5KVIA

Crystal structure of monomeric human apoptosis-inducing factor with e413a/r422a/r430a mutations
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
491
structure length
479
Chain Sequence
PSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLAIDSDFGGFAVNAELQAASNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHEDLEVLFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defining NADH-Driven Allostery Regulating Apoptosis-Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Apoptosis-inducing factor 1, mitochondrial
total genus 148
structure length 479
sequence length 491
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5kviA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kviA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kviA01
1PHHA 1TDNA 2WU5A 3NNEA 1YY5A 1UKVG 2I0ZA 1NENA 2JK6A 1IUUA 2Q0LA 3AD9B 4CCQA 3AYLA 3NTDA 3AEGA 5HYMA 3D8XA 4H7UA 4JNQA 2BCGG 1PJ5A 4X4JA 1FCDA 1ZKQA 1VDCA 4JY3A 4O5QA 2A8XA 3FMWA 4BURA 4XWRA 3P4QA 3AE9A 1KSSA 1FOHA 1ZP0A 3UCLA 2AAQA 4FK1C 1E39A 3DK9A 4CCRA 3P4PA 1O95A 3NK2X 3T37A 3GYJA 3LJPA 1TDOA 2W0HA 5BUKA 3SQPA 2BK3A 3AE4A 1QJDA 3ALLA 4USRA 2V61A 3F8DA 1REOA 1Q1RA 3OC4A 1CC4A 3BNUA 4NTEA 4B65A 4D04A 5EB5A 3KLJA 1F8SA 4B64A 3BI2A 4YWOA 1DOEA 3LZWA 2WS3A 4YSZA 1ZOVA 1L9CA 1NHRA 4H50A 1GXFA 4Z2UA 2JB1A 5HXIA 1LJ1A 4BV6A 1M64A 3ADAB 3UOZA 1Y56A 4IVMB 1E1NA 3NLCA 4JNAA 1KDGA 3CNTA 3NYFA 2WDVA 2AR8A 4DNAA 2DKHA 3NIXA 2XFPA 3D1CA 4TLZA 1OJAA 3NK1X 3QSMA 4ZCDA 4PAAA 4U2SA 3DJEA 1DXLA 1H84A 3UKFA 4AOSA 4U8NA 2WESA 3B3RA 1BF3A 2GRTA 2JB3A 4U8IA 3NYCA 2DKIA 2BXSA 1EL7A 2BXRA 2FJBA 2GAHB 2YG7A 3UKPA 4YKGA 3AE2A 1N1PA 4J57A 2NPXA 1GREA 4U8JA 2B9YA 2AQJA 4K22A 3AD8B 3AE8A 4OPGA 4N9XA 3UOVA 4OPTA 3K7QX 5KVIA 1XHCA 1D5TA 1BGNA 3KA7A 4Z2TA 5IQ4A 1JRYA 4H4XA 5IPYA 3K7MX 1E7PA 2BS4A 2GB0A 4LIIA 2FJDA 1H82A 4EM3A 3UTGA 1F8WA 2IVEA 2B7RA 4ICYA 1KNRA 1GRBA 4ADWA 1KFYA 4Y4MA 4J2WA 4YXDA 4GF7A 2QA2A 3AEAA 3KU9A 4J56A 3VRDB 4BJZA 5ER0A 3AB1A 1D4CA 2YG4A 3H8IA 2V60A 4WCTA 3GDNA 2J3NA 3P4RA 1NHPA 5U25A 3EPTA 4RG4A 2GMJA 1GOSA 4NEWA 1CBOA 2R4EA 2YWLA 4E0VA 4H4UA 1XPQA 3GRSA 1K4QA 2R0PA 2YLXA 4Y4LA 1P2HA 2YLTA 1FL2A 3UKLA 1KNPA 3PS9A 1AOGA 1GRAA 2XLSA 2WETA 1NPXA 2IVDA 2ZBWA 1HYUA 3AD7B 1QLBA 1CHUA 2YR5A 4M52A 4O5UA 5L46A 1F6MA 3CTYA 3QVPA 3RP6A 2XLUA 3K7TA 3UOYA 1L9DA 3V3OA 4USQA 1PS9A 3FPZA 5M10A 2GQWA 2V3AA 4JN9A 5TR3A 1GTEA 4U8LA 2JAEA 5FS6A 5LV9A 1F8RA 4HA6A 1JU2A 1XDIA 4J34A 4B63A 4Z43A 3COXA 1CJCA 3CPHG 4K5SA 4Z26A 2WOIA 3GYIA 1ONFA 4OPIA 3UTHA 2A87A 2YLWA 3Q9TA 2FJAA 5EBKA 2WPCA 3DGHA 2Z5XA 2XVEA 1NAAA 3ICRA 4OPLA 1IUTA 2TMDA 3DGZA 2X3NA 2RGOA 3FBSA 4B66A 2QCUA 3UTFA 4EQRA 2XYOA 4C3YA 2GR1A 2C67A 4OPDA 2R4JA 2CVJA 3II4A 2GR3A 3CNSA 3CNJA 5JCIA 3IF9A 2YG5A 3EF6A 4IA6A 4X9MA 1N4WA 2VRMA 3NH3X 5FS7A 3UOXA 1XANA 3CPJG 2X50A 4H4QA 4TM0A 2C72A 1NEKA 2YAUA 1ZDLA 4Y4NA 1D7LA 1CL0A 3F8RA 5FS9A 3ITJA 4Z25A 2E5VA 3C4NA 2GH5A 3H4KA 2BABA 4H4ZA 1GERA 2O9ZA 3M13A 5FMHA 2WPFA 3ALJA 1PJ7A 4EMWA 2Q7VA 3GD4A 2V5ZA 2YG6A 3C4AA 2YR6A 2XFNA 4UDPA 1Q1WA 4U8PA 2WQYA 5BVAA 4YKFA 4BK2A 2BS3A 2OAMA 1GNDA 2VOUA 1H83A 2E4GA 1JNZA 2VQ7A 2YM2A 2WPEA 2YLRA 2NVKX 2WDQA 2Q0KA 2WBAA 3FG2P 1DODA 5U63A 2V6OA 2QA1A 1X31B 1NG4A 4H4PA 3OZ2A 1VRQB 2A89A 4X9NA 2YVGA 3P9UA 2C75A 3RP8A 4LA1A 3VQRA 3NTAA 1KSUA 4YTMA 2IIDA 2RGJA 4EQXA 4EMJA 2C66A 1ZMCA 1LTXR 3UTEA 3SFDA 4EIPA 4NEVA 1NHQA 2GVCA 1JRZA 1Y56B 1DNCA 2VVLA 4H2QA 3B6DA 4CNJA 2R46A 3BNMA 3G5QA 4A7AA 1H7WA 2XVJA 3VR8A 1S3BA 2B7SA 4XWZA 2JB2A 1Q9IA 4J36A 1PJ6A 3VRBA 3UKQA 2RABA 4H4TA 3UKHA 2VVLG 1D4EA 4B69A 3LZXA 4WX1A 5KOXA 3SFEA 4MJWA 4P9SA 3QSEA 4I59A 4YT0A 3DJGX 4FK1A 2YVJA 3O0HA 2BA9A 3PVCA 1PBCA 5IQ1A 3DK8A 4GDEA 2YM1A 3G5RA 2H88A 1JOAA 2WOWA 3AE3A 4ECHA 1VG9A 4EMIA 2ACZA 1PXBA 2BACA 3ATQA 3GDPA 1PBBA 3NRNA 5KRQA 4ZCCA 3H8LA 3KPFA 2WP6A 4J33A 5CKUA 2WP5A 3L1RA 4H4YA 4IA5A 1GRFA 4BK3A 3NG7X 3VR9A 4Z44A 4C77A 3FIMB 1CF3A 5JCLA 4OVIA 1OJTA 1PXCA 3AEBA 4B68A 4D03A 2C3DA 1PBDA 1S2QA 1E1MA 3AE6A 5CQFA 2TPRA 1YQZA 3DMEA 4TM1A 1Y0PA 3IWAA 4H4WA 1EL5A 2Q6UA 3KKJA 4LU6A 4I58A 3AEEA 2BK5A 1NG3A 2ARDA 2PYXA 3GMBA 1TRBA 1TYTA 1PBEA 3LXDA 4JQ9A 3CN8A 5J60A 2OALA 3G5SA 1B37A 1M6IA 1TDKA 3ABVA 3CNPA 4A5LA 1IUSA 3GRTA 1E6EA 3JSKA 2YLZA 4DGKA 2EQ9A 2F5ZA 4K7ZA 4OPUA 3S61A 4RG3A 3IC9A 2VQBA 4OPCA 2R45A 1L0VA 1GV4A 4H4SA 5JCMA 4REKA 2GV8A 3BHKA 5JCKA 4EQWA 1BGJA 1MO9A 1RP0A 2RGHA 3ATRA 3ICTA 3BI4A 5KVHA 1GRHA 1IUXA 1GETA 1ZY8A 1DJNA 2BK4A 1ELIA 3Q6JA 1BWCA 3BHFA 4H2RA 1B4VA 2WDRA 1CJ3A 1GT8A 3V76A 1LQUA 4KX6A 3QFBA 1DOBA 4GDPA 4GRTA 4B1BA 2X99A 2B9WA 1BZLA 4TM4A 5EOWA 3AXBA 2XFUA 3KVEA 2UZZA 1V59A 4U2TA 3AECA 4AT0A 2WP9A 4IVOB 1CJ2A 1IUWA 3P4SA 3DK4A 4A6NB 4DSGA 1BKWA 3I3LA 5DBJA 4JDRA 1JEHA 3GD3A 5KOWA 4NZHA 4XXGA 3NYEA 4ZN0A 3KD9A 1RYIA 1Z6LA 2XFOA 3CIRA 5M0ZA 3PO7A 1N4VA 3AE5A 4EM4A 1B8SA 1H7XA 3EAOA 5GRTA 2CULA 2JKCA 2XVIA 3DH9A 3AEDA 3DJDA 4J31A 3AYJA 3VRAA 2GF3A 3DA1A 4GR1A 2WEUA 3S5WA 3UP4A 1GESA 4H2NA 2Y6QA 2C7GA 4K2XA 2C64A 2B76A 3WE0A 1YQ3A 2YR4A 4IV9A 5KXJA 3RHAA 4U8KA 2FBWA 1MOKA 4BJYA 2APGA 4H2PA 1ZMDA 3UP5A 4U8MA 3LADA 2GAGB 2Z5YA 1LPFA 1H86A 2XLPA 2XVFA 3C96A 2HQMA 1E1LA 2VZ2A 1LV0A 3L8KA 1KF6A 2BS2A 3GSIA 4UP3A 1GEUA 4K8DA 1TYPA 2VRLA 1ZX9A 3CGBA 2ZZ0A 3RNMA 1YKJA 2FJEA 3AE1A 3ISHA 1H6VA 1NHSA 4YSHA 4YSXA 1K0IA 3R9UA 3LB8A 4DSHA 2C3CA 1O5WA 3NGCX 1CJ4A 3P1WA 3CGDA 2BC1A 4EQSA 3QVRA 5U1OA 2EQ7A 1PDHA 4BK1A 2OA1A 3IHGA 2GR2A 2XFQA 4B67A 2CFYA 1DJQA 1OJCA 1PBFA 2R9ZA 2R0CA 2BC0A 3ALMA 2XDOA 1ZOYA 4H4RA 1K0JA 2JBVA 3EANA 3QFAA 1SEZA 2OLNA 4CNKA 2EQ6A 3LOVA 1COYA 3CNDA 3E1TA 5C2TA 1OJDA 3NHOX 3SM8A 4A99A 4EIQA 3NKSA 1LVLA 5EB4A 3AYIA 2X8GA 2YLSA 4HB9A 2V3BA 3RP7A 4C74A 2X8HA 1FEAA 3UKAA 2C70A 3CGCA 2BYBA 1F3PA 1QO8A 4A9WA 5FS8A 3DJJA 2C76A 4KPRA 2Y6RA 4TLXA 2QAEA 1CC6A 1PN0A 3QJ4A 3SGLA 2XLRA 4YTPA 4A65A 3K30A 1TDEA 4TM3A 1K0LA 4UDQA 3NK0X 4CY6A 2PHHA 1GALA 4GCMA 3REDA 4OCGA 2B9XA 2GMHA 3NT6A 4NTCA 3UKKA 2BCPA 2ZZCA 2C73A 1RSGA 2VVMA 2C65A 1P2EA 3AE7A 4CY8A 2GEWA 1PXAA 2XLTA 1H81A 2WOVA 1GSNA 2GQFA 4GUVA 4PABA 5BRTA 4U8OA 1MXTA 1N4UA 4FDCB 2GR0A 1E1KA 2YQUA 4Z2RA 4U2LA 4YTNA 1D7YA 2XVHA 1GPEA 3IHMA 2WHDA 2X8CA 1NDAA 1CC2A 1GRGA 3GWFA 2CDUA 1GRTA 3AEFA 1IJHA 3BI5A 3QSSA 3ZDNA 3GWDA 1IUVA 2WU2A 4YSYA 4UDRA 4CRTA 2H89A 3ICSA 3NN6X 2XCGA 1JRXA 4RSLA 5GSNA 4Z24A 1S2YA 5JCNA 1VG0A 4K5RA 4AOXA 1VQWA 3CGEA 4C5OA 3M0OA 3M12A 1JNRA 1EBDA 1L9EA 2E1MA 4JY2A 4C3XA 4FX9A 2EQ8A 5BULA 1TDFA 3AWIA 5J7XA 3HZLA 5HY5A 4H4VA 1EL9A 2YG3A 1W4XA 2YVFA 4A79A 1FECA 1FEBA 1GTHA 4A6NA 3ZYXA 1EL8A 1DOCA 4NTDA 1S3EA 3V3NA 3CPIG 4AP3A 3I6DA 1YQ4A 4CBQA 1D4DA 2R0GA 1O94A 3NN0X 5HHFA 4AP1A 1B5QA 1ZK7A 1OJ9A 4APNA 1LQTA 3F8PA 3GMCA 5C3JA 2OLOA 2ZZBA 3URHA 4AT2A 5KWFA
