1F8WA

Crystal structure of nadh peroxidase mutant: r303m
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNAMKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title Analysis of the kinetic and redox properties of the NADH peroxidase R303M mutant: correlation with the crystal structure.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase
total genus 139
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 2000-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1f8wA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1f8wA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1f8wA02
1ZDLA 4LIIA 1GETA 1FEBA 1GRFA 2R0GA 1W4XA 3ALMA 4GDEA 2BC0A 2IIDA 5C3JA 1E7PA 1Y56A 5HY5A 4A7AA 2DKIA 2VRLA 1B5QA 3AE4A 1ZX9A 1GTEA 2YLTA 4Z2RA 3VR9A 2RGJA 3SM8A 5J7XA 2WU2A 1CC6A 5KRQA 1O94A 1ZY8A 3L8KA 4J2WA 3H8IA 4FX9A 5C2TA 1X31B 1ZP0A 3QVPA 2C66A 4Z43A 3SQPA 4Z26A 1PJ5A 4H4YA 3B6DA 3K30A 3GDPA 3AE6A 4Z25A 3AYIA 2ARDA 4H4UA 3P4QA 5GRTA 4PAAA 2YG7A 4BJZA 4ZN0A 1N4WA 4J56A 3UKLA 4EM3A 2JB3A 4X9MA 2BYBA 5EOWA 1EBDA 2GH5A 4H4XA 1COYA 1KDGA 4TM3A 2AQJA 2B7SA 2GR1A 1GERA 3DK8A 2BACA 2GAHB 5FMHA 3G5RA 2WPFA 1CJ2A 2WP6A 4DGKA 1Z6LA 2JBVA 4K22A 3ATRA 4BURA 3KKJA 2WP9A 2ZBWA 1EL8A 1ZMDA 2BS4A 2A8XA 4BV6A 3BHFA 4EIPA 1LVLA 3DMEA 2WESA 5JCKA 4EM4A 3FPZA 4KPRA 4U8LA 3CNDA 3Q6JA 1GRAA 3AB1A 1DOBA 4DSHA 4A6NA 5IQ4A 2R4EA 3AEBA 1H7WA 3FG2P 3AEGA 2DKHA 4O5UA 3V3NA 4KX6A 4TM1A 4CBQA 1F8WA 1PN0A 2YWLA 1VQWA 3AE9A 3DJDA 4H2NA 1QLBA 2H89A 1BGJA 4BJYA 3CPIG 4M52A 1IUTA 3QSSA 1K0IA 4YSYA 3PVCA 3AE5A 3K7QX 4AT2A 2WS3A 2YQUA 1NAAA 2BK4A 4X9NA 2XFQA 3UTEA 5HHFA 4A79A 2A87A 3PO7A 3NTDA 1S3BA 4B63A 2XLTA 4WCTA 1NDAA 4GCMA 1K4QA 2V5ZA 4H2PA 1PXCA 3SGLA 2C3CA 2C3DA 1P2EA 3FMWA 4CNJA 3ICSA 5U25A 2EQ6A 3F8RA 1F8SA 4U2TA 1XPQA 3EAOA 2E5VA 5DBJA 2APGA 3ATQA 4EQRA 2JB2A 2OLNA 4TM0A 3HZLA 4U8JA 4EIQA 4OVIA 2ZZBA 4H4QA 1JNZA 3AD8B 1ZMCA 5JCMA 2Y6QA 5J60A 2BCPA 3P4SA 2XVJA 2I0ZA 2WDVA 3JSKA 1K0LA 2BK5A 4B1BA 5KXJA 4H2RA 2UZZA 2V3AA 5KVIA 1EL9A 3QSMA 4B69A 4NEVA 1CC2A 3NLCA 4JY2A 4CY8A 1FL2A 1GPEA 3M12A 2F5ZA 4U8KA 1XDIA 2GR0A 1LQUA 4DSGA 2EQ7A 4N9XA 1NG3A 2XFPA 1JEHA 1L9CA 1D5TA 1CHUA 1D4CA 2RGOA 3S5WA 4YXDA 5U1OA 3DK4A 1GESA 4FK1A 1IUVA 1IUUA 1OJAA 3H4KA 2WBAA 3CGCA 3Q9TA 2CDUA 1P2HA 4LA1A 1KNRA 1FECA 3BI2A 4CY6A 3NHOX 3IF9A 3AEAA 1GRTA 3NGCX 1NENA 4EQXA 3CIRA 4JNAA 4J31A 4NTDA 1E39A 4Z24A 3CNTA 4JQ9A 2YLSA 3KD9A 4GUVA 1PDHA 3NIXA 4ADWA 4YWOA 3LJPA 5U63A 1UKVG 4H4WA 3NKSA 1M64A 1IJHA 1NHPA 4K5RA 2XVEA 2NPXA 4PABA 2OAMA 2XVFA 4HA6A 2VVMA 3CGDA 3URHA 3P1WA 3QVRA 3AYLA 2C75A 2R45A 2XVIA 3M13A 3ABVA 1B37A 2C7GA 4YKFA 5IPYA 2FJAA 4BK3A 1H82A 3UKFA 5BRTA 1PXAA 3DH9A 1PHHA 1MXTA 2B9YA 3UOZA 4UP3A 4GDPA 4ZCCA 2V6OA 4C3YA 4H50A 2HQMA 3ADAB 2YM1A 5KVHA 2YLWA 2Z5XA 4OPDA 2YM2A 2XLPA 2WHDA 1DJQA 1JRXA 1PBDA 4APNA 4EMJA 1TDFA 3NNEA 4FK1C 4FDCB 2YG4A 4USQA 2YR6A 1BKWA 4Z44A 3QFBA 4H4TA 1LJ1A 2OALA 3BI5A 4XWRA 4OPUA 2R9ZA 1DOCA 2VZ2A 2TPRA 2WPCA 1N1PA 1KSSA 2C76A 3L1RA 3NK1X 2GVCA 3CTYA 1TDKA 2C70A 2XLRA 5CQFA 3UKQA 1CBOA 3KVEA 4USRA 1YQZA 2WDQA 4NEWA 3G5QA 3M0OA 3VR8A 1Y0PA 4A99A 4B68A 1YQ4A 3KA7A 3CPJG 1FEAA 1Y56B 1NHSA 4UDRA 1LPFA 2JK6A 4CRTA 3NN6X 1DNCA 3SFDA 4H4ZA 1PBBA 1E1KA 1KSUA 3NN0X 3II4A 1N4VA 3F8DA 3V3OA 1DJNA 2OA1A 3P4RA 3NTAA 4UDPA 4J33A 2XLSA 2B9XA 2AAQA 1K0JA 1SEZA 3AEEA 2R0CA 2BS2A 1VDCA 3K7MX 5M0ZA 1GNDA 2C64A 3DJEA 4IV9A 2BCGG 3UCLA 4U8MA 4E0VA 3AE2A 2VQ7A 1VG0A 3UOYA 3ZYXA 4RG4A 4YSZA 2R46A 4K2XA 4YSXA 2V3BA 1L9EA 1H86A 1OJCA 2FJDA 2JAEA 1E1LA 1TDOA 3AYJA 1NPXA 3CNSA 3CGEA 4P9SA 4JNQA 3P9UA 2E4GA 3FIMB 2JB1A 4DNAA 2X8GA 2BXSA 2NVKX 2B9WA 2FJEA 2X8CA 3CN8A 2ZZ0A 1YKJA 3COXA 4C74A 1D7LA 1PXBA 2XLUA 4H7UA 2WOWA 3RP6A 1RP0A 3AWIA 1JOAA 1D4DA 1ZK7A 4EMWA 2YLRA 5M10A 3I6DA 3ZDNA 3B3RA 2BS3A 3AE1A 4BK2A 4B64A 4U8PA 1LQTA 2Z5YA 4NTCA 5FS6A 2EQ9A 4EQSA 3P4PA 1Q9IA 3LADA 2RGHA 4A6NB 5EB4A 5GSNA 4OCGA 4TM4A 4NTEA 2YAUA 4H4VA 4U8OA 4A5LA 4AP3A 5JCIA 1CJ3A 1D4EA 4MJWA 4TLXA 5JCNA 2WP5A 4H4RA 4IA5A 3UKPA 4OPIA 1GTHA 3BI4A 4CNKA 1ONFA 2ZZCA 1PS9A 4D03A 3NYEA 1VG9A 3OC4A 3RNMA 4CCRA 4EMIA 3RHAA 2J3NA 3DGZA 2B76A 2R0PA 1IUWA 1E6EA 4XWZA 1BWCA 1Q1WA 2ACZA 3UKKA 1JRYA 1TDEA 4REKA 3LZXA 4XXGA 3AEDA 4K7ZA 2W0HA 1CC4A 3I3LA 4Y4LA 4AOXA 4GR1A 3VRDB 1LV0A 4D04A 2JKCA 5EBKA 3EPTA 1OJTA 2QCUA 1Q1RA 4I58A 1PJ6A 3AE8A 2CFYA 1NEKA 3UP5A 3E1TA 3UTGA 4C5OA 4H4SA 4YKGA 4K5SA 4U2SA 3LB8A 4YTMA 1PBFA 2YLZA 3QSEA 3SFEA 1YY5A 3DK9A 3AE7A 1MO9A 3GRSA 1S2YA 2VOUA 5KWFA 1CJ4A 2AR8A 1BGNA 5LV9A 2XDOA 2WPEA 2YVGA 3ITJA 2CULA 2XVHA 3KPFA 1H6VA 4NZHA 3R9UA 1GEUA 1DOEA 1YQ3A 3DGHA 2B7RA 2PYXA 3FBSA 4GF7A 2X50A 1OJ9A 3BNUA 2VVLG 3AE3A 4WX1A 1REOA 1AOGA 1H7XA 1B4VA 2BA9A 4A65A 2XCGA 5BUKA 4ICYA 1GV4A 2XYOA 3EANA 3BNMA 1KNPA 3C4NA 2OLOA 4C77A 1PBEA 4BK1A 2YR4A 3NYFA 1GRGA 1LTXR 2V60A 2YLXA 1H81A 2GMJA 2Q0KA 4TLZA 2GR2A 2GQFA 3D8XA 1GOSA 4OPTA 4U8NA 4U8IA 2H88A 3S61A 2WU5A 3AEFA 2PHHA 3UOXA 2FJBA 2IVEA 3UP4A 2GQWA 1PBCA 3WE0A 2YG3A 2GAGB 1S3EA 4YT0A 3OZ2A 5FS9A 5HYMA 1BZLA 1VRQB 2VQBA 3KU9A 1NHRA 2QAEA 4C3XA 4O5QA 2GMHA 3EF6A 3GYJA 4X4JA 3CGBA 3UTFA 4AP1A 2BK3A 1CJCA 2GB0A 3GMBA 4IA6A 2WQYA 4H4PA 1QJDA 4LU6A 5BULA 4JDRA 1D7YA 4OPGA 5BVAA 1ZOVA 4J36A 2V61A 3NK2X 4H2QA 3RP8A 2BC1A 1IUXA 1JNRA 4A9WA 4ECHA 3O0HA 3NH3X 1F8RA 3V76A 2GRTA 5HXIA 4HB9A 5EB5A 3KLJA 5CKUA 5KOWA 3F8PA 2VRMA 1QO8A 4IVMB 4ZCDA 4I59A 3UKHA 1N4UA 2GEWA 3DA1A 3DJJA 1TYPA 1CF3A 2GF3A 3IC9A 3IWAA 3CPHG 1HYUA 4J34A 1F3PA 2BABA 2Q6UA 4YTPA 2C72A 1MOKA 1JU2A 3PS9A 2GR3A 1JRZA 3GD3A 1FOHA 1GXFA 2BXRA 5ER0A 2XFNA 3GSIA 3AXBA 4K8DA 3NT6A 1XANA 3D1CA 2WETA 2X8HA 1KFYA 1ELIA 1GT8A 4RSLA 1GRBA 3NG7X 3CNPA 2RABA 5FS7A 2C67A 4AT0A 5KOXA 1EL7A 4J57A 2A89A 3VQRA 1H84A 3H8LA 4GRTA 2YR5A 3LZWA 1GALA 3ISHA 1GSNA 1E1MA 2YVJA 2WDRA 3ALJA 3ICTA 1O5WA 2Q0LA 1DODA 3GWFA 1ZOYA 1TYTA 3GYIA 1KF6A 3LOVA 4JN9A 2Q7VA 4B66A 4YSHA 1H83A 1EL5A 3C4AA 3BHKA 1IUSA 4YTNA 1GREA 1B8SA 4U2LA 4B65A 1M6IA 3QFAA 4Y4NA 5FS8A 3GWDA 3RP7A 3VRAA 1DXLA 1RSGA 3AECA 2EQ8A 1CL0A 1FCDA 3QJ4A 3GRTA 2FBWA 3T37A 1OJDA 3NRNA 1NG4A 1RYIA 4JY3A 2O9ZA 3AD7B 3CNJA 3VRBA 1NHQA 2VVLA 4Y4MA 3UOVA 2QA1A 2QA2A 2CVJA 1S2QA 1O95A 3GMCA 2E1MA 2XFUA 1F6MA 4UDQA 3DJGX 4OPLA 3UTHA 2YVFA 4OPCA 3K7TA 1GRHA 4CCQA 2R4JA 3REDA 4Z2UA 4IVOB 1V59A 2C65A 1TRBA 2X99A 2WEUA 3G5SA 3NYCA 3GD4A 2C73A 2TMDA 3C96A 2YG6A 1L0VA 1L9DA 2Y6RA 5TR3A 3GDNA 5IQ1A 5JCLA 1PJ7A 2IVDA 1ZKQA 2WOVA 1BF3A 3LXDA 4RG3A 5L46A 2X3NA 3IHGA 1E1NA 1TDNA 4Z2TA 3ALLA 2GV8A 3UKAA 2WOIA 2XFOA 1XHCA 3NK0X 3AD9B 3IHMA 4EQWA 3ICRA 4B67A 2YG5A 4AOSA
chains in the Genus database with same CATH superfamily
