5KVIA

Crystal structure of monomeric human apoptosis-inducing factor with e413a/r422a/r430a mutations
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
491
structure length
479
Chain Sequence
b'PSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLAIDSDFGGFAVNAELQAASNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHEDLEVLFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Defining NADH-Driven Allostery Regulating Apoptosis-Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 148
structure length 479
sequence length 491
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5kviA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kviA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kviA01
3K7TA 4EQXA 2YLSA 4EMJA 2GMHA 2GR2A 2NVKX 1EL7A 1JNRA 3GWFA 4J31A 4U8MA 4BK3A 3NHOX 5BRTA 2RABA 5KRQA 3Q6JA 2ZZ0A 4H4RA 2R0GA 2ARDA 3B3RA 1GRFA 2CULA 1K0JA 4A7AA 1VDCA 4P9SA 2NPXA 1Q1WA 2OA1A 3QFBA 2YWLA 2DKHA 1B5QA 3BHFA 4X4JA 1N1PA 5EBKA 1EL8A 3GRTA 2C72A 3LOVA 4YTMA 4GUVA 5C3JA 1FEAA 1ONFA 2WESA 1PJ7A 3RP8A 2OALA 3B6DA 4LU6A 1ZMCA 1OJDA 3UTHA 2WS3A 2X8CA 1BZLA 2WEUA 2XYOA 2R0PA 3VRDB 4A65A 3AD7B 2CDUA 4YKFA 1H84A 2Z5XA 1S2YA 4IA5A 1LTXR 1NPXA 1OJ9A 2GVCA 5TR3A 1PBBA 5U1OA 3AEFA 4EM4A 4OPGA 4HA6A 4JN9A 4NTDA 1MOKA 4H4TA 2BK5A 1X31B 1L9CA 2XLTA 2BABA 3KU9A 3NK0X 3AE8A 4UDPA 2WP9A 1CC6A 3FPZA 2IVDA 4EQRA 2F5ZA 2BC0A 3VRAA 4O5UA 2A8XA 4D04A 4IVMB 5CKUA 2WDQA 1D4CA 4U8JA 4CY6A 3REDA 2OAMA 4H4UA 4TM3A 3CTYA 3OC4A 3BHKA 2WDVA 4DNAA 3P4QA 3ICSA 4GRTA 4B68A 3SQPA 2VQ7A 4TM1A 3GDPA 5J60A 2VVLG 2AQJA 3UTFA 3UOZA 1D4EA 3NG7X 3NRNA 3Q9TA 3PVCA 4J2WA 3UCLA 2AR8A 2XLSA 1O5WA 4EQWA 3IC9A 3P4PA 4C3XA 3ICRA 4Z43A 2YLRA 5CQFA 4H4QA 4Y4MA 4FK1A 3LZXA 5JCNA 3NT6A 2JAEA 2YG4A 1GOSA 1P2HA 4X9MA 3GMBA 4Z44A 4A5LA 4EQSA 1H7WA 5EB5A 3E1TA 5BULA 1H83A 1CJCA 2JB3A 2GQFA 3CNDA 4CBQA 5HHFA 1E7PA 3NYCA 1GERA 4C3YA 3L8KA 3RP7A 5ER0A 1LQUA 3F8RA 4FDCB 2YR4A 3GD4A 4YSYA 1AOGA 2X50A 2ZBWA 3DK9A 1Y56A 3GDNA 5JCIA 1JRZA 3BI4A 2GAHB 1E1NA 4YT0A 4EM3A 3NK2X 2YG6A 2XLRA 5KWFA 1ZDLA 3II4A 2B76A 1PBEA 2XFPA 1NHQA 4EMWA 2JKCA 3V3NA 3LADA 2WP5A 1D4DA 3QVPA 2YG7A 2C70A 3AYLA 1SEZA 1UKVG 2PYXA 2YG5A 3C96A 1D7YA 3VQRA 3CNPA 4U8LA 1FECA 4AT2A 4ADWA 1M6IA 2Q7VA 2BCPA 1REOA 4H50A 4B69A 1KNPA 3G5RA 3IHMA 2XVFA 4Z26A 2IIDA 2C75A 2J3NA 4YWOA 3F8DA 1EL5A 4RSLA 4U8PA 2WOIA 1H86A 4IVOB 2GF3A 1Q1RA 1ZMDA 5KVIA 3RNMA 2R0CA 4TM4A 1Y56B 1E1KA 1B8SA 4J36A 5EOWA 1N4VA 1LVLA 1IUWA 4AOXA 3AD9B 1L0VA 3SGLA 3DJJA 1CJ3A 3P9UA 2R9ZA 4OVIA 1NEKA 3CPIG 3NKSA 4ZCCA 4OPIA 4NTCA 1GRAA 2ZZBA 3AE5A 1P2EA 1ELIA 4PAAA 3UKFA 1LPFA 1TDNA 2FJAA 2Q0LA 1GV4A 2W0HA 1MXTA 3CPHG 3NK1X 4AT0A 4CY8A 5IPYA 4YSXA 3UKLA 3NYFA 1KFYA 2VOUA 4APNA 3SM8A 2QA1A 4BK1A 3I3LA 5C2TA 4U2TA 4USQA 3AECA 2C67A 3UP5A 4U2LA 1B4VA 3NN0X 4UP3A 1CC4A 2WU5A 3AE1A 3CGEA 3KA7A 2BS4A 3G5QA 4K22A 3H4KA 4Z2RA 1NHPA 4MJWA 1GTEA 5KOXA 2R45A 3HZLA 1NG3A 5HY5A 1JU2A 4WX1A 4Z24A 3KVEA 2GRTA 4EIPA 1BGJA 3P4RA 2WETA 1XANA 2TPRA 2WOWA 1N4WA 1EL9A 1GXFA 1CJ4A 3KLJA 3NNEA 1GEUA 2HQMA 1OJAA 4IV9A 2QA2A 3QFAA 2I0ZA 4USRA 1IUSA 2V5ZA 3GYIA 3OZ2A 3DK4A 4YKGA 2XVHA 1OJCA 4NEWA 5FS7A 3ABVA 3V3OA 2IVEA 4KPRA 1L9DA 1Q9IA 2C76A 3QSMA 1H7XA 1TDOA 4A6NA 4CNJA 1GNDA 3L1RA 2GH5A 3GMCA 3QSSA 4JQ9A 1KSUA 2BS2A 3AEBA 3IWAA 4YXDA 1S3EA 3F8PA 4OPLA 1M64A 4OPCA 4BK2A 3AYIA 1DXLA 4DSGA 2GB0A 3AYJA 1S3BA 3NTDA 1NENA 4H4SA 4N9XA 4B67A 3M12A 1DODA 1NHRA 2CFYA 3ALJA 4OCGA 2C3CA 4Z2UA 3D8XA 3FG2P 4BV6A 2XLUA 1KF6A 4Z2TA 4DGKA 4REKA 1CF3A 1V59A 2WPEA 1YY5A 1F8WA 1F8SA 3K7QX 2Q0KA 2XFUA 2YR5A 1RSGA 4FK1C 1FOHA 1S2QA 4WCTA 1LV0A 3DJEA 1TYTA 2E4GA 4RG4A 2Z5YA 3G5SA 4OPDA 1TYPA 3PS9A 5FS6A 2R4JA 4C77A 1BWCA 3COXA 2X8HA 3AEAA 3NYEA 4C74A 3ATRA 4OPTA 2XFQA 3EAOA 1NG4A 1DJQA 4UDRA 4B64A 2H89A 3C4AA 2QCUA 3O0HA 1FL2A 1K0LA 2YM2A 3UTGA 3ALLA 1D5TA 2YLXA 1GPEA 3EF6A 1HYUA 3AB1A 1TDKA 2VVMA 3CNSA 1MO9A 2OLOA 3DMEA 4NTEA 2WQYA 4YSHA 2B9WA 5DBJA 1IUTA 2X8GA 3BI2A 4I59A 2Q6UA 4C5OA 3LZWA 5FMHA 2YR6A 2V61A 5BUKA 4O5QA 1LJ1A 2GV8A 1RYIA 1LQTA 2APGA 3ZDNA 3FIMB 1F3PA 1GRHA 3FBSA 3WE0A 2GQWA 4H4PA 3K7MX 4A9WA 2BA9A 2JK6A 3VR8A 1COYA 3AEEA 5JCLA 3GRSA 3BI5A 3UOVA 2XVEA 3QVRA 1FEBA 2VVLA 1RP0A 2WP6A 4H2PA 3UTEA 2JBVA 4JNQA 2RGHA 5KOWA 1PJ6A 1PXAA 2XDOA 1NDAA 3FMWA 4A79A 2A87A 4NZHA 5IQ1A 3AWIA 4XXGA 4K2XA 1D7LA 3LB8A 1VQWA 2PHHA 1JRXA 1H82A 4GR1A 1YQZA 2XVJA 2FJDA 4GCMA 4IA6A 5KXJA 4K5RA 1XDIA 4U8IA 1GRGA 1L9EA 1NAAA 4J34A 2E5VA 4J56A 3NLCA 3CPJG 1E1MA 2FJEA 1ZY8A 2VQBA 1E1LA 1GSNA 4H4ZA 2X99A 4UDQA 3UKQA 4XWZA 4K8DA 4NEVA 2R46A 1K0IA 3GYJA 3LXDA 1H81A 3ISHA 5FS9A 2BK4A 2JB1A 1O95A 2X3NA 3KPFA 3LJPA 1VG0A 4BJZA 1ZK7A 4KX6A 1B37A 2VRLA 3GD3A 1IUVA 3AEGA 3IHGA 1GT8A 1QJDA 1TDEA 5U63A 4ZN0A 1ZKQA 2RGOA 4LA1A 3JSKA 2AAQA 1KDGA 2VZ2A 3URHA 3UP4A 2BK3A 1N4UA 2RGJA 1GRTA 2GR3A 2C7GA 4H2NA 2GR0A 4E0VA 4BURA 2O9ZA 3ICTA 3NIXA 2YVGA 4Z25A 3H8IA 3DGHA 5U25A 2E1MA 1KNRA 4B1BA 1PXBA 4LIIA 3RHAA 1YKJA 4A99A 1EBDA 4YTNA 1TRBA 2Y6QA 4U8OA 1QO8A 4Y4NA 4B65A 1PS9A 1GREA 5BVAA 2BYBA 3BNUA 2V60A 1CBOA 4JY3A 3M13A 2XCGA 1XHCA 1W4XA 1GALA 4TLXA 2WHDA 2C64A 1E6EA 4U2SA 3GWDA 5IQ4A 2YVJA 4H4XA 5LV9A 5M10A 2B9YA 4U8NA 4B66A 1IUUA 3KD9A 4H7UA 2YQUA 4CNKA 4EMIA 3ALMA 5GSNA 4CCQA 3P1WA 2XFOA 4JNAA 3SFEA 1CL0A 3AE3A 2XFNA 1JOAA 2WBAA 2BS3A 1GESA 3IF9A 1ZP0A 1DJNA 1ZOYA 3SFDA 1CJ2A 3DA1A 2GR1A 3I6DA 4H2RA 1DOEA 1PBDA 2BCGG 1GTHA 4EIQA 4YTPA 3QSEA 4CRTA 3ITJA 5HXIA 4GDPA 2JB2A 2YLTA 1PJ5A 3NTAA 1XPQA 2WPFA 1VRQB 2YAUA 1BF3A 3UKAA 4JDRA 2QAEA 4X9NA 3CGBA 3AE9A 2EQ8A 2GMJA 1IJHA 2XLPA 4OPUA 4AP3A 1CC2A 3NN6X 2WOVA 3UKHA 2CVJA 3S61A 1VG9A 4K7ZA 3EPTA 4H4YA 1DOCA 1PXCA 2EQ9A 2TMDA 3AXBA 4ECHA 2BXSA 4A6NB 2YVFA 2ZZCA 1PN0A 4Y4LA 1JNZA 2B9XA 1DNCA 1Z6LA 3CGDA 1O94A 1ZOVA 5HYMA 3S5WA 1BGNA 3T37A 2VRMA 2WPCA 3EANA 3AE2A 3PO7A 2GAGB 3VRBA 1FCDA 4AOSA 2A89A 1F6MA 5KVHA 1K4QA 3QJ4A 2C3DA 4GF7A 4PABA 1JRYA 2BXRA 4CCRA 4H4VA 1KSSA 1H6VA 2GEWA 3GSIA 3NGCX 1F8RA 3DGZA 1ZX9A 3ZYXA 3BNMA 3CNTA 4U8KA 4ZCDA 3C4NA 4ICYA 3NH3X 1PHHA 1E39A 3AE6A 2V6OA 1YQ4A 3P4SA 2WU2A 4HB9A 3CN8A 2OLNA 2B7RA 4FX9A 4DSHA 3R9UA 2WDRA 3UOXA 3CIRA 3CNJA 3VR9A 1Y0PA 3DJDA 1GETA 2H88A 3K30A 1CHUA 1TDFA 2BC1A 4JY2A 5J7XA 5M0ZA 3DJGX 1PDHA 1PBFA 4GDEA 3RP6A 2EQ7A 1NHSA 4XWRA 2Y6RA 4H4WA 5JCMA 3AE7A 4J57A 2FBWA 3M0OA 4K5SA 4B63A 5L46A 4TLZA 1YQ3A 2V3BA 4TM0A 2YLZA 3AEDA 3DK8A 3AD8B 3ATQA 3UKPA 1JEHA 3UKKA 2XVIA 4H2QA 1PBCA 5EB4A 4YSZA 5JCKA 3AE4A 2C66A 1OJTA 2ACZA 2BACA 4M52A 2V3AA 3DH9A 1BKWA 1DOBA 3H8LA 2FJBA 2EQ6A 4AP1A 2YLWA 1GRBA 5GRTA 1QLBA 3KKJA 2UZZA 3D1CA 3CGCA 3V76A 4D03A 2YM1A 4I58A 2B7SA 3ADAB 4RG3A 2C65A 5FS8A 4J33A 3UOYA 2C73A 2YG3A 4BJYA 2R4EA 1IUXA 2DKIA
chains in the Genus database with same CATH superfamily