chains in the Genus database with same CATH superfamily
1UKVG 2I0ZA 2PGEA 3TW9A 5FJOA 3ETRB 3AYLA 3NTDA 1SJDA 4JNQA 1PJ5A 2A8XA 2P8BA 3P4QA 2W3SA 1KSSA 3UCLA 4FK1C 5G5GB 5BUKA 3SQPA 5IDZA 1N5XA 3D9XA 2V61A 1REOA 3BNUA 4D04A 5EB5A 2WS3A 3QPEA 1NHRA 3ENLA 1LJ1A 2OG9A 1Y56A 4IVMB 4IZGA 2AR8A 3QSMA 4PAAA 1BF3A 1XPYA 3GC2A 2GAHB 2BXRA 2YG7A 4YKGA 1GREA 1WYGA 2B9YA 3UOVA 3N6HA 1BGNA 1VDVA 3CXOA 4H4XA 3R1ZA 3BOXA 1FHUA 2XGZA 4ADWA 4GF7A 2QA2A 3KU9A 3VRDB 4BJZA 3AB1A 1D4CA 2J3NA 2GMJA 4NEWA 3T9PA 2R0PA 2FKPA 4Y4LA 1P2HA 2YLTA 1ONEA 1KNPA 3R10A 1NPXA 2ZBWA 1CHUA 1X2HA 3K7TA 4HYRA 3VFCA 3HYVA 4II3A 4JN9A 5LV9A 4HA6A 2AL2A 4K5SA 4Z26A 4OPIA 2QDDA 3Q9TA 3DG3A 2FJAA 3SXIA 2Z5XA 3FBSA 3V3WA 4C3YA 2C67A 3II4A 4IA6A 2VRMA 2XH0A 3CPJG 4H4QA 4TM0A 4E4FA 4Y4NA 3M13A 5FMHA 3DFHA 3ALJA 1PJ7A 3TCSA 4U8PA 4YKFA 2OAMA 1H83A 2WPEA 5U63A 4DN1A 3RP8A 2P3ZA 3P9UA 4X9NA 1KSUA 4GGBA 2RGJA 4EMJA 1ZMCA 4EIPA 2GVCA 2VVLA 4H2QA 3B6DA 4CNJA 3BNMA 1H7WA 2XVJA 3VR8A 4XWZA 4H4TA 2VVLG 4WX1A 4FK1A 5IQ1A 3DK8A 2H88A 2XSXA 3AE3A 3SJNA 1PXBA 2ACZA 1PBBA 4ZCCA 2W55A 5CKUA 2WP5A 1GRFA 4BK3A 3VR9A 2OFJA 4GAPA 4C77A 4G6GA 1CF3A 4OVIA 1L8PA 1S2QA 3AE6A 2TPRA 3DMEA 3IWAA 3KKJA 3AEEA 3IJQA 2BK5A 2ARDA 1TRBA 3R11A 5J60A 3SSZA 1IUSA 2PP1A 1E6EA 1BKHA 2F5ZA 4K7ZA 2AL1A 5JCKA 3ICTA 1MO9A 3ATRA 5KVHA 1FO4A 1P43A 3QTPA 1GETA 1DJNA 2BK4A 3BHFA 3Q6JA 4H2RA 4G9KA 4KX6A 3ZLHA 2X99A 4TM4A 3AXBA 3OTRA 1V59A 3AECA 3HPFA 4M0XA 1KCZA 1BKWA 5KOWA 4G74A 3NYEA 4H2HA 3CIRA 1N4VA 3CYJA 3AE5A 4MKSA 2CULA 3DA1A 1MRAA 4TVWA 2Y6QA 2B76A 4BJYA 2APGA 4JN8A 1H86A 3C96A 1E1LA 1LV0A 3L8KA 3IJIA 1GEUA 2VRLA 3PWIA 1KKRA 1ZX9A 3ZLFA 3AE1A 1NHSA 2P8CA 4YSHA 1K0IA 3R9UA 3NGCX 3P1WA 1PDHA 3N6JA 2OA1A 3A7AA 3ES8A 1DJQA 4IL0A 2BC0A 1KD0A 3EANA 3QFAA 2OLNA 2EQ6A 1COYA 5EB4A 2X8GA 1T3QC 2I5QA 2OO6A 3PWGA 2BYBA 1F3PA 1ZXIC 1QO8A 4A9WA 5FS8A 4KPRA 2Y6RA 4TLXA 3SZWA 2PU0A 4M6UA 3SGLA 4TM3A 3NK0X 4GCMA 4OCGA 2C73A 2VVMA 1JRPA 1GSNA 2GQFA 5KMPA 3OZMA 1MXTA 2YQUA 2ZADA 4G8TA 2QJNA 1MDLA 2CDUA 1IJHA 3BI5A 3GYXA 4UDRA 3ICSA 1JRXA 3DERA 1H2IA 4AOXA 3DIPA 3VDGA 1L9EA 3TWAA 1TE6A 3T2KA 3SQSA 4KEMA 3SN1A 1GTHA 3Q45A 1EL8A 1DOCA 3V3NA 4AP3A 3T14A 4CBQA 1D4DA 2R0GA 1O94A 5HXIA 5JRBA 1FFVC 3DESA 1OJ9A 3U9IA 5BVAA 1PHHA 1TDNA 2WU5A 1NENA 2JK6A 2Q0LA 2OZ3A 4H7UA 4X4JA 1ZKQA 3NVZB 4O5QA 4Z1YA 3FMWA 4BURA 4XWRA 3AE9A 4A6GA 5KNLA 2HZGA 2W0HA 2OKTA 1QJDA 3MSYA 1Q1RA 3OC4A 4B65A 1F8SA 2W3RA 3BI2A 3DG6A 4YSZA 1GXFA 5KMRA 2JB1A 3ADAB 3UOZA 1KDGA 3CNTA 4NWZA 2DKHA 1EC9A 2PPGA 3UKFA 4AOSA 3NVVB 2WESA 3NYCA 2DKIA 2BXSA 3UKPA 1V97A 3AE2A 2NPXA 4U8JA 4K22A 3AE8A 3K7QX 5KVIA 5IQ4A 3KA7A 4Z2TA 1EC8A 3RO6A 2GB0A 4LIIA 1H82A 3UTGA 1F8WA 1KNRA 2OZTA 2PSNA 4J2WA 4GAVA 3AEAA 4IP5A 4J56A 5ER0A 3OP2A 2OQHA 1NHPA 4HCLA 3P4RA 4DWDA 1GOSA 1CBOA 3GRSA 1K4QA 2YLXA 3UKLA 1AOGA 2GDQA 1OEPA 1GRAA 1QLBA 2GGJA 3BJSA 2YR5A 1JROA 5L46A 1F6MA 5BOFA 3UOYA 2XLUA 3UJFA 4USQA 1PS9A 2GQWA 5TR3A 1GTEA 1XDIA 3FJ4A 3S47A 3DGHA 2XVEA 1NAAA 3SR6B 2FYMA 4OPDA 3H70A 3CNSA 3CNJA 2OQYA 5JCIA 5FJRA 2YG5A 3EF6A 4YWSA 4X9MA 5G5HB 1N4WA 3NH3X 3VA8A 1N60C 1XS2A 4H1ZA 5FS7A 3UOXA 1XANA 4J1OA 1ZDLA 1D7LA 1CL0A 3F8RA 3ITJA 2GH5A 4H4ZA 4EMWA 2Q7VA 2V5ZA 4UDPA 3DG7A 2VQ7A 1GNDA 1NG4A 2C75A 3NTAA 2IIDA 3SFDA 1JRZA 3TJIA 3MQTA 2B7SA 2JB2A 5FJUA 4J36A 3VRBA 5KOXA 1EBGA 1PDYA 1SJBA 4I59A 2YVJA 3NO1A 1PBCA 2YM1A 3G5RA 1NELA 3AMZA 4ECHA 3GDPA 5KMQA 4J33A 1MNSA 1N63C 4H4YA 2MUCA 3I6TA 3A7UA 3AEBA 4B68A 3D46A 4D03A 3R0KA 4JN7A 2C3DA 3UGVA 1PBDA 4DYEA 3ES7A 4H4WA 4LU6A 4I58A 3GMBA 2ZC8A 2PTWA 3ABVA 2PCEA 2YLZA 4OPUA 3SN0A 3NS1B 4RG3A 3T4WA 4H4SA 4EQWA 1STZA 1GRHA 2WDRA 1CJ3A 1GT8A 3T6CA 1LQUA 3QFBA 1DOBA 4GDPA 3T31A 2B9WA 5EOWA 3SZ0A 4E6MA 3P4SA 4A6NB 4E5TA 3GD3A 4MGGA 4NZHA 3PO7A 2ONEA 1B8SA 3EAOA 5GRTA 4J31A 2QJMA 3AYJA 3VRAA 2WEUA 4IT1A 3S5WA 3UP4A 1GESA 4H2NA 5KXJA 1YQ3A 4IV9A 2FBWA 3R07C 1MOKA 4H2PA 3UP5A 1LPFA 4IHCA 2XVFA 3D47A 2BS2A 1TYPA 4HN8A 4J3ZA 3ZVHA 3CGBA 2DW6A 1CJ4A 2EQ7A 3JW7A 4B67A 2CFYA 1PBFA 2OLAA 2R0CA 4H4RA 1K0JA 1FHVA 2JBVA 4HCDA 4CNKA 3NHOX 3SM8A 3UJ2A 3PG6A 1LVLA 2V3BA 2X8HA 3TOYA 2C70A 3S5SA 3OZYA 3U4FA 1BQGA 3EUB3 3DJJA 3PK7A 2C76A 2QAEA 3QJ4A 3VC6A 4YTPA 1K0LA 4UDQA 4CY6A 4F4RA 2BCPA 2ZZCA 1RSGA 3I6EA 3AE7A 1X2GA 4TVYA 2GR0A 4Z2RA 2PA6A 3IHMA 2WHDA 1NDAA 1GRTA 3AEFA 2GSHA 3QSSA 3ZDNA 3A7RA 2WU2A 4CRTA 3AN1A 2H89A 2XCGA 1S2YA 3RCYA 4II2A 1TKKA 1TDFA 3AWIA 4DX3A 3HZLA 2YG3A 1W4XA 2YVFA 3SZFA 1FIQB 4AP1A 1B5QA 1LQTA 3GMCA 4APNA 3F8PA 3UCCA 3UCDA 1MUCA 3NVYB 3URHA 2PTZA 5KWFA 4ROPA 2E3TA 1IUUA 3ZVHB 4CCQA 3H8AA 1YEYA 3AEGA 4GMEA 5HYMA 3D8XA 2BCGG 1FCDA 1VDCA 3KUMA 3BSMA 1ZP0A 1E39A 3DK9A 4CCRA 3NK2X 4IL2A 3LJPA 3MWCA 3AE4A 3ALLA 4DHGA 3F8DA 4NTEA 3KLJA 4B64A 3CMMA 1DOEA 1ELSA 4H50A 4Z2UA 4BV6A 1M64A 3RITA 3UJRA 1E1NA 3NLCA 4JNAA 2WDVA 4DNAA 4TLZA 2XFPA 1OJAA 3NZGA 4G73A 1DXLA 4U8NA 3B3RA 2GGEA 2PP3A 2GRTA 2JB3A 4U8IA 1EL7A 2FJBA 1N1PA 4J57A 1NU5A 5ENLA 3T2YA 1P48A 3I4KA 1IYXA 1D5TA 3FYYA 1JRYA 2BS4A 3RRAA 2IVEA 2B7RA 1GRBA 3SYIA 3CT2A 4YXDA 2PP0A 1WUEA 3EPTA 2R4EA 4E0VA 1XPQA 3KPKA 3STPA 1FL2A 3OW1A 3PS9A 2WETA 2IVDA 4GGHA 1HYUA 3AD7B 4O5UA 5EU9A 3QVPA 3V3OA 1L9DA 3FPZA 5M10A 3IJLA 5FS6A 1F8RA 4FP1A 4J34A 4B63A 4Z43A 4X2PA 1ONFA 4G7FA 3UTHA 2YLWA 4K8GA 5EBKA 1IUTA 2TMDA 2AKZA 2RGOA 2OX4A 2QCUA 1FFUC 2GR1A 3HRDC 2R4JA 3R25A 2GR3A 2C72A 2YAUA 4Z25A 2E5VA 3C4NA 3H4KA 2BABA 3SX6A 1GERA 2O9ZA 3TTEA 2WQYA 4IP4A 2YM2A 2NVKX 2WDQA 2WBAA 2OVLA 1DODA 2QA1A 3GD6A 1X31B 4H4PA 1VRQB 2A89A 4LA1A 3VQRA 3JZUA 3DDMA 4YTMA 4EQXA 1LTXR 1Y56B 4DXKA 2R46A 2GGGA 4GISA 5FJTA 1Q9IA 2P88A 4KWSA 3UKHA 3LZXA 3UJSA 3SFEA 4P9SA 3QSEA 3SY4A 4YT0A 3DJGX 3PVCA 2E5AA 3H7VA 1JPDX 2BACA 3ATQA 5BOEA 1PDZA 5KRQA 2PU1A 3KPFA 2AKMA 4IA5A 3NG7X 4Z44A 3FIMB 5JCLA 1R0MA 1YQZA 4TM1A 4HPNA 3VCCA 1NG3A 2PYXA 2AL2B 1TYTA 4JQ9A 3CN8A 3G5SA 1B37A 1TDKA 3CNPA 4DGKA 2EQ9A 2VQBA 4OPCA 2R45A 5JCMA 1DTNA 2PTYA 4REKA 2RGHA 1RP0A 3BI4A 1JPMA 1IUXA 1ZY8A 4E4UA 2QJJA 1BWCA 3QKEA 3V5CA 1B4VA 1JCTA 4B1BA 3KVEA 2UZZA 4U2TA 4AT0A 2WP9A 4IVOB 1EC7A 1IUWA 1CJ2A 4DSGA 5FJPA 5DBJA 1JEHA 4XXGA 3KD9A 1Z6LA 2QVHA 4EM4A 2XVIA 1H7XA 2JKCA 3AEDA 2HNEA 3R0UA 2QGYA 2GF3A 3NFUA 3JVAA 2C7GA 3WE0A 2HXUA 3CAWA 4U8MA 3MKCA 2GAGB 2Z5YA 4GFIA 2XLPA 2VZ2A 3MUCA 1KF6A 4KT2A 3UJEA 2ZZ0A 3ISHA 4DSHA 2PODA 3CGDA 5U1OA 2P0IA 2XFQA 3PFRA 2R9ZA 2XDOA 3P0WA 1SEZA 3E1TA 1R6WA 1OJDA 5C2TA 3FXGA 4EIQA 3NKSA 2YLSA 2NQLA 4HB9A 2PTXA 1FEAA 3UKAA 3P3BA 3FVDA 1CC6A 2XLRA 3THUA 1TDEA 2GMHA 4NTCA 2POZA 4CY8A 2GEWA 2WOVA 4PABA 4U8OA 4MMWA 1E1KA 3CB3A 4U2LA 4YTNA 2X8CA 1CC2A 4E8GA 4YSYA 3NN6X 3K1GA 5JCNA 1VG0A 4K5RA 3CGEA 3M0OA 3M12A 2E1MA 4JY2A 3DGBA 5BULA 5J7XA 5HY5A 4H4VA 1ECQA 3SBFA 1FECA 4A79A 1FEBA 3ZYXA 