1TZZA

Crystal structure of the protein l1841, unknown member of enolase superfamily from bradyrhizobium japonicum
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
387
structure length
374
Chain Sequence
b'VRIVDVREITKPISSTKMTTSLVAVVTDVVREGKRVVGYGFNSNGRYGQGGLIRERFASRILEADPKKLLNEAGDNLDPDKVWAAMMINEKPGGHGERSVAVGTIDMAVWDAVAKIAGKPLFRLLAERHGVKANPRVFVYAAGGYYGLSMLRGEMRGYLDRGYNVVKMKIGGAPIEEDRMRIEAVLEEIGKDAQLAVDANGRFNLETGIAYAKMLRDYPLFWYEEVGDPLDYALQAALAEFYPGPMATGENLFSHQDARNLLRYGGMRPDRDWLQFDCALSYGLCEYQRTLEVLKTHGWSPSRCIPHGGHQMSLNIAAGLGLGGNESYPDLFQPYGGFPDGVRVENGHITMPDLPGIGFEGKSDLYKEMKALAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical protein L1841
publication title Crystal structure of the protein L1841, unknown member of enolase superfamily from Bradyrhizobium japonicum
rcsb
source organism Bradyrhizobium japonicum
molecule tags Structural genomics, unknown function
total genus 129
structure length 374
sequence length 387
chains with identical sequence B
ec nomenclature ec 4.2.1.81: D(-)-tartrate dehydratase.
pdb deposition date 2004-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1tzzA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1tzzA01
2OZ3A 3OPSA 3UCCA 3BJSA 4EWJA 2MNRA 3DFYA 3UJRA 2PSNA 5FJOA 2AKMA 1R6WA 2DW7A 3MY9A 2P0IA 3PWIA 5ENLA 4ROPA 2PP0A 4X2PA 3SN4A 1KKRA 4A3RA 4DYEA 1BKHA 3NXLA 3TW9A 1YEYA 2PP1A 4IT1A 3SBFA 1MNSA 2XH7A 3R0KA 2XSXA 4J3ZA 3KUMA 2PTWA 3H7VA 3OP2A 3R10A 3QKEA 1F9CA 1XPYA 3CXOA 3OZMA 4E8GA 1E9IA 3R0UA 2HXTA 4ZCWA 3CT2A 2RDXA 4HCDA 4HNLA 4IL2A 4F4RA 4K1WA 5FJPA 3FYYA 3JVAA 4DX3A 1DTNA 2PTYA 3U9IA 3ES8A 1P43A 4GISA 4E4FA 4FP1A 4J1OA 4DHGA 3ZLFA 4GFIA 2OO6A 4IHCA 2OQYA 3Q4DA 1EC9A 2HNEA 4H19A 3VCCA 4M0XA 1XS2A 3K1GA 4YWSA 1TZZA 3RGTA 4ENLA 4HCHA 3PK7A 3VDGA 1JPMA 3SSZA 3CK5A 1EBGA 2PMQA 3OZYA 3SQSA 3P93A 4JHMA 3TCSA 3MKCA 4IL0A 3UJ2A 2P3ZA 2XH4A 4DWDA 4JN8A 3V5CA 3NO1A 3UXLA 3ENLA 1KCZA 3FCPA 3BSMA 3UGVA 7ENLA 5BOEA 3H70A 1WUFA 2AL2B 1ECQA 2QJNA 2QQ6A 3DG3A 3R25A 3QTPA 3H12A 2GGJA 3GD6A 3NZGA 2PA6A 5EU9A 3DFHA 3VC5A 1ELSA 1OEPA 2PPGA 3N4EA 1NELA 3STPA 1NU5A 4HN8A 2HXUA 4MMWA 4M6UA 3UJSA 3N6HA 2QJJA 1W6TA 5FJRA 3TJIA 3B97A 3SN0A 3PWGA 3I6TA 4Z1YA 3JZUA 2PTXA 2OLAA 1MDLA 4A6GA 3VC6A 1BQGA 2XH0A 4GYPA 2PGEA 3FJ4A 2ONEA 5IDZA 2GL5A 3ZVHB 5J04A 1P48A 1R0MA 2XH2A 3Q45A 3IK4A 2AKZA 1KD0A 3DG7A 4KEMA 3PFRA 3QN3A 3FVDA 3U4FA 2CHRA 2I5QA 2PU1A 2GDQA 3NFUA 4H1ZA 3CAWA 1EBHA 3GO2A 1FHVA 2GGIA 2QVHA 2ZADA 2HZGA 1JPDX 2P8CA 3MZNA 4GYPC 4DXKA 3RO6A 2GGGA 3BOXA 4HPNA 2GGEA 3T6CA 2PCEA 2PGWA 2ZC8A 3CYJA 3P0WA 3VA8A 1JCTA 3V3WA 3DESA 3UJEA 4K2SA 2AL2A 1SJAA 1KKOA 3TWAA 1PDZA 3DIPA 2OPJA 4H2HA 3T8QA 3UXKA 3D46A 3DERA 4E4UA 3I4KA 1FHUA 4HYRA 3VCNA 2DW6A 3H8AA 3IJLA 4G8TA 2MUCA 1SJBA 4A35A 4KPLA 3R11A 2AL1A 1WUEA 3RR1A 3SJNA 3IJQA 3EEZA 3RCYA 2PP3A 2FKPA 3N6JA 2OQHA 4E5TA 3TJ4A 3S5SA 3OW1A 4FI4A 4MGGA 2QJMA 3S47A 4DN1A 3D47A 3MQTA 3FXGA 3MSYA 4MKSA 3ZVHA 3DG6A 3ZVIA 1MRAA 3VFCA 3RRAA 4JN7A 3DEQA 4GGHA 2OX4A 1SJDA 2PODA 3ES7A 3TWBA 4KT2A 3CB3A 3P3BA 3MUCA 4KWSA 3QLDA 3RITA 3MWCA 1JDFA 3HPFA 5BOFA 2PU0A 3SN1A 1PDYA 2OKTA 4G7FA 2PS2A 1TE6A 1SJCA 1RVKA 3GY1A 4Z17A 2OVLA 3DGBA 3GC2A 3I6EA 3DDMA 1EC7A 3JW7A 3N4FA 3TQPA 1MDRA 1EC8A 1MUCA 3T4WA 3T9PA 4HNCA 4IP4A 5FJTA 5FJUA 2OZTA 4GIRA 6ENLA 4K8GA 1ONEA 3ZLHA 3TTEA 4IP5A 4GMEA 3UJFA 2OG9A 3IJIA 2GGHA 2OZ8A 4ZA0A 4H83A 3ZLGA 1TKKA 3TOYA 3FV9A 3QPEA 3V4BA 2XGZA 2P88A 2QGYA 4HCLA 2NQLA 2OFJA 2PTZA 2FYMA 1L8PA 3UCDA 2GSHA 2QDDA 3EKGA 2O56A 3V5FA 4GGBA 2P8BA 2POZA 4IZGA 3THUA 4E6MA 1IYXA 3R1ZA 2QDEA 3OTRA
chains in the Genus database with same CATH superfamily
1MW2A 3BC9A 3OPSA 3VNDA 3ARYA 5HUPA 3M16A 2J79A 2VR4A 5CC3A 4MLRA 2G3IA 2WMJA 3W74A 4IP7A 1R2SA 3ATYA 4E2VA 3ZR5A 2VX4A 5I3HA 1XV8A 1RD6A 1G4TA 1KBKA 3U4AA 1LG2A 4LQ1A 3SDOA 3V18A 3EB2A 1FFUC 4B9ZA 2X42A 4W88A 1MNSA 5CPOA 2HNHA 2XSXA 3KOWA 1B5TA 3B8VA 3MI6A 5CZTA 3WX7A 1TWWA 3HOJA 4OZOA 1JZ4A 3DFQA 6TIMA 4D6EA 5FEWA 3TW6A 2X0HA 1GEQA 3OVGA 4H9XA 3QY8A 4MB1A 3FYYA 5HULA 3JZEA 1DJYA 3GDTA 1XW8A 3ES8A 1EOKA 3QFEA 4J3TA 3SW6A 4C6NA 1OYBA 3O0KA 2NT0A 2A4AA 5D02A 4L4LA 4GFIA 2OO6A 2VC7A 3LD5A 2GRTA 3W53A 5IBXC 2GDUA 4YWSA 3W29A 4O4VA 4JFVA 2G0WA 3EF6A 3VDGA 2WMGA 3IGUA 3M64A 3V16A 4YWIA 1TE1A 4PB5A 3S9ZA 2ABAA 1E40A 1FCBA 1I75A 1D7FA 3QHNA 4NAEB 4WIWA 2WM0A 1QBBA 3FVMA 3QQ1A 3UJ2A 4F9DA 5A6KA 5ABHA 4HPJA 5H6HA 2IW0A 2VD8A 5E0CA 3CZKA 3THDA 2WC3A 4DLMA 1E9YB 3CAQA 1YBQA 2JALA 3VK5A 2DUXA 4IGNA 4BWLA 4UWMA 2BV9A 4PCNA 3NJ3A 4QHRA 1ISXA 4OUEA 1JDDA 1KCZA 4HTYA 5BWFA 4PTNA 3EDDA 3QJAA 3ZJ6A 1FWEC 3LBCA 2QQ6A 5HMDA 1X8FA 3ABRA 4HK6A 3WDHA 2GGJA 1QPOA 2I5GA 3NQFA 3TNBA 5IXEA 4YMZA 3IAQA 2F2HA 3M7WA 2G3FA 4IQLA 1ICSA 2ZX8A 3KE0A 2GR2A 1CENA 3N6HA 4DWSD 1PYFA 3LHZA 2ZX9A 3M0HA 3SB0A 4XG1A 4FOJA 4GVHA 4A6GA 3T0AA 4EXBA 1BQGA 4UUIA 1V0MA 2VR2A 3WDIA 1EX1A 1Q7MA 2GUUA 3HJZA 3IIZA 2ESCA 4ZQNA 3ZT7A 4N9BA 2C7FA 1E0WA 4LFYA 3PUEA 1UD5A 1V6TA 2XH2A 6A3HA 1LUCA 1KM1A 1UJQA 3QN3A 5LSMA 3L66A 1KB3A 5A2CA 3HQ1A 4AC1X 1R5YA 1LG1A 4H3DA 3FLUA 2X8RA 2ACRA 2OSWA 1PEZA 4GUJA 1LTDA 2WWDA 4GXWA 4IQEA 4JPGA 5C0QA 4O0QA 3TONA 5A8PA 1F61A 