3ETRB 3OTRA 1JNRA 4U8MA 3Q6JA 2R0GA 3TW9A 4GISA 2RDXA 4K2SA 2DKHA 5EBKA 1EL8A 2C72A 4G9KA 3SN0A 2WESA 1PJ7A 2CHRA 3N4FA 4LU6A 3CXBA 2WS3A 2WEUA 3VRDB 3AD7B 1H84A 3FVDA 3AEFA 1MOKA 2XGZA 3NK0X 3AE8A 2BRAA 1D4CA 4U8JA 4CY6A 3REDA 3R0KA 2WDVA 4IL2A 4TM1A 5J60A 3UOZA 3STPA 3Q9TA 4EQWA 1IYXA 2HXTA 4Y4MA 3LZXA 2JAEA 1P2HA 4EQSA 3E1TA 1H83A 2GQFA 4CBQA 5HHFA 3NYCA 1GERA 3GD6A 4YSYA 3GYXA 3DK9A 4YT0A 1EC8A 1PBEA 2JKCA 4KPLA 3LADA 1D4DA 1UKVG 4DX3A 3RO6A 2E5AA 3SZCA 4AT2A 1S7MA 1M6IA 4G6GA 1REOA 4H50A 4B69A 3G5RA 3IHMA 4Z26A 3F8DA 1EL5A 1MDRA 1H86A 4IVOB 1Q1RA 5KVIA 4TM4A 1Y56B 1B8SA 1N4VA 3AD9B 2MNRA 2R9ZA 4ZCCA 4OPIA 2GGGA 4PAAA 2P3ZA 3UKFA 2W0HA 3NK1X 5IPYA 3UKLA 2QA1A 2XSXA 4USQA 3SZWA 4UP3A 2WU5A 3AE1A 3CGEA 2HNEA 1NHPA 4GGBA 4EIPA 3P4RA 2NQLA 1R0MA 1N62C 3IJLA 3NNEA 1GEUA 3GC2A 1OJAA 1ONEA 4FI4A 1TZZA 2V5ZA 3GYIA 1OJCA 4K1WA 2OFJA 1YEYA 1L9DA 4NWZA 3ZLHA 2OZ3A 2GH5A 3GMCA 3DG6A 5EU9A 3NTDA 4N9XA 5KMRA 1DODA 4G7FA 1KKOA 3FG2P 4BV6A 2WPEA 1YY5A 1F8WA 1RSGA 4FK1C 4JN7A 1FOHA 2E4GA 2Z5YA 3G5SA 4OPDA 5FS6A 1BWCA 3COXA 1XPYA 3ATRA 3VA8A 3DG7A 4UDRA 4B64A 3ZLGA 3O0HA 1K0LA 3EF6A 4E5TA 4NTEA 2B9WA 3FXGA 4Z1YA 4I59A 1TKKA 2Q6UA 2XH2A 5FMHA 5BUKA 4GGHA 1LJ1A 3FBSA 3SX6A 2GQWA 4ZCWA 3K7MX 2JK6A 3VR8A 1COYA 1PDYA 3OW1A 2XVEA 1SJAA 3OPSA 4H2PA 3T2ZA 1RM6B 1PJ6A 2XDOA 1NDAA 4A79A 3PWIA 4XXGA 4K2XA 1VQWA 2PHHA 4H83A 1YQZA 3UJFA 4IA6A 4J34A 3CPJG 1ZY8A 4H4ZA 1EBHA 3VCCA 3LXDA 1H81A 4BJZA 1DTNA 4EWJA 1TDEA 3EKGA 1KDGA 3UP4A 2DW7A 2RGJA 4H2NA 4E0VA 3H8IA 2E1MA 1KNRA 1PXBA 4LIIA 4A99A 2HZGA 2PSNA 3P93A 4Y4NA 1N5XA 2V60A 1CBOA 4JY3A 1MRAA 1RVKA 4TLXA 2WHDA 2PTWA 2C64A 1EBGA 5IQ4A 2YVJA 4H4XA 5M10A 4U8NA 4CNKA 3KD9A 3H12A 4CCQA 3P1WA 4HN8A 4JNAA 3Q45A 3NXLA 1W6TA 1ZOYA 4H2RA 2BCGG 1GTHA 3ITJA 5HXIA 2JB2A 2YLTA 1PJ5A 3UKAA 4X9NA 3VCNA 3S61A 3EPTA 4H4YA 3R07C 2TMDA 2EQ9A 3AXBA 2BXSA 2YVFA 2B9XA 3CGDA 3AE2A 1FCDA 3SXIA 3QJ4A 2BXRA 3TJIA 1KSSA 2PCEA 1F8RA 4U8KA 3C4NA 1E39A 1YQ4A 4HB9A 3DFHA 4DSHA 3R9UA 1Y0PA 3DJDA 3K30A 1FO4A 1TDFA 5M0ZA 5J7XA 1PDHA 4GIRA 1NHSA 3TJ4A 5JCMA 4B63A 1YQ3A 1FFVC 3B9JB 3ATQA 3UKPA 3I4KA 3UKKA 5EB4A 3CK5A 4YSZA 5FJOA 3AE4A 2C66A 2ACZA 1L8PA 1DOBA 3H8LA 2EQ6A 1H2IA 4AP1A 3KKJA 1GRBA 3A7RA 2YG3A 2R4EA 3NZGA 4EQXA 3U9IA 2GMHA 2NVKX 4BK3A 3GWFA 3NHOX 2RABA 4H4RA 2OLAA 1GRFA 2CULA 1K0JA 4P9SA 3T9PA 2NPXA 1Q1WA 2OG9A 3QFBA 4X4JA 3GRTA 4NNJA 1OJDA 2X8CA 1BZLA 2XYOA 2R0PA 2P8BA 2Z5XA 3HYVA 1NPXA 2GVCA 5TR3A 4OPGA 3QKEA 1L9CA 3SY4A 4D04A 3UJSA 4IVMB 5CKUA 4TM3A 3BHKA 4GRTA 4B68A 3UCCA 2QJJA 3GDPA 2PTZA 4X2PA 1D4EA 3NG7X 4J2WA 2AR8A 3IC9A 3ICRA 4Z44A 4A5LA 1H7WA 5EB5A 5BULA 2JB3A 3CNDA 2GSHA 3N6HA 1N5WC 4C3YA 3L8KA 5ER0A 1LQUA 3F8RA 4HNLA 2X50A 3HPFA 2ZBWA 3N4EA 1JRZA 3BI4A 2GAHB 1E1NA 2YG6A 2XLRA 4ZA0A 4Z17A 2XFPA 1STZA 3V3NA 3QVPA 2YG7A 2C70A 2PYXA 2YG5A 3RITA 3VQRA 4U8LA 3UXKA 3FYYA 2BCPA 1KNPA 2C75A 4RSLA 4U8PA 3RNMA 3D47A 3T6CA 2C4CA 1E1KA 2PS2A 1IUWA 1L0VA 3DJJA 1CJ3A 2GGEA 4HNCA 3P9UA 3VFCA 3HW2A 3CPIG 3DERA 2ZZBA 3AE5A 1WUFA 3T0KA 1GV4A 3VDGA 1MXTA 4CY8A 3I3LA 2C67A 1CC4A 2P8CA 3NVVB 3KA7A 2BS4A 3G5QA 3H4KA 4Z2RA 3KVEA 1BGJA 2WETA 3SYIA 3KLJA 1SB3B 3FV9A 4IV9A 2QA2A 3OZ2A 2P88A 3DK4A 4MGGA 2XVHA 4NEWA 3ABVA 2IVEA 4KPRA 1Q9IA 1H7XA 2E3TA 1TDOA 4CNJA 3EEZA 1GNDA 3QSSA 1EC9A 4JQ9A 2BS2A 4YXDA 3RRAA 4BK2A 3AYIA 1DXLA 3NS1B 4DSGA 3AYJA 1S3BA 4IL0A 1NHRA 4Z2UA 3DDMA 2PODA 3UJEA 4DXKA 2XLUA 4Z2TA 4REKA 3K7QX 2Q0KA 2XFUA 3TCSA 1FHUA 1P48A 1X2GA 1S2QA 4WCTA 1LV0A 3DJEA 1TYTA 1TYPA 3T2KA 3NYEA 3EAOA 2H89A 2QCUA 3UTGA 3ALLA 1D5TA 2W3RA 1HYUA 3AB1A 2VVMA 1MO9A 2WQYA 5DBJA 2X8GA 2YR6A 2V61A 4O5QA 2GV8A 1RYIA 3WE0A 3BSMA 3AEEA 3BI5A 3QVRA 2VVLA 2JBVA 1PXAA 5IQ1A 4NZHA 3LB8A 3T31A 1GRGA 3NLCA 2FJEA 3AN1A 1E1LA 2W54A 2X99A 5ENLA 2R46A 6ENLA 5KMSA 5FS9A 2BK4A 1ZK7A 1B37A 3AEGA 3IHGA 1GT8A 1QJDA 5U63A 3TQPA 4LA1A 3JSKA 2GR3A 2C7GA 4BURA 3ES7A 3ICTA 2XH0A 3DGHA 3D46A 3ZVHB 3RHAA 1TRBA 2Y6QA 1QO8A 1VQZA 1PS9A 1GREA 3TOYA 4GFIA 3M13A 1XHCA 1GALA 3GWDA 3RGTA 5LV9A 2B9YA 3SQSA 1CL0A 2OVLA 1JOAA 2WBAA 3IF9A 5FJTA 1ZP0A 1CJ2A 3I6DA 4EIQA 4YTPA 3PK7A 3QSEA 3T2YA 1N63C 1VRQB 2YAUA 4G8TA 1BF3A 2PGEA 4JDRA 2QAEA 2XLPA 4OPUA 3UKHA 3CB3A 4K7ZA 5JRBA 4A6NB 1PN0A 1JNZA 1DNCA 2PU1A 1ZOVA 3RCYA 3S5WA 4YWSA 4J1OA 4AOSA 1F6MA 3SSZA 5KMQA 4H4VA 1H6VA 4G73A 1ZX9A 3BNMA 1KCZA 3AE6A 2V6OA 2WU2A 3V5CA 2AL2A 3ZVIA 4FX9A 3CIRA 3VR9A 1FFUC 3EUB3 4GDEA 2ONEA 2Y6RA 4K5SA 2YLZA 3AEDA 3N6JA 3SZ0A 2XVIA 1PBCA 2PP1A 5JCKA 2BACA 2V3AA 3DH9A 2FJBA 3BOXA 2YLWA 3CGCA 2B7SA 4RG3A 2AKMA 5FS8A 3UOYA 1FHVA 2C73A 2QVHA 5BRTA 4KT2A 2ARDA 3B3RA 1JPMA 3BHFA 4YTMA 3DG3A 3LOVA 1FEAA 2OALA 3UTHA 4YKFA 5J04A 4IA5A 1LTXR 1OJ9A 3UJ2A 4NTDA 3P0WA 2BK5A 4H4TA 3SN4A 3UJRA 2BABA 4UDPA 2WP9A 4EQRA 3DIPA 2BC0A 1P43A 4O5UA 2WDQA 2OAMA 4H4UA 3CTYA 3OC4A 2VQ7A 3OP2A 3UXLA 2AQJA 3NRNA 3KPKA 3UCLA 4G74A 1O5WA 1R6WA 2YLRA 4MMWA 3T14A 1T3QC 3GMBA 1CJCA 3K1GA 2PU0A 1E7PA 2OPJA 3RP7A 3H8AA 3RR1A 4HCDA 5IDZA 4II3A 3GDNA 5JCIA 2QDEA 3NK2X 5KWFA 1ZDLA 3II4A 1NHQA 4HPNA 4IHCA 1FECA 4ADWA 2OKTA 2IIDA 3UGVA 2J3NA 3VC5A 2GF3A 1ZMDA 2R0CA 2W55A 3ES8A 1BQGA 4J36A 5EOWA 4A3RA 1LVLA 4AOXA 3SGLA 4NTCA 1GRAA 2OQHA 3OZMA 1P2EA 1ELIA 1LPFA 2Q0LA 2FJAA 3CPHG 4YSXA 3CMMA 2PTXA 4HCLA 1KFYA 4BK1A 4HYRA 3L5OA 4MJWA 1GTEA 5HY5A 1JU2A 4WX1A 4F4RA 1XS2A 2WOWA 1GXFA 2I5QA 3THUA 3QFAA 2I0ZA 1TE6A 3FJ4A 4YKGA 2C76A 1JPDX 2GGJA 3NVZB 3AEBA 3IWAA 1S3EA 4OPLA 4OPCA 4ENLA 1NENA 4B67A 3M12A 2CFYA 4DGKA 1CF3A 4JHMA 2YR5A 1MDLA 1E9IA 2PMQA 4RG4A 3PS9A 2OZ8A 1X2HA 2X8HA 3AEAA 3IJQA 4H19A 4G6HA 1GPEA 3CNSA 2OLOA 3DMEA 4YSHA 1IUTA 3SJNA 3BI2A 3LZWA 1LQTA 3GO2A 1F3PA 1GRHA 4A9WA 3GRSA 3UOVA 3CT2A 1FEBA 2WP6A 4KEMA 3UTEA 4JNQA 5KOWA 3MY9A 3FMWA 4FP1A 2A87A 2GGIA 1D7LA 1N61C 3VC6A 4GAPA 3A7UA 2P0IA 2XVJA 4DHGA 2PA6A 4K5RA 2O56A 2OX4A 1NAAA 1V97A 2AKZA 3UKQA 2OQYA 4X9MA 2JB1A 7ENLA 2VRLA 1ZKQA 1N4UA 2GR0A 4IP5A 2O9ZA 2YVGA 4U8OA 3AM9A 4MKSA 2BRYA 3B97A 3DFYA 2W3SA 2XCGA 4ROPA 1PDZA 2QJMA 3GY1A 4B66A 1IUUA 4EMIA 3QLDA 2XFOA 3SFDA 3DA1A 1JRPA 3DESA 4CRTA 4H1ZA 1XPQA 2WPFA 3SBFA 3ENLA 3CGBA 3AE9A 2GMJA 4AP3A 1CC2A 1FIQB 3NN6X 2CVJA 1VG9A 5FJPA 4ECHA 2ZZCA 4Y4LA 1VDVA 3V5FA 4J3ZA 1Z6LA 3T37A 2VRMA 2WPCA 3PO7A 2GAGB 4E4UA 2A89A 3JVAA 2C3DA 4GF7A 5FJRA 2GEWA 2POZA 4II2A 1PHHA 1KN0A 3P4SA 3V4BA 3CN8A 2OLNA 2B7RA 3UOXA 2GDQA 5G5GB 3FCPA 1GETA 2H88A 4JY2A 3DJGX 1PBFA 2XH7A 3RP6A 2FBWA 2V3BA 3DK8A 2QDDA 3UCDA 1JEHA 4H2QA 1BKHA 3MKCA 4M52A 5GRTA 1QLBA 2AL2B 3D1CA 3V76A 4D03A 2YM1A 4I58A 1ECQA 3H70A 3PFRA 4J33A 1WUEA 4BJYA 2FYMA 3K7TA 2YLSA 4EMJA 4J31A 2GR2A 1EL7A 4ZOHB 5KRQA 2ZZ0A 3SR6B 4A7AA 1VDCA 2OA1A 2YWLA 1B5QA 1N1PA 5C3JA 4GUVA 1ONFA 3RP8A 1OEPA 3B6DA 1ZMCA 4A65A 2CDUA 1S2YA 1PBBA 