3QKEA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
403
structure length
397
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVAYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Cystal structure of D-mannonate dehydratase from Chromohalobacter salexigens complexed with Mg and D-Gluconate
rcsb
source organism Chromohalobacter salexigens
molecule tags Isomerase
total genus 151
structure length 397
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2011-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3qkeA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3qkeA01
3TTEA 2PU0A 3QKEA 3MSYA 2AKMA 3R11A 2AL2A 3R10A 1P43A 3MQTA 1EC8A 3KUMA 3UJEA 4J3ZA 3ZVHB 2PP3A 2CHRA 3VFCA 4DYEA 3FXGA 2PS2A 2PTYA 1MUCA 2P88A 3RO6A 4E4UA 2OZ8A 3GY1A 2XH2A 1TKKA 3N4EA 1FHUA 2PP1A 3FCPA 2OX4A 3I6EA 4H83A 2DW6A 3VC5A 3THUA 3DG3A 2PCEA 1SJAA 3OP2A 4GGHA 2AL2B 1TE6A 2QDDA 1WUFA 3GO2A 3SN4A 2OLAA 3QPEA 1KCZA 3SSZA 3S5SA 2ZADA 4KPLA 2OZTA 3PK7A 2HXTA 2QJMA 1SJBA 2OG9A 3ES7A 4K1WA 3SBFA 2PGWA 1MDRA 3H70A 3HPFA 4HN8A 3RCYA 3TWBA 3RGTA 3PFRA 2POZA 4G7FA 3ZLGA 1FHVA 4JN8A 4GYPC 3P3BA 4ROPA 1F9CA 1MNSA 3IJLA 3NXLA 3R0KA 1NELA 1PDYA 1R6WA 3K1GA 3N6JA 4GISA 2O56A 2PTZA 3TJIA 3OZMA 4GYPA 3D47A 4GMEA 4F4RA 3N4FA 2PGEA 3MWCA 1W6TA 3TCSA 3PWGA 2HXUA 4HNCA 4A6GA 1RVKA 5FJPA 3JW7A 2OPJA 4IZGA 3T8QA 3NO1A 1OEPA 3DERA 2PPGA 1R0MA 3OPSA 1P48A 1L8PA 2P8BA 4HYRA 3BSMA 1JPDX 4IL2A 4YWSA 1JPMA 5BOFA 3PWIA 1SJDA 3S47A 4DX3A 3ENLA 2PU1A 2OVLA 1MRAA 3P0WA 4M6UA 1MDLA 3CK5A 2PTXA 3QTPA 2OO6A 4Z1YA 4DWDA 3TQPA 2OQYA 2GSHA 4JN7A 5ENLA 3UCDA 4MGGA 3R1ZA 4DHGA 5FJOA 3T9PA 4E6MA 3CAWA 1SJCA 2P3ZA 2RDXA 3I6TA 3VCNA 3MKCA 3EKGA 2GDQA 1EC7A 3STPA 3EEZA 3RRAA 3UGVA 2P0IA 2GL5A 3UJRA 1KKOA 3NZGA 3FYYA 3SN1A 4A3RA 3OZYA 4HPNA 1ECQA 1YEYA 4A35A 4MMWA 3BJSA 3MZNA 3DG6A 5FJRA 3MUCA 6ENLA 2OZ3A 3JVAA 4H2HA 4IP4A 4KT2A 2GGEA 2AKZA 1PDZA 4HCDA 3CYJA 1ONEA 1XS2A 3IK4A 4H1ZA 4E8GA 2QDEA 4ZCWA 1IYXA 3VA8A 2QJJA 4GGBA 4H19A 3TJ4A 4HNLA 5J04A 1KKRA 1DTNA 2AL1A 1KD0A 3GC2A 3VCCA 3CXOA 4MKSA 2I5QA 3TWAA 3DDMA 3DESA 4E5TA 2GGGA 1WUEA 1XPYA 4E4FA 1ELSA 4IT1A 1JDFA 3QN3A 2HZGA 2PODA 1BKHA 2PMQA 1EBGA 4HCHA 1EBHA 3U9IA 2XSXA 2PP0A 3JZUA 2OFJA 2PSNA 4EWJA 3Q45A 2XGZA 2QVHA 4M0XA 2MNRA 3IJIA 3RITA 1JCTA 4FI4A 4KEMA 3Q4DA 2GGIA 4GIRA 4HCLA 3I4KA 3V3WA 2QJNA 3RR1A 3UJSA 4Z17A 3T4WA 2DW7A 2OQHA 4ZA0A 2PA6A 1NU5A 3H8AA 5BOEA 3DG7A 5EU9A 3SQSA 3SN0A 1BQGA 3UJ2A 2XH4A 3N6HA 2PTWA 3TOYA 2GGHA 4G8TA 2ONEA 4ENLA 3V5CA 3VC6A 3OTRA 3MY9A 3T6CA 2P8CA 4DN1A 3DIPA 3ZVIA 3H7VA 3DFHA 2FYMA 4X2PA 1TZZA 3NFUA 3UJFA 2XH0A 3QLDA 5IDZA 4IL0A 5FJUA 3UCCA 3OW1A 3FV9A 3FJ4A 2OKTA 4IP5A 3TW9A 1E9IA 3U4FA 3SJNA 3DGBA 3P93A 4K2SA 3IJQA 3V5FA 3DEQA 2QGYA 2XH7A 3R0UA 4IHCA 4GFIA 3UXKA 3UXLA 3ES8A 3ZLFA 3BOXA 3ZVHA 3DFYA 4FP1A 7ENLA 2NQLA 2ZC8A 5FJTA 4JHMA 3D46A 3R25A 3VDGA 3GD6A 4J1OA 4KWSA 3ZLHA 3CB3A 3CT2A 1EC9A 4DXKA 3V4BA 3H12A 2QQ6A 2MUCA 4K8GA 2GGJA 3FVDA 2FKPA 2HNEA 3B97A
chains in the Genus database with same CATH superfamily
4PUEA 3CHCA 1LWHA 1ZTVA 2GOUA 1MI3A 4UUIA 4U2YA 5C9RA 5HMEA 1VFMA 3VD7A 2X8GA 2CBJA 1YXDA 1M1BA 4OOUA 2DT0A 2DIKA 4IH3A 2VEFA 4OKDA 2F2HA 3A9BA 2HE8A 2VTFA 1BWLA 3DH7A 4INFA 4QQ3A 4DAIA 3RU6A 2V63A 2W27A 1H51A 2QUUA 4S39A 1JZ4A 1F3EA 1YYAA 1VJIA 2GQ8A 2FGZA 4JYDA 4CGTA 4QP0A 4IM4A 3KL0A 4NEVA 1Q6OA 4DJDA 4RW5A 3L12A 1O5XA 4H4YA 4YHEA 5A6LA 3KS6A 3WBEA 5AECA 5DLCA 4Z1BA 3OODA 4J2MA 4IP7A 4YCOA 3ZOAA 4AD1A 1L6WA 4B9ZA 1G9HA 4DYKA 4BURA 1ML1A 4XUYA 1A5CA 3NS1B 2OZTA 3NDYA 4ALDA 3RLVA 2TYSA 4UQCA 3QH2A 3SUSA 4AWUA 4PUWA 1VS1A 2A3LA 4GVGA 2RABA 4YHGA 1FFRA 3NZQA 4APNA 4GNVA 4HOXA 2WM1A 1AH4A 1KFJA 3UCQA 4N2YA 5KITA 2GQWA 3RGTA 4HZ6A 1DEDA 1AQMA 2DP3A 1KRAC 4PTMA 1F9CA 1EX5A 4HTBA 3G22A 1PDYA 3SDOA 2CHOA 4DBDA 3B0YA 3QOMA 3KP1A 4NHVA 2BLEA 5I06A 5DMNA 4P7OA 1XRTA 3U48A 4EP8C 4H9TA 2G5WA 1W6TA 3BICA 3NQAA 3AHZA 1E9ZB 3PBWA 4F40A 3LXAA 2BZNA 3MCNA 1P48A 1Q4NX 4RPPA 3UETA 1Z3NA 2BXYA 4HK7A 1IR2A 3PG6A 1R87A 5FAJA 3EA2A 2CBVA 3OB8A 1ZY9A 3KBVA 4FHAA 2OMAA 1QOPA 1GVFA 4PR4A 1LF1A 1GRBA 3HV8A 1OCQA 1EJVC 3GRTA 1LCOA 3R8RA 3WQWA 1JPMA 2Z28A 3ITLA 3KL3A 1WDSA 1E15A 4TV6A 3VIFA 3ZT5A 5DRCA 1QVBA 1FH8A 1KFKA 3PUOA 3QM3A 3T40A 1KXVA 2BVYA 2OOGA 2XIIA 3PAOA 5T9CE 4D6CA 3L23A 4H8NA 4UBPC 4XKYA 2HV5A 8RUCA 5C55A 4M29A 3LI1A 4Q33A 4V15A 1W1PA 3SI9A 3TX9A 4CD6A 2DT1A 5ENLA 4ONVA 2Z0IA 3LLDA 1EOKA 4FLSA 5ECUA 1EJXC 4ZOEA 3KL5A 3F2CA 4CQDA 4BK9A 2JF7A 2RDXA 1I4NA 4CUCA 3M5VA 7ODCA 2DSZA 3THDA 2GL5A 2W9MA 1B9ZA 4MY8A 3BURA 3NQ2A 2GQ9A 3L5AA 3T09A 1T6MA 3GYCA 1FUYA 2PTDA 3H4GA 4AAJA 1PTGA 2J7FA 2JIEA 4MDOA 4HOWA 3WD0A 2WCAA 3W71A 4Z1DA 3SCNA 3CHFA 3UA3A 3WH6A 3S1WA 3PZNA 3ZYZA 3DFSA 1IYXA 4QXIA 2F8QA 4B5UA 4DUWA 2CIPA 5KMYA 5LNWA 1US2A 2VR5A 1HVXA 2J77A 1MEHA 5BZAA 3EWXA 1EIBA 5BWAA 1FVPA 2X16A 3H2NA 4MSSA 4R7JA 3B0UX 4H4VA 2ZXDA 4P7LA 2EF9A 1VEMA 4Q4SA 2CNCA 4QE4A 4L4LA 4XAFA 4YYFA 4LS0A 4NKCA 1TX0A 3ANYA 2QJIA 4RR4A 3B8IA 4WUIA 3B0XA 1TJPA 1XH2A 3ARSA 3KOFA 3FA5A 2Z00A 5GRTA 4TO8A 1TYPA 1UQZA 4AZCA 1VBRA 3UQNA 