2V3BA

Crystal structure of the electron transfer complex rubredoxin - rubredoxin reductase from pseudomonas aeruginosa.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
381
structure length
381
Chain Sequence
RAPLVIIGTGLAGYNLAREWRKLDGETPLLMITADDGRSYSKPMLSTGFSKNKDADGLAMAEPGAMAEQLNARILTHTRVTGIDPGHQRIWIGEEEVRYRDLVLAWGAEPIRVPVEGDAQDALYPINDLEDYARFRQAAAGKRRVLLLGAGLIGCEFANDLSSGGYQLDVVAPCEQVMPGLLHPAAAKAVQAGLEGLGVRFHLGPVLASLKKAGEGLEAHLSDGEVIPCDLVVSAVGLRPRTELAFAAGLAVNRGIVVDRSLRTSHANIYALGDCAEVDGLNLLYVMPLMACARALAQTLAGNPSQVAYGPMPVTVKTPACPLVVSPPPRGMDGQWLVEGSGTDLKVLCRDTAGRVIGYALTGAAVNEKLALNKELPGLMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Electron Transfer Complex Rubredoxin - Rubredoxin Reductase from Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords RUBREDOXIN REDUCTASE
total genus 116
structure length 381
sequence length 381
ec nomenclature ec 1.18.1.1: Rubredoxin--NAD(+) reductase.
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF18113 Rbx_binding Rubredoxin binding C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.120 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2v3bA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2v3bA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2v3bA02
4HA6A 2GAHB 1GV4A 4YSZA 4KX6A 2WBAA 4GR1A 1ZOYA 5HXIA 1FOHA 2YAUA 3AE6A 2QA1A 3Q9TA 1DJNA 3IWAA 4GDPA 2BS2A 4U8IA 1TDEA 3NT6A 3CNJA 5JCMA 1GRHA 2R4EA 3NIXA 1KSUA 4CY8A 2TPRA 4YTMA 3QVRA 2BACA 3NK1X 1Z6LA 2XFUA 1FEBA 2AQJA 3DH9A 4NTEA 3KVEA 4FK1A 3FG2P 4K5SA 4CNKA 2R0CA 3AYIA 1L9EA 2XFNA 3AE7A 3CGBA 3KKJA 3UKFA 3EF6A 5IPYA 2GRTA 1Q9IA 4H4WA 4ZCCA 4H4PA 2BK4A 4Z43A 1NHRA 1VRQB 3GWFA 2PYXA 3S61A 4H50A 4Y4MA 4BJYA 3COXA 4AT0A 3CPJG 5ER0A 4OPGA 1GRGA 1B37A 4ZCDA 3NYEA 1GSNA 1M6IA 5IQ1A 4JY3A 1F3PA 4A6NB 1KFYA 1MOKA 2EQ6A 1GTHA 3V3OA 2QA2A 1TDOA 1BGNA 5DBJA 2RGOA 3SFDA 3SFEA 1PJ7A 3UKHA 4A99A 3UKLA 4X9NA 3ISHA 5FS8A 3RP7A 2XDOA 4Z2TA 3AYLA 1NHSA 2VVLG 2Z5YA 1E7PA 3NHOX 3NK0X 3REDA 2Y6QA 3M13A 4B67A 2WDVA 2ZZCA 3DA1A 3P4SA 4TM1A 4H2QA 3K7QX 2VQBA 3ALJA 2WS3A 1CHUA 3LOVA 3AE5A 5EB5A 5FS7A 1H82A 2Z5XA 4YXDA 2RABA 2VRMA 1TDNA 3FMWA 4EMWA 1EL5A 3LXDA 4JN9A 1P2EA 5TR3A 3K30A 1N1PA 1KNRA 1PBFA 2YG7A 2C70A 1IUUA 2CVJA 3SGLA 4H2NA 1CJ2A 1K0IA 1ELIA 4J56A 3G5QA 4A79A 2YG5A 3CPHG 3ZYXA 4UDPA 4EQRA 1N4WA 1DODA 4NEWA 1JU2A 2GR3A 1LQTA 1M64A 4B66A 2AAQA 3S5WA 4C77A 1TRBA 2VQ7A 2WP6A 1BWCA 2Q6UA 1GALA 3F8PA 1Y56A 2DKHA 2C67A 2X8GA 3O0HA 3UOXA 4EMJA 1P2HA 2VRLA 3NH3X 4U8MA 2YVFA 2WESA 1ZDLA 3GMCA 5KVIA 1GRFA 3UKPA 3AXBA 4RSLA 3B3RA 3IF9A 4U8KA 4C3XA 3OC4A 1LTXR 4K22A 1NHQA 1SEZA 4GDEA 2CULA 3VQRA 3BI4A 3RNMA 2WDQA 4EIQA 5CKUA 4B63A 4AT2A 1LJ1A 1NG3A 3AD7B 2APGA 1VG0A 2C65A 4U2TA 4MJWA 3ALLA 2ZZ0A 1YQ4A 3AE2A 2JB3A 3I3LA 4Y4LA 3CGCA 2BK5A 4A9WA 3AEGA 4B65A 1RP0A 2XLSA 1PBCA 3D8XA 3DK8A 4CRTA 5BUKA 1JNZA 1ZK7A 4USQA 5KWFA 2V6OA 4H4YA 4B1BA 2B7RA 1DNCA 2YWLA 2C66A 1DOEA 4DSHA 2OA1A 1H6VA 3BNMA 3M12A 4FDCB 1ZMDA 4TM3A 3H8LA 1TDKA 1KSSA 2TMDA 3FIMB 4X9MA 3UKQA 2R46A 4KPRA 1D4EA 2X50A 5L46A 3URHA 4TM4A 3CIRA 5U63A 2ZBWA 3AYJA 5U25A 4U8JA 4XWZA 1Q1RA 2VZ2A 1K0JA 1N4VA 1CC4A 4U8NA 4U8OA 5EBKA 1D5TA 1E6EA 2CDUA 2XLUA 2FJDA 4C3YA 1GNDA 4H2RA 3UTEA 3DJJA 3KD9A 4USRA 1GRTA 1JRXA 2IIDA 2H89A 3AEFA 1D4CA 4J33A 1PDHA 3RP8A 2YQUA 5IQ4A 2C73A 2GV8A 2YR6A 4I59A 4JNQA 2B9XA 2I0ZA 3CPIG 3PO7A 4A65A 1JEHA 3P1WA 4CCRA 3H8IA 3UP4A 2YLTA 2EQ8A 3QSEA 3D1CA 1PBBA 3AE8A 2VOUA 4H4TA 2OAMA 4PABA 4HB9A 4OPUA 2GMJA 3AWIA 4TLXA 1Q1WA 2YR5A 2BK3A 3DK9A 4D04A 3BI5A 1LVLA 1NEKA 2X3NA 3AECA 2EQ7A 2AR8A 1NG4A 1PXCA 4BK1A 4RG3A 4AOSA 1F8SA 1TDFA 5CQFA 1IJHA 1OJCA 4IA6A 4K8DA 2CFYA 1E1KA 4K7ZA 2XFQA 2BS4A 2WOWA 1GRBA 1YQZA 2WOVA 1DOCA 4H4UA 4C5OA 3PS9A 2HQMA 1L9DA 3I6DA 3NTDA 3NYFA 1PN0A 3GYIA 1GPEA 1S2YA 5FS6A 4C74A 2V61A 1EL7A 2E5VA 1NPXA 1O95A 4OPDA 2YLXA 4GRTA 3KU9A 1FCDA 2Y6RA 3KA7A 2WEUA 4YKGA 2BXRA 3PVCA 1BKWA 1ZKQA 4CNJA 1ZX9A 3V76A 5FMHA 5U1OA 2ARDA 1V59A 4A5LA 3NKSA 3K7MX 3UKAA 1GXFA 2YR4A 3AEBA 3DJEA 1IUWA 2B9WA 2YM1A 2NVKX 1PHHA 4H2PA 1TYPA 3GDPA 3IC9A 2YG4A 1MO9A 4J36A 1Y56B 3DMEA 2J3NA 1CBOA 4YTPA 2XVFA 3P4RA 1VQWA 2OLOA 2C75A 2A89A 5J7XA 2JK6A 1PXAA 1BZLA 1TYTA 2OLNA 3GMBA 1H83A 2GB0A 1JOAA 1S3EA 3CTYA 1AOGA 1NENA 2V3AA 2JKCA 4IVMB 1VDCA 2R0GA 3CN8A 4Z44A 3SM8A 1MXTA 2YG6A 3NTAA 2XVEA 4J34A 1PBEA 2B76A 4JDRA 5LV9A 1DOBA 1JRYA 1XPQA 3AB1A 2XVJA 3GYJA 2C72A 5FS9A 3EAOA 5JCKA 4PAAA 3ATRA 4EIPA 4NTCA 4O5UA 3ABVA 3VRAA 3KLJA 3AEEA 1EBDA 3LZWA 3VR9A 2FJBA 1ZMCA 4YT0A 4FK1C 1K4QA 2ZZBA 4H7UA 1OJTA 3OZ2A 4GCMA 1GT8A 1EL9A 1XHCA 3M0OA 4OCGA 4OVIA 5HYMA 1FECA 3CGEA 4J57A 3DGHA 2WPCA 3VR8A 2BC0A 3NLCA 4GF7A 1ZP0A 2W0HA 2C76A 3ADAB 2VVMA 3GWDA 4H4RA 2XCGA 3GSIA 4NZHA 4UP3A 1GTEA 3EANA 4XWRA 3V3NA 3ALMA 5JCLA 2BYBA 3UP5A 1L9CA 2BS3A 2WPEA 3AEAA 1KNPA 4B68A 4ECHA 2O9ZA 4ZN0A 1XANA 1YKJA 4E0VA 1NDAA 3UOVA 2DKIA 1H7XA 4U8LA 5KRQA 2RGJA 2C7GA 3FBSA 1H86A 2QAEA 1OJAA 1GEUA 1H84A 1ONFA 3ICSA 2YLWA 2V3BA 1YY5A 3ITJA 1ZOVA 3DJGX 1REOA 4H4QA 4B64A 4DNAA 4Z26A 3LB8A 1JNRA 3B6DA 3NN0X 1S2QA 2C3DA 2FJEA 1D7LA 3R9UA 4BV6A 3Q6JA 2GH5A 1UKVG 3NGCX 1K0LA 4TM0A 1BF3A 4OPIA 2JAEA 1CJ4A 1CL0A 1E1MA 2NPXA 4IVOB 1LPFA 2GR0A 3DGZA 3UTFA 1PJ5A 4EMIA 3NNEA 2BC1A 2F5ZA 3F8RA 3ICTA 3EPTA 4GUVA 1HYUA 4FX9A 3QFAA 5GRTA 1B5QA 3QSSA 3IHGA 4EM4A 4N9XA 3G5SA 1L0VA 3NG7X 4CY6A 3DK4A 4JNAA 1B8SA 2RGHA 1H7WA 1E1NA 1JRZA 1IUSA 2B7SA 2GR2A 3QJ4A 4I58A 4CBQA 4LA1A 5C3JA 4REKA 4H4XA 4D03A 4WX1A 4OPTA 1BGJA 4K2XA 3L8KA 3SQPA 1PS9A 1PJ6A 1F6MA 1NHPA 4BK2A 4K5RA 2EQ9A 1CJCA 2GF3A 2FBWA 3E1TA 1D4DA 2R0PA 3CNPA 4WCTA 4RG4A 2GMHA 3HZLA 1EL8A 4YSHA 1OJ9A 5M10A 4A7AA 1CC2A 5EB4A 1CJ3A 4BURA 1GOSA 2X8CA 1H81A 2GR1A 2JBVA 2XFOA 2YLZA 3BNUA 3C4NA 3NK2X 4IV9A 2E4GA 4LIIA 4EM3A 4Y4NA 2WDRA 2E1MA 1F8RA 3FPZA 5M0ZA 2PHHA 1ZY8A 4H4VA 2XFPA 5HY5A 3GDNA 3NRNA 4U8PA 1FEAA 4H4ZA 1B4VA 2Q7VA 2BABA 1XDIA 2R45A 1IUTA 2X8HA 3RP6A 2Q0LA 4Z24A 5KVHA 5BRTA 1CC6A 1KF6A 3P4QA 3AEDA 2WP5A 3ICRA 3WE0A 3P9UA 1S3BA 3BHFA 2V60A 3C96A 2IVEA 1GREA 3IHMA 2WU2A 1GESA 5KOXA 3C4AA 1DXLA 2BCPA 4TLZA 4U2LA 1QO8A 3T37A 2GQWA 4UDQA 4ADWA 3GD3A 4YTNA 1IUXA 3CNDA 1X31B 4X4JA 3ZDNA 5GSNA 5BULA 2A87A 2OALA 3AE9A 2XLTA 4J2WA 4EQXA 3UTHA 3UOYA 4Z2RA 3ATQA 3KPFA 4YSXA 1QJDA 2YG3A 4H4SA 1N4UA 2B9YA 4AP3A 2QCUA 1PXBA 1E39A 3P4PA 1VG9A 3CGDA 4J31A 5JCNA 3LZXA 3BI2A 4XXGA 2ACZA 5J60A 4YSYA 4M52A 2XLPA 3CNSA 2GAGB 2R4JA 3GRTA 3AD9B 5EOWA 1O94A 2YM2A 3II4A 2V5ZA 4Z25A 4P9SA 2R9ZA 2X99A 1GETA 2JB2A 2UZZA 2YLSA 5JCIA 3UOZA 4AP1A 4JY2A 3JSKA 3NN6X 1Y0PA 2Q0KA 2A8XA 2XYOA 3F8DA 3NYCA 3VRBA 1IUVA 4YKFA 2WQYA 1O5WA 4IA5A 4DGKA 2BA9A 2WETA 3G5RA 2XVHA 3K7TA 4BJZA 3H4KA 2GEWA 2FJAA 3UTGA 5C2TA 1COYA 4O5QA 3LADA 2XLRA 3VRDB 4Z2UA 3BHKA 4U2SA 2YVJA 4APNA 5BVAA 2XVIA 1W4XA 1E1LA 2H88A 2WHDA 3AE3A 3CNTA 4BK3A 1DJQA 5KOWA 4OPLA 2VVLA 2WOIA 2GQFA 4B69A 4LU6A 5KXJA 3GRSA 2WPFA 4OPCA 1LV0A 4A6NA 3GD4A 2JB1A 4CCQA 3AD8B 3DJDA 4NEVA 1NAAA 1CF3A 2C3CA 1YQ3A 3QSMA 4EQSA 1QLBA 1F8WA 4YWOA 2BXSA 1PBDA 1GERA 2BCGG 2WU5A 2YLRA 4NTDA 2GVCA 1OJDA 3QFBA 4ICYA 2IVDA 3UKKA 4AOXA 2WP9A 2C64A 2YVGA 4EQWA 1FL2A 1KDGA 3LJPA 3QVPA 1RYIA 3AE4A 4DSGA 5HHFA 1RSGA 3RHAA 3UCLA 1D7YA 4JQ9A 3AE1A 4UDRA 3L1RA 1LQUA 1GRAA
