1TZZA

Crystal structure of the protein l1841, unknown member of enolase superfamily from bradyrhizobium japonicum
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
387
structure length
374
Chain Sequence
VRIVDVREITKPISSTKMTTSLVAVVTDVVREGKRVVGYGFNSNGRYGQGGLIRERFASRILEADPKKLLNEAGDNLDPDKVWAAMMINEKPGGHGERSVAVGTIDMAVWDAVAKIAGKPLFRLLAERHGVKANPRVFVYAAGGYYGLSMLRGEMRGYLDRGYNVVKMKIGGAPIEEDRMRIEAVLEEIGKDAQLAVDANGRFNLETGIAYAKMLRDYPLFWYEEVGDPLDYALQAALAEFYPGPMATGENLFSHQDARNLLRYGGMRPDRDWLQFDCALSYGLCEYQRTLEVLKTHGWSPSRCIPHGGHQMSLNIAAGLGLGGNESYPDLFQPYGGFPDGVRVENGHITMPDLPGIGFEGKSDLYKEMKALAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein L1841
publication title Crystal structure of the protein L1841, unknown member of enolase superfamily from Bradyrhizobium japonicum
rcsb
source organism Bradyrhizobium japonicum
total genus 129
structure length 374
sequence length 387
chains with identical sequence B
ec nomenclature ec 4.2.1.81: D(-)-tartrate dehydratase.
pdb deposition date 2004-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1tzzA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1tzzA01
1FHVA 2QJNA 3H70A 3P0WA 1DTNA 1R6WA 2ZADA 3GD6A 4G8TA 1SJBA 3MUCA 3MZNA 2OX4A 4JHMA 3TTEA 4Z17A 3TWBA 4ENLA 3DG6A 4K1WA 2GGIA 4G7FA 4GYPA 4JN8A 1EC7A 3VFCA 3VCNA 3DERA 2OO6A 3UJFA 2O56A 3GY1A 2PODA 2ZC8A 2GGGA 2PMQA 2HNEA 3D47A 5FJPA 3V5FA 1SJDA 3SSZA 1KD0A 4HCDA 3D46A 1JCTA 4MKSA 3VC5A 3JZUA 2CHRA 3TWAA 3NZGA 2PTYA 2QGYA 3IJIA 3ENLA 3MKCA 1ECQA 4IT1A 1KKOA 4IL2A 2GGHA 3RO6A 1TZZA 3I6EA 4K8GA 2HXUA 4E5TA 3UJRA 3EEZA 3DDMA 2XH2A 4IL0A 3UCCA 4K2SA 5FJOA 4HNLA 5EU9A 2GSHA 4GISA 4GMEA 1EC9A 3VDGA 1SJAA 3EKGA 3UCDA 1BKHA 3PK7A 3OZYA 3DFYA 3KUMA 3H12A 4GYPC 1ONEA 1WUFA 2GL5A 2POZA 2OQHA 3BJSA 4HNCA 3FV9A 3TW9A 2PA6A 2XSXA 2DW7A 1YEYA 4IP5A 4DX3A 3DG3A 3OW1A 4IHCA 3RR1A 1F9CA 3DESA 4ZA0A 4Z1YA 5ENLA 1BQGA 3V5CA 1KKRA 1MNSA 4J3ZA 3H8AA 3QKEA 3N4EA 3RITA 2PU1A 4A6GA 3ZVHB 2MNRA 2OPJA 1TKKA 1JDFA 2RDXA 4GIRA 2AL2B 3CYJA 3GC2A 2PP0A 2QDDA 3THUA 4M6UA 4HPNA 3RGTA 3S5SA 3MY9A 2PSNA 2NQLA 2XGZA 1EBGA 3UJEA 4KPLA 2XH0A 2QDEA 3DEQA 3S47A 3ZLGA 3STPA 4DN1A 3IK4A 2PP1A 3T6CA 3CB3A 1NU5A 1SJCA 3R1ZA 3TJIA 3NXLA 3JVAA 2OFJA 4HYRA 5FJTA 2GGJA 3I6TA 6ENLA 3QPEA 5IDZA 3K1GA 2PPGA 4GGBA 2XH7A 5BOFA 3Q45A 2HXTA 3TCSA 3TOYA 3ES8A 3R10A 2AKMA 3MSYA 3CXOA 3VC6A 2P0IA 3QN3A 3OTRA 3UJSA 2P3ZA 3N4FA 1XS2A 2OZTA 4FP1A 2ONEA 2P88A 3RRAA 1RVKA 3SBFA 4ZCWA 3FXGA 4E4UA 4MGGA 1MDRA 3U4FA 1JPDX 4A35A 3OZMA 3QTPA 1IYXA 1W6TA 3U9IA 3UXKA 1MRAA 4KWSA 1EBHA 1PDZA 1P48A 1R0MA 3NFUA 3T8QA 1OEPA 4IZGA 3PWGA 2OZ8A 4IP4A 3SQSA 3SN0A 3NO1A 1FHUA 2PTWA 1TE6A 4H19A 2AL1A 5FJRA 2P8BA 4DWDA 3PFRA 2PTXA 2GDQA 3HPFA 2PTZA 4KT2A 3R0UA 3H7VA 4GGHA 2FYMA 1JPMA 3UJ2A 7ENLA 3TJ4A 3VCCA 2OQYA 3T9PA 2OVLA 3FYYA 4YWSA 1KCZA 4E4FA 2QVHA 3SN1A 5BOEA 1XPYA 3B97A 3DG7A 2OKTA 3FCPA 5J04A 4JN7A 3Q4DA 3CK5A 4E8GA 2QJJA 2OG9A 3QLDA 3RCYA 2OZ3A 4MMWA 3P3BA 4FI4A 2PCEA 3N6JA 3V4BA 3ZVHA 3DIPA 2OLAA 3DFHA 3V3WA 3BSMA 3N6HA 3TQPA 2PGWA 3GO2A 2AL2A 3ZLFA 3T4WA 2XH4A 3ZVIA 4E6MA 4KEMA 3DGBA 1NELA 3ES7A 1E9IA 4HN8A 2PS2A 3CT2A 3CAWA 4DXKA 1L8PA 3BOXA 3MQTA 3R11A 3R0KA 3PWIA 5FJUA 3OPSA 3IJLA 4H1ZA 2GGEA 4A3RA 2HZGA 4EWJA 1WUEA 2MUCA 3SN4A 2I5QA 2PGEA 4ROPA 3FVDA 3ZLHA 2P8CA 4M0XA 2QJMA 1EC8A 2FKPA 1PDYA 4J1OA 4GFIA 4DYEA 3SJNA 3JW7A 3I4KA 1MDLA 4F4RA 3VA8A 2PP3A 3FJ4A 2DW6A 4DHGA 3IJQA 1MUCA 2QQ6A 3R25A 2PU0A 1ELSA 3MWCA 4H2HA 3UGVA 4X2PA 1P43A 2AKZA 4H83A 3P93A 4HCHA 3UXLA 3OP2A 4HCLA
chains in the Genus database with same CATH superfamily
1FHVA 2DZUA 4MM1A 4H4XA 1FX6A 3L5AA 4XBKA 4Z2KA 4PBGA 1XRSA 6CGTA 2PDLA 3NM3A 1NDZA 1TMHA 4ENLA 1L2UA 3JRKA 3R5EA 4MLJA 2Z2AA 2OU4A 4CU7A 2VX4A 2HJPA 1EC7A 1T5AA 4QHRA 3DERA 4PMRA 4FA3A 1O68A 1QNPA 4Q6XA 3TTYA 3QH2A 4PEEA 4LY8A 1US2A 1E55A 3U0HA 1M03A 2YLLA 1FH9A 4RNHA 1WX0A 2DJXA 5F1UA 3TJLA 5LIWX 4AX7A 4GUHA 4DNMA 3NDYA 3WNLA 3EA3A 4KGLA 4RXFA 4K8EA 1SFTA 5HAOA 4CNTA 2FZDA 4PMQA 1G4PA 2WQDA 1VBGA 3MVTA 1TO3A 2ATMA 1AQFA 3CUJA 3S2NA 1BYCA 1YDOA 3ARQA 2ZRXA 1EJVC 3RXZA 3WUBA 4IT1A 1CXKA 1PKNA 1BRLA 3GDLA 3RO6A 1R3YA 3ID7A 3RNDA 4F8XA 4W7WA 4GR1A 4BF7A 1FQ0A 1PHWA 1JPKA 1LUCA 4M6QA 3WDHA 1JQXA 3KM8A 4O12A 4X3ZA 2YDAA 1A49A 1H7PA 2INZA 1IXPA 4H9MA 4EP8C 1K8YA 4QLLA 3P6LA 2BVYA 3EDKA 1NJJA 2GR1A 1DE6A 4ZB5A 4UNKA 3VUPA 5AHNA 3LS9A 2YYTA 2Z6IA 3Q37A 1DEDA 2X40A 3G1AA 4Z08A 3QYSA 1TZ7A 2FTWA 2YAUA 3IS4A 5LIKX 5KSWA 1VFOA 4H41A 1EIXA 3HPAA 1S5VA 2C91A 4PMXA 1XLEA 2V3AA 4QG9A 3IAPA 1HFBA 3WNNA 4M6VA 1M7XA 1ITCA 1ITQA 1PZ0A 3EANA 2PSNA 2EXOA 4CNOA 4MZYA 1R3TA 5DELA 3MP5A 1GOWA 4GJIA 2QPXA 1S2UA 1RJPA 3WD0A 3JUGA 2VR2A 1F3TA 4DN1A 2WNQA 2PP1A 4E3VA 3T6CA 2ODOA 4GJJA 3BH4A 4F0SA 4JQ1A 4EXBA 2Y2WA 4DJED 2E6YA 4HOXA 1L9WA 2OFJA 3AYTA 1SZFA 1KGXA 2JKPA 1XH0A 4J3UA 3DFNA 4WXZA 3BMVA 2ZZCA 3CTLA 1VKFA 1XBZA 2X16A 5MF5A 1JXKA 4LANA 1RQHA 1VQZA 1J96A 4ZOBA 2UY5A 3WDIA 3TIMA 4XISA 1VBUA 2R9RA 3UVIA 3N2CA 3MU7A 3OTRA 1DNCA 2PDMA 1GRGA 4FIRA 1DJXA 1VFHA 1AH3A 1VZWA 3PNZA 4LUTA 3PBGA 4LAZA 4LY4A 1R3SA 3WFZA 2EG7A 3QFEA 3S1GA 3IGXA 3B8DA 4MADA 1VEOA 1DWIM 3R8RA 3CAKA 1CGTA 2DVXA 