3U9IA

The crystal structure of mandelate racemase/muconate lactonizing enzyme from roseiflexus sp.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
366
structure length
346
Chain Sequence
TAPTTIRALTVAPLDIPLHEVARNLLVAVELTDGTRGYGEAAPFPAFNGETQDMAHAAILAARSLVEGADVREWRRIALALPALPGMTGSARCAIETAILDALTRRARLPLWAFFGGAATSLETDVTITVTAAARAAQAIVARGVTTIKIKIGTIRTMEHDLARIVAIRDVAPTARLILDGNCGYTAPDALRLLDMLGVHGIVPALFEQPVAKDDEEGLRRLTATRRVPVAADESVASATDAARLARNAAVDVLNIKLMKCGIVEALDIAAIARTAGLHLMIGGMVESLLAMTVSACFAAGQGGFRFVDLDTPLFLAENPFDGGMTYHGGTIDLTLIEAGHGVTPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme, C-terminal d
publication title The crystal structure of Mandelate racemase/muconate lactonizing enzyme from Roseiflexus sp.
rcsb
source organism Roseiflexus sp. rs-1
total genus 109
structure length 346
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3u9iA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3u9iA01
1MUCA 3TTEA 3U4FA 3B97A 5FJTA 3DERA 3SBFA 3DEQA 4FI4A 2DW6A 2OZTA 3MY9A 2GGIA 1F9CA 2QDDA 3UJSA 3NZGA 2AKMA 4JN7A 3R25A 2QGYA 4MMWA 2CHRA 3HPFA 3FCPA 3PK7A 3UJRA 2OFJA 5BOFA 2OZ8A 4KEMA 4Z17A 3CXOA 3UJFA 7ENLA 3PWIA 3BJSA 4HYRA 2PU1A 1TZZA 1TKKA 4HCHA 4K2SA 1JCTA 2FKPA 3NXLA 2PA6A 1NELA 4DXKA 2P88A 3DESA 1JPDX 4MGGA 3Q4DA 3N4FA 4GGBA 1FHUA 3JZUA 2OO6A 2QVHA 2XSXA 3VFCA 4JHMA 4GMEA 2XH4A 4DWDA 1MDLA 3VC5A 2PCEA 1WUFA 3DFYA 2PTZA 1PDYA 3ZVHB 1XPYA 3R0KA 3RITA 4H2HA 1E9IA 1XS2A 2AL2B 2P8CA 1FHVA 4A6GA 1P43A 1IYXA 4GYPA 3TJIA 3ZVIA 4HN8A 3R11A 4HPNA 3ZLGA 1JPMA 4A3RA 3K1GA 2PP0A 3DGBA 3UCCA 4K1WA 4IT1A 4KPLA 3R10A 4JN8A 1KKRA 3OPSA 2MNRA 2GSHA 4DN1A 2P3ZA 3IJLA 3FYYA 3QTPA 1NU5A 3UXKA 2PTXA 4GISA 4G7FA 3N4EA 3MWCA 1L8PA 3JW7A 3ES7A 1MNSA 3CYJA 3CT2A 2I5QA 3NFUA 5ENLA 3T6CA 4IP4A 3TCSA 1SJAA 1P48A 1RVKA 3NO1A 1ELSA 2AKZA 4IL0A 4F4RA 2ZC8A 4DX3A 4E5TA 3UJ2A 4E4FA 5BOEA 2OPJA 3OZMA 3P3BA 2XH0A 2POZA 3GY1A 3RGTA 5FJPA 2PGWA 4HCDA 1ECQA 1R0MA 2PP1A 2PS2A 1PDZA 4H1ZA 3MKCA 3V4BA 3SN1A 3OTRA 3CB3A 3V5CA 4HCLA 3I4KA 1BKHA 3GD6A 3TWAA 1R6WA 3UCDA 2OKTA 4DHGA 3MZNA 3QN3A 3R0UA 4EWJA 3D46A 3IJIA 3ENLA 3CAWA 5FJRA 3RO6A 2ONEA 3RR1A 3H12A 4E8GA 3SJNA 4MKSA 4A35A 3VDGA 3T8QA 3TW9A 3VCCA 3STPA 3H70A 3H7VA 3ZVHA 1YEYA 2DW7A 3UJEA 2PU0A 1SJBA 3VCNA 3BSMA 1KD0A 3DG6A 4Z1YA 3H8AA 3QLDA 1DTNA 2OQYA 2AL1A 2XH7A 1WUEA 5FJOA 3VC6A 3IK4A 3S5SA 2P8BA 5FJUA 2PTWA 3TQPA 2HXTA 3T9PA 1EC7A 3V5FA 4M6UA 3FXGA 1KKOA 3FVDA 3IJQA 3KUMA 4J3ZA 3I6EA 3ES8A 2PPGA 3SQSA 2GGGA 3PFRA 1OEPA 2GDQA 2HZGA 3DDMA 1ONEA 1TE6A 4H19A 3QPEA 3T4WA 3UGVA 3OZYA 1JDFA 2GGJA 3FV9A 3TJ4A 4GIRA 3GO2A 2QJJA 3EKGA 2QDEA 3CK5A 3GC2A 3N6JA 2HXUA 2XGZA 1W6TA 3MQTA 6ENLA 4X2PA 4IP5A 2OQHA 3N6HA 2XH2A 3R1ZA 2PGEA 1EBGA 2OVLA 2OX4A 2ZADA 3TWBA 3UXLA 2OG9A 5IDZA 3DG3A 2OLAA 1MDRA 3DG7A 3VA8A 1BQGA 5EU9A 2O56A 1KCZA 2PSNA 3ZLHA 2QJNA 4HNCA 5J04A 3P0WA 2PTYA 4M0XA 3OW1A 3DFHA 2PP3A 4GFIA 3PWGA 2OZ3A 2QQ6A 3D47A 4GGHA 4ROPA 4KT2A 3EEZA 3ZLFA 3SN0A 1EBHA 4ZCWA 4ZA0A 4E6MA 4IHCA 1EC9A 2QJMA 4IZGA 3MSYA 3S47A 4ENLA 3DIPA 4H83A 3V3WA 4FP1A 3TOYA 2GGEA 2RDXA 3SSZA 2GL5A 2FYMA 4J1OA 2AL2A 4IL2A 1MRAA 3RRAA 4HNLA 4K8GA 3U9IA 4DYEA 3FJ4A 3OP2A 3P93A 2PODA 1EC8A 3MUCA 2MUCA 3BOXA 2GGHA 2P0IA 2NQLA 3JVAA 1SJDA 3I6TA 4KWSA 4GYPC 4YWSA 3Q45A 2PMQA 3QKEA 1SJCA 4E4UA 3SN4A 3THUA 4G8TA 2HNEA 3RCYA
chains in the Genus database with same CATH superfamily
9XIAA 3F2DA 1GG0A 3MUAA 1W31A 1ADSA 2IKJA 2PI6A 5AYBA 2BS9A 1LRQA 2X99A 1R9XA 2QUUA 3M0LA 1PEZA 1LQ0A 1L6WA 2F7FA 5FEXA 2ISDA 2VKZG 1XRVA 3ZR4A 1FHDA 4IIEA 3HPFA 3V0SA 2ZXDA 5ABEA 4NZFA 1FWWA 4ADUA 2OZ8A 1IHIA 2PGFA 1IXNA 1S2TA 3PTKA 3MO4A 2PU1A 4RDVA 4XG1A 4J28A 3UFYA 4C1LA 4L64A 3TROA 1BEUA 4XK2A 3UA3A 2XN2A 4B9ZA 3VDAA 3MDWA 2X0SA 1W2PA 3U0HA 4BV6A 1JCTA 1VZWA 1I2QA 3TLLA 1BXNA 2FGLA 4FXRA 2GK1A 4BQ4A 3ZJ8A 2JEPA 3IJDA 2F2HA 4I9TA 3UBPC 1SO3A 1FCBA 4GBUA 4K6AA 2EGZA 1M03A 4XBJA 1SZEA 3ECQA 2CHNA 3W9ZA 4AWTA 4XAFA 4AEEA 4CD5A 3AS0A 1TA3A 3LLFA 3M64A 4V1YA 4O8AA 1I60A 2DZWA 2GQ8A 1NVMA 1QWKA 4XAPA 1U5JA 1A0CA 3DFYA 4KGLA 2V69A 5REQA 2RGLA 1GORA 1BF2A 4J3XA 4OV9A 4C6OA 4U2ZA 3LBOA 1VBUA 1D7FA 4B2DA 5D9MA 1UASA 3CXBA 2DPEA 1WXJA 4AXNA 4Q8QA 2XIJA 3VKJA 3EDFA 2QPSA 4JTDA 1XYZA 1ZX9A 4D6JA 1JPMA 1UP2A 1MXSA 4O54A 2POTA 2RFGA 5FF3A 4WD0A 4Q8VA 2GVYA 1VJZA 4KWVA 2NVDA 5HPOA 4WDUA 1GYNA 1OCNA 3VABA 4ZXOA 3B4UA 3LERA 2YB4A 2Z24A 2GUYA 2CBUA 1UW9A 4ONVA 4G7FA 1JYNA 1AJ0A 1BG9A 2QDGA 2B4GA 3C5QA 3E1F1 1UH2A 1CNVA 4IQEA 4AX6A 3MBDA 3NFUA 2ZRWA 4B5SA 1P48A 4UR9A 3WUEA 1WDSA 2MANA 4ZQRA 3B9OA 3A64A 4L6HA 4GO8A 3NL3A 1W1VA 4M3PA 4IJBA 3U7BA 3UG8A 5TNVA 4ERGA 1U2YA 1UOZA 5A8MA 4Z1CA 4HCDA 3DI1A 3CHFA 1TWIA 4JIEA 3EWBX 2JGYA 4TTGA 1V5XA 2R1MA 3BANA 2Y63A 1OABA 2WWDA 4MY1A 5IHSA 3R0DA 4IG2B 1CT5A 3O8AA 3UCDA 3MZNA 7REQA 4Q32A 1VIWA 2R94A 2NUWA 4REQB 1XR2A 2OB3A 4Q6JA 4YIWA 1FFQA 4B5NA 2XISA 3N18A 3OHMB 4CD8A 4E8GA 3FY1A 3GKAA 5BXTA 1T96A 1LP6A 3B0UX 4ADSA 5AYYA 2G97A 4WOQA 4UFKA 1PTDA 4KWOA 1H0IA 1BZLA 1DTNA 1GRGA 4Q8MA 1EB3A 3KP1A 5JMUA 1QFEA 2FPVA 2CZ5A 1Z41A 1DE6A 3HG4A 3ME3A 3Q65A 2YQUA 4PCPA 4MB1A 4D6GA 4OBRA 3QGAC 2FB3A 