2V3BA

Crystal structure of the electron transfer complex rubredoxin - rubredoxin reductase from pseudomonas aeruginosa.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
381
structure length
381
Chain Sequence
RAPLVIIGTGLAGYNLAREWRKLDGETPLLMITADDGRSYSKPMLSTGFSKNKDADGLAMAEPGAMAEQLNARILTHTRVTGIDPGHQRIWIGEEEVRYRDLVLAWGAEPIRVPVEGDAQDALYPINDLEDYARFRQAAAGKRRVLLLGAGLIGCEFANDLSSGGYQLDVVAPCEQVMPGLLHPAAAKAVQAGLEGLGVRFHLGPVLASLKKAGEGLEAHLSDGEVIPCDLVVSAVGLRPRTELAFAAGLAVNRGIVVDRSLRTSHANIYALGDCAEVDGLNLLYVMPLMACARALAQTLAGNPSQVAYGPMPVTVKTPACPLVVSPPPRGMDGQWLVEGSGTDLKVLCRDTAGRVIGYALTGAAVNEKLALNKELPGLMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords RUBREDOXIN REDUCTASE
publication title Crystal Structure of the Electron Transfer Complex Rubredoxin - Rubredoxin Reductase from Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 116
structure length 381
sequence length 381
ec nomenclature ec 1.18.1.1: Rubredoxin--NAD(+) reductase.
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF18113 Rbx_binding Rubredoxin binding C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.120 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2v3bA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2v3bA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2v3bA02
1JOAA 1KSSA 3GRTA 2YWLA 4H4QA 2WP5A 4I58A 4U8KA 5EB5A 4C74A 3DA1A 2C7GA 2GF3A 3E1TA 4EQRA 2AAQA 2X8CA 3AEFA 1RYIA 1N4UA 1Q1WA 2A89A 4K5RA 1F8SA 1TDEA 4C5OA 1GRHA 1DJQA 1P2EA 2YR5A 4U8OA 2Y6RA 4C77A 1GSNA 1OJTA 2V5ZA 1X31B 2BACA 4GCMA 5GSNA 3ATRA 4EMIA 3AD7B 4Z2UA 1TYTA 2XLUA 2ZZ0A 4Z44A 2RGHA 4H4UA 2YG6A 3AXBA 1NAAA 3JSKA 3QVPA 2YAUA 3CPIG 3SQPA 1KSUA 3H8LA 4U8NA 1QO8A 1ZMDA 4A65A 2C3CA 1D5TA 3R9UA 1GREA 2VOUA 5FMHA 1RP0A 2GRTA 3K7QX 2WDVA 4H4XA 2Q7VA 1GXFA 4ZN0A 2WU2A 1O95A 4D04A 2WPFA 1F8RA 4RSLA 1GALA 1GRGA 2BK4A 1D4EA 2GMHA 3BHKA 1LJ1A 5U1OA 4DGKA 3VR9A 2QAEA 1IUXA 2VVLG 4YTMA 4BV6A 1JNZA 5J7XA 4A99A 4TM4A 4EIPA 3UOVA 1F8WA 1CJ2A 2YLZA 1ZK7A 1NHQA 2R4JA 1TRBA 1VG9A 1EL8A 1YQ4A 3CNPA 2WETA 2WPEA 3ICRA 4CCQA 3ADAB 4A6NA 1NEKA 2VRMA 1GTHA 3ISHA 2GEWA 4TM1A 1PDHA 4DSHA 4H2QA 1VQWA 3GYJA 4X9NA 3P9UA 4Y4NA 4AT0A 3CNJA 4XXGA 1YQ3A 1PS9A 4FX9A 2RGJA 1FOHA 1L0VA 3ICTA 3RNMA 5BRTA 4MJWA 2Z5YA 3AD9B 2V6OA 4CCRA 4NEVA 1FEAA 3ATQA 5CKUA 4AP3A 2IVDA 2CDUA 2WOIA 3DGZA 1NHSA 1KDGA 4CRTA 2WBAA 1H7XA 3BHFA 3KKJA 4IVMB 1PN0A 3KVEA 4EM3A 2BYBA 2VVMA 2WESA 4OPTA 2TMDA 1LTXR 3F8PA 4B69A 3CN8A 2ZBWA 3II4A 5TR3A 3NHOX 3P4PA 2C64A 3OC4A 4U2LA 1TDNA 3NKSA 3UKAA 3KPFA 4IA6A 2WP6A 3IC9A 2C65A 3AD8B 4B1BA 1JEHA 1E6EA 1K0LA 4LA1A 1BF3A 1ZOYA 3DJEA 1P2HA 1GNDA 1K4QA 2DKIA 4EQXA 1CJ3A 2WU5A 4NEWA 4AP1A 3CGDA 2BABA 3LADA 2R0GA 1OJCA 4H4ZA 4AOSA 4K2XA 1GRTA 3PO7A 1GRFA 4Y4LA 1Z6LA 4YSYA 3PS9A 1H82A 1M6IA 1BGNA 2YVFA 3NK1X 4Y4MA 4APNA 2AR8A 1F3PA 5KOXA 5L46A 3ALLA 4BK3A 4YSXA 1GRAA 4YWOA 2NPXA 5C2TA 1DODA 4EMWA 1PJ6A 4UP3A 2I0ZA 1IUWA 2AQJA 2WPCA 2GQWA 3CGCA 4J2WA 1QJDA 1Q9IA 2QA2A 1S2QA 2B9YA 4O5QA 4U2TA 2WS3A 1S2YA 3QFAA 3AEAA 2XCGA 3GWDA 2C75A 4A79A 4ADWA 2ZZCA 4USRA 4J57A 1D7YA 2C76A 4FK1A 4C3YA 4DSGA 3DK8A 3UKHA 3LXDA 1PXBA 4D03A 2X50A 5CQFA 1XHCA 1NPXA 4C3XA 5LV9A 4YTPA 1EBDA 1PXCA 1MOKA 1ZP0A 2Q6UA 3VQRA 4YTNA 1CF3A 2B76A 1F6MA 2H89A 2WDQA 3RHAA 3O0HA 5FS9A 4K5SA 4AOXA 2TPRA 2YR6A 1Y56A 3EPTA 3NTDA 2VQ7A 2XFUA 4HA6A 4H2PA 4H4YA 3UKPA 3ITJA 3DK9A 4IA5A 4K7ZA 3B3RA 5EOWA 4REKA 3AE9A 5JCLA 1O5WA 3UCLA 3VRDB 1EL9A 1UKVG 2C72A 4NTEA 2JB3A 2ACZA 1TDFA 2GR2A 2EQ7A 4Z25A 1L9DA 4WCTA 1E1MA 3K30A 4B68A 3K7MX 2XDOA 3NNEA 3NYEA 2RABA 3T37A 1CJ4A 2FBWA 3M12A 3AE1A 3DJDA 4U8IA 4B63A 4B67A 3CGEA 1PBEA 4GF7A 1XPQA 3AEBA 2VVLA 2C70A 1IUVA 2XLTA 4NTDA 4I59A 4CY8A 3CTYA 2WDRA 5U25A 1DOBA 4BURA 1E1NA 2XVJA 1NHPA 3ALJA 5U63A 2XVHA 3FMWA 3CPHG 4H7UA 1XANA 2EQ9A 1H6VA 3FG2P 3FPZA 4GR1A 5J60A 3SM8A 3CNSA 2C73A 3HZLA 2BC1A 3V3OA 3BI4A 3BNMA 3DK4A 4Z43A 1PBCA 3C96A 4KX6A 1ZMCA 4OPCA 1BKWA 1DXLA 1E1LA 1B5QA 3AWIA 4GRTA 2RGOA 1ELIA 3KU9A 4UDPA 2R0PA 4U8LA 1ONFA 1TDKA 3CNDA 5HHFA 4ZCDA 2YR4A 1PBFA 4JY2A 3AE6A 3UTGA 3L8KA 1N4VA 1L9CA 3OZ2A 4EIQA 4FK1C 1CC6A 5JCNA 1B8SA 2J3NA 3NIXA 3QVRA 5KWFA 4CY6A 1XDIA 2VQBA 3KLJA 1M64A 2EQ6A 3NGCX 4YKFA 3LOVA 1D4DA 1IUTA 1FEBA 4OPIA 3REDA 2XVFA 1GESA 3GRSA 2ZZBA 4UDRA 1FL2A 4A7AA 4Z2RA 1NENA 1GETA 2DKHA 2BA9A 2GAGB 2WOVA 1CBOA 2BC0A 2B7RA 2E5VA 1TYPA 2BS2A 2QCUA 3FIMB 2NVKX 3FBSA 3BI2A 4JN9A 4OPDA 3NT6A 4H4RA 4J31A 2XFNA 4EQSA 2BCPA 2FJAA 3QSMA 3ZYXA 3UP5A 3AE4A 2V3BA 1V59A 1BGJA 1DOCA 2GR1A 1O94A 4JQ9A 1D7LA 3I6DA 5EBKA 2GB0A 2GH5A 5M10A 1PHHA 2R9ZA 1PBBA 5IQ4A 1D4CA 3PVCA 1NHRA 3L1RA 4OPGA 4B65A 4EM4A 1SEZA 4BJZA 3LB8A 2CFYA 2XLPA 3NK0X 3NTAA 1GEUA 2UZZA 2A87A 3NK2X 1FCDA 1JU2A 4J36A 1LQTA 3AE7A 3KD9A 4FDCB 1REOA 4PABA 1H86A 1PJ7A 2FJDA 3IHMA 1KF6A 1ZY8A 1GPEA 2XLRA 1COYA 4K8DA 4YXDA 1EL5A 2A8XA 3CIRA 3NRNA 3QJ4A 4USQA 3C4AA 5BULA 1H81A 1CC4A 3G5SA 3G5RA 3NYFA 2OA1A 3B6DA 2GMJA 5KOWA 2ARDA 3KA7A 1CC2A 5FS6A 4N9XA 3S5WA 2X8GA 4X9MA 2X99A 4XWRA 3GDNA 2Q0KA 1NDAA 1QLBA 3GD3A 4AT2A 2B9XA 4XWZA 4U8JA 2C3DA 4H4TA 1CJCA 1PJ5A 3VRAA 2OALA 1W4XA 2E4GA 4A6NB 2R46A 4EQWA 4Z2TA 3AEDA 4GDEA 4UDQA 3P4SA 2XFOA 2C67A 5BVAA 3AECA 5JCKA 4YSZA 4JNQA 2O9ZA 1JRYA 3P4RA 1GT8A 3IWAA 4H4PA 4OPLA 2C66A 3M13A 5EB4A 3UKKA 5C3JA 2XVIA 4U2SA 2YLTA 2PHHA 3UOYA 2IVEA 2YG3A 1NG3A 4K22A 4RG4A 4TM3A 3COXA 2WQYA 2JK6A 2XFQA 2OLOA 3CPJG 2GV8A 2YM1A 3M0OA 1E1KA 2JKCA 3D1CA 2Q0LA 4H50A 3LZWA 5HYMA 2V60A 3GSIA 3P4QA 1Q1RA 1L9EA 3AE3A 4RG3A 4TLZA 1IJHA 5KRQA 2YM2A 3ALMA 4H4VA 1JNRA 2XFPA 1K0JA 2YQUA 3AEEA 3G5QA 4H4SA 4KPRA 1BWCA 5DBJA 5HY5A 2YG5A 3AEGA 3GDPA 3UKQA 4BK1A 1JRXA 2GAHB 3AE2A 3H4KA 3SFEA 2BK3A 5BUKA 3AE5A 4OCGA 3LZXA 1H84A 1ZKQA 4HB9A 4Z24A 4NTCA 4NZHA 1N1PA 4CBQA 4B64A 1ZOVA 4A9WA 1VG0A 2Z5XA 2CULA 1DJNA 4GUVA 2YG7A 2BS4A 2W0HA 1KNRA 1OJAA 3AYJA 3ABVA 4BJYA 1ZX9A 5GRTA 2R0CA 3V76A 3EANA 1VRQB 3NG7X 3VR8A 1DNCA 3UOZA 3Q6JA 3H8IA 4PAAA 4CNJA 2X3NA 2BXRA 3BI5A 2OAMA 1B4VA 4M52A 1MO9A 3SGLA 1CL0A 4ZCCA 1DOEA 2YLSA 4IV9A 1NG4A 1IUSA 1BZLA 1E7PA 1JRZA 4TLXA 4ECHA 1E39A 1H7WA 2BXSA 3SFDA 4JY3A 3QSSA 3BNUA 4Z26A 4TM0A 1GERA 3DH9A 2FJBA 1YKJA 3NLCA 4J56A 5ER0A 2VZ2A 3IF9A 4YKGA 4EMJA 2BK5A 1VDCA 2GVCA 3D8XA 2YLRA 3C4NA 2BS3A 4X4JA 1CHUA 3IHGA 2APGA 1GTEA 2FJEA 1HYUA 3Q9TA 5FS7A 2WP9A 5M0ZA 3GMBA 1YQZA 3F8DA 3AYIA 3K7TA 4H4WA 5KVIA 3UOXA 1Y0PA 4J33A 1YY5A 4O5UA 3WE0A 3URHA 3ICSA 4YSHA 3RP6A 4BK2A 1PBDA 4DNAA 2VRLA 2WEUA 3RP7A 3CGBA 3VRBA 3DJGX 4U8PA 2YVGA 4GDPA 1N4WA 1GRBA 3NYCA 4OVIA 2WOWA 3S61A 2GR0A 3UKFA 1OJDA 1Y56B 2XLSA 3DMEA 3EAOA 3GD4A 3RP8A 2GQFA 4J34A 3GYIA 3AB1A 1LPFA 2E1MA 2JB2A 1AOGA 1OJ9A 3GMCA 3V3NA 2V61A 2R45A 2XYOA 4H2NA 2YLWA 3P1WA 3UTHA 2B9WA 4JNAA 1B37A 3NN6X 3UTEA 1KNPA 2JBVA 2PYXA 1S3BA 4WX1A 5FS8A 2BCGG 4IVOB 3UTFA 1LQUA 2OLNA 1GOSA 3GWFA 2V3AA 3CNTA 5IQ1A 4OPUA 3QSEA 3UKLA 3ZDNA 3AE8A 1LV0A 2H88A 2QA1A 2R4EA 1FECA 3NH3X 2F5ZA 4E0VA 3F8RA 2CVJA 1K0IA 2YG4A 4H2RA 5JCIA 2X8HA 1RSGA 4LU6A 1IUUA 1H83A 2GR3A 2Y6QA 2YLXA 1LVLA 4U8MA 5JCMA 4P9SA 4CNKA 3DGHA 4LIIA 2B7SA 3QFBA 5HXIA 5KVHA 3DJJA 4YT0A 5IPYA 3NN0X 2JAEA 1GV4A 2HQMA 1EL7A 2WHDA 2XVEA 1ZDLA 2IIDA 4ICYA 1TDOA 4B66A 3EF6A 4A5LA 3UP4A 2EQ8A 1MXTA 3AYLA 5KXJA 3LJPA 3I3LA 1S3EA 2YVJA 1KFYA 4JDRA 1PXAA 2JB1A
