1F8WA

Crystal structure of nadh peroxidase mutant: r303m
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNAMKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH PEROXIDASE
publication title Analysis of the kinetic and redox properties of the NADH peroxidase R303M mutant: correlation with the crystal structure.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 139
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 2000-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1f8wA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1f8wA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1f8wA02
2CDUA 1PXBA 2V3AA 4WX1A 1GRTA 2EQ9A 3AYLA 3P4SA 4EMWA 1IUTA 3E1TA 1RSGA 4A6NB 4JN9A 1W4XA 1KF6A 4AT2A 2B9WA 2WOIA 2B7SA 3O0HA 4C5OA 5JCMA 1K0JA 1QO8A 3FG2P 1YY5A 4AOXA 5LV9A 2PHHA 2RGHA 1PBBA 1E7PA 1TYTA 1YQZA 3QFBA 4OPIA 1DOEA 2R4JA 2FJBA 2B9XA 2X3NA 2YG3A 3RP6A 3JSKA 2GQWA 4XWRA 3T37A 1DOCA 1REOA 2BC1A 3UTEA 5U1OA 2X50A 2OLOA 1Y56A 4A7AA 3BHKA 2BS4A 2GR0A 2R4EA 5FS6A 2RGJA 2WDVA 3AXBA 4YTPA 4U8LA 3SQPA 4DSHA 3CGBA 1FL2A 2IIDA 4ZN0A 3NK0X 1OJDA 3B3RA 3LB8A 3WE0A 3CPJG 5KRQA 1XANA 5BUKA 4AP3A 1ONFA 3NTDA 3UKFA 3I6DA 2C65A 3SM8A 2XFQA 3NRNA 1KFYA 4USRA 2E1MA 3AE6A 3C4AA 1TDEA 3CNTA 1E1KA 4B69A 1GRGA 5IPYA 4APNA 3KVEA 2YM1A 3H4KA 1PJ6A 2ACZA 3P1WA 1K0IA 4BK2A 2WHDA 3NIXA 4JQ9A 4B68A 1FECA 1O94A 1M6IA 1LJ1A 4LIIA 2X8GA 1GT8A 2H88A 1GV4A 1ZY8A 1GXFA 1GRHA 1H84A 2V5ZA 3AE3A 2YLZA 1H6VA 4NTDA 1N4UA 2XYOA 1EL8A 1NG4A 4K22A 2YLSA 5KXJA 2GR1A 2AQJA 2C66A 3CPHG 2ZZ0A 1N1PA 1ZMCA 3G5RA 2IVEA 4LA1A 4EQRA 5FS8A 2WP6A 4FX9A 2R0GA 5FS7A 2GAGB 3ICRA 3DGZA 1X31B 1CHUA 4Z25A 3P4PA 4U2TA 2UZZA 4H2QA 4A6NA 1KNRA 2IVDA 1BWCA 1ZX9A 2XVJA 4A99A 1H7XA 4H50A 2XLTA 1DJQA 2XCGA 4I58A 2QCUA 1ZDLA 2Z5XA 2BABA 3CNSA 1CF3A 1HYUA 1EL7A 5JCIA 4OPLA 3VQRA 2YR4A 2A87A 1GRAA 2WP5A 4H4RA 5HYMA 2Q6UA 4K5SA 4Y4MA 4RSLA 1PBEA 4U2LA 4B63A 2XFUA 2V6OA 3M13A 1L9CA 5FMHA 2YLWA 3FBSA 2AR8A 3BNUA 5KWFA 1LV0A 4GR1A 2BYBA 4GCMA 4BJYA 3AB1A 3UKPA 4EIQA 1YKJA 1TYPA 2CULA 4Z2RA 2GR3A 1P2EA 5EB4A 3BNMA 4EMJA 1GREA 2GQFA 3CNPA 3LJPA 2YQUA 1ZOVA 2DKIA 5IQ4A 1O95A 4TM0A 3VRAA 5EBKA 1MOKA 3AYJA 2VVLG 4P9SA 4USQA 2YVFA 3ATRA 4H4TA 2XFPA 2TPRA 4EQSA 2BS3A 4Z44A 2WOVA 1PBDA 1N4VA 1VQWA 3H8LA 4C77A 2XLPA 4OPUA 1OJTA 1GTHA 5L46A 1BGJA 2XVFA 3DJEA 4B1BA 1DJNA 3CGCA 1KSUA 2GAHB 3QSMA 3IWAA 4IA6A 1GOSA 2GF3A 3L1RA 1H83A 3AE7A 3K7QX 4J56A 3M12A 4K5RA 1QLBA 4E0VA 3UOZA 5BRTA 3UTGA 3Q6JA 1IUSA 1F8WA 1GRBA 1EL9A 1ZMDA 1FEBA 4U8NA 3QVRA 3S5WA 4J31A 4EM4A 3F8DA 1L9EA 1TDNA 4PAAA 1GALA 4Z43A 4JY2A 4CY6A 1JRYA 4XXGA 2XVIA 3CNJA 2O9ZA 1VRQB 4A5LA 4X9MA 4FK1A 1LPFA 4ADWA 4M52A 2GR2A 1CL0A 3NYEA 3ZDNA 2ZBWA 2C3CA 2I0ZA 1P2HA 3DMEA 5CQFA 2NPXA 1BF3A 3ABVA 5KVIA 1E1LA 1CJCA 3GMCA 2BK5A 4D03A 2XLSA 2OAMA 5GRTA 4K2XA 1GTEA 2WDRA 3PS9A 5C2TA 4BJZA 1BZLA 1JEHA 1VG9A 2FJDA 2QA2A 2VRLA 1KNPA 3V3NA 4CCRA 3UP5A 2BS2A 2PYXA 4YT0A 3UKKA 5KOXA 3UKQA 1LTXR 2C75A 4EM3A 1JRZA 2GB0A 4H4UA 4O5QA 1NHPA 2CFYA 1L0VA 3ALJA 1PDHA 3BI5A 3EPTA 3QSSA 2AAQA 1LQTA 3AE9A 3COXA 3F8RA 3D1CA 3NKSA 3P4RA 3RP8A 2YAUA 1O5WA 3V3OA 2A89A 1IUUA 2YM2A 4UP3A 4U8KA 3VRDB 2YVGA 1D7LA 3SFEA 1H86A 3Q9TA 2E4GA 4H4WA 3OZ2A 3C96A 2YLRA 3NGCX 1JRXA 2V60A 4FDCB 4NEWA 3GDPA 1DXLA 2WPFA 2XLUA 1H82A 2NVKX 1CJ3A 4NZHA 4B65A 3GYJA 2XVHA 2C7GA 4C3XA 3IF9A 3IHMA 3RNMA 1JOAA 4AP1A 2Q7VA 5EOWA 1RP0A 2BC0A 3RHAA 4BK3A 2ZZCA 1CC2A 3BI2A 4RG3A 2C3DA 3RP7A 1TDOA 2JBVA 1B5QA 2YWLA 4GDPA 5DBJA 1CJ2A 4H7UA 1NHQA 3DJDA 3H8IA 3AWIA 1EL5A 3SGLA 3AEBA 2R9ZA 2GV8A 3FIMB 3LADA 2RGOA 3CTYA 1IJHA 3LZXA 1F6MA 1B8SA 3GRSA 3K7TA 3GRTA 4DGKA 3CNDA 3UCLA 1PBCA 3NK1X 1JNRA 2GRTA 4KX6A 4O5UA 5JCKA 2QA1A 1E6EA 4IA5A 3ATQA 4DSGA 2WEUA 3NK2X 4YSYA 3GD3A 3AEGA 4H4ZA 5J7XA 4EIPA 1FOHA 3L8KA 4UDQA 3DJJA 2OLNA 4CY8A 1XHCA 2YG6A 2YLXA 4UDPA 2W0HA 1S2YA 3SFDA 4Y4LA 3UKHA 4CNJA 5M10A 3GMBA 2C72A 1DODA 3II4A 2X99A 3AYIA 2B76A 4U8IA 3REDA 4U8PA 1MXTA 1YQ4A 3AE1A 4JNAA 4X9NA 1TDFA 2C67A 2Z5YA 3CGEA 2J3NA 2V3BA 2VRMA 5U25A 1PN0A 1B37A 4OPCA 1B4VA 4Z2UA 1JNZA 4TM4A 3NG7X 4TLZA 4A9WA 4OPGA 3EANA 4H4SA 1OJAA 1PBFA 2BA9A 2YG7A 4ZCCA 2WPCA 2X8HA 3P9UA 5HY5A 5IQ1A 2VOUA 1GETA 3URHA 1L9DA 4DNAA 3ALMA 4I59A 4IVMB 5BULA 3GYIA 3FMWA 4GRTA 1GERA 1F8SA 2C64A 1VDCA 1COYA 2Y6QA 4CNKA 4TLXA 1DOBA 1CC4A 4B64A 1K4QA 2BCPA 5GSNA 4YSZA 4X4JA 1Z6LA 4NEVA 1JU2A 3KD9A 2FBWA 2WPEA 1PHHA 1CJ4A 4GF7A 3UOXA 1IUWA 1K0LA 1IUVA 1Q9IA 3CN8A 4C3YA 1V59A 2GMJA 2Q0LA 4J34A 4IV9A 5TR3A 1GRFA 1Q1RA 2ZZBA 1F8RA 1IUXA 3KLJA 1RYIA 2GMHA 2JKCA 3LOVA 4WCTA 1VG0A 1M64A 2ARDA 1CC6A 4ZCDA 3ZYXA 1MO9A 3B6DA 1ZKQA 4K8DA 3DA1A 3AE4A 1PXCA 3AEDA 4AT0A 3NN6X 2VVMA 4OCGA 1PJ7A 4PABA 4A65A 1FCDA 4Z26A 2FJEA 2EQ7A 2WU5A 1GSNA 1NDAA 4OPDA 1PS9A 4OPTA 3BI4A 4J2WA 4RG4A 5J60A 3AE8A 4C74A 4U8OA 2VZ2A 4NTCA 1D4EA 2BK4A 3NNEA 2XFOA 1FEAA 3UKLA 2VVLA 1QJDA 3GWDA 1CBOA 4CBQA 5BVAA 3D8XA 3ADAB 2WBAA 4J33A 2B7RA 4U8JA 3HZLA 3DK9A 3AE2A 1SEZA 4XWZA 3DK8A 4N9XA 1LQUA 1UKVG 2VQ7A 2C76A 4EQXA 5CKUA 1S2QA 2B9YA 3CIRA 4YSHA 2Y6RA 1DNCA 3EF6A 1TDKA 3ICSA 1D4DA 4Y4NA 1H81A 2E5VA 2CVJA 3NHOX 2QAEA 2WP9A 2YVJA 3NH3X 3G5QA 1H7WA 2RABA 1AOGA 2BCGG 2HQMA 2R45A 3QSEA 4Z2TA 4H4VA 2WS3A 2YR5A 1LVLA 5JCLA 4H2RA 3UP4A 3DJGX 3QFAA 3GD4A 4B66A 2XVEA 2JB2A 3LXDA 2YG5A 5U63A 4K7ZA 3DK4A 3PVCA 1YQ3A 4JY3A 3F8PA 3NTAA 2BXSA 2V61A 1Q1WA 3BHFA 1ELIA 3KKJA 2EQ6A 4JNQA 3OC4A 4MJWA 2YLTA 4CRTA 1E1NA 1S3EA 4JDRA 1PXAA 2GH5A 3V76A 1D7YA 1D5TA 3NYFA 4YSXA 3AE5A 3G5SA 1E1MA 1ZP0A 1NG3A 4HA6A 4D04A 5HXIA 2APGA 3NYCA 3NN0X 3KU9A 3FPZA 4FK1C 4H4YA 3VRBA 1GESA 5JCNA 4BK1A 5KOWA 3VR8A 4J57A 1KSSA 2YR6A 1F3PA 2OALA 1Y0PA 3AEEA 3NT6A 3UTHA 3K7MX 3P4QA 5M0ZA 2WDQA 3M0OA 5HHFA 2JK6A 4TM1A 1NPXA 3R9UA 4J36A 4H4XA 1TRBA 2FJAA 4H2PA 2BACA 3UOVA 2DKHA 1ZK7A 3QVPA 3C4NA 3CPIG 4Z24A 2F5ZA 4KPRA 4BV6A 4GDEA 4LU6A 1D4CA 4YWOA 2YG4A 1NAAA 3ALLA 4U2SA 3S61A 4YXDA 2WOWA 1Y56B 3EAOA 3AEAA 4ECHA 3ICTA 4H4PA 4HB9A 1EBDA 5KVHA 1OJCA 1XPQA 5FS9A 2R0PA 2WU2A 3GSIA 3I3LA 1GNDA 2BXRA 4EMIA 1KDGA 2OA1A 3UKAA 2GVCA 3DGHA 2C73A 1ZOYA 2C70A 3IHGA 2XDOA 4GUVA 4REKA 1NEKA 3AECA 3IC9A 3AD7B 3KPFA 4YTMA 3QJ4A 4BURA 2JB1A 3KA7A 3NLCA 4YKFA 2BK3A 2VQBA 3ISHA 1NHRA 1S3BA 4YKGA 2WESA 2Q0KA 2GEWA 3CGDA 2JAEA 3AEFA 2H89A 3LZWA 4TM3A 1BGNA 1N4WA 3UOYA 4H2NA 1PJ5A 2JB3A 3ITJA 4OVIA 1GEUA 2EQ8A 4NTEA 2X8CA 4B67A 3PO7A 5C3JA 2WQYA 4AOSA 5ER0A 2R0CA 2R46A 4H4QA 4ICYA 1NENA 1GPEA 3GWFA 3UTFA 4YTNA 4UDRA 2XLRA 2A8XA 5EB5A 1NHSA 3K30A 1OJ9A 2WETA 3AD9B 1XDIA 4IVOB 3GDNA 4EQWA 2XFNA 3VR9A 1E39A 3DH9A 4CCQA 1BKWA 4U8MA 4A79A 2TMDA 3AD8B
chains in the Genus database with same CATH superfamily
