The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
129
|
sequence length |
387
|
structure length |
374
|
Chain Sequence |
b'VRIVDVREITKPISSTKMTTSLVAVVTDVVREGKRVVGYGFNSNGRYGQGGLIRERFASRILEADPKKLLNEAGDNLDPDKVWAAMMINEKPGGHGERSVAVGTIDMAVWDAVAKIAGKPLFRLLAERHGVKANPRVFVYAAGGYYGLSMLRGEMRGYLDRGYNVVKMKIGGAPIEEDRMRIEAVLEEIGKDAQLAVDANGRFNLETGIAYAKMLRDYPLFWYEEVGDPLDYALQAALAEFYPGPMATGENLFSHQDARNLLRYGGMRPDRDWLQFDCALSYGLCEYQRTLEVLKTHGWSPSRCIPHGGHQMSLNIAAGLGLGGNESYPDLFQPYGGFPDGVRVENGHITMPDLPGIGFEGKSDLYKEMKALAE'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of the protein L1841, unknown member of enolase superfamily from Bradyrhizobium japonicum
rcsb |
molecule keywords |
Hypothetical protein L1841
|
source organism |
Bradyrhizobium japonicum
|
molecule tags |
Structural genomics, unknown function
|
total genus |
129
|
structure length |
374
|
sequence length |
387
|
chains with identical sequence |
B
|
ec nomenclature |
ec
4.2.1.81: D(-)-tartrate dehydratase. |
pdb deposition date | 2004-07-12 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF13378 | MR_MLE_C | Enolase C-terminal domain-like |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Barrel | TIM Barrel | Enolase-like C-terminal domain | ||
Alpha Beta | 2-Layer Sandwich | Enolase-like; domain 1 | Enolase-like, N-terminal domain |