3A21A 3U9IA 2I5IA 4K8DA 1E40A 4UQBA 1OEPA 4Z0SA 4JCMA 2XSBA 2E77A 3HGRA 1QPRA 1PBGA 3TZFA 1HUVA 3NO5A 3NRZB 1UWIA 3S2MA 4R7WA 3ZWTA 1N60C 1QOPA 3H2AA 4PMZA 3W29A 2VCAA 1EYWA 1DPMA 3V75A 4FDCB 3MCMA 3QHOA 4UTUA 3KZSA 4IPIA 3A4XA 3WUFA 1QNOA 1M6IA 4H3DA 3C2RA 3DC0A 1JIBA 4OU1A 1DXFA 3W7JA 3NZRA 2Z28A 3EMQA 2VNCA 3WH7A 4Y6GA 2Y63A 3BICA 1I1XA 4H4UA 3B97A 3ZT6A 5EMMA 3CZ8A 4JQ9A 2C0AA 1RK6A 3IJ6A 2AAMA 4YWIA 3QBUA 4GVGA 3T09A 3SGZA 4A2SA 1V0KA 2GUYA 4UNIA 3T0BA 2A85A 3P84A 2QZRA 1MMFA 4OGZA 1TPC1 3AZSA 4H4ZA 4JKLA 4PTWA 3W73A 3AS0A 2QV4A 2E9LA 4IF2A 1MUMA 1SGJA 3KCJA 3OBEA 4H9VA 3LHTA 4ALDA 2QEZA 4KIEA 4BEQA 2Q3OA 3OQ8A 5HMDA 1GOQA 3PPCA 3WLNA 1JD9A 1E0XA 2FLIA 3ZLFA 2XH4A 2KZHA 4R34A 5E09A 5ABHA 3BANA 4RPPA 2QNEA 5LYRA 3P62A 3B04A 4ZL1A 3REQA 3IJDA 4IMEA 4F9JA 2RJHA 4A2RA 4O16A 3DU0A 3R0KA 3W9ZA 4LPCA 1POKA 2DY3A 2RUSA 5HNTA 1OYCA 2PGEA 3PNUA 5CZ0A 2HPIA 1TV3A 4KMQA 5E0KA 4D8AA 2H6RA 1I0DA 3I65A 1XGDA 3S8HA 1YXDA 4L6OA 4R7JA 4LAKA 3MVIA 3DHDA 2C3CA 1U33A 3P7YA 2ZWYA 3N14A 3VNZA 5I5RA 4MWAE 3PR2A 3OIXA 3DXIA 3O0FA 4TMBA 3UXIA 4AC7C 4XVEA 1P6CA 1UD5A 3DKJA 1W54A 1VLWA 2JIEA 5HOSA 1GQKA 4FF5A 1ZBCA 1KBLA 2ZA3A 3PFMA 3H70A 4KCTA 4F66A 1DTNA 2ZADA 4G6CA 5HNUA 2HV5A 2VP8A 3A3XA 3UWEA 2ZZ7A 2X2YA 2GSJA 3DGZA 4JHMA 4JTKA 3CXBA 4UIOA 4KIRA 1X6NA 3LBOA 1JXJA 3UR7A 3N11A 3OA5A 2GGIA 2O9PA 3EDDA 4UFJA 2INEA 4H2CA 4O0ZA 4S3FA 1PVNA 1P7TB 2X1SA 2AQVA 3LB0A 3FSTA 3WK2A 4S2BA 3LMZA 5FOOA 5A8PA 3LHYA 3NSMA 3WF3A 3MI2A 3VKBA 1NDVA 3GYEA 2PODA 2ZC8A 1OCJA 4LAUA 1FUYA 2VEGA 4JHZA 4XAZA 7REQA 2PMQA 2OEJA 4DVOA 4UQDA 2F2KA 4HCDA 4UCFA 1UKTA 3GBDA 1XJBA 3VKAA 1N55A 3A7RA 1G69A 3L4TA 5KZDA 1SVDA 4FLOA 4U5IA 2VX6A 3TUUA 1BF6A 4US5A 1BWLA 4TVYA 4H4QA 1K7EA 1D7YA 2V3DA 3G0SA 3PBMA 4DBDA 1VIWA 3UJRA 4TO8A 4M56A 3EEGA 2XH2A 1CGWA 1YBQA 3G3DA 3O63A 1HXJA 1GKQA 1M5WA 3AIUA 3BLEA 4BFAA 2V82A 3BWWA 4MFDA 3N9SA 1MEIA 1WXYA 1XDLA 2VZSA 2BVWA 4E38A 4N7QA 1YNQA 4H4VA 1Q45A 4MKNA 3EB4A 2DPEA 5EMKA 2A21A 1G9HA 3GKAA 3M07A 3AIQA 4XD5A 3NAVA 3BW3A 4UWMA 2DW7A 1DIDA 1Q7MA 3LENA 3KHJA 1QDSA 2FZBA 3VNDA 3WMLA 5CEWA 4Z1YA 3C0LA 1S3TC 1QBBA 1PX3A 4E0CA 4DAIA 1UKOA 3BARA 1MNSA 4ZQOA 4U4MA 2QKFA 1W1YA 1RAKA 2FHCA 1NF0A 4HKPA 3PZUA 3T8LA 3S9IA 1XPGA 4CEXC 1E9YB 1TJPA 2R24A 2WVVA 1LOSA 4V28A 4A8IA 1LOLA 1VEPA 3I6RA 4MB3A 3NL6A 4MB5A 4WVXA 1TB3A 1X2GA 1T8QA 2PRLA 1TSIA 3STPA 4S3EA 4WLCA 1EDQA 4LU0A 4F48A 4PUDA 1NU5A 3GQYA 2NT0A 1ZMDA 4Q6JA 4H9ZA 1PHQA 3D6NA 4EAMA 1NSJA 2I57A 1NTHA 2E6DA 1XXXA 4HYRA 2GGJA 1F6KA 5D8ZA 2WSRA 3PF3A 3QPEA 1OYBA 3L9CA 5CPMA 4L64A 2XG9A 5EMLA 1U83A 5DT5A 2VDHA 1X97A 2ON3A 1UB3A 2VC5A 2H3DA 2QCDA 1MRQA 2CKRA 4JYFA 4PRTA 3RDKA 1XWYA 4S3CA 2QF8A 1S5TA 3UJSA 3WJZA 1VB9A 2Q71A 3DOPA 1OBAA 3U7BA 1VPXA 4Q4PA 1KXQA 3MYOA 2X8RA 4FP1A 2RKXA 3LLDA 2Z4GA 3LSCA 3AOFA 4LS2A 4WOQA 4MGGA 4RDVA 1MDRA 3RX2A 2G5WA 2JEQA 4L4PA 3BDKA 3QTPA 3VGBA 3CV6A 2X7VA 4B91A 5BXRA 1EBHA 3CV7A 1FO4A 1QPOA 2WBAA 1NY1A 4ZOAA 3WH5A 5AZ1A 5EB8A 4HZ7A 4HK6A 2UZ9A 3EA2A 1H5YA 1V6WA 3AHXA 1S2WA 4HYWA 5FESA 3V0UA 2CLMA 3C0JA 3H7VA 4NAEA 3CWOX 1G67A 1F8WA 4YS1A 1OVDA 1ZJAA 1V77A 4YL2A 3DGRA 2FHBA 3KOZA 3A4AA 4J3VA 4HNVA 2A7RA 3VK5A 3KP1A 2OSYA 4LVDA 1BRLB 2BXZA 1ZENA 2VZTA 4QXIA 3DH9A 4JFVA 2WHLA 1GCYA 4GQRA 3LUTA 5GPRA 2FMOA 3GFYA 1V03A 3MCNA 5J5RA 1LUCB 5C54A 4LX4A 5K9DA 3BGGA 2QUTA 5I07A 2OZ3A 5BXPA 4QR6A 2W67A 3W7CA 4WY0F 2WBGA 3CT7A 1UQYA 4L9YA 4G9PA 4FOJA 2QCMA 4NIRA 4UTWC 1JCXA 1A5BA 2X41A 5CZTA 3GFXA 4XO7A 5TAOA 1QNSA 4KEZA 1WZAA 1ME9A 3IJ7A 3B4YA 4EWJA 4NVTA 2VTFA 1BVWA 4PMOA 2EG8A 1S46A 4DF2A 4LOCA 5M5DA 1KFWA 1VHNA 4J1OA 2V5JA 4JEJA 4H6QA 4KS0A 5IBXA 4S23A 4DNAA 2VI0A 1HP5A 4Y9PA 1X8FA 1CGXA 5D32A 5HINA 3L4ZA 3PG9A 2V8ZA 2J6VA 3WH6A 1R7OA 2XWDA 3NPWA 4P8UA 1MEHA 2J13A 1TPEA 4WOZA 5LXEA 3NQEA 5BRPA 4EANA 3P60A 2GSEA 4XIMA 5C8BB 3UZWA 2NVAA 3UETA 4W85A 1I4NA 4C6LA 4CVWA 1UWAA 3BJTA 4EM3A 4IIFA 4FSAA 4AD1A 3MP4A 4AFYA 1GT8A 3BLOA 4UTHA 1AG1O 1JQVA 2XIIA 3GNOA 2YPIA 4Y2WA 3L65A 3WNOA 2WHKA 4GPNA 1JDDA 4W87A 1R6WA 2CHNA 4WDTA 4J40A 1MOKA 4PMJA 2NV9A 2CLLA 2C0HA 3I3EA 5A6LA 4Z17A 1V93A 4Z2HA 4ZFMA 3FIGA 1GUVA 3NQ6A 2R1KA 1VC4A 1KFCA 4F0MA 1P5BA 2PB1A 5C9RA 2OO6A 1GK8A 4JFUA 5DY3A 3QLLA 2DP3A 1WBHA 5GRTA 3UYCA 3OQEA 3Q6JA 3B0XA 4AIBA 1XRFA 3GG7A 3KLJA 2WZTA 3BW2A 2OR2A 2H8ZA 3M41A 3EWYA 1BWKA 2AOSA 3VDBA 3VC5A 1H41A 3FJ6A 5HWMA 1B4EA 3VU2A 3HG3A 3TWAA 1QPQA 1ZAJA 5CKSA 5TD4A 3H4XA 3LYEA 3RCNA 1QPNA 2QCGA 1PWMA 3AC0A 3ITLA 4D6DA 2BV9A 1XUUA 3IIPA 1FDYA 4ERGA 1K4HA 3PG8A 3T42A 4XZIA 2J7EA 4HNLA 3UQNA 1TIWA 1THFD 4DRSA 5A6SA 1WKYA 1TWIA 2X8CA 5I6SA 3NURA 3PK7A 3V7PA 1OINA 5CAHA 4A3YA 3MHGA 3QC3A 3WNMA 1XM3A 4BA0A 4Q33A 3NQVA 4QFUA 5G2IA 1FDJA 2R1LA 1TE1A 4GQGA 5D2WA 3DG3A 3S1WA 4QJ5B 2C3DA 4ZA0A 3QZ6A 1XGEA 1AODA 1F2JA 4EMIA 3SJ3A 5JMUA 3W4RA 1X1OA 4AF0A 7ODCA 1AVAA 4O19A 3NQ7A 2PZNA 3QKEA 4JR5A 4I90A 3E0FA 1DWJM 4HP5A 1OFEA 2MNRA 1UKPA 3GXIA 2WHMA 4FLRA 2ZOXA 4XZLX 4WX2A 1R38A 1G4TA 2F2HA 1AK5A 2HE5A 3RGTA 1QASA 2CBIA 3CUGA 3IRDA 4I3GA 3WQ5A 5BW6A 2PAJA 3REQB 4LV9A 1SUXA 3HPSA 2XH0A 4RLIA 3P14A 2PBOA 5IHRA 4LIIA 3SO7A 3B8IA 1SJCA 4J28A 5HULA 1ODUA 2Y5JA 3TJIA 5IBXC 1NEYA 