chains in the Genus database with same CATH superfamily
3P0WA 3AEFA 2X8CA 2GSHA 1N4UA 4K5RA 1DJQA 1GSNA 1OJTA 2ZC8A 1X31B 2BACA 2ZZ0A 2XLUA 4Z44A 3I6EA 3JSKA 3SQPA 1KSUA 4A65A 3R9UA 5FJPA 2GRTA 3K7QX 2XH7A 2E5AA 3OZMA 3T2ZA 4ZN0A 2WU2A 3GD6A 2OQYA 1GRGA 1D4EA 3OTRA 2VVLG 4BV6A 4YTMA 3CMMA 4A99A 4TM4A 1CJ2A 1YQ4A 2WPEA 5KNLA 1NEKA 2POZA 1GTHA 3ISHA 3GYJA 3B9JB 3RR1A 4XXGA 3FVDA 3RO6A 3SR6B 3ZLHA 1L0VA 2BRAA 4MJWA 3NXLA 1N5WC 1VQZA 4NEVA 3FV9A 3ATQA 5CKUA 2IVDA 3JVAA 1NHSA 1H7XA 5KMPA 4IVMB 3KVEA 2WESA 3DG3A 4B69A 7ENLA 3II4A 2C64A 4U2LA 3UKAA 4B1BA 1JEHA 1E6EA 1K0LA 2QDEA 3CGDA 2PP1A 3L5OA 3MWCA 4H4ZA 1GRFA 4Y4LA 3JW7A 1Z6LA 1H82A 2YVFA 1BGNA 4Y4MA 5KOXA 3ALLA 4BK3A 2QJMA 2NPXA 1DODA 1PJ6A 5JRBA 1QJDA 1Q9IA 2QA2A 2WS3A 1S2YA 3AEAA 2CHRA 2XCGA 4A79A 1R0MA 3KUMA 2ZZCA 4IP5A 4FK1A 3U4FA 4D03A 1EBDA 1MOKA 1ZP0A 2FKPA 1TZZA 2B76A 1F6MA 3RHAA 4AOXA 1FHUA 5JCLA 3T4WA 3DERA 1WUFA 1TDFA 2PU1A 4Z25A 4WCTA 4B68A 3IJIA 2RABA 3T37A 3AE1A 4U8IA 4B67A 3MSYA 3OP2A 2QDDA 2XVJA 3ALJA 5J60A 4H7UA 2EQ9A 2PS2A 1FHVA 3BI4A 3DK4A 2AL2B 2GL5A 1PBCA 5KMSA 1DXLA 2P3ZA 3AWIA 3KU9A 2DW7A 1ONFA 3CNDA 5HHFA 3UTGA 2E3TA 1L9CA 3OZ2A 3QVRA 2J3NA 5KWFA 3KLJA 3NGCX 1FEBA 4DXKA 4UDRA 1FL2A 1GETA 2WOVA 1CBOA 2BC0A 2E5VA 1TYPA 2XFNA 2FJAA 2MUCA 3UP5A 2QJNA 1O94A 4JQ9A 1D4CA 4GAPA 4BJZA 3LB8A 2XLPA 1GEUA 4G7FA 2UZZA 3NRZB 3AE7A 3V4BA 2FJDA 4H2HA 3QJ4A 3HYWA 3C4AA 4ZCWA 1H81A 2OA1A 3B6DA 3SJNA 2X8GA 4X9MA 4XWRA 2Q0KA 1NELA 4XWZA 3VFCA 1N63C 1W4XA 2OO6A 3AEDA 5BVAA 2C67A 3VA8A 1SB3B 1GT8A 3UKKA 5EB4A 2OKTA 2PHHA 2IVEA 2XH2A 1NG3A 3CPJG 2GV8A 2YM1A 1E1KA 2Q0LA 5HYMA 4RG3A 1IJHA 5KRQA 2PA6A 3ES7A 2XFPA 2YQUA 4H4SA 1BWCA 2YG5A 4BK1A 3AE2A 3AM9A 3SFEA 1ZKQA 1RM6B 3ES8A 4NZHA 4DX3A 3JZUA 2CULA 1KNRA 4EWJA 3EANA 3NG7X 3UXLA 3MQTA 3H8IA 1CL0A 4II3A 4ZCCA 2YLSA 1IUSA 4JY3A 4ENLA 3BNUA 4K8GA 4MMWA 4Z26A 3DH9A 3TTEA 4J56A 3I6TA 3NLCA 3SYIA 4EMJA 2BK5A 1VDCA 3T0KA 3S47A 4H19A 4X4JA 3GC2A 3GO2A 2WP9A 3GMBA 4H4WA 4O5UA 2VRLA 2WEUA 3TW9A 4OVIA 1GRBA 3NYCA 2WOWA 2GR0A 1Y56B 3EAOA 4HNCA 3RP8A 3GYIA 1LPFA 2XSXA 3UJRA 3V3WA 1R6WA 4IL2A 3R07C 3SY4A 2QJJA 4H2NA 2YLWA 1KNPA 1S3BA 1FFUC 4WX1A 2OLAA 2V3AA 5IQ1A 3QSEA 4JN8A 1LV0A 2QA1A 3NH3X 3DGBA 1ELSA 4LU6A 4U8MA 2GR3A 2YLXA 1LVLA 1FFVC 3MUCA 2AKZA 1IYXA 2JAEA 1GV4A 1F9CA 1ZDLA 2IIDA 1TDOA 4B66A 3EF6A 3AYLA 2NQLA 1KFYA 1N5XA 4JDRA 3PWIA 4BJYA 2JB1A 3GRTA 4H4QA 4U8KA 5EB5A 4C74A 1KCZA 3E1TA 2PU0A 2AAQA 1MDRA 3BJSA 3ATRA 2OFJA 2P8CA 1GREA 2VOUA 1RP0A 1X2GA 4RSLA 3SZFA 2GGHA 4DGKA 4JHMA 5J7XA 3CXBA 3UJSA 2AKMA 1TRBA 4CCQA 4A6NA 2VRMA 4GYPA 3FYYA 2GEWA 3P9UA 3SZCA 3CNJA 1JCTA 1PS9A 1FOHA 5BRTA 3ICTA 2Z5YA 3SBFA 3AD9B 2CDUA 1PDZA 1KDGA 3HPFA 1JRPA 2BYBA 1JPDX 2VVMA 4OPTA 2TMDA 3H7VA 2HXUA 1MNSA 3P4PA 2C65A 3AD8B 3NFUA 1FIQB 3NO1A 1ZOYA 1P2HA 1GNDA 3MY9A 4HNLA 4NEWA 3LADA 4AOSA 3RITA 1N61C 3CAWA 1M6IA 2AR8A 2PP0A 5L46A 3I4KA 4G74A 4UP3A 2I0ZA 1IUWA 2WPCA 2OZTA 2B9YA 4O5QA 4HN8A 3N6HA 3QFAA 2HNEA 4TVYA 3MKCA 4ADWA 4USRA 1MUCA 4J57A 1D7YA 2C76A 2X50A 5LV9A 1PXCA 2Q6UA 4YTNA 3SSZA 2H89A 2WDQA 3O0HA 2AL1A 2YR6A 4H4YA 3Q45A 4K7ZA 3B3RA 3VRDB 1T3QC 1E1MA 3K7MX 2XDOA 3NYEA 1NU5A 4HCLA 4B63A 3CGEA 4G73A 2VVLA 4NTDA 3V5CA 2XLTA 4CY8A 1E1NA 2XVHA 3FPZA 4GR1A 4H1ZA 3SM8A 3T31A 3CXOA 2C73A 3V3OA 3C96A 1ZMCA 4OPCA 2PGEA 3R0UA 4UDPA 2R0PA 4KT2A 3N4FA 3FJ4A 1N4VA 2GDQA 1CC6A 5JCNA 4CY6A 1XDIA 3LOVA 3TWAA 3GRSA 4A7AA 3P93A 1ZXIC 4NNJA 4OPDA 2HZGA 5BOFA 4EQSA 2BCPA 3QSMA 3ZYXA 3AE4A 1V59A 2V3BA 1BGJA 1D7LA 3DFYA 3L1RA 2GGEA 3NK0X 3FCPA 3KD9A 1REOA 3T2KA 3R10A 2XLRA 4K8DA 1COYA 2A8XA 3IK4A 3G5SA 3G5RA 2ARDA 3KA7A 3S5WA 3AN1A 3K1GA 2B9XA 4U8JA 2C3DA 3VRAA 2OALA 2E4GA 4GDEA 3AECA 1JRYA 3P4RA 4OPLA 2C66A 3M13A 5C3JA 2XVIA 3UOYA 4RG4A 3COXA 2JK6A 2JKCA 3TOYA 1Q1RA 4TLZA 4H4VA 3T2YA 1JNRA 4GIRA 3AEEA 5HY5A 3GDPA 2GAHB 3AE5A 3LZXA 1H84A 4Z24A 4NTCA 4B64A 2Z5XA 2GGIA 4F4RA 3VCCA 1OJAA 5GRTA 1VRQB 2XH4A 1DNCA 3Q6JA 2X3NA 2BXRA 1X2HA 4IV9A 3PFRA 2BRYA 4ECHA 1E39A 1H7WA 4HCDA 4GMEA 3QSSA 2PGWA 1SJAA 3GY1A 4Z1YA 1GERA 1YKJA 5ER0A 2YLRA 2FJEA 3F8DA 3AYIA 5KVIA 2OQHA 4BK2A 1N4WA 3S61A 1OJDA 3DMEA 2XLSA 1MDLA 3GD4A 3AB1A 2E1MA 2JB2A 3HYVA 4ZA0A 1RVKA 2R45A 2XYOA 4II2A 2AL2A 1B37A 4JNAA 2JBVA 5FS8A 3B97A 1LQUA 2OLNA 3ZDNA 3AE8A 2F5ZA 4E0VA 3F8RA 2Y6QA 3KPKA 4P9SA 3QFBA 5KVHA 5HXIA 3STPA 5IPYA 2HQMA 2WHDA 4ICYA 4G8TA 2XVEA 1MXTA 3QKEA 2YVJA 3ZLFA 1TKKA 2PYXA 1KSSA 2YWLA 3UJFA 2C7GA 3R25A 1KKOA 1RYIA 1Q1WA 4NWZA 1F8SA 1TDEA 4C5OA 1GRHA 4U8OA 2YR5A 2Y6RA 4GCMA 5GSNA 3AD7B 4Z2UA 1TYTA 3QVPA 2YAUA 3CB3A 1ZMDA 3TJ4A 4HPNA 1D5TA 3SZ0A 2OPJA 3T9PA 1W6TA 2WDVA 4H4XA 3VCNA 2Q7VA 4D04A 1KKRA 2WPFA 1F8RA 1GALA 4GGBA 2BK4A 2GMHA 2XH0A 5U1OA 3BHKA 1PDYA 2XGZA 3VR9A 4M0XA 1IUXA 1JNZA 4EIPA 3PG6A 3UOVA 4E6MA 1ZK7A 4FI4A 1NHQA 3CNPA 4E5TA 2WETA 3QLDA 3IJLA 3ADAB 4DSHA 4H2QA 4X9NA 4Y4NA 4X2PA 3DG6A 1YQ3A 4FX9A 2V6OA 1FEAA 3T6CA 4AP3A 2WBAA 1XS2A 3KKJA 3RGTA 3FXGA 3P3BA 3F8PA 3CN8A 3A7AA 2ZBWA 5TR3A 3TWBA 3NHOX 1TDNA 3NKSA 2WP6A 3IC9A 4LA1A 1BQGA 4A35A 4EQXA 2DKIA 1CJ3A 2WU5A 4AP1A 3H70A 4K2XA 1EC9A 4JN7A 4YSYA 3SN4A 3PS9A 3NK1X 2PPGA 3EUB3 4APNA 3MZNA 1F3PA 1L8PA 4YSXA 3OZYA 4EMWA 4J2WA 1SJBA 4U2TA 3PWGA 3NVZB 2W3SA 3GWDA 4MKSA 2C75A 3UKHA 1STZA 5CQFA 1XHCA 1NPXA 4YTPA 1E9IA 3BOXA 3R11A 3VQRA 1CF3A 2PTYA 5FS9A 2TPRA 1Y56A 3NTDA 4IZGA 2VQ7A 4H2PA 1VDVA 3R0KA 3ITJA 3AE9A 1O5WA 1UKVG 2C72A 3SZWA 2ACZA 1L9DA 3K30A 3U9IA 3NNEA 3M12A 2OG9A 3DJDA 4GF7A 1IUVA 4I59A 4BURA 5U25A 2WDRA 1DOBA 1NHPA 5U63A 3FMWA 3CPHG 4YWSA 1H6VA 2W54A 2I5QA 3HZLA 4Z43A 3D9XA 4IT1A 1OEPA 1E1LA 2RGOA 1ELIA 3ZVHB 3NVWB 4U8LA 4ZCDA 4KPLA 1SJCA 3T8QA 4FK1C 1B8SA 3NIXA 2VQBA 1S7MA 4YKFA 1IUTA 4OPIA 2XVFA 3HRDC 4Z2RA 1N60C 2DKHA 4GISA 2GAGB 5FJOA 2B7RA 2BS2A 2QCUA 4JN9A 2NVKX 3FBSA 3NT6A 4J31A 3OPSA 4J1OA 2GR1A 3DG7A 3I6DA 5M10A 5IQ4A 2R9ZA 1PBBA 3PVCA 4B65A 2CFYA 3NTAA 2A87A 4HYRA 1FCDA 4J36A 1LQTA 1PJ7A 3IHMA 4YXDA 4USQA 2GGGA 1CC4A 2GMJA 5KOWA 2OVLA 5FS6A 5FJRA 3GDNA 3GD3A 4AT2A 1PJ5A 4EQWA 2R46A 3UXKA 4A3RA 4UDQA 1FO4A 2XFOA 3P4SA 5JCKA 3UGVA 4YSZA 3VC6A 3SQSA 4FP1A 2O9ZA 3IWAA 4H4PA 2YLTA 4TM3A 2GGJA 3VC5A 2OLOA 3M0OA 2V60A 3GSIA 3AE3A 2YM2A 3ALMA 1K0JA 3G5QA 4KEMA 2RDXA 3UKQA 1JRXA 3H4KA 2BK3A 5BUKA 4HB9A 1N1PA 3UCDA 1ZOVA 4A9WA 1VG0A 3DIPA 1DJNA 4GUVA 2BS4A 1EC8A 3AYJA 1ZX9A 2R0CA 3N4EA 3VR8A 4HCHA 