3I6EA

Crystal structure of muconate lactonizing enzyme from ruegeria pomeroyi.
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
370
structure length
356
Chain Sequence
LEQKIIAMDLWHLALPVCEIVVLRLVAEGGAEGFGEASPWAVFTGTPEASYAALDRYLRPLVIGRRVGDRVAIMDEAARAVAHCTEAKAALDSALLDLAGRISNLPVWALLGGKCRDTIPLSCSIANPDFDADIALMERLRADGVGLIKLKTGFRDHAFDIMRLELIARDFPEFRVRVDYNQGLEIDEAVPRVLDVAQFQPDFIEQPVRAHHFELMARLRGLTDVPLLADESVYGPEDMVRAAHEGICDGVSIKIMKSGGLTRAQTVARIAAAHGLMAYGGDMFEAGLAHLAGTHMIAATPEITLGCEFYQASYFLNEDILETPFRVEAGQVIVPDGPGLGARADPEKLEHYAVRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Muconate cycloisomerase I
publication title Crystal structure of muconate lactonizing enzyme from Ruegeria pomeroyi.
rcsb
source organism Ruegeria pomeroyi
molecule tags Isomerase
total genus 126
structure length 356
sequence length 370
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 5.5.1.1: Muconate cycloisomerase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3i6eA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3i6eA01
4K8GA 1L8PA 3CB3A 1TE6A 2AL1A 4DX3A 4E8GA 3CYJA 3S47A 1PDYA 2AKMA 2POZA 3I6TA 2QJJA 4MGGA 2XH7A 3IJQA 2QDDA 1TZZA 3H7VA 3QN3A 1EBGA 5FJRA 2PSNA 3ZVIA 2MNRA 2HXTA 4A6GA 3R0UA 1SJDA 3DFYA 1F9CA 3ZLHA 3DG3A 3RRAA 2PTZA 3ZLFA 3H70A 3NFUA 3H12A 2MUCA 2P88A 2RDXA 4E6MA 3MQTA 2PTXA 5ENLA 3IJIA 4M6UA 3OZMA 4DXKA 1WUEA 2XSXA 4Z17A 3OP2A 3KUMA 2QJNA 3R0KA 3N4EA 3UGVA 1KCZA 3MKCA 2PODA 3FVDA 4MKSA 3TCSA 4GGBA 3T9PA 3MWCA 3VCCA 2CHRA 2PP1A 3VC6A 1YEYA 4IL0A 4IZGA 4HNCA 4YWSA 1SJBA 3SN4A 3K1GA 4X2PA 4DYEA 1ONEA 2HXUA 2AKZA 1KKOA 2HZGA 4GGHA 4JN7A 1NELA 3CK5A 1FHVA 4H2HA 3VA8A 3PWIA 4JHMA 4E4FA 3OTRA 3DG6A 1P48A 3HPFA 3MY9A 2FKPA 3GC2A 4A35A 3PK7A 3R10A 3ZVHB 2GGHA 3T6CA 2HNEA 3DGBA 3SSZA 2NQLA 1EC8A 3P3BA 4K1WA 1ELSA 4KWSA 2OVLA 3SJNA 3UCCA 3MUCA 4DWDA 4FI4A 2ONEA 1R0MA 5BOEA 1KD0A 3R1ZA 3STPA 3VDGA 2PTWA 3ENLA 4GYPC 2DW6A 3EEZA 3ES7A 3OZYA 3S5SA 3THUA 2P8CA 3MSYA 3N6HA 4KPLA 2OG9A 3IJLA 3DG7A 2GGJA 2PGEA 1BQGA 3VC5A 3FCPA 4GFIA 3BOXA 3DERA 1IYXA 2QJMA 4G8TA 2GGIA 2PU1A 3RO6A 4K2SA 1NU5A 4GIRA 4E4UA 5FJPA 1R6WA 1DTNA 3N6JA 4DHGA 2GSHA 2PA6A 4F4RA 2QVHA 1ECQA 4HPNA 1SJCA 3NXLA 4H83A 2OO6A 1FHUA 3V5FA 3GY1A 1MUCA 1SJAA 2PPGA 3DIPA 1XS2A 2FYMA 4G7FA 2I5QA 2PGWA 3UJRA 2QDEA 3SBFA 3V3WA 3BSMA 1P43A 2OPJA 3DESA 1JPMA 1XPYA 2OQHA 2AL2B 2XH2A 3TW9A 5IDZA 2AL2A 1EBHA 3OW1A 1OEPA 3QLDA 4J1OA 2GGGA 2QGYA 3IK4A 3PFRA 1W6TA 3V4BA 3VFCA 4KEMA 2GDQA 3GO2A 4DN1A 2PMQA 3PWGA 3R11A 3EKGA 3UJSA 1EC7A 3GD6A 5J04A 3BJSA 2PCEA 3TQPA 4H1ZA 3TJIA 1WUFA 3H8AA 3ES8A 4GMEA 2OZ8A 3P0WA 4Z1YA 4FP1A 4IP5A 1KKRA 1MNSA 2OFJA 3R25A 4HNLA 3CT2A 2PP0A 3Q4DA 1MDRA 3QTPA 4IT1A 2DW7A 1RVKA 3N4FA 3RITA 4ZCWA 4HCHA 3D47A 4GYPA 2P0IA 3U9IA 3T4WA 4MMWA 3MZNA 2ZC8A 1JDFA 3TTEA 2PS2A 3NZGA 1JCTA 3V5CA 2PP3A 2GL5A 6ENLA 4E5TA 7ENLA 2ZADA 4GISA 2O56A 3SQSA 3I4KA 3RCYA 3P93A 3ZVHA 3JVAA 4M0XA 3OPSA 4ENLA 4H19A 4IHCA 3T8QA 2P3ZA 4JN8A 2PTYA 2XH0A 1TKKA 2XH4A 3SN0A 3FXGA 3NO1A 3DFHA 3QPEA 3DDMA 2XGZA 2OKTA 3QKEA 4J3ZA 4HN8A 3RGTA 2OZ3A 3DEQA 3I6EA 5FJTA 1EC9A 3FV9A 5BOFA 3TWAA 5EU9A 3VCNA 2OX4A 3CXOA 3JZUA 3UXLA 3UJFA 4KT2A 1E9IA 3UJ2A 3UCDA 4IP4A 3RR1A 1JPDX 3TJ4A 2OLAA 2OQYA 3FJ4A 3CAWA 3Q45A 3TWBA 1PDZA 1BKHA 3B97A 2GGEA 5FJUA 4ROPA 4ZA0A 4HYRA 2QQ6A 5FJOA 4HCLA 3D46A 3SN1A 3ZLGA 2PU0A 3FYYA 1MDLA 4IL2A 3TOYA 1MRAA 3UJEA 2P8BA 3U4FA 3JW7A 4A3RA 4EWJA 3UXKA 2OZTA 4HCDA
chains in the Genus database with same CATH superfamily
1TE6A 2AL1A 3GXPA 1CLVA 4H8VA 1BF6A 3S9YA 2H8XA 1GYMA 1D7FA 3QTGA 3ANUA 4GZJA 3FJNA 4XK2A 2QDDA 1RZMA 1QI3A 3HZ3A 2DH2A 3CQHA 4IH3A 4OECA 4XZ9A 4YN5A 4HTBA 1GVRA 4M3PA 2JF7A 5A8OA 3WLKX 3ABZA 1U2YA 1YTDA 3WLQA 4GQGA 1X6NA 2YGYA 4E2OA 4WDUA 4D71A 1E6PA 2IQTA 2MUCA 2H3BA 1JCYA 5TD4A 3WUFA 1UP3A 2A21A 2V69A 1E1EA 1V77A 3W53A 4DWSD 3PG9A 5M17A 1I75A 4DWSA 3UWUA 2FZMA 4G5DA 4EXBA 4JEQA 1JZ6A 3WQWA 1Q2RA 3G1SA 4HHHA 2FHFA 3L7RA 5CJMA 1UUQA 1B4KA 1ENUA 3YPIA 2C7FA 2CHRA 1SW3A 1P0DA 3WL0A 3K4AA 4XVDA 3RU8X 2HXUA 2PDKA 1WA3A 4DLFA 1H2IA 3CL8A 4MKVA 5JH2A 2O9RA 4JXCA 1XANA 4JTGA 2O4MA 1PAMA 4E2BA 3EDEA 3WF1A 2XISA 2FFCA 2BVTA 3KTCA 4A35A 3DGHA 4B5UA 1WYGA 3QGAC 2EHHA 2DT1A 4D6HA 1ELSA 1NHSA 4GQBA 3EDFA 4S2BA 1XLHA 1XL9A 4JTTA 3QXBA 1P1MA 2J7DA 4GZ7A 4AG0A 4PB5A 2ONEA 1S1RA 4LVAA 2WMKA 1CT5A 4JOMA 3VDGA 4UXDA 1PKMA 3IVSA 2OOFA 4GC4A 2PTWA 3NQ2A 1PXGA 4C91A 3FA3A 1KW1A 2DW6A 3RG6A 2GSJA 2OQLA 2C1HA 2P8CA 4DUWA 2B0MA 2YQUA 2PWVA 1A5CA 4J27A 3W26A 3NZPA 3QW4B 3LERA 3I7RA 5REQB 4UQCA 2PGEA 4L6HA 2I14A 1AJZA 3N2BA 1XIMA 1BQGA 3GR7A 2FTWA 5CC3A 3GNRA 2EEXA 5H6HA 4DLMA 2YBVA 4PMOA 2C8NA 4ACZB 1VEMA 1L0PA 4O12A 4AXKA 3A21A 1P0KA 2QVHA 3BC9A 5CQ1A 1KC7A 1EIXA 3IUDA 3A9IA 4ZFCA 3N73A 3GY1A 3H2AA 2NQJA 1EUNA 3A4WA 4DBDA 2HVOA 1JCLA 1C9DA 4QSHA 4DZHA 3PZGA 3V3WA 3NZ1A 4TV5A 3VNIA 4DIAA 1JF6A 3WQFA 3ZWTA 4HKPA 3AQUA 4HYVA 3FVMA 5CZKA 4PB3A 4UMBA 3QLDA 3L5LA 1OFDA 3T42A 4H6RA 4J1OA 4W5ZA 2XFRA 1WKEA 2QCDB 3EBVA 3R12A 1PB0A 2FFIA 3MHGA 2FMNA 1JJKA 2GUBA 3DK8A 4RE0A 3GVGA 3VGDA 4GINA 1DIKA 1P0EA 2HQMA 3C3UA 3UR2A 2TPRA 4GWEA 2GK1A 1QOXA 3EKGA 