2V3BA

Crystal structure of the electron transfer complex rubredoxin - rubredoxin reductase from pseudomonas aeruginosa.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
381
structure length
381
Chain Sequence
RAPLVIIGTGLAGYNLAREWRKLDGETPLLMITADDGRSYSKPMLSTGFSKNKDADGLAMAEPGAMAEQLNARILTHTRVTGIDPGHQRIWIGEEEVRYRDLVLAWGAEPIRVPVEGDAQDALYPINDLEDYARFRQAAAGKRRVLLLGAGLIGCEFANDLSSGGYQLDVVAPCEQVMPGLLHPAAAKAVQAGLEGLGVRFHLGPVLASLKKAGEGLEAHLSDGEVIPCDLVVSAVGLRPRTELAFAAGLAVNRGIVVDRSLRTSHANIYALGDCAEVDGLNLLYVMPLMACARALAQTLAGNPSQVAYGPMPVTVKTPACPLVVSPPPRGMDGQWLVEGSGTDLKVLCRDTAGRVIGYALTGAAVNEKLALNKELPGLMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Electron Transfer Complex Rubredoxin - Rubredoxin Reductase from Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords RUBREDOXIN REDUCTASE
total genus 116
structure length 381
sequence length 381
ec nomenclature ec 1.18.1.1: Rubredoxin--NAD(+) reductase.
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF18113 Rbx_binding Rubredoxin binding C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.120 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2v3bA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2v3bA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2v3bA02
1VG9A 1PBEA 2JKCA 3F8PA 1D5TA 5GRTA 3ATQA 4GR1A 1BGNA 3GMCA 4H4ZA 3IHMA 2XFQA 3M0OA 1XDIA 2YR4A 1NENA 3CGDA 1IUWA 1NG4A 3QVPA 4EQXA 1LVLA 1L9CA 2BXSA 3DK8A 4AP1A 5M0ZA 5JCKA 4Y4LA 3RNMA 4EIPA 2Q0KA 4U8OA 3NTDA 3REDA 3URHA 2XLTA 1O5WA 2C64A 3H8IA 5FS7A 3GD4A 2FJDA 5EB4A 3NHOX 1NAAA 4U8NA 3AYJA 4H4QA 3KPFA 3CN8A 1RP0A 4J57A 2QAEA 3DJDA 1EL5A 4RG3A 3C96A 2GMHA 1CJ2A 4WX1A 1Y56B 1DODA 3AEDA 3ALMA 1AOGA 4NZHA 3F8RA 1CJ4A 1GRBA 4B65A 1LPFA 5EB5A 5IPYA 1IUUA 2TMDA 4Z26A 1O95A 1ELIA 4AT0A 1GNDA 3ISHA 1GRHA 2Y6QA 3D1CA 4Y4NA 4IVMB 2XVIA 5TR3A 4OPTA 1DOBA 3DA1A 1LV0A 2YLZA 2H89A 1CL0A 3DJJA 3KU9A 3QSEA 1VRQB 3UKPA 2OA1A 5ER0A 4J33A 4H4VA 2XLPA 3NIXA 4A9WA 2ZZBA 3PVCA 2R9ZA 4C3XA 5JCNA 2AR8A 2E4GA 3Q6JA 1KF6A 3VRBA 3UKAA 2ZZCA 3CNJA 4H4RA 4J2WA 2VZ2A 4PAAA 4Z44A 4B1BA 3LB8A 5HYMA 3G5SA 1OJTA 4CY6A 2E5VA 3Q9TA 2X8CA 2WDVA 4P9SA 3K7QX 4ZCDA 3ALJA 3COXA 2Y6RA 1NHSA 4K7ZA 4OCGA 1P2EA 1IUTA 2VRLA 2C3CA 4Y4MA 2C65A 2XLSA 1NHQA 3NRNA 3KVEA 3I3LA 1NHPA 1JU2A 2X3NA 3NNEA 5BRTA 3CNTA 2RGHA 1D7LA 1ZOYA 1YQ4A 1K4QA 1GRAA 4I59A 4DSHA 3AEBA 1DOEA 1BZLA 1OJDA 3BHFA 4B67A 4NTEA 3NH3X 2XFOA 1XPQA 1CC6A 4RG4A 3UOYA 1PS9A 2DKHA 3FPZA 4AOSA 3GDPA 4C5OA 3G5QA 1GERA 2GR0A 2C66A 3OZ2A 3K7MX 4MJWA 4UDPA 2CFYA 5KRQA 1CBOA 2GH5A 1ONFA 3SFEA 4BK2A 4Z2UA 4H2RA 4H2PA 4TM1A 3UKQA 1K0LA 4TM0A 5HHFA 1EL9A 1JRZA 1ZY8A 3ABVA 3PS9A 2GR1A 3G5RA 3P4QA 3RHAA 4EQSA 3DJEA 4EM4A 1LQUA 2VQBA 2YR5A 4BK1A 2IIDA 2GR2A 4OPUA 4H4XA 3CNSA 4C77A 1TDEA 1ZMCA 3BNMA 4A6NB 1F8RA 3C4NA 3NK2X 4JY3A 2GAHB 1YQ3A 3UCLA 2BS2A 4H4SA 1JEHA 2VOUA 1GEUA 4GDEA 3SM8A 1PXAA 3UOZA 5KOWA 3M12A 1QJDA 3PO7A 4OPIA 1B8SA 1GALA 4WCTA 1PBFA 2BC1A 4H4PA 1LTXR 1PBDA 2JB3A 2WDRA 4U8JA 4YKFA 2XYOA 4B66A 4CBQA 4D04A 2I0ZA 2DKIA 4YKGA 1Z6LA 5IQ4A 1PJ5A 1FEAA 3DGZA 2YLTA 1DJQA 3P4PA 4UDQA 4ECHA 1EL7A 1BGJA 3BI2A 4TM3A 1B4VA 1Q1RA 1YKJA 2H88A 1JOAA 3DMEA 4CNJA 4JDRA 1E7PA 3CIRA 1FECA 1F8WA 1TDFA 3SQPA 4A7AA 3NN0X 1TDOA 1O94A 1GPEA 4XXGA 5HY5A 4H50A 3EF6A 5CQFA 2B9XA 3UOVA 4K5RA 2JK6A 3QVRA 5EBKA 3IC9A 4J36A 2V6OA 2YVGA 2OLNA 2RGJA 2XVEA 3DK9A 3QFAA 4O5QA 3ZYXA 2BCPA 2JB2A 1MO9A 3NLCA 3QFBA 4YWOA 2WP5A 2ARDA 4C74A 3AE2A 2WETA 3SFDA 1PDHA 3AXBA 4ZN0A 2RGOA 3UKFA 2IVDA 1ZMDA 3GWDA 1KDGA 1VDCA 4EQWA 1B5QA 1VG0A 1M64A 3E1TA 5U25A 1K0IA 3NYFA 2WQYA 3AEGA 1TRBA 4NTDA 3NGCX 4DGKA 1W4XA 3AWIA 2ZBWA 1Q9IA 3FMWA 4U8MA 2BCGG 3H4KA 1GRGA 2BXRA 5LV9A 3CGBA 1SEZA 3NYCA 1Q1WA 3IWAA 2OLOA 3GSIA 1ZOVA 2C75A 2XDOA 3AD9B 1BF3A 2FBWA 2JAEA 1JRXA 2GMJA 1S2QA 2Q6UA 4GDPA 3DK4A 4KX6A 4UP3A 3NK1X 2YM2A 3P1WA 4X9MA 3VR9A 4Z2RA 1KSUA 2WEUA 3RP8A 1KNRA 2Z5YA 2R4JA 4EIQA 3L1RA 2BABA 1QO8A 2EQ8A 2WP6A 4OPDA 4CNKA 4H2NA 1CC4A 2JBVA 2QCUA 1GESA 1ZKQA 4ICYA 3VR8A 2ACZA 3AE4A 2XFNA 1NDAA 3BI4A 3IF9A 5FS8A 4AOXA 4EMWA 2YG6A 3AD8B 1Y56A 4DNAA 2BK5A 1X31B 3S61A 3GRSA 3VQRA 4FK1C 1P2HA 4EQRA 3B3RA 2Q7VA 3AD7B 2PHHA 3CPIG 2WESA 2GQFA 4NEWA 3SGLA 2J3NA 3S5WA 1FL2A 1M6IA 2GRTA 2TPRA 1D4CA 3KKJA 1S2YA 2BS3A 2XFPA 1NPXA 1TDKA 3L8KA 4J34A 4DSGA 1BWCA 4YTNA 3CPHG 3ZDNA 2YAUA 1DNCA 3AE9A 2WHDA 2Q0LA 3GDNA 3QSMA 4APNA 1JNRA 4YTMA 4OVIA 2EQ6A 2B7SA 2RABA 4JY2A 1KSSA 3LXDA 4U8IA 2X99A 4A6NA 3JSKA 3UKLA 4HA6A 5CKUA 2Z5XA 2WU5A 5C2TA 3QSSA 2R46A 1RSGA 1COYA 2BK3A 2YLWA 4NEVA 3UP4A 5KOXA 3UOXA 5BUKA 5FS9A 1FOHA 2B76A 3P4RA 4K22A 1GOSA 2XLRA 2PYXA 3K7TA 4LA1A 1GV4A 4TLXA 3T37A 2QA1A 4H4TA 5U1OA 3KD9A 4CRTA 4YT0A 3AE3A 2V3AA 1ZP0A 1CJCA 3ATRA 3EAOA 1PBBA 1F8SA 1H83A 1BKWA 4JNAA 4U2SA 3VRAA 4EMJA 1H82A 3CGEA 3VRDB 4USRA 4YSXA 2C67A 4X4JA 1H86A 1PXCA 4U2LA 1VQWA 3GMBA 1PXBA 5FMHA 2XLUA 4CY8A 1DXLA 2GF3A 2UZZA 1PHHA 2JB1A 2BS4A 3AE1A 4OPGA 3F8DA 2VQ7A 2BA9A 4UDRA 3AE8A 2FJEA 2R0GA 3DJGX 2YVJA 3M13A 4HB9A 4FK1A 3UTEA 2V60A 5U63A 1PN0A 3V3OA 2V3BA 2WOVA 4TLZA 4B69A 4GUVA 2WBAA 2YLXA 1MOKA 4AT2A 4B64A 5M10A 4IV9A 1FEBA 2V5ZA 1TDNA 3GD3A 4YSYA 3NN6X 4BJZA 3P4SA 4A65A 2C72A 3AE5A 4GRTA 2GEWA 4M52A 1DOCA 4B63A 2CDUA 1GRTA 4J31A 3BI5A 3FIMB 1EBDA 1L9EA 4H7UA 4N9XA 3R9UA 3WE0A 3AEEA 5L46A 2WU2A 2XCGA 3II4A 3HZLA 4EM3A 1IUVA 4H4WA 3V76A 3FBSA 5KXJA 1V59A 2GB0A 4AP3A 1JRYA 4REKA 1ZDLA 1MXTA 2NPXA 3D8XA 1YY5A 3RP7A 1TYPA 3AEAA 3AB1A 4BURA 1CF3A 4H4UA 2BACA 3DH9A 3CNDA 1ZX9A 2NVKX 1K0JA 1N4UA 3K30A 5KVHA 3NT6A 2C73A 4H2QA 2YLSA 4JN9A 4CCRA 2XFUA 2R0CA 4YXDA 2FJBA 2WPEA 1D4EA 1GSNA 2A89A 3GYJA 3NG7X 4U8LA 4LU6A 1E1MA 2V61A 1F6MA 3LJPA 4K5SA 1NHRA 1UKVG 3RP6A 2C76A 3FG2P 4IA6A 4B68A 5BULA 1L9DA 2YG7A 4ADWA 1GETA 1JNZA 4YTPA 4K8DA 1PJ6A 3LZXA 1GREA 4JNQA 3UTFA 4E0VA 2XVJA 1GXFA 3P9UA 2X8HA 3GYIA 1TYTA 1HYUA 1YQZA 2R45A 3AE7A 4OPCA 4XWZA 4YSHA 3UKHA 2X8GA 4OPLA 1KFYA 1EL8A 1CC2A 5DBJA 2B9WA 3BHKA 4C3YA 2O9ZA 1IUXA 3UP5A 3UTHA 4A5LA 4ZCCA 5KWFA 1E6EA 3LADA 3CTYA 2WOIA 4BK3A 4Z2TA 3CGCA 4U2TA 1CHUA 2R4EA 2VVMA 2WPFA 1N4WA 2YWLA 3AYIA 1OJ9A 1PJ7A 2EQ9A 4XWRA 3NKSA 3NK0X 4J56A 3AEFA 1GT8A 3OC4A 5J7XA 1H81A 2X50A 1FCDA 1D7YA 3I6DA 4GF7A 1F3PA 2F5ZA 2BK4A 1LJ1A 2B9YA 2AAQA 2VVLA 4FX9A 1REOA 2CVJA 5GSNA 4Z25A 1RYIA 2OAMA 2B7RA 3ICTA 3ADAB 3EPTA 1NG3A 3NYEA 5JCLA 3QJ4A 2GAGB 2XVFA 2BYBA 2W0HA 2E1MA 2QA2A 1DJNA 4LIIA 2BC0A 2EQ7A 2APGA 2IVEA 2YG4A 3GRTA 4RSLA 5JCIA 3ICSA 1E1NA 3AYLA 1IJHA 3ALLA 2WDQA 4GCMA 3UTGA 1E1LA 1B37A 1H84A 3EANA 4EMIA 3V3NA 2GR3A 4PABA 3AE6A 2C7GA 1L0VA 3AECA 1ZK7A 1LQTA 4Z24A 2WS3A 4USQA 1OJCA 2GVCA 2VRMA 2YG3A 1NEKA 2R0PA 1GTHA 3H8LA 3BNUA 2YR6A 3KA7A 2YG5A 3CNPA 1N1PA 4H4YA 5FS6A 1H7XA 4CCQA 4BJYA 3IHGA 5C3JA 2A8XA 3B6DA 1H6VA 1E39A 2GV8A 1H7WA 4A79A 4U8KA 3DGHA 4I58A 4D03A 3NTAA 5J60A 2A87A 3C4AA 4TM4A 4JQ9A 2ZZ0A 2HQMA 1Y0PA 5JCMA 2FJAA 2WOWA 3GWFA 2XVHA 2WP9A 1IUSA 1GRFA 2YM1A 2CULA 2YLRA 4O5UA 2C70A 3LZWA 4IVOB 3UKKA 2AQJA 5IQ1A 1QLBA 4FDCB 2C3DA 5HXIA 1N4VA 1D4DA 4U8PA 1CJ3A 4X9NA 4YSZA 2VVLG 3ICRA 5BVAA 1KNPA 2OALA 2YVFA 1PBCA 3LOVA 1E1KA 4KPRA 5KVIA 1XHCA 2YQUA 2WPCA 1S3EA 4K2XA 2GQWA 4IA5A 3ITJA 3O0HA 4NTCA 1GTEA 3CPJG 1OJAA 1S3BA 4Z43A 4BV6A 1XANA 5EOWA 4A99A 3KLJA
