2PP3A

Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
395
structure length
395
Chain Sequence
SANSDAVTYAKAANTRTAAETGDRIEWVKLSLAFLPLATPVSDAKVLTGRQKPLTEVAIIIAEIRSRDGFEGVGFSYSKRAGGQGIYAHAKEIADNLLGEDPNDIDKIYTKLLWAGASVGRSGMAVQAISPIDIALWDMKAKRAGLPLAKLLGAHRDSVQCYNTSGGFLHTPLDQVLKNVVISRENGIGGIKLAVGQPNCAEDIRRLTAVREALGDEFPLMVDANQQWDRETAIRMGRKMEQFNLIWIEEPLDAYDIEGHAQLAAALDTPIATGEMLTSFREHEQLILGNASDFVQPDAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVHLHLSAAYPLEPWLEHFEWLNPLFNEQLELRDGRMWISDRHGLGFTLSEQARRWTQLTCEFGKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-talarate/galactarate dehydratase
publication title Evolution of enzymatic activities in the enolase superfamily: L-talarate/galactarate dehydratase from Salmonella typhimurium LT2.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 138
structure length 395
sequence length 395
chains with identical sequence B, C
ec nomenclature ec 4.2.1.156: L-talarate dehydratase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2pp3A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2pp3A01
4FI4A 3V3WA 2PSNA 3ZLFA 3DG7A 3RR1A 2PTZA 3TW9A 3TWBA 3RGTA 1SJDA 2ZADA 2AL1A 2OVLA 1PDYA 3NO1A 3U4FA 2RDXA 3DFYA 3N6JA 1XS2A 3V5CA 3DG3A 3NFUA 3MUCA 3TTEA 3PWIA 3QLDA 1SJBA 1ONEA 1ECQA 3ES8A 3V5FA 3K1GA 4DXKA 4GFIA 3H8AA 5BOEA 1EC8A 5EU9A 2PGEA 2GGEA 4HPNA 2HZGA 1R0MA 1EBGA 3QTPA 1MDRA 2P88A 3JW7A 4G7FA 3GD6A 2PS2A 3UXLA 4G8TA 1EC9A 4IP4A 1E9IA 2OLAA 4H83A 2PGWA 1NU5A 3N4FA 3I6EA 4HNLA 4GYPC 3ZLHA 3MZNA 3CAWA 2HXUA 2PTXA 4DN1A 3DFHA 4HCLA 3NXLA 3T9PA 1PDZA 4EWJA 1JDFA 3B97A 3Q45A 2PPGA 3DG6A 3ZVHB 3D47A 3OTRA 4DYEA 3CB3A 3KUMA 3RRAA 2QJMA 3STPA 3TJ4A 4H2HA 1DTNA 4DWDA 4KEMA 3SBFA 4ENLA 4IT1A 2AKMA 3SN1A 3MWCA 3H7VA 3TCSA 3I4KA 1JCTA 2OPJA 4H1ZA 2XH7A 2CHRA 4HNCA 1KCZA 2GGJA 3SSZA 4HN8A 3ZVHA 4DHGA 3PFRA 2PA6A 3RO6A 4MKSA 2OZTA 2NQLA 5IDZA 2O56A 3ES7A 2FYMA 3IJQA 3OW1A 3MY9A 4GISA 4A35A 1RVKA 4E4UA 2OKTA 2QJNA 3S5SA 5FJRA 5FJTA 2PP1A 2P8CA 4IZGA 1JPDX 4K2SA 3DIPA 2XH2A 4IP5A 2QDDA 3PK7A 4IL2A 3N6HA 3RITA 2OQHA 4J1OA 3U9IA 1P43A 3FYYA 4Z1YA 1EBHA 4A3RA 4YWSA 3I6TA 4E8GA 3UGVA 1R6WA 3SN4A 2DW6A 1TZZA 1MNSA 2HNEA 3EKGA 4JHMA 3SQSA 4KWSA 1TKKA 1F9CA 2PP3A 2QQ6A 2ONEA 4GYPA 3UCCA 3QKEA 1OEPA 3EEZA 3RCYA 3R25A 3TOYA 4KT2A 3CK5A 3OPSA 3R0KA 1NELA 3JVAA 3QN3A 1KKOA 3VCNA 3VC5A 3VFCA 2AL2B 2GSHA 4GGHA 1MUCA 2P3ZA 4ZA0A 3P93A 2OZ8A 3DESA 3DEQA 2OZ3A 5BOFA 3DGBA 3HPFA 4H19A 2GGIA 1MRAA 2HXTA 4DX3A 3JZUA 3ENLA 5FJOA 3QPEA 2PP0A 2XGZA 1WUEA 2QDEA 3R10A 3BOXA 3R11A 3THUA 2PU1A 3D46A 3FV9A 3DERA 2GL5A 2QJJA 3OZYA 1JPMA 4ROPA 4GGBA 3UJFA 4GMEA 2OO6A 3FXGA 3UCDA 1W6TA 3VC6A 4HCDA 3CXOA 1FHUA 3SN0A 3VCCA 3P0WA 1ELSA 3IJIA 3PWGA 4KPLA 2QGYA 2OG9A 2GDQA 1WUFA 5ENLA 2POZA 1MDLA 1BKHA 2PCEA 3UJRA 4E6MA 3Q4DA 2QVHA 4K1WA 4HYRA 3FCPA 4MMWA 3MKCA 3T6CA 3FVDA 3H12A 3VA8A 3V4BA 1FHVA 3TQPA 2PTWA 3R0UA 3GO2A 3MQTA 4E4FA 2AKZA 1TE6A 3BSMA 3CT2A 2PODA 2XH4A 3VDGA 4IHCA 1KD0A 3OZMA 5FJPA 3IK4A 2MUCA 3FJ4A 3TJIA 4JN7A 1KKRA 2OQYA 2XSXA 3N4EA 2PTYA 2GGGA 1YEYA 1P48A 3NZGA 1L8PA 4FP1A 1EC7A 3GC2A 3OP2A 2GGHA 2ZC8A 4ZCWA 3ZVIA 3UJ2A 2XH0A 3GY1A 4X2PA 3H70A 4A6GA 2MNRA 3R1ZA 1XPYA 1IYXA 4M6UA 3SJNA 3UJSA 2P0IA 3S47A 2OX4A 3P3BA 1SJCA 2P8BA 4Z17A 3BJSA 3MSYA 4M0XA 3T8QA 3TWAA 5FJUA 3UJEA 2AL2A 5J04A 1SJAA 3CYJA 4E5TA 4F4RA 1BQGA 2DW7A 2FKPA 4MGGA 2OFJA 4J3ZA 2I5QA 2PU0A 4K8GA 4GIRA 7ENLA 3UXKA 4JN8A 3ZLGA 4IL0A 3T4WA 3IJLA 6ENLA 2PMQA 4HCHA 3DDMA
chains in the Genus database with same CATH superfamily
3WK3A 2E9LA 4QITA 4I8YA 2WV8A 2J7BA 4P2VA 4L4OA 4NZ4A 4LF2A 1GOQA 3CL6A 2GR1A 5J5DA 4L65A 1XC6A 6ALDA 4GKLA 5DMMA 3ABZA 4XSLA 3DHPA 5LIWX 3OEXA 2QW5A 3ARXA 1XYCA 2X16A 5T9BG 1XFBA 5FEPA 3WBWA 3ZR5A 1P0NA 1H1ZA 4P8VA 3VFLA 3MDUA 4HA0A 5C2CA 4LA1A 1WDPA 3OIHA 2HCVA 5M1TA 1KV5A 1WPCA 4GYJA 2Y5JA 1NFGA 3OZPA 2A4AA 1U1UA 2X2YA 3OQ8A 3VM7A 4A4AA 3D0CA 1ESWA 1LL6A 1F74A 1IHIA 3GW0A 1IEXA 2J62A 3TYAA 3TAKA 1OZMA 3RMEA 1UMLA 2GQ9A 3P8IA 1O12A 3LBMA 4LXFA 4JOMA 4S3FA 2HXUA 1KBIA 3DFHA 1U22A 2XM2A 3CEPA 4XVDA 4JTGA 4APNA 1JDFA 3AM9A 5K4XA 3WBEA 4CKQA 1PVNA 3WH9A 1G7UA 1NPXA 3KL5A 4C91A 1EIBA 3DOPA 3FEQA 3NL3A 5A2BA 3LK6A 5FKYA 5D37A 5H91A 3PP7A 4L4MA 3N13A 3WQ4A 4YWIA 1TPH1 4KEMA 2VUNA 5CC7A 1N5XA 4N9DA 2OELA 1JEZA 2YFNA 5D9OA 3VKBA 2VC5A 2J8TA 2WNQA 2PWEA 1YPFA 1XC4A 4EACA 3SSZA 4AY1A 2EKGA 4MKSA 3DXIA 1X7FA 3T08A 3PZTA 1ZX9A 4C6KA 8A3HA 4N42A 1YMYA 1R5YA 1V79A 3S2JA 3O8AA 1ISVA 1VJZA 4TTUA 5I3GA 1YBQB 1X1NA 1RY0A 3CGDA 3TCEA 1W1B1 3S1WA 4BFAA 3DIPA 3R7MA 2XFWA 3FNDA 3QKZA 2Z6IA 5I78A 4WR3A 3DECA 3GRTA 1H62A 5L9FA 4P7NA 4IX2A 4OGZA 3GIQA 1L6WA 3BICA 1P43A 3WL1A 3DI1A 2ZX6A 4WK9A 1IWAA 1GVYA 2FZNA 4EKJA 4JHMA 1WA3A 4O1AA 3TYDA 5A6AA 4AH7A 5DXXA 1YRRA 1VR6A 2BZNA 3FG2P 1OYBA 4OHQA 3SFKA 2WPBA 3UCCA 4BI6A 3QKEA 1B54A 2ZUWA 1VEMA 2GQ8A 1XDIA 2OMAA 1XLMA 3PTKA 2VL4A 2QMJA 1K6WA 2F8QA 1LRQA 2FZ8A 6REQA 1D9EA 2DY3A 4NZJA 1SZRA 1JL8A 3E5BA 4RJEA 2GVEA 2XZ7A 4QDWA 3DH7A 4QG8A 1XGDA 2Z7KA 4N9BA 4J9JA 2GVJA 1W3JA 2REQA 3KXQA 4F0MA 4AYSA 4CU8A 3R58A 3H2EA 4LV9A 5AC6A 2PWUA 2EEXA 1PYFA 4UZSA 2BVTA 4JR5A 3DENA 