1TZZA

Crystal structure of the protein l1841, unknown member of enolase superfamily from bradyrhizobium japonicum
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
387
structure length
374
Chain Sequence
VRIVDVREITKPISSTKMTTSLVAVVTDVVREGKRVVGYGFNSNGRYGQGGLIRERFASRILEADPKKLLNEAGDNLDPDKVWAAMMINEKPGGHGERSVAVGTIDMAVWDAVAKIAGKPLFRLLAERHGVKANPRVFVYAAGGYYGLSMLRGEMRGYLDRGYNVVKMKIGGAPIEEDRMRIEAVLEEIGKDAQLAVDANGRFNLETGIAYAKMLRDYPLFWYEEVGDPLDYALQAALAEFYPGPMATGENLFSHQDARNLLRYGGMRPDRDWLQFDCALSYGLCEYQRTLEVLKTHGWSPSRCIPHGGHQMSLNIAAGLGLGGNESYPDLFQPYGGFPDGVRVENGHITMPDLPGIGFEGKSDLYKEMKALAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the protein L1841, unknown member of enolase superfamily from Bradyrhizobium japonicum
rcsb
source organism Bradyrhizobium japonicum
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein L1841
total genus 129
structure length 374
sequence length 387
chains with identical sequence B
ec nomenclature ec 4.2.1.81: D(-)-tartrate dehydratase.
pdb deposition date 2004-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1tzzA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1tzzA01
4IHCA 3QLDA 3TWBA 1MRAA 2PTYA 2XH0A 1OEPA 5BOFA 2PP1A 3N6HA 4HPNA 6ENLA 1JCTA 4HNLA 4E4FA 5J04A 1DTNA 1L8PA 1FHUA 4K1WA 2QJMA 3BSMA 4X2PA 2OZ3A 3R0UA 4HCDA 2PTWA 3MSYA 2GSHA 3SN0A 3V4BA 2FKPA 3Q45A 3MZNA 1W6TA 4IT1A 3VCNA 3RCYA 2FYMA 2PSNA 3ENLA 3PFRA 1ELSA 3ZVHB 3MUCA 4GMEA 2PTXA 3FVDA 3ZVIA 2QQ6A 2POZA 3THUA 3VDGA 1NELA 1EC9A 4KWSA 4G7FA 1TZZA 2GGEA 3SN1A 1ECQA 3CT2A 3ES7A 3T4WA 2HNEA 1JPDX 3DGBA 5EU9A 4GYPC 2XH4A 5BOEA 3B97A 4M0XA 1BQGA 2PS2A 2MNRA 3V5FA 3DFYA 4H2HA 1SJAA 4JHMA 3EKGA 2PODA 3I6TA 3UJFA 3SBFA 2XSXA 2OPJA 4A35A 4MKSA 3QKEA 3UJSA 3GO2A 5ENLA 2NQLA 2PCEA 3DEQA 4H83A 4JN8A 5FJTA 1MDLA 4E6MA 1MNSA 2QVHA 2OQYA 2GGGA 4H1ZA 3V3WA 3DG6A 4IP5A 3T8QA 4A6GA 4KEMA 3ZLGA 3CAWA 3MQTA 3DG3A 3Q4DA 4DX3A 4MGGA 2MUCA 3N4FA 3UJ2A 2I5QA 3UJRA 3D47A 3R25A 3JZUA 2QDEA 4A3RA 2AL1A 4DN1A 2ZADA 3MWCA 2RDXA 4FP1A 5FJRA 3BJSA 2PGEA 1EBHA 3NO1A 4HNCA 3TWAA 3JW7A 3KUMA 3DG7A 3NFUA 1KD0A 3TTEA 3ZLHA 3MKCA 4MMWA 4GGBA 2O56A 3H12A 4GFIA 2ONEA 3EEZA 2QJNA 2OX4A 1P43A 3FCPA 3TQPA 1XS2A 4ENLA 3RR1A 3R1ZA 1BKHA 3VA8A 3FJ4A 3SJNA 2OZTA 2XH7A 2QJJA 2PU1A 3NZGA 2AL2B 2DW6A 4DXKA 2PGWA 3IK4A 2OLAA 2P0IA 5FJPA 2OVLA 4ZCWA 2PP0A 3UXLA 4F4RA 4GYPA 3TCSA 1ONEA 4KT2A 2PMQA 5FJUA 3OW1A 1MDRA 1SJBA 3CXOA 3DESA 2OKTA 2AKZA 4ZA0A 1E9IA 3H7VA 3STPA 3JVAA 2OG9A 3SN4A 3V5CA 3ZVHA 4GGHA 1FHVA 4E5TA 4KPLA 3VC5A 5FJOA 3I6EA 2PPGA 3DFHA 1TKKA 3DIPA 3OPSA 1JDFA 2GL5A 3GD6A 4IL2A 2P8BA 1PDZA 2HXTA 3CB3A 4DHGA 3BOXA 3ES8A 4IZGA 3T9PA 2HZGA 4J3ZA 4DYEA 4E8GA 4Z1YA 2OO6A 3RO6A 3U9IA 1P48A 4ROPA 2OFJA 2P88A 3OZMA 3TJ4A 4EWJA 3U4FA 1TE6A 2GGHA 3SSZA 3SQSA 2PTZA 1JPMA 3P3BA 4IL0A 3VFCA 2P3ZA 7ENLA 1PDYA 5IDZA 3IJQA 4K2SA 3K1GA 1F9CA 2AL2A 2AKMA 3QN3A 4G8TA 2HXUA 1NU5A 2XH2A 1EC7A 3CYJA 4Z17A 4GIRA 1KCZA 1MUCA 3FYYA 3D46A 2PU0A 3HPFA 2GDQA 3IJLA 3VCCA 4HN8A 1WUFA 2GGJA 3OP2A 3UXKA 4YWSA 2P8CA 3OTRA 1IYXA 3P93A 1KKRA 3GY1A 2OZ8A 2QGYA 3NXLA 4E4UA 3FV9A 2PA6A 3OZYA 3CK5A 3R10A 2OQHA 3PWIA 3MY9A 4M6UA 3RGTA 3UCCA 3FXGA 3S5SA 3H70A 3QPEA 4J1OA 3H8AA 1R6WA 4GISA 4K8GA 3R0KA 3PWGA 1XPYA 3DERA 3S47A 3PK7A 1SJDA 3GC2A 2ZC8A 3UCDA 3I4KA 4HCLA 3TJIA 1EC8A 1YEYA 3TW9A 3N6JA 3UGVA 2DW7A 3VC6A 1RVKA 4IP4A 2QDDA 1SJCA 4DWDA 4JN7A 3ZLFA 3T6CA 1R0MA 1KKOA 1WUEA 3IJIA 2GGIA 4H19A 3N4EA 3DDMA 1EBGA 2XGZA 2PP3A 4HCHA 3TOYA 3QTPA 3P0WA 4FI4A 3RRAA 3UJEA 4HYRA 3RITA 3R11A 2CHRA
chains in the Genus database with same CATH superfamily
5AC7A 2D73A 4PMYA 3S2CA 3NIYA 3BZGA 1EA0A 2E6AA 5BOFA 3MCMA 3N6HA 5EBAA 3GZ3A 2ON3A 1XP3A 2EHHA 5DN1A 1DYSA 3W7NA 3E38A 3N34A 2BWGA 3GNDA 1K8XA 3VKJA 1UBPC 1BQCA 1V6TA 1GZGA 1DVJA 1PV8A 2NVCA 2H8XA 4IFRA 1UWQA 2QMJA 4CNNA 2CXEA 4R3UA 3VCNA 1EXPA 3RCYA 4NNBA 3NS1B 1ISWA 4CQDA 5DCBA 1LRQA 5K3VA 2QXWA 5G2IA 4H6RA 4KBXA 4PRRA 5A8QA 3AS0A 5FF0A 2EF9A 4GUHA 4NZJA 1H4PA 1HJUA 1W5QA 1NHRA 3B0YA 3S1GA 5HMFA 2F5ZA 3HG3A 2DVTA 1MWOA 3CUFA 2ZZ5A 5KMYA 3WF2A 4D6CA 1PXGA 4XZHA 4I9TA 1AZ1A 3MUXA 4IIHA 3WUEA 1OGGA 3SCWA 4JDRA 2CKSA 4PCSA 1TZ9A 2FPYA 1W9VA 3SUVA 4MZ1A 4JHMA 3TXVA 1T3QC 4Z1BA 4DIAA 2ZBTA 1Q6GA 1X1ZA 3M5XA 3B05A 2NQ9A 3SY8A 1F3PA 3SM0A 3THQA 4HHPA 2PDHA 4W93A 3TNBA 2VQTA 2IQTA 4N0RA 1EYWA 2H9AA 4BI6A 1MDLA 1V0NA 3ABXA 1HQTA 1DJQA 3V3WA 3DG6A 5A5WA 1QASA 3HZ3A 5AHLA 1ADDA 3B9AA 1F8WA 2V3FA 3H6OA 3RDKA 2ANUA 3GB6A 2Y8VA 3BL3A 1NOFA 1T96A 4MWAC 1TR1A 1LUCA 2FJKA 4YTRA 4UQCA 3EPMA 3O6YX 1AG1O 4H4ZA 3DHPA 1RK6A 3BJSA 1VBUA 4AU0A 2CZFA 5IBXA 3T8LA 3BVJA 4Y7EA 2B7PA 3FJ6A 3LOTA 4NAFB 1ZL1A 4ZVJA 4L1WA 1L6YA 1VJIA 3SUSA 1XXXA 1PWMA 2UY5A 3D3FA 4P5UA 3VDHA 2QJNA 4GE8A 1RP8A 1TUXA 2DZWA 2PTDA 3P67A 5D37A 1L6GA 1HVXA 4PUKA 4H4XA 1A5LC 4NZFA 4CD7A 3PC0A 4PEEA 2PU1A 5A2AA 3AIUA 4EPKA 4NXSA 3LHVA 4M7SA 5HA7A 1ZK7A 3L2MA 3AZSA 3CZGA 4JR5A 4FF7A 1B3YA 1E4IA 4DELA 2V67A 4S39A 4A05A 1TRIA 1DJWA 4DJED 2E28A 3QF0A 3VX1A 1B2YA 3GH5A 3BAXA 1W31A 3A7AA 3GE7A 1D7KA 2CXGA 4O50A 1IEIA 3SECA 4E3VA 1QU4A 5FL1A 1VGAA 4K8EA 3N3MA 4O8RA 3BOFA 2UV8G 4O57A 1BWKA 2ZUUA 4HPXA 2IUZA 