4K1WA 4NTDA 1S3EA 3ZLGA 3I6DA 5HHFA 1ZK7A 2OLOA 3L5OA 6ENLA 2DW7A 4AT2A 3NNEA 1YY5A 3VC5A 3AD9B 1N5WC 1SJAA 3DFYA 4JY3A 1N61C 3N4EA 4G6HA 1FOHA 2AAQA 5J04A 3P4PA 1O95A 3HYWA 3T37A 3GYJA 1TDOA 2BK3A 4USRA 1CC4A 3ZVIA 4YWOA 3LZWA 1ZOVA 1L9CA 1TZZA 2MNRA 3GY1A 3NYFA 4GYPC 3NIXA 3D1CA 3NK1X 3NVWB 4ZCDA 4U2SA 1SB3B 3DJEA 1H84A 4ZA0A 2AQJA 2W54A 3AD8B 4OPGA 4N9XA 4OPTA 3T2ZA 1XHCA 3TJ4A 5IPYA 3K7MX 1E7PA 2FJDA 4EM3A 4ICYA 4Y4MA 1KFYA 3B97A 4HNLA 4ZOHB 1KN0A 2OPJA 2YG4A 3H8IA 2V60A 4WCTA 3GDNA 5U25A 2PMQA 1WUFA 4RG4A 2YWLA 4H4UA 3EKGA 2XLSA 4M52A 3GO2A 3QN3A 3CTYA 3RP6A 2V3AA 4U8LA 2JAEA 4ZCWA 3V4BA 3H12A 1JU2A 3QLDA 3COXA 3NRZB 1CJCA 3CPHG 2WOIA 3DEQA 3GYIA 2XH4A 2A87A 2WPCA 3ICRA 3AM9A 4OPLA 3DGZA 2X3NA 2GGIA 4B66A 3UTFA 4EQRA 2XYOA 2CVJA 1E9IA 3IF9A 4A35A 3UXLA 2XH2A 4K2SA 2PS2A 2X50A 1NEKA 5FS9A 3SZCA 2WPFA 4ENLA 3GD4A 2YG6A 3C4AA 2YR6A 4HCHA 2XFNA 1Q1WA 4BK2A 2BS3A 2VOUA 2E4GA 1JNZA 2YLRA 2Q0KA 2GL5A 3FG2P 1W6TA 1F9CA 2V6OA 4NNJA 3OZ2A 2YVGA 3HYXA 2C66A 3UTEA 1RM6B 4NEVA 1NHQA 1DNCA 4FI4A 3RGTA 3T0KA 3G5QA 4A7AA 1S3BA 1PJ6A 3UKQA 2RABA 1D4EA 4B69A 4MJWA 2BA9A 3O0HA 4H19A 4GDEA 1JOAA 2WOWA 1VG9A 4EMIA 3NRNA 2BRAA 3H8LA 2WP6A 3L1RA 3CK5A 4H83A 1OJTA 7ENLA 1PXCA 3P93A 2GGHA 1E1MA 5CQFA 1Y0PA 1EL5A 2Q6UA 2RDXA 3RR1A 4JHMA 3CXBA 3VCNA 1PBEA 3LXDA 2OALA 1M6IA 4A5LA 3JSKA 2QQ6A 3GRTA 3N4FA 3S61A 2XH7A 3IC9A 1L0VA 1GV4A 2GV8A 3BHKA 2PGWA 1BGJA 1ELIA 2QDEA 3V76A 4Z17A 3MY9A 4GRTA 1EBHA 1BZLA 3TWBA 3B9JB 2XFUA 3DK4A 3NXLA 3I3LA 4JDRA 4ZN0A 1RYIA 2XFOA 5M0ZA 3OPSA 1N62C 3DH9A 3DJDA 1JDFA 4GR1A 1RVKA 4K2XA 2C64A 2YR4A 3RHAA 4U8KA 1ZMDA 4GIRA 3TQPA 3LADA 2HQMA 3GSIA 3EEZA 2OZ8A 4K8DA 4UP3A 2BRYA 1YKJA 3RNMA 2FJEA 1H6VA 4YSXA 3LB8A 2C3CA 1O5WA 2BC1A 4EQSA 4HNCA 3QVRA 4BK1A 3MZNA 3IHGA 2GR2A 1OJCA 3ALMA 1ZOYA 3FCPA 3LOVA 3CNDA 4A99A 1KKOA 3AYIA 4A3RA 3RP7A 4C74A 4EWJA 3SN4A 3CGCA 1MDRA 2CHRA 1PN0A 4A65A 3K30A 2O56A 2PHHA 1GALA 3REDA 2B9XA 3UKKA 2C65A 1P2EA 2HXTA 1PXAA 2XLTA 1H81A 4GUVA 5BRTA 3FV9A 1N4UA 4FDCB 1D7YA 2XVHA 1GPEA 3HW2A 5KMSA 1GRGA 3GWFA 3UXKA 3IK4A 3GWDA 1IUVA 4GYPA 4RSLA 3T8QA 5GSNA 4Z24A 3Q4DA 4KPLA 1VQWA 4C5OA 1JNRA 1EBDA 4C3XA 4FX9A 2EQ8A 3V5FA 1EL9A 2C4CA 1VQZA 4A6NA 1S7MA 3CPIG 1YQ4A 3NN0X 5C3JA 1SJCA 2ZZBA 3NT6A
chains in the Genus database with same CATH topology
1PHHA 1TDNA 2WU5A 3NNEA 1YY5A 1UKVG 2I0ZA 1NENA 2JK6A 1IUUA 2Q0LA 3AD9B 4CCQA 3AYLA 3NTDA 3AEGA 5HYMA 3D8XA 4H7UA 4JNQA 2BCGG 1PJ5A 4X4JA 1FCDA 1ZKQA 1VDCA 4JY3A 4O5QA 2A8XA 3FMWA 4BURA 4G6HA 4XWRA 3P4QA 3AE9A 1KSSA 1FOHA 1ZP0A 3UCLA 2AAQA 4FK1C 1E39A 3DK9A 4CCRA 3P4PA 1O95A 3HYWA 5KNLA 3NK2X 3T37A 3GYJA 3LJPA 1TDOA 2W0HA 5BUKA 3SQPA 2BK3A 3AE4A 1QJDA 3ALLA 3D9XA 4USRA 2V61A 3F8DA 1REOA 1Q1RA 3OC4A 1CC4A 3BNUA 4NTEA 4B65A 4D04A 5EB5A 3KLJA 1F8SA 4B64A 3CMMA 3BI2A 4YWOA 1DOEA 3LZWA 2WS3A 4YSZA 1ZOVA 1L9CA 1NHRA 4H50A 1GXFA 5KMRA 4Z2UA 2JB1A 5HXIA 1LJ1A 4BV6A 1M64A 3ADAB 3UOZA 1Y56A 4IVMB 1E1NA 3NLCA 4JNAA 1KDGA 3CNTA 3NYFA 2WDVA 2AR8A 4DNAA 2DKHA 3NIXA 2XFPA 3D1CA 4NWZA 1OJAA 4TLZA 3NK1X 3QSMA 4G73A 4ZCDA 4PAAA 4U2SA 3DJEA 1DXLA 1H84A 3UKFA 4AOSA 4U8NA 2WESA 3B3RA 1BF3A 2GRTA 2JB3A 4U8IA 3NYCA 2DKIA 2BXSA 1EL7A 2BXRA 2FJBA 2GAHB 2YG7A 3UKPA 4YKGA 3AE2A 1N1PA 4J57A 2NPXA 1GREA 4U8JA 3T2YA 2B9YA 2AQJA 4K22A 3AD8B 3AE8A 4OPGA 4N9XA 3UOVA 4OPTA 3K7QX 5KVIA 1XHCA 1D5TA 1BGNA 3KA7A 3T2ZA 4Z2TA 5IQ4A 1JRYA 4H4XA 5IPYA 3K7MX 1E7PA 2BS4A 2GB0A 4LIIA 2FJDA 1H82A 4EM3A 3UTGA 1F8WA 2IVEA 2B7RA 4ICYA 1KNRA 1GRBA 4ADWA 1KFYA 4Y4MA 4J2WA 3SYIA 4YXDA 4GAVA 2QA2A 4GF7A 3AEAA 3KU9A 4J56A 3VRDB 4BJZA 1KN0A 5ER0A 3AB1A 1D4CA 2YG4A 3H8IA 2V60A 4WCTA 3GDNA 2J3NA 3P4RA 1NHPA 5U25A 3EPTA 4RG4A 2GMJA 1GOSA 4NEWA 1CBOA 2R4EA 2YWLA 4E0VA 4H4UA 1XPQA 3GRSA 1K4QA 3KPKA 2R0PA 2YLXA 4Y4LA 1P2HA 2YLTA 1FL2A 3UKLA 1KNPA 3PS9A 1AOGA 1GRAA 2XLSA 2WETA 1NPXA 2IVDA 2ZBWA 1HYUA 3AD7B 1QLBA 1CHUA 2YR5A 4M52A 4O5UA 5L46A 1F6MA 3CTYA 3QVPA 3RP6A 2XLUA 3K7TA 3UOYA 1L9DA 3V3OA 4USQA 1PS9A 3FPZA 5M10A 3HYVA 2GQWA 2V3AA 4II3A 4JN9A 5TR3A 1GTEA 4U8LA 2JAEA 5FS6A 5LV9A 1F8RA 4HA6A 1JU2A 1XDIA 4J34A 4B63A 4Z43A 3COXA 1CJCA 3CPHG 4K5SA 4Z26A 2WOIA 3GYIA 1ONFA 4OPIA 3UTHA 2A87A 2YLWA 3Q9TA 2FJAA 5EBKA 2WPCA 3SXIA 3DGHA 2Z5XA 2XVEA 1NAAA 3ICRA 4OPLA 1IUTA 2TMDA 3DGZA 2X3NA 2RGOA 3FBSA 4B66A 2QCUA 3UTFA 4EQRA 2XYOA 4C3YA 2GR1A 2C67A 4OPDA 2R4JA 2CVJA 3II4A 2GR3A 3CNSA 3CNJA 5JCIA 3IF9A 2YG5A 3EF6A 4IA6A 4X9MA 1N4WA 2VRMA 3NH3X 5FS7A 3UOXA 1XANA 3CPJG 2X50A 4H4QA 4TM0A 2C72A 1NEKA 2YAUA 1ZDLA 4Y4NA 1D7LA 1CL0A 3F8RA 5FS9A 3ITJA 4Z25A 3SZCA 2E5VA 3C4NA 2GH5A 3H4KA 2BABA 4H4ZA 3SX6A 1GERA 2O9ZA 3M13A 5FMHA 2WPFA 3ALJA 1PJ7A 4EMWA 2Q7VA 3GD4A 2V5ZA 2YG6A 3C4AA 2YR6A 2XFNA 4UDPA 1Q1WA 4U8PA 2WQYA 5BVAA 4YKFA 4BK2A 2BS3A 2OAMA 1GNDA 2VOUA 1H83A 2E4GA 1JNZA 2VQ7A 2YM2A 2WPEA 2YLRA 2NVKX 2WDQA 2Q0KA 2WBAA 3FG2P 1DODA 5U63A 2V6OA 2QA1A 4NNJA 1X31B 1NG4A 4H4PA 3OZ2A 1VRQB 2A89A 4X9NA 2YVGA 3P9UA 2C75A 3RP8A 4LA1A 3VQRA 3NTAA 1KSUA 4YTMA 2IIDA 2RGJA 3HYXA 4EQXA 4EMJA 2C66A 1ZMCA 1LTXR 3UTEA 3SFDA 4EIPA 4NEVA 1NHQA 2GVCA 1JRZA 1Y56B 1DNCA 2VVLA 4H2QA 3B6DA 4CNJA 2R46A 3BNMA 3T0KA 3G5QA 4A7AA 1H7WA 2XVJA 3VR8A 1S3BA 2B7SA 4XWZA 2JB2A 1Q9IA 4J36A 1PJ6A 3VRBA 3UKQA 2RABA 4H4TA 3UKHA 2VVLG 1D4EA 4B69A 3LZXA 4WX1A 5KOXA 3SFEA 4MJWA 4P9SA 3QSEA 4I59A 3SY4A 4YT0A 3DJGX 4FK1A 2YVJA 3O0HA 2BA9A 3PVCA 1PBCA 5IQ1A 3DK8A 4GDEA 2YM1A 3G5RA 2H88A 1JOAA 2WOWA 3AE3A 5KOWA 4ECHA 1VG9A 4EMIA 2ACZA 1PXBA 2BACA 3ATQA 3GDPA 1PBBA 3NRNA 5KMQA 5KRQA 4ZCCA 2BRAA 3H8LA 3KPFA 2WP6A 4J33A 5CKUA 2WP5A 3L1RA 4H4YA 4IA5A 1GRFA 4BK3A 3NG7X 3VR9A 4Z44A 4GAPA 4C77A 3FIMB 4G6GA 1CF3A 5JCLA 4OVIA 1OJTA 1PXCA 3AEBA 4B68A 4D03A 2C3DA 1PBDA 1S2QA 1E1MA 3AE6A 5CQFA 2TPRA 1YQZA 3DMEA 4TM1A 1Y0PA 3IWAA 4H4WA 1EL5A 2Q6UA 3KKJA 4LU6A 4I58A 3AEEA 2BK5A 1NG3A 2ARDA 2PYXA 3GMBA 1TRBA 1TYTA 1PBEA 3LXDA 4JQ9A 3CN8A 5J60A 2OALA 3G5SA 1B37A 1M6IA 1TDKA 3ABVA 3CNPA 4A5LA 1IUSA 3GRTA 1E6EA 3JSKA 2YLZA 4DGKA 2EQ9A 2F5ZA 4K7ZA 4OPUA 3S61A 4RG3A 3IC9A 2VQBA 4OPCA 2R45A 1L0VA 1GV4A 4H4SA 5JCMA 4REKA 2GV8A 3BHKA 5JCKA 4EQWA 1BGJA 1MO9A 1RP0A 2RGHA 3ATRA 3ICTA 3BI4A 5KVHA 1GRHA 1IUXA 1GETA 1ZY8A 1DJNA 2BK4A 1ELIA 3Q6JA 1BWCA 3BHFA 4H2RA 1B4VA 2WDRA 4G9KA 1CJ3A 1GT8A 3V76A 1LQUA 4KX6A 3QFBA 1DOBA 4GDPA 4GRTA 4B1BA 2X99A 3T31A 2B9WA 1BZLA 4TM4A 5EOWA 3SZ0A 3AXBA 2XFUA 3KVEA 2UZZA 1V59A 4U2TA 3AECA 4AT0A 2WP9A 4IVOB 1CJ2A 1IUWA 3P4SA 3DK4A 4A6NB 4DSGA 1BKWA 3I3LA 5DBJA 4JDRA 1JEHA 3GD3A 4G74A 4NZHA 4XXGA 3NYEA 4ZN0A 3KD9A 1RYIA 1Z6LA 2XFOA 3CIRA 5M0ZA 3PO7A 1N4VA 3AE5A 4EM4A 1B8SA 1H7XA 3EAOA 5GRTA 2CULA 2JKCA 2XVIA 3DH9A 3AEDA 3DJDA 4J31A 3AYJA 3VRAA 2GF3A 3DA1A 4GR1A 2WEUA 3S5WA 3UP4A 1GESA 4H2NA 2Y6QA 2C7GA 4K2XA 2C64A 2B76A 3WE0A 