1NHQA

Crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
447
structure length
447
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title Crystallographic analyses of NADH peroxidase Cys42Ala and Cys42Ser mutants: active site structures, mechanistic implications, and an unusual environment of Arg 303.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
total genus 136
structure length 447
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhqA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhqA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhqA02
4TM0A 3LADA 4NEVA 3G5SA 1L9EA 1KFYA 5U63A 2WOIA 4D04A 2BACA 1DOCA 4U8MA 4B65A 3K7MX 4OPIA 4YT0A 2WPFA 2YM1A 4Y4NA 4TM4A 2XVHA 1ZP0A 4IVOB 3KD9A 3BI5A 3JSKA 3V76A 5FMHA 3AXBA 2R4JA 2BCGG 4I59A 2C70A 1NEKA 3AB1A 1K4QA 1VQWA 2R45A 1DODA 2DKIA 3NYCA 2B9YA 2Q0LA 2BYBA 2WETA 1GTEA 4DSGA 3FG2P 3QSEA 1H84A 1BWCA 3KU9A 1RSGA 2WESA 3VQRA 4CY8A 4EQRA 2W0HA 4YTNA 4GDPA 1PBDA 3NK2X 5HHFA 3CNPA 4JQ9A 2J3NA 2WQYA 2YLSA 3AWIA 1E1MA 2I0ZA 3CPJG 4H2RA 4LA1A 4LIIA 2V3AA 4J31A 4K22A 4OPGA 4U8PA 4NEWA 5C3JA 5FS9A 4GR1A 1GPEA 2YM2A 1D7LA 1GOSA 5CKUA 1BGJA 1FEAA 2CULA 3IC9A 2JB1A 1CL0A 4YWOA 2H88A 1DOBA 3BI4A 5M0ZA 2R4EA 4DSHA 2GVCA 1OJ9A 2JKCA 3GMCA 3OC4A 1KSSA 1PJ6A 4NTDA 2Q6UA 3DJEA 3S5WA 2R0CA 3M12A 1NDAA 2CVJA 2XLTA 4H2NA 4IA5A 4FDCB 2UZZA 1FCDA 4C3XA 3UOZA 2BS4A 2XLUA 1PJ5A 5GRTA 1E1NA 5BRTA 2WP6A 3UTEA 2TPRA 3K7QX 3IF9A 4GUVA 4XWZA 4A5LA 4C3YA 4RSLA 3NK0X 3NRNA 3NYFA 4BURA 3BNUA 1L0VA 2YG3A 1VG0A 4YTPA 1GRFA 4ZCDA 1DXLA 4AP3A 4EIQA 4H4ZA 2WP5A 2FJEA 3UOVA 4J57A 2YLWA 1K0IA 1D4EA 3FMWA 3DGZA 1NAAA 1ELIA 3AE7A 1Q1RA 5DBJA 2X50A 2GAHB 3FPZA 2PYXA 4KPRA 3QFAA 1IJHA 3ZYXA 2VVLA 4Z2TA 3AE4A 4PAAA 2C7GA 1XANA 4TM1A 2Y6RA 2VQ7A 5KWFA 3NIXA 4FK1A 4U8LA 1RYIA 1NENA 2DKHA 1ZY8A 2NVKX 5KXJA 1FL2A 3NN0X 2XFNA 2A8XA 4B1BA 4XWRA 5EOWA 2VRLA 2YVFA 3B3RA 1JEHA 3NYEA 4H2QA 3IHMA 3BHKA 1VG9A 2VOUA 4X4JA 1JOAA 4H4RA 1ZOVA 2X8GA 3UP4A 1N1PA 4YTMA 1MOKA 1VDCA 2XLRA 3GRTA 3C96A 1D5TA 3AECA 3F8RA 3NLCA 3UP5A 4Z2RA 1GEUA 3GYJA 2YWLA 1YY5A 2WPCA 2VRMA 4Y4LA 3ATQA 4Z26A 1LJ1A 4U2SA 3NTDA 1BGNA 3FBSA 3H8LA 3AE1A 3ISHA 4LU6A 4UDRA 2GQFA 1TDEA 1NG4A 3DK4A 2XLSA 3ITJA 3AE2A 3UCLA 3L1RA 1S3EA 4JN9A 4EIPA 3AD9B 2AQJA 3LJPA 4TLZA 2ZZBA 3AEEA 4C5OA 1PXAA 3PVCA 1LQTA 4B68A 4Z43A 2CDUA 1IUXA 2C67A 1RP0A 4BK1A 1LV0A 3DGHA 2VVMA 3BHFA 4OPTA 4U2LA 2Y6QA 4USQA 3G5RA 1H7XA 4X9MA 4E0VA 3CGCA 4JNQA 2YLZA 4DNAA 2GR0A 1NHRA 1Y56A 2BXSA 1CC2A 1CC6A 5JCMA 1GTHA 1ZK7A 3D8XA 3F8DA 1MXTA 2GR3A 2H89A 1GT8A 3NN6X 4BV6A 5JCIA 2GEWA 2YR6A 4GDEA 4A65A 2CFYA 1H82A 1N4VA 4NTEA 4B64A 3RP7A 3AEFA 4N9XA 1Y0PA 1E1LA 2TMDA 5FS6A 1OJAA 3C4NA 3GWFA 4JY2A 2BK5A 4CBQA 4P9SA 1HYUA 3O0HA 1CC4A 3P4PA 1TDNA 4O5QA 2EQ6A 4B63A 1PHHA 3I6DA 2JAEA 5ER0A 3L8KA 4Z44A 2YAUA 2C3DA 1F3PA 1GREA 3EF6A 1GRGA 1GSNA 2YLTA 4ZN0A 4NZHA 2C76A 1B5QA 1GXFA 2V6OA 2ARDA 4JDRA 2BK4A 3Q9TA 3UOYA 1H86A 2GR2A 3S61A 4EMWA 3UTHA 3AE9A 2YVGA 1BZLA 3NNEA 3T37A 4H4UA 3IWAA 2BCPA 2GMHA 3M13A 2YLRA 2BC0A 3H4KA 1O95A 2GAGB 4ECHA 5FS7A 1N4UA 3OZ2A 4YKGA 2RGOA 3F8PA 2C72A 4EQXA 1KSUA 4OPCA 4C77A 4BK2A 1GETA 2WEUA 3GDPA 1NHPA 3VR9A 4OVIA 1XHCA 5J60A 4EMIA 4CRTA 1M64A 3EANA 5TR3A 3QVPA 5L46A 2XFQA 3P4SA 2WOWA 4I58A 3QFBA 1YQ4A 3CNDA 3PS9A 4FX9A 4AT0A 5HY5A 3B6DA 3LOVA 1DJNA 1S2YA 1UKVG 2IVDA 3REDA 2XDOA 4B67A 5IPYA 2FBWA 3SGLA 1E6EA 5KOXA 1B8SA 3EPTA 3LB8A 2Z5YA 1E7PA 5BVAA 2YLXA 1IUUA 2F5ZA 4AT2A 1JRYA 1GERA 2OAMA 2B9WA 2XCGA 1FECA 3COXA 4B66A 3LXDA 1ZDLA 2RGHA 2B76A 3K7TA 1ZMCA 3ICTA 4K2XA 5JCNA 3DJGX 4EMJA 3KA7A 3UOXA 4GRTA 3SQPA 2B9XA 2C75A 1JNRA 4H4PA 4Z2UA 2IIDA 3ALLA 1SEZA 1LPFA 4XXGA 1XDIA 1TYPA 2XFUA 3FIMB 4C74A 3DH9A 3ZDNA 4Z25A 3SM8A 3VR8A 1IUVA 3EAOA 1CHUA 3Q6JA 1NHSA 3KVEA 2Q7VA 3UKQA 5LV9A 1GESA 1D7YA 1K0LA 4REKA 2OLNA 3AE3A 1P2HA 5EBKA 4WX1A 2ACZA 1H81A 3GRSA 1P2EA 3ALJA 4EM4A 2JB2A 4H4YA 5IQ1A 2FJBA 4J36A 3AYIA 2BA9A 2ZBWA 4RG4A 3RP6A 2C3CA 1EBDA 3DK9A 1GRAA 4KX6A 1ZMDA 5KRQA 3ALMA 2WU5A 3BI2A 2X8CA 3GYIA 5BULA 1S3BA 4WCTA 1LVLA 3RP8A 3V3OA 2V61A 1S2QA 4ICYA 4H4TA 3DMEA 1LTXR 1L9DA 3NG7X 1E1KA 2A87A 1GRTA 2OLOA 3NHOX 4JNAA 2GQWA 2V5ZA 4H4WA 2WPEA 1EL5A 1GV4A 3GD3A 1BKWA 1PJ7A 2QA2A 1PXCA 2XYOA 3DJDA 3II4A 2YG7A 3CTYA 4M52A 3KPFA 2E1MA 2XVEA 4AP1A 1ZX9A 2XVJA 2X3NA 2YG6A 3QJ4A 1B4VA 4BJZA 4YSZA 5BUKA 1N4WA 3P9UA 1Z6LA 4J33A 4A79A 2VVLG 4BK3A 3CNTA 5J7XA 2C64A 2JBVA 1PS9A 3RHAA 2C73A 4DGKA 2YG4A 1DNCA 1TDKA 2ZZ0A 4K8DA 1JRZA 3DK8A 1PBFA 2FJAA 2VQBA 1YKJA 4H4QA 2OA1A 3AYLA 1Q1WA 2EQ9A 1QJDA 2HQMA 3UKHA 4FK1C 4U8KA 2WOVA 3VRAA 1ZOYA 2WBAA 1PBBA 2XFOA 4TM3A 4J2WA 5KOWA 1JRXA 3URHA 2R0PA 4UDPA 2V3BA 1D4CA 2Z5XA 4ADWA 1H6VA 3CNSA 2BK3A 2WDVA 4OPUA 4OPLA 1PBEA 4NTCA 4U2TA 3P1WA 3UKLA 3LZXA 3CGDA 3WE0A 5HYMA 1IUTA 3ADAB 5JCLA 3UKPA 4CNJA 4CCQA 1YQ3A 4USRA 3ICRA 2XVIA 1KNRA 4BJYA 2BS3A 4HA6A 1NG3A 4IVMB 1JNZA 4GF7A 4U8OA 4A6NA 3SFDA 4CCRA 4UDQA 2YG5A 4YSXA 2WP9A 3I3LA 1V59A 1L9CA 3NH3X 5HXIA 1D4DA 5U25A 2JK6A 1BF3A 4EM3A 2B7RA 1KDGA 3GMBA 2XFPA 2QAEA 3AEGA 4AOSA 2GH5A 2RGJA 4TLXA 1F6MA 1FOHA 1E39A 4Z24A 1Q9IA 4PABA 1QO8A 2APGA 2QCUA 5M10A 4K7ZA 3V3NA 1QLBA 3D1CA 4GCMA 3H8IA 5KVHA 1GALA 3UTFA 4HB9A 3E1TA 2V60A 2JB3A 5U1OA 4H7UA 2R9ZA 1JU2A 2WDRA 3CNJA 1ZKQA 1EL9A 3ABVA 3C4AA 4OPDA 2BABA 1W4XA 2YR4A 1F8RA 1NHQA 2GB0A 3AEDA 1AOGA 5GSNA 2NPXA 1Y56B 3IHGA 3AD8B 1IUSA 2BXRA 4JY3A 2OALA 1DOEA 2YVJA 4B69A 3NT6A 3RNMA 4A7AA 2ZZCA 2RABA 3R9UA 1CJ2A 2WU2A 3KLJA 3LZWA 2X99A 1DJQA 3HZLA 2Q0KA 1K0JA 1M6IA 3P4RA 4U8IA 2VZ2A 4EQSA 3ATRA 4YSYA 1VRQB 2XLPA 3ICSA 4K5SA 2GMJA 3AE5A 3P4QA 3SFEA 5C2TA 3NKSA 3CGBA 3GD4A 2C65A 3QSSA 4MJWA 2FJDA 4X9NA 3UKFA 4AOXA 1GRHA 1OJTA 5FS8A 2WS3A 3UKKA 1XPQA 4J56A 3CIRA 1TDOA 2AR8A 5EB4A 2PHHA 1REOA 1GNDA 2GF3A 4UP3A 4YKFA 1YQZA 2E4GA 4U8JA 1PXBA 4IA6A 2R46A 4J34A 4CNKA 3UTGA 2EQ7A 4RG3A 1OJDA 1TDFA 4U8NA 1CJCA 1FEBA 2WHDA 2X8HA 2GRTA 2YR5A 3DA1A 3UKAA 1MO9A 4OCGA 1COYA 4A6NB 3QVRA 5KVIA 2BC1A 1ONFA 4APNA 3G5QA 2GR1A 2GV8A 3KKJA 3VRBA 2R0GA 1PN0A 3QSMA 3K30A 3M0OA 4H4XA 4IV9A 3AYJA 5EB5A 1CBOA 1NPXA 4H50A 1H83A 2E5VA 4K5RA 2EQ8A 4H2PA 5IQ4A 1OJCA 2A89A 4H4VA 3AE8A 3CPHG 1O5WA 4A99A 4H4SA 3BNMA 3NK1X 4CY6A 3NTAA 3GDNA 1PDHA 1CJ3A 2IVEA 4O5UA 1CF3A 1CJ4A 3PO7A 1H7WA 1TYTA 3DJJA 2XVFA 2B7SA 1TRBA 3CPIG 1O94A 4YXDA 2AAQA 4A9WA 3CGEA 4EQWA 1LQUA 1IUWA 1PBCA 2O9ZA 3AD7B 2YQUA 1KNPA 1F8SA 1B37A 3NGCX 2WDQA 3GSIA 1EL8A 1X31B 3CN8A 5JCKA 3AE6A 4D03A 4YSHA 3VRDB 2BS2A 3AEAA 4Y4MA 5CQFA 2QA1A 1GRBA 1EL7A 3AEBA 3GWDA 1KF6A 4ZCCA 1F8WA 2C66A
chains in the Genus database with same CATH superfamily