3VDAA 4NASA 2Y2WA 1O1HA 3NIYA 2CBVA 3F2BA 1B2YA 2V69A 4HNOA 4DUOA 4D8AA 1E73M 3G1RA 2NZLA 4S3BA 4ATLA 2J9XA 3NPVA 1QAPA 3WBEA 1LQ0A 2VUYA 1HTIA 5AVNA 4E4UA 4DJFD 3NQDA 2YL8A 3CPGA 1FXPA 2ZZ3A 2XDFA 2FFIA 5KZDA 4HYRA 3MJYA 3UFYA 3GXNA 2HCVA 3IJLA 2MUCA 1XIBA 2ZUSA 4KPLA 2PDFA 5C9UA 2AL1A 2VFGA 5A6BA 4E4PA 1M53A 2QF8A 3MO7A 4TX6A 3K4WA 2ZRZA 4DJDC 2XFWA 4AEEA 4LYKA 1G67A 4UTHA 2ZXAA 3RLUA 3TTQA 2JGQA 3AFBA 4O13A 4MJZA 4NNBA 3GW3A 5DO8A 2QXWA 3KHDA 8A3HA 1N63C 1FTXA 4JD4A 1OGGA 2DZXA 2WZHA 1XIHA 4W4QA 5KVHA 4RPPA 3RPTA 1LQAA 4HHPA 2W62A 2ZZ2A 2YCIX 3CEUA 3KW3A 2OX4A 1QNOA 4C7DA 4KT2A 4UZSA 2JIWA 3MUCA 3UG3A 2HE8A 3QLDA 3D3AA 1A3HA 3DJGX 1I6NA 5A6AA 4JQ2A 2OKTA 5LIXX 1YRRA 4WJXA 2VQTA 3FIGA 3UWUA 5KETA 3H4WA 1RVKA 1NAL1 4ZXLA 6ALDA 3W7QA 4BQ3A 1EP2A 2WJDA 3TQPA 2X41A 2A3HA 5FJUA 2PAJA 1V6VA 4JCMA 3CMFA 5E9AA 4C6CA 3APYA 2PE4A 4JDBA 1OBAA 5C5YA 1W3HA 3KWSA 3V35A 1GONA 3WD1A 2QCEA 2WB5A 2VVNA 2QJHA 3LTSA 1UOZA 3W7JA 3UCDA 1ODZA 3MCMA 1WYIA 3NSXA 4HOZA 4YTRA 1E3ZA 3AI0A 3VIKA 1UC4A 1OIFA 3RFAA 3DFSA 2Z2AA 2BFGA 3VIOA 3F4CA 3WD2A 3IV8A 5AHNA 2CLHA 2OZ3A 3L2LA 3VNIA 3DFYA 3MDWA 3R7MA 1XGEA 2R1NA 1KO0A 2DW7A 3CS2A 2F38A 1HX0A 2E68A 3IIOA 1FIQB 1JULA 4FNTA 3GZAA 3WUGA 5AOUA 1ITXA 4PEEA 1GZ1A 3OG2A 5MKGA 3GD3A 4AZ6A 1ZDLA 5HNTA 3UCQA 1VR6A 3MUAA 5H8PA 2B0MA 3C2YA 3RK8A 3L21A 5FF2A 3IGHX 2C19A 2DZWA 4L1WA 1H1YA 2DJXA 4B9YA 4RW5A 2EG6A 3BV7A 1YNYA 2CPUA 2OSXA 4M8UA 1EJUC 2OYMA 4W87A 4JTLA 3OVQA 3L68A 1ZJAA 3GC5A 2XN2A 4CUCA 2EEXA 1KRAC 2WOWA 4L1XA 3O3RA 2E5BA 3PZTA 4ACZB 1M1BA 3THAA 3G1AA 1KQZA 4IM4A 3NXFA 1DTNA 1KBIA 1BYBA 1RPXA 3LHUA 3W4RA 3M6YA 3QR0A 4RR4A 1RK6A 4FNQA 1AW5A 1OINA 3T07A 1EC9A 1U1JA 4R3UA 4AU0A 3PZ9A 4HJFA 3TH6A 4AY1A 3GUWA 4NYYA 4LYQA 4HCHA 2W79A 2Q6ZA 1BWVA 1JPMA 1TTQA 4QR6A 2G8ZA 1KXHA 2DORA 1QRQA 3OZYA 3M43A 4WDTA 3P93A 3LLDA 4JHMA 3TCSA 1XC4A 3AIRA 5AHLA 3NVVB 3NQAA 2XGIA 5REQA 3LCGA 2FZ9A 2FVKA 1P0EA 1ZP4A 4MG4A 4XKYA 2O7SA 5JIWA 4MYAA 3B8SA 3SCRA 3BTNA 1JUBA 1O60A 3F7JA 3PG9A 4HA1A 1BYDA 4GVIA 2C79A 1A5UA 3EA1A 4M81A 3PSVA 1M5WA 3F5JA 1J93A 1GVEA 4DYKA 1P0NA 3GVGA 3VCRA 3BAIA 4MB4A 1SGJA 2PZNA 3PULA 4DB7A 3I7QA 3WNKA 2V2HA 1OC5A 2Q3RA 5LGXA 3VGHA 1Q6QA 2G95A 4PCFA 3G3MA 1NU5A 1NFBA 3GW0A 3H7RA 4DEFA 3POHA 4JN6A 4WGHA 2JKPA 4GJIA 3VGBA 3Q94A 1OB0A 2V5JA 4HNUA 1V02A 1VPYA 1UUOA 2BSLA 1PB0A 3O15A 3GYEA 1GOWA 1Z48A 1UKPA 1ZSXA 3CO8A 2J13A 2W0UA 4IICA 3W7OA 3AMLA 2XH0A 3IIPA 3QBUA 4ORIA 3LPOA 1NM9A 1DQXA 3FJ4A 5FF3A 2P76A 2Y0FA 4JQ9A 4JX4A 1VRDA 1US3A 3OBEA 4KRUA 1BXCA 4EXQA 1R0MA 3S2JA 1UWUA 3N2CA 3XINA 3OODA 3EB3A 3LGEA 3MC5A 3SI9A 1CGWA 5D37A 4ES4A 2WLYA 3IK2A 4TV5A 4I3GA 1B57A 2BTMA 1Q6DA 3WD4A 4B16A 2C13A 4QEHA 1AZ1A 2XIIA 4GYPC 1O5QA 4XSLA 2YIHA 3EWYA 2GGEA 3H54A 4NQ1A 1MXGA 1A0DA 1JCTA 4GY0A 3SGUA 1NF0A 1NWSA 4CEUC 4I7UA 1CCWB 4NJKA 3AJ7A 4GLEA 3H4KA 1LYXA 1XLBA 5CSYA 5C54A 5CPNA 2XVPA 2NUXA 2WCSA 3L5MA 1JCXA 4OE7A 1S2TA 3K30A 2BASA 1EPVA 2OLHA 1QPNA 1JXKA 1KXTA 3GH5A 3KCOA 4EKJA 1ODUA 3CXBA 2VGBA 3GVWA 4PUWA 2Q02A 1YXCA 2ZDRA 2VL4A 2Y5SA 1XHCA 3BARA 3W1RA 3WH9A 2X1UA 3B9AA 3WLPA 3TFXA 1UQZA 3FJ6A 1XQKA 3L12A 2YBTA 4EM4A 3A22A 3I6RA 1GKQA 1TTIA 4BI6A 1WZAA 1CECA 4GYFA 1R38A 1AH0A 2XJ7A 3BJTA 2XIOA 1EZWA 7REQB 1BXBA 1QTWA 3DG6A 4DZIA 4GNKB 5H91A 4DJDD 5I3GA 2HVOA 4AAJA 5B80A 4RDWA 3DEQA 4JTUA 2CLLA 2EXOA 4W7UA 4GYJA 3P61A 1ZY9A 1F05A 1KFLA 1KTBA 1XLGA 4ZFCA 4KWSA 1EJRC 4AX6A 4KEUA 1TYPA 2VELA 3XIMA 3IANA 3BLKA 1KRMA 2PU0A 4C1KA 3E0WA 5TR3A 1Q1WA 1CGUA 4DF2A 3QV7A 1FWAC 1AH4A 1SJCA 1DQUA 4QE5A 2X1SA 3SCNA 3S9IA 3SECA 5KSWA 3UYIA 3GR4A 1A3XA 2G97A 3DYMA 3EX6A 3TTSA 1G7UA 1S2CA 3VGDA 4IP4A 1I1WA 2REQA 1F4HA 5LIUX 4MFEA 1H5YA 1MQRA 3G6MA 3T08A 5FJJA 1LVLA 2JKAA 1W2PA 5K2ZA 4NZ4A 1DOSA 4L9YA 3ZR4A 1BF6A 1HKVA 1ISZA 3VM7A 4HCLA 5A8GA 3E3HA 3R8RA 5C9ZA 4BZYA 2FJKA 2J4GA 4KFNA 3SEPA 4DYJA 3TLLA 4NT0A 2ISWA 2UY2A 2GYIA 2E1WA 3K13A 4PL1A 4ALDA 4H4ZA 3TNOA 1K6WA 2W9MA 4ZZ9A 1ISYA 4RXFA 3BJSA 2ACUA 3P67A 1H49A 4P7QA 3USZA 1LWJA 1XIJA 4I8YA 4H4UA 4LAKA 4DPPA 2NQ9A 5EMYA 2DZUA 3LN3A 4P7OA 1PWMA 1EL3A 2BXYA 1Q6GA 3FG2P 1S3HA 4IUGA 3GHRA 3VKJA 5HWNA 1S7MA 4KWOA 5AYBA 3N13A 3TEVA 3IUHA 3SBFA 4EAMA 1MQPA 3R0KA 4IGHA 3VZYA 3CGCA 4YHEA 4GCXA 1GYLA 1OCJA 1PZ0A 3H23A 3HO8A 2GOUA 4GJJA 2HXTA 2D0GA 2CYGA 3T44A 4NX5A 3GR8A 1XUZA 4HNLA 2CEQA 2BB0A 1WP6A 2YZRA 5I5RA 3M46A 1FRBA 1O7AA 2FPTA 1LT7A 1L6YA 3CV7A 1GVSA 2XVNA 2PWVA 4WHBA 1GRFA 4ZE5A 1QWGA 4A8LA 2PC4A 4CD7A 3VU2A 1RPKA 2C18A 1TYGA 2Y7FA 1MSSA 4Q8WA 3A64A 3GHUA 3AJXA 3H6OA 3W86A 2E67A 3RNMA 4AF0A 2E9LA 1IT8A 3QV8A 3WH5A 2WK2A 3QR3A 2RGLA 4X0VA 1TZZA 4B4FA 4U5IA 1NHPA 5K4ZA 2F6XA 1SSDA 1FCVA 3E5BA 3N18A 3CUGA 3PZVA 2WQDA 3TMLA 4KIEA 1JG9A 1XIGA 4L6HA 4DWSA 2WMIA 4M19A 4J2PA 2WHKA 4XD3A 4L64A 4EPBC 3LNPA 2CBJA 4JN8A 3H24A 1KNWA 5GNZA 1DE5A 4ZOAA 3NO1A 4MF4A 3ICJA 3CTLA 3UXLA 2WHJA 2VDHA 2X1IA 4LVFA 3E2QA 5JBFA 2NWSA 5HMFA 5DMNA 1PE1A 3ENLA 4QS6A 1EEPA 1Q6OA 5DT7A 3RCNA 4GOAA 2ZDSA 3S46A 4GK8A 4PUUA 3BOLA 1Y7VA 3ALGA 1OYAA 3TN3A 1GTEA 2QJNA 3AMZA 4PN2A 1C3FA 3AHYA 1R9XA 2OQLA 1M7XA 3R89A 3W6MA 3THCA 2Z27A 2CW6A 1T8XA 5U7SA 2PPGA 2BOEX 2YFOA 1NELA 3EANA 1OFAA 1YMYA 3K4DA 