1E6ZA 1UR4A 5U4NA 3OHMB 5HJXA 4RE2A 4W93A 4GVIA 2NSOA 3THUA 3CZKA 4J57A 1J10A 1XL9A 5AFDA 2VR5A 3HQ1A 2BV9A 2OSXA 2VTFA 2VCBA 1S2AA 1DVJA 4EXQA 2J6VA 3GXIA 3K30A 4C6EA 2R82A 4MKVA 2H8ZA 4F0KA 3QR1A 4HVXA 2D0GA 3LPPA 4GGBA 4LS1A 3G0SA 3MVIA 3IS4A 1UMYA 2G95A 3M0LA 2IMRA 1PS9A 2BC1A 4PSRA 3IUHA 3U7BA 2PUZA 1V3MA 4HYVA 1PEZA 1TTQA 4QIUA 4TMCA 3P61A 3WD1A 2QF7A 4JFUA 4H6KA 4AAJA 3W1MA 3W1NA 4FHAA 2VFHA 3K8MA 5LSMA 2GDQA 4A29A 3REQB 1VBUA 4DI8A 3UJRA 3QZEA 4MWAB 2WMGA 1Q13A 5KMYA 4PB3A 4JDYA 2DVTA 3HRDC 1OF8A 3QFWA 4FNTA 2WSRA 2BY3A 4GXMA 1TTPA 3W6MA 3L2IA 4DF2A 3ZT5A 3TC3A 3S83A 3HM7A 4JTCA 4Y8EA 1HUVA 2JF7A 4MYXA 1VJIA 4WDTA 2P5NA 1F4HA 2EPNA 3IACA 5HJYA 2QXWA 1L6GA 3UW6A 1OK4A 3VOJA 3WDPP 1FCBA 1MRQA 2XH0A 3GC4A 4WX2A 5FEXA 1CX9A 1E6SM 2J7FA 3LD5A 2HROA 4BHYA 1K7XA 1JGIA 3W7HA 3PPCA 1SO5A 4B2DD 2E5AA 1HT6A 4EQXA 3BLIA 2CESA 4HSNA 1TR9A 1TMHA 3FAXA 3TWAA 1R3RA 5FJUA 3UJEA 3MANA 1UWTA 1KCLA 3NQMA 4MNLA 3NGFA 1EUAA 3W88A 4GI8A 1GJUA 2G0WA 3EA2A 5LA1A 4FLSA 2QEZA 4FOUA 4UFMA 2Y62A 4LIIA 4Q3MA 1S3HA 2FGLA 1FO4A 1KXTA 1F3PA 3UCQA 3C2YA 3FK4A 4E0CA 4G5DA 1M3UA 3E96A 1FWBC 4AY8A 1RVGA 3BAJA 3N18A 5LNRA 3KBNA 2PSNA 3O7UA 4B9ZA 3B9AA 4DUOA 1UKPA 4LC6A 5FL1A 3PZVA 2ZZ5A 4D6EA 1IEIA 3NSMA 1PPIA 2OOFA 3VYLA 4OT7A 3EAOA 3N34A 2ZUMA 3WQFA 1WV2A 1YDNA 5IM51 1YADA 2NW0A 2DT0A 3OOQA 3CTLA 3U4FA 4NG3A 5LGZA 3R0DA 2X1UA 4IUOA 3KDNA 3ITGA 3PWIA 4RZBA 3S2LA 3QLDA 1SJBA 4XK2A 2NT0A 1REQB 3V5FA 3HMCA 4B90A 2WM0A 3ARRA 3LLFA 4TOQA 3HB9A 5BOEA 4K3ZA 2QKFA 5EPDA 3G3DA 1UZ1A 1F5ZA 3N3MA 1XUZA 3BO9A 2YFOA 3LCWA 2I5GA 1H7NA 4RUBA 4KETA 2D20A 4ZENA 3K13A 3SCTA 2VXNA 3AMKA 5G4HC 3WL0A 4B3ZA 4IIFA 3O6AA 1R46A 4O54A 1VYSX 2J7DA 1NHQA 4H4VA 2QS8A 1AMYA 1CLVA 2DVXA 1O95A 4HTYA 1JDCA 4UNKA 2ATMA 3TV8A 1UG6A 2X1RA 4V27A 3R79A 3T9PA 5M17A 4ZL1A 2ZUSA 1QVBA 3MZ2A 1Q45A 4PTVA 3BAWA 1CXEA 4DYEA 3KUMA 1YTKA 3QEZA 2Y7DA 2Z0IA 3CQHA 3CHVA 2HK1A 2INFA 1Q7ZA 5D33A 3JU2A 1JCNA 1YIXA 1ZTVA 2RGLA 3CO4A 1GOWA 4O0KA 3XINA 1IE7C 4ZXLA 1E70M 4J3WA 4PMRA 1J12A 3IPWA 3PFRA 4M56A 3ETRB 1WKFA 2Y0FA 1R2RA 3PPGA 2C6QA 1AJ0A 1IZJA 4XB3A 1OK6A 4ZQRA 4BQ3A 3GUWA 1W8GA 4GK8A 4E4UA 3WUBA 5KVIA 4AB4A 2QJNA 2EPKX 4C1NA 2DH3A 1KXHA 5FJTA 2XDFA 2GJXA 2WO5A 1EJUC 4FR6A 2F6KA 5T9CE 2QCMA 4B16A 1GOXA 4BQ5A 2Q71A 1X97A 3EPOA 3D3AA 3KDOA 4AVFA 3T40A 3S6OA 1UIOA 3C3NA 4XO7A 1T8QA 1NVMA 2OCZA 4HNOA 1XXXA 4YWSA 3AMLA 2I9EA 5CBJA 1EJXC 5D2YA 3HGOA 5C9WA 4J7RA 2PZ0A 4JQ3A 2PP3A 3R07C 4X0VA 2QCDA 3F5LA 2HS6A 3N2XA 1Q1WA 3GIYA 4LUJA 2GPTA 2V5CA 1ZP4A 3HPSA 4O53A 2ZE3A 3T05A 2DUXA 3L23A 4GACA 5C55A 2UY2A 5I23A 2Q6ZA 1F6PA 4FLRA 4J27A 1YXCA 1S2CA 1MUCA 2P3ZA 4ZA0A 4WSKA 1LBFA 2VENA 2W9MA 4NKCA 2P1FA 1EP3A 1DJIA 3ZT7A 4ICMA 3M44A 2GGIA 1S3TC 1WAUA 4LRSA 3UA4A 1UHVA 2AQOA 2TPRA 2O9OA 1NWUA 5C7HA 1MSSA 4BURA 1U1JA 2W55A 1F8IA 1IEQA 4TV6A 3E49A 4NF7A 1JDAA 3W25A 4L6DA 4GVGA 3D46A 3O0KA 3ZJ7A 4Y2WA 1LDCA 1T96A 1E1FA 1MMFA 3HPAA 3OYXA 2I56A 4PBFA 1RLCL 1XRFA 4GZIA 1DL3A 5K9CA 3ABOA 3PZGA 3M5ZA 5FF2A 3WDIA 2A2IA 2WVVA 4NZCA 3BVJA 3INPA 4Q4PA 1KM4A 3AS2A 3HV9A 3W0KA 5ER0A 1ISXA 1S1RA 3W2MA 2CPUA 5EMLA 4EQSA 3SUTA 2ALDA 2HWGA 3ITXA 3ATYA 4RV3A 1W17A 4DPPA 2CLPA 4ICNA 4UFIA 4U2YA 4QJ1A 4H8HA 1ZDLA 1UA3A 3PF3A 3T2QA 4IUGA 2X8GA 3YPIA 4Q8UA 3N9RA 2QLYA 4LQ1A 4UCFA 2ZZCA 1OX4B 3LBCA 9RUBA 7TIMA 3WBYA 4H41A 3MUIA 2IQTA 1OIFA 3CIVA 3LTPA 1H3GA 4JN7A 1R9YA 1ZMCA 4C6JA 4UQAA 4F9DA 3WMBA 2KAUC 3W81A 3HFTA 3GTXA 1VLIA 3PJWA 5HOSA 5LGXA 1U2YA 4C1KA 2XSBA 1QNRA 2NV2A 5ABHA 4QNEA 3PTDA 2PF8A 1W5MA 1QHOA 1U5HA 1R9ZA 3AZRA 2A3CA 2Y1HA 2C14A 2WQDA 3SJNA 3SURA 1CENA 1XLIA 2Q02A 3OVPA 1P6CA 1LZOA 2YXOA 2GJPA 4J3VA 5I77A 4JN6A 3H2FA 4TIMA 2YW4A 1QHZA 1YE4A 1UUQA 4H9TA 1BG4A 3OA3A 1BQGA 1ZY9A 5DMNA 4MFDA 2V38A 3S2CA 4FDCB 2DUZA 3H22A 1FA2A 1FXQA 4IISA 1ZBKA 2HISA 4W8BA 1HGWA 4RV8A 4S3AA 5DRCA 2NSXA 3ABXA 3LM3A 3RLGA 4NASA 4I9AA 3CWHA 4JQAA 3AHYA 3UEQA 1QPKA 2YDSA 3SDOA 1NP0A 4XG1A 3PR2A 3WNMA 2BCPA 1LVLA 2PI6A 4MUZA 3C8NA 4ZO9A 4XD6A 2WOQA 3TFCA 3IIZA 4HU4A 1GVQA 1UP0A 2NX1A 4H7VA 4GNVA 1DWGM 1SUXA 4UTMA 3NEVA 1Q2RA 3AJ7A 3K1DA 3W70A 4PFMA 4IMFA 4M8UA 3STFA 1D3CA 3H4WA 4F0RA 1E1CA 3TAOA 1ISYA 3MI2A 4BJHA 2C0HA 4NJKA 1KXVA 3UVAA 3WQVA 1RA0A 4AUBA 4Q8VA 2VC9A 1LLZA 3EPMA 1XLLA 4H8VA 4HD5A 4IG2B 3F2DA 1OF6A 1S5WA 3DC0A 1LT7A 3SIZA 4DZAA 3S3GA 1FWCC 4QSFA 2WNZA 1T5AA 2GYIA 1Q6OA 3WD3A 3H7RA 4IGHA 1T6MA 3GVGA 2HE8A 1NJJA 4PTDA 4DF0A 1W54A 4YVPA 2DV0A 4B5UA 2ZVRA 5JU6A 1TFVA 4HCLA 3DJJA 5HATA 4FNSA 5KETA 4QRNA 1KC7A 5GVJA 2G3NA 1NQKA 4ADSA 3RN6A 3WLPA 4P7RA 4AEOA 1EYWA 3VKKA 3A4AA 3OIXA 1KCXA 4MKNA 1VFSA 4UTTA 4LUSA 4S2BA 5D2TA 3SY5A 3GXDA 1A5BA 2AOSA 2UY4A 1CGUA 2J75A 2XFYA 4AG0A 3O6YX 4AIOA 1DJGA 3M6DA 1DPMA 2QPXA 1US0A 1CGXA 2ABAA 3MWCA 1KRAC 4O10A 5DBUA 3BZJA 3C86A 3BQ5A 3HG4A 1IQ8A 3QPZA 1E6XM 3ZR4A 4H1ZA 3ITTA 3DGZA 5LNSA 3W7GA 2G4FA 4J3SA 1AZ1A 1ZKQA 3N4AA 1CGWA 2A8XA 3H2CA 4M1RA 1VDVA 4IIEA 2J74A 1MZRA 4OJYA 2YYTA 1EQPA 1A5UA 2XU2A 4IXXA 4W87A 1DJQA 2OKTA 4OOZA 2V2DA 1GEHA 3W1RA 2CWXA 2W66A 4W86A 4JIHA 3MMDA 3FKRA 3TKFA 1E9LA 3JR2A 4RX0A 3KCJA 1MW1A 1VYRA 2QCFA 3GYCA 3SAZA 4NZ3A 3RR4A 3L5OA 