4TM0A 2GSHA 5U63A 4D04A 2BACA 1DOCA 4YT0A 3K7MX 4Y4NA 3BI5A 2BRYA 1NEKA 1K4QA 3DG7A 3NYCA 2Q0LA 2BYBA 4G7FA 2HZGA 1WUFA 3BSMA 3VQRA 3KU9A 2WESA 4GDPA 3NK2X 5ENLA 5HHFA 4JQ9A 3AWIA 3CPJG 4K22A 4LA1A 4OPGA 4NEWA 5C3JA 5FS9A 2QDDA 3IC9A 1CL0A 5M0ZA 3GMCA 4IZGA 1PJ6A 2Q6UA 3DJEA 3ES7A 2BS4A 5BRTA 2WP6A 3UTEA 3K7QX 4GUVA 3IF9A 4XWZA 4A5LA 1ZXIC 3BNUA 3SN4A 4AP3A 4NWZA 2WP5A 4J57A 1NAAA 3AE7A 1ELIA 4GAVA 4KPRA 1IJHA 3H8AA 1R0MA 2DW7A 3NVZB 3V4BA 2A8XA 4B1BA 2VRLA 3IHMA 3BHKA 1JOAA 1OEPA 1JPMA 1VDCA 4YTMA 3AECA 5FJRA 2PTZA 3ATQA 4U2SA 3U4FA 3GYXA 2QJJA 3QTPA 3AE2A 3IJIA 4C5OA 3AEEA 3PVCA 1MDRA 2I5QA 4K2SA 2PS2A 2PSNA 4BK1A 4U2LA 2Y6QA 4DNAA 1NHRA 4H1ZA 1MRAA 1CC6A 5JCMA 3TWAA 1ZK7A 2GR3A 4NNJA 4GDEA 2GEWA 4B64A 1N62C 3SX6A 4N9XA 4DN1A 3GWFA 5FS6A 3SZFA 4CBQA 1KKOA 1HYUA 5ER0A 3L8KA 5KMQA 2YAUA 2C3DA 2OX4A 2AL2B 3Q9TA 4JDRA 3AE9A 1BZLA 3NNEA 2BCPA 2GMHA 1O95A 2GAGB 4ECHA 4DWDA 3TWBA 1GETA 3GDPA 4EMIA 2WOWA 5FJPA 3LOVA 1DJNA 4B67A 2IVDA 3SGLA 1B8SA 3EPTA 4TVYA 2F5ZA 1JRYA 3SSZA 3K7TA 1ZMCA 3UJFA 1V97A 2BRAA 4GRTA 1TYPA 2OQYA 4C74A 3DH9A 3ZVHB 2PP0A 1IUVA 2Q7VA 4GGBA 1K0LA 3AE3A 1NU5A 4KEMA 1H81A 3NO1A 2JB2A 5IQ1A 4J36A 4HCLA 3RP6A 3DK9A 1EBDA 4GMEA 5FJTA 3RP8A 3V3OA 5BOEA 3DMEA 1LTXR 1E1KA 2A87A 4HPNA 1JDFA 3HPFA 5M10A 4XXGA 3II4A 2E1MA 2XVEA 4F4RA 2C64A 2JBVA 3I6TA 3V5FA 3KPKA 1DNCA 4JN8A 2OA1A 2EQ9A 2HQMA 4FK1C 3DDMA 1FIQB 3HW2A 5KOWA 2R0PA 2WDVA 4OPLA 4U2TA 3P1WA 1P48A 4BJYA 2BS3A 4A6NA 3SFDA 2YG5A 3VC5A 1V59A 5HXIA 1D4DA 4DXKA 1BF3A 4IHCA 1F6MA 1FOHA 2GGGA 4Z24A 4PABA 2GGIA 3V3NA 3SZCA 3D1CA 2DW6A 2XGZA 4HN8A 1GALA 3HYWA 1SJAA 2R9ZA 2WDRA 3DG6A 4OPDA 1NHQA 2GB0A 4G74A 1IUSA 2YVJA 2ZZCA 2PTYA 4GISA 2WU2A 3I4KA 1EC7A 4GGHA 3A7AA 2XLPA 4G6HA 3ICSA 3AE5A 3P4QA 3NKSA 1N5WC 4X9NA 3FCPA 5FS8A 2WS3A 3CIRA 1FHUA 2PHHA 4YKFA 2PGWA 4U8JA 4IA6A 2R46A 3HRDC 4ROPA 1OJDA 1FEBA 2AL2A 2X8HA 1COYA 3QVRA 4APNA 4JN7A 2O56A 2R0GA 1STZA 4MKSA 3K30A 3M0OA 4G73A 4IV9A 5EB5A 1EC8A 1O5WA 4H4SA 3BNMA 4CY6A 2ONEA 3S47A 4O5UA 3MY9A 2B7SA 3AD7B 2YQUA 1KNPA 3A7UA 3GSIA 5JCKA 2AKMA 3AD9B 3GD6A 3LADA 4MMWA 4U8MA 4B65A 1FFUC 3VCCA 2YM1A 4TM4A 3RITA 2XVHA 3KD9A 3H7VA 3JSKA 3V76A 3AXBA 4I59A 1DODA 2OO6A 3ZLHA 2WETA 2PTWA 3QSEA 1BWCA 2W0HA 1PBDA 3ENLA 2WQYA 2YLSA 3PWIA 1E1MA 3DESA 2XSXA 4GR1A 4ENLA 1D7LA 1KN0A 1GOSA 3SQSA 3K1GA 2R4EA 4DSHA 2JKCA 1OJ9A 3OC4A 4NTDA 3M12A 1NDAA 2XLTA 4H2NA 4C3XA 3B97A 1SJBA 2TPRA 4C3YA 3CB3A 1VG0A 4YTPA 1GRFA 2YLWA 1K0IA 1D4EA 5DBJA 2PYXA 3QFAA 3ZYXA 2VVLA 3VDGA 1JCTA 5KWFA 3NIXA 4FK1A 4U8LA 3H12A 1NENA 2DKHA 5KXJA 5EOWA 2YVFA 3BJSA 4X4JA 3R10A 1VG9A 2VOUA 1N5XA 1TZZA 3MUCA 3TQPA 2XLRA 1D5TA 4E4UA 2AL1A 3F8RA 3NLCA 1GEUA 2YWLA 4Z26A 3UJ2A 1BGNA 3FBSA 4IP4A 3AE1A 3ISHA 1IYXA 2GQFA 1TDEA 1NG4A 3DK4A 2XLSA 3ITJA 1SJDA 4HNCA 3L1RA 4JN9A 4EIPA 4TLZA 2ZZBA 2CDUA 1LV0A 2VVMA 1P43A 4USQA 1H7XA 3S5SA 4JNQA 2BXSA 3MQTA 1CC2A 1GTHA 2ZC8A 3PFRA 4K8GA 3MSYA 1H82A 3ETRB 4NTEA 3RP7A 1Y0PA 3PK7A 2TMDA 4JY2A 2OZ8A 4P9SA 4IL0A 3O0HA 1FFVC 4GAPA 1TDNA 4Z1YA 4Z44A 1F3PA 3EF6A 2PP1A 1GXFA 3UOYA 1H86A 2GR2A 4EMWA 2PU1A 3UJSA 3T37A 1N61C 2PP3A 3GY1A 3H4KA 4X2PA 1N4UA 4YKGA 1KSUA 4OPCA 3NFUA 2WEUA 3VR9A 4OVIA 2XH0A 5J60A 4J1OA 4CRTA 5L46A 3QVPA 2XFQA 3QFBA 3PS9A 5HY5A 3B6DA 3REDA 2YLXA 1IUUA 1GERA 3SYIA 3MKCA 2XCGA 2QQ6A 2QJNA 2QVHA 3ICTA 1FHVA 2P8BA 3DJGX 3UOXA 4J3ZA 3SQPA 1JNRA 1XDIA 1YEYA 2XFUA 2OPJA 3DEQA 3SM8A 3CMMA 2OQHA 1D7YA 1GESA 4REKA 2OLNA 1P2HA 1JROA 1P2EA 3ALJA 4EM4A 3NS1B 3RO6A 2ZBWA 4RG4A 3ALMA 3BI2A 3STPA 1S3BA 4WCTA 2V61A 4JNAA 4Z17A 1GV4A 3GD3A 1E9IA 3KPFA 3DFYA 3DJDA 2YG7A 4M52A 4AP1A 1KKRA 3QJ4A 1Z6LA 4J33A 3SY4A 4A79A 3TCSA 4DGKA 3TJ4A 4II2A 1TDKA 2ZZ0A 3DK8A 4H4QA 4U8KA 3QN3A 4H2HA 1PBBA 1PDZA 4J2WA 3URHA 3IJLA 4JHMA 4UDPA 3PG6A 3PWGA 4ADWA 2PCEA 3AM9A 4OPUA 4NTCA 3UKLA 3LZXA 3T4WA 3CGDA 3WE0A 1IUTA 3ADAB 5JCLA 1YQ3A 2QJMA 1KNRA 1JNZA 4GF7A 4U8OA 4CCRA 4UDQA 3NZGA 5U25A 2QAEA 2PMQA 4AOSA 2GH5A 4E8GA 4MGGA 3I6EA 3OZYA 1QO8A 7ENLA 3VFCA 2QCUA 1KCZA 5KVHA 3UTFA 2JB3A 4H7UA 1ZKQA 1EL9A 3VC6A 4KPLA 2YR4A 1F8RA 3AEDA 5GSNA 1Y56B 3T9PA 3OTRA 2PPGA 2BXRA 2OALA 2RABA 3R9UA 3FJ4A 2E3TA 3KLJA 3V5CA 3HZLA 2Q0KA 1K0JA 3DGBA 1M6IA 4U8IA 2VZ2A 4EQSA 3ATRA 3SFEA 5C2TA 3CGBA 3GD4A 5FJUA 1OJTA 3UKKA 4J56A 1TDOA 2AR8A 4UP3A 2E4GA 1PXBA 3T2YA 3UCCA 3CT2A 4GFIA 5CKUA 3UKAA 2YR5A 3DA1A 2GGEA 1ONFA 1JRPA 2GV8A 3VRBA 2XH4A 1H83A 4H50A 5IQ4A 2EQ8A 4H2PA 2A89A 3CPHG 3ZLFA 1BQGA 3NTAA 1PDHA 1CJ4A 3PO7A 3DFHA 1TYTA 3DJJA 3FXGA 1TRBA 1O94A 3CGEA 4EQWA 1B37A 3NGCX 1EL8A 3CN8A 3AE6A 3R0KA 1XPYA 3CYJA 3AEAA 3GWDA 1F8WA 2C66A 3DERA 4NEVA 3G5SA 1L9EA 1KFYA 2OZTA 2WOIA 5FMHA 2C70A 3AB1A 3T6CA 2R45A 4G6GA 1GTEA 4DSGA 2XH7A 3NVWB 4EQRA 2NQLA 3CNPA 2J3NA 3N6HA 4LIIA 2GGHA 2PTXA 1TKKA 2RDXA 2H88A 1DOBA 2GVCA 3OW1A 1KSSA 1VDVA 2R0CA 2CVJA 1FCDA 3QKEA 1E1NA 3UXKA 4RSLA 3NRNA 3NYFA 4BURA 2YG3A 4ZCDA 1DXLA 3FMWA 3DGZA 1Q1RA 4Z2TA 3AE4A 1XANA 5G5GB 1RYIA 1ZY8A 1FL2A 3NN0X 2XFNA 1X2GA 5KNLA 3B3RA 3HYXA 2X8GA 1N1PA 1MOKA 3TTEA 1VQZA 5KMSA 3FVDA 4Z2RA 4E4FA 4HYRA 4Y4LA 1LJ1A 4YWSA 3NTDA 3H8LA 4LU6A 4UDRA 3T14A 2AQJA 3LJPA 5FJOA 4B68A 4Z43A 2FKPA 1IUXA 2HXTA 1RP0A 1MDLA 3BHFA 3G5RA 4IL2A 1Y56A 3T31A 1MXTA 1GT8A 4BV6A 4A65A 2P88A 1N4VA 3ZVHA 1OJAA 3R1ZA 4TVWA 2BK5A 3RR1A 1CC4A 3UGVA 4B63A 3I6DA 3VCNA 1GREA 3UCDA 1GSNA 4ZN0A 3RRAA 3Q4DA 3QPEA 2V6OA 2BK4A 3UTHA 2YVGA 2MNRA 3IWAA 1RM6B 2BC0A 1W6TA 3AMZA 1PDYA 2C72A 4C77A 3GC2A 1NHPA 4M6UA 3MWCA 1M64A 3P4SA 1YQ4A 4FX9A 5G5HB 2OVLA 3R0UA 3LB8A 2Z5YA 5BVAA 2HNEA 3B9JB 3ES8A 3COXA 4B66A 3LXDA 2RGHA 2B76A 4EMJA 3KA7A 4Z2UA 2B9XA 2W3SA 2OKTA 4H4PA 3ALLA 3SN1A 1SEZA 3FIMB 4Z25A 2MUCA 3EKGA 3EAOA 3Q6JA 5LV9A 2E5AA 3SJNA 3T8QA 2ACZA 4WX1A 3GRSA 4H4YA 2FJBA 3AYIA 4KX6A 5KRQA 2WU5A 2X8CA 3GYIA 4ICYA 1S2QA 2OZ3A 3NG7X 1GRTA 2GQWA 4H4WA 2QA2A 1EL5A 1BKWA 4TM1A 2XYOA 1DTNA 3CTYA 2HXUA 2X3NA 2YG6A 1B4VA 4BJZA 5BUKA 3P9UA 2VVLG 4BK3A 3Q45A 4M0XA 2OFJA 1JRZA 1YKJA 1Q1WA 3CXBA 1NELA 3P3BA 3UKHA 2WOVA 4G9KA 1ZOYA 2WBAA 2XFOA 1JRXA 1H6VA 3CNSA 2BK3A 4FI4A 4GYPC 4CNJA 3UKPA 4CCQA 2XVIA 4HNLA 3T2ZA 3HYVA 3I3LA 2JK6A 2OG9A 2B7RA 1KDGA 3GMBA 2XFPA 2RGJA 1TE6A 1E39A 3N4EA 1Q9IA 3SBFA 1F9CA 4K7ZA 1ECQA 1QLBA 3T2KA 4GCMA 3E1TA 5U1OA 1JU2A 3C4AA 2BABA 1W4XA 1AOGA 1N60C 3AD8B 4JY3A 3D9XA 4B69A 3RNMA 1L8PA 4HCDA 4DYEA 5J04A 1VRQB 2PGEA 3RGTA 4K5SA 3FYYA 3QSSA 2C65A 1X2HA 3TOYA 1KD0A 1WYGA 1MNSA 4J34A 3UTGA 2EQ7A 4RG3A 4G8TA 2GRTA 3D47A 4A6NB 4OCGA 5KVIA 3G5QA 2GR1A 1ELSA 3KKJA 3N4FA 4A6GA 1PN0A 3QSMA 4E5TA 3AYJA 3V3WA 3IK4A 1CBOA 1NPXA 4K5RA 1RVKA 1OJCA 4H4VA 3AE8A 3NK1X 3GDNA 1CJ3A 1CF3A 3JVAA 3FV9A 2PA6A 4YXDA 2AAQA 1LQUA 1PBCA 2O9ZA 3BOXA 1F8SA 2AKZA 1T3QC 3JZUA 4ZCWA 5JRBA 4YSHA 3VRDB 5CQFA 2QA1A 1GRBA 3H70A 1EL7A 3AEBA 4ZCCA 4XWRA 2PODA 4OPIA 4A3RA 2WPFA 3NVYB 1ZP0A 4IVOB 3SXIA 2R4JA 2BCGG 1VQWA 