3QKEA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
403
structure length
397
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVAYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Cystal structure of D-mannonate dehydratase from Chromohalobacter salexigens complexed with Mg and D-Gluconate
rcsb
source organism Chromohalobacter salexigens
molecule tags Isomerase
total genus 151
structure length 397
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2011-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3qkeA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3qkeA01
3QTPA 3N6HA 4HNLA 5J04A 4E8GA 1TKKA 3DG7A 2PU0A 2XH4A 4A3RA 4DHGA 2OZ8A 3U4FA 5BOEA 1E9IA 1KCZA 4J1OA 4DYEA 3P93A 4M0XA 2QJJA 2PODA 1MDRA 2PTWA 3RRAA 3UJEA 4GMEA 4IP4A 3GD6A 4E5TA 3QLDA 3R25A 3GY1A 4HYRA 3UGVA 2PGWA 3BJSA 1IYXA 3UJFA 3SSZA 2AKMA 2XSXA 2PSNA 3GC2A 2OVLA 3H70A 3Q45A 4ROPA 3QN3A 1BQGA 3I6EA 3STPA 2OFJA 4K1WA 2PMQA 2PS2A 3TWBA 3MSYA 2AL2B 2RDXA 2GGJA 4K2SA 2QDDA 1KKOA 3R11A 3R0KA 3MY9A 4DX3A 3MUCA 1FHUA 4MKSA 2QJMA 3TJIA 2GGEA 3N6JA 3UJRA 3TCSA 2ZC8A 3PWGA 2XH2A 4HNCA 3CK5A 4IP5A 2OZ3A 2QDEA 1YEYA 4DWDA 2ONEA 3DERA 2OG9A 3U9IA 4GYPC 3S5SA 1XPYA 3DESA 3UJSA 3IJLA 1JCTA 1WUEA 2HNEA 5FJUA 3N4FA 4GFIA 3ZVHB 3TOYA 4JN8A 4ZCWA 3D46A 3V4BA 5ENLA 4GGBA 2GGGA 2QJNA 2PP1A 1MUCA 1BKHA 1P48A 3VCNA 3TJ4A 2PTZA 2AKZA 4H1ZA 2QGYA 3FJ4A 3SN0A 4FI4A 1SJDA 1SJCA 4ENLA 1WUFA 3TWAA 3T4WA 2QVHA 2P3ZA 4GYPA 2PCEA 3UXKA 2GGHA 4HPNA 1ELSA 3CB3A 2OX4A 4HCLA 2OQYA 3D47A 4GIRA 1L8PA 3MKCA 3FV9A 3VC6A 3OW1A 1EC7A 1FHVA 3MZNA 3RGTA 3RITA 2MUCA 3RO6A 3H12A 3UCDA 3JW7A 3CYJA 2ZADA 4G8TA 4DXKA 4E4UA 4K8GA 2PPGA 3ZLGA 3NFUA 4X2PA 5FJPA 3ZLHA 3TQPA 3T6CA 4MGGA 2PP0A 4E6MA 3BSMA 5BOFA 5FJTA 5IDZA 3OP2A 7ENLA 2GSHA 3NXLA 3IJQA 4GGHA 2PA6A 3SJNA 3DIPA 6ENLA 3PFRA 1MRAA 3ES8A 3N4EA 3CXOA 3FCPA 2OLAA 3OZYA 3UCCA 1R6WA 1DTNA 3JZUA 4KPLA 3R0UA 2P8CA 1EBGA 1OEPA 2OPJA 2FYMA 1EC8A 3FXGA 3OTRA 3PWIA 4H83A 3T9PA 2HXUA 1W6TA 2O56A 4KT2A 2P0IA 2PGEA 2POZA 2XGZA 3R1ZA 3ZLFA 4M6UA 3R10A 1KKRA 3V3WA 4IL2A 1MDLA 3SN1A 3V5CA 3EEZA 1ONEA 2HZGA 3OZMA 1EBHA 3MQTA 1XS2A 3K1GA 3I4KA 1F9CA 3T8QA 2AL1A 3NO1A 4H19A 4KEMA 3VDGA 1NU5A 3KUMA 2FKPA 3SN4A 3P3BA 3B97A 4H2HA 3MWCA 3DGBA 3FVDA 3I6TA 3DEQA 3DG3A 2PTXA 3Q4DA 3ENLA 3VCCA 2CHRA 3SBFA 2DW7A 4A35A 3PK7A 2DW6A 3OPSA 3UXLA 1KD0A 2GL5A 1JDFA 4F4RA 2GGIA 3P0WA 2AL2A 3SQSA 3S47A 2QQ6A 3DFHA 4E4FA 4DN1A 4HN8A 3QPEA 4HCHA 3UJ2A 4FP1A 3FYYA 1ECQA 3H7VA 1JPDX 2GDQA 3VA8A 3V5FA 4JHMA 3NZGA 3BOXA 5FJOA 3VFCA 5EU9A 2OKTA 3TW9A 4JN7A 3DG6A 3DFYA 1SJBA 3H8AA 1P43A 2XH7A 4G7FA 4MMWA 1RVKA 4J3ZA 4GISA 3QKEA 1TE6A 3ZVIA 2MNRA 2XH0A 1MNSA 4Z1YA 4IT1A 3ZVHA 4IZGA 2OQHA 3DDMA 1EC9A 3HPFA 2OZTA 3IJIA 4ZA0A 3CT2A 3EKGA 3JVAA 2HXTA 4Z17A 4EWJA 3GO2A 2P88A 4IL0A 3THUA 3IK4A 3ES7A 1PDYA 4HCDA 1R0MA 4A6GA 1NELA 3RR1A 1JPMA 2PU1A 3TTEA 2NQLA 3VC5A 2OO6A 1TZZA 4YWSA 3RCYA 5FJRA 4KWSA 1PDZA 4IHCA 3CAWA 2PTYA 1SJAA 2PP3A 2P8BA 2I5QA
chains in the Genus database with same CATH superfamily
1QNOA 3E2QA 1STZA 3VMOA 1LOSA 1GOOA 1NOFA 1UH4A 2ALRA 1A4MA 2OZ8A 3L5AA 1OINA 3V0TA 2V5BA 3ABQA 3ITCA 2GOUA 1N8IA 2DDXA 4PE8A 4H7CA 1MDRA 3B0XA 1FFUC 1O5RA 3TK7A 5AZ0A 5TR3A 1BVNP 3SCQA 1UKSA 1XCXA 4IMGA 1GEHA 2WPGA 1MW1A 4H4TA 4M3PA 4IIHA 2PDFA 3G1YA 1GJWA 3N2TA 1GTHA 1RV8A 5HJYA 3ITVA 2XSXA 1R7AA 3VIJA 1UWUA 4DYJA 1K8YA 1DE6A 1M7OA 1GESA 4F9DA 1OCBA 2F6XA 3EGJA 3W72A 3HA1A 9XIMA 2NWSA 2FJUB 3FA4A 5A8GA 4HU8A 5EFDA 1UD4A 1UR2A 3VZYA 3SQPA 3MBDA 2CBJA 1P6WA 5DT7A 4BK9A 5AYIA 4QIUA 2YDQA 1PTDA 3VXGA 2Z2BA 2BGSA 2X2YA 3MMDA 2WNNA 1VIWA 4JFWA 3URAA 3WSUA 2V82A 1JOAA 3PWGA 3ALFA 3L67A 3BANA 4JDBA 5A6JA 4GC4A 2ZRVA 2AQOA 4D72A 3RU6A 2IQ0A 3THCA 1ZZMA 2F38A 1XX1A 3OZPA 1XQKA 5E5CA 3AIVA 1CGWA 3HFYA 3M9YA 3C2EA 5C54A 4IMCA 5BU6A 4QQ3A 2HNEA 4DUWA 2VWSA 2OTDA 2VDGA 2YBUA 4GFIA 1OK4A 4JN8A 4ZCWA 3F4DA 4CU8A 3OOQA 3JR2A 1E55A 1U1UA 1XDMA 5AC8A 1J5SA 3PAOA 1WZLA 1BYCA 4W93A 5HJLA 2ZX7A 2QCNA 4TMBA 4X0NA 4QQUA 4JY9A 4MNLA 2YA0A 3VABA 1LL7A 1Z9AA 2QPSA 4AIEA 3CAKA 3M5XA 1V93A 5CGMA 1NPXA 3LXDA 1R85A 2NQJA 3U2OA 4ZOCA 4J40A 1ELSA 3B9NA 3D47A 4LH8A 4GIRA 2QGHA 1OG6A 5AHIA 2PWFA 1ZBWA 5DT5A 4CNPA 2Z2AA 1UG6A 1Q4WA 2J66A 4UUIA 1FH8A 4DZIA 3S9IA 5FMHA 2FDSA 1OYBA 5LIKX 2ZADA 4DXKA 4ONVA 1EXPA 4IMEA 3EANA 3ZLHA 4F0MA 1D3GA 3RUBL 5ABTA 5LSMA 1OY0A 3FNDA 4GVIA 2DT3A 3U6WA 3CHDA 1J5TA 1NHQA 2ACQA 4KCWA 2QAFA 4IQEA 1UPMB 1Y0EA 6REQB 1A3HA 7ENLA 2JGYA 3LM3A 4GD0A 2Z4GA 3VNJA 1H7OA 4AX6A 1SPQA 3U57A 3RDKA 1E15A 2IMRA 1R6WA 2A79A 2QV4A 5IFTA 1GKRA 3OIHA 2JFEX 2WV8A 3M43A 4C7FA 1WCGA 3VD4A 1FEBA 4PCFA 3H2EA 1QNRA 4EAMA 4FX9A 2XTKA 4O1EA 4DWSC 2ZXAA 2UBPC 1RJQA 4R34A 1AQFA 5I3DA 5IHSA 2P0OA 2WLZA 4WKHA 2PC4A 3VKAA 2V2DA 2IQDA 1EWDA 2PDIA 1JYVA 4X60A 4WRHA 5HNNA 3SN1A 1TTQA 3W2UA 1R9YA 2J75A 1QI3A 2X16A 4AD5A 2XIQA 1UWTA 1P6BA 2GWGA 3E49A 3PR2A 3I4KA 1WV2A 4E8DA 3E12A 4D1JA 3GXTA 1CGXA 4U31A 4DNMA 4N9DA 5FIPA 1LWIA 3P3BA 1SFTA 2X50A 3RPMA 3MWCA 1W9BM 4AD0A 3TYBA 3K46A 3AALA 4F66A 3W86A 2PTXA 3FGCB 1ZLPA 4ICCX 4UWMA 