1FH9A 4Z1AA 1TX2A 2E40A 1EA0A 1SQ7A 2E09A 5LZLA 1FA2A 4JGDA 4A29A 3UWQA 3NPXA 1R3TA 3B97A 4FR1A 2CLOA 3GNDA 2H90A 4FLRA 3RJXA 1BYCA 1AJ0A 1CT5A 2UWFA 1J0HA 3EWZA 3CJPA 4FZIA 1AK5A 2W3ZA 2A7PA 2BGSA 3GH7A 4AZCA 1TZ7A 3QMRA 2D73A 3P8JA 1BGGA 3OJGA 2NW0A 5HNUA 1J0YA 1TMHA 4FX8A 3NVTA 2VCAA 3ITOA 3F4VA 4NVTA 4NXSA 4WRHA 3K8KA 2WVVA 2XUCA 3PPHA 4H4SA 1E6SM 2H3DA 2Z6IA 3WQFA 4F48A 4XUGA 4OQVA 1N62C 5ECUA 3H2AA 1QK2A 3W1PA 3L65A 3VX1A 1QNQA 4D71A 2HZGA 4A8RA 2C1GA 3MZNA 1UBPC 1A5MC 1PX3A 3G6LA 1YDOA 4UOZA 1EHNA 4HZMA 5CH9A 5DXXA 1GW1A 2QUTA 4L7ZA 3DESA 3QH2A 4D8LA 1GRAA 4DO7A 1ZENA 2IS7A 4JYFA 3QC0A 4PTWA 4Y9OA 4IWWA 1NOWA 2DSUA 1EF2A 4P7LA 4I9AA 2ZUUA 3D46A 5U1OA 4FNPA 1VLIA 4FB7A 5I3JA 5I07A 2R14A 3HMJG 3BW3A 5GVJA 3CGTA 3C61A 4UMCA 2WOQA 3BLDA 1AJ2A 2GJXB 4PUKA 2V81A 3OC4A 1ZTVA 4ZQMA 2XVKA 4WSKA 3MCNA 3MWAA 2ZWYA 4L4MA 4YCPA 4EMWA 2Q8ZA 3VNKA 4IJCA 3V0TA 5EL1A 4ADUA 3ARSA 3IJQA 4NZ3A 2PP3A 3BMXA 3TXZA 3RLVA 2XVGA 5XIMA 1V7YA 4MLJA 2O4MA 4D6IA 2IMRA 1ZXIC 1LOSA 4TVUA 3O16A 1JYWA 3MW7A 3JS3A 3RLHA 1UH4A 4IFOA 1VC4A 4JQ4A 4D8ZA 4UTKA 1HJSA 2DU2A 2QV5A 1IF2A 5M3WA 1PTAA 2R1PA 1X8CA 4JN7A 1LT8A 1TV4A 5AC4A 3I68A 1B1YA 3STGA 3EUB3 3QRHA 4FHAA 1W91A 1LLWA 2WSPA 4M3PA 3GNRA 5JU6A 3FEMA 2PD9A 2VT0A 4CNPA 1VFLA 3FAWA 3RIKA 3UPBA 1TE6A 3G1DA 2NWRA 4MZ1A 2D24A 3GG8A 3URNA 4MNJA 4G56A 3SUUA 3OYXA 3UWYA 4RE2A 3M41A 1CB2A 3C86A 2EQDA 4F0RA 1A5SA 1MUCA 3VE9A 4UFLA 2X8HA 1UD6A 3RMJA 1VENA 3A6OA 2YDAA 3UJFA 2J77A 4OV4A 1QXLA 4H83A 3ZJ8A 2PDNA 2NXIA 3DYOA 1PCWA 1RJQA 1X1NA 1BKSA 2YDQA 3TYBA 5CZSA 1XG4A 4X2RA 2PDCA 1VAHA 2QDDA 3DGRA 3VOJA 2O56A 3CWOX 4UCFA 3F2DA 1JUEA 5D2YA 3W70A 5I09A 3BMWA 3GU2A 2PLCA 2RDTA 4PFMA 4Q8QA 3R1ZA 3PUOA 5T26A 4JZ5A 5F4SA 4JTKA 2WO5A 3LRKA 4AIUA 4QITA 1YBQB 2YL5A 3W27A 1R85A 2F7FA 2PP0A 2FPYA 3EDKA 1WNOA 4X9YA 2ACSA 2WPFA 5LIWX 1BKHA 1W9XA 4GG9A 2ON3A 3IEBA 4XZHA 4WQ6A 2CZFA 2WMFA 4JIPA 4JTEA 3ARWA 3ZT5A 3I7RA 1NQ6A 3AMDA 1E9IA 1L6FA 5HMEA 5IBXA 4TQTA 1Q65A 4GQGA 1OCNA 1E51A 4RZ4A 4AD5A 1K7FA 1UASA 3PPCA 1U2YA 2C1HA 4DX3A 1GWJA 2GK1B 4EX4A 4GQBA 3CLMA 4U2YA 1XBYA 5CBBA 3ABSA 4NYUA 3OLGA 1LWHA 3IVSA 3UGRA 2WOVA 5GNXA 1BF2A 3VCCA 4EMJA 3U6WA 3NGFA 1JCLA 1XRVA 5FIPA 2BXVA 5CG0A 4UC5A 3HJEA 1LUCB 3KDNA 2YCJA 1ZGDA 3CL7A 3AO0A 3ONCA 4R5EA 4XZMX 4O0KA 1B3WA 4RDYA 2TPSA 4HMCA 3KXQA 3P5YA 1FEAA 1YW1A 2AQVA 3BQ5A 2FZMA 4QQ3A 4DWDA 4U31A 2ZZCA 2OEKA 3VILA 4TVCA 3OQ8A 4NSBA 2C71A 1SZFA 3AXHA 4GACA 4F0SA 1TPVA 3DZ1A 1DV7A 2NX9A 2OLSA 1EBDA 1QO2A 3HZ3A 5BOEA 2H9AA 3ZR6A 2PRLA 2Z2BA 3ZXWA 3NQ7A 2DZAA 3KRBA 4KGLA 1PX4A 4LTSA 3R25A 4O11A 1W1A1 1TFVA 3HIJA 1SB3B 5AKQA 3S2NA 3N9RA 5EFDA 4ZR8A 3B04A 1IV8A 3WBXA 2ZE0A 3RO8A 5C7VA 1XPGA 1OYCA 4HNNA 2WJZA 1W0MA 2O55A 2JK6A 1BRLA 2KZHA 2FGZA 1TPFA 2GJNA 1PKLA 1X6NA 5DXYA 2HK1A 4O14A 1XLJA 2X16A 1OFRA 3TV8A 2J6VA 2A3LA 3HFTA 3FNDA 4GINA 3N1AA 4QJ3B 3OO2A 2EKCA 1XBZA 1FWCC 4LYRA 2F61A 3VKKA 3GX9A 3AU2A 4HYWA 1J8VA 5HBFA 5RUBA 2BVWA 3SY8A 3AZRA 4EK7A 1LLZA 4I9JA 2PF0A 4DUWA 4V28A 1B3XA 4B5TA 1K9FA 4R53A 1NJJA 2PU1A 4CCDA 3W82A 3P7YA 1V51A 2VEKA 1W8SA 3AIBA 2PLKA 1J11A 2GLKA 4JIHA 5CLTA 1B0IA 4MM1A 3BK0A 1BZLA 2VC5A 3W2UA 1P6CA 1JYVA 4U3AA 4AXKA 3PJUA 3ZYZA 1Z44A 1JF6A 3T8QA 3ATZA 4DJDA 4HOXA 1F7BA 4CQDA 2Y24A 1DJIA 2YYUA 4A3YA 3LQLA 4JTCA 3UA3A 3E6EA 2BP1A 3ZZ1A 3SRFA 3HFYA 3FGCA 1SJBA 4B90A 3L23A 1V59A 4APNA 2A8XA 2JFEX 1W3JA 3W83A 3WQEA 5D2TA 3S1UA 4HJWA 3SJNA 1P1XA 4IPIA 4W7WA 4FOUA 2QULA 4UCGA 4ZOCA 1TPC1 4FK9A 3OHIA 2WVSA 5FAGA 4FAMA 3S47A 3TYUA 4PCSA 1GVYA 1TJ1A 2I5IA 3MQTA 1XBVA 5GQBA 3L2MA 1F6PA 4GYKA 4D6DA 2NQHA 5MKGB 3FS2A 1HJUA 1RALA 1LZOA 4DO5A 3T1GA 3WLKX 5A6LA 5T9BG 1JJKA 4Q6JA 5XIAA 1ZX9A 4GI8A 1U83A 4I6KA 1RD5A 3AS2A 5DRIA 3WH6A 3B9OA 3QHOA 1GG0A 3WF3A 3L67A 2CZEA 3JW7A 5AZ1A 1TTJA 5CXPA 1IGWA 3I7SA 3QKZA 2YJQA 1JPKA 1OADA 3B4UA 3DOPA 1G01A 1V3KA 5FJTA 3SO7A 3SIMA 3ZLHA 2BBFA 1KWGA 4R7WA 3ITCA 3BAXA 5CZKA 3KAOA 3L4WA 4EANA 4UIOA 2PWEA 4K38A 2OFJA 3BAKA 2FYMA 1W9BM 2YA2A 4QE1A 1UG6A 2ZFAA 3UZJA 4FXJA 1XM3A 1UZ4A 1VQZA 4IMAA 4DPQA 4GXMA 2YL6A 3Q6JA 4MUZA 1OZQA 2I16A 1XH2A 1TR9A 2EPOA 2YDRA 1A4MA 1HFBA 3UR7A 1CI1A 4MZYA 4PMOA 5REQB 5DF0A 4NZ1A 4XKYB 3VNYA 4GQQA 3WF1A 1GCYA 4PR4A 1AG1O 2OODA 5DELA 2FMOA 4DO6A 2FLIA 4B92A 1Z32X 2IKGA 3BH4A 1RCQA 4CCEA 3VOIA 1RZMA 3E74A 3VMPA 4IMGA 3LTYA 4GX9A 1JRPA 2PTWA 3R10A 2BVDA 3EWBX 1PKYA 4KS0A 2YB4A 4ZEPA 4F4RA 1RY0A 4AY8A 3BGJA 1FWIC 5HUOA 3IS4A 2PTYA 1OY0A 3CQJA 5EBKA 4XZ9A 3OU8A 1S38A 5ABTA 1XLEA 1P43A 4GISA 3CZ8A 3AMGA 1XYFA 4J1OA 3TOPA 4H4IA 3VUPA 3G5EA 4XIMA 1VCVA 4DHGA 1JL8A 5TIMA 5AC7A 2QCCA 4X60A 2W92A 1HGWA 1AZ2A 1ZJHA 1TWSA 2PDLA 1ONRA 4RZ5A 3GXIA 3PZQA 5D30A 6XIMA 1GKPA 3NSNA 3W22A 4BY3A 3NRZB 4FSAA 5JCNA 2V6AA 2IQ0A 1V03A 2X0YA 4CQ9A 4ZENA 3V1HA 1KCLA 1DJQA 2ZUVA 5G1MA 4C7FA 1TCMA 1PX8A 2G96A 3H2FA 4PC8A 4J57A 3W02A 4KPRA 3TQ0A 2HV5A 4JTRA 1VBJA 4GIAA 3DH9A 1XI3A 3NOEA 4JNZA 4B5UA 2ZZBA 4IX2A 3EPOA 3FCPA 5C9RA 4K7VA 3AHZA 3FY1A 4LS1A 4ZMGA 1F8MA 1ZLPA 2QCNA 4C7GA 3RCMA 1VEOA 5F2LA 3AS1A 1CW2A 1UD8A 3NO3A 2Z1XA 4RLIA 4IIFA 4Z42C 3DKLA 5AVHA 1KBJA 1YTKA 3WK0A 5AHIA 1W5QA 1MXSA 1XYAA 1GVQA 1IR2A 4QG8A 1OC7A 1ONXA 1NSJA 