2DKIA 2B9YA 2GDQA 3KUMA 3FG2P 1H84A 1RSGA 4CY8A 4YTNA 4H2RA 4J31A 2I0ZA 2V3AA 3GO2A 4U8PA 1GPEA 2YM2A 1BGJA 1FEAA 2CULA 2JB1A 4YWOA 3BI4A 4IT1A 3QLDA 2ZADA 3SZWA 3S5WA 4IA5A 4FDCB 3UJEA 2UZZA 3UOZA 2XLUA 1PJ5A 5GRTA 2QDEA 1MUCA 3NK0X 1L0VA 3NXLA 4EIQA 4H4ZA 2FJEA 3UOVA 4IP5A 3SN0A 2X50A 2GAHB 3FPZA 4PAAA 2C7GA 2Y6RA 2VQ7A 3D46A 2NVKX 2P0IA 1JEHA 3NYEA 4H2QA 4A35A 4H4RA 1ZOVA 3UP4A 1JPDX 3GRTA 3C96A 4GYPA 3UP5A 3GYJA 3UJRA 2WPCA 1YY5A 4HCHA 2VRMA 1SB3B 3IJQA 3R25A 3UCLA 1S3EA 3N6JA 1EBHA 1PXAA 3ZLGA 1LQTA 2C67A 3CXOA 3DGHA 4OPTA 2QGYA 4X9MA 4E0VA 3CGCA 2YLZA 2GR0A 3L5OA 2POZA 3NRZB 3D8XA 3OPSA 3F8DA 2H89A 6ENLA 3NN6X 5JCIA 2YR6A 2CFYA 1R6WA 2GGJA 3AEFA 1E1LA 3C4NA 1WUEA 1SJCA 3P4PA 4O5QA 2CHRA 2EQ6A 1PHHA 2JAEA 2OLAA 1GRGA 2YLTA 3R07C 4NZHA 2C76A 2W3RA 1B5QA 4K1WA 2ARDA 3S61A 4DHGA 4H4UA 3M13A 2YLRA 1ONEA 5KMRA 5FS7A 3OZ2A 2RGOA 3P93A 3F8PA 4EQXA 4BK2A 1XHCA 3EANA 5TR3A 4FP1A 3CK5A 4EWJA 3OP2A 4I58A 3CNDA 4AT0A 1S2YA 1UKVG 5IPYA 2XDOA 2FBWA 1E6EA 5KOXA 1E7PA 3P0WA 5IDZA 2OAMA 2B9WA 1FECA 1ZDLA 3MZNA 4K2XA 5JCNA 2C75A 4KWSA 2IIDA 1LPFA 4KT2A 3ZDNA 3VR8A 3AN1A 1CHUA 1NHSA 3KVEA 3UKQA 3RCYA 2PU0A 2C4CA 5EBKA 1BKHA 2BA9A 3CAWA 2C3CA 1GRAA 1ZMDA 5BULA 3EUB3 4DX3A 1LVLA 4H4TA 1L9DA 2OLOA 3NHOX 2V5ZA 2WPEA 1PJ7A 3THUA 4AT2A 1PXCA 2XH2A 1ZX9A 2XVJA 4YSZA 1N4WA 3CNTA 5J7XA 1PS9A 3RHAA 2C73A 2YG4A 4K8DA 1PBFA 2FJAA 2VQBA 3AYLA 1QJDA 3VRAA 4TM3A 1XS2A 2V3BA 4ZOHB 1D4CA 2Z5XA 3T0KA 4GIRA 1FO4A 1PBEA 3UXLA 2GL5A 5HYMA 4USRA 3ICRA 4E6MA 4HA6A 1NG3A 4IVMB 4YSXA 2WP9A 2W55A 1L9CA 3NH3X 4EM3A 3AEGA 3VA8A 1S7MA 4TLXA 2APGA 3R11A 4II3A 3H8IA 3TW9A 4HB9A 2V60A 3CNJA 3ABVA 2P3ZA 2NPXA 3IHGA 1EBGA 1DOEA 3NT6A 4A7AA 3ZVIA 1CJ2A 3LZWA 2X99A 4ZA0A 1DJQA 3U9IA 4YSYA 3P4RA 2GMJA 4MJWA 2FJDA 3UKFA 4AOXA 1GRHA 1XPQA 3OZMA 3EEZA 5EB4A 5BOFA 1REOA 1GNDA 2GF3A 1YQZA 1N63C 4CNKA 4H83A 1TDFA 4U8NA 1CJCA 2WHDA 1MO9A 3SR6B 3NVVB 2FYMA 2BC1A 4H4XA 4H19A 3TJIA 3SZ0A 2E5VA 4A99A 5EU9A 2P8CA 3DG3A 2IVEA 1H7WA 2XVFA 1H2IA 3CPIG 2W54A 4A9WA 1IUWA 1EC9A 2WDQA 3A7RA 4D03A 1X31B 3DIPA 5KMPA 2BS2A 3JW7A 4Y4MA 1KF6A
chains in the Genus database with same CATH topology
4TM0A 3LADA 4NEVA 3G5SA 1L9EA 1KFYA 5U63A 2WOIA 4D04A 2BACA 1DOCA 4U8MA 4B65A 3K7MX 4OPIA 4YT0A 2WPFA 2YM1A 4Y4NA 4TM4A 2XVHA 1ZP0A 4IVOB 3KD9A 3BI5A 3SXIA 3JSKA 2BRYA 3V76A 5FMHA 3AXBA 2R4JA 2BCGG 4I59A 2C70A 1NEKA 3AB1A 1K4QA 1VQWA 2R45A 4G6GA 1DODA 2DKIA 3NYCA 2B9YA 2Q0LA 2BYBA 2WETA 1GTEA 4DSGA 3FG2P 3QSEA 1H84A 1BWCA 3KU9A 1RSGA 2WESA 3VQRA 4CY8A 4EQRA 2W0HA 4YTNA 4GDPA 1PBDA 3NK2X 5HHFA 3CNPA 4JQ9A 2J3NA 2WQYA 2YLSA 3AWIA 1E1MA 2I0ZA 3CPJG 4H2RA 4LA1A 2V3AA 4LIIA 4J31A 4K22A 4OPGA 4U8PA 4NEWA 5C3JA 5FS9A 4GR1A 1GPEA 2YM2A 1D7LA 1KN0A 1GOSA 5CKUA 1BGJA 1FEAA 2CULA 3IC9A 2JB1A 1CL0A 4YWOA 2H88A 1DOBA 3BI4A 5M0ZA 2R4EA 4DSHA 2GVCA 1OJ9A 2JKCA 3GMCA 3OC4A 1KSSA 1PJ6A 4NTDA 3SZWA 2Q6UA 3DJEA 3S5WA 2R0CA 3M12A 1NDAA 2CVJA 2XLTA 4H2NA 4IA5A 4FDCB 2UZZA 1FCDA 4C3XA 3UOZA 2BS4A 2XLUA 1PJ5A 5GRTA 1E1NA 5BRTA 2WP6A 3UTEA 2TPRA 3K7QX 3IF9A 4GUVA 4XWZA 4A5LA 4C3YA 4RSLA 3NK0X 3NRNA 3NYFA 4BURA 3BNUA 1L0VA 2YG3A 1VG0A 4YTPA 1GRFA 4ZCDA 1DXLA 4NWZA 4AP3A 4H4ZA 2WP5A 2FJEA 4EIQA 3UOVA 4J57A 2YLWA 1K0IA 1D4EA 3FMWA 3DGZA 1NAAA 1ELIA 3AE7A 1Q1RA 4GAVA 5DBJA 2X50A 2GAHB 3FPZA 2PYXA 4KPRA 3QFAA 1IJHA 3ZYXA 2VVLA 4Z2TA 3AE4A 4PAAA 2C7GA 1XANA 4TM1A 2Y6RA 2VQ7A 5KWFA 3NIXA 4FK1A 4U8LA 1RYIA 1NENA 2DKHA 1ZY8A 2NVKX 5KXJA 1FL2A 3NN0X 2XFNA 2A8XA 4B1BA 4XWRA 5EOWA 2VRLA 5KNLA 2YVFA 3B3RA 1JEHA 3NYEA 4H2QA 3IHMA 3BHKA 1VG9A 2VOUA 3HYXA 4X4JA 1JOAA 4H4RA 1ZOVA 2X8GA 3UP4A 1N1PA 4YTMA 1MOKA 1VDCA 2XLRA 3GRTA 3C96A 1D5TA 3AECA 3F8RA 3NLCA 3UP5A 5KMSA 4Z2RA 1GEUA 3GYJA 2YWLA 1YY5A 2WPCA 2VRMA 4Y4LA 3ATQA 4Z26A 1LJ1A 4U2SA 3NTDA 1BGNA 3FBSA 3H8LA 3AE1A 3ISHA 4LU6A 3GYXA 4UDRA 2GQFA 1TDEA 1NG4A 3DK4A 2XLSA 3ITJA 3T14A 3AE2A 3UCLA 3L1RA 1S3EA 4JN9A 4EIPA 3AD9B 2AQJA 3LJPA 4TLZA 2ZZBA 3AEEA 4C5OA 1PXAA 3PVCA 1LQTA 4B68A 4Z43A 2CDUA 1IUXA 2C67A 1RP0A 4BK1A 1LV0A 3DGHA 2VVMA 3BHFA 4OPTA 4U2LA 2Y6QA 4USQA 3G5RA 1H7XA 4X9MA 4E0VA 3CGCA 4JNQA 2YLZA 4DNAA 2GR0A 1NHRA 1Y56A 2BXSA 3L5OA 3T31A 1CC2A 1CC6A 5JCMA 1GTHA 1ZK7A 3D8XA 3F8DA 1MXTA 2GR3A 2H89A 1GT8A 4NNJA 3NN6X 4BV6A 5JCIA 2GEWA 2YR6A 4GDEA 4A65A 2CFYA 1H82A 1N4VA 4NTEA 4B64A 3SX6A 3RP7A 3AEFA 4N9XA 1Y0PA 1E1LA 2TMDA 5FS6A 1OJAA 3C4NA 3GWFA 4JY2A 2BK5A 3SZFA 4CBQA 4P9SA 1HYUA 3O0HA 1CC4A 3P4PA 4GAPA 1TDNA 4O5QA 2EQ6A 4B63A 1PHHA 3I6DA 2JAEA 5ER0A 3L8KA 5KMQA 4Z44A 2YAUA 2C3DA 1F3PA 1GREA 3EF6A 1GRGA 1GSNA 2YLTA 4ZN0A 4NZHA 2C76A 1B5QA 1GXFA 2V6OA 2ARDA 4JDRA 2BK4A 3Q9TA 3UOYA 1H86A 2GR2A 3S61A 4EMWA 3UTHA 3AE9A 2YVGA 1BZLA 3NNEA 3T37A 4H4UA 3IWAA 2BCPA 2GMHA 3M13A 2YLRA 2BC0A 3H4KA 1O95A 5KMRA 2GAGB 4ECHA 5FS7A 1N4UA 3OZ2A 4YKGA 2RGOA 3F8PA 2C72A 4EQXA 1KSUA 4OPCA 4C77A 4BK2A 1GETA 2WEUA 3GDPA 1NHPA 3VR9A 4OVIA 1XHCA 5J60A 4EMIA 4CRTA 1M64A 3EANA 5TR3A 3QVPA 5L46A 2XFQA 3P4SA 2WOWA 4I58A 3QFBA 1YQ4A 3CNDA 3PS9A 4FX9A 4AT0A 5HY5A 3B6DA 3LOVA 1DJNA 1S2YA 1UKVG 2IVDA 3REDA 2XDOA 4B67A 5IPYA 2FBWA 3SGLA 1E6EA 5KOXA 1B8SA 3EPTA 3LB8A 2Z5YA 1E7PA 5BVAA 2YLXA 1IUUA 2F5ZA 4AT2A 1JRYA 1GERA 2OAMA 3SYIA 2B9WA 2XCGA 1FECA 3COXA 4B66A 3LXDA 1ZDLA 2RGHA 2B76A 3K7TA 1ZMCA 3ICTA 4K2XA 5JCNA 3DJGX 4EMJA 3KA7A 3UOXA 2BRAA 4GRTA 3SQPA 2B9XA 2C75A 1JNRA 4H4PA 4Z2UA 2IIDA 3ALLA 1SEZA 1LPFA 4XXGA 1XDIA 1TYPA 2XFUA 3FIMB 4C74A 3DH9A 3ZDNA 4Z25A 3SM8A 3VR8A 1IUVA 3EAOA 3CMMA 1CHUA 3Q6JA 1NHSA 3KVEA 2Q7VA 3UKQA 5LV9A 1GESA 1D7YA 1K0LA 4REKA 2OLNA 3AE3A 1P2HA 5EBKA 2C4CA 4WX1A 2ACZA 1H81A 3GRSA 1P2EA 3ALJA 4EM4A 2JB2A 4H4YA 5IQ1A 2FJBA 4J36A 3AYIA 2BA9A 2ZBWA 4RG4A 3RP6A 2C3CA 1EBDA 3DK9A 1GRAA 4KX6A 1ZMDA 5KRQA 3ALMA 2WU5A 3BI2A 2X8CA 3GYIA 5BULA 1S3BA 4WCTA 1LVLA 3RP8A 3V3OA 2V61A 1S2QA 4ICYA 4H4TA 3DMEA 1LTXR 1L9DA 3NG7X 1E1KA 2A87A 1GRTA 2OLOA 3NHOX 4JNAA 2GQWA 2V5ZA 4H4WA 2WPEA 1EL5A 1GV4A 3GD3A 1BKWA 1PJ7A 2QA2A 1PXCA 2XYOA 3DJDA 3II4A 2YG7A 3CTYA 4M52A 3KPFA 2E1MA 2XVEA 4AP1A 1ZX9A 2XVJA 2X3NA 2YG6A 3QJ4A 1B4VA 4BJZA 4YSZA 5BUKA 1N4WA 3P9UA 1Z6LA 4J33A 3SY4A 4A79A 2VVLG 4BK3A 3CNTA 5J7XA 2C64A 2JBVA 1PS9A 3RHAA 3KPKA 2C73A 4DGKA 2YG4A 4II2A 1DNCA 1TDKA 2ZZ0A 4K8DA 1JRZA 3DK8A 1PBFA 2FJAA 2VQBA 1YKJA 4H4QA 2OA1A 3AYLA 1Q1WA 2EQ9A 1QJDA 2HQMA 3UKHA 4FK1C 4U8KA 2WOVA 3VRAA 4G9KA 1ZOYA 2WBAA 1PBBA 2XFOA 4TM3A 4J2WA 5KOWA 1JRXA 3URHA 2R0PA 4UDPA 2V3BA 3PG6A 1D4CA 2Z5XA 4ADWA 1H6VA 3CNSA 3T0KA 2BK3A 2WDVA 4OPUA 4OPLA 1PBEA 4NTCA 4U2TA 3P1WA 3UKLA 3LZXA 3CGDA 3WE0A 5HYMA 1IUTA 3ADAB 5JCLA 3UKPA 4CNJA 4CCQA 1YQ3A 4USRA 3ICRA 2XVIA 1KNRA 4BJYA 2BS3A 4HA6A 1NG3A 4IVMB 1JNZA 4GF7A 4U8OA 3T2ZA 3SFDA 4A6NA 4CCRA 4UDQA 2YG5A 4YSXA 2WP9A 3HYVA 