4UFLA 3WJSA 2V3GA 1NWRA 4FLQA 5LGZA 1KGUA 1SFJA 4LC6A 3M0IA 3VYLA 3SSJA 3VIIA 3LN3A 4HCLA 4N4QA 2CLEA 5DX7A 4BI6A 4BI7A 2O0TA 1C91A 2E4TA 3BG5A 2YW4A 4C6OA 3DYMA 1JG9A 2UV8G 3R8HA 5C54A 1CT5A 2G3MA 3FSTA 4A3HA 4LY8A 4MPQA 1WZLA 2KX9A 4H4PA 4ENLA 1XSJA 1JZ2A 1EDTA 4JZ5A 3FX4A 2YXXA 3WNPA 3WDJA 3NZRA 4IPPA 1J6OA 5FMHA 5KETA 2WB5A 3TTYA 4S3FA 4IQEA 1UZDA 4JTEA 4C7FA 2HSAA 3LENA 4AUBA 5FJUA 2XFFA 5FL0A 3NVDA 4KF1A 2ZDSA 5A2AA 2OELA 3IGSA 4CD8A 4OWGA 1UZ1A 4LGXA 1KM2A 4UR8A 1SW7A 3L7RA 4XO6A 4J3XA 1Z69A 3VCRA 4JFUA 4LVBA 1H2IA 3S2CA 3MP3A 4YTUA 3P0XA 3UWVA 4JTFA 3T0AA 1FRBA 3ABOA 5T8GA 1IHIA 1JXJA 3FSUA 4BWLA 1ZX9A 1EC9A 1ZAJA 3OU8A 2PLJA 4QX4A 3T2QA 1GZJA 3MZ2A 4TVDA 4FDCB 2YAUA 4B92A 4AC1X 3GAYA 3P7YA 3BOLA 4W88A 3TZFA 3N15A 4B4HA 1PL9A 1YDOA 4KGLA 2YLAA 5FEPA 4RE3A 1BF2A 5M17A 2W3SA 1PSCA 3Q58A 3AXIA 1UCWA 2ZUSA 4F0RA 3U5YA 4ECLA 3GG0A 3HFTA 4PRRA 1WB0A 2I14A 3TNBA 1TPUA 4KCWA 1BVWA 1ODZA 3VD4A 4JTCA 3GU1A 4W7VA 1FH9A 2I56A 3NGJA 4YYCA 2Y5JA 5BU9A 4DWSB 3MUAA 4HNOA 1UR3M 2FFIA 1Q5MA 3UVAA 5D8WA 2YVFA 3LPFA 3UVIA 3C3NA 3CO8A 4TVWA 1UUOA 3M0KA 3S6OA 1H7WA 3VOCA 2HCVA 1U5VA 4C6KA 3CL8A 4K38A 4O16A 2DJXA 5D2TA 3U2OA 2WOIA 4XIMA 3W1PA 1ZBWA 4MFDA 1SJAA 1Y5VA 2BG5A 2FLIA 3LYEA 3DGRA 5A95A 3CNYA 3BV7A 4NI8A 4TX8A 2FPVA 1WZKA 5LZLA 5JCKA 3LV6A 3DK8A 3CXBA 5BRQA 4K1WA 3AIRA 1ZB5A 2OYLA 1WBHA 3W7IA 2X8CA 1ZBVA 1J0ZA 2GUUA 2QF8A 2IPWA 1QI3A 1QTWA 4GVHA 2ESCA 4XUGA 3THAA 5A2CA 4KIEA 3QR0A 1WP6A 4J27A 2VR4A 3VKCA 1IF2A 2VEKA 3PY2A 3EB4A 2JK2A 1VGAA 3B8WA 2QCEA 1K8ZA 2CLPA 1GVIA 3Q2DA 3CHDA 3C2YA 4Q4KA 1F05A 3O15A 1ZGDA 2OSWA 1NDWA 1DJWA 1OFAA 3H6OA 3NWRA 3LSBA 4MB3A 2RUSA 4JYEA 1GZGA 2WPFA 2WMIA 1UASA 4XAPA 1C8QA 3LRKA 2ZE0A 1PPIA 3QFAA 1W5OA 4HNCA 3FW6A 2DZSA 4L80A 2ZZ2A 2EPHA 2F6UA 3OQEA 1QU4A 3TYAA 4FEZA 3QXBA 2WVTA 1XH0A 3Q67A 4PB5A 1RJPA 4L9XA 4NRSA 2CKRA 2YCJA 3PPFA 5BOFA 2BFGA 1K7EA 1J5SA 3FKRA 1L2QA 4OTKA 2W4XA 4Q8VA 1NFBA 2A7NA 1JRPA 2J25A 3E0IA 1XBXA 4FAMA 2NXIA 3LCXA 4GZIA 3TN3A 3TVAA 4X60A 2WC3A 3B8VA 2QDGA 4B5TA 2PTXA 1SZNA 1XIDA 4Y7EA 3FGCA 1E9YB 4HPGA 3NURA 1GVOA 2QUTA 1UUQA 3W6LA 3VIOA 2YJQA 4LV4A 2BCPA 5G1TA 1NFPA 3VNIA 3E6EA 3MMUA 3CAWA 2V67A 3DFNA 3H22A 1NARA 4GYKA 2A3AA 3MKCA 4WY0B 5M2FX 3STPA 3VNLA 1YBQB 2RFGA 4IISA 5CG7A 1PVNA 3OZYA 3GVVA 1FIQB 2RJGA 3DFPA 3EMCA 3MUCA 4U5KA 5DF0A 2YA1A 2IKGA 4HCDA 3WF3A 2YX0A 1O5QA 5JBEA 1YPFA 1PHQA 1TV2A 5ABFB 1WA3A 2VGFA 5JQ9A 3LS9A 3D3FA 2G41A 3TJ4A 4GIYA 1W37A 1LBFA 3MYOA 4OE7A 4N9CA 1K9DA 4IXHA 2B4GA 4KWWA 2ZC1A 1IWBA 1W3JA 1IQ8A 2DUZA 3OHIA 4WDWA 3WCZA 1BVZA 3W28A 1D7YA 1EDGA 2QT3A 4BJHA 3U2EA 2VX6A 1EBGA 4CU8A 2WZTA 1CGTA 2INEA 4QTGA 4ZENA 4CCCA 2ZDRA 3V36A 4FF7A 2OEJA 1BXBA 2AQWA 3MVTA 2NW0A 1PKNA 1RM6B 4A3YA 3DENA 2EJ1A 1XSIA 3CQJA 2EQDA 3QY7A 4OVXA 1B57A 2IXVA 3ZR4A 4A8IA 2QJNA 3BLEA 2XUCA 2FZNA 3W1QA 3WUBA 3H7UA 3UFYA 2BY1A 1N63C 4FXSA 2GPTA 2PA6A 3ZJ7A 4QJ4B 3VMNA 1RBOB 4AF0B 1Q7ZA 1YXCA 2G3JA 3FFSA 2Y8VA 4BQ3A 5FF2A 3LA4A 3CU2A 4AMCA 1C90A 1KM4A 4RZ5A 5HR6A 3TXVA 3OZPA 3MY9A 3QGVA 2WOWA 3KLJA 2Z26A 3W76A 1RAKA 2ISSA 3I3EA 4XKMA 5C71A 3P61A 2FYMA 4RDWA 1SYTA 2XH0A 4WOZA 5DCBA 3V0SA 3W7OA 3AHVA 3BW2A 3I10A 4GG9A 1YDYA 2VX4A 3AICA 1RSCA 1H7NA 3VZYA 1OFEA 2G3IA 8A3HA 1E9IA 1QHZA 3U4FA 3OGRA 4EQWA 3KBSA 4CU7A 4RNFA 3CEUA 3OYZA 1FWAC 3TC3A 3LLFA 2QGYA 2EG8A 4H8UA 4O1EA 2VVSA 4MB5A 3FHAA 3LGDA 3N9KA 1F4HA 5CZSA 4XZHA 5D2YA 1RK5A 2O7QA 2NUWA 3NVYB 1JDDA 3W7MA 4CNSA 3TYUA 5AY7A 3G5EA 3WLKX 1NF0A 2E8ZA 4TUFA 1MO9A 4OV4A 3SGUA 1DWIM 2FZ9A 4JQ2A 2QVNA 4XSLA 4LUSB 1XRVA 2WQDA 3N3TA 1J18A 4AZ5A 4ZQRA 3GXFA 1EJSC 2VENA 3EA3A 2W62A 2PU0A 2YDSA 1XIHA 1V59A 2GVYA 5XIAA 2XDFA 4M8UA 3S8HA 4MLJA 1FKXA 3MJMA 3QGKC 2D0GA 2ON3A 3S2NA 2B81A 1UD5A 3SFWA 2I17A 5KZDA 4EQRA 4Y9MA 4O1CA 5BXRA 3LRLA 4A3QA 2PTYA 2XVLA 3IUIA 3LQGA 1VYSX 3ICJA 1U5HA 5D2WA 3GY1A 4LBUA 1HKVA 3FAXA 2CLHA 2QCNA 1MFUA 2WCGA 1B90A 4Q7IA 3L4TA 3AALA 3IJ8A 3QJAA 2WQPA 1CNVA 4NJHA 3WH5A 4PUNA 5G4WA 3B9EA 2W79A 1TX2A 3H23A 1KB3A 2Y88A 1JOAA 1H60A 3G6MA 3R7MA 4JHOA 3OP2A 4JYFA 1QOXA 4FS9A 3CLWA 3I3BA 2YGYA 3AM9A 5G5HB 4Q4MA 4UB9A 4QFUA 4B3KA 1JXKA 4XZIA 1CBGA 2TAAA 1GNXA 3W7NA 2GH5A 2HXTA 3CV1A 3GW0A 3V0TA 4O57A 3PZMA 3K4AA 5BW6A 1ZJHA 4WSJA 4GH3A 1K9FA 1QPKA 3WDQA 1LL4A 4K39A 1VLWA 1CCWB 5M03A 5HNRA 4DNAA 5M3WA 1W9UA 3TWBA 3MI3A 2WHJA 3W25A 1PO9A 1FHVA 1TVLA 4GYPC 3CUZA 1B0IA 4MM1A 4WVXA 2NWSA 4TOQA 4Q7BA 3RO8A 2RKXA 4AY7A 3G1FA 1AJ0A 3E2RA 4EK7A 1Q6DA 3ZT6A 1YLVA 2I16A 3K4DA 3MHUA 4QG6A 3QC0A 3ZR5A 3PWGA 4GUIA 1DJIA 2ODOA 5J5RA 1OD8A 2NQZA 4S2CA 3AXXA 5LSMA 3CT7A 2DZTA 1BF6A 4JNYA 3VMOA 2EQ6A 4S3KA 2PDJA 4FNQA 1HJQA 1DORA 1ALDA 1AUSL 3WDRA 3O63A 3A23A 3MHFA 2E25A 1WO2A 3BXWA 1X39A 5D37A 2IUZA 1YPXA 3I68A 1E1FA 6REQB 3CTLA 5CXPA 1I2PA 2A4AA 5LXXA 2DEPA 1ITQA 3TYDA 2E3ZA 5I78A 1CZ1A 3STCA 4RE2A 2P3EA 2PZ0A 3P0WA 4AISA 1J0YA 2WMFA 2J8GA 3QV7A 2GQ3A 5CGQA 1OT1A 2FZ8A 4NRRA 4M7SA 1L8NA 1UZ4A 4JN7A 2PDCA 3SIMA 2V82A 2WP6A 3QY8A 4TU1A 3EPNA 4KW2A 3BAJA 4KEUA 4RCXA 1TREA 4KWVA 1D3CA 4C91A 2QJHA 4IUOA 1VFSA 4TTUA 4AVOA 2RDWA 2ISWA 4AX6A 1CXEA 1OM0A 3GBDA 3WH9A 7CGTA 5I24A 4BI5A 2Z1WA 1UWSA 2RGLA 3EMZA 4PMXA 3MZNA 3VKJA 5C9UA 2HK1A 4B5VA 3AIBA 4H2HA 3EOOA 1OK4A 2AKZA 5JRBA 3IUDA 1SZGA 2GJPA 1JQXA 1X96A 1XS2A 1U33A 1DIEA 3H2AA 4H1ZA 3BH4A 3W2UA 1UR0A 2B7OA 4REQB 4BWLC 2XGIA 1UROA 5D02A 4RDVA 3VCCA 3GC2A 4A22A 1W3KA 1KM1A 2ZQ0A 3MUXA 3W27A 3S42A 1A49A 1M53A 1ME8A 1BYCA 5C5YA 3PZVA 1XPYA 3NG3A 4E4FA 4WGXA 3GB6A 4TIMA 3C2EA 1A80A 5D2VA 1HNYA 4H4UA 3ARZA 2P5NA 3G1DA 1TZ9A 3RHGA 1NOFA 3EANA 3T08A 4AHPA 1FP8A 2G4FA 4TTGA 3Q45A 3K8KA 4LUYA 1F3PA 1BXCA 4MYXA 1J01A 5G5GB 4HD5A 4Q22A 2YDQA 4C6FA 4W8LA 3VUPA 3C8FA 1KO0A 4WXZA 3VGFA 1JRCA 8TIMA 2GGIA 4IPNB 1KM6A 4GIRA 1NP2A 5AHMA 3VABA 1J6PA 3R6IA 1PJ9A 2V5LA 1VBJA 1C9WA 4PUKA 2O55A 5EMYA 3NQMA 1XIIA 4NX0A 2BC1A 2WZEA 1B31A 2WVVA 3TOYA 3UBPC 4Q4PA 3NL6A 3W4RA 6PTDA 3B9NA 3RG6A 3LNPA 1DNCA 1PB0A 3ZVIA 3W26A 4GO8A 1YNPA 3TN6A 4EE9A 2Y62A 4RNIA 4AWEA 1P0BA 5G2WA 2DZAA 2PWFA 4FXFA 1ICPA 1KA9F 2HROA 3RR4A 2O7SA 3P60A 2CERA 1XI3A 2ADAA 1UOKA 5BXSA 1XDJA 2ZZ0A 4UOJA 1J0JA 3WEOA 5TNVA 1FWTA 4JGDA 1KXTA 4LU0A 1XGDA 1YMYA 1PCWA 1Z41A 4ZZ9A 3GXIA 1FWGC 2A1YA 1PZ1A 1KGXA 3ZLFA 4D1IA 2VP8A 4AU0A 2Z27A 3EMQA 3CQKA 4XVEA 5A8OA 2GK1A 1W8GA 4JHMA 2WLYA 2E67A 1LQAA 1W3HA 2WPCA 3LXDA 3A4WA 4DXKA 1F61A 3RDKA 2QMJA 4X0VA 3H12A 3B4YA 4UR7A 5I77A 3ABSA 2MUCA 1VYPX 3HG4A 3KOXA 2X1IA 3LBCA 3SCVA 3TC6A 1HKIA 4O0KA 4DF2A 4YTQA 3IV3A 3QKEA 2VEMA 3SIZA 1GW9A 4LF2A 1ZJAA 3PTDA 3T7VA 1HL9A 2PRMA 3HTWA 4U2ZA 1ZFJA 3VAVA 4X2RA 4P61A 2WSKA 5IFPA 3HG2A 2GWGA 2ACUA 4OBSA 1F74A 2A8XA 4MVAA 4H9MA 1E3ZA 1H7RA 5U1OA 1B3OA 4E4UA 3E0LA 3ARTA 5HOSA 4QQUA 2WKGA 4O17A 4DQWA 1AL7A 4PEKA 2CESA 4GZEA 2TPSA 3N4EA 1YXYA 1XD1A 1GJPA 4L6HA 3QW4B 5KZEA 2YZRA 3UWEA 3W1LA 5JUVA 4E38A 4DM1A 2WWDA 3WBAA 2IKIA 2FTPA 1M7XA 4UFMA 3OGSA 1AMYA 1OQFA 3GNRA 3M9YA 1GOOA 3Q37A 3FG2P 3APGA 3NPXA 5KINA 3KVLA 1GESA 4PTDA 3QPEA 2BHYA 3DHUA 1MOKA 1JAKA 4LUTB 5CPNA 3WLMA 3T05A 1SJBA 1DWGM 3LB0A 1VFTA 1IEWA 5L9FA 3PZOA 4HN8A 1OFQA 3PG9A 3WUFA 1GQIA 1F07A 1GREA 1AQFA 4G7FA 4JTHA 9XIMA 4KFPA 3F5JA 3I3DA 1AW5A 1YX1A 4L61A 1M68A 4QE5A 2PI6A 2XWDA 3P62A 1QNQA 1IIGA 2FJKA 1BXNA 4R9OA 3TJIA 2VFFA 3IJ6A 4H3DA 3VOFA 1LLOA 3RPTA 4EMWA 3QTGA 4KKXA 3RJYA 2A2IA 1C8VA 2PGEA 2FHFA 3QQ1A 3TDFA 2GZXA 1ZJIA 4D6GA 3I7QA 3V18A 4OZOA 1GTEA 1QW9A 5CPSA 3K30A 2UY3A 2CXGA 4PTVA 4K7YA 2YW3A 5D4YA 2NVAA 3H2FA 1V6TA 3AS0A 4YWSA 1P5BA 1JZ3A 5FD0A 1HVQA 3U4AA 5HNUA 3RCMA 3S47A 4WXYA 1XHCA 2NPXA 3G3MA 1LM1A 3QFWA 2PU1A 4IMFA 4L9YA 1UH3A 1DXFA 4PA8A 1E6ZA 3CK5A 3E0FA 1FWSA 4HYVA 4Z2KA 1DPMA 2E09A 4OHQA 3TMQA 1UPPA 3WD2A 1ISYA 2Y7GA 3TAKA 2R9ZA 3NJ3A 4FIQA 4FOKA 3ZFHA 3RJXA 4C6NA 1KM3A 1E55A 1A47A 3AZTA 3URAA 4HA3A 1PE1A 2E0PA 1V7YA 1RA0A 5DY2A 5LKYA 3QVQA 4EVZA 5U25A 3BL3A 3TFCA 1C92A 1VFLA 3SZ8A 3WBYA 3EBVA 4F9DA 2GGEA 4M5PA 4LXFA 5I00A 5AOUA 3GZ3A 2QDEA 4ZCWA 1SFSA 1E0UA 1V0MA 4NNAA 5K4ZA 1Z7AA 3NQFA 4LNCA 1JCJA 1XL9A 3Q94A 2O9OA 1JEHA 1XIEA 1HJVA 4HMNA 4RZ4A 2ACRA 1ZP4A 3U7VA 1B30A 1P7TA 1WUEA 3GFYA 1OG0A 1O7AA 4L65A 4JIEA 1GKRA 3LHTA 2ZA2A 2GVLA 2PDQA 4HK6A 2GYIA 2OWXA 2GLKA 4CVUA 1KFCA 2QV4A 1JCXA 1JF5A 5LGXA 3WJXA 3IWPA 4PCNA 5IFTA 2PSNA 7XIMA 2C19A 4E2BA 4Q3MA 4NIRA 4PMVA 1EB3A 1NJJA 4HNUA 1XLGA 3SGGA 4IPJA 1ZUAX 2EBNA 5JH2A 4I6VA 3CV2A 4AHOA 1R9YA 1LOQA 4GIAA 2QAEA 3TKFA 2BASA 1V6VA 2YA2A 3B8TA 5C2GA 3R12A 4JAWA 3SQPA 4O28A 4XD4A 2REQB 3OLEA 5C8BB 2DPEA 1EH9A 2OQHA 2PWGA 3LCWA 4I5UA 2VCCA 3UY7A 5AYIA 5F2MA 4J35A 1TMLA 1V3HA 3SRFA 2FFCA 1H1NA 2NZLA 2PTWA 2VUNA 3WJWA 1OFPA 1XICA 3W2MA 2WV8A 3W1NA 1J12A 2WC4A 4H6EA 1P0EA 1SMAA 3VC6A 3T81A 1N61C 1BKSA 2PDNA 3HGRA 2GFTA 1JYWA 1DQUA 4R7WA 4Y8EA 2F2KA 3L4XA 4QDMA 1CB7B 1I2RA 1MQRA 3K1DA 1RQBA 5JIPA 3FV9A 4H8VA 1SFLA 3CYVA 5A8PA 2DSKA 1LJYA 3HPXA 1KQYA 4AZBA 1UD2A 2ZTKA 4C1LA 1FY6A 2Y5SA 3DXIA 3E1F1 1EHAA 1POKA 5I23A 3NZPA 1EJWC 3UY8A 4QJ1A 4GWEA 3PPHA 1DWAM 4EOUA 2ZRZA 3GFZA 3L9CA 3W6MA 5GNYA 4DI8A 1XLFA 2NQJA 3L8KA 3GG7A 1R3WA 1BYDA 2PLMA 1E71M 4ZOCA 1FXQA 3RX3A 5IBXA 4IIDA 2OCZA 3RPDA 5D9NA 3M0MA 1TMHA 3HURA 1XFCA 3MP5A 3RIKA 2X1SA 2PC4A 2CW6A 2CEQA 1J9YA 1K1DA 3BLOA 5I3FA 1X1ZA 1PX4A 4LAOA 4RDZA 3VKAA 1L6SA 2FKPA 2WVSA 2ZXBA 5EMJA 1KGWA 2IPJA 1UR9A 3P80A 1OJTA 2ZE3A 3WBXA 1H6VA 4JCMA 4RV3A 5AYZA 3FA4A 3VNYA 1JCMP 1GQLA 2YA0A 3R8GA 1PX8A 4V27A 5CAKA 4LF1A 5CEWA 4DBSA 3T8LA 3TSDA 3YPIA 4CD5A 2XJ7A 4BQ2A 4WY0A 3LGEA 3QLLA 5C7VA 1VHCA 3REQB 1YBQA 5LNRA 4ZO8A 3RO6A 1SZFA 3BWWA 3DECA 3SECA 2OZ8A 4Q8WA 3MW7A 4X9SA 1FCQA 4CD4A 2BP1A 1THFD 2C14A 3EWYA 5DFAA 5LA0A 1WCGA 4IOTA 4ZSTA 5JMUA 1B4KA 3HG5A 5FEZA 1G0CA 3ONBA 4GBUA 8XIAA 3XIMA 4FLRA 2ZZ1A 4B5XA 1WUFA 4D72A 4I5RA 2VYOA 4CLMA 1DXLA 1ZBCA 4AY1A 1K4QA 2W54A 1ZLPA 1E4MM 5FA5A 1X7IA 4ZOBA 2XFRA 2X41A 4DO4A 1Q66A 1UR8A 3UG4A 3AROA 3HMJG 3QV6A 4K36A 2W92A 1IXPA 4PB3A 4JIQA 1XC4A 3VNDA 3P3BA 2XINA 3H26A 2WZIA 4KWUA 2PDKA 3PB0A 3ABXA 2Y8UA 4HJFA 1HKJA 1WV2A 2OXNA 2VZOA 2VEGA 3KBWA 1PWMA 1TPC1 4B2DA 3R13A 6CGTA 1EOMA 3MWCA 1GWJA 3VI2A 1ISXA 5H8PA 4RKAA 1WKYA 2Y24A 3RXZA 1SSDA 5PTDA 2R9RA 2OPJA 2YDRA 2RDTA 5HUOA 4IXXA 3EPOA 3EDKA 5I3JA 1TWSA 