chains in the Genus database with same CATH superfamily
4GR1A 3IHMA 1XDIA 4EQXA 3UJEA 2BXSA 5JCKA 4U8OA 3N6JA 3NHOX 1NAAA 4U8NA 4J57A 1RP0A 2QAEA 4GMEA 1CJ2A 3F8RA 3T4WA 3GD6A 1BKHA 4ENLA 1EBHA 4Z26A 1O95A 1ELIA 4AT0A 1GNDA 4HN8A 3D1CA 4IVMB 3DFHA 4OPTA 3DA1A 1LV0A 3UKPA 2XH4A 5ER0A 4C3XA 2E4GA 3TWAA 1KF6A 2ZZCA 4H4RA 3CNJA 1TKKA 3PWGA 3RO6A 4Z44A 3ETRB 4MKSA 2E5VA 3Q9TA 2WDVA 4K7ZA 4OCGA 1X2GA 1JU2A 3IJQA 3P0WA 1ZOYA 3RR1A 4KEMA 1YQ4A 1KD0A 1BZLA 3ZLFA 1XPQA 3UOYA 3GDPA 3ZVIA 1FHVA 4G6HA 4UDPA 5KRQA 1ONFA 2PTZA 4H2RA 1K0LA 5IDZA 3P4QA 4EQSA 2W3RA 2IIDA 3KPKA 2AL2A 4H4XA 3BNMA 3VCCA 3C4NA 4H4SA 2VOUA 3PG6A 3TW9A 1GEUA 3M12A 1QJDA 1B8SA 3QTPA 4WCTA 2WDRA 2I0ZA 5IQ4A 3DFYA 3MSYA 1BGJA 4TM3A 2H88A 4CNJA 1F8WA 3NN0X 1TDOA 4H50A 3SR6B 3VA8A 2OLNA 3OZYA 3QFBA 1P48A 2ARDA 4E4FA 4ZN0A 1PDHA 3UKFA 2IVDA 3GWDA 1B5QA 1VG0A 1MUCA 3NVWB 3NYFA 1TRBA 4NTDA 1T3QC 1Q9IA 3CGBA 3NYCA 2XH0A 1ZXIC 2OLOA 3GSIA 2XDOA 2FBWA 4KX6A 1JRXA 1S2QA 4X9MA 2PA6A 3EUB3 2BABA 2WP6A 4CNKA 3FV9A 2JBVA 1GESA 2GL5A 3BI4A 1P43A 3HW2A 1X31B 1FFUC 2BK5A 4FK1C 4NEWA 3SGLA 2J3NA 3S5WA 1M6IA 3TOYA 2TPRA 3NVZB 3THUA 3T2ZA 2OG9A 1BWCA 4YTNA 3ZDNA 2Q0LA 1JNRA 4OVIA 3FCPA 4H2HA 3JSKA 3QSSA 1N5WC 3N6HA 2YLWA 3UOXA 3RRAA 5BUKA 5FS9A 3CAWA 2XLRA 4ZCWA 1GV4A 3SSZA 4HCHA 4CRTA 2QA1A 1ZP0A 4EMJA 3VRDB 2C67A 4X4JA 1PXCA 4U2LA 1KN0A 4YWSA 4HNCA 2JB1A 3VC5A 3SZCA 3M13A 5U63A 2V3BA 1PDYA 3T9PA 2WBAA 2YLXA 4YSYA 3UXLA 3NN6X 1JRPA 2CDUA 2QDDA 4N9XA 3R9UA 3WE0A 5L46A 2E5AA 1IUVA 2GB0A 1JRYA 2NPXA 2PU1A 3V5FA 3NT6A 4G73A 2YLSA 4JN9A 4CCRA 2GGIA 4YXDA 2WPEA 1GSNA 1D4EA 2V61A 3LJPA 1NHRA 1L9DA 1JNZA 3LZXA 1GREA 4JNQA 4E0VA 2XVJA 3P9UA 2X8HA 4OPCA 1TYTA 1HYUA 3AE7A 2X8GA 3SN0A 1KFYA 5DBJA 5KWFA 2O9ZA 4A5LA 3T2YA 2XH2A 2OLAA 3DG7A 4Z2TA 3CGCA 3ES8A 4U2TA 1CHUA 2VVMA 1N4WA 3R07C 4XWRA 4DN1A 3AEFA 1F3PA 2BK4A 3ENLA 3SXIA 1RYIA 2OAMA 2B7RA 3EPTA 1NG3A 2QJJA 2FKPA 1ONEA 2YG4A 3AYLA 3ALLA 1B37A 1E1LA 1H84A 2C7GA 3SYIA 1LQTA 1WUEA 2YG3A 3H8LA 3KA7A 3BJSA 1S7MA 2I5QA 1E39A 4A79A 3QPEA 4I58A 5FJTA 3NTAA 3R10A 3C4AA 4TM4A 1NELA 2HQMA 4E5TA 4U8PA 4X9NA 2VVLG 3VDGA 2YVFA 1JROA 1PBCA 1E1KA 1S3EA 3O0HA 3GO2A 1VG9A 1D5TA 5GRTA 3L5OA 2P0IA 1BGNA 3GMCA 1OEPA 4HCDA 1H2IA 1IUWA 1NG4A 4AP1A 3DK8A 2Q0KA 2XLTA 1O5WA 4ZA0A 3GD4A 2FJDA 4M6UA 3AYJA 4H4QA 3CN8A 1EL5A 4IP4A 4RG3A 4E8GA 2GMHA 1AOGA 3ALMA 3UJRA 1CJ4A 2CHRA 3SBFA 5EB5A 2OX4A 5TR3A 2YLZA 3KU9A 2H89A 2OA1A 4IL2A 4A9WA 2XLPA 2ZZBA 2R9ZA 5BOFA 1SJDA 3H7VA 4PAAA 5KMPA 5HYMA 2E3TA 3G5SA 2QDEA 1OJTA 4CY6A 2W54A 3TCSA 2X8CA 2C3CA 1EC8A 1N60C 3STPA 3CNTA 2RGHA 6ENLA 1K4QA 1GRAA 4I59A 1KCZA 4B67A 3OPSA 2P88A 2GGGA 1RM6B 3NH3X 1CC6A 4RG4A 2DKHA 4II3A 4K8GA 3OZ2A 2P3ZA 2MUCA 1CBOA 4BK2A 3SFEA 3UKQA 5HHFA 3PS9A 3T14A 3T2KA 3G5RA 4EM4A 4BK1A 2YR5A 2GR2A 4OPUA 4DWDA 3CNSA 2GAHB 1JEHA 4GDEA 2AL2B 3TTEA 2BC1A 2O56A 4U8JA 4II2A 2DKIA 1Z6LA 3CYJA 3DGZA 3P4PA 1X2HA 1IYXA 1EL7A 3HYXA 3BI2A 1YKJA 1E7PA 5HY5A 3EF6A 2B9XA 3DDMA 4J36A 4A35A 4O5QA 3QFAA 1SB3B 3DK9A 2RGJA 2PSNA 3SJNA 1MO9A 4YWOA 2WP5A 4C74A 4GAPA 2WETA 3SFDA 1VDCA 2QGYA 1K0IA 3AEGA 4G7FA 3NGCX 4DGKA 3AM9A 1W4XA 3AWIA 3FMWA 4U8MA 2BCGG 3V5CA 1ZOVA 2C75A 2GMJA 2JAEA 4GDPA 2PP0A 3DK4A 3P1WA 1KSUA 2OPJA 2WEUA 3RP8A 3L1RA 1QO8A 4TVYA 2EQ8A 3B9JB 4OPDA 3UCDA 4H2NA 3K1GA 1CC4A 2QCUA 2ACZA 4AOXA 2XFNA 1NDAA 2YG6A 3AD8B 3HRDC 1P2HA 7ENLA 2WESA 3RCYA 4G74A 2BS3A 2XFPA 1NPXA 3L8KA 4J34A 2WHDA 4KWSA 4APNA 4YTMA 2B7SA 3AMZA 2Z5XA 5C2TA 4JN7A 4NEVA 2B76A 2PYXA 4LA1A 3T37A 4H4TA 2QJMA 3EAOA 3ATRA 1H83A 1BKWA 4U2SA 3VRAA 4USRA 1MNSA 3CK5A 3GMBA 1W6TA 2FJEA 2YVJA 4HB9A 3UTEA 2V60A 4A6GA 3DIPA 3V3OA 4B69A 2DW7A 3IK4A 4GUVA 5G5GB 4B64A 3N4EA 2V5ZA 4BJZA 4A65A 3CB3A 3AE5A 4GRTA 1DOCA 1GRTA 1MDRA 3BI5A 3FIMB 1L9EA 2GDQA 2OKTA 3VFCA 1FO4A 1JCTA 4EM3A 3UJSA 4H4WA 1V59A 4AP3A 4REKA 1MXTA 3D8XA 1TYPA 3NS1B 1CF3A 3HYVA 1ZX9A 4EWJA 2NVKX 1K0JA 3K30A 2QVHA 2C73A 1SJCA 4H2QA 3MY9A 3NRZB 3QN3A 2PMQA 2XFUA 2R0CA 2P8BA 3GYJA 3NG7X 2BRYA 4LU6A 1E1MA 1F6MA 4FI4A 3P93A 4G6GA 5BULA 4K8DA 4TVWA 2OQHA 3UTFA 1GXFA 1YQZA 4XWZA 3BHKA 3TJIA 1FHUA 3A7UA 3CMMA 4H19A 2R4EA 2YWLA 2WPFA 3AYIA 1PJ7A 2EQ9A 3NKSA 1WYGA 4DHGA 5J7XA 3QLDA 1FCDA 3I6DA 4IT1A 1LJ1A 2AAQA 4FX9A 4Z25A 3SY4A 1KKOA 2GAGB 2BYBA 4FP1A 2QA2A 4LIIA 2PTWA 3MWCA 2BC0A 4IP5A 3GRTA 3ICSA 2XSXA 1IJHA 2WDQA 3UCCA 4EMIA 3DEQA 2WS3A 4USQA 3UJ2A 2GVCA 2VRMA 1GTHA 3CNPA 4CCQA 3IHGA 5C3JA 2A8XA 4KPLA 1H6VA 5FJUA 1H7WA 4U8KA 3DGHA 4D03A 5J60A 2A87A 3BSMA 3ZVHB 5JCMA 2WOWA 2XVHA 1GRFA 3PK7A 2P8CA 3LZWA 1ECQA 3R11A 1QLBA 4FDCB 2OALA 5KVIA 1XHCA 2WPCA 4IA5A 1GTEA 3CPJG 4Z43A 4BV6A 3HYWA 3I6EA 2AKMA 4F4RA 1PBEA 2XH7A 4KT2A 4NNJA 1V97A 4H4ZA 2XFQA 3M0OA 2YR4A 1NENA 3QVPA 1LVLA 1DTNA 1L9CA 5M0ZA 4Y4LA 4GIRA 3NTDA 3REDA 3URHA 5EB4A 3KPFA 3PFRA 1Y56B 2PTYA 1GRBA 2OQYA 3OW1A 1LPFA 3SZFA 2TMDA 5BOEA 3ISHA 1GRHA 3DJJA 1DOBA 2ZADA 3NFUA 1VRQB 4H4VA 3PVCA 3Q6JA 4IL0A 5EU9A 3OZMA 4Z17A 4P9SA 3COXA 2Y6RA 1NHSA 3TWBA 4Y4MA 2C65A 3SN1A 3U4FA 3I3LA 3NNEA 1D7LA 3S47A 3BHFA 4NTEA 3KUMA 3FPZA 4IZGA 3DG3A 4C5OA 3G5QA 1GERA 2GR0A 3K7MX 2CFYA 3I4KA 4TM1A 4TM0A 3RHAA 4C77A 1ZMCA 4A6NB 3PWIA 3NK2X 4JY3A 1YQ3A 3UCLA 5KMQA 2HNEA 3DERA 4JHMA 1TE6A 4OPIA 1GALA 1PBFA 4H4PA 1LTXR 2XYOA 5JRBA 4D04A 4YKGA 4DX3A 2YLTA 1DJQA 4UDQA 3DESA 1TZZA 1Q1RA 1B4VA 1JOAA 3CXBA 3DMEA 4JDRA 3CIRA 3SQPA 1FECA 1TDFA 1O94A 1GPEA 3UGVA 4G9KA 3SZ0A 3ZLGA 4XXGA 2JK6A 3QVRA 3IC9A 2V6OA 3FJ4A 2XVEA 3SQSA 2JB2A 3NLCA 3AXBA 2RGOA 3I6TA 3R1ZA 1M64A 2WQYA 1MRAA 2ZBWA 2BXRA 5LV9A 2AL1A 1Q1WA 3IWAA 3H12A 3AD9B 2Q6UA 4UP3A 3VR9A 4Z2RA 1KNRA 3DG6A 2Z5YA 3NVYB 1WUFA 1XPYA 2PGEA 1ZKQA 3AE4A 2POZA 1N61C 3S61A 3GRSA 2QJNA 3B3RA 2QQ6A 2Q7VA 2PHHA 3CPIG 3Q45A 2GQFA 1FL2A 2ONEA 1KKRA 1TDKA 3CPHG 1DNCA 3AE9A 3QSMA 4A6NA 2EQ6A 4JY2A 1KSSA 4U8IA 3NXLA 4HA6A 2WU5A 2R46A 1RSGA 1COYA 2BK3A 4ROPA 3OP2A 2PP1A 3P4RA 4K22A 1GOSA 1SJAA 3AE3A 2V3AA 3ES7A 1PBBA 4JNAA 3P3BA 1H82A 3CGEA 4YSXA 1N5XA 1H86A 3D47A 4CY8A 2GSHA 1DXLA 3CXOA 2UZZA 2BS4A 3AE1A 3B97A 4OPGA 3F8DA 2VQ7A 2OFJA 4UDRA 2R0GA 4FK1A 3OTRA 3SX6A 1PN0A 4TLZA 2WOVA 4J3ZA 4IV9A 1FEBA 3GD3A 3P4SA 2C72A 4B63A 4M52A 2OZTA 4J31A 3AEEA 4H1ZA 2XCGA 2AKZA 3HZLA 2W55A 5FJRA 1ZDLA 1YY5A 3RP7A 3AEAA 3AB1A 4NWZA 4H4UA 4GYPC 2BACA 5J04A 1N4UA 5KVHA 3GY1A 1XS2A 2FJBA 2OZ8A 4Z1YA 4IA6A 4X2PA 2YG7A 1GETA 3IJLA 4MMWA 4YSHA 2R45A 1E9IA 2ZC8A 