3I3LA 1V59A 1L9CA 3NH3X 5HXIA 1D4DA 5U25A 2JK6A 1BF3A 4EM3A 2B7RA 1KDGA 3GMBA 2XFPA 2QAEA 3AEGA 1S7MA 4AOSA 2GH5A 2RGJA 4TLXA 1F6MA 1FOHA 1E39A 4Z24A 1Q9IA 4PABA 1QO8A 2APGA 2QCUA 5M10A 4K7ZA 4II3A 3V3NA 3SZCA 1QLBA 3D1CA 3T2KA 4GCMA 3H8IA 5KVHA 1GALA 3UTFA 4HB9A 3E1TA 3HYWA 2V60A 2JB3A 5U1OA 4H7UA 2R9ZA 1JU2A 2WDRA 3CNJA 1ZKQA 1EL9A 3ABVA 3C4AA 4OPDA 2BABA 1W4XA 2YR4A 1F8RA 1NHQA 2GB0A 4G74A 3AEDA 1AOGA 5GSNA 2NPXA 1Y56B 3IHGA 3AD8B 1IUSA 2BXRA 4JY3A 3D9XA 2OALA 1DOEA 2YVJA 4B69A 3NT6A 3RNMA 4A7AA 2ZZCA 2RABA 3R9UA 1CJ2A 2WU2A 3KLJA 3LZWA 2X99A 1DJQA 3HZLA 2Q0KA 1K0JA 1M6IA 3P4RA 4U8IA 2VZ2A 4EQSA 3ATRA 4YSYA 1VRQB 2XLPA 4G6HA 3ICSA 4K5SA 2GMJA 3AE5A 3P4QA 3SFEA 5C2TA 3NKSA 3CGBA 3GD4A 2C65A 3QSSA 4MJWA 2FJDA 4X9NA 3UKFA 4AOXA 1GRHA 1OJTA 5FS8A 2WS3A 3UKKA 1XPQA 4J56A 3CIRA 1TDOA 2AR8A 5EB4A 2PHHA 1REOA 1GNDA 2GF3A 4UP3A 4YKFA 1YQZA 2E4GA 4U8JA 1PXBA 3T2YA 4IA6A 2R46A 4J34A 4CNKA 3UTGA 2EQ7A 4RG3A 1OJDA 1TDFA 4U8NA 1CJCA 1FEBA 2WHDA 2X8HA 2GRTA 2YR5A 3DA1A 3UKAA 1MO9A 4OCGA 1COYA 4A6NB 3QVRA 5KVIA 2BC1A 1ONFA 4APNA 3G5QA 2GR1A 2GV8A 3KKJA 3VRBA 2R0GA 1PN0A 3QSMA 3K30A 3M0OA 4G73A 4H4XA 4IV9A 3AYJA 5EB5A 1CBOA 1NPXA 4H50A 1H83A 2E5VA 4K5RA 2EQ8A 4H2PA 3SZ0A 5IQ4A 1OJCA 2A89A 4H4VA 3AE8A 3CPHG 1O5WA 4A99A 4H4SA 3BNMA 3NK1X 4CY6A 3NTAA 3GDNA 1PDHA 1CJ3A 2IVEA 4O5UA 1CF3A 1CJ4A 3PO7A 1H7WA 1TYTA 1H2IA 3DJJA 2XVFA 2B7SA 1TRBA 3CPIG 1O94A 4YXDA 2AAQA 4A9WA 3CGEA 4EQWA 1LQUA 1IUWA 1PBCA 2O9ZA 3AD7B 2YQUA 1KNPA 1F8SA 1B37A 3NGCX 2WDQA 3GSIA 1EL8A 1X31B 3CN8A 5JCKA 5JRBA 3AE6A 4D03A 4YSHA 5KMPA 3VRDB 2BS2A 3AEAA 4Y4MA 5CQFA 2QA1A 1GRBA 1EL7A 3AEBA 3GWDA 1KF6A 4ZCCA 1F8WA 2C66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TM0 A;  3LAD A;  4NEV A;  3G5S A;  1L9E A;  1KFY A;  5U63 A;  2WOI A;  4D04 A;  2BAC A;  1DOC A;  4U8M A;  4B65 A;  3K7M X;  4OPI A;  4YT0 A;  2WPF A;  2YM1 A;  4Y4N A;  4TM4 A;  2XVH A;  1ZP0 A;  4IVO B;  3KD9 A;  3BI5 A;  3JSK A;  3V76 A;  5FMH A;  3AXB A;  2R4J A;  2BCG G;  4I59 A;  2C70 A;  1NEK A;  3AB1 A;  1K4Q A;  1VQW A;  2R45 A;  1DOD A;  2DKI A;  3NYC A;  2B9Y A;  2Q0L A;  2BYB A;  2WET A;  1GTE A;  4DSG A;  3FG2 P;  3QSE A;  1H84 A;  1BWC A;  3KU9 A;  1RSG A;  2WES A;  3VQR A;  4CY8 A;  4EQR A;  2W0H A;  4YTN A;  4GDP A;  1PBD A;  3NK2 X;  5HHF A;  3CNP A;  4JQ9 A;  2J3N A;  2WQY A;  2YLS A;  3AWI A;  1E1M A;  2I0Z A;  3CPJ G;  4H2R A;  4LA1 A;  4LII A;  2V3A A;  4J31 A;  4K22 A;  4OPG A;  4U8P A;  4NEW A;  5C3J A;  5FS9 A;  4GR1 A;  1GPE A;  2YM2 A;  1D7L A;  1GOS A;  5CKU A;  1BGJ A;  1FEA A;  2CUL A;  3IC9 A;  2JB1 A;  1CL0 A;  4YWO A;  2H88 A;  1DOB A;  3BI4 A;  5M0Z A;  2R4E A;  4DSH A;  2GVC A;  1OJ9 A;  2JKC A;  3GMC A;  3OC4 A;  1KSS A;  1PJ6 A;  4NTD A;  2Q6U A;  3DJE A;  3S5W A;  2R0C A;  3M12 A;  1NDA A;  2CVJ A;  2XLT A;  4H2N A;  4IA5 A;  4FDC B;  2UZZ A;  1FCD A;  4C3X A;  3UOZ A;  2BS4 A;  2XLU A;  1PJ5 A;  5GRT A;  1E1N A;  5BRT A;  2WP6 A;  3UTE A;  2TPR A;  3K7Q X;  3IF9 A;  4GUV A;  4XWZ A;  4A5L A;  4C3Y A;  4RSL A;  3NK0 X;  3NRN A;  3NYF A;  4BUR A;  3BNU A;  1L0V A;  2YG3 A;  1VG0 A;  4YTP A;  1GRF A;  4ZCD A;  1DXL A;  4AP3 A;  4EIQ A;  4H4Z A;  2WP5 A;  2FJE A;  3UOV A;  4J57 A;  2YLW A;  1K0I A;  1D4E A;  3FMW A;  3DGZ A;  1NAA A;  1ELI A;  3AE7 A;  1Q1R A;  5DBJ A;  2X50 A;  2GAH B;  3FPZ A;  2PYX A;  4KPR A;  3QFA A;  1IJH A;  3ZYX A;  2VVL A;  4Z2T A;  3AE4 A;  4PAA A;  2C7G A;  1XAN A;  4TM1 A;  2Y6R A;  2VQ7 A;  5KWF A;  3NIX A;  4FK1 A;  4U8L A;  1RYI A;  1NEN A;  2DKH A;  1ZY8 A;  2NVK X;  5KXJ A;  1FL2 A;  3NN0 X;  2XFN A;  2A8X A;  4B1B A;  4XWR A;  5EOW A;  2VRL A;  2YVF A;  3B3R A;  1JEH A;  3NYE A;  4H2Q A;  3IHM A;  3BHK A;  1VG9 A;  2VOU A;  4X4J A;  1JOA A;  4H4R A;  1ZOV A;  2X8G A;  3UP4 A;  1N1P A;  4YTM A;  1MOK A;  1VDC A;  2XLR A;  3GRT A;  3C96 A;  1D5T A;  3AEC A;  3F8R A;  3NLC A;  3UP5 A;  4Z2R A;  1GEU A;  3GYJ A;  2YWL A;  1YY5 A;  2WPC A;  2VRM A;  4Y4L A;  3ATQ A;  4Z26 A;  1LJ1 A;  4U2S A;  3NTD A;  1BGN A;  3FBS A;  3H8L A;  3AE1 A;  3ISH A;  4LU6 A;  4UDR A;  2GQF A;  1TDE A;  1NG4 A;  3DK4 A;  2XLS A;  3ITJ A;  3AE2 A;  3UCL A;  3L1R A;  1S3E A;  4JN9 A;  4EIP A;  3AD9 B;  2AQJ A;  3LJP A;  4TLZ A;  2ZZB A;  3AEE A;  4C5O A;  1PXA A;  3PVC A;  1LQT A;  4B68 A;  4Z43 A;  2CDU A;  1IUX A;  2C67 A;  1RP0 A;  4BK1 A;  1LV0 A;  3DGH A;  2VVM A;  3BHF A;  4OPT A;  4U2L A;  2Y6Q A;  4USQ A;  3G5R A;  1H7X A;  4X9M A;  4E0V A;  3CGC A;  4JNQ A;  2YLZ A;  4DNA A;  2GR0 A;  1NHR A;  1Y56 A;  2BXS A;  1CC2 A;  1CC6 A;  5JCM A;  1GTH A;  1ZK7 A;  3D8X A;  3F8D A;  1MXT A;  2GR3 A;  2H89 A;  1GT8 A;  3NN6 X;  4BV6 A;  5JCI A;  2GEW A;  2YR6 A;  4GDE A;  4A65 A;  2CFY A;  1H82 A;  1N4V A;  4NTE A;  4B64 A;  3RP7 A;  3AEF A;  4N9X A;  1Y0P A;  1E1L A;  2TMD A;  5FS6 A;  1OJA A;  3C4N A;  3GWF A;  4JY2 A;  2BK5 A;  4CBQ A;  4P9S A;  1HYU A;  3O0H A;  1CC4 A;  3P4P A;  1TDN A;  4O5Q A;  2EQ6 A;  4B63 A;  1PHH A;  3I6D A;  2JAE A;  5ER0 A;  3L8K A;  4Z44 A;  2YAU A;  2C3D A;  1F3P A;  1GRE A;  3EF6 A;  1GRG A;  1GSN A;  2YLT A;  4ZN0 A;  4NZH A;  2C76 A;  1B5Q A;  1GXF A;  2V6O A;  2ARD A;  4JDR A;  2BK4 A;  3Q9T A;  3UOY A;  1H86 A;  2GR2 A;  3S61 A;  4EMW A;  3UTH A;  3AE9 A;  2YVG A;  1BZL A;  3NNE A;  3T37 A;  4H4U A;  3IWA A;  2BCP A;  2GMH A;  3M13 A;  2YLR A;  2BC0 A;  3H4K A;  1O95 A;  2GAG B;  4ECH A;  5FS7 A;  1N4U A;  3OZ2 A;  4YKG A;  2RGO A;  3F8P A;  2C72 A;  4EQX A;  1KSU A;  4OPC A;  4C77 A;  4BK2 A;  1GET A;  2WEU A;  3GDP A;  1NHP A;  3VR9 A;  4OVI A;  1XHC A;  5J60 A;  4EMI A;  4CRT A;  1M64 A;  3EAN A;  5TR3 A;  3QVP A;  5L46 A;  2XFQ A;  3P4S A;  2WOW A;  4I58 A;  3QFB A;  1YQ4 A;  3CND A;  3PS9 A;  4FX9 A;  4AT0 A;  5HY5 A;  3B6D A;  3LOV A;  1DJN A;  1S2Y A;  1UKV G;  2IVD A;  3RED A;  2XDO A;  4B67 A;  5IPY A;  2FBW A;  3SGL A;  1E6E A;  5KOX A;  1B8S A;  3EPT A;  3LB8 A;  2Z5Y A;  1E7P A;  5BVA A;  2YLX A;  1IUU A;  2F5Z A;  4AT2 A;  1JRY A;  1GER A;  2OAM A;  2B9W A;  2XCG A;  1FEC A;  3COX A;  4B66 A;  3LXD A;  1ZDL A;  2RGH A;  2B76 A;  3K7T A;  1ZMC A;  3ICT A;  4K2X A;  5JCN A;  3DJG X;  4EMJ A;  3KA7 A;  3UOX A;  4GRT A;  3SQP A;  2B9X A;  2C75 A;  1JNR A;  4H4P A;  4Z2U A;  2IID A;  3ALL A;  1SEZ A;  1LPF A;  4XXG A;  1XDI A;  1TYP A;  2XFU A;  3FIM B;  4C74 A;  3DH9 A;  3ZDN A;  4Z25 A;  3SM8 A;  3VR8 A;  1IUV A;  3EAO A;  1CHU A;  3Q6J A;  1NHS A;  3KVE A;  2Q7V A;  3UKQ A;  5LV9 A;  1GES A;  1D7Y A;  1K0L A;  4REK A;  2OLN A;  3AE3 A;  1P2H A;  5EBK A;  4WX1 A;  2ACZ A;  1H81 A;  3GRS A;  1P2E A;  3ALJ A;  4EM4 A;  2JB2 A;  4H4Y A;  5IQ1 A;  2FJB