4DYEA

Crystal structure of an enolase (putative sugar isomerase, target efi-502095) from streptomyces coelicolor, no mg, ordered loop
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
376
structure length
376
Chain Sequence
MMKITDVDVWVVNLPLVNPFTSSFETKTGETRTVVRVRTDSGVEGWGETMWGAPVAAIVRRMAPDLIGTSPFALEAFHRKQHMVPFFYGYLGYAAIAAVDVACWDAMGKATGQSVTDLLGGAVRDEVPITALITRADAPGATPADLPKAMAEHAVRVVEEGGFDAVKLKGTTDCAGDVAILRAVREALPGVNLRVDPNAAWSVPDSVRAGIALEELDLEYLEDPCVGIEGMAQVKAKVRIPLCTNMCVVRFEDFAPAMRLNAVDVIHGDVYKWGGIAATKALAAHCETFGLGMNLHSGGELGIATAAHLAVVSSTPVLSRAIDSMYYLHADDIIEPLHLENGRLRVPSGPGLGVSVDEDKLRHYAGVNERDGDLTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords isomerase
publication title Crystal structure of an enolase (putative sugar isomerase, target efi-502095) from streptomyces coelicolor, no mg, ordered loop
rcsb
source organism Streptomyces coelicolor
molecule tags Isomerase
total genus 134
structure length 376
sequence length 376
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4dyeA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4dyeA01
1MUCA 4ENLA 3DFHA 2P8BA 3N4EA 4DX3A 1TZZA 1W6TA 4KPLA 3MKCA 3SBFA 3PWIA 3P3BA 5FJPA 3MZNA 3JZUA 1TKKA 3VCCA 2PPGA 3OW1A 1ONEA 4E8GA 3TJ4A 3SSZA 2QDDA 3CB3A 3I6TA 4HCHA 4DXKA 3IJIA 4IHCA 1F9CA 2PSNA 2QJJA 4EWJA 3Q4DA 4G7FA 3DDMA 3DGBA 3P93A 3SQSA 3Q45A 2PU0A 4HNCA 3D46A 4IP4A 4IT1A 3S47A 1EBHA 1MRAA 3TQPA 5BOFA 3FYYA 1FHUA 3UXLA 7ENLA 1SJBA 4F4RA 4J1OA 2XH7A 1R6WA 3V3WA 2XGZA 2HZGA 4GYPC 3MSYA 3DG6A 3R25A 2FKPA 5FJOA 3S5SA 4Z1YA 3R0UA 5FJRA 1E9IA 4H1ZA 3UCDA 3TWBA 3QKEA 3QLDA 1JPMA 2PTXA 2PGEA 3EEZA 3QTPA 3P0WA 3GO2A 3ES7A 5FJUA 4M6UA 2AKZA 3MY9A 1R0MA 3UJEA 3DIPA 4H83A 1EC7A 1SJDA 1MNSA 4IL2A 3GC2A 4K1WA 3FJ4A 3I4KA 1MDLA 3TOYA 3PFRA 1NELA 2HNEA 3B97A 3TJIA 3V5FA 4H2HA 3CXOA 2OPJA 3UJSA 3MUCA 3ZVIA 4HNLA 2OQYA 4MGGA 3T6CA 4GISA 4IZGA 3RR1A 1PDZA 3TW9A 2PODA 2MNRA 3UJFA 2PGWA 2ZC8A 1BKHA 2XH2A 4HCDA 4DHGA 2AL2B 2RDXA 2OFJA 4ZA0A 1KCZA 3SN1A 3UJ2A 2XH4A 3ZLHA 3U9IA 4Z17A 1OEPA 4A6GA 2HXUA 3IK4A 4FP1A 3BOXA 2QVHA 3U4FA 2PP3A 2FYMA 3H70A 3CYJA 1KKRA 4ROPA 3R11A 3TCSA 3NZGA 2GGIA 6ENLA 1JDFA 4MMWA 2PP0A 3VC5A 2AL1A 2I5QA 2GSHA 2PA6A 2P88A 3QN3A 4JHMA 3RCYA 2DW7A 2DW6A 3TWAA 2OKTA 3MQTA 1IYXA 3JW7A 2OVLA 1EC9A 4DN1A 4HN8A 4E5TA 4KT2A 3DG3A 3FV9A 3I6EA 3GD6A 3BSMA 4KEMA 3ENLA 4KWSA 3VC6A 3RO6A 3DERA 3ZLFA 1YEYA 3RRAA 1TE6A 4JN7A 2P8CA 3JVAA 5IDZA 2MUCA 3DG7A 3UXKA 2AL2A 2GDQA 1ELSA 2OZ8A 4E4UA 3SN4A 3FXGA 2XSXA 3SN0A 4GYPA 3H8AA 3T4WA 3TTEA 3NFUA 2PTYA 3DESA 3THUA 3H7VA 3ES8A 3NXLA 3IJLA 3GY1A 4JN8A 2OO6A 1DTNA 3RITA 4IP5A 1ECQA 1XS2A 2OLAA 4IL0A 3MWCA 4J3ZA 1XPYA 3DFYA 3N6HA 1KKOA 5J04A 2PS2A 1P43A 4HYRA 3R10A 3D47A 3K1GA 3NO1A 2QQ6A 4GMEA 3FCPA 1EBGA 3OTRA 3UCCA 2PTWA 1WUEA 1NU5A 3UGVA 3ZVHB 4A35A 2ZADA 3CT2A 3CK5A 2GGEA 2QGYA 4HPNA 4YWSA 4X2PA 4E6MA 3CAWA 3VA8A 2P3ZA 1EC8A 4GGBA 3ZLGA 3RGTA 3VDGA 2PTZA 4E4FA 1PDYA 3V5CA 3N4FA 3V4BA 3OP2A 3OZMA 2GGJA 4HCLA 4H19A 1SJAA 2GL5A 3H12A 1RVKA 2CHRA 4GGHA 1FHVA 2O56A 4DWDA 2GGGA 2ONEA 3HPFA 5EU9A 1WUFA 4MKSA 3VCNA 5ENLA 3FVDA 3VFCA 3PWGA 3IJQA 1BQGA 2PMQA 1MDRA 3OZYA 5BOEA 2AKMA 2OX4A 2PU1A 2POZA 4FI4A 5FJTA 3QPEA 3PK7A 3DEQA 3R0KA 2QJMA 3T9PA 4A3RA 2HXTA 3KUMA 1JPDX 3SJNA 2GGHA 4G8TA 4M0XA 2PCEA 4GIRA 1KD0A 3R1ZA 4DYEA 3ZVHA 2QJNA 3EKGA 1P48A 2OG9A 2XH0A 4ZCWA 3N6JA 4K2SA 3BJSA 3UJRA 2QDEA 2PP1A 2P0IA 3T8QA 2NQLA 3OPSA 2OZ3A 3STPA 1L8PA 2OZTA 4K8GA 1JCTA 1SJCA 4GFIA 2OQHA
chains in the Genus database with same CATH superfamily
3QVQA 1WZMA 1YQ2A 3BSGA 2YDRA 1YNPA 2XM1A 4J2PA 3URQA 1A3HA 1Y5WA 4D6IA 3CC1A 3UZYA 3DOPA 4FLQA 5IFPA 1B3ZA 2FMOA 1TV5A 3FGCA 4EIVA 1E5JA 4ZTYA 5HMSA 3TUUA 2E8YA 1XYZA 3H4GA 4JIQA 1E4MM 1F9CA 1OFDA 1FH7A 4CQBA 2WC7A 5H91A 1OCJA 4ML4A 1JZ3A 4JR5A 4RE3A 2X1RA 4JCLA 3ABZA 1JCNA 4J35A 6REQA 3AFBA 5FOOA 3B8UA 2YL6A 3KX6A 4DJEA 3D9XA 2WHMA 3CZKA 3I6RA 1XYFA 3W1AA 4IP4A 2AQVA 4I9AA 4FNSA 3M5VA 4HNNA 1E1CB 1UR0A 4P7LA 2FVKA 1K7FA 4AQLA 3A4AA 4PRRA 1AFSA 1TR1A 2G95A 5CC3A 1XDJA 4XZHA 3C2RA 1A3WA 1SQ7A 1PUDA 2FKPA 2WMKA 4H1ZA 4PR4A 4EK7A 2HQAA 3CMJA 1IZCA 2BXYA 1XRFA 2W4XA 2D24A 2Q8LA 5LIYX 1V3LA 2DZSA 4NX5A 2V3FA 4DPPA 1GOIA 1XLGA 3A23A 5JUVA 2QUTA 1ADOA 1S2VA 3LU2A 5AHLA 2ZOXA 3BGJA 1NAL1 1JR1A 2VQTA 2EQ8A 5FS8A 3SR7A 4F0RA 2XWEA 3P62A 4QE1A 2QHAA 1F7BA 3EBVA 4LYPA 1J0KA 5FI8A 4HSOA 2Z1KA 3G1DA 1EX1A 3W82A 1HL2A 3GTNA 3D3AA 5I3HA 3M0VA 2RDTA 3EPNA 1ZBCA 3PG8A 2RFGA 2YVGA 4GISA 2ALDA 4XTDA 3TSBA 3II1A 1NHSA 2OKOA 2CWXA 5HMEA 5M1TA 4JX4A 1XGDA 2E6FA 2FH8A 4WUIA 1G4PA 4Z1DA 3SCOA 2FTWA 4QAIA 3RM4A 3CL7A 1G4TA 1WKYA 2J9YA 4NUWA 1KBIA 3S1VA 2QR6A 3S46A 2QCDB 4RW3A 1VPXA 2SFPA 2ZBTA 3RDKA 3W87A 3HMCA 3W7KA 2OR2A 3U2EA 1XHCA 1VC4A 5A3HA 3ABSA 4XUYA 3CZEA 2BP1A 5EL1A 4I6VA 2QCEA 2XDFA 3IACA 2VGIA 1UROA 3AMKA 1BYBA 4XAFA 3DFPA 5HA7A 3WBXA 2VC7A 2QZRA 3N3TA 1R85A 1WXYA 1OK4A 1ZGDA 2WAGA 4EOUA 5BXPA 3I3DA 5E0FA 3INPA 1J0ZA 1HJQA 3NQEA 5ABFB 3I7QA 2V38A 3UR2A 2PDNA 3UNDA 4UZSA 2W79A 4LWWA 3U6WA 4QJ5B 1M6IA 2QYGA 3NQ2A 3F2CA 1B1YA 1CPUA 3RPTA 1C92A 3TWAA 4AIBA 4QXIA 1CXIA 1VBUA 1YNQA 2WSYA 2ZRXA 4KIEA 3BMXA 