3U9IA

The crystal structure of mandelate racemase/muconate lactonizing enzyme from roseiflexus sp.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
366
structure length
346
Chain Sequence
b'TAPTTIRALTVAPLDIPLHEVARNLLVAVELTDGTRGYGEAAPFPAFNGETQDMAHAAILAARSLVEGADVREWRRIALALPALPGMTGSARCAIETAILDALTRRARLPLWAFFGGAATSLETDVTITVTAAARAAQAIVARGVTTIKIKIGTIRTMEHDLARIVAIRDVAPTARLILDGNCGYTAPDALRLLDMLGVHGIVPALFEQPVAKDDEEGLRRLTATRRVPVAADESVASATDAARLARNAAVDVLNIKLMKCGIVEALDIAAIARTAGLHLMIGGMVESLLAMTVSACFAAGQGGFRFVDLDTPLFLAENPFDGGMTYHGGTIDLTLIEAGHGVTPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme, C-terminal d
publication title The crystal structure of Mandelate racemase/muconate lactonizing enzyme from Roseiflexus sp.
rcsb
source organism Roseiflexus sp. rs-1
molecule tags Isomerase
total genus 109
structure length 346
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3u9iA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3u9iA01
5EU9A 4IL0A 2PSNA 3IJQA 3KUMA 1TE6A 2QDDA 4KT2A 3DDMA 3VFCA 2PTXA 3T4WA 1FHUA 1XPYA 3CAWA 3BJSA 2PGEA 1MDRA 1MRAA 3ZVHB 3ES7A 4H2HA 1FHVA 3DG3A 3N6HA 4HN8A 3OZMA 3R0UA 2OKTA 1EBGA 1SJDA 3I6TA 2PP3A 3CT2A 2PS2A 4GIRA 4M0XA 3RCYA 3EEZA 3MSYA 4ZA0A 4HYRA 3THUA 3SN1A 2P3ZA 3FV9A 5BOEA 3FJ4A 3SSZA 2QVHA 3N6JA 4G8TA 2ONEA 4E4FA 3FCPA 3ZLGA 2GGGA 3Q4DA 4IP4A 3QN3A 3V4BA 1KKOA 4F4RA 1MNSA 3TCSA 2XH7A 2PTZA 3DIPA 3TQPA 3JZUA 3GO2A 3ZVHA 3R10A 3CK5A 3RRAA 1WUFA 2OFJA 3CB3A 3EKGA 4IHCA 5FJPA 2XGZA 3ZLFA 3RGTA 1PDYA 3T8QA 4KWSA 4E5TA 4GGBA 5FJOA 1NELA 3ES8A 4J1OA 3QTPA 1MUCA 3ZLHA 3OPSA 1BQGA 4MMWA 4HNCA 2OX4A 3QKEA 4E8GA 1F9CA 4H83A 3VC6A 3DG6A 3NFUA 2GGJA 4K2SA 3V5CA 4X2PA 3UCDA 4IZGA 5FJUA 4HCLA 4DWDA 3H70A 3R1ZA 3H12A 3TWAA 3MZNA 2PP0A 2RDXA 1RVKA 4EWJA 4G7FA 3P93A 3JVAA 1JCTA 3UJFA 1W6TA 4IP5A 1YEYA 2PTWA 3VDGA 4E4UA 2QJJA 3R0KA 4JN7A 2PTYA 3D47A 2P8BA 1E9IA 3VA8A 3B97A 3DERA 1SJCA 3P0WA 4GISA 1EC9A 2DW6A 3DGBA 4GFIA 2AKZA 4K1WA 4DN1A 1L8PA 4GMEA 2OVLA 3DFHA 4KPLA 3I4KA 2PCEA 3SQSA 2DW7A 3UJ2A 4A6GA 3TOYA 2P88A 2ZC8A 2XH4A 4MGGA 1TKKA 3SN0A 3V3WA 2XSXA 3S5SA 4E6MA 3S47A 3GD6A 3TJIA 1MDLA 2GSHA 4ROPA 1TZZA 3PWIA 3D46A 4H19A 4GYPA 3PWGA 2OPJA 3MUCA 3R25A 4FI4A 3UXKA 1JDFA 1SJBA 5BOFA 1ONEA 4J3ZA 1SJAA 4DHGA 2OZ8A 4M6UA 2AKMA 3NZGA 3MY9A 1DTNA 3UJEA 4A3RA 2PU1A 3BOXA 3UCCA 3BSMA 4IL2A 3UXLA 4IT1A 3H8AA 3OP2A 1EC8A 3DEQA 3I6EA 5FJTA 3CXOA 3VC5A 5J04A 2PPGA 3U9IA 3UJRA 3MWCA 4GYPC 4KEMA 3H7VA 3RR1A 4DYEA 1BKHA 2GGEA 4FP1A 2GGIA 1XS2A 3FVDA 3IK4A 2FYMA 4MKSA 2QJNA 1ELSA 2OG9A 3T9PA 3VCCA 3T6CA 2HZGA 2P8CA 4ZCWA 3QPEA 3DFYA 4HCDA 3ZVIA 3N4FA 2OLAA 2PP1A 2MUCA 2PODA 1NU5A 1P43A 5IDZA 2P0IA 1WUEA 3MKCA 5FJRA 4ENLA 4JHMA 2I5QA 2GL5A 3IJLA 3DG7A 1IYXA 2FKPA 4JN8A 3VCNA 4K8GA 2PU0A 1R6WA 2XH0A 3R11A 2OQYA 4GGHA 2QGYA 3SJNA 2OZ3A 3HPFA 3UGVA 1EC7A 3CYJA 3NO1A 2QJMA 2PA6A 1EBHA 2POZA 1KKRA 4DXKA 4YWSA 3JW7A 4DX3A 1OEPA 3K1GA 2HNEA 1ECQA 2AL2B 4HPNA 2QDEA 3DESA 3V5FA 1KD0A 3OTRA 2HXUA 3TWBA 3U4FA 1JPMA 4A35A 2XH2A 2PMQA 3UJSA 1P48A 3ENLA 3OZYA 2NQLA 3GC2A 3N4EA 2OO6A 4Z17A 3TTEA 1JPDX 1KCZA 3GY1A 1R0MA 4Z1YA 2OQHA 2GGHA 3SBFA 4HNLA 3FXGA 2ZADA 4H1ZA 3QLDA 3RITA 3FYYA 3TW9A 3STPA 3Q45A 2CHRA 3TJ4A 3SN4A 3PK7A 3IJIA 2GDQA 2O56A 2AL2A 2HXTA 3P3BA 2OZTA 6ENLA 2MNRA 3PFRA 2QQ6A 2PGWA 7ENLA 3RO6A 4HCHA 1PDZA 3NXLA 3MQTA 2AL1A 3OW1A 5ENLA
chains in the Genus database with same CATH superfamily
4GY1A 3BMVA 2WZHA 2YIHA 4LUYA 2CERA 1YTDA 4XX6A 1TZ7A 2OWWA 5AZ1A 1QPQA 4ZXLA 1T5AA 2VVNA 2YJQA 2BXVA 3C2YA 3VDCA 3QHOA 1J0YA 4UNKA 2YKKA 2XGIA 4QGCA 5C55A 4H9ZA 1VJIA 4UB9A 4Y90A 1TQJA 3BJTA 3CL6A 1OGBA 2OKTA 2ALRA 4ZO9A 4WLCA 2EO7A 3VIMA 3VX0A 4M1BA 3S2LA 4PMNA 1NHRA 3PP7A 2EAWA 3WJSA 4PTNA 4MZ1A 2YA2A 4HD5A 1IGSA 1R3SA 3N4AA 2QUNA 4NJIA 3B8SA 1REQA 2UY5A 3KBWA 3LLDA 1XIDA 4H4UA 3P74A 2XFYA 3WK3A 4NZCA 3E12A 3WQGA 3SR7A 4LBRA 1KV5A 3AMCA 4QQUA 4QRNA 3NIYA 4FXSA 1VPQA 5GQBA 2PTZA 3JUGA 3VINA 4AEOA 3FEQA 3BLPX 1V08A 3B9JB 2UWFA 3CPGA 4H4XA 3GTFA 4DWSA 4JX6A 2E5AA 3VVGA 2E77A 4HNVA 2XIIA 3SCVA 3WQFA 4S38A 2E9BA 3ZLHA 2QKFA 4IGMA 1B3YA 1A47A 2J4GA 3EDFA 4HZMA 3GQYA 2XIBA 3W86A 1CIUA 4B5NA 3L4VA 1CGYA 3DG6A 2AQVA 1Z3NA 1K7EA 3IIXA 4HCLA 1JL8A 4WDTA 3B8WA 3U2EA 2A4AA 1OHLA 5JH1A 4AC1X 4XIAA 4I9TA 5HDRA 4HPXA 4F0RA 3LTYA 2E9MA 5JBFA 1GTHA 4JTSA 4N42A 1C93A 2FHCA 1KW1A 3S5NA 1XHCA 3KRZA 2WMHA 4GK8A 1ZRQA 4S3KA 3NVWB 4O12A 3MV01 2QJJA 2Y6ZA 2J7CA 4CQBA 4JN7A 1VBUA 1HJXA 5E9XA 1WDWA 1DQWA 4W7UA 1WAUA 4QS5A 1SPQA 3CWNA 4FEZA 4LB3A 4F8XA 4IJBA 4MWAB 2Y63A 4UUIA 3KZSA 1TA3B 4Z2LA 5MHBA 1V3JA 3H55A 1W3TA 1BXNA 1HJVA 4PRTA 2DW7A 3QW4B 1SR0A 2V6OA 1OVDA 3ARTA 4CNOA 2ZWZA 3IS4A 1GJUA 2WVVB 3NQGA 3UWVA 3BH4A 1LWIA 1EP2A 1D7FA 1G69A 1HIZA 1PPIA 2VOMA 3W6YA 1N5XA 3RFAA 3N2OA 2GR0A 2X1TA 2CW6A 3R25A 2F6XA 3VI2A 2HRWA 3MUXA 1QNRA 1DHPA 3T81A 2OCZA 3UWYA 1VFOA 1XC4A 1FWTA 2AKMA 1G5AA 3B9DA 3WMLA 2Z7GA 3GHTA 1EGZA 3G1RA 2RJGA 3FOKA 2D1ZA 4HHHA 4PCNA 1LWJA 4UBPC 3AHVA 1B57A 4XBKA 4CU7A 3NYZA 1Q13A 4M56A 1LL4A 3FN9A 1QI0A 5T91A 1IXNA 4CQ9A 1OFAA 2VWTA 2C8NA 4BEUA 5K3VA 3VNMA 2BC1A 4QDWA 1TV4A 3PNUA 5EMMA 1NFPA 