2V3BA

Crystal structure of the electron transfer complex rubredoxin - rubredoxin reductase from pseudomonas aeruginosa.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
381
structure length
381
Chain Sequence
b'RAPLVIIGTGLAGYNLAREWRKLDGETPLLMITADDGRSYSKPMLSTGFSKNKDADGLAMAEPGAMAEQLNARILTHTRVTGIDPGHQRIWIGEEEVRYRDLVLAWGAEPIRVPVEGDAQDALYPINDLEDYARFRQAAAGKRRVLLLGAGLIGCEFANDLSSGGYQLDVVAPCEQVMPGLLHPAAAKAVQAGLEGLGVRFHLGPVLASLKKAGEGLEAHLSDGEVIPCDLVVSAVGLRPRTELAFAAGLAVNRGIVVDRSLRTSHANIYALGDCAEVDGLNLLYVMPLMACARALAQTLAGNPSQVAYGPMPVTVKTPACPLVVSPPPRGMDGQWLVEGSGTDLKVLCRDTAGRVIGYALTGAAVNEKLALNKELPGLMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN REDUCTASE
publication title Crystal Structure of the Electron Transfer Complex Rubredoxin - Rubredoxin Reductase from Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 116
structure length 381
sequence length 381
ec nomenclature ec 1.18.1.1: Rubredoxin--NAD(+) reductase.
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF18113 Rbx_binding Rubredoxin binding C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.120 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2v3bA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2v3bA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2v3bA02
4YWOA 2R46A 4OVIA 3OC4A 1VG0A 2FJBA 1M6IA 2BYBA 2GH5A 1NHRA 4YSYA 1PBCA 1PS9A 1ZK7A 1O94A 1GXFA 3LOVA 1PXBA 1JRZA 2YQUA 2YR4A 2FBWA 1O95A 2YM2A 3CGDA 1AOGA 4I59A 3K7QX 5FMHA 2WP9A 2XFNA 2XLUA 1B37A 1E1NA 3LJPA 3NLCA 5EBKA 3C4NA 4CCQA 4H50A 5KOWA 2CULA 2AAQA 2XLTA 1CJ4A 2C73A 1CC4A 4EM4A 2YLTA 3AE1A 2VRLA 2RABA 3ALJA 1MXTA 1VDCA 3SGLA 4A5LA 5KVIA 2BC0A 2EQ6A 3K30A 1RSGA 3FG2P 4EQWA 1REOA 3LXDA 3QFBA 2GQWA 1EL8A 2NPXA 4H4XA 2C70A 2Y6QA 4YXDA 3NN0X 3VR9A 1ELIA 2GR1A 4H2RA 4U8LA 2IIDA 1D5TA 4U8NA 1Q9IA 2YG6A 4FDCB 1FECA 4OPDA 1GSNA 4BK1A 2B7SA 1S2QA 3KLJA 4J2WA 2ARDA 3NTDA 4ZCCA 3BI2A 3LADA 4A6NB 3DK8A 1ZOVA 1H6VA 2YLZA 3PS9A 5FS6A 1W4XA 2XFUA 3EF6A 2UZZA 2OAMA 2YG3A 2I0ZA 3F8DA 1KF6A 4OPLA 3V3NA 1PJ6A 1PBDA 2VVLG 1DXLA 5IQ1A 1JU2A 1E39A 5FS8A 2C65A 3AD7B 5EB5A 4H4UA 1BF3A 4AOXA 1PJ7A 2XFOA 3F8PA 3NHOX 4J33A 3AYLA 2BA9A 4A79A 1EL5A 3BHKA 3RNMA 4YSZA 4CBQA 2X3NA 1L9EA 1GT8A 1DOEA 3H8IA 5ER0A 4EIPA 3P4SA 4O5QA 2JK6A 1NPXA 2RGJA 2XFPA 3NTAA 2VRMA 4D04A 3ZDNA 2XFQA 3AEAA 2ACZA 1TYTA 1F8SA 1KNPA 2JBVA 2R0PA 1LTXR 4LA1A 4UP3A 3ATRA 3ITJA 2F5ZA 3GWDA 3AE3A 4APNA 2WS3A 4CCRA 1SEZA 2C72A 4H4RA 2C7GA 4I58A 5LV9A 1K0IA 3L1RA 1E1LA 2VZ2A 3UTGA 4JY3A 4H4SA 4B63A 3I3LA 4IV9A 1Y56A 3IC9A 2YG7A 5EB4A 3FIMB 4KX6A 1NHSA 1OJCA 1GALA 3VRDB 5HY5A 2V61A 2E1MA 3FMWA 2B7RA 4JY2A 2WP5A 2DKIA 2WU5A 2YG5A 1B8SA 4Z44A 2E5VA 5M10A 3AE8A 4N9XA 2YLWA 4D03A 2Q0LA 3IHMA 2ZZCA 2YLSA 1D4DA 4YKFA 4IA6A 4AOSA 3IWAA 3UKFA 3AE5A 4JN9A 1CHUA 3AE4A 1XANA 3UOVA 3V76A 2C64A 1NHPA 1OJDA 4JNAA 2QAEA 2B76A 2WPEA 3EPTA 4MJWA 4YTMA 2X8CA 4TLXA 5KXJA 1LPFA 1XHCA 2V3BA 5CQFA 1H86A 2BS2A 1EL7A 2BXSA 3CNSA 4YSHA 3AE7A 4EM3A 2QA1A 3P9UA 1H81A 1GEUA 1S2YA 4AP1A 2GVCA 1DJQA 1GV4A 3GYJA 4EMWA 3HZLA 1H84A 3OZ2A 1PBBA 3SFEA 5BVAA 3NRNA 1GPEA 2YG4A 4OPTA 2YAUA 1GETA 1E1MA 2Y6RA 3QSSA 4M52A 4NTEA 4GCMA 3ALMA 4TM1A 2BC1A 1GRFA 3EANA 1BWCA 1Y56B 2VQ7A 1NDAA 3G5QA 3LB8A 4REKA 1IUXA 2OA1A 2QA2A 1OJ9A 2WP6A 4CNJA 4EQSA 3UP5A 4Z24A 4B64A 1GRTA 1JOAA 2V60A 3Q6JA 3UOXA 1S3BA 2GR2A 2FJAA 1DJNA 1DODA 1ZKQA 2X50A 4ZN0A 3D1CA 3UCLA 3V3OA 1FEAA 3KVEA 1ZY8A 4J31A 1OJTA 2GR0A 4X9MA 4AT2A 2FJEA 1DOCA 1H82A 3KA7A 3LZXA 4U2LA 1GRGA 1ONFA 2EQ8A 1B5QA 2OALA 5JCMA 2BABA 2RGHA 5FS7A 2BXRA 3UTEA 4BK2A 5EOWA 1JNZA 1ZP0A 2BACA 1E7PA 4X4JA 3CNDA 2Q6UA 2FJDA 2IVEA 1LVLA 1TYPA 4NTDA 3NYEA 5BULA 3AD8B 1M64A 3BNUA 1Z6LA 3QJ4A 3UTHA 3DJDA 2JB1A 2B9XA 4UDQA 2XYOA 3BNMA 4C3XA 4Z25A 1QLBA 4Z43A 2XLPA 2WDVA 1QO8A 1D4EA 1F3PA 3G5RA 2XVHA 3LZWA 4DSHA 5HHFA 5KVHA 4GDEA 1PHHA 4U8KA 4U8JA 3KU9A 1CJ3A 1TDFA 2YWLA 3PVCA 1L0VA 3E1TA 3RP7A 4GUVA 4EMJA 2WDRA 3GRSA 3RP6A 2R9ZA 4GDPA 4U8MA 4ADWA 2Q7VA 5C2TA 1XPQA 3CN8A 3C96A 2W0HA 2GV8A 4IA5A 2WQYA 1GESA 1F8WA 1PN0A 1D7LA 3AEEA 2O9ZA 4DGKA 2GMJA 3AE6A 4P9SA 4J36A 1KSUA 3QSEA 2AR8A 3QVPA 2XLSA 3T37A 1K4QA 3G5SA 4B1BA 4TLZA 4K5RA 3ADAB 4U8IA 3AECA 3UKQA 2JAEA 1FOHA 4HA6A 2ZBWA 4J34A 5L46A 4A7AA 3QVRA 4JNQA 2OLOA 1CJCA 1YQ3A 4Y4NA 3CGEA 4TM3A 4K22A 3QSMA 1LQTA 1QJDA 2B9WA 1S3EA 2A89A 1YY5A 5J60A 2XVJA 2WEUA 2ZZBA 4U2TA 3DJEA 4XXGA 3NK1X 4Z2RA 3IF9A 2WU2A 2QCUA 3AEDA 2BS4A 3UP4A 3NGCX 3NKSA 4DNAA 3WE0A 4Z2TA 1H83A 3SQPA 4H4YA 4UDRA 1TDOA 3K7MX 3NNEA 3CPHG 4EIQA 3DK9A 3JSKA 2GQFA 2A87A 1V59A 3C4AA 1GRAA 2YR5A 5TR3A 1LQUA 4E0VA 1E1KA 5U63A 1K0LA 3CPJG 2B9YA 2WOWA 4RG4A 4O5UA 1H7XA 3P1WA 2EQ9A 4B65A 1P2HA 1F8RA 4YTPA 1RP0A 2WDQA 3VQRA 2BK5A 1FCDA 3GSIA 3CGCA 3AEBA 3P4RA 3UKKA 2J3NA 3ISHA 1GNDA 1OJAA 1TDNA 4TM0A 4CY8A 2XVEA 4YKGA 1L9CA 2XVFA 1CJ2A 1ZDLA 2HQMA 3DMEA 2DKHA 4KPRA 3EAOA 1KSSA 3UKLA 1ZMDA 2YR6A 3BI5A 3AEGA 4EQRA 4GR1A 3UKHA 3B6DA 1N4WA 3IHGA 3KKJA 4XWRA 4B69A 1IUTA 4EQXA 4BJYA 2V5ZA 3L8KA 1IJHA 1PBEA 2E4GA 2IVDA 4B67A 5KWFA 1IUVA 1PXAA 1PJ5A 3M0OA 4JQ9A 2H89A 1N1PA 4EMIA 2GB0A 1TDKA 4A99A 4FK1C 3NYFA 1O5WA 4CY6A 1K0JA 2C3CA 1CC6A 2CVJA 3FPZA 3AD9B 2X8GA 1JEHA 4RSLA 4USQA 1BGJA 3SM8A 5HXIA 3NG7X 4BV6A 1PDHA 4YSXA 4AP3A 2C66A 1NHQA 1JRYA 3CNPA 4H4VA 2WESA 3BI4A 4WX1A 2Q0KA 2WOVA 1LJ1A 4H4WA 1FL2A 2X8HA 5JCNA 5JCKA 4K7ZA 3KD9A 4Z2UA 2XLRA 3H8LA 4GF7A 2WETA 3ABVA 3GD4A 3AE2A 3DGZA 1YKJA 3DK4A 4OPCA 2X99A 4CRTA 3GD3A 3I6DA 2R4JA 2R4EA 4Y4LA 1LV0A 5IQ4A 1GREA 3NYCA 2YLRA 4YTNA 3NK0X 4FK1A 4H4QA 4A65A 3S5WA 4AT0A 2WPCA 2YVJA 4B66A 1E6EA 3UOZA 4NTCA 3ZYXA 3RP8A 3VR8A 5KOXA 3GYIA 2C3DA 2Z5YA 5DBJA 2V6OA 3NT6A 1X31B 4USRA 5KRQA 1BKWA 1PBFA 2R0CA 1DNCA 3ALLA 3DGHA 3O0HA 2R45A 3PO7A 1PXCA 3AXBA 1XDIA 1IUWA 2GEWA 4GRTA 3SFDA 4IVMB 2WPFA 4UDPA 1BZLA 4K2XA 1Q1WA 3RHAA 4RG3A 3REDA 3ICSA 2BS3A 2RGOA 5JCLA 4WCTA 1GTHA 2GRTA 1D4CA 1GTEA 4J56A 3COXA 2TPRA 5HYMA 3D8XA 4OPUA 3VRBA 1CBOA 2C67A 4ICYA 4Z26A 2XDOA 2GAGB 2GR3A 2VQBA 1ZMCA 3GDNA 4DSGA 1MO9A 1Q1RA 2VVMA 3DA1A 1EL9A 1CF3A 2YVGA 3GMBA 3ICTA 3QFAA 4CNKA 1KNRA 2PHHA 1TDEA 5GSNA 2R0GA 3R9UA 3UTFA 1N4UA 3M13A 3URHA 3UKPA 3H4KA 3ICRA 4X9NA 4LU6A 1VRQB 3GRTA 4FX9A 4BK3A 4OCGA 1TRBA 1ZX9A 3UOYA 2JB3A 3Q9TA 4PABA 3FBSA 4H2QA 1Y0PA 1F6MA 2APGA 1NG3A 3NK2X 4BJZA 1NEKA 1D7YA 4HB9A 4A9WA 1JRXA 1HYUA 3II4A 5C3JA 4C3YA 3BHFA 4ECHA 1CC2A 5BRTA 3AE9A 3KPFA 1NENA 5M0ZA 4H2PA 4H4TA 4XWZA 2GF3A 2PYXA 1JNRA 4H7UA 3NN6X 4TM4A 5U1OA 2XCGA 1NAAA 3AYIA 4J57A 4H4PA 3M12A 2VVLA 4U2SA 1B4VA 2YM1A 1GOSA 1FEBA 4NEVA 4U8OA 5CKUA 2CDUA 2WOIA 2EQ7A 3DH9A 3S61A 3NH3X 5FS9A 2GMHA 1UKVG 1YQZA 1GERA 2BK3A 2OLNA 3CPIG 4C5OA 2TMDA 1N4VA 2BCGG 4IVOB 3AYJA 4OPIA 1KDGA 2C76A 1DOBA 3DJJA 3ATQA 4YT0A 5IPYA 4BURA 1GRBA 1NG4A 1RYIA 3GMCA 2A8XA 1IUSA 3CIRA 4PAAA 2WBAA 2AQJA 2NVKX 2XVIA 4JDRA 3NIXA 4Y4MA 3P4QA 1ZOYA 3VRAA 4C77A 4H2NA 1VG9A 2VOUA 1CL0A 5U25A 2WHDA 1YQ4A 3AEFA 3B3RA 4NZHA 1BGNA 1COYA 2GAHB 2JKCA 3CTYA 4K8DA 1KFYA 1VQWA 4OPGA 2CFYA 3F8RA 5GRTA 5J7XA 4C74A 2C75A 4U8PA 3UKAA 4B68A 3P4PA 1L9DA 2YLXA 1IUUA 2H88A 1GRHA 3CGBA 4ZCDA 1H7WA 4K5SA 2BCPA 3GWFA 4LIIA 3DJGX 4NEWA 2Z5XA 2JB2A 3AB1A 2BK4A 1MOKA 4H4ZA 5JCIA 4A6NA 5BUKA 3CNTA 1EBDA 2YVFA 2ZZ0A 2V3AA 3AWIA 1P2EA 3CNJA 3GDPA 3K7TA