3JVAA 1JYVA 3QGVA 1O66A 3VILA 3WLOA 3CNYA 4JTSA 1S38A 2X8GA 3PHAA 4L4LA 3VNLA 4ZENA 4ZQRA 1FEBA 4O18A 4AVNA 2VKZG 3EWZA 3VM5A 4FXFA 3I68A 3BAWA 4BKNA 2D2JA 1AQ0A 3T7VA 3R6IA 3THCA 3DN5A 3QJAA 1V3IA 2F8QA 3SURA 1Q6FA 3B8SA 3KVLA 5DRIA 3QN3A 3WBAA 3LQLA 1ZGDA 4DJFA 2AAQA 1OT2A 4MY8A 3LHWA 3OU8A 3RRAA 1O12A 1VEMA 2A3AA 3SQPA 3MMUA 4A8RA 4AD4A 4PBFA 3QTGA 3MO7A 2J77A 1UBPC 1BF2A 4A35A 4QLKA 3GLCA 4PL2A 1IE7C 3CYVA 4KERA 4PODA 3LCLA 2C19A 2HNHA 4IZGA 1IXOA 2BOEX 3GYCA 1O1HA 3VPLA 2OZ8A 3QEZA 5D38A 3SQSA 3L4XA 1ZU8A 2Z1BA 3N13A 4F9DA 4KKXA 1ADOA 1E4NA 3C8NA 1EJUC 3RM9A 4O54A 1Q6RA 2ISSA 5I23A 1GPWA 1JYNA 5AC4A 4GI9A 4ERIA 7REQB 7TAAA 3S9YA 3WK0A 1AZ2A 2QUNA 2CCRA 1N5WC 1FHDA 1JCNA 1XKJA 1Q7ZA 3NOYA 4GXPA 4AD0A 2FGLA 3LSBA 4ORIA 3G6LA 4X0NA 4HJFA 1XQLA 3M5ZA 2V3EA 3FCPA 3B9OA 3ANYA 4J3SA 1FP9A 4YWOA 3HV8A 4QAWA 1QI2A 1YBQB 4P8WA 5C71A 2JALA 5I00A 1UA3A 1GZGA 3ITTA 4AU0A 1W0MA 3TTSA 5JRBA 3TP4A 1LCOA 4ZQNA 3GIQA 1VIZA 3W7DA 3CAVA 3ARSA 1CTNA 2HVMA 5D9PA 1DXEA 5FSDC 1E71M 3V3WA 4WGHA 4XIAA 4AZGA 2AL2A 3URAA 3D9XA 3F4WA 3H22A 3NVVB 4NYUA 4I6KA 3C6CA 3FKKA 4QEEA 1KXHA 1BYBA 3EX1A 9RUBA 3E1F1 1SW0A 3MQTA 3RJXA 1YPXA 3LMYA 5XIMA 2W61A 3P82A 3SCVA 2X1UA 2J3NA 2PDPA 3SRFA 4V1YA 2C13A 3O7UA 2WVVB 3DBPA 2JF7A 1UMYA 4NRSA 2PDGA 4PL1A 2DZWA 3LZ3A 3SCSA 3NNTA 4GVHA 4IIEA 4F4RA 4EK7A 3VA8A 2OOGA 2Y85A 3W7GA 1KFEA 3I3BA 3KTSA 1SSDA 4ADTA 4UFKA 5E6YA 1LLWA 3GVWA 1Q7QA 4O4WA 1VGAA 2PLCA 1RA0A 4QG8A 4U3CA 1CLXA 4H6KA 5CSUA 2NWSA 3EX2A 3WL1A 4H4SA 1EPXA 1LTDA 2DV0A 3A9BA 2YKKA 3ZSSA 4JY8A 3FSUA 1RLCL 5T26A 5LGZA 4DIAA 4X2PA 1P43A 1UYQA 3M0HA 5CSSA 4PULA 2X1IA 4IGHA 1DHPA 3OLEA 4DJFC 5A69A 2QCDB 2I9UA 2QGHA 4MSSA 2VR4A 4GRTA 3FKRA 1TJ2A 2Y5EA 5B7ZA 3QXBA 4BWLA 2BSLA 2HVNA 1XP3A 4HZ6A 1D8WA 3NPVA 4NL1A 3CHEA 3ZXWA 3EBVA 2VOMA 3TLQA 4LVAA 2GGGA 2WLYA 3LA4A 3TNBA 1VBHA 4B5TA 3E0IA 2CBVA 2CHOA 1JCTA 1XHCA 1XISA 2JE8A 5IDIA 2X0YA 3CLMA 3JZUA 2G96A 4URIA 4MJMA 5A8NA 2QGYA 4CD4A 1QNVA 8RUCA 2P50A 2W66A 2GGHA 4BQ3A 4NAEB 2JK6A 1K7XA 1C90A 4Z1AA 1XYAA 4O1CA 4AMAA 4IUGA 2BFGA 4LS1A 4UQEA 4TVDA 4LYQA 2OEKA 4LALA 3CH0A 3L5OA 4AHOA 5AHLA 3W7LA 1IZCA 1OZQA 3CWHA 1WKFA 1HVXA 2POZA 3S5YA 6TIMA 3NUKA 3FDKA 3RJYA 2PDNA 1QHOA 1YEYA 3A24A 2A5HA 3ANVA 1LLZA 3KBWA 2JGQA 2XVGA 2V5KA 2YR1A 1OHLA 5CPOA 3AFBA 3KTXA 4PTXA 1FCVA 3EDJA 4I8DA 2VM8A 1E9LA 3GDTA 1H62A 2DVTA 2X0SA 3EPOA 4XZNX 5GJPA 3HGSA 1AOGA 5D33A 2QYGA 3WUEA 3NTYA 2VVNA 2BNJA 3E3HA 4K8HA 1KWGA 3AICA 1LORA 2J27A 4KRTA 3TYEA 3K4AA 3FEMA 3QRHA 3ARVA 2A7PA 1X39A 3B9NA 3WNKA 2X42A 4JY9A 4LGXA 4GX9A 4DELA 4WRHA 2V6AA 4IWWA 2G50A 4C6CA 3S6OA 1TQXA 3QF0A 1OFOA 4A4AA 2D0HA 4IX0A 2Y88A 4I9TA 3UZXA 2QUVA 1KGWA 4DLFA 3B0UX 1SMDA 4PBEA 1D9EA 2P0IA 3GXMA 1KLZA 4TV6A 4HBKA 4DO6A 3H2FA 2CDUA 2WZMA 2EQ7A 3HMCA 4L80A 3M0MA 4NNCA 2WM0A 3AIEA 4EAYA 1LPFA 1ME7A 4FMVA 3NL2A 1S1PA 2ZIDA 1CENA 1GVIA 2F84A 1JF5A 2PCQA 1KM1A 4ADWA 2DU2A 2NQJA 3FAXA 3GDRA 5AFDA 4CVUA 4NJIA 4C90A 4M5PA 3A3HA 4DO7A 1QVBA 4B2DD 2OLSA 4XTDA 1YDNA 4L65A 2EJAA 5IXEA 1B0IA 1IR1A 1PDZA 2WOWA 3EYPA 1GW9A 3PWGA 4P7RA 1GHRA 2PTWA 3UBPC 1RM6B 4LAOA 4DUXA 2AL1A 5DBTA 1PV8A 1V5XA 1C93A 5RUBA 3NZPA 3AXXA 2VO5A 5G1TA 2NUYA 3CQ0A 3W26A 2HS6A 2Y7DA 1EH9A 4JL2A 1JPMA 4YTQA 4DM1A 1AZ1A 1HL2A 2XM1A 4JX4A 3KHDA 4O28A 5BZAA 3OLIA 3GHUA 2Y70A 1OB0A 3UXDA 1NHSA 3P2VA 4DXVA 5HBFA 4S2CA 5U7SA 2MANA 1EZ2A 1V6YA 1C8QA 4IFKA 2ZUVA 2V5LA 1MI3A 2GJPA 4O50A 3N3MA 4F0RA 1WO2A 3G1FA 3UA4A 3E96A 5FSEC 1W1IE 4BK9A 2NUXA 3W2NA 4IX2A 1IF2A 1PTGA 3NQMA 2Z26A 5I3GA 3OYZA 1ZALA 1IQ8A 4F0LA 3ICJA 1ZP4A 3SIMA 4IPJA 1KXTA 1SU5A 2XDFA 4FNTA 3ZVHA 4I7UA 3W1LA 1KTBA 1T0OA 1F4HA 3B8TA 1NP0A 3GO2A 1BXBA 1P4CA 3KVJA 3GW0A 1NELA 1C92A 1MZHA 4AF0B 4PUUA 1L8PA 3CLWA 3G3MA 3C2VA 5A8QA 1Q66A 4Q4OA 3II4A 3BOLA 3M0LA 1DWHM 3SAZA 4JTCA 2RGLA 1W91A 5IM51 3O0KA 3KVKA 2B7NA 3CPRA 3PBYA 3IIXA 1UZHA 4K38A 5CPLA 4JNMA 3G1SA 3HJZA 3TK7A 3QMSA 4DZAA 3SJNA 3JW7A 1DXIA 1PO9A 5A6KA 5IFTA 3AMKA 3LN3A 1JUKA 1L2QA 2J6XA 4B92A 5F2LA 1F76A 1M1BA 2NSOA 3UF9A 1VP5A 5EMYA 3UPWA 2PD9A 2GFTA 1AQHA 1RQBA 1ZJHA 2PTDA 5F1VA 4BY3A 1C8YA 1T40A 3MWCA 3D5HA 1M68A 2VURA 1SW7A 4HQVA 4MJ2A 1CGVA 2VX5A 4O0QA 3E38A 1WKEA 5FF2A 3M7WA 4A21A 3PUOA 4HCHA 2Z7GA 3L4YA 4L9ZA 3GH5A 3TTQA 2YJQA 3YPIA 3LI0A 1UG6A 1ZBKA 4WKAA 3UWVA 4HNOA 1AFSA 2DIKA 3T05A 1FDZA 4H7ZA 1IZJA 5GQBA 4ZQPA 1U1HA 1W3NA 1VF8A 4CD7A 1SYTA 3AIWA 4D6IA 2WSQA 3GAYA 3QFAA 3A5FA 3EX3A 2A4AA 2ZX5A 3CPGA 3G1YA 1OYAA 3MUY1 2X99A 1B3VA 2XFRA 1EB3A 1HO4A 3W2KA 3VGGA 3W1TA 3HN3A 4INFA 3ZJKA 4H8NA 2FH8A 3TC3A 2Y4SA 3BO9A 3UJFA 2DZSA 5TQLA 4ZSUA 3LBCA 4C6EA 4DPQA 3GY1A 3F2CA 4C6MA 2WKJA 3W1MA 4S39A 5FJPA 3KCLA 1D8CA 1XHGA 2V5BA 2FFCA 3WLKX 3GG8A 2ABAA 4GINA 1H7RA 1AMYA 2QV5A 2H9AA 1L6WA 5BWAA 2O7SA 4KRZA 4WJEA 4JTLA 5HMEA 3PANA 4IH3A 3FA4A 5JCNA 5JH1A 1V6TA 3L21A 4XD4A 3ARUA 3WQWA 3U5YA 3EWWA 3M5XA 3NZ1A 4M19A 3FYOA 4Y9AA 3CPUA 1J10A 2R9ZA 3O6CA 2J62A 3LQGA 2IPFA 4NEWA 3VMOA 4AXKA 3HO8A 1GQNA 2GSHA 4O1BA 5I77A 3RNMA 2ZZ5A 1F7BA 2J4GA 3WLHA 2EPKX 3UCDA 1OC5A 3ZYZA 1KRAC 3KUMA 3CO4A 3W3OA 2DZXA 5M1TA 3RYSA 4P5UA 1UIPA 2DT1A 4AZHA 1NVMA 4B5WA 1BTMA 2PDHA 2EGZA 3WFAA 2E09A 5HJLA 