2CDUA 1PXBA 3DDMA 3AYLA 1RSGA 1W4XA 2ONEA 2WOIA 3O0HA 3P93A 5BOEA 1E7PA 1TYTA 1YQZA 3QFBA 4ROPA 2X3NA 2PSNA 1DOCA 2BC1A 2OLOA 5ENLA 2GR0A 4YTPA 3SQPA 4DSHA 4ZN0A 1OJDA 3NVVB 3CPJG 1XANA 3Q4DA 4G8TA 1ONFA 3UKFA 3OW1A 4USRA 2E1MA 3AE6A 1WUFA 3JVAA 5IPYA 4APNA 2ZADA 2ACZA 4A6GA 4BK2A 5KNLA 1FECA 4LIIA 1GT8A 2H88A 1ZY8A 2O56A 3AE3A 1H6VA 4NTDA 2XYOA 1NG4A 2C66A 3SJNA 3DGBA 3SN0A 1DTNA 2WP6A 4FX9A 5FS7A 3ICRA 1X31B 1CHUA 4H2QA 1KNRA 4TVWA 3TWBA 2XLTA 2QCUA 2Z5XA 3TCSA 3CNSA 2PU1A 1CF3A 1HYUA 5JCIA 4OPLA 1GRAA 2WP5A 4H4RA 1RM6B 4U2LA 4B63A 5KWFA 4GCMA 4BJYA 4EIQA 3UXKA 1YKJA 1TYPA 2CULA 4Z2RA 2GR3A 2GQFA 4E5TA 4G6GA 1N5WC 4GFIA 4E4UA 3VRAA 5EBKA 2P3ZA 4P9SA 4USQA 4H4TA 2XFPA 4C77A 2XLPA 1T3QC 2XVFA 3DJEA 3OTRA 1STZA 3SR6B 1KSUA 3QSMA 4J56A 4E0VA 3UOZA 5BRTA 2QDEA 1EL9A 5FJUA 1ZMDA 4J31A 4EM4A 1L9EA 1MNSA 4PAAA 2OX4A 4CY6A 2PTZA 4IT1A 2QJJA 4X9MA 4FK1A 4K8GA 2C3CA 5CQFA 3ABVA 1E1LA 1CJCA 5GRTA 4K2XA 2WDRA 2VRLA 2QA2A 3NVZB 4O5QA 2CFYA 1L0VA 3ALJA 1PDHA 3AE9A 3FV9A 3GO2A 3COXA 3NKSA 3V3OA 2YAUA 1O5WA 4II3A 4U8KA 3VRDB 3Q9TA 2AL2B 3C96A 3GYXA 3NRZB 5BOFA 4C3XA 3IF9A 5EOWA 2ZZCA 3T4WA 3BI2A 2C3DA 1N60C 3SX6A 2JBVA 4GDPA 4H1ZA 1NHQA 3H8IA 2QGYA 2GGHA 2RGOA 3LZXA 1F6MA 4DGKA 1PBCA 3NK1X 1JNRA 1FFUC 1V97A 3SZCA 2WEUA 3GD3A 4KT2A 4GYPA 1S2YA 3RR1A 3UKHA 4CNJA 4U8IA 2X99A 2B76A 3AE1A 2OFJA 2P0IA 1TDFA 2C67A 3NVYB 4Z2UA 3R11A 3NG7X 3EUB3 4A9WA 4OPGA 3EANA 1GETA 2OLAA 4DNAA 4I59A 3GC2A 2C64A 1COYA 1DOBA 4B64A 4H19A 1Z6LA 2WPEA 4M6UA 3UOXA 1IUWA 5TR3A 1F8RA 2JKCA 1CC6A 3ZYXA 1MO9A 1PXCA 3AM9A 3AEDA 3SN1A 1FHUA 4E6MA 1FCDA 4Z26A 2EQ7A 4OPDA 1GSNA 3BI4A 5J60A 4C74A 4KPLA 1D4EA 3NNEA 1QJDA 1CBOA 5BVAA 3UCCA 3HW2A 5CKUA 2XSXA 3VA8A 3EF6A 3H7VA 4DYEA 1D4DA 3QLDA 2E5VA 4H4VA 5FJPA 3VDGA 3UP4A 3DJGX 3QFAA 3LXDA 5U63A 3F8PA 3NTAA 2BXSA 2V61A 3FJ4A 1Q1WA 3BHFA 1ZXIC 2EQ6A 4IL2A 4CRTA 4JDRA 3V76A 1D5TA 3AE5A 1NG3A 5HXIA 3NYCA 3CK5A 2GGGA 1F3PA 1Y0PA 3P4QA 3TQPA 3M0OA 5HHFA 4TM1A 4J36A 1TRBA 4H2PA 3UOVA 4GISA 3D9XA 2GGIA 3QVPA 2AKMA 3C4NA 3HYVA 4GAPA 3S61A 3MUCA 3EAOA 5KVHA 1OJCA 1XPQA 2R0PA 5KMPA 2OA1A 3UKAA 3DGHA 3IHGA 1ZOYA 3U4FA 3PG6A 3KA7A 2POZA 2BK3A 3ISHA 1NHRA 4YKGA 2Q0KA 3PK7A 3AEFA 1BGNA 2JB3A 4OVIA 1FO4A 4KWSA 2X8CA 3PO7A 3NXLA 5ER0A 3FYYA 3BSMA 3H70A 1BKHA 4G9KA 3ZVHA 3UJFA 2XLRA 2A8XA 3K30A 3ZLFA 1OJ9A 1N5XA 1MUCA 3NFUA 5EU9A 1WUEA 3VR9A 1BKWA 1GRTA 4GGBA 1KKOA 3P4SA 3H12A 3E1TA 4A6NB 1KF6A 3JZUA 2B9WA 4NNJA 2B7SA 3SSZA 1MRAA 3RITA 1DOEA 1TE6A 2GQWA 1L8PA 1Y56A 3ZLHA 2R4EA 2QJMA 1FL2A 2IIDA 5BUKA 4F4RA 3SBFA 3DG3A 1E1KA 3H4KA 2P88A 3P1WA 4JQ9A 4B68A 1M6IA 3R10A 1W6TA 2YLZA 2XH0A 4K22A 3MY9A 3CPHG 1P43A 4EQRA 3UJEA 2GAGB 4U2TA 2UZZA 1ZX9A 4G7FA 3ETRB 2QVHA 3HPFA 3FXGA 1OEPA 1ZDLA 2PODA 2Q6UA 4Y4MA 4RSLA 3CXBA 2V6OA 3OZMA 5FMHA 2AR8A 2OKTA 1LV0A 3UKPA 1P2EA 3BNMA 2YQUA 3ENLA 5IQ4A 1MOKA 2CHRA 2VVLG 3ATRA 4EQSA 4Z44A 2WOVA 1PBDA 4IP4A 1GTHA 4NWZA 5L46A 2GAHB 3IWAA 4IA6A 1GOSA 3L1RA 1H83A 3AE7A 3M12A 6ENLA 3Q6JA 1IUSA 3S5WA 4J3ZA 3QVRA 2ZC8A 4JY2A 4XXGA 2XVIA 1ONEA 3I6EA 3A7UA 5FJRA 4A5LA 2PU0A 3ZDNA 1BF3A 5KVIA 4HPNA 2BK5A 3TJIA 5C2TA 4BJZA 1P48A 1KNPA 1SJCA 3UP5A 3UKKA 4EM3A 3T31A 4H4UA 3R25A 1NHPA 3OP2A 3P4RA 3D1CA 2YVGA 4ZCWA 5G5GB 4EWJA 3OZ2A 3SZ0A 4FDCB 1DXLA 2P8BA 2WPFA 2XLUA 4B65A 1CJ3A 2C7GA 3RHAA 1EBHA 2YWLA 1B5QA 3DJDA 3RO6A 1EL5A 2PTYA 3AEBA 2R9ZA 1KCZA 3FIMB 3LADA 3D46A 3CTYA 1B8SA 3BJSA 3AMZA 3A7AA 5JCKA 4FI4A 1E6EA 4IA5A 4YSYA 3NK2X 3PWIA 3EKGA 4UDQA 2XH4A 3DJJA 3FCPA 4CY8A 1XHCA 3T8QA 1DODA 4U8PA 2W54A 2Z5YA 3R0UA 1JDFA 2AKZA 3CGEA 2J3NA 2VRMA 1B37A 4TM4A 3VC6A 4TLZA 4ZCCA 1OJAA 1PBFA 5HY5A 2VOUA 4IVMB 4GRTA 1F8SA 1CC4A 2AL2A 2BCPA 4X4JA 4NEVA 3N6JA 5KMQA 3T2ZA 3JW7A 3CN8A 1IUVA 4ZA0A 4C3YA 2GMJA 2Q0LA 4J34A 1IUXA 3B97A 4WCTA 3RCYA 3ZVIA 3MQTA 3AE4A 3DA1A 4E8GA 2VVMA 4A65A 1H2IA 2FJEA 2WU5A 1NDAA 4RG4A 3QTPA 1XS2A 4NTCA 3OPSA 2BK4A 3D47A 1FEAA 2VVLA 3GWDA 4CBQA 3QN3A 4XWZA 1EBGA 2C76A 1H81A 2CVJA 4HCLA 2WP9A 3NH3X 2RABA 2PTWA 2HQMA 2R45A 4H2RA 4K1WA 2YG5A 4K7ZA 3DK4A 2OO6A 1ELIA 4M0XA 3OC4A 1PXAA 2GH5A 3R1ZA 4D04A 2I5QA 3KU9A 4H4YA 1GESA 5JCNA 2YR6A 3NT6A 3CT2A 5M0ZA 1WYGA 2WDQA 1NPXA 3R9UA 4H4XA 2BACA 2DKHA 1NU5A 3QPEA 4LU6A 4U2SA 4YXDA 1NAAA 2WOWA 3IJLA 4ECHA 2PCEA 3ICTA 1EBDA 3RGTA 3ZLGA 3GSIA 1SJAA 4EMIA 2C70A 1NEKA 2JB1A 3VFCA 5J04A 3R07C 2GEWA 3N4EA 1N4WA 3SZWA 2EQ8A 4B67A 1R0MA 2WQYA 1FFVC 2R46A 1NENA 3HYXA 1GPEA 2XGZA 2W3SA 5EB5A 4EQWA 3EEZA 4U8MA 4A79A 2TMDA 3DFYA 2V3AA 2EQ9A 2BRYA 4C5OA 4A3RA 5JCMA 1K0JA 1QO8A 1YY5A 4AOXA 5LV9A 1PBBA 3RP6A 3JSKA 4XWRA 3B9JB 1REOA 3UTEA 5U1OA 2X50A 3MWCA 2RGJA 5FS6A 2FYMA 3AXBA 3IJQA 4MGGA 3VCNA 2PGWA 3B3RA 3WE0A 5KRQA 2C65A 3SM8A 4DWDA 3NRNA 3VC5A 1TDEA 3CNTA 4B69A 1GRGA 3KVEA 2HNEA 3A7RA 2YM1A 3DG7A 1PJ6A 3TJ4A 3V3WA 2WHDA 3NIXA 3I6TA 1O94A 4H83A 1LJ1A 4G6HA 2X8GA 3UGVA 1GXFA 4A35A 2DW6A 1H84A 2V5ZA 1EC7A 5KXJA 2YLSA 2GR1A 2AQJA 4JHMA 1N1PA 3G5RA 2IVEA 2E3TA 4TVYA 2OZ8A 3DGZA 1JPDX 2NQLA 4HYRA 3P4PA 4A6NA 2IVDA 3Q45A 1BWCA 1H7XA 4H50A 1DJQA 2XCGA 4I58A 2BABA 4GGHA 2YR4A 2A87A 4GAVA 1L9CA 2YLWA 4GR1A 3AB1A 3SN4A 5EB4A 3CNPA 3SY4A 3LJPA 4TM0A 3GD6A 2BS3A 4OPUA 1OJTA 3RRAA 1BGJA 1FHVA 1N62C 1QLBA 3UTGA 1F8WA 1JPMA 1JROA 1TDNA 3CNJA 2O9ZA 1VRQB 2PPGA 4ADWA 4M52A 2GR2A 3OZYA 3TWAA 1CL0A 3NYEA 1F9CA 2ZBWA 2NPXA 3P0WA 3STPA 1KD0A 1BZLA 1VG9A 2PYXA 4YT0A 5KOXA 1LTXR 2C75A 1JRZA 2GB0A 3TW9A 3BI5A 2AL1A 3EPTA 2AAQA 1IUUA 4UP3A 3CMMA 1D7LA 1H86A 4H4WA 4IL0A 1FIQB 3NGCX 3GDPA 3NS1B 1H82A 2NVKX 3T14A 3RNMA 4BK3A 1CC2A 4RG3A 3KUMA 2PP1A 2OG9A 5DBJA 3HYWA 4H7UA 3AWIA 3CYJA 3NO1A 1IJHA 1JCTA 3GRTA 3CNDA 2QA1A 3ATQA 4DSGA 3PFRA 3FVDA 3AEGA 5J7XA 1FOHA 4UDPA 2W0HA 3SFDA 5M10A 3TOYA 4G73A 2C72A 3II4A 3AYIA 4X9NA 2V3BA 4OPCA 1JRPA 5U25A 1PN0A 1B4VA 2BA9A 2YG7A 2WPCA 2X8HA 3P9UA 2OQYA 3ALMA 3URHA 5BULA 1ECQA 3GYIA 3I4KA 4II2A 1VDCA 2Y6QA 1SB3B 3SZFA 4TLXA 4CNKA 5GSNA 4YSZA 3KD9A 2FBWA 1PHHA 1CJ4A 3IK4A 4IV9A 1KN0A 1GRFA 2ZZBA 4GIRA 3LOVA 1VG0A 2ARDA 4ZCDA 3B6DA 1ZKQA 4K8DA 5KMSA 1PJ7A 4PABA 2QDDA 1NELA 1PS9A 4OPTA 4J2WA 3AE8A 4U8OA 2XFOA 3UKLA 2P8CA 3D8XA 2WBAA 2W55A 3HZLA 2PGEA 3AE2A 3DK8A 4N9XA 2PP3A 2B9YA 3PWGA 4YSHA 2Y6RA 1DNCA 1TDKA 3ICSA 5KMRA 3NHOX 2QAEA 2YVJA 3G5QA 1H7WA 4J1OA 3SXIA 2YR5A 3GD4A 3T2YA 3PVCA 4GMEA 3KKJA 4JNQA 1E1NA 1S3EA 1VDVA 3UJ2A 4YSXA 3G5SA 2FKPA 3UXLA 2MUCA 2HXTA 3NN0X 3FPZA 4FK1C 5KOWA 3VR8A 4J57A 4HCHA 3AEEA 4HCDA 3CB3A 1ZK7A 3CAWA 4GDEA 4YWOA 3ALLA 3AEAA 4HB9A 1GNDA 2BXRA 1KDGA 2GVCA 4REKA 2C73A 4GUVA 2XDOA 3KPKA 4DX3A 2OZTA 3KPFA 3IC9A 3AD7B 4YTMA 4YKFA 3CGDA 2H89A 3N6HA 3LZWA 4TM3A 1PJ5A 3ITJA 4K2SA 4NTEA 2OVLA 4AOSA 4H4QA 3V4BA 3UTFA 2WETA 3AD9B 4IVOB 3DH9A 3AD8B 4GYPC 4WX1A 4EMWA 2PA6A 1IUTA 4JN9A 4AT2A 2GGJA 3DFHA 3FG2P 4DN1A 2PHHA 2RGHA 4IHCA 4OPIA 2R4JA 2FJBA 2B9XA 