5KVIA

Crystal structure of monomeric human apoptosis-inducing factor with e413a/r422a/r430a mutations
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
491
structure length
479
Chain Sequence
PSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLAIDSDFGGFAVNAELQAASNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHEDLEVLFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Defining NADH-Driven Allostery Regulating Apoptosis-Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 148
structure length 479
sequence length 491
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5kviA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kviA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kviA01
1OJCA 3ABVA 4EM4A 2YLTA 3AE5A 3ATRA 4B65A 2C67A 1EL9A 2JB1A 3NG7X 4Z25A 1Q1WA 5FMHA 1E7PA 4OPIA 4DGKA 4XWZA 2GR0A 3GD4A 1D7LA 1DXLA 3K7MX 2XDOA 1M6IA 4U2TA 2C75A 2YVGA 2YLZA 5CQFA 2EQ8A 1JNRA 4EMIA 1GNDA 3DA1A 3CTYA 3KPFA 4IV9A 1ZK7A 2BXSA 3VQRA 3LZXA 3IC9A 3B6DA 3UKAA 4O5UA 3NRNA 2EQ9A 3EPTA 2YR5A 3OZ2A 4U8IA 2ACZA 1REOA 1NAAA 1N4UA 3DJEA 3IHGA 4A6NA 2APGA 1MO9A 1L9CA 4FX9A 5KVIA 4AT0A 4U8LA 1ZMDA 2X3NA 3AD8B 4A6NB 2GF3A 1L9DA 2Q0LA 4BK2A 3SFEA 2FJBA 3V76A 2OALA 3NTAA 5KOWA 1B4VA 3BNMA 1E1NA 3NK2X 1PBDA 3UTFA 1GEUA 1GOSA 2YLWA 1D4DA 1Q9IA 3UOVA 3VRDB 1CJ3A 3DJJA 2ZZ0A 1GTEA 3NLCA 4I59A 4DSHA 2GVCA 3P1WA 3UOYA 4UDPA 4N9XA 4GF7A 4TLXA 3FIMB 3F8PA 5J7XA 1PN0A 5L46A 2WETA 3C96A 3CPIG 4K2XA 4Z2UA 2C3CA 4OCGA 1H81A 3KLJA 2FJEA 3QJ4A 2YVFA 2WP9A 3JSKA 5ER0A 1E1MA 2YR4A 1H84A 1GV4A 3Q6JA 4A99A 5GSNA 2WBAA 2R0PA 1CBOA 3G5SA 2GR3A 4A9WA 5FS6A 5U1OA 1XPQA 2WPEA 2X50A 4H4PA 1LTXR 2OA1A 3M12A 4Z44A 1GXFA 2R9ZA 1K0LA 2B9WA 2Q0KA 2FBWA 2Z5YA 3CNTA 1AOGA 2EQ6A 4D04A 2A8XA 4OPCA 3KKJA 1TDEA 4U8MA 3UKKA 1FEAA 4BURA 3UOZA 3CGDA 3GWDA 1TYPA 2WPCA 4AOXA 2OLOA 4K7ZA 1VDCA 1KSUA 5IPYA 3I6DA 3DGZA 2XVFA 5U63A 1PXBA 3ITJA 1CJCA 1BGNA 1IUUA 4JNAA 4CBQA 4TM1A 3CGBA 1PBFA 2ARDA 1CC2A 1LV0A 4GDEA 4TM0A 1ZMCA 2BC1A 4H4YA 2BYBA 1NHRA 1IUXA 2WQYA 3DJGX 2GV8A 1JRYA 2R0CA 4RSLA 3II4A 4H7UA 3H8LA 3VRBA 1VG9A 2B76A 4TLZA 4YSXA 1H7XA 2B7SA 3REDA 4YSYA 1SEZA 3F8RA 2WU2A 4H4XA 1CHUA 3DGHA 2VZ2A 1RYIA 2PHHA 4C77A 4U2LA 4Y4LA 2JB2A 4EQSA 1NG3A 1F8WA 5HXIA 3T37A 1BZLA 1BGJA 3KVEA 2BS4A 4EQXA 1CL0A 2WS3A 3C4AA 4WCTA 3LADA 4X9NA 3LZWA 3UKPA 2V61A 2XLTA 2GMJA 3CNSA 5JCLA 4YT0A 5EBKA 2TMDA 4J2WA 3RNMA 1O94A 3CIRA 3K7TA 1IUVA 3RHAA 3AECA 4GRTA 2RABA 5KVHA 3ADAB 3FMWA 3I3LA 4H2QA 4X4JA 4P9SA 5CKUA 2YG4A 3Q9TA 1GTHA 4XXGA 1GRGA 5C3JA 3QFBA 2X8HA 2X8CA 2F5ZA 3G5QA 4UDQA 1IUWA 2BK4A 1KFYA 3NTDA 3GRSA 3BI2A 5KOXA 3UOXA 3ATQA 2H88A 3VR8A 5FS7A 4Z43A 5KWFA 2CDUA 3AD7B 1F3PA 3KD9A 4Y4NA 2VVLA 4AP3A 1XHCA 1ZOVA 1ZDLA 1KSSA 2V5ZA 1QLBA 1D4CA 1GRFA 2XYOA 1LQTA 1Z6LA 3CN8A 2EQ7A 3S5WA 3ZYXA 1Y56A 3NN6X 4I58A 2H89A 2WHDA 1B8SA 3ISHA 3P4SA 1X31B 1Y56B 2E1MA 2BK3A 3AEDA 4B63A 1GERA 5BUKA 4Z26A 3ICSA 1P2EA 2YG6A 1NEKA 4ICYA 2GAHB 4U8NA 1LVLA 3G5RA 4HA6A 2XFNA 3NHOX 1P2HA 4PAAA 2R4EA 4NEWA 4OPGA 3AE9A 1B37A 4WX1A 2C76A 5DBJA 3PO7A 1Q1RA 4GCMA 3CNPA 3FG2P 1D4EA 3BI4A 2R4JA 4ZN0A 1RSGA 4K5RA 1E1KA 2FJDA 4OPUA 1DOBA 4CRTA 4LU6A 2A89A 2XLUA 3K7QX 3LJPA 1DJQA 3NGCX 3ALLA 5GRTA 4JNQA 4H4VA 5M0ZA 1YY5A 3BHFA 4LA1A 3GRTA 1PJ5A 1PXCA 1TRBA 1VRQB 3NIXA 3NYCA 4YKFA 2XVIA 2JB3A 3VR9A 1GRHA 2XLSA 1TDOA 1H83A 1D5TA 2AQJA 2WP6A 3FBSA 2IVDA 3SFDA 2BC0A 1KNPA 3NNEA 3NYFA 4K22A 2GH5A 2WU5A 3UCLA 4YTMA 2GMHA 2BS2A 2VQBA 4BK1A 5LV9A 4NTDA 1NHPA 3RP7A 4MJWA 2JBVA 2WP5A 3IWAA 4FDCB 4IVMB 4EQRA 1CF3A 4J57A 2CULA 3AE1A 1MOKA 4JQ9A 2GEWA 2JKCA 4CCQA 2GRTA 2YG7A 1DOEA 2B9YA 1BKWA 3CNDA 1GRBA 1NHQA 3AE2A 3ALJA 2NPXA 4Z24A 4B68A 1DODA 5BULA 1BWCA 4BK3A 2OLNA 1FEBA 4NTEA 3UKFA 3P4QA 2Z5XA 2NVKX 1S2YA 3BNUA 3KA7A 1IUTA 2BA9A 1N4VA 2VQ7A 1GETA 3HZLA 3SM8A 4YWOA 1F6MA 1GRAA 2VOUA 3AE3A 5EB4A 3B3RA 1S2QA 4TM4A 2YM2A 4A65A 3O0HA 2C73A 4ZCCA 4Z2TA 2WOIA 4H4UA 3UKLA 2JK6A 2BABA 2R45A 4JN9A 2GR2A 1NHSA 1ONFA 1PBEA 2O9ZA 2CFYA 2YLXA 1D7YA 4EM3A 3BI5A 4H4RA 5TR3A 1GALA 2PYXA 1UKVG 5IQ1A 1GSNA 4BJYA 1PBBA 2WDVA 1M64A 3RP8A 2RGOA 3CGEA 4H4WA 1DNCA 1ZOYA 3C4NA 3URHA 2TPRA 3AEFA 3EF6A 2Q7VA 3DH9A 5U25A 2XFQA 2C72A 1ZP0A 4J33A 1PXAA 5FS9A 2WOVA 2V3AA 2YWLA 3BHKA 3NN0X 4D03A 4B66A 1LPFA 1DJNA 5JCNA 3AEGA 1PS9A 1RP0A 4NZHA 5JCKA 4OPLA 1YQZA 4CCRA 2GQFA 3UKHA 2QA1A 3H4KA 4U2SA 2C66A 4IVOB 1JRZA 4CY8A 1HYUA 2C70A 1PJ7A 5EB5A 4U8OA 1OJDA 3CPHG 4J31A 1PBCA 3F8DA 1TDNA 4KPRA 1ELIA 2GR1A 2VVMA 4U8KA 2V6OA 4A7AA 4EMJA 4UDRA 1L9EA 1Y0PA 2BACA 2XVJA 2RGHA 3WE0A 4YTNA 2BCGG 2BXRA 4AT2A 5HHFA 4E0VA 2GB0A 1E6EA 4B1BA 5HYMA 4APNA 5JCIA 3ALMA 3NYEA 1H86A 2VRLA 4AOSA 4A5LA 5J60A 3UTEA 1GESA 2JAEA 3CNJA 1YQ4A 4J34A 5KXJA 4GR1A 3GMCA 1JOAA 1JNZA 2XVHA 3NK1X 3AB1A 1L0VA 4J36A 4H2RA 2WPFA 1B5QA 2A87A 3AEAA 3RP6A 4REKA 1BF3A 3SQPA 1H7WA 3DK9A 2WESA 3AEEA 1IJHA 3ICRA 1F8RA 3GDNA 1ZKQA 2W0HA 3UP4A 4OPTA 2V3BA 3DK4A 4NTCA 4YXDA 3AXBA 3QSMA 2XCGA 1N1PA 1K0IA 3KU9A 2Q6UA 3ICTA 4EIQA 4X9MA 3L8KA 1QO8A 3NK0X 4JY2A 5IQ4A 2R46A 5BVAA 4DNAA 1ZY8A 4H4ZA 1NPXA 4HB9A 4K5SA 3GYJA 3P4PA 1PJ6A 4TM3A 4A79A 4J56A 1LJ1A 1S3BA 4USQA 4EIPA 4IA5A 3GDPA 3V3OA 3DK8A 1OJAA 2YAUA 4GDPA 4C74A 1CJ2A 2DKIA 4OVIA 1E39A 3PS9A 1MXTA 1FL2A 3P4RA 3UKQA 2YLRA 3DJDA 1F8SA 4H2NA 1QJDA 1ZX9A 2C3DA 3K30A 1E1LA 2YM1A 2X99A 4H4QA 3CPJG 2WOWA 2C7GA 4YKGA 3QFAA 2YLSA 4PABA 1GPEA 2BS3A 3GYIA 3LB8A 4RG3A 3FPZA 1FECA 5JCMA 2B7RA 3AYJA 1PDHA 3SGLA 2QA2A 4H4SA 4CNKA 2C65A 2UZZA 4YSHA 1FCDA 3V3NA 2B9XA 4Z2RA 3AE8A 1NENA 2YG5A 3DMEA 3IF9A 4OPDA 4ZCDA 1TDKA 2WDQA 1GT8A 2Y6RA 4M52A 3AE6A 4H4TA 1JEHA 2DKHA 1OJTA 2HQMA 2V60A 4H50A 3AE7A 4C3YA 1GRTA 1TYTA 1O95A 3CGCA 3VRAA 4ADWA 4EQWA 4BJZA 3LOVA 3S61A 4JY3A 1H82A 2BCPA 2VVLG 4GUVA 4BV6A 2GAGB 1JU2A 1VQWA 3P9UA 2XVEA 3QSSA 4FK1A 4U8PA 1KNRA 2WDRA 3R9UA 1LQUA 2YQUA 1H6VA 4JDRA 3IHMA 4FK1C 1S3EA 3EANA 1KDGA 1O5WA 3L1RA 3UP5A 4RG4A 4B69A 5M10A 3EAOA 3LXDA 4NEVA 1NDAA 3NH3X 4IA6A 2CVJA 2Y6QA 1NG4A 2XFUA 1OJ9A 1FOHA 2ZBWA 1K0JA 1CJ4A 4H2PA 2ZZCA 2RGJA 4YTPA 1W4XA 4AP1A 2QAEA 2X8GA 4DSGA 1CC4A 2XFPA 1XDIA 3AYIA 1IUSA 1EBDA 2BK5A 3GWFA 4XWRA 3QVPA 1COYA 4CY6A 2XFOA 4YSZA 1EL8A 1JRXA 3PVCA 3OC4A 2E5VA 3M13A 2YG3A 2YR6A 1CC6A 2C64A 5KRQA 4EMWA 1V59A 4C3XA 2AAQA 3AD9B 3D1CA 2XLRA 1EL7A 3COXA 3AWIA 3UTGA 1YKJA 2E4GA 1VG0A 3E1TA 3ZDNA 2QCUA 5HY5A 3NKSA 4K8DA 2IVEA 5EOWA 1EL5A 2FJAA 4C5OA 4B64A 1K4QA 2WEUA 3AYLA 3GMBA 5FS8A 2IIDA 4B67A 1GREA 1N4WA 2XLPA 3AE4A 3GSIA 2VRMA 1TDFA 4UP3A 5BRTA 1DOCA 2AR8A 4KX6A 1PHHA 4LIIA 3M0OA 2YVJA 3AEBA 4O5QA 2GQWA 4U8JA 2J3NA 2I0ZA 3NT6A 2ZZBA 5C2TA 4CNJA 3H8IA 3UTHA 4Y4MA 2OAMA 3QSEA 1KF6A 3QVRA 2R0GA 1YQ3A 1XANA 4ECHA 3GD3A 3D8XA 4USRA
chains in the Genus database with same CATH superfamily