3LHUA 5C2XA 2VRJA 1DQWA 5FSEC 2ZYFA 1R86A 3M16A 2FDSA 4IX2A 2XYLA 4Q32A 1J0HA 2OODA 2VGBA 2BOEX 1N2VA 1W17A 3GTFA 4NZ4A 2W5FA 1EF3A 4LUIA 3EOUA 1MW1A 2JEQA 4G1NA 4EMJA 2WSRA 6TAAA 5ABGA 2VWTA 2YIHA 2JKPA 5BRPA 1YRRA 3D3AA 1HO4A 1Z9AA 3GHUA 2NSOA 5REQA 1XIGA 2P76A 5JBDA 2BY3A 3MKKA 2E9BA 5K9CA 3FIGA 5HATA 2VD9A 2ABBA 2AOSA 1PIIA 3ZZ1A 1NDZA 2BNJA 1CGUA 3OA3A 2LLEA 1M5WA 1SJCA 1GYMA 1DOSA 3XINA 3D9XA 1XPGA 2GDQA 1NM9A 2HTMA 3EEZA 4AVFA 1P0DA 2HPMA 3BCDA 5EMLA 4GQRA 4A3RA 5AHNA 3GLCA 2FTWA 4FNRA 4JTAA 2J66A 3FOKA 1YEYA 1F6YA 1GXFA 2TSYA 3G77A 4H6KA 6ENLA 2G50A 1XG4A 3BMVA 1PDZA 3CC1A 1LPFA 1Q85A 2ZZ4A 4HA0A 1ONEA 1ONWA 4XKYB 5RUBA 1QJWA 3THQA 3NL5A 2IW0A 1H63A 3WK3A 3NL3A 5DMLA 2QJJA 2HISA 3GVWA 5T91A 4HNLA 5K7JA 1KKRA 1AQ0A 5CPOA 1BZLA 1PBGA 1K7XA 3P5YA 4KFNA 3RM9A 1MSSA 4QCFA 1OG6A 4AFYA 1EQCA 3TR9A 1NVMA 2VI0A 4R9XA 2V3FA 4IT1A 1QDSA 5ABEA 1H0IA 3UR7A 2DZUA 2PZNA 3CHEA 4AYSA 3RM4A 4QM1A 3A13A 3B9OA 4WKAA 1G67A 3KVKA 3C56A 1Q6GA 4WDTA 1H61A 3U8GA 3NOYA 1H7XA 2FIQA 3B9DA 1JDEA 1TPEA 4M0XA 3GHRA 1JF6A 1RJRA 4QR6A 2EAWA 3DI0A 1JCTA 1JQVA 4NSBA 3QKZA 1QW8A 1EGVA 4L5ZA 3L4UA 1AQHA 3LCLA 3A9IA 2XVPA 3I4KA 4WJ8A 2DFAA 3V3WA 2WK2A 5FS7A 1UP2A 3EX3A 5IDIA 5IM51 3SJ3A 1QATA 4LAZA 4I3GA 4O1BA 2IKJA 3GDMA 3W1UA 3B05A 5LHFA 3L67A 3M7WA 1PXGA 3EKZA 2BOGX 3UJ2A 3GW3A 1I9CB 2CXEA 5M1TA 4LBRA 1HFBA 4ZVJA 3MDUA 2NUXA 5AHFA 1WAUA 1CXIA 1OINA 3WF0A 4ZXOA 2DDXA 2YDAA 3EWBX 3FN9A 3L4VA 3VGBA 4CN4A 1TPVA 1L0PA 1OVDA 4B3ZA 7TIMA 2B7PA 1DTUA 4AZCB 3GYEA 1C3FA 3HPSA 3NPUA 1QXLA 4ML4A 4DJEA 2VC9A 1Y8BA 4TV5A 5K9XA 3M0LA 1M7OA 3WLQA 3S6TA 2ABAA 1G69A 3GD3A 1LRNA 4W8AA 3JU2A 1K70A 4O1AA 2ZZ7A 3DEQA 4G56A 4H4RA 2HS6A 4JX6A 4JHZA 3RLGA 3O3RA 1P1XA 3BOXA 3DFYA 6REQA 3F5KA 4HA4A 3W81A 2FHBA 5EFFA 3C86A 2O4QA 4O8RA 1K6AA 4O0ZA 4UTIA 4URIA 2EQ9A 4K7ZA 4U28A 3N13A 4KRTA 3S1VA 5A6AA 1PV8A 1K02A 1Q8JA 5F1UA 1Z48A 3FLUA 1E73M 1Q6FA 3EB2A 4DELA 3TTEA 3ABQA 3TSMA 1Q4WA 1SW0A 4KEZA 1J0IA 3AZSA 3P74A 4AIUA 4IFRA 4J3WA 4F0MA 3RLUA 4ZQCA 3R11A 4KMQA 1X8CA 2D24A 1Z6KA 3AS3A 4LWWA 3TYEA 1NHPA 1EC8A 3WX7A 5C0QA 3BTNA 3EDFA 2VOTA 1TB3A 1JCNA 4J3ZA 1ZENA 4R88A 4GJJA 4DYEA 3ZQ9A 2P88A 1E6RA 1Y5WA 2IPGA 3IIXA 3CIVA 4J9JA 5F2LA 4ZQMA 5HK4A 1EYEA 1XYCA 1DJZA 2WO5A 2GWNA 3CZLA 4MYAA 3P84A 4S3DA 4HJWA 4J3SA 1V3KA 3C0SA 3GVGA 1OY0A 3WELA 3S4TA 1PS9A 1A5OC 3K13A 3AYRA 4JOMA 1WDQA 1RCQA 4ZFMA 4GGHA 4WJEA 1A0CA 2DIEA 4ATDA 2V9DA 4D8AA 3RMEA 2BWGA 4GQBA 2QS8A 3ZSTA 1XLJA 1NDAA 3L68A 5LIWX 3N17A 1DJQA 3SSZA 1GEHA 1M04A 4D1JA 4N9BA 3TE9A 2EJAA 3P6LA 5A8NA 1NFGA 4BFAA 1R3QA 1V0LA 2PGWA 3E0VA 3POCA 1RR2A 2ZUWA 3OG2A 4NAEB 2GJLA 4JY8A 1WQ5A 2BY0A 1VQZA 1H5VA 4JX4A 4R85A 3E02A 5CZJA 1DBTA 4JN8A 3BARA 1DQXA 1B2YA 4JFTA 4B9YA 1QCWA 3ANUA 1KFEA 1VQTA 2OTDA 3CIXA 1V97A 1YDVA 2PGFA 3G1YA 1W2VA 2QAPA 4JTIA 3G1AA 2BHUA 2FTYA 1V02E 1O6IA 3O6YX 3WK1A 2XIBA 3N4FA 4OQVA 2WVUA 1CB2A 3UZYA 4V28A 4A6GA 3BQ6A 3SUWA 1LORA 3WDPP 1JPHA 2PBGA 4OUEA 1L8PA 2ZKMX 3EWWA 4FSAA 3MV11 1A0DA 3FEQA 4ZXLA 3G1SA 4J2PA 4QDWA 1XSKA 4AD5A 3M5XA 5GPRA 4IL2A 1US3A 5EFDA 1ZJBA 2QUNA 8CGTA 4KERA 1PWLA 2YCLA 3DH9A 4UCFA 3GM8A 3RLHA 3AUOA 2FZDA 2OVLA 4PYSA 2EPLX 4AZHA 4KRZA 4AIOA 2PCQA 2WMIB 1U2YA 3GTHA 1UWAA 4Z1YA 3QRHA 4K37A 5A5WA 5LA2A 3TQPA 3SRKA 3VO0A 2W61A 1J2WA 1WBJA 1EXBA 4Z0JA 2P53A 3FEMA 3GXMA 4GXWA 5FACA 4NZFA 1TFVA 3H4KA 3MS8A 5KZMA 4Q8NA 4ILSA 1QNPA 3RRAA 5BYWA 4CN6A 2CWNA 3UGVA 1XM3A 2I5GA 2GR0A 1HZYA 2A3HA 4NASA 1OSEA 3PB2A 5BMWA 4HPNA 4GC4A 1S5NA 1SPQA 3QC3A 4C1NA 2VD8A 4CN1A 4IUGA 3F2DA 4WQ6A 1Q65A 2XHYA 1OFDA 1EQPA 4DPQA 3UG3A 3NEHA 4CNOA 2PD5A 2PDBA 1NIUA 1VHNA 3CQHA 3ABZA 2ZRXA 1RPKA 2GUYA 1PX3A 5FAGA 3FGCB 3ALGA 2DORA 3AU2A 5G1YA 1KD0A 2OYMA 1TV5A 1ZSXA 3S5YA 3KP0A 3QHOA 3LOTA 1ADOA 3E2SA 2ALRA 2SFPA 1PKLA 2I5IA 5DT5A 3W2JA 2VDIA 4S3CA 4JX5A 3BGGA 1G7VA 3HGSA 3MJYA 1MUMA 4ORMA 3UG5A 1OJXA 3DI1A 1TTJA 1JDFA 3R4IA 3VIPA 3SCPA 2PMQA 2AQVA 3UWQA 3EX2A 3JZUA 5BXPA 1EEXA 5BCAA 2OFJA 4JTJA 3P8JA 5D9OA 3KOYA 4EWJA 3RRXA 4OIFA 3O0HA 4Y9AA 2BB0A 3WQFA 3RYSA 4MNJA 1UD8A 4E0CA 3RITA 4JTTA 3A7UA 4DRSA 4L64A 3W2NA 2JGQA 4A2RA 1XBZA 4HP5A 3RR1A 4M52A 4ZQOA 2ZZCA 3VDCA 1US0A 2TODA 3A7AA 4XZ9A 1M7PA 1BWVA 3W01A 1S5VA 3ZWSA 2BVDA 1HKWA 4AXNA 3LG3A 2BXVA 1QNRA 4Q8MA 4H7CA 5GQBA 3UESA 2ACQA 4MFEA 1LG1A 4NNCA 3MMWA 3WQ6A 5EBUA 2ONEA 2ZRWA 4G9PA 4D6JA 1E1CB 3V5CA 1TO3A 3C2OA 4UC5A 1A0EA 1REQA 2G4JA 1W0MA 3W7QA 1ZAIA 2WAGA 1AD1A 3WEMA 4ZFCA 1LT7A 3S6DA 1V3IA 2POTA 3NFUA 1FWWA 4A29A 2G95A 1GYNA 3QHMA 4QITA 1UZHA 4DJFC 4NVTA 2Z1VA 1VDVA 3GAKA 3VZZA 2Q71A 3T0BA 2D0HA 1BEUA 1GHRA 4KEVA 3AMGA 2V6AA 1V0KA 3A3HA 3TZNA 1OFOA 1QNSA 4QLKA 3MYPA 3WLTA 4NU7A 1G4EA 3PFMA 1G4SA 1LQ0A 4GJ1A 2CLLA 1UB3A 2E5BA 3VDBA 3K8LA 1UP0A 2NQLA 2HRWA 3W70A 2QR6A 2H8ZA 3EWZA 5EPDA 5HQEA 2W55A 1XLLA 1SO4A 1WDPA 2FVLA 3LERA 3WG6A 5C2CA 2WXDM 3KS5A 4YPJA 5F4WA 4JQ1A 3GHSA 1H2JA 4H41A 1FWNA 1E3XA 3RPMA 3AXMA 1UD4A 4GJIA 3SUTA 4DBWA 4O52A 1XP3A 4AEOA 1YQ2A 3CM4A 3PZQA 2NVKX 4CNTA 3QR3A 1C8YA 3QV9A 3GU2A 4R3UA 4H8HA 4L6DA 3MQTA 1TV7A 4S2BA 2V5CA 3JRKA 3L0GA 4PMJA 5C70A 