3QKEA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
403
structure length
397
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVAYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Cystal structure of D-mannonate dehydratase from Chromohalobacter salexigens complexed with Mg and D-Gluconate
rcsb
source organism Chromohalobacter salexigens
total genus 151
structure length 397
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2011-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3qkeA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3qkeA01
1W6TA 3NFUA 3QTPA 4GISA 3V4BA 4DYEA 1PDYA 4HYRA 1TKKA 2PGEA 2NQLA 2OVLA 1JPDX 3PWIA 4H83A 5IDZA 2HZGA 2GGGA 2QJNA 3CK5A 1YEYA 2PP0A 4DN1A 3R0UA 4Z1YA 3DG3A 3I6EA 1NU5A 4E4FA 4A3RA 2HXTA 2ZC8A 5FJTA 5FJUA 3PFRA 2CHRA 3ZLHA 3NXLA 2QDEA 3H70A 3VDGA 3TOYA 2OQYA 4HNCA 3TJIA 1MNSA 6ENLA 2HXUA 3UGVA 2PSNA 4GFIA 2OZ3A 3DERA 1FHUA 4MGGA 3PK7A 3CB3A 3SN4A 3FYYA 3UJ2A 1EBHA 3S47A 7ENLA 3GY1A 2OO6A 3NO1A 2GGEA 1E9IA 2OX4A 3P3BA 3QLDA 3UJSA 3MQTA 2DW7A 3VCCA 3RCYA 2PGWA 3MSYA 3I6TA 1XS2A 2POZA 3FV9A 2GGHA 2PP1A 3MKCA 4DX3A 3UXLA 3DEQA 3P0WA 3VC6A 2PS2A 2PTWA 4JN8A 4E8GA 2AL2A 3STPA 4J1OA 4KT2A 4HN8A 2MNRA 3THUA 2P88A 3VA8A 3ENLA 3CT2A 2FKPA 3R25A 3ZVHB 1L8PA 1WUFA 2QJMA 1EC8A 1SJCA 3V5FA 2GL5A 1KCZA 4DWDA 2OZ8A 2PCEA 3UXKA 2OG9A 4IL0A 4X2PA 3FVDA 2XGZA 3GO2A 2DW6A 5FJRA 3FJ4A 3IJQA 1TE6A 1KD0A 4IT1A 4HPNA 4ENLA 3EEZA 3MY9A 1XPYA 4G7FA 3IK4A 2ZADA 3RITA 2P0IA 3DGBA 2AKZA 2AL2B 4ROPA 4MMWA 2XSXA 2OFJA 4DXKA 4K1WA 3FXGA 4ZCWA 3DG6A 2QDDA 2QVHA 4KEMA 1RVKA 3U4FA 3TW9A 2PA6A 3TWAA 2PU0A 4H19A 3VC5A 3GD6A 1ELSA 3VCNA 3UJRA 2OPJA 3FCPA 3ZVHA 3DIPA 3SQSA 2PMQA 1EC9A 3T8QA 1BKHA 3D47A 3OW1A 4KPLA 4JN7A 2P8BA 3UCCA 3JZUA 1EC7A 2I5QA 3ZLGA 4E5TA 4H2HA 2RDXA 1JDFA 3RO6A 1JPMA 2GDQA 1BQGA 3D46A 4A35A 3H8AA 3SN0A 4E6MA 4GYPC 3TQPA 2PTZA 4JHMA 3QN3A 1MUCA 4F4RA 4Z17A 3KUMA 3SSZA 1P48A 2ONEA 3ES7A 3CYJA 3ES8A 3DESA 3IJIA 3PWGA 4HCLA 4YWSA 3R1ZA 3R11A 3JW7A 2P8CA 1JCTA 1IYXA 5FJPA 4M0XA 5BOEA 3EKGA 1KKOA 1ONEA 1PDZA 2PU1A 2HNEA 3DFYA 1SJAA 5BOFA 4K8GA 4IHCA 4M6UA 3MWCA 3SJNA 3TJ4A 3RRAA 4IZGA 4E4UA 4ZA0A 3GC2A 3CXOA 1MDRA 3S5SA 1OEPA 5J04A 4FP1A 3OZYA 3TCSA 1ECQA 3V5CA 3TTEA 1R6WA 5ENLA 3QPEA 3H7VA 3T6CA 1P43A 2OZTA 4IL2A 2MUCA 3N4FA 4HNLA 1SJDA 2PTXA 3N4EA 3OP2A 4IP4A 3K1GA 3T9PA 2FYMA 1KKRA 3CAWA 3Q4DA 5FJOA 2QGYA 4GGBA 3MZNA 4GYPA 2P3ZA 4G8TA 3UCDA 3I4KA 3SBFA 3OZMA 3BSMA 3HPFA 3DDMA 2OQHA 3R0KA 3H12A 4EWJA 3SN1A 4H1ZA 2XH7A 3RR1A 2XH4A 3UJFA 3T4WA 3JVAA 2PPGA 3IJLA 4HCHA 3MUCA 1MDLA 2O56A 2GSHA 4KWSA 4HCDA 1F9CA 1FHVA 3BJSA 5EU9A 3QKEA 3VFCA 3ZVIA 4A6GA 1WUEA 4K2SA 4MKSA 3N6HA 1DTNA 3OTRA 3DFHA 2OLAA 1SJBA 4GMEA 1R0MA 2QJJA 2XH0A 4GIRA 3BOXA 3UJEA 3N6JA 3R10A 2PODA 2GGIA 4J3ZA 1EBGA 3U9IA 1MRAA 3V3WA 1TZZA 2PP3A 3ZLFA 3DG7A 4IP5A 2GGJA 2AL1A 2XH2A 2AKMA 3RGTA 2OKTA 4DHGA 2QQ6A 2PTYA 3OPSA 3Q45A 3P93A 4FI4A 3TWBA 3B97A 3NZGA 4GGHA 1NELA
chains in the Genus database with same CATH superfamily
4W87A 2ZUMA 3HURA 3PUOA 4XZWA 3BTNA 3LTSA 1PKYA 4DYEA 4REQA 5FCZA 3U3HA 1O7AA 2D0HA 3MDUA 4FXJA 3BURA 5CJMA 5I3GA 1VFLA 3D5HA 1L0PA 5ABFA 5AYZA 4UIOA 2V5CA 1IIGA 4B3ZA 2Y62A 3OQ8A 3C3NA 5HMDA 5E0CA 2CBJA 1F3PA 3KBJA 4DN1A 4K7ZA 3R0UA 1XUZA 3DG3A 1PWMA 3AIEA 1B3WA 4E4FA 5I07A 3QH2A 3TMLA 4LS1A 4EOUA 1S5TA 3LPOA 3VDGA 2WM0A 1J12A 1X2GA 4GQQA 3FHAA 4ZO6A 1VHNA 2XISA 1F4AA 3WKZA 3PZUA 2P3EA 1S1PA 5CGMA 3QMSA 1XLDA 3CPGA 2ATSA 1H63A 2Y63A 3LXDA 4Q4PA 4LUJA 3LTPA 3FA5A 4WSKA 3S47A 4ORIA 1VFHA 4C6JA 2FHBA 2PDWA 1IT8A 5HQEA 5TNVA 3PNZA 1E9IA 4JTFA 3TA6A 3GC4A 3VOGA 5CPQA 4U3CA 1RAKA 3TE9A 4FX7A 2ZUUA 3PR2A 2Y8UA 2PUZA 1UPPA 4JTSA 4MAZA 1JD7A 1XLEA 2XGBA 2TYSA 3CV6A 1QW8A 4HHMA 2A3BA 4KEVA 4R7JA 4Y9MA 1F05A 4KT2A 2FZ9A 4JYFA 3WDRA 3L5OA 5HJLA 5A8OA 3QYSA 4UNKA 4Q4RA 3N2OA 3R25A 1FWFC 4UFLA 2OU4A 4XAYA 2E68A 1OFPA 2F9RA 4HJWA 1VJIA 4CUCA 4ZOEA 3WCZA 4LXFA 1VENA 3TR2A 3DFNA 2GL5A 2NW0A 3U48A 1SYTA 3JU2A 3FDKA 1L2UA 4M7SA 3GYEA 1ECEA 3SJ3A 1E40A 1XM3A 3VX0A 3VYLA 4W88A 2VGBA 1A0DA 3MS8A 3S1GA 1Y0EA 3SADA 1XPYA 3KM8A 1A49A 1PSCA 3RITA 3RUBL 1F4HA 1UMLA 2GR3A 4LF2A 3E2VA 1TYGA 2GZXA 1XSIA 4DXKA 3P5ZA 2BLEA 3U2OA 1W3LA 2BG5A 4A3QA 1BWVA 1A80A 1UA7A 3CGTA 3QF0A 1FA2A 4FNUA 2OCZA 1C3FA 2I56A 4PMRA 4JFUA 1FWGC 3GIYA 5LIKX 4HZ6A 2DZVA 2P10A 3C2RA 3MB9A 3ZVHA 5CLTA 4Q4SA 3U57A 3W1LA 2WQDA 1RJQA 3P6LA 4DUXA 3TYCA 1WXYA 1G67A 4MF4A 4Z2LA 4MUPA 4B2DD 1SFSA 2X0YA 4MLRA 2ISFA 5PTDA 3ITOA 1ADOA 4DM2A 5HR7A 3UCQA 2GR0A 4LY8A 2EPLX 1NQ6A 2ZRXA 2VYOA 1BKSA 1KW1A 4JYEA 3SN0A 4AF0B 5HXMA 2QMKA 3S5YA 4OQVA 2A3LA 1PJ9A 3PZOA 4NEVA 3WUBA 3WYZA 1YPFA 4RV3A 1CDGA 4O1FA 3TTSA 1VCFA 1BVNP 2GJPA 4LEQA 4HHHA 2EJAA 4KRUA 3SCRA 4C1LA 1O66A 2CLOA 1FFUC 4L5ZA 4E2VA 3PWAA 2PWHA 4L64A 1XQLA 1Q5MA 3G24A 1A5KC 1R3WA 4JHOA 4DXXA 3CTTA 3K8MA 2Y89A 3NSXA 1ZU8A 1REQB 1UKSA 1GPWA 3KRUA 3SAZA 3G6LA 3LXBA 4GJIA 3O16A 3GR7A 1XLMA 4IHCA 1C90A 3CZKA 2HBXA 4L9XA 4R7OA 3WLHA 4HMDA 3NGFA 3S5SA 1ZCCA 2XIBA 2R14A 3LI1A 2O4QA 1NQKA 1W1B1 1WDDA 3WY1A 3M0YA 3VILA 3S0CA 1ZJIA 