3U9IA

The crystal structure of mandelate racemase/muconate lactonizing enzyme from roseiflexus sp.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
366
structure length
346
Chain Sequence
TAPTTIRALTVAPLDIPLHEVARNLLVAVELTDGTRGYGEAAPFPAFNGETQDMAHAAILAARSLVEGADVREWRRIALALPALPGMTGSARCAIETAILDALTRRARLPLWAFFGGAATSLETDVTITVTAAARAAQAIVARGVTTIKIKIGTIRTMEHDLARIVAIRDVAPTARLILDGNCGYTAPDALRLLDMLGVHGIVPALFEQPVAKDDEEGLRRLTATRRVPVAADESVASATDAARLARNAAVDVLNIKLMKCGIVEALDIAAIARTAGLHLMIGGMVESLLAMTVSACFAAGQGGFRFVDLDTPLFLAENPFDGGMTYHGGTIDLTLIEAGHGVTPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Mandelate racemase/muconate lactonizing enzyme from Roseiflexus sp.
rcsb
source organism Roseiflexus sp. rs-1
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme, C-terminal d
total genus 109
structure length 346
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3u9iA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3u9iA01
2PU0A 4F4RA 2XH2A 3QTPA 4KPLA 4ENLA 3OPSA 3BJSA 5FJRA 3JVAA 2MNRA 1ONEA 5ENLA 4Z17A 4A3RA 3R1ZA 4HNCA 4IHCA 2O56A 2ZC8A 3TOYA 3SBFA 1RVKA 3TCSA 4HN8A 1SJDA 3FVDA 2QVHA 3ZVHA 4IZGA 4M0XA 1ELSA 1MDLA 4GGBA 2OZTA 3N4EA 1SJAA 4JN8A 2PSNA 4GYPA 3PK7A 2QGYA 2AKMA 5FJTA 2PP1A 3VCCA 3I4KA 3TTEA 2GSHA 2ZADA 1EC8A 3JW7A 1KD0A 1TKKA 3UJEA 2AL2A 3MKCA 1XPYA 5EU9A 3MWCA 3S47A 4M6UA 3IJIA 3VA8A 3FV9A 3MZNA 4DN1A 1F9CA 3ES8A 2P8CA 3P3BA 2NQLA 1W6TA 3UCCA 1OEPA 1SJCA 3S5SA 2HXUA 2XH7A 3SN4A 3H8AA 1MDRA 2PMQA 2OZ3A 4HCHA 1L8PA 3P93A 4IP4A 3UCDA 3CT2A 3DG6A 3RR1A 3OZMA 3DFHA 3FYYA 1WUFA 3VC6A 3U9IA 3DG7A 1P48A 3ZVIA 2OZ8A 4H1ZA 2P8BA 3H7VA 2XH0A 2I5QA 3QPEA 4FP1A 4G8TA 3MSYA 3ZLFA 4DWDA 4GIRA 2ONEA 2FYMA 2PPGA 1E9IA 3FCPA 1P43A 4HCLA 3DESA 4KWSA 4HCDA 2HNEA 3SN1A 5BOEA 2OFJA 2PODA 2QJNA 5FJOA 3MUCA 1R0MA 1KKRA 4A6GA 3DDMA 3GY1A 4E8GA 4YWSA 3ZVHB 4GFIA 2GDQA 1NU5A 3UJRA 4EWJA 2RDXA 1SJBA 1BQGA 3T9PA 1YEYA 2MUCA 4MMWA 3RCYA 5BOFA 2GL5A 2OQHA 2QDEA 3OP2A 4ZCWA 2PA6A 2PCEA 3DFYA 3STPA 1PDYA 3V3WA 3K1GA 3R0KA 3GC2A 2GGJA 2XGZA 2GGIA 1KCZA 5FJUA 4JN7A 3CK5A 3Q45A 4DHGA 2HZGA 3P0WA 3CYJA 1EBHA 3FXGA 4Z1YA 1MNSA 2OLAA 1JPDX 3Q4DA 3T4WA 3CB3A 1JDFA 3RGTA 3IJLA 4DX3A 2XH4A 3N6HA 2GGEA 3PWIA 3UGVA 4FI4A 1JCTA 2PTXA 3R11A 3ZLGA 1JPMA 4IL0A 3PWGA 3GO2A 3ZLHA 1EC7A 2OQYA 3RO6A 1TE6A 3N4FA 3V5FA 4ZA0A 2OPJA 3ES7A 2QDDA 1NELA 3I6TA 2P3ZA 3VFCA 3IK4A 4H83A 2CHRA 3TJIA 2AL1A 3RRAA 4KT2A 1EC9A 3R25A 4MGGA 4KEMA 3VC5A 3V4BA 3DG3A 3EKGA 4J3ZA 3SQSA 4DXKA 3FJ4A 2PP3A 3NFUA 3IJQA 3UXKA 4IL2A 2PTWA 3TWAA 3SSZA 2OX4A 3NXLA 3NO1A 4J1OA 1R6WA 4E4UA 4G7FA 3OTRA 3T8QA 4HPNA 3U4FA 3EEZA 4MKSA 1PDZA 4IP5A 2P88A 3TQPA 2QQ6A 3DIPA 3OW1A 4GGHA 3MY9A 4H19A 3BSMA 3R10A 3OZYA 3DEQA 5IDZA 5FJPA 3D46A 3VCNA 3RITA 3MQTA 2PTYA 4IT1A 2XSXA 4GISA 2GGHA 3CAWA 1MRAA 2PS2A 2POZA 2QJMA 2PGEA 2HXTA 3H12A 4ROPA 2PU1A 3H70A 3QN3A 4HYRA 2DW6A 4JHMA 3VDGA 3UJFA 2FKPA 2OO6A 4K8GA 4A35A 2PP0A 3I6EA 3TWBA 1IYXA 3UJ2A 4HNLA 4GMEA 4E6MA 1BKHA 3PFRA 1DTNA 2AL2B 3HPFA 3ENLA 2PTZA 3JZUA 4E5TA 7ENLA 2PGWA 3QKEA 4GYPC 3SJNA 2OKTA 2P0IA 2AKZA 1WUEA 3TW9A 1XS2A 3R0UA 6ENLA 4H2HA 3SN0A 3NZGA 2GGGA 3UJSA 1EBGA 1TZZA 3BOXA 3DGBA 5J04A 4DYEA 3V5CA 1FHUA 4K2SA 3UXLA 3N6JA 2DW7A 3B97A 3T6CA 3KUMA 1KKOA 4E4FA 1ECQA 2OVLA 2QJJA 3TJ4A 3D47A 3THUA 1MUCA 3GD6A 1FHVA 4K1WA 3QLDA 2OG9A 3DERA 4X2PA 3CXOA
chains in the Genus database with same CATH superfamily
1ZU8A 3C2EA 3AMGA 3L4UA 2E67A 2Q8ZA 3GD4A 5LHFA 3ID7A 1UCWA 2WOQA 4NUWA 4V27A 2YKKA 1VR6A 1ZJBA 1UP3A 2H9AB 3LI1A 3N34A 4I6KA 4O1DA 4W8AA 4I3GA 4W8LA 1ELSA 3VKKA 1JYNA 3VUPA 1S5NA 3EXTA 1J0ZA 4O8RA 4QNEA 2ESCA 2Y5EA 2W91A 3UZZA 4J3SA 5GNZA 1LOQA 3EA3A 4NU7A 3ITXA 4QITA 3TSMA 2DIKA 4B15A 3AIEA 2ZADA 1OINA 1VH7A 3TJXA 4KWUA 4PMUA 5I7GA 4W93A 3EDDA 4PBFA 4JHZA 5EMJA 1RQEA 1ONWA 3EXRA 1W9XA 4ACZB 1CCWB 1ITQA 1R46A 2RDWA 3HPZA 4RXGA 5CBIA 1NVMA 2D22A 1BAGA 4ZOEA 3THAA 3ES8A 3RRXA 1TV2A 3FKKA 1NHRA 4B2DD 4PMQA 4CVUA 1OEPA 4KEVA 1FHLA 2BDQA 1OF8A 1R3RA 5C9ZA 1DBTA 2E68A 1FWJC 4AWSA 3LADA 1H0GA 4CU6A 1OCNA 1XIBA 2R1MA 1IWAA 4P7NA 4OV4A 1UH4A 1ZJHA 3CAQA 4IPJA 3E0VA 3DOPA 4IGMA 3URHA 1FWCC 5LIWX 1AJZA 3M0LA 4MDPA 3QQWA 1H5VA 1MEWA 1J96A 2PDJA 3VX1A 2GR0A 3CEUA 4PMDA 4J35A 3MP3A 2GZXA 4I9MA 1GJPA 3WMBA 1I2RA 1PKMA 3LGEA 3MDUA 4ZTXA 3A3XA 3GDTA 1XC6A 1FWNA 2JFEX 1GORA 1P0DA 4PMNA 5G4EA 3SURA 3L5OA 5IOBA 3M0HA 4A2SA 4HNTA 2YIHA 2XSBA 1GQKA 3MUCA 3S1VA 4XIMA 3ZZ1A 2GJPA 1DWHM 4JDRA 3WQ5A 3FJLA 1TR1A 1Z44A 2PWVA 4ZVJA 3AO0A 1AODA 4IUGA 5PTDA 3GAYA 2PWGA 2RHGA 4XZHA 1UWRA 4GHRA 4AWEA 1EYEA 2DT0A 3AMLA 3OP2A 3QZAA 3VM7A 1S5TA 2CKRA 4I8YA 5FAJA 1YNQA 4PODA 4AC7C 1R7AA 3NVTA 3PN8A 2WPFA 1ZCOA 2GGIA 3WJYA 4K36A 3ZMRA 3KTCA 4AFYA 1WAWA 1NDVA 1KM5A 3UWWA 4BA0A 1TELA 3QHMA 1TYGA 4Q8NA 3TAKA 3GG0A 3UGVA 1UZ1A 1FWEC 4QS5A 2PTXA 5G1MA 3EPNA 3RJXA 4UFJA 2YZ5A 2OEJA 1JPMA 3OGVA 3PWGA 3QPZA 4UTTC 3W1AA 4ZQOA 4RE2A 1JFHA 2WNQA 2XISA 5JVLA 2OKOA 5DN1A 3JRKA 2V67A 2E6FA 3B8UA 5REQA 3P60A 2VVSA 1BWKA 5C5YA 4ZENA 3V18A 4UFHA 1QI0A 1NY1A 4QRNA 4XZMX 1LYXA 4GNJA 1PSCA 3NQVA 2C0AA 4FXJA 2VURA 4EMIA 2EF9A 3W25A 3WBYA 3EX2A 4E2VA 1KR0A 1LWJA 