1EC7A 4AWSA 3W83A 3LHTA 3DBNA 1K9EA 4R7OA 2O92A 3LHWA 3MI6A 4IIDA 4BWLA 3ZO9A 4Y90A 1ISZA 1UUMA 4HOWA 2OWWA 3ZJKA 3U5YA 3FV9A 5LA2A 4LSBA 2NQ9A 3S2JA 1ZAJA 4OUIA 1FTXA 3EX4A 5HJXA 3I3DA 2WMIB 3EEGA 3NZPA 4BQ5A 3WY1A 3CNYA 1XYBA 4QEHA 3QBUA 3QH2A 4ZVJA 4TV6A 2NQJA 2XU2A 1TVNA 1V51A 1LVLA 3UCQA 3WBXA 4IPIA 4BCEA 4IFOA 5JH2A 3ZJ7A 2OZ0A 1K6WA 4LVBA 4JX4A 3WDIA 2OWCA 2ZWYA 4WSHA 2ZXAA 4M81A 2GYIA 3NQAA 2R9RA 2E1WA 2EO7A 4LYKA 3UEQA 1QBAA 3CIVA 4HNCA 1AK5A 5J04A 3IC9A 2E5BA 2GRTA 2R1PA 1FEAA 3KWSA 2ZZ3A 4GFSA 4KRTA 4ECLA 3GNDA 1DJXA 2VRQA 3ABZA 1W5MA 3EA1A 1V8EA 2G96A 3NSNA 3HGOA 4GXMA 3AIEA 4U2YA 4IHCA 3CWNA 3ZR5A 3RLGA 4NAFB 3MWAA 1VLIA 1J8VA 3MSYA 4GH1A 4PSRA 3NDYA 1MEWA 3ZT7A 1LUCB 2BLEA 3CZKA 3V1PA 3N04A 3SQMA 1HF6A 4QXIA 1S1PA 5HMEA 2PLCA 4ICMA 1F8IA 1DYSA 4D8AA 4CN1A 3U5UA 3FAXA 4A05A 4LAMA 2ATSA 5CGTA 4GKTA 5CSRA 4O0KA 3GG1A 2OGYA 4MKVA 1Q66A 4UBPC 3DFOA 3QY7A 2JALA 3UU0A 2V3DA 2ASHA 2XPKA 4AZ5A 3NM3A 1JF6A 3G3MA 3SGZA 1TWDA 4AH7A 4JZ5A 2HNEA 5IBXC 3ABQA 2WLYA 3CPRA 1EDGA 1HP4A 4FX8A 3PB0A 1G4PA 2G95A 2NV2A 2CC0A 3WL1A 2QGHA 3E0VA 4NNBA 1RZMA 3T0TA 1B90A 2DW6A 2PZ0A 3UPMA 1F9CA 4LV9A 3BW4A 2DP3A 3WLPA 3EWDA 4B3LA 3KE0A 1KGXA 1ZFJA 2Y6ZA 4EANA 2QHAA 2I9UA 3LPGA 2IKGA 5K4ZA 4PMZA 1DJGA 5HNUA 4QG9A 1Y5VA 3WBWA 3PWIA 3WF1A 2UV8G 4WEVX 2ZOXA 4XZIA 3V75A 1Q7ZA 4ZSUA 1UWSA 5EBUA 1NOWA 4QTGA 3QSRA 2W55A 3FYOA 3M1ZA 3BAJA 3VU2A 4EF8A 4HD5A 1P6WA 4NX0A 3N2TA 4J5NA 5CC6A 1JZ4A 3ARWA 5I77A 3TE9A 1S5NA 1NELA 2Z26A 4OU1A 1C8XA 4UFJA 2X50A 4K8DA 4MGGA 3QPZA 4LBUA 7PTDA 3QFWA 1QPKA 4N4QA 4PH6A 3VNLA 1X1OA 3FEQA 4MPKA 4QE1A 4LUYA 2NXHA 1VIZA 1N5WC 2CPUA 4HBKA 4C91A 3OVPA 2RH9A 3EX3A 1XUZA 1QRQA 3W23A 4C60A 4C6JA 4LF1A 7ODCA 1HUVA 4WDWA 5DCEA 1F3TA 1BTCA 3EKZA 4OBSA 2PDIA 3E3HA 3APYA 3H4GA 3HQ1A 1B9ZA 3VDCA 3TJIA 1WDDA 1MXDA 4FLRA 3ZVIA 4BEQA 1ZBCA 3K1GA 2O55A 2CITA 2J75A 3B9EA 2WQDA 5HNNA 3F4VA 3KS5A 5LIXX 1DIKA 2A5HA 1CBGA 3A13A 2VFIA 1LF1A 2ZX5A 3MA8A 1XIEA 2FDMA 2XFFA 1L0PA 4YS1A 1I45A 5D2XA 2G3IA 3ITYA 2XTKA 5CAKA 2DIJA 4I3GA 3T78A 3N4EA 3O6CA 3LCIA 3A23A 3CGBA 1DXIA 3CYJA 3WNNA 4C6KA 1F2JA 1HG3A 2NVCA 3REQA 1HTIA 3CT2A 4GRSA 1CZ1A 2ZX6A 3CLMA 1DE5A 2VRJA 3L21A 5H8MA 4Q8NA 1RVKA 3QOMA 4LUJA 3ANVA 3C2VA 3L0NA 3D6NA 3V35A 3WQOA 3XISA 3UG3A 2XH0A 2J24A 2WNZA 2POZA 1XW8A 2X05A 3HV8A 1JOAA 1L6SA 3O07A 3STFA 4DBDA 1RCQA 3CMGA 4S3AA 4CNPA 3SAZA 1PTGA 3NPUA 4NIRA 5AHIA 2Y7DA 1XBVA 3TK7A 3QVQA 1MW1A 1WDRA 1YXCA 3FN9A 1XF0A 1TJ1A 1YHTA 4L1GA 1DPMA 1HQTA 1OFBA 4RZ6A 3HGRA 1IWBA 3UZJA 4URIA 1B3ZA 3GUWA 4NU7A 4IPJA 4FHAA 5AVHA 2JIEA 2IQTA 2Y89A 4W93A 2GDVA 1OQFA 4Z2GA 1Z3NA 4GI9A 3TYUA 1HO1A 4G1NA 5LXEA 2H8ZA 2DZTA 4CNNA 4B16A 5IDIA 5FS9A 2GUUA 1SU5A 2WO5A 2QEZA 4GQ0A 3S42A 3WL0A 3VCNA 2ZVIA 4MADA 3UXIA 3LXAA 4RZBA 5CLWA 2XH7A 3K4WA 1E6QM 1QNRA 5EY5A 3W00A 4BQ2A 2E3TA 4C7FA 4ICNA 1FH8A 3FEMA 4DWSB 2OLHA 4O50A 5G5HB 3TQPA 1TX0A 1XIDA 4ZTXA 3CGEA 2EPKX 4L80A 1J5SA 4AZHA 1W8GA 5DRCA 1DJQA 5LXXA 4MNLA 1TYPA 4MLJA 1VFLA 2Q02A 1N2VA 3GAYA 1BWCA 3PP7A 1FWJC 1IT0A 3SECA 2HQAA 4WXYA 1XIJA 2VJXA 3AMCA 2NUXA 2V3EA 5G5GB 2PDJA 1OFDA 2WPGA 4O11A 2HE5A 4GC4A 1UKTA 3BQ5A 4JQ9A 4YVXA 4DF1A 2WSQA 2VC6A 2OOGA 1JZ2A 3PVFA 1OFAA 4Q3MA 3AMGA 3TLQA 3THQA 1GETA 2VR2A 4O16A 1FWIC 1HT6A 2W6RA 3N4AA 5HUOA 1RJPA 1VPXA 1PXGA 4C7GA 4ZENA 2ZADA 1ZCCA 2WJZA 4UR7A 2F84A 3NZQA 3W2KA 2O56A 5CSSA 2BZNA 3SFWA 3P8JA 3DU0A 1HN1A 1X98A 3VILA 4F48A 4AVFA 1TV2A 3VGBA 1N82A 4QJ1A 2CNCA 4AX7A 1TJPA 1E71M 1UJPA 1A0EA 3W4RA 4E6MA 3A7UA 4HK5A 2XIIA 3TQ0A 1UYQA 1QMLA 1TREA 2BV9A 2ISFA 4PFHA 4MZ1A 1X7IA 1B3XA 4M52A 4GVGA 2YAUA 4Q4SA 3KL3A 3KCLA 4EIVA 1EWDA 2OKOA 4LX4A 5CC7A 1DP0A 1MRAA 3R07C 4CD7A 2Z1VA 4HNLA 1X8CA 1XIFA 1IXQA 1ONRA 3PZUA 4AUBA 2CWXA 4K7YA 1KFEA 2NWRA 5LA0A 1EC8A 2IUZA 4CN6A 1N55A 5HA7A 2XFWA 4X22A 4LNCA 3WUGA 3W72A 3CZGA 2DT0A 1DWAM 1VFUA 1U1JA 2E1DA 1FO4A 3WH9A 4RZ5A 2WB5A 1VB9A 1KM2A 4AF0B 3Q94A 4UFIA 1CXFA 3NIYA 1X6LA 2O4MA 2GJRA 4K38A 1M5WA 2A1YA 2ZFAA 3E0LA 4XZNX 5T9BG 4GINA 4UTMA 2VGIA 1XGEA 5M2FX 2CLKA 3UWYA 5EMKA 1MO0A 1SW3A 2QDDA 4G5DA 2Q71A 1OG6A 2BY0A 3AICA 4ZOCA 2X0HA 3UZWA 2QGYA 4KERA 1DXEA 1MEHA 3PK7A 2R91A 1UP0A 1XYFA 4DM1A 5H8PA 7CGTA 4EQSA 4HVXA 5PTDA 4UMBA 3OHIA 1V7AA 2Z1KA 3DGZA 3CXOA 3WLHA 2WBAA 3WQGA 3GFYA 1J10A 1RQHA 5KVHA 1ITXA 1CB7B 4HPHA 1IWPA 5FSDC 1K02A 1XFBA 3T0BA 3VNIA 2J9XA 5KITA 4P7LA 3SZ8A 3SURA 2E0PA 4N02A 3DAQA 3GW0A 1KLZA 2FKPA 3RF9A 2A85A 2PA6A 1GHRA 3FKKA 3CUXA 3TN4A 4PFMA 5DRIA 4XZHA 6ALDA 1T40A 1UR4A 1E73M 2X16A 4S3JA 5DCBA 2O7QA 1KM4A 3GZ3A 4JTQA 3SUVA 4ZB2A 3HGJA 1AVAA 3T0AA 3EPOA 5BWFA 1O1ZA 5A6BA 5LNSA 2PCEA 1ONXA 4DO5A 1J0KA 4O28A 4L1WA 1JPKA 3P82A 4RR4A 2PWFA 3RPMA 1M7PA 1JD9A 4FR6A 1VEMA 1FWTA 1LRTA 1XX1A 2VWSA 4MTVA 3NQ8A 4U31A 3M0KA 3QY6A 3AUJA 4IUGA 4ZOEA 4QM1A 3AXXA 1YPXA 3EKLA 5FJJA 2Q3OA 1WAUA 3IIVA 1KFWA 1JQVA 4U3CA 3LCFA 4IMEA 1B30A 1T41A 2YCKX 4UQEA 4QQ3A 3PZIA 3SY8A 3S6TA 1N60C 4NJGA 4Q4OA 4GXWA 3R10A 3OPSA 1OB0A 5CKSA 2FMOA 4BWLC 3UXKA 1HJQA 4Z1DA 3WLMA 2V3GA 4FEZA 3H22A 1Z7AA 3BJTA 2FPYA 4DUXA 4W86A 3GNXA 1RA5A 4JQAA 4TTUA 4LBSA 2ZX9A 5BCAA 2XUCA 3KRZA 2UY2A 4PZVA 