3U9IA

The crystal structure of mandelate racemase/muconate lactonizing enzyme from roseiflexus sp.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
366
structure length
346
Chain Sequence
TAPTTIRALTVAPLDIPLHEVARNLLVAVELTDGTRGYGEAAPFPAFNGETQDMAHAAILAARSLVEGADVREWRRIALALPALPGMTGSARCAIETAILDALTRRARLPLWAFFGGAATSLETDVTITVTAAARAAQAIVARGVTTIKIKIGTIRTMEHDLARIVAIRDVAPTARLILDGNCGYTAPDALRLLDMLGVHGIVPALFEQPVAKDDEEGLRRLTATRRVPVAADESVASATDAARLARNAAVDVLNIKLMKCGIVEALDIAAIARTAGLHLMIGGMVESLLAMTVSACFAAGQGGFRFVDLDTPLFLAENPFDGGMTYHGGTIDLTLIEAGHGVTPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme, C-terminal d
publication title The crystal structure of Mandelate racemase/muconate lactonizing enzyme from Roseiflexus sp.
rcsb
source organism Roseiflexus sp. rs-1
molecule tags Isomerase
total genus 109
structure length 346
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3u9iA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3u9iA01
3IJLA 1TZZA 3GC2A 1XPYA 2XGZA 4DXKA 4DX3A 1YEYA 1EC7A 3DESA 3U4FA 4DWDA 4ENLA 2PA6A 3R11A 1SJAA 3CT2A 3H7VA 2GGGA 2P8CA 1KD0A 2QJJA 4DYEA 3VA8A 2HZGA 3KUMA 1P48A 3GD6A 1KKRA 1OEPA 2XSXA 4H2HA 3STPA 1E9IA 3OPSA 3P93A 2PODA 3R1ZA 3SQSA 3I6EA 3CAWA 3H70A 1XS2A 2PGWA 3DGBA 4H83A 3DERA 3CB3A 4KPLA 3SBFA 3T9PA 2PTYA 1P43A 3NFUA 1EC8A 3EEZA 2I5QA 4Z1YA 2OQYA 4JN8A 3UCCA 4KEMA 3ZVHA 3JW7A 3PWGA 2PSNA 3NO1A 3T4WA 3TWBA 3T8QA 3OP2A 3V3WA 2NQLA 3UJRA 2QJMA 3N4EA 1MNSA 3TCSA 3Q45A 2OG9A 4GGBA 3I4KA 3OW1A 3R10A 2PTWA 2HNEA 2OPJA 3OZYA 4JN7A 2XH2A 3QKEA 2RDXA 4H1ZA 2PP3A 1FHUA 1RVKA 1L8PA 3UJSA 4E6MA 4G8TA 1NU5A 3UXLA 1MDRA 1MUCA 3EKGA 1TKKA 5FJUA 2P88A 3RGTA 3FV9A 3FVDA 1FHVA 4A35A 4F4RA 2CHRA 2FKPA 4KWSA 3H12A 3CYJA 3I6TA 4X2PA 4EWJA 2P3ZA 4GIRA 4IT1A 4J3ZA 5ENLA 3JZUA 3UXKA 2ZC8A 4FP1A 3ZLHA 5IDZA 4DHGA 3FXGA 1ECQA 5FJTA 3RITA 3DFHA 5FJPA 1F9CA 1MDLA 3VFCA 4GMEA 5EU9A 3K1GA 3V5CA 1PDZA 3N6JA 4GISA 2DW7A 2AKZA 3OTRA 1JPDX 3D47A 4FI4A 1WUEA 4HNLA 3B97A 3P0WA 3SN0A 4J1OA 3RR1A 1NELA 2OLAA 4Z17A 4JHMA 4HN8A 3PK7A 3JVAA 4K8GA 3FJ4A 4GYPC 3UJ2A 3BJSA 3QLDA 4E8GA 5BOEA 2XH0A 3CXOA 3RRAA 4M0XA 2GDQA 2PP0A 4DN1A 2OX4A 4IZGA 2QGYA 3UGVA 1SJDA 2OKTA 3SN1A 2PGEA 3MZNA 3GO2A 4IP5A 3ZVHB 1DTNA 1R0MA 3MWCA 3GY1A 2PCEA 2OVLA 4ZA0A 3V4BA 3MUCA 3ZLFA 2AL1A 3UCDA 1SJCA 4HYRA 5J04A 2OZ8A 3DG7A 3SN4A 3P3BA 1BKHA 3S5SA 1TE6A 2P0IA 3D46A 2GSHA 2FYMA 4ZCWA 3NZGA 4GYPA 2QVHA 3ZLGA 4MMWA 3OZMA 5FJRA 1JPMA 3RO6A 4A3RA 2GL5A 2ONEA 3ES7A 3IJQA 4E5TA 3TW9A 2O56A 2DW6A 4IP4A 3DIPA 7ENLA 3BSMA 1R6WA 2AL2A 3THUA 4ROPA 3VDGA 2GGHA 1EC9A 3TOYA 2GGJA 3DDMA 2PTZA 2MUCA 4IL2A 1PDYA 3TTEA 3R0UA 2OQHA 1MRAA 3ZVIA 3CK5A 2GGIA 2AL2B 2QJNA 3TJ4A 2XH7A 3QPEA 5BOFA 3TQPA 3VCNA 2MNRA 3VCCA 3IK4A 3NXLA 3DG3A 2ZADA 2XH4A 4HCHA 3RCYA 3R0KA 3N4FA 3BOXA 4IL0A 3U9IA 1JCTA 1W6TA 4HCLA 3TWAA 3SJNA 2OFJA 3Q4DA 4GGHA 1EBGA 3HPFA 3IJIA 3PFRA 3ES8A 2HXTA 4MKSA 3DG6A 3H8AA 1ONEA 4K2SA 2PU1A 2PPGA 3S47A 4M6UA 2OO6A 3FCPA 3MY9A 2PMQA 3V5FA 1BQGA 3DFYA 3N6HA 4MGGA 1ELSA 3VC5A 2P8BA 3MKCA 1KKOA 4GFIA 3MQTA 2OZ3A 1KCZA 3FYYA 4A6GA 4K1WA 4YWSA 2GGEA 2AKMA 2PS2A 4HNCA 2PTXA 2POZA 2QDEA 3PWIA 4E4UA 2HXUA 3QN3A 4KT2A 2PP1A 5FJOA 3QTPA 4G7FA 4E4FA 1IYXA 2QDDA 3R25A 4IHCA 3ENLA 4H19A 1EBHA 1JDFA 3DEQA 2OZTA 3UJEA 3VC6A 2QQ6A 3MSYA 6ENLA 3T6CA 4HCDA 2PU0A 3SSZA 4HPNA 1WUFA 1SJBA 3UJFA 3TJIA
chains in the Genus database with same CATH superfamily
3RM8A 2P76A 2ISVA 2GWNA 2HEJA 3VOIA 2ISWA 2XGZA 3EPNA 1GXFA 1R3WA 2XJ7A 1YEYA 3ARPA 1WNOA 1QFEA 3PVFA 4FSAA 1ZP3A 3TTYA 1T41A 3KL5A 4MWAD 3HF3A 4YTQA 1PSCA 1B4EA 1KGXA 1W1TA 4RPQA 3LB8A 1O4UA 3F5JA 3WLLA 2CLEA 5IRPA 3L5AA 1M1BA 1EBDA 3DFOA 3CWOX 2E6DA 3AU6A 2QPSA 4Q4MA 4LF2A 1HKWA 4NYUA 4KFOA 5CGQA 3S1UA 1UZ1A 3DH7A 2G8ZA 3KLJA 4NAFB 3T9PA 5DMNA 3TLLA 3CV2A 5D38A 2J79A 3SUVA 4JTLA 1Q3NA 5DLCA 3VKJA 3G3MA 3G1FA 2F6UA 4HZ6A 2A7NA 2CBVA 3NO1A 4LVFA 4ERGA 3PJWA 5BU6A 3PUGA 1BSIA 4NI3A 4J27A 4BS0A 3UJRA 4DJEA 4LWWA 1CWYA 1Q6QA 3NJ3A 2IW0A 3CQKA 1GKRA 1UPMB 3PTKA 2PEVA 4DNAA 4LB3A 1XCXA 3CMJA 3R10A 3P2VA 1BF2A 4MB5A 1D3CA 1W3HA 3B9EA 4AC7C 3KEHA 3R79A 3H55A 4KCVA 4LAMA 2DSKA 4JTSA 4UFJA 1A3HA 1F4HA 2TPSA 2CLKA 1QNPA 1SFLA 3UXLA 4EMIA 1K7XA 1XFCA 4AZGA 5E9AA 3W2LA 5LZLA 2IKGA 1J01A 3VMOA 4N9EA 5A8QA 3N11A 1VYRA 3B9DA 3IEBA 4WEVX 3H12A 5CBBA 4AF0B 2IPJA 8CGTA 3FGCA 4IFRA 3AALA 2JE8A 4D71A 1Q13A 2ZC8A 3OLEA 3MSDA 2EQ6A 4WKFA 5A6AA 3FA4A 4Y6GA 4HU8A 3U2OA 3F5KA 4LUJA 3P14A 3WDIA 3VIMA 3DFHA 1S3HA 2XDFA 4WRHA 1GOMA 5H2ZA 3N6JA 5CJMA 1L0PA 3IJ8A 3F5LA 3B8WA 3VD9A 4ZO8A 2V3FA 5EKYA 5D32A 1VFLA 2O7QA 1ZAJA 5LIKX 4X22A 1OK4A 4W9TA 3W1NA 4H4IA 1R3TA 1TJ0A 5A2AA 4KRTA 3DBPA 6TIMA 2INFA 2XH0A 1KFWA 2J8FA 3EMCA 5DBTA 3RRAA 3A22A 1Z41A 4NX5A 2G3NA 4JTDA 1TFVA 1UR8A 1OFPA 1SO6A 4GUHA 3W83A 1H1YA 3WNKA 5AYBA 2V82A 3QV7A 4HPHA 3I7SA 1GEQA 1VFSA 1H1ZA 3AIVA 3NSNA 4NG3A 3IIXA 3PANA 4H4WA 5JQ9A 2VR5A 3B3DA 4B3KA 5REQA 1BF6A 1MXGA 2NUXA 1HVXA 2ZUWA 1RPKA 4XIAA 1TRIA 1Z44A 4W93A 1OF6A 1W17A 4K7YA 4QM1A 2D73A 4FNRA 4TTGA 3IGXA 4L80A 2CIPA 5G2IA 3KDNA 1D8CA 2OLSA 1H7WA 4IXXA 3TFXA 2YCIX 2J7FA 3OZMA 4L64A 5C70A 5FJRA 3GIPA 