2PP3A

Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
395
structure length
395
Chain Sequence
b'SANSDAVTYAKAANTRTAAETGDRIEWVKLSLAFLPLATPVSDAKVLTGRQKPLTEVAIIIAEIRSRDGFEGVGFSYSKRAGGQGIYAHAKEIADNLLGEDPNDIDKIYTKLLWAGASVGRSGMAVQAISPIDIALWDMKAKRAGLPLAKLLGAHRDSVQCYNTSGGFLHTPLDQVLKNVVISRENGIGGIKLAVGQPNCAEDIRRLTAVREALGDEFPLMVDANQQWDRETAIRMGRKMEQFNLIWIEEPLDAYDIEGHAQLAAALDTPIATGEMLTSFREHEQLILGNASDFVQPDAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVHLHLSAAYPLEPWLEHFEWLNPLFNEQLELRDGRMWISDRHGLGFTLSEQARRWTQLTCEFGKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-talarate/galactarate dehydratase
publication title Evolution of enzymatic activities in the enolase superfamily: L-talarate/galactarate dehydratase from Salmonella typhimurium LT2.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 138
structure length 395
sequence length 395
chains with identical sequence B, C
ec nomenclature ec 4.2.1.156: L-talarate dehydratase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2pp3A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2pp3A01
3ZVHA 1E9IA 2I5QA 3H12A 2CHRA 3CT2A 3ES8A 3R25A 3DFYA 3T8QA 4IP5A 1PDZA 6ENLA 2OZTA 4H19A 3RR1A 5IDZA 3IJQA 3FCPA 2HXUA 2XGZA 2QGYA 2OFJA 1MNSA 2GGGA 3VCNA 3BSMA 4ZA0A 3RCYA 2OZ8A 4K2SA 3QPEA 4IP4A 1SJCA 3NZGA 3STPA 1DTNA 4H1ZA 3JZUA 3BJSA 4E4UA 2P8BA 1SJAA 3DG3A 1KKRA 2GL5A 2HZGA 4DN1A 2PTZA 2DW6A 4KT2A 5J04A 4GISA 3S47A 2AL2A 3HPFA 3T9PA 3V5CA 4EWJA 3R0UA 4A6GA 4HNLA 4M0XA 1IYXA 2NQLA 3TTEA 2O56A 4IHCA 3TW9A 3OP2A 3I4KA 1MDLA 5FJTA 3TCSA 3JW7A 2MNRA 3H70A 2QQ6A 4IL0A 3V5FA 3DIPA 3Q4DA 3OTRA 1BKHA 1YEYA 4DHGA 3GY1A 4E6MA 4DX3A 2ONEA 4GGBA 4KPLA 2OLAA 2XH7A 3CYJA 3UCDA 4DXKA 2GGHA 3MUCA 4HN8A 2FYMA 3OW1A 3K1GA 1FHVA 4H83A 3MZNA 3Q45A 4JHMA 2XH2A 4FI4A 3VCCA 1XS2A 3U9IA 1L8PA 2QDDA 3CB3A 2PP1A 2AKMA 2OG9A 3DEQA 2GSHA 3ZLGA 3DERA 4HCDA 2QJJA 3MKCA 2PGWA 4HCLA 3UJFA 2QJMA 3VC5A 3ZLHA 1ELSA 3MY9A 5FJRA 1W6TA 3TWBA 1F9CA 2QVHA 1BQGA 3KUMA 2HXTA 3CXOA 3OZMA 2GGEA 3SBFA 3H8AA 3RRAA 3FJ4A 1ONEA 3PWGA 3EKGA 2POZA 2PMQA 2PP0A 2PTXA 2PU1A 4ENLA 5FJOA 1XPYA 3TQPA 2AL1A 1EBHA 1EC9A 1MRAA 4IL2A 2P88A 3I6TA 3R11A 4H2HA 2DW7A 3TWAA 3TJIA 2GGIA 2PS2A 3THUA 3P0WA 3UJRA 1MDRA 3FV9A 4GMEA 4M6UA 1PDYA 3N6JA 1EC7A 4JN8A 1JPMA 2RDXA 2XH0A 4MMWA 1KD0A 1MUCA 3D46A 4JN7A 4IZGA 3GD6A 1TE6A 1WUEA 3UJ2A 3V4BA 7ENLA 3PWIA 3UXKA 2P8CA 3IJIA 3NXLA 1FHUA 1TZZA 5FJPA 4K8GA 3DGBA 4KWSA 3NFUA 3N6HA 2OO6A 5BOFA 4ZCWA 2PGEA 4J1OA 4GYPA 4DYEA 2OZ3A 3TJ4A 4KEMA 3RGTA 3ENLA 3MSYA 3T6CA 3DG6A 4G7FA 3DDMA 3QKEA 3TOYA 3QN3A 3N4FA 2OPJA 2PU0A 4E5TA 3H7VA 3UJEA 2XH4A 3RITA 3V3WA 2ZC8A 3B97A 2OVLA 4ROPA 4GIRA 4Z1YA 4K1WA 4YWSA 2PPGA 3IJLA 3D47A 1WUFA 3UJSA 1OEPA 1R0MA 3FYYA 2XSXA 3SSZA 2OQYA 3GC2A 3CAWA 3T4WA 4GGHA 3VC6A 1KCZA 4MKSA 3OZYA 3QLDA 1JDFA 3ZVIA 3PFRA 5EU9A 3ZVHB 2PCEA 3BOXA 2MUCA 2PTWA 3DFHA 3DG7A 3VA8A 3MQTA 1SJBA 1ECQA 3VFCA 1KKOA 2AKZA 3VDGA 3I6EA 4E4FA 3GO2A 3RO6A 1JPDX 3SN1A 4E8GA 4J3ZA 2QJNA 2GGJA 3R10A 3DESA 3UGVA 3SJNA 3JVAA 3S5SA 3SQSA 3EEZA 4X2PA 4GYPC 3UXLA 3R1ZA 3N4EA 2P3ZA 3PK7A 3CK5A 2PSNA 3OPSA 2QDEA 1TKKA 4G8TA 1EBGA 4DWDA 3P3BA 3ZLFA 1NU5A 3IK4A 2P0IA 4HCHA 4Z17A 4HNCA 3MWCA 3QTPA 4HYRA 2PODA 5BOEA 5FJUA 4F4RA 2PP3A 3SN0A 2FKPA 2PTYA 2HNEA 2OQHA 2OX4A 4GFIA 4A35A 3NO1A 2PA6A 1RVKA 2GDQA 1NELA 4FP1A 2AL2B 4IT1A 3FXGA 4MGGA 3U4FA 2ZADA 3FVDA 1P43A 1P48A 1R6WA 3ES7A 3P93A 2OKTA 1SJDA 3UCCA 4HPNA 5ENLA 4A3RA 3R0KA 1JCTA 1EC8A 3SN4A
chains in the Genus database with same CATH superfamily
3MMUA 3VCRA 2CHOA 1J18A 4XTDA 3O0KA 4YTTA 5FF2A 1LVLA 1JNDA 3R25A 1MXSA 3T8QA 1KV5A 3GH4A 1M65A 4ATLA 3F7JA 3TVAA 5K9DA 4PUEA 5HUPA 3F4NA 3LTYA 3MZ2A 1PZ2A 3O06A 2QF7A 1WO2A 3KS6A 1UIPA 1VEOA 1FDZA 3A47A 3W7RA 4H4WA 1AQFA 1CXFA 2F8QA 3PG8A 3GDTA 1G4SA 3O3RA 4FNTA 1PEZA 1N7KA 4MY8A 3DHPA 4AY8A 1EJTC 4DPPA 4K2SA 1Y0EA 4PN2A 1QHPA 1GVRA 1GTHA 4IJBA 5I2UA 5PTDA 1I2OA 3WQ5A 3UPWA 2EPKX 4PB3A 3LCFA 2Z24A 1KKRA 1MW3A 3WEMA 1RJRA 5AHMA 4XD3A 4EIVA 4ZB2A 2C0AA 3AZSA 4L65A 4H8UA 2XFWA 3GG1A 3L67A 5REQA 5FL1A 3BLEA 4GQ0A 4J2PA 3VNIA 4N7QA 4LVBA 3AWOA 3TP4A 4PC8A 1R46A 2CLEA 1VLIA 1MDLA 1TA3B 2F7FA 5C9XA 1D2KA 3WH7A 3U4AA 4XBJA 5I06A 2G4FA 1UD6A 4NUWA 2GR1A 3UY7A 2BTMA 3UF9A 3PTDA 2XIMA 2HTMA 3A9IA 2GGHA 3GE7A 3VUSA 3HOJA 3KBWA 3FGCB 4AXNA 1Q6OA 2Y7EA 3W24A 2V9DA 5DBTA 1W1PA 1Y5VA 4XZHA 1OX5A 1GXFA 2ZRZA 4RL3A 4FLRA 4C65A 2CHNA 4W88A 5E0FA 4PL1A 1UH2A 4AY1A 2PDQA 4HCDA 1R85A 3L4TA 4R7JA 3VKJA 2H9AB 4ORIA 3PSVA 4UTJA 3W1MA 1ZKQA 5I3GA 4CNOA 1J0KA 1PYMA 3H54A 1L8NA 1H1ZA 2CITA 2G3FA 3CXOA 1IXNA 3OZMA 5HA7A 3NVWB 3LTPA 3WK2A 2V5LA 4OUIA 1RSCA 1Q4NX 2PTXA 2FGLA 4LAUA 4DAIA 2IKHA 1PIIA 5I3DA 2QUVA 2RJHA 3RJYA 1UR4A 2ZVIA 3AXMA 1I2PA 4MFDA 1K7XA 1H1NA 1Q6DA 4J3WA 3OOQA 3DFTA 1BFNA 2D2HA 3LCLA 1N60C 4MB1A 1CGUA 4P8XA 5J5RA 2JKAA 2PDNA 2VX7A 4H4IA 5CLTA 2JF7A 5FEPA 3SIZA 1BVWA 3VD9A 3D0CA 3HU7A 4MMWA 2EXOA 4C6KA 2ZZ1A 4BJHA 1Y8BA 2R14A 1GVOA 3WQ6A 1BEUA 1JJKA 2YZ5A 2BHUA 3T78A 3G0SA 1F4AA 2X8CA 3CL6A 4HD5A 1EQPA 4Q7IA 3M5XA 2XIQA 1QK2A 2X99A 1RH9A 5B80A 4Q6XA 3FSUA 1GZGA 1J5SA 4P5UA 2XM1A 3K4DA 4KPRA 3GR7A 