4AU0A 1LLWA 4GOAA 3GSMA 4MPKA 3WEOA 1M7OA 4Q8WA 3ARUA 3DXIA 3OIHA 1ZS2A 2NQHA 2NX1A 4JS3A 5MKGB 4TUFA 1E73M 2C79A 2A0NA 1QUMA 3AZTA 1Q85A 2ZBTA 5BMWA 4HU4A 5JRBA 2X7VA 3EAUA 5G5IA 2A4AA 4PBGA 2NQ5A 3M1ZA 3VZXA 3VINA 2WLZA 3IJ7A 1ODUA 5EGRA 1M41A 2PB1A 2UY5A 3N12A 5I07A 1RZMA 5U7SA 1BD0A 4FLRA 3RX3A 3KP0A 4CU8A 3WDQA 4D6HA 3W3OA 4R53A 2EPKX 2O4MA 3M44A 1SW3A 1K03A 1XW8A 3CHVA 3QY6A 5JCNA 3OBAA 2F8QA 5HWJA 3CAWA 4LC6A 4NYYA 5D30A 1X7FA 3M46A 1OYCA 4ZFCA 3NM1A 1J6OA 3GK0A 3WQVA 3I3DA 4GI4A 3B8DA 3H12A 3FK4A 1GVOA 2DEPA 1HTIA 3SFWA 4B2DA 1JGMA 1DV7A 4LIIA 3W74A 1W1B1 5K2ZA 3TE9A 3VDGA 4A35A 1XGZA 1YBQB 5E9XA 2W6RA 3FEQA 4LEQA 3UZ5A 3MMWA 2EPHA 4GR1A 1QJWA 1WZKA 1TMQA 4IMFA 2R6OA 3WNLA 5BWFA 1LQ2A 3UVAA 6PTDA 3EX6A 1Z48A 1CPUA 5HUPA 4GYPC 1I0DA 3H4WA 3FDKA 3U57A 1W1TA 4IM4A 3UR2A 1SFTA 1VQZA 3SN0A 3II1A 1QATA 3AYSA 2XDFA 3N15A 3QR3A 4F0RA 3HG5A 1A0DA 3L7RA 4MY8A 4L9YA 3DC8A 1X2GA 3TN5A 4N9DA 5M5DA 4GLEA 4M1RA 3C86A 1CYGA 3BCJA 3URQA 1OY0A 1XBYA 1IEVA 4N0RA 3WLIA 2FZ9A 2G5WA 4R88A 5CLTA 1D8CA 2BFGA 1X39A 2EBNA 1WYGA 3C2RA 4DJFD 4F0HA 5H8PA 1YXDA 3QTPA 1M6JA 3AM9A 4P7QA 5CPNA 1AZ2A 1KWKA 2C71A 1W9PA 2ZUUA 2QUVA 4A3RA 1R87A 4HNCA 4O4WA 4A29A 3EWDA 1GT8A 2B81A 1W8GA 2TAAA 1G4TA 1EO7A 4W85A 3NG3A 1EA9C 3CPUA 3GNOA 4C6QA 1SYTA 3QGAC 4GCXA 1HJUA 4TVYA 2W66A 9XIMA 4MB5A 1DNCA 2AKMA 2V2DA 3LMYA 2UWFA 4O17A 1RQHA 4KFPA 1LM1A 4XD6A 4WK9A 4PUKA 1DWJM 3CUGA 1TPDA 3IIVA 4O13A 3W7DA 1T8XA 3UJEA 2XUCA 3NZRA 4G1KA 3V1HA 4FHAA 4B5UA 1GOMA 1R30A 1D9EA 1PL9A 4H00A 4YYCA 2Z1XA 5A8QA 3LZ3A 3W0KA 1EGVA 2ZIDA 3FEMA 3O0HA 5DY3A 4WDUA 1XLEA 2FMOA 2NQLA 4NJHA 5DMMA 4GNKB 4WXZA 3TSBA 3TYZA 3SSJA 1H1ZA 4PMJA 1BF2A 1RLDA 3BJFA 4JL2A 4AHPA 3V0TA 4MPQA 3GDBA 3M0KA 5ABFA 1ONRA 4GUJA 4KRZA 1HN1A 3MV01 4NYUA 2YDSA 3FYYA 4JZ5A 3CC1A 1Z42A 1XIEA 3KTSA 2BV9A 4H8UA 3UD6A 1QOQA 4ZFMA 3IAQA 2P50A 2BC0A 1OZQA 3RUBL 3OHMB 4BHYA 3TQKA 3DGRA 4W4QA 4ZOHB 3W1PA 1F8WA 4DWDA 1E9IA 4QLLA 4HCLA 2OFJA 2ZVRA 1P6WA 1JXJA 1XBVA 3LXDA 3MSRA 1TCDA 1KM4A 5FJJA 3THQA 4A6GA 3M9YA 3EWUA 4CKQA 4H4QA 4ZEPA 3FJ6A 3GXIA 3EZ4A 4GI8A 4K6AA 4QHRA 2YBTA 3GY1A 2XFFA 3WLSA 3PBYA 1S2AA 4MNKA 1NU5A 4HMNA 4YL2A 1XP3A 2NLYA 4PUNA 4Z2KA 2Y8UA 4U2YA 1VHCA 1KBJA 2OQHA 2PI6A 5A6BD 2W54A 4R3UA 1DEDA 3VZYA 1WCGA 3WUBA 2BODX 3QFWA 1H7PA 2BX7A 3N11A 4JN7A 4DJED 2ZRYA 3NSNA 2BHYA 1PTAA 4QSFA 2WP5A 4OQVA 3VDAA 4JQAA 1RCQA 4HZ6A 4FNSA 4CU7A 3DK9A 3MI2A 3WH8A 1VCVA 4V2XA 2J9YA 1MEHA 5A6KA 5A95A 3HGSA 4QJ3B 3P67A 2UY2A 2OO0A 5ECVA 1HKKA 2JE8A 3A47A 2F38A 3QRHA 4O1EA 1JPIA 3ABOA 1ZRQA 2VX6A 3WH7A 5C2GA 1M6IA 1ZJAA 1TB3A 4A8LA 3TXZA 5DT7A 1GOWA 1KRMA 1ZY9A 3EA2A 4H9ZA 3PWAA 1HL8A 4DY1A 4TMCA 2XINA 1OGBA 2C0HA 1J12A 3WN6A 3E1F1 1H0IA 3GW3A 4AY1A 2EQDA 3M64A 4DF0A 4W9TA 3UXKA 2AQWA 3K8KA 1S5VA 5REQB 3FN9A 3ELFA 3LLDA 4EPBC 3H4KA 2R8WA 3MCMA 4DJEA 1ZAIA 2BCPA 1Q65A 3G3MA 2SFPA 4MKSA 3SCSA 2V0TA 2PWHA 3OVGA 2NV1A 3MKKA 2B7PA 1Q6FA 4Q7IA 2NUYA 3B9EA 3AMDA 2O9OA 4UTLA 4XZBA 3NDYA 5A6BA 1F61A 3R10A 4QQ3A 1EGMA 3T0TA 1EOMA 1YX1A 3W7JA 1C91A 1DJGA 1R3VA 3F4VA 1H3GA 1V02E 1DVJA 2WYSA 1ONXA 2RJHA 4B5VA 1XH2A 1QXLA 4URIA 4AVOA 3H70A 3GH5A 1XPGA 4B9ZA 2J7DA 1XG3A 1J0YA 1HL9A 3SADA 2OOGA 7REQA 3QC3A 1GRBA 1LJYA 2J6XA 1VKFA 4XBSA 2V3DA 2ICSA 3RPMA 2V69A 2V5BA 2Q8LA 3KVMA 1QHZA 4CN6A 5I5RA 5A8NA 1TO3A 1OIFA 1R8LA 1IXNA 1QW8A 1UMYA 3GXPA 3WYZA 3UJSA 4GXMA 1TZZA 4BQ2A 1DP0A 3U7VA 1KNWA 3WIJA 1EZWA 4QFUA 1V7AA 1UWUA 3ABSA 3GS6A 1TTQA 3UVIA 3UXLA 4KFOA 1NEYA 4DWSD 1VIWA 4GH3A 3KUMA 5CG7A 4XD5A 3WDPP 3ARXA 4W87A 1M7PA 3GD6A 1KTCA 1GZJA 1B0IA 2FGZA 4MOZA 1XRVA 3MJMA 1DQXA 3MUY1 2Z27A 1MW1A 3NPWA 1BF6A 3W85A 5D2YA 2DORA 1I2OA 1PCWA 2BC1A 1UWSA 4NJIA 3T7VA 2MNRA 2X05A 1IEWA 4LUYA 4Z17A 3SUWA 4AUBA 3TH6A 1TG7A 2VUYA 4A3QA 4H9VA 1BVWA 2ZC8A 3RXZA 4ES4A 2WSRA 1P1MA 2YXGA 4DJDC 3M47A 4ZOCA 5DX7A 2FTPA 3ZR5A 3R12A 4PSPA 5BXPA 5FMHA 2X0SA 5A1AA 3WQCA 3DYMA 4WXYA 1HJXA 1EEPA 1K4HA 1JPHA 3KEHA 4JQ3A 4CNPA 2WMIA 4Q3MA 3RJYA 1TQXA 2VFEA 3PZGA 2J7HA 1STZA 3GNRA 4ZB0A 1EX5A 2ZUWA 3MKCA 1JGIA 4FNQA 4ZL1A 3HJEA 3REQB 4Z1BA 5HULA 3E0FA 3VA8A 1EXPA 4F9JA 5HQLA 1BXNA 4GVGA 3BVJA 3OEXA 1GOIA 2QV4A 2DZAA 3OQ8A 1CGWA 5DF0A 3PJWA 4L4PA 2W62A 2PEVA 1D7YA 2Q3OA 1O12A 1HZYA 2NSOA 5D09A 1CLKA 2VC6A 2WPBA 4QJ5B 5JH2A 3GXMA 2A6NA 4OUEA 1HFBA 1XKYA 3C56A 3ITLA 4MVAA 2BGSA 1UOZA 3NZQA 4RV8A 4WX2A 4EQSA 3LD5A 1XSJA 3J7HA 1GTHA 4JICA 2Q3RA 2JF6A 2XVPA 3FYOA 3LMZA 5F2MA 2W63A 3FW6A 4PCNA 1FA2A 3NYDA 2PODA 3GW0A 4FF5A 1MW3A 1L8NA 1XLHA 2BY1A 3AXXA 1SUXA 5GPRA 3CMJA 4E8GA 1TJ0A 1TTPA 3IV3A 1EP3A 1OD8A 1O1HA 2R1LA 3SUUA 5AC6A 3ME3A 4PUEA 1HKIA 1JFXA 1ENUA 5DY2A 3UG5A 4IQJA 5D32A 3W6LA 1AMYA 1QI5A 4LOCA 4S2CA 2FTYA 4M52A 2PDWA 2ZA2A 4LFYA 1VJSA 3TQVA 3KDNA 1UR9A 4W8BA 3GG8A 5D9MA 3V3WA 1NWTA 2YVFA 1KGXA 2XGZA 3NGJA 3H53A 3RX4A 1E3ZA 4QROA 3KL5A 3EOSA 5KSWA 3BLKA 4AB4A 1JCYA 2YLLA 1JPDX 2I7GA 3ZIZA 5EMLA 3MB9A 3UW6A 1KN0A 2YJQA 1BSLA 4H9YA 2PRMA 1JDDA 3P2VA 4TTGA 3CV2A 3GNDA 4PTVA 3NNTA 5I02A 3DFNA 1PUDA 2D20A 4ALDA 1H63A 4IFKA 4OVXA 1BWLA 4W5ZA 1CECA 4LNCA 3E2RA 1OC5A 3MP4A 1V79A 2Y6ZA 2DSKA 4LVAA 3QTGA 4PMYA 4BWLC 4H8HA 