3FS2A 5ENLA 2ZOXA 3I3BA 3KTSA 3TYUA 3GKFA 3SY1A 4Y9PA 3WBWA 3H4WA 4B90A 3EWUA 4DY1A 4PMOA 3UWWA 5G5HB 3GUGA 2A6NA 4IP7A 2I5IA 1GONA 2XSAA 2W5FA 4WJXA 3U5YA 1GETA 4Q8WA 1WKDA 3B0VC 1EJTC 1I2PA 1JQVA 3C2EA 1CXKA 3R79A 2HWGA 4RNHA 2DT1A 3ORWA 5KEZA 4LVAA 1X39A 2ZE0A 4NU7A 1OFQA 1XDMA 2OYMA 2E5CA 1JGMA 4S2CA 3GDTA 3LM7A 3QY8A 1YPXA 2ABAA 4IFKA 5EMYA 3SCQA 2OWCA 3VX1A 1NFBA 3GFXA 4H50A 4X22A 1ISYA 2Z29A 3B9JB 3N3TA 4M6QA 3T4WA 1B30A 1EGVA 2TPRA 1EEPA 2R9ZA 1RJPA 4HCHA 3WD2A 4GNJA 4TO8A 2VFFA 4GZEA 1D8CA 2X42A 4MUZA 3AS2A 5C8BB 1MVYA 2B31A 2YR1A 1YPIA 1XXXA 1LG1A 4GXMA 1MFUA 1JG9A 1OGGA 3HMCA 3M0VA 7TIMA 3T0CA 1LOLA 4LUTB 1UQZA 3ZJ7A 1VRXA 1Z69A 3NDYA 3WDJA 3V3WA 1CEOA 4LCSA 2X7WA 4DHGA 1Z9AA 1HVXA 4MYAA 1GRBA 4I3GA 2J25A 1H6VA 4R9OA 4FI4A 1LF1A 1J96A 1EEXA 4M82A 3GBEA 5I3JA 3TXVA 2VZOA 1J0YA 3P2VA 3NM3A 3HGJA 4QBXA 2AAAA 4L4PA 3WQ6A 1I8JA 1Q6OA 2XM2A 3LDVA 3TXZA 1UBSA 3L65A 3CZEA 2BXYA 4N9EA 5DO8A 3Q37A 3N6QA 3WQDA 4QROA 5CPTA 2VQTA 1UCWA 3SCNA 4WK9A 3MW7A 2BVYA 1XLGA 1SZEA 2FZMA 3NQ6A 3W1RA 4GNVA 4KW2A 1DXFA 2CLIA 3CASA 5AOUA 3R07C 2NSOA 1RA0A 2CPUA 1YX1A 3HN3A 3GD4A 1CLKA 1DPMA 1DQXA 2VZTA 2VL4A 5A2AA 3BLPX 1XLCA 1F3TA 4EPEC 5JRBA 1Z3NA 1WO2A 4H9TA 1VS1A 4Q7NA 2HPMA 5J5RA 1DIEA 3VABA 1LQ0A 1EXPA 1I2OA 2D1ZA 5K2ZA 1ZJBA 2VOTA 3S6TA 2GVLA 1XUUA 3DZ1A 3N9SA 2OX4A 2E09A 4XVDA 1QK2A 1XSJA 4YWOA 3TYBA 1TTQA 3H2FA 1SB3B 4IMCA 3I6TA 3KP0A 2PURA 2VDIA 2GJNA 4DX3A 2I14A 2ZIDA 4GK8A 4LUYA 3T44A 3BLLA 5I6SA 3DEQA 3B40A 4ECLA 2BGQA 3LEPA 1JCLA 4FS9A 3B03A 5FS6A 2I7GA 3NQDA 3PBGA 3CT2A 2FKPA 2HS6A 2YJQA 4W4QA 5H8UA 3TV8A 4GYKA 1X97A 2NUWA 1L6FA 4NJGA 3TSBA 4FMVA 4JTRA 3EOSA 3NAVA 4XZIA 4ZSUA 1TJRA 4DUOA 3KRZA 3R43A 2HCVA 2XWEA 2J27A 4PL2A 4XX6A 1SFJA 4J28A 4WGXA 3M7WA 1P0KA 1HP4A 4QISA 3ABRA 4JDBA 1OYAA 4LALA 3K13A 3SRKA 3O3RA 4KH2A 2EG6A 3VE7A 1AZ2A 3WUEA 1X8FA 3AMCA 2A5HA 3GVGA 3VUSA 2CETA 4LYQA 3AJXA 1BSIA 4Y8EA 1DJGA 1OY0A 5ECUA 2CHNA 4RW5A 1M6JA 1JPIA 2IQTA 4R53A 2QDGA 2RKXA 4MHBA 3UW6A 1V5XA 3TCEA 1WDQA 4B9YA 1EC9A 3T8QA 3W53A 1ZBWA 5HATA 4AWEA 1C8VA 2ANUA 3ATZA 1VFTA 3L66A 4EPDC 4Q6XA 1SFTA 3TYAA 4GIYA 1EGMA 2JIWA 4GVFA 2EQ6A 5DRIA 4QE1A 4A8RA 3F4WA 3MPGA 4MJ2A 1FRBA 2YDQA 1BVWA 2YDAA 2DSZA 1P0DA 5CPLA 4DJFC 1JDFA 3BICA 4AEEA 4GO9A 1CGUA 1UZHA 1KV5A 1RLDA 1WAWA 5G4HC 4I9AA 2I9EA 3L4VA 1ZAJA 4UQBA 4GZJA 4UR8A 2GDVA 1HKJA 3B04A 4IWWA 3VNKA 1MSSA 4EQXA 3WMLA 3W38A 1OK4A 2ZRWA 1P7TB 3BQ6A 3BLKA 3LI0A 4XAPA 1MMFA 4GXPA 5LA1A 3VOHA 2D22A 3NWRA 4DNHA 1QW9A 1W5PA 1WA3A 2J7GA 3T78A 5EA9A 4RZ6A 2CDUA 3VD7A 2PTDA 3IJ7A 4E3TA 2HNEA 1G6CA 2DT3A 1SPQA 2YB4A 2F84A 1HW6A 1FH9A 3ABXA 1B3XA 5M5DA 4LRTA 3SFKA 3MYOA 3QVQA 4C6IA 3ATYA 4XKYA 1I6NA 5K9XA 4H8VA 1JIBA 3RG6A 2Q3OA 3KTXA 5EY5A 1K7FA 3KBNA 4PMNA 3VINA 3WH5A 1E1CB 2CLEA 3VE9A 4IL2A 1MEWA 2W79A 4O1BA 3P8IA 1UROA 3AU6A 3GKAA 4V28A 4GQRA 3VAVA 4JNYA 5E5CA 3W7GA 1GTEA 1M01A 4UOQA 5CPNA 3GU2A 4DBEA 1M3UA 3KVJA 4I6VA 1SO3A 3M07A 4MKVA 4OUIA 1OX4A 4D6GA 3UCDA 1GW1A 4PMDA 4IMGA 1RZMA 3CAKA 3CZ8A 2P1FA 3R0KA 3BCDA 2R1KA 3W85A 2NV2A 2VEMA 1XL9A 2WSYA 4XUYA 3T7VA 2DIJA 5AECA 1OJTA 4Y90A 2ZDRA 3P74A 2PWFA 4J35A 1I45A 1EUAA 3MBDA 4JCLA 3MKVA 4HCDA 4NT0A 3IJDA 4MJZA 3GAKA 3MHFA 4XO7A 3MUZ1 4V2XA 2R1MA 2DJXA 3LCWA 4JIHA 3GVVA 4CLMA 2WW5A 3DFHA 1SZFA 2PLCA 3BPWA 2A3EA 1KBBA 3M0XA 5DCEA 4P5UA 3R10A 1BYCA 1HJVA 2WMIB 3W2KA 3W71A 4PULA 4HPJA 2F38A 3NNTA 1TUXA 2RFGA 1H7WA 2QJIA 4EWND 3QC0A 4IJCA 3WBYA 4Q4MA 4X63A 3AAMA 2L5HA 2YCLA 1HKIA 4LC6A 3ONBA 3BQ5A 3LHZA 1DWAM 1ZQ5A 2JGYA 2UBPC 1DJQA 3NQ2A 2GQ3A 1Q6DA 3LRLA 1ZXIC 4I6KA 2OMAA 4LYPA 4EAYA 1XYZA 3FJNA 3W73A 5LXXA 1OFRA 2EQDA 2Z1WA 1P4CA 2HZGA 3LV6A 4BV6A 5I77A 4Q7IA 3UR8A 3WD1A 1HKVA 2JBMA 1XW8A 2PP0A 4YTUA 1BRLB 2J7HA 2PWVA 1XLJA 2ZZ5A 1XISA 4CCCA 1E6NA 1DWGM 1QOXA 3NXLA 1GKPA 4NNAA 1DXEA 2J75A 1H1NA 2J9YA 1TPB1 4XVEA 5I09A 3ZYZA 3KDOA 2X8RA 4AC7C 2VXNA 4E0CA 1C8XA 1MNSA 2PDQA 5C2GA 3KOZA 5LNRA 2FIQA 2JQXA 1FCQA 2RJHA 4F40A 4PTDA 1Q3NA 4QTGA 2HQAA 1R3QA 4HK6A 1X2HA 1EBHA 1FP8A 4HK7A 1GV4A 1K8YA 2HVOA 3VIFA 1YXCA 1PX4A 2DW7A 3RCYA 3FVMA 4CNPA 4IFOA 4WDTA 3G0XA 4EK7A 1DE5A 3SRHA 3SUUA 5I0DA 1OF6A 1O1HA 2GFTA 3TC6A 4DVOA 2G50A 4LJ3A 4QNWA 3GNOA 3CAQA 4K8HA 2CWNA 1QNRA 4Q8MA 2OODA 3VDBA 1QNPA 3G1HA 4OWGA 5EBAA 2PC8A 2WOQA 2NQHA 2ISDA 1A5OC 4JIIX 1VYPX 4G56A 4H4XA 1WUFA 2YYTA 3WLNA 4PUKA 4FA3A 3HIJA 1V3IA 1FWDC 5I3FA 1SJCA 1HJWA 2BB0A 4DXVA 2FGLA 4ADWA 2WBKA 2GUBA 4CD4A 3BZGA 4Z42C 3C8FA 3BE7A 1MXDA 1EH9A 4FIRA 4BR1A 1SZRA 4PN2A 4ZXOA 4IT1A 1OINA 1XQKA 2PD5A 3IK4A 4UTFA 1SR9A 2ZZ2A 3APGA 2DU2A 1US3A 1XYAA 5EFDA 3DGBA 4CVUA 1OWQA 4FX8A 4S3BA 2QIIA 5EMLA 4MMWA 3OC4A 1KM2A 1QT1A 4NF7A 1E1EA 4EMWA 1GWJA 4OFCA 4PTWA 1F5ZA 1GOQA 2G4FA 2Z0IA 1B4EA 2YXGA 2QUVA 3TW9A 4PRRA 3WQ4A 5JH2A 4NILA 1TV4A 1VIZA 4A21A 1ZFJA 2JE8A 4AYGA 3HV9A 1QNQA 3MCOA 2BP1A 4O53A 3HQNA 4MJMA 4GUFA 3SEPA 3WD4A 3APYA 4U2ZA 1W2PA 3RO6A 3LUTA 3USZA 3N4AA 2CU0A 4CU6A 2QUMA 3WDIA 2Y85A 3RNMA 4F2TA 3ERPA 1QK0A 2Z1SA 3WJZA 3TQ0A 4NASA 4F4RA 3WFLA 4PCNA 1DEDA 4Z17A 1GTHA 4R9XA 6TAAA 5F2GA 1WOBA 4GI8A 1KM5A 