2PP3A

Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
395
structure length
395
Chain Sequence
SANSDAVTYAKAANTRTAAETGDRIEWVKLSLAFLPLATPVSDAKVLTGRQKPLTEVAIIIAEIRSRDGFEGVGFSYSKRAGGQGIYAHAKEIADNLLGEDPNDIDKIYTKLLWAGASVGRSGMAVQAISPIDIALWDMKAKRAGLPLAKLLGAHRDSVQCYNTSGGFLHTPLDQVLKNVVISRENGIGGIKLAVGQPNCAEDIRRLTAVREALGDEFPLMVDANQQWDRETAIRMGRKMEQFNLIWIEEPLDAYDIEGHAQLAAALDTPIATGEMLTSFREHEQLILGNASDFVQPDAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVHLHLSAAYPLEPWLEHFEWLNPLFNEQLELRDGRMWISDRHGLGFTLSEQARRWTQLTCEFGKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords L-talarate/galactarate dehydratase
publication title Evolution of enzymatic activities in the enolase superfamily: L-talarate/galactarate dehydratase from Salmonella typhimurium LT2.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 138
structure length 395
sequence length 395
chains with identical sequence B, C
ec nomenclature ec 4.2.1.156: L-talarate dehydratase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2pp3A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2pp3A01
2GGJA 1EC9A 3BOXA 2P0IA 4G7FA 4K2SA 3HPFA 5FJUA 3OPSA 3V5FA 2ONEA 1PDZA 1NU5A 3CAWA 3UGVA 3TOYA 3SN1A 4JN8A 3FXGA 3RGTA 3S47A 3K1GA 1OEPA 4ZCWA 2MNRA 1EBGA 3IK4A 3VFCA 4E4FA 4HCHA 1TKKA 2PGEA 1TZZA 3VC6A 3UXLA 2PTWA 5BOEA 3OP2A 2AL2A 2OQHA 2QQ6A 3I4KA 3CK5A 3BJSA 4H19A 4DXKA 5EU9A 1JPMA 4KPLA 3SN0A 3ZLFA 1EC8A 3RITA 2HNEA 2PTXA 3MWCA 3PWGA 1KKRA 4MMWA 3MZNA 3RRAA 3P3BA 3DERA 3ZVHB 4H2HA 3DG3A 3ENLA 1YEYA 1L8PA 3SBFA 4GGBA 5ENLA 3RR1A 2PU0A 3V3WA 2ZC8A 1DTNA 3D46A 2HXTA 2QVHA 3IJQA 4ZA0A 3N6HA 3N4EA 4IT1A 1ONEA 1KKOA 2AL1A 4X2PA 3RO6A 1SJAA 2QDDA 1XPYA 2GSHA 2OPJA 3R1ZA 3QKEA 1E9IA 2P8CA 1KCZA 6ENLA 3UJEA 1EC7A 4KWSA 4E6MA 2OZ8A 3T6CA 4G8TA 2QGYA 4IHCA 1BKHA 2PMQA 4FP1A 3OZYA 2P3ZA 3FYYA 2OX4A 3GC2A 4GGHA 2XH2A 2PSNA 3DG6A 3DESA 2PP3A 1MNSA 3R11A 5FJRA 2I5QA 1IYXA 3S5SA 3B97A 3UCCA 4JN7A 3RCYA 1FHUA 2HXUA 4GFIA 3SQSA 3VDGA 2GGHA 3ZLGA 3Q45A 3MKCA 3OZMA 4E4UA 2DW7A 2PTZA 1SJBA 3UCDA 3FCPA 2O56A 4YWSA 3GO2A 4KT2A 4DWDA 2PP0A 2GGGA 2AKMA 3TJ4A 2GL5A 3STPA 3NXLA 3OTRA 4Z17A 1SJDA 2OG9A 1JCTA 3T8QA 4DHGA 1JPDX 2HZGA 5FJPA 3SJNA 2QDEA 4E8GA 5BOFA 4MGGA 4Z1YA 1ELSA 3VCNA 3THUA 4K8GA 3H70A 4GIRA 2RDXA 3MSYA 2PU1A 1MDLA 3DFYA 2PTYA 2XH7A 4HNCA 4IL0A 1BQGA 4ROPA 4DX3A 1RVKA 2GGIA 2POZA 2OZTA 2GGEA 1TE6A 4GYPC 3ZVIA 4H1ZA 2P8BA 3SSZA 2PODA 3ES7A 4A6GA 2XH4A 1R0MA 4MKSA 1P48A 2P88A 3H7VA 3QPEA 3FV9A 2PGWA 3V4BA 1SJCA 2PS2A 7ENLA 3MQTA 2GDQA 5J04A 3D47A 3TWAA 4GISA 3BSMA 2CHRA 4J3ZA 5IDZA 1F9CA 4EWJA 2PCEA 3QLDA 4GYPA 4KEMA 4IP5A 2ZADA 2AL2B 4HPNA 3H12A 3UJSA 2PPGA 3U4FA 3JW7A 4DN1A 1EBHA 2FKPA 3UXKA 3I6EA 4ENLA 3TQPA 2PP1A 1MDRA 1NELA 1PDYA 3ZLHA 3CYJA 3R0UA 3VCCA 4JHMA 3PWIA 1P43A 3QN3A 3GD6A 3CXOA 3QTPA 2XGZA 3UJFA 3ES8A 2MUCA 3KUMA 3UJRA 3P0WA 1MUCA 3FJ4A 3NO1A 3TTEA 4A35A 3SN4A 3NFUA 1XS2A 3MY9A 4HYRA 3CB3A 4DYEA 3H8AA 4GMEA 2OQYA 3TCSA 4HCLA 2NQLA 3NZGA 4FI4A 3JVAA 3P93A 2OFJA 4F4RA 4HCDA 4A3RA 3DDMA 3VC5A 3JZUA 2FYMA 1R6WA 3EEZA 3PFRA 3DGBA 4E5TA 3Q4DA 4IP4A 4J1OA 1MRAA 3UJ2A 1KD0A 3TW9A 4IL2A 3OW1A 3V5CA 2OLAA 3N4FA 3I6TA 3TWBA 2OKTA 3R0KA 3IJLA 4M0XA 3U9IA 3T4WA 4HN8A 2AKZA 3DIPA 1W6TA 5FJOA 4H83A 3PK7A 3ZVHA 5FJTA 3FVDA 3DG7A 3EKGA 1WUEA 2XSXA 4IZGA 1ECQA 1JDFA 2OO6A 2XH0A 2OVLA 2OZ3A 3R10A 3DEQA 2QJMA 3TJIA 3N6JA 1WUFA 2PA6A 4K1WA 2QJNA 3DFHA 3T9PA 3VA8A 3IJIA 4HNLA 3CT2A 4M6UA 2DW6A 3GY1A 1FHVA 2QJJA 3MUCA 3R25A
chains in the Genus database with same CATH superfamily
3PY2A 1Q7QA 1EC9A 3PM6A 4ICMA 1EX1A 4PCNA 4CCCA 3BZJA 1FKWA 2D22A 5EMKA 2VEFA 4NJIA 3L67A 3LM7A 3AWNA 1FA2A 2CBJA 4IIDA 1TWSA 1LG2A 1SW7A 4IMEA 4QHRA 4DO7A 4XO6A 1FWHC 5GNXA 3W07A 1K7EA 2XVLA 3E1F1 3OIHA 4JIIX 5BU9A 3GXDA 3SCWA 1KBJA 4QNWA 5BROA 1H41A 1JPMA 1RR2A 1XGDA 2YW3A 3U48A 1RQEA 1WO2A 4JFUA 4ZOAA 1XIJA 3ALFA 4C1LA 1IHIA 4MMWA 3UF9A 2Z2AA 4GRTA 1TQJA 3LBCA 2PDBA 3BLDA 2EHHA 3R5EA 2PLKA 3ITXA 3SBFA 4LUTB 4JX5A 3B05A 1DWGM 1NTHA 1W1A1 1OJXA 1RJQA 3AXXA 3T0AA 2EPMX 3T2QA 1ZZMA 4FOKA 5IOBA 3MUAA 3ZJ7A 5U25A 1W9UA 4UZSA 3NOYA 3AQUA 4PUMA 5F4SA 2QNEA 1NOWA 3VGHA 3W7JA 4U28A 3BE7A 1MWOA 4K7YA 4OBTA 1TIMA 2GJPA 3L4YA 3OZOA 3PJWA 1P0DA 1V93A 2QAFA 1BF2A 2NX1A 2NZLA 4B90A 4ZQPA 4E6MA 2Z25A 1GOOA 1MEIA 4IHCA 6REQB 1PKNA 2PRHA 2QIIA 1DXFA 1OJTA 3UXIA 5DCBA 3KS5A 4ZFCA 2ZA2A 4H9VA 2QDHA 2JGYA 1STZA 1CCWB 4H4WA 2XH2A 2R1NA 5JXQA 1EPVA 1J5SA 3WX7A 4G7EB 3LB8A 1ZSXA 2ISFA 1XYAA 1MNSA 2W63A 2XZ7A 1ITQA 3GXMA 1J0ZA 3BG5A 1KM2A 3RCYA 4GINA 2HXUA 2XWEA 3BAJA 2Q02A 3SQSA 1C90A 5AYYA 3EBVA 5D04C 1YW1A 3BH4A 1RK5A 4AYGA 5KZ6A 3WMSA 1Z41A 1FWFC 4ZQOA 2QW5A 4WGHA 3UWZA 4AH7A 1YXYA 1V7YA 4RE3A 2VGGA 2YCLA 4A22A 3URAA 2ABAA 3R4IA 1A5LC 1J96A 2ZX9A 2HK0A 1S38A 4MWAD 3W70A 1VP5A 1C92A 2BCPA 4ZODA 1XUUA 4P8XA 1R3VA 3MSRA 4JDBA 3W7CA 2ZTJA 2BY2A 1XIMA 2Z0IA 1T7LA 4BJHA 1NARA 5ABGA 2XH7A 3W2LA 4MF4A 4IPNB 3CASA 3PTDA 3DK4A 4AHPA 5A2AA 4H7ZA 3PANA 4K7ZA 2YBVA 1P6BA 2D0GA 4O12A 3W76A 4H1ZA 3QHMA 5BZAA 3R8HA 2HRWA 3P84A 4XO7A 2IPFA 5BYWA 3U7VA 2H90A 2PDHA 1E6QM 4PFMA 3W7PA 3G5EA 3KHDA 1M5WA 1J0JA 4PBEA 5J5RA 