3I6EA

Crystal structure of muconate lactonizing enzyme from ruegeria pomeroyi.
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
370
structure length
356
Chain Sequence
LEQKIIAMDLWHLALPVCEIVVLRLVAEGGAEGFGEASPWAVFTGTPEASYAALDRYLRPLVIGRRVGDRVAIMDEAARAVAHCTEAKAALDSALLDLAGRISNLPVWALLGGKCRDTIPLSCSIANPDFDADIALMERLRADGVGLIKLKTGFRDHAFDIMRLELIARDFPEFRVRVDYNQGLEIDEAVPRVLDVAQFQPDFIEQPVRAHHFELMARLRGLTDVPLLADESVYGPEDMVRAAHEGICDGVSIKIMKSGGLTRAQTVARIAAAHGLMAYGGDMFEAGLAHLAGTHMIAATPEITLGCEFYQASYFLNEDILETPFRVEAGQVIVPDGPGLGARADPEKLEHYAVRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Muconate cycloisomerase I
publication title Crystal structure of muconate lactonizing enzyme from Ruegeria pomeroyi.
rcsb
source organism Ruegeria pomeroyi
total genus 126
structure length 356
sequence length 370
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 5.5.1.1: Muconate cycloisomerase.
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3i6eA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3i6eA01
5FJTA 2DW6A 3ZLFA 3DG6A 2ZADA 4Z17A 2OQHA 4G7FA 3Q45A 1MRAA 4A6GA 4E4UA 1TZZA 1JDFA 1WUFA 3RO6A 3H70A 2PA6A 4IP4A 3TCSA 4E6MA 1P48A 4X2PA 4E8GA 3R0UA 3QKEA 3DFHA 1TKKA 4JN7A 4IT1A 3V5CA 3MZNA 2PGWA 2QQ6A 3MUCA 4ROPA 3TJIA 2QJJA 7ENLA 4GYPA 4G8TA 1NELA 4JHMA 3QTPA 3H12A 4F4RA 2AL2B 5J04A 3JW7A 2QGYA 2OZ8A 3Q4DA 1L8PA 1JPDX 4DYEA 1MDLA 3ES7A 2OPJA 5FJRA 3PWIA 2PU0A 3RR1A 4M0XA 3DG7A 2NQLA 3TOYA 3KUMA 3UJSA 1DTNA 1SJBA 1EC9A 3TJ4A 3BSMA 2QDDA 3DG3A 1F9CA 1EC8A 3I4KA 3MY9A 4E5TA 3RITA 2AKMA 3IJIA 2GGEA 5FJOA 4IZGA 4K2SA 1MUCA 3NXLA 2DW7A 3DERA 4FI4A 3DESA 1JCTA 3VC6A 2GGJA 3CK5A 3QPEA 1NU5A 2P88A 2OVLA 3P93A 4HNLA 1SJAA 4MGGA 3FJ4A 4MMWA 1WUEA 3U9IA 3R11A 4MKSA 1MDRA 3VA8A 3GY1A 3UJ2A 1W6TA 3UXLA 3SN1A 2HXUA 3BJSA 3PWGA 2GGGA 5BOEA 3T6CA 1KKRA 3OW1A 3N6HA 2PMQA 5EU9A 1EBHA 3OPSA 3V5FA 2GSHA 2XH2A 3CXOA 2GGIA 4EWJA 3CYJA 2GGHA 2GL5A 3P0WA 3RRAA 3IK4A 2P8BA 4ZA0A 3ZVHA 3GO2A 3D47A 3I6EA 3S47A 3V3WA 2HNEA 3H7VA 2HXTA 4M6UA 4ZCWA 3ZLHA 2OKTA 4HCDA 3UJFA 4IHCA 1PDYA 4HN8A 1R0MA 4IL2A 2OG9A 1ELSA 3ZVIA 5FJPA 3NFUA 3SN4A 2XGZA 4IP5A 3GC2A 3H8AA 2P3ZA 2OLAA 2OQYA 3K1GA 4JN8A 1OEPA 3T9PA 2AL1A 3NZGA 1EC7A 3MKCA 2PCEA 3VC5A 3FXGA 1PDZA 1EBGA 3CT2A 3SN0A 3D46A 4A3RA 4YWSA 2XSXA 3TWAA 3SJNA 2PS2A 3JVAA 4KT2A 3NO1A 1MNSA 5BOFA 3RGTA 3VCCA 4J1OA 3ZVHB 3TW9A 2RDXA 3TWBA 2OO6A 4H19A 3EEZA 1E9IA 1XS2A 1ONEA 3P3BA 1SJCA 3OZMA 2O56A 3PK7A 2PU1A 3EKGA 4K1WA 4HPNA 2POZA 3N4FA 2ONEA 3OP2A 2QJMA 1SJDA 4Z1YA 2PTWA 4GFIA 4H83A 4HYRA 4E4FA 3ES8A 3STPA 2PP0A 3MWCA 3UJEA 3OTRA 3ENLA 1KCZA 2PGEA 4ENLA 4HCHA 1XPYA 2AL2A 1KKOA 3V4BA 2PP3A 3R0KA 3FYYA 3TTEA 3SSZA 2XH7A 4HCLA 3VDGA 1BKHA 3ZLGA 4GMEA 3MSYA 3IJLA 3UGVA 2OZ3A 2QVHA 3UCDA 4KPLA 2OX4A 3TQPA 5ENLA 3SBFA 4DXKA 2P8CA 1IYXA 1FHVA 3DEQA 2PTZA 2PP1A 3QLDA 1R6WA 3BOXA 3HPFA 3T8QA 2GDQA 3UJRA 3UXKA 1RVKA 3DGBA 3IJQA 4KWSA 3R10A 4K8GA 1P43A 2PODA 1JPMA 4H2HA 6ENLA 2MUCA 4DHGA 4DX3A 1FHUA 2PSNA 3QN3A 2P0IA 3FCPA 3RCYA 3VFCA 3UCCA 1TE6A 4J3ZA 3DDMA 3R1ZA 2PTXA 3PFRA 3B97A 1ECQA 5FJUA 3THUA 3SQSA 3MQTA 3T4WA 4DN1A 4GGBA 3U4FA 2I5QA 3R25A 1YEYA 2PPGA 3JZUA 4GISA 2PTYA 3DFYA 1KD0A 3FVDA 2CHRA 2MNRA 3CAWA 3GD6A 4H1ZA 4GGHA 2AKZA 2QJNA 5IDZA 3VCNA 2FYMA 2FKPA 2QDEA 3S5SA 3N6JA 2OFJA 3FV9A 1BQGA 2ZC8A 3I6TA 4A35A 2OZTA 3DIPA 2HZGA 4GYPC 4IL0A 2XH0A 2XH4A 4FP1A 4HNCA 4GIRA 4KEMA 3OZYA 4DWDA 3CB3A 3N4EA
chains in the Genus database with same CATH superfamily
2QHAA 2E9BA 2DW6A 3C0JA 5A8MA 1XYBA 1TV5A 1ISXA 1TPC1 3NZQA 2QF7A 4DWSA 4MFDA 1BFNA 3EMCA 2FTPA 5JCLA 1NQKA 3C0SA 1KM2A 3H70A 4D1IA 1FHLA 2NUYA 5I23A 1A3WA 1EHNA 5BOOA 3EF6A 1KB3A 1QBBA 1A53A 4MWAA 1XIMA 3SQMA 3FS2A 1X1NA 2GQWA 3W7NA 3PR2A 4B2DD 4AW7A 3SURA 1UOZA 3GUGA 2J4GA 1C92A 3KL5A 2JKEA 4Z2JA 3TN5A 2G4FA 1E15A 1VFHA 3MWAA 1CLXA 2QUNA 3AMKA 4Z2KA 1VKFA 2IPGA 1G7UA 2QGYA 2OLHA 4ZSTA 2GVYA 2Z7GA 1LROA 4XAFA 4O8RA 2BX7A 3BZJA 3TXVA 4CD5A 1VDVA 3DAQA 2XIIA 3WBWA 2E09A 1DTNA 1NVMA 3URAA 2YGYA 3LD5A 1KXVA 3CZLA 3PFMA 4LY8A 4IWWA 5DQPA 3UQNA 4RE0A 4K6AA 3IJIA 3HMCA 4JDBA 1QATA 4CLMA 1ZENA 4CKQA 2O0TA 3GTHA 1M6JA 3VKJA 1TV7A 4HBKA 3DERA 3MI3A 3W75A 3MMTA 1FWHC 3DN5A 1G1YA 2BGNE 1SFSA 4JTTA 4ZFMA 2YZ5A 2WSRA 1EYWA 3VIPA 3UZYA 1E1CB 4ES4A 3F4DA 4AFYA 1DWGM 4NEWA 4NT0A 1SFTA 3FJ4A 4N9CA 1UUMA 5TQLA 3KRSA 4MY9A 4YS1A 3VIIA 5CJ5A 2D0HA 1XLDA 1XP3A 3FA5A 3PG9A 3UXLA 5AFDA 4DELA 5EMKA 2E9MA 1QK2A 2GGGA 3N2BA 2XVLA 5BOEA 1QBAA 2H3BA 2EPMX 3OW1A 1K9EA 3EOOA 4WY0A 1OD8A 1OADA 3ITLA 2OGYA 1Y7VA 4WIWA 1G4EA 2R1NA 1VYRA 1EHAA 2UY2A 4B5NA 5G5IA 3ZVHA 3VGGA 2ASHA 3MSDA 1N5WC 2BBFA 1M3UA 1HTIA 1KTBA 1XLMA 4DF2A 2OQLA 3VIOA 3AS2A 4KFOA 1GEQA 3TA9A 1MW3A 3NGJA 1FWFC 5DO8A 2V3AA 1FWIC 2QR6A 2WNWA 2VCAA 1V6VA 2I1OA 2WHMA 4K68A 3S6OA 1FWSA 3N1AA 3R8GA 3I7SA 4X9YA 2PDPA 3T9PA 2EJAA 5HXMA 3MKCA 3AWNA 3A7RA 1UCWA 3ZFHA 3WL1A 1UPPA 3SQLA 1TJ0A 4UTTC 2E7FA 1EX5A 3E02A 4W89A 4BZYA 3ZJ8A 1ZK7A 4CNSA 4MY1A 2VZTA 1XRFA 1WAWA 5CC6A 1JYVA 3BK0A 4QCEA 3H55A 4QDPA 3W73A 3DHDA 2C8NA 3RRXA 4APNA 1KR1A 1I8JA 4M6PA 3RILA 4IIDA 7ODCA 1EO7A 3AISA 5HPCA 1I1WA 3VTRA 1SO4A 3TQKA 