4UTWA 1ICSA 2ASHA 1TWDA 1JQXA 1OFOA 3TW9A 2CZ5A 1O1ZA 4PFHA 3LZ5A 1LRNA 3T09A 3LY0A 2XZ7A 1B90A 4U31A 4IICA 4LOCA 3L67A 5FEXA 4OFCA 1YQ2A 3IV8A 3UG3A 4NEWA 2A79A 4EXAA 3P62A 4Z2JA 5JIPA 1PDYA 4ZB5A 1W5OA 5D8ZA 1TTQA 1WBJA 2DVXA 4FNSA 4AY1A 1WZAA 5GJPA 4XVDA 1JFHA 1MYRA 1WA3A 1Q6GA 4OVXA 5A6TC 3E0IA 1VBHA 4LYPA 3PG8A 4RDZA 3TNBA 3W84A 5FMHA 2V5DA 4O28A 3UZJA 3W1QA 3N2MA 5CC6A 1JAEA 3IS4A 3VABA 2G4FA 1A5UA 1YXDA 2YXXA 1QASA 3EAOA 3B4YA 3QH2A 4F79A 4AD4A 4UQDA 3QGAC 3EUB3 2ZRVA 3EWZA 2IKHA 4OTKA 3VXGA 2IS7A 2WOWA 2WC4A 4Q33A 4YMZA 4DQWA 1FDZA 3CUFA 3FCPA 5HJXA 2AAQA 4I8DA 3BCFA 4EQRA 3V5FA 1BQGA 2JKEA 4B5VA 3PAJA 2BGQA 4Z1BA 1E9LA 3WJZA 1Q6FA 4Z1AA 4O8RA 2A3LA 3MKCA 3GDBA 4RW3A 2DZVA 3CS2A 2D2OA 3S2MA 4DUOA 1EOMA 4G1KA 3TONA 1W3KA 4PZVA 4RJEA 1FBAA 2QDDA 1S1PA 3N2TA 3G1RA 5I3DA 3U5YA 1F6YA 2NQHA 2PRLA 2V5LA 1G0CA 3M7SA 4LUYA 2C8NA 1TWZA 2NZLA 1B3ZA 1B3OA 3WJYA 5MHBA 2WC3A 5HNNA 3SB0A 3W7KA 1KV5A 4M6VA 4B2DD 2PUZA 1S38A 1KFKA 2A6NA 4UTTA 3CH9A 1FDJA 1F74A 4ZENA 3CT2A 2YX0A 4M6PA 4IMGA 4XTDA 1RAKA 5AYZA 2RH9A 4KEZA 1KD0A 4DYEA 3LLFA 4DNMA 3BPWA 2XSXA 3BK0A 2A7PA 3BUVA 2ZZ1A 1E9IA 4H4ZA 4AUBA 2ZVIA 2CEQA 3C61A 1OYAA 3LM3A 2NXGA 1UQYA 2A3HA 2EXOA 2J7GA 4XD4A 3QZAA 4IUGA 3KCOA 3MHGA 3VVGA 3G0XA 4K6AA 5A8GA 2J8TA 4L1XA 4BQ4A 3POHA 3W7CA 4XO6A 5FF7A 2X0SA 4HJFA 3WH9A 3PPCA 3NURA 5FIPA 1FWHC 4BQ2A 5KVIA 1C8XA 1JCJA 1Q6CA 1EP3A 1F6PA 4WGXA 2X99A 4CN1A 1GRBA 5EMYA 3BG9A 5KVHA 2NQLA 3MCOA 3BANA 1TR9A 1N62C 2CLOA 4LS1A 3EAUA 4MJ2A 2WZIA 3ME3A 2WHMA 2WMGA 2PTWA 4I5UA 4FEZA 3N1AA 2OPJA 3RLGA 5DMLA 2J74A 1ZSXA 2YCJA 1KBKA 1LVLA 2Y5JA 2O7SA 1QRQA 3VKBA 3N9KA 1UD5A 4GUJA 2XIOA 1WDQA 2GVGA 2D3NA 3CU2A 1BTCA 1CGUA 2YXGA 3BMXA 1FA2A 1MUCA 3NIYA 1UIOA 3KBNA 3UESA 5DCBA 1ZGDA 3PNZA 2YVFA 3LCIA 1NHSA 3TYZA 3EDFA 4PN2A 2ZX9A 3TAOA 5I09A 2GZXA 3RFAA 3DGZA 4PH6A 1EH9A 4DWSD 3STFA 2CBUA 2RDWA 4DZHA 5DO8A 1V93A 5CZ0A 3OVPA 1SW0A 1R2RA 4RZBA 1KGUA 3B0YA 4U33A 1WKFA 2ZZ4A 4AZ7A 3TIMA 3CQ0A 5FJPA 3MANA 4AZCB 3VFCA 3NZ1A 4PMOA 3W00A 3P5ZA 4W86A 5I5RA 2AKZA 3BCDA 1IXQA 3AAMA 4K36A 1ZY9A 4Z17A 1ZHAA 2INZA 3TKFA 4IJRA 1GTEA 1C9DA 1HO1A 5A69A 5AVNA 4FLRA 4ICNA 4JL1A 3M64A 4ECLA 1PKNA 1MEWA 5FAJA 4NILA 4ZXOA 2GQWA 1CGVA 2G50A 1PX4A 3QGKC 1E5NA 2WMJA 4HYWA 3HGSA 3CMGA 3E0VA 5HBFA 3ABOA 3UGVA 4O16A 2GH5A 3VM7A 2UV8G 2X50A 4GRTA 5CH9A 4TVDA 4MJZA 2ZWYA 5CPSA 3HIJA 3A5VA 5DELA 2EG6A 5JU6A 2OQLA 1UHVA 4IP5A 3LNMA 5LGZA 1CXKA 1CGWA 3URNA 3S2NA 2ZZ3A 3ETRB 2VOTA 3BDKA 2VWTA 3RMJA 5A8MA 1KBLA 5AHEA 1X38A 4RX0A 2GUUA 2Y7EA 4QE5A 1H7NA 3QJAA 4JDRA 3T78A 1UPPA 5CPMA 1AMYA 3GFXA 2V2CA 1YE4A 3S5SA 2HVMA 3W7MA 1DJWA 1YNQA 2WOQA 3KBMA 1W1PA 1EXBA 4UXDA 3WLNA 3ATZA 2P5NA 4RKAA 3VD5A 1HP5A 2EJAA 1GRHA 1QOQA 3SURA 3ES7A 4I9TA 2G96A 3VIGA 2FIQA 3S6OA 4OOUA 1S2TA 3A13A 5JCNA 1DL3A 3G1VA 5F1VA 5F4XA 1FWTA 4RE2A 2DFAA 3PJXA 3G1XA 4GZ7A 2BY2A 3LBOA 2YFOA 3P0XA 2D20A 3TOYA 3QVQA 3DDMA 1IZJA 1UC5A 2G41A 1SGJA 4I7WA 1KXHA 3FHAA 3WQVA 1ML1A 3W7EA 4O15A 1UASA 2HK1A 3GVQA 3P74A 3N2XA 1XGZA 3CK5A 2GGIA 2XIBA 3E1F1 3HV8A 2HVOA 5D9NA 2W9MA 3SSJA 2YL9A 1XCWA 5MKGA 3A4WA 3VCCA 2XVKA 3MHFA 1QVBA 2XH4A 1V02A 1AJ2A 1ZUAX 3G1SA 1JEZA 3N4FA 4S23A 5HPOA 4DZ5A 1ZU8A 4QHRA 3B8VA 2HNHA 5C7VA 1Z7AA 2VD9A 2WCGA 1A0EA 4HVXA 5CSRA 4LT9A 5GJNA 2XIQA 4WDTA 4GVHA 5A6LA 5EYWA 1E4NA 4O19A 4N42A 2DVTA 1GT8A 1Q8JA 2PF8A 1R30A 4GJJA 4M6UA 5XINA 5D30A 4K7VA 3C8FA 1OADA 4D8ZA 2CW6A 3MY9A 4JKLA 2TPRA 1D7KA 2EEXA 1EWDA 4AYSA 3WF4A 3QOKA 1X2GA 1K9FA 2WV8A 3W82A 2FZ9A 3PZGA 1KKOA 5BNKA 4N9CA 1VC4A 4KEVA 3ZWTA 3PAOA 3EMZA 4W8LA 5REQB 2IQTA 1RPXA 2QDHA 1MW3A 1XRFA 3IAQA 3L2LA 3GFYA 3CGBA 2E09A 1R5YA 3K4AA 3EDKA 2G3JA 1GETA 1W2PA 2FFIA 2VFHA 2Z00A 3UJEA 3VC6A 1GTHA 3WD1A 4LVBA 2PU0A 3KAOA 4YNGA 3G3DA 5EMLA 1MFUA 3TTQA 2FVKA 3WNOA 3JU2A 4JXCA 2Z28A 3PB2A 3F2BA 4GXPA 2BHUA 5E6ZA 4FNQA 3AMDA 3GU9A 2DQWA 3P61A 3GXDA 3SCSA 2FTWA 4Q6JA 3MVTA 3P6LA 3P93A 2WBKA 4P8XA 3UFYA 1I60A 3MBFA 2Q09A 4MWAE 2VVSA 4I9MA 4NY2A 3W81A 1UBPC 1UR1A 4N6FA 1P43A 3CZGA 3HQNA 1GCYA 4ERIA 4UNKA 4EPBC 4H4PA 5I24A 2C1GA 3W7HA 5FL1A 4KRUA 3RX2A 1G7VA 3EA3A 4KEMA 1AMKA 4HK5A 4MFDA 4ACYA 3PP7A 3EXSA 3HQ1A 3NVTA 3H2CA 4DJFC 3TWBA 4WY0F 1EUNA 3KOXA 3N6QA 2ISFA 3DK9A 5I6SA 1OD0A 3O1NA 1GW1A 4XO7A 2HNEA 1U30A 3UR8A 4GNJA 3OZYA 4UTJA 5IM51 1IGSA 3LI1A 3OG3A 4Q4QA 1EUAA 2NV9A 3WK0A 1L8PA 3UJSA 2IMRA 2LLEA 4L7ZA 4X63A 4H4RA 2NVDA 1HZYA 2EPLX 4IPLA 3HM7A 3QYSA 1H7OA 2R14A 2BDQA 3KHDA 2OOFA 3NPXA 4LV9A 1P5BA 4UOQA 5BMWA 4A21A 3HPAA 4A35A 1TJPA 2X40A 2Z26A 2W6RA 4ATWA 3ANUA 2OOGA 1FWIC 4LALA 3SCVA 4ZE4A 4Y7EA 3M0IA 4GY1A 4QJ5B 5IDZA 2WW5A 2PF0A 4IX0A 3IGHX 1FWWA 4IM4A 3HG3A 1XRSA 1V0LA 3K1GA 4HK7A 1KM6A 4S3JA 2YJQA 2AMXA 3M5YA 2BY0A 3WLPA 3PSVA 4NNBA 4MIMA 4AMAA 1XG3A 3GRSA 1UMLA 2OCZA 3EX6A 2PD5A 3WLKX 3CQIA 1FRBA 1NARA 4JHMA 2TMDA 3NO3A 1G94A 3RU6A 3W02A 1C91A 1PIFA 3WFZA 1YTDA 4AWEA 3BQ6A 1RZMA 2FQIA 3DFNA 1YDOA 4J56A 4J3SA 1UH3A 4TQTA 4M0XA 3NUKA 1TZ9A 4DAFA 4MDPA 3CGEA 1CGXA 4NASA 2PZ0A 3GW0A 5EFDA 2VENA 3K5XA 3KL0A 3L4ZA 1U22A 2PWHA 3HJZA 2WZEA 4F9DA 2D0HA 3WQ6A 2ZYFA 3MWCA 2WPGA 4U5KA 3ONCA 4P8VA 1ZXIC 5AVHA 