4GYJA 3N3MA 4NEWA 4I3GA 2J8FA 1G67A 2Z2UA 3GDMA 1N5XA 2WOIA 3PNZA 3ZJ8A 4DJEA 3ZM8A 4WXYA 3TJ4A 4BCEA 3CIWA 3FJ6A 4QCFA 2VL4A 3B4YA 4L1XA 4YLWA 3USBA 1V6XA 4PRTA 1RV8A 2OPJA 3KE0A 4H4VA 1Z3NA 3UJEA 2PD9A 4E2OA 4YTUA 1IEWA 3VIHA 3CPRA 4NJGA 1AH0A 5GPRA 1U83A 1H09A 2WOQA 2DT3A 4LAZA 3VGDA 1M03A 3A4XA 3GG8A 4DWSB 4Q32A 3BPWA 1R3QA 1NFGA 1R7OA 4OECA 1IV8A 1V77A 4HOWA 1KM5A 4S2BA 4XSLA 1A5NC 2VX6A 3U8GA 3W7GA 3VE9A 4PMUA 3DFHA 2FB2A 3VDHA 4RNFA 5C7VA 1A0DA 2WYSA 1QK0A 1NOFA 2QCEA 3EX1A 4RV3A 1K7FA 3B9OA 2R94A 5ABFB 1WPCA 2G37A 5BRBA 4IPLA 3PBMA 1Q63A 3RYSA 2QAEA 3W74A 2YDQA 2GWGA 3WJYA 4ADTA 4XBKA 1C90A 4QBXA 1J0JA 4ZO7A 1AODA 2W5FA 2XFFA 3EWXA 1E5JA 2WPEA 2CXEA 6CGTA 4CQCA 4OE7A 2NQHA 1E1CB 3AROA 2Q6ZA 3IANA 1UWQA 2V5BA 1GJPA 4OZOA 4OFCA 2CLFA 3U2ZA 1FDYA 3EOUA 1GTEA 2ZVRA 2A3EA 3A21A 1WKDA 4LS0A 1VCGA 5AOUA 1VJIA 5A69A 4XSMA 2FZ8A 4DO5A 3MP3A 1R47A 1CENA 1VPYA 1S3TC 2Y6ZA 3FFSA 5G5GB 3BCDA 1ISYA 3BICA 2BXYA 4E0CA 3W7HA 4HTBA 4UIOA 3CO8A 3YPIA 1I60A 2GQ8A 1J6PA 3ES7A 4UNIA 2QYGA 1ZMCA 1SJDA 3WLQA 4YVPA 4GK8A 1V3JA 5BOOA 1UMYA 5EL1A 2NT1A 2CESA 1JEZA 3GNDA 3L5AA 4O50A 1KQYA 1ZJHA 2IPWA 2E7FA 3RM9A 1K9EA 1X1ZA 4JQ9A 1QNSA 4F0LA 4JD4A 1P4CA 2Z6JA 2X16A 3F4VA 1GWJA 1UZ4A 3QOMA 4EAYA 3SRDA 4CNPA 1QHZA 1SW7A 1AJ0A 1GG1A 5E5CA 1UROA 2ZUMA 3NPWA 3U7BA 1TJPA 3T40A 2OFJA 3BLIA 5LXXA 1QW8A 3IJ6A 4MLRA 1A5OC 1U1JA 3LV6A 2CBJA 3W1RA 2TAAA 2YYTA 5M2FX 3KLJA 4A3YA 2G96A 4IIEA 2Z1WA 4XAPA 5F2IA 1QATA 2VGIA 2Z6IA 3E9AA 3H4GA 3T08A 4AEFA 1A0CA 2D3NA 4GI8A 1ZY9A 2ADAA 3BH4A 5AVHA 3VNKA 5GNYA 4LANA 4DN1A 1GRHA 4HOXA 4IMDA 4JCMA 1GQNA 2J88A 2V2DA 3T8LA 4NJHA 4RXFA 3H2FA 3ARXA 4OBSA 1FH8A 3V5CA 4OOUA 1U5JA 2Z1VA 3UWEA 1EA9C 2YIHA 4XO6A 1NOWA 1TZ9A 2RFGA 1H2IA 2Y1HA 2Y4SA 1HJVA 4LCRA 5A6KA 1TPWA 1E3XA 1V0KA 3FS2A 2VENA 4UTIA 3F03K 2ZX7A 3PFMA 4E2VA 1EBDA 1L6YA 3L2LA 3FYOA 4QE1A 2Y8KA 3L2MA 4UMBA 4LVGA 4YXGA 5CJMA 3W37A 3S9ZA 2PBGA 5CAKA 4LBUA 2DH3A 1MEWA 2J13A 2R8WA 2Y70A 2EF9A 1I2NA 4QTGA 2XFRA 3GXPA 1C29A 1B5TA 3JR2A 1JVNA 1CBGA 1V3HA 3MBDA 1T40A 3LN3A 1XBZA 3PPHA 4NHVA 2ZCGA 1EF2A 3EMQA 4MF4A 4YHGA 5C55A 3IGSA 3PC0A 2HXTA 4AVOA 1I8JA 5LNVA 3K8KA 1W91A 3AOFA 4ZO9A 2PP0A 1JCYA 4FF5A 1VHCA 3USZA 4MUPA 3SSJA 3M47A 3QHNA 5DMLA 2D0HA 3N9SA 1UG6A 1R2SA 3LADA 4LCQA 1MRAA 3BAIA 2OEMA 1FH7A 2XGBA 1JPIA 3DYPA 5EKYA 4QE4A 3TWAA 5A8MA 4DJFD 3SGGA 4YIWA 1TA3A 3ARWA 4JEQA 2XSBA 1GOXA 1W3LA 3GHRA 3MSGA 1F61A 3A7UA 1KGWA 1WYGA 3HURA 5T9CE 3HZ3A 2E9BA 4AY7A 2G8ZA 2DZWA 3FGCA 2W3SA 1FWTA 1KTCA 1F3XA 3H2MA 4HKPA 1BVZA 3GTIA 3LCHA 4F8XA 4NKCA 3CJPA 3GQYA 2P8CA 1WV2A 5DF0A 4BZYA 1SO3A 2NT0A 4JTTA 5D2VA 3M0HA 4A21A 2X30A 4CCZA 4D2JA 4QAIA 3V5OA 1FEBA 2H9AA 5HJLA 4M29A 1KW1A 2E77A 4JFUA 5EBKA 3DGZA 1E70M 1LWIA 3TLQA 4JTSA 3N13A 4Q8VA 2EQDA 3EKZA 1SZFA 2XSAA 4ZFCA 3CHVA 3WDIA 4DBDA 3GDLA 4H8VA 4Q4SA 2E25A 4LVAA 1GKQA 3APYA 2RKXA 1OF6A 3WMCA 3B40A 3N4FA 1FFVC 3HPZA 1HKWA 1POKA 3TXZA 3CHFA 3NQVA 3QMSA 2PRLA 3SCWA 3VX0A 1E6PA 1QNRA 3E5PA 3HQOA 4ZBCA 2EQ7A 1SYTA 3B97A 3W75A 4BI5A 5FSDC 3W88A 4JTRA 4PSRA 2FJKA 1QT1A 4QQ3A 4LC8A 3NXFA 1AZ1A 4J57A 4LUTB 1P0KA 3BLOA 3KRZA 1OEPA 1XWYA 3OLIA 2GOUA 4XZIA 3N73A 2IKIA 3T4WA 3VC6A 2WC4A 4L4MA 4TXEA 3STCA 1JDFA 3V7PA 3ZVHB 2YVFA 1H61A 4W4QA 5HMFA 2C1GA 4GRTA 2WPBA 1TJ2A 4N4PA 2QUNA 2NV9A 1TO3A 3HG2A 1DBTA 4DJDD 1PKLA 2HE5A 3W01A 1TFVA 4NYYA 2WZEA 3UZ5A 4ZTXA 3WY1A 2BVTA 3SJNA 3E49A 1H7OA 3CAKA 1S5TA 4P7NA 1Q1WA 3C6CA 1BF6A 1P7TB 3VKBA 3UQNA 5FS8A 2VQTA 3EXSA 4D6GA 4BFAA 4A8LA 1BD0A 4X9SA 4AISA 3ZLFA 3SB0A 3OJGA 3WL1A 1GOQA 4E8CA 3FDGA 4O1AA 2EPOA 3N17A 4IFOA 4UFMA 3NPVA 5JBEA 4HNTA 5DX7A 5U25A 2PTYA 3FJNA 1E6RA 4JX6A 2I9UA 4WDTA 2A21A 3H26A 3IPWA 4US6A 3MT1A 2ZA2A 2CLIA 4MNMA 4ES4A 3PG9A 1GZJA 4DWSA 1TPFA 3QVQA 3ZR6A 5HOSA 3MSDA 4MNJA 3TROA 3VI2A 4Q8TA 4M7SA 4IGMA 2DZPA 1UA7A 3M0KA 4TX6A 2XN1A 4Q4KA 4ZSTA 2I5QA 4AMAA 1LROA 1GCYA 3MVIA 5H6HA 4WKAA 2QVNA 1QRQA 4IMFA 1OCQA 4KRZA 4NAEB 1US3A 5ABFA 4FLSA 3TONA 4ZO6A 2XIBA 2DSZA 3VNDA 3I3EA 1LORA 1ZMDA 3LM3A 4RDZA 1M7OA 2J7EA 1W5OA 3VD4A 3S0CA 3VOIA 4PCTA 1HFBA 1KM2A 2WCSA 4LRTA 4BI6A 1E1CA 1GVSA 1VFUA 1F76A 4NEVA 1EEPA 3OBKA 3GVGA 2OGJA 4J56A 2WP6A 2GDVA 3DGHA 3DYMA 1ITXA 4BQ3A 3R8RA 1X2GA 1LOSA 5BMWA 1RBAA 3QC3A 9XIMA 4IUGA 2HZGA 2PTZA 1OABA 1HKKA 1V7YA 1AA1B 4PYSA 1QI4A 1DJNA 1WYIA 3D5HA 3W70A 3MDWA 3HPXA 1DOSA 1NHSA 4WEVX 5BW6A 3JUGA 2FMNA 1IYXA 3HQPA 2D73A 1OWQA 3SCNA 2GJXB 2EQ6A 4S3FA 4EACA 2YXOA 3VINA 1QVBA 4IL0A 2BCPA 4B5SA 1DORA 1EPXA 3R12A 1F5ZA 2DVUA 4H4UA 4UXDA 2ONEA 3CIXA 3R94A 3ANYA 3UR8A 3W7CA 3MUCA 4R34A 5J5DA 2FYMA 3VMNA 4QJ4B 2WK2A 3GVRA 2CNCA 2FDSA 3LGGA 5DBUA 2WZMA 1FHVA 1SSGA 3M5ZA 3OLEA 1EJSC 4JHMA 3T55A 1TVNA 4V1XA 1H2JA 1ZDLA 4JYFA 4DELA 2OX1A 5JCMA 3SQLA 2YR1A 1VS1A 2OG9A 3DEQA 3P60A 4FALA 4JTAA 3C2VA 2YXGA 2XIJA 3QGKC 4PFMA 2WP5A 4MWAE 3NM3A 1IZJA 1LT7A 1W6TA 4DZIA 5CG0A 3MKVA 3QBUA 4ZQMA 3ARRA 5A2BA 3ZR4A 1AG1O 4IJRA 3TSDA 4XG1A 3ONCA 4QROA 1KA9F 4ZQRA 3OVRA 4QG8A 4GY7A 5AYBA 3ZSTA 3M7WA 4AZCB 2WB5A 1B3YA 4JOMA 4GPNA 3TN5A 1Q5MA 4POCA 3TA9A 3LDVA 3QZAA 1LZOA 3CUIA 2VGFA 1CIUA 3STEA 1EZ2A 3IWPA 3WF0A 1GEQA 3THDA 2DW7A 3VMPA 