1I60A 4TO8A 2QJGA 3TYBA 2YL8A 4PMUA 3TVAA 1LLOA 3GVRA 2CHNA 1XS2A 5A6BD 4JQ4A 1OX6A 3WQ6A 4XX6A 1JIBA 3P3BA 3WLHA 2X7WA 4QROA 4GQGA 1V6TA 1UD5A 1WDWA 3RJYA 4D6CA 4KWUA 3PB2A 2QJMA 3TLLA 4Q7BA 3MP5A 1SJDA 1GVOA 3E0IA 2BMBA 1LWIA 3G77A 3NDOA 4JICA 3ES8A 2V6AA 2PP0A 5A5WA 3UYCA 2GQ8A 3QY8A 3POCA 1JGIA 3W2NA 4GHRA 4WGXA 4LAMA 5EPDA 1XICA 4HSNA 1IWPA 1I45A 4MB3A 2VC9A 4AMAA 3B9DA 2J7DA 4D8ZA 1XQKA 2YQUA 2P3EA 1P7TB 1BPLB 1H6VA 2OEKA 5C8BB 8TIMA 1HX0A 3MSRA 5CBBA 1TYPA 1FP8A 4FEZA 4M29A 4GIEA 1ZUAX 1Z41A 2PTZA 3O15A 1JRPA 4BF5A 2ZZ0A 1W3TA 5M2FX 3GNPA 4MLJA 1K4QA 3U0HA 3EOEA 5MKGA 3WD4A 4O13A 2PODA 4H41A 2YW4A 1O5QA 1R38A 1PX8A 4YVVA 2PSNA 2J77A 4UTUA 1R3YA 3DYPA 4GUGA 3PM6A 4LTSA 3SCWA 2J27A 1OC7A 2CESA 4MIMA 1B2YA 3FYPA 4G2DA 1GQIA 4N42A 3P8IA 4U28A 1HF6A 1BXBA 2I5QA 4PMVA 1YEYA 3N9KA 1Z7AA 1QI0A 3M5ZA 4NYYA 5EBAA 3GXTA 2KZHA 2GR2A 2CZDA 1CLVA 4CNNA 2FGLA 4XIMA 1FX6A 2BDQA 1WDSA 2ZE0A 3OBAA 4DPPA 3VZZA 2VX6A 2YW3A 2PEVA 5IDZA 1EEXA 4X0VA 1VFLA 2PLJA 1GZ1A 3A5VA 3AALA 2EKCA 3NQMA 4JDRA 3AIEA 1S3TC 1TFVA 1T40A 2YXOA 3N3TA 1IIGA 4TMCA 3GWQA 1S5VA 3OZOA 1I0DA 3W7KA 5KZMA 2EQ9A 2VFGA 4PUEA 1VB9A 2WHLA 4GXPA 2ADAA 3N4EA 1PKYA 4R85A 1G4PA 4LS0A 2TRSA 3B8TA 1K9DA 1ZDLA 1E0TA 3GK0A 1LVLA 3W82A 3GR8A 3ISIX 1JYXA 1KO0A 4HK7A 2EPNA 3VOGA 2ZRWA 1NM9A 2VVSA 1OFRA 5HMDA 5FCZA 3BO9A 4O28A 2Y7FA 4R33A 3M6DA 3LX9A 4BQ5A 4M7SA 2DZVA 3KWSA 1XKJA 3F4NA 4AD4A 2PAJA 4UTFA 1Z42A 2GDVA 1W2PA 4IG2B 2WPCA 4BEUA 1R47A 3T0CA 3GVWA 3AZSA 4YHGA 2FHCA 4EQWA 1A5MC 1XLFA 1J01A 2Y0FA 1R2TA 4AZBA 3HG4A 1GKPA 2O7SA 5H8MA 3WH8A 4DVOA 1KM6A 1K8ZA 4UTKA 3TR9A 1GTEA 1H63A 1NWTA 1SB3B 4RDZA 3MBDA 4AMCA 1TWWA 3MUZ1 3A64A 2PLMA 5FJRA 1XJBA 2ZUUA 2W62A 1GESA 3QSRA 4M0XA 3AHYA 1N8FA 1MW0A 2YVGA 4ZSUA 1QRQA 4QGCA 5AYZA 3IPWA 4DWSD 1SJBA 1TSIA 1PEZA 4QJ5B 1LOQA 3QPYA 5D9NA 2G3NA 5A1AA 2VR5A 2E5DA 5D2YA 3RO8A 4CNUA 3CLMA 3B40A 3BMVA 1F07A 3WLIA 4MWAD 4H4SA 2A3AA 4L6HA 2IUZA 3W1AA 1S3HA 5D2XA 4ZB0A 4GPNA 4Y8EA 3VXGA 3W38A 1QW8A 1TPFA 1TQJA 1R8LA 1XLLA 4CN1A 3CUIA 2W0UA 1L6SA 4CEUC 1VFTA 2DY3A 1WUEA 1F76A 4FLQA 3NS1B 1GJUA 4O18A 1OZMA 1R7AA 2BY0A 3PPCA 4UOQA 2HISA 1OFQA 3BCJA 4Z2GA 1UZ1A 1FBAA 3TAOA 4LS1A 4P8WA 3STFA 1PUDA 3EWWA 3FJLA 1TX2A 4MUZA 1XIGA 2CFYA 1B57A 1LOSA 5JMUA 3IRDA 1W1YA 2CKSA 1XSKA 4F2TA 1J4EA 1IXPA 4D6FA 4MTVA 3DZ1A 2G4JA 2GGIA 3PNZA 4EWJA 3SB0A 4YJ5A 2YVFA 1OFEA 4N4QA 3ARWA 4O11A 3QFWA 4L1XA 3D47A 4XBJA 4MPQA 1C91A 4QSFA 4K7YA 4JQ1A 4J3XA 4GWEA 2E68A 2Y7EA 2ISSA 2ATSA 3BICA 1C9DA 1IXOA 1ZBWA 1Q7MA 1ML1A 4J3TA 3WFAA 2WB5A 1R3VA 3MHFA 2X09A 1FWNA 1KM5A 4H9XA 4C6IA 3R12A 1H4PA 1R2RA 3K1GA 4ORMA 3NTYA 3WNPA 3AIVA 1JCLA 1R3TA 4NUWA 4DUVA 3LHWA 4G1KA 3TSBA 3A4AA 1VBHA 2WAGA 4YWSA 3GIYA 2PRLA 3MJMA 2WP5A 3ABRA 1UR4A 1F8MA 2BGQA 4YPJA 4J1OA 1ITUA 3O0KA 5AYBA 3OQ8A 4LC6A 3W2MA 1DQWA 3CUJA 3BXWA 1A5SA 1ITQA 4Q8MA 4RW5A 1IGWA 4Q32A 2Y89A 2B7NA 3OZPA 3MVTA 1EEPA 4GUIA 2Q8ZA 7REQA 1E4MM 3GHTA 1D7KA 4FLSA 1FECA 1GOXA 4HZMA 2CC0A 1SZNA 3PTDA 4JIPA 4K36A 1XGDA 5DBTA 2ZZ7A 3AROA 3NVZB 1S1PA 1C93A 5AC6A 1BGGA 3VX0A 3WF2A 2VDIA 3KVKA 1FWEC 3CGCA 4JIHA 2ZFAA 4FOUA 2DSVA 2X8CA 2PC4A 5CJMA 4HK5A 3H21A 4HYRA 5I3HA 4AYGA 4GXWA 3PUEA 1SW7A 1W1TA 3NGFA 2VZSA 2J7HA 1R85A 1XLEA 2NQ5A 3T1GA 1I2PA 2X99A 3W27A 4B9ZA 2WKLA 3TA6A 1WCGA 1DPMA 3W84A 4NJGA 2Z1KA 3OLIA 4LBUA 1AH4A 1G5AA 1NOUA 2WMIB 4AQLA 2CHOA 2R94A 4WF7A 1JDCA 4NILA 2Y85A 2HS8A 3L4UA 1NTHA 3PY2A 1QCWA 3PZNA 4UWMA 1IIHA 4M82A 4HA1A 2P8CA 4DLFA 3ORWA 1HKKA 3HPZA 2PLCA 1K3UA 3C2EA 4NSBA 4H4PA 3L2IA 3EBVA 3W6YA 4GJIA 3UGRA 1EWDA 4AY7A 3IS4A 5CPQA 3SUUA 2WO5A 5A8GA 4RLIA 4DXXA 3BG9A 2D2OA 1FFVC 4BCEA 1YQZA 3ATZA 3QLLA 4DX3A 1SVDA 1VBRA 4G6CA 1FHUA 3OYZA 4OHQA 5AYYA 2P53A 4GABA 3HF3A 4PRRA 3EUB3 2DPEA 2VENA 4AU0A 1SO6A 3HJEA 3KBSA 4HOXA 1R7OA 4BF7A 2QAFA 3M0LA 4MFEA 4ZMGA 1NWRA 1B0IA 5JCMA 3R25A 3JZUA 4DEFA 3B9AA 3WD1A 3Q37A 3I3BA 3CQHA 2P50A 2W55A 5T91A 4IX2A 2AKZA 3EAUA 1ICPA 1VIZA 1AJZA 5HOSA 8XIMA 1GVSA 2EG6A 2IW0A 4ACZA 4F0RA 3GIPA 3R0DA 3NIYA 4DJEC 3QGVA 3FHQA 4CCZA 1ZGDA 4WHBA 4U3AA 3UZZA 3WH7A 1PIIA 5JIPA 1W56A 1DJWA 4IFKA 4DXVA 3ZSTA 2IKJA 5HUOA 2V2CA 2XPKA 4GI9A 5PTDA 4WLCA 3RU6A 3BH4A 5C9XA 3UWZA 1VD6A 4KWVA 4MKNA 2D20A 4Q8PA 3UT0A 4PUUA 2BSLA 4HK6A 4ZO9A 4Q4RA 1R3QA 1JPKA 3WMLA 1JAEA 3OBKA 1AZ1A 3KCJA 3OLEA 1TREA 4BY3A 1UD4A 1TR9A 4GIYA 3WDIA 2DVTA 4H2CA 2ZRVA 3NO3A 2QQ6A 3QC0A 1BQCA 4LBRA 3EOUA 3CZJA 7ENLA 4YVPA 2DT0A 1VHNA 2TMDA 3B0UX 1RQEA 4F9JA 4JTKA 3CV2A 4JKMA 3SZ8A 3TZNA 1RZMA 1RBLA 2W6RA 3MP3A 1B5TA 1UBSA 5JU6A 2OZ8A 5M03A 2Z00A 1C8QA 3KM8A 4W88A 1E3XA 1UIPA 4BWLA 2H8ZA 1KXTA 5LNRA 1EA9C 1LLZA 3FN9A 3KUMA 3VOIA 1EC9A 1ZP4A 5I3JA 4RZBA 3FDGA 4PN2A 2OODA 3PJUA 3SJ3A 1VFOA 3ZJKA 1S39A 2DU2A 1JR1A 1S5MA 3WQ5A 4F2UA 1QR7A 3NXLA 4GZ7A 3CWOX 4GE8A 2BXYA 3T0DA 3L5LA 1JCTA 2Y88A 1YBQA 3EWZA 3KEHA 5F4WA 1XIFA 3OYXA 4W5ZA 1RH9A 4Y8FA 4AY1A 4XG1A 3L67A 3WQPA 4D1JA 1CXFA 4ZBCA 1OHLA 3WBXA 1JUBA 1U1HA 4MGGA 3M0KA 1LBMA 2L5HA 1ISVA 3U9IA 2VFHA 1GW9A 3OGVA 3UW6A 2DUZA 1NHRA 1GTHA 1QHOA 3LCLA 1US3A 4O15A 3BW2A 5DXXA 3V35A 3PWGA 3N2OA 5FF7A 5HJXA 3RLHA 3NEHA 1TTJA 1O5RA 2F5ZA 3EX3A 4UR8A 