4YLWA 3PC0A 2ONEA 1OSEA 3WL0A 3PJTA 3W74A 2YL9A 3AJ7A 1UR0A 1IR2A 2ZTKA 4FXFA 1TQXA 4HA4A 2PBOA 2QXWA 5K7JA 2WZMA 2DT0A 3OVQA 3PBUA 4XB3A 1BPLB 2WMHA 1EUNA 4O8AA 5ABEA 1XICA 3NVVB 3UR7A 4CD5A 1TZ7A 2W66A 2R8WA 3CUXA 5JQ9A 1LG2A 1UR9A 3D3FA 2C1HA 4I5XA 1ECQA 1WQ5A 3V5CA 1EJRC 3HPSA 2C0HA 4CD8A 3CLWA 4JFVA 3VD9A 1GQNA 1HQTA 1H51A 3WG6A 1BWKA 3UWZA 2YCJA 1C7SA 3LRKA 2X99A 3V7PA 3RM4A 3LS9A 2JKAA 1CXEA 3LSBA 4XD4A 3RCMA 4O8RA 1UOZA 1ZKQA 2XFWA 1T6MA 3WJSA 4EPBC 3LQGA 4F0SA 3EPNA 1I9CB 3BSGA 4G8TA 3GIPA 3CGCA 1JDDA 3CV1A 3N11A 4UFHA 5EBKA 3EOUA 3EPOA 5CC5A 3OU8A 2OQHA 3QY6A 1UR3M 3UA4A 2Z7KA 2YCEA 4QXIA 2FFIA 1W3TA 3AIQA 3LBOA 2CHOA 1YE4A 1JXKA 3ITXA 4CCEA 4S3CA 3PZ9A 1X8CA 2B7PA 4Z2JA 3NURA 3ID7A 2ODOA 4G1NA 1E4MM 1HFBA 3AROA 3N9KA 4LNYA 1B3OA 1XDLA 1K4QA 1XYLA 2PDKA 4B5NA 3GHSA 1R46A 4E4PA 5KVIA 1ADSA 3AHZA 1ONFA 1VEOA 3LLXA 1HKWA 1XIJA 1WV2A 5FKYA 4MZ1A 3EX4A 4N7QA 2A21A 3MDWA 1H2JA 5AC7A 4OKDA 3WSUA 3RNDA 4C5YA 1PKMA 4GIRA 4PFMA 4ZGYA 1LBMA 3KBSA 3WBEA 3VD3A 2XHYA 3RYSA 3PTQA 2RAGA 4NAEB 1VIWA 1OZQA 2XVGA 4RE4A 3VGHA 4FALA 3XINA 3RGTA 4TVCA 3C2FA 3E9AA 1PCWA 4GZ7A 2DT2A 5C70A 4QP0A 1UMYA 3FSUA 3MI2A 3KXQA 2B7QA 1IEXA 2DIKA 1BF2A 1ML1A 2PWDA 1GRGA 1RPKA 1X6LA 3B97A 3NZGA 4B16A 1ZNNA 1WKYA 2E5BA 3MU7A 3N12A 1UWAA 3PTKA 1KV8A 3QTPA 3RU8X 4KPRA 3UD6A 3I68A 4JEJA 2CBIA 4WKFA 4AVFA 1TKKA 5G5IA 3F2DA 4ERAA 2PD9A 4N0RA 1ODZA 5IBXC 5GRTA 4HSNA 2GGGA 2WOIA 1V0LA 4N6EA 2G5WA 4A3YA 2QAEA 4UFKA 4UTWA 2Z2UA 2RUSA 3Q6JA 4O11A 4N4QA 1Z32X 1ZENA 2O4MA 5EYWA 2ZX9A 1U1JA 1IEWA 4B5TA 1W1ZA 4YXGA 5CKSA 5A8PA 3LBCA 1OYCA 4DI8A 5DCBA 1CLXA 1DJWA 3NSMA 4DLFA 3EZ4A 2OGYA 4H4TA 4WXZA 3NA8A 3TN6A 1VAHA 2VR4A 3GIQA 3ISIX 1WZKA 4PMJA 3WELA 1B0IA 2WPEA 5BXPA 1R8LA 6REQB 3O6YX 1K6WA 3OEXA 2QUTA 3UG3A 2IKIA 1UKPA 3RAOA 3M0JA 1RCXB 1V79A 3GW0A 1EGZA 5D4YA 3W75A 2BC1A 1XBVA 3WJXA 4BCEA 2PWGA 1XIIA 2P0OA 4PMYA 2C18A 3VCCA 1ONXA 3ZWSA 4U3AA 3TU9A 2ZUNA 4FK9A 4Z2IA 1PHWA 3STPA 3ARPA 2F6KA 4Y6GA 1NY1A 2QJHA 5C9XA 1YTDA 3NQGA 2YQUA 3FY1A 4GY1A 4JAWA 5AC4A 4UMCA 3BL3A 4AAJA 9XIAA 3QPZA 4QS6A 4KCTA 1JRCA 3AYRA 3NEVA 1F74A 4R33A 1F2JA 5G2HA 3PB0A 2VFDA 4QEHA 4O10A 2XFRA 5JU6A 3UG5A 4EQWA 2PCEA 2VHLA 1DHPA 3GFYA 2UV8G 1T96A 2A7PA 3OG2A 5DMNA 2GJLA 1E6PA 3GO2A 2DW6A 5AVHA 2C91A 4H3DA 3S1VA 4QX4A 5I7GA 4KFOA 1EDGA 4G7FA 2TAAA 2GOKA 1R9XA 1ICPA 2A8XA 4K7YA 2IUZA 3LCGA 2QAPA 3UG4A 2V3GA 5D32A 2MANA 4QHRA 3FXGA 3AQUA 1VPYA 1FCUA 3GXPA 1MZHA 2HSAA 2ACRA 3TDFA 2BOEX 4YYCA 2E5DA 4H8NA 4KCWA 2X1IA 3VCNA 1FEBA 1B9BA 3K30A 2A1YA 3VMOA 1Z6KA 4NZCA 3W2UA 2ZBTA 4JTJA 1A5CA 5DMLA 1P6CA 1E6RA 3J7HA 1TPWA 3G1DA 5HNRA 1B54A 2EPOA 1AK5A 4FX6M 3UWEA 4CD7A 5HMSA 5JIWA 2EHHA 1BLIA 4AU0A 1MWOA 3C5QA 4UQAA 5C5YA 3D46A 1ZBKA 1YQ2A 2QCGA 1KBKA 1UH3A 1JAEA 3F2BA 2JEQA 1NF7A 1T41A 1W3KA 2CW6A 5AYXA 3DK9A 1UHVA 4M81A 3VM5A 4BI5A 1XC4A 3IJIA 2QJGA 3PZGA 2X1TA 4LAKA 4ML9A 3H23A 4JQ2A 5FIPA 4I7WA 1UWTA 3JW7A 1W8SA 4M0XA 2CEQA 1YDOA 2VWTA 3A7UA 1B9ZA 1NDAA 4ZOCA 3SCPA 3IRDA 2G3NA 2YW3A 3C0JA 1SJAA 4K8GA 1TJ2A 2E40A 4JOMA 3UA3A 1WAUA 5F4SA 4MNLA 1ZCOA 2TMDA 1VPQA 2R82A 1ITUA 1S5MA 3V18A 4IJRA 1GYLA 3QQ1A 4A8LA 3WENA 4DUWA 2DZSA 3W72A 4U4MA 4PSPA 1KO0A 4AZCB 3NL2A 4CQBA 1E9LA 4ROQA 3WNMA 3FIGA 1HTIA 4JD4A 4QJ5B 1U22A 1DL3A 3AWNA 3WNNA 2J47A 4H4YA 3KL3A 3AYTA 5IHRA 3STGA 4WZHA 2ACQA 1J6OA 1K9FA 3DJJA 2WPFA 3W7EA 5BCAA 3RPMA 1E0UA 1T40A 1I0DA 2GSEA 1Z89A 1L6WA 3W84A 3WK1A 3HJZA 1H7NA 3CAVA 4EM3A 9CGTA 2VC5A 3SN1A 5HWJA 3W7NA 4RKAA 1J01A 4LOCA 1X6NA 4XAZA 1XCFA 3C0SA 1E4LA 1UKQA 4GLEA 4ES4A 2A85A 2HTMA 5A3HA 1HJQA 1V3HA 1W9PA 1E55A 1EYEA 4HHPA 5E93A 2HVNA 3AC0A 3A7AA 4MKSA 4QCEA 4HHLA 3LM3A 4US5A 1UW9A 3TAOA 9RUBA 1FXPA 1XLAA 1KCXA 1YLVA 1N5XA 3W9ZA 3DYOA 4WDXA 1ISZA 1PYFA 5HUPA 3TOPA 4TIMA 4M7TA 1OK6A 4AIOA 1O5QA 3LADA 3BAWA 1YIXA 1XWYA 3CH9A 3XIMA 3FGCA 2HS8A 2YCKX 4HK5A 2AMXA 3FA3A 3DG7A 3WF0A 1Z7AA 4I8DA 1MO9A 1JCXA 4ZL1A 4G1KA 3QC3A 1Z42A 5ER0A 4HZ8A 5JCLA 1K3UA 3Q45A 1U30A 5C6MA 1EDQA 1NOWA 3O1NA 1VEMA 4Q6JA 2NLIA 4H8HA 3R13A 1DIKA 1LUCA 2ISSA 4OV4A 2WPCA 3B06A 3BGJA 1SO5A 2JF6A 1SFLA 3LGDA 1H7RA 4S3AA 3TK7A 1AW5A 4JTTA 2IPFA 4Y8FA 3LK6A 4UMAA 4WKHA 4HBKA 3VNMA 1E6ZA 1B3VA 2QJNA 4MM1A 1M7JA 1PZ0A 6TIMA 1E43A 4US5D 1NOUA 2GR2A 1P1MA 4LV9A 4J3UA 4H04A 4MB5A 3ZMRA 2D3NA 4N2YA 4QFUA 2BFGA 2C8NA 1XKJA 2OO0A 1BQCA 3GXNA 2OSXA 5FL1A 3W1NA 4X0VA 2HXUA 2PSNA 4GO8A 4PE8A 1PL9A 3AXKA 5A2CA 5A6LA 5H1WA 3W7LA 1E6QM 3N29A 3UPBA 4FEZA 4C6KA 1PIGA 2SFPA 3LMZA 1B3YA 3ZR5A 4P2VA 1UZ4A 2OO6A 3T0TA 4H9MA 1A5LC 3GH4A 3CMJA 5AB3A 3OIHA 2PF0A 4ZO7A 1S46A 3PUDA 3S2MA 4C6EA 1XS2A 5I78A 2Y5EA 2PP1A 3WNLA 3M0LA 5MKGA 3OVPA 2ALDA 4KS0A 1GNXA 1EP1A 5EMMA 5IFPA 2PS2A 1SO4A 2ACSA 3NOYA 3OG3A 1GVFA 3NQ7A 3OZOA 4JX5A 2XN1A 4H4ZA 1Q66A 1HF6A 5HOSA 3L4TA 3EYPA 4QCFA 4X9SA 3CV2A 3CHFA 4IQEA 3GH5A 4LBUA 1EC8A 3C8NA 3AOFA 3GG1A 2E9BA 4Y9NA 1KQZA 4IGMA 4NY2A 2OZ8A 4B5VA 1GOWA 3SCUA 3VKDA 1NWRA 2CXEA 3ZJKA 1YDYA 4F0KA 1U5HA 3TQVA 3TZNA 2RH9A 2B81A 3OIXA 2WYSA 2YL6A 4BF9A 1XYCA 2OEKA 1UC5A 4KQNA 2PI6A 2C16A 3EEZA 2XGIA 3L4UA 3M41A 2ZVRA 4AEOA 