2V3BA

Crystal structure of the electron transfer complex rubredoxin - rubredoxin reductase from pseudomonas aeruginosa.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
381
structure length
381
Chain Sequence
RAPLVIIGTGLAGYNLAREWRKLDGETPLLMITADDGRSYSKPMLSTGFSKNKDADGLAMAEPGAMAEQLNARILTHTRVTGIDPGHQRIWIGEEEVRYRDLVLAWGAEPIRVPVEGDAQDALYPINDLEDYARFRQAAAGKRRVLLLGAGLIGCEFANDLSSGGYQLDVVAPCEQVMPGLLHPAAAKAVQAGLEGLGVRFHLGPVLASLKKAGEGLEAHLSDGEVIPCDLVVSAVGLRPRTELAFAAGLAVNRGIVVDRSLRTSHANIYALGDCAEVDGLNLLYVMPLMACARALAQTLAGNPSQVAYGPMPVTVKTPACPLVVSPPPRGMDGQWLVEGSGTDLKVLCRDTAGRVIGYALTGAAVNEKLALNKELPGLMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN REDUCTASE
publication title Crystal Structure of the Electron Transfer Complex Rubredoxin - Rubredoxin Reductase from Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 116
structure length 381
sequence length 381
ec nomenclature ec 1.18.1.1: Rubredoxin--NAD(+) reductase.
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
A PF18113 Rbx_binding Rubredoxin binding C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.120 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2v3bA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2v3bA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2v3bA02
5EB4A 1N4WA 2WOVA 3AB1A 1JU2A 1D7LA 3GYJA 3O0HA 4Y4MA 3PO7A 4DNAA 4GF7A 4GR1A 4OPDA 2EQ8A 2XFUA 3DH9A 4BURA 2YQUA 2WEUA 3UKLA 2RGOA 4C5OA 3CNSA 3FBSA 3LB8A 1TDKA 1CF3A 1KSSA 3NYEA 4H4QA 4M52A 4X4JA 3SM8A 4D03A 2GMHA 1ZOYA 3CGEA 3ICRA 4DGKA 4EMJA 2WP9A 2WOIA 3SFEA 1NPXA 5KXJA 4OPUA 1L0VA 1N1PA 4O5UA 3UOVA 1K0LA 1RP0A 2WP5A 4YWOA 1L9DA 5CKUA 5JCKA 5KVHA 3NGCX 1BKWA 2GF3A 1MXTA 1MOKA 2BABA 4K2XA 3F8RA 3P4RA 4OPIA 3UOZA 1JNZA 5J60A 4CNKA 2WBAA 2H89A 2YG3A 1XHCA 1ELIA 2XFPA 2YLSA 1LV0A 1FCDA 1X31B 4APNA 1ZK7A 2J3NA 1LQTA 1Y56B 3T37A 4AOSA 3AWIA 1JRXA 5BUKA 1E1NA 4YT0A 3NHOX 4NTEA 4X9NA 2R4JA 1ONFA 4A99A 3Q9TA 4BJYA 1PHHA 1PS9A 2YVGA 1EL9A 2B9XA 4Z43A 1E39A 2RABA 2ARDA 4H4PA 2XVHA 4H2QA 3VR9A 1EL5A 4TM3A 3I3LA 3UKKA 2B7SA 1D4DA 3IHGA 4NEWA 2WU5A 2YVFA 4JY3A 4EM4A 2R0PA 4KX6A 1D7YA 2AQJA 1PBBA 1IUXA 3DGHA 4K5SA 4XWRA 4RG3A 3GD3A 1E1LA 2EQ9A 4JNQA 2GRTA 1IJHA 1LVLA 2XFQA 2XLRA 5C3JA 4HA6A 5J7XA 3V3OA 1MO9A 3GWFA 2WQYA 3DJDA 4JDRA 3URHA 1H7WA 2PYXA 3CNJA 4HB9A 4H50A 3SQPA 3UKQA 3AE8A 1Q1WA 1ZMDA 3KA7A 1VRQB 3UTEA 3II4A 1YKJA 4OPCA 4BK2A 3CNDA 2V6OA 1E6EA 1OJAA 3S5WA 3K7QX 1HYUA 4UDRA 4BJZA 4YSXA 1S3EA 4WX1A 3LJPA 1OJTA 2WOWA 4IA6A 1TYTA 2FJDA 1TYPA 4TM1A 2X8GA 4H4UA 1B5QA 1CBOA 3EF6A 4LU6A 1GESA 1H81A 1QO8A 3B3RA 4FK1A 3DA1A 4EQXA 2O9ZA 2ZZCA 2BK3A 1TDOA 3BI2A 4YSHA 2XVJA 2Q6UA 4J57A 1EL8A 1KFYA 4A6NB 1GRAA 1EL7A 3GDNA 2V3AA 3WE0A 4U8KA 4X9MA 4C74A 1F3PA 1LPFA 3H8IA 1B37A 3UP5A 2XVEA 1GREA 3F8DA 3P9UA 5JCLA 1GV4A 2FJBA 1BZLA 1NAAA 3NK2X 4Y4LA 4U8PA 3VRDB 4EQSA 2YR5A 3C96A 4C3YA 1CJ2A 1BF3A 2CDUA 3NN6X 3CTYA 4ZCDA 3AEBA 5BRTA 2IIDA 4ZN0A 3AYJA 2WP6A 3IHMA 2WDRA 4H4SA 3GYIA 1CL0A 1GRHA 4FX9A 4B64A 3NK0X 4EIPA 1KSUA 3NG7X 2JK6A 2GR0A 2WESA 3C4NA 1GALA 2Q0KA 3NKSA 4GRTA 1BGNA 4BK1A 3OC4A 3NYFA 2R46A 3EAOA 4CCRA 4Z25A 3PVCA 2EQ7A 2BXRA 3ICSA 5IQ1A 3DJEA 3QFAA 3QSSA 4EMIA 5KWFA 3DK4A 1K4QA 1XDIA 4PABA 4CY8A 4YKGA 1M6IA 4O5QA 2X3NA 3QSEA 5FS8A 1DJQA 1CC4A 3GRTA 1NHSA 2X8HA 1B8SA 1H86A 1PBCA 4B65A 5GRTA 1N4UA 4IVMB 3GMBA 3KPFA 2VQ7A 1YQZA 1FECA 2JB2A 3AEDA 3UTFA 2VQBA 1H84A 3AE7A 3NIXA 4BK3A 1GSNA 4EQWA 2JBVA 5FS6A 2BCGG 2XCGA 1GOSA 1P2HA 2WPFA 2TMDA 1ZX9A 3F8PA 2E5VA 3R9UA 4YSYA 3P4PA 4E0VA 3CNPA 3LOVA 3LZWA 3B6DA 2RGJA 3BI4A 1LTXR 4K7ZA 4YTNA 1D4CA 2GAGB 5KOXA 4UDQA 2NVKX 3CPHG 4TM0A 1TRBA 1F8RA 1DNCA 1K0IA 2C66A 3LADA 3DGZA 4JN9A 1LQUA 5U25A 4C3XA 4H4TA 2FJEA 2W0HA 3AD7B 4KPRA 2A87A 3K30A 3CPIG 3UOXA 4EM3A 1GRGA 2C75A 4ZCCA 2GV8A 4K8DA 4NZHA 1H83A 5FS9A 3RP6A 4H4WA 3BHFA 3D8XA 1D5TA 2E4GA 4YXDA 4NTDA 3KD9A 4TM4A 4TLXA 2C64A 4A9WA 4A79A 3NN0X 3ADAB 1VQWA 3NK1X 3ATRA 4H2NA 1FOHA 4MJWA 3UTHA 1BGJA 4UDPA 2XFNA 2C76A 1NG3A 3NT6A 4B63A 3LZXA 2JB3A 4REKA 1Q9IA 3ISHA 4NEVA 2YG4A 2ZBWA 1S2YA 5JCIA 1PXAA 1EBDA 3AE9A 3DJJA 1IUTA 4H2PA 3KU9A 4ADWA 2H88A 4J2WA 2C70A 5BULA 3S61A 2BXSA 4DSHA 1ZDLA 2VOUA 3AE4A 2GH5A 3EANA 1IUVA 1PBFA 1GERA 3C4AA 1XPQA 2AAQA 2Q7VA 3ICTA 3UKFA 2GEWA 1P2EA 2B9WA 5CQFA 4Z2UA 2BK5A 3K7TA 3RNMA 3SGLA 1JNRA 1DJNA 2I0ZA 3DMEA 3FIMB 4U2LA 2XFOA 5EOWA 1GT8A 2B9YA 2VVLG 3ITJA 4Z44A 1DOEA 1FL2A 4YTMA 2QA1A 2R4EA 2GAHB 1H82A 2YM1A 3RHAA 4H7UA 2IVEA 1REOA 1FEBA 1GNDA 2YLWA 3FPZA 4I59A 3V3NA 4CCQA 1SEZA 5M10A 1KNPA 1M64A 3VRAA 1YQ3A 4XXGA 2R0GA 4A6NA 1YQ4A 1Q1RA 2WHDA 2C65A 3AD8B 4CBQA 1YY5A 2YLRA 1TDFA 2GQFA 4H2RA 4CY6A 3L1RA 4YKFA 1NENA 2XDOA 2DKHA 2YLZA 3AE2A 3NYCA 1L9CA 1RSGA 3AYIA 4LA1A 1COYA 1DXLA 4CNJA 2OLNA 2BK4A 2Z5YA 3K7MX 2QA2A 2XLSA 3AYLA 2WETA 1OJDA 1ZP0A 3UKPA 1GTHA 2GR1A 2C7GA 2YAUA 1IUSA 2WU2A 3GMCA 5M0ZA 1GPEA 2C3DA 3UOYA 4J31A 2ZZBA 1O5WA 2X99A 1PBEA 1V59A 3ALLA 4H4RA 3GRSA 2OAMA 2WDQA 3CNTA 1ZY8A 3IF9A 4WCTA 4AT2A 3QSMA 3GWDA 5IPYA 2V3BA 3AECA 4J33A 2BACA 3VQRA 1L9EA 1JRZA 4NTCA 3ZDNA 4P9SA 2GMJA 1PJ7A 3ABVA 4GUVA 4IA5A 4CRTA 1IUUA 3HZLA 3I6DA 3BI5A 1NHQA 1AOGA 2R0CA 3NTDA 3AE5A 2GVCA 1NEKA 3L8KA 3VR8A 4A65A 4JNAA 4AOXA 1QLBA 1GRTA 2JKCA 4U8LA 2YWLA 3VRBA 5EBKA 2B7RA 4ECHA 2V61A 3IC9A 4USQA 1S2QA 5GSNA 3M12A 3E1TA 2WPEA 4AP3A 3KKJA 1Y0PA 2CULA 3BNUA 2QCUA 1BWCA 2B76A 4U8MA 5HY5A 4IV9A 1DOBA 4EMWA 1JOAA 3QVPA 2APGA 3QFBA 4I58A 2YG5A 2XYOA 4J36A 3P4QA 1CJ3A 4GDEA 2GQWA 3DK9A 2JB1A 4YSZA 4FK1C 2CFYA 2ACZA 1ZMCA 3UP4A 4OCGA 4YTPA 2BA9A 1XANA 1NHPA 2OA1A 1PBDA 4RG4A 4C77A 1CHUA 1PJ6A 2WPCA 1Y56A 2Z5XA 4JQ9A 3NNEA 2NPXA 1PJ5A 1GEUA 5L46A 3G5RA 2C72A 3REDA 2BC0A 2C67A 1NDAA 4B1BA 4H4XA 4DSGA 2BC1A 3H4KA 1E7PA 2XVIA 4N9XA 2BS2A 1PXCA 2YG7A 5U1OA 4U2SA 1QJDA 2VZ2A 4OPGA 1S3BA 1RYIA 2VVLA 4A7AA 4Y4NA 5ER0A 4A5LA 5KOWA 3G5SA 2GB0A 1D4EA 3JSKA 2HQMA 4EIQA 5BVAA 3AXBA 3GSIA 2CVJA 3ZYXA 4U8OA 1TDEA 3CPJG 3AEFA 2QAEA 1KF6A 1LJ1A 3CGCA 4H4ZA 1DODA 2OALA 2YR4A 1CJ4A 3NTAA 4GCMA 1UKVG 5TR3A 2BYBA 4J34A 2C3CA 2UZZA 3BHKA 3D1CA 3IWAA 2R45A 2PHHA 3FMWA 2YG6A 5HHFA 3SFDA 5JCNA 4IVOB 3COXA 3DK8A 4OVIA 2VRMA 4USRA 4B69A 2X8CA 1PDHA 1DOCA 3CGDA 2BCPA 2XLPA 2JAEA 5EB5A 3V76A 3UTGA 3AE1A 1VG9A 3CIRA 3KVEA 3FG2P 1VDCA 3UCLA 2V5ZA 4TLZA 1F6MA 2AR8A 3CGBA 5JCMA 1TDNA 3GD4A 1E1MA 3P1WA 1CC6A 3RP8A 2RGHA 4EQRA 2A89A 3NLCA 4BV6A 4GDPA 2YLTA 2YLXA 5LV9A 2VVMA 5FMHA 1B4VA 1NHRA 1VG0A 2F5ZA 3G5QA 4K22A 2IVDA 1KNRA 1ZOVA 1FEAA 1ZKQA 4Z2RA 3BNMA 4B67A 2XLUA 1NG4A 4UP3A 3UKAA 2GR2A 5U63A 3ALJA 5KVIA 5IQ4A 3OZ2A 2GR3A 3DJGX 3EPTA 2Q0LA 1CJCA 4U8JA 5HYMA 2ZZ0A 3NRNA 1KDGA 3QJ4A 2YR6A 1GETA 2V60A 4AT0A 1K0JA 4PAAA 1W4XA 2EQ6A 4RSLA 4U2TA 1H7XA 3AEGA 4AP1A 2Y6QA 1F8SA 1N4VA 3AEEA 1PN0A 4K5RA 2DKIA 4Z24A 3ATQA 4J56A 2TPRA 4Z2TA 4JY2A 1GRFA 3UKHA 1Z6LA 5C2TA 1E1KA 2BS3A 3H8LA 1OJ9A 3KLJA 1JRYA 2A8XA 4XWZA 4LIIA 1GXFA 2YM2A 1OJCA 3Q6JA 5DBJA 1GRBA 3RP7A 2VRLA 3CN8A 3P4SA 3QVRA 1H6VA 4OPLA 5HXIA 4H4YA 3M0OA 2XLTA 1IUWA 4D04A 3AD9B 3AE6A 2WDVA 2X50A 3GDPA 3M13A 3ALMA 1JEHA 4B66A 2R9ZA 4H4VA 4Z26A 1F8WA 3AE3A 3PS9A 2BS4A 5KRQA 1O94A 1O95A 4OPTA 4U8NA 2FBWA 1CC2A 2Y6RA 5FS7A 3LXDA 4FDCB 1GTEA 2WS3A 3AEAA 2C73A 2OLOA 2XVFA 2YVJA 4B68A 4U8IA 2FJAA 2E1MA 3NH3X 4ICYA 1PXBA