4PAAA 4CNJA 4DN1A 3BI5A 4M52A 5G5GB 4Z17A 1DOEA 1NG4A 1ECQA 4TLXA 3SFDA 2FJBA 2VZ2A 2FYMA 3D8XA 3Q9TA 5FS7A 5M0ZA 5G5HB 2PP3A 3K7TA 1Y0PA 3WE0A 3URHA 3RP6A 3VDGA 1PBDA 1EC7A 3VRBA 4DYEA 2YVGA 4GDPA 1N62C 4J34A 3SN0A 2QQ6A 3SX6A 3GYXA 5BOEA 1OJ9A 3GMCA 3V3NA 3H8AA 2V61A 3UTHA 2B9WA 3PK7A 3NN6X 1V97A 3UTFA 3GWFA 4OPUA 2H88A 2R4EA 2OZ3A 5KMRA 4G6HA 1YEYA 1K0IA 2YG4A 2OX4A 1IUUA 1H83A 5JCMA 3CT2A 1WUEA 2PODA 2B7SA 3DJJA 4MGGA 3NN0X 1P48A 4GAVA 3UP4A 2EQ8A 4J3ZA 3LJPA 3I3LA 1PXAA 3KPFA 1JOAA 3CYJA 2WP5A 4I58A 3DA1A 2GF3A 4GFIA 4EQRA 2A89A 1P2EA 4C77A 2V5ZA 4EMIA 2PSNA 4H4UA 2RGHA 2YG6A 3AXBA 1NAAA 3AMZA 3CPIG 3H8LA 4U8NA 1QO8A 2C3CA 3D46A 5FMHA 4ROPA 1GXFA 1O95A 1LJ1A 2QAEA 1KD0A 1F8WA 2YLZA 5J04A 2R4JA 2OZ8A 1VG9A 1EL8A 3ICRA 4DWDA 3THUA 2DW6A 4TM1A 1PDHA 2ZADA 3QPEA 1VQWA 4AT0A 3NS1B 4GGHA 2RGJA 3RNMA 4G6GA 4CCRA 4TVWA 1XPYA 5FJUA 4K1WA 2WOIA 3DGZA 4CRTA 3BHFA 1PN0A 4EM3A 2W3RA 3HW2A 1LTXR 3H12A 3ETRB 3HYXA 3OC4A 4IA6A 1BF3A 3DJEA 1K4QA 2R0GA 1OJCA 1GRTA 3PO7A 1SJDA 1ONEA 1GRAA 4YWOA 1EBGA 5C2TA 4A6GA 2AQJA 2GQWA 3CGCA 1S2QA 2W55A 6ENLA 3OW1A 4GYPC 4IP4A 4C3YA 4DSGA 3DK8A 3LXDA 4H83A 1PXBA 4C3XA 3UCCA 5IDZA 4K5SA 3D47A 3RRAA 3EPTA 2XFUA 4HA6A 3UKPA 3DK9A 4IA5A 5EOWA 4REKA 2PTWA 3RCYA 3UCLA 1EL9A 1JDFA 4NTEA 2JB3A 4E4UA 2GR2A 2EQ7A 1JPMA 1P43A 1CJ4A 3SXIA 1EBHA 3A7UA 2FBWA 2PTZA 1PBEA 1XPQA 3AEBA 3S5SA 2C70A 3IJQA 3UJEA 3CTYA 1XANA 3FG2P 3N6JA 3NVYB 3ZLGA 3CNSA 3BSMA 2BC1A 3BNMA 3A7RA 4KX6A 1BKWA 4GRTA 1B5QA 1TDKA 2YR4A 1PBFA 4JY2A 3AE6A 3L8KA 4EIQA 4ZOHB 1M64A 2EQ6A 2MNRA 1JROA 1D4DA 3REDA 3DFHA 1GESA 2ZZBA 1NENA 3V5FA 1DTNA 2BA9A 3ZVIA 3FIMB 3BI2A 2ONEA 4H4RA 1H2IA 1DOCA 5EBKA 4E8GA 2GB0A 2GH5A 1PHHA 4OPGA 1NHRA 4EM4A 1SEZA 3NK2X 1JU2A 4FDCB 4PABA 1H86A 1ZY8A 1KF6A 1GPEA 3R1ZA 1EL5A 3CIRA 3NRNA 5BULA 2P8BA 3NYFA 2PTXA 5ENLA 3SN1A 1CC2A 4N9XA 3TQPA 2X99A 1NDAA 1QLBA 4H4TA 4KWSA 3EKGA 1CJCA 3NVVB 4A6NB 4Z2TA 3Q4DA 3EEZA 2QGYA 4JNQA 4E4FA 3UJ2A 3TJIA 4DHGA 4U2SA 2YG3A 4K22A 5KMQA 2WQYA 2XFQA 3D1CA 4H50A 3LZWA 3P4QA 1L9EA 4G9KA 2O56A 4KPRA 5DBJA 3CK5A 3QN3A 3AEGA 4OCGA 4CBQA 5EU9A 2YG7A 2W0HA 3ABVA 3V76A 1WYGA 3DDMA 3UOZA 2PMQA 2OAMA 1B4VA 3SGLA 1MO9A 1TE6A 1E7PA 1BZLA 1JRZA 2BXSA 2P88A 3ENLA 4TM0A 3T14A 3IF9A 4YKGA 2C4CA 3DEQA 2GVCA 2PCEA 3C4NA 2BS3A 1CHUA 3IHGA 2APGA 1GTEA 1HYUA 3QTPA 1YQZA 3UOXA 4J33A 1YY5A 4YSHA 3ICSA 4DNAA 3RP7A 3CGBA 3DJGX 4U8PA 3UKFA 2GQFA 2QVHA 1AOGA 1BKHA 3P1WA 4K2SA 3UTEA 2BCGG 4IVOB 1GOSA 3CNTA 3ZVHA 1KN0A 3UKLA 1FECA 2P0IA 1MRAA 2CVJA 4H2RA 5JCIA 2X8HA 1RSGA 4CNKA 3DGHA 4LIIA 3DESA 4YT0A 4M6UA 1EL7A 4IHCA 4A5LA 5FJTA 4IL0A 5KXJA 2HXTA 3NZGA 1S3EA 3TCSA 2BABA
chains in the Genus database with same CATH topology
1JOAA 1KSSA 3GRTA 2YWLA 4H4QA 2WP5A 4I58A 4U8KA 5EB5A 4C74A 3DA1A 2C7GA 2GF3A 3E1TA 4EQRA 2AAQA 2X8CA 3AEFA 1RYIA 1Q1WA 1N4UA 4NWZA 2A89A 4K5RA 1F8SA 1TDEA 4C5OA 1GRHA 1DJQA 1P2EA 2YR5A 4U8OA 2Y6RA 4C77A 1GSNA 1OJTA 2V5ZA 1X31B 2BACA 4GCMA 4EMIA 3ATRA 5GSNA 3AD7B 4Z2UA 1TYTA 2ZZ0A 2XLUA 4Z44A 4H4UA 2RGHA 2YG6A 3AXBA 1NAAA 3JSKA 3QVPA 2YAUA 3SQPA 3CPIG 1KSUA 3H8LA 4U8NA 1QO8A 1ZMDA 4A65A 2C3CA 1D5TA 3SZ0A 3R9UA 1GREA 2VOUA 5FMHA 1RP0A 2GRTA 3K7QX 2WDVA 4H4XA 2Q7VA 3T2ZA 1GXFA 4ZN0A 2WU2A 1O95A 4D04A 2WPFA 1F8RA 4RSLA 3SZFA 1GALA 1GRGA 2BK4A 1D4EA 2GMHA 5U1OA 1LJ1A 3BHKA 4DGKA 3VR9A 2QAEA 1IUXA 2VVLG 4BV6A 4YTMA 1JNZA 3CMMA 3PG6A 4TM4A 5J7XA 4A99A 3UOVA 4EIPA 1F8WA 1CJ2A 2YLZA 1ZK7A 1NHQA 2R4JA 1TRBA 1VG9A 1EL8A 1YQ4A 3CNPA 2WPEA 2WETA 3ICRA 4CCQA 3ADAB 4A6NA 1NEKA 2VRMA 5KNLA 1GTHA 3ISHA 2GEWA 4TM1A 1PDHA 4DSHA 4H2QA 1VQWA 3GYJA 4X9NA 3P9UA 4Y4NA 4AT0A 3SZCA 3CNJA 4XXGA 1YQ3A 1PS9A 4FX9A 2RGJA 1FOHA 2BRAA 3RNMA 3ICTA 1L0VA 4G6GA 2Z5YA 4MJWA 5BRTA 3AD9B 2V6OA 4CCRA 4NEVA 1FEAA 3ATQA 5CKUA 4AP3A 2IVDA 2CDUA 2WOIA 3DGZA 1NHSA 1KDGA 4CRTA 2WBAA 1H7XA 5KMPA 3BHFA 3KKJA 4IVMB 1PN0A 3KVEA 4EM3A 2BYBA 2VVMA 2WESA 4OPTA 2TMDA 1LTXR 3F8PA 4B69A 3CN8A 2ZBWA 3HYXA 3II4A 5TR3A 3NHOX 3P4PA 2C64A 3OC4A 4U2LA 1TDNA 3NKSA 3UKAA 3KPFA 4IA6A 2WP6A 3IC9A 2C65A 3AD8B 4B1BA 1JEHA 4LA1A 1E6EA 1K0LA 1BF3A 1ZOYA 3DJEA 1P2HA 1K4QA 4EQXA 1GNDA 2DKIA 1CJ3A 2WU5A 4NEWA 4AP1A 3CGDA 2BABA 3LADA 3L5OA 4H4ZA 1OJCA 2R0GA 4AOSA 4K2XA 1GRTA 3PO7A 1GRFA 4Y4LA 1Z6LA 4YSYA 3PS9A 1H82A 1M6IA 2YVFA 1BGNA 3NK1X 4Y4MA 4APNA 2AR8A 1F3PA 5KOXA 5L46A 3ALLA 4BK3A 4YSXA 4G74A 1GRAA 4YWOA 2NPXA 5C2TA 4EMWA 1DODA 1PJ6A 5JRBA 4UP3A 2I0ZA 1IUWA 2AQJA 2WPCA 2GQWA 3CGCA 4J2WA 1QJDA 1Q9IA 2QA2A 1S2QA 2B9YA 4O5QA 4U2TA 2WS3A 1S2YA 3QFAA 3AEAA 2XCGA 3GWDA 2C75A 4A79A 4ADWA 2ZZCA 4USRA 4J57A 1D7YA 2C76A 4FK1A 4C3YA 4DSGA 3DK8A 3UKHA 3LXDA 1PXBA 4D03A 2X50A 5CQFA 1XHCA 1NPXA 4C3XA 5LV9A 4YTPA 1EBDA 1PXCA 1MOKA 1ZP0A 2Q6UA 3VQRA 4YTNA 1CF3A 2B76A 1F6MA 2H89A 2WDQA 3RHAA 3O0HA 5FS9A 4K5SA 4AOXA 2TPRA 2YR6A 1Y56A 3EPTA 3NTDA 2VQ7A 2XFUA 4HA6A 4H2PA 4H4YA 3UKPA 3ITJA 3DK9A 4K7ZA 4IA5A 3B3RA 5EOWA 4REKA 3AE9A 5JCLA 1O5WA 3UCLA 3VRDB 1EL9A 1UKVG 2C72A 4NTEA 2JB3A 3SZWA 2ACZA 1TDFA 2GR2A 2EQ7A 4Z25A 1L9DA 4WCTA 1E1MA 3K30A 4B68A 3K7MX 2XDOA 3NNEA 3NYEA 2RABA 3T37A 1CJ4A 3SXIA 2FBWA 3M12A 3AE1A 3DJDA 4U8IA 4B63A 4B67A 3CGEA 1PBEA 4G73A 4GF7A 1XPQA 3AEBA 2VVLA 2C70A 1IUVA 2XLTA 4NTDA 4I59A 4CY8A 4BURA 5U25A 2WDRA 1DOBA 3CTYA 1E1NA 2XVJA 1NHPA 3ALJA 5U63A 2XVHA 3FMWA 3CPHG 4H7UA 1XANA 2EQ9A 1H6VA 3FG2P 4GR1A 3FPZA 5J60A 3SM8A 3CNSA 3T31A 2C73A 3HZLA 2BC1A 3V3OA 3BI4A 3BNMA 3DK4A 1PXAA 4Z43A 1PBCA 3D9XA 5KMSA 3C96A 4KX6A 1ZMCA 4OPCA 1BKWA 1DXLA 1E1LA 4GRTA 1B5QA 3AWIA 2RGOA 1ELIA 3KU9A 4UDPA 2R0PA 4U8LA 1ONFA 1TDKA 3CNDA 5HHFA 4ZCDA 2YR4A 1PBFA 4JY2A 3AE6A 3UTGA 3L8KA 1N4VA 1L9CA 3OZ2A 4EIQA 4FK1C 1CC6A 5JCNA 1B8SA 2J3NA 3NIXA 3QVRA 5KWFA 4CY6A 1XDIA 3KLJA 2VQBA 1S7MA 1M64A 2EQ6A 3NGCX 4YKFA 3LOVA 1D4DA 1FEBA 1IUTA 4OPIA 3REDA 2XVFA 1GESA 3GRSA 2ZZBA 4UDRA 1FL2A 4A7AA 4Z2RA 1NENA 1GETA 2DKHA 2BA9A 2WOVA 2GAGB 1CBOA 2BC0A 2B7RA 2E5VA 1TYPA 2BS2A 2QCUA 3FIMB 2NVKX 3FBSA 3BI2A 4JN9A 4NNJA 4OPDA 4H4RA 4EQSA 3NT6A 2XFNA 4J31A 2BCPA 2FJAA 3QSMA 3ZYXA 1H2IA 3UP5A 3AE4A 1V59A 2V3BA 1BGJA 1DOCA 2GR1A 5EBKA 4JQ9A 1D7LA 1O94A 3I6DA 2GB0A 2GH5A 5M10A 1PHHA 2R9ZA 1PBBA 5IQ4A 1D4CA 3PVCA 1NHRA 4EM4A 3L1RA 4OPGA 4B65A 1SEZA 4GAPA 4BJZA 3LB8A 2CFYA 2XLPA 3NK0X 3NTAA 1GEUA 2UZZA 2A87A 3NK2X 1FCDA 1JU2A 4J36A 1LQTA 4FDCB 3AE7A 3KD9A 1REOA 4PABA 1H86A 1PJ7A 2FJDA 3IHMA 1ZY8A 1KF6A 3T2KA 1GPEA 2XLRA 4K8DA 1COYA 4YXDA 2A8XA 1EL5A 3CIRA 3NRNA 3QJ4A 3HYWA 4USQA 3C4AA 5BULA 1H81A 1CC4A 3G5SA 3G5RA 3NYFA 2OA1A 3B6DA 2GMJA 5KOWA 2ARDA 3KA7A 5FS6A 1CC2A 4N9XA 3S5WA 2X8GA 4X9MA 2X99A 4XWRA 3GDNA 2Q0KA 1NDAA 3GD3A 1QLBA 4AT2A 2B9XA 4XWZA 4U8JA 2C3DA 4H4TA 1CJCA 1PJ5A 3VRAA 2OALA 1W4XA 4EQWA 2E4GA 2R46A 4A6NB 4Z2TA 3AEDA 4GDEA 4UDQA 3P4SA 2XFOA 2C67A 5BVAA 3AECA 5JCKA 4YSZA 4JNQA 2O9ZA 1JRYA 3P4RA 1GT8A 