3WF2A 2G95A 2P0IA 1ME8A 5F4WA 3V35A 5G4WA 3CQ0A 1S38A 2XSXA 1E6XM 2OTDA 3MSGA 1QRQA 2W0UA 4ZCWA 4GWEA 4C65A 2E1DA 3DG6A 2EQ7A 3O2LA 1VCVA 1TA3A 1XYMA 3NUKA 1OABA 3GVRA 1RBOB 2YA0A 1EB3A 3WN6A 3NM1A 2A6LA 3UJRA 5CBJA 3AIWA 2V69A 1ZALA 1LQAA 2PMQA 1KFCA 3DHDA 3B0YA 2OEJA 1N5WC 3CEPA 1W54A 1TFVA 4PR4A 3IEBA 4LNCA 3RR4A 1OD8A 1KBLA 4ONVA 2XWDA 1NHQA 5CGQA 1KFKA 3AICA 2P8BA 2G3JA 5FF2A 4H4UA 4HU8A 4RZ5A 3O0FA 3UZZA 4AMAA 4L7ZA 3S5ZA 3WMCA 4JEQA 4KGLA 1XH0A 3ITYA 1QJWA 3HQPA 3MWAA 4O4VA 3GH7A 3CIVA 2PDXA 1D7KA 4E8CA 4PCFA 4KIRA 1MUCA 3MV11 3M5ZA 4NRRA 8RUCA 2YW4A 2G4JA 1IWAA 1A5UA 5LNVA 3QR0A 3TR9A 3RRXA 4LB4A 3NG3A 3HMJG 7XIMA 1GYNA 2WMFA 2E77A 2P8CA 3EX3A 2EAWA 1ITXA 1WOAA 3IWPA 3GU9A 5BOEA 5KSWA 1EJUC 1UZDA 4FSAA 3SGZA 3AS3A 2VGFA 1E73M 5D9MA 1PE1A 5BU6A 3MI3A 3MBFA 2D0GA 4ERIA 3LTYA 1QI2A 5KINA 4BQ5A 1KC7A 1LORA 3KLJA 3WBXA 4LH8A 4RX0A 4BS0A 1RY0A 3CWHA 4JTEA 2Q8XA 4C6OA 2POTA 4FOUA 4GVGA 4AF0A 2A2IA 3ELFA 2FVMA 4XZBA 3BMXA 3R2GA 4XTDA 2OYKA 5D04C 3DYMA 4PMVA 4LCQA 3V16A 3OLIA 2PDPA 4YTQA 4HNVA 4TU1A 4CN4A 2V81A 1Q6LA 2C19A 1BYDA 1TX0A 1PO9A 3ARXA 3S2LA 2NVDA 1BGAA 4GY0A 2J9XA 5FAGA 5AC8A 3P7YA 5FJOA 1R47A 4C6FA 4CCDA 3DYPA 3L23A 1W5MA 1YTKA 4HKPA 4W93A 5D9PA 2V5BA 5LKYA 3CMFA 5ABHA 1HKKA 4BEUA 1QR7A 4QRNA 5MHBA 2VI0A 4YPJA 2D24A 3UJFA 1JDCA 3M9YA 1AQMA 5A6BD 2EF9A 2O56A 2QCLA 4YS1A 4R7WA 1JOAA 4Z0JA 5K3VA 2CBVA 1XDIA 4ZENA 3EKLA 5ABTA 4K2SA 2VVSA 3EX2A 4UZUA 3OTRA 2FZNA 2CC0A 3M0HA 1EX1A 2X09A 1CLVA 1KXVA 1H5VA 1ZP4A 3CUHA 1JGIA 3F03K 3N6JA 4MY8A 1J11A 1OM0A 1KRBC 4S3KA 3W00A 1R2SA 1UB3A 1WXJA 2QUNA 3WDHA 4LA1A 3T8LA 1A5MC 1UP3A 2E6FA 3UYCA 2REQB 4GYJA 5D30A 1DORA 4QDWA 4F79A 4AB4A 2DSVA 1OGBA 3DK4A 3L0GA 2PTYA 2WWCA 3MYPA 3U6WA 1XFBA 3ABOA 1RH9A 1J8VA 4O1AA 1P5BA 2G0WA 2CZEA 3VOJA 3WF1A 1A3XA 1W5OA 4UBPC 4U5KA 3H24A 2VC7A 4J57A 1BG9A 1KBJA 3L7RA 3MTWA 2HV5A 4W8LA 2DDXA 4X9YA 1UD3A 1H60A 2OOFA 4MG4A 1K9DA 1H0GA 1A5NC 1FDZA 1WKEA 3L12A 2NV9A 1JNEA 1FVPA 2E4TA 5HINA 1TV8A 3Q2DA 2A79A 4HGXA 1GOOA 4Q7BA 1EPXA 1J5TA 2VEIA 3POCA 1RVGA 1TPDA 2CFFA 4ZTXA 4EKJA 4BEQA 6ENLA 2DPEA 2W3RA 5AYIA 3TA9A 4JTGA 1JROA 1ESWA 1KTBA 2YGYA 3CPRA 1CYGA 3P8JA 1FWJC 1ZBCA 3KS5A 3MHUA 3WBAA 4LV4A 1RQEA 5BROA 2Z6JA 5CSUA 3KL0A 5RUBA 3RU6A 1NWUA 2OR2A 5G2IA 1K9EA 3KVKA 3A9BA 3FKRA 3ZSSA 4NYUA 1ZY8A 5IRPA 1G9HA 4JICA 3PAJA 4F2BA 1M41A 3F5KA 3M0IA 3WEZA 4JFSA 3QZAA 4Z1AA 3QTGA 4HA0A 2BNJA 3THCA 2Q8LA 1K4HA 4IIFA 5I03A 1RJRA 3ITCA 4XO6A 1Q4WA 3CC1A 2ON3A 3EOLA 3LV5A 1CGYA 4NZ4A 1KRAC 3WNPA 2BXZA 5HR6A 2WVVA 3NQBA 3DK8A 2JKEA 4GE8A 4FR6A 4YU1A 1CXFA 1JXJA 1VFUA 3GE7A 3EOOA 3WLJA 1GW9A 3NO3A 4ZQOA 3GYCA 3NO5A 4FAMA 4RPQA 1PV8A 5KZEA 4LGXA 3MJYA 2C13A 5REQA 3EKZA 2V3DA 1F8WA 1AJ2A 3OHIA 3NSNA 1T8XA 7REQA 3HPAA 1QO5A 1UKOA 2WKGA 3HFYA 4I8YA 2WK2A 3CXBA 4IPIA 1ZLPA 2A7RA 3KS6A 4UB9A 3TFCA 1H7OA 1VRDA 2VX7A 2IPGA 4IXHA 5JUVA 3WO8A 1F6KA 3TYEA 3CYVA 3GNXA 1Q65A 1N2VA 2OYLA 2AKZA 4MNMA 5DBTA 3H2NA 3NQ8A 4D8LA 1XIGA 4NQ1A 3QGVA 1WB0A 3EB2A 2BDQA 2CCRA 3B3DA 1Q4NX 1J5SA 1QNOA 3H2MA 1JF5A 4L6OA 2P53A 4MWAA 2V5LA 4YCOA 1A0CA 4APNA 2YXOA 4FXRA 5CJNA 3EDKA 1AH0A 3W1PA 1H09A 3PM6A 1BXNA 1UWQA 2E3ZA 3AXHA 1Q63A 1VH7A 2R94A 2QT3A 3P14A 4JTDA 2PDNA 3NZPA 1EC7A 1KM6A 1IT7A 3CUIA 4DYJA 2Z2BA 3B0PA 1TB3A 1QMLA 4CN6A 4QNEA 2WSRA 4F0HA 4XG1A 1UWSA 2WSPA 4XD3A 2GWGA 1DNCA 5DY3A 1VFMA 3G3DA 3MP5A 3CB8A 2V0TA 2OSWA 1GVEA 2W54A 2OSYA 3BOFA 4XIAA 3REQA 3S2JA 3BXWA 1XYFA 3OYXA 3S1WA 4QITA 3XISA 1VC4A 1C9WA 4E2BA 1AMKA 4GHRA 1XGZA 4A3HA 3S46A 3SUSA 3AIRA 1US2A 5F1VA 1TPVA 3UPMA 3EWXA 1A5AA 1JZ3A 1M5WA 3MI6A 3R89A 4GIEA 1XIDA 1NP2A 2X16A 1UUQA 2NVKX 3CV7A 1OHLA 1QI4A 4O13A 2PU1A 5FESA 2VP8A 4MWAD 1EL3A 1VPXA 4LEFA 3TJ4A 4EXAA 2NWRA 3DC0A 1LP6A 4MB4A 4UQDA 1JYVA 3NVDA 5AYYA 3CLMA 1RV8A 1DE6A 4UMBA 2RHGA 4RW3A 4TVDA 4LW7A 1DJXA 3W28A 4Z2KA 3CQIA 1JRBA 1O5RA 4QSFA 2OEMA 3LQLA 1OIMA 5C71A 2V3BA 1OX6A 1LWJA 4QAIA 2J8TA 5FEZA 3K1DA 1MRQA 1AZ1A 2ZUSA 3H7VA 3EANA 4W7UA 3WH9A 2OZTA 1O68A 1T99A 3B05A 1HO1A 3N2BA 3NVTA 3N4EA 2E25A 2P5NA 3GQYA 1G01A 4WCJA 3EWBX 3VNJA 3FNDA 4PB4A 3VIGA 2H3BA 4N9BA 1UD4A 2DUZA 2E3TA 2FJKA 3Q4DA 3E2RA 4C6LA 4W85A 4HN4A 4UCFA 3CHVA 4H8UA 1DJNA 1FCBA 3C56A 1M04A 3RPDA 1PTDA 4LFYA 2ZZ3A 3UGRA 1UASA 1SW3A 2BBFA 4NZ5A 5CQ1A 3HPFA 3KP1A 1F3XA 1KXQA 4LU0A 3WQPA 1JPHA 3ITGA 4A8IA 1O94A 4O28A 1TUFA 4FDCB 3IIVA 3VZZA 4FLQA 2F6UA 1MDLA 2PRMA 3A4JA 4GACA 3W07A 1O1ZA 3TN3A 1TIWA 1N7KA 3M0ZA 2CKRA 2Q6ZA 3GR8A 4KCVA 7TAAA 1H61A 3EPMA 1C7TA 1DTNA 4GPNA 1JZ8A 1K02A 1GK8A 4GMEA 1XCXA 1FWSA 1R0MA 5E9XA 1KWKA 1KM1A 2G3MA 2J79A 4GUIA 1S2VA 3ECQA 1HG3A 2ZWZA 1Q7ZA 3BW3A 3KCLA 2NVAA 1W9VA 1OBAA 3VNLA 4AD1A 1DIDA 1VGAA 4IFKB 2CESA 4OBSA 3ZJ8A 2ZA3A 1J10A 4UNLA 3QYQA 3UQNA 4CKQA 1I60A 1V02A 3RJYA 1IE7C 2W91A 1W6TA 3RX2A 3IGHX 3QQWA 3A4XA 4IPJA 1W2VA 4PUEA 4EVZA 1M9HA 4HYRA 1JCNA 4GC3A 1JPDX 1HL2A 2D73A 2NQZA 5IDZA 3CEUA 1E70M 3HO8A 1VDVA 3JUGA 1K03A 3T0BA 4UQ9A 3NJ3A 1XLIA 3EWWA 5JCKA 1R85A 2ZX7A 1QVBA 5I23A 1KWGA 4YTTA 4IX0A 4A3RA 4B5XA 2NXIA 3BAIA 4WIWA 3QSTA 2WO5A 1ENUA 4Q8QA 1KR1A 5AYBA 