5JCNA 4NJJA 1W9VA 4QQ3A 3BK0A 4UR7A 5A2BA 3EB3A 1GPWA 1OK4A 2ZZBA 1XLLA 4WOZA 3DCPA 1Y0EA 4H9XA 1K7FA 3W6LA 2QCCA 3NQCA 4NXSA 3WLRA 2NV2A 3EKZA 1QNRA 3UR2A 3RR4A 1EZ2A 1Q2RA 3FY1A 3GH5A 3M0JA 2KZHA 1JCXA 3I6EA 3AN1A 4ASTA 3OHMB 4J3UA 1XKJA 5D33A 3RFAA 3PTKA 2QCMA 2WPBA 3WH9A 1SMDA 1J2BA 3SUVA 2DSWA 4GA8A 1R9YA 5HOSA 2WWDA 3SFWA 4FA3A 3MA8A 3AS3A 3I68A 3NEVA 1VBGA 4WQ6A 1L6WA 1UKOA 3V1HA 3B3DA 1XIHA 4OBRA 3F4NA 1ISXA 1E0TA 4AVOA 5A8OA 4NI8A 2RDUA 3UVIA 1LYXA 2OQYA 1W1TA 1XP3A 3BXWA 1EF2A 4RZ5A 3NOEA 4CD6A 2BV9A 3TQVA 3T40A 1OCQA 4GY0A 3TA9A 1XRTA 4JTQA 1PE1A 4E5TA 1PBGA 4IMCA 1KM1A 4EVZA 3RM8A 1LOQA 1GOQA 3CHFA 1PTGA 1XH1A 5U4NA 3PZQA 3AZTA 2XG9A 3M9YA 2ZZ6A 3NQEA 4XUYA 1CTNA 3IJLA 1UWRA 1ONWA 1CLKA 2G4JA 3NVTA 2ZZ3A 3GVGA 4B5VA 1JZ5A 3LXDA 2G3NA 3W29A 4UTJA 2WKJA 1KV5A 3ARYA 3LTSA 3PK7A 3B8DA 4K6AA 3ZVHA 5JU6A 4JTRA 2HBXA 2EQ8A 4UUIA 1QUMA 4LVBA 3O1NA 5JVLA 4M24A 2CBIA 3HG2A 1IIGA 3E6EA 1J4EA 4V15A 4TVWA 3TJIA 2BNJA 4QAWA 3S6DA 1LRQA 1NSJA 1UOKA 2TYSA 3TJLA 1GYNA 5EBUA 4GRSA 3BTNA 5XINA 3GW0A 1QT1A 4S3DA 3GY1A 3HTWA 2QVNA 4XD5A 3M47A 3WDRA 2OQLA 4H3DA 1V6TA 2FDSA 2BMBA 1PDZA 1JRBA 5EPDA 3CAWA 3N9RA 1NHPA 3HG3A 3WLQA 3PNZA 1J2WA 2H8ZA 3QYQA 1WYGA 3IC9A 5IM51 3CQHA 1FFUC 2GQWA 2ALDA 5FACA 3L2IA 4H2CA 4CD8A 2BG5A 3SR6B 3FA5A 3MMUA 1T0OA 3K13A 1V3KA 3IIPA 3LCGA 3FFSA 2VR4A 3NQDA 1JZ7A 5DLCA 3ZSTA 3VOFA 3QZAA 2PDMA 5M3WA 4U5IA 4LUJA 2ESCA 4PUWA 1G67A 1GOWA 4W5UA 3V75A 1S5WA 5HUOA 1RY8A 1ZP3A 4XVDA 3EWCA 3K4WA 3W24A 3DKJA 4EAYA 3RITA 2EKCA 3SRDA 4UCGA 4WGXA 3VOJA 1WX0A 1LDCA 1Q1RA 5EMLA 4O1DA 4INFA 4GO9A 3W1MA 3RG6A 2B0MA 2TRSA 2W0HA 3ZVHB 5C6MA 4H2HA 1NP2A 2GVYA 5EKYA 4KWVA 1MXDA 3QF0A 2HCVA 2QCDA 1YTEA 4MYAA 2YFNA 4CQAA 3POHA 2FVLA 4DJFC 4M5PA 1MYRA 2OEJA 3VGGA 1A53A 3CAKA 4MPQA 4EQXA 3EWWA 2B81A 1BG9A 3BCJA 5MKGB 4US6A 2VRKA 3DK9A 3PUOA 3E5PA 5BW6A 2HV5A 5CJMA 5HMSA 3AMGA 2WPCA 3W0KA 4LVFA 4IG2A 1RY0A 1TVLA 5CCZA 2F2HA 2Q71A 2RGLA 3G1HA 3NM1A 4AFYA 3ZYZA 2AOSA 3EWDA 3DG6A 1QOQA 3ARVA 3ABOA 4ORIA 1AMYA 2Y61A 5U1OA 3WLKX 1JRCA 1PIGA 3G1XA 3H2NA 2ACSA 4QP0A 1AW5A 1XH2A 3WLLA 2HVOA 3O6DA 5A8QA 2QMKA 1RV8A 3SRFA 3OZMA 1ZP4A 4RPQA 4A3HA 1XDMA 2VCAA 2VX5A 4LF2A 4HHLA 5G2IA 3MBDA 4PL2A 2BVTA 4BI6A 3S3GA 5CAHA 1NVMA 5AVHA 3LHUA 2PP0A 4M29A 1EJVC 1LJYA 4F0RA 5H8MA 3WUGA 3UY8A 1E70M 1RJRA 1FH9A 4DZIA 5AHMA 2W3ZA 1QRQA 2CFFA 1PIIA 4TQTA 1LM1A 5LIYX 3FKRA 3RN6A 1VKFA 1XD1A 1I6NA 3HQNA 4XX6A 3QOMA 1KLZA 1UASA 2GDVA 4C1NA 2DVXA 1LQAA 1E1EA 3ZO9A 2X0SA 2Y7GA 3QQ1A 1MDLA 2DJLA 4AC1X 1HX0A 1FCQA 1PJ9A 3NSNA 4H9UA 3IIVA 3RPMA 2O9RA 4JQ3A 4HSNA 1OWQA 4IJCA 3ANUA 1L8NA 2GGIA 3KBWA 4DLMA 2Z1VA 5FA5A 2C71A 2GGEA 4D71A 5CBBA 5JBDA 3S9YA 1V3HA 2BLEA 3C3NA 1TPVA 1GZ1A 4WZHA 4H01A 3TTYA 5FL1A 3WD4A 4RNJA 3ZT7A 1SB3B 2IPGA 1RK6A 2HVNA 4O4WA 3E0FA 4W89A 2A3HA 4ZFMA 4TO8A 1TWDA 2XFFA 1Y5VA 2CHRA 4Q32A 4Q7NA 3P8JA 5HATA 1CXIA 5DO8A 4YWOA 1WZMA 5EMUA 3NQAA 2ADAA 4DY1A 3B8VA 5T26A 1S2VA 1GYMA 1VYRA 3O0KA 4I7WA 1LUCA 2AL2B 2BVWA 1W3NA 2P3EA 1UZHA 5DT7A 3JW7A 4DN1A 1OG6A 1RQHA 1QNQA 1KR0A 3UXKA 5JCLA 3A5FA 2V3BA 5D03A 3OVRA 1PTAA 5LKYA 4JY8A 4WY0F 1PWMA 1P43A 3OVGA 4G56A 3GTHA 1CGYA 5BXTA 4XV0A 1Q7ZA 4EANA 1W2VA 2YLLA 1O5RA 4OTKA 4E2VA 3T0DA 1JOAA 1TPDA 1JZ4A 3A7AA 3XIMA 3ABSA 5CSUA 3GX9A 8RUCA 4QLKA 5AC8A 1EJUC 2O7SA 4XB3A 5CZJA 4XSMA 3L7RA 1W5OA 2IQDA 3M0VA 5I03A 1AH3A 2HNHA 3BW3A 4L4OA 2QUUA 1O1HA 4J3WA 3CUZA 1AH0A 4A05A 1R6WA 1PZ0A 1KCLA 4K37A 4WKAA 1VFLA 3W6YA 3LADA 1U1UA 1JVNA 2GJXA 1G4EA 4NAEB 3WF0A 1F5ZA 1FWJC 3QV7A 3N4FA 4LB3A 3TYDA 3TYUA 2DDXA 1ZGDA 1DHKA 3LY0A 4JTJA 1ZMCA 2J78A 3C86A 3H6OA 4H4ZA 3M5ZA 1XBYA 3LB0A 4J9JA 2X8GA 4CEUC 1M68A 4ICNA 1I0BA 1L6GA 4L6HA 1LUCB 3ITLA 3N11A 2VX4A 3V7PA 3QY7A 3JR2A 2OZ3A 1Q1WA 4GYKA 3VOGA 3WLSA 2WVTA 4BY3A 3PTMA 4DF2A 1E0WA 3KDOA 2R14A 1ALDA 2WQDA 2DUXA 4ZTYA 3T9PA 3MCMA 3MW7A 1KBKA 1KV8A 2DW6A 4QIUA 3T55A 3E12A 4JQ2A 1JF6A 3MUCA 4EPEC 1S2TA 1JGIA 3E5BA 4H04A 4KQNA 3BQ5A 1M04A 1MO9A 4GFSA 3NZQA 1JFXA 3M1ZA 1UQZA 3WEMA 4UNLA 2PWGA 2WM0A 2Y70A 4QXIA 1QFEA 2NWSA 4F2BA 2Z2BA 1RBOB 4C6MA 3SCRA 4EM3A 5JCKA 1TKKA 4F9JA 1UA3A 4QSFA 5HNTA 3KBMA 1GVYA 1FWRA 1K4HA 5F2MA 3DC0A 1XDLA 5U7SA 3DFSA 3BJSA 3CS2A 4O52A 1AA1B 1EA9C 1XYZA 1ZY9A 3H21A 4IQDA 2YLAA 4QQUA 4CU7A 7REQB 4BEQA 4ZVJA 4A3UA 1EXBA 1JDDA 3PWGA 4KEVA 1YRRA 4EPKA 4YCPA 3UVAA 3S83A 3R2GA 5FSDC 6XIMA 5EL1A 3DERA 2NQJA 1EP3A 3HO8A 4MZYA 1PL9A 4QRNA 2XVNA 3AMCA 3KWXA 3RNDA 3RR1A 3H4WA 4Z1AA 3CAVA 4MWAE 3D46A 3OG3A 3SB0A 4RPPA 3S2CA 5CJNA 2F5ZA 1DPMA 2BGSA 1NWTA 2JK2A 2Z6IA 2J7FA 1FP9A 2F9RA 1V6VA 4MFEA 3PZNA 3EOSA 4NU7A 1N7KA 2VELA 5D37A 5C70A 1UD6A 3TC7A 6ENLA 1Z7AA 4K7VA 3N12A 5C55A 2PMQA 4BWLA 1NQKA 1GKRA 4R5EA 4LWWA 4H9YA 3W1LA 4F0HA 2E9MA 4M3PA 2EPLX 4HZ7A 4O11A 1DIKA 4PEKA 4IFKB 4R34A 4NRRA 3UPMA 4FNUA 4IH3A 3DN5A 1UR3M 1M7PA 4HU8A 4O8RA 4AWEA 3H2FA 3DH7A 2J4GA 5I77A 3EMQA 4D72A 5D8WA 3LGDA 3FG2P 1C9DA 1VHNA 3WH5A 1KBBA 4UTMA 1KM5A 2RDTA 1WNOA 2G3FA 3KLLA 1KC7A 4JQAA 5H6HA 2W5FA 3IGXA 4F9DA 1BFNA 2OCZA 3TR9A 1KM4A 3D5HA 1IGWA 3MPGA 1F3WA 4RK8A 3PSWA 4ZB2A 5I24A 3VIFA 4KGJA 3MP4A 4XBJA 2FGLA 1UR2A 3WQ4A 1V51A 5L6UA 4IJRA 2ODOA 