3IWAA 4H4PA 4OPLA 2C66A 3M13A 5EB4A 3UKKA 5C3JA 2XVIA 4U2SA 2YLTA 2PHHA 3UOYA 2IVEA 2YG3A 1NG3A 4K22A 4RG4A 4TM3A 5KMQA 3COXA 2WQYA 2JK6A 2XFQA 2OLOA 3CPJG 2GV8A 2YM1A 3M0OA 1E1KA 2JKCA 3D1CA 2Q0LA 4H50A 3LZWA 5HYMA 2V60A 3GSIA 3P4QA 1Q1RA 1L9EA 3AE3A 4G9KA 4RG3A 1IJHA 4TLZA 5KRQA 4H4VA 2YM2A 3ALMA 3T2YA 1JNRA 2XFPA 2YQUA 4H4SA 4KPRA 1K0JA 3AEEA 3G5QA 1BWCA 5DBJA 5HY5A 2YG5A 3AEGA 3GDPA 3UKQA 4BK1A 1JRXA 2GAHB 3AE2A 3H4KA 3SFEA 2BK3A 5BUKA 3AE5A 4OCGA 3LZXA 1H84A 1ZKQA 4HB9A 4Z24A 4NTCA 4NZHA 1N1PA 4CBQA 4B64A 1ZOVA 4A9WA 1VG0A 2Z5XA 2CULA 1DJNA 4GUVA 2YG7A 2BS4A 2W0HA 1KNRA 1OJAA 3AYJA 3ABVA 4BJYA 1ZX9A 5GRTA 2R0CA 3V76A 3EANA 1VRQB 3NG7X 3VR8A 1DNCA 3UOZA 3Q6JA 3H8IA 4PAAA 4CNJA 2X3NA 2BXRA 3BI5A 2OAMA 1B4VA 4M52A 1MO9A 3SGLA 1CL0A 4II3A 4ZCCA 1DOEA 2YLSA 4IV9A 1NG4A 1JRZA 1BZLA 1IUSA 1E7PA 4TLXA 2BRYA 4ECHA 1E39A 1H7WA 2BXSA 3SFDA 4JY3A 3QSSA 3BNUA 4Z26A 4TM0A 1GERA 3DH9A 3T14A 4J56A 1YKJA 2FJBA 3NLCA 3SYIA 5ER0A 2VZ2A 3IF9A 4YKGA 4EMJA 2BK5A 2C4CA 1VDCA 2GVCA 3D8XA 3T0KA 2YLRA 3C4NA 2BS3A 4X4JA 1CHUA 3IHGA 2APGA 1GTEA 5FS7A 1HYUA 2FJEA 3Q9TA 2WP9A 5M0ZA 3GMBA 1YQZA 3F8DA 4H4WA 3AYIA 3K7TA 5KVIA 3UOXA 1Y0PA 4J33A 1YY5A 4O5UA 3WE0A 3URHA 3ICSA 4YSHA 3RP6A 4BK2A 1PBDA 4DNAA 2VRLA 2WEUA 3RP7A 3CGBA 3VRBA 3DJGX 4U8PA 2YVGA 4GDPA 1N4WA 1GRBA 3NYCA 4OVIA 2WOWA 3S61A 2GR0A 3UKFA 1OJDA 1Y56B 3EAOA 2XLSA 3DMEA 3GD4A 3RP8A 2GQFA 4J34A 3GYIA 3AB1A 1LPFA 1AOGA 2E1MA 2JB2A 3GYXA 3HYVA 3SX6A 1OJ9A 3GMCA 3V3NA 3SY4A 2V61A 2R45A 2XYOA 4H2NA 2YLWA 3P1WA 4II2A 3UTHA 2B9WA 4JNAA 1B37A 3NN6X 3UTEA 1KNPA 2JBVA 2PYXA 5FS8A 1S3BA 4WX1A 2BCGG 4IVOB 3UTFA 1LQUA 2OLNA 1GOSA 3GWFA 2V3AA 3CNTA 5IQ1A 4OPUA 3QSEA 1KN0A 3UKLA 3ZDNA 3AE8A 1LV0A 2H88A 2QA1A 2R4EA 5KMRA 1FECA 4G6HA 3NH3X 2F5ZA 4E0VA 3F8RA 2CVJA 1K0IA 2YG4A 4H2RA 5JCIA 2X8HA 1RSGA 4LU6A 1IUUA 1H83A 2GR3A 2Y6QA 2YLXA 1LVLA 5JCMA 4U8MA 3KPKA 4P9SA 3DGHA 4CNKA 4LIIA 2B7SA 3QFBA 5KVHA 5HXIA 3DJJA 4YT0A 5IPYA 3NN0X 2JAEA 1GV4A 2HQMA 1EL7A 2WHDA 2XVEA 1ZDLA 2IIDA 4ICYA 1TDOA 4B66A 3EF6A 4GAVA 3UP4A 4A5LA 2EQ8A 3AYLA 5KXJA 3LJPA 3I3LA 1S3EA 2YVJA 1KFYA 4JDRA 1MXTA 2JB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOA A;  1KSS A;  3GRT A;  2YWL A;  4H4Q A;  2WP5 A;  4I58 A;  4U8K A;  5EB5 A;  4C74 A;  3DA1 A;  2C7G A;  2GF3 A;  3E1T A;  4EQR A;  2AAQ A;  2X8C A;  3AEF A;  1RYI A;  1N4U A;  1Q1W A;  2A89 A;  4K5R A;  1F8S A;  1TDE A;  4C5O A;  1GRH A;  1DJQ A;  1P2E A;  2YR5 A;  4U8O A;  2Y6R A;  4C77 A;  1GSN A;  1OJT A;  2V5Z A;  1X31 B;  2BAC A;  4GCM A;  5GSN A;  3ATR A;  4EMI A;  3AD7 B;  4Z2U A;  1TYT A;  2XLU A;  2ZZ0 A;  4Z44 A;  2RGH A;  4H4U A;  2YG6 A;  3AXB A;  1NAA A;  3JSK A;  3QVP A;  2YAU A;  3CPI G;  3SQP A;  1KSU A;  3H8L A;  4U8N A;  1QO8 A;  1ZMD A;  4A65 A;  2C3C A;  1D5T A;  3R9U A;  1GRE A;  2VOU A;  5FMH A;  1RP0 A;  2GRT A;  3K7Q X;  2WDV A;  4H4X A;  2Q7V A;  1GXF A;  4ZN0 A;  2WU2 A;  1O95 A;  4D04 A;  2WPF A;  1F8R A;  4RSL A;  1GAL A;  1GRG A;  2BK4 A;  1D4E A;  2GMH A;  3BHK A;  1LJ1 A;  5U1O A;  4DGK A;  3VR9 A;  2QAE A;  1IUX A;  2VVL G;  4YTM A;  4BV6 A;  1JNZ A;  5J7X A;  4A99 A;  4TM4 A;  4EIP A;  3UOV A;  1F8W A;  1CJ2 A;  2YLZ A;  1ZK7 A;  1NHQ A;  2R4J A;  1TRB A;  1VG9 A;  1EL8 A;  1YQ4 A;  3CNP A;  2WET A;  2WPE A;  3ICR A;  4CCQ A;  3ADA B;  4A6N A;  1NEK A;  2VRM A;  1GTH A;  3ISH A;  2GEW A;  4TM1 A;  1PDH A;  4DSH A;  4H2Q A;  1VQW A;  3GYJ A;  4X9N A;  3P9U A;  4Y4N A;  4AT0 A;  3CNJ A;  4XXG A;  1YQ3 A;  1PS9 A;  4FX9 A;  2RGJ A;  1FOH A;  1L0V A;  3ICT A;  3RNM A;  5BRT A;  4MJW A;  2Z5Y A;  3AD9 B;  2V6O A;  4CCR A;  4NEV A;  1FEA A;  3ATQ A;  5CKU A;  4AP3 A;  2IVD A;  2CDU A;  2WOI A;  3DGZ A;  1NHS A;  1KDG A;  4CRT A;  2WBA A;  1H7X A;  3BHF A;  3KKJ A;  4IVM B;  1PN0 A;  3KVE A;  4EM3 A;  2BYB A;  2VVM A;  2WES A;  4OPT A;  2TMD A;  1LTX R;  3F8P A;  4B69 A;  3CN8 A;  2ZBW A;  3II4 A;  5TR3 A;  3NHO X;  3P4P A;  2C64 A;  3OC4 A;  4U2L A;  1TDN A;  3NKS A;  3UKA A;  3KPF A;  4IA6 A;  2WP6 A;  3IC9 A;  2C65 A;  3AD8 B;  4B1B A;  1JEH A;  1E6E A;  1K0L A;  4LA1 A;  1BF3 A;  1ZOY A;  3DJE A;  1P2H A;  1GND A;  1K4Q A;  2DKI A;  4EQX A;  1CJ3 A;  2WU5 A;  4NEW A;  4AP1 A;  3CGD A;  2BAB A;  3LAD A;  2R0G A;  1OJC A;  4H4Z A;  4AOS A;  4K2X A;  1GRT A;  3PO7 A;  1GRF A;  4Y4L A;  1Z6L A;  4YSY A;  3PS9 A;  1H82 A;  1M6I A;  1BGN A;  2YVF A;  3NK1 X;  4Y4M A;  4APN A;  2AR8 A;  1F3P A;  5KOX A;  5L46 A;  3ALL A;  4BK3 A;  4YSX A;  1GRA A;  4YWO A;  2NPX A;  5C2T A;  1DOD A;  4EMW A;  1PJ6 A;  4UP3 A;  2I0Z A;  1IUW A;  2AQJ A;  2WPC A;  2GQW A;  3CGC A;  4J2W A;  1QJD A;  1Q9I A;  2QA2 A;  1S2Q A;  2B9Y A;  4O5Q A;  4U2T A;  2WS3 A;  1S2Y A;  3QFA A;  3AEA A;  2XCG A;  3GWD A;  2C75 A;  4A79 A;  4ADW A;  2ZZC A;  4USR A;  4J57 A;  1D7Y A;  2C76 A;  4FK1 A;  4C3Y A;  4DSG A;  3DK8 A;  3UKH A;  3LXD A;  1PXB A;  4D03 A;  2X50 A;  5CQF A;  1XHC A;  1NPX A;  4C3X A;  5LV9 A;  4YTP A;  1EBD A;  1PXC A;  1MOK A;  1ZP0 A;  2Q6U A;  3VQR A;  4YTN A;  1CF3 A;  2B76 A;  1F6M A;  2H89 A;  2WDQ A;  3RHA A;  3O0H A;  5FS9 A;  4K5S A;  4AOX A;  2TPR A;  2YR6 A;  1Y56 A;  3EPT A;  3NTD A;  2VQ7 A;  2XFU A;  4HA6 A;  4H2P A;  4H4Y A;  3UKP A;  3ITJ A;  3DK9 A;  4IA5 A;  4K7Z A;  3B3R A;  5EOW A;  4REK A;  3AE9 A;  5JCL A;  1O5W A;  3UCL A;  3VRD B;  1EL9 A;  1UKV G;  2C72 A;  4NTE A;  2JB3 A;  2ACZ A;  1TDF A;  2GR2 A;  2EQ7 A;  4Z25 A;  1L9D A;  4WCT A;  1E1M A;  3K30 A;  4B68 A;  3K7M X;  2XDO A;  3NNE A;  3NYE A;  2RAB A;  3T37 A;  1CJ4 A;  2FBW A;  3M12 A;  3AE1 A;  3DJD A;  4U8I A;  4B63 A;  4B67 A;  3CGE A;  1PBE A;  4GF7 A;  1XPQ A;  3AEB A;  2VVL A;  2C70 A;  1IUV A;  2XLT A;  4NTD A;  4I59 A;  4CY8 A;  3CTY A;  2WDR A;  5U25 A;  1DOB A;  4BUR A;  1E1N A;  2XVJ A;  1NHP A;  3ALJ A;  5U63 A;  2XVH A;  3FMW A;  3CPH G;  4H7U A;  1XAN A;  2EQ9 A;  1H6V A;  3FG2 P;  3FPZ A;  4GR1 A;  5J60 A;  3SM8 A;  3CNS A;  2C73 A;  3HZL A;  2BC1 A;  3V3O A;  3BI4 A;  3BNM A;  3DK4 A;  4Z43 A;  1PBC A;  3C96 A;  4KX6 A;  1ZMC A;  4OPC A;  1BKW A;  1DXL A;  1E1L A;  1B5Q A;  3AWI A;  4GRT A;  2RGO A;  1ELI A;  3KU9 A;  4UDP A;  2R0P A;  4U8L A;  1ONF A;  1TDK A;  3CND A;  5HHF A;  4ZCD A;  2YR4 A;  1PBF A;  4JY2 A;  3AE6 A;  3UTG A;  3L8K A;  1N4V A;  1L9C A;  3OZ2 A;  4EIQ A;  4FK1 C;  1CC6 A;  5JCN A;  1B8S A;  2J3N A;  3NIX A;  3QVR A;  5KWF A;  4CY6 A;  1XDI A;  2VQB A;  3KLJ A;  1M64 A;  2EQ6 A;  3NGC X;  4YKF A;  3LOV A;  1D4D A;  1IUT A;  1FEB A;  4OPI A;  3RED A;  2XVF A;  1GES A;  3GRS A;  2ZZB A;  4UDR A;  1FL2 A;  4A7A A;  4Z2R A;  1NEN A;  1GET A;  2DKH A;  2BA9 A;  2GAG B;  2WOV A;  1CBO A;  2BC0 A;  2B7R A;  2E5V A;  1TYP A;  2BS2 A;  2QCU A;  3FIM B;  2NVK X;  3FBS A;  