4YXGA 3UWZA 4ZA0A 2X1RA 1I1XA 4K1GA 3V4BA 1XC4A 4GIYA 3MUCA 3ZLFA 2AL1A 4YU1A 2Y70A 1B3XA 1E0WA 3W1LA 1QNRA 5HWNA 1OCQA 5I02A 1VJZA 1MNZA 2ZX8A 2PDWA 3CZ8A 2ALDA 5AN7A 3EBVA 1BWLA 3RRXA 4AY7A 5ABFB 1XCFA 3E2QA 3LB0A 3CM4A 3BLPX 1TV3A 3NVDA 3HO8A 1TREA 2QCFA 1UH4A 3PZMA 2W3RA 3GK0A 3VPLA 4H9UA 5I0DA 4IGHA 4JL2A 3GUGA 3R12A 4BEUA 3OLIA 5DMYA 3LV5A 3M5ZA 3DHUA 2V67A 3VINA 3ZS4A 4TMCA 3GRTA 2Q02A 2UY5A 3ZM8A 3A3WA 1UW9A 3P7YA 3KOFA 1XLDA 4AD3A 1ME9A 4NEVA 4ZSUA 3CB8A 2BY3A 2YCEA 4QX4A 4M1BA 1XDIA 4H4YA 3P81A 4TXEA 5ER0A 1CB7B 1JR1A 4JX5A 2PBOA 2DEPA 4IGSA 4A3QA 1FP8A 2Y61A 3QV8A 5CJ5A 5KZ6A 3GG7A 1M3UA 2NVCA 3TXVA 2ZADA 4KBXA 4GUFA 4CVWA 3QR3A 1OC6A 3LRLA 2BOFX 1WPCA 3U9IA 3KTSA 4D6DA 2ZZ0A 1VR6A 2X41A 1HL9A 4HCLA 4PR4A 3SFKA 4GGHA 4NJGA 4UTUA 3TW7A 2AMGA 1RP8A 4O1EA 3IACA 1UP0A 1XIHA 4GQGA 4MKSA 1PB0A 1AL8A 4J28A 3S47A 3CJPA 2PB1A 4PULA 4QS6A 1NHPA 3MA8A 1OC5A 4PFMA 2GR0A 4TU1A 3QY7A 1OGSA 4RR4A 1UD8A 4XAZA 4XKYA 5CPNA 3LI0A 2GQ8A 2FJUB 4A2RA 2Q8XA 3EYPA 3VE9A 3Q65A 1VB9A 3UZYA 4XUGA 2POZA 1V6TA 3UWQA 5A8OA 4C91A 1PO9A 3B8DA 3QN3A 3ZT6A 1HKVA 1TVPA 2X16A 2V5BA 4PUNA 2X1IA 3ARYA 1XWYA 4ZOHB 3W71A 3HRDC 1S2CA 3MT1A 4B5XA 1ZJIA 4ML9A 1S39A 1KM0A 1JULA 2C3DA 3LCLA 4KERA 2X7VA 7A3HA 4GBDA 4HCDA 3AZTA 4UR8A 5F7UA 2XHYA 3TJIA 1RCOB 2NX9A 4B5TA 1G5AA 3GC2A 1XPYA 4M80A 2E68A 3OA3A 1E5JA 2EPOA 1UP3A 2ISDA 3PN8A 2Y5SA 4UTLA 3OZOA 5H1WA 2HZGA 3BTNA 4P8WA 1K4GA 1IF2A 1X6UA 3R8GA 4TX9A 2H9AA 4JTUA 3GBEA 2DIKA 4YVVA 3UF9A 3PZ9A 3R1ZA 2I17A 4BY3A 1XIFA 2Q3RA 3E2RA 1UKTA 4Y2WA 5ABTA 3FXYA 4HHMA 3VFLA 4WJ8A 4K3ZA 2VFEA 1ONRA 2FJKA 1UB3A 2A0NA 3W3OA 5C9ZA 4RXFA 2D23A 1S5NA 2PE4A 5MKGB 1GNXA 1FWDC 3GTFA 9RUBA 4JN8A 3UCCA 2VFIA 4NZJA 4A29A 4CQ8A 2ALRA 4PEKA 3T4WA 2C19A 1J93A 1EJVC 1FXQA 1YXYA 1ZBVA 2VEFA 3ISIX 3KBVA 2IKJA 5A6MA 1SMAA 4PEEA 1JOAA 3N3TA 3O6AA 4AY8A 2FZNA 2BC1A 1V3HA 1GUVA 1ZX9A 2I1OA 2DT2A 1YPFA 3AYRA 2Q71A 4LA1A 1UR0A 4TVCA 3H4KA 3AHZA 4KIRA 4OJYA 1C93A 1XYMA 1CXFA 1DKWA 1S2UA 3CHFA 4MB1A 4JGDA 3WELA 1KBIA 5LHFA 4JDYA 1GK8A 3ITOA 5E6YA 3S46A 3N15A 1UA7A 3M7WA 5D33A 2O9RA 4W8AA 3NDYA 3SUSA 4ORMA 1EWEA 2FKPA 1JD7A 1UCWA 2L5HA 3O6DA 3VIJA 1AJ0A 3MUAA 3NQ8A 2Y5EA 2YFNA 4LY8A 1VF8A 4UWMA 4DBDA 5C2XA 1QOXA 1T96A 4O57A 3E5PA 3VOJA 4Z2GA 4OOZA 4MUPA 4EF8A 4ZO6A 2FDMA 2PFHA 3QHMA 3E74A 5EU9A 1YDNA 3WL0A 1IWPA 3UETA 3QY6A 3CV7A 1NH6A 5BRQA 3TN6A 4L4LA 3D47A 5C9XA 1Q4NX 3FEMA 4BI6A 5BOOA 5D9OA 4PL2A 1DWGM 3GTHA 3R13A 2CETA 3UJ2A 1NDAA 3O15A 2PLJA 5HINA 2GR3A 1WKEA 5CC7A 4PGLA 1POJA 4OV4A 2QUMA 2ZDRA 2ZTJA 5KTLA 4J2MA 2Y2WA 2BFGA 2IXVA 1G4SA 4XUYA 1LOQA 4CD5A 2IKIA 1OM0A 4LH8A 1SR9A 2GJXB 1T99A 5IBXA 3W29A 2CKRA 1K02A 2PCEA 5FF0A 3VNIA 2WZHA 3T55A 3BAIA 5RUBA 1ICPA 1C8VA 1GQJA 1V03A 3THAA 4F2UA 4Q8WA 3TJXA 2FHBA 5HQLA 3W2KA 3PB0A 1WYIA 2BTMA 1IIGA 1C3FA 4KCWA 3EOLA 3EZ4A 4K68A 3A7UA 4JS3A 2FH6A 4ZE5A 2R9RA 4NXSA 3P3BA 1BKHA 2X05A 3VAVA 3R0DA 4NZ3A 4DI8A 1GONA 4XAGA 3QFWA 4RV8A 1W9VA 1OCJA 4ZCWA 1C7SA 1MW1A 4IIHA 2FB3A 4KWVA 5FF2A 5D05A 3SGZA 3MP5A 1DOSA 1TVLA 4N6EA 3JRKA 1EP2A 2GSJA 4MNLA 3WSUA 3BG3A 3ZR4A 1W91A 3OLGA 1R6WA 4MAZA 4BFAA 3EPOA 2VRJA 4XZHA 3ZIZA 3MSRA 4JEJA 3VDGA 4NVTA 3PR2A 4NX0A 3O7UA 2FZMA 4EE9A 1F5ZA 3TE9A 4QJ4B 3A24A 1SFSA 4IFKA 3W1AA 1UJQA 5AKQA 3PUOA 2XN0A 4KWOA 1J8VA 2GSEA 4L9ZA 1T5AA 4X9YA 4CNPA 1BVZA 3PG6A 3R8RA 1DE6A 1IZKA 4C6QA 3UWVA 5BW6A 3S9YA 4MJ4A 5DANA 4GQRA 2RABA 1W5PA 5K9CA 1JCTA 3SRKA 4TO8A 4GJ1A 4IQDA 1W6TA 3W6LA 3UY8A 2EBNA 4NJKA 2E25A 3R43A 2QCEA 5CG0A 3F2DA 3OGVA 3VOFA 1NDVA 4IIFA 2HXTA 2XG9A 1QBAA 1V0NA 1R86A 3EB2A 4KW2A 5JMUA 1GRFA 5D2XA 4C90A 5IFPA 1AOGA 5C54A 3NEVA 3PSWA 4V1XA 1WDDA 4GVFA 2BCPA 2OYMA 1AG1O 1Y8BA 2DIEA 1EJRC 4E2OA 1OFQA 4ZR8A 4YHEA 3RG6A 3FW6A 1V0KA 5DRIA 3CLWA 1KR1A 6TAAA 5DBUA 2OZ3A 5DXXA 3P8IA 4A6GA 4EPKA 4YIWA 3F4WA 5EFFA 5LXEA 3TDFA 4AW7A 1JPKA 5HA7A 1NAL1 1DXEA 3SRDA 3C0QA 2BG5A 4GINA 3TQKA 1VFOA 4PMVA 4B4HA 1BXNA 1IV8A 2WWCA 3ENLA 4LAOA 4XSLA 3H2MA 1BQCA 4L1WA 2V30A 4Y9AA 3WQGA 5HR6A 4DJFD 1HXJA 1WUFA 3R7MA 1PWMA 1UOKA 2PLMA 2OWWA 4D9PA 2JBMA 1FWNA 2WNZA 4CCZA 2B81A 1FY6A 3IJLA 3PZOA 4C6LA 1BWKA 2W62A 1CECA 2OTDA 1IZCA 1SJAA 5CJNA 1BYCA 4CNUA 4O10A 3NQFA 4IX2A 2ZRZA 4W5UA 1ZFJA 4GCAA 2WVUA 1DTUA 3HB9A 1P48A 3VK5A 4TX8A 2E6AA 3SQMA 2ESCA 1GZJA 1H5VA 4E2VA 2VC5A 3VI2A 3L2MA 3UVAA 3AN1A 4IPIA 3S1GA 4GR1A 1VFFA 2PODA 2V5CA 1VYSX 2E67A 2ZUSA 1JZ4A 3IC9A 3CAWA 4FAMA 4TV5A 3SUUA 1XS2A 2PGWA 3AISA 2FFCA 2E7FA 4V27A 2PTYA 4CCCA 2QIIA 5A95A 1LF1A 2JIWA 1PZ2A 1LWHA 2O55A 1JUEA 2QLYA 3INPA 1DPMA 4O18A 1I9CB 3RM9A 4PCPA 3VGDA 4REQB 4FR6A 4GHRA 3OVGA 3JW7A 3NVVB 3NGJA 4M51A 3RNDA 4EPDC 2VWSA 2X1UA 1VENA 3C2YA 1NF7A 1NFPA 3ELFA 3TN5A 1GOKA 4HNTA 4EMWA 3UBPC 1TZ7A 4O1CA 1XDLA 3WO8A 1SFJA 1F3WA 2BY1A 2WSYA 3IGSA 3RF9A 1O66A 3BOFA 1ONFA 5D9MA 1DQXA 2XN1A 1ZJBA 4H1ZA 3L4WA 4JIRA 4GC3A 1RVKA 2GOUA 1SO4A 4XKYB 3FAXA 4GC4A 3FKKA 1KM2A 3KTXA 1E51A 1VIWA 3LENA 3SQLA 4LB4A 3DOPA 1MDRA 4M5PA 4DF0A 2F7FA 4CUCA 4Q4OA 1VHCA 4S1FA 3RAOA 1VPQA 2ZX6A 1A50A 3FVDA 3F4VA 3G22A 2BHZA 3GXMA 3H2OA 2JEQA 1EGVA 1ME7A 2CHRA 4RNFA 1XLMA 3CYJA 1GVQA 3GRIA 4EWJA 2Z1KA 2BNJA 