3U9IA

The crystal structure of mandelate racemase/muconate lactonizing enzyme from roseiflexus sp.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
366
structure length
346
Chain Sequence
TAPTTIRALTVAPLDIPLHEVARNLLVAVELTDGTRGYGEAAPFPAFNGETQDMAHAAILAARSLVEGADVREWRRIALALPALPGMTGSARCAIETAILDALTRRARLPLWAFFGGAATSLETDVTITVTAAARAAQAIVARGVTTIKIKIGTIRTMEHDLARIVAIRDVAPTARLILDGNCGYTAPDALRLLDMLGVHGIVPALFEQPVAKDDEEGLRRLTATRRVPVAADESVASATDAARLARNAAVDVLNIKLMKCGIVEALDIAAIARTAGLHLMIGGMVESLLAMTVSACFAAGQGGFRFVDLDTPLFLAENPFDGGMTYHGGTIDLTLIEAGHGVTPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme, C-terminal d
publication title The crystal structure of Mandelate racemase/muconate lactonizing enzyme from Roseiflexus sp.
rcsb
source organism Roseiflexus sp. rs-1
molecule tags Isomerase
total genus 109
structure length 346
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3u9iA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3u9iA01
1EC8A 2FKPA 1L8PA 3ZVHA 3ENLA 2PP0A 3CYJA 1TZZA 3TJIA 4J3ZA 2PSNA 3DIPA 4K8GA 3VFCA 3QPEA 2QDDA 2ZC8A 3SN1A 2P88A 2XGZA 1ECQA 4KWSA 2AL2B 3FYYA 3FXGA 1P43A 2OG9A 3FJ4A 1NELA 2MNRA 4E5TA 3NO1A 3TWBA 3RRAA 4H83A 1IYXA 3H7VA 3DFHA 3UJRA 3P0WA 3STPA 3D47A 1ONEA 3THUA 2OLAA 1F9CA 3CXOA 2OZ3A 2HNEA 2DW7A 4M0XA 3SQSA 3NZGA 1JPMA 4HPNA 1TE6A 3I4KA 1E9IA 1JCTA 3SN4A 4A6GA 4Z1YA 3OZMA 3V5FA 4GGBA 5FJPA 3T9PA 2GGHA 3QKEA 3TJ4A 3RGTA 3MY9A 4GFIA 1NU5A 3T8QA 1R0MA 3Q4DA 3S5SA 2HXUA 2AL1A 3IJQA 4KEMA 3D46A 3CAWA 1PDYA 4JN7A 1DTNA 3PWGA 3ZLFA 3NFUA 5FJOA 3GC2A 2PU0A 3Q45A 4H1ZA 1KCZA 3H70A 5J04A 3OZYA 4FP1A 2XH7A 2GGJA 2GGEA 3EKGA 2XH0A 2QQ6A 3ES7A 4GIRA 3GO2A 3ZVHB 2PS2A 3V4BA 4K1WA 3OP2A 5FJRA 2I5QA 1EC7A 2HXTA 2OKTA 3UJ2A 4IT1A 4HCLA 5IDZA 3OW1A 3R1ZA 4MGGA 2QJJA 4GYPC 1SJCA 2QJMA 4IP5A 3MUCA 4HCDA 4E8GA 2RDXA 3CK5A 3TW9A 2ONEA 3N4EA 1YEYA 4YWSA 2OQYA 1ELSA 1BKHA 2DW6A 3QLDA 1W6TA 3QTPA 3RR1A 3FVDA 1PDZA 3ZLHA 3BOXA 3VA8A 4A35A 2OVLA 2GL5A 3DG6A 2GSHA 4DYEA 3UJSA 3MKCA 6ENLA 4DWDA 2MUCA 3P93A 4HCHA 2PTZA 1MRAA 2PP1A 1EC9A 3HPFA 4GISA 4EWJA 2PTYA 3GY1A 3DG7A 3T6CA 3TWAA 2O56A 3DDMA 4MKSA 3UJEA 3JW7A 2PCEA 4HNCA 4ZCWA 4IZGA 3KUMA 1WUEA 3PK7A 3NXLA 4FI4A 2PPGA 1SJAA 3BSMA 2GDQA 2PA6A 3U4FA 1KKRA 2PU1A 2PGEA 2CHRA 3CT2A 4JHMA 3N6JA 4G7FA 2P8CA 3I6TA 3VDGA 3PFRA 4IP4A 4GGHA 5FJTA 3RO6A 1EBHA 2NQLA 3UXKA 3EEZA 1P48A 3DEQA 5FJUA 3SJNA 3V5CA 1FHVA 2PTWA 2QVHA 2GGGA 2PGWA 2XSXA 3ZLGA 4M6UA 3S47A 3UCDA 4KPLA 4HN8A 1TKKA 3H8AA 1WUFA 1SJDA 3SN0A 3MQTA 2P0IA 3K1GA 3TTEA 3VCCA 3UCCA 1MDRA 4X2PA 4E4FA 2OFJA 3MWCA 4J1OA 3BJSA 5BOEA 3DERA 3H12A 2QGYA 4IHCA 4ZA0A 1SJBA 2GGIA 3UGVA 2PP3A 4F4RA 4H19A 3FCPA 3R0KA 5EU9A 2POZA 5BOFA 4HYRA 1KKOA 4ENLA 3CB3A 3UJFA 2OQHA 3ZVIA 1OEPA 1JPDX 1XS2A 3R0UA 3JVAA 2ZADA 2PTXA 1MDLA 3TCSA 2PODA 4GYPA 4JN8A 3DFYA 3QN3A 3IJLA 2OZTA 2AL2A 3B97A 1KD0A 3MSYA 3ES8A 3DESA 3GD6A 4MMWA 3JZUA 2OZ8A 2QDEA 1MNSA 1MUCA 4A3RA 3RCYA 3R10A 3P3BA 1XPYA 4Z17A 4G8TA 1FHUA 2P8BA 3MZNA 4DXKA 1R6WA 2QJNA 2PMQA 4IL0A 4ROPA 3R11A 1RVKA 3U9IA 1BQGA 3SSZA 3IJIA 3VC5A 4DHGA 3R25A 4E4UA 1EBGA 3UXLA 4HNLA 4GMEA 2OPJA 4H2HA 3SBFA 2XH4A 4KT2A 3DG3A 4K2SA 3OPSA 3DGBA 3TQPA 4E6MA 2OX4A 3N6HA 1JDFA 2XH2A 5ENLA 3OTRA 7ENLA 2FYMA 3V3WA 3T4WA 3VC6A 3IK4A 2AKMA 4DN1A 2OO6A 3N4FA 4DX3A 3RITA 2P3ZA 4IL2A 3PWIA 3TOYA 2HZGA 3VCNA 3FV9A 2AKZA 3I6EA
chains in the Genus database with same CATH superfamily
4YWIA 4L6HA 5EYWA 2PP0A 3ITTA 1EJSC 4HQVA 3TJIA 4J3ZA 4UOJA 3LEPA 3SUTA 3WD3A 1QNSA 1DWFM 2Y61A 3OHMB 4INFA 1RK6A 1UP2A 4NZ3A 1M7XA 3SQLA 3FNDA 3VIFA 3B0PA 4DF1A 2VFFA 1DJZA 2FH8A 3TIMA 4H9ZA 2WXDM 3W53A 3PFMA 1JZ5A 3UWVA 4B2DD 3NQ6A 2JEPA 3CZ8A 3VKKA 2VELA 4L65A 3N14A 2V63A 5B80A 4ZQOA 1JRCA 2WSPA 1OFAA 3M7WA 1OY0A 2X8CA 3GQYA 4TMCA 3AROA 4BWLA 1JPMA 3CLMA 1E9YB 4DO7A 1KFCA 4UQDA 5CPOA 1FEAA 1E6PA 1TREA 1M5WA 1TTQA 3PBUA 3AIRA 4FDCB 2ZRYA 1UD8A 4KFOA 4LBRA 1EDGA 2ZUTA 1DWIM 1H1YA 1XDIA 3TH6A 3DFPA 2D3NA 3IGUA 1OF8A 3ARWA 4DO4A 3URAA 4E3TA 1OABA 5A8QA 1P4CA 3OHIA 3PB0A 4GX8A 1FRBA 2P3EA 4PMRA 1U1UA 1NHRA 2OU4A 3PUGA 3O1NA 2F6XA 7REQA 3EKGA 4HMDA 5ABTA 2VHLA 3ES7A 2ZUWA 3F5JA 2EG6A 3VIOA 1LM1A 4XD5A 4YPJA 3PTQA 4LUSA 3OW1A 3CIXA 2OZ0A 3V16A 4I6KA 3E0LA 5LKYA 4JIPA 4Q7BA 2W55A 1C93A 4YU1A 1UJQA 1JZ4A 2QXWA 1XRTA 2A2IA 2J7BA 3ZSTA 1DVJA 4IIBA 3N73A 5TNVA 1GOQA 2RDWA 2Z29A 1TFVA 3ZWSA 4FNUA 1B3YA 4NEVA 4JYDA 5AHNA 1F7BA 3QTGA 4GCAA 2YW3A 3CXBA 1S1RA 4LVFA 1P0NA 3M5YA 1AK5A 1JF5A 1J6OA 3GS6A 3B04A 4P7OA 4F0SA 1FDZA 1TVLA 3LPGA 2ZRVA 1FUYA 4UB9A 4ADTA 3THDA 4PMJA 4HZMA 1GOWA 4QS5A 3WNLA 4MZYA 3BMVA 4QJ1A 1ONRA 2WSQA 3UJEA 4IISA 1OT2A 5FF3A 3QGVA 1VYPX 5K7JA 4IGHA 4L4LA 3SO7A 1CYGA 2ALDA 5T9CE 3LXCA 1AOGA 2EKCA 4FXRA 2DVXA 2J7HA 2WZMA 1VLWA 1EA0A 3LTPA 4MUPA 5EA9A 2PA6A 2VRKA 1I8JA 3QZAA 3WBEA 2VRQA 3QV9A 2RFGA 5D9PA 1VCGA 2VCBA 2F6UA 4LYPA 2R1PA 5E9XA 2ZFAA 3H7RA 3PJTA 2BY3A 1XC4A 3UA3A 4M56A 1SO5A 1AQMA 1ZBVA 3UBPC 2DY3A 1MFUA 2ZUMA 3VGGA 4O8AA 5LNSA 4A4AA 2PTWA 5EMYA 3CGCA 4RZBA 1XKYA 5M5DA 3G6LA 1EGMA 4O18A 5D9MA 1Q8JA 3MMDA 3SIZA 4XIAA 2G8ZA 4JTFA 4J7RA 4H8HA 4C6EA 1W1YA 3WCZA 1DPMA 4L64A 1CXIA 