chains in the Genus database with same CATH superfamily
1N63C 2GAHB 2PGWA 3AE6A 1OEPA 2BS2A 3NVYB 4U8IA 1TDEA 3NT6A 3CNJA 2R4EA 3DGBA 3QVRA 3NK1X 3R10A 1N61C 5KNLA 2XFNA 4ZCCA 4H4PA 1X2GA 4BJYA 4AT0A 3CPJG 5ER0A 4ZCDA 1B37A 4A6NB 1F3PA 1KFYA 2QA2A 3SFDA 2RGOA 1N62C 5FS8A 3ISHA 3RP7A 2XDOA 4Z2TA 2Y6QA 2WDVA 2ZZCA 4Z17A 3K7QX 3UGVA 5EB5A 5FS7A 3R25A 2RABA 3QPEA 3FCPA 2XSXA 2YG7A 1IUUA 3SGLA 3S47A 2W54A 3G5QA 2YG5A 4UDPA 1DODA 1JU2A 2NQLA 1LQTA 4B66A 2WP6A 1GALA 2DKHA 2C67A 1P2HA 2WESA 5KVIA 1FFUC 3T14A 1LTXR 2CULA 3VQRA 3U9IA 1XPYA 4AT2A 3AD7B 1VG0A 2ZZ0A 1YQ4A 2XH4A 4B65A 3DK8A 3D8XA 5BUKA 2V6OA 4B1BA 1V97A 2B7RA 1H6VA 3QN3A 3PK7A 3BNMA 3M12A 3H8LA 2OPJA 1KSSA 3FIMB 4KPRA 3IK4A 1Q1RA 1K0JA 4U8OA 1E6EA 1TZZA 3UTEA 3DJJA 4USRA 2IIDA 3B9JB 2H89A 3T9PA 3RP8A 3A7AA 5IQ4A 2C73A 3AN1A 3SBFA 2GV8A 4CCRA 1F9CA 3RITA 2YLTA 3D1CA 3SYIA 3GY1A 4HB9A 3AWIA 5LV9A 1Q1WA 1WUFA 3DK9A 1LVLA 1NEKA 1MRAA 2X3NA 4RG3A 1F8SA 5CQFA 4IA6A 4K7ZA 2XFQA 4GAPA 2WOVA 4Z1YA 4HNCA 3NTDA 1EC7A 1S2YA 1O95A 4OPDA 2YLXA 4GRTA 2POZA 1BKWA 4CNJA 5FMHA 5U1OA 2ARDA 4A5LA 3K7MX 3UKAA 3A7UA 2YR4A 3CT2A 2YM1A 3GDPA 3IC9A 3FYYA 1Y56B 1KKRA 2J3NA 3ENLA 2OLOA 2A89A 5J7XA 2JK6A 3GMBA 2OLNA 2GB0A 3SM8A 4YWSA 3D9XA 3RR1A 4G8TA 4J34A 2B76A 4JDRA 1DOBA 1XPQA 3DESA 3VCCA 4PAAA 1BKHA 1S7MA 4EIPA 1EBDA 3VR9A 2OG9A 4YT0A 4FK1C 3R0KA 3OZ2A 4GCMA 2PTYA 1T3QC 2WPCA 2W0HA 2C76A 4H4RA 4UP3A 3FVDA 3EANA 3RO6A 3ALMA 2WPEA 3AEAA 4ECHA 3QLDA 4IT1A 1YKJA 4ENLA 4U8LA 2C7GA 2QAEA 1GEUA 1ONFA 1H84A 3TW9A 4GFIA 3LB8A 4HN8A 3EUB3 3NXLA 4HCDA 2BRAA 3VDGA 3RCYA 2F5ZA 4DXKA 1HYUA 1B5QA 4EM4A 1L0VA 3NG7X 1E1NA 1JRZA 1IUSA 2OZTA 3QJ4A 1MDLA 4REKA 2MNRA 3IJLA 4D03A 3OTRA 4OPTA 3SJNA 3CYJA 1NHPA 1CJCA 2GF3A 3E1TA 1D4DA 3CNPA 4RG4A 3HZLA 1ONEA 4BURA 2GR1A 3NK2X 4EM3A 1MUCA 1H2IA 2OFJA 4M6UA 5HY5A 3GDNA 1FEAA 2Q7VA 2R45A 4DN1A 4ZCWA 5KVHA 3AEDA 3P0WA 4J1OA 3N6HA 3C96A 2IVEA 4U2LA 3SN0A 4UDQA 4ADWA 3GD3A 4H83A 1JROA 3P3BA 4MKSA 5GSNA 3TCSA 3ZVHB 3AE9A 4J2WA 3UTHA 4Z2RA 1N4UA 1E39A 4J31A 4XXGA 5J60A 3IJQA 2OVLA 3CNSA 2GAGB 4G6GA 4A35A 5JCIA 3NO1A 4JY2A 3JSKA 1Y0PA 2Q0KA 3NYCA 2A8XA 3OPSA 3VRBA 1IUVA 3EEZA 4YKFA 2WQYA 4U2SA 5BVAA 2H88A 5KOWA 3ES7A 3ZLGA 2WOIA 4B69A 4LU6A 4OPCA 4CCQA 4NEVA 1PDYA 2C3CA 1YQ3A 2CHRA 3QSMA 2GVCA 4NNJA 3T2YA 3AE4A 4IVOB 1ELIA 1GRAA 1GV4A 4KX6A 1ZOYA 2QA1A 3UCDA 5JCMA 3NIXA 4K8GA 3RGTA 4YTMA 1BQGA 2AQJA 3MKCA 3AM9A 4FK1A 4K5SA 3AYIA 3CGBA 3AE7A 3UKFA 2GRTA 3GWFA 3S61A 3TQPA 1GRGA 1E9IA 1GSNA 4IP4A 1MOKA 1TDOA 1PDZA 3AYLA 1NHSA 2VVLG 1E7PA 3NK0X 3DA1A 1RM6B 3P93A 3ALJA 1CHUA 2PS2A 3FMWA 4JN9A 2AKMA 1EBGA 2QQ6A 4H2NA 4ROPA 3VFCA 1FHUA 4EQRA 1N4WA 4NEWA 2GR3A 1M64A 3TTEA 3S5WA 1TRBA 4IL0A 4E4UA 2Q6UA 1Y56A 3UOXA 2RDXA 2QDDA 3GMCA 3S5SA 1GRFA 4C3XA 3HW2A 1NHQA 4G6HA 4G7FA 3NVVB 4EIQA 1EC9A 1NG3A 2C65A 4MJWA 2GGIA 3PWGA 3AE2A 3OP2A 4E4FA 4A9WA 5IDZA 4E5TA 1JNZA 4DWDA 2W3SA 4H4YA 1DNCA 2OA1A 1SB3B 1D4EA 2X50A 3URHA 5U63A 2ZBWA 4U8JA 4XWZA 1CC4A 4U8NA 1D5TA 1ECQA 3PG6A 2XLUA 2FJDA 4C3YA 3TOYA 5JRBA 4F4RA 3KD9A 4HYRA 4GYPC 1MDRA 3UJSA 1D4CA 2YQUA 2QJNA 4I59A 2EQ8A 1PBBA 3AE8A 2AL1A 2GMJA 2P88A 2YR5A 3AECA 2AR8A 1NG4A 4AOSA 1TDFA 1IJHA 1OJCA 2BS4A 1YQZA 4H4UA 4C5OA 2HQMA 2OKTA 3MSYA 3NYFA 5FS6A 1GPEA 4C74A 2E5VA 4M0XA 3SR6B 4YKGA 1JPDX 3PVCA 1FFVC 3V76A 3NKSA 3HYVA 1PHHA 1P48A 3DMEA 1VQWA 2OLAA 2FYMA 3FJ4A 3CTYA 1NENA 2V3AA 2JKCA 4Z44A 1VDCA 1MXTA 3T6CA 3UXKA 3JW7A 1PBEA 1JRYA 1SJAA 4JN7A 2XVJA 5JCKA 3FV9A 5KMSA 3VRAA 3ABVA 3KLJA 3H12A 3AEEA 4H19A 1ZMCA 1RVKA 2ZZBA 4H7UA 1OJTA 1XHCA 5HYMA 4HNLA 1FECA 3DGHA 3VR8A 1EBHA 4NZHA 1GTEA 4XWRA 5JCLA 2BYBA 4B68A 4ZN0A 1NDAA 3UOVA 3FBSA 1H86A 4Z26A 3ITJA 3Q45A 3NN0X 1L8PA 2C3DA 3T2KA 1D7LA 3R9UA 3Q6JA 1UKVG 3N4FA 1K0LA 1LPFA 2GR0A 4KEMA 1DTNA 1FO4A 3UJFA 3DG6A 3NNEA 2BC1A 3QFAA 4CY6A 1B8SA 2RGHA 1H7WA 5FJOA 4H4XA 2GGEA 3CAWA 4WX1A 3GO2A 1BGJA 4K2XA 1SJBA 3SQPA 1PJ6A 3JVAA 2EQ9A 3NRZB 2R0PA 4WCTA 1EL8A 5M10A 2W55A 3H8AA 1CC2A 3BSMA 2YLZA 3BNUA 3C4NA 4IV9A 4LIIA 2WDRA 2PHHA 3HYXA 1ELSA 1R6WA 4DHGA 4Z24A 1CC6A 1KF6A 3P9UA 1S3BA 2ZC8A 2V60A 5KOXA 2BCPA 3T37A 2O56A 4YTNA 1IUXA 3ZDNA 2OALA 3R0UA 4EQXA 4MGGA 3U4FA 3ATQA 1QJDA 4AP3A 1PXBA 3P4PA 2PGEA 3BI2A 7ENLA 2ACZA 4M52A 3T2ZA 2R4JA 1O94A 4KPLA 2V5ZA 2PCEA 4AP1A 3UOZA 5KMPA 3NN6X 2AL2A 3F8DA 1O5WA 3G5RA 3K7TA 4BJZA 1NU5A 3H4KA 2GEWA 3H7VA 2FJAA 4E8GA 3UJEA 3UTGA 1COYA 3STPA 4O5QA 3LADA 3SX6A 3BHKA 3JZUA 1E1LA 3T0KA 3AE3A 3CNTA 1WUEA 5KMQA 5KXJA 2WPFA 1LV0A 3GD4A 2JB1A 3AD8B 4MMWA 2HXTA 1F8WA 3AMZA 2PMQA 1GERA 4AOXA 3QFBA 2YVGA 1RYIA 2XGZA 1RSGA 1KD0A 4UDRA 1LQUA 4TLZA 4HA6A 2WBAA 4GR1A 3GD6A 1FOHA 2YAUA 3GC2A 3CK5A 1DJNA 4HCLA 4GIRA 1KSUA 2E3TA 3VC5A 2TPRA 2BACA 1FEBA 3DH9A 3KVEA 2R0CA 3KKJA 2ONEA 5IPYA 4H4WA 3H70A 2BK4A 1NHRA 3COXA 2PU1A 4OPGA 3NYEA 1M6IA 4JY3A 3ES8A 2EQ6A 3V3OA 5DBJA 3UKHA 2W3RA 4X9NA 1FHVA 2Z5YA 3K1GA 3REDA 1SJCA 3M13A 4TM1A 4II2A 3T8QA 3Q4DA 3N4EA 4YXDA 4EMWA 1EL5A 4G9KA 3LXDA 1PBFA 1KNRA 2CVJA 3T31A 5KMRA 4A79A 3A7RA 3CPHG 3GYXA 3ZYXA 2OX4A 2AAQA 1TE6A 4C77A 2VQ7A 1BWCA 4GGBA 1MNSA 3CB3A 3O0HA 2VRLA 4G74A 1ZDLA 5BOEA 3UKPA 3AXBA 4RSLA 3B3RA 3OC4A 2HNEA 4GDEA 3BI4A 3RNMA 4B63A 4U2TA 1KKOA 2JB3A 2XLSA 1P43A 5KWFA 3D46A 2YWLA 4DSHA 2C66A 1ZMDA 4TM3A 1TDKA 4X9MA 2TMDA 3UKQA 2R46A 4TM4A 2GL5A 3AYJA 2VZ2A 1N4VA 1JCTA 4HCHA 2AL2B 2GGHA 3AEFA 4TVWA 3MZNA 1PDHA 5ENLA 1STZA 2YR6A 4JNQA 3CPIG 3I6TA 3H8IA 2VOUA 2OAMA 4PABA 4KT2A 4OPUA 2BK3A 2EQ7A 3SZCA 2GSHA 3CXOA 4K8DA 3CMMA 1DOCA 3OW1A 3PS9A 1L9DA 1PN0A 3DG7A 3I6EA 3MQTA 1EL7A 2Y6RA 3MUCA 2GGJA 2OQHA 1X2HA 2PPGA 4IL2A 3R1ZA 3HYWA 1N5WC 2GGGA 3DJEA 1IUWA 2B9WA 2NVKX 3I4KA 4J36A 3SXIA 1CBOA 4YTPA 2C75A 1BZLA 1S3EA 1AOGA 2R0GA 2YG6A 1ZXIC 2PODA 3MY9A 3AB1A 1IYXA 2PA6A 3GYJA 2C72A 3EAOA 2BRYA 4O5UA 1FIQB 3ZVIA 3LZWA 4J3ZA 2PP0A 4OCGA 1GT8A 1EL9A 3SZ0A 3CGEA 4GF7A 1ZP0A 2XCGA 3R07C 3V3NA 1L9CA 3RRAA 1KNPA 1N5XA 1H7XA 2RGJA 3ICSA 2V3BA 1YY5A 4B64A 3DJGX 1ZOVA 4DNAA 3B6DA 4BV6A 2GH5A 4TM0A 4OPIA 1CJ4A 1CL0A 1E1MA 3UTFA 3V5FA 2PU0A 1PJ5A 4EMIA 4DX3A 3F8RA 4GUVA 4FX9A 3QSSA 3IHGA 3G5SA 3DK4A 4JNAA 4II3A 3NFUA 2PTWA 1R0MA 3UJ2A 3SZFA 4I58A 2GR2A 3UCCA 4LA1A 1JPMA 5C3JA 3DEQA 3CXBA 1PS9A 1F6MA 4K5RA 2XH7A 2GMHA 4YSHA 3QTPA 5FJRA 3VC6A 1CJ3A 2MUCA 1GOSA 3SSZA 4JHMA 2JBVA 2XFOA 5M0ZA 2E1MA 1F8RA 1ZY8A 2P8CA 4H4VA 2XFPA 3NRNA 3OZMA 4H4ZA 1B4VA 1IUTA 3RP6A 