3CGDA 4C1NA 3BXWA 2CBUA 1K9TA 2NQHA 3EOLA 3ARWA 1C7SA 2RDXA 1OWQA 2WWDA 3BSHA 4ACYA 1W31A 2WNNA 3MYPA 4LC8A 2AL2B 1AD1A 2E67A 3AZTA 3V16A 4HNUA 4PTDA 3QY6A 4JTTA 3VDCA 3PZNA 3FAWA 2OGYA 4PMVA 1M01A 4GBDA 4L9XA 4M82A 5DMLA 1P6BA 1E1EA 2GDUA 1R9XA 4XD3A 2XWEA 1NOFA 3IK4A 4W7UA 2BHYA 3ZT7A 2OEMA 2HK1A 1BVZA 4DEFA 2D2HA 4E2DA 2QMKA 4PGLA 2PLJA 4ZXOA 1U30A 3OJGA 5IDZA 3CGCA 1OX5A 3H6OA 4GGBA 3T0TA 1X96A 1FWJC 2VR5A 3LXDA 3VO0A 1TJ1A 4J5NA 3BC9A 3PB0A 2RGMA 3C2YA 4LYRA 4NY2A 3H24A 3UY8A 3WENA 4MJ4A 3M9YA 4LUIA 1DWFM 4CD5A 2ZUTA 3GVGA 2GWNA 2R6OA 2VWSA 1FWIC 2GJLA 1GJUA 2DZVA 4ZSTA 1PX8A 3T0AA 3FXGA 3L7RA 1EF2A 4GKTA 2NV1A 1WDWA 2QULA 4NKCA 3U4FA 3EWCA 3QFBA 1YW1A 2XISA 5CJMA 3AMZA 2AGTA 2B7QA 4G56A 1K77A 1OX4A 5MHBA 3QZEA 5TBOA 2EHHA 1XDIA 1JR1A 1LBLA 5A8MA 3USBA 1F07A 1FHUA 1PL9A 3B05A 1G5AA 2F7FA 5G5HB 4IJCA 2WC4A 2PLKA 4DWDA 1K3UA 1EA9C 3LV6A 5ECVA 3URQA 3WLQA 3VIHA 1GOOA 2Y62A 4UQCA 2VC6A 2XM2A 1XDJA 2CBJA 1HL8A 3V0SA 3GU9A 4I9MA 3LLXA 4RJEA 3UJ2A 5CSYA 4IGSA 2PWHA 2PWDA 3F5KA 2VRJA 1LYXA 1QO2A 2PC8A 4L56A 1YNYA 3M0XA 4ECLA 4E4FA 3TCEA 2PI6A 3DBNA 1M53A 4BQ5A 4GI4A 4ZOHB 3DG7A 4M80A 4LUJA 2YXGA 2CERA 3CM4A 2I14A 4CNUA 1FKWA 4FS9A 3UG3A 3NA8A 3QHMA 1KC7A 3VM7A 5G1YA 3NVDA 3TOPA 1JROA 1M6JA 3M6DA 3KRSA 4WDUA 4MAVA 4NU7A 1I75A 1ZMCA 3POHA 4XVDA 3SDOA 2P3EA 1WDRA 4IIGA 2Y89A 3LEPA 3AHYA 3SADA 4LS0A 3W81A 3L68A 3V4BA 5LHEA 3MMWA 1UUOA 2QVNA 1GHSA 5M3WA 4Q7BA 4KCUA 1J2WA 3RU6A 4CGTA 1RQEA 3OGVA 3U57A 3N2TA 4KEMA 4H6EA 3CT2A 1F5ZA 1FTXA 5REQB 4MOZA 2E28A 5C9WA 3T40A 3URHA 4JN6A 1ZJIA 4A3RA 3IPWA 5J5DA 3RMJA 4AH7A 1GRTA 4Z2GA 3EAOA 1EZWA 4V1XA 3KFTA 5DRCA 2ADAA 3DC8A 3HOJA 3LB8A 1LG2A 4MPKA 4XZBA 3LRLA 3CV2A 2DZTA 4O1FA 4WKFA 4RCXA 5DBUA 1HX0A 4U5KA 4YJ5A 5CZKA 1ESWA 4XX6A 4DWSC 4EF8A 5D30A 2DQXA 2Q3RA 2ABBA 3P8IA 4JQ3A 1GETA 2NW0A 4ZXLA 4QM1A 4PTNA 4JIIX 3OLGA 4JTFA 2A7NA 2H3BA 4L4MA 1V51A 4UOJA 5E9AA 1OC7A 4HMEA 1Y65A 3QKZA 2DQWA 6A3HA 3P8JA 1OSEA 5HJYA 4ADSA 3FGCA 5CG7A 4S1FA 1Z44A 4CKQA 2ASHA 1TYTA 3EWDA 3QR1A 3AU2A 2F6UA 2NPXA 2V68A 3A4JA 4DUVA 5DCEA 5A6BA 1C9DA 5JH2A 1KV8A 4KPRA 2JBMA 4NG3A 3WDJA 1NPXA 3I7SA 3URBA 3CJPA 3GDKA 5LKYA 3MS8A 3OVGA 2VXNA 4HPXA 1JZ2A 1EJTC 1Q6OA 5FIPA 3QQWA 1EXBA 2Z1KA 3RR4A 4AHPA 3N9KA 4JXCA 2FZNA 1JAEA 2E7FA 4NX0A 2NQ9A 2EQ8A 5FL1A 4A3QA 1JGMA 3AMGA 3TQKA 4UMBA 2PDCA 1LRTA 4IMGA 3VIFA 4YU1A 3TMLA 2AMXA 1CB7B 2OQLA 3PPGA 3A22A 4QISA 4JBRA 2J9YA 1EHAA 1E6PA 1TZZA 2BBFA 5DFAA 1PS9A 4GC4A 2P10A 3PAJA 1AH4A 1AL7A 3S4TA 4ZTYA 4UOZA 1U22A 2VCCA 2IUZA 1EWEA 6REQA 2XIBA 3AYRA 3BPWA 4MPQA 1SMAA 3LD5A 4NNBA 2WC3A 3LPGA 3KCOA 2O7QA 4ZOEA 4PMDA 4QJ3B 4O8AA 1XLAA 3EUB3 1X8CA 1X7FA 2C16A 4IFKB 5A3HA 4LEFA 2WSKA 4HHLA 1TJ0A 3RLHA 3RO8A 1XG4A 4Q4QA 1LP6A 5FA5A 4HN4A 3LCWA 4NP7A 3SGGA 4HOWA 3CHVA 1DJHA 4DM2A 4F79A 3HBLA 3CU2A 4LNYA 3WF4A 1IEIA 3LTYA 4JD4A 2V63A 3AXMA 1S2CA 3ITOA 4QS5A 4XBSA 1E6NA 2PU1A 3WQEA 4JTEA 1Z69A 3ZVHB 5F4SA 1E6SM 4V27A 3QM3A 4MG4A 4Z2JA 3W7PA 4EQWA 2ATSA 1UD4A 1FXPA 3WELA 5T9CE 4DLMA 1OM0A 3VX1A 1S39A 4CQBA 4XSLA 3EOSA 4OQVA 2HQAA 1S3HA 3PZGA 2DZBA 3VZYA 1LROA 4NT0A 1OQFA 1GWJA 1RBAA 4IQEA 2VEKA 3K8LA 2I17A 5C2CA 5EMUA 1V6VA 3GH7A 4D8ZA 2DH3A 4PZVA 1OADA 2ZZ0A 4PC8A 3WD3A 1E6XM 5FACA 2NSXA 1TV4A 4GA8A 4J2MA 2ZX7A 5FF0A 2Z1XA 3WN6A 1GRHA 1VCGA 4WJ8A 2E4TA 4EQSA 2CZVA 4LNCA 4NF7A 5DLCA 3WJWA 4KQNA 3U4AA 1G4EA 1O7AA 2QJGA 1JVNA 5AC7A 3HFTA 2Z2UA 1TELA 3WQVA 4QQ3A 4QDMA 3NDZA 4QE5A 3L4UA 5CGMA 2OYLA 5I09A 3GB6A 4XAPA 1S2TA 4EPDC 4TVWA 1HTIA 3KZPA 4W8LA 1VS1A 4K3ZA 2A3CA 3LZ5A 4HPHA 3LNPA 3QPZA 2GUUA 4Q7NA 4ZEPA 2OKOA 1KRBC 3IVUA 2W55A 2V3GA 4AWEA 1RJQA 2ZUNA 1TV5A 4HU8A 1M3UA 4YYFA 2AMGA 1XI3A 3OHIA 3ABOA 2WXDM 2PGRA 3TN3A 1YTKA 3MKVA 1HF6A 5C0QA 2CLKA 1XW8A 5I3HA 5I3JA 1ADDA 4CCEA 1P1MA 3NQFA 1BLIA 1D3HA 3C2EA 1PYFA 5A6JA 3EF6A 2NXGA 3L0KA 3BOFA 3G8RA 3AS3A 5DMNA 1UOKA 1SPQA 3M1ZA 3U7VA 4C6IA 4HD5A 4NSBA 1TMLA 3VCCA 3WIJA 3H2NA 3B06A 3FYYA 1TPB1 5C9XA 2ZDRA 3UCQA 4C7FA 5F2GA 3RPDA 5F4XA 1XPYA 2H9AB 5H1WA 3NDOA 3UPBA 1XYZA 2IPJA 4GH1A 4R9XA 4YVPA 2A0NA 2WLZA 1JI1A 3E02A 1RP8A 3MB9A 1LQ2A 5DXXA 1GRFA 1LZOA 4KW2A 4B4HA 5HWNA 1UC5A 2OXNA 4QP0A 9CGTA 1W9BM 4AIUA 4B4FA 4MF4A 1TG7A 2OWWA 4AQLA 5IRPA 1VYPX 2WZEA 2NT1A 4AVFA 1QW9A 4GD0A 1XSIA 3DFHA 3BSMA 4C6BA 4O15A 3DECA 4DWSD 2CLPA 2A3HA 4RX0A 4ZVJA 2R82A 2PS2A 1F3XA 1GNXA 4DXKA 4J56A 1UR9A 1JGIA 2J7CA 4TX9A 3FVMA 1UR2A 4C1NB 3AUJA 3APYA 4PRRA 4WXYA 4OBSA 4AEEA 4DZ5A 1PXGA 4MB4A 3L5LA 1FOBA 1TPFA 4F2UA 1WQ5A 1R9ZA 2EQDA 4GFIA 3QPYA 3SCQA 3ITCA 3T2OA 2C6QA 4E3TA 1FY6A 3I4KA 3S6DA 4XWUA 5I03A 3TNOA 2YDSA 3C61A 3HF3A 2DW6A 8CGTA 3TQVA 4AAJA 1UZ4A 4E2VA 4L5ZA 3K2GA 4A3UA 3IGHX 3I7RA 4UTMA 4DQWA 2HDJA 3MP3A 1QRQA 3GX9A 1CXHA 1S5WA 1H51A 3Q2DA 1RBLA 2GQWA 1HZYA 4NJKA 2PWFA 1GRBA 3N3TA 3FNDA 2Y0FA 1CT5A 2Q6ZA 4Y7EA 1VCVA 2PEVA 1MFVA 2C1GA 3EKZA 4YVXA 1K1DA 1KXVA 2W0UA 2PDXA 3OGRA 1XUZA 5T91A 1KV5A 3C86A 1B30A 2G3MA 2W3RA 1CNVA 2EKCA 4O8RA 4YCPA 5FEXA 3WF1A 4JN8A 4N9BA 1GEQA 4QG6A 4GACA 3ITYA 4UMAA 3TSMA 3LGGA 3ARYA 2XSAA 4FAMA 3VE7A 5IHSA 1C29A 1RZMA 1NARA 1V7YA 1OX4B 3MUIA 2XN2A 4P7QA 4C5ZA 1SO5A 1BQCA 1NQKA 4RV8A 5LXXA 4Q8WA 3M46A 