3T4CA 5HAOA 4J3TA 3UWVA 3RLVA 2FGLA 5I7GA 2Z0IA 3N12A 3R07C 4I5RA 2WHMA 3B0PA 4HSOA 3R8GA 4DPPA 1D7KA 4S23A 4AZIA 2G3JA 4FLRA 4EWND 4XIAA 3BOFA 1GJUA 4WUIA 3GBEA 1E6PA 2EPMX 5G4HC 2D3NA 4LPCA 1RY8A 4DF0A 2ZUUA 1KR0A 1IIHA 4PRRA 2I9UA 1TO3A 3N3MA 1KFKA 1KTBA 2AAQA 2E6DA 2RH9A 4NEWA 4S38A 1B5TA 2J6XA 4MNMA 3LXCA 3TZNA 1V6WA 4WXZA 4UZSA 1FA2A 3LLDA 3W7CA 2W62A 3PUGA 3VOGA 4PRWA 1DP0A 4RXGA 1EA0A 1Z41A 3NUKA 2Z1BA 1ZU8A 3HPFA 2Z1VA 2Y7GA 2GJXA 1LT7A 3ECQA 3NVZB 1EH9A 3D3AA 4FXJA 2VX6A 4Q3MA 4F0LA 4JYDA 3AAMA 4DIAA 4A3HA 5HMEA 5I3FA 3ME3A 1R0MA 3E0VA 3UA3A 5EYWA 1S5WA 3A3WA 1G5AA 3W7PA 2Q01A 5FJRA 4IMDA 1JEHA 1UWSA 1W3NA 3QF0A 3UG5A 1N60C 1HF6A 1D9EA 2OSYA 4DWSA 4DUOA 2DJXA 1H61A 4DO6A 3BTNA 3CMFA 4FOJA 2I1OA 3GHUA 1RK6A 3WQVA 3NCOA 4HBKA 4C6CA 3DOPA 5J04A 4WQ6A 2J24A 4D6HA 3TDFA 1QBBA 1FWIC 1RLCL 3TN5A 1SSGA 1ZALA 3GAYA 2PRMA 3G5EA 3UPMA 4JTGA 4UNKA 1KBBA 1KNWA 2F2HA 4NZ4A 3NL6A 3WFZA 2P1FA 1IXQA 5A8OA 3M64A 2DVTA 2PDJA 1UP2A 1OYCA 2PDKA 3EX2A 2HSAA 1RA0A 3R58A 1EWEA 4O13A 1ECEA 2GUYA 3VNKA 4QE4A 3BJSA 4YVXA 5D02A 2EAWA 2W27A 3DYPA 3ITGA 5D9OA 2PTDA 4BKNA 4AZGA 2DV0A 3UZJA 2FVLA 4MB5A 1LBMA 1FWDC 1VYSX 1AZ2A 1VZWA 3M16A 1PBGA 1QO2A 3GHRA 3CGEA 1UQYA 1OD8A 2J47A 1BTMA 2FFCA 4YL2A 3V18A 5DN1A 1XHCA 4KEVA 2J77A 1VYPX 3MI3A 2BXVA 1XSJA 2R14A 1FWBC 1EOMA 3LXBA 3FKKA 5K9CA 1ZBKA 3W3OA 1H5VA 4CEUC 4BQ5A 2W4XA 3A47A 2A3HA 3AIUA 3LEPA 2YBTA 4YYFA 3CH9A 3G1DA 5AY7A 2A3LA 4JR5A 5HWNA 4IP5A 3GQYA 4Z42C 1GRAA 1E6QM 3KVMA 1A5AA 1LROA 1YEYA 4GZJA 4K1GA 2QMKA 2GJPA 3IIXA 4IGSA 1K8CA 1Q63A 1HTIA 2O4QA 5DCBA 2QAEA 2ZXBA 5LHFA 3UJSA 2WP5A 2ZUNA 3R7MA 3N1AA 3LXAA 3S46A 1Q1WA 1SQ7A 3MPGA 7ODCA 3AHXA 5D2TA 3TOYA 1WDDA 3I10A 3GX9A 4HNUA 2WHJA 4G6CA 1EKOA 4GGBA 4Y7EA 4P7OA 1V3IA 1AW1A 4DBEA 3VCNA 1V3JA 1JGIA 2OT1A 2BS9A 3CQ0A 1XGDA 3SN0A 2NXGA 2HDJA 3BUVA 1VAHA 5AN7A 4Q8WA 1WA3A 4ERIA 2ZWZA 3SIZA 3KE0A 3QMSA 1L2UA 3T4WA 2QVHA 2VFGA 4FX8A 2TRSA 4D6IA 4GYPA 1IEWA 2WCAA 1C29A 1SR9A 3LUTA 4HOWA 3GUWA 4L7ZA 3QC0A 4TOQA 1XDIA 4QAWA 1KBKA 4RDZA 1XLCA 1KW1A 4XTIA 3F7JA 3SCNA 4LUSB 3W4RA 4P8WA 3E5BA 2I9EA 1EQPA 4ACZA 3RXZA 3RGTA 2XM1A 2VR5A 3CUJA 4H9YA 5LA1A 4G8TA 1AA1B 2GVJA 1XI3A 4LXFA 3XISA 1XWYA 1U5VA 4M19A 3AS1A 5FJPA 1XBYA 4CQBA 4EQRA 3NO5A 4KRZA 1Q5MA 3DK8A 1PV8A 6A3HA 1VBJA 3GRSA 3ID7A 3MU7A 5HWMA 2IKIA 1SFLA 4A3YA 4QS5A 1XDLA 1UC5A 4MZYA 4D6JA 2XN0A 4GQBA 1WDSA 4CNTA 1VFHA 2VELA 4RUBA 4W8AA 3I3EA 4W89A 4O8AA 2DT1A 1DTNA 1X38A 2H8ZA 1GCYA 3BICA 1A49A 1OFAA 1TB3A 3H26A 3PWIA 3UR8A 4JAWA 3T7VA 2I14A 1W6TA 4KT2A 4GQRA 4AZCB 3QGKC 5U7SA 3GDMA 1W1A1 2JF7A 3W6MA 1EL3A 3KBNA 2GQ9A 4IPPA 4UOQA 5A8MA 1VC4A 4O52A 5E09A 1PEZA 4HA4A 3RM4A 3OA3A 1QNPA 5H1WA 4LNYA 2A0NA 3MZ2A 3U7BA 1VRDA 5FJIA 3HURA 1A5SA 4LUIA 3ANUA 3L23A 3VILA 1JRCA 3ZFHA 3SW6A 1LBFA 1IR2A 4H2CA 3R94A 4KEMA 4JYFA 5FSDC 2XFWA 3KUMA 3A9BA 3QVQA 4QLKA 2HPMA 4H2HA 3DGBA 2A6NA 3NZRA 1ZPTA 4RNFA 4O0QA 4M56A 5JMUA 2NPXA 1BFNA 1JCJA 3CH0A 4IQDA 2PURA 3BARA 1HJXA 1TV7A 1W0MA 2GGIA 1W3HA 2AL2A 1SMAA 5I5RA 1SB3B 3WF4A 2ACUA 4E4PA 5C8BB 4S3FA 5FI8A 2Y5EA 3OVRA 2EJAA 4DN1A 4YYCA 4MLRA 5F1UA 3W24A 3UZXA 3UWZA 1LORA 4FMVA 3G8EA 4JNMA 4Z1DA 2Q8XA 4TTGA 1EOKA 4JHMA 1W31A 4PUKA 4AZ6A 3AM9A 3W1PA 5G1MA 1I0DA 4PBFA 4ZB2A 3ZJ6A 4EK7A 2WB5A 3P0XA 2VZUA 2NZLA 2C3CA 1VRXA 3AXKA 4G7FA 4PSRA 3THQA 1J4EA 3GKAA 1VCGA 3QKEA 3H2CA 3T2PA 1R7OA 3MV11 3QPZA 3DH9A 4OHQA 4WX2A 3LERA 1K9TA 3N34A 2W63A 2V3EA 3IJIA 2ZZ0A 2Z00A 3TFCA 3EKGA 3VNIA 1Z7AA 5CXPA 1XIDA 4JHZA 1LG2A 4F3HA 1A5LC 4AC7C 3W76A 3WH8A 4UMCA 4JD4A 5IFPA 3ES7A 5CC3A 2E9MA 3RR1A 3Q37A 3FHQA 4YWSA 3KL5A 3WD4A 3ZJ7A 2I5IA 4ZO7A 3PB0A 1SZFA 4JIHA 1S2VA 1QW8A 1A50A 4HD5A 3ITYA 2CFYA 1XJBA 4NAFB 1F3XA 4NXSA 1BYDA 4DRSA 2DZAA 1FBAA 3KLLA 5EBAA 2ZIDA 4CVWA 5JCLA 2EQ9A 4NU7A 4OKDA 1PL9A 3CZ8A 1N7KA 2OEJA 1UYQA 1XUUA 4UTTC 3WQGA 4L1XA 1OJTA 3MSRA 3Q67A 2YL5A 1EGVA 1VD6A 5CBIA 4DYEA 3WEZA 4KCTA 3ALGA 2YCJA 4UOZA 4KCVA 5DMLA 1Q6EA 3KTCA 1Z8AA 2EPKX 2J13A 3MVIA 2X1TA 4HSHA 2A4AA 1OBAA 1LT8A 4ZOAA 4WOZA 3GY1A 4HYRA 1AMKA 4CQ9A 2XVLA 3A12A 1GRFA 2B7QA 6PTDA 2ZCGA 4LBRA 1DJYA 2BGNE 1ISVA 1J0HA 4JIQA 1IEIA 2PDUA 3N29A 1KA9F 5IHRA 3PC0A 1GOQA 4DM2A 2Y89A 3M0MA 4C6LA 2VEKA 1Q7MA 2GGJA 4ACZB 3A3XA 4IM4A 5IBXC 2C1GA 4R53A 1W3KA 3BLIA 3KEHA 4M24A 5HMDA 3GIQA 2OMAA 3NQFA 1CB7B 4FXFA 3OODA 1A5OC 2J7BA 5BXTA 3NIYA 3Q2DA 3SURA 2E67A 1XYAA 3GR7A 1XUZA 3U7VA 4U2YA 5XIMA 1NHPA 3CQIA 1YLVA 1TJ2A 4XAFA 1KXTA 4H41A 1G4TA 1UKOA 3KM8A 1XIGA 1A47A 1ISXA 5H6HA 5A5WA 1U5HA 2Q3RA 1M04A 3QW4B 5C9UA 1MWOA 2NX1A 3OA5A 4NZ1A 4GJIA 3W1TA 4CKQA 1XPYA 3QXBA 1QW9A 3C5QA 3DJGX 4XWUA 3LADA 1HKJA 2OKOA 1NVMA 1WUEA 4H4VA 3WDQA 1CCWB 1GQJA 1OG0A 3AC0A 2YFOA 3NXFA 4FDCB 1UW9A 3A9IA 2WBGA 2WM1A 2EG7A 2E8YA 3QMRA 3WLMA 3NTYA 4PMRA 4AYGA 4IIEA 1T5AA 3AHYA 4JFSA 4GQQA 3BLPX 3DC0A 3NQDA 4RE4A 1L8PA 1E0UA 3W2KA 3FV9A 2CXGA 1BGGA 3BW3A 1KBJA 1QRQA 1JUEA 1DWJM 4LYKA 4QNEA 1E56A 2V63A 1QO5A 4D6FA 2F9RA 1VPXA 4Y8EA 3DFOA 6ALDA 2OOFA 2DUXA 2G3FA 1EJXC 3QW3A 2CIPA 3LCFA 3D0CA 3ZLGA 3GZAA 3EWZA 1K77A 3PF3A 3PS7A 3DYOA 4HZ7A 3TQPA 3WDHA 