3MUY1 3ZR4A 1PIFA 5M2FX 4EQRA 2J9ZA 3B9EA 4J3XA 2EBNA 2J8GA 2WLYA 3WFAA 4LPCA 3W7KA 4DWSA 1GVIA 2GSJA 3SQPA 5DT7A 4W5UA 4UOJA 2OZ3A 4WOZA 2E7FA 1EDTA 2F61A 4PZVA 1UKTA 3GNRA 5C9WA 2V68A 2WPBA 1CB2A 4NRSA 6XIMA 2J4GA 1XLHA 4IG2B 4W86A 2ASHA 2WMGA 3CWOX 4AD3A 4WF7A 2GUUA 3CUGA 3GY1A 1X6UA 1UWIA 3M6YA 2QPXA 2ZZ6A 4OV9A 3DX5A 4FF7A 4C6NA 4LT9A 3NS1B 3MKCA 1B31A 3VIMA 1Z48A 1JYWA 1F3EA 3N3MA 4JN8A 1JEHA 3Q67A 3OVGA 1K9TA 2ZX6A 1M68A 1S39A 1CGTA 3UF9A 3TKFA 5FMHA 3GNDA 1S3HA 1MUWA 3OBEA 1J0JA 1TWWA 5AKQA 1UYQA 4O54A 1UP0A 3B8DA 4PA8A 1Q7QA 1YADA 1W17A 4UTTC 1EWEA 4QLJA 4DWSD 5LIXX 4ZOBA 4ICCX 3SR7A 4ZQCA 3R58A 3WMBA 1Q85A 4YHGA 1W8GA 1E4NA 4K36A 3QW4B 5BW6A 1IHIA 1SR0A 3G1VA 4EX4A 5U25A 4K39A 2YA1A 4UZSA 1EHAA 1XYBA 1RA5A 3AHYA 1Q8JA 3N2MA 3PP7A 1J9YA 3FAXA 1F3WA 1V51A 1Y5XA 3HG3A 1MW2A 2XM1A 2VZUA 4EANA 3CGEA 3UY8A 3BGAA 2C7FA 1V02E 1XLKA 4JFWA 2PA6A 4L6HA 3WQFA 1GJWA 3LPPA 2PDIA 1SSGA 4B3LA 4GNKB 1NVMA 4M5PA 1VFSA 1GPFA 5D2XA 1KLZA 3N2TA 3BMVA 1A3HA 2A3HA 4Z1BA 3M0MA 3AXIA 5A2BA 1PZ2A 4GX8A 4ZSTA 4EF8A 5HULA 2PGFA 3EDEA 1ODUA 4WSHA 3UZ5A 1CTNA 4HNUA 1PPIA 4AD2A 2NLYA 3EDFA 2GDQA 1CECA 3WL1A 1JJKA 5AHLA 3TNOA 3W26A 5LIYX 3UVIA 4LS2A 1ADDA 2WVUA 3TQPA 3AMLA 1F07A 1JF6A 2ZZ0A 4UQEA 3QW3A 3W87A 5TF0A 3WLQA 1XV8A 4MAVA 5D2TA 2C3ZA 1F8MA 2X05A 3KHJA 4U28A 4L61A 3W7OA 2X40A 3MO4A 4U2YA 2W63A 3R1ZA 4BQ4A 2J78A 4LVBA 2C15A 5DF0A 4ZXLA 5GJMA 4M6UA 3MWCA 4UTJA 1R3TA 4ZA0A 4JQ1A 2EKGA 4Q8VA 2X30A 4JTIA 4CD6A 4L1WA 1MDRA 1TO3A 5J04A 3AS1A 3BDKA 4FOJA 3F2CA 2VR2A 6ALDA 3W81A 2W62A 3G0SA 3MVIA 4HNTA 1H41A 4HB7A 4ZTYA 5J8LA 4B3KA 1RQHA 3ZFHA 2V30A 4S3GA 1KNWA 5EPDA 3N4FA 4HNLA 1SJDA 2QCDB 5HNUA 5KZ6A 1P6WA 1E56A 1MQPA 1DOSA 4DJED 3BH4A 1GVYA 2BZNA 3ABZA 5D2WA 3LXCA 4LAUA 1XC6A 5FOOA 1O95A 2CZFA 4PUDA 3KBVA 4GYPA 2BXVA 3A21A 4NYYA 2P3ZA 4JR5A 2JGQA 3DFOA 1V3JA 3OZMA 3DN5A 3DDMA 1NH6A 4XKYB 4OT7A 3ZT6A 4O12A 5CAKA 1CNVA 1LT7A 1XCWA 3JZEA 4JX6A 3RR1A 3SURA 1O12A 3ZR6A 2VQUA 3C61A 4X3ZA 3RF9A 3WQWA 4YN5A 4KWSA 4J56A 1ICQA 3PZQA 1RD5A 3UVAA 2BC0A 2WSQA 2WCGA 4RR4A 3MA8A 4A6GA 2DVTA 1DTUA 2VOMA 3GTHA 1KFLA 2Z26A 5DBUA 2WKLA 5BXTA 1EO5A 1XFCA 4KWWA 3FKKA 3BLFA 4HSHA 2QJJA 4JYDA 4C6CA 3S42A 3W02A 4D6JA 2BHZA 2O92A 3TJXA 1OFEA 1F8IA 1OX4B 4W7WA 2AL1A 4WGHA 2OKTA 5A8GA 3CHDA 2QGHA 4IUOA 2GYIA 3SCSA 4RV8A 4Q33A 4NXSA 2WNWA 3TNBA 1LTDA 4GGHA 1BEUA 2X50A 3C2YA 4EAMA 3DI1A 3HG4A 4JTAA 4QS5A 4HTYA 1NOFA 2WNQA 5TD4A 1ICSA 1S2CA 4TTUA 1JI2A 4UR7A 3C3UA 4D1JA 4WX2A 1DJZA 1B57A 5LHEA 3E5PA 1AVAA 3MP3A 4XSLA 4AUBA 1K8ZA 1ZPTA 2EQ8A 4M19A 4JTUA 4BF7A 4WY0A 2YOCA 2W0HA 3MKKA 3UWQA 4TTGA 4MNJA 1K8CA 1CXHA 2JEPA 1XGEA 1NU5A 2YBTA 5BRBA 3MV01 5IM51 4JDRA 4PL1A 4IQJA 3ARZA 5D8ZA 3GB6A 2YCLB 3Q65A 2J13A 4JIEA 4O15A 4ASTA 5D03A 1MXGA 4CQCA 2WLZA 1W56A 2Q01A 1RLCL 1ZSXA 3G3MA 1Q13A 1EHNA 3RM8A 3KOYA 2WNNA 4JGDA 3SN4A 4JKKA 4ZQPA 3W2LA 3WQ5A 1OC6A 4RPPA 4QJ3B 4JBRA 1JDEA 2WQPA 3W1QA 3VGFA 4A8NA 3BG5A 4C1NA 1Y8BA 4JDYA 2EPHA 5A6TC 4DUVA 1WX0A 3CIWA 4WKAA 3VKJA 3TYZA 3W7JA 3M43A 2W3ZA 3MSYA 2PZ0A 1FFRA 1LZOA 2G37A 3CHCA 3WH8A 5ECVA 1RBLA 2QAFA 1IV8A 3IACA 3VC6A 5CZKA 2WBAA 4S3FA 6PTDA 3UZJA 3M16A 3QXBA 3O8AA 4FNTA 3PULA 4J1OA 4ZFMA 4D6IA 4HN8A 4DF2A 1RR2A 2HISA 4ZFCA 2EG7A 3AZSA 1PX8A 1GT8A 3I4EA 2ZZ4A 2EXOA 4EF9A 4CNUA 2VGGA 3IJ6A 3BAYA 3B8SA 5CAHA 2GRTA 3BARA 3WDPP 3PZIA 3WK0A 4Z1DA 3IIPA 3OGVA 3ABSA 1FWTA 5JCNA 1CI1A 1M7PA 2Y8KA 4DRSA 3NVZB 3ARRA 3MSRA 3GRSA 4DQWA 4WDWA 2BVTA 3TTQA 3FJLA 2DZAA 2PLMA 2CERA 1TIMA 4X2PA 1Z44A 1HL8A 4GJ1A 3IJQA 5D09A 3VGGA 5F1UA 3T05A 4GQBA 2YDSA 4K7VA 1ZJHA 1TCMA 4JL2A 4FXSA 1DQUA 3ALFA 3PG9A 1WZMA 3CO8A 4GABA 1UPMB 3BAJA 4ROPA 4GI9A 3B9DA 4AISA 1C91A 2VRJA 1JUKA 4KEMA 2XVLA 3SY5A 3W2JA 3UWUA 4PB5A 1ITCA 5AHFA 2ZZBA 4AWTA 3ARTA 2J77A 4TUFA 2XPKA 2GJRA 1O4UA 1Y5WA 4PMUA 3HM7A 3A9IA 2JIEA 1O6IA 4S38A 1GEUA 2G97A 4JKLA 2D2GA 5A6KA 3L5MA 4V1YA 3TSDA 3OA3A 2QIWA 4CVWA 3E12A 3R6IA 3UZWA 4PBGA 1HJXA 4OGZA 2I5QA 3ALGA 3AS0A 3JS3A 4PRTA 4BQ2A 4H9VA 4OOUA 5C9UA 1DYSA 1K70A 1J0ZA 2EKCA 3NCOA 2QHAA 1THFD 3A3XA 1EO7A 4HNNA 4X2RA 3VNDA 5FS9A 8XIAA 5JIPA 3FXYA 3RM9A 3NZ1A 1W1PA 4ADSA 2R9RA 1UJQA 1EFZA 3NRZB 3TN5A 2KX9A 2OT0A 3E0IA 2OT1A 4HCLA 2F6XA 2INEA 3DH9A 4QJ1A 1IYXA 1JCTA 1ZAHA 5FJPA 3UFYA 1PX3A 2NWSA 2Y5JA 4Q4KA 4OJYA 1R38A 4TV6A 5C9ZA 1S2TA 2ZICA 4C7FA 1D3GA 3SI9A 4XBSA 4AD4A 8CGTA 3H55A 5HA7A 1CXIA 4KBXA 3GK0A 4K38A 4PUUA 4GFSA 2ZA1A 3MO7A 4JN6A 4X60A 1UD2A 1V6UA 3H54A 3E0WA 3FHQA 4XAFA 1WE5A 3TCSA 3M4HA 2FFCA 1XRVA 2I16A 4LS0A 3U2EA 1IIHA 3UY7A 4G7EB 4ZQMA 1NJJA 1TRDA 4QQUA 3MSDA 5J5DA 3EWZA 3VCRA 2ZTJA 3KLLA 1BXBA 4M52A 3KCOA 5EMJA 2WJFA 1GOKA 3MMDA 2AQOA 3T9PA 1YDNA 3Q94A 4RXGA 1GZGA 5TQLA 1KQYA 3VKKA 2PDYA 4P8XA 5FJJA 4BWLC 3WF3A 5EBUA 1P6BA 1H49A 2Y2WA 4I7UA 1WXZA 1K7EA 3G22A 3OHMB 1XGDA 1V7AA 2WVSA 3GG8A 2VFGA 1UWRA 1KA9F 2X1SA 4W8BA 4B4HA 4I90A 5C0QA 1X7FA 3BG3A 3O07A 4JTQA 3CJPA 3V0TA 1AW2A 1LWIA 3PBWA 4M51A 4DJDC 3I3DA 3VU2A 5I06A 4WY0F 1EQCA 1XIHA 3N2XA 4WLCA 1TR1A 5D02A 2ZXQA 2VELA 2WAGA 4RCXA 1AFSA 3BOXA 2EG8A 1QATA 2WSKA 1U5JA 3V0UA 1EBGA 