1NHQA

Crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
447
structure length
447
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title Crystallographic analyses of NADH peroxidase Cys42Ala and Cys42Ser mutants: active site structures, mechanistic implications, and an unusual environment of Arg 303.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
total genus 136
structure length 447
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhqA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhqA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhqA02
1CL0A 1JRZA 5FS6A 4K8DA 5JCIA 4YWOA 2BS2A 2XFQA 1GNDA 5J60A 3S61A 4Z2UA 2UZZA 1YQZA 3QSMA 3ALMA 4H2QA 4U2LA 3AE3A 2XCGA 3NN6X 3AE6A 3H4KA 2YG5A 3AE2A 2BS3A 2C7GA 2WP6A 3NK0X 1PXBA 2R0CA 2GB0A 1S2YA 4X9MA 1H6VA 4H4RA 1V59A 3NTAA 3VRBA 2V6OA 4U8MA 3UTFA 1H84A 1KDGA 1KF6A 4ZCDA 1E1MA 4GDPA 3P4SA 2XDOA 2PYXA 3IWAA 2QA1A 1UKVG 1H81A 2GR2A 4MJWA 4WCTA 3NLCA 1PDHA 4H4PA 5GRTA 2OALA 3K30A 2YM2A 3ZYXA 4A6NA 2BK4A 1COYA 2WETA 1E39A 2AQJA 2WEUA 1JRXA 1EBDA 5KOWA 3G5RA 5J7XA 4YTPA 2RGOA 1O94A 2WDQA 1NHRA 2BA9A 1NAAA 3H8LA 5EOWA 4USQA 2BYBA 3QSEA 4D03A 3QFBA 1TDOA 3CGEA 2ARDA 2B9YA 4AT2A 1IUXA 1CC2A 3K7QX 3DGHA 3CTYA 3AD8B 1E7PA 5CKUA 5FS9A 1JRYA 2WP5A 1CJCA 1VRQB 4GUVA 3CNJA 2WU2A 3ISHA 2WOWA 4NTCA 1GESA 4OPLA 4A79A 2C75A 3DJGX 4Z26A 2X99A 3NH3X 1VDCA 2BS4A 4Z25A 1N4VA 3LOVA 3AD9B 4U8NA 3D8XA 3BHKA 3L1RA 1LPFA 1OJ9A 4C77A 2WESA 2WDRA 4NZHA 3EF6A 2XLUA 3GD4A 4CY8A 1S2QA 4H4VA 2TPRA 1DOCA 2VZ2A 3DH9A 1PBDA 3UOZA 2B7SA 4YTNA 1X31B 4LIIA 3G5QA 4AP3A 1GRTA 5BVAA 3QJ4A 1EL7A 1PN0A 4RG3A 3AE7A 1BZLA 1D4CA 2XVIA 4JN9A 1XANA 5KVHA 5JCMA 2OLNA 3UKKA 2YM1A 5HY5A 3NHOX 1VG0A 3SM8A 3UOVA 2B7RA 2IVDA 1F3PA 4U8JA 2JAEA 3DA1A 1LQTA 3IHGA 1LV0A 3II4A 1FOHA 1GT8A 3Q6JA 1PBFA 1PBCA 4PABA 3SQPA 2WOIA 3GMBA 1TDKA 2XFUA 4GF7A 3UTHA 2V3BA 1IUUA 2CULA 4OPTA 4H4SA 4A6NB 1GREA 1B5QA 1BGJA 2R0GA 4EIPA 5LV9A 1PBBA 4O5UA 3B6DA 4H4WA 3LB8A 2GQFA 2C67A 1IUVA 3AE8A 4TLXA 5U25A 1F8RA 1GRGA 2GAHB 4YT0A 4UDQA 1PS9A 4B69A 4J31A 4J57A 4B67A 1H7XA 1KFYA 1PHHA 2DKHA 2YLSA 3UKPA 2H89A 3KLJA 2XVEA 5KVIA 1D5TA 3KVEA 3GD3A 5JCKA 4PAAA 2A89A 2VQ7A 2NVKX 2VQBA 4B66A 3UOYA 1PJ7A 1Q1WA 3AEAA 2WBAA 1CJ2A 1KSUA 4B65A 5FS7A 2BCPA 4GDEA 3T37A 3F8RA 2BCGG 2JK6A 2V60A 3FMWA 2YLZA 5IPYA 3AD7B 2OAMA 3F8PA 3NNEA 3BHFA 3O0HA 1QLBA 3ICRA 1LQUA 2B76A 2YR4A 3NYCA 4OVIA 2AAQA 5TR3A 2GR0A 1GTEA 3LZWA 2C72A 3GDNA 3GWDA 4J2WA 2JKCA 3NT6A 1ZDLA 3URHA 3G5SA 2V5ZA 4K7ZA 1NPXA 1LVLA 2XFOA 5KRQA 2ZZBA 3CGDA 3ADAB 4JY3A 1P2EA 3BNMA 4J33A 4OCGA 2GV8A 3H8IA 4EQWA 1IUWA 1ZK7A 3CGBA 4O5QA 2WU5A 4EM3A 2YR6A 1FCDA 3I6DA 2BACA 2GMJA 4CCQA 3QSSA 2ACZA 3RP6A 2VOUA 2GMHA 4CBQA 3AE1A 1F6MA 3C4AA 3K7MX 4EM4A 3SGLA 3IHMA 3NK2X 3P4RA 1IUSA 4Z2TA 2VRMA 3VQRA 1NG4A 2E1MA 2GR3A 1M64A 2E4GA 2QA2A 3CIRA 3NRNA 3EPTA 1TRBA 1O95A 2YLWA 2YR5A 3FIMB 3EANA 3GDPA 4U8PA 3WE0A 4CNJA 4EIQA 3CNDA 4YTMA 5EB4A 1N4WA 2GH5A 1REOA 1EL5A 3RP7A 1ZX9A 4OPCA 4TM4A 2Z5YA 2V61A 1NDAA 3P1WA 4EQRA 2B9XA 1RSGA 4HB9A 2BABA 3P4PA 2YAUA 3ICSA 1CJ4A 3R9UA 5HXIA 4C3YA 3ALJA 3UOXA 1TYPA 3AEFA 3KD9A 1NENA 3V76A 1L9EA 1RP0A 4EQSA 4I59A 2F5ZA 4EMWA 2FBWA 1TDNA 3SFDA 4BJYA 4ZN0A 4YSYA 4NTEA 4FX9A 4M52A 3CNTA 4CCRA 1ZMCA 2A8XA 3LZXA 3NYEA 4X4JA 5IQ4A 3AEGA 3DJEA 3JSKA 1H86A 1GRHA 2IVEA 2DKIA 3P4QA 1FECA 4JY2A 2GF3A 2FJBA 3QFAA 1GETA 1DOEA 4J34A 2FJDA 3AEDA 1YQ4A 5JCLA 1YKJA 2APGA 2Q6UA 5IQ1A 4YXDA 4J36A 4J56A 4H2RA 1GPEA 3UTEA 4YSHA 2XLPA 1B37A 1L9DA 4ICYA 1RYIA 2JBVA 1TYTA 3HZLA 2YQUA 4ZCCA 1S3BA 2R4EA 4YKGA 4EMIA 5CQFA 1Q1RA 1CC4A 3ICTA 4K2XA 5BULA 3ALLA 1D7LA 5U1OA 4EMJA 3GSIA 1JNZA 4A65A 2WHDA 2Q0LA 2YG4A 3C4NA 3CPJG 4NEWA 3IF9A 3L8KA 3NIXA 3LJPA 2X8GA 2XVHA 4BURA 4H4XA 1CHUA 3GRTA 3CGCA 3FPZA 4B64A 4JQ9A 4CY6A 1E1NA 1W4XA 2R45A 1DXLA 3NG7X 4D04A 5C2TA 3ATQA 3ZDNA 4IVOB 2WQYA 3RNMA 2Z5XA 4U2TA 2C76A 2J3NA 4APNA 1Z6LA 4A7AA 1QJDA 1CC6A 3ATRA 1FEAA 1MXTA 2ZZCA 4JDRA 3KPFA 5EB5A 2C3CA 1NEKA 2C73A 3AEEA 4XXGA 3F8DA 3BNUA 1PBEA 3GMCA 4AOSA 5DBJA 1XDIA 5BUKA 1BWCA 1GERA 3RHAA 1PXAA 3NKSA 3AXBA 2NPXA 2GEWA 1H82A 2EQ6A 1GRFA 1PXCA 2E5VA 1K0IA 4KX6A 3DK9A 2CVJA 2R46A 2HQMA 1ELIA 1L9CA 2C66A 4E0VA 4EQXA 2VVLA 4BJZA 4TM1A 4I58A 4ADWA 4XWRA 3CPIG 2QCUA 1GALA 2V3AA 4TLZA 2CDUA 1DNCA 3AECA 3CN8A 4TM0A 2A87A 5GSNA 2WP9A 1B8SA 1NHSA 3AB1A 3NN0X 3Q9TA 2BK5A 4UDPA 4NEVA 1FL2A 4H4TA 3GYIA 4U2SA 3AYLA 1YQ3A 4IA6A 2WDVA 3BI5A 4H7UA 4H2NA 4C74A 2GAGB 1LTXR 3NK1X 2W0HA 3UKLA 1GRBA 2FJEA 4YKFA 4H4ZA 4K5SA 3RP8A 4C5OA 1ZOVA 4IVMB 2YWLA 5KOXA 4NTDA 2B9WA 1N4UA 3DMEA 4X9NA 2GQWA 2YLRA 2ZBWA 4H50A 1OJTA 2XVJA 3VR8A 5L46A 1K4QA 5HHFA 4WX1A 2YVGA 2Q7VA 4LA1A 3P9UA 2VVLG 2ZZ0A 4GRTA 1DJQA 4FDCB 3UKAA 4AOXA 1NG3A 2XYOA 2YG6A 1OJDA 1ZOYA 2H88A 1JEHA 1BKWA 3UTGA 3K7TA 4DGKA 4A9WA 4FK1C 2JB1A 1ZY8A 2EQ8A 3QVRA 3UP5A 3DJJA 4CNKA 1EL8A 1PJ5A 1GOSA 3PS9A 3NYFA 3LADA 4H2PA 3VRAA 4KPRA 4GCMA 1NHPA 5KWFA 3PO7A 3KU9A 4GR1A 1NHQA 3CNSA 3GRSA 2R4JA 1JOAA 3M0OA 4Z24A 3EAOA 4HA6A 4B68A 2FJAA 4REKA 4XWZA 2VVMA 4USRA 2C65A 1K0JA 5EBKA 2BXRA 2RABA 4FK1A 4RG4A 1ZKQA 1JU2A 2XLSA 1OJCA 4UDRA 4C3XA 2XFNA 2R0PA 2QAEA 3OC4A 1EL9A 4DSGA 1DOBA 2XLRA 2X3NA 2AR8A 1Y56A 4AT0A 2X8CA 2WOVA 4DNAA 1H83A 2Y6QA 3M13A 4Y4MA 4BK3A 3DJDA 3DK4A 2XLTA 2EQ9A 4K5RA 2BXSA 1YY5A 3ITJA 1Q9IA 3OZ2A 4K22A 1BGNA 4BK2A 4YSXA 3KKJA 4A5LA 1DJNA 2YVJA 1GV4A 1CJ3A 1P2HA 4TM3A 1JNRA 1TDEA 1O5WA 1KSSA 4U8KA 4B1BA 4Z2RA 1PJ6A 1GEUA 1IJHA 3AYJA 4JNAA 4Z44A 2GRTA 2X50A 3IC9A 1IUTA 3VRDB 2Y6RA 5FMHA 1E1LA 2EQ7A 3COXA 4P9SA 4Z43A 1MOKA 4ECHA 2XVFA 1H7WA 5U63A 3VR9A 2GR1A 1E6EA 1XHCA 1OJAA 2YLXA 1B4VA 1S3EA 2BK3A 1MO9A 1KNPA 1Y0PA 2OLOA 2BC1A 3D1CA 1N1PA 4UP3A 1ZP0A 4IV9A 3S5WA 4YSZA 2JB2A 1XPQA 3I3LA 1E1KA 3NTDA 3PVCA 4A99A 3AE5A 4IA5A 1ZMDA 3FG2P 2IIDA 3CPHG 3AE9A 2VRLA 3UP4A 1LJ1A 1F8SA 3AEBA 2C64A 3AE4A 2GVCA 3LXDA 1KNRA 2RGJA 1GSNA 1F8WA 1M6IA 3UKHA 3QVPA 2C70A 4Y4NA 3ABVA 3UKFA 1VQWA 2OA1A 1BF3A 2C3DA 3E1TA 3REDA 3V3OA 4U8IA 3CNPA 2RGHA 2BC0A 4H4UA 4H4QA 1VG9A 4RSLA 1K0LA 1HYUA 3UCLA 1AOGA 4AP1A 1D4EA 2XFPA 1GXFA 3AYIA 1D4DA 5C3JA 3M12A 1GRAA 2R9ZA 2PHHA 1SEZA 4JNQA 1Y56B 5FS8A 1GTHA 1QO8A 1TDFA 4H4YA 2WPCA 2JB3A 3SFEA 5ER0A 4OPGA 4OPIA 5KXJA 4BV6A 4BK1A 3UKQA 1FEBA 4LU6A 3DK8A 3AWIA 3BI2A 3KA7A 1ONFA 1CF3A 2Q0KA 3BI4A 2CFYA 2O9ZA 4OPUA 4CRTA 5BRTA 2X8HA 5M0ZA 5M10A 4U8OA 2TMDA 3FBSA 3DGZA 1CBOA 2I0ZA 4Y4LA 1D7YA 1L0VA 4N9XA 2YG3A 5HYMA 4DSHA 3B3RA 3NGCX 3GWFA 2YVFA 2WPEA 3C96A 4B63A 3GYJA 2WS3A 2YLTA 5JCNA 4U8LA 3V3NA 1DODA 4OPDA 2YG7A 2WPFA