4C3YA 4ZCCA 3GC2A 3CTYA 2WOIA 4HNLA 1STZA 2MNRA 3VCNA 2X50A 1D7YA 2F5ZA 3N4FA 2B9YA 3T0KA 1REOA 2CVJA 5GSNA 3Q4DA 3FXGA 3ICTA 2PODA 3UXKA 3JVAA 3NYEA 5JCLA 2XVFA 2E1MA 1DJNA 2EQ7A 3HPFA 3ZVHA 1E1NA 3RGTA 4HYRA 3UTGA 3EANA 2PPGA 1R0MA 3QKEA 2FYMA 4IHCA 4PABA 3AE6A 1L0VA 2PU0A 4Z24A 1BQGA 1NEKA 3BNUA 5ENLA 2YG5A 1N1PA 1H7XA 4BJYA 3U9IA 2FJAA 3NZGA 3GWFA 2WP9A 1IUSA 4O5UA 2C70A 3UKKA 2AQJA 2C3DA 1D4DA 1KNPA 4KPRA 2YQUA 4K2XA 3T6CA 2GQWA 5KMSA 5G5HB 4NTCA 1OJAA 1XANA 5EOWA 4A99A 2OZ3A 2JKCA 2GGEA 3F8PA 4GAVA 3ATQA 3CGDA 4H83A 3RNMA 4EIPA 5FS7A 2C64A 3H8IA 2RDXA 3TJ4A 3DJDA 3T8QA 4K1WA 3C96A 4WX1A 1DODA 3AEDA 4DXKA 4NZHA 1FIQB 4B65A 5IPYA 1IUUA 3TQPA 1MDLA 3GYXA 2Y6QA 4Y4NA 2XVIA 2PP3A 1CL0A 3QSEA 4J33A 3NIXA 5JCNA 2AR8A 3VRBA 3UKAA 1ELSA 4J2WA 2VZ2A 2C4CA 4B1BA 3LB8A 2OO6A 3RITA 4ZCDA 3K7QX 3ALJA 3A7RA 1P2EA 1IUTA 2VRLA 2HXUA 2XLSA 1NHQA 3NRNA 3KVEA 1NHPA 3VC6A 2X3NA 5BRTA 4DYEA 4DSHA 3AEBA 1DOEA 1OJDA 2XFOA 1PS9A 4AOSA 4JN8A 2C66A 4MJWA 4Z2UA 2GGJA 2GH5A 4H2PA 3AN1A 1EL9A 1ZY8A 1JRZA 3ABVA 2GR1A 4MGGA 3DJEA 1LQUA 2VQBA 3FVDA 1N63C 3BOXA 1TDEA 1F8RA 2BS2A 4J1OA 3SM8A 1PXAA 3UOZA 5KOWA 3PO7A 4GYPA 1PBDA 2JB3A 4YKFA 4B66A 4CBQA 1PJ5A 1FEAA 4ECHA 3NO1A 1VQZA 1EBGA 4A7AA 1EC7A 5CQFA 3UOVA 4K5RA 1RVKA 3D46A 5EBKA 3CT2A 2YVGA 4E6MA 2HZGA 3ZYXA 2BCPA 3AE2A 1ZMDA 3R0KA 1KDGA 3V4BA 4EQWA 3MZNA 3E1TA 5U25A 2NQLA 3IJIA 3H4KA 1GRGA 1SEZA 3S5SA 3EEZA 1BF3A 3NK1X 2YM2A 1F9CA 3MKCA 2R4JA 4EIQA 4GGHA 1L8PA 4ICYA 3VR8A 3IF9A 4EMWA 5FS8A 3UJFA 4DNAA 1Y56A 4EQRA 3VQRA 3SN4A 3AD7B 3SZWA 1JPMA 2GRTA 1D4CA 3KKJA 1S2YA 1R6WA 4DSGA 1FFVC 3H8AA 1JDFA 1SJBA 2YAUA 3GDNA 3FYYA 3V3WA 2RABA 3LXDA 2X99A 3UKLA 5CKUA 3UP4A 5KOXA 1FOHA 4M0XA 3K7TA 4GFIA 3DGBA 4TLXA 5U1OA 4YT0A 3KD9A 1CJCA 1EC9A 1F8SA 5FMHA 3ZLHA 1VQWA 1PXBA 2XLUA 2GF3A 1PHHA 3H70A 3MUCA 4ZOHB 3NVVB 3JZUA 2BA9A 3AE8A 3DJGX 2PS2A 1N62C 4G8TA 1NU5A 1MOKA 4AT2A 5M10A 1TDNA 2GEWA 1PDZA 3MQTA 1EBDA 4H7UA 3D9XA 2WU2A 3II4A 1JPDX 3EKGA 3V76A 3FBSA 5KXJA 4GISA 4BURA 3DH9A 3CNDA 5FJPA 4U8LA 2A89A 2DW6A 4K5SA 3JW7A 1UKVG 3RP6A 2C76A 2W3SA 3FG2P 1VDVA 4B68A 4ADWA 4YTPA 1PJ6A 3GYIA 3UKHA 4OPLA 3T31A 1EL8A 1CC2A 2B9WA 3UP5A 1IUXA 3UTHA 3LADA 1E6EA 2GGHA 3A7AA 5FJOA 4BK3A 4HCLA 2BRAA 2XGZA 2HXTA 5KNLA 1OJ9A 3NK0X 4J56A 3OC4A 4A3RA 1GT8A 2PGWA 1H81A 4GF7A 2VVLA 2OVLA 3ADAB 3QJ4A 4HPNA 2W0HA 2PTXA 1YEYA 3R0UA 2APGA 2IVEA 4RSLA 5JCIA 4GGBA 4GCMA 3V3NA 2GR3A 3AECA 1ZK7A 1OJCA 2R0PA 2YR6A 4H4YA 5FS6A 3R25A 3B6DA 2GV8A 4JQ9A 2ZZ0A 1Y0PA 2YM1A 2CULA 2YLRA 4IVOB 5IQ1A 5HXIA 1N4VA 1CJ3A 4YSZA 3ICRA 5BVAA 4K2SA 3LOVA 5KMRA 2PCEA 4E4UA 3ITJA 1S3BA 3KLJA
chains in the Genus database with same CATH topology
1VG9A 1PBEA 2JKCA 3F8PA 1D5TA 5GRTA 3L5OA 4GAVA 3ATQA 4GR1A 4NNJA 1BGNA 3GMCA 4H4ZA 3IHMA 2XFQA 3M0OA 1H2IA 1XDIA 2YR4A 1NENA 3CGDA 1IUWA 1NG4A 3QVPA 4EQXA 1LVLA 1L9CA 2BXSA 3DK8A 4AP1A 5M0ZA 5JCKA 4Y4LA 3RNMA 4EIPA 2Q0KA 4U8OA 3NTDA 3REDA 3URHA 5FS7A 1O5WA 2C64A 2XLTA 3H8IA 3GD4A 2FJDA 5EB4A 3NHOX 1NAAA 4U8NA 3AYJA 4H4QA 4J57A 3CN8A 1RP0A 3KPFA 2QAEA 3DJDA 1EL5A 4RG3A 3C96A 2GMHA 1CJ2A 4WX1A 1Y56B 1AOGA 1DODA 3AEDA 3ALMA 4NZHA 3F8RA 1CJ4A 1GRBA 4B65A 1LPFA 5EB5A 5IPYA 1IUUA 3SZFA 2TMDA 4Z26A 1O95A 1ELIA 4AT0A 3GYXA 1GNDA 3ISHA 1GRHA 2Y6QA 3D1CA 4Y4NA 4IVMB 2XVIA 5TR3A 4OPTA 3DJJA 1DOBA 1LV0A 2YLZA 2H89A 1CL0A 3DA1A 3KU9A 3QSEA 1VRQB 4U8LA 2OA1A 3UKPA 5ER0A 4J33A 4H4VA 2XLPA 3NIXA 5JCNA 2ZZBA 3PVCA 2R9ZA 4A9WA 4C3XA 2AR8A 2E4GA 3Q6JA 1KF6A 3VRBA 3UKAA 2ZZCA 4H4RA 3CNJA 4J2WA 2VZ2A 2C4CA 4PAAA 5KMPA 4Z44A 4B1BA 3LB8A 5HYMA 3G5SA 1OJTA 4CY6A 2E5VA 3Q9TA 2X8CA 2WDVA 4P9SA 3K7QX 4ZCDA 3ALJA 3COXA 4K7ZA 1NHSA 2Y6RA 4OCGA 1P2EA 1IUTA 2VRLA 2C3CA 4Y4MA 2C65A 2XLSA 1NHQA 3NRNA 3KVEA 3I3LA 1NHPA 1JU2A 2X3NA 3NNEA 5BRTA 3CNTA 2RGHA 1D7LA 1ZOYA 1YQ4A 1K4QA 1GRAA 4I59A 4DSHA 3AEBA 1DOEA 1BZLA 1OJDA 3BHFA 4B67A 4NTEA 3NH3X 2XFOA 1XPQA 1CC6A 4RG4A 3UOYA 1PS9A 2DKHA 3FPZA 4AOSA 3GDPA 4C5OA 3G5QA 1GERA 4II3A 2GR0A 2C66A 3OZ2A 3K7MX 4MJWA 4G6HA 4UDPA 2CFYA 5KRQA 1CBOA 2GH5A 1ONFA 3SFEA 4BK2A 4Z2UA 4H2RA 4H2PA 4TM1A 3UKQA 1K0LA 4TM0A 5HHFA 1EL9A 1JRZA 1ZY8A 3ABVA 3PS9A 3T14A 3T2KA 2GR1A 3G5RA 3P4QA 4EQSA 3RHAA 4EM4A 3DJEA 1LQUA 2VQBA 2YR5A 4BK1A 2IIDA 2GR2A 3KPKA 4OPUA 4H4XA 3CNSA 4C77A 1ZMCA 1TDEA 3BNMA 4A6NB 1F8RA 3C4NA 3NK2X 4JY3A 1YQ3A 2GAHB 3UCLA 2BS2A 4H4SA 1JEHA 2VOUA 5KMQA 3PG6A 1GEUA 4GDEA 3SM8A 1PXAA 3UOZA 5KOWA 3M12A 1QJDA 3PO7A 4OPIA 1B8SA 1GALA 4WCTA 1PBFA 2BC1A 4H4PA 1LTXR 1PBDA 2JB3A 2WDRA 4U8JA 4YKFA 2XYOA 4B66A 4CBQA 4II2A 5JRBA 4D04A 2I0ZA 2DKIA 4YKGA 1Z6LA 5IQ4A 1PJ5A 1FEAA 3DGZA 2YLTA 1DJQA 3P4PA 4UDQA 4ECHA 1EL7A 3HYXA 1BGJA 3BI2A 4TM3A 1Q1RA 1B4VA 1YKJA 2H88A 1JOAA 3DMEA 4CNJA 4JDRA 1E7PA 3SQPA 1FECA 1F8WA 1TDFA 3CIRA 4A7AA 3NN0X 1TDOA 1O94A 1GPEA 4G9KA 3SZ0A 4XXGA 5HY5A 4H50A 3EF6A 5CQFA 2B9XA 3UOVA 4K5RA 2JK6A 3QVRA 5EBKA 3IC9A 4J36A 2V6OA 2YVGA 2OLNA 3QFAA 3DK9A 2RGJA 2XVEA 4O5QA 3ZYXA 5KWFA 2BCPA 2JB2A 1MO9A 3QFBA 4YWOA 3NLCA 2WP5A 2ARDA 4C74A 4GAPA 3AE2A 2WETA 3SFDA 1PDHA 3AXBA 4ZN0A 2RGOA 3UKFA 2IVDA 1ZMDA 3GWDA 1KDGA 1VDCA 4EQWA 1B5QA 1VG0A 1M64A 3E1TA 5U25A 1K0IA 3NYFA 2WQYA 3AEGA 1TRBA 4NTDA 3NGCX 4DGKA 1W4XA 3AWIA 2ZBWA 1Q9IA 3FMWA 4U8MA 3H4KA 2BCGG 1GRGA 2BXRA 5LV9A 3CGBA 1SEZA 3NYCA 1Q1WA 3IWAA 2OLOA 3GSIA 1ZOVA 2C75A 2XDOA 3AD9B 1BF3A 2FBWA 2GMJA 1JRXA 2JAEA 1S2QA 2Q6UA 4GDPA 3DK4A 4KX6A 4UP3A 3NK1X 2YM2A 3P1WA 4X9MA 3VR9A 4Z2RA 1KSUA 2WEUA 3RP8A 1KNRA 2Z5YA 2R4JA 4EIQA 3L1RA 2BABA 1QO8A 2EQ8A 2WP6A 4OPDA 4CNKA 4H2NA 1CC4A 2JBVA 2QCUA 1GESA 1ZKQA 4ICYA 3VR8A 2ACZA 3AE4A 2XFNA 1NDAA 4EMWA 5FS8A 3BI4A 3IF9A 4AOXA 4DNAA 2YG6A 1Y56A 3AD8B 2BK5A 1X31B 4EQRA 3GRSA 3S61A 4FK1C 1P2HA 3VQRA 3B3RA 2Q7VA 3AD7B 2PHHA 3CPIG 4NEWA 2GQFA 2WESA 4G74A 3SZWA 3SGLA 2J3NA 3S5WA 1M6IA 1FL2A 2GRTA 2TPRA 1D4CA 3KKJA 3T2ZA 1S2YA 2BS3A 2XFPA 1NPXA 1TDKA 3L8KA 4J34A 4DSGA 1BWCA 4YTNA 3CPHG 3ZDNA 2YAUA 1DNCA 3AE9A 2WHDA 2Q0LA 3GDNA 3QSMA 4APNA 1JNRA 4YTMA 4OVIA 2EQ6A 2B7SA 2RABA 4JY2A 1KSSA 3LXDA 4U8IA 2X99A 4A6NA 3JSKA 3UKLA 4HA6A 5CKUA 2Z5XA 2WU5A 5C2TA 3QSSA 2R46A 1RSGA 1COYA 2BK3A 2YLWA 4NEVA 3UP4A 5KOXA 3UOXA 5BUKA 5FS9A 1FOHA 2B76A 3P4RA 4K22A 1GOSA 2XLRA 2PYXA 3K7TA 4LA1A 1GV4A 4TLXA 3T37A 4H4TA 5U1OA 2QA1A 3KD9A 4CRTA 4YT0A 3AE3A 2V3AA 1ZP0A 3EAOA 1CJCA 3ATRA 1PBBA 1F8SA 1H83A 1BKWA 4JNAA 4U2SA 3VRAA 4EMJA 1H82A 3CGEA 3VRDB 4USRA 4YSXA 2C67A 4X4JA 5FMHA 1H86A 1PXCA 1VQWA 3GMBA 1PXBA 1KN0A 4U2LA 2XLUA 4CY8A 1DXLA 2GF3A 2UZZA 1PHHA 2JB1A 2BS4A 3AE1A 4OPGA 3F8DA 2VQ7A 2BA9A 4UDRA 3AE8A 2FJEA 3SZCA 3DJGX 2R0GA 2YVJA 3M13A 4HB9A 4FK1A 3UTEA 2V60A 3SX6A 5U63A 1PN0A 3V3OA 2V3BA 2WOVA 4TLZA 4B69A 4GUVA 2WBAA 2YLXA 1MOKA 4AT2A 4B64A 5M10A 4IV9A 1FEBA 3GD3A 1TDNA 2V5ZA 4YSYA 3NN6X 4BJZA 3P4SA 4A65A 2C72A 3AE5A 4GRTA 4M52A 2GEWA 1DOCA 4B63A 