3BK0A 1XLJA 1VGAA 3LRLA 1CW2A 3HQ1A 4XZLX 3GTFA 2X7VA 1O1ZA 4HNNA 2XVPA 2WMKA 5AZ1A 3EWWA 1ZRQA 1IIHA 3M16A 2BNJA 2BHZA 1WKYA 2E9MA 5L9FA 1PWLA 4G9PA 2EQ8A 1ZAIA 5GNZA 4PUWA 3VABA 2W79A 2AQVA 3UZWA 4B5NA 4OKDA 3T7VA 3MKKA 1WZLA 5G2HA 3D6NA 3KRSA 2XVLA 4QGCA 4PBFA 1GESA 5AC6A 4F2TA 3WJXA 1OGGA 4JTKA 2EG8A 4HA0A 2WLYA 3WELA 3RMJA 3NAVA 3EB3A 2H90A 3MCOA 4QS6A 3SUVA 3RJXA 5HNNA 2OWWA 3F2CA 4DYEA 4QAWA 1TV2A 1RP8A 1UP3A 4DUVA 3WEOA 3L4YA 3QR3A 3P61A 4Y9AA 1GYMA 1ONWA 3E5BA 1NFBA 3HV9A 3B9EA 5DRCA 4O1EA 1Z69A 3W2MA 3NGJA 4E5TA 5DELA 1W9XA 1UD8A 3ITXA 2CZFA 2Y24A 4AZBA 2BOGX 1JDEA 3BE7A 1XRSA 3CC1A 2AGKA 2GJNA 5ABTA 1HP4A 4IPPA 3K4WA 3TMLA 4DPQA 4WKFA 2GR2A 1E5NA 2PPGA 3IJLA 1HVQA 3EEGA 3PZMA 1G01A 4ML9A 4JFVA 3FYYA 2E40A 2J78A 1J4EA 3QYQA 3I7RA 3M7SA 1W9BM 4XK2A 2AQWA 2NSXA 1JRPA 5C9UA 4UOQA 2ESCA 4UR8A 2KAUC 2QV5A 3WDRA 2ZZ5A 4ZGYA 3GK0A 4AW7A 3NJ3A 4HPJA 2Q01A 1DE5A 1XH1A 4PTMA 3R10A 1QOQA 1TMQA 1O95A 2LLEA 3EEZA 4GYPC 4M6VA 4M6PA 4MIMA 3IUHA 4G5DA 2R1KA 1G4EA 1BYDA 2A8XA 3UY8A 4HNOA 3T09A 2BY3A 3H4KA 3SUSA 3WD0A 1SW3A 4UTTA 1H7XA 4D6DA 4YHEA 5H8MA 4CQAA 5D04C 4RXGA 3ZO9A 2OODA 1HKJA 4QDPA 3II4A 3N15A 5JCNA 3REQB 3UZZA 3UPMA 3SN0A 3O05A 1J5TA 4FNUA 3OO2A 2OQHA 3BAKA 2CEQA 1YXYA 4S39A 4X61A 4WJEA 3ANVA 1IEIA 1H7PA 5JMUA 4U2YA 3NQ8A 5J8LA 3WG6A 4LUTA 1NWSA 2VUNA 1RQHA 1QW7A 1A5MC 1ONXA 4JX5A 1BGAA 3THQA 4JPGA 3B8VA 3UWZA 3M0VA 2WSKA 2NXGA 4J2MA 3L5OA 5G4WA 3ZVHA 1XCXA 1E9IA 2WOWA 4AF0B 3WUFA 1EH9A 4JDRA 3EWUA 2VO5A 1XLGA 3DCPA 5A6BD 4APNA 4LAMA 4QG9A 3GAYA 4QFUA 4AHQA 2GR0A 2BOEX 3WX7A 2V3DA 4JTUA 3STGA 4K6AA 3SW6A 4RPQA 4HQVA 3DI1A 3MV11 4JTCA 1LT8A 1V79A 4XZ9A 1P7TA 2NVCA 2GZXA 1IF2A 1DWIM 2Z27A 1RQEA 1A5UA 1OVDA 2J66A 1H11A 1WAUA 3HPAA 4ECLA 2HDJA 4QCEA 5HANA 1NHRA 3OLGA 1ZCOA 4IP4A 2VEMA 1VF8A 2OEJA 2DSKA 3STPA 2ZZ3A 3BJSA 4MB4A 3GXDA 4NJIA 5LA2A 4AD5A 3EB2A 1KFEA 1JF6A 2GL5A 5FS6A 4PE8A 2CZVA 2X0HA 4DLFA 1VEPA 2DW6A 5DRIA 3IS4A 2C15A 5FEXA 4GVGA 1TWWA 2ZUSA 1V4YA 3QOKA 5CZ0A 4WY0B 3ALGA 2WSYA 2QV4A 3ABSA 2PB1A 4B9YA 1V02A 2VD9A 4IHCA 1KR1A 4S3BA 1DIEA 1KM0A 5G5HB 2D0GA 3DIPA 1BXNA 2CWXA 1O68A 3KL3A 1XYCA 3DBNA 3LS9A 3AMKA 1X8FA 2V3GA 3NSMA 4NAEA 7CGTA 2WMIB 1PE1A 2CLMA 4PTXA 2PFHA 4AVFA 1SB3B 1KR0A 4MHBA 1WZAA 2CZ5A 4FI4A 2ZTKA 1XKJA 5ABEA 2CETA 5FF0A 1L8PA 3NYZA 2X1RA 4XAYA 3KCLA 1EX1A 5DXXA 3CUZA 4HHHA 4PMDA 3SCTA 2ZDRA 1KGUA 5JIWA 2XISA 4IX2A 2XPKA 3ZLHA 1TJ0A 4YL2A 1ELSA 4JQAA 1TMHA 3TWBA 2IW0A 1BYCA 3KUMA 3KFTA 1Q1RA 3ARTA 2JALA 4PRRA 5H2ZA 1EWDA 1UKSA 2DT0A 4WJXA 4V33A 3UP8A 4AZGA 3PBUA 3ABRA 3W4RA 1UJPA 3SR7A 1VYPX 4FXFA 4L6OA 8CGTA 2CZDA 4GUGA 1F6YA 1XPYA 2IPJA 1A3WA 5C6MA 4GNJA 1YTDA 1HO4A 4DJFC 1X1OA 3I6TA 3NNTA 3SGUA 4JTGA 2EBNA 1I9CB 3BGJA 2DORA 2GJXA 4QXIA 4QNEA 1JD9A 3W7MA 1X7IA 3C2EA 3G1HA 3UJRA 3KOZA 1MDRA 3HGJA 3P6LA 4RX0A 1EUAA 3FA3A 2QNEA 5DMMA 1FWDC 1OG6A 3J7HA 5T9BG 4D9PA 2CBVA 1IEQA 2OOFA 2WSQA 3PPGA 2PDMA 4ML4A 4N6EA 3KOXA 1K6WA 4IZGA 4MAVA 3IGUA 3WDJA 4RKAA 1VQZA 2V8ZA 4D6CA 1JAKA 2YW4A 2UZ9A 2DUZA 1LG2A 4LNCA 1UW9A 4JIPA 1PHQA 2FVKA 1UWUA 4F66A 2V3AA 1BKSA 4J7RA 3RCMA 1TCDA 1UZHA 5JCIA 1YBQB 3GU9A 5M17A 3MC5A 4O1DA 4IQJA 1RK5A 2VX4A 1DHPA 3M5VA 1XP3A 3OLDA 4R7WA 2OB3A 3W86A 1V03A 2RDTA 5ABGA 3B8SA 3O8AA 4JQ4A 1TE1A 2ZZ4A 1I75A 3BW2A 2VCCA 3KP0A 1Q6LA 1HX0A 3PTMA 1VIWA 4JKLA 1U22A 3A4JA 4AZCA 2A0NA 2O92A 3FK4A 1YHTA 3AHTA 3WD1A 3QN3A 4GY0A 2FZMA 1GVEA 3CTTA 5HXMA 2GVYA 3WEZA 1C7TA 3KXQA 1F3WA 3LHUA 4RDVA 2KX9A 3PY2A 3UG4A 3KDOA 3N6QA 2YA1A 1XBXA 3MHFA 3SRHA 2IKGA 2P76A 2Y5EA 3AYVA 2AMXA 4RK8A 2W62A 5G5IA 1H5VA 4HMCA 1KV8A 4LV4A 3NVYB 2BGQA 5I3IA 2YXXA 1A5BA 3BMWA 2GVLA 5KVHA 4DJDC 2EJAA 1HJXA 1W1VA 1A4LA 3A3WA 1ECQA 1NWTA 1W0MA 1GPFA 4U4MA 3C86A 2ALDA 3EWBX 3MUXA 3GKAA 2FFIA 1CB7B 4QISA 1ZK7A 3ID7A 5EMUA 2PDHA 3M0JA 1DP0A 1MXGA 3UXLA 1TV8A 1JZ6A 3R1ZA 3FEMA 4BWLA 2JK6A 4LS2A 1Q2RA 3ATYA 4NILA 2WSPA 4FX9A 3P3BA 5F2LA 4Q8OA 1TYGA 2BLEA 1UR9A 2VVSA 1E73M 3RPDA 3QR0A 1EZWA 3EAOA 2V5DA 5JCLA 4U2ZA 5U7SA 1OIFA 1DV7A 4ZE4A 1H63A 2V6AA 3MBFA 3KZSA 3AMZA 1TZ7A 2NQ9A 4GFIA 1BZLA 3OU8A 2PA6A 2J7CA 2X8GA 4O16A 5LNWA 2Z7KA 4LUYA 1M3UA 1H5YA 1EOKA 2ZQ0A 2GUUA 1E9ZB 1P48A 2CERA 2OLSA 3IIVA 4J3XA 4YCPA 3ZT5A 4INFA 3WH8A 4J9JA 1DWFM 1YIXA 1W9PA 4C6QA 3QR1A 1AD4A 4GCXA 1UR2A 1JCTA 1EC8A 1OINA 3HG5A 1EP2A 3KHJA 4H01A 5T91A 2GSJA 2QIIA 1G4PA 4F48A 1NH6A 2CPUA 2Z4GA 4KGLA 1X1NA 3QKZA 4FNRA 1TIWA 3R7MA 1N8FA 4NZ5A 2IXVA 1N2VA 4D1IA 6TAAA 4M1RA 1S5NA 2D2GA 1V93A 4DB7A 1X6LA 6XIMA 2CXGA 4C6BA 3UWYA 1AW5A 1J2WA 1AW2A 1OZQA 4GWEA 1V6TA 2WMHA 2GGGA 4GRSA 1HO1A 1OYBA 2A3BA 4H4SA 4LCSA 2OZ8A 5CSYA 2ISFA 4NIRA 2H3DA 4HJFA 1XCFA 1SGJA 1F74A 2QUUA 4J4KA 1DTNA 5K9XA 3PJXA 3G1XA 3C3UA 3REQA 1YW1A 3GYCA 2XZ7A 4WD0A 1HVXA 1QR7A 3L0NA 3TN6A 3IGXA 4IMEA 3WDQA 3ME3A 2YFNA 4H4ZA 2ASHA 4HVXA 2R24A 3PBGA 2UV8G 3IACA 2H6RA 1N8WA 4Q4PA 3W2NA 3QHOA 1D7KA 1W5NA 1PSCA 2V2CA 2E6DA 4YVVA 1ZZMA 3KVLA 3IARA 1FX6A 3C2OA 4YTRA 4HMEA 1SZGA 3BWWA 5BROA 3SCUA 1UR3M 5CBBA 4S3DA 2QDGA 3AU2A 4AF0A 3TUUA 1C8XA 1M9HA 1YEYA 3VZYA 2W27A 4OWGA 4DHGA 1XYLA 1P5BA 4GOAA 1ZJIA 2XH7A 1PB0A 2BC0A 2V69A 4HN8A 4FPSA 2RGLA 3G22A 3K1GA 