5U1OA 4EM4A 3R25A 4HA6A 4JN9A 3P3BA 4M6UA 1X31B 2XLTA 3KU9A 1CC6A 3FPZA 2IVDA 2F5ZA 3VRAA 2A8XA 4DNAA 3P4QA 3ICSA 3SQPA 2VVLG 4IP4A 3S5SA 3UTFA 2ZADA 3PVCA 1SJDA 2XLSA 4Z43A 3P4PA 4C3XA 5BOFA 5CQFA 4H4QA 4FK1A 3CXOA 5JCNA 3NT6A 2ZC8A 2YG4A 1GOSA 3BJSA 3R1ZA 3JZUA 1KKRA 3Q4DA 3HYXA 4FDCB 2YR4A 3GD4A 1AOGA 1Y56A 4EM3A 2PPGA 2FKPA 2B76A 1NELA 4DYEA 2OZTA 4EMWA 2WP5A 3AYLA 3TTEA 1SEZA 3C96A 1D7YA 3CNPA 2PP0A 2Q7VA 3DEQA 3ZLFA 2XVFA 4YWOA 2HXUA 2WOIA 3HRDC 2QJNA 3QN3A 3CAWA 1WYGA 4OVIA 1NEKA 3NKSA 3IJIA 4TVYA 3ZVHA 1TDNA 3T4WA 4AT0A 4TVWA 3NYFA 2MUCA 2VOUA 4APNA 3SM8A 5C2TA 4U2TA 3AECA 3UP5A 4U2LA 1B4VA 3NN0X 4DN1A 3NFUA 4IZGA 4K22A 3R10A 3MQTA 5KOXA 2R45A 3HZLA 1NG3A 4Z24A 2GRTA 1XANA 2TPRA 1SJCA 4K8GA 1EL9A 1N4WA 1CJ4A 2HQMA 3MWCA 4USRA 1IUSA 4A35A 4IT1A 5FS7A 2OO6A 4GMEA 3V3OA 3QPEA 1JCTA 3QSMA 4GAVA 2PTYA 5BOEA 4A6NA 2QGYA 3L1RA 3R11A 1KSUA 4DWDA 4H2HA 3F8PA 1M64A 2GB0A 4H4SA 3ALJA 3R0UA 4OCGA 2C3CA 3D8XA 4M0XA 1KF6A 1MUCA 1V59A 3MZNA 1F8SA 5FJUA 3JW7A 3S47A 2R4JA 4C77A 4C74A 4OPTA 2XFQA 1NG4A 1DJQA 3C4AA 3CYJA 3MSYA 1FL2A 2YM2A 2YLXA 1TDKA 5KNLA 3I6EA 4C5OA 4E8GA 3ZDNA 2APGA 2DW6A 3FIMB 4H4PA 2BA9A 4E6MA 5JCLA 3QTPA 1RP0A 2PP3A 2RGHA 3KUMA 3MUCA 1F9CA 3AWIA 1JRXA 1JDFA 1H82A 4GR1A 2FJDA 4GCMA 5KXJA 3IK4A 3PWGA 1XDIA 4U8IA 1L9EA 2E5VA 1SJBA 4J56A 1E1MA 2VQBA 3D9XA 3T8QA 1GSNA 4UDQA 4XWZA 4K8DA 4NEVA 2AL1A 1K0IA 3GYJA 2GGHA 3LJPA 3ISHA 2X3NA 1O95A 3KPFA 4A6GA 1VG0A 4KX6A 4E4FA 3GD3A 1IUVA 4ZN0A 3TWBA 2RGOA 3NVWB 2AAQA 2VZ2A 3URHA 4GYPA 2BK3A 1GRTA 3NVYB 3NIXA 4Z25A 5U25A 4B1BA 4GYPC 1YKJA 4YTNA 1EBDA 2PGWA 4HCHA 3H7VA 1NU5A 3NRZB 4B65A 5BVAA 2BYBA 3BNUA 2QQ6A 1W4XA 3AMZA 1E6EA 4U2SA 5KMPA 3PG6A 4H7UA 2YQUA 3ALMA 5GSNA 1N60C 3SFEA 3AE3A 3A7AA 2XFNA 2BS3A 1GESA 1DJNA 2GR1A 1DOEA 1PBDA 1ZXIC 4GDPA 3NTAA 3TWAA 1ELSA 3SN1A 2GL5A 2EQ8A 1MNSA 1IJHA 2WOVA 3DGBA 1DOCA 1PXCA 2XH4A 1O94A 5HYMA 3I6TA 1BGNA 3EANA 3VRBA 5KVHA 1K4QA 4PABA 1JRYA 4CCRA 1JROA 3GSIA 3NGCX 1EC7A 3DGZA 3ZYXA 3CNTA 3NO1A 4ICYA 4ZCDA 3U4FA 3NH3X 4JN8A 2WDRA 3CNJA 1CHUA 2BC1A 2EQ7A 4XWRA 3AE7A 4H4WA 3M0OA 4J57A 3SZFA 5L46A 4TLZA 1KD0A 4TM0A 3AD8B 3OZYA 3V3WA 4KWSA 1OJTA 1BKWA 3HYWA 2UZZA 5G5HB 3ADAB 2C65A 1IUXA 2DKIA
chains in the Genus database with same CATH topology
3K7TA 4EQXA 2YLSA 4EMJA 2GMHA 2GR2A 2NVKX 1EL7A 1JNRA 3GWFA 4J31A 4U8MA 4BK3A 3NHOX 5BRTA 2RABA 5KRQA 3Q6JA 2ZZ0A 4H4RA 2R0GA 2ARDA 3B3RA 1GRFA 2CULA 1K0JA 4A7AA 1VDCA 4P9SA 2NPXA 1Q1WA 2OA1A 3QFBA 2YWLA 2DKHA 1B5QA 3BHFA 4X4JA 1N1PA 5EBKA 1EL8A 3GRTA 2C72A 3LOVA 4G9KA 4GUVA 4YTMA 5C3JA 1FEAA 1ONFA 2WESA 1PJ7A 3RP8A 2OALA 4NNJA 3B6DA 4LU6A 1ZMCA 1OJDA 3UTHA 2WS3A 2X8CA 1BZLA 2WEUA 2XYOA 2R0PA 3VRDB 4A65A 3AD7B 2CDUA 4YKFA 1H84A 2Z5XA 1S2YA 3HYVA 4IA5A 1LTXR 1NPXA 1OJ9A 2GVCA 5TR3A 1PBBA 5U1OA 3AEFA 4EM4A 4OPGA 4HA6A 4JN9A 4NTDA 1MOKA 4H4TA 2BK5A 1X31B 1L9CA 2XLTA 2BABA 3KU9A 3NK0X 3AE8A 4UDPA 2WP9A 1CC6A 2BRAA 3FPZA 4EQRA 2IVDA 2F5ZA 2BC0A 3SY4A 4O5UA 3VRAA 2A8XA 4D04A 4IVMB 5CKUA 2WDQA 1D4CA 4U8JA 4CY6A 3REDA 2OAMA 4H4UA 4TM3A 3CTYA 3OC4A 3BHKA 2WDVA 4DNAA 3P4QA 3ICSA 4GRTA 4B68A 3SQPA 2VQ7A 4TM1A 3GDPA 5J60A 2VVLG 2AQJA 3UTFA 3UOZA 1D4EA 3NG7X 3NRNA 3Q9TA 3PVCA 3KPKA 4J2WA 3UCLA 4G74A 2AR8A 2XLSA 1O5WA 4EQWA 3IC9A 3P4PA 4C3XA 3ICRA 4Z43A 2YLRA 5CQFA 4H4QA 4Y4MA 4FK1A 3T14A 3LZXA 5JCNA 3NT6A 2JAEA 2YG4A 1GOSA 1P2HA 4X9MA 3GMBA 4Z44A 4A5LA 4EQSA 1H7WA 5EB5A 3E1TA 5BULA 1H83A 1CJCA 2JB3A 2GQFA 3CNDA 4CBQA 5HHFA 1E7PA 3NYCA 1GERA 4C3YA 3L8KA 3RP7A 5ER0A 3HYXA 1LQUA 3F8RA 4FDCB 2YR4A 3GD4A 4YSYA 1AOGA 2X50A 3GYXA 2ZBWA 3DK9A 1Y56A 4II3A 3GDNA 5JCIA 1JRZA 3BI4A 2GAHB 1E1NA 4YT0A 4EM3A 3NK2X 2YG6A 2XLRA 5KWFA 1ZDLA 3II4A 2B76A 1PBEA 2XFPA 1NHQA 4EMWA 2JKCA 3V3NA 3LADA 2WP5A 1D4DA 3QVPA 2YG7A 2C70A 3AYLA 1SEZA 1UKVG 2PYXA 2YG5A 3C96A 1D7YA 3VQRA 3CNPA 4U8LA 1FECA 3SZCA 4ADWA 4AT2A 1S7MA 1M6IA 2Q7VA 4G6GA 2BCPA 1REOA 4H50A 4B69A 1KNPA 3G5RA 3IHMA 2XVFA 4Z26A 2IIDA 2C75A 2J3NA 4YWOA 3F8DA 1EL5A 4RSLA 4U8PA 2WOIA 1H86A 4IVOB 2GF3A 1Q1RA 1ZMDA 5KVIA 3RNMA 2R0CA 4TM4A 2C4CA 1Y56B 1E1KA 1B8SA 4J36A 5EOWA 1N4VA 1LVLA 1IUWA 4AOXA 3AD9B 1L0VA 3SGLA 3DJJA 1CJ3A 3P9UA 2R9ZA 4OVIA 1NEKA 3CPIG 3NKSA 4ZCCA 4OPIA 4NTCA 1GRAA 2ZZBA 3AE5A 1P2EA 1ELIA 4PAAA 3UKFA 1LPFA 1TDNA 2FJAA 2Q0LA 3T0KA 1GV4A 2W0HA 1MXTA 3CPHG 3NK1X 4AT0A 4CY8A 5IPYA 4YSXA 3UKLA 3NYFA 3CMMA 1KFYA 2VOUA 4APNA 3SM8A 2QA1A 4BK1A 3I3LA 5C2TA 4U2TA 4USQA 3AECA 2C67A 3UP5A 4U2LA 1B4VA 3SZWA 3NN0X 4UP3A 1CC4A 2WU5A 3AE1A 3CGEA 3KA7A 2BS4A 3G5QA 4K22A 3H4KA 4Z2RA 3L5OA 1NHPA 4MJWA 1GTEA 5KOXA 2R45A 3HZLA 1NG3A 5HY5A 1JU2A 4WX1A 4Z24A 3KVEA 2GRTA 4EIPA 1BGJA 3P4RA 2WETA 3SYIA 1XANA 2TPRA 2WOWA 1N4WA 1EL9A 1GXFA 1CJ4A 3KLJA 3NNEA 1GEUA 2HQMA 1OJAA 4IV9A 2QA2A 3QFAA 2I0ZA 4USRA 1IUSA 2V5ZA 3GYIA 3OZ2A 3DK4A 4YKGA 2XVHA 1OJCA 4NEWA 5FS7A 3ABVA 3V3OA 2IVEA 4KPRA 1L9DA 1Q9IA 2C76A 3QSMA 1H7XA 4NWZA 4GAVA 1TDOA 4A6NA 4CNJA 1GNDA 3L1RA 2GH5A 3GMCA 3QSSA 4JQ9A 1KSUA 2BS2A 3AEBA 3IWAA 4YXDA 1S3EA 3F8PA 4OPLA 1M64A 4OPCA 4BK2A 3AYIA 1DXLA 4DSGA 2GB0A 3AYJA 1S3BA 3NTDA 1NENA 4H4SA 4N9XA 4B67A 3M12A 1DODA 5KMRA 1NHRA 2CFYA 3ALJA 4OCGA 2C3CA 4Z2UA 3D8XA 3FG2P 4BV6A 2XLUA 1KF6A 4Z2TA 4DGKA 4REKA 1CF3A 1V59A 2WPEA 1YY5A 1F8WA 1F8SA 3K7QX 2Q0KA 2XFUA 2YR5A 1RSGA 4FK1C 1FOHA 1S2QA 4WCTA 1LV0A 3DJEA 1TYTA 2E4GA 4RG4A 2Z5YA 3G5SA 4OPDA 1TYPA 3PS9A 5FS6A 2R4JA 4C77A 1BWCA 3COXA 3T2KA 2X8HA 3AEAA 3NYEA 4C74A 3ATRA 4OPTA 2XFQA 3EAOA 1NG4A 1DJQA 4UDRA 4B64A 2H89A 3C4AA 2QCUA 3O0HA 1FL2A 1K0LA 2YM2A 4G6HA 3UTGA 3ALLA 1D5TA 2YLXA 1GPEA 3EF6A 1HYUA 3AB1A 1TDKA 2VVMA 5KNLA 3CNSA 1MO9A 2OLOA 3DMEA 4NTEA 2WQYA 4YSHA 2B9WA 5DBJA 1IUTA 2X8GA 3BI2A 4I59A 2Q6UA 4C5OA 3LZWA 5FMHA 2YR6A 2V61A 5BUKA 4O5QA 1LJ1A 2GV8A 1RYIA 1LQTA 2APGA 3ZDNA 3FIMB 1F3PA 1GRHA 3FBSA 3WE0A 3SX6A 2GQWA 4H4PA 3K7MX 4A9WA 2BA9A 2JK6A 3VR8A 1COYA 3AEEA 5JCLA 3GRSA 3BI5A 3UOVA 2XVEA 3QVRA 1FEBA 2VVLA 1RP0A 2WP6A 4H2PA 3T2ZA 3UTEA 2JBVA 4JNQA 2RGHA 5KOWA 1PJ6A 1PXAA 2XDOA 1NDAA 3FMWA 4A79A 2A87A 4NZHA 5IQ1A 3AWIA 4XXGA 4K2XA 1D7LA 3LB8A 1VQWA 2PHHA 1JRXA 4GAPA 3T31A 1H82A 4GR1A 1YQZA 2XVJA 2FJDA 4GCMA 4IA6A 5KXJA 4K5RA 1XDIA 4U8IA 1GRGA 1L9EA 1NAAA 4J34A 2E5VA 4J56A 3NLCA 3CPJG 1E1MA 2FJEA 1ZY8A 2VQBA 3D9XA 1E1LA 1GSNA 4H4ZA 2X99A 4UDQA 3UKQA 4XWZA 4K8DA 4NEVA 2R46A 1K0IA 3GYJA 3LXDA 5KMSA 1H81A 3ISHA 5FS9A 2BK4A 2JB1A 1O95A 2X3NA 3KPFA 3LJPA 1VG0A 4BJZA 1ZK7A 4KX6A 1B37A 2VRLA 3GD3A 1IUVA 3AEGA 3IHGA 1GT8A 1QJDA 1TDEA 5U63A 4ZN0A 1ZKQA 2RGOA 4LA1A 3JSKA 2AAQA 1KDGA 2VZ2A 3URHA 3UP4A 2BK3A 1N4UA 2RGJA 1GRTA 2GR3A 2C7GA 4H2NA 2GR0A 4E0VA 4BURA 2O9ZA 3ICTA 3NIXA 2YVGA 4Z25A 3H8IA 3DGHA 5U25A 2E1MA 1KNRA 4B1BA 1PXBA 4LIIA 3RHAA 1YKJA 4A99A 1EBDA 4YTNA 1TRBA 2Y6QA 4U8OA 