1F8MA 1CLVA 4MDPA 2WJZA 4ZO7A 1DVJA 2FHFA 3B8SA 5BOFA 1J9YA 3THUA 1C9WA 3RK8A 1X7IA 2P5NA 4UFMA 4PMOA 3MWAA 4PUKA 1GRAA 2HROA 4LEFA 3CTLA 3TUUA 1Z8AA 4EOUA 4X61A 3HN3A 1W8SA 3BOLA 4DI9A 1WV2A 4DUWA 4WSHA 5CGMA 1X97A 1TZ7A 2VEMA 5CEWA 4MUZA 3TMLA 2EG8A 3CWNA 4ML4A 1JGMA 4M81A 4WXZA 1QBBA 1FTXA 3L21A 3NZ1A 1IZCA 1TRDA 1OX4A 2AGKA 3RUBL 4JHOA 2FTPA 3FV9A 1TVNA 5BCAA 2GQ9A 1E40A 1TTJA 3CUXA 2ZZCA 2VWSA 2ZRYA 2WPEA 3LSBA 3TWAA 2FB3A 6TIMA 1IV8A 2E5CA 5CPSA 4ZMGA 3PAJA 1VYSX 1BXBA 3AHZA 3M7SA 2W4XA 2QGHA 2WSKA 3I7RA 2XIJA 3C0QA 3WMCA 2YR1A 1KFLA 3P67A 2CLIA 4APNA 3GVQA 2VD9A 1BTCA 3KZPA 1N2VA 2G3MA 4POCA 4S3JA 3UWUA 3G0XA 4GBDA 2Y63A 4MY8A 4WX2A 1F2JA 4CD5A 3ZLHA 1CT5A 1Y7VA 1XSIA 3PFMA 1HKIA 1V6UA 3RPTA 1UROA 2X0YA 5FESA 5EA9A 4M6VA 3REQA 3NQMA 1VDVA 3BG9A 1EBDA 1OCNA 5IFTA 5CSRA 4OBSA 4QROA 3GIPA 7CGTA 2I5IA 3QHNA 1TR9A 4LCQA 4QBXA 5I09A 3AXKA 3ZR5A 2OFJA 3HB9A 1JAKA 2E67A 4J2MA 2WPFA 2J27A 1CEOA 1TPB1 1V6XA 4GUIA 1P4CA 5AZ0A 4GPNA 1OX4B 3BOFA 3DGBA 4JTUA 1S2WA 2Y89A 4QTGA 3S5NA 3TW9A 1TV7A 4W88A 3VM7A 1KTCA 4AY1A 3VIPA 5LHEA 4BI5A 3TN3A 3MYOA 2PDXA 4IOTA 1VH7A 3IJ8A 2Y24A 5I02A 1IR1A 1N61C 3L9CA 3CWHA 4Y7EA 4DPPA 3DK8A 2F7FA 4XTDA 5A5WA 9CGTA 4K8HA 4NEWA 3W7HA 2Z2UA 3K8LA 3E38A 1DV7A 3DBNA 2ACQA 5M2FX 1R7OA 1R3RA 3NRZB 1VC4A 1VF8A 3RHGA 3VCRA 2CKSA 4H4SA 3WLIA 4HNLA 3L68A 3SCNA 4QE1A 4PTMA 2YL6A 1ZDLA 1TA3B 2PLJA 3EB4A 3GH7A 3BGJA 2WC3A 1KTNA 1WB0A 1XIIA 1B54A 1TG7A 3UZZA 3KCOA 1W1ZA 4JR5A 3KOZA 3REQB 2WKLA 1UWSA 2V68A 3LPGA 3MI6A 3SN1A 1U5HA 3VNZA 3EPOA 4ROQA 4J5NA 3GTIA 5H8PA 4EQSA 4U10A 3H4GA 1OEPA 2FGBA 1EOMA 1YBQA 4D2JA 1EBGA 3IK4A 3W28A 2NLYA 1IZJA 1CB7B 5G5IA 4O54A 4X2RA 4PUUA 4AZIA 1MEHA 3ZR4A 5M03A 4E2DA 2NUYA 2FPTA 3CK5A 4KCWA 1POKA 1B2YA 1UHVA 3CZJA 1HJXA 3N19B 2J7EA 3VDBA 4GQBA 3OVQA 1QBAA 1OGSA 3MYPA 2X8HA 3P81A 3HOJA 2CCRA 4O0KA 3QTGA 2OGJA 3P3BA 2OYKA 1GV4A 3R7MA 2VXNA 3NO5A 3HMCA 3NO3A 4DJFD 4HU4A 3CHDA 1DWFM 1XLGA 4HHPA 1O1ZA 1OCBA 4JBRA 5G5GB 4H4TA 4F0LA 3WH7A 3IJQA 4ADWA 2NVKX 3NL3A 4IT1A 3OBKA 4FHAA 3HG4A 4J2PA 1IQ8A 1GW1A 1P0KA 3QH2A 5HNNA 4DJEA 4HKPA 2GSHA 1NQ6A 3EDJA 1R2RA 1XLFA 2VVNA 4QCEA 2INZA 5AHLA 2X16A 2DQWA 4KWSA 1UB3A 4AD1A 1JRPA 3A7RA 1G6CA 3BAWA 1BKHA 4GQRA 4A3YA 2C0AA 3N2OA 1R2TA 4KCUA 3CEUA 4Q7IA 1AUSL 3HPSA 5A8NA 2BOGX 4MUPA 5EGRA 3WF1A 4PC8A 4PN2A 3QXBA 1ME9A 3SM0A 3W83A 3OU8A 4ZQNA 2X30A 4J57A 4WJEA 4P7NA 3AMKA 4Z0JA 3WBWA 3QC0A 5F1VA 2WSRA 3WK1A 4Y8EA 4UCFA 2XU2A 3T44A 3U5UA 4AD3A 2B7OA 1E1CB 1WDPA 4ADTA 4NNAA 2GGHA 3CV7A 3NDOA 5BRPA 4H6QA 2QV5A 2ZC1A 5DXYA 5E93A 1XL9A 1LBLA 5E9AA 1H49A 4WXYA 2DSKA 3UCDA 4PSRA 2UV8G 3T42A 5CLWA 3NVVB 3IUHA 2FLIA 3SJ3A 1LT7A 4FR1A 2W54A 3WQGA 5HQMA 3URHA 4JD4A 4NJKA 1CXFA 4MB4A 3RLHA 2Y6ZA 1PTDA 2J7GA 2VFDA 4Z17A 4LAZA 3ARXA 1AMKA 1HL2A 4OV9A 1MQQA 4Z2JA 1SJDA 3KVMA 2OG9A 3GQYA 1QNOA 5ABEA 3LLDA 3WQ5A 1GHSA 1SGJA 1UC5A 1ZUAX 1LROA 1OFBA 1UPMB 4K8GA 1AJ0A 5JH2A 5CC6A 3HRDC 3SCQA 2QDGA 3TYAA 3UFYA 4E0CA 5A6LA 3IJ7A 1OY0A 1HF6A 1B3VA 3CLMA 3FJ6A 3NCOA 4AEFA 1NDVA 2PDFA 2UY5A 3C2FA 1NOUA 1ZAHA 4NF7A 1LF1A 1XC6A 4US5D 2R1LA 4M19A 2HISA 2DY3A 3MMDA 2CLOA 2P50A 3TYBA 4D6IA 1X6UA 1YPIA 3UNTA 1EO7A 4LGXA 1R0MA 4Y9AA 4B9ZA 1JEHA 3VILA 2P88A 4HZ8A 3QPEA 2Y8KA 4UTFA 3F03K 1EL3A 3L23A 5M5DA 3VXGA 4PMNA 4GD0A 4AHOA 4O17A 2XIOA 1VJSA 3BSMA 2XJ7A 5CKSA 3KRSA 2RDWA 1JYVA 1JD7A 1W9PA 1M1BA 1EWDA 5AYBA 3GR8A 2DIKA 5LXEA 1NFBA 2WMFA 1FH7A 2G97A 5HK4A 1J79A 5F2IA 3PVFA 3UERA 4I8DA 2JFEX 1ONRA 2WWCA 4AD4A 2HPMA 3S1XA 3URNA 4I8YA 3O06A 4XZMX 1FDJA 1F4AA 2PD9A 1PSCA 5D05A 3BW2A 1VCGA 1V02E 2VKZG 4QDWA 2W66A 1XQLA 4LYPA 1YE4A 2J8TA 2FZDA 3A13A 1I1XA 2XGZA 3WLNA 1T99A 3PZTA 1VPQA 2FQIA 5C9ZA 2DQXA 2V3AA 3CL8A 1Q6RA 2XSBA 3TTEA 4PBFA 4E3TA 1JROA 3PBYA 1R5YA 3MS8A 4R7WA 3S6TA 1KWGA 1XS2A 3MY9A 3LZ5A 4XZBA 1E71M 1IF2A 3I65A 4XD4A 4YVPA 4GIYA 1Q6DA 3M0ZA 2R82A 3D9XA 4KCTA 3CGDA 2PWFA 4YS1A 5LXXA 3QW3A 2WZEA 4REQA 4OE7A 4A3RA 4DJEC 3GSMA 3CBWA 4CKQA 2I1OA 5IBXC 2TAAA 1VFTA 4QFUA 4IPPA 4V1XA 4J7RA 4HYWA 3ETRB 1H5YA 1JI2A 1TX0A 1T5AA 2J47A 1W56A 2FPVA 4PEEA 1X6NA 4H41A 2VR2A 2FZMA 1KCXA 1ITXA 5FI8A 1JEZA 3FSTA 1CB2A 3T78A 3BLIA 4F0KA 1WUEA 4AIEA 1JZ2A 1XW8A 4DO5A 3VIHA 1TTPA 2VZOA 5FS8A 3M0IA 3CIWA 4ZB0A 1R3SA 4YTQA 1BGGA 1HG3A 5M17A 2O4MA 4EXBA 1Q66A 4HSHA 1PCKA 2Y8UA 3IJIA 3TV8A 4ONVA 2VGIA 3GNOA 1HVXA 2OO0A 1JCMP 3LXCA 3FN9A 5DRIA 3C5QA 4DBSA 4NT0A 3H2CA 4G7FA 4QX4A 1BRLA 5K9DA 2V6AA 1SSGA 2F6UA 5HNUA 4LS0A 4ZXLA 4TVDA 2YCKX 3OODA 3C2EA 1HO1A 2D2OA 5DFAA 2JKPA 4WK9A 4L4LA 1JIBA 4RX0A 4UMBA 3WENA 1EP1A 1BTMA 3HM7A 5I3HA 1L9WA 4QSHA 1GQNA 3PG8A 2DU2A 4GZIA 1JAEA 2AQWA 4X60A 4REQB 2VYOA 3CQIA 2GR3A 3BV4A 2YVFA 3OGSA 3U8GA 4MZ8A 4M82A 5BWAA 3QR1A 1QNSA 3OGVA 2OSWA 3DHUA 4ZO9A 4MKNA 2X2GA 3WD3A 3VOIA 4DXKA 1VIZA 5EU9A 2WLYA 3QY6A 5HULA 3FA3A 4JFSA 3LI0A 1QK0A 4NUWA 1P0BA 4U3AA 1VZWA 4UFHA 3SY1A 3MWCA 5FKYA 4IISA 4XSLA 3FIGA 3MKVA 5D30A 5C9RA 5A6KA 4OT7A 1EZWA 3VX0A 1GOMA 2IMRA 1UWIA 4Q4RA 1M6JA 1XWYA 4P7RA 2H3BA 2VTFA 1J0IA 3PZ9A 3II1A 2DZVA 3BPWA 1VBRA 4OZOA 3W53A 3BGAA 2VDHA 4HB7A 2J3NA 2NX9A 3DC8A 4O4VA 2OYLA 1T6MA 3IVTA 3R43A 3O7UA 4XZWA 1NM9A 