2Q0LA 4GAVA 5BRTA 3WE0A 3SN1A 3BHFA 3DIPA 1GESA 3C4AA 1DXLA 1QO8A 4K2SA 2GQWA 5BULA 2A87A 1WYGA 3V5CA 3PWIA 3UOYA 3KPFA 4YSXA 2QCUA 3CGDA 2XLPA 2ZADA 3GRTA 3AD9B 5EOWA 3II4A 4Z25A 4P9SA 1GETA 2YLSA 6ENLA 3D47A 2OO6A 4DGKA 2BA9A 2WETA 5C2TA 4IP5A 3TJIA 2XLRA 4ZOHB 2YVJA 4APNA 3HPFA 4BK3A 3NVZB 3NVWB 4OPLA 3SN4A 2VVLA 2GQFA 2P3ZA 4A6NA 3DJDA 1NAAA 4EQSA 2BXSA 4GGHA 2P0IA 2BCGG 2YLRA 4NTDA 1OJDA 4ICYA 3UKKA 2WP9A 2C64A 1FL2A 1KDGA 4GISA 3R11A 2QDEA 5HHFA 4JQ9A 3AE1A 1XS2A 3L1RA 4H2HA 4YSZA 5FJTA 5HXIA 1JRPA 2PP3A 3Q9TA 3IWAA 4GDPA 3T4WA 1GRHA 2OQYA 4CY8A 1Z6LA 2XFUA 4NTEA 4CNKA 3FG2P 4GYPA 4ZA0A 1L9EA 3NZGA 3EF6A 3N6JA 1Q9IA 4Z43A 1VRQB 2PYXA 4H50A 4Y4MA 5IQ1A 4KWSA 2HZGA 1GTHA 2C4CA 1BGNA 4A99A 3SFEA 1PJ7A 3UJRA 3UKLA 3NHOX 3DG3A 4B67A 3P4SA 4H2QA 2DW7A 2FKPA 2VQBA 3NS1B 2WS3A 3LOVA 3AE5A 3V3WA 1H82A 2Z5XA 4IHCA 2VRMA 1TDNA 1EC8A 1P2EA 5TR3A 3K30A 1N1PA 2C70A 1CJ2A 1K0IA 4J56A 3DFHA 3KUMA 4EMJA 3F8PA 2X8GA 4H1ZA 3NH3X 4U8MA 2YVFA 2QGYA 3IF9A 4U8KA 4K22A 1SEZA 2WDQA 3SY4A 2GDQA 3DERA 5CKUA 1LJ1A 3KPKA 2E5AA 2APGA 2I5QA 3ALLA 3I3LA 4Y4LA 3CGCA 2BK5A 3AEGA 3THUA 1RP0A 1PBCA 1KN0A 4CRTA 1ZK7A 4USQA 3VA8A 1DOEA 4FI4A 5FJUA 1SJDA 4FDCB 3UXLA 4GMEA 5L46A 3CIRA 5U25A 5EBKA 2CDUA 3B97A 1GNDA 4H2RA 1GRTA 1JRXA 4J33A 1JDFA 4X2PA 2B9XA 2I0ZA 3PO7A 4A65A 1NELA 1JEHA 4TVYA 3P1WA 3UP4A 3QSEA 3BJSA 4H4TA 2XH0A 4TLXA 4D04A 3BI5A 3DDMA 1PXCA 4BK1A 3ZLHA 3TWBA 2CFYA 1E1KA 2WOWA 1GRBA 3I6DA 3GYIA 2V61A 2HXUA 3L5OA 3MWCA 1NPXA 3KU9A 1FCDA 3KA7A 2WEUA 2BXRA 1ZKQA 1ZX9A 3IJIA 1V59A 1GXFA 3AEBA 2QJMA 4H2PA 1TYPA 2YG4A 1MO9A 2XVFA 3P4RA 1PXAA 1TYTA 1H83A 1JOAA 4A6GA 4IVMB 3CN8A 2PTXA 3NTAA 2XVEA 2XH2A 5FS9A 5G5HB 2OZ3A 3ATRA 4NTCA 3SQSA 2FJBA 4HPNA 1K4QA 3DFYA 3M0OA 4OVIA 3FXGA 4J57A 3TJ4A 2BC0A 3NLCA 3GWDA 3ADAB 2VVMA 3GSIA 3V4BA 5BOFA 3UP5A 2BS3A 1W6TA 2O9ZA 1XANA 4E0VA 2DKIA 5KRQA 1OJAA 1YEYA 3BOXA 4EWJA 2YLWA 2PSNA 4H4QA 1REOA 1JNRA 1S2QA 2FJEA 3NGCX 1BF3A 2JAEA 2PP1A 2NPXA 3DGZA 2PTZA 3ICTA 2DW6A 3EPTA 5GRTA 4A3RA 4N9XA 4DYEA 2B7SA 4CBQA 2QVHA 2P8BA 3L8KA 2QJJA 4BK2A 2FBWA 3QKEA 2OZ8A 1OJ9A 3SZWA 4A7AA 5EB4A 2X8CA 1H81A 3OZYA 2E4GA 4Y4NA 3FPZA 1VQZA 3ZVHA 1VDVA 4U8PA 3TWAA 2BABA 1XDIA 2X8HA 4NWZA 3P4QA 2WP5A 3ICRA 4JN8A 4G73A 1GREA 3IHMA 2WU2A 4FP1A 3HRDC 1TKKA 3CNDA 1X31B 4X4JA 5EU9A 2XLTA 4E6MA 2YG3A 5J04A 1N60C 4H4SA 2B9YA 5JCNA 1VG9A 3LZXA 4YSYA 4K1WA 3VCNA 2YM2A 2R9ZA 2X99A 2JB2A 2UZZA 1KCZA 3ZLFA 2XYOA 4IA5A 2XVHA 3ETRB 3EKGA 5G5GB 3PFRA 2AKZA 3VRDB 4Z2UA 2XVIA 1W4XA 5FJPA 2WHDA 1DJQA 3GRSA 1CF3A 1QLBA 4YWOA 1PBDA 2WU5A 2IVDA 4EQWA 3LJPA 3QVPA 4DSGA 3RHAA 3UCLA 1D7YA 4IZGA
chains in the Genus database with same CATH topology
4HA6A 2GAHB 1GV4A 4YSZA 4KX6A 2WBAA 4GR1A 1ZOYA 5HXIA 1FOHA 2YAUA 3AE6A 2QA1A 3Q9TA 1DJNA 3IWAA 4GDPA 2BS2A 4U8IA 1TDEA 3NT6A 1GRAA 3CNJA 5JCMA 1GRHA 2R4EA 3NIXA 1KSUA 4CY8A 2TPRA 4YTMA 3QVRA 2BACA 3NK1X 1Z6LA 2XFUA 1FEBA 3DH9A 2AQJA 4NTEA 3KVEA 4FK1A 3FG2P 4K5SA 4CNKA 5KNLA 2R0CA 3AYIA 3CGBA 1L9EA 2XFNA 3AE7A 3KKJA 3UKFA 3EF6A 5IPYA 2GRTA 1Q9IA 4H4WA 4ZCCA 4H4PA 2BK4A 4Z43A 1NHRA 1VRQB 3GWFA 2PYXA 3S61A 4H50A 4Y4MA 4BJYA 3COXA 4AT0A 3CPJG 5ER0A 4OPGA 1GRGA 1B37A 4ZCDA 3NYEA 1GSNA 1M6IA 5IQ1A 4JY3A 1F3PA 4A6NB 2EQ6A 1MOKA 1KFYA 1GTHA 2C4CA 3V3OA 2QA2A 1TDOA 1BGNA 5DBJA 2RGOA 3SFDA 3SFEA 1PJ7A 3UKHA 4A99A 3UKLA 4X9NA 5FS8A 3ISHA 3RP7A 2XDOA 4Z2TA 3AYLA 1NHSA 2VVLG 2Z5YA 1E7PA 3NHOX 3NK0X 3REDA 2Y6QA 3M13A 4B67A 2WDVA 2ZZCA 3DA1A 3P4SA 4TM1A 4H2QA 3K7QX 2VQBA 4II2A 3ALJA 2WS3A 1CHUA 3LOVA 5FS7A 3AE5A 5EB5A 1H82A 2Z5XA 4YXDA 2RABA 2VRMA 1TDNA 3FMWA 4EMWA 1EL5A 4G9KA 3LXDA 4JN9A 1P2EA 5TR3A 3K30A 1N1PA 1KNRA 1PBFA 2YG7A 2C70A 1IUUA 2CVJA 3SGLA 4H2NA 1CJ2A 3T31A 1K0IA 5KMRA 4J56A 3G5QA 4A79A 2YG5A 3CPHG 3GYXA 4EQRA 4UDPA 1N4WA 1DODA 4NEWA 3ZYXA 1JU2A 2GR3A 1LQTA 1M64A 4B66A 2AAQA 3S5WA 4C77A 1TRBA 2VQ7A 2WP6A 1BWCA 2Q6UA 4EMJA 1GALA 1Y56A 2X8GA 2C67A 3O0HA 2DKHA 3F8PA 3UOXA 1P2HA 2VRLA 3NH3X 4U8MA 2YVFA 4G74A 2WESA 1ZDLA 5KVIA 3GMCA 1GRFA 3T14A 3UKPA 3AXBA 4RSLA 3B3RA 3IF9A 4U8KA 4C3XA 3OC4A 1LTXR 4K22A 1NHQA 1SEZA 4G6HA 4GDEA 2CULA 3VQRA 3BI4A 3RNMA 2WDQA 3SY4A 4EIQA 5CKUA 4B63A 4AT2A 1LJ1A 1NG3A 3AD7B 3KPKA 2APGA 1VG0A 2C65A 4U2TA 4MJWA 3ALLA 2ZZ0A 1YQ4A 3AE2A 2JB3A 3I3LA 4Y4LA 3CGCA 2BK5A 4A9WA 3AEGA 4B65A 1RP0A 3DK8A 1PBCA 1KN0A 2XLSA 3D8XA 4CRTA 1ZK7A 1JNZA 4USQA 5BUKA 5KWFA 2V6OA 4H4YA 4B1BA 2B7RA 1DNCA 2YWLA 2C66A 1DOEA 4DSHA 2OA1A 1H6VA 3BNMA 3M12A 4FDCB 1ZMDA 4TM3A 3H8LA 1TDKA 1KSSA 2TMDA 3FIMB 4X9MA 3UKQA 2R46A 4KPRA 1D4EA 2X50A 5L46A 3URHA 4TM4A 3CIRA 5U63A 2ZBWA 5U25A 3AYJA 4U8JA 4XWZA 1Q1RA 2VZ2A 1K0JA 1N4VA 1CC4A 4U8NA 4U8OA 5EBKA 1D5TA 1E6EA 2CDUA 3PG6A 2XLUA 2FJDA 4C3YA 5JRBA 1GNDA 4H2RA 3DJJA 3KD9A 4USRA 3UTEA 1GRTA 1JRXA 2IIDA 2H89A 3AEFA 1D4CA 4J33A 1PDHA 3RP8A 2YQUA 5IQ4A 2C73A 4AOXA 2GV8A 2YR6A 4I59A 4JNQA 2B9XA 2I0ZA 3CPIG 3PO7A 4A65A 1JEHA 3P1WA 4CCRA 3H8IA 3UP4A 2YLTA 2EQ8A 3QSEA 3D1CA 1PBBA 3SYIA 3AE8A 2VOUA 4H4TA 2OAMA 4PABA 4HB9A 4OPUA 2GMJA 3AWIA 4TLXA 1Q1WA 2YR5A 2BK3A 3DK9A 4D04A 3BI5A 1LVLA 1NEKA 2X3NA 3AECA 2EQ7A 2AR8A 1NG4A 3SZCA 1PXCA 4BK1A 4RG3A 4AOSA 1F8SA 1TDFA 5CQFA 1IJHA 1OJCA 4IA6A 4K8DA 2CFYA 4K7ZA 1E1KA 2XFQA 2WOWA 2BS4A 3CMMA 1GRBA 1YQZA 4GAPA 2WOVA 1DOCA 4H4UA 4C5OA 3PS9A 2HQMA 1L9DA 3I6DA 3NTDA 3NYFA 1PN0A 3GYIA 5FS6A 1GPEA 1S2YA 4C74A 2V61A 3L5OA 1EL7A 2E5VA 1NPXA 1O95A 4OPDA 2YLXA 4GRTA 3KU9A 1FCDA 2Y6RA 3KA7A 2WEUA 4YKGA 2BXRA 3PVCA 1BKWA 1ZKQA 4CNJA 1ZX9A 3V76A 5FMHA 5U1OA 2ARDA 1V59A 3HYWA 4A5LA 3NKSA 3K7MX 3UKAA 3HYVA 1GXFA 2YR4A 3AEBA 3DJEA 1IUWA 2B9WA 2YM1A 2NVKX 1PHHA 4H2PA 1TYPA 3GDPA 3IC9A 2YG4A 1MO9A 4J36A 1Y56B 3DMEA 2J3NA 3SXIA 1CBOA 4YTPA 2XVFA 3P4RA 1VQWA 2OLOA 2C75A 2A89A 5J7XA 2JK6A 1PXAA 1BZLA 1TYTA 2OLNA 3GMBA 1H83A 1S3EA 1JOAA 2GB0A 3CTYA 1AOGA 1NENA 2V3AA 2JKCA 4IVMB 1VDCA 2R0GA 3CN8A 4Z44A 3SM8A 1MXTA 2YG6A 3D9XA 3NTAA 2XVEA 4J34A 1PBEA 2B76A 4JDRA 5LV9A 1DOBA 1JRYA 1XPQA 3AB1A 2XVJA 3GYJA 5FS9A 5JCKA 3EAOA 2C72A 2BRYA 4PAAA 3ATRA 5KMSA 1S7MA 4NTCA 4O5UA 3ABVA 3VRAA 3KLJA 4EIPA 3AEEA 1EBDA 3LZWA 3VR9A 2FJBA 1ZMCA 4YT0A 4FK1C 1K4QA 2ZZBA 4H7UA 1OJTA 3OZ2A 4GCMA 1GT8A 1XHCA 1EL9A 3M0OA 4OCGA 4OVIA 3SZ0A 5HYMA 1FECA 3CGEA 4J57A 3DGHA 2WPCA 3VR8A 2BC0A 3NLCA 4GF7A 1ZP0A 2W0HA 2C76A 3ADAB 2VVMA 3GWDA 4H4RA 2XCGA 3GSIA 4NZHA 4UP3A 1GTEA 3EANA 4XWRA 3V3NA 3ALMA 5JCLA 2BYBA 3UP5A 1L9CA 2BS3A 2WPEA 3AEAA 1KNPA 4B68A 4ECHA 2O9ZA 4ZN0A 1XANA 1YKJA 4E0VA 1NDAA 3UOVA 2DKIA 1H7XA 4U8LA 5KRQA 2RGJA 2C7GA 3FBSA 1H86A 2QAEA 1OJAA 1GEUA 1ONFA 1H84A 3ICSA 2YLWA 2V3BA 4H4QA 1YY5A 3DJGX 1ZOVA 1REOA 4DNAA 3ITJA 4B64A 4Z26A 3LB8A 1JNRA 3B6DA 3NN0X 2C3DA 1S2QA 2FJEA 1D7LA 3R9UA 4BV6A 3T2KA 3Q6JA 2GH5A 1UKVG 3NGCX 1K0LA 4TM0A 1BF3A 4OPIA 1CJ4A 1CL0A 2JAEA 1E1MA 2NPXA 4IVOB 1LPFA 2GR0A 3DGZA 