1QO8A 4Y4NA 4B65A 1PS9A 2BRYA 1GREA 5BVAA 2BYBA 3BNUA 2V60A 1CBOA 4JY3A 3M13A 2XCGA 1XHCA 1W4XA 1GALA 4TLXA 2WHDA 2C64A 1E6EA 4U2SA 3GWDA 5IQ4A 5KMPA 2YVJA 4H4XA 5LV9A 5M10A 2B9YA 4U8NA 4B66A 3PG6A 1IUUA 3KD9A 4H7UA 2YQUA 4CNKA 4EMIA 3ALMA 5GSNA 4CCQA 3P1WA 2XFOA 4JNAA 3SFEA 1CL0A 3AE3A 2XFNA 1JOAA 2WBAA 2BS3A 1GESA 3IF9A 1ZP0A 1DJNA 1ZOYA 3SFDA 1CJ2A 3DA1A 2GR1A 3I6DA 4H2RA 1DOEA 1PBDA 2BCGG 1GTHA 4EIQA 4YTPA 3QSEA 3T2YA 4CRTA 3ITJA 5HXIA 4GDPA 2JB2A 2YLTA 1PJ5A 3NTAA 1XPQA 2WPFA 1VRQB 2YAUA 1BF3A 3UKAA 4JDRA 2QAEA 4X9NA 3CGBA 3AE9A 2EQ8A 2GMJA 1IJHA 2XLPA 4OPUA 4AP3A 1CC2A 3NN6X 2WOVA 3UKHA 2CVJA 3S61A 1VG9A 4K7ZA 3EPTA 4H4YA 1DOCA 1PXCA 2EQ9A 5JRBA 2TMDA 3AXBA 4ECHA 2BXSA 4A6NB 2YVFA 2ZZCA 1PN0A 4Y4LA 1JNZA 2B9XA 1DNCA 1Z6LA 3CGDA 1O94A 1ZOVA 5HYMA 3S5WA 1BGNA 3T37A 2VRMA 2WPCA 3EANA 3AE2A 3PO7A 2GAGB 3VRBA 1FCDA 3SXIA 4AOSA 2A89A 1F6MA 5KVHA 1K4QA 3QJ4A 2C3DA 4GF7A 4PABA 1JRYA 2BXRA 5KMQA 4CCRA 4H4VA 1KSSA 1H6VA 2GEWA 3GSIA 3NGCX 4II2A 1F8RA 4G73A 3DGZA 1ZX9A 3ZYXA 3BNMA 3CNTA 4U8KA 4ZCDA 3C4NA 4ICYA 3NH3X 1PHHA 1KN0A 1E39A 2V6OA 1YQ4A 3AE6A 2WU2A 3P4SA 4HB9A 3CN8A 2OLNA 2B7RA 4FX9A 4DSHA 3R9UA 2WDRA 3UOXA 3CIRA 3CNJA 3VR9A 1Y0PA 3DJDA 1GETA 2H88A 3K30A 1CHUA 1TDFA 2BC1A 4JY2A 5J7XA 5M0ZA 3DJGX 1PDHA 1PBFA 4GDEA 3RP6A 2EQ7A 1NHSA 4XWRA 2Y6RA 4H4WA 5JCMA 3AE7A 4J57A 2FBWA 3M0OA 4K5SA 3SZFA 4B63A 4TLZA 5L46A 1YQ3A 2V3BA 4TM0A 2YLZA 3AEDA 3DK8A 3AD8B 3ATQA 3UKPA 3SZ0A 1JEHA 3UKKA 2XVIA 4H2QA 1PBCA 5EB4A 4YSZA 5JCKA 3AE4A 2C66A 1OJTA 2ACZA 2BACA 4M52A 2V3AA 3DH9A 1BKWA 1DOBA 3H8LA 2FJBA 2EQ6A 1H2IA 4AP1A 3HYWA 2YLWA 1GRBA 5GRTA 1QLBA 3KKJA 2UZZA 3D1CA 3CGCA 3V76A 4D03A 2YM1A 4I58A 2B7SA 3ADAB 4RG3A 2C65A 5FS8A 4J33A 3UOYA 2C73A 2YG3A 4BJYA 2R4EA 1IUXA 2DKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7T A;  4EQX A;  2YLS A;  4EMJ A;  2GMH A;  2GR2 A;  2NVK X;  1EL7 A;  1JNR A;  3GWF A;  4J31 A;  4U8M A;  4BK3 A;  3NHO X;  5BRT A;  2RAB A;  5KRQ A;  3Q6J A;  2ZZ0 A;  4H4R A;  2R0G A;  2ARD A;  3B3R A;  1GRF A;  2CUL A;  1K0J A;  4A7A A;  1VDC A;  4P9S A;  2NPX A;  1Q1W A;  2OA1 A;  3QFB A;  2YWL A;  2DKH A;  1B5Q A;  3BHF A;  4X4J A;  1N1P A;  5EBK A;  1EL8 A;  3GRT A;  2C72 A;  3LOV A;  4YTM A;  4GUV A;  5C3J A;  1FEA A;  1ONF A;  2WES A;  1PJ7 A;  3RP8 A;  2OAL A;  3B6D A;  4LU6 A;  1ZMC A;  1OJD A;  3UTH A;  2WS3 A;  2X8C A;  1BZL A;  2WEU A;  2XYO A;  2R0P A;  3VRD B;  4A65 A;  3AD7 B;  2CDU A;  4YKF A;  1H84 A;  2Z5X A;  1S2Y A;  4IA5 A;  1LTX R;  1NPX A;  1OJ9 A;  2GVC A;  5TR3 A;  1PBB A;  5U1O A;  3AEF A;  4EM4 A;  4OPG A;  4HA6 A;  4JN9 A;  4NTD A;  1MOK A;  4H4T A;  2BK5 A;  1X31 B;  1L9C A;  2XLT A;  2BAB A;  3KU9 A;  3NK0 X;  3AE8 A;  4UDP A;  2WP9 A;  1CC6 A;  3FPZ A;  2IVD A;  4EQR A;  2F5Z A;  2BC0 A;  3VRA A;  4O5U A;  2A8X A;  4D04 A;  4IVM B;  5CKU A;  2WDQ A;  1D4C A;  4U8J A;  4CY6 A;  3RED A;  2OAM A;  4H4U A;  4TM3 A;  3CTY A;  3OC4 A;  3BHK A;  2WDV A;  4DNA A;  3P4Q A;  3ICS A;  4GRT A;  4B68 A;  3SQP A;  2VQ7 A;  4TM1 A;  3GDP A;  5J60 A;  2VVL G;  2AQJ A;  3UTF A;  3UOZ A;  1D4E A;  3NG7 X;  3NRN A;  3Q9T A;  3PVC A;  4J2W A;  3UCL A;  2AR8 A;  2XLS A;  1O5W A;  4EQW A;  3IC9 A;  3P4P A;  4C3X A;  3ICR A;  4Z43 A;  2YLR A;  5CQF A;  4H4Q A;  4Y4M A;  4FK1 A;  3LZX A;  5JCN A;  3NT6 A;  2JAE A;  2YG4 A;  1GOS A;  1P2H A;  4X9M A;  3GMB A;  4Z44 A;  4A5L A;  4EQS A;  1H7W A;  5EB5 A;  3E1T A;  5BUL A;  1H83 A;  1CJC A;  2JB3 A;  2GQF A;  3CND A;  4CBQ A;  5HHF A;  1E7P A;  3NYC A;  1GER A;  4C3Y A;  3L8K A;  3RP7 A;  5ER0 A;  1LQU A;  3F8R A;  4FDC B;  2YR4 A;  3GD4 A;  4YSY A;  1AOG A;  2X50 A;  2ZBW A;  3DK9 A;  1Y56 A;  3GDN A;  5JCI A;  1JRZ A;  3BI4 A;  2GAH B;  1E1N A;  4YT0 A;  4EM3 A;  3NK2 X;  2YG6 A;  2XLR A;  5KWF A;  1ZDL A;  3II4 A;  2B76 A;  1PBE A;  2XFP A;  1NHQ A;  4EMW A;  2JKC A;  3V3N A;  3LAD A;  2WP5 A;  1D4D A;  3QVP A;  2YG7 A;  2C70 A;  3AYL A;  1SEZ A;  1UKV G;  2PYX A;  2YG5 A;  3C96 A;  1D7Y A;  3VQR A;  3CNP A;  4U8L A;  1FEC A;  4AT2 A;  4ADW A;  1M6I A;  2Q7V A;  2BCP A;  1REO A;  4H50 A;  4B69 A;  1KNP A;  3G5R A;  3IHM A;  2XVF A;  4Z26 A;  2IID A;  2C75 A;  2J3N A;  4YWO A;  3F8D A;  1EL5 A;  4RSL A;  4U8P A;  2WOI A;  1H86 A;  4IVO B;  2GF3 A;  1Q1R A;  1ZMD A;  5KVI A;  3RNM A;  2R0C A;  4TM4 A;  1Y56 B;  1E1K A;  1B8S A;  4J36 A;  5EOW A;  1N4V A;  1LVL A;  1IUW A;  4AOX A;  3AD9 B;  1L0V A;  3SGL A;  3DJJ A;  1CJ3 A;  3P9U A;  2R9Z A;  4OVI A;  1NEK A;  3CPI G;  3NKS A;  4ZCC A;  4OPI A;  4NTC A;  1GRA A;  2ZZB A;  3AE5 A;  1P2E A;  1ELI A;  4PAA A;  3UKF A;  1LPF A;  1TDN A;  2FJA A;  2Q0L A;  1GV4 A;  2W0H A;  1MXT A;  3CPH G;  3NK1 X;  4AT0 A;  4CY8 A;  5IPY A;  4YSX A;  3UKL A;  3NYF A;  1KFY A;  2VOU A;  4APN A;  3SM8 A;  2QA1 A;  4BK1 A;  3I3L A;  5C2T A;  4U2T A;  4USQ A;  3AEC A;  2C67 A;  3UP5 A;  4U2L A;  1B4V A;  3NN0 X;  4UP3 A;  1CC4 A;  2WU5 A;  3AE1 A;  3CGE A;  3KA7 A;  2BS4 A;  3G5Q A;  4K22 A;  3H4K A;  4Z2R A;  1NHP A;  4MJW A;  1GTE A;  5KOX A;  2R45 A;  3HZL A;  1NG3 A;  5HY5 A;  1JU2 A;  4WX1 A;  4Z24 A;  3KVE A;  2GRT A;  4EIP A;  1BGJ A;  3P4R A;  2WET A;  1XAN A;  2TPR A;  2WOW A;  1N4W A;  1EL9 A;  1GXF A;  1CJ4 A;  3KLJ A;  3NNE A;  1GEU A;  2HQM A;  1OJA A;  4IV9 A;  2QA2 A;  3QFA A;  2I0Z A;  4USR A;  1IUS A;  2V5Z A;  3GYI A;  3OZ2 A;  3DK4 A;  4YKG A;  2XVH A;  1OJC A;  4NEW A;  5FS7 A;  3ABV A;  3V3O A;  2IVE A;  4KPR A;  1L9D A;  1Q9I A;  2C76 A;  3QSM A;  1H7X A;  1TDO A;  4A6N A;  4CNJ A;  1GND A;  3L1R A;  2GH5 A;  3GMC A;  3QSS A;  4JQ9 A;  1KSU A;  2BS2 A;  3AEB A;  3IWA A;  4YXD A;  1S3E A;  3F8P A;  4OPL A;  1M64 A;  4OPC A;  4BK2 A;  3AYI A;  1DXL A;  4DSG A;  2GB0 A;  3AYJ A;  1S3B A;  3NTD A;  1NEN A;  4H4S A;  4N9X A;  4B67 A;  3M12 A;  1DOD A;  1NHR A;  2CFY A;  3ALJ A;  4OCG A;  2C3C A;  4Z2U A;  3D8X A;  3FG2 P;  4BV6 A;  2XLU A;  1KF6 A;  4Z2T A;  4DGK A;  4REK A;  1CF3 A;  1V59 A;  2WPE A;  1YY5 A;  1F8W A;  1F8S A;  3K7Q X;  2Q0K A;  2XFU A;  2YR5 A;  1RSG A;  4FK1 C;  1FOH A;  1S2Q A;  4WCT A;  1LV0 A;  3DJE A;  1TYT A;  2E4G A;  4RG4 A;  2Z5Y A;  3G5S A;  4OPD A;  1TYP A;  3PS9 A;  5FS6 A;  2R4J A;  4C77 A;  1BWC A;  3COX A;  2X8H A;  3AEA A;  3NYE A;  4C74 A;  3ATR A;  4OPT A;  2XFQ A;  3EAO A;  1NG4 A;  1DJQ A;  4UDR A;  4B64 A;  2H89 A;  3C4A A;  2QCU A;  3O0H A;  1FL2 A;  1K0L A;  2YM2 A;  3UTG A;  3ALL A;  1D5T A;  2YLX A;  1GPE A;  3EF6 A;  1HYU A;  3AB1 A;  1TDK A;  2VVM A;  3CNS A;  1MO9 A;  2OLO A;  3DME A;  4NTE A;  2WQY A;  4YSH A;  2B9W A;  5DBJ A;  1IUT A;  2X8G A;  3BI2 A;  4I59 A;  2Q6U A;  4C5O A;  3LZW A;  5FMH A;  2YR6 A;  2V61 