1EOKA 3L2LA 3U2CA 1VS1A 3LCIA 4IGHA 2X0HA 3LDVA 1SJAA 2HSAA 5TR3A 3MUZ1 1E3XA 5LNWA 1GTEA 3F4CA 4MZ1A 3MUXA 5I3FA 3MO4A 2DORA 3U2ZA 1G5AA 4JY9A 4CU8A 1CDGA 4B3ZA 3V0UA 2E6DA 3SRHA 1F74A 3NZPA 2GOUA 4FP1A 1R9XA 1DEDA 4LANA 4WUIA 3TW7A 2OX4A 2XWDA 1UD5A 3CPRA 4GGHA 1ZQ5A 3VGFA 4AMAA 4ZO6A 1UW9A 1XCWA 3VIOA 1GVRA 2ISWA 3C2RA 1Q6LA 3M0HA 5CG7A 5RUBA 3EWBX 3DBPA 3UETA 4RV3A 1E72M 1H7PA 4AIBA 4MNLA 4CU6A 2CXGA 2DIJA 2XINA 2ZBTA 1XKYA 2ZYFA 3GTFA 3KL3A 1GRFA 1M41A 5K4ZA 5LA2A 4PRRA 1WDDA 2CLKA 4CCZA 3TTQA 1WXZA 3W1QA 3GZAA 2JEPA 4C6FA 4LS1A 1B5TA 5H91A 2DPEA 1GYLA 2J6VA 3NQ8A 2VO5A 3W4RA 3B8UA 4XAGA 3AXHA 2GL5A 3GNXA 4DZHA 1NEYA 3C52A 4JTLA 3QVQA 1EDQA 4NAFA 3TCEA 3QC3A 3B0UX 3W1TA 3L66A 4CD4A 2B7NA 1ELSA 1QOPA 1OD8A 2GVJA 4EE9A 1CGVA 3V0SA 5AHNA 3ZZ1A 4M1BA 2B4GA 4O50A 5I23A 1K4GA 2WNNA 2J8FA 5AHFA 1IEQA 1HO4A 1QPRA 2GUUA 2YSWA 5T9BG 3GAYA 4MY1A 4I9AA 5CZTA 1BQGA 4JX6A 1HZYA 4M1RA 3N15A 1OZQA 5KITA 2WB5A 3CT7A 3ITYA 3KCLA 2NT0A 4HPGA 1ZL1A 1C8YA 3ES7A 3K30A 1EX5A 4RJEA 2PD5A 1W2PA 1XISA 1JCLA 1I2RA 4B9YA 2VC7A 2A1YA 3KW3A 1T96A 4OGZA 7ODCA 3UWVA 4MWAA 2OEKA 3GFXA 3EF6A 4MVAA 3W02A 3ALGA 2WVUA 3TZNA 2A2IA 1DE6A 1MNZA 4YU1A 4C6EA 3TNOA 3MHFA 4C6JA 3JRKA 1GXFA 5BXSA 1P1XA 5PTDA 4DBUA 3DGRA 4MKVA 1ML1A 4GI6A 4GX9A 3I7SA 1P5BA 5CXPA 3H12A 3W1RA 5CZKA 3ORWA 1BZLA 3W27A 3SIZA 1H1ZA 1QPNA 4UTIA 2X1RA 4KERA 3AU2A 3EMZA 4AZ7A 1XRVA 3GW3A 2GPTA 3K8KA 2PWUA 3CXOA 4XAPA 2PDWA 3BLOA 3OJGA 2O0TA 2PBGA 3QGAC 3ME3A 1YXCA 5G4EA 2ISDA 1RM6B 3WCZA 1VFHA 3MKKA 2WNWA 4UIOA 3UXDA 3HF3A 4HYVA 3ERPA 1EIBA 3W82A 3THQA 2W61A 3V1PA 1GSNA 4MNMA 4NVTA 1DJQA 2A0NA 2PDQA 4A29A 1DWHM 1EYWA 1EWEA 1AODA 1FWGC 3Q65A 1QO5A 1XCXA 5I0DA 1IT7A 4QAIA 4GVGA 5HJLA 3LYEA 5D9OA 1XLJA 4FALA 3EPMA 5DN1A 3EEZA 3ZMRA 3N2BA 4LNCA 4IP4A 4TXEA 2X41A 1XPGA 5HWNA 1ZALA 2R1MA 4NXKA 3PS7A 1FFVC 4WR3A 3GC4A 4BI7A 3GKFA 4JFVA 3BWWA 3IUIA 3ARRA 2XIBA 3MBFA 2AKZA 3HPXA 1A0DA 4TVCA 3G77A 4MNJA 3PP7A 1R46A 5E9XA 3W85A 4IIEA 2YXOA 3G24A 2YBUA 1E1FA 1ISZA 1KXTA 1UOZA 1XIFA 3QW4B 3N6JA 3EPNA 2FPYA 2IUZA 4GABA 5AC7A 5CG0A 1UUQA 3NQ2A 1MUMA 3IJ9A 3FA4A 4FSAA 4ORMA 4DELA 2GR0A 3W00A 3KE0A 2ZZ2A 5SWUA 2QJJA 2ZUWA 1PUDA 3LCWA 3IS4A 4AVFA 1H7XA 1L2UA 2EPKX 4FLQA 1PZ1A 4YYCA 2IPJA 3AALA 4Z2HA 3AHXA 5HA7A 1RLCL 4W8BA 3RF9A 4GYJA 5LNRA 3VNIA 2WPGA 2OLSA 4EKJA 1FWIC 3KHJA 1PO9A 1KN0A 5KVHA 4ZCWA 3W7MA 2PDLA 4LH8A 3FKKA 1HJVA 4V27A 5EMYA 4DZAA 5ECVA 3EXSA 3RIKA 1WYIA 1XC4A 2YJQA 1JFHA 3W7GA 3M5XA 3O0HA 1VFSA 1MW3A 1WXJA 4B5XA 3COTA 4LALA 2D3NA 3LG3A 2NV9A 2YXXA 3KBJA 3M5YA 4QNEA 3O6AA 3QR3A 1D7YA 5D9MA 1XG3A 4LBSA 2C14A 1WA3A 3TIMA 1XCFA 2FFCA 3QHOA 4GZJA 1RA0A 2VMFA 3DJJA 1A5CA 1ZJBA 2QUVA 1GONA 4CVUA 4ML9A 1MO0A 1O66A 3DHFA 2VRJA 3G3MA 1VRDA 5I3KA 2ZC8A 3C6CA 3EGJA 5FL0A 3CV1A 3MU7A 3S1VA 2OZ0A 3NTYA 4LAOA 1PHQA 5HR7A 1YYAA 1G4PA 3SFKA 3WZ0E 4JTCA 1DYSA 2P8CA 4AZBA 1FCUA 1GVQA 4LVGA 3BDKA 3VD9A 5LIUX 3P6LA 1X96A 5REQB 3AZRA 4WCJA 2Y7DA 5B80A 4NI3A 3OZYA 4U33A 4DF1A 2P3ZA 1FWSA 3GC2A 1Y5XA 3DGZA 2WXDM 5GJPA 5C7VA 3SDOA 1W9BM 3KZSA 3DESA 1AH4A 2A7RA 3BCFA 3L65A 4ZGYA 3ID7A 3MI3A 3B97A 4JN7A 4H4RA 1HP4A 4XIMA 5K9XA 2CBVA 4GUHA 4KS0A 2YBTA 3M46A 3Q45A 5KZDA 1CGWA 1VJZA 3CUFA 3NVWB 4N9DA 3FCPA 2EBNA 4WJXA 4MAZA 2BC0A 4UB9A 1GQLA 2E9BA 4P8UA 1MEWA 1KLYA 1HVQA 2Q3OA 1XF0A 1FECA 1BG4A 4Z1CA 3CHVA 1OYBA 4PRTA 5AHIA 2XVGA 2OJPA 3SRKA 3BZGA 1U83A 1WPCA 4AYSA 4HZ6A 4E8GA 3CZEA 4RZ4A 3HFTA 1EYEA 4ZOCA 3PUEA 2XGIA 5AY7A 1H2JA 3VCNA 1XQKA 1MW0A 2OKOA 4QM1A 3RX3A 2Z1BA 1UR4A 2D2HA 3RJYA 3DYOA 2FH6A 3B9EA 2DJXA 1QU4A 1OK6A 3Q37A 4NHVA 3NJ3A 3KVKA 4P5UA 4HMDA 5HR6A 3O9NA 1UBSA 3VGDA 1GREA 3K8MA 2BS9A 2PODA 2XH4A 1K1DA 1AQMA 2FVKA 1LLWA 5IRPA 3VDHA 1R86A 2E6AA 5D2XA 2ON3A 2I57A 2GR1A 4KEZA 2VEIA 2X2YA 3UZXA 3LGGA 2QPXA 5C2CA 3W71A 4JIEA 4F2UA 1TIWA 5IDIA 4DAFA 4DUXA 3IUDA 5LSMA 2WC4A 4D1JA 2EF9A 4GYPA 3EZ4A 2E1WA 3AROA 2VGFA 4B5SA 4LC6A 1RA5A 3BO9A 3N73A 4AMCA 3ARSA 2A21A 1OFAA 1KXHA 3C2VA 2Y1HA 2J6XA 2WW5A 1R3TA 3LXAA 4I9JA 4DXVA 3UY7A 2C7FA 3KEHA 2XN1A 4FAMA 3WQVA 1I8JA 3GR4A 3ES8A 3POCA 2CZFA 3CGBA 4CQ8A 3GU2A 3HU7A 4Z0SA 4R9OA 4M7SA 4W8LA 3GHTA 1ITUA 1NHRA 1UP2A 4UXDA 3HQPA 3VK5A 1YADA 4D6JA 4BFAA 4I7UA 4N9CA 2MANA 2A4AA 3QMSA 5FAGA 3S2JA 3CLWA 3P93A 3WO8A 2FMNA 4ZQCA 4LUSA 4C1KA 3GVWA 1ZTVA 4IGNA 5ABFA 4QJ1A 3WQEA 1X2HA 1W5PA 3KFTA 1PIFA 4DBEA 3GS6A 4A8IA 2XVKA 4J1OA 2O7QA 2RJHA 1JNDA 3SI9A 1V3MA 4BK9A 3S46A 4IL2A 3B0YA 1R3QA 4Q8WA 3SO7A 3VZYA 4MTVA 1ZMDA 4D6CA 3R0KA 3LTPA 3O8AA 3L5AA 4RLIA 2BY1A 1M03A 3IWPA 1F8WA 4B92A 3WNOA 1B4EA 2X1TA 4G5DA 3WNPA 3KP0A 1FWCC 1XXXA 2RH9A 4OU1A 2D69A 4Q4PA 4AEEA 3QEZA 3P5YA 4HNOA 1S2CA 4QJ5B 4C6IA 1MVYA 2G41A 3P2VA 1VAHA 1JD9A 3GZ3A 1QPQA 2XZ9A 3C0SA 4C90A 4LB4A 1V79A 1GVSA 2YCIX 4U31A 3L5MA 4DAIA 2C18A 3BSHA 2ZFAA 4FNRA 3BOXA 2P0IA 4W85A 4IUGA 2DT3A 2UWFA 5CAKA 2E25A 2QPUA 3E0IA 4S23A 1GNXA 4CQBA 2PDUA 3TSMA 3N29A 1K4QA 2A7NA 4OIFA 4R53A 1JDCA 4JOMA 2V82A 2RKXA 5E1QA 1WP6A 4LUSB 1UD2A 4Q8OA 5ABFB 3CM4A 1JQXA 4JIQA 1LG1A 3EDDA 4LCRA 3A4JA 3RO8A 1GVFA 3AJ7A 2YCEA 2V81A 3PZOA 2OQHA 4XBKA 2QQ6A 3PJXA 1K9EA 3KBNA 1XM3A 4H19A 4GC3A 4JCMA 1BWKA 2BHZA 