3CUHA 3S5YA 4C6QA 2WHJA 3I6TA 4DLMA 2WBAA 3KHJA 3MJYA 1E5JA 3MHGA 1X6UA 3UZWA 1F9CA 4YTTA 2WKLA 4NVTA 2VX5A 4PUWA 5GNZA 1Z69A 5MKGA 2WSPA 4ZTYA 2ZA2A 5XIMA 3VK5A 2WCSA 3O0HA 3LMYA 1Z44A 5AKQA 1LPFA 4YVXA 2Z7GA 3E0IA 1I0BA 3WLQA 3AO0A 3CB8A 4H4YA 3N9KA 4YIWA 4QISA 4JQ1A 1K70A 3O15A 4GHRA 1W1VA 2GK1B 1OFQA 3QHMA 5DEZA 4O8AA 3KBMA 4JTRA 1GZJA 1IGWA 1KTBA 1WBJA 1STZA 1BFNA 3V1HA 1J79A 3WH7A 3PNUA 2J9YA 1GQLA 4RNHA 3QGVA 4UQDA 1P6WA 4PMJA 1BTMA 4J28A 2J25A 3BOXA 2WZMA 3P81A 1AG1O 2EJ1A 3EWUA 4ZQMA 2TSYA 2HE5A 5BRQA 3SIMA 4CNOA 3FV9A 1OX5A 2V2CA 4M5PA 2BY2A 2OB3A 1GKRA 3GC5A 3B06A 4Q8NA 2R1NA 4JIIX 2HVOA 3T07A 1UOZA 1XLCA 1NDAA 1HVQA 4PZVA 2EPLX 4U31A 3NL2A 3A9BA 4GC3A 3DYPA 1CGYA 2IKGA 1X8FA 2A79A 4K38A 3R94A 2BBFA 1VLWA 3L4UA 3IJIA 2J7CA 5BZAA 3E2QA 3K4DA 4NRSA 4W8LA 1XANA 1DEDA 3AUJA 1BRLA 3QHNA 1R30A 1WKEA 2CLHA 5FEZA 1O1HA 2ZUUA 3Q2DA 4O1BA 3U48A 3UZXA 2O7QA 2QV4A 4C60A 1EHAA 2WQPA 2VEFA 1TE6A 3RNDA 4IHCA 2OWWA 1QHPA 2FMOA 1R9XA 1SMDA 3KOWA 1J96A 1TB3A 3NQ2A 3TSMA 3E2VA 1KKRA 2NXGA 1YPXA 5ECVA 1J0YA 4XSMA 3E5PA 4CCDA 5EMYA 4CCEA 1EZWA 3O0FA 4IQLA 4JNYA 1THFD 4UNLA 3TC6A 1EXBA 2DVUA 3PFMA 4R3UA 2LLEA 1V08A 4IF2A 3UG5A 3ARTA 4TX9A 5F4SA 5E9XA 3GYEA 1A3WA 1W3NA 1FUYA 2H9AA 4AX6A 3CU2A 3F5JA 1W1PA 3DI0A 3C61A 4BA0A 3S1XA 4H6RA 5RUBA 1EGVA 4S3KA 1CLKA 4PUMA 3U2ZA 3WBAA 4FSAA 4GIRA 2Z6JA 1QWKA 3VNLA 3W4RA 1ZBVA 3W00A 2EO7A 1K8CA 1VFTA 3T4WA 3HN3A 2VDGA 1M7JA 3WF2A 4DWSA 2QUTA 1FFVC 1UR2A 4QQUA 4AIUA 1JDDA 1PTGA 3UXDA 3M0JA 5DBTA 1P5BA 1WKYA 1B3OA 1W9PA 5D9PA 3MC5A 4LAMA 1L9WA 5HMEA 1TWZA 3CC1A 4J2MA 4PCNA 3TWBA 6CGTA 2HQMA 5K9XA 4DM1A 1R87A 1AZ2A 1XP3A 3HPZA 4OU1A 1ZP3A 3VOCA 3DFOA 2Y8KA 1TTJA 2EQ6A 1EQCA 2WMIA 1KB3A 2JGQA 3VNJA 3Q67A 3GD3A 1YQZA 3UERA 3G8EA 5CAHA 4GO8A 4B5WA 3NJ3A 4JYDA 4DUVA 4I7UA 4GFSA 1OX6A 1UD3A 1S5NA 7CGTA 1VIZA 1R0MA 2I14A 5H8PA 2XWDA 1KM0A 2V6AA 2YR1A 1HJVA 4MY1A 5J8LA 4KESA 4F0SA 4JY9A 3M0XA 4JKKA 1X6LA 2REQB 4GNJA 5BRPA 1KBBA 3W7CA 5G4EA 3SW6A 1XBXA 1OG0A 3O05A 2ZRVA 4AZCA 4O50A 3LV5A 4MZ1A 4QSHA 1ME7A 3IJ6A 4GABA 5D2WA 3GH4A 1HNYA 1XIFA 2OZ0A 2ESCA 5AC7A 1UR8A 2PPGA 1G1YA 5AECA 1NHPA 1QCWA 2OU4A 2C13A 3FHQA 4IJBA 4H2CA 1W2VA 2FH8A 4OKDA 3PJUA 2PDGA 3AC0A 2W62A 3GHSA 4W9TA 4L9XA 1UD8A 4L4PA 1C91A 2PDKA 3GE7A 1VHNA 4DPQA 4DM2A 4JQ9A 3VIFA 2HPMA 2VFEA 2H8XA 3FLUA 1XBVA 4U3CA 1KWKA 4AMCA 4WQ6A 4ERGA 3M5XA 2B7OA 1TQXA 1XD1A 2E8ZA 1C3FA 2VEGA 4LVFA 1WZMA 4RDZA 3F4DA 1IXOA 2EPOA 3C4UA 4GISA 1RVKA 4EVZA 2E40A 1AW1A 1PAMA 1CYGA 3MUXA 4AEEA 3C0SA 1DJZA 2POTA 3P0XA 2PP1A 3B8WA 1E4NA 1H09A 4K2SA 1HX0A 4BCEA 3GKFA 2YA0A 3UNTA 4X61A 4UC5A 4D6FA 2R9ZA 1FVPA 1LTDA 2NPXA 1H4PA 5CEWA 5A8QA 5FF0A 1JQVA 3CUZA 1DJNA 3G6MA 2VC7A 1WDWA 4ZB2A 3EWZA 1WOBA 5DCEA 3E0FA 4LYQA 3PZUA 3GXNA 4GOAA 3CUJA 3WENA 4MLJA 3DFQA 3ITVA 1AD1A 2DFAA 3W2JA 4J4KA 4DWSD 4I90A 2WJEA 4O52A 4D8AA 4P5UA 4R85A 1UH2A 3CK5A 2QVNA 1LG2A 2VFFA 3OVQA 3AWOA 3PUOA 3C5QA 4KW2A 4PUUA 1DQWA 3V7PA 4PUJA 2F9RA 3FDKA 3W73A 1A5OC 3VIMA 1KW1A 2F84A 2OYMA 5A8PA 3BAKA 4Y9AA 1HIZA 2BVWA 1G0CA 3OG3A 1GQKA 1V97A 4ZSUA 4GVHA 4QX4A 4WJEA 1MWOA 1Y8BA 5HWMA 2E3TA 3C2VA 4NAFA 2DZVA 3AU2A 2V3EA 1IGSA 1BG9A 1UQZA 4JFTA 3DGHA 5FSDC 1XIMA 1OSEA 2ZDRA 1PZ3A 3KBJA 3APYA 3B40A 4NNCA 3M6YA 2QUUA 4LJ3A 5A6SA 4M7SA 3GD4A 1F4AA 2H6RA 1TA3B 3W86A 4JEJA 2BG5A 5CLTA 3AU6A 2HDJA 3LQGA 2VD9A 4W7UA 1C29A 4PL2A 4QS6A 4YCPA 1XSIA 4UUIA 4W88A 4TVWA 4YNGA 1MEHA 1M04A 5KINA 4NILA 3L5LA 4QS5A 2H90A 3LX9A 3G2GA 2OKOA 1DJHA 3EB2A 1ADOA 3QV8A 1PCKA 4DWSC 3EDEA 2V5KA 3P0WA 3SQMA 3WFLA 2ZA3A 4EE9A 3IIXA 3VGBA 4R27A 5FCZA 1FWEC 1UJPA 4GYKA 2RABA 1OHLA 3OBKA 1NEYA 1JUBA 1HP5A 4UZUA 3PUDA 5ABGA 1MUWA 4LALA 1B9ZA 1AMKA 2CETA 1KGXA 3N9SA 3WEOA 1KA9F 3NWRA 4CLMA 2FZ9A 2V3DA 3OHIA 2WM1A 2G3JA 3V4BA 4AQLA 3TYEA 2QMKA 1P0BA 3UG3A 1KM5A 1Q65A 1ZL1A 2CBJA 4LUYA 1ODUA 1EJ7L 2PODA 3H2OA 1RD5A 3TQKA 3CGCA 1ZB5A 3N4EA 2ZRUA 2PDFA 1C8VA 1XH1A 3II4A 1QATA 3S4TA 4UQEA 3RLUA 3N1AA 2X50A 4XKYA 1QK0A 4DZ5A 1JI1A 1KFEA 1M7XA 1CDGA 4QAIA 4CN6A 2C3ZA 1VH7A 2EPMX 3BXWA 2YCEA 1FIQB 2B7PA 2BMBA 3L5MA 3UJSA 4KH2A 1TVLA 3S47A 1JZ4A 3MI6A 4H7ZA 4Z17A 1Z6KA 4M0XA 3NDYA 1GEQA 2PTDA 1OADA 3CIXA 2ZUNA 3ZWSA 4WDUA 2IQ0A 4TVDA 3B03A 2ISSA 2GR3A 2TMDA 5D02A 2I9UA 3S2MA 1RCQA 3RIKA 1I1XA 5FA5A 1H7OA 1VFOA 3EPNA 3IJLA 3PS7A 4S38A 4BS0A 2PDNA 4ACZA 3DDMA 4J56A 2PDYA 4KWOA 1K1DA 2D69A 1ADSA 5K7JA 4H4SA 4GBUA 3DJGX 3EXTA 4A8RA 3QY7A 3AHVA 1I2RA 2X0HA 3KLLA 1SJDA 1CXIA 4JFWA 4PSPA 5HUPA 2WPGA 2WMKA 2CZVA 3EBVA 3W1TA 1GSNA 5HR7A 2V3BA 3MT1A 1V6TA 3S0CA 3N2CA 2ZUVA 3RNMA 3L4ZA 6TIMA 4NX5A 7TAAA 1J2BA 1ZUAX 4YN5A 2YVJA 3ZFHA 4OUIA 5C70A 2V82A 4AC7C 3KL3A 2VELA 4KRZA 4JD4A 4D6JA 5H8MA 3W2UA 2VYOA 2HEJA 3OLIA 3QYQA 1Z41A 2B4GA 5LA0A 4BV6A 3N4FA 4DO5A 3ZJ6A 3B8UA 1I8JA 3BG3A 3EX3A 3S1UA 4HNLA 3APTA 5F2MA 2Y8UA 3MZNA 2FVKA 2PTXA 1PCWA 3TNOA 5D2VA 4ATLA 5LNUA 3UGRA 3D5HA 1EL3A 3DHUA 2V5JA 5C7VA 1Q6LA 2V69A 3MMUA 4QDMA 1GOOA 2Z1VA 1QBBA 1S2UA 4Y7EA 3LZ5A 4DO7A 1UH3A 1K4GA 2PZNA 4YTRA 4MLRA 1O1ZA 1WNOA 3BGAA 3L0KA 4H2HA 1A50A 5G1TA 1W3KA 1BGGA 2GQAA 2WKGA 1XLHA 3DYOA 1B57A 2ZXQA 2ZYFA 5F1UA 2XH7A 4X2RA 2XG9A 4Z42C 2PWDA 