2CBJA 2R1KA 4IT1A 4MY8A 3U7BA 2PDKA 3NS1B 3ALFA 1W3LA 1Y5XA 1RXOB 3B40A 1C8YA 3AXKA 1EJSC 3SW6A 2GVEA 5FJTA 1JI1A 1G4EA 3THQA 2GDUA 2PDUA 1A5CA 3PJUA 4GCXA 1QBBA 7TAAA 2YPIA 4B5WA 2WBGA 4AD5A 1W1B1 1GQKA 1P4CA 3IV3A 4QROA 3WD4A 3VTRA 4EKJA 3CGTA 2GPTA 3QXBA 4JQ2A 2DUAA 3WBAA 4OBTA 3B97A 2CPUA 3GVGA 3SN0A 2EQDA 1G4TA 5I23A 1CT5A 3M0VA 2H9AB 4GYPC 1S5WA 2QNEA 3FIGA 3AWOA 2NUWA 3AS0A 1STZA 4WOQA 4RLIA 3L4XA 1VBJA 4AZHA 1Y7VA 2E5AA 4M24A 2PP0A 1W9PA 4G56A 1YTEA 2EPMX 2OSYA 3G1AA 1PZ0A 5LNVA 4BWLC 3LCFA 5AOUA 1QI5A 3IARA 4CD8A 1X7IA 3W7PA 1H51A 3BZJA 2J78A 3MV01 4S3AA 3POCA 2V0TA 4MUZA 1TG7A 3HURA 2ZUNA 4AH7A 3NRZB 3W1XA 3TVAA 1BGGA 3BW3A 4TTUA 3DG7A 2ACSA 1PHQA 3ZMRA 2I5IA 3MKVA 4DM1A 4OUIA 4WX2A 2QUVA 3NOEA 3VX0A 4JYEA 3EX2A 3M4HA 4LNCA 1EZ2A 3N2CA 2YA2A 1EA9C 1J5SA 1DORA 1O60A 1PXGA 1RBLA 2PC4A 1GJUA 2NXIA 3GLCA 3STCA 2CDUA 4ZOEA 1VYPX 2ISSA 2DW6A 1Q8AA 2RAGA 3UR7A 3MVIA 5BZAA 5HPCA 5HMDA 1NWRA 7ENLA 3F4CA 5JBFA 1XIEA 3GTNA 3ALGA 2DV0A 2J3NA 2CNCA 4BQ3A 3VKKA 3S0CA 5I78A 4CU8A 3KX6A 5C0QA 1A5KC 4R5EA 4Q8PA 4C6DA 4PUKA 1I4NA 3MUIA 1DWIM 2HROA 1US2A 2D1ZA 2YLLA 3TCEA 4U28A 4F2TA 2CZDA 1VKFA 3AU2A 2ACRA 4V15A 4YTUA 2GJPA 3PZNA 4A3UA 2HK0A 1PKYA 3OC4A 1K7EA 2HS6A 4GZIA 1NQ6A 1TTJA 4E8DA 3BOXA 1DHPA 3GHTA 4DXVA 4WSHA 1T3QC 2VELA 1US3A 3AQUA 1KFCA 3BWWA 5EMKA 1KM1A 3VD3A 3KBWA 2W79A 2DY3A 1HF6A 1MQRA 3H8AA 4LQ1A 3AYVA 2J9ZA 4GO9A 1W3IA 1O5KA 3N9SA 1MSSA 4DY1A 5E9XA 1YIXA 3VDCA 3Q58A 2WJEA 4G7EA 5BXPA 1RP9A 3TZFA 2E8YA 5DCEA 3C2RA 4LV4A 1N8IA 1TV7A 3V0UA 5I00A 1UC4A 1ZBWA 1PYMA 1IIHA 2QS8A 1L6FA 1P6BA 3MTWA 1ISWA 4R85A 1LRTA 5FS9A 2C18A 3G1DA 4V2XA 4Q8OA 1UWTA 2IXUA 5H8UA 5C9RA 1KM3A 1M03A 1VS1A 3BLDA 1NEYA 3QYQA 4MZYA 3ZJ6A 1C9WA 1E3XA 3CT7A 4FOJA 4NRSA 3UP8A 1QNSA 4FOKA 1EGZA 3BAJA 4JR5A 4HPGA 3LMYA 1DJHA 3EOSA 1R2TA 5K9XA 4UFIA 1GYLA 3V1PA 2Y85A 2JIEA 3CWHA 4IWWA 3EOEA 3ZJ8A 5EBKA 2Y89A 4AC1X 1HL8A 3WCZA 4H4QA 3WF2A 2XPKA 2ZXDA 5HNUA 2YXOA 1XBVA 3W25A 3N13A 3E96A 4C6JA 2V2HA 1U33A 1JDDA 5U7SA 2NSOA 3CPUA 3VMPA 4AVFA 4ZVJA 5HNRA 4POCA 2VX6A 1XC6A 5M3WA 1E4IA 4AEFA 4H50A 1G4PA 1EF2A 1U2YA 8RUCA 3EOOA 4H8VA 2PD9A 3QPYA 1NSJA 3KUMA 2UZ9A 1QNVA 4OIFA 1FECA 3G0UA 1EIXA 3ICJA 5D2WA 1VLWA 3VM5A 1UG6A 4FZIA 5C9UA 4IFKB 3MDWA 1HW6A 1SU5A 1QHZA 4JTIA 1HX0A 4G6CA 1Q7QA 2WSRA 3KRZA 2A6LA 2GRTA 2HQMA 1HG3A 1K8XA 3SCUA 2WSKA 3O06A 4GJIA 2CBIA 4I9JA 2EKCA 4WD0A 1RJQA 4EQSA 4UOJA 1W1VA 2VX4A 2I9UA 1QUMA 4BI5A 3WNMA 2J47A 2WQPA 1WO2A 4CNNA 2CKSA 4MNMA 3TTSA 3OP2A 3TXZA 5FJJA 4IISA 2QJMA 4PMQA 1LZOA 3L8KA 4MG4A 1KBJA 3OW1A 3W26A 3GIQA 3WK3A 5C7HA 4HA0A 2V68A 2EKGA 4QSFA 5LNWA 1RLDA 2I56A 2JFEX 4JN7A 3LBCA 1KA9F 3W0KA 3BLOA 2BWGA 3JUGA 1JGIA 2PP3A 1MW2A 5FJIA 5LA0A 2WMIA 2W4XA 4JTQA 3CUGA 4AXNA 1SB3B 1Q45A 4ZTYA 3O63A 3S2JA 1FWBC 4HB7A 3IIPA 2G0WA 1TYTA 2PURA 3Q67A 4ZB2A 3RLUA 3NVWB 2WSQA 1NQKA 7CGTA 3TJLA 2AQWA 3UPWA 5FD0A 2YB4A 4NP7A 4NZ1A 4W88A 1KRAC 3LCGA 2AQVA 4P7LA 4XV0A 1QTWA 2UBPC 2VR4A 4K7ZA 3NQDA 3B9NA 3WLHA 5CC3A 3REQA 1EJUC 3NXFA 1QCWA 5EPDA 3O0FA 5K4XA 4JOMA 4C7GA 3M0LA 3C5QA 3CHVA 1Z48A 4CNTA 3LHYA 2I16A 1QW7A 1WOAA 4RNJA 3ARQA 2Q8LA 2WPFA 2DW7A 2X0YA 4P7OA 2BMBA 1VP5A 4QE1A 1TYGA 4OWGA 4UR9A 4J1OA 2WSPA 1A4MA 4PMUA 4FIQA 3PK7A 1THFD 3ITCA 1D7FA 2FLIA 3UA4A 4ATLA 4FLQA 3GAYA 3GDLA 3VNYA 4E8GA 1LG1A 3I3DA 4DUXA 5HMEA 1UWIA 4TVYA 1QPQA 3A4AA 4N4QA 1CIUA 5JCMA 4IG2A 4APNA 1EX1A 3VOHA 2F6XA 3WF3A 2C6QA 1V97A 1SO5A 4LW7A 3HG2A 3SN1A 3HFYA 3GHSA 2ZC1A 3MO4A 2HVNA 1KCKA 2W0HA 4KGJA 1H60A 4JTRA 1QK0A 3NTYA 1LG2A 5IXEA 3MO7A 2V38A 3MMTA 4PBGA 4AIUA 4FX6M 4IFOA 4WIWA 2PWDA 2OKOA 4F0SA 1N60C 3DC0A 3PBWA 3CIXA 2ZZ7A 1W9XA 1QPKA 4YYFA 1FH7A 1V7YA 2ZZCA 4W84A 1T7LA 2J66A 3CUXA 1C7TA 1N8FA 1Q6LA 2ZWZA 1WXJA 2XFWA 4AEEA 5H8PA 2C14A 4AISA 3M6YA 3TR9A 2DSVA 1IEIA 1AVAA 2QVHA 4MMWA 2ACUA 3GG0A 5HJLA 4GNKB 1NIUA 2VX7A 2NLYA 1JRBA 3HGJA 3A9BA 1TSIA 2GQAA 5AC6A 2VUNA 2JGQA 3DIPA 1YPXA 3THDA 4UFKA 4FA3A 2X42A 3SY8A 3THUA 3NQVA 1FX6A 1R2SA 3L4YA 2DDXA 2V3BA 1ZAHA 5AHLA 4XD3A 2X7WA 4MVAA 4AHPA 4OT7A 3LXDA 1JXJA 2UY2A 4GBUA 4H01A 1W1IE 4F66A 2OQHA 3KRBA 3SM0A 3AIRA 4GKLA 5BU9A 3GHRA 4NAEA 1ZPTA 3QPEA 3SRFA 4YWIA 3VIPA 4ADUA 1UKQA 2XU2A 3CC1A 4RXGA 3W7GA 2EQ9A 1KRMA 4HU4A 5DX7A 4DO4A 1PS9A 2OFJA 4N02A 3Q4DA 4NJJA 1YW1A 1KQYA 4IOTA 4C1NB 3AZRA 1I2PA 4DBSA 1S5MA 5K7JA 1TCMA 3TP4A 4J2PA 3NPUA 1Z32X 2GOKA 1JRPA 5BYWA 4NSBA 1F6KA 4DVOA 4IQLA 3XIMA 3W28A 4ZQNA 2W54A 1XSJA 3SCPA 3VO0A 1G7UA 3AJ7A 7REQA 4QJ1A 3ABSA 1UWRA 1H11A 1OFEA 4E0CA 3NQBA 1BPLB 2GDVA 1A49A 4S39A 2PS2A 4I7UA 2QDEA 2NT1A 2HXUA 1MEIA 3EA2A 2VMFA 3TTOA 5BXTA 1HGYA 3I7QA 2PBGA 1KM5A 4LC6A 3DGHA 2A5HA 4XBKA 4BV6A 5A6JA 2V69A 2CLIA 4KWWA 3BOLA 3TU9A 4HIBA 2CLHA 4ZMGA 4JN6A 5D2VA 6ENLA 4I7VA 1JUKA 2PWFA 3WBEA 2VO5A 4U4MA 3LCHA 2NQ5A 3CTTA 1GRGA 3BLKA 4DX3A 3OZPA 4K8EA 2XYLA 2HDJA 3AIQA 2W66A 3RLVA 2GGGA 1KCXA 4HSHA 1S2VA 1D3HA 1TX2A 1WKDA 3WQ8A 4BI7A 1F05A 2GFTA 3L4UA 1XH0A 4F3HA 3V7PA 2A3BA 3I6EA 4WXYA 5CGTA 2VTFA 4QDPA 4IQJA 4S3DA 1T0OA 1DIEA 3CB3A 5TR3A 1X96A 2VZSA 2ZE3A 5LXXA 4IIGA 3W7IA 1HKKA 1KTCA 1KW1A 3BL3A 1RY8A 3OOQA 1V5XA 4HOXA 1EPVA 1DHKA 2H6RA 