1KN0A 4LIIA 1FEBA 2R0GA 2GGGA 1E7PA 3AE4A 1GTEA 5JRBA 3SM8A 2BRYA 1CC6A 4HNLA 1O94A 4FX9A 1ZP0A 3QVPA 3PWGA 3K30A 3GDPA 3EUB3 3AYIA 3A7RA 4ZN0A 5GRTA 4PAAA 3R0KA 4X9MA 2BYBA 5EOWA 1SJBA 3T8QA 1GERA 2PMQA 2WP6A 3SR6B 4K22A 2ZBWA 3ETRB 3S5SA 4BV6A 1LVLA 4ZOHB 5JCKA 3FPZA 3CNDA 3Q6JA 4A6NA 5IQ4A 4IT1A 1H7WA 3BOXA 4KEMA 3HYWA 3AEGA 4H2NA 1BGJA 4BJYA 3CPIG 4AT2A 1FHUA 5HHFA 4DYEA 2A87A 3NTDA 3I6TA 4IL2A 2C3DA 4CNJA 3FMWA 5U25A 1F8SA 3HYXA 4GFIA 4U2TA 1XPQA 3QKEA 3THUA 1V97A 3T0KA 5JCMA 2BCPA 3P4SA 3P93A 2WDVA 3JSKA 1JPMA 4H2RA 1S7MA 2V3AA 3QSMA 4CY8A 3M12A 2XH7A 4N9XA 1R0MA 1JEHA 4YXDA 1D5TA 2QJNA 1FO4A 1KNRA 4CY6A 3AEAA 4J31A 4NTDA 3CNTA 1JROA 5U63A 4JHMA 1UKVG 1M64A 1IJHA 2XVEA 4HA6A 3CGDA 3URHA 3P1WA 3OZMA 4YKFA 2O56A 1PXAA 1MXTA 3UOZA 3ADAB 5KVHA 2Z5XA 3RCYA 3RRAA 1JRXA 2YG4A 4USQA 1BKWA 4M0XA 1LJ1A 4H4TA 1DOCA 2QDEA 3L1RA 3RITA 3PG6A 1KD0A 4GISA 3M0OA 2W3RA 3KA7A 2PPGA 1LPFA 3V5FA 2OA1A 2FKPA 4IP5A 1SEZA 3AEEA 5FJTA 2R0CA 2BS2A 4X2PA 5M0ZA 1GNDA 2C64A 3UCLA 5G5GB 4U8MA 4E0VA 3AE2A 1VG0A 3ZYXA 4RG4A 4FI4A 1E1LA 1TDOA 3CGEA 3P9UA 2PODA 2QDDA 2GGJA 2ZZ0A 3COXA 1D7LA 2WOWA 1JOAA 4M6UA 4IZGA 2YLRA 3B3RA 3SN4A 4BK2A 2Z5YA 4EQSA 3LADA 2RGHA 1L8PA 3A7UA 4OCGA 4TM4A 2PSNA 2YAUA 3ES8A 4U8OA 1CJ3A 4TLXA 4MJWA 3UKPA 3CYJA 3I4KA 3QLDA 3BI4A 1ONFA 1PS9A 3NYEA 4CCRA 3DGZA 1FIQB 4XXGA 3AEDA 4MGGA 3QPEA 1CC4A 4KT2A 1P48A 4Y4LA 3VRDB 5EBKA 1OJTA 3OTRA 3UP5A 3GD6A 4YKGA 4K5SA 3EEZA 3DK9A 3GRSA 5KWFA 1BGNA 3STPA 3KPFA 1OEPA 3R9UA 2X50A 1SJCA 1SJAA 4Z1YA 4DN1A 4H1ZA 4ICYA 1GV4A 4MKSA 2XYOA 3EANA 3PK7A 3IJQA 3BNMA 2OLOA 4C77A 2V60A 1MDLA 3NZGA 2Q0KA 4Z17A 4OPTA 3D8XA 4U8NA 4NNJA 2WU5A 2PP3A 1PBCA 3WE0A 1S3EA 4IL0A 5HYMA 1VRQB 4X4JA 2GB0A 2BK3A 1FFVC 4IA6A 3FV9A 4H4PA 2WQYA 4OPGA 3NK2X 1KKRA 5HXIA 2VRMA 4IVMB 4I59A 3UKHA 3IWAA 3JW7A 1HYUA 2BABA 2Q6UA 2C72A 3QTPA 4IP4A 1JRZA 2BXRA 3NT6A 3H12A 1GT8A 3DG7A 2A89A 4GRTA 1GALA 2W54A 2YVJA 1X2HA 3N6HA 3LOVA 4JN9A 2Q7VA 5J04A 1H83A 1NELA 4GYPC 4YTNA 1B8SA 4B65A 1M6IA 4Y4NA 5FS8A 3GWDA 2XH4A 2POZA 1DXLA 2OPJA 3NRNA 1NG4A 3RR1A 2O9ZA 4ZA0A 3AN1A 3CNJA 2CVJA 1O95A 4OPLA 4OPCA 3K7TA 1GRHA 4CCQA 1VDVA 3REDA 4IVOB 1V59A 1TRBA 2XSXA 2WEUA 3NYCA 3GD4A 2YG6A 1L9DA 2Y6RA 5TR3A 5IQ1A 1WYGA 4ROPA 5L46A 1E1NA 1TDNA 3ALLA 3SBFA 1XHCA 3P3BA 4B67A 3U4FA 3OW1A 1ZDLA 3SN0A 1GRFA 4GDEA 2BC0A 2IIDA 4A7AA 1ZX9A 2YLTA 2RGJA 1XS2A 2WU2A 1JPDX 3SY4A 3V4BA 1FFUC 3GY1A 2C66A 4Z43A 1PJ5A 3B6DA 4Z25A 3FYYA 3B97A 2E5AA 3CXBA 2YG7A 1N4WA 3UJRA 4GYPA 4H4XA 1KDGA 2AQJA 4J1OA 2WPFA 3SQSA 2JBVA 4BURA 3KKJA 1EC9A 3ZVHB 1ZMDA 2BS4A 2QJMA 3BHFA 3DMEA 2WESA 1GRAA 1TZZA 3PFRA 3AB1A 3VA8A 4E4UA 4M52A 1IUTA 1TKKA 3AE5A 2YQUA 2BK4A 3UTEA 4A79A 3T9PA 1R6WA 1NDAA 1K4QA 3NVVB 2V5ZA 3N4EA 2C3CA 3MKCA 3F8RA 2NQLA 1YEYA 4K1WA 2APGA 4EQRA 2AKZA 2OLNA 4TM0A 3HZLA 4GGHA 1PDYA 2OO6A 2ZZBA 4H4QA 2Y6QA 4B1BA 2GDQA 1K0LA 1EL9A 1CC2A 2PTYA 1XDIA 2GR0A 1LQUA 2EQ7A 1NG3A 2XFPA 1L9CA 3DERA 3TWAA 3Q9TA 3IF9A 1GRTA 3DIPA 2PP1A 3DDMA 4GUVA 3FVDA 4ADWA 3LJPA 2NPXA 2XVFA 3QVRA 2C75A 3M13A 4BK3A 1IYXA 4UP3A 4ZCCA 2V6OA 2C4CA 4OPDA 3T31A 3CK5A 2XLPA 2P8BA 2PU0A 3N4FA 2WHDA 3TWBA 4EMJA 4FDCB 3ZVHA 3ENLA 3BI5A 4XWRA 4OPUA 2R9ZA 2VZ2A 1KSSA 3NK1X 3CTYA 2XLRA 1CBOA 3VR8A 1Y0PA 4A99A 4B68A 3CPJG 1Y56B 4UDRA 3SZWA 3N6JA 4H4ZA 2P8CA 1DJNA 2OZ3A 2B9XA 1WUEA 3K7MX 3UXLA 3DJEA 4IV9A 2BCGG 2R46A 1OJCA 3H8AA 3U9IA 2JB1A 4DNAA 5EU9A 3SZCA 2NVKX 1STZA 3UJ2A 2FJEA 3DEQA 2XLUA 1P43A 4H7UA 2P88A 3RP6A 3AWIA 4ZCWA 1D4DA 1ZK7A 4EMWA 3I6DA 2BS3A 4NTCA 5GSNA 5JCIA 4OPIA 1GTHA 4CNKA 2ZZCA 3R25A 3D9XA 4HN8A 2B76A 2PTWA 2ACZA 1JRYA 3LZXA 4K7ZA 4AOXA 4H83A 3OPSA 4D04A 2JKCA 4I58A 3A7AA 3V3WA 3AE8A 1NEKA 3E1TA 4H4SA 4U2SA 3LB8A 2YLZA 1ELSA 2VOUA 1MUCA 2AR8A 1E9IA 2CULA 1H6VA 4NZHA 3DGHA 1OJ9A 4HNCA 3AE3A 1AOGA 3TQPA 2XCGA 1KNPA 4H19A 3DG6A 4GAVA 1DTNA 2XH0A 2GR2A 4U8IA 4YWSA 3S61A 1EBHA 3UOXA 4ENLA 2FJBA 1PDZA 5KMRA 4K2SA 5FS9A 1BZLA 3DGBA 4C3XA 3CMMA 3UTFA 3AM9A 3VCCA 4LU6A 2CHRA 5BULA 1D7YA 3GO2A 3H70A 4H2QA 4DHGA 1JNRA 1F8RA 3KPKA 5CKUA 5KOWA 1QO8A 1N4UA 2GEWA 2GF3A 3IC9A 4YTPA 1MOKA 1JU2A 2GR3A 1FOHA 1JDFA 1XANA 2X8HA 1KFYA 3RO6A 5FS7A 3QN3A 2AL2B 4AT0A 1EL7A 4J57A 3VQRA 3T14A 3LZWA 1E1MA 3ALJA 2WDRA 3ICTA 3GWFA 1ZOYA 7ENLA 1RM6B 4YSHA 1EL5A 1IUSA 4U2LA 5ENLA 4G74A 2EQ8A 3QJ4A 1FCDA 1RYIA 2GGEA 2QA1A 2XFUA 3UXKA 4UDQA 2P0IA 3UTHA 2R4JA 4Z2UA 2X99A 1L0VA 2IVDA 1ZKQA 4RG3A 1XPYA 2GGIA 3UKAA 2OQYA 3TJIA 2XFOA 3NK0X 3AD9B 3IHMA 3DFYA 3T2KA 3ALMA 5C3JA 1N63C 2VRLA 3ZVIA 3OZYA 5J7XA 4E5TA 4G6HA 3L8KA 3H8IA 5C2TA 2PGEA 4H4YA 4E4FA 4GGBA 2ARDA 4H4UA 3P4QA 4BJZA 4J56A 1EBDA 2GH5A 1COYA 2B7SA 2GR1A 2PGWA 2GAHB 3G5RA 1CJ2A 1Z6LA 4HCHA 1EL8A 4EIPA 1DOBA 2MNRA 3AEBA 3FG2P 4O5UA 4TM1A 2HXUA 3K1GA 1VQWA 3AE9A 1F9CA 1QLBA 4YSYA 1K0IA 3PVCA 3K7QX 3SN1A 2WS3A 2XH2A 2XFQA 4WCTA 3Q45A 2BRAA 4H2PA 1PXCA 1P2EA 3ICSA 5FJOA 3EAOA 2E5VA 2JB2A 3D46A 4U8JA 3ZLFA 2XVJA 2I0ZA 5KXJA 3NVZB 5KVIA 4B69A 4NEVA 3T6CA 4DSGA 1NU5A 3NVYB 3MQTA 2RGOA 3S5WA 1CHUA 1D4CA 3DK4A 4FK1A 1EBGA 1IUVA 1IUUA 1OJAA 2WBAA 3CGCA 1P2HA 3MSYA 4KWSA 3BI2A 2ZC8A 3NGCX 1NENA 4EQXA 3CIRA 4JNAA 1MNSA 4JQ9A 3KD9A 1PDHA 2OVLA 3FJ4A 2QVHA 2VVMA 4F4RA 3ABVA 1B37A 2C7GA 5IPYA 4DWDA 2FJAA 4G8TA 5BRTA 3DH9A 1PHHA 4H50A 2YLWA 3GC2A 4HCLA 2YM2A 3IK4A 1DJQA 1PBDA 1TDFA 4APNA 3NNEA 2PTXA 1ZXIC 4Z44A 2OALA 2QQ6A 2TPRA 1N1PA 1EC8A 2C76A 2C70A 5CQFA 1YQZA 4NEWA 1FEAA 1NHSA 3I6EA 2JK6A 4CRTA 3NN6X 1DNCA 3SFDA 1E1KA 1KSUA 3NO1A 3NN0X 3II4A 1N4VA 3F8DA 4II3A 1X2GA 3S47A 3NTAA 4UDPA 2OKTA 2MUCA 3UOYA 4YSZA 4YSXA 2V3BA 2FJDA 2JAEA 1NPXA 4P9SA 4JN7A 2E4GA 3FIMB 2X8GA 2BXSA 2B9WA 4C74A 1YKJA 1RP0A 3VCNA 4U8PA 5FS6A 3P4PA 3FCPA 4A6NB 3HW2A 4NTEA 4A5LA 5JCNA 4H4RA 1VG9A 3RHAA 2PA6A 2R0PA 4G9KA 1E6EA 1BWCA 1Q1WA 3R1ZA 2W0HA 3I3LA 3SZFA 4GR1A 1LV0A 4J3ZA 4DX3A 2QCUA 2PS2A 3L5OA 4IHCA 1PBFA 3ES7A 2PTZA 3UJFA 3AE7A 1MO9A 1S2YA 5LV9A 2XDOA 2WPEA 3V5CA 2YVGA 1GEUA 4GF7A 2B7RA 3FBSA 1REOA 1H7XA 5FJUA 3TOYA 1B4VA 4A65A 3C4NA 1PBEA 2YR4A 1GRGA 1H81A 2GMJA 4TLZA 3AMZA 2H88A 3AEFA 3HRDC 2IVEA 4JN8A 2YG3A 4YT0A 1TE6A 3KU9A 1NHRA 2QAEA 2GMHA 3GYJA 1CJCA 1QJDA 5BVAA 1ZOVA 1H2IA 2V61A 2BC1A 1IUXA 3V76A 4A35A 4HB9A 3BSMA 4G6GA 3DA1A 3DJJA 1CF3A 3R11A 4J34A 3PS9A 1GXFA 2XFNA 5ER0A 3GSIA 3CXOA 3SJNA 3MWCA 3AXBA 4K8DA 2WETA 5FJPA 3CNPA 2RABA 2C67A 3T4WA 3TW9A 3H8LA 3ISHA 5G5HB 1DODA 6ENLA 1TYTA 4B66A 1EC7A 3TTEA 3NS1B 1GREA 3QFAA 3VRAA 5BOEA 3NXLA 3GRTA 2FBWA 3T37A 3SZ0A 2OZ8A 3B9JB 1NHQA 4Y4MA 2QA2A 3MUCA 3SX6A 1MRAA 2E1MA 1F6MA 3IJLA 2YVFA 1KKOA 4E8GA 2TMDA 3GDNA 5JCLA 2WOVA 1SJDA 2AL1A 2X3NA 3IHGA 2WOIA 3MY9A 3ICRA 2YG5A 2GSHA 4AOSA 1FHVA 1GETA 1W4XA 1Y56A 5HY5A 2DKIA 1B5QA 1VQZA 4Z2RA 3VR9A 2GL5A 3ZLHA 2W55A 5KRQA 1ZY8A 4J2WA 1X31B 3SXIA 3SQPA 4Z26A 3DG3A 3AE6A 2RDXA 3NFUA 3D47A 3UKLA 4EM3A 2JB3A 