4ATWA 3S1XA 4HZMA 5AHFA 3EOOA 4JIEA 3UWUA 1Y65A 2VDIA 4ZTYA 4N0RA 2WHJA 4JTFA 4GIEA 2DVTA 1BVNP 4ICNA 4Y9NA 3WQOA 5LIWX 3E6EA 3CTLA 4MPKA 5G4HC 1FBAA 3MKCA 4NZ3A 1XG3A 2QJMA 1OY0A 3BO9A 4H9TA 1H1YA 3UEQA 1LQ2A 1W3HA 3N04A 4D8LA 4RNHA 1V0MA 1SPQA 1HW6A 3V0TA 3H4WA 4D6HA 3CUGA 3NVTA 5LXEA 2HBVA 4ADWA 4GZJA 2G3MA 5AC8A 1M1BA 1OFBA 5K2ZA 1XANA 4LOCA 3BDKA 3WNNA 1O4UA 2AL1A 1LL6A 3W2LA 1J0ZA 4WY0A 5D32A 1XW8A 4C6JA 4H2HA 4QNWA 1JGIA 3VGGA 1SR0A 2J77A 3VZZA 2R9RA 4GH3A 1QNOA 2I16A 3E38A 5A2CA 4M24A 4PTVA 4NZ4A 3VOCA 4NI8A 3QY6A 5CZTA 1ME8A 1TELA 5CC5A 2WMIA 2VZOA 4IIHA 1KO0A 4EQRA 2XHYA 3TYCA 2ACUA 5LGZA 4PMVA 5E93A 2J7BA 4K8EA 5HINA 4C6LA 5JBFA 3UJ2A 1C3FA 1B9ZA 1OX4B 3MPGA 3W00A 1P1MA 1B1YA 2H8ZA 2WNZA 3MA8A 4B5TA 1FWBC 4HPXA 2QMKA 2XWDA 4IMGA 3UR7A 3OGVA 2YLAA 3QFAA 1RQBA 1FUYA 2INEA 5G2IA 5HQLA 1GT8A 3AHZA 4QDMA 5BOFA 5CJNA 4J1OA 1N8IA 2WMJA 1FECA 4M8UA 3O16A 4W87A 3VGEA 4R85A 2GSEA 3NURA 2P1FA 5LYRA 4EMJA 2QAFA 4E3VA 4LB3A 4MY9A 3SRFA 5EMJA 4TV5A 4IGHA 1BLIA 4XBSA 1R9ZA 4EQXA 1YKWA 4GBUA 3TTSA 1NARA 4UUIA 1OB0A 3GS6A 4Z1AA 4O8AA 4MLJA 3W3OA 3LOTA 2DV0A 4UFJA 3WD4A 5GVJA 4O19A 3S3GA 4L1WA 3LXAA 1UD4A 3CGBA 3ZVIA 4D6FA 4IJCA 1FEAA 2XGIA 5HMDA 4CEXC 1JYVA 3AMLA 3VA8A 5BXPA 5FAGA 1C92A 5C8BB 2D2OA 1BSIA 1W9VA 2ZOXA 3LGDA 3NDYA 4GI9A 4H6RA 3PS7A 3FSTA 4XISA 2QR6A 3ITCA 3L4VA 3VIOA 2IQDA 1HJSA 1E6NA 4H4TA 2CFYA 3LERA 4LBSA 3DXIA 5EMYA 3EOLA 2Z2BA 2Q09A 2CLLA 4DZAA 3QQ0A 1DEDA 4KRTA 3RM4A 4S38A 4C91A 4LX4A 3Q37A 1EB3A 1DJXA 1VFLA 1GV4A 2Y88A 3ZOAA 3GDKA 4S3CA 2YAUA 3FN9A 1GRGA 1KBJA 1XDJA 1XIIA 3EXTA 5MHBA 2GDQA 4K7VA 4KCWA 3CM4A 3BLPX 1F6PA 3TYBA 5IBXA 1JCMP 2QIWA 1JNEA 1Q6GA 2GJPA 4H9UA 3GB6A 4HPGA 2XUCA 3L2IA 3DK8A 4LVDA 5ENLA 4P61A 4PA8A 4PB5A 1KFJA 3R0KA 4ZO8A 1MI3A 3URBA 2ZUVA 3DX5A 3SY8A 2Y89A 2PWVA 5ABHA 3C52A 1LRQA 1BG9A 1XLKA 5M1TA 4C6NA 1OFAA 2CYGA 3ES8A 4FXJA 1OFQA 1YE6A 5CSUA 1GSNA 2PDWA 3S1UA 3MHUA 2ZUWA 4FLQA 3H2EA 2V5JA 1YTEA 3KOFA 1DNCA 3LPFA 3TIMA 2VEGA 2XTKA 3QV8A 1K4QA 1RBOB 1LRNA 3ARUA 2NW0A 4CCCA 1VPQA 1PZ1A 4G6CA 3LHZA 4CQDA 2J7FA 1EGVA 4MOZA 5A8QA 4C90A 2VFFA 2YL5A 2NUWA 3V36A 1MUWA 3E2QA 2X2YA 1RD5A 1JZ2A 3CUHA 4GVFA 3W0KA 1NOUA 3S5NA 3MCNA 1V3IA 4HMNA 1PX8A 1OFRA 1E0VA 5KETA 2H3BA 4M52A 1OM0A 1RCQA 4B15A 4YWOA 1O12A 3W27A 1EIXA 4FDCB 1JGMA 2NQLA 1WDDA 3B3DA 3RLUA 1I2QA 2WQDA 1CEOA 2YZRA 3URNA 1X38A 4N9BA 1SZNA 3GH5A 5HMSA 1FWCC 1LUCB 1PX3A 3LLDA 2QQ6A 3DK4A 5GJMA 1VFTA 4O15A 1HJUA 4K7ZA 2YVGA 2VDGA 1P6WA 3UBPC 4BKNA 3QQ1A 1OFDA 3VNMA 1TYPA 1V5XA 2ZICA 1E71M 2AAQA 3UCDA 4DXKA 1J96A 3HA1A 4FLOA 3NM1A 2VFIA 3TSMA 3SCRA 1E4NA 1ALDA 2F6KA 4ILSA 4B2DD 3A24A 3Q45A 2OGYA 3WLIA 1FHDA 3AWNA 4XX6A 1SU5A 4C6IA 1HKIA 2DY3A 3LCIA 3OZOA 1B3ZA 1W56A 3R2GA 3ZLGA 1Q8AA 2J47A 1H60A 5HBFA 5EGRA 1D3HA 3ITLA 2FDMA 1K8CA 4H9ZA 1F9CA 4GJIA 5AC5A 1BQGA 4O53A 2CCRA 3TTYA 3DBPA 2DVXA 4KW2A 1B0IA 1ONEA 4MWAD 3EKGA 3MO7A 1X2HA 2J24A 4ZVJA 2E0PA 3CL7A 4GYFA 2WHLA 1XV8A 3S9IA 3GFXA 2ZYFA 1UD5A 3R4IA 1Y5WA 3EDFA 1EBHA 3VIMA 1ISVA 1I2RA 3VX1A 4H4YA 4W8LA 4C7GA 3R11A 4EPEC 1XFBA 1NJJA 4GE8A 1VH7A 2XVNA 2GOKA 2QEZA 3OVQA 1TWDA 3B9DA 2J79A 4GKLA 1LBLA 3P0WA 4N02A 2WZIA 3FV9A 2NVKX 4K3ZA 2QCLA 2I56A 4M6UA 1LWHA 4NRSA 5IHSA 1ZP4A 3HPSA 3M0LA 1TWSA 3RN6A 3RU8X 1KXVA 5D9NA 5AYIA 1XHCA 1UMLA 4W9TA 3EA2A 2QPUA 2D2JA 4P8VA 3N2OA 3WYZA 1RPXA 4IG2B 1FWFC 1JD7A 1E6XM 3IUDA 3SQMA 2J74A 4PH6A 1VR6A 3LEPA 4JY8A 3T0DA 3KS5A 3ABZA 2L5HA 2X7WA 3LXBA 2I9EA 4FO4A 4WZHA 2F6UA 4GQBA 4AC1X 4AEEA 4JFWA 3GIYA 2PWGA 4XAZA 3IJ7A 3B03A 1SVDA 1WB0A 1XD1A 3KRUA 1VC4A 2PTDA 3LBCA 1YPFA 1HIZA 4H7ZA 1QW9A 4IGNA 1IT0A 3NQMA 3N19B 1XX1A 2VRQA 1HUVA 3CYVA 3IK2A 3G1YA 1EUNA 1ZU8A 1PYFA 3FYPA 4UOJA 4MG4A 4CN6A 4UNLA 3LHYA 2E6FA 4W86A 1KGXA 1KQZA 2Z1KA 1W54A 3NOYA 1BXCA 2ICSA 1VIZA 5A3HA 3AIUA 1X96A 4I6VA 4ZOCA 1TWZA 4Z1YA 5D9OA 3CGTA 4GQRA 3I3DA 1GW1A 1F3TA 3A64A 5C2CA 4WUIA 4GGHA 3VGHA 1G7UA 4R27A 5EYWA 2ATSA 5EU9A 1JFHA 1S5WA 4UTLA 3PUEA 3VMOA 1XUZA 3PVFA 3MI2A 1OX4A 1PUDA 5AB3A 3POHA 3V16A 4Z2LA 3EZ4A 3VDAA 1TJRA 2WZTA 1B3XA 3FKKA 1K9DA 2QJNA 1FKWA 4R3UA 2GR3A 1NDZA 4GCAA 2FIQA 4GXMA 3E0IA 1EF3A 2ZZ0A 2PGRA 4XKMA 2ZRVA 4UMCA 2HV5A 4W7WA 1XRTA 2BS9A 2DZAA 3ISIX 3PK7A 5K4ZA 5IHRA 1JRCA 3GRIA 1GHRA 3SAZA 1PHWA 4ASTA 4TV6A 3TMQA 5BRQA 2NLYA 3L5LA 1TRDA 1GRBA 1KFBA 1HJWA 3LZ3A 2PODA 3S9YA 3L66A 1K8YA 4LGXA 1WCGA 3BG5A 4HU8A 5MKGB 2CU0A 1XYFA 1YQZA 3NL5A 4UQAA 3Q94A 4C60A 4AHPA 3G0UA 1FCBA 3W7LA 3U4FA 1J10A 1UQYA 3V18A 1FXPA 1UUMA 5FMHA 4I7VA 1H51A 1ZALA 1XIEA 2CLKA 1TRIA 5FD0A 5FF7A 4H4QA 3HTWA 4IXXA 4GH1A 1EJVC 3DFSA 3G0XA 3RX3A 3T2PA 1F7BA 4X0NA 2AOSA 4MUZA 1NM9A 4FNQA 2VVNA 3EANA 1XDLA 2YL6A 1A3HA 5C5YA 1GONA 1R5YA 1FP8A 1PDZA 2J7GA 1TUXA 2W9MA 3B9AA 5KVIA 4KKXA 3T44A 3LMZA 3N2TA 1Z32X 4KWUA 3O6CA 2QGYA 4XZNX 3RX4A 1EDQA 3LNPA 2NXHA 1LBFA 1W32A 2EPMX 3O6YX 4UQDA 2OO0A 4KEVA 3N25A 3QZEA 5AY7A 2YJQA 3OBEA 5IM51 1UIOA 3ITGA 3VXGA 1RAKA 4S2CA 3UZJA 1PWMA 3NZGA 1QPNA 4HNVA 3W1QA 2VT0A 5C7HA 3PP7A 1QFEA 3F4WA 5I3HA 4BQ5A 5D9PA 3KDNA 1UKPA 3WNLA 4HN4A 4I9MA 1ZGDA 3A23A 3PANA 3HIJA 3E12A 3RK8A 3RG6A 1T6MA 3SUTA 2BBFA 4XKYB 1OGSA 3G6MA 1SO5A 