2PP1A 3N4FA 1EL9A 2JB1A 3QKEA 1IYXA 4OPIA 4XWZA 2GR0A 1X2GA 1D7LA 1DXLA 3IJQA 1M6IA 4U2TA 2C75A 2YVGA 1FHUA 3KPFA 4IV9A 3DA1A 3CTYA 1ZK7A 3B6DA 3UKAA 2EQ9A 2YR5A 4G9KA 1MO9A 3H7VA 5FJPA 4FX9A 3AD8B 4A6NB 2OALA 3NTAA 3BNMA 1PBDA 2YLWA 1Q9IA 2AKMA 1CJ3A 4DSHA 4H2HA 4N9XA 4GF7A 3AM9A 4TLXA 3FIMB 1FHVA 3P3BA 3C96A 4OCGA 1H81A 2FJEA 2WP9A 3Q6JA 4A99A 2WBAA 2R0PA 1CBOA 1R6WA 5U1OA 2X50A 1ELSA 1LTXR 3VC6A 2R9ZA 1BKHA 2EQ6A 4OPCA 3B97A 3UKKA 2OKTA 1WYGA 2WPCA 2OLOA 4G7FA 4K7ZA 2XGZA 3U9IA 2XVFA 1FO4A 5U63A 1PXBA 3ITJA 1CJCA 1BGNA 4CBQA 1EC9A 2BC1A 4H4YA 1NHRA 3GY1A 1R0MA 2XSXA 1JRYA 3GD6A 3VRBA 1TE6A 4YSXA 1H7XA 2I5QA 1SEZA 3F8RA 4ENLA 2WU2A 3DGHA 2VZ2A 1RYIA 2PHHA 4Y4LA 2DW6A 4EQSA 4IL0A 4WCTA 3LZWA 3UKPA 2XLTA 2P3ZA 1RVKA 1KN0A 3BJSA 1X2HA 3AECA 5KVHA 4XXGA 1GRGA 3QFBA 2X8HA 2F5ZA 2GGHA 1KFYA 3GRSA 5KWFA 1F3PA 3QN3A 2VVLA 4AP3A 1ZOVA 3JW7A 1KSSA 4B1BA 1GRFA 2XYOA 3CN8A 2EQ7A 3DGBA 1Y56B 4Z26A 1FFVC 3B9JB 3VDGA 3G5RA 2R4EA 4WX1A 5DBJA 4GCMA 3FG2P 1BQGA 4II2A 2XLUA 4ROPA 3ALLA 5M0ZA 4LA1A 1VRQB 3NYCA 4IT1A 2PSNA 3CXBA 1D5TA 3ES8A 2IVDA 3DFHA 2VQBA 2BS2A 5LV9A 3HPFA 3RP7A 3V4BA 4MJWA 4FDCB 4IVMB 4H19A 3SN4A 2CULA 2JKCA 4II3A 1GRBA 2NPXA 4DWDA 1DODA 3VC5A 4NTEA 1FEBA 3UCCA 1S2YA 4H1ZA 3NZGA 3KA7A 3UXKA 4TM4A 4A65A 1JRPA 4Z2TA 4A6GA 2JK6A 1PBEA 1ONFA 1P43A 2CFYA 3BI5A 1GALA 5IQ1A 1GSNA 2PS2A 4DHGA 2TPRA 2Q7VA 5U25A 4J33A 1ZP0A 2WOVA 4D03A 4NZHA 4OPLA 5JCKA 3UJFA 2HXUA 1JRZA 2QGYA 4CY8A 5EB5A 3GC2A 2OLAA 4HPNA 2P88A 4U8KA 4A7AA 2VVMA 4EMJA 4UDRA 3UJEA 3WE0A 4YTNA 1E6EA 2QJMA 4A5LA 2NQLA 2JAEA 3CNJA 1YQ4A 4J34A 3TQPA 1EC7A 1MRAA 2XVHA 1L0VA 1MNSA 2A87A 2XH4A 3SQPA 1IJHA 3GDNA 1ZKQA 4IHCA 2V3BA 4YXDA 3AXBA 4FI4A 4X9MA 1QO8A 5IQ4A 4JY2A 4DNAA 4H4ZA 4IA5A 2ZADA 3GYXA 2OO6A 1MDRA 3JVAA 3K30A 1E1LA 2YM1A 3H8AA 2WOWA 3SZ0A 2YLSA 2XH0A 2PPGA 3AYJA 2PCEA 5FJTA 3N6HA 2C65A 2UZZA 4YSHA 1FCDA 3V3NA 2B9XA 1NENA 2YG5A 2OG9A 4M52A 2DKHA 3DERA 4JY3A 2BCPA 3OTRA 2XVEA 4FK1A 4U8PA 2YQUA 3IHMA 2BRYA 3EANA 1KDGA 1O5WA 3ES7A 3NH3X 4IA6A 3T4WA 2ZBWA 1VDVA 2QAEA 4GMEA 1CC4A 4DSGA 1IUSA 3M13A 3SN0A 1SJCA 1V59A 2AAQA 3R0KA 3I6TA 1JCTA 2FYMA 1EL7A 2OX4A 1YKJA 2E4GA 3E1TA 3UJRA 3ZDNA 3QPEA 4K8DA 1EL5A 1P48A 2FJAA 4B64A 3IK4A 1N4WA 3GSIA 2VRMA 1ECQA 2AR8A 1EBHA 3UXLA 4KT2A 3PFRA 4U8JA 4ZCWA 3H8IA 3UTHA 1ZXIC 4USRA 2DW7A 1OJCA 2C67A 2E5AA 1Q1WA 5FMHA 1E7PA 2YLZA 2EQ8A 4EMIA 3VQRA 3LZXA 4U8IA 1REOA 3IHGA 3H70A 2APGA 3T8QA 3FV9A 4AT0A 1ZMDA 2X3NA 1L9DA 2Q0LA 4TVYA 2FJBA 3V76A 3N4EA 1B4VA 1E1NA 3NK2X 1GEUA 2QQ6A 1D4DA 3UOVA 2PU1A 2GVCA 3P1WA 2OFJA 4JN7A 5L46A 2OZ8A 2YVFA 3THUA 3JSKA 1E1MA 5GSNA 3HRDC 5FS6A 2W55A 3RCYA 3M12A 1GXFA 1K0LA 2FBWA 4JHMA 3HYWA 1TDEA 4U8MA 1FEAA 4BURA 4IP4A 3EEZA 1KSUA 5IPYA 3I6DA 3FVDA 3DGZA 5EU9A 4JNAA 1IUUA 3CGBA 1CC2A 4GDEA 2BYBA 2WQYA 2R0CA 4H7UA 3DG3A 2B76A 4TLZA 2B7SA 2GGIA 1SJAA 1KKOA 2JB2A 3T37A 1BZLA 3TJIA 4EQXA 2WS3A 3C4AA 4DN1A 4GGHA 3NRZB 4G73A 4YT0A 5EBKA 4J2WA 1O94A 1W6TA 4H2QA 2YG4A 3Q9TA 1GTHA 3SR6B 3G5QA 3NTDA 3FYYA 3VR8A 4Z43A 1QLBA 1D4CA 1Z6LA 2H89A 3NXLA 1B8SA 3P4SA 4E4UA 3D46A 2YG6A 1TZZA 1T3QC 3T6CA 2XFNA 3NHOX 1P2HA 4PAAA 1B37A 2C76A 3PO7A 1Q1RA 1D4EA 4E8GA 4OPUA 1DOBA 4LU6A 3LJPA 1YY5A 3BHFA 4M0XA 3NIXA 2GGJA 3BOXA 3VR9A 3PK7A 2AQJA 4G74A 1KNPA 3NFUA 2GH5A 3SZFA 4BK1A 3A7UA 1XPYA 2JBVA 1N5WC 4EQRA 2W3SA 2GEWA 4CCQA 2GRTA 3DDMA 1N5XA 1NHQA 4EWJA 3ALJA 5BULA 4B68A 1BWCA 3UKFA 2Z5XA 2NVKX 2W54A 3BNUA 2MUCA 4DXKA 3Q45A 1N4VA 3D47A 2VQ7A 4YWOA 1F6MA 1GRAA 3B3RA 3T14A 1S2QA 2WOIA 3MQTA 4H4UA 5KNLA 1NHSA 3VFCA 2YLXA 3NVYB 4EM3A 2AL1A 4H4RA 2PYXA 3FJ4A 3MUCA 1PBBA 1DNCA 3URHA 3EF6A 2XFQA 2V3AA 2YWLA 3NN0X 4B66A 1LPFA 2P0IA 3AEGA 3T31A 3JZUA 1N63C 2GQFA 3UKHA 2QA1A 4U2SA 3RO6A 2C66A 4IVOB 2C70A 2PGWA 1TDNA 4KPRA 2GR1A 2P8BA 2XVJA 1F9CA 2BCGG 2BXRA 5HHFA 4E0VA 2RDXA 4APNA 3ALMA 2VRLA 3TJ4A 3UTEA 1V97A 4J36A 2WPFA 1B5QA 4G6HA 4REKA 1BF3A 4Z1YA 2WESA 3ICRA 2W0HA 4NTCA 2XCGA 3UGVA 2Q6UA 3ICTA 2FKPA 2HZGA 3NK0X 2R46A 3NVWB 5BVAA 1ZY8A 4K5SA 3P4PA 4TM3A 1LJ1A 4USQA 3DK8A 5BOFA 4C74A 3RR1A 3PS9A 3UKQA 2YLRA 4GIRA 3R11A 1F8SA 1QJDA 1ZX9A 3CPJG 3RRAA 3QFAA 2ZC8A 3LB8A 2HXTA 4RG3A 1PDHA 3SGLA 4J1OA 3CB3A 2QA2A 3FCPA 4Z2RA 4OPDA 3IF9A 1TDKA 2OQHA 4H4TA 4IP5A 2V60A 4H50A 1GRTA 1TYTA 1O95A 3LOVA 3S61A 1H82A 2VVLG 2GAGB 2HNEA 3QSSA 4DX3A 3R9UA 1LQUA 2C4CA 4B69A 3UP5A 3CT2A 4RG4A 3EAOA 3LXDA 3TTEA 2CVJA 2Y6QA 1FOHA 2ZZCA 2RGJA 1W4XA 4AP1A 2X8GA 3TWAA 1KKRA 4IZGA 3AYIA 2BK5A 5FJRA 3GWFA 4XWRA 3QVPA 4CY6A 1JRXA 3PVCA 1MDLA 3OC4A 4K1WA 2E5VA 2YG3A 1CC6A 2C64A 3EUB3 3D9XA 5IDZA 2IVEA 4C5OA 3SX6A 3AYLA 1GREA 2XLPA 1TDFA 4UP3A 3SQSA 2YVJA 5C2TA 2I0ZA 3AN1A 2ZZBA 4NNJA 3T9PA 2PODA 3ABVA 3AE5A 3NG7X 4Z25A 3GD4A 3KPKA 2XDOA 1L8PA 2BXSA 3IC9A 3NRNA 3CXOA 4HN8A 3EPTA 3PWIA 2ACZA 4A6NA 1NAAA 1L9CA 5KVIA 1XS2A 4TVWA 4BK2A 5KOWA 3SN1A 3NLCA 3RGTA 1PN0A 2WETA 3CPIG 4K2XA 1GV4A 1H84A 3G5SA 4E6MA 3A7RA 1XPQA 2WPEA 2OA1A 2Q0KA 3CNTA 2A8XA 2PTWA 4A3RA 3CGDA 3GWDA 1TYPA 2GL5A 3KUMA 1PBFA 1LV0A 4MMWA 1ZMCA 2PP3A 4RSLA 3II4A 3CMMA 3H8LA 1VG9A 5G5HB 3QTPA 3REDA 3I4KA 1CHUA 1S7MA 4C77A 1F8WA 5HXIA 3DEQA 1BGJA 4X9NA 3HYVA 2GMJA 2CHRA 4HNCA 1IUVA 3RHAA 4GRTA 2RABA 3I3LA 3CK5A 5C3JA 2X8CA 3ZLHA 1IUWA 4GYPC 3BI2A 5KOXA 3UOXA 2H88A 3AD7B 4Y4NA 1SB3B 3V3WA 3ZYXA 4KWSA 1Y56A 3NN6X 2POZA 3EKGA 1X31B 1GERA 1VQZA 3ICSA 3SZWA 5JRBA 1NEKA 2GAHB 4U8NA 3NS1B 1LVLA 3CYJA 2PA6A 4GFIA 3VA8A 2GGGA 3CNPA 5ENLA 2OVLA 3DG7A 3BI4A 4ZN0A 1RSGA 4K5RA 1E1KA 4ZA0A 4CRTA 2A89A 3NVZB 1DJQA 4KPLA 3NGCX 4JNQA 4H4VA 3GRTA 1TRBA 1PXCA 2XVIA 2W3RA 1GRHA 2WP6A 3FBSA 3NNEA 4K22A 2WU5A 3UCLA 2GMHA 4NTDA 1NHPA 2WP5A 3IJIA 3S5SA 5G5GB 3R0UA 3AE1A 4JQ9A 5KMPA 3CNDA 3AE2A 3R25A 1EBGA 2OLNA 4F4RA 1IUTA 2BA9A 2PMQA 3UJ2A 3SM8A 3AE3A 5EB4A 1MUCA 4ZCCA 3UKLA 2BABA 4JN9A 2O9ZA 4J3ZA 1H2IA 3TOYA 5TR3A 1UKVG 2WDVA 1M64A 3RP8A 1ZOYA 3V5CA 3C4NA 2AL2B 5FS9A 3BHKA 4HYRA 3S47A 5FJUA 1PS9A 1YQZA 4JN8A 1PJ7A 1JDFA 2MNRA 4U8OA 1OJDA 4J31A 1PBCA 1Y0PA 3GO2A 2BACA 4AT2A 5HYMA 3N6JA 3T2ZA 1H86A 1WUFA 5J60A 1GESA 3SXIA 3AB1A 4H2RA 3OP2A 3AEAA 3RP6A 1H7WA 4NWZA 1F8RA 3UP4A 1YEYA 4OPTA 1N1PA 4EIQA 1NPXA 3GYJA 4J56A 3ZLFA 4EIPA 4HCHA 4MKSA 1OJAA 1CJ2A 2DKIA 4OVIA 1E39A 1MXTA 1FL2A 1OEPA 2C3DA 2X99A 4H4QA 1KD0A 4KEMA 4YKGA 1JPMA 4PABA 1PDYA 2OZTA 2BS3A 1FECA 5FJOA 4CNKA 3DIPA 4ZCDA 2WDQA 1GT8A 4FP1A 2Y6RA 4K2SA 1JEHA 1OJTA 2HQMA 4E5TA 1RM6B 3CGCA 4ADWA 4EQWA 4BJZA 3MZNA 3CAWA 4M6UA 2PTZA 2WDRA 3ZVHB 4A35A 1S3EA 5M10A 3UCDA 4HCDA 2QVHA 4NEVA 1NG4A 2XFUA 1K0JA 4H2PA 3MSYA 4K8GA 5KMRA 2XFPA 2XH7A 2E3TA 1WUEA 1COYA 2XFOA 1EL8A 3IJLA 3L5OA 3PG6A 2PTYA 3AD9B 3OW1A 2BRAA 2XLRA 3AWIA 2QJJA 2QCUA 2PGEA 5HY5A 3NKSA 5EOWA 4GGBA 2ONEA 2WEUA 3GMBA 5FS8A 2IIDA 4B67A 