3WJWA 4MGGA 2C71A 4O54A 2F7FA 3EMQA 2DU2A 2Z28A 2UZ9A 3ABOA 3GSMA 1OWQA 2CBUA 2EQDA 1R47A 4UC5A 4QAIA 3IJQA 3K4WA 3HMCA 4HSNA 4JYEA 4LQ1A 5BOOA 4AD3A 4FA3A 5C0QA 3T8LA 3QR3A 1N2VA 4PA8A 4MY1A 1MUMA 2ISSA 2FMOA 1OEPA 5M3WA 3W1AA 4H4ZA 3LY0A 3UR5A 1YADA 3W53A 1UA7A 6XIMA 1EXBA 2HXUA 1J96A 1W2VA 2BDQA 3W7MA 3OBKA 3CAQA 1MQPA 4DXVA 5IBXA 4L56A 3QGAC 2R6OA 2ZOXA 4US5A 1VFOA 1MDLA 4HT3A 4I9MA 4MB3A 3HOJA 1W17A 3LOTA 4GHRA 2RHGA 3QR1A 3KS5A 3EEZA 4GFSA 5L9FA 3L2MA 4GRTA 1EBHA 3TIMA 3AJ7A 2OODA 1S3HA 2CKSA 1F4AA 2R1PA 4YU1A 2XM2A 4AWEA 1T3QC 4HIBA 5BU9A 1JZ4A 2BOGX 3TC3A 3E1F1 3B97A 4PTDA 3M0LA 4JHOA 1UWQA 2Z7KA 1EO7A 3LCLA 2XSAA 2VZTA 2QXWA 4HK6A 4JX4A 3HBLA 1ZY9A 2RDUA 4KS0A 1RXOB 4HJFA 3LPFA 1XRFA 4J5NA 3W1NA 3LI1A 1RVGA 4CCZA 4DUVA 3MHFA 1LYXA 2C1IA 1NDVA 2BC0A 3B0VC 1FWRA 5LIYX 4XZMX 5M1TA 3RX2A 3G2GA 4XBKA 3F5LA 2Y7FA 1PZ0A 1ZAIA 2W0HA 4AVFA 3VOCA 1KRMA 2J62A 3G0XA 5EMLA 3O06A 3QPEA 4HCHA 3WY1A 2PLJA 3HPSA 1DE5A 3UJ2A 4FO4A 3N2MA 3HM7A 1H7WA 3U4AA 3V5FA 4ERAA 3WQ5A 3L4ZA 1H63A 2Z24A 1AD4A 1TVLA 5CZKA 8XIAA 1G1YA 3DX5A 4XZLX 3PZTA 4A2SA 4MMWA 2GR0A 5FEWA 2VQTA 3M0XA 2WBAA 1GXFA 3OQ8A 1GQLA 2HCVA 2O92A 4CQDA 4A21A 1RA5A 1VHCA 1VFTA 2YYUA 3I7RA 1ISZA 3VD7A 1OYAA 2MANA 3CT2A 4AQLA 4QSHA 2HXTA 4GBUA 1NFBA 2UY5A 1WZKA 4PGLA 3I3DA 3DXIA 4NKCA 1J0IA 3WZ0E 3BC9A 1EZWA 1VDVA 4R7JA 3CT7A 4EANA 4YTRA 4Q8QA 4A6GA 2P50A 2PU1A 3LA4A 5E6ZA 1W3JA 1G01A 1PDZA 4GIAA 1CNVA 4PB4A 4NJJA 4O0KA 4ACYA 3VOFA 4QR6A 3S5NA 2G3NA 2G3MA 3QTGA 2PP3A 2IKHA 3VPLA 3CXBA 3PJTA 3AIEA 5I3HA 3N6HA 4XO7A 4YJ5A 2WKLA 2PU0A 4N02A 4EVZA 1PKMA 4XZHA 2GQAA 1WQ5A 1I75A 3VNMA 4AY8A 3TTQA 1ZX9A 3NAVA 2A7RA 1XIEA 4GUFA 2C15A 1S38A 4CVUA 3GVRA 4XK2A 3AMDA 2OQLA 4O17A 4QBXA 1KM5A 3Q6JA 1XLBA 1GT8A 4LBSA 4EMIA 1F05A 2V67A 2FHFA 2VMFA 4UFKA 2QIIA 1L2QA 3CWHA 1MVYA 1DQUA 3ZO9A 3UQNA 2WMIB 1H4PA 2XG9A 1DKWA 1F8IA 3MSDA 4QHRA 4ZFMA 4LUJA 4PL2A 4IWWA 1B54A 4D6GA 4HMDA 3VDCA 4BA0A 1KLZA 4KETA 5CC6A 2ZTKA 4FIRA 1FO4A 3IC9A 5CAHA 1BAGA 1RQHA 1MEWA 2EO7A 2ZZBA 5HR6A 1J2WA 1IGSA 3ZQ9A 4HTYA 4V33A 2BXYA 4O57A 1H7PA 3A7AA 4WDUA 1ADDA 2Y8VA 1OVDA 3CEPA 2ZWYA 3I4EA 3SM0A 5M5DA 2FDMA 3HG4A 2VRJA 1E0VA 4XVEA 4HZ8A 4O4VA 4XZ9A 1CXHA 1H62A 4C6JA 4FK9A 3MJYA 4WDTA 2OZ3A 3NDYA 5C2CA 2ABBA 4QFUA 5D38A 5EMKA 2QV5A 2R82A 3SCVA 2HBVA 2EGZA 1WXZA 3RF9A 4UQBA 2ODOA 4QCEA 3MDUA 1OHLA 1GYNA 1NEYA 1JPHA 1GRGA 1M03A 1LDCA 4HA3A 2DUZA 3WK2A 3P6LA 3UPBA 4QE1A 4QJ4B 4LV9A 4UFIA 4LUYA 1JQXA 5ENLA 2GQ3A 1X1ZA 2QJNA 4L80A 1Z89A 1AL7A 4RR4A 3WJYA 1RCOB 3TC6A 3VD5A 2ATMA 3ARUA 1GEQA 2BLEA 1SJCA 4O1DA 3ZSTA 4XTDA 3IJ6A 3TCEA 2GUUA 3II1A 2V68A 1J0KA 2FB3A 3CB3A 3HMJG 1W9PA 2W66A 1Q6CA 2VZOA 2QNEA 4MDOA 4HU4A 4B15A 1FH9A 1R3TA 2IXVA 1F6YA 1GW1A 3UWQA 3VGBA 4DXXA 3NPWA 3DFPA 4L65A 4NY2A 3WBXA 1TJPA 5HNTA 4REQA 5G5HB 3WELA 3AMLA 4F2UA 1TWDA 3NQCA 3AIRA 3PUDA 4Q6JA 4Y2WA 2WOIA 5CPQA 3U2CA 1QK2A 5C55A 3WMBA 3SCWA 3W9ZA 2OEKA 3N04A 1UPPA 1W5OA 3VKKA 1JR1A 2ICSA 5DMMA 1HIZA 2GWNA 2ZUVA 1Q45A 5IOBA 3FA5A 3GS6A 4NF7A 2YX0A 3AISA 4UR9A 2TSYA 3I65A 3W2NA 2CLEA 3NXLA 4KKXA 1Q65A 3V0UA 2RAGA 1E0WA 4JCMA 2DQWA 3FCPA 3OZYA 5AYZA 3UCCA 1UBPC 3ARPA 3VM5A 1DTUA 4D2JA 3GXMA 4BF9A 2QJHA 3A3HA 3GDLA 1AVAA 2VEFA 4H6KA 1W2PA 4MKVA 2O56A 4C91A 3NPVA 4PUEA 2WJEA 3BAXA 4AF0B 1KFJA 2ZYFA 3GK0A 3B8IA 4KBXA 3T08A 4AIBA 5T9BG 3PTMA 3LX9A 2QPUA 1E5JA 4Q4RA 3OQEA 1CEOA 1KRAC 3IWPA 5D09A 3TYDA 4F2BA 5CLWA 5HOSA 1A5CA 4S3DA 4DJFD 1QK0A 1JDEA 1XS2A 5HINA 4GABA 3UF9A 2V81A 4PCNA 1XSIA 2PFHA 2INEA 2PAJA 3TUUA 3QZ6A 4CN1A 4HOXA 2GR2A 5J5RA 1T7LA 1TZ7A 5A1AA 3VIIA 1VJIA 4BHYA 1ZQ5A 2CHRA 5LIWX 1Q85A 3IJDA 1QDSA 3RR4A 1TZ9A 1JDFA 4GXPA 1B4EA 2PCQA 4WKAA 2X1IA 5EMUA 1X2HA 2ZZ5A 2QCDB 2X0HA 1GSNA 3VDHA 2DJLA 1MMFA 4NILA 2Y24A 3AFBA 1HJVA 4JTSA 4Q8VA 3ETRB 3KTSA 2QVNA 2BHUA 4O1FA 1J93A 2EKGA 4DYKA 5ABFA 3QZAA 4LYQA 4O1BA 5HMSA 3LG3A 1XANA 1UR1A 5BROA 2D0GA 5RUBA 3UWEA 3C4UA 3UG3A 1DWAM 1CDGA 4HHHA 4MNKA 2DT0A 3CZKA 2DIJA 4GISA 3N19B 1R9XA 4K68A 4BV6A 4IT1A 4PR4A 3TW7A 1B9BA 1VBGA 1S2UA 3B8DA 1D3CA 1QVBA 2XGIA 3ZXWA 3T07A 4URIA 3GXFA 3CU2A 4HPGA 1GORA 4U3CA 1HJSA 4ZENA 2VGBA 4V27A 3PY2A 1F3WA 2ADAA 2VFEA 3L5MA 1GK8A 3S6OA 1GZGA 3M5YA 5CZTA 1IZKA 5BXSA 4ASTA 4ATDA 1VFLA 3WK3A 5KZ6A 4TVDA 3TQKA 2X99A 5HUOA 5CGQA 3L0KA 3LLFA 4Q4KA 5JIWA 4W8LA 2PZ0A 3GVWA 3UW6A 2INFA 3SDOA 5FF2A 2PODA 3UWYA 3AS3A 1L6YA 3E0LA 3RRAA 3OLGA 2J7DA 3UGVA 2C16A 4M6VA 1NOWA 3L66A 3O8AA 4MVAA 4LRTA 1GQIA 4B5TA 2XFRA 2WANA 4LBUA 2C6QA 1EPVA 1O5QA 1Q6QA 2E3ZA 3HGJA 2CITA 4EACA 3C61A 3MSYA 4FOKA 3RRXA 4NYUA 4XBSA 1MXSA 2BFGA 1NIUA 2PLMA 1K6WA 4REQB 2QUNA 1MXDA 4B9YA 1DOSA 1IR1A 1H7XA 3CUGA 1R46A 1X8CA 3AO0A 2E6FA 4RE0A 4UZUA 2J8FA 3IVUA 3P60A 3QY6A 3DK4A 1J9YA 1UKTA 3W02A 5HPOA 2XIOA 3AMGA 3GDTA 5I79A 5JH2A 4KWVA 4OBTA 1VH7A 3E2VA 4ML9A 4X0VA 3MMWA 4R7WA 4PMJA 5ECVA 1ZRQA 4I7VA 1M7XA 4GACA 1ZXIC 3F2CA 5D03A 2XJ7A 4ZOHB 2R8WA 3FJNA 3EYPA 4GRSA 3IUHA 1VBRA 2E09A 2P5NA 1HKKA 3O3RA 4DNAA 1G4EA 5AHNA 5DQPA 2BP1A 4QE5A 3SCUA 4POCA 4XUGA 2PI6A 1FVPA 3W83A 4FI4A 1YNQA 4HA0A 4EPBC 1EJUC 3SR6B 4J4KA 3GD4A 