chains in the Genus database with same CATH superfamily
4YWOA 2R46A 1M6IA 4YSYA 4YWSA 1PS9A 1TKKA 3CGDA 1BKHA 3STPA 3LJPA 4CCQA 5KOWA 3SQSA 3N6HA 1CC4A 3H8AA 2RABA 3ALJA 4II3A 1VDCA 3FG2P 3FV9A 1REOA 3CAWA 1EL8A 3SN1A 2C70A 3NN0X 4H2RA 3T6CA 4IHCA 2YG6A 4FDCB 1FECA 1GSNA 4BK1A 2ARDA 3BI2A 3DK8A 1H6VA 3PS9A 5FS6A 1W4XA 2XFUA 2I0ZA 3F8DA 1PBDA 3QPEA 1JU2A 3TOYA 4H4UA 4AOXA 3NHOX 4GMEA 2BA9A 3R11A 5ER0A 4O5QA 3P93A 2XFPA 4D04A 2XFQA 1TYTA 3VA8A 4HCDA 4LA1A 2R0PA 4UP3A 3ATRA 3GWDA 4APNA 2WS3A 2C7GA 1K0IA 2VZ2A 2OX4A 4JY3A 4H4SA 3DEQA 2PP0A 3IC9A 1L8PA 3FIMB 1OJCA 4IP4A 4HNLA 2OKTA 1FFUC 3EEZA 4ROPA 3T2KA 2Q0LA 1N60C 4EWJA 4YKFA 3AE5A 4JN9A 1CHUA 4DWDA 3V76A 2C64A 1NHPA 4JN8A 5G5GB 1P48A 1P43A 2V3BA 1EL7A 3CNSA 2QA1A 3SXIA 1S2YA 3ZVHA 3TCSA 1GV4A 4EMWA 3SFEA 2PSNA 4OPTA 2YAUA 3QSSA 4GCMA 4TM1A 1NDAA 3G5QA 3ZLHA 2OA1A 1OJ9A 3IK4A 4CNJA 3CYJA 3UGVA 2V60A 3Q6JA 3UOXA 1S3BA 2P8BA 3UCLA 3V3OA 3U4FA 2OG9A 2OVLA 2EQ8A 2OALA 2QVHA 4ENLA 2BXRA 3UTEA 3B97A 2BACA 2QQ6A 2IVEA 1TYPA 1ZXIC 5FJRA 2QJNA 3ZVHB 4Z25A 2WDVA 1EC9A 1ELSA 5HHFA 2AKMA 4GDEA 3R0KA 4KPLA 2WDRA 3V5FA 4GDPA 4U8MA 4IP5A 2Q7VA 1XPQA 1D7LA 4P9SA 3ETRB 5JRBA 2XLSA 3T37A 4B1BA 4KEMA 3JZUA 3UKQA 4HA6A 4DX3A 1KD0A 4A7AA 3QVRA 4JNQA 3RRAA 4GFIA 3DG7A 3QSMA 1IYXA 1QJDA 2B9WA 2XVJA 3R1ZA 3NK1X 2GGGA 2XH2A 2QCUA 3NGCX 4Z2TA 4H4YA 3K7MX 3P0WA 2GQFA 4E0VA 4HCHA 3NVWB 4DN1A 2WOWA 4RG4A 4O5UA 1F8RA 1RP0A 3VQRA 3GSIA 3AM9A 1GNDA 1TDNA 1CJ2A 1ZDLA 4KPRA 2DKHA 3UCDA 1KSSA 1ZMDA 4GR1A 3UKHA 4B69A 3JVAA 3L8KA 2W55A 5KWFA 1IUVA 1PJ5A 4GYPA 3H7VA 3QTPA 3AD9B 1JEHA 2GSHA 2C66A 3SN0A 4H4WA 1FL2A 2X8HA 5JCNA 2XLRA 2WETA 3ABVA 1YKJA 3DK4A 3I6DA 1EBHA 4Y4LA 3NZGA 2YLRA 3S5WA 3SZ0A 3TWAA 3VR8A 5KOXA 4E4UA 2C3DA 2Z5YA 4E4FA 3ALLA 2GEWA 4IVMB 3FYYA 3RHAA 3DERA 3H12A 3Q4DA 4OPUA 3VRBA 2XDOA 2VQBA 1ZMCA 2AL1A 2VVMA 1FIQB 1CF3A 2ZADA 2W3SA 5GSNA 3UTFA 3M13A 4LU6A 4OCGA 1ZX9A 1TRBA 2JB3A 4HB9A 3II4A 4C3YA 3R07C 1CC2A 3AE9A 1NENA 4XWZA 3HYWA 4H7UA 4H4PA 4NEVA 5IDZA 2CDUA 2EQ7A 3ES7A 1UKVG 4C5OA 1GERA 3AYJA 1DOBA 4YT0A 4BURA 4NWZA 4PAAA 4NNJA 4Y4MA 4C77A 2QJMA 1VG9A 3UXKA 1YQ4A 1DTNA 1BGNA 3V3WA 5J7XA 3F8RA 3D47A 3N4EA 3SN4A 1L9DA 1GRHA 4K5SA 3OPSA 2Z5XA 3AB1A 4Z17A 4A6NA 5BUKA 4HYRA 3AWIA 1P2EA 2QDDA 3OC4A 2GH5A 2BYBA 4JN7A 1GXFA 3PG6A 1PXBA 2YR4A 1O95A 2YM2A 2PPGA 1AOGA 3K7QX 2XFNA 2XSXA 4HPNA 3S5SA 1B37A 2XLUA 3NLCA 2P8CA 3V5CA 2AAQA 4EM4A 1KCZA 3TTEA 2GR1A 4U8LA 1NELA 3T9PA 4OPDA 3THUA 1S2QA 1VQZA 4E6MA 4J2WA 1T3QC 4A6NB 3DGBA 1FHUA 2P88A 2OAMA 2YG3A 2PA6A 2GGEA 4OPLA 1JPDX 2VVLG 3UJFA 3AD7B 3SR6B 1BF3A 1PJ7A 2XFOA 1KKOA 3BHKA 3RNMA 4CBQA 3P4SA 2RGJA 3AEAA 3QLDA 4IT1A 4GGHA 1TZZA 3HYXA 1SEZA 5LV9A 3BOXA 2YG7A 4K1WA 5EU9A 2B7RA 3AN1A 2DKIA 4Z44A 3AE8A 3NO1A 3PK7A 2YLWA 3IWAA 3UKFA 4G8TA 1XANA 3R0UA 3RO6A 3FJ4A 2QAEA 2B76A 2WPEA 4MJWA 4TLXA 4TVYA 1LPFA 3I4KA 4KWSA 2BXSA 3PWGA 3FCPA 1GEUA 4AP1A 3GYJA 3NRNA 1BWCA 2VQ7A 2ONEA 3CK5A 3P3BA 1IUXA 2BRYA 4B64A 2MNRA 3CT2A 1GRTA 2GR2A 2FJAA 1DJNA 4ZN0A 3D1CA 1ZY8A 1OJTA 2GR0A 4G74A 4AT2A 2FJEA 1GRGA 1N61C 1EBGA 5JCMA 2BABA 2PODA 3MZNA 4BK2A 4MMWA 1E9IA 2Q6UA 4FI4A 2E3TA 1RM6B 3SBFA 3SX6A 2XYOA 1V97A 4C3XA 1N63C 2PTZA 1F3PA 3LZWA 5KVHA 2PS2A 3KU9A 3PFRA 1CJ3A 3GC2A 3E1TA 3OW1A 3OZMA 3RP6A 2R9ZA 3GY1A 3C96A 1ECQA 2W0HA 1GESA 1F8WA 3AEEA 2GMJA 3AE6A 1EC7A 4JHMA 4J36A 1KSUA 3QSEA 2AR8A 1MNSA 1K4QA 4TLZA 2HZGA 3AECA 2DW7A 2ZBWA 4J34A 3PWIA 3RCYA 2A89A 3D9XA 1FFVC 1R0MA 3T4WA 2WEUA 3ZVIA 3DJEA 4XXGA 3EKGA 4H1ZA 2BS4A 4G6HA 3T31A 3WE0A 3HRDC 5KMPA 4EIQA 3CPHG 1V59A 3UXLA 3C4AA 1GRAA 5U63A 1K0LA 3CPJG 1H7XA 4B65A 4Z1YA 1P2HA 2WDQA 1FCDA 3AEBA 1JROA 3UKKA 4TM0A 1L9CA 2HQMA 3DMEA 4EQRA 1SB3B 3BI5A 3QKEA 2PTWA 3KKJA 4EQXA 3NVYB 1PXAA 4EMIA 3NYFA 1CC6A 2X8GA 3VCCA 5HXIA 3GD6A 4H4VA 3CNPA 3BI4A 2PCEA 3KD9A 2OQYA 3IJLA 2X99A 3GD3A 2R4JA 4YTNA 4FK1A 3VCNA 2YVJA 3UOZA 3DG3A 5DBJA 1X31B 1PBFA 1PXCA 4UDPA 4K2XA 3REDA 3ZLFA 3NS1B 3FVDA 4WCTA 3SYIA 3COXA 2TPRA 5KMQA 1CBOA 3N6JA 4Z26A 2PGWA 2GAGB 2FYMA 4DSGA 3GDNA 1MO9A 1Q1RA 3DA1A 2YVGA 3QFAA 2PHHA 1N4UA 3GRTA 2PMQA 4PABA 4H2QA 2AL2A 3BHFA 4ECHA 5BRTA 3KPFA 2GF3A 1JNRA 5U1OA 3RR1A 3AYIA 5J04A 2VVLA 1GOSA 5CKUA 1YEYA 1N5WC 4U8OA 3S61A 1YQZA 3NXLA 1W6TA 2TMDA 4IVOB 5IPYA 1NG4A 3SZCA 1IUSA 2NVKX 1ZOYA 4HN8A 2VOUA 1CL0A 3DIPA 2WHDA 3K1GA 1XS2A 3B3RA 4NZHA 3CTYA 2W54A 1VQWA 4C74A 3UKAA 4B68A 2AL2B 3P4PA 2YLXA 1IUUA 2OZ3A 7ENLA 3GO2A 2BK4A 1MOKA 4GIRA 5JCIA 1EBDA 3OTRA 2YVFA 2P3ZA 2ZZ0A 2V3AA 4OVIA 2FJBA 1NHRA 1PBCA 4K8GA 1O94A 2YQUA 2FBWA 2WP9A 3C4NA 1CJ4A 1JDFA 3ENLA 2YLTA 1N62C 1MXTA 3SGLA 4K2SA 5KVIA 3K30A 4H19A 1RSGA 2HXUA 3LXDA 3QFBA 2GQWA 4G73A 2NPXA 5KMSA 3IJIA 4H4XA 1TE6A 1D5TA 1RVKA 2B7SA 4ZCCA 3NTDA 3BJSA 3LADA 2PP3A 3A7RA 3T2ZA 2C4CA 3EF6A 2MUCA 3V3NA 5IQ1A 1E39A 5FS8A 2C65A 3SJNA 5EB5A 4HNCA 3DDMA 4TVWA 3AYLA 2X3NA 1XPYA 4IZGA 2JK6A 4J3ZA 2VRMA 3ZDNA 2ACZA 2JBVA 2PU1A 1LTXR 2QDEA 4CCRA 3H70A 3L1RA 3UTGA 2GGHA 4B63A 3ZLGA 3I3LA 1OEPA 1Y56A 4KX6A 3TWBA 1N5XA 3UCCA 1GALA 3VRDB 2V61A 2E1MA 5FJPA 2PTXA 2E5VA 4N9XA 4D03A 3IHMA 2ZZCA 3KPKA 1D4DA 2PGEA 3Q45A 4A35A 4GISA 1OJDA 4JNAA 3EPTA 4YTMA 2X8CA 3TJIA 5KXJA 1XHCA 3DFYA 5CQFA 2FKPA 4YSHA 4EM3A 1R6WA 3P9UA 3NVZB 2QGYA 1DJQA 1MDRA 1PBBA 2RDXA 1GPEA 4M52A 4NTEA 1GRFA 3EANA 3LB8A 1Y56B 4REKA 2WP6A 3UP5A 4Z24A 3VDGA 2X50A 1FEAA 2XH4A 1JPMA 3KA7A 1H82A 3LZXA 1ONFA 1B5QA 5FS7A 2OFJA 1JNZA 1ZP0A 5EOWA 1E7PA 3MSYA 4X4JA 2FJDA 2POZA 2ZC8A 5BULA 3UTHA 1M64A 1Z6LA 3DJDA 2JB1A 3R25A 2B9XA 4UDQA 1QLBA 2XLPA 1QO8A 3G5RA 2XVHA 1PHHA 3PVCA 1L0VA 4GUVA 2HNEA 4ADWA 5C2TA 2GV8A 4IA5A 2WQYA 1PN0A 2O9ZA 3QVPA 1VDVA 4ZA0A 4K5RA 1FOHA 5L46A 1H2IA 1MDLA 4MKSA 1YQ3A 4TM3A 2HXTA 1LQTA 1YY5A 2ZZBA 3L5OA 4G6GA 4Z2RA 2WU2A 3AEDA 4DNAA 1H83A 3SQPA 4UDRA 3JSKA 4GYPC 2YR5A 5TR3A 2PP1A 2B9YA 3P1WA 2EQ9A 4YTPA 3S47A 3P4RA 2J3NA 1OJAA 2I5QA 4GAPA 4YKGA 5G5HB 3AEGA 3B6DA 4XWRA 1IUTA 4BJYA 2E4GA 1IJHA 2IVDA 3MY9A 4JQ9A 2H89A 1MUCA 4CY6A 2C3CA 4FP1A 3SM8A 2WESA 2W3RA 4WX1A 2Q0KA 2WOVA 1LJ1A 5JCKA 4K7ZA 4Z2UA 3GD4A 3DGZA 4OPCA 1PDZA 4CRTA 2R4EA 1LV0A 1FO4A 3NYCA 3NK0X 4AT0A 2GGJA 2WPCA 1E6EA 4NTCA 3ZYXA 3RP8A 3TQPA 5KRQA 3NT6A 4USRA 3O0HA 2R0CA 1DNCA 3DGHA 2OO6A 4GRTA 2R45A 4KT2A 1XDIA 5ENLA 3SFDA 1BZLA 2BS3A 5FJUA 1S7MA 2GRTA 1D4CA 1GTEA 4J56A 5HYMA 3BSMA 2C67A 4ICYA 3GMBA 3CXBA 3ICTA 1WUEA 4CNKA 1TDEA 2R0GA 