1YQ3A 2YR4A 4IV9A 5KXJA 3RHAA 4U8KA 2FBWA 1MOKA 4BJYA 2APGA 4H2PA 1ZMDA 3UP5A 4U8MA 3LADA 2GAGB 2Z5YA 1H86A 1LPFA 2XLPA 2XVFA 3C96A 2HQMA 1E1LA 2VZ2A 1LV0A 3L8KA 1KF6A 2BS2A 3GSIA 4UP3A 1GEUA 4K8DA 1TYPA 2BRYA 2VRLA 1ZX9A 3CGBA 2ZZ0A 3RNMA 1YKJA 2FJEA 3AE1A 3ISHA 1H6VA 1NHSA 4YSHA 4YSXA 1K0IA 3R9UA 3LB8A 4DSHA 2C3CA 1O5WA 3NGCX 1CJ4A 3P1WA 3CGDA 2BC1A 4EQSA 3QVRA 5U1OA 2EQ7A 1PDHA 4BK1A 2OA1A 3IHGA 2GR2A 2XFQA 4B67A 2CFYA 1DJQA 1OJCA 1PBFA 2R9ZA 2R0CA 2BC0A 3ALMA 2XDOA 1ZOYA 4H4RA 1K0JA 2JBVA 3EANA 3QFAA 1SEZA 2OLNA 4CNKA 2EQ6A 3LOVA 1COYA 3CNDA 3E1TA 5C2TA 1OJDA 3NHOX 3SM8A 4A99A 4EIQA 3PG6A 3NKSA 1LVLA 5EB4A 3AYIA 2X8GA 2YLSA 4HB9A 2V3BA 3RP7A 4C74A 2X8HA 1FEAA 3UKAA 2C70A 3CGCA 2BYBA 1F3PA 1QO8A 4A9WA 5FS8A 3DJJA 2C76A 4KPRA 2Y6RA 4TLXA 3SZWA 2QAEA 1CC6A 1PN0A 3QJ4A 3SGLA 2XLRA 4YTPA 4A65A 3K30A 1TDEA 4TM3A 1K0LA 4UDQA 3NK0X 4CY6A 2PHHA 1GALA 4GCMA 3REDA 4OCGA 2B9XA 2GMHA 3NT6A 4NTCA 3UKKA 2BCPA 2ZZCA 2C73A 1RSGA 2VVMA 2C65A 1P2EA 3AE7A 4CY8A 2GEWA 1PXAA 2XLTA 1H81A 2WOVA 1GSNA 2GQFA 4GUVA 4PABA 5BRTA 5KMPA 4U8OA 1MXTA 1N4UA 4FDCB 2GR0A 1E1KA 2YQUA 4Z2RA 4U2LA 4YTNA 1D7YA 2XVHA 1GPEA 3IHMA 2WHDA 2X8CA 1NDAA 5KMSA 1CC2A 1GRGA 3GWFA 2CDUA 1GRTA 3AEFA 1IJHA 3BI5A 3GYXA 3QSSA 3ZDNA 3GWDA 1IUVA 2WU2A 4YSYA 4UDRA 4CRTA 2H89A 3ICSA 3NN6X 2XCGA 1JRXA 4RSLA 5GSNA 4Z24A 1S2YA 1H2IA 5JCNA 1VG0A 4K5RA 4AOXA 1VQWA 3CGEA 4C5OA 3M0OA 3M12A 1JNRA 1EBDA 1L9EA 2E1MA 4JY2A 4II2A 4C3XA 4FX9A 2EQ8A 5BULA 3T2KA 1TDFA 3AWIA 5J7XA 3HZLA 5HY5A 4H4VA 1EL9A 2YG3A 1W4XA 2YVFA 3SZFA 2C4CA 1FECA 4A79A 1FEBA 1GTHA 4A6NA 1S7MA 3ZYXA 1EL8A 1DOCA 4NTDA 1S3EA 3V3NA 3CPIG 4AP3A 3T14A 3I6DA 1YQ4A 4CBQA 1D4DA 2R0GA 1O94A 3NN0X 5HHFA 5JRBA 1B5QA 1LQTA 1OJ9A 1ZK7A 4APNA 3F8PA 3GMCA 4AP1A 5C3JA 2OLOA 3L5OA 2ZZBA 3URHA 4AT2A 5KWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PHH A;  1TDN A;  2WU5 A;  3NNE A;  1YY5 A;  1UKV G;  2I0Z A;  1NEN A;  2JK6 A;  1IUU A;  2Q0L A;  3AD9 B;  4CCQ A;  3AYL A;  3NTD A;  3AEG A;  5HYM A;  3D8X A;  4H7U A;  4JNQ A;  2BCG G;  1PJ5 A;  4X4J A;  1FCD A;  1ZKQ A;  1VDC A;  4JY3 A;  4O5Q A;  2A8X A;  3FMW A;  4BUR A;  4XWR A;  3P4Q A;  3AE9 A;  1KSS A;  1FOH A;  1ZP0 A;  3UCL A;  2AAQ A;  4FK1 C;  1E39 A;  3DK9 A;  4CCR A;  3P4P A;  1O95 A;  3NK2 X;  3T37 A;  3GYJ A;  3LJP A;  1TDO A;  2W0H A;  5BUK A;  3SQP A;  2BK3 A;  3AE4 A;  1QJD A;  3ALL A;  4USR A;  2V61 A;  3F8D A;  1REO A;  1Q1R A;  3OC4 A;  1CC4 A;  3BNU A;  4NTE A;  4B65 A;  4D04 A;  5EB5 A;  3KLJ A;  1F8S A;  4B64 A;  3BI2 A;  4YWO A;  1DOE A;  3LZW A;  2WS3 A;  4YSZ A;  1ZOV A;  1L9C A;  1NHR A;  4H50 A;  1GXF A;  4Z2U A;  2JB1 A;  5HXI A;  1LJ1 A;  4BV6 A;  1M64 A;  3ADA B;  3UOZ A;  1Y56 A;  4IVM B;  1E1N A;  3NLC A;  4JNA A;  1KDG A;  3CNT A;  3NYF A;  2WDV A;  2AR8 A;  4DNA A;  2DKH A;  3NIX A;  2XFP A;  3D1C A;  4TLZ A;  1OJA A;  3NK1 X;  3QSM A;  4ZCD A;  4PAA A;  4U2S A;  3DJE A;  1DXL A;  1H84 A;  3UKF A;  4AOS A;  4U8N A;  2WES A;  3B3R A;  1BF3 A;  2GRT A;  2JB3 A;  4U8I A;  3NYC A;  2DKI A;  2BXS A;  1EL7 A;  2BXR A;  2FJB A;  2GAH B;  2YG7 A;  3UKP A;  4YKG A;  3AE2 A;  1N1P A;  4J57 A;  2NPX A;  1GRE A;  4U8J A;  2B9Y A;  2AQJ A;  4K22 A;  3AD8 B;  3AE8 A;  4OPG A;  4N9X A;  3UOV A;  4OPT A;  3K7Q X;  5KVI A;  1XHC A;  1D5T A;  1BGN A;  3KA7 A;  4Z2T A;  5IQ4 A;  1JRY A;  4H4X A;  5IPY A;  3K7M X;  1E7P A;  2BS4 A;  2GB0 A;  4LII A;  2FJD A;  1H82 A;  4EM3 A;  3UTG A;  1F8W A;  2IVE A;  2B7R A;  4ICY A;  1KNR A;  1GRB A;  4ADW A;  1KFY A;  4Y4M A;  4J2W A;  4YXD A;  4GF7 A;  2QA2 A;  3AEA A;  3KU9 A;  4J56 A;  3VRD B;  4BJZ A;  5ER0 A;  3AB1 A;  1D4C A;  2YG4 A;  3H8I A;  2V60 A;  4WCT A;  3GDN A;  2J3N A;  3P4R A;  1NHP A;  5U25 A;  3EPT A;  4RG4 A;  2GMJ A;  1GOS A;  4NEW A;  1CBO A;  2R4E A;  2YWL A;  4E0V A;  4H4U A;  1XPQ A;  3GRS A;  1K4Q A;  2R0P A;  2YLX A;  4Y4L A;  1P2H A;  2YLT A;  1FL2 A;  3UKL A;  1KNP A;  3PS9 A;  1AOG A;  1GRA A;  2XLS A;  2WET A;  1NPX A;  2IVD A;  2ZBW A;  1HYU A;  3AD7 B;  1QLB A;  1CHU A;  2YR5 A;  4M52 A;  4O5U A;  5L46 A;  1F6M A;  3CTY A;  3QVP A;  3RP6 A;  2XLU A;  3K7T A;  3UOY A;  1L9D A;  3V3O A;  4USQ A;  1PS9 A;  3FPZ A;  5M10 A;  2GQW A;  2V3A A;  4JN9 A;  5TR3 A;  1GTE A;  4U8L A;  2JAE A;  5FS6 A;  5LV9 A;  1F8R A;  4HA6 A;  1JU2 A;  1XDI A;  4J34 A;  4B63 A;  4Z43 A;  3COX A;  1CJC A;  3CPH G;  4K5S A;  4Z26 A;  2WOI A;  3GYI A;  1ONF A;  4OPI A;  3UTH A;  2A87 A;  2YLW A;  3Q9T A;  2FJA A;  5EBK A;  2WPC A;  3DGH A;  2Z5X A;  2XVE A;  1NAA A;  3ICR A;  4OPL A;  1IUT A;  2TMD A;  3DGZ A;  2X3N A;  2RGO A;  3FBS A;  4B66 A;  2QCU A;  3UTF A;  4EQR A;  2XYO A;  4C3Y A;  2GR1 A;  2C67 A;  4OPD A;  2R4J A;  2CVJ A;  3II4 A;  2GR3 A;  3CNS A;  3CNJ A;  5JCI A;  3IF9 A;  2YG5 A;  3EF6 A;  4IA6 A;  4X9M A;  1N4W A;  2VRM A;  3NH3 X;  5FS7 A;  3UOX A;  1XAN A;  3CPJ G;  2X50 A;  4H4Q A;  4TM0 A;  2C72 A;  1NEK A;  2YAU A;  1ZDL A;  4Y4N A;  1D7L A;  1CL0 A;  3F8R A;  5FS9 A;  3ITJ A;  4Z25 A;  2E5V A;  3C4N A;  2GH5 A;  3H4K A;  2BAB A;  4H4Z A;  1GER A;  2O9Z A;  3M13 A;  5FMH A;  2WPF A;  3ALJ A;  1PJ7 A;  4EMW A;  2Q7V A;  3GD4 A;  2V5Z A;  2YG6 A;  3C4A A;  2YR6 A;  2XFN A;  4UDP A;  1Q1W A;  4U8P A;  2WQY A;  5BVA A;  4YKF A;  4BK2 A;  2BS3 A;  2OAM A;  1GND A;  2VOU A;  1H83 A;  2E4G A;  1JNZ A;  2VQ7 A;  2YM2 A;  2WPE A;  2YLR A;  2NVK X;  2WDQ A;  2Q0K A;  2WBA A;  3FG2 P;  1DOD A;  5U63 A;  2V6O A;  2QA1 A;  1X31 B;  1NG4 A;  4H4P A;  3OZ2 A;  1VRQ B;  2A89 A;  4X9N A;  2YVG A;  3P9U A;  2C75 A;  3RP8 A;  4LA1 A;  3VQR A;  3NTA A;  1KSU A;  4YTM A;  2IID A;  2RGJ A;  4EQX A;  4EMJ A;  2C66 A;  1ZMC A;  1LTX R;  3UTE A;  3SFD A;  4EIP A;  4NEV A;  1NHQ A;  2GVC A;  1JRZ A;  1Y56 B;  1DNC A;  2VVL A;  4H2Q A;  3B6D A;  4CNJ A;  2R46 A;  3BNM A;  3G5Q A;  4A7A A;  1H7W A;  2XVJ A;  3VR8 A;  1S3B A;  2B7S A;  4XWZ A;  2JB2 A;  1Q9I A;  4J36 A;  1PJ6 A;  3VRB A;  3UKQ A;  2RAB A;  4H4T A;  3UKH A;  2VVL G;  1D4E A;  4B69 A;  3LZX A;  4WX1 A;  5KOX A;  3SFE A;  4MJW A;  4P9S A;  3QSE A;  4I59 A;  4YT0 A;  3DJG X;  4FK1 A;  2YVJ A;  3O0H A;  2BA9 A;  3PVC A;  1PBC A;  5IQ1 A;  3DK8 A;  4GDE A;  2YM1 A;  3G5R A;  2H88 A;  1JOA A;  2WOW A;  3AE3 A;  4ECH A;  1VG9 A;  4EMI A;  2ACZ A;  1PXB A;  2BAC A;  3ATQ A;  3GDP A;  1PBB A;  3NRN A;  5KRQ A;  4ZCC A;  3H8L A;  3KPF A;  2WP6 A;  4J33 A;  5CKU A;  2WP5 A;  3L1R A;  4H4Y A;  4IA5 A;  1GRF A;  4BK3 A;  3NG7 X;  3VR9 A;  4Z44 A;  4C77 A;  3FIM B;  1CF3 A;  5JCL A;  4OVI A;  1OJT A;  1PXC A;  3AEB A;  4B68 A;  4D03 A;  2C3D A;  1PBD A;  1S2Q A;  1E1M A;  3AE6 A;  5CQF A;  2TPR A;  1YQZ A;  3DME A;  4TM1 A;  1Y0P A;  