3UTFA 2BRAA 1PJ5A 4EMIA 3NNEA 2BC1A 2F5ZA 3F8RA 3ICTA 3EPTA 4GUVA 4FX9A 1HYUA 3QFAA 5GRTA 1B5QA 3QSSA 3IHGA 4EM4A 4N9XA 3G5SA 1L0VA 3NG7X 4CY6A 3DK4A 4JNAA 1B8SA 2RGHA 1H7WA 4II3A 1E1NA 1JRZA 1IUSA 3SZFA 2B7SA 2GR2A 3QJ4A 4I58A 4CBQA 4LA1A 5C3JA 4REKA 4H4XA 4D03A 4WX1A 4OPTA 1BGJA 4K2XA 3L8KA 3SQPA 1PS9A 1PJ6A 1F6MA 1NHPA 4BK2A 4K5RA 2EQ9A 1CJCA 2GF3A 2FBWA 3E1TA 1D4DA 2R0PA 3CNPA 4WCTA 4RG4A 2GMHA 3HZLA 1EL8A 4YSHA 1OJ9A 5M10A 3SZWA 4A7AA 1CC2A 5EB4A 1CJ3A 4BURA 1GOSA 2X8CA 1H81A 2GR1A 2JBVA 2XFOA 2YLZA 3BNUA 3C4NA 3NK2X 4LIIA 2E4GA 4IV9A 4EM3A 4Y4NA 2WDRA 2E1MA 1F8RA 3FPZA 5M0ZA 2PHHA 1H2IA 1ZY8A 4H4VA 2XFPA 5HY5A 3GDNA 3NRNA 3HYXA 1FEAA 4U8PA 4H4ZA 1B4VA 2Q7VA 2BABA 1XDIA 2R45A 1IUTA 2X8HA 4NWZA 2Q0LA 4Z24A 5KVHA 4GAVA 1CC6A 1KF6A 3P4QA 3RP6A 3AEDA 5BRTA 2WP5A 3ICRA 3WE0A 3P9UA 1S3BA 3BHFA 2V60A 3C96A 4G73A 2IVEA 1GREA 3IHMA 2WU2A 1GESA 5KOXA 3C4AA 1DXLA 2BCPA 4TLZA 4U2LA 1QO8A 3T37A 2GQWA 4UDQA 4ADWA 3GD3A 4YTNA 1IUXA 3CNDA 1X31B 4X4JA 3ZDNA 5GSNA 5BULA 2A87A 2OALA 3AE9A 2XLTA 4J2WA 4EQXA 3UTHA 3UOYA 4Z2RA 3ATQA 3KPFA 4YSXA 1QJDA 2YG3A 4H4SA 1N4UA 2B9YA 4AP3A 2QCUA 1PXBA 1E39A 3P4PA 3CGDA 5JCNA 1VG9A 4J31A 3LZXA 3BI2A 4XXGA 2ACZA 5J60A 4YSYA 4M52A 2XLPA 3T2ZA 3CNSA 2GAGB 2R4JA 3GRTA 3AD9B 5EOWA 1O94A 2YM2A 3II4A 2V5ZA 4Z25A 4G6GA 4P9SA 2R9ZA 2X99A 1GETA 2JB2A 2UZZA 5JCIA 2YLSA 3UOZA 4AP1A 4JY2A 5KMPA 3JSKA 3NN6X 1Y0PA 2Q0KA 2A8XA 2XYOA 3F8DA 3NYCA 3VRBA 1IUVA 4YKFA 2WQYA 1O5WA 4IA5A 4DGKA 2BA9A 2WETA 3G5RA 2XVHA 3K7TA 4BJZA 3H4KA 2GEWA 2FJAA 3UTGA 5C2TA 1COYA 4O5QA 3SX6A 3LADA 2XLRA 3VRDB 4Z2UA 3BHKA 4U2SA 2YVJA 4APNA 5BVAA 2XVIA 1W4XA 1E1LA 3T0KA 2H88A 2WHDA 3AE3A 3CNTA 4BK3A 1DJQA 5KOWA 4OPLA 2VVLA 2WOIA 2GQFA 5KMQA 4LU6A 4B69A 3GRSA 2WPFA 5KXJA 4OPCA 1LV0A 4A6NA 3GD4A 2JB1A 4CCQA 3AD8B 3DJDA 4NEVA 2C3CA 1CF3A 1NAAA 1YQ3A 4EQSA 3QSMA 1QLBA 1F8WA 4YWOA 2BXSA 1PBDA 1GERA 2BCGG 2WU5A 2YLRA 4NTDA 2GVCA 3QFBA 1OJDA 4ICYA 4EQWA 4NNJA 2IVDA 2WP9A 2C64A 2YVGA 3UKKA 1FL2A 1KDGA 3LJPA 3QVPA 1RYIA 3T2YA 3AE4A 4DSGA 5HHFA 1RSGA 3RHAA 3UCLA 1D7YA 4JQ9A 3AE1A 4UDRA 3L1RA 1LQUA 1ELIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HA6 A;  2GAH B;  1GV4 A;  4YSZ A;  4KX6 A;  2WBA A;  4GR1 A;  1ZOY A;  5HXI A;  1FOH A;  2YAU A;  3AE6 A;  2QA1 A;  3Q9T A;  1DJN A;  3IWA A;  4GDP A;  2BS2 A;  4U8I A;  1TDE A;  3NT6 A;  3CNJ A;  5JCM A;  1GRH A;  2R4E A;  3NIX A;  1KSU A;  4CY8 A;  2TPR A;  4YTM A;  3QVR A;  2BAC A;  3NK1 X;  1Z6L A;  2XFU A;  1FEB A;  2AQJ A;  3DH9 A;  4NTE A;  3KVE A;  4FK1 A;  3FG2 P;  4K5S A;  4CNK A;  2R0C A;  3AYI A;  1L9E A;  2XFN A;  3AE7 A;  3CGB A;  3KKJ A;  3UKF A;  3EF6 A;  5IPY A;  2GRT A;  1Q9I A;  4H4W A;  4ZCC A;  4H4P A;  2BK4 A;  4Z43 A;  1NHR A;  1VRQ B;  3GWF A;  2PYX A;  3S61 A;  4H50 A;  4Y4M A;  4BJY A;  3COX A;  4AT0 A;  3CPJ G;  5ER0 A;  4OPG A;  1GRG A;  1B37 A;  4ZCD A;  3NYE A;  1GSN A;  1M6I A;  5IQ1 A;  4JY3 A;  1F3P A;  4A6N B;  1KFY A;  1MOK A;  2EQ6 A;  1GTH A;  3V3O A;  2QA2 A;  1TDO A;  1BGN A;  5DBJ A;  2RGO A;  3SFD A;  3SFE A;  1PJ7 A;  3UKH A;  4A99 A;  3UKL A;  4X9N A;  3ISH A;  5FS8 A;  3RP7 A;  2XDO A;  4Z2T A;  3AYL A;  1NHS A;  2VVL G;  2Z5Y A;  1E7P A;  3NHO X;  3NK0 X;  3RED A;  2Y6Q A;  3M13 A;  4B67 A;  2WDV A;  2ZZC A;  3DA1 A;  3P4S A;  4TM1 A;  4H2Q A;  3K7Q X;  2VQB A;  3ALJ A;  2WS3 A;  1CHU A;  3LOV A;  3AE5 A;  5EB5 A;  5FS7 A;  1H82 A;  2Z5X A;  4YXD A;  2RAB A;  2VRM A;  1TDN A;  3FMW A;  4EMW A;  1EL5 A;  3LXD A;  4JN9 A;  1P2E A;  5TR3 A;  3K30 A;  1N1P A;  1KNR A;  1PBF A;  2YG7 A;  2C70 A;  1IUU A;  2CVJ A;  3SGL A;  4H2N A;  1CJ2 A;  1K0I A;  1ELI A;  4J56 A;  3G5Q A;  4A79 A;  2YG5 A;  3CPH G;  3ZYX A;  4UDP A;  4EQR A;  1N4W A;  1DOD A;  4NEW A;  1JU2 A;  2GR3 A;  1LQT A;  1M64 A;  4B66 A;  2AAQ A;  3S5W A;  4C77 A;  1TRB A;  2VQ7 A;  2WP6 A;  1BWC A;  2Q6U A;  1GAL A;  3F8P A;  1Y56 A;  2DKH A;  2C67 A;  2X8G A;  3O0H A;  3UOX A;  4EMJ A;  1P2H A;  2VRL A;  3NH3 X;  4U8M A;  2YVF A;  2WES A;  1ZDL A;  3GMC A;  5KVI A;  1GRF A;  3UKP A;  3AXB A;  4RSL A;  3B3R A;  3IF9 A;  4U8K A;  4C3X A;  3OC4 A;  1LTX R;  4K22 A;  1NHQ A;  1SEZ A;  4GDE A;  2CUL A;  3VQR A;  3BI4 A;  3RNM A;  2WDQ A;  4EIQ A;  5CKU A;  4B63 A;  4AT2 A;  1LJ1 A;  1NG3 A;  3AD7 B;  2APG A;  1VG0 A;  2C65 A;  4U2T A;  4MJW A;  3ALL A;  2ZZ0 A;  1YQ4 A;  3AE2 A;  2JB3 A;  3I3L A;  4Y4L A;  3CGC A;  2BK5 A;  4A9W A;  3AEG A;  4B65 A;  1RP0 A;  2XLS A;  1PBC A;  3D8X A;  3DK8 A;  4CRT A;  5BUK A;  1JNZ A;  1ZK7 A;  4USQ A;  5KWF A;  2V6O A;  4H4Y A;  4B1B A;  2B7R A;  1DNC A;  2YWL A;  2C66 A;  1DOE A;  4DSH A;  2OA1 A;  1H6V A;  3BNM A;  3M12 A;  4FDC B;  1ZMD A;  4TM3 A;  3H8L A;  1TDK A;  1KSS A;  2TMD A;  3FIM B;  4X9M A;  3UKQ A;  2R46 A;  4KPR A;  1D4E A;  2X50 A;  5L46 A;  3URH A;  4TM4 A;  3CIR A;  5U63 A;  2ZBW A;  3AYJ A;  5U25 A;  4U8J A;  4XWZ A;  1Q1R A;  2VZ2 A;  1K0J A;  1N4V A;  1CC4 A;  4U8N A;  4U8O A;  5EBK A;  1D5T A;  1E6E A;  2CDU A;  2XLU A;  2FJD A;  4C3Y A;  1GND A;  4H2R A;  3UTE A;  3DJJ A;  3KD9 A;  4USR A;  1GRT A;  1JRX A;  2IID A;  2H89 A;  3AEF A;  1D4C A;  4J33 A;  1PDH A;  3RP8 A;  2YQU A;  5IQ4 A;  2C73 A;  2GV8 A;  2YR6 A;  4I59 A;  4JNQ A;  2B9X A;  2I0Z A;  3CPI G;  3PO7 A;  4A65 A;  1JEH A;  3P1W A;  4CCR A;  3H8I A;  3UP4 A;  2YLT A;  2EQ8 A;  3QSE A;  3D1C A;  1PBB A;  3AE8 A;  2VOU A;  4H4T A;  2OAM A;  4PAB A;  4HB9 A;  4OPU A;  2GMJ A;  3AWI A;  4TLX A;  1Q1W A;  2YR5 A;  2BK3 A;  3DK9 A;  4D04 A;  3BI5 A;  1LVL A;  1NEK A;  2X3N A;  3AEC A;  2EQ7 A;  2AR8 A;  1NG4 A;  1PXC A;  4BK1 A;  4RG3 A;  4AOS A;  1F8S A;  1TDF A;  5CQF A;  1IJH A;  1OJC A;  4IA6 A;  4K8D A;  2CFY A;  1E1K A;  4K7Z A;  2XFQ A;  2BS4 A;  2WOW A;  1GRB A;  1YQZ A;  2WOV A;  1DOC A;  4H4U A;  4C5O A;  3PS9 A;  2HQM A;  1L9D A;  3I6D A;  3NTD A;  3NYF A;  1PN0 A;  3GYI A;  1GPE A;  1S2Y A;  5FS6 A;  4C74 A;  2V61 A;  1EL7 A;  2E5V A;  1NPX A;  1O95 A;  4OPD A;  2YLX A;  4GRT A;  3KU9 A;  1FCD A;  2Y6R A;  3KA7 A;  2WEU A;  4YKG A;  2BXR A;  3PVC A;  1BKW A;  1ZKQ A;  4CNJ A;  1ZX9 A;  3V76 A;  5FMH A;  5U1O A;  2ARD A;  1V59 A;  4A5L A;  3NKS A;  3K7M X;  3UKA A;  1GXF A;  2YR4 A;  3AEB A;  3DJE A;  1IUW A;  2B9W A;  2YM1 A;  2NVK X;  1PHH A;  4H2P A;  1TYP A;  3GDP A;  3IC9 A;  2YG4 A;  1MO9 A;  4J36 A;  1Y56 B;  3DME A;  2J3N A;  1CBO A;  4YTP A;  2XVF A;  3P4R A;  1VQW A;  2OLO A;  2C75 A;  2A89 A;  5J7X A;  2JK6 A;  1PXA A;  1BZL A;  1TYT A;  2OLN A;  3GMB A;  1H83 A;  2GB0 A;  1JOA A;  1S3E A;  3CTY A;  1AOG A;  1NEN A;  2V3A A;  2JKC A;  4IVM B;  1VDC A;  2R0G A;  3CN8 A;  4Z44 A;  3SM8 A;  1MXT A;  2YG6 A;  3NTA A;  2XVE A;  4J34 A;  1PBE A;  2B76 A;  4JDR A;  5LV9 A;  1DOB A;  