1DIOA 2V2HA 3OEXA 4LUSA 1NDYA 1ELSA 2AKZA 3P81A 4O4WA 4J40A 3BLOA 2ZC8A 3I7QA 4M56A 4E4FA 2VVSA 2WPCA 1TIWA 3WLIA 3T4CA 1ZMCA 2VEKA 3LRKA 4YU1A 1MXGA 4DXVA 3WDPP 4NSBA 4UTKA 3HPSA 1HL9A 4NZ4A 1UD3A 4GQRA 1BYAA 1VRDA 1XLKA 2QDHA 4LC8A 3RM4A 2G5WA 2PBOA 1J01A 1GQNA 1QPRA 3VE7A 1MQPA 1RPXA 3EXSA 3W81A 1Z44A 3V4BA 3IIOA 3GTHA 1E0TA 1XKYA 2REQB 3CB3A 2XDFA 2JKAA 2YL6A 3FHQA 4H4PA 1F6KA 3W6YA 3W76A 3T44A 4H4YA 1TPUA 4AIEA 1DHKA 4W9TA 2YSWA 3PNZA 5FJRA 1AH4A 4MWAA 4PBEA 2ONEA 2QNEA 3SJNA 1D8CA 3WF2A 1XRTA 2PWDA 4JYEA 5I3KA 3QV8A 4IGHA 3N2CA 3H70A 3ZIZA 3UZ5A 4WCJA 1QJWA 4BK9A 4NXSA 1MEIA 4JTSA 4X63A 2R1NA 5I23A 3VX0A 3A9IA 2P8BA 3DFTA 2PRLA 3LX9A 5A8PA 5FAGA 2Z1SA 3M7WA 3BSHA 3VIJA 1BWKA 2PPGA 1DKWA 3KZPA 3GU9A 1J79A 3H4XA 4CU8A 1S2CA 1VFOA 2A79A 3ARRA 1BVWA 1CW2A 1XLLA 4H4RA 4PCFA 3RDKA 5JCLA 1PZ0A 3VD7A 4GIRA 4Q4KA 4LQ1A 1FBAA 1JIBA 3O9NA 4N7QA 4GC3A 3Q37A 3DKJA 2W66A 4RJEA 2ZWZA 2NT0A 3N2MA 5FEZA 4ADWA 3TW6A 2QCEA 2OO0A 2XYLA 1GVEA 4S3FA 4IMAA 1GWJA 1KA9F 3H26A 6REQA 3PPFA 4JTEA 2J4GA 5HJYA 3FA5A 5HNRA 2VOTA 3GG7A 3HURA 4DUVA 4JCMA 4GI8A 3O16A 4UTLA 1TIMA 3LV6A 1QW8A 4UTTA 3C2OA 3RPTA 4C6DA 5LNVA 4DBUA 3ZWSA 2BXZA 2YIHA 3S0CA 3UY8A 3KBSA 2Y70A 3DYPA 4Q33A 4GFIA 1UWQA 3CTTA 2QQ6A 2DJXA 3AIBA 1VYSX 2DIEA 2VR4A 2E25A 3LTSA 2YBTA 1UB3A 3E96A 4ORIA 5I3FA 1HKKA 1SYTA 1ISXA 1K7FA 1Q2RA 1I0DA 2V3AA 1R38A 3WK3A 2AMGA 4JIQA 3B03A 4E2DA 5G1MA 4HNOA 1N8FA 1XRSA 4JIRA 4HIBA 2GL5A 3WD4A 4MB3A 5D03A 4EQXA 4LPCA 3USBA 4DF0A 3P84A 4J35A 4YN5A 4BQ3A 2R9ZA 4L4MA 1IT7A 1UQYA 2ADAA 3DH9A 2CBIA 1AODA 1VH7A 2V8ZA 1DJIA 1L6YA 3BW2A 2INEA 1AH0A 4DVOA 4LU0A 1OD8A 1E1CA 1A5AA 2EPLX 3Q45A 1UPMB 3EDDA 5RUBA 3LA4A 2H9AB 4W88A 3STEA 3MCOA 2GH5A 3GHUA 3R43A 2XJ7A 1WV2A 4PL1A 4AY7A 1K8YA 3DFQA 2NVAA 4XUGA 4M51A 2PDFA 3B8VA 3BG3A 3BZJA 2V63A 3N2OA 1VQZA 4IXHA 1V6VA 1Q7MA 3R2GA 4JNZA 4FNSA 4YPJA 4YVVA 1OADA 1K4GA 4NZCA 3GU2A 1E0VA 2BOFX 3W2UA 1UMYA 2Z2UA 3FW6A 4H6EA 5D8ZA 4PMYA 3IUDA 3VIIA 3UJRA 3NUKA 4Y8FA 1E3ZA 3V18A 3WK2A 1OX4A 3BJSA 5I24A 4LUTB 1VAHA 3VTRA 3GAKA 3GFZA 1RD5A 3B06A 3OQEA 1GVFA 1W1ZA 3B4YA 1B2YA 3QOKA 4RCXA 2YA0A 2IQ0A 4PSPA 4EPDC 4TMCA 3AHYA 1AUSL 3CU2A 3CH0A 4GUJA 3GSMA 3I6RA 1YQZA 2WPFA 4GKLA 3GTNA 4DEFA 2ZICA 4JHMA 4GMEA 1EPXA 2ZZ6A 2YW4A 4A4AA 5F1VA 4LRTA 3BLFA 3E2SA 3STGA 4J3SA 1VEOA 1TV5A 3TTOA 3W24A 2TAAA 2R24A 1G4TA 3HG3A 3U3HA 2D0HA 3R0KA 3K30A 4LBRA 2VMFA 1OCJA 4DBSA 1W3KA 1F4HA 1W3JA 2V9DA 5C9XA 1EO5A 3CWHA 5DO8A 3A6OA 1GZJA 3D0CA 4PUNA 3TP4A 1GJPA 1D2KA 1S38A 1H49A 4YMZA 2WC3A 4K1WA 4KFOA 1FX6A 5GNZA 4H4WA 5GQBA 4I8YA 2OYMA 3LU2A 2WNQA 2HK0A 2VC7A 3PJWA 1EKOA 1I9CB 1R46A 4WKAA 1W1PA 1VCFA 1Z6KA 2YA2A 5A2AA 2GFTA 4EM4A 1GEHA 1JDDA 4CVWA 3QV9A 1GNXA 2QCMA 3GC5A 4CQ9A 5LA1A 3IUIA 4JGDA 5DCDA 2WVVB 1F8MA 3SUTA 1UPPA 3M07A 3PBWA 2G0WA 3C3UA 4PMDA 3FX4A 2V5LA 4H8NA 3UZYA 2VZSA 2W9MA 2YCLA 1STZA 3KOZA 2WVUA 2CERA 4KCTA 5BXPA 5LKYA 1ZS2A 4M1RA 3HU7A 3TOPA 3MYOA 1XCWA 2WOQA 4XSMA 3HPXA 4W5ZA 5TR3A 1SFSA 4S39A 2Z0IA 3BLLA 4ZOBA 3T09A 3MANA 4WJEA 4L56A 1FRBA 2YVJA 4UNLA 2Q8ZA 5FCZA 1TSIA 4E8CA 2ZYFA 3MI3A 3GBEA 3H7UA 3LSCA 1AJ2A 5A69A 1LROA 4QE5A 3MCNA 3ZR6A 1M1BA 3S9IA 4GXPA 1EX5A 4KCVA 4GE8A 3P0XA 2FGBA 2BY3A 3UWWA 1SJBA 3GLCA 3W2LA 1NPXA 1J5TA 1KD0A 3WMCA 3W53A 1W3LA 2C1GA 3KW3A 4K68A 1BXBA 2DUXA 4UC5A 1CGYA 1W9PA 1S5VA 4HYWA 5E0CA 3PANA 2FZBA 1OT2A 3PBMA 4JFUA 4Q8OA 4IPLA 2YCIX 3LCHA 1CYGA 5FS8A 1CGVA 4F0HA 4LW7A 4D6DA 3MHGA 1GRHA 4IGSA 3EA3A 1NHSA 1GZGA 5JCIA 3R89A 1XIHA 4B5VA 3A5VA 3WUFA 1V6TA 4DB7A 2YBVA 2GGJA 3TJ4A 5C9WA 3FSTA 3V0TA 1EF3A 1GOQA 5C7HA 3S9ZA 3AIVA 3BK0A 1TPH1 2BOGX 2J7EA 1TVPA 3B9NA 1V6WA 2FFIA 1LRNA 3FOKA 3TC6A 1LPFA 1E0UA 1J9YA 1RR2A 1W5QA 3VDHA 2WJFA 2QCNA 2Y24A 3SCNA 4JTFA 3BTNA 1EP3A 4X2PA 1UR2A 2YBUA 4JFVA 3WNKA 3SR7A 4CCCA 3R1ZA 1HP5A 1YXDA 4MYXA 5KSWA 3U2CA 3B9JB 5D4YA 2QJIA 1FCVA 3TWBA 2QCHA 1BQGA 2E6FA 4LWWA 2PRMA 3W37A 3IV8A 3GFXA 4EXQA 1V77A 3EX1A 1EWEA 4H6KA 1R3VA 4RE4A 3PG8A 1YDOA 3ZLFA 2GOKA 3PG9A 3B04A 2AQVA 4QQUA 1S3TC 1HKVA 1F8WA 1PUDA 2CW6A 2WWCA 4GWEA 1K9TA 1W5PA 1QATA 1BGGA 1LQ2A 4N2YA 2XZ9A 2CHOA 2VC9A 3PTDA 1K1DA 1JNDA 1M6IA 1C8QA 3BPWA 3V36A 1V0KA 4IL2A 5HNTA 5D32A 1JYXA 4WZHA 1BRLB 3SCQA 3DENA 3W1AA 5D38A 4KIEA 3OP2A 3HZ3A 1FKXA 3RPDA 3S6DA 1RALA 1EJUC 2OXNA 3I6TA 3RN6A 2HVMA 2PD5A 4JEJA 3NQBA 1VEPA 4Q4PA 1G9HA 1VDVA 4H7VA 4ATDA 4NJJA 2H3BA 2NWSA 3ZS4A 1MWOA 1FVPA 2D20A 3PBYA 3GIQA 3ARSA 3N3MA 3LSBA 5U4NA 2OGJA 5H91A 3GVWA 4EMIA 1GT8A 4NQ1A 1XICA 4EMJA 1C29A 3URAA 3FS2A 3W7RA 4FOJA 3NCOA 4IPPA 2D0FA 2D0GA 2HPIA 3G22A 3UJFA 2CKRA 3WQ4A 2CZVA 4B4HA 4NUWA 3WLTA 1FWGC 1GERA 3F5KA 3CH9A 1OT1A 1T8XA 3W1UA 1Z32X 3OVGA 5A95A 5DELA 4UFMA 1ZUAX 4NY2A 3FGCA 4BS0A 7TIMA 5HANA 2W79A 4OT7A 4PUJA 4UTUA 4WY0F 2PUZA 2OSXA 3HPAA 1ZJIA 2F8QA 4REQA 5LZLA 4IQLA 1DQWA 2VD8A 1PS9A 2XH4A 3RMEA 1Q5MA 3NL2A 3EOOA 3WLLA 2F38A 3SY5A 2Y5JA 4L4PA 4LCRA 5G4EA 4GY7A 3C8FA 1MSSA 3KVJA 2BGQA 4ZZ9A 4MWAC 1QOXA 1PDYA 4RKAA 3SDOA 1NFGA 2DZPA 1KR0A 2EQ6A 3W7DA 3IGUA 1H5VA 1OC6A 1YPIA 4A6GA 3UPBA 2CLIA 1IXOA 1GQIA 3H2FA 4GUGA 4AIUA 2PWVA 4FXJA 3WLSA 1SFLA 2Y61A 4CNOA 1NH6A 1OC5A 