3IWA A;  4H4W A;  1EL5 A;  2Q6U A;  3KKJ A;  4LU6 A;  4I58 A;  3AEE A;  2BK5 A;  1NG3 A;  2ARD A;  2PYX A;  3GMB A;  1TRB A;  1TYT A;  1PBE A;  3LXD A;  4JQ9 A;  3CN8 A;  5J60 A;  2OAL A;  3G5S A;  1B37 A;  1M6I A;  1TDK A;  3ABV A;  3CNP A;  4A5L A;  1IUS A;  3GRT A;  1E6E A;  3JSK A;  2YLZ A;  4DGK A;  2EQ9 A;  2F5Z A;  4K7Z A;  4OPU A;  3S61 A;  4RG3 A;  3IC9 A;  2VQB A;  4OPC A;  2R45 A;  1L0V A;  1GV4 A;  4H4S A;  5JCM A;  4REK A;  2GV8 A;  3BHK A;  5JCK A;  4EQW A;  1BGJ A;  1MO9 A;  1RP0 A;  2RGH A;  3ATR A;  3ICT A;  3BI4 A;  5KVH A;  1GRH A;  1IUX A;  1GET A;  1ZY8 A;  1DJN A;  2BK4 A;  1ELI A;  3Q6J A;  1BWC A;  3BHF A;  4H2R A;  1B4V A;  2WDR A;  1CJ3 A;  1GT8 A;  3V76 A;  1LQU A;  4KX6 A;  3QFB A;  1DOB A;  4GDP A;  4GRT A;  4B1B A;  2X99 A;  2B9W A;  1BZL A;  4TM4 A;  5EOW A;  3AXB A;  2XFU A;  3KVE A;  2UZZ A;  1V59 A;  4U2T A;  3AEC A;  4AT0 A;  2WP9 A;  4IVO B;  1CJ2 A;  1IUW A;  3P4S A;  3DK4 A;  4A6N B;  4DSG A;  1BKW A;  3I3L A;  5DBJ A;  4JDR A;  1JEH A;  3GD3 A;  5KOW A;  4NZH A;  4XXG A;  3NYE A;  4ZN0 A;  3KD9 A;  1RYI A;  1Z6L A;  2XFO A;  3CIR A;  5M0Z A;  3PO7 A;  1N4V A;  3AE5 A;  4EM4 A;  1B8S A;  1H7X A;  3EAO A;  5GRT A;  2CUL A;  2JKC A;  2XVI A;  3DH9 A;  3AED A;  3DJD A;  4J31 A;  3AYJ A;  3VRA A;  2GF3 A;  3DA1 A;  4GR1 A;  2WEU A;  3S5W A;  3UP4 A;  1GES A;  4H2N A;  2Y6Q A;  2C7G A;  4K2X A;  2C64 A;  2B76 A;  3WE0 A;  1YQ3 A;  2YR4 A;  4IV9 A;  5KXJ A;  3RHA A;  4U8K A;  2FBW A;  1MOK A;  4BJY A;  2APG A;  4H2P A;  1ZMD A;  3UP5 A;  4U8M A;  3LAD A;  2GAG B;  2Z5Y A;  1LPF A;  1H86 A;  2XLP A;  2XVF A;  3C96 A;  2HQM A;  1E1L A;  2VZ2 A;  1LV0 A;  3L8K A;  1KF6 A;  2BS2 A;  3GSI A;  4UP3 A;  1GEU A;  4K8D A;  1TYP A;  2VRL A;  1ZX9 A;  3CGB A;  2ZZ0 A;  3RNM A;  1YKJ A;  2FJE A;  3AE1 A;  3ISH A;  1H6V A;  1NHS A;  4YSH A;  4YSX A;  1K0I A;  3R9U A;  3LB8 A;  4DSH A;  2C3C A;  1O5W A;  3NGC X;  1CJ4 A;  3P1W A;  3CGD A;  2BC1 A;  4EQS A;  3QVR A;  5U1O A;  2EQ7 A;  1PDH A;  4BK1 A;  2OA1 A;  3IHG A;  2GR2 A;  2XFQ A;  4B67 A;  2CFY A;  1DJQ A;  1OJC A;  1PBF A;  2R9Z A;  2R0C A;  2BC0 A;  3ALM A;  2XDO A;  1ZOY A;  4H4R A;  1K0J A;  2JBV A;  3EAN A;  3QFA A;  1SEZ A;  2OLN A;  4CNK A;  2EQ6 A;  3LOV A;  1COY A;  3CND A;  3E1T A;  5C2T A;  1OJD A;  3NHO X;  3SM8 A;  4A99 A;  4EIQ A;  3NKS A;  1LVL A;  5EB4 A;  3AYI A;  2X8G A;  2YLS A;  4HB9 A;  2V3B A;  3RP7 A;  4C74 A;  2X8H A;  1FEA A;  3UKA A;  2C70 A;  3CGC A;  2BYB A;  1F3P A;  1QO8 A;  4A9W A;  5FS8 A;  3DJJ A;  2C76 A;  4KPR A;  2Y6R A;  4TLX A;  2QAE A;  1CC6 A;  1PN0 A;  3QJ4 A;  3SGL A;  2XLR A;  4YTP A;  4A65 A;  3K30 A;  1TDE A;  4TM3 A;  1K0L A;  4UDQ A;  3NK0 X;  4CY6 A;  2PHH A;  1GAL A;  4GCM A;  3RED A;  4OCG A;  2B9X A;  2GMH A;  3NT6 A;  4NTC A;  3UKK A;  2BCP A;  2ZZC A;  2C73 A;  1RSG A;  2VVM A;  2C65 A;  1P2E A;  3AE7 A;  4CY8 A;  2GEW A;  1PXA A;  2XLT A;  1H81 A;  2WOV A;  1GSN A;  2GQF A;  4GUV A;  4PAB A;  5BRT A;  4U8O A;  1MXT A;  1N4U A;  4FDC B;  2GR0 A;  1E1K A;  2YQU A;  4Z2R A;  4U2L A;  4YTN A;  1D7Y A;  2XVH A;  1GPE A;  3IHM A;  2WHD A;  2X8C A;  1NDA A;  1CC2 A;  1GRG A;  3GWF A;  2CDU A;  1GRT A;  3AEF A;  1IJH A;  3BI5 A;  3QSS A;  3ZDN A;  3GWD A;  1IUV A;  2WU2 A;  4YSY A;  4UDR A;  4CRT A;  2H89 A;  3ICS A;  3NN6 X;  2XCG A;  1JRX A;  4RSL A;  5GSN A;  4Z24 A;  1S2Y A;  5JCN A;  1VG0 A;  4K5R A;  4AOX A;  1VQW A;  3CGE A;  4C5O A;  3M0O A;  3M12 A;  1JNR A;  1EBD A;  1L9E A;  2E1M A;  4JY2 A;  4C3X A;  4FX9 A;  2EQ8 A;  5BUL A;  1TDF A;  3AWI A;  5J7X A;  3HZL A;  5HY5 A;  4H4V A;  1EL9 A;  2YG3 A;  1W4X A;  2YVF A;  4A79 A;  1FEC A;  1FEB A;  1GTH A;  4A6N A;  3ZYX A;  1EL8 A;  1DOC A;  4NTD A;  1S3E A;  3V3N A;  3CPI G;  4AP3 A;  3I6D A;  1YQ4 A;  4CBQ A;  1D4D A;  2R0G A;  1O94 A;  3NN0 X;  5HHF A;  4AP1 A;  1B5Q A;  1ZK7 A;  1OJ9 A;  4APN A;  1LQT A;  3F8P A;  3GMC A;  5C3J A;  2OLO A;  2ZZB A;  3URH A;  4AT2 A;  5KWF A; 
#chains in the Genus database with same CATH topology
 1UKV G;  2I0Z A;  2PGE A;  3TW9 A;  5FJO A;  3ETR B;  3AYL A;  3NTD A;  1SJD A;  4JNQ A;  1PJ5 A;  2A8X A;  2P8B A;  3P4Q A;  2W3S A;  1KSS A;  3UCL A;  4FK1 C;  5G5G B;  5BUK A;  3SQP A;  5IDZ A;  1N5X A;  3D9X A;  2V61 A;  1REO A;  3BNU A;  4D04 A;  5EB5 A;  2WS3 A;  3QPE A;  1NHR A;  3ENL A;  1LJ1 A;  2OG9 A;  1Y56 A;  4IVM B;  4IZG A;  2AR8 A;  3QSM A;  4PAA A;  1BF3 A;  1XPY A;  3GC2 A;  2GAH B;  2BXR A;  2YG7 A;  4YKG A;  1GRE A;  1WYG A;  2B9Y A;  3UOV A;  3N6H A;  1BGN A;  1VDV A;  3CXO A;  4H4X A;  3R1Z A;  3BOX A;  1FHU A;  2XGZ A;  4ADW A;  4GF7 A;  2QA2 A;  3KU9 A;  3VRD B;  4BJZ A;  3AB1 A;  1D4C A;  2J3N A;  2GMJ A;  4NEW A;  3T9P A;  2R0P A;  2FKP A;  4Y4L A;  1P2H A;  2YLT A;  1ONE A;  1KNP A;  3R10 A;  1NPX A;  2ZBW A;  1CHU A;  1X2H A;  3K7T A;  4HYR A;  3VFC A;  3HYV A;  4II3 A;  4JN9 A;  5LV9 A;  4HA6 A;  2AL2 A;  4K5S A;  4Z26 A;  4OPI A;  2QDD A;  3Q9T A;  3DG3 A;  2FJA A;  3SXI A;  2Z5X A;  3FBS A;  3V3W A;  4C3Y A;  2C67 A;  3II4 A;  4IA6 A;  2VRM A;  2XH0 A;  3CPJ G;  4H4Q A;  4TM0 A;  4E4F A;  4Y4N A;  3M13 A;  5FMH A;  3DFH A;  3ALJ A;  1PJ7 A;  3TCS A;  4U8P A;  4YKF A;  2OAM A;  1H83 A;  2WPE A;  5U63 A;  4DN1 A;  3RP8 A;  2P3Z A;  3P9U A;  4X9N A;  1KSU A;  4GGB A;  2RGJ A;  4EMJ A;  1ZMC A;  4EIP A;  2GVC A;  2VVL A;  4H2Q A;  3B6D A;  4CNJ A;  3BNM A;  1H7W A;  2XVJ A;  3VR8 A;  4XWZ A;  4H4T A;  2VVL G;  4WX1 A;  4FK1 A;  5IQ1 A;  3DK8 A;  2H88 A;  2XSX A;  3AE3 A;  3SJN A;  1PXB A;  2ACZ A;  1PBB A;  4ZCC A;  2W55 A;  5CKU A;  2WP5 A;  1GRF A;  4BK3 A;  3VR9 A;  2OFJ A;  4GAP A;  4C77 A;  4G6G A;  1CF3 A;  4OVI A;  1L8P A;  1S2Q A;  3AE6 A;  2TPR A;  3DME A;  3IWA A;  3KKJ A;  3AEE A;  3IJQ A;  2BK5 A;  2ARD A;  1TRB A;  3R11 A;  5J60 A;  3SSZ A;  1IUS A;  2PP1 A;  1E6E A;  1BKH A;  2F5Z A;  4K7Z A;  2AL1 A;  5JCK A;  3ICT A;  1MO9 A;  3ATR A;  5KVH A;  1FO4 A;  1P43 A;  3QTP A;  1GET A;  1DJN A;  2BK4 A;  3BHF A;  3Q6J A;  4H2R A;  4G9K A;  4KX6 A;  3ZLH A;  2X99 A;  4TM4 A;  3AXB A;  3OTR A;  1V59 A;  3AEC A;  3HPF A;  4M0X A;  1KCZ A;  1BKW A;  5KOW A;  4G74 A;  3NYE A;  4H2H A;  3CIR A;  1N4V A;  3CYJ A;  3AE5 A;  4MKS A;  2CUL A;  3DA1 A;  1MRA A;  4TVW A;  2Y6Q A;  2B76 A;  4BJY A;  2APG A;  4JN8 A;  1H86 A;  3C96 A;  1E1L A;  1LV0 A;  3L8K A;  3IJI A;  1GEU A;  2VRL A;  3PWI A;  1KKR A;  1ZX9 A;  3ZLF A;  3AE1 A;  1NHS A;  2P8C A;  4YSH A;  1K0I A;  3R9U A;  3NGC X;  3P1W A;  1PDH A;  3N6J A;  2OA1 A;  3A7A A;  3ES8 A;  1DJQ A;  4IL0 A;  2BC0 A;  1KD0 A;  3EAN A;  3QFA A;  2OLN A;  2EQ6 A;  1COY A;  5EB4 A;  2X8G A;  1T3Q C;  