1C7TA 3Q58A 2J6VA 4KPRA 5JIWA 3BAKA 3SQLA 1WKYA 3BE7A 3NM3A 3ONCA 3VD9A 4LC8A 3QFEA 3LCIA 3N6QA 4LT9A 4I9TA 3CTTA 1FCBA 4U28A 1V77A 1ALDA 7ODCA 3WDRA 5FIPA 4KT2A 1TRIA 2J9ZA 3NEHA 2AOSA 3BAJA 1SMAA 1EC9A 1PS9A 1O5XA 4XTDA 2VR5A 4H6EA 1V3LA 2PWFA 1AG1O 3DG3A 4CQCA 4F0LA 4TX8A 2J8GA 1RV8A 4FALA 3M5YA 1EPXA 2CZVA 3MYOA 4IGSA 1E9YB 1R9YA 4GCAA 1GGOA 4H8NA 2PP3A 3AUOA 2A7NA 3M5XA 1ZBKA 1OBAA 4J27A 4O1AA 5AKQA 2VC5A 1EIBA 4AEEA 4V1YA 2TMDA 1HO4A 3WNPA 2OODA 3D3FA 3V0SA 4AF0B 4KWWA 2NT1A 1KBLA 1FWRA 4G7FA 3WLKX 1D3HA 4Z2JA 4YXGA 3QZ6A 4CQAA 5D9OA 3M0IA 4O1FA 3RPTA 2WZHA 4S3BA 2Q01A 2DSUA 4L4MA 1GVEA 3D46A 1NPXA 2E3ZA 6A3HA 4GA8A 1MRAA 1JCLA 5H1WA 2POZA 3T1GA 4GY0A 2B7OA 1R3YA 5I3KA 1WXZA 1QDSA 1F5ZA 4JTGA 2PDGA 2PLMA 3ZJ8A 3DGHA 3I6EA 3JS3A 1M04A 1REQB 3BLOA 4YWIA 2DZWA 2HE5A 4Y9NA 3B9OA 3KTXA 4R27A 2Y7EA 1A50A 2CW6A 1U5VA 2LLEA 2ABBA 1VFUA 3PUOA 4BURA 3FGCB 1ISZA 4ZO6A 2WVVB 3O3RA 3ARYA 3GVVA 3F5LA 4HBKA 2C8NA 4AZBA 4V15A 1UKSA 4H4TA 4RNHA 4S3CA 4GWEA 2OMAA 4MUPA 1IIGA 2FLIA 3B97A 4ASTA 2BGNE 2QCHA 4M56A 1JL8A 4HU0A 5B7YA 5C9WA 2VT0A 4BI6A 1CGXA 2GQ8A 4HNUA 4O28A 2CCRA 2CETA 3BTNA 1UD5A 5I6SA 2ACQA 4C6JA 5LHEA 2A2IA 1TPB1 3KOFA 2PDYA 4LV4A 2PDHA 2CLHA 3TW7A 2R14A 1YDYA 3OBKA 3BMWA 2NXIA 4H9TA 1CXKA 3G8RA 4X9SA 1RVKA 2QVHA 4GGBA 2E1WA 4NNCA 3EAOA 4MZ1A 1FKWA 4NAEB 2PC4A 3ARWA 3QH2A 3QMRA 3WL0A 4GYPA 4TMBA 5FJTA 1PTGA 3CYVA 1P4CA 2JK2A 1N62C 4NQ1A 2CEQA 2VD9A 3K2GA 3MMUA 2O92A 4GYFA 1OB0A 2W92A 1EC8A 2FZ8A 2VC9A 1CBGA 1Q8AA 3S5ZA 4ZSTA 4MB1A 2XIIA 1POKA 3TQ0A 3BJTA 5AHMA 3G1HA 2PF0A 1ZL1A 4Q4KA 3WF4A 2VX7A 2V38A 1OADA 1J5TA 3EB3A 3PSWA 1Z8AA 1FWAC 4U5IA 1GERA 1LLZA 4LB3A 3LHVA 1YPXA 4J40A 1O66A 1JZ4A 3DUGA 5ABTA 4QJ1A 3E0LA 1MDRA 2CBJA 3K4WA 3W2NA 1UJPA 3R94A 2XFWA 3P93A 1OM0A 2Z1SA 4FXFA 3N2XA 1IR1A 4Y9AA 1NOWA 4G7EA 1K8XA 3B05A 3NOEA 2XM1A 3AZSA 1ISWA 2FHCA 6TAAA 5E6ZA 1BKSA 2JKPA 2WPCA 5KZDA 1P48A 3VFLA 1ZY8A 1UP2A 3ZVIA 1WZMA 2OZ8A 3W7KA 1HP4A 2DDXA 3CL8A 3IIZA 4GZEA 2AQOA 1GOQA 5EL1A 1G7UA 5HK4A 2DT3A 4H41A 1XGDA 4RKAA 1VFHA 4NNBA 4GIRA 1IEIA 3FCPA 4UQAA 4L4OA 5A2BA 5BWAA 3G1VA 3KRSA 3W87A 1UD4A 3M7SA 3KOYA 1C90A 1RY0A 1VHNA 2CFYA 3ARVA 5HINA 3UWQA 2OSXA 3VX0A 1T40A 4DUVA 3N14A 3CIWA 5C6MA 3W7LA 4AVNA 1AK5A 4GQGA 4OU1A 3O2LA 2QCFA 3GIPA 5BOFA 2GL5A 2PAJA 4C65A 3DFYA 4MLJA 1WBHA 3TYDA 3C2OA 1PDYA 2FTWA 3PPCA 2OU4A 1RAKA 1OVDA 1W17A 2RGLA 4C7DA 1IZJA 3W38A 2E5DA 3CK5A 3T2PA 3Q45A 5A8MA 3RAOA 3P0WA 6XIAA 4YTUA 3MU7A 1Y5WA 3GHTA 1EZ2A 1X7IA 3RLVA 4BK9A 1H61A 3ZXWA 2PRHA 1XIHA 1S1PA 3F2CA 2VRKA 2CBUA 1V6YA 3VIKA 4QNWA 2E6DA 5DELA 4C1NA 4ZE4A 4FI4A 5I3JA 1YTDA 2Z1WA 2YCIX 5SWUA 1ZMDA 4D1IA 5CSRA 2J66A 1EC7A 3W83A 4L64A 3DHDA 2DUXA 2FB3A 1EJSC 3ITYA 3VIMA 3N4FA 3B0XA 2DZPA 3LU2A 1GJWA 1VBHA 1EQCA 4H7CA 4IPIA 2D3LA 2HJPA 2P3ZA 3SCUA 3VFCA 2WJFA 3FXYA 3WJXA 4KKXA 2CERA 4CEUC 1V0KA 2F84A 3AWNA 3SZ8A 4EWND 3RPDA 4DO7A 3TKFA 1AH4A 1PXGA 1VEMA 3HRDC 2UZ9A 4J3ZA 1ZNNA 1US2A 3GDMA 3FJ4A 3QV8A 1S2WA 3ARTA 4DJDD 1SZGA 4HMEA 4UR9A 1QNQA 4HU3A 3UWEA 5T9CE 3R79A 4O0KA 4YVPA 5FF4A 1V3KA 4K8DA 4M6VA 4XZLX 1SB3B 3Q6JA 1NFGA 5A6AA 3WDJA 1E0VA 1W0MA 1EJRC 3W84A 4RJEA 1TWSA 4WR3A 4MYAA 3T8QA 3LA4A 1KTBA 4IGHA 4JIQA 4XKMA 4DBDA 4H50A 5DBUA 3IWPA 2EAWA 4JX5A 1BPLB 1P6BA 3DFPA 1IF2A 4JOMA 4UTWA 1UKTA 3G1RA 3W82A 1DE6A 1F3WA 3W7RA 3C8NA 1M1BA 1OFPA 3OLEA 2DH2A 4N4QA 2X2GA 3MPGA 4Q4QA 1K3UA 1IIHA 3KZPA 2OTDA 1P0KA 2PGRA 1PPIA 2VGIA 3EWCA 4Y96A 2IXVA 2QJMA 1MFVA 3MVTA 2PGEA 4CD8A 4L1WA 4TQTA 1MUWA 4LTSA 1ADDA 2I16A 4QAWA 3BL3A 4GACA 4YWOA 4OUIA 2PDCA 4NI8A 5IXEA 2OQLA 3PJTA 2X99A 3IGSA 5FEZA 1UUMA 1TJPA 3TEVA 4UTUA 1DTNA 3LBMA 5HJYA 3UXIA 1EB3A 1UPPA 3GR4A 4NY2A 3GTNA 3GXDA 1GQIA 3AIRA 3HQOA 4JIRA 1GREA 1OD0A 4ERAA 2PDPA 3HZ3A 4KF1A 5MF5A 4IG2A 5GQBA 3UGRA 1I8JA 2NVDA 4PCPA 1W1YA 4OIFA 2ATMA 2CLFA 3W4RA 3LCGA 1H7OA 3N6JA 3ZM8A 5A8PA 1MMFA 3CH0A 3P5YA 3OZPA 1CXFA 4E4FA 1LCOA 3H24A 1N61C 2OYLA 4PFHA 4X61A 3CZGA 2WMJA 5CZJA 3DFQA 1BGAA 1XKJA 1XD0A 2PU0A 4O16A 1PVNA 1E56A 1XYBA 4MJZA 3C2YA 1B31A 4IUOA 1K70A 2W0HA 2V30A 5CLWA 3MI3A 1LRQA 2EQ8A 4LAOA 3G1AA 4KETA 3LZ5A 2YA2A 4WLCA 1UOKA 3GQYA 1A3HA 4LCRA 3DCPA 4AZHA 5HPOA 1A0CA 1SJDA 3CIXA 1ZALA 4HNVA 2A3HA 1EJVC 4HOWA 1AD1A 4Q6XA 1FEBA 3GBEA 1KA9F 1BYAA 2A8XA 3OB8A 1W1VA 3A9IA 5HJXA 3NDZA 4DIAA 4GJJA 4JTSA 4C90A 3W28A 1GKRA 3PUDA 1MW0A 1ML1A 4I6VA 1G0CA 4AHQA 3FDGA 1XL9A 3UZXA 4MDOA 2CIPA 2AL2A 1FFVC 1U83A 2VQUA 4GUFA 4BF5A 3EB4A 1Q6LA 4HZ8A 4M6UA 3FV9A 3FVMA 3ISIX 5E1QA 3W7EA 5D05A 1J93A 1NHSA 5LKYA 5U1OA 1K8YA 3BH4A 1S5WA 5K4ZA 2OT1A 4JTCA 4JCLA 2YPIA 1L6YA 1RK6A 4EK7A 4CNOA 3S5SA 3PP7A 1RJRA 5CCZA 3AMCA 4HCHA 3OLDA 3F7JA 4H4VA 1H11A 1I60A 2ANUA 4CD6A 2R1PA 1A5MC 1VRXA 1VDVA 4C5ZA 1QK0A 3LCHA 3MKVA 5AYXA 1QASA 3PAOA 4XX6A 1W3LA 3DFHA 3EWWA 3QHOA 1Q2SA 1DPMA 3O16A 3ABXA 3VABA 1WNOA 3I3BA 2XWDA 2HTMA 4K3ZA 1CGYA 3W71A 2J74A 2CNCA 4MWAE 2WB5A 4IPLA 4A05A 4TVCA 2UV8G 3QPEA 5HXMA 2ZXDA 1V03A 2Y8KA 4O0ZA 3U2ZA 4ORIA 1RXOB 1G69A 2F61A 3BLFA 4R7OA 1C8XA 2CHOA 2ZZ7A 3UR7A 1Z7AA 4BF7A 1ZB5A 3QHNA 2YAUA 5EBKA 3VYLA 4M7SA 5G4WA 4TX6A 4UMCA 2PDBA 1QI4A 4Z1DA 3BAYA 2QMKA 3NQ6A 