3BI2 A;  4JN9 A;  4OPD A;  3NT6 A;  4H4R A;  4J31 A;  2XFN A;  4EQS A;  2BCP A;  2FJA A;  3QSM A;  3ZYX A;  3UP5 A;  3AE4 A;  2V3B A;  1V59 A;  1BGJ A;  1DOC A;  2GR1 A;  1O94 A;  4JQ9 A;  1D7L A;  3I6D A;  5EBK A;  2GB0 A;  2GH5 A;  5M10 A;  1PHH A;  2R9Z A;  1PBB A;  5IQ4 A;  1D4C A;  3PVC A;  1NHR A;  3L1R A;  4OPG A;  4B65 A;  4EM4 A;  1SEZ A;  4BJZ A;  3LB8 A;  2CFY A;  2XLP A;  3NK0 X;  3NTA A;  1GEU A;  2UZZ A;  2A87 A;  3NK2 X;  1FCD A;  1JU2 A;  4J36 A;  1LQT A;  3AE7 A;  3KD9 A;  4FDC B;  1REO A;  4PAB A;  1H86 A;  1PJ7 A;  2FJD A;  3IHM A;  1KF6 A;  1ZY8 A;  1GPE A;  2XLR A;  1COY A;  4K8D A;  4YXD A;  1EL5 A;  2A8X A;  3CIR A;  3NRN A;  3QJ4 A;  4USQ A;  3C4A A;  5BUL A;  1H81 A;  1CC4 A;  3G5S A;  3G5R A;  3NYF A;  2OA1 A;  3B6D A;  2GMJ A;  5KOW A;  2ARD A;  3KA7 A;  1CC2 A;  5FS6 A;  4N9X A;  3S5W A;  2X8G A;  4X9M A;  2X99 A;  4XWR A;  3GDN A;  2Q0K A;  1NDA A;  1QLB A;  3GD3 A;  4AT2 A;  2B9X A;  4XWZ A;  4U8J A;  2C3D A;  4H4T A;  1CJC A;  1PJ5 A;  3VRA A;  2OAL A;  1W4X A;  2E4G A;  4A6N B;  2R46 A;  4EQW A;  4Z2T A;  3AED A;  4GDE A;  4UDQ A;  3P4S A;  2XFO A;  2C67 A;  5BVA A;  3AEC A;  5JCK A;  4YSZ A;  4JNQ A;  2O9Z A;  1JRY A;  3P4R A;  1GT8 A;  3IWA A;  4H4P A;  4OPL A;  2C66 A;  3M13 A;  5EB4 A;  3UKK A;  5C3J A;  2XVI A;  4U2S A;  2YLT A;  2PHH A;  3UOY A;  2IVE A;  2YG3 A;  1NG3 A;  4K22 A;  4RG4 A;  4TM3 A;  3COX A;  2WQY A;  2JK6 A;  2XFQ A;  2OLO A;  3CPJ G;  2GV8 A;  2YM1 A;  3M0O A;  1E1K A;  2JKC A;  3D1C A;  2Q0L A;  4H50 A;  3LZW A;  5HYM A;  2V60 A;  3GSI A;  3P4Q A;  1Q1R A;  1L9E A;  3AE3 A;  4RG3 A;  4TLZ A;  1IJH A;  5KRQ A;  2YM2 A;  3ALM A;  4H4V A;  1JNR A;  2XFP A;  1K0J A;  2YQU A;  3AEE A;  3G5Q A;  4H4S A;  4KPR A;  1BWC A;  5DBJ A;  5HY5 A;  2YG5 A;  3AEG A;  3GDP A;  3UKQ A;  4BK1 A;  1JRX A;  2GAH B;  3AE2 A;  3H4K A;  3SFE A;  2BK3 A;  5BUK A;  3AE5 A;  4OCG A;  3LZX A;  1H84 A;  1ZKQ A;  4HB9 A;  4Z24 A;  4NTC A;  4NZH A;  1N1P A;  4CBQ A;  4B64 A;  1ZOV A;  4A9W A;  1VG0 A;  2Z5X A;  2CUL A;  1DJN A;  4GUV A;  2YG7 A;  2BS4 A;  2W0H A;  1KNR A;  1OJA A;  3AYJ A;  3ABV A;  4BJY A;  1ZX9 A;  5GRT A;  2R0C A;  3V76 A;  3EAN A;  1VRQ B;  3NG7 X;  3VR8 A;  1DNC A;  3UOZ A;  3Q6J A;  3H8I A;  4PAA A;  4CNJ A;  2X3N A;  2BXR A;  3BI5 A;  2OAM A;  1B4V A;  4M52 A;  1MO9 A;  3SGL A;  1CL0 A;  4ZCC A;  1DOE A;  2YLS A;  4IV9 A;  1NG4 A;  1IUS A;  1BZL A;  1E7P A;  1JRZ A;  4TLX A;  4ECH A;  1E39 A;  1H7W A;  2BXS A;  3SFD A;  4JY3 A;  3QSS A;  3BNU A;  4Z26 A;  4TM0 A;  1GER A;  3DH9 A;  2FJB A;  1YKJ A;  3NLC A;  4J56 A;  5ER0 A;  2VZ2 A;  3IF9 A;  4YKG A;  4EMJ A;  2BK5 A;  1VDC A;  2GVC A;  3D8X A;  2YLR A;  3C4N A;  2BS3 A;  4X4J A;  1CHU A;  3IHG A;  2APG A;  1GTE A;  2FJE A;  1HYU A;  3Q9T A;  5FS7 A;  2WP9 A;  5M0Z A;  3GMB A;  1YQZ A;  3F8D A;  3AYI A;  3K7T A;  4H4W A;  5KVI A;  3UOX A;  1Y0P A;  4J33 A;  1YY5 A;  4O5U A;  3WE0 A;  3URH A;  3ICS A;  4YSH A;  3RP6 A;  4BK2 A;  1PBD A;  4DNA A;  2VRL A;  2WEU A;  3RP7 A;  3CGB A;  3VRB A;  3DJG X;  4U8P A;  2YVG A;  4GDP A;  1N4W A;  1GRB A;  3NYC A;  4OVI A;  2WOW A;  3S61 A;  2GR0 A;  3UKF A;  1OJD A;  1Y56 B;  2XLS A;  3DME A;  3EAO A;  3GD4 A;  3RP8 A;  2GQF A;  4J34 A;  3GYI A;  3AB1 A;  1LPF A;  2E1M A;  2JB2 A;  1AOG A;  1OJ9 A;  3GMC A;  3V3N A;  2V61 A;  2R45 A;  2XYO A;  4H2N A;  2YLW A;  3P1W A;  3UTH A;  2B9W A;  4JNA A;  1B37 A;  3NN6 X;  3UTE A;  1KNP A;  2JBV A;  2PYX A;  1S3B A;  4WX1 A;  5FS8 A;  2BCG G;  4IVO B;  3UTF A;  1LQU A;  2OLN A;  1GOS A;  3GWF A;  2V3A A;  3CNT A;  5IQ1 A;  4OPU A;  3QSE A;  3UKL A;  3ZDN A;  3AE8 A;  1LV0 A;  2H88 A;  2QA1 A;  2R4E A;  1FEC A;  3NH3 X;  2F5Z A;  4E0V A;  3F8R A;  2CVJ A;  1K0I A;  2YG4 A;  4H2R A;  5JCI A;  2X8H A;  1RSG A;  4LU6 A;  1IUU A;  1H83 A;  2GR3 A;  2Y6Q A;  2YLX A;  1LVL A;  4U8M A;  5JCM A;  4P9S A;  4CNK A;  3DGH A;  4LII A;  2B7S A;  3QFB A;  5HXI A;  5KVH A;  3DJJ A;  4YT0 A;  5IPY A;  3NN0 X;  2JAE A;  1GV4 A;  2HQM A;  1EL7 A;  2WHD A;  2XVE A;  1ZDL A;  2IID A;  4ICY A;  1TDO A;  4B66 A;  3EF6 A;  4A5L A;  3UP4 A;  2EQ8 A;  1MXT A;  3AYL A;  5KXJ A;  3LJP A;  3I3L A;  1S3E A;  2YVJ A;  1KFY A;  4JDR A;  1PXA A;  2JB1 A; 
#chains in the Genus database with same CATH topology
 3P0W A;  3AEF A;  2X8C A;  2GSH A;  1N4U A;  4K5R A;  1DJQ A;  1GSN A;  1OJT A;  2ZC8 A;  1X31 B;  2BAC A;  2ZZ0 A;  2XLU A;  4Z44 A;  3I6E A;  3JSK A;  3SQP A;  1KSU A;  4A65 A;  3R9U A;  5FJP A;  2GRT A;  3K7Q X;  2XH7 A;  2E5A A;  3OZM A;  3T2Z A;  4ZN0 A;  2WU2 A;  3GD6 A;  2OQY A;  1GRG A;  1D4E A;  3OTR A;  2VVL G;  4BV6 A;  4YTM A;  3CMM A;  4A99 A;  4TM4 A;  1CJ2 A;  1YQ4 A;  2WPE A;  5KNL A;  1NEK A;  2POZ A;  1GTH A;  3ISH A;  3GYJ A;  3B9J B;  3RR1 A;  4XXG A;  3FVD A;  3RO6 A;  3SR6 B;  3ZLH A;  1L0V A;  2BRA A;  4MJW A;  3NXL A;  1N5W C;  1VQZ A;  4NEV A;  3FV9 A;  3ATQ A;  5CKU A;  2IVD A;  3JVA A;  1NHS A;  1H7X A;  5KMP A;  4IVM B;  3KVE A;  2WES A;  3DG3 A;  4B69 A;  7ENL A;  3II4 A;  2C64 A;  4U2L A;  3UKA A;  4B1B A;  1JEH A;  1E6E A;  1K0L A;  2QDE A;  3CGD A;  2PP1 A;  3L5O A;  3MWC A;  4H4Z A;  1GRF A;  4Y4L A;  3JW7 A;  1Z6L A;  1H82 A;  2YVF A;  1BGN A;  4Y4M A;  5KOX A;  3ALL A;  4BK3 A;  2QJM A;  2NPX A;  1DOD A;  1PJ6 A;  5JRB A;  1QJD A;  1Q9I A;  2QA2 A;  2WS3 A;  1S2Y A;  3AEA A;  2CHR A;  2XCG A;  4A79 A;  1R0M A;  3KUM A;  2ZZC A;  4IP5 A;  4FK1 A;  3U4F A;  4D03 A;  1EBD A;  1MOK A;  1ZP0 A;  2FKP A;  1TZZ A;  2B76 A;  1F6M A;  3RHA A;  4AOX A;  1FHU A;  5JCL A;  3T4W A;  3DER A;  1WUF A;  1TDF A;  2PU1 A;  4Z25 A;  4WCT A;  4B68 A;  3IJI A;  2RAB A;  3T37 A;  3AE1 A;  4U8I A;  4B67 A;  3MSY A;  3OP2 A;  2QDD A;  2XVJ A;  3ALJ A;  5J60 A;  4H7U A;  2EQ9 A;  2PS2 A;  1FHV A;  3BI4 A;  3DK4 A;  2AL2 B;  2GL5 A;  1PBC A;  5KMS A;  1DXL A;  2P3Z A;  3AWI A;  3KU9 A;  2DW7 A;  1ONF A;  3CND A;  5HHF A;  3UTG A;  2E3T A;  1L9C A;  3OZ2 A;  3QVR A;  2J3N A;  5KWF A;  3KLJ A;  3NGC X;  1FEB A;  4DXK A;  4UDR A;  1FL2 A;  1GET A;  2WOV A;  1CBO A;  2BC0 A;  2E5V A;  1TYP A;  2XFN A;  2FJA A;  2MUC A;  3UP5 A;  2QJN A;  1O94 A;  4JQ9 A;  1D4C A;  4GAP A;  4BJZ A;  3LB8 A;  2XLP A;  1GEU A;  4G7F A;  2UZZ A;  3NRZ B;  3AE7 A;  3V4B A;  2FJD A;  4H2H A;  3QJ4 A;  3HYW A;  3C4A A;  4ZCW A;  1H81 A;  2OA1 A;  3B6D A;  3SJN A;  2X8G A;  4X9M A;  4XWR A;  2Q0K A;  1NEL A;  4XWZ A;  3VFC A;  1N63 C;  1W4X A;  2OO6 A;  3AED A;  5BVA A;  2C67 A;  3VA8 A;  1SB3 B;  1GT8 A;  3UKK A;  5EB4 A;  2OKT A;  2PHH A;  2IVE A;  2XH2 A;  1NG3 A;  3CPJ G;  2GV8 A;  2YM1 A;  1E1K A;  2Q0L A;  5HYM A;  4RG3 A;  1IJH A;  5KRQ A;  2PA6 A;  3ES7 A;  2XFP A;  2YQU A;  4H4S A;  1BWC A;  2YG5 