3MKKA 4U2ZA 1JYXA 4RDWA 5LYRA 5KZMA 2J7EA 1JCMP 3KRBA 4CNSA 5I78A 3VM7A 2P3ZA 4ADWA 3B04A 3QYSA 3EWDA 4F48A 1HUVA 4V2XA 1H0IA 1YE4A 1W1B1 5LNRA 5F7UA 5EBKA 1P0EA 1DORA 3OU8A 4H4WA 5FKYA 3QV7A 4GH3A 1Q13A 2PGFA 3NGFA 4JY8A 2BNJA 1LF1A 3GDRA 3IUIA 1A3WA 2MUCA 1RHCA 1T8QA 4F0KA 3BK0A 4L5ZA 1QWGA 4Y9AA 1S5MA 2BOEX 1AW2A 4BF7A 4C6MA 4GLEA 3SZ8A 2FZDA 4NVTA 3TC7A 3MYPA 2PPGA 5A6LA 1JDDA 5JRBA 1DL3A 1VPYA 1KCKA 3NFUA 4UTWA 3TXVA 3MV01 4WJ8A 3EX4A 1SUXA 3OO2A 4C90A 1BSIA 2PP0A 2PWEA 1XM3A 1OFQA 3W7JA 4QTGA 4XD6A 5A8QA 4GZIA 1OC5A 1ZJHA 2OWWA 4C60A 3RN6A 1DJGA 1CXIA 1RPKA 2GVEA 5GJPA 3RAOA 4LF2A 1LLWA 3MW7A 1GPWA 5I07A 2OPJA 4IP7A 4A8NA 4H8NA 5HDRA 3SGUA 1RM6B 5A8PA 3TJXA 4MJ2A 4PTVA 3RCMA 2EPOA 1GJPA 3G1XA 2Z25A 5LXXA 3WLHA 1BZLA 3CV2A 1TIWA 4ZVJA 3VZXA 4OUIA 4RJEA 1QI0A 4MZ8A 4CD6A 1QUMA 3GHSA 3CTTA 2E7FA 4ZXOA 1I6NA 3AI0A 2WMJA 3V5CA 3RM8A 3OC4A 3BAKA 4B92A 4QP0A 5AHEA 4I9JA 5A69A 2ZKMX 3NOEA 1HKWA 2AL1A 1CENA 4MFEA 1I0BA 1O66A 3AJXA 4PUNA 4H19A 3VDGA 1GVRA 4G7EA 1E1CA 1SO3A 1IZJA 5I03A 2Y63A 3M7WA 1WOBA 3EB2A 1F8MA 3NZPA 1UWRA 2F6UA 3S2CA 3QMTA 3C2OA 2D20A 1S2WA 3SUTA 1DYSA 2A3CA 1UH2A 2KX9A 4ZO8A 5REQB 4A35A 3AYRA 1E6ZA 2X1SA 1BWLA 3A7RA 1XINA 2VVSA 2VEMA 1UKPA 1X39A 1CZ1A 3KW3A 1M9HA 2BXZA 3BWWA 3LLXA 4IG2A 4RW5A 5FAGA 5AB3A 3WF1A 3IPWA 2JIEA 2VCCA 5A6MA 1SGJA 3ARXA 1M7JA 1ECQA 2CLOA 3ITTA 2WVVA 1JPDX 2ZZ4A 3BURA 1N8WA 4QRNA 1ME8A 3BJTA 3E74A 3MYOA 1W1PA 4B3KA 3VGDA 3VFCA 2WPBA 4M52A 3KOYA 4Q22A 3KDNA 4OECA 4NZJA 1V0NA 2F84A 4B5UA 2G41A 3FG2P 2XZ9A 3B4YA 1LL6A 3WJSA 1TJRA 2OGYA 1UCWA 3H8AA 4NUWA 3HQ1A 3FFSA 2A85A 2BVTA 3T05A 3TAOA 2L5HA 3CUZA 5HBFA 2VD8A 2DP3A 2W3RA 5TQLA 2OQHA 3C8FA 1U1JA 4NJIA 2QCHA 4GY0A 3RM9A 8XIMA 1IV8A 2DH3A 3HF3A 4EPDC 3KBJA 4YVVA 5TBOA 2CWXA 2C1HA 2WSYA 3S6DA 4W87A 1VBUA 3BAJA 2P88A 1AQHA 2W9MA 1M41A 3AHTA 5BRQA 1TYGA 1V4YA 4KESA 2JIWA 4JQAA 5AC6A 2ISWA 4NI8A 2BX7A 1V8EA 1YE6A 3EXTA 2ZRUA 4WY0B 4DJFC 2GJRA 1YNYA 4V1XA 5H8MA 1E72M 2ZX6A 1V3HA 2Y0FA 4B9ZA 3KCLA 3ZMRA 4WCJA 4W5UA 3ZIZA 1HKMA 3GVVA 1KBLA 2PTYA 1GKPA 1XLHA 4MJMA 1J8VA 2BZNA 2I5QA 4N6EA 1EJ7L 3BJFA 5A6TC 2DSKA 3N2CA 1XLJA 2UY3A 4HNLA 1J0ZA 2BG5A 3GM8A 3SCOA 1RH9A 4U5IA 2F61A 3F4WA 1Y8BA 3W88A 3MUXA 5CGTA 2QLYA 4MWAE 5HANA 3WF2A 1XIJA 1W1IE 1G0CA 3BAYA 5LNWA 2W79A 3NPXA 2NX3A 5FF4A 3KVKA 5U25A 1K03A 3UJFA 3WLJA 3C52A 1V97A 2OELA 4E2OA 1B31A 3COTA 2YYTA 2V3DA 2W61A 3N4AA 1UB3A 4IFKB 1OT2A 4FNUA 2PMQA 2BV9A 1XP3A 2ACSA 2BVYA 1E71M 4PCPA 2RDXA 3GBDA 2O0TA 3N2XA 1UZDA 3R0KA 4IIDA 1J79A 4UTJA 2JGQA 3UZ5A 2WSRA 3RLGA 1NP0A 3MTWA 5FEZA 3QZEA 3M0YA 2ZFAA 5EKYA 2ZZCA 1M7PA 3AHVA 4D9PA 4DBUA 3N11A 5JVLA 2A1YA 2A5HA 3OJGA 1ME7A 3MUY1 1SM9A 3AS2A 1P4CA 1GV4A 4LU0A 3NVWB 4MADA 4W84A 3GIYA 4AVNA 4Z2LA 1TMHA 3WH5A 4RZ5A 4MWAB 1FFRA 3OBEA 4WGXA 3ZJKA 3AMKA 1B0IA 4GY7A 2DSZA 3NQGA 1IWPA 3DESA 3GG0A 1TMQA 3H2MA 4HZ6A 1UMLA 3JS3A 3N25A 3NQEA 1Q2RA 7CGTA 4QDPA 1R3VA 3CS2A 3USBA 3P2VA 4ZE5A 3GXDA 3D46A 4W85A 4S39A 2J7HA 5J5DA 4MAZA 4WR3A 1OJXA 3BCDA 3KRUA 2Y2WA 3BGAA 4O16A 2NLIA 4A8IA 3NL5A 5K3VA 3UZZA 1FOBA 1IWBA 1U22A 3W1XA 2XVNA 2XVPA 3UXKA 3A5FA 3NM1A 2WNQA 4BF5A 1XCWA 1HJWA 3NVYB 1UH3A 2CBIA 3EA2A 1IEQA 1RD5A 4UCFA 3GNPA 1P6CA 2Q6ZA 3SECA 4MWAD 3LB8A 1E1CB 3VGEA 3NEHA 3RNMA 1IZCA 2FZNA 3SFKA 4F9JA 4DF2A 2ZA3A 1XC6A 1IE7C 1VP5A 4HYVA 3TTOA 4DLMA 2RUSA 3TEVA 4CD8A 1FWFC 1QPNA 1TYPA 1P0KA 1XH2A 1SU5A 2PLCA 2BC1A 3CZEA 3H7UA 3T6CA 4XVDA 2AMGA 4YHEA 3TSDA 5C7HA 4TV6A 5CJ5A 2DEPA 3NO3A 1QW7A 4GGHA 4XO6A 1GRHA 3TP4A 5CJNA 5E6YA 3N9SA 1EPXA 2Y62A 4JQ3A 4C5YA 3NM3A 4OZOA 4JGDA 4TX6A 5KINA 3NQ8A 4N42A 3R0UA 2SFPA 4HPJA 4PMNA 1C91A 4WSHA 1LM1A 3B8SA 2X7WA 3FXGA 3OTRA 3RHGA 3T9PA 2FTPA 4RNHA 3FSTA 2YLLA 4NAEA 3N17A 3DN5A 1MQQA 2OX1A 1XRTA 3I6RA 3PBVA 1UZ1A 3BGJA 2O9TA 2V3FA 3SCRA 4JTJA 4R9OA 1MO0A 1VFSA 2H3DA 1W3LA 3A64A 2F6KA 5J8LA 5H8PA 2FPVA 3C3NA 3CMGA 4XD3A 2CHNA 1OIMA 2D23A 1O94A 5A95A 3PG6A 4C1NA 4HP5A 2GDVA 2P76A 2JF6A 2X8GA 4WEVX 2VO5A 2A3AA 3CIXA 1EFZA 1ODZA 1P7TA 4G56A 4LAUA 2ZZ6A 4S3KA 5KITA 4HHLA 1AJ2A 2FZ8A 3F1QA 2D2GA 3FIGA 3KDOA 4H9XA 4Q8UA 2PDMA 1TV8A 1GONA 5U4NA 1K9EA 1XRSA 4JIPA 3SUSA 3G6MA 4NQ1A 4B3LA 1OFDA 1W5QA 4LRSA 2YW3A 3G0UA 1WDRA 4IGNA 2ZRYA 3EAUA 4S3JA 2RGMA 4J9JA 3GH4A 3P14A 3NNTA 4X63A 3K8KA 2EPHA 3G1AA 3SGGA 1LP6A 1SFSA 4M29A 3EKZA 3MP4A 1IGWA 4FP1A 3VFLA 3E5PA 3VDBA 4IGMA 2ZRWA 3M07A 3PBMA 5GNYA 1TELA 3W7GA 3WL1A 3EPNA 4K3ZA 1YNPA 4J57A 1R3YA 3F4CA 4BEQA 4R5EA 4KWUA 1FHDA 4IXXA 2ZZ3A 4Y9PA 3PG9A 4AU0A 3ZR4A 4N4QA 1FHLA 3A5VA 4WSJA 1VFFA 3ZVHA 1KWGA 4W9TA 4HNOA 2QS8A 1IIGA 2RABA 1TPB1 4IIBA 2QCLA 4R9XA 4KFOA 2R91A 4W88A 1I2NA 3FN9A 1BTCA 2HE5A 2RJHA 1SZRA 4GE8A 1Z48A 3VIMA 1L6GA 3R89A 6TIMA 1Q7QA 3VOIA 3HO8A 4QG6A 3LMYA 1F6KA 5HMFA 3WF0A 2G4FA 3P61A 1DJZA 1CTNA 3PZUA 2OR2A 4EIVA 4F0SA 3L2LA 4K39A 1UD3A 4O28A 1MUWA 4IPIA 3EF6A 3N15A 1OFPA 1K9DA 1RQEA 5SWUA 3P62A 4EQSA 1PAMA 4DHGA 2PLKA 2GYIA 3WH9A 4IJRA 4ZQNA 5CCZA 3VINA 4MZ1A 1TQXA 1TV5A 3CB8A 3QHNA 1A5NC 1QI2A 4DI8A 5BWFA 3IJ7A 1W1ZA 1DHPA 1EYEA 2C3DA 4H4SA 1GVYA 5MKGB 1SZGA 5A6KA 1JG9A 4J27A 