5CPQA 1EC7A 2FPVA 1XIDA 5J04A 2AOSA 4IPPA 4MWAD 1FUYA 5A6MA 3P0WA 2LLEA 4FP1A 1KXTA 1QHPA 4UOJA 4YXGA 1Z3NA 2PGRA 3SB0A 3RPMA 4MSSA 4UCGA 4W89A 3KS6A 1MW3A 4H4VA 2RH9A 4PCSA 5IRPA 1MZHA 3LGDA 3VGGA 4ZCWA 4HCHA 2XIBA 3QY6A 5D4YA 1ZK7A 5EMMA 3L2MA 3SDOA 3AHVA 1V7AA 2OXNA 5CZJA 4C1LA 5K9XA 3B0UX 1UZ4A 3BG9A 3T08A 1J10A 1UPMB 4IPLA 2CPUA 4JIPA 4IQEA 1DXIA 3L2IA 1J01A 3VK5A 7CGTA 3GFZA 4JKKA 3OGRA 4Q4PA 4AWSA 1PUDA 1LQ0A 2ZDRA 3CUXA 5J8LA 3I68A 3RX3A 2OWCA 4XO6A 1G4TA 3ITTA 5GVJA 4R85A 1BYCA 2OWWA 2ZUSA 3G8RA 3VPLA 2WMIB 1GV4A 3NQDA 3VIGA 1A53A 4V1XA 3WL1A 4GY7A 1H3GA 1O5QA 4XUGA 1H51A 2ZDSA 3STEA 4IWWA 5D09A 3EMZA 3VKCA 2G97A 2WNWA 4OBTA 3F7JA 4L1XA 1GUVA 3RLVA 2X1UA 4J3ZA 4AZ5A 1HJVA 2ISSA 4QTGA 3VOGA 3NA8A 1H11A 3FJ6A 2W61A 3LYEA 4JTFA 3EOEA 3CXOA 2Y88A 1T8QA 4S38A 2QPUA 4K8DA 3REQA 2W0HA 4BA0A 3GVQA 4BWLA 3WQGA 4I5UA 4M1RA 4U2YA 3GFXA 3H2MA 4CGTA 5JCNA 3MCNA 4DAFA 4JL1A 9XIAA 3QFBA 2NSOA 2YA1A 2C19A 4K38A 1MXDA 3N19B 4UMCA 3E3HA 3G1RA 2J8GA 2VELA 5FJOA 3B40A 4W7WA 2ZA1A 5BXRA 1SMAA 3N2TA 2Z2BA 1F3PA 2O7SA 1BG4A 3SJ3A 4Q4SA 2X8RA 1E0WA 1J6OA 1TPUA 3IWPA 4DXXA 1VZWA 4MPKA 3MHUA 3DENA 3U4FA 1IZCA 4GYKA 4EWJA 1AA1B 4JQ9A 2AL2A 1QATA 2IW0A 1XDJA 3DJGX 1OFBA 1A5AA 2INZA 3A4JA 4J9JA 3C0LA 3MUXA 3S47A 1KGXA 3PG8A 4ZZ9A 3NWRA 1YADA 4RE4A 4F2UA 3TW6A 3B9JB 4GABA 2PB1A 1LZOA 3GKFA 4M81A 3S2MA 4NXKA 2WZEA 5AZ1A 2HPMA 2QJJA 2XH7A 4L9XA 3C2YA 2NXIA 3H7VA 4B2DA 2BV9A 1F7BA 1UZHA 3MS8A 1EBGA 2PSNA 4UQAA 2PBGA 3ARQA 3M6YA 2WOWA 2Z1WA 3MMTA 4EQXA 4GY1A 2G50A 4X60A 5I07A 3U3HA 3OG3A 4A21A 4D8ZA 3LV6A 2F7FA 2OEMA 3I3BA 3RRAA 4DNMA 2ON3A 3GZ3A 4LF2A 3NURA 3ANYA 1DP0A 4XTDA 3N34A 3LHYA 4AH7A 3MQTA 4WSHA 1M7XA 3G1YA 4HSNA 3VZXA 4IGHA 1YX1A 3D6NA 3NOYA 2ZZ1A 1W3IA 3ALFA 1W3HA 4YPJA 3TCSA 3MYOA 1Q6OA 4WY0F 1LTDA 5T26A 3G22A 1TYGA 2Z25A 3VXGA 1DJZA 1V6VA 3R2GA 4JKLA 1P6CA 4IL0A 1V59A 3DGZA 4DBUA 2GR2A 5JIPA 3UZYA 5T9BG 3OYZA 5JCIA 1NELA 4ZFMA 5JBFA 4H4IA 4XAGA 5CC5A 4HN4A 1FEAA 3APYA 3WO8A 3ECQA 1W5NA 2OLSA 3LOTA 1VC4A 4LBSA 1PWLA 3GC2A 3WD0A 2UY4A 4QSFA 5CGTA 1KRMA 3PK7A 3PZNA 4HMNA 3NQ8A 3TMLA 8RUCA 1FFVC 1EBDA 1XLAA 3TOPA 2HMCA 2HVNA 4XD3A 2WSKA 1FWDC 1UG6A 2E28A 3HG2A 1FKXA 5L6UA 1TFVA 4WF7A 3STPA 5AY7A 2IKGA 2D73A 2XG9A 4GYPC 3TYAA 5BYWA 1LOQA 4GKLA 3OZYA 5F4SA 1IT0A 4TVCA 3BAJA 4A22A 2A6LA 3SUVA 3M43A 5A95A 1SZGA 3R8HA 1EX1A 1IWPA 3LHUA 4AZ7A 4WZHA 2A2IA 3DYPA 2ANUA 4JN6A 4C6OA 3VUSA 3BLFA 1A5UA 1UC5A 4C6EA 3QM3A 2BY1A 4M1BA 5F2MA 3BK0A 3OEXA 4NU7A 2PLMA 2ZZ3A 3PJTA 1ECQA 3IIZA 4AFYA 2VO5A 1IIHA 5FKYA 2C14A 3WQOA 1QXLA 1A0CA 5K4XA 2EBNA 4EANA 4OE7A 1HKMA 1PCWA 1AQFA 4H00A 1FDJA 5I3GA 1FDYA 4C6JA 3HGSA 2DP3A 4IIFA 1GQLA 3M41A 1TTIA 2EPLX 1JPMA 1XPYA 3B9AA 1YIXA 3H2EA 2OLHA 4MM1A 3WX7A 1W5QA 4B92A 5LA2A 4KWOA 2PDMA 4H01A 4O17A 1W17A 3E49A 3PJWA 4H6EA 1Y5WA 4E3VA 3RN6A 4RW3A 2X8GA 1W37A 3P81A 4I7WA 4ADSA 2CESA 1UD5A 1K4GA 1JYNA 2GDQA 1EJWC 1ZX9A 3MBFA 1Z6KA 3R0DA 3U2OA 2WPFA 3UJSA 3TSMA 2VQTA 3TQPA 1FHDA 5BW6A 1U33A 3GQYA 5HPOA 3ES8A 2Z26A 1EX5A 2BHUA 3GNXA 3B06A 1M41A 1E72M 1RJQA 4CLMA 1QFEA 3ARYA 4FS9A 1RVKA 3N4FA 1FIQB 2X8HA 1RBAA 1OIMA 2TMDA 3G1XA 3O0FA 4O0QA 3BG3A 3ATZA 1MFUA 4TV6A 4DJDD 1PHQA 5DY2A 1IZJA 4DUVA 3VUPA 5D05A 3TTEA 4DJDA 1TZ9A 4KGJA 2W6RA 2EQDA 1L9WA 4GXMA 1CI1A 1AH4A 3TN3A 3HN3A 4J5NA 4IXXA 3VDCA 1HKKA 3WQ5A 1XCXA 5C55A 1JRPA 2TODA 2C13A 1GRGA 1I2QA 1PPIA 1JCJA 1H60A 4KFOA 3I65A 4WX2A 1KV5A 2J7GA 3GXDA 2ABBA 4S39A 4WDWA 2HEJA 3PG6A 4H9VA 1B4EA 1FVPA 2PDJA 3QGVA 1SO6A 3IVTA 5JCMA 2VGBA 3BGGA 3TH6A 3ZR6A 1F2JA 1HNYA 2FZ8A 2UV8G 3MSDA 4G56A 4X63A 4KCWA 2DFAA 2GQWA 5AHLA 4MVAA 2VI0A 4FALA 1GONA 3NYZA 1W3JA 4QJ5B 2Z24A 5JBDA 2FHBA 4WKFA 3P60A 1JZ8A 4IP4A 1JPDX 1KXHA 3BCFA 5FS8A 1RP9A 4L64A 3T44A 4W4QA 3PPGA 1V6XA 4LAMA 5DBUA 3W07A 3TYZA 4LRTA 2V5KA 1XFBA 1GQKA 1QI0A 3D46A 1GQNA 4NRRA 1LP6A 3TC3A 1QNQA 2VEFA 4Q7BA 2Z6IA 1HF6A 3B0XA 4LY8A 2Q3OA 3UJEA 1FWHC 4QP0A 4AVFA 3N3MA 3WCZA 4UTWC 2H6RA 4XWUA 3UR8A 3L4VA 3KM8A 4GE8A 1T7LA 3HFTA 1MI3A 1P6BA 3FG2P 5A94A 5AHMA 4WLCA 3KTSA 1E6ZA 1QK2A 3N4AA 2NX3A 3I6TA 5CZTA 4L61A 3B9EA 1TZZA 3HMJG 6XIAA 3QN3A 4XBJA 2V3EA 2P76A 1RP8A 3ABQA 3RCMA 2J47A 1E4LA 5AKQA 4AIEA 4AD2A 1OG6A 3ZLHA 3PC0A 4J3WA 1DXLA 3L5OA 2VFDA 2A4AA 2YXXA 2P88A 2VX7A 4NILA 2XYLA 2GK1B 5HANA 4P8WA 2UY2A 3HPZA 3C61A 5FIPA 4AYGA 1RJPA 2PDCA 5G2HA 1M1BA 2QJNA 1D3HA 3KCOA 2R91A 5H1WA 6PTDA 1MUWA 4NAEA 3OGSA 3Q65A 2D22A 4Q8MA 2PRHA 3W25A 3VILA 2DSVA 3SY8A 3WDQA 2DSUA 2WZIA 1XLMA 4H7CA 3WUBA 2QUMA 3T0CA 1FCQA 3BE7A 5ABHA 4DYEA 3KRZA 4IQLA 2G4FA 4O54A 4JTUA 2OOGA 1AUSL 1OK6A 3VA8A 1XLCA 2XIQA 1MFVA 2P5NA 3THAA 3W02A 2JEPA 3GUGA 4QM1A 2W3SA 1HKWA 3DG6A 4AWEA 2X0YA 4FNSA 4O1FA 3BG5A 3IIVA 1M6IA 3IIPA 3EWUA 2XINA 3H4WA 1Z69A 1NQ6A 3AYTA 3QEZA 2NQLA 2W92A 2XM2A 4KWSA 5CG0A 4U33A 2VDIA 1TWIA 1JQVA 3AISA 3NL5A 4X22A 3MZ2A 3WQCA 1J5TA 1QBBA 3T81A 2WPGA 1GORA 3L0KA 3QYSA 3UG8A 1RPKA 3AC0A 4EQSA 3CHEA 4MLJA 4Y9OA 2DORA 2VGFA 1XYFA 4EM3A 3NYDA 3L65A 4REQA 3EWYA 1KTNA 4WIWA 1EUAA 3WD4A 1KCKA 4OU1A 2PDQA 2J7BA 5IHRA 1RQHA 4DXVA 4U3CA 2C1IA 1UW9A 5M03A 3E0IA 2ZXAA 1AZ1A 3W74A 2WMGA 4AZCA 1GVFA 3GRIA 3EB2A 