1TQXA 3CEPA 3KM8A 3ZMRA 1E72M 2W4XA 3N14A 4UCGA 4OHQA 2VOTA 4V28A 2V6OA 1W1YA 4C5YA 2W0UA 1TTJA 4PODA 4ROQA 1MSSA 1J0HA 3TEVA 3OTRA 1U1UA 1EYWA 5HNTA 4A2RA 4AYSA 3L4WA 3CQKA 2B4GA 2Z1SA 3C0QA 4K37A 4EF9A 2CKSA 1MW1A 2WJDA 1WE5A 4UCFA 4ZOEA 2WWCA 3AYSA 4PULA 3WQ4A 1XS2A 2VXNA 2PD5A 5TBOA 2YL8A 3IVSA 4CGTA 5DLCA 2DP3A 2EO7A 3QW4B 2YPIA 4XAFA 1QNVA 1J0YA 4S3AA 3KLLA 3FEQA 3L0KA 4OTKA 1JOAA 3WF3A 4IFKB 4MAZA 1N62C 2WVVB 3W2JA 4O0QA 3AIEA 3OHMB 4C1NB 1CGXA 1R7AA 5IFPA 4CD8A 2PDFA 1HL2A 2ZA1A 2O4MA 3P2VA 3PZNA 2C7FA 1KXQA 1OQFA 3AXHA 4UR9A 1XGDA 4Q8QA 4ONVA 2IUZA 2E6AA 2VKZG 4CNUA 4KIRA 2DPEA 3NQEA 3ZZ1A 1EOMA 1A5KC 1ICPA 3IIZA 2Y85A 4EE9A 3NZQA 4ERIA 4ICCX 5CAHA 3R07C 1C8QA 2Y5SA 4RE4A 1LUCA 2CBUA 3GXFA 3POCA 3QFWA 3W72A 1W8SA 1KM1A 3CWNA 3E0WA 4GACA 3OGSA 2XIOA 4L4LA 2J75A 4A3QA 4FB7A 1WDWA 3AYRA 3UCQA 3IAPA 4UTFA 3U2OA 1ZS2A 2R1LA 4JN7A 4Y7EA 3LRKA 4DZHA 3HF3A 1JDDA 3UXKA 3FDKA 4H4XA 1W3KA 1XCWA 4S3JA 3VKCA 4B5XA 3DUGA 1RLCL 1GRFA 3B05A 3BTNA 8A3HA 4X0VA 3S6OA 1C8YA 2E68A 1PO9A 1DJYA 1MNZA 3NFUA 5CZJA 2QCMA 3XINA 1F07A 1I1WA 3HRDC 4AZHA 1K02A 1S38A 4M1BA 9RUBA 1AUSL 4A8RA 2W54A 4ZCWA 1QHOA 2PDKA 1KXTA 1EDGA 4F3HA 1DQXA 3JU2A 1XJBA 4ZB5A 2JIWA 4RNIA 4B3KA 3ZQ9A 4A8IA 1EJXC 4C6PA 2E5AA 3TZFA 1R9XA 3CBWA 4K36A 2PU0A 1W3NA 1FIQB 3IRSA 1QTWA 1TTIA 1ZBVA 4NSBA 3VD5A 2QJIA 3RITA 2E8YA 5I3FA 3K30A 1H7WA 4W8BA 1G94A 4TMCA 3F2DA 1IWPA 2AAMA 4Y96A 1EL3A 1VFOA 3M46A 2DZVA 4TMBA 3VE7A 4D71A 1M7JA 3S8HA 3WFAA 2VNCA 2YGYA 2OQYA 1MYRA 1UOKA 5BYWA 4I6KA 2WVSA 3K8LA 1GYLA 1MWOA 3G1VA 2PTWA 5AYYA 4JKMA 2IPGA 4JYEA 4IG2A 5D38A 4RZ4A 4J40A 2FH8A 3PTKA 1R3SA 1UWAA 3I6EA 4NZ1A 3FAWA 4H7VA 2UY3A 5LSMA 2J6XA 1JPDX 3WUGA 3WLTA 2GLKA 3WQWA 4HHLA 1FVPA 3C2YA 1L2UA 2Q3OA 1US0A 3AIWA 4AUBA 1HNYA 2QDHA 3UG3A 3A3HA 4HHPA 3CK5A 4DJED 2DQXA 3MHGA 1E9YB 1BGGA 4L56A 1KB3A 2VC6A 3Q2DA 1NU5A 2MANA 2WXDM 5FL0A 3PZQA 1YX1A 3BSGA 3ITOA 4UZUA 4WIWA 4Z2IA 1WOAA 3L7RA 3ERPA 1ZFJA 3BL3A 3VOJA 5FJUA 4AHOA 3M5YA 3B8TA 1WKEA 4GUFA 4QR6A 4H9MA 1NIUA 2POTA 4U33A 2Q8ZA 4O12A 1NDAA 1A3XA 5E0KA 1MZRA 5A2AA 1E1FA 2BASA 2IPFA 3P62A 2YQUA 3KL5A 3PHAA 1VB9A 2HRWA 3O7UA 3P93A 2ZZ6A 3WDPP 2E67A 4ERAA 3SECA 1KFCA 3L9CA 3NSNA 1FRBA 4MNKA 1PL9A 2B7OA 3QV9A 4PZVA 2Y0FA 1DIOA 1W1ZA 2BMBA 2Y62A 1YRRA 1AMYA 3LQLA 1GGOA 4H19A 2Z29A 3ZXWA 3L5MA 5EFDA 5RUBA 3RILA 4KCUA 2PDYA 2OYLA 4U3AA 5HWMA 1PKNA 2BV9A 3MW7A 3KW3A 4QJ5B 4I90A 1RR2A 1CGWA 1SSDA 2Z25A 5HAOA 4HK5A 3TAKA 5AHEA 3TNBA 2XDFA 3I68A 3KEHA 1HG3A 2ISSA 4L4OA 3DYOA 1JULA 3GG0A 2Z2AA 3AAMA 2YB4A 1L2QA 4BV6A 4JIHA 3WK0A 4O18A 4MVAA 3D3FA 4RE2A 4F0HA 3T1GA 1UKQA 1GNXA 2PDJA 5MKGA 4RZ6A 1CX9A 4B4HA 3WLNA 3TJXA 3B8WA 3M0YA 4LAKA 1TPDA 4AAJA 1QO2A 5AN7A 5J04A 3HPFA 3NCOA 1V3KA 5D02A 2C18A 5G4EA 1XLDA 4FK9A 4KETA 3Q58A 2HEJA 2YSWA 2ZRWA 3ARPA 5FSEC 4OV9A 4FR6A 3CNYA 1H4PA 3AMDA 1KWKA 4XWUA 4KRUA 3OA5A 4OV4A 3VOFA 3BARA 5FJTA 4DY1A 3JW7A 4L64A 1O1HA 1VBHA 2Z0IA 4E6MA 2HVNA 3IVUA 3KWSA 5D09A 2XG9A 2D0FA 4GGBA 5A6LA 3CYJA 1U5HA 3SI9A 1I45A 2WPGA 1LCOA 2J8GA 4UC5A 1XHGA 1M6JA 3BAYA 3LLFA 1XLBA 2ZC1A 5EFFA 2VC5A 3U9IA 3RNDA 3KHDA 3CB3A 1XC4A 4YYCA 1KM3A 5E9XA 1ZQ5A 4WDXA 3M41A 2JBMA 4LAOA 3PULA 4JNMA 3LHVA 4JDYA 2WM1A 4A2SA 4HCLA 2X0YA 4EAMA 1UWRA 3H22A 4F2UA 3NIYA 3AIVA 3MMTA 2WSRA 2CC0A 4HJWA 4UQCA 4MWAC 4QITA 3MCMA 4I7WA 1GETA 2ZTJA 4J27A 5AZ0A 2OU4A 5JXQA 3AYTA 3JZEA 3BLKA 4BA0A 5FAJA 5ECVA 3TSBA 2VTFA 1IXPA 1W1A1 4X60A 3W73A 2PDLA 1XLCA 3GZAA 4HA1A 4Y90A 4JZ5A 4MNLA 2VC7A 2BVYA 1EC9A 2WKLA 1EXPA 1FTXA 4OQVA 4PMOA 5D05A 3K2GA 3GUWA 4XKYA 1I0BA 3S83A 3BMXA 3GD4A 4A29A 1MW2A 1M68A 3URHA 2WC3A 1ITUA 3I3BA 3OC4A 3GG7A 3AALA 2ZUNA 1GRAA 1Q8JA 2HISA 4GMEA 4DBUA 3FVMA 4N9EA 1B3OA 3R0DA 3N6JA 3FKRA 2XH0A 1BWVA 4WJ8A 1MQQA 4JIRA 2BWGA 3TTOA 2QGHA 3W83A 3OIXA 3DJJA 1E43A 4LC6A 1A0EA 1WUEA 1GVQA 1GQKA 2TYSA 3VGBA 2FHFA 4DLMA 1KRCC 3OVGA 1I6NA 3O15A 3RCNA 3WUEA 2WM0A 4JAWA 1K3UA 1KCKA 4XZBA 3GD3A 1HXJA 3SQPA 3AM9A 3LPOA 3LZ5A 2WANA 4K8GA 3T2OA 1XLLA 3HMJG 4US5A 1BTMA 4CLMA 1UWIA 3EB4A 4O4VA 3VM7A 2ZRXA 1RBLA 3ZT7A 4U3CA 1TJ1A 2HE8A 4IFKA 1UHVA 3S2JA 2WVVA 1JQVA 1ZJBA 1MUMA 4HNUA 1S2UA 4JQ2A 3TFXA 1V08A 3IIXA 4C1NA 2OZ3A 2VI0A 1BHGA 2GFTA 1CLVA 4HZ6A 4P7QA 3DI0A 1UPPA 4GBDA 3T2QA 3DDMA 2W92A 1G6CA 2FZNA 3SCSA 1U1HA 4O11A 3WQVA 4PCSA 4HP5A 3W2UA 5F2GA 5TR3A 4AX6A 3ZFHA 1DWGM 4MYXA 1JEHA 2FLIA 5BZAA 4O57A 2NV2A 3VNLA 4JS3A 1XH2A 2Z7GA 2ACQA 1C7SA 3C0SA 4X2RA 1Z9AA 3TW6A 4UFKA 4YWSA 1TMLA 4I5XA 4S3KA 3EDKA 3ZSSA 3SIMA 3CAWA 1TCMA 5DO8A 1XQLA 2D23A 2QCNA 3KOWA 2DZUA 1ZAJA 1TV5A 2ZXDA 1S2VA 3UWQA 4XIAA 3HGOA 4JNZA 3TTQA 3WSUA 5CJ5A 4ORMA 4GVIA 3GO2A 3RO6A 3VOHA 3PAOA 1VKFA 2QKFA 3THAA 1GJUA 1CT5A 1U33A 3PBYA 2OT1A 3DESA 4Z08A 1XXXA 4KFNA 1C9DA 5C9ZA 4AD4A 3FIGA 4LXFA 1IHIA 4Q6JA 4QG6A 4WGHA 1KWGA 3CHCA 1D7FA 1EHNA 1WQ5A 1SUXA 3KBMA 4LEFA 2J27A 1XIBA 2Q71A 3W1LA 2EG6A 5ER0A 5A94A 4PEEA 2V5KA 7PTDA 4AZ7A 4IICA 2ZXAA 3AXIA 4KCTA 3KRBA 1VBUA 5CPSA 1GOKA 1S2AA 3VIKA 2G41A 2GVEA 2RUSA 5E1QA 3LENA 4RDYA 1NHPA 3VD7A 3LHTA 1MZHA 2C16A 3AS1A 4PUMA 3GNNA 4UQEA 3NO1A 5BXTA 4CNSA 3WLOA 5CGQA 3AS2A 1ISXA 3VNZA 3W82A 2OWXA 5CQ1A 1XIGA 