4I7UA 3SJ3A 2O9OA 1V79A 5F2GA 2AKMA 2GVLA 5AC7A 5C7VA 8A3HA 2PSNA 4GH1A 2Y70A 2HQMA 1P0DA 1Q6OA 3I6EA 4XBJA 2OFJA 1I2PA 2DT2A 2WHLA 1OFBA 2NUXA 2WPEA 5TNVA 3LU2A 3R4IA 3WQDA 1KBIA 2Q8LA 3LHZA 3J7HA 4GUJA 1H2IA 1XR2A 2VZVA 3O16A 3W7RA 1NWSA 3R11A 2YBVA 4DX3A 1ZL1A 3IK2A 1XD1A 3H54A 3TLQA 3QFBA 1HN1A 1G4SA 3EDJA 4WZHA 1QTWA 2E0PA 3CEUA 4CU6A 2PDLA 2XYLA 1I9CB 4H4QA 2GGEA 3UWUA 4MG4A 2IW0A 4CCCA 3QM3A 2P3EA 1G9HA 1F07A 5A3HA 5A94A 1KRBC 2CYGA 4HK7A 3W01A 3LBMA 4EKJA 4AEOA 2GSJA 2QULA 4JTKA 1R5YA 4KERA 3CHEA 4QG8A 4RK8A 2YL9A 3UY7A 2WJZA 1QPRA 1IXNA 1Q66A 1VKFA 2GGGA 5A2CA 4NAEB 4PEEA 4Y9MA 4TTUA 1RSCA 1WOAA 3W73A 2AKZA 3FJ4A 4LCRA 2WP6A 3WYZA 1ISYA 2CKRA 5CBBA 3E0FA 3NYZA 5TIMA 3KOXA 5M17A 4UB9A 3M1ZA 2YDAA 4C1NB 5DXYA 3KHDA 4RKAA 3QC3A 4HCLA 2D0HA 2VT0A 3KRSA 1JCXA 4V1YA 2ZICA 4M51A 2BHZA 1EC7A 2BSLA 3JRKA 1BXNA 4IPLA 1GVEA 1VFUA 2Z26A 4B91A 3BLKA 1OM0A 3WX7A 2Q09A 4JQ9A 3VTRA 4LEQA 2VEGA 1YX1A 1NSJA 2QW5A 1FWSA 1U2YA 4QG9A 4ERGA 3W70A 3DFTA 3C0QA 1CECA 2VFDA 5DANA 3PVFA 3PB2A 4K8EA 2WOWA 4NASA 4OE7A 1RCQA 3SEPA 4KRUA 3C0SA 5FJTA 3DGRA 1Q7ZA 3H55A 1TPC1 3MA8A 3W81A 1TIMA 2DVUA 4PFHA 1MRAA 4OOUA 4JKMA 5C9ZA 2REQA 3L0GA 3OLIA 3LGGA 3N73A 1XLGA 3C0LA 3S1GA 1FKWA 3KCOA 4KF1A 1GYLA 4P7NA 2OYLA 1YPIA 1FWCC 1GVFA 4KPLA 2WMHA 4MYAA 1PHWA 2HROA 4JX6A 3TYUA 1AFSA 2P10A 1A5BA 4JTLA 5KTLA 3CQHA 5C2GA 1TWZA 4OGZA 4JIIX 4PMZA 3VX0A 1Q6LA 1JD9A 2D24A 1JCLA 1KCLA 1UR8A 4DVOA 4DI9A 1KN0A 3E0WA 1QHZA 3BAWA 2TAAA 3NL2A 1YXDA 3BG3A 3RILA 2CBVA 1I45A 4C6FA 3LK6A 1ONEA 3TTYA 3C0JA 4HU0A 3BOLA 3LMZA 2CC0A 2AQVA 4N9BA 3C56A 2ZE3A 1NU5A 1OCQA 1Y65A 2B7PA 1XLEA 3SN4A 4C6DA 4LX4A 2WPCA 4EXBA 3GW3A 4RXFA 4KGLA 8RUCA 3RLHA 4LIIA 3ABZA 1H11A 2E77A 2GL5A 3NRZB 1E9LA 3QY8A 2VX5A 4H7ZA 2WVUA 1KLYA 1B90A 1KV8A 4UQDA 1QFEA 1ZDLA 1EEPA 1DXFA 4JQ2A 5FOOA 4PTWA 1XL9A 1KM2A 1NM9A 1OSEA 1KRCC 1V6YA 1T6MA 1TA3A 2VEPA 3DHDA 4Q8OA 3QH2A 3EWXA 1UBSA 2NVDA 1GHSA 4AC1X 1YDYA 4ZSTA 3EOSA 4IJCA 4IICA 5G2IA 4LV4A 1L8NA 3H23A 2WKGA 1FWGC 4IIGA 1LBLA 4WJXA 2XU2A 1HJQA 2CZVA 1SJBA 3REQA 4E0CA 3U2EA 5BCAA 1RVKA 1BWVA 2H6RA 3UETA 1ZJBA 1TE6A 1OK6A 1HO4A 3N13A 2E1DA 2E9LA 2WXDM 2QJIA 5E70A 4NEVA 3DDMA 3OGRA 4LALA 3W6YA 3L68A 3JVAA 1LZOA 1GTEA 5T8GA 2BODX 3SRKA 1V7AA 1R3WA 4GYJA 3K2GA 1V02E 4M6PA 4HGXA 4Q8PA 3SCTA 3THUA 4FF7A 1NQ6A 4H8VA 1EDQA 1SZEA 2VP8A 2X05A 1PDYA 4HCDA 3LPGA 3IGUA 4J3WA 3HQPA 2IKJA 3F2DA 1IEXA 1PKLA 1TE1A 2B81A 2DSVA 1UJQA 1TCDA 3RCYA 1F76A 4UTLA 4AZ7A 1US2A 1ZCOA 2VNCA 1L6FA 1EB3A 1B3XA 5ER0A 4L9ZA 3TYCA 2XHYA 4LY4A 4Z1CA 3L5OA 3CZJA 5C9XA 3QTPA 1I1WA 5A6AA 4KH2A 1TTJA 3R8HA 3CUXA 4LVGA 1HXJA 4A3RA 4IUOA 4W86A 1HT6A 4WKFA 3VNYA 5JCMA 3STCA 3IV3A 4LS0A 3LBCA 1XYBA 4PCTA 3DAQA 4HOZA 2OSXA 4EE9A 4EMJA 2Z1SA 1N55A 2XFYA 4M1RA 1REQA 3R25A 2WKJA 3IAPA 4Y96A 3IJ8A 3QHOA 3EWBX 4O15A 1FWTA 3QQWA 1ITXA 2PUZA 3WCZA 2OVLA 5KEZA 3ARTA 3QN3A 5ABHA 3S9YA 1YBQB 3ARYA 4OT7A 5T91A 3PJXA 4EMWA 5AKQA 2I57A 2ZRXA 3VMPA 3TWBA 1H6VA 2VKZG 4P8XA 2C91A 4OBSA 4GYKA 5C6MA 1E6NA 5GQBA 3UYIA 3O07A 4WK9A 2HRWA 4U28A 3U0HA 3P5YA 1BG4A 4KEZA 2GJLA 4D8LA 2ACRA 3AYTA 3DU0A 3UPWA 3SB0A 5JBFA 2O55A 1FDZA 4CD4A 4QXIA 3QSTA 2Y1HA 4BZYA 2NV2A 3ZJ8A 1XV8A 4JTUA 3W7HA 2VC5A 3LGEA 3M46A 3NPUA 4ADUA 4LVDA 3U9IA 3GU9A 4JNYA 2VFIA 5HNUA 3GTHA 1QXLA 1O60A 7PTDA 1OFEA 1XW8A 1XKYA 5PTDA 2IXUA 2OCZA 2YL8A 3SY1A 4H9MA 3B0UX 2Y7DA 3V4BA 4GBDA 4MF4A 1OX4B 1Y7VA 5JCIA 4LNCA 4TXEA 3AUOA 1TX2A 1FQ0A 3TLLA 3U3HA 4INFA 4H3DA 1XBVA 2FTWA 3AUJA 3KX6A 2X30A 1G69A 4LUTA 4JN6A 2PDGA 4NP7A 1CXEA 4UNIA 4GWEA 1JZ8A 2V2HA 3K8MA 5CSSA 3LDVA 3MWAA 1TRDA 3GE7A 3KRZA 4JKLA 5HATA 4RNIA 1WAWA 1WKYA 3B06A 3W7NA 2I16A 3MZNA 1XQLA 3GNOA 2XVGA 2PBGA 2J3NA 1HL9A 1SSDA 1R86A 2GQWA 1GOKA 3T2OA 3TA6A 3EMCA 3SRFA 4KFNA 4O19A 3UT0A 4D6CA 1AMYA 3A21A 3BL3A 1EZ2A 3KHJA 2BY3A 2EXOA 4CNOA 1C92A 2Y88A 3H7RA 2FMNA 3E38A 3NJ3A 1TA3B 3C2YA 5CPLA 1DWHM 4M81A 1JI1A 1JAEA 3ERPA 4S1FA 4RZBA 3N4EA 2OLAA 3CNYA 1LG1A 1WDQA 5DMNA 1KTNA 1O1HA 2Y8UA 4DJDC 3AU2A 2F2KA 1TRIA 1X6LA 4EF9A 3F4NA 3S2LA 5BRPA 1XIHA 2OZ0A 2G0WA 5F4WA 4IOTA 3HIJA 5JXQA 5FF3A 3S9ZA 1LWJA 1PVNA 5D2XA 3BLDA 3R1ZA 2EQ8A 1WKFA 4RW3A 4YMZA 1BF6A 1J10A 4JOMA 4GZ7A 3DI1A 3TW6A 1PYFA 3IARA 2HV5A 3SY5A 3CZLA 4GUIA 1THFD 4QSFA 2NVKX 2ZC1A 4WLCA 3QY7A 3WQWA 1KFEA 3MQTA 3HQOA 3V1PA 2ON3A 4ECLA 3WLRA 2GZXA 3AXMA 3S4TA 5DMYA 3UGRA 4XX6A 4YXGA 4S3EA 4RE2A 1VFMA 1E6XM 3GLCA 3WBAA 1I2RA 4H4XA 4WDWA 4IX2A 4RV8A 1NJJA 1VEMA 3PG8A 3Q4DA 3ENLA 3M0HA 3E2SA 5LNVA 2GR1A 2VFFA 3F5JA 1JCNA 5FSEC 1A53A 2ZUWA 3RIKA 4BWLC 4FS9A 1CWYA 3IGXA 3IRDA 1F73A 2OOGA 4FPSA 4XZBA 3ELFA 1U30A 1Q6FA 2V69A 3MKVA 2X1RA 4CD7A 5K9DA 4K38A 4A8RA 4PMYA 2PF0A 3BQ6A 3TH6A 7XIMA 1NH6A 3AS0A 5F2IA 3LHYA 3W85A 1C93A 3TSMA 4LSBA 1PE1A 2VC9A 1ODUA 3CM4A 2AMXA 3GIPA 5FJOA 1TVPA 4GVHA 4JDYA 1LLZA 1REQB 3MVTA 2YVFA 5CJMA 3ATZA 3VU2A 1K7XA 4L64A 3P8JA 1VYRA 3DFYA 2YR1A 3APTA 1XLLA 3LRKA 3CQJA 1P43A 2C18A 1EIXA 4FXSA 1V3MA 3S1WA 1PIFA 4JICA 1Z32X 2CESA 4HZMA 4S2BA 2EJ1A 1H41A 1MNSA 4PMXA 3VGHA 3BSGA 5CG0A 2QUVA 3G1FA 1W5NA 4BQ4A 3GNNA 3TQ0A 4CNNA 4O0ZA 