1HJUA 3S1XA 3RXZA 4AWUA 1OZQA 1HW6A 3QYSA 2WJFA 3RN6A 1YXCA 1WYGA 4OOZA 1E43A 1AUSL 3FX4A 3H7VA 4ZO7A 1DJGA 3NCOA 1J0YA 2X0HA 4AEOA 5LXXA 1Q66A 4LRTA 1ZHAA 4UTJA 3STEA 2WHJA 3S83A 4H4YA 1GKQA 3WCZA 3OIXA 4JQAA 2CFFA 5CPLA 1SZGA 1S2CA 3GZAA 5T9BG 1O1ZA 2D3NA 4ZOBA 2P3ZA 3K4DA 2OQYA 2AL1A 1GOMA 3LGDA 2UZ9A 1S2AA 2ALDA 1TQXA 3INPA 4FAMA 4XAPA 1WPCA 2WOWA 5I2UA 5E0CA 1QPKA 3TN3A 2O4MA 3NO1A 3CXBA 4XVDA 2C14A 4H6RA 4I7UA 5T8GA 3L8KA 1OX5A 2PDXA 2EPLX 3PB0A 4XD3A 1RALA 2R8WA 1PCKA 2VEKA 2NSXA 3LHZA 4Q8NA 1LRTA 4I9MA 1W2VA 3A5FA 3EKGA 9CGTA 1JF6A 2D23A 1A4LA 2G3JA 4NVTA 2OYMA 3ZJ7A 3RLVA 3L9CA 3S2CA 4GI4A 4H83A 1VRDA 1YNYA 4H9TA 3R7MA 2VDGA 4F0HA 4I90A 5AHIA 1XYMA 1OBAA 4CQDA 3RU8X 3TEVA 4DM2A 1K1DA 3RHGA 3NL6A 4PC8A 3HQ1A 3WLTA 1Q4WA 4HHPA 1K7XA 4P5UA 1U22A 3WLQA 1FWTA 1G01A 2WBGA 1IT0A 5FEPA 2XIOA 3APGA 2TPRA 4U5IA 4CGTA 1M04A 3CPGA 5FL0A 4K7VA 3KW3A 1ZNNA 3FHAA 2DH2A 5A2CA 3GNXA 3G24A 2G95A 1ZZMA 4KPLA 1Z32X 2F8QA 3A12A 5K9CA 4UTWA 3SBFA 3THAA 3W87A 2D69A 1YPIA 4IPPA 1HKVA 5HK4A 1Z44A 4PCTA 4TVWA 1WKEA 4LY4A 2Z28A 4NJIA 3UG8A 1XDMA 1IE7C 5IHSA 3VK5A 4NNBA 5XINA 1RBAA 4RV3A 3FY1A 3DUGA 5DY2A 5D9MA 3IJQA 4KWSA 2Q09A 1BYBA 2QEZA 4PCPA 3LU2A 3AYSA 1DYSA 3NQGA 3VIHA 3LCFA 3GRTA 1R5YA 1OFAA 3C61A 2R91A 2P0IA 1XXXA 4JBRA 1PWLA 4ORIA 3ABZA 3DDMA 4JX4A 4Q22A 2V5JA 3B0VC 2CLMA 4LANA 2C13A 1J9YA 4RNIA 3DBNA 4HD5A 4DN1A 2ZOXA 4LWWA 4B92A 1OC5A 1C29A 4IPIA 2VX5A 2VDHA 1TUXA 4DB7A 4GISA 5KMYA 3G1XA 5C6MA 3KAOA 2ZA3A 4C6KA 1SFLA 1O66A 2A1YA 3AYTA 3HN3A 2XFFA 3CWHA 4GGHA 1FUYA 3LV6A 1PO9A 1REQA 1ZCOA 3M7WA 3UR7A 1A50A 2AGKA 3C2OA 4PMXA 1KBBA 5I3KA 3SW6A 1THFD 4H6KA 2X8RA 1PL9A 1VBGA 4IOTA 2EJ1A 1DTUA 3WEMA 3HG2A 3VKKA 4QQ3A 5CG0A 5DT7A 5FJTA 4PTNA 3VI2A 3K5XA 3RMJA 1HO4A 4URIA 3RCMA 4B3LA 4H9YA 4XTIA 4MB5A 2P1FA 4HNTA 4O12A 1YRRA 4AWEA 5FI8A 3E6EA 1WBJA 1ZP3A 3I4EA 4HJWA 5D9PA 1XKYA 4JX5A 3W1NA 1SU5A 3GFZA 1K70A 1JG9A 4IJBA 2W0HA 2FFCA 4IJRA 1MWOA 1AD1A 1CZ1A 1V3MA 5LHFA 2ZX9A 4JIRA 3AJXA 3EPOA 1ONXA 3MZNA 3O07A 3TJIA 4B5UA 4PUMA 4HPHA 3A47A 3NSMA 4CVWA 2E1WA 3W1PA 3KTSA 1DWFM 3H12A 5EY5A 3AO0A 5HR6A 2CDUA 3KCLA 3BSGA 3VNIA 3FAWA 3IVSA 1XDIA 3NZRA 1UD8A 3GXIA 1HJQA 2V30A 4GRTA 2F2HA 3KOWA 5GRTA 4XAYA 3RNDA 4YWIA 2DSZA 5FOOA 2RUSA 2OPJA 4H9MA 2Z26A 1R86A 2WM1A 2C19A 1TCDA 2YX0A 2Z2BA 1TIWA 5A6SA 1V6XA 2CZFA 2R1KA 2DZWA 3TP4A 4M6VA 1SFJA 4RL3A 1ECEA 4YL2A 1JCNA 5AN7A 2FHFA 3MY9A 4QBXA 3MBFA 4PR4A 3SCTA 3KE0A 3ELFA 4AISA 1JDDA 4A29A 2GGJA 3N2XA 3CZKA 1NU5A 3GAYA 3MU7A 5AZ0A 4S23A 4YXGA 1ADSA 1HL8A 4XZBA 4RE4A 3SRDA 4PCSA 5TD4A 2FPTA 3PTMA 1UYQA 4UNIA 4XAGA 3CHCA 3BV4A 5I7GA 5L9FA 2YCEA 1QNOA 3AU2A 3GRSA 5AC5A 2YLLA 5D32A 4ML4A 3CHDA 3HGOA 4L9XA 3GR4A 1IV8A 2XM2A 4MM1A 3F2BA 1XYCA 3U2EA 2GGHA 1K4HA 1UC4A 3GVGA 3UFYA 1XQLA 4H04A 3WQFA 3AZTA 1HKWA 5FS9A 4JZ5A 3PUGA 3UJFA 3WK3A 4J2MA 3MI2A 3A9IA 3TNBA 5LIWX 3ZIZA 3USBA 3D3FA 1VZWA 4RE2A 1ELSA 2BVDA 4DF0A 3GD4A 3IUIA 2QIIA 3WSUA 3G1HA 1CYGA 1XHCA 4CNPA 1UC5A 1EF3A 3VIKA 3KLKA 3LYEA 4EXAA 4QG8A 4DAIA 3QEZA 4QE5A 3VNJA 4AVNA 3C0LA 3IGHX 4GJJA 2HWGA 4GX8A 5DMLA 3MMUA 1H41A 1DWAM 3QFBA 3CYVA 3UA4A 3L0KA 1TZ7A 2RDXA 2R24A 1LWJA 4LVGA 3GKAA 2JF6A 2GRTA 4UQAA 4HU0A 4B5TA 3DI0A 5KZDA 4B9YA 5TNVA 5RUBA 3AS1A 1H7WA 2WKJA 1P7TA 4XZWA 3VGBA 3L7RA 3W53A 4QG6A 1XD1A 2IPWA 4G7EB 4QX4A 3VOJA 1M7JA 3MKVA 2DQWA 4GO8A 2GR3A 1L6FA 1IF2A 2F38A 4TU1A 3O2LA 2E0PA 3BAWA 4ZOHB 2ZZ1A 1MW2A 1HNYA 1ZALA 3AMGA 2Z29A 5D33A 3DGRA 4IF2A 2YBTA 3OLDA 1WZLA 3E38A 3TCEA 3VE7A 3G3MA 4HCHA 2AL2A 2HVNA 4RJEA 1BLIA 3EDKA 1RR2A 1MUWA 4DI8A 1KGWA 2XH7A 1X7IA 2TPSA 4XZ9A 1IEQA 3DHPA 3RNMA 3G8EA 2JIWA 2JFEX 4QR6A 3QR3A 2E5CA 1JF5A 4NAFB 3VIGA 1E3ZA 2W3RA 3H4WA 4J27A 5E70A 7XIMA 1WB0A 2YA2A 3RAOA 4JY8A 4H9VA 3DX5A 2ODOA 1I2QA 1RUSA 3UBPC 3H4GA 3NPXA 1P0BA 4ROQA 1QNPA 3M5VA 1B54A 2VXNA 3NZ1A 3PNUA 4Y96A 2J7FA 1J8VA 3LMYA 3Q2DA 2R1MA 1ZTVA 1JZ7A 3WEZA 5BXSA 5K7JA 3UXKA 1GUVA 3L4WA 3EDJA 4CVUA 5KEZA 1FCQA 3N29A 1J96A 1O68A 1HT6A 2YLAA 3SGGA 3R10A 3WJZA 1HKJA 3TYUA 3LY0A 4MY8A 4H2HA 2BOEX 4ZE5A 3IUHA 4EPDC 1AW2A 3VX1A 1HUVA 3NDYA 1JPIA 3WQVA 2GOUA 4LAOA 1GJWA 4JTHA 2WNNA 2VFFA 4ZENA 4M8UA 1EJSC 3OGSA 3CTTA 4JTEA 3T4WA 4HGXA 4OQVA 4UUIA 1V6WA 1VYSX 1KFBA 4PBEA 4D8AA 6CGTA 2ZQ0A 1EJ7L 1QPQA 2NX3A 2XWDA 1NOFA 3TFXA 3CAWA 3OODA 2DQXA 3V18A 3QW3A 1CLKA 1JYWA 1PX4A 4WD0A 2J74A 3MVIA 3NVVB 3RR4A 3SCOA 1O60A 2ZA2A 1ZMCA 2OFJA 1EOMA 2CLLA 3NAVA 4GCXA 3TZFA 2NVAA 3B4UA 3I6TA 4JQ3A 5GJMA 3H23A 4WKAA 1X8FA 1F3TA 1G0CA 1HGWA 3QGAC 5DN1A 4JX6A 4EM3A 2Y7DA 1EX1A 1ZKQA 2WCGA 1F6KA 3VD9A 2ZZ2A 4FXFA 1XBXA 2NSOA 4JN6A 3GNOA 4C6CA 3Q45A 2A6LA 1MRAA 3TTYA 3VM7A 4W4QA 3AXMA 4E4UA 4MYXA 1PIFA 2QJIA 4DJFD 1CB7B 4JKKA 5M3WA 3A24A 3LLFA 3AIBA 3R0UA 1TJRA 4DBSA 3SI9A 4J7RA 3WK1A 2GJNA 4FIQA 1YTKA 4C6OA 3T2QA 3WBEA 3KBWA 4UNLA 4N2YA 1LWHA 3BMXA 4M51A 3HGSA 3FA4A 4EQXA 2J9XA 3O3RA 5DMNA 1NWSA 2QF8A 1V97A 1ONWA 3WQEA 1H1ZA 1NEYA 4EM4A 2X1TA 3SCNA 3UP8A 3LB0A 4ZQPA 2I57A 1DIOA 1YYAA 3PUDA 1TWSA 5BRPA 1HN1A 4IM4A 3SM0A 5K2ZA 4A3YA 2JF7A 1RCXB 1T8XA 4YLWA 1JZ6A 2YVJA 3LTYA 2J25A 4V33A 1M03A 3O9NA 3ME3A 3K46A 1K9TA 4PL2A 1XH1A 4K2SA 3VPLA 