3TJXA 4E38A 1UKOA 4WQ6A 3F4NA 3ATZA 4Q8TA 4CQCA 3WD3A 4JS3A 2RDTA 4GISA 3TXVA 1QI4A 3MHUA 2WMIA 1A5MC 4YTQA 4PMRA 1W1A1 2I7GA 4FIQA 4Q7NA 3KOFA 3R7MA 3CTLA 3LHZA 2FTWA 1XGZA 2QAFA 3LHVA 3NR0A 3ZXWA 2W0HA 3FK4A 1ZP3A 3MMWA 4PUMA 3E5BA 1B3WA 1WBJA 4R3UA 4AVNA 2VUYA 1Q8AA 1UA7A 2FJKA 4HMDA 2V81A 1OGBA 3LGDA 4BF5A 1WYIA 4XZMX 5AYIA 2V5JA 2AAAA 3GX9A 3ARUA 4QBXA 3GDMA 1R0MA 4RE3A 2PDYA 4JDBA 4F0MA 4UTTC 4U4MA 5TIMA 1G6CA 4XWUA 2OOFA 1J2BA 3I4KA 3WLRA 1RBAA 2ZZ4A 1JUBA 1E0WA 4J2PA 4BI7A 1R9ZA 5HUPA 3SIMA 3L2MA 3QMRA 2VFDA 2WHLA 2E6AA 1MOKA 4NAFA 3HTWA 1PKLA 4YWOA 2FZNA 2HVOA 5C2GA 1LUCA 4BEUA 4I7WA 3FXYA 5B7ZA 3TMLA 2ZVRA 1SQ7A 2A0NA 3TTYA 3RR1A 1FP9A 3OLIA 1H60A 3AIRA 1JRBA 3B8WA 2Q09A 3LRMA 1AQMA 3H7VA 4BI6A 1YEYA 3IARA 4TIMA 4OUEA 4YL2A 2QAPA 3Q67A 1XG3A 1UWAA 1A5UA 4MZ8A 1D3CA 3F03K 3SJ3A 2X2GA 1LBMA 2ZA3A 1ODUA 5D37A 2VGBA 4J3ZA 1O66A 3ES8A 3ONBA 4V15A 1WOBA 5IFTA 3S5OA 4LVGA 3DDMA 5CPTA 4JN6A 4H19A 2GWGA 2YZ5A 4MDPA 4Z1BA 1E0XA 3TN3A 3VNYA 1BVZA 3SCPA 1F3EA 2ZRYA 5I2UA 1BYCA 4J57A 3GC2A 4JIHA 4H4UA 1J0HA 2Y5SA 1KFCA 3PUOA 1QXLA 2QF8A 3GVRA 5AC5A 5AC6A 3NPWA 2XGZA 1GW9A 1EPVA 2WJDA 1W6TA 3VXGA 4GIEA 5I7GA 4FF5A 2XIOA 3KZSA 3O0HA 1E4IA 4LV4A 1VJSA 3EDKA 2WSYA 3TAOA 3W1TA 3TR2A 3T0DA 4M1BA 3KP0A 4ZQOA 4IX2A 3SRDA 5IDZA 4ATWA 1MDRA 3GXMA 3JRKA 1JZ5A 1G4EA 2QJNA 4M0XA 1XDMA 4IWWA 3PS7A 1QHOA 1RJRA 4WY0A 3RX3A 1PBGA 3BG9A 3L5MA 5I3IA 4EPKA 3MJMA 1Y5WA 1DVJA 3LGEA 1I2PA 4F0SA 4JNYA 3Q6JA 4WHBA 4KW2A 4K7VA 5I3HA 4ZR8A 5HBFA 4IZGA 4GX8A 3WBEA 4A21A 1S5TA 2X40A 4JYDA 1RLDA 2ICSA 1VD6A 3H4KA 3MP4A 4LTSA 4DJDD 3EWXA 1JGIA 3P5ZA 3BAKA 1U22A 3WFZA 4XKMA 4Q4QA 3AS2A 1Q8JA 4JXCA 3A21A 3ID7A 1B4EA 5DY2A 4TVYA 2ZZBA 5LIKX 5JQ9A 4HU4A 1RY8A 2ZE3A 4HSOA 2DU2A 2VL4A 2J47A 4O1EA 3CV7A 3JVAA 2BC1A 1TPDA 4HJFA 3QR0A 1NJJA 2YW3A 1SJCA 1XLBA 4XAGA 4DIAA 3SN4A 2V3BA 1YMYA 1HW6A 3L4UA 1UJQA 3FA4A 2TODA 1JRCA 1ML1A 2WMHA 5FJTA 3WJWA 3WD1A 3VM5A 3GUGA 4ZB5A 4PUWA 2GR2A 3J7HA 2EKGA 3TYZA 1XL9A 1TPVA 3LQLA 5FSEC 3HIJA 2AKMA 1X2HA 4WSKA 3UG5A 2OEJA 3PUGA 4G56A 1Q6FA 1QI0A 3WCZA 1EOKA 3CQHA 3U8GA 4B3ZA 3UYCA 3DK8A 1T0OA 4S3EA 2A8XA 4PMXA 2J77A 1GYLA 1YDVA 3S2NA 3W87A 1XHCA 2GJXB 1QUMA 4GVFA 2VZUA 1UD4A 2WZMA 4PEKA 1OFEA 3WNPA 1C9WA 1HKWA 1Z9AA 1Z89A 1M7XA 3LCXA 4EOUA 1YTDA 3QM3A 1ZY8A 3VNMA 5CZ0A 4AEOA 1ITCA 2YR1A 4LFYA 4LAKA 2A3BA 3WLJA 3ORWA 1PTAA 3OZPA 1YDNA 4WR3A 2J7CA 2P88A 2Y0FA 1ME9A 4OZOA 3WEZA 4IPNB 1P6CA 4MJ4A 4ZE4A 1FWRA 1TMLA 3F2CA 3OBAA 2B7PA 3OQ8A 4XAYA 3UGRA 4AW7A 3GIYA 4FXSA 3NVTA 3BC9A 2O4QA 3LY0A 3LCLA 1ESWA 4KS0A 3W88A 2ZX8A 4K8HA 3O63A 1SZRA 2AMXA 2VXNA 4HNTA 5CC3A 3OC4A 2PZNA 3AISA 2W5FA 4O13A 4GO9A 4GQBA 3WELA 3CT7A 2QUMA 3WLOA 5I00A 4DWSA 2OWXA 3DHUA 4LJ3A 3UF9A 5FF2A 1AG1O 4O12A 4P2VA 5I0DA 2QUVA 4F40A 1ADDA 3TW7A 2XWEA 4NKCA 3C0JA 1UZDA 4G2DA 3PB2A 2ZZ5A 1V3JA 4D1JA 5BYWA 1RQBA 2NV9A 1MO9A 4NG3A 5FS6A 4IT1A 1REQB 1KKRA 2DZSA 1UD6A 3E2QA 3WMBA 5LNUA 1ZBKA 2D2JA 1IZJA 4I5RA 4PUDA 2RGMA 3HQPA 3L5LA 4MDOA 3KVLA 1FHLA 3WH7A 4ILSA 1MNSA 3FKRA 4U3AA 1MYRA 3UR7A 1KM6A 3WH8A 3AI0A 3SADA 1WDWA 1OK6A 3P62A 2E5AA 4DX3A 2FDSA 5LSMA 4Q6XA 5D33A 3M41A 1WAWA 1NF7A 5C54A 4NZ5A 1JGMA 5CEWA 3PM6A 4XISA 1XDJA 4DNMA 1ZY9A 1D3HA 5CPLA 2INZA 4N4PA 4DELA 2BNJA 1KFLA 1XWYA 4AC1X 2BY1A 3LNPA 4LANA 2DSUA 2YKKA 1A3XA 1F73A 3OBKA 2WNWA 1CLVA 1IZCA 3AJXA 1HIZA 5HK4A 4JHOA 4YHGA 5FI8A 1D7KA 3QQ0A 5BOOA 2FMNA 3P67A 3L7RA 2EPMX 4MKSA 1WKYA 4E2VA 2QPUA 1XDIA 3VX1A 3UVAA 2C19A 2WMFA 4KPRA 1H62A 1O1HA 4JL2A 3M5YA 1JZ7A 3PJTA 3VGEA 1GW1A 3PTMA 1T6MA 3W1NA 2OYLA 3H8AA 5BRPA 2Y88A 1AA1B 2CZEA 3LTYA 4FOKA 1PO9A 2X7WA 4IMFA 3S5SA 1W1TA 1ZJAA 1LL4A 2ZZ1A 4WKFA 3QJAA 4FSAA 3EUB3 3CZEA 4RXGA 4AF0A 4D8ZA 4DUOA 5CPOA 3WX7A 3SQPA 2QAEA 1FWDC 1RP9A 3SCOA 1OEPA 5J5RA 4S3BA 4RW3A 4GCAA 1TE6A 2F6UA 3P6LA 3OZYA 2H8XA 3R6IA 3MVTA 4Q22A 3TKFA 3N9KA 1PX3A 3W7LA 4MJZA 1ITQA 2C3CA 3BLIA 4PTVA 4B91A 1VPQA 4AD5A 3AU2A 4GJ1A 4AZ7A 1NHPA 2CCRA 3BGGA 4NZ1A 3BQ6A 3AALA 3I65A 2QCCA 5I07A 3TVAA 1SO4A 3WLNA 4DZ5A 1H50A 2YLLA 1VQTA 1J0IA 1UOKA 1TZ7A 2BWGA 1XDLA 2WOIA 2NVKX 3DJJA 4ERIA 4XUYA 2DUZA 2FTYA 1I75A 3NGFA 3ITVA 1BHGA 2OVLA 4H01A 1C7TA 4AD3A 4KQNA 4MY9A 2DIKA 1EX1A 3N12A 8RUCA 3GZAA 5DN1A 3NJ3A 2NX3A 1EF2A 1K8CA 2OZ3A 1P6BA 1S2UA 4J9JA 1FKWA 2GQ3A 1XC4A 2WC4A 2EEXA 4RNFA 3FAWA 2GQAA 4O10A 4KMQA 2QT3A 4KCUA 3NZRA 2WANA 1TA3B 2QJMA 3ZWTA 5AKQA 2XVNA 4LB4A 2WYSA 1KV8A 1W3TA 1Y5XA 3K4DA 3L4TA 3V5OA 5AZ1A 4QSFA 1NY1A 3C0LA 3F4WA 3NL6A 3QC3A 2DEPA 8TIMA 2ZE0A 4F0KA 5DQPA 1JEZA 1V6UA 4UWMA 4ZO7A 1P7TB 2Q6ZA 2VQUA 4Q4RA 3HPZA 1A5LC 1TTIA 2EPHA 2XIQA 4A3QA 2CLLA 3EB4A 3GU1A 3OJGA 3G1DA 3GQYA 3ITTA 2VX5A 4EPBC 5GPRA 3WQVA 1XYAA 5D2YA 1Q6LA 2NQLA 4XIAA 3F7JA 1SJDA 2Y8UA 3OYZA 1N61C 1FXPA 4LT9A 1S2WA 3MDUA 2A2IA 2X41A 3THUA 3LDVA 2YX0A 1QHZA 5B7YA 1FY6A 2WXDM 3W2MA 3WLKX 5HMDA 1A0DA 1UZ4A 3QKZA 4K39A 2X0YA 3EWYA 1OGGA 2P50A 4J27A 3ALFA 1OGSA 3M0JA 1KTBA 3R25A 5BU9A 1EYEA 3THDA 5LIYX 5A3HA 3EB3A 3APTA 3VKAA 4JYFA 2PWHA 2OFJA 3CEPA 3IVTA 3ZSTA 4XD6A 1WOAA 4LAUA 1BYBA 3GD4A 3NEHA 1XIMA 2FFCA 3L67A 1SR9A 1TZZA 3PZGA 3GR8A 5MKGA 3WQCA 1HGYA 4UQCA 4HHHA 