3UKPA 3H4KA 3ICRA 1ONEA 4FX9A 3Q9TA 4DXKA 3FBSA 4A6GA 1D7YA 1JRXA 1HYUA 5M0ZA 2GGIA 4H4TA 2PYXA 4TM4A 4IL0A 2PTYA 4J57A 1NAAA 2XCGA 1JRPA 3A7UA 3M12A 4U2SA 5FJOA 1B4VA 2YM1A 4M6UA 1FEBA 3DH9A 5FS9A 3NH3X 3CPIG 2BK3A 2AKZA 4OPIA 1KDGA 2C76A 3DJJA 3ATQA 3I6TA 4MGGA 2A8XA 3CIRA 2WBAA 2AQJA 4X2PA 4HCLA 3P4QA 3VRAA 4H2NA 2XH7A 3AEFA 2GAHB 2OZTA 2CFYA 5GRTA 4OPGA 2C75A 3UJ2A 2H88A 4ZCDA 3DFHA 1H7WA 4LIIA 3DJGX 4H4ZA 3VC5A 3CNTA 3CNJA 1VG0A 3MUCA 1ZK7A 3LOVA 1JRZA 4I59A 5FMHA 1E1NA 5EBKA 4H50A 2CULA 2XLTA 2C73A 3AE1A 2VRLA 4A5LA 2BC0A 2EQ6A 4EQWA 1KKRA 4A3RA 2Y6QA 4YXDA 3VR9A 1ELIA 3GYXA 2IIDA 4U8NA 1Q9IA 3KLJA 4IL2A 1X2GA 3HYVA 1ZOVA 5FJTA 4II2A 2YLZA 2UZZA 1KF6A 1PJ6A 1DXLA 3F8PA 4J33A 4A79A 1EL5A 4YSZA 1L9EA 1GT8A 1DOEA 3H8IA 4EIPA 5KNLA 1NPXA 3DG6A 3NTAA 1F8SA 1KNPA 3SZWA 3ITJA 2F5ZA 3T14A 3AE3A 4H4RA 2C72A 4I58A 1E1LA 3NFUA 2GDQA 4IV9A 5EB4A 5BOEA 1NHSA 1MRAA 3HW2A 5HY5A 3FMWA 2P0IA 4JY2A 2WP5A 2WU5A 3MWCA 2YG5A 1B8SA 4E5TA 5M10A 1BQGA 2OLAA 2YLSA 3RITA 4IA6A 4AOSA 2PU0A 3AE4A 3UOVA 4ZOHB 4ZCWA 1NU5A 3HPFA 1H86A 2BS2A 3AE7A 4G7FA 1H81A 2GVCA 3HZLA 1H84A 3OZ2A 5BVAA 2XH0A 2YG4A 1GETA 1E1MA 2Y6RA 3SY4A 1WUFA 3ALMA 2BC1A 4EQSA 2QA2A 3I6EA 1JOAA 3DESA 1ZKQA 1DODA 2GL5A 3TW9A 3KVEA 4J31A 4X9MA 1DOCA 4U2LA 4H83A 2RGHA 3CNDA 1LVLA 3MKCA 4NTDA 3NYEA 3AD8B 1SJBA 3BNUA 3QJ4A 1F9CA 3V4BA 3BNMA 4Z43A 3T8QA 1D4EA 4DSHA 4GAVA 4U8KA 4J1OA 4U8JA 1TDFA 2YWLA 4EMJA 3RP7A 2OPJA 3GRSA 1KN0A 3OP2A 3CN8A 4DGKA 3UJEA 4H2HA 3G5SA 3ADAB 4U8IA 3A7AA 3B9JB 2JAEA 3ES8A 1SJDA 2OLOA 1CJCA 4Y4NA 3CGEA 4K22A 4F4RA 1S3EA 5J60A 4U2TA 1EC8A 3IF9A 3UP4A 3NKSA 3VFCA 1TDOA 3NNEA 3DK9A 2A87A 1LQUA 1E1KA 2BK5A 1X2HA 3CGCA 3ISHA 3NVVB 4CY8A 6ENLA 2XVEA 2XVFA 1PDYA 2DW6A 3AMZA 3EAOA 3UKLA 2YR6A 1N4WA 3NRZB 3IHGA 3JW7A 2V5ZA 1PBEA 5BOFA 4B67A 2BRAA 3M0OA 3SSZA 4GGBA 1N1PA 2GB0A 1TDKA 4A99A 4FK1C 3RGTA 1JCTA 1O5WA 1K0JA 2CVJA 3FPZA 4RSLA 4USQA 1BGJA 3N4FA 3U9IA 3NG7X 4BV6A 1FHVA 1PDHA 4AP3A 4YSXA 1NHQA 1JRYA 3CB3A 3CXOA 3VC6A 3SZFA 3H8LA 4GF7A 3AE2A 4E8GA 5IQ4A 1GREA 4DHGA 3IJQA 4H4QA 4A65A 4B66A 3T2YA 2OQHA 3UJSA 3GYIA 2V6OA 3EUB3 1BKWA 3PO7A 3AXBA 1IUWA 2WPFA 1Q1WA 4RG3A 2QJJA 3ICSA 5JCLA 2RGOA 4G9KA 1GTHA 5KMRA 3D8XA 2GR3A 1EL9A 3R10A 2OZ8A 1KNRA 2O56A 3R9UA 3URHA 3QN3A 4X9NA 1VRQB 4BK3A 3UOYA 3MQTA 3CMMA 1STZA 4DYEA 1Y0PA 1F6MA 2APGA 1NG3A 3NK2X 4BJZA 2XGZA 1NEKA 4A9WA 5C3JA 1SJAA 2NQLA 1WYGA 4H2PA 3NN6X 4M0XA 2WOIA 2GMHA 2OLNA 1N4VA 2BCGG 1GRBA 1SJCA 1RYIA 3GMCA 2XVIA 2CHRA 4JDRA 3NIXA 2E5AA 5U25A 3TJ4A 3FXGA 1COYA 3T0KA 4K8DA 2JKCA 1KFYA 4U8PA 3KUMA 3CGBA 3UJRA 3D46A 2BCPA 3GWFA 4NEWA 2JB2A 3OZYA 3GDPA 3K7TA
chains in the Genus database with same CATH topology
4YWOA 2R46A 4OVIA 3OC4A 1VG0A 2GH5A 1M6IA 2BYBA 2FJBA 1NHRA 4YSYA 1PBCA 1PS9A 1ZK7A 1O94A 1GXFA 3PG6A 3LOVA 1PXBA 1JRZA 2YQUA 2YR4A 2FBWA 1O95A 3CGDA 2YM2A 1AOGA 4I59A 3K7QX 5FMHA 2WP9A 2XFNA 2XLUA 1B37A 1E1NA 3LJPA 3NLCA 5EBKA 3C4NA 4CCQA 4H50A 5KOWA 2CULA 2AAQA 2XLTA 1CJ4A 2C73A 1CC4A 4EM4A 2YLTA 3AE1A 2VRLA 2RABA 3ALJA 4II3A 1MXTA 1VDCA 3SGLA 4A5LA 5KVIA 2BC0A 2EQ6A 3K30A 1RSGA 3FG2P 4EQWA 1REOA 3LXDA 3QFBA 2GQWA 1EL8A 4G73A 2NPXA 5KMSA 4H4XA 2C70A 2Y6QA 4YXDA 3NN0X 3VR9A 1ELIA 3GYXA 2GR1A 4H2RA 4U8LA 2IIDA 1D5TA 4U8NA 1Q9IA 2YG6A 4FDCB 1FECA 4OPDA 1GSNA 4BK1A 2B7SA 3KLJA 1S2QA 4J2WA 2ARDA 3NTDA 4ZCCA 3BI2A 3HYVA 3LADA 4A6NB 3DK8A 1ZOVA 1H6VA 4II2A 2YLZA 3PS9A 3T2ZA 2C4CA 5FS6A 1W4XA 3EF6A 2XFUA 2UZZA 2OAMA 2YG3A 2I0ZA 3F8DA 1KF6A 4OPLA 3V3NA 1PJ6A 1PBDA 2VVLG 1DXLA 5IQ1A 1JU2A 1E39A 5FS8A 2C65A 3AD7B 5EB5A 4H4UA 1BF3A 4AOXA 1PJ7A 2XFOA 3F8PA 3NHOX 4J33A 3AYLA 2BA9A 4A79A 1EL5A 3BHKA 3RNMA 4YSZA 4CBQA 2X3NA 1L9EA 5ER0A 1DOEA 1GT8A 3H8IA 4EIPA 3P4SA 4O5QA 2JK6A 5KNLA 1NPXA 2RGJA 2XFPA 3NTAA 2VRMA 4D04A 3ZDNA 2XFQA 3AEAA 2ACZA 1TYTA 1F8SA 1KNPA 2JBVA 4LA1A 1LTXR 2R0PA 4UP3A 3SZWA 3ATRA 3ITJA 2F5ZA 3T14A 3GWDA 3AE3A 4APNA 2WS3A 3HYXA 4CCRA 4H4RA 1SEZA 2C72A 2C7GA 4I58A 5LV9A 1K0IA 3L1RA 1E1LA 2VZ2A 3UTGA 4JY3A 4H4SA 4B63A 3I3LA 4IV9A 1Y56A 3IC9A 2YG7A 5EB4A 3FIMB 4KX6A 1NHSA 1OJCA 1GALA 3VRDB 5HY5A 2V61A 2E1MA 3FMWA 2B7RA 4JY2A 3T2KA 2WP5A 2DKIA 2WU5A 2YG5A 1B8SA 4Z44A 2E5VA 5M10A 3AE8A 4N9XA 2YLWA 4D03A 2Q0LA 3IHMA 2ZZCA 2YLSA 3KPKA 1D4DA 4YKFA 4IA6A 4AOSA 3IWAA 3UKFA 3AE5A 4JN9A 1CHUA 3AE4A 1XANA 3UOVA 3V76A 2C64A 1NHPA 1OJDA 4JNAA 2QAEA 2B76A 2WPEA 3EPTA 4MJWA 4YTMA 2X8CA 4TLXA 5KXJA 1LPFA 1XHCA 2V3BA 5CQFA 1H86A 2BS2A 1EL7A 2BXSA 3CNSA 4YSHA 4EM3A 3AE7A 2QA1A 3P9UA 3SXIA 1H81A 1GEUA 1S2YA 4AP1A 2GVCA 1DJQA 1GV4A 4EMWA 3GYJA 3HZLA 1H84A 3OZ2A 1PBBA 3SFEA 5BVAA 3NRNA 1GPEA 2YG4A 4OPTA 2YAUA 1GETA 4M52A 1E1MA 2Y6RA 3QSSA 3SY4A 4NTEA 4GCMA 3ALMA 4TM1A 2BC1A 1GRFA 3EANA 1BWCA 3LB8A 1Y56B 1NDAA 2VQ7A 3G5QA 4REKA 1IUXA 2BRYA 4EQSA 2OA1A 2WP6A 1OJ9A 2QA2A 4CNJA 3UP5A 4Z24A 4B64A 1GRTA 1JOAA 3Q6JA 2V60A 3UOXA 1S3BA 2GR2A 2FJAA 1ZKQA 1DODA 1DJNA 2X50A 4ZN0A 3D1CA 3UCLA 3V3OA 1FEAA 3KVEA 1ZY8A 4J31A 1OJTA 2GR0A 4G74A 4X9MA 4AT2A 2FJEA 1DOCA 1H82A 3KA7A 3LZXA 4U2LA 1GRGA 1ONFA 2EQ8A 1B5QA 2OALA 5JCMA 2BABA 2RGHA 5FS7A 2BXRA 3UTEA 4BK2A 5EOWA 1JNZA 1ZP0A 2BACA 1E7PA 4X4JA 3CNDA 2Q6UA 2FJDA 2IVEA 1LVLA 1TYPA 4NTDA 3NYEA 5BULA 3AD8B 1M64A 3BNUA 1Z6LA 3QJ4A 3UTHA 3DJDA 2JB1A 2B9XA 4UDQA 3SX6A 2XYOA 3BNMA 4C3XA 4Z25A 1QLBA 4Z43A 2XLPA 2WDVA 1QO8A 1D4EA 1F3PA 3G5RA 5KVHA 2XVHA 3LZWA 5HHFA 4DSHA 4GDEA 1PHHA 4GAVA 4U8KA 4U8JA 3KU9A 1CJ3A 1TDFA 2YWLA 3PVCA 1L0VA 4EMJA 3E1TA 4GUVA 3RP7A 2WDRA 3GRSA 3RP6A 2R9ZA 4ADWA 4GDPA 4U8MA 1KN0A 2Q7VA 5C2TA 1XPQA 3CN8A 3C96A 2W0HA 2GV8A 4IA5A 2WQYA 1GESA 1F8WA 1PN0A 1D7LA 3AEEA 2O9ZA 4DGKA 2GMJA 3AE6A 4P9SA 4J36A 1KSUA 3QSEA 2AR8A 3QVPA 5JRBA 2XLSA 3T37A 1K4QA 3G5SA 4B1BA 4TLZA 4K5RA 3ADAB 4U8IA 3AECA 3UKQA 2JAEA 1FOHA 4HA6A 2ZBWA 4J34A 5L46A 1H2IA 4A7AA 3QVRA 4JNQA 2OLOA 1CJCA 1YQ3A 4Y4NA 3CGEA 4TM3A 4K22A 3QSMA 1LQTA 1QJDA 2B9WA 1S3EA 2A89A 3D9XA 1YY5A 5J60A 2ZZBA 2WEUA 2XVJA 4U2TA 3L5OA 3DJEA 4XXGA 4G6GA 3NK1X 4Z2RA 3IF9A 2WU2A 2QCUA 3AEDA 2BS4A 4G6HA 3UP4A 3T31A 3NGCX 3NKSA 4DNAA 3WE0A 4Z2TA 1H83A 3SQPA 4H4YA 4UDRA 5KMPA 1TDOA 3K7MX 3NNEA 3CPHG 4EIQA 3DK9A 3JSKA 2GQFA 2A87A 1V59A 3C4AA 1GRAA 2YR5A 5TR3A 1LQUA 4E0VA 1E1KA 5U63A 1K0LA 3PO7A 3CPJG 2WOWA 2B9YA 4RG4A 4O5UA 1H7XA 3P1WA 2EQ9A 4B65A 1P2HA 1F8RA 4YTPA 1RP0A 2WDQA 3VQRA 2BK5A 1FCDA 3GSIA 3CGCA 3AEBA 3P4RA 3UKKA 2J3NA 3ISHA 1GNDA 1OJAA 1TDNA 4GAPA 4TM0A 4CY8A 2XVEA 4YKGA 1L9CA 2XVFA 2HQMA 1ZDLA 4KPRA 1CJ2A 2DKHA 3DMEA 3EAOA 1KSSA 3UKLA 1ZMDA 4EQRA 2YR6A 3AEGA 3BI5A 4GR1A 3UKHA 3B6DA 1N4WA 3IHGA 3KKJA 4XWRA 4B69A 4EQXA 1IUTA 4BJYA 2V5ZA 3L8KA 1IJHA 1PBEA 2E4GA 2IVDA 4B67A 5KWFA 1IUVA 2BRAA 1PXAA 1PJ5A 3M0OA 4JQ9A 2H89A 1N1PA 4EMIA 2GB0A 1TDKA 4A99A 4FK1C 3NYFA 1O5WA 4CY6A 2C3CA 1K0JA 1CC6A 2CVJA 3FPZA 3AD9B 2X8GA 1JEHA 4RSLA 4USQA 1BGJA 