3PNZA 1K6AA 4KFPA 2E6AA 1QPOA 3IARA 4UWMA 4DBWA 3FYOA 5TNVA 5D32A 5BCAA 4URIA 3CPUA 5CG7A 1K4HA 1WOBA 1G9HA 3I7SA 1FRBA 3H2FA 3W1TA 2VGFA 1BWCA 4DNAA 4RLIA 2PFHA 4C7DA 3N4FA 1O60A 4WJXA 2VD9A 5LXEA 1BD0A 4Y7EA 3WNOA 3GHUA 3TKFA 5LA2A 2VO5A 1IEVA 1B3WA 3QFEA 4M7TA 1E5JA 1JIBA 1WV2A 1J0JA 2NLIA 3DC0A 4TV5A 4J3UA 2FJKA 3HPXA 3WY1A 1E0UA 1I2QA 4MIMA 3EAUA 3DGRA 5I24A 2QGYA 4MNJA 2KX9A 3HPFA 4MPKA 3F2CA 4GOAA 3HJEA 1JPHA 3G18A 4UTTC 3WQVA 5HNRA 3EX3A 5E6YA 3V35A 2NZLA 3HTWA 3IAPA 3KXQA 1AQ0A 3LSCA 2OOFA 4LAZA 3DK4A 2ZWYA 1XDIA 1EGMA 4O4VA 4JTUA 3K2GA 3NDOA 4ZE4A 3CHEA 1KBBA 3OLGA 4DJEA 1CB2A 3A47A 2OGYA 5AVHA 4DAFA 3W7JA 5BXPA 1P6WA 3QHNA 4QROA 1K8CA 3B40A 3PSVA 4WY0B 1IT0A 5GVJA 2J74A 2BHZA 3Q65A 1R3WA 1GORA 2SFPA 2VYOA 1CGTA 1MMFA 2HVOA 4ZQNA 4WUIA 5EL1A 5G5HB 1JRCA 4HQVA 1Q4NX 3CH9A 3WJXA 2BMBA 3C86A 2GGHA 4OIFA 2HMCA 3RK8A 2ZUWA 1QDSA 1V93A 3M41A 5M2FX 3TX9A 3GDKA 3SUSA 3W1UA 1P0DA 2E8YA 2OSXA 1CZ1A 4WKAA 1Y65A 2PAJA 4BQ4A 2BVYA 2QCDA 3VIFA 5HJLA 5L9FA 2UZ9A 4HJWA 3P3BA 5JRBA 3IVTA 1NHQA 2MNRA 3OVQA 1HQTA 3I7RA 3VXGA 3ZR6A 1OX6A 3GDLA 2GJLA 4Q4PA 1HUVA 2DZPA 3W73A 2NW0A 1T8QA 1XRTA 4N9CA 1Y5XA 2WOVA 1UD8A 2EEXA 3KUMA 4BHYA 6A3HA 4ZQPA 3OQ8A 4M6VA 2WVTA 2PTXA 3BL3A 4B2DD 3CZKA 4GXWA 4X9YA 1I9CB 4Z1BA 3CS2A 4RW5A 3DZ1A 3R8GA 4B4FA 2JF7A 4LS1A 3H22A 1YADA 4JIEA 2Z1BA 3N29A 3DG3A 5CH9A 2WC4A 4IPPA 2YCJA 3MC5A 2X7VA 1Z8AA 2RH9A 5CXPA 3W01A 1L0PA 5G5GB 4FXFA 2QMJA 4FXRA 3EEZA 5GRTA 3HV8A 4OJYA 3MVIA 3EWYA 1KWKA 1OT2A 2EPLX 3P67A 3NQDA 5AZ0A 2J7GA 4JIHA 1GESA 4JTRA 4AXKA 4Q32A 5D2TA 5FMHA 3ARSA 1V8EA 4DQWA 1E1CB 5BYWA 3PFMA 2BVWA 4RZ5A 4LC8A 3W26A 3LZ3A 3OVPA 5LNSA 1VFLA 3K1DA 4V1YA 3ZS4A 3SCOA 3Q4DA 1TYTA 3RPDA 4CD4A 4GC3A 1UB3A 4GJJA 4EPDC 4FF5A 5JBDA 5CSUA 3C0JA 5F2LA 5CGMA 4HKPA 3L2IA 3ARQA 3R10A 2BXYA 3SW6A 3FGCB 1E1FA 4BV6A 4I9MA 4PTWA 1TELA 1SZRA 1GOIA 3RU8X 2Y62A 1RBAA 4FMVA 1XISA 1F8MA 2EPNA 1XIBA 3S2JA 1ZMDA 3AOFA 1K9TA 1PHWA 2XIQA 1JR1A 1IWBA 1XDMA 1OFPA 1M7XA 1H1NA 1MFUA 5A6BD 2DZWA 3VE9A 1GSNA 2OODA 2UY3A 2FHFA 4E8GA 5KETA 4B5SA 5CLTA 3AU6A 3TC6A 4U2ZA 1H7OA 2XVGA 3H4GA 3LLFA 3MZNA 3CZJA 4R88A 3I65A 2YYUA 3M5ZA 4DJDC 1TJRA 3WFAA 3ZJ7A 3TE9A 2A3HA 1JYXA 2FFIA 4E4UA 3EX1A 1SZFA 3HFTA 3UY7A 2FMNA 2PCQA 2PRLA 4IGHA 1PKYA 1CXIA 4J7RA 4C6KA 1E9IA 4W8LA 4W8AA 4O52A 1S5TA 1OC7A 3P0WA 4QISA 1FH8A 1L9WA 1NEYA 3GNNA 1ITCA 3T8LA 1EJ7L 4HB7A 1A3WA 4I7VA 1JYVA 4A8RA 3HG3A 3MO7A 1QI4A 4NG3A 1TX0A 4AF0B 1S7MA 3WUGA 4D2JA 4XBSA 4C6PA 4KPLA 3SQSA 1O5XA 1JEHA 1DTUA 1MZHA 5A95A 2XWEA 3WQPA 3EB3A 4EPBC 3NR0A 3EXTA 4JHZA 3BGJA 4ZE5A 1DEDA 3S5ZA 2O7SA 3N18A 1OIMA 4DUWA 3S83A 4TUFA 1WP6A 3BJFA 5DMYA 2I7GA 4UFKA 1FP9A 2A85A 3DHPA 2X2YA 3JS3A 1H7NA 3BUVA 1WA3A 1SM9A 3S4TA 3BAKA 4J3ZA 3T0CA 3ZT7A 1GRBA 5GJMA 1GRGA 3MCMA 4FZIA 3S1GA 4MYAA 5AY7A 6XIMA 3MY9A 1WOAA 5T26A 3EWXA 4LVGA 3AS0A 2WXDM 1HNYA 3LBOA 4W5UA 4F0LA 3V0TA 1QATA 4IT1A 3NVDA 4MYXA 4H4RA 3BLLA 4PFHA 1UD5A 2YBVA 3I6EA 3QKZA 1R46A 5FJTA 2BVTA 3SFWA 3CXOA 4EF8A 4DO7A 1YNPA 2WMJA 4MB1A 1FHDA 2Z29A 1UP0A 4OOZA 4K7YA 5F1VA 1OGGA 1SQ7A 4PH6A 3LBCA 1M5WA 4ASTA 1PZ2A 5I06A 3DGZA 3PM6A 3NURA 3LV6A 3WF1A 4UQDA 3DFYA 1R2TA 4UOQA 1G7VA 3CWHA 1Q6RA 1NU5A 4LEQA 3BAWA 3M0ZA 1SZGA 4YVPA 2V2HA 3GR4A 1SW0A 2VEIA 5D2WA 3TN6A 2VFFA 2ZZ0A 3AMDA 4MZ8A 1SFTA 4B5WA 2X16A 4LCRA 3TFXA 4B5VA 3B8VA 4US5A 2PDYA 2QJMA 4Q8TA 2OYKA 3WQCA 7TAAA 3AQUA 2DPEA 3HJZA 4M24A 2J7BA 3TA9A 1FFQA 3NOYA 3W1QA 4DJFA 4BQ5A 3ZSSA 1O95A 3QYQA 4K37A 2BP1A 3HPAA 1V6WA 2Z1VA 1Q3NA 4O16A 3MW7A 1S3HA 2QULA 4P8VA 1JUEA 4HA4A 8TIMA 1PIGA 3ME3A 4P8UA 5CC3A 3V5OA 1XQLA 2EJ1A 4X0NA 1P48A 2RGLA 1DHKA 2F6KA 3AYTA 4PRWA 1ZX9A 4NX0A 1DJGA 3WLLA 3AN1A 1QWKA 3DFTA 2CNCA 2V81A 5CZJA 3P5ZA 3GIQA 4UNLA 2VQUA 2AQOA 5KZ6A 1H11A 1MI3A 1OK6A 3NAVA 4KCVA 5AKQA 1MXSA 4G1NA 4KGJA 3UA3A 4CNPA 3VIIA 4K8DA 3UZJA 4N9EA 2GUUA 2V69A 4GG9A 1MOKA 1B2YA 5KITA 3KFTA 1VEMA 4TVDA 1PYMA 1DIEA 4C1NA 1YBQB 3PFRA 1DWHM 1A5OC 1GYNA 1DXFA 3KP1A 4OBSA 1QAPA 3CGTA 4D8AA 3OHMB 3WDRA 5E93A 3MQTA 1J01A 1X2GA 5DBUA 4AIOA 2VDHA 1KA9F 4DPQA 4DUOA 1PCWA 3SGGA 3FX4A 1OJXA 4TQTA 5A6MA 3LCLA 2QDDA 2F2KA 3FY1A 3GBDA 2YFNA 1FHUA 2Z1WA 4QBXA 4ZMGA 3S2CA 4TMBA 2PURA 3N73A 5AC4A 1Q1WA 3DI1A 1A49A 4AISA 1GGOA 3GTXA 3P14A 2DVXA 2E4TA 1ONFA 1XGEA 2VL4A 2BG5A 3E0LA 4LAMA 4H7VA 5DF0A 1TPB1 1NM9A 1YE4A 1Y8BA 2AGKA 3PBVA 3ARRA 5XIAA 2VGIA 2Y5JA 1OJTA 4ZSTA 3ABXA 2J3NA 3LEPA 1H1ZA 2YGYA 4IMCA 2Y88A 4FX7A 1KM1A 5I3JA 2V5DA 3B0YA 2HTMA 4AY8A 4DUXA 3TQKA 4HZ6A 3QQ0A 3SO7A 4HA0A 4KH2A 1H2JA 1AL7A 4H4TA 1XG3A 4WR3A 1EHAA 1EXPA 4AZGA 5LYRA 4Q8QA 1E56A 1UWIA 1V77A 1XLBA 1S3TC 4JIQA 4PULA 4AVOA 3CB8A 3DIPA 3SUUA 3W07A 4GZEA 3ZVHA 3G1XA 2BASA 5JCMA 2YAUA 3ATYA 3WQ6A 3TLLA 3GR7A 5FJPA 5KVIA 5AN7A 1XLCA 1PDYA 5JUVA 2QUUA 3UVAA 4I6VA 1EJSC 1W1VA 5IXEA 3O2LA 3LV5A 2X7WA 2EPKX 2OX4A 3ARYA 1VRXA 1M1BA 1XI3A 3QY8A 3MVTA 1PX4A 2VGGA 1LLOA 4S3BA 2VX4A 3C2RA 3PZMA 2J8FA 1MRQA 1NIUA 1VFMA 2LLEA 4JN6A 3HMJG 3AJXA 3Q67A 1UJPA 1TV5A 1X8CA 1JCTA 2PC8A 2HPMA 1XLHA 2GRTA 4HK5A 4H6QA 4FA3A 1XIGA 2PDCA 3LPGA 2DZTA 2DH2A 1LT8A 2KZHA 3H7RA 3VGGA 3MP4A 5FF0A 4HP5A 1GYMA 1YX1A 2GPTA 