3BH4A 3TN5A 3GM8A 3A9BA 2FTPA 3KEHA 1OM0A 4LVDA 3WF4A 2WHKA 1V7YA 4UXDA 1KRBC 4UIOA 1UR1A 2ALDA 3DESA 4H8UA 1QBBA 2X1UA 7REQB 4QSHA 3C3NA 4HZMA 1F61A 3WK1A 3PWAA 2BGSA 4MIMA 3RCMA 3QYQA 1H2JA 4KFPA 4DWDA 1F5ZA 1VFFA 4AHPA 4IFKB 6XIAA 4J3WA 2OU4A 1XYLA 1AMYA 3AOFA 3W28A 4ZFMA 2Y2WA 3TONA 1OZQA 1O5RA 1B4KA 4UQAA 4LYPA 1LBFA 4IH3A 1XH1A 1JAEA 1E9IA 1HJSA 2QUTA 3TA6A 3O6YX 4I9MA 2NX1A 3W6LA 4R33A 3PJUA 1IGSA 1JDEA 1AMKA 1UWTA 1X97A 2OR2A 5D2WA 3UWVA 5D2VA 3U2ZA 2PP0A 2P5NA 1GQJA 5JBFA 3G6MA 1AL7A 2MNRA 1M41A 4AIBA 4GX9A 4D8LA 2VCBA 1GVIA 2GR3A 2ZUUA 2CESA 2VUNA 4EX4A 3GVVA 2ZRVA 3MWCA 1WZLA 2HBXA 4FX6M 5BZAA 3LLDA 4W8AA 1FOBA 3AHXA 3E0IA 5A94A 2ZZ2A 3T6CA 4BI5A 2VCAA 1H0GA 3AYVA 3B0YA 4LH8A 2P53A 2B31A 3O6AA 4AWUA 2OMAA 1LLZA 2OELA 3VI2A 3MPGA 2G3NA 1EJVC 3FLUA 4H41A 3EMQA 1A5BA 4A2RA 3E6EA 5G2HA 3EDEA 4KEZA 4YTTA 3MKCA 1JZ8A 2EJAA 1J0JA 1N62C 1XCFA 1ZLPA 1XHGA 2OKTA 4DHGA 4DO6A 4DPPA 4YTSA 4ES4A 2XVGA 3BMVA 3IJIA 4C6CA 5CJ5A 1A3HA 3QV7A 1SPQA 3RO6A 1DEDA 1BF6A 1GQKA 3DFSA 3IANA 3OODA 4C6MA 4WLCA 2ON3A 1K7XA 1KM5A 4UZUA 4H8HA 4LB3A 3RRXA 4FNTA 1R3SA 2C14A 3NRZB 1E6SM 3QR3A 2A3EA 2EJ1A 1TJRA 2AL1A 3VC6A 3ARVA 2FGZA 1JCMP 2J8GA 3M0YA 2I1OA 4OHQA 5KZDA 4R7JA 2CKSA 4DO4A 1LG1A 4H9XA 3A4WA 3NVWB 2E7FA 1NP0A 4AFYA 2H9AA 1QNSA 4GJIA 1NIUA 4N9EA 3CV1A 1I1WA 3VIKA 3DKLA 4F8XA 3M5ZA 7XIMA 2HZGA 1RSCA 2YL5A 4DF2A 3BLEA 5IFPA 2EAWA 4NHVA 3GXFA 2FLIA 4LUIA 3K1DA 5FOOA 1XLHA 4EQRA 1H1YA 5TBOA 3MI2A 2EXOA 4GNVA 2J6VA 3NNTA 4US5D 1ZGDA 4LC6A 4F2TA 2W3ZA 1G5AA 3W7MA 3WENA 4AXKA 5CAHA 3C2YA 1LOQA 3DBPA 4ZOAA 5D2TA 3MSRA 3VD4A 2OLSA 3MO7A 5HR6A 3NZ1A 2OQHA 3FA3A 4LUTA 5A6MA 4FPSA 2XINA 1ZMDA 1JD7A 1TV3A 2XIMA 3N11A 3NSXA 3MJYA 3M9YA 4MG4A 4C6QA 3S4TA 4ZQPA 5T8GA 3CGDA 3EWCA 3VNDA 3VZZA 3ZLHA 3R8RA 1LL6A 2FVMA 8XIAA 3O1NA 1FA2A 3CHDA 1FDJA 4CNTA 4HK7A 3VCRA 4UOZA 3M7SA 2VX7A 4QNEA 1YKWA 3ARXA 1FXQA 3TX9A 1JAKA 4F2UA 2Q8LA 2QR6A 1QHPA 1EBHA 3NQ7A 1KQZA 4ZA0A 4H4TA 1AL8A 4QP0A 1YTKA 3KBNA 5EYWA 1HL2A 3LV5A 4OBTA 3LXDA 2DJLA 2Z28A 4H83A 1I1XA 3KCOA 2FZDA 3H7RA 3ARPA 5BXRA 5C8BB 1S7MA 3VFLA 4ACZA 3MTWA 3FG2P 2DQXA 1SFJA 4GBDA 2Q01A 3B0PA 4UTWA 3E49A 1OG0A 2JGQA 1Q1WA 1S2AA 2Y8KA 5HQEA 1XPGA 2AGKA 1FWAC 3M5XA 2B0MA 3O06A 3MUCA 1YIXA 4LY8A 5EB8A 3WJSA 4DWSC 2DGAA 3VOJA 3EOUA 4OOUA 1FUYA 3UXDA 5U1OA 3SFKA 2QCGA 5K3VA 4W87A 4L1XA 4KEUA 2J13A 2ZBTA 3IPWA 1NWUA 2CDUA 3PBUA 4X3ZA 1X1NA 3W1QA 4L4OA 5LGZA 1JPIA 3W2JA 1LWHA 1OHLA 3T7VA 4YTRA 4Y2WA 2GGIA 1QT1A 2X30A 2FZ9A 4UQBA 2GOUA 4HPJA 2PC8A 3O0KA 2CHRA 4LA1A 1UUQA 1WDPA 2FH6A 3HW2A 1PKNA 3VK5A 2VI0A 4MKNA 2Z29A 1TPEA 3KDOA 3ALGA 3S5ZA 5KTLA 1WPCA 3WUBA 2VFFA 4NRSA 2AOSA 2W4XA 3HM7A 2WSKA 1EL3A 5EGRA 5EKYA 2EG7A 4NEWA 1HJWA 3BLPX 3MP3A 1PCWA 2CETA 4K2SA 4FAMA 3NQCA 3EX2A 1MZRA 1J4EA 4OJYA 4AD0A 3U57A 1ZENA 4XVEA 2SFPA 2DSZA 1J96A 1W3HA 1N7KA 4S38A 1IEVA 1IWAA 2IPFA 1FHUA 2W27A 3JZUA 3IS4A 3UWZA 2R8WA 3ITGA 1FWHC 5D04C 3KM8A 4C6BA 3T2QA 5ABHA 1ZKQA 1A5KC 4CD6A 4TX8A 2BXYA 4IOTA 4PODA 2IMRA 4H8VA 4DI8A 3M47A 2BMBA 4JFWA 4XZLX 1L2UA 1XS2A 3L4YA 4K3ZA 1OX6A 4EP8C 1E72M 4EF9A 4EMWA 3A24A 4HN8A 3GHSA 3DN5A 1AD1A 3WK0A 3GXDA 1MI3A 1H41A 2WOWA 4CU7A 4APNA 2X1RA 1HXJA 2GDUA 2YCJA 4JFTA 1TWSA 3S5YA 1VFMA 1NFPA 3CYVA 1A5NC 5EMMA 3T07A 3RLHA 2P3ZA 1IQ8A 2OODA 4M6PA 2E4TA 2ABAA 2PDQA 3S2LA 3S6OA 3SM0A 3LPFA 3RLVA 1ZU8A 4B4FA 1NWSA 3JW7A 3ES7A 1PPIA 3KLLA 2Y7FA 5T26A 1SZGA 3KHDA 2FVKA 3EBVA 3R8GA 1FFUC 1SJAA 3XIMA 2UY3A 5HINA 4YTUA 3OU8A 5HQMA 2GZXA 3QFAA 2V68A 1GPWA 3ONCA 2YDAA 4HP5A 1GRTA 4FXFA 2W61A 1JROA 1MVYA 2J9YA 1TZ9A 2GVGA 3RHGA 1BVNP 1TTJA 1XH2A 2J62A 3KBWA 1EEXA 4M19A 1E70M 1XP3A 2PS2A 1Q6RA 4H1ZA 1EIBA 2PGRA 2DT3A 5G4HC 2JBMA 3T08A 1OWQA 4D6HA 3OTRA 3AXHA 1JCLA 4HCLA 1R87A 3UR8A 4QGCA 1DWFM 1R6WA 2IW0A 1M65A 3WQWA 1G01A 1E9ZB 3TFCA 3S5NA 3FYPA 4ZBCA 2XFRA 3PAOA 1UD5A 1DXLA 2PEVA 4NILA 2QPXA 4A35A 2WKLA 1V6XA 3II4A 3DXIA 5ABFB 4XQ6A 3T55A 1CXEA 3ZVHA 3UJEA 1B3OA 1JCYA 5KVIA 1BRLA 5CPSA 3EOEA 4Z1YA 1G94A 3TC3A 4B90A 2XN0A 1YXYA 3EMCA 2VDGA 3RNDA 1EA0A 5A6JA 3WSUA 1E1EA 1Q6OA 1GOWA 1GRFA 2VZVA 4GVIA 1D8WA 3NURA 4UQ9A 1Q1RA 1XIBA 1UA3A 5ECUA 4Z2IA 3GRIA 4G1KA 1W1YA 1KKOA 1QAPA 3FVDA 4FIRA 3AS3A 3HQOA 3K2GA 4H3DA 4PA8A 4DXXA 1IR2A 3W25A 3KVKA 2NPXA 2A3HA 4AWEA 1UQZA 4DZHA 3LXBA 2DZXA 2OX1A 3MP5A 5DT5A 3U4AA 1A5CA 3I10A 4ZE5A 2D1ZA 1UR0A 2Q8XA 4O4VA 4KKXA 1VBHA 3RX4A 3THCA 3W3OA 1XBXA 2IS7A 1PE1A 1E56A 4A2SA 2O9PA 2D24A 4DJDA 3HN3A 4CU6A 2EQ9A 1DJYA 1E5NA 1C91A 4GNKB 4Z1AA 3E9AA 3GKFA 1SR0A 4F9DA 1MMFA 2V2DA 2B7OA 4FNRA 1O6IA 1M7OA 2WJEA 3N1AA 4IISA 3CUIA 3LGGA 2ZUWA 4QS5A 4WVXA 2G8ZA 2OX4A 1VFTA 2OG9A 3PZTA 5FS7A 4X9YA 2PBGA 4G6CA 2GSJA 2Y62A 3NXFA 4H6QA 1TPB1 1DJNA 3CPUA 3CUGA 1J0YA 4WJXA 1WZAA 3WBAA 2E6DA 4YCOA 4NZJA 3K13A 1QDSA 1XCXA 2Z2BA 1L6FA 3BE7A 3CAQA 4O15A 4DJFD 3KLJA 1QPNA 3CZJA 2DZUA 8CGTA 1ZK7A 5K2ZA 3S47A 1CX9A 3DIPA 5AHNA 4V2XA 1A47A 2VOMA 1UR3M 3WQFA 3USZA 2FB2A 2X1SA 2A6LA 1VFHA 4J1OA 2C7FA 1XFCA 4GZJA 4LF2A 2JF7A 5KINA 5F2GA 1LOSA 4AU0A 3O7UA 1RA0A 2CZDA 2YA1A 1H3GA 1BQCA 4D6EA 5HWMA 1OFPA 3GDTA 2O0TA 4PTXA 2MUCA 3L0KA 2GGHA 1A49A 1UUOA 2ZIDA 