4TM3A 3CB3A 3DK8A 2BACA 5FMHA 4DGKA 3ATRA 3JZUA 2WP9A 2A8XA 5FJRA 5KMPA 4EM4A 4KPRA 4U8LA 3RGTA 4DSHA 2R4EA 5KMSA 3TCSA 2DKHA 3V3NA 4KX6A 4CBQA 2OX4A 1F8WA 3CT2A 2P3ZA 1PN0A 2YWLA 3DJDA 2H89A 4K8GA 3R0UA 3QSSA 5KMQA 3DESA 1NAAA 4X9NA 3PO7A 1S3BA 4B63A 2XLTA 4GCMA 3SGLA 2EQ6A 5DBJA 4MMWA 1KCZA 3ATQA 3PWIA 3HPFA 4EIQA 4OVIA 1JNZA 3AD8B 3EKGA 5BOFA 1ZMCA 3NRZB 5J60A 2BK5A 2UZZA 1ECQA 2I5QA 3NLCA 4JY2A 1FL2A 1GPEA 4U8KA 2F5ZA 2ZADA 1BKHA 2QGYA 5U1OA 1GESA 3NVWB 3H4KA 2CDUA 3DFHA 4LA1A 1FECA 2PU1A 3IJIA 3UGVA 3NHOX 3CAWA 1E39A 4Z24A 3OP2A 2YLSA 3NIXA 4A3RA 4YWOA 4H4WA 3NKSA 1NHPA 4K5RA 4PABA 1N61C 3T2ZA 2OAMA 3AYLA 2R45A 2XVIA 3H7VA 1RVKA 1H82A 3UKFA 4NWZA 4FP1A 2B9YA 4G7FA 4GDPA 4C3YA 2HQMA 2YM1A 2HNEA 4G73A 2OZTA 3VDGA 4FK1C 2YR6A 2HXTA 3QFBA 2WPCA 2OQHA 1JCTA 3UKQA 2GVCA 1TDKA 4USRA 3KVEA 2WDQA 3G5QA 2PP0A 1YQ4A 2AL2A 4HPNA 1PBBA 3V3OA 3P4RA 4J33A 2XLSA 2AAQA 1K0JA 2HZGA 4GMEA 1VDCA 2VQ7A 4K2XA 1L9EA 1H86A 1N60C 3AYJA 3CNSA 4JNQA 2OFJA 3ZLGA 2ONEA 2X8CA 3CN8A 5KNLA 2XGZA 1PXBA 4EWJA 3T2YA 5M10A 4GIRA 3ZDNA 3AE1A 4B64A 1ONEA 1LQTA 2EQ9A 1Q9IA 5EB4A 4A6GA 4H4VA 4AP3A 1D4EA 4IA5A 2WP5A 1W6TA 2OG9A 4II2A 4D03A 3OC4A 3RNMA 4EMIA 2J3NA 2PCEA 2OLAA 1IUWA 4XWZA 3UKKA 1TDEA 4REKA 3MZNA 3EPTA 1Q1RA 1PJ6A 2CFYA 1T3QC 3UTGA 4C5OA 3VFCA 4YTMA 4HCDA 2QJJA 3QSEA 3SFEA 1YY5A 3FXGA 5IDZA 1CJ4A 3ITJA 2XVHA 4GAPA 2PYXA 3UCDA 1DOEA 1YQ3A 2GGHA 3BNUA 2VVLG 4WX1A 2BA9A 5BUKA 2DW7A 3TJ4A 4BK1A 3NYFA 1LTXR 2YLXA 4H2HA 2GQFA 2FYMA 1GOSA 3R07C 4KPLA 2PHHA 3R10A 3UP4A 2GQWA 2GAGB 3OZ2A 2VQBA 1N62C 4O5QA 3EF6A 3CGBA 3JVAA 4AP1A 3GMBA 3KUMA 4JDRA 2AKMA 4J36A 3RP8A 4A9WA 4ECHA 3O0HA 3NH3X 2GRTA 3SSZA 4E6MA 5EB5A 3KLJA 3F8PA 4ZCDA 2E3TA 1TYPA 3UCCA 3CPHG 1F3PA 3GD3A 4TVWA 1BQGA 3D1CA 3Q4DA 1ELIA 4RSLA 1GRBA 3NG7X 5KOXA 1WUFA 1H84A 2YR5A 1GSNA 3SYIA 4TVYA 1O5WA 2Q0LA 3BJSA 1N5XA 3GYIA 1KF6A 2W3SA 3C4AA 3BHKA 3HYVA 4HYRA 1N5WC 3RP7A 1RSGA 3AECA 1CL0A 3VC5A 1OJDA 4JY3A 3AD7B 3GYXA 3VRBA 2VVLA 3UOVA 1MDRA 1S2QA 3GMCA 2DW6A 3P0WA 3DJGX 3UJSA 2C65A 3G5SA 2C73A 3C96A 1PJ7A 1BF3A 3LXDA 4DXKA 4Z2TA 2GV8A 1SB3B 1JRPA 3VC6A 4EQWA 3UJEA
chains in the Genus database with same CATH topology
1KN0A 1ZDLA 3T2KA 4LIIA 1GETA 1FEBA 1GRFA 2R0GA 1W4XA 3ALMA 4GDEA 2BC0A 2IIDA 5C3JA 1E7PA 1Y56A 5HY5A 4A7AA 2DKIA 2VRLA 1B5QA 3AE4A 1ZX9A 1GTEA 2YLTA 4Z2RA 3VR9A 5JRBA 2RGJA 3SM8A 5J7XA 2BRYA 2WU2A 1CC6A 3SY4A 5KRQA 1O94A 4G6HA 1ZY8A 3L8KA 4J2WA 3H8IA 4FX9A 5C2TA 1X31B 1ZP0A 3SXIA 3QVPA 2C66A 4Z43A 3SQPA 4Z26A 1PJ5A 4H4YA 3B6DA 3K30A 3GDPA 3AE6A 4Z25A 3AYIA 2ARDA 4H4UA 3P4QA 5GRTA 4PAAA 2YG7A 4BJZA 4ZN0A 1N4WA 4J56A 3UKLA 4EM3A 2JB3A 4X9MA 2BYBA 5EOWA 1EBDA 2GH5A 4H4XA 1COYA 1KDGA 4TM3A 2AQJA 2B7SA 2GR1A 1GERA 3DK8A 2BACA 2GAHB 5FMHA 3G5RA 2WPFA 1CJ2A 2WP6A 4DGKA 1Z6LA 2JBVA 4K22A 3ATRA 4BURA 3KKJA 2WP9A 2ZBWA 1EL8A 1ZMDA 2BS4A 2A8XA 4BV6A 3BHFA 5KMPA 4EIPA 1LVLA 3DMEA 2WESA 5JCKA 4EM4A 3FPZA 4KPRA 4U8LA 3CNDA 3Q6JA 1GRAA 3AB1A 1DOBA 4DSHA 4A6NA 5IQ4A 2R4EA 3AEBA 1H7WA 3FG2P 3HYWA 5KMSA 3AEGA 2DKHA 4O5UA 3V3NA 4KX6A 4TM1A 4CBQA 1F8WA 1PN0A 2YWLA 1VQWA 3AE9A 3DJDA 4H2NA 1QLBA 2H89A 1BGJA 4BJYA 3CPIG 4M52A 1IUTA 3QSSA 1K0IA 5KMQA 3PVCA 3AE5A 3K7QX 4YSYA 4AT2A 2WS3A 2YQUA 1NAAA 2BK4A 4X9NA 2XFQA 3UTEA 5HHFA 4A79A 2A87A 3PO7A 3NTDA 1S3BA 4B63A 2XLTA 4WCTA 1NDAA 4GCMA 1K4QA 2V5ZA 2BRAA 4H2PA 1PXCA 3SGLA 2C3CA 2C3DA 1P2EA 3FMWA 4CNJA 3ICSA 5U25A 2EQ6A 3F8RA 1F8SA 3HYXA 4U2TA 1XPQA 3EAOA 2E5VA 5DBJA 2APGA 3ATQA 4EQRA 2JB2A 2OLNA 4TM0A 3T0KA 3HZLA 4U8JA 4EIQA 4OVIA 2ZZBA 4H4QA 1JNZA 3AD8B 1ZMCA 5JCMA 2Y6QA 5J60A 2BCPA 3P4SA 2XVJA 2I0ZA 2WDVA 3JSKA 1K0LA 2BK5A 4B1BA 5KXJA 4H2RA 2UZZA 1S7MA 2V3AA 5KVIA 1EL9A 3QSMA 4NEVA 4B69A 1CC2A 3NLCA 4JY2A 4CY8A 1FL2A 1GPEA 3M12A 2F5ZA 4U8KA 1XDIA 2GR0A 1LQUA 4DSGA 2EQ7A 4N9XA 1NG3A 2XFPA 1JEHA 1L9CA 1D5TA 1CHUA 1D4CA 2RGOA 3S5WA 4YXDA 5U1OA 3DK4A 1GESA 4FK1A 1IUVA 1IUUA 1OJAA 3H4KA 2WBAA 3CGCA 3Q9TA 2CDUA 1P2HA 4LA1A 1KNRA 1FECA 3BI2A 4CY6A 3NHOX 3IF9A 3AEAA 1GRTA 3NGCX 1NENA 4EQXA 3CIRA 4JNAA 4J31A 4NTDA 1E39A 4Z24A 3CNTA 4JQ9A 2YLSA 3KD9A 4GUVA 1PDHA 3NIXA 4ADWA 4YWOA 3LJPA 5U63A 1UKVG 4H4WA 3NKSA 1M64A 1IJHA 1NHPA 4K5RA 2XVEA 2NPXA 4PABA 3T2ZA 2OAMA 2XVFA 4HA6A 2VVMA 3CGDA 3URHA 3P1WA 3QVRA 3AYLA 2C75A 2R45A 2XVIA 3M13A 3ABVA 1B37A 2C7GA 4YKFA 5IPYA 2FJAA 4BK3A 1H82A 3UKFA 5BRTA 4NWZA 1PXAA 3DH9A 1PHHA 1MXTA 2B9YA 3UOZA 4UP3A 4GDPA 4ZCCA 2V6OA 4C3YA 4H50A 2HQMA 3ADAB 2YM1A 5KVHA 2C4CA 2YLWA 2Z5XA 4G73A 4OPDA 3T31A 2YM2A 2XLPA 2WHDA 1DJQA 1JRXA 1PBDA 4APNA 4EMJA 1TDFA 3NNEA 4FK1C 4FDCB 2YG4A 4USQA 2YR6A 1BKWA 4Z44A 3QFBA 4H4TA 1LJ1A 2OALA 3BI5A 4XWRA 4OPUA 2R9ZA 1DOCA 2VZ2A 2TPRA 2WPCA 1N1PA 1KSSA 2C76A 3L1RA 3NK1X 2GVCA 3CTYA 1TDKA 2C70A 2XLRA 5CQFA 3UKQA 1CBOA 3KVEA 4USRA 1YQZA 3PG6A 2WDQA 4NEWA 3G5QA 3M0OA 3VR8A 1Y0PA 4A99A 4B68A 1YQ4A 3KA7A 3CPJG 1FEAA 1Y56B 1NHSA 4UDRA 1LPFA 3SZWA 2JK6A 4CRTA 3NN6X 1DNCA 3SFDA 4H4ZA 1PBBA 1E1KA 1KSUA 3NN0X 3II4A 1N4VA 3F8DA 4II3A 3V3OA 1DJNA 2OA1A 3P4RA 3NTAA 4UDPA 4J33A 2XLSA 2B9XA 2AAQA 1K0JA 1SEZA 3AEEA 2R0CA 2BS2A 1VDCA 3K7MX 5M0ZA 1GNDA 2C64A 3DJEA 4IV9A 2BCGG 3UCLA 4U8MA 4E0VA 3AE2A 2VQ7A 1VG0A 3UOYA 3ZYXA 4RG4A 4YSZA 2R46A 4K2XA 4YSXA 2V3BA 1L9EA 1H86A 1OJCA 2FJDA 2JAEA 1E1LA 1TDOA 3AYJA 1NPXA 3CNSA 3CGEA 4P9SA 4JNQA 3P9UA 2E4GA 3FIMB 2JB1A 4DNAA 3SZCA 2X8GA 2BXSA 2NVKX 2B9WA 2FJEA 2X8CA 3CN8A 2ZZ0A 1YKJA 3COXA 4C74A 5KNLA 1D7LA 1PXBA 2XLUA 4H7UA 2WOWA 3RP6A 1RP0A 3AWIA 1JOAA 1D4DA 1ZK7A 3T2YA 4EMWA 2YLRA 5M10A 3I6DA 3ZDNA 3B3RA 2BS3A 3AE1A 4BK2A 4B64A 4U8PA 1LQTA 2Z5YA 4NTCA 5FS6A 2EQ9A 4EQSA 3P4PA 1Q9IA 3LADA 2RGHA 4A6NB 5EB4A 5GSNA 4OCGA 4TM4A 4NTEA 2YAUA 4H4VA 4U8OA 4A5LA 4AP3A 5JCIA 1CJ3A 1D4EA 4MJWA 4TLXA 5JCNA 2WP5A 4H4RA 4IA5A 3UKPA 4II2A 4OPIA 1GTHA 3BI4A 4CNKA 1ONFA 2ZZCA 1PS9A 4D03A 3NYEA 1VG9A 3OC4A 3RNMA 4CCRA 3D9XA 4EMIA 3RHAA 2J3NA 3DGZA 2B76A 2R0PA 4G9KA 1IUWA 1E6EA 4XWZA 1BWCA 1Q1WA 2ACZA 3UKKA 1JRYA 1TDEA 4REKA 3LZXA 4XXGA 3AEDA 4K7ZA 2W0HA 1CC4A 3I3LA 3SZFA 4Y4LA 4AOXA 4GR1A 3VRDB 1LV0A 4D04A 2JKCA 5EBKA 3EPTA 1OJTA 2QCUA 1Q1RA 4I58A 3L5OA 1PJ6A 3AE8A 2CFYA 1NEKA 3UP5A 3E1TA 3UTGA 4C5OA 4H4SA 4YKGA 4K5SA 4U2SA 3LB8A 4YTMA 1PBFA 2YLZA 3QSEA 3SFEA 1YY5A 3DK9A 3AE7A 1MO9A 3GRSA 1S2YA 2VOUA 5KWFA 1CJ4A 2AR8A 1BGNA 5LV9A 2XDOA 2WPEA 2YVGA 3ITJA 2CULA 2XVHA 4GAPA 3KPFA 1H6VA 4NZHA 3R9UA 1GEUA 1DOEA 1YQ3A 3DGHA 2B7RA 2PYXA 3FBSA 4GF7A 2X50A 1OJ9A 3BNUA 2VVLG 3AE3A 4WX1A 1REOA 1AOGA 1H7XA 1B4VA 2BA9A 4A65A 2XCGA 5BUKA 4ICYA 1GV4A 2XYOA 3EANA 3BNMA 1KNPA 3C4NA 2OLOA 4C77A 1PBEA 4GAVA 4BK1A 2YR4A 3NYFA 1GRGA 1LTXR 2V60A 2YLXA 1H81A 2GMJA 2Q0KA 4TLZA 2GR2A 2GQFA 3D8XA 1GOSA 4OPTA 4U8NA 4U8IA 2H88A 3S61A 4NNJA 2WU5A 3AEFA 2PHHA 