3BLFA 1QK2A 5A6JA 1JDCA 2PPGA 4ZFCA 3WF3A 4IQDA 2J77A 1PAMA 4U4MA 3HBLA 3B9DA 4ZSTA 4QJ4B 3FVMA 4JKKA 2VC6A 4W8BA 3AYRA 1RJPA 1XG4A 3AIRA 3W07A 1AQFA 3L0NA 4RNIA 2ZTJA 1GYLA 2OSYA 2V2HA 1W3HA 5M2FX 4OBTA 2KAUC 3CL8A 3CLWA 2EAWA 2Z26A 2D23A 4EWJA 3W7LA 3C2YA 3UQNA 3HPXA 1CX9A 1JFHA 1YXYA 2BOFX 3FXYA 2CLPA 1SO3A 2CZEA 3LK6A 2FB3A 1O12A 5CAKA 4H4VA 3UPBA 3NQFA 5D2TA 5SWUA 1G67A 5K9XA 4JCMA 2XH2A 2ZZ0A 2ZCGA 3BAIA 3SGUA 1N60C 1E6XM 4LUYA 1VC4A 4C5YA 1GRAA 2WPGA 3PS7A 3FHAA 3AU2A 3OTRA 1IYXA 5A1AA 3GVGA 3NYDA 1JYXA 3PNZA 3H2CA 1NM9A 5JCIA 2OYLA 3O0KA 1POKA 4XD3A 1SW0A 1W2PA 3TTYA 3FXGA 3GNOA 1ZSXA 4H7CA 5CBBA 3LEPA 3W1RA 3N3TA 1BAGA 3AMLA 4QCFA 4FOKA 4UNKA 4AMAA 4JHZA 4KIEA 3F4WA 4ZTYA 4LF2A 3BURA 3BE7A 3P7YA 3PZOA 4BQ2A 1YEYA 3O0FA 3KEHA 5AC4A 3WFZA 3L12A 1WXZA 1OSEA 4I7VA 5IBXC 4CD8A 1VIZA 4DWDA 2CZ5A 2X1UA 3FA3A 3BTNA 3ALGA 3W29A 2ZXQA 1VH7A 4H19A 4H9UA 3PJXA 4Z0JA 4WD0A 2CHOA 4LPCA 2IW0A 3CT7A 3KCOA 4PTWA 3CC1A 1GKPA 1TJ0A 4CQ9A 2OB3A 2BG5A 2PI6A 2C16A 3OGRA 3OB8A 4W9TA 2ALRA 2P5NA 4NEVA 3A4JA 2FDMA 4M56A 1SZFA 3QLDA 1RPXA 3TROA 1HXJA 1ZAIA 3MANA 4C6QA 4R34A 3T42A 3EOEA 1UD8A 2PDMA 2Z7KA 2VEKA 1L9WA 5BZAA 1DTNA 1HT6A 2CBUA 3E49A 4UIOA 3S8HA 3O8AA 3S2NA 2REQB 4DQWA 1Y7VA 1Q2RA 2PTWA 3WLOA 4GNKB 2X2YA 2J79A 3SN0A 1ENUA 1B0IA 2WJZA 1DORA 3DFNA 3DAQA 1DOSA 3GAYA 1ZS2A 3DZ1A 3QFWA 3G1RA 4QHRA 1JXJA 4FA3A 1Y8BA 2GH5A 3T0BA 7TIMA 5ABGA 1EZ2A 1XDIA 1I2NA 4I6KA 5HNTA 1ZMCA 2J7DA 3P82A 1RD6A 5JH1A 2UY2A 3M0KA 4UFKA 5I23A 2YCLB 3G0UA 2GVEA 5BXSA 1NF0A 1SU5A 4W5ZA 2Q8ZA 4GHRA 4C6PA 4DI8A 1I9CB 3O15A 4RCXA 1ISZA 2PS2A 2VFGA 4WSHA 4H4QA 1E6ZA 4LVAA 2V3GA 4FLQA 3H7UA 3W72A 3KM8A 3ZT7A 3R2GA 1WZKA 2FDSA 1H61A 1K4HA 2R6OA 2FB2A 1MOKA 4OBSA 3KTSA 3MV01 3VKCA 1B4EA 5MF5A 3VILA 2PLCA 4JFWA 1FDZA 3MMWA 3W75A 3M0ZA 5FJTA 1LBLA 3UG5A 2EQDA 4UXDA 1YDYA 4LRTA 3N2TA 3IJ9A 5HUPA 4JIRA 3M1ZA 4HJFA 2J24A 1LORA 2O9OA 2X7WA 1GVOA 3ZMRA 1NAL1 1FY6A 3W73A 4XIAA 5M1TA 5HR7A 1K8YA 2GJNA 1XCXA 4A3RA 1Q6RA 1KM6A 1JDDA 3MWCA 3U4AA 3BV4A 3QXBA 4NY2A 5FF4A 9CGTA 2GJRA 2GQ3A 3G22A 5JQ9A 2PGEA 3DYPA 3NEVA 2ABBA 2QCDA 1QI2A 5F4XA 2OZ0A 4DJFD 2OJPA 2GJLA 4PTMA 1UH4A 2BVDA 3V36A 1J5TA 1Y5WA 2NXIA 4GGBA 2PB1A 1AVAA 4LANA 2ONEA 1EPVA 1OYBA 2IPJA 4HNUA 4D6GA 1J5SA 3H2FA 3PAOA 1I0DA 2Q01A 3V0UA 2WZTA 3ZSSA 2IKHA 2ACUA 2HVMA 1LRNA 1EHNA 1X6UA 3UG8A 2OLSA 1IXNA 2YVJA 3WQVA 4AZCA 1TREA 4JGDA 2RFGA 4EQRA 2VURA 4DM1A 2EPHA 2WPCA 1DP0A 2YB4A 1E1CB 4C7FA 2OSXA 4Q7BA 3TCSA 1XH1A 2D2OA 3UG3A 5CJMA 5J8LA 4AZBA 3WIJA 3QYQA 4LVDA 2OOFA 2O92A 5H8UA 2PD5A 2QCCA 5G2WA 1AOGA 3E9AA 4I5XA 3WLTA 2WHMA 4HP5A 2YLAA 1XINA 1JD9A 1H7OA 2BY0A 1FHVA 5IFTA 4PUJA 1VHNA 1XJBA 3R12A 3BWWA 5K4XA 1DTUA 2FFCA 3ABZA 3EYPA 3G8EA 4RNHA 4ZR8A 3KP1A 1AH0A 2A5HA 1V0MA 4HA0A 3AAMA 1GOQA 1EUNA 2DT0A 1LVLA 1EGMA 3GWQA 3NOEA 3Q58A 1OFQA 5E0FA 3EX1A 3FKRA 2Y1HA 4MHBA 5FCZA 1QPKA 4IX0A 5ABHA 4GXWA 2OO6A 4HU3A 4G6CA 3PHAA 4U10A 3MDWA 2G4FA 1UH3A 5B80A 1UR1A 4ZENA 2YCLA 3IGXA 3WKZA 3NSNA 4QTGA 2Y6ZA 2RH9A 2JGYA 3O9NA 4AG0A 1FWSA 1EJTC 1JPMA 3VXGA 4CD5A 3GXFA 4L64A 4BKNA 1GG1A 4W7WA 2WM0A 5E0CA 2BODX 3RMJA 3A24A 3QZ6A 1EOKA 2AL2A 1OFRA 3MW7A 1XYMA 4EIVA 3F1QA 3LA4A 1S46A 3E2VA 4XBJA 4QNWA 2FIQA 3MPGA 3QV8A 2GDQA 2J27A 2HROA 2XM2A 5H2ZA 4UTTA 2VR5A 3L9CA 1CT5A 3Q2DA 1S5MA 3R8RA 3GTIA 4GYFA 1BHGA 1DHKA 1KKRA 3PANA 3SURA 3PBWA 4HPHA 5C9WA 3S2JA 1KTCA 4TX6A 2WMIA 1M7JA 1L6FA 3CHCA 4AX6A 4WDXA 6REQB 3WBWA 4XKYA 3C3NA 4JTQA 4M6UA 2EJAA 3BGGA 2HCVA 3WNPA 1K70A 5JIPA 1I8JA 3DFPA 3TZFA 3QLLA 4GZEA 4HOXA 3R0KA 1FCUA 5A6MA 2UY3A 3E2RA 5CZTA 4MNMA 4DAFA 5HXMA 3VE7A 4LF1A 3WF4A 3PZMA 2J4GA 2ZC8A 1ZB5A 2XHYA 1GVYA 4MWAA 3TJIA 1UOZA 1HG3A 4BR1A 4H4PA 2VR2A 1LT7A 4FNPA 5JBDA 4J3WA 4GUGA 2C15A 5GNZA 3VIFA 3WBXA 6TIMA 3AM9A 3GM8A 4LC8A 2HPMA 1H5VA 1KGXA 3H4XA 4H41A 5D9OA 5M3WA 1QTWA 3TW7A 1ZJIA 2NT0A 2OGJA 2XGZA 1OGBA 1EDTA 2V2CA 4IJBA 4AD4A 1UC5A 4ZOCA 1CNVA 3LI0A 5FACA 1ZBWA 3WLQA 3W2UA 3MYOA 3B0UX 4MADA 5AVHA 1MRAA 3LRKA 1B9ZA 3N1AA 3PUOA 4AC7C 5H8MA 3ABRA 2E6FA 3VKDA 4U31A 1T40A 4HYVA 3S2MA 1PX4A 1JPIA 3ITLA 1XBZA 4C6CA 1BSLA 2ZZBA 4RE2A 4QLLA 1UHVA 3T0TA 2WWDA 3T07A 4FXJA 2PRHA 1NIUA 2QCLA 4JICA 3UYCA 3VOGA 2AMGA 1AQ0A 1JQVA 2WBAA 2VWTA 2DQWA 4P7NA 2ZUSA 1OJTA 1OCJA 3A47A 1RCXB 1DE5A 5AYYA 2C3ZA 1RAKA 1WDDA 3MUAA 8XIMA 5KZ6A 3OVPA 3PNUA 2WP5A 3GIQA 5CPSA 1XIDA 3V1HA 2QCFA 1B31A 3ERPA 5JCLA 2HMCA 2VZSA 3SIMA 1ZAJA 1VLWA 2BC0A 4NZ5A 3A64A 1M65A 3U8GA 1PKMA 3M44A 5C71A 1GUVA 3R43A 3O6CA 4IOTA 1SQ7A 3PSVA 1XHGA 2X30A 3I3EA 3DI1A 4B9YA 4PN2A 3L8KA 4D1JA 3GVVA 3SR6B 4NZ3A 5CJ5A 1Q4NX 5REQB 3QKEA 1J96A 1V93A 4X63A 2NQLA 3EXSA 1YIXA 1QPRA 3RPDA 3TQKA 1P0BA 2DQXA 2Y8UA 2OQYA 3UESA 1M03A 2DVUA 3WLLA 4A6GA 3IIPA 3T78A 3PPCA 3NGFA 1UR8A 1AD1A 2XFRA 1O60A 3S5ZA 3BG9A 3VM5A 1FHLA 2EQ7A 4W4QA 1X2GA 2I5QA 3UJRA 3XINA 2EQ9A 4QQUA 3C8NA 3AWOA 2HVOA 2ZADA 1OFPA 4UMCA 2J88A 3S6DA 1LROA 3PUGA 3MP4A 2TODA 3BDKA 4GPNA 3W82A 2WMHA 2VZOA 4HYWA 1ML1A 2NUWA 2G3NA 2QF8A 4RLIA 4EPEC 1VQZA 4IGSA 4PA8A 1KD0A 3ZJKA 4MYXA 1E51A 5HQEA 4WJXA 3LM3A 1PCKA 4PB5A 5A8PA 5G4EA 4UTKA 2O55A 2BZNA 4NAFA 4NU7A 2BP1A 1KM5A 1OM0A 1R30A 1TJ1A 3OG2A 3RR1A 3GVRA 