1QWKA 1MQQA 1KFJA 2PP3A 1G4PA 4H9YA 1IXNA 5CPOA 1M7XA 3WD0A 2QVNA 3AALA 3DKLA 4NI8A 1POJA 1IZKA 2Z2AA 4I9TA 2QQ6A 3TLLA 1KTCA 2WP6A 2Y24A 4D6EA 2OLHA 4PH6A 3UG8A 3NYDA 2WVTA 4KWOA 4RLIA 3O06A 2QYGA 1LBLA 1FH8A 4KFNA 3S1XA 2BGSA 3PBVA 3B0UX 4U5IA 4AEFA 3LN3A 1LDCA 3LB8A 3QY7A 1Y5VA 3QMTA 4WVXA 1J93A 1QPQA 1W37A 5JCMA 2A4AA 1FHLA 3I7QA 4UTHA 5FF4A 1W3HA 1AW1A 2WHKA 2XUCA 3DCPA 2CHRA 3QZEA 3ZLHA 1HL9A 1YMYA 2BSLA 4AX6A 1Q6GA 2WWDA 4P8VA 4D2JA 4HNCA 4PUJA 1B4KA 3KBMA 1S5NA 4HPGA 1AL7A 3N04A 1M65A 3VTRA 3PPGA 1IZCA 4XKMA 3ONCA 3LNMA 3SR6B 1G94A 1QBBA 3AMGA 2GQAA 3FYYA 1JULA 1EJSC 3SUWA 4ACZB 1QNSA 1YNPA 2A0NA 4LRSA 3H6OA 2A7NA 2GGEA 3IANA 3GXIA 3WH6A 4IXXA 1UOKA 3NVWB 1XBYA 4RXFA 4JTKA 3C4UA 1V0MA 2IQ0A 2ZWYA 4BKNA 3S1UA 1RBAA 3UXLA 3CBWA 1OF8A 1R3VA 1QCWA 5K4ZA 3S9IA 1QO2A 3SB0A 1W91A 3P0WA 5XINA 3V5OA 1G69A 3WD3A 2E6DA 3KVLA 3BO9A 5XIMA 2FLIA 4L56A 3SDOA 1P0EA 1BZLA 5M3WA 3ZO9A 4GCAA 2CLPA 1XD1A 4WHBA 1KCZA 3S2CA 3VZYA 4DJEC 1HIZA 3QFBA 3EX6A 4Q8PA 2HK0A 4D72A 1GG1A 5FF3A 1FWBC 2FDMA 3WFZA 3DBPA 2X0HA 4GYFA 4H7VA 5LGZA 2V9DA 1D8WA 2D2HA 1D2KA 2PZNA 3WLOA 1KGWA 4GG9A 5D8WA 3PY2A 4S3EA 4X0NA 3BVJA 3HFTA 1HO4A 3FFSA 2Y7DA 1FP9A 2OFJA 1MUMA 2FZ8A 5E0KA 5H8MA 4HVXA 1BGGA 3OLEA 1FOBA 4IMAA 1GORA 3VIKA 1V3MA 1C9DA 4H6QA 4O4WA 3BLDA 4H19A 3CQJA 5DMMA 4BJHA 4LVFA 3DENA 1Q6EA 3HGOA 2CLLA 3TC3A 3D47A 2YSWA 4NZ1A 1A4MA 3F5JA 1PB0A 3KBWA 4KETA 5B80A 1FEAA 4LCRA 1GQKA 1DIOA 3SRFA 1RK5A 1BYBA 4OECA 3HQOA 3NQVA 4WR3A 4DPPA 3WQ8A 3CT7A 2WHMA 3RLHA 1HGYA 3W7MA 1QDSA 4RE0A 3C0LA 3TAKA 5FL0A 2VCBA 4GYPC 2GDUA 1O5KA 2FB2A 4AZ5A 2XIOA 4C90A 2NV1A 3EOEA 4PUMA 3E6EA 2AGTA 3TW7A 3DFPA 3OLGA 3GRTA 2C0AA 2W67A 1TTJA 5LIUX 4GUJA 1NHPA 2CNCA 5HDRA 4PRWA 4LAMA 2W61A 1I1XA 4W89A 3LA4A 2DZTA 3UT0A 1OCJA 3UWVA 5E1QA 4AIUA 2ZZ7A 3LLFA 3T09A 3CTLA 4JX4A 1A50A 4CNTA 2H6RA 4LY4A 4JTCA 1NF0A 1XLLA 1XG4A 1QI5A 5U4NA 3AHTA 3OZYA 2VVNA 3RMJA 3R4IA 4KIEA 3M6DA 3L9CA 3L0KA 5D38A 4AZ7A 2I5GA 1V4YA 3ARSA 1LOSA 4H6RA 4QG8A 5LNWA 2PEVA 3IC9A 2IKGA 3K46A 4PTNA 1ZMCA 3O7UA 5U7SA 3AZRA 4GI6A 3WMSA 2PDGA 3C6CA 3RLGA 2H9AA 2NQ5A 1GHRA 1R86A 2FYMA 2QZRA 1CIUA 3DOPA 2WJDA 5LIWX 2F5ZA 3CAWA 4KEUA 3W1AA 3N18A 3EXTA 1C8YA 1CPUA 1DWHM 4FIQA 3N34A 5HWMA 5T9BG 5A8QA 4ZBCA 3KCJA 5BYWA 2OB3A 4QE5A 4MZYA 1SGJA 1WNOA 2XZ7A 3W2MA 2INZA 1OQFA 1YXDA 4IPLA 3TN4A 3QV8A 1PCKA 1ZMDA 3OJGA 3R5EA 4LUSB 3TW6A 2XH4A 3GTFA 1JDAA 2YCIX 3G2GA 3T4CA 3T0AA 1MZRA 1QBAA 3H21A 3IJLA 4Z08A 1Q2SA 3BGGA 2GJXB 1F9CA 3E96A 3PTMA 1KFBA 5EU9A 4JCMA 2NZLA 5CSRA 3QR1A 3CMGA 4Q32A 2YBUA 4KFPA 3H2OA 3DHFA 4KRZA 1DWFM 4CU7A 4H4RA 1A53A 1U2YA 1TV5A 1EJWC 3EWCA 3I6RA 4F0RA 2BY2A 3LZ5A 2UY5A 1TZZA 2GQ9A 2I57A 8XIMA 3EXRA 2CWXA 2AKMA 2JFEX 3M46A 5KZDA 5FSEC 2O9RA 5IFTA 7ODCA 2QPSA 1GRTA 4A2RA 3P93A 4DF1A 1V77A 4ILSA 1IR1A 2AOSA 3VNIA 4DO5A 1JAKA 1W1IE 3DU0A 5DLCA 1V08A 3EWDA 1YHTA 4OE7A 4GISA 4POCA 5CSSA 4CQAA 2YDRA 3EA3A 4AZHA 1F61A 3DBNA 3SUVA 3UZYA 2YFNA 1J2BA 2QEZA 1ZZMA 3ANUA 3QBUA 4R88A 1OT1A 4L1XA 2W27A 1GESA 2BVWA 3GNNA 1H2IA 1Q7MA 2ZX8A 5H2ZA 4YVXA 4Y9OA 4S3DA 4E2OA 3QGKC 1EJXC 1GCYA 2R1LA 4DJFA 6XIAA 3BW2A 3EDDA 3GDKA 4AZGA 2NQ9A 1W9DM 1XX1A 4J2MA 2YB1A 1Q8AA 2GK1A 3ITVA 3LCLA 4TR9A 4IIGA 4RDWA 4NX0A 3PTDA 4MGGA 4N6FA 1TPFA 3L68A 1LUCB 2VDGA 1KRCC 3UWYA 3W0KA 4EQSA 1N8IA 2AQWA 4GJJA 1UD8A 1JYNA 1AD4A 3F4NA 3BV7A 4C6DA 4HMNA 2IS7A 4W7VA 3QLDA 3K2GA 3UPWA 4JIRA 3W70A 1HX0A 4RZ4A 2GGHA 4C1KA 4MFEA 2GUYA 1STZA 3PZNA 1HJSA 3NOEA 4AHPA 3KVMA 2W4XA 1DWJM 4INFA 2YPIA 5LNUA 3KRBA 4E8GA 2AL2A 1BWLA 2J62A 3KX6A 3MCNA 3VIJA 4CU8A 2WZHA 2JK2A 1TWZA 4DJFD 3O63A 4DZ5A 1TWIA 2HPIA 4PCPA 3ARYA 2OJPA 3ZT5A 1NHSA 1FBAA 1PZ1A 4M8UA 1XJBA 2ZCGA 2BCPA 1ALDA 1ISWA 2ABBA 3N1AA 1AQHA 1UD6A 3N25A 4F0LA 4DWDA 4C6QA 2YFOA 2XVKA 3SSJA 3UXKA 4OOZA 1Z41A 3FW6A 3W2NA 3DECA 5BU9A 4QEEA 4J2PA 2Z6IA 1BTMA 2FTPA 5FJIA 5FJRA 5BZAA 3ITLA 5MKGB 1YBQB 2PDHA 1TQJA 3VDAA 3A64A 3MMWA 1VD6A 2ZZCA 3O15A 5C54A 4MY1A 1J2WA 3A4WA 5F2IA 4NHVA 4K1WA 1E0WA 3FYOA 5D9NA 1CCWB 3ZQ9A 3OB8A 3EMCA 3TJLA 1JD9A 1GOMA 2BV9A 3EF6A 3IPWA 3QOKA 3LX9A 3QV6A 4IGNA 4QAWA 3S5OA 3NTYA 2HE8A 3PJXA 4DZHA 1LRNA 3LHUA 5BRQA 2Q71A 4KPLA 1QPOA 3RDKA 2YA2A 3QFAA 1BXCA 4DEFA 1GVOA 1NDZA 4GVIA 2WM1A 3H22A 3U8GA 1ZL1A 2Q8ZA 2RDXA 2NX9A 1QTWA 4IMEA 2ZDSA 4W9TA 1GUVA 4H2CA 4AWSA 4C7DA 5GNZA 2X2YA 3PB2A 1OB0A 3TH6A 3FOKA 5CG7A 4B5SA 1TPC1 1R3SA 1TZ9A 5KITA 2R1PA 2ZRZA 2Q02A 1TA3B 1PZ3A 5FI8A 1TMHA 2E6AA 4HA3A 3CYJA 3R8GA 4U31A 5G4EA 1W1TA 3B8UA 3PWGA 1OD0A 4XD6A 3NVYB 4PMZA 1G7VA 5T26A 4AHQA 3VIIA 4XZLX 5HAOA 3EKGA 3W01A 4B2DA 3SQMA 1KKOA 2VMFA 3ANVA 4BI7A 4IX2A 3OGRA 3WJYA 1KTNA 3CZGA 3P5YA 5AHNA 1VBRA 2C3CA 1LM1A 3RRAA 5G1YA 2V3FA 1E6SM 1FQ0A 4PTMA 5CPSA 4QIUA 4RDZA 5IOBA 1OEPA 1R2RA 3SCVA 1TX2A 3AIVA 5I02A 3O0HA 4H4PA 4H4SA 1QI0A 1VHCA 3U7BA 1KCKA 3D0CA 4PUWA 3T1GA 3E0LA 2YZ5A 3G1SA 3W25A 3GZAA 4D1IA 4AWUA 1EA9C 3GTNA 4FPSA 4GRTA 3F4DA 1KFWA 4R85A 2QCCA 1IEVA 4HOZA 3MANA 1JZ5A 3R8HA 3L4ZA 1IEQA 1GSNA 5LYRA 8TIMA 4XD5A 2Z4GA 5HMFA 3IGUA 2BY3A 4IMFA 3N73A 3GD3A 1QOQA 2CKSA 4NZJA 5T9CE 3S6DA 3SRDA 