2YCLB 3KBJA 4FX7A 1UD2A 2BVYA 4TVUA 2Z1SA 3CK5A 2WZEA 3BAXA 2J78A 3VM5A 4JY9A 1FO4A 4Q6XA 3VIJA 3P93A 3PZQA 3QKZA 2CETA 5AHMA 3NJ3A 5JCNA 2J13A 3T8LA 4QJ3B 1YTEA 5DLCA 1K4GA 1MMFA 1TV3A 1BGAA 5BMWA 1E9LA 3K1DA 1HFBA 4I7WA 1UP0A 1US0A 1E6QM 2HXUA 1B3ZA 5CSRA 4UQEA 3S9YA 3CMGA 4YIWA 1LQ2A 4X60A 1DKWA 1XX1A 3QZAA 2GVGA 4EOUA 1XSJA 3DHUA 2ABAA 5XIAA 2GUYA 1NFGA 4LUJA 2YAUA 1OK4A 3XIMA 2XISA 3VMPA 5LGZA 4UOJA 2Y8KA 1V0LA 1PS9A 3W02A 3VFLA 3IC9A 2PD9A 4ERIA 4H4RA 4TIMA 3NRZB 4C65A 5DELA 1XHGA 3ARQA 3EMQA 2ISFA 4I3GA 3L5MA 5AY7A 4LGXA 4IP5A 1QDSA 4R7OA 1W0MA 3UERA 4O52A 3BV7A 5EFFA 1B1YA 3KOYA 4U4MA 2CEQA 1JRCA 4JIQA 2BG5A 4GIAA 2VCCA 4IJCA 4ZODA 3E74A 1ITCA 4PB4A 5K9XA 2AMXA 4UB9A 2F6XA 3REQB 5EFDA 1UQZA 2XSXA 3RM4A 5CGQA 3WNOA 3O63A 3SJNA 3EDDA 1RD5A 5C9RA 1H51A 4UXDA 5I24A 1DWJM 1H7PA 3S46A 5BOFA 3OU8A 3ALGA 3VCCA 3MS8A 3SY1A 1DBTA 2A79A 3G22A 3GIQA 7TAAA 4FA3A 4INFA 1MUMA 3Q94A 3WX7A 1OB0A 4AF0A 2PWDA 2DEPA 4DYKA 4H4ZA 1K77A 5D2WA 4KGLA 2OO6A 3VINA 1E9IA 2WMKA 2OWXA 4WR3A 4DYJA 1L2QA 3I10A 1OM0A 3FG2P 2JGQA 4FS9A 3UXDA 4K1WA 3VGDA 3W71A 2ONEA 3NVYB 3KFTA 4WCJA 3TU9A 4UTTA 2VEFA 1GKRA 3RPMA 5A8OA 1OCNA 4ADWA 1Y8BA 4QLKA 1AH0A 5I03A 3PBUA 3CUHA 3BJTA 3T40A 4H7ZA 2XFYA 2OOFA 3VDHA 3W7EA 4G9PA 5EYWA 2OGJA 1W3NA 3C8NA 4HT3A 2I14A 1IEVA 5L6UA 2YB1A 1NDAA 4R5EA 2WCSA 2PP3A 2JKPA 1OGSA 1RAKA 4CN4A 2XG9A 4GMEA 1K6AA 3CL6A 2TYSA 1G9HA 5E6YA 2NVDA 5D04C 4LBSA 3AHXA 1EZ2A 2FIQA 4FSAA 3IJLA 3MUAA 1GRBA 2QAPA 1D9EA 4YNGA 4KKXA 2EGZA 1V7YA 2AAMA 3UCDA 5B7YA 3IWPA 3SUSA 3CGEA 1XBVA 3BLKA 3W0KA 1AW5A 4X3ZA 1R6WA 3U6WA 1ZBVA 3AICA 4O8AA 4BI5A 3T8QA 1AMYA 3UR2A 2CLKA 3R58A 3IEBA 2INEA 3N13A 1UR2A 5D2VA 5EGRA 5GNYA 1D3HA 2D2HA 5AC8A 2C7FA 1KWGA 4PUKA 4Y90A 1JPMA 3W25A 3OVGA 5HNNA 1GVRA 2WPBA 1C8YA 3KOFA 1EL3A 3K4WA 3QN3A 3VKAA 3B9NA 3T55A 4BJHA 4TQTA 1BSLA 4J3ZA 3W9ZA 3TROA 2Y4SA 1UPMB 3R1ZA 3S4TA 1HVQA 1Z89A 4O1BA 2W27A 4NY2A 1WAUA 2E6YA 3NA8A 1GHSA 1BHGA 2JALA 2HS6A 4B3ZA 1C3FA 2W9MA 3S1WA 2QIWA 3H24A 3MZ2A 2ZX5A 2PPGA 2GK1A 2OO0A 2PDNA 2PTYA 1JD7A 4JQ2A 3ONCA 1LRQA 3EWXA 3URQA 4I9AA 3MCNA 1W5OA 4H1ZA 4G5DA 4LUTB 3THDA 1FFUC 4LOCA 2J8TA 1ESWA 4PULA 4EPBC 4JCMA 2BWGA 4IXHA 4S3EA 2QMJA 1N61C 1XFBA 2VCBA 2ZC8A 4BA0A 2OYLA 4Q3MA 1EJTC 1XLGA 4L80A 4XZMX 5LGXA 4IP7A 1LRNA 1RY8A 1CGVA 2W63A 3FYOA 3WN6A 2X05A 4J35A 4KFPA 3FKRA 1OIFA 5JBFA 5JUVA 5G1YA 4CQ8A 3QTGA 3R8RA 2ZZ6A 1FH7A 2WYSA 4KWOA 2PWFA 5AC7A 4EPKA 3P62A 3TFCA 1O1HA 4HN4A 4AIEA 4GCAA 1L2UA 1XRSA 4M81A 1K8XA 3U5YA 1MEHA 4TMBA 3PN8A 2Y63A 4PSPA 1KLZA 4OBRA 5BXPA 1JFXA 3VE9A 4J3SA 2VRKA 4IH3A 2Z1VA 1TA3B 1KC7A 2NLYA 2XZ9A 3CMFA 4NL1A 4HSHA 2EQ6A 4RX0A 2VFDA 3DI1A 4S3FA 7CGTA 2YBVA 3CM4A 1ZSXA 4UQDA 1A5NC 2V2DA 5DXYA 4NRSA 1EGMA 1RSCA 3QY7A 2PUZA 3SCQA 1XIIA 4FDCB 1DV7A 1LUCA 3WJSA 1FWRA 3BCFA 4MAVA 3UD6A 4GUJA 1PKLA 3HO8A 2HSAA 2UY5A 1T0OA 4EQSA 4J4KA 1EQCA 3GYEA 4MVAA 1ICSA 1GQLA 4CN6A 4X63A 4Z1DA 2I56A 1F9CA 1F61A 5MHBA 1VPQA 1F3PA 3VDBA 5CJNA 4DLMA 4IZGA 3VO0A 3R94A 3L5AA 4BHYA 3KVLA 4US6A 3AIUA 5FSEC 3N25A 4ZOEA 2Z0IA 1NFPA 4XTDA 5K3VA 1GEHA 4HVXA 4WOQA 2HTMA 3G1RA 3G18A 4Q8QA 4RXFA 5AZ1A 3WQ8A 2VQTA 3O6CA 2DZTA 3IJ6A 1SO5A 3BQ5A 3SSJA 3WDQA 1HKMA 4TX8A 5JIWA 2CZVA 1MVYA 1TG7A 3LBMA 1TR1A 1EJVC 1VPXA 3CHEA 3C86A 2PMQA 1YADA 4RNJA 5KETA 1XWYA 3VMOA 3WLNA 1GVFA 1S2WA 1U33A 1XINA 2NWRA 3KZSA 2ZRZA 2G96A 1F5ZA 1YKWA 2V9DA 2O7QA 2BNJA 3GUWA 1TB3A 1N63C 3K2GA 3MCMA 3WUBA 3MP4A 4Z0SA 5LNUA 1OK6A 3BG3A 1FCVA 5GNZA 2HCVA 1ICQA 3EMZA 4HIBA 3AHTA 2PI6A 2DIEA 1DJQA 3BURA 2KX9A 1SZRA 4DJFC 2XM1A 5CZSA 5HJLA 4JN8A 1OEPA 1OFDA 2CBVA 6XIAA 3LCXA 3ITCA 1J11A 1KR0A 3CT2A 3H4XA 3DHFA 2A3HA 4LCQA 2GWGA 1PV8A 3ZT7A 3B9OA 3H4KA 4W93A 1YHTA 2V3BA 2B7QA 4Q8UA 1H1NA 2WVVB 2EBNA 5C7HA 2NXIA 3GLCA 4JFUA 3N15A 5FD0A 4G1NA 1W1B1 1ONEA 2OT0A 1A5CA 4ATWA 2ZE3A 3RCNA 1XV8A 2E77A 2Y5SA 1GYLA 3LTPA 1P0KA 3B8IA 1EJXC 4JR5A 4E4PA 2NX9A 2GJXB 1PTAA 3LBCA 1X7FA 4RPQA 1Q6FA 4I8YA 3BLIA 2WNZA 5J5DA 1EXPA 4QG9A 1MRQA 4AEFA 3HG5A 4E4FA 5CEWA 4N6EA 3A9BA 2PZ0A 3AMZA 2AGTA 4KIRA 2FZNA 3F4WA 2QDGA 1W5MA 2Z27A 1CXEA 1TMLA 3OEXA 4AXNA 3L65A 4W9TA 3S2LA 3H2OA 4ATLA 1P5BA 3W76A 1UKQA 2YL9A 3NPUA 1EIXA 3VNDA 4J9JA 3LRMA 1R87A 4MB4A 5CXPA 4YHEA 3U2CA 1BG9A 4JYEA 2V63A 5D30A 2VZUA 4D6IA 3KRZA 4JNYA 5G1MA 2GJRA 5K9DA 3WFLA 5A69A 1FHDA 1Q13A 2DH3A 4MZ8A 4Y9OA 3GS6A 1E70M 2X0YA 5D02A 4LUSB 4HNVA 2G97A 3S1VA 2QS8A 3T05A 1KNWA 4TTUA 3GH5A 2EQDA 1DL3A 3NPWA 1M7XA 5A2AA 1OX4A 3QJAA 2WBAA 2WC3A 3CT7A 4GBDA 1BF6A 2GDQA 2CZ5A 3UCQA 2J75A 4S3GA 1CXLA 3R79A 1STZA 3CB8A 4QDWA 4K8GA 2OMAA 2D73A 1UWSA 2QKFA 1TVPA 4Y9NA 6ENLA 4NNCA 3UWVA 1HJVA 1YW1A 4DHGA 3AXKA 3W2JA 3VDCA 5JCIA 5E1QA 4PMNA 1EXBA 2ZZ4A 3C52A 4QQUA 3R89A 2X41A 2BXVA 4A8IA 3O06A 3TOPA 1UKTA 1H7OA 2YDSA 1GSNA 1V3HA 4FXJA 5FJUA 4AD5A 2B0MA 3MQTA 4JTGA 2XN0A 5LSMA 1U83A 4IIFA 2ZDRA 1OFPA 3BGGA 2QCMA 2HQMA 2CIPA 3QFAA 2DSUA 4L9YA 1XLAA 1X97A 3D6NA 3DENA 4QS6A 4EMIA 3WLJA 3N3MA 4ZO8A 2YCKX 3GBDA 3EXRA 1PYMA 3B0XA 3CBWA 2HBXA 2HE5A 3N04A 2GWNA 2FVLA 1E56A 4KW2A 3SDOA 3S5SA 2VI0A 1RCQA 1KQZA 2EPHA 5CAKA 2RFGA 2OZTA 1DOSA 1OYCA 1Q65A 4ASTA 5LZLA 4K8HA 3SCRA 