3CQHA 1GJUA 1M53A 4HA1A 5TBOA 1RCQA 1Y0EA 4ZCWA 3VGGA 3TK7A 1PS9A 4DZ5A 4GYPA 4LW7A 1BXBA 1O1HA 1DWFM 5BRPA 4H9TA 2FQIA 1Q6CA 3LGDA 4C6BA 3GDLA 3W6MA 3E0VA 3PF3A 4GQRA 5D03A 4MAVA 4JFVA 4NKCA 3PTQA 1E72M 1EIXA 4QBXA 3H4KA 1PHQA 2PBGA 4JYFA 2QZRA 4AD1A 2A6NA 4C6NA 4E5TA 2WKJA 3WY1A 3GD4A 2F8QA 2SFPA 1KCLA 1AJZA 4OV9A 1W17A 1CXKA 2O7QA 5F7UA 4DUWA 1OX4B 3ETRB 1A5MC 4R33A 2OWXA 3WQFA 2DT1A 1FDYA 1V08A 4LAUA 1PDZA 1U2YA 4IMAA 4DJFC 2CLIA 1F76A 3W25A 4JQ1A 3ZM8A 1VB9A 3QH2A 5EYWA 4J3ZA 2G5WA 2DH3A 3UETA 1J6PA 2VUNA 4GQQA 5K2ZA 2GR1A 3PJWA 5EMKA 1F8MA 3IGUA 1P5BA 9XIAA 1G9HA 3L2IA 4ACZB 4B5TA 7TAAA 1JRBA 1JUKA 1CGWA 4PRWA 4LCRA 3EX3A 2P53A 3DXIA 5CLWA 3F4VA 1JCNA 2CC0A 1W8SA 1XLCA 3B4YA 3K1DA 5AVNA 1JRPA 5JUVA 1JAKA 5H8PA 5CZKA 1Q6DA 2ATMA 3NO3A 1A4MA 3G1HA 2GWNA 2ZXDA 1U1JA 1F6KA 4F2BA 3N2MA 1KM2A 3UXKA 4W85A 4UQBA 2C14A 2WJDA 1ITQA 1X1NA 3FDKA 1TV7A 5KZEA 3AUJA 4MIMA 1BRLA 2ABAA 3T81A 3USBA 5I24A 3QOMA 3AN1A 2B7QA 1V3MA 3W1NA 1FWRA 4GZ7A 2X1SA 4CNOA 3S5SA 1QOXA 2G41A 4ONVA 2FJUB 4CQBA 2A3BA 3AALA 3QPEA 4J1OA 5FL0A 2F84A 2WHKA 4W7VA 4GYKA 1XCFA 3AYVA 1G4PA 2VFHA 2W4XA 4RE0A 1XDJA 5T9BG 4IG2A 2EG7A 4P8VA 1GCYA 4WUIA 3WDHA 1SJCA 5F2GA 4PSPA 1CLKA 4NAEB 1VYPX 3CZLA 3BQ6A 3B8IA 4OBRA 2P1FA 1NDZA 2XUCA 1BLIA 1DQWA 4Z42C 4RJEA 3B4UA 4P2VA 2GLKA 1VS1A 3OLGA 4I9JA 3HO8A 4UTWA 3ZT5A 4HYRA 3SGZA 3NVTA 3E0FA 4KFPA 2CHRA 1YADA 1QMLA 1I2PA 4GK8A 2Z27A 4L4PA 1UA3A 4ZFMA 2VGIA 1ZTVA 1FH8A 2G0WA 2FTPA 1K7XA 3EBVA 3LM7A 4HMCA 1UR3M 1W1A1 1NWUA 2GSEA 1GYMA 5REQA 3V0TA 3DK9A 4LOCA 4WKHA 2BXVA 3PZQA 1KQYA 3WO8A 1W6TA 1C8VA 1V6XA 3GRTA 2PZ0A 2ACQA 3KW3A 4HVXA 5JXQA 1GOXA 1S3HA 3O1NA 1ELSA 4LY8A 3AS1A 3OLEA 1BKSA 1T41A 4I7UA 1XBVA 3IAQA 2R1PA 1K9DA 3HQ1A 3HF3A 5H91A 3QV7A 2J6VA 2VEMA 2XIMA 2XVPA 3ITTA 3SCUA 1GEUA 1T99A 2HNEA 3SUWA 4BURA 1QNVA 1WYGA 3PZ9A 3DI0A 1SM9A 2WMJA 1FP9A 2I1OA 3E02A 4IFOA 3WYZA 4R27A 2NSOA 3T05A 4PMJA 4Q32A 1UZ4A 3W7KA 3TYUA 1RPKA 1CB2A 4WCJA 2XSXA 1RY0A 2OPJA 4OFCA 3LU2A 5C7VA 1AUSL 5I00A 2E6YA 2PCEA 2OO0A 1HFBA 4A8IA 3WLMA 1OCNA 3SCQA 3C8FA 3TNOA 4JQAA 2J47A 4YTTA 2GGGA 5AZ0A 5HNUA 2E68A 4JY9A 3OBKA 1GQNA 1LPFA 3BICA 4QGCA 1YTDA 1TFVA 4ROQA 4BY3A 1V8EA 3LQLA 3TLLA 3WJYA 4DX3A 3APTA 4UOJA 1UD3A 1TPVA 3NDOA 2OQLA 3O2LA 4MB4A 2OYKA 2A8XA 5C6MA 3PVFA 4HHHA 3WNLA 3V16A 4OKDA 3BLLA 3M0HA 4FNRA 2X8CA 3RX2A 5FJRA 2WHLA 2PWFA 1E4MM 3IIZA 2FLIA 3GXPA 4JPGA 4MM1A 5F4WA 2ZZ3A 1TVLA 1TPC1 4RW3A 1YHTA 3KUMA 5FF3A 4DUOA 4MY8A 1VPQA 3G3DA 3ZLHA 2BMBA 4S23A 5DRIA 1W8GA 3MMDA 1MXDA 3WDPP 1A3XA 2OX4A 1P43A 1ZY8A 3HG5A 1LWIA 3PFMA 1NARA 1HJWA 1TPUA 3HTWA 2VCCA 2HPIA 3W84A 1NQ6A 4HNNA 3K4DA 3NZGA 3Q65A 1TJRA 2BY3A 1GHSA 4BF5A 2PGWA 1U22A 2OVLA 2P0OA 2TYSA 3CUZA 3P8JA 4MF4A 1FKXA 4KT2A 2WVVA 5KSWA 1Q3NA 2PMQA 5FJUA 4Y9AA 4LQ1A 3MSGA 2CERA 4QSFA 3QMTA 3S6TA 1ZCOA 1K8ZA 1GTHA 5E6ZA 1G69A 3CHFA 4FLOA 1XLDA 1N61C 2R9ZA 2VHLA 4GNVA 5FKYA 2PDJA 1UKSA 2FTWA 1CI1A 4O0ZA 3MZ2A 4AVFA 4N6EA 1P0KA 2Z1KA 3C2EA 1PIIA 3R79A 3DFHA 1PTGA 3A3WA 3U6WA 2V3AA 1TG7A 5U4NA 4EX4A 1N2VA 3MHFA 2ZRXA 4RPPA 1K9FA 4N02A 3BUVA 2HZGA 2XWDA 1R3TA 1BYBA 1LBMA 3CGBA 2V6AA 1BG9A 4TMCA 5CSRA 5F1UA 4HT3A 3BLIA 4D6FA 9XIMA 1VZWA 4PC8A 1HN1A 2OFJA 3TJ4A 1XFCA 1GQJA 2VOMA 1BYAA 3GU2A 3AIQA 3C3UA 4O17A 1QVBA 1FDJA 3CHEA 4HZ6A 1XYCA 3GUGA 5LZLA 1GETA 1VBJA 4G2DA 3SSJA 1HKIA 1VFUA 2INZA 4TUFA 5G4WA 3QN3A 3AWNA 4K7VA 3GBEA 3KCJA 3UNTA 4K1GA 3VD3A 1HW6A 4H8HA 3BANA 4L7ZA 4KEZA 1FO4A 1CBGA 2BB0A 1A5KC 2GGJA 1B5TA 3H22A 3VABA 4QJ1A 4LT9A 4RZ4A 3VOIA 3WH7A 4NF7A 5EBUA 3P80A 9RUBA 2DSWA 1OG0A 4AIEA 3IARA 2VRJA 3NPWA 3W6YA 3HV9A 1S2AA 3TN3A 2WLZA 5B7ZA 5DF0A 4MPQA 2EEXA 5PTDA 3ITGA 4U3CA 3W7RA 1JZ2A 1V3IA 2VCBA 3UZZA 1XIBA 4V1YA 1ZLPA 5AHMA 3MT1A 4H8UA 4AHOA 2VEPA 1UZHA 4MLJA 1H50A 4Q22A 4W8LA 1P1MA 3MKKA 4AFYA 2VFEA 3TKFA 1T0OA 3MUZ1 4ERIA 1FXQA 1HKKA 3OC4A 4D8ZA 4HCLA 3UZWA 1PUDA 4NVTA 4B3ZA 5G5GB 1IZCA 3PAJA 3UGVA 5HNRA 5FI8A 5HMEA 2VMFA 3BC9A 1MQQA 5GPRA 4IP7A 4JN7A 5AN7A 2YR1A 2W6RA 4F0MA 2HV5A 3M64A 2DFAA 2PWHA 5DMMA 3VOHA 2BGSA 1NWTA 2VZVA 3ARWA 2HDJA 3QW4B 3EGJA 4R7WA 4L6OA 2YYTA 4L4OA 3N13A 4IHCA 8TIMA 5FEXA 1KXVA 1GPFA 2EKGA 1S2CA 4FEZA 1BFNA 3TOPA 2PP1A 1MO0A 3C52A 4F0RA 4FXRA 3OZPA 4DO4A 2F7FA 4C7GA 3ZJ6A 5M17A 3VAVA 4E8CA 5MKGA 2X2GA 3NRZB 2VDIA 4KW2A 1RH9A 2QJMA 4Z2HA 2PDIA 1NEYA 1KRBC 3GDMA 1FWIC 2CWXA 1VENA 3CUXA 2FYMA 4AW7A 2PSNA 4RZ6A 1UD6A 4PMVA 3FKKA 1N8IA 1THFD 4TVUA 4IUGA 3WLRA 1UMYA 1QT1A 1B3WA 1F73A 2BASA 2DSUA 5A8OA 2DZUA 1ZP3A 2GQWA 1KCKA 2UY4A 4KWSA 3HMJG 1VF8A 3KFTA 2J7EA 2GGEA 5I3GA 4F0LA 4BEUA 4QLKA 2YL5A 2PDBA 4WHBA 3T4WA 3BJFA 3G6LA 3R13A 1E6NA 4GH1A 4LS1A 4FSAA 4GI6A 1GOMA 4M52A 3DFYA 3VK5A 1LL6A 1FECA 4E2VA 3IJ6A 3EKGA 3W9ZA 1TMQA 1EJUC 1X7FA 4OQVA 3UWEA 1XPGA 1XRVA 1KFBA 4NJHA 3KAOA 2FVLA 2ZX7A 3FHQA 3U2OA 4R88A 4Y96A 2VZUA 3RPMA 3DH7A 2OKOA 4FR1A 4DO7A 1EBDA 4H1ZA 4GIEA 1KWGA 2F61A 4KMQA 3FAXA 2BGNE 2P76A 3CLMA 4XTDA 3ARQA 2VTFA 1KV8A 3GHSA 2TPSA 2A7RA 4PYSA 4KF1A 2J9YA 2BFGA 2ZRWA 3QZEA 4H04A 1ZZMA 1I0BA 2DZAA 1F05A 3CL6A 1HO1A 4IH3A 4X61A 1GV4A 2PCQA 1XUZA 2NQZA 3ARVA 1WYIA 3NDYA 3KDOA 4EF8A 4WQ6A 4LH8A 4JFTA 1IF2A 3CMGA 4Q3MA 3DK8A 1W5MA 