4H6EA 2DW6A 2QAPA 4ZFMA 3QGKC 1T6MA 1OFEA 3SZ8A 3GVQA 1KRBC 2JFEX 4GNKB 2NQ5A 2XFRA 3W84A 5KSWA 4GMEA 2R91A 1XGDA 4MOZA 2PLJA 1FEAA 3W2LA 4IJCA 5FS9A 2FZ8A 1EUAA 1N63C 3TONA 4R9OA 3SN0A 3MKKA 3C3UA 4U4MA 2XDFA 1ZBCA 5HAOA 1XKYA 1EEXA 2DZSA 5CSYA 5LGXA 1LLWA 1NF0A 1KFBA 4Y9OA 4JFWA 1O1HA 3PWIA 2YQUA 2E25A 1QHZA 1LOSA 3LG3A 3GBEA 1MVYA 5FA5A 2GQWA 1TWDA 4R3UA 3CHCA 4PEKA 1FWCC 1NQ6A 3E0IA 3LMZA 1PKMA 3HPSA 3KP0A 4GINA 4XUYA 1OB0A 5KZEA 2X2GA 5C2XA 3E49A 4L6OA 3G1FA 3GVGA 3WD4A 3LA4A 2W92A 4PA8A 3UCCA 4K8EA 1GVQA 1W1B1 3MB9A 2CZ5A 3UXLA 3L21A 4Q8MA 3IRDA 2ESCA 5LHFA 3CLMA 1VFSA 2NUXA 4IX0A 3RX4A 3VOCA 2PPGA 3KBNA 5D02A 5F7UA 3L0GA 3NPXA 1IWAA 2VCCA 3BURA 2J47A 2R1LA 4MG4A 4DY1A 2WV8A 5HWMA 3S9ZA 5I77A 5E0CA 1TWZA 1Z7AA 4V28A 2YL6A 2DV0A 5HMFA 2PDMA 3WBEA 5LA0A 1IEXA 1UUQA 1XX1A 1SW7A 1JULA 1U2YA 5C9ZA 3SCTA 4H9TA 2GLKA 3FA5A 1EJRC 3ARWA 3KWXA 5HK4A 1HT6A 1X1OA 1JDAA 1GQLA 1YLVA 1J8VA 2RHGA 1QI3A 3HBLA 3TYUA 1F5ZA 3NO3A 2OQYA 1SFSA 1W37A 2ISSA 3N17A 4BF5A 2D3NA 1FHLA 2BHUA 2Z27A 3APTA 2WWDA 5I00A 1PX8A 4B9ZA 2DIJA 1YW1A 1J5SA 2BLEA 2DT1A 2R9RA 4AD5A 5C9RA 1DOSA 1UZHA 3KBVA 1Z9AA 3PTMA 2HXUA 3RXZA 1CNVA 3KL3A 1ZZMA 3KHDA 3V7PA 3VUPA 3QVQA 2W9MA 1UC5A 3FW6A 4S1FA 2A7NA 4MWAA 2VZTA 2QPUA 3IIVA 3NVZB 3PHAA 1IT7A 3EWWA 1EYEA 3B0XA 1QU4A 4PBFA 3QXBA 1JPDX 4LC6A 2YFOA 1ZBKA 3W74A 1E9LA 2FB2A 3U48A 5EY5A 3LZ5A 1WCGA 1IT8A 3EXRA 4O54A 3O07A 3XISA 3GR8A 3RAOA 3APGA 4LNYA 3KOZA 3N14A 2O9TA 4HVXA 3W0KA 1TWWA 1S2UA 4C6IA 4F2TA 4POCA 3TLQA 5BU6A 2FTYA 1HL2A 4JD4A 3T4CA 4FX9A 1WDDA 2VOTA 3MYPA 3W7NA 2AL2A 5C0QA 1J5TA 5C9XA 3NS1B 1H5YA 4NNAA 1TPUA 4ORIA 3QFWA 5AC8A 1LRQA 5DRIA 4LW7A 4Q8NA 4IQEA 4O17A 4CNNA 1CDGA 1W8SA 1XD0A 2BOEX 4DXVA 4L9XA 2QAEA 4LIIA 3S1VA 3UG3A 1XYMA 3M0LA 5HBFA 1MEWA 3AZRA 2X1UA 2Y8VA 3AALA 1RQEA 3RCMA 2X05A 5C2GA 5DFAA 3HFYA 3T0AA 3DHDA 1A5UA 1XLGA 5DCBA 1Y5WA 4IMGA 4XUGA 1AQFA 2VDGA 5JCIA 1JUKA 3OZMA 5H1WA 3VDHA 3HM7A 4AQLA 3I6TA 5TAOA 1IV8A 3M07A 1DNCA 3CQHA 2EG8A 2D73A 3QV7A 3WYZA 2VQTA 3SN1A 2IQDA 2NXHA 5EFDA 2IPFA 2V67A 3U2ZA 4GO8A 1L2UA 3W7OA 1S5MA 1DJZA 3DBPA 3PF3A 1V3IA 2YVGA 3SRDA 3OBAA 4HSNA 3USZA 5E0FA 1JDCA 5AC6A 7PTDA 1T3QC 2C0AA 3PTDA 5CZ0A 3QN3A 3WLHA 4H4WA 4IP7A 5LNRA 3V4BA 5CG0A 3WLTA 5A6AA 3IV3A 3CASA 4I5XA 2Z6IA 4ADTA 3E0VA 2Z2UA 5FI8A 3FK4A 3TW7A 1VFTA 1A5BA 4HA3A 1CCWB 2NT0A 1VBJA 2ACSA 5D33A 3LN3A 3EOEA 3L0NA 1C8VA 2J8GA 3QFBA 4E3TA 3ES8A 4UR8A 4ZGYA 5HMEA 1RPKA 1ZK7A 4JTTA 4H83A 3B0VC 1UKPA 2QYGA 2Z26A 3GZ3A 1KFEA 4E38A 3TWAA 4HJFA 3REQA 3TTSA 5AYZA 2QUMA 1L8NA 3SR6B 2NSXA 4G7FA 4EX4A 3APYA 1OG0A 2XWDA 2ZXQA 2C3DA 3ABZA 3S6DA 4K7VA 3W1AA 1QNSA 1LRTA 3ARPA 3M0YA 3WD0A 4UIOA 4JL1A 2WSRA 4MWAE 4ZL1A 1FCVA 2PTYA 3TZNA 2OOGA 2P8BA 3LHUA 3GDBA 5LNWA 3GSMA 1QOXA 4QR6A 4ADUA 3VZYA 1BKSA 4JTGA 3W9ZA 3T78A 4XAPA 4EXAA 2OEJA 1Q85A 2H9AA 4JQ3A 2B7NA 2QF8A 4PMYA 5ABHA 4YTQA 1DWAM 1FEBA 3ABSA 3GXPA 1R86A 3FHQA 2WHJA 4E2OA 3CQ0A 1GXFA 1J96A 1KR1A 2PCEA 2WKLA 4HIBA 2C79A 2FZBA 3HQPA 5J5RA 3TH6A 3NL2A 4C6CA 2QCFA 1XM3A 3CQKA 4MDOA 3STGA 1C9WA 5C2CA 4H8UA 3IEBA 3WQ5A 3NQ6A 2BY0A 4Q8UA 1EWDA 2GUBA 2R24A 4H7CA 1IZKA 4JTFA 3TN5A 3SGZA 1STZA 4EM3A 1K70A 3N9RA 2A79A 3IUDA 5BWFA 3GVRA 2A1YA 2WNQA 4NAEB 5E6ZA 4TVUA 3VK5A 1H41A 4R27A 4Q4OA 4GWEA 3WLOA 3PJWA 4WD0A 2VRKA 3MCOA 4EMIA 4W8BA 4QE5A 5E09A 3KS6A 4D9PA 3VGEA 2FMOA 3RLVA 2BGNE 3MMWA 2PDFA 3BTNA 2RKXA 4IPLA 4CGTA 2NLYA 3IGUA 4FNPA 1E1CA 1SYTA 4A22A 3GG0A 3TYCA 1HL9A 4QJ4B 3W37A 1V97A 3WQWA 4I7UA 1BKHA 2GGEA 3HMCA 4OV9A 5D9MA 3RU6A 3FAWA 4C1LA 1JRBA 3HRDC 4TVYA 4G6CA 2EQ8A 3VOJA 4R85A 1P7TB 4BK9A 4FB7A 2DSKA 1K7FA 4GPNA 1ONRA 4ZO6A 1QUMA 2X8CA 2WMFA 1XCXA 1RH9A 2VR2A 2V38A 1YDOA 4A3QA 4XD5A 4BQ2A 5KZDA 4TTGA 4AZIA 2PP1A 2PODA 5A6SA 3ORWA 5ABEA 3MKCA 3CNYA 5LSMA 3VIPA 3WEOA 1R87A 3HU7A 1K4GA 1XIFA 3RMJA 2CLEA 4AY1A 1LF1A 3VCNA 1E0TA 2B0MA 2XVKA 1ODZA 2DEPA 1TPFA 4TMCA 5H8PA 5HINA 3R11A 3NJ3A 2J9YA 4JKMA 1X8FA 3M0HA 3CEUA 1XXXA 4LF2A 1ZGDA 3OGSA 1GW9A 3A3HA 2G41A 2OQLA 1QXLA 3KWSA 2DGAA 3QV9A 2YBUA 5IFTA 1UWTA 3WFZA 1Q7QA 2OWCA 5I02A 1MZRA 3F4VA 3XIMA 4EPKA 2VC9A 1E6XM 1ZCCA 1K8ZA 1I8JA 3M47A 2C3ZA 2E68A 1JPMA 1BFNA 4GRSA 4FNSA 4PGLA 4CD5A 1L6FA 1F73A 3ABOA 3CIWA 1YHTA 2ATMA 1V3MA 4P7QA 2ZZ6A 4KERA 2NQLA 3VMOA 1VS1A 2V3BA 2CLOA 3MCNA 3M7WA 2OO6A 3GXDA 1MO9A 2EHHA 2VP8A 2E40A 2V63A 2OGJA 5A8MA 3WEMA 4Z1YA 5GPRA 2YXOA 4O1CA 5AHMA 3QR0A 2NVDA 1XBXA 4WF7A 1BPLB 3W25A 3EKLA 1PZ0A 1W5NA 3WD3A 4GIYA 1W1ZA 1RHCA 3H2NA 2WMIA 2Z24A 4D6JA 1BYAA 4AIEA 4ZEPA 2EG7A 2GDQA 4GQGA 4RDZA 1GKRA 1IEIA 2R6OA 5CSRA 2OJPA 2YCLA 1JROA 3FIGA 1DP0A 3TW6A 3VDAA 1QT1A 2PGWA 4HCHA 4A29A 4MPQA 4GYFA 3HQ1A 5ENLA 4IL0A 2NX3A 3KLLA 1NOUA 5LIKX 3VMNA 3WF0A 2ZUSA 1G0CA 5DO8A 4LYPA 1I2OA 1HJUA 2Q01A 4YHEA 1V6VA 5DQPA 3DFOA 1O6IA 3BARA 4H2HA 3FFSA 3H21A 3W53A 3GYEA 1FHVA 1XH0A 2V8ZA 3O1NA 3VILA 3B04A 4H01A 1M7OA 1V59A 5J5DA 1GJPA 5FF7A 3M0MA 2E09A 2YA0A 5HANA 2PS2A 4EKJA 2GVLA 3THUA 4EMWA 1OD8A 3CL7A 2IKIA 3IJ6A 3BSGA 1FECA 2J7EA 1LLZA 1AJ2A 6TAAA 3SUTA 1PXGA 2BC0A 3SSZA 2QVHA 3CT7A 4EP8C 3FCPA 4KIEA 3WDIA 4H4PA 3M44A 1U1UA 3UWQA 3P6LA 3QGVA 5AYIA 3TFCA 2Y7GA 