2GSEA 1F6YA 4DZ5A 1OK6A 4WEVX 4DUVA 3T0AA 1RA0A 5CQ1A 4FNPA 4KCWA 5J8LA 1VEOA 4XKYB 3VCCA 3A7RA 3NDYA 3BLOA 2NV2A 3M5ZA 2YLAA 4TVYA 4H7CA 1E0XA 3R89A 3C2FA 3H12A 3EMQA 1XFCA 3WLQA 1Z89A 4MLJA 1OGBA 3CUJA 1UKTA 3E1F1 5I3GA 4LVAA 4CEUC 4HPGA 3VK5A 5CCZA 4BZYA 3NDOA 1XYFA 4FR1A 3SGGA 1EO5A 2GVGA 4WY0F 4CNNA 1LLZA 3HPZA 2WM0A 4AEOA 3O3RA 3IAPA 2EAWA 4C7DA 3GU1A 3B0VC 2ZCGA 2DJXA 7PTDA 3TFXA 1LCOA 2PODA 4AISA 1ME7A 1EO7A 4TTGA 4YLWA 3P8JA 5C2XA 4K3ZA 4F79A 2GDVA 1BRLB 3CH0A 4S39A 1S2UA 3ES8A 2ACQA 3PZ9A 4OIFA 2VGFA 4X0VA 1J2BA 5GJMA 4KIRA 4DPQA 3UF9A 1OG6A 4L9XA 4IFKA 3BZJA 1N62C 1ADSA 1E1CB 3A4JA 5A6AA 3EX2A 4BI6A 3W81A 3A24A 4REQA 1TR9A 1XCXA 2W27A 2ACSA 1US3A 5I7GA 1KO0A 1X6LA 5BWFA 4PUEA 3R12A 4MFEA 3V0UA 1H3GA 4S3DA 1ZK7A 3CTTA 4GMEA 4D6CA 2Z6IA 1ZP3A 2YDQA 3GSMA 3DGBA 2DUAA 2OX4A 1Q4WA 1RK5A 3A7UA 5D02A 2BHZA 1LZOA 4HD5A 5FESA 1UZDA 3W27A 4KFPA 2ACUA 3PAOA 4XZIA 2Z7GA 1G9HA 4PRTA 1VFLA 1VQZA 2CIPA 5ECUA 3BPWA 2RUSA 1TMQA 1R9ZA 5D03A 3EF6A 2OELA 2VFEA 9XIAA 4CLMA 4PCSA 3QFEA 3RCMA 4PMQA 5H8UA 4URIA 3AMGA 2HVNA 1LWIA 1P1MA 1F6KA 3GKAA 3A9BA 4MKVA 4UCFA 4CN6A 2VKZG 5A2AA 7XIMA 1KFEA 3SUWA 1XBYA 4K7VA 2IKIA 1XIJA 3NO3A 3ID7A 3P82A 3ZM8A 1IV8A 4HTYA 2NQ5A 1E3XA 3UVIA 1IXPA 1VBHA 3P8IA 1K03A 1QW8A 1UD6A 2J88A 3B3DA 2HNHA 4E5TA 3LBOA 3CV7A 4O4VA 1ZCOA 1GWJA 3BV7A 2ZXAA 1GVRA 4N9CA 1DJWA 1M6JA 2O7SA 4WQ6A 5IRPA 3SURA 5A6JA 1PHWA 1EEXA 3LXDA 1CEOA 3CV2A 4LRTA 3W2JA 1JGIA 3WUEA 4UCGA 2GVLA 1ICPA 1VP5A 3PG8A 1E1EA 5GJNA 2NX1A 1TV3A 2A6NA 4A8IA 3VKAA 3MY9A 1F2JA 3Q4DA 2X0YA 4EM3A 2HXUA 3UG5A 3HQPA 4GNKB 2A3AA 1OC7A 3PJWA 3I10A 5A6BD 1ADOA 2GFTA 2CWXA 3CL7A 2V38A 3SFWA 1K8XA 3OQ8A 4EQRA 4JN7A 3ZZ1A 4QBXA 4GINA 1W3KA 2TPRA 4EMJA 1F3XA 2A79A 2ZX6A 3NCOA 5ABFB 3OBKA 3H70A 2EQ8A 5I6SA 4H8VA 4JFWA 5BZAA 1SO3A 2Y88A 1PVNA 4Y8FA 2XH7A 1D8WA 3R6IA 3FHQA 1UR3M 1BZLA 4JIHA 3N17A 3U2ZA 2D23A 1ZJAA 3ZVHB 4B5WA 4QGCA 1CB2A 2DORA 4Q8WA 2QCNA 4HK5A 3E3HA 3UETA 3AMZA 3D9XA 1R38A 1O7AA 4JQ4A 4B4FA 4YTUA 1ML1A 1IT0A 1OWQA 1G4TA 5I79A 2RDXA 1CT5A 2FGLA 4LANA 3UERA 2TYSA 2Y0FA 5MHBA 4Z1BA 4KCVA 1GJPA 2VZTA 4MWAA 1C91A 4AZGA 1V6XA 2P50A 1R46A 1JNEA 1U1HA 2PWFA 4O14A 3VFLA 1F3PA 1TCMA 3ZLHA 1HQTA 1STZA 3TYBA 2B7PA 2QCGA 5CLWA 2NW0A 3T2OA 1XDMA 1EOMA 4XAZA 2DH3A 1EYWA 1TV7A 2I16A 4Q8TA 1NP2A 1X1ZA 2X1SA 4J2PA 1FXQA 3HA1A 3NVYB 1PKMA 3I7SA 4ZE4A 3SCUA 1W1A1 4GISA 3GHRA 4Q3MA 2EQ6A 3QQ0A 2J6VA 1I2OA 3LHZA 4EP8C 3ABSA 4LEFA 4UQEA 1BF2A 2G0WA 4UZSA 1RLDA 1Y7VA 3VM7A 1GOIA 4H4WA 3BCDA 1ONFA 1KTNA 1MXGA 2HK1A 5MKGA 1E73M 3THAA 3BH4A 4BI7A 1E6RA 2VZVA 1TV2A 5IM51 1OCQA 3JS3A 1OYAA 4QM1A 2B31A 1EJWC 4L56A 1CCWB 3MJYA 5ABHA 3H53A 4OHQA 1EJRC 1OZQA 3EEZA 1D3GA 4G7EB 3UG4A 1L6YA 3QGAC 4E8CA 3K4DA 3MUIA 1DP0A 2INEA 5C54A 4LFYA 1H7PA 3UR7A 1D3CA 1QNVA 2Y5JA 1E15A 2VZUA 4ICCX 4BFAA 3QQ1A 4PL1A 2PBOA 1TKKA 3I3DA 3H8AA 4DUOA 2C13A 2PGFA 1GERA 3TTEA 1A5SA 2VDHA 4D6GA 1XYAA 1MFVA 4C6OA 1S2CA 2EG8A 2YA0A 3G1VA 1W2VA 5DANA 2WMGA 1RUSA 4TO8A 3K8KA 1E40A 3MC5A 4GVHA 2GVEA 3W6MA 1S5TA 5GNYA 3SCNA 3NXFA 2DZPA 2E77A 3U4AA 3RMJA 3VOGA 3M6DA 4F4RA 3KRSA 2BG5A 3REQB 2X8GA 3R8RA 4QJ3B 1BVWA 1FCQA 4NZCA 2XWEA 3ANUA 3FSTA 3BO9A 4ALDA 1S2TA 2C16A 3TJXA 4MNJA 3GTNA 4TV6A 2W66A 1H0IA 2PWGA 1H6VA 3PBYA 5IBXC 1C8VA 4RPPA 2Y85A 5CZKA 3W7MA 5HULA 3GIQA 2FLIA 1MQRA 4B3ZA 1LT7A 4L6OA 4O1CA 1ZJHA 3GD6A 1KXTA 1KNWA 1WKFA 1MYRA 2W3ZA 4A3RA 2ACRA 4TMBA 3W6LA 4M29A 3KFTA 4QNEA 3P3BA 3C0SA 3PVFA 4Z17A 3BE7A 3E0FA 3M47A 4HZ8A 4D6JA 2XZ7A 3VMPA 1CGWA 2XWDA 1AW5A 2XVLA 3DCPA 4H04A 5AN7A 1FWEC 1PIGA 1EF2A 2WWCA 4F0LA 5B7ZA 2HK0A 3DK8A 4XD4A 2E09A 5D4YA 3HMJG 4TXEA 3MUAA 1OX4B 4WDXA 1K6WA 4AF0B 1VIWA 2YA1A 1PKNA 3WH6A 1BSIA 4QITA 5HNNA 4PB5A 3WD1A 3H6OA 5E93A 4A3UA 1V97A 1SZRA 4U33A 3IEBA 2ZVIA 1W9UA 1GQNA 1KW1A 2VMFA 4H8NA 1FEBA 3AO0A 2ATSA 3NEHA 1NTHA 3DJJA 1WZAA 2ZE0A 4GC3A 1HJSA 1BXCA 4MJ2A 3HW2A 3T09A 1XV8A 1FCVA 2Q3RA 4GI8A 4O52A 3IIXA 2XGZA 3OA5A 1NQ6A 4B9ZA 2XGIA 4PE8A 1W5PA 4QE5A 5C9WA 3QR3A 2X1IA 5D30A 1GEUA 2NWSA 4X9YA 1SU5A 2YXOA 1DWGM 3BAXA 1XH1A 1VJSA 3MU7A 1VPQA 4ZQPA 4AZ5A 1MNZA 2YKKA 5M2FX 4MKNA 1LORA 2C1HA 1V0NA 3ZXWA 2YB1A 1XH0A 1QOXA 2WC3A 4JTEA 1EP2A 3DGZA 4NX0A 2BOFX 4EACA 1JF6A 1TYPA 3MYOA 1E0VA 3KX6A 4ORMA 3VOJA 3FG2P 3TK7A 5AYXA 3IGSA 2NLYA 1BG4A 4H4XA 5I00A 1W1B1 5LGXA 3PC0A 3L5AA 4PTWA 1XUZA 4MYXA 3GC2A 3L66A 3WF0A 3GFZA 4GZEA 4Q33A 1FCUA 4X60A 1YDNA 5E1QA 4JS3A 3NZQA 1PSCA 1UZHA 2VT0A 4O53A 3MMUA 3G24A 2J66A 4US5D 4HTBA 2D0HA 2C19A 4WJEA 2HCVA 1K70A 2R1MA 1QBAA 3CWOX 2RDTA 4FO4A 1V3IA 2FPVA 4GK8A 3O0FA 4E8DA 1LBFA 1KFLA 2DEPA 3J7HA 4IT1A 4TVWA 3R1ZA 1TJPA 3GR7A 2WZIA 3LLDA 4N6FA 2PDPA 3OYZA 5BW6A 3CV6A 3MT1A 4C5YA 4PMYA 2VUYA 2D2GA 4CEXC 4N02A 1AJ2A 3EDDA 3T0TA 1KCKA 1UPPA 1F3WA 4Y96A 1EEPA 2DP3A 1X7FA 5IFTA 1NOUA 3TFCA 5BXTA 2PWDA 1NFPA 1UG6A 2AQOA 2INZA 4ZSUA 1ZBKA 1RQBA 1OCJA 4HZ7A 6ENLA 3U48A 1BF6A 1TWDA 1VQTA 3AXIA 3QV7A 2V3FA 3RJYA 1JZ8A 4HSHA 1QU4A 1O5XA 4YYCA 3P67A 3A7AA 2PF0A 1GORA 1W1ZA 2FVMA 4KH2A 1UMLA 1V08A 3FS2A 3TR2A 2OWCA 1WUEA 3W9ZA 1ZDLA 3R4IA 2W63A 4B5TA 1UQZA 2WJEA 3I6RA 2YB4A 2FH6A 4GJ1A 1M1BA 1M04A 3RFAA 