3SM8A 5HXIA 3NG7X 4BV6A 1PDHA 4YSXA 4AP3A 2C66A 1NHQA 1JRYA 4H4VA 3CNPA 2WESA 3BI4A 4WX1A 2Q0KA 2WOVA 1LJ1A 4H4WA 1FL2A 2X8HA 5JCNA 5JCKA 4K7ZA 3SZFA 3KD9A 4Z2UA 2XLRA 3H8LA 4GF7A 2WETA 3ABVA 3GD4A 3DGZA 3AE2A 1YKJA 3DK4A 4OPCA 2X99A 4CRTA 3GD3A 3I6DA 2R4JA 2R4EA 4Y4LA 1LV0A 5IQ4A 1GREA 3NYCA 2YLRA 4YTNA 3NK0X 4FK1A 4H4QA 4A65A 3S5WA 4AT0A 2WPCA 2YVJA 4B66A 1E6EA 3UOZA 4NTCA 3ZYXA 3T2YA 3RP8A 3SZ0A 3VR8A 5KOXA 3GYIA 2C3DA 2Z5YA 5DBJA 2V6OA 3NT6A 1X31B 4USRA 5KRQA 1BKWA 3O0HA 1PBFA 1DNCA 3DGHA 2R0CA 4GRTA 2R45A 3ALLA 1PXCA 3AXBA 1XDIA 1IUWA 2GEWA 3SFDA 4IVMB 2WPFA 4UDPA 1BZLA 4K2XA 1Q1WA 3RHAA 4RG3A 3REDA 3ICSA 2BS3A 5JCLA 2RGOA 4WCTA 4G9KA 1GTHA 3SYIA 1S7MA 2GRTA 5KMRA 1D4CA 1GTEA 4J56A 3COXA 2TPRA 5HYMA 3D8XA 4OPUA 5KMQA 3VRBA 1CBOA 2C67A 4ICYA 4Z26A 2XDOA 2GAGB 2GR3A 2VQBA 1ZMCA 3GDNA 4DSGA 1MO9A 1Q1RA 2VVMA 3DA1A 1EL9A 2YVGA 1CF3A 3GMBA 3ICTA 3QFAA 4CNKA 1KNRA 2PHHA 1TDEA 5GSNA 2R0GA 3R9UA 3UTFA 3URHA 1N4UA 3M13A 3UKPA 3H4KA 3ICRA 4X9NA 4LU6A 3GRTA 1VRQB 4FX9A 4BK3A 4OCGA 1ZX9A 1TRBA 3UOYA 2JB3A 3Q9TA 3CMMA 4PABA 3FBSA 4H2QA 1Y0PA 1F6MA 2APGA 1NG3A 3NK2X 4BJZA 1NEKA 1D7YA 4HB9A 4A9WA 1JRXA 3II4A 1HYUA 5C3JA 4C3YA 3BHFA 4ECHA 1CC2A 5BRTA 3AE9A 3KPFA 1NENA 5M0ZA 4H4TA 3HYWA 4H2PA 4XWZA 2GF3A 2PYXA 1JNRA 4H7UA 3NN6X 4TM4A 5U1OA 2XCGA 4J57A 1NAAA 3AYIA 4H4PA 3M12A 2VVLA 4U2SA 1B4VA 2YM1A 4NEVA 1FEBA 1GOSA 4U8OA 5CKUA 2CDUA 2WOIA 2EQ7A 3DH9A 3S61A 5FS9A 3NH3X 1YQZA 1UKVG 2BK3A 1GERA 2GMHA 2OLNA 3CPIG 4C5OA 2TMDA 1N4VA 2BCGG 4IVOB 3AYJA 4OPIA 1KDGA 2C76A 1DOBA 3DJJA 3ATQA 4YT0A 5IPYA 4BURA 1GRBA 4NWZA 1NG4A 1RYIA 3GMCA 2A8XA 1IUSA 3CIRA 4PAAA 2WBAA 2AQJA 2NVKX 3SZCA 2XVIA 4NNJA 4JDRA 3NIXA 4Y4MA 3P4QA 1ZOYA 3VRAA 4C77A 4H2NA 1VG9A 2VOUA 5U25A 1CL0A 2WHDA 1YQ4A 3AEFA 3B3RA 4NZHA 1BGNA 1COYA 3T0KA 2GAHB 4K8DA 2JKCA 3CTYA 1KFYA 1VQWA 4OPGA 2CFYA 5GRTA 3F8RA 5J7XA 4C74A 2C75A 4U8PA 3UKAA 4B68A 3P4PA 1L9DA 2YLXA 1IUUA 3CGBA 1GRHA 2H88A 4ZCDA 1H7WA 4K5SA 2BCPA 4LIIA 3GWFA 3DJGX 4NEWA 2Z5XA 2JB2A 3AB1A 2BK4A 1MOKA 4H4ZA 5JCIA 4A6NA 5BUKA 3CNTA 1EBDA 2YVFA 2ZZ0A 2V3AA 3AWIA 1P2EA 3CNJA 3GDPA 3K7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YWO A;  2R46 A;  4OVI A;  3OC4 A;  1VG0 A;  2FJB A;  1M6I A;  2BYB A;  2GH5 A;  1NHR A;  4YSY A;  1PBC A;  1PS9 A;  1ZK7 A;  1O94 A;  1GXF A;  3LOV A;  1PXB A;  1JRZ A;  2YQU A;  2YR4 A;  2FBW A;  1O95 A;  2YM2 A;  3CGD A;  1AOG A;  4I59 A;  3K7Q X;  5FMH A;  2WP9 A;  2XFN A;  2XLU A;  1B37 A;  1E1N A;  3LJP A;  3NLC A;  5EBK A;  3C4N A;  4CCQ A;  4H50 A;  5KOW A;  2CUL A;  2AAQ A;  2XLT A;  1CJ4 A;  2C73 A;  1CC4 A;  4EM4 A;  2YLT A;  3AE1 A;  2VRL A;  2RAB A;  3ALJ A;  1MXT A;  1VDC A;  3SGL A;  4A5L A;  5KVI A;  2BC0 A;  2EQ6 A;  3K30 A;  1RSG A;  3FG2 P;  4EQW A;  1REO A;  3LXD A;  3QFB A;  2GQW A;  1EL8 A;  2NPX A;  4H4X A;  2C70 A;  2Y6Q A;  4YXD A;  3NN0 X;  3VR9 A;  1ELI A;  2GR1 A;  4H2R A;  4U8L A;  2IID A;  1D5T A;  4U8N A;  1Q9I A;  2YG6 A;  4FDC B;  1FEC A;  4OPD A;  1GSN A;  4BK1 A;  2B7S A;  1S2Q A;  3KLJ A;  4J2W A;  2ARD A;  3NTD A;  4ZCC A;  3BI2 A;  3LAD A;  4A6N B;  3DK8 A;  1ZOV A;  1H6V A;  2YLZ A;  3PS9 A;  5FS6 A;  1W4X A;  2XFU A;  3EF6 A;  2UZZ A;  2OAM A;  2YG3 A;  2I0Z A;  3F8D A;  1KF6 A;  4OPL A;  3V3N A;  1PJ6 A;  1PBD A;  2VVL G;  1DXL A;  5IQ1 A;  1JU2 A;  1E39 A;  5FS8 A;  2C65 A;  3AD7 B;  5EB5 A;  4H4U A;  1BF3 A;  4AOX A;  1PJ7 A;  2XFO A;  3F8P A;  3NHO X;  4J33 A;  3AYL A;  2BA9 A;  4A79 A;  1EL5 A;  3BHK A;  3RNM A;  4YSZ A;  4CBQ A;  2X3N A;  1L9E A;  1GT8 A;  1DOE A;  3H8I A;  5ER0 A;  4EIP A;  3P4S A;  4O5Q A;  2JK6 A;  1NPX A;  2RGJ A;  2XFP A;  3NTA A;  2VRM A;  4D04 A;  3ZDN A;  2XFQ A;  3AEA A;  2ACZ A;  1TYT A;  1F8S A;  1KNP A;  2JBV A;  2R0P A;  1LTX R;  4LA1 A;  4UP3 A;  3ATR A;  3ITJ A;  2F5Z A;  3GWD A;  3AE3 A;  4APN A;  2WS3 A;  4CCR A;  1SEZ A;  2C72 A;  4H4R A;  2C7G A;  4I58 A;  5LV9 A;  1K0I A;  3L1R A;  1E1L A;  2VZ2 A;  3UTG A;  4JY3 A;  4H4S A;  4B63 A;  3I3L A;  4IV9 A;  1Y56 A;  3IC9 A;  2YG7 A;  5EB4 A;  3FIM B;  4KX6 A;  1NHS A;  1OJC A;  1GAL A;  3VRD B;  5HY5 A;  2V61 A;  2E1M A;  3FMW A;  2B7R A;  4JY2 A;  2WP5 A;  2DKI A;  2WU5 A;  2YG5 A;  1B8S A;  4Z44 A;  2E5V A;  5M10 A;  3AE8 A;  4N9X A;  2YLW A;  4D03 A;  2Q0L A;  3IHM A;  2ZZC A;  2YLS A;  1D4D A;  4YKF A;  4IA6 A;  4AOS A;  3IWA A;  3UKF A;  3AE5 A;  4JN9 A;  1CHU A;  3AE4 A;  1XAN A;  3UOV A;  3V76 A;  2C64 A;  1NHP A;  1OJD A;  4JNA A;  2QAE A;  2B76 A;  2WPE A;  3EPT A;  4MJW A;  4YTM A;  2X8C A;  4TLX A;  5KXJ A;  1LPF A;  1XHC A;  2V3B A;  5CQF A;  1H86 A;  2BS2 A;  1EL7 A;  2BXS A;  3CNS A;  4YSH A;  3AE7 A;  4EM3 A;  2QA1 A;  3P9U A;  1H81 A;  1GEU A;  1S2Y A;  4AP1 A;  2GVC A;  1DJQ A;  1GV4 A;  3GYJ A;  4EMW A;  3HZL A;  1H84 A;  3OZ2 A;  1PBB A;  3SFE A;  5BVA A;  3NRN A;  1GPE A;  2YG4 A;  4OPT A;  2YAU A;  1GET A;  1E1M A;  2Y6R A;  3QSS A;  4M52 A;  4NTE A;  4GCM A;  3ALM A;  4TM1 A;  2BC1 A;  1GRF A;  3EAN A;  1BWC A;  1Y56 B;  2VQ7 A;  1NDA A;  3G5Q A;  3LB8 A;  4REK A;  1IUX A;  2OA1 A;  2QA2 A;  1OJ9 A;  2WP6 A;  4CNJ A;  4EQS A;  3UP5 A;  4Z24 A;  4B64 A;  1GRT A;  1JOA A;  2V60 A;  3Q6J A;  3UOX A;  1S3B A;  2GR2 A;  2FJA A;  1DJN A;  1DOD A;  1ZKQ A;  2X50 A;  4ZN0 A;  3D1C A;  3UCL A;  3V3O A;  1FEA A;  3KVE A;  1ZY8 A;  4J31 A;  1OJT A;  2GR0 A;  4X9M A;  4AT2 A;  2FJE A;  1DOC A;  1H82 A;  3KA7 A;  3LZX A;  4U2L A;  1GRG A;  1ONF A;  2EQ8 A;  1B5Q A;  2OAL A;  5JCM A;  2BAB A;  2RGH A;  5FS7 A;  2BXR A;  3UTE A;  4BK2 A;  5EOW A;  1JNZ A;  1ZP0 A;  2BAC A;  1E7P A;  4X4J A;  3CND A;  2Q6U A;  2FJD A;  2IVE A;  1LVL A;  1TYP A;  4NTD A;  3NYE A;  5BUL A;  3AD8 B;  1M64 A;  3BNU A;  1Z6L A;  3QJ4 A;  3UTH A;  3DJD A;  2JB1 A;  2B9X A;  4UDQ A;  2XYO A;  3BNM A;  4C3X A;  4Z25 A;  1QLB A;  4Z43 A;  2XLP A;  2WDV A;  1QO8 A;  1D4E A;  1F3P A;  3G5R A;  2XVH A;  3LZW A;  4DSH A;  5HHF A;  5KVH A;  4GDE A;  1PHH A;  4U8K A;  4U8J A;  3KU9 A;  1CJ3 A;  1TDF A;  2YWL A;  3PVC A;  1L0V A;  3E1T A;  3RP7 A;  4GUV A;  4EMJ A;  2WDR A;  3GRS A;  3RP6 A;  2R9Z A;  4GDP A;  4U8M A;  4ADW A;  2Q7V A;  5C2T A;  1XPQ A;  3CN8 A;  3C96 A;  2W0H A;  2GV8 A;  4IA5 A;  2WQY A;  1GES A;  1F8W A;  1PN0 A;  1D7L A;  3AEE A;  2O9Z A;  4DGK A;  2GMJ A;  3AE6 A;  4P9S A;  4J36 A;  1KSU A;  3QSE A;  2AR8 A;  3QVP A;  2XLS A;  3T37 A;  1K4Q A;  3G5S A;  4B1B A;  4TLZ A;  4K5R A;  3ADA B;  4U8I A;  3AEC A;  3UKQ A;  2JAE A;  1FOH A;  4HA6 A;  2ZBW A;  4J34 A;  5L46 A;  4A7A A;  3QVR A;  4JNQ A;  2OLO A;  1CJC A;  1YQ3 A;  4Y4N A;  3CGE A;  4TM3 A;  4K22 A;  3QSM A;  1LQT A;  1QJD A;  2B9W A;  1S3E A;  2A89 A;  1YY5 A;  5J60 A;  2XVJ A;  2WEU A;  2ZZB A;  4U2T A;  3DJE A;  4XXG A;  