4IL0A 3MKKA 4RCXA 3O16A 1W54A 3SFKA 1E9ZB 2J62A 3BANA 2QCGA 1IZKA 1FOBA 3RFAA 2XGBA 4WX2A 5CSSA 4NZ4A 1SZEA 2OQHA 1XCXA 1GWJA 5AHFA 3HURA 3PZGA 4LRSA 5F2MA 3PULA 3W7MA 6REQA 4XVEA 3I3DA 3TCSA 1P48A 2OSYA 3QKEA 4F48A 4V27A 3RF9A 1EFZA 4DJEA 2WOQA 1GRAA 5EB8A 3B4YA 3FJNA 4WRHA 1Q6EA 3BJFA 1RQHA 3E5PA 4RNFA 4NZ3A 1WOBA 4RKAA 5BROA 1NELA 1US2A 3PBGA 4FMVA 2PBOA 3TV8A 3MANA 1J79A 5G4HC 1G94A 2EF9A 1AG1O 3WQCA 3BAJA 4IQDA 1QI3A 3AMCA 1W31A 2Y5EA 1KW1A 3ERPA 3B3DA 3W88A 4XIAA 2ABBA 1XYFA 3N6QA 5HR7A 2WCAA 4NASA 4P8UA 1NWUA 4GY0A 3M0YA 1Q5MA 4OT7A 3VGEA 2HQAA 1NOWA 2OWWA 4JYDA 4C6EA 4FI4A 1H11A 1W5PA 2W92A 3WK0A 2F9RA 2NPXA 4ADSA 3RK8A 3CL7A 5FSDC 3BOFA 5BMXA 1OCBA 4LX4A 4U2ZA 2XN2A 1JGMA 1NDZA 2X2YA 8RUCA 3PZVA 3XINA 1N7KA 3QRHA 3U5UA 4ZTXA 3FLUA 1E4LA 2WSYA 1GQJA 4FIRA 4POCA 4ZTYA 4WDXA 1ZBCA 5E9XA 1ZPTA 1O12A 1KLYA 4GINA 4KRUA 1LYXA 2DP3A 3W22A 2D3LA 2I9UA 2WJDA 3U7VA 4MJZA 4MNMA 4XO6A 2PTDA 2XH2A 3S1GA 3GZ3A 3QVQA 1UH4A 3O1NA 1PTDA 3AI0A 4HU3A 1FWDC 2VRQA 3LZ3A 1E5JA 4GOAA 1ZAIA 4ZCWA 2V5LA 2WHKA 5I3GA 2E5BA 5BWFA 3CH0A 2WSPA 1I2NA 4HN8A 3M44A 3WUGA 1SSGA 1RCOB 5FJPA 3WYZA 1H2IA 2QJHA 1KCKA 4C7DA 1OT2A 3CL8A 3CO4A 3K8KA 2G37A 4MNJA 2GVJA 1PJ9A 2ZWYA 1PYFA 1ZS2A 4UZSA 2QCNA 3WLPA 2OLAA 4U3CA 1UP3A 2GQAA 3HQOA 1VJIA 5G1TA 3EA2A 4MNKA 1UR0A 1LBLA 1P1XA 1ONFA 1M01A 3LCIA 1EBGA 1R9ZA 1HIZA 4D6HA 3U3HA 4KIEA 2H9AB 4O1DA 4Q6JA 3EAOA 3PF3A 1XUUA 3NNTA 4OV9A 2HMCA 1V3KA 3LCWA 5HWMA 2CWNA 3C4UA 4I5RA 3LXCA 4Q4SA 1FA2A 4ICNA 2OEMA 1H5VA 1PB0A 3LBOA 4IQEA 1S2TA 5U1OA 2Z6IA 4F40A 2HRWA 2JK2A 4Q4KA 1X6NA 2R1PA 1GYNA 3T44A 4M52A 4GRSA 4NAFA 3K4AA 3I6RA 4UFIA 4CUCA 1P0NA 3HJZA 5HMEA 1YTDA 5D03A 2CLEA 1K6WA 3RDKA 4WJEA 3W7LA 4PB3A 2W54A 3QV7A 3GQYA 2I5GA 2ZKMX 4FNRA 3HQPA 4LYRA 2DFAA 5AYXA 4PMRA 5FS8A 4J3UA 1X2HA 1FXPA 2J79A 3LHYA 1JDEA 3DFOA 4OBSA 3R0KA 2YA0A 3LHUA 1NHSA 3W7QA 3SCSA 3AM9A 1K9FA 4TXEA 2QAEA 1B30A 1GNXA 1DJNA 4B4HA 4AYSA 5HWNA 1RVGA 1LT8A 1O94A 3WFZA 2C18A 1V3JA 1VQTA 2A85A 2VM8A 1UA3A 4DXKA 2HPIA 3E12A 1FHVA 1DIDA 3LQGA 4X0NA 2DZPA 4K8DA 1T3QC 4WDTA 4RZ6A 4GVGA 2E6FA 2XYLA 4XZIA 4ZB2A 3URNA 4IUGA 5D4YA 3ARZA 3DH7A 3W3OA 1YQ2A 1LZOA 2QULA 3A4WA 1W3JA 4WY0B 3S5OA 3ITOA 3FVMA 3KVJA 3WELA 1G69A 4XZLX 4REQB 1MO9A 3TQVA 3GXDA 2Z2AA 3VFCA 3ARYA 3UCCA 3OBEA 4A22A 2PZNA 1O5KA 1PBGA 2PDLA 4EQRA 1XIDA 2Z1WA 4HA4A 1ADDA 4QDMA 1FTXA 5CC5A 4A8NA 4EAYA 3CASA 3BW3A 2F61A 3OVRA 3G1YA 1R3WA 1J2WA 3IRSA 1FWAC 2VGBA 4AX7A 3FVDA 3M4HA 3WMCA 3ZWSA 3SECA 3WNMA 3W7JA 2FGZA 2E25A 1DVJA 1EDQA 4F8XA 1WXYA 2X30A 1WKDA 4AC7C 4AZ7A 3HTWA 4AVOA 4P61A 2QCDB 2IKIA 2FYMA 2FKPA 2V6OA 2VD8A 2DDXA 4UTLA 2DSKA 1EJRC 3FSUA 1BQGA 4KBXA 1LPFA 1YE6A 4XKYA 2A6NA 8CGTA 4ZFCA 5IXEA 4GYPC 4C91A 3G1AA 1I6NA 1VIWA 1BTCA 4S3CA 3EX6A 2DT2A 3WBYA 5H2ZA 3H7UA 2QZRA 3CB3A 4DPQA 4PMYA 4S1FA 3C56A 3SIMA 4IUOA 2J88A 4Z17A 4C5ZA 4UMAA 3VD5A 1XYZA 4ZXLA 4G7FA 4OJYA 3LI1A 4A6GA 2INFA 2WXDM 4UNKA 1E40A 3LTSA 1UKSA 3GDMA 3N14A 2GPTA 1H50A 4JDYA 3EWBX 3LRKA 1GOOA 2PWVA 4LB4A 3O7UA 1KA9F 4IQLA 3PS7A 3V5CA 1XSIA 2YCLA 1AQMA 4NX5A 1Y65A 2HK0A 1GQKA 2FZ8A 4I7VA 1QW9A 3NUKA 2REQB 4W7UA 2RJHA 4NZ1A 4NF7A 1CGYA 1V5XA 2NQZA 2GJPA 3LN3A 4AZCB 1VRXA 5J04A 4WY0F 3PTQA 1U5VA 4O1FA 3P5ZA 5A2BA 3NL5A 3DU0A 1QNVA 3KOZA 5C2CA 2ZVRA 2R9RA 1MZHA 1J5TA 3I7QA 1QOQA 3CUZA 5LNVA 1WO2A 3QXBA 1Q4NX 2ZZ3A 4AZ5A 3KZPA 2FQIA 3RLUA 3SY5A 1DIEA 3TJ4A 3PTKA 3DG3A 1EP3A 3UY8A 4W85A 3GDRA 3PANA 3RITA 1NPXA 2NQ9A 3WJXA 2XSAA 1QHPA 3RPTA 2FJUB 2IQTA 2ZXBA 5A6MA 3Q6JA 4DJED 1VAHA 2P0OA 2ZCGA 4Z1BA 1DJZA 1PTGA 2E1DA 1JQVA 4V15A 5LNWA 4M24A 1V8EA 3ZR6A 3HW2A 3N9RA 5CLTA 3ABQA 4M80A 1H49A 4XD4A 2ZZCA 3UZJA 4Z1AA 1YDVA 1SJAA 3GFYA 3R43A 3SCVA 4A3UA 2I5IA 1AL8A 2PGFA 3LCHA 1U5HA 4PEKA 3GC4A 3MT1A 4UZUA 3SY8A 4GVIA 4Y6GA 1UUOA 1BEUA 8A3HA 3QFEA 4PYSA 3FW6A 3LS9A 3B8VA 1BRLB 4BFAA 3GHSA 3P61A 3ZT6A 4LV4A 1B3OA 2CLIA 1TV4A 4ZEPA 3VUPA 1J0KA 1EKOA 3ZM8A 5FJJA 1BZLA 4GI8A 4EKJA 5KSWA 5E0FA 1E4NA 3F7JA 3H2NA 4GNJA 5F2GA 4BI7A 1ZFJA 4FXRA 3CYJA 2GL5A 3P0WA 2WBKA 4D2JA 1ISWA 3ITVA 3PPGA 4CNTA 4PTXA 4ZQMA 2OKTA 4HCDA 3E0LA 3BLPX 4ZVJA 4ALDA 3P5YA 5HMSA 4IMDA 4S3KA 2FVKA 1U2YA 3GFXA 1R0MA 2E6DA 3GSMA 3UG5A 3ZVIA 3EB2A 5LKYA 1JXKA 4IIHA 2IPFA 4DY1A 3AAMA 3NQFA 4KCTA 4RV8A 4H9ZA 3WD3A 4BURA 2IQDA 4FR6A 5HULA 1YXDA 2VP8A 4LUYA 3PZMA 5CZJA 1I2OA 2C0HA 1Q7QA 2W4XA 1X96A 4H8VA 3EANA 4AY8A 4ZL1A 1WBHA 2FZMA 4K39A 3MV11 4J3VA 3M64A 2PD5A 2X16A 1OQFA 1ZY9A 2V5KA 3AMLA 2CKRA 2QCCA 3H2EA 4HHLA 3CAVA 2J47A 3UWYA 4C1LA 1XH2A 1ZBKA 4N9BA 4W5UA 3TW9A 3ITXA 1AQ0A 3PPFA 1XUZA 3D9XA 3B9EA 3W1MA 4WSKA 2IPJA 4C90A 3UY7A 3WKZA 4AC1X 2BFGA 1V0NA 4JFTA 2A0NA 1RA0A 3A3HA 2RDUA 4UFLA 1M7OA 4WJXA 3EKLA 4H8HA 1A5AA 5FAGA 4R9OA 3NQBA 1LDCA 1VBJA 3SADA 3QH2A 4ONVA 2V3FA 5I79A 3UVIA 4RZ4A 5CPMA 1H1YA 3MWCA 3GKFA 3DFNA 1XYAA 3FGCB 3WLKX 3RMEA 4ENLA 1CENA 3UPBA 4ZXOA 4QJ4B 1KCXA 3NYDA 3POHA 3W1XA 4HCLA 3GDBA 2W5FA 3HV9A 4MJ4A 3G1DA 4NG3A 3F5KA 2CXGA 4XD5A 1YNPA 4XBSA 2GLKA 5MF5A 2O9RA 3MCOA 1RK6A 4W7WA 1TJ1A 4IX0A 1S2UA 4H6QA 1EGVA 2UWFA 4PMOA 4EF8A 1JCXA 1UH2A 1F6YA 1V3IA 3G0UA 3V75A 5BRQA 3UJRA 4LUTA 3GDLA 4ECLA 4IGSA 3EX1A 