4FDCB 3CO8A 1W56A 5FEPA 5AHFA 1Q6FA 2GZXA 3LYEA 4L1GA 2CCRA 1FWJC 4XZWA 3R79A 5TBOA 4O1FA 3QOKA 4QXIA 2L5HA 3MI3A 4KFNA 4IHCA 1XLEA 4N6EA 4A2RA 5CC5A 4LSBA 1KCKA 4LUTB 1AQHA 4XZNX 4RPQA 3EDJA 1BLIA 4IZGA 1AW5A 3DECA 5GNYA 4AY7A 3OA5A 1W31A 5LNVA 4GBUA 1EWEA 2XFFA 1EPXA 2ON3A 1KM4A 4EWJA 1XSIA 1ZY9A 3P93A 3EWCA 2PGFA 5HJYA 3A4WA 5XIMA 3EOUA 4LANA 2JGQA 5E9AA 3AJ7A 4LPCA 3UCQA 4QDPA 1W2VA 4ICMA 2BOFX 3LSBA 1EOMA 1F3PA 1MWOA 4GVHA 1RUSA 1S2VA 3NQFA 1UD2A 1C91A 4GI9A 3VA8A 4L56A 2QDGA 1X1ZA 4TVWA 3SCUA 2G3JA 1OFQA 3E1F1 4N9BA 3PZOA 2G5WA 1RJRA 5H91A 2WNNA 1YTKA 4XV0A 1TR9A 1L8PA 3EGJA 1EPVA 1U5JA 3KBJA 3BXWA 1MXDA 1PZ3A 4BKNA 3BGAA 3IANA 3PG9A 3W23A 3UR5A 1O68A 1YBQA 4X63A 1XF0A 2GFTA 3I3BA 3AFBA 3S46A 3TN4A 5CBBA 3E2SA 4MLRA 2VFEA 4AFYA 1B30A 5IOBA 2CZDA 3UWZA 4C6NA 3G1AA 4K68A 1ZS2A 3BW2A 7A3HA 2HQAA 3CZEA 2GK1A 1DKWA 3MUCA 4UZUA 3NPVA 4IICA 3S6OA 3R07C 3LTPA 3UW6A 3BSHA 1PS9A 4AX7A 1UPPA 4XQ6A 3R43A 3BLEA 4QEEA 5K7JA 2R9ZA 3OQEA 4JPGA 2CZVA 2WCAA 2OT0A 1JG9A 2DSWA 3MBDA 1A5CA 2C1HA 1M7PA 2XSAA 2WAGA 3CAKA 2WP6A 3A5VA 4M3PA 1FKWA 4CNTA 4Z08A 2Y85A 4NZ1A 1U1JA 3EBVA 2WW5A 2C1GA 2NWRA 1EC8A 1OINA 1WBJA 1IEQA 4UTJA 3NQCA 1EFZA 4Q8WA 4PMVA 4GD0A 3U9IA 1PCKA 2PB1A 2ZZCA 3MTWA 1BVNP 1G4TA 1H51A 2EGZA 3RR1A 1IQ8A 1D2KA 1ZXIC 1OWQA 3GS6A 4FP1A 3W7CA 2A2IA 1IF2A 3WLPA 2ABAA 2GJXB 4LB4A 3HPZA 4Z1CA 4DBUA 3N04A 3ITGA 2INFA 4A3UA 3GRIA 3S5OA 4LALA 4UCFA 3GD4A 3HQNA 5LIUX 1XLJA 3ITTA 2Z7KA 3T0DA 4Z1DA 1JCJA 1KM0A 2A7RA 4MM1A 2ASHA 2F8QA 2GOUA 2WPEA 4JN8A 3QJAA 1N2VA 3N2MA 1E4NA 2PU0A 1EO5A 4DAIA 2W3SA 1XYZA 2C14A 3TYZA 4C6LA 1W0MA 5AECA 3QC0A 1G67A 4Z42C 4FF7A 3G8RA 2J27A 4GXPA 4MLJA 4K6AA 2YB4A 2H8XA 5KTLA 1WZLA 3LHYA 3IPWA 3SCQA 3ZQ9A 1MYRA 1MW2A 1C90A 3SURA 2IPJA 3L65A 3V5FA 1LCOA 1KRMA 1KFJA 3UWWA 2O9RA 1KFWA 1W3NA 4O50A 1ZJHA 3FYPA 5BRPA 3KW3A 1NFGA 3GU1A 4HSHA 3ID7A 4LEFA 2PWDA 3EX4A 1IXQA 3N4EA 5TQLA 4JTIA 2A3BA 1JRPA 3H23A 2OEKA 1V4YA 2PBOA 1ZQ5A 4QS6A 2ACQA 2CETA 3MUIA 2TRSA 4B2DA 3IGSA 1VFUA 3H6OA 5FEXA 2V6AA 3FYYA 1A3XA 2ZZ3A 1FY6A 2ZBTA 3OZPA 3Q2DA 3STPA 3ZWTA 1L2QA 3SN4A 4KQNA 2FZ9A 3IJIA 5E0KA 3I68A 2YDAA 1F3WA 4ML4A 4E2DA 1QWGA 3CLWA 4JIPA 1TUXA 3LTSA 3M0JA 2GH5A 3A9BA 5IRPA 1RQHA 4LH8A 3GWQA 3ITCA 1YPFA 1LWHA 1ZLPA 2HCVA 1ZENA 3I3EA 5AHNA 3BAJA 3QW3A 4S2BA 3VNLA 5AOUA 1H3GA 1WXYA 3W2UA 5BROA 3SUVA 2CBUA 4JTHA 1OG6A 1N8IA 5JVLA 1XFCA 1IE7C 1PKNA 2JBMA 3AXKA 1TZ9A 1AH0A 2J77A 3D5HA 4YVVA 5RUBA 1H6VA 1FFUC 3K4WA 4HN8A 3U2OA 3G5EA 3M5YA 3SGUA 3TV8A 3AS3A 3EPNA 2ACRA 3W81A 1OYAA 2NUYA 4LS0A 5CEWA 4GJ1A 1HP4A 2DIKA 1UQYA 5CPQA 4KRZA 2HS8A 4L65A 2FZNA 4LBSA 5A6BA 4KBXA 4B4HA 3KRBA 4DZHA 3TJLA 3PBMA 1QJWA 2G97A 2OELA 4W86A 3W83A 2E6YA 2ONEA 4PB4A 4NU7A 4QLKA 4LFYA 1CW2A 3EMQA 2P50A 3UESA 3FJNA 4D8LA 1R3TA 1NSJA 1BSIA 3TSBA 4R33A 4Y6GA 1KB3A 1QBBA 3GW0A 4C65A 3GB6A 2D2HA 2Y7EA 4AVNA 2IKGA 3BMXA 4R53A 3INPA 3BQ6A 4AG0A 3RRXA 2ZUUA 3VNZA 3QTPA 2IMRA 3AWOA 2W27A 3C8NA 1UA3A 4NIRA 2F5ZA 5D2VA 3FSUA 3E0FA 1W5QA 3KDOA 4FLQA 1ICPA 5FJUA 1C8QA 1FKXA 1X96A 5AC5A 3TQVA 4N7QA 4CVUA 3NL5A 3UWEA 3TTYA 1A0CA 2A3AA 4FOUA 2ZUMA 2JF6A 4OE7A 1AL8A 4RE0A 1JGIA 3MUY1 4L7ZA 4ATDA 4Q4MA 4REQB 5IHSA 5E5CA 2V2CA 2ZZ4A 4C6JA 3SUWA 1UWAA 1A5LC 2ZTKA 2B7PA 3K8LA 3H53A 1R38A 2X1IA 2IXVA 3WMSA 3N19B 3KCLA 3B8DA 4JTJA 2V5LA 4GYJA 2PWEA 4ML9A 1FIQB 3I6RA 1FX6A 1A5AA 3WG6A 4OZOA 4IFKA 1SO4A 1UD3A 1QNQA 4YJ5A 1H60A 2GYIA 2J13A 2EPOA 3GKFA 4RV3A 3UXIA 4AHQA 2P88A 2XH4A 3KBSA 2YCIX 3W00A 3FVMA 1R30A 4E6MA 5CC6A 5TF0A 4IFRA 4JXCA 4C6QA 3W3OA 3CHDA 4H04A 2H3BA 2A6LA 3TJIA 3I10A 4FAMA 4O0KA 4YN5A 2C3CA 1M68A 2XJ7A 1K7XA 5FAGA 3NSMA 1H2IA 2H8ZA 2PZNA 2FVKA 1LQAA 5HR6A 1OCBA 1JXKA 4FNRA 1GPFA 4MJ4A 3W7KA 5LKYA 1PL9A 1UROA 1W9XA 3ZYZA 5I5RA 5A6LA 2XG9A 1N55A 1KXQA 5HPCA 1DTNA 4GI4A 2ZKMX 3BOXA 1EGVA 1HKKA 4IGSA 2XINA 3ECQA 3BW3A 3PZQA 4Z0SA 3NQEA 4O14A 2XM1A 3E5PA 4D6FA 4PR4A 4H4VA 1DXLA 1UWUA 4W84A 4ZB5A 1JYWA 4NI3A 5MKGB 4K38A 1X38A 4XSLA 3NPUA 4GX9A 1SSGA 1QPRA 1AA1B 2QCLA 4LWWA 1D7KA 1DVJA 1FXQA 3E2VA 3OLDA 5HQLA 3WH8A 2G0WA 1JZ5A 1FWIC 1FWAC 4HTYA 1E4LA 5U1OA 4LV4A 2GGIA 3IK4A 2BWGA 1JZ7A 1Q6CA 4UR7A 3SB0A 4NXKA 3SM0A 1LQ0A 4DZAA 4DWSD 3V16A 1DIKA 1DWFM 2V82A 3ITXA 2W54A 1EZ2A 4RDVA 1FWWA 4TX6A 2R94A 3TZFA 2V3AA 4N4QA 2BODX 3GIYA 3UEQA 1SZNA 3GD3A 2A7PA 4QSFA 5ABTA 3S6TA 1OYCA 3R8HA 3RM8A 1HTIA 3QZEA 2R82A 3AHXA 4YCOA 2HROA 2GL5A 3IJLA 4DELA 1B54A 2FKPA 2D69A 3N3MA 4CD7A 1HW6A 4UOZA 1XLKA 4LA1A 1BAGA 4XTDA 4BY3A 2REQB 2DUXA 4Q8OA 4F2UA 1BF2A 1SR9A 4OUIA 3AHYA 3CU2A 1VP5A 1V7AA 1W91A 3J7HA 5FSEC 4LYKA 3JW7A 3FXYA 1P0NA 3OOQA 1AW2A 3QV6A 3RDKA 4Q3MA 1TPVA 2VFDA 3VIJA 2I16A 2X99A 1YXCA 4HK7A 4A8LA 3URBA 4WY0F 3C2EA 1XW8A 3PY2A 2OKOA 4G2DA 4L6HA 2CXGA 2OLSA 4U28A 1LRNA 3EDDA 2WKJA 1EDGA 5F4XA 2G3NA 5JQ9A 3ZJ6A 1ZPTA 3W1LA 3CGCA 3HN3A 3MSRA 4G1KA 5FAJA 2BBFA 3PR2A 3TC7A 3L5LA 4KWVA 4UOJA 3IK2A 1A0DA 2OQHA 1Q8JA 4KESA 3CTLA 1Q63A 3KCOA 1E0XA 2Z1XA 1U22A 1W9PA 3PJXA 4YHGA 1QW7A 1EF3A 3F1QA 4GLEA 1F74A 3FKKA 1QFEA 3E5BA 1CXEA 3EX6A 4PMRA 1KXVA 2HXTA 3I4EA 3KOXA 1TX2A 1WYIA 3NZPA 1YPIA 1BZLA 3G0XA 2QQ6A 2ZE0A 3AXHA 3TN3A 1O4UA 