2I5Q A;  2OO6 A;  3PWG A;  2BYB A;  1F3P A;  1ZXI C;  1QO8 A;  4A9W A;  5FS8 A;  4KPR A;  2Y6R A;  4TLX A;  3SZW A;  2PU0 A;  4M6U A;  3SGL A;  4TM3 A;  3NK0 X;  4GCM A;  4OCG A;  2C73 A;  2VVM A;  1JRP A;  1GSN A;  2GQF A;  5KMP A;  3OZM A;  1MXT A;  2YQU A;  2ZAD A;  4G8T A;  2QJN A;  1MDL A;  2CDU A;  1IJH A;  3BI5 A;  3GYX A;  4UDR A;  3ICS A;  1JRX A;  3DER A;  1H2I A;  4AOX A;  3DIP A;  3VDG A;  1L9E A;  3TWA A;  1TE6 A;  3T2K A;  3SQS A;  4KEM A;  3SN1 A;  1GTH A;  3Q45 A;  1EL8 A;  1DOC A;  3V3N A;  4AP3 A;  3T14 A;  4CBQ A;  1D4D A;  2R0G A;  1O94 A;  5HXI A;  5JRB A;  1FFV C;  3DES A;  1OJ9 A;  3U9I A;  5BVA A;  1PHH A;  1TDN A;  2WU5 A;  1NEN A;  2JK6 A;  2Q0L A;  2OZ3 A;  4H7U A;  4X4J A;  1ZKQ A;  3NVZ B;  4O5Q A;  4Z1Y A;  3FMW A;  4BUR A;  4XWR A;  3AE9 A;  4A6G A;  5KNL A;  2HZG A;  2W0H A;  2OKT A;  1QJD A;  3MSY A;  1Q1R A;  3OC4 A;  4B65 A;  1F8S A;  2W3R A;  3BI2 A;  3DG6 A;  4YSZ A;  1GXF A;  5KMR A;  2JB1 A;  3ADA B;  3UOZ A;  1KDG A;  3CNT A;  4NWZ A;  2DKH A;  1EC9 A;  2PPG A;  3UKF A;  4AOS A;  3NVV B;  2WES A;  3NYC A;  2DKI A;  2BXS A;  3UKP A;  1V97 A;  3AE2 A;  2NPX A;  4U8J A;  4K22 A;  3AE8 A;  3K7Q X;  5KVI A;  5IQ4 A;  3KA7 A;  4Z2T A;  1EC8 A;  3RO6 A;  2GB0 A;  4LII A;  1H82 A;  3UTG A;  1F8W A;  1KNR A;  2OZT A;  2PSN A;  4J2W A;  4GAV A;  3AEA A;  4IP5 A;  4J56 A;  5ER0 A;  3OP2 A;  2OQH A;  1NHP A;  4HCL A;  3P4R A;  4DWD A;  1GOS A;  1CBO A;  3GRS A;  1K4Q A;  2YLX A;  3UKL A;  1AOG A;  2GDQ A;  1OEP A;  1GRA A;  1QLB A;  2GGJ A;  3BJS A;  2YR5 A;  1JRO A;  5L46 A;  1F6M A;  5BOF A;  3UOY A;  2XLU A;  3UJF A;  4USQ A;  1PS9 A;  2GQW A;  5TR3 A;  1GTE A;  1XDI A;  3FJ4 A;  3S47 A;  3DGH A;  2XVE A;  1NAA A;  3SR6 B;  2FYM A;  4OPD A;  3H70 A;  3CNS A;  3CNJ A;  2OQY A;  5JCI A;  5FJR A;  2YG5 A;  3EF6 A;  4YWS A;  4X9M A;  5G5H B;  1N4W A;  3NH3 X;  3VA8 A;  1N60 C;  1XS2 A;  4H1Z A;  5FS7 A;  3UOX A;  1XAN A;  4J1O A;  1ZDL A;  1D7L A;  1CL0 A;  3F8R A;  3ITJ A;  2GH5 A;  4H4Z A;  4EMW A;  2Q7V A;  2V5Z A;  4UDP A;  3DG7 A;  2VQ7 A;  1GND A;  1NG4 A;  2C75 A;  3NTA A;  2IID A;  3SFD A;  1JRZ A;  3TJI A;  3MQT A;  2B7S A;  2JB2 A;  5FJU A;  4J36 A;  3VRB A;  5KOX A;  1EBG A;  1PDY A;  1SJB A;  4I59 A;  2YVJ A;  3NO1 A;  1PBC A;  2YM1 A;  3G5R A;  1NEL A;  3AMZ A;  4ECH A;  3GDP A;  5KMQ A;  4J33 A;  1MNS A;  1N63 C;  4H4Y A;  2MUC A;  3I6T A;  3A7U A;  3AEB A;  4B68 A;  3D46 A;  4D03 A;  3R0K A;  4JN7 A;  2C3D A;  3UGV A;  1PBD A;  4DYE A;  3ES7 A;  4H4W A;  4LU6 A;  4I58 A;  3GMB A;  2ZC8 A;  2PTW A;  3ABV A;  2PCE A;  2YLZ A;  4OPU A;  3SN0 A;  3NS1 B;  4RG3 A;  3T4W A;  4H4S A;  4EQW A;  1STZ A;  1GRH A;  2WDR A;  1CJ3 A;  1GT8 A;  3T6C A;  1LQU A;  3QFB A;  1DOB A;  4GDP A;  3T31 A;  2B9W A;  5EOW A;  3SZ0 A;  4E6M A;  3P4S A;  4A6N B;  4E5T A;  3GD3 A;  4MGG A;  4NZH A;  3PO7 A;  2ONE A;  1B8S A;  3EAO A;  5GRT A;  4J31 A;  2QJM A;  3AYJ A;  3VRA A;  2WEU A;  4IT1 A;  3S5W A;  3UP4 A;  1GES A;  4H2N A;  5KXJ A;  1YQ3 A;  4IV9 A;  2FBW A;  3R07 C;  1MOK A;  4H2P A;  3UP5 A;  1LPF A;  4IHC A;  2XVF A;  3D47 A;  2BS2 A;  1TYP A;  4HN8 A;  4J3Z A;  3ZVH A;  3CGB A;  2DW6 A;  1CJ4 A;  2EQ7 A;  3JW7 A;  4B67 A;  2CFY A;  1PBF A;  2OLA A;  2R0C A;  4H4R A;  1K0J A;  1FHV A;  2JBV A;  4HCD A;  4CNK A;  3NHO X;  3SM8 A;  3UJ2 A;  3PG6 A;  1LVL A;  2V3B A;  2X8H A;  3TOY A;  2C70 A;  3S5S A;  3OZY A;  3U4F A;  1BQG A;  3EUB 3;  3DJJ A;  3PK7 A;  2C76 A;  2QAE A;  3QJ4 A;  3VC6 A;  4YTP A;  1K0L A;  4UDQ A;  4CY6 A;  4F4R A;  2BCP A;  2ZZC A;  1RSG A;  3I6E A;  3AE7 A;  1X2G A;  4TVY A;  2GR0 A;  4Z2R A;  2PA6 A;  3IHM A;  2WHD A;  1NDA A;  1GRT A;  3AEF A;  2GSH A;  3QSS A;  3ZDN A;  3A7R A;  2WU2 A;  4CRT A;  3AN1 A;  2H89 A;  2XCG A;  1S2Y A;  3RCY A;  4II2 A;  1TKK A;  1TDF A;  3AWI A;  4DX3 A;  3HZL A;  2YG3 A;  1W4X A;  2YVF A;  3SZF A;  1FIQ B;  4AP1 A;  1B5Q A;  1LQT A;  3GMC A;  4APN A;  3F8P A;  3UCC A;  3UCD A;  1MUC A;  3NVY B;  3URH A;  2PTZ A;  5KWF A;  4ROP A;  2E3T A;  1IUU A;  3ZVH B;  4CCQ A;  3H8A A;  1YEY A;  3AEG A;  4GME A;  5HYM A;  3D8X A;  2BCG G;  1FCD A;  1VDC A;  3KUM A;  3BSM A;  1ZP0 A;  1E39 A;  3DK9 A;  4CCR A;  3NK2 X;  4IL2 A;  3LJP A;  3MWC A;  3AE4 A;  3ALL A;  4DHG A;  3F8D A;  4NTE A;  3KLJ A;  4B64 A;  3CMM A;  1DOE A;  1ELS A;  4H50 A;  4Z2U A;  4BV6 A;  1M64 A;  3RIT A;  3UJR A;  1E1N A;  3NLC A;  4JNA A;  2WDV A;  4DNA A;  4TLZ A;  2XFP A;  1OJA A;  3NZG A;  4G73 A;  1DXL A;  4U8N A;  3B3R A;  2GGE A;  2PP3 A;  2GRT A;  2JB3 A;  4U8I A;  1EL7 A;  2FJB A;  1N1P A;  4J57 A;  1NU5 A;  5ENL A;  3T2Y A;  1P48 A;  3I4K A;  1IYX A;  1D5T A;  3FYY A;  1JRY A;  2BS4 A;  3RRA A;  2IVE A;  2B7R A;  1GRB A;  3SYI A;  3CT2 A;  4YXD A;  2PP0 A;  1WUE A;  3EPT A;  2R4E A;  4E0V A;  1XPQ A;  3KPK A;  3STP A;  1FL2 A;  3OW1 A;  3PS9 A;  2WET A;  2IVD A;  4GGH A;  1HYU A;  3AD7 B;  4O5U A;  5EU9 A;  3QVP A;  3V3O A;  1L9D A;  3FPZ A;  5M10 A;  3IJL A;  5FS6 A;  1F8R A;  4FP1 A;  4J34 A;  4B63 A;  4Z43 A;  4X2P A;  1ONF A;  4G7F A;  3UTH A;  2YLW A;  4K8G A;  5EBK A;  1IUT A;  2TMD A;  2AKZ A;  2RGO A;  2OX4 A;  2QCU A;  1FFU C;  2GR1 A;  3HRD C;  2R4J A;  3R25 A;  2GR3 A;  2C72 A;  2YAU A;  4Z25 A;  2E5V A;  3C4N A;  3H4K A;  2BAB A;  3SX6 A;  1GER A;  2O9Z A;  3TTE A;  2WQY A;  4IP4 A;  2YM2 A;  2NVK X;  2WDQ A;  2WBA A;  2OVL A;  1DOD A;  2QA1 A;  3GD6 A;  1X31 B;  4H4P A;  1VRQ B;  2A89 A;  4LA1 A;  3VQR A;  3JZU A;  3DDM A;  4YTM A;  4EQX A;  1LTX R;  1Y56 B;  4DXK A;  2R46 A;  2GGG A;  4GIS A;  5FJT A;  1Q9I A;  2P88 A;  4KWS A;  3UKH A;  3LZX A;  3UJS A;  3SFE A;  4P9S A;  3QSE A;  3SY4 A;  4YT0 A;  3DJG X;  3PVC A;  2E5A A;  3H7V A;  1JPD X;  2BAC A;  3ATQ A;  5BOE A;  1PDZ A;  5KRQ A;  2PU1 A;  3KPF A;  2AKM A;  4IA5 A;  3NG7 X;  4Z44 A;  3FIM B;  5JCL A;  1R0M A;  1YQZ A;  4TM1 A;  4HPN A;  3VCC A;  1NG3 A;  2PYX A;  2AL2 B;  1TYT A;  4JQ9 A;  3CN8 A;  3G5S A;  1B37 A;  1TDK A;  3CNP A;  4DGK A;  2EQ9 A;  2VQB A;  4OPC A;  2R45 A;  5JCM A;  1DTN A;  2PTY A;  4REK A;  2RGH A;  1RP0 A;  3BI4 A;  1JPM A;  1IUX A;  1ZY8 A;  4E4U A;  2QJJ A;  1BWC A;  3QKE A;  3V5C A;  1B4V A;  1JCT A;  4B1B A;  3KVE A;  2UZZ A;  4U2T A;  4AT0 A;  2WP9 A;  4IVO B;  1EC7 A;  1IUW A;  1CJ2 A;  4DSG A;  5FJP A;  5DBJ A;  1JEH A;  4XXG A;  3KD9 A;  1Z6L A;  2QVH A;  4EM4 A;  2XVI A;  1H7X A;  2JKC A;  3AED A;  2HNE A;  3R0U A;  2QGY A;  2GF3 A;  3NFU A;  3JVA A;  2C7G A;  3WE0 A;  2HXU A;  3CAW A;  4U8M A;  3MKC A;  2GAG B;  2Z5Y A;  4GFI A;  2XLP A;  2VZ2 A;  3MUC A;  1KF6 A;  4KT2 A;  3UJE A;  2ZZ0 A;  3ISH A;  4DSH A;  2POD A;  3CGD