2UWFA 4B16A 2PU1A 4ZB5A 1RR2A 1V08A 2PDGA 3FJLA 1D7YA 4YHEA 1DXFA 4JICA 1HGWA 2AGTA 3V35A 5HWNA 3QHNA 2GSHA 4GJIA 3R8RA 3GR4A 4YVXA 2WJEA 1W31A 4RE3A 5TBOA 3FAWA 3D5HA 2QUNA 2WPCA 2VCBA 2CNCA 4PFMA 3LGGA 4JTRA 1SJAA 4ACYA 1TPFA 1RCXB 4BHYA 3NVDA 4EQRA 1K7FA 3TR2A 4OKDA 2E8ZA 4PODA 4ML9A 4RZ4A 5IBXC 1CEOA 3VGEA 3AU6A 2AL2B 2QCEA 4DB7A 2VTFA 1XXXA 2E3ZA 4O50A 2HK0A 3CV2A 3E5PA 3M0JA 4D6JA 4OJYA 3L8KA 1OC6A 1NWSA 2WWDA 4HPHA 3C2FA 1M5WA 3IK4A 4CEXC 1RD6A 1OK4A 1EJVC 2DUZA 1S46A 3PUOA 1UZ1A 1ALDA 3U6WA 3TAOA 4G1KA 3KP0A 4FXJA 3NQBA 1Q7ZA 2VD9A 2V68A 2V38A 1NFBA 1AODA 2PCEA 3EA3A 4NSBA 1KM0A 4XX6A 1XUZA 4C6MA 2OFJA 1WXYA 1IGWA 2YLLA 4AF0A 3O7UA 1R3RA 2HS8A 4CQ8A 1TCMA 1KBIA 4R7WA 2BODX 1Z89A 3AXMA 4DBEA 5C70A 1R9YA 2ZC8A 3SCUA 2W0UA 4H41A 1HL9A 2EQ8A 3UQNA 1GVSA 4Q8QA 4XZLX 4A3UA 1BVWA 1NTHA 3ARRA 3EXSA 1XRVA 2FZ9A 4OIFA 4DPPA 2VXNA 1FWIC 1KFBA 1XINA 3OPSA 4E8CA 2Q8XA 4LXFA 3F4DA 3SFWA 2ZYFA 3NPXA 2P3ZA 2YA0A 4K39A 1MUMA 2XH0A 4H4RA 3BH4A 4IP7A 1BKSA 1XLDA 5E0FA 1J2BA 1W3LA 3AICA 1C8XA 1DPMA 4GVHA 3WLIA 3CAQA 3AS2A 1A5NC 5H91A 3TP4A 5DLCA 4DF2A 4LVDA 2WLZA 3G8EA 3DEQA 2Y7GA 2ZWZA 3OBKA 4I6KA 3LB8A 1GVQA 3PAOA 4H7ZA 4HU3A 3ONBA 5BOFA 1VFSA 1EA9C 5LA0A 1N5XA 4H4WA 1M3UA 3UXLA 3DYOA 3V16A 1ISXA 4NI3A 4FXFA 4GBUA 4DO6A 3UCDA 2I7GA 2O7QA 3WJSA 1VBUA 1U5HA 3C2EA 3CQ0A 5C9RA 1W1B1 4DVOA 1BKHA 4BV6A 2FZNA 2EJ1A 4EWND 2DVUA 1EDTA 2QQ6A 2E3TA 3A64A 1GW1A 1TR1A 5LIYX 2V81A 4K8EA 4JFSA 1UB3A 2PU0A 3W7NA 2RGMA 2NSXA 4HK7A 1I4NA 1LPFA 3GG0A 1FP9A 1YLVA 4S3DA 1GKPA 3VGBA 3DKJA 4AQLA 1Y8BA 3MUIA 3UXKA 3LCIA 1EJ7L 1W9XA 3QMRA 1V6YA 3TYUA 3KVLA 4ATWA 2XJ7A 2VJXA 3MCOA 3C0QA 5IOBA 4KGLA 3CYJA 3IANA 3QMSA 1H5VA 3IGHX 1K9FA 2WANA 4MIMA 1Q13A 2AKMA 2J9XA 3HRDC 3M0MA 4KWUA 5JCKA 1SO4A 1LORA 3IEBA 2P53A 4ES4A 4HNOA 3A23A 1N5WC 2Q8LA 4Q8NA 2HXTA 3DC8A 3R0UA 3P62A 4JTCA 1IEWA 3AZRA 4IJRA 1ZNNA 3EPNA 4ERIA 1VJZA 3ITGA 2ZXQA 4UFKA 1M65A 5A6BA 3I3EA 1E1CA 4HIBA 3Q6JA 2A8XA 4GXWA 2RDXA 4I7VA 5B80A 2IMRA 2ATSA 3VMNA 5I3IA 1OIFA 3DJJA 3NM1A 3KUMA 3RAOA 3RM8A 2ZVRA 1V97A 5E5CA 2E68A 2R9ZA 4AAJA 4H4QA 1IWAA 3CS2A 2ZX9A 3UCQA 1F8MA 2ZVIA 3SR6B 2NQHA 2ZUWA 1FWAC 1Q6LA 2PP1A 3I10A 4YWSA 1OQFA 5EGRA 1B2YA 2Y0FA 1W1YA 4GFSA 3GXIA 5DFAA 3MO7A 3VFLA 1TV4A 3G6MA 3G18A 3W0KA 5I09A 2ZXBA 3M5YA 3AJXA 4GX9A 1V3MA 1YTEA 2FDSA 4JY8A 3KVJA 1K03A 3QFWA 4F0SA 3IK2A 3O0HA 1NAL1 1WZKA 1J0ZA 2WMFA 3SSZA 4C6LA 2PLKA 4N9BA 4QEEA 3PR2A 3FSTA 4PZVA 2HV5A 2O9OA 2Y2WA 5I00A 3FLUA 1TX0A 1TV3A 3KOZA 3W7JA 3WJYA 4NEVA 5J5RA 1WAUA 2V8ZA 5A69A 5HJYA 2PTDA 3VZYA 1REQB 3P84A 1WX0A 4K7YA 1LVLA 1T5AA 1ZU8A 3BGJA 3VE7A 4UTJA 3OBAA 3NSXA 5HWMA 1UASA 3URBA 1Q6FA 2B7OA 1AL7A 4G8TA 3S1UA 4JQAA 3UERA 2A79A 1NU5A 3O3RA 1F4AA 3QHOA 3M0VA 1OX6A 1GZGA 3PP7A 4XBSA 1GKQA 3VE9A 4M80A 4GJ1A 1C3FA 1D3CA 1HJSA 2XSAA 1BGAA 2CERA 3NQEA 4TVDA 4H83A 3ARPA 3G3DA 1SZFA 2GQAA 1R3WA 3UPMA 4WKAA 1CBGA 2DSWA 2Y8UA 4HNNA 5BU6A 3DIPA 3H6OA 1WDRA 4DYKA 2EQ6A 2ZKMX 1PIFA 4MF4A 2P50A 5GNXA 2PDUA 5E70A 4F48A 1XIGA 1HZYA 3ABOA 1BG9A 1M68A 3GG7A 4XZBA 1KCXA 2DEPA 2A7NA 5DBTA 4YCOA 4QBXA 2J79A 1WV2A 3QY8A 1PKYA 3BW3A 4WD0A 1UR8A 3BMXA 1AW2A 1RA5A 4R88A 4JQ1A 4GIAA 3W27A 3OZPA 2YL6A 1W6TA 3SZ8A 5K9CA 4AHOA 3M6DA 3GDTA 5FSDC 1H0GA 1NARA 1UPPA 5HQLA 1LJYA 1OCBA 2NVCA 4H8HA 3WUGA 4X9YA 1NP0A 4X0VA 1VKFA 4FF7A 3M5ZA 4AEEA 2J24A 3VOJA 1HX0A 2AMGA 3RUBL 4GZEA 4NX0A 3CM4A 5DF0A 1TO3A 3OJGA 1UUOA 2RJGA 3LQLA 2CZVA 4GVFA 2C3CA 4HNLA 2Y6ZA 3E6EA 4CN4A 4AIBA 3TDFA 4HPXA 1JI2A 2R1NA 4UTKA 3KLJA 4E0CA 3PM6A 3Q4DA 1SQ7A 3WZ0E 1EZ2A 3GDRA 2YPIA 2YVGA 1OFOA 1UKQA 1QPKA 3O6YX 4EXAA 2CDUA 1XWYA 1YNQA 1VF8A 1R3YA 3QZEA 5DY3A 1PIIA 4YVPA 2OR2A 3DGRA 5AYIA 4BCEA 2ZTJA 4PRTA 5IDIA 1H1ZA 3ZJKA 4F0KA 4O4WA 4GR1A 4ZENA 2J13A 4M0XA 3GXMA 5DCEA 1KRBC 1P7TB 1R86A 4V27A 1ADDA 3BARA 1UD2A 1S2VA 1CXLA 1WE5A 5HK4A 3DDMA 3WNNA 1EP1A 1WBJA 4RXGA 4JYDA 3UVIA 2L5HA 3GDBA 4HVXA 3EWWA 3OIXA 5XIAA 2TSYA 2XFFA 5I3HA 3T05A 3DFQA 1YMYA 1NFPA 2V6OA 3FY1A 1RLCL 4AUBA 2VCCA 3EANA 2A7PA 3VD9A 4HHLA 4B3LA 2X50A 4AD1A 1FQ0A 1JZ5A 3NQGA 1WZMA 2Y5EA 3COTA 3O05A 4FEZA 4R3UA 3O1NA 3S46A 3GC5A 3KVKA 8TIMA 4CU6A 5E09A 2HSAA 2YBUA 3L4XA 3MI6A 4MJ4A 3ZMRA 1R2TA 1NP2A 2EJAA 1E73M 1FH7A 4A05A 1XIBA 4AWUA 4CNSA 2YDSA 3FYYA 3A12A 3L21A 5G1MA 1PZ2A 4YL2A 4LS2A 1W2PA 3UT0A 3AMCA 3S1VA 1VPQA 4MFEA 1QW8A 2PDLA 4Q4MA 2QT3A 4PUNA 4C6QA 4WOQA 2C18A 2X7WA 1UHVA 5F1UA 4AW7A 4R33A 1KNWA 2EQ9A 3D3FA 3F03K 2BBFA 1DHKA 4BZYA 1QOPA 3CGDA 3EWBX 4NAFA 4WQ6A 5CBIA 2E1DA 2ZIDA 3OODA 3I7QA 4IFKA 3PTKA 1L6FA 5DT7A 4MGGA 4JAWA 1POJA 3W7LA 5IFPA 2A3CA 1WPCA 5CC6A 3DK4A 1Q85A 1V5XA 2DZPA 2BZNA 1GK8A 3P7YA 1B54A 3SUWA 4H4UA 3DG3A 5AYXA 1EJTC 1H5YA 3V7PA 4D6IA 4WJXA 2EXOA 1JFHA 1L6GA 2I5GA 3G1VA 4UTTA 2QW5A 3FGCA 3H26A 3N9KA 4I3GA 3VINA 3QQWA 4UFLA 2WKGA 3BW4A 1WUEA 1ZP4A 1FH9A 4W8LA 3R0KA 1SVDA 3W1UA 1NHRA 1CXFA 2WQPA 4R9XA 3M9YA 1XX1A 1A5KC 2R14A 3WN6A 1UROA 2Q02A 3KRSA 3PBWA 3LRLA 4J3SA 2O9TA 2X41A 1BZLA 5KZEA 4QE5A 2FMOA 5D2YA 1TVNA 1FEBA 4JHMA 4M24A 4UFHA 3GS6A 3GD4A 3II4A 2OT0A 3PBMA 3W4RA 4KEUA 3HPFA 3DHPA 2WQDA 3A4AA 3P2VA 1TA3B 3GD3A 1UD8A 4BEUA 3FOKA 3F5JA 4QISA 1XUUA 