JA 5LA2A 2VGGA 4K2SA 3AYVA 4IMGA 1GONA 3WJYA 1X97A 5BMWA 2XM1A 5BYWA 2GYIA 3UPWA 4BI7A 3B9NA 1MI3A 4GHRA 3U2ZA 4A4AA 3LHWA 2OKTA 4LPCA 3T0TA 4DPPA 3QZAA 2W67A 5HNRA 2REQA 2A21A 3ALGA 2Q8XA 4PCFA 1E40A 3SSJA 4DUVA 4JCLA 1IXOA 2YZRA 2ZZ7A 1M5WA 5C9RA 1RCXB 4DZAA 5KZ6A 5E0KA 4ZXLA 2Z6IA 2ZZ4A 3PBMA 5IBXA 1YE6A 1CI1A 4O17A 4S2CA 1G4SA 5M1TA 3NJ3A 5E93A 1POJA 3VIOA 4OBSA 4AYSA 3NFUA 1NFPA 1RR2A 3RGTA 3NVDA 3PZOA 3O15A 2C0HA 2VZOA 3DBPA 3BK0A 5TR3A 1US3A 1ZBCA 2VEIA 3DESA 3RM4A 4PUNA 3WMSA 1FWFC 1FOBA 4M29A 1HGYA 3TJIA 3PNZA 1VFHA 3VGDA 3WLQA 1YX1A 4FNSA 3UFYA 1GOQA 3USBA 3RX3A 1OVDA 4F3HA 5G1YA 3DDMA 3W07A 1W54A 1TVNA 5F4XA 2V63A 5BXTA 3W7OA 1WUEA 3N9RA 4UFLA 2IXUA 4I6VA 2VMFA 4A29A 2C1IA 5IDIA 1G94A 3IV8A 3V16A 3BOXA 3L5AA 2PC4A 3WUFA 2DH2A 1BWLA 3N4EA 4BCEA 4B2DD 2Z7KA 3VPLA 4DEFA 1OX5A 2OLSA 5FSDC 3G5EA 3RU6A 1SZRA 1KTCA 4OFCA 1LQ2A 1RA5A 1N5WC 2EG6A 3C8NA 5LA1A 4WX2A 1JFXA 4DZ5A 2QCGA 1JCXA 5I03A 2ZYFA 2Y24A 1TTPA 1W17A 3BMVA 3MZ2A 3EF6A 1RP9A 2Y6ZA 3IIZA 1GQNA 1PE1A 3NL6A 3UT0A 2Z2AA 2XVLA 3T05A 1QOQA 2Q02A 4B9YA 4NKCA 3SGUA 3HA1A 3S5ZA 3TSDA 3N2XA 2BOEX 3LENA 4O1DA 1E9LA 3U0HA 3KVMA 3LCGA 4YVPA 1IHIA 3CYVA 3M7WA 1QOXA 3E12A 2XM2A 3GRTA 3BURA 2VWSA 2WC7A 4DO4A 1YXCA 4XBKA 4UNIA 2CLMA 4WIWA 2GUYA 2HISA 2VQUA 3WL0A 1VHNA 3CQKA 4FNRA 3BG5A 2OVLA 3U9IA 2BXYA 5ER0A 5EB8A 2QEZA 2I1OA 1EL3A 3UEQA 4H8UA 5J04A 3GYCA 4FIRA 1QASA 2GRTA 5LKYA 1DIDA 4LBSA 4X61A 5AHEA 1IEWA 1TE6A 4MF4A 5DCDA 3KCLA 2CFFA 2PGRA 1PS9A 3AXIA 3LPPA 2GK1A 4A35A 5K7JA 4Q8UA 4J3WA 3R1ZA 1FP9A 3P14A 1J0KA 2OCZA 3MT1A 4NF7A 5CXPA 1AH4A 3WEMA 3QFBA 3E2QA 1H3GA 1RH9A 3QYSA 1F6KA 4ZO7A 3EXRA 2DSUA 3VGGA 3T1GA 4P7LA 3V4BA 4B5SA 1UUQA 4MDPA 4J9JA 4LT9A 1LDCA 1GW9A 1JGIA 2JF6A 2BSLA 4PBEA 2YA2A 4EIVA 1CXFA 2ZKMX 4NZJA 1BTCA 4UTJA 3NR0A 3TN5A 1L6GA 3Q6JA 1Z89A 4QISA 4PMRA 3AXXA 4JX6A 1KR0A 2GWNA 1DL3A 4RKAA 3VA8A 1XLBA 2BY2A 4TX8A 1C8QA 3B8UA 3W01A 4AW7A 3CZ8A 1NF7A 4Q4PA 1O5KA 1A3HA 2HBVA 2XFYA 4KPLA 3FAWA 1K6WA 3W6LA 1KM6A 2CC0A 1HUVA 2P0OA 1OZQA 2VNCA 4LRSA 3S1VA 5FS7A 2QF7A 1KFCA 3MO7A 4NAFA 3URAA 3LI1A 3LU2A 2WMFA 4BHYA 1SO5A 4H2CA 1BYBA 3ARTA 1DWGM 3LZ5A 4CU8A 2TYSA 1CXEA 3L0NA 1R86A 4MFEA 1V6VA 2GDQA 4FR1A 3U57A 2FPVA 1J8VA 3EWBX 1TA3B 3ITYA 3WELA 1EPVA 4JDBA 4PL2A 3QHMA 3KBJA 5LSMA 5C6MA 1FFVC 5C8BB 1N8IA 5CLWA 2F9RA 2ZC1A 3UU0A 3DI1A 4PCSA 1KFLA 4FALA 4H8NA 1PHWA 2REQB 3WH6A 3DHFA 3NDOA 4XO6A 2DEPA 4HHPA 4JS3A 1UJQA 3ARSA 4NUWA 1BZLA 2NX9A 3O2LA 5H8UA 2NWSA 4XZBA 4W89A 5G2WA 2O55A 2XFWA 1DJGA 5GNXA 3EKLA 1H7NA 1DJZA 3WLKX 5EFFA 2BWGA 1I2PA 4JTAA 4EF8A 1MNSA 5D9OA 3M0JA 1F4HA 4RDVA 4MVAA 3MVIA 2HNHA 1LG2A 1OM0A 7PTDA 3KVKA 3B03A 4AHOA 3QTPA 5I0DA 3V7PA 1TFVA 3LBCA 2Y8VA 2F2HA 1Q6EA 1K9FA 5GJNA 2BG5A 1OD0A 2PZ0A 3VGEA 2CIPA 2QCDA 3EOSA 3TQKA 5DT5A 3T2QA 4I7UA 3VC5A 3R0DA 4WJEA 1GUVA 2CLKA 1EEPA 1LWIA 1OCQA 1BXNA 2Q71A 4AIEA 3KBVA 4NJIA 2B7OA 3OJGA 1AFSA 3NNTA 2VX6A 4IFOA 2Z1VA 1DTUA 2HZGA 4ZB0A 1F5ZA 5AHMA 1ZNNA 1SFSA 4YS1A 4P8WA 2VZSA 1NEYA 1MFVA 3OG3A 2XVNA 3AFBA 4XD4A 3MI3A 4DNMA 5C54A 3EB4A 3S47A 1J5TA 1CDGA 1KGWA 3C56A 3STPA 3RCYA 4YXGA 3N3MA 5U7SA 2PDPA 5A2BA 7XIMA 3LSBA 4YIWA 4M1BA 4JTCA 1UROA 4A2RA 2IS7A 4FEZA 4G9PA 2CXEA 2MNRA 3WD4A 2AL1A 1KA9F 1PKMA 4MJMA 3AZTA 1GERA 2YX0A 3KDOA 3EA2A 4WSJA 4GFSA 1RLDA 1PIIA 1M04A 4RV8A 2WCGA 4IPPA 5FS6A 3VIHA 4FIQA 2BASA 5HJXA 6XIAA 3MMTA 1JZ4A 1IZKA 4QLJA 3PBYA 4LYKA 4A21A 3A7UA 1OG6A 1KKRA 3PTDA 3D47A 4OU1A 4GYJA 4C1NA 3CAVA 4LUTA 2BY1A 3GTIA 2BY3A 5K9CA 1BWVA 3HPZA 1HJVA 1PO9A 2WNQA 3N6HA 2VEGA 3Q4DA 1QNQA 3B9EA 2CDUA 4LTSA 1LUCA 3ITLA 4XSMA 1SSDA 5D9PA 3QKZA 2VM8A 2GK1B 3LN3A 2YDQA 3NQ6A 3II1A 2FQIA 4REQA 3T7VA 2OYMA 1NARA 2BOFX 1PVNA 1XC4A 1JCNA 1MMFA 4Y6GA 2OSYA 3BW3A 2PA6A 4TVWA 1FWWA 1H1ZA 4RE0A 2PBGA 2X2GA 2R91A 5HBFA 