A;  5BUK A;  4O5Q A;  1LJ1 A;  2GV8 A;  1RYI A;  1LQT A;  2APG A;  3ZDN A;  3FIM B;  1F3P A;  1GRH A;  3FBS A;  3WE0 A;  2GQW A;  4H4P A;  3K7M X;  4A9W A;  2BA9 A;  2JK6 A;  3VR8 A;  1COY A;  3AEE A;  5JCL A;  3GRS A;  3BI5 A;  3UOV A;  2XVE A;  3QVR A;  1FEB A;  2VVL A;  1RP0 A;  2WP6 A;  4H2P A;  3UTE A;  2JBV A;  4JNQ A;  2RGH A;  5KOW A;  1PJ6 A;  1PXA A;  2XDO A;  1NDA A;  3FMW A;  4A79 A;  2A87 A;  4NZH A;  5IQ1 A;  3AWI A;  4XXG A;  4K2X A;  1D7L A;  3LB8 A;  1VQW A;  2PHH A;  1JRX A;  1H82 A;  4GR1 A;  1YQZ A;  2XVJ A;  2FJD A;  4GCM A;  4IA6 A;  5KXJ A;  4K5R A;  1XDI A;  4U8I A;  1GRG A;  1L9E A;  1NAA A;  4J34 A;  2E5V A;  4J56 A;  3NLC A;  3CPJ G;  1E1M A;  2FJE A;  1ZY8 A;  2VQB A;  1E1L A;  1GSN A;  4H4Z A;  2X99 A;  4UDQ A;  3UKQ A;  4XWZ A;  4K8D A;  4NEV A;  2R46 A;  1K0I A;  3GYJ A;  3LXD A;  1H81 A;  3ISH A;  5FS9 A;  2BK4 A;  2JB1 A;  1O95 A;  2X3N A;  3KPF A;  3LJP A;  1VG0 A;  4BJZ A;  1ZK7 A;  4KX6 A;  1B37 A;  2VRL A;  3GD3 A;  1IUV A;  3AEG A;  3IHG A;  1GT8 A;  1QJD A;  1TDE A;  5U63 A;  4ZN0 A;  1ZKQ A;  2RGO A;  4LA1 A;  3JSK A;  2AAQ A;  1KDG A;  2VZ2 A;  3URH A;  3UP4 A;  2BK3 A;  1N4U A;  2RGJ A;  1GRT A;  2GR3 A;  2C7G A;  4H2N A;  2GR0 A;  4E0V A;  4BUR A;  2O9Z A;  3ICT A;  3NIX A;  2YVG A;  4Z25 A;  3H8I A;  3DGH A;  5U25 A;  2E1M A;  1KNR A;  4B1B A;  1PXB A;  4LII A;  3RHA A;  1YKJ A;  4A99 A;  1EBD A;  4YTN A;  1TRB A;  2Y6Q A;  4U8O A;  1QO8 A;  4Y4N A;  4B65 A;  1PS9 A;  1GRE A;  5BVA A;  2BYB A;  3BNU A;  2V60 A;  1CBO A;  4JY3 A;  3M13 A;  2XCG A;  1XHC A;  1W4X A;  1GAL A;  4TLX A;  2WHD A;  2C64 A;  1E6E A;  4U2S A;  3GWD A;  5IQ4 A;  2YVJ A;  4H4X A;  5LV9 A;  5M10 A;  2B9Y A;  4U8N A;  4B66 A;  1IUU A;  3KD9 A;  4H7U A;  2YQU A;  4CNK A;  4EMI A;  3ALM A;  5GSN A;  4CCQ A;  3P1W A;  2XFO A;  4JNA A;  3SFE A;  1CL0 A;  3AE3 A;  2XFN A;  1JOA A;  2WBA A;  2BS3 A;  1GES A;  3IF9 A;  1ZP0 A;  1DJN A;  1ZOY A;  3SFD A;  1CJ2 A;  3DA1 A;  2GR1 A;  3I6D A;  4H2R A;  1DOE A;  1PBD A;  2BCG G;  1GTH A;  4EIQ A;  4YTP A;  3QSE A;  4CRT A;  3ITJ A;  5HXI A;  4GDP A;  2JB2 A;  2YLT A;  1PJ5 A;  3NTA A;  1XPQ A;  2WPF A;  1VRQ B;  2YAU A;  1BF3 A;  3UKA A;  4JDR A;  2QAE A;  4X9N A;  3CGB A;  3AE9 A;  2EQ8 A;  2GMJ A;  1IJH A;  2XLP A;  4OPU A;  4AP3 A;  1CC2 A;  3NN6 X;  2WOV A;  3UKH A;  2CVJ A;  3S61 A;  1VG9 A;  4K7Z A;  3EPT A;  4H4Y A;  1DOC A;  1PXC A;  2EQ9 A;  2TMD A;  3AXB A;  4ECH A;  2BXS A;  4A6N B;  2YVF A;  2ZZC A;  1PN0 A;  4Y4L A;  1JNZ A;  2B9X A;  1DNC A;  1Z6L A;  3CGD A;  1O94 A;  1ZOV A;  5HYM A;  3S5W A;  1BGN A;  3T37 A;  2VRM A;  2WPC A;  3EAN A;  3AE2 A;  3PO7 A;  2GAG B;  3VRB A;  1FCD A;  4AOS A;  2A89 A;  1F6M A;  5KVH A;  1K4Q A;  3QJ4 A;  2C3D A;  4GF7 A;  4PAB A;  1JRY A;  2BXR A;  4CCR A;  4H4V A;  1KSS A;  1H6V A;  2GEW A;  3GSI A;  3NGC X;  1F8R A;  3DGZ A;  1ZX9 A;  3ZYX A;  3BNM A;  3CNT A;  4U8K A;  4ZCD A;  3C4N A;  4ICY A;  3NH3 X;  1PHH A;  1E39 A;  3AE6 A;  2V6O A;  1YQ4 A;  3P4S A;  2WU2 A;  4HB9 A;  3CN8 A;  2OLN A;  2B7R A;  4FX9 A;  4DSH A;  3R9U A;  2WDR A;  3UOX A;  3CIR A;  3CNJ A;  3VR9 A;  1Y0P A;  3DJD A;  1GET A;  2H88 A;  3K30 A;  1CHU A;  1TDF A;  2BC1 A;  4JY2 A;  5J7X A;  5M0Z A;  3DJG X;  1PDH A;  1PBF A;  4GDE A;  3RP6 A;  2EQ7 A;  1NHS A;  4XWR A;  2Y6R A;  4H4W A;  5JCM A;  3AE7 A;  4J57 A;  2FBW A;  3M0O A;  4K5S A;  4B63 A;  5L46 A;  4TLZ A;  1YQ3 A;  2V3B A;  4TM0 A;  2YLZ A;  3AED A;  3DK8 A;  3AD8 B;  3ATQ A;  3UKP A;  1JEH A;  3UKK A;  2XVI A;  4H2Q A;  1PBC A;  5EB4 A;  4YSZ A;  5JCK A;  3AE4 A;  2C66 A;  1OJT A;  2ACZ A;  2BAC A;  4M52 A;  2V3A A;  3DH9 A;  1BKW A;  1DOB A;  3H8L A;  2FJB A;  2EQ6 A;  4AP1 A;  2YLW A;  1GRB A;  5GRT A;  1QLB A;  3KKJ A;  2UZZ A;  3D1C A;  3CGC A;  3V76 A;  4D03 A;  2YM1 A;  4I58 A;  2B7S A;  3ADA B;  4RG3 A;  2C65 A;  5FS8 A;  4J33 A;  3UOY A;  2C73 A;  2YG3 A;  4BJY A;  2R4E A;  1IUX A;  2DKI A; 
#chains in the Genus database with same CATH topology
 3ETR B;  3OTR A;  1JNR A;  4U8M A;  3Q6J A;  2R0G A;  3TW9 A;  4GIS A;  2RDX A;  4K2S A;  2DKH A;  5EBK A;  1EL8 A;  2C72 A;  4G9K A;  3SN0 A;  2WES A;  1PJ7 A;  2CHR A;  3N4F A;  4LU6 A;  3CXB A;  2WS3 A;  2WEU A;  3VRD B;  3AD7 B;  1H84 A;  3FVD A;  3AEF A;  1MOK A;  2XGZ A;  3NK0 X;  3AE8 A;  2BRA A;  1D4C A;  4U8J A;  4CY6 A;  3RED A;  3R0K A;  2WDV A;  4IL2 A;  4TM1 A;  5J60 A;  3UOZ A;  3STP A;  3Q9T A;  4EQW A;  1IYX A;  2HXT A;  4Y4M A;  3LZX A;  2JAE A;  1P2H A;  4EQS A;  3E1T A;  1H83 A;  2GQF A;  4CBQ A;  5HHF A;  3NYC A;  1GER A;  3GD6 A;  4YSY A;  3GYX A;  3DK9 A;  4YT0 A;  1EC8 A;  1PBE A;  2JKC A;  4KPL A;  3LAD A;  1D4D A;  1UKV G;  4DX3 A;  3RO6 A;  2E5A A;  3SZC A;  4AT2 A;  1S7M A;  1M6I A;  4G6G A;  1REO A;  4H50 A;  4B69 A;  3G5R A;  3IHM A;  4Z26 A;  3F8D A;  1EL5 A;  1MDR A;  1H86 A;  4IVO B;  1Q1R A;  5KVI A;  4TM4 A;  1Y56 B;  1B8S A;  1N4V A;  3AD9 B;  2MNR A;  2R9Z A;  4ZCC A;  4OPI A;  2GGG A;  4PAA A;  2P3Z A;  3UKF A;  2W0H A;  3NK1 X;  5IPY A;  3UKL A;  2QA1 A;  2XSX A;  4USQ A;  3SZW A;  4UP3 A;  2WU5 A;  3AE1 A;  3CGE A;  2HNE A;  1NHP A;  4GGB A;  4EIP A;  3P4R A;  2NQL A;  1R0M A;  1N62 C;  3IJL A;  3NNE A;  1GEU A;  3GC2 A;  1OJA A;  1ONE A;  4FI4 A;  1TZZ A;  2V5Z A;  3GYI A;  1OJC A;  4K1W A;  2OFJ A;  1YEY A;  1L9D A;  4NWZ A;  3ZLH A;  2OZ3 A;  2GH5 A;  3GMC A;  3DG6 A;  5EU9 A;  3NTD A;  4N9X A;  5KMR A;  1DOD A;  4G7F A;  1KKO A;  3FG2 P;  4BV6 A;  2WPE A;  1YY5 A;  1F8W A;  1RSG A;  4FK1 C;  4JN7 A;  1FOH A;  2E4G A;  2Z5Y A;  3G5S A;  4OPD A;  5FS6 A;  1BWC A;  3COX A;  1XPY A;  3ATR A;  3VA8 A;  3DG7 A;  4UDR A;  4B64 A;  3ZLG A;  3O0H A;  1K0L A;  3EF6 A;  4E5T A;  4NTE A;  2B9W A;  3FXG A;  4Z1Y A;  4I59 A;  1TKK A;  2Q6U A;  2XH2 A;  5FMH A;  5BUK A;  4GGH A;  1LJ1 A;  3FBS A;  3SX6 A;  2GQW A;  4ZCW A;  3K7M X;  2JK6 A;  3VR8 A;  1COY A;  1PDY A;  3OW1 A;  2XVE A;  1SJA A;  3OPS A;  4H2P A;  3T2Z A;  1RM6 B;  1PJ6 A;  2XDO A;  1NDA A;  4A79 A;  3PWI A;  4XXG A;  4K2X A;  1VQW A;  2PHH A;  4H83 A;  1YQZ A;  3UJF A;  4IA6 A;  4J34 A;  3CPJ G;  1ZY8 A;  4H4Z A;  1EBH A;  3VCC A;  3LXD A;  1H81 A;  4BJZ A;  1DTN A;  4EWJ A;  1TDE A;  3EKG A;  1KDG A;  3UP4 A;  2DW7 A;  2RGJ A;  4H2N A;  4E0V A;  3H8I A;  2E1M A;  1KNR A;  1PXB A;  4LII A;  4A99 A;  2HZG A;  2PSN A;  3P93 A;  4Y4N A;  1N5X A;  2V60 A;  1CBO A;  4JY3 A;  1MRA A;  1RVK A;  4TLX A;  2WHD A;  2PTW A;  2C64 A;  1EBG A;  5IQ4 A;  2YVJ A;  4H4X A;  5M10 A;  4U8N A;  4CNK A;  3KD9 A;  3H12 A;  4CCQ A;  3P1W A;  4HN8 A;  4JNA A;  3Q45 A;  3NXL A;  1W6T A;  1ZOY A;  4H2R A;  2BCG G;  1GTH