5D09A 3PBMA 3Q67A 4WSJA 3UXIA 2IUZA 4CD8A 3SADA 1DXLA 1XG3A 1L9WA 1DQWA 4IPLA 4C1LA 3HN3A 5HA7A 1BVNP 4ADTA 4Z1YA 4F2TA 2EJAA 1XP3A 1HKWA 3DK8A 4D2JA 3RM9A 5J8LA 1UP2A 2Y5JA 2WKJA 4WJ8A 5JCKA 4GYPA 4BF9A 3QMSA 2NLYA 3NURA 3C52A 1WKYA 3GDRA 4YWOA 1XYBA 1JCYA 2R9ZA 1UWSA 1ZBVA 2PDGA 4S3DA 3IWPA 3EWCA 4OHQA 4PMVA 5DT5A 3HPAA 4GNJA 1PBGA 1TPEA 4MNMA 4HNTA 4WR3A 3LB8A 3PB2A 1BSLA 4S3KA 2Y63A 3W0KA 1SO3A 1VGAA 3C0JA 1S3TC 2IPGA 1ZALA 3T0CA 3RPMA 2PRMA 2X30A 4ERAA 1EGZA 1TIWA 3PZGA 2XISA 2VVSA 2D1ZA 4Q8VA 1N60C 4X0NA 3N04A 1EGMA 3WG6A 3LB0A 1TSIA 1ZRQA 3TWAA 1UR8A 3DIPA 4JAWA 4RK8A 5IHSA 2VR5A 3NPUA 2AOSA 1UQYA 1K6AA 1T8QA 5CC6A 1P0KA 1DHKA 2FHFA 2I14A 4KCTA 3GKFA 3MMDA 1QHOA 1DWFM 3OGVA 1GK8A 1PIFA 3F03K 4MPQA 1P0DA 4O12A 4UMAA 1Z3NA 3KL0A 2G4FA 1AUSL 4B5WA 2E1DA 2WV8A 1Q4NX 2WAGA 3T4CA 3I10A 5G4WA 3WEMA 1X1ZA 4DIAA 3HW2A 3PG6A 3OW1A 1E0XA 5MF5A 4MGGA 4HGXA 3U0HA 3D47A 4UTMA 2ICSA 4QDPA 1GOIA 3BLIA 3FXGA 2XSAA 3E5PA 4MKSA 2PDBA 2WPGA 3A13A 1DJHA 2WVTA 2YBVA 3QMTA 4L56A 1GOKA 2WZIA 3W81A 2J7DA 4Y96A 2WWCA 1RLCL 2HVMA 3ORWA 3KVJA 3S4TA 5F4WA 4XO7A 1BD0A 2VEFA 2J8GA 1XLLA 1ISWA 1SSGA 3SGZA 2YKKA 1IXPA 1S2WA 3HG2A 4EQSA 3SN1A 1UYQA 4H8UA 3IGXA 3LA4A 1JNDA 4LY8A 2BMBA 3TAKA 3NVYB 2QAEA 3KCJA 3EA2A 3M9YA 1TPB1 1POJA 4UQBA 1XINA 3GVRA 3MUIA 3CH0A 3PTQA 2FDMA 1SR9A 3W7DA 1LL4A 2VYOA 1J0JA 3EAOA 2DSKA 2Y5EA 4QSHA 4NNAA 2OELA 3SCVA 2FVMA 4EQXA 3S83A 1GQLA 4JTIA 1E1EA 1MI3A 4AF0B 3PAOA 1ICPA 2CC0A 3T42A 2DZBA 4XD5A 2YW4A 5EKYA 2PTZA 3WLOA 1CTNA 1W9DM 3P82A 3V5FA 1IQ8A 3RRXA 3WBAA 4DVOA 1E1CB 5JRBA 3PBGA 4UTJA 2P10A 1NHRA 4Z0JA 1UH3A 4QTGA 2UV8G 3APTA 3M0VA 4LF1A 4B5VA 4UNLA 4MDOA 1GZGA 1R7OA 4DWSB 2WMIB 4AC7C 1Q2SA 3CUXA 2I1OA 2VDGA 4GUGA 4O8AA 3NCOA 1XCFA 2I56A 4MZ8A 3UJRA 2XHYA 4ZOHB 3GFXA 5FAJA 1UZ1A 4LCRA 4QISA 3AWOA 3MY9A 3M0JA 3MHUA 3W6LA 4C90A 2E25A 1FWRA 3BCDA 4RV8A 2E6YA 3N73A 3QSRA 4PUNA 4UTTC 3T8LA 4JL1A 5KITA 4GIYA 3HTWA 3QPZA 1YEYA 3A9IA 3K8MA 4N9DA 4YNGA 4IT1A 1GOXA 3QYSA 3OIHA 3M0ZA 4J3ZA 3W7MA 4Q33A 3EKZA 2J7FA 1E0UA 3WLLA 1Q1RA 3EZ4A 1W1ZA 5I78A 1V6UA 1J4EA 2YAUA 4MYXA 4M1BA 3U5YA 4YPJA 5D2XA 3R5EA 2E9BA 3NAVA 1UD4A 4WKHA 2HDJA 3D5HA 5F2IA 3W7LA 5FJPA 5B7ZA 2FH6A 4Q7BA 2Q8LA 4PUMA 2XYLA 3JVAA 3W85A 3S42A 5I06A 1E5NA 1JUKA 2EPNA 4AZIA 1BXNA 4N4QA 1WZMA 3TK7A 5IFPA 1D7YA 5FCZA 3MU7A 3LNMA 4PMQA 4IQDA 5D9PA 1P5BA 5LNUA 4AIOA 3RHGA 1G69A 4AZCB 3U5UA 4LS2A 1F3TA 3KTCA 2C3CA 2HNEA 1K9TA 2EQ6A 3GG1A 3OGRA 4YTSA 4HA3A 4K36A 1W5PA 2VRKA 1OJTA 3CIXA 4U5KA 1YKWA 2H3BA 1UKOA 2VGIA 3E12A 1S1PA 2WVVB 3NQEA 4GY1A 5BXTA 5HQLA 3TA6A 2D2OA 5JBEA 1GERA 3UYCA 5IRPA 3L9CA 2RDWA 3SQSA 2GJLA 2POTA 4HK5A 5G2WA 3LMZA 4WY0B 4GQ0A 5AB3A 2OEMA 1IEIA 2GVLA 3ITVA 2Q71A 4O52A 3W38A 2J74A 1OZMA 3ZWSA 4LALA 3CO4A 1PZ2A 2BC0A 3M47A 1VHNA 4N4PA 3GRSA 1KTCA 3Q2DA 1JZ7A 4H6QA 1K1DA 3GNOA 4US6A 1O4UA 3WLTA 1KGUA 2GFTA 4HA0A 1TO3A 2FVLA 3P60A 2W4XA 5FACA 3DG3A 3P62A 1KM2A 2PGFA 3IJ7A 3MBDA 1OFBA 3QTPA 1GJUA 6REQA 1SYTA 3ALFA 2TPRA 5E93A 1X7IA 5AYZA 3LRMA 5I0DA 3GR7A 4M24A 4EF9A 2V3BA 1NWRA 2AGKA 1OX6A 4AEOA 2DJLA 3PPGA 5HJLA 4JIEA 4HN8A 4LANA 3SUWA 5G2IA 3KS6A 2VD9A 4UZUA 1E9ZB 2WQPA 1JD9A 1TELA 1YPXA 3DI1A 1CGVA 4Q3MA 2DV0A 3MANA 3REQA 2ACQA 5LXEA 2ZUTA 3RPDA 1VD6A 5JCLA 1LJYA 3MKVA 4TTGA 3TP4A 3PWGA 1IWBA 4YLWA 1Q7ZA 3WNNA 1QI3A 3GG0A 4GH3A 3HV8A 3NQ6A 1QBAA 1ZJBA 2QJIA 4B2DD 1I2RA 1R3YA 3D3FA 3CHVA 4L4OA 1LM1A 1OG6A 3IK4A 1CXFA 2AKZA 2QYGA 4J35A 3W2KA 1TWDA 3M1ZA 1XD0A 3A3HA 3S6OA 3GVQA 4ATDA 5KZMA 3COTA 4JX6A 3Q58A 1O1ZA 2GWGA 1DP0A 4ZSTA 2XFFA 1K3UA 3FHQA 3WQOA 4LAUA 2RJHA 2C15A 1W37A 3BW2A 2FTYA 3P0WA 1QW9A 3HG5A 3OLEA 1ESWA 4IGSA 2VENA 3CTTA 2CFYA 3A4WA 3LHTA 2OPJA 3KL3A 4E8CA 4GUIA 1OT2A 3AOFA 3KLJA 4K3ZA 5K3VA 2Z00A 4RE4A 3L4XA 4OJYA 2DW6A 3RM8A 1XIDA 5TNVA 3A7UA 1R30A 4G8TA 5KVIA 3LPPA 3VFLA 2PGRA 4Y7EA 1MZRA 1XH1A 1KFCA 1YIXA 2NVDA 5A6TC 3EYPA 1ML1A 4FMVA 4V15A 4PMUA 4QAWA 4XSMA 3ITGA 1Q8AA 3ABOA 1JF5A 1KBBA 3OGSA 1QPQA 1Q5MA 4ML4A 1XFBA 4FLSA 1TR1A 5DCBA 1UW9A 5CLWA 3LBOA 4PRRA 3EWUA 1XYLA 2QMJA 4H7VA 5GPRA 3C2FA 4ZSUA 3AWNA 3IJ9A 2Z7KA 2XIMA 2EBNA 3DFOA 4AYGA 9RUBA 1MRAA 3E49A 3GTXA 5CBIA 1HKJA 4KERA 4A3HA 6CGTA 1MRQA 4L9XA 5BU6A 1BG4A 5C2CA 4P8UA 4DF0A 2WP5A 4WEVX 4S3AA 1T6MA 1SJDA 1EJVC 4LWWA 2CLEA 5DMLA 3S5YA 3CV1A 1QMLA 2A1YA 5CPQA 4M6QA 3D6NA 1KCKA 3A5FA 3WQWA 3VKAA 4XO6A 3ZJ7A 1B4EA 3NO5A 1KRCC 1LBLA 1QJWA 3W88A 2R94A 3DGBA 1C8XA 3I6EA 2YVFA 3NUKA 3G0XA 4QDWA 3BE7A 4H2CA 4MSSA 2GQ8A 1X39A 3G3DA 4UXDA 3KHJA 4ZQRA 8XIMA 4YL2A 1QW8A 1Q8JA 4O54A 4JTHA 4GI6A 3GQYA 3ZMRA 2OG9A 3IJIA 1HP5A 1UP3A 3LV6A 3PB0A 4A8NA 1DXIA 1FDJA 3MSGA 3V4BA 1WA3A 1B54A 1WQ5A 3OQEA 1OFPA 4E2DA 1B90A 4F0MA 4LNYA 5EFFA 5IHRA 3WK3A 3FDGA 3LCXA 4JEQA 4F79A 5E6ZA 2BHUA 4O1EA 1DWJM 7A3HA 3UPWA 4KH2A 2B7NA 3H2NA 3EXSA 4TV6A 4O1AA 4YJ5A 4TVYA 3H53A 1ZJIA 1FH8A 3NTYA 3LXBA 1TPH1 3PJWA 3VIFA 5CGMA 2FDSA 3W25A 4GY7A 3ZQ9A 4EXAA 3KP0A 4IXXA 3THQA 3SY1A 2INZA 3GRIA 2VEGA 3CMGA 2DZTA 3LK6A 5T8GA 2W61A 1EYWA 2H9AB 4LNCA 3UPMA 3TXVA 2EPMX 1PO9A 1YXYA 1HW6A 3DGHA 1SFLA 1L0PA 3EB4A 4B91A 1DNCA 2V5DA 3MO4A 1OX5A 3WFAA 1UZHA 4ZO7A 2DPEA 2XWEA 3OA5A 1H7PA 5FS7A 3V5OA 4ZCWA 3M7SA 