1JRY A;  1XPQ A;  3AB1 A;  2XVJ A;  3GYJ A;  2C72 A;  5FS9 A;  3EAO A;  5JCK A;  4PAA A;  3ATR A;  4EIP A;  4NTC A;  4O5U A;  3ABV A;  3VRA A;  3KLJ A;  3AEE A;  1EBD A;  3LZW A;  3VR9 A;  2FJB A;  1ZMC A;  4YT0 A;  4FK1 C;  1K4Q A;  2ZZB A;  4H7U A;  1OJT A;  3OZ2 A;  4GCM A;  1GT8 A;  1EL9 A;  1XHC A;  3M0O A;  4OCG A;  4OVI A;  5HYM A;  1FEC A;  3CGE A;  4J57 A;  3DGH A;  2WPC A;  3VR8 A;  2BC0 A;  3NLC A;  4GF7 A;  1ZP0 A;  2W0H A;  2C76 A;  3ADA B;  2VVM A;  3GWD A;  4H4R A;  2XCG A;  3GSI A;  4NZH A;  4UP3 A;  1GTE A;  3EAN A;  4XWR A;  3V3N A;  3ALM A;  5JCL A;  2BYB A;  3UP5 A;  1L9C A;  2BS3 A;  2WPE A;  3AEA A;  1KNP A;  4B68 A;  4ECH A;  2O9Z A;  4ZN0 A;  1XAN A;  1YKJ A;  4E0V A;  1NDA A;  3UOV A;  2DKI A;  1H7X A;  4U8L A;  5KRQ A;  2RGJ A;  2C7G A;  3FBS A;  1H86 A;  2QAE A;  1OJA A;  1GEU A;  1H84 A;  1ONF A;  3ICS A;  2YLW A;  2V3B A;  1YY5 A;  3ITJ A;  1ZOV A;  3DJG X;  1REO A;  4H4Q A;  4B64 A;  4DNA A;  4Z26 A;  3LB8 A;  1JNR A;  3B6D A;  3NN0 X;  1S2Q A;  2C3D A;  2FJE A;  1D7L A;  3R9U A;  4BV6 A;  3Q6J A;  2GH5 A;  1UKV G;  3NGC X;  1K0L A;  4TM0 A;  1BF3 A;  4OPI A;  2JAE A;  1CJ4 A;  1CL0 A;  1E1M A;  2NPX A;  4IVO B;  1LPF A;  2GR0 A;  3DGZ A;  3UTF A;  1PJ5 A;  4EMI A;  3NNE A;  2BC1 A;  2F5Z A;  3F8R A;  3ICT A;  3EPT A;  4GUV A;  1HYU A;  4FX9 A;  3QFA A;  5GRT A;  1B5Q A;  3QSS A;  3IHG A;  4EM4 A;  4N9X A;  3G5S A;  1L0V A;  3NG7 X;  4CY6 A;  3DK4 A;  4JNA A;  1B8S A;  2RGH A;  1H7W A;  1E1N A;  1JRZ A;  1IUS A;  2B7S A;  2GR2 A;  3QJ4 A;  4I58 A;  4CBQ A;  4LA1 A;  5C3J A;  4REK A;  4H4X A;  4D03 A;  4WX1 A;  4OPT A;  1BGJ A;  4K2X A;  3L8K A;  3SQP A;  1PS9 A;  1PJ6 A;  1F6M A;  1NHP A;  4BK2 A;  4K5R A;  2EQ9 A;  1CJC A;  2GF3 A;  2FBW A;  3E1T A;  1D4D A;  2R0P A;  3CNP A;  4WCT A;  4RG4 A;  2GMH A;  3HZL A;  1EL8 A;  4YSH A;  1OJ9 A;  5M10 A;  4A7A A;  1CC2 A;  5EB4 A;  1CJ3 A;  4BUR A;  1GOS A;  2X8C A;  1H81 A;  2GR1 A;  2JBV A;  2XFO A;  2YLZ A;  3BNU A;  3C4N A;  3NK2 X;  4IV9 A;  2E4G A;  4LII A;  4EM3 A;  4Y4N A;  2WDR A;  2E1M A;  1F8R A;  3FPZ A;  5M0Z A;  2PHH A;  1ZY8 A;  4H4V A;  2XFP A;  5HY5 A;  3GDN A;  3NRN A;  4U8P A;  1FEA A;  4H4Z A;  1B4V A;  2Q7V A;  2BAB A;  1XDI A;  2R45 A;  1IUT A;  2X8H A;  3RP6 A;  2Q0L A;  4Z24 A;  5KVH A;  5BRT A;  1CC6 A;  1KF6 A;  3P4Q A;  3AED A;  2WP5 A;  3ICR A;  3WE0 A;  3P9U A;  1S3B A;  3BHF A;  2V60 A;  3C96 A;  2IVE A;  1GRE A;  3IHM A;  2WU2 A;  1GES A;  5KOX A;  3C4A A;  1DXL A;  2BCP A;  4TLZ A;  4U2L A;  1QO8 A;  3T37 A;  2GQW A;  4UDQ A;  4ADW A;  3GD3 A;  4YTN A;  1IUX A;  3CND A;  1X31 B;  4X4J A;  3ZDN A;  5GSN A;  5BUL A;  2A87 A;  2OAL A;  3AE9 A;  2XLT A;  4J2W A;  4EQX A;  3UTH A;  3UOY A;  4Z2R A;  3ATQ A;  3KPF A;  4YSX A;  1QJD A;  2YG3 A;  4H4S A;  1N4U A;  2B9Y A;  4AP3 A;  2QCU A;  1PXB A;  1E39 A;  3P4P A;  1VG9 A;  3CGD A;  4J31 A;  5JCN A;  3LZX A;  3BI2 A;  4XXG A;  2ACZ A;  5J60 A;  4YSY A;  4M52 A;  2XLP A;  3CNS A;  2GAG B;  2R4J A;  3GRT A;  3AD9 B;  5EOW A;  1O94 A;  2YM2 A;  3II4 A;  2V5Z A;  4Z25 A;  4P9S A;  2R9Z A;  2X99 A;  1GET A;  2JB2 A;  2UZZ A;  2YLS A;  5JCI A;  3UOZ A;  4AP1 A;  4JY2 A;  3JSK A;  3NN6 X;  1Y0P A;  2Q0K A;  2A8X A;  2XYO A;  3F8D A;  3NYC A;  3VRB A;  1IUV A;  4YKF A;  2WQY A;  1O5W A;  4IA5 A;  4DGK A;  2BA9 A;  2WET A;  3G5R A;  2XVH A;  3K7T A;  4BJZ A;  3H4K A;  2GEW A;  2FJA A;  3UTG A;  5C2T A;  1COY A;  4O5Q A;  3LAD A;  2XLR A;  3VRD B;  4Z2U A;  3BHK A;  4U2S A;  2YVJ A;  4APN A;  5BVA A;  2XVI A;  1W4X A;  1E1L A;  2H88 A;  2WHD A;  3AE3 A;  3CNT A;  4BK3 A;  1DJQ A;  5KOW A;  4OPL A;  2VVL A;  2WOI A;  2GQF A;  4B69 A;  4LU6 A;  5KXJ A;  3GRS A;  2WPF A;  4OPC A;  1LV0 A;  4A6N A;  3GD4 A;  2JB1 A;  4CCQ A;  3AD8 B;  3DJD A;  4NEV A;  1NAA A;  1CF3 A;  2C3C A;  1YQ3 A;  3QSM A;  4EQS A;  1QLB A;  1F8W A;  4YWO A;  2BXS A;  1PBD A;  1GER A;  2BCG G;  2WU5 A;  2YLR A;  4NTD A;  2GVC A;  1OJD A;  3QFB A;  4ICY A;  2IVD A;  3UKK A;  4AOX A;  2WP9 A;  2C64 A;  2YVG A;  4EQW A;  1FL2 A;  1KDG A;  3LJP A;  3QVP A;  1RYI A;  3AE4 A;  4DSG A;  5HHF A;  1RSG A;  3RHA A;  3UCL A;  1D7Y A;  4JQ9 A;  3AE1 A;  4UDR A;  3L1R A;  1LQU A;  1GRA A; 
#chains in the Genus database with same CATH topology
 1N63 C;  2GAH B;  2PGW A;  3AE6 A;  1OEP A;  2BS2 A;  3NVY B;  4U8I A;  1TDE A;  3NT6 A;  3CNJ A;  2R4E A;  3DGB A;  3QVR A;  3NK1 X;  3R10 A;  1N61 C;  5KNL A;  2XFN A;  4ZCC A;  4H4P A;  1X2G A;  4BJY A;  4AT0 A;  3CPJ G;  5ER0 A;  4ZCD A;  1B37 A;  4A6N B;  1F3P A;  1KFY A;  2QA2 A;  3SFD A;  2RGO A;  1N62 C;  5FS8 A;  3ISH A;  3RP7 A;  2XDO A;  4Z2T A;  2Y6Q A;  2WDV A;  2ZZC A;  4Z17 A;  3K7Q X;  3UGV A;  5EB5 A;  5FS7 A;  3R25 A;  2RAB A;  3QPE A;  3FCP A;  2XSX A;  2YG7 A;  1IUU A;  3SGL A;  3S47 A;  2W54 A;  3G5Q A;  2YG5 A;  4UDP A;  1DOD A;  1JU2 A;  2NQL A;  1LQT A;  4B66 A;  2WP6 A;  1GAL A;  2DKH A;  2C67 A;  1P2H A;  2WES A;  5KVI A;  1FFU C;  3T14 A;  1LTX R;  2CUL A;  3VQR A;  3U9I A;  1XPY A;  4AT2 A;  3AD7 B;  1VG0 A;  2ZZ0 A;  1YQ4 A;  2XH4 A;  4B65 A;  3DK8 A;  3D8X A;  5BUK A;  2V6O A;  4B1B A;  1V97 A;  2B7R A;  1H6V A;  3QN3 A;  3PK7 A;  3BNM A;  3M12 A;  3H8L A;  2OPJ A;  1KSS A;  3FIM B;  4KPR A;  3IK4 A;  1Q1R A;  1K0J A;  4U8O A;  1E6E A;  1TZZ A;  3UTE A;  3DJJ A;  4USR A;  2IID A;  3B9J B;  2H89 A;  3T9P A;  3RP8 A;  3A7A A;  5IQ4 A;  2C73 A;  3AN1 A;  3SBF A;  2GV8 A;  4CCR A;  1F9C A;  3RIT A;  2YLT A;  3D1C A;  3SYI A;  3GY1 A;  4HB9 A;  3AWI A;  5LV9 A;  1Q1W A;  1WUF A;  3DK9 A;  1LVL A;  1NEK A;  1MRA A;  2X3N A;  4RG3 A;  1F8S A;  5CQF A;  4IA6 A;  4K7Z A;  2XFQ A;  4GAP A;  2WOV A;  4Z1Y A;  4HNC A;  3NTD A;  1EC7 A;  1S2Y A;  1O95 A;  4OPD A;  2YLX A;  4GRT A;  2POZ A;  1BKW A;  4CNJ A;  5FMH A;  5U1O A;  2ARD A;  4A5L A;  3K7M X;  3UKA A;  3A7U A;  2YR4 A;  3CT2 A;  2YM1 A;  3GDP A;  3IC9 A;  3FYY A;  1Y56 B;  1KKR A;  2J3N A;  3ENL A;  2OLO A;  2A89 A;  5J7X A;  2JK6 A;  3GMB A;  2OLN A;  2GB0 A;  3SM8 A;  4YWS A;  3D9X A;  3RR1 A;  4G8T A;  4J34 A;  2B76 A;  4JDR A;  1DOB A;  1XPQ A;  3DES A;  3VCC A;  4PAA A;  1BKH A;  1S7M A;  4EIP A;  1EBD A;  3VR9 A;  2OG9 A;  4YT0 A;  4FK1 C;  3R0K A;  3OZ2 A;  4GCM A;  2PTY A;  1T3Q C;  2WPC A;  2W0H A;  2C76 A;  4H4R A;  4UP3 A;  3FVD A;  3EAN A;  3RO6 A;  3ALM A;  2WPE A;  3AEA A;  4ECH A;  3QLD A;  4IT1 A;  1YKJ A;  4ENL A;  4U8L A;  2C7G A;  2QAE A;  1GEU A;  1ONF A;  1H84 A;  3TW9 A;  4GFI A;  3LB8 A;  4HN8 A;  3EUB 3;  3NXL A;  4HCD A;  2BRA A;  3VDG A;  3RCY A;  2F5Z A;  4DXK A;  1HYU A;  1B5Q A;  4EM4 A;  1L0V A;  3NG7 X;  1E1N A;  1JRZ A;  1IUS A;  2OZT A;  3QJ4 A;  1MDL A;  4REK A;  2MNR A;  3IJL A;  4D03 A;  