chains in the Genus database with same CATH superfamily
1N4WA 4DNAA 3PO7A 4GR1A 3DH9A 2WEUA 4C5OA 2RGOA 3LB8A 1CF3A 4D03A 1R6WA 1ZOYA 1IYXA 2GGGA 2GMHA 3ICRA 3UJSA 5KMSA 4OPUA 2HXTA 5KVHA 4HN8A 1MXTA 4K2XA 2HZGA 5J60A 2YG3A 2XFPA 3UCDA 1FCDA 4APNA 1Y56B 5BUKA 4DX3A 4BJYA 1PS9A 3IK4A 1E39A 2ARDA 4TM3A 2MNRA 4NEWA 2WU5A 2YVFA 3DGHA 3H70A 4RG3A 2EQ9A 1IJHA 2XFQA 4HA6A 3V3OA 3GWFA 3T0KA 3TW9A 3DJDA 2PS2A 2PYXA 3UKQA 3AE8A 1Q1WA 3STPA 3UTEA 4OPCA 1E6EA 2AL2A 4UDRA 4YSXA 3ZVIA 3VC5A 2FJDA 1TYPA 3DA1A 4HCLA 3DDMA 3MWCA 3BI2A 4YSHA 4A6NB 2PP0A 1GRAA 3EEZA 1F3PA 3NRZB 5JCLA 1BZLA 1NAAA 4Y4LA 3KPKA 3C96A 2PTWA 2CDUA 3CB3A 2IIDA 4FX9A 1CL0A 4B64A 4GRTA 1GALA 3MY9A 4HYRA 1BGNA 3RITA 3EAOA 4EMIA 1XDIA 4PABA 5FS8A 2QGYA 1CC4A 1B8SA 4H83A 1PBCA 5GRTA 3VDGA 4IVMB 3SQSA 2OZTA 2JB2A 1TKKA 3AE7A 4BK3A 4E6MA 2BCGG 2XCGA 1GOSA 1P2HA 1ZX9A 3R9UA 3PG6A 2RGJA 1LTXR 5KOXA 1SJAA 1DNCA 3MSYA 1K0IA 2C66A 4C3XA 2OPJA 4H4TA 2W0HA 4KPRA 3NVVB 1BKHA 4EM3A 3K30A 2C75A 3TWBA 5FS9A 1D5TA 2E4GA 2C4CA 4A79A 3NN0X 3ADAB 3ATRA 2ZC8A 2QVHA 1NG3A 3FV9A 1X2HA 4NEVA 4G9KA 3SN1A 2O56A 2I5QA 1EBGA 1FHUA 3PK7A 3S61A 2GGEA 1GERA 2Q7VA 3UKFA 1P2EA 2B9WA 4IZGA 3I4KA 1DJNA 3FIMB 3V3WA 3TQPA 2VVLG 1ELSA 1DOEA 1H82A 2YM1A 2IVEA 5EU9A 2YLWA 3FPZA 3VCCA 1ONEA 3AD8B 4CY6A 4HNCA 3RO6A 1NENA 3ZVHA 3AE2A 3R11A 1DXLA 5G5GB 2BK4A 3K7MX 3AYLA 1GTHA 1IUSA 3GMCA 2C3DA 1GPEA 4GYPA 2ZZBA 1O5WA 4F4RA 1PBEA 4H4RA 2P8BA 4WCTA 3IF9A 3R0UA 3DIPA 4J1OA 3GWDA 2V3BA 3QSMA 3AECA 4J33A 2BACA 1L9EA 4NTCA 3ZDNA 3I6DA 3HZLA 1AOGA 1NHQA 4KWSA 2R0CA 3NTDA 3L8KA 3VR8A 4A65A 4AOXA 1QLBA 1WYGA 4U8LA 2YWLA 5EBKA 2CHRA 2ZADA 3PWIA 3T2ZA 2PA6A 1S2QA 3E1TA 2QCUA 1BWCA 4U8MA 4IV9A 4EMWA 1JOAA 3QVPA 3P4QA 4YSZA 3DK9A 1ZMCA 1PJ6A 2Z5XA 3NVZB 1N62C 1FHVA 3NNEA 5L46A 1GEUA 1VQZA 2BC0A 4B1BA 3H4KA 3R1ZA 1E7PA 4II2A 4N9XA 2YG7A 1FFVC 4OPGA 1RYIA 2VVLA 3G5SA 3CXOA 2BRYA 2CVJA 1JPMA 3CGCA 4KEMA 3KUMA 2BYBA 2DW7A 3IWAA 2AKZA 1JDFA 2ONEA 1PDZA 2X8CA 2PP3A 3SZCA 1JROA 2BCPA 4IT1A 3UTGA 3AE1A 3CIRA 2AR8A 2PU1A 2NQLA 1CC6A 2RGHA 2A89A 4GDPA 5LV9A 1FFUC 2VVMA 1NHRA 4K22A 3TWAA 1KNRA 5KNLA 3P3BA 1XPYA 1EC9A 1CJCA 3AMZA 2YR6A 4AT0A 1W4XA 4U2TA 1PN0A 3ZVHB 1WUEA 2TPRA 3T31A 4JY2A 2MUCA 1JRYA 3RP7A 1GRBA 2XH7A 4H4YA 2OQYA 4IP4A 3NVWB 2P8CA 1JEHA 3ALMA 3DERA 4J3ZA 4Z26A 4ROPA 3GYXA 3AE3A 3S47A 1O94A 2BRAA 2PSNA 4NWZA 1MUCA 2OLOA 2XVFA 4JNAA 5IDZA 3ETRB 2QAEA 5EB4A 2WOVA 4GISA 3O0HA 1D7LA 1JU2A 3AB1A 3GYJA 5KMQA 4GF7A 3FBSA 1KSSA 3SM8A 3HW2A 2OZ8A 3SFEA 1N1PA 4H19A 3THUA 4O5UA 3UOVA 1L9DA 5CKUA 2GF3A 1MOKA 2BABA 3F8RA 4OPIA 1JNZA 2WBAA 1XHCA 2OKTA 2J3NA 3T37A 3AWIA 1E1NA 1ONFA 1EL9A 2B9XA 4GMEA 4H2QA 3VR9A 4KX6A 4K5SA 3GD3A 1E1LA 2GRTA 1LVLA 2GDQA 5C3JA 3AM9A 1H7WA 2GGIA 4GAVA 3CNJA 4HB9A 1VRQB 4BK2A 4E8GA 3S5WA 4BJZA 1S3EA 4WX1A 1OJTA 3B97A 4IA6A 2X8GA 2W54A 1CBOA 1GESA 3B3RA 4FK1A 1V97A 2XVJA 2Q6UA 4Z1YA 1EL7A 3FCPA 3H8IA 3UP5A 1B37A 1GREA 3F8DA 1GV4A 2FJBA 2GGJA 2YR5A 1CJ2A 3CTYA 3HYVA 2WDRA 4EIPA 3GYIA 1STZA 2WESA 3C4NA 4BK1A 3OC4A 2R46A 4CCRA 1N5XA 3QSSA 3OZMA 4CY8A 1M6IA 1DJQA 3GRTA 2PGEA 4GGHA 3GMBA 2XH4A 3KPFA 3AEDA 3UTFA 3NIXA 2TMDA 2E5VA 4E0VA 3LZWA 3TOYA 4YTNA 2GAGB 1YEYA 3RGTA 3CPHG 4TM0A 1TRBA 3S5SA 3LADA 3DGZA 1MDRA 3PFRA 3AD7B 3PWGA 3CPIG 3UOXA 1H83A 3BHFA 3D8XA 3JVAA 3OPSA 1FOHA 2PGWA 5FJUA 3SYIA 2C76A 3NVYB 3MQTA 3LZXA 1Q9IA 2YG4A 4K2SA 1PXAA 3ENLA 4ADWA 2H88A 4J2WA 2BXSA 1XPQA 1MRAA 3T14A 3N6HA 5CQFA 3K7TA 1BQGA 3RNMA 3RR1A 4E5TA 1JNRA 4KPLA 1GT8A 3ITJA 4YTMA 5J04A 4NNJA 4H7UA 2E5AA 3TJ4A 1GNDA 3V3NA 5FJRA 4I59A 1SEZA 1KNPA 1M64A 3VRAA 1YY5A 4M6UA 3T2KA 4YKFA 1JRPA 2DKHA 2W55A 1RSGA 4EWJA 1T3QC 3GO2A 2WETA 1ZP0A 3UKPA 3QTPA 1EBHA 3HYWA 1V59A 1NU5A 2OAMA 2WDQA 3T9PA 1JRZA 3DFYA 4P9SA 2GMJA 1PJ7A 4IA5A 3GY1A 1IUUA 1NEKA 2JKCA 2QJMA 4HCHA 1RM6B 4USQA 3ES8A 2OQHA 3BOXA 2WPEA 4AP3A 1Y0PA 4G74A 3BNUA 1N5WC 4DXKA 4I58A 4J36A 2GQWA 2JB1A 4MGGA 3SZFA 4G6GA 4YTPA 1EC8A 4C77A 1KKOA 4JQ9A 3TJIA 4ZA0A 2C67A 1NDAA 1SJBA 2BC1A 3OP2A 4Y4NA 4A5LA 3EKGA 3JSKA 2OG9A 3CPJG 3SX6A 3NTAA 1UKVG 4J34A 3BHKA 2OVLA 2R45A 3FMWA 3SFDA 3AN1A 3JZUA 3VA8A 4IP5A 4B69A 1DOCA 3V76A 3FG2P 1VDCA 2V5ZA 1F6MA 3CGBA 1TDNA 2P3ZA 2W3SA 4M0XA 3RP8A 1SB3B 5FMHA 1EC7A 1B4VA 2AL2B 1ZOVA 1XS2A 1ZKQA 3BNMA 4B67A 4GAPA 3UCCA 2GR2A 5IQ4A 3NFUA 2GR3A 1KDGA 1GETA 4KT2A 4PAAA 3L5OA 4G7FA 4AP1A 2Y6QA 1N4VA 4Z24A 4J56A 3FYYA 1Z6LA 5C2TA 1E1KA 2BS3A 3H8LA 3KLJA 2A8XA 3DFHA 4XWZA 4LIIA 1GXFA 3IJLA 2YM2A 2VRLA 5HXIA 3UJ2A 4OPLA 3UXKA 3M0OA 2XLTA 4D04A 3GDPA 2X50A 4B66A 2R9ZA 3PS9A 2BS4A 3A7UA 1R0MA 2FBWA 2Y6RA 5FS7A 4FDCB 1GTEA 2C73A 3D47A 2YVJA 4U8IA 3NH3X 4ICYA 3N4FA 4BURA 3UKLA 4H4QA 3NYEA 4M52A 4EMJA 5KXJA 2WP9A 2WOIA 1K0LA 4YWOA 2GSHA 3NGCX 1BKWA 3P4RA 2YLSA 1ELIA 1X31B 4AOSA 1ZK7A 1P43A 3R10A 4NTEA 4A99A 3Q9TA 1PHHA 2PPGA 2YVGA 4H4PA 3NS1B 3I3LA 3UKKA 3NXLA 1TZZA 3IHGA 1PDYA 4JY3A 4EM4A 3DG7A 1D7YA 1PBBA 3CXBA 4JNQA 2XLRA 5J7XA 3V5FA 1MO9A 4JDRA 1RVKA 3NO1A 4H50A 3ZLFA 3SZ0A 3KA7A 3R25A 1YKJA 5G5HB 2V6OA 1ECQA 1OJAA 3OTRA 3LJPA 4HCDA 1TYTA 4TM1A 1B5QA 3EF6A 4LU6A 4EQXA 1TDOA 5FJOA 4G8TA 1KFYA 1N60C 2V3AA 4IL0A 3WE0A 3DEQA 4C74A 1LPFA 2XVEA 3BSMA 3NK2X 3VRDB 4EQSA 4C3YA 1BF3A 4E4UA 2XH0A 2P88A 5BRTA 3AYJA 2WP6A 4H4SA 3IHMA 2GGHA 3NK0X 2GR0A 3NKSA 4MKSA 2XGZA 3PVCA 2BXRA 4MMWA 5IQ1A 3DJEA 3QFAA 3HPFA 5KWFA 3P93A 3IJQA 1WUFA 4B65A 2X8HA 1H86A 3I6EA 1N4UA 3FXGA 2VQ7A 1YQZA 2E3TA 2VQBA 1H84A 3OZYA 4EQWA 2DW6A 3F8PA 4YSYA 3P4PA 3LOVA 2OFJA 3MUCA 4H1ZA 3BI4A 3CK5A 2AL1A 3MKCA 3V5CA 3CT2A 4JN9A 4DHGA 3GC2A 3ZLGA 2QJJA 4H4WA 2PODA 3JW7A 4NTDA 2C64A 3NK1X 4H2NA 4MJWA 2XFNA 4B63A 2JB3A 4REKA 7ENLA 3ISHA 1H2IA 2ZBWA 1EBDA 3DJJA 1IUTA 4H2PA 3EUB3 2C70A 5BULA 3AE4A 2GH5A 3EANA 1IUVA 1PBFA 2PTXA 2AAQA 3SY4A 3ICTA 2GEWA 4Z2UA 2BK5A 2QDEA 3ES7A 3SSZA 4U2LA 1MDLA 3CYJA 2B9YA 3RHAA 3U9IA 1FEBA 1REOA 5M10A 1F9CA 4XXGA 2R0GA 4A6NA 1YQ4A 1Q1RA 2WHDA 2C65A 4CBQA 2FKPA 2YLRA 1TDFA 2GQFA 3CMMA 2XDOA 2YLZA 3NYCA 3AYIA 4LA1A 1COYA 2OLNA 2Z5YA 2GR1A 2WU2A 5M0ZA 3UOYA 1ZXIC 3ZLHA 2X99A 3GRSA 3CNTA 1ZY8A 5IPYA 3A7AA 3ABVA 4GUVA 4DWDA 1N63C 3BI5A 3AE5A 1GRTA 3VRBA 4ECHA 2V61A 1SJDA 3M12A 3KKJA 2CULA 5HY5A 3QFBA 2APGA 4TVYA 3U4FA 4GDEA 3UJEA 2ACZA 4IHCA 1XANA 1NHPA 2OA1A 3H12A 4ZCWA 3NZGA 1KN0A 1SJCA 2GL5A 3QKEA 3G5RA 2C72A 4H4XA 1PXCA 4GGBA 4U2SA 1QJDA 3V4BA 1JCTA 1S3BA 4A7AA 