3UOXA 2FJBA 2IVEA 3UP4A 2GQWA 1PBCA 3WE0A 2YG3A 2GAGB 1S3EA 4YT0A 3OZ2A 5FS9A 5KMRA 5HYMA 1BZLA 1VRQB 2VQBA 3KU9A 1NHRA 2QAEA 4C3XA 4O5QA 3CMMA 2GMHA 3EF6A 3GYJA 4X4JA 3CGBA 3UTFA 4AP1A 2BK3A 1CJCA 2GB0A 3GMBA 4IA6A 2WQYA 4H4PA 1QJDA 4LU6A 5BULA 4JDRA 1D7YA 4OPGA 5BVAA 1ZOVA 1H2IA 2V61A 3NK2X 4H2QA 4J36A 3RP8A 2BC1A 1IUXA 1JNRA 4A9WA 4ECHA 3O0HA 3NH3X 1F8RA 3V76A 2GRTA 5HXIA 4HB9A 5EB5A 3KLJA 3KPKA 5CKUA 5KOWA 3F8PA 2VRMA 1QO8A 4IVMB 4ZCDA 4I59A 3UKHA 1N4UA 2GEWA 4G6GA 3DA1A 3DJJA 1TYPA 1CF3A 2GF3A 3IC9A 3IWAA 3CPHG 1HYUA 4J34A 1F3PA 2BABA 2Q6UA 4YTPA 2C72A 1MOKA 1JU2A 3PS9A 2GR3A 1JRZA 3GD3A 1FOHA 1GXFA 2BXRA 5ER0A 2XFNA 3GSIA 3AXBA 4K8DA 3NT6A 1XANA 3D1CA 2WETA 2X8HA 1KFYA 1ELIA 1GT8A 4RSLA 1GRBA 3NG7X 3CNPA 2RABA 5FS7A 2C67A 4AT0A 5KOXA 1EL7A 4J57A 2A89A 3VQRA 3T14A 1H84A 3H8LA 4GRTA 2YR5A 3LZWA 1GALA 3ISHA 1GSNA 1E1MA 2YVJA 2WDRA 3ALJA 3ICTA 3SYIA 1O5WA 2Q0LA 1DODA 3GWFA 1ZOYA 1TYTA 3GYIA 1KF6A 3LOVA 4JN9A 2Q7VA 4B66A 4YSHA 1H83A 1EL5A 3C4AA 3BHKA 1IUSA 3HYVA 4YTNA 1GREA 1B8SA 4U2LA 4B65A 1M6IA 3QFAA 4Y4NA 5FS8A 3GWDA 3RP7A 3VRAA 1DXLA 1RSGA 3AECA 2EQ8A 1CL0A 1FCDA 3QJ4A 4G74A 3GRTA 2FBWA 3T37A 1OJDA 3NRNA 1NG4A 1RYIA 3SZ0A 4JY3A 2O9ZA 3AD7B 3GYXA 3CNJA 3VRBA 1NHQA 2VVLA 4Y4MA 3UOVA 2QA1A 2QA2A 2CVJA 1S2QA 1O95A 3GMCA 2E1MA 3SX6A 2XFUA 1F6MA 4UDQA 3DJGX 4OPLA 3UTHA 2YVFA 4OPCA 3K7TA 1GRHA 4CCQA 2R4JA 3REDA 4Z2UA 4IVOB 1V59A 2C65A 1TRBA 2X99A 2WEUA 3G5SA 3NYCA 3GD4A 2C73A 2TMDA 3C96A 2YG6A 1L0VA 1L9DA 2Y6RA 5TR3A 3GDNA 5IQ1A 5JCLA 1PJ7A 2IVDA 1ZKQA 2WOVA 1BF3A 3LXDA 4RG3A 5L46A 2X3NA 3IHGA 1E1NA 1TDNA 4Z2TA 3ALLA 2GV8A 3UKAA 2WOIA 2XFOA 1XHCA 3NK0X 3AD9B 3IHMA 4EQWA 3ICRA 4B67A 2YG5A 4AOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZDL A;  4LII A;  1GET A;  1FEB A;  1GRF A;  2R0G A;  1W4X A;  3ALM A;  4GDE A;  2BC0 A;  2IID A;  5C3J A;  1E7P A;  1Y56 A;  5HY5 A;  4A7A A;  2DKI A;  2VRL A;  1B5Q A;  3AE4 A;  1ZX9 A;  1GTE A;  2YLT A;  4Z2R A;  3VR9 A;  2RGJ A;  3SM8 A;  5J7X A;  2WU2 A;  1CC6 A;  5KRQ A;  1O94 A;  1ZY8 A;  3L8K A;  4J2W A;  3H8I A;  4FX9 A;  5C2T A;  1X31 B;  1ZP0 A;  3QVP A;  2C66 A;  4Z43 A;  3SQP A;  4Z26 A;  1PJ5 A;  4H4Y A;  3B6D A;  3K30 A;  3GDP A;  3AE6 A;  4Z25 A;  3AYI A;  2ARD A;  4H4U A;  3P4Q A;  5GRT A;  4PAA A;  2YG7 A;  4BJZ A;  4ZN0 A;  1N4W A;  4J56 A;  3UKL A;  4EM3 A;  2JB3 A;  4X9M A;  2BYB A;  5EOW A;  1EBD A;  2GH5 A;  4H4X A;  1COY A;  1KDG A;  4TM3 A;  2AQJ A;  2B7S A;  2GR1 A;  1GER A;  3DK8 A;  2BAC A;  2GAH B;  5FMH A;  3G5R A;  2WPF A;  1CJ2 A;  2WP6 A;  4DGK A;  1Z6L A;  2JBV A;  4K22 A;  3ATR A;  4BUR A;  3KKJ A;  2WP9 A;  2ZBW A;  1EL8 A;  1ZMD A;  2BS4 A;  2A8X A;  4BV6 A;  3BHF A;  4EIP A;  1LVL A;  3DME A;  2WES A;  5JCK A;  4EM4 A;  3FPZ A;  4KPR A;  4U8L A;  3CND A;  3Q6J A;  1GRA A;  3AB1 A;  1DOB A;  4DSH A;  4A6N A;  5IQ4 A;  2R4E A;  3AEB A;  1H7W A;  3FG2 P;  3AEG A;  2DKH A;  4O5U A;  3V3N A;  4KX6 A;  4TM1 A;  4CBQ A;  1F8W A;  1PN0 A;  2YWL A;  1VQW A;  3AE9 A;  3DJD A;  4H2N A;  1QLB A;  2H89 A;  1BGJ A;  4BJY A;  3CPI G;  4M52 A;  1IUT A;  3QSS A;  1K0I A;  4YSY A;  3PVC A;  3AE5 A;  3K7Q X;  4AT2 A;  2WS3 A;  2YQU A;  1NAA A;  2BK4 A;  4X9N A;  2XFQ A;  3UTE A;  5HHF A;  4A79 A;  2A87 A;  3PO7 A;  3NTD A;  1S3B A;  4B63 A;  2XLT A;  4WCT A;  1NDA A;  4GCM A;  1K4Q A;  2V5Z A;  4H2P A;  1PXC A;  3SGL A;  2C3C A;  2C3D A;  1P2E A;  3FMW A;  4CNJ A;  3ICS A;  5U25 A;  2EQ6 A;  3F8R A;  1F8S A;  4U2T A;  1XPQ A;  3EAO A;  2E5V A;  5DBJ A;  2APG A;  3ATQ A;  4EQR A;  2JB2 A;  2OLN A;  4TM0 A;  3HZL A;  4U8J A;  4EIQ A;  4OVI A;  2ZZB A;  4H4Q A;  1JNZ A;  3AD8 B;  1ZMC A;  5JCM A;  2Y6Q A;  5J60 A;  2BCP A;  3P4S A;  2XVJ A;  2I0Z A;  2WDV A;  3JSK A;  1K0L A;  2BK5 A;  4B1B A;  5KXJ A;  4H2R A;  2UZZ A;  2V3A A;  5KVI A;  1EL9 A;  3QSM A;  4B69 A;  4NEV A;  1CC2 A;  3NLC A;  4JY2 A;  4CY8 A;  1FL2 A;  1GPE A;  3M12 A;  2F5Z A;  4U8K A;  1XDI A;  2GR0 A;  1LQU A;  4DSG A;  2EQ7 A;  4N9X A;  1NG3 A;  2XFP A;  1JEH A;  1L9C A;  1D5T A;  1CHU A;  1D4C A;  2RGO A;  3S5W A;  4YXD A;  5U1O A;  3DK4 A;  1GES A;  4FK1 A;  1IUV A;  1IUU A;  1OJA A;  3H4K A;  2WBA A;  3CGC A;  3Q9T A;  2CDU A;  1P2H A;  4LA1 A;  1KNR A;  1FEC A;  3BI2 A;  4CY6 A;  3NHO X;  3IF9 A;  3AEA A;  1GRT A;  3NGC X;  1NEN A;  4EQX A;  3CIR A;  4JNA A;  4J31 A;  4NTD A;  1E39 A;  4Z24 A;  3CNT A;  4JQ9 A;  2YLS A;  3KD9 A;  4GUV A;  1PDH A;  3NIX A;  4ADW A;  4YWO A;  3LJP A;  5U63 A;  1UKV G;  4H4W A;  3NKS A;  1M64 A;  1IJH A;  1NHP A;  4K5R A;  2XVE A;  2NPX A;  4PAB A;  2OAM A;  2XVF A;  4HA6 A;  2VVM A;  3CGD A;  3URH A;  3P1W A;  3QVR A;  3AYL A;  2C75 A;  2R45 A;  2XVI A;  3M13 A;  3ABV A;  1B37 A;  2C7G A;  4YKF A;  5IPY A;  2FJA A;  4BK3 A;  1H82 A;  3UKF A;  5BRT A;  1PXA A;  3DH9 A;  1PHH A;  1MXT A;  2B9Y A;  3UOZ A;  4UP3 A;  4GDP A;  4ZCC A;  2V6O A;  4C3Y A;  4H50 A;  2HQM A;  3ADA B;  2YM1 A;  5KVH A;  2YLW A;  2Z5X A;  4OPD A;  2YM2 A;  2XLP A;  2WHD A;  1DJQ A;  1JRX A;  1PBD A;  4APN A;  4EMJ A;  1TDF A;  3NNE A;  4FK1 C;  4FDC B;  2YG4 A;  4USQ A;  2YR6 A;  1BKW A;  4Z44 A;  3QFB A;  4H4T A;  1LJ1 A;  2OAL A;  3BI5 A;  4XWR A;  4OPU A;  2R9Z A;  1DOC A;  2VZ2 A;  2TPR A;  2WPC A;  1N1P A;  1KSS A;  2C76 A;  3L1R A;  3NK1 X;  2GVC A;  3CTY A;  1TDK A;  2C70 A;  2XLR A;  5CQF A;  3UKQ A;  1CBO A;  3KVE A;  4USR A;  1YQZ A;  2WDQ A;  4NEW A;  3G5Q A;  3M0O A;  3VR8 A;  1Y0P A;  4A99 A;  4B68 A;  1YQ4 A;  3KA7 A;  3CPJ G;  1FEA A;  1Y56 B;  1NHS A;  4UDR A;  1LPF A;  2JK6 A;  4CRT A;  3NN6 X;  1DNC A;  3SFD A;  4H4Z A;  1PBB A;  1E1K A;  1KSU A;  3NN0 X;  3II4 A;  1N4V A;  3F8D A;  3V3O A;  1DJN A;  2OA1 A;  3P4R A;  3NTA A;  4UDP A;  4J33 A;  2XLS A;  2B9X A;  2AAQ A;  1K0J A;  1SEZ A;  3AEE A;  2R0C A;  2BS2 A;  1VDC A;  3K7M X;  5M0Z A;  1GND A;  2C64 A;  3DJE A;  4IV9 A;  2BCG G;  3UCL A;  4U8M A;  4E0V A;  3AE2 A;  2VQ7 A;  1VG0 A;  3UOY A;  3ZYX A;  4RG4 A;  4YSZ A;  2R46 A;  4K2X A;  4YSX A;  2V3B A;  1L9E A;  1H86 A;  1OJC A;  2FJD A;  2JAE A;  1E1L A;  1TDO A;  3AYJ A;  1NPX A;  3CNS A;  3CGE A;  4P9S A;  4JNQ A;  3P9U A;  2E4G A;  3FIM B;  2JB1 A;  4DNA A;  2X8G A;  2BXS A;  2NVK X;  2B9W A;  2FJE A;  2X8C A;  3CN8 A;  2ZZ0 A;  1YKJ A;  3COX A;  4C74 A;  1D7L A;  1PXB A;  2XLU A;  4H7U A;  2WOW A;  3RP6 A;  1RP0 A;  3AWI A;  1JOA A;  1D4D A;  1ZK7 A;  4EMW A;  2YLR A;  5M10 A;  3I6D A;  3ZDN A;  3B3R A;  2BS3 A;  3AE1 A;  4BK2 A;  4B64 A;  4U8P A;  1LQT A;  2Z5Y A;  4NTC A;  5FS6 A;  2EQ9 A;  4EQS A;  3P4P A;  1Q9I A;  3LAD A;  2RGH A;  4A6N B;  5EB4 A;  5GSN A;  4OCG A;  4TM4 A;  4NTE A;  2YAU A;  