2HVNA 5H6HA 4ZGYA 3M1ZA 4UTMA 1WKEA 1RZMA 1W31A 1N62C 4FR1A 3L5MA 1LUCA 4S23A 4QG8A 4LB4A 1Q13A 2FB3A 2FQIA 4RV8A 3ZJ6A 3KRZA 3GSMA 4I9AA 2YR1A 4HNTA 1OBAA 4PMYA 3CPGA 1LT8A 2GR3A 4EF8A 2V68A 2WPBA 1QMLA 3EAUA 4HSNA 3AOFA 2PUZA 1DP0A 4X3ZA 3NQEA 4GRTA 1QHOA 1TV4A 5HR7A 3BSHA 2E6DA 1RH9A 1TWWA 5CH9A 4FXRA 1NP0A 2QCCA 4ORIA 2Q8XA 4M56A 1EO5A 4KPLA 5TIMA 3MMDA 3WQ4A 2INFA 1T99A 1CX9A 4IGHA 1K3UA 3VE7A 2JKEA 5E6YA 2FGLA 1PEZA 3KM8A 1XLAA 3WLNA 4AMAA 4FNTA 1IEXA 3BK0A 1JUEA 4C6EA 5C9WA 5CZKA 2POZA 3WFZA 3APTA 3ZLGA 3QZEA 5LIUX 4GNKB 2VC7A 1XBYA 3LX9A 3R0KA 1OABA 1P6CA 1XISA 4Z2IA 2ISFA 3QBUA 4GISA 1KRMA 2O56A 1TRDA 3S9YA 3MKVA 3PULA 2XIOA 1M41A 1OIFA 1HP5A 3KOZA 1UR4A 2RH9A 1QPQA 2G0WA 1CI1A 2Z7GA 3TUUA 3WD1A 1BHGA 4CEXC 4JQ9A 5A69A 1M01A 2IQDA 3LGGA 4PMOA 1RVKA 3L2LA 2PDUA 3MBFA 3TQKA 1UH2A 1HXJA 3GDTA 3BLIA 1DE5A 1UJPA 2YBVA 3KE0A 1DIOA 3QSTA 1W5QA 3ANVA 5XIMA 2J24A 3H55A 3O6CA 4AZ7A 4ZR8A 2FZMA 4IWWA 1LOSA 4JTKA 2X1TA 5E0CA 5I7GA 4ICMA 3NSXA 1PHWA 1GEQA 3NEVA 4DF0A 1EA9C 1LOLA 5AHIA 1IT7A 4Q8UA 4FF5A 3VU2A 4HU8A 3FNDA 3PUEA 1IZKA 1V6UA 3XISA 2WYSA 2A5HA 1N8FA 1FECA 1C8XA 4F2UA 3URNA 2V5JA 5JIWA 1FCUA 4NG3A 2OYKA 3VIHA 3B4UA 1EWEA 1AW1A 2OSYA 2V81A 2ATMA 3IIZA 1DJHA 3PZUA 4GKTA 5AYBA 1GQJA 4LX4A 3R43A 4MF4A 2VWSA 5E0KA 3WQDA 1JDCA 3GIPA 3VDHA 1CIUA 3AS2A 3ONCA 2QGHA 1VCVA 3VD3A 4DJEC 4NQ1A 1Q1RA 1WOBA 1XCWA 3RX4A 2NLYA 3S1UA 4QNEA 3NZGA 4ACYA 1X97A 2WSPA 3LHWA 4LY4A 2O92A 1S1RA 4UTKA 2X0HA 4WIWA 3WNKA 3IC9A 1FWJC 4YJ5A 3DG6A 3E2VA 4IP4A 3NXFA 1DXIA 3II1A 1H1YA 3CQIA 4Y90A 1NF7A 2QCMA 4PTWA 1G4TA 3BOFA 2XWEA 3GFXA 3V16A 4DO6A 3MDWA 4AD0A 3KZPA 1KR0A 2D20A 1CXFA 2AL1A 1VB9A 4LOCA 4WLCA 5JCNA 3CZJA 4E3TA 4M19A 4HMCA 4NAFA 1DV7A 1XANA 4EM4A 5CZ0A 1GVEA 2QYGA 4XISA 1ELSA 3ABRA 4DZIA 2HZGA 4MIMA 4OBTA 2PDPA 2PODA 1NOWA 1QT1A 2J6XA 1VBUA 3E2QA 2XSBA 1KTBA 2V30A 3CGTA 4B5WA 1MFVA 1TYTA 5K4XA 4DF1A 3V75A 5K2ZA 1VF8A 4UNIA 3VIJA 1OX4A 4JIIX 4F8XA 1ZP3A 1RA5A 4PC8A 2A3CA 4XD5A 1PCKA 5XINA 2PDMA 1ADSA 3TMLA 3BMXA 3W29A 4GI6A 1MO0A 3Q4DA 1XYBA 4EIVA 4GUHA 3UWZA 4H00A 1P1MA 4YTTA 4EPKA 3ERPA 2YZ5A 3LHYA 2HNHA 1V03A 4DIAA 1AMKA 1MXSA 2VGGA 4N42A 1GQKA 3IVTA 3NRZB 4JTUA 2ACSA 2E8YA 2D3NA 4GVIA 4RNJA 2EEXA 4P7NA 3ETRB 1BGGA 3W7LA 2HEJA 3MI2A 1T7LA 2V5BA 4RJEA 5AHLA 1JIBA 2D0FA 1B3ZA 3H7VA 5HUPA 4EXQA 1KCXA 2WKJA 2OJPA 3M46A 1V6WA 5ABHA 2BDQA 5D8ZA 4GO9A 4R33A 2YL8A 1VJSA 1F7BA 1NTHA 3W7EA 1KN0A 1NHRA 3BG3A 3KTXA 2XN1A 2HE5A 1GETA 1UWQA 3WUGA 1MWOA 3UXIA 3NVTA 1X38A 3Q6JA 3FKKA 3PN8A 3GVQA 1I6NA 3UXKA 1A5MC 3Q65A 1S2AA 4HU0A 2WVVB 1RJQA 4IJBA 3ARVA 3B06A 1R3YA 5MF5A 3VE9A 3N73A 3APYA 3GZAA 2DZWA 3KAOA 2VVNA 5CZTA 3GWQA 5HJYA 2QCGA 1AG1O 1XX1A 3LSCA 4JKMA 2I57A 4FPSA 4MZYA 4LBSA 1EJRC 1MUWA 3NR0A 1CGXA 3CGDA 3GVRA 3W7JA 1X7FA 3E9AA 1R2SA 5CQ1A 3CO4A 1OC7A 4NUWA 4H9ZA 2Z6IA 3UWUA 2ZX9A 1K6WA 1XUUA 1P43A 5HMDA 3N2BA 1HP4A 5E5CA 3P5ZA 3JZEA 3PUGA 1TPB1 1BVNP 1MXDA 1D2KA 2PS2A 5AVHA 2GK1B 3RX2A 2J6VA 4WHBA 4RDYA 5LIXX 1SFTA 3RM8A 3WNLA 1SMDA 3M5YA 4XWUA 1KV5A 2Q8ZA 3T2PA 4LPCA 3G8EA 4MNMA 3CWHA 3B04A 4N9EA 2F6KA 1FHUA 1Q2SA 1KBBA 5HAOA 4IMGA 2WLZA 4H83A 1BTMA 4P8VA 2VJXA 1EA0A 2EO7A 1LLZA 2G37A 3AQUA 1GVSA 2V3EA 2XSAA 3ARYA 3FS2A 3CWOX 2V3AA 4C6LA 1E6NA 2AQOA 3IS4A 3PK7A 2CFFA 3LB8A 3W83A 1MZRA 1V08A 4M80A 4GX8A 4DY1A 3IGHX 3L0KA 1LROA 3EGJA 4J3UA 5HBFA 3RNDA 4TVYA 4KFOA 2VCBA 5E6ZA 3OVQA 1W9BM 2ZVRA 2P0OA 4B2DD 4WF7A 2ZIDA 1UKOA 1P0KA 2PWUA 2VEPA 4GVFA 3GKFA 1JPKA 3N6JA 1Q45A 3EWCA 4G1KA 5BXTA 4GYPA 1K03A 3GXNA 2IQ0A 4P8WA 3CHVA 1EPXA 1WYGA 1FX6A 1KFLA 1TTQA 3TCSA 2HXUA 1NQKA 1CLVA 2CHNA 1KBKA 3ZT7A 4X9YA 1OCNA 4LB3A 4Q8QA 3ARXA 5DQPA 3IARA 3TAOA 4V1YA 4MJ4A 4FX6M 3II4A 1VFUA 2YSWA 2W63A 1GKPA 2J88A 2VZVA 3B3DA 4WR3A 3AFBA 1YNQA 4PUJA 2OU4A 5HNTA 4YNGA 2Z29A 4QROA 3SEPA 2HDJA 4IG2A 4DX3A 5DXXA 3TLLA 3TK7A 4KRUA 1KW1A 5D2XA 3FDKA 1OCBA 1QOQA 4O1DA 1OFRA 3AIUA 1HKKA 3PBYA 3F7JA 1N7KA 1RD6A 1LG2A 2VO5A 3AMDA 3HRDC 3JR2A 4GUJA 3PR2A 1Q6QA 3LQLA 1W8SA 3CZEA 4B5SA 4HSOA 3WQ5A 4GOAA 2DVUA 2OO0A 1ZZMA 3LBOA 2XVNA 3A6OA 4M24A 5A94A 4PZVA 1TCMA 3A47A 3MWAA 3AN1A 3DOPA 3WQVA 2FB2A 2VFGA 2XU2A 4IMCA 3AU6A 2PF8A 5J8LA 4QRNA 4E2VA 1NOUA 3T0CA 5C9ZA 4JIHA 1GVYA 3CUJA 3CB8A 3PS7A 1LYXA 4EF9A 1GVQA 1YIXA 1MVYA 1X1OA 1OGBA 1D7FA 4PSPA 3TV8A 3T4CA 3W02A 2UY4A 4TX9A 3DN5A 1IEIA 4DB7A 2C13A 1AW2A 5E9AA 3A22A 4WDUA 3LBMA 4UTLA 1BD0A 5I0DA 3PM6A 4NJGA 4GY7A 3AYSA 3URBA 3L5LA 3DYOA 3GRSA 3ORWA 1S2WA 1AA1B 3H21A 4NZ5A 2YBUA 1HG3A 1S46A 2Q01A 4WD0A 3NZ1A 5HA7A 5FESA 3MVIA 1BKHA 1PZ0A 2XZ7A 1VIZA 1SQ7A 4F0SA 1G5AA 2XSXA 2PURA 1STZA 3HZ3A 5CJ5A 2WWCA 1GZ1A 3UR2A 4I7VA 1C29A 5G2HA 3EWDA 3QHNA 3UWYA 1UH4A 1JDAA 3ZR6A 2X30A 2DZVA 3J7HA 1Q6EA 2D73A 3VNZA 1N60C 1DWJM 3LM3A 2WJZA 2R24A 3OIXA 2DSVA 5D30A 3KHJA 2BX7A 1G01A 1UMLA 3PJXA 2DVTA 3F2BA 2Z24A 4FMVA 5F4SA 1P7TB 1IXQA 3G18A 4LRTA 3DAQA 4JEJA 4NAEA 1QPOA 2QHAA 4QLLA 2GR1A 3W82A 4IF2A 4ERAA 2DZXA 1W9XA 4G8TA 5G4HC 4WKHA 3HO8A 4DNHA 3UXAA 4B16A 3G2GA 5I5RA 4DJED 2ANUA 2C16A 3DIPA 1NHQA 1UIOA 4H4SA 1SR0A 2O9RA 5TAOA 2RDUA 4GA8A 3QV8A 3NIYA 