2AAMA 2QPSA 3LHVA 4E8CA 2BV9A 9RUBA 1Y5WA 1Y8BA 3VKCA 4Q7BA 2EG7A 3G8EA 1WZLA 4JTUA 1UB3A 3I7SA 4KPRA 2VRJA 2YXOA 4ZODA 3GTNA 3R13A 4V28A 2ZX5A 2HXTA 5CEWA 1LPFA 1PCKA 5A6JA 2XPKA 1EBDA 3T81A 4W5UA 3VIMA 2NQZA 3HGOA 4LBRA 4QX4A 3SUVA 4E2DA 2AGTA 1UR1A 5CSSA 3UWQA 1G01A 1TWSA 3H53A 5I3DA 4GOAA 3V18A 1V03A 3DZ1A 2GVJA 2UV8G 3BARA 2WBGA 5AC5A 4LIIA 2ZTJA 4NAFB 3GG7A 3KP0A 4FS9A 2Z6JA 2VENA 3P0XA 3PZTA 2J62A 3EX2A 2YCJA 3SGGA 3O6DA 4FF5A 2EQ9A 1ONWA 4QS6A 3LHUA 1BD0A 1MSSA 3IUHA 3S5NA 1RM6B 2NT1A 4TTUA 4DXKA 1P0BA 1Q8AA 3E6EA 3C0QA 1QAPA 3O05A 3FA5A 3ZZ1A 4GYPC 2WQDA 2YBUA 2H8ZA 4Q4OA 1VYPX 4DUOA 2PZNA 3W23A 4YTRA 3WK0A 1OC7A 3FAXA 2P0IA 2ZXAA 1D3HA 4JR5A 1R2TA 2VXNA 3DFQA 4EMJA 3WLTA 3KRBA 1JYVA 2TPSA 4WGHA 2A5HA 3Q94A 4F66A 4JTLA 2XWEA 4PUDA 2XU2A 2ZZBA 4IMEA 2E9LA 6XIMA 2MUCA 1FH9A 3GNOA 1V08A 3MSYA 3W1QA 1KXVA 5CJNA 4MUPA 5DMNA 3V1PA 2WCSA 4MKSA 4XAPA 5FF4A 4EM4A 3NGJA 3W1UA 1TTJA 4OUIA 1YXYA 3VAVA 2CW6A 3AISA 4GY0A 2XHYA 3SO7A 3CPGA 4ROQA 4UFMA 2GH5A 5FL1A 2Z24A 2FFIA 2G50A 3RK8A 3QZEA 5KZDA 1MOKA 2BCPA 4NYYA 3BLPX 3QMTA 2QCDB 2V3EA 2PP1A 3KVJA 4FXRA 3GXTA 4I6KA 2WPFA 1E71M 5AVNA 1GT8A 1C3FA 1ZJAA 1DPMA 1XIBA 2WM1A 3HRDC 4GXMA 3SR7A 3WDIA 2HE5A 4W86A 4NJHA 1R30A 2F8QA 4FAMA 4K1GA 2XN1A 4O16A 1YYAA 3E3HA 4HA0A 3NUKA 3NXLA 4QNEA 2A7NA 3N25A 4YWIA 4LA1A 4DWDA 2CLPA 3W1AA 5D2YA 1CLXA 4H8VA 1B3OA 1U1HA 2I5QA 2VFIA 1O5XA 2HK1A 2X7VA 3LGEA 5HWJA 1W5PA 3LERA 2OKOA 1E4MM 1QPQA 3IRDA 3PJTA 4PMJA 3RILA 3ITOA 1VCFA 3D6NA 2VDIA 3CMFA 4BWLA 2IMRA 3NO3A 3EDFA 3N3TA 2Q8ZA 3UJRA 4GPNA 1GKRA 3PULA 2OODA 1M7XA 4BF9A 1LBFA 2QLYA 2J25A 4IFRA 3GR8A 3F2BA 3P5YA 3IWPA 3BH4A 1QCWA 2JIEA 4LANA 3G1AA 1E6QM 3EMZA 4LWWA 4MWAC 3GHSA 4Z1DA 2E28A 4XAZA 1X98A 1H5VA 1FDYA 3HQPA 4H00A 1GRAA 2QCCA 3B9OA 3CUFA 3WQDA 3M0VA 1K7XA 3M47A 1EA9C 4C1NB 2WWDA 1XP3A 2WO5A 4LXFA 4N2YA 4XX6A 4N02A 3AO0A 3E96A 2WXDM 4N42A 1R3RA 2Z27A 2X1SA 3BL3A 1LUCB 4J57A 4WDUA 2E3TA 1ITXA 2RFGA 1E4IA 1YADA 1JROA 4PTXA 4DF2A 1XISA 4REQB 4C6FA 5D8WA 1U30A 4GI9A 1U5HA 1QPRA 1ZXIC 4JY9A 4D1JA 1Y65A 3TNBA 1H1YA 1Q6DA 3T2PA 2TSYA 4N9CA 1GYMA 1H51A 2OEMA 4X9YA 4KCVA 1NDYA 1E6NA 1DWAM 3RLHA 3K46A 1KRCC 1P7TA 4FNPA 1YLVA 1SQ7A 3S6TA 3SQPA 1D7FA 4OBRA 3FIGA 5JXQA 2V3GA 4O1AA 1D8CA 3SW6A 5IFPA 1L6SA 2PDUA 4QLLA 2O92A 3VCNA 4ZMGA 1TMHA 2Z25A 3WK1A 3OIHA 3E38A 3AI0A 3RFAA 4U2ZA 3ZVHA 3TC6A 4HNNA 4PMYA 2D0HA 1E0UA 1C92A 3PTMA 2ANUA 3UG3A 3M07A 3MUY1 2OTDA 3WSUA 1NQ6A 4J3SA 4E4FA 4I9AA 3WQWA 1R8LA 3VXGA 2DP3A 4LC6A 3LK6A 3EMCA 4TO8A 1VBUA 2XIOA 1D3CA 4NIRA 3N29A 3HFYA 3PVFA 4BS0A 3PAJA 4WJ8A 1BRLA 1TR1A 4XO7A 3ABZA 4H41A 4R33A 4WDTA 5FJOA 1UOZA 2ZWZA 4PH6A 3LXCA 4EACA 3CGEA 4AD5A 4H3DA 1LLWA 4GZEA 3DHUA 1J0IA 4LQ1A 1XANA 2QCMA 4S39A 4NQ1A 4PMXA 3SCOA 3VFLA 2PFHA 1P5BA 1WCGA 1JEHA 1KM2A 3DU0A 5F2LA 1SSGA 4AZ7A 1UQYA 1H5YA 1JZ7A 3VX0A 2W55A 3UA4A 5HR7A 4AMCA 2OO6A 2X30A 1XM3A 4XD3A 1CZ1A 2FZDA 5F4WA 4CEUC 4WD0A 3PPHA 2QJJA 2OO0A 1R2RA 3STEA 4ZFMA 2VJXA 5DMMA 5JBFA 1U2YA 3QLLA 4PR4A 2FZ8A 3TIMA 1C7TA 3BTNA 1V97A 1QATA 3T8LA 1RY8A 1M01A 4CVWA 1QRQA 1DJYA 1ELSA 5FD0A 3DG6A 3N2OA 1H6VA 4C6BA 4MSSA 1R5YA 3W02A 1XDIA 1DIOA 4KF1A 4GQGA 1CCWB 2YR1A 3I6RA 2R9ZA 1HKMA 5DXYA 4J3UA 1TWIA 2V8ZA 1VR6A 3GXDA 3MHUA 4R7WA 2P76A 3FG2P 4PFHA 4GIEA 2I5IA 4XZLX 2RDUA 4RPPA 4JCMA 3BQ5A 3FV9A 2WOWA 3PANA 3PBGA 1ONEA 3A23A 3NURA 1K03A 4ZOHB 4HSOA 4LF2A 1UH4A 1GORA 4UQBA 1U83A 3ABQA 4ZR8A 3TTEA 1DJNA 5BMXA 5BWFA 5FSEC 3KOXA 1U5JA 4AVFA 2WZIA 2VEFA 1FHDA 2C13A 4K7YA 3QSRA 3ES8A 1JNDA 1EX1A 2ZBTA 3S2CA 8XIAA 4HN8A 2Y8KA 1WP6A 4PTDA 5AC7A 3W22A 1TPB1 1JXJA 1C91A 1PZ3A 3TLQA 1G5AA 4ES4A 1HVXA 3HG4A 3KBNA 3PPGA 1IF2A 1O94A 5E9XA 5IDZA 4GZIA 4KWWA 3SURA 1OCJA 3QRHA 4ZO6A 1OINA 4K39A 3WMCA 4S3FA 2HROA 3I4KA 4C6EA 4OBTA 4O28A 3SIMA 3AZRA 