2C3ZA 3S1GA 4GIYA 1QI2A 2IPGA 4CQBA 3QKEA 5C0QA 4POCA 5AYXA 2PDCA 2YL9A 3W7HA 2YOCA 3PF3A 4DAIA 1MZHA 4YHEA 4BFAA 4E8DA 4M29A 2CEQA 2V0TA 3VUSA 4ZTYA 3DERA 2J7GA 3TZFA 4MHBA 1EHAA 1HX0A 2R1KA 2HWGA 3WDHA 4UFLA 3MW7A 4H04A 1FH9A 3MMUA 4EACA 4RW5A 3R79A 3VMNA 1CCWB 5CSUA 1SSDA 3E2RA 3TR9A 5CH9A 1Y65A 1IV8A 3E2VA 3BAXA 1Q6GA 2ZC1A 1XV8A 3W29A 4HCHA 4O0ZA 5I02A 1AQ0A 3SCRA 5CPMA 2DSWA 2VEPA 1XSJA 4AD1A 3B8TA 3NXLA 5E0FA 3VIPA 1I2NA 3QMTA 2CXGA 3DK9A 4ZXLA 5EMJA 3K8MA 6XIMA 4XX6A 2IPJA 4GR1A 3VKCA 5FAJA 4PCNA 3G6LA 5FA5A 5EFDA 3F2BA 3TSDA 5D09A 4MWAB 4PEEA 4UB9A 1RH9A 2KX9A 3QHNA 3NVYB 1TTPA 4IXXA 1XGDA 1WA3A 1RM6B 3GH4A 2PTZA 4Z2HA 1J93A 5H8UA 3ZMRA 4XZWA 1F07A 3QRHA 3VINA 3WQ6A 1UG6A 2FIQA 3QY8A 4PMVA 3RITA 3MUY1 1Q85A 1SZFA 5SWUA 5JXQA 3KRSA 2YFNA 3WJXA 4BJHA 2HEJA 3WQEA 1VENA 4I6KA 3W84A 4CLMA 3ZLGA 5A6TC 4NASA 2WPBA 4E0CA 2C0HA 3GNNA 1NQKA 1EXPA 1UIOA 1U83A 1CLXA 1S46A 2BVTA 5AFDA 2ZRXA 3BSGA 3CZ8A 3TYAA 4BR1A 5K9DA 2PWUA 4NYYA 3NYDA 1O5XA 5HATA 3BLKA 3DH7A 2E8ZA 1BGAA 1XC6A 3A4JA 2F5ZA 1PX8A 1YNQA 3GTFA 4DO7A 1VKFA 3T81A 3PNUA 1VS1A 3P74A 4RE0A 5B80A 1F05A 5KZ6A 3C0QA 2NQ5A 2V38A 6CGTA 3SCSA 3O05A 3ZQ9A 4GZ7A 1YE6A 4Z2LA 5ENLA 6REQB 5F4SA 5GVJA 3K4AA 4QAWA 3QZ6A 1O4UA 3GG0A 4XSLA 3P3BA 1I4NA 5FJPA 2PDWA 1TX2A 4ASTA 5KZEA 4ZQNA 3W1MA 1XBZA 3B9AA 3W7JA 3ICJA 3GR4A 1JCNA 5FACA 3DJGX 3CQKA 4B3KA 3QC0A 3WD0A 3MUZ1 2FVLA 1Q6EA 3CWOX 1VLWA 3GC4A 2A21A 2QZRA 3GD6A 3NQ2A 4NF7A 4HZ6A 4KCWA 2P0OA 4MUZA 4LXFA 3OGSA 1EOMA 1R5YA 1H1NA 1XUUA 2I56A 3W22A 1EH9A 2JIWA 3B9DA 3KL5A 1M68A 3CUHA 2GSEA 3PSVA 1PIFA 3WH6A 1PKYA 5CJMA 3NEVA 1R2TA 3H2OA 2BXVA 4QNWA 4PB3A 1K8XA 3OA3A 4UCFA 2ZZCA 2PAJA 5CG7A 4Q7BA 2XVPA 3QLDA 3O0FA 2YDQA 3ITLA 5AECA 5D30A 4N6EA 3G1FA 4UTWC 2ZUTA 5D9PA 2Y8VA 3S46A 1F3WA 5HMSA 4XD3A 1E1CB 3MYPA 3DGHA 2I14A 2NSXA 4CQAA 3GVQA 2OQLA 1TMQA 2GDQA 2RJGA 2PDUA 2YVFA 3AYSA 4KWUA 1OIMA 4UTIA 1JDFA 1LLOA 3H2AA 5HXMA 5A6BD 1LORA 2C15A 2RUSA 1FDZA 3NQMA 4GYFA 4QDMA 2NXIA 3QYSA 4XTIA 3EKGA 2YVGA 2V5KA 1DIEA 1WDQA 3WH5A 3NDZA 1POJA 1W17A 5K4XA 3OIXA 3P5YA 3HG2A 1I2OA 3BARA 4C5ZA 1E6PA 5E93A 3A4XA 1WXYA 3DGRA 5A8GA 3QFBA 2G50A 3CQ0A 4IP5A 4EKJA 2J88A 3RXZA 1OF6A 2QV4A 3EDJA 1TMHA 1KXVA 1P5BA 3BVJA 2QCDB 2JKPA 1EBGA 1Q7QA 2CLOA 3O3RA 4M5PA 2VNCA 2R82A 2WSPA 1KO0A 3W27A 3P0WA 3OG2A 1UROA 3O2LA 1KXQA 2PTDA 3S2MA 3CO8A 4X2RA 4EAMA 1U30A 5DT7A 1YTEA 3PBGA 3WYZA 3D47A 3FJ6A 4UOQA 1G7VA 2GPTA 4RDWA 2ODOA 4QROA 1K9DA 5JRBA 4GACA 4W5UA 3SN0A 1DJHA 3WDJA 2VELA 1SUXA 4D6FA 1BSIA 2B81A 1RAKA 3N2BA 3OO2A 4PE8A 1LT7A 3M0ZA 4ENLA 3WKZA 3GD3A 1MFUA 2RJHA 4PTWA 4ICCX 3TOYA 1XLDA 3CEUA 2W0UA 1LQAA 1NTHA 1DWIM 3STCA 1K3UA 4YWIA 3WQDA 3G1SA 1HKJA 4ZQMA 2B7QA 3PY2A 4YJ5A 3UWQA 4O1CA 1M7JA 2VM8A 1OCBA 3TSBA 2F9RA 3ARYA 2PODA 3L12A 5BRBA 4LYRA 4ZL1A 2P0IA 5BMWA 1GJUA 3DC8A 3T42A 1T7LA 3GK0A 4KETA 4OVXA 4TUFA 2WK2A 2VFHA 4E4UA 3GH5A 3KTSA 4X60A 1F76A 3QQ1A 3VKDA 4G7EB 3B97A 5M03A 1OD0A 4TOQA 1V0NA 1XLIA 1ME7A 4MWAD 4HPXA 3B8IA 5A6LA 1W2VA 3MY9A 4W7WA 4S3GA 4HTBA 1H63A 3G2GA 2W67A 1FFVC 4MNMA 4K7ZA 3FCPA 2DVTA 3D5HA 5FL1A 3AN1A 2I16A 1R3TA 2V30A 3QR1A 4IIGA 1RD6A 2W62A 1AW5A 3T40A 2PWGA 4GIAA 2PDMA 4CVUA 2JE8A 2HCVA 3BMXA 4HSNA 3UZXA 2GVJA 4JTGA 4MJ2A 3AYTA 3GG8A 3MKVA 3SRFA 1QO2A 3TJLA 3CL8A 4PBGA 4KF1A 4KH2A 2YYUA 4O52A 1EJSC 1CEOA 1ISYA 3ARZA 3UNDA 4JKKA 3PZVA 2D2HA 5FF4A 1AW2A 2D2OA 4P8VA 2QVHA 4DY1A 2XSXA 1R3RA 1YQ2A 2PRHA 3A22A 3BGJA 4ZB0A 5KETA 4P61A 1IR1A 1MDLA 4PN2A 1ICQA 1UWIA 3GIPA 4G9PA 3SSJA 1RUSA 3DHDA 3EXTA 1EP1A 4HPGA 4IMDA 2YFOA 4I7VA 4WOZA 3TCEA 1TR1A 1LM1A 1O12A 2AL2B 1FHVA 4B5UA 3LRLA 2PDHA 3LHYA 2HDJA 1US0A 2WZIA 3GDBA 5CBIA 4GLEA 1RHCA 4NJIA 1KBJA 2PF8A 4H2CA 2YL8A 4PC8A 2H3DA 3SRKA 4O53A 1JDAA 1SW0A 5L9FA 4XIMA 3TTQA 5A8NA 3G1AA 1H11A 4Y9PA 3JUGA 1XD0A 2XG9A 4NL1A 3M6YA 4KRZA 4JCLA 1EEPA 2GJNA 4RX0A 4U28A 1LCOA 2Y4SA 4HYVA 3G5EA 4YVPA 3BICA 2VEIA 3MV01 1CIUA 1R8LA 1M6JA 2ALRA 3BMWA 1GHSA 3FFSA 4DI9A 8A3HA 3N14A 5GJNA 3ZT6A 3GVGA 3TCSA 1LL7A 4L9XA 1AQFA 3NO1A 3E12A 1U5VA 1O5KA 2DSKA 1FCQA 3UJ2A 4DJDC 3KTXA 2EQDA 1H4PA 2J9ZA 2YGYA 3FJLA 4R7WA 5FF7A 3UY7A 1GYMA 1XSIA 1GRAA 4H9VA 2HPMA 1RLCL 3R12A 1KFJA 2E9MA 3OG3A 1S39A 2X1IA 1NAL1 2WKGA 2Z1XA 1JG9A 1V02E 4JNMA 1GUVA 3KOWA 1S2VA 3PBVA 3SN1A 1RCXB 4W8BA 2WPEA 1E3XA 3DECA 3WEMA 1HJXA 2CLMA 3CHEA 2VT0A 3VDBA 3UT0A 1VCVA 5H6HA 1Y8BA 1XYCA 1RCOB 1KWKA 1ZDLA 1XINA 2HSAA 1A4MA 5E6YA 4US5A 4JOMA 1NP2A 4LAOA 2V5CA 2Z6IA 1XLEA 3NL5A 2AQWA 4AZCA 1JFXA 1P7TA 1HGWA 1FWFC 4QISA 5AVNA 4DM2A 4NJHA 3B8DA 5JIWA 3RILA 2OQYA 1Q4WA 4JFSA 3TYDA 1W54A 5FMHA 4D6IA 3VYLA 5FJUA 4HU0A 2WW5A 4GK8A 5CPQA 4O0QA 3TEVA 2C13A 2TSYA 4M6VA 2E40A 1UWRA 3IJQA 3KUMA 1AW1A 2ISSA 2HS6A 1WO2A 3AQUA 1X7FA 2X8GA 1WZKA 2C71A 4QE4A 3W7EA 1YYAA 3QXBA 4V33A 1Q3NA 2V6OA 3IACA 1NHRA 3CHCA 1KBLA 3GO2A 3M5VA 4IP7A 5C2XA 1G7UA 2C79A 5JH1A 4JY9A 4QX4A 2VX4A 4H4ZA 4AZBA 5JVLA 3Q2DA 2J8TA 3NTYA 1DL3A 4OQVA 4U10A 1OVDA 1DIDA 3N9SA 1YBQB 3MQTA 4F0RA 4NJKA 5HJLA 4JIPA 3CV2A 2BOEX 4C65A 2VZOA 4W85A 2W3RA 3M43A 5F2LA 1NWRA 1ZHAA 3L5AA 2EBNA 3BGAA 4MWAE 1TR9A 3GTXA 1TELA 5I5RA 4N0RA 3KWXA 1QPOA 1HL8A 