1ZKQA 5BXRA 1EC8A 1V02A 3ZT5A 3NPWA 3IIZA 4M8UA 4PMDA 1E56A 3B8IA 2GQAA 3RXZA 1S3HA 1LBFA 4PCPA 5JUVA 4J40A 1F6KA 1H0IA 5CPOA 3SUTA 2EGZA 1L8PA 2POTA 1FKXA 2OEMA 2ASHA 1TMHA 2WBKA 2YB4A 1EEPA 2X50A 3IACA 3VIGA 3EWUA 4V28A 1OINA 4HOZA 2YL8A 2ZQ0A 4QDMA 5GJNA 3W7LA 4HOXA 1R3WA 3AUOA 4KWUA 4NP7A 1US0A 5HPCA 4Y2WA 3AYRA 5I3DA 1KKOA 2AL1A 3NWRA 4HMNA 5BMXA 4NZ5A 1OF6A 4IGSA 3FAXA 3QKEA 1UCWA 1KCZA 3OYZA 5A8GA 3UJEA 2REQB 4AVNA 4Q6JA 4IPJA 5I3JA 4JICA 4K36A 1KRCC 3T6CA 3SADA 3MP5A 2TSYA 4YHGA 4HBKA 1UG6A 1V0LA 3TZFA 1AJ2A 4CNNA 3NQGA 2W91A 3AIQA 4MJ4A 4ZSTA 4CD7A 3KCJA 3VKKA 4AC7C 3ZOAA 4IIBA 2OWWA 1MQPA 3LENA 2Q8XA 1CGTA 2ZWZA 4LXFA 5C9XA 4PMYA 1I1WA 1SFLA 2QF7A 1N60C 2VC6A 2FZ8A 3R11A 1OGGA 3GHUA 4KBXA 3S2LA 4BA0A 4WLCA 4RE4A 1L2QA 5H2ZA 3VDGA 4CQ9A 1K8CA 4KCVA 4OQVA 1G9HA 3BUVA 3VE9A 2O56A 3M64A 3WUEA 4YWSA 2OOFA 4WKHA 4LU0A 1P6CA 2IXUA 2ALRA 2G50A 2AKMA 3TJ4A 1HJQA 3UA3A 8TIMA 1JCNA 1VENA 1ZAIA 3MO7A 3MCOA 4LCSA 3HZ3A 5TF0A 1A47A 1H7WA 2ZVIA 4HTYA 1S2UA 4C6QA 1UJQA 3WY1A 2X05A 2CXEA 2QAPA 1SR0A 3Q94A 3AS1A 4UFLA 5FAJA 1BXNA 4O1BA 3P74A 3THAA 2ZZ1A 2A8XA 4RV8A 1FWDC 4JYEA 2V3DA 2CLHA 2DZXA 2WV8A 1HGYA 4UQ9A 4A6GA 1R47A 3EAUA 5C7HA 1BGAA 1P48A 1M01A 3DHDA 3H7RA 5I07A 3OLIA 3AHVA 1XLKA 1I2NA 2CNCA 3V4BA 4RDWA 4DPQA 5CPQA 1DJGA 3PBMA 2PS2A 1HQTA 4ZQMA 3TYCA 3W7IA 1WZKA 4QEHA 4UTTA 1IEWA 2RJGA 2JF6A 2B7PA 2YB1A 2E28A 4LOCA 1NY1A 2GQ8A 2QZRA 1UH3A 1H1YA 3VUPA 4OKDA 2W67A 1LBMA 5HPOA 2VP8A 4GXWA 7TIMA 4HPJA 1U22A 2A5HA 2ZCGA 2RUSA 1YNPA 1MDRA 1GZJA 1C93A 6REQA 3HGOA 1OFQA 4ERIA 1CXEA 2DUZA 5E6ZA 3R0UA 3NQ7A 4CEXC 3PWIA 2CHOA 1A0EA 1F6PA 3NR0A 3UJFA 2QEZA 3FYPA 1M53A 5F2GA 5TNVA 2QF8A 4N02A 5HXMA 2NQ9A 4G7EA 1ISVA 3GU1A 5AC5A 1J0HA 3TU9A 2P1FA 2I9UA 3SN4A 1ECEA 1IWPA 3K4AA 4IUOA 5F7UA 2PDNA 2O55A 2XIIA 1TREA 3JVAA 5FOOA 1UR8A 1X7FA 4JTEA 3DXIA 4YL2A 5FEWA 2CU0A 4IMDA 3JZUA 2BY3A 3FW6A 4ZSUA 3G2GA 5E6YA 2KX9A 2NXHA 4MG4A 4XQ6A 2XVPA 3Q4DA 2CLLA 2INEA 3OZPA 1Z69A 1IXPA 4NILA 4HA3A 2CZDA 1ZCCA 2BBFA 3P62A 3NL5A 4UC5A 4HTBA 3CO4A 2F6XA 3UEQA 3GNRA 1JF5A 1PKLA 3DIPA 3B04A 5C2GA 1R85A 4C6OA 2ZTKA 1V3LA 3BLKA 1KNWA 3UXAA 2GWNA 1F3EA 3URQA 1H3GA 1EJSC 3LPOA 1DWAM 2V8ZA 2DV0A 5DCEA 4CN6A 1JJKA 3T0TA 2Y85A 4Z42C 4O1AA 3UU0A 4AEOA 4MLJA 2NVCA 2NV1A 1DJYA 3V36A 3QGKC 1Q63A 5A6SA 5A6JA 4M6UA 4WEVX 3VI2A 1UIOA 3CQKA 3WQWA 1NDWA 1PAMA 3KRBA 5T8GA 2WMGA 4RR4A 1M7OA 3C4UA 2D2GA 2E40A 2WMJA 1YPXA 3HGJA 4Q8PA 2QJHA 2J9ZA 3CU2A 1HTIA 2A6LA 3AM9A 4X22A 3W2JA 4B3LA 3UNDA 4AZHA 1BYCA 1OD0A 3S47A 1ZENA 4D1IA 5KMYA 1ICQA 4GI9A 2PDCA 4E4FA 2QHAA 3GDLA 2EPOA 4WRHA 4UQBA 2WP6A 1BWVA 2ZXBA 3DYMA 3WJXA 2O4QA 4GLEA 2VCCA 1WXYA 1QHOA 1G4SA 1TJ1A 3I4KA 3EX6A 4MJ2A 4N0RA 3SN0A 1F3XA 1K03A 1NWRA 2PGRA 3EB2A 2IKJA 3PUDA 2CZ5A 2EQ9A 2GH5A 2PF8A 2GOKA 3PZUA 3LHWA 4BQ4A 1FWWA 2WANA 3ITGA 4D8AA 3TKFA 3GXPA 2DT2A 1V3IA 4K39A 5ENLA 1JG9A 3HFYA 5LIKX 4BQ3A 5CBIA 2ISVA 3CUHA 3F4DA 3UZ5A 1KM6A 2Y5SA 4UTTC 2QVHA 3L4UA 1VEOA 1KGXA 2E0PA 5JMUA 1VCVA 1R7AA 4K38A 4NX5A 4LBUA 5E0KA 3MB9A 1TYGA 3TLLA 2O9OA 1D2KA 3M5VA 4GC4A 2PCQA 4RXFA 4I9MA 2OLHA 2BOFX 1BVWA 4DM1A 1A4LA 1EC7A 3WEZA 4J56A 4O18A 5JRBA 2OOGA 3TH6A 2EXOA 3ABRA 4QS6A 1YMYA 1FVPA 3WK3A 1ZX9A 2PLMA 5JBEA 2J74A 4EMIA 2XM1A 4QG9A 3HJZA 3V35A 4FOJA 3FYYA 4FX8A 4F79A 2W3SA 4WVXA 4DJFA 3N2TA 4WKFA 1YLVA 1J0KA 3U57A 4RDZA 3BMVA 3UWQA 3IIXA 2PP3A 5E70A 3QFWA 4DJDC 2ANUA 1QJWA 3F4VA 1S7MA 3VGBA 4S2BA 2GZXA 2HVMA 3PG9A 4GFIA 1GERA 1W3LA 2YOCA 1U30A 1GORA 2X1SA 3CHCA 4X9YA 3W86A 3IANA 2VX7A 1UKTA 1Q85A 4L4MA 4HJFA 2QKFA 3WJSA 1UKQA 1WZAA 2VM8A 1L6FA 4CCEA 5A3HA 3GO2A 3GDKA 2D0HA 1FP8A 3RMJA 1AJZA 1H5VA 2GSEA 2GGGA 3N4AA 1DL3A 1Q3NA 4O15A 1SYTA 3QPZA 4QR6A 3STPA 3VINA 2QXWA 1HL9A 2EQ6A 1YKWA 2WMIA 3OBEA 4JN6A 1QI0A 1O5QA 4NJHA 4NL1A 4TTUA 4Z1YA 4Q4KA 4I6KA 3EX2A 3E9AA 3H70A 3WF3A 2GJNA 3VNJA 3RRXA 1GQKA 3PPGA 5IXEA 3SAZA 4XIAA 2WCAA 1X1OA 2V9DA 2EAWA 2W27A 1ZHAA 3LLFA 3MV11 3WMBA 4DO6A 3UESA 3QQWA 3W2KA 1C8XA 1MQRA 2HMCA 3U0HA 4M7TA 3AMLA 3N14A 3GYEA 3QV9A 4GVHA 1OABA 1TE6A 3N6QA 3L5LA 1X2GA 1NH6A 1SW3A 4FX9A 3TR2A 3C61A 4URIA 2RGMA 1IT8A 3IRDA 1F4HA 4R9XA 3W87A 4W5ZA 3E2VA 4PMUA 3IPWA 5XIAA 4GI4A 2Q01A 1KWKA 3VIJA 3VKJA 1QO2A 4KMQA 2BXZA 3CWOX 3NEHA 4GISA 3LBOA 4HNVA 3G1YA 3A9BA 3TTSA 4QLJA 4ZQRA 4G1NA 4DQWA 4GIEA 3AHTA 3KX6A 1R87A 2J75A 1OC5A 2G5WA 2ZZ4A 3VPLA 5MKGA 4W7UA 2QYGA 4US5A 4UOQA 5D2VA 1VBJA 3W2NA 2Z7GA 3LPPA 3IGHX 3CC1A 3TXZA 2FKPA 3CV6A 1S5VA 2PP1A 1O4UA 2WMIB 1PDYA 5EFDA 3MTWA 1LT8A 4IXHA 4PB3A 1GRTA 2Z4GA 1JCJA 4L4PA 2WBAA 4IX2A 4O0QA 3S1GA 3GG1A 4Z08A 5EB8A 1OG0A 1KBLA 3UPBA 3E2SA 1VRXA 3U3HA 1Z3NA 4JIPA 4S38A 2WLZA 3TJXA 3UWYA 4C6BA 2VNCA 3SGZA 2OR2A 4AQLA 3VE7A 4HCDA 1HW6A 2RABA 3N3TA 3STGA 1UC4A 4UR9A 1B3XA 9RUBA 2V6OA 2V38A 1NDYA 2WJDA 3T7VA 1QI5A 2P76A 1Z6KA 1R9ZA 1MRAA 3SQMA 3LN3A 3PZVA 3RLGA 2VC5A 1J6OA 4PCTA 1YDYA 1A50A 4QE5A 1QVBA 2YCJA 4GKTA 3IAQA 1CECA 4GY1A 3VMPA 2VL4A 2C1HA 1SR9A 4JTKA 1W6TA 4FLOA 4H83A 3F2BA 4FNTA 3QR0A 5J8LA 1O94A 2GRTA 3GXIA 2G96A 3FHAA 2Y7EA 3O2LA 3TQ0A 1MSSA 3W7NA 2WSYA 3PZMA 3CNYA 2FJUB 4CVWA 3OA5A 2NSOA 3AC0A 1QOXA 4LPCA 3SEPA 2OWXA 2OXNA 