3FJLA 4EXBA 3DH9A 5EMJA 1LL6A 2WHKA 1Q7ZA 4GY0A 3LEPA 1ZJHA 2ZZ6A 3WZ0E 4L6HA 4QG9A 1MMFA 2DUXA 4M1RA 3W75A 2C15A 1MRQA 3LTPA 4C5YA 5E70A 3ITVA 5C2GA 3WLSA 4Q7IA 3T2QA 5H8MA 2CWNA 2H90A 1Z8AA 1PVNA 1VH7A 5CC5A 3CGDA 4LC8A 4PB4A 1ZRQA 2DP3A 1FHUA 3UWWA 3ZT7A 1CXLA 2Z1XA 4KS0A 4R7JA 3WEOA 5U4NA 4A22A 3TYDA 1NFBA 1V0MA 3W74A 3AMGA 2NX1A 1XD1A 2YCLB 3QR0A 5I3GA 1K8CA 3O05A 1FHVA 1QO5A 4P5UA 5FAGA 3CTLA 1F3TA 3BG5A 1RUSA 3VKDA 3CUZA 1JF6A 1L6SA 4FNUA 4HA1A 3U4AA 1JYXA 1LORA 1JZ7A 3M16A 6XIMA 2V3EA 4FXSA 4CGTA 4TOQA 3VMNA 4B16A 3SGUA 1GVYA 2W3ZA 3H7UA 2VCAA 1KGWA 4HN4A 3COTA 5FKYA 3RX3A 4INFA 3WQ4A 4QS5A 1E1FA 1GG0A 1QU4A 3V1HA 1GERA 1SSGA 2ZUMA 4G1NA 4H9VA 2WNNA 3NAVA 1VRXA 2BX7A 4IMFA 4AX7A 1XYLA 2KX9A 3LQGA 1GPWA 4MWAA 4N2YA 2BXVA 1IEQA 4BF7A 3B9AA 3GDMA 2QF7A 1NPXA 2E3ZA 2X1TA 2WKJA 1XI3A 3T2OA 1DVJA 2CZVA 2HRWA 3K8MA 9XIMA 2BGNE 3DZ1A 3O9NA 4UMBA 3FX4A 2AAAA 2DZAA 3UERA 3PM6A 2QCNA 3GNXA 2VGBA 3LOTA 3H54A 3LHZA 1KR0A 2R1MA 1JZ8A 5TQLA 1XQLA 4MYAA 3LHVA 5B80A 3AYTA 3GFZA 1SZEA 4XD6A 4NI8A 2ZX5A 4DF2A 3OHIA 5FSDC 4PRRA 2AGKA 1RR2A 2ZXQA 4YVXA 5J5DA 7ODCA 1XJBA 5D09A 3DHPA 2ZKMX 2XFRA 1DJZA 1ZLPA 3RCMA 1AJZA 3AJXA 2WPCA 4JCLA 4JKKA 3QMRA 1FCBA 3ITGA 1M04A 1OT2A 2W91A 4RL3A 3W88A 1XANA 1XX1A 3DUGA 2OYLA 1M6JA 3B9JB 2DSWA 2GR1A 4PCTA 4WK9A 1VIZA 3DKLA 2GSHA 1JYNA 3ZOAA 3M0JA 1Z3NA 3IVUA 3ZLGA 2HBVA 4U3AA 3AIBA 4J3TA 3MP4A 2BSLA 2WMIB 1TUXA 2ZXAA 1R3QA 2HWGA 1A5NC 4KKXA 5E0CA 3KS6A 2EG8A 3RJYA 4YLWA 2YOCA 3BAXA 4I5XA 1WB0A 2ZUUA 4MADA 2EJ1A 3VX1A 3A64A 4H04A 3SEPA 3OBAA 4Y8FA 1E0UA 4KH2A 1W5NA 3GDTA 2C3ZA 1G01A 2MUCA 1FFUC 1JZ2A 2Z29A 1K77A 1RA5A 3ARWA 3ZVIA 3EWDA 3TN3A 5GPRA 1MXDA 2AL2B 2QJNA 4PCFA 3WLQA 4L6OA 3IGUA 3VCNA 2WWDA 4GD0A 3REQB 3R94A 3L0NA 2J27A 1LWJA 3GE7A 2VNCA 1TVNA 2EQ7A 3LGGA 4ADSA 4GKTA 3B04A 1RVGA 3WUEA 1H7RA 2W3SA 2KZHA 3AZSA 3IK2A 3TW6A 4XZ9A 1LUCA 1GOXA 4KFNA 1TV4A 4UNIA 4XZIA 2C71A 4EIVA 2Y8VA 1Q5MA 3HU7A 4RDYA 1VZWA 1AZ1A 4QG8A 2WJFA 5KITA 4LNYA 1ADDA 3KLKA 2GR2A 2OEKA 4DO7A 3XISA 1KRBC 4GYKA 3OO2A 4TVUA 4IG2B 3OG2A 1RK6A 3HQOA 3AUOA 2O0TA 4MGGA 1E55A 1XH1A 3R6IA 1XBYA 1QHOA 2C0HA 5CCZA 3TN4A 3WL1A 5FI8A 1G69A 1PEZA 1UZHA 2JEPA 3RPDA 1FTXA 4QXIA 2WAGA 4W7VA 3K4WA 2WPBA 1WBHA 5JVLA 5XIAA 3IUIA 3PBGA 4UUIA 3R25A 4C7FA 1C92A 2YAUA 4NT0A 2GJLA 1JFXA 4J9JA 2WBAA 3W70A 1XR2A 4PBEA 1HJUA 1A47A 2QQ6A 1XXXA 4CQ9A 1HJXA 4QEEA 3CHDA 2DZXA 2V63A 6REQB 1E4MM 2ZVRA 4MB4A 3JZEA 3K2GA 2VOMA 3W73A 3S5ZA 4HSOA 1VCFA 2JALA 4WXZA 3W1PA 2PA6A 2OB3A 5FA5A 1FH9A 3H7RA 3UYCA 1AH4A 2POTA 1B2YA 1ZB5A 4O54A 4DJDA 1AA1B 4O13A 1XUZA 5FF3A 1GVOA 1OX6A 2A3CA 5GVJA 1JNDA 1NM9A 2Z2BA 4YHGA 4JQ4A 3SBFA 1K70A 5C2CA 3EDDA 3R4IA 2V8ZA 4ZL1A 4GI9A 3S5NA 3LG3A 3ID7A 3AICA 1W3TA 5D04C 4BKNA 4EF9A 2A1YA 3UR5A 4YWOA 3A3XA 3WBWA 1OZQA 2PSNA 1W31A 1GJPA 4GFSA 1SQ7A 1U83A 4JNMA 2V5JA 3HMJG 2XFYA 3E9AA 3TOPA 1TV2A 3OA5A 3WUFA 1ZBKA 5AZ1A 2PDYA 3PZIA 1SR0A 4O4WA 1RA0A 1KFLA 1OFRA 1I2RA 2OZ0A 1XH2A 3GNDA 3KE0A 1CX9A 2D2HA 3DU0A 1UD2A 3SCOA 3LCWA 4M7TA 4GO8A 4KGLA 4UQEA 2RDXA 1K7FA 3UZXA 1XG4A 3CL6A 7REQB 3ARVA 4Q8QA 5E93A 4E6MA 3KRSA 2VZVA 3NL6A 3S5OA 2NQ9A 3EWXA 4O1AA 3OLDA 2XWDA 2FH8A 5D37A 5HUPA 3RGTA 4LS0A 1UWSA 1S5TA 4UCGA 4PTNA 1JROA 4F4RA 3GD3A 1U5HA 1ME8A 4JQ3A 1X6NA 8A3HA 1OB0A 3SZ8A 1YKWA 3D6NA 3UXKA 3T7VA 1KBBA 1FUYA 2QCMA 3AO0A 1BYAA 2PDQA 3GKAA 1EL3A 4HMNA 2QV5A 1A5SA 4HGXA 1QWKA 3SRHA 2YW3A 4ONVA 2HCVA 3MPGA 1LTDA 3NZQA 1XQKA 1PDZA 1TWIA 1GHRA 1DXIA 1A0CA 1OYBA 4FX8A 1CNVA 3LSCA 3UW6A 4RZ5A 2O4QA 3MDUA 3I7RA 7XIMA 1T6MA 4ZQCA 3UNDA 3QSTA 4ZOCA 1PKMA 4DPPA 4RCXA 1O12A 4B91A 2D3LA 4O52A 1HQTA 4O1FA 2B7OA 1OT1A 3PUEA 2J4GA 1E1CA 3WLMA 1S7MA 4S2BA 3CAVA 4JAWA 2WOIA 3N14A 2WM1A 5DEZA 2OX4A 3R8HA 1HJVA 4UIOA 4PMZA 1XKYA 1HGWA 3W6MA 3TNOA 4C1LA 2WM0A 2DQXA 5A2CA 4E8CA 2VGGA 1LM1A 2V5KA 3LXBA 3ZR5A 1H49A 4GI6A 1ZDLA 1ZKQA 3EEGA 1YBQA 3DCPA 5GNZA 3KRUA 4AEOA 4XSMA 2IPFA 4L4PA 3HG4A 4PBFA 5HK4A 1OY0A 1MZRA 4HMEA 4ZGYA 1JNEA 2CZEA 1CLVA 1KLZA 3MMWA 1ZS2A 2A7RA 3IJ7A 5AC8A 4JYDA 1L6GA 3KCJA 4EP8C 3WDPP 3GD4A 4A8RA 4G2DA 2DT0A 5A5WA 2IQ0A 1JL8A 4UQAA 3VZYA 1N8WA 4AD0A 2PWEA 3DENA 3NWRA 1QDSA 1EF3A 2O56A 4CLMA 1IHIA 2FVLA 2V3AA 4QISA 1PPIA 1O94A 4ZOAA 3BSMA 3VNZA 3GAKA 3VNKA 4H9MA 5M5DA 4DWSA 1ONWA 3Q37A 4ROPA 4GH3A 4MOZA 1AL7A 1M68A 3PBYA 1UD6A 2C1IA 2GGJA 1TJ2A 2OU4A 1KWGA 3KVLA 4RDVA 3ARTA 3RNMA 3G6LA 4IL2A 1A3XA 4ZEPA 2RGLA 4W4QA 4YCPA 1J10A 3S3GA 2MNRA 1LROA 3AMLA 4YL2A 3DG3A 3WQEA 5EGRA 1UUQA 5E1QA 3FHQA 3R0KA 4IL0A 4Y8EA 3RPTA 3SJNA 4OZOA 3G6MA 2VC9A 5JH2A 3LQLA 4JTEA 2D22A 5LKYA 1EBGA 4PYSA 2PWGA 1XGEA 2VDHA 4B4FA 4FXRA 5IHRA 1RH9A 2QGHA 3MV11 1OG0A 3MBDA 4J7RA 2J6VA 2DT3A 5LYRA 2V6OA 5CGMA 4D72A 5CBIA 1OJTA 3D3AA 3KTCA 1GHSA 5BROA 2PMQA 5FEPA 2VEMA 3G24A 2UY3A 3VD4A 4Z2LA 5AHNA 3AXMA 2A3AA 1W54A 4EPEC 4FALA 2E3TA 3B0PA 3CH0A 4D1JA 2P8BA 4GFIA 4H41A 1KCZA 1WQ5A 1J0YA 5LIYX 4H6EA 1WOBA 3WQWA 3NYDA 3NPWA 4CD4A 1KFJA 2WPEA 4XAYA 3NGFA 4XZLX 5G4HC 3VIKA 5FS8A 1KB3A 1I75A 1VEPA 3CQJA 2YSWA 2AQOA 1BG9A 3QLLA 1DNCA 2DU2A 2VR2A 2CZFA 3SSZA 1OFBA 4NF7A 3MB9A 3LDVA 5AZ0A 3RR4A 3EX1A 1GREA 2FZDA 3WBYA 3D9XA 