3OTR A;  4OPT A;  3SJN A;  3CYJ A;  1NHP A;  1CJC A;  2GF3 A;  3E1T A;  1D4D A;  3CNP A;  4RG4 A;  3HZL A;  1ONE A;  4BUR A;  2GR1 A;  3NK2 X;  4EM3 A;  1MUC A;  1H2I A;  2OFJ A;  4M6U A;  5HY5 A;  3GDN A;  1FEA A;  2Q7V A;  2R45 A;  4DN1 A;  4ZCW A;  5KVH A;  3AED A;  3P0W A;  4J1O A;  3N6H A;  3C96 A;  2IVE A;  4U2L A;  3SN0 A;  4UDQ A;  4ADW A;  3GD3 A;  4H83 A;  1JRO A;  3P3B A;  4MKS A;  5GSN A;  3TCS A;  3ZVH B;  3AE9 A;  4J2W A;  3UTH A;  4Z2R A;  1N4U A;  1E39 A;  4J31 A;  4XXG A;  5J60 A;  3IJQ A;  2OVL A;  3CNS A;  2GAG B;  4G6G A;  4A35 A;  5JCI A;  3NO1 A;  4JY2 A;  3JSK A;  1Y0P A;  2Q0K A;  3NYC A;  2A8X A;  3OPS A;  3VRB A;  1IUV A;  3EEZ A;  4YKF A;  2WQY A;  4U2S A;  5BVA A;  2H88 A;  5KOW A;  3ES7 A;  3ZLG A;  2WOI A;  4B69 A;  4LU6 A;  4OPC A;  4CCQ A;  4NEV A;  1PDY A;  2C3C A;  1YQ3 A;  2CHR A;  3QSM A;  2GVC A;  4NNJ A;  3T2Y A;  3AE4 A;  4IVO B;  1ELI A;  1GRA A;  1GV4 A;  4KX6 A;  1ZOY A;  2QA1 A;  3UCD A;  5JCM A;  3NIX A;  4K8G A;  3RGT A;  4YTM A;  1BQG A;  2AQJ A;  3MKC A;  3AM9 A;  4FK1 A;  4K5S A;  3AYI A;  3CGB A;  3AE7 A;  3UKF A;  2GRT A;  3GWF A;  3S61 A;  3TQP A;  1GRG A;  1E9I A;  1GSN A;  4IP4 A;  1MOK A;  1TDO A;  1PDZ A;  3AYL A;  1NHS A;  2VVL G;  1E7P A;  3NK0 X;  3DA1 A;  1RM6 B;  3P93 A;  3ALJ A;  1CHU A;  2PS2 A;  3FMW A;  4JN9 A;  2AKM A;  1EBG A;  2QQ6 A;  4H2N A;  4ROP A;  3VFC A;  1FHU A;  4EQR A;  1N4W A;  4NEW A;  2GR3 A;  1M64 A;  3TTE A;  3S5W A;  1TRB A;  4IL0 A;  4E4U A;  2Q6U A;  1Y56 A;  3UOX A;  2RDX A;  2QDD A;  3GMC A;  3S5S A;  1GRF A;  4C3X A;  3HW2 A;  1NHQ A;  4G6H A;  4G7F A;  3NVV B;  4EIQ A;  1EC9 A;  1NG3 A;  2C65 A;  4MJW A;  2GGI A;  3PWG A;  3AE2 A;  3OP2 A;  4E4F A;  4A9W A;  5IDZ A;  4E5T A;  1JNZ A;  4DWD A;  2W3S A;  4H4Y A;  1DNC A;  2OA1 A;  1SB3 B;  1D4E A;  2X50 A;  3URH A;  5U63 A;  2ZBW A;  4U8J A;  4XWZ A;  1CC4 A;  4U8N A;  1D5T A;  1ECQ A;  3PG6 A;  2XLU A;  2FJD A;  4C3Y A;  3TOY A;  5JRB A;  4F4R A;  3KD9 A;  4HYR A;  4GYP C;  1MDR A;  3UJS A;  1D4C A;  2YQU A;  2QJN A;  4I59 A;  2EQ8 A;  1PBB A;  3AE8 A;  2AL1 A;  2GMJ A;  2P88 A;  2YR5 A;  3AEC A;  2AR8 A;  1NG4 A;  4AOS A;  1TDF A;  1IJH A;  1OJC A;  2BS4 A;  1YQZ A;  4H4U A;  4C5O A;  2HQM A;  2OKT A;  3MSY A;  3NYF A;  5FS6 A;  1GPE A;  4C74 A;  2E5V A;  4M0X A;  3SR6 B;  4YKG A;  1JPD X;  3PVC A;  1FFV C;  3V76 A;  3NKS A;  3HYV A;  1PHH A;  1P48 A;  3DME A;  1VQW A;  2OLA A;  2FYM A;  3FJ4 A;  3CTY A;  1NEN A;  2V3A A;  2JKC A;  4Z44 A;  1VDC A;  1MXT A;  3T6C A;  3UXK A;  3JW7 A;  1PBE A;  1JRY A;  1SJA A;  4JN7 A;  2XVJ A;  5JCK A;  3FV9 A;  5KMS A;  3VRA A;  3ABV A;  3KLJ A;  3H12 A;  3AEE A;  4H19 A;  1ZMC A;  1RVK A;  2ZZB A;  4H7U A;  1OJT A;  1XHC A;  5HYM A;  4HNL A;  1FEC A;  3DGH A;  3VR8 A;  1EBH A;  4NZH A;  1GTE A;  4XWR A;  5JCL A;  2BYB A;  4B68 A;  4ZN0 A;  1NDA A;  3UOV A;  3FBS A;  1H86 A;  4Z26 A;  3ITJ A;  3Q45 A;  3NN0 X;  1L8P A;  2C3D A;  3T2K A;  1D7L A;  3R9U A;  3Q6J A;  1UKV G;  3N4F A;  1K0L A;  1LPF A;  2GR0 A;  4KEM A;  1DTN A;  1FO4 A;  3UJF A;  3DG6 A;  3NNE A;  2BC1 A;  3QFA A;  4CY6 A;  1B8S A;  2RGH A;  1H7W A;  5FJO A;  4H4X A;  2GGE A;  3CAW A;  4WX1 A;  3GO2 A;  1BGJ A;  4K2X A;  1SJB A;  3SQP A;  1PJ6 A;  3JVA A;  2EQ9 A;  3NRZ B;  2R0P A;  4WCT A;  1EL8 A;  5M10 A;  2W55 A;  3H8A A;  1CC2 A;  3BSM A;  2YLZ A;  3BNU A;  3C4N A;  4IV9 A;  4LII A;  2WDR A;  2PHH A;  3HYX A;  1ELS A;  1R6W A;  4DHG A;  4Z24 A;  1CC6 A;  1KF6 A;  3P9U A;  1S3B A;  2ZC8 A;  2V60 A;  5KOX A;  2BCP A;  3T37 A;  2O56 A;  4YTN A;  1IUX A;  3ZDN A;  2OAL A;  3R0U A;  4EQX A;  4MGG A;  3U4F A;  3ATQ A;  1QJD A;  4AP3 A;  1PXB A;  3P4P A;  2PGE A;  3BI2 A;  7ENL A;  2ACZ A;  4M52 A;  3T2Z A;  2R4J A;  1O94 A;  4KPL A;  2V5Z A;  2PCE A;  4AP1 A;  3UOZ A;  5KMP A;  3NN6 X;  2AL2 A;  3F8D A;  1O5W A;  3G5R A;  3K7T A;  4BJZ A;  1NU5 A;  3H4K A;  2GEW A;  3H7V A;  2FJA A;  4E8G A;  3UJE A;  3UTG A;  1COY A;  3STP A;  4O5Q A;  3LAD A;  3SX6 A;  3BHK A;  3JZU A;  1E1L A;  3T0K A;  3AE3 A;  3CNT A;  1WUE A;  5KMQ A;  5KXJ A;  2WPF A;  1LV0 A;  3GD4 A;  2JB1 A;  3AD8 B;  4MMW A;  2HXT A;  1F8W A;  3AMZ A;  2PMQ A;  1GER A;  4AOX A;  3QFB A;  2YVG A;  1RYI A;  2XGZ A;  1RSG A;  1KD0 A;  4UDR A;  1LQU A;  4TLZ A;  4HA6 A;  2WBA A;  4GR1 A;  3GD6 A;  1FOH A;  2YAU A;  3GC2 A;  3CK5 A;  1DJN A;  4HCL A;  4GIR A;  1KSU A;  2E3T A;  3VC5 A;  2TPR A;  2BAC A;  1FEB A;  3DH9 A;  3KVE A;  2R0C A;  3KKJ A;  2ONE A;  5IPY A;  4H4W A;  3H70 A;  2BK4 A;  1NHR A;  3COX A;  2PU1 A;  4OPG A;  3NYE A;  1M6I A;  4JY3 A;  3ES8 A;  2EQ6 A;  3V3O A;  5DBJ A;  3UKH A;  2W3R A;  4X9N A;  1FHV A;  2Z5Y A;  3K1G A;  3RED A;  1SJC A;  3M13 A;  4TM1 A;  4II2 A;  3T8Q A;  3Q4D A;  3N4E A;  4YXD A;  4EMW A;  1EL5 A;  4G9K A;  3LXD A;  1PBF A;  1KNR A;  2CVJ A;  3T31 A;  5KMR A;  4A79 A;  3A7R A;  3CPH G;  3GYX A;  3ZYX A;  2OX4 A;  2AAQ A;  1TE6 A;  4C77 A;  2VQ7 A;  1BWC A;  4GGB A;  1MNS A;  3CB3 A;  3O0H A;  2VRL A;  4G74 A;  1ZDL A;  5BOE A;  3UKP A;  3AXB A;  4RSL A;  3B3R A;  3OC4 A;  2HNE A;  4GDE A;  3BI4 A;  3RNM A;  4B63 A;  4U2T A;  1KKO A;  2JB3 A;  2XLS A;  1P43 A;  5KWF A;  3D46 A;  2YWL A;  4DSH A;  2C66 A;  1ZMD A;  4TM3 A;  1TDK A;  4X9M A;  2TMD A;  3UKQ A;  2R46 A;  4TM4 A;  2GL5 A;  3AYJ A;  2VZ2 A;  1N4V A;  1JCT A;  4HCH A;  2AL2 B;  2GGH A;  3AEF A;  4TVW A;  3MZN A;  1PDH A;  5ENL A;  1STZ A;  2YR6 A;  4JNQ A;  3CPI G;  3I6T A;  3H8I A;  2VOU A;  2OAM A;  4PAB A;  4KT2 A;  4OPU A;  2BK3 A;  2EQ7 A;  3SZC A;  2GSH A;  3CXO A;  4K8D A;  3CMM A;  1DOC A;  3OW1 A;  3PS9 A;  1L9D A;  1PN0 A;  3DG7 A;  3I6E A;  3MQT A;  1EL7 A;  2Y6R A;  3MUC A;  2GGJ A;  2OQH A;  1X2H A;  2PPG A;  4IL2 A;  3R1Z A;  3HYW A;  1N5W C;  2GGG A;  3DJE A;  1IUW A;  2B9W A;  2NVK X;  3I4K A;  4J36 A;  3SXI A;  1CBO A;  4YTP A;  2C75 A;  1BZL A;  1S3E A;  1AOG A;  2R0G A;  2YG6 A;  1ZXI C;  2POD A;  3MY9 A;  3AB1 A;  1IYX A;  2PA6 A;  3GYJ A;  2C72 A;  3EAO A;  2BRY A;  4O5U A;  1FIQ B;  3ZVI A;  3LZW A;  4J3Z A;  2PP0 A;  4OCG A;  1GT8 A;  1EL9 A;  3SZ0 A;  3CGE A;  4GF7 A;  1ZP0 A;  2XCG A;  3R07 C;  3V3N A;  1L9C A;  3RRA A;  1KNP A;  1N5X A;  1H7X A;  2RGJ A;  3ICS A;  2V3B A;  1YY5 A;  4B64 A;  3DJG X;  1ZOV A;  4DNA A;  3B6D A;  4BV6 A;  2GH5 A;  4TM0 A;  4OPI A;  1CJ4 A;  1CL0 A;  1E1M A;  3UTF A;  3V5F A;  2PU0 A;  1PJ5 A;  4EMI A;  4DX3 A;  3F8R A;  4GUV A;  4FX9 A;  3QSS A;  3IHG A;  3G5S A;  3DK4 A;  4JNA A;  4II3 A;  3NFU A;  2PTW A;  1R0M A;  3UJ2 A;  3SZF A;  4I58 A;  2GR2 A;  3UCC A;  4LA1 A;  1JPM A;  5C3J A;  3DEQ A;  3CXB A;  1PS9 A;  1F6M A;  4K5R A;  2XH7 A;  2GMH A;  4YSH A;  3QTP A;  5FJR A;  3VC6 A;  