5AHFA 2CXEA 4C6FA 1ZBVA 4N6FA 2V3FA 3FGCB 1UH3A 3JR2A 2Y85A 2VC5A 2ZTKA 4HK6A 3LCGA 1XIIA 4GQQA 4L6DA 4P7QA 3CL7A 4BF9A 1BG4A 3WLQA 3U2OA 1TPFA 2F6XA 4S3CA 2ACSA 3SGUA 4KT2A 1FWBC 4PMJA 4IUOA 1E15A 3SQLA 4LCSA 4KGJA 3LI1A 1KBKA 4TU1A 3N73A 1KFBA 1F74A 1SO6A 4S2CA 3CO4A 1CPUA 3KBVA 3W1RA 4IFKA 3PZNA 4HMCA 5LHEA 3H53A 2HS8A 3MKKA 1IXPA 1J11A 3GHTA 3HFYA 3OBEA 4AHQA 3MCMA 4H4XA 2ABBA 4F79A 2PDXA 3AMKA 2GQ9A 3AZSA 3BZGA 3ZM8A 5AC8A 3HOJA 4HB7A 4S3KA 4J3TA 3E5PA 1WKEA 1W5OA 3LTPA 4AB4A 3IWPA 5DEZA 4AYGA 3LCWA 2L5HA 2X7VA 1OJTA 1HJVA 2IXVA 3DI0A 1L8NA 1FP8A 3LBMA 5E5CA 1GZ1A 1W1IE 2WHMA 3VOCA 4QIUA 1E4LA 1M9HA 1LDCA 2TYSA 4LS2A 5CZTA 4O1BA 3ZSSA 3AU6A 1E6NA 5DMLA 2ZTJA 2XSAA 2IXUA 4I6VA 4K36A 1WZMA 2BC0A 3VGFA 1QOQA 4EXAA 3KCJA 2P76A 2C91A 1R85A 3GS6A 3WQ5A 1OYBA 1VC4A 4H4VA 3WDRA 2ZUSA 3GW3A 1UC5A 4JX5A 1OY0A 4CQ8A 2PURA 4Q7IA 4C6NA 1DXFA 1TFVA 1S5MA 1W9BM 3L4WA 3NZGA 1JXJA 1GKRA 2E5CA 3VE9A 4AC7C 1SZNA 1DORA 1A3WA 1EGMA 3SGGA 3RU6A 1PAMA 4EQWA 1UH4A 4TVWA 1TVLA 3R4IA 2I57A 3BV4A 4AD4A 5M17A 4HN4A 3CHVA 3KRUA 4FZIA 2BB0A 3M46A 2V82A 4HYRA 3LM3A 3M16A 3T2PA 1KCKA 1KM0A 1V3KA 5A6AA 1ZRQA 4ACYA 4HNUA 4IICA 4WX2A 5DMNA 3KVMA 1KBIA 5TQLA 1KRAC 3EXRA 4JTRA 3VVGA 3RYSA 3N29A 1JR1A 4DXKA 1XKJA 3NG3A 2XGBA 4ZEPA 2QV5A 1UBSA 4ERAA 3LG3A 4QAIA 3RFAA 2FZMA 3LM7A 4HHLA 4JEQA 5ABGA 1GOMA 1VBJA 3VZXA 3W7GA 4CEXC 2CFYA 3T05A 3AIWA 3G0UA 2ZZ0A 3DK4A 1W37A 1XPYA 4FR1A 3NQGA 5HDRA 1XQKA 4H4SA 2DZVA 2BGNE 2OSYA 1S3HA 3WMLA 1ZCOA 4K37A 1XM3A 4KEVA 1R30A 1A80A 3T1GA 1K7EA 1SM9A 3POHA 3P60A 2C6QA 2XZ7A 2DVUA 1KM1A 5TF0A 1PZ3A 1OJXA 3L0GA 3UCCA 4OECA 3L5OA 1OINA 2RHGA 1ODZA 3SCTA 4PUKA 1CXIA 3FIGA 4JKMA 2J7DA 1GREA 2DFAA 1KFKA 3KL0A 2PTXA 4QHRA 3GB6A 3VIGA 1FCUA 2Y7GA 1AZ2A 4IM4A 1L8PA 3PHAA 1QWGA 4LYQA 4JTIA 1EYWA 1CGTA 1PSCA 2PDGA 4IP4A 4ORMA 4IL0A 4JTCA 4PCSA 4ZO6A 4O19A 2J27A 3UZZA 2WNNA 1CXLA 3W01A 3RGTA 1W9VA 2FZ8A 4A8NA 1ZTVA 4FS9A 1YPFA 2WV8A 3S83A 4R27A 3RMJA 3D3AA 4PGLA 3TIMA 4WY0B 2VEFA 1EO7A 2QULA 3QEZA 3CB8A 2KAUC 3II1A 1V3IA 4LEQA 1KBBA 4JTAA 1NHQA 2GVLA 5A2CA 2VWTA 5E9AA 5DMMA 5LIWX 3D46A 4D9PA 4D1IA 1CXKA 3UG4A 3G77A 2QIIA 5LGXA 2OTDA 3MS8A 1ZNNA 3EPMA 1S1RA 1OC7A 1CECA 3MSGA 3SB0A 4DBEA 3GHRA 1KRMA 3C2EA 4V28A 4XZ9A 4O17A 5C55A 4XKYB 3EWZA 3URHA 1TCMA 1ZL1A 4KIRA 4HMEA 1EUNA 2X1TA 3DG6A 4KRUA 3IJ7A 4HTYA 1IEWA 2YLAA 2VCCA 3VIOA 3N13A 4CEUC 2WP5A 3Q58A 3KBMA 2HXTA 5K9CA 1Y7VA 2PLJA 1QPQA 3T9PA 5HAOA 3ITXA 5A8QA 1PZ2A 5EMUA 1V79A 1HFBA 4W7VA 4JQ3A 4J56A 3H2CA 3BLDA 3AC0A 5J8LA 1P0EA 4RV3A 3QPEA 3TV8A 4JTHA 1NOFA 4GJJA 4ML9A 1FEBA 3CAVA 2EG8A 4RK8A 4DJFA 3TYBA 2YB1A 3CIXA 3W85A 1W91A 3NWRA 1EBDA 5JCMA 2WM1A 3WN6A 4EM3A 3IAQA 3U6WA 1KTCA 1GEUA 2HXUA 4GCXA 2WC7A 1KR1A 3GYCA 4GABA 5IRPA 1XIGA 4JAWA 4WGXA 1LBLA 3WNOA 5GJPA 3MVIA 4YYCA 2ISWA 2C1IA 3HFTA 1YLVA 2BODX 4FALA 3L66A 3UXLA 5JIPA 3DG7A 3HMJG 5CPNA 1NWTA 4YYFA 3W7QA 1C3FA 3BAWA 3OW1A 4LOCA 4U5IA 4NI3A 2QF7A 1EP2A 5KZMA 1QTWA 1SMAA 4Z2JA 2GWNA 1W8SA 4ROPA 3NQ6A 4IG2A 1G1YA 1XBYA 2HVNA 4WUIA 1OSEA 2ZXBA 3AMZA 3AXKA 3TA9A 5XIAA 2HISA 5FL0A 4FNUA 5G1YA 4GYKA 4FP1A 2VEGA 1A4LA 4DJED 5F4XA 1JYVA 1UBPC 3QSTA 3WNMA 3A12A 2J3NA 2FYMA 1XLFA 6A3HA 1GVOA 1JEHA 1GVSA 3KOXA 5CJNA 3RRAA 2O7SA 4MAVA 4K8GA 2KZHA 2A7NA 2J25A 3H2MA 3EWUA 3FJ4A 5GNYA 2J7FA 3ZJ6A 3K8KA 4PRRA 1GJWA 4RPPA 4KESA 4FB7A 5EMLA 3OZOA 1TRIA 3CIWA 1I8JA 2PCQA 1Z8AA 1JNEA 1L6GA 4MSSA 1PJ9A 3QF0A 1KW1A 4S1FA 3TTEA 3U4FA 1JVNA 2VFEA 2ZUNA 4X9SA 3TDFA 3AO0A 4H9MA 1E1FA 2BVDA 1O95A 1DBTA 3BURA 4GY1A 1PV8A 3A47A 1PKMA 5E1QA 4JN7A 1F6PA 4MB5A 4RL3A 4DLFA 3VIMA 1O68A 2DZAA 3FSUA 2QMKA 2QYGA 4WSJA 1B1YA 4HA3A 1EZ2A 4TV5A 2G3MA 4TX9A 3VD9A 2HNHA 2DDXA 1WNOA 2V2CA 3NVVB 4XZBA 2E9LA 3WQ8A 3MT1A 1TKKA 1KRCC 1A5SA 3G8EA 1TV8A 4BY3A 4AD2A 1X39A 4HGXA 4D6CA 3SUWA 3CLWA 3HJEA 5EPDA 3I7SA 3U2EA 1E6RA 5IM51 4RUBA 1VCGA 3L23A 1CDGA 2YDSA 1TQXA 1JZ6A 1E4MM 4JICA 2R1LA 3T0CA 4LS1A 4ZO8A 1BFNA 2WM0A 3S8HA 3N4FA 5E9XA 1KWGA 4FNPA 2Z1BA 4M24A 1PVNA 1EUAA 1GVQA 1KXHA 5ABFA 3A5FA 3HA1A 3VMOA 4GYJA 5KEZA 1XYMA 4Y9NA 3P61A 1YE4A 1LTDA 2ZUMA 4Y9AA 4D2JA 4J7RA 4HA4A 5FD0A 3S1WA 4JX6A 1PIGA 1IYXA 4UFHA 4GYPA 5FIPA 2E8YA 3ABSA 3E74A 4AQLA 4MNKA 3DCPA 3N3TA 4NT0A 2I5IA 4A3RA 3BJFA 3I3EA 3OIHA 4L4LA 2W91A 4R88A 1GEQA 5U25A 4PUEA 3URNA 3EPNA 4C5YA 1IIHA 1CGXA 4LVFA 1THFD 2BASA 4JN8A 2R6OA 1ZP4A 3IJ8A 3ANUA 3BCJA 1AQHA 1TV7A 4OTKA 2V6AA 2Z7GA 3R13A 2CYGA 1H61A 5C9RA 2VHLA 3CV6A 1A5OC 4IQJA 4AYSA 4XBKA 2WAGA 3RAOA 3H21A 1MW2A 2E68A 2I5QA 4J4KA 1TCDA 4AHOA 1GSNA 4NZ3A 1E43A 4F4RA 3QHMA 1DJZA 1GESA 2VX6A 4E5TA 1JJKA 3TYCA 1KXTA 1MUWA 1RXOB 2WKJA 3U7VA 1X8FA 3GYEA 3ERPA 5C9ZA 3QGVA 3ZFHA 4Y9MA 4INFA 1D3GA 4J2MA 1F7BA 2PP1A 1VBRA 1BTMA 5G5IA 1PDZA 3LENA 1C90A 1GOXA 1XD1A 4QDPA 2X8HA 1OFOA 3QQWA 3W0KA 1UD8A 1Q13A 1X96A 3KLKA 1C7SA 3TWAA 4NNCA 1FWNA 3W74A 2AQOA 1ZAIA 3A7AA 3QN3A 2VGGA 3VGGA 3OLGA 3ENLA 1HKIA 3AZRA 5EBKA 3ARTA 1LG2A 1CXHA 1KLYA 4F66A 1WCGA 3AROA 3HB9A 3VNJA 1SMDA 1U1HA 2PLMA 3VCCA 1V02A 3LZ5A 4HJWA 2BP1A 1K4QA 4TVDA 4MM1A 4MB4A 4PRTA 4GHRA 3M0HA 3O6DA 3F1QA 5XINA 4WXZA 3R5EA 4DRSA 1ADOA 3P2VA 3W75A 5CQ1A 