4B91A 4CCEA 1GG0A 4KPRA 5KVHA 4CCZA 3H2OA 3V5FA 1DJXA 2YL9A 2I7GA 4IHCA 4GLEA 4DWSC 4EAMA 3GH5A 4OJYA 1B9BA 3DKLA 4QGCA 4PMDA 2J9YA 1PYMA 2ALDA 2PWEA 1SO6A 2Y63A 3FJNA 3SCQA 2X0YA 1ISWA 1KR1A 1V51A 3N2TA 2WHLA 1V3LA 3D46A 3BAWA 3VNKA 3OYXA 1UKPA 1R46A 4GXPA 4R34A 3UZZA 1S38A 3RAOA 4J5NA 4WSKA 2QQ6A 4D6EA 2E7FA 2Z1SA 2CWXA 5A6JA 1VP5A 2XN2A 1EJTC 3FVDA 4A2SA 3QPZA 3PNZA 4B4FA 2Z1XA 3GIQA 4G6CA 3TH6A 1FWHC 3N6QA 4ROQA 4D71A 2AL2A 1A5NC 4ZMGA 3CBWA 2VT0A 1M3UA 2R1NA 3KUMA 3FY1A 4AZGA 3KFTA 4GD0A 2QPXA 4QG9A 1VIWA 3LU2A 1EL3A 2PDXA 3BANA 4ACZA 1U83A 4ZE4A 2ZZ5A 2W6RA 4QS6A 1J5TA 3LTSA 4PE8A 3NQ7A 3I4EA 1W1TA 1ONFA 1QK0A 2CZ5A 4MKNA 4Y9PA 1F6KA 3S83A 1GPFA 4MADA 4DO7A 1FHDA 3H2MA 2PP1A 1VFHA 1TPH1 4ZL1A 4FIRA 1AJZA 1PZ2A 2Q09A 2BY2A 1IT0A 2ISVA 2R1LA 3IANA 1T8QA 4DPPA 1Z44A 2OSXA 3PSWA 2OZ0A 3VOGA 1EX1A 4FOUA 5LNUA 2R1MA 5AC7A 6XIAA 1DVJA 4H7VA 3KBMA 4L7ZA 1S3TC 1HN1A 2V2HA 4XZNX 4NNBA 1XIJA 3S5SA 4JIRA 4P7RA 5A8GA 3IAPA 5F4XA 3B40A 1DWFM 3K4WA 4PODA 4ZTYA 3HV9A 5CSRA 1T40A 2OX1A 1PKMA 2F61A 4LT9A 4ZQPA 2WC7A 3TCEA 1DL3A 3AYVA 1EPVA 3N04A 2J9XA 4ROPA 3IJLA 3PBVA 4OOZA 3W2LA 2AMXA 3WLHA 1HQTA 1H11A 3H4WA 5EA9A 1UOZA 4ZB5A 1ITXA 4ZOHB 4M6PA 2X40A 3VKKA 1XGEA 3SW6A 3G6LA 1CXKA 2VQUA 3AHXA 2Z6JA 3TYBA 5CPTA 2VUYA 3NTYA 3DERA 1ZMCA 1U1UA 2P8BA 1XIFA 4PUDA 1XINA 4MG4A 1E1CA 3RILA 1JPDX 1QI2A 4WSHA 1VZWA 1KXQA 4HU4A 2EQ8A 2R82A 1S1PA 1ME9A 1NWUA 3VGDA 2BOFX 1G6CA 4ADWA 4O11A 4UCGA 1PYFA 3NQ6A 2ZZ3A 3NM3A 2ZRVA 1F5ZA 4IIHA 3I7RA 1GOXA 4YVXA 4YXGA 1W91A 2I9UA 2JE8A 2NX9A 4AH7A 3TOPA 4KCTA 2ZXAA 3QTPA 2ZRUA 4PSRA 4DWDA 2R8WA 4IMDA 5LIKX 4JIPA 4UMBA 3MMTA 5L6UA 4Q4RA 2BVTA 2UY2A 2V8ZA 3MUIA 4GKLA 1OYBA 2FVKA 2Y85A 4MGGA 2XIMA 3WK0A 4DHGA 5HQMA 9RUBA 2OWCA 3NAVA 1XR2A 2PDFA 4IPIA 2H9AA 2I9EA 4EPDC 2QXWA 1WKFA 4YL2A 2XVGA 3W6YA 4RUBA 3RK8A 3A21A 1UUMA 3WH8A 4WCJA 4QAIA 4XBJA 3N12A 4LUJA 4BEUA 3BJSA 5DXYA 3ITGA 4N7QA 5FJRA 3PBMA 3O2LA 1ZK7A 3JVAA 5H8MA 1QWGA 2VOMA 2NWRA 5REQB 3BG9A 4LEQA 1O95A 2INZA 1KTCA 2F9RA 1WZAA 4IIEA 3VA8A 1T0OA 5FS9A 4C6IA 1BAGA 2CLKA 4LYQA 4MKSA 1E0XA 5E09A 2Y4SA 3SUVA 3DESA 1GTHA 2OLSA 3OLIA 1GCYA 2Z2UA 4BV6A 1UPMB 4DAFA 2C1HA 2NQHA 3O8AA 1PUDA 3GG1A 5HMFA 1ZS2A 3OGVA 2ISDA 2PBOA 4YTRA 2PP0A 3MTWA 4S3AA 1IEQA 2HQMA 3GTIA 3S3GA 4EM3A 1E6SM 5AZ1A 4Q8PA 1OGGA 1MZHA 3C2FA 3OVRA 5CC3A 4LYPA 3QFBA 1J10A 2IKHA 3CGBA 1QW7A 4HQVA 3NUKA 2Q8LA 1BWKA 1EHNA 3IJIA 1ISVA 1AD4A 5LNVA 2VZUA 3SRHA 3W37A 4GI9A 3PZIA 2PC8A 1R9XA 4XZLX 4H6RA 5A6BA 5EU9A 1Y7VA 2X7VA 1YTKA 4TXEA 3MBDA 1EIXA 3RU8X 4I9JA 1TWZA 4C7DA 3JUGA 4HTYA 4Z08A 4O10A 2GGHA 4K1GA 4XSMA 3USBA 5CGTA 4EPEC 5JCIA 4AZ6A 4LYRA 4M81A 3DFHA 1S39A 2D3LA 4HB7A 4K68A 1Q8AA 3LHVA 4ADUA 2NSXA 3C52A 4JDYA 2V2DA 1WX0A 3AUJA 3C0JA 1RY0A 2BXZA 3OW1A 1QHPA 4NJJA 5HNNA 3KCJA 4XAZA 3JS3A 1VC4A 3PG8A 3LRMA 4TVUA 1QPRA 3A3XA 4MUZA 2PRLA 1KTNA 3GDLA 4LS2A 5DY3A 5A8MA 2OOFA 4K6AA 4OBRA 1EGMA 1M7JA 1XLCA 4ERGA 3GDBA 6TIMA 5I02A 3N11A 5AZ0A 3WMLA 1Q3NA 2WMGA 4HGXA 3A7RA 3O6DA 3WLRA 4H7ZA 3ZLHA 2NT0A 3GK0A 4NJKA 5C7HA 3DU0A 4HPHA 5U4NA 3LADA 4QJ5B 1TWDA 3V4BA 2EPNA 2E68A 4O50A 1XYMA 5CSUA 4OFCA 2XZ9A 1GJWA 3IPWA 4KH2A 2GGJA 3M5ZA 2XFYA 4HOZA 1XUZA 5LHEA 4J56A 4NXSA 4A3UA 1RV8A 4O8AA 4GQ0A 4E3VA 3HQ1A 3CPRA 2ZICA 1P4CA 1FWEC 3TW7A 5BRBA 1N8IA 3EUB3 2J7DA 3LY0A 4IX0A 2R1PA 3VFCA 4WKFA 3FXGA 1EFZA 3L0NA 1QWKA 3MHGA 1KRCC 4BF5A 4GC3A 4CQ8A 2JEPA 2IMRA 3AWNA 4LW7A 2BMBA 3P67A 3TC7A 4ERIA 3BPWA 4IFOA 3DHFA 1TKKA 3W1MA 3IK2A 5CAHA 4XV0A 4MJZA 4P7QA 3CL6A 3KLKA 3I6EA 3E12A 3PTQA 2EKGA 2CLMA 3NYZA 1JAEA 1YADA 2C1GA 3IGXA 4H9UA 3DG3A 2OEMA 5KVIA 2J62A 3UZWA 2GVEA 4ML9A 3VIMA 3P81A 1XW8A 2QDDA 1C9DA 1K4GA 2VHLA 3VDAA 4BR1A 1ZPTA 3GU9A 4MWAA 2ATSA 4PCSA 2BBFA 1VFOA 4IIBA 2ZADA 2BTMA 5M5DA 4YCPA 3IIOA 4TMCA 3ES7A 1FCBA 4PCTA 4GPNA 4UTHA 1I1XA 1GG1A 1KM5A 4V33A 4UTJA 3VVGA 3PFRA 4GQGA 3ZIZA 3K46A 4PTXA 2C0AA 3LCHA 4J40A 1IZJA 5I3KA 1TQXA 2X8RA 3ISIX 4Z2JA 3FJLA 4UOQA 2P10A 3BAKA 5JCLA 3GH7A 3VM7A 4GMEA 3VOHA 2DY3A 5FCZA 4LIIA 4JN6A 2BGSA 3W3OA 1G94A 3W7GA 1WXYA 1FWDC 2TPRA 3NO1A 3BLFA 2EPMX 4CKQA 2L5HA 1XLKA 3BAIA 1ZCCA 4UTUA 4J7RA 3QQWA 3R58A 4JQAA 5BU6A 3CASA 1B3WA 4YVVA 1HJXA 2PDGA 4Q6XA 1GOQA 2J7CA 2RHGA 4AD2A 3IVUA 2C79A 2FHCA 3W7KA 4Y9NA 2V6OA 2Y7EA 1BG4A 4AB4A 1V93A 4GUFA 1UR2A 2P50A 2YKKA 1CGVA 2AGTA 4AC7C 4M6UA 5ABTA 1TSIA 2QJGA 4PN2A 3AIVA 4ZBCA 1VEPA 2VDGA 5I09A 1R47A 2E5DA 4NI3A 4EQSA 3N2MA 1BQCA 4F0LA 1IWAA 3GXTA 2YLLA 5D03A 4UR9A 5FJOA 3UNDA 2QCLA 3AMLA 3KXQA 1V7AA 3EDEA 3PWAA 4DO5A 2EQ7A 2H3DA 3G0UA 2YBTA 4W87A 5EL1A 4JQ3A 2UZ9A 2JBMA 4LVDA 1KKOA 4MTVA 2YCLB 2YYTA 5GJMA 2X8HA 4ZO7A 3WF1A 2ICSA 2C0HA 3H7RA 3NQGA 4QLJA 1G7UA 4A8RA 1FFVC 2DV0A 1EZWA 2NXGA 2WJDA 4QSHA 3BGAA 1IIHA 5TR3A 5BWFA 3KWSA 1NSJA 3G3DA 3DBPA 4FZIA 1W1ZA 4FXJA 1ZY8A 4XQ6A 4AXKA 3W00A 4RXFA 3AYTA 1PIFA 4NZ3A 4Q4OA 2PLKA 4LEFA 4YN5A 3IIVA 4H4ZA 4NYYA 3SFKA 2E1DA 5AB3A 4MLRA 4F66A 1TPFA 3BJTA 3L2IA 1EZ2A 3R94A 4XO7A 1OWQA 3DBNA 4GINA 3SUUA 4LS1A 4C1NB 1M9HA 2QKFA 3BV4A 4G7EB 4DBEA 2W0UA 3NVWB 5DO8A 3O07A 1EBDA 3CMGA 2QPSA 2ZZBA 3QMRA 