chains in the Genus database with same CATH superfamily
1CL0A 5FS6A 4FP1A 5J60A 3R25A 4Z2UA 3ALMA 4G8TA 4U2LA 3AE3A 2POZA 2WP6A 1PXBA 3SZ0A 2GB0A 4X9MA 2PP1A 1KDGA 4ZCDA 3P4SA 3IWAA 3SJNA 1H81A 1PDHA 5GRTA 3K30A 2GGEA 2YM2A 4KEMA 2RGOA 3SR6B 1NHRA 5EOWA 1NAAA 2B9YA 3DG7A 4G9KA 3CTYA 1VRQB 2WU2A 1ELSA 2BS4A 3LOVA 4C77A 3BHKA 1LPFA 3RR1A 3OZYA 3EF6A 2TPRA 3DH9A 2B7SA 1OEPA 4X2PA 4YTNA 3QJ4A 1H2IA 3AE7A 1D4CA 2XVIA 5BOEA 3NHOX 3SM8A 3EUB3 2B7RA 4H1ZA 2ZC8A 2OPJA 2GGHA 2CULA 2PODA 3S5SA 4EIPA 5LV9A 3B6DA 1IUVA 1F8RA 2AL2A 2GAHB 3T0KA 4B69A 4B67A 3UKPA 2DKHA 2YLSA 5KVIA 2AL1A 3PFRA 5JCKA 4PAAA 2VQ7A 2NVKX 2WBAA 2QJNA 1KSUA 5FS7A 4GDEA 3T37A 3ZLGA 2BCGG 1N61C 3UJ2A 3TTEA 1N63C 3F8PA 3NNEA 3NYCA 2AAQA 1GTEA 3LZWA 2C72A 3GWDA 5FJOA 4J2WA 1ZDLA 2XH4A 3G5SA 2V5ZA 3UCDA 1NPXA 1FHUA 3CGDA 4OCGA 2W54A 4EQWA 3CGBA 2YR6A 1FCDA 3I6DA 3QSSA 3RP6A 4JHMA 2VOUA 3AE1A 1F6MA 3C4AA 3TWAA 3SGLA 1IUSA 4Z2TA 2OLAA 2VRMA 1NG4A 2AL2B 3NRNA 5C3JA 2PSNA 1TRBA 1YEYA 2YLWA 3GDPA 4K1WA 3WE0A 3VCCA 4HYRA 2Z5YA 4DYEA 2E5AA 3P1WA 2NQLA 1V97A 2B9XA 1RSGA 3QKEA 3MWCA 5HXIA 4DXKA 3ALJA 2GL5A 3DFYA 3GC2A 3NRZB 1RP0A 4EMWA 4YSYA 4NTEA 4M52A 3CNTA 1N62C 5FJUA 3AEGA 1GRHA 3QPEA 4Z17A 2FJBA 1YQ4A 5JCLA 2Q6UA 5IQ1A 3BOXA 3UTEA 2XLPA 1B37A 1RYIA 1WUFA 4YKGA 2E3TA 1R0MA 3ES7A 4A65A 4E5TA 3IF9A 3NVZB 2XVHA 3FVDA 4BURA 4DX3A 4JQ9A 1E1NA 1DXLA 5C2TA 3ZDNA 2WQYA 2PP3A 4A7AA 5IDZA 1CC6A 3ATRA 1FEAA 1MXTA 3FXGA 3AEEA 3F8DA 4AOSA 1XDIA 3DESA 4MKSA 3RHAA 2P8CA 2EQ6A 1PXCA 2E5VA 2R46A 4IP5A 4MMWA 1R6WA 4ZOHB 4BJZA 4TM1A 2V3AA 1DNCA 2A87A 1NHSA 3Q9TA 3I6EA 2BK5A 4UDPA 4NEVA 4C74A 2FKPA 3UKLA 3BSMA 1FO4A 3RP8A 4C5OA 1N5WC 2B9WA 4G74A 2XVJA 5L46A 1KKRA 1DJQA 4GRTA 2HZGA 1EL8A 1SJAA 3PS9A 3NYFA 3CMMA 3TCSA 3M0OA 3EAOA 3DFHA 3A7RA 1BQGA 3FYYA 4C3XA 5FJPA 1KN0A 2R0PA 3VC5A 1EL9A 4DN1A 1DOBA 2XLRA 4BK3A 4DNAA 1H83A 3M13A 3SYIA 2RDXA 3MQTA 1RVKA 1YY5A 2HNEA 4YSXA 1DJNA 2YVJA 4TM3A 4Z2RA 4U8KA 1GEUA 2C4CA 1T3QC 1WYGA 2X50A 1IUTA 3VC6A 5FMHA 4Z43A 1MOKA 4ECHA 3MZNA 4HNLA 1XHCA 2OLOA 1N1PA 2JB2A 3I3LA 2MNRA 5J04A 1L8PA 1E1KA 1IYXA 3STPA 3AE9A 4KPLA 1LJ1A 2C64A 3T8QA 3IJQA 1GSNA 3ABVA 3UKFA 3R0UA 1VQWA 2C3DA 3E1TA 3REDA 3T2KA 3CNPA 2BC0A 4H4QA 1KD0A 3UCLA 3GO2A 2XFPA 1GXFA 2PHHA 1SEZA 4JNQA 1QO8A 1TDFA 3H12A 3SFEA 5ER0A 3CXBA 3BI2A 2Q0KA 2CFYA 4CRTA 1SJCA 3FCPA 2I0ZA 1KKOA 1L0VA 5JCNA 1JRZA 3QSMA 4H2QA 1DTNA 2PCEA 3AE2A 2BS3A 3NK0X 2GDQA 1S2YA 4H4RA 3NTAA 3VRBA 3R11A 4G6GA 3SX6A 4GDPA 2PYXA 2XH0A 2QA1A 2GGGA 3NLCA 3ZYXA 1JRXA 3G5RA 4YTPA 2WDQA 3H8LA 4D03A 3QFBA 3T31A 1CC2A 3K7QX 3DGHA 3AD8B 3OTRA 5FS9A 4GUVA 3CNJA 2C75A 4Z26A 4Z25A 4E6MA 3D8XA 3L1RA 1OJ9A 2WESA 3GD4A 4CY8A 3H70A 2VZ2A 3UOZA 3T14A 5BVAA 1EL7A 1PN0A 4RG3A 2OX4A 1BZLA 1XANA 5KVHA 5JCMA 5HY5A 3UOVA 2JAEA 1LQTA 2I5QA 3II4A 1FOHA 1PBCA 4PABA 1IUUA 4OPTA 4H4SA 1B5QA 2MUCA 2R0GA 5G5GB 4O5UA 3TQPA 3LB8A 2GQFA 2C67A 3KUMA 4TLXA 1XS2A 1PS9A 4J31A 3CB3A 1KFYA 2H89A 4M6UA 2VQBA 3UJSA 4DHGA 1CJ2A 3F8RA 2OAMA 3HPFA 3BHFA 3ICRA 1LQUA 3T2ZA 3GDNA 3V5CA 3NT6A 2XFOA 2ZZBA 4J33A 1IUWA 1ZK7A 2PGEA 2CHRA 4EM3A 2GMJA 2ACZA 3JW7A 3K7MX 4IT1A 2O56A 4EM4A 3NK2X 3VQRA 1N5XA 2GR3A 1M64A 3NFUA 3EPTA 2GH5A 4II2A 1ZX9A 4OPCA 1NDAA 4K8GA 2GGIA 4HPNA 4GAVA 2OQHA 3B97A 3T9PA 1NENA 4EQSA 2F5ZA 1JPDX 3SFDA 4CCRA 2A8XA 4ENLA 3LZXA 3NYEA 4X4JA 3DJEA 2IVEA 4II3A 2GF3A 3QFAA 1DOEA 3AM9A 5FJTA 3S47A 4J36A 4YSHA 3UJRA 1L9DA 1TYTA 3RO6A 4HNCA 2R4EA 1FIQB 4EMIA 4K2XA 1MUCA 5BULA 2HXUA 2YG4A 4NEWA 3L8KA 3LJPA 4H4XA 4B64A 3VDGA 4CY6A 3SQSA 4IVOB 3RNMA 3GY1A 3UCCA 3P3BA 2C76A 3R0KA 4IL0A 1Z6LA 1QJDA 2ZZCA 4JDRA 3KPFA 5EB5A 1NEKA 1RM6B 2PTZA 2C73A 4XXGA 3U4FA 1GERA 3JVAA 3AXBA 4E4FA 2OZ3A 1GRFA 4KX6A 3DK9A 2CVJA 3DG3A 4E0VA 2C66A 2P88A 4I58A 4XWRA 3CPIG 4TLZA 3AECA 1B8SA 3AB1A 1FL2A 4IA6A 1YQ3A 2WDVA 3BI5A 4H7UA 4H2NA 4H2HA 1LTXR 2W0HA 3NZGA 2FJEA 4GYPA 1ZOVA 4IVMB 2YWLA 4NTDA 2P0IA 4X9NA 2GQWA 4H50A 1OJTA 4WX1A 1NU5A 1FHVA 2OFJA 2ZZ0A 2YG6A 1OJDA 1ZOYA 4HCLA 1BKWA 4DGKA 4A9WA 3SBFA 1ZY8A 3DJJA 3SN4A 1GOSA 3LADA 3RRAA 3PO7A 4GR1A 2PGWA 4ROPA 1JOAA 3VFCA 4REKA 5EBKA 2BXRA 4RG4A 3SZFA 7ENLA 1JU2A 2XLSA 1STZA 1PDYA 1S7MA 3OZMA 2QAEA 3OC4A 4AT0A 1SB3B 3HYWA 1SJBA 3DK4A 3Q4DA 4K5RA 1Q9IA 1FFUC 4A5LA 1P2HA 1O5WA 1KSSA 2OO6A 3AYJA 1WUEA 1JRPA 3CAWA 2Y6RA 4P9SA 5G5HB 1H7WA 5U63A 3VR9A 1VDVA 3D1CA 1KNPA 1ZP0A 4IV9A 3DIPA 3NTDA 3ENLA 3ZVIA 3FG2P 1X2HA 1F8SA 3AEBA 2GVCA 3LXDA 3NVVB 2RGJA 3UKHA 1BF3A 4U8IA 1VG9A 4RSLA 3NS1B 1K0LA 4OPGA 4BK1A 4GAPA 2PU0A 1CF3A 4J3ZA 4OPUA 3MUCA 5M10A 5KMPA 2TMDA 3FBSA 3N4FA 2GGJA 3FJ4A 1D7YA 2BRYA 3KPKA 5HYMA 4DSHA 3R07C 3B3RA 2QQ6A 2YVFA 4B63A 4TVWA 3V3NA 4OPDA 3HRDC 2WPFA 2BS2A 2XFQA 2ZADA 3NN6X 3AE6A 2YG5A 3RCYA 2R0CA 1H6VA 1V59A 4U8MA 3OP2A 1KF6A 2XDOA 1UKVG 2GR2A 4H4PA 2OALA 4H83A 2WEUA 1EBDA 5J7XA 2BYBA 2ARDA 4AT2A 1IUXA 1E7PA 2QGYA 1JRYA 2WP5A 2XH2A 1CJCA 2BRAA 2QDEA 2WOWA 1GESA 4A79A 2X99A 1VDCA 4ZA0A 6ENLA 1E9IA 3AMZA 1N4VA 2PA6A 2XLUA 1DOCA 1JPMA 4IP4A 4JN7A 3G5QA 4AP3A 1GRTA 3H8AA 3CYJA 3UKKA 2OLNA 1TE6A 1SJDA 4GIRA 1F3PA 4U8JA 2IVDA 3IHGA 1LV0A 1PBFA 2WOIA 3GMBA 2V3BA 1N60C 4H4WA 2XSXA 5U25A 4G6HA 4YT0A 4UDQA 3ZLFA 1PHHA 3KLJA 2XVEA 1D5TA 3KVEA 3SY4A 3TOYA 3UOYA 2BCPA 3MSYA 2JK6A 2V60A 3FMWA 2YLZA 3PWIA 5IPYA 3AD7B 3O0HA 2B76A 2YR4A 4OVIA 4KWSA 5KNLA 5TR3A 3TW9A 3I6TA 3URHA 4TVYA 5KRQA 1JROA 3BNMA 2P8BA 