1QHPA 3EXSA 3GXFA 3DGHA 3A3HA 1X1ZA 1RP9A 5LXEA 2YVGA 3W83A 3IAPA 3L2IA 3VK5A 2XH7A 4HD5A 3CWNA 3STFA 1MOKA 4B5WA 3MUCA 3FJ6A 3W7CA 4AFYA 4TX9A 4KEZA 3LHVA 1FWRA 1GVSA 1QPKA 2CIPA 2QF7A 3BG9A 2DORA 3C2VA 1EPVA 4KERA 4J3TA 1GKRA 1QW7A 4DAIA 3NPVA 3E02A 3MHGA 2OLAA 1GRFA 2FHCA 2FHFA 3WLMA 2HK1A 2C71A 1SU5A 4F3HA 1GQLA 4J3ZA 4MB1A 1N82A 5LHFA 4A2SA 2XH2A 3O0KA 3KE0A 1EP2A 3I3EA 1TV2A 5LSMA 1MEHA 5XIAA 3W27A 1TVPA 3B9OA 5A5WA 5CCZA 3PBMA 4JKMA 1XI3A 1YNYA 4GQ0A 1GOIA 3H53A 3KAOA 4GKTA 1LL6A 3M7SA 2FB3A 2INFA 4EE9A 4PEKA 2NQLA 1JZ7A 4LYRA 2Z28A 1UZ1A 3A47A 4TX8A 4DO6A 3KZPA 1OC5A 1UR2A 5I5RA 4MIMA 3B9AA 4K3ZA 5CPMA 1UBPC 1J4EA 3K5XA 3I6EA 3HTWA 5ABGA 1YRRA 2HXTA 3GXDA 4GC4A 4BA0A 2W92A 2NX3A 3DUGA 5FJUA 1MEIA 1JI1A 2HRWA 3IUHA 1TPH1 1FWWA 1TJ0A 2BHUA 1BTCA 1I4NA 5LGXA 2VC6A 1HT6A 3IJ8A 2JALA 2X8GA 1TYTA 4GFIA 1WYGA 5BMWA 4Q8TA 4ZE5A 5FS7A 3GFZA 2WJEA 4OIFA 3UNTA 2VM8A 3LB0A 2FQIA 2BTMA 2CLHA 4O1EA 4R27A 3QSRA 4WUIA 3HJEA 3HV8A 2BASA 4ATLA 2Z27A 4GBUA 4IPPA 4L9YA 3UJ2A 1GHSA 3A23A 2EPNA 2ZUTA 3MVTA 1JZ2A 2VUYA 4NJKA 3QOMA 4CNSA 2VJXA 4AXKA 4H7ZA 4AVNA 3DGRA 1AMYA 3MQTA 3NEHA 3BJTA 3BCFA 3CL8A 4TOQA 1KBIA 1XBXA 2D2JA 3B8VA 1L2QA 4W5ZA 2ZA2A 2Z1BA 5JBFA 4ML4A 4MYXA 4Q4OA 3W1TA 1YNQA 2PTWA 4GH3A 4H9UA 2QCFA 3UXIA 1X98A 3THUA 1GYMA 5JMUA 2V82A 3CIXA 1ZTVA 1N60C 3EB3A 2PFHA 5AC5A 1PAMA 2XDFA 2G96A 3AHVA 5K9CA 5U1OA 3LMYA 4CNNA 5JXQA 3QQ0A 4FF5A 1HUVA 1U1HA 5HNNA 1Y65A 1M6IA 1VYRA 4OBTA 2RDWA 3HZ3A 4TVYA 1LQ2A 5DEZA 1QAPA 1HXJA 1E5JA 4IG2A 3L8KA 1KD0A 2HJPA 5CZTA 1XIFA 1UD5A 2BMBA 4HPNA 3LY0A 3N17A 2BOFX 2QCMA 2JF7A 3GHRA 4XAGA 1GVRA 2EQ9A 3KRSA 1R3RA 4B5UA 2FGZA 2HBVA 1QU4A 2VEFA 4R3UA 2DZBA 1L6GA 1S2AA 1SW7A 2WVVB 1PXGA 2FJUB 4FLSA 3U4FA 3RJXA 3M5YA 5GJNA 3HPXA 3RLUA 2GQWA 4OHQA 3PUGA 4IOTA 4PMXA 5L9FA 5REQB 3BLIA 2VNCA 1A47A 7REQB 2VFIA 2R91A 2WC7A 3BZJA 4D6CA 1DQWA 3QJAA 4XSMA 2B7OA 4JN7A 1FFVC 3SY8A 3W7HA 3QFEA 3NDZA 4FNRA 1JVNA 1HVQA 1S5WA 1GVQA 3CU2A 4LF1A 4D6HA 2YLLA 3WK2A 2TRSA 3CNYA 3F5LA 4P7RA 3EB4A 2R6OA 3C86A 3GUWA 3TX9A 3M0KA 4KWUA 1L6SA 3GC5A 4O52A 3KUMA 1OX5A 2DEPA 2JKPA 1T5AA 3LNPA 3QKZA 3POHA 3T55A 3WLRA 3THDA 1MQRA 3P82A 5TAOA 4MWAB 1D7FA 3LHYA 1ISVA 1HNYA 1RALA 2DVXA 2J3NA 5IBXA 5BWAA 3GLCA 2EPKX 4H6EA 4HZMA 1EJ7L 2FTYA 5GQBA 4HU4A 2XFYA 3N15A 3PG8A 1PDZA 1AH3A 4ZR8A 1C29A 3AXMA 3L67A 4Z2HA 1CENA 3ARQA 2FVKA 1CBGA 4HZ7A 4AZBA 5I3IA 3KW3A 1LT8A 1LWHA 1JZ6A 3OBKA 5F4XA 4HYVA 3CL6A 4C5ZA 1E71M 3S9YA 4XZMX 3VO0A 1Y7VA 4AMCA 1GERA 2NUYA 3REQB 1H3GA 1L9WA 2MUCA 3EX1A 3K8KA 4TMCA 4AD0A 4Q8NA 1PEZA 1F6YA 4URIA 5M17A 3KWSA 2QS8A 2OX1A 3MP4A 2VD9A 4UTIA 1CWYA 4O50A 3ARWA 4EPKA 4V27A 2C1IA 4M56A 1M03A 5HQMA 3P60A 1E72M 1UR4A 4GX9A 1H1YA 4GOAA 4HPHA 1WBHA 3P80A 4AY7A 3B8TA 4EWJA 2QPUA 5D2YA 2Z1XA 1UUOA 3GVWA 1TVLA 4L80A 2IW0A 1B90A 4MDOA 3W86A 4JPGA 2Y61A 5CLWA 3PSVA 4XISA 4JQ4A 2FZDA 1WZAA 1PKLA 4HT3A 3KOFA 4JQ9A 2DP3A 1TREA 2O7QA 3WF4A 3P61A 2VDHA 4DO7A 4ZMGA 2QCHA 4J27A 1BG4A 3KHDA 2DZPA 2QV4A 1SJBA 3PVFA 3PPHA 1BSLA 1OCQA 2GOUA 4HPXA 5E0FA 1SZNA 3I7SA 4I9JA 5D33A 1VLWA 3LGGA 4AZ6A 2QCDA 2PODA 2VRQA 1N8WA 3CQHA 4A29A 3WK3A 2D23A 3W37A 2CZ5A 3M44A 2TODA 3LLDA 1JYXA 1RK6A 4QLKA 1KGUA 2VENA 3RMEA 3S4TA 3VOCA 1W3NA 3GDRA 1OCBA 5FEPA 2RGMA 4BI6A 1U5VA 4DAFA 1BYAA 3FEMA 2D0FA 2PAJA 4HU0A 4GUHA 3UERA 3BLOA 2A3AA 3EBVA 1W5QA 3IIOA 4YWIA 1OYBA 3HGSA 1ZBVA 3NQFA 2WZIA 3NZQA 4UC5A 3V4BA 3OODA 2ZXAA 4B9ZA 1N8FA 3COTA 1VFOA 1G4TA 2Y4SA 3VUPA 2ZKMX 4L1GA 2X0SA 3GTIA 3G1YA 1BD0A 3V1HA 2XIMA 4LBRA 4MKNA 1CGWA 5FD0A 4DYKA 4OVXA 2PRHA 3RCNA 4GVHA 1TPEA 2IPJA 3GRIA 5FJTA 3PFRA 3SCWA 2ZX5A 5I79A 2PLJA 1B2YA 3HPZA 4E3VA 5DXYA 2VC9A 1XPGA 5HPOA 1H5YA 2BS9A 1NSJA 3PBYA 3E1F1 1W31A 3VIHA 2XVPA 5C7HA 4MPKA 3PK7A 3PHAA 5HBFA 4NNBA 3WDQA 3AWOA 1GOXA 4M29A 4D8ZA 4FLRA 4QDMA 2XVNA 3AFBA 3PJWA 1BFNA 3L0NA 4BZYA 4H4WA 3LOTA 3FN9A 1XH1A 3VM7A 2OZ0A 4F8XA 3P3BA 3W1UA 3EEGA 5DMYA 4XZHA 1Q6FA 3GVQA 4IUGA 5AN7A 1GXFA 1K4GA 3GAYA 3H4XA 4TVUA 5A69A 3MMTA 1SMAA 2W55A 4NXKA 3LYEA 4GR1A 3W4RA 1V6VA 3ABQA 4J4KA 2GR1A 3VKCA 4BHYA 2MNRA 4DWSB 1LVLA 3F7JA 4AXNA 2J6XA 2PWEA 2HDJA 2UY2A 1ZAIA 1OVDA 1C93A 1ZHAA 1IEIA 2QJMA 2A3CA 2VRKA 3T0DA 4AY8A 2V3AA 1Q45A 4HA1A 2B0MA 1X38A 3E5BA 2RGLA 3WLKX 4JNMA 1CXLA 1GRAA 5K4XA 3AMDA 4LVDA 3FVDA 1UA3A 3H2AA 3UEQA 2ZUVA 3B4YA 4LANA 3FG2P 4NAFB 4W84A 1DBTA 1IQ8A 4DNAA 4M3PA 2HE5A 4MTVA 2VX6A 1OIFA 2XN0A 4JFTA 1XBZA 1TPUA 2DUAA 4D6FA 1XSKA 1T7LA 3VNZA 1UG6A 5D9OA 3BW4A 1EZWA 3FAWA 1R9YA 5A94A 1TE1A 3WZ0E 2WB5A 3LENA 3EUB3 1EF2A 1RVKA 1RSCA 1SSDA 2NUXA 4NZ3A 2NSXA 3VC5A 2GLKA 1UWUA 1FKWA 1VLIA 1ELSA 1DJIA 4LVGA 4YVPA 3FCPA 3LXAA 5EL1A 3BJFA 4EP8C 4MLJA 1FXQA 5KZMA 2PDUA 1V97A 4EIVA 1CGVA 1REQA 1MFVA 3RXZA 2WKJA 1H50A 3UCCA 4UTWC 4E5TA 5FEWA 1YXYA 4P7OA 4DO4A 3WQEA 5D37A 5G2WA 4UQCA 2V5JA 2YVFA 4IMDA 1JPMA 3EAUA 3QR3A 4D71A 2CLKA 3H8AA 3NL3A 2DSUA 1LLZA 2QCNA 3DXIA 5CGTA 2E28A 4XV0A 3GM8A 2IMRA 2E6YA 3FX4A 2X1UA 2VZVA 3IARA 4DBDA 2J88A 4UTKA 1P48A 3WNOA 4NG3A 1OCNA 2AGKA 3ES7A 4RNFA 4O0ZA 3DESA 1NEYA 1S2UA 2GQ8A 3FYPA 4YWSA 5AFDA 3ZZ1A 