2W55A 3WF0A 4FHAA 3ALFA 4GLEA 1S2WA 5FD0A 4KWWA 4ICCX 1LZOA 4E8CA 1WE5A 1PHQA 2UV8G 3UWQA 5D2VA 1TE6A 2WHJA 1O12A 3LXAA 1P4CA 4JY9A 5JCNA 1KWKA 2J88A 4BQ2A 1GW9A 5J8LA 3BG9A 1QO5A 3ORWA 4QFUA 3MO4A 3VIMA 4N9CA 4Q32A 3GX9A 1EEPA 1K6AA 1Q2RA 5EKYA 3BANA 3VNIA 3VIPA 2VWTA 2J3NA 4PRWA 4K7ZA 1U5JA 2VR4A 1XIHA 2DJXA 3VK5A 2HQMA 4GUHA 2RGLA 4UQEA 4DF1A 3EEGA 1T0OA 3GG7A 2Z00A 3LB8A 1E9YB 1KB3A 1UD4A 3LV5A 4J2MA 5LIUX 2GJRA 4EPDC 4TX6A 3NOYA 4K37A 2X40A 3GH7A 4J3ZA 4JN6A 2DH3A 5EB8A 3O6DA 4Z0JA 4K3ZA 2F9RA 2ZZ7A 5U1OA 1CXEA 2QQ6A 1EXPA 3ICJA 3NEVA 4O19A 5FEPA 3FG2P 4Q8WA 3MVIA 1ZAHA 4GACA 2PDLA 1P6BA 5C9UA 2QGHA 3LRKA 4HPNA 5IBXA 1G7UA 4J40A 1Q6QA 4S2BA 4MTVA 4S1FA 3BCFA 3O0FA 1GOOA 4ZO8A 5M3WA 3ZLGA 3EF6A 3C86A 1F61A 4LY8A 1DORA 3W23A 2FTYA 5MF5A 3MYOA 3WH6A 2W0UA 1D7YA 5E9AA 1WO2A 4PSPA 4FAMA 3WQVA 1UUMA 2G50A 4JTDA 1FHVA 5H6HA 4DWDA 3ZYZA 3UWEA 1JPHA 1H0IA 4KEVA 1AK5A 1Q65A 2YR1A 3VCNA 3CGEA 5C8BB 2XVPA 5ENLA 1DKWA 4YCOA 2VR5A 1CECA 1KM1A 1LDCA 2PWFA 2ZXAA 3FGCB 4HMEA 4ZO7A 4LY4A 1ME9A 4MWAE 2PMQA 2FZ9A 1NDZA 1UMLA 2J6VA 4D2JA 5C71A 4CGTA 3ARRA 2E25A 2NUWA 3IRSA 2WZHA 2QCFA 6REQB 3T44A 1TX0A 3N4AA 2PZNA 1R9ZA 4GI9A 2XIMA 3M0HA 4DJFA 3HV9A 3NM1A 3WLNA 2FGBA 3MSDA 1V0NA 4NVTA 4JS3A 1P48A 2EG6A 2Z6JA 4AXKA 3R8HA 3HQOA 1LOLA 1A5SA 1MMFA 3EX1A 3LDVA 3G6LA 3BJSA 4WGHA 3N29A 5CLWA 2R9RA 1OGBA 1KCKA 3W84A 3BW4A 1GKQA 1L8PA 3NGFA 1OQFA 2UY5A 3EA3A 3P7YA 3VKKA 2GPTA 1AW2A 1NFPA 3TYZA 2QJGA 5GPRA 1GNXA 2ZUSA 2AAQA 1FWSA 4TU1A 4UTTC 3NG3A 3CLWA 2DGAA 3S1XA 3NVVB 3C52A 2VNCA 1BSIA 4C5ZA 4I5UA 4GPNA 4H9XA 4CQ8A 2EKGA 4LAMA 1SR0A 1CGVA 2FVMA 2R94A 1U22A 4Q4SA 2OO0A 2Y70A 3FA3A 4LVDA 1UYQA 3APTA 4B90A 4ZB0A 5G2WA 1V7YA 1ADDA 4IMAA 3LGGA 2REQA 1FWRA 3AZSA 3SQPA 4Z1CA 3HM7A 1X2HA 1R86A 2Y0FA 3FYYA 4UTWC 1W9DM 2XTKA 7ENLA 1H49A 1TG7A 2YA1A 3TC6A 3G0XA 3T0CA 3HURA 4PFHA 4HGXA 3PPGA 5I23A 1JXJA 4CCZA 2WCAA 4FLRA 1B31A 4G5DA 3TWBA 3Q58A 1A4MA 3N11A 5FESA 1BG4A 4GJIA 4W8BA 3M16A 2PGEA 3STEA 4NZJA 1DWAM 3ITGA 4MYXA 3W7NA 5CAKA 2DIJA 2A79A 3LQLA 3W25A 3B9OA 4DVOA 2EPHA 3WF2A 1JPIA 4DLMA 2Y7FA 4WOQA 4LU0A 3GSMA 3OZOA 1XLKA 3GTXA 4WJEA 3QBUA 2D1ZA 2W27A 1J6PA 1UD2A 4JZ5A 3P84A 4GR1A 3W7JA 2OYLA 2OB3A 4IICA 1F05A 2Y4SA 3ZVIA 3VDBA 3ITLA 1QW9A 4O11A 3GD4A 1W9UA 4EXQA 3TW9A 1XANA 1FO4A 3UJFA 3VXGA 2XGIA 3NTYA 2BHZA 4H7VA 3K8LA 4CNSA 2BHUA 3W88A 4FO4A 2YFNA 1HJXA 1MW2A 3ELFA 1YHTA 2ACUA 3ZM8A 2A7PA 3GKFA 1H7NA 5AYYA 2RGMA 3RR4A 1LOQA 3ITCA 1QBAA 2VZTA 1JCXA 2E3ZA 1VQTA 1W3JA 2ZDSA 2PZ0A 4GKTA 1PX3A 1YDOA 3GNDA 4UFMA 3O6YX 2ZZ0A 2J7DA 5JIPA 4GH3A 5ABTA 4AYGA 1LJYA 2C3ZA 3I7RA 4XBJA 3SGGA 1W1PA 4IJCA 3F5KA 1EHNA 2GGIA 4W88A 2VI0A 3KCLA 1V0LA 1ZHAA 3UD6A 3AZTA 3IIVA 1TUFA 2HVMA 1PX4A 4CNTA 3AOFA 2I5QA 2V5LA 3V16A 1HO1A 2V68A 4IIBA 4JHMA 2F6UA 1CXHA 1B9ZA 4IH3A 4X9YA 1OSEA 3W01A 2DZUA 1H2JA 1VFUA 4O10A 3EXTA 1O6IA 2XIIA 2A7NA 2GJLA 4BA0A 1LT7A 2VKZG 3PZGA 2YZRA 5E09A 5GVJA 3FV9A 1H63A 2BSLA 2CIPA 1ALDA 3ENLA 2GSEA 3KHJA 1X1NA 5FKYA 1OJXA 4X3ZA 5JH1A 1I2RA 5KTLA 5CZ0A 1FWNA 4CQAA 1NDAA 3KS5A 3SFWA 2OYMA 2OTDA 1TJ1A 3QQ0A 3R4IA 2ZRUA 3THUA 3LENA 4ZTXA 1DJHA 4XZ9A 5BRQA 3AIQA 3B9NA 1YXCA 3LCGA 2BC1A 4AW7A 3WMLA 4GRTA 3H2MA 4HKPA 3B03A 5C5YA 2Z26A 6TAAA 1K7EA 2BVYA 5A2BA 1UD3A 1TE1A 1HFBA 4IQDA 4LUSA 3TV8A 4FXRA 3FN9A 2OWWA 2EPNA 1OM0A 2EGZA 4ADWA 3UGVA 2G4FA 4A35A 2GQ3A 1ME7A 3EUB3 2GGEA 3GFZA 2J25A 2J7FA 5BNKA 3A64A 2Z25A 1IEVA 3AJXA 5D2WA 4M8UA 1EL3A 3TN3A 2OSYA 2VWSA 1F4AA 5HANA 1UR9A 4LC6A 4X0NA 3W7QA 1IXOA 2XHYA 3TTYA 2BVTA 1FCVA 2E67A 3CEPA 3NCOA 3EA1A 3TA9A 4K8HA 2HS6A 1S2CA 3QV8A 2QAEA 3WKZA 4D6FA 5AKQA 4DI8A 3AUJA 4KKXA 3W1RA 2F6KA 4NZ3A 4R7OA 3P0XA 5EPDA 4EMIA 5JVLA 2DSKA 3M07A 3ZS4A 3KOWA 2E3TA 1XISA 4MG4A 3QPEA 4H6KA 5CZTA 1HZYA 3IEBA 3NQCA 5F4XA 1J96A 1GONA 4XO7A 4E4PA 1UC4A 4MB5A 3EOLA 2IXUA 4UQAA 4AD1A 1G0CA 2REQB 1AD1A 3WQFA 3WUBA 5HWNA 3NVTA 3VUPA 2QJNA 4ROQA 3F4VA 2CITA 4TVDA 5HNNA 1E6QM 1OZQA 1G67A 4LOCA 3G1SA 3M0IA 4WY0A 4RE2A 2ZZ3A 1ZBKA 2WMIA 3S4TA 2CLKA 2EG7A 4HZ7A 3OIXA 3R94A 3BZJA 3MHUA 3DHPA 3PAOA 3CIVA 3A7UA 1XLBA 1OABA 3LPOA 2E6DA 4JL2A 1NPXA 4ZL1A 1AQMA 3CV7A 2F6XA 4ADSA 2EEXA 3PWIA 4ERGA 1XDLA 3PUEA 1FFVC 3L4UA 4J56A 5A95A 3SRDA 1ICSA 4G1KA 4P7RA 5G4HC 3GW3A 1U5VA 3GXIA 2ZRWA 4EQWA 4G7EA 4MJZA 5HR6A 1DJNA 3M43A 2PSNA 5C70A 1NQ6A 4UOZA 1I0DA 1PIGA 4Q4KA 1P0KA 3P93A 2ZZCA 3M41A 5CZSA 4ICNA 2GK1A 3F5LA 2D0GA 1WPCA 3VM7A 4HNOA 4AHOA 3VNKA 3FK4A 4M6VA 3QQWA 3RLUA 1HKIA 2JIEA 1FHUA 3M5YA 3ATZA 3NZRA 4CNOA 2HS8A 5HNRA 2NUXA 1TUXA 3V3WA 1N63C 3WNLA 2GVLA 1BPLB 1LQ2A 3A6OA 3L68A 1XIGA 1SZRA 1GVYA 4XV0A 3M7SA 1J0JA 3HA1A 2J66A 3S2LA 3TLQA 1PTAA 1I2QA 4QQUA 3BWWA 2X1SA 3CTLA 3GIPA 1X97A 5AC5A 3W7RA 3W86A 1S5MA 2Z1VA 3TNOA 1R0MA 2YJQA 4C6IA 1YNYA 3B3DA 2R14A 5CH9A 4BFAA 1P1XA 2XPKA 3T0DA 3ARXA 4JCMA 2FH6A 4TX8A 1UHVA 3I65A 3I4EA 5LIWX 5I3JA 2VEMA 4CEXC 2W6RA 5TD4A 2BOEX 2QPSA 4WVXA 1V6YA 3QFEA 1O60A 1WKFA 1M7XA 3AROA 4MY9A 2GUBA 1GPWA 3FYPA 8RUCA 2V30A 3EYPA 4HMCA 2VOTA 2WBKA 1KCXA 1YMYA 2CBJA 3UBPC 4RE4A 4FEZA 5I6SA 2D73A 2R1NA 2ZUNA 5U7SA 4OU1A 1A5MC 3GC4A 3CGCA 3W07A 1KC7A 4D6JA 1O1ZA 3S83A 3THAA 4Y8FA 4L6OA 3U9IA 