2C6QA 1IT7A 4FOKA 2FFIA 1Y5WA 3APTA 1AZ2A 4TVCA 5IFPA 5CKSA 2FLIA 3TE9A 2GH5A 4UIOA 4HB7A 4EMJA 3GXPA 1W3LA 3WF0A 1F74A 4K7ZA 3P2VA 3BAIA 4S3BA 3ATYA 3QZ6A 3LENA 1NDWA 3PFRA 1TTPA 3B97A 1KXHA 3DECA 4PUWA 3GTFA 1ZL1A 3SQSA 4JIIX 1FP9A 1VEPA 4AAJA 1NFBA 1QOPA 4LSBA 1OFBA 1BXNA 2PWEA 4D72A 4JAWA 4WXZA 1UJQA 5BYWA 4GGBA 1CBGA 4Y9MA 2ZRYA 3FAXA 2Z6JA 4IPNB 4C1NA 1J18A 4S3DA 1TCMA 3M0IA 2WVSA 4PMJA 5I3DA 2CHRA 3LERA 3DH9A 3M5XA 4RNHA 4XK2A 4L5ZA 2DUXA 1POKA 3ZR4A 4D6EA 1TA3A 1LG1A 4D6DA 2QDEA 3VNKA 3PC0A 2FTWA 1E0VA 3MYOA 3M0MA 3UG3A 5C71A 1I1XA 3WLSA 5FKYA 5I3IA 2X1UA 2NVKX 3AXXA 2WQDA 3QQ0A 3OJGA 4I5UA 5C5YA 4GQQA 2WPGA 2ZC1A 3WEOA 5AHEA 8XIAA 7REQB 1XFCA 3W7DA 2JE8A 2G5WA 4GKLA 1HQTA 2FDSA 2YPIA 3O6DA 4GJ1A 3H53A 4MJ2A 4F9DA 3WDRA 2VUYA 2P5NA 2PA6A 2PDWA 1UIOA 4AD3A 3HV8A 5HMFA 1QASA 3N73A 1TKKA 4DO4A 2PCQA 4GQRA 2NV2A 3GBEA 2PGWA 2ZWZA 4PTWA 5G2IA 1OFOA 1W1VA 1YPFA 4OTKA 1PAMA 2G3IA 3IIZA 3CQ0A 5AYIA 3LUTA 1TTQA 4R88A 1TV8A 3THCA 3VABA 2WP6A 2VWTA 3AXIA 4RPPA 5CGMA 4OOUA 3TK7A 4HZ8A 1JPDX 4W7VA 1UWAA 4W87A 3DFPA 1I75A 2PU0A 5H6HA 4HMDA 5FIPA 4X22A 1R9YA 2OOGA 2ACQA 2DT3A 3TOYA 1VEOA 3EYPA 3P7YA 3QF0A 5DCDA 3CZ8A 1EGZA 4GXMA 5AECA 3P60A 1ODZA 2EHHA 1EC8A 3UWUA 4AD1A 4GYFA 1BSIA 2AKMA 3M47A 3AYRA 3CPUA 4F0LA 4LU0A 1I0BA 4QITA 5TR3A 4PFMA 2HROA 2ZRXA 4GYJA 2Q3OA 4OZOA 1PCWA 1SYTA 4HNLA 5C9WA 3LV5A 1YIXA 4I8DA 4D8LA 4Z2IA 5DY3A 1PPIA 2PDFA 2DVXA 4RDYA 1W6TA 3TTSA 2VEPA 4O0KA 4EE9A 1CX9A 4A3HA 3W74A 1CECA 3VKDA 3T6CA 2BOFX 3NDZA 4B3KA 4NHVA 3B06A 3N6HA 2FPVA 5EU9A 3SFWA 3WLMA 3V5FA 4F0MA 3PZOA 2VEGA 2BVTA 3LXDA 3W00A 1BVNP 1BVWA 3SO7A 2BGSA 4O0ZA 5LYRA 3U4AA 4KH2A 5CZ0A 5TAOA 3V3WA 5F1VA 2XWEA 1KBKA 1H7RA 1OGBA 4FR1A 2WVVA 1JVNA 4ACZB 3CV1A 1HP5A 3P0XA 1E5NA 3VU2A 3WY1A 2E28A 4N7QA 3NFUA 1IQ8A 2YB4A 1P6CA 2GJXA 2LLEA 1TJPA 3C0QA 5TIMA 2R82A 1C8VA 2G50A 3VC5A 1CGWA 1J12A 1Q3NA 3AQUA 4J40A 2XZ7A 3LB8A 1CI1A 4W8BA 3EWUA 5KVHA 1IEIA 1KFWA 2PS2A 4QP0A 1I2RA 1TO3A 4PODA 3ALFA 5CG7A 1F3XA 2OWCA 1E71M 2XN1A 3TYZA 5DT5A 2V69A 4PH6A 5C0QA 1EDGA 3DC0A 3TWBA 4Y7EA 2ZUTA 2NUXA 4WSJA 1RP9A 9XIMA 3H2MA 5J5RA 3ZO9A 5E5CA 1QI5A 3WH9A 1A0CA 5JQ9A 4H3DA 3TC7A 1ZCCA 3AOFA 4WDWA 1P0EA 4OE7A 2HBVA 4ERAA 3VUSA 1A5UA 3IARA 1AJ2A 2J7GA 3JZEA 1X39A 4JQ9A 1RBOB 4DZHA 4WDUA 4GFIA 2OU4A 2VR4A 1IT8A 4RE3A 5EKYA 4XD6A 5A6TC 1OG6A 4YMZA 2X1RA 2NXGA 4O19A 5AC4A 2DJXA 2A8XA 1F4HA 1R30A 5DRCA 1QOXA 3OTRA 3CH9A 5E09A 1KCZA 4J2PA 2W61A 3GTXA 1H0GA 1XPYA 4L4MA 3L2MA 1OYAA 1KV5A 1RM6B 3VDGA 4L9ZA 3RM8A 1RA5A 1CIUA 4HP5A 1YBQB 3ECQA 2WSQA 1TYGA 5T26A 5F4SA 3QOKA 3ARSA 4JTUA 1OY0A 4Z2HA 3USZA 2IKHA 4CCDA 3MTWA 1MNZA 3C8FA 3E5BA 1O6IA 3WLRA 1JROA 1R9XA 2O9TA 2BV9A 2W67A 1UG6A 2JEPA 4YTSA 1W1PA 4NZCA 3G0SA 3TC6A 1X1OA 4OUIA 4UTMA 4NX0A 2RGMA 2YL5A 1B9BA 3L4XA 3TW6A 4PSRA 1OSEA 3BGJA 4NZFA 2KAUC 5E0KA 4PE8A 4US5D 1E51A 1H3GA 3OOQA 4JIEA 3AXHA 3O0HA 4XUGA 1DE5A 4EP8C 2X42A 1SW3A 3FFSA 1QW7A 4XAZA 1QHZA 2PDIA 3MO4A 3HFTA 4J5NA 4M6QA 3BCDA 4UFMA 2PTXA 4HNUA 5AHLA 3WNKA 5A8QA 3LPGA 3QHMA 1QJWA 4IICA 3EKZA 4TX9A 4E8DA 5BNKA 3ARTA 4LVDA 1M65A 4N4PA 3UWWA 6XIMA 3W01A 2TSYA 4FX9A 1XDLA 2NQJA 4BS0A 1BYAA 1VFSA 3OO2A 4P7OA 5A8NA 1T6MA 4HHMA 2Z25A 1FEAA 3VMNA 4C6MA 3MPGA 3D0CA 2ISDA 4JCLA 4C6QA 3E49A 1JRBA 4RXGA 1XIEA 1XG4A 1W1ZA 3ZOAA 4Q7IA 4CU7A 5ER0A 3QGKC 4CU6A 3GE7A 3MW7A 1J2BA 1CGTA 2E5AA 3OLGA 3VD7A 4L7ZA 4HNCA 4GIRA 5A94A 3NVTA 4EK7A 1W1A1 4LVFA 2Y8UA 1XLKA 4FLOA 1WX0A 1LT7A 3S2JA 2QCHA 2C71A 2BC1A 1J0IA 3VGHA 1NHPA 3A21A 3OG2A 4QEHA 4DIAA 3KXQA 4ZO6A 2WWDA 4A8LA 3RO6A 1Y0EA 4XV0A 1UR1A 3C3UA 4PZVA 1JYNA 4X2PA 2X50A 2GJLA 5DMYA 3HGJA 3W72A 3LHVA 5F2IA 1D2KA 1L6GA 3R13A 4JFWA 2QCEA 2YIHA 3KWXA 1KGUA 2OB3A 3BLDA 1Q7ZA 4O14A 2ZTKA 5HANA 2PRHA 1EQPA 1JUKA 3GRIA 2INZA 1XH0A 4KWWA 2QVNA 3IANA 4LAKA 4X9SA 5DEZA 1JJKA 1OYBA 1M9HA 4DAFA 3NQ8A 3AN1A 3VNZA 2GYIA 2XVGA 1EP1A 1MDLA 3ES7A 4JL1A 3KL0A 2ZX8A 4H8UA 5CBIA 1F3WA 2JKAA 1KFLA 3IGSA 5IDIA 4IMEA 4HU4A 1AD4A 5IM51 3BSMA 3BPWA 3LEPA 5D05A 1MZRA 2BTMA 2CYGA 2PE4A 3A3XA 3R2GA 1KM4A 3ZYZA 1IEWA 1E1EA 3UZ5A 4PRWA 4KMQA 2V8ZA 3R5EA 3M0ZA 1BAGA 1M53A 4IGNA 1VP5A 3CGBA 5KZ6A 4U5KA 3KBVA 3Q67A 4UCFA 2A3EA 1JOAA 4JHZA 2Z7KA 1KRAC 4HPGA 1J0JA 5CSYA 2CBUA 1UWIA 1YDNA 5H1WA 2NLIA 1Q8JA 2WMJA 3PJWA 3ZXWA 1ZX9A 1UWUA 2J9YA 1XM3A 4IGHA 2VRJA 1W9DM 1LLWA 2FHBA 3SN1A 3TLQA 3W07A 3BJSA 1OCQA 4I9TA 2XVPA 2O9PA 3FEMA 3CGTA 2J7EA 4W86A 4R9XA 2H9AA 2BC0A 2GSHA 4S2CA 4KCVA 3IVUA 4GYKA 3ANUA 1XGEA 4Q4MA 3RRAA 4GLEA 3FA3A 2PF8A 2Q8LA 1ZLPA 3M16A 3S47A 3WG6A 3O0FA 3WENA 4BEQA 4ZOCA 4IHCA 2FZ9A 1REQB 1W9BM 4IMAA 2AQVA 3PZTA 4LPCA 2Y6ZA 4L65A 4EXBA 2CCRA 3PBYA 1NARA 6ALDA 1LM1A 3WLOA 1NIUA 2OYKA 1WXJA 1ZU8A 1TPH1 3CNYA 1ODUA 2D1ZA 4ZGYA 2QUTA 4Y2WA 2ZUWA 3NZGA 3FXGA 3UXIA 2PURA 1VH7A 4MZ1A 1ENUA 1QXLA 3D46A 3KS5A 4S2BA 4HYVA 3IAPA 4HMCA 1FFRA 1W3KA 5BWAA 1CDGA 4HNNA 1B31A 2SFPA 5I00A 4TX6A 4C6NA 1K7FA 1XIBA 4BI6A 1OVDA 2R9ZA 1U30A 3LNMA 3NM1A 3W24A 2JQXA 3M41A 4H9UA 1KM1A 2WLZA 3FOKA 4JTJA 5REQB 1FWWA 3TMLA 4YWOA 1UQYA 4QLLA 4GR1A 2D24A 3OZMA 4GQBA 4DJFA 2O56A 1A0EA 3PVFA 3I3EA 3MUY1 3B8WA 3OA5A 5AKQA 4UBPC 1UROA 