A;  3ITJ A;  5HXI A;  2JB2 A;  2YLT A;  1PJ5 A;  3UKA A;  4X9N A;  3VCN A;  3S61 A;  3EPT A;  4H4Y A;  3R07 C;  2TMD A;  2EQ9 A;  3AXB A;  2BXS A;  2YVF A;  2B9X A;  3CGD A;  3AE2 A;  1FCD A;  3SXI A;  3QJ4 A;  2BXR A;  3TJI A;  1KSS A;  2PCE A;  1F8R A;  4U8K A;  3C4N A;  1E39 A;  1YQ4 A;  4HB9 A;  3DFH A;  4DSH A;  3R9U A;  1Y0P A;  3DJD A;  3K30 A;  1FO4 A;  1TDF A;  5M0Z A;  5J7X A;  1PDH A;  4GIR A;  1NHS A;  3TJ4 A;  5JCM A;  4B63 A;  1YQ3 A;  1FFV C;  3B9J B;  3ATQ A;  3UKP A;  3I4K A;  3UKK A;  5EB4 A;  3CK5 A;  4YSZ A;  5FJO A;  3AE4 A;  2C66 A;  2ACZ A;  1L8P A;  1DOB A;  3H8L A;  2EQ6 A;  1H2I A;  4AP1 A;  3KKJ A;  1GRB A;  3A7R A;  2YG3 A;  2R4E A;  3NZG A;  4EQX A;  3U9I A;  2GMH A;  2NVK X;  4BK3 A;  3GWF A;  3NHO X;  2RAB A;  4H4R A;  2OLA A;  1GRF A;  2CUL A;  1K0J A;  4P9S A;  3T9P A;  2NPX A;  1Q1W A;  2OG9 A;  3QFB A;  4X4J A;  3GRT A;  4NNJ A;  1OJD A;  2X8C A;  1BZL A;  2XYO A;  2R0P A;  2P8B A;  2Z5X A;  3HYV A;  1NPX A;  2GVC A;  5TR3 A;  4OPG A;  3QKE A;  1L9C A;  3SY4 A;  4D04 A;  3UJS A;  4IVM B;  5CKU A;  4TM3 A;  3BHK A;  4GRT A;  4B68 A;  3UCC A;  2QJJ A;  3GDP A;  2PTZ A;  4X2P A;  1D4E A;  3NG7 X;  4J2W A;  2AR8 A;  3IC9 A;  3ICR A;  4Z44 A;  4A5L A;  1H7W A;  5EB5 A;  5BUL A;  2JB3 A;  3CND A;  2GSH A;  3N6H A;  1N5W C;  4C3Y A;  3L8K A;  5ER0 A;  1LQU A;  3F8R A;  4HNL A;  2X50 A;  3HPF A;  2ZBW A;  3N4E A;  1JRZ A;  3BI4 A;  2GAH B;  1E1N A;  2YG6 A;  2XLR A;  4ZA0 A;  4Z17 A;  2XFP A;  1STZ A;  3V3N A;  3QVP A;  2YG7 A;  2C70 A;  2PYX A;  2YG5 A;  3RIT A;  3VQR A;  4U8L A;  3UXK A;  3FYY A;  2BCP A;  1KNP A;  2C75 A;  4RSL A;  4U8P A;  3RNM A;  3D47 A;  3T6C A;  2C4C A;  1E1K A;  2PS2 A;  1IUW A;  1L0V A;  3DJJ A;  1CJ3 A;  2GGE A;  4HNC A;  3P9U A;  3VFC A;  3HW2 A;  3CPI G;  3DER A;  2ZZB A;  3AE5 A;  1WUF A;  3T0K A;  1GV4 A;  3VDG A;  1MXT A;  4CY8 A;  3I3L A;  2C67 A;  1CC4 A;  2P8C A;  3NVV B;  3KA7 A;  2BS4 A;  3G5Q A;  3H4K A;  4Z2R A;  3KVE A;  1BGJ A;  2WET A;  3SYI A;  3KLJ A;  1SB3 B;  3FV9 A;  4IV9 A;  2QA2 A;  3OZ2 A;  2P88 A;  3DK4 A;  4MGG A;  2XVH A;  4NEW A;  3ABV A;  2IVE A;  4KPR A;  1Q9I A;  1H7X A;  2E3T A;  1TDO A;  4CNJ A;  3EEZ A;  1GND A;  3QSS A;  1EC9 A;  4JQ9 A;  2BS2 A;  4YXD A;  3RRA A;  4BK2 A;  3AYI A;  1DXL A;  3NS1 B;  4DSG A;  3AYJ A;  1S3B A;  4IL0 A;  1NHR A;  4Z2U A;  3DDM A;  2POD A;  3UJE A;  4DXK A;  2XLU A;  4Z2T A;  4REK A;  3K7Q X;  2Q0K A;  2XFU A;  3TCS A;  1FHU A;  1P48 A;  1X2G A;  1S2Q A;  4WCT A;  1LV0 A;  3DJE A;  1TYT A;  1TYP A;  3T2K A;  3NYE A;  3EAO A;  2H89 A;  2QCU A;  3UTG A;  3ALL A;  1D5T A;  2W3R A;  1HYU A;  3AB1 A;  2VVM A;  1MO9 A;  2WQY A;  5DBJ A;  2X8G A;  2YR6 A;  2V61 A;  4O5Q A;  2GV8 A;  1RYI A;  3WE0 A;  3BSM A;  3AEE A;  3BI5 A;  3QVR A;  2VVL A;  2JBV A;  1PXA A;  5IQ1 A;  4NZH A;  3LB8 A;  3T31 A;  1GRG A;  3NLC A;  2FJE A;  3AN1 A;  1E1L A;  2W54 A;  2X99 A;  5ENL A;  2R46 A;  6ENL A;  5KMS A;  5FS9 A;  2BK4 A;  1ZK7 A;  1B37 A;  3AEG A;  3IHG A;  1GT8 A;  1QJD A;  5U63 A;  3TQP A;  4LA1 A;  3JSK A;  2GR3 A;  2C7G A;  4BUR A;  3ES7 A;  3ICT A;  2XH0 A;  3DGH A;  3D46 A;  3ZVH B;  3RHA A;  1TRB A;  2Y6Q A;  1QO8 A;  1VQZ A;  1PS9 A;  1GRE A;  3TOY A;  4GFI A;  3M13 A;  1XHC A;  1GAL A;  3GWD A;  3RGT A;  5LV9 A;  2B9Y A;  3SQS A;  1CL0 A;  2OVL A;  1JOA A;  2WBA A;  3IF9 A;  5FJT A;  1ZP0 A;  1CJ2 A;  3I6D A;  4EIQ A;  4YTP A;  3PK7 A;  3QSE A;  3T2Y A;  1N63 C;  1VRQ B;  2YAU A;  4G8T A;  1BF3 A;  2PGE A;  4JDR A;  2QAE A;  2XLP A;  4OPU A;  3UKH A;  3CB3 A;  4K7Z A;  5JRB A;  4A6N B;  1PN0 A;  1JNZ A;  1DNC A;  2PU1 A;  1ZOV A;  3RCY A;  3S5W A;  4YWS A;  4J1O A;  4AOS A;  1F6M A;  3SSZ A;  5KMQ A;  4H4V A;  1H6V A;  4G73 A;  1ZX9 A;  3BNM A;  1KCZ A;  3AE6 A;  2V6O A;  2WU2 A;  3V5C A;  2AL2 A;  3ZVI A;  4FX9 A;  3CIR A;  3VR9 A;  1FFU C;  3EUB 3;  4GDE A;  2ONE A;  2Y6R A;  4K5S A;  2YLZ A;  3AED A;  3N6J A;  3SZ0 A;  2XVI A;  1PBC A;  2PP1 A;  5JCK A;  2BAC A;  2V3A A;  3DH9 A;  2FJB A;  3BOX A;  2YLW A;  3CGC A;  2B7S A;  4RG3 A;  2AKM A;  5FS8 A;  3UOY A;  1FHV A;  2C73 A;  2QVH A;  5BRT A;  4KT2 A;  2ARD A;  3B3R A;  1JPM A;  3BHF A;  4YTM A;  3DG3 A;  3LOV A;  1FEA A;  2OAL A;  3UTH A;  4YKF A;  5J04 A;  4IA5 A;  1LTX R;  1OJ9 A;  3UJ2 A;  4NTD A;  3P0W A;  2BK5 A;  4H4T A;  3SN4 A;  3UJR A;  2BAB A;  4UDP A;  2WP9 A;  4EQR A;  3DIP A;  2BC0 A;  1P43 A;  4O5U A;  2WDQ A;  2OAM A;  4H4U A;  3CTY A;  3OC4 A;  2VQ7 A;  3OP2 A;  3UXL A;  2AQJ A;  3NRN A;  3KPK A;  3UCL A;  4G74 A;  1O5W A;  1R6W A;  2YLR A;  4MMW A;  3T14 A;  1T3Q C;  3GMB A;  1CJC A;  3K1G A;  2PU0 A;  1E7P A;  2OPJ A;  3RP7 A;  3H8A A;  3RR1 A;  4HCD A;  5IDZ A;  4II3 A;  3GDN A;  5JCI A;  2QDE A;  3NK2 X;  5KWF A;  1ZDL A;  3II4 A;  1NHQ A;  4HPN A;  4IHC A;  1FEC A;  4ADW A;  2OKT A;  2IID A;  3UGV A;  2J3N A;  3VC5 A;  2GF3 A;  1ZMD A;  2R0C A;  2W55 A;  3ES8 A;  1BQG A;  4J36 A;  5EOW A;  4A3R A;  1LVL A;  4AOX A;  3SGL A;  4NTC A;  1GRA A;  2OQH A;  3OZM A;  1P2E A;  1ELI A;  1LPF A;  2Q0L A;  2FJA A;  3CPH G;  4YSX A;  3CMM A;  2PTX A;  4HCL A;  1KFY A;  4BK1 A;  4HYR A;  3L5O A;  4MJW A;  1GTE A;  5HY5 A;  1JU2 A;  4WX1 A;  4F4R A;  1XS2 A;  2WOW A;  1GXF A;  2I5Q A;  3THU A;  3QFA A;  2I0Z A;  1TE6 A;  3FJ4 A;  4YKG A;  2C76 A;  1JPD X;  2GGJ A;  3NVZ B;  3AEB A;  3IWA A;  1S3E A;  4OPL A;  4OPC A;  4ENL A;  1NEN A;  4B67 A;  3M12 A;  2CFY A;  4DGK A;  1CF3 A;  4JHM A;  2YR5 A;  1MDL A;  1E9I A;  2PMQ A;  4RG4 A;  3PS9 A;  2OZ8 A;  1X2H A;  2X8H A;  3AEA A;  3IJQ A;  4H19 A;  4G6H A;  1GPE A;  3CNS A;  2OLO A;  3DME A;  4YSH A;  1IUT A;  3SJN A;  3BI2 A;  3LZW A;  1LQT A;  3GO2 A;  1F3P A;  1GRH A;  4A9W A;  3GRS A;  3UOV A;  3CT2 A;  1FEB A;  2WP6 A;  4KEM A;  3UTE A;  4JNQ A;  5KOW A;  3MY9 A;  3FMW A;  4FP1 A;  2A87 A;  2GGI A;  1D7L A;  1N61 C;  3VC6 A;  4GAP A;  3A7U A;  2P0I A;  2XVJ A;  4DHG A;  2PA6 A;  4K5R A;  2O56 A;  2OX4 A;  1NAA A;  1V97 A;  2AKZ A;  3UKQ A;  2OQY A;  4X9M A;  2JB1 A;  7ENL A;  2VRL A;  1ZKQ A;  1N4U A;  2GR0 A;  4IP5 A;  2O9Z A;  2YVG A;  4U8O A;  3AM9 A;  4MKS A;  2BRY A;  3B97 A;  3DFY A;  2W3S A;  2XCG A;  4ROP A;  1PDZ A;  2QJM A;  3GY1 A;  4B66 A;  1IUU A;  4EMI A;  3QLD A;  2XFO A;  3SFD A;  3DA1 A;  1JRP A;  3DES A;  4CRT A;  4H1Z A;  1XPQ A;  2WPF A;  3SBF A;  3ENL A;  3CGB A;  3AE9 A;  2GMJ A;  4AP3 A;  1CC2 A;  1FIQ B;  3NN6 X;  2CVJ A;  1VG9 A;  5FJP A;  4ECH A;  2ZZC A;  4Y4L A;  1VDV A;  3V5F A;  4J3Z A;  1Z6L A;  3T37 A;  2VRM A;  2WPC A;  3PO7 A;  2GAG B;  4E4U A;  2A89 A;  3JVA A;  2C3D A;  4GF7 A;  5FJR A;  2GEW A;  2POZ A;  