3GUWA 4UZUA 2XN0A 1NOFA 4GYFA 2GJPA 3RHGA 1ZFJA 1A5CA 2VX4A 1PWMA 3C0SA 1XYCA 1J2WA 1VKFA 4JOMA 2WPEA 3S5NA 2HPMA 3UR8A 1P7TA 4Q8VA 4O1DA 4LUSB 3BLFA 2QULA 3V36A 3UG3A 5I24A 1J01A 3B8WA 3TR2A 1N8FA 3E2QA 4KCUA 1Q6OA 2FDMA 3TROA 5DT7A 2ABBA 1T3QC 4F2UA 5IFTA 3GVGA 1MEHA 1Y5XA 3DX5A 3W2MA 1O5QA 3LD5A 3BGAA 1XLEA 1GYNA 4IF2A 2QIWA 4NXSA 5A8GA 3ERPA 3RO8A 3LCLA 1H62A 1T7LA 3GAKA 5A5WA 2X30A 1IEXA 3KXQA 3WYZA 4KEMA 2HBVA 4GQRA 2FFCA 5E5CA 4N6FA 3RO6A 2BY1A 2V8ZA 2A8XA 5FL1A 2MUCA 2HRWA 2WCGA 1GOQA 2A6NA 5I3FA 3SN4A 4PUWA 2I1OA 4MNMA 4BF5A 1IWAA 4PMVA 3GVVA 5FL0A 1DJWA 3QPYA 4N6EA 1UMYA 1PTDA 1HL8A 5AVHA 3H4XA 2PF8A 1FTXA 4JN8A 4A8LA 3MB9A 1EPVA 4BQ5A 2BY3A 2G5WA 3UZXA 4DIAA 1UOKA 3PR2A 3BE7A 3W02A 1E0WA 1MWOA 1XUUA 2DV0A 3ARTA 3W2NA 4OWGA 1WDWA 1M5WA 1P43A 3R10A 3FCPA 2ZZ2A 3U7BA 4DJEC 4W89A 1G01A 2DSVA 3M0MA 4QLKA 1J10A 1V7AA 2X0YA 4QJ3B 1MQRA 4PMUA 1AJ2A 1YE4A 2DIEA 3B9JB 4E6MA 4OIFA 3DYMA 1FY6A 3W2KA 1GZJA 5G5HB 2EHHA 1J5SA 2YFOA 4O16A 2P3ZA 1QCWA 2BVDA 4LS2A 1ZAJA 4WXZA 3R89A 3APYA 3W73A 1Q66A 2ZA1A 3RGTA 4WY0B 2VOMA 3GIQA 3TLLA 2XISA 8TIMA 3KBWA 4Q8TA 2WMIB 1RK5A 2EO7A 1E1EA 1WDPA 2D22A 3PULA 4UTMA 1Q8JA 1EYEA 5KINA 3LSCA 4QS6A 3KLJA 4L56A 4UQBA 1ZUAX 4IIFA 4B3ZA 1O5RA 3U57A 1HT6A 3MMTA 3CNYA 5T9BG 5I07A 1XBYA 2P5NA 1I0BA 3PBYA 2VFEA 1ZAIA 3KCJA 1DWJM 4MUZA 4G7EB 1V4YA 5I3KA 2QMJA 4BF9A 3VAVA 4AFYA 3LLDA 3DH7A 1OFRA 4FI4A 3PPHA 1SPQA 4HTBA 1J5TA 5LA2A 1GGOA 4NJIA 4HA1A 4FPSA 4G1NA 4MUPA 2QVNA 5DCEA 3SDOA 2BC0A 2GK1B 2UWFA 4EQXA 3MUAA 3P6LA 5AY7A 5F1VA 4MAVA 2P3EA 4NAFA 1HKMA 3FLUA 5FCZA 1C7SA 1TMHA 1PKYA 3CYVA 4V1YA 2HJPA 5BU9A 3N6JA 3SIMA 1DJIA 2VRQA 5DMNA 3N25A 4M7SA 2C79A 5D8ZA 3CZJA 1TJ2A 4JTEA 3H53A 4DXXA 2Z1BA 2OZ3A 2BXVA 4K8GA 1F6PA 5HWJA 1IXQA 1K1DA 1KLYA 5CG7A 5A6JA 3STCA 3ETRB 1PEZA 3LZ5A 3BLKA 7TIMA 3IGXA 3RK8A 2BMBA 5KZDA 4NJHA 3PB2A 3PG6A 1HXJA 2ON3A 3MKCA 2EBNA 2WJZA 1BLIA 1C9DA 2CNCA 3FY1A 3T55A 1JYXA 1TWSA 4HMNA 3QXBA 5HATA 4PUUA 1G1YA 1UB3A 5I78A 3SRHA 4GX9A 4JTHA 4I5XA 3TYAA 3VOCA 1GVQA 4PL2A 1R5YA 2PAJA 4EAYA 4WDTA 2R8WA 4O12A 1HKJA 4JQAA 4OV4A 3QYSA 3P14A 4HNCA 3D46A 3USZA 4EF9A 1GZ1A 1CBGA 3N2OA 2CZDA 4HHLA 4WGXA 4F4RA 4X9SA 5HXMA 5AOUA 3UW6A 1WOAA 1WZAA 1XCFA 3FSUA 4O28A 1TYTA 4QJ1A 1JD9A 1V6TA 3FJLA 1XKJA 4DEFA 2W91A 3TOPA 1HNYA 2QV5A 4LCRA 4TTUA 4LTSA 4B2DD 4Y2WA 3QKEA 2P0OA 3HRDC 5FF0A 4GZ7A 1THFD 1FWHC 3NO5A 2ZRZA 3NAVA 4M6UA 3GWQA 1P7TB 4B5TA 4UTHA 2W3SA 1EC7A 3NRZB 3WBWA 2X1IA 3MDUA 1RAKA 2GR0A 3G18A 1PZ2A 1MFUA 1QNQA 4HBKA 4O53A 4IPIA 1FCBA 3B97A 3TJIA 1X7IA 4PMXA 1T99A 5K7JA 2F2KA 1V59A 4Z42C 2OPJA 2WPFA 3GQYA 1X6LA 4GI4A 5IBXC 3L2LA 3AHXA 3QHMA 4NASA 1UR4A 3OLIA 2QW5A 3AISA 3T6CA 4Z2GA 1FCQA 1WKEA 2FZBA 1XH1A 4WK9A 3IAPA 4IZGA 4C6NA 3GUGA 3O05A 3RILA 2MNRA 2FGZA 1IT7A 1SZGA 4XTIA 2NVCA 2H90A 2WHKA 1A50A 1PPIA 1ZP4A 5FACA 3SAZA 3LRLA 4KH2A 4BURA 4PMQA 1GG0A 2A1YA 3QW3A 3SURA 4BI6A 2O9TA 2HISA 3UPMA 1TWDA 3R43A 1ONRA 4H6QA 3G3MA 4HQVA 3MP5A 5LIXX 4LAZA 2HE5A 2FB2A 1KKRA 3BG5A 1ZMDA 4XAPA 1CGTA 1C8QA 1MEIA 3GBEA 3NZGA 4RXFA 1O5KA 3GHSA 4JTRA 4F2BA 1ZSXA 1X38A 3MUIA 3ATYA 2JF7A 4RDVA 1ODUA 4FXSA 4A22A 1TR9A 3DFQA 5CBBA 3MMWA 1FHLA 1HKKA 4CCEA 4M56A 3CMGA 4DNMA 1IXPA 2ICSA 3IVUA 4L7ZA 2WVSA 3SQLA 2PDJA 1IYXA 4REQA 4ASTA 3USBA 5JXQA 1UW9A 2YVFA 1L6FA 3TN4A 4KT2A 4J3SA 4K38A 4YLWA 5A6LA 4GZJA 4FXFA 1Y5VA 2X7WA 3W0KA 2P8CA 3NPXA 3D3FA 3O6AA 4YVXA 1XIMA 3JVAA 1NP0A 1C7TA 3XINA 4O0KA 2IPJA 1X6UA 1XICA 3PNUA 1AJZA 4Y6GA 5I0DA 1VRDA 4GYPA 4DWSC 2VCAA 1RBOB 4QE4A 2RKXA 1DQWA 4C6FA 2XN1A 1LG2A 3EX6A 3H2OA 3I3EA 2WW5A 3NQBA 1K7XA 3ZIZA 1XLFA 1FA2A 3F2DA 3IUHA 3K2GA 4OFCA 4GY1A 2C0AA 1H51A 3AIBA 4IISA 5I06A 2CCRA 3AS3A 3A21A 2GUUA 1M41A 1JD7A 1TJRA 1XJBA 3BLIA 2G3IA 4GZEA 1Q1RA 1FECA 3N6HA 3TTOA 5KZ6A 5J04A 3NR0A 3IVSA 3UCCA 2XVNA 3AXIA 5C6MA 6A3HA 1HL9A 5BRPA 5HDRA 4O8AA 4NAFB 4D6CA 3BL3A 3W76A 4JKMA 2QGYA 4N02A 3ZT7A 1CX9A 5HMFA 3KM8A 5HINA 2Z7GA 3IIXA 2VL4A 4LV4A 4NNAA 5EBUA 3VNZA 2IXVA 4H9UA 2E6AA 4JTCA 2Y7DA 4ZSUA 5IHSA 2NQ9A 3L5LA 1TTIA 2WC4A 2RAGA 3AM9A 2L5HA 1AA1B 2VX6A 1V02E 3OZMA 4ZXOA 1H7WA 2NXIA 9RUBA 3PZNA 4UTJA 3R07C 5I5RA 1RVKA 2A3BA 3SUVA 2E5BA 3CBWA 2C0HA 1UD6A 2A4AA 2VR2A 1GUVA 3UY8A 1J0IA 1KXHA 3NQDA 3JZEA 4E2VA 3RYSA 2V2CA 4KGJA 3WDJA 3OZYA 2FMNA 4PMRA 4L9ZA 5T8GA 4G56A 2AKMA 3KVKA 1XSJA 5FJTA 3MPGA 4PCNA 3HOJA 5DLCA 2OWCA 4R53A 2PRHA 1NWTA 4AD0A 1G9HA 3E74A 2E9BA 4HNTA 1JUKA 1UBSA 1SM9A 4GIRA 3H7RA 1UA7A 2WXDM 1WAWA 2ZTKA 4AEEA 1OIMA 4GG9A 3FXYA 1XG4A 4JDYA 2HE8A 4KETA 1AMKA 3O9NA 4KRTA 1EX5A 1UD5A 2CKRA 3GDBA 1L2UA 1Q63A 1ENUA 4NAEA 5DMMA 4A8RA 1XH2A 3GYEA 1DTUA 1F3WA 1I1XA 1QPKA 5LNVA 4WXYA 4DAFA 4QHRA 1TKKA 1FWFC 4L4LA 3A13A 2WKLA 3AZRA 4NI3A 1KGWA 3UXDA 1IEQA 3RCNA 3ABOA 1ZQ5A 2DP3A 4QITA 4W9TA 3GXPA 1HTIA 4DXKA 4MJMA 3OQ8A 2Y8VA 4GC4A 1QT1A 1SO5A 2PDIA 3O2LA 1R47A 5DRCA 2A3CA 2WM1A 3UA3A 3DDMA 3DGBA 5H2ZA 1UUOA 2WOIA 1R7AA 1K9TA 4JTLA 3TX9A 4WDWA 3S42A 1XR2A 7REQA 5D9OA 4NKCA 2GSJA 1F8WA 2Z2BA 3EAOA 2QV4A 3GXTA 4UQCA 1FDZA 2Z29A 1IV8A 1XIIA 4M6QA 1ITXA 3RJYA 3E0WA 1AL7A 1ZBVA 2JEPA 2OGYA 3U7VA 2E1DA 1H1ZA 4HK5A 2W9MA 3C0JA 3PZOA 3S2NA 2BY0A 5H8MA 