2QJNA 5ER0A 1DTNA 3H8AA 1D4EA 2HQMA 4EIQA 5FJTA 3AXBA 3GSIA 3ZYXA 1TDEA 3AEFA 4H4ZA 1DODA 2OALA 2YR4A 2OZ3A 4GCMA 1JPDX 2C3CA 3RRAA 2PHHA 5HHFA 2HNEA 3DK8A 4USRA 2VRMA 5EB5A 4A35A 3KVEA 3OW1A 3UCLA 4TLZA 2HXUA 3UJRA 4HPNA 4EQRA 3NLCA 1S7MA 2YLTA 2YLXA 3DESA 1P48A 1FEAA 3TTEA 4Z2RA 2XLUA 1NG4A 5KVIA 3OZ2A 4DYEA 1KD0A 3EPTA 3NRNA 3QJ4A 4X2PA 2V60A 3Q4DA 4RSLA 2EQ6A 2OX4A 1H7XA 3AEGA 3H7VA 1L8PA 4GIRA 1F8SA 4K5RA 2DKIA 3GD6A 3ATQA 4FI4A 1OJ9A 3Q6JA 1OJCA 3CN8A 3P4SA 3T2YA 3SN0A 3QVRA 1IUWA 3FJ4A 3AD9B 3AE6A 3M13A 2WDVA 1F8WA 5KRQA 2OO6A 4FP1A 4OPTA 4A6GA 4YWSA 3CAWA 1CC2A 3Q45A 4H2HA 4B68A 2FJAA 3R07C 1KKRA 1PXBA 4JHMA 5KMPA 4Y4MA 4OPDA 2EQ8A 2XFUA 2YQUA 3CNSA 1KCZA 4X4JA 1TDKA 3CGEA 4DGKA 1NPXA 4Z17A 1L0VA 2WP5A 2POZA 1RP0A 5JCKA 4IL2A 3UOZA 5FJPA 4CNKA 2H89A 4GYPC 1LV0A 4A3RA 1LQTA 1JRXA 4YT0A 2AKMA 3NHOX 4X9NA 2R4JA 3RCYA 2FYMA 3UJFA 2RABA 5ENLA 4Z43A 3SJNA 2XVHA 1EL5A 2B7SA 1D4DA 4K8GA 1X2GA 2R0PA 2AQJA 1IUXA 1VDVA 4XWRA 2WQYA 3URHA 1FO4A 3A7RA 3SQPA 1ZMDA 3II4A 3B9JB 3CNDA 3D9XA 6ENLA 3K7QX 1HYUA 2WOWA 4H4UA 1H81A 1QO8A 2ZZCA 2O9ZA 2BK3A 1NELA 4J57A 1EL8A 3GDNA 3VCNA 4U8KA 4X9MA 3SXIA 3P9UA 2PP1A 4U8PA 3NN6X 4ZCDA 3AEBA 4ZN0A 3R0KA 1GRHA 1KSUA 3NG7X 2JK6A 2Q0KA 2QQ6A 5BOFA 3NYFA 4Z25A 2EQ7A 2QDDA 2P0IA 3ICSA 3DK4A 1K4QA 4YKGA 3BJSA 4O5QA 2X3NA 3QSEA 4G73A 4ZOHB 3QLDA 1NHSA 1FECA 1GSNA 2JBVA 5FS6A 2WPFA 3CNPA 3B6DA 4K7ZA 1D4CA 4UDQA 2NVKX 3VC6A 1F8RA 3IJIA 1LQUA 5U25A 2FJEA 2A87A 2XH2A 1GRGA 4ZCCA 2GV8A 1N61C 4K8DA 4NZHA 3RP6A 4YXDA 3SBFA 3KD9A 4TM4A 4TLXA 4A9WA 1VQWA 3UTHA 1BGJA 4UDPA 3NT6A 3HYXA 1FIQB 1S2YA 4E4FA 5JCIA 3AE9A 3T6CA 3KU9A 4DSHA 3SZWA 4JN7A 1ZDLA 4K1WA 2VOUA 3C4AA 4G6HA 3SGLA 2I0ZA 3DMEA 3T8QA 2XFOA 5EOWA 4Z44A 1W6TA 2PTYA 1FL2A 2QA1A 2R4EA 2GAHB 3N4EA 4CCQA 1YQ3A 4H2RA 3L1RA 1L9CA 2OLAA 4CNJA 2QA2A 2XLSA 1OJDA 2C7GA 2YAUA 4J31A 2XSXA 3N6JA 3ALLA 3P0WA 4AT2A 3D46A 2PCEA 3VQRA 4HNLA 4CRTA 2GVCA 2B7RA 2PMQA 3IC9A 5GSNA 3QN3A 3MZNA 5BOEA 2B76A 2PU0A 1DOBA 2YG5A 2XYOA 1CJ3A 4FK1C 2CFYA 3UP4A 4OCGA 2BA9A 3FVDA 1PBDA 4RG4A 1CHUA 3VFCA 2RDXA 2WPCA 1Y56A 4DN1A 2NPXA 1PJ5A 3REDA 4DSGA 2XVIA 2BS2A 3I6TA 5U1OA 2VZ2A 1OEPA 1E9IA 5KMRA 5KOWA 3K1GA 2GB0A 5BVAA 4U8OA 1KF6A 4TVWA 1LJ1A 1CJ4A 5TR3A 1TE6A 2UZZA 3D1CA 5JCNA 2YG6A 3SN4A 4IVOB 3COXA 4OVIA 1PDHA 3CGDA 2XLPA 2JAEA 3T4WA 3DGBA 1VG9A 1MNSA 4JN8A 5JCMA 3GD4A 1E1MA 3P1WA 4GFIA 4BV6A 1VG0A 2F5ZA 3G5QA 2IVDA 4UP3A 3UKAA 5U63A 3ALJA 3UXLA 3QPEA 3DJGX 2Q0LA 4U8JA 5HYMA 2ZZ0A 1K0JA 3AEEA 2W3RA 3SR6B 3TCSA 4II3A 2PTZA 3DG3A 4Z2TA 1GRFA 3UKHA 4ENLA 5DBJA 1H6VA 5JRBA 3HRDC 4H4VA 3DG6A 1O95A 4U8NA 3LXDA 3UGVA 2WS3A 3AEAA 2E1MA
chains in the Genus database with same CATH topology
5EB4A 1N4WA 5KMPA 2WOVA 3AB1A 3O0HA 1D7LA 1JU2A 4DNAA 3GYJA 3PO7A 4Y4MA 4GF7A 5KMQA 4GR1A 4OPDA 2EQ8A 2XFUA 3DH9A 4BURA 2YQUA 2WEUA 3UKLA 2RGOA 4C5OA 3CNSA 3FBSA 3LB8A 1TDKA 1CF3A 4H4QA 1KSSA 3NYEA 4M52A 4X4JA 3SM8A 4EMJA 2GMHA 3CGEA 1ZOYA 3ICRA 4D03A 4DGKA 2WP9A 2WOIA 3SFEA 1NPXA 5KMSA 5KXJA 4OPUA 1L0VA 1N1PA 4O5UA 3UOVA 2WP5A 1K0LA 4YWOA 1RP0A 1L9DA 5JCKA 5CKUA 5KVHA 3NGCX 1BKWA 2GF3A 1MXTA 1MOKA 2BABA 4K2XA 3F8RA 3P4RA 4OPIA 3UOZA 1JNZA 5J60A 4CNKA 2WBAA 2H89A 2YG3A 1XHCA 1ELIA 2XFPA 2YLSA 1LV0A 1FCDA 1X31B 4APNA 1ZK7A 2J3NA 1LQTA 1Y56B 3T37A 4AOSA 3AWIA 1JRXA 5BUKA 1E1NA 4YT0A 3NHOX 4NTEA 4X9NA 2R4JA 1ONFA 4A99A 3Q9TA 4BJYA 1PHHA 1PS9A 2YVGA 1EL9A 2B9XA 4Z43A 2RABA 1E39A 2ARDA 4H4PA 2XVHA 4H2QA 3VR9A 1EL5A 4TM3A 3I3LA 3UKKA 2B7SA 1D4DA 3IHGA 4NEWA 2WU5A 2YVFA 4JY3A 4EM4A 2R0PA 4KX6A 1D7YA 2AQJA 1PBBA 1IUXA 3DGHA 4K5SA 4XWRA 4RG3A 3GD3A 2EQ9A 1E1LA 4JNQA 2GRTA 1LVLA 1IJHA 2XFQA 2XLRA 5C3JA 4HA6A 5J7XA 3V3OA 1MO9A 3GWFA 3T0KA 2WQYA 3DJDA 4JDRA 3URHA 1H7WA 2PYXA 4GAVA 3CNJA 4HB9A 4H50A 3SQPA 3UKQA 3AE8A 1Q1WA 1ZMDA 3KA7A 3SZ0A 1VRQB 3UTEA 3II4A 1YKJA 4OPCA 4BK2A 3CNDA 2V6OA 3D9XA 1E6EA 1OJAA 3S5WA 3K7QX 1HYUA 4UDRA 4BJZA 4YSXA 1S3EA 4WX1A 3LJPA 1OJTA 2WOWA 4IA6A 1TYTA 2FJDA 1TYPA 4TM1A 2X8GA 4H4UA 1B5QA 1CBOA 3EF6A 4LU6A 1GESA 1H81A 1QO8A 3B3RA 4FK1A 3DA1A 4EQXA 2ZZCA 2O9ZA 2BK3A 1TDOA 3BI2A 4YSHA 2XVJA 2Q6UA 4J57A 1EL8A 1KFYA 4A6NB 1GRAA 1EL7A 3GDNA 2V3AA 3WE0A 4U8KA 4X9MA 4C74A 3SXIA 1F3PA 1LPFA 3H8IA 1B37A 3UP5A 2XVEA 1GREA 3F8DA 3P9UA 5JCLA 1GV4A 1BZLA 2FJBA 1NAAA 3NK2X 4Y4LA 4U8PA 3VRDB 4EQSA 3KPKA 2YR5A 3C96A 4C3YA 1CJ2A 1BF3A 2CDUA 3NN6X 3CTYA 4ZCDA 3AEBA 3HYVA 2IIDA 4ZN0A 5BRTA 3AYJA 2WP6A 4H4SA 2WDRA 3IHMA 3GYIA 4FX9A 1GRHA 1CL0A 4B64A 3NK0X 4EIPA 1KSUA 3NG7X 2JK6A 2GR0A 4GRTA 2WESA 1GALA 2Q0KA 3C4NA 3NKSA 1BGNA 4BK1A 3OC4A 3NYFA 3EAOA 2R46A 4CCRA 4Z25A 3PVCA 2EQ7A 2BXRA 3ICSA 5IQ1A 4EMIA 3QFAA 3DJEA 3QSSA 5KWFA 3DK4A 1K4QA 1XDIA 4PABA 4CY8A 4YKGA 1M6IA 4O5QA 2X3NA 3QSEA 5FS8A 1DJQA 4G73A 1CC4A 3GRTA 1NHSA 2X8HA 1B8SA 1H86A 1PBCA 4B65A 5GRTA 1N4UA 4IVMB 3GMBA 3KPFA 2VQ7A 1YQZA 1FECA 2JB2A 3AEDA 3UTFA 2VQBA 1H84A 3AE7A 3NIXA 4BK3A 1GSNA 4EQWA 2JBVA 5FS6A 2BCGG 2XCGA 2WPFA 1GOSA 1P2HA 2TMDA 1ZX9A 3F8PA 2E5VA 3R9UA 4YSYA 3P4PA 4E0VA 3CNPA 3LOVA 3LZWA 3B6DA 3PG6A 2RGJA 3BI4A 1LTXR 4K7ZA 4YTNA 1D4CA 2GAGB 5KOXA 4UDQA 2NVKX 3CPHG 4TM0A 1TRBA 1F8RA 1DNCA 1K0IA 2C66A 3LADA 3DGZA 4JN9A 1LQUA 5U25A 4C3XA 4H4TA 2W0HA 4KPRA 2FJEA 3AD7B 2A87A 4EM3A 3CPIG 3K30A 3UOXA 1GRGA 2C75A 4ZCCA 2GV8A 4K8DA 4NZHA 1H83A 5FS9A 3RP6A 4H4WA 3BHFA 3D8XA 1D5TA 2E4GA 4YXDA 4NTDA 2C4CA 3KD9A 4TM4A 4TLXA 2C64A 4A9WA 4A79A 3NN0X 3ADAB 1VQWA 3NK1X 3ATRA 4H2NA 1FOHA 4MJWA 3UTHA 1BGJA 4UDPA 2XFNA 3SYIA 2C76A 1NG3A 3NT6A 4B63A 3LZXA 2JB3A 4REKA 3HYXA 1Q9IA 3ISHA 4NEVA 1H2IA 2YG4A 2ZBWA 1S2YA 4G9KA 5JCIA 1PXAA 1EBDA 3AE9A 3DJJA 1IUTA 4ADWA 3KU9A 4H2PA 2H88A 4J2WA 2C70A 5BULA 3S61A 2BXSA 4DSHA 3SZWA 1ZDLA 2VOUA 3AE4A 2GH5A 3EANA 1IUVA 1PBFA 1GERA 3C4AA 1XPQA 4G6HA 2AAQA 3SY4A 2Q7VA 3ICTA 3UKFA 2GEWA 3T14A 1P2EA 2B9WA 5CQFA 4Z2UA 3RNMA 2BK5A 3K7TA 3SGLA 1JNRA 1DJNA 2I0ZA 3DMEA 3FIMB 4U2LA 2XFOA 5EOWA 1GT8A 2B9YA 2VVLG 3ITJA 4Z44A 1DOEA 1FL2A 4YTMA 2QA1A 2R4EA 4NNJA 2GAHB 1H82A 2YM1A 3RHAA 4H7UA 2IVEA 1REOA 1FEBA 1GNDA 2YLWA 3FPZA 4I59A 3V3NA 4CCQA 1SEZA 5M10A 1KNPA 1M64A 3VRAA 1YQ3A 4XXGA 2R0GA 4A6NA 1YQ4A 1Q1RA 2WHDA 2C65A 3AD8B 4CBQA 1YY5A 2YLRA 1TDFA 2GQFA 4H2RA 3T2KA 4CY6A 3L1RA 3CMMA 1NENA 4YKFA 2XDOA 2DKHA 2YLZA 3AE2A 3NYCA 1L9CA 1RSGA 3AYIA 4LA1A 1COYA 1DXLA 4CNJA 2OLNA 2BK4A 2Z5YA 3K7MX 2QA2A 2XLSA 3AYLA 2WETA 1OJDA 1ZP0A 3UKPA 1GTHA 2GR1A 2C7GA 2YAUA 1IUSA 2WU2A 3GMCA 5M0ZA 2C3DA 1GPEA 3UOYA 4J31A 2ZZBA 1O5WA 3HYWA 2X99A 1PBEA 1V59A 3ALLA 4H4RA 3GRSA 2OAMA 2WDQA 3CNTA 1ZY8A 3IF9A 4WCTA 4AT2A 3QSMA 3GWDA 5IPYA 2V3BA 3AECA 4J33A 2BACA 3VQRA 1L9EA 1JRZA 4NTCA 3ZDNA 4P9SA 2GMJA 1PJ7A 3ABVA 4GUVA 4IA5A 4CRTA 1IUUA 3HZLA 1AOGA 3BI5A 1NHQA 3I6DA 2R0CA 3NTDA 3AE5A 2GVCA 3L8KA 1NEKA 3VR8A 4A65A 4JNAA 4AOXA 1QLBA 1GRTA 2JKCA 4U8LA 2YWLA 3VRBA 