A;  5U1O A;  2P0I A;  2XFQ A;  3PFR A;  2R9Z A;  2XDO A;  3P0W A;  1SEZ A;  3E1T A;  1R6W A;  1OJD A;  5C2T A;  3FXG A;  4EIQ A;  3NKS A;  2YLS A;  2NQL A;  4HB9 A;  2PTX A;  1FEA A;  3UKA A;  3P3B A;  3FVD A;  1CC6 A;  2XLR A;  3THU A;  1TDE A;  2GMH A;  4NTC A;  2POZ A;  4CY8 A;  2GEW A;  2WOV A;  4PAB A;  4U8O A;  4MMW A;  1E1K A;  3CB3 A;  4U2L A;  4YTN A;  2X8C A;  1CC2 A;  4E8G A;  4YSY A;  3NN6 X;  3K1G A;  5JCN A;  1VG0 A;  4K5R A;  3CGE A;  3M0O A;  3M12 A;  2E1M A;  4JY2 A;  3DGB A;  5BUL A;  5J7X A;  5HY5 A;  4H4V A;  1ECQ A;  3SBF A;  1FEC A;  4A79 A;  1FEB A;  3ZYX A;  4K1W A;  4NTD A;  1S3E A;  3ZLG A;  3I6D A;  5HHF A;  1ZK7 A;  2OLO A;  3L5O A;  6ENL A;  2DW7 A;  4AT2 A;  3NNE A;  1YY5 A;  3VC5 A;  3AD9 B;  1N5W C;  1SJA A;  3DFY A;  4JY3 A;  1N61 C;  3N4E A;  4G6H A;  1FOH A;  2AAQ A;  5J04 A;  3P4P A;  1O95 A;  3HYW A;  3T37 A;  3GYJ A;  1TDO A;  2BK3 A;  4USR A;  1CC4 A;  3ZVI A;  4YWO A;  3LZW A;  1ZOV A;  1L9C A;  1TZZ A;  2MNR A;  3GY1 A;  3NYF A;  4GYP C;  3NIX A;  3D1C A;  3NK1 X;  3NVW B;  4ZCD A;  4U2S A;  1SB3 B;  3DJE A;  1H84 A;  4ZA0 A;  2AQJ A;  2W54 A;  3AD8 B;  4OPG A;  4N9X A;  4OPT A;  3T2Z A;  1XHC A;  3TJ4 A;  5IPY A;  3K7M X;  1E7P A;  2FJD A;  4EM3 A;  4ICY A;  4Y4M A;  1KFY A;  3B97 A;  4HNL A;  4ZOH B;  1KN0 A;  2OPJ A;  2YG4 A;  3H8I A;  2V60 A;  4WCT A;  3GDN A;  5U25 A;  2PMQ A;  1WUF A;  4RG4 A;  2YWL A;  4H4U A;  3EKG A;  2XLS A;  4M52 A;  3GO2 A;  3QN3 A;  3CTY A;  3RP6 A;  2V3A A;  4U8L A;  2JAE A;  4ZCW A;  3V4B A;  3H12 A;  1JU2 A;  3QLD A;  3COX A;  3NRZ B;  1CJC A;  3CPH G;  2WOI A;  3DEQ A;  3GYI A;  2XH4 A;  2A87 A;  2WPC A;  3ICR A;  3AM9 A;  4OPL A;  3DGZ A;  2X3N A;  2GGI A;  4B66 A;  3UTF A;  4EQR A;  2XYO A;  2CVJ A;  1E9I A;  3IF9 A;  4A35 A;  3UXL A;  2XH2 A;  4K2S A;  2PS2 A;  2X50 A;  1NEK A;  5FS9 A;  3SZC A;  2WPF A;  4ENL A;  3GD4 A;  2YG6 A;  3C4A A;  2YR6 A;  4HCH A;  2XFN A;  1Q1W A;  4BK2 A;  2BS3 A;  2VOU A;  2E4G A;  1JNZ A;  2YLR A;  2Q0K A;  2GL5 A;  3FG2 P;  1W6T A;  1F9C A;  2V6O A;  4NNJ A;  3OZ2 A;  2YVG A;  3HYX A;  2C66 A;  3UTE A;  1RM6 B;  4NEV A;  1NHQ A;  1DNC A;  4FI4 A;  3RGT A;  3T0K A;  3G5Q A;  4A7A A;  1S3B A;  1PJ6 A;  3UKQ A;  2RAB A;  1D4E A;  4B69 A;  4MJW A;  2BA9 A;  3O0H A;  4H19 A;  4GDE A;  1JOA A;  2WOW A;  1VG9 A;  4EMI A;  3NRN A;  2BRA A;  3H8L A;  2WP6 A;  3L1R A;  3CK5 A;  4H83 A;  1OJT A;  7ENL A;  1PXC A;  3P93 A;  2GGH A;  1E1M A;  5CQF A;  1Y0P A;  1EL5 A;  2Q6U A;  2RDX A;  3RR1 A;  4JHM A;  3CXB A;  3VCN A;  1PBE A;  3LXD A;  2OAL A;  1M6I A;  4A5L A;  3JSK A;  2QQ6 A;  3GRT A;  3N4F A;  3S61 A;  2XH7 A;  3IC9 A;  1L0V A;  1GV4 A;  2GV8 A;  3BHK A;  2PGW A;  1BGJ A;  1ELI A;  2QDE A;  3V76 A;  4Z17 A;  3MY9 A;  4GRT A;  1EBH A;  1BZL A;  3TWB A;  3B9J B;  2XFU A;  3DK4 A;  3NXL A;  3I3L A;  4JDR A;  4ZN0 A;  1RYI A;  2XFO A;  5M0Z A;  3OPS A;  1N62 C;  3DH9 A;  3DJD A;  1JDF A;  4GR1 A;  1RVK A;  4K2X A;  2C64 A;  2YR4 A;  3RHA A;  4U8K A;  1ZMD A;  4GIR A;  3TQP A;  3LAD A;  2HQM A;  3GSI A;  3EEZ A;  2OZ8 A;  4K8D A;  4UP3 A;  2BRY A;  1YKJ A;  3RNM A;  2FJE A;  1H6V A;  4YSX A;  3LB8 A;  2C3C A;  1O5W A;  2BC1 A;  4EQS A;  4HNC A;  3QVR A;  4BK1 A;  3MZN A;  3IHG A;  2GR2 A;  1OJC A;  3ALM A;  1ZOY A;  3FCP A;  3LOV A;  3CND A;  4A99 A;  1KKO A;  3AYI A;  4A3R A;  3RP7 A;  4C74 A;  4EWJ A;  3SN4 A;  3CGC A;  1MDR A;  2CHR A;  1PN0 A;  4A65 A;  3K30 A;  2O56 A;  2PHH A;  1GAL A;  3RED A;  2B9X A;  3UKK A;  2C65 A;  1P2E A;  2HXT A;  1PXA A;  2XLT A;  1H81 A;  4GUV A;  5BRT A;  3FV9 A;  1N4U A;  4FDC B;  1D7Y A;  2XVH A;  1GPE A;  3HW2 A;  5KMS A;  1GRG A;  3GWF A;  3UXK A;  3IK4 A;  3GWD A;  1IUV A;  4GYP A;  4RSL A;  3T8Q A;  5GSN A;  4Z24 A;  3Q4D A;  4KPL A;  1VQW A;  4C5O A;  1JNR A;  1EBD A;  4C3X A;  4FX9 A;  2EQ8 A;  3V5F A;  1EL9 A;  2C4C A;  1VQZ A;  4A6N A;  1S7M A;  3CPI G;  1YQ4 A;  3NN0 X;  5C3J A;  1SJC A;  2ZZB A;  3NT6 A; 
#chains in the Genus database with same CATH homology
 1PHH A;  1TDN A;  2WU5 A;  3NNE A;  1YY5 A;  1UKV G;  2I0Z A;  1NEN A;  2JK6 A;  1IUU A;  2Q0L A;  3AD9 B;  4CCQ A;  3AYL A;  3NTD A;  3AEG A;  5HYM A;  3D8X A;  4H7U A;  4JNQ A;  2BCG G;  1PJ5 A;  4X4J A;  1FCD A;  1ZKQ A;  1VDC A;  4JY3 A;  4O5Q A;  2A8X A;  3FMW A;  4BUR A;  4G6H A;  4XWR A;  3P4Q A;  3AE9 A;  1KSS A;  1FOH A;  1ZP0 A;  3UCL A;  2AAQ A;  4FK1 C;  1E39 A;  3DK9 A;  4CCR A;  3P4P A;  1O95 A;  3HYW A;  5KNL A;  3NK2 X;  3T37 A;  3GYJ A;  3LJP A;  1TDO A;  2W0H A;  5BUK A;  3SQP A;  2BK3 A;  3AE4 A;  1QJD A;  3ALL A;  3D9X A;  4USR A;  2V61 A;  3F8D A;  1REO A;  1Q1R A;  3OC4 A;  1CC4 A;  3BNU A;  4NTE A;  4B65 A;  4D04 A;  5EB5 A;  3KLJ A;  1F8S A;  4B64 A;  3CMM A;  3BI2 A;  4YWO A;  1DOE A;  3LZW A;  2WS3 A;  4YSZ A;  1ZOV A;  1L9C A;  1NHR A;  4H50 A;  1GXF A;  5KMR A;  4Z2U A;  2JB1 A;  5HXI A;  1LJ1 A;  4BV6 A;  1M64 A;  3ADA B;  3UOZ A;  1Y56 A;  4IVM B;  1E1N A;  3NLC A;  4JNA A;  1KDG A;  3CNT A;  3NYF A;  2WDV A;  2AR8 A;  4DNA A;  2DKH A;  3NIX A;  2XFP A;  3D1C A;  4NWZ A;  1OJA A;  4TLZ A;  3NK1 X;  3QSM A;  4G73 A;  4ZCD A;  4PAA A;  4U2S A;  3DJE A;  1DXL A;  1H84 A;  3UKF A;  4AOS A;  4U8N A;  2WES A;  3B3R A;  1BF3 A;  2GRT A;  2JB3 A;  4U8I A;  3NYC A;  2DKI A;  2BXS A;  1EL7 A;  2BXR A;  2FJB A;  2GAH B;  2YG7 A;  3UKP A;  4YKG A;  3AE2 A;  1N1P A;  4J57 A;  2NPX A;  1GRE A;  4U8J A;  3T2Y A;  2B9Y A;  2AQJ A;  4K22 A;  3AD8 B;  3AE8 A;  4OPG A;  4N9X A;  3UOV A;  4OPT A;  3K7Q X;  5KVI A;  1XHC A;  1D5T A;  1BGN A;  3KA7 A;  3T2Z A;  4Z2T A;  5IQ4 A;  1JRY A;  4H4X A;  5IPY A;  3K7M X;  1E7P A;  2BS4 A;  2GB0 A;  4LII A;  2FJD A;  1H82 A;  4EM3 A;  3UTG A;  1F8W A;  2IVE A;  2B7R A;  4ICY A;  1KNR A;  1GRB A;  4ADW A;  1KFY A;  4Y4M A;  4J2W A;  3SYI A;  4YXD A;  4GAV A;  2QA2 A;  4GF7 A;  3AEA A;  3KU9 A;  4J56 A;  3VRD B;  4BJZ A;  1KN0 A;  5ER0 A;  3AB1 A;  1D4C A;  2YG4 A;  3H8I A;  2V60 A;  4WCT A;  3GDN A;  2J3N A;  3P4R A;  1NHP A;  5U25 A;  3EPT A;  4RG4 A;  2GMJ A;  1GOS A;  4NEW A;  1CBO A;  2R4E A;  2YWL A;  4E0V A;  4H4U A;  1XPQ A;  3GRS A;  1K4Q A;  3KPK A;  2R0P A;  2YLX A;  4Y4L A;  1P2H A;  2YLT A;  1FL2 A;  3UKL A;  1KNP A;  3PS9 A;  1AOG A;  1GRA A;  2XLS A;  2WET A;  1NPX A;  2IVD A;  2ZBW A;  1HYU A;  3AD7 B;  1QLB A;  1CHU A;  2YR5 A;  4M52 A;  4O5U A;  5L46 A;  1F6M A;  3CTY A;  3QVP A;  3RP6 A;  2XLU A;  3K7T A;  3UOY A;  1L9D A;  3V3O A;  4USQ A;  1PS9 A;  3FPZ A;  5M10 A;  3HYV A;  2GQW A;  2V3A A;  4II3 A;  4JN9 A;  5TR3 A;  1GTE A;  4U8L A;  2JAE A;  5FS6 A;  5LV9 A;  1F8R A;  4HA6 A;  1JU2 A;  1XDI A;  4J34 A;  