1RY8A 4QX4A 5BU6A 1OX6A 1PKLA 4BCEA 4LXFA 1GTHA 1PCKA 4ML9A 5I02A 1E4LA 3NO3A 3ZOAA 4MY8A 5HOSA 3BTNA 4IX0A 3QC3A 3DGRA 1MNSA 4ONVA 4HZ8A 1M9HA 3KFTA 5DMYA 3PFRA 3PVFA 2FHCA 1XH0A 3A5VA 3HJZA 1XLCA 4AVFA 3F2BA 2CZFA 1GCYA 1RR2A 1FVPA 3CZ8A 4DO4A 2X0SA 4ATDA 3HQNA 4REQB 3NM3A 3UYIA 4OTKA 5D04C 1T5AA 3NUKA 4P8XA 1PX8A 2VCCA 4OZOA 3UP8A 6TIMA 2J47A 4JTUA 3VPLA 1OCQA 3P61A 3EANA 2PUZA 3BGGA 3GVWA 3VOJA 3WQPA 3T2PA 4HCDA 5A6TC 1EDTA 4GH1A 3TVAA 4JFTA 2X2GA 4MWAD 5CC5A 3R13A 4IMEA 1ZCCA 3VNLA 4PSRA 2IKIA 2D2OA 2GJXA 1UASA 1K9FA 4AG0A 3BLDA 4NZ4A 3WFZA 1LL7A 1EZWA 1H61A 2ISDA 2O9RA 3RIKA 3WFAA 2WB5A 4X61A 5E9XA 3VE9A 4H8VA 5CJ5A 1QRQA 1CDGA 3Q67A 2V3DA 3OQEA 4TO8A 1BAGA 4KIRA 2VELA 1JDFA 2GQAA 4ZR8A 1EEXA 4HJFA 2WQDA 4C6BA 4BEUA 4IPLA 1UWTA 4J3UA 3M0LA 3OVQA 5A6MA 1AVAA 4FZIA 3CO8A 4H04A 1KM6A 3L21A 3RCYA 4YYFA 1E43A 2QDHA 4HU3A 1R2RA 1CXLA 1ZZMA 1GG1A 2VEKA 2DT2A 3TZFA 1SO4A 4HHHA 4OGZA 3QC0A 2ZUVA 4RKAA 4IFKA 4B2DA 3DG7A 3HGOA 3AO0A 1GRAA 2HK0A 2X8CA 3QW4B 4IQJA 3MMDA 4W8LA 1H11A 3VD5A 3CH9A 1BYAA 1REQA 2Y88A 3KDOA 4QLLA 2Y6ZA 4ZSTA 1E40A 1ZY8A 3B9AA 1DL3A 1TPB1 1PJ9A 5F4WA 1HN1A 1WDSA 2DIKA 3SW6A 1W5OA 4L80A 4TTGA 2Q71A 2PD5A 3NQMA 3A24A 3CUZA 1O68A 3SRFA 1E1FA 1OFPA 5ABGA 3MCNA 3AYRA 1LL4A 3TYUA 2C8NA 5D37A 3UETA 2B7OA 3LCXA 3U2ZA 4F8XA 3BAIA 3VINA 4WF7A 4UCGA 4ATWA 2PWDA 3HPSA 1N8WA 5G5IA 4O50A 1B3OA 3QR1A 4B5VA 4PRTA 4GGBA 7CGTA 2DSUA 1Z6KA 3MYPA 3SR6B 3OLDA 3B8SA 4Q4MA 3V4BA 2VEIA 3N17A 3T08A 3LNPA 2I14A 4NAEB 3UG5A 3ITVA 4TMCA 4UB9A 2F84A 3KBNA 2C6QA 1XSKA 5AB3A 2CHRA 3AMZA 4FNTA 5IOBA 2YAUA 3VNMA 3NDYA 3S2JA 4DZHA 3Q94A 1V0KA 4OOUA 3SADA 2Z1SA 3OYXA 5C2GA 2R1MA 4PODA 1BQGA 1K4HA 1MDRA 1O95A 3KVJA 1M3UA 3NL5A 4DJDA 1PHWA 4NRSA 1SO6A 4GRSA 1TA3A 2I17A 4AZCA 2DORA 4PB4A 2CBIA 4BJHA 3R0KA 3SJNA 4MNKA 3U4AA 7REQB 5HWMA 3M9YA 3RMEA 3II4A 1JRBA 4WSKA 5G4EA 2XM2A 1JQVA 2GR3A 3CQKA 1XFBA 2AAMA 2AMXA 1B3VA 1ZJBA 5I09A 2HPIA 3W2LA 1EH9A 4DBWA 4YCPA 3AUOA 4Q8NA 1GHRA 2CETA 3NJ3A 2ZQ0A 4FALA 2ZXDA 1ZJIA 1DXEA 3DUGA 2VDHA 4IIGA 1VH7A 1K4GA 1EPXA 4GVHA 3S6OA 3GTHA 1MUCA 4HHMA 1UR8A 3THCA 3WF1A 2F38A 4B15A 3FS2A 1W6TA 1L8NA 4ZFMA 3O3RA 4S3EA 3MZNA 2XIJA 4IGHA 3VCCA 3LQGA 4GVFA 3AIUA 4E8GA 3HG3A 3S9ZA 3MUY1 1BQCA 3WO8A 4RNHA 2QDDA 1K3UA 3BJFA 5FSEC 4FX6M 4YTUA 2QJJA 1WZLA 3BICA 5L6UA 3T09A 4QG8A 1UH3A 3ZMRA 4HJWA 3SCPA 3VD9A 3B0VC 5EBAA 2DZPA 3OVGA 1OT2A 4C6KA 2R24A 2VEFA 3OG2A 4IQLA 5AHIA 5BOFA 3KLLA 4FDCB 4MVAA 1SJBA 3KL3A 2DVTA 4PULA 2A6LA 3WY1A 3WEMA 2DT3A 1JOAA 2GJXB 2GQWA 3QHOA 5AVNA 1D7FA 1MI3A 3LMZA 5FJOA 3S5SA 5DY2A 3QTGA 2BODX 2X0HA 2FZDA 1V93A 1W32A 2BOFX 3G1XA 1OD8A 4E8DA 2GDUA 3B05A 3N18A 1BF6A 1W9BM 3CXBA 1JPMA 3BXWA 4F48A 8CGTA 3SCVA 3EPMA 2CLOA 2XFYA 2V63A 4S23A 1GZGA 3H2CA 4L9XA 4H8HA 4GQQA 2CYGA 1QI3A 3UGRA 3PBWA 2IKHA 2QPXA 4C6QA 3A4XA 1F73A 1C91A 1LL6A 4K7YA 3GNPA 4O54A 3GH5A 1F76A 2FZMA 4FX9A 4JNZA 2CFYA 2ZX5A 2E5AA 4K8DA 4N9EA 2R1LA 2D20A 2ODOA 2J27A 3PB0A 4HB7A 1JJKA 2WSPA 5T91A 4UR8A 2E5DA 4I8DA 3KEHA 3ZFHA 1DPMA 3OVRA 4IFKB 4Y9AA 2OXNA 2C3DA 1HJWA 4N2YA 4Z2LA 5FAJA 1TTJA 3SN1A 4FMVA 4IM4A 2CLHA 3WJZA 1H7RA 1Q6RA 1REQB 2OELA 2HXUA 1J2BA 2IS7A 3IK4A 4AY8A 1ISWA 4FP1A 1YTEA 3W3OA 3LA4A 4QS5A 4DNAA 2FQIA 1JEZA 4E38A 2QVHA 5AZ1A 1IEIA 4JIHA 1F07A 1EO7A 2OLHA 1PO9A 3CL6A 2I7GA 1BTMA 4EM3A 4OBRA 3GU2A 2MANA 1U30A 6ENLA 2V5CA 1KR1A 5BXTA 1ME8A 3G5EA 3B9EA 3L0NA 3W71A 1W2PA 3AXKA 2PC8A 4P5UA 1W2VA 4JIEA 2P88A 3IIOA 3BV4A 3EMQA 4EVZA 4KWUA 4GO8A 2J24A 1KCLA 2HVOA 1DEDA 3EDDA 1EB3A 1AW5A 1HKVA 2OEKA 1ZL1A 2Q6ZA 1EC9A 5KEZA 4I9JA 4W7VA 9XIAA 1DXIA 2RABA 3WZ0E 3ZJKA 1W1ZA 2CKSA 2RH9A 3P82A 5CKSA 2VUYA 3VC6A 3A47A 3RRAA 1X1ZA 2C3CA 1M7JA 1R2SA 1WDRA 3CASA 4K36A 5IDZA 1U1JA 4LRTA 3AIVA 3LHWA 2Q8XA 3GM8A 4CD5A 4DUOA 5FF3A 1KTNA 4H9YA 2TAAA 4F79A 1GQIA 3WD4A 1MSSA 2GLKA 3NXLA 1XPGA 5E0CA 3DK8A 1A5UA 1LF1A 2O0TA 1DTNA 3K8KA 3RITA 4NSBA 1NF7A 1MW1A 1S38A 5C2CA 2QT3A 1TA3B 2X09A 2NQJA 4AZCB 1H1YA 4J3XA 1OJTA 1EIBA 1XPYA 5I00A 1JCLA 3TN5A 1J18A 4P7QA 2PS2A 1Q85A 3D47A 1CGYA 2PCQA 1QI4A 4CLMA 5A6KA 2XJ7A 1UUQA 1CGUA 1LLZA 1VJZA 3GU9A 1UZDA 4UTLA 3OC4A 2WKGA 3W85A 1OF8A 1TIMA 1XYAA 4MKNA 4GYKA 2ACRA 5KZEA 4YTRA 1RXOB 5FEZA 4LH8A 3U8GA 1XUZA 1VF8A 4UWMA 4ZOHB 3VDGA 1F3PA 4PUNA 1FRBA 4U3AA 4S3GA 2CZEA 1W3TA 4XAGA 3AXMA 2VFDA 3HW2A 3MJYA 3WENA 4OUEA 1VBJA 4Q7NA 4I3GA 1VJSA 3VI2A 4YPJA 3OO2A 4DBUA 3IGSA 5HQEA 3PJTA 3IUDA 1KTCA 1TV7A 1C90A 3GG8A 1UP0A 2BTMA 2FJUB 3CUIA 2VJXA 3CB8A 4JTGA 1V6XA 4LEFA 1IT0A 4TVYA 3A7RA 1I2NA 5A6AA 4Q8QA 4WSHA 3MU7A 1JUEA 1CCWB 3H26A 3NSNA 1VS1A 3BMVA 5FAGA 3NVDA 4L65A 5FSDC 3STFA 4AD3A 1RJQA 1QHZA 2HXTA 1KM4A 3DYPA 3SZ8A 2ISVA 4YL2A 1Q8AA 2NZLA 1PTGA 2WMGA 3V7PA 4OE7A 4M82A 5GJNA 3VX1A 3EWWA 5C9XA 5J5RA 3KBMA 1E9ZB 1RSCA 1V5XA 4GI6A 1W5NA 2W3RA 3E5PA 1NQKA 3LV6A 4GD0A 3UJRA 3AS1A 1PIFA 4TMBA 1JYVA 2H9AA 1EJXC 1AH0A 4UQDA 1N60C 1CB2A 4AWSA 3WK1A 4LBUA 1W9XA 2P8BA 1S1PA 3N4EA 4DRSA 4MZ8A 4FNUA 3E0LA 2Y61A 2OGJA 4GVIA 2DVXA 2VZUA 3PZQA 3PY2A 1OYCA 3JZUA 3C0LA 4L6DA 1TPC1 4ECLA 1AW1A 2PPGA 4RK8A 3NYZA 2TRSA 2OSXA 2ZX8A 2QKFA 1J93A 2D2JA 2PLMA 2OU4A 5AN7A 1B90A 3ARYA 1E6XM 1AOGA 4KFNA 