1GSNA 1E5JA 3VO0A 1RHCA 1K9FA 2WC4A 5LNUA 5HPCA 1RLCL 1W5MA 1PWLA 2QDEA 4I9AA 1FWGC 1GYLA 4J3UA 4PRTA 4PTWA 1K4QA 1WO2A 2VFIA 3NO3A 2GGJA 1SW7A 3KCLA 4FK9A 2BXVA 2C13A 2HZGA 3GTFA 2Z7GA 2W67A 3VOGA 4DO6A 3AIVA 4RNJA 8XIAA 3GBDA 3N17A 4QCFA 2JQXA 4NX0A 4JBRA 4LVDA 3EDKA 4Y9MA 3VDCA 3BAXA 3SY5A 2ZZ6A 3MO7A 1Q6GA 3TLQA 1XXXA 4IIEA 5T9BG 1GG0A 3WUGA 1HF6A 1WOAA 3MUZ1 1FCUA 4PMOA 2J8FA 3NPXA 1SSDA 3QFAA 3VIJA 5LA1A 3M0VA 3TJLA 1BSIA 4QDWA 2BOEX 2HBXA 5DFAA 3B40A 4DRSA 2YR1A 3ZFHA 3U48A 1EBDA 2ALDA 4Y9OA 1E0TA 3TJIA 2VNCA 1FWHC 3R2GA 3BOFA 4JD4A 4WJXA 3WBWA 5F2LA 2WMIB 4KCWA 2CDUA 3SO7A 2EEXA 3WF0A 3FJNA 3GIYA 4LRSA 1P5BA 4XV0A 4WZHA 3N18A 5E9AA 2RDTA 3T2OA 1LUCA 4DPQA 2YVGA 4P8UA 1WDRA 3URAA 3EGJA 3SSZA 1S46A 5TF0A 3UR8A 1EWDA 3KBWA 4HD5A 1X8FA 1UBPC 1ECEA 2X16A 1O94A 1EFZA 3AS2A 3AOFA 4MWAB 1OFRA 2G3NA 4QM1A 1E6SM 4IP5A 1JAEA 2YGYA 5JIPA 2NWSA 3DIPA 3OW1A 3HMCA 2FPTA 1UG6A 3GTIA 3LCXA 3GXNA 3BG5A 4AZ7A 3S1GA 1B4EA 1UD2A 2V3FA 4UC5A 2XSXA 3N04A 3KRZA 2E8YA 1VPYA 2Y7FA 2BXZA 2ZTKA 1JCXA 2ZUTA 3WLTA 2VR2A 3OIXA 1FFUC 2F6KA 1KCLA 2QIWA 2ZYFA 4DZ5A 2R9ZA 5BRQA 3M6DA 4O1CA 5E09A 4H4SA 3HG4A 4XKYB 4KIEA 4K8GA 1DJNA 2OXNA 1XX1A 5DCDA 1XLJA 2V63A 1W9BM 3BDKA 3CGDA 2FDMA 3PB2A 2YW4A 3L4YA 2DZXA 2E77A 3DI0A 3F4WA 1YNPA 1LROA 2Z28A 3VMNA 4GD0A 4IIDA 4GUHA 5G5HB 1ZLPA 1Z89A 1F4HA 1MO9A 4BEQA 2ZA3A 3A23A 3P61A 4M8UA 4WDWA 4HGXA 2A3BA 3V5CA 3RFAA 1TX0A 3M0ZA 3W24A 1SO4A 3UU0A 3PZTA 5KINA 3S6DA 1Q4NX 3MT1A 1XRSA 3TJ4A 4U33A 3THUA 2WSQA 2Z2AA 2W3RA 1B3OA 4L1GA 4M6PA 1XLMA 4K7ZA 5A3HA 2ISVA 2A5HA 1YPFA 3MCNA 5TAOA 4BF9A 1BZLA 3RIKA 1LPFA 3CXOA 3WNKA 3O63A 2PDUA 3W1MA 3KE0A 4LS1A 4NIRA 1VS1A 4EQXA 5I03A 3AHVA 2QUTA 3UF9A 4ENLA 1B3VA 2DVXA 3BV4A 1OHLA 1NDWA 3LXCA 2XZ7A 1Q7ZA 3OBEA 1MXGA 4OOUA 4UZUA 2WO5A 3TOYA 4XBKA 3AYVA 1EDQA 2FB2A 4GC3A 4IZGA 4H4IA 1LL7A 4R85A 1VBGA 1XISA 1KGUA 5JXQA 5G2IA 2C91A 3CUHA 4LWWA 2W3SA 3GU2A 4LBRA 3TTQA 3ONBA 3MO4A 4Z0JA 2QGYA 1A53A 2WCSA 1VJIA 3UPMA 1GKQA 3O9NA 1EKOA 1MSSA 4WRHA 3LGGA 3R89A 5KZ6A 2VDHA 3BAWA 3H22A 1ISYA 2W4XA 2VX4A 3VIFA 3QSTA 5JCIA 2XN0A 3LK6A 2D2OA 3PPGA 2G50A 1HKVA 2J75A 2WPEA 1E6ZA 1FXQA 2FPVA 1YE6A 3E74A 5BXRA 3VDHA 4LW7A 1T96A 5CGQA 3VGHA 4AW7A 1TPEA 4JN6A 1VYPX 3GWQA 1XLAA 5C2XA 2GR2A 4NL1A 1TX2A 5G4HC 7TAAA 4NVTA 1RJPA 2R82A 1QNRA 1ZX9A 4LBUA 3UCDA 5E93A 2NX3A 3DHUA 5HQEA 1TUFA 2B7QA 3U9IA 2G4JA 4XZWA 1QU4A 1F6KA 3EEGA 4I5XA 3UG3A 1L6SA 3UFYA 3MJYA 2D0GA 1HX0A 2QF7A 1YLVA 2VJXA 4BI5A 3UNDA 4YCOA 4H04A 3CO4A 3G1XA 3W2KA 3VU2A 3MYPA 2OWWA 3MSYA 1GTEA 1G4PA 4CNUA 2J47A 4IX2A 1P43A 2Y5JA 3GNPA 1KBIA 2QJNA 3S5YA 1WAUA 3H4XA 3Q94A 3U0HA 1R0MA 1R3SA 4JKMA 4Q6JA 4ZODA 3ZO9A 3XINA 3I7SA 4GFSA 4UWMA 4JFSA 3BMXA 3TONA 5D03A 4RNFA 1JF6A 1GETA 2OCZA 4KCVA 4EWJA 2H3BA 4NZCA 2X7WA 4JQ4A 1JOAA 1J01A 5FCZA 3HQNA 4MHBA 3M41A 1ITUA 3MTWA 4MMWA 2YXXA 4LXFA 1OCQA 5CKSA 4EXQA 2IKIA 5LIXX 1SM9A 1Q6CA 2O4QA 3FYPA 1RJQA 4XBJA 3WLRA 4AY7A 4WEVX 2XFYA 4LX4A 3HF3A 2WKLA 1QPQA 4AZGA 4WOQA 5FJUA 3S46A 3GXTA 1B9BA 4DYJA 4GNVA 1PKYA 1GVRA 3GVWA 1NWUA 1EBHA 2C3DA 4MWAD 1J0KA 3U2CA 1M7XA 3WQOA 3JU2A 1KFEA 3C0QA 3RX2A 2INFA 1JDFA 1AJ2A 1L0PA 4LNYA 1W9UA 1DE5A 2CLKA 4Q4OA 4W7WA 1FWFC 2BWGA 3VTRA 3S1WA 1RUSA 3B9AA 5C2CA 1NFBA 4HIBA 1OFOA 1TPUA 2BP1A 2B31A 4IL0A 3IJ8A 3W23A 4FOJA 1QO2A 3TA6A 4BS0A 4K1GA 3VGFA 4C6LA 2RH9A 1RCOB 2XIJA 1U1UA 5L9FA 2KX9A 3N3TA 4JTIA 4DF2A 1EX1A 3ATZA 4YCPA 1Q7QA 5HR7A 3GNXA 1QW9A 1UH3A 4FOKA 3VK5A 4EM3A 5KITA 4YS1A 2A3LA 1PTDA 1IWPA 1DIKA 1K6AA 5FEXA 4XZ9A 2JIEA 3BPWA 1QT1A 1XI3A 3UG4A 3ZYZA 5I09A 4JIEA 1QPOA 1OFBA 3ABZA 3RG6A 3W27A 1FWBC 2A7PA 3TMLA 1IGSA 2VM8A 4HHHA 4KEMA 1FEAA 2QW5A 4ZOAA 5I3FA 3UZWA 1JRBA 1GVFA 1YNYA 3SUSA 1V6WA 4HPJA 3P84A 3KWXA 4IXXA 4C6MA 3PC0A 5DCBA 4WOZA 4HTBA 5LZLA 2X1IA 1HIZA 1TV3A 2V2HA 4UB9A 1Z3NA 5CSUA 4BQ3A 1JUEA 4ECLA 4E4UA 3EX3A 4S3GA 5F4SA 3LGDA 2EXOA 2ALRA 3S42A 4C7GA 1KFCA 4A8RA 1JG9A 1D7KA 4EANA 3WLMA 2WM0A 1XUZA 5JH1A 2JBMA 1W54A 3A4XA 1F07A 4AH7A 1V3JA 4IOTA 3DC0A 3JZEA 3BW3A 1G7VA 4LB4A 1V8EA 4UFMA 1XIJA 1DJXA 2YZRA 2PDXA 1PZ3A 3W7OA 2V3AA 4NG3A 5F4WA 2F2HA 2W9MA 1X6LA 3D3AA 3QSRA 3RLUA 1JYVA 4Y6GA 2G4FA 2ABAA 3V36A 1QHPA 3FA3A 1UYQA 3MCOA 3NL3A 3HQ1A 3BARA 3PPHA 1X96A 1XINA 4B16A 2E5BA 1Q8JA 3HPFA 2DIJA 3PBWA 3DFTA 2YL5A 1W1PA 4TV6A 2PGWA 3QKEA 2V9DA 1SQ7A 2EG8A 3SI9A 3VOCA 4IMEA 1ZPTA 3QEZA 4S23A 2GGGA 4PEKA 2WXDM 1JULA 2BASA 1EBGA 3MVIA 4HK7A 3SQPA 4LSBA 2IKHA 3W6MA 1FDZA 1IZCA 4RNIA 4W89A 4G7EB 3WENA 3NL5A 1HW6A 2ZUVA 2WVVA 4QE1A 2NVKX 3PUEA 3B04A 5M2FX 3TYAA 1K9EA 3WK0A 3CWNA 4AXKA 3P0XA 3LTYA 1CTNA 3DERA 4I7WA 4K68A 4ZO8A 2ZUNA 2EQ9A 4EAYA 2ZA1A 4C6DA 3QV7A 1XBZA 1TJ2A 1TREA 1F76A 2ZWZA 5I3DA 1X6NA 3EKZA 4MADA 3G0XA 1A47A 1FH7A 5FJRA 3TK7A 1VPQA 1Z6KA 3CJPA 1THFD 3LCFA 4IF2A 1ISXA 2BNJA 1S2UA 4CCCA 2ZXQA 4HN8A 3FVDA 1DIDA 4D6GA 2OX1A 1G4SA 1SJAA 4JAWA 4MJ4A 3DFSA 1XLIA 3KS6A 1TV5A 2XVLA 2E9BA 1YMYA 2Z24A 4UTWC 4AIBA 2VRJA 1B3XA 2W27A 4N9CA 4GC4A 4AMCA 1W2PA 1A5BA 1V7YA 4RDZA 2OYKA 3H2OA 1LRNA 2FZDA 1TV7A 1GQLA 3L2MA 1LORA 4LBSA 4H01A 4NKCA 3MZ2A 1NQ6A 3QVQA 2EJAA 3WEMA 1FDYA 4DNMA 3HIJA 5G1TA 1F9CA 