4H4V A;  4U8O A;  4A5L A;  4AP3 A;  5JCI A;  1CJ3 A;  1D4E A;  4MJW A;  4TLX A;  5JCN A;  2WP5 A;  4H4R A;  4IA5 A;  3UKP A;  4OPI A;  1GTH A;  3BI4 A;  4CNK A;  1ONF A;  2ZZC A;  1PS9 A;  4D03 A;  3NYE A;  1VG9 A;  3OC4 A;  3RNM A;  4CCR A;  4EMI A;  3RHA A;  2J3N A;  3DGZ A;  2B76 A;  2R0P A;  1IUW A;  1E6E A;  4XWZ A;  1BWC A;  1Q1W A;  2ACZ A;  3UKK A;  1JRY A;  1TDE A;  4REK A;  3LZX A;  4XXG A;  3AED A;  4K7Z A;  2W0H A;  1CC4 A;  3I3L A;  4Y4L A;  4AOX A;  4GR1 A;  3VRD B;  1LV0 A;  4D04 A;  2JKC A;  5EBK A;  3EPT A;  1OJT A;  2QCU A;  1Q1R A;  4I58 A;  1PJ6 A;  3AE8 A;  2CFY A;  1NEK A;  3UP5 A;  3E1T A;  3UTG A;  4C5O A;  4H4S A;  4YKG A;  4K5S A;  4U2S A;  3LB8 A;  4YTM A;  1PBF A;  2YLZ A;  3QSE A;  3SFE A;  1YY5 A;  3DK9 A;  3AE7 A;  1MO9 A;  3GRS A;  1S2Y A;  2VOU A;  5KWF A;  1CJ4 A;  2AR8 A;  1BGN A;  5LV9 A;  2XDO A;  2WPE A;  2YVG A;  3ITJ A;  2CUL A;  2XVH A;  3KPF A;  1H6V A;  4NZH A;  3R9U A;  1GEU A;  1DOE A;  1YQ3 A;  3DGH A;  2B7R A;  2PYX A;  3FBS A;  4GF7 A;  2X50 A;  1OJ9 A;  3BNU A;  2VVL G;  3AE3 A;  4WX1 A;  1REO A;  1AOG A;  1H7X A;  1B4V A;  2BA9 A;  4A65 A;  2XCG A;  5BUK A;  4ICY A;  1GV4 A;  2XYO A;  3EAN A;  3BNM A;  1KNP A;  3C4N A;  2OLO A;  4C77 A;  1PBE A;  4BK1 A;  2YR4 A;  3NYF A;  1GRG A;  1LTX R;  2V60 A;  2YLX A;  1H81 A;  2GMJ A;  2Q0K A;  4TLZ A;  2GR2 A;  2GQF A;  3D8X A;  1GOS A;  4OPT A;  4U8N A;  4U8I A;  2H88 A;  3S61 A;  2WU5 A;  3AEF A;  2PHH A;  3UOX A;  2FJB A;  2IVE A;  3UP4 A;  2GQW A;  1PBC A;  3WE0 A;  2YG3 A;  2GAG B;  1S3E A;  4YT0 A;  3OZ2 A;  5FS9 A;  5HYM A;  1BZL A;  1VRQ B;  2VQB A;  3KU9 A;  1NHR A;  2QAE A;  4C3X A;  4O5Q A;  2GMH A;  3EF6 A;  3GYJ A;  4X4J A;  3CGB A;  3UTF A;  4AP1 A;  2BK3 A;  1CJC A;  2GB0 A;  3GMB A;  4IA6 A;  2WQY A;  4H4P A;  1QJD A;  4LU6 A;  5BUL A;  4JDR A;  1D7Y A;  4OPG A;  5BVA A;  1ZOV A;  4J36 A;  2V61 A;  3NK2 X;  4H2Q A;  3RP8 A;  2BC1 A;  1IUX A;  1JNR A;  4A9W A;  4ECH A;  3O0H A;  3NH3 X;  1F8R A;  3V76 A;  2GRT A;  5HXI A;  4HB9 A;  5EB5 A;  3KLJ A;  5CKU A;  5KOW A;  3F8P A;  2VRM A;  1QO8 A;  4IVM B;  4ZCD A;  4I59 A;  3UKH A;  1N4U A;  2GEW A;  3DA1 A;  3DJJ A;  1TYP A;  1CF3 A;  2GF3 A;  3IC9 A;  3IWA A;  3CPH G;  1HYU A;  4J34 A;  1F3P A;  2BAB A;  2Q6U A;  4YTP A;  2C72 A;  1MOK A;  1JU2 A;  3PS9 A;  2GR3 A;  1JRZ A;  3GD3 A;  1FOH A;  1GXF A;  2BXR A;  5ER0 A;  2XFN A;  3GSI A;  3AXB A;  4K8D A;  3NT6 A;  1XAN A;  3D1C A;  2WET A;  2X8H A;  1KFY A;  1ELI A;  1GT8 A;  4RSL A;  1GRB A;  3NG7 X;  3CNP A;  2RAB A;  5FS7 A;  2C67 A;  4AT0 A;  5KOX A;  1EL7 A;  4J57 A;  2A89 A;  3VQR A;  1H84 A;  3H8L A;  4GRT A;  2YR5 A;  3LZW A;  1GAL A;  3ISH A;  1GSN A;  1E1M A;  2YVJ A;  2WDR A;  3ALJ A;  3ICT A;  1O5W A;  2Q0L A;  1DOD A;  3GWF A;  1ZOY A;  1TYT A;  3GYI A;  1KF6 A;  3LOV A;  4JN9 A;  2Q7V A;  4B66 A;  4YSH A;  1H83 A;  1EL5 A;  3C4A A;  3BHK A;  1IUS A;  4YTN A;  1GRE A;  1B8S A;  4U2L A;  4B65 A;  1M6I A;  3QFA A;  4Y4N A;  5FS8 A;  3GWD A;  3RP7 A;  3VRA A;  1DXL A;  1RSG A;  3AEC A;  2EQ8 A;  1CL0 A;  1FCD A;  3QJ4 A;  3GRT A;  2FBW A;  3T37 A;  1OJD A;  3NRN A;  1NG4 A;  1RYI A;  4JY3 A;  2O9Z A;  3AD7 B;  3CNJ A;  3VRB A;  1NHQ A;  2VVL A;  4Y4M A;  3UOV A;  2QA1 A;  2QA2 A;  2CVJ A;  1S2Q A;  1O95 A;  3GMC A;  2E1M A;  2XFU A;  1F6M A;  4UDQ A;  3DJG X;  4OPL A;  3UTH A;  2YVF A;  4OPC A;  3K7T A;  1GRH A;  4CCQ A;  2R4J A;  3RED A;  4Z2U A;  4IVO B;  1V59 A;  2C65 A;  1TRB A;  2X99 A;  2WEU A;  3G5S A;  3NYC A;  3GD4 A;  2C73 A;  2TMD A;  3C96 A;  2YG6 A;  1L0V A;  1L9D A;  2Y6R A;  5TR3 A;  3GDN A;  5IQ1 A;  5JCL A;  1PJ7 A;  2IVD A;  1ZKQ A;  2WOV A;  1BF3 A;  3LXD A;  4RG3 A;  5L46 A;  2X3N A;  3IHG A;  1E1N A;  1TDN A;  4Z2T A;  3ALL A;  2GV8 A;  3UKA A;  2WOI A;  2XFO A;  1XHC A;  3NK0 X;  3AD9 B;  3IHM A;  4EQW A;  3ICR A;  4B67 A;  2YG5 A;  4AOS A; 
#chains in the Genus database with same CATH topology
 1KN0 A;  4LII A;  1FEB A;  2R0G A;  2GGG A;  1E7P A;  3AE4 A;  1GTE A;  5JRB A;  3SM8 A;  2BRY A;  1CC6 A;  4HNL A;  1O94 A;  4FX9 A;  1ZP0 A;  3QVP A;  3PWG A;  3K30 A;  3GDP A;  3EUB 3;  3AYI A;  3A7R A;  4ZN0 A;  5GRT A;  4PAA A;  3R0K A;  4X9M A;  2BYB A;  5EOW A;  1SJB A;  3T8Q A;  1GER A;  2PMQ A;  2WP6 A;  3SR6 B;  4K22 A;  2ZBW A;  3ETR B;  3S5S A;  4BV6 A;  1LVL A;  4ZOH B;  5JCK A;  3FPZ A;  3CND A;  3Q6J A;  4A6N A;  5IQ4 A;  4IT1 A;  1H7W A;  3BOX A;  4KEM A;  3HYW A;  3AEG A;  4H2N A;  1BGJ A;  4BJY A;  3CPI G;  4AT2 A;  1FHU A;  5HHF A;  4DYE A;  2A87 A;  3NTD A;  3I6T A;  4IL2 A;  2C3D A;  4CNJ A;  3FMW A;  5U25 A;  1F8S A;  3HYX A;  4GFI A;  4U2T A;  1XPQ A;  3QKE A;  3THU A;  1V97 A;  3T0K A;  5JCM A;  2BCP A;  3P4S A;  3P93 A;  2WDV A;  3JSK A;  1JPM A;  4H2R A;  1S7M A;  2V3A A;  3QSM A;  4CY8 A;  3M12 A;  2XH7 A;  4N9X A;  1R0M A;  1JEH A;  4YXD A;  1D5T A;  2QJN A;  1FO4 A;  1KNR A;  4CY6 A;  3AEA A;  4J31 A;  4NTD A;  3CNT A;  1JRO A;  5U63 A;  4JHM A;  1UKV G;  1M64 A;  1IJH A;  2XVE A;  4HA6 A;  3CGD A;  3URH A;  3P1W A;  3OZM A;  4YKF A;  2O56 A;  1PXA A;  1MXT A;  3UOZ A;  3ADA B;  5KVH A;  2Z5X A;  3RCY A;  3RRA A;  1JRX A;  2YG4 A;  4USQ A;  1BKW A;  4M0X A;  1LJ1 A;  4H4T A;  1DOC A;  2QDE A;  3L1R A;  3RIT A;  3PG6 A;  1KD0 A;  4GIS A;  3M0O A;  2W3R A;  3KA7 A;  2PPG A;  1LPF A;  3V5F A;  2OA1 A;  2FKP A;  4IP5 A;  1SEZ A;  3AEE A;  5FJT A;  2R0C A;  2BS2 A;  4X2P A;  5M0Z A;  1GND A;  2C64 A;  3UCL A;  5G5G B;  4U8M A;  4E0V A;  3AE2 A;  1VG0 A;  3ZYX A;  4RG4 A;  4FI4 A;  1E1L A;  1TDO A;  3CGE A;  3P9U A;  2POD A;  2QDD A;  2GGJ A;  2ZZ0 A;  3COX A;  1D7L A;  2WOW A;  1JOA A;  4M6U A;  4IZG A;  2YLR A;  3B3R A;  3SN4 A;  4BK2 A;  2Z5Y A;  4EQS A;  3LAD A;  2RGH A;  1L8P A;  3A7U A;  4OCG A;  4TM4 A;  2PSN A;  2YAU A;  3ES8 A;  4U8O A;  1CJ3 A;  4TLX A;  4MJW A;  3UKP A;  3CYJ A;  3I4K A;  3QLD A;  3BI4 A;  1ONF A;  1PS9 A;  3NYE A;  4CCR A;  3DGZ A;  1FIQ B;  4XXG A;  3AED A;  4MGG A;  3QPE A;  1CC4 A;  4KT2 A;  1P48 A;  4Y4L A;  3VRD B;  5EBK A;  1OJT A;  3OTR A;  3UP5 A;  3GD6 A;  4YKG A;  4K5S A;  3EEZ A;  3DK9 A;  3GRS A;  5KWF A;  1BGN A;  3STP A;  3KPF A;  1OEP A;  3R9U A;  2X50 A;  1SJC A;  1SJA A;  4Z1Y A;  4DN1 A;  4H1Z A;  4ICY A;  1GV4 A;  4MKS A;  2XYO A;  3EAN A;  3PK7 A;  3IJQ A;  3BNM A;  2OLO A;  4C77 A;  2V60 A;  1MDL A;  3NZG A;  2Q0K A;  4Z17 A;  4OPT A;  3D8X A;  4U8N A;  4NNJ A;  2WU5 A;  2PP3 A;  1PBC A;  3WE0 A;  1S3E A;  4IL0 A;  5HYM A;  1VRQ B;  4X4J A;  2GB0 A;  2BK3 A;  1FFV C;  4IA6 A;  3FV9 A;  4H4P A;  2WQY A;  4OPG A;  3NK2 X;  1KKR A;  5HXI A;  2VRM A;  4IVM B;  