4DHGA 3WQGA 1XKJA 2I57A 1A5MC 2DIKA 3PG9A 5HNTA 4LTSA 4Q8MA 2R14A 3W29A 2VX7A 1M1BA 3IJQA 1EX5A 3B4UA 1GJPA 2YX0A 1Q4NX 4IGMA 1GPWA 1W9VA 2A3HA 3S42A 3W24A 3VIPA 1VPQA 1EEXA 2NUWA 1ITQA 4Q7IA 1SSGA 2XH2A 2CZFA 4EIVA 8TIMA 2ZTJA 3N6HA 9CGTA 2FMNA 1QBAA 5FF4A 4J1OA 2GQ3A 3U9IA 4GE8A 3ZJKA 1B3WA 5HBFA 2FZDA 1V5XA 4MFEA 3LU2A 4CD7A 3C3UA 3BPWA 2B31A 1GRHA 1YBQA 4QDPA 2WMHA 5JCNA 1VENA 4GR1A 2D2HA 1XJBA 2V67A 3RJYA 1UWUA 1VQZA 1XF0A 5JIPA 1BWLA 2ZRXA 1LUCA 2G96A 4C90A 4HIBA 1M01A 3SCPA 1WZKA 3TFXA 1V03A 1EP2A 3RFAA 1GGOA 4F3HA 4I9JA 3ARUA 4HSOA 1ZK7A 2NV1A 5BOFA 3I10A 1VFLA 4GNKB 5M3WA 1E55A 1SZNA 2BNJA 3MB9A 1Z89A 5TQLA 3S1VA 4WD0A 2J78A 2WJFA 4ASTA 5LIYX 2ZFAA 3HGSA 3TSBA 2WHMA 1OGSA 2GOUA 4AZBA 1E3ZA 5AVHA 3G8RA 3FY1A 1VCVA 3VNDA 4H50A 1GCYA 3W85A 1XRSA 1GG0A 1E0VA 4GWEA 3PBWA 1K03A 1KV8A 3NQEA 3OZYA 3GQYA 3SR7A 4QLLA 1GTHA 4DBEA 1JPMA 3C56A 2IPGA 4B9YA 4Q4OA 3DK4A 1TCMA 1QNQA 4Z2GA 4OV9A 1H2IA 4OBSA 1Q1RA 5D32A 3FXGA 1ZPTA 4NY2A 3PG8A 2B81A 3M43A 2DT3A 4HU0A 4NQ1A 2OTDA 4XZNX 1TSIA 4FIRA 3CGTA 3SRDA 1DXEA 1SO6A 3NZPA 3A7RA 2PDQA 3N2MA 2NVDA 5I07A 1I60A 4OE7A 3Q4DA 1TJ2A 4KCWA 4ZODA 1JF6A 1AQFA 3UZZA 1XV8A 1H60A 1SO3A 4LYRA 1RD6A 3UESA 3PZMA 1FFQA 4CQAA 2V63A 3THDA 4Q8QA 5DRIA 3WNNA 4PBGA 2JE8A 3WQCA 5DMLA 3CPRA 3B9JB 1YNQA 3WLIA 3HG3A 4IQDA 3LB0A 2J47A 1XICA 3O6DA 1WYGA 3UWWA 5G4WA 4KCUA 1V93A 3WEMA 1E56A 2VRJA 1QW9A 1Z3NA 1GUVA 4V15A 3KWXA 4CQBA 1XI3A 4XAFA 6A3HA 4DLFA 3GY1A 4AX7A 2PDIA 3EB3A 4LVGA 3H70A 4DYKA 3EKZA 5I3KA 4KEVA 2XIMA 3RILA 3QRHA 5F4XA 1AH0A 4AWSA 1A3XA 3RJXA 2FQIA 1I4NA 3FDGA 3GM8A 1JI2A 3TW7A 2WANA 1OVDA 2HK0A 1RA5A 4E5TA 4V28A 4F4RA 4GUIA 3FKKA 2PBOA 3R6IA 3HTWA 1OQFA 4Q32A 1A49A 2PU0A 3MYPA 2F61A 4K68A 1IR2A 4GZJA 7ENLA 3U2CA 1TZ9A 2CLOA 3WZ0E 2C16A 3UWUA 3TNBA 4DZIA 4NX0A 3QFAA 3Q58A 3DFSA 4HBKA 1JCYA 1TJ1A 5D9NA 5I79A 5IHRA 3M16A 2ZE0A 1JD9A 2QCHA 2WHLA 2PTZA 2PDCA 1HP4A 4KCVA 1W37A 4OWGA 2YCLB 3W1UA 1PO9A 3VCRA 1PDYA 4G56A 3DFYA 4ZB5A 1CEOA 1UZHA 2CWNA 2QF8A 4JZ5A 1IWPA 3ZWTA 1CXHA 5JCIA 4F8XA 3CWNA 3HGJA 1J6OA 3PBGA 3TVAA 3ALFA 2INZA 3ISIX 3PHAA 5MKGB 1D7KA 1XM3A 3W7KA 4DO4A 1H5VA 5EU9A 5CPOA 2VZTA 5HNRA 4WCJA 5FAJA 5BU9A 3BV4A 5C54A 4TU1A 2OODA 1WDDA 3W3OA 3UZ5A 2DQWA 5JUVA 4RDVA 2HVNA 4PCTA 3OGSA 3QW3A 2OLAA 2QPUA 1T0OA 1REQA 4RZ5A 1UWRA 1HFBA 4WSJA 3AZTA 1E71M 4QXIA 3ZLHA 1VRXA 4XBSA 3CAWA 3CZEA 1PDZA 4EWJA 1R3TA 3DKJA 3T42A 2Q8ZA 2J7HA 1EP1A 4BEUA 3UF9A 4CEXC 4MAZA 1FCVA 3MKVA 2PDLA 4XZHA 3F7JA 4PE8A 1OYCA 3CB3A 1BGAA 3UZJA 3HO8A 3VDAA 1L6FA 1DTNA 1K8ZA 1ME8A 1QMLA 3WLHA 2DZTA 5FJJA 2VWTA 3SBFA 1HKMA 4I9MA 4KFNA 3I4KA 5FF3A 2X2GA 2W92A 2AAQA 4XZBA 3OGRA 1EJVC 5E0CA 1G69A 2JIWA 4LCSA 1TX0A 1R3VA 1SFSA 1VFMA 4MWAD 4R88A 4D6HA 3AHZA 2J77A 4AZGA 3WNLA 5B7YA 1UB3A 1JRCA 1MQQA 3IANA 3NUKA 1GWJA 3ES7A 1Q4WA 3BQ6A 1MW0A 3PBYA 4OFCA 2FH6A 4KCTA 1ML1A 1T3QC 4O18A 3PG6A 4DVOA 1QO2A 3L21A 3FSUA 3VZZA 4FX6M 4JGDA 1A4LA 3FIGA 1H7RA 1H11A 3LGEA 2WP5A 4ZOEA 4JYFA 2FHFA 5TIMA 3AMCA 1WDRA 1TPUA 4Z1YA 5XINA 4WY0B 1MVYA 2PDMA 3IVSA 1QOPA 1R8LA 2OGYA 3MWAA 1X1ZA 1TKKA 3W07A 1DXLA 1FWJC 4PMYA 4FA3A 1PB0A 1ZS2A 3IUIA 1NFPA 4UOQA 1X2HA 2H9AB 1UP3A 2V5DA 3SCOA 3UPBA 3RK8A 1XSJA 4RXGA 4WOZA 3I4EA 3NM3A 1NARA 4GUJA 1KWGA 2PWHA 4MWAC 4XBKA 2E3ZA 4P7OA 3TP4A 4ROQA 3I3EA 2OEJA 4B5SA 3AYSA 1QI4A 4LAOA 3NURA 4MJ2A 4EMIA 3CV2A 3OBEA 2P53A 3U3HA 2RDWA 3ENLA 1WO2A 1XQKA 4GIYA 3DU0A 3MP3A 5HWNA 3TYZA 1A5SA 3WSUA 3MU7A 1QU4A 2RH9A 1XINA 4OOUA 2VFGA 4YLWA 4UFKA 1KR1A 4AY7A 4DF1A 2YPIA 3FA4A 5AY7A 1KTCA 3GXPA 3G24A 1NY1A 3ZSSA 1K77A 1DHKA 4CD4A 3CLMA 3IIOA 4XZMX 4ML4A 1WBHA 3PTQA 3W2LA 4GMEA 3Q6JA 1GVEA 1KM2A 4S3GA 4KKXA 2Y63A 2CBUA 1SFLA 1XX1A 4JEQA 2XYLA 2IKIA 3OLGA 1KFCA 3DX5A 4W5UA 4N4PA 5CQ1A 1ECEA 4Z2HA 1YQ2A 4IPIA 1DORA 4H4PA 3G1XA 4XZ9A 2D24A 4A8NA 5I5RA 2PFHA 4K1WA 2JFEX 1DWIM 5A6KA 3LUTA 3WDQA 2PEVA 1FFUC 3VA8A 1F73A 1SZEA 1NHSA 4B4HA 2W91A 3ZZ1A 4HHLA 2PTWA 1GVFA 1V8EA 3MQTA 3P62A 3P67A 2YAUA 1G01A 5CPTA 1PX4A 2QDGA 4WZHA 3CT2A 3NG3A 3MI3A 1WZLA 1KLZA 4LNYA 4K7VA 4QFUA 1KQYA 2VC6A 2MUCA 4PBEA 2CHNA 4PR4A 1QASA 1MOKA 3OP2A 1Z7AA 4ADUA 4EPKA 1AVAA 3USZA 4UIOA 2VD8A 2ABBA 3O3RA 1JPHA 3QYSA 2ISFA 4LCQA 2C8NA 5GJMA 3WG6A 4TVYA 3LHTA 1QDSA 1DV7A 2DJXA 4PL1A 1OX4A 3M5VA 4R53A 2DIJA 3GH5A 3TZFA 4W85A 3OZOA 2FPVA 5K2ZA 3T8QA 1WQ5A 2H3DA 2JIEA 1MZHA 3CYJA 4GYFA 4S2CA 2OOGA 4EXAA 1W1TA 1UKSA 2VEPA 3BZGA 5H2ZA 5D8WA 3NQFA 3AOFA 2EQDA 1NHRA 2DJLA 2BS9A 1EWDA 4LY8A 2AAAA 4EPBC 4A3YA 1EX1A 3E74A 1QR7A 3UWZA 4IFRA 3LCHA 3K4AA 1PTAA 3N15A 4LF1A 3BLFA 4EX4A 4UFJA 4KRUA 4E4PA 2W27A 4QCFA 3NM1A 4L7ZA 3W7IA 1RV8A 4IM4A 4J40A 4JQ4A 1JZ5A 2PF0A 2SFPA 4JTQA 3AN1A 1V02E 1JRPA 3N14A 3BGGA 3V0SA 1QOXA 1AH4A 2D2OA 1F07A 3TTEA 3KVLA 2F7FA 3M7SA 5KZDA 3V16A 1IR1A 2NX3A 3NQAA 4LW7A 3CZLA 3EGJA 4AFYA 2E9BA 3VU2A 3SB0A 1A3HA 1W3HA 1S5TA 2Z29A 1HJXA 2YLAA 3UYCA 1DJXA 5DN1A 4O14A 2IUZA 1W5QA 3AI0A 1IT0A 1H2JA 2A1YA 2Z00A 3VGGA 4GI6A 1M53A 1GVOA 1ZCOA 4FPSA 2VWSA 4AZ5A 3WFAA 5AC8A 1VIWA 1LLOA 4IIGA 2QIIA 5CGTA 1AD4A 2WOIA 1C7SA 4H83A 3BGJA 1VCGA 3E0LA 1J0KA 2IQDA 3G3MA 3VMPA 2QHAA 2EBNA 2EGZA 4RZ4A 4BY3A 3AHTA 2IXVA 