2WU5A 3NXLA 2BACA 2GMHA 3T6CA 2QJJA 5KMRA 3IHMA 3P4RA 4A35A 3TJIA 2E1MA 3FIMB 2YR5A 5KMSA 3CNDA 3UXKA 1N4WA 1REOA 1EL5A 3RP7A 4TM4A 2BABA 2PPGA 2YAUA 3ICSA 3R9UA 1TZZA 1TYPA 3AN1A 3ZLHA 3KD9A 3V76A 4GMEA 3P93A 1TDNA 5JRBA 4BJYA 4ZN0A 3JSKA 2OVLA 2DKIA 3P4QA 4JY2A 1TKKA 3NVYB 4J34A 2FJDA 3DEQA 1YKJA 4YXDA 4J56A 4H2RA 1GPEA 4ICYA 2YQUA 5CQFA 1Q1RA 3ALLA 4EMJA 3GSIA 1JNZA 2WHDA 3C4NA 4HCDA 3R1ZA 2PS2A 4HCHA 3NIXA 2X8GA 3TJ4A 1CHUA 3CK5A 1W4XA 4D04A 3ATQA 2Z5XA 2J3NA 1X2GA 2C3CA 3GMCA 1PBEA 1BWCA 3NKSA 1H82A 1K0IA 1ELIA 2VVLA 1JDFA 3HW2A 2QCUA 1GALA 4GYPC 2CDUA 3A7UA 4TM0A 3CN8A 2WP9A 2OZTA 3ES8A 3OW1A 3AYLA 2QDDA 2GAGB 1FFVC 1EC7A 4YKFA 3MY9A 4G7FA 3VCNA 4NNJA 3Q45A 5KOXA 2W3SA 1N4UA 3DMEA 2ZBWA 3K1GA 2YLRA 3VR8A 1K4QA 5HHFA 2YVGA 1VQZA 3BJSA 2VVLG 1NG3A 2XYOA 2H88A 3UTGA 1ONEA 3QVRA 2EQ8A 3UP5A 1PJ5A 3UGVA 4H2PA 3VRAA 3KU9A 3CNSA 1NHQA 2R4JA 4Z24A 4B68A 4HA6A 2VVMA 2PTWA 2RABA 4FK1A 5FJRA 4DSGA 2FYMA 1Y56A 2Y6QA 4Y4MA 2PTXA 3DJDA 2XLTA 1ECQA 3ITJA 3OZ2A 4BK2A 3QN3A 1CJ3A 1JNRA 2QVHA 2HXTA 1IJHA 3RITA 4JNAA 4Z44A 3IC9A 3VRDB 2EQ7A 3COXA 2XVFA 2ONEA 3VA8A 3DGBA 2GR1A 2OG9A 3D47A 1E6EA 1OJAA 3N4EA 2DW7A 1S3EA 1MO9A 1Y0PA 3S5WA 2AKMA 1MDRA 4HN8A 1XPQA 3PVCA 4A99A 2IIDA 3HYXA 3CPHG 2VRLA 3UP4A 3AE4A 1F8WA 1M6IA 1MRAA 2AKZA 2C70A 2PU1A 3I4KA 2OA1A 3FV9A 3ZVHA 2RGHA 4H4UA 2DW6A 2PMQA 1HYUA 4AP1A 4KT2A 1D4EA 3UJFA 1D4DA 4GGBA 3M12A 1GRAA 2R9ZA 1Y56B 1GTHA 4H4YA 4F4RA 2JB3A 4M0XA 4OPIA 4BV6A 4LU6A 3AWIA 1ONFA 3BI4A 4EWJA 3P0WA 2O9ZA 5BRTA 2X8HA 5M0ZA 4U8OA 3DGZA 4Y4LA 2YG3A 3NGCX 4A3RA 3EKGA 3C96A 3GYJA 2YLTA 4U8LA 2OKTA 3QTPA 3D46A 1NELA 4K8DA 3D9XA 5JCIA 4YWOA 3UXLA 1GNDA 3S61A 2UZZA 1YQZA 2XCGA 4E8GA 3H4KA 2C7GA 4FI4A 2V6OA 3UTFA 3GD6A 1H84A 1E1MA 3ZVHB 4MJWA 4WCTA 4YWSA 4A6NA 3CXOA 2BK4A 1COYA 2WETA 1E39A 2AQJA 5KOWA 3V4BA 3DERA 1O94A 2BA9A 4USQA 3QSEA 1TDOA 3CGEA 3NO1A 2OZ8A 5CKUA 4OPLA 3ISHA 4NTCA 3DJGX 3NH3X 4JN8A 3AD9B 1EBHA 4U8NA 1F9CA 2WDRA 4NZHA 3N6JA 1S2QA 4H4VA 1PBDA 3PK7A 1X31B 4LIIA 4IHCA 4JN9A 2YM1A 1VG0A 3N6HA 3DA1A 1GT8A 3Q6JA 3SQPA 1TDKA 2XFUA 4GF7A 3UTHA 2QJMA 3OPSA 4A6NB 1GREA 2PP0A 1BGJA 1PBBA 3AE8A 1GRGA 4J57A 1H7XA 3THUA 3GD3A 2A89A 4B66A 1PJ7A 1Q1WA 3AEAA 4B65A 1QLBA 2GR0A 3SZCA 3MKCA 1XPYA 2JKCA 4K7ZA 3SN0A 1LVLA 3ADAB 4JY3A 1P2EA 3T4WA 4K2SA 2GV8A 3H8IA 1W6TA 4O5QA 4CCQA 4IZGA 4CBQA 3EEZA 2PTYA 2QA2A 2E4GA 3CIRA 4U8PA 1O95A 4CNJA 3EANA 4EIQA 5EB4A 4YTMA 3B9JB 3U9IA 2V61A 4EQRA 4HB9A 3P4PA 1CJ4A 4IL2A 4C3YA 3UOXA 3AEFA 3T2YA 1KCZA 1L9EA 4I59A 3IJIA 3PG6A 2FBWA 4FX9A 3RGTA 1ZMCA 5IQ4A 1H86A 1FECA 1GETA 3AEDA 2APGA 3ETRB 2JBVA 3TWBA 3HZLA 1S3BA 4GFIA 3R10A 1CC4A 3ICTA 1EC9A 1D7LA 5U1OA 2Q0LA 4E4UA 3CPJG 3SZWA 5KMQA 3FPZA 3GRTA 3CGCA 5EU9A 3L5OA 2R45A 3NG7X 3CT2A 3IK4A 3SXIA 4U2TA 4APNA 1P43A 2W55A 3BNUA 5DBJA 1EC8A 5BUKA 1PXAA 2NPXA 2GEWA 2HQMA 1L9CA 3SN1A 4EQXA 4ADWA 4J1OA 5GSNA 4GGHA 2XH7A 1BKHA 3NN0X 1MNSA 4H4TA 3GYIA 4U2SA 3DDMA 3NK1X 1GRBA 4ZCWA 4H4ZA 4K5SA 3JZUA 3QLDA 2OQYA 2Q7VA 4LA1A 3P9UA 4FDCB 3UKAA 4AOXA 1JEHA 3K7TA 4FK1C 1MDLA 2W3RA 2JB1A 4CNKA 4Z1YA 3V3WA 3A7AA 3PWGA 4KPRA 4GCMA 1NHPA 5KWFA 3GYXA 3GRSA 4GISA 4NWZA 2FJAA 4XWZA 4USRA 2C65A 1K0JA 3H7VA 1ZKQA 3DG6A 1OJCA 4UDRA 4G73A 2XFNA 1EBGA 2X3NA 2AR8A 2X8CA 2WOVA 5BOFA 2EQ9A 2BXSA 4K22A 1BGNA 3KKJA 3NVWB 1GV4A 4B1BA 1TDEA 1PJ6A 2GRTA 4A6GA 1E1LA 2XGZA 2YLXA 1B4VA 2BK3A 4ZCCA 4UP3A 2BC1A 4YSZA 3SSZA 3AE5A 4IA5A 1ZMDA 4DWDA 3HYVA 3UJEA 1KNRA 1JCTA 3QVPA 4Y4NA 3IJLA 3V3OA 2GSHA 3V5FA 1AOGA 1P48A 3AYIA 5FS8A 4MGGA 2WPCA 5KXJA 3UKQA 1FEBA 3DK8A 3KA7A 1CBOA 5ENLA 4H19A 4N9XA 1ZXIC 3GWFA 2WPEA 2WS3A 1PDZA 1DODA 2YG7A 2P3ZA
chains in the Genus database with same CATH topology
1CL0A 1JRZA 5FS6A 4K8DA 3D9XA 5JCIA 4YWOA 2BS2A 2XFQA 1GNDA 5J60A 3S61A 4Z2UA 2UZZA 1YQZA 3QSMA 3ALMA 4H2QA 4U2LA 3AE3A 2XCGA 3NN6X 3AE6A 3H4KA 2YG5A 3AE2A 2BS3A 2C7GA 2WP6A 3NK0X 1PXBA 2R0CA 3SZ0A 2GB0A 1S2YA 4X9MA 1H6VA 4H4RA 1V59A 3NTAA 3VRBA 2V6OA 4U8MA 3UTFA 1H84A 1KDGA 1KF6A 4G6GA 1E1MA 4ZCDA 3SX6A 4GDPA 3P4SA 2XDOA 2PYXA 3IWAA 2QA1A 1UKVG 1H81A 2GR2A 4MJWA 4WCTA 3NLCA 1PDHA 4H4PA 5GRTA 2OALA 3K30A 2YM2A 3ZYXA 4A6NA 2BK4A 1COYA 2WETA 1E39A 2AQJA 2WEUA 1JRXA 1EBDA 5KOWA 3G5RA 5J7XA 4YTPA 2RGOA 1O94A 2WDQA 1NHRA 2BA9A 1NAAA 3H8LA 5EOWA 4USQA 2BYBA 3QSEA 4D03A 3QFBA 1TDOA 3T31A 3CGEA 2ARDA 2B9YA 4AT2A 1IUXA 1CC2A 3K7QX 3DGHA 4G9KA 3CTYA 3AD8B 1E7PA 5CKUA 5FS9A 1JRYA 2WP5A 1CJCA 1VRQB 4GUVA 3CNJA 2BRAA 2WU2A 2WOWA 3ISHA 1GESA 4NTCA 4OPLA 4A79A 2C75A 3DJGX 4Z26A 2X99A 3NH3X 1VDCA 2BS4A 4Z25A 1N4VA 3LOVA 3AD9B 4U8NA 3D8XA 3BHKA 3L1RA 1LPFA 1OJ9A 4C77A 2WESA 2WDRA 4NZHA 3EF6A 2XLUA 3GD4A 4CY8A 1S2QA 4H4VA 2TPRA 1DOCA 2VZ2A 3DH9A 1PBDA 3UOZA 2B7SA 4YTNA 3T14A 1X31B 4LIIA 3G5QA 4AP3A 1GRTA 5BVAA 3QJ4A 1H2IA 1EL7A 1PN0A 4RG3A 3AE7A 1BZLA 1D4CA 2XVIA 4JN9A 1XANA 5KVHA 5JCMA 2OLNA 3UKKA 2YM1A 5HY5A 3NHOX 1VG0A 3SM8A 3UOVA 2B7RA 2IVDA 1F3PA 4U8JA 2JAEA 3DA1A 1LQTA 3IHGA 1LV0A 3II4A 1FOHA 1GT8A 3Q6JA 1PBFA 1PBCA 4PABA 3SQPA 2WOIA 3GMBA 1TDKA 2XFUA 4GF7A 3UTHA 2V3BA 1IUUA 2CULA 4OPTA 4H4SA 4A6NB 1GREA 1B5QA 1BGJA 2R0GA 4EIPA 5LV9A 1PBBA 4O5UA 3B6DA 4H4WA 3LB8A 2GQFA 2C67A 1IUVA 3AE8A 4TLXA 5U25A 4G6HA 1F8RA 1GRGA 2GAHB 4YT0A 4UDQA 3T0KA 1PS9A 4B69A 4J31A 4J57A 4B67A 1H7XA 1KFYA 1PHHA 2DKHA 2YLSA 3UKPA 2H89A 3KLJA 2XVEA 5KVIA 1D5TA 3KVEA 3GD3A 5JCKA 4PAAA 2A89A 2VQ7A 2NVKX 2VQBA 3SY4A 4B66A 3UOYA 1PJ7A 1Q1WA 3AEAA 2WBAA 1CJ2A 1KSUA 4B65A 5FS7A 2BCPA 4GDEA 3T37A 3F8RA 2BCGG 2JK6A 2V60A 3FMWA 2YLZA 5IPYA 3AD7B 2OAMA 3F8PA 3NNEA 3BHFA 3O0HA 1QLBA 3ICRA 1LQUA 2B76A 2YR4A 3NYCA 4OVIA 2AAQA 3T2ZA 5TR3A 5KNLA 2GR0A 1GTEA 3SZCA 3LZWA 2C72A 3GDNA 3GWDA 4J2WA 2JKCA 3NT6A 1ZDLA 3URHA 3G5SA 2V5ZA 4K7ZA 1NPXA 1LVLA 2XFOA 5KRQA 2ZZBA 3CGDA 3ADAB 4JY3A 1P2EA 3BNMA 4J33A 4OCGA 2GV8A 3H8IA 4EQWA 1IUWA 1ZK7A 3CGBA 4O5QA 2WU5A 4EM3A 2YR6A 1FCDA 3I6DA 2BACA 2GMJA 4CCQA 3QSSA 2ACZA 3RP6A 2VOUA 2GMHA 4CBQA 3AE1A 1F6MA 3C4AA 3K7MX 