3NQDA 1V79A 3DJJA 2VL4A 4XUYA 5G4WA 1EIBA 2GQ9A 1S5WA 3IV3A 3M0VA 1CCWB 4PMQA 3O05A 1ME9A 4YYCA 2YFNA 4EXQA 1DJIA 3C2RA 4ICCX 2D2GA 4NNAA 2ACSA 4B90A 3SR7A 4FXSA 2BCPA 4FNTA 1HJWA 1LF1A 3RLGA 3WO8A 1R2SA 4Q8OA 2CBIA 4Q4PA 1KKOA 4GC4A 3L0GA 6PTDA 5AB3A 3OIHA 1DWIM 1DJXA 2HNHA 3L5OA 3SSZA 1ISZA 1QVBA 4REQA 3LCGA 3V1PA 3PZUA 3OVPA 3W2LA 3W70A 3COTA 1WP6A 4JFVA 4YTRA 2O9OA 5FS7A 3MSGA 1EO5A 1N2VA 4TOQA 5FF3A 2YDAA 4QHRA 4L1WA 4CQAA 3CAQA 4UQCA 1LQ0A 2YYUA 3TYDA 1WYIA 4RR4A 1W3IA 2EAWA 2YCIX 3NM3A 3W2KA 1CPUA 4TVYA 2ESCA 1LBFA 5I78A 1IXNA 5I07A 2QCDA 3BSHA 2VZOA 3AWOA 3TN4A 5F7UA 1E1CA 1WQ5A 3T78A 4HA3A 3WF1A 2HJPA 4QISA 3RPDA 5JH1A 1OGGA 3CV6A 3LPOA 3IUDA 1L6YA 4DBUA 2BODX 4AG0A 4V28A 1EYEA 3IVTA 3I68A 2ZDSA 1Q2RA 3NOYA 3LPFA 1X98A 3KLLA 3VAVA 4OUEA 2WJEA 1KD0A 3ONBA 3A23A 4F2BA 2IXVA 2CLPA 4RZ5A 1E6NA 3UVAA 4QFUA 1M7PA 3BW4A 5D8ZA 5ABGA 3VCNA 1DXLA 3UZXA 3TW7A 3QMTA 2REQA 2WZHA 1UMYA 3EWDA 2TAAA 5A3HA 4H6EA 5G2WA 2FTYA 3MMWA 4Y9AA 5T9CE 4AZCA 2XH4A 4NZJA 1MFVA 2A21A 1YX1A 4KEMA 1VCFA 3OZYA 3CQKA 4LAZA 3Q65A 3OG3A 2W66A 1J0HA 1LORA 3DG6A 1B4KA 1UJPA 2ZADA 1FDJA 1BKSA 1TWZA 1E72M 5B7ZA 2JK6A 1G4SA 1UWTA 4CQCA 5D8WA 1NY1A 3N34A 4KESA 1YNQA 1TWDA 4GX9A 1EF2A 4FB7A 3G5EA 4YN5A 1TZ9A 2BB0A 5IBXC 4P8XA 1HXJA 4CU8A 5LIXX 3L23A 2R6OA 2J9ZA 4JTAA 5HQLA 3CO8A 4G8TA 1JQXA 2AQWA 3HOJA 2VO5A 2D22A 3BC9A 5I5RA 2PRMA 2AL2B 1D7YA 3STGA 3BMWA 2Y62A 1OJXA 4LF2A 4RDVA 3O6YX 1XLBA 4Q8VA 5F2LA 2NXHA 5LIKX 3TYAA 3OHIA 2YA1A 1S38A 2BASA 3GC5A 5CZTA 1BRLA 1XRTA 3GHRA 3QV8A 1SGJA 3M6YA 4AH7A 2FZDA 4WKFA 1AL7A 2QMKA 4EF9A 1UASA 3BUVA 3A22A 2ZZ5A 3LG3A 3I4KA 5G2HA 1AH3A 1QU4A 3OQEA 3AHZA 1DHKA 1OF8A 3CHVA 3WF3A 2RJGA 2A3LA 5EMLA 2Z2UA 2WKGA 3T81A 1EP2A 1GOWA 1BYDA 3QPEA 3MYPA 4DJDD 1XLCA 2RHGA 1CGXA 2AMGA 3WQDA 2QDHA 2P88A 4GY1A 2B31A 2CXEA 1B3WA 5FACA 5D9OA 3PP7A 4W8AA 3V5OA 1N8IA 2VMFA 3WIJA 1QI4A 1VEMA 5HUPA 1ZJBA 2EPOA 2WVUA 1QNRA 1UB3A 1QWKA 4MF4A 2V5DA 3N2MA 1PX3A 1E6PA 4HZ7A 4MDPA 1LG2A 4UMCA 2VX4A 3P8JA 5J8LA 1JPHA 5BCAA 2C1HA 2VYOA 3C2FA 2EG8A 1QO2A 4O1CA 4NAEB 5A8PA 1PDYA 1TPB1 3CPRA 2G0WA 3AZRA 1GPFA 3E3HA 3FSTA 1JD9A 4H4XA 4JNZA 1FXQA 5I3FA 4EWND 3N12A 2YBUA 3B0YA 3A7AA 4RK8A 4M7TA 3GAKA 4FNSA 3S2NA 1BYCA 1JZ8A 3S5YA 1VQZA 3WNNA 2BOGX 4PL1A 2D2JA 4G56A 4P7NA 3LA4A 1JCYA 3EA3A 3FGCA 2ISVA 3QHNA 1DJYA 4HPJA 1BD0A 4AEEA 5DANA 3W4RA 2CWXA 4DZAA 1MSSA 1MNSA 3BOLA 2IS7A 3QHOA 1SMAA 3A3WA 4E38A 3GXNA 5A6LA 2RH9A 1ADOA 1Y5XA 5JCKA 1H61A 1UR9A 1T41A 1E9YB 2CLOA 2Y61A 4MHBA 5EMMA 4AVFA 3L4TA 3RM9A 3T0AA 1EA0A 5ABFB 2E8ZA 3PK7A 3R4IA 6TAAA 2PU1A 3MDWA 4HPNA 3BAYA 3N4FA 3OP2A 4R27A 3M5YA 3GDTA 4JKLA 1XGZA 1W17A 4P2VA 2ATMA 2BLEA 2IXUA 3W1LA 3NQVA 4IG2A 4LT9A 3TX9A 4RW3A 1K02A 3PG8A 2VEIA 4QTGA 4PMZA 2EEXA 3ZQ9A 3ENLA 1IXQA 1C9WA 2PGEA 1QAPA 3WLLA 4D6JA 3W7GA 1CXIA 3MO7A 5C9ZA 3N11A 4BKNA 2FPYA 1QNQA 2ZZBA 4NXKA 1BKHA 3WUFA 3NL2A 1FIQB 3RG6A 4X61A 2VHLA 2WW5A 3UGVA 3W6MA 3DCPA 3LMZA 2WC7A 1LJYA 4MZYA 1QFEA 5I0DA 2D0GA 4E3TA 3OGRA 2OX4A 1HKIA 3TQPA 2XTKA 2Q01A 4P8VA 3IGXA 3SEPA 2E67A 2AQOA 2UY3A 3EXTA 1HO1A 1Q6LA 4WVXA 3E1F1 3UR8A 2FJKA 4GUHA 3BZGA 4MJMA 4JEQA 1J6PA 1P0DA 4LNCA 5DBUA 1E0UA 2C3DA 3DK4A 3GG0A 3VGFA 4GBUA 5JBEA 3II4A 3V0SA 4ATDA 1FRBA 2PDUA 4UCGA 4F0SA 5G5HB 3L0NA 3NQ7A 1XL9A 3UWQA 3W1RA 3FCPA 1VR6A 1TE6A 4R7JA 2PDKA 2WZIA 4ZR8A 2DSWA 4DI9A 1YDOA 2NW0A 4U33A 4BV6A 1VFUA 2NV1A 4BR1A 4L4OA 3MI6A 3A6OA 2NUWA 2J6VA 4IMGA 2XJ7A 2BY1A 4PEEA 4C6DA 3D3AA 2QUVA 3N17A 4GUFA 3VNMA 3B8DA 3ITYA 3HFYA 1N82A 3E0FA 1GHRA 4GVHA 1DQUA 4K38A 1TPUA 4QAIA 5U25A 3NOEA 1D8WA 5FMHA 1MYRA 2ON3A 3AHVA 4H4VA 1O95A 1XF0A 2BY2A 4S3AA 1Z69A 2OEJA 3W1UA 5U7SA 3EDFA 4WJ8A 2VWSA 2VELA 2HPMA 2WWCA 5LA2A 1QPRA 1MO0A 3ZZ1A 3A4XA 4TV5A 4AF0B 4YCOA 3M0HA 4X2RA 3TAKA 9RUBA 2V5CA 5FEZA 4C7GA 5HPOA 4YCPA 2OZ0A 2GUUA 2Y5JA 2B7OA 1XBZA 4L6OA 3MB9A 1V3LA 2Y8VA 4JFSA 4J56A 1UWQA 3TSMA 2DIJA 4QNEA 1XCWA 2W3ZA 1TIMA 2XSBA 4GY7A 1N5XA 4NU7A 4PCNA 4NKCA 4DZ5A 4GKTA 5FF2A 4JN7A 3TIMA 1LL7A 4XISA 3MUCA 4ROPA 4GYPA 3SUTA 2OJPA 3MHUA 1CGUA 1VCGA 2GOKA 3CGDA 2BHZA 4S39A 5ECVA 1UKPA 3S9ZA 4KFNA 3KBMA 1UH3A 3DK8A 2H8XA 3Q4DA 1L8PA 4K1GA 3ZS4A 4DYEA 3VOFA 1Z3NA 5EBUA 1SR9A 3VNYA 3GU9A 1DHPA 1F73A 5GQBA 1LCOA 3PBMA 2XIJA 3CUFA 4JS3A 1FWGC 3KRBA 3NQCA 5BXTA 1VYPX 2Y2WA 4C6LA 3LHTA 2QLYA 1KRBC 3GHUA 1UZHA 2J6XA 2Q3RA 1LTDA 5M5DA 3QY6A 2PWHA 2WMIA 4HNOA 3H2AA 1VBUA 3GH7A 4WK9A 1EWEA 1ZQ5A 1ONRA 1V93A 2VGIA 4GNVA 4C60A 1W8GA 4LVBA 4PFHA 3KVMA 1G67A 1L8NA 1AODA 2VZVA 1WDQA 4JTIA 5TF0A 5IFTA 1FWJC 4MUPA 4IMFA 4FLRA 2CITA 4LA1A 3DXIA 4O4WA 3EGJA 2CZEA 1KBIA 2XUCA 1VF8A 1KV8A 1PZ1A 4LUIA 1MXSA 2QGHA 2GK1B 5CPNA 3NG3A 2C91A 1TX0A 3L2LA 4HMEA 2P10A 3KP1A 1PHQA 4PBFA 1ZAHA 5HATA 4ZA0A 3P80A 2FMOA 2C3ZA 1OG0A 3EDEA 4UTIA 2BXZA 3TMQA 4KEVA 3F5JA 1P4CA 2ALRA 4OWGA 3BAKA 4LEFA 3WDJA 2JBMA 5FJIA 1A4MA 5DMMA 4LYPA 2NVCA 3H8AA 5ECUA 3PPHA 1MFUA 2WM0A 4XO7A 1UMLA 3GDKA 1EC7A 2JIEA 5CCZA 4AHQA 3EPMA 1FWCC 2OXNA 3IIVA 4XWUA 4GQ0A 3VCRA 4A3RA 1XW8A 5AVHA 1IR1A 5LA1A 3IJ7A 3QOMA 3EB3A 4KQNA 1GT8A 1DNCA 4H50A 2EXOA 5FESA 4PUJA 4JEJA 5HJYA 2I7GA 2X8HA 1GW1A 1F05A 1E6XM 3R6IA 3U7BA 