1DOCA 4KX6A 1PHHA 4LIIA 3AEBA 2J3NA 3Q4DA 3NT6A 4Y4MA 2OAMA 3QSEA 3QVRA 2OZ3A 2R0GA 3H4KA 3GD3A 3D8XA 4EM4A 2YLTA 3ATRA 4B65A 4DGKA 3DESA 3K7MX 4GAPA 5CQFA 1JNRA 2QDEA 1GNDA 1FFUC 4O5UA 2QDDA 3OZ2A 3MKCA 1N4UA 3DJEA 4U8LA 2GF3A 3SFEA 3NO1A 3UTFA 1GOSA 3H12A 3VRDB 3DJJA 4HCLA 2ZZ0A 3SJNA 1GTEA 4I59A 1STZA 3UOYA 4UDPA 3TW9A 3F8PA 1JROA 5J7XA 3I6EA 4Z2UA 2C3CA 3QJ4A 3KLJA 5ER0A 2YR4A 2GR3A 4A9WA 4G6GA 2PU0A 4H4PA 4Z44A 1ONEA 2B9WA 2Z5YA 1AOGA 4D04A 3OZYA 3NVVB 3KKJA 4GAVA 3UOZA 4AOXA 3STPA 1VDCA 3UJSA 4ZOHB 4TM1A 2ARDA 4TM0A 1IUXA 3DJGX 2GV8A 3OZMA 4MGGA 1PDZA 5J04A 4YSYA 1N62C 4H4XA 2AL2A 4U2LA 1NG3A 3KVEA 2BS4A 1CL0A 3LADA 2V61A 3CNSA 5JCLA 2O56A 2P8CA 2TMDA 4H83A 3RNMA 3CIRA 3K7TA 3ADAB 3FMWA 4X4JA 5CKUA 4P9SA 1SJDA 4GYPA 3VCNA 4UDQA 2BK4A 1TKKA 4Z17A 3ATQA 5FS7A 2CDUA 3KD9A 3ENLA 1XHCA 1ZDLA 3OPSA 2V5ZA 3S5WA 5KMSA 1LQTA 3SBFA 3R10A 4I58A 2WHDA 3ISHA 3P0WA 2E1MA 2BK3A 3AEDA 5KMQA 4B63A 5BUKA 3QLDA 1P2EA 4ICYA 3SYIA 4HA6A 4NEWA 4OPGA 3AE9A 2R4JA 4G8TA 2FJDA 3K7QX 5GRTA 1NELA 1PJ5A 4YKFA 3T2YA 2JB3A 2XLSA 1TDOA 1H83A 3AMZA 3SY4A 3SFDA 2BC0A 3DG6A 3NYFA 1NU5A 4YTMA 3IWAA 3ETRB 1CF3A 4J57A 1MOKA 3HW2A 2YG7A 1DOEA 2B9YA 1BKWA 4Z24A 4BK3A 3P4QA 7ENLA 3RITA 3K1GA 1GETA 3HZLA 2VOUA 3R1ZA 3P93A 2YM2A 3O0HA 2GDQA 2C73A 3T0KA 1EC8A 1N60C 3R07C 4HNLA 2R45A 2GR2A 3ZVHA 1D7YA 1FIQB 4BJYA 3MWCA 2RGOA 3CGEA 4H4WA 3AEFA 3DH9A 2C72A 1PXAA 1DJNA 5JCNA 1RP0A 4CCRA 1E9IA 4GISA 1HYUA 3CPHG 3F8DA 1ELIA 2V6OA 1L9EA 2RGHA 2GB0A 3ZVIA 5JCIA 3NYEA 4AOSA 5KXJA 4GR1A 3GMCA 1JOAA 1JNZA 3NK1X 6ENLA 1DTNA 3DK9A 3AEEA 2PTXA 3DK4A 3MY9A 3U4FA 3QSMA 1K0IA 3KU9A 3L8KA 3FXGA 4YWSA 4HB9A 1PJ6A 4A79A 1S3BA 4E4FA 3A7AA 3GDPA 3V3OA 3BSMA 2YAUA 4GDPA 3V5FA 2PP0A 3P4RA 3DJDA 4H2NA 1KCZA 2C7GA 3PWGA 1GPEA 3GYIA 3FPZA 3HYXA 5JCMA 2B7RA 5BOEA 1N61C 2OQYA 4H4SA 3AE8A 3DMEA 2AKZA 3AE6A 3AE7A 4C3YA 3VRAA 4X2PA 2GSHA 4GUVA 4BV6A 3TCSA 1JU2A 1VQWA 3P9UA 2OPJA 4IL2A 1KNRA 3DFYA 1H6VA 4JDRA 3SSZA 4FK1C 3L1RA 1NDAA 2GGEA 1OJ9A 1CJ4A 3SZCA 3TWBA 4YTPA 1XDIA 2XH2A 1EBDA 4YSZA 3T2KA 2YR6A 5KRQA 4EMWA 4C3XA 3D1CA 3ZLGA 3COXA 3UTGA 1VG0A 1SJBA 1JPDX 1K4QA 3VCCA 2QJNA 3AE4A 5BRTA 3M0OA 4O5QA 2GQWA 4CNJA 1KF6A 4DYEA 1YQ3A 1XANA 4ECHA
chains in the Genus database with same CATH topology
1OJCA 3ABVA 4EM4A 2YLTA 3AE5A 3ATRA 4B65A 2C67A 1EL9A 2JB1A 3NG7X 4Z25A 1Q1WA 5FMHA 1E7PA 4OPIA 4DGKA 4XWZA 2GR0A 3GD4A 1D7LA 1DXLA 3K7MX 3KPKA 2XDOA 1M6IA 4GAPA 2C75A 2YVGA 2YLZA 4U2TA 5CQFA 2EQ8A 1JNRA 4EMIA 1GNDA 3DA1A 3CTYA 3KPFA 4IV9A 1ZK7A 2BXSA 3VQRA 3LZXA 3IC9A 3B6DA 3UKAA 4O5UA 3NRNA 2EQ9A 3EPTA 2YR5A 3OZ2A 4G9KA 4U8IA 2ACZA 1REOA 1NAAA 1N4UA 3DJEA 3IHGA 4A6NA 2APGA 1MO9A 1L9CA 4FX9A 5KVIA 4AT0A 4U8LA 1ZMDA 2X3NA 3AD8B 4A6NB 2GF3A 1L9DA 2Q0LA 4BK2A 3SFEA 2FJBA 3V76A 2OALA 3NTAA 5KOWA 1B4VA 3BNMA 1E1NA 3NK2X 1PBDA 3UTFA 1GEUA 1GOSA 2YLWA 1D4DA 1Q9IA 3UOVA 3VRDB 1CJ3A 3DJJA 2ZZ0A 1GTEA 3NLCA 4I59A 4DSHA 2GVCA 3P1WA 3UOYA 4UDPA 4N9XA 4GF7A 4TLXA 3FIMB 3F8PA 5J7XA 1PN0A 5L46A 2WETA 3C96A 3CPIG 4K2XA 4Z2UA 2C3CA 4OCGA 1H81A 3KLJA 2FJEA 3QJ4A 2YVFA 2WP9A 3JSKA 5ER0A 1E1MA 2YR4A 1H84A 1GV4A 3Q6JA 4A99A 5GSNA 2WBAA 2R0PA 1CBOA 3G5SA 2GR3A 4A9WA 5FS6A 5U1OA 4G6GA 1XPQA 2WPEA 2X50A 4H4PA 1LTXR 2OA1A 3M12A 4Z44A 1GXFA 2R9ZA 1K0LA 2B9WA 2Q0KA 2FBWA 2Z5YA 3CNTA 1AOGA 2EQ6A 4D04A 2A8XA 4OPCA 3HYWA 1TDEA 3KKJA 4GAVA 1FEAA 4BURA 4U8MA 3UKKA 3UOZA 3CGDA 3GWDA 1TYPA 2WPCA 4AOXA 2OLOA 4K7ZA 1VDCA 1KSUA 5IPYA 3I6DA 3DGZA 2XVFA 5U63A 1PXBA 3ITJA 1CJCA 1BGNA 1IUUA 4JNAA 4CBQA 4TM1A 3CGBA 1PBFA 2ARDA 1CC2A 1LV0A 4GDEA 4TM0A 1ZMCA 2BC1A 4H4YA 2BYBA 1NHRA 1IUXA 2WQYA 3DJGX 2GV8A 1JRYA 2R0CA 4RSLA 3II4A 4H7UA 3CMMA 3H8LA 3VRBA 1VG9A 2B76A 4TLZA 4YSXA 1H7XA 2B7SA 3REDA 4YSYA 1SEZA 3F8RA 2WU2A 4H4XA 1CHUA 1S7MA 3DGHA 2VZ2A 1RYIA 2PHHA 4C77A 4U2LA 4Y4LA 2JB2A 4EQSA 1NG3A 1F8WA 5HXIA 3T37A 1BZLA 1BGJA 3KVEA 2BS4A 4EQXA 1CL0A 2WS3A 3C4AA 3HYVA 3LADA 4WCTA 4X9NA 3LZWA 3UKPA 2V61A 4G73A 2XLTA 2GMJA 3CNSA 5JCLA 1KN0A 4YT0A 5EBKA 2TMDA 4J2WA 3RNMA 1O94A 3CIRA 3K7TA 1IUVA 3RHAA 3AECA 4GRTA 2RABA 5KVHA 3ADAB 3FMWA 3I3LA 4H2QA 4X4JA 4P9SA 5CKUA 2YG4A 3Q9TA 1GTHA 4XXGA 1GRGA 5C3JA 3QFBA 2X8HA 2X8CA 2F5ZA 3G5QA 4UDQA 1IUWA 2BK4A 1KFYA 3NTDA 3GRSA 3BI2A 5KOXA 3UOXA 3ATQA 2H88A 3VR8A 5FS7A 4Z43A 5KWFA 2CDUA 3AD7B 1F3PA 3KD9A 4Y4NA 2VVLA 4AP3A 1XHCA 1ZOVA 1ZDLA 1KSSA 2V5ZA 1QLBA 1D4CA 1GRFA 2XYOA 1LQTA 1Z6LA 3CN8A 2EQ7A 3S5WA 3ZYXA 5KMSA 1Y56A 3NN6X 4I58A 2H89A 2WHDA 1B8SA 3ISHA 3P4SA 1X31B 1Y56B 2E1MA 2BK3A 3AEDA 5KMQA 1GERA 4B63A 5BUKA 4Z26A 3ICSA 3SZWA 1P2EA 2YG6A 5JRBA 1NEKA 2GAHB 4ICYA 4U8NA 1LVLA 3SYIA 3G5RA 4HA6A 2XFNA 3NHOX 1P2HA 4PAAA 2R4EA 4NEWA 4OPGA 3AE9A 1B37A 4WX1A 2C76A 5DBJA 3PO7A 1Q1RA 4GCMA 3CNPA 3FG2P 1D4EA 3BI4A 2R4JA 4II2A 4ZN0A 1RSGA 4K5RA 1E1KA 2FJDA 4OPUA 1DOBA 4CRTA 4LU6A 2A89A 2XLUA 3K7QX 3LJPA 1DJQA 3NGCX 3ALLA 5GRTA 4JNQA 4H4VA 5M0ZA 1YY5A 3BHFA 4LA1A 3GRTA 1PJ5A 1PXCA 1TRBA 1VRQB 3NIXA 3NYCA 4YKFA 2XVIA 3T2YA 2JB3A 3VR9A 1GRHA 2XLSA 1TDOA 1H83A 1D5TA 2AQJA 2WP6A 3SY4A 3FBSA 4G74A 2IVDA 3SFDA 2BC0A 1KNPA 3NNEA 3NYFA 4K22A 2GH5A 2WU5A 3UCLA 4YTMA 2GMHA 2BS2A 2VQBA 3SZFA 4BK1A 5LV9A 4NTDA 1NHPA 3RP7A 4MJWA 2JBVA 2WP5A 3IWAA 4FDCB 4IVMB 4EQRA 1CF3A 4J57A 2CULA 3AE1A 1MOKA 4JQ9A 2GEWA 2JKCA 4CCQA 2GRTA 2YG7A 4II3A 1DOEA 2B9YA 1BKWA 5KMPA 3CNDA 1GRBA 1NHQA 3AE2A 3ALJA 2NPXA 4Z24A 4B68A 1DODA 5BULA 1BWCA 4BK3A 2OLNA 1FEBA 4NTEA 3UKFA 3P4QA 2Z5XA 2NVKX 1S2YA 3BNUA 3KA7A 1IUTA 2BA9A 1N4VA 2VQ7A 1GETA 3HZLA 3SM8A 4YWOA 1F6MA 1GRAA 2VOUA 3AE3A 5EB4A 3B3RA 3T14A 1S2QA 4TM4A 2YM2A 4A65A 3O0HA 2C73A 4ZCCA 3T0KA 2WOIA 4Z2TA 4H4UA 3UKLA 2JK6A 2BABA 2R45A 4JN9A 2GR2A 1NHSA 1ONFA 1PBEA 2O9ZA 5KNLA 2CFYA 1H2IA 2YLXA 1D7YA 4EM3A 3BI5A 4H4RA 5TR3A 1GALA 2PYXA 1UKVG 5IQ1A 1GSNA 4BJYA 1PBBA 2WDVA 1M64A 3RP8A 2RGOA 3CGEA 4H4WA 1DNCA 1ZOYA 3C4NA 3URHA 2TPRA 3AEFA 3EF6A 2Q7VA 3DH9A 5U25A 2XFQA 2C72A 1ZP0A 4J33A 1PXAA 5FS9A 2WOVA 2V3AA 2YWLA 3BHKA 3NN0X 4D03A 4B66A 1LPFA 1DJNA 5JCNA 3AEGA 1PS9A 1RP0A 4NZHA 5JCKA 4OPLA 1YQZA 4CCRA 3T31A 2GQFA 3UKHA 2QA1A 3H4KA 4U2SA 2C66A 4IVOB 1JRZA 4CY8A 1HYUA 2C70A 1PJ7A 5EB5A 4U8OA 1OJDA 3CPHG 4J31A 1PBCA 3F8DA 1TDNA 4KPRA 1ELIA 2GR1A 2VVMA 4U8KA 2V6OA 4A7AA 4EMJA 4UDRA 1L9EA 1Y0PA 2BACA 2XVJA 2RGHA 3WE0A 4YTNA 2BCGG 2BXRA 4AT2A 5HHFA 4E0VA 2GB0A 1E6EA 4B1BA 5HYMA 4APNA 5JCIA 3ALMA 3NYEA 3T2ZA 1H86A 2VRLA 4AOSA 4A5LA 5J60A 3UTEA 1GESA 2JAEA 3CNJA 1YQ4A 3SXIA 4J34A 5KXJA 4GR1A 3GMCA 1JOAA 1JNZA 2XVHA 3NK1X 3AB1A 1L0VA 4J36A 4H2RA 2WPFA 1B5QA 4G6HA 2A87A 3AEAA 3RP6A 4REKA 1BF3A 3SQPA 1H7WA 3DK9A 2WESA 3AEEA 1IJHA 3ICRA 4NWZA 1F8RA 3GDNA 1ZKQA 2W0HA 3UP4A 4OPTA 2V3BA 3DK4A 4NTCA 4YXDA 3AXBA 3QSMA 2XCGA 1N1PA 1K0IA 3KU9A 2Q6UA 3ICTA 4EIQA 4X9MA 