3CT2A 2RDXA 4BQ4A 5D33A 2QAPA 1MNZA 3TSDA 3L5AA 4CN1A 1AW1A 1DWHM 2R91A 3DC0A 4Q8TA 1BRLB 1N55A 2GWNA 4TMCA 3W72A 4O16A 1TJRA 1FFRA 1G9HA 4CNNA 3DECA 2J24A 3RX3A 1Y5XA 1F4AA 1LOQA 1XL9A 2OQYA 4DNHA 1VYPX 1RCXB 1W1VA 4AZHA 1GVIA 4WXYA 4C91A 1OIMA 3CZJA 1MEHA 3STEA 3WJYA 4EAYA 1VB9A 3LPFA 1JAEA 4JKKA 2GH5A 2PMQA 1R3SA 3MI2A 1YHTA 5C70A 2WC4A 4ML9A 3LBMA 4NF7A 3M6DA 5F2GA 1R7AA 4WCJA 3G1XA 4B5XA 1E0VA 1BVWA 5AFDA 4O19A 5FJIA 5CGTA 3KVMA 3F5KA 1CNVA 1DYSA 2ZUNA 4IJBA 1N8FA 4WKAA 1SZRA 3ZS4A 1KR1A 3C6CA 4S2BA 5H8UA 5MHBA 1XHGA 2WW5A 4AQLA 2WOIA 2Y7EA 1WDDA 1K4QA 1JPHA 1ECQA 1EUAA 2VZSA 3QZ6A 1UA3A 3ZIZA 5E0KA 3AIQA 4D6HA 1E15A 3RF9A 4JKMA 3NZGA 4RXGA 1ZZMA 2DZPA 2WPBA 4Z2KA 3W3OA 4RL3A 4NI3A 3B8TA 1MVYA 4NL1A 3NEVA 2VUNA 1OK4A 3N6QA 2W6RA 3S5ZA 3LLXA 3FGCB 2Q01A 4NZJA 1E4MM 3E2RA 4M6UA 2DY3A 2CIPA 1REQA 3KOFA 3QOMA 1TYTA 4RZ6A 4CNTA 4Y90A 3LI1A 1XSJA 3GD4A 5D2VA 3JZUA 3BLOA 3WH7A 3DHDA 3VC6A 3S2LA 1R46A 1SFJA 5BCAA 1IEXA 5IOBA 3CHCA 2G4JA 3BXWA 1F6KA 5DCEA 2GL5A 3N9KA 2WSYA 5KINA 4WK9A 4GZ7A 2BX7A 1DIEA 1NDVA 4W93A 4QS5A 3FVDA 4JQ3A 4AH7A 3O6DA 3QYQA 1QHPA 3N9SA 1XDJA 1XC6A 4XBJA 3H4XA 3HG3A 4NX0A 4M5PA 1BLIA 1H51A 2Z6JA 2Y4SA 2OX1A 2P1FA 1UWQA 1JPDX 3KL5A 1QT1A 4W7VA 3AMKA 2P8CA 5HNNA 1NQKA 2GGGA 3BOXA 5J5DA 2WMHA 1NOFA 2D23A 4GXPA 2QV4A 2X0SA 3GDLA 4O15A 4TMBA 2Z1WA 4H9ZA 2QR6A 5C9XA 3AUOA 2NSXA 3S6TA 2ADAA 3R4IA 2AL2A 1SFTA 2W67A 2AGTA 9CGTA 1H0GA 4K7ZA 1RY8A 2C16A 3HM7A 2AQOA 4L4PA 5T9CE 4PRTA 2PWHA 1K8ZA 3AZSA 2QPUA 4MOZA 2J6XA 2ZVIA 1KM0A 4G6CA 4LUSA 3CWHA 4GVGA 4RE0A 2F84A 3AAMA 1RV8A 3T81A 3WJZA 4A35A 4AG0A 3S9YA 1UMYA 1O95A 3MUXA 3F2CA 3T2PA 1T5AA 4PMJA 1C9DA 2CLPA 1B3ZA 3VOFA 1TB3A 3RCYA 4C6KA 3KP1A 1MWOA 8TIMA 2EGZA 2V82A 5EB8A 3S5OA 1US0A 4DXVA 1W9VA 4X63A 1B9ZA 5FL1A 5LYRA 4J3WA 4IPJA 2IKJA 3NZRA 3S3GA 3KTSA 4AMCA 1Y5WA 3PJXA 1HO1A 3VFCA 5HPCA 2HISA 2C8NA 1UKTA 4FNRA 4O1FA 2JGYA 3VE7A 4ZODA 5CAHA 2TYSA 5E1QA 5DLCA 4AWEA 1GOQA 3GKAA 3LENA 3AXXA 4JHOA 3CYVA 1LBMA 4ZTXA 4UQ9A 1EIBA 3AYVA 2HBXA 3WLSA 1CPUA 2CXEA 3G0UA 2ZXDA 1DJGA 1FDYA 4O53A 3W23A 2F6UA 4Q4MA 2A3AA 4EP8C 5F2MA 4PMZA 5HQMA 1FWSA 1LP6A 1OG0A 4QP0A 3GU1A 3TTEA 4IP5A 5FOOA 4J7RA 3TROA 3NQ8A 3G1YA 3PUGA 2A3BA 2TMDA 1CGYA 1UR2A 3EWXA 4AZ7A 4B3ZA 2D69A 2DT3A 4HYVA 1ITCA 3MS8A 4LXFA 2Z1VA 4CQAA 4KESA 3NQ2A 3DFNA 3MP4A 5HATA 1FY6A 4IZGA 5LNRA 4E6MA 1V4YA 3N25A 4EWND 2B7PA 1M7PA 1J18A 3TFCA 4B5SA 2FHBA 3QZEA 2HQAA 4NKCA 4GQRA 2PSNA 3G1VA 1IXOA 4TTUA 4F8XA 2ZX5A 3RX4A 1BVZA 1FCQA 2WCGA 3WUEA 4H4YA 3W75A 4Q8OA 3N34A 1W3TA 3N2TA 4ZOBA 1A5BA 1X6LA 3RR4A 3SN4A 4HQVA 4HD5A 2HEJA 4PEKA 2DT0A 1U5JA 2B4GA 3NXLA 1TQXA 1FBAA 3SCOA 3IIXA 2KX9A 1JIBA 3MVTA 4GUFA 3N19B 5ABGA 2GK1A 3NYZA 1JCJA 4XIAA 3KM8A 5DMMA 3RAOA 1EP1A 1NY1A 3BDKA 4KKXA 8RUCA 1XX1A 3MMUA 3WQ5A 2HJPA 5LIKX 3W7CA 3QTGA 2CHOA 1V8EA 3TC7A 4HU3A 2DUZA 2QZRA 4S2CA 5DANA 5CG7A 1X96A 2UBPC 2VDIA 2ZBTA 3O6CA 2X09A 3W7EA 2OWWA 4HHMA 1SO5A 3KS5A 4JOMA 3NDZA 2OWXA 4WLCA 4WD0A 2BHZA 1MEWA 1GSNA 1XBXA 1RLDA 2XGBA 2QVNA 3CNYA 3CK5A 1KW1A 2LLEA 2VEIA 4O50A 4FF7A 3A24A 1RH9A 2CWXA 3MKCA 1MW1A 1I0DA 3CBWA 1US2A 2CLFA 1M41A 1XKJA 2RUSA 2VFIA 4DNMA 2AAMA 3OYZA 1P1MA 4OOZA 2FQIA 2YCLA 3TQVA 1Z9AA 3M0LA 2X50A 4JX5A 2Z25A 1XWYA 2YPIA 3C0SA 3TYEA 2JF6A 1Y5VA 4B2DA 4MWAC 3CV2A 1DXFA 4LAZA 4LAOA 1NTHA 4XZNX 3B8IA 2YXGA 5JUVA 5I23A 4RKAA 4A2RA 4NEWA 1NWUA 7ODCA 1OEPA 4PBFA 1VS1A 4LY4A 2CNCA 4OT7A 1UWAA 2VO5A 4XAGA 1K8YA 2X7WA 1W9UA 4U28A 3WMCA 4W9TA 3SUVA 2WBGA 4PYSA 1IZCA 3S2MA 2Z7GA 1ME9A 4E8DA 2W66A 4UTUA 1BWCA 3EGJA 4YVPA 2W54A 1Q85A 5CAKA 3WMSA 3LCWA 4HP5A 2C14A 5KZEA 1I8JA 5AHMA 5EA9A 3JU2A 4EE9A 4A8IA 1WCGA 4W5UA 4BEQA 1M6IA 2ZICA 2QIIA 4HU8A 4DJEC 2YB1A 4ZB2A 1GQJA 4PTXA 1QI4A 4TU1A 3PNUA 1TJ2A 1H7WA 4NJHA 2D0HA 3QHMA 1HVQA 3N14A 3UD6A 1OFQA 1GT8A 2GJRA 3GYCA 1EOMA 1RBLA 1ZQ5A 3T6CA 3U57A 2PGWA 3BAJA 2OCZA 4S3CA 1G4EA 4C6OA 3QLLA 3MSDA 4H8HA 1PJ9A 4K2SA 4W89A 2VNCA 5FSEC 3GIPA 4F0HA 3BG3A 3BSHA 5D9MA 4TX9A 4J28A 5K4XA 4A22A 4F0KA 4C6QA 3EEGA 3TTOA 4M7TA 4B3KA 1KGWA 2L5HA 2WLZA 4KF1A 3BG5A 3VYLA 4WY0F 2AQWA 2CZDA 3TX9A 3DU0A 1JRCA 2DEPA 2O4QA 2DIEA 2VC9A 3T55A 4CCCA 2FZBA 3PSWA 3TSBA 1NP0A 3PFMA 2YZ5A 1L2QA 4BV6A 4ACYA 2BODX 3P8IA 2CESA 2A7NA 3ITTA 2FIQA 4C6EA 1J01A 3LMYA 1UWTA 4DZ5A 2J78A 5AECA 3WLMA 1FH7A 1V3JA 2OQHA 4S3GA 3FJLA 1E56A 2ZA1A 1F3EA 4CQCA 1FKWA 5D38A 3LADA 4QBXA 2QCGA 1HUVA 4BQ2A 4ZE4A 3N2OA 4Z08A 1FDZA 3L4UA 2E0PA 5EMJA 4Q4QA 4Z2IA 2E28A 3T40A 2J75A 5HINA 3NL6A 3TN5A 3W1NA 4O10A 3W01A 3ES7A 3TWBA 1AQMA 2BOFX 3VD7A 3RITA 1P6BA 4EPDC 2A2IA 1IZKA 1PDYA 1GOMA 2I57A 3AXKA 3VI2A 1BGAA 1H50A 3UW6A 2J8TA 4GRSA 1V5XA 5IFTA 2PBGA 2Y6ZA 3SCTA 1IHIA 4GBDA 3N3MA 1SFSA 4ORMA 5BXPA 3MUY1 2WJFA 3I3DA 2GJPA 2G3NA 4GMEA 3QQWA 3WENA 4PZVA 1WDWA 4N2YA 3IGSA 2PRHA 1VRXA 1RM6B 3FKKA 3QSTA 3FV9A 4GCAA 4GKTA 1QPKA 2NV2A 1S2AA 3OIXA 3ECQA 3M0MA 4HVXA 3QEZA 2GSHA 3EKGA 4MJMA 3R13A 3P14A 4NRSA 3UWVA 4AWSA 4QLLA 2JBMA 3SUTA 5DMYA 1WPCA 1XIIA 4NXKA 2W0HA 3M0KA 2QDHA 1DPMA 1C8QA 1GVFA 4NY2A 3UWEA 4EWJA 4OTKA 4FIRA 1BWLA 2ZIDA 2AKMA 2VX6A 5I77A 3GAKA 1DWIM 2ZRXA 5FF4A 1VIWA 3K5XA 5G1YA 1HJWA 1C92A 2RKXA 1E55A 1XLIA 1XGDA 1GOOA 