1SJAA 7CGTA 4OU1A 1AW1A 1I0BA 3AOFA 3DFTA 1PHQA 3N11A 3RRXA 4QFUA 3CHEA 2CFFA 1TPEA 3EX4A 4F66A 7REQB 1WV2A 4IP4A 4XAFA 3TTSA 1TZ7A 2CLIA 3SCTA 2CCRA 1JDDA 3EWWA 1MEIA 3GG1A 3AIUA 1IT8A 3U3HA 3MV11 3UD6A 2Z1VA 1U5JA 4LUSB 2GGGA 1W8SA 2XSXA 3M0LA 3CM4A 4LRSA 3S42A 3P5ZA 1X39A 1F07A 2A8XA 1B1YA 3WH9A 1JDEA 1U1JA 1NFBA 1OADA 2V3EA 3PZGA 3TAKA 1WXZA 4JTTA 3K2GA 1KBIA 3GXMA 1PCKA 4UR7A 4ZOAA 3IUHA 4CNSA 1X98A 1SJDA 4O50A 2VUNA 1QWGA 3BLLA 2PDJA 3OBEA 1NHPA 5G1YA 3BG3A 4UUIA 4L4PA 1NDAA 4E4FA 1PZ3A 2VQUA 2CZEA 3VKBA 5CPSA 3BLDA 4W7VA 2MANA 1I1XA 1OT1A 1S2VA 4ADUA 4AXNA 2BODX 4LVDA 1IR2A 3FCPA 4N6EA 5E9AA 4HYRA 2GUBA 3DU0A 2X2YA 1A53A 5ECVA 2FB2A 3ZVIA 4MVAA 3NAVA 4M81A 5FACA 3LXAA 1UA3A 4B2DA 2J7DA 2PDGA 3AI0A 3C2YA 3SM0A 1H50A 2E25A 3VCRA 3GR8A 1TQXA 4PC8A 2CPUA 2A7NA 3CUIA 5H8PA 1RH9A 4RKAA 3W85A 2I7GA 3B97A 3VD4A 5FKYA 3MSYA 1V6WA 1R3VA 4GA8A 4MNLA 4PMVA 3VGFA 4HHPA 4EE9A 3F1QA 2PWEA 4KETA 5BXRA 2NX9A 4NJJA 5DXXA 5CEWA 3WEMA 3HN3A 2VFHA 3AJXA 4UMBA 2YAUA 1FX6A 4XQ6A 2DSUA 2QJNA 2I17A 4ATLA 2PMQA 1K8YA 1B3XA 2B7OA 3R2GA 5CSSA 4B92A 4JFVA 1EYEA 4E4UA 5CG0A 3DN5A 4A22A 2PD5A 3CO8A 1UQYA 2A85A 5C5YA 1ECEA 4AY8A 1PYFA 3SCVA 1Q6EA 2VGBA 3AYSA 4AD1A 4R53A 2XH2A 2DDXA 1XRSA 2HV5A 2WOQA 5D9NA 1WKYA 3RAOA 1TPVA 2X09A 4J3TA 2PC4A 2WC4A 3VGDA 4RLIA 1Q6FA 4LUJA 4IL2A 3LD5A 4N4QA 4Z1DA 4JQ3A 3B0UX 1E56A 4TIMA 2WKJA 4DJEA 1PZ2A 2YX0A 4H6EA 3H2FA 4PL2A 5U25A 3C61A 5C9XA 2AGKA 4W87A 3FA5A 4H4VA 3L7RA 2R91A 3ITXA 1J0IA 2P88A 3RU8X 4EKJA 3LCGA 5AYZA 1FWIC 1UD5A 3FJ4A 3CWHA 1VFHA 4DXXA 5E5CA 2D2OA 4ZTXA 3VMOA 3GTXA 3CUHA 4A3YA 1GQJA 1M53A 3T08A 5CJNA 3PJUA 3A4XA 4IFKB 5JH2A 5LIXX 1ZU8A 1KR0A 1JYWA 3FA3A 3IJ8A 4CQCA 3OO2A 1JEHA 1M68A 1QOQA 1GG1A 1AA1B 4REQB 1QT1A 5AYBA 2GZXA 3EXTA 1K6AA 3WQDA 5FJPA 3T9PA 3HPAA 4DXVA 4LALA 4MNMA 1WDRA 1DJXA 1R2TA 2Y62A 3POHA 3UCQA 4NY2A 4W8LA 5A8NA 2FHCA 3FYOA 3W1UA 2RJHA 2ZZ3A 1S5VA 3L0GA 1GONA 1UZ1A 1EJ7L 4J2MA 2C14A 4WJ8A 3CAWA 5IXEA 1MO9A 4D6HA 2JGYA 5A69A 1UR8A 1CLKA 2KZHA 5LIWX 4JTAA 5EGRA 4IJCA 5FJOA 2QULA 4H1ZA 3KDNA 4K6AA 3DBPA 3GHUA 4IQDA 2Z6JA 2GGJA 3RPDA 3EEGA 2OTDA 5FL1A 4MM1A 3ABRA 4GX9A 4B16A 3TU9A 2E7FA 2C7FA 5LNWA 1XD1A 1ISWA 4GOAA 2BY0A 3KL0A 3B9DA 3LADA 2HXTA 2BC1A 2VCAA 3MPGA 2Y5SA 2ZYFA 3NURA 3WQWA 2XFYA 4JDYA 4JTQA 3R7MA 3O7UA 4I8YA 4ACZA 1IZCA 2ZBTA 3GUGA 4IGSA 3GDRA 1KB3A 3H23A 1A0DA 2Q8XA 3WQOA 4YWSA 4MB3A 2DW6A 4IMGA 5E6YA 4HMCA 1GXFA 1PDZA 3BAJA 5F2IA 3UEQA 3WUGA 6TAAA 3L67A 3WLNA 3W1RA 1JEZA 3UJSA 1W1VA 4AZHA 2WW5A 3GVGA 3HGRA 8A3HA 1V93A 4P7QA 4LW7A 5CGMA 4IFOA 3M46A 1EC9A 3GHTA 4IPIA 1JNDA 1KR1A 1ZPTA 3RM4A 3NSXA 2PCEA 4ZCWA 4LVBA 4F9JA 3APTA 2XTKA 1R8LA 1H1NA 3LPPA 2W92A 3L5MA 3LI1A 2ZRZA 1YE4A 3RK8A 1AH4A 1PX8A 3FKRA 4ZOEA 1BLIA 1KXQA 1V59A 3QF0A 4LC6A 5I09A 1XYLA 5REQA 5FS8A 1XP3A 1IXQA 4PULA 4V27A 1XYMA 2WPFA 1B4KA 1K7FA 3PG9A 1J6PA 1Q6LA 3APYA 1V6YA 1F8WA 4M3PA 2NVCA 2PGWA 2VFGA 3SFKA 3ZLGA 3ZT5A 2J24A 1QFEA 3BDKA 4MADA 4PFHA 1PBGA 3WUFA 1VDVA 4K1GA 2F61A 1IEQA 2R6OA 4QXIA 4WLCA 4FLRA 4MWAB 4DPPA 3W2KA 1WUFA 2YBUA 2ZVRA 3ZMRA 4Q4QA 1EQCA 2O9RA 2DIEA 3ME3A 1Q6QA 3EWCA 3LHUA 4B4HA 2PLCA 5BOEA 5DRCA 1OJTA 3VOFA 1JYNA 3GNDA 5DY3A 3BLPX 5D2TA 4I9MA 3S3GA 2Y4SA 3H2CA 4MJZA 5D2VA 4HPJA 3MP3A 3FLUA 3FW6A 5BOFA 4KBXA 2ZUSA 3CZKA 5JQ9A 2CZVA 2DT0A 3W7QA 2E5BA 3W87A 3QRHA 4OE7A 3WLTA 4C6MA 1V51A 2ZADA 3MI3A 1L9WA 4C6JA 2J27A 3GE7A 4S3BA 3G6MA 1GVOA 4C6CA 4AD5A 3LY0A 3WNKA 2ZZ6A 2H3BA 5MKGB 1LQAA 1EIBA 4BKNA 3G5EA 1XINA 4LAMA 5CKSA 1PYMA 3KZPA 3VX1A 1A0CA 1MUCA 4LY4A 2OT0A 1E6QM 4GZIA 4LTSA 1RPKA 1N5WC 5FL0A 4ZB0A 2HPIA 5E6ZA 2E5AA 3P6LA 2WVVA 4LOCA 4OT7A 3G1FA 4LAUA 3MO7A 3U2CA 5A6BA 1BQGA 5FI8A 2PDFA 4JHZA 2BSLA 3C56A 2OPJA 1W0MA 3NTYA 4OUEA 4F2UA 1N2VA 3TP4A 1TTIA 4GQGA 4DWSC 2Y2WA 1PWMA 3CAKA 3CWNA 4QG6A 5F4WA 5FS7A 5HPOA 3IRDA 4CQAA 2WQDA 3GZAA 3EBVA 5A8GA 1E4NA 4PB3A 3PPCA 2Z27A 1KCLA 2QJIA 4DLFA 3AMDA 5HWJA 3WDHA 3N3TA 2DZSA 3DHUA 3OGVA 3C2OA 3CUGA 1NWRA 3MTWA 2RDUA 4MYAA 2OR2A 4I9TA 4AC7C 3QY6A 3GXDA 2MNRA 1DBTA 3NO1A 4N9BA 3EB3A 1R5YA 1JI1A 2ZUVA 1AVAA 4FEZA 1SZEA 2FTWA 3VNDA 2BFGA 2NVKX 5D38A 2OZ3A 4M0XA 2GRTA 2QV4A 4QR6A 2GVYA 3H54A 3NZGA 1BGGA 4WKHA 5D05A 5FSDC 1EUAA 4ZOBA 3KBVA 2DSZA 1T96A 3OZMA 4GABA 4GGBA 1O60A 1V6VA 3TJ4A 4PCPA 1RM6B 3MHFA 3PZMA 2CLOA 5XINA 3V5OA 3PPGA 4F40A 2Y8KA 3S5OA 1R0MA 4LYRA 5DO8A 1CZ1A 2FTPA 1ZSXA 3NVVB 5HWNA 4GC4A 4XUYA 4CU6A 4KEMA 4K8HA 4TQTA 2OKOA 3G0XA 2D3LA 1DTNA 1XDJA 4CGTA 1KBLA 5GQBA 4DM1A 3ZLFA 4HMNA 3IACA 3Q45A 1UJPA 1B31A 4K36A 3Q65A 3B9AA 3ARRA 2NSOA 5CBJA 3F4NA 1RCOB 4XO6A 1F05A 1WQ5A 4IIEA 4MLRA 4IMFA 1OFEA 4FA3A 4GIRA 4US6A 3GO2A 2FTYA 3HGJA 1GEQA 3AJ7A 1ISZA 4P2VA 3TLQA 3VGBA 4AWTA 3UQNA 4IIFA 3AICA 1O5KA 2HE5A 2VFDA 1P0BA 1ICQA 3CS2A 5EMUA 3WZ0E 3AZTA 2QJMA 1LRTA 4CQBA 1A4LA 2IS7A 3IARA 1IEVA 3C0LA 1GRBA 4OVXA 3WNMA 1EJXC 1XQKA 5H8MA 1VCVA 1UKPA 1XRFA 3VNZA 1EF3A 1V0LA 2H3DA 1TPFA 3CAQA 4RNFA 2FHFA 1TZ9A 3COTA 3KRZA 3EMZA 1L2QA 1XLHA 4KCTA 3ELFA 4MG4A 4QDMA 2E8ZA 3IV8A 3JRKA 1RPXA 2HDJA 5AYYA 3GVVA 3NQBA 3A4AA 4IICA 5D2XA 3KXQA 1LBMA 5A5WA 3NJ3A 5FAJA 3FJNA 1H7NA 3MCOA 4A8LA 4MKSA 3BLFA 