5EBKA 2B7RA 4ECHA 2V61A 3T2ZA 3IC9A 4USQA 1S2QA 5GSNA 3M12A 3E1TA 2WPEA 4AP3A 3KKJA 1Y0PA 2CULA 4G74A 3BNUA 2QCUA 1BWCA 2B76A 4U8MA 5HY5A 4IV9A 4EMWA 1DOBA 1JOAA 3QVPA 3QFBA 2APGA 4I58A 2YG5A 2XYOA 4J36A 3P4QA 1CJ3A 4GDEA 2GQWA 3DK9A 2JB1A 4YSZA 3SZFA 4FK1C 2CFYA 2ACZA 1ZMCA 4G6GA 3UP4A 4OCGA 4YTPA 2BA9A 1XANA 1NHPA 2OA1A 1PBDA 4RG4A 4C77A 1CHUA 1PXBA 1PJ6A 1KN0A 2WPCA 1Y56A 2Z5XA 4JQ9A 3NNEA 2NPXA 1PJ5A 1GEUA 5L46A 3G5RA 2C72A 3REDA 2BC0A 2C67A 1NDAA 4B1BA 4H4XA 4DSGA 2BC1A 3H4KA 1E7PA 2XVIA 4II2A 4N9XA 2BS2A 1PXCA 5U1OA 2YG7A 4U2SA 1QJDA 2VZ2A 4OPGA 1S3BA 1RYIA 2VVLA 5KMRA 4A7AA 4Y4NA 5ER0A 4A5LA 5KOWA 3G5SA 2GB0A 1D4EA 3JSKA 2HQMA 4EIQA 5BVAA 2BRYA 3AXBA 3GSIA 2CVJA 3ZYXA 4U8OA 1TDEA 3CPJG 3AEFA 3SX6A 1KF6A 1LJ1A 3CGCA 4H4ZA 1DODA 2OALA 2YR4A 1CJ4A 3NTAA 4GCMA 5TR3A 1UKVG 2BYBA 4J34A 2C3CA 2UZZA 3BHKA 3D1CA 5JCNA 2R45A 2PHHA 3FMWA 2YG6A 3IWAA 5HHFA 3SFDA 4IVOB 3COXA 3DK8A 4OVIA 2VRMA 4USRA 4B69A 2X8CA 1PDHA 1DOCA 3CGDA 3SZCA 2BCPA 2XLPA 2JAEA 5EB5A 3V76A 3UTGA 3AE1A 1VG9A 3CIRA 3KVEA 3FG2P 1VDCA 3UCLA 2V5ZA 4TLZA 1F6MA 2AR8A 3CGBA 5JCMA 1TDNA 3GD4A 1E1MA 3P1WA 1CC6A 3RP8A 2RGHA 4EQRA 2A89A 3NLCA 4BV6A 4GDPA 1S7MA 2YLTA 2YLXA 5LV9A 2VVMA 5FMHA 1B4VA 1NHRA 1VG0A 2F5ZA 3G5QA 4K22A 2IVDA 1KNRA 1ZOVA 5KNLA 1FEAA 1ZKQA 4Z2RA 3BNMA 4B67A 4GAPA 2XLUA 1NG4A 4UP3A 3UKAA 2GR2A 5U63A 3ALJA 5KVIA 5IQ4A 3OZ2A 2GR3A 3DJGX 3EPTA 2Q0LA 1CJCA 4U8JA 5HYMA 2ZZ0A 3NRNA 1KDGA 3QJ4A 2YR6A 1GETA 2V60A 4AT0A 1K0JA 4PAAA 2EQ6A 3L5OA 1W4XA 4RSLA 4U2TA 1H7XA 3AEGA 4AP1A 2Y6QA 1F8SA 1N4VA 3AEEA 1PN0A 4K5RA 2DKIA 4Z24A 4J56A 3ATQA 4II3A 2TPRA 3T31A 4Z2TA 4JY2A 1GRFA 3UKHA 1Z6LA 5C2TA 1E1KA 2BS3A 3H8LA 1OJ9A 3KLJA 1JRYA 2A8XA 4XWZA 4LIIA 1GXFA 3Q6JA 1OJCA 2YM2A 5DBJA 1GRBA 3RP7A 2VRLA 3CN8A 3P4SA 3T2YA 3QVRA 1H6VA 4OPLA 5HXIA 4H4YA 5JRBA 3M0OA 2XLTA 1IUWA 4D04A 3AD9B 3AE6A 2WDVA 2X50A 3GDPA 3M13A 3ALMA 1JEHA 4B66A 2R9ZA 4H4VA 4Z26A 1F8WA 3GYXA 3AE3A 3PS9A 2BS4A 5KRQA 1O94A 1O95A 4OPTA 4U8NA 2BRAA 2FBWA 1CC2A 2Y6RA 5FS7A 3LXDA 4FDCB 1GTEA 2WS3A 3AEAA 4NWZA 2C73A 2YVJA 2OLOA 2XVFA 4B68A 4U8IA 2FJAA 2E1MA 3NH3X 4ICYA 2QAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EB4 A;  1N4W A;  2WOV A;  3AB1 A;  1JU2 A;  1D7L A;  3GYJ A;  3O0H A;  4Y4M A;  3PO7 A;  4DNA A;  4GF7 A;  4GR1 A;  4OPD A;  2EQ8 A;  2XFU A;  3DH9 A;  4BUR A;  2YQU A;  2WEU A;  3UKL A;  2RGO A;  4C5O A;  3CNS A;  3FBS A;  3LB8 A;  1TDK A;  1CF3 A;  1KSS A;  3NYE A;  4H4Q A;  4M52 A;  4X4J A;  3SM8 A;  4D03 A;  2GMH A;  1ZOY A;  3CGE A;  3ICR A;  4DGK A;  4EMJ A;  2WP9 A;  2WOI A;  3SFE A;  1NPX A;  5KXJ A;  4OPU A;  1L0V A;  1N1P A;  4O5U A;  3UOV A;  1K0L A;  1RP0 A;  2WP5 A;  4YWO A;  1L9D A;  5CKU A;  5JCK A;  5KVH A;  3NGC X;  1BKW A;  2GF3 A;  1MXT A;  1MOK A;  2BAB A;  4K2X A;  3F8R A;  3P4R A;  4OPI A;  3UOZ A;  1JNZ A;  5J60 A;  4CNK A;  2WBA A;  2H89 A;  2YG3 A;  1XHC A;  1ELI A;  2XFP A;  2YLS A;  1LV0 A;  1FCD A;  1X31 B;  4APN A;  1ZK7 A;  2J3N A;  1LQT A;  1Y56 B;  3T37 A;  4AOS A;  3AWI A;  1JRX A;  5BUK A;  1E1N A;  4YT0 A;  3NHO X;  4NTE A;  4X9N A;  2R4J A;  1ONF A;  4A99 A;  3Q9T A;  4BJY A;  1PHH A;  1PS9 A;  2YVG A;  1EL9 A;  2B9X A;  4Z43 A;  1E39 A;  2RAB A;  2ARD A;  4H4P A;  2XVH A;  4H2Q A;  3VR9 A;  1EL5 A;  4TM3 A;  3I3L A;  3UKK A;  2B7S A;  1D4D A;  3IHG A;  4NEW A;  2WU5 A;  2YVF A;  4JY3 A;  4EM4 A;  2R0P A;  4KX6 A;  1D7Y A;  2AQJ A;  1PBB A;  1IUX A;  3DGH A;  4K5S A;  4XWR A;  4RG3 A;  3GD3 A;  1E1L A;  2EQ9 A;  4JNQ A;  2GRT A;  1IJH A;  1LVL A;  2XFQ A;  2XLR A;  5C3J A;  4HA6 A;  5J7X A;  3V3O A;  1MO9 A;  3GWF A;  2WQY A;  3DJD A;  4JDR A;  3URH A;  1H7W A;  2PYX A;  3CNJ A;  4HB9 A;  4H50 A;  3SQP A;  3UKQ A;  3AE8 A;  1Q1W A;  1ZMD A;  3KA7 A;  1VRQ B;  3UTE A;  3II4 A;  1YKJ A;  4OPC A;  4BK2 A;  3CND A;  2V6O A;  1E6E A;  1OJA A;  3S5W A;  3K7Q X;  1HYU A;  4UDR A;  4BJZ A;  4YSX A;  1S3E A;  4WX1 A;  3LJP A;  1OJT A;  2WOW A;  4IA6 A;  1TYT A;  2FJD A;  1TYP A;  4TM1 A;  2X8G A;  4H4U A;  1B5Q A;  1CBO A;  3EF6 A;  4LU6 A;  1GES A;  1H81 A;  1QO8 A;  3B3R A;  4FK1 A;  3DA1 A;  4EQX A;  2O9Z A;  2ZZC A;  2BK3 A;  1TDO A;  3BI2 A;  4YSH A;  2XVJ A;  2Q6U A;  4J57 A;  1EL8 A;  1KFY A;  4A6N B;  1GRA A;  1EL7 A;  3GDN A;  2V3A A;  3WE0 A;  4U8K A;  4X9M A;  4C74 A;  1F3P A;  1LPF A;  3H8I A;  1B37 A;  3UP5 A;  2XVE A;  1GRE A;  3F8D A;  3P9U A;  5JCL A;  1GV4 A;  2FJB A;  1BZL A;  1NAA A;  3NK2 X;  4Y4L A;  4U8P A;  3VRD B;  4EQS A;  2YR5 A;  3C96 A;  4C3Y A;  1CJ2 A;  1BF3 A;  2CDU A;  3NN6 X;  3CTY A;  4ZCD A;  3AEB A;  5BRT A;  2IID A;  4ZN0 A;  3AYJ A;  2WP6 A;  3IHM A;  2WDR A;  4H4S A;  3GYI A;  1CL0 A;  1GRH A;  4FX9 A;  4B64 A;  3NK0 X;  4EIP A;  1KSU A;  3NG7 X;  2JK6 A;  2GR0 A;  2WES A;  3C4N A;  1GAL A;  2Q0K A;  3NKS A;  4GRT A;  1BGN A;  4BK1 A;  3OC4 A;  3NYF A;  2R46 A;  3EAO A;  4CCR A;  4Z25 A;  3PVC A;  2EQ7 A;  2BXR A;  3ICS A;  5IQ1 A;  3DJE A;  3QFA A;  3QSS A;  4EMI A;  5KWF A;  3DK4 A;  1K4Q A;  1XDI A;  4PAB A;  4CY8 A;  4YKG A;  1M6I A;  4O5Q A;  2X3N A;  3QSE A;  5FS8 A;  1DJQ A;  1CC4 A;  3GRT A;  1NHS A;  2X8H A;  1B8S A;  1H86 A;  1PBC A;  4B65 A;  5GRT A;  1N4U A;  4IVM B;  3GMB A;  3KPF A;  2VQ7 A;  1YQZ A;  1FEC A;  2JB2 A;  3AED A;  3UTF A;  2VQB A;  1H84 A;  3AE7 A;  3NIX A;  4BK3 A;  1GSN A;  4EQW A;  2JBV A;  5FS6 A;  2BCG G;  2XCG A;  1GOS A;  1P2H A;  2WPF A;  2TMD A;  1ZX9 A;  3F8P A;  2E5V A;  3R9U A;  4YSY A;  3P4P A;  4E0V A;  3CNP A;  3LOV A;  3LZW A;  3B6D A;  2RGJ A;  3BI4 A;  1LTX R;  4K7Z A;  4YTN A;  1D4C A;  2GAG B;  5KOX A;  4UDQ A;  2NVK X;  3CPH G;  4TM0 A;  1TRB A;  1F8R A;  1DNC A;  1K0I A;  2C66 A;  3LAD A;  3DGZ A;  4JN9 A;  1LQU A;  5U25 A;  4C3X A;  4H4T A;  2FJE A;  2W0H A;  3AD7 B;  4KPR A;  2A87 A;  3K30 A;  3CPI G;  3UOX A;  4EM3 A;  1GRG A;  2C75 A;  4ZCC A;  2GV8 A;  4K8D A;  4NZH A;  1H83 A;  5FS9 A;  3RP6 A;  4H4W A;  3BHF A;  3D8X A;  1D5T A;  2E4G A;  4YXD A;  4NTD A;  3KD9 A;  4TM4 A;  4TLX A;  2C64 A;  4A9W A;  4A79 A;  3NN0 X;  3ADA B;  1VQW A;  3NK1 X;  3ATR A;  4H2N A;  1FOH A;  4MJW A;  3UTH A;  1BGJ A;  4UDP A;  2XFN A;  2C76 A;  1NG3 A;  3NT6 A;  4B63 A;  3LZX A;  2JB3 A;  4REK A;  1Q9I A;  3ISH A;  4NEV A;  2YG4 A;  2ZBW A;  1S2Y A;  5JCI A;  1PXA A;  1EBD A;  3AE9 A;  3DJJ A;  1IUT A;  4H2P A;  3KU9 A;  4ADW A;  2H88 A;  4J2W A;  2C70 A;  5BUL A;  3S61 A;  2BXS A;  4DSH A;  1ZDL A;  2VOU A;  3AE4 A;  2GH5 A;  3EAN A;  1IUV A;  1PBF A;  1GER A;  3C4A A;  1XPQ A;  2AAQ A;  2Q7V A;  3ICT A;  3UKF A;  2GEW A;  1P2E A;  2B9W A;  5CQF A;  4Z2U A;  2BK5 A;  3K7T A;  3RNM A;  3SGL A;  1JNR A;  1DJN A;  2I0Z A;  3DME A;  3FIM B;  4U2L A;  2XFO A;  5EOW A;  1GT8 A;  2B9Y A;  2VVL G;  3ITJ A;  4Z44 A;  1DOE A;  1FL2 A;  4YTM A;  2QA1 A;  2R4E A;  2GAH B;  1H82 A;  2YM1 A;  3RHA A;  4H7U A;  2IVE A;  1REO A;  1FEB A;  1GND A;  2YLW A;  3FPZ A;  4I59 A;  3V3N A;  4CCQ A;  1SEZ A;  5M10 A;  1KNP A;  1M64 A;  3VRA A;  1YQ3 A;  4XXG A;  2R0G A;  4A6N A;  1YQ4 A;  1Q1R A;  2WHD A;  2C65 A;  3AD8 B;  4CBQ A;  1YY5 A;  2YLR A;  1TDF A;  2GQF A;  4H2R A;  4CY6 A;  3L1R A;  4YKF A;  1NEN A;  2XDO A;  2DKH A;  2YLZ A;  3AE2 A;  3NYC A;  1L9C A;  1RSG A;  3AYI A;  4LA1 A;  1COY A;  1DXL A;  4CNJ A;  2OLN A;  2BK4 A;  2Z5Y A;  3K7M X;  2QA2 A;  2XLS A;  3AYL A;  2WET A;  1OJD A;  1ZP0 A;  3UKP A;  1GTH A;  2GR1 A;  2C7G A;  2YAU A;  1IUS A;  2WU2 A;  3GMC A;  5M0Z A;  1GPE A;  2C3D A;  3UOY A;  4J31 A;  2ZZB A;  1O5W A;  2X99 A;  1PBE A;  1V59 A;  3ALL A;  4H4R A;  3GRS A;  2OAM A;  2WDQ A;  3CNT A;  1ZY8 A;  3IF9 A;  4WCT A;  4AT2 A;  3QSM A;  3GWD A;  5IPY A;  2V3B A;  3AEC A;  4J33 A;  2BAC A;  3VQR A;  1L9E A;  1JRZ A;  4NTC A;  3ZDN A;  4P9S A;  2GMJ A;  1PJ7 A;  3ABV A;  4GUV A;  4IA5 A;  4CRT A;  1IUU A;  3HZL A;  3I6D A;  3BI5 A;  1NHQ A;  1AOG A;  2R0C A;  3NTD A;  3AE5 A;  2GVC A;  1NEK A;  3L8K A;  3VR8 A;  4A65 A;  4JNA A;  4AOX A;  1QLB A;  1GRT A;  2JKC A;  4U8L A;  2YWL A;  3VRB A;  5EBK A;  2B7R A;  4ECH A;  2V61 A;  3IC9 A;  4USQ A;  1S2Q A;  5GSN A;  3M12 A;  3E1T A;  2WPE A;  4AP3 A;  3KKJ A;  1Y0P A;  2CUL A;  3BNU A;  2QCU A;  1BWC A;  2B76 A;  4U8M A;  5HY5 A;  4IV9 A;  1DOB A;  4EMW A;  1JOA A;  3QVP A;  2APG A;  3QFB A;  4I58 A;  2YG5 A;  2XYO A;  4J36 A;  3P4Q A;  1CJ3 A;  4GDE A;  2GQW A;  3DK9 A;  2JB1 A;  4YSZ A;  4FK1 C;  2CFY A;  2ACZ A;  1ZMC A;  3UP4 A;  4OCG A;  4YTP A;  2BA9 A;  1XAN A;  1NHP A;  2OA1 A;  1PBD A;  4RG4 A;  4C77 A;  1CHU A;  1PJ6 A;  2WPC A;  1Y56 A;  2Z5X A;  4JQ9 A;  3NNE A;  2NPX A;  1PJ5 A;  1GEU A;  5L46 A;  3G5R A;  2C72 A;  3RED A;  2BC0 A;  2C67 A;  1NDA A;  4B1B A;  4H4X A;  4DSG A;  2BC1 A;  3H4K A;  1E7P A;  2XVI A;  4N9X A;  2BS2 A;  1PXC A;  2YG7 A;  5U1O A;  4U2S A;  1QJD A;  2VZ2 A;  4OPG A;  1S3B A;  1RYI A;  2VVL A;  4A7A A;  4Y4N A;  5ER0 A;  4A5L A;  5KOW A;  3G5S A;  2GB0 A;  1D4E A;  3JSK A;  2HQM A;  4EIQ A;  5BVA A;  3AXB A;  3GSI A;  2CVJ A;  3ZYX A;  4U8O A;  1TDE A;  3CPJ G;  3AEF A;  2QAE A;  1KF6 A;  1LJ1 A;  3CGC A;  4H4Z A;  1DOD A;  2OAL A;  2YR4 A;  1CJ4 A;  3NTA A;  4GCM A;  1UKV G;  5TR3 A;  2BYB A;  4J34 A;  2C3C A;  2UZZ A;  3BHK A;  3D1C A;  3IWA A;  2R45 A;  2PHH A;  3FMW A;  2YG6 A;  5HHF A;  3SFD A;  5JCN A;  4IVO B;  3COX A;  3DK8 A;  4OVI A;  2VRM A;  4USR A;  4B69 A;  2X8C A;  1PDH A;  1DOC A;  3CGD A;  2BCP A;  2XLP A;  2JAE A;  5EB5 A;  3V76 A;  3UTG A;  3AE1 A;  1VG9 A;  3CIR A;  3KVE A;  3FG2 P;  1VDC A;  3UCL A;  2V5Z A;  4TLZ A;  1F6M A;  2AR8 A;  3CGB A;  5JCM A;  1TDN A;  3GD4 A;  1E1M A;  3P1W A;  1CC6 A;  3RP8 A;  2RGH A;  4EQR A;  2A89 A;  3NLC A;  4BV6 A;  4GDP A;  2YLT A;  2YLX A;  5LV9 A;  2VVM A;  5FMH A;  1B4V A;  1NHR A;  1VG0 A;  2F5Z A;  3G5Q A;  4K22 A;  2IVD A;  1KNR A;  1ZOV A;  1FEA A;  1ZKQ A;  4Z2R A;  3BNM A;  4B67 A;  2XLU A;  1NG4 A;  4UP3 A;  3UKA A;  2GR2 A;  5U63 A;  3ALJ A;  5KVI A;  5IQ4 A;  3OZ2 A;  2GR3 A;  3DJG X;  3EPT A;  2Q0L A;  1CJC A;  4U8J A;  5HYM A;  2ZZ0 A;  3NRN A;  1KDG A;  3QJ4 A;  2YR6 A;  1GET A;  2V60 A;  4AT0 A;  1K0J A;  4PAA A;  1W4X A;  2EQ6 A;  4RSL A;  4U2T A;  1H7X A;  3AEG A;  4AP1 A;  2Y6Q A;  1F8S A;  1N4V A;  3AEE A;  1PN0 A;  4K5R A;  2DKI A;  4Z24 A;  3ATQ A;  4J56 A;  2TPR A;  4Z2T A;  4JY2 A;  1GRF A;  3UKH A;  1Z6L A;  5C2T A;  1E1K A;  2BS3 A;  3H8L A;  1OJ9 A;  3KLJ A;  1JRY A;  2A8X A;  4XWZ A;  4LII A;  1GXF A;  2YM2 A;  1OJC A;  3Q6J A;  5DBJ A;  1GRB A;  3RP7 A;  2VRL A;  3CN8 A;  3P4S A;  3QVR A;  1H6V A;  4OPL A;  5HXI A;  4H4Y A;  3M0O A;  2XLT A;  1IUW A;  4D04 A;  3AD9 B;  3AE6 A;  2WDV A;  2X50 A;  3GDP A;  3M13 A;  3ALM A;  1JEH A;  4B66 A;  2R9Z A;  4H4V A;  4Z26 A;  1F8W A;  3AE3 A;  3PS9 A;  2BS4 A;  5KRQ A;  1O94 A;  1O95 A;  4OPT A;  4U8N A;  2FBW A;  1CC2 A;  2Y6R A;  5FS7 A;  3LXD A;  4FDC B;  1GTE A;  2WS3 A;  3AEA A;  2C73 A;  2OLO A;  2XVF A;  2YVJ A;  4B68 A;  4U8I A;  2FJA A;  2E1M A;  3NH3 X;  4ICY A;  1PXB A; 
#chains in the Genus database with same CATH topology
 1N4W A;  4DNA A;  3PO7 A;  4GR1 A;  3DH9 A;  2WEU A;  4C5O A;  2RGO A;  3LB8 A;  1CF3 A;  4D03 A;  1R6W A;  1ZOY A;  1IYX A;  2GGG A;  2GMH A;  3ICR A;  3UJS A;  5KMS A;  4OPU A;  2HXT A;  5KVH A;  4HN8 A;  1MXT A;  4K2X A;  2HZG A;  5J60 A;  2YG3 A;  2XFP A;  3UCD A;  1FCD A;  4APN A;  1Y56 B;  5BUK A;  4DX3 A;  4BJY A;  1PS9 A;  3IK4 A;  1E39 A;  2ARD A;  4TM3 A;  2MNR A;  4NEW A;  2WU5 A;  2YVF A;  3DGH A;  3H70 A;  4RG3 A;  2EQ9 A;  1IJH A;  2XFQ A;  4HA6 A;  3V3O A;  3GWF A;  3T0K A;  3TW9 A;  3DJD A;  2PS2 A;  2PYX A;  3UKQ A;  3AE8 A;  1Q1W A;  3STP A;  3UTE A;  4OPC A;  1E6E A;  2AL2 A;  4UDR A;  4YSX A;  3ZVI A;  3VC5 A;  2FJD A;  1TYP A;  3DA1 A;  4HCL A;  3DDM A;  3MWC A;  3BI2 A;  4YSH A;  4A6N B;  2PP0 A;  1GRA A;  3EEZ A;  1F3P A;  3NRZ B;  5JCL A;  1BZL A;  1NAA A;  4Y4L A;  3KPK A;  3C96 A;  2PTW A;  2CDU A;  3CB3 A;  2IID A;  4FX9 A;  1CL0 A;  4B64 A;  4GRT A;  1GAL A;  3MY9 A;  4HYR A;  1BGN A;  3RIT A;  3EAO A;  4EMI A;  1XDI A;  4PAB A;  5FS8 A;  2QGY A;  1CC4 A;  1B8S A;  4H83 A;  1PBC A;  5GRT A;  3VDG A;  4IVM B;  3SQS A;  2OZT A;  2JB2 A;  1TKK A;  3AE7 A;  4BK3 A;  4E6M A;  2BCG G;  2XCG A;  1GOS A;  1P2H A;  1ZX9 A;  3R9U A;  3PG6 A;  2RGJ A;  1LTX R;  5KOX A;  1SJA A;  1DNC A;  3MSY A;  1K0I A;  2C66 A;  4C3X A;  2OPJ A;  4H4T A;  2W0H A;  4KPR A;  3NVV B;  1BKH A;  4EM3 A;  3K30 A;  2C75 A;  3TWB A;  5FS9 A;  1D5T A;  2E4G A;  2C4C A;  4A79 A;  3NN0 X;  3ADA B;  3ATR A;  2ZC8 A;  2QVH A;  1NG3 A;  3FV9 A;  1X2H A;  4NEV A;  4G9K A;  3SN1 A;  2O56 A;  2I5Q A;  1EBG A;  1FHU A;  3PK7 A;  3S61 A;  2GGE A;  1GER A;  2Q7V A;  3UKF A;  1P2E A;  2B9W A;  4IZG A;  3I4K A;  1DJN A;  3FIM B;  3V3W A;  3TQP A;  2VVL G;  1ELS A;  1DOE A;  1H82 A;  2YM1 A;  2IVE A;  5EU9 A;  2YLW A;  3FPZ A;  3VCC A;  1ONE A;  3AD8 B;  4CY6 A;  4HNC A;  3RO6 A;  1NEN A;  3ZVH A;  3AE2 A;  3R11 A;  1DXL A;  5G5G B;  2BK4 A;  3K7M X;  3AYL A;  1GTH A;  1IUS A;  3GMC A;  2C3D A;  1GPE A;  4GYP A;  2ZZB A;  1O5W A;  4F4R A;  1PBE A;  4H4R A;  2P8B A;  4WCT A;  3IF9 A;  3R0U A;  3DIP A;  4J1O A;  3GWD A;  2V3B A;  3QSM A;  3AEC A;  4J33 A;  2BAC A;  1L9E A;  4NTC A;  3ZDN A;  3I6D A;  3HZL A;  1AOG A;  1NHQ A;  4KWS A;  2R0C A;  3NTD A;  3L8K A;  3VR8 A;  4A65 A;  4AOX A;  1QLB A;  1WYG A;  4U8L A;  2YWL A;  5EBK A;  2CHR A;  2ZAD A;  3PWI A;  3T2Z A;  2PA6 A;  1S2Q A;  3E1T A;  2QCU A;  1BWC A;  