A;  4J36 A;  3AYI A;  2BA9 A;  2ZBW A;  4RG4 A;  3RP6 A;  2C3C A;  1EBD A;  3DK9 A;  1GRA A;  4KX6 A;  1ZMD A;  5KRQ A;  3ALM A;  2WU5 A;  3BI2 A;  2X8C A;  3GYI A;  5BUL A;  1S3B A;  4WCT A;  1LVL A;  3RP8 A;  3V3O A;  2V61 A;  1S2Q A;  4ICY A;  4H4T A;  3DME A;  1LTX R;  1L9D A;  3NG7 X;  1E1K A;  2A87 A;  1GRT A;  2OLO A;  3NHO X;  4JNA A;  2GQW A;  2V5Z A;  4H4W A;  2WPE A;  1EL5 A;  1GV4 A;  3GD3 A;  1BKW A;  1PJ7 A;  2QA2 A;  1PXC A;  2XYO A;  3DJD A;  3II4 A;  2YG7 A;  3CTY A;  4M52 A;  3KPF A;  2E1M A;  2XVE A;  4AP1 A;  1ZX9 A;  2XVJ A;  2X3N A;  2YG6 A;  3QJ4 A;  1B4V A;  4BJZ A;  4YSZ A;  5BUK A;  1N4W A;  3P9U A;  1Z6L A;  4J33 A;  4A79 A;  2VVL G;  4BK3 A;  3CNT A;  5J7X A;  2C64 A;  2JBV A;  1PS9 A;  3RHA A;  2C73 A;  4DGK A;  2YG4 A;  1DNC A;  1TDK A;  2ZZ0 A;  4K8D A;  1JRZ A;  3DK8 A;  1PBF A;  2FJA A;  2VQB A;  1YKJ A;  4H4Q A;  2OA1 A;  3AYL A;  1Q1W A;  2EQ9 A;  1QJD A;  2HQM A;  3UKH A;  4FK1 C;  4U8K A;  2WOV A;  3VRA A;  1ZOY A;  2WBA A;  1PBB A;  2XFO A;  4TM3 A;  4J2W A;  5KOW A;  1JRX A;  3URH A;  2R0P A;  4UDP A;  2V3B A;  1D4C A;  2Z5X A;  4ADW A;  1H6V A;  3CNS A;  2BK3 A;  2WDV A;  4OPU A;  4OPL A;  1PBE A;  4NTC A;  4U2T A;  3P1W A;  3UKL A;  3LZX A;  3CGD A;  3WE0 A;  5HYM A;  1IUT A;  3ADA B;  5JCL A;  3UKP A;  4CNJ A;  4CCQ A;  1YQ3 A;  4USR A;  3ICR A;  2XVI A;  1KNR A;  4BJY A;  2BS3 A;  4HA6 A;  1NG3 A;  4IVM B;  1JNZ A;  4GF7 A;  4U8O A;  4A6N A;  3SFD A;  4CCR A;  4UDQ A;  2YG5 A;  4YSX A;  2WP9 A;  3I3L A;  1V59 A;  1L9C A;  3NH3 X;  5HXI A;  1D4D A;  5U25 A;  2JK6 A;  1BF3 A;  4EM3 A;  2B7R A;  1KDG A;  3GMB A;  2XFP A;  2QAE A;  3AEG A;  4AOS A;  2GH5 A;  2RGJ A;  4TLX A;  1F6M A;  1FOH A;  1E39 A;  4Z24 A;  1Q9I A;  4PAB A;  1QO8 A;  2APG A;  2QCU A;  5M10 A;  4K7Z A;  3V3N A;  1QLB A;  3D1C A;  4GCM A;  3H8I A;  5KVH A;  1GAL A;  3UTF A;  4HB9 A;  3E1T A;  2V60 A;  2JB3 A;  5U1O A;  4H7U A;  2R9Z A;  1JU2 A;  2WDR A;  3CNJ A;  1ZKQ A;  1EL9 A;  3ABV A;  3C4A A;  4OPD A;  2BAB A;  1W4X A;  2YR4 A;  1F8R A;  1NHQ A;  2GB0 A;  3AED A;  1AOG A;  5GSN A;  2NPX A;  1Y56 B;  3IHG A;  3AD8 B;  1IUS A;  2BXR A;  4JY3 A;  2OAL A;  1DOE A;  2YVJ A;  4B69 A;  3NT6 A;  3RNM A;  4A7A A;  2ZZC A;  2RAB A;  3R9U A;  1CJ2 A;  2WU2 A;  3KLJ A;  3LZW A;  2X99 A;  1DJQ A;  3HZL A;  2Q0K A;  1K0J A;  1M6I A;  3P4R A;  4U8I A;  2VZ2 A;  4EQS A;  3ATR A;  4YSY A;  1VRQ B;  2XLP A;  3ICS A;  4K5S A;  2GMJ A;  3AE5 A;  3P4Q A;  3SFE A;  5C2T A;  3NKS A;  3CGB A;  3GD4 A;  2C65 A;  3QSS A;  4MJW A;  2FJD A;  4X9N A;  3UKF A;  4AOX A;  1GRH A;  1OJT A;  5FS8 A;  2WS3 A;  3UKK A;  1XPQ A;  4J56 A;  3CIR A;  1TDO A;  2AR8 A;  5EB4 A;  2PHH A;  1REO A;  1GND A;  2GF3 A;  4UP3 A;  4YKF A;  1YQZ A;  2E4G A;  4U8J A;  1PXB A;  4IA6 A;  2R46 A;  4J34 A;  4CNK A;  3UTG A;  2EQ7 A;  4RG3 A;  1OJD A;  1TDF A;  4U8N A;  1CJC A;  1FEB A;  2WHD A;  2X8H A;  2GRT A;  2YR5 A;  3DA1 A;  3UKA A;  1MO9 A;  4OCG A;  1COY A;  4A6N B;  3QVR A;  5KVI A;  2BC1 A;  1ONF A;  4APN A;  3G5Q A;  2GR1 A;  2GV8 A;  3KKJ A;  3VRB A;  2R0G A;  1PN0 A;  3QSM A;  3K30 A;  3M0O A;  4H4X A;  4IV9 A;  3AYJ A;  5EB5 A;  1CBO A;  1NPX A;  4H50 A;  1H83 A;  2E5V A;  4K5R A;  2EQ8 A;  4H2P A;  5IQ4 A;  1OJC A;  2A89 A;  4H4V A;  3AE8 A;  3CPH G;  1O5W A;  4A99 A;  4H4S A;  3BNM A;  3NK1 X;  4CY6 A;  3NTA A;  3GDN A;  1PDH A;  1CJ3 A;  2IVE A;  4O5U A;  1CF3 A;  1CJ4 A;  3PO7 A;  1H7W A;  1TYT A;  3DJJ A;  2XVF A;  2B7S A;  1TRB A;  3CPI G;  1O94 A;  4YXD A;  2AAQ A;  4A9W A;  3CGE A;  4EQW A;  1LQU A;  1IUW A;  1PBC A;  2O9Z A;  3AD7 B;  2YQU A;  1KNP A;  1F8S A;  1B37 A;  3NGC X;  2WDQ A;  3GSI A;  1EL8 A;  1X31 B;  3CN8 A;  5JCK A;  3AE6 A;  4D03 A;  4YSH A;  3VRD B;  2BS2 A;  3AEA A;  4Y4M A;  5CQF A;  2QA1 A;  1GRB A;  1EL7 A;  3AEB A;  3GWD A;  1KF6 A;  4ZCC A;  1F8W A;  2C66 A; 
#chains in the Genus database with same CATH topology
 4TM0 A;  2GSH A;  5U63 A;  4D04 A;  2BAC A;  1DOC A;  4YT0 A;  3K7M X;  4Y4N A;  3BI5 A;  2BRY A;  1NEK A;  1K4Q A;  3DG7 A;  3NYC A;  2Q0L A;  2BYB A;  4G7F A;  2HZG A;  1WUF A;  3BSM A;  3VQR A;  3KU9 A;  2WES A;  4GDP A;  3NK2 X;  5ENL A;  5HHF A;  4JQ9 A;  3AWI A;  3CPJ G;  4K22 A;  4LA1 A;  4OPG A;  4NEW A;  5C3J A;  5FS9 A;  2QDD A;  3IC9 A;  1CL0 A;  5M0Z A;  3GMC A;  4IZG A;  1PJ6 A;  2Q6U A;  3DJE A;  3ES7 A;  2BS4 A;  5BRT A;  2WP6 A;  3UTE A;  3K7Q X;  4GUV A;  3IF9 A;  4XWZ A;  4A5L A;  1ZXI C;  3BNU A;  3SN4 A;  4AP3 A;  4NWZ A;  2WP5 A;  4J57 A;  1NAA A;  3AE7 A;  1ELI A;  4GAV A;  4KPR A;  1IJH A;  3H8A A;  1R0M A;  2DW7 A;  3NVZ B;  3V4B A;  2A8X A;  4B1B A;  2VRL A;  3IHM A;  3BHK A;  1JOA A;  1OEP A;  1JPM A;  1VDC A;  4YTM A;  3AEC A;  5FJR A;  2PTZ A;  3ATQ A;  4U2S A;  3U4F A;  3GYX A;  2QJJ A;  3QTP A;  3AE2 A;  3IJI A;  4C5O A;  3AEE A;  3PVC A;  1MDR A;  2I5Q A;  4K2S A;  2PS2 A;  2PSN A;  4BK1 A;  4U2L A;  2Y6Q A;  4DNA A;  1NHR A;  4H1Z A;  1MRA A;  1CC6 A;  5JCM A;  3TWA A;  1ZK7 A;  2GR3 A;  4NNJ A;  4GDE A;  2GEW A;  4B64 A;  1N62 C;  3SX6 A;  4N9X A;  4DN1 A;  3GWF A;  5FS6 A;  3SZF A;  4CBQ A;  1KKO A;  1HYU A;  5ER0 A;  3L8K A;  5KMQ A;  2YAU A;  2C3D A;  2OX4 A;  2AL2 B;  3Q9T A;  4JDR A;  3AE9 A;  1BZL A;  3NNE A;  2BCP A;  2GMH A;  1O95 A;  2GAG B;  4ECH A;  4DWD A;  3TWB A;  1GET A;  3GDP A;  4EMI A;  2WOW A;  5FJP A;  3LOV A;  1DJN A;  4B67 A;  2IVD A;  3SGL A;  1B8S A;  3EPT A;  4TVY A;  2F5Z A;  1JRY A;  3SSZ A;  3K7T A;  1ZMC A;  3UJF A;  1V97 A;  2BRA A;  4GRT A;  1TYP A;  2OQY A;  4C74 A;  3DH9 A;  3ZVH B;  2PP0 A;  1IUV A;  2Q7V A;  4GGB A;  1K0L A;  3AE3 A;  1NU5 A;  4KEM A;  1H81 A;  3NO1 A;  2JB2 A;  5IQ1 A;  4J36 A;  4HCL A;  3RP6 A;  3DK9 A;  1EBD A;  4GME A;  5FJT A;  3RP8 A;  3V3O A;  5BOE A;  3DME A;  1LTX R;  1E1K A;  2A87 A;  4HPN A;  1JDF A;  3HPF A;  5M10 A;  4XXG A;  3II4 A;  2E1M A;  2XVE A;  4F4R A;  2C64 A;  2JBV A;  3I6T A;  3V5F A;  3KPK A;  1DNC A;  4JN8 A;  2OA1 A;  2EQ9 A;  2HQM A;  4FK1 C;  3DDM A;  1FIQ B;  3HW2 A;  5KOW A;  2R0P A;  2WDV A;  4OPL A;  4U2T A;  3P1W A;  1P48 A;  4BJY A;  2BS3 A;  4A6N A;  3SFD A;  2YG5 A;  3VC5 A;  1V59 A;  5HXI A;  1D4D A;  4DXK A;  1BF3 A;  4IHC A;  1F6M A;  1FOH A;  2GGG A;  4Z24 A;  4PAB A;  2GGI A;  3V3N A;  3SZC A;  3D1C A;  2DW6 A;  2XGZ A;  4HN8 A;  1GAL A;  3HYW A;  1SJA A;  2R9Z A;  2WDR A;  3DG6 A;  4OPD A;  1NHQ A;  2GB0 A;  4G74 A;  1IUS A;  2YVJ A;  2ZZC A;  2PTY A;  4GIS A;  2WU2 A;  3I4K A;  1EC7 A;  4GGH A;  3A7A A;  2XLP A;  4G6H A;  3ICS A;  3AE5 A;  3P4Q A;  3NKS A;  1N5W C;  4X9N A;  3FCP A;  5FS8 A;  2WS3 A;  3CIR A;  1FHU