2CLKA 4PCTA 1HZYA 4HNCA 4P7NA 1H49A 4PCFA 1D7FA 3PK7A 3G0UA 3W2MA 1FWWA 4IM4A 1XLEA 1JFXA 1HKVA 3GNPA 1GSNA 3WLHA 3E0IA 2CLFA 3F7JA 5F4XA 1V6UA 2PU1A 1ZBCA 4NVTA 4LAKA 5FA5A 3ALFA 3PPFA 4B90A 4V28A 3ANYA 1M6IA 5C7VA 1Q3NA 2NQLA 3GRSA 1P5BA 3VOCA 3PWAA 1FBAA 4DO6A 4IMEA 3N15A 2ODOA 2QIIA 2F2HA 4AG0A 2WC7A 3PHAA 2ABBA 2DQXA 1HXJA 1PPIA 2UV8G 2V2CA 4Q8UA 3AMCA 1FQ0A 4P7LA 2G3NA 4RR4A 4KWOA 3IIOA 1KM6A 1FWAC 4Q8VA 4GUJA 3W24A 5D8ZA 1FECA 2BGNE 2XFFA 2ZRWA 4AIBA 3SI9A 3HG2A 4GBDA 3RM9A 3U7VA 5DY2A 1DJNA 2ZTKA 2VX5A 5GRTA 2J74A 4DVOA 1WDDA 1GCYA 3CIWA 4AD4A 5BYWA 4FALA 3AS3A 4I8DA 4ENLA 1GPFA 1YXYA 3U5UA 1TIMA 4G2DA 3PUDA 3O8AA 4DJDD 4PMXA 4L9YA 2TSYA 4GIEA 3F4DA 3KZSA 4Z2KA 1MQPA 4H4QA 3LOTA 1JPDX 1XS2A 2PEVA 4LIIA 1G4SA 1JPHA 3BAKA 3TSDA 1ZRQA 1DIOA 2X1TA 2D69A 1REQA 1QNOA 2QW5A 2YL5A 3DHDA 4D1JA 3INPA 1XR2A 2AMXA 1J2WA 5HK4A 3UPBA 1EOKA 3TN3A 1J0JA 5BU6A 4FS9A 4OUIA 5CPNA 2X1RA 1B0IA 3M16A 3W83A 5JIWA 4WY0A 3AYVA 3ANVA 3GC4A 4RDYA 1RP8A 4MMWA 4B5SA 3JZUA 1NY1A 3NOEA 2GYIA 4NEWA 1W9PA 2J78A 4HHHA 5LIKX 2BX7A 1XPYA 3RR4A 2HTMA 3UR2A 4JNMA 3AZRA 3HG5A 3F2CA 3GW0A 4F0RA 3GK0A 8TIMA 1RVKA 4HK6A 1A3XA 5CGTA 1NOFA 1B3VA 4GXPA 2Z4GA 8CGTA 2J7CA 3G1XA 1O68A 1BXBA 1DOSA 5B7YA 3MO4A 5BXSA 1GNXA 2IPFA 3LENA 3MB9A 2C91A 4RE0A 4EPBC 4K39A 1C7TA 1TMLA 3H7UA 2R9ZA 2PDQA 2HE8A 3N18A 1UUOA 3TQPA 3W2NA 2GWGA 4US5A 3VC6A 3KM8A 4LEQA 5IHSA 4DN1A 4MJMA 1IXOA 1QO2A 3AC0A 2BDQA 4IG2A 2A3CA 2YSWA 4W84A 5A6KA 2GQ9A 3AXMA 2F6KA 2A3BA 3C6CA 3LLXA 6CGTA 3OGSA 3FV9A 2VR2A 2YBTA 5DBTA 3GDLA 2A7PA 3HJZA 4CD5A 3O6YX 3N2CA 1NHSA 3TYCA 1NDWA 5HAOA 5AC6A 1JULA 3CHDA 4CNTA 1GKPA 2J79A 2BNJA 3FXGA 1EDTA 3FOKA 3WFZA 2R24A 3GLCA 3KW3A 3W00A 8RUCA 5T26A 3DFHA 3WX7A 1O5QA 1UW9A 3THUA 2BHYA 2OGJA 3SDOA 3KTXA 2CBIA 4NNBA 2CBJA 1X2GA 4HPNA 1MXDA 1SZFA 1KM5A 1XJBA 4LGXA 1VJIA 1JCTA 2I9EA 1S3TC 3GXIA 4AW7A 4DAIA 1A5NC 1DJGA 5AHFA 1VFUA 3TX9A 1DWHM 2V3GA 3BG9A 4GWEA 2WP6A 5PTDA 3W73A 4MAVA 1HKIA 4PMNA 4K38A 4JQ9A 3WNPA 4KERA 4YNGA 1NP0A 4LSBA 4Z08A 2EF9A 3S5SA 2AL1A 2Q02A 2H90A 2JIWA 1JDCA 3WLMA 4LT9A 4S3JA 4YS1A 3LNPA 3D5HA 1PZ1A 1ZXIC 1KCZA 1H0GA 4QJ4B 1WZKA 3OZYA 4DBSA 1OK4A 3QY7A 2PZ0A 3WBAA 4HPXA 1KBKA 4FF7A 4JQAA 3EMCA 2Z2AA 4RW3A 1BVNP 1U22A 4QG8A 4DUXA 1CW2A 2A1YA 4GJJA 5JBEA 9CGTA 1V77A 1L2UA 2I5GA 3MP5A 1RZMA 3BQ5A 1VJZA 3QKZA 4OBSA 2GQ8A 1LBLA 1I2PA 3DC8A 3S0CA 4JOMA 1Q1RA 4HA3A 2PDWA 4KS0A 3NQAA 1XH2A 3LLFA 4XBKA 4IP5A 1O5RA 2Y7GA 4M19A 1HP4A 4H4RA 4NJIA 5EBUA 2GJXB 4C6PA 3TC7A 3T7VA 1GQKA 3NSNA 3WJSA 1CIUA 3WQ5A 4MWAD 1S2WA 3PB2A 3BCJA 1ELSA 3UGRA 1BKHA 4S2BA 3GVRA 2QV5A 1JVNA 4XD6A 1GT8A 1NWUA 4IGNA 1VBGA 2OYKA 4UQCA 4XZBA 4JEJA 4CD6A 3KHJA 3HJEA 4NX5A 3WD4A 2W62A 4NZ1A 4Q4OA 1OINA 3W2UA 4GNJA 3MKKA 2X42A 1QPOA 3G0SA 4MWAE 3MCMA 1MRAA 3E74A 5BRBA 5DMNA 2YCJA 1GVYA 3GY1A 3W1LA 5CBBA 2GR0A 3T6CA 3EWDA 3RN6A 4PZVA 1JAEA 4KW2A 3M0HA 1XLIA 1KV5A 1H7OA 1E4MM 4XBJA 2NXGA 2PURA 1QI0A 4IJBA 2V69A 3VD7A 2IW0A 3WD0A 3VKDA 5J5RA 2V81A 5A2BA 1W31A 2ZZ5A 3Q2DA 2VR4A 3L23A 3W7DA 4N42A 3N9SA 3P5YA 2VDGA 1R3WA 2XZ9A 4R9XA 2C0AA 5F1VA 4CU8A 3IRSA 5HATA 4EPDC 1XW8A 1ZY9A 2VTFA 3UY8A 4IMDA 3B9JB 1P48A 1W1TA 1OGSA 3W1TA 5DQPA 2DIJA 3FVMA 4RZ4A 4NJKA 4JHOA 3II1A 1RALA 4H9TA 2V6AA 1X96A 3HBLA 3SZ8A 1C9DA 4ACZB 4AZ7A 5HJXA 4ZB2A 5E0CA 3S47A 1TPH1 4MUZA 5AFDA 3S8HA 1ITCA 2Y89A 2F7FA 1ZX9A 4S3GA 3QSTA 3LM3A 5KSWA 1UKOA 5C9UA 2C18A 1WOAA 5EMKA 2WMIA 3WH7A 3GB6A 5TF0A 3AHTA 2C6QA 3W7IA 1LQ2A 3MWCA 1MUMA 4J1OA 3FIGA 2R8WA 3KOYA 4GUIA 2G4FA 3G18A 4PUWA 1TJ0A 1EHNA 2UZ9A 2XVKA 3ZJ7A 1ISYA 3C2RA 1C8QA 4UFIA 5AC4A 5T9BG 1JFHA 1WDSA 1LYXA 1H09A 5HBFA 5I3DA 5HQMA 1HT6A 2ZICA 3ETRB 3IWPA 5FAGA 5C71A 2Z1KA 4XK2A 3FDKA 1TPDA 3OG3A 1F3EA 2CLEA 4ADSA 4E2VA 1N63C 1OB0A 3M43A 3V7PA 3RDKA 3VIGA 3A13A 4DF0A 3B0XA 3WF4A 2Q3OA 3WMLA 2FGZA 3TMLA 3G22A 1BG9A 3JZEA 4G9PA 3TYZA 2A7RA 3TN5A 3WJXA 4NZ4A 3RHGA 3CL8A 2P5NA 2J7EA 5ER0A 3AZSA 3EOLA 5REQB 1W5QA 3GWQA 1RD6A 1PJ9A 5C9ZA 3ATYA 2DSVA 1F61A 4EQSA 3EWZA 3LU2A 2BB0A 5A6MA 3USBA 3GAYA 2HMCA 1XLGA 4L4MA 4QJ5B 4FIQA 1AW2A 4L80A 3M41A 3TTQA 3ITLA 1E5JA 4BV6A 1KFJA 2NV9A 2GJLA 4LAOA 1AH0A 3KLJA 2VDIA 2ZA3A 2WCAA 1FFVC 1UWUA 4RNIA 1XLFA 4TOQA 2Y7FA 1IEIA 5C8BB 2WPEA 2PZNA 4FX9A 4X63A 5CG7A 3OPSA 3WN6A 3NQEA 1CGYA 3OTRA 2AAQA 2VEKA 3KHDA 1EUNA 5A2CA 4QHRA 1X1OA 2OO6A 5G5HB 1H2JA 1TV8A 1I0DA 4JD4A 3ARXA 4M1RA 3C3UA 3W29A 3P80A 1WAUA 3GTFA 5D32A 5I02A 1XD0A 1H63A 3F4CA 3VCNA 4AVNA 4KESA 4PTDA 4ZL1A 1L8PA 4AHOA 2CETA 2YZ5A 2P76A 4M6VA 2E9BA 3W6YA 2YL6A 2VP8A 3VGHA 4UMCA 2VC7A 1GOMA 3WEOA 1VENA 3WY1A 4BCEA 4LYQA 1OYCA 4Y9AA 3T44A 1E4LA 3PTMA 1NELA 3G1RA 1UASA 4ZO9A 1RV8A 2X50A 5CAHA 3T05A 3MV01 5DELA 3OQEA 4MZ8A 3TWBA 1QVBA 4MTVA 4FLQA 4JYEA 2Y5EA 1AQ0A 1YE6A 1F9CA 4QIUA 3MMWA 5LNVA 1TSIA 3IIPA 1TRIA 2POTA 4AX7A 1SFTA 4D6IA 4JY8A 3W7LA 1TYGA 2PC8A 2WVVB 3VE9A 2XUCA 1C92A 3CEUA 3HV9A 3DX5A 4IX2A 1SUXA 3LB8A 1FH8A 3OEXA 1PX3A 1LL7A 4K8EA 2ATMA 2ICSA 3NQ8A 3LRMA 1ZJBA 4WDTA 5A8PA 3M0MA 4X3ZA 1IF2A 4PUKA 5JIPA 1BKSA 4NJGA 3VKJA 1JGMA 1WA3A 3EX3A 1TUFA 1TPWA 1TRDA 1E0WA 3OU8A 4Y9NA 4DM2A 2EPLX 1NPXA 4L4OA 2E9MA 3L12A 4XD3A 