3NK1 X;  4Z2R A;  3IF9 A;  2WU2 A;  2QCU A;  3AED A;  2BS4 A;  3UP4 A;  3NGC X;  3NKS A;  4DNA A;  3WE0 A;  4Z2T A;  1H83 A;  3SQP A;  4H4Y A;  4UDR A;  1TDO A;  3K7M X;  3NNE A;  3CPH G;  4EIQ A;  3DK9 A;  3JSK A;  2GQF A;  2A87 A;  1V59 A;  3C4A A;  1GRA A;  2YR5 A;  5TR3 A;  1LQU A;  4E0V A;  1E1K A;  5U63 A;  1K0L A;  3CPJ G;  2B9Y A;  2WOW A;  4RG4 A;  4O5U A;  1H7X A;  3P1W A;  2EQ9 A;  4B65 A;  1P2H A;  1F8R A;  4YTP A;  1RP0 A;  2WDQ A;  3VQR A;  2BK5 A;  1FCD A;  3GSI A;  3CGC A;  3AEB A;  3P4R A;  3UKK A;  2J3N A;  3ISH A;  1GND A;  1OJA A;  1TDN A;  4TM0 A;  4CY8 A;  2XVE A;  4YKG A;  1L9C A;  2XVF A;  1CJ2 A;  1ZDL A;  2HQM A;  3DME A;  2DKH A;  4KPR A;  3EAO A;  1KSS A;  3UKL A;  1ZMD A;  2YR6 A;  3BI5 A;  3AEG A;  4EQR A;  4GR1 A;  3UKH A;  3B6D A;  1N4W A;  3IHG A;  3KKJ A;  4XWR A;  4B69 A;  1IUT A;  4EQX A;  4BJY A;  2V5Z A;  3L8K A;  1IJH A;  1PBE A;  2E4G A;  2IVD A;  4B67 A;  5KWF A;  1IUV A;  1PXA A;  1PJ5 A;  3M0O A;  4JQ9 A;  2H89 A;  1N1P A;  4EMI A;  2GB0 A;  1TDK A;  4A99 A;  4FK1 C;  3NYF A;  1O5W A;  4CY6 A;  1K0J A;  2C3C A;  1CC6 A;  2CVJ A;  3FPZ A;  3AD9 B;  2X8G A;  1JEH A;  4RSL A;  4USQ A;  1BGJ A;  3SM8 A;  5HXI A;  3NG7 X;  4BV6 A;  1PDH A;  4YSX A;  4AP3 A;  2C66 A;  1NHQ A;  1JRY A;  3CNP A;  4H4V A;  2WES A;  3BI4 A;  4WX1 A;  2Q0K A;  2WOV A;  1LJ1 A;  4H4W A;  1FL2 A;  2X8H A;  5JCN A;  5JCK A;  4K7Z A;  3KD9 A;  4Z2U A;  2XLR A;  3H8L A;  4GF7 A;  2WET A;  3ABV A;  3GD4 A;  3AE2 A;  3DGZ A;  1YKJ A;  3DK4 A;  4OPC A;  2X99 A;  4CRT A;  3GD3 A;  3I6D A;  2R4J A;  2R4E A;  4Y4L A;  1LV0 A;  5IQ4 A;  1GRE A;  3NYC A;  2YLR A;  4YTN A;  3NK0 X;  4FK1 A;  4H4Q A;  4A65 A;  3S5W A;  4AT0 A;  2WPC A;  2YVJ A;  4B66 A;  1E6E A;  3UOZ A;  4NTC A;  3ZYX A;  3RP8 A;  3VR8 A;  5KOX A;  3GYI A;  2C3D A;  2Z5Y A;  5DBJ A;  2V6O A;  3NT6 A;  1X31 B;  4USR A;  5KRQ A;  1BKW A;  1PBF A;  2R0C A;  1DNC A;  3ALL A;  3DGH A;  3O0H A;  2R45 A;  3PO7 A;  1PXC A;  3AXB A;  1XDI A;  1IUW A;  2GEW A;  4GRT A;  3SFD A;  4IVM B;  2WPF A;  4UDP A;  1BZL A;  4K2X A;  1Q1W A;  3RHA A;  4RG3 A;  3RED A;  3ICS A;  2BS3 A;  2RGO A;  5JCL A;  4WCT A;  1GTH A;  2GRT A;  1D4C A;  1GTE A;  4J56 A;  3COX A;  2TPR A;  5HYM A;  3D8X A;  4OPU A;  3VRB A;  1CBO A;  2C67 A;  4ICY A;  4Z26 A;  2XDO A;  2GAG B;  2GR3 A;  2VQB A;  1ZMC A;  3GDN A;  4DSG A;  1MO9 A;  1Q1R A;  2VVM A;  3DA1 A;  1EL9 A;  1CF3 A;  2YVG A;  3GMB A;  3ICT A;  3QFA A;  4CNK A;  1KNR A;  2PHH A;  1TDE A;  5GSN A;  2R0G A;  3R9U A;  3UTF A;  1N4U A;  3M13 A;  3URH A;  3UKP A;  3H4K A;  3ICR A;  4X9N A;  4LU6 A;  1VRQ B;  3GRT A;  4FX9 A;  4BK3 A;  4OCG A;  1TRB A;  1ZX9 A;  3UOY A;  2JB3 A;  3Q9T A;  4PAB A;  3FBS A;  4H2Q A;  1Y0P A;  1F6M A;  2APG A;  1NG3 A;  3NK2 X;  4BJZ A;  1NEK A;  1D7Y A;  4HB9 A;  4A9W A;  1JRX A;  1HYU A;  3II4 A;  5C3J A;  4C3Y A;  3BHF A;  4ECH A;  1CC2 A;  5BRT A;  3AE9 A;  3KPF A;  1NEN A;  5M0Z A;  4H2P A;  4H4T A;  4XWZ A;  2GF3 A;  2PYX A;  1JNR A;  4H7U A;  3NN6 X;  4TM4 A;  5U1O A;  2XCG A;  1NAA A;  3AYI A;  4J57 A;  4H4P A;  3M12 A;  2VVL A;  4U2S A;  1B4V A;  2YM1 A;  1GOS A;  1FEB A;  4NEV A;  4U8O A;  5CKU A;  2CDU A;  2WOI A;  2EQ7 A;  3DH9 A;  3S61 A;  3NH3 X;  5FS9 A;  2GMH A;  1UKV G;  1YQZ A;  1GER A;  2BK3 A;  2OLN A;  3CPI G;  4C5O A;  2TMD A;  1N4V A;  2BCG G;  4IVO B;  3AYJ A;  4OPI A;  1KDG A;  2C76 A;  1DOB A;  3DJJ A;  3ATQ A;  4YT0 A;  5IPY A;  4BUR A;  1GRB A;  1NG4 A;  1RYI A;  3GMC A;  2A8X A;  1IUS A;  3CIR A;  4PAA A;  2WBA A;  2AQJ A;  2NVK X;  2XVI A;  4JDR A;  3NIX A;  4Y4M A;  3P4Q A;  1ZOY A;  3VRA A;  4C77 A;  4H2N A;  1VG9 A;  2VOU A;  1CL0 A;  5U25 A;  2WHD A;  1YQ4 A;  3AEF A;  3B3R A;  4NZH A;  1BGN A;  1COY A;  2GAH B;  2JKC A;  3CTY A;  4K8D A;  1KFY A;  1VQW A;  4OPG A;  2CFY A;  3F8R A;  5GRT A;  5J7X A;  4C74 A;  2C75 A;  4U8P A;  3UKA A;  4B68 A;  3P4P A;  1L9D A;  2YLX A;  1IUU A;  2H88 A;  1GRH A;  3CGB A;  4ZCD A;  1H7W A;  4K5S A;  2BCP A;  3GWF A;  4LII A;  3DJG X;  4NEW A;  2Z5X A;  2JB2 A;  3AB1 A;  2BK4 A;  1MOK A;  4H4Z A;  5JCI A;  4A6N A;  5BUK A;  3CNT A;  1EBD A;  2YVF A;  2ZZ0 A;  2V3A A;  3AWI A;  1P2E A;  3CNJ A;  3GDP A;  3K7T A; 
#chains in the Genus database with same CATH topology
 4YWO A;  2R46 A;  1M6I A;  4YSY A;  4YWS A;  1PS9 A;  1TKK A;  3CGD A;  1BKH A;  3STP A;  3LJP A;  4CCQ A;  5KOW A;  3SQS A;  3N6H A;  1CC4 A;  3H8A A;  2RAB A;  3ALJ A;  4II3 A;  1VDC A;  3FG2 P;  3FV9 A;  1REO A;  3CAW A;  1EL8 A;  3SN1 A;  2C70 A;  3NN0 X;  4H2R A;  3T6C A;  4IHC A;  2YG6 A;  4FDC B;  1FEC A;  1GSN A;  4BK1 A;  2ARD A;  3BI2 A;  3DK8 A;  1H6V A;  3PS9 A;  5FS6 A;  1W4X A;  2XFU A;  2I0Z A;  3F8D A;  1PBD A;  3QPE A;  1JU2 A;  3TOY A;  4H4U A;  4AOX A;  3NHO X;  4GME A;  2BA9 A;  3R11 A;  5ER0 A;  4O5Q A;  3P93 A;  2XFP A;  4D04 A;  2XFQ A;  1TYT A;  3VA8 A;  4HCD A;  4LA1 A;  2R0P A;  4UP3 A;  3ATR A;  3GWD A;  4APN A;  2WS3 A;  2C7G A;  1K0I A;  2VZ2 A;  2OX4 A;  4JY3 A;  4H4S A;  3DEQ A;  2PP0 A;  3IC9 A;  1L8P A;  3FIM B;  1OJC A;  4IP4 A;  4HNL A;  2OKT A;  1FFU C;  3EEZ A;  4ROP A;  3T2K A;  2Q0L A;  1N60 C;  4EWJ A;  4YKF A;  3AE5 A;  4JN9 A;  1CHU A;  4DWD A;  3V76 A;  2C64 A;  1NHP A;  4JN8 A;  5G5G B;  1P48 A;  1P43 A;  2V3B A;  1EL7 A;  3CNS A;  2QA1 A;  3SXI A;  1S2Y A;  3ZVH A;  3TCS A;  1GV4 A;  4EMW A;  3SFE A;  2PSN A;  4OPT A;  2YAU A;  3QSS A;  4GCM A;  4TM1 A;  1NDA A;  3G5Q A;  3ZLH A;  2OA1 A;  1OJ9 A;  3IK4 A;  4CNJ A;  3CYJ A;  3UGV A;  2V60 A;  3Q6J A;  3UOX A;  1S3B A;  2P8B A;  3UCL A;  3V3O A;  3U4F A;  2OG9 A;  2OVL A;  2EQ8 A;  2OAL A;  2QVH A;  4ENL A;  2BXR A;  3UTE A;  3B97 A;  2BAC A;  2QQ6 A;  2IVE A;  1TYP A;  1ZXI C;  5FJR A;  2QJN A;  3ZVH B;  4Z25 A;  2WDV A;  1EC9 A;  1ELS A;  5HHF A;  2AKM A;  4GDE A;  3R0K A;  4KPL A;  2WDR A;  3V5F A;  4GDP A;  4U8M A;  4IP5 A;  2Q7V A;  1XPQ A;  1D7L A;  4P9S A;  3ETR B;  5JRB A;  2XLS A;  3T37 A;  4B1B A;  4KEM A;  3JZU A;  3UKQ A;  4HA6 A;  4DX3 A;  1KD0 A;  4A7A A;  3QVR A;  4JNQ A;  3RRA A;  4GFI A;  3DG7 A;  3QSM A;  1IYX A;  1QJD A;  2B9W A;  2XVJ A;  3R1Z A;  3NK1 X;  2GGG A;  2XH2 A;  2QCU A;  3NGC X;  4Z2T A;  4H4Y A;  3K7M X;  3P0W A;  2GQF A;  4E0V A;  4HCH A;  3NVW B;  4DN1 A;  2WOW A;  4RG4 A;  4O5U A;  1F8R A;  1RP0 A;  3VQR A;  3GSI A;  3AM9 A;  1GND A;  1TDN A;  1CJ2 A;  1ZDL A;  4KPR A;  2DKH A;  3UCD A;  1KSS A;  1ZMD A;  4GR1 A;  3UKH A;  4B69 A;  3JVA A;  3L8K A;  2W55 A;  5KWF A;  1IUV A;  1PJ5 A;  4GYP A;  3H7V A;  3QTP A;  3AD9 B;  1JEH A;  2GSH A;  2C66 A;  3SN0 A;  4H4W A;  1FL2 A;  2X8H A;  5JCN A;  2XLR A;  2WET A;  3ABV A;  1YKJ A;  3DK4 A;  3I6D A;  1EBH A;  4Y4L A;  