3KOZA 4CGTA 5ABFA 1NPXA 3MTWA 1Q7MA 1W1TA 3N2CA 4AWUA 2WWCA 1WAUA 1W3TA 3BMVA 5C54A 1CYGA 4B5VA 1E6QM 2NX9A 1XRFA 2ZRVA 2E0PA 3WL1A 3F03K 1FWNA 2YZ5A 1ODZA 3LHWA 1A47A 3QHNA 3MO4A 4WY0F 3QFBA 2PDGA 4MWAD 3MMTA 3C2OA 2Y70A 4J2PA 1SB3B 3LTYA 1QCWA 1ZP4A 1XYAA 3DKLA 1R7AA 3LRMA 1ONEA 1KM0A 2BHUA 4KFOA 1X1OA 2C71A 1HJSA 3QHMA 2V5DA 3S6OA 3CIWA 5CSUA 4L6DA 2CFYA 1KNWA 4ERGA 3NQCA 3C0JA 1Z3NA 3NQ7A 4IIFA 3ZVHA 3NQVA 3VIMA 1FWCC 4GRSA 5CPOA 4J3UA 4UR8A 1PYFA 4JNZA 3ARUA 2PDXA 3W1UA 1TWDA 4DO5A 2VC9A 3NSXA 4QLJA 2TPRA 4PCNA 5A8NA 2QCHA 3K8KA 2PDFA 3GD6A 1PVNA 1QW8A 5K9CA 5BU6A 4A2SA 1RCOB 5HATA 2D20A 2VFFA 4MY9A 1GWJA 2YQUA 1XI3A 4FOUA 3W02A 4IZGA 4O16A 4JIIX 1UWTA 2WNQA 5A6BA 2AQWA 3STFA 1TX2A 3WDJA 4KQNA 1SMDA 2ZQ0A 3EA1A 4MB3A 1XSJA 4F9DA 1HF6A 2P10A 1NH6A 3LY0A 2P88A 2YDSA 3G0XA 4DUVA 4B5NA 1NWSA 1Z48A 4K37A 1AK5A 3WJXA 4OOUA 3CV6A 1DEDA 1T8XA 4BEQA 2Q6ZA 5LIXX 4CQAA 3TEVA 3S5NA 4D71A 3NM3A 3BJTA 2PTZA 2HWGA 4GACA 3MV11 2QLYA 2Y5SA 3BMXA 3RLHA 3SRHA 4HHLA 3VI2A 2GUBA 3TX9A 1JEHA 1EIBA 4I5RA 2CESA 3W83A 4G8TA 1LG1A 2VFIA 4OV4A 4BQ4A 4DWSB 3CXBA 2WOWA 3FX4A 3TC3A 1ZX9A 1J4EA 2IPWA 3CV1A 3D46A 2ZXAA 4LXFA 3S1VA 4EXQA 3P6LA 4IIBA 4C6JA 3VFLA 5LNUA 1C8QA 1TWSA 4RZ5A 4S3DA 2QCNA 1RP9A 4RV3A 1AFSA 4C1NA 1H63A 5CSSA 2VJXA 4F48A 4QISA 3AXMA 4D2JA 2CFFA 3RN6A 3I4EA 1MFUA 2AAAA 3WK3A 3MDUA 4XAGA 5I3JA 4Q4SA 1UASA 4M3PA 3QBUA 1HZYA 4EK7A 3RRXA 4QR6A 1FWJC 3DFQA 3BW2A 2W55A 1SJDA 1A53A 3WBYA 3B9JB 3ZWSA 4R9XA 2YOCA 3N6JA 1VFTA 3P62A 5BROA 2OMAA 2PD9A 3SQPA 3L7RA 2D0FA 4WJEA 2GGIA 2V6OA 2IXUA 1VJSA 2YX0A 4GI8A 3B9OA 1M5WA 4L1GA 4GZJA 3EOUA 1B9BA 4ZO8A 2EG8A 5D2VA 4B3LA 1O95A 2YBVA 1OG6A 3LXAA 3PM6A 2E7FA 3ATZA 4L56A 2RKXA 4F8XA 4E2DA 3MHGA 3KBVA 1RJRA 3I7SA 2Y62A 3ANYA 1FTXA 1W1B1 5BMXA 1GOOA 1JCTA 4E4FA 3OO2A 4AWTA 2ZX5A 4JTLA 4XBKA 1ECEA 4C6EA 1ZQ5A 3BSMA 4X2PA 1SFTA 4OZOA 4P8XA 5E6YA 1P6CA 3AMDA 3H24A 1S3TC 4DBWA 4XZBA 1JRCA 3V4BA 1MEHA 4PMZA 4CD6A 4X3ZA 4NAEA 5A6AA 2Z29A 4PRTA 1VLIA 2PEVA 4XUGA 3LG3A 4W86A 3UU0A 3PY2A 1JZ5A 1PKYA 1XV8A 1QI3A 1HX0A 2QJGA 2FGBA 1HKVA 1JPDX 3KBJA 3QYSA 3CUJA 1E3XA 2J62A 2XH4A 3L0GA 4I8YA 4M0XA 5CBIA 5A94A 1ODUA 3ZO9A 3B0VC 1JYWA 4AYSA 4AHQA 1R3QA 4Q33A 4REQB 4O1FA 5HJXA 3MVTA 2R91A 1JZ7A 3BOLA 1ITXA 1UIOA 3SDOA 3EWUA 1OYAA 5C2CA 4FDCB 3ONBA 3W88A 1GOIA 1VFSA 1P0DA 4IP5A 4JL1A 3T8QA 1M3UA 3CYVA 1E0TA 5JBFA 3CAWA 4J56A 2FMOA 1AH4A 4C90A 1W37A 2IXVA 5C9ZA 4L9YA 3TE9A 4NG3A 4PSRA 2WP6A 1X39A 1IWAA 2CLLA 3DG3A 5LIWX 5E0KA 4H9MA 1JUEA 3AICA 1Q1WA 1TYPA 1SZEA 3R25A 3P84A 1A0EA 2CLFA 3ME3A 2WQPA 4B15A 1OCQA 3H2EA 4JX5A 3CO4A 4QIUA 1LJYA 4HZMA 2XIQA 3SRFA 4K7ZA 1DHPA 1GVSA 1BVNP 1XD1A 2CHNA 1Q45A 1AQMA 2GJPA 4A8RA 4WDWA 2H8ZA 1BZLA 4GYJA 2BCPA 4QG8A 1KN0A 2X09A 4NJGA 1S5WA 3CQKA 5F2LA 1MEIA 1WZAA 3CMJA 3ZSTA 1OX4A 3NQEA 5GQBA 1MUMA 2C1GA 4D6IA 2E25A 3CMFA 1Y65A 3VGBA 5H1WA 3K4WA 4IMEA 1K9EA 3R1ZA 3HPSA 1K03A 3G6MA 2X05A 1NY1A 2XSBA 4CN6A 1HIZA 3DBPA 3MSRA 1QNPA 4F2UA 1LLWA 5FJPA 2PDWA 1TR9A 4UTLA 3UXLA 4WEVX 1FCVA 2J7FA 3EWCA 4WY0B 3KBNA 3SR7A 1J93A 3OLIA 4JQ2A 3QV9A 4DB7A 1K9TA 3WSUA 2VCAA 4ML9A 1E9IA 1OX6A 3GRSA 4GQGA 3C0SA 2ZUNA 4GGHA 4E2OA 3CWNA 3HN3A 3RCNA 4IM4A 1GREA 3TTSA 1EQCA 1VJZA 1K6WA 4H9ZA 1W3IA 3KBSA 5DCEA 3LCGA 3T2OA 3S9IA 3LRLA 1I6NA 5EMLA 4J3TA 1V6UA 3REQB 1M04A 4RDYA 1PHWA 4J5NA 3NQMA 5DT5A 4PUUA 3ZFHA 1C92A 4LUSA 1I75A 3OA5A 3CGEA 3IGHX 4LUTB 4XZIA 3IIVA 5M03A 1ICPA 2BY1A 1ZALA 1GKRA 5LXEA 2QNEA 2JQXA 3WLSA 3LNPA 3SB0A 1TWZA 2GGHA 1ZDLA 1BXNA 1EX5A 3VUPA 2YW3A 1L2UA 4PMRA 4IJCA 2ZZ7A 2JEQA 4O54A 1XC6A 4O52A 1V6YA 3QY6A 3VFCA 5I06A 3V0SA 1XIIA 1V02E 2AAQA 3QGVA 1I2QA 4K2SA 4P7OA 4XIMA 3JRKA 5A95A 1VCGA 3W7GA 4PEKA 3WLKX 1W32A 3O7UA 2AKMA 3CASA 4DO6A 4NZ4A 5I6SA 1DXLA 1B3XA 1GKQA 4O11A 3G1YA 2ZRZA 3FGCB 3UD6A 2V5CA 1OYCA 3IJDA 2NV9A 4FIQA 3IWPA 1Z42A 1TB3A 4MAZA 3EX6A 3E1F1 3OP2A 4OIFA 4C1KA 3SCTA 1IWPA 3BMWA 2D0HA 3TYEA 4NJJA 2ZC1A 4M7TA 4E4UA 1G4TA 2D69A 1LT8A 3PWAA 4AZGA 4GVGA 2CBVA 3EF6A 3A12A 4I7WA 4DYJA 4GXPA 3TIMA 4OECA 2Q8LA 3PWIA 2J74A 1QUMA 2J75A 3HA1A 3XISA 4JIHA 3H8AA 3TN6A 2OEJA 4PMXA 3NL6A 5I77A 2YYUA 4O28A 1GNXA 3WQEA 3WNKA 5HQLA 1SFJA 3WQCA 3S47A 4LUJA 3CQIA 4GVIA 5I3IA 3KZSA 1IGWA 3WF0A 2YCJA 2YVFA 4J40A 1E5NA 1F6PA 1R0MA 4G7EA 1UCWA 1D3CA 2XFWA 1AH3A 1KFEA 2L5HA 4ZOBA 3PPGA 4RW5A 3SCSA 1IEXA 2JF6A 2RAGA 3L0KA 3QR1A 1EQPA 4HCHA 4CQ8A 1E43A 1TPB1 4Q4MA 3P0WA 4UQEA 2QDHA 3DUGA 4H8NA 5AYZA 2CZVA 1H5YA 4RX0A 1XD0A 3EMCA 3CPRA 3U0HA 3AS2A 1J01A 2FGLA 1RBLA 3PN8A 4OTKA 3VD4A 2WZHA 3W2KA 4B5SA 4HGXA 4BI5A 3SAZA 4AD5A 4K1WA 3TXZA 4YWIA 4DLMA 4AC1X 5GJMA 1WA3A 2OZ3A 4WJ8A 1UP0A 1TTIA 5DANA 3QC3A 2FKPA 3I6RA 4J3XA 4GI4A 1IEVA 1VYRA 2J6XA 2X41A 4GY1A 4M5PA 4HTYA 1TA3B 5I03A 1RQBA 1XSIA 2PDUA 3NWRA 1G0CA 4ICMA 2X1IA 2Z2BA 2V9DA 2O9TA 3S2LA 4MJ4A 1YW1A 1OINA 3AI0A 1EC9A 4PMQA 4N9EA 4MKVA 3MJMA 3IUDA 1F4HA 2ZZ2A 4MPKA 1UUOA 5AHFA 1HKMA 1OHLA 1V51A 4M81A 5J5DA 4XD4A 2FVKA 4G56A 4MLRA 3RCMA 3E96A 4J35A 1CIUA 2NXHA 5BOEA 2GUYA 4DM2A 1ZAHA 4O1CA 2ASHA 4UR9A 4C6KA 1SJAA 1OFEA 2Q09A 4DZHA 5IXEA 3BW4A 2OOGA 4KGLA 2DZSA 3QHOA 3BV7A 3SADA 1GXFA 4CNSA 1O7AA 4O19A 5D4YA 1GRFA 3L5LA 1CGXA 