3CGCA 4HIBA 1MW0A 2CZEA 4Y9PA 5AHIA 1O5XA 1R6WA 2X40A 4Z1CA 5AC7A 2X1IA 4H41A 4CN1A 4ACYA 4GC3A 1S3HA 5C54A 3P0XA 2ALRA 3WNOA 3P8IA 3W7NA 4FR1A 1B2YA 2ODOA 1VCFA 4E2BA 2Y7GA 1OC5A 1JYNA 3RLHA 4ZENA 3WLSA 2G4JA 3KZPA 1UOZA 4Z42C 1JPHA 3MVTA 4U28A 3NQ2A 4EPBC 4P7LA 3B8IA 4E2DA 2VEIA 3RNMA 1W5QA 3HQNA 3S46A 3ANUA 4B16A 4JHZA 2PDIA 1BWLA 1F3EA 4ZA0A 3BG3A 3GR8A 1O66A 3WLPA 5F1VA 4O28A 1TR1A 4K1GA 1SJCA 3BW3A 2RDUA 2OYKA 1NVMA 3VNJA 3JZUA 3CQHA 3NTYA 6A3HA 2I17A 1X6NA 1ADDA 2FPYA 1VYSX 5I5RA 1XIHA 3PZTA 1OBAA 2VZSA 3DZ1A 3K46A 3AXXA 3U3HA 3V35A 3LA4A 2PWHA 1OIMA 5FS9A 3R0UA 1ZNNA 4PTWA 4DWSD 4UTWC 3HO8A 4JTDA 5D2WA 3UG8A 1MXDA 4CD7A 1OSEA 4S3GA 3MU7A 3TTEA 1UWTA 2HPMA 1EO5A 4YPJA 3VPLA 5D2TA 2YVJA 2XVKA 1D3GA 1ZCCA 2A3CA 1KCLA 1OADA 3QSRA 3H7UA 1F05A 3AJ7A 4AD0A 3AS0A 1H41A 3KBJA 1V59A 3W7IA 1DHKA 2V81A 5A6MA 1F3PA 3PNUA 7REQB 3RF9A 1XICA 4I9JA 3QZ6A 3GRSA 1BRLA 1BF2A 3A9BA 3GVVA 1OJTA 3SFKA 2XH2A 2A1YA 4XO7A 4GZ7A 4KEZA 4WDWA 3HW2A 4I8YA 2GSHA 1YQ2A 1IQ8A 2FH6A 5C70A 4EMIA 5KZ6A 1LPFA 3OG2A 1WZKA 2PGWA 3AO0A 5I6SA 1W1B1 1PS9A 3UJFA 3NVDA 4ZEPA 4AB4A 1EIBA 5FJRA 3L12A 1CTNA 5DQPA 2E3ZA 1Q6EA 3ZWSA 4PTNA 5F1UA 5DFAA 1BG4A 2JKEA 2JGQA 1S1RA 3SBFA 2WVUA 3H8AA 4KIEA 5HR7A 3IEBA 1LDCA 4Q3MA 2GRTA 1VEMA 2P10A 1FWIC 2PEVA 4KBXA 1K7EA 4JTHA 4JR5A 4MPQA 2PLCA 3OQEA 3FA5A 1TTPA 2P88A 2DZSA 5D8ZA 4JEJA 3SM0A 1REQB 1FOBA 4TUFA 2GGIA 4X9YA 2PS2A 2O9PA 4Q8UA 3D9XA 2BODX 2V38A 1GKRA 2WMFA 1BYBA 2WCGA 5A6SA 1WAWA 3N2BA 2CW6A 4H3DA 1FWHC 4JN8A 3JRKA 5H91A 5LNUA 4D6EA 1EPVA 4GUIA 1JQXA 1WBHA 1JCNA 3H24A 4DM2A 1EFZA 2W61A 1YE4A 1AL8A 5EY5A 3V0SA 1YYAA 1FH9A 4PBGA 2VR2A 4HZ7A 2VP8A 1VQTA 5I00A 2D3LA 3MO4A 1LLOA 3QV7A 4B90A 2ACRA 3DGBA 3CWHA 4IH3A 5HPOA 3Q65A 4U10A 1V51A 3PM6A 4BURA 1J01A 4IPIA 1MO0A 2IQ0A 1WDRA 4Q22A 3ZJ6A 3GSMA 1DQUA 4WY0F 4AH7A 4QJ1A 3MI6A 2X05A 3VM5A 4EKJA 1W8GA 3Q67A 3AISA 4XAGA 2HQMA 2HCVA 4KQNA 4GUJA 4D8AA 1M7PA 4ZL1A 1WZMA 2PLJA 2REQB 4NF7A 1T41A 3GTNA 4QJ3B 1GG0A 3WZ0E 4DNHA 2TPRA 1YNPA 4HPHA 4LF2A 4YWIA 5E0CA 3P8JA 3LBMA 5CG7A 2OVLA 4ROPA 5AFDA 2NQZA 2ZKMX 5C2GA 1QXLA 3D47A 5TQLA 1A53A 2OR2A 3SDOA 2PI6A 4C7FA 4O14A 1IT8A 4MKSA 1K8XA 3TE9A 4CU8A 3SR6B 3P74A 1KN0A 3DG7A 3H2CA 2X42A 3W85A 3HN3A 4JTEA 3BV4A 2FGZA 2X09A 3VFCA 4DUOA 5LHEA 5I78A 1KKOA 3SURA 1FP9A 1EP3A 4E4FA 1NF0A 4JXCA 4HSOA 4Q33A 5FS7A 3P80A 5L6UA 3E0VA 2OCZA 4AQLA 1ENUA 4O13A 2HJPA 5G1TA 4I8DA 4DJEC 5CZSA 1GERA 3N4EA 4LYPA 2NWRA 1DKWA 1TKKA 8XIMA 4Y2WA 1LBMA 2JKPA 3IJ9A 2GDUA 4RW3A 2FZDA 1DPMA 3DENA 4X63A 1BTCA 3NDZA 2HMCA 4J3TA 3LYEA 3W1UA 4HNCA 1ZUAX 3MMWA 1MRQA 4AZ5A 1UB3A 3VKDA 3G1SA 3GNRA 3HM7A 1ZB5A 1G1YA 1P1XA 1QI0A 1WP6A 3WLRA 4BS0A 1B30A 3BCJA 2DIKA 4JQ1A 4HA3A 4L9ZA 3ORWA 4NJKA 4HBKA 1E4MM 3U2CA 2J9XA 5IXEA 3SJ3A 4QLKA 3NYDA 4H50A 4GR1A 3LHWA 1XSKA 4MJMA 3C61A 1KTBA 1SMDA 3WQPA 2J62A 4XVEA 1EEXA 3W7OA 2BFGA 4IP5A 3L4UA 4HK7A 4GIYA 4HHMA 2C6QA 3H2OA 5LIXX 2VHLA 5DN1A 2DDXA 2UWFA 4MZ1A 2V63A 4PB4A 4IMCA 1DYSA 5LKYA 4E8DA 4CVUA 2NSOA 1VLWA 4MZ8A 4HYVA 2QXWA 2CLHA 2JIEA 3PZVA 3TAOA 1QI2A 2QPSA 4W84A 2V3EA 1OK6A 1XIJA 2ZX9A 5KSWA 1TPVA 3T0CA 2GYIA 4NXKA 2VX5A 2E1WA 1JI2A 4NY2A 2FZBA 3EA3A 1EO7A 4OU1A 1KFWA 5HMEA 1P0NA 1Q4WA 4O1CA 5EMKA 3GXMA 1JL8A 5AHLA 1EGZA 3DG3A 2PWEA 4GKTA 4TIMA 5JH2A 1Z42A 4AWSA 3BG9A 3GW0A 1CDGA 3GU2A 3S47A 3T9PA 3RM8A 1EWEA 4Y8FA 3PTQA 3VK5A 3ECQA 3VKKA 3CWOX 3NSXA 4R88A 3SCPA 5A95A 2YCLB 3S6DA 2RABA 2G3JA 4K39A 1DJZA 3G8EA 4IIGA 3CL8A 2O56A 1GK8A 2QF8A 5KMYA 3TKFA 4Q7NA 4IPNB 2A7NA 3WK3A 3TCSA 2VJXA 4N42A 3S6TA 1SO6A 3C3NA 7ODCA 1TB3A 2DQWA 2ISVA 3P84A 3Q4DA 3CZ8A 1F8WA 4HU0A 5I77A 4DX3A 5B7YA 4Q4OA 2VFGA 4YU1A 3QYSA 1QPRA 4EXBA 1JYWA 4IXHA 1Z41A 1XLEA 4AWTA 1VRDA 5H8UA 3MZNA 3G24A 4ADUA 3MANA 3MI3A 2V82A 2YL9A 4TX9A 1AZ2A 5EPDA 3EPMA 5CKSA 3SUWA 1GVFA 2QMJA 3SUUA 1XD0A 2ZIDA 3WQFA 2QHAA 4GI4A 4JTLA 1LG1A 2PCQA 4AIBA 3A5FA 2AAAA 4LU0A 4OGZA 3T0BA 4GXPA 1ICSA 1JPKA 3CU2A 1JZ3A 2JEPA 2EQ9A 4JN6A 3ZYZA 1WXYA 4HOZA 3R5EA 1UJQA 4ICMA 2NVAA 3NDOA 2BZNA 5HATA 2W3RA 3CMGA 2POZA 5K4XA 1MO9A 3TYEA 3CPGA 3W84A 2OQLA 3OBAA 1OCBA 1R8LA 4GX9A 5F4SA 3K13A 7A3HA 3NO5A 2ZX5A 3DHUA 1VENA 2WJEA 5TIMA 2R82A 4ZXLA 5CXPA 1XISA 2Z26A 1V6UA 2D22A 1DTUA 4NRRA 4W8AA 4WR3A 4UFHA 2PE4A 4XD4A 1R3YA 1M53A 3SY1A 2GQWA 2V3BA 1DQWA 1CGYA 1J6OA 4IQDA 4PUDA 4W5ZA 4JFSA 7REQA 1EC7A 5DT5A 4H8NA 3O0FA 4BQ2A 3MSRA 2VZUA 3A7RA 3E74A 5CBIA 3TA6A 2PGFA 5XINA 5HQMA 3D46A 3TN4A 1TPB1 2ZZ2A 5I03A 3CZKA 3GW3A 4RCXA 5JIPA 3CHEA 1LF1A 3PWIA 2OZ0A 3VILA 2C0HA 2Z28A 4CVWA 3B0PA 4Q8WA 2J7DA 1LOLA 1CXIA 5DY3A 1WA3A 3R8GA 2QJHA 4MKNA 4XTIA 1AFSA 1YDNA 3PJWA 5FIPA 4Z0JA 4DI8A 4LJ3A 3N6HA 1AJZA 1B3VA 1NY1A 2FPVA 3RHGA 1XLAA 3QFEA 2YCIX 1V6YA 1OK4A 4DNAA 1N55A 5EMLA 3ITVA 4B3LA 2W91A 1E0WA 5LIKX 4F0SA 4Q4MA 2QLYA 1AVAA 2NPXA 5CPNA 1JI1A 4HU3A 1IWAA 5C2XA 1LJYA 4QRNA 1SO4A 3WF1A 2YB1A 3TR2A 4QEEA 1J79A 2WJZA 4XQ6A 3PPFA 3BAXA 1DL3A 4N4QA 1GQLA 5H1WA 5FEZA 3AFBA 3B04A 1REQA 3DECA 3UA4A 3MJMA 2WQPA 4F40A 3VVGA 2YKKA 4XB3A 4PMXA 2WNQA 2YOCA 4DI9A 3DOPA 2VR4A 1HQTA 4L5ZA 1W1IE 4NU7A 1Q45A 1IGWA 3QGVA 3SSZA 3K4AA 1QASA 3GHSA 1ODZA 3QLDA 1OYCA 3W87A 2WHKA 