5KMRA 4EM4A 3SGLA 3IHMA 3NK2X 3P4RA 1IUSA 4Z2TA 2VRMA 3VQRA 1NG4A 2E1MA 2GR3A 1M64A 2E4GA 2QA2A 3CIRA 3NRNA 3EPTA 1TRBA 1O95A 2YLWA 2YR5A 3FIMB 3EANA 3GDPA 4U8PA 3WE0A 4CNJA 4EIQA 5KMSA 3CNDA 4YTMA 5EB4A 1N4WA 2GH5A 1REOA 4II2A 1EL5A 3RP7A 1ZX9A 4OPCA 4TM4A 2Z5YA 2V61A 1NDAA 3P1WA 4EQRA 2B9XA 1RSGA 4HB9A 2BABA 3P4PA 2YAUA 4GAVA 3ICSA 1CJ4A 3R9UA 5HXIA 4C3YA 3ALJA 3UOXA 1TYPA 3AEFA 3KD9A 1NENA 3V76A 3T2YA 1L9EA 1RP0A 4EQSA 4I59A 2F5ZA 3PG6A 4EMWA 2FBWA 1TDNA 3SFDA 5JRBA 4BJYA 4ZN0A 4YSYA 4NTEA 4FX9A 4M52A 3CNTA 4CCRA 1ZMCA 2A8XA 3LZXA 3NYEA 4X4JA 5IQ4A 3AEGA 3DJEA 3JSKA 1H86A 1GRHA 2IVEA 2DKIA 4II3A 3P4QA 1FECA 4JY2A 2GF3A 2FJBA 3QFAA 1GETA 1DOEA 4J34A 2FJDA 3AEDA 1YQ4A 5JCLA 1YKJA 2APGA 2Q6UA 5IQ1A 4YXDA 4J36A 4J56A 4H2RA 1GPEA 3UTEA 4YSHA 2XLPA 1B37A 1L9DA 4ICYA 1RYIA 2JBVA 1TYTA 3HZLA 2YQUA 4ZCCA 1S3BA 2R4EA 4YKGA 4EMIA 5CQFA 1Q1RA 1CC4A 3ICTA 4K2XA 5BULA 3ALLA 1D7LA 5U1OA 4EMJA 3GSIA 1JNZA 4A65A 2WHDA 2Q0LA 2YG4A 3C4NA 3CPJG 4NEWA 3SZWA 3IF9A 3L8KA 5KMQA 3NIXA 3LJPA 2X8GA 2XVHA 4BURA 4H4XA 1CHUA 3GRTA 3CGCA 3FPZA 4B64A 4JQ9A 4CY6A 1E1NA 1W4XA 3L5OA 2R45A 1DXLA 3NG7X 4D04A 5C2TA 3ATQA 3ZDNA 4IVOB 2WQYA 3RNMA 3SXIA 2Z5XA 4U2TA 2C76A 2J3NA 4APNA 1Z6LA 4A7AA 1QJDA 1CC6A 3ATRA 1FEAA 1MXTA 2ZZCA 4JDRA 3KPFA 5EB5A 2C3CA 1NEKA 2C73A 3AEEA 4XXGA 3F8DA 3BNUA 1PBEA 3GMCA 4AOSA 5DBJA 1XDIA 5BUKA 1BWCA 1GERA 3RHAA 1PXAA 3NKSA 3AXBA 2NPXA 2GEWA 1H82A 2EQ6A 1GRFA 1PXCA 2E5VA 1K0IA 4KX6A 3DK9A 2CVJA 2R46A 2HQMA 1ELIA 1L9CA 2C66A 4E0VA 4EQXA 2VVLA 4BJZA 4TM1A 4I58A 4ADWA 4XWRA 3CPIG 2QCUA 1GALA 2V3AA 4TLZA 2CDUA 1DNCA 3AECA 3CN8A 4TM0A 2A87A 5GSNA 2WP9A 1B8SA 1NHSA 3AB1A 3NN0X 3Q9TA 2BK5A 4UDPA 4NEVA 1FL2A 4H4TA 3GYIA 4U2SA 3AYLA 1YQ3A 4IA6A 2WDVA 3BI5A 4H7UA 4H2NA 4C74A 2GAGB 1LTXR 3NK1X 2W0HA 3UKLA 1GRBA 2FJEA 4YKFA 4H4ZA 4K5SA 3RP8A 4C5OA 1ZOVA 4IVMB 4NNJA 2YWLA 5KOXA 4NTDA 2B9WA 1N4UA 3DMEA 4X9NA 4G74A 2GQWA 2YLRA 2ZBWA 4H50A 1OJTA 2XVJA 3VR8A 5L46A 1K4QA 5HHFA 4WX1A 2YVGA 2Q7VA 4LA1A 3P9UA 2VVLG 2ZZ0A 4GRTA 1DJQA 4FDCB 3UKAA 4AOXA 1NG3A 2XYOA 2YG6A 1OJDA 1ZOYA 2H88A 1JEHA 1BKWA 3UTGA 3K7TA 4DGKA 4A9WA 4FK1C 2JB1A 1ZY8A 2EQ8A 3QVRA 3UP5A 3DJJA 4CNKA 1EL8A 1PJ5A 1GOSA 3PS9A 3NYFA 3CMMA 3LADA 4H2PA 3VRAA 4KPRA 4GCMA 1NHPA 5KWFA 3GYXA 3PO7A 3KU9A 4GR1A 1NHQA 3CNSA 3GRSA 4NWZA 2R4JA 1JOAA 3M0OA 4Z24A 3EAOA 4HA6A 4B68A 2FJAA 4REKA 4XWZA 2VVMA 4USRA 2C65A 1K0JA 5EBKA 2BXRA 2RABA 4FK1A 4RG4A 3SZFA 1ZKQA 1JU2A 2XLSA 1OJCA 4UDRA 4G73A 2XFNA 4C3XA 1KN0A 1S7MA 2R0PA 2QAEA 3OC4A 1EL9A 4DSGA 1DOBA 2XLRA 2X3NA 2AR8A 1Y56A 4AT0A 2X8CA 2WOVA 4DNAA 1H83A 2Y6QA 3M13A 4Y4MA 3SYIA 3HYWA 3DJDA 3DK4A 2XLTA 2EQ9A 4K5RA 2BXSA 1YY5A 3ITJA 1Q9IA 3OZ2A 4K22A 1BGNA 4BK2A 4YSXA 3KKJA 4A5LA 1DJNA 2YVJA 1GV4A 1CJ3A 1P2HA 4TM3A 1JNRA 1TDEA 1O5WA 1KSSA 4U8KA 4B1BA 4Z2RA 1PJ6A 1GEUA 1IJHA 2C4CA 3AYJA 4JNAA 4Z44A 2GRTA 2X50A 3IC9A 1IUTA 3VRDB 2Y6RA 5FMHA 1E1LA 2EQ7A 3COXA 4P9SA 4Z43A 1MOKA 4ECHA 2XVFA 1H7WA 5U63A 3VR9A 2GR1A 1E6EA 1XHCA 1OJAA 2YLXA 1B4VA 1S3EA 2BK3A 1MO9A 1KNPA 1Y0PA 2OLOA 2BC1A 3D1CA 1N1PA 4UP3A 1ZP0A 4IV9A 3S5WA 4YSZA 2JB2A 1XPQA 3I3LA 1E1KA 3NTDA 3PVCA 4A99A 3AE5A 4IA5A 1ZMDA 3FG2P 2IIDA 3HYXA 3CPHG 3AE9A 2VRLA 3UP4A 1LJ1A 1F8SA 3AEBA 2C64A 3AE4A 3HYVA 2GVCA 3LXDA 1KNRA 2RGJA 1GSNA 1F8WA 1M6IA 3UKHA 3QVPA 2C70A 4Y4NA 3ABVA 3UKFA 1VQWA 2OA1A 1BF3A 2C3DA 3E1TA 3REDA 3T2KA 3V3OA 4U8IA 3CNPA 2RGHA 2BC0A 4H4UA 4H4QA 1VG9A 4RSLA 1K0LA 1HYUA 3UCLA 1AOGA 4AP1A 1D4EA 2XFPA 1GXFA 3AYIA 1D4DA 5C3JA 3M12A 1GRAA 2R9ZA 2PHHA 1SEZA 4JNQA 1Y56B 5FS8A 1GTHA 1QO8A 1TDFA 4H4YA 2WPCA 2JB3A 3SFEA 5ER0A 4OPGA 4OPIA 5KXJA 4BV6A 4BK1A 4GAPA 1FEBA 4LU6A 3DK8A 3UKQA 3AWIA 3BI2A 3KA7A 1ONFA 1CF3A 2Q0KA 3BI4A 2CFYA 2O9ZA 4OPUA 4BK3A 4CRTA 5BRTA 2X8HA 5M0ZA 5KMPA 5M10A 4U8OA 2TMDA 3FBSA 3DGZA 1CBOA 2I0ZA 4Y4LA 1D7YA 1L0VA 2BRYA 4N9XA 2YG3A 3KPKA 5HYMA 4DSHA 3B3RA 3NGCX 3GWFA 2YVFA 2WPEA 3C96A 4B63A 3GYJA 2WS3A 2YLTA 5JCNA 4U8LA 3V3NA 1DODA 4OPDA 2YG7A 2WPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CL0 A;  1JRZ A;  5FS6 A;  4K8D A;  5JCI A;  4YWO A;  2BS2 A;  2XFQ A;  1GND A;  5J60 A;  3S61 A;  4Z2U A;  2UZZ A;  1YQZ A;  3QSM A;  3ALM A;  4H2Q A;  4U2L A;  3AE3 A;  2XCG A;  3NN6 X;  3AE6 A;  3H4K A;  2YG5 A;  3AE2 A;  2BS3 A;  2C7G A;  2WP6 A;  3NK0 X;  1PXB A;  2R0C A;  2GB0 A;  1S2Y A;  4X9M A;  1H6V A;  4H4R A;  1V59 A;  3NTA A;  3VRB A;  2V6O A;  4U8M A;  3UTF A;  1H84 A;  1KDG A;  1KF6 A;  4ZCD A;  1E1M A;  4GDP A;  3P4S A;  2XDO A;  2PYX A;  3IWA A;  2QA1 A;  1UKV G;  1H81 A;  2GR2 A;  4MJW A;  4WCT A;  3NLC A;  1PDH A;  4H4P A;  5GRT A;  2OAL A;  3K30 A;  2YM2 A;  3ZYX A;  4A6N A;  2BK4 A;  1COY A;  2WET A;  1E39 A;  2AQJ A;  2WEU A;  1JRX A;  1EBD A;  5KOW A;  3G5R A;  5J7X A;  4YTP A;  2RGO A;  1O94 A;  2WDQ A;  1NHR A;  2BA9 A;  1NAA A;  3H8L A;  5EOW A;  4USQ A;  2BYB A;  3QSE A;  4D03 A;  3QFB A;  1TDO A;  3CGE A;  2ARD A;  2B9Y A;  4AT2 A;  1IUX A;  1CC2 A;  3K7Q X;  3DGH A;  3CTY A;  3AD8 B;  1E7P A;  5CKU A;  5FS9 A;  1JRY A;  2WP5 A;  1CJC A;  1VRQ B;  4GUV A;  3CNJ A;  2WU2 A;  3ISH A;  2WOW A;  4NTC A;  1GES A;  4OPL A;  4A79 A;  2C75 A;  3DJG X;  4Z26 A;  2X99 A;  3NH3 X;  1VDC A;  2BS4 A;  4Z25 A;  1N4V A;  3LOV A;  3AD9 B;  4U8N A;  3D8X A;  3BHK A;  3L1R A;  1LPF A;  1OJ9 A;  4C77 A;  2WES A;  2WDR A;  4NZH A;  3EF6 A;  2XLU A;  3GD4 A;  4CY8 A;  1S2Q A;  4H4V A;  2TPR A;  1DOC A;  2VZ2 A;  3DH9 A;  1PBD A;  3UOZ A;  2B7S A;  4YTN A;  1X31 B;  4LII A;  3G5Q A;  4AP3 A;  1GRT A;  5BVA A;  3QJ4 A;  1EL7 A;  1PN0 A;  4RG3 A;  3AE7 A;  1BZL A;  1D4C A;  2XVI A;  4JN9 A;  1XAN A;  5KVH A;  5JCM A;  2OLN A;  3UKK A;  2YM1 A;  5HY5 A;  3NHO X;  1VG0 A;  3SM8 A;  3UOV A;  2B7R A;  2IVD A;  1F3P A;  4U8J A;  2JAE A;  3DA1 A;  1LQT A;  3IHG A;  1LV0 A;  3II4 A;  1FOH A;  1GT8 A;  3Q6J A;  1PBF A;  1PBC A;  4PAB A;  3SQP A;  2WOI A;  3GMB A;  1TDK A;  2XFU A;  4GF7 A;  3UTH A;  