4U8M A;  4IV9 A;  4EMW A;  1JOA A;  3QVP A;  3P4Q A;  4YSZ A;  3DK9 A;  1ZMC A;  1PJ6 A;  2Z5X A;  3NVZ B;  1N62 C;  1FHV A;  3NNE A;  5L46 A;  1GEU A;  1VQZ A;  2BC0 A;  4B1B A;  3H4K A;  3R1Z A;  1E7P A;  4II2 A;  4N9X A;  2YG7 A;  1FFV C;  4OPG A;  1RYI A;  2VVL A;  3G5S A;  3CXO A;  2BRY A;  2CVJ A;  1JPM A;  3CGC A;  4KEM A;  3KUM A;  2BYB A;  2DW7 A;  3IWA A;  2AKZ A;  1JDF A;  2ONE A;  1PDZ A;  2X8C A;  2PP3 A;  3SZC A;  1JRO A;  2BCP A;  4IT1 A;  3UTG A;  3AE1 A;  3CIR A;  2AR8 A;  2PU1 A;  2NQL A;  1CC6 A;  2RGH A;  2A89 A;  4GDP A;  5LV9 A;  1FFU C;  2VVM A;  1NHR A;  4K22 A;  3TWA A;  1KNR A;  5KNL A;  3P3B A;  1XPY A;  1EC9 A;  1CJC A;  3AMZ A;  2YR6 A;  4AT0 A;  1W4X A;  4U2T A;  1PN0 A;  3ZVH B;  1WUE A;  2TPR A;  3T31 A;  4JY2 A;  2MUC A;  1JRY A;  3RP7 A;  1GRB A;  2XH7 A;  4H4Y A;  2OQY A;  4IP4 A;  3NVW B;  2P8C A;  1JEH A;  3ALM A;  3DER A;  4J3Z A;  4Z26 A;  4ROP A;  3GYX A;  3AE3 A;  3S47 A;  1O94 A;  2BRA A;  2PSN A;  4NWZ A;  1MUC A;  2OLO A;  2XVF A;  4JNA A;  5IDZ A;  3ETR B;  2QAE A;  5EB4 A;  2WOV A;  4GIS A;  3O0H A;  1D7L A;  1JU2 A;  3AB1 A;  3GYJ A;  5KMQ A;  4GF7 A;  3FBS A;  1KSS A;  3SM8 A;  3HW2 A;  2OZ8 A;  3SFE A;  1N1P A;  4H19 A;  3THU A;  4O5U A;  3UOV A;  1L9D A;  5CKU A;  2GF3 A;  1MOK A;  2BAB A;  3F8R A;  4OPI A;  1JNZ A;  2WBA A;  1XHC A;  2OKT A;  2J3N A;  3T37 A;  3AWI A;  1E1N A;  1ONF A;  1EL9 A;  2B9X A;  4GME A;  4H2Q A;  3VR9 A;  4KX6 A;  4K5S A;  3GD3 A;  1E1L A;  2GRT A;  1LVL A;  2GDQ A;  5C3J A;  3AM9 A;  1H7W A;  2GGI A;  4GAV A;  3CNJ A;  4HB9 A;  1VRQ B;  4BK2 A;  4E8G A;  3S5W A;  4BJZ A;  1S3E A;  4WX1 A;  1OJT A;  3B97 A;  4IA6 A;  2X8G A;  2W54 A;  1CBO A;  1GES A;  3B3R A;  4FK1 A;  1V97 A;  2XVJ A;  2Q6U A;  4Z1Y A;  1EL7 A;  3FCP A;  3H8I A;  3UP5 A;  1B37 A;  1GRE A;  3F8D A;  1GV4 A;  2FJB A;  2GGJ A;  2YR5 A;  1CJ2 A;  3CTY A;  3HYV A;  2WDR A;  4EIP A;  3GYI A;  1STZ A;  2WES A;  3C4N A;  4BK1 A;  3OC4 A;  2R46 A;  4CCR A;  1N5X A;  3QSS A;  3OZM A;  4CY8 A;  1M6I A;  1DJQ A;  3GRT A;  2PGE A;  4GGH A;  3GMB A;  2XH4 A;  3KPF A;  3AED A;  3UTF A;  3NIX A;  2TMD A;  2E5V A;  4E0V A;  3LZW A;  3TOY A;  4YTN A;  2GAG B;  1YEY A;  3RGT A;  3CPH G;  4TM0 A;  1TRB A;  3S5S A;  3LAD A;  3DGZ A;  1MDR A;  3PFR A;  3AD7 B;  3PWG A;  3CPI G;  3UOX A;  1H83 A;  3BHF A;  3D8X A;  3JVA A;  3OPS A;  1FOH A;  2PGW A;  5FJU A;  3SYI A;  2C76 A;  3NVY B;  3MQT A;  3LZX A;  1Q9I A;  2YG4 A;  4K2S A;  1PXA A;  3ENL A;  4ADW A;  2H88 A;  4J2W A;  2BXS A;  1XPQ A;  1MRA A;  3T14 A;  3N6H A;  5CQF A;  3K7T A;  1BQG A;  3RNM A;  3RR1 A;  4E5T A;  1JNR A;  4KPL A;  1GT8 A;  3ITJ A;  4YTM A;  5J04 A;  4NNJ A;  4H7U A;  2E5A A;  3TJ4 A;  1GND A;  3V3N A;  5FJR A;  4I59 A;  1SEZ A;  1KNP A;  1M64 A;  3VRA A;  1YY5 A;  4M6U A;  3T2K A;  4YKF A;  1JRP A;  2DKH A;  2W55 A;  1RSG A;  4EWJ A;  1T3Q C;  3GO2 A;  2WET A;  1ZP0 A;  3UKP A;  3QTP A;  1EBH A;  3HYW A;  1V59 A;  1NU5 A;  2OAM A;  2WDQ A;  3T9P A;  1JRZ A;  3DFY A;  4P9S A;  2GMJ A;  1PJ7 A;  4IA5 A;  3GY1 A;  1IUU A;  1NEK A;  2JKC A;  2QJM A;  4HCH A;  1RM6 B;  4USQ A;  3ES8 A;  2OQH A;  3BOX A;  2WPE A;  4AP3 A;  1Y0P A;  4G74 A;  3BNU A;  1N5W C;  4DXK A;  4I58 A;  4J36 A;  2GQW A;  2JB1 A;  4MGG A;  3SZF A;  4G6G A;  4YTP A;  1EC8 A;  4C77 A;  1KKO A;  4JQ9 A;  3TJI A;  4ZA0 A;  2C67 A;  1NDA A;  1SJB A;  2BC1 A;  3OP2 A;  4Y4N A;  4A5L A;  3EKG A;  3JSK A;  2OG9 A;  3CPJ G;  3SX6 A;  3NTA A;  1UKV G;  4J34 A;  3BHK A;  2OVL A;  2R45 A;  3FMW A;  3SFD A;  3AN1 A;  3JZU A;  3VA8 A;  4IP5 A;  4B69 A;  1DOC A;  3V76 A;  3FG2 P;  1VDC A;  2V5Z A;  1F6M A;  3CGB A;  1TDN A;  2P3Z A;  2W3S A;  4M0X A;  3RP8 A;  1SB3 B;  5FMH A;  1EC7 A;  1B4V A;  2AL2 B;  1ZOV A;  1XS2 A;  1ZKQ A;  3BNM A;  4B67 A;  4GAP A;  3UCC A;  2GR2 A;  5IQ4 A;  3NFU A;  2GR3 A;  1KDG A;  1GET A;  4KT2 A;  4PAA A;  3L5O A;  4G7F A;  4AP1 A;  2Y6Q A;  1N4V A;  4Z24 A;  4J56 A;  3FYY A;  1Z6L A;  5C2T A;  1E1K A;  2BS3 A;  3H8L A;  3KLJ A;  2A8X A;  3DFH A;  4XWZ A;  4LII A;  1GXF A;  3IJL A;  2YM2 A;  2VRL A;  5HXI A;  3UJ2 A;  4OPL A;  3UXK A;  3M0O A;  2XLT A;  4D04 A;  3GDP A;  2X50 A;  4B66 A;  2R9Z A;  3PS9 A;  2BS4 A;  3A7U A;  1R0M A;  2FBW A;  2Y6R A;  5FS7 A;  4FDC B;  1GTE A;  2C73 A;  3D47 A;  2YVJ A;  4U8I A;  3NH3 X;  4ICY A;  3N4F A;  4BUR A;  3UKL A;  4H4Q A;  3NYE A;  4M52 A;  4EMJ A;  5KXJ A;  2WP9 A;  2WOI A;  1K0L A;  4YWO A;  2GSH A;  3NGC X;  1BKW A;  3P4R A;  2YLS A;  1ELI A;  1X31 B;  4AOS A;  1ZK7 A;  1P43 A;  3R10 A;  4NTE A;  4A99 A;  3Q9T A;  1PHH A;  2PPG A;  2YVG A;  4H4P A;  3NS1 B;  3I3L A;  3UKK A;  3NXL A;  1TZZ A;  3IHG A;  1PDY A;  4JY3 A;  4EM4 A;  3DG7 A;  1D7Y A;  1PBB A;  3CXB A;  4JNQ A;  2XLR A;  5J7X A;  3V5F A;  1MO9 A;  4JDR A;  1RVK A;  3NO1 A;  4H50 A;  3ZLF A;  3SZ0 A;  3KA7 A;  3R25 A;  1YKJ A;  5G5H B;  2V6O A;  1ECQ A;  1OJA A;  3OTR A;  3LJP A;  4HCD A;  1TYT A;  4TM1 A;  1B5Q A;  3EF6 A;  4LU6 A;  4EQX A;  1TDO A;  5FJO A;  4G8T A;  1KFY A;  1N60 C;  2V3A A;  4IL0 A;  3WE0 A;  3DEQ A;  4C74 A;  1LPF A;  2XVE A;  3BSM A;  3NK2 X;  3VRD B;  4EQS A;  4C3Y A;  1BF3 A;  4E4U A;  2XH0 A;  2P88 A;  5BRT A;  3AYJ A;  2WP6 A;  4H4S A;  3IHM A;  2GGH A;  3NK0 X;  2GR0 A;  3NKS A;  4MKS A;  2XGZ A;  3PVC A;  2BXR A;  4MMW A;  5IQ1 A;  3DJE A;  3QFA A;  3HPF A;  5KWF A;  3P93 A;  3IJQ A;  1WUF A;  4B65 A;  2X8H A;  1H86 A;  3I6E A;  1N4U A;  3FXG A;  2VQ7 A;  1YQZ A;  2E3T A;  2VQB A;  1H84 A;  3OZY A;  4EQW A;  2DW6 A;  3F8P A;  4YSY A;  3P4P A;  3LOV A;  2OFJ A;  3MUC A;  4H1Z A;  3BI4 A;  3CK5 A;  2AL1 A;  3MKC A;  3V5C A;  3CT2 A;  4JN9 A;  4DHG A;  3GC2 A;  3ZLG A;  2QJJ A;  4H4W A;  2POD A;  3JW7 A;  4NTD A;  2C64 A;  3NK1 X;  4H2N A;  4MJW A;  2XFN A;  4B63 A;  2JB3 A;  4REK A;  7ENL A;  3ISH A;  1H2I A;  2ZBW A;  1EBD A;  3DJJ A;  1IUT A;  4H2P A;  3EUB 3;  2C70 A;  5BUL A;  3AE4 A;  2GH5 A;  3EAN A;  1IUV A;  1PBF A;  2PTX A;  2AAQ A;  3SY4 A;  3ICT A;  2GEW A;  4Z2U A;  2BK5 A;  2QDE A;  3ES7 A;  3SSZ A;  4U2L A;  1MDL A;  3CYJ A;  2B9Y A;  3RHA A;  3U9I A;  1FEB A;  1REO A;  5M10 A;  1F9C A;  4XXG A;  2R0G A;  4A6N A;  1YQ4 A;  1Q1R A;  2WHD A;  2C65 A;  4CBQ A;  2FKP A;  2YLR A;  1TDF A;  2GQF A;  3CMM A;  2XDO A;  2YLZ A;  3NYC A;  3AYI A;  4LA1 A;  1COY A;  2OLN A;  2Z5Y A;  2GR1 A;  2WU2 A;  5M0Z A;  3UOY A;  1ZXI C;  3ZLH A;  2X99 A;  3GRS A;  3CNT A;  1ZY8 A;  5IPY A;  3A7A A;  3ABV A;  4GUV A;  4DWD A;  1N63 C;  3BI5 A;  3AE5 A;  1GRT A;  3VRB A;  4ECH A;  2V61 A;  1SJD A;  3M12 A;  3KKJ A;  2CUL A;  5HY5 A;  3QFB A;  2APG A;  4TVY A;  3U4F A;  4GDE A;  3UJE A;  2ACZ A;  4IHC A;  1XAN A;  1NHP A;  2OA1 A;  