2YBTA 4IG2A 4DN1A 4A22A 3URAA 3NDOA 3WK2A 2QYGA 2QDHA 4WLCA 1V02A 2CLIA 3LTYA 5CJNA 4N9CA 3F03K 3ZVHB 4JICA 4XWUA 1RQHA 1VQTA 2XVLA 4JTEA 4GH3A 3EDJA 1GOKA 4RK8A 5EA9A 1L0PA 4K8HA 2BWGA 3GG7A 3SN1A 3W2NA 3RO8A 2PCQA 3BE7A 5DCDA 4ILSA 1J6PA 3BC9A 1DE6A 2QGHA 2IKJA 3G22A 5M2FX 1K7FA 4KFPA 4QG9A 1KR0A 1TWSA 5BU6A 1KO0A 3NQ7A 1EOMA 3CHCA 2Z4GA 5CPQA 3S6TA 2HTMA 1EGMA 3RO6A 4JTFA 5H1WA 3LY0A 2CFFA 3F4VA 1YKWA 4QLKA 2HJPA 3PBVA 3TTSA 1JZ2A 2QCEA 2ZOXA 2IW0A 5LA2A 1PXGA 2Z1XA 3QY8A 2PWVA 3ABRA 4JX4A 1YLVA 3GDLA 1R86A 2HQAA 5AHIA 4IPNB 3USBA 1TPEA 4UQ9A 5BYWA 4H3DA 1GXFA 1ZJBA 1ZBWA 5HNNA 1WX0A 3PZQA 4AF0A 4I3GA 1G9HA 3A3XA 3VXGA 2W67A 2R24A 3UGVA 1FCUA 3NSXA 2HNEA 4FK9A 5AYIA 1XYLA 1WE5A 3DHDA 4PB4A 3GTNA 2YVFA 4GY1A 5ABEA 3B9EA 3RM4A 5AHEA 4US5D 3SFWA 3CASA 2B7QA 4IXHA 3HMJG 3HGRA 1XH2A 3N2BA 4H9ZA 1C93A 4KWWA 2Y5SA 1Y5WA 4HHPA 3VC5A 2E1WA 2XFRA 3CHEA 3W23A 3SCQA 1TRIA 3NSNA 4OZOA 2DZXA 2W0HA 1J9YA 5AOUA 5REQB 1XDLA 4KEUA 2E5BA 2VUYA 3I7RA 3A7UA 2OZ3A 2JKPA 1NFBA 1KFBA 4EMJA 3C52A 1MRAA 3VINA 1I0DA 3QY6A 3DFNA 3TTYA 1U30A 4JL2A 2D73A 3MUY1 1HZYA 4M52A 1JGMA 5KEZA 4ACZB 4DJFA 1SSDA 2A7RA 4ZQCA 1W3IA 1RY8A 3IK2A 3OBAA 1TTIA 1E72M 2B0MA 2YJQA 1CCWB 3G1YA 1PHQA 4YCOA 2EQ8A 4E2DA 1E40A 3W87A 2GK1A 4JIPA 1YYAA 2FTWA 4W8AA 1OT1A 2ZX8A 3FJLA 1EO5A 4MUPA 5AB3A 4X3ZA 4NAEA 3RRXA 2O4QA 4QG6A 1SW3A 5CLWA 3CXOA 4RNIA 3KZSA 1OJTA 1RP9A 5J5RA 1ELSA 3EZ4A 3G18A 4NZ5A 1LL4A 2ZX7A 4IPJA 2E28A 2W3RA 1OC7A 1GQIA 3V35A 1CIUA 2WKJA 1PIIA 3FCPA 3S9IA 3MKCA 5D09A 4JNMA 4W4QA 1EJSC 3CZ8A 2QR6A 4YYCA 1P1XA 4XIMA 3P82A 3OLEA 4DYJA 3DH9A 2WC3A 2FTYA 4NRRA 4EAMA 5BXTA 2WWDA 4MJZA 3VDGA 4EM4A 6XIMA 1Q6DA 1KD0A 3H53A 1BQCA 1VGAA 3IK4A 4RNFA 3GBDA 3SCSA 3TJIA 1UBPC 4ZQPA 4M3PA 3DBPA 4XTIA 3UPMA 1YEYA 3JS3A 3QSRA 2IPFA 4QHRA 1UASA 2NQ9A 1FP8A 3IAQA 3T0BA 3KX6A 4FOJA 3PN8A 3GU2A 1LWIA 3GHTA 2E0PA 4CQ8A 2BOGX 4UTIA 5AC5A 5I3DA 3M1ZA 4YPJA 3C0LA 3M0MA 5BXPA 1YX1A 2CYGA 1LCOA 1NM9A 3F5KA 1GNXA 3EYPA 3HV8A 3N3TA 1BLIA 1F3EA 2AL2A 2PDPA 4BZYA 3FXYA 1R3QA 3LDVA 1UKTA 4UWMA 1R2TA 3UXIA 4Y9MA 1O60A 1NDZA 1LYXA 3CZJA 1OC5A 5PTDA 3WD0A 4WRHA 3BANA 3CMGA 1J5SA 3H26A 5AZ0A 3PSWA 1Z9AA 1OGBA 2YZ5A 2VRQA 3CO8A 1CGVA 1J11A 2ZZ6A 3PZIA 4JHZA 1DOSA 2VO5A 3DFTA 3QBUA 4J5NA 3W1PA 5T26A 2X1SA 3ARYA 3VDCA 3VOGA 3HPXA 3WO8A 1DQUA 1US3A 1FBAA 3L4WA 3ELFA 4V33A 3GFZA 1XLBA 3GHRA 4W84A 1AQ0A 1ICSA 3RGTA 1YHTA 2CZEA 2OVLA 3BMVA 2RDXA 4KIEA 1TZ7A 3EX4A 5AVNA 1AA1B 4Q22A 1UR0A 3SCWA 3DCPA 4IMGA 1QRQA 1V3LA 1UYQA 1B3XA 3RPTA 2A6LA 3FEMA 4HZ7A 4DJFD 3LHUA 4AU0A 1LUCB 1EO7A 3HU7A 2Y61A 1J0IA 3QFBA 3NO3A 1XIGA 3AJXA 4OIFA 3QH2A 2HZGA 2QUNA 4W89A 2DZUA 3VUSA 2FHBA 4Y9PA 1XDJA 3JW7A 4MB4A 3V0TA 2CC0A 2AMGA 2YCJA 1EUNA 3WELA 3W7RA 1XBZA 1XIIA 4HHHA 5FEWA 1JYNA 4YU1A 1RP8A 3IV8A 1ITUA 5GJNA 3ZQ9A 4P7QA 1XKYA 4QCEA 1GRBA 1CB7B 3CUIA 4ZXOA 5CZJA 3AS0A 1XRVA 2FGZA 5BCAA 4QLJA 1FFRA 1HKWA 1X39A 1LRTA 1H63A 3G1FA 3IGSA 3U2EA 3LRKA 3SCNA 1TWIA 3PY2A 4L9ZA 3VZXA 4C6MA 1TJPA 1KRCC 4D1IA 1SB3B 1TCDA 5EBUA 3VOFA 3QTGA 1CBGA 1TQJA 2YB4A 1H1YA 4M81A 2ZWYA 1P0KA 3ID7A 4HZ8A 5A8GA 4MJMA 2YL8A 2GJRA 4CQDA 1OWQA 1R85A 1UP2A 1EDTA 5CSRA 1FWHC 5C2XA 4XKMA 4ACYA 3KOZA 5GNYA 3SUVA 1TMQA 1PV8A 1ZJHA 4JTHA 4DJFC 4AMAA 3ARPA 3GU9A 1QI2A 5I2UA 1UD6A 4EOUA 1HL8A 1I75A 1QO5A 2NQLA 4B5NA 4HNTA 1VEPA 3TJLA 1RLDA 1Q85A 3KW3A 3LHVA 2ICSA 4MB1A 3W7EA 1I1WA 3BAIA 4JDRA 1CWYA 1B90A 2GJLA 3MSDA 3RM8A 1XPGA 3UBPC 4MB3A 4IL2A 2FDMA 3LG3A 3HF3A 1CXLA 3QXBA 1ONRA 5GJPA 1HJWA 4UMCA 4HZ6A 4UR7A 2V8ZA 5H6HA 2D0FA 4U10A 4NEWA 1N60C 2PLJA 4F2TA 2CLFA 3O9NA 1BF6A 4UTJA 2DW6A 3AIRA 2WZEA 2Z28A 3M47A 1V3JA 1TPB1 1GJWA 3D9XA 3EDKA 1HVXA 4GYPA 4PCPA 3W22A 4D6DA 1E6RA 3A23A 3BTNA 3R25A 3HOJA 3VOIA 1LT8A 1OFOA 4K7YA 3QSTA 3PUGA 3IJ9A 4LGXA 1UR1A 3QOKA 3LXCA 3DEQA 1K9TA 3DGBA 4H00A 3HPFA 3F1QA 2C0AA 3POCA 2WNWA 2P10A 4LPCA 4X22A 4DB7A 2E4TA 4G1KA 3T1GA 3OJGA 2XWEA 5DQPA 4RE0A 5A6TC 5FJOA 1WUEA 3RYSA 4F2UA 3WY1A 3L5AA 4O4WA 4HPGA 4YHGA 4YJ5A 4AD3A 4HK6A 3W2KA 1P7TA 2FB3A 4HMNA 5E9AA 4XUYA 1TYTA 1KFLA 5T91A 3OB8A 3GWQA 5HR6A 5I3JA 1HW6A 3DERA 3JUGA 2QJJA 4BEQA 8CGTA 2E6YA 4FR1A 4WKFA 5LXEA 1GQNA 4ZSTA 3QQ0A 5HNUA 5BOOA 3OO2A 4WSHA 5D8ZA 1V3HA 2XN2A 4HCDA 3LXDA 2GUYA 5ABFA 1CGTA 3CYVA 3KAOA 4PYSA 1FECA 3EUB3 1TA3A 3ECQA 4GG9A 2CZDA 2GDVA 3CS2A 3G77A 2DPEA 3GKAA 4TR9A 1RAKA 4B5VA 3BJFA 4Q7NA 2POZA 1RJRA 4A8IA 1MDLA 2OQLA 5JCKA 1OBAA 2VFIA 4GY0A 2RFGA 1WYIA 2QVHA 3PJTA 2VRKA 3IEBA 1QI5A 4UFLA 3TN5A 4HYRA 1RPXA 2HMCA 1N8IA 3T6CA 1TIWA 4WOQA 4M29A 4O57A 5D2XA 5CZTA 1XG3A 2D3NA 3G1AA 2Y7FA 4UOZA 1B4EA 3BW3A 4UNIA 4YL2A 5CSUA 3CEUA 1QOQA 2XH4A 2WAGA 2ACSA 3W7LA 3O1NA 3W76A 3DK9A 4B3KA 2A3LA 4K39A 1S7MA 3WLSA 1O6IA 2XIJA 1PWMA 1ME9A 3BAXA 3FS2A 5E93A 3FJ6A 1WCGA 3G1SA 4AD1A 4A6GA 2VOMA 3TYCA 3GDTA 2BXZA 3R1ZA 4DRSA 2VOTA 3HA1A 1CT5A 2RKXA 2VCCA 4YMZA 3SI9A 1RHCA 1J4EA 1NF0A 2I1OA 2MANA 3L4XA 4CGTA 3AXXA 2JQXA 1O5XA 4HGXA 4JTKA 1P0DA 3C6CA 3PB2A 2ZICA 2E7FA 1B5TA 4MGGA 3JRKA 3LRLA 3NQ8A 1RK6A 3V36A 4LAKA 1D2KA 2GWGA 2W61A 3ZLGA 3GH7A 3WK1A 4HTBA 1LQ2A 4HU8A 1L2QA 3BLLA 3WX7A 3FYPA 3BW4A 1VHCA 3ZLFA 5LZLA 1DIKA 3W75A 3FA3A 