2V3B A;  1IUU A;  2CUL A;  4OPT A;  4H4S A;  4A6N B;  1GRE A;  1B5Q A;  1BGJ A;  2R0G A;  4EIP A;  5LV9 A;  1PBB A;  4O5U A;  3B6D A;  4H4W A;  3LB8 A;  2GQF A;  2C67 A;  1IUV A;  3AE8 A;  4TLX A;  5U25 A;  1F8R A;  1GRG A;  2GAH B;  4YT0 A;  4UDQ A;  1PS9 A;  4B69 A;  4J31 A;  4J57 A;  4B67 A;  1H7X A;  1KFY A;  1PHH A;  2DKH A;  2YLS A;  3UKP A;  2H89 A;  3KLJ A;  2XVE A;  5KVI A;  1D5T A;  3KVE A;  3GD3 A;  5JCK A;  4PAA A;  2A89 A;  2VQ7 A;  2NVK X;  2VQB A;  4B66 A;  3UOY A;  1PJ7 A;  1Q1W A;  3AEA A;  2WBA A;  1CJ2 A;  1KSU A;  4B65 A;  5FS7 A;  2BCP A;  4GDE A;  3T37 A;  3F8R A;  2BCG G;  2JK6 A;  2V60 A;  3FMW A;  2YLZ A;  5IPY A;  3AD7 B;  2OAM A;  3F8P A;  3NNE A;  3BHF A;  3O0H A;  1QLB A;  3ICR A;  1LQU A;  2B76 A;  2YR4 A;  3NYC A;  4OVI A;  2AAQ A;  5TR3 A;  2GR0 A;  1GTE A;  3LZW A;  2C72 A;  3GDN A;  3GWD A;  4J2W A;  2JKC A;  3NT6 A;  1ZDL A;  3URH A;  3G5S A;  2V5Z A;  4K7Z A;  1NPX A;  1LVL A;  2XFO A;  5KRQ A;  2ZZB A;  3CGD A;  3ADA B;  4JY3 A;  1P2E A;  3BNM A;  4J33 A;  4OCG A;  2GV8 A;  3H8I A;  4EQW A;  1IUW A;  1ZK7 A;  3CGB A;  4O5Q A;  2WU5 A;  4EM3 A;  2YR6 A;  1FCD A;  3I6D A;  2BAC A;  2GMJ A;  4CCQ A;  3QSS A;  2ACZ A;  3RP6 A;  2VOU A;  2GMH A;  4CBQ A;  3AE1 A;  1F6M A;  3C4A A;  3K7M X;  4EM4 A;  3SGL A;  3IHM A;  3NK2 X;  3P4R A;  1IUS A;  4Z2T A;  2VRM A;  3VQR A;  1NG4 A;  2E1M A;  2GR3 A;  1M64 A;  2E4G A;  2QA2 A;  3CIR A;  3NRN A;  3EPT A;  1TRB A;  1O95 A;  2YLW A;  2YR5 A;  3FIM B;  3EAN A;  3GDP A;  4U8P A;  3WE0 A;  4CNJ A;  4EIQ A;  3CND A;  4YTM A;  5EB4 A;  1N4W A;  2GH5 A;  1REO A;  1EL5 A;  3RP7 A;  1ZX9 A;  4OPC A;  4TM4 A;  2Z5Y A;  2V61 A;  1NDA A;  3P1W A;  4EQR A;  2B9X A;  1RSG A;  4HB9 A;  2BAB A;  3P4P A;  2YAU A;  3ICS A;  1CJ4 A;  3R9U A;  5HXI A;  4C3Y A;  3ALJ A;  3UOX A;  1TYP A;  3AEF A;  3KD9 A;  1NEN A;  3V76 A;  1L9E A;  1RP0 A;  4EQS A;  4I59 A;  2F5Z A;  4EMW A;  2FBW A;  1TDN A;  3SFD A;  4BJY A;  4ZN0 A;  4YSY A;  4NTE A;  4FX9 A;  4M52 A;  3CNT A;  4CCR A;  1ZMC A;  2A8X A;  3LZX A;  3NYE A;  4X4J A;  5IQ4 A;  3AEG A;  3DJE A;  3JSK A;  1H86 A;  1GRH A;  2IVE A;  2DKI A;  3P4Q A;  1FEC A;  4JY2 A;  2GF3 A;  2FJB A;  3QFA A;  1GET A;  1DOE A;  4J34 A;  2FJD A;  3AED A;  1YQ4 A;  5JCL A;  1YKJ A;  2APG A;  2Q6U A;  5IQ1 A;  4YXD A;  4J36 A;  4J56 A;  4H2R A;  1GPE A;  3UTE A;  4YSH A;  2XLP A;  1B37 A;  1L9D A;  4ICY A;  1RYI A;  2JBV A;  1TYT A;  3HZL A;  2YQU A;  4ZCC A;  1S3B A;  2R4E A;  4YKG A;  4EMI A;  5CQF A;  1Q1R A;  1CC4 A;  3ICT A;  4K2X A;  5BUL A;  3ALL A;  1D7L A;  5U1O A;  4EMJ A;  3GSI A;  1JNZ A;  4A65 A;  2WHD A;  2Q0L A;  2YG4 A;  3C4N A;  3CPJ G;  4NEW A;  3IF9 A;  3L8K A;  3NIX A;  3LJP A;  2X8G A;  2XVH A;  4BUR A;  4H4X A;  1CHU A;  3GRT A;  3CGC A;  3FPZ A;  4B64 A;  4JQ9 A;  4CY6 A;  1E1N A;  1W4X A;  2R45 A;  1DXL A;  3NG7 X;  4D04 A;  5C2T A;  3ATQ A;  3ZDN A;  4IVO B;  2WQY A;  3RNM A;  2Z5X A;  4U2T A;  2C76 A;  2J3N A;  4APN A;  1Z6L A;  4A7A A;  1QJD A;  1CC6 A;  3ATR A;  1FEA A;  1MXT A;  2ZZC A;  4JDR A;  3KPF A;  5EB5 A;  2C3C A;  1NEK A;  2C73 A;  3AEE A;  4XXG A;  3F8D A;  3BNU A;  1PBE A;  3GMC A;  4AOS A;  5DBJ A;  1XDI A;  5BUK A;  1BWC A;  1GER A;  3RHA A;  1PXA A;  3NKS A;  3AXB A;  2NPX A;  2GEW A;  1H82 A;  2EQ6 A;  1GRF A;  1PXC A;  2E5V A;  1K0I A;  4KX6 A;  3DK9 A;  2CVJ A;  2R46 A;  2HQM A;  1ELI A;  1L9C A;  2C66 A;  4E0V A;  4EQX A;  2VVL A;  4BJZ A;  4TM1 A;  4I58 A;  4ADW A;  4XWR A;  3CPI G;  2QCU A;  1GAL A;  2V3A A;  4TLZ A;  2CDU A;  1DNC A;  3AEC A;  3CN8 A;  4TM0 A;  2A87 A;  5GSN A;  2WP9 A;  1B8S A;  1NHS A;  3AB1 A;  3NN0 X;  3Q9T A;  2BK5 A;  4UDP A;  4NEV A;  1FL2 A;  4H4T A;  3GYI A;  4U2S A;  3AYL A;  1YQ3 A;  4IA6 A;  2WDV A;  3BI5 A;  4H7U A;  4H2N A;  4C74 A;  2GAG B;  1LTX R;  3NK1 X;  2W0H A;  3UKL A;  1GRB A;  2FJE A;  4YKF A;  4H4Z A;  4K5S A;  3RP8 A;  4C5O A;  1ZOV A;  4IVM B;  2YWL A;  5KOX A;  4NTD A;  2B9W A;  1N4U A;  3DME A;  4X9N A;  2GQW A;  2YLR A;  2ZBW A;  4H50 A;  1OJT A;  2XVJ A;  3VR8 A;  5L46 A;  1K4Q A;  5HHF A;  4WX1 A;  2YVG A;  2Q7V A;  4LA1 A;  3P9U A;  2VVL G;  2ZZ0 A;  4GRT A;  1DJQ A;  4FDC B;  3UKA A;  4AOX A;  1NG3 A;  2XYO A;  2YG6 A;  1OJD A;  1ZOY A;  2H88 A;  1JEH A;  1BKW A;  3UTG A;  3K7T A;  4DGK A;  4A9W A;  4FK1 C;  2JB1 A;  1ZY8 A;  2EQ8 A;  3QVR A;  3UP5 A;  3DJJ A;  4CNK A;  1EL8 A;  1PJ5 A;  1GOS A;  3PS9 A;  3NYF A;  3LAD A;  4H2P A;  3VRA A;  4KPR A;  4GCM A;  1NHP A;  5KWF A;  3PO7 A;  3KU9 A;  4GR1 A;  1NHQ A;  3CNS A;  3GRS A;  2R4J A;  1JOA A;  3M0O A;  4Z24 A;  3EAO A;  4HA6 A;  4B68 A;  2FJA A;  4REK A;  4XWZ A;  2VVM A;  4USR A;  2C65 A;  1K0J A;  5EBK A;  2BXR A;  2RAB A;  4FK1 A;  4RG4 A;  1ZKQ A;  1JU2 A;  2XLS A;  1OJC A;  4UDR A;  4C3X A;  2XFN A;  2R0P A;  2QAE A;  3OC4 A;  1EL9 A;  4DSG A;  1DOB A;  2XLR A;  2X3N A;  2AR8 A;  1Y56 A;  4AT0 A;  2X8C A;  2WOV A;  4DNA A;  1H83 A;  2Y6Q A;  3M13 A;  4Y4M A;  4BK3 A;  3DJD A;  3DK4 A;  2XLT A;  2EQ9 A;  4K5R A;  2BXS A;  1YY5 A;  3ITJ A;  1Q9I A;  3OZ2 A;  4K22 A;  1BGN A;  4BK2 A;  4YSX A;  3KKJ A;  4A5L A;  1DJN A;  2YVJ A;  1GV4 A;  1CJ3 A;  1P2H A;  4TM3 A;  1JNR A;  1TDE A;  1O5W A;  1KSS A;  4U8K A;  4B1B A;  4Z2R A;  1PJ6 A;  1GEU A;  1IJH A;  3AYJ A;  4JNA A;  4Z44 A;  2GRT A;  2X50 A;  3IC9 A;  1IUT A;  3VRD B;  2Y6R A;  5FMH A;  1E1L A;  2EQ7 A;  3COX A;  4P9S A;  4Z43 A;  1MOK A;  4ECH A;  2XVF A;  1H7W A;  5U63 A;  3VR9 A;  2GR1 A;  1E6E A;  1XHC A;  1OJA A;  2YLX A;  1B4V A;  1S3E A;  2BK3 A;  1MO9 A;  1KNP A;  1Y0P A;  2OLO A;  2BC1 A;  3D1C A;  1N1P A;  4UP3 A;  1ZP0 A;  4IV9 A;  3S5W A;  4YSZ A;  2JB2 A;  1XPQ A;  3I3L A;  1E1K A;  3NTD A;  3PVC A;  4A99 A;  3AE5 A;  4IA5 A;  1ZMD A;  3FG2 P;  2IID A;  3CPH G;  3AE9 A;  2VRL A;  3UP4 A;  1LJ1 A;  1F8S A;  3AEB A;  2C64 A;  3AE4 A;  