3CZKA 1HO1A 5CJMA 1LWJA 2QEZA 2HPIA 2HS8A 3HN3A 3IJDA 3KRUA 4Z1AA 3FA3A 3HF3A 4UWMA 1JPIA 2PWDA 2C7FA 3BJFA 5D38A 3EXSA 4LA1A 1BRLA 1MW0A 5F2IA 4D2JA 4ZA0A 1MEWA 4ES4A 2C8NA 5BOEA 3DG7A 1QO5A 3M43A 1CENA 5I03A 1LBLA 3GG8A 4DUOA 4F48A 3LMZA 1W54A 2X50A 3N29A 2ZTJA 5MKGA 4DI9A 1EO7A 3BSGA 2WBKA 3OTRA 4CEUC 3NSMA 4JKLA 3GXPA 1O4UA 3H24A 5HWMA 1S2UA 1I75A 3BE7A 4M6VA 3NO3A 3B03A 3VNMA 1EP2A 1O5RA 4PMUA 1E51A 3FJ4A 3H2EA 4I5XA 4J4KA 4D9PA 4Z2LA 1JRBA 2BGNE 1XLHA 3NVZB 4DUXA 4M6QA 2H90A 3IJQA 1VRDA 2QCDA 1I60A 2C3DA 4DM2A 1HKMA 3NQVA 4DZAA 3W7CA 2CLIA 3G8RA 2WNQA 1V6YA 4PRTA 3PC0A 3WNNA 4JS3A 4S3BA 3W1RA 3T07A 4MNLA 4KS0A 1R8LA 5HANA 1KCLA 3U3HA 2VELA 5FJTA 1REQB 1XDLA 4U3CA 1A5UA 5FL1A 2VZTA 3WLLA 1XKJA 3PBUA 4M7TA 4GYFA 1U1JA 3ITOA 1F8IA 3TR2A 4GNJA 1GERA 1JD9A 1F2JA 3S2JA 3HPAA 4CCDA 3W23A 4FR6A 5E93A 1X6NA 3CUFA 4QSFA 5IHRA 2VRKA 4B3LA 9XIAA 5DMYA 4JTDA 3R10A 2PDYA 4Y2WA 4MAZA 1RD5A 4NYUA 3KVMA 5I3HA 1OGSA 1QUMA 1U22A 2D2JA 2PP3A 3U7BA 1W9PA 1YPIA 1ZXIC 4IGSA 2NV2A 4GR1A 2Z2AA 4JNZA 3KX6A 3PUDA 3SY5A 1K9TA 3HM7A 1CGWA 2A6NA 3UZXA 2GR2A 1FKWA 1JI1A 3GS6A 2ZUUA 4OGZA 1VCFA 1AK5A 1MEIA 2Y61A 1HGWA 3MB9A 4CQAA 3VGGA 1I8JA 4XBKA 3LPGA 3THUA 3C3UA 3IVSA 3LXBA 2PCEA 2YL6A 3CQ0A 5HWJA 3M0HA 1RLDA 4IGMA 2CBIA 4ADTA 4F3HA 2GDVA 1VEOA 2VR2A 1XH1A 3SN4A 3NSNA 2X1UA 4F9JA 3EXTA 1KCZA 1A4MA 1AVAA 3UPBA 3ZS4A 1Q63A 1ZKQA 1GRGA 4XTDA 4U5IA 4FO4A 4NZJA 1XYZA 3UT0A 1K4HA 1ESWA 1LUCB 1H49A 4I7UA 1CXHA 4ZB0A 4X22A 1JJKA 2CZDA 5EMKA 4UNLA 1H09A 4L4MA 1JYNA 1A5LC 5JU6A 3D47A 1R5YA 4DBUA 4HPJA 2H8XA 4MJ2A 1O94A 1NEYA 1SU5A 1FWIC 4IZGA 4RW3A 5JH1A 4K8DA 2E77A 2PPGA 1U30A 2HK0A 3TJXA 3OPSA 3LZ3A 7REQA 1OZQA 1J79A 3C8NA 2B0MA 2QV5A 1IXNA 2VRQA 1W3NA 1LVLA 2VQTA 1A5SA 4ICNA 3WD4A 1P6WA 4UNKA 3V5OA 2PDIA 5HQLA 4ZB2A 1RQEA 2ASHA 4IJRA 3PHAA 4Z1CA 1O68A 3E0WA 4UTTA 3IACA 2JFEX 3UYIA 4NX5A 1XKYA 4C6QA 1YTDA 6XIMA 3DYPA 3UCDA 1C7SA 5CJNA 3F1QA 3WO8A 2E9LA 3IUHA 1Y5XA 1F76A 3G1RA 3LMYA 1WOAA 3C4UA 3EKGA 3QGAC 5EBAA 4V2XA 1WYIA 4E4PA 4MPKA 1TV8A 1HX0A 3W1XA 5CKSA 3VOJA 3WQOA 2GJXA 4I90A 3SN1A 3WQGA 5FIPA 2D22A 4HA1A 1LWIA 1JCYA 3GC5A 4H6QA 3LEPA 4BEQA 5F1VA 1XXXA 2Z2BA 3DZ1A 3VGEA 2OZ3A 1OIMA 1WAWA 4PUMA 5KTLA 1A53A 2ZWYA 3T1GA 3IK4A 3N19B 1XF0A 3VK5A 3EYPA 5CGMA 1LRTA 2J27A 3VX1A 3BZJA 2EHHA 4JDBA 2W3ZA 3SRDA 5B7YA 3OVGA 1KM0A 1TV3A 3DKJA 3TWAA 1QRQA 3P8IA 3PF3A 2GGGA 4RPQA 4NILA 4E2DA 3FYOA 4ZEPA 1UKTA 2V0TA 1XIBA 1WPCA 3RCNA 1FWRA 4QISA 3LUTA 2CC0A 1UMYA 3AHYA 3M0VA 1KBIA 5FF4A 3K2GA 1VBHA 1M65A 5D9PA 3EDJA 4HCHA 5CC7A 3HFYA 1MQPA 2CETA 2WANA 4PRWA 3WNOA 3QPYA 1N5WC 3KBNA 5CPMA 2VDHA 2QVHA 1T41A 1CLXA 1E6QM 1LQ2A 2GDUA 4PL2A 4MZ1A 4JPGA 2WMJA 1J0KA 3W85A 2YPIA 4NAFB 3TQ0A 4RX0A 4N9DA 1FWFC 1UHVA 3KVJA 1QASA 2GQAA 4W7WA 3GX9A 3QOKA 5HDRA 5AKQA 3W9ZA 1SZRA 4GHRA 4UOZA 1SB3B 2VKZG 3WLPA 4JTLA 1OD0A 4PUUA 1R38A 2F6XA 2Q3RA 3CTTA 5IHSA 3W0KA 5KEZA 1XFBA 5DCDA 1OX4B 1JCLA 4CNUA 1TTIA 4X2PA 4MWAC 5LNSA 4U33A 3MSDA 1YHTA 1DJYA 3TIMA 3G24A 4M82A 3WEZA 1VCGA 2HBVA 2Z25A 1E4IA 5BROA 4ZODA 3UW6A 3ARQA 3DGBA 4FNSA 1B54A 5C9XA 4DJFA 3CS2A 3NL2A 1RK6A 1OYAA 4A4AA 4Y9OA 1FFQA 4I9MA 1TELA 1DXEA 3ZVHA 3S1XA 3SGZA 1F3TA 4KQNA 1KBJA 4MOZA 3OVPA 1W3LA 2C15A 1ODUA 3ARRA 1NDYA 3GNNA 1TIMA 2PDHA 2EPKX 4C65A 4J1OA 3CB3A 1GW1A 1RY8A 1R2TA 2PWVA 4S3JA 5FJJA 5GJPA 4W86A 4O0QA 4QHRA 3WQPA 1GHSA 2FVMA 4WOQA 4XTIA 1DHPA 4H4WA 3ZJ8A 3GNXA 1LTDA 4HT3A 4C6PA 1ME7A 4YTSA 3MO7A 2D2HA 3KWXA 2C1IA 4H4IA 5FF7A 1E0VA 3WY1A 3QMTA 2W3RA 4H9XA 3O05A 4UFKA 2WNNA 3UJEA 2GJRA 4W5ZA 3OBKA 5G2IA 3GQYA 3WJZA 3NYDA 4OV9A 3F4WA 3MCOA 2F7FA 3W88A 2QPUA 3UP8A 2E5CA 4DJDC 1TYGA 1Z32X 1OT2A 2GSJA 1DE6A 2VFDA 2NQ9A 2FMOA 3LPOA 3PJWA 2YVGA 1W1VA 3FCPA 2ZX6A 2TRSA 4HZ7A 2ZZ6A 2VM8A 3S9ZA 1SR9A 4RZ6A 4D6DA 3NPWA 4IGNA 5H1WA 1N8WA 3E5BA 2IQTA 4FOJA 4MKVA 4ZO6A 1OC6A 2QF7A 4QCEA 2QIIA 2Y6ZA 1CW2A 2G97A 5LYRA 3K8MA 2Y7DA 3WQ8A 2YB1A 3BCFA 4POCA 1ONRA 5U7SA 2QJMA 1XIMA 1J2BA 1TG7A 2VX5A 3TA6A 3DGHA 2WMKA 1MDRA 3H70A 3GC4A 4BF7A 1U5JA 1PAMA 1Q7QA 5AHEA 1RCXB 3M64A 4RNHA 4FX9A 2PWHA 1ZRQA 4YWIA 1DKWA 3HW2A 4H2CA 1P6BA 5H2ZA 5FJIA 2O4MA 3QQ0A 1H62A 3TEVA 1MYRA 1CWYA 4I8YA 2WCSA 4Z0SA 5H8UA 1TPWA 3V1HA 3GDRA 4JDRA 4NZCA 1W32A 3OBAA 3NNTA 4ZTXA 5I2UA 4QAWA 4HIBA 1SSGA 3BLKA 3SCUA 1I2NA 3HB9A 4PB4A 2E1WA 1HJSA 3CAQA 1JYVA 3QYSA 2J7EA 1ZBKA 1S2TA 3WFAA 3BLPX 4HYRA 5E1QA 2CU0A 2Z4GA 4AIBA 1AZ1A 1UJQA 4O18A 3W53A 1XLBA 3M0JA 3R79A 2FPYA 4GCXA 5CSSA 3PWIA 4KGJA 3N25A 4Q6JA 1PZ3A 2C18A 1Q6RA 3A24A 3U5UA 2ZFAA 4NT0A 4DUVA 1QFEA 1I1WA 4GY0A 2BC0A 1TA3A 1XRFA 1KQZA 1UWIA 1FHLA 4PULA 4LSBA 4KESA 1D7KA 1KWGA 1KFWA 3UXDA 1S5MA 3OZOA 1I0BA 1V5XA 4JKKA 5I3DA 3EEGA 4U4MA 3B9JB 3EX4A 3B0VC 4UQ9A 4OU1A 1NWSA 1X98A 3WF4A 4UFJA 1GYLA 1Y65A 3U2ZA 3WJYA 1WZMA 1AH0A 3VCNA 2CZFA 4MB1A 1J4EA 4O12A 3N4AA 4IFKB 4DZHA 4FX7A 1E4NA 3E74A 3FYYA 3EPMA 4IG2B 2PD9A 1A50A 3ZO9A 3R07C 2JKAA 4E2OA 3PTMA 4MMWA 1JULA 4GXMA 5C6MA 2EG7A 1BWCA 2ZA3A 4KT2A 1BLIA 1D9EA 4JFWA 3CUIA 1OF6A 4UZSA 1R85A 2J74A 2G3FA 3OIHA 4AW7A 4YVPA 3SQLA 1XWYA 3USZA 3W07A 3CGCA 3GR7A 7PTDA 