5HMEA 1KM1A 2YDAA 1XYZA 3CTLA 4MHBA 4LV4A 3R8HA 3Q94A 3TROA 1M03A 3WO8A 1LUCA 3K5XA 1JXKA 4H01A 1EIXA 3OVGA 3KBJA 6REQA 4V1YA 2P53A 1LRQA 4UMAA 5EMLA 3VM5A 4PSPA 4U31A 3M0JA 1U2YA 3OP2A 4J35A 3TE9A 4LF2A 1PIFA 4Z42C 3QLLA 3HURA 4X2RA 1DXEA 4Y9MA 5CC6A 5AHIA 3DBNA 3I7QA 4NXKA 4GKTA 1SJCA 4HT3A 4UTKA 3GNNA 5A8MA 4GY1A 4HMEA 3ZFHA 1IZKA 5BRPA 1BWVA 2DIKA 4DUWA 3N4EA 2YCIX 1GVQA 2X1UA 2Z00A 4G1NA 1Q13A 2Z1XA 2OQYA 2ZZ2A 4QLJA 3W7KA 4Z2JA 1WO2A 3FVDA 1TB3A 5G2WA 5H2ZA 2HISA 3WK1A 2FHBA 1LVLA 2WHJA 1E0TA 2GSHA 4ASTA 3K46A 4GG9A 4UTTA 1E3ZA 3UZYA 5JBFA 5HJLA 3P93A 3EAOA 1V0MA 4S3FA 1GQLA 1F3TA 1KXHA 4EWJA 4S1FA 4DNHA 2BVDA 2J4GA 2D0FA 2AQWA 2FZMA 3O2LA 4ZQRA 3PBMA 5FEXA 1UWIA 2VOTA 2PDYA 4Q32A 4FNRA 1HKMA 1S3HA 4AIOA 3UYIA 1TWWA 3D0CA 2B4GA 2PPGA 2JE8A 4NAEA 1IEWA 5AECA 3SSJA 4WOZA 3HPSA 4LV9A 1BAGA 4Q8QA 3QC0A 2OCZA 2V68A 4N9DA 2IPWA 1UH2A 3B9OA 4R27A 3GHSA 3EXRA 1N7KA 3F2DA 3A5VA 1YTDA 3Q58A 2VGGA 4DBEA 4GGHA 4NUWA 4XX6A 3OZPA 2NUYA 2QPXA 3UXKA 3A3WA 4RE4A 1ZQ5A 4RDWA 5JRBA 1SGJA 5FJUA 5C6MA 1ZKQA 5FF4A 3ZOAA 4WD0A 4XAPA 1N5XA 4LX4A 5AKQA 3W1NA 3AMKA 3W7RA 1B90A 4D6EA 2DT2A 1FH9A 5EMMA 1GREA 3BLKA 3GNXA 1HW6A 4NAFA 4WXZA 1XISA 1JYXA 2ZQ0A 1QK0A 1OX5A 3DERA 3I3EA 4BK9A 1G67A 4C6BA 2JF7A 4RE3A 3BWWA 5JMUA 3L5LA 4AAJA 4GZ7A 1J0ZA 1I9CB 4LBUA 4RNJA 3URNA 1XQLA 4TU1A 2IPGA 4IGMA 3CZLA 1K9FA 1QBBA 1LOQA 3TCSA 1HIZA 3IJLA 4HB7A 1W9VA 2AL2A 1KRCC 1S5MA 2HQMA 3H24A 5T91A 3SCQA 1DXFA 2QMJA 3BTNA 3PF3A 2BZNA 1D8CA 1IWPA 4MAZA 1A3WA 1UP0A 3KE0A 2YJQA 5LHEA 3VNYA 5DF0A 1EZWA 3W75A 3C2EA 3R10A 3ARTA 4NNAA 1Z41A 4G8TA 3DC0A 4QAIA 4UFMA 3S9IA 1QPNA 4NF7A 1XRVA 1VBUA 2GJNA 3WJZA 2R9RA 4HBKA 1ITXA 3LMZA 1B3WA 2I9UA 4I6VA 3V0SA 3WBWA 3LMYA 3ITOA 2GQWA 2EPKX 4H7ZA 2HVMA 3VC5A 1PV8A 1YXCA 4QSFA 4JEQA 2PRMA 3M0ZA 3W25A 4O1EA 4MIMA 4M8UA 3B8WA 4LA1A 2NLIA 1GJUA 1W91A 4LCRA 3FXYA 1JROA 1JDFA 6XIAA 4GKLA 4KGLA 4V15A 1UUMA 3AWOA 5BRQA 3P14A 3TV8A 4M52A 1ISXA 3N19B 4PA8A 1A80A 2QUMA 2A3HA 1O4UA 1AG1O 3BW2A 1J96A 2VX7A 3PWIA 4Q4KA 4DJED 2JALA 2BOGX 3RLUA 3IC9A 5EMJA 4JQ2A 4XVDA 2WZEA 1L6FA 4PFMA 3CT7A 1BYAA 4MY8A 2QDDA 5AC8A 1XWYA 2Z28A 8XIAA 3EXSA 3KDOA 5KEZA 1REQB 4KWSA 4HKPA 3B9EA 3FYYA 3ICJA 3LN3A 1M3UA 3VIJA 4JIIX 3N2BA 5JH1A 3WLIA 4CUCA 3UFYA 3EX6A 1I2QA 3S1VA 2YVJA 3HV8A 1MSSA 3W7HA 1XFBA 4QNWA 5FEZA 3L65A 1H4PA 1LT8A 3STPA 2VURA 1UUQA 4H7VA 1JXJA 3SQSA 4D6FA 3AAMA 3AUOA 3WG6A 4HOXA 1G4PA 4LY8A 2FJUB 1ONXA 4IUOA 3HGSA 2EKGA 4H9VA 2JBMA 2QPSA 1QDSA 2VOMA 2KAUC 1CPUA 1VRDA 4GFIA 1X2HA 3WLPA 3RXZA 1WBHA 3KOWA 5A8OA 2WQPA 2OLHA 5I24A 3W4RA 1DJIA 5DX7A 2WNZA 4N4PA 4Q8OA 5KMYA 1AD4A 1HUVA 1IHIA 3OLEA 2FIQA 3SB0A 1C29A 2BV9A 1R3SA 1CX9A 2DZUA 2R82A 4IG2B 4HHLA 2DVUA 2VX4A 3DYPA 4GIYA 7A3HA 1SM9A 4LC8A 2XH0A 4JTKA 4DYKA 1OIFA 1J01A 3LA4A 4AB4A 4C6IA 5FJRA 5C55A 1U5VA 1DL3A 2HPMA 4FK9A 2NT1A 5CSYA 5J5DA 3EAUA 2GQAA 3IVTA 2IKGA 3O06A 3S5ZA 2H9AA 3VZYA 4UTIA 3G1YA 3VABA 1A3HA 2W5FA 3KCLA 2D20A 2O9OA 4OJYA 2YGYA 4RZ6A 1OFBA 5CGQA 1EJUC 2GUUA 2FDSA 3BOXA 1E72M 2NPXA 3DH7A 4M6QA 4D72A 2WBKA 3AFBA 3WDQA 4DJDA 1OFQA 4W9TA 3UP8A 4G6CA 4S3EA 3VIIA 3VMNA 4WZHA 9XIMA 4DWDA 3BOFA 2REQA 1NDYA 1PZ0A 3UVAA 1VLIA 1LRNA 4XV0A 1HGYA 4H9MA 2PTYA 1KGUA 1E6XM 4FR6A 2ISSA 1VR6A 4PTMA 4U2ZA 1RCXB 2VQTA 3W76A 4X61A 4DZHA 2DT3A 4X9SA 6A3HA 1XIEA 3CQ0A 2X41A 4AY1A 4OFCA 1OHLA 4TTUA 4F48A 4GVGA 1V02A 3U2EA 3LZ5A 1OD8A 1E4IA 2V5LA 2ZRUA 1R7OA 4PSRA 3LB0A 4WSJA 5HXMA 3UZWA 3CGTA 3VTRA 3UZXA 2YYTA 4JFUA 1ME8A 3AXHA 3LTSA 3VYLA 2WCGA 3EOOA 3RILA 5HNTA 1EX1A 3NYZA 2ZE3A 5DN1A 1KRBC 3EWYA 3L8KA 5G1MA 4YN5A 3NYDA 4QDWA 4B5XA 1NEYA 3NA8A 3DI0A 1EGVA 1VFTA 3Q37A 1UH4A 3MQTA 3E2SA 1EJVC 1HKWA 1WKEA 3S9ZA 1GUVA 2Z0IA 3S2JA 2RAGA 3K8LA 4HNTA 4GQ0A 1RBLA 3CASA 4HNNA 1KKOA 1VB9A 4ZXOA 3OVPA 2VGIA 5M1TA 4CN1A 1Y65A 1KQZA 2X8HA 1JCNA 4XSLA 1H1ZA 1DXIA 5K4ZA 4OV9A 1OEPA 3SCRA 1WE5A 3R0UA 1WDPA 3OYXA 1MEHA 2VC6A 4LCSA 3TZNA 3KBWA 7TAAA 1WDQA 1C90A 1TJ1A 1VBRA 3PS7A 3KBSA 1KM3A 3MVIA 1CGTA 3XINA 3STCA 4JDRA 4UFKA 1VPYA 3BSGA 3BGJA 4KMQA 2YOCA 2PCQA 3LERA 2CFYA 4K8DA 1G1YA 4LBSA 2XN0A 4L61A 4Z2HA 3H55A 3LHWA 1FDJA 2GDUA 3MZNA 4A29A 4B9YA 4UNLA 2OEKA 2PDIA 1CXEA 3N29A 1JUKA 1FWJC 2CHNA 4JTGA 4GD0A 3VZZA 3W1PA 4PGLA 2ZZ7A 2RGLA 1MWOA 3L5OA 3PZUA 3PR2A 2IKHA 1Z3NA 4FPSA 4LB4A 3SSZA 1X97A 5HMFA 3W01A 1FKWA 1UD3A 4DHGA 1XLMA 1A5AA 3IUIA 3TEVA 1VD6A 2ASHA 3M0XA 3MSDA 2VZSA 3GG8A 4AWEA 2CNCA 2ZUUA 4OBRA 4WDUA 2IQDA 3AS1A 3GUWA 3TQVA 1DEDA 2WMIB 4AIUA 4CD8A 3LK6A 2EQ9A 5A94A 4AHPA 4GO8A 1WBJA 3UESA 1Q5MA 4PRRA 1O95A 3LI0A 2QJGA 3G3DA 5HR7A 3GX9A 3T4WA 1UROA 1N60C 1YBQA 3P62A 4W88A 4IPPA 1XI3A 2DZAA 4RE2A 4EPEC 2NVDA 3UPMA 3KWSA 2P3ZA 1XSKA 3WLSA 4JQ1A 4UFHA 2HZGA 4JN6A 5A6SA 1Q66A 3QEZA 3H2OA 1TZZA 4JTSA 4E4PA 3E5PA 1HVQA 2OXNA 3SN1A 4X0NA 4GH1A 1NWSA 4TUFA 5U7SA 4MPQA 4FNTA 1P43A 5KZDA 3A22A 2NQJA 1KGXA 1AMYA 3O6AA 1WZMA 3WQVA 1DORA 1IR1A 1T3QC 3ORWA 2PUZA 2YXXA 3TW6A 3NVTA 2IPJA 3IPWA 2G41A 1GPWA 1EPXA 4DB7A 2YDSA 1XCFA 4RPQA 1DJQA 2D2JA 3W84A 2BS9A 2G3MA 3N12A 4A3HA 4ZFCA 3PJXA 4PMZA 2I57A 1E9IA 4RL3A 4IQEA 3PTDA 1R3QA 3SECA 4FOKA 1W9XA 1XX1A 2G97A 1AD1A 3BC9A 