3ARVA 5D2YA 3EOOA 1H7RA 3WQOA 3RYSA 4EWJA 1KV5A 3N14A 1QPKA 3QJAA 1YPFA 1TQJA 5D8WA 2Z27A 4H6RA 5AC5A 5ECUA 2Q02A 4LS2A 1NELA 2Z1KA 1UR3M 2NQLA 7REQA 4DJDA 2CZ5A 5GVJA 1TZZA 3PPCA 3UG8A 1AG1O 3V7PA 3SIMA 2Y5SA 1I60A 2R9RA 4M6QA 1C8YA 3CAWA 3G18A 1XYMA 5I3IA 1V6XA 1C8VA 1DNCA 5DEZA 5DRIA 1HL2A 2KAUC 1XCFA 1WDWA 4HJWA 1UWIA 2UY2A 3NOYA 4CNUA 3FJLA 1TKKA 3KWXA 1UA3A 1G7VA 1OADA 3SAZA 1US3A 3E2RA 4C6KA 3JU2A 4LC6A 2E5BA 3LCIA 3TZFA 3E9AA 2C13A 4G9PA 3D9XA 1HX0A 3HTWA 1GRTA 3JZEA 2GSEA 1W54A 4R85A 1K4QA 2C19A 3T1GA 3PSWA 5AYXA 3KP1A 2H9AA 3FY1A 5TD4A 4LCQA 2YA2A 2VX7A 2X09A 4GYFA 1S2CA 5FEPA 2EPNA 3DBNA 1K70A 3H70A 5HQEA 1HVXA 1LVLA 4GI9A 4QM1A 3LQLA 1HGWA 1KFCA 1QI5A 3OHMB 4XIMA 3CGTA 3KWSA 3AMZA 5I02A 1MYRA 5HULA 3WF3A 5AVNA 3ZM8A 1RPXA 2Z6IA 4PMUA 3WDPP 2O9PA 3MUCA 2HE8A 3I68A 1UHVA 1ALDA 3IANA 3U5YA 4AW7A 1KM6A 5JCNA 1F6PA 1TYTA 3W7IA 2V38A 3EBVA 3G3MA 4AZ5A 1EHNA 2TODA 1EIBA 3EX3A 3OB8A 3RPTA 2J9YA 1F3PA 4MM1A 1E9YB 2EQ7A 2G8ZA 4EF8A 3VOHA 5I24A 4LFYA 1MSSA 2QJGA 2VUNA 4RL3A 3IGSA 3THDA 3OYXA 1CX9A 2ONEA 2OG9A 2VGIA 5A6SA 2NUWA 4ROQA 1VCVA 2G95A 3UXIA 1RJPA 5DBTA 4DJED 1ZNNA 3UVIA 1EBDA 3POHA 4B5XA 2C7FA 4GI8A 3ZYZA 1H2JA 4AWUA 1BKHA 4D1IA 2GJXB 2OLSA 2QGYA 1FECA 4ZOBA 2X41A 4U3AA 2FVMA 1SYTA 2V5CA 3R5EA 3MJMA 1EJSC 1WUFA 2XN2A 1H7NA 4AX7A 2E8ZA 1WAUA 1FKXA 3LN3A 2HK1A 2YCEA 2FLIA 4XD5A 2QF7A 1YIXA 2XIBA 4OOZA 2QKFA 3EOUA 4N2YA 1HNYA 3H21A 4MPKA 4ALDA 2X8CA 4DWSB 2CLLA 4U33A 4QJ5B 2PDNA 4U5KA 3Q58A 1VQTA 2VR4A 4B5NA 3BZJA 1JNEA 3THAA 2QR6A 1ITUA 4DZ5A 4F8XA 3C2RA 4ZODA 3R2GA 4NNAA 1MNZA 3TYEA 4MOZA 3AWOA 2XISA 5BOFA 2HBXA 3CGBA 2ATSA 3II4A 1DJHA 5CPOA 4AD4A 1VR6A 4MYXA 5EMJA 2ZXQA 4LANA 4ZTYA 4E38A 4Q7BA 3T81A 1B4KA 2VCBA 4I6VA 3L4XA 3NVDA 2DZPA 1JYWA 3JZUA 4NJKA 4EM4A 5B7YA 4EQWA 3H4KA 1WKDA 1QBAA 1QWKA 1R3SA 1EC8A 3NL3A 4DWSD 3MB9A 2YCLA 1B3YA 5I3JA 3LCGA 1OZMA 4RLIA 4I9TA 2PGEA 4RDVA 3HQNA 1AZ1A 4Q6XA 1YTEA 4XAPA 4TMCA 1F3EA 1F8WA 1XG3A 2BY2A 1V0LA 3CL8A 4J3VA 4WHBA 2CLFA 3LCWA 2VDHA 4LA1A 3VZZA 5KVIA 3R12A 2WZHA 2X8HA 1K02A 1UP0A 1LL4A 2VEIA 1XISA 3DG3A 4RV3A 4WD0A 2FZ9A 2BASA 2QCEA 4QCFA 4F4RA 5JUVA 2VENA 3WFLA 1PTAA 1X97A 2POTA 5FS8A 2Z29A 3SCSA 1SZNA 4NG3A 4C6PA 1TV2A 2CEQA 4GK8A 4AMCA 1VLWA 3A4AA 3CJPA 4G5DA 2DZTA 4XV0A 5AECA 3G6LA 3AU6A 4EPKA 3H7VA 2WC4A 3ARSA 2E5AA 2J74A 2G3IA 2EQ6A 5KMYA 3G1HA 4MB1A 3LD5A 3O05A 4FF5A 4H8UA 4LYPA 4O53A 4X9YA 5EU9A 4GNJA 5MHBA 4HA1A 2AOSA 1YRRA 1OIFA 3ZS4A 3IIPA 1CYGA 2XH7A 3TROA 4PL1A 4UQEA 1V7YA 4L6OA 2DSUA 1VLIA 3GTIA 4EM3A 1UIOA 3IIZA 4KEUA 4Z1YA 4Z1BA 2VI0A 3MCOA 3S5OA 4OU1A 3K4DA 1UKQA 1ML1A 2OZTA 2VRKA 4ZA0A 4A29A 3BCJA 1RBAA 3PN8A 2PEVA 4JL2A 1QT1A 3MC5A 4EXAA 3FXYA 5JQ9A 4IFRA 1UR9A 3T40A 2GRTA 2CWNA 5C71A 1CBGA 8TIMA 2V0TA 3IK4A 1H1NA 2WC7A 2B4GA 1WNOA 1FDYA 1OT1A 4GR1A 4PEKA 2WWCA 3DJJA 2NSOA 1U1HA 3LPOA 4APNA 4LWWA 1AQ0A 2WOVA 2HVNA 3HJEA 3K5XA 4CLMA 1D3HA 3UD6A 5TF0A 1OGGA 4ZO6A 3R79A 1X96A 5A6BD 5DELA 3UZYA 5DY2A 3ZSSA 1EX5A 2YA1A 7TIMA 1BYAA 3LI0A 4LS1A 2DUAA 3EDKA 3TMQA 4GUHA 2OWCA 4UMBA 4WVXA 3UJEA 6REQA 3QGVA 4NZCA 1SVDA 2XN1A 2AAAA 1W3TA 2DSWA 4JTRA 3E02A 3ORWA 2X42A 3VUSA 4FNPA 4H4PA 3G1VA 3ARZA 3GTXA 3GTFA 4M7TA 1CI1A 2W91A 3V1HA 1T99A 2C14A 1TTPA 3G22A 4UTTA 1TCMA 2CXEA 4K1WA 1TV4A 1ZFJA 3F2BA 1TSIA 2FPYA 2AL2B 2QCFA 4LAZA 2H90A 4FLSA 1KWKA 3NYDA 1SR0A 3M0KA 3L4UA 4N9CA 1B3ZA 1K1DA 1VIZA 2O9RA 1O1ZA 4S3BA 4CCDA 3BLEA 2ZC8A 2Y6ZA 2VDIA 4HB7A 1JEZA 3LSBA 5FAJA 3S3GA 1S7MA 1NAL1 3ARWA 3BSHA 5D2VA 2OYMA 4ZB5A 3GTNA 3OEXA 1ONXA 3NQBA 4Q4MA 2PB1A 4Z2IA 1X6NA 3AWNA 3KBVA 5CC5A 3M6DA 2IS7A 3AN1A 3O6DA 2YAUA 2HMCA 2J7CA 4AHPA 4AHQA 4BR1A 2CLMA 3SQLA 3W37A 2YCLB 4JFTA 1JD7A 3ZZ1A 3CGDA 3WQPA 4GQGA 1MXGA 3LHUA 3TYZA 4HNTA 3BW2A 1PWMA 4N0RA 4AHOA 3FYOA 1UIPA 1OGSA 3DGHA 4AWTA 2WAGA 3DFSA 3KVLA 1EJTC 1M6IA 4EOUA 3GH7A 3EDFA 1Z3NA 3FAXA 4HPNA 4N6FA 4C6BA 1U83A 6XIAA 1V3KA 1QOQA 1JUBA 1E4NA 2W67A 1WYGA 2V6AA 5EGRA 3URNA 4ZTXA 3SQMA 3QQ0A 3UCDA 3CTLA 1O4UA 1PHQA 1DVJA 1NWTA 3ABSA 4YIWA 3M6YA 1JI2A 1C3FA 3VGGA 2NQZA 3H6OA 1Y5XA 2IKGA 1FWJC 2A8XA 2E5DA 5T26A 1VGAA 2PWGA 2WW5A 6ENLA 5LZLA 4LW7A 1M53A 2YLAA 3WNMA 4DY1A 3G1SA 3L0NA 4MPQA 3BXWA 1UMYA 3H53A 3M7SA 3GDKA 2PD9A 4H7VA 3UVAA 4TO8A 4YLWA 2WBKA 4PC8A 3WLTA 2WPFA 2Y8KA 3GB6A 4RX0A 2Q3OA 4MKNA 1EEXA 3WG6A 3LZ3A 3FA3A 2XIJA 3O0HA 2WNWA 4O1AA 4Q33A 2P0IA 1X6UA 5CG7A 1LWHA 3STEA 1VBHA 4PUJA 3QOKA 5I2UA 1IXOA 4KFPA 4B5VA 3PZMA 4QJ1A 5CPMA 4NRRA 3URHA 4AEEA 1HVQA 1PIIA 2DORA 4Y9NA 3VIOA 4NZ5A 1F7BA 4HMNA 4DJEC 3O6YX 2QUMA 1XHGA 2G37A 5EMMA 5CEWA 1GETA 5HR7A 4UQCA 5JBDA 4LB4A 3HGSA 3ABRA 4IF2A 3CZGA 4JX5A 1QCWA 3S2NA 3A6OA 3EKLA 2E6YA 3V5OA 1BKSA 1EJRC 3APYA 1EGMA 4JTEA 3WENA 4UBPC 3UXLA 1Q6GA 4WY0F 4H00A 4FEZA 3BLOA 2QQ6A 2ESCA 4OWGA 2ALDA 3TA9A 4H6QA 4E4FA 3IRSA 3KL3A 1EHAA 1OC7A 1CGVA 1Q6DA 1W8GA 1YTDA 2XINA 3WLIA 3G24A 5BYWA 4DF1A 2R1LA 3HRDC 5HJXA 2PGRA 4H9VA 1TMLA 3CPRA 4UOJA 5E0FA 3NQMA 4H01A 4O18A 4Z1AA 1J2BA 4H8HA 3AXIA 4M80A 1FXQA 1M1BA 1DIOA 1N61C 1JZ5A 4CQAA 3NZGA 3I7SA 3BOXA 2CW6A 1GOXA 3I3BA 2B31A 1GVQA 2JE8A 3UFYA 3ZR6A 