4LUIA 4KCTA 5GJMA 1XIGA 5DO8A 3P3BA 5TQLA 2F2KA 2H8XA 3IVUA 4YTQA 2OOFA 3H8AA 3PTKA 4D8AA 1FECA 3BG3A 2E3TA 4CUCA 1RBLA 3OYXA 4YN5A 3UXAA 1JRPA 3MUAA 3AJXA 2QPSA 1OFAA 1HKJA 4CEXC 5ABFB 1TTJA 3NPUA 1R2TA 1B2YA 4M82A 5H8UA 4GZIA 3LPOA 5F1VA 3BCFA 1VCFA 3SR6B 4C6EA 1O5KA 1N63C 3U6WA 4Q7NA 2PDKA 2YB4A 4R34A 4GQQA 1LP6A 2EG6A 2R91A 4F0SA 1TR9A 2GOKA 4IICA 1UWIA 2CXEA 4HNNA 3M0MA 2IS7A 4Q4PA 2P8BA 4DM1A 1DIEA 1XRTA 2BZNA 3P81A 1CX9A 4LUSA 1C7SA 2ONEA 3K13A 1CB7B 3DESA 2I9EA 1GONA 2HNEA 3E5PA 4HMCA 2VWTA 4IMDA 4PTNA 4MYXA 4GABA 4HSOA 1WKDA 3AALA 4O8AA 3T8LA 2VZVA 4H4UA 3W7HA 3A7RA 5HNRA 4QGCA 3ZVHB 3LTSA 3H7UA 1QWGA 3ARQA 4HZMA 3S83A 4CLMA 1MUMA 3GB6A 4WQ6A 1Z41A 1YIXA 1TZ9A 4PL2A 3NRZB 3PG8A 4PGLA 5HAOA 2O55A 2G3MA 2FVLA 1ZSXA 3K1GA 3R0KA 1DJYA 4RK8A 1YPIA 4JNZA 4R7JA 4I7UA 4XO6A 1S7MA 1O1ZA 2YCJA 3DI1A 3DBNA 3BXWA 1DQUA 1VBUA 4JPGA 3G18A 4H3DA 3ZT7A 3LEPA 1LQAA 4HA1A 4NZJA 3V7PA 3Q4DA 1FBAA 1X1ZA 2X1RA 3T4WA 4REQB 1I2PA 1CW2A 1N5WC 5DT5A 5FSDC 1AL7A 2GGEA 3VPLA 4PMVA 3NQ7A 1W3HA 4M5PA 2I5GA 3NDOA 4JFVA 4DI9A 3PTMA 1H50A 3LM3A 1OF6A 3N29A 3EBVA 3GG1A 2G3FA 3IIOA 2WVTA 1MI3A 5BU9A 1VB9A 3GDLA 3K1DA 1TE6A 5JBEA 4DWSB 5JQ9A 4D6DA 2WANA 1GWJA 3CHFA 3LXAA 2BVYA 4JGDA 3N2BA 2ZVIA 1UPMB 1TPFA 3ES7A 4PMZA 1AH3A 2J27A 2KAUC 5C54A 1IEXA 5DLCA 5HMEA 1DHKA 5DEZA 1NM9A 3B0PA 1NH6A 3UETA 1XRFA 4GH1A 2G8ZA 1KQYA 3UXDA 5G2WA 4QG8A 3K5XA 4EQRA 1K8ZA 1LL6A 1LT8A 1KLZA 1PHQA 4GQRA 2EHHA 4CGTA 3DYOA 4IL2A 4UQCA 1I2NA 2OEMA 3APYA 1JAKA 3NURA 5IBXA 1QRQA 3URNA 1RD6A 1T0OA 2VEFA 3PBMA 4S3JA 5AB3A 2QPXA 1GVQA 2QGHA 4QQUA 3TP4A 3W9ZA 2GPTA 4RL3A 4W7UA 2ACSA 3FA5A 4S2BA 5A2AA 3OZYA 2DUAA 1K9TA 3RITA 3LV6A 4IT1A 3OC4A 2Y7DA 3M16A 3BSHA 3N2MA 1ZKQA 4KIRA 2POTA 4PCTA 4PUDA 5EMKA 4HT3A 1OG6A 4IQEA 1UR0A 4Z2HA 3D0CA 4RV3A 2X8RA 3LUTA 4B5NA 1EUNA 4B5SA 4HYRA 5M03A 2NWRA 3PNZA 1HP5A 4EE9A 3UJ2A 6CGTA 4GMEA 1Y0EA 4L61A 4BFAA 2YL8A 3OU8A 3S8HA 2UY3A 2W0UA 4NRSA 4P7OA 3WMCA 2X50A 5EPDA 4KERA 1GHSA 1W1ZA 1XR2A 3ABQA 3O0FA 3QJAA 2FHBA 3TW9A 3VZZA 3R0UA 4QLJA 1DJHA 1TVPA 2NQJA 2VR4A 4L6OA 1PJ9A 2A1YA 1E9ZB 4YMZA 3IUIA 3ZR4A 1MNZA 4PZVA 2VZUA 2J7BA 2QAEA 1M03A 3W7QA 2OSWA 3LOTA 4M24A 5ER0A 3T0CA 9RUBA 4JTEA 1DWFM 2CLEA 4N7QA 2WMGA 3KLLA 3CUIA 3D47A 1MUCA 1F3XA 3GFXA 4XD4A 3PTDA 5HWNA 4XUYA 4DM2A 1XSKA 4ORMA 3VOHA 5AY7A 5AHEA 5XIMA 1WQ5A 1Q13A 2AQVA 5KVHA 1FWWA 4KPLA 1KCXA 4V33A 1A4MA 2D0FA 2ZX7A 4O54A 4Z2IA 4NSBA 2PD9A 4IIGA 1V3MA 2PLJA 4WVXA 1FDJA 3LSCA 3BWWA 5CJNA 4IHCA 4LS0A 3FA4A 3T07A 6XIMA 1FX6A 3E9AA 1SU5A 1E4IA 3DFOA 2VCAA 3VOJA 1QWKA 3L4WA 3N4EA 4W86A 2F6UA 1YDVA 3L2LA 4HPGA 3W2LA 1PB0A 2ZDSA 4PB4A 3CMFA 2AMGA 1E3XA 4ZE5A 4X9YA 2QJIA 3G1FA 3SAZA 3TVAA 4O52A 2VDGA 4HSNA 3TR2A 2HQMA 3BW2A 3T81A 3VMPA 4B5TA 5HATA 3MP5A 4LV9A 1KD0A 2XU2A 4R9OA 2PZ0A 3W7MA 1NDAA 5EU9A 2E5CA 3D5HA 3CZEA 4OJYA 1T8QA 1UR2A 1V3HA 3W02A 3FIGA 1TJRA 2ZWYA 3CV6A 4UQ9A 1FY6A 5IHRA 5FESA 2VVNA 1XLFA 1KXQA 3OGRA 3E38A 3LHWA 2GK1B 4W88A 3F4DA 2WZMA 1VEPA 1LL4A 3R13A 2GJXB 5AFDA 3Q37A 4RUBA 3KBNA 3DBPA 1GEUA 3MWAA 3H23A 5DXXA 4CVWA 1F2JA 3BURA 1UR4A 3STEA 4P61A 1WUFA 3CLWA 3TZNA 5D38A 3U7BA 1IHIA 5FD0A 4WDXA 3LRLA 2I14A 4YTRA 4QIUA 3BSGA 4H1ZA 4J7RA 2WC7A 1KFWA 5K9XA 4AX6A 3A3WA 2DSWA 1LG1A 3C0LA 1Q45A 4HCDA 3AC0A 3QW4B 1DJZA 3ALFA 4Y2WA 2XWEA 1KKRA 2VYOA 2UBPC 3ITCA 4GJ1A 5BNKA 3FS2A 4H2CA 1C8VA 1VQTA 3DDMA 5D04C 3RMJA 4JIIX 3UJRA 5GJNA 1TQJA 2O9TA 1YEYA 1I1XA 3XIMA 1H41A 1TV8A 2X09A 2R1KA 3ARSA 1C93A 1OT2A 1TPVA 3CQKA 1M53A 4DZIA 2DZTA 3UP8A 4H6KA 2GYIA 3N2OA 2QCDA 4A2RA 4IX0A 4A3HA 3W1QA 4ML9A 1RP8A 1GV4A 1QPNA 3B4UA 1W1IE 4ZGYA 2GQ3A 3WD2A 1QNSA 1V51A 4C1NB 3H26A 1DORA 4ADSA 1I6NA 2WVSA 3P14A 2BHUA 3DENA 4FAMA 1HJSA 3AU2A 2HNHA 2J3NA 1YXYA 1BGGA 5EFFA 3S2MA 5AZ1A 5C0QA 1SFSA 2P5NA 4UFLA 4B5WA 2Z6JA 4O4VA 1WYIA 4ERIA 1XDJA 1E6PA 2DH3A 4UFKA 3LY0A 4GBUA 4DO5A 3TYCA 3VNIA 3ITVA 4GUGA 2ZQ0A 4N6EA 1JDEA 5LGXA 4I5RA 3L66A 1PIFA 1XWYA 1N7KA 3WD1A 4ZA0A 1HJQA 4WDTA 1W31A 5BCAA 3W1LA 4AMAA 4U3AA 4ZMGA 1RY8A 1MQRA 3UY8A 3FLUA 3VE9A 4PN2A 5ABEA 4X0VA 4CQ9A 1WXYA 1B3ZA 3GC5A 3F5JA 4N4PA 1EJ7L 4Q22A 3G3DA 3TMQA 3L4XA 3VKDA 4POCA 3SCOA 1ZENA 4AISA 3W07A 1VFMA 4QR6A 1W5PA 5BROA 3IS4A 1H7NA 4PCSA 1IZKA 3HJZA 5KZEA 2I17A 3FNDA 3GZ3A 3IGHX 2GUBA 3CB8A 3SR7A 4WJ8A 2O9PA 2P88A 1GVYA 4XD3A 1D3GA 1KM3A 4BZYA 2G37A 4FOUA 5CZSA 4H19A 3VD7A 5FJPA 4NHVA 3GX9A 3MHUA 1LBLA 2XVNA 1GRHA 4C5YA 1C29A 3WX7A 1X8CA 3G1SA 3ANVA 1VJZA 1LWHA 1FIQB 3HO8A 2Y62A 3PBVA 1MO0A 5M17A 5KVIA 4EQWA 4H8VA 1H7WA 1OIMA 3EMCA 3SCVA 4RZ5A 4I8DA 2P1FA 3GYCA 3PFRA 3KOXA 1YW1A 1XLLA 3STGA 3NQBA 3AU6A 4XAGA 5LYRA 3M7WA 4XZNX 4DBEA 4IPNB 4PB3A 2E1DA 2RDUA 4WIWA 3SJNA 3PJUA 2ACRA 1BYCA 4TVUA 4FNRA 3ITOA 4QAIA 3RO8A 2VFFA 4FXRA 1NHPA 3PULA 3GTHA 2WOVA 1P0BA 1SZNA 4ZBCA 4JY9A 1EPVA 2W61A 1XYAA 4GYJA 1AQ0A 2YCKX 1L6GA 3BOXA 5AHFA 3TTYA 3PVFA 5J04A 4F0MA 3R43A 3KDOA 5CAHA 3G6LA 3PR2A 3OVQA 1XFCA 3T6CA 1MRQA 3BICA 3HA1A 4QP0A 2DV0A 1ITXA 2MANA 4IFOA 1F73A 2C14A 1VFTA 4Z2LA 3B8TA 3GU9A 1ZXIC 2OG9A 3AHZA 1A5CA 2ZZ3A 1XLCA 5CBBA 2CKSA 1KTNA 4PUWA 4U2ZA 3C2FA 4NF7A 4CNSA 2YA0A 4NZFA 1YTKA 2PBGA 3AMZA 