1M7JA 3ARUA 2XYLA 9RUBA 1J79A 1XDLA 5I5RA 2J8TA 3DXIA 3S9YA 4FOUA 5C2CA 2WZHA 4AIEA 2V3BA 3ABQA 1QNRA 3UXIA 3NQGA 2ZX8A 3SRHA 2OLSA 4ONVA 4PMDA 5HANA 5C2GA 1Z8AA 2OMAA 3IJ9A 4EWND 1GW1A 3ARQA 4AWUA 1HF6A 1G7UA 2CXEA 1BQCA 3LHVA 5IOBA 3NUKA 3QVQA 3WH5A 4O0QA 3CGBA 3ARVA 3B03A 4UZUA 2J62A 5ABFA 3STFA 1A5CA 4V33A 4H4TA 1X6NA 3WSUA 1IGSA 1Z6KA 3O6CA 2I5QA 4UWMA 3OIHA 4JCLA 4W8BA 2VNCA 3TVAA 4TX6A 1GRFA 2YIHA 4JX5A 1T8QA 1K4HA 3AIWA 4GUFA 4WUIA 1P7TA 4XVEA 2XIIA 5C9RA 2CZDA 4AQLA 3GAKA 4A2SA 1ZLPA 4C6FA 4WGHA 1KV8A 1YEYA 1UR2A 4JL1A 3UWZA 6ALDA 4GRTA 4NRSA 4CCEA 2YLLA 1J5SA 2E40A 3QTPA 4RV3A 3EUB3 2VEMA 3RR1A 2R1NA 1BTCA 1B9BA 3CMGA 2NX3A 5FJJA 4I3GA 2WBGA 3PAJA 5DCEA 4LF1A 5HMSA 3QOMA 4D8ZA 4UQBA 5I06A 5L6UA 4QDPA 4AD2A 2AQVA 3G8RA 3U2OA 2CC0A 4HCHA 4ZOHB 2DU2A 1J11A 2HS8A 2YCEA 4WKAA 3EOEA 1NSJA 1K9TA 4FXSA 2PWVA 3N13A 3EANA 2B7NA 2XSAA 3AM9A 4J57A 1EB3A 3TWAA 1MW1A 3FJ6A 5AHEA 4YHEA 1JDAA 2QZRA 3AXKA 1U30A 4M82A 2QNEA 2DZTA 4C91A 2PDCA 4AXKA 3DENA 3LV5A 4FZIA 1OQFA 3BOLA 2WKLA 4RUBA 1M9HA 4WRHA 5XIMA 4N9EA 3PUEA 2RKXA 2E68A 1SW7A 3KL3A 3CT2A 2WVSA 4JHMA 3BMXA 2JQXA 1TVNA 3I6TA 2G95A 5I3JA 3AISA 1MXSA 1DJHA 4AU0A 5I3FA 5HQLA 1B5TA 5GPRA 4XZHA 1XKJA 3WYZA 1P0EA 4BQ2A 5DMMA 1UWSA 2PAJA 3T4CA 5FCZA 2OYMA 5HINA 1OD0A 4ZFMA 1VIZA 4NZFA 2ZOXA 4G7EA 1QI4A 3MI2A 2WOIA 2C3CA 1G4EA 3FGCA 3B0YA 5K9CA 4JIQA 3TOPA 5GNZA 3M6YA 1S5WA 1RY8A 5LA0A 2GK1A 2Y1HA 2W91A 4FB7A 2BCPA 3DJGX 5LNRA 1G94A 1A49A 5JUVA 4UTJA 3PULA 1IIHA 1V5XA 3VXGA 2RHGA 4O1DA 1AJZA 3RPTA 5EU9A 5K3VA 1H5YA 1TVPA 1SFJA 3QW4B 1R2RA 4IOTA 3UJFA 1D2KA 3GH7A 5A6LA 1Q6OA 3L4VA 1SO6A 4RDZA 3AYTA 1OGGA 3QMTA 3JVAA 1A5LC 1DJYA 1LL4A 5CC7A 3MYPA 2OZTA 5G2HA 1EH9A 2GWNA 4NAEB 3RX3A 4DELA 3WQEA 3SY5A 3DGHA 4ERAA 1QHPA 1QI3A 1HO1A 3CC1A 1GYNA 3GIYA 3SCSA 3F03K 1CXFA 2YFOA 5HA7A 4JTRA 1YPFA 4Y7EA 4GO9A 2FFCA 1F74A 1PE1A 1PTGA 5IHRA 5JCNA 2P8BA 3QQWA 1Q7QA 1GQIA 2D0GA 3S83A 5CC5A 2WVUA 2G5WA 4IWWA 3VDCA 2XM2A 3GXTA 3GVQA 3TZFA 1T7LA 3R11A 4JBRA 3QJAA 4RZ5A 3T07A 4H4UA 3V35A 5HNRA 1EBGA 2ZIDA 4C1NA 5TAOA 3PBGA 1E55A 2YVFA 3QZ6A 3KP0A 4IX0A 3H2MA 3SBFA 2ZC1A 5HPCA 3AQUA 3NPVA 1RJQA 4J28A 1FY6A 2OSXA 1VHCA 3CUXA 2PDUA 7ENLA 5LXEA 3LGGA 3WL0A 2QDHA 3L68A 1N55A 3C86A 5EPDA 3NO5A 1KFWA 1J12A 1KBBA 4QSHA 4AF0A 4NKCA 4DX3A 1LG2A 1KTCA 4OBTA 4I5RA 2UY4A 1J0YA 2PTDA 5LIYX 4IUGA 4D1IA 2Q01A 1YLVA 2R94A 3A3HA 3QPZA 4IMAA 3CL6A 4CQ8A 4HSOA 3GH4A 3K4WA 4V1XA 1XBZA 3MS8A 3SY8A 1RP9A 4Z2IA 3PSWA 4NYUA 4TVUA 5FS6A 4JX6A 2AL2B 5D8WA 4DEFA 1NOWA 2NVAA 3KVMA 3AN1A 1RSCA 1RXOB 1KM4A 4LCQA 2W61A 4Y9PA 3RRAA 2PBGA 4MPKA 1JCYA 3RCNA 1MEWA 5KZEA 3P0WA 3NL6A 3IS4A 4E3VA 3W07A 1FFUC 3A64A 3F5LA 2HNEA 1ZFJA 1VFMA 3FYPA 1W3NA 1QOPA 3E5BA 3PZNA 1VFOA 1D7YA 4NI3A 1OX6A 3SN4A 1CI1A 4X22A 4A6GA 1HL9A 1ZP4A 1V8EA 3AHVA 1YPIA 5M3WA 2E1DA 2GJRA 3EGJA 1EWEA 1P6WA 1UC5A 3N3MA 4NNCA 4KEZA 7ODCA 3LGEA 2XIBA 4V2XA 3ZS4A 4Z1AA 2CLHA 1MMFA 1QATA 1SVDA 4WX2A 4FF5A 3N1AA 1GRAA 4IIGA 3IJQA 3P84A 3UR5A 1Z9AA 1PDYA 2DH2A 1HG3A 2VX6A 3VX0A 1ZB5A 4F0MA 4P8VA 4AUBA 3CUFA 5EBAA 1DHPA 3KLKA 4AZIA 1CBGA 2BVYA 3TC3A 1TV4A 4AYSA 2X16A 1IWAA 1KFKA 3MUXA 2C1GA 2V30A 3MJMA 3OG2A 4W7UA 3V4BA 3W1MA 5KZMA 4PMUA 4L5ZA 1VBJA 4JZ5A 3TXVA 3C0QA 3B8TA 1UWTA 1TA3A 1UC4A 2RH9A 3A3XA 4ROQA 4JCMA 1Q6GA 4HU3A 3MZ2A 4H4IA 5EFFA 3T0CA 2OB3A 2QJJA 4GYPC 1S7MA 2ZXQA 1UWAA 3WNOA 4JTJA 3THQA 3CK5A 3IJ7A 5AC7A 2ONEA 2ZDRA 2Z2UA 1Z69A 2CLLA 1KWKA 3RPMA 3G1HA 4GCXA 4RXFA 1QK2A 1FOBA 1E6SM 3S4TA 2NSXA 5G4EA 1ZAJA 5JU6A 3VA8A 4KWUA 2XG9A 2R1KA 3NVWB 2CZFA 4GNVA 3PZVA 3TXZA 4EAMA 1UR9A 4OZOA 3IGXA 4TX8A 1HJUA 1RVGA 2MUCA 2R1LA 5K9DA 4ICNA 5G4WA 4Z2LA 4U3CA 2O0TA 1X8FA 1EQPA 1L8NA 3BARA 5CSRA 3IUDA 5KVHA 3HQ1A 1FXPA 2FZBA 5I07A 1IGWA 5CJ5A 1NF7A 2HRWA 3EWUA 4QISA 5I3HA 4NP7A 2ZTJA 3ZSSA 2GR1A 1KXVA 1XHCA 3KUMA 4CCDA 2RGMA 1G6CA 3UPWA 5BMWA 1UKQA 1M7OA 1NM9A 4UFJA 5HJYA 1VEMA 5EKYA 4YL2A 2ZWYA 3PY2A 1KM2A 1H11A 1I2NA 2XM1A 4EXQA 3CH9A 1KKRA 2ZX5A 3URQA 3W88A 3EPMA 4DJFD 1IQ8A 3VD5A 6PTDA 4CVUA 3BSHA 5BMXA 2A5HA 1Q6RA 3QFAA 3RO6A 3ZR5A 1I45A 1PKYA 1CXHA 3HFYA 3SQMA 4XG1A 3MKVA 1Q65A 5H6HA 4CNUA 3RLGA 4FX7A 1US0A 4QRNA 1IEXA 3F4VA 1IIGA 2WYSA 3GM8A 5DBUA 4D8AA 3HTWA 2O9PA 1TPUA 3PP7A 4ML4A 2QIWA 4UTWA 2E6DA 2DPEA 2H9AB 5DMYA 4R33A 3D6NA 2WMKA 1JRBA 4J4KA 1ONWA 3CHVA 3F5KA 4O1BA 1VYSX 4U5KA 3UCCA 4GI6A 1O12A 3U0HA 2OGYA 1JYVA 2BVWA 4MJ4A 4DY1A 4WDWA 3W7JA 1XIHA 4C7FA 1CECA 1YMYA 4GXMA 4Y8EA 5ABGA 3TA6A 4L1WA 4BWLC 2INFA 4WF7A 4H4SA 1CDGA 4H19A 3R0KA 4HPHA 2REQB 1MVYA 3N04A 4P5UA 3KOFA 2B7QA 4Q8PA 2XU2A 3NZ1A 2I5IA 5I77A 3P61A 3RIKA 3S2NA 3SCOA 4PYSA 2HBXA 3H4XA 2YVGA 1GHSA 4O1FA 1MDLA 3R58A 4J3SA 1P6CA 5HWMA 5FIPA 1MOKA 3CU2A 4Q7IA 1D9EA 4PBEA 3ZJ6A 3LHYA 4WVXA 3FHAA 1GOKA 1K9EA 2J7FA 3WD2A 2CW6A 2A6LA 3NQDA 3VD3A 3SAZA 3DESA 1YRRA 4XAYA 5C0QA 4B91A 3TC6A 1CNVA 2OZ8A 2QDEA 3B8IA 5CZSA 4YTTA 3PANA 1JD7A 1DHKA 3BL3A 4WSHA 1A5UA 1V7AA 3T78A 1FHUA 1FTXA 2O4QA 1XSIA 4XZLX 4MB1A 2KX9A 4PUNA 3TQ0A 5K9XA 1WOBA 2NT0A 3BCFA 2NQHA 5BCAA 1R7AA 1W3JA 3T8LA 1I4NA 2V8ZA 2Y8VA 4JTDA 2WANA 3LSCA 3O0KA 1Q2RA 3UXLA 4P61A 2WSKA 2V5BA 3VIMA 