A;  4BK1 A;  3AE2 A;  3AM9 A;  3SFE A;  1ZKQ A;  1RM6 B;  3ES8 A;  4NZH A;  4DX3 A;  3JZU A;  2CUL A;  1KNR A;  4EWJ A;  3EAN A;  3NG7 X;  3UXL A;  3MQT A;  3H8I A;  1CL0 A;  4II3 A;  4ZCC A;  2YLS A;  1IUS A;  4JY3 A;  4ENL A;  3BNU A;  4K8G A;  4MMW A;  4Z26 A;  3DH9 A;  3TTE A;  4J56 A;  3I6T A;  3NLC A;  3SYI A;  4EMJ A;  2BK5 A;  1VDC A;  3T0K A;  3S47 A;  4H19 A;  4X4J A;  3GC2 A;  3GO2 A;  2WP9 A;  3GMB A;  4H4W A;  4O5U A;  2VRL A;  2WEU A;  3TW9 A;  4OVI A;  1GRB A;  3NYC A;  2WOW A;  2GR0 A;  1Y56 B;  3EAO A;  4HNC A;  3RP8 A;  3GYI A;  1LPF A;  2XSX A;  3UJR A;  3V3W A;  1R6W A;  4IL2 A;  3R07 C;  3SY4 A;  2QJJ A;  4H2N A;  2YLW A;  1KNP A;  1S3B A;  1FFU C;  4WX1 A;  2OLA A;  2V3A A;  5IQ1 A;  3QSE A;  4JN8 A;  1LV0 A;  2QA1 A;  3NH3 X;  3DGB A;  1ELS A;  4LU6 A;  4U8M A;  2GR3 A;  2YLX A;  1LVL A;  1FFV C;  3MUC A;  2AKZ A;  1IYX A;  2JAE A;  1GV4 A;  1F9C A;  1ZDL A;  2IID A;  1TDO A;  4B66 A;  3EF6 A;  3AYL A;  2NQL A;  1KFY A;  1N5X A;  4JDR A;  3PWI A;  4BJY A;  2JB1 A;  3GRT A;  4H4Q A;  4U8K A;  5EB5 A;  4C74 A;  1KCZ A;  3E1T A;  2PU0 A;  2AAQ A;  1MDR A;  3BJS A;  3ATR A;  2OFJ A;  2P8C A;  1GRE A;  2VOU A;  1RP0 A;  1X2G A;  4RSL A;  3SZF A;  2GGH A;  4DGK A;  4JHM A;  5J7X A;  3CXB A;  3UJS A;  2AKM A;  1TRB A;  4CCQ A;  4A6N A;  2VRM A;  4GYP A;  3FYY A;  2GEW A;  3P9U A;  3SZC A;  3CNJ A;  1JCT A;  1PS9 A;  1FOH A;  5BRT A;  3ICT A;  2Z5Y A;  3SBF A;  3AD9 B;  2CDU A;  1PDZ A;  1KDG A;  3HPF A;  1JRP A;  2BYB A;  1JPD X;  2VVM A;  4OPT A;  2TMD A;  3H7V A;  2HXU A;  1MNS A;  3P4P A;  2C65 A;  3AD8 B;  3NFU A;  1FIQ B;  3NO1 A;  1ZOY A;  1P2H A;  1GND A;  3MY9 A;  4HNL A;  4NEW A;  3LAD A;  4AOS A;  3RIT A;  1N61 C;  3CAW A;  1M6I A;  2AR8 A;  2PP0 A;  5L46 A;  3I4K A;  4G74 A;  4UP3 A;  2I0Z A;  1IUW A;  2WPC A;  2OZT A;  2B9Y A;  4O5Q A;  4HN8 A;  3N6H A;  3QFA A;  2HNE A;  4TVY A;  3MKC A;  4ADW A;  4USR A;  1MUC A;  4J57 A;  1D7Y A;  2C76 A;  2X50 A;  5LV9 A;  1PXC A;  2Q6U A;  4YTN A;  3SSZ A;  2H89 A;  2WDQ A;  3O0H A;  2AL1 A;  2YR6 A;  4H4Y A;  3Q45 A;  4K7Z A;  3B3R A;  3VRD B;  1T3Q C;  1E1M A;  3K7M X;  2XDO A;  3NYE A;  1NU5 A;  4HCL A;  4B63 A;  3CGE A;  4G73 A;  2VVL A;  4NTD A;  3V5C A;  2XLT A;  4CY8 A;  1E1N A;  2XVH A;  3FPZ A;  4GR1 A;  4H1Z A;  3SM8 A;  3T31 A;  3CXO A;  2C73 A;  3V3O A;  3C96 A;  1ZMC A;  4OPC A;  2PGE A;  3R0U A;  4UDP A;  2R0P A;  4KT2 A;  3N4F A;  3FJ4 A;  1N4V A;  2GDQ A;  1CC6 A;  5JCN A;  4CY6 A;  1XDI A;  3LOV A;  3TWA A;  3GRS A;  4A7A A;  3P93 A;  1ZXI C;  4NNJ A;  4OPD A;  2HZG A;  5BOF A;  4EQS A;  2BCP A;  3QSM A;  3ZYX A;  3AE4 A;  1V59 A;  2V3B A;  1BGJ A;  1D7L A;  3DFY A;  3L1R A;  2GGE A;  3NK0 X;  3FCP A;  3KD9 A;  1REO A;  3T2K A;  3R10 A;  2XLR A;  4K8D A;  1COY A;  2A8X A;  3IK4 A;  3G5S A;  3G5R A;  2ARD A;  3KA7 A;  3S5W A;  3AN1 A;  3K1G A;  2B9X A;  4U8J A;  2C3D A;  3VRA A;  2OAL A;  2E4G A;  4GDE A;  3AEC A;  1JRY A;  3P4R A;  4OPL A;  2C66 A;  3M13 A;  5C3J A;  2XVI A;  3UOY A;  4RG4 A;  3COX A;  2JK6 A;  2JKC A;  3TOY A;  1Q1R A;  4TLZ A;  4H4V A;  3T2Y A;  1JNR A;  4GIR A;  3AEE A;  5HY5 A;  3GDP A;  2GAH B;  3AE5 A;  3LZX A;  1H84 A;  4Z24 A;  4NTC A;  4B64 A;  2Z5X A;  2GGI A;  4F4R A;  3VCC A;  1OJA A;  5GRT A;  1VRQ B;  2XH4 A;  1DNC A;  3Q6J A;  2X3N A;  2BXR A;  1X2H A;  4IV9 A;  3PFR A;  2BRY A;  4ECH A;  1E39 A;  1H7W A;  4HCD A;  4GME A;  3QSS A;  2PGW A;  1SJA A;  3GY1 A;  4Z1Y A;  1GER A;  1YKJ A;  5ER0 A;  2YLR A;  2FJE A;  3F8D A;  3AYI A;  5KVI A;  2OQH A;  4BK2 A;  1N4W A;  3S61 A;  1OJD A;  3DME A;  2XLS A;  1MDL A;  3GD4 A;  3AB1 A;  2E1M A;  2JB2 A;  3HYV A;  4ZA0 A;  1RVK A;  2R45 A;  2XYO A;  4II2 A;  2AL2 A;  1B37 A;  4JNA A;  2JBV A;  5FS8 A;  3B97 A;  1LQU A;  2OLN A;  3ZDN A;  3AE8 A;  2F5Z A;  4E0V A;  3F8R A;  2Y6Q A;  3KPK A;  4P9S A;  3QFB A;  5KVH A;  5HXI A;  3STP A;  5IPY A;  2HQM A;  2WHD A;  4ICY A;  4G8T A;  2XVE A;  1MXT A;  3QKE A;  2YVJ A;  3ZLF A;  1TKK A;  2PYX A;  1KSS A;  2YWL A;  3UJF A;  2C7G A;  3R25 A;  1KKO A;  1RYI A;  1Q1W A;  4NWZ A;  1F8S A;  1TDE A;  4C5O A;  1GRH A;  4U8O A;  2YR5 A;  2Y6R A;  4GCM A;  5GSN A;  3AD7 B;  4Z2U A;  1TYT A;  3QVP A;  2YAU A;  3CB3 A;  1ZMD A;  3TJ4 A;  4HPN A;  1D5T A;  3SZ0 A;  2OPJ A;  3T9P A;  1W6T A;  2WDV A;  4H4X A;  3VCN A;  2Q7V A;  4D04 A;  1KKR A;  2WPF A;  1F8R A;  1GAL A;  4GGB A;  2BK4 A;  2GMH A;  2XH0 A;  5U1O A;  3BHK A;  1PDY A;  2XGZ A;  3VR9 A;  4M0X A;  1IUX A;  1JNZ A;  4EIP A;  3PG6 A;  3UOV A;  4E6M A;  1ZK7 A;  4FI4 A;  1NHQ A;  3CNP A;  4E5T A;  2WET A;  3QLD A;  3IJL A;  3ADA B;  4DSH A;  4H2Q A;  4X9N A;  4Y4N A;  4X2P A;  3DG6 A;  1YQ3 A;  4FX9 A;  2V6O A;  1FEA A;  3T6C A;  4AP3 A;  2WBA A;  1XS2 A;  3KKJ A;  3RGT A;  3FXG A;  3P3B A;  3F8P A;  3CN8 A;  3A7A A;  2ZBW A;  5TR3 A;  3TWB A;  3NHO X;  1TDN A;  3NKS A;  2WP6 A;  3IC9 A;  4LA1 A;  1BQG A;  4A35 A;  4EQX A;  2DKI A;  1CJ3 A;  2WU5 A;  4AP1 A;  3H70 A;  4K2X A;  1EC9 A;  4JN7 A;  4YSY A;  3SN4 A;  3PS9 A;  3NK1 X;  2PPG A;  3EUB 3;  4APN A;  3MZN A;  1F3P A;  1L8P A;  4YSX A;  3OZY A;  4EMW A;  4J2W A;  1SJB A;  4U2T A;  3PWG A;  3NVZ B;  2W3S A;  3GWD A;  4MKS A;  2C75 A;  3UKH A;  1STZ A;  5CQF A;  1XHC A;  1NPX A;  4YTP A;  1E9I A;  3BOX A;  3R11 A;  3VQR A;  1CF3 A;  2PTY A;  5FS9 A;  2TPR A;  1Y56 A;  3NTD A;  4IZG A;  2VQ7 A;  4H2P A;  1VDV A;  3R0K A;  3ITJ A;  3AE9 A;  1O5W A;  1UKV G;  2C72 A;  3SZW A;  2ACZ A;  1L9D A;  3K30 A;  3U9I A;  3NNE A;  3M12 A;  2OG9 A;  3DJD A;  4GF7 A;  1IUV A;  4I59 A;  4BUR A;  5U25 A;  2WDR A;  1DOB A;  1NHP A;  5U63 A;  3FMW A;  3CPH G;  4YWS A;  1H6V A;  2W54 A;  2I5Q A;  3HZL A;  4Z43 A;  3D9X A;  4IT1 A;  1OEP A;  1E1L A;  2RGO A;  1ELI A;  3ZVH B;  3NVW B;  4U8L A;  4ZCD A;  4KPL A;  1SJC A;  3T8Q A;  4FK1 C;  1B8S A;  3NIX A;  2VQB A;  1S7M A;  4YKF A;  1IUT A;  4OPI A;  2XVF A;  3HRD C;  4Z2R A;  1N60 C;  2DKH A;  4GIS A;  2GAG B;  5FJO A;  2B7R A;  2BS2 A;  2QCU A;  4JN9 A;  2NVK X;  3FBS A;  3NT6 A;  4J31 A;  3OPS A;  4J1O A;  2GR1 A;  3DG7 A;  3I6D A;  5M10 A;  5IQ4 A;  2R9Z A;  1PBB A;  3PVC A;  4B65 A;  2CFY A;  3NTA A;  2A87 A;  4HYR A;  1FCD A;  4J36 A;  1LQT A;  1PJ7 A;  3IHM A;  4YXD A;  4USQ A;  2GGG A;  1CC4 A;  2GMJ A;  5KOW A;  2OVL A;  5FS6 A;  5FJR A;  3GDN A;  3GD3 A;  4AT2 A;  1PJ5 A;  4EQW A;  2R46 A;  3UXK A;  4A3R A;  4UDQ A;  1FO4 A;  2XFO A;  3P4S A;  5JCK A;  3UGV A;  4YSZ A;  3VC6 A;  3SQS A;  4FP1 A;  2O9Z A;  3IWA A;  4H4P A;  2YLT A;  4TM3 A;  2GGJ A;  3VC5 A;  2OLO A;  3M0O A;  2V60 A;  3GSI A;  3AE3 A;  2YM2 A;  3ALM A;  1K0J A;  3G5Q A;  4KEM A;  2RDX A;  3UKQ A;  1JRX A;  3H4K A;  2BK3 A;  5BUK A;  