A;  2PHH A;  4YKF A;  2PGW A;  4U8J A;  4IA6 A;  2R46 A;  3HRD C;  4ROP A;  1OJD A;  1FEB A;  2AL2 A;  2X8H A;  1COY A;  3QVR A;  4APN A;  4JN7 A;  2O56 A;  2R0G A;  1STZ A;  4MKS A;  3K30 A;  3M0O A;  4G73 A;  4IV9 A;  5EB5 A;  1EC8 A;  1O5W A;  4H4S A;  3BNM A;  4CY6 A;  2ONE A;  3S47 A;  4O5U A;  3MY9 A;  2B7S A;  3AD7 B;  2YQU A;  1KNP A;  3A7U A;  3GSI A;  5JCK A;  2AKM A;  3AD9 B;  3GD6 A;  3LAD A;  4MMW A;  4U8M A;  4B65 A;  1FFU C;  3VCC A;  2YM1 A;  4TM4 A;  3RIT A;  2XVH A;  3KD9 A;  3H7V A;  3JSK A;  3V76 A;  3AXB A;  4I59 A;  1DOD A;  2OO6 A;  3ZLH A;  2WET A;  2PTW A;  3QSE A;  1BWC A;  2W0H A;  1PBD A;  3ENL A;  2WQY A;  2YLS A;  3PWI A;  1E1M A;  3DES A;  2XSX A;  4GR1 A;  4ENL A;  1D7L A;  1KN0 A;  1GOS A;  3SQS A;  3K1G A;  2R4E A;  4DSH A;  2JKC A;  1OJ9 A;  3OC4 A;  4NTD A;  3M12 A;  1NDA A;  2XLT A;  4H2N A;  4C3X A;  3B97 A;  1SJB A;  2TPR A;  4C3Y A;  3CB3 A;  1VG0 A;  4YTP A;  1GRF A;  2YLW A;  1K0I A;  1D4E A;  5DBJ A;  2PYX A;  3QFA A;  3ZYX A;  2VVL A;  3VDG A;  1JCT A;  5KWF A;  3NIX A;  4FK1 A;  4U8L A;  3H12 A;  1NEN A;  2DKH A;  5KXJ A;  5EOW A;  2YVF A;  3BJS A;  4X4J A;  3R10 A;  1VG9 A;  2VOU A;  1N5X A;  1TZZ A;  3MUC A;  3TQP A;  2XLR A;  1D5T A;  4E4U A;  2AL1 A;  3F8R A;  3NLC A;  1GEU A;  2YWL A;  4Z26 A;  3UJ2 A;  1BGN A;  3FBS A;  4IP4 A;  3AE1 A;  3ISH A;  1IYX A;  2GQF A;  1TDE A;  1NG4 A;  3DK4 A;  2XLS A;  3ITJ A;  1SJD A;  4HNC A;  3L1R A;  4JN9 A;  4EIP A;  4TLZ A;  2ZZB A;  2CDU A;  1LV0 A;  2VVM A;  1P43 A;  4USQ A;  1H7X A;  3S5S A;  4JNQ A;  2BXS A;  3MQT A;  1CC2 A;  1GTH A;  2ZC8 A;  3PFR A;  4K8G A;  3MSY A;  1H82 A;  3ETR B;  4NTE A;  3RP7 A;  1Y0P A;  3PK7 A;  2TMD A;  4JY2 A;  2OZ8 A;  4P9S A;  4IL0 A;  3O0H A;  1FFV C;  4GAP A;  1TDN A;  4Z1Y A;  4Z44 A;  1F3P A;  3EF6 A;  2PP1 A;  1GXF A;  3UOY A;  1H86 A;  2GR2 A;  4EMW A;  2PU1 A;  3UJS A;  3T37 A;  1N61 C;  2PP3 A;  3GY1 A;  3H4K A;  4X2P A;  1N4U A;  4YKG A;  1KSU A;  4OPC A;  3NFU A;  2WEU A;  3VR9 A;  4OVI A;  2XH0 A;  5J60 A;  4J1O A;  4CRT A;  5L46 A;  3QVP A;  2XFQ A;  3QFB A;  3PS9 A;  5HY5 A;  3B6D A;  3RED A;  2YLX A;  1IUU A;  1GER A;  3SYI A;  3MKC A;  2XCG A;  2QQ6 A;  2QJN A;  2QVH A;  3ICT A;  1FHV A;  2P8B A;  3DJG X;  3UOX A;  4J3Z A;  3SQP A;  1JNR A;  1XDI A;  1YEY A;  2XFU A;  2OPJ A;  3DEQ A;  3SM8 A;  3CMM A;  2OQH A;  1D7Y A;  1GES A;  4REK A;  2OLN A;  1P2H A;  1JRO A;  1P2E A;  3ALJ A;  4EM4 A;  3NS1 B;  3RO6 A;  2ZBW A;  4RG4 A;  3ALM A;  3BI2 A;  3STP A;  1S3B A;  4WCT A;  2V61 A;  4JNA A;  4Z17 A;  1GV4 A;  3GD3 A;  1E9I A;  3KPF A;  3DFY A;  3DJD A;  2YG7 A;  4M52 A;  4AP1 A;  1KKR A;  3QJ4 A;  1Z6L A;  4J33 A;  3SY4 A;  4A79 A;  3TCS A;  4DGK A;  3TJ4 A;  4II2 A;  1TDK A;  2ZZ0 A;  3DK8 A;  4H4Q A;  4U8K A;  3QN3 A;  4H2H A;  1PBB A;  1PDZ A;  4J2W A;  3URH A;  3IJL A;  4JHM A;  4UDP A;  3PG6 A;  3PWG A;  4ADW A;  2PCE A;  3AM9 A;  4OPU A;  4NTC A;  3UKL A;  3LZX A;  3T4W A;  3CGD A;  3WE0 A;  1IUT A;  3ADA B;  5JCL A;  1YQ3 A;  2QJM A;  1KNR A;  1JNZ A;  4GF7 A;  4U8O A;  4CCR A;  4UDQ A;  3NZG A;  5U25 A;  2QAE A;  2PMQ A;  4AOS A;  2GH5 A;  4E8G A;  4MGG A;  3I6E A;  3OZY A;  1QO8 A;  7ENL A;  3VFC A;  2QCU A;  1KCZ A;  5KVH A;  3UTF A;  2JB3 A;  4H7U A;  1ZKQ A;  1EL9 A;  3VC6 A;  4KPL A;  2YR4 A;  1F8R A;  3AED A;  5GSN A;  1Y56 B;  3T9P A;  3OTR A;  2PPG A;  2BXR A;  2OAL A;  2RAB A;  3R9U A;  3FJ4 A;  2E3T A;  3KLJ A;  3V5C A;  3HZL A;  2Q0K A;  1K0J A;  3DGB A;  1M6I A;  4U8I A;  2VZ2 A;  4EQS A;  3ATR A;  3SFE A;  5C2T A;  3CGB A;  3GD4 A;  5FJU A;  1OJT A;  3UKK A;  4J56 A;  1TDO A;  2AR8 A;  4UP3 A;  2E4G A;  1PXB A;  3T2Y A;  3UCC A;  3CT2 A;  4GFI A;  5CKU A;  3UKA A;  2YR5 A;  3DA1 A;  2GGE A;  1ONF A;  1JRP A;  2GV8 A;  3VRB A;  2XH4 A;  1H83 A;  4H50 A;  5IQ4 A;  2EQ8 A;  4H2P A;  2A89 A;  3CPH G;  3ZLF A;  1BQG A;  3NTA A;  1PDH A;  1CJ4 A;  3PO7 A;  3DFH A;  1TYT A;  3DJJ A;  3FXG A;  1TRB A;  1O94 A;  3CGE A;  4EQW A;  1B37 A;  3NGC X;  1EL8 A;  3CN8 A;  3AE6 A;  3R0K A;  1XPY A;  3CYJ A;  3AEA A;  3GWD A;  1F8W A;  2C66 A;  3DER A;  4NEV A;  3G5S A;  1L9E A;  1KFY A;  2OZT A;  2WOI A;  5FMH A;  2C70 A;  3AB1 A;  3T6C A;  2R45 A;  4G6G A;  1GTE A;  4DSG A;  2XH7 A;  3NVW B;  4EQR A;  2NQL A;  3CNP A;  2J3N A;  3N6H A;  4LII A;  2GGH A;  2PTX A;  1TKK A;  2RDX A;  2H88 A;  1DOB A;  2GVC A;  3OW1 A;  1KSS A;  1VDV A;  2R0C A;  2CVJ A;  1FCD A;  3QKE A;  1E1N A;  3UXK A;  4RSL A;  3NRN A;  3NYF A;  4BUR A;  2YG3 A;  4ZCD A;  1DXL A;  3FMW A;  3DGZ A;  1Q1R A;  4Z2T A;  3AE4 A;  1XAN A;  5G5G B;  1RYI A;  1ZY8 A;  1FL2 A;  3NN0 X;  2XFN A;  1X2G A;  5KNL A;  3B3R A;  3HYX A;  2X8G A;  1N1P A;  1MOK A;  3TTE A;  1VQZ A;  5KMS A;  3FVD A;  4Z2R A;  4E4F A;  4HYR A;  4Y4L A;  1LJ1 A;  4YWS A;  3NTD A;  3H8L A;  4LU6 A;  4UDR A;  3T14 A;  2AQJ A;  3LJP A;  5FJO A;  4B68 A;  4Z43 A;  2FKP A;  1IUX A;  2HXT A;  1RP0 A;  1MDL A;  3BHF A;  3G5R A;  4IL2 A;  1Y56 A;  3T31 A;  1MXT A;  1GT8 A;  4BV6 A;  4A65 A;  2P88 A;  1N4V A;  3ZVH A;  1OJA A;  3R1Z A;  4TVW A;  2BK5 A;  3RR1 A;  1CC4 A;  3UGV A;  4B63 A;  3I6D A;  3VCN A;  1GRE A;  3UCD A;  1GSN A;  4ZN0 A;  3RRA A;  3Q4D A;  3QPE A;  2V6O A;  2BK4 A;  3UTH A;  2YVG A;  2MNR A;  3IWA A;  1RM6 B;  2BC0 A;  1W6T A;  3AMZ A;  1PDY A;  2C72 A;  4C77 A;  3GC2 A;  1NHP A;  4M6U A;  3MWC A;  1M64 A;  3P4S A;  1YQ4 A;  4FX9 A;  5G5H B;  2OVL A;  3R0U A;  3LB8 A;  2Z5Y A;  5BVA A;  2HNE A;  3B9J B;  3ES8 A;  3COX A;  4B66 A;  3LXD A;  2RGH A;  2B76 A;  4EMJ A;  3KA7 A;  4Z2U A;  2B9X A;  2W3S A;  2OKT A;  4H4P A;  3ALL A;  3SN1 A;  1SEZ A;  3FIM B;  4Z25 A;  2MUC A;  3EKG A;  3EAO A;  3Q6J A;  5LV9 A;  2E5A A;  3SJN A;  3T8Q A;  2ACZ A;  4WX1 A;  3GRS A;  4H4Y A;  2FJB A;  3AYI A;  4KX6 A;  5KRQ A;  2WU5 A;  2X8C A;  3GYI A;  4ICY A;  1S2Q A;  2OZ3 A;  3NG7 X;  1GRT A;  2GQW A;  4H4W A;  2QA2 A;  1EL5 A;  1BKW A;  4TM1 A;  2XYO A;  1DTN A;  3CTY A;  2HXU A;  2X3N A;  2YG6 A;  1B4V A;  4BJZ A;  5BUK A;  3P9U A;  2VVL G;  4BK3 A;  3Q45 A;  4M0X A;  2OFJ A;  1JRZ A;  1YKJ A;  1Q1W A;  3CXB A;  1NEL A;  3P3B A;  3UKH A;  2WOV A;  4G9K A;  1ZOY A;  2WBA A;  2XFO A;  1JRX A;  1H6V A;  3CNS A;  2BK3 A;  4FI4 A;  4GYP C;  4CNJ A;  3UKP A;  4CCQ A;  2XVI A;  4HNL A;  3T2Z A;  3HYV A;  3I3L A;  2JK6 A;  2OG9 A;  2B7R A;  1KDG A;  3GMB A;  2XFP A;  2RGJ A;  1TE6 A;  1E39 A;  3N4E A;  1Q9I A;  3SBF A;  1F9C A;  4K7Z A;  1ECQ A;  1QLB A;  3T2K A;  4GCM A;  3E1T A;  5U1O A;  1JU2 A;  3C4A A;  2BAB A;  1W4X A;  1AOG A;  1N60 C;  3AD8 B;  4JY3 A;  3D9X A;  4B69 A;  3RNM A;  