1VRDA 4YXGA 1EJTC 3THDA 1MNZA 4GCXA 4PTMA 1B9ZA 3ZFHA 4BWLC 3AUOA 4L1XA 1GOMA 1L6WA 3CV7A 1X7IA 3SDOA 1GETA 3VNDA 4KCTA 5DX7A 4NJGA 2UV8G 3LBMA 3NG3A 5EBAA 4BR1A 1TV7A 5EB8A 2Q09A 2VI0A 2Z1SA 5HXMA 3WH7A 2Z2BA 3C0SA 3ZM8A 1HFBA 1D3HA 3IIOA 3PS7A 4ZB0A 4GA8A 3KTSA 2FGLA 4WX2A 5K4XA 4AVFA 4UMBA 2D2GA 3GW3A 4M82A 3G1HA 3STCA 4Q8PA 2NT1A 4J9JA 3L67A 4O28A 3FV9A 4JEJA 5BWAA 2BY1A 4NI8A 1MW3A 3W76A 1P7TA 4JHOA 1Y5VA 3H2MA 3WENA 3PJTA 3W72A 1OF8A 1WBHA 3GNPA 4IXXA 3F2BA 2XN1A 4BI5A 2PF8A 3W7DA 3VPLA 2ISWA 1BGAA 4A3HA 2DDXA 2FZDA 2NWSA 2FPTA 3LX9A 1ZALA 1MNSA 5C9UA 1TYPA 3W85A 1XP3A 2PRMA 2ZX5A 3QH2A 5BZAA 2EQ9A 3A3XA 3MA8A 2YDRA 1F2JA 3ETRB 2QF7A 4FLOA 4IPNB 2A8XA 3SFKA 3VDBA 1KO0A 2NV9A 3O6AA 3BV4A 1E4MM 1ECEA 1LBMA 4GQRA 3IV8A 4QNWA 1KBKA 1QI5A 4HA1A 1CXFA 2BX7A 1BQGA 4MMWA 3VU2A 2FDSA 3VC6A 3BK0A 5CLWA 4YYFA 2V5CA 4QCEA 2XM2A 2VFGA 5G2IA 1TVPA 3HOJA 1OFRA 1VQTA 3E96A 3HGRA 3UJFA 1JXJA 1YEYA 3M16A 4X3ZA 1HZYA 4I7WA 4TX8A 1GQIA 2VC5A 4Q4KA 4DWSC 1RCOB 3LB8A 3U57A 5GJNA 3D9XA 3KE0A 2XN2A 1VDVA 4H4ZA 2CDUA 3H4XA 4UQ9A 3VIGA 5A8NA 9CGTA 3LERA 3EOOA 3B9OA 1ISWA 3HB9A 2PBGA 3KVMA 5E70A 2XHYA 1ZJIA 2NV1A 1S5VA 1US0A 4GNJA 4CD8A 2JKAA 3H54A 1UR8A 4HMCA 5J8LA 1WB0A 3W82A 3QEZA 3LMYA 1OZMA 4WRHA 5REQA 2XU2A 1ADSA 3GH4A 4NZFA 2RDWA 3CUZA 4JTEA 2GOKA 1OZQA 1I6NA 1GKQA 2QAFA 3GG8A 2I5IA 4EXBA 3QQWA 2WQDA 5G1YA 4XKMA 3G3DA 1OIFA 1TYGA 3VGDA 1J0IA 2OB3A 2ZE3A 1LPFA 4WKFA 3WLIA 3S0CA 4J3TA 2D0GA 1SJAA 3WJZA 3H2AA 2PWFA 3EF6A 2QGHA 1TJ0A 3PUEA 2XIMA 1P6CA 4A3RA 1EJWC 3OG3A 1CLVA 2G95A 2P76A 1OFDA 3QOMA 2B31A 1HGWA 1GKPA 3W1RA 3PZNA 3E6EA 3WL0A 1QVBA 2OYMA 3H8AA 2Z4GA 2H3DA 3OP2A 4IH3A 4LGXA 1S1PA 3G6LA 4R5EA 2IPWA 1UQZA 3DENA 3S5YA 1HKWA 1VJZA 4TOQA 1Q1RA 1OX4B 3ANUA 1XRSA 3N2TA 3OIXA 6REQB 1KXHA 2PRHA 2ZUTA 1FWBC 3TR9A 4EQWA 2WPGA 3L8KA 1M9HA 1XYCA 3ZXWA 1JQVA 4QEHA 4JQ9A 3LS9A 4JTKA 4MNKA 1ZKQA 2A3CA 3VM5A 4L9YA 4I90A 1KBIA 3VUSA 3VCCA 3VX1A 2UY2A 4BFAA 1C29A 3GVVA 5IBXA 2E5CA 5DCDA 4M81A 3UR8A 3WJWA 1MQPA 1BHGA 3NTYA 1RK5A 3SCRA 1VD6A 3CZGA 1RBOB 2EPHA 4A21A 1J6OA 2YW4A 3DYOA 1RALA 1B9BA 4J4KA 2I5QA 3EA2A 2E6DA 1Q6QA 4H9XA 4H9UA 3NSXA 5BRQA 1XKJA 4CCZA 1P1XA 3DN5A 1UBSA 3UQNA 4MNLA 4IPJA 3UGVA 3G1DA 3W7LA 2YOCA 3RMEA 3W27A 4HMNA 2E67A 1UUMA 3V75A 3HA1A 4I5UA 5C9WA 1GTEA 2V9DA 3BVJA 2VEKA 3L66A 4KCWA 3W28A 3FLUA 3LDVA 3TOPA 1TFVA 1NDAA 4DNHA 5AHIA 2PZ0A 4U5IA 3QLLA 4UTUA 1R8LA 4QHRA 2C16A 3ALFA 4NASA 4XWUA 4GUFA 1J9YA 1T99A 1ZP4A 4LYQA 3HGSA 3PG8A 1NFBA 3L12A 1POJA 2PDQA 4ATWA 2VXNA 4I9JA 3KDNA 2VR4A 4W7VA 1LBFA 4O1EA 3U5UA 2HBXA 3WH9A 1PWLA 2VZOA 1TJ2A 1XIMA 4P8WA 1C7TA 4XO7A 5ECUA 1ISZA 3CAQA 2ZADA 3UNTA 4WIWA 3DFQA 5M1TA 1A5NC 1XIEA 2V5KA 2NQHA 4LCQA 3PK7A 4QAWA 4XB3A 4HHPA 4BI7A 2X09A 3AXXA 2OZTA 3AIUA 3UR2A 2ATSA 4DJEC 4U33A 1KNWA 3W7EA 1AZ2A 4I8DA 1YPXA 3CPRA 1GVSA 3HZ3A 2E3ZA 2VCAA 2PWHA 1LL7A 1T0OA 1AD4A 1KTCA 1ZMCA 1M3UA 4IG2A 3R13A 3C5QA 4IX2A 3OLEA 3AC0A 4D6GA 3OODA 3KL5A 5KMYA 4CKQA 1VCVA 3VD5A 3LLXA 4AAJA 4ERAA 5EBUA 4ZODA 1CI1A 5K9CA 5AYXA 3DH9A 3RF9A 5JBEA 1NAL1 2WVSA 2QJIA 4GE8A 4M80A 4U5KA 4BEQA 4DWSB 2Z2AA 2E8ZA 1UR3M 4HU3A 3B0PA 4CCCA 2YA1A 3WDHA 3UERA 4LUJA 4RXFA 3UPWA 1L6SA 4NYUA 2XUCA 3S1UA 4WXZA 4HNUA 3M6DA 2VZVA 5BOEA 3AXIA 3W38A 4BQ3A 3N6JA 1FWGC 1VBGA 2VEMA 5LXXA 3B06A 1OABA 4XD3A 4EQXA 3UT0A 4H8VA 3QTGA 4H2CA 2WO5A 3WQ4A 3LCWA 4DYJA 3M9YA 3W2NA 3NQBA 5D30A 2HVMA 2YZ5A 4Z2HA 3STFA 4A8NA 3W2KA 3O0HA 4BS0A 4JNZA 4L1WA 1AZ1A 2OEMA 2UBPC 4JOMA 3BGGA 1XWYA 4NQ1A 5DANA 2OFJA 3CB3A 1GEUA 2YDQA 4O53A 1QK0A 3WDJA 3O3RA 2BGSA 3NVTA 1JFXA 4W4QA 2BFGA 1N60C 4K3ZA 1YDNA 3DYPA 4GI8A 3GFXA 1T8XA 3EA1A 3AYRA 3NFUA 3V5CA 3PAJA 4B3KA 4UFLA 4JY9A 4LQ1A 5M03A 1BQCA 4C6EA 1J2WA 2EBNA 3LXCA 4PTVA 4NEVA 3C8FA 1RVKA 4FIQA 4PMDA 1Z32X 3LENA 2Q6ZA 3T2QA 2DJLA 2E9LA 1TIWA 4DJDD 3AZSA 1CGUA 3VE7A 2O4QA 5KINA 2FQIA 4K39A 2PTWA 4YL2A 3VDGA 4H4YA 1H63A 1OT1A 1PKLA 3HG4A 4WSHA 3YPIA 1ITXA 1GHSA 1BWLA 4CQAA 1A53A 4O8RA 2JKPA 1E0VA 4BJHA 4GISA 1JCNA 3KLJA 2DSUA 3WNKA 4AZBA 1EP1A 1B5TA 4PMXA 4ZQCA 4HU0A 4B91A 3HV9A 3QC3A 3S8HA 3R0DA 4B15A 1ZNNA 2FB3A 4QJ3B 2CC0A 1GOOA 3URQA 3I4KA 2DVUA 2ZA2A 4GO9A 2ZA3A 4YIWA 3UJ2A 3W71A 4M52A 4HU4A 1RA0A 2BTMA 1NTHA 2ZDRA 3NOEA 1QO5A 3PTKA 3D3FA 3S47A 4AHOA 4OUEA 1P1MA 3WN6A 4TIMA 2GSHA 1ZBVA 4WGHA 3DKLA 1KGUA 5G5IA 4IIFA 4H19A 5FJIA 1E15A 2WB5A 2XFWA 1XSKA 3D0CA 1MSSA 5JIWA 1OD0A 2QCGA 2VJXA 2FGZA 4IIEA 1VEOA 1ONEA 5HA7A 1XYFA 5JU6A 1A5SA 2JGYA 3CV6A 5A3HA 1HKVA 3NZGA 4WSKA 2V3EA 1W3JA 3TAOA 1OK4A 4Y96A 1FFRA 1XCFA 1RLDA 3WMCA 2ZX7A 3GH5A 4FS9A 1O1ZA 3RIKA 1Q65A 1J12A 1KM2A 3UGRA 1KM3A 4PCSA 5CSSA 4ZFCA 3DI0A 3NWRA 3C0LA 4CU6A 1UHVA 3H7VA 1TJPA 4X60A 3FDGA 4J40A 3WLJA 1PZ1A 1W3KA 3M43A 5AB3A 3RJXA 1V51A 4MAZA 3H2OA 4PMQA 3ZR4A 4LRTA 2MANA 1VCGA 4JIRA 3RO8A 2QXWA 2P8CA 1E55A 2VR5A 3T09A 4J2PA 4LJ3A 1LYXA 3UPMA 3VKCA 2NVKX 4OECA 4HYWA 2OLAA 2R8WA 2JKEA 1VCFA 3ITOA 3LHWA 1VF8A 3TVAA 4O13A 1AD1A 2X8HA 5C71A 6CGTA 1HN1A 3M6YA 5EMYA 3UG8A 4Z2KA 3F4NA 2W0HA 3NEHA 2YL8A 2OMAA 3E2RA 2PE4A 1JZ2A 4CQ8A 5A8OA 5G4EA 3B8UA 4PMZA 2Q71A 1PV8A 1M03A 3G1SA 1DXEA 3CYJA 7REQA 3P62A 