4I59 A;  3UKH A;  3IWA A;  3JW7 A;  1HYU A;  2BAB A;  2Q6U A;  2C72 A;  3QTP A;  4IP4 A;  1JRZ A;  2BXR A;  3NT6 A;  3H12 A;  1GT8 A;  3DG7 A;  2A89 A;  4GRT A;  1GAL A;  2W54 A;  2YVJ A;  1X2H A;  3N6H A;  3LOV A;  4JN9 A;  2Q7V A;  5J04 A;  1H83 A;  1NEL A;  4GYP C;  4YTN A;  1B8S A;  4B65 A;  1M6I A;  4Y4N A;  5FS8 A;  3GWD A;  2XH4 A;  2POZ A;  1DXL A;  2OPJ A;  3NRN A;  1NG4 A;  3RR1 A;  2O9Z A;  4ZA0 A;  3AN1 A;  3CNJ A;  2CVJ A;  1O95 A;  4OPL A;  4OPC A;  3K7T A;  1GRH A;  4CCQ A;  1VDV A;  3RED A;  4IVO B;  1V59 A;  1TRB A;  2XSX A;  2WEU A;  3NYC A;  3GD4 A;  2YG6 A;  1L9D A;  2Y6R A;  5TR3 A;  5IQ1 A;  1WYG A;  4ROP A;  5L46 A;  1E1N A;  1TDN A;  3ALL A;  3SBF A;  1XHC A;  3P3B A;  4B67 A;  3U4F A;  3OW1 A;  1ZDL A;  3SN0 A;  1GRF A;  4GDE A;  2BC0 A;  2IID A;  4A7A A;  1ZX9 A;  2YLT A;  2RGJ A;  1XS2 A;  2WU2 A;  1JPD X;  3SY4 A;  3V4B A;  1FFU C;  3GY1 A;  2C66 A;  4Z43 A;  1PJ5 A;  3B6D A;  4Z25 A;  3FYY A;  3B97 A;  2E5A A;  3CXB A;  2YG7 A;  1N4W A;  3UJR A;  4GYP A;  4H4X A;  1KDG A;  2AQJ A;  4J1O A;  2WPF A;  3SQS A;  2JBV A;  4BUR A;  3KKJ A;  1EC9 A;  3ZVH B;  1ZMD A;  2BS4 A;  2QJM A;  3BHF A;  3DME A;  2WES A;  1GRA A;  1TZZ A;  3PFR A;  3AB1 A;  3VA8 A;  4E4U A;  4M52 A;  1IUT A;  1TKK A;  3AE5 A;  2YQU A;  2BK4 A;  3UTE A;  4A79 A;  3T9P A;  1R6W A;  1NDA A;  1K4Q A;  3NVV B;  2V5Z A;  3N4E A;  2C3C A;  3MKC A;  3F8R A;  2NQL A;  1YEY A;  4K1W A;  2APG A;  4EQR A;  2AKZ A;  2OLN A;  4TM0 A;  3HZL A;  4GGH A;  1PDY A;  2OO6 A;  2ZZB A;  4H4Q A;  2Y6Q A;  4B1B A;  2GDQ A;  1K0L A;  1EL9 A;  1CC2 A;  2PTY A;  1XDI A;  2GR0 A;  1LQU A;  2EQ7 A;  1NG3 A;  2XFP A;  1L9C A;  3DER A;  3TWA A;  3Q9T A;  3IF9 A;  1GRT A;  3DIP A;  2PP1 A;  3DDM A;  4GUV A;  3FVD A;  4ADW A;  3LJP A;  2NPX A;  2XVF A;  3QVR A;  2C75 A;  3M13 A;  4BK3 A;  1IYX A;  4UP3 A;  4ZCC A;  2V6O A;  2C4C A;  4OPD A;  3T31 A;  3CK5 A;  2XLP A;  2P8B A;  2PU0 A;  3N4F A;  2WHD A;  3TWB A;  4EMJ A;  4FDC B;  3ZVH A;  3ENL A;  3BI5 A;  4XWR A;  4OPU A;  2R9Z A;  2VZ2 A;  1KSS A;  3NK1 X;  3CTY A;  2XLR A;  1CBO A;  3VR8 A;  1Y0P A;  4A99 A;  4B68 A;  3CPJ G;  1Y56 B;  4UDR A;  3SZW A;  3N6J A;  4H4Z A;  2P8C A;  1DJN A;  2OZ3 A;  2B9X A;  1WUE A;  3K7M X;  3UXL A;  3DJE A;  4IV9 A;  2BCG G;  2R46 A;  1OJC A;  3H8A A;  3U9I A;  2JB1 A;  4DNA A;  5EU9 A;  3SZC A;  2NVK X;  1STZ A;  3UJ2 A;  2FJE A;  3DEQ A;  2XLU A;  1P43 A;  4H7U A;  2P88 A;  3RP6 A;  3AWI A;  4ZCW A;  1D4D A;  1ZK7 A;  4EMW A;  3I6D A;  2BS3 A;  4NTC A;  5GSN A;  5JCI A;  4OPI A;  1GTH A;  4CNK A;  2ZZC A;  3R25 A;  3D9X A;  4HN8 A;  2B76 A;  2PTW A;  2ACZ A;  1JRY A;  3LZX A;  4K7Z A;  4AOX A;  4H83 A;  3OPS A;  4D04 A;  2JKC A;  4I58 A;  3A7A A;  3V3W A;  3AE8 A;  1NEK A;  3E1T A;  4H4S A;  4U2S A;  3LB8 A;  2YLZ A;  1ELS A;  2VOU A;  1MUC A;  2AR8 A;  1E9I A;  2CUL A;  1H6V A;  4NZH A;  3DGH A;  1OJ9 A;  4HNC A;  3AE3 A;  1AOG A;  3TQP A;  2XCG A;  1KNP A;  4H19 A;  3DG6 A;  4GAV A;  1DTN A;  2XH0 A;  2GR2 A;  4U8I A;  4YWS A;  3S61 A;  1EBH A;  3UOX A;  4ENL A;  2FJB A;  1PDZ A;  5KMR A;  4K2S A;  5FS9 A;  1BZL A;  3DGB A;  4C3X A;  3CMM A;  3UTF A;  3AM9 A;  3VCC A;  4LU6 A;  2CHR A;  5BUL A;  1D7Y A;  3GO2 A;  3H70 A;  4H2Q A;  4DHG A;  1JNR A;  1F8R A;  3KPK A;  5CKU A;  5KOW A;  1QO8 A;  1N4U A;  2GEW A;  2GF3 A;  3IC9 A;  4YTP A;  1MOK A;  1JU2 A;  2GR3 A;  1FOH A;  1JDF A;  1XAN A;  2X8H A;  1KFY A;  3RO6 A;  5FS7 A;  3QN3 A;  2AL2 B;  4AT0 A;  1EL7 A;  4J57 A;  3VQR A;  3T14 A;  3LZW A;  1E1M A;  3ALJ A;  2WDR A;  3ICT A;  3GWF A;  1ZOY A;  7ENL A;  1RM6 B;  4YSH A;  1EL5 A;  1IUS A;  4U2L A;  5ENL A;  4G74 A;  2EQ8 A;  3QJ4 A;  1FCD A;  1RYI A;  2GGE A;  2QA1 A;  2XFU A;  3UXK A;  4UDQ A;  2P0I A;  3UTH A;  2R4J A;  4Z2U A;  2X99 A;  1L0V A;  2IVD A;  1ZKQ A;  4RG3 A;  1XPY A;  2GGI A;  3UKA A;  2OQY A;  3TJI A;  2XFO A;  3NK0 X;  3AD9 B;  3IHM A;  3DFY A;  3T2K A;  3ALM A;  5C3J A;  1N63 C;  2VRL A;  3ZVI A;  3OZY A;  5J7X A;  4E5T A;  4G6H A;  3L8K A;  3H8I A;  5C2T A;  2PGE A;  4H4Y A;  4E4F A;  4GGB A;  2ARD A;  4H4U A;  3P4Q A;  4BJZ A;  4J56 A;  1EBD A;  2GH5 A;  1COY A;  2B7S A;  2GR1 A;  2PGW A;  2GAH B;  3G5R A;  1CJ2 A;  1Z6L A;  4HCH A;  1EL8 A;  4EIP A;  1DOB A;  2MNR A;  3AEB A;  3FG2 P;  4O5U A;  4TM1 A;  2HXU A;  3K1G A;  1VQW A;  3AE9 A;  1F9C A;  1QLB A;  4YSY A;  1K0I A;  3PVC A;  3K7Q X;  3SN1 A;  2WS3 A;  2XH2 A;  2XFQ A;  4WCT A;  3Q45 A;  2BRA A;  4H2P A;  1PXC A;  1P2E A;  3ICS A;  5FJO A;  3EAO A;  2E5V A;  2JB2 A;  3D46 A;  4U8J A;  3ZLF A;  2XVJ A;  2I0Z A;  5KXJ A;  3NVZ B;  5KVI A;  4B69 A;  4NEV A;  3T6C A;  4DSG A;  1NU5 A;  3NVY B;  3MQT A;  2RGO A;  3S5W A;  1CHU A;  1D4C A;  3DK4 A;  4FK1 A;  1EBG A;  1IUV A;  1IUU A;  1OJA A;  2WBA A;  3CGC A;  1P2H A;  3MSY A;  4KWS A;  3BI2 A;  2ZC8 A;  3NGC X;  1NEN A;  4EQX A;  3CIR A;  4JNA A;  1MNS A;  4JQ9 A;  3KD9 A;  1PDH A;  2OVL A;  3FJ4 A;  2QVH A;  2VVM A;  4F4R A;  3ABV A;  1B37 A;  2C7G A;  5IPY A;  4DWD A;  2FJA A;  4G8T A;  5BRT A;  3DH9 A;  1PHH A;  4H50 A;  2YLW A;  3GC2 A;  4HCL A;  2YM2 A;  3IK4 A;  1DJQ A;  1PBD A;  1TDF A;  4APN A;  3NNE A;  2PTX A;  1ZXI C;  4Z44 A;  2OAL A;  2QQ6 A;  2TPR A;  1N1P A;  1EC8 A;  2C76 A;  2C70 A;  5CQF A;  1YQZ A;  4NEW A;  1FEA A;  1NHS A;  3I6E A;  2JK6 A;  4CRT A;  3NN6 X;  1DNC A;  3SFD A;  1E1K A;  1KSU A;  3NO1 A;  3NN0 X;  3II4 A;  1N4V A;  3F8D A;  4II3 A;  1X2G A;  3S47 A;  3NTA A;  4UDP A;  2OKT A;  2MUC A;  3UOY A;  4YSZ A;  4YSX A;  2V3B A;  2FJD A;  2JAE A;  1NPX A;  4P9S A;  4JN7 A;  2E4G A;  3FIM B;  2X8G A;  2BXS A;  2B9W A;  4C74 A;  1YKJ A;  1RP0 A;  3VCN A;  4U8P A;  5FS6 A;  3P4P A;  3FCP A;  4A6N B;  3HW2 A;  4NTE A;  4A5L A;  5JCN A;  4H4R A;  1VG9 A;  3RHA A;  2PA6 A;  2R0P A;  4G9K A;  1E6E A;  1BWC A;  1Q1W A;  3R1Z A;  2W0H A;  3I3L A;  3SZF A;  4GR1 A;  1LV0 A;  4J3Z A;  4DX3 A;  2QCU A;  2PS2 A;  3L5O A;  4IHC A;  1PBF A;  3ES7 A;  2PTZ A;  3UJF A;  3AE7 A;  1MO9 A;  1S2Y A;  5LV9 A;  2XDO A;  2WPE A;  3V5C A;  2YVG A;  1GEU A;  4GF7 A;  2B7R A;  3FBS A;  1REO A;  1H7X A;  5FJU A;  3TOY A;  1B4V A;  4A65 A;  3C4N A;  1PBE A;  2YR4 A;  1GRG A;  1H81 A;  2GMJ A;  4TLZ A;  3AMZ A;  2H88 A;  3AEF A;  3HRD C;  2IVE A;  4JN8 A;  2YG3 A;  4YT0 A;  1TE6 A;  3KU9 A;  1NHR A;  2QAE A;  2GMH A;  3GYJ A;  1CJC A;  1QJD A;  5BVA A;  1ZOV A;  1H2I A;  2V61 A;  2BC1 A;  1IUX A;  3V76 A;  4A35 A;  4HB9 A;  3BSM A;  4G6G A;  3DA1 A;  3DJJ A;  1CF3 A;  3R11 A;  4J34 A;  3PS9 A;  1GXF A;  2XFN A;  5ER0 A;  3GSI A;  3CXO A;  3SJN A;  3MWC A;  3AXB A;  4K8D A;  