4DNMA 2J9ZA 1XWYA 4S2CA 2Y7EA 2E4TA 2HISA 1SZRA 2ZTKA 3SZ8A 3PTMA 4HPJA 4KEUA 2BC1A 3FG2P 2X42A 7A3HA 2YBTA 1XH0A 3NA8A 1TWWA 4PFMA 2AOSA 5FAGA 1K4GA 2G96A 2XN1A 3HPZA 5CC5A 1NFPA 4GLEA 4MUZA 1KXTA 1HGYA 1TQJA 2FZBA 4HOZA 1HJXA 1H60A 2ZRUA 2XGBA 1K7EA 5C5YA 3ANUA 3EDKA 3GG7A 5XINA 2ZVRA 5AHEA 3UR2A 1GESA 2YCKX 3HGJA 3A9IA 3EB4A 3ZZ1A 1KRAC 2FZNA 4YCPA 3M0JA 1K02A 4IICA 3TC6A 4UQDA 4J3VA 2Z2AA 1UR2A 4IX2A 2AAMA 3NZ1A 3DGHA 3NFUA 3DJJA 1AD4A 4E3TA 3E2QA 2BBFA 4QEEA 1BEUA 4X9SA 2VXNA 3ARZA 3AJ7A 3H12A 4GFIA 2X99A 1OK6A 1QW7A 5T91A 2JE8A 6CGTA 3C0QA 2WHJA 4DJDA 2ZZ6A 3C61A 4XAFA 1IIGA 4W84A 1HTIA 2C3DA 1FOBA 2BXYA 1IQ8A 3BLPX 1JXKA 1C7SA 2HQAA 4IFKB 1XRSA 1MSSA 4URIA 1QW9A 3QMRA 4R53A 4GWEA 4V27A 3TCEA 4FLSA 1XG3A 1KRMA 3IK4A 1W1YA 1DBTA 3T55A 2XZ7A 3N6QA 2HS6A 3GDRA 3PUEA 1XGEA 1X8CA 1EF2A 1PPIA 4ASTA 3NVVB 2QV4A 1E1FA 4HHMA 1A49A 3H7VA 3MCOA 3MVIA 1P1XA 5CPLA 1XDMA 1W3JA 1KFCA 3RILA 3IJ7A 3D3AA 5EB8A 1V3LA 2JBMA 4FO4A 1KWKA 3NQ2A 4M29A 5FJOA 1F3TA 4ZE4A 4LC6A 2A4AA 4K8DA 4ZZ9A 2ZX9A 1VHCA 4IL2A 2VELA 1U33A 5ECVA 2P8BA 1HUVA 1RA0A 4WOZA 1QNSA 5FEPA 5LNSA 4LNYA 2BHYA 1MRQA 4IPJA 3VNMA 2J25A 1YNYA 1V79A 4E8GA 3QOKA 3BK0A 3LXBA 1KC7A 1TWIA 2VRKA 1P48A 3VD9A 2W54A 1TIWA 4HMDA 1WAWA 2OLHA 2PZNA 1FH7A 5C0QA 3AXXA 1OC6A 2OELA 2FHFA 3VNKA 3AC0A 3SSZA 1TIMA 4GCXA 1QHOA 3EA3A 3KCLA 7ENLA 1UWSA 1QI0A 5TQLA 2VZTA 3GR8A 1JZ8A 1V0KA 3W1XA 1XANA 4FPSA 5A6TC 4ZE5A 4HMEA 4WGXA 2HXUA 5JH2A 1UQYA 1EC7A 1BVZA 4ZO6A 2DP3A 4HU8A 7ODCA 4GXMA 1QNRA 4CCZA 1BYDA 3HQNA 3BO9A 3OYXA 3VCCA 2YGYA 1PJ9A 4PTDA 2Y88A 3AYSA 4KFNA 1DWJM 5CC7A 1NOUA 3EOLA 2WKLA 2V2DA 3WH9A 1QXLA 2G37A 1C9WA 1I1XA 3RX4A 4FNTA 3B0XA 1UD5A 3MCNA 2CYGA 1GRHA 2GOKA 5GRTA 4FR6A 2Z1SA 3S4TA 4ILSA 4UCFA 2GK1A 2DSVA 4PULA 5CPQA 4GFSA 3MJYA 2PDQA 3VDCA 2ZWYA 3T08A 5EMMA 3AIEA 3AMGA 4ZOHB 2VD9A 2Z2UA 3EX2A 5CGMA 3DJGX 5HWNA 2VX6A 4IP4A 1TPH1 2IPGA 3UR7A 2DT3A 3A13A 4K6AA 3LLXA 1B1YA 4H4UA 2E3ZA 3N2XA 3RF9A 3URNA 1EBGA 1HVQA 4QG6A 1XIGA 1F2JA 2A6LA 3TYAA 2NVAA 4AD2A 2EBNA 4KERA 4HZ8A 1O66A 4AD0A 1K7FA 3R4IA 5BXRA 1PEZA 2NPXA 1US2A 1UC4A 2YB1A 3M0YA 1VEOA 1E9LA 3PB2A 4IIDA 2XH0A 4DXVA 1YPIA 2CLOA 4FX7A 3VOFA 3UEQA 4LB4A 5EY5A 4IUOA 4MZYA 2FH8A 2P3EA 2GSJA 4DZIA 1W5OA 5JMUA 3CQ0A 3ZXWA 1P7TB 2R8WA 3SCOA 3TJXA 5KVIA 4XZ9A 2F38A 3UWQA 2ZE3A 1GGOA 4L65A 3LN3A 2DH2A 1PCWA 5BYWA 4CN4A 2BV9A 4GRTA 4EAYA 4UNIA 5FS8A 3P74A 1C3FA 1KXHA 3GNXA 3TSDA 3FVDA 3ITOA 5GNYA 2POZA 1YNQA 1WBJA 2W63A 4DNAA 1A50A 3WK2A 4HK6A 3E12A 1HL9A 1W1IE 4PGLA 5AKQA 1EWEA 1PTDA 1OFAA 4DLFA 3W7OA 5AB3A 5DELA 3DGBA 2J78A 5DMNA 1IT8A 3PBMA 4GINA 3SFKA 1IZKA 3BARA 3WJWA 3KZPA 4TVDA 4QDWA 3WMBA 2O4MA 4BF7A 1Z7AA 2PLMA 2WNNA 1F3EA 1J18A 1O1ZA 1JCXA 1X6NA 4B2DD 2YFNA 5KTLA 4P7LA 4G1NA 4EQSA 4YTUA 2ZRYA 3QFAA 2Q71A 2Z4GA 2WO5A 3LPGA 2ICSA 3OQ8A 1OB0A 2ACSA 1FWGC 1GRTA 1OWQA 2G4JA 4KEMA 3AMKA 3RIKA 4JTHA 4LCQA 4JX6A 2ACRA 3LYEA 1Q2SA 2GWGA 1Z69A 1BD0A 2CPUA 5DQPA 2ZUVA 5I5RA 2YW4A 1PZ3A 2XN0A 5CXPA 4O1AA 4U33A 2AL1A 4NSBA 3SI9A 3M5YA 5JCNA 2PE4A 3GR7A 4XAYA 1JZ3A 4QITA 2A7PA 2J13A 5CG0A 1XQLA 3W71A 1R46A 3AZTA 1E40A 1H0IA 3GKFA 1G6CA 1EP2A 2C6QA 1QRQA 1WKDA 5A6BD 3NQAA 1TMHA 5FMHA 3GDTA 4PUDA 3DG7A 4YN5A 4A2RA 3QM3A 4CVUA 1KTNA 1LTDA 3SIZA 4GJ1A 4REQA 1KB3A 2W5FA 5I79A 2PAJA 1Z9AA 3EEZA 3M0VA 3EMZA 4HOWA 3WQ4A 1PE1A 1VQTA 2R1MA 2DY3A 3WQ8A 4MOZA 4D6HA 1GVIA 1XF0A 3TN4A 3W4RA 3LHYA 4NXKA 1VRDA 4XZWA 4J3SA 3ZQ9A 1FP8A 4US5D 2OT1A 2OKTA 3NVYB 2B31A 4ZA0A 4Y90A 3TQVA 2Y85A 1YRRA 4FIRA 4Q8WA 2D1ZA 4E8DA 3CHDA 4O8AA 2JALA 3YPIA 3QGAC 4NIRA 7CGTA 1U83A 3BSHA 5HUOA 1M7XA 1LOSA 3EEGA 3QRHA 4NNCA 1OCBA 1X2HA 2B81A 3GAKA 4QDMA 4U5KA 4LIIA 1B3OA 1W2VA 3WMSA 3OBAA 1YE4A 3GNPA 4G5DA 3W87A 3KBMA 4FX8A 3B40A 4ZQRA 1UR0A 3G1VA 2W61A 3H2AA 5G4HC 3RX3A 1PIFA 2W3ZA 3SRDA 3EOOA 1SSDA 3VIKA 4EXAA 1H09A 1EEXA 1MFVA 2PLKA 4Y2WA 2NLIA 3R89A 1Q6OA 1H7XA 1YBQB 4MY1A 1WP6A 3KLJA 4UFHA 5LNVA 1DJYA 1V0LA 3ARTA 1NFBA 2WMFA 3APYA 2WZMA 1T5AA 2R1KA 5IOBA 3DHDA 1A3WA 1BTMA 2AMXA 4NUWA 3T2PA 1LUCB 1ZUAX 2GOUA 4N4QA 4W89A 3CGCA 4IQLA 1X98A 2YDQA 3A4AA 4E0CA 3WL0A 4KWVA 1UA7A 1PDYA 2OODA 1A5SA 4YPJA 4H9YA 3BAWA 4WR3A 3WQOA 1SVDA 4MJ2A 3WLHA 1Q66A 4X60A 2VEGA 4BHYA 3PB0A 1ZHAA 3NZQA 4UR7A 3CYJA 3EWYA 3MHUA 5CBJA 5I02A 2J8GA 5D04C 2GDUA 2HBVA 2VOTA 2IKJA 2QIIA 1REQA 3HURA 5DMYA 4DRSA 4WLCA 1J10A 5G1TA 1JNEA 2CLKA 3EWXA 3NXLA 3OZYA 2AQOA 3H4GA 2WOQA 1F8IA 1LOQA 3MY9A 5DX7A 1VPYA 3DC0A 3WD2A 3P5ZA 5AFDA 3ONCA 4XB3A 4PBGA 1TPWA 3S42A 1NDVA 1CGUA 4JD4A 3U3HA 3KRBA 5CLTA 5C70A 4H6KA 5C9XA 3DERA 4NRSA 3WQ6A 1LL4A 1RJQA 3OG3A 2VGBA 3N4AA 1XBXA 4Y8FA 5D8ZA 3OHIA 4NZ1A 1VFOA 3VC6A 2F6UA 5TIMA 1TTPA 3C86A 2V5JA 2XM1A 4ZBCA 3M07A 5BWAA 3V5OA 4F40A 1YPXA 1WUEA 2ADAA 5EMJA 1XX1A 5TAOA 1PTAA 1U5HA 4OHQA 4MTVA 4B5WA 4N2YA 4YL2A 3QR0A 5FS9A 1KBBA 3NGJA 1E71M 3FS2A 5D30A 4FI4A 1VBRA 3RRAA 2VP8A 3RITA 1UKQA 2HBXA 2E67A 1MXGA 1N55A 4ZB2A 1Y5XA 1DJGA 1QHPA 1DJZA 4PFHA 4Z0SA 1D7FA 1E4NA 3SFWA 1S39A 4AIUA 1FCBA 4PMDA 4G1KA 4PCFA 2XTKA 2QAPA 3RM9A 1FHUA 2HRWA 2E9LA 5EPDA 3F7JA 4E38A 2BDQA 2GQ8A 1TJ2A 1U30A 3CS2A 3W22A 1H1NA 3MB9A 4HCDA 1UOKA 1JCLA 3U48A 1VFHA 3Q45A 5EMYA 4K68A 