2CDUA 1GRTA 4J31A 3BI5A 3FIMB 1EBDA 1L9EA 4H7UA 4N9XA 3D9XA 3R9UA 3WE0A 3AEEA 5L46A 2WU2A 2XCGA 3II4A 4EM3A 3HZLA 1IUVA 4H4WA 3V76A 3FBSA 5KXJA 1V59A 2GB0A 4AP3A 1JRYA 4REKA 1ZDLA 1MXTA 2NPXA 3D8XA 1YY5A 3RP7A 1TYPA 3AEAA 3AB1A 4NWZA 4BURA 1CF3A 4H4UA 2BACA 3HYVA 3DH9A 3CNDA 1ZX9A 2NVKX 1K0JA 1N4UA 3K30A 5KVHA 3NT6A 2C73A 4G73A 4H2QA 2YLSA 4JN9A 4CCRA 2XFUA 2R0CA 4YXDA 2FJBA 2WPEA 1D4EA 1GSNA 2A89A 3GYJA 2BRYA 3NG7X 4LU6A 1E1MA 2V61A 1F6MA 3LJPA 4K5SA 1NHRA 1UKVG 3RP6A 2C76A 3FG2P 4G6GA 4IA6A 4B68A 1L9DA 4ADWA 2YG7A 1GETA 5BULA 1JNZA 4YTPA 4K8DA 1PJ6A 3LZXA 1GREA 4JNQA 3UTFA 4E0VA 2XVJA 1GXFA 3P9UA 2X8HA 3GYIA 1TYTA 1YQZA 1HYUA 2R45A 3AE7A 4OPCA 4XWZA 4YSHA 3UKHA 2X8GA 4OPLA 1KFYA 3T31A 1EL8A 1CC2A 5DBJA 2B9WA 3BHKA 4C3YA 2O9ZA 1IUXA 3UP5A 3UTHA 4A5LA 4ZCCA 3T2YA 3LADA 1E6EA 3CTYA 2WOIA 4BK3A 4Z2TA 2BRAA 3CGCA 3CMMA 4U2TA 1CHUA 2R4EA 2WPFA 2VVMA 1N4WA 2YWLA 3AYIA 5KNLA 1OJ9A 1PJ7A 2EQ9A 4XWRA 3NKSA 4J56A 3NK0X 3AEFA 3OC4A 1GT8A 5J7XA 2X50A 1H81A 1FCDA 1D7YA 3I6DA 4GF7A 1F3PA 2F5ZA 2BK4A 1LJ1A 2B9YA 2AAQA 2VVLA 3T0KA 4FX9A 3SXIA 1REOA 2CVJA 5GSNA 4Z25A 1RYIA 4A99A 2OAMA 2B7RA 3ICTA 3ADAB 3EPTA 1NG3A 3SY4A 3NYEA 5JCLA 3QJ4A 2GAGB 2XVFA 2BYBA 2W0HA 2E1MA 2QA2A 1DJNA 4LIIA 2BC0A 2EQ7A 2APGA 2IVEA 2YG4A 3GRTA 4RSLA 5JCIA 3ICSA 1E1NA 3AYLA 1IJHA 3ALLA 2WDQA 4GCMA 3UTGA 3EANA 4EMIA 1B37A 1E1LA 1H84A 3V3NA 2GR3A 4PABA 3AE6A 2C7GA 1L0VA 3AECA 1ZK7A 3SYIA 1LQTA 4Z24A 2WS3A 4USQA 1OJCA 2GVCA 2VRMA 2YG3A 1NEKA 2R0PA 1GTHA 3H8LA 3BNUA 2YR6A 3KA7A 2YG5A 3CNPA 1S7MA 4H4YA 5FS6A 1N1PA 1H7XA 4CCQA 4BJYA 3IHGA 5C3JA 2A8XA 3B6DA 1H6VA 1E39A 2GV8A 1H7WA 4A79A 4U8KA 3DGHA 4I58A 4D03A 3NTAA 5J60A 2A87A 3C4AA 4TM4A 4JQ9A 2ZZ0A 2HQMA 5JCMA 1Y0PA 2FJAA 2WOWA 3GWFA 2XVHA 2WP9A 1IUSA 1GRFA 2YM1A 2CULA 2YLRA 4O5UA 2C70A 3LZWA 4IVOB 3UKKA 2AQJA 5IQ1A 1QLBA 4FDCB 2C3DA 5HXIA 1N4VA 1D4DA 4U8PA 1CJ3A 4X9NA 4YSZA 2VVLG 3ICRA 5BVAA 1KNPA 2OALA 2YVFA 1PBCA 3LOVA 5KMRA 1E1KA 4KPRA 5KVIA 1XHCA 2YQUA 2WPCA 1S3EA 4K2XA 2GQWA 4IA5A 3ITJA 5KMSA 3O0HA 4NTCA 1GTEA 3CPJG 1OJAA 1S3BA 4Z43A 4BV6A 1XANA 5EOWA 3HYWA 3KLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VG9 A;  1PBE A;  2JKC A;  3F8P A;  1D5T A;  5GRT A;  3ATQ A;  4GR1 A;  1BGN A;  3GMC A;  4H4Z A;  3IHM A;  2XFQ A;  3M0O A;  1XDI A;  2YR4 A;  1NEN A;  3CGD A;  1IUW A;  1NG4 A;  3QVP A;  4EQX A;  1LVL A;  1L9C A;  2BXS A;  3DK8 A;  4AP1 A;  5M0Z A;  5JCK A;  4Y4L A;  3RNM A;  4EIP A;  2Q0K A;  4U8O A;  3NTD A;  3RED A;  3URH A;  2XLT A;  1O5W A;  2C64 A;  3H8I A;  5FS7 A;  3GD4 A;  2FJD A;  5EB4 A;  3NHO X;  1NAA A;  4U8N A;  3AYJ A;  4H4Q A;  3KPF A;  3CN8 A;  1RP0 A;  4J57 A;  2QAE A;  3DJD A;  1EL5 A;  4RG3 A;  3C96 A;  2GMH A;  1CJ2 A;  4WX1 A;  1Y56 B;  1DOD A;  3AED A;  3ALM A;  1AOG A;  4NZH A;  3F8R A;  1CJ4 A;  1GRB A;  4B65 A;  1LPF A;  5EB5 A;  5IPY A;  1IUU A;  2TMD A;  4Z26 A;  1O95 A;  1ELI A;  4AT0 A;  1GND A;  3ISH A;  1GRH A;  2Y6Q A;  3D1C A;  4Y4N A;  4IVM B;  2XVI A;  5TR3 A;  4OPT A;  1DOB A;  3DA1 A;  1LV0 A;  2YLZ A;  2H89 A;  1CL0 A;  3DJJ A;  3KU9 A;  3QSE A;  1VRQ B;  3UKP A;  2OA1 A;  5ER0 A;  4J33 A;  4H4V A;  2XLP A;  3NIX A;  4A9W A;  2ZZB A;  3PVC A;  2R9Z A;  4C3X A;  5JCN A;  2AR8 A;  2E4G A;  3Q6J A;  1KF6 A;  3VRB A;  3UKA A;  2ZZC A;  3CNJ A;  4H4R A;  4J2W A;  2VZ2 A;  4PAA A;  4Z44 A;  4B1B A;  3LB8 A;  5HYM A;  3G5S A;  1OJT A;  4CY6 A;  2E5V A;  3Q9T A;  2X8C A;  2WDV A;  4P9S A;  3K7Q X;  4ZCD A;  3ALJ A;  3COX A;  2Y6R A;  1NHS A;  4K7Z A;  4OCG A;  1P2E A;  1IUT A;  2VRL A;  2C3C A;  4Y4M A;  2C65 A;  2XLS A;  1NHQ A;  3NRN A;  3KVE A;  3I3L A;  1NHP A;  1JU2 A;  2X3N A;  3NNE A;  5BRT A;  3CNT A;  2RGH A;  1D7L A;  1ZOY A;  1YQ4 A;  1K4Q A;  1GRA A;  4I59 A;  4DSH A;  3AEB A;  1DOE A;  1BZL A;  1OJD A;  3BHF A;  4B67 A;  4NTE A;  3NH3 X;  2XFO A;  1XPQ A;  1CC6 A;  4RG4 A;  3UOY A;  1PS9 A;  2DKH A;  3FPZ A;  4AOS A;  3GDP A;  4C5O A;  3G5Q A;  1GER A;  2GR0 A;  2C66 A;  3OZ2 A;  3K7M X;  4MJW A;  4UDP A;  2CFY A;  5KRQ A;  1CBO A;  2GH5 A;  1ONF A;  3SFE A;  4BK2 A;  4Z2U A;  4H2R A;  4H2P A;  4TM1 A;  3UKQ A;  1K0L A;  4TM0 A;  5HHF A;  1EL9 A;  1JRZ A;  1ZY8 A;  3ABV A;  3PS9 A;  2GR1 A;  3G5R A;  3P4Q A;  3RHA A;  4EQS A;  3DJE A;  4EM4 A;  1LQU A;  2VQB A;  2YR5 A;  4BK1 A;  2IID A;  2GR2 A;  4OPU A;  4H4X A;  3CNS A;  4C77 A;  1TDE A;  1ZMC A;  3BNM A;  4A6N B;  1F8R A;  3C4N A;  3NK2 X;  4JY3 A;  2GAH B;  1YQ3 A;  3UCL A;  2BS2 A;  4H4S A;  1JEH A;  2VOU A;  1GEU A;  4GDE A;  3SM8 A;  1PXA A;  3UOZ A;  5KOW A;  3M12 A;  1QJD A;  3PO7 A;  4OPI A;  1B8S A;  1GAL A;  4WCT A;  1PBF A;  2BC1 A;  4H4P A;  1LTX R;  1PBD A;  2JB3 A;  2WDR A;  4U8J A;  4YKF A;  2XYO A;  4B66 A;  4CBQ A;  4D04 A;  2I0Z A;  2DKI A;  4YKG A;  1Z6L A;  5IQ4 A;  1PJ5 A;  1FEA A;  3DGZ A;  2YLT A;  1DJQ A;  3P4P A;  4UDQ A;  4ECH A;  1EL7 A;  1BGJ A;  3BI2 A;  4TM3 A;  1B4V A;  1Q1R A;  1YKJ A;  2H88 A;  1JOA A;  3DME A;  4CNJ A;  4JDR A;  1E7P A;  3CIR A;  1FEC A;  1F8W A;  1TDF A;  3SQP A;  4A7A A;  3NN0 X;  1TDO A;  1O94 A;  1GPE A;  4XXG A;  5HY5 A;  4H50 A;  3EF6 A;  5CQF A;  2B9X A;  3UOV A;  4K5R A;  2JK6 A;  3QVR A;  5EBK A;  3IC9 A;  4J36 A;  2V6O A;  2YVG A;  2OLN A;  2RGJ A;  2XVE A;  3DK9 A;  3QFA A;  4O5Q A;  3ZYX A;  2BCP A;  2JB2 A;  1MO9 A;  3NLC A;  3QFB A;  4YWO A;  2WP5 A;  2ARD A;  4C74 A;  3AE2 A;  2WET A;  3SFD A;  1PDH A;  3AXB A;  4ZN0 A;  2RGO A;  3UKF A;  2IVD A;  1ZMD A;  3GWD A;  1KDG A;  1VDC A;  4EQW A;  1B5Q A;  1VG0 A;  1M64 A;  3E1T A;  5U25 A;  1K0I A;  3NYF A;  2WQY A;  3AEG A;  1TRB A;  4NTD A;  3NGC X;  4DGK A;  1W4X A;  3AWI A;  2ZBW A;  1Q9I A;  3FMW A;  4U8M A;  2BCG G;  3H4K A;  1GRG A;  2BXR A;  5LV9 A;  3CGB A;  1SEZ A;  3NYC A;  1Q1W A;  3IWA A;  2OLO A;  3GSI A;  1ZOV A;  2C75 A;  2XDO A;  3AD9 B;  1BF3 A;  2FBW A;  2JAE A;  1JRX A;  2GMJ A;  1S2Q A;  2Q6U A;  4GDP A;  3DK4 A;  4KX6 A;  4UP3 A;  3NK1 X;  2YM2 A;  3P1W A;  4X9M A;  3VR9 A;  4Z2R A;  1KSU A;  2WEU A;  3RP8 A;  1KNR A;  2Z5Y A;  2R4J A;  4EIQ A;  3L1R A;  2BAB A;  1QO8 A;  2EQ8 A;  2WP6 A;  4OPD A;  4CNK A;  4H2N A;  1CC4 A;  2JBV A;  2QCU A;  1GES A;  1ZKQ A;  4ICY A;  3VR8 A;  2ACZ A;  3AE4 A;  2XFN A;  1NDA A;  3BI4 A;  3IF9 A;  5FS8 A;  4AOX A;  4EMW A;  2YG6 A;  3AD8 B;  1Y56 A;  4DNA A;  2BK5 A;  1X31 B;  3S61 A;  3GRS A;  3VQR A;  4FK1 C;  1P2H A;  4EQR A;  3B3R A;  2Q7V A;  3AD7 B;  2PHH A;  3CPI G;  2WES A;  2GQF A;  4NEW A;  3SGL A;  2J3N A;  3S5W A;  1FL2 A;  1M6I A;  2GRT A;  2TPR A;  1D4C A;  3KKJ A;  1S2Y A;  2BS3 A;  2XFP A;  1NPX A;  1TDK A;  3L8K A;  4J34 A;  4DSG A;  1BWC A;  4YTN A;  3CPH G;  3ZDN A;  2YAU A;  1DNC A;  3AE9 A;  2WHD A;  2Q0L A;  3GDN A;  3QSM A;  