2D0HA 2XFWA 4ZE4A 3PTQA 1I9CB 1QASA 4LCSA 5TNVA 1Q6FA 1VCGA 3P74A 3UT0A 1PB0A 1XLMA 2G96A 1A0DA 5EFDA 3TC7A 2INEA 1JZ5A 1L9WA 2ZUTA 1V51A 1GXFA 4GUFA 4PMZA 1FWBC 1V8EA 3QH2A 4Z1BA 4RL3A 5CGMA 2DFAA 3H55A 5I2UA 4F0MA 2BASA 4GYPC 2D0FA 3O16A 1AQ0A 3TMLA 3NVWB 1XCXA 1EGZA 2Z2UA 2O9PA 4AEOA 1RPXA 1IGSA 4JNMA 4MHBA 3BJTA 5I77A 2PTXA 5AYIA 3MBDA 3G1AA 4WX2A 1L6YA 1Z32X 4DJFD 2AKZA 4TVUA 4M5PA 4PTDA 2IPGA 3GRSA 3KWSA 1GQLA 3TOYA 3CHVA 4NZ5A 1O5XA 1QHPA 5CPLA 4AWEA 4B3LA 5D33A 3C2OA 4H2HA 3SI9A 3N2CA 2YLLA 1UG6A 4GVGA 2V5KA 4NG3A 4OUIA 1Q4NX 1UPPA 1KRBC 1W54A 1UIOA 3UR7A 5C9WA 3WD0A 2ZC8A 4WEVX 5JCKA 1FH8A 2FHBA 1EJVC 1AUSL 1K77A 2W3ZA 1TTPA 4CNUA 5EMLA 4PN2A 5FJJA 3UZWA 1HP5A 4EXBA 2A3LA 3QGKC 1HUVA 1UWUA 5M2FX 1XYLA 4UMCA 3HFYA 4QJ4B 2NXGA 4R85A 3HZ3A 2Z7KA 3LI0A 4A21A 2VVNA 4LB4A 2NXHA 4HHPA 2WWCA 3E49A 2A2IA 4PCFA 2PP3A 3HPZA 3POHA 5BOOA 3FA5A 5JU6A 1FKXA 3M0YA 2JEQA 4C1KA 4QP0A 5LIKX 2AGKA 3WH8A 1LTDA 1STZA 3E2VA 4HN4A 1XI3A 2WPBA 3L9CA 5BRBA 4AD2A 4URIA 1LROA 4MZYA 4HOXA 4MMWA 5LXXA 1SZFA 4GXMA 4UNIA 2DT0A 2VDIA 4AD5A 2WZIA 1HX0A 3GXMA 1BD0A 1EQPA 2X2YA 2D23A 4TOQA 4PA8A 5DO8A 1W1TA 4HA0A 3P2VA 1JROA 2VZVA 1QK0A 2GR1A 4ICMA 2PTDA 1IIHA 4H6EA 5CBJA 4F40A 3B4UA 4B91A 3B40A 2JIWA 2WOVA 5G5GB 2TMDA 3GIYA 3PJUA 1H41A 4KWSA 2IQDA 4LW7A 5A69A 4LVAA 4GBDA 3PZVA 4MPQA 3V1HA 3BCJA 1DXFA 3UCQA 1KTBA 3W1NA 1JZ4A 2J6XA 4FSAA 3VMOA 3LY0A 2C91A 2HTMA 1ECEA 3WBYA 3KS6A 4ADTA 4IIDA 1E5NA 1YADA 4PUDA 1JYWA 3GH4A 5K9XA 4A8IA 3G22A 2ZIDA 3NQ7A 3IJLA 1RZMA 3S1WA 3G8EA 5A2CA 3M0JA 3DKLA 4C6OA 3KRZA 3S6TA 1GESA 1H50A 4P7OA 1KFEA 1TWZA 2GJNA 4IL0A 1RLDA 3EX3A 2JKEA 3KW3A 5AFDA 1TREA 1KW1A 3HQPA 4D72A 2P50A 4WJXA 5CPNA 4HYRA 1H0GA 3CEUA 3S0CA 3DFSA 4QGCA 3MI2A 2PTWA 3WLKX 1NP2A 3W7PA 4DAIA 3WDRA 3CK5A 3OHIA 4U2ZA 1H6VA 5EGRA 3LADA 1JZ8A 2PWHA 3B0UX 1XM3A 4ZVJA 4PBFA 1ISZA 1ZBWA 4CU6A 2E77A 2PTZA 1H60A 3W7IA 1XCWA 1AQFA 1MQPA 4XZMX 3K30A 3V75A 2FIQA 3ZZ1A 2CXGA 3H2FA 5FF2A 2QLYA 3WMBA 1DXLA 4JX5A 3B0XA 3NQVA 4X63A 4N7QA 1W3HA 3RG6A 3L7RA 3FVDA 5HPOA 2TYSA 4Y9OA 3WDQA 4CN4A 2ISFA 2DZBA 4CQCA 4DZ5A 3H4WA 4LRSA 4QE5A 3AI0A 1G5AA 1DWFM 3N19B 3B8VA 1PV8A 2X99A 1G6CA 2YPIA 3EDJA 3CPGA 3TMQA 4DQWA 4JTIA 4PUKA 4M1RA 1ZCOA 3B8IA 1XD0A 4Z0SA 3EXRA 1OFOA 4OHQA 3ZJ7A 4QNWA 3VGDA 3VZZA 4J5NA 4YWIA 5A6SA 3D0CA 3PBVA 4IMDA 5BWFA 3CQJA 2EJ1A 1US2A 3AHTA 1CYGA 2D2HA 4H4IA 4F0SA 4OBTA 4EQSA 3N04A 4TIMA 4HIBA 1DHPA 2DUXA 2ZCGA 4IUGA 2VRJA 2YXXA 3TJLA 4LNYA 4INFA 1QTWA 2DSWA 1QI0A 1ZB5A 3STPA 3I68A 1SJCA 1I2PA 2Z0IA 1SFSA 3PTKA 2WP6A 1ZALA 4A2SA 3C8FA 1QPQA 4NIRA 4AYSA 1VHCA 1J12A 1M68A 3CUGA 3WH5A 1LWJA 4JYEA 2JGQA 3VVGA 3P3BA 3ECQA 3LCHA 2OEJA 2J8FA 1ZNNA 1TPVA 1GRTA 1FWJC 2OZ0A 2BB0A 1B4KA 4PUMA 1JCYA 3M44A 1D9EA 1XBXA 4J9JA 2YXOA 1WDQA 2QCHA 5LA0A 3FIGA 4UR9A 1YBQA 4BS0A 4C1LA 2Z6IA 3SJ3A 1EJ7L 1RV8A 5M5DA 5CCZA 4R33A 1D3GA 4OOZA 4O15A 4H8UA 2WSKA 1V3JA 3TU9A 1XLJA 4FS9A 3S47A 2A3AA 2E9MA 1UKTA 1XHGA 3R5EA 4H9VA 1QW8A 4NU7A 4J1OA 3NNTA 3S5ZA 4AX7A 1B3WA 4LBRA 3YPIA 1ZTVA 1KFLA 3B0PA 1S1RA 3QZEA 4K8EA 3OG3A 3PF3A 3T4CA 3CZLA 2J8TA 3AU2A 3MV01 4Z1YA 5A6BD 4W93A 1SMAA 3STGA 3T0AA 3E6EA 3OHMB 3ZO9A 1JZ7A 4C60A 1QWGA 2BG5A 3QMSA 3W1LA 1XLHA 3AHYA 4O1EA 5FJUA 2B7QA 4WHBA 3SFKA 3W28A 4ZB5A 1BYDA 1K8XA 4APNA 4GQGA 4K1WA 1FFUC 2O55A 1CTNA 1MDLA 3N13A 4D8LA 5PTDA 3THQA 4WJ8A 3OBAA 1TTQA 4Q4QA 1E0UA 2VGFA 3KBSA 2OQYA 3MV11 1RALA 3LXDA 2NQ5A 3KVMA 4YVPA 1E4NA 1EDQA 1PYMA 3RPMA 1H2IA 4WIWA 3BUVA 3K1DA 3NXFA 4UTIA 5ECUA 2HBXA 2BS9A 3DBPA 3M0ZA 3HG2A 5IHRA 1E6SM 2I9EA 3N34A 2PGWA 2AAAA 3ZJ8A 3CUHA 2X8RA 4H4ZA 1EJUC 1ICQA 2WJDA 4QBXA 3MKKA 3UJ2A 4XUGA 1W37A 3HV8A 1VBRA 4MSSA 4IFOA 3L4XA 2YCEA 4S2CA 1P6CA 3GDTA 3NQGA 1IE7C 2VCBA 3QSTA 3TXVA 3P67A 1E3ZA 2OX1A 1EKOA 3B8DA 1TV8A 1BEUA 2J9ZA 1P6WA 1E71M 4ROPA 1V6WA 4NJKA 4DJDC 1TCMA 1W3LA 2INZA 5EBKA 3PUOA 4WDXA 5LSMA 4L9YA 4K39A 4AY7A 1MO9A 1Y8BA 3IWPA 3DXIA 4UR7A 1GYMA 4JDBA 3SCWA 1CGXA 3BSHA 3EWDA 1IZKA 3FA4A 3O1NA 3HTWA 3RMJA 1GRFA 1GOWA 3GXNA 3UVIA 4PUJA 3W7LA 2W63A 2HSAA 2PLKA 2YCKX 2GH5A 3VKCA 4CD6A 4JN7A 3WD3A 1JGIA 4E2DA 4S38A 4ZENA 3CWHA 2C18A 4IOTA 1VGAA 1DOSA 3ITTA 3FFSA 1XLIA 4LF2A 1LT8A 2OZ8A 4MLJA 3DJGX 2ESCA 3T2QA 3W37A 4J27A 4ORMA 5DCBA 4NEVA 3VGGA 2WLYA 5C55A 4PCTA 1UD8A 3WJYA 5KVHA 2PDBA 4N9BA 4YWOA 1EZ2A 1EOMA 3PSWA 4JFUA 4XZIA 4AVOA 3WQCA 4R27A 4FNRA 3PZ9A 4JKLA 2X50A 2WP5A 4XVEA 1U1HA 2O7SA 2B7NA 3WEZA 5IRPA 1GVRA 3AMDA 5A8MA 1M03A 3MSRA 4XIAA 3C3NA 1RPKA 4AVNA 4MDOA 4PEKA 1OG0A 4JEJA 3WDPP 2OMAA 1WKDA 4X2PA 4YS1A 3TQ0A 3N2XA 2I5GA 1N61C 3E12A 1BYCA 3TFCA 3LB0A 1GWJA 2EPMX 3MBFA 1CI1A 2E28A 2VMFA 3QGVA 4JQ4A 4UBPC 2X7VA 4X60A 4UTTA 4KCWA 3AJ7A 2WLZA 4MAZA 1SR9A 3TKFA 1CIUA 2ZVIA 4UOJA 3C61A 2NUYA 4BV6A 2A85A 2O56A 1V6VA 2ONEA 1QPOA 1YKWA 1VYPX 3PZIA 2V2DA 1J79A 2I16A 4MKSA 1L6WA 5D9NA 4MNLA 1GOKA 3VFCA 3MTWA 2CESA 3MP4A 2W61A 2WJEA 2H8XA 4AIOA 1RP8A 3CPUA 2PEVA 1N62C 1GEHA 1WOBA 3WLOA 4RPPA 1YBQB 3BZGA 1GVEA 2YVJA 1RY0A 1OFBA 3GVQA 2WOWA 1NSJA 4A3RA 5GJPA 1NFBA 1XLAA 1CNVA 4YXGA 1JPDX 3PUDA 5CG0A 4XBSA 3N2TA 1F3TA 4DYEA 3A5FA 4M3PA 3HGJA 3KOFA 2VD9A 1W9VA 1J0YA 1Q5MA 4IXXA 3WQWA 