2OSXA 3W22A 3GFYA 2CC0A 1KWGA 4GQRA 3QGKC 4UR9A 1AJ0A 3KX6A 4KEVA 3WH7A 4UTHA 2V2CA 1QVBA 5D02A 2R6OA 4PTVA 2V30A 4OVXA 1L2QA 2WZMA 4NP7A 2E09A 1R38A 3MSYA 4MYXA 3TX9A 4C7DA 4NJGA 4OT7A 1K3UA 1V3HA 1LBMA 4RZ5A 2X1RA 1UWQA 2NXGA 1BAGA 4CEUC 3DAQA 1U30A 4PE8A 4AD5A 2QJMA 1QI4A 4TVUA 1BSLA 3CV7A 2PDHA 5HINA 3R4IA 3WSUA 5BZAA 3MANA 1DJYA 3IUHA 1WDDA 2XVKA 3CHDA 3CH9A 2VRKA 2QIWA 1UKPA 3S2JA 3NRZB 3F5LA 3GM8A 4HZMA 1LM1A 1O66A 1MUCA 4HJWA 2PPGA 2GVJA 4V15A 1DWGM 2FGBA 3UFYA 3UWEA 3S2LA 3UZ5A 4ADUA 2NUWA 2G4JA 2X0SA 1TV5A 1A3WA 1FCUA 1OFAA 2ALDA 1GOWA 4MZ8A 3W1PA 4QCFA 3LBOA 2YLAA 3FA4A 3EXRA 3CHVA 4JQ4A 2BGQA 5AC4A 2WWCA 3Q58A 3S9ZA 1C8QA 4HOXA 1KBBA 1UKTA 3C52A 3TXVA 2J8FA 1XLKA 3AWOA 3WF2A 3DK9A 1ITQA 3HF3A 1R3SA 5KMYA 2OGJA 1I45A 5G1YA 4LYKA 4D1IA 4FXRA 4RDYA 4CNOA 4HK6A 3BOFA 1Q4NX 2QKFA 3EX1A 2DVTA 2Z29A 3FHAA 3GLCA 1TRDA 3R11A 1NH6A 3U7BA 4UQDA 4FR6A 1XH2A 4IXHA 4L65A 2ZFAA 4W93A 3U4AA 2EF9A 1W8SA 3I4EA 3W1AA 4XO7A 4C65A 3B8VA 4P7QA 5ABFA 4PR4A 4IT1A 4B5VA 5AYZA 4JTEA 4N4PA 4TMCA 4DRSA 4Y7EA 4GI8A 1OB0A 4Q8WA 3L0GA 4GK8A 4K1GA 4UMAA 3LPFA 3CZEA 3RHGA 3TW7A 4FX6M 1QPQA 3HQOA 5EY5A 1EFZA 2WKJA 3H23A 4HZ8A 3NEVA 6ENLA 3HW2A 1GHRA 1TV8A 2ZX6A 4L6DA 4GISA 2O56A 2F6UA 4CD7A 3P93A 3FX4A 2W3ZA 1VQTA 3JVAA 4YTUA 1FO4A 2JKEA 2IKIA 2BHZA 2NQZA 1XCWA 4HBKA 4JEJA 1AQMA 2QUUA 3HB9A 2EPHA 3DFNA 3FXGA 1DE5A 3VDBA 2BDQA 2GUUA 4XIMA 4I9TA 2RABA 4Y2WA 4DJEC 2FPYA 4LBUA 1RV8A 4DELA 5FOOA 1DJNA 5DMYA 4JS3A 4O19A 1KBKA 2DQXA 1QW9A 1RXOB 4ZO7A 2D3LA 5GNZA 1KA9F 1O60A 3V5OA 3WLRA 2O55A 4XSLA 5FJTA 3BLLA 3MCMA 3XIMA 2IPWA 4MB5A 5D9PA 4Q6XA 3P5ZA 4Q33A 4DF1A 1J18A 2YJQA 1FXQA 4QRNA 4ZR8A 3RR1A 4WGXA 1DV7A 1EJUC 2V63A 3FJ4A 3WNOA 3A4XA 4HTYA 1LF1A 3AXHA 2NLIA 3WQ4A 1CIUA 3KLKA 3GG1A 3T2QA 4N42A 3S5YA 3SCTA 1EP3A 1XG4A 2NQ5A 3KL3A 5U25A 1EP2A 4ZQCA 3WK3A 4Q4OA 2VYOA 3VYLA 3C6CA 3IJ8A 1MXGA 1XBZA 1OBAA 1MRAA 1EWEA 2EGZA 3LTPA 1RY0A 1A80A 4XG1A 3W1QA 5HMEA 2YX0A 2WHJA 4XAYA 3N25A 1UWRA 2ZUVA 4O0KA 4DX3A 4Y6GA 3EUB3 3VM5A 1GESA 4TU1A 3EXTA 3UG4A 2QV4A 3KHJA 1WP6A 1F8IA 1QUMA 5C2GA 4NZ1A 2PDXA 1LT8A 1O7AA 2YCJA 4EPBC 5G4EA 4US5A 2JBMA 2SFPA 3VIKA 1R87A 2CZFA 3QKZA 2I1OA 1H09A 2DY3A 2V3FA 4E6MA 1K8CA 1O5XA 3UVAA 3HGOA 2GZXA 3EYPA 3FK4A 3E38A 4J56A 1JOAA 4M6UA 1UOZA 1UR4A 3A3XA 3U5YA 1OJTA 2KX9A 2ZA3A 2V3GA 4FIQA 2JF6A 4JTQA 1FWRA 5D38A 4JTAA 3W7MA 1BEUA 1EGZA 4PMYA 1YEYA 5CEWA 4LUSA 4HNCA 1ITXA 3K1GA 1WQ5A 3KW3A 3AS1A 4J57A 2FGLA 4ALDA 4PFHA 3RLGA 1UH3A 1KKOA 4J4KA 2WZTA 4D6EA 3K8MA 4HP5A 3RK8A 3O07A 3N13A 1WDWA 1QNSA 2EPKX 2PF8A 1RCOB 4ZEPA 1H49A 3R43A 1JROA 4QLKA 5I3JA 1XIHA 1CXHA 5CKSA 1X39A 4Y96A 3SJNA 1CX9A 4LAKA 4FNTA 3LB0A 2XN2A 3V1HA 1W9VA 3GRTA 5I3KA 3OLDA 1GW9A 4Y8FA 1NDYA 4YYFA 5FD0A 1ONRA 2ACQA 4Q8OA 3J7HA 1EQCA 3W23A 3ENLA 4MJ2A 3MI2A 1E40A 3IUIA 2IS7A 1YXYA 5A6AA 2OG9A 4NT0A 4NZJA 4ILSA 1O4UA 3VC5A 3LK6A 1K8YA 3OC4A 3BOXA 3T4CA 2D2GA 3LCFA 4MZ1A 3IGXA 4KH2A 5AFDA 4BK9A 2DT0A 4I5XA 4ZQRA 3APGA 3EDJA 2Q8ZA 3PTQA 4EPKA 1MRQA 2IQDA 1GOXA 4LGXA 4TVYA 2G96A 2WVVA 3EMCA 4JD4A 2DUXA 2R1PA 1YNPA 3F2DA 5A8QA 4MAZA 2WSQA 3GAKA 4G7FA 3OG2A 5HAOA 4CCCA 4P61A 2XWDA 3QY7A 2HVMA 2I9UA 2ZC1A 3CZ8A 2VFEA 3VI2A 4KQNA 1E70M 4B5SA 1HJWA 1AD1A 1RSCA 1V02E 3K8KA 3ZT6A 1P5BA 1ZALA 1IR2A 5HQEA 1KBJA 5C2XA 3O6AA 5REQA 5EBAA 3TNOA 5CGQA 5E0KA 4NAFB 2DZUA 2PWHA 3GDLA 1KFJA 3QFAA 1RD5A 2VVNA 4IFKB 1DJQA 2J7FA 4ACZA 5DN1A 3FIGA 1SB3B 3DXIA 4A8IA 1V6TA 1QU4A 3TQVA 3LHTA 3KOYA 3GDMA 3W9ZA 4K8HA 3NUKA 4LX4A 3BJSA 2ISFA 3CLWA 3H8AA 4OBRA 4DQWA 4PUEA 3RDKA 4BR1A 4C90A 2VENA 5KVIA 1MNSA 1JCMP 1X38A 2P1FA 2WOVA 4INFA 3FGCB 5D9OA 2YVFA 1YHTA 5CC7A 5BNKA 3LM3A 1MDRA 4H4YA 1TPWA 1LG2A 3LXCA 4CUCA 2J9ZA 1SSGA 1J0IA 7TIMA 5E6YA 2PDYA 5M3WA 2VKZG 2OELA 3ZOAA 5A6JA 4MY9A 4D8AA 2PC8A 4LUIA 4S3CA 1Q7MA 4Z1BA 1MW0A 1BWVA 3T07A 3AMZA 4H4TA 4A8LA 3W72A 2YCIX 3LV5A 4W86A 3QR3A 3S6OA 1JCTA 2EG8A 5AHIA 1LUCA 1WBHA 3NAVA 1ZXIC 7ENLA 2ZADA 4MB3A 1FX6A 4Q8UA 1HJXA 1JDCA 1VLIA 3W7QA 3RYSA 3WD1A 3MUZ1 2PWEA 4YVVA 3U57A 3WF3A 3NVTA 1R3VA 4UIOA 3GK0A 4IHCA 4F0RA 4R34A 1EDQA 1SM9A 2QS8A 3WLPA 3NSMA 4RNJA 4XD5A 5CXPA 2G3NA 3KCJA 1JEHA 1KM2A 1XQKA 2PWUA 2KAUC 3L23A 1D9EA 1PX8A 3QR0A 4DJED 3P74A 4F9JA 3SCPA 2CFYA 2OYLA 3T2PA 4F66A 3FYOA 5D9MA 4HYWA 2OZ3A 2VEKA 1Q1WA 3GXTA 4B4FA 3KBNA 5HULA 3SCRA 2X16A 4U31A 2EQ7A 3Q94A 1OGBA 4PCTA 3LXDA 2VDGA 3JZUA 2E6YA 3PB0A 3ITCA 1O5KA 3VVGA 2Y1HA 4JHZA 3SRDA 1G4PA 1W3NA 1FWJC 3PZTA 2Y70A 3DOPA 3P14A 5A1AA 4BY3A 1LQ2A 3Q45A 1PZ3A 3K4DA 4F2TA 4QJ4B 1DL3A 1VBGA 5IXEA 3MJMA 3EKZA 4LJ3A 2WMHA 3HJEA 1XIJA 4O4VA 1VBHA 4I8YA 4ZA0A 5LIKX 4C7FA 2CBJA 4LB3A 5KEZA 4CU7A 2WMIA 2ZZ2A 3O06A 2BOEX 4PCPA 4Q4RA 4XD4A 1XYAA 4KEZA 2DVXA 2XHYA 1R9XA 2IKHA 3VKJA 3V0TA 4ZGYA 2WJZA 3UR7A 3A24A 3UR5A 4C1NA 3ZFHA 1G9HA 4A3RA 3ARXA 1A5OC 3THDA 3TC6A 2XGIA 3VGHA 3A6OA 3V0UA 3IIOA 5CGMA 2EKGA 3DU0A 3BURA 3E0FA 2CLHA 2F38A 4CNUA 2QUVA 1DWIM 5FJRA 3W7HA 2B31A 1C93A 1GQJA 3DFYA 1XHGA 2NX1A 4O18A 2FTYA 3GKAA 1UH2A 1E3XA 3GU2A 3H12A 3M07A 3TE9A 1QR7A 4A3HA 4ATLA 4JTKA 4N6FA 2V5JA 1NOFA 4ZOCA 3IJIA 5CPLA 4ZVJA 3STGA 4QE1A 4Z17A 1CWYA 4TR9A 2PDIA 4KRZA 3OYXA 