4MKSA 1XINA 1NDWA 1EF3A 6ALDA 3GTFA 3VIGA 4MY9A 3P5YA 5FS9A 3M4HA 3G1RA 2CZ5A 1AD4A 3DDMA 4MVAA 3VINA 2GQ9A 2YL8A 5H8UA 4AW7A 1TREA 1KGUA 2Z7KA 1WBJA 4YHEA 4D72A 4CN4A 3C56A 3CHFA 4YTSA 1GOKA 3CUZA 1GYLA 1XLLA 2WMGA 3WG6A 1TUXA 1V02E 2EPLX 2E1WA 2CU0A 4D6HA 4ZQMA 4FEZA 4AWTA 2DIJA 1UJPA 1E4IA 1TV8A 3FK4A 3OO2A 2OQHA 3O9NA 4NJHA 4Z1CA 3O0HA 3OZPA 3IIOA 4LCQA 5KZEA 3MUAA 4XAFA 4IHCA 1QPKA 2NWRA 4LYPA 1E3ZA 3HV9A 3K4WA 1XLJA 1UKQA 1QHPA 3CIWA 4EVZA 2FPTA 4QDWA 4YNGA 4CNSA 2RH9A 3STFA 4QE4A 4O57A 4BJHA 3TFCA 2GR0A 3ERPA 5MKGA 1TWWA 3GC2A 4BF5A 5U1OA 1UPPA 3CZLA 1TZ9A 4GK8A 1I9CB 4LUSA 3DAQA 4KPLA 1XSJA 4C6QA 4HMCA 2QDEA 3DEQA 3S47A 2QUUA 3VI2A 5HATA 2V3FA 1WYGA 4C1LA 4A29A 1W56A 3EWBX 3BLKA 1JCMP 4ZBCA 2AAAA 3PJXA 2GWGA 1LRQA 4W5UA 3K1GA 4DPPA 1GQIA 1FWBC 3O07A 5E93A 1DV7A 1EJXC 4FHAA 5BOFA 1KQZA 2KAUC 5BU9A 1EX5A 3T2QA 2WOVA 1A5LC 3TYAA 1DOSA 1G01A 5AZ0A 3E0VA 5CC6A 2CESA 1PCKA 2YBTA 4HVXA 2DUAA 1XX1A 3H2CA 3MDUA 2G95A 3N4FA 3THDA 1KFJA 2IPWA 2QCFA 2PRHA 3C3UA 1US3A 1VDVA 2DT0A 3FGCB 1HQTA 1VJIA 1YTDA 2CZFA 3CB8A 3TSBA 1IYXA 3NGJA 2VVSA 3T81A 3UR8A 3HG2A 4QTGA 4TR9A 4JTIA 3EWUA 5LGXA 1J12A 1PJ9A 4KWSA 4AZ6A 4PCTA 5A2AA 1DJQA 1A53A 4QS6A 2W63A 4HK7A 3T8QA 4QQUA 1OFRA 4H01A 3U8GA 3R89A 2WMIA 2ZYFA 1AL8A 4ZODA 4QNWA 1XYFA 1Q6QA 2QCLA 2GPTA 4RNFA 5I02A 3PFRA 1XD1A 1JFHA 3DX5A 4PSRA 3BMXA 1B4KA 3O6AA 1ONRA 3UT0A 1NWSA 1F61A 4ZO6A 3UWUA 2WQPA 1TMQA 3SQLA 4BURA 2OQYA 3QOMA 2WMKA 4M6PA 2OVLA 1TCMA 2ZZ4A 1U5HA 4ZOCA 3ZZ1A 1UC4A 1AQMA 5D2YA 2ACQA 2QVHA 4XZ9A 3AMLA 1HW6A 3W01A 1XLGA 3WMCA 1FVPA 1EFZA 1X2HA 4B3ZA 2HEJA 1B3OA 4PTVA 1ECEA 2Y8KA 3PZVA 5EBUA 5I79A 1A5KC 4LQ1A 6REQB 4GUGA 4J7RA 4M24A 4IICA 1J18A 4UQ9A 1QAPA 1ZLPA 4NZ4A 1CXFA 3LTPA 3S2CA 4H9TA 1XD0A 2QCHA 2VL4A 5AY7A 3HG4A 1CI1A 3UFYA 5GVJA 2J24A 3MKKA 1A4MA 1ENUA 2O9OA 5HANA 1XCWA 1FWGC 4J3TA 4DJDD 3DGBA 3ES7A 2GR3A 2XFWA 4HIBA 4XQ6A 3FJNA 2DSKA 3DFTA 3B8WA 4OWGA 3WO8A 1VRXA 3PWIA 1FH8A 5PTDA 5JCKA 2HZGA 3CEPA 3QW4B 1VFLA 4FLQA 5AHFA 3W0KA 3KS5A 4H8VA 3RX3A 3GWQA 4LSBA 4NZFA 3U2OA 4L4OA 1R5YA 2ZRWA 2GLKA 5JIPA 3C2OA 1JZ6A 1WOAA 3CZGA 4HA4A 4FLSA 2P76A 3CEUA 2QAEA 1SZRA 1N5XA 2QJIA 2FFIA 1QNRA 1SB3B 2VDIA 4N42A 4D6GA 2AGKA 1LVLA 1RV8A 1Q4NX 3EXRA 2X0HA 1WPCA 2GVJA 3SIZA 4B3LA 1D2KA 4MKVA 1CXIA 4MLRA 4M1BA 4L61A 5HR7A 4Q7IA 2PF8A 5F2MA 1XBXA 3OP2A 1CDGA 1AW2A 4DZIA 2W3SA 1R2RA 3L0GA 3E9AA 2YYUA 1IEQA 4C6JA 3TR2A 3EXSA 1YIXA 1Q63A 3LXBA 1D7KA 4GC3A 3C0SA 3CS2A 1TV7A 3VDAA 1DVJA 2CETA 3EZ4A 3R8GA 2YCLA 2YA2A 4DBSA 3MUCA 2G37A 3DG6A 5GNZA 1J0KA 4N9CA 2CFYA 3W7NA 4IXXA 4AB4A 3N4AA 3VCNA 1S7MA 4ZGYA 2IPGA 5BXSA 3RN6A 1W8GA 1TPDA 1OIFA 2VFIA 2O56A 1WE5A 3S5OA 3VGDA 4G7EA 4IIBA 2FJUB 1I2PA 2A8XA 2A1YA 1H3GA 1B9BA 3S46A 1TR1A 5FAGA 1EUAA 3D46A 4WZHA 3CQIA 1GXFA 2QDHA 4X9SA 1L6YA 2XUCA 2BVTA 5CGTA 1IV8A 1OGSA 1MXGA 3B8VA 3B0PA 1BSIA 2PTYA 3LG3A 1DE5A 3LCIA 3M43A 4ZR8A 2ISVA 3MKCA 4V2XA 1KKOA 4UTLA 4X61A 4P7OA 1FWTA 3T1GA 1ZRQA 1BWVA 4LJ3A 4P7LA 3TSDA 2V69A 1TV2A 4NJJA 3KLLA 1XIBA 2FB3A 2NX1A 3KEHA 4JZ5A 2NVKX 3SW6A 1HGYA 1QT1A 2ISDA 4KGJA 3DK4A 3TLLA 1UMLA 4C6FA 1P0NA 2YW4A 1BZLA 1SJAA 1BKHA 3UYIA 1FWEC 1OF8A 1BYAA 1WKDA 2BHZA 3ANUA 2FDMA 1XQKA 2Y8UA 2FH6A 2JFEX 4XUGA 3FV9A 3TW9A 6PTDA 2Y1HA 1K7FA 3NPXA 3F2DA 4RR4A 1E5NA 1FCBA 2WPCA 1J79A 2VGIA 5CAKA 3PPFA 1CEOA 1RY0A 3N2OA 4QX4A 1BQGA 1UH3A 2BOGX 2E5BA 3N4EA 3VGHA 4U33A 4OBRA 1R9YA 2XGBA 4C5YA 4TX6A 1EBDA 2TSYA 3QMTA 1EXPA 4W7VA 3NCOA 1J0ZA 1X98A 1MW0A 3WLIA 1IHIA 1SO3A 2QCCA 1OFQA 5CJ5A 4H8UA 1V0LA 1RLDA 2RAGA 4JICA 2Y61A 1W17A 4NNAA 4QRNA 3ZLGA 4B5NA 3XISA 3WKZA 2XZ7A 1SFLA 1UWTA 2NX3A 4H8HA 4F2TA 3GXNA 4NZ5A 2A3LA 4P2VA 1JYWA 3F03K 5BNKA 1UUMA 3HG5A 3I6TA 4E8DA 4BR1A 3M0IA 3MZ2A 4O1DA 5D04C 2XH7A 4L6DA 2UY4A 2J74A 1UASA 3TCSA 2ESCA 4MZ1A 2XU2A 1Q8AA 3LPPA 3T2PA 1GVOA 2YIHA 1MSSA 4JTUA 2YXXA 3K5XA 5K9XA 3W7QA 4S3KA 4JEQA 2YSWA 3EMZA 1XS2A 3GR8A 3MMDA 3VKCA 1VJZA 1A3HA 2WVSA 3BMWA 2HK0A 1A80A 1GVQA 4QIUA 5AHIA 3NQAA 3S6TA 2Y5SA 4RW5A 4JIHA 2I16A 3INPA 1JPDX 8XIAA 5H2ZA 3O05A 1AMKA 3C8FA 3TW7A 3AROA 5GNYA 3SB0A 1JRBA 4I7WA 1TX0A 2ZCGA 1FKXA 4RW3A 1U1JA 2BODX 3UXKA 3ZSTA 5FAJA 1FEAA 1LL6A 2ZUSA 1XH1A 2XIQA 4RZBA 4XKMA 3FS2A 1HGWA 2WV8A 2D3LA 3ETRB 2G41A 3GTXA 4BHYA 3N04A 1T99A 3B0YA 1XIHA 3F4NA 1UHVA 3ARZA 1W3HA 2ZQ0A 3AZRA 1C8VA 4KT2A 4KETA 1SO4A 4GGHA 4CQDA 2OJPA 3MV01 7ENLA 4QNEA 5HA7A 1UH4A 5KEZA 2FPVA 4HPGA 1PTDA 2CFFA 3M5VA 5CG0A 3RCMA 4H7VA 5CPQA 5BOEA 1W1TA 4HNNA 2VEMA 2G3JA 3GXPA 3SRKA 5AYYA 1M7PA 3G1HA 1KCLA 4TU1A 4JN7A 3LCFA 4G1NA 5KMYA 3MHUA 3Q4DA 2VD8A 1E70M 2XTKA 5H91A 1JFXA 4FNUA 1R3VA 2VUNA 2QJJA 3XIMA 4DF1A 1R2TA 1E6QM 2DSVA 4TUFA 5AHMA 5CC5A 1H49A 2QLYA 3ORWA 3QLDA 4N6EA 3WZ0E 3P3BA 1E4MM 5AVHA 2C71A 4IG2A 3RIKA 2V0TA 3VD3A 5LIYX 4OV4A 1KFLA 2GOUA 4QDPA 3SCOA 2E3ZA 2NQ5A 3EPNA 1OFAA 3EAUA 2D23A 2PD5A 5LIXX 3BE7A 3L2IA 3ONBA 5DCDA 1DORA 3U48A 2ZXDA 5HQLA 4FOKA 1E1FA 2Z25A 4G1KA 1X38A 2TPRA 3IWPA 1GKPA 2POTA 3HGJA 1WUEA 2V2CA 2HBXA 2G0WA 4K39A 3VCRA 1ISWA 5MKGB 1BVNP 5EY5A 3AHZA 1FFUC 4N4QA 1EC8A 3IV8A 3EKLA 1PDYA 2A6LA 1GESA 4BV6A 3OC4A 5KVHA 3VNKA 1E0UA 1K8XA 1HVQA 4IIDA 3BL3A 2WOQA 4LUSB 3WEOA 5T8GA 