3H12 A;  4ZCW A;  3NZG A;  1KN0 A;  1SJC A;  2GL5 A;  3QKE A;  3G5R A;  2C72 A;  4H4X A;  1PXC A;  4GGB A;  4U2S A;  1QJD A;  3V4B A;  1JCT A;  1S3B A;  4A7A A;  2QJN A;  5ER0 A;  1DTN A;  3H8A A;  1D4E A;  2HQM A;  4EIQ A;  5FJT A;  3AXB A;  3GSI A;  3ZYX A;  1TDE A;  3AEF A;  4H4Z A;  1DOD A;  2OAL A;  2YR4 A;  2OZ3 A;  4GCM A;  1JPD X;  2C3C A;  3RRA A;  2PHH A;  5HHF A;  2HNE A;  3DK8 A;  4USR A;  2VRM A;  5EB5 A;  4A35 A;  3KVE A;  3OW1 A;  3UCL A;  4TLZ A;  2HXU A;  3UJR A;  4HPN A;  4EQR A;  3NLC A;  1S7M A;  2YLT A;  2YLX A;  3DES A;  1P48 A;  1FEA A;  3TTE A;  4Z2R A;  2XLU A;  1NG4 A;  5KVI A;  3OZ2 A;  4DYE A;  1KD0 A;  3EPT A;  3NRN A;  3QJ4 A;  4X2P A;  2V60 A;  3Q4D A;  4RSL A;  2EQ6 A;  2OX4 A;  1H7X A;  3AEG A;  3H7V A;  1L8P A;  4GIR A;  1F8S A;  4K5R A;  2DKI A;  3GD6 A;  3ATQ A;  4FI4 A;  1OJ9 A;  3Q6J A;  1OJC A;  3CN8 A;  3P4S A;  3T2Y A;  3SN0 A;  3QVR A;  1IUW A;  3FJ4 A;  3AD9 B;  3AE6 A;  3M13 A;  2WDV A;  1F8W A;  5KRQ A;  2OO6 A;  4FP1 A;  4OPT A;  4A6G A;  4YWS A;  3CAW A;  1CC2 A;  3Q45 A;  4H2H A;  4B68 A;  2FJA A;  3R07 C;  1KKR A;  1PXB A;  4JHM A;  5KMP A;  4Y4M A;  4OPD A;  2EQ8 A;  2XFU A;  2YQU A;  3CNS A;  1KCZ A;  4X4J A;  1TDK A;  3CGE A;  4DGK A;  1NPX A;  4Z17 A;  1L0V A;  2WP5 A;  2POZ A;  1RP0 A;  5JCK A;  4IL2 A;  3UOZ A;  5FJP A;  4CNK A;  2H89 A;  4GYP C;  1LV0 A;  4A3R A;  1LQT A;  1JRX A;  4YT0 A;  2AKM A;  3NHO X;  4X9N A;  2R4J A;  3RCY A;  2FYM A;  3UJF A;  2RAB A;  5ENL A;  4Z43 A;  3SJN A;  2XVH A;  1EL5 A;  2B7S A;  1D4D A;  4K8G A;  1X2G A;  2R0P A;  2AQJ A;  1IUX A;  1VDV A;  4XWR A;  2WQY A;  3URH A;  1FO4 A;  3A7R A;  3SQP A;  1ZMD A;  3II4 A;  3B9J B;  3CND A;  3D9X A;  6ENL A;  3K7Q X;  1HYU A;  2WOW A;  4H4U A;  1H81 A;  1QO8 A;  2ZZC A;  2O9Z A;  2BK3 A;  1NEL A;  4J57 A;  1EL8 A;  3GDN A;  3VCN A;  4U8K A;  4X9M A;  3SXI A;  3P9U A;  2PP1 A;  4U8P A;  3NN6 X;  4ZCD A;  3AEB A;  4ZN0 A;  3R0K A;  1GRH A;  1KSU A;  3NG7 X;  2JK6 A;  2Q0K A;  2QQ6 A;  5BOF A;  3NYF A;  4Z25 A;  2EQ7 A;  2QDD A;  2P0I A;  3ICS A;  3DK4 A;  1K4Q A;  4YKG A;  3BJS A;  4O5Q A;  2X3N A;  3QSE A;  4G73 A;  4ZOH B;  3QLD A;  1NHS A;  1FEC A;  1GSN A;  2JBV A;  5FS6 A;  2WPF A;  3CNP A;  3B6D A;  4K7Z A;  1D4C A;  4UDQ A;  2NVK X;  3VC6 A;  1F8R A;  3IJI A;  1LQU A;  5U25 A;  2FJE A;  2A87 A;  2XH2 A;  1GRG A;  4ZCC A;  2GV8 A;  1N61 C;  4K8D A;  4NZH A;  3RP6 A;  4YXD A;  3SBF A;  3KD9 A;  4TM4 A;  4TLX A;  4A9W A;  1VQW A;  3UTH A;  1BGJ A;  4UDP A;  3NT6 A;  3HYX A;  1FIQ B;  1S2Y A;  4E4F A;  5JCI A;  3AE9 A;  3T6C A;  3KU9 A;  4DSH A;  3SZW A;  4JN7 A;  1ZDL A;  4K1W A;  2VOU A;  3C4A A;  4G6H A;  3SGL A;  2I0Z A;  3DME A;  3T8Q A;  2XFO A;  5EOW A;  4Z44 A;  1W6T A;  2PTY A;  1FL2 A;  2QA1 A;  2R4E A;  2GAH B;  3N4E A;  4CCQ A;  1YQ3 A;  4H2R A;  3L1R A;  1L9C A;  2OLA A;  4CNJ A;  2QA2 A;  2XLS A;  1OJD A;  2C7G A;  2YAU A;  4J31 A;  2XSX A;  3N6J A;  3ALL A;  3P0W A;  4AT2 A;  3D46 A;  2PCE A;  3VQR A;  4HNL A;  4CRT A;  2GVC A;  2B7R A;  2PMQ A;  3IC9 A;  5GSN A;  3QN3 A;  3MZN A;  5BOE A;  2B76 A;  2PU0 A;  1DOB A;  2YG5 A;  2XYO A;  1CJ3 A;  4FK1 C;  2CFY A;  3UP4 A;  4OCG A;  2BA9 A;  3FVD A;  1PBD A;  4RG4 A;  1CHU A;  3VFC A;  2RDX A;  2WPC A;  1Y56 A;  4DN1 A;  2NPX A;  1PJ5 A;  3RED A;  4DSG A;  2XVI A;  2BS2 A;  3I6T A;  5U1O A;  2VZ2 A;  1OEP A;  1E9I A;  5KMR A;  5KOW A;  3K1G A;  2GB0 A;  5BVA A;  4U8O A;  1KF6 A;  4TVW A;  1LJ1 A;  1CJ4 A;  5TR3 A;  1TE6 A;  2UZZ A;  3D1C A;  5JCN A;  2YG6 A;  3SN4 A;  4IVO B;  3COX A;  4OVI A;  1PDH A;  3CGD A;  2XLP A;  2JAE A;  3T4W A;  3DGB A;  1VG9 A;  1MNS A;  4JN8 A;  5JCM A;  3GD4 A;  1E1M A;  3P1W A;  4GFI A;  4BV6 A;  1VG0 A;  2F5Z A;  3G5Q A;  2IVD A;  4UP3 A;  3UKA A;  5U63 A;  3ALJ A;  3UXL A;  3QPE A;  3DJG X;  2Q0L A;  4U8J A;  5HYM A;  2ZZ0 A;  1K0J A;  3AEE A;  2W3R A;  3SR6 B;  3TCS A;  4II3 A;  2PTZ A;  3DG3 A;  4Z2T A;  1GRF A;  3UKH A;  4ENL A;  5DBJ A;  1H6V A;  5JRB A;  3HRD C;  4H4V A;  3DG6 A;  1O95 A;  4U8N A;  3LXD A;  3UGV A;  2WS3 A;  3AEA A;  2E1M A; 
#chains in the Genus database with same CATH homology
 5EB4 A;  1N4W A;  5KMP A;  2WOV A;  3AB1 A;  3O0H A;  1D7L A;  1JU2 A;  4DNA A;  3GYJ A;  3PO7 A;  4Y4M A;  4GF7 A;  5KMQ A;  4GR1 A;  4OPD A;  2EQ8 A;  2XFU A;  3DH9 A;  4BUR A;  2YQU A;  2WEU A;  3UKL A;  2RGO A;  4C5O A;  3CNS A;  3FBS A;  3LB8 A;  1TDK A;  1CF3 A;  4H4Q A;  1KSS A;  3NYE A;  4M52 A;  4X4J A;  3SM8 A;  4EMJ A;  2GMH A;  3CGE A;  1ZOY A;  3ICR A;  4D03 A;  4DGK A;  2WP9 A;  2WOI A;  3SFE A;  1NPX A;  5KMS A;  5KXJ A;  4OPU A;  1L0V A;  1N1P A;  4O5U A;  3UOV A;  2WP5 A;  1K0L A;  4YWO A;  1RP0 A;  1L9D A;  5JCK A;  5CKU A;  5KVH A;  3NGC X;  1BKW A;  2GF3 A;  1MXT A;  1MOK A;  2BAB A;  4K2X A;  3F8R A;  3P4R A;  4OPI A;  3UOZ A;  1JNZ A;  5J60 A;  4CNK A;  2WBA A;  2H89 A;  2YG3 A;  1XHC A;  1ELI A;  2XFP A;  2YLS A;  1LV0 A;  1FCD A;  1X31 B;  4APN A;  1ZK7 A;  2J3N A;  1LQT A;  1Y56 B;  3T37 A;  4AOS A;  3AWI A;  1JRX A;  5BUK A;  1E1N A;  4YT0 A;  3NHO X;  4NTE A;  4X9N A;  2R4J A;  1ONF A;  4A99 A;  3Q9T A;  4BJY A;  1PHH A;  1PS9 A;  2YVG A;  1EL9 A;  2B9X A;  4Z43 A;  2RAB A;  1E39 A;  2ARD A;  4H4P A;  2XVH A;  4H2Q A;  3VR9 A;  1EL5 A;  4TM3 A;  3I3L A;  3UKK A;  2B7S A;  1D4D A;  3IHG A;  4NEW A;  2WU5 A;  2YVF A;  4JY3 A;  4EM4 A;  2R0P A;  4KX6 A;  1D7Y A;  2AQJ A;  1PBB A;  1IUX A;  3DGH A;  4K5S A;  4XWR A;  4RG3 A;  3GD3 A;  2EQ9 A;  1E1L A;  4JNQ A;  2GRT A;  1LVL A;  1IJH A;  2XFQ A;  2XLR A;  5C3J A;  4HA6 A;  5J7X A;  3V3O A;  1MO9 A;  3GWF A;  3T0K A;  2WQY A;  3DJD A;  4JDR A;  3URH A;  1H7W A;  2PYX A;  4GAV A;  3CNJ A;  4HB9 A;  4H50 A;  3SQP A;  3UKQ A;  3AE8 A;  1Q1W A;  1ZMD A;  3KA7 A;  3SZ0 A;  1VRQ B;  3UTE A;  3II4 A;  1YKJ A;  4OPC A;  4BK2 A;  3CND A;  2V6O A;  3D9X A;  1E6E A;  1OJA A;  3S5W A;  3K7Q X;  1HYU A;  4UDR A;  4BJZ A;  4YSX A;  1S3E A;  4WX1 A;  3LJP A;  1OJT A;  2WOW A;  4IA6 A;  1TYT A;  2FJD A;  1TYP A;  4TM1 A;  2X8G A;  4H4U A;  1B5Q A;  1CBO A;  3EF6 A;  4LU6 A;  1GES A;  1H81 A;  1QO8 A;  3B3R A;  4FK1 A;  3DA1 A;  4EQX A;  2ZZC A;  2O9Z A;  2BK3 A;  1TDO A;  3BI2 A;  4YSH A;  2XVJ A;  2Q6U A;  4J57 A;  1EL8 A;  1KFY A;  4A6N B;  1GRA A;  1EL7 A;  3GDN A;  2V3A A;  3WE0 A;  4U8K A;  4X9M A;  4C74 A;  3SXI A;  1F3P A;  1LPF A;  3H8I A;  1B37 A;  3UP5 A;  2XVE A;  1GRE A;  3F8D A;  3P9U A;  5JCL A;  1GV4 A;  1BZL A;  2FJB A;  1NAA A;  3NK2 X;  4Y4L A;  4U8P A;  3VRD B;  4EQS A;  3KPK A;  2YR5 A;  3C96 A;  4C3Y A;  1CJ2 A;  1BF3 A;  2CDU A;  3NN6 X;  3CTY A;  4ZCD A;  3AEB A;  3HYV A;  2IID A;  4ZN0 A;  5BRT A;  3AYJ A;  2WP6 A;  4H4S A;  2WDR A;  3IHM