4QG9A 3MKKA 3K2GA 1S39A 4A3RA 4LS0A 3TYDA 4LC8A 3RUBL 1JI2A 4HA4A 4HSOA 2PUZA 4RW3A 3AQUA 4GD0A 2R1LA 1VFHA 1EA9C 6REQB 3W2NA 2R8WA 4TVWA 5HAOA 4GX8A 1XPYA 3M5ZA 3CU2A 1W3LA 3SFWA 1BQCA 3VKBA 5J5RA 1ECEA 1XYZA 5BNKA 1KBLA 3T2QA 3B0PA 3QFBA 4YVVA 4XD6A 1V97A 3BURA 3REQB 5AC8A 3CASA 4PBGA 4XX6A 4PFHA 4QLKA 4DUXA 1A0CA 3GH4A 3ARQA 2PDMA 3FX4A 1E9LA 1Q6FA 1IR1A 3CGEA 2J25A 3WQ8A 2P3EA 4JFUA 1I9CB 3ARZA 1SUXA 3CQKA 3C4UA 2DZSA 3W1QA 4W8BA 5DN1A 3HV9A 1RQHA 2J9YA 5HANA 2BLEA 3OB8A 9XIAA 2VGFA 3UNTA 5JQ9A 1XISA 4XAPA 2IQTA 3QFWA 3O06A 1GYMA 3LPGA 5DCDA 5H1WA 4PRWA 3CAKA 1FP8A 3W6YA 4CKQA 2V67A 1VEMA 1DBTA 1JGMA 2V5BA 1H4PA 3BSMA 2PDQA 4PB3A 3QQ0A 4QFUA 2IPFA 5D2WA 3VXGA 3A3WA 4WKFA 1VJZA 2JIEA 1Q63A 4E2BA 2C6QA 1ZNNA 4P8VA 1CLXA 1H09A 3H55A 1XYMA 2WM1A 2XVLA 4QQUA 3VKCA 4UOQA 3G77A 3VGEA 3VZZA 1FFVC 1J5SA 3FYPA 3STPA 5BZAA 1GV4A 1WKDA 3UU0A 4MJ2A 4MWAD 3F5LA 2V63A 1D7KA 2HXUA 4S38A 4NJJA 2WNZA 1G94A 2OMAA 1SO6A 5F1UA 3XISA 1XFCA 3V75A 4W5ZA 3IAPA 4DZHA 1JRBA 3LX9A 3T7VA 3VO0A 1W2VA 4US5D 5ABEA 4KIRA 5JCIA 1AH3A 2YLAA 4CCZA 2E77A 6PTDA 2ZX6A 3AXIA 3VD3A 4LB4A 3JR2A 1J79A 1L8NA 1A53A 3VZXA 3TW7A 1HP4A 1OD0A 1RJPA 3FFSA 3PFRA 4UTLA 1S2VA 1FWWA 2VWTA 3BLLA 1FX6A 1EXPA 1RHCA 2ZRYA 3GM8A 5HNRA 4QM1A 1FHVA 2ALRA 3SR7A 4NP7A 3EMZA 3IUIA 3AICA 1VP5A 2HROA 3C0LA 1C9WA 4BFAA 1NVMA 1TJPA 3L0NA 5A69A 2QNEA 4JFTA 2XIBA 3GXPA 2PC8A 3ZSSA 5BRBA 3KRUA 3C3UA 3FSUA 1EJSC 4Z2JA 1SW3A 5EMLA 2G37A 3ANUA 3VKDA 4QJ4B 2OEJA 1HL9A 5CBJA 4WOZA 4BJHA 1FHDA 4GI4A 3VCNA 1WDSA 1H1ZA 4KRZA 2QGHA 4GVFA 4GR1A 4DWSC 4ZQPA 5CZ0A 2E6DA 2OSYA 3AROA 4MWAE 3T2OA 2GUYA 1V0NA 4FNSA 3BOFA 3CT7A 3KVLA 5A2AA 1YE6A 3RU6A 1JGIA 2ZCGA 3W7RA 2VFEA 3LCIA 4BR1A 1KM3A 5D8WA 3AIEA 2FKPA 1IEWA 1Q66A 3H21A 3WDPP 2DH2A 4HMEA 4I5RA 3WMBA 2A6LA 1GVOA 1VQTA 4S23A 4H01A 2AAQA 4GH1A 3QXBA 4ZB0A 4MB3A 2VFDA 1IXNA 3MSYA 2CXGA 4EVZA 3O0HA 3LZ5A 3CWNA 5M1TA 2CETA 1XLAA 3GWQA 3GXDA 2NQJA 2DT2A 2HS6A 4JY8A 4LC6A 4IIDA 1I2OA 2PODA 4JL2A 3SFKA 3EDEA 2BY3A 5EBUA 4JXCA 4A3UA 3BQ6A 3V1PA 2BG5A 5FF7A 3GDKA 3UXDA 2EQ7A 1XUUA 3M0IA 4HU4A 3AS3A 1N8WA 4Z17A 1VYSX 1KN0A 3G22A 1CGXA 2JF7A 3SQPA 4KWWA 2PDJA 1J0ZA 1MYRA 2E6AA 3E0IA 4ZVJA 3N4FA 4BCEA 2FMNA 4DJFC 1CLKA 1MDRA 1PTGA 1T40A 3FSTA 4S3FA 1AQHA 4WX2A 1IT0A 2P53A 2A21A 6ENLA 1ONEA 1JAKA 3UY7A 1B31A 3SURA 1XR2A 4G7EA 1E1CA 3OLDA 1E6NA 1GVRA 3V7PA 2XGZA 1TV7A 1EGVA 3GDMA 2ISDA 1NDYA 4UFJA 1PTDA 3WNLA 1KR0A 3MHGA 2OGJA 5I79A 3KZPA 1EO7A 2E8YA 4GGBA 3TCEA 4JYEA 2P8BA 3MMTA 2WJEA 5AYIA 2R9RA 3EX2A 3CPUA 1WKEA 4HSNA 1W1PA 5C7HA 4QAIA 4ILSA 5A6JA 2DVUA 1FOBA 3M5VA 2D3LA 1QUMA 3URHA 4YCOA 1R47A 3EPMA 4NAFA 1W5NA 4UOJA 4LUTA 1PCKA 4XUYA 1VFTA 2X2GA 2CZ5A 1LROA 1GPFA 3HGJA 2QDGA 4BF5A 5D8ZA 5I3KA 3AM9A 1GUVA 4O17A 4OBRA 2D22A 4IH3A 5ECVA 2DUAA 1TVLA 3WLJA 3G8EA 3NS1B 3CV6A 4AWTA 1RP9A 3KUMA 1LL7A 3OP2A 1F9CA 3QGVA 3USBA 1JZ3A 1UUQA 2CLKA 1OWQA 4IL2A 3KBJA 3OVPA 3LTPA 3PANA 1TCDA 1EPXA 5CPTA 4E38A 3MPGA 2OZ0A 3VMOA 1REQB 2AMXA 2IQDA 4AVFA 4WDXA 1AL8A 1TV8A 1J2BA 1OCQA 3T0BA 1A0EA 1EZ2A 1PUDA 4LRSA 2XM2A 1JYNA 4CD6A 3I4EA 1M65A 3NA8A 4UQCA 3QV9A 3N15A 3NWRA 4IHCA 3DX5A 3Q4DA 1H7NA 3INPA 4H19A 4WY0A 3UVAA 1GORA 3W87A 2WZMA 4ENLA 5AC5A 3CAVA 1ZY8A 3LHYA 1XLMA 3SSZA 2O9PA 3DC8A 4I5XA 1UR3M 2EF9A 1F8WA 4X3ZA 1LORA 5A5WA 8XIAA 3DYPA 2WBAA 4IL0A 3A3XA 3UVIA 2NV1A 2J47A 2YQUA 3L5OA 3ITLA 2V3FA 1G4PA 1BSIA 5A6SA 2ZA3A 2PF8A 3KBSA 4LVBA 2INFA 5KZ6A 4FIQA 2XN1A 1JZ2A 1GQIA 1OD8A 2UY4A 3OG3A 5DX7A 4E2OA 3E0FA 3W28A 1BTMA 3DK9A 1QNSA 3UGVA 1DJNA 3GTIA 1JDEA 3GBDA 1F3XA 2AL2B 2PDHA 5HR7A 4KQNA 4AVNA 1AA1B 1EJXC 1RUSA 3QF0A 1ZP3A 3C8NA 3B9JB 3TUUA 3OZPA 1VIZA 1HT6A 3KBNA 4OGZA 3WFLA 4LUSB 5G4EA 2ZRVA 2JQXA 1G0CA 4PB4A 2DVTA 2V5LA 2Z28A 5EPDA 4IFKA 1N8IA 1Z42A 2WXDM 5FJRA 3WEZA 1WOBA 1UA7A 4CU6A 1PL9A 3ERPA 4LEQA 2E5CA 3GSMA 1ZMCA 1X97A 3UG8A 1LWIA 3FHAA 5EGRA 3ISIX 2JE8A 1JQVA 3UG4A 3CHEA 1J9YA 4KFOA 3Q45A 2XSBA 1TPUA 4P2VA 3CQHA 3KVKA 4WOQA 3B8UA 2CHRA 3WD0A 2I5QA 4RJEA 4AVOA 3TYAA 2HVNA 1XYCA 3RDKA 4NIRA 4H1ZA 1R87A 3GO2A 4O1CA 3NL2A 1QR7A 1XXXA 4MTVA 1UIOA 3DXIA 1H5VA 3E9AA 3NOYA 1B3YA 3WF2A 1CDGA 4DI9A 1W31A 4LSBA 2PCEA 2ZC8A 3F4NA 2WVUA 4UTFA 1RCOB 2NX1A 4NUWA 2QCMA 3YPIA 1SJAA 1UKQA 1V0LA 1MW0A 4QJ1A 1KKOA 4H2HA 4IMEA 4H4PA 5F4XA 3VDCA 2DH3A 1R3WA 1OSEA 4RNIA 5DBTA 3I4KA 1ZCCA 2QCDA 3WH8A 1GREA 3MDUA 3WQPA 2GR3A 1C93A 4GA8A 1X2HA 4DBWA 1LBFA 3W76A 1O66A 2QT3A 3C2VA 4QG6A 2ZQ0A 5BOOA 3ZWTA 3D9XA 1JROA 3AU6A 1S5NA 4HHHA 1CIUA 5E6YA 5BXSA 4K68A 4CD4A 1TPWA 3ME3A 2E7FA 4H04A 3AYRA 1UIPA 4A05A 3GS6A 3P80A 4MY8A 2C1IA 3ONBA 2J3NA 4G5DA 1EH9A 4IG2A 1GPWA 4K6AA 3WL0A 1QK0A 3NQMA 1SZGA 4H4QA 4DBSA 2E6FA 4NU7A 1UR4A 5T91A 2ALDA 4AXNA 4PSPA 1NARA 1NPXA 1QNRA 1ZAHA 2A3EA 2FFCA 3RRAA 4EPKA 1QI0A 3I3BA 4K37A 1L6WA 4L9ZA 1ENUA 1FVPA 1U5HA 1HG3A 4PA8A 3HRDC 2UZ9A 4LRTA 1EJTC 3MB9A 3RG6A 2F9RA 2Y1HA 4RNHA 2BXZA 4NZ5A 3F4DA 3A7RA 1EYEA 3FN9A 1XICA 4UFIA 2VTFA 4ZQCA 1JDFA 1EIXA 4UFHA 1FO4A 1VKFA 2X8GA 3QPYA 2WCAA 1FWNA 1K9DA 1MO0A 3CQ0A 1F5ZA 1YNQA 2CCRA 3VNJA 1CBGA 1H1NA 1VFUA 1UZDA 2OVLA 3HGOA 3WNMA 2MANA 4NHVA 6TAAA 1JCMP 5JXQA 4TVDA 4HKPA 1ZPTA 2QIWA 2Q3OA 4GIRA 3SGGA 4YXGA 5BW6A 