1VFTA 3ABXA 3WUGA 1E5JA 3W86A 2B81A 1RCQA 4LRTA 3RX4A 2B7PA 2ZRZA 2J7HA 3BG3A 1FHLA 4QEHA 2VFFA 2Y6ZA 4APNA 3UZZA 1ELSA 4QCFA 1GW1A 1B2YA 4HOZA 3JZEA 3WF0A 1KWKA 2BY0A 3ZWSA 4F0KA 1ZJBA 1P6WA 4UTTA 3W7OA 3WD1A 2ALRA 3CHDA 4HCLA 2PWEA 3W70A 3WBXA 4GYKA 3WLTA 1YQ2A 4JCLA 1LT8A 3V5OA 1ONWA 3BQ6A 3OVRA 4CQ9A 4B5VA 1LT7A 2WJZA 3DI1A 2C3ZA 3BGJA 5XIAA 5BRQA 1ZAHA 4WHBA 3TWBA 3H4KA 2ZA2A 2E3TA 3LPFA 4GYPA 1SZGA 1NF7A 4GYJA 5CZSA 1EP1A 1GVYA 3GFZA 4AUBA 4XAGA 5D9MA 3PB2A 4JOMA 3U2ZA 3B4UA 3KAOA 1ZS2A 1SJDA 1DTUA 1GGOA 1J0JA 1JAKA 4AZBA 3W38A 1O95A 4PMYA 3L67A 3PTMA 1NH6A 4IXHA 2CHRA 3MC5A 2WMIB 1ITUA 3I4EA 4L1GA 3EDFA 3DK9A 2R1PA 3N9RA 2ZXBA 3A6OA 1HJVA 2PDIA 3COTA 4F40A 1P0EA 1F73A 3VOFA 3VNYA 3TX9A 2RABA 3W88A 3S5NA 3ATZA 5G5GB 2RFGA 2FJKA 2GH5A 3IGSA 2EPNA 4UUIA 5DMYA 4O13A 4GRSA 4NZ1A 1REQA 1YE4A 2PURA 1BG9A 1V08A 1UP3A 3WH9A 4FXJA 4AIOA 3EXTA 3PJUA 1N61C 1Q8JA 4W8BA 2X8HA 1VAHA 4DX3A 1FFQA 4HNTA 5FMHA 1W32A 1TYPA 4BI6A 1ZCCA 4GZ7A 5FEZA 1KKRA 4GABA 4J3ZA 4C6NA 3T07A 1MVYA 1JYXA 3UR5A 4N4PA 3UG8A 1KM4A 2WMJA 4JX6A 1MYRA 4HTYA 4JTRA 5DY2A 4WCJA 1JDFA 2CLOA 4DJEA 4LAMA 1JZ4A 5I06A 3ABZA 3EOEA 3S1VA 2VDGA 1ISXA 3T0DA 4D1IA 3VOHA 3WQOA 3DYOA 4GHRA 4PB4A 5I24A 5EPDA 4Z42C 1JZ5A 2VFHA 1QOXA 1XV8A 5F7UA 8TIMA 1NM9A 3PC0A 4UFMA 5AYXA 1I0BA 1Z8AA 3WQPA 1EGZA 4K1GA 1E3XA 2EQ9A 1O1ZA 4O17A 2W9MA 2HXTA 2QUMA 1R30A 1X7IA 1YNPA 3O6DA 3VE9A 4I5RA 3R58A 4XD6A 2GVYA 1YADA 4OVXA 2DORA 1RD6A 4JIRA 3VABA 4D6CA 4UTTC 1TJRA 5AN7A 3WBYA 1JPHA 1O5RA 1CWYA 4PEKA 1BEUA 3M47A 3KX6A 4ZCWA 1XIEA 4GY0A 4BF9A 3U2CA 2EKGA 5JCIA 1XYLA 4AMCA 1VRDA 3TYBA 1XYBA 1UWUA 3AIBA 4LA1A 5CBBA 2FB2A 3TN4A 3WLJA 2RJGA 3ALFA 3AALA 2V6OA 2YCLB 3CQJA 4LB4A 1R0MA 3GXFA 4GY1A 3W00A 3OG3A 5DMMA 2QDGA 5F4WA 2VELA 4C7GA 4KEVA 2V81A 3THAA 3B40A 3GSMA 5B80A 2JK2A 1Q5MA 4G7EB 5A8GA 3W2JA 1B3YA 1I2OA 1ZP3A 1ZZMA 3S9ZA 5FS7A 3WEMA 1RHCA 1KR0A 1KCKA 4JFSA 2EPMX 4GNJA 3PN8A 1PPIA 1VFSA 2PDFA 2VHLA 4RNJA 4WJXA 2DUXA 2WSYA 3WBWA 1K9EA 1KTNA 3QV7A 4CEUC 1B3ZA 5I3KA 1DP0A 5LNSA 3LK6A 2CLEA 3CK5A 3WK3A 1XLIA 3WQ8A 4CQCA 5JU6A 1GVFA 3LXCA 5GJNA 2D0GA 1X1NA 5E9XA 2O9TA 4FI4A 3WL0A 2PCEA 3GNNA 2DDXA 5AYIA 3PTKA 3Q94A 2EG6A 2GK1B 4R3UA 6XIAA 1Z6KA 2XYLA 2B0MA 4K6AA 5D37A 4IPPA 1ICSA 3G6MA 5ECUA 5DX7A 1YDVA 2DZPA 3IUHA 1OF6A 1G1YA 3F5JA 2YB1A 2HVOA 1CIUA 1PIIA 2I1OA 4JFWA 4ILSA 3AI0A 1I60A 2ZX8A 2E9BA 3B3DA 3ELFA 4C1KA 4PUWA 2CW6A 4OHQA 3SQMA 4GUFA 1K6AA 1R7AA 3I3DA 2IW0A 4E4PA 4LFYA 2I5QA 3FVDA 2D2OA 5CSRA 4CCZA 3CZEA 5JCLA 4LVGA 2FKPA 1E1CA 1WDQA 3AQUA 1K9FA 2ZZ3A 3H26A 3CAQA 4DYEA 1ZB5A 2HPMA 4AD5A 3SUVA 4U3AA 4Q4RA 3T78A 1UZDA 3H2EA 2J47A 3BTNA 1XYMA 1W5MA 1GZJA 4K7ZA 4DZHA 1JI2A 2J75A 1LOQA 4PE8A 2GJXA 2F9RA 4CNNA 4UQAA 1K03A 1XLFA 1VFMA 1MFUA 4AVOA 1TTPA 3H7UA 3UGVA 1KBIA 5IFPA 2X1TA 4J57A 4Q8PA 1IGSA 4B9ZA 3UXLA 4KESA 3UZJA 3P0WA 1PZ1A 3G77A 2X7WA 3BAYA 1LRNA 3C52A 1KN0A 2A3EA 4MNJA 3GNRA 3A5VA 1YPIA 2GQ3A 3TN6A 3KL0A 3L4WA 3AM9A 3ITXA 3LRMA 2UV8G 1E6RA 3KOXA 1Y5XA 3UY7A 1RD5A 3SY1A 3GXDA 3BK0A 4PFHA 4KFPA 1Q2RA 2DGAA 2BZNA 2XVKA 5K3VA 2C8NA 2FZMA 3BUVA 1W9DM 3CQHA 3S5ZA 3AYSA 4O14A 3V5FA 2EF9A 4NXSA 3KRZA 4B90A 2Q09A 1B31A 3DENA 2V67A 3NZGA 4AHQA 1UUQA 4RL3A 2Z24A 1N7KA 2W62A 4AZIA 1XYCA 3UESA 2NVCA 3FA5A 1E9ZB 3URNA 1O5KA 4W86A 3G2GA 1TPUA 4K68A 1NOUA 3SRDA 4GVIA 2BC1A 4HMDA 1F6YA 1WA3A 4JPGA 1C9WA 2W91A 1E56A 3GU2A 1GSNA 3B9DA 3VOGA 2Z0IA 4M3PA 3VDGA 2IKIA 4US5D 3WLRA 1I45A 3H12A 1ONEA 3STCA 3W1AA 3BJSA 1WCGA 4HNCA 3W25A 4AY1A 3G1DA 4AD2A 3BGAA 4YPJA 3V1PA 1F9CA 5FCZA 2WVTA 5ENLA 1A0DA 2A79A 3SUUA 4IG2B 1XLMA 1FWCC 3H8AA 4GY7A 2PE4A 4LBRA 2XIOA 1BTCA 5TF0A 2OO0A 3FHQA 1P0BA 2YA0A 4XO6A 3NOEA 1O4UA 1J0YA 3WMSA 3WQFA 3G22A 5KETA 3NWRA 1WV2A 3UJEA 3UNDA 1H5VA 1LQ0A 5C7VA 2ACUA 2CITA 2C1HA 3VGEA 1TVPA 3WSUA 4XV0A 3N29A 3H53A 1Q4WA 1R47A 3CHCA 5CLWA 3GIYA 2VMFA 1W5OA 2RDUA 3F1QA 3H2OA 3L12A 2WK2A 4HA3A 4D1JA 3KL3A 3D3AA 2DT2A 4DY1A 3MI3A 1FBAA 2G3IA 4GNVA 2VC7A 4WDWA 4LV4A 4GUJA 2WMFA 2UWFA 3TFXA 3NVTA 4GFSA 4UMCA 1I1WA 5HJXA 4IMAA 1XFCA 3SGUA 3CXOA 3FN9A 1Q2SA 2W54A 3RLGA 3TC7A 1FWAC 4UBPC 1V4YA 2BGSA 5FS6A 1KM6A 2EJ1A 2NLYA 1ZBVA 1KNWA 3ECQA 2WJDA 4EX4A 2OOFA 3BV4A 3ONCA 5DT7A 2WCGA 1LWIA 1ODZA 1NP2A 1TUFA 4H9YA 2YCIX 2GQ8A 5KZ6A 3NIYA 4P61A 3OZMA 1XF0A 4Q8MA 1GZ1A 2ZE0A 1TR9A 3W02A 1W6TA 1VBRA 5I3FA 3TTOA 3CZKA 1EOKA 2ZC1A 4MZ8A 2F6KA 1QOQA 4IMDA 3NFUA 3A13A 1JUBA 4MY1A 3PAOA 3KOFA 1Z9AA 4Q8TA 3NO1A 3HQNA 1R87A 3AO0A 3K4DA 1EJWC 4H19A 4FO4A 4GVFA 1E4LA 1EP2A 2EEXA 5DF0A 4CD6A 4EXQA 3GHTA 4UR7A 3LOTA 5TR3A 3MI6A 3AHVA 1RCOB 2BLEA 2RHGA 4ROQA 1XLCA 4P8XA 1RPKA 1VPYA 1BD0A 3VKKA 5KZMA 3U3HA 1KCZA 2VENA 2FGZA 1MO9A 2YVFA 3GVVA 3TH6A 1C7TA 3VTRA 2E8ZA 3GR7A 5TNVA 3SFKA 2XPKA 1J93A 1ITXA 1W3IA 4RXGA 3HQPA 1YRRA 3ZM8A 1N82A 3CGTA 4DYJA 1JDAA 4K36A 4EQXA 1W3JA 3HW2A 1ZCOA 4H4RA 2PDUA 4RDYA 4F0HA 3F7JA 2D73A 3HZ3A 3GXTA 4QGCA 2OG9A 1K6WA 3RCYA 3NVZB 5CH9A 1REQB 4DI9A 2R1NA 3N6JA 3AMCA 4ATWA 4TVCA 1BYDA 3M7SA 4GXWA 2CLFA 3DIPA 1OCNA 1A0EA 2VGBA 4TXEA 3NVWB 2NXIA 1DKWA 4RDWA 5FEPA 3RM4A 4TX8A 3ZVIA 3CUHA 4JFTA 1E9IA 4HMNA 1WOBA 1A3WA 4XZMX 3W71A 4R5EA 2VRQA 3AJ7A 1BXCA 2TPSA 4C6KA 