2DZXA 1I75A 1LWJA 2XH4A 5JCKA 5EBKA 2W9MA 1ZZMA 1JAKA 3BMWA 5DT5A 3G8EA 4EMWA 3MHGA 2WP5A 3V3WA 2QUVA 1W1PA 4DZIA 1SFLA 2E3ZA 4MDPA 3FY1A 1QTWA 4BEUA 3QGKC 4M5PA 4E2OA 4JTHA 1B54A 2UBPC 3CIVA 4J5NA 3QV6A 2ZZBA 2EQDA 2W67A 3ABOA 1HJVA 1WCGA 1EC8A 1MW3A 3TAOA 4LNCA 4PCNA 1LPFA 1A50A 3ITGA 3QPEA 1OVDA 2BMBA 1BWLA 2C15A 3AHZA 4IXHA 3IK2A 2VWTA 1HO4A 2GSJA 5BWAA 2WNNA 4AZ6A 4BI5A 4EMIA 1SW0A 3S6OA 1XLJA 3LS9A 4B3LA 5CJMA 1EA9C 3S1XA 4JFTA 3NQFA 2OQLA 1ONEA 2NUWA 3QM3A 4UXDA 5CZTA 3TNOA 1DIDA 3TYEA 1Y5VA 2E6FA 2PDMA 1PCWA 4KKXA 3QFBA 2VO5A 1WB0A 5DMLA 3FX4A 4JXCA 1OYBA 2Z1BA 3VIKA 3WIJA 4M51A 4QLKA 2Y7DA 3CBWA 4Z1YA 3O16A 5M03A 4PBGA 4BY3A 4YVPA 3O6DA 2O92A 1SFSA 1V7YA 3B06A 3GYCA 3VNIA 1P1XA 2DVTA 4MB5A 4IIHA 1I60A 3EPNA 3PN8A 3WLRA 5CLTA 1ZAIA 1U83A 2E67A 3CEPA 2Z24A 5AOUA 3WQGA 3PZIA 5LSMA 2BP1A 2QT3A 3R0DA 3VILA 2SFPA 5DEZA 4R7OA 1N8IA 3NSMA 2PU0A 3SEPA 1YBQB 4LVGA 1O1HA 1TELA 3TCEA 4ZO6A 4R3UA 4W5ZA 1GETA 4I7WA 1LQ0A 1AL8A 3M4HA 3OJGA 5G1TA 4K1WA 3CLWA 1KN0A 1A47A 2X2GA 3TYAA 2VCCA 2OJPA 4DJDC 1OFOA 2XVNA 5HMDA 3ZT7A 3E49A 3QMSA 3UU0A 1PWLA 1IWBA 4RW5A 3OODA 4ZQNA 3A12A 3L9CA 3MMTA 3CJPA 3KBNA 4AZCA 3MBFA 3CO4A 4BS0A 4S3KA 2DZVA 3IVSA 3VDHA 1FHDA 2PF8A 1SPQA 3MCNA 1XLAA 2QUTA 3TTOA 2VR5A 2VVNA 3BW3A 4DWSA 4C1LA 3DYOA 4FOJA 4DF2A 4MB4A 3W86A 4LYKA 2IXVA 1CXLA 2GL5A 1WYIA 3AIQA 4YXGA 4KRUA 1SMDA 4R7JA 3BANA 1L6SA 4KWVA 1HL2A 1ZMCA 1J10A 4OWGA 1OJXA 3AU2A 3NG3A 4NSBA 3A23A 3GXPA 4GY7A 4HNOA 4GI4A 3II4A 2W0UA 1XBXA 3BLIA 1SYTA 1EP1A 1SO4A 4RXGA 3N2XA 1KLYA 2V3DA 5JCLA 2V9DA 5BU9A 2TRSA 3POCA 4WHBA 1UR0A 1WNOA 1AZ2A 2JKEA 1SMAA 3BSMA 2PDKA 2W3SA 4YWOA 4EIVA 3U4FA 4QEHA 4YHGA 5CH9A 3UYCA 1X8CA 2OOGA 4PTVA 4Q6JA 1SSGA 3QC3A 4I9AA 3PFRA 4XKMA 2VYOA 4L6DA 5C70A 1E6ZA 1KRMA 4HP5A 1NWTA 1CGXA 4RX0A 3MANA 2CU0A 2QVHA 1UR1A 3HZ3A 3UWWA 5CZ0A 3OC4A 1O66A 4QLLA 4BJHA 2BLEA 3GBDA 4IP7A 1P7TB 4XZNX 4I5UA 4CCZA 1W56A 1XG4A 4M6UA 2W6RA 1GZ1A 2Y63A 1OCBA 2BOEX 1Q8AA 1LF1A 2VL4A 2CXGA 1W3IA 5K4XA 2P0IA 4ATDA 1YDOA 3EWXA 1HKKA 2J75A 3OBAA 2WPBA 2I14A 3OVQA 3B8DA 2GR2A 3SY1A 4IHCA 3EA1A 5FJIA 4ZA0A 1KQYA 3UGVA 3TW7A 2AAAA 3WBXA 4PH6A 1GOXA 4O12A 1ZHAA 1UD2A 3DFSA 3L0NA 2QCDA 1QR7A 3EOSA 1BYBA 2EXOA 3P60A 1B3OA 4DNAA 3H21A 3QOKA 3NOYA 4Y6GA 1BSLA 4ZENA 3T0DA 4WSKA 3VNLA 1VS1A 3LYEA 1VFFA 2QCFA 2X99A 3MSGA 3CGEA 2J7GA 4J40A 3URBA 3P81A 3WENA 3F4WA 5EL1A 3EWBX 3ONCA 1ME9A 1FWFC 4NL1A 4MNKA 4O57A 3BURA 2OEJA 4ZODA 4M7SA 1DKWA 3WELA 3LGDA 3RCYA 4UBPC 2J13A 2QF8A 5DLCA 3DFNA 3A47A 3LCLA 4HN4A 3D3AA 4UNKA 3LZ3A 1LL6A 5FEWA 3M07A 3NNTA 4FX6M 4QQ3A 2X7WA 3WL1A 1RQHA 2QAEA 2WZTA 3HGOA 3LG3A 3SUSA 2NQZA 1FWGC 3SJ3A 3FGCB 5I2UA 4HNLA 4GRSA 1LDCA 3STGA 4TX9A 3QR0A 1FIQB 1JUEA 2PRHA 1K4QA 2IQTA 1W5OA 1F6PA 3DG3A 1TUXA 2GK1B 4MWAC 2EJ1A 5F2MA 1PUDA 1YADA 1X6UA 2VC9A 1W2PA 2YCLA 3SRFA 4O17A 4CQDA 3WMCA 4C1KA 4AC1X 2XGBA 5I03A 3UA4A 3CMFA 3RITA 1VPXA 2HROA 1B9ZA 1CTNA 3W23A 4GHRA 2WHKA 1S39A 5F7UA 1ODZA 2J47A 2E5CA 3VGEA 4GY0A 4KQNA 3I6EA 1JZ3A 2ISWA 2FKPA 2WK2A 4D6DA 3B9NA 4DQWA 5T8GA 4AZBA 3TJLA 1QPQA 5TQLA 3MDWA 2Y24A 1R47A 3LV6A 4A2RA 4P7RA 4H6QA 1Q2SA 3L2LA 2QAFA 2F2KA 3WDPP 2A21A 1SB3B 4NQ1A 2PDNA 2ZUNA 4O28A 4YMZA 1H51A 5CBIA 3C5QA 3TONA 4O54A 4GPNA 1WAWA 3H7VA 3V75A 5LXXA 3D47A 4CD7A 3DGRA 4UOQA 3CXOA 2FZ8A 3NIYA 1GKRA 4EF9A 1GZGA 2G3FA 2OWWA 2ISDA 3I4KA 1EWDA 4ACYA 3GZ3A 5G5GB 2O9TA 3KP1A 4O19A 1M65A 1QPRA 3T55A 5KETA 3OZOA 3RGTA 3RYSA 4WR3A 1P6BA 2I56A 4C1NB 3W1QA 3IV3A 2XPKA 3PNZA 1QI5A 1E43A 1WKDA 4R9OA 2FGBA 3T2QA 4NU7A 3E12A 1NFGA 4PUUA 4M24A 1QO5A 3NFUA 4PODA 3OVRA 3NM1A 2A3EA 2WPGA 3QPYA 1T5AA 4UTUA 7TIMA 4FP1A 3R79A 3MP4A 4PB4A 2GGEA 3WJWA 3IANA 1GESA 5H1WA 5FF2A 3NPXA 2GJPA 5LIUX 5L9FA 3WDRA 4H4YA 4NI8A 3QR1A 3HB9A 3UY7A 3O0HA 1F4AA 3R94A 1B3ZA 5LYRA 2CBVA 1FH7A 2CERA 4HCDA 4QG9A 3N2OA 4M80A 4UC5A 3F2BA 4E8GA 2GQ3A 2XVPA 4LUYA 3KOXA 4S38A 4EVZA 2XIQA 5FF0A 2C3DA 3RO8A 1TPB1 1J8VA 1OSEA 3A4WA 2PB1A 2PRLA 3BZGA 1R30A 4O1AA 4TR9A 1G7VA 1QASA 2OODA 3FAWA 1MRQA 5HUOA 2EEXA 3VNKA 3APGA 3ARZA 4EM4A 1RD5A 5FOOA 4I7UA 4BURA 3U57A 1V03A 3WEZA 3TMQA 2P1FA 1I1WA 2WV8A 1JI2A 2D73A 2DV0A 2QAPA 5XIAA 2JGQA 3LM7A 4ECLA 2QCHA 2PTZA 3E0VA 1FDYA 2A0NA 5DFAA 4UOZA 2PP1A 5IFPA 3C52A 1P0DA 1V3HA 3DG7A 3WLLA 3FN9A 1EFZA 2NWRA 3ERPA 3JW7A 4QAWA 1Q7MA 1V3JA 3CQHA 2BTMA 2X0SA 4JR5A 4FX8A 1C9WA 3NXLA 1TG7A 3SUVA 3N6QA 1SR9A 2UY3A 3MW7A 1EGZA 1CLXA 3PNUA 1PTAA 4PBFA 3VIHA 2WMFA 4LJ3A 4Z0JA 3NR0A 1YNQA 2FMOA 4GJIA 3TDFA 4FXFA 1KWGA 1T0OA 4G7FA 1GKQA 1HP5A 1FCBA 4AVFA 1OM0A 5A3HA 3VINA 4OV4A 5CPQA 1K9DA 1SQ7A 3SJNA 3EOUA 3GD4A 1TA3B 3I4EA 4ZSTA 2ZWZA 1E71M 3L21A 4JL2A 3DUGA 1OCNA 4DI9A 3WMBA 1W37A 4WIWA 2F5ZA 1GVSA 1UKSA 3ZR6A 4XTIA 1IE7C 4EXBA 1V02E 2IQ0A 1FO4A 1N8FA 4A8NA 1A5MC 4HYWA 4HHMA 3ITYA 1VAHA 1AJ0A 3EKLA 1QW9A 3GDBA 3VIPA 5AB3A 2JKAA 2DSKA 2FVLA 1AL7A 4J3VA 4NZ5A 2YXGA 1MDRA 3C2VA 2ISFA 4X2PA 1Q6CA 1PEZA 1TX0A 3RX2A 4DLMA 1UIOA 3VDAA 5HOSA 4O4WA 2QGYA 3CPUA 4UR9A 3NQ2A 3O05A 4J27A 1SJBA 5A1AA 2FB3A 4BQ4A 3N9RA 3ABXA 1GHRA 2QJHA 4MFDA 4EANA 3N2TA 4O10A 2YL8A 5LNUA 3CZJA 1EX5A 3RLVA 2W4XA 3DFQA 4XIMA 2EPHA 3M0IA 3TSBA 