2J9YA 3T0TA 2GH5A 4EE9A 4MKSA 5ABFB 4A8RA 3CL7A 2NVKX 5LNUA 1N60C 1PTDA 3T9PA 5KETA 3WY1A 5A8PA 3EX4A 2A3AA 1ZMDA 3HG3A 1PJ9A 5GPRA 2DPEA 1SJBA 1UMLA 4A8NA 2H8ZA 4HA4A 1XKJA 4ZTYA 3LUTA 3SCQA 4JX4A 3NR0A 4GGHA 2GVLA 2YZRA 3HFYA 3SSJA 3DH7A 4NKCA 3T0DA 1FWGC 4H2CA 4RXFA 4JPGA 1A3XA 1R3TA 3E1F1 2PWFA 3WQ6A 3V75A 4W8BA 1MW1A 4C6DA 4D6FA 2YW4A 1V02A 3R89A 1T3QC 3LNMA 1ICPA 1H7PA 5GJPA 3M0XA 5AYYA 5DO8A 4EPEC 1GERA 4Q22A 1ZQ5A 1AG1O 4URIA 1XYBA 4XUYA 3RJYA 1KD0A 2J4GA 3NJ3A 1SMDA 1MZRA 4GLEA 1BWLA 3WH5A 4D6GA 4WXZA 4GRSA 5F4WA 4ZOAA 2XFYA 4LU0A 3GDKA 4C6CA 3GU1A 1KTBA 5BXPA 2X99A 1JAEA 2FQIA 2FIQA 1MQQA 1US3A 3IRSA 4DBWA 4DNHA 1IT8A 3A3HA 1AW1A 3SCOA 1SZRA 1EH9A 1F74A 1W1TA 3B05A 2QHAA 1KRCC 1Y5VA 1FY6A 2DZSA 1VS1A 3SIMA 3OBEA 4PUUA 2Z1VA 4QLJA 4ZSTA 1TRIA 1U5VA 2XN1A 2IPJA 4FXSA 1NFGA 4NY2A 1TIWA 2RDWA 3QOMA 1VFLA 3VMOA 2VEGA 3C86A 3P8IA 1VR6A 4BQ3A 4GOAA 3H4KA 3HTWA 4JY9A 2VEIA 1V3IA 1Z9AA 3VDHA 3BL3A 5MKGA 5C9XA 4LQ1A 3MP4A 1RLDA 2C1GA 4GQQA 5CG7A 2FYMA 5A6LA 1DIOA 3A7RA 4N9CA 4KW2A 4KERA 5GQBA 5JQ9A 2G3FA 1KFLA 1US2A 3LHVA 3TW9A 2FHCA 5RUBA 2GSEA 1Q5MA 3AXKA 1BWCA 4RKAA 4Z2HA 1EQPA 1Z32X 2QGYA 3O63A 1EXPA 1VFHA 4LUJA 4BWLC 1ZY8A 4RDVA 4UTMA 4XBKA 4FA3A 4EAMA 4M7SA 4HU4A 4KEMA 1K7XA 3GO2A 3FKRA 3LI0A 3CQKA 2YXOA 4BQ2A 3DBPA 4ERAA 2BNJA 3TJIA 3Q2DA 3LD5A 4GMEA 1XCFA 3THQA 4DYJA 1W9UA 3CT2A 3E9AA 4RNIA 6ALDA 1V6UA 3QF0A 2XPKA 3BW2A 2CBIA 1IHIA 3WLSA 1D3GA 3H4GA 5FJJA 3UXDA 4FNQA 3U9IA 1GOOA 5EKYA 4UCFA 5HNRA 5SWUA 4H04A 2G3IA 3BQ5A 4QR6A 4LUSB 1XSKA 2GL5A 2O9PA 2ZUMA 2CLIA 4NJJA 1XJBA 3SQSA 1J5SA 3EWZA 3ZVHA 5I7GA 3BVJA 1NSJA 3TSBA 1MMFA 1SO3A 1BYAA 3T8QA 1M03A 2JIWA 1XLFA 4JN8A 2OWXA 4C60A 1FBAA 1LCOA 3LZ3A 4K7ZA 4AC7C 3LZ5A 3GNPA 3WLLA 3ZR5A 4GHRA 1KGWA 4WGHA 3BGAA 2WOQA 4KS0A 2CLLA 1A4LA 1MQRA 1CB7B 3N6QA 4AVOA 4PBFA 1IEVA 4GKTA 2DT2A 1Q2SA 1JPIA 2Y8VA 1DIEA 1CGUA 4BF9A 4UNKA 3TKFA 3AALA 3BAYA 2J78A 5LSMA 2OYMA 2JIEA 2NT1A 1NF7A 3ZQ9A 4PSRA 3A5VA 5CSRA 3CAWA 4AZ6A 2VEMA 3CHCA 2V3AA 3KL0A 3W7DA 1AW5A 5IHSA 1K02A 4OHQA 4PGLA 5F4XA 1OFEA 4FMVA 1ESWA 3W00A 3UESA 2VFIA 3ZT5A 3W83A 2WVVB 4GX8A 5FCZA 2V82A 4ZQPA 3EOOA 3TK7A 4AHQA 1K9EA 3PZOA 3G5EA 4MFDA 2AMXA 2E8YA 2HE5A 4WJEA 3CIWA 3MP5A 4E8GA 5D37A 1Y65A 3IRDA 5K3VA 1XLLA 4P7RA 1QT1A 1VBRA 2J62A 2ZRUA 5LHEA 2ESCA 5FA5A 3W71A 3INPA 1E4IA 4C5YA 1S2TA 3E96A 4OZOA 2XFWA 1IF2A 4AMAA 4X0NA 3CLMA 1LLWA 3CAKA 1JFXA 4N0RA 4QE4A 3N11A 2FPTA 1UZDA 1JRBA 1AH3A 1PO9A 4GD0A 2RKXA 3NZQA 3OO2A 3CASA 4LALA 4S3AA 1A49A 1SFTA 1VEOA 3PJUA 3E0VA 3WMLA 2W55A 5LNVA 3N4EA 3KXQA 4FX9A 5KVHA 5AB3A 3HV8A 1B1YA 1DEDA 1T96A 2WHLA 3VCCA 3G1AA 1OT2A 5CPMA 4UUIA 5LXXA 3GH4A 3UP8A 4IMEA 2PF0A 1OF8A 5D33A 3BLOA 2P10A 4QGCA 1EXBA 4MNMA 2WHKA 3L12A 2HZGA 4ASTA 1EKOA 1HXJA 3OHMB 1LROA 1QNRA 4TQTA 1FFQA 1S5WA 3VD3A 2ZRYA 1E9ZB 1FRBA 2WNZA 2B7NA 1LUCB 3G1FA 4YTRA 4UB9A 1NDVA 4QFUA 3R79A 2VOTA 1CPUA 1S38A 4QHRA 4GACA 5F1VA 3KOFA 4Y9MA 1E0UA 4JX5A 3S2NA 4HNUA 3QRHA 2ASHA 3BTNA 1DJHA 1BYDA 1QAPA 3VIPA 3WMCA 4BQ5A 1EO5A 4DWDA 3OHIA 1EPXA 2YSWA 2ISVA 4OQVA 1ODZA 1JGMA 1NDZA 2PUZA 3LY0A 4EMWA 3LMZA 4PL1A 1JQXA 3F2CA 3MMUA 2XWEA 1CDGA 5GRTA 5A2AA 3MBDA 1M01A 2ABAA 3O15A 3DG7A 2BTMA 4HPJA 2ZRWA 4DJDC 3USBA 3LPPA 4Z1DA 1SW7A 1FTXA 3FCPA 3A5FA 1JGIA 4GFIA 4KPRA 1GEQA 3I3DA 2OKOA 1UWIA 6REQA 1VIWA 1X8CA 2FDMA 3WQEA 1US0A 4B5TA 3KWSA 2E4TA 2AAQA 4LA1A 1ZPTA 2D23A 2ZUUA 1FWWA 3SCWA 4F4RA 2YOCA 1UA7A 3HPAA 2GYIA 1CW2A 5HNNA 5HWJA 3V5FA 1OFRA 3PUGA 3K30A 1G4SA 3CL6A 1Q6EA 3A3WA 3RJXA 2E6FA 2Y5JA 3MC5A 2I5QA 2PGWA 4GXPA 5ABGA 1BF2A 3CQJA 1AQ0A 4C1NB 4WUIA 1JI1A 2XUCA 3HOJA 4QAWA 5M5DA 3W1LA 2W54A 3ATYA 1EBHA 4ZOHB 1UD3A 4N6EA 4P8UA 1TIMA 1TTJA 3P80A 5C8BB 2Z1KA 2VC9A 4FX7A 1XDMA 1GT8A 2D20A 4PMNA 3CUZA 3LS9A 1LRNA 3U5UA 1QO5A 5AYBA 4GUIA 3BLDA 4BKNA 3PSWA 3PBGA 3QFEA 4ZB2A 5I3DA 2BC1A 1G7UA 3HQ1A 1QO2A 1SZEA 2ACSA 1KQYA 2YYTA 3PY2A 3ARTA 3KL5A 1CYGA 1GVOA 1KKRA 4ONVA 1Z8AA 3RILA 3DFSA 4AVNA 5CAKA 4HZ6A 3QTPA 2R94A 4QNEA 1Y7VA 4IMCA 1SO5A 4GBDA 2VR5A 5E9AA 4KIEA 1JL8A 3DC0A 3F4VA 2C79A 4K36A 1J0YA 1KRAC 3ZT7A 1HVQA 1TWWA 3LBCA 5E6ZA 4PEEA 4MNJA 3L4TA 4Q32A 1SW0A 1ZENA 3WDIA 3NM3A 3UY7A 5A2CA 3TFCA 4WY0A 4B2DD 2Y85A 3A22A 4WRHA 1ICSA 1NWRA 4F0HA 4PCNA 2DIEA 3E5BA 3NO5A 3C2RA 3KBWA 3LX9A 4PUWA 5DCDA 4Y9AA 4MUZA 1BPLB 1JYXA 4LAOA 1I0BA 3DI0A 3GUWA 3PTDA 1MSSA 4BURA 3ITVA 4US6A 4IPIA 2WVUA 6XIMA 3IJ9A 2KZHA 3JUGA 1M04A 1K9TA 4LH8A 3W70A 4Z2LA 3NO1A 2R1LA 5BXSA 3AYRA 5BWAA 3P6LA 4ZO9A 4FLRA 1WOBA 2BSLA 2GDVA 1A0DA 1YDYA 1CLKA 1G69A 4HN8A 3U0HA 3K13A 5AVHA 2WBAA 4PMXA 5DQPA 2VFGA 4ZTXA 2VMFA 1OCJA 4GUFA 3U8GA 4JQ3A 3SADA 3C3NA 1EC9A 3ARVA 1ISZA 3FW6A 4E8DA 1RVGA 5BXTA 2EO7A 3WH9A 3KFTA 1AOGA 2Y7EA 5A3HA 1K70A 4H6KA 4A2RA 1RQEA 2HCVA 5I03A 5J5DA 4Q4QA 2XVNA 4FX8A 4IGSA 3TLLA 1R30A 4A29A 3WDHA 5FJUA 4ADWA 4YHGA 3H55A 5M1TA 1H7WA 3WLMA 3ARUA 3NQ7A 1R46A 1XDIA 1VAHA 4M29A 2PDBA 4GNKB 3OLGA 4UWMA 1VFOA 1VYPX 3PWAA 3NGFA 5DRCA 4IL2A 1BRLB 2I5IA 1UJQA 1F6PA 3K5XA 5A5WA 1Z42A 4ZO6A 4UNIA 1QNPA 3BCDA 5MKGB 3JW7A 5DMNA 1TPB1 1OG0A 2ODOA 4JTLA 3LBMA 3B9OA 2WKLA 2OZTA 4K8GA 1L8PA 3WD2A 1X98A 3OA5A 2A3LA 1CNVA 