4A8IA 3FKKA 3EWUA 1MXDA 4G1KA 3PZGA 3R7MA 1TJRA 1V3MA 1XIEA 1J10A 3JZEA 4JEQA 4NJJA 1IXPA 3LOTA 4Z2KA 2V2DA 3GTXA 5GRTA 1FCBA 1LZOA 1WYGA 1CIUA 1UKOA 4JQ4A 3T9PA 3SUTA 1UWAA 2HBXA 3PFRA 3LA4A 2P88A 5C9UA 5IHRA 1CGUA 1ZCCA 3CZJA 4FF7A 1OFAA 3QV7A 3MYOA 3GVWA 2ZXDA 2UY2A 3FX4A 4QNWA 4BR1A 4F0MA 1HJUA 4NVTA 1H7PA 4C6CA 1HF6A 3W76A 3VNDA 3O63A 3A4WA 2OR2A 5F7UA 1U1JA 1AMYA 2DZTA 1VB9A 3B4YA 3OTRA 4UQAA 3W7GA 4Q3MA 4EPEC 4ZA0A 4CN6A 4L9YA 4N6FA 4KWVA 2FIQA 3WLSA 3RJXA 2RAGA 4LVFA 1IZJA 2C8NA 2R14A 1IR2A 3KW3A 1A3WA 5ABGA 3EOLA 3FY1A 2X8RA 3F7JA 4HNOA 4OV9A 1I2RA 5I5RA 1J93A 3QY7A 3LB0A 1P7TB 4LY4A 4PMZA 3UYIA 4CQ9A 1DE6A 4O1CA 4IMAA 3MCNA 2X50A 1C9WA 4QG9A 2NV9A 3S6OA 2CITA 1ZAHA 4AVNA 3CQ0A 3W1TA 3N6QA 4DWSA 3OA3A 3ZVHB 4JDYA 1H60A 3CIVA 2PS2A 4UOJA 1DQWA 2W3ZA 3BV4A 3HG5A 3UESA 1XLKA 2PURA 1XIDA 3CWNA 1NHQA 5EYWA 1N5XA 2HV5A 4M80A 1B31A 1JPKA 3CUIA 1HZYA 4W8AA 2FMOA 4FK9A 4TV5A 3GD6A 2A7PA 3GNRA 4KRUA 3ZR5A 1XYAA 3HGSA 2D24A 1BRLB 3L4XA 1P6WA 1R6WA 4QSHA 1EGMA 4JQ9A 1EC8A 2VP8A 1B30A 2J4GA 4R5EA 3TYAA 5BU9A 1T8QA 1UBSA 3THUA 1KLYA 1EP1A 2D2OA 3BO9A 1Q8JA 3NGFA 2ACRA 2TAAA 1VENA 2HS8A 3ELFA 5A8OA 4EAMA 1NU5A 3KWSA 2OFJA 3F5KA 3DC8A 1W91A 4UTKA 1PJ9A 2PLCA 2WVVA 1HIZA 1SVDA 5JCIA 3LD5A 1B54A 4S3EA 4KWUA 3P74A 8A3HA 3WFAA 2ZZCA 4G7FA 3APGA 1SYTA 1XH0A 3BJTA 4UTWC 4HTBA 4DIAA 3W1MA 3KRUA 2XH0A 1TTIA 1UWQA 3WD0A 4AY8A 2WKLA 5KVHA 2YGYA 3NQBA 3OODA 4Q8WA 3HJZA 3VNLA 5I79A 1FXQA 1GEUA 4C6OA 4UR7A 5D05A 1PZ1A 1N60C 1BG9A 1W56A 2PDWA 3HPFA 3AS1A 2Z00A 3R79A 1C8VA 3TTSA 4P8UA 3G3MA 1KWKA 2W79A 3OZOA 2YDAA 3M64A 2V38A 2WANA 4WUIA 5CZJA 4PMUA 1YPXA 3B0VC 1Z48A 3NPWA 3GH4A 4XTIA 3MP5A 3CL6A 5CSRA 4J3ZA 4IIEA 4O0KA 3S9YA 1SR0A 3WLJA 1NOUA 3IS4A 3OLEA 3DG7A 2HK0A 4DWSD 4UOZA 3ZO9A 2W62A 2V69A 4LFYA 3NQGA 2Q3OA 1X7IA 3TA9A 1ZJBA 5B7YA 3SN0A 1XQKA 3BAXA 4TIMA 4UWMA 3G77A 4GQQA 4WEVX 2A4AA 4IZGA 1FWTA 4J2MA 1X96A 2X42A 3T4CA 5KZEA 4AQLA 1WKEA 3LQLA 3RRXA 1XH1A 3VDAA 1S3TC 2D22A 1KXHA 4L6HA 3AU6A 3BOFA 1W32A 5ABTA 1NDAA 4TU1A 2AQVA 2I17A 2PTXA 4I5RA 4D72A 5JUVA 1AH3A 4DYKA 3E0WA 2VKZG 3BWWA 3GYEA 5EMLA 3NQ8A 5G1MA 1PB0A 3EPMA 1P43A 1F07A 1EDQA 1AD1A 2YCLA 2NX1A 2Y2WA 1HL2A 1YPIA 3EDEA 2E5CA 1Q13A 7REQA 1PCWA 1I1XA 1FRBA 4L56A 1AL8A 2QCNA 2XIMA 6PTDA 3O8AA 3PJXA 4CN4A 4LYRA 4PMVA 4CVUA 4S2BA 3OO2A 4XIAA 3FA4A 3P8IA 4XV0A 4MTVA 3U2EA 4X60A 4EOUA 4JIRA 2Z7GA 1QNOA 3MJMA 4L6OA 1ENUA 5A8MA 1BYAA 3OYXA 2X99A 1OWQA 2DZXA 4ACZA 4CUCA 4IFKA 1A4LA 4GXWA 1JRCA 4UQEA 1S1RA 1OZMA 2V0TA 2QMKA 1O5QA 1QNRA 5I09A 3M0KA 3NOYA 1NPXA 1IXQA 3RO6A 1BHGA 1E1EA 1MQPA 2ZOXA 3MV11 4B5WA 3ZM8A 3UG8A 1MVYA 5MKGB 4PSRA 3MANA 1DTNA 3IC9A 4NYUA 3K4WA 4BQ3A 4CD4A 3GIQA 2EPNA 3WF0A 4B5VA 2V3BA 2QJGA 2GLKA 5H6HA 3CPRA 5JIWA 3P7YA 1K4HA 1VFTA 3LI0A 4HZ6A 3VUPA 3Q2DA 1GOXA 1J2BA 4PBGA 1JEZA 3MQTA 4WKFA 2ZA1A 2ATMA 5BRQA 3KUMA 3P67A 3QKEA 3GFZA 5LIWX 4BQ2A 1XV8A 3P80A 4J4KA 3AXMA 1NWSA 3F4VA 4C7FA 4Q4KA 3LXDA 4GI6A 1C9DA 1ZDLA 1YDNA 3SGZA 5D04C 4B3LA 4KEUA 4DWSB 3SEPA 2RGMA 1YXDA 5K9DA 3A3WA 4UCGA 3SCSA 4M5PA 1EHNA 1IEVA 4IGNA 3AYSA 3BLDA 1RAKA 1MUWA 5IFTA 1W5QA 2GVLA 2PBOA 1S46A 2PSNA 2E25A 5CPQA 1E0WA 2ZX9A 7TAAA 1UWUA 1EEXA 1HN1A 1LL6A 3NQDA 1QPKA 2PGFA 2QULA 4EWND 3NQ7A 6ALDA 2CZ5A 4MAZA 4JTTA 3O0KA 1GOIA 1RBAA 1RPXA 3AMDA 1FCQA 3UBPC 3TYZA 5HANA 4NX5A 4D6CA 3TK7A 3TUUA 1QHPA 1K8YA 1Q2RA 1FH8A 5PTDA 1SW3A 1RV8A 3WQFA 2HS6A 4IGHA 3LZ3A 5CG0A 3IAQA 3CL7A 3A64A 1UKQA 3FJLA 2WWCA 4IMDA 2PTYA 3KBSA 3LLXA 9CGTA 4Q7IA 4JL2A 1F8MA 5T9BG 3HQOA 3GXFA 1TUFA 1S2AA 3O6CA 5A6BA 2FVKA 4AZGA 2CZVA 3GG8A 2W3SA 1OBAA 4BEQA 4HYRA 2EPHA 2C1GA 1EHAA 3ITVA 3MBDA 3MSGA 3G1FA 1KV8A 2PGWA 4Z08A 3LMYA 3FVMA 3LBMA 3K1GA 1GGOA 4LF1A 3EBVA 3MBFA 4HNCA 3EYPA 1OK4A 2HTMA 3ZWSA 3POHA 2ZXQA 2OLAA 3WLPA 3V35A 1XG3A 