1EO7A 4PODA 3KZPA 2W55A 3WIJA 3CEPA 3IIZA 2ZZ5A 3H4WA 1RD6A 2V3GA 5CGTA 4L6DA 3K1GA 4DF0A 2HNEA 4PCPA 3WO8A 3WBWA 3O16A 1P0BA 1TO3A 4GVFA 4A05A 3DFNA 4HZ7A 4D6CA 5FS6A 1W3IA 2QJGA 3OTRA 2FVMA 4O19A 3VZXA 4FOJA 1KXTA 3IACA 4RNJA 1HL8A 1DBTA 1QASA 3GXFA 2WP5A 3ENLA 1UCWA 5CKSA 3SRKA 2WCGA 5F1UA 4B3LA 4XO6A 2GWGA 1OX5A 1H09A 2YZRA 1CYGA 1WE5A 1E71M 4TXEA 2QMKA 3UNDA 1YQ2A 2FHBA 1N7KA 4WZHA 1LG2A 3EX2A 4DJFC 3LPFA 2D2OA 4IIBA 3DU0A 3TW9A 5E1QA 2YB1A 5U25A 1ICSA 3WDPP 4XZLX 1MXGA 3P7YA 4S3JA 2F2HA 1P6BA 1UH3A 5ER0A 3LHTA 3FDKA 5D04C 3OIHA 5F2IA 5HUPA 4OV4A 1UP2A 2ICSA 3PUOA 4ZBCA 1ZUAX 3IUIA 3NXLA 1DJYA 1GCYA 2XYLA 2QUVA 7TIMA 1HP5A 4WDUA 1N5WC 2PEVA 5HR7A 2J7HA 3W1NA 4AWEA 1K9EA 1G7UA 1GQJA 1TV3A 1XPYA 4ERIA 2IKHA 5JXQA 3L68A 4LX4A 5HJXA 3NYDA 4FLRA 4OU1A 1F6KA 4X61A 3LRMA 3VNIA 1UOKA 1AODA 4CQCA 3CHVA 2VGBA 1V02A 4G7EB 2G4JA 4AZCA 3TROA 1J0KA 1ALDA 3S42A 3F5KA 3BV7A 1XPGA 4HGXA 2BZNA 2FJUB 4RNIA 4JR5A 4XKYA 1JF6A 2V0TA 5SWUA 3WK0A 2P3ZA 3P8IA 3O63A 4MB4A 2NQJA 1XDLA 1AFSA 3GHSA 1CX9A 3VKAA 3AMLA 4EIVA 3IWPA 1A50A 3O15A 3WLSA 1E4IA 3BLDA 2CLMA 1DJIA 1TPDA 4IP4A 1TRDA 2ZFAA 3GXIA 2DZAA 1P0KA 1OYBA 2YL9A 1TRIA 2FIQA 1ZJBA 4FNTA 1VHCA 3PB2A 4ACZB 4RNFA 4N4PA 3ANYA 4MKNA 2FVLA 4OGZA 1R85A 3V36A 2DQWA 3N15A 2JIEA 4GKLA 4H50A 3M0IA 3URHA 3RGTA 2BDQA 4O0ZA 2CLPA 4KWSA 3BPWA 4C91A 5JH2A 4U3CA 2ISDA 2C0HA 2PDHA 3TYEA 4RE2A 1QCWA 3OU8A 3W7MA 5I3KA 2HSAA 2NSOA 4BI6A 1NOFA 1XLAA 4LT9A 1LQ2A 3CGEA 1PE1A 3DBNA 1XJBA 1H62A 3VAVA 2D0HA 5FS8A 2BGQA 2QIIA 4I9AA 3HF3A 3TNBA 2G4FA 3ABQA 4BF7A 3ABRA 3JVAA 3A21A 4JYDA 2FLIA 1ISVA 4RDYA 1FP8A 4EM4A 1E9ZB 4M6PA 2F61A 2OSWA 2CHOA 3A7UA 4V27A 1CBGA 2OTDA 3ARUA 2EKCA 3QPYA 1EP3A 1LT7A 2A5HA 4UCGA 2PF0A 3L2LA 1EJUC 4GFIA 1RSCA 2QV5A 1LVLA 5HNNA 2PD5A 1ZAJA 1IR1A 2VX5A 3A4JA 3Q6JA 4IGNA 1Q66A 4LY8A 5CPOA 3WJYA 2X0SA 4NHVA 3EB4A 4WEVX 2RAGA 1SUXA 4Q7BA 5HQMA 4ZQMA 1QOQA 2D20A 3RILA 4IIHA 3TOYA 4AUBA 2EQ6A 4PFMA 1NWTA 2JQXA 1EQPA 4KRUA 5JCKA 5CBIA 4J28A 2G50A 2TPRA 2VC7A 4QIUA 1FVPA 4ROPA 7ODCA 3WSUA 3GH7A 4RE4A 4YS1A 3G1VA 4GYPA 1V0NA 3PWGA 1XINA 1W9DM 2OPJA 3UXDA 1GWJA 3AHZA 3BC9A 2ZRWA 3UXKA 4PMJA 3MUZ1 3A9IA 3HQOA 5BOFA 2H6RA 2TODA 3MI6A 1XRVA 1DWIM 4GRTA 1UP3A 2Q3OA 2E5DA 3SADA 5TR3A 2O9PA 5IDIA 4DEFA 2ZRVA 4GH3A 3BQ5A 4JNYA 4TU1A 4Z1AA 4D72A 1V02E 2AGTA 3LY0A 3BAIA 3DGHA 4CCDA 2POTA 4FLSA 3W1MA 1I1WA 2XPKA 2WPCA 4DBSA 3II4A 1SZEA 1QNVA 2HVNA 1GVFA 4D6EA 1FUYA 3UJRA 4ICCX 3NGFA 3M46A 1RV8A 3WMBA 1GW1A 3N9KA 1XUUA 1XS2A 4F40A 2O4MA 3PJUA 3W1XA 1M41A 1FWDC 3M64A 3NM3A 2J24A 4YNGA 4W88A 1UWQA 4CN1A 2WSYA 4ONVA 1T41A 4MJMA 1UR2A 1IHIA 1TWSA 4ZOAA 2I17A 2ZUVA 2TMDA 3FG2P 3OA3A 2YVFA 4IUGA 4H4QA 4HSOA 4J3WA 2VEPA 1P43A 1VR6A 4MJ2A 3NQVA 3KTXA 4JZ5A 3C2FA 4FNQA 3NL6A 5FJRA 2INEA 2I5GA 4ADSA 2Z28A 1CLKA 5CQ1A 3LXAA 3VD4A 3AICA 2DSZA 3D6NA 2W61A 1GRHA 3PZTA 4QITA 3QMSA 4XAYA 2OSYA 5D09A 2PA6A 3KL0A 2IPGA 4P2VA 3TU9A 3TXZA 4P61A 4DX3A 2WZTA 3UG4A 4YPJA 4RXGA 3LCXA 2IQ0A 1XLMA 4C1NB 1TJ1A 8CGTA 3A3WA 1SGJA 4NXSA 1GVYA 1T40A 4AMAA 4NVTA 1XC6A 3U4FA 3LGDA 2Q8ZA 2J6XA 2PMQA 5LIYX 4JL2A 4B3ZA 2HS6A 3N11A 4JQ1A 4R7OA 1MFVA 5IM51 1K8XA 2AMGA 4Q22A 5B80A 3NDZA 2UY4A 4Z17A 3RNMA 4B9YA 1B3ZA 1Q6EA 3EXSA 1NVMA 1JZ6A 2DT3A 1R0MA 3N1AA 3MO4A 4UTIA 1WX0A 1UKTA 5AHLA 4HNLA 3MMTA 1NP0A 2V5BA 3RITA 2WPFA 1B4EA 1V5XA 2EF9A 1A5MC 4GYKA 1MQRA 3UD6A 3ZSTA 2CHRA 3PN8A 2P3EA 3LQLA 3U4AA 1NWUA 3QYSA 3LHVA 1TREA 4FX8A 3CWOX 2W4XA 3VABA 4IMFA 2QDHA 4PEEA 5LZLA 1FWNA 2W63A 3KVKA 1QOPA 3WLQA 3N12A 1RQBA 1TE1A 1PDZA 1W3LA 1HKMA 1Q5MA 4JFUA 3O0FA 5EU9A 2PSNA 4ZSUA 3E38A 4M1RA 4ZVJA 5H2ZA 3F5LA 1S2CA 1WDSA 1FCQA 3DDMA 3T4WA 1F3XA 2QNEA 4PCFA 3TTOA 3T0BA 4LAOA 2PLCA 3CH0A 4WK9A 1GT8A 4YMZA 3ZVHB 1NDVA 3LXBA 1UC4A 5HWNA 3WK2A 2X1RA 4J57A 1I75A 1VYSX 6REQA 4NAFA 1EBGA 2PP3A 5A69A 4UTWA 4KMQA 2F9RA 4HHLA 5L6UA 2GVYA 3CQJA 4MVAA 4M7SA 1O5KA 1W1A1 2Y0FA 4H9YA 4IWWA 4GUIA 2BCPA 1GVEA 4N02A 3FSTA 1K4QA 1WXZA 1NY1A 1W9BM 4F2BA 4M8UA 3ZLGA 1X2HA 3E74A 4AZHA 3VKKA 5CGQA 5FD0A 3CYVA 3MZ2A 2Y5SA 4PUMA 3TCSA 1MUWA 1SO3A 1XDJA 3GUGA 3IGXA 3VOGA 3GKAA 3R89A 5HMSA 4W85A 2HK1A 3KVLA 4ZOCA 1MEHA 1GOKA 3ITVA 3MHGA 3VIKA 1JCMP 1H49A 1KQZA 3ITYA 1ZAIA 1PJ9A 3G22A 2ZICA 5CZKA 4ES4A 1PUDA 4PZVA 1HKJA 5G4WA 3OPSA 3C2VA 1XBZA 4HNCA 3A6OA 4W87A 2CBVA 1HO1A 4FSAA 3LUTA 1GUVA 5JMUA 1HJQA 3W4RA 4APNA 1ESWA 1LBLA 2PP0A 3ICJA 4S3CA 3AI0A 1NDWA 5DELA 3DK9A 4PB3A 4TX9A 1RAKA 3SY5A 2J75A 1Q6LA 5G1TA 4Q7IA 4KEVA 1TPC1 4AX6A 3SSJA 3V1PA 3WNPA 5EBKA 4JDBA 3DJGX 4JDRA 4QLLA 2WZIA 3UETA 5K9XA 3N2CA 5BNKA 3WLRA 3MSGA 3OZOA 3WEZA 4NJJA 3MMUA 2J6VA 2JEPA 1J10A 3ELFA 4MDPA 2QIWA 1WYGA 1BG9A 1KM6A 2P5NA 3L4UA 1PTGA 1R47A 4MGGA 2X42A 1PO9A 3S3GA 4PUNA 4ZZ9A 4C1KA 3OBEA 2OT1A 5FESA 3AROA 2FFCA 1M6JA 3WUFA 3D46A 1I2RA 3RNDA 2JK2A 4TVCA 2Y61A 2A6NA 4S3AA 1JDDA 3RUBL 2CFFA 3GG7A 1Z41A 1UMLA 2GQ8A 4NT0A 3NSNA 4QCFA 2A3LA 2I9EA 4P5UA 4JTQA 1VAHA 3NA8A 3FJ6A 4HK6A 2WWCA 3HW2A 1TA3A 1W1YA 3NQAA 1PTDA 5DRCA 4CEUC 4CVWA 4O11A 3G0SA 1OY0A 1ME7A 1OF6A 4W89A 3QBUA 2WVVA 3CUXA 3WL1A 3VC5A 2W62A 4HN4A 5ABFB 2ZRXA 3W1PA 1GVRA 4EWND 4A3YA 1FWRA 2Q02A 4B5UA 