2J25A 3GR7A 4K7VA 1O60A 1ZZMA 3APGA 2WOWA 3B0YA 3KVLA 1RPXA 2JIWA 4L65A 3W7GA 3RHGA 4S39A 1MXDA 1EXBA 3CS2A 3C52A 2TODA 4XAZA 3LRKA 2XVKA 5A8GA 5DQPA 1UMLA 2PCQA 4FPSA 3UZYA 1MDLA 3BCDA 2INEA 3A24A 4HYWA 5D2XA 3WEZA 4W7VA 1X98A 1TV4A 4WY0A 4JN8A 4AY8A 1GPFA 4UTKA 1XYZA 3GRTA 1T41A 1NIUA 2DFAA 4MAVA 1EEXA 5A94A 3G22A 3VGDA 5CJMA 1OC7A 2OGYA 2DPEA 1UD3A 3T42A 4JX4A 3LRMA 1QVBA 1QPRA 1XPYA 1EGZA 2CYGA 1B54A 3VI2A 3MWCA 3VOFA 4L6HA 1EF2A 4LYRA 1OYAA 3EWZA 1OJXA 1CGUA 3LNPA 3VAVA 3CV1A 3PJXA 3VD5A 3K46A 4TU1A 1X6UA 2X8GA 5FA5A 4C91A 3KP1A 3PZUA 2QNEA 1QK2A 3LBOA 3S4TA 5D33A 2ZUMA 1CXIA 1DJWA 3NQ2A 4I7VA 1REQA 2CLMA 1KRBC 2RGMA 1FCVA 3VC6A 1YKWA 2KZHA 3UZJA 3UA3A 3WMLA 2QDHA 2X1TA 3DKJA 3IJ6A 3FOKA 1PHWA 4IGNA 4ROQA 3ZJ7A 5DCEA 3H7VA 4OKDA 3KOZA 3W7CA 2XH0A 4S3AA 1Q7MA 1XBXA 1EO5A 1N2VA 2J9XA 1WDDA 4ADTA 2PC8A 1FVPA 2DVTA 4GVFA 3B4YA 2GQWA 3ERPA 5FJOA 2QLYA 4P2VA 3B9JB 3GHUA 2HE8A 4JKLA 1QTWA 2ON3A 3PB0A 3GVQA 2ZXAA 3ORWA 1YYAA 2DSZA 1K7FA 2RDXA 5CZKA 1JJKA 1XG4A 3W6YA 3RNMA 2XTKA 1JD7A 1E4NA 2C1HA 2UY4A 4ZCWA 3BZGA 3S1UA 3CNYA 2WQDA 1ZAJA 1NAL1 1H2JA 7A3HA 2I56A 3FX4A 2GDVA 2NV2A 2NQZA 3UWVA 3WFLA 4BY3A 2C19A 2XGIA 4ONVA 3MMTA 3NL6A 4DEFA 1X2HA 4HYVA 2PDIA 3E2SA 1PV8A 2CZDA 1KGWA 4EPDC 4A3YA 3N73A 3NVWB 1ZUAX 4Z1AA 5K4XA 3IIPA 1B9ZA 1BWVA 3A12A 3TLLA 5JCMA 3TNBA 1KXVA 4H4XA 1K1DA 2YXOA 4PL1A 4UMAA 3I6RA 3VGGA 5H91A 3ZLHA 3CZ8A 1PZ1A 4GZ7A 1KLYA 2NVAA 2R24A 4D6JA 1LZOA 1PYMA 3V5FA 2J79A 1W8SA 4MM1A 4FS9A 1TFVA 5EA9A 2BY2A 4FIRA 4QDPA 3QMSA 5HNTA 3A13A 3FAWA 4GO8A 1H6VA 4YJ5A 1EJUC 3BV7A 1XV8A 1TPWA 4UTFA 1JZ7A 1RA0A 4ADUA 3TCEA 1ISVA 3VC5A 1A5LC 4UUIA 4MWAC 4AAJA 3S9ZA 4PEEA 4WJEA 1IXOA 4ATLA 1IT8A 3NWRA 1N60C 3W1RA 2GJRA 4C6OA 4S3DA 2ZX9A 1M68A 1DWIM 4J2PA 1J18A 5FS8A 2DT1A 3ATYA 1MQPA 4M51A 4MG4A 3KL3A 4AF0A 2GVJA 1XF0A 4M3PA 1PE1A 1J5SA 3C3NA 3TQPA 4CN4A 4B3KA 4DJFC 3M07A 2F7FA 4YNGA 3LB8A 5U4NA 2XFRA 1FH9A 4GGHA 3MY9A 4QJ4B 2WNNA 4RE0A 3MQTA 4LU0A 2YL6A 3R58A 5LNWA 1DL3A 4DELA 4ZSUA 1OC6A 3TXVA 3VNZA 1RSCA 5DRIA 1UKOA 1R7OA 3HV8A 1T7LA 5DMNA 2W5FA 4LUJA 4YPJA 4G2DA 5RUBA 2E4TA 2WQPA 3NVVB 1WBJA 3PSVA 3PFMA 4RPQA 3ABRA 4PMXA 2JKEA 1XHCA 1A5UA 4WGHA 1UB3A 4H9UA 1JQXA 3WNOA 4UXDA 4E2DA 5GVJA 1QR7A 3U4AA 1L9WA 3CGEA 3SQMA 1FO4A 4LUTA 1O5QA 2XVGA 4JX6A 2PTZA 2IMRA 2WCGA 3AWOA 2GUYA 4LCSA 1DWGM 1JQVA 2G3JA 3ZJ6A 1XS2A 3W53A 4H2HA 4WY0B 2WZIA 4EMWA 5F2IA 3WQDA 3VCRA 3VNJA 1TCMA 5E0FA 4NJJA 3SECA 3ZJKA 1L2QA 3CAKA 4TVDA 1TPH1 1FHUA 4KEZA 2DT2A 6TIMA 3NOYA 4DAFA 1ECQA 4GX8A 2E5AA 5E5CA 4YTTA 3PY2A 1PKNA 1OCJA 1XICA 4MNLA 5T26A 4I5UA 3STFA 4AEOA 1HQTA 3LENA 5D2TA 2Z1BA 3I68A 2ZX5A 4IQDA 3B8SA 2CBIA 4ICCX 2XH2A 3VNLA 2HQAA 3S9YA 3PZOA 4MFDA 4PCFA 2PFHA 1FQ0A 2EPOA 1LT7A 3H7RA 3R1ZA 1LBFA 2C3ZA 4MIMA 3PF3A 3OJGA 4L5ZA 3IJ9A 2IKGA 3G2GA 3U8GA 1ICPA 2QCCA 1G94A 4JHOA 4NNAA 3NR0A 2OZTA 3CWOX 3BGAA 1PZ2A 3SUTA 3LBCA 1YXCA 4Z1CA 2H8ZA 3I3EA 3BLLA 1SZEA 2QEZA 4FZIA 5FEWA 5EKYA 4JL1A 2QT3A 2HVOA 1XYFA 4UMBA 5E0CA 3SCNA 1YBQA 3AN1A 5AVHA 3O7UA 1JPKA 4AD1A 2CLIA 1XLBA 4IJRA 3AJ7A 2QZRA 2NT0A 4K37A 5JBDA 1TKKA 5ABGA 2ZX8A 5HOSA 2EPLX 1UA3A 1J0IA 2EPNA 4B3LA 4L1XA 2YOCA 3WH5A 1I0BA 3H54A 4DZHA 3H2AA 2YLAA 3M4HA 1OGSA 3APTA 1JR1A 1UZHA 1VGAA 2D69A 3XISA 4J3VA 1OT1A 3CHDA 1IQ8A 1M65A 5IRPA 4JNMA 2E9LA 3GHSA 4IP4A 3QW3A 3KBSA 4MJMA 1JZ6A 1GVIA 3WFAA 3DHFA 4EAMA 4A22A 8TIMA 3OZMA 1XYMA 4EVZA 4MZ8A 4UNKA 1J2BA 2C1GA 3LQGA 3RR4A 4KFNA 2WHJA 3HGJA 1FTXA 4Q8TA 3OG3A 2WPGA 5GJPA 3WQFA 2B4GA 2GRTA 3S5NA 1W32A 2D24A 3KXQA 3G0UA 7CGTA 4U31A 4ICNA 3WQ8A 5JUVA 2XIMA 2PDQA 5FF7A 3WBEA 4JFTA 2V3BA 3QGKC 3TR9A 2HEJA 1CENA 1ME7A 2VRQA 4YWSA 5DANA 4ZTYA 2V5JA 3LHUA 4GFIA 1O68A 1VRDA 4UR7A 5IM51 4B91A 4LF2A 1SJBA 1Q6OA 2D3NA 2E09A 2REQA 3L67A 3L4ZA 1IT7A 3VMOA 2YBUA 2CBVA 1AD4A 3A9BA 2Y70A 3NO5A 3EDFA 1BYDA 1XQLA 2XM2A 3MHGA 3STPA 1XIIA 1CT5A 2C3CA 4XISA 4EP8C 1NSJA 1CEOA 1B57A 1GXFA 3VNYA 5FF0A 2HWGA 3VKBA 8A3HA 1UKPA 4W5UA 4NX5A 3NVDA 1TSIA 1FHDA 1JEZA 4O57A 2Z1VA 4TV5A 4TR9A 4FR1A 3E2VA 5CEWA 1VCGA 5D4YA 1XLKA 1GCYA 3M0YA 2X0YA 4NRRA 4GYKA 1AFSA 3AFBA 5CSSA 3RO6A 1BVZA 1WP6A 2C6QA 4Q8UA 1FRBA 2Z26A 2QJHA 2J7FA 4LEFA 4L6DA 3KFTA 1JD9A 3II4A 3A7AA 4NZ1A 2QCLA 1WZLA 2RAGA 4O11A 4HU8A 2WZEA 3I6TA 1UP0A 1B90A 4DQWA 9XIAA 2Z25A 4REQA 5LXXA 3OOQA 1V02A 4DJDA 2VOTA 1JCNA 5CC6A 1YHTA 5K9CA 4HHLA 4EOUA 3N19B 4A4AA 2E40A 4ZO7A 1KM0A 3FKRA 4P8XA 2V2CA 3L5LA 5AHNA 2ZC1A 3BW4A 3CV7A 3NQMA 4XSLA 3HM7A 1OX4B 4IIBA 3AS3A 1E1EA 2YBVA 5BOOA 3JUGA 3SW6A 1P0NA 1TE1A 1ZJIA 4QDMA 3GRIA 4GKTA 5C70A 5D37A 2A79A 3QQ1A 4GI9A 1AW2A 3EB2A 4HPXA 1DQWA 3S0CA 1A5OC 1BXCA 4H7VA 3B3DA 2AGTA 3THCA 2E25A 2WV8A 3U4FA 2VXNA 2BY3A 1V6XA 1KBBA 3EYPA 2QQ6A 3CZJA 3ZOAA 2PUZA 3A64A 1S38A 5C9UA 3P6LA 2D23A 2PURA 2NQ9A 1DKWA 5TBOA 1WDPA 3CH9A 1US0A 4PYSA 4GISA 4PULA 4Y90A 3K30A 1BWCA 3GHRA 2PS2A 1OK6A 1XC4A 3B9DA 2O7QA 2FGLA 1GYMA 3HPAA 3VM5A 2CLLA 1UWQA 3NJ3A 2BBFA 2FKPA 4D8ZA 1RPKA 1H1NA 3H4GA 1RH9A 1HVQA 4AZCA 3HBLA 4RPPA 3ZSTA 1RVGA 1NJJA 5HBFA 5KETA 4LCQA 5I0DA 1O6IA 1IEQA 3G1DA 1YQ2A 4GIEA 1A3XA 5MHBA 3GDRA 3OHIA 3GYEA 9CGTA 4WKHA 3DK4A 3WD4A 3E96A 1MQQA 