2GVC A;  3LXD A;  1KNR A;  2RGJ A;  1GSN A;  1F8W A;  1M6I A;  3UKH A;  3QVP A;  2C70 A;  4Y4N A;  3ABV A;  3UKF A;  1VQW A;  2OA1 A;  1BF3 A;  2C3D A;  3E1T A;  3RED A;  3V3O A;  4U8I A;  3CNP A;  2RGH A;  2BC0 A;  4H4U A;  4H4Q A;  1VG9 A;  4RSL A;  1K0L A;  1HYU A;  3UCL A;  1AOG A;  4AP1 A;  1D4E A;  2XFP A;  1GXF A;  3AYI A;  1D4D A;  5C3J A;  3M12 A;  1GRA A;  2R9Z A;  2PHH A;  1SEZ A;  4JNQ A;  1Y56 B;  5FS8 A;  1GTH A;  1QO8 A;  1TDF A;  4H4Y A;  2WPC A;  2JB3 A;  3SFE A;  5ER0 A;  4OPG A;  4OPI A;  5KXJ A;  4BV6 A;  4BK1 A;  3UKQ A;  1FEB A;  4LU6 A;  3DK8 A;  3AWI A;  3BI2 A;  3KA7 A;  1ONF A;  1CF3 A;  2Q0K A;  3BI4 A;  2CFY A;  2O9Z A;  4OPU A;  4CRT A;  5BRT A;  2X8H A;  5M0Z A;  5M10 A;  4U8O A;  2TMD A;  3FBS A;  3DGZ A;  1CBO A;  2I0Z A;  4Y4L A;  1D7Y A;  1L0V A;  4N9X A;  2YG3 A;  5HYM A;  4DSH A;  3B3R A;  3NGC X;  3GWF A;  2YVF A;  2WPE A;  3C96 A;  4B63 A;  3GYJ A;  2WS3 A;  2YLT A;  5JCN A;  4U8L A;  3V3N A;  1DOD A;  4OPD A;  2YG7 A;  2WPF A; 
#chains in the Genus database with same CATH topology
 1CL0 A;  5FS6 A;  4FP1 A;  5J60 A;  3R25 A;  4Z2U A;  3ALM A;  4G8T A;  4U2L A;  3AE3 A;  2POZ A;  2WP6 A;  1PXB A;  3SZ0 A;  2GB0 A;  4X9M A;  2PP1 A;  1KDG A;  4ZCD A;  3P4S A;  3IWA A;  3SJN A;  1H81 A;  1PDH A;  5GRT A;  3K30 A;  2GGE A;  2YM2 A;  4KEM A;  2RGO A;  3SR6 B;  1NHR A;  5EOW A;  1NAA A;  2B9Y A;  3DG7 A;  4G9K A;  3CTY A;  1VRQ B;  2WU2 A;  1ELS A;  2BS4 A;  3LOV A;  4C77 A;  3BHK A;  1LPF A;  3RR1 A;  3OZY A;  3EF6 A;  2TPR A;  3DH9 A;  2B7S A;  1OEP A;  4X2P A;  4YTN A;  3QJ4 A;  1H2I A;  3AE7 A;  1D4C A;  2XVI A;  5BOE A;  3NHO X;  3SM8 A;  3EUB 3;  2B7R A;  4H1Z A;  2ZC8 A;  2OPJ A;  2GGH A;  2CUL A;  2POD A;  3S5S A;  4EIP A;  5LV9 A;  3B6D A;  1IUV A;  1F8R A;  2AL2 A;  2GAH B;  3T0K A;  4B69 A;  4B67 A;  3UKP A;  2DKH A;  2YLS A;  5KVI A;  2AL1 A;  3PFR A;  5JCK A;  4PAA A;  2VQ7 A;  2NVK X;  2WBA A;  2QJN A;  1KSU A;  5FS7 A;  4GDE A;  3T37 A;  3ZLG A;  2BCG G;  1N61 C;  3UJ2 A;  3TTE A;  1N63 C;  3F8P A;  3NNE A;  3NYC A;  2AAQ A;  1GTE A;  3LZW A;  2C72 A;  3GWD A;  5FJO A;  4J2W A;  1ZDL A;  2XH4 A;  3G5S A;  2V5Z A;  3UCD A;  1NPX A;  1FHU A;  3CGD A;  4OCG A;  2W54 A;  4EQW A;  3CGB A;  2YR6 A;  1FCD A;  3I6D A;  3QSS A;  3RP6 A;  4JHM A;  2VOU A;  3AE1 A;  1F6M A;  3C4A A;  3TWA A;  3SGL A;  1IUS A;  4Z2T A;  2OLA A;  2VRM A;  1NG4 A;  2AL2 B;  3NRN A;  5C3J A;  2PSN A;  1TRB A;  1YEY A;  2YLW A;  3GDP A;  4K1W A;  3WE0 A;  3VCC A;  4HYR A;  2Z5Y A;  4DYE A;  2E5A A;  3P1W A;  2NQL A;  1V97 A;  2B9X A;  1RSG A;  3QKE A;  3MWC A;  5HXI A;  4DXK A;  3ALJ A;  2GL5 A;  3DFY A;  3GC2 A;  3NRZ B;  1RP0 A;  4EMW A;  4YSY A;  4NTE A;  4M52 A;  3CNT A;  1N62 C;  5FJU A;  3AEG A;  1GRH A;  3QPE A;  4Z17 A;  2FJB A;  1YQ4 A;  5JCL A;  2Q6U A;  5IQ1 A;  3BOX A;  3UTE A;  2XLP A;  1B37 A;  1RYI A;  1WUF A;  4YKG A;  2E3T A;  1R0M A;  3ES7 A;  4A65 A;  4E5T A;  3IF9 A;  3NVZ B;  2XVH A;  3FVD A;  4BUR A;  4DX3 A;  4JQ9 A;  1E1N A;  1DXL A;  5C2T A;  3ZDN A;  2WQY A;  2PP3 A;  4A7A A;  5IDZ A;  1CC6 A;  3ATR A;  1FEA A;  1MXT A;  3FXG A;  3AEE A;  3F8D A;  4AOS A;  1XDI A;  3DES A;  4MKS A;  3RHA A;  2P8C A;  2EQ6 A;  1PXC A;  2E5V A;  2R46 A;  4IP5 A;  4MMW A;  1R6W A;  4ZOH B;  4BJZ A;  4TM1 A;  2V3A A;  1DNC A;  2A87 A;  1NHS A;  3Q9T A;  3I6E A;  2BK5 A;  4UDP A;  4NEV A;  4C74 A;  2FKP A;  3UKL A;  3BSM A;  1FO4 A;  3RP8 A;  4C5O A;  1N5W C;  2B9W A;  4G74 A;  2XVJ A;  5L46 A;  1KKR A;  1DJQ A;  4GRT A;  2HZG A;  1EL8 A;  1SJA A;  3PS9 A;  3NYF A;  3CMM A;  3TCS A;  3M0O A;  3EAO A;  3DFH A;  3A7R A;  1BQG A;  3FYY A;  4C3X A;  5FJP A;  1KN0 A;  2R0P A;  3VC5 A;  1EL9 A;  4DN1 A;  1DOB A;  2XLR A;  4BK3 A;  4DNA A;  1H83 A;  3M13 A;  3SYI A;  2RDX A;  3MQT A;  1RVK A;  1YY5 A;  2HNE A;  4YSX A;  1DJN A;  2YVJ A;  4TM3 A;  4Z2R A;  4U8K A;  1GEU A;  2C4C A;  1T3Q C;  1WYG A;  2X50 A;  1IUT A;  3VC6 A;  5FMH A;  4Z43 A;  1MOK A;  4ECH A;  3MZN A;  4HNL A;  1XHC A;  2OLO A;  1N1P A;  2JB2 A;  3I3L A;  2MNR A;  5J04 A;  1L8P A;  1E1K A;  1IYX A;  3STP A;  3AE9 A;  4KPL A;  1LJ1 A;  2C64 A;  3T8Q A;  3IJQ A;  1GSN A;  3ABV A;  3UKF A;  3R0U A;  1VQW A;  2C3D A;  3E1T A;  3RED A;  3T2K A;  3CNP A;  2BC0 A;  4H4Q A;  1KD0 A;  3UCL A;  3GO2 A;  2XFP A;  1GXF A;  2PHH A;  1SEZ A;  4JNQ A;  1QO8 A;  1TDF A;  3H12 A;  3SFE A;  5ER0 A;  3CXB A;  3BI2 A;  2Q0K A;  2CFY A;  4CRT A;  1SJC A;  3FCP A;  2I0Z A;  1KKO A;  1L0V A;  5JCN A;  1JRZ A;  3QSM A;  4H2Q A;  1DTN A;  2PCE A;  3AE2 A;  2BS3 A;  3NK0 X;  2GDQ A;  1S2Y A;  4H4R A;  3NTA A;  3VRB A;  3R11 A;  4G6G A;  3SX6 A;  4GDP A;  2PYX A;  2XH0 A;  2QA1 A;  2GGG A;  3NLC A;  3ZYX A;  1JRX A;  3G5R A;  4YTP A;  2WDQ A;  3H8L A;  4D03 A;  3QFB A;  3T31 A;  1CC2 A;  3K7Q X;  3DGH A;  3AD8 B;  3OTR A;  5FS9 A;  4GUV A;  3CNJ A;  2C75 A;  4Z26 A;  4Z25 A;  4E6M A;  3D8X A;  3L1R A;  1OJ9 A;  2WES A;  3GD4 A;  4CY8 A;  3H70 A;  2VZ2 A;  3UOZ A;  3T14 A;  5BVA A;  1EL7 A;  1PN0 A;  4RG3 A;  2OX4 A;  1BZL A;  1XAN A;  5KVH A;  5JCM A;  5HY5 A;  3UOV A;  2JAE A;  1LQT A;  2I5Q A;  3II4 A;  1FOH A;  1PBC A;  4PAB A;  1IUU A;  4OPT A;  4H4S A;  1B5Q A;  2MUC A;  2R0G A;  5G5G B;  4O5U A;  3TQP A;  3LB8 A;  2GQF A;  2C67 A;  3KUM A;  4TLX A;  1XS2 A;  1PS9 A;  4J31 A;  3CB3 A;  1KFY A;  2H89 A;  4M6U A;  2VQB A;  3UJS A;  4DHG A;  1CJ2 A;  3F8R A;  2OAM A;  3HPF A;  3BHF A;  3ICR A;  1LQU A;  3T2Z A;  3GDN A;  3V5C A;  3NT6 A;  2XFO A;  2ZZB A;  4J33 A;  1IUW A;  1ZK7 A;  2PGE A;  2CHR A;  4EM3 A;  2GMJ A;  2ACZ A;  3JW7 A;  3K7M X;  4IT1 A;  2O56 A;  4EM4 A;  3NK2 X;  3VQR A;  1N5X A;  2GR3 A;  1M64 A;  3NFU A;  3EPT A;  2GH5 A;  4II2 A;  1ZX9 A;  4OPC A;  1NDA A;  4K8G A;  2GGI A;  4HPN A;  4GAV A;  2OQH A;  3B97 A;  3T9P A;  1NEN A;  4EQS A;  2F5Z A;  1JPD X;  3SFD A;  4CCR