4HB9 A;  1N1P A;  3UCD A;  1ZOV A;  4A9W A;  1VG0 A;  3DIP A;  1DJN A;  4GUV A;  2BS4 A;  1EC8 A;  3AYJ A;  1ZX9 A;  2R0C A;  3N4E A;  3VR8 A;  4HCH A;  4PAA A;  4CNJ A;  4DN1 A;  3BI5 A;  4M52 A;  5G5G B;  4Z17 A;  1DOE A;  1NG4 A;  1ECQ A;  4TLX A;  3SFD A;  2FJB A;  2VZ2 A;  2FYM A;  3D8X A;  3Q9T A;  5FS7 A;  5M0Z A;  5G5H B;  2PP3 A;  3K7T A;  1Y0P A;  3WE0 A;  3URH A;  3RP6 A;  3VDG A;  1PBD A;  1EC7 A;  3VRB A;  4DYE A;  2YVG A;  4GDP A;  1N62 C;  4J34 A;  3SN0 A;  2QQ6 A;  3SX6 A;  3GYX A;  5BOE A;  1OJ9 A;  3GMC A;  3V3N A;  3H8A A;  2V61 A;  3UTH A;  2B9W A;  3PK7 A;  3NN6 X;  1V97 A;  3UTF A;  3GWF A;  4OPU A;  2H88 A;  2R4E A;  2OZ3 A;  5KMR A;  4G6H A;  1YEY A;  1K0I A;  2YG4 A;  2OX4 A;  1IUU A;  1H83 A;  5JCM A;  3CT2 A;  1WUE A;  2POD A;  2B7S A;  3DJJ A;  4MGG A;  3NN0 X;  1P48 A;  4GAV A;  3UP4 A;  2EQ8 A;  4J3Z A;  3LJP A;  3I3L A;  1PXA A;  3KPF A;  1JOA A;  3CYJ A;  2WP5 A;  4I58 A;  3DA1 A;  2GF3 A;  4GFI A;  4EQR A;  2A89 A;  1P2E A;  4C77 A;  2V5Z A;  4EMI A;  2PSN A;  4H4U A;  2RGH A;  2YG6 A;  3AXB A;  1NAA A;  3AMZ A;  3CPI G;  3H8L A;  4U8N A;  1QO8 A;  2C3C A;  3D46 A;  5FMH A;  4ROP A;  1GXF A;  1O95 A;  1LJ1 A;  2QAE A;  1KD0 A;  1F8W A;  2YLZ A;  5J04 A;  2R4J A;  2OZ8 A;  1VG9 A;  1EL8 A;  3ICR A;  4DWD A;  3THU A;  2DW6 A;  4TM1 A;  1PDH A;  2ZAD A;  3QPE A;  1VQW A;  4AT0 A;  3NS1 B;  4GGH A;  2RGJ A;  3RNM A;  4G6G A;  4CCR A;  4TVW A;  1XPY A;  5FJU A;  4K1W A;  2WOI A;  3DGZ A;  4CRT A;  3BHF A;  1PN0 A;  4EM3 A;  2W3R A;  3HW2 A;  1LTX R;  3H12 A;  3ETR B;  3HYX A;  3OC4 A;  4IA6 A;  1BF3 A;  3DJE A;  1K4Q A;  2R0G A;  1OJC A;  1GRT A;  3PO7 A;  1SJD A;  1ONE A;  1GRA A;  4YWO A;  1EBG A;  5C2T A;  4A6G A;  2AQJ A;  2GQW A;  3CGC A;  1S2Q A;  2W55 A;  6ENL A;  3OW1 A;  4GYP C;  4IP4 A;  4C3Y A;  4DSG A;  3DK8 A;  3LXD A;  4H83 A;  1PXB A;  4C3X A;  3UCC A;  5IDZ A;  4K5S A;  3D47 A;  3RRA A;  3EPT A;  2XFU A;  4HA6 A;  3UKP A;  3DK9 A;  4IA5 A;  5EOW A;  4REK A;  2PTW A;  3RCY A;  3UCL A;  1EL9 A;  1JDF A;  4NTE A;  2JB3 A;  4E4U A;  2GR2 A;  2EQ7 A;  1JPM A;  1P43 A;  1CJ4 A;  3SXI A;  1EBH A;  3A7U A;  2FBW A;  2PTZ A;  1PBE A;  1XPQ A;  3AEB A;  3S5S A;  2C70 A;  3IJQ A;  3UJE A;  3CTY A;  1XAN A;  3FG2 P;  3N6J A;  3NVY B;  3ZLG A;  3CNS A;  3BSM A;  2BC1 A;  3BNM A;  3A7R A;  4KX6 A;  1BKW A;  4GRT A;  1B5Q A;  1TDK A;  2YR4 A;  1PBF A;  4JY2 A;  3AE6 A;  3L8K A;  4EIQ A;  4ZOH B;  1M64 A;  2EQ6 A;  2MNR A;  1JRO A;  1D4D A;  3RED A;  3DFH A;  1GES A;  2ZZB A;  1NEN A;  3V5F A;  1DTN A;  2BA9 A;  3ZVI A;  3FIM B;  3BI2 A;  2ONE A;  4H4R A;  1H2I A;  1DOC A;  5EBK A;  4E8G A;  2GB0 A;  2GH5 A;  1PHH A;  4OPG A;  1NHR A;  4EM4 A;  1SEZ A;  3NK2 X;  1JU2 A;  4FDC B;  4PAB A;  1H86 A;  1ZY8 A;  1KF6 A;  1GPE A;  3R1Z A;  1EL5 A;  3CIR A;  3NRN A;  5BUL A;  2P8B A;  3NYF A;  2PTX A;  5ENL A;  3SN1 A;  1CC2 A;  4N9X A;  3TQP A;  2X99 A;  1NDA A;  1QLB A;  4H4T A;  4KWS A;  3EKG A;  1CJC A;  3NVV B;  4A6N B;  4Z2T A;  3Q4D A;  3EEZ A;  2QGY A;  4JNQ A;  4E4F A;  3UJ2 A;  3TJI A;  4DHG A;  4U2S A;  2YG3 A;  4K22 A;  5KMQ A;  2WQY A;  2XFQ A;  3D1C A;  4H50 A;  3LZW A;  3P4Q A;  1L9E A;  4G9K A;  2O56 A;  4KPR A;  5DBJ A;  3CK5 A;  3QN3 A;  3AEG A;  4OCG A;  4CBQ A;  5EU9 A;  2YG7 A;  2W0H A;  3ABV A;  3V76 A;  1WYG A;  3DDM A;  3UOZ A;  2PMQ A;  2OAM A;  1B4V A;  3SGL A;  1MO9 A;  1TE6 A;  1E7P A;  1BZL A;  1JRZ A;  2BXS A;  2P88 A;  3ENL A;  4TM0 A;  3T14 A;  3IF9 A;  4YKG A;  2C4C A;  3DEQ A;  2GVC A;  2PCE A;  3C4N A;  2BS3 A;  1CHU A;  3IHG A;  2APG A;  1GTE A;  1HYU A;  3QTP A;  1YQZ A;  3UOX A;  4J33 A;  1YY5 A;  4YSH A;  3ICS A;  4DNA A;  3RP7 A;  3CGB A;  3DJG X;  4U8P A;  3UKF A;  2GQF A;  2QVH A;  1AOG A;  1BKH A;  3P1W A;  4K2S A;  3UTE A;  2BCG G;  4IVO B;  1GOS A;  3CNT A;  3ZVH A;  1KN0 A;  3UKL A;  1FEC A;  2P0I A;  1MRA A;  2CVJ A;  4H2R A;  5JCI A;  2X8H A;  1RSG A;  4CNK A;  3DGH A;  4LII A;  3DES A;  4YT0 A;  4M6U A;  1EL7 A;  4IHC A;  4A5L A;  5FJT A;  4IL0 A;  5KXJ A;  2HXT A;  3NZG A;  1S3E A;  3TCS A;  2BAB A; 
#chains in the Genus database with same CATH homology
 1JOA A;  1KSS A;  3GRT A;  2YWL A;  4H4Q A;  2WP5 A;  4I58 A;  4U8K A;  5EB5 A;  4C74 A;  3DA1 A;  2C7G A;  2GF3 A;  3E1T A;  4EQR A;  2AAQ A;  2X8C A;  3AEF A;  1RYI A;  1Q1W A;  1N4U A;  4NWZ A;  2A89 A;  4K5R A;  1F8S A;  1TDE A;  4C5O A;  1GRH A;  1DJQ A;  1P2E A;  2YR5 A;  4U8O A;  2Y6R A;  4C77 A;  1GSN A;  1OJT A;  2V5Z A;  1X31 B;  2BAC A;  4GCM A;  4EMI A;  3ATR A;  5GSN A;  3AD7 B;  4Z2U A;  1TYT A;  2ZZ0 A;  2XLU A;  4Z44 A;  4H4U A;  2RGH A;  2YG6 A;  3AXB A;  1NAA A;  3JSK A;  3QVP A;  2YAU A;  3SQP A;  3CPI G;  1KSU A;  3H8L A;  4U8N A;  1QO8 A;  1ZMD A;  4A65 A;  2C3C A;  1D5T A;  3SZ0 A;  3R9U A;  1GRE A;  2VOU A;  5FMH A;  1RP0 A;  2GRT A;  3K7Q X;  2WDV A;  4H4X A;  2Q7V A;  3T2Z A;  1GXF A;  4ZN0 A;  2WU2 A;  1O95 A;  4D04 A;  2WPF A;  1F8R A;  4RSL A;  3SZF A;  1GAL A;  1GRG A;  2BK4 A;  1D4E A;  2GMH A;  5U1O A;  1LJ1 A;  3BHK A;  4DGK A;  3VR9 A;  2QAE A;  1IUX A;  2VVL G;  4BV6 A;  4YTM A;  1JNZ A;  3CMM A;  3PG6 A;  4TM4 A;  5J7X A;  4A99 A;  3UOV A;  4EIP A;  1F8W A;  1CJ2 A;  2YLZ A;  1ZK7 A;  1NHQ A;  2R4J A;  1TRB A;  1VG9 A;  1EL8 A;  1YQ4 A;  3CNP A;  2WPE A;  2WET A;  3ICR A;  4CCQ A;  3ADA B;  4A6N A;  1NEK A;  2VRM A;  5KNL A;  1GTH A;  3ISH A;  2GEW A;  4TM1 A;  1PDH A;  4DSH A;  4H2Q A;  1VQW A;  3GYJ A;  4X9N A;  3P9U A;  4Y4N A;  4AT0 A;  3SZC A;  3CNJ A;  4XXG A;  1YQ3 A;  1PS9 A;  4FX9 A;  2RGJ A;  1FOH A;  2BRA A;  3RNM A;  3ICT A;  1L0V A;  4G6G A;  2Z5Y A;  4MJW A;  5BRT A;  3AD9 B;  2V6O A;  4CCR A;  4NEV A;  1FEA A;  3ATQ A;  5CKU A;  4AP3 A;  2IVD A;  2CDU A;  2WOI A;  3DGZ A;  1NHS A;  1KDG A;  4CRT A;  2WBA A;  1H7X A;  5KMP A;  3BHF A;  3KKJ A;  4IVM B;  1PN0 A;  3KVE A;  4EM3 A;  2BYB A;  2VVM A;  2WES A;  4OPT A;  2TMD A;  1LTX R;  3F8P A;  4B69 A;  3CN8 A;  2ZBW A;  3HYX A;  3II4 A;  5TR3 A;  3NHO X;  3P4P A;  2C64 A;  3OC4 A;  4U2L A;  1TDN A;  3NKS A;  3UKA A;  3KPF A;  4IA6 A;  2WP6 A;  3IC9 A;  2C65 A;  3AD8 B;  4B1B A;  1JEH A;  4LA1 A;  1E6E A;  1K0L A;  1BF3 A;  1ZOY A;  3DJE A;  1P2H A;  1K4Q A;  4EQX A;  1GND A;  2DKI A;  1CJ3 A;  2WU5 A;  4NEW A;  4AP1 A;  3CGD A;  2BAB A;  3LAD A;  3L5O A;  4H4Z A;  1OJC A;  2R0G A;  4AOS A;  4K2X A;  1GRT A;  3PO7 A;  1GRF A;  4Y4L A;  1Z6L A;  4YSY A;  3PS9 A;  1H82 A;  1M6I A;  2YVF A;  1BGN A;  3NK1 X;  4Y4M A;  4APN A;  2AR8 A;  1F3P A;  5KOX A;  5L46 A;  3ALL A;  4BK3 A;  4YSX A;  4G74 A;  1GRA A;  4YWO A;  2NPX A;  5C2T A;  4EMW A;  1DOD A;  1PJ6 A;  5JRB A;  4UP3 A;  2I0Z A;  1IUW A;  2AQJ A;  2WPC A;  2GQW A;  