2BP1A 4LT9A 1EQPA 2DSZA 3CMJA 4AIEA 3PS7A 1F05A 3SECA 3EPMA 1DJYA 3O6YX 4JNZA 2V2HA 3GBEA 3W7MA 2ACSA 2DUZA 1LLOA 5D2TA 4Q4MA 2OLHA 3RK8A 2C1IA 3AHTA 2PP3A 1UCWA 3ARRA 3ZS4A 5BOOA 2HWGA 3KBJA 3RFAA 1QATA 3AXHA 1HKMA 2C79A 3NXFA 2DH2A 5I0DA 1J6OA 5CGQA 2IKJA 4FPSA 1MEWA 2Z29A 4QSHA 3M0YA 5D2VA 3C3NA 1CW2A 1ZBWA 1FH7A 1XIDA 4O52A 1MW3A 1K4GA 5REQA 4H83A 3W87A 3P93A 3GU1A 5JIWA 1W1VA 4OKDA 1H09A 2QJNA 4EF9A 2OB3A 2DEPA 3LCGA 4JTDA 2G8ZA 2YDRA 3W27A 3UEQA 4JAWA 4PCPA 1Q1RA 2ZVIA 1BSLA 4GIEA 3ZMRA 3FW6A 3VIMA 4IISA 4MNMA 3KVMA 4REQA 5FL0A 4PUKA 1MO0A 1L6FA 2RDTA 4QAIA 3VFCA 2E5DA 3L23A 4D9PA 2BTMA 1DXLA 1KFKA 1RALA 3P81A 3WX7A 2YVGA 1W5QA 3RLVA 2CPUA 3TEVA 3SEPA 4WKHA 4AY8A 2HNEA 3VKJA 4GUIA 3THQA 3NQGA 5CPTA 1V6UA 3PSWA 1FWHC 4RE2A 2JQXA 3FEQA 3TROA 1DIOA 3IIZA 3A9IA 4WF7A 2HXUA 3TXZA 2PWUA 1VCFA 4N0RA 3U5UA 1NDYA 1S5NA 5EMJA 2VCBA 2WW5A 4NASA 2OX1A 4GI8A 3WD2A 1UH2A 1XDMA 4AWSA 4K2SA 5G5IA 4J3XA 4JTGA 2WP5A 4XUYA 1ZTVA 4FALA 3IJ9A 4N9DA 5HUPA 4QE1A 2QW5A 5E6ZA 2GVGA 4UFIA 4BWLC 4CN1A 2DJLA 3GIPA 3VNJA 1ZY8A 1WAUA 3OOQA 1QHZA 2XSXA 2GJRA 3PVFA 1CYGA 1W2VA 1EQCA 1XBVA 4NQ1A 3BV7A 4LF2A 1H61A 4W88A 2J7DA 3BSGA 1NWTA 3V5CA 1Y5WA 4Q8VA 3N73A 2YX0A 2BXVA 3WQ6A 1U5VA 4AD3A 1KRCC 2OPJA 1J01A 2CC0A 4IOTA 4S3BA 4AG0A 3FA3A 1KM2A 3CC1A 1CXEA 4G5DA 3CYJA 3NVYB 1RCXB 1RXOB 1TYGA 2YBVA 4FR6A 1EBGA 3NEHA 3L5MA 1H11A 1GVRA 4PCFA 1NWRA 3ARPA 1GPFA 3VAVA 1RJRA 3NM1A 2VC9A 3P67A 1ONXA 3Q65A 3GZ3A 3QW3A 4M8UA 2YBUA 4GI6A 1DJIA 1W5NA 3PG6A 4BS0A 1H6VA 3NXLA 3BZJA 2F5ZA 2HRWA 4QJ4B 4ZB0A 1F3PA 1Q6EA 1E1CB 5BRBA 2WWCA 4P7NA 4OOUA 1K4QA 1JDEA 1TA3A 4C65A 2VUYA 4RZ4A 3ZOAA 2YCKX 2OT0A 3GTIA 5E0CA 1QWGA 3W53A 3MT1A 3PZOA 4UZUA 4CUCA 2ZKMX 4FXRA 5E0FA 2A6NA 1Q1WA 1EKOA 3TQ0A 4ZTXA 3VKDA 2PF0A 1VLIA 3DJJA 4GNKB 3TN5A 2JKAA 3SUSA 2AKMA 3IANA 3MSYA 3OBAA 2GJXB 3PBUA 5FF4A 4JTJA 4PMNA 3ARTA 4OECA 3TU9A 2QPUA 2I5GA 3E49A 3UGRA 2Z1SA 3DFSA 1XL9A 1I2NA 4GOAA 3NR0A 3W75A 1FXQA 3OBKA 2VJXA 2BS9A 4N02A 1AUSL 4E4UA 5CZJA 4NI8A 5DN1A 2ZX6A 5CC3A 4PRWA 1GERA 1ALDA 3MDWA 4YTUA 2EPHA 3GVQA 3QV6A 4MHBA 3USZA 2XIMA 3LNMA 1TQJA 4QJ1A 3RU8X 1AJZA 1QI4A 4DJFD 1HN1A 3VX0A 1H60A 1XH2A 4R27A 4C6DA 3C2FA 2E8YA 3Q58A 5FJJA 1G94A 3CIVA 1XCFA 1PKMA 2P8BA 2HCVA 7PTDA 1HJXA 3L0NA 5DEZA 4CNPA 3IJ8A 4UTWA 3R0UA 5EFFA 2FYMA 1A5NC 2G4FA 2DVUA 2ZBTA 1B57A 1W3LA 3N18A 1QW7A 3R07C 3DK8A 4IPNB 3A12A 4TTUA 4AZ7A 3W1NA 3I7QA 3VNIA 4C60A 1PYMA 4MWAA 4WY0A 1BXNA 3UW6A 3DFOA 3H23A 2IS7A 2VFDA 2OSXA 3KWXA 1V7AA 1W1PA 1UD6A 4EOUA 1TPVA 2W5FA 1Z48A 3IV3A 4YYCA 4YTRA 2ZICA 2ZDSA 3WDRA 1PIFA 1WNOA 5FKYA 3R7MA 1UR3M 3W1PA 1VJSA 1F8IA 2R91A 4IFOA 1JRCA 4UTJA 4ZO9A 3TYUA 2V2DA 2UY2A 1A3XA 3FLUA 1GG0A 3SY5A 4PFMA 3UA3A 3IACA 3APTA 4Q8UA 4LF1A 2ACRA 2UY3A 1B54A 1JCJA 1WXZA 2ZRVA 5BXTA 4ZE5A 5CBJA 1Z42A 1IR2A 5AB3A 4GXMA 2PDBA 3BAIA 1A5MC 1Q6LA 3OYXA 4H6RA 3KWSA 3EOUA 4G2DA 5A1AA 2OODA 4H1ZA 2OCZA 4LBSA 4AEFA 1H50A 3H54A 4HYVA 4ROPA 1QMLA 4Q3MA 4UB9A 3DCPA 5F2IA 2D3NA 1HKIA 2XVLA 2BHUA 3RPMA 2XIJA 1JNEA 1FCQA 4U31A 3S1UA 2PDJA 3WD4A 1R3RA 3A64A 1GQJA 2BASA 5G4HC 1PZ2A 5A94A 1AJ2A 1UR4A 4DHGA 4A8NA 4HZ8A 1MUCA 1YPFA 4ES4A 2V3BA 2QQ6A 3MUXA 4FF7A 3F4VA 1XSKA 2ZWZA 3F5LA 3KOYA 3AWNA 3WF2A 2CYGA 2ZZ1A 3APGA 3WQCA 2YXOA 3GVRA 4UNLA 1J0HA 4RUBA 3ISIX 3K30A 3KDNA 4MNLA 2CKSA 4PH6A 3VZZA 3MMTA 3CASA 3R8HA 4I9JA 1OD8A 1HKKA 3FY1A 4Q8NA 3W76A 3R79A 3ALGA 3W2MA 2GDVA 4BI7A 2NUWA 7TIMA 2PWVA 5FJIA 5JVLA 4H9UA 4DXXA 4X0VA 4ZFCA 3AIRA 4DBUA 3P5ZA 1SJBA 3V36A 3FJLA 1CZ1A 1TVLA 4IUOA 4PB3A 3TTEA 1HIZA 3MSRA 1J6PA 2YB4A 1JRPA 3CQKA 3E0LA 3G5EA 1N62C 3GD4A 1NWUA 1XLBA 5K4XA 1QU4A 1H2JA 1GONA 5ER0A 2TODA 2D20A 4R7OA 5EGRA 3BLFA 1LBMA 4CU8A 2FGBA 3D47A 3QR3A 1JOAA 2X50A 1NFPA 3AWOA 1SM9A 1EA0A 4MUPA 3IIVA 1DQXA 1H7NA 1PKLA 1DL3A 4OBTA 1EL3A 1JZ8A 4S3JA 2WC7A 1HL9A 3E74A 3IUIA 3AN1A 1CGYA 2PWGA 1B5TA 4TIMA 2YZ5A 4A05A 1LDCA 3A23A 2ALDA 2ZA1A 5BROA 5A95A 2ZFAA 4MWAC 3DJGX 2XGIA 1G6CA 1Z7AA 3H7RA 3K8KA 2XN1A 1UWSA 4ORMA 4POCA 2FDSA 1N8WA 2XJ7A 4LYKA 1AH0A 3OZYA 1KA9F 3BLPX 3GDMA 3TONA 3SCNA 5HPCA 3MTWA 1XIJA 1YQZA 3KW3A 3LY0A 3N19B 1KRMA 3RR1A 3HPXA 1RSCA 3VD4A 4AWUA 2ZTKA 3ZR4A 3EOOA 1F3EA 3RITA 4FX8A 1UKSA 4FK9A 3W83A 2GVEA 2ICSA 3WBEA 2VT0A 5EYWA 3PZTA 2Y24A 4NRRA 5D9NA 4WQ6A 1JEZA 3VD5A 1VPQA 2Y7GA 1RH9A 2DFAA 4HPNA 1QI3A 3W37A 4ML9A 1BGAA 2L5HA 5HMFA 2NQLA 3FFSA 3S42A 4LUTB 4JQ4A 2YOCA 1CX9A 4E2BA 2F6XA 3NO3A 5JQ9A 4HU0A 4GZIA 1CXLA 1EDGA 4NZ3A 1FP8A 1BKSA 4EE9A 1W9PA 1G4SA 3PJWA 1YE6A 1DYSA 2W0HA 3GZAA 4HPJA 1HKVA 1OFDA 5FJTA 2WJFA 3EA1A 3E2VA 2PPGA 2FZ9A 1ML1A 4DF0A 2E40A 3HURA 2Q8ZA 1S2AA 3PZQA 2Q8XA 3W7IA 1U2YA 1JULA 1D7FA 2PLMA 3ES8A 4MYXA 2TYSA 3VC6A 2TAAA 4B2DA 4HGXA 4XKYA 1OCBA 3E5PA 4J2PA 3STEA 1EJRC 1J5TA 4ZE4A 2OZTA 3DHFA 4BQ4A 4EQRA 4WR3A 3LU2A 3MBFA 2ZUMA 3H55A 1X6UA 4NZJA 3HPZA 1DBTA 5LNUA 3N6QA 1IWBA 3HM7A 3MPGA 4EPBC 3O1NA 5HNRA 8A3HA 3KL5A 4PSPA 4NYYA 3Q67A 2J7BA 3LXAA 1P48A 2IQ0A 4REQB 4W89A 2OWCA 3SFWA 1FRBA 1OX6A 1MWOA 2O4MA 4JX5A 1N2VA 2IKGA 4RDZA 2BG5A 4DNHA 3VYLA 1TE6A 2J8GA 3NZQA 3OG2A 4IMCA 1GEUA 3MANA 1FECA 1YXYA 1QW8A 2QXWA 5C2GA 4S3AA 2NZLA 3GNDA 1HO1A 1OFPA 3TJ4A 3T9PA 2Z27A 