3L8KA 1QO8A 3NK0X 4JY2A 5IQ4A 2R46A 5BVAA 4DNAA 1ZY8A 4H4ZA 1NPXA 4HB9A 4K5SA 3GYJA 3P4PA 1PJ6A 4TM3A 4A79A 4J56A 1LJ1A 1S3BA 4USQA 4EIPA 4IA5A 3GDPA 3V3OA 3DK8A 1OJAA 2YAUA 4GDPA 4C74A 1CJ2A 2DKIA 3GYXA 1E39A 3PS9A 4OVIA 1MXTA 1FL2A 3P4RA 3UKQA 2YLRA 3DJDA 1F8SA 4H2NA 1QJDA 1ZX9A 2C3DA 3K30A 1E1LA 2YM1A 2X99A 4H4QA 3CPJG 2WOWA 2C7GA 3SZ0A 4YKGA 3QFAA 2YLSA 4PABA 1GPEA 2BS3A 3GYIA 3LB8A 4RG3A 3FPZA 3HYXA 1FECA 5JCMA 2B7RA 3AYJA 1PDHA 3SGLA 2QA2A 4H4SA 4CNKA 2C65A 2UZZA 4YSHA 1FCDA 3V3NA 2B9XA 4Z2RA 3AE8A 1NENA 2YG5A 3DMEA 3IF9A 4OPDA 4ZCDA 1TDKA 2WDQA 1GT8A 2Y6RA 4M52A 3AE6A 4H4TA 1JEHA 2DKHA 1OJTA 2HQMA 2V60A 4H50A 3AE7A 4C3YA 1GRTA 1TYTA 1O95A 3CGCA 3VRAA 4ADWA 4EQWA 4BJZA 3LOVA 3S61A 4JY3A 1H82A 2BCPA 2VVLG 4GUVA 4BV6A 2GAGB 1JU2A 1VQWA 3P9UA 2XVEA 3QSSA 4FK1A 4U8PA 1KNRA 2WDRA 3R9UA 1LQUA 2C4CA 2YQUA 1H6VA 4JDRA 3IHMA 4FK1C 2BRYA 1S3EA 3EANA 1KDGA 1O5WA 3L1RA 3UP5A 4RG4A 4B69A 5M10A 3EAOA 3LXDA 4NEVA 1NDAA 3NH3X 4IA6A 2CVJA 2Y6QA 1NG4A 2XFUA 1OJ9A 1FOHA 2ZBWA 1K0JA 1CJ4A 4H2PA 2ZZCA 2RGJA 3SZCA 4YTPA 1W4XA 4AP1A 2QAEA 2X8GA 5KMRA 4DSGA 1CC4A 2XFPA 1XDIA 3AYIA 1IUSA 1EBDA 2BK5A 3GWFA 4XWRA 3QVPA 1COYA 4CY6A 2XFOA 4YSZA 1EL8A 1JRXA 3PVCA 3OC4A 2E5VA 3M13A 3T2KA 2YG3A 3L5OA 2YR6A 1CC6A 3PG6A 2C64A 4EMWA 5KRQA 1V59A 4C3XA 2AAQA 3AD9B 2BRAA 3D1CA 2XLRA 1EL7A 3D9XA 3COXA 3AWIA 3UTGA 1YKJA 2E4GA 1VG0A 3E1TA 3ZDNA 2QCUA 5HY5A 3NKSA 4K8DA 2IVEA 5EOWA 1EL5A 2FJAA 4C5OA 4B64A 1K4QA 3SX6A 2WEUA 3AYLA 3GMBA 5FS8A 2IIDA 4B67A 1GREA 1N4WA 2XLPA 3AE4A 3GSIA 2VRMA 1TDFA 4UP3A 5BRTA 1DOCA 2AR8A 4KX6A 1PHHA 4LIIA 3M0OA 2YVJA 3AEBA 4O5QA 2GQWA 4U8JA 2J3NA 2I0ZA 3NT6A 2ZZBA 5C2TA 4CNJA 3H8IA 3UTHA 4NNJA 4Y4MA 2OAMA 3QSEA 1KF6A 3QVRA 2R0GA 1YQ3A 1XANA 4ECHA 3GD3A 3D8XA 4USRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJC A;  3ABV A;  4EM4 A;  2YLT A;  3AE5 A;  3ATR A;  4B65 A;  2C67 A;  1EL9 A;  2JB1 A;  3NG7 X;  4Z25 A;  1Q1W A;  5FMH A;  1E7P A;  4OPI A;  4DGK A;  4XWZ A;  2GR0 A;  3GD4 A;  1D7L A;  1DXL A;  3K7M X;  2XDO A;  1M6I A;  4U2T A;  2C75 A;  2YVG A;  2YLZ A;  5CQF A;  2EQ8 A;  1JNR A;  4EMI A;  1GND A;  3DA1 A;  3CTY A;  3KPF A;  4IV9 A;  1ZK7 A;  2BXS A;  3VQR A;  3LZX A;  3IC9 A;  3B6D A;  3UKA A;  4O5U A;  3NRN A;  2EQ9 A;  3EPT A;  2YR5 A;  3OZ2 A;  4U8I A;  2ACZ A;  1REO A;  1NAA A;  1N4U A;  3DJE A;  3IHG A;  4A6N A;  2APG A;  1MO9 A;  1L9C A;  4FX9 A;  5KVI A;  4AT0 A;  4U8L A;  1ZMD A;  2X3N A;  3AD8 B;  4A6N B;  2GF3 A;  1L9D A;  2Q0L A;  4BK2 A;  3SFE A;  2FJB A;  3V76 A;  2OAL A;  3NTA A;  5KOW A;  1B4V A;  3BNM A;  1E1N A;  3NK2 X;  1PBD A;  3UTF A;  1GEU A;  1GOS A;  2YLW A;  1D4D A;  1Q9I A;  3UOV A;  3VRD B;  1CJ3 A;  3DJJ A;  2ZZ0 A;  1GTE A;  3NLC A;  4I59 A;  4DSH A;  2GVC A;  3P1W A;  3UOY A;  4UDP A;  4N9X A;  4GF7 A;  4TLX A;  3FIM B;  3F8P A;  5J7X A;  1PN0 A;  5L46 A;  2WET A;  3C96 A;  3CPI G;  4K2X A;  4Z2U A;  2C3C A;  4OCG A;  1H81 A;  3KLJ A;  2FJE A;  3QJ4 A;  2YVF A;  2WP9 A;  3JSK A;  5ER0 A;  1E1M A;  2YR4 A;  1H84 A;  1GV4 A;  3Q6J A;  4A99 A;  5GSN A;  2WBA A;  2R0P A;  1CBO A;  3G5S A;  2GR3 A;  4A9W A;  5FS6 A;  5U1O A;  1XPQ A;  2WPE A;  2X50 A;  4H4P A;  1LTX R;  2OA1 A;  3M12 A;  4Z44 A;  1GXF A;  2R9Z A;  1K0L A;  2B9W A;  2Q0K A;  2FBW A;  2Z5Y A;  3CNT A;  1AOG A;  2EQ6 A;  4D04 A;  2A8X A;  4OPC A;  3KKJ A;  1TDE A;  4U8M A;  3UKK A;  1FEA A;  4BUR A;  3UOZ A;  3CGD A;  3GWD A;  1TYP A;  2WPC A;  4AOX A;  2OLO A;  4K7Z A;  1VDC A;  1KSU A;  5IPY A;  3I6D A;  3DGZ A;  2XVF A;  5U63 A;  1PXB A;  3ITJ A;  1CJC A;  1BGN A;  1IUU A;  4JNA A;  4CBQ A;  4TM1 A;  3CGB A;  1PBF A;  2ARD A;  1CC2 A;  1LV0 A;  4GDE A;  4TM0 A;  1ZMC A;  2BC1 A;  4H4Y A;  2BYB A;  1NHR A;  1IUX A;  2WQY A;  3DJG X;  2GV8 A;  1JRY A;  2R0C A;  4RSL A;  3II4 A;  4H7U A;  3H8L A;  3VRB A;  1VG9 A;  2B76 A;  4TLZ A;  4YSX A;  1H7X A;  2B7S A;  3RED A;  4YSY A;  1SEZ A;  3F8R A;  2WU2 A;  4H4X A;  1CHU A;  3DGH A;  2VZ2 A;  1RYI A;  2PHH A;  4C77 A;  4U2L A;  4Y4L A;  2JB2 A;  4EQS A;  1NG3 A;  1F8W A;  5HXI A;  3T37 A;  1BZL A;  1BGJ A;  3KVE A;  2BS4 A;  4EQX A;  1CL0 A;  2WS3 A;  3C4A A;  4WCT A;  3LAD A;  4X9N A;  3LZW A;  3UKP A;  2V61 A;  2XLT A;  2GMJ A;  3CNS A;  5JCL A;  4YT0 A;  5EBK A;  2TMD A;  4J2W A;  3RNM A;  1O94 A;  3CIR A;  3K7T A;  1IUV A;  3RHA A;  3AEC A;  4GRT A;  2RAB A;  5KVH A;  3ADA B;  3FMW A;  3I3L A;  4H2Q A;  4X4J A;  4P9S A;  5CKU A;  2YG4 A;  3Q9T A;  1GTH A;  4XXG A;  1GRG A;  5C3J A;  3QFB A;  2X8H A;  2X8C A;  2F5Z A;  3G5Q A;  4UDQ A;  1IUW A;  2BK4 A;  1KFY A;  3NTD A;  3GRS A;  3BI2 A;  5KOX A;  3UOX A;  3ATQ A;  2H88 A;  3VR8 A;  5FS7 A;  4Z43 A;  5KWF A;  2CDU A;  3AD7 B;  1F3P A;  3KD9 A;  4Y4N A;  2VVL A;  4AP3 A;  1XHC A;  1ZOV A;  1ZDL A;  1KSS A;  2V5Z A;  1QLB A;  1D4C A;  1GRF A;  2XYO A;  1LQT A;  1Z6L A;  3CN8 A;  2EQ7 A;  3S5W A;  3ZYX A;  1Y56 A;  3NN6 X;  4I58 A;  2H89 A;  2WHD A;  1B8S A;  3ISH A;  3P4S A;  1X31 B;  1Y56 B;  2E1M A;  2BK3 A;  3AED A;  4B63 A;  1GER A;  5BUK A;  4Z26 A;  3ICS A;  1P2E A;  2YG6 A;  1NEK A;  4ICY A;  2GAH B;  4U8N A;  1LVL A;  3G5R A;  4HA6 A;  2XFN A;  3NHO X;  1P2H A;  4PAA A;  2R4E A;  4NEW A;  4OPG A;  3AE9 A;  1B37 A;  4WX1 A;  2C76 A;  5DBJ A;  3PO7 A;  1Q1R A;  4GCM A;  3CNP A;  3FG2 P;  1D4E A;  3BI4 A;  2R4J A;  4ZN0 A;  1RSG A;  4K5R A;  1E1K A;  2FJD A;  4OPU A;  1DOB A;  4CRT A;  4LU6 A;  2A89 A;  2XLU A;  3K7Q X;  3LJP A;  1DJQ A;  3NGC X;  3ALL A;  5GRT A;  4JNQ A;  4H4V A;  5M0Z A;  1YY5 A;  3BHF A;  4LA1 A;  3GRT A;  1PJ5 A;  1PXC A;  1TRB A;  1VRQ B;  3NIX A;  3NYC A;  4YKF A;  2XVI A;  2JB3 A;  3VR9 A;  1GRH A;  2XLS A;  1TDO A;  1H83 A;  1D5T A;  2AQJ A;  2WP6 A;  3FBS A;  2IVD A;  3SFD A;  2BC0 A;  1KNP A;  3NNE A;  3NYF A;  4K22 A;  2GH5 A;  2WU5 A;  3UCL A;  4YTM A;  2GMH A;  2BS2 A;  2VQB A;  4BK1 A;  5LV9 A;  4NTD A;  1NHP A;  3RP7 A;  4MJW A;  2JBV A;  2WP5 A;  3IWA A;  4FDC B;  4IVM B;  4EQR A;  1CF3 A;  4J57 A;  2CUL A;  3AE1 A;  1MOK A;  4JQ9 A;  2GEW A;  2JKC A;  4CCQ A;  2GRT A;  2YG7 A;  1DOE A;  2B9Y A;  1BKW A;  3CND A;  1GRB A;  1NHQ A;  3AE2 A;  3ALJ A;  2NPX A;  4Z24 A;  4B68 A;  1DOD A;  5BUL A;  1BWC A;  4BK3 A;  2OLN A;  1FEB A;  4NTE A;  3UKF A;  3P4Q A;  2Z5X A;  2NVK X;  1S2Y A;  3BNU A;  3KA7 A;  1IUT A;  2BA9 A;  1N4V A;  2VQ7 A;  1GET A;  3HZL A;  3SM8 A;  4YWO A;  1F6M A;  1GRA A;  2VOU A;  3AE3 A;  5EB4 A;  3B3R A;  1S2Q A;  4TM4 A;  2YM2 A;  4A65 A;  3O0H A;  2C73 A;  4ZCC A;  4Z2T A;  2WOI A;  4H4U A;  3UKL A;  2JK6 A;  2BAB A;  2R45 A;  4JN9 A;  2GR2 A;  1NHS A;  1ONF A;  1PBE A;  2O9Z A;  2CFY A;  2YLX A;  1D7Y A;  4EM3 A;  