2ZOXA 3UZZA 3IJDA 3SO7A 4B9YA 3W2JA 2D2JA 4I90A 1H7OA 2POZA 1JDEA 4PUKA 2H90A 2OTDA 3TCEA 1STZA 3W6MA 3LMYA 4MY1A 3WLHA 3SUTA 1OABA 2YAUA 4PUMA 1F3TA 1HFBA 4J3UA 3NSNA 4UQBA 4O52A 3ZZ1A 1U1UA 2I16A 2FVLA 5FEPA 4F40A 3WBEA 3NFUA 1JUEA 3JR2A 4WEVX 4H9UA 3LLXA 3GAYA 4LIIA 5H8UA 4CCZA 1LL6A 3UZXA 1A5LC 5KTLA 2UY5A 3EKLA 2J7HA 5FF3A 4GO8A 1C92A 3W1TA 1ECEA 2VHLA 4QG6A 5HMDA 4QCEA 4D8LA 1KCZA 3MKCA 1VYSX 3UG3A 4V28A 1KR0A 3BV4A 1EGMA 4B3KA 3GTHA 3MWCA 4WSKA 3HU7A 2WBKA 2ZX5A 1PVNA 2YCLB 1E0XA 3ALGA 3MUY1 1UKOA 3HMCA 1IQ8A 4GG9A 4N7QA 1DNCA 2BX7A 3LXBA 1W9PA 2JKAA 4KETA 1WDQA 3AM9A 3RPDA 2X30A 3AHYA 1BSIA 4GI9A 1H6VA 1VBJA 4DNAA 3MY9A 3UETA 3QW3A 1JXJA 3VTRA 5FF2A 3RNMA 4X61A 1DVJA 1DWFM 1T41A 3ZVHB 4F0LA 2ZUTA 4UZUA 4M19A 1LBFA 4Q7IA 4YJ5A 1DJWA 1EIBA 4UTUA 1KB3A 4JFUA 7PTDA 1XV8A 2VX5A 2D1ZA 3SR7A 1W9BM 3S5NA 1ZAIA 3S42A 3UGRA 3UNDA 3ME3A 3GRSA 4AZBA 3E02A 1HUVA 1E6XM 4NF7A 2WK2A 1NVMA 1I2RA 3KBVA 3ELFA 1M7PA 3N15A 4ADTA 3UA3A 2IUZA 5EMYA 4Z08A 4KPLA 2E9LA 4IUGA 3VZZA 3GR8A 3H22A 2MANA 1LOLA 5EMJA 4AD3A 3CV6A 3PZMA 3NL6A 2ZRXA 1EHAA 2BVDA 1S2WA 3RO6A 3N29A 1WKYA 4FNPA 2WSYA 4R7JA 5JUVA 5BRQA 4EM4A 4IG2A 2WC3A 3T55A 4HK5A 3SGUA 4LEFA 4C7GA 4PTMA 3T7VA 3PTMA 3QPYA 4NEWA 3LNPA 3AIRA 1L6YA 3TNBA 4NJHA 4YMZA 4LANA 1O95A 4LS1A 3GU9A 1JULA 2VRJA 1BXNA 2BOGX 4O1EA 3W84A 1ML1A 4U4MA 3MKVA 1PHWA 1ODUA 2OPJA 2XGBA 4AEFA 1E71M 1HIZA 1RHCA 3W1NA 2AQWA 3B4UA 3M0IA 1REQA 2R9RA 2OZ0A 3EAUA 1I60A 4BJHA 1WKDA 5CSUA 2G3MA 3GNNA 3GIPA 1YKWA 3VM7A 4CCDA 2F5ZA 2B7PA 1QPOA 1FCBA 2NV2A 2XVPA 3DH9A 1WOAA 2YA2A 5TQLA 1TJRA 1EOKA 3URQA 1KQZA 1XGZA 3MV01 1PX4A 2EPMX 4DN1A 4LNYA 1DYSA 1MNZA 4IIEA 2FZDA 1YXCA 5F2IA 5KZDA 2AGKA 2VR2A 2F6XA 2CETA 3BUVA 2OZ8A 3G6LA 3MA8A 4S23A 1X6UA 1F05A 1V0NA 3GB6A 2PWGA 3AOFA 1BGGA 1LRTA 4HSOA 3CZLA 4S1FA 1YRRA 4IJBA 3APTA 3AS0A 2DSKA 1TUXA 4CVWA 1O1HA 2E6AA 3RCNA 4HT3A 5D04C 3PZIA 3TV8A 4H3DA 1DWAM 4XIAA 4E4PA 4TOQA 4RV8A 1O94A 3CWNA 3UZJA 1VCGA 3KBSA 2I56A 5JMUA 2JGQA 1Q8AA 1V0LA 3W73A 3H7RA 5EMKA 4RZ6A 2B81A 4EMJA 3K46A 2NV1A 3FEQA 3FDGA 3I4KA 3MSGA 4R7OA 3MB9A 3WEZA 5G5IA 2CKRA 2ZE3A 2DZAA 1UKSA 1H63A 2PDFA 2R82A 4S2CA 1HG3A 3W28A 4M7TA 1EEXA 4R53A 1L8NA 1GQIA 3N18A 3WNMA 1CGXA 1YDVA 1YQ2A 1QTWA 3QH2A 1B3YA 3TROA 2V9DA 3HGRA 4DO4A 3CUJA 4KF1A 1T8XA 2ZRZA 3ITYA 1XPGA 3HV9A 3I6RA 3O6CA 2O92A 3EOUA 3OIHA 4NXSA 2R24A 4MUPA 4WJ8A 3TWAA 1TPC1 3ZO9A 1X8FA 1N55A 4HNVA 3WF4A 4JFWA 1EGVA 3OQ8A 2AQOA 2XZ7A 3GVVA 4PA8A 1TV2A 4O1CA 3UD6A 2Y7DA 3LI1A 4NI8A 2GJRA 2YL5A 3M64A 2F2KA 3R13A 3B97A 3TQ0A 2V67A 6REQB 4FOJA 5CSSA 3TEVA 3G1HA 1GWJA 2RUSA 2WXDM 3L0NA 1P7TA 2CEQA 4NYUA 4DF0A 1PKLA 4CNTA 4U28A 1OYBA 2DQWA 5FEXA 1JXKA 4Y90A 1NQKA 4H7VA 1A50A 5LIUX 4ICMA 1DQWA 4AXNA 4U3AA 3W24A 2JEQA 3NTYA 1CLXA 1OYAA 1X7IA 1OVDA 3S5OA 2GOKA 2OU4A 3C2OA 1VP5A 3S0CA 2PFHA 1YPIA 3PS7A 3RU6A 3VIOA 3OB8A 4M82A 4PRWA 3TZFA 2QJIA 1HL8A 4FDCB 1HT6A 1XYZA 3GX9A 4AD0A 4P7NA 5GNYA 2BVWA 3SUUA 2VZSA 3RR4A 2IKJA 1H1NA 1TVPA 4TIMA 1EZWA 3L68A 2V5DA 4R27A 1TX2A 4QS6A 4NASA 2NV9A 3EF6A 4WR3A 4ZQNA 5I06A 1J11A 3OVRA 3N14A 1S7MA 1A5SA 1EL3A 3DHDA 4DZAA 2PTXA 4LUTB 3R5EA 4RJEA 4FF5A 1S39A 1LL7A 3HGJA 3DYMA 4EX4A 2XSXA 1EEPA 3S1GA 4JL2A 4TVWA 2PODA 3WQ8A 1JPKA 4D1JA 4IX0A 3ITOA 3KWXA 4YWIA 1MVYA 3K1DA 4ORIA 2AAMA 4LW7A 5HXMA 3WDRA 4OFCA 4X2PA 4GI4A 4IICA 1D7KA 2BFGA 3M0ZA 3H2OA 1NJJA 1TJ1A 1W1VA 4M8UA 4DUOA 1L6WA 1F73A 4WY0B 1AH0A 1JD7A 1AZ2A 5JH1A 2P0OA 1UCWA 1B5TA 2CLFA 1P4CA 2WM1A 1PZ1A 1XSJA 3P3BA 1O1ZA 3FNDA 3B8TA 2OVLA 2VGIA 1R47A 1ICQA 1GVIA 1I2PA 1KM4A 1VCFA 4MB1A 2IXUA 4RR4A 3VOIA 5HDRA 1IV8A 2RFGA 2PC4A 4RW5A 3MSRA 1GTEA 4LOCA 2ZCGA 3LRMA 3KRUA 1OFPA 2DZTA 1XGDA 5EFFA 4CQ9A 2DGAA 4PB4A 5D8ZA 4JKMA 1V4YA 2CLKA 1DIDA 1KGUA 1S3TC 4LVFA 1TSIA 4H9ZA 1XH0A 2XDFA 1RQBA 5EB8A 1Q6QA 1ME9A 1S3HA 1AMKA 1ISYA 4XAFA 2DUAA 5B7ZA 5C9UA 2V0TA 4K2SA 1ZBKA 1F6YA 1GREA 3OZOA 4I9AA 3VIFA 1DTNA 4QITA 1SUXA 4Q6JA 1TA3A 2VZVA 4IUOA 3N6JA 1ZDLA 4DHGA 3TA9A 2A85A 1FWNA 3RM9A 2EPOA 4O1AA 4GJJA 3QSRA 2HTMA 1P0BA 3TYDA 4O13A 1ZFJA 1W54A 2VZTA 1YPXA 3GBDA 3GNDA 1TE1A 2Z6JA 4IOTA 2BG5A 1AK5A 2R1KA 5FS6A 2WJDA 1BTCA 1E9YB 2DT3A 3SGGA 2J88A 4UOQA 3VNZA 4HMCA 1U22A 3CAVA 3OOQA 4OGZA 5PTDA 4AHPA 2Q6ZA 2BOFX 1F6KA 2QXWA 2YB4A 3VKAA 2BS9A 4I8DA 2WYSA 5IM51 3PZ9A 2W62A 4DO7A 4EKJA 4Z0SA 4M52A 3VIIA 2QMJA 2YFNA 4FPSA 3HJZA 4JDRA 4E3TA 3VKKA 3VIMA 3ZIZA 2QCCA 1U5JA 1XR2A 5LNSA 5EL1A 2QPXA 3LM7A 4PMRA 1B3XA 4MPQA 5CJNA 5CPNA 4H8UA 1F8WA 3BPWA 2XVGA 1HP5A 2C6QA 2GWNA 1IXOA 2VL4A 2TRSA 4GPNA 7REQB 3MI3A 1W1IE 1HP4A 3JS3A 4IGMA 1Q1RA 4GH1A 3T4WA 3WNKA 1WKFA 3ZJ8A 2IXVA 4RDZA 5FS9A 3V5CA 1TWDA 1OY0A 2J6VA 2PP3A 3EX2A 3BMVA 3CNYA 2DV0A 2OB3A 1BXBA 4O8AA 3FN9A 4LVBA 2PD5A 1ZZMA 3WELA 4OOUA 1K77A 4ENLA 4H19A 5A6BD 4UTTC 4PTNA 1E51A 3O16A 1B31A 3P82A 3SN0A 1YW1A 3LPGA 3KS5A 3SCSA 1YPFA 1VFMA 1ITCA 3JRKA 1TREA 1ZBWA 3BSHA 5ECUA 1B9BA 1NM9A 1XBXA 1R85A 4ML4A 3QKEA 3S83A 2GFTA 4D72A 3CWHA 4XKYA 1UIOA 2CBUA 4Z2JA 4XAZA 1GGOA 3CGTA 3P8JA 3CMJA 5EU9A 1FDZA 3XISA 2OX4A 1SYTA 4PULA 4IGNA 4ZOEA 1K4QA 4RK8A 3AUJA 1CENA 1T6MA 2QV5A 1QI2A 2HBVA 1WDSA 2VD8A 4IPJA 3VX0A 1EJXC 