1L8P A;  4HCD A;  4DYE A;  5J04 A;  1VRQ B;  2PGE A;  3RGT A;  4K5S A;  3FYY A;  3QSS A;  2C65 A;  1X2H A;  3TOY A;  1KD0 A;  1WYG A;  1MNS A;  4J34 A;  3UTG A;  2EQ7 A;  4RG3 A;  4G8T A;  2GRT A;  3D47 A;  4A6N B;  4OCG A;  5KVI A;  3G5Q A;  2GR1 A;  1ELS A;  3KKJ A;  3N4F A;  4A6G A;  1PN0 A;  3QSM A;  4E5T A;  3AYJ A;  3V3W A;  3IK4 A;  1CBO A;  1NPX A;  4K5R A;  1RVK A;  1OJC A;  4H4V A;  3AE8 A;  3NK1 X;  3GDN A;  1CJ3 A;  1CF3 A;  3JVA A;  3FV9 A;  2PA6 A;  4YXD A;  2AAQ A;  1LQU A;  1PBC A;  2O9Z A;  3BOX A;  1F8S A;  2AKZ A;  1T3Q C;  3JZU A;  4ZCW A;  5JRB A;  4YSH A;  3VRD B;  5CQF A;  2QA1 A;  1GRB A;  3H70 A;  1EL7 A;  3AEB A;  4ZCC A;  4XWR A;  2POD A;  4OPI A;  4A3R A;  2WPF A;  3NVY B;  1ZP0 A;  4IVO B;  3SXI A;  2R4J A;  2BCG G;  1VQW A;  2DKI A;  2B9Y A;  2GDQ A;  3KUM A;  3FG2 P;  1H84 A;  1RSG A;  4CY8 A;  4YTN A;  4H2R A;  4J31 A;  2I0Z A;  2V3A A;  3GO2 A;  4U8P A;  1GPE A;  2YM2 A;  1BGJ A;  1FEA A;  2CUL A;  2JB1 A;  4YWO A;  3BI4 A;  4IT1 A;  3QLD A;  2ZAD A;  3SZW A;  3S5W A;  4IA5 A;  4FDC B;  3UJE A;  2UZZ A;  3UOZ A;  2XLU A;  1PJ5 A;  5GRT A;  2QDE A;  1MUC A;  3NK0 X;  1L0V A;  3NXL A;  4EIQ A;  4H4Z A;  2FJE A;  3UOV A;  4IP5 A;  3SN0 A;  2X50 A;  2GAH B;  3FPZ A;  4PAA A;  2C7G A;  2Y6R A;  2VQ7 A;  3D46 A;  2NVK X;  2P0I A;  1JEH A;  3NYE A;  4H2Q A;  4A35 A;  4H4R A;  1ZOV A;  3UP4 A;  1JPD X;  3GRT A;  3C96 A;  4GYP A;  3UP5 A;  3GYJ A;  3UJR A;  2WPC A;  1YY5 A;  4HCH A;  2VRM A;  1SB3 B;  3IJQ A;  3R25 A;  3UCL A;  1S3E A;  3N6J A;  1EBH A;  1PXA A;  3ZLG A;  1LQT A;  2C67 A;  3CXO A;  3DGH A;  4OPT A;  2QGY A;  4X9M A;  4E0V A;  3CGC A;  2YLZ A;  2GR0 A;  3L5O A;  2POZ A;  3NRZ B;  3D8X A;  3OPS A;  3F8D A;  2H89 A;  6ENL A;  3NN6 X;  5JCI A;  2YR6 A;  2CFY A;  1R6W A;  2GGJ A;  3AEF A;  1E1L A;  3C4N A;  1WUE A;  1SJC A;  3P4P A;  4O5Q A;  2CHR A;  2EQ6 A;  1PHH A;  2JAE A;  2OLA A;  1GRG A;  2YLT A;  3R07 C;  4NZH A;  2C76 A;  2W3R A;  1B5Q A;  4K1W A;  2ARD A;  3S61 A;  4DHG A;  4H4U A;  3M13 A;  2YLR A;  1ONE A;  5KMR A;  5FS7 A;  3OZ2 A;  2RGO A;  3P93 A;  3F8P A;  4EQX A;  4BK2 A;  1XHC A;  3EAN A;  5TR3 A;  4FP1 A;  3CK5 A;  4EWJ A;  3OP2 A;  4I58 A;  3CND A;  4AT0 A;  1S2Y A;  1UKV G;  5IPY A;  2XDO A;  2FBW A;  1E6E A;  5KOX A;  1E7P A;  3P0W A;  5IDZ A;  2OAM A;  2B9W A;  1FEC A;  1ZDL A;  3MZN A;  4K2X A;  5JCN A;  2C75 A;  4KWS A;  2IID A;  1LPF A;  4KT2 A;  3ZDN A;  3VR8 A;  3AN1 A;  1CHU A;  1NHS A;  3KVE A;  3UKQ A;  3RCY A;  2PU0 A;  2C4C A;  5EBK A;  1BKH A;  2BA9 A;  3CAW A;  2C3C A;  1GRA A;  1ZMD A;  5BUL A;  3EUB 3;  4DX3 A;  1LVL A;  4H4T A;  1L9D A;  2OLO A;  3NHO X;  2V5Z A;  2WPE A;  1PJ7 A;  3THU A;  4AT2 A;  1PXC A;  2XH2 A;  1ZX9 A;  2XVJ A;  4YSZ A;  1N4W A;  3CNT A;  5J7X A;  1PS9 A;  3RHA A;  2C73 A;  2YG4 A;  4K8D A;  1PBF A;  2FJA A;  2VQB A;  3AYL A;  1QJD A;  3VRA A;  4TM3 A;  1XS2 A;  2V3B A;  4ZOH B;  1D4C A;  2Z5X A;  3T0K A;  4GIR A;  1FO4 A;  1PBE A;  3UXL A;  2GL5 A;  5HYM A;  4USR A;  3ICR A;  4E6M A;  4HA6 A;  1NG3 A;  4IVM B;  4YSX A;  2WP9 A;  2W55 A;  1L9C A;  3NH3 X;  4EM3 A;  3AEG A;  3VA8 A;  1S7M A;  4TLX A;  2APG A;  3R11 A;  4II3 A;  3H8I A;  3TW9 A;  4HB9 A;  2V60 A;  3CNJ A;  3ABV A;  2P3Z A;  2NPX A;  3IHG A;  1EBG A;  1DOE A;  3NT6 A;  4A7A A;  3ZVI A;  1CJ2 A;  3LZW A;  2X99 A;  4ZA0 A;  1DJQ A;  3U9I A;  4YSY A;  3P4R A;  2GMJ A;  4MJW A;  2FJD A;  3UKF A;  4AOX A;  1GRH A;  1XPQ A;  3OZM A;  3EEZ A;  5EB4 A;  5BOF A;  1REO A;  1GND A;  2GF3 A;  1YQZ A;  1N63 C;  4CNK A;  4H83 A;  1TDF A;  4U8N A;  1CJC A;  2WHD A;  1MO9 A;  3SR6 B;  3NVV B;  2FYM A;  2BC1 A;  4H4X A;  4H19 A;  3TJI A;  3SZ0 A;  2E5V A;  4A99 A;  5EU9 A;  2P8C A;  3DG3 A;  2IVE A;  1H7W A;  2XVF A;  1H2I A;  3CPI G;  2W54 A;  4A9W A;  1IUW A;  1EC9 A;  2WDQ A;  3A7R A;  4D03 A;  1X31 B;  3DIP A;  5KMP A;  2BS2 A;  3JW7 A;  4Y4M A;  1KF6 A; 
#chains in the Genus database with same CATH homology
 4TM0 A;  3LAD A;  4NEV A;  3G5S A;  1L9E A;  1KFY A;  5U63 A;  2WOI A;  4D04 A;  2BAC A;  1DOC A;  4U8M A;  4B65 A;  3K7M X;  4OPI A;  4YT0 A;  2WPF A;  2YM1 A;  4Y4N A;  4TM4 A;  2XVH A;  1ZP0 A;  4IVO B;  3KD9 A;  3BI5 A;  3SXI A;  3JSK A;  2BRY A;  3V76 A;  5FMH A;  3AXB A;  2R4J A;  2BCG G;  4I59 A;  2C70 A;  1NEK A;  3AB1 A;  1K4Q A;  1VQW A;  2R45 A;  4G6G A;  1DOD A;  2DKI A;  3NYC A;  2B9Y A;  2Q0L A;  2BYB A;  2WET A;  1GTE A;  4DSG A;  3FG2 P;  3QSE A;  1H84 A;  1BWC A;  3KU9 A;  1RSG A;  2WES A;  3VQR A;  4CY8 A;  4EQR A;  2W0H A;  4YTN A;  4GDP A;  1PBD A;  3NK2 X;  5HHF A;  3CNP A;  4JQ9 A;  2J3N A;  2WQY A;  2YLS A;  3AWI A;  1E1M A;  2I0Z A;  3CPJ G;  4H2R A;  4LA1 A;  2V3A A;  4LII A;  4J31 A;  4K22 A;  4OPG A;  4U8P A;  4NEW A;  5C3J A;  5FS9 A;  4GR1 A;  1GPE A;  2YM2 A;  1D7L A;  1KN0 A;  1GOS A;  5CKU A;  1BGJ A;  1FEA A;  2CUL A;  3IC9 A;  2JB1 A;  1CL0 A;  4YWO A;  2H88 A;  1DOB A;  3BI4 A;  5M0Z A;  2R4E A;  4DSH A;  2GVC A;  1OJ9 A;  2JKC A;  3GMC A;  3OC4 A;  1KSS A;  1PJ6 A;  4NTD A;  3SZW A;  2Q6U A;  3DJE A;  3S5W A;  2R0C A;  3M12 A;  1NDA A;  2CVJ A;  2XLT A;  4H2N A;  4IA5 A;  4FDC B;  2UZZ A;  1FCD A;  4C3X A;  3UOZ A;  2BS4 A;  2XLU A;  1PJ5 A;  5GRT A;  1E1N A;  5BRT A;  2WP6 A;  3UTE A;  2TPR A;  3K7Q X;  3IF9 A;  4GUV A;  4XWZ A;  4A5L A;  4C3Y A;  4RSL A;  3NK0 X;  3NRN A;  3NYF A;  4BUR A;  3BNU A;  1L0V A;  2YG3 A;  1VG0 A;  4YTP A;  1GRF A;  4ZCD A;  1DXL A;  4NWZ A;  4AP3 A;  4H4Z A;  2WP5 A;  2FJE A;  4EIQ A;  3UOV A;  4J57 A;  2YLW A;  1K0I A;  1D4E A;  3FMW A;  3DGZ A;  1NAA A;  1ELI A;  3AE7 A;  1Q1R A;  4GAV A;  5DBJ A;  2X50 A;  2GAH B;  3FPZ A;  2PYX A;  4KPR A;  3QFA A;  1IJH A;  3ZYX A;  2VVL A;  4Z2T A;  3AE4 A;  4PAA A;  2C7G A;  1XAN A;  4TM1 A;  2Y6R A;  2VQ7 A;  5KWF A;  3NIX A;  4FK1 A;  4U8L A;  1RYI A;  1NEN A;  2DKH A;  1ZY8 A;  2NVK X;  5KXJ A;  1FL2 A;  3NN0 X;  2XFN A;  2A8X A;  4B1B A;  4XWR A;  5EOW A;  2VRL A;  5KNL A;  2YVF A;  3B3R A;  1JEH A;  3NYE A;  4H2Q A;  3IHM A;  3BHK A;  1VG9 A;  2VOU A;  3HYX A;  4X4J A;  1JOA A;  4H4R A;  1ZOV A;  2X8G A;  3UP4 A;  1N1P A;  4YTM A;  1MOK A;  1VDC A;  2XLR A;  3GRT A;  3C96 A;  1D5T A;  3AEC A;  3F8R A;  3NLC A;  3UP5 A;  5KMS A;  4Z2R A;  1GEU A;  3GYJ A;  2YWL A;  1YY5 A;  2WPC A;  2VRM A;  4Y4L A;  3ATQ A;  4Z26 A;  1LJ1 A;  4U2S A;  3NTD A;  1BGN A;  3FBS A;  3H8L A;  3AE1 A;  3ISH A;  4LU6 A;  3GYX A;  4UDR A;  2GQF A;  1TDE A;  1NG4 A;  3DK4 A;  2XLS A;  3ITJ A;  3T14 A;  3AE2 A;  3UCL A;  3L1R A;  1S3E A;  4JN9 A;  4EIP A;  3AD9 B;  2AQJ A;  3LJP A;  4TLZ A;  2ZZB A;  3AEE A;  4C5O A;  