3QW4B 3TE9A 4HBKA 1KFKA 4O8RA 3TYCA 4AD3A 3EOSA 1IT7A 2OZ8A 4ZA0A 5C2XA 2ZZ1A 4DBUA 3MUZ1 2YCEA 4AISA 2WSRA 4W8LA 3R07C 1WZLA 3HU7A 4AFYA 4DAFA 4FNUA 3A7AA 2EJ1A 5GJPA 2IKHA 1HL8A 3B9DA 4PTMA 2BY0A 1PKNA 4HSHA 1WBJA 1Q6CA 4RDVA 4K8DA 1E6XM 3O63A 1C8VA 1B9BA 3CMJA 2XFRA 2QF7A 4MY9A 5A3HA 3SAZA 1QFEA 4G9PA 4C6DA 3O05A 4JTSA 1XDMA 1PWLA 4AIBA 2XTKA 3O6AA 4QX4A 2MNRA 3IRSA 2FTWA 2O92A 1EJ7L 1R6WA 5I3DA 5EY5A 3P0XA 3SZ8A 1LPFA 1Z8AA 4F2UA 4FEZA 5HDRA 3NNTA 4EQRA 2YA1A 2YCLB 2ISFA 4JHZA 5AYXA 3W1XA 2VEMA 4X2PA 4BURA 1O68A 4YTQA 2W3RA 1I4NA 4I9TA 1AD4A 1SW7A 2PBOA 4UFKA 1A50A 2XH7A 1E6PA 2YFNA 3PTKA 2VOTA 1XDLA 1HVXA 4PODA 1H62A 1K7EA 2O0TA 4RDZA 2OTDA 4C6JA 2OYKA 4HHLA 1KQYA 4E3TA 1N5XA 1MQQA 1ZAIA 2J27A 2QHAA 1T7LA 2WZEA 3OBAA 1KFJA 1WV2A 3QC3A 4DM1A 3KBWA 4GO9A 4XZLX 1F2JA 2ASHA 3AISA 4JTQA 2P0OA 3DK4A 3LHVA 4E4FA 2D2GA 4PTDA 3NZQA 3PBWA 3MSRA 4LVGA 1NH6A 4DO4A 3C2EA 3PM6A 4IXHA 4OUIA 1UB3A 5BRPA 1JPIA 1VZWA 4OV9A 1FCUA 3W1LA 3K1GA 3WQDA 4O4WA 3WDQA 4XKMA 3EDJA 3B9NA 3SIZA 1IEVA 4H6RA 1QNPA 1VHCA 5CPLA 4MWAA 1J96A 5L6UA 5A8NA 1H2JA 2VOMA 4HIBA 2P3ZA 4A21A 3TR9A 4MKNA 1G5AA 4RNFA 2VCBA 4US5A 5LHFA 1HKIA 3IUDA 4H00A 4YVXA 1FWDC 3VIHA 1KGXA 3M4HA 3ZT6A 4MNKA 4MPKA 4IPPA 4LVAA 3NEHA 1Q45A 1E70M 1V3IA 3MV11 4TOQA 4BF7A 1JR1A 2V5CA 3H4GA 5JBDA 5EU9A 3FDKA 3CEPA 4ZOEA 1DWAM 1WE5A 1M01A 3LCFA 3URBA 1E6ZA 4UQAA 1BWKA 1JDAA 3SR6B 3B0UX 4MIMA 5I02A 1L6SA 4TXEA 1TA3A 1AW2A 3GK0A 1XIFA 4N42A 2PWUA 4LVDA 1XDIA 4D1IA 5EMKA 4ZBCA 2NQZA 2FH8A 2Y7GA 1ONFA 4W8AA 2GPTA 4DJEA 1DHPA 1UD3A 1F74A 3UY8A 4MADA 2WHLA 3SN0A 3I6TA 4DLFA 3TDFA 2OLAA 1GGOA 3EXRA 4P61A 5D03A 1KM4A 1JCNA 2NPXA 3CH9A 1YDYA 4JNMA 2HE5A 4Q8PA 2WNQA 2NLIA 3HPZA 1ZK7A 3KBVA 3E2SA 4H6KA 1TTPA 3ANYA 3LDVA 5J04A 1C7TA 4Y9NA 1BHGA 5LNVA 4CGTA 2BGQA 3NQBA 4W86A 1TZ9A 3NFUA 2VURA 3QZAA 4JTGA 1AOGA 2QVHA 3W2MA 4MHBA 5ER0A 4L80A 1EB3A 3IC9A 5FL0A 2PTDA 4Q8NA 1E71M 4I5UA 1TIMA 3QY7A 2OT1A 5BXRA 1J0KA 3VA8A 3B0VC 2X99A 3A4JA 1TV3A 4AEFA 1HIZA 4NJIA 5KEZA 2Z29A 3PG8A 1OVDA 2GQ9A 1W3NA 1W3KA 3QGKC 3TZFA 2HS8A 5M17A 4LV9A 4RUBA 2BDQA 3GBEA 3TIMA 3UNDA 1FHUA 2NXHA 3CUFA 4GZJA 4HU0A 1NDWA 3PTMA 3DHUA 3QW3A 3FA5A 5FS9A 1RK5A 4YYFA 1RSCA 2IPWA 4O0ZA 4KRTA 5CGQA 4POCA 1U1UA 1D3CA 2YR1A 3MTWA 2UY5A 1W54A 1XSKA 4URIA 3CGBA 3VX0A 2FTPA 4BKNA 2ZXQA 4H7CA 2XZ9A 3N6JA 4JTDA 4S3JA 3EXTA 3R43A 2NUWA 4V33A 2QUMA 3D0CA 5G5HB 3VD9A 4GKLA 4FI4A 3ID7A 3LQGA 1ADOA 4FR6A 2YXOA 4REQA 2WHMA 3ZVIA 3MI3A 3BL3A 5JVLA 3U8GA 5BMXA 1GG1A 1VH7A 2OOFA 2W3SA 2A79A 2Z0IA 3AIWA 4J3XA 5JH1A 1GJPA 1CGTA 4XAYA 1ZBWA 1Z69A 4OBSA 2NX3A 3HPFA 2HWGA 4LBSA 3R94A 1E6QM 1X7FA 3SQLA 4G7FA 2PS2A 2F5ZA 4PMNA 3PPFA 1AD1A 6XIAA 4F66A 1KM5A 3GY1A 1NWTA 2ZE3A 3NVDA 3N29A 4DZAA 1V77A 1VEPA 2Y7DA 3T9PA 3II4A 2OZTA 1SU5A 3IPWA 3GUGA 3B40A 3TR2A 2PLMA 4U3CA 3T0DA 3VUSA 1F76A 1IWAA 3ZLGA 1XIEA 3PZOA 2G41A 3QPEA 3RU8X 4GZEA 4C6BA 1PHWA 2VGGA 3NVZB 5BWAA 3E02A 1CLVA 1L6GA 1H3GA 5E9XA 2HK0A 2D2JA 1G1YA 3C56A 2POZA 3H2EA 2PWFA 1H2IA 3EBVA 3W2LA 2R24A 3KZSA 5F7UA 1HO4A 1H11A 1EDQA 1I2NA 3ARXA 1EF3A 1Z7AA 1T96A 2YYTA 4WXZA 3FAXA 3ZM8A 1MFVA 4Q4SA 4YIWA 1VCGA 1QO5A 3CZLA 2ZZ7A 3LRLA 3A9BA 3L7RA 4GC4A 3T05A 3UWZA 3CZGA 1JFXA 3ABZA 1IE7C 5AHEA 4H7ZA 5I3IA 3E0LA 3NQCA 1HL2A 4GPNA 3CB8A 4JIQA 1G6CA 4FX6M 5ABFA 5I24A 2IKIA 3G0SA 4BHYA 4V2XA 5C55A 2GR1A 1GHRA 1J6PA 2PP1A 4OVXA 4Q6XA 3SM0A 4Q4KA 3M44A 4U4MA 2FJUB 4TIMA 4R9OA 3S6DA 4ICMA 5FESA 2V8ZA 3LCLA 1BFNA 3R0UA 2XU2A 1X6UA 1KM6A 3ARTA 2J7BA 4CQBA 2PB1A 1HJVA 4KWUA 1RA5A 3N11A 4DUVA 1EEXA 2FZ8A 4INFA 3L4TA 1EWEA 3UR8A 3VGFA 3ELFA 2XG9A 3CM4A 3C8FA 1E6RA 3AZTA 2J88A 1XKYA 1FWFC 3G24A 1XANA 1UKSA 2V5KA 4WUIA 4Q8MA 3LS9A 5G5GB 1ZCOA 3VDHA 4J2MA 3TQKA 3MP5A 4E3VA 1J5TA 1WXYA 2VMFA 4LAMA 3OLIA 4HZ6A 4ADWA 1SMDA 5E70A 3WDRA 4LW7A 1OF6A 4M6PA 5DRCA 2CERA 2J7GA 3K4AA 5A8MA 3TKFA 2WBKA 3GAYA 4YS1A 3SCSA 2RH9A 1DEDA 1YYAA 2XIQA 3BPWA 1PHQA 1NFGA 1LDCA 2QCFA 4LGXA 3WELA 1RQBA 2FB2A 4R27A 4PUJA 2V2DA 2RFGA 1VCFA 4UR7A 1R3VA 4AWUA 3P6LA 3MP3A 4ICNA 3MYPA 2PDYA 4N02A 3H70A 4JTFA 1TV2A 4IGMA 3GD6A 1WX0A 1UP0A 4KEZA 4Y8EA 2VFHA 2IPJA 4LCQA 4UFMA 4J9JA 4R34A 4AMAA 3N4EA 4LH8A 2QS8A 3I65A 3WY1A 3GRTA 2BGNE 4C60A 3VOCA 4C1NA 2CLIA 4UBPC 4H9TA 5CSUA 1PKMA 3BZGA 3LSBA 5KMYA 2H8ZA 1EHAA 3B0XA 1UR1A 2TRSA 1W6TA 3IJ8A 3II1A 2PDUA 1OABA 2CZVA 4BI7A 3WNPA 4HZ7A 1T99A 1B3OA 1I60A 4J27A 3PZNA 1JOAA 1NP2A 3H22A 3LXCA 2NVAA 4MB5A 3WUFA 1NEYA 1E43A 1OHLA 2WKLA 2EHHA 1Z89A 1ZU8A 2PGEA 2GR0A 4K1GA 3L4ZA 2OXNA 1RA0A 1P48A 1F3WA 3VAVA 3W07A 5LNSA 1TG7A 1ADSA 3DBNA 1H0IA 3DG7A 4CNSA 3MV01 3B05A 3W7IA 1ISVA 1DVJA 1W1B1 1QOQA 5FS6A 3W7HA 3EOOA 4L6DA 1GETA 1PVNA 3RILA 2GVEA 1SM9A 1PIGA 2ZADA 1NDAA 1VLWA 2XFYA 9XIMA 1TWZA 2V0TA 3PF3A 1VYRA 2Y8VA 3NL3A 3WK2A 1D9EA 5DY2A 3U2CA 1PV8A 4WDWA 5C8BB 3PUDA 2PD5A 3WF0A 4M1RA 3WMLA 4B4HA 3LUTA 4R88A 4BA0A 1LRNA 2X7VA 4PULA 3CL6A 3ARVA 1EJWC 2DGAA 1R9YA 3HG4A 1U33A 4D6FA 3TC3A 1LQ2A 1XCXA 1I2QA 3GIQA 2EPKX 4G7EB 1OGSA 1GNXA 3GLCA 2FGLA 2Y88A 1XRSA 1C29A 2B31A 1UOKA 1QI2A 5DQPA 1AMYA 1WUEA 3MZ2A 1K7XA 1GKRA 1QHZA 3NZ1A 1W9PA 2VP8A 3B06A 4MY1A 5L9FA 4Y9MA 4H8VA 4XBSA 3T0TA 1XLHA 4DF1A 1VFMA 3S5SA 