3FW6A 2GVYA 5CGQA 1M6JA 2XINA 3UG4A 4MUPA 4M19A 1C91A 4MYAA 3FNDA 3E5BA 4UTHA 1TA3A 3V7PA 3T1GA 4L4LA 1D9EA 3THUA 2YLLA 5KETA 4YTSA 1NFGA 4TTUA 2PURA 4F0SA 3GTXA 3QR3A 3F4DA 4J7RA 5G2HA 1NQKA 3DYOA 1Q6LA 4HSOA 2V3EA 5DXYA 3ID7A 5T26A 4GOAA 1UP3A 1BVWA 5HWJA 2XFFA 3G77A 3NOYA 4HN4A 4DYKA 3IV8A 5LNWA 2YXOA 2V3BA 4EP8C 2H6RA 2IKIA 2FZ8A 1UJPA 1O6IA 1FWAC 3WD3A 1W3KA 3SBFA 2Z6JA 3RMEA 4JTAA 2WQDA 3M7SA 3H26A 4UUIA 3UF9A 4PMOA 1MVYA 3IV3A 3RNMA 2CNCA 4NZCA 4X2RA 3W37A 3CPGA 1QK0A 3NM1A 4KCVA 2XZ9A 3FDGA 2YKKA 3VGDA 1WKYA 2JFEX 2QVHA 3HG2A 3KTCA 1R9YA 4G7EB 4UMBA 3FFSA 3VX0A 1H41A 3OZOA 4F79A 2EPMX 2WYSA 3TYCA 3ARSA 2XG9A 3RLUA 4MKNA 5HOSA 2PLJA 3N11A 2X0SA 3W86A 1IIHA 2MUCA 3KHJA 5FESA 3GW0A 3TYBA 2IQDA 2XVNA 3D47A 1FFVC 3E2SA 1VYSX 5HK4A 1S2VA 4PH6A 3J7HA 2VR4A 3B3DA 1GQLA 4AY7A 3EAUA 2I9EA 5A6SA 4O14A 4APNA 3CV2A 4U3AA 1RY8A 3NO1A 2JK6A 3KS6A 3U2EA 2V69A 1FKWA 8RUCA 4TXEA 1CENA 3S9YA 4P7QA 1S5TA 1R9ZA 2XIOA 1RBOB 1RLCL 1SFSA 1S38A 4BFAA 1OD0A 4I5UA 2MANA 3VZZA 2BVYA 3EWWA 2WNZA 3NEHA 3URAA 3FCPA 1QBAA 1A5AA 4Q8TA 3G24A 4ENLA 2NVKX 1V7AA 1WV2A 3VZYA 2I9UA 3VA8A 3S5OA 1JGIA 1KCXA 1WDQA 2YDAA 4EOUA 1LQ0A 1GW9A 3UZXA 3W7HA 2RDUA 2XDFA 1XIEA 3LXDA 1QOPA 3BAYA 4KWUA 4H01A 4S1FA 4FNQA 3EDFA 4DEFA 1XSKA 3W1AA 5I09A 3XIMA 4LYKA 2NW0A 4EE9A 1R47A 3PZIA 4C60A 3DHUA 1SJBA 3CB8A 3GHTA 4KRUA 4KWWA 4ZGYA 4TMBA 2ZXBA 1SYTA 3A5VA 2Y7GA 2RUSA 1UP2A 2DIEA 1KBJA 4GA8A 2Q3RA 3V5CA 4D6JA 1XICA 4YJ5A 5D9PA 1F74A 2DT2A 5LIYX 4LUSB 3W6LA 2J7HA 1ZPTA 3G3MA 3AIBA 4GUJA 2OR2A 1K6AA 3B8VA 3NXFA 4AH7A 3MBFA 3QEZA 4ZMGA 4YVVA 5HWMA 2CW6A 4IFKA 3ES8A 1KBLA 2BHZA 4XO7A 1F6YA 6REQA 1TVPA 4M1BA 3KVLA 4IPNB 4EAMA 4H7ZA 1B57A 2CLMA 3VDAA 2OYMA 2IS7A 4W87A 3O6DA 1CXHA 3SQSA 2DSZA 1V77A 5LA1A 4JHOA 2NUYA 4JYEA 3IJQA 1V6WA 3NSMA 3ITYA 6XIAA 1NDAA 2ALDA 4QM1A 2W66A 5CG7A 4NT0A 4MDPA 1KCZA 1MUCA 2GQ9A 3T7VA 1I60A 3THAA 1JUBA 3GTHA 3IJLA 4X9YA 1OF6A 4HK5A 2XN2A 2WMGA 1H0GA 3VIHA 4O10A 1IR1A 2V30A 1TX0A 2OZ8A 3F2CA 3N04A 1VEPA 4OUIA 2WOVA 3QKZA 1VR6A 1JYNA 4WDUA 4YU1A 4EM3A 1ZRQA 4EMWA 3G8RA 1XLLA 3I3BA 4IIEA 3WN6A 2H3DA 4EQXA 1EB3A 2ATSA 3VE9A 2VQUA 3PWGA 2NLYA 3WBEA 1ME7A 1XPYA 4UB9A 3KHDA 3R8HA 4M82A 4LB3A 4EWND 4NX5A 3RAOA 3L67A 4XVDA 2XISA 4TOQA 3BXWA 3FN9A 1RLDA 3CGTA 4FNUA 1IR2A 2WKGA 3W28A 2HQMA 1EC8A 1SW7A 2FZMA 3WUBA 5DY2A 1I4NA 1BTCA 2PDPA 1HJQA 3CZ8A 1QO5A 2WPEA 2YL6A 1R3WA 1OIFA 5EA9A 1R3VA 3R7MA 3VZXA 3DDMA 1Z89A 2D3NA 3QY7A 1O5QA 4Q4OA 1OZQA 4KS0A 4JTIA 1H6VA 2Y61A 3PZGA 1F5ZA 1PKLA 4QQ3A 2GPTA 1FWDC 1Q6QA 2C13A 2PTYA 1B4KA 1YBQA 1JNDA 4AZCB 1LWJA 4ZOEA 4HU0A 1PZ0A 4QX4A 4RR4A 2Q8XA 3W81A 4DWSC 1FA2A 3CIXA 5FSDC 3NZPA 2FZ9A 4NNAA 5CPNA 1KQZA 5D8WA 3GIPA 1HKJA 4QE4A 2V5BA 4ZQOA 2HK1A 2GSHA 2JGQA 3DU0A 4IMGA 4H9XA 3KBWA 2C19A 1UWIA 4HBKA 4O4WA 2DZVA 4HTBA 1XLGA 2ESCA 4GMEA 4KCWA 2PTXA 1EGVA 1DWHM 3TFXA 3BCDA 2PC4A 4RE4A 2E1DA 3UVAA 1XIJA 3VMNA 1FWBC 3ITXA 4QFUA 3HGRA 2D24A 2WVVB 4GI9A 3R8GA 4H4YA 3JS3A 1NELA 1O5RA 3VIPA 1DPMA 1UD4A 4Q8NA 2ZUWA 4G7FA 3TAOA 4JY8A 5HMSA 1LOLA 1R3RA 1ECQA 1FFRA 3CT2A 3L4TA 4XKMA 3PUDA 2CBIA 2R94A 2PRMA 3UYIA 3SCNA 5I3FA 3MUIA 3V5FA 1Q7ZA 3DK4A 1WDPA 2A1YA 1A0DA 2WCSA 4LCSA 4FNSA 3KOWA 3WLNA 1YXDA 4UTJA 3VU2A 4XZLX 2QCEA 1GQIA 3GZAA 5ABTA 4A21A 4Q4RA 4XBSA 4JIEA 4P8WA 5EBKA 2NXGA 3MYPA 1HO4A 2ZZCA 4INFA 3H53A 1A5OC 1KM1A 5C9RA 1BPLB 3USZA 3O05A 1TVNA 4UWMA 5I7GA 1C8XA 1UPPA 3S1XA 3GYCA 1F7BA 1RSCA 1R87A 1QOQA 4ECLA 3R5EA 3WK0A 2FVMA 2A79A 4ORIA 3CUGA 1N7KA 1B54A 4LBUA 3UXAA 3GLCA 3KE0A 1E0VA 2GR0A 1LYXA 1DNCA 5D05A 3JZUA 4TTGA 1RZMA 4DN1A 3THDA 3FY1A 2INFA 3O07A 3D5HA 4A3QA 4FP1A 3LERA 2JEPA 4JKLA 1GSNA 5CZ0A 2CLEA 3KWXA 3POCA 3UFYA 2PDLA 2QMKA 4HNCA 1Q8AA 3TWAA 1X6LA 3EWBX 3JW7A 5AYBA 5FD0A 4NJKA 1GZ1A 3QGKC 1DXFA 3LB0A 2O56A 2WJFA 4POCA 3RLGA 2C3CA 3WMCA 3PPHA 3VD5A 3VYLA 1UWAA 2YCIX 4I3GA 5EMUA 5IFPA 4MFDA 2BLEA 5LA2A 4HZ7A 2CBJA 4Q8PA 4GC3A 1BKHA 2HE8A 5A8GA 5TF0A 4UFIA 5HR6A 5A6KA 1PKNA 1W54A 1R38A 3SEPA 2E5DA 2Y8KA 3IC9A 1YQZA 1ONFA 3H2NA 2P0IA 1ME9A 1X38A 3KTXA 2XVLA 3IVUA 3KP0A 1UMLA 4U2YA 1JFXA 3DFSA 2BGQA 8XIAA 1KM4A 3KXQA 5LKYA 2Z25A 3GXIA 3SCVA 1W1ZA 4GD0A 4W8AA 3CXOA 4RXGA 2H90A 2AKZA 4R85A 2X1TA 3N2BA 3UA3A 1WO2A 5G5HB 1TPEA 3URQA 2FPTA 4PR4A 4TV6A 1QDSA 4F0HA 1NHQA 1JDAA 3C2RA 3QSRA 3WG6A 2FGZA 4WY0A 1FXPA 2FHBA 2UBPC 1TKKA 3F2DA 4ES4A 2R14A 4MG4A 3C6CA 4XZNX 3MO7A 3RNDA 4AD3A 5I2UA 3INPA 1H3GA 1RD5A 4MSSA 4DHGA 3BOXA 1UW9A 3BG5A 3W1LA 4Z1YA 4IMFA 3M6DA 1XC4A 3RO6A 2Z1BA 1A4LA 3EDJA 4DF0A 1W56A 2VC7A 3N25A 3U4FA 4V33A 2F6XA 4Q8MA 1M7OA 3SGGA 2Z6IA 1ZCCA 2EQ6A 1NTHA 4YWOA 1PB0A 3W26A 3L5MA 1KGWA 1FCQA 3TYZA 4JTDA 6A3HA 4WSKA 1M68A 2XVKA 2P3ZA 1E5JA 1ISYA 2WXDM 2YBUA 3RUBL 1CLXA 1J0HA 1E9YB 3AHZA 2GUUA 1F9CA 1YYAA 3LPFA 4RKAA 4Z17A 1XYFA 4GIRA 3W2MA 4Q4QA 5EGRA 1A5NC 4AIOA 4A22A 1DQXA 1XKJA 4FXFA 3AOFA 2J66A 1DJIA 1KM3A 3JU2A 1UWUA 3O3RA 1TMLA 3TFCA 4LBRA 5T9CE 2BXZA 2VUYA 1IV8A 2D2GA 1ZBKA 4JTFA 1G7UA 3VO0A 2VWSA 3R58A 3ATYA 2XPKA 1W3NA 3GTFA 1DKWA 3UCCA 3A3HA 4KCTA 1CDGA 3VVGA 4JNYA 4C6MA 1NP0A 3M6YA 4J2MA 3SUTA 1NHSA 1FHDA 4EPBC 4GY0A 1E0WA 3AYTA 4BQ5A 1R2RA 3GC2A 3N18A 3UWUA 4PTNA 2G97A 3AMZA 1BXCA 