A;  2A8X A;  4ENL A;  3LZX A;  3NYE A;  4X4J A;  3DJE A;  2IVE A;  4II3 A;  2GF3 A;  3QFA A;  1DOE A;  3AM9 A;  5FJT A;  3S47 A;  4J36 A;  4YSH A;  3UJR A;  1L9D A;  1TYT A;  3RO6 A;  4HNC A;  2R4E A;  1FIQ B;  4EMI A;  4K2X A;  1MUC A;  5BUL A;  2HXU A;  2YG4 A;  4NEW A;  3L8K A;  3LJP A;  4H4X A;  4B64 A;  3VDG A;  4CY6 A;  3SQS A;  4IVO B;  3RNM A;  3GY1 A;  3UCC A;  3P3B A;  2C76 A;  3R0K A;  4IL0 A;  1Z6L A;  1QJD A;  2ZZC A;  4JDR A;  3KPF A;  5EB5 A;  1NEK A;  1RM6 B;  2PTZ A;  2C73 A;  4XXG A;  3U4F A;  1GER A;  3JVA A;  3AXB A;  4E4F A;  2OZ3 A;  1GRF A;  4KX6 A;  3DK9 A;  2CVJ A;  3DG3 A;  4E0V A;  2C66 A;  2P88 A;  4I58 A;  4XWR A;  3CPI G;  4TLZ A;  3AEC A;  1B8S A;  3AB1 A;  1FL2 A;  4IA6 A;  1YQ3 A;  2WDV A;  3BI5 A;  4H7U A;  4H2N A;  4H2H A;  1LTX R;  2W0H A;  3NZG A;  2FJE A;  4GYP A;  1ZOV A;  4IVM B;  2YWL A;  4NTD A;  2P0I A;  4X9N A;  2GQW A;  4H50 A;  1OJT A;  4WX1 A;  1NU5 A;  1FHV A;  2OFJ A;  2ZZ0 A;  2YG6 A;  1OJD A;  1ZOY A;  4HCL A;  1BKW A;  4DGK A;  4A9W A;  3SBF A;  1ZY8 A;  3DJJ A;  3SN4 A;  1GOS A;  3LAD A;  3RRA A;  3PO7 A;  4GR1 A;  2PGW A;  4ROP A;  1JOA A;  3VFC A;  4REK A;  5EBK A;  2BXR A;  4RG4 A;  3SZF A;  7ENL A;  1JU2 A;  2XLS A;  1STZ A;  1PDY A;  1S7M A;  3OZM A;  2QAE A;  3OC4 A;  4AT0 A;  1SB3 B;  3HYW A;  1SJB A;  3DK4 A;  3Q4D A;  4K5R A;  1Q9I A;  1FFU C;  4A5L A;  1P2H A;  1O5W A;  1KSS A;  2OO6 A;  3AYJ A;  1WUE A;  1JRP A;  3CAW A;  2Y6R A;  4P9S A;  5G5H B;  1H7W A;  5U63 A;  3VR9 A;  1VDV A;  3D1C A;  1KNP A;  1ZP0 A;  4IV9 A;  3DIP A;  3NTD A;  3ENL A;  3ZVI A;  3FG2 P;  1X2H A;  1F8S A;  3AEB A;  2GVC A;  3LXD A;  3NVV B;  2RGJ A;  3UKH A;  1BF3 A;  4U8I A;  1VG9 A;  4RSL A;  3NS1 B;  1K0L A;  4OPG A;  4BK1 A;  4GAP A;  2PU0 A;  1CF3 A;  4J3Z A;  4OPU A;  3MUC A;  5M10 A;  5KMP A;  2TMD A;  3FBS A;  3N4F A;  2GGJ A;  3FJ4 A;  1D7Y A;  2BRY A;  3KPK A;  5HYM A;  4DSH A;  3R07 C;  3B3R A;  2QQ6 A;  2YVF A;  4B63 A;  4TVW A;  3V3N A;  4OPD A;  3HRD C;  2WPF A;  2BS2 A;  2XFQ A;  2ZAD A;  3NN6 X;  3AE6 A;  2YG5 A;  3RCY A;  2R0C A;  1H6V A;  1V59 A;  4U8M A;  3OP2 A;  1KF6 A;  2XDO A;  1UKV G;  2GR2 A;  4H4P A;  2OAL A;  4H83 A;  2WEU A;  1EBD A;  5J7X A;  2BYB A;  2ARD A;  4AT2 A;  1IUX A;  1E7P A;  2QGY A;  1JRY A;  2WP5 A;  2XH2 A;  1CJC A;  2BRA A;  2QDE A;  2WOW A;  1GES A;  4A79 A;  2X99 A;  1VDC A;  4ZA0 A;  6ENL A;  1E9I A;  3AMZ A;  1N4V A;  2PA6 A;  2XLU A;  1DOC A;  1JPM A;  4IP4 A;  4JN7 A;  3G5Q A;  4AP3 A;  1GRT A;  3H8A A;  3CYJ A;  3UKK A;  2OLN A;  1TE6 A;  1SJD A;  4GIR A;  1F3P A;  4U8J A;  2IVD A;  3IHG A;  1LV0 A;  1PBF A;  2WOI A;  3GMB A;  2V3B A;  1N60 C;  4H4W A;  2XSX A;  5U25 A;  4G6H A;  4YT0 A;  4UDQ A;  3ZLF A;  1PHH A;  3KLJ A;  2XVE A;  1D5T A;  3KVE A;  3SY4 A;  3TOY A;  3UOY A;  2BCP A;  3MSY A;  2JK6 A;  2V60 A;  3FMW A;  2YLZ A;  3PWI A;  5IPY A;  3AD7 B;  3O0H A;  2B76 A;  2YR4 A;  4OVI A;  4KWS A;  5KNL A;  5TR3 A;  3TW9 A;  3I6T A;  3URH A;  4TVY A;  5KRQ A;  1JRO A;  3BNM A;  2P8B A;  2WU5 A;  3NXL A;  2BAC A;  2GMH A;  3T6C A;  2QJJ A;  5KMR A;  3IHM A;  3P4R A;  4A35 A;  3TJI A;  2E1M A;  3FIM B;  2YR5 A;  5KMS A;  3CND A;  3UXK A;  1N4W A;  1REO A;  1EL5 A;  3RP7 A;  4TM4 A;  2BAB A;  2PPG A;  2YAU A;  3ICS A;  3R9U A;  1TZZ A;  1TYP A;  3AN1 A;  3ZLH A;  3KD9 A;  3V76 A;  4GME A;  3P93 A;  1TDN A;  5JRB A;  4BJY A;  4ZN0 A;  3JSK A;  2OVL A;  2DKI A;  3P4Q A;  4JY2 A;  1TKK A;  3NVY B;  4J34 A;  2FJD A;  3DEQ A;  1YKJ A;  4YXD A;  4J56 A;  4H2R A;  1GPE A;  4ICY A;  2YQU A;  5CQF A;  1Q1R A;  3ALL A;  4EMJ A;  3GSI A;  1JNZ A;  2WHD A;  3C4N A;  4HCD A;  3R1Z A;  2PS2 A;  4HCH A;  3NIX A;  2X8G A;  3TJ4 A;  1CHU A;  3CK5 A;  1W4X A;  4D04 A;  3ATQ A;  2Z5X A;  2J3N A;  1X2G A;  2C3C A;  3GMC A;  1PBE A;  1BWC A;  3NKS A;  1H82 A;  1K0I A;  1ELI A;  2VVL A;  1JDF A;  3HW2 A;  2QCU A;  1GAL A;  4GYP C;  2CDU A;  3A7U A;  4TM0 A;  3CN8 A;  2WP9 A;  2OZT A;  3ES8 A;  3OW1 A;  3AYL A;  2QDD A;  2GAG B;  1FFV C;  1EC7 A;  4YKF A;  3MY9 A;  4G7F A;  3VCN A;  4NNJ A;  3Q45 A;  5KOX A;  2W3S A;  1N4U A;  3DME A;  2ZBW A;  3K1G A;  2YLR A;  3VR8 A;  1K4Q A;  5HHF A;  2YVG A;  1VQZ A;  3BJS A;  2VVL G;  1NG3 A;  2XYO A;  2H88 A;  3UTG A;  1ONE A;  3QVR A;  2EQ8 A;  3UP5 A;  1PJ5 A;  3UGV A;  4H2P A;  3VRA A;  3KU9 A;  3CNS A;  1NHQ A;  2R4J A;  4Z24 A;  4B68 A;  4HA6 A;  2VVM A;  2PTW A;  2RAB A;  4FK1 A;  5FJR A;  4DSG A;  2FYM A;  1Y56 A;  2Y6Q A;  4Y4M A;  2PTX A;  3DJD A;  2XLT A;  1ECQ A;  3ITJ A;  3OZ2 A;  4BK2 A;  3QN3 A;  1CJ3 A;  1JNR A;  2QVH A;  2HXT A;  1IJH A;  3RIT A;  4JNA A;  4Z44 A;  3IC9 A;  3VRD B;  2EQ7 A;  3COX A;  2XVF A;  2ONE A;  3VA8 A;  3DGB A;  2GR1 A;  2OG9 A;  3D47 A;  1E6E A;  1OJA A;  3N4E A;  2DW7 A;  1S3E A;  1MO9 A;  1Y0P A;  3S5W A;  2AKM A;  1MDR A;  4HN8 A;  1XPQ A;  3PVC A;  4A99 A;  2IID A;  3HYX A;  3CPH G;  2VRL A;  3UP4 A;  3AE4 A;  1F8W A;  1M6I A;  1MRA A;  2AKZ A;  2C70 A;  2PU1 A;  3I4K A;  2OA1 A;  3FV9 A;  3ZVH A;  2RGH A;  4H4U A;  2DW6 A;  2PMQ A;  1HYU A;  4AP1 A;  4KT2 A;  1D4E A;  3UJF A;  1D4D A;  4GGB A;  3M12 A;  1GRA A;  2R9Z A;  1Y56 B;  1GTH A;  4H4Y A;  4F4R A;  2JB3 A;  4M0X A;  4OPI A;  4BV6 A;  4LU6 A;  3AWI A;  1ONF A;  3BI4 A;  4EWJ A;  3P0W A;  2O9Z A;  5BRT A;  2X8H A;  5M0Z A;  4U8O A;  3DGZ A;  4Y4L A;  2YG3 A;  3NGC X;  4A3R A;  3EKG A;  3C96 A;  3GYJ A;  2YLT A;  4U8L A;  2OKT A;  3QTP A;  3D46 A;  1NEL A;  4K8D A;  3D9X A;  5JCI A;  4YWO A;  3UXL A;  1GND A;  3S61 A;  2UZZ A;  1YQZ A;  2XCG A;  4E8G A;  3H4K A;  2C7G A;  4FI4 A;  2V6O A;  3UTF A;  3GD6 A;  1H84 A;  1E1M A;  3ZVH B;  4MJW A;  4WCT A;  4YWS A;  4A6N A;  3CXO A;  2BK4 A;  1COY A;  2WET A;  1E39 A;  2AQJ A;  5KOW A;  3V4B A;  3DER A;  1O94 A;  2BA9 A;  4USQ A;  3QSE A;  1TDO A;  3CGE A;  3NO1 A;  2OZ8 A;  5CKU A;  4OPL