2WNWA 3P2VA 1UC5A 3BCFA 2VRJA 1Q6EA 2OWCA 1GJWA 3B3DA 1SO4A 3NM1A 4NAFB 1K03A 1JDCA 4LUTB 4IOTA 1R2RA 1Q3NA 2CKSA 2QAFA 3DAQA 4DM2A 4FALA 1TV5A 3EKLA 1NOUA 1S5VA 4GGHA 3AHXA 2NV9A 4DJFA 3U48A 1VBUA 4RCXA 4CLMA 1X98A 1FHLA 3VIMA 3N12A 3A47A 5M03A 1VBGA 4A2SA 4MKVA 5C71A 1M7JA 2A6NA 3B9EA 4GRTA 3P81A 3POCA 1UPMB 4C6IA 5CC5A 1UR9A 2GVJA 4PCPA 1IWPA 4J40A 3L4VA 1V3MA 5BRQA 3MCOA 2C0AA 1D8CA 4LYPA 4RV3A 1BEUA 1EC7A 3KLKA 4HZ8A 1FQ0A 4OECA 4CD5A 3BMVA 2VM8A 3UT0A 4DQWA 1O94A 2ABBA 3WL1A 4KETA 3O0FA 4MAZA 4I9MA 3CZEA 4JKLA 3NR0A 1TKKA 3TOYA 1FP9A 3HB9A 1ME7A 4AW7A 4ZTYA 2Z4GA 1P7TA 4ZB5A 3IVUA 3W26A 1FWJC 3AIVA 1QATA 1M7OA 4M7SA 5FF0A 5FSDC 1F8IA 4Q7NA 2NXGA 3QFAA 3NDYA 2PEVA 4P8XA 3WQGA 1WXZA 5G2HA 2NQ5A 3P74A 4Z2HA 3NYDA 2QUNA 2QDEA 3LOTA 4PUDA 1VPQA 3IRDA 4ZL1A 1BPLB 4MFDA 3TA9A 5I03A 3GNPA 4BI5A 3FW6A 4XVDA 1WO2A 2PURA 4GIEA 5GNYA 4D9PA 3BLFA 1ZKQA 1GXFA 1JZ8A 1S1RA 2QCHA 4LF2A 1HNYA 3C3NA 1P0BA 2YLLA 4F2BA 2V30A 3U7VA 2DSZA 4CVWA 3ZOAA 3UP8A 2GQWA 4EPEC 1E1FA 3KTXA 2D0FA 5CPSA 3PY2A 1FWTA 5M2FX 4MJ4A 3CXOA 3OZMA 1MZHA 1M3UA 4Z1DA 3W1UA 1HJXA 3N2XA 1R2TA 1VBRA 2ATMA 4AYSA 1DJZA 1EO5A 4JS3A 2J7CA 3HMCA 1PIIA 4M51A 4LBRA 3CLWA 4IFKB 1OX4A 4XZBA 3L8KA 1A5KC 2V3AA 4FO4A 3U9IA 3NPWA 4MVAA 1G7VA 2J66A 4NJGA 3S2CA 1V3HA 3W00A 5BMWA 5AC6A 1O12A 1EDGA 2X40A 2O9TA 3C5QA 4PUEA 1ZHAA 4WJEA 2W27A 4I90A 3FOKA 4IMFA 1KLZA 5E0FA 4M0XA 3WLIA 4RPQA 4P8WA 1V6XA 3W24A 3UA4A 4K39A 1AQFA 1NFPA 3BW4A 4U33A 4XAZA 3AC0A 3SCUA 3KBMA 2HBVA 3S1WA 4V1YA 5M5DA 2VZTA 1GZJA 4ZO8A 1TX0A 1A47A 5BU9A 3JUGA 5EBAA 3ABQA 2YCKX 3GTNA 3WLQA 1D3GA 4EIVA 5TD4A 1DIKA 2PDIA 5HXMA 1S2UA 1JFHA 4QEEA 2A7RA 8CGTA 2DSWA 2FGBA 1JI1A 1VJIA 3A5VA 4OWGA 4Y9PA 4PL2A 3VINA 1HJQA 2O9RA 3WKZA 1BTCA 1A3WA 3VOHA 4EACA 7ENLA 3WK1A 4MDPA 4PSRA 4V27A 2ZC1A 4IUOA 1EX5A 3PR2A 1HF6A 3TLQA 3W7GA 4LT9A 2BOGX 1N61C 3N4AA 4FPSA 4J3VA 1YLVA 4AX7A 2QCDB 1AL7A 1PZ3A 1ELSA 2J9ZA 3W73A 1KXQA 1F3PA 1OCBA 2E4TA 2OYLA 1DL3A 1W56A 4LPCA 4J3UA 1H7XA 4XQ6A 2CHNA 4FXFA 4QSFA 1R9ZA 5CJ5A 2WKGA 4TX8A 1GQKA 1U5VA 4ICCX 4GO8A 3R8HA 1A5AA 4L65A 3TJIA 1MMFA 3RYSA 3MMWA 2HPMA 4OIFA 4L1GA 3MT1A 2PTXA 4H9VA 2E8ZA 1MDLA 4IG2B 1IEQA 2PLJA 1K8XA 1JVNA 3GFYA 3DJJA 2F2KA 2PCQA 1V93A 3MYOA 5D32A 3TZNA 4LEFA 1AMKA 4NNCA 3LM3A 7TIMA 4YN5A 1QDSA 2GOKA 1RR2A 3U2OA 4IX0A 4YYCA 3LXDA 1LOLA 5LXXA 2B7OA 2QEZA 4KWVA 3EX1A 4DXKA 3VD5A 3G1SA 2JKEA 2EAWA 3LZ3A 3EWWA 1OFOA 5FA5A 2V3EA 3CYJA 2OKOA 3WLHA 1RBAA 3R79A 1UPPA 4R7JA 3R0DA 3QOKA 1E0TA 1KLYA 1WAUA 2YL9A 4D1JA 1PDZA 2HSAA 1E5JA 3DCPA 2DDXA 3R6IA 4E0CA 3RXZA 4LX4A 3M5YA 4UNIA 5IDIA 3DERA 1QOXA 4WDUA 3DFPA 1FUYA 4ERIA 4I6VA 3GNXA 4JIIX 1J2WA 4ZXOA 1GEHA 5H2ZA 2Y8UA 2EG8A 2Z2UA 1ZBCA 2VFFA 2ISVA 4B15A 3TAOA 2VWSA 2VZOA 5D04C 1HQTA 5HR6A 1DIDA 2BVYA 3EEZA 2QKFA 2NUYA 4LV4A 5GJNA 4NI8A 4UTWC 2OT0A 4O28A 1QASA 4IIHA 5DFAA 3LY0A 4KW2A 2CLMA 4F0LA 4GUHA 1MW3A 1HKMA 3VNZA 4XISA 3LCHA 4TO8A 3GTHA 5K7JA 3KFTA 4HT3A 3QR1A 1VFSA 4EMIA 3R2GA 2B81A 4O1DA 1LL6A 1NHSA 1Q4WA 3ZVHA 3OZOA 4P7RA 4CVUA 4UR9A 3VOGA 3FK4A 1JD7A 4HPGA 5JH2A 4UTIA 2DVXA 1XRFA 3S1VA 1V0KA 1KWKA 1TREA 1ITQA 3AIUA 1VFFA 1DKWA 3UQNA 3VNMA 3BSGA 3B03A 2GVYA 5AN7A 2F8QA 5SWUA 3DI0A 3UF9A 3RJYA 4JBRA 3R58A 1EQCA 4C6FA 3QV6A 1W3IA 4KEVA 4H4VA 1EDTA 1AODA 4QIUA 4IPNB 3RX2A 3Q65A 3GB6A 4K7YA 3CC1A 2XINA 4Q32A 1UCWA 1YNPA 4V1XA 4CQ8A 4PMXA 3MBFA 3PJTA 2UY3A 1JXJA 1VFOA 3UR2A 4HNCA 4O18A 1FKXA 2RAGA 3WZ0E 3EOLA 2QUVA 2HTMA 3E38A 4A3QA 2D2HA 3AYTA 3N2MA 3F1QA 3STFA 4XZIA 1GRBA 1M04A 4GABA 5C9WA 4H41A 2P88A 4M29A 3M0XA 4JEJA 3PZIA 1TUFA 3URAA 2NQLA 4ZO6A 5CSRA 3PS7A 4YTTA 1K02A 3FEQA 3V36A 5HOSA 4DXXA 3EWDA 1ITUA 3GZ3A 4CN4A 1QCWA 3THUA 1AFSA 4MWAB 3SRHA 3LHWA 3WBWA 1AQ0A 2X05A 4H9UA 4H6EA 2ZWZA 3OTRA 1OT1A 3LYEA 3UCCA 2VJXA 1GW9A 3KOYA 1KCXA 4AZGA 1PS9A 4JCLA 4U10A 5LA2A 3KRZA 1ZAJA 4L5ZA 4CEXC 4IIGA 3VVGA 2P0IA 4QDMA 3SQMA 3HURA 1W1TA 1AVAA 1KKRA 4DYEA 3W2JA 1PAMA 5JCMA 3EMCA 2D3NA 1H61A 3M0YA 3TW9A 3WEOA 4N9EA 1N5WC 2X2YA 5LIYX 5FEPA 4G2DA 1PXGA 4LA1A 1D8WA 1CB7B 3EOUA 1O5XA 1SZNA 1A80A 2ZZ5A 1XJBA 4EOUA 1BAGA 1ONWA 3W7NA 3GXFA 4LU0A 1VDVA 3BUVA 2EKGA 3B8WA 2V3DA 1D2KA 4S1FA 2GSJA 1JNEA 4HCDA 1YX1A 3QM3A 4DAIA 2J7HA 3V0SA 2VEPA 3VMNA 4BK9A 2Y70A 1TA3B 4UR8A 2G3JA 1CXEA 4XVEA 1DE6A 3PTDA 2JEPA 1STZA 3UZZA 1UBSA 1CYGA 5DBUA 1CZ1A 4BQ5A 3VD4A 4S3EA 4FP1A 1E72M 2DZVA 1GQNA 2W91A 5CZJA 2RABA 2HPIA 3W7PA 3APGA 2Y62A 3WNOA 2D20A 4NZFA 2I7GA 5CC7A 5FEZA 2ZRWA 3RGTA 2R6OA 5K9XA 1MUMA 1RAKA 4OBTA 1R8LA 3BV4A 2XIJA 2Z1BA 1EBGA 1CXKA 4PMRA 1DORA 3DGZA 3C2OA 3BANA 2RDUA 4PTVA 3EDFA 2EO7A 4M56A 3WQ4A 1U22A 3E1F1 2V68A 1HN1A 1KTNA 1Z6KA 1N82A 3WO8A 1RVGA 2EQ8A 2RHGA 1JQXA 3WF4A 4Q7IA 1UUMA 4M80A 3JRKA 5HMSA 3ITYA 3SY5A 2HMCA 2ISSA 4IJRA 4OOUA 3CHFA 3HPSA 4QCFA 2OU4A 3LV5A 5FS8A 5HPOA 3E2VA 3UZ5A 3EX3A 4H9MA 3KCLA 4ZO9A 4YHGA 4FX9A 3MA8A 5CEWA 2R1MA 4QXIA 2OJPA 3CIVA 4DELA 1Y8BA 2GSEA 3L2IA 1K8CA 3H12A 5GRTA 1B4KA 3PVFA 2ZZ6A 4C6LA 3DFHA 2Y85A 5E09A 3OVRA 4BWLC 2VCCA 2PWGA 4LBUA 3EOEA 2ZTJA 1GRTA 1XLFA 1L2UA 2O7QA 4JDRA 3LGDA 1XF0A 5HJYA 3ETRB 2QJJA 2Y61A 1W8GA 1HXJA 3TU9A 4UB9A 2VQUA 1U30A 3HQPA 3ZO9A 1S5TA 3BAYA 3TN6A 2XN0A 5AYYA