2YG3A 3T37A 3S5SA 5G5HB 4A7AA 3BHKA 2BS4A 2W3RA 2WDVA 4U8LA 2OQHA 3CGBA 3NK0X 3LB8A 3ES8A 4AP3A 3NTDA 1R6WA 3I6DA 2XFQA 1KFYA 3U9IA 3C4AA 1S7MA 4Z17A 1K0IA 1GV4A 1GRHA 3DG6A 1N4UA 1EL8A 4HN8A 2ZZ0A 3SQSA 1ZMCA 5FJTA 2OZ3A 4LA1A 5FS8A 2R0GA 1SJBA 4Z25A 3MKCA 1IYXA 2XVJA 4A99A 4IZGA 4IP5A 1EL7A 4MKSA 3VQRA 3DERA 5HYMA 4K5SA 3NZGA 1PBEA 2XFUA 3M13A 3FBSA 3BNUA 4JN7A 2BYBA 4EMJA 1GREA 1ZOVA 2DKIA 1O95A 3AYJA 3V5CA 2YVFA 3AN1A 2OPJA 2TPRA 3T9PA 1N4VA 1VQWA 3H8LA 3UJSA 1MDLA 4B1BA 1DJNA 3CGCA 2GF3A 3K7QX 4K5RA 4JN8A 1GRBA 1FEBA 1MDRA 4U8NA 3F8DA 1VQZA 4Z43A 1GALA 1JRYA 1LPFA 4G74A 3TTEA 2I0ZA 1P2HA 3DMEA 3GMCA 4D03A 2XLSA 2OAMA 3THUA 1GTEA 3PS9A 1JEHA 2FJDA 3V3NA 4CCRA 2BS2A 3UKQA 2BRAA 1XPYA 3T0KA 3QSSA 2GDQA 1LQTA 4KEMA 3F8RA 3RP8A 3UJRA 2A89A 2YM2A 3SFEA 2E4GA 2QJNA 2YLRA 1JRXA 2V60A 4NEWA 4NZHA 3NVWB 3GYJA 2XVHA 3T6CA 4DHGA 5FJOA 3IHMA 4Z1YA 4AP1A 1JOAA 2Q7VA 1RP0A 2BC0A 3MSYA 3RP7A 1TDOA 1CJ2A 2PTXA 1N63C 3SGLA 3H8AA 2GV8A 1EC9A 3ES7A 2XH2A 1EC8A 3GRSA 3K7TA 3UCLA 2GRTA 4KX6A 4O5UA 1YEYA 2GL5A 4H4ZA 4EIPA 3L8KA 2OLNA 2YG6A 2YLXA 4Y4LA 3GMBA 3REDA 1MXTA 1YQ4A 4JNAA 2DW7A 2GGEA 3P3BA 3HRDC 1JNZA 3MZNA 4H4SA 5IQ1A 3IJIA 2XH7A 1L9DA 3GY1A 3FMWA 1GERA 1E9IA 3VCCA 1K4QA 2GSHA 3DESA 1JU2A 3L5OA 3QKEA 4GF7A 4ZOHB 4ENLA 2C4CA 1K0LA 1Q9IA 1V59A 4FP1A 4X2PA 1Q1RA 1RYIA 2GMHA 3KLJA 1M64A 4AT0A 3N4FA 1TKKA 3NN6X 4OCGA 3R0KA 2PP0A 3CXOA 2MNRA 2VZ2A 3ADAB 4J33A 2B7RA 4U8JA 3DK9A 4DXKA 1SEZA 4E4FA 1LQUA 1UKVG 2VQ7A 3V5FA 4EQXA 2PMQA 2HXUA 1S2QA 3CIRA 3SYIA 1SJDA 4Y4NA 2PS2A 1AOGA 2BCGG 3QSEA 4Z2TA 2WS3A 4HNLA 1LVLA 5JCLA 4B66A 2XVEA 2JB2A 4H2HA 4JY3A 1YQ3A 3ZVHB 1N61C 4MJWA 2YLTA 1RVKA 1D7YA 3NYFA 3S47A 1E1MA 1ZP0A 4HA6A 2APGA 3K1GA 3VRBA 4BK1A 1KSSA 2OALA 3UTHA 3K7MX 3DIPA 2JK6A 3BOXA 1TZZA 2FJAA 1PDZA 4YWSA 3CPIG 4Z24A 2F5ZA 3DEQA 4KPRA 4MMWA 4BV6A 1D4CA 2YG4A 1Y56B 5JRBA 1X2HA 4H4PA 2RDXA 5FS9A 2WU2A 2QQ6A 4HNCA 3I3LA 3AECA 3QJ4A 4BURA 3NLCA 2VQBA 1S3BA 3T2KA 2WESA 2JAEA 3UOYA 4H2NA 1GEUA 1ELSA 5C3JA 1KKRA 2R0CA 7ENLA 4ICYA 3GWFA 4YTNA 4UDRA 2E5AA 3UCDA 1X2GA 1NHSA 1XDIA 3GDNA 2XFNA 1E39A 5IDZA 1PDYA 4CCQA 2HZGA 1BQGA
chains in the Genus database with same CATH topology
2CDUA 2V3AA 1PXBA 4WX1A 1GRTA 2EQ9A 3AYLA 3P4SA 4EMWA 1IUTA 3E1TA 1RSGA 4A6NB 4JN9A 1W4XA 1KF6A 4AT2A 2BRYA 2B9WA 2WOIA 2B7SA 3O0HA 4NNJA 4C5OA 5JCMA 1K0JA 1QO8A 3FG2P 1YY5A 4AOXA 5LV9A 2PHHA 2RGHA 1PBBA 1E7PA 1TYTA 1YQZA 3QFBA 4OPIA 1DOEA 2R4JA 2FJBA 2B9XA 2X3NA 2YG3A 3RP6A 3JSKA 2GQWA 4XWRA 3T37A 1DOCA 1REOA 2BC1A 3UTEA 5U1OA 2X50A 2OLOA 1Y56A 4A7AA 3BHKA 2BS4A 2GR0A 2R4EA 5FS6A 2RGJA 2WDVA 3AXBA 4YTPA 4U8LA 3SQPA 4DSHA 3CGBA 1FL2A 2IIDA 4ZN0A 3NK0X 1OJDA 3B3RA 3LB8A 3WE0A 3CPJG 5KRQA 1XANA 5BUKA 4AP3A 1ONFA 3NTDA 3UKFA 3I6DA 2C65A 3SM8A 2XFQA 3NRNA 1KFYA 4USRA 2E1MA 3AE6A 3C4AA 1TDEA 3CNTA 1E1KA 4B69A 1GRGA 5IPYA 4APNA 3KVEA 2YM1A 3H4KA 1PJ6A 2ACZA 3P1WA 1S7MA 1K0IA 4BK2A 2WHDA 5KNLA 3NIXA 4JQ9A 4B68A 1FECA 1O94A 1M6IA 1LJ1A 4LIIA 2X8GA 1GT8A 2H88A 1GV4A 4G6HA 1ZY8A 1GXFA 1GRHA 1H84A 2V5ZA 3AE3A 2YLZA 1H6VA 4NTDA 1N4UA 2XYOA 1EL8A 1NG4A 4K22A 2YLSA 5KXJA 2GR1A 2AQJA 2C66A 3CPHG 2ZZ0A 1N1PA 1ZMCA 3G5RA 2IVEA 4LA1A 4EQRA 5FS8A 2WP6A 4FX9A 2R0GA 5FS7A 2GAGB 3ICRA 3DGZA 1X31B 1CHUA 4Z25A 3P4PA 4U2TA 2UZZA 4H2QA 4A6NA 1KNRA 2IVDA 1BWCA 1ZX9A 2XVJA 4A99A 1H7XA 4H50A 2XLTA 1DJQA 2XCGA 4I58A 2QCUA 1ZDLA 2Z5XA 2BABA 3CNSA 1CF3A 1HYUA 1EL7A 5JCIA 4OPLA 3VQRA 2YR4A 2A87A 1GRAA 2WP5A 4H4RA 5HYMA 2Q6UA 4GAVA 4K5SA 4Y4MA 4RSLA 1PBEA 4U2LA 4B63A 2XFUA 2V6OA 3M13A 1L9CA 5FMHA 2YLWA 3FBSA 2AR8A 3BNUA 5KWFA 1LV0A 4GR1A 2BYBA 4GCMA 4BJYA 3AB1A 3UKPA 4EIQA 1YKJA 1TYPA 2CULA 4Z2RA 2GR3A 1P2EA 5EB4A 3BNMA 4EMJA 1GREA 2GQFA 3CNPA 3LJPA 4G6GA 3SY4A 2YQUA 1ZOVA 2DKIA 5IQ4A 1O95A 4TM0A 3VRAA 5EBKA 1MOKA 3AYJA 2VVLG 4P9SA 4USQA 2YVFA 3ATRA 4H4TA 2XFPA 2TPRA 4EQSA 2BS3A 4Z44A 2WOVA 1PBDA 1N4VA 1VQWA 3H8LA 4C77A 2XLPA 4OPUA 1OJTA 1GTHA 4NWZA 5L46A 1BGJA 2XVFA 3DJEA 4B1BA 1DJNA 3CGCA 1KSUA 2GAHB 3QSMA 3IWAA 4IA6A 1GOSA 2GF3A 3L1RA 1H83A 3AE7A 3K7QX 4J56A 3M12A 4K5RA 1QLBA 4E0VA 3UOZA 5BRTA 3UTGA 3Q6JA 1IUSA 1F8WA 1GRBA 1EL9A 1ZMDA 1FEBA 4U8NA 3QVRA 3S5WA 4J31A 4EM4A 3F8DA 1L9EA 1TDNA 4PAAA 1GALA 4Z43A 4JY2A 4CY6A 1JRYA 4XXGA 2XVIA 3CNJA 2O9ZA 1VRQB 4A5LA 4X9MA 4FK1A 1LPFA 4ADWA 4G74A 4M52A 2GR2A 1CL0A 3NYEA 3ZDNA 2ZBWA 2C3CA 2I0ZA 1P2HA 3DMEA 5CQFA 2NPXA 1BF3A 3ABVA 5KVIA 1E1LA 1CJCA 3GMCA 2BK5A 4D03A 2XLSA 2OAMA 5GRTA 4K2XA 1GTEA 2WDRA 3PS9A 5C2TA 4BJZA 1BZLA 1JEHA 1VG9A 2FJDA 2QA2A 2VRLA 1KNPA 3V3NA 4CCRA 3UP5A 2BS2A 2PYXA 4YT0A 3UKKA 5KOXA 3UKQA 1LTXR 2C75A 4EM3A 1JRZA 3T31A 2GB0A 4H4UA 2BRAA 4O5QA 1NHPA 2CFYA 1L0VA 3T0KA 3ALJA 1PDHA 3BI5A 3EPTA 3QSSA 2AAQA 1LQTA 3AE9A 3COXA 3F8RA 3D1CA 3NKSA 3P4RA 3RP8A 2YAUA 1O5WA 3V3OA 2A89A 1IUUA 2YM2A 4UP3A 4II3A 4U8KA 3VRDB 2YVGA 3CMMA 1D7LA 3SFEA 1H86A 3Q9TA 2E4GA 4H4WA 3OZ2A 3C96A 2YLRA 3NGCX 1JRXA 2V60A 3SZ0A 4FDCB 4NEWA 3GDPA 3GYXA 1DXLA 2WPFA 2XLUA 1H82A 2NVKX 1CJ3A 4NZHA 4B65A 3GYJA 2XVHA 3T14A 2C7GA 4C3XA 3IF9A 3IHMA 3RNMA 1JOAA 4AP1A 2Q7VA 5EOWA 1RP0A 2BC0A 3RHAA 4BK3A 2ZZCA 1CC2A 3BI2A 4RG3A 2C3DA 3RP7A 3SX6A 1TDOA 2JBVA 1B5QA 2YWLA 4GDPA 5DBJA 3HYWA 1CJ2A 4H7UA 1NHQA 3DJDA 3H8IA 3AWIA 1EL5A 3SGLA 3AEBA 2R9ZA 2GV8A 3FIMB 3LADA 2RGOA 3CTYA 1IJHA 3LZXA 1F6MA 1B8SA 3GRSA 3K7TA 3GRTA 4DGKA 3CNDA 3UCLA 1PBCA 3NK1X 1JNRA 2GRTA 4KX6A 4O5UA 5JCKA 2QA1A 1E6EA 4IA5A 3ATQA 3SZCA 4DSGA 2WEUA 3NK2X 4YSYA 3GD3A 3AEGA 4H4ZA 5J7XA 4EIPA 1FOHA 3L8KA 4UDQA 3DJJA 2OLNA 4CY8A 1XHCA 2YG6A 2YLXA 4UDPA 2W0HA 1S2YA 3SFDA 4Y4LA 3UKHA 4CNJA 5M10A 4G73A 3GMBA 2C72A 1DODA 3II4A 2X99A 3AYIA 2B76A 4U8IA 3REDA 4U8PA 1MXTA 1YQ4A 3AE1A 4JNAA 4X9NA 1TDFA 2C67A 2Z5YA 3CGEA 2J3NA 2V3BA 2VRMA 5U25A 1PN0A 1B37A 4OPCA 1B4VA 4Z2UA 1JNZA 4TM4A 3NG7X 4TLZA 4A9WA 4OPGA 3EANA 4H4SA 1OJAA 1PBFA 2BA9A 2YG7A 4ZCCA 2WPCA 2X8HA 3P9UA 5HY5A 5IQ1A 2VOUA 1GETA 3URHA 1L9DA 4DNAA 3ALMA 4I59A 4IVMB 5BULA 3GYIA 3FMWA 4GRTA 1GERA 1F8SA 2C64A 4II2A 1VDCA 1COYA 2Y6QA 3SZFA 4TLXA 1DOBA 4CNKA 1CC4A 4B64A 1K4QA 2BCPA 5GSNA 4YSZA 4X4JA 1Z6LA 4NEVA 1JU2A 3KD9A 3L5OA 2FBWA 5KMQA 2WPEA 1PHHA 1CJ4A 3T2ZA 4GF7A 3UOXA 1IUWA 2C4CA 1K0LA 1IUVA 1Q9IA 3CN8A 4C3YA 1V59A 2GMJA 2Q0LA 4J34A 4IV9A 1KN0A 1GRFA 1Q1RA 2ZZBA 5TR3A 1IUXA 3KLJA 1F8RA 1RYIA 2GMHA 2JKCA 3LOVA 4WCTA 1VG0A 1M64A 2ARDA 1CC6A 4ZCDA 3ZYXA 1MO9A 3B6DA 1ZKQA 4K8DA 3DA1A 3AE4A 5KMSA 1PXCA 3AEDA 4AT0A 3NN6X 2VVMA 4OCGA 1PJ7A 4PABA 4A65A 1H2IA 1FCDA 4Z26A 2FJEA 2EQ7A 2WU5A 1GSNA 1NDAA 4OPDA 1PS9A 4OPTA 3BI4A 4J2WA 4RG4A 5J60A 3AE8A 4C74A 4U8OA 2VZ2A 4NTCA 1D4EA 2BK4A 3NNEA 2XFOA 1FEAA 3UKLA 2VVLA 1QJDA 3GWDA 1CBOA 4CBQA 5BVAA 3D8XA 3ADAB 2WBAA 4J33A 2B7RA 4U8JA 3HZLA 3DK9A 3AE2A 1SEZA 4XWZA 