4APN A;  1JNR A;  4YTM A;  4OVI A;  2EQ6 A;  2B7S A;  2RAB A;  4JY2 A;  1KSS A;  3LXD A;  4U8I A;  2X99 A;  4A6N A;  3JSK A;  3UKL A;  4HA6 A;  5CKU A;  2Z5X A;  2WU5 A;  5C2T A;  3QSS A;  2R46 A;  1RSG A;  1COY A;  2BK3 A;  2YLW A;  4NEV A;  3UP4 A;  5KOX A;  3UOX A;  5BUK A;  5FS9 A;  1FOH A;  2B76 A;  3P4R A;  4K22 A;  1GOS A;  2XLR A;  2PYX A;  3K7T A;  4LA1 A;  1GV4 A;  4TLX A;  3T37 A;  2QA1 A;  4H4T A;  5U1O A;  3KD9 A;  4CRT A;  4YT0 A;  3AE3 A;  2V3A A;  1ZP0 A;  1CJC A;  3ATR A;  3EAO A;  1PBB A;  1F8S A;  1H83 A;  1BKW A;  4JNA A;  4U2S A;  3VRA A;  4EMJ A;  1H82 A;  3CGE A;  3VRD B;  4USR A;  4YSX A;  2C67 A;  4X4J A;  1H86 A;  1PXC A;  4U2L A;  1VQW A;  3GMB A;  1PXB A;  5FMH A;  2XLU A;  4CY8 A;  1DXL A;  2GF3 A;  2UZZ A;  1PHH A;  2JB1 A;  2BS4 A;  3AE1 A;  4OPG A;  3F8D A;  2VQ7 A;  2BA9 A;  4UDR A;  3AE8 A;  2FJE A;  2R0G A;  3DJG X;  2YVJ A;  3M13 A;  4HB9 A;  4FK1 A;  3UTE A;  2V60 A;  5U63 A;  1PN0 A;  3V3O A;  2V3B A;  2WOV A;  4TLZ A;  4B69 A;  4GUV A;  2WBA A;  2YLX A;  1MOK A;  4AT2 A;  4B64 A;  5M10 A;  4IV9 A;  1FEB A;  2V5Z A;  1TDN A;  3GD3 A;  4YSY A;  3NN6 X;  4BJZ A;  3P4S A;  4A65 A;  2C72 A;  3AE5 A;  4GRT A;  2GEW A;  4M52 A;  1DOC A;  4B63 A;  2CDU A;  1GRT A;  4J31 A;  3BI5 A;  3FIM B;  1EBD A;  1L9E A;  4H7U A;  4N9X A;  3R9U A;  3WE0 A;  3AEE A;  5L46 A;  2WU2 A;  2XCG A;  3II4 A;  3HZL A;  4EM3 A;  1IUV A;  4H4W A;  3V76 A;  3FBS A;  5KXJ A;  1V59 A;  2GB0 A;  4AP3 A;  1JRY A;  4REK A;  1ZDL A;  1MXT A;  2NPX A;  3D8X A;  1YY5 A;  3RP7 A;  1TYP A;  3AEA A;  3AB1 A;  4BUR A;  1CF3 A;  4H4U A;  2BAC A;  3DH9 A;  3CND A;  1ZX9 A;  2NVK X;  1K0J A;  1N4U A;  3K30 A;  5KVH A;  3NT6 A;  2C73 A;  4H2Q A;  2YLS A;  4JN9 A;  4CCR A;  2XFU A;  2R0C A;  4YXD A;  2FJB A;  2WPE A;  1D4E A;  1GSN A;  2A89 A;  3GYJ A;  3NG7 X;  4U8L A;  4LU6 A;  1E1M A;  2V61 A;  1F6M A;  3LJP A;  4K5S A;  1NHR A;  1UKV G;  3RP6 A;  2C76 A;  3FG2 P;  4IA6 A;  4B68 A;  5BUL A;  1L9D A;  2YG7 A;  4ADW A;  1GET A;  1JNZ A;  4YTP A;  4K8D A;  1PJ6 A;  3LZX A;  1GRE A;  4JNQ A;  3UTF A;  4E0V A;  2XVJ A;  1GXF A;  3P9U A;  2X8H A;  3GYI A;  1TYT A;  1HYU A;  1YQZ A;  2R45 A;  3AE7 A;  4OPC A;  4XWZ A;  4YSH A;  3UKH A;  2X8G A;  4OPL A;  1KFY A;  1EL8 A;  1CC2 A;  5DBJ A;  2B9W A;  3BHK A;  4C3Y A;  2O9Z A;  1IUX A;  3UP5 A;  3UTH A;  4A5L A;  4ZCC A;  5KWF A;  1E6E A;  3LAD A;  3CTY A;  2WOI A;  4BK3 A;  4Z2T A;  3CGC A;  4U2T A;  1CHU A;  2R4E A;  2VVM A;  2WPF A;  1N4W A;  2YWL A;  3AYI A;  1OJ9 A;  1PJ7 A;  2EQ9 A;  4XWR A;  3NKS A;  3NK0 X;  4J56 A;  3AEF A;  1GT8 A;  3OC4 A;  5J7X A;  1H81 A;  2X50 A;  1FCD A;  1D7Y A;  3I6D A;  4GF7 A;  1F3P A;  2F5Z A;  2BK4 A;  1LJ1 A;  2B9Y A;  2AAQ A;  2VVL A;  4FX9 A;  1REO A;  2CVJ A;  5GSN A;  4Z25 A;  1RYI A;  2OAM A;  2B7R A;  3ICT A;  3ADA B;  3EPT A;  1NG3 A;  3NYE A;  5JCL A;  3QJ4 A;  2GAG B;  2XVF A;  2BYB A;  2W0H A;  2E1M A;  2QA2 A;  1DJN A;  4LII A;  2BC0 A;  2EQ7 A;  2APG A;  2IVE A;  2YG4 A;  3GRT A;  4RSL A;  5JCI A;  3ICS A;  1E1N A;  3AYL A;  1IJH A;  3ALL A;  2WDQ A;  4GCM A;  3UTG A;  1E1L A;  1B37 A;  1H84 A;  3EAN A;  4EMI A;  3V3N A;  2GR3 A;  4PAB A;  3AE6 A;  2C7G A;  1L0V A;  3AEC A;  1ZK7 A;  1LQT A;  4Z24 A;  2WS3 A;  4USQ A;  1OJC A;  2GVC A;  2VRM A;  2YG3 A;  1NEK A;  2R0P A;  1GTH A;  3H8L A;  3BNU A;  2YR6 A;  3KA7 A;  2YG5 A;  3CNP A;  1N1P A;  4H4Y A;  5FS6 A;  1H7X A;  4CCQ A;  4BJY A;  3IHG A;  5C3J A;  2A8X A;  3B6D A;  1H6V A;  1E39 A;  2GV8 A;  1H7W A;  4A79 A;  4U8K A;  3DGH A;  4I58 A;  4D03 A;  3NTA A;  5J60 A;  2A87 A;  3C4A A;  4TM4 A;  4JQ9 A;  2ZZ0 A;  2HQM A;  1Y0P A;  5JCM A;  2FJA A;  2WOW A;  3GWF A;  2XVH A;  2WP9 A;  1IUS A;  1GRF A;  2YM1 A;  2CUL A;  2YLR A;  4O5U A;  2C70 A;  3LZW A;  4IVO B;  3UKK A;  2AQJ A;  5IQ1 A;  1QLB A;  4FDC B;  2C3D A;  5HXI A;  1N4V A;  1D4D A;  4U8P A;  1CJ3 A;  4X9N A;  4YSZ A;  2VVL G;  3ICR A;  5BVA A;  1KNP A;  2OAL A;  2YVF A;  1PBC A;  3LOV A;  1E1K A;  4KPR A;  5KVI A;  1XHC A;  2YQU A;  2WPC A;  1S3E A;  4K2X A;  2GQW A;  4IA5 A;  3ITJ A;  3O0H A;  4NTC A;  1GTE A;  3CPJ G;  1OJA A;  1S3B A;  4Z43 A;  4BV6 A;  1XAN A;  5EOW A;  4A99 A;  3KLJ A; 
#chains in the Genus database with same CATH topology
 4GR1 A;  3IHM A;  1XDI A;  4EQX A;  3UJE A;  2BXS A;  5JCK A;  4U8O A;  3N6J A;  3NHO X;  1NAA A;  4U8N A;  4J57 A;  1RP0 A;  2QAE A;  4GME A;  1CJ2 A;  3F8R A;  3T4W A;  3GD6 A;  1BKH A;  4ENL A;  1EBH A;  4Z26 A;  1O95 A;  1ELI A;  4AT0 A;  1GND A;  4HN8 A;  3D1C A;  4IVM B;  3DFH A;  4OPT A;  3DA1 A;  1LV0 A;  3UKP A;  2XH4 A;  5ER0 A;  4C3X A;  2E4G A;  3TWA A;  1KF6 A;  2ZZC A;  4H4R A;  3CNJ A;  1TKK A;  3PWG A;  3RO6 A;  4Z44 A;  3ETR B;  4MKS A;  2E5V A;  3Q9T A;  2WDV A;  4K7Z A;  4OCG A;  1X2G A;  1JU2 A;  3IJQ A;  3P0W A;  1ZOY A;  3RR1 A;  4KEM A;  1YQ4 A;  1KD0 A;  1BZL A;  3ZLF A;  1XPQ A;  3UOY A;  3GDP A;  3ZVI A;  1FHV A;  4G6H A;  4UDP A;  5KRQ A;  1ONF A;  2PTZ A;  4H2R A;  1K0L A;  5IDZ A;  3P4Q A;  4EQS A;  2W3R A;  2IID A;  3KPK A;  2AL2 A;  4H4X A;  3BNM A;  3VCC A;  3C4N A;  4H4S A;  2VOU A;  3PG6 A;  3TW9 A;  1GEU A;  3M12 A;  1QJD A;  1B8S A;  3QTP A;  4WCT A;  2WDR A;  2I0Z A;  5IQ4 A;  3DFY A;  3MSY A;  1BGJ A;  4TM3 A;  2H88 A;  4CNJ A;  1F8W A;  3NN0 X;  1TDO A;  4H50 A;  3SR6 B;  3VA8 A;  2OLN A;  3OZY A;  3QFB A;  1P48 A;  2ARD A;  4E4F A;  4ZN0 A;  1PDH A;  3UKF A;  2IVD A;  3GWD A;  1B5Q A;  1VG0 A;  1MUC A;  3NVW B;  3NYF A;  1TRB A;  4NTD A;  1T3Q C;  1Q9I A;  3CGB A;  3NYC A;  2XH0 A;  1ZXI C;  2OLO A;  3GSI A;  2XDO A;  2FBW A;  4KX6 A;  1JRX A;  1S2Q A;  4X9M A;  2PA6 A;  3EUB 3;  2BAB A;  2WP6 A;  4CNK A;  3FV9 A;  2JBV A;  1GES A;  2GL5 A;  3BI4 A;  1P43 A;  3HW2 A;  1X31 B;  1FFU C;  2BK5 A;  4FK1 C;  4NEW A;  3SGL A;  2J3N A;  3S5W A;  1M6I A;  3TOY A;  2TPR A;  3NVZ B;  3THU A;  3T2Z A;  2OG9 A;  1BWC A;  4YTN A;  3ZDN A;  2Q0L A;  1JNR A;  4OVI A;  3FCP A;  4H2H A;  3JSK A;  3QSS A;  1N5W C;  3N6H A;  2YLW A;  3UOX A;  3RRA A;  5BUK A;  5FS9 A;  3CAW A;  2XLR A;  4ZCW A;  1GV4 A;  3SSZ A;  4HCH A;  4CRT A;  2QA1 A;  1ZP0 A;  4EMJ A;  3VRD B;  2C67 A;  4X4J A;  1PXC A;  4U2L A;  1KN0 A;  4YWS A;  4HNC A;  2JB1 A;  3VC5 A;  3SZC A;  3M13 A;  5U63 A;  2V3B A;  1PDY A;  3T9P A;  2WBA A;  2YLX A;  4YSY A;  3UXL A;  3NN6 X;  1JRP A;  2CDU A;  2QDD A;  4N9X A;  3R9U A;  3WE0 A;  5L46 A;  2E5A A;  1IUV A;  2GB0 A;  1JRY A;  2NPX A;  2PU1 A;  3V5F A;  3NT6 A;  4G73 A;  2YLS A;  4JN9 A;  4CCR A;  2GGI A;  4YXD A;  2WPE A;  1GSN A;  1D4E A;  2V61 A;  3LJP A;  1NHR A;  1L9D A;  1JNZ A;  3LZX A;  1GRE A;  4JNQ A;  4E0V A;  2XVJ A;  3P9U A;  2X8H A;  4OPC A;  1TYT A;  