2EQDA 1M6JA 3EWUA 3QM3A 1NVMA 3OPSA 1JFXA 1TQJA 1OCNA 4FOUA 2EJAA 3W7CA 3L12A 4Q8UA 4I6KA 5LGZA 3W7HA 4GNVA 3U48A 4FF7A 3O63A 3WN6A 3TQKA 1X98A 3VGFA 4NL1A 1TVNA 5I03A 2WJFA 1K03A 1HJVA 3DFNA 1I45A 3O07A 3S6DA 1DJGA 4HYWA 3GNXA 1WV2A 4EPEC 1NDYA 1YIXA 1UKSA 4KEZA 4QSHA 4AISA 3GE7A 4FX7A 1CZ1A 2VM8A 5K9DA 2FHFA 4TX9A 5JIWA 2WMFA 4XVDA 4LS0A 1AD4A 2OOFA 2NLYA 4R7WA 3VILA 1FXQA 4JPGA 3F5JA 1ZDLA 2EQ6A 5TBOA 2DDXA 5JRBA 3FAXA 3SRKA 1ZS2A 5D05A 1TWWA 3TW6A 5CPTA 3G77A 3GHTA 1SUXA 2F61A 3VMPA 3WNNA 4DPQA 3L4VA 4F66A 3UY7A 2RHGA 3ARQA 1AODA 4DO5A 3AC0A 3A4WA 3S5OA 4MJ4A 3R0UA 1RUSA 5FJRA 4RZ4A 3UCDA 4L1WA 5AHMA 4XQ6A 1P0EA 7PTDA 5REQA 4EACA 3QY6A 2E68A 8XIAA 3HG4A 3SB0A 2Z2AA 3L67A 1E4IA 3WLJA 5DMLA 3RX2A 2YBTA 4AB4A 4PMDA 1C9WA 1BWVA 3WL1A 3PZMA 3UESA 2I5IA 1Y7VA 4ZXLA 1KXVA 1TPH1 1Z69A 2YL8A 3TH6A 4GY0A 3NDZA 3CLMA 4LYKA 2XZ9A 3T7VA 4MWAC 1GKRA 2PDFA 1TRIA 3OVPA 5B7ZA 4RV3A 4CN1A 1MXGA 5AHEA 2PLCA 4QAWA 1BWCA 3EXSA 5HNUA 4XZWA 2ZXBA 3N9RA 2RDXA 3FKKA 3QFAA 2OFJA 4ZA0A 4ATLA 4C65A 3DI1A 5G1YA 2WYSA 4KESA 4GE8A 1BVWA 4YIWA 1IGWA 3S8HA 1OEPA 1MNZA 2E09A 5G1TA 3UZ5A 4DNHA 3DN5A 4XD5A 4JHOA 3SCTA 5JCLA 1KM5A 2UBPC 1OB0A 1JDCA 1PWLA 3R11A 3TCSA 2DUAA 2ZRVA 1S7MA 3CQIA 5BWAA 1S3TC 3W2JA 3RRXA 3VU2A 3AU6A 4EQRA 3VC5A 4IPNB 2XGBA 4V27A 3M0KA 2QJHA 4UTUA 2W62A 2VENA 3H54A 1OT1A 2V82A 1A3XA 1C29A 4OQVA 5DX7A 1AZ2A 1D8WA 3WQOA 4ALDA 3KRBA 3G1YA 2P10A 4DN1A 2J77A 4M29A 4GO9A 4I90A 5H8UA 4BK9A 1POJA 4JFWA 3IJ9A 3BSMA 1SZNA 3F4NA 3IGUA 3JS3A 2G3NA 1IXNA 3IUIA 1NDWA 2WVVA 1W1B1 4PEEA 4ZQNA 5A6BA 3EDEA 1BVNP 3C4UA 2AL2A 2PDKA 5G1MA 3FXGA 4LAOA 3G24A 4AZ6A 3LYEA 3ZT5A 4O8RA 3GNNA 3QKZA 3L5MA 3BAYA 2CLPA 5E6ZA 3GTFA 3H2EA 4ES4A 4AC7C 3I10A 4UOQA 1XC6A 4LIIA 1B9BA 1DJXA 4IIEA 2OO6A 4S39A 3GR7A 1TZ7A 3MVTA 1LRQA 3LS9A 4NNBA 4OBSA 3PHAA 4KCTA 4HZMA 3G1FA 3AIEA 1V02A 3WX7A 3KWXA 3KVLA 3BAWA 1QR7A 4H9MA 1QDSA 5LHFA 1RCXB 1J11A 1EDGA 3H4KA 3W1MA 5DXYA 5F2GA 3V35A 1YPXA 2J7CA 2OCZA 1HKWA 2DUZA 2CFFA 4ZB2A 1F8IA 4RZBA 1F2JA 2VT0A 4KBXA 1R3TA 5U25A 3CS2A 1MEWA 3RN6A 2J62A 1OYAA 1A5LC 2QCNA 2W92A 4B16A 3TA6A 3NSMA 3QYQA 1C8YA 1A47A 1XKYA 2WQPA 5HK4A 1I4NA 4AY1A 2HK1A 3ARUA 5CSUA 4EE9A 3A4JA 1YTDA 4H19A 2J75A 1X2GA 5DFAA 4LVBA 2Y5SA 1A80A 3P80A 1R3QA 3OLGA 4C7GA 1VFLA 4KPRA 1GQNA 7A3HA 4KWVA 2BGSA 3H21A 3LBOA 1Q6LA 3ZR4A 1WUFA 1OADA 3E0FA 3HGSA 3ZWSA 2JFEX 4LV9A 4HNVA 1T96A 1GJPA 4C90A 4RUBA 1E6PA 4R34A 1GV4A 1Z89A 2DH2A 3DZ1A 5G2IA 1BGGA 2YDSA 3HU7A 3L5AA 4AZ5A 2QF7A 2J7GA 1EF2A 1UH4A 4ZOEA 5CC7A 3NVYB 5I3DA 2X16A 3FVMA 4XBKA 2J9XA 4IP7A 1SMDA 1YPIA 4N42A 3DEQA 2E40A 1UBPC 3OBKA 3TC3A 4K7VA 3E5BA 4KRUA 4B5WA 4WDUA 4G8TA 2VFIA 1TVLA 3AAMA 2BCPA 1KN0A 5H1WA 2NVDA 1SW7A 5CSYA 1DV7A 4DBSA 1V03A 5T9CE 3CH0A 4GHRA 1GKPA 2PURA 1O7AA 1OFQA 2NQLA 1N5XA 3SUTA 3P60A 1JZ2A 3IVTA 4GFIA 3OIHA 3ALGA 5REQB 4WOZA 4ZMGA 3NSXA 1QW7A 1JI1A 2O9OA 5HJXA 3LOTA 1TZZA 3GDMA 1YDYA 4TVCA 1WZKA 1LLOA 2V69A 4O1FA 1UKOA 3FHQA 3BAJA 3I6TA 1CLVA 4HCHA 2DZTA 2BNJA 1O94A 4JAWA 1E6NA 3C2VA 3VABA 2C19A 3JRKA 1NIUA 4V28A 5ABHA 5EFFA 4J7RA 2WV8A 1PKNA 1TMLA 3SCUA 2CLIA 1QUMA 4MIMA 1E6ZA 3PANA 1UWSA 1X1OA 4UMBA 1EWEA 4IT1A 2QEZA 3MI6A 1CW2A 3SCRA 3LBMA 3VM5A 3BC9A 1JQXA 4XD3A 1V79A 3HPXA 4I9MA 4GA8A 1Y0EA 2XH7A 4FR1A 3O8AA 1R6WA 2V3GA 2WVTA 5FEWA 3K4WA 4PCPA 5KSWA 3G8RA 2NX3A 2X05A 5DQPA 1E9IA 1YQZA 4XAYA 4H9TA 4H4YA 4US5A 2V81A 2X1TA 3IS4A 1RD6A 4V2XA 3TNBA 2VC6A 1LBFA 2Y7EA 5KITA 3LERA 1E0VA 3ES7A 3H2AA 3MY9A 3RFAA 2EAWA 4RX0A 4LUTA 4GXPA 3IJ6A 5D38A 3RXZA 3LCWA 2NWRA 4N4QA 2D2GA 4UIOA 1XYBA 1AG1O 1V3KA 4PC8A 3OEXA 4HNLA 4H4VA 1S2UA 3UVAA 1RQHA 1VCVA 1DJYA 1JGMA 1RK6A 1JI2A 3RR1A 2PDMA 3EMCA 2PODA 5DY3A 2BOGX 4O4WA 3ABXA 1GEUA 4AH7A 2WVVB 3T05A 3GG0A 4MOZA 2RDWA 3W6LA 3WBEA 2AL2B 4GCXA 1ZJAA 4P8UA 1OC6A 2CLEA 3KL5A 1AZ1A 4HZ6A 3I7SA 3ZLHA 1WB0A 2QDGA 4KCVA 2ATSA 3WJXA 4XO6A 2NPXA 1OX4A 1E55A 2NT1A 2ZZ4A 4YYCA 4AF0A 3R12A 3TAOA 2UY2A 3F4DA 2YOCA 4RNIA 3GDLA 3WNKA 2J7HA 4LX4A 2GOKA 3CYJA 4Z2HA 1N5WC 2ZFAA 4I8YA 3KP1A 1VPYA 1KO0A 4R9OA 3H22A 4GINA 1XDIA 2G3JA 3SCSA 4EAMA 2Y24A 1T6MA 3EGJA 1PIIA 1LPFA 2AMGA 1C8VA 3QN3A 5JCIA 4FIRA 1FWDC 5KETA 3TW7A 2OKTA 3MQTA 4MJ2A 3FDKA 5B80A 4TV6A 1W3IA 4HT3A 3I6EA 3O7UA 1NM9A 5AZ0A 2OT0A 4MZ1A 1JCJA 1W91A 3GHRA 3WELA 4L4MA 3WNOA 3TDFA 4UFLA 3IAQA 4D6GA 4NP7A 4O1CA 1DE5A 3U5YA 4D1IA 1SB3B 3M6YA 1Q3NA 4JTKA 4CU7A 4C6CA 1G4SA 2NX1A 2DZWA 2O4MA 5AECA 4KWOA 1DIDA 1VEOA 1BXNA 3ANVA 1PYFA 2JQXA 5BXRA 1FXPA 1NF0A 4ACZA 4Q33A 3PP7A 2C14A 3PS7A 3WFLA 2BDQA 3GRIA 2ZX7A 1HVXA 2Q3RA 4IJRA 3N2MA 4NJGA 4AWTA 4F9JA 2WOQA 3ONBA 1QJWA 5XINA 4FIQA 4NYUA 4PFMA 1VCFA 4GQBA 2PDHA 2BXZA 1EBGA 3OGVA 4H8NA 1I8JA 3VIIA 3PUGA 3WLSA 4NRRA 3OU8A 1QATA 3ITXA 3BV7A 3TTSA 2WM0A 5I79A 2NQZA 4QRNA 3BAXA 4B5NA 1PDYA 2EPKX 2OWXA 3KZPA 3TFXA 7XIMA 1EP2A 1MO0A 2HCVA 1FWCC 5LGXA 1BWKA 4M52A 3H12A 1Q7QA 2VFFA 2NWSA 1ZXIC 1S2TA 1MOKA 1LP6A 1SSDA 4C6LA 1TPFA 2VX7A 3QF0A 1EXBA 3HPFA 4AMCA 1GYLA 2XWDA 5C54A 1NH6A 5B7YA 2VXNA 4DELA 3M5XA 4CUCA 2FJKA 4DB7A 1FWIC 4F0LA 3FDGA 3NQFA 1BZLA 4WLCA 3IJQA 3U3HA 4DI9A 3SY8A 2XN2A 3TQVA 5JH2A 3RX3A 1BXCA 2PRLA 1ADSA 3COTA 3QFBA 5E6YA 