3DK8A 4N9XA 1LQUA 1UKVG 2VQ7A 2C76A 4EQXA 5CKUA 1S2QA 2B9YA 3CIRA 4YSHA 2Y6RA 1DNCA 3EF6A 1TDKA 3ICSA 5KMRA 1D4DA 3SYIA 4Y4NA 1H81A 2E5VA 2CVJA 3NHOX 2QAEA 2WP9A 2YVJA 3NH3X 3G5QA 1H7WA 2RABA 1AOGA 2BCGG 2HQMA 2R45A 3QSEA 3SXIA 4H4VA 4Z2TA 2WS3A 2YR5A 1LVLA 5JCLA 4H2RA 3UP4A 3DJGX 3QFAA 3GD4A 4B66A 2XVEA 2JB2A 3LXDA 3T2YA 2YG5A 5U63A 4K7ZA 3DK4A 3PVCA 1YQ3A 4JY3A 3F8PA 3NTAA 2BXSA 2V61A 1Q1WA 3BHFA 1ELIA 3KKJA 2EQ6A 4JNQA 3OC4A 4MJWA 2YLTA 4CRTA 1E1NA 1S3EA 4JDRA 1PXAA 2GH5A 3V76A 1D7YA 1D5TA 3NYFA 4YSXA 3AE5A 3G5SA 1E1MA 1ZP0A 1NG3A 4HA6A 4D04A 5HXIA 2APGA 3NYCA 3NN0X 3KU9A 3FPZA 4FK1C 4H4YA 3VRBA 1GESA 5JCNA 4BK1A 5KOWA 3VR8A 4J57A 1KSSA 2YR6A 1F3PA 2OALA 1Y0PA 3AEEA 3NT6A 3UTHA 3K7MX 3P4QA 5M0ZA 2WDQA 3M0OA 5HHFA 2JK6A 4TM1A 1NPXA 3R9UA 4J36A 4H4XA 1TRBA 2FJAA 4H2PA 2BACA 3UOVA 2DKHA 1ZK7A 3D9XA 3QVPA 3C4NA 3CPIG 3HYVA 4Z24A 2F5ZA 4GAPA 4KPRA 4BV6A 4GDEA 4LU6A 1D4CA 4YWOA 2YG4A 1NAAA 3ALLA 4U2SA 3S61A 4YXDA 2WOWA 1Y56B 5JRBA 3EAOA 3AEAA 4ECHA 3ICTA 4H4PA 4HB9A 1EBDA 5KVHA 1OJCA 1XPQA 5FS9A 2R0PA 2WU2A 3GSIA 5KMPA 3I3LA 1GNDA 2BXRA 4EMIA 1KDGA 2OA1A 3UKAA 2GVCA 3DGHA 2C73A 1ZOYA 2C70A 3IHGA 2XDOA 4GUVA 4REKA 3KPKA 1NEKA 3AECA 3IC9A 3AD7B 3KPFA 3PG6A 4YTMA 3QJ4A 4BURA 2JB1A 3KA7A 3NLCA 4YKFA 2BK3A 2VQBA 3ISHA 1NHRA 1S3BA 3T2KA 4YKGA 2WESA 2Q0KA 2GEWA 3CGDA 2JAEA 3AEFA 2H89A 3LZWA 4TM3A 1BGNA 1N4WA 3SZWA 4H2NA 3UOYA 1PJ5A 2JB3A 3ITJA 4OVIA 1GEUA 2EQ8A 4NTEA 2X8CA 4B67A 3PO7A 5C3JA 2WQYA 4AOSA 5ER0A 2R0CA 2R46A 4H4QA 4ICYA 1NENA 3HYXA 1GPEA 4G9KA 3GWFA 3UTFA 4YTNA 4UDRA 2XLRA 2A8XA 5EB5A 1NHSA 3K30A 1OJ9A 2WETA 3AD9B 1XDIA 4IVOB 3GDNA 4EQWA 2XFNA 3VR9A 1E39A 3DH9A 4CCQA 1BKWA 4U8MA 4A79A 2TMDA 3AD8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CDU A;  1PXB A;  2V3A A;  4WX1 A;  1GRT A;  2EQ9 A;  3AYL A;  3P4S A;  4EMW A;  1IUT A;  3E1T A;  1RSG A;  4A6N B;  4JN9 A;  1W4X A;  1KF6 A;  4AT2 A;  2B9W A;  2WOI A;  2B7S A;  3O0H A;  4C5O A;  5JCM A;  1K0J A;  1QO8 A;  3FG2 P;  1YY5 A;  4AOX A;  5LV9 A;  2PHH A;  2RGH A;  1PBB A;  1E7P A;  1TYT A;  1YQZ A;  3QFB A;  4OPI A;  1DOE A;  2R4J A;  2FJB A;  2B9X A;  2X3N A;  2YG3 A;  3RP6 A;  3JSK A;  2GQW A;  4XWR A;  3T37 A;  1DOC A;  1REO A;  2BC1 A;  3UTE A;  5U1O A;  2X50 A;  2OLO A;  1Y56 A;  4A7A A;  3BHK A;  2BS4 A;  2GR0 A;  2R4E A;  5FS6 A;  2RGJ A;  2WDV A;  3AXB A;  4YTP A;  4U8L A;  3SQP A;  4DSH A;  3CGB A;  1FL2 A;  2IID A;  4ZN0 A;  3NK0 X;  1OJD A;  3B3R A;  3LB8 A;  3WE0 A;  3CPJ G;  5KRQ A;  1XAN A;  5BUK A;  4AP3 A;  1ONF A;  3NTD A;  3UKF A;  3I6D A;  2C65 A;  3SM8 A;  2XFQ A;  3NRN A;  1KFY A;  4USR A;  2E1M A;  3AE6 A;  3C4A A;  1TDE A;  3CNT A;  1E1K A;  4B69 A;  1GRG A;  5IPY A;  4APN A;  3KVE A;  2YM1 A;  3H4K A;  1PJ6 A;  2ACZ A;  3P1W A;  1K0I A;  4BK2 A;  2WHD A;  3NIX A;  4JQ9 A;  4B68 A;  1FEC A;  1O94 A;  1M6I A;  1LJ1 A;  4LII A;  2X8G A;  1GT8 A;  2H88 A;  1GV4 A;  1ZY8 A;  1GXF A;  1GRH A;  1H84 A;  2V5Z A;  3AE3 A;  2YLZ A;  1H6V A;  4NTD A;  1N4U A;  2XYO A;  1EL8 A;  1NG4 A;  4K22 A;  2YLS A;  5KXJ A;  2GR1 A;  2AQJ A;  2C66 A;  3CPH G;  2ZZ0 A;  1N1P A;  1ZMC A;  3G5R A;  2IVE A;  4LA1 A;  4EQR A;  5FS8 A;  2WP6 A;  4FX9 A;  2R0G A;  5FS7 A;  2GAG B;  3ICR A;  3DGZ A;  1X31 B;  1CHU A;  4Z25 A;  3P4P A;  4U2T A;  2UZZ A;  4H2Q A;  4A6N A;  1KNR A;  2IVD A;  1BWC A;  1ZX9 A;  2XVJ A;  4A99 A;  1H7X A;  4H50 A;  2XLT A;  1DJQ A;  2XCG A;  4I58 A;  2QCU A;  1ZDL A;  2Z5X A;  2BAB A;  3CNS A;  1CF3 A;  1HYU A;  1EL7 A;  5JCI A;  4OPL A;  3VQR A;  2YR4 A;  2A87 A;  1GRA A;  2WP5 A;  4H4R A;  5HYM A;  2Q6U A;  4K5S A;  4Y4M A;  4RSL A;  1PBE A;  4U2L A;  4B63 A;  2XFU A;  2V6O A;  3M13 A;  1L9C A;  5FMH A;  2YLW A;  3FBS A;  2AR8 A;  3BNU A;  5KWF A;  1LV0 A;  4GR1 A;  2BYB A;  4GCM A;  4BJY A;  3AB1 A;  3UKP A;  4EIQ A;  1YKJ A;  1TYP A;  2CUL A;  4Z2R A;  2GR3 A;  1P2E A;  5EB4 A;  3BNM A;  4EMJ A;  1GRE A;  2GQF A;  3CNP A;  3LJP A;  2YQU A;  1ZOV A;  2DKI A;  5IQ4 A;  1O95 A;  4TM0 A;  3VRA A;  5EBK A;  1MOK A;  3AYJ A;  2VVL G;  4P9S A;  4USQ A;  2YVF A;  3ATR A;  4H4T A;  2XFP A;  2TPR A;  4EQS A;  2BS3 A;  4Z44 A;  2WOV A;  1PBD A;  1N4V A;  1VQW A;  3H8L A;  4C77 A;  2XLP A;  4OPU A;  1OJT A;  1GTH A;  5L46 A;  1BGJ A;  2XVF A;  3DJE A;  4B1B A;  1DJN A;  3CGC A;  1KSU A;  2GAH B;  3QSM A;  3IWA A;  4IA6 A;  1GOS A;  2GF3 A;  3L1R A;  1H83 A;  3AE7 A;  3K7Q X;  4J56 A;  3M12 A;  4K5R A;  1QLB A;  4E0V A;  3UOZ A;  5BRT A;  3UTG A;  3Q6J A;  1IUS A;  1F8W A;  1GRB A;  1EL9 A;  1ZMD A;  1FEB A;  4U8N A;  3QVR A;  3S5W A;  4J31 A;  4EM4 A;  3F8D A;  1L9E A;  1TDN A;  4PAA A;  1GAL A;  4Z43 A;  4JY2 A;  4CY6 A;  1JRY A;  4XXG A;  2XVI A;  3CNJ A;  2O9Z A;  1VRQ B;  4A5L A;  4X9M A;  4FK1 A;  1LPF A;  4ADW A;  4M52 A;  2GR2 A;  1CL0 A;  3NYE A;  3ZDN A;  2ZBW A;  2C3C A;  2I0Z A;  1P2H A;  3DME A;  5CQF A;  2NPX A;  1BF3 A;  3ABV A;  5KVI A;  1E1L A;  1CJC A;  3GMC A;  2BK5 A;  4D03 A;  2XLS A;  2OAM A;  5GRT A;  4K2X A;  1GTE A;  2WDR A;  3PS9 A;  5C2T A;  4BJZ A;  1BZL A;  1JEH A;  1VG9 A;  2FJD A;  2QA2 A;  2VRL A;  1KNP A;  3V3N A;  4CCR A;  3UP5 A;  2BS2 A;  2PYX A;  4YT0 A;  3UKK A;  5KOX A;  3UKQ A;  1LTX R;  2C75 A;  4EM3 A;  1JRZ A;  2GB0 A;  4H4U A;  4O5Q A;  1NHP A;  2CFY A;  1L0V A;  3ALJ A;  1PDH A;  3BI5 A;  3EPT A;  3QSS A;  2AAQ A;  1LQT A;  3AE9 A;  3COX A;  3F8R A;  3D1C A;  3NKS A;  3P4R A;  3RP8 A;  2YAU A;  1O5W A;  3V3O A;  2A89 A;  1IUU A;  2YM2 A;  4UP3 A;  4U8K A;  3VRD B;  2YVG A;  1D7L A;  3SFE A;  1H86 A;  3Q9T A;  2E4G A;  4H4W A;  3OZ2 A;  3C96 A;  2YLR A;  3NGC X;  1JRX A;  2V60 A;  4FDC B;  4NEW A;  3GDP A;  1DXL A;  2WPF A;  2XLU A;  1H82 A;  2NVK X;  1CJ3 A;  4NZH A;  4B65 A;  3GYJ A;  2XVH A;  2C7G A;  4C3X A;  3IF9 A;  3IHM A;  3RNM A;  1JOA A;  4AP1 A;  2Q7V A;  5EOW A;  1RP0 A;  2BC0 A;  3RHA A;  4BK3 A;  2ZZC A;  1CC2 A;  3BI2 A;  4RG3 A;  2C3D A;  3RP7 A;  1TDO A;  2JBV A;  1B5Q A;  2YWL A;  4GDP A;  5DBJ A;  1CJ2 A;  4H7U A;  1NHQ A;  3DJD A;  3H8I A;  3AWI A;  1EL5 A;  3SGL A;  3AEB A;  2R9Z A;  2GV8 A;  3FIM B;  3LAD A;  2RGO A;  3CTY A;  1IJH A;  3LZX A;  1F6M A;  1B8S A;  3GRS A;  3K7T A;  3GRT A;  4DGK A;  3CND A;  3UCL A;  1PBC A;  3NK1 X;  1JNR A;  2GRT A;  4KX6 A;  4O5U A;  5JCK A;  2QA1 A;  1E6E A;  4IA5 A;  3ATQ A;  4DSG A;  2WEU A;  3NK2 X;  4YSY A;  3GD3 A;  3AEG A;  4H4Z A;  5J7X A;  4EIP A;  1FOH A;  3L8K A;  4UDQ A;  3DJJ A;  2OLN A;  4CY8 A;  1XHC A;  2YG6 A;  2YLX A;  4UDP A;  2W0H A;  1S2Y A;  3SFD A;  4Y4L A;  3UKH A;  4CNJ A;  5M10 A;  3GMB A;  2C72 A;  1DOD A;  3II4 A;  2X99 A;  3AYI A;  2B76 A;  4U8I A;  3RED A;  4U8P