1HYU A;  3AE7 A;  2X8G A;  3SN0 A;  1KFY A;  5DBJ A;  5KWF A;  2O9Z A;  4A5L A;  3T2Y A;  2XH2 A;  2OLA A;  3DG7 A;  4Z2T A;  3CGC A;  3ES8 A;  4U2T A;  1CHU A;  2VVM A;  1N4W A;  3R07 C;  4XWR A;  4DN1 A;  3AEF A;  1F3P A;  2BK4 A;  3ENL A;  3SXI A;  1RYI A;  2OAM A;  2B7R A;  3EPT A;  1NG3 A;  2QJJ A;  2FKP A;  1ONE A;  2YG4 A;  3AYL A;  3ALL A;  1B37 A;  1E1L A;  1H84 A;  2C7G A;  3SYI A;  1LQT A;  1WUE A;  2YG3 A;  3H8L A;  3KA7 A;  3BJS A;  1S7M A;  2I5Q A;  1E39 A;  4A79 A;  3QPE A;  4I58 A;  5FJT A;  3NTA A;  3R10 A;  3C4A A;  4TM4 A;  1NEL A;  2HQM A;  4E5T A;  4U8P A;  4X9N A;  2VVL G;  3VDG A;  2YVF A;  1JRO A;  1PBC A;  1E1K A;  1S3E A;  3O0H A;  3GO2 A;  1VG9 A;  1D5T A;  5GRT A;  3L5O A;  2P0I A;  1BGN A;  3GMC A;  1OEP A;  4HCD A;  1H2I A;  1IUW A;  1NG4 A;  4AP1 A;  3DK8 A;  2Q0K A;  2XLT A;  1O5W A;  4ZA0 A;  3GD4 A;  2FJD A;  4M6U A;  3AYJ A;  4H4Q A;  3CN8 A;  1EL5 A;  4IP4 A;  4RG3 A;  4E8G A;  2GMH A;  1AOG A;  3ALM A;  3UJR A;  1CJ4 A;  2CHR A;  3SBF A;  5EB5 A;  2OX4 A;  5TR3 A;  2YLZ A;  3KU9 A;  2H89 A;  2OA1 A;  4IL2 A;  4A9W A;  2XLP A;  2ZZB A;  2R9Z A;  5BOF A;  1SJD A;  3H7V A;  4PAA A;  5KMP A;  5HYM A;  2E3T A;  3G5S A;  2QDE A;  1OJT A;  4CY6 A;  2W54 A;  3TCS A;  2X8C A;  2C3C A;  1EC8 A;  1N60 C;  3STP A;  3CNT A;  2RGH A;  6ENL A;  1K4Q A;  1GRA A;  4I59 A;  1KCZ A;  4B67 A;  3OPS A;  2P88 A;  2GGG A;  1RM6 B;  3NH3 X;  1CC6 A;  4RG4 A;  2DKH A;  4II3 A;  4K8G A;  3OZ2 A;  2P3Z A;  2MUC A;  1CBO A;  4BK2 A;  3SFE A;  3UKQ A;  5HHF A;  3PS9 A;  3T14 A;  3T2K A;  3G5R A;  4EM4 A;  4BK1 A;  2YR5 A;  2GR2 A;  4OPU A;  4DWD A;  3CNS A;  2GAH B;  1JEH A;  4GDE A;  2AL2 B;  3TTE A;  2BC1 A;  2O56 A;  4U8J A;  4II2 A;  2DKI A;  1Z6L A;  3CYJ A;  3DGZ A;  3P4P A;  1X2H A;  1IYX A;  1EL7 A;  3HYX A;  3BI2 A;  1YKJ A;  1E7P A;  5HY5 A;  3EF6 A;  2B9X A;  3DDM A;  4J36 A;  4A35 A;  4O5Q A;  3QFA A;  1SB3 B;  3DK9 A;  2RGJ A;  2PSN A;  3SJN A;  1MO9 A;  4YWO A;  2WP5 A;  4C74 A;  4GAP A;  2WET A;  3SFD A;  1VDC A;  2QGY A;  1K0I A;  3AEG A;  4G7F A;  3NGC X;  4DGK A;  3AM9 A;  1W4X A;  3AWI A;  3FMW A;  4U8M A;  2BCG G;  3V5C A;  1ZOV A;  2C75 A;  2GMJ A;  2JAE A;  4GDP A;  2PP0 A;  3DK4 A;  3P1W A;  1KSU A;  2OPJ A;  2WEU A;  3RP8 A;  3L1R A;  1QO8 A;  4TVY A;  2EQ8 A;  3B9J B;  4OPD A;  3UCD A;  4H2N A;  3K1G A;  1CC4 A;  2QCU A;  2ACZ A;  4AOX A;  2XFN A;  1NDA A;  2YG6 A;  3AD8 B;  3HRD C;  1P2H A;  7ENL A;  2WES A;  3RCY A;  4G74 A;  2BS3 A;  2XFP A;  1NPX A;  3L8K A;  4J34 A;  2WHD A;  4KWS A;  4APN A;  4YTM A;  2B7S A;  3AMZ A;  2Z5X A;  5C2T A;  4JN7 A;  4NEV A;  2B76 A;  2PYX A;  4LA1 A;  3T37 A;  4H4T A;  2QJM A;  3EAO A;  3ATR A;  1H83 A;  1BKW A;  4U2S A;  3VRA A;  4USR A;  1MNS A;  3CK5 A;  3GMB A;  1W6T A;  2FJE A;  2YVJ A;  4HB9 A;  3UTE A;  2V60 A;  4A6G A;  3DIP A;  3V3O A;  4B69 A;  2DW7 A;  3IK4 A;  4GUV A;  5G5G B;  4B64 A;  3N4E A;  2V5Z A;  4BJZ A;  4A65 A;  3CB3 A;  3AE5 A;  4GRT A;  1DOC A;  1GRT A;  1MDR A;  3BI5 A;  3FIM B;  1L9E A;  2GDQ A;  2OKT A;  3VFC A;  1FO4 A;  1JCT A;  4EM3 A;  3UJS A;  4H4W A;  1V59 A;  4AP3 A;  4REK A;  1MXT A;  3D8X A;  1TYP A;  3NS1 B;  1CF3 A;  3HYV A;  1ZX9 A;  4EWJ A;  2NVK X;  1K0J A;  3K30 A;  2QVH A;  2C73 A;  1SJC A;  4H2Q A;  3MY9 A;  3NRZ B;  3QN3 A;  2PMQ A;  2XFU A;  2R0C A;  2P8B A;  3GYJ A;  3NG7 X;  2BRY A;  4LU6 A;  1E1M A;  1F6M A;  4FI4 A;  3P93 A;  4G6G A;  5BUL A;  4K8D A;  4TVW A;  2OQH A;  3UTF A;  1GXF A;  1YQZ A;  4XWZ A;  3BHK A;  3TJI A;  1FHU A;  3A7U A;  3CMM A;  4H19 A;  2R4E A;  2YWL A;  2WPF A;  3AYI A;  1PJ7 A;  2EQ9 A;  3NKS A;  1WYG A;  4DHG A;  5J7X A;  3QLD A;  1FCD A;  3I6D A;  4IT1 A;  1LJ1 A;  2AAQ A;  4FX9 A;  4Z25 A;  3SY4 A;  1KKO A;  2GAG B;  2BYB A;  4FP1 A;  2QA2 A;  4LII A;  2PTW A;  3MWC A;  2BC0 A;  4IP5 A;  3GRT A;  3ICS A;  2XSX A;  1IJH A;  2WDQ A;  3UCC A;  4EMI A;  3DEQ A;  2WS3 A;  4USQ A;  3UJ2 A;  2GVC A;  2VRM A;  1GTH A;  3CNP A;  4CCQ A;  3IHG A;  5C3J A;  2A8X A;  4KPL A;  1H6V A;  5FJU A;  1H7W A;  4U8K A;  3DGH A;  4D03 A;  5J60 A;  2A87 A;  3BSM A;  3ZVH B;  5JCM A;  2WOW A;  2XVH A;  1GRF A;  3PK7 A;  2P8C A;  3LZW A;  1ECQ A;  3R11 A;  1QLB A;  4FDC B;  2OAL A;  5KVI A;  1XHC A;  2WPC A;  4IA5 A;  1GTE A;  3CPJ G;  4Z43 A;  4BV6 A;  3HYW A;  3I6E A;  2AKM A;  4F4R A;  1PBE A;  2XH7 A;  4KT2 A;  4NNJ A;  1V97 A;  4H4Z A;  2XFQ A;  3M0O A;  2YR4 A;  1NEN A;  3QVP A;  1LVL A;  1DTN A;  1L9C A;  5M0Z A;  4Y4L A;  4GIR A;  3NTD A;  3RED A;  3URH A;  5EB4 A;  3KPF A;  3PFR A;  1Y56 B;  2PTY A;  1GRB A;  2OQY A;  3OW1 A;  1LPF A;  3SZF A;  2TMD A;  5BOE A;  3ISH A;  1GRH A;  3DJJ A;  1DOB A;  2ZAD A;  3NFU A;  1VRQ B;  4H4V A;  3PVC A;  3Q6J A;  4IL0 A;  5EU9 A;  3OZM A;  4Z17 A;  4P9S A;  3COX A;  2Y6R A;  1NHS A;  3TWB A;  4Y4M A;  2C65 A;  3SN1 A;  3U4F A;  3I3L A;  3NNE A;  1D7L A;  3S47 A;  3BHF A;  4NTE A;  3KUM A;  3FPZ A;  4IZG A;  3DG3 A;  4C5O A;  3G5Q A;  1GER A;  2GR0 A;  3K7M X;  2CFY A;  3I4K A;  4TM1 A;  4TM0 A;  3RHA A;  4C77 A;  1ZMC A;  4A6N B;  3PWI A;  3NK2 X;  4JY3 A;  1YQ3 A;  3UCL A;  5KMQ A;  2HNE A;  3DER A;  4JHM A;  1TE6 A;  4OPI A;  1GAL A;  1PBF A;  4H4P A;  1LTX R;  2XYO A;  5JRB A;  4D04 A;  4YKG A;  4DX3 A;  2YLT A;  1DJQ A;  4UDQ A;  3DES A;  1TZZ A;  1Q1R A;  1B4V A;  1JOA A;  3CXB A;  3DME A;  4JDR A;  3CIR A;  3SQP A;  1FEC A;  1TDF A;  1O94 A;  1GPE A;  3UGV A;  4G9K A;  3SZ0 A;  3ZLG A;  4XXG A;  2JK6 A;  3QVR A;  3IC9 A;  2V6O A;  3FJ4 A;  2XVE A;  3SQS A;  2JB2 A;  3NLC A;  3AXB A;  2RGO A;  3I6T A;  3R1Z A;  1M64 A;  2WQY A;  1MRA A;  2ZBW A;  2BXR A;  5LV9 A;  2AL1 A;  1Q1W A;  3IWA A;  3H12 A;  3AD9 B;  2Q6U A;  4UP3 A;  3VR9 A;  4Z2R A;  1KNR A;  3DG6 A;  2Z5Y A;  3NVY B;  1WUF A;  1XPY A;  2PGE A;  1ZKQ A;  3AE4 A;  2POZ A;  1N61 C;  3S61 A;  3GRS A;  2QJN A;  3B3R A;  2QQ6 A;  2Q7V A;  2PHH A;  3CPI G;  3Q45 A;  2GQF A;  1FL2 A;  2ONE A;  1KKR A;  1TDK A;  3CPH G;  1DNC A;  3AE9 A;  3QSM A;  4A6N A;  2EQ6 A;  4JY2 A;  1KSS A;  4U8I A;  3NXL A;  4HA6 A;  2WU5 A;  2R46 A;  1RSG A;  1COY A;  2BK3 A;  4ROP A;  3OP2 A;  2PP1 A;  3P4R A;  4K22 A;  1GOS A;  1SJA A;  3AE3 A;  2V3A A;  3ES7 A;  1PBB A;  4JNA A;  3P3B A;  1H82 A;  3CGE A;  4YSX A;  1N5X A;  1H86 A;  3D47 A;  4CY8 A;  2GSH A;  1DXL A;  3CXO A;  2UZZ A;  2BS4 A;  3AE1 A;  3B97 A;  4OPG A;  3F8D A;  2VQ7 A;  2OFJ A;  4UDR A;  2R0G A;  4FK1 A;  3OTR A;  3SX6 A;  1PN0 A;  4TLZ A;  2WOV A;  4J3Z A;  4IV9 A;  1FEB A;  3GD3 A;  3P4S A;  2C72 A;  4B63 A;  4M52 A;  2OZT A;  4J31 A;  3AEE A;  4H1Z A;  2XCG A;  2AKZ A;  3HZL A;  2W55 A;  5FJR A;  1ZDL A;  1YY5 A;  3RP7 A;  3AEA A;  3AB1 A;  4NWZ A;  4H4U