3PG9A 4TTGA 3WNKA 1OYCA 4GNJA 4F2UA 1M1BA 5C55A 4WSKA 3LRLA 1GW1A 3GTHA 1E1CA 1SJBA 1N55A 2ZZ2A 1OYBA 4K36A 3AS2A 1Q6QA 2VT0A 3CT7A 2O56A 1UR3M 3T4WA 5CZ0A 3MY9A 4YTSA 2BHZA 1NHSA 2Y61A 4OE7A 3G6LA 5KTLA 4EQRA 4GGHA 4YWSA 3FSTA 2E1WA 1OIFA 1SGJA 1K7FA 3E5PA 4LSBA 4GA8A 3WQOA 4A8LA 4DXVA 3STFA 3HPSA 5DELA 1EUAA 3OQEA 3INPA 4GH3A 4Y8EA 2IPFA 4IL0A 1P48A 1KRBC 1W3LA 2JALA 1CWYA 5LXEA 4JL1A 2B7QA 1Z42A 4HNLA 2XIBA 3UG4A 4C60A 3KL5A 2BC1A 1ODUA 4GIRA 4UTFA 5FOOA 1F6YA 4C6MA 1XCFA 2WW5A 4PB5A 2E3ZA 3MMWA 1ECQA 4IWWA 3NVZB 1ZTVA 3FFSA 4GYFA 1Q66A 4MYXA 3EWZA 2V5DA 3A13A 2OYKA 3GU2A 5ABHA 5DXXA 3KHDA 3GNDA 4F8XA 2XVKA 4D6EA 4ZB5A 1KN0A 1MUMA 4KESA 4UB9A 1ISYA 1EO5A 4CNTA 2D2JA 3G1DA 3FDKA 1QU4A 4GCAA 3R4IA 2YCLB 5DEZA 4JYFA 3T0CA 3UJ2A 1ADSA 3TFXA 4A22A 4FXSA 5I6SA 2ALRA 7REQB 2EQ7A 1K4GA 2VI0A 2YVFA 4HN4A 3P6LA 3GUWA 1KM4A 5DRIA 3TEVA 4NZCA 1EJSC 2BBFA 3EEGA 2Q8LA 4MLRA 1KXQA 5A6BD 2YFOA 1RXOB 1ECEA 5JRBA 3BLLA 3W7NA 4OOZA 1C7SA 2ZUMA 4GR1A 3WDJA 4ACZB 4IFKB 4B91A 3UR5A 5CSYA 3T6CA 4DM2A 1EGZA 1JAEA 1S2VA 2DW7A 2I9EA 3EB2A 3DI0A 1PIFA 2NPXA 2POZA 2CBUA 1R0MA 2X0HA 2DUXA 5C7VA 4F9JA 5K9XA 4JBRA 2FDSA 3SUWA 4JFWA 3CAWA 1VLWA 3AOFA 2V5BA 5H8PA 4DY1A 4XZ9A 3RMEA 3NPUA 3BGJA 3QYQA 5BXSA 2ZX6A 3MKCA 1WAWA 3ZSSA 4AZCA 1ONRA 3A22A 3CHCA 1P4CA 5LIUX 5B80A 3IAPA 5G2HA 4Q8VA 4GKLA 3DJGX 1OC5A 3SRDA 2ZFAA 3GH7A 4IQLA 4P7RA 4RXGA 4DF0A 3TSBA 3BG9A 4CNPA 4S3CA 2ABAA 3GDLA 3S1WA 1QO5A 1I9CB 1RQBA 1BYCA 5DRCA 1KQYA 4C5ZA 1J12A 4DI9A 3TW7A 2G5WA 4FP1A 5BWAA 1UH2A 1AUSL 1BWKA 1XRTA 2WC4A 3UNTA 1V02E 3KX6A 4HPJA 3GW3A 1VPQA 2POTA 1JG9A 1SMAA 3GXMA 3TAOA 2P5NA 3KCJA 3IIXA 4J56A 2GR3A 1A3XA 4JAWA 4DLFA 2NLIA 2WKGA 4ASTA 4ML9A 1WOBA 3L4TA 4N9EA 3MUIA 2YFNA 3TJ4A 2YYTA 3WF1A 2NVAA 3LPFA 2GOKA 3F1QA 3H2FA 3QQ0A 1UZDA 2VWTA 3ARUA 4MY8A 2WB5A 2GDUA 1A47A 1JZ5A 3GX9A 1IQ8A 3NVWB 1O7AA 2HJPA 2VUYA 4FLRA 4QSFA 1JVNA 1WKDA 1GYLA 1XLGA 4HPGA 1V3KA 1BTMA 3UF9A 1XLIA 2EKGA 1T8XA 3K1DA 4XKMA 2I56A 4GRTA 3C2YA 1E1CB 3AMGA 1KTNA 1RPKA 3E2SA 2VZUA 2XGBA 3ITXA 4UFIA 4AY1A 2CZEA 4M24A 4TVUA 4H7VA 5I7GA 1H62A 2DVUA 1UUMA 3V75A 3G8RA 4MYAA 1MEIA 1F3WA 2WM0A 4LVDA 1W2PA 1IWAA 1J4EA 1Y5XA 3B97A 3W3OA 5G4WA 4XTDA 1Q1WA 4AWEA 2ZC8A 2OSWA 3WUEA 4MAVA 1DKWA 4IP7A 3MCOA 1FCUA 1YMYA 3W7DA 2WJEA 3UPBA 3SADA 3MJYA 4AEOA 3XISA 2V3FA 1B0IA 3GK0A 2W3RA 2I5GA 2R24A 1GZJA 2P10A 1EP2A 4X3ZA 2OX1A 2DZUA 3QGVA 4QE5A 1A0EA 4BQ4A 3HJEA 4GZ7A 2GGEA 4AZIA 1IEXA 4LAZA 1R47A 1YTDA 3V36A 3IRSA 4AZ6A 2ZRUA 3ZQ9A 5LA0A 3PC0A 3NPXA 4OKDA 3L5LA 1OB0A 3BDKA 2ZZ3A 3W1LA 2X2YA 3TCSA 1W8SA 4TXEA 1GYNA 3HQNA 4E2BA 3DN5A 1TJ0A 3R0UA 1IZCA 4QTGA 1BXCA 2CPUA 1OQFA 3B4UA 5AB3A 3BLKA 4AD4A 4B3ZA 4P7QA 1XBXA 5AKQA 3I3DA 1B3XA 3W87A 2WHKA 1HKJA 1JZ8A 3WQ8A 1XLHA 4ZENA 3SIZA 2J88A 2B7PA 4HZMA 4E8GA 2Y8UA 3G1SA 1LWHA 1YDYA 2BVWA 4J7RA 1JI2A 1S1PA 4NEVA 4IIFA 4C6PA 1QO2A 2QJMA 4HHMA 3C2OA 3VABA 3G0UA 3BJSA 3WLMA 1A5BA 4D6IA 2G0WA 2W9MA 1LLZA 1W1YA 3M4HA 4J1OA 4KWOA 4DELA 2PD9A 1YTKA 4LX4A 3UVAA 4Z42C 1OX4A 3F03K 3KOZA 5DCEA 2WMJA 2VOTA 3QY6A 1GHRA 1XUZA 4PCNA 2CESA 1ZL1A 3WY1A 3WNLA 3NWRA 4LGXA 1OK6A 2DQXA 5FF3A 1A80A 4R7JA 1REQA 5HATA 2EBNA 2OMAA 5U1OA 2H90A 4XD5A 1HNYA 5HMFA 1ESWA 1VEPA 5HMEA 3KM8A 3APYA 3FNDA 1LJYA 2Z26A 4F4RA 2OQHA 1H2IA 1ZBVA 4Y90A 1GRFA 3AQUA 4ZTXA 3FEMA 5G5HB 1Q85A 3WLRA 3L8KA 4ZQRA 1TVLA 2EPMX 1O66A 4UOQA 4WK9A 4AZBA 4AZCB 3RYSA 1QUMA 5AYZA 2NV1A 2FDMA 2BOGX 1JDCA 5G4EA 4C6IA 3GIYA 1W5OA 4QIUA 1GOKA 2WMHA 2J7HA 1V6TA 2IQDA 1R7OA 3DIPA 3UPMA 5LNVA 4JTHA 5A6AA 3G1YA 2BGNE 3H7VA 4MPQA 4NNBA 3M46A 4WOZA 3W1NA 1CTNA 1JI1A 2D2GA 4NHVA 3VX1A 1XGZA 4J35A 2QVNA 4HPHA 4DBWA 3EXTA 4DBDA 3L5MA 2YW3A 1XSJA 2CHNA 1NH6A 3H6OA 2YDRA 1OFQA 2HQMA 5XIAA 4XISA 2BX7A 3A4JA 1ZAIA 5EMJA 4RUBA 4JFTA 2B7NA 5EPDA 1S5NA 