2PDWA 3W86A 3R89A 3QSRA 3DDMA 5G4EA 3CPUA 3ALFA 4BKNA 4LVAA 4R53A 4HZ8A 4R27A 2D2OA 3ITYA 2WPEA 3KCOA 4C5YA 1L6YA 1ICQA 1LZOA 3T42A 4AD4A 2V2CA 2Q02A 2A79A 5CCZA 3L66A 3EOLA 4CQ9A 3RN6A 4Y96A 3UPMA 3TONA 1TTPA 3LTPA 4AQLA 1ZNNA 4GUGA 2XIJA 1E1EA 4Y6GA 3QZAA 1TR1A 1UD6A 3PZGA 5AVNA 5CLTA 5IRPA 2CLFA 3N2CA 3HOJA 2A85A 1UKQA 3HMCA 5A6BD 1V6XA 3SY1A 3SCTA 3AWOA 2CDUA 3NOEA 3WMSA 5AYYA 3UEQA 1A3WA 3S5OA 3IV8A 3AJ7A 4GZ7A 1AFSA 3AAMA 3C2RA 2AAMA 4PH6A 5CSYA 1FH7A 3N6HA 4LCRA 1UA7A 2X2YA 1OB0A 2R94A 5EBKA 3CV6A 3WD3A 3V0UA 2D69A 2FJUB 3TYCA 2YCIX 3HGJA 4DN1A 1HT6A 3CL7A 4I8DA 3UR8A 4C6CA 3RFAA 5LA1A 2A0NA 1VPXA 3S1GA 4EAYA 1TZZA 3TW6A 3AI0A 5HJLA 5IDZA 1X1NA 4AX7A 1JD7A 4HYWA 1XCXA 3KCLA 4O13A 4IICA 1UD3A 3R0DA 1OF8A 1DJNA 2CCRA 2R1KA 2OKTA 3INPA 3WDIA 3EXRA 3TW9A 3WLIA 2VGIA 3W72A 3PNUA 1XJBA 3H4XA 4H9YA 3N9SA 4PMZA 3R2GA 5FSDC 2OKOA 1QBBA 1MW2A 2WZMA 3ES8A 4GABA 3VM5A 1HJWA 2ZA1A 2DQWA 1GK8A 1F4AA 2BS9A 3R25A 2A3BA 1J93A 3ELFA 3CT2A 5CBJA 2AGKA 5AC8A 3KEHA 3CZ8A 2V5DA 2YB4A 4PGLA 4XAYA 3KRSA 4MDPA 1LRQA 3BVJA 4QEEA 2Y89A 3W87A 5FOOA 4TVCA 2D2GA 1RXOB 4ATWA 1F3WA 3LCFA 5E0FA 1E40A 3EF6A 4V1XA 3ITCA 1A5KC 3MSYA 3SQMA 3NQDA 3W84A 4E8CA 4HHHA 2W0HA 4F2TA 3TA9A 3ZXWA 2DIJA 4AVNA 1JFHA 4RLIA 2JIWA 5EB8A 2GRTA 4YWOA 1B4EA 3AMKA 2OQLA 1W1A1 1FDZA 1QPNA 1W1IE 5HMSA 3E3HA 4AEFA 1WDDA 3TYZA 3VMPA 3NM1A 3CAKA 3CUXA 1F6PA 3DK4A 4RZBA 3GD4A 1GVRA 4LC8A 1FO4A 5A2BA 3WIJA 3UF9A 4UQAA 1KV8A 4U3AA 1T5AA 2B7NA 4UTTC 3BC9A 2FGBA 1TJ0A 3CUGA 5CLWA 1XLDA 1EUAA 1I45A 3T44A 2BSLA 4PCPA 1TVPA 4IMEA 4PBFA 4LV9A 4BCEA 1E5NA 4JFSA 3NDOA 4NXKA 2QCFA 2WW5A 2J7GA 1S7MA 4MWAD 3E5PA 5EY5A 2UY5A 2EGZA 2FDMA 3N2XA 2AL2B 4WGHA 4UMAA 5CBBA 1SZEA 2CKSA 4M1RA 1AH3A 3GO2A 4KWOA 1SW3A 2C3CA 1AL8A 3KDOA 2IPFA 1TUXA 3M0YA 3PAJA 4Q8OA 2V3BA 1HGYA 3LDVA 3LNMA 2X99A 3ID7A 4ACZB 2WP5A 1IT8A 4CQCA 5FF3A 4MAVA 5A8QA 3RCYA 1DIKA 4O1FA 4G7EA 2AMGA 2WNWA 5CC5A 1VD6A 4QE1A 4GZJA 3F4NA 1NWTA 3NXLA 3K1GA 4HMEA 4C6DA 3DCPA 4XZWA 1OC5A 3GNPA 4MY1A 4NJIA 2E40A 1X6LA 3OO2A 4JTRA 3RUBL 4W5UA 1DYSA 3FVMA 3TROA 1JUKA 4EACA 3LXCA 3ZMRA 4HHPA 3M07A 2YFNA 3VUSA 2XPKA 1TVNA 1OEPA 3GR8A 1R0MA 1H7OA 3IJ9A 4A8LA 3BSMA 4BF9A 1TCDA 4F0HA 3W22A 3IRDA 1HL8A 1XDIA 3TQVA 2WJEA 3LV5A 2CZEA 4GYJA 3B0PA 3HIJA 3STEA 3WLSA 4LYKA 5FS8A 3LCIA 4L6OA 2C91A 4NL1A 4XBSA 2WBGA 4DJDD 1LL7A 3VD5A 3T2OA 4O19A 1EYWA 3GTNA 1MRAA 3QW3A 1MDLA 3ARPA 3I65A 1W5PA 2J8TA 1QNVA 2VURA 3N3MA 1KLYA 1WDWA 3N34A 4HNNA 5CPLA 2HVOA 5I79A 3R5EA 2GSEA 4JD4A 4K8HA 1GRHA 3R1ZA 4OUIA 3BGJA 4E6MA 4CQBA 3CMFA 3KHDA 3A5VA 4D6FA 2JF6A 5D09A 5F7UA 1HL2A 3G0XA 2P0IA 4W84A 3UJRA 2PFHA 3BMWA 5AC5A 4W93A 2E9MA 4C5ZA 2H3BA 3IGUA 3IIPA 3UU0A 3CIWA 4JQ4A 2ZCGA 3EWUA 2BV9A 4BQ4A 5T26A 1FXPA 1YE6A 4MHBA 3M0XA 4E8GA 2Y8KA 1NQ6A 4A21A 2Z1BA 3UNTA 2NUYA 4H19A 2ZOXA 3WBWA 1E56A 4K3ZA 1BSLA 3MPGA 3URHA 3L4WA 2DZBA 1YKWA 5LIYX 3GR4A 1KBLA 3B8UA 2H9AB 3E38A 1L9WA 3U0HA 3GNOA 4DZ5A 1XG3A 4XX6A 3W2KA 4FNPA 1XYLA 4P5UA 4H04A 2CBUA 3GRIA 4BHYA 3HA1A 4NZ1A 1LLWA 3DHPA 1LP6A 2BODX 2QZRA 4I7WA 1VH7A 1W9DM 4WY0F 2UWFA 3B8DA 4NY2A 1R2RA 4QEHA 1ZAHA 2VX7A 4ZOAA 3SR6B 3LLXA 2MNRA 4S3EA 3LK6A 3FK4A 3F4CA 3EB3A 4EANA 2OGJA 1UG6A 5B7ZA 2ZVIA 1X8FA 5FEXA 1ZALA 4QDPA 5EGRA 1XD0A 1NU5A 4HMDA 3H54A 1HF6A 1OCJA 1CXLA 5T9BG 2VCAA 2BGQA 1R3VA 1E0TA 3H53A 4C7GA 2C6QA 1E43A 3HJZA 3VKBA 3CJPA 3SADA 3UA4A 3LD5A 1G1YA 1NH6A 3T6CA 4LALA 2P8CA 1BG9A 3PP7A 1J11A 4AIEA 3TXZA 4AWSA 3UJFA 2JGYA 3PPGA 2ZX5A 3SAZA 4QJ3B 1V4YA 4M51A 2QNEA 4MUPA 3GNDA 2J7HA 3URQA 1Q7MA 2Y2WA 2E3TA 4UQEA 3WQCA 3CGEA 3EX6A 3HQPA 4L4OA 3A4XA 1M03A 4J28A 2Y1HA 4U31A 4H4XA 4US5A 2OWWA 4P8UA 4RL3A 2XH7A 1GSNA 4DYJA 4PEEA 3BAYA 3N9RA 4LCQA 2VFIA 2B31A 4HNVA 3NDZA 7ENLA 4EQXA 3OLDA 4DWSA 4D6IA 3C61A 1GRFA 2WSYA 3OC4A 1L2UA 3RNMA 2WM0A 1JZ6A 1LDCA 5E70A 3VFLA 5DEZA 4HZMA 4LVGA 3T0TA 1MXGA 1E70M 3B97A 5FF0A 5GNZA 4FALA 1UR1A 2J79A 4HPXA 1VJZA 5IXEA 2DUAA 4RE0A 3GUWA 2PE4A 1UWUA 2FH6A 5CG0A 1AOGA 5KZ6A 4FLOA 4U10A 3PJUA 3FXYA 4MY9A 5DN1A 3WFLA 5DT7A 2HJPA 5BOOA 3DK9A 2ZUMA 4P8XA 4LNYA 1NY1A 3C2VA 3CWNA 4QBXA 3DJJA 1NDVA 5I3IA 2NVCA 2E5AA 2OGYA 1CTNA 1D8CA 1C7TA 1FQ0A 2E28A 2YVJA 3VXGA 2OX4A 1C93A 4JL1A 4LQ1A 2QDHA 4LFYA 1R30A 2DW6A 2EKCA 4EX4A 4TR9A 3ITVA 3VNJA 2V5KA 5MHBA 1GUVA 4AZIA 3WLJA 4UTWA 3S2LA 1DJGA 3EZ4A 3H2CA 1F3XA 3CUHA 5AYXA 1O5KA 2ZUTA 1JEZA 3C5QA 3SM0A 1JZ7A 4AG0A 4BA0A 3P2VA 3WN6A 2DJLA 1YTEA 2OG9A 4D8LA 4E8DA 1U1HA 5DMMA 3SBFA 4JICA 4L1WA 3HPFA 3VIKA 1UBSA 1GEUA 4UIOA 3WENA 3AMZA 4W4QA 4I6KA 3S9IA 2VXNA 5FKYA 1OK6A 1Z89A 2VNCA 4PTNA 1V0NA 4JEQA 2PLCA 3GBEA 2C71A 3M6YA 1R3RA 1J96A 3F4DA 2PTZA 1YDNA 1R3SA 3OJGA 1BPLB 1N5XA 4X0NA 4IQJA 1GRAA 2GJNA 3PVFA 3A5FA 3PZTA 3IJ7A 2WKLA 5TQLA 4J57A 4MWAB 3JW7A 3C0LA 3T8QA 1VPYA 4AY8A 1MQQA 4N6FA 1TE1A 4EMIA 5DRIA 4X63A 4DLFA 1VENA 1ECEA 2CYGA 2DZPA 3MI6A 3MCMA 2E6YA 2PRHA 2MANA 4L4PA 3TNOA 1AODA 1Z42A 4YLWA 1JGIA 1IEVA 1LBMA 3VPLA 4WRHA 3SO7A 2GOKA 3W7PA 1JR1A 1TIWA 2A6LA 4IIGA 1M6IA 1V3MA 2XTKA 5BNKA 4B5NA 1VKFA 3WK2A 3DFQA 4UFIA 5ABFA 1PTDA 1ZDLA 2WPGA 2PEVA 4HVXA 4JBRA