A;  1MXT A;  1YQ4 A;  3AE1 A;  4JNA A;  4X9N A;  1TDF A;  2C67 A;  2Z5Y A;  3CGE A;  2J3N A;  2V3B A;  2VRM A;  5U25 A;  1PN0 A;  1B37 A;  4OPC A;  1B4V A;  4Z2U A;  1JNZ A;  4TM4 A;  3NG7 X;  4TLZ A;  4A9W A;  4OPG A;  3EAN A;  4H4S A;  1OJA A;  1PBF A;  2BA9 A;  2YG7 A;  4ZCC A;  2WPC A;  2X8H A;  3P9U A;  5HY5 A;  5IQ1 A;  2VOU A;  1GET A;  3URH A;  1L9D A;  4DNA A;  3ALM A;  4I59 A;  4IVM B;  5BUL A;  3GYI A;  3FMW A;  4GRT A;  1GER A;  1F8S A;  2C64 A;  1VDC A;  1COY A;  2Y6Q A;  4CNK A;  4TLX A;  1DOB A;  1CC4 A;  4B64 A;  1K4Q A;  2BCP A;  5GSN A;  4YSZ A;  4X4J A;  1Z6L A;  4NEV A;  1JU2 A;  3KD9 A;  2FBW A;  2WPE A;  1PHH A;  1CJ4 A;  4GF7 A;  3UOX A;  1IUW A;  1K0L A;  1IUV A;  1Q9I A;  3CN8 A;  4C3Y A;  1V59 A;  2GMJ A;  2Q0L A;  4J34 A;  4IV9 A;  5TR3 A;  1GRF A;  1Q1R A;  2ZZB A;  1F8R A;  1IUX A;  3KLJ A;  1RYI A;  2GMH A;  2JKC A;  3LOV A;  4WCT A;  1VG0 A;  1M64 A;  2ARD A;  1CC6 A;  4ZCD A;  3ZYX A;  1MO9 A;  3B6D A;  1ZKQ A;  4K8D A;  3DA1 A;  3AE4 A;  1PXC A;  3AED A;  4AT0 A;  3NN6 X;  2VVM A;  4OCG A;  1PJ7 A;  4PAB A;  4A65 A;  1FCD A;  4Z26 A;  2FJE A;  2EQ7 A;  2WU5 A;  1GSN A;  1NDA A;  4OPD A;  1PS9 A;  4OPT A;  3BI4 A;  4J2W A;  4RG4 A;  5J60 A;  3AE8 A;  4C74 A;  4U8O A;  2VZ2 A;  4NTC A;  1D4E A;  2BK4 A;  3NNE A;  2XFO A;  1FEA A;  3UKL A;  2VVL A;  1QJD A;  3GWD A;  1CBO A;  4CBQ A;  5BVA A;  3D8X A;  3ADA B;  2WBA A;  4J33 A;  2B7R A;  4U8J A;  3HZL A;  3DK9 A;  3AE2 A;  1SEZ A;  4XWZ A;  3DK8 A;  4N9X A;  1LQU A;  1UKV G;  2VQ7 A;  2C76 A;  4EQX A;  5CKU A;  1S2Q A;  2B9Y A;  3CIR A;  4YSH A;  2Y6R A;  1DNC A;  3EF6 A;  1TDK A;  3ICS A;  1D4D A;  4Y4N A;  1H81 A;  2E5V A;  2CVJ A;  3NHO X;  2QAE A;  2WP9 A;  2YVJ A;  3NH3 X;  3G5Q A;  1H7W A;  2RAB A;  1AOG A;  2BCG G;  2HQM A;  2R45 A;  3QSE A;  4Z2T A;  4H4V A;  2WS3 A;  2YR5 A;  1LVL A;  5JCL A;  4H2R A;  3UP4 A;  3DJG X;  3QFA A;  3GD4 A;  4B66 A;  2XVE A;  2JB2 A;  3LXD A;  2YG5 A;  5U63 A;  4K7Z A;  3DK4 A;  3PVC A;  1YQ3 A;  4JY3 A;  3F8P A;  3NTA A;  2BXS A;  2V61 A;  1Q1W A;  3BHF A;  1ELI A;  3KKJ A;  2EQ6 A;  4JNQ A;  3OC4 A;  4MJW A;  2YLT A;  4CRT A;  1E1N A;  1S3E A;  4JDR A;  1PXA A;  2GH5 A;  3V76 A;  1D7Y A;  1D5T A;  3NYF A;  4YSX A;  3AE5 A;  3G5S A;  1E1M A;  1ZP0 A;  1NG3 A;  4HA6 A;  4D04 A;  5HXI A;  2APG A;  3NYC A;  3NN0 X;  3KU9 A;  3FPZ A;  4FK1 C;  4H4Y A;  3VRB A;  1GES A;  5JCN A;  4BK1 A;  5KOW A;  3VR8 A;  4J57 A;  1KSS A;  2YR6 A;  1F3P A;  2OAL A;  1Y0P A;  3AEE A;  3NT6 A;  3UTH A;  3K7M X;  3P4Q A;  5M0Z A;  2WDQ A;  3M0O A;  5HHF A;  2JK6 A;  4TM1 A;  1NPX A;  3R9U A;  4J36 A;  4H4X A;  1TRB A;  2FJA A;  4H2P A;  2BAC A;  3UOV A;  2DKH A;  1ZK7 A;  3QVP A;  3C4N A;  3CPI G;  4Z24 A;  2F5Z A;  4KPR A;  4BV6 A;  4GDE A;  4LU6 A;  1D4C A;  4YWO A;  2YG4 A;  1NAA A;  3ALL A;  4U2S A;  3S61 A;  4YXD A;  2WOW A;  1Y56 B;  3EAO A;  3AEA A;  4ECH A;  3ICT A;  4H4P A;  4HB9 A;  1EBD A;  5KVH A;  1OJC A;  1XPQ A;  5FS9 A;  2R0P A;  2WU2 A;  3GSI A;  3I3L A;  1GND A;  2BXR A;  4EMI A;  1KDG A;  2OA1 A;  3UKA A;  2GVC A;  3DGH A;  2C73 A;  1ZOY A;  2C70 A;  3IHG A;  2XDO A;  4GUV A;  4REK A;  1NEK A;  3AEC A;  3IC9 A;  3AD7 B;  3KPF A;  4YTM A;  3QJ4 A;  4BUR A;  2JB1 A;  3KA7 A;  3NLC A;  4YKF A;  2BK3 A;  2VQB A;  3ISH A;  1NHR A;  1S3B A;  4YKG A;  2WES A;  2Q0K A;  2GEW A;  3CGD A;  2JAE A;  3AEF A;  2H89 A;  3LZW A;  4TM3 A;  1BGN A;  1N4W A;  3UOY A;  4H2N A;  1PJ5 A;  2JB3 A;  3ITJ A;  4OVI A;  1GEU A;  2EQ8 A;  4NTE A;  2X8C A;  4B67 A;  3PO7 A;  5C3J A;  2WQY A;  4AOS A;  5ER0 A;  2R0C A;  2R46 A;  4H4Q A;  4ICY A;  1NEN A;  1GPE A;  3GWF A;  3UTF A;  4YTN A;  4UDR A;  2XLR A;  2A8X A;  5EB5 A;  1NHS A;  3K30 A;  1OJ9 A;  2WET A;  3AD9 B;  1XDI A;  4IVO B;  3GDN A;  4EQW A;  2XFN A;  3VR9 A;  1E39 A;  3DH9 A;  4CCQ A;  1BKW A;  4U8M A;  4A79 A;  2TMD A;  3AD8 B; 
#chains in the Genus database with same CATH topology
 2CDU A;  1PXB A;  3DDM A;  3AYL A;  1RSG A;  1W4X A;  2ONE A;  2WOI A;  3O0H A;  3P93 A;  5BOE A;  1E7P A;  1TYT A;  1YQZ A;  3QFB A;  4ROP A;  2X3N A;  2PSN A;  1DOC A;  2BC1 A;  2OLO A;  5ENL A;  2GR0 A;  4YTP A;  3SQP A;  4DSH A;  4ZN0 A;  1OJD A;  3NVV B;  3CPJ G;  1XAN A;  3Q4D A;  4G8T A;  1ONF A;  3UKF A;  3OW1 A;  4USR A;  2E1M A;  3AE6 A;  1WUF A;  3JVA A;  5IPY A;  4APN A;  2ZAD A;  2ACZ A;  4A6G A;  4BK2 A;  5KNL A;  1FEC A;  4LII A;  1GT8 A;  2H88 A;  1ZY8 A;  2O56 A;  3AE3 A;  1H6V A;  4NTD A;  2XYO A;  1NG4 A;  2C66 A;  3SJN A;  3DGB A;  3SN0 A;  1DTN A;  2WP6 A;  4FX9 A;  5FS7 A;  3ICR A;  1X31 B;  1CHU A;  4H2Q A;  1KNR A;  4TVW A;  3TWB A;  2XLT A;  2QCU A;  2Z5X A;  3TCS A;  3CNS A;  2PU1 A;  1CF3 A;  1HYU A;  5JCI A;  4OPL A;  1GRA A;  2WP5 A;  4H4R A;  1RM6 B;  4U2L A;  4B63 A;  5KWF A;  4GCM A;  4BJY A;  4EIQ A;  3UXK A;  1YKJ A;  1TYP A;  2CUL A;  4Z2R A;  2GR3 A;  2GQF A;  4E5T A;  4G6G A;  1N5W C;  4GFI A;  4E4U A;  3VRA A;  5EBK A;  2P3Z A;  4P9S A;  4USQ A;  4H4T A;  2XFP A;  4C77 A;  2XLP A;  1T3Q C;  2XVF A;  3DJE A;  3OTR A;  1STZ A;  3SR6 B;  1KSU A;  3QSM A;  4J56 A;  4E0V A;  3UOZ A;  5BRT A;  2QDE A;  1EL9 A;  5FJU A;  1ZMD A;  4J31 A;  4EM4 A;  1L9E A;  1MNS A;  4PAA A;  2OX4 A;  4CY6 A;  2PTZ A;  4IT1 A;  2QJJ A;  4X9M A;  4FK1 A;  4K8G A;  2C3C A;  5CQF A;  3ABV A;  1E1L A;  1CJC A;  5GRT A;  4K2X A;  2WDR A;  2VRL A;  2QA2 A;  3NVZ B;  4O5Q A;  2CFY A;  1L0V A;  3ALJ A;  1PDH A;  3AE9 A;  3FV9 A;  3GO2 A;  3COX A;  3NKS A;  3V3O A;  2YAU A;  1O5W A;  4II3 A;  4U8K A;  3VRD B;  3Q9T A;  2AL2 B;  3C96 A;  3GYX A;  3NRZ B;  5BOF A;  4C3X A;  3IF9 A;  5EOW A;  2ZZC A;  3T4W A;  3BI2 A;  2C3D A;  1N60 C;  3SX6 A;  2JBV A;  4GDP A;  4H1Z A;  1NHQ A;  3H8I A;  2QGY A;  2GGH A;  2RGO A;  3LZX A;  1F6M A;  4DGK A;  1PBC A;  3NK1 X;  1JNR A;  1FFU C;  1V97 A;  3SZC A;  2WEU A;  3GD3 A;  4KT2 A;  4GYP A;  1S2Y A;  3RR1 A;  3UKH A;  4CNJ A;  4U8I A;  2X99 A;  2B76 A;  3AE1 A;  2OFJ A;  2P0I A;  1TDF A;  2C67 A;  3NVY B;  4Z2U A;  3R11 A;  3NG7 X;  3EUB 3;  4A9W A;  4OPG A;  3EAN A;  1GET A;  2OLA A;  4DNA A;  4I59 A;  3GC2 A;  2C64 A;  1COY A;  1DOB A;  4B64 A;  4H19 A;  1Z6L A;  2WPE A;  4M6U A;  3UOX A;  1IUW A;  5TR3 A;  1F8R A;  2JKC A;  1CC6 A;  3ZYX A;  1MO9 A;  1PXC A;  3AM9 A;  3AED A;  3SN1 A;  1FHU A;  4E6M A;  1FCD A;  4Z26 A;  2EQ7 A;  4OPD A;  1GSN A;  3BI4 A;  5J60 A;  4C74 A;  4KPL A;  1D4E A;  3NNE A;  1QJD A;  1CBO A;  5BVA A;  3UCC A;  3HW2 A;  5CKU A;  2XSX A;  3VA8 A;  3EF6 A;  3H7V A;  4DYE A;  1D4D A;  3QLD A;  2E5V A;  4H4V A;  5FJP A;  3VDG A;  3UP4 A;  3DJG X;  3QFA A;  3LXD