1GJWA 4DJEC 3W76A 3U4FA 3NYZA 2CWXA 3WD0A 1L6WA 5JCLA 2Z7KA 2D0GA 5I3IA 4HK6A 2VM8A 3KBJA 3EKZA 2VZTA 2OGYA 3ANVA 3LNPA 2OT1A 4F8XA 3GU1A 3DHDA 4JQ1A 3Q6JA 1ITQA 1TO3A 1PZ1A 4PTVA 2W27A 4ATDA 1B9ZA 1LQAA 3G18A 2IQDA 1H6VA 4R53A 4P7NA 4JFUA 5HMSA 4KPLA 3DK8A 3M0XA 3CIVA 2O4MA 4MKNA 1KC7A 4KF1A 3ATYA 2QJIA 2QCGA 3DYPA 1XIMA 1Y5VA 3T0BA 5LHEA 2CITA 3OYXA 3H4WA 4BCEA 1Q65A 1ZP4A 3HW2A 2F2KA 1M01A 1XIBA 3I65A 2WNQA 4EQXA 1D2KA 1D7YA 2VC6A 1E71M 3IRSA 4DJDC 1LUCB 4F0HA 1X7FA 4YJ5A 3TCSA 3K46A 2PWVA 4XKMA 1WZLA 4LUSA 3BJFA 4LRTA 1VLIA 5HJYA 5JH1A 3I4KA 3WLJA 5DFAA 3GVVA 3WDQA 3LLXA 2QMKA 4MKVA 2VVNA 2NV2A 2V3DA 4OECA 1QI4A 2R24A 4JICA 2EPKX 4AF0A 1GKPA 4DF1A 2X30A 5AECA 1GPFA 1HJSA 1AH0A 1TKKA 4GI8A 1O7AA 1XKJA 4CEXC 1OWQA 1IR2A 3S1XA 3I6TA 5CZJA 3T40A 3STGA 2YKKA 4IPNB 2QEZA 3ARUA 1V51A 4P7QA 4K37A 4QDMA 5T26A 3N2OA 1IGWA 4Y9NA 4H8UA 1YYAA 3L65A 3WYZA 3QPZA 4PMYA 4KCUA 1IXPA 2Y62A 4ERAA 1KCLA 2CXEA 3W1RA 1TPEA 4X60A 3N04A 1BZLA 4GMEA 3EGJA 3FGCB 4RZ4A 2J62A 4QJ3B 4GISA 3SDOA 1MW0A 3OTRA 1JPDX 1E40A 4O17A 3S2CA 3DKJA 5C55A 4HNLA 3M0ZA 1K3UA 3TA9A 4MNJA 1NOUA 1TWSA 4H4TA 1LLWA 4J40A 8XIAA 3OHMB 2OO0A 4LU0A 5CZKA 1D8WA 1V6XA 3URHA 2VFDA 2DGAA 3M0KA 4EOUA 1LCOA 3DC8A 3I10A 3CZJA 4UTWC 4C6MA 3TQ0A 1OFAA 2WCSA 1L2QA 4QAIA 3O0HA 2HISA 5SWUA 4TX6A 3B8UA 1F7BA 1KV8A 4GXWA 3JR2A 4K8DA 3B05A 3DYMA 3W6YA 1F8IA 3GH4A 1J0IA 1ESWA 2FPVA 3MZNA 3PPGA 4ZB0A 3AC0A 3GY1A 1FFVC 4MYXA 3BURA 2R91A 2Z6IA 2XWEA 4HMDA 3WK1A 2QUNA 1NJJA 1N7KA 1O5QA 3HG5A 4S3FA 3UCDA 4D2JA 5ECVA 1E0TA 4HYRA 3S6DA 3FVMA 2WVVA 2Q6ZA 4YVPA 2C1HA 1GQIA 2PDHA 3SY5A 5K4ZA 3H2FA 1UWQA 3QFEA 1XYFA 1QO2A 2EO7A 2PDNA 1FQ0A 2ZE0A 1B0IA 2JF7A 3XINA 1DP0A 2VFGA 5JXQA 1S2AA 4MF4A 4EAMA 2I5GA 2VYOA 3BLEA 2WYSA 1Q1RA 2QDGA 5HATA 2GL5A 1CXHA 1H1NA 4QGCA 3QZ6A 4E5TA 1BVNP 4HPJA 1J18A 1CBGA 3KP1A 2E5BA 2E9BA 2X8CA 3AROA 1IQ8A 2FGZA 1BEUA 1TMHA 2GGHA 4D1IA 1UWUA 1B57A 1RV8A 4BR1A 4ZFCA 1JEHA 5CXPA 4EANA 2PTZA 2E8ZA 2OJPA 2C16A 2BC0A 3SFWA 3SUTA 4Q4RA 4U2ZA 5JBEA 2E5DA 1P0EA 4I5RA 3W2UA 1CGTA 1QPNA 4EMJA 3CL7A 3O2LA 3VNMA 3TQPA 1M53A 3W1MA 2E9LA 3GXNA 3NXLA 1LWIA 1A5OC 3AIUA 4GE8A 4QQ3A 1ITCA 4HTYA 5LSMA 2QULA 4I6KA 5BRBA 4OKDA 2Y6ZA 1RD6A 5T9CE 3IPWA 3K8KA 4YCOA 4QITA 3IRDA 4GPNA 3HPFA 1RM6B 1XICA 1VFHA 4IP7A 5U1OA 3SGGA 3WQDA 1OHLA 3KS5A 3SO7A 3M0HA 5EMUA 1ZJAA 3BW4A 2ANUA 3PTMA 4UTTC 4XZBA 1KLYA 1ZZMA 4FNTA 3PG9A 5A6SA 1KNWA 2RJGA 3LK6A 2E77A 5HWMA 4DI9A 2VEPA 3NQ2A 4JHZA 3APGA 1BWVA 1TUFA 3N6HA 2EQ8A 3S2LA 3QRHA 4A4AA 3ZSSA 2CHNA 4Q8UA 2CERA 1UD4A 3WLIA 3WFAA 1V6UA 4JZ5A 3LHTA 3A12A 4PMDA 4IGNA 1VCGA 4IMCA 4HA3A 1ZMDA 3R2GA 1YBQB 2J13A 4KT2A 3W7NA 1IR1A 1E0VA 1X1OA 4J4KA 1P6WA 3DJJA 3II1A 1SO3A 3C52A 1O5XA 4DBUA 2J77A 1K6WA 1ADOA 1M7JA 1X6LA 1R3SA 2FZBA 4MFEA 4IPPA 4E2BA 1FWGC 5G1YA 3NQCA 1GVSA 1JCLA 3VGHA 2B0MA 4MB3A 3AHYA 5LNRA 2R1PA 2BOGX 2YL6A 3S8HA 3GH7A 3DESA 4DWDA 1TELA 4LCSA 3L5LA 3N3MA 1GYMA 3VZXA 1WAUA 5G5IA 1KXVA 4DWSB 1YRRA 1PJ9A 4A3YA 4H9YA 3EWYA 2PDXA 2DZTA 3CBWA 2QT3A 1EOKA 4ICCX 2QCLA 1EKOA 1GVRA 5HUOA 1AW1A 3MUXA 2ZOXA 3DERA 1EGMA 3V18A 1TJ1A 4Q8TA 1WZMA 4HHHA 1XLAA 2Z4GA 1ONXA 2QXWA 1EC8A 1R38A 3N34A 4XBJA 1R85A 4H6RA 4UTKA 3ZQ9A 3HA1A 3GSMA 3KOZA 3UG4A 2OQYA 5HDRA 4RW5A 5E0KA 1F8MA 3PWGA 3FSTA 3BQ5A 1NDWA 1FKWA 3KLLA 3UCQA 3HBLA 1GOQA 3MYPA 2ZFAA 3V3WA 2JK2A 4WCJA 4GWEA 3OQ8A 1B3VA 4S3GA 1DYSA 4F0MA 4L56A 2OG9A 2DJLA 2OXNA 1XIJA 2YCKX 4DUVA 1FFQA 3MKKA 4LTSA 4F0KA 3TZNA 4MSSA 3BCJA 1CCWB 2B31A 3HGOA 4UB9A 2GVJA 3QMSA 3TR2A 2D2GA 3SQPA 2Q3OA 1JDAA 4B15A 1J79A 1REQA 3BSGA 1YNPA 3KXQA 2CCRA 1UA3A 4NZ4A 2RHGA 5F2GA 2PDJA 4XZMX 3DAQA 1MO9A 3QKZA 3UQNA 2G97A 4M52A 1XM3A 3EKGA 4NNAA 5JCKA 5LNSA 4TMBA 3FV9A 3ITYA 3MW7A 4S3CA 1UUOA 2BHYA 3RX4A 3N4AA 1G9HA 5AHMA 2J25A 4AZCA 2WB5A 3FSUA 5JBDA 4O0QA 3DI0A 4WDXA 1I2QA 5M17A 1K9DA 4TUFA 1J12A 5H6HA 3ZLHA 3MCNA 4HNNA 3TFCA 7TIMA 4DHGA 1JCNA 3VYLA 1F9CA 1M7XA 1JAKA 4UQBA 1WCGA 3WG6A 2VX5A 3V5CA 4C6KA 5A6BD 1PBGA 3NA8A 1WX0A 4U2YA 2H3DA 1EYEA 2GVYA 1BD0A 4FB7A 3LMZA 1OSEA 3UU0A 3ZWSA 4O1DA 3EWBX 1HT6A 2QMJA 3UXAA 5GJMA 1PL9A 1HJQA 5LA2A 2E6YA 2BLEA 1KQZA 3CXOA 1JZ6A 1SM9A 1E6SM 5TBOA 5PTDA 3O6YX 1YADA 3I4EA 2OEJA 3VNJA 4DXXA 2WHJA 4KEUA 2DSUA 1PHWA 4DN1A 1JRCA 2NW0A 2QGYA 3A5FA 2ZUTA 5CAKA 1C8QA 3IVSA 4GI4A 3GNPA 4EQWA 4JFVA 1VJSA 3C2FA 3VILA 1ISZA 1NP0A 1M9HA 1R0MA 2F5ZA 2PAJA 2PDGA 3T81A 3ONBA 4GOAA 4LIIA 2OVLA 3CZKA 5BWAA 1W56A 4RE4A 1Q6RA 1B3YA 3FN9A 3FYPA 1SJCA 1UWAA 2DJXA 2QV4A 1FH8A 1B3WA 4XWUA 5F1UA 4ZODA 4J57A 4LUSB 4QRNA 4ZXLA 2JK6A 3C3NA 5JUVA 1ZTVA 2P0IA 3HJEA 1AW2A 2OGJA 2RKXA 1RCXB 2HPIA 3AIEA 1JCYA 4HA4A 4IIDA 2R94A 1TRDA 1CDGA 1JCXA 2NX3A 1RBAA 3HPZA 3RO6A 4QIUA 4FNPA 3DJGX 2ONEA 1QR7A 3U8GA 4AQLA 1MOKA 4O0ZA 4Z1DA 3U2EA 2WXDM 1VGAA 4JQAA 4UTHA 4AZIA 3M1ZA 1DQUA 2WLZA 2QUUA 3VOCA 3QTGA 5E09A 4O4VA 1PX8A 3T42A 4DM2A 3Q2DA 3LPPA 4GYJA 3TQVA 1XRVA 4B9YA 4R88A 4B3ZA 3W7DA 4HD5A 3RK8A 4XX6A 1GYNA 1XF0A 2NWRA 1JF5A 3FG2P 4LEQA 2O9PA 3PZUA 3E0LA 1Q2SA 3D5HA 3FA3A 1E3ZA 4X2RA 2DZWA 2YL8A 7PTDA 4HBKA 4RPPA 3KVJA 2XZ9A 3PFRA 2VQUA 3E6EA 4A05A 3DG6A 2A4AA 4DJED 2G3IA 1K4HA 3C0SA 