2QVNA 2YBVA 1R9XA 3T81A 3L2MA 3ONBA 3UZZA 4NHVA 4R34A 2QDGA 2WAGA 1J0KA 2FMNA 2YPIA 1Z44A 2WPCA 2EBNA 3FSUA 3W0KA 4Z0SA 3WKZA 3H22A 4P8UA 4RV8A 3UZJA 2Q6ZA 3GYEA 5GNXA 4AEEA 3P7YA 4UIOA 3UWQA 4S3AA 4WCJA 1VYRA 1A5KC 3S2CA 1FP8A 1MNSA 4PRWA 3RU6A 2VFIA 1W9DM 1HX0A 1XLLA 2WHLA 5E09A 5DCBA 4QE4A 3Q6JA 1BYCA 1XLCA 3HQNA 4NASA 2GPTA 4Q6XA 1B57A 2WMJA 3CB8A 1EP3A 4CN4A 2C71A 4A3QA 1XPGA 3GNRA 1I2RA 3W2LA 4MDOA 3KBMA 3R25A 2X05A 3DECA 3LQGA 4H2HA 4D8LA 1YKWA 1KM0A 1Z7AA 2HSAA 1R86A 4JFSA 1NHQA 2ABAA 3NQ7A 5JXQA 1V3MA 2GH5A 3RX4A 2Y7EA 2FYMA 3RG6A 2X30A 1IZJA 2PLKA 2EG7A 1N8WA 3NS1B 1HKJA 4KFNA 1FFQA 4ZB5A 3N4FA 4HGXA 4YIWA 2FPTA 3KEHA 1K8CA 4KGJA 1HGWA 4DBDA 2YZRA 1Y5WA 3BLEA 3PZTA 3MWAA 4BF5A 5K2ZA 3RUBL 5BXPA 2AAMA 2AKZA 4C65A 4AEFA 4K7YA 1GZJA 4NXSA 2ZRXA 4AWSA 3L2IA 4E2BA 5I3IA 1BFNA 4XISA 1G0CA 4OKDA 3DIPA 3VFCA 1UCWA 1K3UA 3BGGA 2QMKA 3SCWA 2XFWA 5CSUA 1EDQA 2RABA 1Q1WA 3GIPA 2W79A 4O0ZA 3HF3A 4ILSA 3PZOA 5DT7A 4ZQCA 2OYLA 2QUNA 1UR4A 1VH7A 2BY1A 4IQLA 1ZUAX 2EGZA 2QGHA 3K8MA 1FWSA 1JZ2A 2OLAA 4CNPA 3QY8A 1U5HA 2DW7A 5CPTA 2PI6A 3CAVA 1EPVA 1QHOA 2CLPA 4DZAA 2WOWA 1ZTVA 3A21A 1JPKA 3ZQ9A 3FDGA 3AHXA 4IXXA 1VGAA 2EQ7A 1SZGA 4LAZA 4UTHA 1CGVA 1B4EA 4IMCA 1K8ZA 4LUTA 2BGSA 4QE1A 4RDVA 1RBAA 4BEQA 3S2MA 2WJDA 5LA1A 1HTIA 4KPRA 1RLCL 4NT0A 4GVFA 1UH3A 2BVTA 1EL3A 4A05A 4AH7A 4JTUA 4TVCA 4G56A 4DJFA 4O0KA 1C8YA 2ZKMX 3EA2A 1TO3A 2G4JA 3K1DA 1QAPA 3FEQA 2V67A 1L6WA 2OOFA 1IT7A 3VUSA 4QX4A 3STEA 1TX2A 3HIJA 1WX0A 3KWXA 2E0PA 4PEEA 5AC5A 3NPWA 3S46A 4UTMA 1UOKA 2E6YA 1FKXA 4ERGA 3AXXA 2WSYA 3DHPA 5M17A 1TWZA 3KCJA 5DCDA 3UW6A 3GDMA 4MGGA 1C7SA 2QR6A 2DFAA 3MUCA 1AQFA 2NZLA 1PAMA 3I68A 3CMJA 1YXDA 4S3CA 3ZT6A 2WJZA 3VAVA 1RR2A 1V4YA 4KEVA 3CGDA 2BC0A 1DIEA 2J25A 3WUBA 3WNNA 2GJXA 3GXFA 1C3FA 1NH6A 5LGZA 5JBDA 3HRDC 2W54A 2DZBA 1MO0A 3VPLA 2XIOA 3L4TA 1TMHA 3DG6A 1BGAA 3BICA 4KIEA 2P10A 3A5FA 1VRXA 1H41A 2Q8ZA 3IVUA 1TJ2A 5LHFA 2PWUA 4EX4A 2YR1A 4I9JA 3LDVA 4FAMA 4CU7A 4ERIA 1PL9A 1UWQA 2O56A 3LRKA 3MBDA 1ITUA 3DDMA 1YHTA 2QCLA 4PR4A 2F38A 1R87A 1KFBA 2WLYA 1UD4A 3BG5A 3SRKA 2FZ9A 4UTWC 3ZYZA 5KZ6A 1JQVA 1YTEA 4NYYA 5BOOA 3B40A 1YX1A 2O55A 2PGEA 4XZ9A 3LPOA 4UR8A 4HOZA 3OOQA 3CUZA 3RM8A 3EZ4A 5DRIA 1K7XA 6XIMA 4AVOA 3L4UA 4DJEC 3VNMA 1M41A 5I0DA 2WOVA 1BEUA 3ITVA 3EDJA 2YCKX 4NZJA 3A6OA 4B5UA 5KTLA 2WCSA 1XICA 4HU8A 1GJWA 2OSWA 1V3KA 3PBVA 2UY2A 1LJYA 3E2VA 3TN6A 1TPC1 1QUMA 4AZCB 1XSJA 2L5HA 4H6RA 4MOZA 1XLBA 2WHMA 2BXVA 3CPRA 4Y2WA 2XHYA 4AX6A 3VNJA 3EDFA 4F2TA 4DWSB 4O11A 2EPOA 1AFSA 3WDJA 2CKRA 4PTXA 4W85A 3E38A 1WXJA 1QNQA 5SWUA 3T2PA 3L4ZA 1VEPA 3KS5A 2GGIA 5CXPA 1PX4A 5F4SA 2DUXA 4M1BA 1ENUA 1S38A 3PM6A 3TUUA 3RLHA 1GVEA 1PXGA 2X0HA 1THFD 4CVWA 1UA7A 4AYGA 2QCEA 5JVLA 4WKFA 1GK8A 4H4ZA 1O6IA 1E9ZB 4D71A 4ML9A 4YYFA 4GYFA 3O63A 3NDZA 2C3ZA 5AZ0A 3KVLA 2EPNA 3EPOA 4WOQA 1KD0A 3DAQA 2WBAA 4Q4MA 5D37A 5KITA 1GV4A 1TJRA 1E0UA 2OO0A 3ZO9A 1TR1A 5U4NA 3H4WA 2VENA 4ORIA 1OFPA 3E02A 2Y6ZA 3M5XA 3C8FA 1TV5A 1YNPA 1PTDA 3RF9A 1Z32X 1UB3A 3HG4A 5FD0A 2H8XA 4DIAA 3TQKA 2GOKA 1OG0A 1W54A 3BK0A 1NARA 2FJKA 3FEMA 1ZNNA 3IAQA 2C0HA 4JDBA 1MW2A 1FWHC 3BAIA 4ADWA 4C6QA 2PD9A 3YPIA 4LS2A 1FVPA 4QCFA 4GE8A 4I90A 3PSVA 1K1DA 3QBUA 4IPJA 3MHUA 1AMKA 3HFTA 1J93A 4K68A 5D2YA 2HS6A 3I65A 3VE7A 4YCOA 2ZXBA 4JKLA 1B2YA 1YTKA 2BWGA 3GH5A 2X7VA 3SADA 1JZ6A 3FK4A 1TCDA 1GEHA 5AZ1A 1XIGA 3T40A 4ZO7A 2E3TA 2ZZCA 4W93A 2VEPA 4HIBA 4PUMA 1OC6A 3W26A 3SQPA 4XUGA 2VD9A 2YA2A 1LP6A 2AKMA 2QS8A 3VVGA 2OT1A 2DGAA 3EDKA 3SGUA 2CKSA 4DYJA 3V1PA 3C8NA 4EPKA 3UNTA 1V3LA 1J5TA 1GG0A 4HNUA 4Q4RA 1AH3A 3SW6A 3LCHA 4L1XA 2QCDB 1DQUA 2FPYA 3ECQA 3ENLA 4FIRA 1QWKA 3KL5A 1YQZA 3TR9A 3IJ6A 1Z48A 2ZC8A 4LPCA 4ES4A 2JF6A 1XF0A 3C0JA 5CAKA 4WJXA 1ECQA 3HQOA 2CDUA 1UWRA 1EHAA 1JG9A 1BVZA 3LTYA 3W7EA 1MW0A 4F8XA 3HM7A 4C6DA 5EY5A 4GUGA 3IIZA 4W89A 4H83A 1KC7A 3ZR4A 4B15A 4HOWA 3WBYA 1JCLA 1ITQA 2XN1A 4R5EA 1E51A 5BROA 4GXWA 2I1OA 1XYCA 4U3AA 1JL8A 2VZOA 1GOOA 2CLMA 3EB4A 1Q4NX 4JYFA 4C7GA 2YYUA 3USZA 5E70A 5I23A 1XYBA 1ISVA 2GGHA 3QKEA 3HMCA 2WO5A 4K7ZA 5HQEA 1NU5A 1H62A 3T8QA 3QYQA 5F2LA 1XBVA 1UMYA 5U1OA 4J3XA 3CZGA 2QKFA 2UWFA 4FLOA 3B05A 2Q8LA 1SZNA 1CWYA 1QNPA 1LG1A 4YCPA 4HU0A 2DQWA 2NQ9A 1PKLA 2A4AA 4Q4PA 5LZLA 1YPXA 1XGDA 3DH9A 2D22A 2YCLB 1H7WA 4IIDA 1C8XA 5BNKA 1JCJA 2CEQA 3FAXA 1YQ2A 3WQFA 4LQ1A 5AHLA 1LROA 1FWCC 3NRZB 3U7BA 1MI3A 2WWDA 4JIRA 3HU7A 2LLEA 3DK4A 2PDXA 2QQ6A 3QV8A 1GRGA 1A5OC 4AHQA 2D24A 3K4AA 4PUJA 3WK0A 1TYTA 3SRDA 1UHVA 4HYVA 1NVMA 2OKTA 1YW1A 3CNYA 5IDIA 4LB3A 3GTHA 4U28A 4UTLA 5IDZA 4ICMA 1QXLA 2HJPA 2BXZA 1R3RA 4PMOA 4UTFA 1E6NA 3ARSA 4BQ5A 2ZZ4A 4N2YA 1W32A 3LHTA 1S2AA 3UR8A 3OLGA 3URHA 2JFEX 3E2RA 3NVZB 2C1IA 2XDFA 1YDYA 3VU2A 3QLDA 2J8GA 3S5YA 1K7EA 3OB8A 3KRBA 4OOUA 4B5NA 1HVXA 1YDVA 2W0HA 1XIDA 2WNQA 4A35A 3BJFA 3QW3A 2ZX9A 4FLSA 1BWKA 4C5ZA 4MF4A 4DBUA 1W17A 4O15A 1FFRA 3GDTA 5AHMA 2TMDA 1V79A 1BWCA 1T6MA 5KVIA 3RNDA 2PWHA 1M7PA 3GG7A 4U2YA 1K4GA 3EA3A 3XIMA 3HPFA 3QHOA 2Z2BA 1DV7A 4H50A 3P2VA 1LOSA 4P8XA 4ZR8A 2PLMA 5G4HC 1DNCA 4Q8MA 3NL2A 1TIWA 1BTMA 3P0XA 3LBCA 1R2SA 4JGDA 1G01A 2CWNA 4QS6A 3W7GA