A;  3GYI A;  4FX9 A;  1GRH A;  1CL0 A;  4B64 A;  3NK0 X;  4EIP A;  1KSU A;  3NG7 X;  2JK6 A;  2GR0 A;  4GRT A;  2WES A;  1GAL A;  2Q0K A;  3C4N A;  3NKS A;  1BGN A;  4BK1 A;  3OC4 A;  3NYF A;  3EAO A;  2R46 A;  4CCR A;  4Z25 A;  3PVC A;  2EQ7 A;  2BXR A;  3ICS A;  5IQ1 A;  4EMI A;  3QFA A;  3DJE A;  3QSS A;  5KWF A;  3DK4 A;  1K4Q A;  1XDI A;  4PAB A;  4CY8 A;  4YKG A;  1M6I A;  4O5Q A;  2X3N A;  3QSE A;  5FS8 A;  1DJQ A;  4G73 A;  1CC4 A;  3GRT A;  1NHS A;  2X8H A;  1B8S A;  1H86 A;  1PBC A;  4B65 A;  5GRT A;  1N4U A;  4IVM B;  3GMB A;  3KPF A;  2VQ7 A;  1YQZ A;  1FEC A;  2JB2 A;  3AED A;  3UTF A;  2VQB A;  1H84 A;  3AE7 A;  3NIX A;  4BK3 A;  1GSN A;  4EQW A;  2JBV A;  5FS6 A;  2BCG G;  2XCG A;  2WPF A;  1GOS A;  1P2H A;  2TMD A;  1ZX9 A;  3F8P A;  2E5V A;  3R9U A;  4YSY A;  3P4P A;  4E0V A;  3CNP A;  3LOV A;  3LZW A;  3B6D A;  3PG6 A;  2RGJ A;  3BI4 A;  1LTX R;  4K7Z A;  4YTN A;  1D4C A;  2GAG B;  5KOX A;  4UDQ A;  2NVK X;  3CPH G;  4TM0 A;  1TRB A;  1F8R A;  1DNC A;  1K0I A;  2C66 A;  3LAD A;  3DGZ A;  4JN9 A;  1LQU A;  5U25 A;  4C3X A;  4H4T A;  2W0H A;  4KPR A;  2FJE A;  3AD7 B;  2A87 A;  4EM3 A;  3CPI G;  3K30 A;  3UOX A;  1GRG A;  2C75 A;  4ZCC A;  2GV8 A;  4K8D A;  4NZH A;  1H83 A;  5FS9 A;  3RP6 A;  4H4W A;  3BHF A;  3D8X A;  1D5T A;  2E4G A;  4YXD A;  4NTD A;  2C4C A;  3KD9 A;  4TM4 A;  4TLX A;  2C64 A;  4A9W A;  4A79 A;  3NN0 X;  3ADA B;  1VQW A;  3NK1 X;  3ATR A;  4H2N A;  1FOH A;  4MJW A;  3UTH A;  1BGJ A;  4UDP A;  2XFN A;  3SYI A;  2C76 A;  1NG3 A;  3NT6 A;  4B63 A;  3LZX A;  2JB3 A;  4REK A;  3HYX A;  1Q9I A;  3ISH A;  4NEV A;  1H2I A;  2YG4 A;  2ZBW A;  1S2Y A;  4G9K A;  5JCI A;  1PXA A;  1EBD A;  3AE9 A;  3DJJ A;  1IUT A;  4ADW A;  3KU9 A;  4H2P A;  2H88 A;  4J2W A;  2C70 A;  5BUL A;  3S61 A;  2BXS A;  4DSH A;  3SZW A;  1ZDL A;  2VOU A;  3AE4 A;  2GH5 A;  3EAN A;  1IUV A;  1PBF A;  1GER A;  3C4A A;  1XPQ A;  4G6H A;  2AAQ A;  3SY4 A;  2Q7V A;  3ICT A;  3UKF A;  2GEW A;  3T14 A;  1P2E A;  2B9W A;  5CQF A;  4Z2U A;  3RNM A;  2BK5 A;  3K7T A;  3SGL A;  1JNR A;  1DJN A;  2I0Z A;  3DME A;  3FIM B;  4U2L A;  2XFO A;  5EOW A;  1GT8 A;  2B9Y A;  2VVL G;  3ITJ A;  4Z44 A;  1DOE A;  1FL2 A;  4YTM A;  2QA1 A;  2R4E A;  4NNJ A;  2GAH B;  1H82 A;  2YM1 A;  3RHA A;  4H7U A;  2IVE A;  1REO A;  1FEB A;  1GND A;  2YLW A;  3FPZ A;  4I59 A;  3V3N A;  4CCQ A;  1SEZ A;  5M10 A;  1KNP A;  1M64 A;  3VRA A;  1YQ3 A;  4XXG A;  2R0G A;  4A6N A;  1YQ4 A;  1Q1R A;  2WHD A;  2C65 A;  3AD8 B;  4CBQ A;  1YY5 A;  2YLR A;  1TDF A;  2GQF A;  4H2R A;  3T2K A;  4CY6 A;  3L1R A;  3CMM A;  1NEN A;  4YKF A;  2XDO A;  2DKH A;  2YLZ A;  3AE2 A;  3NYC A;  1L9C A;  1RSG A;  3AYI A;  4LA1 A;  1COY A;  1DXL A;  4CNJ A;  2OLN A;  2BK4 A;  2Z5Y A;  3K7M X;  2QA2 A;  2XLS A;  3AYL A;  2WET A;  1OJD A;  1ZP0 A;  3UKP A;  1GTH A;  2GR1 A;  2C7G A;  2YAU A;  1IUS A;  2WU2 A;  3GMC A;  5M0Z A;  2C3D A;  1GPE A;  3UOY A;  4J31 A;  2ZZB A;  1O5W A;  3HYW A;  2X99 A;  1PBE A;  1V59 A;  3ALL A;  4H4R A;  3GRS A;  2OAM A;  2WDQ A;  3CNT A;  1ZY8 A;  3IF9 A;  4WCT A;  4AT2 A;  3QSM A;  3GWD A;  5IPY A;  2V3B A;  3AEC A;  4J33 A;  2BAC A;  3VQR A;  1L9E A;  1JRZ A;  4NTC A;  3ZDN A;  4P9S A;  2GMJ A;  1PJ7 A;  3ABV A;  4GUV A;  4IA5 A;  4CRT A;  1IUU A;  3HZL A;  1AOG A;  3BI5 A;  1NHQ A;  3I6D A;  2R0C A;  3NTD A;  3AE5 A;  2GVC A;  3L8K A;  1NEK A;  3VR8 A;  4A65 A;  4JNA A;  4AOX A;  1QLB A;  1GRT A;  2JKC A;  4U8L A;  2YWL A;  3VRB A;  5EBK A;  2B7R A;  4ECH A;  2V61 A;  3T2Z A;  3IC9 A;  4USQ A;  1S2Q A;  5GSN A;  3M12 A;  3E1T A;  2WPE A;  4AP3 A;  3KKJ A;  1Y0P A;  2CUL A;  4G74 A;  3BNU A;  2QCU A;  1BWC A;  2B76 A;  4U8M A;  5HY5 A;  4IV9 A;  4EMW A;  1DOB A;  1JOA A;  3QVP A;  3QFB A;  2APG A;  4I58 A;  2YG5 A;  2XYO A;  4J36 A;  3P4Q A;  1CJ3 A;  4GDE A;  2GQW A;  3DK9 A;  2JB1 A;  4YSZ A;  3SZF A;  4FK1 C;  2CFY A;  2ACZ A;  1ZMC A;  4G6G A;  3UP4 A;  4OCG A;  4YTP A;  2BA9 A;  1XAN A;  1NHP A;  2OA1 A;  1PBD A;  4RG4 A;  4C77 A;  1CHU A;  1PXB A;  1PJ6 A;  1KN0 A;  2WPC A;  1Y56 A;  2Z5X A;  4JQ9 A;  3NNE A;  2NPX A;  1PJ5 A;  1GEU A;  5L46 A;  3G5R A;  2C72 A;  3RED A;  2BC0 A;  2C67 A;  1NDA A;  4B1B A;  4H4X A;  4DSG A;  2BC1 A;  3H4K A;  1E7P A;  2XVI A;  4II2 A;  4N9X A;  2BS2 A;  1PXC A;  5U1O A;  2YG7 A;  4U2S A;  1QJD A;  2VZ2 A;  4OPG A;  1S3B A;  1RYI A;  2VVL A;  5KMR A;  4A7A A;  4Y4N A;  5ER0 A;  4A5L A;  5KOW A;  3G5S A;  2GB0 A;  1D4E A;  3JSK A;  2HQM A;  4EIQ A;  5BVA A;  2BRY A;  3AXB A;  3GSI A;  2CVJ A;  3ZYX A;  4U8O A;  1TDE A;  3CPJ G;  3AEF A;  3SX6 A;  1KF6 A;  1LJ1 A;  3CGC A;  4H4Z A;  1DOD A;  2OAL A;  2YR4 A;  1CJ4 A;  3NTA A;  4GCM A;  5TR3 A;  1UKV G;  2BYB A;  4J34 A;  2C3C A;  2UZZ A;  3BHK A;  3D1C A;  5JCN A;  2R45 A;  2PHH A;  3FMW A;  2YG6 A;  3IWA A;  5HHF A;  3SFD A;  4IVO B;  3COX A;  3DK8 A;  4OVI A;  2VRM A;  4USR A;  4B69 A;  2X8C A;  1PDH A;  1DOC A;  3CGD A;  3SZC A;  2BCP A;  2XLP A;  2JAE A;  5EB5 A;  3V76 A;  3UTG A;  3AE1 A;  1VG9 A;  3CIR A;  3KVE A;  3FG2 P;  1VDC A;  3UCL A;  2V5Z A;  4TLZ A;  1F6M A;  2AR8 A;  3CGB A;  5JCM A;  1TDN A;  3GD4 A;  1E1M A;  3P1W A;  1CC6 A;  3RP8 A;  2RGH A;  4EQR A;  2A89 A;  3NLC A;  4BV6 A;  4GDP A;  1S7M A;  2YLT A;  2YLX A;  5LV9 A;  2VVM A;  5FMH A;  1B4V A;  1NHR A;  1VG0 A;  2F5Z A;  3G5Q A;  4K22 A;  2IVD A;  1KNR A;  1ZOV A;  5KNL A;  1FEA A;  1ZKQ A;  4Z2R A;  3BNM A;  4B67 A;  4GAP A;  2XLU A;  1NG4 A;  4UP3 A;  3UKA A;  2GR2 A;  5U63 A;  3ALJ A;  5KVI A;  5IQ4 A;  3OZ2 A;  2GR3 A;  3DJG X;  3EPT A;  2Q0L A;  1CJC A;  4U8J A;  5HYM A;  2ZZ0 A;  3NRN A;  1KDG A;  3QJ4 A;  2YR6 A;  1GET A;  2V60 A;  4AT0 A;  1K0J A;  4PAA A;  2EQ6 A;  3L5O A;  1W4X A;  4RSL A;  4U2T A;  1H7X A;  3AEG A;  4AP1 A;  2Y6Q A;  1F8S A;  1N4V A;  3AEE A;  1PN0 A;  4K5R A;  2DKI A;  4Z24 A;  4J56 A;  3ATQ A;  4II3 A;  2TPR A;  3T31 A;  4Z2T A;  4JY2 A;  1GRF A;  3UKH A;  1Z6L A;  5C2T A;  1E1K A;  2BS3 A;  3H8L A;  1OJ9 A;  3KLJ A;  1JRY A;  2A8X A;  4XWZ A;  4LII A;  1GXF A;  3Q6J A;  1OJC A;  2YM2 A;  5DBJ A;  1GRB A;  3RP7 A;  2VRL A;  3CN8 A;  3P4S A;  3T2Y A;  3QVR A;  1H6V A;  4OPL A;  5HXI A;  4H4Y A;  5JRB A;  3M0O A;  2XLT A;  1IUW A;  4D04 A;  3AD9 B;  3AE6 A;  2WDV A;  2X50 A;  3GDP A;  3M13 A;  3ALM A;  1JEH A;  4B66 A;  2R9Z A;  4H4V A;  4Z26 A;  1F8W A;  3GYX A;  3AE3 A;  3PS9 A;  2BS4 A;  5KRQ A;  1O94 A;  1O95 A;  4OPT A;  4U8N A;  2BRA A;  2FBW A;  1CC2 A;  2Y6R A;  5FS7 A;  3LXD A;  4FDC B;  1GTE A;  2WS3 A;  3AEA A;  4NWZ A;  2C73 A;  2YVJ A;  2OLO A;  2XVF A;  4B68 A;  4U8I A;  2FJA A;  2E1M A;  3NH3 X;  4ICY A;  2QAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...