4DYKA 2JQXA 3DFHA 4NASA 2VOMA 2YZ5A 3H2OA 2UY4A 4EF8A 3HURA 3T0BA 3BJTA 3LERA 3TOPA 4OJYA 4GJ1A 4LA1A 4O53A 2YZRA 2YL9A 1QDSA 4J3XA 1AQFA 3P5ZA 2EQ7A 1J93A 2PE4A 3DOPA 3R0DA 3OPSA 1ZCOA 4NYUA 1XDJA 1N5XA 3UP8A 2DZWA 3AIVA 4W86A 1UWTA 3EX4A 4Z2IA 4F0MA 3T4CA 2V5CA 1XINA 2V0TA 1QW9A 4LC8A 5D8ZA 2EEXA 1ICPA 2XPKA 4ATDA 5BXPA 4Q7BA 5FS6A 4JNMA 4E38A 4IX0A 2ZZ7A 1HXJA 2VI0A 1V77A 2YA1A 3W01A 2OB3A 5E0CA 3G1AA 3BGGA 4YXGA 3CYVA 2VOTA 2WP5A 4D6GA 2AL2A 4GY7A 4YTSA 3LCLA 1U5JA 1XBXA 1MFUA 2UY3A 2BSLA 4GNJA 2YDQA 2ZX7A 2ZUSA 2R24A 3NGJA 2PRMA 3WUBA 4GWEA 3SQPA 1W32A 2D23A 5EMMA 1KKRA 4IWWA 4GUGA 1X98A 4F8XA 4DUOA 2NUWA 5AZ1A 1TO3A 4MHBA 1WCGA 4IIFA 1DQUA 3CPUA 2C3CA 4QISA 3HJEA 1J5TA 3HGRA 1E43A 4E8CA 2PWEA 2FHCA 3R07C 3TXVA 1PVNA 2PFHA 1VIWA 3VGEA 4RE0A 4PBGA 4X2PA 1R3YA 2G95A 1WDQA 4D6DA 4RNFA 3BARA 5GJMA 1WKFA 3G1DA 3VIIA 3NA8A 4Z2GA 5FEXA 5D2YA 1IIHA 3VABA 2R9ZA 3UBPC 2OZ8A 5DBTA 3UZYA 1BEUA 1DJHA 3W1NA 2GVLA 1GEQA 4NAEA 1VGAA 2ZICA 1IE7C 1FDZA 4JYFA 3PZGA 4MIMA 2EJAA 3A24A 3GKAA 3B0VC 4ATWA 4ZOEA 1IZKA 1TPEA 2VQUA 1DJIA 3S42A 1R30A 5HMFA 4HPXA 5G5HB 1QW7A 1W5MA 2XN2A 4UOZA 5D2TA 2VD8A 3STFA 4C5ZA 4C6PA 1VCFA 4XZIA 3MMTA 1UKPA 3WK0A 3ZLGA 4P7LA 1EFZA 2DT0A 4QJ3B 3W22A 1H50A 4AG0A 3CZKA 4GVIA 3TW6A 5HWMA 3B9DA 1H60A 3W72A 2YYUA 3MSGA 4WHBA 3QSTA 1OFDA 1ESWA 4FDCB 5G4WA 5I79A 4L6OA 3GHRA 4UNKA 1JCTA 2Y5JA 1K7XA 3L8KA 4H7VA 5LNVA 4C5YA 4DWSB 6CGTA 3GRTA 1XRSA 3MVTA 4PZVA 3QYSA 1E6ZA 4Q4QA 1JUBA 4BS0A 2NXGA 1NIUA 1OB0A 4P7OA 5MF5A 1GEHA 4YTTA 3TK7A 4ROPA 4PR4A 3B9NA 4BV6A 2I7GA 4ALDA 3UR5A 4LRSA 2OZTA 3EMCA 3HGSA 5KSWA 4FEZA 4XUGA 3RLUA 7REQA 1B3WA 3STCA 3I7QA 5FJIA 4B16A 1AK5A 2IW0A 3S9ZA 3BLPX 1A5MC 3VZXA 1UP0A 4HT3A 2DSVA 1ZY8A 1IXNA 2WK2A 4Q33A 1W1YA 1XGEA 1VJIA 1SO4A 3YPIA 1UZ1A 2VWTA 4TVYA 2CPUA 1T41A 1MZHA 2R8WA 3ZWTA 3BL3A 1YTDA 5A6MA 2HTMA 2CLPA 4DNMA 5FEZA 1V0MA 3WL0A 4WDUA 4LAUA 1NF7A 3EANA 5K7JA 3U4FA 3U4AA 1EBHA 1A5UA 1LL7A 4L6DA 3GDRA 3TQPA 1S5NA 3BAKA 4Q8UA 2X8CA 3AYVA 4WY0B 2WJEA 1E9LA 5M1TA 4IIHA 3GIQA 4GCXA 3VCCA 3WEOA 4PMZA 1SU5A 3TROA 1KBIA 3LM3A 1RXOB 3LQGA 4IFKA 4HU0A 4W7WA 4ZEPA 2PBOA 5G1MA 4B2DD 2FH8A 5EBAA 2QUTA 2FDMA 1E0VA 1EXPA 2CC0A 4S3EA 8A3HA 5DEZA 4QE4A 3P14A 1ISYA 3TCSA 4B5NA 4JXCA 5CGTA 4DWSC 3NZGA 4FI4A 3L0KA 4BR1A 4FB7A 4HK6A 2P0OA 1XR2A 4OHQA 3VC5A 3DFOA 3RCNA 3PBGA 1KFKA 5MHBA 3VNLA 4Q8QA 3DYPA 5CPMA 2WOWA 1SUXA 1ZLPA 2WVSA 3CV2A 1GQIA 2TMDA 5LIWX 2R91A 1OSEA 2OLAA 4IMGA 4HK7A 3EXRA 2CIPA 2W6RA 4RW3A 5DY3A 2C0HA 4AUBA 3HQ1A 1A5NC 2H3DA 1HP5A 2E3ZA 4E3VA 1ODUA 2AAMA 3W23A 1ZNNA 2XHYA 5HUPA 4EM4A 1UJPA 3VAVA 4OFCA 3E49A 4U5KA 4NEVA 3GD4A 2V5KA 3B0XA 4RCXA 2YDRA 2ZUNA 4FF7A 1RHCA 1IEVA 2QJNA 4GQQA 2FGZA 2EPHA 2XM2A 2J8GA 1TZ9A 1THFD 3TSBA 1TV5A 2VURA 5BRBA 1DXEA 4K3ZA 4Z2KA 1OX6A 4J4KA 4ZE5A 4QGCA 3WJYA 3WNNA 1HJWA 3VO0A 1TB3A 4GCAA 1AQ0A 3CIXA 1NU5A 3GLCA 3ZWSA 4AY7A 4JTIA 3F2CA 2ZX6A 1UMLA 1KW1A 3MDUA 1UD8A 4MFDA 1GQJA 5F2LA 2E5AA 3A4AA 4ZXOA 4JTSA 1GWJA 2J62A 1IWBA 2Y4SA 3G0UA 4V1YA 5IHRA 2VQTA 2DZSA 3C2YA 4L1WA 2QMJA 3SCSA 4P8VA 2V69A 2IKHA 4ICCX 5G1TA 4IMFA 4LYRA 4FX7A 4D9PA 1QK2A 2FZBA 5F4XA 2VDGA 4CNUA 5DX7A 1FHDA 3M6DA 5HNRA 4ADSA 4G9PA 1YQZA 2IPWA 4O19A 3BCDA 4PB4A 3V16A 2VFIA 3AI0A 4WSJA 3HIJA 4LUIA 1GCYA 5C8BB 2RAGA 2ZIDA 1R8LA 4C6LA 5FSEC 1MUWA 2HK1A 1XSJA 1D8WA 4A3QA 3H7UA 2UBPC 3O07A 1TSIA 3ARUA 1NFGA 2A3EA 2WCSA 2VCBA 3VVGA 5LA1A 4ZA0A 4EX4A 1U33A 3UQNA 5F4WA 1E4NA 1Y8BA 1ONEA 2QCLA 5FF2A 1XPYA 3LS9A 2Z27A 6ALDA 4M6PA 4CN4A 3M7WA 1SZEA 4ERGA 2EG7A 2V2CA 2FVMA 1EQPA 3GTNA 1FWBC 2QGYA 1AD1A 3I3BA 1FFQA 2ZX5A 3TN6A 2XSAA 4KWWA 4B5UA 4HHHA 1RAKA 1E9ZB 1MMFA 4LAMA 3A4WA 1CW2A 1X38A 4MY9A 3R6IA 2WKGA 2WO5A 1MXSA 1EIXA 4OUEA 3UG8A 4DJDD 1PPIA 5D9NA 1W5QA 3UD6A 1O6IA 3TAKA 4GK8A 4EACA 4XD6A 1BF6A 3WBAA 1G69A 2VFFA 4KKXA 4JCLA 3AXMA 1A3XA 2NVDA 3QY8A 4YN5A 1TTQA 5A8MA 1RSCA 3LU2A 4GI8A 3ZJ8A 4L9YA 3OOQA 1LWJA 3B4YA 3BICA 3OQ8A 4E4UA 4UOJA 1AW2A 3G1RA 3WF2A 5GVJA 5D02A 1NWUA 2RHGA 3WD2A 1GTHA 4NG3A 3C8NA 2DT1A 4HD5A 4FOUA 1PKYA 2DZPA 4DWDA 1TA3A 1NPXA 4B3KA 3NVDA 2E09A 3VUSA 4LJ3A 1GOKA 4GIAA 5AOUA 1HUVA 4FXSA 4MJZA 4FNSA 4UTWC 4A21A 3DZ1A 5I06A 1Q6CA 1XIDA 2CYGA 1KQZA 4Y9MA 3A3WA 1XH0A 1QXLA 5I78A 2EG6A 1PZ2A 3VD3A 3VD5A 3ZFHA 1BYBA 3A22A 3W37A 4ATLA 3G6LA 4MGGA 1D7FA 5A2CA 4AX7A 5CSYA 4Y96A 2LLEA 1FDYA 3H2MA 2G8ZA 4UTUA 3BQ6A 2PZ0A 4JL1A 2RDXA 1BVZA 1K8YA 3HV9A 1FRBA 2E8ZA 4O14A 1KO0A 2CEQA 3AS0A 1XIBA 1B31A 3G8RA 5J5DA 5ABHA 4LQ1A 1WAUA 1TPC1 4I5XA 4U4MA 4BQ5A 3URBA 2QT3A 2VFEA 1MRQA 4DYJA 3BMXA 3ZVIA 1W91A 3WK2A 1ZRQA 4TU1A 1K8ZA 2CERA 1RVGA 1XLMA 3O16A 4G6CA 1GK8A 4MB5A 5CC5A 1J10A 4LYQA 3WBYA 3F5KA 4XWUA 3ANYA 2G4FA 5BU6A 3E74A 1E4IA 1XYLA 1D9EA 1EUAA 1YTKA 1TV3A 1DIDA 4BCEA 1W1PA 4GNVA 3M43A 5FF3A 3PBUA 4XTIA 4HQVA 5IDZA 3C8FA 3ABQA 1H62A 2ZADA 4C7FA 2J24A 3SUWA 3G1FA 2WHJA 1VD6A 1WZLA 3C3UA 2ZX8A 1UKSA 4M6QA 2R6OA 4JKLA 4UMAA 4JTHA 3KWSA 1W3HA 4FPSA 3CYJA 4FNQA 3K4DA 1UUMA 4Y9NA 2WCGA 5CC3A 3U2EA 5AKQA 2AMGA 2QLYA 3KUMA 1K3UA 5D32A 3UJRA 1HN1A 1DORA 4H8NA 1DP0A 1JXKA 3NO1A 3VU2A 3LHVA 2CW6A 4O16A 3OVPA 3VMNA 3CB3A 1E1CA 2Z1WA 1N8FA 1HJUA 4ZBCA 2WOIA 