1CJ3 A;  2MUC A;  1GOS A;  3SSZ A;  4JHM A;  2JBV A;  2XFO A;  5M0Z A;  2E1M A;  1F8R A;  1ZY8 A;  2P8C A;  4H4V A;  2XFP A;  3NRN A;  3OZM A;  4H4Z A;  1B4V A;  1IUT A;  3RP6 A;  2Q0L A;  4GAV A;  5BRT A;  3WE0 A;  3SN1 A;  3BHF A;  3DIP A;  1GES A;  3C4A A;  1DXL A;  1QO8 A;  4K2S A;  2GQW A;  5BUL A;  2A87 A;  1WYG A;  3V5C A;  3PWI A;  3UOY A;  3KPF A;  4YSX A;  2QCU A;  3CGD A;  2XLP A;  2ZAD A;  3GRT A;  3AD9 B;  5EOW A;  3II4 A;  4Z25 A;  4P9S A;  1GET A;  2YLS A;  6ENL A;  3D47 A;  2OO6 A;  4DGK A;  2BA9 A;  2WET A;  5C2T A;  4IP5 A;  3TJI A;  2XLR A;  4ZOH B;  2YVJ A;  4APN A;  3HPF A;  4BK3 A;  3NVZ B;  3NVW B;  4OPL A;  3SN4 A;  2VVL A;  2GQF A;  2P3Z A;  4A6N A;  3DJD A;  1NAA A;  4EQS A;  2BXS A;  4GGH A;  2P0I A;  2BCG G;  2YLR A;  4NTD A;  1OJD A;  4ICY A;  3UKK A;  2WP9 A;  2C64 A;  1FL2 A;  1KDG A;  4GIS A;  3R11 A;  2QDE A;  5HHF A;  4JQ9 A;  3AE1 A;  1XS2 A;  3L1R A;  4H2H A;  4YSZ A;  5FJT A;  5HXI A;  1JRP A;  2PP3 A;  3Q9T A;  3IWA A;  4GDP A;  3T4W A;  1GRH A;  2OQY A;  4CY8 A;  1Z6L A;  2XFU A;  4NTE A;  4CNK A;  3FG2 P;  4GYP A;  4ZA0 A;  1L9E A;  3NZG A;  3EF6 A;  3N6J A;  1Q9I A;  4Z43 A;  1VRQ B;  2PYX A;  4H50 A;  4Y4M A;  5IQ1 A;  4KWS A;  2HZG A;  1GTH A;  2C4C A;  1BGN A;  4A99 A;  3SFE A;  1PJ7 A;  3UJR A;  3UKL A;  3NHO X;  3DG3 A;  4B67 A;  3P4S A;  4H2Q A;  2DW7 A;  2FKP A;  2VQB A;  3NS1 B;  2WS3 A;  3LOV A;  3AE5 A;  3V3W A;  1H82 A;  2Z5X A;  4IHC A;  2VRM A;  1TDN A;  1EC8 A;  1P2E A;  5TR3 A;  3K30 A;  1N1P A;  2C70 A;  1CJ2 A;  1K0I A;  4J56 A;  3DFH A;  3KUM A;  4EMJ A;  3F8P A;  2X8G A;  4H1Z A;  3NH3 X;  4U8M A;  2YVF A;  2QGY A;  3IF9 A;  4U8K A;  4K22 A;  1SEZ A;  2WDQ A;  3SY4 A;  2GDQ A;  3DER A;  5CKU A;  1LJ1 A;  3KPK A;  2E5A A;  2APG A;  2I5Q A;  3ALL A;  3I3L A;  4Y4L A;  3CGC A;  2BK5 A;  3AEG A;  3THU A;  1RP0 A;  1PBC A;  1KN0 A;  4CRT A;  1ZK7 A;  4USQ A;  3VA8 A;  1DOE A;  4FI4 A;  5FJU A;  1SJD A;  4FDC B;  3UXL A;  4GME A;  5L46 A;  3CIR A;  5U25 A;  5EBK A;  2CDU A;  3B97 A;  1GND A;  4H2R A;  1GRT A;  1JRX A;  4J33 A;  1JDF A;  4X2P A;  2B9X A;  2I0Z A;  3PO7 A;  4A65 A;  1NEL A;  1JEH A;  4TVY A;  3P1W A;  3UP4 A;  3QSE A;  3BJS A;  4H4T A;  2XH0 A;  4TLX A;  4D04 A;  3BI5 A;  3DDM A;  1PXC A;  4BK1 A;  3ZLH A;  3TWB A;  2CFY A;  1E1K A;  2WOW A;  1GRB A;  3I6D A;  3GYI A;  2V61 A;  2HXU A;  3L5O A;  3MWC A;  1NPX A;  3KU9 A;  1FCD A;  3KA7 A;  2WEU A;  2BXR A;  1ZKQ A;  1ZX9 A;  3IJI A;  1V59 A;  1GXF A;  3AEB A;  2QJM A;  4H2P A;  1TYP A;  2YG4 A;  1MO9 A;  2XVF A;  3P4R A;  1PXA A;  1TYT A;  1H83 A;  1JOA A;  4A6G A;  4IVM B;  3CN8 A;  2PTX A;  3NTA A;  2XVE A;  2XH2 A;  5FS9 A;  5G5H B;  2OZ3 A;  3ATR A;  4NTC A;  3SQS A;  2FJB A;  4HPN A;  1K4Q A;  3DFY A;  3M0O A;  4OVI A;  3FXG A;  4J57 A;  3TJ4 A;  2BC0 A;  3NLC A;  3GWD A;  3ADA B;  2VVM A;  3GSI A;  3V4B A;  5BOF A;  3UP5 A;  2BS3 A;  1W6T A;  2O9Z A;  1XAN A;  4E0V A;  2DKI A;  5KRQ A;  1OJA A;  1YEY A;  3BOX A;  4EWJ A;  2YLW A;  2PSN A;  4H4Q A;  1REO A;  1JNR A;  1S2Q A;  2FJE A;  3NGC X;  1BF3 A;  2JAE A;  2PP1 A;  2NPX A;  3DGZ A;  2PTZ A;  3ICT A;  2DW6 A;  3EPT A;  5GRT A;  4A3R A;  4N9X A;  4DYE A;  2B7S A;  4CBQ A;  2QVH A;  2P8B A;  3L8K A;  2QJJ A;  4BK2 A;  2FBW A;  3QKE A;  2OZ8 A;  1OJ9 A;  3SZW A;  4A7A A;  5EB4 A;  2X8C A;  1H81 A;  3OZY A;  2E4G A;  4Y4N A;  3FPZ A;  1VQZ A;  3ZVH A;  1VDV A;  4U8P A;  3TWA A;  2BAB A;  1XDI A;  2X8H A;  4NWZ A;  3P4Q A;  2WP5 A;  3ICR A;  4JN8 A;  4G73 A;  1GRE A;  3IHM A;  2WU2 A;  4FP1 A;  3HRD C;  1TKK A;  3CND A;  1X31 B;  4X4J A;  5EU9 A;  2XLT A;  4E6M A;  2YG3 A;  5J04 A;  1N60 C;  4H4S A;  2B9Y A;  5JCN A;  1VG9 A;  3LZX A;  4YSY A;  4K1W A;  3VCN A;  2YM2 A;  2R9Z A;  2X99 A;  2JB2 A;  2UZZ A;  1KCZ A;  3ZLF A;  2XYO A;  4IA5 A;  2XVH A;  3ETR B;  3EKG A;  5G5G B;  3PFR A;  2AKZ A;  3VRD B;  4Z2U A;  2XVI A;  1W4X A;  5FJP A;  2WHD A;  1DJQ A;  3GRS A;  1CF3 A;  1QLB A;  4YWO A;  1PBD A;  2WU5 A;  2IVD A;  4EQW A;  3LJP A;  3QVP A;  4DSG A;  3RHA A;  3UCL A;  1D7Y A;  4IZG A; 
#chains in the Genus database with same CATH homology
 4HA6 A;  2GAH B;  1GV4 A;  4YSZ A;  4KX6 A;  2WBA A;  4GR1 A;  1ZOY A;  5HXI A;  1FOH A;  2YAU A;  3AE6 A;  2QA1 A;  3Q9T A;  1DJN A;  3IWA A;  4GDP A;  2BS2 A;  4U8I A;  1TDE A;  3NT6 A;  1GRA A;  3CNJ A;  5JCM A;  1GRH A;  2R4E A;  3NIX A;  1KSU A;  4CY8 A;  2TPR A;  4YTM A;  3QVR A;  2BAC A;  3NK1 X;  1Z6L A;  2XFU A;  1FEB A;  3DH9 A;  2AQJ A;  4NTE A;  3KVE A;  4FK1 A;  3FG2 P;  4K5S A;  4CNK A;  5KNL A;  2R0C A;  3AYI A;  3CGB A;  1L9E A;  2XFN A;  3AE7 A;  3KKJ A;  3UKF A;  3EF6 A;  5IPY A;  2GRT A;  1Q9I A;  4H4W A;  4ZCC A;  4H4P A;  2BK4 A;  4Z43 A;  1NHR A;  1VRQ B;  3GWF A;  2PYX A;  3S61 A;  4H50 A;  4Y4M A;  4BJY A;  3COX A;  4AT0 A;  3CPJ G;  5ER0 A;  4OPG A;  1GRG A;  1B37 A;  4ZCD A;  3NYE A;  1GSN A;  1M6I A;  5IQ1 A;  4JY3 A;  1F3P A;  4A6N B;  2EQ6 A;  1MOK A;  1KFY A;  1GTH A;  2C4C A;  3V3O A;  2QA2 A;  1TDO A;  1BGN A;  5DBJ A;  2RGO A;  3SFD A;  3SFE A;  1PJ7 A;  3UKH A;  4A99 A;  3UKL A;  4X9N A;  5FS8 A;  3ISH A;  3RP7 A;  2XDO A;  4Z2T A;  3AYL A;  1NHS A;  2VVL G;  2Z5Y A;  1E7P A;  3NHO X;  3NK0 X;  3RED A;  2Y6Q A;  3M13 A;  4B67 A;  2WDV A;  2ZZC A;  3DA1 A;  3P4S A;  4TM1 A;  4H2Q A;  3K7Q X;  2VQB A;  4II2 A;  3ALJ A;  2WS3 A;  1CHU A;  3LOV A;  5FS7 A;  3AE5 A;  5EB5 A;  1H82 A;  2Z5X A;  4YXD A;  2RAB A;  2VRM A;  1TDN A;  3FMW A;  4EMW A;  1EL5 A;  4G9K A;  3LXD A;  4JN9 A;  1P2E A;  5TR3 A;  3K30 A;  1N1P A;  1KNR A;  1PBF A;  2YG7 A;  2C70 A;  1IUU A;  2CVJ A;  3SGL A;  4H2N A;  1CJ2 A;  3T31 A;  1K0I A;  5KMR A;  4J56 A;  3G5Q A;  4A79 A;  2YG5 A;  3CPH G;  3GYX A;  4EQR A;  4UDP A;  1N4W A;  1DOD A;  4NEW A;  3ZYX A;  1JU2 A;  2GR3 A;  1LQT A;  1M64 A;  4B66 A;  2AAQ A;  3S5W A;  4C77 A;  1TRB A;  2VQ7 A;  2WP6 A;  1BWC A;  2Q6U A;  4EMJ A;  1GAL A;  1Y56 A;  2X8G A;  2C67 A;  3O0H A;  2DKH A;  3F8P A;  3UOX A;  1P2H A;  2VRL A;  3NH3 X;  4U8M A;  2YVF A;  4G74 A;  2WES A;  1ZDL A;  5KVI A;  3GMC A;  1GRF A;  3T14 A;  3UKP A;  3AXB A;  4RSL A;  3B3R A;  3IF9 A;  4U8K A;  4C3X A;  3OC4 A;  1LTX R;  4K22 A;  1NHQ A;  1SEZ A;  4G6H A;  4GDE A;  2CUL A;  3VQR A;  3BI4 A;  3RNM A;  2WDQ A;  3SY4 A;  4EIQ A;  5CKU A;  4B63 A;  4AT2 A;  1LJ1 A;  1NG3 A;  3AD7 B;  3KPK A;  2APG A;  1VG0 A;  2C65 A;  4U2T A;  4MJW A;  3ALL A;  2ZZ0 A;  1YQ4 A;  3AE2 A;  2JB3 A;  3I3L A;  4Y4L A;  3CGC A;  2BK5 A;  4A9W A;  3AEG A;  4B65 A;  1RP0 A;  3DK8 A;  1PBC A;  1KN0 A;  2XLS A;  3D8X A;  4CRT A;  1ZK7 A;  1JNZ A;  4USQ A;  5BUK A;  5KWF A;  2V6O A;  4H4Y A;  4B1B A;  2B7R A;  1DNC A;  2YWL A;  2C66 