1WZLA 3ARXA 3M7WA 2GDVA 1TJPA 4GJJA 2DZPA 1CWYA 1ZJBA 3K30A 4FOJA 1Q7QA 4DJDD 4IMCA 1DJXA 5KVHA 3LXCA 2GRTA 1XIHA 4AF0A 2EQ8A 4O0KA 1DJHA 4IPIA 2QF7A 2WAGA 2I14A 3OIHA 3N9RA 2OTDA 1IXQA 5DMLA 1PSCA 1VDVA 4DVOA 3GFZA 4UTTC 1HP5A 4Z2IA 1PYMA 1DIDA 1AJ2A 3F2BA 1X97A 1KO0A 1SW3A 5AECA 2E09A 5LXXA 3TC7A 1OT1A 2ZUTA 4ATWA 5E9AA 4PB3A 3W23A 4ADTA 1CZ1A 2B0MA 5J04A 2XSAA 3STCA 1IGSA 4Y9OA 4PZVA 2WCGA 1EJSC 2JKEA 4QCEA 1VAHA 4NASA 5EKYA 4DJFA 7REQB 3Q6JA 4RL3A 2R82A 3MSYA 4AZ6A 1E56A 3FK4A 3QMSA 3RLVA 2BS9A 4WOQA 2R1LA 4HSNA 1SZGA 4UFJA 4AVOA 3G5EA 2DDXA 3LENA 5EFFA 1LQ2A 4Q6JA 4AHPA 3D6NA 3OVQA 3QVQA 3U2CA 1DWIM 4PUEA 1UR9A 3DOPA 3L4ZA 4X22A 1KRCC 3TLQA 1MZRA 5DO8A 5DEZA 4XO6A 1ITUA 1OFBA 1NDYA 2BNJA 3H7RA 4J4KA 3LCLA 5DBUA 1EUAA 2GR3A 2Z1XA 3KOXA 3LDVA 1HGWA 3CUIA 3SUUA 4H4WA 1Q1RA 3W01A 4Q7IA 2ZZ1A 4L5ZA 3HGSA 4AISA 1Q4WA 4QE1A 1BSIA 1WDRA 1XIFA 3B97A 2DZBA 3TA6A 1FQ0A 1Q6FA 2E6DA 1FFQA 2QUVA 3T2QA 2H9AB 2Z1WA 3LPOA 1US3A 1EYEA 4S38A 3K2GA 2V38A 4GC4A 3VGEA 2TMDA 3UT0A 1LQAA 4MNJA 3ZR4A 1XYBA 1KA9F 3GO2A 5ENLA 1CGTA 2LLEA 4JXCA 4JDYA 4E6MA 1OF8A 3AHYA 1H1ZA 3ARPA 2J8FA 1A5BA 1LLZA 1E0UA 5IDIA 5CCZA 1G4EA 1EP3A 3GG1A 3MQTA 1EHAA 3U7BA 1QI5A 8CGTA 4MJZA 3AFBA 2OEMA 4XX6A 1IZJA 5D2WA 4WSJA 1CB7B 1GG0A 4C6LA 2NT1A 3W1MA 4WRHA 3H2OA 3GHRA 3GXDA 1BWCA 4DWSA 1JDEA 2V3DA 1W5PA 3H2MA 4HNOA 4O1DA 1H2JA 3WH8A 5LSMA 1JR1A 2VI0A 4L9XA 3DKJA 3UY8A 2JKPA 4EQWA 3OBEA 2YA1A 3NL3A 1L2QA 2W3SA 4IQJA 5BMWA 3R6IA 1J12A 3NQBA 1UQZA 2I7GA 1R9XA 1ZNNA 1XR2A 3N17A 1VD6A 4D8AA 1XGDA 4YHGA 5E9XA 4QXIA 4RV8A 3POHA 4BCEA 1ALDA 3T40A 4CNUA 3TQPA 4HU4A 3LTSA 3UVIA 2ZX6A 1JI1A 5FS7A 1WXJA 4HMNA 2UZ9A 1E15A 4UZSA 1WOAA 1GVQA 3FJLA 2I56A 4C91A 2PP0A 1YDVA 5AY7A 4F4RA 4Z2GA 1C7TA 3BGAA 1S7MA 1BGGA 5CC6A 3HJZA 1MW3A 3WFAA 3UBPC 1R85A 1QWKA 1E1EA 3L5AA 2WBGA 1V5XA 3ZOAA 3TYDA 3BLOA 4AX7A 1Z44A 4GQBA 4O1EA 3CAKA 2QPXA 3V18A 4I9AA 3SN4A 1JAEA 4MWAE 1E6RA 5I0DA 4ZSUA 1WX0A 2X0HA 2QHAA 3FAWA 6PTDA 3G2GA 3WX7A 1M7PA 3LB8A 3OPSA 2H3BA 3AQUA 1XYZA 4XSLA 5GJNA 3QQ1A 2YA2A 4DAIA 1SGJA 4FLRA 3WUGA 3NVWB 2B7NA 4EANA 3CB3A 2C91A 4O1BA 4A8NA 2GVGA 4IPLA 4GABA 3M0IA 4UTUA 4BWLC 4B91A 1FWHC 3G0SA 2D3LA 4PTVA 3KL0A 1VPXA 2IMRA 1ADSA 4JTJA 1PX8A 5IM51 3LS9A 3OZMA 4V15A 3WLIA 4F66A 4GKTA 1TE6A 1TTJA 1N63C 2W92A 1U5JA 5ABFB 4KRTA 1LP6A 3PTDA 1S1RA 4ZODA 1FIQB 5AC5A 2BY2A 4U28A 3FA4A 2VVNA 3URBA 5IDZA 4ZQCA 5D9MA 1UKOA 3OEXA 4Z1DA 1NU5A 1V3JA 1FWTA 4WX2A 5CPMA 4UC5A 1JCYA 4A3HA 2GVLA 1ZJAA 3HPFA 1KR1A 1SO4A 3NQDA 1CXEA 1R86A 4YWSA 2FH6A 1X7IA 4LALA 3P93A 3GFYA 3MMUA 1K3UA 3K8MA 2A85A 5F2MA 3FV9A 3GDKA 2PA6A 2V82A 3CJPA 2WMIB 2W27A 3ECQA 4UOQA 3W74A 4WDTA 2Z1VA 5C2GA 2QV5A 2QUNA 1F07A 2WSYA 3LMZA 3VIGA 2DGAA 3KWSA 4YMZA 3LHTA 5JRBA 3ZR6A 3O0HA 3M43A 4N4PA 4C6IA 3IIXA 4DJDC 1MEWA 3RFAA 1CXIA 5JBEA 4PUNA 4NJIA 1XLFA 2QT3A 3T0DA 1TV2A 3M16A 3WENA 1GK8A 1XISA 1M1BA 4AEFA 5C7HA 2TRSA 4PCPA 4WF7A 5D9NA 3LV6A 3IUHA 3KS5A 1QR7A 3T44A 2XIBA 2QCGA 1C8YA 1M41A 1ZKQA 3TTQA 4BA0A 5LGZA 4AUBA 5A6LA 3GD3A 1XGZA 4MVAA 5HMDA 2DU2A 3A9BA 3DENA 3FYPA 1OQFA 4DF2A 3C4UA 4B90A 3NPVA 1P0EA 3QTPA 3EKZA 3TZNA 3UJEA 3AHVA 2A3EA 1MNZA 3G1FA 1V02A 3GDBA 2FHCA 5GVJA 5F4SA 3W7IA 2GR2A 4HPNA 5DRCA 1S2UA 3I68A 4LGXA 1D8WA 1CPUA 1K77A 1PWLA 2B4GA 3RHGA 1BWLA 1REQB 1UR4A 3B8SA 2HNHA 1OD8A 3MKVA 4PUWA 4C5ZA 3M0MA 3LSCA 3W2NA 4UFLA 4JZ5A 3AIVA 1S2WA 3QQ0A 3MZNA 1EWDA 1AW1A 1DIKA 3VNYA 2A2IA 4R7OA 1US0A 3EXTA 4XWUA 3ZVIA 4XVEA 3VOCA 2QQ6A 1HL2A 1EXBA 5GJPA 4B92A 1W9DM 4D1IA 2DJXA 5TR3A 2CU0A 3B0PA 3P5YA 2VT0A 3EMQA 1NHPA 1XM3A 1G5AA 3AMCA 3STGA 3S5YA 3M46A 4M1RA 4KESA 1R2SA 3HG4A 2Z00A 4IJRA 2VRQA 4M51A 1VCFA 4FMVA 4H9VA 4F2TA 3CM4A 3KRZA 5E5CA 3W53A 4UTWC 3N2OA 3THCA 2MNRA 1D7YA 4CNTA 2CZDA 1ADOA 2C0HA 5I3DA 3TH6A 3LUTA 2PODA 4Q8UA 1YLVA 2DIJA 2VVSA 2QGHA 1DV7A 4CKQA 2QUMA 1QAPA 7REQA 3GG8A 3KL5A 4W5UA 1H7RA 4MNKA 1UUMA 3GX9A 4O4VA 5DY3A 4JIPA 4LSBA 4H83A 1L6SA 3W2JA 4AVNA 4QP0A 4DUXA 3DC8A 5XIAA 2CCRA 5I07A 3GHUA 4JCLA 1E55A 1B30A 3OHMB 1KTBA 3W2LA 3W1TA 1EP1A 4GR1A 1GVRA 2BVTA 4U5IA 3RM8A 2DV0A 2WM1A 1CGVA 3OLDA 1XLKA 2QPSA 1J0ZA 3UCQA 3UJ2A 2QDEA 5JCMA 2Y2WA 4AF0B 4AEOA 3WCZA 1JPKA 4YNGA 4MNLA 3AU6A 3BGJA 2G8ZA 3S1WA 1SFLA 1TQXA 2W67A 3D9XA 4W88A 3C56A 2AGTA 1C9DA 4OOZA 3TTEA 5HINA 3MKCA 1GVFA 1EJWC 3UWZA 4Q4PA 1JYVA 1ICSA 4FX9A 1H11A 1VKFA 3AIWA 1LG2A 3O6AA 3KVJA 4ZB5A 4NHVA 4Z2LA 3NQ8A 5D38A 5K7JA 4BQ3A 3EDEA 5BWFA 3ABOA 2WPFA 3AISA 1IWBA 4CEUC 2XH7A 2X8RA 2W79A 4HNVA 1MMFA 3GYEA 4TQTA 3JR2A 4K38A 3L4YA 1YPFA 1TSIA 3A4XA 1DJNA 4DY1A 2XFYA 2A3CA 4ACZA 8A3HA 3UWVA 2EPNA 1EF3A 1W9UA 3VUSA 4V28A 1N62C 2OX1A 1GQKA 1TE1A 1GJWA 2WSPA 4IGMA 2VX5A 3A6OA 1CLVA 4K8HA 2F2HA 1NJJA 1SPQA 2A0NA 1JL8A 4KPLA 5EL1A 3VC5A 2BOGX 3NQ6A 1EDQA 3LX9A 4ZB0A 3O06A 2V5KA 4GZIA 5FJIA 4RK8A 1QPQA 2CKRA 5LHEA 2YFOA 3MBDA 1GVEA 1AQHA 2DEPA 4LYPA 3E6EA 4IWWA 4DI9A 2HXTA 1DQUA 5F2IA 2QVNA 2E9BA 3DH9A 5FS6A 5CPTA 2R1NA 1R5YA 5K9DA 2PWVA 1BYCA 3WDQA 5CSYA 3W70A 4ROPA 1UBSA 1MXSA 4KPRA 4TX8A 3NZRA 2Z7GA 5KZMA 4Z2KA 3W0KA 1FH9A 4FX6M 1RV8A 4FXSA 3UW6A 1XKYA 4CUCA 3U57A 3ZJ7A 3ISIX 1GONA 3CTTA 5HPCA 1R7OA 1TV5A 2HK0A 4B4FA 1V3KA 5JVLA 