3BI5 A;  4H4R A;  5TR3 A;  1GAL A;  2PYX A;  1UKV G;  5IQ1 A;  1GSN A;  4BJY A;  1PBB A;  2WDV A;  1M64 A;  3RP8 A;  2RGO A;  3CGE A;  4H4W A;  1DNC A;  1ZOY A;  3C4N A;  3URH A;  2TPR A;  3AEF A;  3EF6 A;  2Q7V A;  3DH9 A;  5U25 A;  2XFQ A;  2C72 A;  1ZP0 A;  4J33 A;  1PXA A;  5FS9 A;  2WOV A;  2V3A A;  2YWL A;  3BHK A;  3NN0 X;  4D03 A;  4B66 A;  1LPF A;  1DJN A;  5JCN A;  3AEG A;  1PS9 A;  1RP0 A;  4NZH A;  5JCK A;  4OPL A;  1YQZ A;  4CCR A;  2GQF A;  3UKH A;  2QA1 A;  3H4K A;  4U2S A;  2C66 A;  4IVO B;  1JRZ A;  4CY8 A;  1HYU A;  2C70 A;  1PJ7 A;  5EB5 A;  4U8O A;  1OJD A;  3CPH G;  4J31 A;  1PBC A;  3F8D A;  1TDN A;  4KPR A;  1ELI A;  2GR1 A;  2VVM A;  4U8K A;  2V6O A;  4A7A A;  4EMJ A;  4UDR A;  1L9E A;  1Y0P A;  2BAC A;  2XVJ A;  2RGH A;  3WE0 A;  4YTN A;  2BCG G;  2BXR A;  4AT2 A;  5HHF A;  4E0V A;  2GB0 A;  1E6E A;  4B1B A;  5HYM A;  4APN A;  5JCI A;  3ALM A;  3NYE A;  1H86 A;  2VRL A;  4AOS A;  4A5L A;  5J60 A;  3UTE A;  1GES A;  2JAE A;  3CNJ A;  1YQ4 A;  4J34 A;  5KXJ A;  4GR1 A;  3GMC A;  1JOA A;  1JNZ A;  2XVH A;  3NK1 X;  3AB1 A;  1L0V A;  4J36 A;  4H2R A;  2WPF A;  1B5Q A;  2A87 A;  3AEA A;  3RP6 A;  4REK A;  1BF3 A;  3SQP A;  1H7W A;  3DK9 A;  2WES A;  3AEE A;  1IJH A;  3ICR A;  1F8R A;  3GDN A;  1ZKQ A;  2W0H A;  3UP4 A;  4OPT A;  2V3B A;  3DK4 A;  4NTC A;  4YXD A;  3AXB A;  3QSM A;  2XCG A;  1N1P A;  1K0I A;  3KU9 A;  2Q6U A;  3ICT A;  4EIQ A;  4X9M A;  3L8K A;  1QO8 A;  3NK0 X;  4JY2 A;  5IQ4 A;  2R46 A;  5BVA A;  4DNA A;  1ZY8 A;  4H4Z A;  1NPX A;  4HB9 A;  4K5S A;  3GYJ A;  3P4P A;  1PJ6 A;  4TM3 A;  4A79 A;  4J56 A;  1LJ1 A;  1S3B A;  4USQ A;  4EIP A;  4IA5 A;  3GDP A;  3V3O A;  3DK8 A;  1OJA A;  2YAU A;  4GDP A;  4C74 A;  1CJ2 A;  2DKI A;  4OVI A;  1E39 A;  3PS9 A;  1MXT A;  1FL2 A;  3P4R A;  3UKQ A;  2YLR A;  3DJD A;  1F8S A;  4H2N A;  1QJD A;  1ZX9 A;  2C3D A;  3K30 A;  1E1L A;  2YM1 A;  2X99 A;  4H4Q A;  3CPJ G;  2WOW A;  2C7G A;  4YKG A;  3QFA A;  2YLS A;  4PAB A;  1GPE A;  2BS3 A;  3GYI A;  3LB8 A;  4RG3 A;  3FPZ A;  1FEC A;  5JCM A;  2B7R A;  3AYJ A;  1PDH A;  3SGL A;  2QA2 A;  4H4S A;  4CNK A;  2C65 A;  2UZZ A;  4YSH A;  1FCD A;  3V3N A;  2B9X A;  4Z2R A;  3AE8 A;  1NEN A;  2YG5 A;  3DME A;  3IF9 A;  4OPD A;  4ZCD A;  1TDK A;  2WDQ A;  1GT8 A;  2Y6R A;  4M52 A;  3AE6 A;  4H4T A;  1JEH A;  2DKH A;  1OJT A;  2HQM A;  2V60 A;  4H50 A;  3AE7 A;  4C3Y A;  1GRT A;  1TYT A;  1O95 A;  3CGC A;  3VRA A;  4ADW A;  4EQW A;  4BJZ A;  3LOV A;  3S61 A;  4JY3 A;  1H82 A;  2BCP A;  2VVL G;  4GUV A;  4BV6 A;  2GAG B;  1JU2 A;  1VQW A;  3P9U A;  2XVE A;  3QSS A;  4FK1 A;  4U8P A;  1KNR A;  2WDR A;  3R9U A;  1LQU A;  2YQU A;  1H6V A;  4JDR A;  3IHM A;  4FK1 C;  1S3E A;  3EAN A;  1KDG A;  1O5W A;  3L1R A;  3UP5 A;  4RG4 A;  4B69 A;  5M10 A;  3EAO A;  3LXD A;  4NEV A;  1NDA A;  3NH3 X;  4IA6 A;  2CVJ A;  2Y6Q A;  1NG4 A;  2XFU A;  1OJ9 A;  1FOH A;  2ZBW A;  1K0J A;  1CJ4 A;  4H2P A;  2ZZC A;  2RGJ A;  4YTP A;  1W4X A;  4AP1 A;  2QAE A;  2X8G A;  4DSG A;  1CC4 A;  2XFP A;  1XDI A;  3AYI A;  1IUS A;  1EBD A;  2BK5 A;  3GWF A;  4XWR A;  3QVP A;  1COY A;  4CY6 A;  2XFO A;  4YSZ A;  1EL8 A;  1JRX A;  3PVC A;  3OC4 A;  2E5V A;  3M13 A;  2YG3 A;  2YR6 A;  1CC6 A;  2C64 A;  5KRQ A;  4EMW A;  1V59 A;  4C3X A;  2AAQ A;  3AD9 B;  3D1C A;  2XLR A;  1EL7 A;  3COX A;  3AWI A;  3UTG A;  1YKJ A;  2E4G A;  1VG0 A;  3E1T A;  3ZDN A;  2QCU A;  5HY5 A;  3NKS A;  4K8D A;  2IVE A;  5EOW A;  1EL5 A;  2FJA A;  4C5O A;  4B64 A;  1K4Q A;  2WEU A;  3AYL A;  3GMB A;  5FS8 A;  2IID A;  4B67 A;  1GRE A;  1N4W A;  2XLP A;  3AE4 A;  3GSI A;  2VRM A;  1TDF A;  4UP3 A;  5BRT A;  1DOC A;  2AR8 A;  4KX6 A;  1PHH A;  4LII A;  3M0O A;  2YVJ A;  3AEB A;  4O5Q A;  2GQW A;  4U8J A;  2J3N A;  2I0Z A;  3NT6 A;  2ZZB A;  5C2T A;  4CNJ A;  3H8I A;  3UTH A;  4Y4M A;  2OAM A;  3QSE A;  1KF6 A;  3QVR A;  2R0G A;  1YQ3 A;  1XAN A;  4ECH A;  3GD3 A;  3D8X A;  4USR A; 
#chains in the Genus database with same CATH topology
 2PP1 A;  3N4F A;  1EL9 A;  2JB1 A;  3QKE A;  1IYX A;  4OPI A;  4XWZ A;  2GR0 A;  1X2G A;  1D7L A;  1DXL A;  3IJQ A;  1M6I A;  4U2T A;  2C75 A;  2YVG A;  1FHU A;  3KPF A;  4IV9 A;  3DA1 A;  3CTY A;  1ZK7 A;  3B6D A;  3UKA A;  2EQ9 A;  2YR5 A;  4G9K A;  1MO9 A;  3H7V A;  5FJP A;  4FX9 A;  3AD8 B;  4A6N B;  2OAL A;  3NTA A;  3BNM A;  1PBD A;  2YLW A;  1Q9I A;  2AKM A;  1CJ3 A;  4DSH A;  4H2H A;  4N9X A;  4GF7 A;  3AM9 A;  4TLX A;  3FIM B;  1FHV A;  3P3B A;  3C96 A;  4OCG A;  1H81 A;  2FJE A;  2WP9 A;  3Q6J A;  4A99 A;  2WBA A;  2R0P A;  1CBO A;  1R6W A;  5U1O A;  2X50 A;  1ELS A;  1LTX R;  3VC6 A;  2R9Z A;  1BKH A;  2EQ6 A;  4OPC A;  3B97 A;  3UKK A;  2OKT A;  1WYG A;  2WPC A;  2OLO A;  4G7F A;  4K7Z A;  2XGZ A;  3U9I A;  2XVF A;  1FO4 A;  5U63 A;  1PXB A;  3ITJ A;  1CJC A;  1BGN A;  4CBQ A;  1EC9 A;  2BC1 A;  4H4Y A;  1NHR A;  3GY1 A;  1R0M A;  2XSX A;  1JRY A;  3GD6 A;  3VRB A;  1TE6 A;  4YSX A;  1H7X A;  2I5Q A;  1SEZ A;  3F8R A;  4ENL A;  2WU2 A;  3DGH A;  2VZ2 A;  1RYI A;  2PHH A;  4Y4L A;  2DW6 A;  4EQS A;  4IL0 A;  4WCT A;  3LZW A;  3UKP A;  2XLT A;  2P3Z A;  1RVK A;  1KN0 A;  3BJS A;  1X2H A;  3AEC A;  5KVH A;  4XXG A;  1GRG A;  3QFB A;  2X8H A;  2F5Z A;  2GGH A;  1KFY A;  3GRS A;  5KWF A;  1F3P A;  3QN3 A;  2VVL A;  4AP3 A;  1ZOV A;  3JW7 A;  1KSS A;  4B1B A;  1GRF A;  2XYO A;  3CN8 A;  2EQ7 A;  3DGB A;  1Y56 B;  4Z26 A;  1FFV C;  3B9J B;  3VDG A;  3G5R A;  2R4E A;  4WX1 A;  5DBJ A;  4GCM A;  3FG2 P;  1BQG A;  4II2 A;  2XLU A;  4ROP A;  3ALL A;  5M0Z A;  4LA1 A;  1VRQ B;  3NYC A;  4IT1 A;  2PSN A;  3CXB A;  1D5T A;  3ES8 A;  2IVD A;  3DFH A;  2VQB A;  2BS2 A;  5LV9 A;  3HPF A;  3RP7 A;  3V4B A;  4MJW A;  4FDC B;  4IVM B;  4H19 A;  3SN4 A;  2CUL A;  2JKC A;  4II3 A;  1GRB A;  2NPX A;  4DWD A;  1DOD A;  3VC5 A;  4NTE A;  1FEB A;  3UCC A;  1S2Y A;  4H1Z A;  3NZG A;  3KA7 A;  3UXK A;  4TM4 A;  4A65 A;  1JRP A;  4Z2T A;  4A6G A;  2JK6 A;  1PBE A;  1ONF A;  1P43 A;  2CFY A;  3BI5 A;  1GAL A;  5IQ1 A;  1GSN A;  2PS2 A;  4DHG A;  2TPR A;  2Q7V A;  5U25 A;  4J33 A;  1ZP0 A;  2WOV A;  4D03 A;  4NZH A;  4OPL A;  5JCK A;  3UJF A;  2HXU A;  1JRZ A;  2QGY A;  4CY8 A;  5EB5 A;  3GC2 A;  2OLA A;  4HPN A;  2P88 A;  4U8K A;  4A7A A;  2VVM A;  4EMJ A;  4UDR A;  3UJE A;  3WE0 A;  4YTN A;  1E6E A;  2QJM A;  4A5L A;  2NQL A;  2JAE A;  3CNJ A;  1YQ4 A;  4J34 A;  3TQP A;  1EC7 A;  1MRA A;  2XVH A;  1L0V A;  1MNS A;  2A87 A;  2XH4 A;  3SQP A;  1IJH A;  3GDN A;  1ZKQ A;  4IHC A;  2V3B A;  4YXD A;  3AXB A;  4FI4 A;  4X9M A;  1QO8 A;  5IQ4 A;  4JY2 A;  4DNA A;  4H4Z A;  4IA5 A;  2ZAD A;  3GYX A;  2OO6 A;  1MDR