3IARA 5I78A 3UXIA 3WD3A 3AHXA 4RX0A 1JZ7A 3VCRA 1XGEA 3QVQA 2FH8A 3HIJA 4K68A 3ETRB 4RPQA 3CWOX 4IJCA 3CBWA 4UFJA 5U4NA 3PJXA 2Y7FA 4QEHA 2O4QA 2X40A 2J75A 4MWAA 2X1SA 1VEPA 2FB3A 2YB1A 3SN1A 1NWUA 2INEA 4IG2B 4K7VA 5CLWA 2PRLA 3STCA 3N9RA 2WCGA 4FHAA 3IGUA 1WAWA 4GYFA 1R7AA 2H9AA 1VJIA 3UYIA 2WC4A 3GE7A 3RXZA 3TLQA 2CLEA 5AHFA 4CCEA 3LCWA 1BVZA 1E43A 4BI6A 5D9NA 4DEFA 4CU8A 4C6FA 2QCLA 2ZTKA 3TTOA 4QX4A 4IF2A 2WW5A 3T09A 5CPTA 5F2GA 1TWZA 5I5RA 3W76A 2QGHA 3AZTA 4UR7A 1CXEA 3FEMA 5AHNA 4S3GA 4UFMA 4HGXA 4QG9A 5ECVA 2QCFA 2QZRA 2OYKA 2X2GA 3GYEA 1G7VA 4AMCA 1SJDA 1GJPA 1TUFA 4ATDA 2HNHA 1D2KA 1Q4WA 2VDHA 3TU9A 5HBFA 1DJIA 2J74A 2W66A 4V1YA 2PDPA 2RHGA 4ZO8A 2PTZA 4JX6A 3N2XA 1SFJA 3RIKA 5CAHA 1J96A 3ERPA 3KE0A 4I6VA 2VUYA 1BYBA 5AC7A 3D0CA 4D9PA 1A5MC 4J2MA 4XV0A 4LAUA 1UH4A 3UWWA 3FVDA 2XSBA 2Z1XA 4XTIA 2E40A 4O0ZA 1PTGA 4LWWA 5ER0A 4PBGA 2ZRVA 3U7VA 4P2VA 1OSEA 2E1WA 4HNTA 1RK6A 1J12A 2D0HA 1Q45A 1KXVA 3UXAA 2EPNA 3D3AA 1GHSA 1H41A 4JN7A 3THCA 1Q65A 3SRFA 3NVVB 3CK5A 4MY8A 4G6CA 4DI9A 3POCA 1OX5A 2TYSA 1P48A 1RALA 4QDMA 2QF8A 4GVGA 3W29A 4LPCA 5BU9A 3R10A 2GGHA 5XIMA 1H62A 4PUJA 4K1WA 1H0IA 1EB3A 4LT9A 1QK0A 3G2GA 3V0SA 3R58A 1ZKQA 3GBEA 3VDAA 1VH7A 1VQZA 3NQMA 1AQHA 2WHMA 4LYQA 5A2BA 5B7YA 1J0KA 5A6TC 4NHVA 3VGFA 4TTGA 1NPXA 2XIOA 3GG8A 2VURA 5BRBA 3EB4A 3THUA 4S3EA 3NXFA 1S2AA 2BASA 1W56A 2GGJA 2Y63A 4PMVA 3NVYB 1GJUA 3W75A 4NQ1A 2E5BA 1W9DM 1K8ZA 1UIPA 4JCMA 1SZNA 3W7RA 9XIMA 3MVIA 1HKJA 2QEZA 2YCKX 5HATA 3S9IA 4YTQA 4H8NA 2QULA 2J25A 3WH8A 2VFFA 2D69A 3R94A 2QLYA 3LADA 4TX6A 3AJ7A 4OUIA 3IV3A 1SR0A 3MWAA 4L4OA 1B30A 1GRFA 1UD6A 1CB2A 1JF5A 2Y5SA 1W8GA 2VC6A 2VC7A 4UBPC 1GRAA 1P6WA 4HD5A 3U48A 3IS4A 1R2RA 1ZB5A 4XQ6A 7XIMA 1SPQA 2H3DA 1RBLA 4ICNA 4FLOA 2OQHA 2XH2A 2W67A 5IDZA 3GHTA 2WLYA 2WM0A 4S3BA 4P8XA 1N8FA 2JE8A 1I1WA 3WKZA 3W1MA 2NXHA 1HJQA 3EWXA 4XZWA 1MO9A 1K6WA 1EPVA 1JZ2A 3NO3A 3S4TA 3VNMA 3PFRA 1XRFA 1NY1A 2A3EA 1DJXA 4U10A 1HGYA 3WLJA 3EOLA 1EOMA 2G95A 3KBJA 1C7SA 1K7EA 3TXZA 2XIIA 2BB0A 3RF9A 2QUTA 4XKMA 2A5HA 2HK1A 2CFFA 3EGJA 3PVFA 3WQPA 3B8SA 8XIAA 1Q6GA 1PIGA 4UQEA 3PZVA 4PSPA 4IP5A 3N3TA 1CGVA 3E12A 3G0SA 4CQDA 1N82A 2PP0A 4U5IA 3TYCA 1EWDA 4AY1A 3UA4A 4HA3A 1UQZA 5DXYA 3SRHA 1GCYA 1XH1A 3ONCA 3RITA 5EYWA 3GTIA 1E5NA 4OOZA 3PN8A 1OZMA 4H4XA 2FJKA 4ROQA 2QF7A 3IPWA 3SI9A 1JUKA 4G1NA 3V18A 3NZGA 3T8LA 3QV7A 4FIRA 2ZZ4A 5G4HC 4ZBCA 5HUPA 2NZLA 4LVGA 4BF5A 3LENA 3RCYA 4LYPA 3MMWA 4J28A 4HQVA 2XVLA 3N2CA 4UFIA 4TXEA 1QWGA 3LLDA 3WJXA 4B5NA 4LFYA 4ICCX 2CIPA 3RO8A 5I23A 1R7OA 2BC0A 4LEQA 1VRDA 1TG7A 2Z1BA 6TAAA 1TYTA 4AYSA 3RNDA 3QPEA 1XSIA 2GDUA 3TONA 1K6AA 2XGZA 5U7SA 1LT7A 4L9ZA 3OQEA 2VC5A 2WNQA 2GQ3A 9RUBA 4MAVA 3G1DA 1I2OA 1RY8A 1LG1A 4AIUA 3C2VA 4H9MA 3FV9A 3TA6A 2E67A 5FI8A 3VCNA 4H4ZA 3DFPA 4P5UA 4EF8A 4TUFA 3EDKA 3UJFA 4NNBA 1PV8A 4JNYA 4KT2A 2OT1A 1E9IA 5JRBA 2OLAA 4AZIA 1W5PA 2GQ8A 2E9MA 1YDOA 4B15A 3TWBA 3LCGA 4HA1A 4W7VA 4FSAA 1KTCA 1QHZA 3KOXA 4B4HA 2NUYA 2VZOA 2W3RA 3BAIA 3G24A 3UBPC 5ABTA 3CUGA 4D2JA 2J8TA 3QMTA 3XINA 4QIUA 2ISWA 3AIWA 3UU0A 4PEKA 4KRUA 4DWSB 1FECA 1V3LA 1NHQA 4ZSUA 3CH0A 1X1NA 1YE4A 5I6SA 1IEIA 4Q8VA 4KWVA 3NPUA 1KM6A 1GETA 3W2KA 4O1DA 3HPXA 1XG3A 2BVYA 3O2LA 1PDYA 3RMJA 1CGYA 1QMLA 2BGSA 2OCZA 3CT7A 5C9WA 5FESA 4XISA 1V93A 5FACA 3A9BA 3T40A 4XZMX 2PI6A 3SURA 1UWUA 1V6WA 4UTFA 3N17A 5FAGA 5CZSA 1ONFA 2DSZA 6TIMA 3WNLA 2EAWA 2GVGA 3ARSA 4X2RA 2E7FA 5AECA 1GRHA 1F9CA 3MV11 5KINA 1HN1A 3AHZA 1LWIA 4Z1AA 1W1ZA 2OGYA 5G5HB 1XDLA 3M5VA 3TN6A 2DZXA 4NYYA 1EA0A 3EPOA 1S2CA 3B3DA 1ADSA 2XU2A 2YCEA 1N62C 4W8AA 4TMBA 2YZ5A 1M53A 1SR9A 5LNWA 4M6VA 5D03A 2CLMA 3OP2A 2QCGA 5I3FA 3T0BA 1Z7AA 3L9CA 3QBUA 2GUYA 1OZQA 1K4HA 1GVEA 1GNXA 4F79A 4L4MA 2ZZBA 1F3WA 1V51A 3CUHA 1TMHA 4FOKA 1X97A 1FXPA 1IWBA 3SN4A 2YR1A 3WDJA 1TCDA 3T78A 3MHFA 1C8YA 3WFAA 2BLEA 3O8AA 3BLIA 2DZBA 1G0CA 1DWJM 1WCGA 4LAZA 1A4MA 1E6QM 4ZE4A 1OC5A 1GEUA 1EDGA 1ZLPA 3GTNA 3G3MA 5I24A 4MJMA 1JCNA 2WBGA 3TZNA 2QAEA 4POCA 3DGBA 5KZ6A 3E74A 2PLCA 4JNZA 1HTIA 1H4PA 1GPFA 1LLZA 2RDUA 3TYBA 2V3BA 1M6JA 5HJXA 1V8EA 1H2JA 1PYFA 4H9XA 1R0MA 2CU0A 5LIXX 3H21A 1GTHA 3IACA 3FYPA 4AU0A 1XIFA 2Z28A 4XAPA 3KBMA 5AC5A 4YWOA 3NEHA 4XKYB 3EEZA 5CZ0A 3GNOA 1RH9A 1WXJA 3LEPA 3S5SA 4GA8A 1C9WA 4IIHA 2TPSA 4EPDC 3KZSA 3DX5A 5JBEA 4C6PA 3IJLA 2VGGA 1IGSA 1A3HA 1JG9A 3M4HA 1B0IA 1JDAA 1BQCA 3L67A 3GIQA 3H2CA 3DERA 3OVPA 4WSJA 3Q67A 2BY3A 3ZR4A 3S6TA 3BANA 5MF5A 3M1ZA 4E4UA 1KR1A 5DRIA 5EMUA 3UG5A 1GG0A 4N9EA 3A7UA 3KTXA 3WBYA 1UR9A 1ONWA 1C91A 2G8ZA 1YQZA 3WJWA 4EQWA 1YBQA 5HNUA 4MWAB 4RUBA 1FHUA 4HU8A 2VWSA 2HROA 4KIRA 1KFWA 2WP5A 3AMDA 2JFEX 1IXPA 4C1KA 1PE1A 1BFNA 1W3TA 2H9AB 3IGSA 3B0PA 1OWQA 2ZQ0A 3SBFA 4JFTA 1JUBA 2CHOA 2VEPA 3BSMA 4X3ZA 1YTKA 2NPXA 4JCLA 1IXNA 1Z41A 2C16A 1I2NA 2NWSA 2ALRA 3V36A 1GG1A 3WQDA 2A0NA 2J27A 3LRKA 4LY4A 4V2XA 1QNOA 2JK2A 3M7WA 1E0VA 4DUXA 3F2BA 3LU2A 1AD4A 2GJXA 5LGXA 1M7JA 2QNEA 3SAZA 3URAA 3V4BA 1NHPA 3L4ZA 4C6NA 5GJMA 1E6SM 4PMZA 1KBLA 1XHCA 3CYVA 4ZE5A 3ZJ7A 3MT1A 5I02A 3DBNA 3GYCA 2RAGA 1JRCA 1B57A 4FZIA 4RV3A 4XZIA 4A3YA 3PPFA 1P0NA 2E25A 1KLZA 4R9OA 1QWKA 3H2NA 5E0CA 