A;  1DOE A;  4DSH A;  2OA1 A;  1H6V A;  3BNM A;  3M12 A;  4FDC B;  1ZMD A;  4TM3 A;  3H8L A;  1TDK A;  1KSS A;  2TMD A;  3FIM B;  4X9M A;  3UKQ A;  2R46 A;  4KPR A;  1D4E A;  2X50 A;  5L46 A;  3URH A;  4TM4 A;  3CIR A;  5U63 A;  2ZBW A;  5U25 A;  3AYJ A;  4U8J A;  4XWZ A;  1Q1R A;  2VZ2 A;  1K0J A;  1N4V A;  1CC4 A;  4U8N A;  4U8O A;  5EBK A;  1D5T A;  1E6E A;  2CDU A;  3PG6 A;  2XLU A;  2FJD A;  4C3Y A;  5JRB A;  1GND A;  4H2R A;  3DJJ A;  3KD9 A;  4USR A;  3UTE A;  1GRT A;  1JRX A;  2IID A;  2H89 A;  3AEF A;  1D4C A;  4J33 A;  1PDH A;  3RP8 A;  2YQU A;  5IQ4 A;  2C73 A;  4AOX A;  2GV8 A;  2YR6 A;  4I59 A;  4JNQ A;  2B9X A;  2I0Z A;  3CPI G;  3PO7 A;  4A65 A;  1JEH A;  3P1W A;  4CCR A;  3H8I A;  3UP4 A;  2YLT A;  2EQ8 A;  3QSE A;  3D1C A;  1PBB A;  3SYI A;  3AE8 A;  2VOU A;  4H4T A;  2OAM A;  4PAB A;  4HB9 A;  4OPU A;  2GMJ A;  3AWI A;  4TLX A;  1Q1W A;  2YR5 A;  2BK3 A;  3DK9 A;  4D04 A;  3BI5 A;  1LVL A;  1NEK A;  2X3N A;  3AEC A;  2EQ7 A;  2AR8 A;  1NG4 A;  3SZC A;  1PXC A;  4BK1 A;  4RG3 A;  4AOS A;  1F8S A;  1TDF A;  5CQF A;  1IJH A;  1OJC A;  4IA6 A;  4K8D A;  2CFY A;  4K7Z A;  1E1K A;  2XFQ A;  2WOW A;  2BS4 A;  3CMM A;  1GRB A;  1YQZ A;  4GAP A;  2WOV A;  1DOC A;  4H4U A;  4C5O A;  3PS9 A;  2HQM A;  1L9D A;  3I6D A;  3NTD A;  3NYF A;  1PN0 A;  3GYI A;  5FS6 A;  1GPE A;  1S2Y A;  4C74 A;  2V61 A;  3L5O A;  1EL7 A;  2E5V A;  1NPX A;  1O95 A;  4OPD A;  2YLX A;  4GRT A;  3KU9 A;  1FCD A;  2Y6R A;  3KA7 A;  2WEU A;  4YKG A;  2BXR A;  3PVC A;  1BKW A;  1ZKQ A;  4CNJ A;  1ZX9 A;  3V76 A;  5FMH A;  5U1O A;  2ARD A;  1V59 A;  3HYW A;  4A5L A;  3NKS A;  3K7M X;  3UKA A;  3HYV A;  1GXF A;  2YR4 A;  3AEB A;  3DJE A;  1IUW A;  2B9W A;  2YM1 A;  2NVK X;  1PHH A;  4H2P A;  1TYP A;  3GDP A;  3IC9 A;  2YG4 A;  1MO9 A;  4J36 A;  1Y56 B;  3DME A;  2J3N A;  3SXI A;  1CBO A;  4YTP A;  2XVF A;  3P4R A;  1VQW A;  2OLO A;  2C75 A;  2A89 A;  5J7X A;  2JK6 A;  1PXA A;  1BZL A;  1TYT A;  2OLN A;  3GMB A;  1H83 A;  1S3E A;  1JOA A;  2GB0 A;  3CTY A;  1AOG A;  1NEN A;  2V3A A;  2JKC A;  4IVM B;  1VDC A;  2R0G A;  3CN8 A;  4Z44 A;  3SM8 A;  1MXT A;  2YG6 A;  3D9X A;  3NTA A;  2XVE A;  4J34 A;  1PBE A;  2B76 A;  4JDR A;  5LV9 A;  1DOB A;  1JRY A;  1XPQ A;  3AB1 A;  2XVJ A;  3GYJ A;  5FS9 A;  5JCK A;  3EAO A;  2C72 A;  2BRY A;  4PAA A;  3ATR A;  5KMS A;  1S7M A;  4NTC A;  4O5U A;  3ABV A;  3VRA A;  3KLJ A;  4EIP A;  3AEE A;  1EBD A;  3LZW A;  3VR9 A;  2FJB A;  1ZMC A;  4YT0 A;  4FK1 C;  1K4Q A;  2ZZB A;  4H7U A;  1OJT A;  3OZ2 A;  4GCM A;  1GT8 A;  1XHC A;  1EL9 A;  3M0O A;  4OCG A;  4OVI A;  3SZ0 A;  5HYM A;  1FEC A;  3CGE A;  4J57 A;  3DGH A;  2WPC A;  3VR8 A;  2BC0 A;  3NLC A;  4GF7 A;  1ZP0 A;  2W0H A;  2C76 A;  3ADA B;  2VVM A;  3GWD A;  4H4R A;  2XCG A;  3GSI A;  4NZH A;  4UP3 A;  1GTE A;  3EAN A;  4XWR A;  3V3N A;  3ALM A;  5JCL A;  2BYB A;  3UP5 A;  1L9C A;  2BS3 A;  2WPE A;  3AEA A;  1KNP A;  4B68 A;  4ECH A;  2O9Z A;  4ZN0 A;  1XAN A;  1YKJ A;  4E0V A;  1NDA A;  3UOV A;  2DKI A;  1H7X A;  4U8L A;  5KRQ A;  2RGJ A;  2C7G A;  3FBS A;  1H86 A;  2QAE A;  1OJA A;  1GEU A;  1ONF A;  1H84 A;  3ICS A;  2YLW A;  2V3B A;  4H4Q A;  1YY5 A;  3DJG X;  1ZOV A;  1REO A;  4DNA A;  3ITJ A;  4B64 A;  4Z26 A;  3LB8 A;  1JNR A;  3B6D A;  3NN0 X;  2C3D A;  1S2Q A;  2FJE A;  1D7L A;  3R9U A;  4BV6 A;  3T2K A;  3Q6J A;  2GH5 A;  1UKV G;  3NGC X;  1K0L A;  4TM0 A;  1BF3 A;  4OPI A;  1CJ4 A;  1CL0 A;  2JAE A;  1E1M A;  2NPX A;  4IVO B;  1LPF A;  2GR0 A;  3DGZ A;  3UTF A;  2BRA A;  1PJ5 A;  4EMI A;  3NNE A;  2BC1 A;  2F5Z A;  3F8R A;  3ICT A;  3EPT A;  4GUV A;  4FX9 A;  1HYU A;  3QFA A;  5GRT A;  1B5Q A;  3QSS A;  3IHG A;  4EM4 A;  4N9X A;  3G5S A;  1L0V A;  3NG7 X;  4CY6 A;  3DK4 A;  4JNA A;  1B8S A;  2RGH A;  1H7W A;  4II3 A;  1E1N A;  1JRZ A;  1IUS A;  3SZF A;  2B7S A;  2GR2 A;  3QJ4 A;  4I58 A;  4CBQ A;  4LA1 A;  5C3J A;  4REK A;  4H4X A;  4D03 A;  4WX1 A;  4OPT A;  1BGJ A;  4K2X A;  3L8K A;  3SQP A;  1PS9 A;  1PJ6 A;  1F6M A;  1NHP A;  4BK2 A;  4K5R A;  2EQ9 A;  1CJC A;  2GF3 A;  2FBW A;  3E1T A;  1D4D A;  2R0P A;  3CNP A;  4WCT A;  4RG4 A;  2GMH A;  3HZL A;  1EL8 A;  4YSH A;  1OJ9 A;  5M10 A;  3SZW A;  4A7A A;  1CC2 A;  5EB4 A;  1CJ3 A;  4BUR A;  1GOS A;  2X8C A;  1H81 A;  2GR1 A;  2JBV A;  2XFO A;  2YLZ A;  3BNU A;  3C4N A;  3NK2 X;  4LII A;  2E4G A;  4IV9 A;  4EM3 A;  4Y4N A;  2WDR A;  2E1M A;  1F8R A;  3FPZ A;  5M0Z A;  2PHH A;  1H2I A;  1ZY8 A;  4H4V A;  2XFP A;  5HY5 A;  3GDN A;  3NRN A;  3HYX A;  1FEA A;  4U8P A;  4H4Z A;  1B4V A;  2Q7V A;  2BAB A;  1XDI A;  2R45 A;  1IUT A;  2X8H A;  4NWZ A;  2Q0L A;  4Z24 A;  5KVH A;  4GAV A;  1CC6 A;  1KF6 A;  3P4Q A;  3RP6 A;  3AED A;  5BRT A;  2WP5 A;  3ICR A;  3WE0 A;  3P9U A;  1S3B A;  3BHF A;  2V60 A;  3C96 A;  4G73 A;  2IVE A;  1GRE A;  3IHM A;  2WU2 A;  1GES A;  5KOX A;  3C4A A;  1DXL A;  2BCP A;  4TLZ A;  4U2L A;  1QO8 A;  3T37 A;  2GQW A;  4UDQ A;  4ADW A;  3GD3 A;  4YTN A;  1IUX A;  3CND A;  1X31 B;  4X4J A;  3ZDN A;  5GSN A;  5BUL A;  2A87 A;  2OAL A;  3AE9 A;  2XLT A;  4J2W A;  4EQX A;  3UTH A;  3UOY A;  4Z2R A;  3ATQ A;  3KPF A;  4YSX A;  1QJD A;  2YG3 A;  4H4S A;  1N4U A;  2B9Y A;  4AP3 A;  2QCU A;  1PXB A;  1E39 A;  3P4P A;  3CGD A;  5JCN A;  1VG9 A;  4J31 A;  3LZX A;  3BI2 A;  4XXG A;  2ACZ A;  5J60 A;  4YSY A;  4M52 A;  2XLP A;  3T2Z A;  3CNS A;  2GAG B;  2R4J A;  3GRT A;  3AD9 B;  5EOW A;  1O94 A;  2YM2 A;  3II4 A;  2V5Z A;  4Z25 A;  4G6G A;  4P9S A;  2R9Z A;  2X99 A;  1GET A;  2JB2 A;  2UZZ A;  5JCI A;  2YLS A;  3UOZ A;  4AP1 A;  4JY2 A;  5KMP A;  3JSK A;  3NN6 X;  1Y0P A;  2Q0K A;  2A8X A;  2XYO A;  3F8D A;  3NYC A;  3VRB A;  1IUV A;  4YKF A;  2WQY A;  1O5W A;  4IA5 A;  4DGK A;  2BA9 A;  2WET A;  3G5R A;  2XVH A;  3K7T A;  4BJZ A;  3H4K A;  2GEW A;  2FJA A;  3UTG A;  5C2T A;  1COY A;  4O5Q A;  3SX6 A;  3LAD A;  2XLR A;  3VRD B;  4Z2U A;  3BHK A;  4U2S A;  2YVJ A;  4APN A;  5BVA A;  2XVI A;  1W4X A;  1E1L A;  3T0K A;  2H88 A;  2WHD A;  3AE3 A;  3CNT A;  4BK3 A;  1DJQ A;  5KOW A;  4OPL A;  2VVL A;  2WOI A;  2GQF A;  5KMQ A;  4LU6 A;  4B69 A;  3GRS A;  2WPF A;  5KXJ A;  4OPC A;  1LV0 A;  4A6N A;  3GD4 A;  2JB1 A;  4CCQ A;  3AD8 B;  3DJD A;  4NEV A;  2C3C A;  1CF3 A;  1NAA A;  1YQ3 A;  4EQS A;  3QSM A;  1QLB A;  1F8W A;  4YWO A;  2BXS A;  1PBD A;  1GER A;  2BCG G;  2WU5 A;  2YLR A;  4NTD A;  2GVC A;  3QFB A;  1OJD A;  4ICY A;  4EQW A;  4NNJ A;  2IVD A;  2WP9 A;  2C64 A;  2YVG A;  3UKK A;  1FL2 A;  1KDG A;  3LJP A;  3QVP A;  1RYI A;  3T2Y A;  3AE4 A;  4DSG A;  5HHF A;  1RSG A;  3RHA A;  3UCL A;  1D7Y A;  4JQ9 A;  3AE1 A;  4UDR A;  3L1R A;  1LQU A;  1ELI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...