A;  3JVA A;  3K30 A;  1E1L A;  2YM1 A;  3H8A A;  2WOW A;  3SZ0 A;  2YLS A;  2XH0 A;  2PPG A;  3AYJ A;  2PCE A;  5FJT A;  3N6H A;  2C65 A;  2UZZ A;  4YSH A;  1FCD A;  3V3N A;  2B9X A;  1NEN A;  2YG5 A;  2OG9 A;  4M52 A;  2DKH A;  3DER A;  4JY3 A;  2BCP A;  3OTR A;  2XVE A;  4FK1 A;  4U8P A;  2YQU A;  3IHM A;  2BRY A;  3EAN A;  1KDG A;  1O5W A;  3ES7 A;  3NH3 X;  4IA6 A;  3T4W A;  2ZBW A;  1VDV A;  2QAE A;  4GME A;  1CC4 A;  4DSG A;  1IUS A;  3M13 A;  3SN0 A;  1SJC A;  1V59 A;  2AAQ A;  3R0K A;  3I6T A;  1JCT A;  2FYM A;  1EL7 A;  2OX4 A;  1YKJ A;  2E4G A;  3E1T A;  3UJR A;  3ZDN A;  3QPE A;  4K8D A;  1EL5 A;  1P48 A;  2FJA A;  4B64 A;  3IK4 A;  1N4W A;  3GSI A;  2VRM A;  1ECQ A;  2AR8 A;  1EBH A;  3UXL A;  4KT2 A;  3PFR A;  4U8J A;  4ZCW A;  3H8I A;  3UTH A;  1ZXI C;  4USR A;  2DW7 A;  1OJC A;  2C67 A;  2E5A A;  1Q1W A;  5FMH A;  1E7P A;  2YLZ A;  2EQ8 A;  4EMI A;  3VQR A;  3LZX A;  4U8I A;  1REO A;  3IHG A;  3H70 A;  2APG A;  3T8Q A;  3FV9 A;  4AT0 A;  1ZMD A;  2X3N A;  1L9D A;  2Q0L A;  4TVY A;  2FJB A;  3V76 A;  3N4E A;  1B4V A;  1E1N A;  3NK2 X;  1GEU A;  2QQ6 A;  1D4D A;  3UOV A;  2PU1 A;  2GVC A;  3P1W A;  2OFJ A;  4JN7 A;  5L46 A;  2OZ8 A;  2YVF A;  3THU A;  3JSK A;  1E1M A;  5GSN A;  3HRD C;  5FS6 A;  2W55 A;  3RCY A;  3M12 A;  1GXF A;  1K0L A;  2FBW A;  4JHM A;  3HYW A;  1TDE A;  4U8M A;  1FEA A;  4BUR A;  4IP4 A;  3EEZ A;  1KSU A;  5IPY A;  3I6D A;  3FVD A;  3DGZ A;  5EU9 A;  4JNA A;  1IUU A;  3CGB A;  1CC2 A;  4GDE A;  2BYB A;  2WQY A;  2R0C A;  4H7U A;  3DG3 A;  2B76 A;  4TLZ A;  2B7S A;  2GGI A;  1SJA A;  1KKO A;  2JB2 A;  3T37 A;  1BZL A;  3TJI A;  4EQX A;  2WS3 A;  3C4A A;  4DN1 A;  4GGH A;  3NRZ B;  4G73 A;  4YT0 A;  5EBK A;  4J2W A;  1O94 A;  1W6T A;  4H2Q A;  2YG4 A;  3Q9T A;  1GTH A;  3SR6 B;  3G5Q A;  3NTD A;  3FYY A;  3VR8 A;  4Z43 A;  1QLB A;  1D4C A;  1Z6L A;  2H89 A;  3NXL A;  1B8S A;  3P4S A;  4E4U A;  3D46 A;  2YG6 A;  1TZZ A;  1T3Q C;  3T6C A;  2XFN A;  3NHO X;  1P2H A;  4PAA A;  1B37 A;  2C76 A;  3PO7 A;  1Q1R A;  1D4E A;  4E8G A;  4OPU A;  1DOB A;  4LU6 A;  3LJP A;  1YY5 A;  3BHF A;  4M0X A;  3NIX A;  2GGJ A;  3BOX A;  3VR9 A;  3PK7 A;  2AQJ A;  4G74 A;  1KNP A;  3NFU A;  2GH5 A;  3SZF A;  4BK1 A;  3A7U A;  1XPY A;  2JBV A;  1N5W C;  4EQR A;  2W3S A;  2GEW A;  4CCQ A;  2GRT A;  3DDM A;  1N5X A;  1NHQ A;  4EWJ A;  3ALJ A;  5BUL A;  4B68 A;  1BWC A;  3UKF A;  2Z5X A;  2NVK X;  2W54 A;  3BNU A;  2MUC A;  4DXK A;  3Q45 A;  1N4V A;  3D47 A;  2VQ7 A;  4YWO A;  1F6M A;  1GRA A;  3B3R A;  3T14 A;  1S2Q A;  2WOI A;  3MQT A;  4H4U A;  5KNL A;  1NHS A;  3VFC A;  2YLX A;  3NVY B;  4EM3 A;  2AL1 A;  4H4R A;  2PYX A;  3FJ4 A;  3MUC A;  1PBB A;  1DNC A;  3URH A;  3EF6 A;  2XFQ A;  2V3A A;  2YWL A;  3NN0 X;  4B66 A;  1LPF A;  2P0I A;  3AEG A;  3T31 A;  3JZU A;  1N63 C;  2GQF A;  3UKH A;  2QA1 A;  4U2S A;  3RO6 A;  2C66 A;  4IVO B;  2C70 A;  2PGW A;  1TDN A;  4KPR A;  2GR1 A;  2P8B A;  2XVJ A;  1F9C A;  2BCG G;  2BXR A;  5HHF A;  4E0V A;  2RDX A;  4APN A;  3ALM A;  2VRL A;  3TJ4 A;  3UTE A;  1V97 A;  4J36 A;  2WPF A;  1B5Q A;  4G6H A;  4REK A;  1BF3 A;  4Z1Y A;  2WES A;  3ICR A;  2W0H A;  4NTC A;  2XCG A;  3UGV A;  2Q6U A;  3ICT A;  2FKP A;  2HZG A;  3NK0 X;  2R46 A;  3NVW B;  5BVA A;  1ZY8 A;  4K5S A;  3P4P A;  4TM3 A;  1LJ1 A;  4USQ A;  3DK8 A;  5BOF A;  4C74 A;  3RR1 A;  3PS9 A;  3UKQ A;  2YLR A;  4GIR A;  3R11 A;  1F8S A;  1QJD A;  1ZX9 A;  3CPJ G;  3RRA A;  3QFA A;  2ZC8 A;  3LB8 A;  2HXT A;  4RG3 A;  1PDH A;  3SGL A;  4J1O A;  3CB3 A;  2QA2 A;  3FCP A;  4Z2R A;  4OPD A;  3IF9 A;  1TDK A;  2OQH A;  4H4T A;  4IP5 A;  2V60 A;  4H50 A;  1GRT A;  1TYT A;  1O95 A;  3LOV A;  3S61 A;  1H82 A;  2VVL G;  2GAG B;  2HNE A;  3QSS A;  4DX3 A;  3R9U A;  1LQU A;  2C4C A;  4B69 A;  3UP5 A;  3CT2 A;  4RG4 A;  3EAO A;  3LXD A;  3TTE A;  2CVJ A;  2Y6Q A;  1FOH A;  2ZZC A;  2RGJ A;  1W4X A;  4AP1 A;  2X8G A;  3TWA A;  1KKR A;  4IZG A;  3AYI A;  2BK5 A;  5FJR A;  3GWF A;  4XWR A;  3QVP A;  4CY6 A;  1JRX A;  3PVC A;  1MDL A;  3OC4 A;  4K1W A;  2E5V A;  2YG3 A;  1CC6 A;  2C64 A;  3EUB 3;  3D9X A;  5IDZ A;  2IVE A;  4C5O A;  3SX6 A;  3AYL A;  1GRE A;  2XLP A;  1TDF A;  4UP3 A;  3SQS A;  2YVJ A;  5C2T A;  2I0Z A;  3AN1 A;  2ZZB A;  4NNJ A;  3T9P A;  2POD A;  3ABV A;  3AE5 A;  3NG7 X;  4Z25 A;  3GD4 A;  3KPK A;  2XDO A;  1L8P A;  2BXS A;  3IC9 A;  3NRN A;  3CXO A;  4HN8 A;  3EPT A;  3PWI A;  2ACZ A;  4A6N A;  1NAA A;  1L9C A;  5KVI A;  1XS2 A;  4TVW A;  4BK2 A;  5KOW A;  3SN1 A;  3NLC A;  3RGT A;  1PN0 A;  2WET A;  3CPI G;  4K2X A;  1GV4 A;  1H84 A;  3G5S A;  4E6M A;  3A7R A;  1XPQ A;  2WPE A;  2OA1 A;  2Q0K A;  3CNT A;  2A8X A;  2PTW A;  4A3R A;  3CGD A;  3GWD A;  1TYP A;  2GL5 A;  3KUM A;  1PBF A;  1LV0 A;  4MMW A;  1ZMC A;  2PP3 A;  4RSL A;  3II4 A;  3CMM A;  3H8L A;  1VG9 A;  5G5H B;  3QTP A;  3RED A;  3I4K A;  1CHU A;  1S7M A;  4C77 A;  1F8W A;  5HXI A;  3DEQ A;  1BGJ A;  4X9N A;  3HYV A;  2GMJ A;  2CHR A;  4HNC A;  1IUV A;  3RHA A;  4GRT A;  2RAB A;  3I3L A;  3CK5 A;  5C3J A;  2X8C A;  3ZLH A;  1IUW A;  4GYP C;  3BI2 A;  5KOX A;  3UOX A;  2H88 A;  3AD7 B;  4Y4N A;  1SB3 B;  3V3W A;  3ZYX A;  4KWS A;  1Y56 A;  3NN6 X;  2POZ A;  3EKG A;  1X31 B;  1GER A;  1VQZ A;  3ICS A;  3SZW A;  5JRB A;  1NEK A;  2GAH B;  4U8N A;  3NS1 B;  1LVL A;  3CYJ A;  2PA6 A;  4GFI A;  3VA8 A;  2GGG A;  3CNP A;  5ENL A;  2OVL A;  3DG7 A;  3BI4 A;  4ZN0 A;  1RSG A;  4K5R A;  1E1K A;  4ZA0 A;  4CRT A;  2A89 A;  3NVZ B;  1DJQ A;  4KPL A;  3NGC X;  4JNQ A;  4H4V A;  3GRT A;  1TRB A;  1PXC A;  2XVI A;  2W3R A;  1GRH A;  2WP6 A;  3FBS A;  3NNE A;  4K22 A;  2WU5 A;  3UCL A;  2GMH A;  4NTD A;  1NHP A;  2WP5 A;  3IJI A;  3S5S A;  5G5G B;  3R0U A;  3AE1 A;  4JQ9 A;  5KMP A;  3CND A;  3AE2 A;  3R25 A;  1EBG A;  2OLN A;  4F4R A;  1IUT A;  2BA9 A;  2PMQ A;  3UJ2 A;  3SM8 A;  3AE3 A;  5EB4 A;  1MUC A;  4ZCC A;  3UKL A;  2BAB A;  4JN9 A;  2O9Z A;  4J3Z A;  1H2I A;  3TOY A;  5TR3 A;  1UKV G;  2WDV A;  1M64 A;  3RP8 A;  1ZOY A;  3V5C A;  3C4N A;  2AL2 B;  5FS9 A;  3BHK A;  4HYR A;  3S47 A;  5FJU A;  1PS9 A;  1YQZ A;  4JN8 A;  1PJ7 A;  1JDF A;  2MNR A;  4U8O A;  1OJD A;  4J31 A;  1PBC A;  1Y0P A;  3GO2 A;  2BAC A;  4AT2 A;  5HYM A;  3N6J A;  3T2Z A;  1H86 A;  1WUF A;  5J60 A;  1GES A;  3SXI A;  3AB1 A;  4H2R A;  3OP2 A;  3AEA A;  3RP6 A;  1H7W A;  4NWZ A;  1F8R A;  3UP4 A;  1YEY A;  4OPT A;  1N1P A;  4EIQ A;  1NPX A;  3GYJ A;  4J56 A;  3ZLF A;  4EIP A;  4HCH A;  4MKS A;  1OJA A;  1CJ2 A;  2DKI A;  4OVI A;  1E39 A;  1MXT A;  1FL2 A;  1OEP A;  2C3D A;  2X99 A;  4H4Q A;  1KD0 A;  4KEM A;  4YKG A;  1JPM A;  4PAB A;  