3T0TA 2ZE0A 1W8GA 2C7FA 3W53A 2FZNA 3CM4A 2GGHA 1BFNA 3O0HA 3R1ZA 4XSLA 4YVVA 4LAKA 1E73M 1TMQA 4B5XA 3EKGA 1VP5A 3B04A 3SUSA 2PD9A 3FJNA 2ZYFA 4WKHA 1U1UA 1VHNA 1GVIA 4O0ZA 1X7FA 4BWLA 1D2KA 4DO6A 1JL8A 5A8OA 1TB3A 3W1TA 4GWEA 4L5ZA 3W38A 1GJWA 1SFJA 4J4KA 2VFHA 3TZNA 1MXDA 2ANUA 1GOXA 4NY2A 1YX1A 3TE9A 1QPRA 3VKAA 5A8NA 4JTFA 1MUWA 1A49A 4DZAA 1HVQA 3BG3A 4HPHA 3KCOA 4MADA 4EWND 5BW6A 2UY4A 5A1AA 4KPLA 4L1GA 4ZQOA 3SBFA 3DH9A 4LUTB 2Z24A 4JIIX 4EXAA 3MO7A 4LPCA 1KRMA 3TJ4A 5CQ1A 1FWGC 4DZIA 1DIKA 4QCEA 5GRTA 3VZYA 4C6JA 4U5KA 1W5QA 3LCFA 3IGHX 1POKA 5C7VA 2FVLA 3FEMA 4XKMA 3U2OA 2DZAA 6CGTA 5J5DA 1J0HA 5I3GA 4H41A 5DN1A 3Q4DA 3WMCA 4G7FA 1ONXA 4UTKA 1W31A 4V1XA 1O66A 3Q45A 4PUEA 2PU0A 4QROA 4FB7A 1U5HA 1TRDA 4IG2A 1DE6A 1BGAA 3I3BA 4PMYA 1MRAA 3E9AA 1QAPA 3UXLA 3UXAA 2B81A 4IMFA 4MNJA 1UKPA 5M17A 3VGBA 1BF2A 3UA4A 4AZGA 4DJFC 3A3XA 5T26A 1GSNA 1FP8A 3KLKA 1FHDA 1E0XA 1OX4B 4DJDD 1UZHA 1HG3A 4AF0B 2OT1A 5F7UA 3A9IA 1P0DA 3CQ0A 3QLDA 4I7VA 4XD6A 2NVAA 2IKJA 1U33A 3P0WA 9CGTA 4GX8A 1S5VA 3LSBA 1TVPA 1LYXA 4Q6XA 4C5YA 3PM6A 1E9LA 4US6A 4JIRA 1H5YA 2YYTA 1UC5A 4Q7BA 3WH9A 4ZQMA 3NQAA 1F5ZA 1F3EA 8XIMA 1CLKA 3NOEA 2CBVA 4FR6A 1KRAC 2PBGA 2ACQA 1UZ4A 3AALA 2AQOA 2YSWA 2BWGA 3TYCA 2WWDA 4G2DA 4IX2A 5XIAA 1CENA 1M1BA 1I6NA 2VTFA 2ZA2A 1QFEA 2BY2A 3WCZA 4E0CA 4AZHA 4MF4A 4C6EA 4P2VA 3BW3A 2C1IA 2XG9A 4DWSA 4AC1X 1IIGA 3VNDA 4EP8C 2Y63A 5M03A 1HJUA 1VD6A 4HMDA 4IGNA 1WXJA 1SYTA 4IJBA 1Z7AA 4Q4PA 3KHDA 4IQEA 1OINA 2AGTA 1W5MA 5K3VA 3QQ1A 4M19A 1GQJA 1LWHA 2I56A 1V77A 2FLIA 4O18A 3KTCA 3BOXA 4ACZB 2ZX9A 3LK6A 4UFKA 4JTSA 1VIWA 3N12A 3U4FA 1JPKA 4Q6JA 2TODA 1TELA 2YKKA 1OFAA 1R7OA 3CPRA 3XISA 3QHNA 3LNMA 3N73A 3NPUA 5DEZA 2Y89A 1CWYA 6ALDA 4CVWA 4W7WA 3SECA 5EY5A 3FOKA 4R3UA 4NZCA 3MC5A 3NL3A 2AL1A 4LEQA 4KEUA 1Q6GA 4E2OA 1KFKA 2A3EA 3KOXA 4LNCA 3LHUA 4QDMA 5K4ZA 3P81A 3GZAA 1T8XA 2DSZA 4LJ3A 4W87A 3TR9A 1YLVA 2DW7A 3SIZA 5EA9A 2IW0A 1US3A 2QUUA 1ODZA 4DBEA 1FX6A 3QR3A 3VIHA 3TAKA 3M4HA 3GD6A 1ZLPA 1V97A 3OB8A 3W7OA 2J4GA 2PLJA 4JQ3A 5G2HA 5DELA 3W81A 3IC9A 4I9TA 3MJMA 2ZDRA 2Z27A 4C6PA 2GDQA 3N9KA 2R1PA 3VKJA 5AC8A 3SSJA 4AIEA 3H8AA 3WMSA 1OYBA 3TTEA 1NHRA 1A0EA 1H4PA 3C56A 5LNRA 3SM0A 3BLPX 1TV4A 2XUCA 4WSJA 3EX2A 4NX0A 4CCCA 3KP0A 5BCAA 3TK7A 1VJIA 4IP5A 3UFYA 2HNHA 2IKGA 3N15A 4LS1A 1F6KA 4B4HA 2VQUA 4GZIA 3UWZA 4ZEPA 2V3EA 5F2IA 3IIZA 1UOZA 1FQ0A 3Q2DA 4DBDA 1KKOA 3KDNA 2DJLA 1DWIM 2W5FA 3LMYA 2PC4A 2TSYA 2W0HA 1DQUA 1WUEA 3LX9A 2ZADA 3CT2A 1OWQA 4H00A 3EWXA 1JYNA 1OK6A 4POCA 3QJAA 1D8CA 1FFQA 3SO7A 4AUBA 2XSBA 2WC3A 1KFCA 5CEWA 4RLIA 4A05A 1HQTA 4ADUA 3N4FA 1Q6DA 2HDJA 4RJEA 4PTVA 2XZ7A 3W75A 4O13A 2HROA 1TIWA 1GT8A 2O4QA 4HCLA 1RJPA 4GC3A 1Q7ZA 2GL5A 1O4UA 1Q13A 5E1QA 1ITCA 1XW8A 1KV8A 1Q1WA 4H4XA 3MS8A 1NARA 4XKYA 1TPWA 2OEMA 1KR0A 1AH4A 2ALRA 4UXDA 3AXXA 2Y5JA 1T41A 1UR3M 1ZU8A 5F2MA 4IUOA 3EOOA 4LUYA 3ZSSA 4AX6A 1OF6A 4KFOA 4YTTA 3GFXA 4QDWA 5BOEA 4WKAA 2PU1A 1JZ6A 3LG3A 2Q01A 1OCBA 3L65A 4PTMA 3ARSA 3PK7A 4S3CA 4HTYA 3VNYA 3E38A 3T9PA 4F3HA 2CPUA 4TXEA 1KBJA 4G9PA 3T0BA 1D3CA 1WYIA 3QZAA 2WANA 3RM8A 4IG2B 4R5EA 2BZNA 3L5OA 4YN5A 3EB4A 3T2OA 1KD0A 3PPFA 5HJLA 4H4PA 1SSGA 2FFIA 4HK6A 3N14A 1C3FA 3VIKA 2PDYA 1GRHA 4R88A 2OOGA 1HW6A 4NEWA 4UFIA 1LRTA 4GIYA 3SUUA 4QG6A 1PZ1A 3GR4A 2FDSA 1JIBA 4RDWA 4A3QA 3IJ8A 1JNDA 7ODCA 1VQZA 5AHFA 1ZP3A 4AD4A 2J13A 3IRDA 2C71A 4JQ1A 4FLSA 3NDOA 1BG9A 1TPUA 3V0SA 1J9YA 2GVGA 4H4QA 3DFHA 4L4PA 1LRNA 1AL8A 3LZ3A 3MP3A 3FKRA 3ZR5A 3E0VA 1E6RA 2YYUA 4DX3A 2FB3A 3PJWA 2FPVA 5HNTA 4LA1A 3LI1A 3W6YA 4RDYA 2E1WA 3URBA 1KA9F 4IMCA 3EZ4A 3IJ7A 3RAOA 3KAOA 3GBDA 1TSIA 1JUBA 3VDAA 4Q22A 1WBHA 4ZODA 3G2GA 4E3TA 5C7HA 1OVDA 4FOKA 2IQTA 2YL5A 1V08A 4H01A 2R91A 1TJ0A 1OY0A 1Z41A 1BVZA 4JTAA 5CPSA 1VDVA 2PWEA 4H2CA 4DWSB 1SZEA 2WZMA 6XIAA 1GVSA 3OJGA 3BOLA 5JCMA 4MPKA 1G94A 4X2RA 3AICA 5D03A 5MKGA 3ME3A 4EANA 2Y5EA 4PMOA 4IXHA 1XYMA 5LYRA 2G0WA 1TV2A 2HZGA 1LQ0A 3WLQA 1B2YA 5AC4A 4TV5A 2Z4GA 3R25A 1UQZA 1E3XA 3FAWA 4KFPA 4JFVA 2QUVA 1TZ9A 4JFSA 5G4WA 1AJ0A 4UC5A 5EMJA 3CGDA 4FK9A 3OGRA 4P8VA 2GZXA 3PBGA 3QTPA 4FF5A 2WK2A 2IPWA 3S3GA 4EKJA 1CXKA 3L4YA 3NPWA 1A5BA 1NTHA 3BW2A 3DIPA 4H83A 1P0BA 3M47A 4D8ZA 5BZAA 1OC5A 4JNYA 1SJDA 2WMHA 3LHVA 3FJ4A 5D30A 4X22A 3GD3A 1PCWA 4JTJA 4HU8A 5CC6A 1VFHA 3VOIA 4IWWA 3CXOA 3VMNA 4A29A 3LLFA 1XIBA 1TYPA 3N6QA 1F8MA 4O1BA 4ZZ9A 4H4TA 3IPWA 3NQ8A 1UQYA 4LALA 4U4MA 1VEPA 1VFSA 2PWUA 4WCJA 2EXOA 1R3WA 4U33A 1EUAA 2WPGA 1WXZA 3LPFA 3R0DA 3UWVA 1XF0A 3BLEA 3DFOA 4LQ1A 3K46A 4AWUA 4I7UA 3EDKA 1DQXA 5ECVA 3CIWA 4ZOCA 2GQ8A 1H1NA 1GVFA 3GRTA 5ER0A 3DJJA 3W24A 3BQ6A 1WBJA 3UG4A 1PZ3A 3BDKA 1TCDA 2CWNA 3AQUA 1MUMA 3AS2A 4PGLA 4GK8A 3T1GA 3KOYA 2WPCA 3VZXA 2BBFA 1VEMA 3TP4A 1GREA 4MLRA 4OVXA 4P8WA 3G3DA 4S3JA 3WLPA 2EPOA 2WSQA 1GRBA 3PAJA 3MUXA 3DI0A 2GRTA 1V3MA 2E6YA 3ANUA 3VIGA 1X6NA 1SFTA 3EA2A 5A2AA 2XVKA 5CLTA 4XZLX 3QOKA 1H7PA 5GNYA 3IK2A 4HN8A 1KFBA 2NV2A 1XQLA 2ZWYA 3URNA 3M5ZA 3CAVA 1W17A 4JTQA 1JAEA 3UYCA 2NSOA 4UQ9A 5CAHA 3VYLA 4LBSA 3UXKA 1ZENA 1VRXA 2YCLA 4R9XA 1VFFA 3DGHA 1U83A 4XWUA 1K70A 1JAKA 2V6AA 4XKYB 1YPFA 3Q37A 1M7OA 4GXWA 2HMCA 