4DXXA 2O92A 1V6TA 2QJNA 2OG9A 4AMCA 1H50A 4QJ1A 4MNMA 1BVZA 1ME8A 1Q2SA 4YYCA 3V0UA 4V1XA 2QJHA 1YE6A 1WKDA 4K7ZA 3M0VA 3SI9A 3HIJA 4UTLA 5I09A 4FALA 1XL9A 1TMQA 3WQOA 1PEZA 3A64A 3ONBA 3QSRA 5F2MA 1UZ4A 3C3NA 4PTDA 1DWJM 1A5KC 3WFLA 1A3HA 3U3HA 3GAYA 5IHRA 3NZ1A 2OZ3A 3SECA 2YXGA 3VTRA 3WBAA 2IQTA 1KN0A 4KETA 3URNA 1EBHA 1GHRA 3B3DA 4OOUA 4GHRA 3MT1A 1VZWA 4EQRA 1FH9A 1OC6A 1ITUA 3S9IA 5C7HA 2AL2B 4GKTA 4MB3A 5AC7A 4IQJA 4UTMA 1EEPA 1MW1A 1K1DA 3T0TA 1J0HA 3U6WA 1VKFA 1F3TA 2I1OA 4EMJA 4LF1A 4B92A 5C8BB 1KLYA 2PWGA 2X0YA 4E2BA 1DXIA 3NQ7A 4PMUA 4UFMA 3GUWA 4IMEA 4PC8A 3W7IA 3BG3A 2OU4A 1IEWA 4Z2JA 1BWVA 3QLDA 2WM1A 1EA9C 1AQMA 2PD9A 4ZB2A 5D2YA 3DFPA 1O7AA 4PBGA 1XYAA 4XBJA 2O56A 2DY3A 4HOXA 1XSJA 2B4GA 2ZA1A 1F6YA 2E3TA 4INFA 5U4NA 1VYPX 3C0QA 2CLLA 1HO4A 4DZ5A 4CD6A 3PZUA 5D9NA 3T05A 1S1RA 3C56A 2BVDA 2GVGA 3KM8A 1KTBA 1DQXA 3ZZ1A 4JKKA 4WY0A 3KBMA 3K46A 2AOSA 5LA1A 3G24A 4PUWA 5BRBA 1AMYA 5A8PA 2ZRZA 4GABA 5H8UA 3CAWA 3R12A 1BVWA 2ZX6A 3PBWA 2YLLA 3BJSA 4S3FA 1F3EA 3ES7A 1CGWA 1VFHA 3W6MA 3N6HA 4UTKA 1VB9A 3NDYA 1TVLA 3R0UA 4QE4A 4U10A 4EOUA 2ZVRA 3THQA 3VZZA 3ATZA 4HMEA 1KC7A 1DJNA 1BXBA 1CT5A 1XV8A 4LOCA 4ZA0A 1L6GA 1V03A 3DUGA 5JCNA 1JVNA 2WM0A 1EDQA 4OBRA 2DT2A 2E1WA 4Q4QA 1RVGA 2TSYA 4G5DA 4B16A 4JCMA 3EMZA 1O66A 1LUCB 4ALDA 4PRRA 3REQB 5D8ZA 5KZMA 2DZXA 2O55A 1Q6DA 1EOKA 4F9DA 3KOFA 1C92A 2W6RA 1Z69A 4GH1A 3BG9A 2DZUA 3MKVA 3RYSA 3VKDA 4GQ0A 2ZXAA 1WZMA 1GQKA 5HULA 2I9UA 4XD4A 3JZUA 1TMLA 1MEIA 1YRRA 2XVNA 4X0VA 1UWSA 1FWHC 2OZ0A 2WC3A 1WUFA 4PL1A 2G3IA 2TPSA 2E1DA 2VWSA 1Y7VA 4S23A 1B3XA 3PBYA 4PB5A 1TTIA 2X40A 4E5TA 2H9AB 2QR6A 1BSLA 1K02A 4H6RA 4J1OA 4XZHA 3A7AA 1R3YA 2DZBA 3OVGA 2OYLA 1W9VA 1VH7A 4WVXA 5FOOA 1AG1O 1AJZA 2GGJA 3SCPA 4GY0A 3E0WA 2I56A 4DWDA 3H70A 3IUHA 1W1PA 1YMYA 1CGXA 2PDLA 1H1YA 3U2CA 3MPGA 3TCEA 1GK8A 2RDUA 2V2DA 4AHPA 3H7UA 2PTDA 3LM3A 3KOWA 1RM6B 3KS5A 2XN0A 1I0BA 4QDMA 4GUJA 1GRFA 3GTNA 1FXPA 1RJPA 3NZRA 3GXNA 3FGCA 1W2PA 4LXFA 4GZIA 4WHBA 3JU2A 1WZAA 3B97A 1C7SA 1EC9A 4PTXA 4ATLA 4R7JA 5HUOA 1DQUA 3NQ2A 4CLMA 3GNOA 4IIGA 3ZJKA 4B5XA 2WBAA 1JGMA 3DFHA 3GU2A 4A6GA 2Z0IA 3EB2A 1F05A 1S2AA 4B90A 4XZIA 1TKKA 3TC3A 3V3WA 2XSXA 1JYNA 2V3DA 5FEWA 3L23A 5DLCA 2Y1HA 4HTBA 3WUBA 3FS2A 3LD5A 4H9VA 3GD6A 3LPOA 4TV6A 4LVFA 1XGZA 5TD4A 3EANA 5PTDA 5BOOA 2D3LA 4FO4A 1JFHA 3B4YA 5A8GA 1J4EA 1JNEA 1FCBA 4C60A 4Y9MA 3E2QA 1GQNA 1NARA 2ZC1A 4YLWA 1GG0A 4G7EA 4LTSA 4R34A 2G8ZA 2IKJA 1FDJA 2HV5A 2IXUA 1CLXA 3ONCA 3RM9A 1ZU8A 3U7VA 4AF0A 1B31A 1T96A 1EJVC 2HE5A 1ZP3A 1F61A 4L4MA 3DK8A 3DEQA 2G37A 5CJNA 5HNUA 2YCEA 4LVAA 2F38A 2Y2WA 1FWEC 1KFLA 1QRQA 3QRHA 4F0SA 1B3VA 3FHAA 4DYEA 3LNPA 4RZBA 4U2YA 2RABA 1M01A 3K4DA 2ZYFA 4MKSA 4M6QA 5K2ZA 4UTTA 3V1HA 3WKZA 1JJKA 4F0HA 4ACZA 1CPUA 4RCXA 1I4NA 1YYAA 1WQ5A 5DT5A 5I07A 1AMKA 1US3A 3QPEA 4GY7A 1WKYA 4ZENA 1IGWA 3FKRA 3EWDA 1XIIA 3IJ9A 2HE8A 1JNDA 3RN6A 3IAQA 2QCCA 3BZGA 1ZTVA 1YIXA 2W66A 3T40A 3CO4A 3VFLA 1JD7A 1VBHA 1R5YA 3BICA 1S38A 2YX0A 3DAQA 3W7GA 3T08A 1XIHA 4CUCA 2J88A 1LG1A 4IPIA 3RLUA 9XIMA 5G4HC 4ZR8A 4KFOA 2XISA 4FHAA 2F84A 3AZTA 3VOIA 2WPBA 1CGVA 1UD4A 2WMIB 3GC4A 1ECQA 3HG2A 8XIMA 2E7FA 2DSVA 4NNBA 1EJXC 2YCLB 1Q45A 2ANUA 2P0OA 2ZZBA 2Y8KA 3TWBA 3EWBX 3GYCA 1PYFA 3II1A 4DI9A 3CGDA 3QGAC 1O12A 3GFZA 4E8CA 3HGOA 1KV8A 4HNOA 4WXYA 3AU2A 9RUBA 4O1BA 1UR0A 3LCHA 2Q8XA 4O1DA 3VD9A 1HF6A 3N3TA 2BB0A 3K8KA 2DFAA 3DYMA 2B7OA 3ANVA 4JFSA 3LM7A 1XG4A 3GZAA 1J2BA 1P0EA 1WKFA 2HJPA 3M1ZA 1YNYA 3F2DA 3UY8A 4E8DA 2OWXA 5FF2A 3A24A 3COTA 4JGDA 4R9XA 1D8WA 1QK2A 3EDKA 3C52A 1W54A 1PWMA 4QM1A 1EX1A 4RX0A 3WK1A 1FOBA 1K6WA 4O57A 1UKOA 3V0SA 3DHUA 4ACYA 1S39A 1J79A 2ZZ7A 4KKXA 4O8AA 3MSDA 1Q2RA 4OKDA 5EPDA 3DJJA 4RK8A 2XVPA 3DOPA 3WBXA 1FQ0A 2NVAA 2XVLA 3AUJA 3CZ8A 2BV9A 1QHPA 3P80A 2QS8A 4LCSA 3L7RA 3VGFA 2GQAA 2VZUA 3ZIZA 3CUFA 3MP3A 2VEGA 5CZTA 1MDRA 1KR0A 2GWNA 1EKOA 1UH4A 1QI2A 2EG6A 1AH4A 2XZ7A 4H6KA 3ISIX 2KAUC 5I6SA 4JTAA 4LYRA 3M0KA 4Y9AA 1F8WA 1GZGA 3SCWA 1X6UA 5I78A 1I1XA 1LL6A 3QY6A 2D24A 2DORA 4HZ8A 3MI2A 2X50A 4AD1A 4AYSA 4GZ7A 2E5BA 4MUPA 2VT0A 1RR2A 3E02A 2GGGA 3EUB3 1E3ZA 4F4RA 1EXBA 2WSKA 2HISA 4S3DA 2QW5A 3ALGA 3KVJA 1POKA 3UZYA 4QG9A 2ODOA 4DJDA 2E0PA 2XH7A 4J3VA 1C3FA 1E0WA 2WNWA 1A4LA 4TTUA 3RRAA 3KHJA 3A22A 3AS1A 3MANA 3O6YX 1VQZA 1ITQA 2CXEA 5C54A 2CLHA 4RNHA 3BCFA 3P2VA 1ZL1A 2J9ZA 1XH1A 4YWOA 1NELA 3PPHA 1GEQA 3H26A 3GIPA 4JQ2A 4QSHA 3UG5A 4AIUA 3AIVA 4BZYA 3QKEA 6XIAA 4UFJA 3UP8A 1SVDA 3UWUA 1EB3A 4LUSB 1ICQA 2FH8A 5FSDC 1Q6GA 4G9PA 4JQAA 3R1ZA 4J35A 3QF0A 2J25A 4JNMA 4Q4SA 5GNXA 5EMKA 3H4KA 1RBLA 4OTKA 3LK6A 3B05A 3OC4A 2YBTA 1TPEA 4F79A 8XIAA 2W91A 3AIRA 3THAA 3SEPA 2ZZ1A 3NEVA 2NPXA 3Q58A 1QO2A 4AEFA 3PZ9A 2J8TA 2GK1B 1WDQA 4GJIA 1UH2A 3NVYB 3R4IA 4NZJA 1XYBA 5BMXA 4YCPA 2D0FA 2X30A 4J56A 2ALDA 4W5ZA 2WQPA 3DGBA 1B4KA 1NHSA 4NILA 1P5BA 2CFYA 5LNUA 1SO6A 4JCLA 3EZ4A 2R1MA 1AJ0A 1BTCA 2ZRUA 3AS2A 2VFIA 3T2PA 4ZQOA 3B4UA 4XISA 3UFYA 4J3XA 1CXKA 2GUYA 1OBAA 3GM8A 2V5JA 2ZX9A 5D4YA 1SB3B 2WJDA 3OHIA 5I0DA 3NGJA 3TMQA 1VPXA 3PVFA 3N9SA 4AC7C 2XTKA 4FI4A 5A2CA 2NXGA 1H7PA 3WF3A 4RW3A 1NDYA 3BDKA 5EMUA 