3NZG A;  2YLR A;  3S5W A;  3SZ0 A;  3TWA A;  3VR8 A;  5KOX A;  4E4U A;  2C3D A;  2Z5Y A;  4E4F A;  3ALL A;  2GEW A;  4IVM B;  3FYY A;  3RHA A;  3DER A;  3H12 A;  3Q4D A;  4OPU A;  3VRB A;  2XDO A;  2VQB A;  1ZMC A;  2AL1 A;  2VVM A;  1FIQ B;  1CF3 A;  2ZAD A;  2W3S A;  5GSN A;  3UTF A;  3M13 A;  4LU6 A;  4OCG A;  1ZX9 A;  1TRB A;  2JB3 A;  4HB9 A;  3II4 A;  4C3Y A;  3R07 C;  1CC2 A;  3AE9 A;  1NEN A;  4XWZ A;  3HYW A;  4H7U A;  4H4P A;  4NEV A;  5IDZ A;  2CDU A;  2EQ7 A;  3ES7 A;  1UKV G;  4C5O A;  1GER A;  3AYJ A;  1DOB A;  4YT0 A;  4BUR A;  4NWZ A;  4PAA A;  4NNJ A;  4Y4M A;  4C77 A;  2QJM A;  1VG9 A;  3UXK A;  1YQ4 A;  1DTN A;  1BGN A;  3V3W A;  5J7X A;  3F8R A;  3D47 A;  3N4E A;  3SN4 A;  1L9D A;  1GRH A;  4K5S A;  3OPS A;  2Z5X A;  3AB1 A;  4Z17 A;  4A6N A;  5BUK A;  4HYR A;  3AWI A;  1P2E A;  2QDD A;  3OC4 A;  2GH5 A;  2BYB A;  4JN7 A;  1GXF A;  3PG6 A;  1PXB A;  2YR4 A;  1O95 A;  2YM2 A;  2PPG A;  1AOG A;  3K7Q X;  2XFN A;  2XSX A;  4HPN A;  3S5S A;  1B37 A;  2XLU A;  3NLC A;  2P8C A;  3V5C A;  2AAQ A;  4EM4 A;  1KCZ A;  3TTE A;  2GR1 A;  4U8L A;  1NEL A;  3T9P A;  4OPD A;  3THU A;  1S2Q A;  1VQZ A;  4E6M A;  4J2W A;  1T3Q C;  4A6N B;  3DGB A;  1FHU A;  2P88 A;  2OAM A;  2YG3 A;  2PA6 A;  2GGE A;  4OPL A;  1JPD X;  2VVL G;  3UJF A;  3AD7 B;  3SR6 B;  1BF3 A;  1PJ7 A;  2XFO A;  1KKO A;  3BHK A;  3RNM A;  4CBQ A;  3P4S A;  2RGJ A;  3AEA A;  3QLD A;  4IT1 A;  4GGH A;  1TZZ A;  3HYX A;  1SEZ A;  5LV9 A;  3BOX A;  2YG7 A;  4K1W A;  5EU9 A;  2B7R A;  3AN1 A;  2DKI A;  4Z44 A;  3AE8 A;  3NO1 A;  3PK7 A;  2YLW A;  3IWA A;  3UKF A;  4G8T A;  1XAN A;  3R0U A;  3RO6 A;  3FJ4 A;  2QAE A;  2B76 A;  2WPE A;  4MJW A;  4TLX A;  4TVY A;  1LPF A;  3I4K A;  4KWS A;  2BXS A;  3PWG A;  3FCP A;  1GEU A;  4AP1 A;  3GYJ A;  3NRN A;  1BWC A;  2VQ7 A;  2ONE A;  3CK5 A;  3P3B A;  1IUX A;  2BRY A;  4B64 A;  2MNR A;  3CT2 A;  1GRT A;  2GR2 A;  2FJA A;  1DJN A;  4ZN0 A;  3D1C A;  1ZY8 A;  1OJT A;  2GR0 A;  4G74 A;  4AT2 A;  2FJE A;  1GRG A;  1N61 C;  1EBG A;  5JCM A;  2BAB A;  2POD A;  3MZN A;  4BK2 A;  4MMW A;  1E9I A;  2Q6U A;  4FI4 A;  2E3T A;  1RM6 B;  3SBF A;  3SX6 A;  2XYO A;  1V97 A;  4C3X A;  1N63 C;  2PTZ A;  1F3P A;  3LZW A;  5KVH A;  2PS2 A;  3KU9 A;  3PFR A;  1CJ3 A;  3GC2 A;  3E1T A;  3OW1 A;  3OZM A;  3RP6 A;  2R9Z A;  3GY1 A;  3C96 A;  1ECQ A;  2W0H A;  1GES A;  1F8W A;  3AEE A;  2GMJ A;  3AE6 A;  1EC7 A;  4JHM A;  4J36 A;  1KSU A;  3QSE A;  2AR8 A;  1MNS A;  1K4Q A;  4TLZ A;  2HZG A;  3AEC A;  2DW7 A;  2ZBW A;  4J34 A;  3PWI A;  3RCY A;  2A89 A;  3D9X A;  1FFV C;  1R0M A;  3T4W A;  2WEU A;  3ZVI A;  3DJE A;  4XXG A;  3EKG A;  4H1Z A;  2BS4 A;  4G6H A;  3T31 A;  3WE0 A;  3HRD C;  5KMP A;  4EIQ A;  3CPH G;  1V59 A;  3UXL A;  3C4A A;  1GRA A;  5U63 A;  1K0L A;  3CPJ G;  1H7X A;  4B65 A;  4Z1Y A;  1P2H A;  2WDQ A;  1FCD A;  3AEB A;  1JRO A;  3UKK A;  4TM0 A;  1L9C A;  2HQM A;  3DME A;  4EQR A;  1SB3 B;  3BI5 A;  3QKE A;  2PTW A;  3KKJ A;  4EQX A;  3NVY B;  1PXA A;  4EMI A;  3NYF A;  1CC6 A;  2X8G A;  3VCC A;  5HXI A;  3GD6 A;  4H4V A;  3CNP A;  3BI4 A;  2PCE A;  3KD9 A;  2OQY A;  3IJL A;  2X99 A;  3GD3 A;  2R4J A;  4YTN A;  4FK1 A;  3VCN A;  2YVJ A;  3UOZ A;  3DG3 A;  5DBJ A;  1X31 B;  1PBF A;  1PXC A;  4UDP A;  4K2X A;  3RED A;  3ZLF A;  3NS1 B;  3FVD A;  4WCT A;  3SYI A;  3COX A;  2TPR A;  5KMQ A;  1CBO A;  3N6J A;  4Z26 A;  2PGW A;  2GAG B;  2FYM A;  4DSG A;  3GDN A;  1MO9 A;  1Q1R A;  3DA1 A;  2YVG A;  3QFA A;  2PHH A;  1N4U A;  3GRT A;  2PMQ A;  4PAB A;  4H2Q A;  2AL2 A;  3BHF A;  4ECH A;  5BRT A;  3KPF A;  2GF3 A;  1JNR A;  5U1O A;  3RR1 A;  3AYI A;  5J04 A;  2VVL A;  1GOS A;  5CKU A;  1YEY A;  1N5W C;  4U8O A;  3S61 A;  1YQZ A;  3NXL A;  1W6T A;  2TMD A;  4IVO B;  5IPY A;  1NG4 A;  3SZC A;  1IUS A;  2NVK X;  1ZOY A;  4HN8 A;  2VOU A;  1CL0 A;  3DIP A;  2WHD A;  3K1G A;  1XS2 A;  3B3R A;  4NZH A;  3CTY A;  2W54 A;  1VQW A;  4C74 A;  3UKA A;  4B68 A;  2AL2 B;  3P4P A;  2YLX A;  1IUU A;  2OZ3 A;  7ENL A;  3GO2 A;  2BK4 A;  1MOK A;  4GIR A;  5JCI A;  1EBD A;  3OTR A;  2YVF A;  2P3Z A;  2ZZ0 A;  2V3A A;  4OVI A;  2FJB A;  1NHR A;  1PBC A;  4K8G A;  1O94 A;  2YQU A;  2FBW A;  2WP9 A;  3C4N A;  1CJ4 A;  1JDF A;  3ENL A;  2YLT A;  1N62 C;  1MXT A;  3SGL A;  4K2S A;  5KVI A;  3K30 A;  4H19 A;  1RSG A;  2HXU A;  3LXD A;  3QFB A;  2GQW A;  4G73 A;  2NPX A;  5KMS A;  3IJI A;  4H4X A;  1TE6 A;  1D5T A;  1RVK A;  2B7S A;  4ZCC A;  3NTD A;  3BJS A;  3LAD A;  2PP3 A;  3A7R A;  3T2Z A;  2C4C A;  3EF6 A;  2MUC A;  3V3N A;  5IQ1 A;  1E39 A;  5FS8 A;  2C65 A;  3SJN A;  5EB5 A;  4HNC A;  3DDM A;  4TVW A;  3AYL A;  2X3N A;  1XPY A;  4IZG A;  2JK6 A;  4J3Z A;  2VRM A;  3ZDN A;  2ACZ A;  2JBV A;  2PU1 A;  1LTX R;  2QDE A;  4CCR A;  3H70 A;  3L1R A;  3UTG A;  2GGH A;  4B63 A;  3ZLG A;  3I3L A;  1OEP A;  1Y56 A;  4KX6 A;  3TWB A;  1N5X A;  3UCC A;  1GAL A;  3VRD B;  2V61 A;  2E1M A;  5FJP A;  2PTX A;  2E5V A;  4N9X A;  4D03 A;  3IHM A;  2ZZC A;  3KPK A;  1D4D A;  2PGE A;  3Q45 A;  4A35 A;  4GIS A;  1OJD A;  4JNA A;  3EPT A;  4YTM A;  2X8C A;  3TJI A;  5KXJ A;  1XHC A;  3DFY A;  5CQF A;  2FKP A;  4YSH A;  4EM3 A;  1R6W A;  3P9U A;  3NVZ B;  2QGY A;  1DJQ A;  1MDR A;  1PBB A;  2RDX A;  1GPE A;  4M52 A;  4NTE A;  1GRF A;  3EAN A;  3LB8 A;  1Y56 B;  4REK A;  2WP6 A;  3UP5 A;  4Z24 A;  3VDG A;  2X50 A;  1FEA A;  2XH4 A;  1JPM A;  3KA7 A;  1H82 A;  3LZX A;  1ONF A;  1B5Q A;  5FS7 A;  2OFJ A;  1JNZ A;  1ZP0 A;  5EOW A;  1E7P A;  3MSY A;  4X4J A;  2FJD A;  2POZ A;  2ZC8 A;  5BUL A;  3UTH A;  1M64 A;  1Z6L A;  3DJD A;  2JB1 A;  3R25 A;  2B9X A;  4UDQ A;  1QLB A;  2XLP A;  1QO8 A;  3G5R A;  2XVH A;  1PHH A;  3PVC A;  1L0V A;  4GUV A;  2HNE A;  4ADW A;  5C2T A;  2GV8 A;  4IA5 A;  2WQY A;  1PN0 A;  2O9Z A;  3QVP A;  1VDV A;  4ZA0 A;  4K5R A;  1FOH A;  5L46 A;  1H2I A;  1MDL A;  4MKS A;  1YQ3 A;  4TM3 A;  2HXT A;  1LQT A;  1YY5 A;  2ZZB A;  3L5O A;  4G6G A;  4Z2R A;  2WU2 A;  3AED A;  4DNA A;  1H83 A;  3SQP A;  4UDR A;  3JSK A;  4GYP C;  2YR5 A;  5TR3 A;  2PP1 A;  2B9Y A;  3P1W A;  2EQ9 A;  4YTP A;  3S47 A;  3P4R A;  2J3N A;  1OJA A;  2I5Q A;  4GAP A;  4YKG A;  5G5H B;  3AEG A;  3B6D A;  4XWR A;  1IUT A;  4BJY A;  2E4G A;  1IJH A;  2IVD A;  3MY9 A;  4JQ9 A;  2H89 A;  1MUC A;  4CY6 A;  2C3C A;  4FP1 A;  3SM8 A;  2WES A;  2W3R A;  4WX1 A;  2Q0K A;  2WOV A;  1LJ1 A;  5JCK A;  4K7Z A;  4Z2U A;  3GD4 A;  3DGZ A;  4OPC A;  1PDZ A;  4CRT A;  2R4E A;  1LV0 A;  1FO4 A;  3NYC A;  3NK0 X;  4AT0 A;  2GGJ A;  2WPC A;  1E6E A;  4NTC A;  3ZYX A;  3RP8 A;  3TQP A;  5KRQ A;  3NT6 A;  4USR A;  3O0H A;  2R0C A;  1DNC A;  3DGH A;  2OO6 A;  4GRT A;  2R45 A;  4KT2 A;  1XDI A;  5ENL A;  3SFD A;  