3NTYA 2EG7A 3SRDA 3NQ8A 2PD5A 4IMAA 1C8QA 5EFDA 1XJBA 3E3HA 1UKQA 5GRTA 4RXFA 2EQ6A 3NXFA 1TTIA 1G67A 3WH9A 4O1BA 4WF7A 5AZ0A 3NQEA 1H4PA 1WXJA 3KAOA 4EX4A 2G95A 2J4GA 3LN3A 2WBKA 5B7ZA 2DVUA 4DUWA 3L8KA 2ZXBA 5LA2A 3KCJA 1TMHA 4K1WA 5AOUA 3L4TA 1NQKA 2QJGA 3UYIA 1EWEA 2Q6ZA 3W7IA 1EQPA 2IPWA 4F4RA 2Z2BA 1U30A 2GH5A 2YVJA 2FQIA 2V5LA 5ENLA 5I23A 4S38A 1XYCA 2ZZCA 1Z69A 4LUTB 4AEFA 4FXSA 3LB0A 4F40A 1ONFA 3EX4A 3TYBA 3TCSA 3BUVA 4QEHA 4JXCA 3ZVHA 1F6YA 1EJXC 4CCZA 1R3QA 4UCFA 4UTMA 3TN3A 3SB0A 2YB1A 3MBDA 2A21A 2QPUA 1BRLA 3THDA 3TNOA 2ZOXA 2FJUB 3PK7A 1NF0A 5AYZA 5BRPA 3K8LA 1KM2A 1TWWA 5AECA 3QFBA 4A8NA 4NXKA 4PRRA 4UOJA 1J79A 3NVYB 1T3QC 4XAFA 4NJKA 1TYPA 1XM3A 3T40A 1VF8A 3S3GA 1QFEA 4TOQA 3RCNA 3SGZA 2ZCGA 4NT0A 1SMDA 3S47A 2OJPA 3IJIA 3IACA 2DQWA 4CNTA 4DJFA 2AAAA 4EXAA 1OX4A 2BVWA 1KFKA 2BVTA 3AHYA 4TXEA 3L68A 3SGUA 3UCCA 2VQTA 5K7JA 2DGAA 3TIMA 5D02A 4G9PA 4O19A 3DYPA 1NWSA 2V6AA 2DY3A 4CQDA 1U22A 3DZ1A 4E3TA 4NAFA 3E5BA 2GWGA 2WJZA 4GRTA 2TSYA 1F6PA 1KR1A 4TVWA 1JEHA 5CZ0A 1PX4A 1E6XM 3OVPA 1SW0A 1RR2A 3CIVA 4AWUA 1SO5A 2OR2A 2NUXA 2ATSA 2CITA 1HKMA 3F4CA 4AG0A 5AC8A 4RW5A 3IV8A 3WJSA 3TYEA 3P8JA 2H9AA 5F1UA 1GRGA 4JTHA 1LLOA 4G8TA 2VP8A 5AYBA 4K8EA 5C8BB 4KWSA 3L0GA 3VKCA 4US5A 4YLWA 1UIPA 3T0DA 2F6XA 1UZ4A 1NDZA 4R33A 1QCWA 4LALA 4HVXA 2AGKA 2HV5A 4JFWA 3ANYA 2OEKA 3N2TA 1EP1A 4BI7A 2VL4A 4U10A 3O06A 4CD7A 3RCYA 3FSUA 5I06A 3PUGA 5A2CA 3WK1A 4TX9A 2E9MA 5LNRA 1MWOA 1E5NA 2V8ZA 1W5NA 4FDCB 4OZOA 2PLKA 5LIKX 1AOGA 1VFSA 4XG1A 3T55A 4LVGA 4NEVA 3IC9A 3OZOA 2GK1A 1PKLA 3WBXA 3UERA 5CC3A 4Z1YA 1B30A 2HBVA 1CZ1A 1SSGA 4DVOA 4ACZA 4IJBA 1VFLA 4WSHA 3B8WA 1L6WA 1RD5A 2XH4A 3R8GA 4E8DA 2FVMA 1YQZA 3K4AA 4ZOBA 5I77A 3R11A 1TZ7A 2YQUA 1HUVA 2P10A 3M5VA 2JF7A 3B0UX 3N9SA 4UNLA 4FX6M 2R1NA 2FH8A 2I5IA 3TN6A 4H6QA 1JZ2A 4QXIA 4L4LA 2OPJA 2QDDA 3I7QA 1JZ3A 3NGFA 1NFPA 1H49A 1WKEA 2NLIA 3RRAA 4FX8A 1SFJA 2QXWA 1N82A 2E6YA 2FMNA 1G6CA 3GUWA 1AVAA 3PHAA 4MGGA 1O4UA 2YCLB 5A69A 1NTHA 4DO4A 1F7BA 1TPC1 5FF3A 4J57A 4UQEA 3L9CA 1UWTA 3A4JA 1V0LA 4D8LA 3BAIA 4LRTA 3HG3A 3SCQA 1VD6A 2PTWA 3TWAA 3AXIA 3BANA 4UBPC 2J78A 3GG7A 2QUMA 3UEQA 2QV5A 2OX4A 3UPWA 1OCBA 3HN3A 5LNSA 3GFYA 4YTSA 1B3WA 2IPJA 1DXLA 1MOKA 2TPRA 3OTRA 1K6WA 2IQTA 3D9XA 3LCWA 3EMZA 3NZ1A 4GRSA 5EBUA 3NL2A 3MUIA 1K02A 2A3EA 4E38A 4QBXA 2VENA 3W7PA 3GR8A 4AZCB 3DEQA 3C61A 2NSXA 3G8EA 4NAEA 5I2UA 1EP2A 1QNOA 1X97A 1AL8A 2OLHA 1CIUA 1CXHA 3EWXA 1QAPA 2V5DA 2REQB 1JI2A 4PE8A 1FFRA 2FDSA 4WUIA 3SUVA 1OFEA 3VD4A 2FJKA 4EIVA 1WV2A 2CZ5A 1KFLA 3QN3A 5HJLA 2X0HA 2BY0A 3A5VA 5I78A 1C92A 1YADA 5AC5A 3RMEA 4K7YA 5J8LA 3UJFA 1XFBA 4Q8OA 3RK8A 1F3TA 4GPNA 3SRFA 4LYQA 4HNLA 3RU8X 4A8IA 1ZHAA 5FSEC 1Q1WA 4PA8A 4GX9A 1BTCA 4M6QA 3L2IA 3LPPA 1CLXA 1Z9AA 2WNZA 4GK8A 4AZIA 1S1RA 2P0IA 2AKZA 2VELA 5I3HA 2HPIA 2V5CA 3GC4A 2Z29A 4X2RA 1T99A 3URBA 1XGEA 1U2YA 5H6HA 4US5D 1OFDA 5G5GB 3CZLA 3O6AA 4IFKB 3BGGA 1LG2A 1Z32X 3EKLA 1W56A 2WSKA 4JKKA 4K2SA 3SIMA 1F3EA 3WQEA 5FS7A 2HK1A 2J7GA 3U2EA 2ZRZA 3A4WA 1E0UA 4M29A 3YPIA 2RKXA 1EDTA 1GQJA 3E6EA 2QJJA 4JTRA 4PSRA 3W00A 5HQMA 1J8VA 4V28A 1PEZA 1U1HA 5EB8A 1XH1A 3BQ6A 3GLCA 5TIMA 3AMKA 2YFOA 3LI0A 1VLWA 4I9JA 4DUXA 2HISA 3KCOA 1LOLA 4HOZA 4JDYA 2HMCA 4OBTA 1Q6DA 4JQ9A 1VP5A 4FEZA 4N6FA 4MNMA 1C9WA 3W1UA 3H2EA 3HMJG 5LIUX 3QLLA 5HA7A 2XHYA 5E70A 4IJCA 3QY8A 4RZ6A 3AROA 2HS6A 1OX6A 3SY8A 3GFZA 1DWAM 2QUUA 4JYDA 4J56A 1HJWA 1JROA 3HGOA 3CAVA 5I3IA 2GOUA 4IIHA 4PTDA 3OYZA 3EXSA 4JDBA 2VMFA 3PS7A 1G4EA 2GJLA 3ZWTA 4BJHA 1JNDA 1KRCC 2GSHA 1A3WA 3JW7A 4KRUA 1C3FA 4M81A 1JNEA 3AIWA 5LA0A 2ODOA 1EJWC 5D9PA 4C6PA 2F9RA 1GYNA 1S3HA 4LAMA 2ZZ4A 5GNYA 4JTFA 1VFOA 2PWEA 3B9NA 1ZDLA 4N02A 4NAFB 1VBRA 2EJ1A 2WMFA 3F2DA 4GE8A 4M7TA 2GWNA 2Y5SA 2BXYA 4ZXOA 1MVYA 4C6BA 5MKGA 1JVNA 2YYTA 4L9ZA 3HGRA 2JKAA 1JUKA 2V68A 2PMQA 1UZDA 2V82A 5DRCA 4GXPA 3C0SA 2WK2A 2NV9A 1CI1A 3H55A 3L5MA 4AXNA 4RX0A 2P76A 1A5AA 4YYFA 4XVEA 5AC7A 3GVGA 3SY1A 1CNVA 3UCQA 1KBKA 4CQ8A 2BSLA 3CU2A 3DG7A 4OBRA 2BTMA 7TIMA 3BZJA 4IMCA 4IMGA 3WELA 1LDCA 1V59A 3F03K 4OFCA 4AIUA 5CQ1A 5U25A 1TMLA 1QW7A 4OGZA 1PIGA 3KLKA 2A6LA 3PBUA 5DMYA 2PPGA 4DF1A 4P8VA 3SGGA 2ZDRA 3PM6A 4K38A 2HDJA 1DJIA 2A3AA 1B3YA 3IVTA 4UTJA 3BLEA 4KWOA 3SFKA 4L56A 3B8IA 5CPOA 2PZNA 4B3ZA 4WKFA 4QEEA 4V1XA 4GBDA 4KW2A 1LBMA 2OGJA 4CQBA 3G1YA 3A7UA 4XQ6A 3N9KA 1ADOA 3KZSA 3CM4A 1F8IA 5EYWA 1TRDA 1YTEA 3P80A 4HNOA 3T08A 1WKFA 3MUXA 1M9HA 3WJWA 1GJUA 1RBAA 2GVGA 2CESA 2I9UA 1AUSL 4LS2A 4NASA 4PUMA 1FXPA 1R3WA 3IUHA 2WWCA 3FXGA 5CC5A 1MNSA 5BXSA 2OLAA 1KQZA 1DXEA 3NQFA 4NZ5A 2VX5A 1B5TA 2WSPA 3CUXA 1G9HA 1V93A 3B06A 3BGJA 5JMUA 1HGWA 5EBAA 3R6IA 3KX6A 1J4EA 4KMQA 2YDAA 2O0TA 1EL3A 5TD4A 3AS0A 1JXKA 4X22A 1QNVA 3GO2A 4WHBA 3USBA 3P82A 4NJGA 3ANUA 4O50A 4LANA 3ZQ9A 4NZ4A 4XTIA 2Y61A 4JY8A 5BZAA 1CGVA 1H60A 1HNYA 1SZRA 4IP7A 2WM1A 4JTQA 1P7TA 4LUSB 3R25A 3RN6A 5H8MA 1GNXA 4HMDA 1J11A 2BLEA 2YL9A 1EDGA 1SPQA 1XDLA 1EHAA 5J5DA 2XGBA 1S5MA 4DXKA 3P8IA 4JYEA 3CXBA 2VWSA 4JTLA 3WQWA 2WP6A 2XN2A 4H4ZA 2TPSA 2VGFA 1NDYA 4PTMA 2VGGA 4HK5A 3QYSA 1UR8A 4Q32A 4PB5A 3CBWA 7PTDA 1R85A 5CC7A 3NXLA 