1UWSA 4JFSA 2NXIA 4B5XA 3TW9A 4ES4A 3WMCA 4LFYA 3IRSA 1MO0A 1FH8A 1SR9A 3GS6A 4PCFA 3IV3A 1A0EA 1XLFA 5KZEA 3G6LA 1XS2A 1XCFA 3L2LA 2XN0A 4AWEA 3LLDA 2V30A 1TV8A 2JKEA 4LVAA 3T2OA 1IXPA 1JF5A 3A13A 2HRWA 1HL9A 4DXKA 2ZQ0A 1KTNA 1S39A 1JUEA 4R7WA 1JNDA 3WNKA 1AH3A 2NUXA 4B4FA 5A2CA 1PZ0A 5DANA 2VGIA 2YIHA 3TDFA 2E5DA 1VFHA 3LBOA 4QAWA 3PZ9A 1UH4A 4LV4A 3ZJ8A 3DYMA 7REQB 3OVRA 4GYPC 5TNVA 3ZT6A 4EPEC 4UTFA 2PLMA 1BPLB 3EWCA 3U5UA 1P6BA 4ZO8A 1GKPA 4ERAA 1RJQA 1QI3A 1ALDA 3AYTA 3QQ1A 3T44A 1SZGA 3BG9A 3GDMA 1S2VA 4PEKA 1OYAA 2FPYA 4AZHA 3O16A 4H9XA 4UTLA 3DG6A 4RPQA 2WBKA 5HK4A 1PKYA 5I7GA 2DZPA 2QJHA 1XIEA 1A0DA 3STPA 4C6BA 4M19A 4IT1A 3T78A 2GLKA 4ENLA 4IFOA 5DT5A 2YDQA 3UG8A 4CNTA 3NGJA 1UOKA 1JNEA 2DSUA 3N2TA 2W3SA 2XN1A 2XIIA 3UT0A 2XFFA 1R3YA 4KPRA 3QLLA 3WQ6A 2VEMA 4HMCA 3OA5A 4PMQA 1M65A 3PBMA 3CUFA 4FB7A 4AWTA 1IEWA 3PWAA 4Z1CA 3KBSA 5HINA 5CSYA 5BW6A 4BK9A 2OZTA 2RJHA 5IDZA 2O56A 4LSBA 3VKDA 3LI1A 4FF5A 4XISA 5M5DA 4J2PA 4DBDA 1A5AA 1PE1A 3LGDA 2VNCA 1S46A 3DK8A 1C90A 1TRDA 1XYFA 3GR7A 3F4CA 4OQVA 2OEMA 1ITXA 4PEEA 1EDGA 4F40A 1VPYA 1D8WA 3AIWA 1CNVA 3FGCB 4BF7A 5HMFA 3EWWA 3OVGA 4Q7BA 3W7PA 3IGHX 5M03A 4HK5A 4Y9NA 4X9YA 1VBJA 2CXEA 1O94A 2CKRA 1WXZA 5I09A 3SQSA 2RDTA 3MYOA 1SMAA 3EA1A 3MHFA 1BWCA 1HTIA 3B04A 3UXAA 1F2JA 2E25A 3AIUA 4KFOA 4AISA 5A8MA 3R4IA 5JRBA 2WMFA 4KT2A 5JCMA 4ADTA 4PODA 4P8UA 1WB0A 1KKOA 1UJQA 3TR2A 2XGBA 1E4LA 1GT8A 1DBTA 3NRZB 3W38A 1GORA 5I02A 4GH1A 4ZQNA 1QPRA 1GETA 3ANYA 1G7VA 2R1MA 4FIQA 4PMXA 1FTXA 1XIBA 4G6CA 4FNQA 1A5LC 5CBBA 3KL0A 3LXBA 3QZAA 1QT1A 3RUBL 4U3AA 2QJIA 2QCLA 4ZVJA 1ZLPA 2NQZA 3T0AA 1GW1A 2IPWA 4LC8A 2WZIA 2V3GA 2V5LA 1VBHA 4I6KA 2VZVA 4N4QA 3T09A 1BYBA 3FAWA 4YXGA 4NSBA 2OR2A 1DTUA 4KEZA 3ZSTA 4KMQA 1ZGDA 2FJKA 3W7DA 3WH6A 1U83A 3R11A 3MV11 4JY8A 3WK0A 1W9UA 3QGAC 3BV7A 3RM9A 5A5WA 1F6YA 4WGHA 4XD3A 4M6QA 2V5BA 4PRWA 3BMXA 1MQRA 3GG1A 3CL8A 2DZSA 5KZMA 2CNCA 3E38A 3WF4A 1BWVA 3FFSA 4IJCA 4R9OA 1FRBA 3ITYA 3W7JA 3AXIA 1RQEA 1W1IE 1RXOB 2FDSA 1JUKA 2AGTA 2VT0A 3AMDA 3EOSA 4RKAA 2VX6A 5CPMA 1PX3A 4KQNA 3PB0A 4ONVA 1W91A 1D3GA 3HURA 2WSYA 4ZE4A 2OG9A 3RU6A 2BTMA 2PBGA 3BLOA 2E5CA 3K5XA 3HQPA 1AL7A 4MMWA 2YVGA 1EB3A 1BYDA 3B0PA 5LIUX 1EGZA 3KRZA 1VKFA 3FYOA 1HJSA 1AOGA 4LVDA 1NP2A 3MS8A 1JXKA 2BLEA 4HP5A 4A05A 2EXOA 1HKVA 2YBVA 5FS6A 1TVPA 1B3ZA 3EX2A 2EQ9A 2O9RA 1LL7A 4F0HA 1M7PA 1A5CA 5CGMA 1M41A 4WY0F 1XCXA 2CIPA 3P74A 5GRTA 3ZVIA 3FVMA 1K8YA 3UJ2A 2Q01A 3BAYA 1IZCA 3LCIA 1B31A 5FMHA 4IIHA 1UR3M 3DAQA 2CITA 4TXEA 3MJMA 2A21A 4ZTXA 3URBA 4GVFA 2P8BA 3BJSA 4LB4A 3GXFA 1EWEA 1F61A 2HVMA 2WZHA 3MCNA 4XIAA 4WJ8A 5JCLA 1D7FA 5J04A 3AALA 3UR2A 4H7CA 4LH8A 5BXSA 4U33A 3NQGA 3LCLA 3TN6A 3ZIZA 4EMWA 4K8GA 2X05A 1VRDA 5G5IA 5T8GA 2BHZA 4DZHA 1GTEA 3T81A 1BAGA 4BI5A 4CNSA 4NEVA 5EKYA 2IS7A 2QV5A 1QNPA 5HQEA 2RJGA 3KLKA 2A3EA 4S3CA 3A5FA 2BY0A 4P61A 3PANA 3F2BA 3W02A 4H01A 3QC3A 3AMZA 2X30A 3KTSA 3QC0A 4GRSA 4AF0B 1HF6A 3EXSA 3B0YA 1I6NA 3TEVA 2R8WA 2ZADA 5DCBA 1GPFA 3NO1A 1D7YA 2Y8VA 3JZEA 4RXFA 1HG3A 3WF0A 3ZO9A 2YL9A 1GG1A 3K1GA 4CU7A 3P2VA 1AW2A 3VTRA 3URHA 4NL1A 1NH6A 3ABSA 2YCLA 3WJZA 1E6NA 1ZZMA 4FF7A 3CV6A 3GZ3A 1EBGA 1RM6B 1I2QA 4ZOCA 1P0EA 5BMWA 1R3SA 3GD6A 5JQ9A 2QUVA 1GRFA 2E68A 1PKMA 1W5OA 1FDYA 4G8TA 3N12A 3ERPA 5D4YA 2PGWA 1MYRA 1EF2A 2BASA 4O4VA 3AXMA 5C9RA 1NWTA 4Z1DA 2AGKA 5CJ5A 1KFWA 2VGFA 3WH8A 1O5KA 1QWGA 3BARA 2O0TA 1Q8AA 4E3VA 1E0TA 1FWFC 4HQVA 2F6UA 1T99A 4MY9A 2HV5A 2WP6A 2WC7A 1LJYA 3AYVA 1C9WA 4HK7A 2E8YA 4D71A 3W27A 1ZAJA 3U2OA 3ZS4A 1R7AA 3VAVA 4GZ7A 2J4GA 4CVWA 3SGGA 3TJ4A 4CQ9A 1L8NA 4P8XA 4DWDA 3W7MA 2VP8A 3G1RA 1FEBA 3VPLA 4UMAA 2BHYA 4NAEB 3IGUA 3W6LA 3VNYA 4DAIA 2DSWA 1PSCA 4AD4A 4GXWA 4NJHA 2PWFA 3QMTA 3CZGA 4XD4A 2FZMA 1GZ1A 1JJKA 2OYLA 1UA7A 2YYUA 3EKLA 1Z8AA 5IFTA 3LCFA 3MO7A 4IGSA 3GNNA 1MW3A 1NAL1 4GA8A 3U5YA 5A2AA 2PGRA 2PGFA 1GESA 3UZYA 5GQBA 2TPSA 2P8CA 1XQLA 1H6VA 4K8EA 4IWWA 5DLCA 2F2HA 1TV5A 3QMRA 2DSVA 5F1VA 4UBPC 2FFCA 4FALA 4H9UA 3IJ7A 4H4ZA 1KQZA 1VS1A 2NXHA 2PRMA 1UZDA 1U5VA 3NEHA 3KTXA 1TZZA 1V0MA 3EKGA 2PB1A 4REQB 5CPNA 4CD5A 1PIGA 2QQ6A 4D6GA 5C71A 1D3HA 3VNZA 1DWJM 4QM1A 2E6AA 4X9SA 1YE6A 3UA3A 4JTTA 2G8ZA 1R47A 3TOYA 3CUXA 3OODA 1E0XA 2Y7EA 3JVAA 4JTAA 2OEKA 4ZFCA 4HJWA 4WEVX 3TZNA 2XTKA 1V6UA 2R1PA 3UWEA 4LANA 4WY0A 1MEWA 4L1GA 2BGQA 4O1FA 2AL2B 2YZRA 3VNIA 1V3KA 5BMXA 3P93A 4D1JA 2W0UA 4ZB0A 5C2GA 2WNNA 4OVXA 2CEQA 4ALDA 1RR2A 5LHEA 1CB2A 2QJGA 3RCMA 3K2GA 3NDZA 4XD5A 2DEPA 3AFBA 1J18A 1GOMA 4KS0A 4W5ZA 4DX3A 2D22A 1Q7MA 3BJTA 3VE7A 2GUBA 2PP0A 1TPWA 2ZZ3A 1PIFA 2E9MA 2D2GA 4GUFA 4QP0A 3EDDA 2G3MA 2GDUA 2PDHA 3R89A 1PYMA 1CECA 2BX7A 4DUWA 2IXUA 4TVCA 5FS9A 4DNMA 4BF9A 1ZSXA 1JR1A 4PTNA 1N8FA 4UTTC 4AVOA 1MXSA 4DO6A 1X38A 4ZQOA 3W7OA 2WOWA 2UZ9A 5D04C 2R9RA 4FLOA 4Q33A 1EKOA 1B1YA 3PPFA 2DSKA 1YTEA 1Z32X 1R3WA 1NDVA 3UFYA 4NYUA 3CQ0A 3GVVA 5E5CA 4O15A 5E1QA 1LG1A 2VKZG 3XIMA 1QFEA 3TA6A 3W1AA 1EH9A 4D2JA 4NUWA 3T2PA 2YA2A 4B2DA 3PC0A 5LNWA 1OCJA 1HJQA 4HN4A 5I03A 4DXXA 1F3WA 3B9NA 3NZQA 3AXKA 5LHFA 4GCXA 3MKKA 3ABQA 4IH3A 3SJ3A 1LWHA 5A94A 3WLLA 1UD5A 3H54A 4C6IA 4HA4A 3VM5A 4AD5A 4LS0A 