2CWXA 1G7UA 1F3WA 4AX6A 1HJUA 4PN2A 5ABEA 4WDXA 4IJRA 2BMBA 5A8OA 1LQAA 5DO8A 3PZ9A 3GG1A 4YN5A 3W72A 2FVMA 4WSJA 1WZMA 3NYDA 1IT7A 4OE7A 1SR9A 4R9OA 2JGYA 3TAKA 1A5UA 1QNQA 3H4GA 1GOMA 3POCA 3W7EA 3WY1A 1LL4A 3W23A 2BWGA 2WHJA 5DXYA 1EGMA 3NQ2A 3FYPA 4PUJA 1FWDC 3GK0A 5G4EA 2REQA 2V5CA 5FD0A 1AA1B 2IQDA 3W24A 2OZ0A 1ISZA 3AS2A 3QVQA 3FX4A 1G0CA 1EGVA 1EWDA 2OGJA 5D03A 4CQ8A 5I78A 2BY2A 4NZCA 1DIEA 3AISA 3BAKA 3VIJA 1J2BA 5AC6A 1XC6A 3TDFA 2EO7A 3WNPA 3N34A 5LNVA 1A4LA 2WPGA 4NEVA 4OUIA 3VMNA 3R11A 1OJTA 2DZAA 5JBDA 3LADA 2ZXQA 3M64A 4AZCA 1EOMA 4XB3A 2MUCA 4Q8OA 4H4WA 1EO7A 2QJMA 1EO5A 1OFBA 5FEWA 3PBWA 4Y9MA 3UNTA 4BZYA 3O16A 4B5SA 3E12A 4V33A 3UWZA 3LV5A 5CPSA 1MDLA 3LTSA 2EQ6A 3VFLA 4TVUA 2E5AA 4I7VA 1Z3NA 2ZZ6A 3R25A 3BCJA 1QTWA 1TRDA 1ZFJA 4JS3A 1PSCA 2OMAA 1NFGA 1FWNA 1IXNA 2HQMA 2JIWA 4Q32A 4V15A 3QSRA 4KH2A 3S2LA 3B03A 1TA3B 3LCXA 4XK2A 4EPEC 2ZUUA 3MJYA 1Q6GA 4JNYA 4DB7A 3PULA 4RNIA 1VFFA 5E70A 4JL1A 4BQ2A 4PUNA 3RPTA 3IGUA 4KWVA 2Z2BA 2FVLA 2NXHA 3J7HA 2TMDA 2BB0A 2YLAA 3GD6A 4EKJA 3IK2A 3LCHA 3WCZA 2O4QA 1MXSA 4N2YA 5A6MA 1Z32X 1XIMA 4K1WA 2QHAA 3S0CA 4RV3A 3QOKA 3E2RA 1QXLA 3L2MA 1TPWA 1KO0A 4MWAD 3SUWA 4HA0A 1H1ZA 3KRBA 5BMXA 4JDYA 5ABFA 1Q13A 2WAGA 5I3IA 3EB3A 1VH7A 4YXGA 2W79A 2QJHA 2WO5A 4FXSA 1EP3A 1K9DA 2QAFA 5G4WA 4B16A 5A5WA 2Q8LA 4XBJA 4EMJA 2E68A 4D6FA 1ICQA 2IQTA 1EEXA 3L4VA 3ENLA 5C70A 4GKLA 4XG1A 2OWXA 4NILA 4EIVA 4K8GA 3WLSA 1E51A 3BCDA 3K13A 2G97A 2VOTA 4IL0A 1KLYA 2FMNA 3T4CA 2A2IA 2BX7A 3H2MA 3S1XA 3VMPA 1ZDLA 3QY7A 3TYCA 5FF3A 3PUGA 1Y8BA 4H00A 3PUDA 2BGQA 4GMEA 4MWAB 4WY0B 4LCRA 3B0VC 3EKGA 1BPLB 1QJWA 1TRIA 4HHMA 3CGEA 3KDOA 2QCNA 1FA2A 1SO6A 3UWWA 4IP7A 4LBUA 3PUEA 1G7VA 1LJYA 1V0NA 2GQAA 2V5DA 4JKKA 1GQLA 3MSDA 2CLIA 1A47A 3CGBA 1I6NA 1XCXA 2RDWA 1W9XA 1S2VA 1O6IA 1TCDA 5BMWA 1OABA 1STZA 1E43A 4JHOA 2PP0A 2QDDA 3CMGA 3THUA 1TFVA 3IVTA 2BCPA 4H7CA 2ZVRA 3R43A 1KW1A 1V3LA 1ISYA 2OSWA 4CCDA 3HB9A 4LXFA 5EL1A 9XIMA 2WNWA 1O5XA 3ZO9A 1VBJA 4K7YA 5AYZA 4L1WA 4HSHA 4B5XA 3IARA 3TKFA 3LGEA 1L0PA 3R1ZA 3GNXA 4NJGA 2R94A 5BYWA 3P74A 3D3FA 2WKGA 2XFYA 4W8AA 1H63A 1OY0A 3SCUA 1M41A 5DANA 2VEPA 3NG3A 3MJMA 1EX1A 1LG1A 3CZJA 1JUEA 1IZKA 4GLEA 3ME3A 4ICMA 3AYVA 4KWUA 2WMHA 2XVPA 2WZIA 4FOUA 3S2JA 3GRIA 1OK6A 2FPYA 4O53A 3R10A 3W74A 2IKHA 4ASTA 3W07A 3VNMA 1I2QA 4ZMGA 3MO4A 2AQOA 1DWAM 4FIQA 3CUXA 4FZIA 3DH7A 4HSOA 3KBMA 4O10A 2PDWA 2P0OA 2PDYA 3G1VA 1BWCA 1PE1A 4HU4A 1T96A 5B7YA 3N12A 3TMQA 3VDHA 1TTJA 1WP6A 2CLHA 1MRAA 3CO8A 3SR6B 4PB5A 2XHYA 3W6MA 1KM0A 2DSUA 1Z41A 3LHZA 3NS1B 3KTCA 1IIHA 4DO5A 1D3CA 2X05A 1P0DA 1JEHA 1RK5A 3UZ5A 1J4EA 2JKEA 4L1XA 5FJRA 1Q85A 4OZOA 2VEIA 2VZOA 3KP0A 4GWEA 4WK9A 4LCSA 3HPFA 4B5UA 5H8MA 1LF1A 4HHPA 4JDRA 5AHEA 1JPIA 5XINA 5EBKA 2EBNA 4MFEA 3GC5A 1CBGA 3F4CA 3LDVA 1Q65A 1A5CA 1C8XA 4K7VA 1ONFA 3G0XA 3CBWA 5L6UA 4FX6M 5FF7A 2XZ9A 1ZX9A 1XRTA 1NDAA 4LC6A 3RM8A 4O11A 2F38A 1HNYA 4H4IA 4Y9OA 5JBEA 1V8EA 4CLMA 3HQ1A 3QFWA 1NHQA 4KCWA 1WAWA 1J5SA 3GRSA 4Z1BA 1NHRA 3KS6A 3MV11 3GW3A 4GBUA 3GM8A 4I9AA 1TTIA 1UWQA 2GYIA 2OLAA 1WZKA 2VQTA 3CL7A 4DYKA 5D05A 3N6HA 2W4XA 2HROA 4O4VA 2AQWA 1YKWA 5TIMA 3T4WA 4MDOA 3AIVA 3QC0A 1DQUA 3QV8A 3PY2A 4H4PA 1UD8A 2WM1A 4OOZA 5CXPA 2WYSA 3CAWA 1ADSA 2J79A 1XBYA 1C3FA 3BOXA 1JCYA 3CL8A 2Z1VA 4Q4KA 5K7JA 2FIQA 1IEXA 2GGEA 5CCZA 4M0XA 3TJXA 3DGHA 4OUEA 2YL6A 1VFUA 1RY8A 5K2ZA 3QQ0A 3IEBA 1J9YA 1YX1A 3HIJA 4O1AA 4W93A 5FI8A 1VQTA 2C18A 2D69A 4XSMA 1DJWA 1KR1A 5KINA 4OT7A 1GKRA 4BCEA 5I7GA 2EAWA 4ACZA 5G2HA 3FJ4A 2E0PA 4UOQA 2YL9A 1EEPA 3PTQA 2E5CA 2OT1A 5L9FA 4LH8A 3GKFA 4GJ1A 4Q8QA 1ZY9A 1GV4A 4BEUA 5E5CA 1XKYA 1SFSA 2AKZA 1DQWA 2CXEA 4GCAA 3K46A 3TYZA 1KCXA 1OGBA 4GQBA 2Y8VA 1IEWA 1V3JA 2BY1A 4TTGA 1TWSA 1QBAA 3VGFA 1YTEA 3BURA 3SM0A 4Z2IA 7CGTA 4G8TA 1M04A 3AXKA 3OLDA 1M9HA 4XKYB 1QR7A 1DJNA 1POJA 3MZNA 4RE0A 1JJKA 3JR2A 4LVBA 2WB5A 3OVQA 1HP4A 4QSFA 3E2QA 2QPSA 3W2LA 4RE3A 1IGWA 3TC6A 4GO9A 1V79A 1TVNA 5JCMA 3UD6A 3RAOA 5I2UA 1KD0A 1WZLA 5A6BD 3GRTA 4HK5A 5GJMA 3PJTA 4FNSA 1QO5A 4H4YA 5J8LA 2W27A 1YMYA 4J4KA 4B9YA 3SRHA 5I3DA 1R46A 3IJIA 1AW1A 1PB0A 5D9OA 2G3NA 5BU6A 2YFOA 4IL2A 3TYDA 3TVAA 5HWJA 1W9UA 1N8FA 2O92A 3ZR6A 2VEFA 1EYEA 3NL3A 4D8LA 5CBIA 2QR6A 4X63A 3G18A 1YDYA 2H8XA 1GOIA 5EU9A 1BAGA 4Y96A 2WKLA 3UXAA 5GNXA 1Q6DA 1GTHA 3GDBA 1JNDA 1EC9A 1L6SA 1T8XA 4GCXA 1RBOB 2J66A 5A6TC 1PAMA 3O8AA 2ZE3A 1WUFA 3M0JA 4MB1A 1ZNNA 2KX9A 2PA6A 4O0KA 3UR2A 4PYSA 3H4WA 1ZSXA 3ZJ6A 5JXQA 3DI0A 1H1NA 1BFNA 3QV9A 3W1QA 2EPOA 1B1YA 1NQ6A 1OC6A 5AECA 1RR2A 1E0TA 3WQGA 2P53A 1UROA 2BGNE 2REQB 4NHVA 4RKAA 3G8EA 4JQ2A 5D8WA 3DUGA 4GG9A 4PR4A 3A7UA 1MW1A 1VYSX 1UZ1A 1A5SA 3JU2A 2WBKA 4HU3A 3OODA 3UVAA 1EJ7L 1SZEA 3LBMA 3N2MA 1W5PA 1WDPA 1RPXA 4I6VA 4KCVA 3V0TA 4M6UA 3DHPA 1FCUA 3S5SA 3WEZA 1QI0A 3O3RA 2INFA 1PTAA 1V3HA 2XGZA 3OVPA 5M03A 4OFCA 1OZMA 1YLVA 2J25A 4Y90A 3MWAA 3M0ZA 1MXDA 3OA3A 5HDRA 1V97A 1EDTA 4O1EA 1ISVA 2X09A 2YCEA 4AZCB 1K70A 3BZGA 5KTLA 4IQDA 3HU7A 1Z89A 1NIUA 2G3FA 1H0GA 4A22A 3W7HA 3SI9A 4LWWA 3WLLA 1XIGA 3I10A 4S38A 4Y8EA 1US0A 3TOYA 1ZPTA 1H7XA 4PA8A 3CH9A 4QCEA 4KF1A 3TR9A 4XZHA 3ZQ9A 4PCNA 3B9AA 3EWXA 4J27A 4NUWA 1DJGA