3KVJA 1V08A 1Q66A 1YDNA 4MNJA 1IXPA 4GG9A 4GXWA 3QV6A 5HNNA 5FS6A 1PDZA 1UIOA 1F05A 3W70A 1IXQA 1K4GA 1NP0A 2C16A 2WJEA 1UASA 1TVNA 5IBXC 5IDZA 1JZ8A 3VCNA 3KBJA 3KOWA 2FZMA 4IIFA 2QYGA 1GRTA 2PGFA 4HZ7A 1K7EA 2H90A 3EANA 1FWDC 2XZ9A 4AWTA 4EACA 2BB0A 3VIGA 1LUCB 4J28A 3WF2A 4DWSC 4XSMA 2ZZ0A 1POJA 3NYZA 1A49A 4RCXA 3BC9A 1M7JA 4KQNA 2PU1A 2Z6IA 4J4KA 1GZ1A 1E6QM 1C9DA 2J7CA 4ERGA 4U5KA 3H2CA 1XIFA 3HQPA 3W88A 1E72M 5D9NA 5JBFA 1R3TA 4EKJA 4XIAA 4E4PA 4E6MA 1BKHA 3DH7A 3CQHA 2AL2B 1AW5A 1PAMA 1B4KA 2CLPA 1X38A 3JZUA 3WQGA 5CPLA 3O07A 2V3GA 2VD8A 4AQLA 4O53A 3W29A 1DOSA 1F8MA 2OSYA 2H3DA 4EF8A 2RUSA 3T05A 4LYPA 1KXHA 5DMLA 1U1JA 3N4AA 2ZFAA 4HA3A 1P6CA 3R8HA 4F2BA 2NUWA 1KW1A 3AISA 3QPYA 1VFFA 4D6EA 1GG1A 5CPSA 3DJJA 2A85A 4MB4A 3S2CA 2PBOA 1VEOA 2OVLA 3V1PA 1K9DA 1E1FA 1TUXA 4FX7A 4B92A 1I9CB 3O1NA 2CU0A 3RM9A 3RCMA 1XUUA 3IPWA 1US3A 3AXHA 1U5HA 1W3IA 5LIYX 4QSHA 1N8IA 1N5XA 4FLOA 4HOXA 1GEQA 3NSXA 1R86A 1AMKA 2X42A 4WSKA 4J9JA 3WJZA 1YRRA 7XIMA 1D2KA 1W5QA 1XDIA 3QOKA 1VLIA 1XIMA 5LNVA 3BMVA 4FMVA 3L5AA 4G56A 1A4LA 1X1NA 1S3TC 2L5HA 3C0JA 1XCXA 1H5YA 3DK8A 4J5NA 4M0XA 1R9XA 1OWQA 4GY7A 4US6A 1ODZA 1MZRA 3EOOA 1FWIC 2PSNA 1PIIA 4GZJA 4JTUA 2EGZA 4AIOA 3SCRA 2VCCA 2PDFA 3MC5A 4YHGA 2QCMA 3K4DA 2D2JA 3SCWA 1P1XA 5A6SA 2BGQA 1I2QA 1JIBA 1Q3NA 4PH6A 4O15A 4MJ2A 3CEPA 3CO8A 2WWDA 4HN4A 2QCDB 2QULA 1HKWA 3BLDA 2Z0IA 2WOIA 3R07C 3NUKA 3WQ4A 3QM3A 2AAMA 3LS9A 1H7XA 5CXPA 3MZNA 3CGCA 1W3KA 2ZRVA 1JCMP 2YYUA 3T78A 2OT0A 1ZQ5A 1PCKA 4DBSA 1Y7VA 4LYKA 6ALDA 3G77A 4MF4A 3TOPA 4XK2A 1KFJA 2QHAA 4MZYA 5CPTA 4IPPA 2FZNA 3NQAA 4ICMA 3RYSA 4MTVA 3DN5A 4P8WA 1J6PA 1RBOB 3WFZA 3CQ0A 1Q6EA 3DAQA 3P5ZA 3W2UA 3WF1A 2VC7A 3NAVA 2VZTA 3FHAA 3UPBA 5FS9A 2Y88A 3CPGA 5FACA 1UQZA 1E0WA 2Z1KA 1BQCA 5AYIA 4CN1A 3MMDA 5LGZA 4APNA 3PAJA 1EJTC 4DAIA 3R7MA 1E1CB 1VZWA 3ZLFA 3AIQA 3NSMA 4CCEA 2TYSA 2ISSA 5A8OA 5BOEA 4EPKA 3SN1A 3PZNA 2FH6A 3OQEA 2WW5A 3KBMA 3WLHA 4L9XA 5CGTA 1OJTA 2CLOA 1OQFA 2NX9A 3LLFA 5FI8A 4PBEA 4ZQMA 2QAFA 2X1SA 4XWUA 1XYLA 4D2JA 3P74A 2CZFA 2VFGA 4RR4A 2DP3A 8RUCA 2ZE3A 1E6RA 1BQGA 3I10A 2NXHA 1SR0A 4UTHA 4R9XA 4JCMA 3ARZA 1ZBVA 2CPUA 1T5AA 2PCEA 4X3ZA 3GE7A 5CH9A 3KS5A 2XN1A 5DXYA 1RCXB 4JTDA 3AQUA 1AA1B 1QOPA 3R4IA 3VIHA 3TC6A 3K8MA 3KRBA 3L4VA 2P53A 1R38A 5F7UA 4KCUA 3RDKA 1XLDA 2DJLA 3GTXA 1KC7A 1W2VA 1GESA 1UJQA 5IDIA 1ZFJA 4QE4A 4F2TA 4ZQCA 3U5UA 3HPXA 3IIXA 2WBAA 4TO8A 3HFYA 1E1CA 3TC7A 3JR2A 3W1NA 5F4XA 4LQ1A 5D2VA 1E0XA 1AQMA 3AS1A 3KHDA 3T0BA 2OQYA 4EXBA 3CASA 4RZ4A 3PZQA 1YDOA 2HCVA 1AH0A 1H09A 5BW6A 4BR1A 4XVDA 5J5RA 2ZX6A 1I45A 1J10A 4LAKA 3LV5A 2BMBA 4WCJA 4TTUA 3Q67A 3WLJA 1GHRA 4F79A 2FVKA 1Q4WA 2CHRA 3W26A 2QVNA 2VEKA 4YU1A 5CAKA 4MY9A 3IEBA 5T91A 5E0KA 2QCGA 1ZTVA 4XB3A 1BHGA 3H21A 1JF5A 3V4BA 1V0MA 2O9RA 5TNVA 4YVXA 1S2TA 3CT7A 3W2JA 3AIUA 3VUSA 1E6NA 1UQYA 2VHLA 3IJQA 3NQDA 2BOGX 2D2GA 4H7ZA 4UTIA 1XHGA 4J1OA 1E40A 2VGBA 4HHMA 4ZB2A 4AHOA 4KRTA 1BLIA 1N8WA 1U33A 1FUYA 2VZSA 2CZEA 5A5WA 3UESA 1J2WA 3MA8A 1GPWA 4GINA 4MY1A 1GOOA 1W9VA 4S3EA 4FNUA 4IWWA 4WSJA 4DB7A 3DH9A 3TW6A 1VYSX 2J13A 1CLVA 3LERA 2X30A 2W3ZA 1S39A 2FGBA 1SO3A 2PDLA 4MSSA 3N1AA 3RF9A 3WDHA 3C2VA 4JTJA 3TV8A 1FCQA 2HK0A 4ROPA 3EMQA 3TFCA 4A21A 3M6YA 5C55A 1KO0A 1UD6A 4GUIA 1CGTA 3LHZA 3ECQA 1GOXA 3VNDA 3WK3A 2EO7A 3TN4A 3POHA 5C71A 1HJVA 3TWBA 1IYXA 2ZZ2A 1QBAA 1KM6A 4DWSA 4RDWA 3DX5A 3ZWSA 3VGEA 4JTTA 4LVFA 4H4WA 4OBSA 2WZTA 1VC4A 3CUJA 3QZEA 5XINA 7ENLA 4U4MA 4OWGA 3FAXA 4FLQA 1WUEA 1LRTA 1ITCA 1VBJA 3RNDA 2GJXA 3NZGA 1A80A 4QG9A 4J3WA 1UHVA 1E15A 2DQXA 1KXTA 1JCJA 3FFSA 3RILA 2JEQA 4C7FA 1FKXA 2XYLA 2VKZG 4Y7EA 2DW7A 5BYWA 3SDOA 1Q2RA 2FIQA 4YVVA 3LDVA 2WMHA 1VPXA 3UT0A 3PTQA 2EKCA 4AD0A 3VE7A 1R2SA 2C1IA 4RE3A 4C6CA 1TVLA 3UNTA 3W22A 3LHYA 2JEPA 3ZR6A 3IVSA 1ZP4A 2Z4GA 4JNYA 2X2YA 3M5ZA 1RK5A 3OPSA 3E49A 3JVAA 1BFNA 1ONEA 3EX1A 3INPA 3VKJA 1PBGA 1OX5A 4DI8A 3H2FA 3IJDA 2CXGA 4Q8QA 1LVLA 3I65A 3DGZA 4RW3A 3KVKA 1IGWA 1AZ1A 1FOBA 1TWDA 3PNUA 1DTUA 4B5XA 3ZT6A 1W5OA 3LX9A 4F0KA 4FX9A 4F9DA 5K9DA 5IFTA 5GNXA 3VKAA 1WB0A 1XLGA 2PP1A 1ZK7A 1WX0A 5CG0A 2QKFA 2GSEA 2XSAA 5HANA 4FLSA 1J9YA 1E71M 4D71A 3F2BA 3E02A 1HL2A 4S1FA 3QY7A 4ML4A 1TYTA 4FNPA 2Y7GA 1QOXA 1JDCA 1TJ1A 4QISA 4DN1A 4UFIA 4ZQPA 1L2UA 3GKFA 3GNNA 3AYRA 4MUZA 3IRDA 4Z2GA 1FWTA 4QG6A 2Y63A 2XH7A 3DJGX 2WLYA 2TRSA 2E8ZA 3L21A 1JUBA 2WNWA 2OZ3A 4IG2B 4X60A 4PR4A 2IXUA 3V16A 1FH8A 1MW2A 3WNMA 4FO4A 2DZUA 4AIEA 3RM4A 3VNMA 4AYGA 3OLIA 1Y5XA 4GY1A 4E8CA 2G3IA 5FF2A 2ACUA 1DYSA 3F4NA 5BMXA 2J77A 1OYBA 3LPGA 3EWBX 3G6MA 3GRSA 1Y5VA 4ZZ9A 1CWYA 3HPSA 2BVDA 3Q65A 1RM6B 2WCAA 3M0JA 3WLQA 2ISFA 3UWZA 3RM8A 3GU1A 2ZTJA 4OTKA 5CPQA 1HT6A 2C7FA 4G5DA 1UUOA 2J88A 3S2LA 4JQ1A 4G6CA 5DBTA 1GQNA 1T6MA 2WC3A 4KGJA 5CSYA 1KM1A 3UYCA 1P7TB 2JALA 4EPEC 2G0WA 2Y8VA 4HB7A 1RA5A 2Q09A 2CWXA 1QHOA 4JYFA 2WBGA 1AQFA 4UR8A 2NVCA 1HGYA 1FP8A 3CTLA 4GJIA 3UG8A 1VIZA 5C9XA 2PDMA 4R5EA 1SGJA 1G5AA 2NZLA 3TFXA 2Y0FA 4S3KA 2YW3A 5D8ZA 3IJLA 4PMRA 3E0WA 2GUUA 3N6HA 3PWIA 1KWGA 3BLIA 5AN7A 4D1JA 3V75A 4LY8A 1NARA 4Q7BA 2XJ7A 3W75A 2B7NA 3AUJA 4Q8PA 1Q5MA 5KMYA 2P3EA 3S5OA 1MZHA