1PXA A;  3PVC A;  1LQT A;  4B68 A;  4Z43 A;  2CDU A;  1IUX A;  2C67 A;  1RP0 A;  4BK1 A;  1LV0 A;  3DGH A;  2VVM A;  3BHF A;  4OPT A;  4U2L A;  2Y6Q A;  4USQ A;  3G5R A;  1H7X A;  4X9M A;  4E0V A;  3CGC A;  4JNQ A;  2YLZ A;  4DNA A;  2GR0 A;  1NHR A;  1Y56 A;  2BXS A;  3L5O A;  3T31 A;  1CC2 A;  1CC6 A;  5JCM A;  1GTH A;  1ZK7 A;  3D8X A;  3F8D A;  1MXT A;  2GR3 A;  2H89 A;  1GT8 A;  4NNJ A;  3NN6 X;  4BV6 A;  5JCI A;  2GEW A;  2YR6 A;  4GDE A;  4A65 A;  2CFY A;  1H82 A;  1N4V A;  4NTE A;  4B64 A;  3SX6 A;  3RP7 A;  3AEF A;  4N9X A;  1Y0P A;  1E1L A;  2TMD A;  5FS6 A;  1OJA A;  3C4N A;  3GWF A;  4JY2 A;  2BK5 A;  3SZF A;  4CBQ A;  4P9S A;  1HYU A;  3O0H A;  1CC4 A;  3P4P A;  4GAP A;  1TDN A;  4O5Q A;  2EQ6 A;  4B63 A;  1PHH A;  3I6D A;  2JAE A;  5ER0 A;  3L8K A;  5KMQ A;  4Z44 A;  2YAU A;  2C3D A;  1F3P A;  1GRE A;  3EF6 A;  1GRG A;  1GSN A;  2YLT A;  4ZN0 A;  4NZH A;  2C76 A;  1B5Q A;  1GXF A;  2V6O A;  2ARD A;  4JDR A;  2BK4 A;  3Q9T A;  3UOY A;  1H86 A;  2GR2 A;  3S61 A;  4EMW A;  3UTH A;  3AE9 A;  2YVG A;  1BZL A;  3NNE A;  3T37 A;  4H4U A;  3IWA A;  2BCP A;  2GMH A;  3M13 A;  2YLR A;  2BC0 A;  3H4K A;  1O95 A;  5KMR A;  2GAG B;  4ECH A;  5FS7 A;  1N4U A;  3OZ2 A;  4YKG A;  2RGO A;  3F8P A;  2C72 A;  4EQX A;  1KSU A;  4OPC A;  4C77 A;  4BK2 A;  1GET A;  2WEU A;  3GDP A;  1NHP A;  3VR9 A;  4OVI A;  1XHC A;  5J60 A;  4EMI A;  4CRT A;  1M64 A;  3EAN A;  5TR3 A;  3QVP A;  5L46 A;  2XFQ A;  3P4S A;  2WOW A;  4I58 A;  3QFB A;  1YQ4 A;  3CND A;  3PS9 A;  4FX9 A;  4AT0 A;  5HY5 A;  3B6D A;  3LOV A;  1DJN A;  1S2Y A;  1UKV G;  2IVD A;  3RED A;  2XDO A;  4B67 A;  5IPY A;  2FBW A;  3SGL A;  1E6E A;  5KOX A;  1B8S A;  3EPT A;  3LB8 A;  2Z5Y A;  1E7P A;  5BVA A;  2YLX A;  1IUU A;  2F5Z A;  4AT2 A;  1JRY A;  1GER A;  2OAM A;  3SYI A;  2B9W A;  2XCG A;  1FEC A;  3COX A;  4B66 A;  3LXD A;  1ZDL A;  2RGH A;  2B76 A;  3K7T A;  1ZMC A;  3ICT A;  4K2X A;  5JCN A;  3DJG X;  4EMJ A;  3KA7 A;  3UOX A;  2BRA A;  4GRT A;  3SQP A;  2B9X A;  2C75 A;  1JNR A;  4H4P A;  4Z2U A;  2IID A;  3ALL A;  1SEZ A;  1LPF A;  4XXG A;  1XDI A;  1TYP A;  2XFU A;  3FIM B;  4C74 A;  3DH9 A;  3ZDN A;  4Z25 A;  3SM8 A;  3VR8 A;  1IUV A;  3EAO A;  3CMM A;  1CHU A;  3Q6J A;  1NHS A;  3KVE A;  2Q7V A;  3UKQ A;  5LV9 A;  1GES A;  1D7Y A;  1K0L A;  4REK A;  2OLN A;  3AE3 A;  1P2H A;  5EBK A;  2C4C A;  4WX1 A;  2ACZ A;  1H81 A;  3GRS A;  1P2E A;  3ALJ A;  4EM4 A;  2JB2 A;  4H4Y A;  5IQ1 A;  2FJB A;  4J36 A;  3AYI A;  2BA9 A;  2ZBW A;  4RG4 A;  3RP6 A;  2C3C A;  1EBD A;  3DK9 A;  1GRA A;  4KX6 A;  1ZMD A;  5KRQ A;  3ALM A;  2WU5 A;  3BI2 A;  2X8C A;  3GYI A;  5BUL A;  1S3B A;  4WCT A;  1LVL A;  3RP8 A;  3V3O A;  2V61 A;  1S2Q A;  4ICY A;  4H4T A;  3DME A;  1LTX R;  1L9D A;  3NG7 X;  1E1K A;  2A87 A;  1GRT A;  2OLO A;  3NHO X;  4JNA A;  2GQW A;  2V5Z A;  4H4W A;  2WPE A;  1EL5 A;  1GV4 A;  3GD3 A;  1BKW A;  1PJ7 A;  2QA2 A;  1PXC A;  2XYO A;  3DJD A;  3II4 A;  2YG7 A;  3CTY A;  4M52 A;  3KPF A;  2E1M A;  2XVE A;  4AP1 A;  1ZX9 A;  2XVJ A;  2X3N A;  2YG6 A;  3QJ4 A;  1B4V A;  4BJZ A;  4YSZ A;  5BUK A;  1N4W A;  3P9U A;  1Z6L A;  4J33 A;  3SY4 A;  4A79 A;  2VVL G;  4BK3 A;  3CNT A;  5J7X A;  2C64 A;  2JBV A;  1PS9 A;  3RHA A;  3KPK A;  2C73 A;  4DGK A;  2YG4 A;  4II2 A;  1DNC A;  1TDK A;  2ZZ0 A;  4K8D A;  1JRZ A;  3DK8 A;  1PBF A;  2FJA A;  2VQB A;  1YKJ A;  4H4Q A;  2OA1 A;  3AYL A;  1Q1W A;  2EQ9 A;  1QJD A;  2HQM A;  3UKH A;  4FK1 C;  4U8K A;  2WOV A;  3VRA A;  4G9K A;  1ZOY A;  2WBA A;  1PBB A;  2XFO A;  4TM3 A;  4J2W A;  5KOW A;  1JRX A;  3URH A;  2R0P A;  4UDP A;  2V3B A;  3PG6 A;  1D4C A;  2Z5X A;  4ADW A;  1H6V A;  3CNS A;  3T0K A;  2BK3 A;  2WDV A;  4OPU A;  4OPL A;  1PBE A;  4NTC A;  4U2T A;  3P1W A;  3UKL A;  3LZX A;  3CGD A;  3WE0 A;  5HYM A;  1IUT A;  3ADA B;  5JCL A;  3UKP A;  4CNJ A;  4CCQ A;  1YQ3 A;  4USR A;  3ICR A;  2XVI A;  1KNR A;  4BJY A;  2BS3 A;  4HA6 A;  1NG3 A;  4IVM B;  1JNZ A;  4GF7 A;  4U8O A;  3T2Z A;  3SFD A;  4A6N A;  4CCR A;  4UDQ A;  2YG5 A;  4YSX A;  2WP9 A;  3HYV A;  3I3L A;  1V59 A;  1L9C A;  3NH3 X;  5HXI A;  1D4D A;  5U25 A;  2JK6 A;  1BF3 A;  4EM3 A;  2B7R A;  1KDG A;  3GMB A;  2XFP A;  2QAE A;  3AEG A;  1S7M A;  4AOS A;  2GH5 A;  2RGJ A;  4TLX A;  1F6M A;  1FOH A;  1E39 A;  4Z24 A;  1Q9I A;  4PAB A;  1QO8 A;  2APG A;  2QCU A;  5M10 A;  4K7Z A;  4II3 A;  3V3N A;  3SZC A;  1QLB A;  3D1C A;  3T2K A;  4GCM A;  3H8I A;  5KVH A;  1GAL A;  3UTF A;  4HB9 A;  3E1T A;  3HYW A;  2V60 A;  2JB3 A;  5U1O A;  4H7U A;  2R9Z A;  1JU2 A;  2WDR A;  3CNJ A;  1ZKQ A;  1EL9 A;  3ABV A;  3C4A A;  4OPD A;  2BAB A;  1W4X A;  2YR4 A;  1F8R A;  1NHQ A;  2GB0 A;  4G74 A;  3AED A;  1AOG A;  5GSN A;  2NPX A;  1Y56 B;  3IHG A;  3AD8 B;  1IUS A;  2BXR A;  4JY3 A;  3D9X A;  2OAL A;  1DOE A;  2YVJ A;  4B69 A;  3NT6 A;  3RNM A;  4A7A A;  2ZZC A;  2RAB A;  3R9U A;  1CJ2 A;  2WU2 A;  3KLJ A;  3LZW A;  2X99 A;  1DJQ A;  3HZL A;  2Q0K A;  1K0J A;  1M6I A;  3P4R A;  4U8I A;  2VZ2 A;  4EQS A;  3ATR A;  4YSY A;  1VRQ B;  2XLP A;  4G6H A;  3ICS A;  4K5S A;  2GMJ A;  3AE5 A;  3P4Q A;  3SFE A;  5C2T A;  3NKS A;  3CGB A;  3GD4 A;  2C65 A;  3QSS A;  4MJW A;  2FJD A;  4X9N A;  3UKF A;  4AOX A;  1GRH A;  1OJT A;  5FS8 A;  2WS3 A;  3UKK A;  1XPQ A;  4J56 A;  3CIR A;  1TDO A;  2AR8 A;  5EB4 A;  2PHH A;  1REO A;  1GND A;  2GF3 A;  4UP3 A;  4YKF A;  1YQZ A;  2E4G A;  4U8J A;  1PXB A;  3T2Y A;  4IA6 A;  2R46 A;  4J34 A;  4CNK A;  3UTG A;  2EQ7 A;  4RG3 A;  1OJD A;  1TDF A;  4U8N A;  1CJC A;  1FEB A;  2WHD A;  2X8H A;  2GRT A;  2YR5 A;  3DA1 A;  3UKA A;  1MO9 A;  4OCG A;  1COY A;  4A6N B;  3QVR A;  5KVI A;  2BC1 A;  1ONF A;  4APN A;  3G5Q A;  2GR1 A;  2GV8 A;  3KKJ A;  3VRB A;  2R0G A;  1PN0 A;  3QSM A;  3K30 A;  3M0O A;  4G73 A;  4H4X A;  4IV9 A;  3AYJ A;  5EB5 A;  1CBO A;  1NPX A;  4H50 A;  1H83 A;  2E5V A;  4K5R A;  2EQ8 A;  4H2P A;  3SZ0 A;  5IQ4 A;  1OJC A;  2A89 A;  4H4V A;  3AE8 A;  3CPH G;  1O5W A;  4A99 A;  4H4S A;  3BNM A;  3NK1 X;  4CY6 A;  3NTA A;  3GDN A;  1PDH A;  1CJ3 A;  2IVE A;  4O5U A;  1CF3 A;  1CJ4 A;  3PO7 A;  1H7W A;  1TYT A;  1H2I A;  3DJJ A;  2XVF A;  2B7S A;  1TRB A;  3CPI G;  1O94 A;  4YXD A;  2AAQ A;  4A9W A;  3CGE A;  4EQW A;  1LQU A;  1IUW A;  1PBC A;  2O9Z A;  3AD7 B;  2YQU A;  1KNP A;  1F8S A;  1B37 A;  3NGC X;  2WDQ A;  3GSI A;  1EL8 A;  1X31 B;  3CN8 A;  5JCK A;  5JRB A;  3AE6 A;  4D03 A;  4YSH A;  5KMP A;  3VRD B;  2BS2 A;  3AEA A;  4Y4M A;  5CQF A;  2QA1 A;  1GRB A;  1EL7 A;  3AEB A;  3GWD A;  1KF6 A;  4ZCC A;  1F8W A;  2C66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...