2Y24A 2CIPA 4DHGA 4LY4A 3IGHX 2OZ8A 4DI8A 4C5ZA 1V0MA 5FF4A 2QZRA 1G01A 4HPGA 3L5MA 5BXRA 4KWUA 1DJXA 4ZQRA 4BURA 2VRJA 2G3MA 2PGRA 3BSMA 3BLKA 4U31A 1WXJA 4LV9A 1NP2A 4GCAA 5CPMA 2CESA 4J2MA 1FFVC 3LRKA 2YR1A 3CMJA 3FNDA 3GDTA 4WCJA 4DF1A 3WLNA 1V79A 1MUMA 3H24A 3R7MA 1X97A 3C2OA 1XRFA 4KEMA 1LJYA 4QTGA 5I23A 5DMLA 1BYDA 1EIBA 3CTTA 3DFSA 1PVNA 5DN1A 4JYEA 2J7FA 4OQVA 3MMDA 1GZ1A 4AD2A 5KVHA 2YL5A 2FYMA 2ZCGA 4AWTA 4AXNA 3VNJA 4HOZA 2PLKA 3EPMA 4AWUA 1ME9A 1H7WA 5DXXA 3WBYA 2Z00A 4C6MA 5T9CE 3AIWA 4QQ3A 2GVEA 4KEZA 3QPZA 2GJPA 2CKRA 1IR2A 3HG5A 4DO6A 3ZVIA 3GRTA 2INZA 4LBUA 2P0IA 1RZMA 3O05A 2GVJA 3G0UA 1UW9A 1QNPA 3UZXA 2P1FA 4DPPA 2Y89A 4QNEA 4K1GA 3OYZA 1ADOA 3SRFA 1E70M 3CGBA 4GQQA 2WSQA 3U7BA 5BU9A 3CAVA 4H8NA 3PTQA 1I2PA 3ZO9A 1EL3A 4TO8A 1F4HA 5EMLA 4IQDA 3MWAA 5FCZA 2PDWA 3CV1A 2XIJA 1UD6A 2P10A 2POZA 2QPSA 1JAEA 3EYPA 3N6QA 2NXIA 2C1IA 4S39A 4YWSA 4DM1A 1U83A 3MJYA 2PDUA 1U30A 2Y5EA 3GK0A 3VNKA 1Q7MA 3KLKA 4NZ3A 4NUWA 1KGXA 5BW6A 4JFVA 3OJGA 4N6FA 5DT7A 5GNZA 4OT7A 4CCEA 1R9XA 4KEUA 1LORA 5LIWX 2WSPA 2CWNA 4IJRA 3UJSA 1V3HA 1U5VA 5FKYA 4ZXOA 4BF9A 2DUAA 2Y7FA 4QLJA 3CXBA 1RD5A 2HWGA 3OZYA 2GSJA 1SMDA 3GC2A 4QAIA 1SMAA 3BE7A 1XLIA 1BGGA 2Y7DA 3W70A 2VURA 2RGMA 4RZ6A 3CZLA 1ONXA 5EFFA 1PHQA 2D23A 1C9DA 1DORA 3T7VA 3FXGA 4H1ZA 4IIDA 4HU8A 4QP0A 1G1YA 3RM4A 4UNIA 1HKIA 1N62C 2QV4A 4D1JA 1TPWA 3R8RA 5C5YA 4L9ZA 3TJ4A 2O7QA 1J0ZA 3URAA 5LGZA 1SO5A 1CWYA 5CZSA 3AWNA 3ZOAA 3L4WA 1UIOA 4NRRA 1K3UA 1KRCC 4ZOBA 1OCNA 5K4ZA 4CNUA 4M29A 3L5AA 4FXJA 5A6TC 7ENLA 4A8IA 5I03A 4YVXA 2A0NA 1NPXA 4Y9PA 1E6SM 5DEZA 5KEZA 1TE6A 1VIZA 1IXPA 4O18A 3WD1A 3UVIA 3VFCA 4XAFA 3A7RA 4AD4A 2TYSA 5D38A 3K13A 2WJEA 3WUEA 2VEFA 1TCMA 3D3AA 1ZB5A 3SIMA 2O9OA 4QE1A 4OHQA 3SQPA 3AM9A 2QCNA 5ABFA 8A3HA 4XG1A 2V3FA 5K9DA 4X22A 1CTNA 3UF9A 3OEXA 4M0XA 1A80A 4MF4A 2CZEA 2YYTA 1WKEA 4X2RA 1G6CA 1MW0A 3L5OA 1WDRA 2VDIA 2CZFA 4GZJA 5CAHA 4IMDA 4ZO8A 1V6YA 1TV2A 3L4ZA 2C71A 2J66A 1HX0A 2WOWA 5HWJA 1KTNA 4AZ5A 2WOIA 3G3MA 4PCTA 3OLIA 4S3GA 1RLCL 2Y70A 1M53A 1VHNA 1D3CA 4JY8A 4Z2IA 1ODUA 3L2MA 1GZJA 3WLKX 1RP9A 1AH3A 5BXSA 4HYVA 5A2AA 3PULA 1YQZA 3TQPA 3IJ8A 3QSTA 3GO2A 2DZVA 3POHA 3VD7A 3CC1A 1M04A 1R2SA 4HT3A 4Q6XA 2FTWA 2JK6A 3MHUA 3T07A 3DH7A 2DP3A 3O06A 5A2BA 3LCGA 3T8QA 4DLFA 2GR3A 1RPXA 3BOFA 3ITLA 4IFKB 3NCOA 4KWOA 4H4IA 3H2CA 2WHKA 3WNLA 3PPFA 4EF9A 3RJYA 1UR9A 2GJRA 4LUIA 3OYXA 3M0XA 3PBUA 2VD8A 4Z2GA 2FZMA 1E6PA 3WZ0E 1TWIA 2ZZ2A 1EHNA 3QR1A 4L61A 4Y9NA 4PBEA 2Y4SA 1TR1A 3TR2A 2CITA 1XR2A 4NL1A 4IFOA 4NYYA 3O7UA 3OG2A 4V33A 2ISFA 4HPHA 4OWGA 4WGXA 1VBRA 2J79A 4G56A 3VMPA 3EA3A 1OCQA 2GSEA 1NWSA 5M17A 3GXMA 1HJWA 2ZQ0A 3OB8A 2WCSA 4E2VA 2ZX8A 4NEWA 2J78A 2AKZA 1NHPA 4NJHA 4DN1A 3PZVA 2GJNA 3A4XA 1Z6KA 3OBKA 3MDUA 2O0TA 3MS8A 4H8HA 4IXHA 4MY1A 1QMLA 3GDRA 3W2MA 3BLOA 3TTQA 1V0KA 1XQKA 3B8TA 4L64A 4UFIA 2AAMA 4QFUA 3VKBA 2QPXA 2C13A 4C5YA 4D8ZA 2Y8UA 1GV4A 4GX8A 4EXQA 3OGVA 3PWAA 1BRLB 3O6DA 1YDYA 1OFOA 2IW0A 1X6NA 4RZ4A 2PLMA 3IC9A 2ABBA 2EJAA 2VENA 3FA4A 5CCZA 1XFBA 2YVJA 4RUBA 3TYBA 4O0QA 2HK0A 4E4PA 3CJPA 3N34A 5D9OA 5G1MA 2DU2A 3LNMA 4JDYA 2VUYA 5ABGA 3TK7A 4P8XA 3WNMA 4MTVA 3VGBA 4QJ5B 4JX5A 1Z44A 4I8YA 1TTJA 3F03K 4JS3A 1Z48A 1E73M 4GQBA 3U0HA 1CEOA 1V3LA 4DVOA 4GFSA 2OR2A 3CBWA 3O9NA 3F4WA 1LUCA 1G4EA 2WLZA 2YXXA 1VLIA 4UFHA 1UWRA 4W93A 1X7FA 2E6FA 3B9AA 2R1NA 3F7JA 5C70A 3VO0A 1VENA 3KRUA 1TG7A 1HXJA 2HZGA 3ZJ8A 2W67A 3LOTA 2ZXBA 3R6IA 5D03A 3WQDA 1BF6A 4NAEA 2GQ9A 1ML1A 2W5FA 3GLCA 1EDTA 3ARXA 1EIXA 1FCUA 4XK2A 4H9MA 2MUCA 2ZOXA 5I2UA 1E6RA 4Q7NA 2AAQA 3FEMA 1DIDA 4WOQA 1D7YA 4AEEA 4ENLA 3OGRA 1W5MA 3TA6A 1IYXA 4Y2WA 2VELA 1UASA 5A8QA 4WDXA 1PIIA 3W7HA 1LP6A 1W1TA 1UR1A 3P84A 2CU0A 1W9UA 4H00A 1ZCOA 1WDPA 1X98A 5FEZA 3NO1A 4RE3A 4UTFA 3QFAA 1X39A 1FO4A 4I5RA 3SJ3A 4DXKA 1IIGA 2VX7A 5IBXC 1E43A 4J5NA 4JIIX 1QPKA 2C91A 1LDCA 3T2OA 1AOGA 4KIRA 4HPNA 1N61C 1HG3A 4FR1A 1EUNA 3CUGA 1KD0A 3LGEA 3AO0A 2DT0A 1ENUA 1E3XA 2WHMA 5EA9A 4NJKA 1I2NA 1U33A 3TQ0A 3EKZA 4UQCA 3PUGA 1WAWA 2WMKA 1KCZA 5M5DA 1OGSA 3THCA 1GRTA 3DX5A 2EQDA 1UJQA 4O15A 4ADWA 2EQ7A 1LOQA 4F9JA 3Q45A 1XCWA 1UPMB 4IISA 3MU7A 3KOYA 1VJSA 3TEVA 4CNSA 2QVNA 1PTAA 3PSWA 3AIBA 2D2JA 2WK2A 1H5VA 2WNZA 4DJED 1GEHA 2PI6A 4GI6A 3AHTA 3BAYA 3PANA 4JQ4A 3BOLA 3TUUA 4KT2A 3FJLA 4AB4A 3AXMA 2A3EA 2BNJA 2WOQA 4E0CA 3AMKA 2EXOA 3CUHA 1JZ3A 3L9CA 4WOZA 1FA2A 4KGLA 1UZ1A 3JR2A 4DNMA 4XZBA 3EWZA 1MRAA 3OO2A 3MYOA 4NKCA 2NX1A 3WCZA 1EYWA 3UU0A 4HNNA 1KBLA 3RLGA 3MP5A 4L80A 4JAWA 1CXLA 3B8IA 1GOQA 2CLFA 4GIRA 1JPKA 4MADA 3MSYA 3W29A 3BG5A 3EEGA 1KFCA 3R2GA 3RX3A 4XD6A 1OM0A 3K5XA 2VX6A 4IF2A 4AZ7A 3FJ4A 4KS0A 3RHGA 5XINA 4G8TA 3NRZB 3UA4A 4E4FA 1ZSXA 2DIEA 3IVSA 1SW3A 1VLWA 1H7RA 4XVDA 2BY2A 4DIAA 2CPUA 1H0GA 4NY2A 1Q6OA 2WJZA 3RCNA 1FH7A 3IIPA 2X8RA 3RPMA 1MQQA 3S1XA 2BXZA 4RV8A 4QX4A 1TIMA 3EKGA 3NPWA 3N2BA 1MO0A 3POCA 1THFD 4B5TA 5AFDA 1D9EA 3TYAA 4GGBA 2VUNA 4UR9A 1JZ8A 4C6OA 2C7FA 3S1WA 6ALDA 2QCEA 2ZDSA 5FF3A 2OX1A 1F9CA 1GNXA 2PWUA 1C8XA 1JPIA 3MJMA 4X2PA 4F0MA 3QQ1A 4Y8EA 3VD3A 1F4AA 3A23A 5REQB 2RDXA 2VC6A 5I3GA 4N0RA 4X9SA 1F7BA 4LS2A 5I3HA 1PIF