4B63 A;  4Z43 A;  3COX A;  1CJC A;  3CPH G;  4K5S A;  4Z26 A;  2WOI A;  3GYI A;  1ONF A;  4OPI A;  3UTH A;  2A87 A;  2YLW A;  3Q9T A;  2FJA A;  5EBK A;  2WPC A;  3SXI A;  3DGH A;  2Z5X A;  2XVE A;  1NAA A;  3ICR A;  4OPL A;  1IUT A;  2TMD A;  3DGZ A;  2X3N A;  2RGO A;  3FBS A;  4B66 A;  2QCU A;  3UTF A;  4EQR A;  2XYO A;  4C3Y A;  2GR1 A;  2C67 A;  4OPD A;  2R4J A;  2CVJ A;  3II4 A;  2GR3 A;  3CNS A;  3CNJ A;  5JCI A;  3IF9 A;  2YG5 A;  3EF6 A;  4IA6 A;  4X9M A;  1N4W A;  2VRM A;  3NH3 X;  5FS7 A;  3UOX A;  1XAN A;  3CPJ G;  2X50 A;  4H4Q A;  4TM0 A;  2C72 A;  1NEK A;  2YAU A;  1ZDL A;  4Y4N A;  1D7L A;  1CL0 A;  3F8R A;  5FS9 A;  3ITJ A;  4Z25 A;  3SZC A;  2E5V A;  3C4N A;  2GH5 A;  3H4K A;  2BAB A;  4H4Z A;  3SX6 A;  1GER A;  2O9Z A;  3M13 A;  5FMH A;  2WPF A;  3ALJ A;  1PJ7 A;  4EMW A;  2Q7V A;  3GD4 A;  2V5Z A;  2YG6 A;  3C4A A;  2YR6 A;  2XFN A;  4UDP A;  1Q1W A;  4U8P A;  2WQY A;  5BVA A;  4YKF A;  4BK2 A;  2BS3 A;  2OAM A;  1GND A;  2VOU A;  1H83 A;  2E4G A;  1JNZ A;  2VQ7 A;  2YM2 A;  2WPE A;  2YLR A;  2NVK X;  2WDQ A;  2Q0K A;  2WBA A;  3FG2 P;  1DOD A;  5U63 A;  2V6O A;  2QA1 A;  4NNJ A;  1X31 B;  1NG4 A;  4H4P A;  3OZ2 A;  1VRQ B;  2A89 A;  4X9N A;  2YVG A;  3P9U A;  2C75 A;  3RP8 A;  4LA1 A;  3VQR A;  3NTA A;  1KSU A;  4YTM A;  2IID A;  2RGJ A;  3HYX A;  4EQX A;  4EMJ A;  2C66 A;  1ZMC A;  1LTX R;  3UTE A;  3SFD A;  4EIP A;  4NEV A;  1NHQ A;  2GVC A;  1JRZ A;  1Y56 B;  1DNC A;  2VVL A;  4H2Q A;  3B6D A;  4CNJ A;  2R46 A;  3BNM A;  3T0K A;  3G5Q A;  4A7A A;  1H7W A;  2XVJ A;  3VR8 A;  1S3B A;  2B7S A;  4XWZ A;  2JB2 A;  1Q9I A;  4J36 A;  1PJ6 A;  3VRB A;  3UKQ A;  2RAB A;  4H4T A;  3UKH A;  2VVL G;  1D4E A;  4B69 A;  3LZX A;  4WX1 A;  5KOX A;  3SFE A;  4MJW A;  4P9S A;  3QSE A;  4I59 A;  3SY4 A;  4YT0 A;  3DJG X;  4FK1 A;  2YVJ A;  3O0H A;  2BA9 A;  3PVC A;  1PBC A;  5IQ1 A;  3DK8 A;  4GDE A;  2YM1 A;  3G5R A;  2H88 A;  1JOA A;  2WOW A;  3AE3 A;  5KOW A;  4ECH A;  1VG9 A;  4EMI A;  2ACZ A;  1PXB A;  2BAC A;  3ATQ A;  3GDP A;  1PBB A;  3NRN A;  5KMQ A;  5KRQ A;  4ZCC A;  2BRA A;  3H8L A;  3KPF A;  2WP6 A;  4J33 A;  5CKU A;  2WP5 A;  3L1R A;  4H4Y A;  4IA5 A;  1GRF A;  4BK3 A;  3NG7 X;  3VR9 A;  4Z44 A;  4GAP A;  4C77 A;  3FIM B;  4G6G A;  1CF3 A;  5JCL A;  4OVI A;  1OJT A;  1PXC A;  3AEB A;  4B68 A;  4D03 A;  2C3D A;  1PBD A;  1S2Q A;  1E1M A;  3AE6 A;  5CQF A;  2TPR A;  1YQZ A;  3DME A;  4TM1 A;  1Y0P A;  3IWA A;  4H4W A;  1EL5 A;  2Q6U A;  3KKJ A;  4LU6 A;  4I58 A;  3AEE A;  2BK5 A;  1NG3 A;  2ARD A;  2PYX A;  3GMB A;  1TRB A;  1TYT A;  1PBE A;  3LXD A;  4JQ9 A;  3CN8 A;  5J60 A;  2OAL A;  3G5S A;  1B37 A;  1M6I A;  1TDK A;  3ABV A;  3CNP A;  4A5L A;  1IUS A;  3GRT A;  1E6E A;  3JSK A;  2YLZ A;  4DGK A;  2EQ9 A;  2F5Z A;  4K7Z A;  4OPU A;  3S61 A;  4RG3 A;  3IC9 A;  2VQB A;  4OPC A;  2R45 A;  1L0V A;  1GV4 A;  4H4S A;  5JCM A;  4REK A;  2GV8 A;  3BHK A;  5JCK A;  4EQW A;  1BGJ A;  1MO9 A;  1RP0 A;  2RGH A;  3ATR A;  3ICT A;  3BI4 A;  5KVH A;  1GRH A;  1IUX A;  1GET A;  1ZY8 A;  1DJN A;  2BK4 A;  1ELI A;  3Q6J A;  1BWC A;  3BHF A;  4H2R A;  1B4V A;  2WDR A;  4G9K A;  1CJ3 A;  1GT8 A;  3V76 A;  1LQU A;  4KX6 A;  3QFB A;  1DOB A;  4GDP A;  4GRT A;  4B1B A;  2X99 A;  3T31 A;  2B9W A;  1BZL A;  4TM4 A;  5EOW A;  3SZ0 A;  3AXB A;  2XFU A;  3KVE A;  2UZZ A;  1V59 A;  4U2T A;  3AEC A;  4AT0 A;  2WP9 A;  4IVO B;  1CJ2 A;  1IUW A;  3P4S A;  3DK4 A;  4A6N B;  4DSG A;  1BKW A;  3I3L A;  5DBJ A;  4JDR A;  1JEH A;  3GD3 A;  4G74 A;  4NZH A;  4XXG A;  3NYE A;  4ZN0 A;  3KD9 A;  1RYI A;  1Z6L A;  2XFO A;  3CIR A;  5M0Z A;  3PO7 A;  1N4V A;  3AE5 A;  4EM4 A;  1B8S A;  1H7X A;  3EAO A;  5GRT A;  2CUL A;  2JKC A;  2XVI A;  3DH9 A;  3AED A;  3DJD A;  4J31 A;  3AYJ A;  3VRA A;  2GF3 A;  3DA1 A;  4GR1 A;  2WEU A;  3S5W A;  3UP4 A;  1GES A;  4H2N A;  2Y6Q A;  2C7G A;  4K2X A;  2C64 A;  2B76 A;  3WE0 A;  1YQ3 A;  2YR4 A;  4IV9 A;  5KXJ A;  3RHA A;  4U8K A;  2FBW A;  1MOK A;  4BJY A;  2APG A;  4H2P A;  1ZMD A;  3UP5 A;  4U8M A;  3LAD A;  2GAG B;  2Z5Y A;  1H86 A;  1LPF A;  2XLP A;  2XVF A;  3C96 A;  2HQM A;  1E1L A;  2VZ2 A;  1LV0 A;  3L8K A;  1KF6 A;  2BS2 A;  3GSI A;  4UP3 A;  1GEU A;  4K8D A;  1TYP A;  2BRY A;  2VRL A;  1ZX9 A;  3CGB A;  2ZZ0 A;  3RNM A;  1YKJ A;  2FJE A;  3AE1 A;  3ISH A;  1H6V A;  1NHS A;  4YSH A;  4YSX A;  1K0I A;  3R9U A;  3LB8 A;  4DSH A;  2C3C A;  1O5W A;  3NGC X;  1CJ4 A;  3P1W A;  3CGD A;  2BC1 A;  4EQS A;  3QVR A;  5U1O A;  2EQ7 A;  1PDH A;  4BK1 A;  2OA1 A;  3IHG A;  2GR2 A;  2XFQ A;  4B67 A;  2CFY A;  1DJQ A;  1OJC A;  1PBF A;  2R9Z A;  2R0C A;  2BC0 A;  3ALM A;  2XDO A;  1ZOY A;  4H4R A;  1K0J A;  2JBV A;  3EAN A;  3QFA A;  1SEZ A;  2OLN A;  4CNK A;  2EQ6 A;  3LOV A;  1COY A;  3CND A;  3E1T A;  5C2T A;  1OJD A;  3NHO X;  3SM8 A;  4A99 A;  4EIQ A;  3PG6 A;  3NKS A;  1LVL A;  5EB4 A;  3AYI A;  2X8G A;  2YLS A;  4HB9 A;  2V3B A;  3RP7 A;  4C74 A;  2X8H A;  1FEA A;  3UKA A;  2C70 A;  3CGC A;  2BYB A;  1F3P A;  1QO8 A;  4A9W A;  5FS8 A;  3DJJ A;  2C76 A;  4KPR A;  2Y6R A;  4TLX A;  3SZW A;  2QAE A;  1CC6 A;  1PN0 A;  3QJ4 A;  3SGL A;  2XLR A;  4YTP A;  4A65 A;  3K30 A;  1TDE A;  4TM3 A;  1K0L A;  4UDQ A;  3NK0 X;  4CY6 A;  2PHH A;  1GAL A;  4GCM A;  3RED A;  4OCG A;  2B9X A;  2GMH A;  3NT6 A;  4NTC A;  3UKK A;  2BCP A;  2ZZC A;  2C73 A;  1RSG A;  2VVM A;  2C65 A;  1P2E A;  3AE7 A;  4CY8 A;  2GEW A;  1PXA A;  2XLT A;  1H81 A;  2WOV A;  1GSN A;  2GQF A;  4GUV A;  4PAB A;  5BRT A;  5KMP A;  4U8O A;  1MXT A;  1N4U A;  4FDC B;  2GR0 A;  1E1K A;  2YQU A;  4Z2R A;  4U2L A;  4YTN A;  1D7Y A;  2XVH A;  1GPE A;  3IHM A;  2WHD A;  2X8C A;  1NDA A;  5KMS A;  1CC2 A;  1GRG A;  3GWF A;  2CDU A;  1GRT A;  3AEF A;  1IJH A;  3BI5 A;  3GYX A;  3QSS A;  3ZDN A;  3GWD A;  1IUV A;  2WU2 A;  4YSY A;  4UDR A;  4CRT A;  2H89 A;  3ICS A;  3NN6 X;  2XCG A;  1JRX A;  4RSL A;  5GSN A;  4Z24 A;  1S2Y A;  1H2I A;  5JCN A;  1VG0 A;  4K5R A;  4AOX A;  1VQW A;  3CGE A;  4C5O A;  3M0O A;  3M12 A;  1JNR A;  1EBD A;  1L9E A;  2E1M A;  4JY2 A;  4II2 A;  4C3X A;  4FX9 A;  2EQ8 A;  5BUL A;  3T2K A;  1TDF A;  3AWI A;  5J7X A;  3HZL A;  5HY5 A;  4H4V A;  1EL9 A;  2YG3 A;  1W4X A;  2YVF A;  3SZF A;  2C4C A;  1FEC A;  4A79 A;  1FEB A;  1GTH A;  4A6N A;  1S7M A;  3ZYX A;  1EL8 A;  1DOC A;  4NTD A;  1S3E A;  3V3N A;  3CPI G;  4AP3 A;  3T14 A;  3I6D A;  1YQ4 A;  4CBQ A;  1D4D A;  2R0G A;  1O94 A;  3NN0 X;  5HHF A;  5JRB A;  1B5Q A;  1LQT A;  1OJ9 A;  1ZK7 A;  4APN A;  3F8P A;  3GMC A;  4AP1 A;  5C3J A;  2OLO A;  3L5O A;  2ZZB A;  3URH A;  4AT2 A;  5KWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...