3GDMA 4GE8A 1OGGA 4IHCA 1D7YA 1SFJA 5HDRA 1O6IA 3PBWA 3NZGA 3HV8A 4ECLA 2GZXA 1WQ5A 3NCOA 4CQ8A 3V0UA 4H4WA 1BSIA 3HBLA 3LV6A 3FS2A 2J13A 4ZTYA 1AVAA 1QI0A 4XZHA 3QGKC 4K8GA 2O9PA 1GQIA 5FEXA 8CGTA 2GGIA 2JGYA 4L64A 4HT3A 1FFUC 4QE1A 3SY5A 3BV7A 6TIMA 1XBVA 1C93A 3NDZA 1E51A 1G69A 4AZHA 2JKPA 2BVYA 3H2AA 1VRDA 5CZSA 2TPRA 3KFTA 4MB5A 1GTHA 4HCLA 5D37A 3O07A 4EPBC 2PWEA 2WPBA 5JIPA 3MDWA 1RQHA 4KIEA 5EL1A 4R88A 3WH5A 1XLJA 4HK7A 1FX6A 1JGMA 4I7WA 5I3IA 3NL3A 2RJHA 3NAVA 3G0XA 1LT8A 3VTRA 1WX0A 3VNKA 4A3HA 3AHZA 4DJEC 4I5UA 4IL2A 3WZ0E 4JFVA 5I00A 2QZRA 2XIQA 3DOPA 3LCFA 4E8DA 2XGZA 3TOYA 2QJNA 2DJLA 1P0NA 2IPWA 3WJXA 2WHMA 1PX8A 1J18A 4NNCA 1NHRA 1F3EA 4FI4A 5J5RA 1SZGA 5HPCA 1VBRA 4IIGA 5DMYA 4HK5A 2HQAA 3TNOA 4GO9A 3K4AA 3GNPA 3GVQA 5AHFA 4K8DA 4OECA 4L1XA 1C8XA 1UKSA 2J6XA 2E6DA 1F7BA 4HOWA 1BWCA 2Z2BA 3HN3A 2EPOA 4NJKA 2VRQA 3QMSA 4YJ5A 3GSMA 5FL0A 4EX4A 2IW0A 4JFUA 3KTSA 1DOSA 1FWNA 2GQ3A 1UP0A 4C6KA 2DSWA 1V0MA 2XVGA 1YIXA 2FZ9A 3ECQA 1H49A 2GSJA 4F2TA 4XZMX 3WDQA 5JVLA 1H2JA 1DWFM 3IJ7A 4YL2A 5HMDA 2PDNA 1XL9A 1V8EA 5CGTA 3BICA 1VEMA 3HURA 4DAIA 4S3AA 1RCQA 4AFYA 2ICSA 3WUGA 4RNHA 3C8FA 4O0ZA 4D6GA 3T07A 2RDTA 2XDFA 5EFDA 3UR8A 2FGLA 1S5WA 3F2DA 2Z29A 4XG1A 4QJ3B 1SU5A 1F2JA 3PBUA 2NSOA 5TBOA 1J79A 5DN1A 3GUGA 1B3VA 1PXGA 4MY1A 2E5AA 4D6DA 1LQAA 1QPOA 3EA3A 4IP5A 3ICJA 5A6TC 2CZDA 3WNOA 1IEIA 1OX4B 1OX6A 3AN1A 3VD5A 4RR4A 3OIXA 4WHBA 1WZMA 3EMQA 1GOWA 1B4EA 4K8HA 3BAKA 1EJRC 1QWGA 3W83A 4WF7A 1KCXA 4IXHA 4H01A 1REQB 1DWHM 4V1YA 2A79A 2DIEA 4X2PA 1QI2A 1UD8A 1W9BM 2GVEA 3MCMA 2QYGA 3RNDA 4PMOA 3FJ4A 3WDRA 5MF5A 1K7EA 4TX9A 3ARRA 4PTWA 4JICA 1X6UA 3IANA 3DH9A 3GR7A 4M7TA 2OWWA 1US2A 1BF6A 2A3LA 2PWVA 1EC9A 4PEKA 2J7EA 2CERA 1W1TA 4O54A 5HA7A 3C3UA 3L9CA 2QS8A 3AJ7A 3DC0A 3BCFA 3OHIA 3OEXA 3W82A 1FHVA 3IJDA 3USZA 5JBEA 3AS3A 5JH2A 3EDKA 1UWRA 5CBJA 4WVXA 4B15A 1OF8A 2HPMA 3KTXA 4EPKA 3S5YA 3VOFA 3JU2A 4R3UA 1TJ1A 4YHEA 3CBWA 4M6VA 1NOFA 2GQ9A 4RNJA 5DQPA 2JIWA 4U4MA 4EP8C 1A5AA 1RBOB 3MB9A 1FIQB 1JDAA 4K1WA 4U3AA 2YSWA 3W7LA 1E72M 2QCFA 3L4YA 1K8CA 3UY8A 3N4FA 3D46A 3WBAA 4IF2A 1FO4A 3L67A 2FKPA 3KL3A 3TYUA 1TR9A 3BSMA 3TC3A 3HGJA 1P6BA 4DLMA 1QFEA 3SY1A 3CZGA 3T42A 2CBVA 2WSYA 1ZAJA 4CCZA 5AHIA 1H1NA 1K9DA 3PSWA 3AAMA 2CLOA 5AHLA 5I23A 3CUJA 3TAKA 2ZRVA 3U8GA 5HUPA 4LB4A 1EDGA 1A5CA 4LOCA 2QUNA 3THAA 3EWDA 3MC5A 3GHTA 1KWGA 4L4OA 2WNNA 2VZTA 4JTGA 4H4PA 5E6YA 1ZGDA 3EA1A 3WLIA 1LRNA 4AWUA 4BI6A 1AW5A 1AL7A 5A8PA 4ALDA 3FOKA 2PDXA 3QV6A 1G4TA 1XQLA 2ZTKA 1UPMB 1ZBKA 1YE4A 3ZJ8A 5FJJA 4LAKA 4L6DA 5BCAA 3MS8A 4PRRA 1TV2A 4GUIA 3ZS4A 4U5IA 2WPEA 1LCOA 3GXIA 3IJLA 1XLFA 4DJDC 4O8RA 5CSUA 3PP7A 1TJPA 5FF0A 4JTRA 5T8GA 1Z44A 4MG4A 3ORWA 2QCHA 1VFFA 3TYBA 2VO5A 2PRHA 1QPNA 5FEZA 6REQA 3BGGA 4GD0A 4K7ZA 4GACA 3DG3A 4D6HA 5H2ZA 3L2MA 1R7AA 4W5ZA 4FB7A 3NQEA 2XH7A 4DO7A 3S9ZA 3E2RA 5H1WA 4FSAA 2WMIA 1OFPA 2YKKA 1M65A 3PM6A 4OZOA 1NDZA 1CGVA 1HFBA 1EF2A 3CQJA 1DNCA 4F2BA 3SZ8A 4KCUA 3DKLA 3RMJA 2CETA 1SPQA 2PD5A 3TLLA 1WKFA 4HB7A 3AS0A 1X1ZA 1OFEA 1DQUA 4TMCA 4LV9A 2QPXA 3ARVA 4CNNA 1VFOA 2PU0A 4AX6A 4D71A 4Q4RA 3OPSA 5A1AA 2G3JA 3PJUA 1IGWA 4NSBA 1RVGA 1XXXA 3OQ8A 5SWUA 3SJ3A 2BGSA 2R6OA 3KZSA 4WOQA 4HP5A 1XYBA 2LLEA 5JH1A 4Q4SA 1F76A 4H4TA 1W3IA 5FS8A 5M2FX 2H9AB 2YZ5A 1J96A 2QQ6A 5FI8A 1UMYA 2BXVA 1SB3B 3IIOA 3E1F1 3L2IA 3BQ6A 1VQTA 1EFZA 1O1ZA 2PDCA 2V5JA 3QOMA 4JD4A 1V6WA 4YNGA 3LPOA 2QCEA 1GWJA 4ORIA 1GRTA 4XWUA 4JHMA 1PKNA 3UZZA 4CQDA 1NTHA 4JN6A 4ZFCA 1W2VA 3BMWA 2BNJA 2QDHA 2F84A 3TMQA 4LUYA 3ITGA 3B8TA 2PCEA 2VR4A 3SRHA 4AD0A 3FYPA 2DIJA 4LALA 1LTDA 3FCPA 5CC5A 1UZ4A 3R12A 3TC7A 2Y5EA 2PEVA 3N9KA 4QITA 1CGYA 3B8IA 3VOJA 2HWGA 3I7RA 2PDYA 4AY7A 1GZGA 1PSCA 3JZUA 2OLHA 4GC4A 1XC6A 3PB2A 1C90A 5BRBA 1B5TA 3NQMA 3N2BA 3OA5A 2W66A 