1FDJA 5D9MA 3W1LA 1GZJA 3PZVA 2QF8A 1FWEC 3CHVA 3W74A 5U1OA 1Q1RA 4TX9A 4J2PA 2QCMA 4XSLA 4W7UA 1RR2A 1LQ0A 1UP3A 1O12A 4MIMA 3UXDA 2CZFA 3KVJA 1K8ZA 1L6SA 1GRBA 3BW4A 3HG2A 4Q4OA 2VL4A 4J3SA 5F4XA 1E3XA 4WJEA 1QOPA 1A3XA 1NARA 3RG6A 3NVVB 4AH7A 2DZWA 2Y7EA 3LHVA 1CXLA 1OABA 5DLCA 3WJXA 3KOWA 3VGFA 4PMDA 3UG4A 2WVSA 4JS3A 3S42A 5CSYA 1JPMA 4GKLA 4G1KA 1I2QA 5CQ1A 4LUSA 1BF2A 2FB2A 1Y5WA 3B3DA 4OBRA 1FWAC 3GXNA 3H2OA 3NURA 1XPGA 3PWAA 1GW9A 5E0KA 3NSNA 1K4HA 4Y6GA 3D5HA 2RDTA 4MHBA 4NHVA 2YXXA 5F2LA 1S1RA 1TPDA 1E9IA 4DJEA 2VCAA 4L4PA 2NXHA 2QUUA 3OLEA 5BW6A 4PSPA 4FNSA 2QJJA 2XUCA 1CGTA 2NQ9A 4IMAA 4JQ4A 4GMEA 1ADOA 3IS4A 4DO7A 4E5TA 1O5KA 3NQ2A 3QLDA 4MAVA 6CGTA 5CLTA 2X7VA 3M0VA 1ZKQA 1YPXA 3SSZA 1PZ1A 1BXBA 5LKYA 2R1MA 2E1WA 3AICA 5G1TA 3Q45A 1G7UA 5CC7A 2V30A 1LQAA 3STPA 4AG0A 5G2HA 3S1UA 3KZPA 5I00A 2OWXA 3DI0A 4AZCA 3N2BA 1B2YA 4K7ZA 1C90A 4L9YA 4UQ9A 5FD0A 3A24A 1ZBCA 2GVGA 4FNRA 4K2SA 5BNKA 4TVCA 2QDDA 3WBYA 4US5D 3L4YA 4IIFA 4ZR8A 3GW0A 4AISA 4AY1A 4PTNA 5LHEA 4WDXA 4UTKA 1YYAA 3QLLA 3WNOA 3DUGA 2CU0A 3SO7A 3UJRA 2ZVRA 3E6EA 3KXQA 1QOXA 1S5TA 2YVJA 3WEOA 1H1ZA 1OF8A 4DZHA 3W7DA 4FHAA 1CLKA 4GYPC 2FPTA 2QT3A 1JF5A 1ZTVA 3W29A 1PZ3A 3CUHA 1QATA 3FAWA 5FJUA 2YB4A 1KXVA 3NWRA 4XZNX 3WNPA 2PDCA 2DIKA 1MUCA 4I8YA 1FWNA 1MOKA 4GVGA 2J78A 3V75A 1D8CA 3L4TA 1ITQA 3WBWA 4ZQCA 3TWAA 3HPZA 4LTSA 3WK0A 3VDAA 4BEUA 5K9XA 3CBWA 4AUBA 1GOMA 2QZRA 3GFZA 4A05A 3UNTA 4Z2KA 4L9XA 4NSBA 4P2VA 1XH0A 3DENA 3O9NA 3NVTA 3OW1A 2PWDA 2ZDSA 1OQFA 1GHRA 3CLWA 2JK2A 4MB4A 1GQNA 1V6TA 1DV7A 4A3QA 3G77A 3FW6A 3BMWA 1ME9A 3T0TA 3AXHA 3UBPC 3B8VA 4X2PA 1XICA 4I8DA 3XIMA 2GR3A 3RK8A 2J7GA 1RBOB 3EX1A 3TX9A 4JTTA 3WLKX 4UCGA 5IDZA 1UASA 2FZBA 3FEMA 4HTBA 3RMEA 5G5GB 2PA6A 5DCEA 1W91A 3B40A 5BZAA 1XYZA 1BG9A 3MUIA 2YSWA 1E6RA 4IISA 4E3TA 3R8RA 4PMOA 1ICQA 3EAOA 2FYMA 3P81A 3WUEA 5FESA 2PDXA 2OSWA 4NAFA 3BLLA 4YTUA 2J7FA 4JCLA 3UWWA 4UFLA 5I6SA 1XIMA 1MEHA 2GLKA 2XGZA 3W26A 1DJQA 3TOPA 3HG3A 7A3HA 4HNNA 4L6DA 1YXCA 4B4FA 3V3WA 2VQUA 1ITCA 4E2DA 3ARRA 3G1RA 4OVXA 3WKZA 2C3ZA 1C8XA 3LS9A 1QNSA 5FF7A 1G67A 3WNNA 1W9DM 1Q8AA 4K7YA 1K7FA 1LCOA 5E93A 5C70A 3R0DA 4Q4SA 4MSSA 3W2LA 1GWJA 3XINA 3RJXA 3I6TA 1XDJA 1AW5A 1J0YA 5FL1A 5DBUA 1OZQA 3L7RA 5FCZA 4HKPA 4AB4A 2W55A 3SBFA 2DW7A 3UR2A 1VB9A 4DAIA 3LV6A 4JPGA 3SQSA 3DFHA 2XDFA 2XWEA 3UP8A 5B7ZA 1QNQA 4FX7A 1P0NA 3B05A 1XGEA 4J56A 4Y9OA 1XYCA 3STFA 5D4YA 5I09A 3USZA 1BSLA 3Q65A 4IX0A 5A6BA 3LGDA 2CETA 1C9WA 4M1BA 1DIEA 3HJZA 1UD5A 3VA8A 3HGRA 3WK1A 1C9DA 1AQMA 4LB3A 1SMDA 5CZ0A 1NHRA 4R33A 4YHGA 2VYOA 4TR9A 1HL8A 2PD5A 1DPMA 4AXKA 1CLXA 2OKTA 4ZQPA 1PWLA 4E2VA 4IUGA 1E73M 3IGHX 2CLPA 4P7LA 2OXNA 1IT7A 3YPIA 4AIOA 1R30A 4C1LA 2D69A 3L5LA 1Q2SA 5E0CA 5I0DA 3DH7A 1V59A 4A4AA 1EC9A 4MJ4A 5FEXA 3QFWA 1LOQA 2EPLX 4HPXA 2FJKA 3BLFA 3BV7A 1JYNA 4Z17A 2BVDA 4IL0A 4XSMA 3TR9A 3WH6A 2D0FA 4AYSA 3EA1A 1X1OA 1FH7A 4ZQOA 4R7OA 5IM51 2WJDA 4FAMA 1L0PA 5BMXA 3RNDA 1UUQA 3DYMA 5C5YA 4FLOA 5KZDA 3WQ6A 1GG1A 2XIIA 3H4WA 2P8BA 3O0FA 1K9FA 4K8HA 1PIGA 4K37A 2QEZA 3PUOA 2XH4A 4PODA 1XLFA 4JKKA 4QEHA 1JGMA 3QBUA 4J1OA 1FCQA 3BO9A 5CZJA 4M0XA 4D6EA 2BOFX 2HNHA 4US6A 3K4AA 3GXPA 1QHPA 5EPDA 1T8XA 1HKIA 1LRQA 3DFQA 4XD4A 5HWJA 2E5CA 4HHPA 4GOAA 3DHUA 3POCA 3WQFA 2VR2A 3L4WA 4YWIA 2ISVA 2DGAA 2WCGA 1CXKA 4FNTA 4B16A 3GC2A 1W56A 3TAKA 4UTMA 1X2GA 4YNGA 4W8BA 4OIFA 3QV6A 3S0CA 1BD0A 1N5WC 1YDOA 3W7LA 1W3IA 2YFNA 1Q4NX 3EPMA 3TSBA 2XZ7A 1KKOA 1ZS2A 3OG2A 2PDPA 3VKBA 4MKSA 1PX3A 1GYMA 1W1TA 3KAOA 2QJMA 4KWWA 3VVGA 1IF2A 1PKNA 1IXPA 3KBMA 2WQDA 1O95A 3P7YA 3CMJA 3L9CA 5XIAA 1R38A 2JKEA 1E43A 5ABFB 3MANA 3VMNA 1RLDA 2NQHA 1E1EA 2XH2A 4HK5A 3CK5A 4HNCA 3ITLA 4ZQMA 3VNDA 3BG9A 1BYBA 1ESWA 3RX3A 3H22A 3W2MA 3BE7A 4HMEA 2FIQA 4DWDA 1M65A 5GNZA 2KZHA 3DERA 2J79A 1MQRA 1E70M 3FX4A 1C7SA 3W28A 1XLKA 4A22A 5DY3A 4CCEA 3BGGA 3VIHA 4DLFA 3U48A 3OVPA 1S2TA 3LHTA 1JZ7A 2WZEA 2EG6A 5CPNA 3M5VA 2DPEA 3V35A 3TJ4A 4DQWA 4H1ZA 2YDRA 1ZY8A 4ZQRA 4UR7A 1BEUA 1HO1A 2OLHA 3WQ8A 2Z6JA 3K30A 3VK5A 1G94A 1TJ1A 2PCEA 5CKSA 3H24A 1MEIA 4H4UA 1EP2A 4KQNA 3NZ1A 3GFXA 4CN4A 1C8QA 4X2RA 1FHVA 4HVXA 4B3ZA 1KFLA 2VGFA 4UQAA 4S2CA 4NZ3A 1R2SA 1DHKA 2AQWA 3KL0A 3WO8A 5DRCA 3ZR5A 1J0JA 4LAOA 1KGUA 3HW2A 1PO9A 4R3UA 2ISDA 3CQKA 2ANUA 3EA3A 3BSMA 1R3QA 3VKCA 2CFFA 4NJHA 3W71A 2O4MA 4JTCA 3GNDA 2XWDA 1PS9A 3DFNA 3UXAA 5BRBA 3PZGA 2W3ZA 1XYLA 1PXGA 1XRVA 3UEQA 4YTSA 5KETA 3PULA 1H50A 3AYSA 2C0AA 3TR2A 5DF0A 3SR7A 5C9RA 1B3WA 1F2JA 1S3TC 4QNWA 3S83A 2Y61A 4EP8C 1JAKA 4V15A 2GQ8A 2PBOA 1E4LA 1TPFA 3OVGA 1AJ0A 3CYVA 4ADSA 4BFAA 1M6JA 3WQ4A 4NL1A 1O68A 1FCUA 2VGGA 4Q32A 4DO5A 1CIUA 2HQAA 3Q94A 3OZMA 5DXXA 3T78A 4BURA 4JFUA 2R9ZA 1EF2A 4DBDA 3W87A 3BZGA 2D1ZA 4F79A 3WMLA 4IH3A 3NO1A 3VCRA 1YKWA 2GUBA 1FP9A 5AHMA 3PBWA 4XUYA 3NQ7A 1WZMA 2YIHA 1PKYA 1BWCA 3OHIA 3NZQA 1ZENA 3WQEA 4UTFA 2WMIA 4WIWA 1KQZA 3PBUA 3LNMA 3VCCA 3QQ1A 5EFFA 2HTMA 3S1XA 1XXXA 3UCQA 1E3ZA 3OLDA 3S47A 3QV8A 4DBWA 4GO9A 5M03A 1ENUA 3F5KA 2B0MA 4AIUA 1J01A 4Q8MA 4ZXLA 2V3GA 3SGZA 4WGHA 1JZ2A 5LNSA 5CH9A 3BG5A 3WLPA 4O50A 