2R1KA 3VNDA 3MT1A 4NZCA 1BVNP 3N1AA 1E4MM 4N4QA 3O63A 3DHPA 3CEPA 4H4QA 2UY2A 7A3HA 1DQXA 1GVEA 2X1IA 3PFRA 1J8VA 3OYXA 3RU6A 1UR9A 3NQFA 4JDYA 1JZ3A 1PX3A 2DP3A 4YPJA 4IXXA 1YX1A 3A3HA 3W75A 2WM1A 2OKTA 5CC7A 3VTRA 3C56A 3P82A 1Q65A 3ZSSA 3QGVA 4LFYA 3TN4A 4GBUA 4OUIA 1QNVA 3TAOA 5LNUA 4RXGA 5CBJA 1F3TA 2PZNA 1D8CA 1Q6QA 1ECQA 1JDFA 3WJZA 4RE2A 2C8NA 2GQ3A 1TFVA 2E68A 4Z1DA 5BRQA 5IBXA 1FWEC 2DH3A 3U2OA 2D24A 4F3HA 3BAXA 2Z24A 1Q5MA 3Q6JA 2VDIA 1XGZA 3NVZB 1DXLA 4Q8VA 4XAFA 3SR7A 2AAQA 4R3UA 3WNKA 3R89A 1BYDA 1TRIA 3JZEA 1OIMA 3LK6A 2YCLB 3DH9A 4BEUA 2ZRVA 5FS9A 2NQHA 3G1VA 4AW7A 2Y0FA 1ZFJA 1ADSA 2JEQA 4TX8A 4LVAA 1C7SA 1E6XM 2Q8ZA 4JHZA 3RGTA 1ZU8A 2O9TA 3K1GA 3RYSA 4FIQA 3GRSA 1ADOA 1RBAA 4Q8MA 4JIHA 2JALA 2AQVA 1WBJA 4FMVA 4C91A 2YDSA 4HU3A 5KTLA 2W92A 4EQWA 3GG8A 4AU0A 3NPXA 2YYTA 3UXLA 1QPOA 1E6SM 3RX4A 4UZUA 2YW4A 1DWIM 1XUZA 4D8ZA 4TX6A 2WMHA 1CENA 1AL8A 5AHEA 5D38A 4KPRA 1FCBA 1H61A 1M7XA 1N55A 2BP1A 3LPFA 4YCOA 2JF7A 3FX4A 1RD6A 4GOAA 1V0NA 2E1DA 4RDVA 3AJXA 3UCQA 4MLRA 1Z9AA 4TMCA 3ENLA 4KFNA 3B8TA 3CGTA 3V3WA 1M65A 1FWNA 3IVSA 5G2WA 2TPRA 1FBAA 4HA4A 1K77A 1OC6A 4XKMA 2XDFA 3ARZA 3VFLA 2CFYA 3N04A 3ZM8A 3RPDA 3CB8A 3AISA 2X7VA 3RO6A 1G7UA 2ICSA 3EOUA 3TX9A 4NY2A 1DJZA 3A23A 4JDRA 3DFTA 3WDQA 4KWOA 3O6YX 2I14A 3PPFA 3P7YA 3PULA 2E5BA 3GE7A 4TIMA 1I2PA 2P53A 4GX8A 4H9ZA 4NYYA 4WJ8A 3OEXA 2ZA1A 1OM0A 4X0VA 1OFRA 2WHMA 1AL7A 2RFGA 4QCFA 5HMDA 3NSXA 1E73M 1A3HA 4A8NA 2V3EA 2AGTA 1NOFA 1CYGA 3NPUA 4H6KA 1H2IA 2WZIA 1IYXA 2QCFA 3L4XA 4BKNA 1FHUA 3HW2A 4ES4A 3T09A 3WDHA 1US3A 1N62C 1S3TC 4I6VA 2E9LA 1KFJA 4KH2A 1ZB5A 5H8UA 2AMXA 2DW7A 4I90A 1GRBA 2PTZA 3KL0A 1IXQA 2FZ9A 2YVGA 1BLIA 3NAVA 1FY6A 1ONFA 4BHYA 1EP2A 4KT2A 1RP8A 1PYFA 1T8XA 4W87A 5E09A 2BVDA 2A7PA 2Q09A 3W7KA 3WYZA 5CGQA 1Q6EA 1UZDA 3AWOA 2XIQA 2V5JA 2Q3RA 4JEQA 3RMEA 1ZBVA 2PF0A 4YYFA 3PAOA 4DHGA 4EWND 4I3GA 3ARWA 3ITVA 1A3WA 3GC5A 1KRBC 1UQYA 2C19A 3WLMA 2IQTA 3WIJA 3FK4A 3TC3A 1SO6A 1GJUA 4O13A 4K68A 2J9YA 2CESA 4B4FA 4ZE4A 3H2AA 1O7AA 4CN1A 2VX6A 1E0UA 3O0FA 3N18A 3WBXA 3L12A 4C60A 1E6NA 4XK2A 1R2SA 3BAIA 3NNTA 1UBPC 4CNPA 4DX3A 3ITTA 3NSMA 2YVJA 3CPGA 4HMCA 1ZBKA 5KINA 3AIEA 2JIEA 2A3AA 1DXIA 5FMHA 1UH4A 4I9TA 2PDKA 1OX5A 2VT0A 4RDYA 5DQPA 5HQEA 3D6NA 5A1AA 3OLGA 5I3IA 3CZ8A 4PUJA 2WHKA 5J04A 4FNPA 1F07A 3SURA 2DUAA 2C13A 4Z2LA 1T40A 1KB3A 4J3ZA 3GH4A 1U1JA 1AQHA 4RNIA 3K2GA 4IMAA 4FR6A 5DCDA 3LMZA 4BF5A 3W9ZA 5AYXA 2QAEA 3AICA 2KAUC 3IEBA 3AZSA 4OWGA 3NYZA 4H4VA 1XBZA 1JYNA 3UPWA 3M44A 2NVAA 4D6HA 2QV4A 4L65A 4AD0A 1NHSA 1B9ZA 1DBTA 2IKGA 1O68A 4PUNA 1PS9A 4RL3A 4EPBC 3USBA 1XLIA 5CPLA 1J0YA 1C8VA 3ISIX 1CBGA 1PKMA 4DNAA 3P0WA 2QCDB 4UWMA 5JCMA 1UWUA 1OQFA 3WH8A 2Z1KA 1TX2A 2HQAA 1TJ2A 1B4KA 4A4AA 4KIRA 4M80A 4DWSD 4J35A 3H8AA 3GR7A 2PI6A 3VKCA 1I2OA 2ZOXA 3VNYA 5FF4A 1F6YA 3EDFA 1A5KC 2A85A 1UWAA 2HJPA 3S5OA 5IHSA 1CX9A 4AWSA 4H50A 1ZAJA 3SIMA 4MNKA 1YE6A 1T8QA 4TMBA 5BNKA 2FYMA 1XI3A 5CH9A 6PTDA 2YA2A 3SZ8A 4OVXA 2CZEA 4FLSA 1EEXA 4KETA 1PCWA 4IG2B 3DUGA 3GVVA 3GD3A 1EUNA 5DBUA 3E0VA 1S46A 3SECA 1QMLA 3W74A 2WOVA 1M7JA 1XYFA 1EJXC 3T4WA 2GVEA 3FJNA 1XFBA 1QWKA 4ZOBA 5K2ZA 4F2TA 3FJLA 4N2YA 4HIBA 3DG7A 4AX6A 4FF5A 3LRLA 3FEMA 4L9ZA 3VMOA 1SMAA 4S3CA 2J7DA 2QUNA 1KCKA 2GLKA 1ONXA 2X8RA 2I9EA 3R10A 1RALA 1B0IA 3SGUA 3DEQA 2QJMA 3A3XA 4QG6A 2NQ5A 3VNKA 1I4NA 4NQ1A 3QM3A 2ZE3A 3DGHA 4H6RA 4LY8A 2G0WA 1IEIA 1A49A 3T8LA 2VJXA 5EMJA 1GJWA 3M0YA 4UBPC 3WQ8A 4B91A 4W9TA 1KFBA 2CDUA 3RCMA 5KETA 2HDJA 1H4PA 2BFGA 2DSUA 3KOXA 4JQ4A 1OZMA 1CXKA 1EHNA 5LNSA 5CZ0A 1SW0A 3KAOA 3BURA 1TUXA 4JN8A 1SSDA 1Y5WA 4H9TA 1X1ZA 4X63A 3KXQA 4C1NB 3RM4A 1JQVA 4PULA 5LA0A 4F40A 2OWCA 3B9JB 3MCNA 3FDKA 1TYPA 3OLEA 1J18A 3H24A 1EDTA 1CXHA 2GDUA 5A95A 2PWDA 3KTSA 1FO4A 3ECQA 3QMRA 3QMTA 1X39A 4ZL1A 2OSYA 4H4UA 2BX7A 4M52A 4OECA 1PYMA 5D9PA 4M51A 2ZVRA 1GGOA 2HNEA 3LSCA 3TMQA 4HOWA 5I2UA 3WLOA 3ARTA 2ZRWA 4HZMA 4EAMA 1DWJM 3FS2A 3FXYA 3MANA 1WKDA 4S2CA 1WBHA 2BC1A 4XAZA 2YQUA 2X99A 5C2XA 4WD0A 4N6FA 5DANA 1ZS2A 4J3SA 3AIWA 2Z29A 1I45A 1E6PA 3H53A 4L80A 1EH9A 1TELA 3CGCA 5I6SA 2GSJA 3FSUA 4AISA 4BURA 2QDDA 3N3MA 3CZLA 3E3HA 2W55A 3QLLA 5HWJA 3TYEA 1EO5A 3GAKA 5GPRA 4JTGA 2GUBA 2HPIA 3EAOA 3GBEA 3MHGA 3LLXA 3ZQ9A 3I3EA 3AYTA 4G8TA 1H11A 1LORA 1KRMA 1JPKA 2BVYA 4AD2A 5K9CA 2PEVA 2V5LA 3EOLA 3S5YA 3LA4A 3O3RA 1FHLA 3NXFA 2PC4A 1OT2A 3IV3A 4PTWA 3TDFA 2OT0A 2OYMA 3HG5A 4Y9OA 2NXIA 3LTYA 5DT5A 1F3PA 5FJRA 4EK7A 5LGXA 4ADUA 3GVRA 5DY2A 1GOIA 4YTRA 4R7OA 4L1XA 5C9UA 1E51A 3WFLA 3B4UA 1EA0A 3MKCA 3W7RA 1O5KA 3V0TA 4HHMA 4KGLA 1U1HA 2J9XA 4EIVA 2VZVA 3TNBA 1LWHA 3IV8A 2E77A 4DI8A 3DU0A 2FJKA 2Y7FA 3H4XA 1F05A 3JU2A 4PCFA 2WNQA 4WSKA 2GJXB 3OTRA 4JFWA 2ATSA 3W6MA 3B9AA 4IPIA 1FEAA 2I56A 4YTUA 5JIWA 3WQDA 3TC6A 1WAWA 1Q45A 1W3IA 1JPDX 2G3JA 1W1B1 3CUJA 3VZZA 3KBSA 4PMJA 4RZBA 4PH6A 4XZ9A 4UQDA 2Q8LA 3OGRA 4X0NA 2PDYA 2ZRXA 3L5OA 2PLCA 3MSYA 2PU1A 4KW2A 4TOQA 2A3CA 4UQEA 1BYAA 1PV8A 3MV01 2HEJA 5JQ9A 4JYDA 1KFCA 3DENA 4IF2A 3VIMA 4JTAA 3GXTA 1U2YA 2HE8A 2YPIA 3ZJ6A 2ZE0A 4EP8C 3KS6A 1KM3A 2G37A 1E5NA 3PF3A 2H9AA 1AZ1A 1LRTA 1DOSA 1RCOB 4MKSA 3FDGA 3AIBA 