1U5JA 4GQBA 1U5VA 4QP0A 2XVGA 3PBVA 1HTIA 2OO6A 2G5WA 3BV4A 3RYSA 4QR6A 1ADSA 2ZBTA 3KHJA 1IE7C 3V35A 1S3TC 2Z1SA 4Q32A 5KZDA 5TAOA 3VC5A 3WLOA 1W3JA 2FGBA 1OGBA 3MQTA 3CGCA 1EJWC 1FWCC 3WEZA 2H8ZA 1H41A 1LQ2A 1QPRA 5BRPA 2CC0A 4M56A 4UMAA 3TROA 1ENUA 2WVVB 4H4UA 2XIMA 3N29A 2NQZA 1G67A 1EFZA 3WQFA 3NSXA 2W63A 5E5CA 4HT3A 1CZ1A 3PPFA 4DYJA 3T6CA 1E72M 1QXLA 3NSMA 3UR2A 3BVJA 3MCMA 4DJDD 2CESA 4UTFA 1NP2A 4L61A 3GG8A 2G3MA 2XGIA 1O68A 4DXKA 1FHDA 2CU0A 1GSNA 3FNDA 1QK2A 2Y7GA 1RJRA 4W87A 2DSZA 3R89A 4WQ6A 1O5RA 3TAKA 1EEPA 4QG6A 2YQUA 3W87A 3A47A 3MZ2A 3C2VA 3D0CA 4ADTA 4CKQA 2V2DA 1CLKA 4LRSA 1OGGA 1TV8A 4RZ6A 5XIMA 4TV6A 1NWUA 4I3GA 1YLVA 3S1WA 1IXNA 1JJKA 3CHEA 4ICMA 4H83A 1TPDA 3ZO9A 1XV8A 1AQHA 2VRKA 3GX9A 1WXYA 2ZZ2A 2FTPA 3SR6B 3RXZA 3UEQA 1YHTA 1W1ZA 1H62A 1PIIA 3BARA 4UQ9A 1QWGA 2Y4SA 3AYSA 2Y24A 2FDSA 4WKHA 3W37A 3DHFA 2MANA 1SFTA 1EJTC 1J6OA 4Y96A 4BQ5A 4FLSA 4HZ7A 1E1EA 2XSBA 3QSRA 1MQPA 1XGDA 1QI0A 3HPSA 3WNNA 5A3HA 1T8XA 1IWAA 2V9DA 4IUOA 1NDZA 4DYKA 3QGVA 1BAGA 3WDRA 1JYVA 1EIBA 3BAWA 1W2VA 3GQYA 4C65A 4P61A 1LYXA 2VEKA 1EP1A 3Q45A 3QF0A 1Y0EA 3GVRA 3NL3A 1N5XA 4WSJA 3PS7A 4LYRA 3FOKA 4JHOA 1OD8A 3AXIA 1NDYA 2ON3A 1K9TA 1ZAIA 1KFEA 1OVDA 1E6ZA 3FYOA 3RM4A 3LXAA 1JXKA 1H2IA 1LT8A 3ABXA 2Y8UA 1E6RA 3W7JA 1LOSA 1XYCA 3M41A 2WC7A 3VUSA 4M8UA 3GTXA 2VL4A 4CU6A 1V79A 1KTBA 1MWOA 4LSBA 3PBUA 4GIRA 2YGYA 4DJFA 1QNOA 3RMEA 1UR3M 2YW4A 1A53A 2J75A 3N25A 1JIBA 4W85A 4CNOA 2VRQA 3L7RA 1WP6A 4KESA 4AIOA 3P80A 2FB2A 1ISXA 1PUDA 2Y88A 5C9WA 3RITA 5F2MA 3LLDA 1O95A 4FIRA 3L4VA 4PTXA 1AD1A 4PCSA 5EMMA 1EHNA 3GYCA 3MHUA 3OVQA 3PBMA 5CPOA 1WUEA 6A3HA 4AAJA 2J8GA 1OIFA 3URQA 3LUTA 2DVUA 1E73M 4CQCA 2W61A 1EQPA 4MNKA 3BGGA 4OU1A 1GGOA 1K9EA 4Q4SA 3G0SA 5IHSA 1TTIA 2QPXA 1WDPA 4F48A 1WAWA 1AUSL 4W8BA 1R3YA 1LBFA 4H8NA 4GIAA 2E28A 3CHCA 3EB3A 3UZZA 1W1YA 5L6UA 2H3BA 3ARSA 3BLFA 4NRRA 5G1MA 4GRSA 4J3WA 4H2CA 3TH6A 2OKTA 1PTAA 4AYGA 4C6BA 5ABFA 4O0KA 3AS1A 4C6OA 1B30A 2OT0A 1OX5A 3LPOA 4QLKA 3ARRA 3PZQA 3LV6A 2VEGA 2B7QA 3OIHA 1GQLA 4JYFA 2FHFA 2GWGA 5HAOA 3MSGA 1U1UA 4QE4A 4WGHA 4LAZA 3W24A 4NHVA 1XIIA 2WZMA 4W7WA 3N18A 4NNCA 4M82A 5G2HA 1REQB 1YMYA 2FGLA 4S3EA 2VEIA 2ZIDA 4K38A 4YN5A 3IJQA 3W7OA 2Z24A 4HZMA 3K13A 3IAPA 2XVLA 1TPH1 2EF9A 4IIEA 5CG7A 3CXBA 1GZ1A 2ZUVA 3PC0A 1XYAA 4E2DA 1UR2A 4JNZA 3S83A 3H53A 1PKLA 4XQ6A 4N0RA 1M5WA 4ZO7A 4ZQRA 4OHQA 3E0FA 5KSWA 1RQHA 2WHLA 5CSUA 4AVNA 5FSEC 1NY1A 3ABQA 3W2MA 1MRAA 5G5GB 6XIAA 1U1HA 3FEQA 3E12A 2XH7A 1TB3A 4GK8A 1KN0A 4KPRA 1VDVA 3GVWA 4A8NA 5HNTA 4QTGA 1MI3A 1FO4A 1H3GA 2PGRA 5CQ1A 3M44A 2OR2A 5D8WA 2R1NA 2HE5A 1BGAA 1DBTA 4CVUA 1CLXA 2WMKA 4PODA 3T08A 4WSKA 1WDRA 4JIIX 5FCZA 2P3EA 5GRTA 1EDQA 1VBRA 2OWXA 1M7OA 4PUUA 1CGYA 5U25A 2X8RA 3DGRA 2Y63A 1N2VA 1SMDA 1DJYA 5DY2A 3G8EA 1W8SA 3CASA 4LANA 3V75A 4C6IA 2BXYA 2I9EA 2E6FA 3AXHA 3UPMA 2EPNA 3HOJA 3WUGA 4O14A 3F4NA 1VAHA 1TIWA 1HVQA 1ELSA 4PSPA 2BV9A 3GZAA 1EXPA 2SFPA 1Q4WA 4K1WA 1CPUA 4LCQA 1AW5A 1IWBA 3PWIA 4URIA 1XLBA 4XVEA 3QTPA 1DJIA 3UZWA 4E4FA 4S2CA 1P0NA 1IYXA 3SIZA 4IHCA 4TR9A 3W27A 4OV9A 2VZUA 1EBHA 1JDFA 4DIAA 2OODA 2QIWA 4R9OA 3IUDA 4YTRA 4ZOBA 1X8CA 3MYOA 4WLCA 1VRDA 1SJBA 1FCQA 2QCCA 2D2JA 2YR1A 1UJPA 4AZ6A 1EC7A 4LUTA 4R33A 1X98A 3VDAA 1FEBA 4D6HA 4UTMA 4L9YA 2W0UA 4XZWA 4JTHA 8TIMA 2A2IA 4BHYA 4J3VA 3GB6A 4QLLA 1XIDA 1GVIA 2XGBA 3QHNA 4HNOA 3A4XA 3B06A 1F61A 4H4VA 3QV9A 5A94A 3NL2A 1B9BA 1YDYA 2ZICA 4FK9A 3GXPA 3VIHA 4MTVA 4H3DA 1JGMA 1GW9A 1H0IA 4EX4A 4QNEA 4JX4A 4AB4A 2VGIA 1B1YA 3P82A 1GKQA 3GNRA 4JFWA 3UVIA 4AWSA 1M7PA 2RJHA 1DIOA 5LIXX 3ZVHA 1XSIA 1L2UA 5T9BG 3GDKA 3UG5A 5FACA 2ZXBA 3S4TA 4FO4A 3PNUA 2DIJA 1H0GA 4O12A 1WDSA 2WVSA 2QAPA 1RJPA 1MNSA 3H2AA 2ICSA 4GGBA 2UY4A 4E38A 4GACA 1DXLA 3APYA 3WLRA 5G5HB 3NL5A 3URAA 1HP4A 4JTGA 4JIEA 1A3WA 4HHPA 3SCNA 4AHOA 1ITUA 4CN4A 4AWUA 3GU2A 2F84A 3GXTA 5GQBA 2RDUA 4D8AA 4E3TA 1EX5A 4GX8A 3PJTA 4ZTXA 1ALDA 2PLKA 4P8UA 4Q4PA 3NG3A 2OLHA 1A5LC 3UWUA 1RQEA 4LYQA 3MJYA 3EWUA 3WQ5A 1JD9A 6CGTA 3UPBA 1IEXA 1NHQA 3U5UA 4X2PA 2DZSA 1R46A 4U3CA 1V3MA 3VNLA 5IBXC 2VKZG 1DWHM 1J5TA 3A3HA 1J2BA 3HN3A 5J5RA 1GOOA 1MDLA 1P1MA 1W37A 2PDFA 1UZDA 3FKRA 2V81A 4AMCA 4PTDA 4MLJA 4GY7A 3W85A 4PMJA 4ACZA 2OLAA 1FOBA 2ODOA 3MC5A 3JVAA 2J9YA 1J9YA 3FJ4A 4XK2A 5DQPA 3SCTA 3WQPA 4UC5A 3OGRA 2GJXA 5BOEA 2QYGA 3WH5A 1BLIA 5JIWA 5LIWX 3WLTA 3SCRA 2HS8A 5DMMA 3V0TA 4AU0A 2RFGA 3F4DA 1WV2A 2OX1A 3AMKA 5I3FA 4GZJA 4BURA 2VCCA 4RK8A 1TYPA 4LS2A 2PDCA 3O3RA 2JQXA 2YDAA 1EDTA 5CLTA 1J0KA 3BAYA 1I45A 3B0UX 1W9DM 2DH2A 5T8GA 2P50A 1E9ZB 2OELA 3TLQA 1GORA 4XD5A 3EOUA 4UNLA 4Q7BA 5F4WA 5CSYA 1TE6A 3D46A 1ZNNA 4P7RA 1C90A 2H8XA 5I3JA 3BLLA 1AZ2A 3K1DA 4HQVA 5LIUX 1PYFA 1JPMA 1TX0A 1CENA 3II4A 1ZL1A 4A3RA 2B4GA 2A3EA 4H7CA 4CNSA 3UWEA 2QCDA 3ITTA 3PF3A 1NOFA 1ZMCA 2NT0A 3KFTA 3L0GA 3B8TA 2GUBA 4P2VA 2E5CA 5F2IA 2CFFA 4AD1A 3UG8A 2QHAA 4IGMA 4GVIA 4FXFA 3UT0A 4NXKA 1TPWA 2BS9A 1XIGA 3BSHA 2W92A 2X09A 4WUIA 3OODA 2HJPA 3TSDA 3WH7A 2TSYA 1FVPA 3SECA 3RN6A 5IFTA 5ABHA 2HBXA 1BFNA 3RDKA 3ARZA 1F2JA 3ECQA 5EBAA 3CEPA 2XUCA 1K8YA 3CZLA 3N73A 2X8HA 5CPQA 2HE8A 4OGZA 4YTSA 