A;  5U63 A;  3F8P A;  3NTA A;  2BXS A;  2V61 A;  3FJ4 A;  1Q1W A;  3BHF A;  1ZXI C;  2EQ6 A;  4IL2 A;  4CRT A;  4JDR A;  3V76 A;  1D5T A;  3AE5 A;  1NG3 A;  5HXI A;  3NYC A;  3CK5 A;  2GGG A;  1F3P A;  1Y0P A;  3P4Q A;  3TQP A;  3M0O A;  5HHF A;  4TM1 A;  4J36 A;  1TRB A;  4H2P A;  3UOV A;  4GIS A;  3D9X A;  2GGI A;  3QVP A;  2AKM A;  3C4N A;  3HYV A;  4GAP A;  3S61 A;  3MUC A;  3EAO A;  5KVH A;  1OJC A;  1XPQ A;  2R0P A;  5KMP A;  2OA1 A;  3UKA A;  3DGH A;  3IHG A;  1ZOY A;  3U4F A;  3PG6 A;  3KA7 A;  2POZ A;  2BK3 A;  3ISH A;  1NHR A;  4YKG A;  2Q0K A;  3PK7 A;  3AEF A;  1BGN A;  2JB3 A;  4OVI A;  1FO4 A;  4KWS A;  2X8C A;  3PO7 A;  3NXL A;  5ER0 A;  3FYY A;  3BSM A;  3H70 A;  1BKH A;  4G9K A;  3ZVH A;  3UJF A;  2XLR A;  2A8X A;  3K30 A;  3ZLF A;  1OJ9 A;  1N5X A;  1MUC A;  3NFU A;  5EU9 A;  1WUE A;  3VR9 A;  1BKW A;  1GRT A;  4GGB A;  1KKO A;  3P4S A;  3H12 A;  3E1T A;  4A6N B;  1KF6 A;  3JZU A;  2B9W A;  4NNJ A;  2B7S A;  3SSZ A;  1MRA A;  3RIT A;  1DOE A;  1TE6 A;  2GQW A;  1L8P A;  1Y56 A;  3ZLH A;  2R4E A;  2QJM A;  1FL2 A;  2IID A;  5BUK A;  4F4R A;  3SBF A;  3DG3 A;  1E1K A;  3H4K A;  2P88 A;  3P1W A;  4JQ9 A;  4B68 A;  1M6I A;  3R10 A;  1W6T A;  2YLZ A;  2XH0 A;  4K22 A;  3MY9 A;  3CPH G;  1P43 A;  4EQR A;  3UJE A;  2GAG B;  4U2T A;  2UZZ A;  1ZX9 A;  4G7F A;  3ETR B;  2QVH A;  3HPF A;  3FXG A;  1OEP A;  1ZDL A;  2POD A;  2Q6U A;  4Y4M A;  4RSL A;  3CXB A;  2V6O A;  3OZM A;  5FMH A;  2AR8 A;  2OKT A;  1LV0 A;  3UKP A;  1P2E A;  3BNM A;  2YQU A;  3ENL A;  5IQ4 A;  1MOK A;  2CHR A;  2VVL G;  3ATR A;  4EQS A;  4Z44 A;  2WOV A;  1PBD A;  4IP4 A;  1GTH A;  4NWZ A;  5L46 A;  2GAH B;  3IWA A;  4IA6 A;  1GOS A;  3L1R A;  1H83 A;  3AE7 A;  3M12 A;  6ENL A;  3Q6J A;  1IUS A;  3S5W A;  4J3Z A;  3QVR A;  2ZC8 A;  4JY2 A;  4XXG A;  2XVI A;  1ONE A;  3I6E A;  3A7U A;  5FJR A;  4A5L A;  2PU0 A;  3ZDN A;  1BF3 A;  5KVI A;  4HPN A;  2BK5 A;  3TJI A;  5C2T A;  4BJZ A;  1P48 A;  1KNP A;  1SJC A;  3UP5 A;  3UKK A;  4EM3 A;  3T31 A;  4H4U A;  3R25 A;  1NHP A;  3OP2 A;  3P4R A;  3D1C A;  2YVG A;  4ZCW A;  5G5G B;  4EWJ A;  3OZ2 A;  3SZ0 A;  4FDC B;  1DXL A;  2P8B A;  2WPF A;  2XLU A;  4B65 A;  1CJ3 A;  2C7G A;  3RHA A;  1EBH A;  2YWL A;  1B5Q A;  3DJD A;  3RO6 A;  1EL5 A;  2PTY A;  3AEB A;  2R9Z A;  1KCZ A;  3FIM B;  3LAD A;  3D46 A;  3CTY A;  1B8S A;  3BJS A;  3AMZ A;  3A7A A;  5JCK A;  4FI4 A;  1E6E A;  4IA5 A;  4YSY A;  3NK2 X;  3PWI A;  3EKG A;  4UDQ A;  2XH4 A;  3DJJ A;  3FCP A;  4CY8 A;  1XHC A;  3T8Q A;  1DOD A;  4U8P A;  2W54 A;  2Z5Y A;  3R0U A;  1JDF A;  2AKZ A;  3CGE A;  2J3N A;  2VRM A;  1B37 A;  4TM4 A;  3VC6 A;  4TLZ A;  4ZCC A;  1OJA A;  1PBF A;  5HY5 A;  2VOU A;  4IVM B;  4GRT A;  1F8S A;  1CC4 A;  2AL2 A;  2BCP A;  4X4J A;  4NEV A;  3N6J A;  5KMQ A;  3T2Z A;  3JW7 A;  3CN8 A;  1IUV A;  4ZA0 A;  4C3Y A;  2GMJ A;  2Q0L A;  4J34 A;  1IUX A;  3B97 A;  4WCT A;  3RCY A;  3ZVI A;  3MQT A;  3AE4 A;  3DA1 A;  4E8G A;  2VVM A;  4A65 A;  1H2I A;  2FJE A;  2WU5 A;  1NDA A;  4RG4 A;  3QTP A;  1XS2 A;  4NTC A;  3OPS A;  2BK4 A;  3D47 A;  1FEA A;  2VVL A;  3GWD A;  4CBQ A;  3QN3 A;  4XWZ A;  1EBG A;  2C76 A;  1H81 A;  2CVJ A;  4HCL A;  2WP9 A;  3NH3 X;  2RAB A;  2PTW A;  2HQM A;  2R45 A;  4H2R A;  4K1W A;  2YG5 A;  4K7Z A;  3DK4 A;  2OO6 A;  1ELI A;  4M0X A;  3OC4 A;  1PXA A;  2GH5 A;  3R1Z A;  4D04 A;  2I5Q A;  3KU9 A;  4H4Y A;  1GES A;  5JCN A;  2YR6 A;  3NT6 A;  3CT2 A;  5M0Z A;  1WYG A;  2WDQ A;  1NPX A;  3R9U A;  4H4X A;  2BAC A;  2DKH A;  1NU5 A;  3QPE A;  4LU6 A;  4U2S A;  4YXD A;  1NAA A;  2WOW A;  3IJL A;  4ECH A;  2PCE A;  3ICT A;  1EBD A;  3RGT A;  3ZLG A;  3GSI A;  1SJA A;  4EMI A;  2C70 A;  1NEK A;  2JB1 A;  3VFC A;  5J04 A;  3R07 C;  2GEW A;  3N4E A;  1N4W A;  3SZW A;  2EQ8 A;  4B67 A;  1R0M A;  2WQY A;  1FFV C;  2R46 A;  1NEN A;  3HYX A;  1GPE A;  2XGZ A;  2W3S A;  5EB5 A;  4EQW A;  3EEZ A;  4U8M A;  4A79 A;  2TMD A;  3DFY A;  2V3A A;  2EQ9 A;  2BRY A;  4C5O A;  4A3R A;  5JCM A;  1K0J A;  1QO8 A;  1YY5 A;  4AOX A;  5LV9 A;  1PBB A;  3RP6 A;  3JSK A;  4XWR A;  3B9J B;  1REO A;  3UTE A;  5U1O A;  2X50 A;  3MWC A;  2RGJ A;  5FS6 A;  2FYM A;  3AXB A;  3IJQ A;  4MGG A;  3VCN A;  2PGW A;  3B3R A;  3WE0 A;  5KRQ A;  2C65 A;  3SM8 A;  4DWD A;  3NRN A;  3VC5 A;  1TDE A;  3CNT A;  4B69 A;  1GRG A;  3KVE A;  2HNE A;  3A7R A;  2YM1 A;  3DG7 A;  1PJ6 A;  3TJ4 A;  3V3W A;  2WHD A;  3NIX A;  3I6T A;  1O94 A;  4H83 A;  1LJ1 A;  4G6H A;  2X8G A;  3UGV A;  1GXF A;  4A35 A;  2DW6 A;  1H84 A;  2V5Z A;  1EC7 A;  5KXJ A;  2YLS A;  2GR1 A;  2AQJ A;  4JHM A;  1N1P A;  3G5R A;  2IVE A;  2E3T A;  4TVY A;  2OZ8 A;  3DGZ A;  1JPD X;  2NQL A;  4HYR A;  3P4P A;  4A6N A;  2IVD A;  3Q45 A;  1BWC A;  1H7X A;  4H50 A;  1DJQ A;  2XCG A;  4I58 A;  2BAB A;  4GGH A;  2YR4 A;  2A87 A;  4GAV A;  1L9C A;  2YLW A;  4GR1 A;  3AB1 A;  3SN4 A;  5EB4 A;  3CNP A;  3SY4 A;  3LJP A;  4TM0 A;  3GD6 A;  2BS3 A;  4OPU A;  1OJT A;  3RRA A;  1BGJ A;  1FHV A;  1N62 C;  1QLB A;  3UTG A;  1F8W A;  1JPM A;  1JRO A;  1TDN A;  3CNJ A;  2O9Z A;  1VRQ B;  2PPG A;  4ADW A;  4M52 A;  2GR2 A;  3OZY A;  3TWA A;  1CL0 A;  3NYE A;  1F9C A;  2ZBW A;  2NPX A;  3P0W A;  3STP A;  1KD0 A;  1BZL A;  1VG9 A;  2PYX A;  4YT0 A;  5KOX A;  1LTX R;  2C75 A;  1JRZ A;  2GB0 A;  3TW9 A;  3BI5 A;  2AL1 A;  3EPT A;  2AAQ A;  1IUU A;  4UP3 A;  3CMM A;  1D7L A;  1H86 A;  4H4W A;  4IL0 A;  1FIQ B;  3NGC X;  3GDP A;  3NS1 B;  1H82 A;  2NVK X;  3T14 A;  3RNM A;  4BK3 A;  1CC2 A;  4RG3 A;  3KUM A;  2PP1 A;  2OG9 A;  5DBJ A;  3HYW A;  4H7U A;  3AWI A;  3CYJ A;  3NO1 A;  1IJH A;  1JCT A;  3GRT A;  3CND A;  2QA1 A;  3ATQ A;  4DSG A;  3PFR A;  3FVD A;  3AEG A;  5J7X A;  1FOH A;  4UDP A;  2W0H A;  3SFD A;  5M10 A;  3TOY A;  4G73 A;  2C72 A;  3II4 A;  3AYI A;  4X9N A;  2V3B A;  4OPC A;  1JRP A;  5U25 A;  1PN0 A;  1B4V A;  2BA9 A;  2YG7 A;  2WPC A;  2X8H A;  3P9U A;  2OQY A;  3ALM A;  3URH A;  5BUL A;  1ECQ A;  3GYI A;  3I4K A;  4II2 A;  1VDC A;  2Y6Q A;  1SB3 B;  3SZF A;  4TLX A;  4CNK A;  5GSN A;  4YSZ A;  3KD9 A;  2FBW A;  1PHH A;  1CJ4 A;  3IK4 A;  4IV9 A;  1KN0 A;  1GRF A;  2ZZB A;  4GIR A;  3LOV A;  1VG0 A;  2ARD A;  4ZCD A;  3B6D A;  1ZKQ A;  4K8D A;  5KMS A;  1PJ7 A;  4PAB A;  2QDD A;  1NEL A;  1PS9 A;  4OPT A;  4J2W A;  3AE8 A;  4U8O A;  2XFO A;  3UKL A;  2P8C A;  3D8X A;  2WBA A;  2W55 A;  3HZL A;  2PGE A;  3AE2 A;  3DK8 A;  4N9X A;  2PP3 A;  2B9Y A;  3PWG A;  4YSH A;  2Y6R A;  1DNC A;  1TDK A;  3ICS A;  5KMR A;  3NHO X;  2QAE A;  2YVJ A;  3G5Q A;  1H7W A;  4J1O A;  3SXI A;  2YR5 A;  3GD4 A;  3T2Y A;  3PVC A;  4GME A;  3KKJ A;  4JNQ A;  