4MUPA 1WUEA 2PDNA 5JUVA 2BVWA 5JCNA 5CZSA 1GRBA 3W86A 2PDKA 3CUFA 2Z27A 3NPXA 1CB2A 1IGWA 4Y6GA 3G0XA 4XO6A 3HGSA 1T99A 3BOLA 4N9CA 3FDGA 1KM3A 5HR7A 3PPGA 4JDRA 3AXIA 1OFRA 2D73A 1HJUA 3MMDA 1L9WA 1ONEA 1TYGA 3C0SA 2VD9A 4JTUA 2UY5A 3LYEA 5TAOA 3UGVA 4NVTA 1VYPX 4Z0JA 4TO8A 3KS6A 3MUIA 3M6DA 2DY3A 2HQMA 4DQWA 5HMFA 1CENA 1G67A 1EFZA 4CNSA 2NW0A 3UWEA 2ZRZA 7A3HA 4LY4A 3DHFA 4C6PA 2BTMA 1CLKA 4UNIA 4HNVA 1E9YB 3G1RA 2WOVA 5EMYA 4OKDA 1CI1A 1Z42A 2GUBA 2J6XA 4ML4A 4DWSD 4OIFA 2DT2A 3YPIA 3ETRB 5E09A 3C86A 2ZQ0A 3OGVA 2E67A 3BDKA 2Z4GA 1H7RA 4P8XA 5AY7A 1JRPA 4H9TA 1TJ2A 5MKGB 4HNNA 2OLAA 1IE7C 3VA8A 2HRWA 3NDOA 5DF0A 3VAVA 1TUXA 4C1NB 2X8RA 4MZYA 4AY8A 1ISWA 2PP3A 1S5WA 4JR5A 2W63A 2RKXA 4LVAA 3W71A 1GVYA 5AB3A 4OFCA 4NAEB 3LMYA 3EEZA 3M4HA 1B57A 1QK2A 4LS0A 4A22A 2NZLA 4PYSA 4GY0A 1KC7A 2PB1A 1EC9A 2YPIA 1EJRC 4HZ7A 1OYAA 2WLZA 4WGHA 2NT1A 1Z69A 2JK6A 1EDTA 1WB0A 3NQDA 2VVNA 3S9YA 2ZA1A 3UXAA 4MOZA 1N63C 2QS8A 3BAIA 2GR1A 5DLCA 3NSMA 4UR8A 2X09A 1UP3A 2TPSA 3QV6A 4FDCB 1W1B1 1ZJHA 3DC0A 4AZIA 2YYTA 2ZDSA 1XXXA 1FWCC 4RPQA 3VIFA 3AJ7A 4QRNA 1QI3A 4YWSA 3KHJA 4GI6A 3G24A 2EPOA 2DH3A 3P80A 2UZ9A 3EOLA 3L4XA 4I90A 2XWDA 4MAZA 3B0VC 4EXBA 5DY3A 2JFEX 3ABRA 3SEPA 3WDQA 4YCPA 2E09A 4ZGYA 3NVZB 4NXKA 1H2IA 2QKFA 3VGDA 3LEPA 2BSLA 5I03A 4MMWA 4PL2A 2E3ZA 3NPVA 3UD6A 5HOSA 5A1AA 4NP7A 3ITOA 1LLWA 4KEMA 4L65A 5AOUA 1KCXA 3TXZA 5XIMA 3WQPA 1O94A 1H51A 4H7CA 5F4WA 3WIJA 4UTFA 5LYRA 5C2CA 5AYZA 1FFRA 2FHFA 1K6AA 3UP8A 4GRTA 3CQIA 4IGNA 2XVKA 2ZA2A 4H9ZA 2J8FA 1C92A 1MRQA 4Q8WA 5C5YA 2G4FA 1GVRA 4W89A 1K03A 3C4UA 3EGJA 3NVDA 4EWND 2DV0A 4GGBA 2UWFA 4WDXA 4MFEA 4MJMA 1T3QC 1SB3B 3AUOA 3ZYZA 1EHNA 3WFLA 3PFMA 1TV4A 5CZJA 2OT1A 1V08A 1L2QA 1VRXA 4CQDA 1XLGA 3DYMA 1US2A 1NSJA 2EKCA 3QHOA 4J3VA 3M0XA 1D7YA 4Y7EA 3SI9A 1VF8A 1DQUA 1WQ5A 2P8CA 4ZO9A 3NQFA 1AOGA 1V03A 3RU8X 3W7IA 3WEOA 2FQIA 3HJZA 3JZEA 1BXCA 4I9JA 1GCYA 4RLIA 4LAZA 3CPGA 1DNCA 1N8IA 1UHVA 1XQLA 1NARA 3HV9A 3TMQA 5E0KA 4KPLA 1IEQA 4W84A 4QLJA 2AAQA 2BG5A 3M0VA 4P7OA 2PE4A 3IJLA 2Z00A 3URBA 3N9RA 2OJPA 1B54A 2C16A 1A53A 5L6UA 2QIWA 4PTNA 1KN0A 1UZHA 4DAFA 4M80A 4XTDA 4DJFC 2CBJA 3EF6A 1NEYA 4QITA 2EG6A 2HE8A 3VKKA 1Q63A 3M0IA 3BXWA 4O1FA 1ONFA 2QCDA 3OVRA 2BHYA 2OPJA 4LNYA 1FH7A 3OZMA 3W38A 1PL9A 3AM9A 1JXKA 5I09A 5F7UA 2W3SA 4JKLA 3TAKA 3SO7A 5ECVA 1V0LA 2QXWA 4H4IA 3GWQA 3IIXA 2D3NA 4H7ZA 4QR6A 4O8RA 1I6NA 1Q6DA 1VFSA 2J78A 1JL8A 4PTMA 2G41A 4PRWA 3JS3A 4ZMGA 4IMCA 4DUWA 2Z1WA 2GK1B 1XG4A 4WRHA 4UNKA 3WO8A 4IFRA 3BO9A 4IF2A 4RZ4A 3CAWA 3C56A 1FIQB 3KFTA 3H12A 1RP8A 3T8QA 3TW9A 1VHNA 1ISVA 5G1TA 4ACZB 2DQWA 3THAA 3WD2A 5J5DA 5REQB 4K8EA 5T91A 1MFVA 3TTSA 2DW7A 4AY1A 5LHFA 1DJWA 3V1HA 2X2YA 5FJOA 1W3NA 1UR8A 3EWWA 3CQJA 4IIBA 1ICSA 1WKDA 2I5GA 4FF7A 3T2OA 1LJYA 3I6EA 1QK0A 2X42A 3PFRA 4I5UA 3UNTA 3VKBA 4G7EA 1RY0A 1OZMA 3B40A 3QFEA 3F4DA 2INFA 4CGTA 4OOZA 2GQWA 3H2EA 3TC7A 2VGFA 1W32A 1UIPA 2CWNA 1EJWC 4Y96A 4LRSA 1XH0A 4X0VA 7TAAA 5CGMA 2XN1A 2CFFA 3NO5A 1VR6A 2XGIA 3KTCA 3RO8A 5AN7A 2J7BA 2C8NA 3HO8A 1GKPA 3B8SA 3EMZA 2ESCA 3CASA 1WE5A 4FLSA 4IMGA 1H7OA 1PZ1A 2YJQA 2DORA 1PYFA 3HMCA 1DV7A 3LZ3A 3W7KA 4JTTA 3ISIX 1VGAA 1QOPA 3G0SA 2EPNA 5EU9A 2PSNA 2PTYA 4B9YA 1W9XA 3DFHA 2B7NA 1GQLA 2CLEA 2REQA 3UR2A 1NDAA 4EPEC 1O5QA 1FWSA 2BFGA 2E5DA 2P1FA 1VYRA 5BNKA 1QI5A 1JCJA 2CLPA 3IGSA 3UVIA 2DVXA 1SGJA 5IOBA 4M7TA 1EJXC 4GH3A 2CLFA 1ZB5A 1F4AA 3GBDA 4FO4A 2TMDA 1UCWA 4OE7A 1OBAA 3FNDA 2OYKA 3CGCA 3HQNA 2D69A 5BROA 1V6YA 1CTNA 3N19B 1T5AA 1V4YA 2NXGA 4HA1A 1QNOA 4AEFA 3AWNA 4WF7A 2PLKA 2AL2A 3MV11 3CBWA 1QR7A 2NQHA 1GTHA 4TVCA 3ATYA 3P93A 5BRQA 3NO3A 4AG0A 3W26A 4QCFA 3WNLA 1X1ZA 4GYPC 1ONWA 3MSDA 4N9DA 5HWNA 2RAGA 2ZDRA 4UUIA 3VZYA 2RABA 4NNAA 4CD4A 3VOFA 3DFPA 1Q45A 1Z48A 4R9XA 1MUCA 4EVZA 2J79A 4M82A 4TVUA 4MNJA 2A3LA 4B5WA 2Z2AA 4U5KA 4FI4A 5C7VA 1BWLA 2X8CA 1FECA 1BD0A 2D23A 2VFGA 4PMQA 5FEWA 1RJQA 1PIIA 5F1UA 1JF5A 2I17A 4QG8A 5FESA 1R7OA 2QJHA 4AZGA 4WKHA 1X38A 3SCUA 4TXEA 3GXNA 1W9UA 4Z17A 5BW6A 1E55A 1TO3A 7ENLA 5G2IA 1IZKA 3CUZA 5M3WA 4CCEA 4H9YA 5FJIA 4GOAA 4OGZA 3LADA 5CG0A 2FH8A 5FF0A 1QW7A 4CNUA 1OIFA 2HK1A 1RVGA 1VJIA 1JUEA 2NLIA 1OX5A 3MBFA 1H7XA 1BSLA 5E6ZA 4P7RA 3E0WA 5IXEA 4I7UA 3S1XA 1JPDX 2VR5A 3HF3A 3WG6A 1R2RA 1LZOA 3Q4DA 3FDKA 2DZBA 4U33A 1JPHA 2ISVA 2BHUA 1UC4A 2OO6A 3VFCA 2O9RA 2XVLA 1EDQA 3CM4A 4PUUA 2O9OA 1B5TA 4AIOA 3C2RA 3AWOA 2YCEA 1NFBA 1WX0A 4PMOA 4PMUA 1YX1A 1J2WA 3R94A 3ZVHB 4IJRA 1IEXA 5M1TA 2FJUB 3KRBA 2P3EA 1R47A 4D71A 5GJMA 3L4VA 1XLMA 3FJNA 4L5ZA 4ALDA 1LYXA 1G69A 4AZ6A 1P43A 4GI4A 4IQDA 3VPLA 3A3HA 8XIMA 3R11A 4HPNA 4XVDA 1FDYA 1RK5A 3NOEA 4CCDA 5D05A 4FOUA 2F61A 3CGTA 3PPHA 3RCNA 1ZXIC 1XLAA 3LUTA 4LGXA 3DGBA 4XBSA 4O57A 4R85A 1G4SA 3H55A 4NRRA 5C6MA 3A4AA 3PZOA 3ABXA 3V16A 1NU5A 6TIMA 1E6XM 2QVNA 1MQQA 2E6YA 2HJPA 1O60A 3W2NA 4GQGA 3AFBA 2NV1A 4DNAA 3H4WA 4CUCA 3IEBA 1YBQA 3ELFA 3VOHA 2UY4A 4IIHA 3P14A 2D2GA 3SRHA 1POKA 2ZRUA 3DOPA 3HG5A 1K77A 4F0LA 4B2DD 3O15A 3MU7A 5CC5A 1TRDA 2E9BA 3W7CA 4ATLA 2HMCA 5HULA 3EZ4A 1JQXA 4LEFA 3RJYA 1ECQA 4I5XA 2FHBA 3COTA 1V0MA 4HA0A 5BWAA 2RDUA 4P7NA 1VP5A