1PDY A;  2OZT A;  2BS3 A;  1FEC A;  5FJO A;  4CNK A;  3DIP A;  4ZCD A;  2WDQ A;  1GT8 A;  4FP1 A;  2Y6R A;  4K2S A;  1JEH A;  1OJT A;  2HQM A;  4E5T A;  1RM6 B;  3CGC A;  4ADW A;  4EQW A;  4BJZ A;  3MZN A;  3CAW A;  4M6U A;  2PTZ A;  2WDR A;  3ZVH B;  4A35 A;  1S3E A;  5M10 A;  3UCD A;  4HCD A;  2QVH A;  4NEV A;  1NG4 A;  2XFU A;  1K0J A;  4H2P A;  3MSY A;  4K8G A;  5KMR A;  2XFP A;  2XH7 A;  2E3T A;  1WUE A;  1COY A;  2XFO A;  1EL8 A;  3IJL A;  3L5O A;  3PG6 A;  2PTY A;  3AD9 B;  3OW1 A;  2BRA A;  2XLR A;  3AWI A;  2QJJ A;  2QCU A;  2PGE A;  5HY5 A;  3NKS A;  5EOW A;  4GGB A;  2ONE A;  2WEU A;  3GMB A;  5FS8 A;  2IID A;  4B67 A;  1DOC A;  4KX6 A;  1PHH A;  4LII A;  3AEB A;  2J3N A;  3Q4D A;  3NT6 A;  4Y4M A;  2OAM A;  3QSE A;  3QVR A;  2OZ3 A;  2R0G A;  3H4K A;  3GD3 A;  3D8X A;  4EM4 A;  2YLT A;  3ATR A;  4B65 A;  4DGK A;  3DES A;  3K7M X;  4GAP A;  5CQF A;  1JNR A;  2QDE A;  1GND A;  1FFU C;  4O5U A;  2QDD A;  3OZ2 A;  3MKC A;  1N4U A;  3DJE A;  4U8L A;  2GF3 A;  3SFE A;  3NO1 A;  3UTF A;  1GOS A;  3H12 A;  3VRD B;  3DJJ A;  4HCL A;  2ZZ0 A;  3SJN A;  1GTE A;  4I59 A;  1STZ A;  3UOY A;  4UDP A;  3TW9 A;  3F8P A;  1JRO A;  5J7X A;  3I6E A;  4Z2U A;  2C3C A;  3QJ4 A;  3KLJ A;  5ER0 A;  2YR4 A;  2GR3 A;  4A9W A;  4G6G A;  2PU0 A;  4H4P A;  4Z44 A;  1ONE A;  2B9W A;  2Z5Y A;  1AOG A;  4D04 A;  3OZY A;  3NVV B;  3KKJ A;  4GAV A;  3UOZ A;  4AOX A;  3STP A;  1VDC A;  3UJS A;  4ZOH B;  4TM1 A;  2ARD A;  4TM0 A;  1IUX A;  3DJG X;  2GV8 A;  3OZM A;  4MGG A;  1PDZ A;  5J04 A;  4YSY A;  1N62 C;  4H4X A;  2AL2 A;  4U2L A;  1NG3 A;  3KVE A;  2BS4 A;  1CL0 A;  3LAD A;  2V61 A;  3CNS A;  5JCL A;  2O56 A;  2P8C A;  2TMD A;  4H83 A;  3RNM A;  3CIR A;  3K7T A;  3ADA B;  3FMW A;  4X4J A;  5CKU A;  4P9S A;  1SJD A;  4GYP A;  3VCN A;  4UDQ A;  2BK4 A;  1TKK A;  4Z17 A;  3ATQ A;  5FS7 A;  2CDU A;  3KD9 A;  3ENL A;  1XHC A;  1ZDL A;  3OPS A;  2V5Z A;  3S5W A;  5KMS A;  1LQT A;  3SBF A;  3R10 A;  4I58 A;  2WHD A;  3ISH A;  3P0W A;  2E1M A;  2BK3 A;  3AED A;  5KMQ A;  4B63 A;  5BUK A;  3QLD A;  1P2E A;  4ICY A;  3SYI A;  4HA6 A;  4NEW A;  4OPG A;  3AE9 A;  2R4J A;  4G8T A;  2FJD A;  3K7Q X;  5GRT A;  1NEL A;  1PJ5 A;  4YKF A;  3T2Y A;  2JB3 A;  2XLS A;  1TDO A;  1H83 A;  3AMZ A;  3SY4 A;  3SFD A;  2BC0 A;  3DG6 A;  3NYF A;  1NU5 A;  4YTM A;  3IWA A;  3ETR B;  1CF3 A;  4J57 A;  1MOK A;  3HW2 A;  2YG7 A;  1DOE A;  2B9Y A;  1BKW A;  4Z24 A;  4BK3 A;  3P4Q A;  7ENL A;  3RIT A;  3K1G A;  1GET A;  3HZL A;  2VOU A;  3R1Z A;  3P93 A;  2YM2 A;  3O0H A;  2GDQ A;  2C73 A;  3T0K A;  1EC8 A;  1N60 C;  3R07 C;  4HNL A;  2R45 A;  2GR2 A;  3ZVH A;  1D7Y A;  1FIQ B;  4BJY A;  3MWC A;  2RGO A;  3CGE A;  4H4W A;  3AEF A;  3DH9 A;  2C72 A;  1PXA A;  1DJN A;  5JCN A;  1RP0 A;  4CCR A;  1E9I A;  4GIS A;  1HYU A;  3CPH G;  3F8D A;  1ELI A;  2V6O A;  1L9E A;  2RGH A;  2GB0 A;  3ZVI A;  5JCI A;  3NYE A;  4AOS A;  5KXJ A;  4GR1 A;  3GMC A;  1JOA A;  1JNZ A;  3NK1 X;  6ENL A;  1DTN A;  3DK9 A;  3AEE A;  2PTX A;  3DK4 A;  3MY9 A;  3U4F A;  3QSM A;  1K0I A;  3KU9 A;  3L8K A;  3FXG A;  4YWS A;  4HB9 A;  1PJ6 A;  4A79 A;  1S3B A;  4E4F A;  3A7A A;  3GDP A;  3V3O A;  3BSM A;  2YAU A;  4GDP A;  3V5F A;  2PP0 A;  3P4R A;  3DJD A;  4H2N A;  1KCZ A;  2C7G A;  3PWG A;  1GPE A;  3GYI A;  3FPZ A;  3HYX A;  5JCM A;  2B7R A;  5BOE A;  1N61 C;  2OQY A;  4H4S A;  3AE8 A;  3DME A;  2AKZ A;  3AE6 A;  3AE7 A;  4C3Y A;  3VRA A;  4X2P A;  2GSH A;  4GUV A;  4BV6 A;  3TCS A;  1JU2 A;  1VQW A;  3P9U A;  2OPJ A;  4IL2 A;  1KNR A;  3DFY A;  1H6V A;  4JDR A;  3SSZ A;  4FK1 C;  3L1R A;  1NDA A;  2GGE A;  1OJ9 A;  1CJ4 A;  3SZC A;  3TWB A;  4YTP A;  1XDI A;  2XH2 A;  1EBD A;  4YSZ A;  3T2K A;  2YR6 A;  5KRQ A;  4EMW A;  4C3X A;  3D1C A;  3ZLG A;  3COX A;  3UTG A;  1VG0 A;  1SJB A;  1JPD X;  1K4Q A;  3VCC A;  2QJN A;  3AE4 A;  5BRT A;  3M0O A;  4O5Q A;  2GQW A;  4CNJ A;  1KF6 A;  4DYE A;  1YQ3 A;  1XAN A;  4ECH A; 
#chains in the Genus database with same CATH homology
 1OJC A;  3ABV A;  4EM4 A;  2YLT A;  3AE5 A;  3ATR A;  4B65 A;  2C67 A;  1EL9 A;  2JB1 A;  3NG7 X;  4Z25 A;  1Q1W A;  5FMH A;  1E7P A;  4OPI A;  4DGK A;  4XWZ A;  2GR0 A;  3GD4 A;  1D7L A;  1DXL A;  3K7M X;  3KPK A;  2XDO A;  1M6I A;  4GAP A;  2C75 A;  2YVG A;  2YLZ A;  4U2T A;  5CQF A;  2EQ8 A;  1JNR A;  4EMI A;  1GND A;  3DA1 A;  3CTY A;  3KPF A;  4IV9 A;  1ZK7 A;  2BXS A;  3VQR A;  3LZX A;  3IC9 A;  3B6D A;  3UKA A;  4O5U A;  3NRN A;  2EQ9 A;  3EPT A;  2YR5 A;  3OZ2 A;  4G9K A;  4U8I A;  2ACZ A;  1REO A;  1NAA A;  1N4U A;  3DJE A;  3IHG A;  4A6N A;  2APG A;  1MO9 A;  1L9C A;  4FX9 A;  5KVI A;  4AT0 A;  4U8L A;  1ZMD A;  2X3N A;  3AD8 B;  4A6N B;  2GF3 A;  1L9D A;  2Q0L A;  4BK2 A;  3SFE A;  2FJB A;  3V76 A;  2OAL A;  3NTA A;  5KOW A;  1B4V A;  3BNM A;  1E1N A;  3NK2 X;  1PBD A;  3UTF A;  1GEU A;  1GOS A;  2YLW A;  1D4D A;  1Q9I A;  3UOV A;  3VRD B;  1CJ3 A;  3DJJ A;  2ZZ0 A;  1GTE A;  3NLC A;  4I59 A;  4DSH A;  2GVC A;  3P1W A;  3UOY A;  4UDP A;  4N9X A;  4GF7 A;  4TLX A;  3FIM B;  3F8P A;  5J7X A;  1PN0 A;  5L46 A;  2WET A;  3C96 A;  3CPI G;  4K2X A;  4Z2U A;  2C3C A;  4OCG A;  1H81 A;  3KLJ A;  2FJE A;  3QJ4 A;  2YVF A;  2WP9 A;  3JSK A;  5ER0 A;  1E1M A;  2YR4 A;  1H84 A;  1GV4 A;  3Q6J A;  4A99 A;  5GSN A;  2WBA A;  2R0P A;  1CBO A;  3G5S A;  2GR3 A;  4A9W A;  5FS6 A;  5U1O A;  4G6G A;  1XPQ A;  2WPE A;  2X50 A;  4H4P A;  1LTX R;  2OA1 A;  3M12 A;  4Z44 A;  1GXF A;  2R9Z A;  1K0L A;  2B9W A;  2Q0K A;  2FBW A;  2Z5Y A;  3CNT A;  1AOG A;  2EQ6 A;  4D04 A;  2A8X A;  4OPC A;  3HYW A;  1TDE A;  3KKJ A;  4GAV A;  1FEA A;  4BUR A;  4U8M A;  3UKK A;  3UOZ A;  3CGD A;  3GWD A;  1TYP A;  2WPC A;  4AOX A;  2OLO A;  4K7Z A;  1VDC A;  1KSU A;  5IPY A;  3I6D A;  3DGZ A;  2XVF A;  5U63 A;  1PXB A;  3ITJ A;  1CJC A;  1BGN A;  1IUU A;  4JNA A;  4CBQ A;  4TM1 A;  3CGB A;  1PBF A;  2ARD A;  1CC2 A;  1LV0 A;  4GDE A;  4TM0 A;  1ZMC A;  2BC1 A;  4H4Y A;  2BYB A;  1NHR A;  1IUX A;  2WQY A;  3DJG X;  2GV8 A;  1JRY A;  2R0C A;  4RSL A;  3II4 A;  4H7U A;  3CMM A;  3H8L A;  3VRB A;  1VG9 A;  2B76 A;  4TLZ A;  4YSX A;  1H7X A;  2B7S A;  3RED A;  4YSY A;  1SEZ A;  3F8R A;  2WU2 A;  4H4X A;  1CHU A;  1S7M A;  3DGH A;  2VZ2 A;  1RYI A;  2PHH A;  4C77 A;  4U2L A;  4Y4L A;  2JB2 A;  4EQS A;  1NG3 A;  1F8W A;  5HXI A;  3T37 A;  1BZL A;  1BGJ A;  3KVE A;  2BS4 A;  4EQX A;  1CL0 A;  2WS3 A;  3C4A A;  3HYV A;  3LAD A;  4WCT A;  4X9N A;  3LZW A;  3UKP A;  2V61 A;  4G73 A;  2XLT A;  2GMJ A;  3CNS A;  5JCL A;  1KN0 A;  4YT0 A;  5EBK A;  2TMD A;  4J2W A;  3RNM A;  1O94 A;  3CIR A;  3K7T A;  1IUV A;  3RHA A;  3AEC A;  