4II2 A;  1PHH A;  1KN0 A;  3P4S A;  3V4B A;  3CN8 A;  2OLN A;  2B7R A;  3UOX A;  2GDQ A;  5G5G B;  3FCP A;  1GET A;  2H88 A;  4JY2 A;  3DJG X;  1PBF A;  2XH7 A;  3RP6 A;  2FBW A;  2V3B A;  3DK8 A;  2QDD A;  3UCD A;  1JEH A;  4H2Q A;  1BKH A;  3MKC A;  4M52 A;  5GRT A;  1QLB A;  2AL2 B;  3D1C A;  3V76 A;  4D03 A;  2YM1 A;  4I58 A;  1ECQ A;  3H70 A;  3PFR A;  4J33 A;  1WUE A;  4BJY A;  2FYM A;  3K7T A;  2YLS A;  4EMJ A;  4J31 A;  2GR2 A;  1EL7 A;  4ZOH B;  5KRQ A;  2ZZ0 A;  3SR6 B;  4A7A A;  1VDC A;  2OA1 A;  2YWL A;  1B5Q A;  1N1P A;  5C3J A;  4GUV A;  1ONF A;  3RP8 A;  1OEP A;  3B6D A;  1ZMC A;  4A65 A;  2CDU A;  1S2Y A;  1PBB A;  5U1O A;  4EM4 A;  3R25 A;  4HA6 A;  4JN9 A;  3P3B A;  4M6U A;  1X31 B;  2XLT A;  3KU9 A;  1CC6 A;  3FPZ A;  2IVD A;  2F5Z A;  3VRA A;  2A8X A;  4DNA A;  3P4Q A;  3ICS A;  3SQP A;  2VVL G;  4IP4 A;  3S5S A;  3UTF A;  2ZAD A;  3PVC A;  1SJD A;  2XLS A;  4Z43 A;  3P4P A;  4C3X A;  5BOF A;  5CQF A;  4H4Q A;  4FK1 A;  3CXO A;  5JCN A;  3NT6 A;  2ZC8 A;  2YG4 A;  1GOS A;  3BJS A;  3R1Z A;  3JZU A;  1KKR A;  3Q4D A;  3HYX A;  4FDC B;  2YR4 A;  3GD4 A;  1AOG A;  1Y56 A;  4EM3 A;  2PPG A;  2FKP A;  2B76 A;  1NEL A;  4DYE A;  2OZT A;  4EMW A;  2WP5 A;  3AYL A;  3TTE A;  1SEZ A;  3C96 A;  1D7Y A;  3CNP A;  2PP0 A;  2Q7V A;  3DEQ A;  3ZLF A;  2XVF A;  4YWO A;  2HXU A;  2WOI A;  3HRD C;  2QJN A;  3QN3 A;  3CAW A;  1WYG A;  4OVI A;  1NEK A;  3NKS A;  3IJI A;  4TVY A;  3ZVH A;  1TDN A;  3T4W A;  4AT0 A;  4TVW A;  3NYF A;  2MUC A;  2VOU A;  4APN A;  3SM8 A;  5C2T A;  4U2T A;  3AEC A;  3UP5 A;  4U2L A;  1B4V A;  3NN0 X;  4DN1 A;  3NFU A;  4IZG A;  4K22 A;  3R10 A;  3MQT A;  5KOX A;  2R45 A;  3HZL A;  1NG3 A;  4Z24 A;  2GRT A;  1XAN A;  2TPR A;  1SJC A;  4K8G A;  1EL9 A;  1N4W A;  1CJ4 A;  2HQM A;  3MWC A;  4USR A;  1IUS A;  4A35 A;  4IT1 A;  5FS7 A;  2OO6 A;  4GME A;  3V3O A;  3QPE A;  1JCT A;  3QSM A;  4GAV A;  2PTY A;  5BOE A;  4A6N A;  2QGY A;  3L1R A;  3R11 A;  1KSU A;  4DWD A;  4H2H A;  3F8P A;  1M64 A;  2GB0 A;  4H4S A;  3ALJ A;  3R0U A;  4OCG A;  2C3C A;  3D8X A;  4M0X A;  1KF6 A;  1MUC A;  1V59 A;  3MZN A;  1F8S A;  5FJU A;  3JW7 A;  3S47 A;  2R4J A;  4C77 A;  4C74 A;  4OPT A;  2XFQ A;  1NG4 A;  1DJQ A;  3C4A A;  3CYJ A;  3MSY A;  1FL2 A;  2YM2 A;  2YLX A;  1TDK A;  5KNL A;  3I6E A;  4C5O A;  4E8G A;  3ZDN A;  2APG A;  2DW6 A;  3FIM B;  4H4P A;  2BA9 A;  4E6M A;  5JCL A;  3QTP A;  1RP0 A;  2PP3 A;  2RGH A;  3KUM A;  3MUC A;  1F9C A;  3AWI A;  1JRX A;  1JDF A;  1H82 A;  4GR1 A;  2FJD A;  4GCM A;  5KXJ A;  3IK4 A;  3PWG A;  1XDI A;  4U8I A;  1L9E A;  2E5V A;  1SJB A;  4J56 A;  1E1M A;  2VQB A;  3D9X A;  3T8Q A;  1GSN A;  4UDQ A;  4XWZ A;  4K8D A;  4NEV A;  2AL1 A;  1K0I A;  3GYJ A;  2GGH A;  3LJP A;  3ISH A;  2X3N A;  1O95 A;  3KPF A;  4A6G A;  1VG0 A;  4KX6 A;  4E4F A;  3GD3 A;  1IUV A;  4ZN0 A;  3TWB A;  2RGO A;  3NVW B;  2AAQ A;  2VZ2 A;  3URH A;  4GYP A;  2BK3 A;  1GRT A;  3NVY B;  3NIX A;  4Z25 A;  5U25 A;  4B1B A;  4GYP C;  1YKJ A;  4YTN A;  1EBD A;  2PGW A;  4HCH A;  3H7V A;  1NU5 A;  3NRZ B;  4B65 A;  5BVA A;  2BYB A;  3BNU A;  2QQ6 A;  1W4X A;  3AMZ A;  1E6E A;  4U2S A;  5KMP A;  3PG6 A;  4H7U A;  2YQU A;  3ALM A;  5GSN A;  1N60 C;  3SFE A;  3AE3 A;  3A7A A;  2XFN A;  2BS3 A;  1GES A;  1DJN A;  2GR1 A;  1DOE A;  1PBD A;  1ZXI C;  4GDP A;  3NTA A;  3TWA A;  1ELS A;  3SN1 A;  2GL5 A;  2EQ8 A;  1MNS A;  1IJH A;  2WOV A;  3DGB A;  1DOC A;  1PXC A;  2XH4 A;  1O94 A;  5HYM A;  3I6T A;  1BGN A;  3EAN A;  3VRB A;  5KVH A;  1K4Q A;  4PAB A;  1JRY A;  4CCR A;  1JRO A;  3GSI A;  3NGC X;  1EC7 A;  3DGZ A;  3ZYX A;  3CNT A;  3NO1 A;  4ICY A;  4ZCD A;  3U4F A;  3NH3 X;  4JN8 A;  2WDR A;  3CNJ A;  1CHU A;  2BC1 A;  2EQ7 A;  4XWR A;  3AE7 A;  4H4W A;  3M0O A;  4J57 A;  3SZF A;  5L46 A;  4TLZ A;  1KD0 A;  4TM0 A;  3AD8 B;  3OZY A;  3V3W A;  4KWS A;  1OJT A;  1BKW A;  3HYW A;  2UZZ A;  5G5H B;  3ADA B;  2C65 A;  1IUX A;  2DKI A; 
#chains in the Genus database with same CATH homology
 3K7T A;  4EQX A;  2YLS A;  4EMJ A;  2GMH A;  2GR2 A;  2NVK X;  1EL7 A;  1JNR A;  3GWF A;  4J31 A;  4U8M A;  4BK3 A;  3NHO X;  5BRT A;  2RAB A;  5KRQ A;  3Q6J A;  2ZZ0 A;  4H4R A;  2R0G A;  2ARD A;  3B3R A;  1GRF A;  2CUL A;  1K0J A;  4A7A A;  1VDC A;  4P9S A;  2NPX A;  1Q1W A;  2OA1 A;  3QFB A;  2YWL A;  2DKH A;  1B5Q A;  3BHF A;  4X4J A;  1N1P A;  5EBK A;  1EL8 A;  3GRT A;  2C72 A;  3LOV A;  4G9K A;  4GUV A;  4YTM A;  5C3J A;  1FEA A;  1ONF A;  2WES A;  1PJ7 A;  3RP8 A;  2OAL A;  4NNJ A;  3B6D A;  4LU6 A;  1ZMC A;  1OJD A;  3UTH A;  2WS3 A;  2X8C A;  1BZL A;  2WEU A;  2XYO A;  2R0P A;  3VRD B;  4A65 A;  3AD7 B;  2CDU A;  4YKF A;  1H84 A;  2Z5X A;  1S2Y A;  3HYV A;  4IA5 A;  1LTX R;  1NPX A;  1OJ9 A;  2GVC A;  5TR3 A;  1PBB A;  5U1O A;  3AEF A;  4EM4 A;  4OPG A;  4HA6 A;  4JN9 A;  4NTD A;  1MOK A;  4H4T A;  2BK5 A;  1X31 B;  1L9C A;  2XLT A;  2BAB A;  3KU9 A;  3NK0 X;  3AE8 A;  4UDP A;  2WP9 A;  1CC6 A;  2BRA A;  3FPZ A;  4EQR A;  2IVD A;  2F5Z A;  2BC0 A;  3SY4 A;  4O5U A;  3VRA A;  2A8X A;  4D04 A;  4IVM B;  5CKU A;  2WDQ A;  1D4C A;  4U8J A;  4CY6 A;  3RED A;  2OAM A;  4H4U A;  4TM3 A;  3CTY A;  3OC4 A;  3BHK A;  2WDV A;  4DNA A;  3P4Q A;  3ICS A;  4GRT A;  4B68 A;  3SQP A;  2VQ7 A;  4TM1 A;  3GDP A;  5J60 A;  2VVL G;  2AQJ A;  3UTF A;  3UOZ A;  1D4E A;  3NG7 X;  3NRN A;  3Q9T A;  3PVC A;  3KPK A;  4J2W A;  3UCL A;  4G74 A;  2AR8 A;  2XLS A;  1O5W A;  4EQW A;  3IC9 A;  3P4P A;  4C3X A;  3ICR A;  4Z43 A;  2YLR A;  5CQF A;  4H4Q A;  4Y4M A;  4FK1 A;  3T14 A;  3LZX A;  5JCN A;  3NT6 A;  2JAE A;  2YG4 A;  1GOS A;  1P2H A;  4X9M A;  3GMB A;  4Z44 A;  4A5L A;  4EQS A;  1H7W A;  5EB5 A;  3E1T A;  5BUL A;  1H83 A;  1CJC A;  2JB3 A;  2GQF A;  3CND A;  4CBQ A;  5HHF A;  1E7P A;  3NYC A;  1GER A;  4C3Y A;  3L8K A;  3RP7 A;  5ER0 A;  3HYX A;  1LQU A;  3F8R A;  4FDC B;  2YR4 A;  3GD4 A;  4YSY A;  1AOG A;  2X50 A;  3GYX A;  2ZBW A;  3DK9 A;  1Y56 A;  4II3 A;  3GDN A;  5JCI A;  1JRZ A;  3BI4 A;  2GAH B;  1E1N A;  4YT0 A;  4EM3 A;  3NK2 X;  2YG6 A;  2XLR A;  5KWF A;  1ZDL A;  3II4 A;  2B76 A;  1PBE A;  2XFP A;  1NHQ A;  4EMW A;  2JKC A;  3V3N A;  3LAD A;  2WP5 A;  1D4D A;  3QVP A;  2YG7 A;  2C70 A;  3AYL A;  1SEZ A;  1UKV G;  2PYX A;  2YG5 A;  3C96 A;  1D7Y A;  3VQR A;  3CNP A;  4U8L A;  1FEC A;  3SZC A;  4ADW A;  4AT2 A;  1S7M A;  1M6I A;  2Q7V A;  4G6G A;  2BCP A;  1REO A;  4H50 A;  4B69 A;  1KNP A;  3G5R A;  3IHM A;  2XVF A;  4Z26 A;  2IID A;  2C75 A;  2J3N A;  4YWO A;  3F8D A;  1EL5 A;  4RSL A;  4U8P A;  2WOI A;  1H86 A;  4IVO B;  2GF3 A;  1Q1R A;  1ZMD A;  5KVI A;  3RNM A;  2R0C A;  4TM4 A;  