1E1N A;  1S3E A;  1VDV A;  3UJ2 A;  4YSX A;  3G5S A;  2FKP A;  3UXL A;  2MUC A;  2HXT A;  3NN0 X;  3FPZ A;  4FK1 C;  5KOW A;  3VR8 A;  4J57 A;  4HCH A;  3AEE A;  4HCD A;  3CB3 A;  1ZK7 A;  3CAW A;  4GDE A;  4YWO A;  3ALL A;  3AEA A;  4HB9 A;  1GND A;  2BXR A;  1KDG A;  2GVC A;  4REK A;  2C73 A;  4GUV A;  2XDO A;  3KPK A;  4DX3 A;  2OZT A;  3KPF A;  3IC9 A;  3AD7 B;  4YTM A;  4YKF A;  3CGD A;  2H89 A;  3N6H A;  3LZW A;  4TM3 A;  1PJ5 A;  3ITJ A;  4K2S A;  4NTE A;  2OVL A;  4AOS A;  4H4Q A;  3V4B A;  3UTF A;  2WET A;  3AD9 B;  4IVO B;  3DH9 A;  3AD8 B;  4GYP C;  4WX1 A;  4EMW A;  2PA6 A;  1IUT A;  4JN9 A;  4AT2 A;  2GGJ A;  3DFH A;  3FG2 P;  4DN1 A;  2PHH A;  2RGH A;  4IHC A;  4OPI A;  2R4J A;  2FJB A;  2B9X A;  2YG3 A;  3T37 A;  3S5S A;  5G5H B;  4A7A A;  3BHK A;  2BS4 A;  2W3R A;  2WDV A;  4U8L A;  2OQH A;  3CGB A;  3NK0 X;  3LB8 A;  3ES8 A;  4AP3 A;  3NTD A;  1R6W A;  3I6D A;  2XFQ A;  1KFY A;  3U9I A;  3C4A A;  1S7M A;  4Z17 A;  1K0I A;  1GV4 A;  1GRH A;  3DG6 A;  1N4U A;  1EL8 A;  4HN8 A;  2ZZ0 A;  3SQS A;  1ZMC A;  5FJT A;  2OZ3 A;  4LA1 A;  5FS8 A;  2R0G A;  1SJB A;  4Z25 A;  3MKC A;  1IYX A;  2XVJ A;  4A99 A;  4IZG A;  4IP5 A;  1EL7 A;  4MKS A;  3VQR A;  3DER A;  5HYM A;  4K5S A;  3NZG A;  1PBE A;  2XFU A;  3M13 A;  3FBS A;  3BNU A;  4JN7 A;  2BYB A;  4EMJ A;  1GRE A;  1ZOV A;  2DKI A;  1O95 A;  3AYJ A;  3V5C A;  2YVF A;  3AN1 A;  2OPJ A;  2TPR A;  3T9P A;  1N4V A;  1VQW A;  3H8L A;  3UJS A;  1MDL A;  4B1B A;  1DJN A;  3CGC A;  2GF3 A;  3K7Q X;  4K5R A;  4JN8 A;  1GRB A;  1FEB A;  1MDR A;  4U8N A;  3F8D A;  1VQZ A;  4Z43 A;  1GAL A;  1JRY A;  1LPF A;  4G74 A;  3TTE A;  2I0Z A;  1P2H A;  3DME A;  3GMC A;  4D03 A;  2XLS A;  2OAM A;  3THU A;  1GTE A;  3PS9 A;  1JEH A;  2FJD A;  3V3N A;  4CCR A;  2BS2 A;  3UKQ A;  2BRA A;  1XPY A;  3T0K A;  3QSS A;  2GDQ A;  1LQT A;  4KEM A;  3F8R A;  3RP8 A;  3UJR A;  2A89 A;  2YM2 A;  3SFE A;  2E4G A;  2QJN A;  2YLR A;  1JRX A;  2V60 A;  4NEW A;  4NZH A;  3NVW B;  3GYJ A;  2XVH A;  3T6C A;  4DHG A;  5FJO A;  3IHM A;  4Z1Y A;  4AP1 A;  1JOA A;  2Q7V A;  1RP0 A;  2BC0 A;  3MSY A;  3RP7 A;  1TDO A;  1CJ2 A;  2PTX A;  1N63 C;  3SGL A;  3H8A A;  2GV8 A;  1EC9 A;  3ES7 A;  2XH2 A;  1EC8 A;  3GRS A;  3K7T A;  3UCL A;  2GRT A;  4KX6 A;  4O5U A;  1YEY A;  2GL5 A;  4H4Z A;  4EIP A;  3L8K A;  2OLN A;  2YG6 A;  2YLX A;  4Y4L A;  3GMB A;  3RED A;  1MXT A;  1YQ4 A;  4JNA A;  2DW7 A;  2GGE A;  3P3B A;  3HRD C;  1JNZ A;  3MZN A;  4H4S A;  5IQ1 A;  3IJI A;  2XH7 A;  1L9D A;  3GY1 A;  3FMW A;  1GER A;  1E9I A;  3VCC A;  1K4Q A;  2GSH A;  3DES A;  1JU2 A;  3L5O A;  3QKE A;  4GF7 A;  4ZOH B;  4ENL A;  2C4C A;  1K0L A;  1Q9I A;  1V59 A;  4FP1 A;  4X2P A;  1Q1R A;  1RYI A;  2GMH A;  3KLJ A;  1M64 A;  4AT0 A;  3N4F A;  1TKK A;  3NN6 X;  4OCG A;  3R0K A;  2PP0 A;  3CXO A;  2MNR A;  2VZ2 A;  3ADA B;  4J33 A;  2B7R A;  4U8J A;  3DK9 A;  4DXK A;  1SEZ A;  4E4F A;  1LQU A;  1UKV G;  2VQ7 A;  3V5F A;  4EQX A;  2PMQ A;  2HXU A;  1S2Q A;  3CIR A;  3SYI A;  1SJD A;  4Y4N A;  2PS2 A;  1AOG A;  2BCG G;  3QSE A;  4Z2T A;  2WS3 A;  4HNL A;  1LVL A;  5JCL A;  4B66 A;  2XVE A;  2JB2 A;  4H2H A;  4JY3 A;  1YQ3 A;  3ZVH B;  1N61 C;  4MJW A;  2YLT A;  1RVK A;  1D7Y A;  3NYF A;  3S47 A;  1E1M A;  1ZP0 A;  4HA6 A;  2APG A;  3K1G A;  3VRB A;  4BK1 A;  1KSS A;  2OAL A;  3UTH A;  3K7M X;  3DIP A;  2JK6 A;  3BOX A;  1TZZ A;  2FJA A;  1PDZ A;  4YWS A;  3CPI G;  4Z24 A;  2F5Z A;  3DEQ A;  4KPR A;  4MMW A;  4BV6 A;  1D4C A;  2YG4 A;  1Y56 B;  5JRB A;  1X2H A;  4H4P A;  2RDX A;  5FS9 A;  2WU2 A;  2QQ6 A;  4HNC A;  3I3L A;  3AEC A;  3QJ4 A;  4BUR A;  3NLC A;  2VQB A;  1S3B A;  3T2K A;  2WES A;  2JAE A;  3UOY A;  4H2N A;  1GEU A;  1ELS A;  5C3J A;  1KKR A;  2R0C A;  7ENL A;  4ICY A;  3GWF A;  4YTN A;  4UDR A;  2E5A A;  3UCD A;  1X2G A;  1NHS A;  1XDI A;  3GDN A;  2XFN A;  1E39 A;  5IDZ A;  1PDY A;  4CCQ A;  2HZG A;  1BQG A; 
#chains in the Genus database with same CATH homology
 2CDU A;  2V3A A;  1PXB A;  4WX1 A;  1GRT A;  2EQ9 A;  3AYL A;  3P4S A;  4EMW A;  1IUT A;  3E1T A;  1RSG A;  4A6N B;  4JN9 A;  1W4X A;  1KF6 A;  4AT2 A;  2BRY A;  2B9W A;  2WOI A;  2B7S A;  3O0H A;  4NNJ A;  4C5O A;  5JCM A;  1K0J A;  1QO8 A;  3FG2 P;  1YY5 A;  4AOX A;  5LV9 A;  2PHH A;  2RGH A;  1PBB A;  1E7P A;  1TYT A;  1YQZ A;  3QFB A;  4OPI A;  1DOE A;  2R4J A;  2FJB A;  2B9X A;  2X3N A;  2YG3 A;  3RP6 A;  3JSK A;  2GQW A;  4XWR A;  3T37 A;  1DOC A;  1REO A;  2BC1 A;  3UTE A;  5U1O A;  2X50 A;  2OLO A;  1Y56 A;  4A7A A;  3BHK A;  2BS4 A;  2GR0 A;  2R4E A;  5FS6 A;  2RGJ A;  2WDV A;  3AXB A;  4YTP A;  4U8L A;  3SQP A;  4DSH A;  3CGB A;  1FL2 A;  2IID A;  4ZN0 A;  3NK0 X;  1OJD A;  3B3R A;  3LB8 A;  3WE0 A;  3CPJ G;  5KRQ A;  1XAN A;  5BUK A;  4AP3 A;  1ONF A;  3NTD A;  3UKF A;  3I6D A;  2C65 A;  3SM8 A;  2XFQ A;  3NRN A;  1KFY A;  4USR A;  2E1M A;  3AE6 A;  3C4A A;  1TDE A;  3CNT A;  1E1K A;  4B69 A;  1GRG A;  5IPY A;  4APN A;  3KVE A;  2YM1 A;  3H4K A;  1PJ6 A;  2ACZ A;  3P1W A;  1S7M A;  1K0I A;  4BK2 A;  2WHD A;  5KNL A;  3NIX A;  4JQ9 A;  4B68 A;  1FEC A;  1O94 A;  1M6I A;  1LJ1 A;  4LII A;  2X8G A;  1GT8 A;  2H88 A;  1GV4 A;  4G6H A;  1ZY8 A;  1GXF A;  1GRH A;  1H84 A;  2V5Z A;  3AE3 A;  2YLZ A;  1H6V A;  4NTD A;  1N4U A;  2XYO A;  1EL8 A;  1NG4 A;  4K22 A;  2YLS A;  5KXJ A;  2GR1 A;  2AQJ A;  2C66 A;  3CPH G;  2ZZ0 A;  1N1P A;  1ZMC A;  3G5R A;  2IVE A;  4LA1 A;  4EQR A;  5FS8 A;  2WP6 A;  4FX9 A;  2R0G A;  5FS7 A;  2GAG B;  3ICR A;  3DGZ A;  1X31 B;  1CHU A;  4Z25 A;  3P4P A;  4U2T A;  2UZZ A;  4H2Q A;  4A6N A;  1KNR A;  2IVD A;  1BWC A;  1ZX9 A;  2XVJ A;  4A99 A;  1H7X A;  4H50 A;  2XLT A;  1DJQ A;  2XCG A;  4I58 A;  2QCU A;  1ZDL A;  2Z5X A;  2BAB A;  3CNS A;  1CF3 A;  1HYU A;  1EL7 A;  5JCI A;  4OPL A;  3VQR A;  2YR4 A;  2A87 A;  1GRA A;  2WP5 A;  4H4R A;  5HYM A;  2Q6U A;  4GAV A;  4K5S A;  4Y4M A;  4RSL A;  1PBE A;  4U2L A;  4B63 A;  2XFU A;  2V6O A;  3M13 A;  1L9C A;  5FMH A;  2YLW A;  3FBS A;  2AR8 A;  3BNU A;  5KWF A;  1LV0 A;  4GR1 A;  2BYB A;  4GCM A;  4BJY A;  3AB1 A;  3UKP A;  4EIQ A;  1YKJ A;  1TYP A;  2CUL A;  4Z2R A;  2GR3 A;  1P2E A;  5EB4 A;  3BNM A;  4EMJ A;  1GRE A;  2GQF A;  3CNP A;  3LJP A;  4G6G A;  3SY4 A;  2YQU A;  1ZOV A;  2DKI A;  5IQ4 A;  1O95 A;  4TM0 A;  3VRA A;  5EBK A;  1MOK A;  3AYJ A;  2VVL G;  4P9S A;  4USQ A;  2YVF A;  3ATR A;  4H4T A;  2XFP A;  2TPR A;  4EQS A;  2BS3 A;  4Z44 A;  2WOV A;  1PBD A;  1N4V A;  1VQW A;  3H8L A;  4C77 A;  2XLP A;  4OPU A;  1OJT A;  1GTH A;  4NWZ A;  5L46 A;  1BGJ A;  2XVF A;  3DJE A;  4B1B A;  1DJN A;  3CGC A;  1KSU A;  