3PJXA 4AHPA 1HQTA 2J3NA 4QNWA 2CW6A 3KHDA 1XR2A 3POHA 3KM8A 1TWWA 5XIAA 2XIOA 3A12A 3VGEA 4DXVA 2NX9A 2OQYA 1Q6EA 1G5AA 3VIGA 2ZCGA 3M7WA 2X1TA 4H9MA 2GGHA 3RX4A 2R6OA 4LX4A 4FAMA 2WLZA 2VGBA 1POKA 3GTIA 4PC8A 2VQUA 4QJ5B 2C7FA 1G67A 2Z1SA 1Q5MA 1FY6A 3N04A 4GX8A 1W5PA 3OU8A 2F38A 1FWWA 3B8SA 3C8FA 4JAWA 5A6JA 3UWQA 1XYAA 1AJZA 3U8GA 3WJYA 2XIQA 2VVNA 3EAUA 3NA8A 5TR3A 4O8RA 3DBNA 1FDZA 4IMAA 5BXRA 5B7ZA 5C6MA 3GNOA 1WOAA 3EB4A 2OT1A 3BOFA 1FHDA 5HUOA 1K3UA 5D38A 1W3LA 2PMQA 3A9IA 5CAKA 1V0NA 1KRBC 3C2FA 5EFFA 3V3WA 3WMSA 2X42A 4CN1A 2DZBA 3M64A 3RR1A 1RCOB 2QAFA 3M0VA 1LOQA 3NCOA 4HB7A 3RPMA 3O6CA 3TX9A 2ZZ0A 2AL1A 5I24A 3AIBA 4V1YA 3V5CA 1SW0A 1XD0A 4JXCA 4MDPA 4CU6A 4IMDA 4XO6A 5CXPA 3A4WA 1A80A 3ZOAA 2QCCA 2YL5A 3H8AA 1EC8A 1TR1A 4S1FA 1MEIA 2A85A 2GGEA 4IFKB 2P3EA 1EXPA 4JIRA 1SR0A 1XGEA 2Y4SA 3CBWA 3R43A 4I8DA 4IQJA 3NL6A 1EEPA 1BSLA 1TV4A 2PS2A 4FO4A 3KZPA 5DFAA 1MW2A 2VX4A 3UG4A 2DUAA 1XH0A 4LVBA 3S1GA 4IP4A 1E9IA 1OJXA 2OJPA 3RMJA 2ATSA 4GQRA 4XZIA 3VNMA 1QUMA 4GZEA 2ACRA 2QAEA 4TTGA 1BTCA 1UQYA 1XW8A 3W1QA 1J0HA 4NJJA 3LNPA 3SEPA 1V0KA 4TUFA 3LM7A 1JROA 3NOYA 3AXHA 1P7TB 1YW1A 3IAPA 3B97A 3W83A 3NS1B 3SECA 4JNZA 1CTNA 5G5HB 3BK0A 3AQUA 4JIQA 4WXYA 1UR9A 3ZR6A 1Q6QA 4GBDA 4H8UA 3GXMA 4UFHA 2X09A 2ZXBA 1O5RA 2DSZA 1UWAA 4RZ6A 4KRTA 2Z27A 5HAOA 2C15A 1V7YA 2P76A 4GCAA 2O4MA 5DX7A 3NO5A 2QZRA 3IJDA 5ABFB 3VO0A 1OINA 3RAOA 4MDOA 2C91A 2VMFA 1KCZA 3ZVHA 3H24A 3R5EA 2YGYA 2AMXA 4C6OA 3J7HA 1M6IA 3EMCA 1X6NA 3A4JA 2C1HA 3WLOA 1M03A 2W79A 2Y70A 5TBOA 3IVUA 1T7LA 3LHYA 5DELA 1N8WA 4D6IA 2WYSA 6XIAA 1NWRA 4Z2LA 1LF1A 1K02A 4L56A 5JBEA 5KSWA 3HW2A 2JEQA 3F4WA 1ICQA 1UROA 4H6QA 4AD0A 2YDAA 2YW3A 4AIBA 3CQIA 4ML9A 3TA9A 3KOFA 1OD8A 4N6FA 3VUPA 2FZBA 1KGWA 1MFUA 3U6WA 4EK7A 5I3FA 1V6WA 1QTWA 2Z1KA 1VB9A 2BB0A 1EBHA 1EOKA 1JZ8A 2GUUA 4L64A 5KZ6A 4E8GA 3D6NA 1NSJA 2GVYA 2Z1WA 1MNSA 4AZ6A 5D05A 3H55A 2ZRWA 1YPIA 1ISZA 1PUDA 2XGIA 3GSMA 7PTDA 3WJSA 4MNMA 3UWYA 1OCNA 1ZHAA 3P8JA 1GK8A 2D1ZA 5DXYA 5BROA 3H2NA 3SY8A 4IQEA 1XLJA 3VCNA 1KGUA 3L12A 5JH1A 1QPQA 2ISDA 2NLYA 3LXAA 4N02A 3T0TA 3A22A 1S1PA 1NWSA 4DNHA 3AS3A 2HXTA 1DXIA 3CMFA 1RBLA 4OECA 1NOWA 2Z25A 4L9YA 1UD2A 3WD2A 3AWNA 1JEHA 1PWLA 4WGXA 3ATZA 3C0JA 1VPXA 3B8TA 2CLEA 5FESA 4JTLA 1HO4A 2L5HA 2HSAA 3W53A 2FLIA 2XIBA 4DAFA 3GRIA 2OYKA 1H0IA 5REQA 2PU1A 2WSKA 4IPPA 4N0RA 3B05A 3VZYA 4XTDA 1ICPA 5KVHA 4J3TA 2GL5A 1Q2SA 2A6NA 1JD7A 1W31A 5EY5A 4LBRA 4O12A 1PL9A 2WK2A 2WPCA 5AHFA 4C6CA 1QW7A 1FH9A 3PSVA 1XGZA 3EMQA 3HG5A 3I7SA 1GW9A 2R1LA 4M80A 5EMKA 2JALA 1LOSA 3ZYZA 4WUIA 4R7JA 5I06A 1VAHA 3L0NA 1FEAA 5TAOA 1PBGA 3BURA 3BLEA 4DEFA 2RHGA 2QGYA 1BD0A 5ENLA 3LOTA 4W7VA 5AHLA 3OQEA 1UC5A 5CPSA 1AL8A 4JYEA 4N6EA 3UYIA 3LV6A 4UB9A 4B3LA 1IXQA 1MFVA 1VFFA 2O9TA 4L6HA 1UWQA 4GQBA 3GX9A 1FHVA 2XZ9A 2ZZBA 3R8GA 4H9VA 4HYWA 1AJ2A 5E0FA 4KWVA 7XIMA 3NZRA 5HANA 5DY2A 4YHEA 3BCJA 1NDWA 3OZMA 1B3YA 4ATDA 3FJ4A 3QZ6A 1UD4A 1P48A 4FP1A 2GRTA 4WHBA 1ZAIA 2GWNA 1Q6RA 4KF1A 2BC0A 4AEFA 4Q8TA 3CTTA 4Z2JA 3TUUA 4F66A 2YLLA 1FKWA 7A3HA 1IT8A 4IX0A 1G4SA 4MSSA 2YCKX 3C2RA 1IWBA 2ZX5A 4YVVA 4PH6A 3WLMA 1WAWA 1XG4A 4N9EA 1TUFA 3ONCA 3PZOA 3LEPA 1GZGA 2J7GA 2JKAA 3M0HA 2O9PA 4DBSA 2FKPA 4UTKA 3LADA 4GINA 4GRTA 1N2VA 5CH9A 3UXKA 4UCGA 3MMTA 1RH9A 3B8VA 3M46A 4FI4A 5C9UA 1E0UA 3VKCA 4INFA 5AHNA 3GFXA 2HBXA 3WN6A 1JZ3A 3KE0A 5EGRA 1TV2A 3P5ZA 9XIMA 4DJDA 3UR8A 5C5YA 1QNSA 1DXFA 4M24A 4PFHA 4M6VA 4D8LA 1JULA 1VP5A 5HJLA 5LXXA 5HPOA 3N6JA 5IOBA 3UD6A 5C9XA 3LHWA 2BXYA 4IP7A 3LNMA 1LRNA 2VFDA 2ZC1A 4DY1A 1XFCA 4BQ2A 1ONEA 2NVCA 3M5YA 3ES8A 4MTVA 3WQWA 3QF0A 4D72A 5I0DA 4TX8A 3LQLA 1KFKA 2GR2A 1U1HA 2W3ZA 1OGGA 3FW6A 1AK5A 3V0UA 3IRDA 4C7FA 3THQA 3W71A 1GV4A 3QTPA 1MDRA 3KRUA 2HBVA 2Y88A 5E70A 2NLIA 1W1YA 5CC5A 1FOBA 3VX0A 3O63A 4LB3A 1QK2A 3WLNA 4Q8OA 3BSGA 3CUGA 4GJIA 5F7UA 4NNAA 1SO4A 4H4UA 3GW3A 4LOCA 1C8QA 4WKAA 3M4HA 3I6EA 1VFUA 1FCQA 3NQ6A 3VOHA 3B9DA 3P5YA 1G6CA 1XBYA 3TROA 3NXLA 1EA9C 1Z42A 3F4NA 5EBKA 2ACQA 3V75A 2YCIX 7ODCA 2ZZ1A 3Q45A 2KZHA 3LHZA 5CG7A 3E6EA 2BP1A 4LT9A 3IGXA 4W7WA 3L67A 1QI0A 4AXNA 1V51A 2PDXA 1PJ9A 4BI7A 1W9XA 4LCRA 2EHHA 1OIMA 4NZFA 5EMJA 3VGFA 1RALA 3ARWA 1UKQA 8RUCA 1KXQA 1XIDA 3HJEA 4B5TA 5HULA 3WUGA 1POJA 4ZOHB 2P50A 2J79A 4ZZ9A 2VZOA 1NOUA 3TONA 3N73A 5DF0A 1QXLA 4GJJA 4F48A 2XJ7A 2NQHA 4NI3A 4CUCA 5AHMA 3W26A 2G5WA 2YA1A 1MNZA 4QGCA 4ZGYA 1XYBA 4UR9A 1T40A 3DUGA 3B0UX 5K4ZA 4GI9A 1JFXA 4MF4A 3O2LA 1DQXA 3C2EA 3IIPA 2NQJA 1SFTA 3TQ0A 4DBWA 3CT7A 1GRGA 3QQWA 4IPLA 5EFDA 3ZXWA 3DHFA 3QJAA 3KRSA 1G4EA 5EMMA 3P80A 3WDHA 4JDBA 4KERA 4E8DA 3FSTA 5EL1A 1TREA 3ITOA 3EMZA 4M51A 4O17A 4PB5A 3MCOA 4ZOAA 1DIOA 3W7QA 1SFJA 4DIAA 4H8NA 5G2IA 2UY3A 1JZ6A 2OQHA 3UR7A 3B3DA 3AIQA 3VIIA 2OXNA 3CM4A 2C18A 4TV5A 4UTUA 1E51A 1R6WA 1K4HA 2NWSA 4BR1A 2ZZ7A 1S38A 3LSBA 3NL5A 4UMBA 2ALRA 3CPGA 3WBXA 1AUSL 3IJ8A 2A3AA 4Q4SA 4WJXA 3GB6A 4GUHA 1TJ0A 3OPSA 5KITA 3R0KA 1Q7QA 4S3JA 1BWKA 1XHCA 4J3XA 4EF8A 4DJDD 4EQRA 5TF0A 3EOUA 4AHQA 3R13A 4GGHA 3AS1A 4MOZA 4PMZA 5AYYA 5GPRA 2V6OA 4K6AA 1RUSA 2OZ8A 4JBRA 1W0MA 4BWLA 4C1LA 2EKCA 3LA4A 4JX6A 3SUSA 3F2CA 2VJXA 2J66A 4L1WA 