3I3EA 1I6NA 3H4KA 3H55A 1NWTA 4R7OA 3M1ZA 1LRTA 4NI8A 3F5LA 2YCIX 3IJ6A 4GKTA 3OG2A 3ETRB 1W9DM 3RCMA 4F0LA 1VIZA 3SQLA 2EQ8A 4GK8A 2FJKA 3STGA 1OIMA 3W27A 1RZMA 1VHCA 5B7ZA 2J9ZA 2NQHA 2DZWA 4PUUA 1YDOA 3AU2A 1KFWA 3C0SA 4JXCA 3W72A 3ZLHA 2RUSA 3OZPA 4H19A 1I1WA 1UMLA 2OT1A 3B8SA 4UR9A 2PP0A 1QOPA 8XIMA 3SDOA 3EX4A 2ABBA 4MM1A 3CYJA 3N1AA 4G2DA 4NY2A 4IPNB 3G3DA 5HJLA 4N4QA 1PL9A 1RALA 4OHQA 3BCJA 1FVPA 1R9XA 2WOIA 4JTIA 3WD2A 4GZJA 4I9MA 1FWBC 1CENA 2R1NA 1BF2A 1UD6A 3TMLA 4JTFA 3WFLA 1G4EA 1BVNP 4H9XA 2OZ3A 2I9UA 1LOSA 3QPYA 2ADAA 4MY9A 4EXQA 3RDKA 4H4UA 1FDZA 1G1YA 3AROA 5G2IA 3UJSA 5A8NA 4D8LA 4HBKA 4WGXA 3GNXA 1VFLA 1CW2A 1JYWA 5TQLA 2CBIA 2V30A 4AB4A 3ARZA 2XFFA 4ICNA 4B4FA 4KGJA 2ODOA 1EQPA 3VNZA 5HAOA 1BGAA 4NU7A 5A8GA 2EKCA 4AHQA 4DBEA 2ZUVA 2MANA 1BVWA 4JTDA 1IT7A 3WQ6A 1HO4A 3KRZA 1Q6GA 2DY3A 3TONA 1ZRQA 2HPIA 2G97A 1A5KC 1FEBA 5C9WA 2X40A 2BHUA 1R3WA 4Y8FA 2CKRA 2VVSA 3CV2A 3DERA 5M3WA 3CIXA 4Q22A 4O11A 1SJDA 4QCEA 3VMPA 4C6NA 1LF1A 4RV3A 4JIPA 1ZKQA 2G3NA 3PZNA 4LS0A 1E55A 3CB8A 2I57A 3M0ZA 3W88A 1GK8A 3DBNA 3QM3A 3S46A 2VC9A 4G56A 1ZP4A 3S9IA 2V3DA 2Q09A 3I6TA 1SW0A 5AZ0A 1XSIA 6REQB 2UY4A 3CQHA 2QDEA 1GRHA 4CCCA 3KP1A 4AIOA 5HNUA 3M44A 2PWDA 1TPUA 1HL8A 4KEVA 5FMHA 1ISXA 2DUAA 3K13A 4S3DA 3GVVA 3E5BA 3K8KA 3NQVA 2WMIB 3CHFA 4O1EA 3FLUA 6TAAA 3VKDA 3OGRA 1GTEA 1XJBA 4O8AA 2DZPA 5DX7A 4RPQA 4FLOA 1XRSA 3BE7A 3MWCA 1ZJIA 2C1HA 3PSVA 1AG1O 4JIQA 4YWOA 1BG4A 4HPXA 4JN8A 2PB1A 3UCQA 1XRVA 1CNVA 3DGBA 4MZ1A 1KM1A 3SECA 4PTMA 4H50A 2NQ5A 1QI3A 3EDJA 3ARYA 4RE3A 4RZ6A 3L4ZA 3GDKA 1DXEA 5A2AA 4Z1CA 3VUSA 3NZRA 2DFAA 1TZZA 1VIWA 3CGCA 1RY0A 5IRPA 4AH7A 4LV4A 2HVOA 2X09A 1PTAA 4S3BA 4J3TA 3W2MA 4ICCX 3RUBL 3C2FA 2J27A 2ACQA 3URQA 4LY8A 4HD5A 3QQWA 3OW1A 4ZXOA 3W9ZA 1QMLA 4NILA 4KERA 3ZLFA 3HB9A 3KXQA 4HIBA 2DU2A 5KMYA 4QRNA 1W5NA 4D1IA 2Z1KA 4IX0A 1NELA 1PWLA 3TV8A 1CGXA 3WK2A 3RITA 1Q7MA 1RUSA 1MW1A 1XKYA 1W3NA 3N14A 3MKKA 2PWGA 2B81A 3T0DA 1QDSA 1Q6OA 1UG6A 2H3BA 2VGFA 3XIMA 1W3TA 3LCHA 3WLOA 1D8WA 3TZFA 2CKSA 4HA3A 2QCLA 3S4TA 2J7FA 3A6OA 1VKFA 3CNYA 1X38A 3M5VA 4EQSA 1T0OA 2TMDA 4Z0SA 1GREA 5ECVA 3TH6A 1Q6LA 2D1ZA 3GTFA 3HGRA 3GS6A 4I5XA 2BVDA 3BVJA 2AGKA 4LCRA 5KSWA 3QPZA 3MP4A 4FDCB 2B0MA 4CD7A 3DFOA 2DT0A 3SCPA 1WBHA 1EP3A 4K68A 3E9AA 4I8DA 4LYQA 1JYNA 2VDGA 1NOWA 4QG8A 3HU7A 4NZ5A 1TYGA 3GD3A 2GVYA 2RKXA 3DFTA 4BURA 2PWHA 1QNSA 3KTCA 3HM7A 4GNVA 1ZZMA 5LHEA 5KETA 2YVGA 1IXNA 3CT2A 3QFEA 3AIUA 3FDGA 4GJIA 1LM1A 4Q4MA 2FYMA 4BZYA 3SCRA 1BVZA 2C14A 3D3AA 4M1RA 4UTTC 4NEWA 5KEZA 2J6VA 1JXKA 1JF5A 4QGCA 2PU1A 4XAGA 4W8BA 3URNA 1PTGA 3UNDA 4JHZA 3R6IA 4MWAA 3AMCA 3THCA 4RLIA 1PPIA 1TQJA 1I2QA 3QR3A 2BFGA 1FHUA 3PWGA 3GC2A 4H1ZA 1E0TA 1V0NA 1WAUA 2C91A 3QTGA 2UY3A 1E1FA 2W5FA 3IVTA 5LNWA 4A8NA 1WOAA 2FZNA 3VI2A 1C29A 2WJZA 1F3XA 2DSZA 1A53A 1LL4A 1WDWA 2IQ0A 1Z32X 2QW5A 1QNVA 1QBAA 3Q65A 4GBDA 4UTLA 1ZP3A 2J7CA 3WNNA 1NQKA 2EJAA 5A69A 3LGGA 2YL9A 3TXVA 3RX4A 2CLFA 4AWTA 4C90A 5A6SA 3RX2A 3TROA 3NYDA 3UXAA 1IIHA 1GJWA 2CLIA 1L8NA 3DYOA 3A9IA 3BG3A 4I8YA 1UWIA 5ABEA 1DJWA 4IXXA 3WLNA 3GFXA 1QW9A 1ZMDA 2YW4A 2YB4A 3L66A 3PPCA 5AC6A 4BEUA 4ZOEA 1Q7ZA 5EBKA 2X8CA 4QAIA 4Y9PA 3PHAA 3TOPA 3CV1A 2OGJA 2PDIA 4O0QA 3F2CA 3MTWA 3WQCA 4GC3A 3S5SA 5CC7A 1JPMA 3ZR6A 3QF0A 4M82A 3P3BA 3LXBA 2P53A 3E02A 2ZUSA 1UOKA 1BYDA 3AICA 4AMAA 5FF2A 3ENLA 3WD1A 1DP0A 3KOYA 4ICMA 4YU1A 1W1B1 4B4HA 1L2QA 3LQGA 4XUYA 2WMKA 4HJFA 1SZFA 2FH8A 3L4VA 2J8GA 3DK9A 4PODA 4W9TA 3DEQA 2OWCA 3W0KA 5HQMA 3DYMA 5CPNA 2FGZA 4H9VA 4I90A 2D20A 3DK8A 1JR1A 2JEPA 1HT6A 4RDWA 2Z1XA 3CAQA 1GXFA 4YYFA 3CWOX 3NSMA 1YDVA 1TKKA 3HOJA 1Z8AA 1OSEA 1C8YA 1MNZA 1J11A 1CGWA 5U4NA 1FEAA 2L5HA 3QPEA 3W6YA 5KVIA 5FEWA 4ZOAA 3VU2A 5T26A 2NXGA 4PEEA 5I3FA 4C6LA 1DHKA 4GMEA 1O1HA 1GETA 