4LYQA 2OYKA 1K8ZA 3RUBL 5E93A 1W9PA 2RJGA 3DESA 4W8AA 1RBLA 5A8QA 3GY1A 2ZA3A 3H7UA 3E96A 4RXGA 3DK9A 1LCOA 2B7PA 2ZE3A 1R30A 3AS0A 1WYGA 3W22A 1ZMCA 4ZBCA 4HU4A 4L6HA 1SVDA 5TF0A 3IANA 5D2XA 2NV1A 5SWUA 2J7EA 1C8XA 3TYEA 3CHEA 3L23A 4D71A 1NU5A 3SUWA 4W7UA 2PI6A 1TWIA 2WO5A 2ZUUA 1DP0A 3BQ5A 1RH9A 3VA8A 3LRMA 5LZLA 4JBRA 4DYJA 3S1GA 1W8SA 4Z1AA 4JQ9A 3UQNA 4DO7A 5LNUA 3ZQ9A 1R2TA 2XU2A 4FX8A 4V15A 5GNXA 1KBKA 1RLCL 2WHLA 3U2CA 1A0CA 1UP2A 3TIMA 4H4RA 3QMRA 4GGHA 2C15A 3S9IA 1FWAC 1Q4WA 3GVRA 4GIAA 3B9DA 1VIZA 2G3MA 2DQWA 4CU8A 1RD5A 1G4EA 3VE7A 2OSWA 2VD8A 2KZHA 1SGJA 3TJXA 3Q6JA 3PWGA 3WD1A 3KL0A 2WVUA 4Q4RA 3DECA 2IQ0A 1GOMA 1A5AA 2Q3OA 1TYGA 2GYIA 3GR8A 1RJRA 1XV8A 4HSNA 1XIJA 3LPGA 1S39A 5BROA 1M01A 5CGTA 1EOKA 4HYVA 4QQ3A 5FIPA 3JU2A 5CPOA 3VUSA 1K9EA 4CD4A 3WSUA 3CHDA 1FDYA 4WZHA 3KUMA 3BOFA 1WQ5A 3CIXA 1DIEA 1ZKQA 4GY7A 3IV3A 3C0QA 4LVFA 3IJDA 4XG1A 1NHPA 5MKGB 3WEOA 2CDUA 4ZCWA 1IWPA 3QV6A 3FJ6A 3LPPA 4NZFA 1VB9A 1GHSA 4IPJA 4YJ5A 3PTMA 4HOZA 3KBVA 1J6OA 5H8PA 4IIHA 3WH7A 3M6DA 2OZTA 3VNJA 2OQHA 2R82A 4D6DA 1K6WA 3M7WA 4M81A 1KM0A 1HIZA 4G6CA 3SCQA 2Y8UA 3LUTA 4DYKA 1W56A 1MRQA 3O15A 3VO0A 4UMAA 3W83A 3MW7A 4C6MA 1ICPA 3W7GA 3LEPA 1CEOA 1KLZA 1B4EA 2YLAA 1XINA 1IQ8A 2VGGA 1NWRA 3GKAA 1F4HA 4F2TA 1JDDA 1QOQA 4RW5A 2G37A 4ZQRA 3CB3A 2D3LA 4PTXA 4JHZA 1KM2A 3IJIA 5AC6A 4B9YA 1GVOA 3CHCA 2P53A 2VC5A 4M6PA 4EM4A 3LCIA 2RJHA 1PAMA 2YQUA 4QM1A 2V0TA 2NSXA 1QXLA 1XGZA 1GORA 1UR2A 1E0TA 1MW3A 3OZPA 2NV9A 1I1WA 3EOUA 2DQXA 1S5TA 3DFTA 4X0VA 3S2CA 3TQPA 1CXFA 4QR6A 3DC8A 4DUXA 1W3NA 2V67A 4XIMA 3DHUA 4S3FA 4J28A 4M80A 3PWAA 2GR2A 3LHTA 4U5IA 3LM3A 3MSYA 4JDRA 3RLGA 2CLMA 3CAQA 2UY3A 1KNWA 3MWAA 4RZ6A 3NYDA 3HF3A 4MYAA 4PBEA 3PN8A 3R2GA 4WKFA 1XIDA 2EKCA 4XB3A 2NX9A 2ZWZA 3L66A 3AWOA 4KQNA 2PDCA 3H24A 3QMTA 2G4JA 3VDHA 4Q3MA 4B4FA 3UJEA 4O4VA 2WZEA 3DAQA 3NURA 2YXGA 2XFFA 2ZICA 2EF9A 1AQHA 1XWYA 2GWGA 1V0MA 1U2YA 3V5FA 1EJTC 4N4PA 1MFVA 3MUCA 3C2EA 3WNMA 2NLIA 1FEAA 3MT1A 1CGWA 4L64A 4E2BA 2JK6A 1PSCA 2GFTA 1ML1A 4HPJA 3P8IA 3T40A 1UZ1A 4CNNA 2POTA 1B5TA 3NQ6A 4Z2KA 4XZNX 1B54A 4H3DA 4Y90A 5HUOA 3VIFA 3P8JA 1QNSA 1GEQA 4BZYA 2PDXA 3A22A 3KE0A 2NW0A 5E70A 1H3GA 3SEPA 3MDWA 2YCLB 5GNZA 3K5XA 4H50A 4LF1A 1Q6EA 1S2AA 3UWUA 4AU0A 1FBAA 1HGYA 2YB1A 1FWEC 2OQLA 1EJSC 3T42A 2BHYA 3PJXA 4LT9A 4YHGA 2H8ZA 2QUMA 3LBCA 2PDQA 3TSMA 1T40A 4B3KA 3AYVA 4B5SA 4LAUA 3ISIX 5HUPA 4WRHA 2GWNA 4B9ZA 3WUGA 1ZRQA 3VGHA 1R3RA 2YA2A 4HU0A 1PS9A 5FF4A 3WLTA 1SU5A 3SY5A 3R58A 4JTTA 3BPWA 5XIMA 2JF6A 2GSHA 3VOGA 2DZVA 2PRMA 2G8ZA 4Z2JA 4NXKA 3FHAA 2DW6A 2KX9A 1JULA 4ZGYA 4BI7A 1KQZA 2QS8A 3U5UA 4LUIA 2JE8A 4BWLC 3U0HA 4LSBA 5L9FA 1JRPA 1O1HA 1OZMA 2D69A 1H09A 1Z44A 3BK0A 1XP3A 1IZJA 4H6RA 3LTSA 3OA5A 1UWIA 3WQEA 1ELSA 1MQQA 4HD5A 3CV6A 4W85A 4E4UA 5GJMA 1MZRA 2CEQA 2XSXA 2Y1HA 1H7XA 1M7PA 3G1HA 4DLFA 2ASHA 4AZIA 3ZXWA 3UPBA 4PMJA 1XBVA 4YU1A 3A3WA 4W5UA 1GPFA 3GHUA 4FXJA 4S3BA 3T81A 1E15A 1ECQA 3MANA 2ISWA 1XS2A 1BXBA 4Q8MA 3S9YA 3WQGA 1D7KA 1DVJA 4Y9PA 4H4SA 3A7AA 3AMCA 2RUSA 2CXEA 2VHLA 2INFA 4XD4A 1BSLA 2YL9A 3M46A 3BVJA 3NO1A 4S3AA 4F9DA 4W84A 4EMWA 3UEQA 4H4UA 3BLOA 4MFDA 3WK3A 2VGBA 3CMFA 3F4CA 3JUGA 4EPKA 4I5RA 3QLLA 2ZTJA 3TYDA 4PMNA 2P76A 3DHDA 1SO3A 1QOPA 4YHEA 4GABA 4JYDA 5D09A 1K8CA 3FNDA 1UH2A 4CQDA 3N3MA 1YDNA 4TQTA 5CZKA 4PH6A 1TJPA 5DCDA 1ITUA 4BKNA 3E02A 4YTQA 4NNCA 1ZY9A 2XIBA 3EWYA 4KW2A 1VR6A 3HIJA 1K02A 4U28A 1PL9A 5TAOA 1KBLA 3ARZA 1RQBA 3KOZA 2BLEA 1Z3NA 2FZ8A 4CD7A 5AYXA 1NFGA 4B92A 1WX0A 3ABRA 4O1AA 2PF0A 3CO4A 4LVGA 3NA8A 1UJPA 4PBGA 1HP4A 2WSRA 1B0IA 1N82A 2A7RA 2B4GA 1NWSA 1RBAA 3LXCA 3E2SA 3NVZB 1QK2A 3H6OA 3C5QA 3VX0A 4EPBC 2E5CA 1TO3A 3OLEA 4IGMA 2Q8ZA 3ZVHA 3WNPA 2Y62A 2A5HA 3POCA 2JALA 1Z42A 3TONA 2X8GA 3RLVA 1R3VA 5E0KA 5D9PA 1NDVA 3KTSA 8A3HA 2NVKX 3ARPA 1S5NA 2C16A 1X8CA 2QDEA 2VDGA 3F4WA 4PYSA 4LFYA 5BMXA 2PGRA 2P0IA 2VEPA 1KRCC 1DNCA 3K4AA 3QPZA 2VO5A 1DYSA 5HPCA 4RV8A 5CXPA 4UNKA 5FJIA 2W54A 5JQ9A 4BQ4A 1MVYA 3K8MA 3E0IA 1M53A 2F2HA 4KGLA 1JVNA 2VX5A 3NL2A 4Q8OA 2VC9A 4DM1A 5HQMA 4ZOAA 2GQ9A 2J8GA 1CLXA 1JDAA 4JD4A 2YBVA 4W86A 3OA3A 1BHGA 1JEHA 1M04A 1P0NA 1XXXA 1XRSA 4DY1A 2XIQA 4W4QA 4A3HA 3OOQA 1V3HA 2AQWA 2V5DA 4MFEA 1I2OA 4L4OA 1Z8AA 5LA1A 2YDAA 9XIMA 3HMJG 4M1BA 5U4NA 1JG9A 4ERAA 1RA5A 2NQHA 3MCOA 3SQSA 3RPDA 2CZVA 1Q2SA 1VZWA 3FYOA 4QTGA 1CB7B 1UWRA 2YIHA 1MXSA 4ZO9A 1IR2A 1EBHA 5K4XA 1W0MA 2Y2WA 2YW4A 3GTIA 4AHPA 3EWBX 3H2NA 4A3UA 1ZK7A 1L6GA 4JEQA 2HVNA 3TXZA 3WBAA 4P61A 3DG6A 2VEGA 4XAZA 2Z1WA 2EPLX 1J4EA 2CLLA 2QCMA 2Q09A 3A3HA 3DGZA 4FNPA 4Y9NA 2I57A 3W2UA 4QSFA 3QSRA 1FEBA 4ZQCA 1KXTA 1LLWA 3VIOA 2CU0A 3L8KA 5LXEA 4S3DA 2VYOA 1PZ0A 1K9DA 3SQMA 5BYWA 3H23A 1TPEA 3GDKA 2YGYA 2QCCA 3PZUA 3GAYA 4J3WA 2QUNA 3I4KA 4R7JA 1KFWA 3GS6A 4JXCA 2H3BA 5EMMA 4GUJA 3GYCA 1UPMB 3UU0A 3UWWA 3K13A 4A4AA 5D4YA 4GUGA 4GOAA 3ABQA 2CLFA 1WDDA 4MGGA 1WNOA 3QZ6A 1GERA 1V6UA 4HP5A 3AIRA 4QCFA 2BGQA 2DT1A 4CNPA 1PDZA 2E9LA 1LWIA 4RNJA 3WIJA 4J57A 3W1XA 2CC0A 1YXYA 1HO4A 1MZHA 4L61A 3RM9A 3NL6A 2XH4A 1W5PA 3AIWA 3PPCA 4IPPA 1JFHA 3G6MA 1DJQA 3QEZA 4CN6A 3WK0A 4ZOBA 4Q8PA 1W1A1 4CKQA 2BVWA 3FW6A 2V9DA