2WET A;  5FJP A;  3CNP A;  2RAB A;  2C67 A;  3T4W A;  3TW9 A;  3H8L A;  3ISH A;  5G5H B;  1DOD A;  6ENL A;  1TYT A;  4B66 A;  1EC7 A;  3TTE A;  3NS1 B;  1GRE A;  3QFA A;  3VRA A;  5BOE A;  3NXL A;  3GRT A;  2FBW A;  3T37 A;  3SZ0 A;  2OZ8 A;  3B9J B;  1NHQ A;  4Y4M A;  2QA2 A;  3MUC A;  3SX6 A;  1MRA A;  2E1M A;  1F6M A;  3IJL A;  2YVF A;  1KKO A;  4E8G A;  2TMD A;  3GDN A;  5JCL A;  2WOV A;  1SJD A;  2AL1 A;  2X3N A;  3IHG A;  2WOI A;  3MY9 A;  3ICR A;  2YG5 A;  2GSH A;  4AOS A;  1FHV A;  1GET A;  1W4X A;  1Y56 A;  5HY5 A;  2DKI A;  1B5Q A;  1VQZ A;  4Z2R A;  3VR9 A;  2GL5 A;  3ZLH A;  2W55 A;  5KRQ A;  1ZY8 A;  4J2W A;  1X31 B;  3SXI A;  3SQP A;  4Z26 A;  3DG3 A;  3AE6 A;  2RDX A;  3NFU A;  3D47 A;  3UKL A;  4EM3 A;  2JB3 A;  4TM3 A;  3CB3 A;  3DK8 A;  2BAC A;  5FMH A;  4DGK A;  3ATR A;  3JZU A;  2WP9 A;  2A8X A;  5FJR A;  5KMP A;  4EM4 A;  4KPR A;  4U8L A;  3RGT A;  4DSH A;  2R4E A;  5KMS A;  3TCS A;  2DKH A;  3V3N A;  4KX6 A;  4CBQ A;  2OX4 A;  1F8W A;  3CT2 A;  2P3Z A;  1PN0 A;  2YWL A;  3DJD A;  2H89 A;  4K8G A;  3R0U A;  3QSS A;  5KMQ A;  3DES A;  1NAA A;  4X9N A;  3PO7 A;  1S3B A;  4B63 A;  2XLT A;  4GCM A;  3SGL A;  2EQ6 A;  5DBJ A;  4MMW A;  1KCZ A;  3ATQ A;  3PWI A;  3HPF A;  4EIQ A;  4OVI A;  1JNZ A;  3AD8 B;  3EKG A;  5BOF A;  1ZMC A;  3NRZ B;  5J60 A;  2BK5 A;  2UZZ A;  1ECQ A;  2I5Q A;  3NLC A;  4JY2 A;  1FL2 A;  1GPE A;  4U8K A;  2F5Z A;  2ZAD A;  1BKH A;  2QGY A;  5U1O A;  1GES A;  3NVW B;  3H4K A;  2CDU A;  3DFH A;  4LA1 A;  1FEC A;  2PU1 A;  3IJI A;  3UGV A;  3NHO X;  3CAW A;  1E39 A;  4Z24 A;  3OP2 A;  2YLS A;  3NIX A;  4A3R A;  4YWO A;  4H4W A;  3NKS A;  1NHP A;  4K5R A;  4PAB A;  1N61 C;  3T2Z A;  2OAM A;  3AYL A;  2R45 A;  2XVI A;  3H7V A;  1RVK A;  1H82 A;  3UKF A;  4NWZ A;  4FP1 A;  2B9Y A;  4G7F A;  4GDP A;  4C3Y A;  2HQM A;  2YM1 A;  2HNE A;  4G73 A;  2OZT A;  3VDG A;  4FK1 C;  2YR6 A;  2HXT A;  3QFB A;  2WPC A;  2OQH A;  1JCT A;  3UKQ A;  2GVC A;  1TDK A;  4USR A;  3KVE A;  2WDQ A;  3G5Q A;  2PP0 A;  1YQ4 A;  2AL2 A;  4HPN A;  1PBB A;  3V3O A;  3P4R A;  4J33 A;  2XLS A;  2AAQ A;  1K0J A;  2HZG A;  4GME A;  1VDC A;  2VQ7 A;  4K2X A;  1L9E A;  1H86 A;  1N60 C;  3AYJ A;  3CNS A;  4JNQ A;  2OFJ A;  3ZLG A;  2ONE A;  2X8C A;  3CN8 A;  5KNL A;  2XGZ A;  1PXB A;  4EWJ A;  3T2Y A;  5M10 A;  4GIR A;  3ZDN A;  3AE1 A;  4B64 A;  1ONE A;  1LQT A;  2EQ9 A;  1Q9I A;  5EB4 A;  4A6G A;  4H4V A;  4AP3 A;  1D4E A;  4IA5 A;  2WP5 A;  1W6T A;  2OG9 A;  4II2 A;  4D03 A;  3OC4 A;  3RNM A;  4EMI A;  2J3N A;  2PCE A;  2OLA A;  1IUW A;  4XWZ A;  3UKK A;  1TDE A;  4REK A;  3MZN A;  3EPT A;  1Q1R A;  1PJ6 A;  2CFY A;  1T3Q C;  3UTG A;  4C5O A;  3VFC A;  4YTM A;  4HCD A;  2QJJ A;  3QSE A;  3SFE A;  1YY5 A;  3FXG A;  5IDZ A;  1CJ4 A;  3ITJ A;  2XVH A;  4GAP A;  2PYX A;  3UCD A;  1DOE A;  1YQ3 A;  2GGH A;  3BNU A;  2VVL G;  4WX1 A;  2BA9 A;  5BUK A;  2DW7 A;  3TJ4 A;  4BK1 A;  3NYF A;  1LTX R;  2YLX A;  4H2H A;  2GQF A;  2FYM A;  1GOS A;  3R07 C;  4KPL A;  2PHH A;  3R10 A;  3UP4 A;  2GQW A;  2GAG B;  3OZ2 A;  2VQB A;  1N62 C;  4O5Q A;  3EF6 A;  3CGB A;  3JVA A;  4AP1 A;  3GMB A;  3KUM A;  4JDR A;  2AKM A;  4J36 A;  3RP8 A;  4A9W A;  4ECH A;  3O0H A;  3NH3 X;  2GRT A;  3SSZ A;  4E6M A;  5EB5 A;  3KLJ A;  3F8P A;  4ZCD A;  2E3T A;  1TYP A;  3UCC A;  3CPH G;  1F3P A;  3GD3 A;  4TVW A;  1BQG A;  3D1C A;  3Q4D A;  1ELI A;  4RSL A;  1GRB A;  3NG7 X;  5KOX A;  1WUF A;  1H84 A;  2YR5 A;  1GSN A;  3SYI A;  4TVY A;  1O5W A;  2Q0L A;  3BJS A;  1N5X A;  3GYI A;  1KF6 A;  2W3S A;  3C4A A;  3BHK A;  3HYV A;  4HYR A;  1N5W C;  3RP7 A;  1RSG A;  3AEC A;  1CL0 A;  3VC5 A;  1OJD A;  4JY3 A;  3AD7 B;  3GYX A;  3VRB A;  2VVL A;  3UOV A;  1MDR A;  1S2Q A;  3GMC A;  2DW6 A;  3P0W A;  3DJG X;  3UJS A;  2C65 A;  3G5S A;  2C73 A;  3C96 A;  1PJ7 A;  1BF3 A;  3LXD A;  4DXK A;  4Z2T A;  2GV8 A;  1SB3 B;  1JRP A;  3VC6 A;  4EQW A;  3UJE A; 
#chains in the Genus database with same CATH homology
 1KN0 A;  1ZDL A;  3T2K A;  4LII A;  1GET A;  1FEB A;  1GRF A;  2R0G A;  1W4X A;  3ALM A;  4GDE A;  2BC0 A;  2IID A;  5C3J A;  1E7P A;  1Y56 A;  5HY5 A;  4A7A A;  2DKI A;  2VRL A;  1B5Q A;  3AE4 A;  1ZX9 A;  1GTE A;  2YLT A;  4Z2R A;  3VR9 A;  5JRB A;  2RGJ A;  3SM8 A;  5J7X A;  2BRY A;  2WU2 A;  1CC6 A;  3SY4 A;  5KRQ A;  1O94 A;  4G6H A;  1ZY8 A;  3L8K A;  4J2W A;  3H8I A;  4FX9 A;  5C2T A;  1X31 B;  1ZP0 A;  3SXI A;  3QVP A;  2C66 A;  4Z43 A;  3SQP A;  4Z26 A;  1PJ5 A;  4H4Y A;  3B6D A;  3K30 A;  3GDP A;  3AE6 A;  4Z25 A;  3AYI A;  2ARD A;  4H4U A;  3P4Q A;  5GRT A;  4PAA A;  2YG7 A;  4BJZ A;  4ZN0 A;  1N4W A;  4J56 A;  3UKL A;  4EM3 A;  2JB3 A;  4X9M A;  2BYB A;  5EOW A;  1EBD A;  2GH5 A;  4H4X A;  1COY A;  1KDG A;  4TM3 A;  2AQJ A;  2B7S A;  2GR1 A;  1GER A;  3DK8 A;  2BAC A;  2GAH B;  5FMH A;  3G5R A;  2WPF A;  1CJ2 A;  2WP6 A;  4DGK A;  1Z6L A;  2JBV A;  4K22 A;  3ATR A;  4BUR A;  3KKJ A;  2WP9 A;  2ZBW A;  1EL8 A;  1ZMD A;  2BS4 A;  2A8X A;  4BV6 A;  3BHF A;  5KMP A;  4EIP A;  1LVL A;  3DME A;  2WES A;  5JCK A;  4EM4 A;  3FPZ A;  4KPR A;  4U8L A;  3CND A;  3Q6J A;  1GRA A;  3AB1 A;  1DOB A;  4DSH A;  4A6N A;  5IQ4 A;  2R4E A;  3AEB A;  1H7W A;  3FG2 P;  3HYW A;  5KMS A;  3AEG A;  2DKH A;  4O5U A;  3V3N A;  4KX6 A;  4TM1 A;  4CBQ A;  1F8W A;  1PN0 A;  2YWL A;  1VQW A;  3AE9 A;  3DJD A;  4H2N A;  1QLB A;  2H89 A;  1BGJ A;  4BJY A;  3CPI G;  4M52 A;  1IUT A;  3QSS A;  1K0I A;  5KMQ A;  3PVC A;  3AE5 A;  3K7Q X;  4YSY A;  4AT2 A;  2WS3 A;  2YQU A;  1NAA A;  2BK4 A;  4X9N A;  2XFQ A;  3UTE A;  5HHF A;  4A79 A;  2A87 A;  3PO7 A;  3NTD A;  1S3B A;  4B63 A;  2XLT A;  4WCT A;  1NDA A;  4GCM A;  1K4Q A;  2V5Z A;  2BRA A;  4H2P A;  1PXC A;  3SGL A;  2C3C A;  2C3D A;  1P2E A;  3FMW A;  4CNJ A;  3ICS A;  5U25 A;  2EQ6 A;  3F8R A;  1F8S A;  3HYX A;  4U2T A;  1XPQ A;  3EAO A;  2E5V A;  5DBJ A;  2APG A;  3ATQ A;  4EQR A;  2JB2 A;  2OLN A;  4TM0 A;  3T0K A;  3HZL A;  4U8J A;  4EIQ A;  4OVI A;  2ZZB A;  4H4Q A;  1JNZ A;  3AD8 B;  1ZMC A;  5JCM A;  2Y6Q A;  5J60 A;  2BCP A;  3P4S A;  2XVJ A;  2I0Z A;  2WDV A;  3JSK A;  1K0L A;  2BK5 A;  4B1B A;  5KXJ A;  4H2R A;  2UZZ A;  1S7M A;  2V3A A;  5KVI A;  1EL9 A;  3QSM A;  4NEV A;  4B69 A;  1CC2 A;  3NLC A;  4JY2 A;  4CY8 A;  1FL2 A;  1GPE A;  3M12 A;  2F5Z A;  4U8K A;  1XDI A;  2GR0 A;  1LQU A;  4DSG A;  2EQ7 A;  4N9X A;  1NG3 A;  2XFP A;  1JEH A;  1L9C A;  1D5T A;  1CHU A;  1D4C A;  2RGO A;  3S5W A;  4YXD A;  5U1O A;  3DK4 A;  1GES A;  4FK1 A;  1IUV A;  1IUU A;  1OJA A;  3H4K A;  2WBA A;  3CGC A;  3Q9T A;  2CDU A;  1P2H A;  4LA1 A;  1KNR A;  1FEC A;  3BI2 A;  4CY6 