1I2PA 3KCLA 1WZAA 5JIWA 1DIEA 3M0IA 3LLXA 1K4QA 1ADDA 3PVFA 4G7EA 2XGZA 3KBVA 2V81A 4J35A 3MTWA 2QDEA 5CJMA 4QTGA 4QJ4B 1CXKA 3MBDA 3R10A 3CV7A 3W84A 4E8CA 3TOPA 3SRKA 4YTQA 3CJPA 1E6QM 3N2OA 3MUZ1 4GQGA 3N11A 3HJZA 1D8CA 2ZIDA 4P8WA 4MB5A 1I2NA 4O0ZA 2ZRZA 3BOLA 1RJPA 3B8IA 3H23A 3RU8X 2ZUTA 2OO6A 3E9AA 3V18A 1G4PA 3CWOX 3MV01 4BQ4A 2X8RA 5CC6A 4PTXA 2QT3A 4HA1A 5A6MA 1OFEA 3PBUA 4UQCA 1NF7A 4Z0JA 2BXVA 3W28A 2D2JA 4JTJA 5AZ1A 1C8XA 4WF7A 3BCFA 1V6YA 4DJDC 3C0QA 3LN3A 3EOEA 4MADA 2G97A 2C71A 1BKHA 4UR8A 3TMLA 4PULA 3NQDA 1EBDA 4CN4A 2UY5A 3H12A 4HPXA 1TV3A 4EAYA 3A5VA 4Y90A 5FD0A 3ARQA 3TJXA 1KM6A 1SM9A 1IT7A 2J9XA 4F9JA 3NVYB 4O1CA 3AZSA 3QR3A 3TXVA 2Z26A 2CU0A 2X7VA 2PD9A 4H4WA 2X1IA 1NOFA 4AW7A 1EC7A 2FHCA 3W9ZA 1E4IA 3NR0A 3BUVA 4ZCWA 1LBMA 2C79A 5EYWA 3NYZA 4G2DA 2I17A 2DORA 5B80A 1O7AA 1OABA 1A5KC 1IYXA 5I6SA 1LQAA 1OD0A 2FPTA 4R34A 3E0WA 2VZSA 2P0IA 3FOKA 4ZBCA 3MCMA 4U28A 4OTKA 3KP1A 2ZX9A 3OGVA 3K46A 3UNDA 5ECUA 4NIRA 1BF2A 3WQOA 3RF9A 1E4MM 2RUSA 4YS1A 4A2RA 5DY3A 2JEPA 4H9YA 4B15A 1V6XA 1VCFA 3MBFA 1EHNA 2Z24A 3R2GA 2CZ5A 2Z2BA 3TR9A 1U33A 1H1NA 1H7XA 2PD5A 2WVSA 1LM1A 4LAUA 1UIPA 4CNPA 3SGUA 4F0LA 2E1DA 4OUEA 5ABTA 1XDMA 4P7LA 2ZC8A 1PKNA 3KVKA 3K8LA 4Z1AA 2PDWA 3PPHA 4MAVA 4WKHA 4XUGA 1V77A 3HZ3A 2O55A 2A7PA 2WJZA 3FJNA 1UC4A 3RX2A 3CAVA 4JCMA 3SY1A 3SCVA 1SZFA 3GVRA 2F5ZA 2GR0A 2ZKMX 4Y6GA 5I3IA 5HA7A 1DNCA 4PRTA 2X0YA 3VIHA 1F8WA 2DU2A 1HKIA 3TSDA 2ON3A 1P4CA 1MI3A 3MA8A 2PDBA 1JZ7A 4IGNA 3L4VA 3W37A 1E15A 3CV1A 3URNA 4CCZA 3A4XA 2BGNE 4NP7A 1DWFM 1IV8A 3DZ1A 4AVNA 4A21A 4JFVA 3TYBA 1E9ZB 3UXLA 1JYXA 1K9DA 4XQ6A 1CW2A 1XLGA 3TYUA 4K1GA 1ZU8A 3WJWA 1C7TA 1F7BA 3H21A 1AQHA 5E6YA 4GO9A 4GX9A 5I3HA 3LRMA 1J0ZA 1JRBA 2CDUA 2CKSA 1BXNA 4UOJA 2ODOA 4QBXA 3EX6A 8XIAA 2O7SA 1CI1A 3WNOA 2J88A 3ARVA 2AAMA 3D47A 1WDSA 1DP0A 3PNZA 2TYSA 3CQKA 4MZ8A 3TE9A 3W1XA 4ZE5A 4BWLC 2QJMA 7REQA 3A3WA 1HKJA 2WXDM 4HOZA 3L65A 3EDFA 1E5NA 1Q6FA 2P0OA 3ONBA 3WQPA 2YL6A 1FX6A 1OT2A 3E2RA 3W7NA 3GG8A 4HNCA 1FWSA 2GOKA 4EXBA 1E0WA 3VX1A 5MF5A 2VURA 3GVQA 1GREA 3SZ8A 1JPIA 2CCRA 4FEZA 4LUTA 2V2HA 3SUUA 3MY9A 4A35A 4AD2A 1JXJA 2ZZ4A 3VIKA 5EB8A 1T8XA 1H50A 3NQBA 3GZAA 4DUXA 1Q8JA 1R38A 1TYGA 4IZGA 1JPDX 2PAJA 4NU7A 3PK7A 1X98A 3O06A 3L8KA 5SWUA 2QPSA 5A8OA 4R5EA 4HZMA 6REQB 3WEZA 4C6PA 3TXZA 3BDKA 1E3XA 4GC4A 3I65A 4A3QA 1JOAA 4WXZA 1N55A 1U5JA 4K37A 4LEQA 1DKWA 3ICJA 1TUXA 4H4RA 3LERA 3ARSA 1TG7A 3WDRA 1VYPX 2FVMA 3EANA 3FGCA 2PRHA 2ZTKA 4M7TA 1A5NC 4PRRA 3VIJA 3UPWA 1NTHA 5HPCA 5JMUA 5K9DA 3T0CA 2PC8A 1LBLA 1M6JA 4H6EA 4PTMA 2A0NA 3L4TA 3AAMA 1IIHA 1O4UA 2JK2A 1Q6GA 3KOXA 3KS6A 4V1XA 1EPVA 1MUMA 4Y96A 3Q94A 4JPGA 2G37A 1GHSA 4Z0SA 3QV6A 3PULA 1BVWA 4AWUA 4O16A 2O92A 4JS3A 1PZ2A 1FKXA 5FSEC 3S6DA 5CPLA 3JZUA 1RSCA 4GY7A 5LNVA 1F6KA 5CGQA 4XBJA 1HKKA 3KWSA 3U4AA 1KBLA 5CCZA 1XYZA 2VVSA 1HL2A 2HS8A 3KLJA 4UQBA 4Z08A 4XX6A 1GRAA 3QMSA 2BOFX 5HMSA 5IRPA 3QHOA 1UUOA 1JPKA 2R94A 1BHGA 3NNTA 3CH0A 4NJGA 4NXKA 3LPFA 3RG6A 4LS2A 3OYZA 2QAPA 5FACA 3WFZA 3LSCA 3AROA 2OO0A 4S3EA 1FWDC 1G94A 1TX2A 3RHGA 5AC4A 2V3FA 4AZ7A 3UQNA 2YOCA 3LZ3A 3DN5A 3NOEA 4Y8FA 3BLPX 4EF9A 1JDEA 2Q8XA 4JIEA 2UV8G 3AYRA 4H4IA 4DNAA 1TWDA 1H49A 3NVDA 1DHPA 2D3LA 5IHSA 5FF7A 3SCRA 4CVUA 3THAA 2PDJA 3CPUA 4GKTA 3SO7A 2NV9A 3B9OA 1OFAA 3IWPA 3ME3A 4DQWA 4K36A 2ANUA 3R0UA 3AHXA 2Q3OA 4E4FA 4NXSA 4ECLA 3RX3A 1T41A 3BSMA 4YYFA 1TYPA 4MPQA 2WZTA 2CFYA 4LNCA 2XSAA 3LMZA 2GJNA 3ALGA 1UW9A 4JTSA 4JTIA 3W1LA 1L8PA 3CAQA 2X8HA 4MZYA 4F2BA 1W1A1 2FGBA 3GC2A 4GD0A 1P1MA 3TN4A 3OG2A 3CHDA 3EWYA 4C7DA 4JTUA 4H04A 2MNRA 1GVSA 4UXDA 3P6LA 1XSKA 2QCGA 1PHWA 5LIXX 2QIWA 4M6UA 3Q65A 2V68A 2OX4A 3P3BA 1KBKA 4GXPA 4JL1A 2VI0A 2XM1A 3NYDA 4C6FA 3A3HA 1BXCA 4HA3A 4I5UA 3QOMA 1TPFA 5CSSA 2RAGA 1SJAA 4Q4QA 3RLHA 1JAKA 2DW7A 1B0IA 4X0NA 2QULA 1GVRA 2HPIA 2Y89A 2DZAA 3SSJA 2EPHA 4O28A 4RW5A 3L9CA 2WMJA 5IFPA 4IL0A 3MVTA 6ENLA 2X40A 1N63C 2G3FA 2GVGA 1GVIA 3D3FA 1M7OA 2WWCA 4ZFMA 1JCMP 3LTSA 3NPXA 3SUWA 3TTOA 2NVKX 1ZNNA 3SR6B 1N7KA 4HOWA 2ACUA 1B2YA 2H3BA 3V5OA 1EA0A 4EPDC 1XHGA 4XAYA 4Q4MA 5TD4A 3NXFA 5AN7A 3P60A 2OSYA 3WF3A 3P7YA 4RNJA 5CC3A 4O19A 5DT7A 1Y5XA 1PZ1A 3AUOA 2BDQA 1VBRA 1VC4A 3GLCA 1DJWA 4LEFA 2NUYA 1TIMA 4PUKA 1KBJA 1B9BA 3GDRA 1IZKA 1NQ6A 2PGEA 1FWIC 4FX8A 3W82A 1ZAHA 3RPDA 4FZIA 2DDXA 4M6PA 5JXQA 4RR4A 2FJUB 5LYRA 2WB5A 3GU1A 4OBTA 5CZSA 4PMOA 3TN3A 3DC8A 4GPNA 3MP4A 4KGJA 1YNYA 2X99A 2J27A 2X0SA 4JCLA 5HMDA 3VABA 3MMWA 2PURA 3KS5A 3L2MA 2V9DA 2VR4A 4HNNA 3SM0A 1XISA 1SW7A 4AXKA 4MM1A 3MSGA 2Z2UA 1EDQA 4IJRA 2ZWZA 2OGJA 4TX6A 2BODX 2A5HA 5D30A 3OTRA 1GRTA 4I7WA 3L7RA 2C3DA 4BF5A 4XZWA 2AKMA 4WDXA 4XAZA 4Z2IA 1WDQA 2PWGA 2YXXA 3TCSA 3TIMA 3ZM8A 4DJEA 3G1HA 3VGHA 1SGJA 4C1NB 3GFYA 4L80A 4E2VA 5JVLA 1EJRC 2GJXB 2GGJA 4HN8A 3STCA 3LGGA 3EF6A 1W32A 3CQJA 3S9YA 3VILA 4QE4A 2VDHA 1FWNA 3Q37A 3A47A 3N6QA 1FHLA 4CD6A 1JQXA 2Y2WA 3GHUA 4I9TA 1LQ0A 1RQBA 1ODZA 4Q4RA 1RBOB 4I5RA 2QCDB 2YKKA 3MO4A 3ARZA 2GFTA 5HQLA 2XVNA 3P84A 5C0QA 3U0HA 1QNVA 2XPKA 3NVVB 1F76A 4K8DA 3NQVA 1Z48A 1TJRA 2J8GA 2W5FA 2OX1A 2X7WA 2WHKA 1GOIA 3FYYA 2QCNA 4CCCA 1J8VA 2BHUA 4KBXA 5FI