A;  4GYP C;  2BAC A;  5J04 A;  1N4U A;  5KVH A;  3GY1 A;  1XS2 A;  2FJB A;  2OZ8 A;  4Z1Y A;  4IA6 A;  4X2P A;  2YG7 A;  1GET A;  3IJL A;  4MMW A;  4YSH A;  2R45 A;  1E9I A;  2ZC8 A;  4C3Y A;  4ZCC A;  3GC2 A;  3CTY A;  2WOI A;  4HNL A;  1STZ A;  2MNR A;  3VCN A;  2X50 A;  1D7Y A;  2F5Z A;  3N4F A;  2B9Y A;  3T0K A;  1REO A;  2CVJ A;  5GSN A;  3Q4D A;  3FXG A;  3ICT A;  2POD A;  3UXK A;  3JVA A;  3NYE A;  5JCL A;  2XVF A;  2E1M A;  1DJN A;  2EQ7 A;  3HPF A;  3ZVH A;  1E1N A;  3RGT A;  4HYR A;  3UTG A;  3EAN A;  2PPG A;  1R0M A;  3QKE A;  2FYM A;  4IHC A;  4PAB A;  3AE6 A;  1L0V A;  2PU0 A;  4Z24 A;  1BQG A;  1NEK A;  3BNU A;  5ENL A;  2YG5 A;  1N1P A;  1H7X A;  4BJY A;  3U9I A;  2FJA A;  3NZG A;  3GWF A;  2WP9 A;  1IUS A;  4O5U A;  2C70 A;  3UKK A;  2AQJ A;  2C3D A;  1D4D A;  1KNP A;  4KPR A;  2YQU A;  4K2X A;  3T6C A;  2GQW A;  5KMS A;  5G5H B;  4NTC A;  1OJA A;  1XAN A;  5EOW A;  4A99 A;  2OZ3 A;  2JKC A;  2GGE A;  3F8P A;  4GAV A;  3ATQ A;  3CGD A;  4H83 A;  3RNM A;  4EIP A;  5FS7 A;  2C64 A;  3H8I A;  2RDX A;  3TJ4 A;  3DJD A;  3T8Q A;  4K1W A;  3C96 A;  4WX1 A;  1DOD A;  3AED A;  4DXK A;  4NZH A;  1FIQ B;  4B65 A;  5IPY A;  1IUU A;  3TQP A;  1MDL A;  3GYX A;  2Y6Q A;  4Y4N A;  2XVI A;  2PP3 A;  1CL0 A;  3QSE A;  4J33 A;  3NIX A;  5JCN A;  2AR8 A;  3VRB A;  3UKA A;  1ELS A;  4J2W A;  2VZ2 A;  2C4C A;  4B1B A;  3LB8 A;  2OO6 A;  3RIT A;  4ZCD A;  3K7Q X;  3ALJ A;  3A7R A;  1P2E A;  1IUT A;  2VRL A;  2HXU A;  2XLS A;  1NHQ A;  3NRN A;  3KVE A;  1NHP A;  3VC6 A;  2X3N A;  5BRT A;  4DYE A;  4DSH A;  3AEB A;  1DOE A;  1OJD A;  2XFO A;  1PS9 A;  4AOS A;  4JN8 A;  2C66 A;  4MJW A;  4Z2U A;  2GGJ A;  2GH5 A;  4H2P A;  3AN1 A;  1EL9 A;  1ZY8 A;  1JRZ A;  3ABV A;  2GR1 A;  4MGG A;  3DJE A;  1LQU A;  2VQB A;  3FVD A;  1N63 C;  3BOX A;  1TDE A;  1F8R A;  2BS2 A;  4J1O A;  3SM8 A;  1PXA A;  3UOZ A;  5KOW A;  3PO7 A;  4GYP A;  1PBD A;  2JB3 A;  4YKF A;  4B66 A;  4CBQ A;  1PJ5 A;  1FEA A;  4ECH A;  3NO1 A;  1VQZ A;  1EBG A;  4A7A A;  1EC7 A;  5CQF A;  3UOV A;  4K5R A;  1RVK A;  3D46 A;  5EBK A;  3CT2 A;  2YVG A;  4E6M A;  2HZG A;  3ZYX A;  2BCP A;  3AE2 A;  1ZMD A;  3R0K A;  1KDG A;  3V4B A;  4EQW A;  3MZN A;  3E1T A;  5U25 A;  2NQL A;  3IJI A;  3H4K A;  1GRG A;  1SEZ A;  3S5S A;  3EEZ A;  1BF3 A;  3NK1 X;  2YM2 A;  1F9C A;  3MKC A;  2R4J A;  4EIQ A;  4GGH A;  1L8P A;  4ICY A;  3VR8 A;  3IF9 A;  4EMW A;  5FS8 A;  3UJF A;  4DNA A;  1Y56 A;  4EQR A;  3VQR A;  3SN4 A;  3AD7 B;  3SZW A;  1JPM A;  2GRT A;  1D4C A;  3KKJ A;  1S2Y A;  1R6W A;  4DSG A;  1FFV C;  3H8A A;  1JDF A;  1SJB A;  2YAU A;  3GDN A;  3FYY A;  3V3W A;  2RAB A;  3LXD A;  2X99 A;  3UKL A;  5CKU A;  3UP4 A;  5KOX A;  1FOH A;  4M0X A;  3K7T A;  4GFI A;  3DGB A;  4TLX A;  5U1O A;  4YT0 A;  3KD9 A;  1CJC A;  1EC9 A;  1F8S A;  5FMH A;  3ZLH A;  1VQW A;  1PXB A;  2XLU A;  2GF3 A;  1PHH A;  3H70 A;  3MUC A;  4ZOH B;  3NVV B;  3JZU A;  2BA9 A;  3AE8 A;  3DJG X;  2PS2 A;  1N62 C;  4G8T A;  1NU5 A;  1MOK A;  4AT2 A;  5M10 A;  1TDN A;  2GEW A;  1PDZ A;  3MQT A;  1EBD A;  4H7U A;  3D9X A;  2WU2 A;  3II4 A;  1JPD X;  3EKG A;  3V76 A;  3FBS A;  5KXJ A;  4GIS A;  4BUR A;  3DH9 A;  3CND A;  5FJP A;  4U8L A;  2A89 A;  2DW6 A;  4K5S A;  3JW7 A;  1UKV G;  3RP6 A;  2C76 A;  2W3S A;  3FG2 P;  1VDV A;  4B68 A;  4ADW A;  4YTP A;  1PJ6 A;  3GYI A;  3UKH A;  4OPL A;  3T31 A;  1EL8 A;  1CC2 A;  2B9W A;  3UP5 A;  1IUX A;  3UTH A;  3LAD A;  1E6E A;  2GGH A;  3A7A A;  5FJO A;  4BK3 A;  4HCL A;  2BRA A;  2XGZ A;  2HXT A;  5KNL A;  1OJ9 A;  3NK0 X;  4J56 A;  3OC4 A;  4A3R A;  1GT8 A;  2PGW A;  1H81 A;  4GF7 A;  2VVL A;  2OVL A;  3ADA B;  3QJ4 A;  4HPN A;  2W0H A;  2PTX A;  1YEY A;  3R0U A;  2APG A;  2IVE A;  4RSL A;  5JCI A;  4GGB A;  4GCM A;  3V3N A;  2GR3 A;  3AEC A;  1ZK7 A;  1OJC A;  2R0P A;  2YR6 A;  4H4Y A;  5FS6 A;  3R25 A;  3B6D A;  2GV8 A;  4JQ9 A;  2ZZ0 A;  1Y0P A;  2YM1 A;  2CUL A;  2YLR A;  4IVO B;  5IQ1 A;  5HXI A;  1N4V A;  1CJ3 A;  4YSZ A;  3ICR A;  5BVA A;  4K2S A;  3LOV A;  5KMR A;  2PCE A;  4E4U A;  3ITJ A;  1S3B A;  3KLJ A; 
#chains in the Genus database with same CATH homology
 1VG9 A;  1PBE A;  2JKC A;  3F8P A;  1D5T A;  5GRT A;  3L5O A;  4GAV A;  3ATQ A;  4GR1 A;  4NNJ A;  1BGN A;  3GMC A;  4H4Z A;  3IHM A;  2XFQ A;  3M0O A;  1H2I A;  1XDI A;  2YR4 A;  1NEN A;  3CGD A;  1IUW A;  1NG4 A;  3QVP A;  4EQX A;  1LVL A;  1L9C A;  2BXS A;  3DK8 A;  4AP1 A;  5M0Z A;  5JCK A;  4Y4L A;  3RNM A;  4EIP A;  2Q0K A;  4U8O A;  3NTD A;  3RED A;  3URH A;  5FS7 A;  1O5W A;  2C64 A;  2XLT A;  3H8I A;  3GD4 A;  2FJD A;  5EB4 A;  3NHO X;  1NAA A;  4U8N A;  3AYJ A;  4H4Q A;  4J57 A;  3CN8 A;  1RP0 A;  3KPF A;  2QAE A;  3DJD A;  1EL5 A;  4RG3 A;  3C96 A;  2GMH A;  1CJ2 A;  4WX1 A;  1Y56 B;  1AOG A;  1DOD A;  3AED A;  3ALM A;  4NZH A;  3F8R A;  1CJ4 A;  1GRB A;  4B65 A;  1LPF A;  5EB5 A;  5IPY A;  1IUU A;  3SZF A;  2TMD A;  4Z26 A;  1O95 A;  1ELI A;  4AT0 A;  3GYX A;  1GND A;  3ISH A;  1GRH A;  2Y6Q A;  3D1C A;  4Y4N A;  4IVM B;  2XVI A;  5TR3 A;  4OPT A;  3DJJ A;  1DOB A;  1LV0 A;  2YLZ A;  2H89 A;  1CL0 A;  3DA1 A;  3KU9 A;  3QSE A;  1VRQ B;  4U8L A;  2OA1 A;  3UKP A;  5ER0 A;  4J33 A;  4H4V A;  2XLP A;  3NIX A;  5JCN A;  2ZZB A;  3PVC A;  2R9Z A;  4A9W A;  4C3X A;  2AR8 A;  2E4G A;  3Q6J A;  1KF6 A;  3VRB A;  3UKA A;  2ZZC A;  4H4R A;  3CNJ A;  4J2W A;  2VZ2 A;  2C4C A;  4PAA A;  5KMP A;  4Z44 A;  4B1B A;  3LB8 A;  5HYM A;  3G5S A;  1OJT A;  4CY6 A;  2E5V A;  3Q9T A;  2X8C A;  2WDV A;  4P9S A;  3K7Q X;  4ZCD A;  3ALJ A;  3COX A;  4K7Z A;  1NHS A;  2Y6R A;  4OCG A;  1P2E A;  1IUT A;  2VRL A;  2C3C A;  4Y4M A;  2C65 A;  2XLS A;  1NHQ A;  3NRN A;  3KVE A;  3I3L A;  1NHP A;  1JU2 A;  2X3N A;  3NNE A;  5BRT A;  3CNT A;  2RGH A;  1D7L A;  1ZOY A;  1YQ4 A;  1K4Q A;  1GRA A;  4I59 A;  4DSH A;  3AEB A;  1DOE A;  1BZL A;  1OJD A;  3BHF A;  4B67 A;  4NTE A;  3NH3 X;  2XFO A;  1XPQ A;  1CC6 A;  4RG4 A;  3UOY A;  1PS9 A;  2DKH A;  3FPZ A;  4AOS A;  3GDP A;  4C5O A;  3G5Q A;  1GER A;  4II3 A;  2GR0 A;  2C66 A;  3OZ2 A;  3K7M X;  4MJW A;  4G6H A;  4UDP A;  2CFY A;  5KRQ A;  1CBO A;  2GH5 A;  1ONF A;  3SFE A;  4BK2 A;  4Z2U A;  4H2R A;  4H2P A;  4TM1 A;  3UKQ A;  1K0L A;  4TM0 A;  5HHF A;  1EL9 A;  1JRZ A;  1ZY8 A;  3ABV A;  3PS9 A;  3T14 A;  3T2K A;  2GR1 A;  3G5R A;  3P4Q A;  4EQS A;  3RHA A;  4EM4 A;  3DJE A;  1LQU A;  2VQB A;  2YR5 A;  4BK1 A;  2IID A;  2GR2 A;  3KPK A;  4OPU A;  4H4X A;  3CNS A;  4C77 A;  1ZMC A;  1TDE A;  3BNM A;  4A6N B;  1F8R A;  3C4N A;  3NK2 X;  4JY3 A;  1YQ3 A;  2GAH B;  3UCL A;  2BS2 A;  4H4S A;  1JEH A;  2VOU A;  5KMQ A;  3PG6 A;  1GEU A;  4GDE A;  3SM8 A;  1PXA A;  3UOZ A;  5KOW A;  3M12 A;  1QJD