1BZL A;  2BS3 A;  5FJU A;  1S7M A;  2GRT A;  1D4C A;  1GTE A;  4J56 A;  5HYM A;  3BSM A;  2C67 A;  4ICY A;  3GMB A;  3CXB A;  3ICT A;  1WUE A;  4CNK A;  1TDE A;  2R0G A;  3UKP A;  3H4K A;  3ICR A;  1ONE A;  4FX9 A;  3Q9T A;  4DXK A;  3FBS A;  4A6G A;  1D7Y A;  1JRX A;  1HYU A;  5M0Z A;  2GGI A;  4H4T A;  2PYX A;  4TM4 A;  4IL0 A;  2PTY A;  4J57 A;  1NAA A;  2XCG A;  1JRP A;  3A7U A;  3M12 A;  4U2S A;  5FJO A;  1B4V A;  2YM1 A;  4M6U A;  1FEB A;  3DH9 A;  5FS9 A;  3NH3 X;  3CPI G;  2BK3 A;  2AKZ A;  4OPI A;  1KDG A;  2C76 A;  3DJJ A;  3ATQ A;  3I6T A;  4MGG A;  2A8X A;  3CIR A;  2WBA A;  2AQJ A;  4X2P A;  4HCL A;  3P4Q A;  3VRA A;  4H2N A;  2XH7 A;  3AEF A;  2GAH B;  2OZT A;  2CFY A;  5GRT A;  4OPG A;  2C75 A;  3UJ2 A;  2H88 A;  4ZCD A;  3DFH A;  1H7W A;  4LII A;  3DJG X;  4H4Z A;  3VC5 A;  3CNT A;  3CNJ A;  1VG0 A;  3MUC A;  1ZK7 A;  3LOV A;  1JRZ A;  4I59 A;  5FMH A;  1E1N A;  5EBK A;  4H50 A;  2CUL A;  2XLT A;  2C73 A;  3AE1 A;  2VRL A;  4A5L A;  2BC0 A;  2EQ6 A;  4EQW A;  1KKR A;  4A3R A;  2Y6Q A;  4YXD A;  3VR9 A;  1ELI A;  3GYX A;  2IID A;  4U8N A;  1Q9I A;  3KLJ A;  4IL2 A;  1X2G A;  3HYV A;  1ZOV A;  5FJT A;  4II2 A;  2YLZ A;  2UZZ A;  1KF6 A;  1PJ6 A;  1DXL A;  3F8P A;  4J33 A;  4A79 A;  1EL5 A;  4YSZ A;  1L9E A;  1GT8 A;  1DOE A;  3H8I A;  4EIP A;  5KNL A;  1NPX A;  3DG6 A;  3NTA A;  1F8S A;  1KNP A;  3SZW A;  3ITJ A;  2F5Z A;  3T14 A;  3AE3 A;  4H4R A;  2C72 A;  4I58 A;  1E1L A;  3NFU A;  2GDQ A;  4IV9 A;  5EB4 A;  5BOE A;  1NHS A;  1MRA A;  3HW2 A;  5HY5 A;  3FMW A;  2P0I A;  4JY2 A;  2WP5 A;  2WU5 A;  3MWC A;  2YG5 A;  1B8S A;  4E5T A;  5M10 A;  1BQG A;  2OLA A;  2YLS A;  3RIT A;  4IA6 A;  4AOS A;  2PU0 A;  3AE4 A;  3UOV A;  4ZOH B;  4ZCW A;  1NU5 A;  3HPF A;  1H86 A;  2BS2 A;  3AE7 A;  4G7F A;  1H81 A;  2GVC A;  3HZL A;  1H84 A;  3OZ2 A;  5BVA A;  2XH0 A;  2YG4 A;  1GET A;  1E1M A;  2Y6R A;  3SY4 A;  1WUF A;  3ALM A;  2BC1 A;  4EQS A;  2QA2 A;  3I6E A;  1JOA A;  3DES A;  1ZKQ A;  1DOD A;  2GL5 A;  3TW9 A;  3KVE A;  4J31 A;  4X9M A;  1DOC A;  4U2L A;  4H83 A;  2RGH A;  3CND A;  1LVL A;  3MKC A;  4NTD A;  3NYE A;  3AD8 B;  1SJB A;  3BNU A;  3QJ4 A;  1F9C A;  3V4B A;  3BNM A;  4Z43 A;  3T8Q A;  1D4E A;  4DSH A;  4GAV A;  4U8K A;  4J1O A;  4U8J A;  1TDF A;  2YWL A;  4EMJ A;  3RP7 A;  2OPJ A;  3GRS A;  1KN0 A;  3OP2 A;  3CN8 A;  4DGK A;  3UJE A;  4H2H A;  3G5S A;  3ADA B;  4U8I A;  3A7A A;  3B9J B;  2JAE A;  3ES8 A;  1SJD A;  2OLO A;  1CJC A;  4Y4N A;  3CGE A;  4K22 A;  4F4R A;  1S3E A;  5J60 A;  4U2T A;  1EC8 A;  3IF9 A;  3UP4 A;  3NKS A;  3VFC A;  1TDO A;  3NNE A;  3DK9 A;  2A87 A;  1LQU A;  1E1K A;  2BK5 A;  1X2H A;  3CGC A;  3ISH A;  3NVV B;  4CY8 A;  6ENL A;  2XVE A;  2XVF A;  1PDY A;  2DW6 A;  3AMZ A;  3EAO A;  3UKL A;  2YR6 A;  1N4W A;  3NRZ B;  3IHG A;  3JW7 A;  2V5Z A;  1PBE A;  5BOF A;  4B67 A;  2BRA A;  3M0O A;  3SSZ A;  4GGB A;  1N1P A;  2GB0 A;  1TDK A;  4A99 A;  4FK1 C;  3RGT A;  1JCT A;  1O5W A;  1K0J A;  2CVJ A;  3FPZ A;  4RSL A;  4USQ A;  1BGJ A;  3N4F A;  3U9I A;  3NG7 X;  4BV6 A;  1FHV A;  1PDH A;  4AP3 A;  4YSX A;  1NHQ A;  1JRY A;  3CB3 A;  3CXO A;  3VC6 A;  3SZF A;  3H8L A;  4GF7 A;  3AE2 A;  4E8G A;  5IQ4 A;  1GRE A;  4DHG A;  3IJQ A;  4H4Q A;  4A65 A;  4B66 A;  3T2Y A;  2OQH A;  3UJS A;  3GYI A;  2V6O A;  3EUB 3;  1BKW A;  3PO7 A;  3AXB A;  1IUW A;  2WPF A;  1Q1W A;  4RG3 A;  2QJJ A;  3ICS A;  5JCL A;  2RGO A;  4G9K A;  1GTH A;  5KMR A;  3D8X A;  2GR3 A;  1EL9 A;  3R10 A;  2OZ8 A;  1KNR A;  2O56 A;  3R9U A;  3URH A;  3QN3 A;  4X9N A;  1VRQ B;  4BK3 A;  3UOY A;  3MQT A;  3CMM A;  1STZ A;  4DYE A;  1Y0P A;  1F6M A;  2APG A;  1NG3 A;  3NK2 X;  4BJZ A;  2XGZ A;  1NEK A;  4A9W A;  5C3J A;  1SJA A;  2NQL A;  1WYG A;  4H2P A;  3NN6 X;  4M0X A;  2WOI A;  2GMH A;  2OLN A;  1N4V A;  2BCG G;  1GRB A;  1SJC A;  1RYI A;  3GMC A;  2XVI A;  2CHR A;  4JDR A;  3NIX A;  2E5A A;  5U25 A;  3TJ4 A;  3FXG A;  1COY A;  3T0K A;  4K8D A;  2JKC A;  1KFY A;  4U8P A;  3KUM A;  3CGB A;  3UJR A;  3D46 A;  2BCP A;  3GWF A;  4NEW A;  2JB2 A;  3OZY A;  3GDP A;  3K7T A; 
#chains in the Genus database with same CATH homology
 4YWO A;  2R46 A;  4OVI A;  3OC4 A;  1VG0 A;  2GH5 A;  1M6I A;  2BYB A;  2FJB A;  1NHR A;  4YSY A;  1PBC A;  1PS9 A;  1ZK7 A;  1O94 A;  1GXF A;  3PG6 A;  3LOV A;  1PXB A;  1JRZ A;  2YQU A;  2YR4 A;  2FBW A;  1O95 A;  3CGD A;  2YM2 A;  1AOG A;  4I59 A;  3K7Q X;  5FMH A;  2WP9 A;  2XFN A;  2XLU A;  1B37 A;  1E1N A;  3LJP A;  3NLC A;  5EBK A;  3C4N A;  4CCQ A;  4H50 A;  5KOW A;  2CUL A;  2AAQ A;  2XLT A;  1CJ4 A;  2C73 A;  1CC4 A;  4EM4 A;  2YLT A;  3AE1 A;  2VRL A;  2RAB A;  3ALJ A;  4II3 A;  1MXT A;  1VDC A;  3SGL A;  4A5L A;  5KVI A;  2BC0 A;  2EQ6 A;  3K30 A;  1RSG A;  3FG2 P;  4EQW A;  1REO A;  3LXD A;  3QFB A;  2GQW A;  1EL8 A;  4G73 A;  2NPX A;  5KMS A;  4H4X A;  2C70 A;  2Y6Q A;  4YXD A;  3NN0 X;  3VR9 A;  1ELI A;  3GYX A;  2GR1 A;  4H2R A;  4U8L A;  2IID A;  1D5T A;  4U8N A;  1Q9I A;  2YG6 A;  4FDC B;  1FEC A;  4OPD A;  1GSN A;  4BK1 A;  2B7S A;  3KLJ A;  1S2Q A;  4J2W A;  2ARD A;  3NTD A;  4ZCC A;  3BI2 A;  3HYV A;  3LAD A;  4A6N B;  3DK8 A;  1ZOV A;  1H6V A;  4II2 A;  2YLZ A;  3PS9 A;  3T2Z A;  2C4C A;  5FS6 A;  1W4X A;  3EF6 A;  2XFU A;  2UZZ A;  2OAM A;  2YG3 A;  2I0Z A;  3F8D A;  1KF6 A;  4OPL A;  3V3N A;  1PJ6 A;  1PBD A;  2VVL G;  1DXL A;  5IQ1 A;  1JU2 A;  1E39 A;  5FS8 A;  2C65 A;  3AD7 B;  5EB5 A;  4H4U A;  1BF3 A;  4AOX A;  1PJ7 A;  2XFO A;  3F8P A;  3NHO X;  4J33 A;  3AYL A;  2BA9 A;  4A79 A;  1EL5 A;  3BHK A;  3RNM A;  4YSZ A;  4CBQ A;  2X3N A;  1L9E A;  5ER0 A;  1DOE A;  1GT8 A;  3H8I A;  4EIP A;  3P4S A;  4O5Q A;  2JK6 A;  5KNL A;  1NPX A;  2RGJ A;  2XFP A;  3NTA A;  2VRM A;  4D04 A;  3ZDN A;  2XFQ A;  3AEA A;  2ACZ A;  1TYT A;  1F8S A;  1KNP A;  2JBV A;  4LA1 A;  1LTX R;  2R0P A;  4UP3 A;  3SZW A;  3ATR A;  3ITJ A;  2F5Z A;  3T14 A;  3GWD A;  3AE3 A;  4APN A;  2WS3 A;  3HYX A;  4CCR A;  4H4R A;  1SEZ A;  2C72 A;  2C7G A;  4I58 A;  5LV9 A;  1K0I A;  3L1R A;  1E1L A;  2VZ2 A;  3UTG A;  4JY3 A;  4H4S A;  4B63 A;  3I3L A;  4IV9 A;  1Y56 A;  3IC9 A;  2YG7 A;  5EB4 A;  3FIM B;  4KX6 A;  1NHS A;  1OJC A;  1GAL A;  3VRD B;  5HY5 A;  2V61 A;  2E1M A;  3FMW A;  2B7R A;  4JY2 A;  3T2K A;  2WP5 A;  2DKI A;  2WU5 A;  2YG5 A;  1B8S A;  4Z44 A;  2E5V A;  5M10 A;  3AE8 A;  4N9X A;  2YLW A;  4D03 A;  2Q0L A;  3IHM A;  2ZZC A;  2YLS A;  3KPK A;  1D4D A;  4YKF A;  4IA6 A;  4AOS A;  3IWA A;  3UKF A;  3AE5 A;  4JN9 A;  1CHU A;  3AE4 A;  1XAN A;  3UOV A;  3V76 A;  2C64 A;  1NHP A;  1OJD A;  4JNA A;  2QAE A;  2B76 A;  2WPE A;  3EPT A;  4MJW A;  4YTM A;  2X8C A;  4TLX A;  5KXJ A;  1LPF A;  1XHC A;  2V3B A;  5CQF A;  1H86 