3P81A 3TQVA 3GVGA 3KVLA 3IGSA 2GDVA 3IGHX 4A3QA 4IMCA 3T40A 3VNJA 3W6MA 2YL8A 4OUEA 3PZVA 1ZUAX 2NVDA 3TZNA 1LOQA 4HGXA 2D0FA 1J0ZA 5BXPA 5CC3A 2JGQA 3D0CA 1KB3A 4U10A 1GVOA 2QUVA 4JN7A 3MMUA 2J9XA 1X2HA 1FH7A 4C1KA 4R34A 1H11A 4XAYA 4JGDA 3WQ4A 4D6FA 4L9ZA 3EKZA 1QW7A 4GY1A 1GSNA 3S83A 1QI5A 1WXZA 1TV3A 1NIUA 4P5UA 4YYCA 1H41A 2CYGA 3VC6A 1NDVA 4LAMA 5A8QA 1T3QC 1QWKA 2OSXA 3H2MA 1LG1A 3ARWA 1VEOA 1QTWA 2A1YA 4V2XA 2DJXA 5FF7A 2GVGA 4ZZ9A 4HCDA 2A8XA 2PCQA 2TRSA 2WAGA 3WN6A 1DBTA 1J2WA 2X05A 4GVHA 1W5MA 2QUUA 3B0XA 3MI6A 4XAFA 1XDLA 3CZEA 2ISSA 4XIMA 4E38A 4QCFA 1W1VA 4RK8A 1UKPA 3C3NA 2QMJA 3SCUA 4PTNA 3BSGA 3BPWA 1EQCA 2VC5A 3FJ6A 1H7XA 2YCKX 1YHTA 3N18A 3ITTA 3MSDA 4UMAA 3PNUA 4U28A 3CUHA 4QR6A 2J66A 3W74A 3B8VA 3UG5A 2EJ1A 1X6NA 3U2OA 3GKFA 1D9EA 3FYOA 4B5TA 4D2JA 1U1UA 4WDXA 3VKJA 5C2XA 4QQ3A 4ZQOA 4EQXA 3RRAA 2HVNA 7A3HA 5GVJA 3OLGA 1TVPA 4H4ZA 4UQ9A 3H54A 4QM1A 3TSMA 3FGCA 1E9ZB 1G67A 1UKTA 5CAKA 1TV4A 5D9MA 1RP8A 2Y5JA 2WC3A 4FLQA 1VPXA 1UHVA 2NXIA 4O10A 1EC7A 2CWXA 1BQCA 4ADWA 1I2OA 3L65A 4Y2WA 1GG1A 4Z2GA 4AIBA 1CB2A 3ZOAA 3CO8A 4MWAB 2BTMA 5CZTA 3K8LA 5I78A 1B3YA 1RJRA 3L12A 3OGVA 3POCA 1PBGA 2A3CA 1YNQA 1QK2A 1TZ9A 3KZPA 3LM7A 1BEUA 1TIWA 4UR8A 3L2LA 1QBBA 2DDXA 4C6JA 3WH9A 2NLYA 1BFNA 1XLDA 3CTLA 2A2IA 2BGQA 4LVBA 4P61A 2PMQA 3M43A 2EG8A 4NRSA 2X8HA 5E0FA 3VFCA 4Y9OA 3HG2A 1LQ0A 3FSUA 4TR9A 4KW2A 2XH4A 5C9XA 4QROA 4JY8A 1YNPA 1T6MA 5BW6A 4P7OA 5AZ1A 2QV5A 4HNUA 3BAWA 3LX9A 1XICA 5ECUA 1J9YA 3E49A 1OCBA 4DBUA 1BQGA 1TPC1 4XD6A 5K4XA 3G22A 2DZSA 3W26A 5DF0A 2VZVA 1HJSA 2X1RA 4A6GA 1FFRA 1TPDA 4U2YA 2QDDA 1DHPA 4UNKA 1OY0A 1ODZA 1JJKA 1G6CA 3EUB3 2FFCA 4L65A 1F8WA 1PYMA 3RPTA 3UGRA 1UR9A 4KWSA 1XW8A 1R3TA 4A3RA 1VLIA 4ZCWA 3GZAA 5AC8A 4BI5A 4MKVA 4OTKA 1AJZA 4RNFA 3NEVA 3CQIA 3W2NA 2GUUA 4GUJA 3WBEA 5BRPA 2VFHA 3W25A 1OFRA 2GJXB 2Y70A 2XG9A 2ZRZA 1W31A 4PCTA 2G96A 3FYYA 4U3CA 1RK5A 1HKKA 5TF0A 4V27A 4M0XA 3RNMA 5K2ZA 3A5FA 3HMCA 3B8WA 2DGAA 3RM8A 1HG3A 3AC0A 3LCXA 1N7KA 3H7RA 5TD4A 1EJ7L 4UNLA 1VGAA 3QVQA 1UIPA 1E0XA 1HKIA 2PRLA 5JCNA 4EKJA 3HZ3A 3M16A 3S1UA 2WPCA 3JVAA 4MGGA 4KEZA 2OXNA 2VVNA 4L9XA 4NZ4A 3A7AA 3N9SA 1LP6A 1ZY9A 4S1FA 2VCCA 5EMKA 2GR1A 1I0DA 4JIIX 4EMIA 1BLIA 2QR6A 3BLIA 2VOMA 1UP3A 2B31A 4GQ0A 5JCKA 2GQAA 2JK6A 4O50A 1WV2A 3VINA 2WK2A 1VZWA 2XZ7A 2H6RA 4ZSUA 5FA5A 1H0IA 3I10A 2XUCA 2E09A 8RUCA 4FMVA 1KFEA 5HNTA 3QR1A 1UC4A 3N17A 1TMQA 4R9XA 2FB3A 5HNNA 2WJFA 4UTWA 1P1XA 2V68A 1UPPA 4UTHA 2PUZA 4CNUA 3QJAA 2QVHA 4IX2A 2O9RA 4EANA 4W88A 1MZRA 4HYWA 3M0MA 3PF3A 4C6DA 3VZXA 3SJNA 1FFQA 1H7OA 4H9TA 2CXGA 3LHTA 3UWEA 2FH6A 2C15A 3U4AA 3W2JA 4B5UA 1MRQA 2WHLA 3AZSA 4H9UA 3M0XA 3TR9A 1I2NA 4D6JA 2WNWA 2J7GA 1SJAA 4HNTA 3G2GA 1TRDA 2WHJA 1W3JA 3DFYA 1WXJA 1A49A 1T40A 1TPH1 3K8MA 4FX8A 3B9DA 2C7FA 4ATDA 4H9MA 3CXOA 4Q7NA 2J75A 4DYEA 1UWTA 3G1RA 5L6UA 3CEPA 3AM9A 1XINA 2AL2A 1Z6KA 3MUCA 1E9IA 1I0BA 4US5A 3WD3A 4IQDA 4FXJA 4I7VA 3QHNA 1CECA 1K9EA 1MXGA 4B92A 1EJWC 4LNYA 1ICQA 3LMZA 4GJJA 3NVTA 2O7SA 4ZQMA 5HQEA 1GNXA 3U5YA 2FPTA 3M5ZA 5DLCA 2FHFA 3CUXA 3FGCB 3TWBA 4FX7A 1W9XA 3GQYA 1WDDA 3BLFA 4QE4A 1GRBA 3JW7A 4FZIA 2XINA 1W0MA 1KO0A 3M5YA 3DFNA 1ME7A 3FKRA 4AC7C 4NAEA 3BW4A 3PR2A 4ACYA 4B2DA 1JD7A 1HVQA 1CEOA 1CPUA 2GJPA 2VD9A 1E4NA 1MDRA 3HPAA 3UXKA 4M8UA 3C0LA 3P61A 2P8BA 1XLLA 4C7GA 1W9UA 1M6JA 4QJ1A 2PDKA 9XIMA 2A3HA 3CS2A 4GGBA 3PFMA 3O3RA 1NJJA 1NM9A 4U5KA 3TX9A 1N8FA 2YL5A 4DJFC 4WY0A 5AYXA 4PMDA 1EIBA 2YLLA 4GX9A 3W24A 2C3CA 5J8LA 3ANYA 4N7QA 3RLVA 4ZB2A 3DAQA 4OGZA 1MEWA 4TVYA 3ZLGA 3AWOA 1DQXA 2A6LA 1A50A 3L21A 1Q5MA 2ZZ6A 5AFDA 1WDRA 3W7HA 1S2TA 4UXDA 4TMBA 4KH2A 3WBWA 3EWWA 2YDSA 4GBUA 4RDYA 2OELA 3G1HA 3GXPA 2Q6ZA 4UBPC 1FXPA 1E3XA 3CH0A 1PDZA 3M0YA 1ONXA 3VM7A 4C7DA 5A94A 3LV5A 3SQMA 1G7VA 3U5UA 3WLLA 