A;  3PO7 A;  4OPI A;  1B8S A;  1GAL A;  4WCT A;  1PBF A;  2BC1 A;  4H4P A;  1LTX R;  1PBD A;  2JB3 A;  2WDR A;  4U8J A;  4YKF A;  2XYO A;  4B66 A;  4CBQ A;  4II2 A;  5JRB A;  4D04 A;  2I0Z A;  2DKI A;  4YKG A;  1Z6L A;  5IQ4 A;  1PJ5 A;  1FEA A;  3DGZ A;  2YLT A;  1DJQ A;  3P4P A;  4UDQ A;  4ECH A;  1EL7 A;  3HYX A;  1BGJ A;  3BI2 A;  4TM3 A;  1Q1R A;  1B4V A;  1YKJ A;  2H88 A;  1JOA A;  3DME A;  4CNJ A;  4JDR A;  1E7P A;  3SQP A;  1FEC A;  1F8W A;  1TDF A;  3CIR A;  4A7A A;  3NN0 X;  1TDO A;  1O94 A;  1GPE A;  4G9K A;  3SZ0 A;  4XXG A;  5HY5 A;  4H50 A;  3EF6 A;  5CQF A;  2B9X A;  3UOV A;  4K5R A;  2JK6 A;  3QVR A;  5EBK A;  3IC9 A;  4J36 A;  2V6O A;  2YVG A;  2OLN A;  3QFA A;  3DK9 A;  2RGJ A;  2XVE A;  4O5Q A;  3ZYX A;  5KWF A;  2BCP A;  2JB2 A;  1MO9 A;  3QFB A;  4YWO A;  3NLC A;  2WP5 A;  2ARD A;  4C74 A;  4GAP A;  3AE2 A;  2WET A;  3SFD A;  1PDH A;  3AXB A;  4ZN0 A;  2RGO A;  3UKF A;  2IVD A;  1ZMD A;  3GWD A;  1KDG A;  1VDC A;  4EQW A;  1B5Q A;  1VG0 A;  1M64 A;  3E1T A;  5U25 A;  1K0I A;  3NYF A;  2WQY A;  3AEG A;  1TRB A;  4NTD A;  3NGC X;  4DGK A;  1W4X A;  3AWI A;  2ZBW A;  1Q9I A;  3FMW A;  4U8M A;  3H4K A;  2BCG G;  1GRG A;  2BXR A;  5LV9 A;  3CGB A;  1SEZ A;  3NYC A;  1Q1W A;  3IWA A;  2OLO A;  3GSI A;  1ZOV A;  2C75 A;  2XDO A;  3AD9 B;  1BF3 A;  2FBW A;  2GMJ A;  1JRX A;  2JAE A;  1S2Q A;  2Q6U A;  4GDP A;  3DK4 A;  4KX6 A;  4UP3 A;  3NK1 X;  2YM2 A;  3P1W A;  4X9M A;  3VR9 A;  4Z2R A;  1KSU A;  2WEU A;  3RP8 A;  1KNR A;  2Z5Y A;  2R4J A;  4EIQ A;  3L1R A;  2BAB A;  1QO8 A;  2EQ8 A;  2WP6 A;  4OPD A;  4CNK A;  4H2N A;  1CC4 A;  2JBV A;  2QCU A;  1GES A;  1ZKQ A;  4ICY A;  3VR8 A;  2ACZ A;  3AE4 A;  2XFN A;  1NDA A;  4EMW A;  5FS8 A;  3BI4 A;  3IF9 A;  4AOX A;  4DNA A;  2YG6 A;  1Y56 A;  3AD8 B;  2BK5 A;  1X31 B;  4EQR A;  3GRS A;  3S61 A;  4FK1 C;  1P2H A;  3VQR A;  3B3R A;  2Q7V A;  3AD7 B;  2PHH A;  3CPI G;  4NEW A;  2GQF A;  2WES A;  4G74 A;  3SZW A;  3SGL A;  2J3N A;  3S5W A;  1M6I A;  1FL2 A;  2GRT A;  2TPR A;  1D4C A;  3KKJ A;  3T2Z A;  1S2Y A;  2BS3 A;  2XFP A;  1NPX A;  1TDK A;  3L8K A;  4J34 A;  4DSG A;  1BWC A;  4YTN A;  3CPH G;  3ZDN A;  2YAU A;  1DNC A;  3AE9 A;  2WHD A;  2Q0L A;  3GDN A;  3QSM A;  4APN A;  1JNR A;  4YTM A;  4OVI A;  2EQ6 A;  2B7S A;  2RAB A;  4JY2 A;  1KSS A;  3LXD A;  4U8I A;  2X99 A;  4A6N A;  3JSK A;  3UKL A;  4HA6 A;  5CKU A;  2Z5X A;  2WU5 A;  5C2T A;  3QSS A;  2R46 A;  1RSG A;  1COY A;  2BK3 A;  2YLW A;  4NEV A;  3UP4 A;  5KOX A;  3UOX A;  5BUK A;  5FS9 A;  1FOH A;  2B76 A;  3P4R A;  4K22 A;  1GOS A;  2XLR A;  2PYX A;  3K7T A;  4LA1 A;  1GV4 A;  4TLX A;  3T37 A;  4H4T A;  5U1O A;  2QA1 A;  3KD9 A;  4CRT A;  4YT0 A;  3AE3 A;  2V3A A;  1ZP0 A;  3EAO A;  1CJC A;  3ATR A;  1PBB A;  1F8S A;  1H83 A;  1BKW A;  4JNA A;  4U2S A;  3VRA A;  4EMJ A;  1H82 A;  3CGE A;  3VRD B;  4USR A;  4YSX A;  2C67 A;  4X4J A;  5FMH A;  1H86 A;  1PXC A;  1VQW A;  3GMB A;  1PXB A;  1KN0 A;  4U2L A;  2XLU A;  4CY8 A;  1DXL A;  2GF3 A;  2UZZ A;  1PHH A;  2JB1 A;  2BS4 A;  3AE1 A;  4OPG A;  3F8D A;  2VQ7 A;  2BA9 A;  4UDR A;  3AE8 A;  2FJE A;  3SZC A;  3DJG X;  2R0G A;  2YVJ A;  3M13 A;  4HB9 A;  4FK1 A;  3UTE A;  2V60 A;  3SX6 A;  5U63 A;  1PN0 A;  3V3O A;  2V3B A;  2WOV A;  4TLZ A;  4B69 A;  4GUV A;  2WBA A;  2YLX A;  1MOK A;  4AT2 A;  4B64 A;  5M10 A;  4IV9 A;  1FEB A;  3GD3 A;  1TDN A;  2V5Z A;  4YSY A;  3NN6 X;  4BJZ A;  3P4S A;  4A65 A;  2C72 A;  3AE5 A;  4GRT A;  4M52 A;  2GEW A;  1DOC A;  4B63 A;  2CDU A;  1GRT A;  4J31 A;  3BI5 A;  3FIM B;  1EBD A;  1L9E A;  4H7U A;  4N9X A;  3D9X A;  3R9U A;  3WE0 A;  3AEE A;  5L46 A;  2WU2 A;  2XCG A;  3II4 A;  4EM3 A;  3HZL A;  1IUV A;  4H4W A;  3V76 A;  3FBS A;  5KXJ A;  1V59 A;  2GB0 A;  4AP3 A;  1JRY A;  4REK A;  1ZDL A;  1MXT A;  2NPX A;  3D8X A;  1YY5 A;  3RP7 A;  1TYP A;  3AEA A;  3AB1 A;  4NWZ A;  4BUR A;  1CF3 A;  4H4U A;  2BAC A;  3HYV A;  3DH9 A;  3CND A;  1ZX9 A;  2NVK X;  1K0J A;  1N4U A;  3K30 A;  5KVH A;  3NT6 A;  2C73 A;  4G73 A;  4H2Q A;  2YLS A;  4JN9 A;  4CCR A;  2XFU A;  2R0C A;  4YXD A;  2FJB A;  2WPE A;  1D4E A;  1GSN A;  2A89 A;  3GYJ A;  2BRY A;  3NG7 X;  4LU6 A;  1E1M A;  2V61 A;  1F6M A;  3LJP A;  4K5S A;  1NHR A;  1UKV G;  3RP6 A;  2C76 A;  3FG2 P;  4G6G A;  4IA6 A;  4B68 A;  1L9D A;  4ADW A;  2YG7 A;  1GET A;  5BUL A;  1JNZ A;  4YTP A;  4K8D A;  1PJ6 A;  3LZX A;  1GRE A;  4JNQ A;  3UTF A;  4E0V A;  2XVJ A;  1GXF A;  3P9U A;  2X8H A;  3GYI A;  1TYT A;  1YQZ A;  1HYU A;  2R45 A;  3AE7 A;  4OPC A;  4XWZ A;  4YSH A;  3UKH A;  2X8G A;  4OPL A;  1KFY A;  3T31 A;  1EL8 A;  1CC2 A;  5DBJ A;  2B9W A;  3BHK A;  4C3Y A;  2O9Z A;  1IUX A;  3UP5 A;  3UTH A;  4A5L A;  4ZCC A;  3T2Y A;  3LAD A;  1E6E A;  3CTY A;  2WOI A;  4BK3 A;  4Z2T A;  2BRA A;  3CGC A;  3CMM A;  4U2T A;  1CHU A;  2R4E A;  2WPF A;  2VVM A;  1N4W A;  2YWL A;  3AYI A;  5KNL A;  1OJ9 A;  1PJ7 A;  2EQ9 A;  4XWR A;  3NKS A;  4J56 A;  3NK0 X;  3AEF A;  3OC4 A;  1GT8 A;  5J7X A;  2X50 A;  1H81 A;  1FCD A;  1D7Y A;  3I6D A;  4GF7 A;  1F3P A;  2F5Z A;  2BK4 A;  1LJ1 A;  2B9Y A;  2AAQ A;  2VVL A;  3T0K A;  4FX9 A;  3SXI A;  1REO A;  2CVJ A;  5GSN A;  4Z25 A;  1RYI A;  4A99 A;  2OAM A;  2B7R A;  3ICT A;  3ADA B;  3EPT A;  1NG3 A;  3SY4 A;  3NYE A;  5JCL A;  3QJ4 A;  2GAG B;  2XVF A;  2BYB A;  2W0H A;  2E1M A;  2QA2 A;  1DJN A;  4LII A;  2BC0 A;  2EQ7 A;  2APG A;  2IVE A;  2YG4 A;  3GRT A;  4RSL A;  5JCI A;  3ICS A;  1E1N A;  3AYL A;  1IJH A;  3ALL A;  2WDQ A;  4GCM A;  3UTG A;  3EAN A;  4EMI A;  1B37 A;  1E1L A;  1H84 A;  3V3N A;  2GR3 A;  4PAB A;  3AE6 A;  2C7G A;  1L0V A;  3AEC A;  1ZK7 A;  3SYI A;  1LQT A;  4Z24 A;  2WS3 A;  4USQ A;  1OJC A;  2GVC A;  2VRM A;  2YG3 A;  1NEK A;  2R0P A;  1GTH A;  3H8L A;  3BNU A;  2YR6 A;  3KA7 A;  2YG5 A;  3CNP A;  1S7M A;  4H4Y A;  5FS6 A;  1N1P A;  1H7X A;  4CCQ A;  4BJY A;  3IHG A;  5C3J A;  2A8X A;  3B6D A;  1H6V A;  1E39 A;  2GV8 A;  1H7W A;  4A79 A;  4U8K A;  3DGH A;  4I58 A;  4D03 A;  3NTA A;  5J60 A;  2A87 A;  3C4A A;  4TM4 A;  4JQ9 A;  2ZZ0 A;  2HQM A;  5JCM A;  1Y0P A;  2FJA A;  2WOW A;  3GWF A;  2XVH A;  2WP9 A;  1IUS A;  1GRF A;  2YM1 A;  2CUL A;  2YLR A;  4O5U A;  2C70 A;  3LZW A;  4IVO B;  3UKK A;  2AQJ A;  5IQ1 A;  1QLB A;  4FDC B;  2C3D A;  5HXI A;  1N4V A;  1D4D A;  4U8P A;  1CJ3 A;  4X9N A;  4YSZ A;  2VVL G;  3ICR A;  5BVA A;  1KNP A;  2OAL A;  2YVF A;  1PBC A;  3LOV A;  5KMR A;  1E1K A;  4KPR A;  5KVI A;  1XHC A;  2YQU A;  2WPC A;  1S3E A;  4K2X A;  2GQW A;  4IA5 A;  3ITJ A;  5KMS A;  3O0H A;  4NTC A;  1GTE A;  3CPJ G;  1OJA A;  1S3B A;  4Z43 A;  4BV6 A;  1XAN A;  5EOW A;  3HYW A;  3KLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...