2ZRUA 1LL4A 1R7AA 3R0DA 1W1YA 2OWXA 4N02A 5GVJA 4LYKA 3WNKA 3TFXA 3NDOA 3S8HA 5GPRA 4DM1A 1IWPA 2AQVA 6A3HA 5BOFA 3TTYA 1FHDA 4PFHA 1DXLA 4NZFA 4RE3A 4QM1A 1NFGA 5F2MA 1EIXA 3DFSA 3JRKA 4UFMA 1KN0A 4H9XA 4FP1A 4J40A 1GQIA 2DUXA 1MXSA 4J7RA 3N13A 4YJ5A 4F48A 3H2EA 2F7FA 1YDVA 4Y2WA 1IT0A 2DV0A 4FOKA 2FH8A 2V6OA 1J0KA 3L2MA 4WDUA 4AW7A 4HOWA 4X61A 1GRHA 4WEVX 2D20A 3EA2A 1G1YA 4ZQNA 1IXOA 3DI0A 2V3EA 3G1XA 1DJHA 1FWIC 1VP5A 1TMLA 4XZNX 4O16A 4MDPA 4AH7A 3WUGA 4UUIA 1SZGA 3T08A 5CBIA 4LUTA 2UY4A 2WV8A 2XG9A 4P8UA 4GGBA 1RUSA 1PYMA 5E6ZA 4V1XA 1ZY9A 5AC6A 2F2HA 2NT1A 2V6AA 1FIQB 3TVAA 5EKYA 2PDCA 3KDNA 4REQB 4MSSA 3JVAA 1FDJA 2PE4A 2GSHA 2FH6A 2XINA 3W6LA 3RN6A 1QPRA 3WQGA 2NXHA 5ABFB 4S2BA 3S6OA 5I3DA 4M24A 4G7EA 1J6PA 1V03A 4L6DA 3L4YA 4GA8A 2GH5A 1NM9A 1R9ZA 3V75A 1T0OA 1FO4A 1QOPA 1NIUA 3AIBA 1Z8AA 1FWEC 1XRSA 4PB3A 2HNHA 2V2CA 2DIEA 2AMGA 4C91A 5I3KA 4BFAA 3BCJA 1TTIA 2HEJA 3W7IA 2EEXA 5E70A 2PRLA 3OPSA 4FB7A 4LBSA 1H1ZA 1MO0A 4GY7A 3AHXA 1WBJA 3RFAA 3TWBA 5AHIA 2GVJA 3H2CA 3NQEA 2YYUA 1OFOA 4JL1A 4OZOA 2WBGA 1QWGA 3INPA 3NFUA 3I7RA 1SMDA 1EKOA 4IQDA 5AY7A 3CM4A 1E0XA 3GNPA 1W0MA 3PWIA 1DXIA 3AMKA 3DGZA 1MW1A 2OELA 4LC8A 3W7PA 1TWDA 2DH3A 2YL8A 3CGDA 2Y7FA 4JHZA 1LJYA 3AUOA 1VBGA 1K6AA 1N62C 1PS9A 3CL7A 3NQCA 5CBBA 1JCJA 2DZXA 4RDVA 3KL5A 4LIIA 1AUSL 8A3HA 2D2OA 3HG5A 5A6MA 4NJHA 4IGSA 4XIMA 1NWTA 4ICMA 4PTVA 5GJPA 1ONRA 3O05A 2XIQA 4AQLA 1TWSA 5KTLA 4QGCA 3IIZA 1FECA 3TC7A 4KRTA 5BOOA 1UIPA 1VJZA 1PTGA 1PHQA 3GDBA 2J66A 3MT1A 3PANA 3WQOA 3BUVA 5EMUA 3OZPA 3OBAA 1MYRA 1CGXA 1YW1A 3QHNA 4RNJA 7ENLA 5IHSA 1VZWA 3LCFA 1F73A 1FWCC 3LHTA 3LU2A 4WY0B 1L6YA 4PMQA 1FUYA 4QG9A 3OGSA 1ZP3A 3U7VA 1H4PA 1PKNA 1R7OA 3G1FA 4GI4A 1J0IA 2FMNA 3FDGA 4MZ8A 2X8CA 4PCTA 5AVNA 2TPSA 4NVTA 2D3LA 4G2DA 4EACA 2WHJA 3THQA 1NPXA 2R24A 3VA8A 5KMYA 2BWGA 3EMQA 4YNGA 1M53A 1G7UA 2H8ZA 1A5SA 1PBGA 3ZVHB 2G41A 5HJYA 1JCYA 4ATDA 4LUIA 4YHEA 1UJPA 3QEZA 4XUGA 1KM3A 5I24A 3LPFA 1HJUA 4P7QA 4IGHA 7PTDA 1ZS2A 4EMIA 1D3HA 4PSRA 2WCAA 2DQXA 3GG0A 1F6PA 4C1NB 2YBVA 2OG9A 4BQ3A 4J3WA 1KCLA 1XINA 1IXPA 1MW3A 4IH3A 3SIZA 4I5UA 4PTXA 1XLBA 3FSTA 3AZTA 2KAUC 1TE6A 4J9JA 4ACZA 4YIWA 1UUMA 1WPCA 3VIOA 3M5VA 3AN1A 2ALRA 1GEQA 2ZADA 3F4VA 4ZVJA 3CUFA 4HMCA 4S23A 3B8IA 5EMKA 1S3TC 1B1YA 3CZLA 4XZ9A 4KGJA 4NL1A 4MB3A 3BANA 1V6TA 5AHEA 3URAA 4R5EA 1EOKA 2PU0A 3NXFA 4HJFA 1P7TA 3GD6A 3VI2A 3PF3A 3G18A 3SQSA 4M1BA 3USBA 3OLDA 3A22A 3IJ9A 3WLIA 1EWDA 3VOFA 3W1XA 1LPFA 5M1TA 4IIDA 1Q6CA 3O6DA 1R5YA 3GU1A 4H2HA 1VCGA 3WEMA 4E38A 1BQGA 3W6MA 1TMQA 3CPUA 4A35A 2F8QA 2WHLA 5FF0A 1HGWA 2GVEA 1LBFA 2PTZA 1SUXA 4UTMA 4HIBA 5DT5A 2RJGA 3BSHA 3PAOA 1XKYA 3G6MA 1XDJA 5A6JA 1LLWA 2XIJA 1RQBA 1WCGA 3G0UA 4XBJA 1E1CA 5DX7A 2E0PA 1FTXA 1US0A 4O19A 2VD8A 1I0BA 1NAL1 3IUDA 3GS6A 3T2PA 2TSYA 1LOQA 2WZEA 4LX4A 1QFEA 1NWSA 4B91A 1RHCA 1A0EA 3TLQA 1C92A 4JY9A 4PC8A 3EDJA 1M1BA 3IVSA 3HU7A 3PFMA 1RCOB 5FEXA 1O60A 3RHGA 2VFHA 1GEHA 5CC3A 4E4UA 3ETRB 4PGLA 2PCQA 3GC2A 2OXNA 4F0MA 5JH1A 3AM9A 3L5AA 2OQLA 2V5DA 2WOWA 1LRTA 2RDTA 2JK6A 4DBUA 1AG1O 2FTWA 2XIIA 3A7RA 4YTSA 1WKFA 2VTFA 1OJXA 4LAOA 3M1ZA 3WLSA 4ZB5A 4CQ9A 3G8RA 4O18A 3TTEA 2Z00A 2D69A 4FNQA 2Y7GA 4EM4A 3N9RA 1D3CA 2QUUA 3WEOA 3ZM8A 4FNSA 1X1OA 2I17A 4AIEA 1KR0A 4ZEPA 3OP2A 4AZIA 4RE2A 5BXRA 5CXPA 4IF2A 2GWNA 1VF8A 2C14A 4H4VA 2WMIA 3E74A 2VURA 1EZ2A 1YE6A 3II4A 3D9XA 3PSWA 1VKFA 3GHTA 1V6YA 3A12A 1OFAA 3LHWA 2UZ9A 1QNVA 4FLOA 2G8ZA 3QPYA 2BY0A 2OKOA 2C1GA 1XH2A 2Y88A 2UY3A 3E38A 3TMQA 4FHAA 1T8QA 4L4OA 1Q2RA 4JIQA 1I75A 1NTHA 3WLLA 3PPFA 5BWFA 4IIBA 5A6AA 3VFLA 2YZRA 3GW3A 1ZX9A 3ZVIA 2C79A 2ZXDA 4N42A 1W9XA 1WUEA 4O14A 5JCIA 5HWNA 3P67A 4TV5A 1NFPA 3KWXA 1KRMA 5A6SA 5FSDC 3DC8A 4BK9A 1QPNA 4O57A 2DH2A 4AD5A 3U4AA 2WCSA 5TIMA 4KF1A 1ZUAX 4P7LA 1BRLA 2BGNE 4IM4A 1S1RA 3IAQA 2X7VA 2CLFA 3TSMA 3ZLFA 1S2WA 1FWHC 3LGEA 4M6PA 3VZXA 3LRMA 4H41A 2C3DA 4J3VA 4ADUA 4NP7A 3AIUA 4H00A 4I5RA 4MADA 4AX7A 5TR3A 3W22A 2VT0A 2FPYA 1UQYA 4G9PA 4CQDA 1IGWA 5DQPA 2YLAA 3A3WA 1OFDA 4MOZA 4LUSA 1KXHA 3HW2A 2BOGX 5C55A 5EGRA 1PDYA 2BVDA 2PLKA 4LB3A 1XD0A 3B4UA 4H83A 4HSOA 4ALDA 2GJXA 3QV9A 5K9DA 3MZ2A 4Y9AA 1FCVA 1GGOA 4HOXA 5CG0A 4OUEA 2VGIA 5AZ0A 3L4XA 3G5EA 4Z1YA 3L2LA 2G3FA 3FEQA 2PB1A 3UXDA 3GBDA 3II1A 4EXBA 1OGSA 2ZC8A 2BX7A 4AC1X 3MMUA 2QDEA 3URNA 4EMJA 1UR1A 1J79A 2Z1VA 1V3KA 3BV4A 4US6A 2NPXA 3BAKA 4P7NA 3UXAA 4IICA 3TQKA 3TJIA 1VYSX 4K6AA 1PWLA 3QZ6A 4L4MA 1OZMA 1E9YB 4XK2A 2V2DA 3VXGA 1NP0A 4O1DA 3DERA 4H6KA 2QDHA 3M5XA 3OOQA 2OOGA 1EYWA 5G1MA 4Z0SA 4HYWA 2VCAA 4O0QA 5GNXA 4QJ4B 1G0CA 1DWIM 2GPTA 4NI3A 2HROA 3NO1A 2Y5SA 3UJSA 1G5AA 2DFAA 1GJUA 1QASA 3RO8A 2W3SA 4UNIA 3T42A 3UU0A 1FH7A 4S1FA 3NPXA 2FZBA 3URQA 3W7RA 4HMEA 1LCOA 1SVDA 3UR5A 2GVGA 2YX0A 3LERA 2VO5A 2XYLA 3SIMA 4H4IA 5A1AA 4QE4A 2P88A 4Z1CA 3LD5A 1E1FA 2LLEA 3K4DA 3DFQA 3BWWA 2J8FA 2ZFAA 1AL8A 5HQLA 3SW6A 4DF0A 3V0SA 3ZT7A 1TTPA 4JZ5A 4NX5A 1AQ0A 3Q58A 1H0IA 4DELA 1XR2A 3GDLA 3CHEA 4GQGA 1JEZA 2XFFA 3PPCA 3HF3A 1EBDA 3U2CA 5HMEA 3FJ4A 4K8EA 2E5AA 4N9DA 1E0TA 4MY9A 4ENLA 3MY9A 5D05A 4YL2A 2IKJA