2GAH B;  3QSM A;  3IWA A;  4IA6 A;  1GOS A;  2GF3 A;  3L1R A;  1H83 A;  3AE7 A;  3K7Q X;  4J56 A;  3M12 A;  4K5R A;  1QLB A;  4E0V A;  3UOZ A;  5BRT A;  3UTG A;  3Q6J A;  1IUS A;  1F8W A;  1GRB A;  1EL9 A;  1ZMD A;  1FEB A;  4U8N A;  3QVR A;  3S5W A;  4J31 A;  4EM4 A;  3F8D A;  1L9E A;  1TDN A;  4PAA A;  1GAL A;  4Z43 A;  4JY2 A;  4CY6 A;  1JRY A;  4XXG A;  2XVI A;  3CNJ A;  2O9Z A;  1VRQ B;  4A5L A;  4X9M A;  4FK1 A;  1LPF A;  4ADW A;  4G74 A;  4M52 A;  2GR2 A;  1CL0 A;  3NYE A;  3ZDN A;  2ZBW A;  2C3C A;  2I0Z A;  1P2H A;  3DME A;  5CQF A;  2NPX A;  1BF3 A;  3ABV A;  5KVI A;  1E1L A;  1CJC A;  3GMC A;  2BK5 A;  4D03 A;  2XLS A;  2OAM A;  5GRT A;  4K2X A;  1GTE A;  2WDR A;  3PS9 A;  5C2T A;  4BJZ A;  1BZL A;  1JEH A;  1VG9 A;  2FJD A;  2QA2 A;  2VRL A;  1KNP A;  3V3N A;  4CCR A;  3UP5 A;  2BS2 A;  2PYX A;  4YT0 A;  3UKK A;  5KOX A;  3UKQ A;  1LTX R;  2C75 A;  4EM3 A;  1JRZ A;  3T31 A;  2GB0 A;  4H4U A;  2BRA A;  4O5Q A;  1NHP A;  2CFY A;  1L0V A;  3T0K A;  3ALJ A;  1PDH A;  3BI5 A;  3EPT A;  3QSS A;  2AAQ A;  1LQT A;  3AE9 A;  3COX A;  3F8R A;  3D1C A;  3NKS A;  3P4R A;  3RP8 A;  2YAU A;  1O5W A;  3V3O A;  2A89 A;  1IUU A;  2YM2 A;  4UP3 A;  4II3 A;  4U8K A;  3VRD B;  2YVG A;  3CMM A;  1D7L A;  3SFE A;  1H86 A;  3Q9T A;  2E4G A;  4H4W A;  3OZ2 A;  3C96 A;  2YLR A;  3NGC X;  1JRX A;  2V60 A;  3SZ0 A;  4FDC B;  4NEW A;  3GDP A;  3GYX A;  1DXL A;  2WPF A;  2XLU A;  1H82 A;  2NVK X;  1CJ3 A;  4NZH A;  4B65 A;  3GYJ A;  2XVH A;  3T14 A;  2C7G A;  4C3X A;  3IF9 A;  3IHM A;  3RNM A;  1JOA A;  4AP1 A;  2Q7V A;  5EOW A;  1RP0 A;  2BC0 A;  3RHA A;  4BK3 A;  2ZZC A;  1CC2 A;  3BI2 A;  4RG3 A;  2C3D A;  3RP7 A;  3SX6 A;  1TDO A;  2JBV A;  1B5Q A;  2YWL A;  4GDP A;  5DBJ A;  3HYW A;  1CJ2 A;  4H7U A;  1NHQ A;  3DJD A;  3H8I A;  3AWI A;  1EL5 A;  3SGL A;  3AEB A;  2R9Z A;  2GV8 A;  3FIM B;  3LAD A;  2RGO A;  3CTY A;  1IJH A;  3LZX A;  1F6M A;  1B8S A;  3GRS A;  3K7T A;  3GRT A;  4DGK A;  3CND A;  3UCL A;  1PBC A;  3NK1 X;  1JNR A;  2GRT A;  4KX6 A;  4O5U A;  5JCK A;  2QA1 A;  1E6E A;  4IA5 A;  3ATQ A;  3SZC A;  4DSG A;  2WEU A;  3NK2 X;  4YSY A;  3GD3 A;  3AEG A;  4H4Z A;  5J7X A;  4EIP A;  1FOH A;  3L8K A;  4UDQ A;  3DJJ A;  2OLN A;  4CY8 A;  1XHC A;  2YG6 A;  2YLX A;  4UDP A;  2W0H A;  1S2Y A;  3SFD A;  4Y4L A;  3UKH A;  4CNJ A;  5M10 A;  4G73 A;  3GMB A;  2C72 A;  1DOD A;  3II4 A;  2X99 A;  3AYI A;  2B76 A;  4U8I A;  3RED A;  4U8P A;  1MXT A;  1YQ4 A;  3AE1 A;  4JNA A;  4X9N A;  1TDF A;  2C67 A;  2Z5Y A;  3CGE A;  2J3N A;  2V3B A;  2VRM A;  5U25 A;  1PN0 A;  1B37 A;  4OPC A;  1B4V A;  4Z2U A;  1JNZ A;  4TM4 A;  3NG7 X;  4TLZ A;  4A9W A;  4OPG A;  3EAN A;  4H4S A;  1OJA A;  1PBF A;  2BA9 A;  2YG7 A;  4ZCC A;  2WPC A;  2X8H A;  3P9U A;  5HY5 A;  5IQ1 A;  2VOU A;  1GET A;  3URH A;  1L9D A;  4DNA A;  3ALM A;  4I59 A;  4IVM B;  5BUL A;  3GYI A;  3FMW A;  4GRT A;  1GER A;  1F8S A;  2C64 A;  4II2 A;  1VDC A;  1COY A;  2Y6Q A;  3SZF A;  4TLX A;  1DOB A;  4CNK A;  1CC4 A;  4B64 A;  1K4Q A;  2BCP A;  5GSN A;  4YSZ A;  4X4J A;  1Z6L A;  4NEV A;  1JU2 A;  3KD9 A;  3L5O A;  2FBW A;  5KMQ A;  2WPE A;  1PHH A;  1CJ4 A;  3T2Z A;  4GF7 A;  3UOX A;  1IUW A;  2C4C A;  1K0L A;  1IUV A;  1Q9I A;  3CN8 A;  4C3Y A;  1V59 A;  2GMJ A;  2Q0L A;  4J34 A;  4IV9 A;  1KN0 A;  1GRF A;  1Q1R A;  2ZZB A;  5TR3 A;  1IUX A;  3KLJ A;  1F8R A;  1RYI A;  2GMH A;  2JKC A;  3LOV A;  4WCT A;  1VG0 A;  1M64 A;  2ARD A;  1CC6 A;  4ZCD A;  3ZYX A;  1MO9 A;  3B6D A;  1ZKQ A;  4K8D A;  3DA1 A;  3AE4 A;  5KMS A;  1PXC A;  3AED A;  4AT0 A;  3NN6 X;  2VVM A;  4OCG A;  1PJ7 A;  4PAB A;  4A65 A;  1H2I A;  1FCD A;  4Z26 A;  2FJE A;  2EQ7 A;  2WU5 A;  1GSN A;  1NDA A;  4OPD A;  1PS9 A;  4OPT A;  3BI4 A;  4J2W A;  4RG4 A;  5J60 A;  3AE8 A;  4C74 A;  4U8O A;  2VZ2 A;  4NTC A;  1D4E A;  2BK4 A;  3NNE A;  2XFO A;  1FEA A;  3UKL A;  2VVL A;  1QJD A;  3GWD A;  1CBO A;  4CBQ A;  5BVA A;  3D8X A;  3ADA B;  2WBA A;  4J33 A;  2B7R A;  4U8J A;  3HZL A;  3DK9 A;  3AE2 A;  1SEZ A;  4XWZ A;  3DK8 A;  4N9X A;  1LQU A;  1UKV G;  2VQ7 A;  2C76 A;  4EQX A;  5CKU A;  1S2Q A;  2B9Y A;  3CIR A;  4YSH A;  2Y6R A;  1DNC A;  3EF6 A;  1TDK A;  3ICS A;  5KMR A;  1D4D A;  3SYI A;  4Y4N A;  1H81 A;  2E5V A;  2CVJ A;  3NHO X;  2QAE A;  2WP9 A;  2YVJ A;  3NH3 X;  3G5Q A;  1H7W A;  2RAB A;  1AOG A;  2BCG G;  2HQM A;  2R45 A;  3QSE A;  3SXI A;  4H4V A;  4Z2T A;  2WS3 A;  2YR5 A;  1LVL A;  5JCL A;  4H2R A;  3UP4 A;  3DJG X;  3QFA A;  3GD4 A;  4B66 A;  2XVE A;  2JB2 A;  3LXD A;  3T2Y A;  2YG5 A;  5U63 A;  4K7Z A;  3DK4 A;  3PVC A;  1YQ3 A;  4JY3 A;  3F8P A;  3NTA A;  2BXS A;  2V61 A;  1Q1W A;  3BHF A;  1ELI A;  3KKJ A;  2EQ6 A;  4JNQ A;  3OC4 A;  4MJW A;  2YLT A;  4CRT A;  1E1N A;  1S3E A;  4JDR A;  1PXA A;  2GH5 A;  3V76 A;  1D7Y A;  1D5T A;  3NYF A;  4YSX A;  3AE5 A;  3G5S A;  1E1M A;  1ZP0 A;  1NG3 A;  4HA6 A;  4D04 A;  5HXI A;  2APG A;  3NYC A;  3NN0 X;  3KU9 A;  3FPZ A;  4FK1 C;  4H4Y A;  3VRB A;  1GES A;  5JCN A;  4BK1 A;  5KOW A;  3VR8 A;  4J57 A;  1KSS A;  2YR6 A;  1F3P A;  2OAL A;  1Y0P A;  3AEE A;  3NT6 A;  3UTH A;  3K7M X;  3P4Q A;  5M0Z A;  2WDQ A;  3M0O A;  5HHF A;  2JK6 A;  4TM1 A;  1NPX A;  3R9U A;  4J36 A;  4H4X A;  1TRB A;  2FJA A;  4H2P A;  2BAC A;  3UOV A;  2DKH A;  1ZK7 A;  3D9X A;  3QVP A;  3C4N A;  3CPI G;  3HYV A;  4Z24 A;  2F5Z A;  4GAP A;  4KPR A;  4BV6 A;  4GDE A;  4LU6 A;  1D4C A;  4YWO A;  2YG4 A;  1NAA A;  3ALL A;  4U2S A;  3S61 A;  4YXD A;  2WOW A;  1Y56 B;  5JRB A;  3EAO A;  3AEA A;  4ECH A;  3ICT A;  4H4P A;  4HB9 A;  1EBD A;  5KVH A;  1OJC A;  1XPQ A;  5FS9 A;  2R0P A;  2WU2 A;  3GSI A;  5KMP A;  3I3L A;  1GND A;  2BXR A;  4EMI A;  1KDG A;  2OA1 A;  3UKA A;  2GVC A;  3DGH A;  2C73 A;  1ZOY A;  2C70 A;  3IHG A;  2XDO A;  4GUV A;  4REK A;  3KPK A;  1NEK A;  3AEC A;  3IC9 A;  3AD7 B;  3KPF A;  3PG6 A;  4YTM A;  3QJ4 A;  4BUR A;  2JB1 A;  3KA7 A;  3NLC A;  4YKF A;  2BK3 A;  2VQB A;  3ISH A;  1NHR A;  1S3B A;  3T2K A;  4YKG A;  2WES A;  2Q0K A;  2GEW A;  3CGD A;  2JAE A;  3AEF A;  2H89 A;  3LZW A;  4TM3 A;  1BGN A;  1N4W A;  3SZW A;  4H2N A;  3UOY A;  1PJ5 A;  2JB3 A;  3ITJ A;  4OVI A;  1GEU A;  2EQ8 A;  4NTE A;  2X8C A;  4B67 A;  3PO7 A;  5C3J A;  2WQY A;  4AOS A;  5ER0 A;  2R0C A;  2R46 A;  4H4Q A;  4ICY A;  1NEN A;  3HYX A;  1GPE A;  4G9K A;  3GWF A;  3UTF A;  4YTN A;  4UDR A;  2XLR A;  2A8X A;  5EB5 A;  1NHS A;  3K30 A;  1OJ9 A;  2WET A;  3AD9 B;  1XDI A;  4IVO B;  3GDN A;  4EQW A;  2XFN A;  3VR9 A;  1E39 A;  3DH9 A;  4CCQ A;  1BKW A;  4U8M A;  4A79 A;  2TMD A;  3AD8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...