A;  3NHO X;  3IF9 A;  3AEA A;  1GRT A;  3NGC X;  1NEN A;  4EQX A;  3CIR A;  4JNA A;  4J31 A;  4NTD A;  1E39 A;  4Z24 A;  3CNT A;  4JQ9 A;  2YLS A;  3KD9 A;  4GUV A;  1PDH A;  3NIX A;  4ADW A;  4YWO A;  3LJP A;  5U63 A;  1UKV G;  4H4W A;  3NKS A;  1M64 A;  1IJH A;  1NHP A;  4K5R A;  2XVE A;  2NPX A;  4PAB A;  3T2Z A;  2OAM A;  2XVF A;  4HA6 A;  2VVM A;  3CGD A;  3URH A;  3P1W A;  3QVR A;  3AYL A;  2C75 A;  2R45 A;  2XVI A;  3M13 A;  3ABV A;  1B37 A;  2C7G A;  4YKF A;  5IPY A;  2FJA A;  4BK3 A;  1H82 A;  3UKF A;  5BRT A;  4NWZ A;  1PXA A;  3DH9 A;  1PHH A;  1MXT A;  2B9Y A;  3UOZ A;  4UP3 A;  4GDP A;  4ZCC A;  2V6O A;  4C3Y A;  4H50 A;  2HQM A;  3ADA B;  2YM1 A;  5KVH A;  2C4C A;  2YLW A;  2Z5X A;  4G73 A;  4OPD A;  3T31 A;  2YM2 A;  2XLP A;  2WHD A;  1DJQ A;  1JRX A;  1PBD A;  4APN A;  4EMJ A;  1TDF A;  3NNE A;  4FK1 C;  4FDC B;  2YG4 A;  4USQ A;  2YR6 A;  1BKW A;  4Z44 A;  3QFB A;  4H4T A;  1LJ1 A;  2OAL A;  3BI5 A;  4XWR A;  4OPU A;  2R9Z A;  1DOC A;  2VZ2 A;  2TPR A;  2WPC A;  1N1P A;  1KSS A;  2C76 A;  3L1R A;  3NK1 X;  2GVC A;  3CTY A;  1TDK A;  2C70 A;  2XLR A;  5CQF A;  3UKQ A;  1CBO A;  3KVE A;  4USR A;  1YQZ A;  3PG6 A;  2WDQ A;  4NEW A;  3G5Q A;  3M0O A;  3VR8 A;  1Y0P A;  4A99 A;  4B68 A;  1YQ4 A;  3KA7 A;  3CPJ G;  1FEA A;  1Y56 B;  1NHS A;  4UDR A;  1LPF A;  3SZW A;  2JK6 A;  4CRT A;  3NN6 X;  1DNC A;  3SFD A;  4H4Z A;  1PBB A;  1E1K A;  1KSU A;  3NN0 X;  3II4 A;  1N4V A;  3F8D A;  4II3 A;  3V3O A;  1DJN A;  2OA1 A;  3P4R A;  3NTA A;  4UDP A;  4J33 A;  2XLS A;  2B9X A;  2AAQ A;  1K0J A;  1SEZ A;  3AEE A;  2R0C A;  2BS2 A;  1VDC A;  3K7M X;  5M0Z A;  1GND A;  2C64 A;  3DJE A;  4IV9 A;  2BCG G;  3UCL A;  4U8M A;  4E0V A;  3AE2 A;  2VQ7 A;  1VG0 A;  3UOY A;  3ZYX A;  4RG4 A;  4YSZ A;  2R46 A;  4K2X A;  4YSX A;  2V3B A;  1L9E A;  1H86 A;  1OJC A;  2FJD A;  2JAE A;  1E1L A;  1TDO A;  3AYJ A;  1NPX A;  3CNS A;  3CGE A;  4P9S A;  4JNQ A;  3P9U A;  2E4G A;  3FIM B;  2JB1 A;  4DNA A;  3SZC A;  2X8G A;  2BXS A;  2NVK X;  2B9W A;  2FJE A;  2X8C A;  3CN8 A;  2ZZ0 A;  1YKJ A;  3COX A;  4C74 A;  5KNL A;  1D7L A;  1PXB A;  2XLU A;  4H7U A;  2WOW A;  3RP6 A;  1RP0 A;  3AWI A;  1JOA A;  1D4D A;  1ZK7 A;  3T2Y A;  4EMW A;  2YLR A;  5M10 A;  3I6D A;  3ZDN A;  3B3R A;  2BS3 A;  3AE1 A;  4BK2 A;  4B64 A;  4U8P A;  1LQT A;  2Z5Y A;  4NTC A;  5FS6 A;  2EQ9 A;  4EQS A;  3P4P A;  1Q9I A;  3LAD A;  2RGH A;  4A6N B;  5EB4 A;  5GSN A;  4OCG A;  4TM4 A;  4NTE A;  2YAU A;  4H4V A;  4U8O A;  4A5L A;  4AP3 A;  5JCI A;  1CJ3 A;  1D4E A;  4MJW A;  4TLX A;  5JCN A;  2WP5 A;  4H4R A;  4IA5 A;  3UKP A;  4II2 A;  4OPI A;  1GTH A;  3BI4 A;  4CNK A;  1ONF A;  2ZZC A;  1PS9 A;  4D03 A;  3NYE A;  1VG9 A;  3OC4 A;  3RNM A;  4CCR A;  3D9X A;  4EMI A;  3RHA A;  2J3N A;  3DGZ A;  2B76 A;  2R0P A;  4G9K A;  1IUW A;  1E6E A;  4XWZ A;  1BWC A;  1Q1W A;  2ACZ A;  3UKK A;  1JRY A;  1TDE A;  4REK A;  3LZX A;  4XXG A;  3AED A;  4K7Z A;  2W0H A;  1CC4 A;  3I3L A;  3SZF A;  4Y4L A;  4AOX A;  4GR1 A;  3VRD B;  1LV0 A;  4D04 A;  2JKC A;  5EBK A;  3EPT A;  1OJT A;  2QCU A;  1Q1R A;  4I58 A;  3L5O A;  1PJ6 A;  3AE8 A;  2CFY A;  1NEK A;  3UP5 A;  3E1T A;  3UTG A;  4C5O A;  4H4S A;  4YKG A;  4K5S A;  4U2S A;  3LB8 A;  4YTM A;  1PBF A;  2YLZ A;  3QSE A;  3SFE A;  1YY5 A;  3DK9 A;  3AE7 A;  1MO9 A;  3GRS A;  1S2Y A;  2VOU A;  5KWF A;  1CJ4 A;  2AR8 A;  1BGN A;  5LV9 A;  2XDO A;  2WPE A;  2YVG A;  3ITJ A;  2CUL A;  2XVH A;  4GAP A;  3KPF A;  1H6V A;  4NZH A;  3R9U A;  1GEU A;  1DOE A;  1YQ3 A;  3DGH A;  2B7R A;  2PYX A;  3FBS A;  4GF7 A;  2X50 A;  1OJ9 A;  3BNU A;  2VVL G;  3AE3 A;  4WX1 A;  1REO A;  1AOG A;  1H7X A;  1B4V A;  2BA9 A;  4A65 A;  2XCG A;  5BUK A;  4ICY A;  1GV4 A;  2XYO A;  3EAN A;  3BNM A;  1KNP A;  3C4N A;  2OLO A;  4C77 A;  1PBE A;  4GAV A;  4BK1 A;  2YR4 A;  3NYF A;  1GRG A;  1LTX R;  2V60 A;  2YLX A;  1H81 A;  2GMJ A;  2Q0K A;  4TLZ A;  2GR2 A;  2GQF A;  3D8X A;  1GOS A;  4OPT A;  4U8N A;  4U8I A;  2H88 A;  3S61 A;  4NNJ A;  2WU5 A;  3AEF A;  2PHH A;  3UOX A;  2FJB A;  2IVE A;  3UP4 A;  2GQW A;  1PBC A;  3WE0 A;  2YG3 A;  2GAG B;  1S3E A;  4YT0 A;  3OZ2 A;  5FS9 A;  5KMR A;  5HYM A;  1BZL A;  1VRQ B;  2VQB A;  3KU9 A;  1NHR A;  2QAE A;  4C3X A;  4O5Q A;  3CMM A;  2GMH A;  3EF6 A;  3GYJ A;  4X4J A;  3CGB A;  3UTF A;  4AP1 A;  2BK3 A;  1CJC A;  2GB0 A;  3GMB A;  4IA6 A;  2WQY A;  4H4P A;  1QJD A;  4LU6 A;  5BUL A;  4JDR A;  1D7Y A;  4OPG A;  5BVA A;  1ZOV A;  1H2I A;  2V61 A;  3NK2 X;  4H2Q A;  4J36 A;  3RP8 A;  2BC1 A;  1IUX A;  1JNR A;  4A9W A;  4ECH A;  3O0H A;  3NH3 X;  1F8R A;  3V76 A;  2GRT A;  5HXI A;  4HB9 A;  5EB5 A;  3KLJ A;  3KPK A;  5CKU A;  5KOW A;  3F8P A;  2VRM A;  1QO8 A;  4IVM B;  4ZCD A;  4I59 A;  3UKH A;  1N4U A;  2GEW A;  4G6G A;  3DA1 A;  3DJJ A;  1TYP A;  1CF3 A;  2GF3 A;  3IC9 A;  3IWA A;  3CPH G;  1HYU A;  4J34 A;  1F3P A;  2BAB A;  2Q6U A;  4YTP A;  2C72 A;  1MOK A;  1JU2 A;  3PS9 A;  2GR3 A;  1JRZ A;  3GD3 A;  1FOH A;  1GXF A;  2BXR A;  5ER0 A;  2XFN A;  3GSI A;  3AXB A;  4K8D A;  3NT6 A;  1XAN A;  3D1C A;  2WET A;  2X8H A;  1KFY A;  1ELI A;  1GT8 A;  4RSL A;  1GRB A;  3NG7 X;  3CNP A;  2RAB A;  5FS7 A;  2C67 A;  4AT0 A;  5KOX A;  1EL7 A;  4J57 A;  2A89 A;  3VQR A;  3T14 A;  1H84 A;  3H8L A;  4GRT A;  2YR5 A;  3LZW A;  1GAL A;  3ISH A;  1GSN A;  1E1M A;  2YVJ A;  2WDR A;  3ALJ A;  3ICT A;  3SYI A;  1O5W A;  2Q0L A;  1DOD A;  3GWF A;  1ZOY A;  1TYT A;  3GYI A;  1KF6 A;  3LOV A;  4JN9 A;  2Q7V A;  4B66 A;  4YSH A;  1H83 A;  1EL5 A;  3C4A A;  3BHK A;  1IUS A;  3HYV A;  4YTN A;  1GRE A;  1B8S A;  4U2L A;  4B65 A;  1M6I A;  3QFA A;  4Y4N A;  5FS8 A;  3GWD A;  3RP7 A;  3VRA A;  1DXL A;  1RSG A;  3AEC A;  2EQ8 A;  1CL0 A;  1FCD A;  3QJ4 A;  4G74 A;  3GRT A;  2FBW A;  3T37 A;  1OJD A;  3NRN A;  1NG4 A;  1RYI A;  3SZ0 A;  4JY3 A;  2O9Z A;  3AD7 B;  3GYX A;  3CNJ A;  3VRB A;  1NHQ A;  2VVL A;  4Y4M A;  3UOV A;  2QA1 A;  2QA2 A;  2CVJ A;  1S2Q A;  1O95 A;  3GMC A;  2E1M A;  3SX6 A;  2XFU A;  1F6M A;  4UDQ A;  3DJG X;  4OPL A;  3UTH A;  2YVF A;  4OPC A;  3K7T A;  1GRH A;  4CCQ A;  2R4J A;  3RED A;  4Z2U A;  4IVO B;  1V59 A;  2C65 A;  1TRB A;  2X99 A;  2WEU A;  3G5S A;  3NYC A;  3GD4 A;  2C73 A;  2TMD A;  3C96 A;  2YG6 A;  1L0V A;  1L9D A;  2Y6R A;  5TR3 A;  3GDN A;  5IQ1 A;  5JCL A;  1PJ7 A;  2IVD A;  1ZKQ A;  2WOV A;  1BF3 A;  3LXD A;  4RG3 A;  5L46 A;  2X3N A;  3IHG A;  1E1N A;  1TDN A;  4Z2T A;  3ALL A;  2GV8 A;  3UKA A;  2WOI A;  2XFO A;  1XHC A;  3NK0 X;  3AD9 B;  3IHM A;  4EQW A;  3ICR A;  4B67 A;  2YG5 A;  4AOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...