4GRT A;  2RAB A;  5KVH A;  3ADA B;  3FMW A;  3I3L A;  4H2Q A;  4X4J A;  4P9S A;  5CKU A;  2YG4 A;  3Q9T A;  1GTH A;  4XXG A;  1GRG A;  5C3J A;  3QFB A;  2X8H A;  2X8C A;  2F5Z A;  3G5Q A;  4UDQ A;  1IUW A;  2BK4 A;  1KFY A;  3NTD A;  3GRS A;  3BI2 A;  5KOX A;  3UOX A;  3ATQ A;  2H88 A;  3VR8 A;  5FS7 A;  4Z43 A;  5KWF A;  2CDU A;  3AD7 B;  1F3P A;  3KD9 A;  4Y4N A;  2VVL A;  4AP3 A;  1XHC A;  1ZOV A;  1ZDL A;  1KSS A;  2V5Z A;  1QLB A;  1D4C A;  1GRF A;  2XYO A;  1LQT A;  1Z6L A;  3CN8 A;  2EQ7 A;  3S5W A;  3ZYX A;  5KMS A;  1Y56 A;  3NN6 X;  4I58 A;  2H89 A;  2WHD A;  1B8S A;  3ISH A;  3P4S A;  1X31 B;  1Y56 B;  2E1M A;  2BK3 A;  3AED A;  5KMQ A;  1GER A;  4B63 A;  5BUK A;  4Z26 A;  3ICS A;  3SZW A;  1P2E A;  2YG6 A;  5JRB A;  1NEK A;  2GAH B;  4ICY A;  4U8N A;  1LVL A;  3SYI A;  3G5R A;  4HA6 A;  2XFN A;  3NHO X;  1P2H A;  4PAA A;  2R4E A;  4NEW A;  4OPG A;  3AE9 A;  1B37 A;  4WX1 A;  2C76 A;  5DBJ A;  3PO7 A;  1Q1R A;  4GCM A;  3CNP A;  3FG2 P;  1D4E A;  3BI4 A;  2R4J A;  4II2 A;  4ZN0 A;  1RSG A;  4K5R A;  1E1K A;  2FJD A;  4OPU A;  1DOB A;  4CRT A;  4LU6 A;  2A89 A;  2XLU A;  3K7Q X;  3LJP A;  1DJQ A;  3NGC X;  3ALL A;  5GRT A;  4JNQ A;  4H4V A;  5M0Z A;  1YY5 A;  3BHF A;  4LA1 A;  3GRT A;  1PJ5 A;  1PXC A;  1TRB A;  1VRQ B;  3NIX A;  3NYC A;  4YKF A;  2XVI A;  3T2Y A;  2JB3 A;  3VR9 A;  1GRH A;  2XLS A;  1TDO A;  1H83 A;  1D5T A;  2AQJ A;  2WP6 A;  3SY4 A;  3FBS A;  4G74 A;  2IVD A;  3SFD A;  2BC0 A;  1KNP A;  3NNE A;  3NYF A;  4K22 A;  2GH5 A;  2WU5 A;  3UCL A;  4YTM A;  2GMH A;  2BS2 A;  2VQB A;  3SZF A;  4BK1 A;  5LV9 A;  4NTD A;  1NHP A;  3RP7 A;  4MJW A;  2JBV A;  2WP5 A;  3IWA A;  4FDC B;  4IVM B;  4EQR A;  1CF3 A;  4J57 A;  2CUL A;  3AE1 A;  1MOK A;  4JQ9 A;  2GEW A;  2JKC A;  4CCQ A;  2GRT A;  2YG7 A;  4II3 A;  1DOE A;  2B9Y A;  1BKW A;  5KMP A;  3CND A;  1GRB A;  1NHQ A;  3AE2 A;  3ALJ A;  2NPX A;  4Z24 A;  4B68 A;  1DOD A;  5BUL A;  1BWC A;  4BK3 A;  2OLN A;  1FEB A;  4NTE A;  3UKF A;  3P4Q A;  2Z5X A;  2NVK X;  1S2Y A;  3BNU A;  3KA7 A;  1IUT A;  2BA9 A;  1N4V A;  2VQ7 A;  1GET A;  3HZL A;  3SM8 A;  4YWO A;  1F6M A;  1GRA A;  2VOU A;  3AE3 A;  5EB4 A;  3B3R A;  3T14 A;  1S2Q A;  4TM4 A;  2YM2 A;  4A65 A;  3O0H A;  2C73 A;  4ZCC A;  3T0K A;  2WOI A;  4Z2T A;  4H4U A;  3UKL A;  2JK6 A;  2BAB A;  2R45 A;  4JN9 A;  2GR2 A;  1NHS A;  1ONF A;  1PBE A;  2O9Z A;  5KNL A;  2CFY A;  1H2I A;  2YLX A;  1D7Y A;  4EM3 A;  3BI5 A;  4H4R A;  5TR3 A;  1GAL A;  2PYX A;  1UKV G;  5IQ1 A;  1GSN A;  4BJY A;  1PBB A;  2WDV A;  1M64 A;  3RP8 A;  2RGO A;  3CGE A;  4H4W A;  1DNC A;  1ZOY A;  3C4N A;  3URH A;  2TPR A;  3AEF A;  3EF6 A;  2Q7V A;  3DH9 A;  5U25 A;  2XFQ A;  2C72 A;  1ZP0 A;  4J33 A;  1PXA A;  5FS9 A;  2WOV A;  2V3A A;  2YWL A;  3BHK A;  3NN0 X;  4D03 A;  4B66 A;  1LPF A;  1DJN A;  5JCN A;  3AEG A;  1PS9 A;  1RP0 A;  4NZH A;  5JCK A;  4OPL A;  1YQZ A;  4CCR A;  3T31 A;  2GQF A;  3UKH A;  2QA1 A;  3H4K A;  4U2S A;  2C66 A;  4IVO B;  1JRZ A;  4CY8 A;  1HYU A;  2C70 A;  1PJ7 A;  5EB5 A;  4U8O A;  1OJD A;  3CPH G;  4J31 A;  1PBC A;  3F8D A;  1TDN A;  4KPR A;  1ELI A;  2GR1 A;  2VVM A;  4U8K A;  2V6O A;  4A7A A;  4EMJ A;  4UDR A;  1L9E A;  1Y0P A;  2BAC A;  2XVJ A;  2RGH A;  3WE0 A;  4YTN A;  2BCG G;  2BXR A;  4AT2 A;  5HHF A;  4E0V A;  2GB0 A;  1E6E A;  4B1B A;  5HYM A;  4APN A;  5JCI A;  3ALM A;  3NYE A;  3T2Z A;  1H86 A;  2VRL A;  4AOS A;  4A5L A;  5J60 A;  3UTE A;  1GES A;  2JAE A;  3CNJ A;  1YQ4 A;  3SXI A;  4J34 A;  5KXJ A;  4GR1 A;  3GMC A;  1JOA A;  1JNZ A;  2XVH A;  3NK1 X;  3AB1 A;  1L0V A;  4J36 A;  4H2R A;  2WPF A;  1B5Q A;  4G6H A;  2A87 A;  3AEA A;  3RP6 A;  4REK A;  1BF3 A;  3SQP A;  1H7W A;  3DK9 A;  2WES A;  3AEE A;  1IJH A;  3ICR A;  4NWZ A;  1F8R A;  3GDN A;  1ZKQ A;  2W0H A;  3UP4 A;  4OPT A;  2V3B A;  3DK4 A;  4NTC A;  4YXD A;  3AXB A;  3QSM A;  2XCG A;  1N1P A;  1K0I A;  3KU9 A;  2Q6U A;  3ICT A;  4EIQ A;  4X9M A;  3L8K A;  1QO8 A;  3NK0 X;  4JY2 A;  5IQ4 A;  2R46 A;  5BVA A;  4DNA A;  1ZY8 A;  4H4Z A;  1NPX A;  4HB9 A;  4K5S A;  3GYJ A;  3P4P A;  1PJ6 A;  4TM3 A;  4A79 A;  4J56 A;  1LJ1 A;  1S3B A;  4USQ A;  4EIP A;  4IA5 A;  3GDP A;  3V3O A;  3DK8 A;  1OJA A;  2YAU A;  4GDP A;  4C74 A;  1CJ2 A;  2DKI A;  3GYX A;  1E39 A;  3PS9 A;  4OVI A;  1MXT A;  1FL2 A;  3P4R A;  3UKQ A;  2YLR A;  3DJD A;  1F8S A;  4H2N A;  1QJD A;  1ZX9 A;  2C3D A;  3K30 A;  1E1L A;  2YM1 A;  2X99 A;  4H4Q A;  3CPJ G;  2WOW A;  2C7G A;  3SZ0 A;  4YKG A;  3QFA A;  2YLS A;  4PAB A;  1GPE A;  2BS3 A;  3GYI A;  3LB8 A;  4RG3 A;  3FPZ A;  3HYX A;  1FEC A;  5JCM A;  2B7R A;  3AYJ A;  1PDH A;  3SGL A;  2QA2 A;  4H4S A;  4CNK A;  2C65 A;  2UZZ A;  4YSH A;  1FCD A;  3V3N A;  2B9X A;  4Z2R A;  3AE8 A;  1NEN A;  2YG5 A;  3DME A;  3IF9 A;  4OPD A;  4ZCD A;  1TDK A;  2WDQ A;  1GT8 A;  2Y6R A;  4M52 A;  3AE6 A;  4H4T A;  1JEH A;  2DKH A;  1OJT A;  2HQM A;  2V60 A;  4H50 A;  3AE7 A;  4C3Y A;  1GRT A;  1TYT A;  1O95 A;  3CGC A;  3VRA A;  4ADW A;  4EQW A;  4BJZ A;  3LOV A;  3S61 A;  4JY3 A;  1H82 A;  2BCP A;  2VVL G;  4GUV A;  4BV6 A;  2GAG B;  1JU2 A;  1VQW A;  3P9U A;  2XVE A;  3QSS A;  4FK1 A;  4U8P A;  1KNR A;  2WDR A;  3R9U A;  1LQU A;  2C4C A;  2YQU A;  1H6V A;  4JDR A;  3IHM A;  4FK1 C;  2BRY A;  1S3E A;  3EAN A;  1KDG A;  1O5W A;  3L1R A;  3UP5 A;  4RG4 A;  4B69 A;  5M10 A;  3EAO A;  3LXD A;  4NEV A;  1NDA A;  3NH3 X;  4IA6 A;  2CVJ A;  2Y6Q A;  1NG4 A;  2XFU A;  1OJ9 A;  1FOH A;  2ZBW A;  1K0J A;  1CJ4 A;  4H2P A;  2ZZC A;  2RGJ A;  3SZC A;  4YTP A;  1W4X A;  4AP1 A;  2QAE A;  2X8G A;  5KMR A;  4DSG A;  1CC4 A;  2XFP A;  1XDI A;  3AYI A;  1IUS A;  1EBD A;  2BK5 A;  3GWF A;  4XWR A;  3QVP A;  1COY A;  4CY6 A;  2XFO A;  4YSZ A;  1EL8 A;  1JRX A;  3PVC A;  3OC4 A;  2E5V A;  3M13 A;  3T2K A;  2YG3 A;  3L5O A;  2YR6 A;  1CC6 A;  3PG6 A;  2C64 A;  4EMW A;  5KRQ A;  1V59 A;  4C3X A;  2AAQ A;  3AD9 B;  2BRA A;  3D1C A;  2XLR A;  1EL7 A;  3D9X A;  3COX A;  3AWI A;  3UTG A;  1YKJ A;  2E4G A;  1VG0 A;  3E1T A;  3ZDN A;  2QCU A;  5HY5 A;  3NKS A;  4K8D A;  2IVE A;  5EOW A;  1EL5 A;  2FJA A;  4C5O A;  4B64 A;  1K4Q A;  3SX6 A;  2WEU A;  3AYL A;  3GMB A;  5FS8 A;  2IID A;  4B67 A;  1GRE A;  1N4W A;  2XLP A;  3AE4 A;  3GSI A;  2VRM A;  1TDF A;  4UP3 A;  5BRT A;  1DOC A;  2AR8 A;  4KX6 A;  1PHH A;  4LII A;  3M0O A;  2YVJ A;  3AEB A;  4O5Q A;  2GQW A;  4U8J A;  2J3N A;  2I0Z A;  3NT6 A;  2ZZB A;  5C2T A;  4CNJ A;  3H8I A;  3UTH A;  4NNJ A;  4Y4M A;  2OAM A;  3QSE A;  1KF6 A;  3QVR A;  2R0G A;  1YQ3 A;  1XAN A;  4ECH A;  3GD3 A;  3D8X A;  4USR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...