1KRBC 3GXTA 1NQKA 3INPA 4YCOA 2ZWZA 5GJNA 3MQTA 1DXLA 1R9YA 5F4WA 2AKZA 3PZ9A 2GQ9A 3U0HA 4LS1A 1FHLA 3IIOA 2DIJA 2NUYA 2GGJA 3V75A 1TPUA 4MSSA 3HJZA 3OHIA 3NO3A 1STZA 1KBBA 4X2PA 1GQJA 3BLFA 3N29A 2O55A 5HR6A 4DO6A 2ZRUA 4WRHA 1GOMA 3EX2A 1AK5A 1B57A 3XIMA 4GJJA 3IK4A 3PPCA 1WKFA 1K9TA 2WC7A 5E9AA 2OKOA 2EEXA 1KBKA 1P6CA 2G3IA 4AIUA 4IQLA 1E15A 6PTDA 3GYEA 3ETRB 4HYRA 5IFTA 3EDJA 1UYQA 1OC6A 3NQ7A 1E4IA 1ZBWA 3AU6A 1PCKA 3CLWA 2REQA 1A47A 1OC7A 4J3SA 4IT1A 4AG0A 1CGVA 2PLKA 3FOKA 2EGZA 4P8UA 1VFFA 3FVDA 3EWZA 3SCOA 5I09A 4JFTA 3TC3A 4YTQA 3IJDA 4PGLA 5A8GA 2NXIA 4EF8A 4EXQA 3SN4A 1OJXA 2A6LA 3DN5A 1K03A 1IE7C 3LSCA 1IZKA 3GHTA 4NNCA 1UBPC 4WDUA 3WLKX 3QGAC 3EF6A 3BQ6A 3OB8A 3EX3A 2VEPA 2NX3A 2OZTA 3HGSA 1OGBA 1JG9A 1CXEA 4EP8C 1CNVA 3RR1A 3W6YA 1YADA 3PBVA 5CPTA 1RM6B 1RA0A 1BYAA 5HDRA 1K6AA 3HG4A 5FACA 2WKGA 1O6IA 5I0DA 2XM2A 1B4EA 3AZTA 2ZXQA 4YMZA 2ZUTA 2UY4A 1GPWA 3BSMA 1GKPA 1H50A 3F5KA 4V27A 4BK9A 2XZ9A 3NQFA 1RJQA 3UWWA 1JR1A 3FJLA 3E1F1 5M03A 1KNWA 1JRBA 3ITTA 3TYZA 4B3ZA 1AQ0A 1VD6A 2F6XA 5EBAA 4TTUA 4H9XA 3W81A 2ZWYA 3M0XA 4DWSC 1QPKA 3BUVA 3W71A 3N11A 4Q7BA 3LXDA 1M41A 1Z48A 2DZTA 1H0GA 3AN1A 1Q6QA 2Y2WA 3NOEA 3BXWA 1CECA 1P0DA 5B7ZA 1VHNA 3AIQA 2VGBA 4CQBA 3P14A 3R89A 4KWWA 2MNRA 1GW9A 2QCHA 4PRWA 1Q2SA 1W3JA 1PKYA 4Y8EA 4IX0A 3QPZA 1UZ1A 4H7CA 1UP0A 5A8PA 3GNOA 2VRJA 4TQTA 2OLAA 3BVJA 2WKJA 4HYWA 2G3NA 5KTLA 1JDAA 1WX0A 3G3DA 4UQBA 1E56A 4URIA 4ZOAA 3NS1B 1S39A 4FNSA 3WQDA 1VDVA 3BZJA 1A5AA 4GX8A 3DC8A 3DERA 4EANA 1P0EA 4L9YA 2A79A 3VIPA 4RPPA 4J35A 1MFVA 4N9CA 2QVHA 2W63A 3CAQA 3D3AA 2J25A 4ZQOA 1KXHA 3DU0A 3UGRA 3EX6A 1RALA 3RXZA 3AQUA 5CPQA 2ATMA 1CWYA 3UD6A 4W5UA 3VIIA 4C6DA 1L9WA 4JQ3A 3WKZA 4PCPA 3AZRA 3H2NA 4XD6A 4MJ2A 3QW3A 1V3MA 1ADOA 4EXAA 3KCJA 4M80A 5E70A 1XBYA 2YCLA 4PMQA 5D8WA 3EKLA 1S5MA 3B8UA 3LI1A 2VDHA 3V1HA 3CMJA 1U30A 4JBRA 2ZXBA 3AI0A 3TJIA 4R5EA 4F9JA 4C6FA 1HT6A 1M01A 2G97A 2R91A 4FX6M 3GXNA 1Q85A 3PR2A 3WL0A 3QSTA 1L0PA 2VELA 3CAVA 1ICQA 3H55A 1I0DA 1PDYA 4L7ZA 1RPKA 4U5KA 2WBGA 1VFSA 3U57A 1V3LA 3EA1A 4ZOHB 3FHAA 4M51A 3WBXA 1PV8A 3M9YA 4AX7A 1LQ0A 7ENLA 1JUEA 1R38A 1XIFA 3G18A 2OLHA 2YDRA 4GO8A 5HWJA 5FCZA 1K4HA 4PMYA 3UXAA 4O17A 1OFOA 3CZLA 4I7UA 4A3HA 3TFCA 1YNYA 3O1NA 4CUCA 4EQWA 1AH4A 5DANA 4WHBA 6TIMA 4E4PA 1IT7A 2EKCA 5KZMA 4G1KA 2OO6A 1E0TA 3KOYA 2X1TA 1TPEA 2WVTA 4GYPA 2ZX6A 1GHSA 1T3QC 2Z1BA 5KZEA 5FF4A 2Y61A 4HZ8A 3VU2A 3WNPA 2HQAA 2ACSA 1A5SA 4GA8A 4D1JA 2AGTA 4FHAA 1MEHA 2F38A 3BAWA 2O9TA 2EKGA 1FWWA 1VFMA 4YN5A 3UZXA 4IIDA 4V2XA 2WV8A 4DUXA 1YXCA 4MTVA 3CS2A 4WX2A 1UUQA 1OF8A 4ADSA 4CCDA 4QHRA 2QW5A 2X41A 1E51A 2P3EA 5EB8A 3CZEA 1A49A 1TV3A 5CPMA 3W7DA 4FSAA 2OOGA 2TMDA 3PFRA 3EYPA 4DXXA 3SCVA 1ITQA 4HGXA 3LUTA 4JHOA 1XDMA 4PCFA 4NX5A 3UFYA 4L6HA 3W7JA 2PF8A 1O5KA 4O54A 1XIDA 1IR1A 4UTUA 2A3AA 2PDGA 4DRSA 3WD3A 4UOZA 3LM7A 1K9FA 3S5SA 3A6OA 1XYBA 3RLVA 2TSYA 4DEFA 4P8WA 3L23A 1G9HA 4JICA 1OFPA 3W9ZA 1A50A 3LBOA 4TVUA 3MS8A 1Z6KA 2P0IA 1T8QA 5LNSA 3S1GA 3O07A 3WIJA 2WO5A 3WBEA 1OCNA 4P2VA 2CLOA 3UWVA 3WENA 4M7TA 1RP9A 4WVXA 3U5UA 2VFDA 3EX4A 4R33A 3C8NA 4CCEA 1FWGC 5DCBA 3OIHA 4I9AA 2B7QA 1RVKA 4FP1A 1R86A 3TW7A 4MJZA 3V1PA 1A5LC 1E6ZA 3WJWA 3VAVA 4I5UA 5DMYA 1PBGA 3WF4A 2OKTA 3NQAA 5MF5A 2O9RA 2EG7A 1E6QM 4GUHA 3MUY1 1OD0A 5IDIA 3EBVA 1UKOA 4LH8A 3MP4A 3LV5A 2PRMA 2OYMA 3CUJA 3JS3A 5HNRA 6ENLA 3EUB3 1KCXA 1QWGA 3C56A 3CIVA 2I57A 1THFD 1YXDA 3GIQA 4MADA 3IJQA 3FCPA 4GZIA 4LYRA 4ZQNA 3NA8A 2HXUA 3NQ6A 4QSHA 4KWOA 2DFAA 2YDSA 3CT7A 1XLHA 2XFYA 3ZWTA 4LSBA 3E2VA 3SGZA 2NVDA 3B9JB 1MNSA 4UTTC 1BSLA 3L4XA 3IV3A 3L65A 3LU2A 4WGXA 3TXVA 4LUJA 1UBSA 2VFHA 3FY1A 2ISDA 3QPEA 4B5VA 4WKHA 2A2IA 3W53A 4ATDA 3NZPA 2CLPA 1W3IA 4BEUA 2HSAA 4EK7A 3BZGA 2G0WA 4R9OA 1DXIA 1ML1A 3TQVA 4LRSA 1UC4A 4LUSB 1P6BA 1IGSA 4UFLA 2XN2A 4PMNA 1CLKA 1QNPA 2GVJA 2Y7FA 1KLYA 5D30A 5CGMA 1OHLA 1TG7A 3CQJA 1JYXA 2PZ0A 2ZRYA 3CGDA 4KMQA 4AIOA 2XN0A 3FW6A 1EP1A 3W6MA 3LPGA 1ISWA 4DF0A 1EA0A 4LV9A 4DVOA 1KTNA 4TU1A 4DJFA 3I4KA 2FGBA 2DUXA 3FAXA 1QWKA 1G4TA 2TRSA 3P67A 2JE8A 2J8TA 1BKHA 1UA3A 2QCFA 3GY1A 4L1GA 1FQ0A 3HMCA 1XYZA 4XV0A 1XGEA 3ATZA 5T8GA 4MZYA 1W17A 5FF3A 1NHQA 2HVOA 4IF2A 3BGGA 2V68A 3FX4A 2E8ZA 1E9LA 2NLIA 1J11A 3ARZA 1OYAA 4KS0A 1JCJA 4WSHA 2VQUA 1YPIA 1TV7A 3I4EA 2D1ZA 3MYOA 5HJXA 1JZ5A 3R43A 1QPQA 1MOKA 2GWNA 4NZFA 3GUGA 2PDPA 1B31A 2X1SA 2PWFA 3B0VC 2ZE3A 3GZ3A 3GDRA 3COTA 1CCWB 4UB9A 4ERGA 3V0UA 1HKVA 2ZA3A 2GGEA 4XVDA 3KBNA 3NEHA 4GVHA 2QAPA 1J9YA 5LZLA 5CC3A 1GORA 4WCJA 3QXBA 3PSWA 1OT1A 3M4HA 4AMCA 2ZZCA 3I10A 1ME7A 2QCDB 2E5BA 1F73A 1L6GA 4IL2A 2I14A 2X0SA 4F0RA 3FNDA 2WPCA 3DHFA 1ZXIC 2YBUA 2YA0A 1FWEC 3TYAA 4H8HA 1UPMB 4CNTA 1VJZA 2F84A 4RW5A 4O0KA 3E96A 5E6YA 1PTDA 2OXNA 3UESA 1EXBA 1KFKA 1Z8AA 4WSKA 1RLDA 4XUGA 2RDXA 2OEKA 1KD0A 3GIPA 4PR4A 3RAOA 5CEWA 2WOVA 2C14A 1JUKA 2BY2A 3B06A 5M3WA 1XRVA 3GNXA 3H7RA 4JGDA 3QMRA 4DJDA 3IJIA 3MMDA 1TZZA 3W1XA 5JVLA 4UMAA 5BRPA 3F5LA 3SRKA 2OTDA 5AECA 4PUNA 3LMYA 3QC0A 3FLUA 4KWSA 1JIBA 3P5ZA 5G1YA 3GXIA 4A8NA 2BY0A 1ZAHA 2FFCA 3BW4A 4MB5A 5LA1A 4MB3A 5K7JA 4GLEA 2HK1A 2FVMA 2VRKA 4KEMA 3RGTA 3N34A 1H6VA 