3H6OA 4H19A 1DJHA 3EEZA 3QR1A 1HG3A 2QPXA 1S46A 4XBKA 1OCJA 1XG3A 3TKFA 2POZA 1CT5A 1RLDA 4DM1A 3B8UA 4Z1YA 3ITTA 1PSCA 2ZUSA 1J6OA 3SQPA 2NT0A 2QPUA 4JTRA 1LUCB 3AIQA 5KZEA 1NHQA 5E6ZA 3QYQA 1J93A 3W2UA 4KETA 3GB6A 4DJDC 2J8FA 1H09A 4IQJA 3EXSA 3P74A 4OU1A 3T4CA 4QNWA 4Q8TA 3L4ZA 3W85A 2DJLA 3H22A 4DBDA 4HA0A 2ZUMA 3RIKA 2VD9A 3TTEA 2GQ3A 4YU1A 3DOPA 3PZ9A 3JUGA 4XZHA 2WV8A 4JNMA 2E3TA 1BG4A 1GVQA 2NQHA 2V3DA 3N19B 3S5ZA 5KVIA 1IWAA 1Q45A 1SQ7A 3DYMA 2V3EA 3IIPA 3CQIA 1JZ5A 4S38A 5D38A 1XDJA 1MXDA 1IR2A 4E2DA 1IYXA 3A4JA 4O10A 3N9SA 3QMRA 4MAZA 4JOMA 4CQ9A 4NI3A 4FNUA 4KS0A 3ARVA 1SPQA 2IQ0A 4B4FA 1RVKA 3DGBA 1A5KC 3C2YA 3SRFA 2WLYA 5CQ1A 3AUJA 4R53A 3EB4A 2TODA 3TYCA 2HEJA 3O8AA 3W37A 4TUFA 3KOXA 1S7MA 1V08A 3QMSA 4DO6A 4LFYA 4HTYA 3TYEA 5JVLA 2CLHA 4MB1A 2XDFA 1PVNA 1SW0A 2XVNA 2VC6A 1Q6RA 4EAMA 3V7PA 2QV5A 3SR6B 3TTOA 4F66A 1XYLA 3YPIA 1JCJA 3K30A 3NYZA 4Q7NA 4CD6A 2YXGA 4DWSC 4C6FA 1FH8A 4PTDA 3UEQA 1ZAJA 3GD6A 5CC7A 1Q6OA 3E0VA 3U48A 2UY4A 5BXRA 4MWAC 1Q2SA 3LI0A 3WD0A 2VFIA 4OGZA 5GNXA 1QK0A 3N6JA 4N9EA 4C5YA 1RXOB 1JNEA 3ABXA 2W91A 1NDVA 1H62A 1GREA 4KEUA 1A0DA 2EG7A 1EB3A 2A7RA 1SZFA 4GZIA 5U4NA 3KHJA 1V6UA 4AD2A 2ZYFA 4QLJA 3URBA 4EX4A 5JBDA 2FDMA 3VOCA 5E9AA 1DP0A 4UQBA 4B15A 3TN6A 4S3JA 1GRGA 3L4VA 3MUIA 2RKXA 2QXWA 4E8GA 1JL8A 2O4QA 3CQJA 3DFHA 1GXFA 4WGHA 4YTTA 4Q4OA 2WSKA 3UF9A 1EUNA 4FK9A 2WPFA 3QZEA 2VX7A 1D3CA 2CBJA 4B5XA 1QNSA 3ARXA 2OELA 4AXKA 1CTNA 4O54A 5AHNA 3W23A 2AOSA 3MA8A 4E2OA 1C90A 1F2JA 2VTFA 1L9WA 1T8QA 4NJKA 5I06A 4LQ1A 3FJ6A 2PB1A 2XGIA 1W37A 3DGZA 5LXEA 4ZOAA 4I5XA 1VENA 5KTLA 1JDAA 2PDJA 4H4TA 3PWIA 3BQ6A 4FNQA 4V2XA 1KBJA 3RR1A 3WQOA 2PC8A 2GSEA 3I7RA 4QIUA 4LALA 1N62C 3UNDA 2NV9A 3BLFA 5CGTA 1AOGA 3QV9A 4AWTA 1O5XA 3ZT5A 3NO5A 2H90A 1HL2A 3EWCA 1OX4B 2PWGA 1PIGA 2WC4A 5LIYX 3KCOA 4MOZA 1MUCA 3PZIA 2ZUVA 3OVQA 2OCZA 2MANA 1RD6A 2VC5A 3VC6A 4QAWA 4AIOA 1T7LA 2WVTA 4JTSA 1IGSA 2XIBA 1WDRA 2C15A 2OVLA 4F3HA 7A3HA 4E2BA 4BQ4A 5TBOA 1LL6A 3R11A 2VR2A 4N02A 1MDRA 3OHMB 2ZX6A 2VVNA 4FALA 3DC8A 3OB8A 2CERA 2UV8G 3UJ2A 2C16A 1G4TA 3GG8A 1OF6A 2W3SA 1X1ZA 3CUXA 2QCFA 4AHOA 3RYSA 1H7XA 3WK2A 5C70A 2J7CA 4ZB5A 2VKZG 3BGAA 3LGEA 1MW1A 4RDWA 1PE1A 3CXOA 5BRBA 4TTGA 1DWHM 3NR0A 4P7RA 2CLFA 3OC4A 3BLOA 4Z08A 4DUWA 4AIBA 3IK4A 1EPXA 1F3EA 3PAOA 1SM9A 4AB4A 4PUNA 4JHOA 3KTXA 5JRBA 3I65A 3NZPA 5REQA 4O50A 4ZQNA 4B16A 4L6DA 3ZMRA 1V51A 1NF0A 4TV6A 4R7WA 1Q6DA 3CZGA 3ETRB 5C9UA 1GORA 1K8CA 1YXYA 4KRTA 5ABEA 2ACUA 1EBDA 1V03A 3F5LA 1UP2A 2EKGA 3H2CA 1KTCA 3O6AA 1QT1A 1NSJA 1CXKA 1VCVA 3FIGA 2A7NA 4A2SA 2WANA 2DORA 4QCFA 1VS1A 1YDYA 3HPXA 3SRHA 1AQFA 1EJUC 1HZYA 2GFTA 1E0XA 4A05A 6REQB 3W7RA 1UZDA 5BZAA 2R1LA 3N2TA 5CPSA 3LPPA 1XPGA 5I77A 4W8LA 4ZE4A 1OC6A 1MOKA 1WZKA 3CU2A 3E96A 1JAKA 1UOKA 3E9AA 3QQWA 4UC5A 3LXAA 2CU0A 3G6LA 2QW5A 2RAGA 2DVUA 3LGGA 4NXSA 3UXAA 4KERA 4DBEA 1XI3A 2XVKA 1VLWA 4H4QA 4UFHA 2PTWA 4IMCA 3CEUA 4U31A 3V16A 1XRVA 3BG5A 4L4LA 3E2VA 1JXJA 3ABSA 2V82A 3LDVA 3WMSA 1VPYA 4ZQRA 3UJEA 1S1RA 3WDPP 1Z6KA 4P7QA 3W7PA 4LV9A 4NIRA 1F8WA 3STCA 3AMDA 3MV01 4GH1A 3GD3A 4ERGA 3C5QA 3TSDA 3F4CA 1KRCC 3V0TA 1TMHA 3DBPA 1UWRA 3ZLGA 3TC3A 2OTDA 3GG1A 5LIUX 1AQHA 2VEMA 2GSJA 2DZSA 3FDKA 1RK5A 4NP7A 1NQ6A 2PDBA 4UQ9A 3PG6A 3LK6A 4HSOA 3RUBL 1E0WA 3T07A 5FEXA 1XIHA 4LNYA 3KHDA 4GH3A 1P1MA 5CLWA 1FY6A 1Q63A 3JRKA 5C2XA 3DEQA 2NZLA 1D3GA 4M56A 4W84A 4K37A 1NH6A 3HPFA 1NP0A 2H6RA 2YJQA 3B05A 4M1BA 3ID7A 3EEGA 1J10A 1M41A 2X7VA 1WDPA 1TJ2A 4O53A 1XLJA 1UA7A 4QS5A 1W32A 2ZXDA 3NWRA 1EZWA 1TUFA 3S2MA 4C1KA 1C7SA 4GVFA 3GXFA 3SGUA 1BTMA 4QM1A 4BF9A 1V02E 1A5BA 1V77A 4BQ2A 1V59A 4EPEC 1PZ0A 1S2VA 3SGZA 5I02A 1B3YA 4OVXA 4KCUA 1WNOA 3KLJA 3SRKA 3U4FA 3WQGA 3MC5A 2VOTA 4JTLA 2P76A 4TVDA 1V6YA 2E6AA 5HNRA 3CLWA 1PKNA 1F6PA 1VHCA 3DKLA 3QSTA 1PHWA 3PBVA 2PDQA 1MQRA 1L0PA 4B5SA 4O4VA 2QUMA 1R3SA 5F4XA 3W1TA 2E8YA 3GU1A 3CTLA 1HJXA 5HINA 3IACA 3LM7A 3K8MA 1PZ2A 3CS2A 4PRTA 3A7UA 1KFJA 4A8RA 1BWLA 1KBLA 1V7AA 2HVOA 4O1AA 1KQYA 4FP1A 5A6JA 1IHIA 1T96A 3DJGX 3HM7A 2GDUA 5JXQA 1TELA 1M68A 4DO7A 5D09A 1JNDA 1OABA 3UZWA 2HK1A 1X8CA 3WMBA 1TZZA 2RABA 4Q4QA 1JZ2A 3AIRA 1V0KA 1K7EA 3ICJA 1D8CA 2XFRA 1AW1A 1CEOA 1WA3A 3T0TA 2YDQA 4H4UA 3WQWA 2YFOA 3PWAA 4N9DA 2RDTA 2ZX7A 1FKWA 1U1JA 3LADA 1PWMA 3EX4A 4JHMA 1WKYA 3FEQA 3QTPA 1LQAA 4HMNA 4G7EA 5FA5A 1MXGA 3LSCA 1W5NA 3H2FA 3PJTA 2ICSA 1KCLA 3QBUA 3P14A 3M0JA 4DWSB 2OX1A 1TMQA 3DG7A 3QPZA 2FB2A 2NQLA 4IGMA 4GD0A 4FPSA 3GW0A 1E73M 2X2GA 3GU2A 4YVXA 3EOLA 3SCUA 2FB3A 4DNMA 2Q8XA 3EWYA 3QR0A 1M6IA 4AZIA 2VFEA 4MWAB 3VIFA 4D6GA 4MNLA 2ISWA 5FJOA 2B4GA 4WUIA 2H3DA 3C3NA 1NP2A 2CW6A 4PB5A 1X38A 4UFJA 1O4UA 5LNSA 1B3VA 1RQBA 4H01A 4NAEA 4I6KA 3VILA 1CNVA 5BU9A 3EPNA 1EDTA 2O92A 2X0SA 3QV6A 3PUOA 3BDKA 4WSHA 4MKSA 1JUEA 1Z48A 1BF2A 3VZYA 2E40A 2DT1A 1TPEA 4MWAE 5HNUA 4NQ1A 4AZ6A 4BK9A 3NXFA 1KKRA 1V0MA 4NI8A 1J0ZA 2G3FA 2WPEA 1F4AA 3G1VA 1EBHA 1WKFA 3UR5A 1Y5VA 3VVGA 3DFTA 3KS6A 4C7FA 1Q8AA 4DNAA 1GG1A 9XIAA 1GRTA 1PKMA 3HA1A 5FEWA 2Y70A 3EX2A 2YZRA 1KXQA 3L12A 1GZJA 1W9PA 4J28A 3KBNA 4O1EA 2VURA 1JCMP 4UTHA 1KM3A 3H54A 2G41A 2YR1A 2A3BA 1FDZA 1GPWA