3CGC A;  4J2W A;  1QJD A;  1Q9I A;  2QA2 A;  1S2Q A;  2B9Y A;  4O5Q A;  4U2T A;  2WS3 A;  1S2Y A;  3QFA A;  3AEA A;  2XCG A;  3GWD A;  2C75 A;  4A79 A;  4ADW A;  2ZZC A;  4USR A;  4J57 A;  1D7Y A;  2C76 A;  4FK1 A;  4C3Y A;  4DSG A;  3DK8 A;  3UKH A;  3LXD A;  1PXB A;  4D03 A;  2X50 A;  5CQF A;  1XHC A;  1NPX A;  4C3X A;  5LV9 A;  4YTP A;  1EBD A;  1PXC A;  1MOK A;  1ZP0 A;  2Q6U A;  3VQR A;  4YTN A;  1CF3 A;  2B76 A;  1F6M A;  2H89 A;  2WDQ A;  3RHA A;  3O0H A;  5FS9 A;  4K5S A;  4AOX A;  2TPR A;  2YR6 A;  1Y56 A;  3EPT A;  3NTD A;  2VQ7 A;  2XFU A;  4HA6 A;  4H2P A;  4H4Y A;  3UKP A;  3ITJ A;  3DK9 A;  4K7Z A;  4IA5 A;  3B3R A;  5EOW A;  4REK A;  3AE9 A;  5JCL A;  1O5W A;  3UCL A;  3VRD B;  1EL9 A;  1UKV G;  2C72 A;  4NTE A;  2JB3 A;  3SZW A;  2ACZ A;  1TDF A;  2GR2 A;  2EQ7 A;  4Z25 A;  1L9D A;  4WCT A;  1E1M A;  3K30 A;  4B68 A;  3K7M X;  2XDO A;  3NNE A;  3NYE A;  2RAB A;  3T37 A;  1CJ4 A;  3SXI A;  2FBW A;  3M12 A;  3AE1 A;  3DJD A;  4U8I A;  4B63 A;  4B67 A;  3CGE A;  1PBE A;  4G73 A;  4GF7 A;  1XPQ A;  3AEB A;  2VVL A;  2C70 A;  1IUV A;  2XLT A;  4NTD A;  4I59 A;  4CY8 A;  4BUR A;  5U25 A;  2WDR A;  1DOB A;  3CTY A;  1E1N A;  2XVJ A;  1NHP A;  3ALJ A;  5U63 A;  2XVH A;  3FMW A;  3CPH G;  4H7U A;  1XAN A;  2EQ9 A;  1H6V A;  3FG2 P;  4GR1 A;  3FPZ A;  5J60 A;  3SM8 A;  3CNS A;  3T31 A;  2C73 A;  3HZL A;  2BC1 A;  3V3O A;  3BI4 A;  3BNM A;  3DK4 A;  1PXA A;  4Z43 A;  1PBC A;  3D9X A;  5KMS A;  3C96 A;  4KX6 A;  1ZMC A;  4OPC A;  1BKW A;  1DXL A;  1E1L A;  4GRT A;  1B5Q A;  3AWI A;  2RGO A;  1ELI A;  3KU9 A;  4UDP A;  2R0P A;  4U8L A;  1ONF A;  1TDK A;  3CND A;  5HHF A;  4ZCD A;  2YR4 A;  1PBF A;  4JY2 A;  3AE6 A;  3UTG A;  3L8K A;  1N4V A;  1L9C A;  3OZ2 A;  4EIQ A;  4FK1 C;  1CC6 A;  5JCN A;  1B8S A;  2J3N A;  3NIX A;  3QVR A;  5KWF A;  4CY6 A;  1XDI A;  3KLJ A;  2VQB A;  1S7M A;  1M64 A;  2EQ6 A;  3NGC X;  4YKF A;  3LOV A;  1D4D A;  1FEB A;  1IUT A;  4OPI A;  3RED A;  2XVF A;  1GES A;  3GRS A;  2ZZB A;  4UDR A;  1FL2 A;  4A7A A;  4Z2R A;  1NEN A;  1GET A;  2DKH A;  2BA9 A;  2WOV A;  2GAG B;  1CBO A;  2BC0 A;  2B7R A;  2E5V A;  1TYP A;  2BS2 A;  2QCU A;  3FIM B;  2NVK X;  3FBS A;  3BI2 A;  4JN9 A;  4NNJ A;  4OPD A;  4H4R A;  4EQS A;  3NT6 A;  2XFN A;  4J31 A;  2BCP A;  2FJA A;  3QSM A;  3ZYX A;  1H2I A;  3UP5 A;  3AE4 A;  1V59 A;  2V3B A;  1BGJ A;  1DOC A;  2GR1 A;  5EBK A;  4JQ9 A;  1D7L A;  1O94 A;  3I6D A;  2GB0 A;  2GH5 A;  5M10 A;  1PHH A;  2R9Z A;  1PBB A;  5IQ4 A;  1D4C A;  3PVC A;  1NHR A;  4EM4 A;  3L1R A;  4OPG A;  4B65 A;  1SEZ A;  4GAP A;  4BJZ A;  3LB8 A;  2CFY A;  2XLP A;  3NK0 X;  3NTA A;  1GEU A;  2UZZ A;  2A87 A;  3NK2 X;  1FCD A;  1JU2 A;  4J36 A;  1LQT A;  4FDC B;  3AE7 A;  3KD9 A;  1REO A;  4PAB A;  1H86 A;  1PJ7 A;  2FJD A;  3IHM A;  1ZY8 A;  1KF6 A;  3T2K A;  1GPE A;  2XLR A;  4K8D A;  1COY A;  4YXD A;  2A8X A;  1EL5 A;  3CIR A;  3NRN A;  3QJ4 A;  3HYW A;  4USQ A;  3C4A A;  5BUL A;  1H81 A;  1CC4 A;  3G5S A;  3G5R A;  3NYF A;  2OA1 A;  3B6D A;  2GMJ A;  5KOW A;  2ARD A;  3KA7 A;  5FS6 A;  1CC2 A;  4N9X A;  3S5W A;  2X8G A;  4X9M A;  2X99 A;  4XWR A;  3GDN A;  2Q0K A;  1NDA A;  3GD3 A;  1QLB A;  4AT2 A;  2B9X A;  4XWZ A;  4U8J A;  2C3D A;  4H4T A;  1CJC A;  1PJ5 A;  3VRA A;  2OAL A;  1W4X A;  4EQW A;  2E4G A;  2R46 A;  4A6N B;  4Z2T A;  3AED A;  4GDE A;  4UDQ A;  3P4S A;  2XFO A;  2C67 A;  5BVA A;  3AEC A;  5JCK A;  4YSZ A;  4JNQ A;  2O9Z A;  1JRY A;  3P4R A;  1GT8 A;  3IWA A;  4H4P A;  4OPL A;  2C66 A;  3M13 A;  5EB4 A;  3UKK A;  5C3J A;  2XVI A;  4U2S A;  2YLT A;  2PHH A;  3UOY A;  2IVE A;  2YG3 A;  1NG3 A;  4K22 A;  4RG4 A;  4TM3 A;  5KMQ A;  3COX A;  2WQY A;  2JK6 A;  2XFQ A;  2OLO A;  3CPJ G;  2GV8 A;  2YM1 A;  3M0O A;  1E1K A;  2JKC A;  3D1C A;  2Q0L A;  4H50 A;  3LZW A;  5HYM A;  2V60 A;  3GSI A;  3P4Q A;  1Q1R A;  1L9E A;  3AE3 A;  4G9K A;  4RG3 A;  1IJH A;  4TLZ A;  5KRQ A;  4H4V A;  2YM2 A;  3ALM A;  3T2Y A;  1JNR A;  2XFP A;  2YQU A;  4H4S A;  4KPR A;  1K0J A;  3AEE A;  3G5Q A;  1BWC A;  5DBJ A;  5HY5 A;  2YG5 A;  3AEG A;  3GDP A;  3UKQ A;  4BK1 A;  1JRX A;  2GAH B;  3AE2 A;  3H4K A;  3SFE A;  2BK3 A;  5BUK A;  3AE5 A;  4OCG A;  3LZX A;  1H84 A;  1ZKQ A;  4HB9 A;  4Z24 A;  4NTC A;  4NZH A;  1N1P A;  4CBQ A;  4B64 A;  1ZOV A;  4A9W A;  1VG0 A;  2Z5X A;  2CUL A;  1DJN A;  4GUV A;  2YG7 A;  2BS4 A;  2W0H A;  1KNR A;  1OJA A;  3AYJ A;  3ABV A;  4BJY A;  1ZX9 A;  5GRT A;  2R0C A;  3V76 A;  3EAN A;  1VRQ B;  3NG7 X;  3VR8 A;  1DNC A;  3UOZ A;  3Q6J A;  3H8I A;  4PAA A;  4CNJ A;  2X3N A;  2BXR A;  3BI5 A;  2OAM A;  1B4V A;  4M52 A;  1MO9 A;  3SGL A;  1CL0 A;  4II3 A;  4ZCC A;  1DOE A;  2YLS A;  4IV9 A;  1NG4 A;  1JRZ A;  1BZL A;  1IUS A;  1E7P A;  4TLX A;  2BRY A;  4ECH A;  1E39 A;  1H7W A;  2BXS A;  3SFD A;  4JY3 A;  3QSS A;  3BNU A;  4Z26 A;  4TM0 A;  1GER A;  3DH9 A;  3T14 A;  4J56 A;  1YKJ A;  2FJB A;  3NLC A;  3SYI A;  5ER0 A;  2VZ2 A;  3IF9 A;  4YKG A;  4EMJ A;  2BK5 A;  2C4C A;  1VDC A;  2GVC A;  3D8X A;  3T0K A;  2YLR A;  3C4N A;  2BS3 A;  4X4J A;  1CHU A;  3IHG A;  2APG A;  1GTE A;  5FS7 A;  1HYU A;  2FJE A;  3Q9T A;  2WP9 A;  5M0Z A;  3GMB A;  1YQZ A;  3F8D A;  4H4W A;  3AYI A;  3K7T A;  5KVI A;  3UOX A;  1Y0P A;  4J33 A;  1YY5 A;  4O5U A;  3WE0 A;  3URH A;  3ICS A;  4YSH A;  3RP6 A;  4BK2 A;  1PBD A;  4DNA A;  2VRL A;  2WEU A;  3RP7 A;  3CGB A;  3VRB A;  3DJG X;  4U8P A;  2YVG A;  4GDP A;  1N4W A;  1GRB A;  3NYC A;  4OVI A;  2WOW A;  3S61 A;  2GR0 A;  3UKF A;  1OJD A;  1Y56 B;  3EAO A;  2XLS A;  3DME A;  3GD4 A;  3RP8 A;  2GQF A;  4J34 A;  3GYI A;  3AB1 A;  1LPF A;  1AOG A;  2E1M A;  2JB2 A;  3GYX A;  3HYV A;  3SX6 A;  1OJ9 A;  3GMC A;  3V3N A;  3SY4 A;  2V61 A;  2R45 A;  2XYO A;  4H2N A;  2YLW A;  3P1W A;  4II2 A;  3UTH A;  2B9W A;  4JNA A;  1B37 A;  3NN6 X;  3UTE A;  1KNP A;  2JBV A;  2PYX A;  5FS8 A;  1S3B A;  4WX1 A;  2BCG G;  4IVO B;  3UTF A;  1LQU A;  2OLN A;  1GOS A;  3GWF A;  2V3A A;  3CNT A;  5IQ1 A;  4OPU A;  3QSE A;  1KN0 A;  3UKL A;  3ZDN A;  3AE8 A;  1LV0 A;  2H88 A;  2QA1 A;  2R4E A;  5KMR A;  1FEC A;  4G6H A;  3NH3 X;  2F5Z A;  4E0V A;  3F8R A;  2CVJ A;  1K0I A;  2YG4 A;  4H2R A;  5JCI A;  2X8H A;  1RSG A;  4LU6 A;  1IUU A;  1H83 A;  2GR3 A;  2Y6Q A;  2YLX A;  1LVL A;  5JCM A;  4U8M A;  3KPK A;  4P9S A;  3DGH A;  4CNK A;  4LII A;  2B7S A;  3QFB A;  5KVH A;  5HXI A;  3DJJ A;  4YT0 A;  5IPY A;  3NN0 X;  2JAE A;  1GV4 A;  2HQM A;  1EL7 A;  2WHD A;  2XVE A;  1ZDL A;  2IID A;  4ICY A;  1TDO A;  4B66 A;  3EF6 A;  4GAV A;  3UP4 A;  4A5L A;  2EQ8 A;  3AYL A;  5KXJ A;  3LJP A;  3I3L A;  1S3E A;  2YVJ A;  1KFY A;  4JDR A;  1MXT A;  2JB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...