2YCKX 3DG6A 2Q02A 1M7XA 3P5YA 4AWEA 2DGAA 2D20A 3WO8A 3KX6A 1FWSA 4F2BA 1H7NA 4NJJA 3C2RA 4W85A 4DO4A 4Y9MA 5A6JA 4UTKA 1UR1A 1XFCA 3VIFA 3O9NA 4Z2HA 1N5WC 1XR2A 4QX4A 2BGSA 3TCEA 2J9YA 1SZEA 3GVQA 2Y5JA 1F4HA 2FVLA 2UY5A 4GIRA 3KVKA 3P7YA 1Y7VA 1H62A 4K1WA 5I3JA 2FTPA 3UYCA 3UW6A 4RE0A 4DM1A 1WUFA 2V67A 3URQA 2XSXA 4X22A 1WOBA 4GFSA 4KWVA 3QPYA 2YCJA 4IMAA 2G5WA 2PCEA 3VGFA 3BOXA 3EGJA 1HGYA 1TTQA 3H2AA 3W2KA 1JZ4A 2I5IA 3LCXA 4KFOA 3MUIA 4B9ZA 3S1VA 2J3NA 3CLMA 3HV8A 3VDGA 1OX6A 4PUUA 1LM1A 3UA3A 4QQUA 5GNXA 3UGVA 3WCZA 3ARYA 3W1NA 2HS8A 2GPTA 3VZXA 4NVTA 3BCFA 4FOJA 4WOZA 5EA9A 1S7MA 4DYKA 1SQ7A 2WNNA 2QS8A 3KTSA 1LOQA 4FZIA 4G8TA 3L0GA 4MY1A 3PZIA 4C1LA 4JIQA 3I7SA 1RVGA 1NEYA 3SCQA 3WN6A 1AW1A 1MQPA 1XM3A 3QY7A 1ME9A 4HCHA 3MWCA 4IIFA 5KITA 2G50A 3M44A 5U4NA 3S2NA 5BOEA 2VMFA 3TV8A 3C0JA 2VFEA 3OGRA 4H00A 4HA4A 1TYTA 3VYLA 3GWQA 3CUXA 4AYGA 1XL9A 3L4ZA 3LNMA 2AL2B 1CGTA 1TPH1 1G0CA 2PWDA 4RDWA 3T42A 1GJWA 4ZE5A 5CC6A 4CNNA 3W07A 4W7VA 4PEKA 4I9TA 1NP2A 1UZDA 2IXUA 3CZJA 4GNKB 5EMMA 4A3RA 1XQKA 3M0MA 2X1UA 1B90A 4A4AA 1DJIA 3H12A 2CHRA 1XGZA 3M1ZA 4U31A 3BGAA 4F0MA 1QBAA 4AFYA 1CB2A 1F8MA 1Q6RA 3CT2A 3TH6A 3IGHX 4NT0A 4H04A 3CV6A 3CQIA 3AMCA 2ZZBA 4UTHA 1ZBCA 3KTCA 4BWLC 1JCXA 1GYNA 1VBJA 5HWNA 4WSJA 2V3FA 4BHYA 5FEWA 3TYUA 1HP5A 3GAKA 4M3PA 4Q4RA 1M6IA 2X2GA 2WW5A 4D6IA 2FMOA 1O60A 4IM4A 5JCKA 2B7PA 2ANUA 3PF3A 2NX1A 1B4KA 2DSWA 1FFQA 1SFTA 1PXGA 3LX9A 4LB4A 4K68A 3S1WA 5C0QA 3BOLA 2ZUUA 4WK9A 4QP0A 2BSLA 4IFRA 2PDUA 4RJEA 5D2XA 5TD4A 3QRHA 2BC1A 4A05A 4L9XA 3ABOA 3GLCA 4Z0SA 4KT2A 1OZMA 3CV2A 3WUBA 4EM4A 4LEQA 1DIKA 3AJXA 3SADA 4LTSA 3WJZA 5AHNA 1HKMA 3RR4A 1KM6A 3NPXA 3HG3A 4HNLA 3M43A 3CHDA 4DYJA 3E0FA 1F6KA 1IZCA 4J3VA 4O1FA 4GHRA 3TW9A 1EJUC 4PCNA 2JFEX 3EMCA 4K8DA 4IQEA 3L8KA 1DWJM 2UBPC 4Y9OA 1FA2A 5A5WA 4JL2A 2C1HA 1V6WA 2J6VA 3LLXA 3S5YA 2IS7A 8XIAA 3WDHA 5GRTA 4BEQA 1SMAA 2GUYA 3CXBA 4O1BA 1W5PA 4O0ZA 1XKYA 2GQ3A 4H83A 3FA4A 5LA0A 4Q8NA 4IP7A 3VCCA 2JQXA 1V8EA 1V0LA 2PP1A 1A4MA 1OD8A 1HN1A 4PL2A 4OT7A 3NL3A 1W37A 4TX8A 1O5QA 4B91A 2OJPA 1S2WA 3VUPA 4KCVA 3LRMA 4K7YA 4DAFA 1HZYA 3KBSA 2NQ5A 2DSUA 3ZR5A 3AS3A 1D3CA 3RRAA 4LUSA 4C5ZA 1Q7QA 5C9RA 2BY1A 4E3TA 2BG5A 2A4AA 1J2BA 2INFA 2ISWA 2CBIA 4ENLA 4L6DA 4AD3A 3TQPA 3HFTA 1LLZA 4NNAA 4FOKA 3NUKA 3F5JA 3CUFA 4MDOA 3H4XA 5ECUA 2QPXA 1M04A 3KWXA 1NDWA 4BF9A 5FJJA 1FFUC 4FA3A 5JRBA 3ONBA 4LYKA 1YNQA 1RY0A 4GIAA 3TC6A 4BF5A 1WDQA 4PFHA 3HGRA 2OWCA 3P81A 2E4TA 3GBEA 3W7QA 3DFPA 4LY4A 3DKJA 4UZSA 4DBSA 2YBVA 4JCLA 3N2MA 4EX4A 4NZJA 1VPXA 4TR9A 4IPJA 2KZHA 1BQCA 2E5CA 4ZQPA 1UASA 2ZX8A 1MUCA 4IISA 4IWWA 1ZX9A 1RXOB 4OUEA 1E40A 1V0NA 1L6WA 5I24A 3DH9A 3S5OA 1QOPA 6REQB 1D8WA 1DWAM 2C71A 1X8CA 2BHYA 1R3TA 1NP0A 1QU4A 1Z44A 2HNHA 3GR4A 1X7FA 1AJ2A 4GY1A 1Y5XA 3MP5A 3H6OA 2EPLX 4KF1A 4EM3A 3AIRA 1TV4A 5AYXA 3IV8A 2FJUB 3KBVA 3URAA 1N61C 1BPLB 1G69A 2CWNA 3AMGA 1GQIA 5JBDA 4UR7A 1XH0A 3BJTA 1ITCA 3WD2A 1JUBA 3OYZA 3A22A 4AU0A 1DJHA 5I23A 4Z2JA 5BU6A 2PDXA 4WLCA 3KCOA 3TOYA 3QF0A 4CU7A 4HU4A 2QCDA 3B8DA 1ZLPA 4IOTA 4MFEA 3G8RA 1Q3NA 3KAOA 3TJLA 1Q65A 4GABA 5F7UA 4NL1A 5CLWA 3GH7A 4NQ1A 3MWAA 3SEPA 4R53A 2GH5A 3W25A 2Q8LA 1VYRA 2F61A 4C6OA 2NQJA 3EOEA 1E0XA 4KGJA 3GC2A 3N2CA 2QUTA 4DF1A 5JUVA 3GM8A 3CV1A 4IGSA 2PZNA 1E4LA 4QSFA 1S2TA 3NL2A 1KBLA 3E3HA 4B92A 5A6BA 1SJBA 3G1DA 3A12A 5LNRA 2ABBA 3WK1A 2OSXA 2QT3A 5CZKA 1PIGA 5DEZA 1EJWC 2C3CA 1IWBA 3A7AA 4H4RA 4NAFB 2C3ZA 5SWUA 1CXLA 3NL6A 1EX5A 2YBTA 2B31A 3LCWA 1RZMA 1OG0A 4AD2A 7TIMA 7TAAA 3S42A 2DEPA 1QMLA 4Z1DA 3G1AA 3M0IA 1B9BA 4NG3A 3K1DA 2PSNA 3OPSA 2QDEA 2NWSA 4A22A 4YTSA 4XIMA 4DIAA 1W9DM 3RO8A 3GVWA 4AZ6A 3C2FA 1MEIA 2WZHA 3A5VA 1JXJA 3PBWA 4G2DA 1LL7A 3GNPA 1ADSA 3DH7A 4H4PA 2OX4A 3M07A 4LY8A 2VC9A 4ZXOA 4TVCA 3LGEA 4N6FA 3W7KA 4GC4A 4TO8A 1HJQA 4GINA 4OJYA 4XUYA 1T7LA 1J8VA 3WNMA 1P43A 5D4YA 2VEFA 3GKFA 1X98A 1Q13A 1SFJA 1X39A 4HPNA 1FO4A 4TOQA 3EPOA 2IQTA 4HMDA 1RUSA 1IXQA 1ZENA 3TX9A 1KRMA 1PCWA 3DFYA 5A6TC 1R30A 1B3WA 3AUJA 3PUGA 2BXZA 4QLJA 3B0YA 3RLGA 3KVJA 3APGA 2HPIA 3W28A 5IDZA 1NWRA 4LQ1A 3W22A 3Q6JA 2XGZA 5EBUA 4TTGA 3FXYA 4YVXA 2ZFAA 2JEQA 2VR5A 4V1YA 3I6RA 3KP1A 3BQ5A 3GHUA 3TOPA 4BR1A 1V02E 3RCYA 3F4DA 2HROA 4W7UA 3UYIA 1AL7A 4S3EA 5LHFA 3OYXA 4W93A 1KFLA 1F8IA 3ARSA 4NXSA 2GVGA 1VP5A 4Q8PA 1A80A 2Q8XA 4LBRA 3NG3A 3WLLA 1AQMA 4L4PA 1NF7A 2QCGA 2VM8A 3U7VA 1OT2A 3OEXA 5IBXC 1Z7AA 4FX7A 1PAMA 1YDOA 2PDBA 3TN3A 1AD1A 2AL2A 4RR4A 2HWGA 4K8HA 1YMYA 5G1MA 2OELA 2F2KA 1MMFA 4H6EA 1LYXA 4OBTA 1GRTA 4ZZ9A 5I3KA 4M0XA 3RX2A 1NDYA 2HS6A 5FI8A 2PF0A 2GK1B 1PZ0A 2FPTA 1GEUA 5KEZA 1XDIA 5KINA 3E2SA 3R58A 2E28A 1SFSA 3HJEA 2W66A 1FWRA 1TUFA 2C13A 2A7PA 3OODA 3WMBA 5BNKA 3W7EA 5I79A 3CASA 3VIGA 3SZ8A 1E6SM 1MQRA 3PJUA 3T0AA 4YYFA 5IOBA 3OW1A 3NQGA 1A5CA 2WJFA 3CH0A 5C71A 3VDBA 4LIIA 1XLIA 3RDKA 3PZGA 4G7EB 1ZY8A 4AXKA 4MM1A 4W89A 1KBIA 3PN8A 1PTGA 3NR0A 4JYDA 5I07A 1XYAA 4KH2A 4QLLA 4QS5A 2BX7A 3QEZA 2GJLA 4UQ9A 1FKXA 2PMQA 1D9EA 5C9WA 3GC4A 2A6NA 3IC9A 2WCAA 3GRTA 3F4CA 2RJGA 1AQHA 3O0HA 1PPIA 2W55A 5E6ZA 3BV7A 2A3LA 5FJOA 2AMGA 1C9WA 1UH4A 3TNOA 1XUUA 4REQB 1IR2A 4WXZA 1LL4A 1S46A