2F5ZA 1Z7AA 3QW3A 4AXNA 3N2CA 5HK4A 1EX5A 5FJUA 1IEQA 3ZR4A 3LLDA 5GNYA 3ZT7A 4Q8OA 1JOAA 2XGIA 2ZUTA 4WDWA 1FWIC 4PB4A 3WEZA 2DV0A 4D8AA 2X1IA 2PF0A 1E15A 4NXKA 2XH2A 4US5D 3W75A 5HXMA 4GO8A 1Q6FA 2YA1A 4DF1A 2FTYA 3N15A 2OU4A 1JUEA 2UBPC 2VD8A 1XLAA 3P0WA 2NUWA 3ZIZA 3CM4A 1PZ0A 2PLKA 1UJPA 3NA8A 3RIKA 3H4WA 2J7BA 3II4A 1K4QA 4RW3A 4HCHA 4WRHA 4Z2LA 4AUBA 3BCDA 3GC5A 4RZ4A 5MKGA 3AHTA 1UQZA 4LJ3A 3MMDA 5JQ9A 3H23A 3VOCA 2FHBA 1UBPC 2GSEA 3FXGA 4AVOA 1XCWA 2CLHA 3CUZA 2I16A 3WF3A 1VP5A 1KBLA 3VKBA 1E6SM 2E9MA 3CLMA 4J3XA 1WB0A 4F79A 1WDPA 3D3FA 3LTSA 5A6LA 3TR2A 1EF3A 1UR2A 2FJUB 1SFTA 2Y7FA 3DGHA 4O4VA 5CLTA 4H4YA 4NT0A 5H91A 5I3GA 3H21A 4O14A 5GJMA 1XIGA 4M19A 3OGSA 3JRKA 2F38A 2WZTA 3PBVA 1YEYA 4E5TA 3WNMA 1A5SA 4QHRA 1RA0A 4QS5A 3WG6A 3TU9A 4HHLA 2R9RA 2VCAA 4AEFA 4IUGA 3UWWA 3UWZA 3OBEA 3ERPA 3R10A 3GAKA 1ZCOA 1UH3A 1HGWA 2E1DA 4GINA 1L6FA 1DV7A 5JU6A 4XUGA 3LRKA 3RG6A 4X0VA 1L6WA 3K2GA 1XYZA 2YVJA 4H4XA 4DVOA 3CZLA 3IIVA 5ENLA 3W29A 1VS1A 3EGJA 3QXBA 1HX0A 1IT8A 5C70A 2C6QA 3O0FA 3ABXA 4QDPA 5LYRA 4DO5A 5CGQA 1UA7A 1K8XA 2RHGA 4ADSA 4IIBA 3AXHA 1LBMA 3SRKA 3AIWA 2ZUUA 3JUGA 4LEQA 1KM3A 1TCDA 4L4MA 2P3EA 4FNQA 3DYPA 1XDMA 1UD2A 1XG4A 3E74A 1E5NA 2V5KA 4BF7A 5FAJA 1WKYA 3ABOA 1WZAA 1POKA 5A5WA 3VMNA 4GNKB 2AL2B 4ATWA 4H7ZA 4DUXA 5LGZA 3W73A 4DNHA 2GQ8A 4NXSA 5LNSA 1JCMP 1LWJA 1K3UA 4PC8A 3N73A 3Q37A 2Y7GA 1HKWA 4GWEA 4NP7A 4P2VA 3W1RA 4ZOBA 3VIKA 1XHGA 3C52A 4JOMA 2VCBA 3VDHA 1NAL1 4XBJA 3A24A 1TPVA 1XSKA 1K1DA 4RJEA 5AYYA 5XINA 4C91A 2AAAA 3THDA 4B9ZA 3VGBA 5E1QA 3A4XA 1NFBA 2ZE3A 3PZQA 4CCEA 4UFJA 4NAEB 3H7UA 3VE7A 1IYXA 4XKYA 4WSHA 1KFKA 3M9YA 1V5XA 2AKZA 4PGLA 5I77A 1PX4A 4AF0A 4CQAA 1YKWA 1AODA 1TRIA 3GBDA 3UA3A 2VELA 1VBJA 3KBMA 1H7WA 3XINA 1W1PA 3QV9A 1W1A1 3VIGA 3M41A 3OHMB 3NZ1A 2H8XA 2G95A 3DECA 4WZHA 3IVUA 1XLEA 3SB0A 4WY0B 2BZNA 3HF3A 1G0CA 4IGMA 5EMYA 3WH7A 1TB3A 4HNVA 4NRRA 1JZ2A 2JE8A 4IG2A 2VFFA 1DWJM 2OX4A 3U7VA 4WKHA 4PRTA 1KGUA 4Y7EA 1VRXA 1MEHA 5A6KA 3VE9A 3H2NA 1ZX9A 4RW5A 1Q2SA 3NTYA 4KFOA 4RDZA 3GR4A 4AEEA 4NG3A 3SN4A 1EH9A 4IGSA 1UR4A 2BHYA 4W7UA 3IK2A 4NL1A 4UMCA 1STZA 3E2VA 3GVRA 1UC5A 1XPYA 1PV8A 3BZGA 4JX5A 3DX5A 2X1UA 1HO1A 1CT5A 2R1KA 2Y85A 3W7RA 5LNUA 3LM3A 3M6YA 4TUFA 1CXHA 1E73M 3OVPA 1X7FA 1EUNA 2D73A 3EWYA 3R8HA 3QW4B 3CGBA 3AYTA 3QMRA 3N13A 2E6YA 1UASA 7CGTA 2PODA 1MWOA 2ISVA 4NJGA 4GY7A 3EEZA 3TQPA 4LRTA 1MW0A 5M5DA 4PTVA 1NFGA 3EZ4A 2BXZA 1WDSA 3UCDA 3BGAA 3NS1B 4ZBCA 2D3LA 1V77A 1VFUA 3IJ8A 5AHNA 3BLEA 1PAMA 3FA3A 3TA6A 2VR5A 2X0YA 4UTIA 3PPFA 1EOMA 2PI6A 1XH2A 3SCWA 3EANA 3W53A 3N12A 2ZX7A 4Z1BA 2BS9A 5EGRA 2YBTA 4TVCA 3H70A 4GIYA 3B05A 3B0UX 2X8GA 3IJQA 1B1YA 2KX9A 4LVAA 2ZRWA 3NQFA 2PLJA 1TELA 4U33A 1W9PA 3IJ9A 2E68A 3G1VA 2ZZ0A 3GHRA 5E70A 2J24A 4GRSA 1X1NA 3DHPA 4RXFA 4JKLA 4ERAA 2OEKA 3WNPA 4GVFA 2HVMA 3N34A 1TG7A 3S0CA 4MJ2A 1FCVA 3RCNA 1FWSA 1G7UA 3NRZB 4YTTA 1RSCA 1OGSA 5IBXC 1RBLA 2ZRYA 3CHVA 4E2OA 4Q8PA 4Q8TA 1QW8A 1ZENA 1YNYA 3RLGA 5TAOA 2NV2A 5D03A 1P0KA 3GB6A 3NG3A 3BANA 2GJLA 1PDYA 1TO3A 2ZADA 3AIEA 1RHCA 3TN3A 2BB0A 2HE8A 3UZXA 4CCDA 2EEXA 4FPSA 1UUOA 3V5CA 3K5XA 1NDWA 1Q6RA 1KTBA 2QJIA 2ZICA 4AYGA 2PTZA 3ME3A 4FNTA 4P8XA 1TZ7A 3OVGA 4AISA 4IISA 4CU6A 3S3GA 3QFWA 4F0HA 4QJ4B 1P0EA 1NWUA 2J79A 3EKGA 1YQZA 1I60A 5BOOA 3VD9A 2FVLA 1CGTA 1T5AA 2NQJA 1EDTA 4M56A 2BMBA 5D2TA 4XB3A 3WQ5A 1DYSA 2PDJA 3Q58A 4LAUA 1ZPTA 1OF6A 1VPYA 3VD3A 4B3KA 1H63A 3OYZA 2OQLA 1EIXA 4ZVJA 1OFBA 1J0HA 1MXSA 4AD3A 4PSPA 5KINA 2WMGA 1BAGA 1FHLA 2E0PA 2V67A 1EKOA 1VFMA 2WZEA 3BOLA 1N62C 3LHYA 1WPCA 4W87A 5IXEA 4H4IA 1KCLA 3LCLA 4F48A 4LS1A 3W4RA 3TJXA 1V6YA 5IHSA 2C18A 4QDMA 3K30A 2JK2A 3HV9A 1T7LA 3PTKA 1X6LA 4ILSA 5A3HA 1XYMA 2Y7EA 3AJXA 4CU7A 2E5BA 2WQPA 4JQ2A 2YAUA 3GNNA 5CJ5A 1GKQA 1G9HA 4H4SA