3UYCA 1XLDA 2QS8A 2ACUA 2PGWA 2E6YA 3N34A 3FAWA 1F73A 5FF7A 1SFSA 3ATZA 4XAYA 2VHLA 3QPYA 1HIZA 3UGRA 2G3IA 1HKJA 3TONA 1TWIA 3AS2A 1CI1A 3L4VA 3BLEA 1W37A 4Q22A 3KTCA 3DECA 5DXXA 2QCGA 4JPGA 3MMWA 1RCXB 4DLFA 4RNHA 3NVYB 4ECLA 1CPUA 2QR6A 1QTWA 2C91A 5AVNA 3KBVA 5FF0A 4W4QA 4Y90A 4OOZA 3OC4A 4ENLA 5REQA 4PA8A 4S3BA 2HS8A 1TPUA 2H8XA 1JPHA 2XTKA 2Y2WA 3T07A 2WZMA 3LCFA 3N2MA 4GACA 3E2RA 7XIMA 3L4ZA 5HJXA 2QJGA 2F6KA 5D09A 1QR7A 4F66A 3H55A 1W1VA 1E55A 5AYZA 3LOTA 2CZVA 3GNPA 3UG3A 4LV4A 2JBMA 3NQBA 5DRCA 5KZEA 4XBSA 1IEXA 3KOFA 1B57A 4A35A 3NFUA 1PX8A 4B5WA 3ELFA 3D3AA 4O0ZA 1K02A 1W9DM 3AIRA 2CLEA 4WDTA 4YJ5A 4N7QA 1KXVA 2W9MA 2PTDA 4IFRA 2H9AB 1HL8A 1XLAA 4DBWA 5A6BD 3ICJA 4AF0A 3BMWA 2OT1A 4R7JA 1FEBA 1H0GA 1KXQA 2V2HA 1C3FA 4G1KA 1DNCA 3O6CA 3VDAA 1V4YA 4JQ1A 2C16A 3LCHA 1LTDA 1HT6A 1OF8A 4UQAA 2EPNA 1GHRA 4V2XA 4UTLA 3LD5A 4AD5A 4L64A 1W1IE 1OT1A 1WDSA 4FXRA 3S8HA 3CHEA 5H1WA 2ZDRA 2INFA 4H6EA 4HGXA 2VUNA 2VFHA 4EQRA 3FVMA 5DELA 1H51A 1WUFA 3IRSA 4H4YA 1BWCA 4A8RA 4BF7A 3VA8A 1VEPA 1HKKA 4AY8A 3ZR6A 4HK5A 5JH1A 4P61A 1OBAA 4H4PA 4AHQA 1UPPA 2NT1A 3H22A 3WLPA 4WOQA 4H8UA 3BLFA 3ZIZA 4MB1A 2V5BA 1O5XA 3IK2A 3SSJA 5JBFA 3QV8A 3FEQA 3UGVA 4PYSA 1JPIA 2F38A 3A7UA 3NG3A 3WF4A 2MNRA 1RLDA 1W3TA 4UFKA 3VFCA 4R85A 1F8IA 3FLUA 4LT9A 4UTHA 4K1GA 2AAAA 2BY0A 4AF0B 9XIMA 2YL5A 4JFTA 3QV6A 5AFDA 3LV5A 2ZDSA 1MZRA 3QFBA 1BKSA 2R9RA 5E5CA 4Y6GA 3APGA 3ZLFA 3VM5A 1B30A 4DZ5A 3UZWA 1ODZA 2V67A 2WVVA 1QASA 3A47A 3A6OA 2JIWA 4NZ3A 4MOZA 1ISWA 1I75A 3RRAA 4UMCA 4C6NA 1ENUA 3QQ0A 4W7VA 4BWLC 2TODA 4J3VA 1Q6OA 5G2HA 1TPWA 4N9EA 1DTNA 5C9WA 2HXTA 1A5AA 4HMEA 2VEKA 1KA9F 4GUFA 4XZNX 3WH6A 1XYCA 3N6HA 2R94A 3SCUA 3TP4A 1XIEA 3AU6A 5CJ5A 4S39A 2R1PA 3OHIA 1LPFA 1JYWA 1E9IA 1PEZA 1B3YA 1MOKA 4JEJA 1Y65A 5ER0A 3TFXA 4GHRA 3GFYA 3PC0A 3PB0A 4KF1A 4GQGA 3WFAA 3LCXA 3W1PA 3S5ZA 1A5BA 3ABXA 1E5JA 2V2DA 4MPKA 1XLHA 4E2OA 3UZJA 4ZTXA 4DO4A 1XX1A 1XANA 3KDNA 1NP0A 1RPKA 3S5SA 3UCCA 1LWIA 3INPA 4NNBA 4D6FA 5A94A 1XD0A 2D2JA 3FGCA 3GDTA 1M9HA 2GVGA 3VYLA 1N82A 4JS3A 1FH8A 5KEZA 6A3HA 4FIRA 1OHLA 2WVVB 4PODA 1QHZA 4N42A 2PB1A 1ZXIC 4IGMA 4J27A 1WOBA 3PBWA 1Z32X 4UR8A 2FIQA 3M0XA 3KP1A 1TV8A 2QCNA 3NL2A 1C7TA 4E4PA 1W5NA 3LRKA 1A5SA 5A8PA 3IGSA 4FK9A 5C0QA 3P60A 5FIPA 3F7JA 3S0CA 4RUBA 2FTWA 1XDIA 2HBVA 3P0XA 2XUCA 2IXVA 1RP9A 4Q6XA 3NL6A 3TEVA 1S5TA 3CAQA 3QKZA 3K46A 3M0MA 2E8YA 3CUIA 5CPTA 1UR0A 2WQPA 1IT0A 3WG6A 5HJYA 3A64A 3CGEA 1AOGA 3UG4A 4H9MA 3QFAA 3WKZA 3FHQA 2CKRA 5C5YA 3DAQA 3XISA 3HV8A 3ABZA 3RU8X 4C7DA 1SJCA 3J7HA 5HBFA 3GXFA 1MI3A 4AZ5A 2GDQA 3SCPA 3ZS4A 4Q8TA 4DNHA 1TVPA 3PZIA 3OLDA 2QCHA 1GT8A 1YBQB 3FGCB 3GUWA 1H7OA 5T91A 5EFFA 3BG3A 1DIEA 3V5OA 4GH3A 2HE5A 2NWRA 3VDCA 1Z44A 4GUJA 3QLDA 3NZRA 1JL8A 4DXXA 3NGFA 3EA1A 3I10A 4W84A 4S3AA 1Q8JA 3RDKA 4AXNA 3WSUA 2REQA 1N5WC 4EF9A 3CMGA 2BOEX 2QIWA 2YDAA 1LRNA 3TA6A 2V3FA 4H00A 4JHMA 1U5VA 4Y9PA 1I60A 3G1SA 2C1IA 1TV4A 1QWGA 2D3LA 3N9KA 5K3VA 4I5RA 4PMXA 3W7EA 1H63A 4LRTA 1J6PA 3THDA 1EJ7L 4QEEA 1EQCA 1X1NA 2W62A 4DYEA 1O12A 3B06A 4TUFA 4IP7A 2DZUA 2W79A 4XKYA 4LX4A 1OVDA 4KRZA 1OCJA 4YVVA 4HNUA 2YAUA 1K9TA 3AOFA 5A69A 3EKLA 1Q7MA 1IGSA 1UIPA 4OV4A 3VNMA 3ANVA 3ITOA 1J01A 5LGZA 7PTDA 5G1YA 2I5GA 1NAL1 4GH1A 1B3OA 3QOKA 1NFPA 3WDIA 4BF9A 3GDMA 3W3OA 4AZGA 3RNMA 4TV5A 1GESA 3N2XA 1SZRA 3I6TA 3TWBA 3LQLA 4JTFA 1TE1A 1NDZA 4WIWA 1UZ4A 5LHFA 3U9IA 4B2DA 4HN8A 1G7VA 3EYPA 4JNYA 4B4HA 1WKYA 1OYCA 4D6EA 4MYXA 3IIOA 2GK1A 2ZUVA 3NDYA 3T2OA 3LNMA 3LXBA 4ACYA 3EKGA 1ME7A 4IZGA 5FD0A 2VRQA 3H2EA 1PXGA 1VB9A 3QBUA 2JE8A 3TVAA 3PUGA 1B90A 4ZR8A 4HP5A 2OVLA 3TE9A 3T08A 4A2RA 3O15A 1FIQB 3HA1A 3WLTA 3AO0A 4K1WA 1K70A 3RM9A 3PN8A 1TCDA 1GETA 1L6SA 4IPLA 4U3CA 1EPXA 1UD4A 2J7HA 3CMJA 2CITA 3DI0A 4P8WA 1K6AA 2Y8VA 4ERAA 1GPFA 3HPFA 3V5FA 2WOQA 2IQ0A 3N17A 2BGQA 3IJDA 3G8EA 3UW6A 3WQPA 3G0SA 3I6RA 3DFNA 1CWYA 3KOYA 3FXGA 1GG1A 4AZCA 4JKMA 1TYTA 4XKYB 3PR2A 3PNUA 3QRHA 3W1UA 5FJJA 1LVLA 1E0XA 4N4PA 1H1NA 4XZLX 2WHLA 1T3QC 2PGEA 2DH2A 2TPSA 3LI1A 1TZZA 1W0MA 3DI1A 4KFOA 4NZFA 4AAJA 5AC6A 3APTA 4JNZA 4H8VA 3TLQA 3WFZA 4PRWA 4PL1A 5TIMA 3WQOA 2ABBA 4W8AA 1DKWA 3VKAA 4AZ6A 1UMYA 1UR1A 3WDJA 2BHYA 4A2SA 3EA2A 2PTXA 1KGWA 1ZBWA 1LL4A 3GTXA 2WJFA 1YQ2A 4NJGA 2GK1B 1B3ZA 2PDGA 3DG3A 3THCA 4JTTA 3W25A 1HGWA 2DVTA 1OFEA 2PURA 2PU0A 9XIAA 1V59A 3RJXA 3CIVA 4NRSA 3OA3A 1SZFA 1VFUA 2YX0A 3NS1B 2QULA 2W0UA 4V33A 3S4TA 2ZKMX 2Z26A 2YFOA 5AN7A 2NQZA 2OPJA 3R1ZA 4LIIA 3HBLA 1NF0A 3CJPA 4PSPA 3LGEA 3MC5A 3W73A 3V18A 4QITA 3SUSA 3PPHA 1TMQA 1XHGA 2CETA 2ZUMA 1FXQA 1GEUA 4B15A 1I9CB 3KLJA 3LX9A 2ZXAA 2H6RA 1N63C 4AZCB 5HANA 1MW1A 3WNMA 2J88A 4WDWA 2WZHA 3OG2A 5LIXX 3F4WA 2PSNA 3WQCA 5GNYA 1L6YA 1N8WA 2I5QA 4LVDA 4CQCA 3NUKA 3W7QA 1LLZA 1VQTA 3LHYA 4DIAA 3II4A 3A4XA 1ZPTA 1K9FA 2BXVA 3AUJA 1RQBA 3WBEA 4HNTA 3PSVA 3GNNA 4PMVA 2XISA 2WYSA 2I17A 3B8WA 4LAKA 2GR2A 4H4IA 5LZLA 1Q6GA 4DJDA 1YDVA 1PHWA 1RZMA 2FHBA 4L56A 1YDOA 4N6EA 3K1DA 1V7AA 4IIGA 4GJJA 2HZGA 1HKMA 3PHAA 5FJPA 5DMLA 3BW4A 2AQOA 1GJPA 1WKEA 4R27A 2QUMA 2O92A 4Z1BA 1XYMA 4GIRA 4YLWA 3L0NA 2PTYA 1S1RA 4M56A 2PGFA 3ITCA 1RVKA 1LZOA 5EBKA 1VR6A