2C4C A;  1Y56 B;  1E1K A;  1B8S A;  4J36 A;  5EOW A;  1N4V A;  1LVL A;  1IUW A;  4AOX A;  3AD9 B;  1L0V A;  3SGL A;  3DJJ A;  1CJ3 A;  3P9U A;  2R9Z A;  4OVI A;  1NEK A;  3CPI G;  3NKS A;  4ZCC A;  4OPI A;  4NTC A;  1GRA A;  2ZZB A;  3AE5 A;  1P2E A;  1ELI A;  4PAA A;  3UKF A;  1LPF A;  1TDN A;  2FJA A;  2Q0L A;  3T0K A;  1GV4 A;  2W0H A;  1MXT A;  3CPH G;  3NK1 X;  4AT0 A;  4CY8 A;  5IPY A;  4YSX A;  3UKL A;  3NYF A;  3CMM A;  1KFY A;  2VOU A;  4APN A;  3SM8 A;  2QA1 A;  4BK1 A;  3I3L A;  5C2T A;  4U2T A;  4USQ A;  3AEC A;  2C67 A;  3UP5 A;  4U2L A;  1B4V A;  3SZW A;  3NN0 X;  4UP3 A;  1CC4 A;  2WU5 A;  3AE1 A;  3CGE A;  3KA7 A;  2BS4 A;  3G5Q A;  4K22 A;  3H4K A;  4Z2R A;  3L5O A;  1NHP A;  4MJW A;  1GTE A;  5KOX A;  2R45 A;  3HZL A;  1NG3 A;  5HY5 A;  1JU2 A;  4WX1 A;  4Z24 A;  3KVE A;  2GRT A;  4EIP A;  1BGJ A;  3P4R A;  2WET A;  3SYI A;  1XAN A;  2TPR A;  2WOW A;  1N4W A;  1EL9 A;  1GXF A;  1CJ4 A;  3KLJ A;  3NNE A;  1GEU A;  2HQM A;  1OJA A;  4IV9 A;  2QA2 A;  3QFA A;  2I0Z A;  4USR A;  1IUS A;  2V5Z A;  3GYI A;  3OZ2 A;  3DK4 A;  4YKG A;  2XVH A;  1OJC A;  4NEW A;  5FS7 A;  3ABV A;  3V3O A;  2IVE A;  4KPR A;  1L9D A;  1Q9I A;  2C76 A;  3QSM A;  1H7X A;  4NWZ A;  4GAV A;  1TDO A;  4A6N A;  4CNJ A;  1GND A;  3L1R A;  2GH5 A;  3GMC A;  3QSS A;  4JQ9 A;  1KSU A;  2BS2 A;  3AEB A;  3IWA A;  4YXD A;  1S3E A;  3F8P A;  4OPL A;  1M64 A;  4OPC A;  4BK2 A;  3AYI A;  1DXL A;  4DSG A;  2GB0 A;  3AYJ A;  1S3B A;  3NTD A;  1NEN A;  4H4S A;  4N9X A;  4B67 A;  3M12 A;  1DOD A;  5KMR A;  1NHR A;  2CFY A;  3ALJ A;  4OCG A;  2C3C A;  4Z2U A;  3D8X A;  3FG2 P;  4BV6 A;  2XLU A;  1KF6 A;  4Z2T A;  4DGK A;  4REK A;  1CF3 A;  1V59 A;  2WPE A;  1YY5 A;  1F8W A;  1F8S A;  3K7Q X;  2Q0K A;  2XFU A;  2YR5 A;  1RSG A;  4FK1 C;  1FOH A;  1S2Q A;  4WCT A;  1LV0 A;  3DJE A;  1TYT A;  2E4G A;  4RG4 A;  2Z5Y A;  3G5S A;  4OPD A;  1TYP A;  3PS9 A;  5FS6 A;  2R4J A;  4C77 A;  1BWC A;  3COX A;  3T2K A;  2X8H A;  3AEA A;  3NYE A;  4C74 A;  3ATR A;  4OPT A;  2XFQ A;  3EAO A;  1NG4 A;  1DJQ A;  4UDR A;  4B64 A;  2H89 A;  3C4A A;  2QCU A;  3O0H A;  1FL2 A;  1K0L A;  2YM2 A;  4G6H A;  3UTG A;  3ALL A;  1D5T A;  2YLX A;  1GPE A;  3EF6 A;  1HYU A;  3AB1 A;  1TDK A;  2VVM A;  5KNL A;  3CNS A;  1MO9 A;  2OLO A;  3DME A;  4NTE A;  2WQY A;  4YSH A;  2B9W A;  5DBJ A;  1IUT A;  2X8G A;  3BI2 A;  4I59 A;  2Q6U A;  4C5O A;  3LZW A;  5FMH A;  2YR6 A;  2V61 A;  5BUK A;  4O5Q A;  1LJ1 A;  2GV8 A;  1RYI A;  1LQT A;  2APG A;  3ZDN A;  3FIM B;  1F3P A;  1GRH A;  3FBS A;  3WE0 A;  3SX6 A;  2GQW A;  4H4P A;  3K7M X;  4A9W A;  2BA9 A;  2JK6 A;  3VR8 A;  1COY A;  3AEE A;  5JCL A;  3GRS A;  3BI5 A;  3UOV A;  2XVE A;  3QVR A;  1FEB A;  2VVL A;  1RP0 A;  2WP6 A;  4H2P A;  3T2Z A;  3UTE A;  2JBV A;  4JNQ A;  2RGH A;  5KOW A;  1PJ6 A;  1PXA A;  2XDO A;  1NDA A;  3FMW A;  4A79 A;  2A87 A;  4NZH A;  5IQ1 A;  3AWI A;  4XXG A;  4K2X A;  1D7L A;  3LB8 A;  1VQW A;  2PHH A;  1JRX A;  4GAP A;  3T31 A;  1H82 A;  4GR1 A;  1YQZ A;  2XVJ A;  2FJD A;  4GCM A;  4IA6 A;  5KXJ A;  4K5R A;  1XDI A;  4U8I A;  1GRG A;  1L9E A;  1NAA A;  4J34 A;  2E5V A;  4J56 A;  3NLC A;  3CPJ G;  1E1M A;  2FJE A;  1ZY8 A;  2VQB A;  3D9X A;  1E1L A;  1GSN A;  4H4Z A;  2X99 A;  4UDQ A;  3UKQ A;  4XWZ A;  4K8D A;  4NEV A;  2R46 A;  1K0I A;  3GYJ A;  3LXD A;  5KMS A;  1H81 A;  3ISH A;  5FS9 A;  2BK4 A;  2JB1 A;  1O95 A;  2X3N A;  3KPF A;  3LJP A;  1VG0 A;  4BJZ A;  1ZK7 A;  4KX6 A;  1B37 A;  2VRL A;  3GD3 A;  1IUV A;  3AEG A;  3IHG A;  1GT8 A;  1QJD A;  1TDE A;  5U63 A;  4ZN0 A;  1ZKQ A;  2RGO A;  4LA1 A;  3JSK A;  2AAQ A;  1KDG A;  2VZ2 A;  3URH A;  3UP4 A;  2BK3 A;  1N4U A;  2RGJ A;  1GRT A;  2GR3 A;  2C7G A;  4H2N A;  2GR0 A;  4E0V A;  4BUR A;  2O9Z A;  3ICT A;  3NIX A;  2YVG A;  4Z25 A;  3H8I A;  3DGH A;  5U25 A;  2E1M A;  1KNR A;  4B1B A;  1PXB A;  4LII A;  3RHA A;  1YKJ A;  4A99 A;  1EBD A;  4YTN A;  1TRB A;  2Y6Q A;  4U8O A;  1QO8 A;  4Y4N A;  4B65 A;  1PS9 A;  2BRY A;  1GRE A;  5BVA A;  2BYB A;  3BNU A;  2V60 A;  1CBO A;  4JY3 A;  3M13 A;  2XCG A;  1XHC A;  1W4X A;  1GAL A;  4TLX A;  2WHD A;  2C64 A;  1E6E A;  4U2S A;  3GWD A;  5IQ4 A;  5KMP A;  2YVJ A;  4H4X A;  5LV9 A;  5M10 A;  2B9Y A;  4U8N A;  4B66 A;  3PG6 A;  1IUU A;  3KD9 A;  4H7U A;  2YQU A;  4CNK A;  4EMI A;  3ALM A;  5GSN A;  4CCQ A;  3P1W A;  2XFO A;  4JNA A;  3SFE A;  1CL0 A;  3AE3 A;  2XFN A;  1JOA A;  2WBA A;  2BS3 A;  1GES A;  3IF9 A;  1ZP0 A;  1DJN A;  1ZOY A;  3SFD A;  1CJ2 A;  3DA1 A;  2GR1 A;  3I6D A;  4H2R A;  1DOE A;  1PBD A;  2BCG G;  1GTH A;  4EIQ A;  4YTP A;  3QSE A;  3T2Y A;  4CRT A;  3ITJ A;  5HXI A;  4GDP A;  2JB2 A;  2YLT A;  1PJ5 A;  3NTA A;  1XPQ A;  2WPF A;  1VRQ B;  2YAU A;  1BF3 A;  3UKA A;  4JDR A;  2QAE A;  4X9N A;  3CGB A;  3AE9 A;  2EQ8 A;  2GMJ A;  1IJH A;  2XLP A;  4OPU A;  4AP3 A;  1CC2 A;  3NN6 X;  2WOV A;  3UKH A;  2CVJ A;  3S61 A;  1VG9 A;  4K7Z A;  3EPT A;  4H4Y A;  1DOC A;  1PXC A;  2EQ9 A;  5JRB A;  2TMD A;  3AXB A;  4ECH A;  2BXS A;  4A6N B;  2YVF A;  2ZZC A;  1PN0 A;  4Y4L A;  1JNZ A;  2B9X A;  1DNC A;  1Z6L A;  3CGD A;  1O94 A;  1ZOV A;  5HYM A;  3S5W A;  1BGN A;  3T37 A;  2VRM A;  2WPC A;  3EAN A;  3AE2 A;  3PO7 A;  2GAG B;  3VRB A;  1FCD A;  3SXI A;  4AOS A;  2A89 A;  1F6M A;  5KVH A;  1K4Q A;  3QJ4 A;  2C3D A;  4GF7 A;  4PAB A;  1JRY A;  2BXR A;  5KMQ A;  4CCR A;  4H4V A;  1KSS A;  1H6V A;  2GEW A;  3GSI A;  3NGC X;  4II2 A;  1F8R A;  4G73 A;  3DGZ A;  1ZX9 A;  3ZYX A;  3BNM A;  3CNT A;  4U8K A;  4ZCD A;  3C4N A;  4ICY A;  3NH3 X;  1PHH A;  1KN0 A;  1E39 A;  2V6O A;  1YQ4 A;  3AE6 A;  2WU2 A;  3P4S A;  4HB9 A;  3CN8 A;  2OLN A;  2B7R A;  4FX9 A;  4DSH A;  3R9U A;  2WDR A;  3UOX A;  3CIR A;  3CNJ A;  3VR9 A;  1Y0P A;  3DJD A;  1GET A;  2H88 A;  3K30 A;  1CHU A;  1TDF A;  2BC1 A;  4JY2 A;  5J7X A;  5M0Z A;  3DJG X;  1PDH A;  1PBF A;  4GDE A;  3RP6 A;  2EQ7 A;  1NHS A;  4XWR A;  2Y6R A;  4H4W A;  5JCM A;  3AE7 A;  4J57 A;  2FBW A;  3M0O A;  4K5S A;  3SZF A;  4B63 A;  4TLZ A;  5L46 A;  1YQ3 A;  2V3B A;  4TM0 A;  2YLZ A;  3AED A;  3DK8 A;  3AD8 B;  3ATQ A;  3UKP A;  3SZ0 A;  1JEH A;  3UKK A;  2XVI A;  4H2Q A;  1PBC A;  5EB4 A;  4YSZ A;  5JCK A;  3AE4 A;  2C66 A;  1OJT A;  2ACZ A;  2BAC A;  4M52 A;  2V3A A;  3DH9 A;  1BKW A;  1DOB A;  3H8L A;  2FJB A;  2EQ6 A;  1H2I A;  4AP1 A;  3HYW A;  2YLW A;  1GRB A;  5GRT A;  1QLB A;  3KKJ A;  2UZZ A;  3D1C A;  3CGC A;  3V76 A;  4D03 A;  2YM1 A;  4I58 A;  2B7S A;  3ADA B;  4RG3 A;  2C65 A;  5FS8 A;  4J33 A;  3UOY A;  2C73 A;  2YG3 A;  4BJY A;  2R4E A;  1IUX A;  2DKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...