5AZ1A 3A4WA 2RJGA 1OX6A 2BWGA 4AZBA 3JUGA 3H2NA 4AMAA 4DO4A 3WLNA 1JIBA 2WMGA 4FX6M 5D33A 3ABXA 1OB0A 1XF0A 1F61A 1CLVA 1PB0A 3TW9A 1DJNA 1FFQA 4CEXC 3D6NA 4CN6A 2VVNA 5G4WA 1JNDA 2QUTA 3LTSA 2XH0A 4K7VA 4CQCA 1GUVA 3OGSA 4IZGA 1K4GA 4BI5A 3MCMA 4ORIA 1J11A 3LHWA 2TPRA 2GK1A 3QFEA 1JULA 3S5YA 5HXMA 4H4YA 1QNVA 5F4SA 5XINA 3AZSA 5LGZA 4P7RA 2HISA 3GXIA 3S8HA 2Q71A 1DBTA 2PZNA 1RZMA 3SUVA 3R6IA 2IPFA 3HPAA 5K4ZA 4EAYA 3B0YA 9XIAA 1B3VA 1AUSL 3TTEA 1MFUA 2NW0A 3FDKA 4MY9A 2D22A 3VC5A 3FK4A 2OO6A 3BPWA 3TKFA 1TWIA 3EXSA 1UD6A 4KWSA 4AEFA 5D05A 3WLSA 1ZMCA 1EP3A 1NP2A 4Y8FA 3GYEA 1ICSA 4TU1A 4A3UA 1A5UA 1PZ2A 2NXIA 4H04A 1IT8A 4XAZA 3WNLA 2NSXA 2I56A 3SY8A 1WE5A 4C5ZA 4QITA 1YDVA 1H60A 3T0DA 4JDRA 2PRHA 3EWUA 2ZUMA 4BY3A 4QGCA 1DXIA 3P93A 1PCWA 1Z69A 3H2AA 3MMUA 2YCKX 4DJFA 2XVKA 4JTFA 3C3UA 3NDZA 4ZZ9A 1XKJA 6TAAA 2BGQA 1SO5A 3IUDA 2GDUA 2V3BA 3PNUA 5AYBA 3BQ5A 4G7EB 3MHUA 2VTFA 3MHGA 4FR6A 1IYXA 1JZ3A 1CGYA 4QS6A 3P74A 1ZK7A 2YOCA 3N9KA 4GI4A 4S3CA 1VJZA 3KCJA 1BQGA 2YB1A 4I5XA 2V5LA 2E25A 4ZSUA 3QFAA 1K6AA 2E4TA 4H6EA 4RNJA 3P82A 4E2BA 2BMBA 1FRBA 4AF0A 3EX6A 1JL8A 1VJSA 2PDBA 2PRLA 3GC5A 4IG2B 3GDBA 5AC4A 1FHUA 4H4IA 3L12A 4L4LA 3L2IA 1MO9A 3P80A 4DAFA 2A6LA 4C7GA 1RQBA 4IQLA 3RLUA 1KGXA 3URQA 1EDTA 3B9JB 2WVVB 4YTQA 2UV8G 1HP4A 3W23A 2R1KA 3AROA 2FQIA 3HV9A 3O2LA 3VIFA 4MDPA 4RE3A 1UJPA 1J6OA 1NWRA 4IJBA 4X9SA 3KOFA 2X8RA 2DH2A 3CHCA 4W4QA 1ZCCA 3S5SA 1SO6A 5EMYA 1T41A 4D71A 1JFHA 5D37A 4V28A 4AXNA 3MT1A 1UR0A 3HGOA 2XSBA 2JK6A 4LEFA 4RZ6A 4UMAA 1AL8A 1NFPA 2ZZ1A 1J18A 4HN4A 4LY8A 4K36A 2OJPA 2PP1A 3IAQA 1P48A 3GZ3A 1LJYA 3LCXA 2QCDA 2A21A 1E6SM 2DVXA 5A8NA 4Q8TA 1N8FA 1P1XA 1BRLA 3KBWA 1SJDA 4AY7A 3LTYA 3VE7A 4BI6A 5CPTA 3R43A 5HQMA 2Z2UA 3LRMA 3QOMA 1AJZA 1DIDA 2EKCA 2GPTA 3WD1A 3C2VA 4AAJA 2IPJA 1FFVC 2GGHA 4JXCA 2OQYA 4GVFA 3WUBA 2ZA1A 1HFBA 2W92A 4JTHA 1YTKA 4MY8A 3RITA 1DQXA 3GG1A 4O14A 2JEPA 2ZXDA 4OV4A 4MLJA 1AH4A 1TX0A 1GVOA 1J12A 3LNPA 4Q4QA 3W2JA 3W38A 4C6QA 4JTAA 5F1VA 1GG0A 2WYSA 1AODA 4DZAA 2ZX9A 1UWAA 1KM1A 1ICPA 1XIIA 4Y90A 2CCRA 4E6MA 2BCPA 3EDEA 3DHFA 4JTIA 2DFAA 1C7TA 3FHAA 2JKPA 2WWDA 3KBSA 1BVWA 4GCAA 2VUYA 3ANYA 3CV1A 3VOJA 1TTIA 1GQKA 1Z6KA 2J6VA 2BB0A 2WMFA 5FA5A 4YWOA 1POJA 4JQ1A 3P8IA 1LOLA 2AGTA 4ZL1A 3B4UA 2EBNA 1FIQB 1LPFA 5DX7A 3N3TA 1SW3A 4J3XA 2WK2A 5T9CE 4JEQA 1VF8A 2WMKA 4ES4A 4P5UA 1V77A 3UERA 4GXMA 1GNXA 1R3RA 3CL7A 1IHIA 1HP5A 5A2AA 4KRTA 1MRQA 5L6UA 1TR9A 3IVSA 2NX9A 1A0DA 3W25A 3PJUA 4IL2A 3L8KA 4P8UA 1TPVA 4IQJA 1WB0A 1X1NA 1HZYA 3BMXA 4HHMA 2GK1B 3E96A 4P61A 5D04C 2EHHA 1FCVA 5BMWA 3VAVA 4ZB0A 3FVMA 4CGTA 4MJZA 1S5NA 4GC3A 2ZUTA 3W7KA 3CWNA 4C6OA 5FS9A 2V2CA 3WMCA 4MNJA 3EMZA 2G97A 1H5YA 1WXYA 3LYEA 5DFAA 3HFTA 1SO4A 5AHFA 3GUGA 1ONRA 1RP9A 2FVKA 5CPSA 1NTHA 3PK7A 1KD0A 1M3UA 3AIWA 1TPWA 1O7AA 3P0WA 4OTKA 3QR0A 3URBA 2PWVA 7TAAA 1R8LA 3SI9A 1UUOA 3C8NA 3SUWA 1NHSA 2QMJA 4UFHA 4M5PA 1SW7A 3O7UA 4E8CA 3AMCA 1MW2A 4Z08A 3IACA 4D8ZA 2GDQA 1JROA 5LIUX 4EPEC 4L4OA 1UC4A 3GH5A 2BBFA 1ZB5A 3U2ZA 1DWGM 3MDWA 3N6QA 4UNLA 3PZIA 4NXKA 3EEGA 5LNUA 9RUBA 4JN7A 2J9ZA 5HK4A 3PUEA 4I6KA 3EOLA 1B30A 2ZZ7A 1LLOA 3IVTA 4NYYA 1P5BA 3GC4A 1JPKA 3OGVA 3V36A 2YJQA 1N82A 3O0KA 3LCHA 1JQVA 3A22A 1QMLA 3GFYA 3H4GA 4QJ3B 3W7QA 1WPCA 2DZUA 1TUXA 3F03K 3OBAA 1ONWA 2ZVIA 5D30A 4H9ZA 1TJ0A 3K8LA 3WDJA 1AOGA 4Z0SA 4IGHA 5G2WA 4GNVA 4TVUA 3SRHA 2NUYA 2HS8A 1GOWA 2TMDA 4ILSA 3QRHA 3NS1B 3TVAA 3CV7A 2YL6A 1KR1A 4TX8A 4KWOA 4A8LA 2I5GA 4IHCA 3QV9A 2FGZA 1DIKA 2PDWA 5I06A 1RJRA 4XKMA 1DQWA 4QLJA 1JVNA 3GWQA 3UYCA 5CZSA 3LRLA 1XFBA 1LUCA 1E51A 3DG7A 3KTXA 3VNZA 2JEQA 4UR8A 3UA4A 1VEPA 4QISA 1LRNA 1N62C 3QEZA 4HQVA 1BWKA 5JBEA 1I2OA 4PUDA 5LA0A 4TQTA 1R2RA 2PDYA 4OV9A 2V5JA 2PTWA 3OIXA 3CUIA 4HYWA 1KCXA 3G8RA 1BRLB 1P7TB 3BAIA 1W32A 5KVHA 4LVBA 2V9DA 4GQ0A 4KMQA 1NWUA 2NV9A 4CUCA 4UTUA 3OVQA 3O1NA 3RO8A 3ATYA 3ONBA 1V08A 1L6WA 3WJZA 5GNXA 2E68A 3QKZA 1KB3A 1KFBA 1TPUA 1VEOA 4ZFCA 4FSAA 4WF7A 3TTSA 1TWSA 3W6LA 4ZOEA 1OC6A 1FCBA 1S39A 4ATWA 3P5ZA 3GG8A 3IV8A 3TV8A 1WP6A 3MY9A 5GJNA 4ZBCA 1FTXA 5JH1A 4QDWA 2OO0A 3K13A 5G4EA 1V0KA 2OYKA 1J6PA 3VUPA 3ZT7A 3WUGA 3SFWA 3N6JA 3GD3A 2YKKA 2WSPA 4GCXA 1BPLB 1IWAA 5JCKA 2HEJA 1WYIA 2X0SA 5ABEA 5A2BA 5FACA 1EGZA 1T0OA 1YQZA 4HPHA 1EUAA 2PDQA 1B1YA 3DGZA 4C1KA 1P1MA 2NVAA 1QASA 1EUNA 3GRIA 4Q8NA 1S5VA 5REQA 3IJ9A 1GGOA 3IJLA 1H0GA 1EA9C 1JCYA 4GJ1A 2F5ZA 5LIXX 1ZJAA 5D8ZA 5K4XA 3DKLA 4GKTA 3ZVHB 3P67A 3GVQA 3WIJA 2X2GA 1Z44A 2I17A 4MUPA 1QHOA 1RAKA 3DECA 2VOMA 2XFFA 2VFHA 3W1RA 4ZE4A 3KLJA 3UR7A 5F2MA 3HPXA 3ONCA 1OGBA 2G96A 3CO8A 3PANA 1XBZA 5CAKA 4F40A 4GIYA 3GAKA 4UTWC 2WQPA 1NF0A 3S6TA 4N4PA 2VX4A 3P84A 4PBEA 1RBLA 2DZBA 1F74A 2PE4A 3O15A 3SRDA 2OX4A 3M0JA 1XH1A 2PWHA 3MUZ1 3VC6A 1YMYA 1E40A 4AFYA 5IDIA 4PYSA 2GOKA 4MWAC 3GHTA 4RDYA 1QAPA 2NLYA 4P8VA 4ZEPA 3CYJA 1BVZA 1TPH1 1YQ2A 3UZWA 5M2FX 2CLKA 3CC1A 3MMTA 3M44A 1JZ6A 3B8UA 4XZIA 1Q6RA 3NEVA 1GOIA 4E4UA 4XISA 1DWFM 3VIKA 2EEXA 1KM0A 4BI7A 4YTTA 4YVPA 3TQVA 4DUXA 4GUGA 1ZGDA 3TNOA 1VS1A 3T0CA 1WDPA 1V6UA 4PUMA 1DXEA 2GH5A 4D6DA 3WD0A