4YTSA 5C7VA 3W7GA 3FS2A 3SEPA 4GYPA 4ZMGA 4DAIA 1AL8A 1XBYA 4Z2KA 5HMFA 1NDWA 1VDVA 1KV8A 1KFKA 3PF3A 4L9YA 4A2SA 5IFTA 1Q7QA 3MZNA 4B3ZA 1Q66A 3AYVA 4FNUA 2AQVA 1CECA 3REQB 3CGCA 2BXVA 2PURA 4D6CA 5DELA 1V79A 4JIQA 5AVNA 5LZLA 5CSYA 3LG3A 2PZ0A 1U83A 1ZL1A 3CZKA 3NDZA 4US5D 2XZ9A 1WB0A 3AU2A 1GKRA 1I1XA 5EFDA 4Z42C 4IM4A 1EF3A 2X2YA 1JNDA 3WMSA 5DANA 4CNPA 4PTXA 2PTYA 3HBLA 4BI5A 2CZEA 4XZNX 3WMBA 1X6LA 3QQ1A 3V1PA 1M9HA 3PANA 4BFAA 1JZ3A 1TYPA 2YVJA 5D8WA 4B5WA 4M51A 4ERGA 1KM3A 3SQPA 3MUAA 3TAKA 3USZA 4EAYA 2V5LA 1V3JA 4BQ4A 4EACA 3CIXA 2WO5A 3A13A 4AY7A 5FMHA 5C54A 3GVRA 2DDXA 5A6SA 2DH3A 4O57A 1MYRA 2PDWA 3GHUA 2WCSA 4PCFA 5LA1A 2BMBA 4KKXA 2WSPA 4ROPA 3ZSTA 2E6DA 8XIMA 2J66A 1D8WA 3LHZA 3L66A 4QS5A 3AIVA 1SGJA 2CLPA 4E2VA 4F9DA 2VX6A 1AMYA 1Q63A 1K8XA 2RGLA 1MDLA 3GSMA 1TTPA 3TOYA 3W86A 2ZBTA 4J3XA 4DPQA 1IEQA 3A47A 3H7UA 3ICJA 3WDPP 1X2GA 4GH3A 1W3KA 1MXSA 3CB3A 3P0XA 1O68A 4FR1A 1VD6A 3KLLA 4GCXA 4NJIA 1OD8A 2X0HA 1S5MA 5AC8A 1MEHA 2ADAA 3IC9A 1VCVA 5KITA 1DJGA 4PTDA 3C0SA 1NOWA 2YDRA 4OWGA 3CXBA 3VO0A 3E2VA 1V7YA 4O53A 1ZTVA 2I17A 3FXYA 2PLJA 4GYJA 9CGTA 1O5RA 3URHA 1TPDA 1J4EA 1KN0A 2HRWA 3VABA 3QQ0A 3QV8A 3KCLA 4OUEA 2QDHA 3H24A 3H70A 3MO4A 4XVEA 3QC0A 4LV9A 4IMFA 1VFUA 1Q6RA 1ZJBA 2Y4SA 4NUWA 4JTJA 5HPCA 1QJWA 3LA4A 3OZMA 4DXKA 3KZPA 2YKKA 5C6MA 4ECLA 1YNYA 3UGVA 4ZXLA 4OV9A 3VAVA 3F4CA 1RJRA 1KXQA 3FKKA 3PBUA 1X1ZA 3EX3A 1TMLA 1JVNA 1LQAA 1RK5A 1SFLA 1B9ZA 3SGZA 1FP8A 4IZGA 3MVTA 3OVQA 3WYZA 3H54A 3FFSA 3QC3A 3ZWSA 4UOZA 2PCQA 4AEOA 1C29A 3BSGA 1RAKA 3RRXA 4E4FA 4PYSA 3W2UA 2JALA 2ZZ5A 4L1GA 4LCQA 2ZUNA 1TTQA 3VMPA 1DHPA 4KFPA 3W1RA 1MWOA 3NDOA 1EHNA 4JTSA 1TJPA 2ZZ6A 3KEHA 1J6PA 2BY2A 4KESA 2GJLA 1ZBCA 4XZHA 4LCSA 1Z44A 3OLEA 5C5YA 3LCXA 1FHLA 4F0MA 5BCAA 5BOEA 4QQUA 3R1ZA 2NLYA 4UTWA 5G1TA 3KDNA 2C0HA 1XI3A 1T99A 1RA0A 4AB4A 1JR1A 4QJ3B 1OCQA 1XD0A 2YBTA 3B9DA 2NQ9A 2Z27A 2A3BA 1GXFA 4Z2IA 3NVWB 4KCVA 3P67A 2G41A 3W7KA 3U2CA 5CH9A 1XRTA 2QJGA 2RDTA 1WNOA 2CWXA 4CQAA 2D2OA 4RE2A 3AIBA 3M44A 4HZ7A 5FJPA 1GJWA 4C6KA 3MDUA 2X42A 4AY8A 3SQLA 3KRBA 2UBPC 3DFTA 4HPNA 1SJCA 1UC4A 3R8GA 4I5RA 2QR6A 4IQDA 1XC6A 3VIJA 3WEMA 4CD8A 2FTPA 4LBRA 5AOUA 4MG4A 1UA3A 4JBRA 3AXIA 3NS1B 4WXYA 1XIEA 1PEZA 5LXEA 4EP8C 2VR4A 2C3DA 3UJRA 2QDEA 1MW2A 3RMEA 1ISVA 3CB8A 1I6NA 3DESA 1LRQA 3GVWA 3AMLA 1HJUA 3NL2A 3WLOA 3IAQA 1XLEA 1XLBA 1OEPA 1L2UA 4YIWA 1V0MA 5AZ0A 3AWNA 4F8XA 5TF0A 4HA0A 2X1IA 4L6OA 1T0OA 1VFFA 4C5ZA 2CBVA 3TSDA 5M2FX 1UWTA 2HISA 2Z2UA 4PN2A 3MW7A 3CV1A 1EJRC 1XQLA 3NNTA 1S5NA 4JFVA 4NJKA 3QV6A 3W38A 4PTWA 1IXQA 1EYWA 3QOKA 3GD6A 1OT1A 3M7SA 4EIVA 4RZBA 4GQ0A 2C71A 3GW3A 4H1ZA 1DKWA 3BCJA 5LNRA 1TPH1 4I7UA 5HA7A 2VT0A 2FGZA 4G7EA 3IVUA 3NQ6A 2ZX7A 4Q3MA 4AIOA 1S1PA 1FWCC 1BXCA 2Z2AA 3L5MA 1H7RA 1P1XA 1U1JA 1VFTA 3FHQA 3SY5A 2GR0A 1XYLA 2NW0A 5TIMA 3LLFA 3VKBA 3NQCA 2HS6A 1XC4A 2VOMA 4N2YA 3G0XA 1V3KA 1TB3A 4MMWA 2X05A 4ZB0A 3TMQA 1JIBA 4GCAA 2EG7A 1W1PA 3LDVA 3NZRA 5T9CE 2Z0IA 1RCQA 1S2UA 1MEIA 3VOHA 4O10A 3UPWA 4TTUA 5BMXA 1J9YA 5HJLA 3S1WA 3WLTA 3SUSA 4MADA 3AIQA 1XYMA 3KP1A 4Y9NA 4QQ3A 2TAAA 4NVTA 2R1MA 4FAMA 3C5QA 4PMQA 2NVAA 2XH4A 1F3XA 3M47A 1R2SA 2I9EA 3ANVA 1B3OA 3RM4A 2W91A 1QDSA 3LPOA 2BWGA 5CCZA 3CZGA 2OKTA 3IAPA 3SW6A 5CJ5A 4ZOBA 3DFOA 2WPEA 1EO7A 2F6KA 1LL4A 4HB7A 3BO9A 5IBXA 3I6EA 4JTDA 2E0PA 1VYRA 4FB7A 1E15A 1I0DA 2QCNA 1O12A 2WCAA 5LGZA 3SM0A 5I0DA 7ODCA 1E6RA 2QIIA 3DUGA 4PMJA 5GJNA 1XW8A 1J0JA 1G5AA 1TJ0A 5CBBA 3OVGA 2W27A 3VOCA 3GWQA 4IFRA 4MOZA 5FJIA 1XD1A 3CTLA 3WBXA 1W2VA 1OJXA 3QHMA 5DMLA 2Z7KA 2CZ5A 2ZZCA 1EYEA 1FWTA 3TYEA 5H8MA 2PDNA 1RUSA 5A8NA 2Z1SA 1YBQB 4Y9PA 3QSTA 4WK9A 3UW6A 1OGGA 3NIYA 4HHMA 1IT7A 4OTKA 3WF0A 1C90A 4W84A 2V5BA 2QDGA 1MEWA 3SQMA 2P8BA 4NAEB 1K9DA 3ABSA 2A7RA 2BP1A 2F9RA 3R7MA 1B90A 5FAJA 1WZLA 2OEKA 4O15A 3R07C 3HURA 1UWAA 3W7CA 3LN3A 1OINA 4UQ9A 4NX5A 4J7RA 3AHTA 4MDPA 4YCPA 4IIDA 1XICA 1BVNP 3KAOA 3JU2A 3EDDA 5JVLA 3IJQA 4CNNA 1SU5A 2YIHA 4GIYA 4RCXA 3NPWA 2JKPA 2GJXB 3C56A 3NQFA 1G6CA 4B5XA 1GVYA 1HKIA 1XLJA 1J93A 3W01A 3ZLFA 1OHLA 4B9ZA 3TQKA 1MOKA 1E9LA 3NDYA 3JZEA 1HL2A 4LV4A 3MKKA 5JIWA 3VNYA 3N9SA 1ZSXA 2Q71A 4DJFC 3TN4A 1BRLA 2XIMA 1GOKA 2J7EA 3WH6A 1DQUA 3KOWA 4Y8EA 3TJLA 2X8CA 1PX3A 2FB2A 2E9BA 2WC7A 3B8DA 3E2SA 4LC6A 3BJFA 1GEHA 4O8RA 1Q6CA 3M5XA 4GC3A 3EPMA 4REQB 3VKDA 4HMEA 3N12A 2ZXDA 3FA5A 4S3KA 1A0EA 3WEOA 4MYAA 4JYEA 1VPXA 3VD7A 3E2QA 4AZCB 4RNFA 4FLSA 1DOSA 3WENA 5EA9A 4IIBA 3WQVA 1TELA 1BWKA 2DJXA 3BZJA 4WDXA 1QBAA 5E93A 3BOLA 3FSUA 1XLGA 2OJPA 2VNCA 3W2LA 2HNEA 1EC8A 4BF7A 5FEWA 1H7NA 2VRQA 2UZ9A 3ZXWA 1W5OA 4EVZA 2ZZ0A 1Q6DA 1E55A 2QCMA 3O0KA 2BGNE 2OX1A 2ZE0A 3MUCA 2DZWA 4FI4A 3WBAA 1ZJHA 5A8GA 1R9ZA 3TR9A 2JK6A 1J79A 5JXQA 7TAAA 4K37A 5TR3A 6CGTA 4M6QA 4WKHA 3ES7A 5TNVA 2V6AA 5EMLA 1GRTA 1OGSA 1G67A 2F8QA 4HMDA 1XLIA 2YCLA 2HE8A 3B4YA 3B04A 1FH8A 4H9TA 1OYCA 5G2WA 3W6LA 3WK0A 3NPVA 5HR7A 1POKA 3B03A 3VNLA 2HWGA 3W2MA 1X2HA 2NUXA 4R5EA 2HQAA 4QNWA 3NOEA 1E5JA 1DWHM 1FFRA 4CKQA 3UYCA 4QAIA 3CMFA 3URNA 4H4PA 3VD5A 1FKWA 1JCXA 2PA6A 1OF6A 3CO4A 3CPGA 3DI1A 4O16A 1EJSC 4JHOA 1GZJA 5I79A 3ABRA 4MKNA 4WVXA 3CIVA