3LTYA 3VOGA 1HO4A 1HUVA 4X3ZA 2EAWA 3HQPA 3CWNA 2C3CA 1QI3A 4ZO9A 2AAMA 3SCWA 1CI1A 3S6TA 3G5EA 1H5YA 2WJZA 2VDGA 5HWJA 5AC5A 5JRBA 4ADWA 4NL1A 1SUXA 2QUTA 3S9IA 3NQ7A 1OYCA 5D2TA 3K8LA 4J3UA 3KWXA 3O8AA 3T8LA 1JPHA 4US5A 3HZ3A 3BO9A 2NLIA 2AKMA 1XRTA 1Q6EA 2BGSA 4D6IA 4PB5A 4OBRA 1E56A 1UIPA 1UMYA 2AOSA 1V4YA 1L8NA 1GOWA 3ZT5A 4QBXA 3T1GA 1DJXA 2XISA 1PCWA 5MF5A 1I1WA 4LXFA 3LYEA 4H19A 1E43A 2VCBA 1ZK7A 2ABAA 4OBSA 5M2FX 1GQNA 1R9YA 3CUIA 3MSYA 3IVTA 2GUYA 1EO5A 3QW3A 3FJ6A 5CPLA 2ATSA 2XN2A 3TX9A 1UOZA 2X1SA 4JFTA 3DYOA 3ZXWA 1B4KA 5DRCA 1GWJA 4PL1A 1A5BA 1SPQA 2ZRWA 3T2PA 3A9IA 1W1A1 1F4AA 3OU8A 4OUEA 1RK5A 3TSBA 3A6OA 3WF0A 4IMAA 2GK1A 4FF5A 4Q3MA 4HZ8A 3EKLA 3YPIA 3DFSA 4J35A 3BW2A 4REQA 1VCVA 1PTGA 5J8LA 4C6NA 4JQ9A 3RO8A 4H9TA 2P1FA 2BVYA 3H70A 4Q7NA 3FK4A 2BODX 3KOYA 2PGFA 4D6JA 1XLFA 3TMLA 1OJXA 4H7ZA 1K1DA 1E6XM 2QAFA 4LY4A 4E4PA 2NPXA 3NDZA 5AC7A 2PDIA 3TYBA 3IJ6A 1HNYA 2J7CA 5BCAA 3QEZA 1AODA 2C13A 1QW9A 2BP1A 2J7BA 4AZBA 3JS3A 5FEZA 5M03A 1R7OA 4ZZ9A 2E0PA 2WP5A 1UQZA 4N4PA 1W5MA 3H23A 3EPMA 2CXGA 3RUBL 3A21A 4L5ZA 1I2OA 2TRSA 3I68A 4GLEA 2QPUA 1ISYA 2Z1WA 3EDEA 1Z42A 2QR6A 3LZ3A 3QBUA 4UZUA 4Q8MA 2A85A 1ISVA 4IMDA 5CKSA 2VURA 2J7DA 3C56A 3BICA 3HTWA 4D6EA 2C0AA 3C2EA 5FL0A 4KQNA 1UD3A 2WLYA 3UXIA 3ERPA 3TK7A 3H21A 5G1TA 5C5YA 1TE1A 5A1AA 1AFSA 3KVKA 1F3XA 9CGTA 1Q66A 1LJYA 3EMQA 1TPFA 3DXIA 2J24A 2WCAA 4BF5A 4G8TA 1J2WA 1NU5A 1AQMA 1XBXA 4PUWA 2DPEA 4EK7A 4PTMA 4L4OA 2INEA 5FJUA 3OGSA 1LLOA 4XZNX 3WBXA 4AXKA 4C6PA 2ZA2A 1E9YB 3W7LA 5ENLA 3JZUA 1KXQA 1A4LA 3BE7A 4YPJA 5EY5A 1L6YA 3RHGA 2ZRUA 5AB3A 2W67A 1GOIA 3LD5A 1G1YA 2FPTA 1ZQ5A 3KOWA 2F9RA 1R7AA 1DQWA 5CZSA 1S2WA 1E15A 3CAKA 4XIMA 4WY0A 4JEQA 3APTA 3M5VA 2E1DA 2PRMA 4LUTB 3AUJA 4FDCB 1X1ZA 3PTDA 3QV6A 4AD2A 3C0JA 4I90A 5TIMA 4B5SA 4XAFA 3WMSA 2VGFA 3P0WA 3SCQA 4JCMA 3OQEA 3E02A 1Z9AA 4H8HA 2WKLA 3LCXA 4GX9A 4M29A 2X2YA 3QOMA 1BSLA 4JBRA 3BJSA 1KTNA 3F2CA 4DRSA 1T8QA 1Q85A 3FJNA 3DK4A 4EAYA 3DX5A 1F76A 5KMYA 1C29A 4JKMA 4JTAA 3T0CA 1GVEA 2NWSA 2WMHA 1OG6A 4I9AA 4Q4KA 4PMNA 4FPSA 2PLCA 3BZGA 3EXTA 4HP5A 1V3KA 3V0SA 4DLFA 2C91A 4GYFA 4WJEA 3CMFA 2RDTA 2V3GA 1QAPA 1BXCA 3ZVHB 1FP9A 3AHTA 3RJXA 3C0LA 3ZR6A 4ASTA 2NXHA 5AC4A 2CLPA 9XIAA 2REQA 5G4WA 3KDOA 3AXXA 3ZZ1A 3IIVA 5FOOA 4IIBA 4ILSA 3NDOA 3MS8A 1XLIA 3PZVA 3USZA 3DFQA 4H4SA 2IPWA 1OQFA 3O0KA 1J0HA 3CO8A 4D6GA 1S5VA 1US0A 3AIWA 3MU7A 1UUMA 1XHCA 4GYPA 4LAKA 1TA3A 2EPHA 1QMLA 4WZHA 3P67A 5L9FA 4C6CA 4MM1A 5I06A 4DPQA 3LHUA 3H2EA 1PX3A 3H4GA 2E4TA 3CNYA 1SZNA 4Z2KA 4IP4A 3LN3A 3DBNA 3NM1A 5TF0A 1J96A 3DI1A 5CAHA 4BWLA 2WKGA 1JG9A 2A8XA 4O11A 1KO0A 4LX4A 1LDCA 3W7RA 3WIJA 1XP3A 2V6AA 2ZDSA 1QPOA 5CLWA 4CCDA 3WN6A 3QC3A 3CEUA 3LM7A 2TYSA 3L9CA 2HSAA 3WY1A 1DEDA 3K4DA 5BMXA 1KWKA 4DO6A 3LXCA 2P0OA 3W38A 4MLRA 3ABZA 3QC0A 4JY9A 3E2VA 3C3UA 2O9OA 2BVWA 5FS6A 1T40A 3E5BA 3M46A 3AS2A 3OEXA 1Q6OA 1TMQA 4PUMA 4NUWA 1JUBA 4WF7A 1XYBA 2CYGA 1B31A 3L4TA 3W07A 2XM2A 3C8NA 4Y9PA 2YDRA 3FY1A 2VFFA 1EQCA 5KZMA 3WFLA 4UZSA 3TWAA 4ACZB 2R9ZA 4RNIA 4MZ8A 3AI0A 3SAZA 2QCHA 4EM3A 4X0NA 3WH6A 3WH8A 3ES8A 1O1HA 1FWEC 5I79A 1V59A 4JD4A 4RNHA 4K2SA 3FFSA 3H6OA 2PC8A 3ZFHA 1XLKA 1E6QM 2XIIA 4MHBA 2YYTA 3EX4A 3NO5A 3NM3A 3NQ6A 1DWFM 1FWJC 2P10A 2ZTKA 3IANA 3UA3A 3BGAA 2CLLA 5D02A 3HGRA 3FYYA 4O53A 1LL7A 2QKFA 4YWSA 4G7EB 1EJXC 2HTMA 1TWWA 4B9ZA 1Y5WA 3FAWA 4RV3A 4UBPC 1ODUA 5K9DA 1TV5A 3NVYB 1VD6A 3B9OA 3ANYA 4CEUC 4JIHA 1JI2A 3DEQA 3MI6A 1RBOB 1WZKA 3LBMA 4HPNA 2UWFA 2DORA 1CXIA 4GH1A 1TZZA 2QAEA 4JTKA 2E40A 3MP3A 4ENLA 3M0YA 3DFPA 1LLZA 4F2BA 1YX1A 4Q8VA 5I2UA 2YYUA 2QCDB 3H7VA 5EBUA 3WD3A 1UKPA 1V08A 2ABBA 3H4XA 3J7HA 3E2SA 2YZ5A 4JX6A 1PCKA 3WQOA 1R8LA 2PI6A 1FXPA 2ZA3A 3MMDA 4H2HA 3GS6A 3STPA 2WOVA 4B5UA 3GC5A 4UFLA 3BC9A 1P6CA 2CHOA 4DO5A 4EWND 1LOLA 3WJSA 1KM4A 4PE8A 2QVNA 4GVGA 3VKCA 4GNVA 1UBSA 3NFUA 4Z2HA 5F2LA 3M6DA 3CV6A 4EACA 2VP8A 3WENA 2B7PA 2I14A 1TTPA 3W72A 1BHGA 2GQ9A 3UYIA 3CV1A 4NIRA 5C71A 5EL1A 3RU8X 4HHLA 4ALDA 4O1BA 2GYIA 2F8QA 3PFMA 3AHXA 3W4RA 3IWPA 4HKPA 2D0FA 1S1RA 3HMCA 5A6KA 2BOEX 4FHAA 1DXFA 4LBSA 3W23A 4C6FA 3QKEA 2PDMA 3L0KA 2WANA 4MY9A 4Y9MA 1YXCA 4I6VA 1QHPA 2G4JA 2KAUC 3MI2A 2VD8A 4R3UA 4S38A 4AG0A 2F2HA 3GG1A 4PTWA 2G37A 4A8IA 1RSCA 1VFMA 4UMCA 3VIFA 2Q01A 4HNUA 5A2BA 1HJWA 3IJ9A 2ADAA 1XLHA 5I3HA 1OCNA 1ZENA 4FLOA 2IUZA 4ORIA 3KP0A 4XISA 1W3NA 1G6CA 1TPC1 1H61A 3CLMA 3EDJA 1IEWA 1OBAA 4WOZA 1F3EA 1R87A 3VCRA 3L68A 3TC3A 3WMLA 4CN6A 4KETA 3BGJA 5BXSA 4MZ1A 3GR8A 3L23A 3NOYA 1U1JA 1VPXA 1FCVA 1P7TA 3QFAA 5AYXA 1P1XA 1N61C 1LBLA 3VGGA 1UROA 1HKIA 1V3LA 5IOBA 5G4EA 2GK1B 4HN8A 4DBEA 3PHAA 3BV7A 1KFBA 1V02E 3LPFA 4CD6A 1Q6DA 1XLEA 3QLDA 1PZ3A 4QDWA 1FCUA 1B5TA 4R27A 4GG9A 4QNWA 4MDOA 3DN5A 1TMLA 4BJHA 3GZ3A 2PRHA 5LA1A 1IXOA 1H7XA 2O92A 1SJDA 4MJMA 3S1VA 1GVFA 1XHGA 3W9ZA 1W9UA 1X39A 4C6EA 1UR9A 1Y65A 4H9ZA 4H6QA 1DJGA 1SW3A 1DTNA 1QW8A 3M9YA 3WX7A 3D3FA 4NZFA 3GNNA 1VPYA 4O50A 1H4PA 2DZPA 2JGYA 1W32A 3SUWA 4BA0A 1BYBA 3VDBA 3NZPA 1F73A 3SN4A 3VGEA 1YDVA 3E49A 3EWCA 3GWQA 4UR7A 3KZPA 4F0LA 4HOZA 3G1HA 4GIEA 1IT8A 1ZCCA 2FYMA 2WO5A 4PUEA 3NZGA 4RE3A 1SW7A