4LS2A 2RHGA 1H2IA 4DF1A 1UKPA 3N19B 5FSEC 4LA1A 3E0IA 3UWYA 4JKMA 4HIBA 2KZHA 3FEQA 4F9JA 5DCDA 1Y5VA 1J8VA 4HN8A 2DUZA 4CU7A 1Q65A 5CC3A 2P8CA 5A2CA 1P7TA 1JI2A 4GVHA 1P6BA 3GG0A 3GSMA 2QGYA 1NF7A 1V6VA 1PBGA 1OK4A 4L61A 3IEBA 2A3LA 2NZLA 2RGMA 4FB7A 4WVXA 2G3IA 1O4UA 1DWAM 3NQGA 1VCVA 4EACA 2QR6A 2X16A 1WBHA 3M9YA 3G1SA 2FMNA 2YXGA 4B3KA 4GO9A 2AGKA 3LHZA 4JTGA 4C1NB 1BF6A 4UCGA 1GOKA 1GZJA 3DCPA 3I65A 3Q67A 4BI7A 3W38A 4QNEA 1KFWA 4JTCA 1EPXA 4B5UA 4HNTA 3LADA 1F3XA 3LCWA 3GIYA 1FUYA 4D8LA 4OE7A 3VCRA 4UMAA 3VTRA 2EPOA 3ITCA 3AO0A 3RR4A 3B04A 2TAAA 3WEMA 3VNLA 5JIWA 3IVTA 3GVQA 4YCOA 4DPQA 4JQ9A 1QJWA 4JIQA 2X8HA 4B9ZA 1KR0A 3W7MA 4RNFA 1E0XA 2F6KA 2XGIA 2XIIA 3CNYA 3G1DA 3GBDA 2PP3A 2KX9A 3NYZA 4OGZA 4R7JA 1ESWA 3WQWA 4P61A 5C55A 5GNXA 1ITCA 3W7PA 3HGOA 4LYQA 3ZR5A 3Q94A 4LEFA 3LCHA 3VPLA 2QIWA 1B90A 2ISSA 3VIJA 4NQ1A 2BVWA 3L5OA 3CH0A 4GIYA 3R94A 1LBFA 4LU0A 1JIBA 1LL7A 2Y7FA 1UB3A 5A3HA 5HNNA 4JQ4A 4NYYA 4ML4A 1V3HA 1OC5A 2PDNA 1NOWA 2DZXA 2GFTA 1UZ1A 4DBSA 3SQMA 2G95A 2QW5A 2Z0IA 3GR4A 3PG9A 1NSJA 3N73A 4ORMA 3CU2A 3PFRA 1GJPA 4BJHA 3ZVHB 4BZYA 4MB5A 1ISVA 5CJNA 3HMCA 1HKWA 3QQWA 1YKWA 4YYCA 5HAOA 5K4ZA 2RJHA 3QFEA 4JTKA 3TU9A 3EPNA 4R9OA 4CN1A 2WCAA 1TZZA 2QEZA 1MW0A 2W0UA 3ES7A 4KWOA 1ISXA 3F5KA 1JCMP 3M4HA 3MU7A 2DVXA 4US5A 1AJ0A 1UROA 5KZDA 3WH6A 1HNYA 1YDOA 4LVFA 2YL8A 5LIKX 1TYGA 2I57A 4IG2B 4RXFA 1RHCA 3C0LA 1Q5MA 1DE6A 1WB0A 4JOMA 3CH9A 3IANA 5BU9A 1YX1A 1EJRC 1QI4A 3NL2A 3ABQA 3DEQA 4LVBA 2W9MA 1RXOB 1XLHA 2ISFA 3W7QA 3OGSA 4PMNA 1R2TA 4JAWA 1MNSA 4Z1CA 1BRLB 1KFKA 3T0AA 3ZLGA 3K8LA 3WNNA 3S83A 2J7BA 5AHNA 4XV0A 4O53A 1T8QA 2PF0A 3A22A 3GQYA 1A80A 3A7RA 1KFLA 5ER0A 4ZXLA 2EXOA 2J7CA 4IMDA 4JX4A 3KRUA 2HVNA 1SSGA 4ICNA 1Q8JA 1U1HA 3OYZA 1VP5A 3OVRA 4LTSA 4C6OA 4CD4A 6XIMA 3GH7A 4XKYB 5HJLA 1KXQA 1ZXIC 3AROA 4P7RA 5HQMA 1XRTA 3TMQA 2PF8A 1NWRA 3TMLA 5D33A 4KGJA 3DX5A 3TN5A 3CBWA 2ZVIA 3B8UA 3EPOA 1J11A 1BGAA 3KDNA 1XS2A 4JN6A 5FEWA 1GEHA 3WQGA 3KVMA 3SJNA 5KITA 1H51A 4M6QA 5FJJA 3CPUA 1VRXA 1ZU8A 2AL2B 1TPDA 4EM4A 3WMLA 3LBOA 1O68A 3LHUA 2VM8A 2PUZA 2QDGA 1GERA 2E5AA 2VC5A 3OGVA 1GW1A 4V1XA 3LCIA 2WNWA 3K4AA 4QEHA 3TP4A 1HP4A 4L4MA 5L9FA 4I9MA 2C1IA 3DESA 2V8ZA 5DBTA 1FEBA 1IT7A 1O94A 3STPA 1JPHA 3MI6A 5U7SA 2WSQA 2OG9A 1A0CA 1W9BM 2DSKA 1FWFC 1XBYA 2GQAA 3MP3A 3WFLA 3VD7A 1PZ1A 2D2HA 3OU8A 3W00A 3JUGA 2RGLA 3DIPA 1SMAA 4XAZA 4O13A 3DBNA 4L9ZA 3NL5A 2YIHA 1LLOA 4I6VA 3IACA 4N9BA 1J6OA 1Q6EA 4RDVA 2W91A 3LCFA 1V97A 1L6WA 2FFIA 4QE5A 5MKGB 1OVDA 3PJTA 3GU1A 1GYNA 1RALA 1TTQA 1AL7A 2ZICA 1TUFA 1FWEC 3IGSA 4RDZA 4WGHA 2XYLA 1JJKA 3M47A 4FALA 4UNLA 2VEFA 1WKFA 3ANVA 4M6VA 3DECA 3WNMA 3P3BA 3L65A 5JU6A 4JFSA 2VX4A 3LBMA 1E1CA 4AY1A 3NPXA 3K1GA 1MI3A 3ZYZA 4GUIA 1L8NA 3GH4A 1H7PA 3L23A 5LHFA 3FYYA 2BX7A 4KH2A 3SW6A 1N5XA 2PU0A 2E40A 1EGZA 4Z2JA 3ALFA 3RYSA 1WUFA 3MWAA 1A5CA 5AC8A 3DFOA 4DJEA 2VEIA 4K3ZA 3GY1A 2ZYFA 3GNRA 3IAPA 4GX8A 4YTQA 3ZWTA 4ZEPA 4A8LA 3WEZA 1ZMDA 3T0CA 2FPVA 3KL3A 3G1XA 3HIJA 2EPLX 3UPMA 1IXPA 5CQ1A 2WV8A 3UXDA 4I8DA 2OT0A 3N14A 1EO5A 3PR2A 1XCWA 4KETA 2V5LA 4Z08A 3LMYA 2QULA 4XSMA 4WZHA 1IEQA 2X1RA 3WJZA 1V03A 3I4KA 1O5KA 3A3XA 4M8UA 4H2CA 4JS3A 5DFAA 5ABEA 4D9PA 4XTIA 5RUBA 3PG6A 4K39A 2QDDA 4GUFA 3FOKA 3HJEA 2PGRA 3T6CA 2ZA3A 5T8GA 3L4UA 5BNKA 3AXKA 3KLKA 2WK2A 4EMIA 1ME8A 3S3GA 3BLKA 2BSLA 2ZUMA 4XG1A 1CECA 1JULA 1PIGA 4YHEA 3PZTA 4RE3A 1LM1A 3E0WA 3FEMA 3TWBA 7PTDA 2WC7A 2NX1A 4KCUA 4LUIA 5D32A 3ZJ8A 2C18A 3U7VA 3NVZB 4HNLA 3OQEA 1EKOA 1LRTA 1L8PA 1Q63A 1WPCA 2PRLA 4JNMA 4NYUA 5D2XA 1Z6KA 2VD8A 5IHRA 3TONA 1D8CA 1W0MA 3UZJA 1TO3A 1SR9A 2E8ZA 3R0UA 2Q3OA 1C93A 5JCKA 2QAFA 4AY8A 4X0VA 4PBFA 4GO8A 4LRSA 2WMKA 3HOJA 2DZTA 4IT1A 3EB2A 1G4SA 1M01A 4XZMX 4IXHA 3VKKA 5CEWA 2C7FA 1JROA 4OUEA 3SQLA 2V0TA 1JGMA 4WKFA 4RPQA 4XQ6A 3TA9A 2RDTA 3VMPA 1EJ7L 1KW1A 4O15A 4J9JA 3MI3A 3CL7A 2V81A 3GNNA 4Y9NA 4M80A 3PBYA 4B16A 3PSWA 1XFBA 4LV9A 3R0DA 4AZIA 3VIOA 2RABA 5HJYA 1QWGA 3AHTA 2NV2A 3ARYA 4XUYA 3AS3A 2REQA 1OBAA 2QUTA 4LUTA 3BLEA 3KRSA 4AAJA 2DPEA 2VDGA 1UYQA 3L4WA 3L4XA 4H2HA 4Q8VA 5J5RA 4MWAB 5BRQA 1T6MA 4EPDC 3AXIA 2GJXA 2GVJA 5A8MA 3CV7A 4S2BA 3O16A 3UXIA 4I90A 5CGTA 3CUHA 3LD5A 3UJFA 3H4WA 3PZVA 3SY1A 3IIOA 2WC3A 5BOOA 1VBHA 4CCEA 4F3HA 1ZENA 4KEVA 3F4NA 3NPUA 1J9YA 1J2BA 3R07C 2XWEA 4BF9A 3RK8A 1Q13A 2F9RA 3TAKA 3K5XA 3GC4A 1JZ6A 1AW2A 2GJXB 3U5UA 5CZSA 4HQVA 3NVDA 3OA3A 1E73M 2POTA 1ONRA 5E09A 4GNJA 4RDWA 3UP8A 1R3SA 3ELFA 4AEEA 3N4FA 4ZTXA 3UA4A 3T09A 2OGYA 3GVWA 1EEPA 3UGRA 4D6EA 4L1XA 2YL9A 3RXZA 1SR0A 3STEA 1OABA 3C2VA 1H49A 3L21A 5TD4A 1STZA 4YS1A 3HQOA 1SZNA 3KLLA 1S2TA 1D3GA 4UFMA 4YIWA 2X7VA 1JD7A 3OJGA 3NR0A 1IXOA 4MMWA 2D2JA 3LLFA 4Q8QA 2HE5A 2WZIA 3M0XA 2NUXA 4Y6GA 4NX0A 2I5IA 1KBKA 3NCOA 3S1UA 3M5ZA 2OXNA 2WSKA 4AZHA 4AMCA 3Q37A 2AQVA 3LV5A 3W85A 3N12A 1B3VA 5BW6A 1D3HA 1XLBA 3WUFA 3QV6A 2QYGA 3FJ4A 4S3BA 4PL1A 3L68A 1P6WA 1WE5A 5BXTA 2W3RA 3PULA 2DW6A 3FIGA 4DXKA 5U25A 1GORA 4E2BA 1R8LA 2G50A 3FYOA 2I17A 3H23A 4S3GA 3QC0A 3SCPA 3OVGA 3TW6A 4N42A 1N8WA 3WQPA 3D0CA 2OWWA 3OW1A 3QSTA 2R9RA 5FIPA 2RDWA 3F5JA 2WZEA 3BSGA 2VX7A 3NDZA 1AW5A 2C0AA 3JVAA 4ADWA 3BAKA 2CLHA