A;  2BS2 A;  1EL7 A;  2BXS A;  3CNS A;  4YSH A;  4EM3 A;  3AE7 A;  2QA1 A;  3P9U A;  3SXI A;  1H81 A;  1GEU A;  1S2Y A;  4AP1 A;  2GVC A;  1DJQ A;  1GV4 A;  4EMW A;  3GYJ A;  3HZL A;  1H84 A;  3OZ2 A;  1PBB A;  3SFE A;  5BVA A;  3NRN A;  1GPE A;  2YG4 A;  4OPT A;  2YAU A;  1GET A;  4M52 A;  1E1M A;  2Y6R A;  3QSS A;  3SY4 A;  4NTE A;  4GCM A;  3ALM A;  4TM1 A;  2BC1 A;  1GRF A;  3EAN A;  1BWC A;  3LB8 A;  1Y56 B;  1NDA A;  2VQ7 A;  3G5Q A;  4REK A;  1IUX A;  2BRY A;  4EQS A;  2OA1 A;  2WP6 A;  1OJ9 A;  2QA2 A;  4CNJ A;  3UP5 A;  4Z24 A;  4B64 A;  1GRT A;  1JOA A;  3Q6J A;  2V60 A;  3UOX A;  1S3B A;  2GR2 A;  2FJA A;  1ZKQ A;  1DOD A;  1DJN A;  2X50 A;  4ZN0 A;  3D1C A;  3UCL A;  3V3O A;  1FEA A;  3KVE A;  1ZY8 A;  4J31 A;  1OJT A;  2GR0 A;  4G74 A;  4X9M A;  4AT2 A;  2FJE A;  1DOC A;  1H82 A;  3KA7 A;  3LZX A;  4U2L A;  1GRG A;  1ONF A;  2EQ8 A;  1B5Q A;  2OAL A;  5JCM A;  2BAB A;  2RGH A;  5FS7 A;  2BXR A;  3UTE A;  4BK2 A;  5EOW A;  1JNZ A;  1ZP0 A;  2BAC A;  1E7P A;  4X4J A;  3CND A;  2Q6U A;  2FJD A;  2IVE A;  1LVL A;  1TYP A;  4NTD A;  3NYE A;  5BUL A;  3AD8 B;  1M64 A;  3BNU A;  1Z6L A;  3QJ4 A;  3UTH A;  3DJD A;  2JB1 A;  2B9X A;  4UDQ A;  3SX6 A;  2XYO A;  3BNM A;  4C3X A;  4Z25 A;  1QLB A;  4Z43 A;  2XLP A;  2WDV A;  1QO8 A;  1D4E A;  1F3P A;  3G5R A;  5KVH A;  2XVH A;  3LZW A;  5HHF A;  4DSH A;  4GDE A;  1PHH A;  4GAV A;  4U8K A;  4U8J A;  3KU9 A;  1CJ3 A;  1TDF A;  2YWL A;  3PVC A;  1L0V A;  4EMJ A;  3E1T A;  4GUV A;  3RP7 A;  2WDR A;  3GRS A;  3RP6 A;  2R9Z A;  4ADW A;  4GDP A;  4U8M A;  1KN0 A;  2Q7V A;  5C2T A;  1XPQ A;  3CN8 A;  3C96 A;  2W0H A;  2GV8 A;  4IA5 A;  2WQY A;  1GES A;  1F8W A;  1PN0 A;  1D7L A;  3AEE A;  2O9Z A;  4DGK A;  2GMJ A;  3AE6 A;  4P9S A;  4J36 A;  1KSU A;  3QSE A;  2AR8 A;  3QVP A;  5JRB A;  2XLS A;  3T37 A;  1K4Q A;  3G5S A;  4B1B A;  4TLZ A;  4K5R A;  3ADA B;  4U8I A;  3AEC A;  3UKQ A;  2JAE A;  1FOH A;  4HA6 A;  2ZBW A;  4J34 A;  5L46 A;  1H2I A;  4A7A A;  3QVR A;  4JNQ A;  2OLO A;  1CJC A;  1YQ3 A;  4Y4N A;  3CGE A;  4TM3 A;  4K22 A;  3QSM A;  1LQT A;  1QJD A;  2B9W A;  1S3E A;  2A89 A;  3D9X A;  1YY5 A;  5J60 A;  2ZZB A;  2WEU A;  2XVJ A;  4U2T A;  3L5O A;  3DJE A;  4XXG A;  4G6G A;  3NK1 X;  4Z2R A;  3IF9 A;  2WU2 A;  2QCU A;  3AED A;  2BS4 A;  4G6H A;  3UP4 A;  3T31 A;  3NGC X;  3NKS A;  4DNA A;  3WE0 A;  4Z2T A;  1H83 A;  3SQP A;  4H4Y A;  4UDR A;  5KMP A;  1TDO A;  3K7M X;  3NNE A;  3CPH G;  4EIQ A;  3DK9 A;  3JSK A;  2GQF A;  2A87 A;  1V59 A;  3C4A A;  1GRA A;  2YR5 A;  5TR3 A;  1LQU A;  4E0V A;  1E1K A;  5U63 A;  1K0L A;  3PO7 A;  3CPJ G;  2WOW A;  2B9Y A;  4RG4 A;  4O5U A;  1H7X A;  3P1W A;  2EQ9 A;  4B65 A;  1P2H A;  1F8R A;  4YTP A;  1RP0 A;  2WDQ A;  3VQR A;  2BK5 A;  1FCD A;  3GSI A;  3CGC A;  3AEB A;  3P4R A;  3UKK A;  2J3N A;  3ISH A;  1GND A;  1OJA A;  1TDN A;  4GAP A;  4TM0 A;  4CY8 A;  2XVE A;  4YKG A;  1L9C A;  2XVF A;  2HQM A;  1ZDL A;  4KPR A;  1CJ2 A;  2DKH A;  3DME A;  3EAO A;  1KSS A;  3UKL A;  1ZMD A;  4EQR A;  2YR6 A;  3AEG A;  3BI5 A;  4GR1 A;  3UKH A;  3B6D A;  1N4W A;  3IHG A;  3KKJ A;  4XWR A;  4B69 A;  4EQX A;  1IUT A;  4BJY A;  2V5Z A;  3L8K A;  1IJH A;  1PBE A;  2E4G A;  2IVD A;  4B67 A;  5KWF A;  1IUV A;  2BRA A;  1PXA A;  1PJ5 A;  3M0O A;  4JQ9 A;  2H89 A;  1N1P A;  4EMI A;  2GB0 A;  1TDK A;  4A99 A;  4FK1 C;  3NYF A;  1O5W A;  4CY6 A;  2C3C A;  1K0J A;  1CC6 A;  2CVJ A;  3FPZ A;  3AD9 B;  2X8G A;  1JEH A;  4RSL A;  4USQ A;  1BGJ A;  3SM8 A;  5HXI A;  3NG7 X;  4BV6 A;  1PDH A;  4YSX A;  4AP3 A;  2C66 A;  1NHQ A;  1JRY A;  4H4V A;  3CNP A;  2WES A;  3BI4 A;  4WX1 A;  2Q0K A;  2WOV A;  1LJ1 A;  4H4W A;  1FL2 A;  2X8H A;  5JCN A;  5JCK A;  4K7Z A;  3SZF A;  3KD9 A;  4Z2U A;  2XLR A;  3H8L A;  4GF7 A;  2WET A;  3ABV A;  3GD4 A;  3DGZ A;  3AE2 A;  1YKJ A;  3DK4 A;  4OPC A;  2X99 A;  4CRT A;  3GD3 A;  3I6D A;  2R4J A;  2R4E A;  4Y4L A;  1LV0 A;  5IQ4 A;  1GRE A;  3NYC A;  2YLR A;  4YTN A;  3NK0 X;  4FK1 A;  4H4Q A;  4A65 A;  3S5W A;  4AT0 A;  2WPC A;  2YVJ A;  4B66 A;  1E6E A;  3UOZ A;  4NTC A;  3ZYX A;  3T2Y A;  3RP8 A;  3SZ0 A;  3VR8 A;  5KOX A;  3GYI A;  2C3D A;  2Z5Y A;  5DBJ A;  2V6O A;  3NT6 A;  1X31 B;  4USR A;  5KRQ A;  1BKW A;  3O0H A;  1PBF A;  1DNC A;  3DGH A;  2R0C A;  4GRT A;  2R45 A;  3ALL A;  1PXC A;  3AXB A;  1XDI A;  1IUW A;  2GEW A;  3SFD A;  4IVM B;  2WPF A;  4UDP A;  1BZL A;  4K2X A;  1Q1W A;  3RHA A;  4RG3 A;  3RED A;  3ICS A;  2BS3 A;  5JCL A;  2RGO A;  4WCT A;  4G9K A;  1GTH A;  3SYI A;  1S7M A;  2GRT A;  5KMR A;  1D4C A;  1GTE A;  4J56 A;  3COX A;  2TPR A;  5HYM A;  3D8X A;  4OPU A;  5KMQ A;  3VRB A;  1CBO A;  2C67 A;  4ICY A;  4Z26 A;  2XDO A;  2GAG B;  2GR3 A;  2VQB A;  1ZMC A;  3GDN A;  4DSG A;  1MO9 A;  1Q1R A;  2VVM A;  3DA1 A;  1EL9 A;  2YVG A;  1CF3 A;  3GMB A;  3ICT A;  3QFA A;  4CNK A;  1KNR A;  2PHH A;  1TDE A;  5GSN A;  2R0G A;  3R9U A;  3UTF A;  3URH A;  1N4U A;  3M13 A;  3UKP A;  3H4K A;  3ICR A;  4X9N A;  4LU6 A;  3GRT A;  1VRQ B;  4FX9 A;  4BK3 A;  4OCG A;  1ZX9 A;  1TRB A;  3UOY A;  2JB3 A;  3Q9T A;  3CMM A;  4PAB A;  3FBS A;  4H2Q A;  1Y0P A;  1F6M A;  2APG A;  1NG3 A;  3NK2 X;  4BJZ A;  1NEK A;  1D7Y A;  4HB9 A;  4A9W A;  1JRX A;  3II4 A;  1HYU A;  5C3J A;  4C3Y A;  3BHF A;  4ECH A;  1CC2 A;  5BRT A;  3AE9 A;  3KPF A;  1NEN A;  5M0Z A;  4H4T A;  3HYW A;  4H2P A;  4XWZ A;  2GF3 A;  2PYX A;  1JNR A;  4H7U A;  3NN6 X;  4TM4 A;  5U1O A;  2XCG A;  4J57 A;  1NAA A;  3AYI A;  4H4P A;  3M12 A;  2VVL A;  4U2S A;  1B4V A;  2YM1 A;  4NEV A;  1FEB A;  1GOS A;  4U8O A;  5CKU A;  2CDU A;  2WOI A;  2EQ7 A;  3DH9 A;  3S61 A;  5FS9 A;  3NH3 X;  1YQZ A;  1UKV G;  2BK3 A;  1GER A;  2GMH A;  2OLN A;  3CPI G;  4C5O A;  2TMD A;  1N4V A;  2BCG G;  4IVO B;  3AYJ A;  4OPI A;  1KDG A;  2C76 A;  1DOB A;  3DJJ A;  3ATQ A;  4YT0 A;  5IPY A;  4BUR A;  1GRB A;  4NWZ A;  1NG4 A;  1RYI A;  3GMC A;  2A8X A;  1IUS A;  3CIR A;  4PAA A;  2WBA A;  2AQJ A;  2NVK X;  3SZC A;  2XVI A;  4NNJ A;  4JDR A;  3NIX A;  4Y4M A;  3P4Q A;  1ZOY A;  3VRA A;  4C77 A;  4H2N A;  1VG9 A;  2VOU A;  5U25 A;  1CL0 A;  2WHD A;  1YQ4 A;  3AEF A;  3B3R A;  4NZH A;  1BGN A;  1COY A;  3T0K A;  2GAH B;  4K8D A;  2JKC A;  3CTY A;  1KFY A;  1VQW A;  4OPG A;  2CFY A;  5GRT A;  3F8R A;  5J7X A;  4C74 A;  2C75 A;  4U8P A;  3UKA A;  4B68 A;  3P4P A;  1L9D A;  2YLX A;  1IUU A;  3CGB A;  1GRH A;  2H88 A;  4ZCD A;  1H7W A;  4K5S A;  2BCP A;  4LII A;  3GWF A;  3DJG X;  4NEW A;  2Z5X A;  2JB2 A;  3AB1 A;  2BK4 A;  1MOK A;  4H4Z A;  5JCI A;  4A6N A;  5BUK A;  3CNT A;  1EBD A;  2YVF A;  2ZZ0 A;  2V3A A;  3AWI A;  1P2E A;  3CNJ A;  3GDP A;  3K7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...