A;  3ISH A;  4NTC A;  3DJG X;  3NH3 X;  4JN8 A;  3AD9 B;  1EBH A;  4U8N A;  1F9C A;  2WDR A;  4NZH A;  3N6J A;  1S2Q A;  4H4V A;  1PBD A;  3PK7 A;  1X31 B;  4LII A;  4IHC A;  4JN9 A;  2YM1 A;  1VG0 A;  3N6H A;  3DA1 A;  1GT8 A;  3Q6J A;  3SQP A;  1TDK A;  2XFU A;  4GF7 A;  3UTH A;  2QJM A;  3OPS A;  4A6N B;  1GRE A;  2PP0 A;  1BGJ A;  1PBB A;  3AE8 A;  1GRG A;  4J57 A;  1H7X A;  3THU A;  3GD3 A;  2A89 A;  4B66 A;  1PJ7 A;  1Q1W A;  3AEA A;  4B65 A;  1QLB A;  2GR0 A;  3SZC A;  3MKC A;  1XPY A;  2JKC A;  4K7Z A;  3SN0 A;  1LVL A;  3ADA B;  4JY3 A;  1P2E A;  3T4W A;  4K2S A;  2GV8 A;  3H8I A;  1W6T A;  4O5Q A;  4CCQ A;  4IZG A;  4CBQ A;  3EEZ A;  2PTY A;  2QA2 A;  2E4G A;  3CIR A;  4U8P A;  1O95 A;  4CNJ A;  3EAN A;  4EIQ A;  5EB4 A;  4YTM A;  3B9J B;  3U9I A;  2V61 A;  4EQR A;  4HB9 A;  3P4P A;  1CJ4 A;  4IL2 A;  4C3Y A;  3UOX A;  3AEF A;  3T2Y A;  1KCZ A;  1L9E A;  4I59 A;  3IJI A;  3PG6 A;  2FBW A;  4FX9 A;  3RGT A;  1ZMC A;  5IQ4 A;  1H86 A;  1FEC A;  1GET A;  3AED A;  2APG A;  3ETR B;  2JBV A;  3TWB A;  3HZL A;  1S3B A;  4GFI A;  3R10 A;  1CC4 A;  3ICT A;  1EC9 A;  1D7L A;  5U1O A;  2Q0L A;  4E4U A;  3CPJ G;  3SZW A;  5KMQ A;  3FPZ A;  3GRT A;  3CGC A;  5EU9 A;  3L5O A;  2R45 A;  3NG7 X;  3CT2 A;  3IK4 A;  3SXI A;  4U2T A;  4APN A;  1P43 A;  2W55 A;  3BNU A;  5DBJ A;  1EC8 A;  5BUK A;  1PXA A;  2NPX A;  2GEW A;  2HQM A;  1L9C A;  3SN1 A;  4EQX A;  4ADW A;  4J1O A;  5GSN A;  4GGH A;  2XH7 A;  1BKH A;  3NN0 X;  1MNS A;  4H4T A;  3GYI A;  4U2S A;  3DDM A;  3NK1 X;  1GRB A;  4ZCW A;  4H4Z A;  4K5S A;  3JZU A;  3QLD A;  2OQY A;  2Q7V A;  4LA1 A;  3P9U A;  4FDC B;  3UKA A;  4AOX A;  1JEH A;  3K7T A;  4FK1 C;  1MDL A;  2W3R A;  2JB1 A;  4CNK A;  4Z1Y A;  3V3W A;  3A7A A;  3PWG A;  4KPR A;  4GCM A;  1NHP A;  5KWF A;  3GYX A;  3GRS A;  4GIS A;  4NWZ A;  2FJA A;  4XWZ A;  4USR A;  2C65 A;  1K0J A;  3H7V A;  1ZKQ A;  3DG6 A;  1OJC A;  4UDR A;  4G73 A;  2XFN A;  1EBG A;  2X3N A;  2AR8 A;  2X8C A;  2WOV A;  5BOF A;  2EQ9 A;  2BXS A;  4K22 A;  1BGN A;  3KKJ A;  3NVW B;  1GV4 A;  4B1B A;  1TDE A;  1PJ6 A;  2GRT A;  4A6G A;  1E1L A;  2XGZ A;  2YLX A;  1B4V A;  2BK3 A;  4ZCC A;  4UP3 A;  2BC1 A;  4YSZ A;  3SSZ A;  3AE5 A;  4IA5 A;  1ZMD A;  4DWD A;  3HYV A;  3UJE A;  1KNR A;  1JCT A;  3QVP A;  4Y4N A;  3IJL A;  3V3O A;  2GSH A;  3V5F A;  1AOG A;  1P48 A;  3AYI A;  5FS8 A;  4MGG A;  2WPC A;  5KXJ A;  3UKQ A;  1FEB A;  3DK8 A;  3KA7 A;  1CBO A;  5ENL A;  4H19 A;  4N9X A;  1ZXI C;  3GWF A;  2WPE A;  2WS3 A;  1PDZ A;  1DOD A;  2YG7 A;  2P3Z A; 
#chains in the Genus database with same CATH homology
 1CL0 A;  1JRZ A;  5FS6 A;  4K8D A;  3D9X A;  5JCI A;  4YWO A;  2BS2 A;  2XFQ A;  1GND A;  5J60 A;  3S61 A;  4Z2U A;  2UZZ A;  1YQZ A;  3QSM A;  3ALM A;  4H2Q A;  4U2L A;  3AE3 A;  2XCG A;  3NN6 X;  3AE6 A;  3H4K A;  2YG5 A;  3AE2 A;  2BS3 A;  2C7G A;  2WP6 A;  3NK0 X;  1PXB A;  2R0C A;  3SZ0 A;  2GB0 A;  1S2Y A;  4X9M A;  1H6V A;  4H4R A;  1V59 A;  3NTA A;  3VRB A;  2V6O A;  4U8M A;  3UTF A;  1H84 A;  1KDG A;  1KF6 A;  4G6G A;  1E1M A;  4ZCD A;  3SX6 A;  4GDP A;  3P4S A;  2XDO A;  2PYX A;  3IWA A;  2QA1 A;  1UKV G;  1H81 A;  2GR2 A;  4MJW A;  4WCT A;  3NLC A;  1PDH A;  4H4P A;  5GRT A;  2OAL A;  3K30 A;  2YM2 A;  3ZYX A;  4A6N A;  2BK4 A;  1COY A;  2WET A;  1E39 A;  2AQJ A;  2WEU A;  1JRX A;  1EBD A;  5KOW A;  3G5R A;  5J7X A;  4YTP A;  2RGO A;  1O94 A;  2WDQ A;  1NHR A;  2BA9 A;  1NAA A;  3H8L A;  5EOW A;  4USQ A;  2BYB A;  3QSE A;  4D03 A;  3QFB A;  1TDO A;  3T31 A;  3CGE A;  2ARD A;  2B9Y A;  4AT2 A;  1IUX A;  1CC2 A;  3K7Q X;  3DGH A;  4G9K A;  3CTY A;  3AD8 B;  1E7P A;  5CKU A;  5FS9 A;  1JRY A;  2WP5 A;  1CJC A;  1VRQ B;  4GUV A;  3CNJ A;  2BRA A;  2WU2 A;  2WOW A;  3ISH A;  1GES A;  4NTC A;  4OPL A;  4A79 A;  2C75 A;  3DJG X;  4Z26 A;  2X99 A;  3NH3 X;  1VDC A;  2BS4 A;  4Z25 A;  1N4V A;  3LOV A;  3AD9 B;  4U8N A;  3D8X A;  3BHK A;  3L1R A;  1LPF A;  1OJ9 A;  4C77 A;  2WES A;  2WDR A;  4NZH A;  3EF6 A;  2XLU A;  3GD4 A;  4CY8 A;  1S2Q A;  4H4V A;  2TPR A;  1DOC A;  2VZ2 A;  3DH9 A;  1PBD A;  3UOZ A;  2B7S A;  4YTN A;  3T14 A;  1X31 B;  4LII A;  3G5Q A;  4AP3 A;  1GRT A;  5BVA A;  3QJ4 A;  1H2I A;  1EL7 A;  1PN0 A;  4RG3 A;  3AE7 A;  1BZL A;  1D4C A;  2XVI A;  4JN9 A;  1XAN A;  5KVH A;  5JCM A;  2OLN A;  3UKK A;  2YM1 A;  5HY5 A;  3NHO X;  1VG0 A;  3SM8 A;  3UOV A;  2B7R A;  2IVD A;  1F3P A;  4U8J A;  2JAE A;  3DA1 A;  1LQT A;  3IHG A;  1LV0 A;  3II4 A;  1FOH A;  1GT8 A;  3Q6J A;  1PBF A;  1PBC A;  4PAB A;  3SQP A;  2WOI A;  3GMB A;  1TDK A;  2XFU A;  4GF7 A;  3UTH A;  2V3B A;  1IUU A;  2CUL A;  4OPT A;  4H4S A;  4A6N B;  1GRE A;  1B5Q A;  1BGJ A;  2R0G A;  4EIP A;  5LV9 A;  1PBB A;  4O5U A;  3B6D A;  4H4W A;  3LB8 A;  2GQF A;  2C67 A;  1IUV A;  3AE8 A;  4TLX A;  5U25 A;  4G6H A;  1F8R A;  1GRG A;  2GAH B;  4YT0 A;  4UDQ A;  3T0K A;  1PS9 A;  4B69 A;  4J31 A;  4J57 A;  4B67 A;  1H7X A;  1KFY A;  1PHH A;  2DKH A;  2YLS A;  3UKP A;  2H89 A;  3KLJ A;  2XVE A;  5KVI A;  1D5T A;  3KVE A;  3GD3 A;  5JCK A;  4PAA A;  2A89 A;  2VQ7 A;  2NVK X;  2VQB A;  3SY4 A;  4B66 A;  3UOY A;  1PJ7 A;  1Q1W A;  3AEA A;  2WBA A;  1CJ2 A;  1KSU A;  4B65 A;  5FS7 A;  2BCP A;  4GDE A;  3T37 A;  3F8R A;  2BCG G;  2JK6 A;  2V60 A;  3FMW A;  2YLZ A;  5IPY A;  3AD7 B;  2OAM A;  3F8P A;  3NNE A;  3BHF A;  3O0H A;  1QLB A;  3ICR A;  1LQU A;  2B76 A;  2YR4 A;  3NYC A;  4OVI A;  2AAQ A;  3T2Z A;  5TR3 A;  5KNL A;  2GR0 A;  1GTE A;  3SZC A;  3LZW A;  2C72 A;  3GDN A;  3GWD A;  4J2W A;  2JKC A;  3NT6 A;  1ZDL A;  3URH A;  3G5S A;  2V5Z A;  4K7Z A;  1NPX A;  1LVL A;  2XFO A;  5KRQ A;  2ZZB A;  3CGD A;  3ADA B;  4JY3 A;  1P2E A;  3BNM A;  4J33 A;  4OCG A;  2GV8 A;  3H8I A;  4EQW A;  1IUW A;  1ZK7 A;  3CGB A;  4O5Q A;  2WU5 A;  4EM3 A;  2YR6 A;  1FCD A;  3I6D A;  2BAC A;  2GMJ A;  4CCQ A;  3QSS A;  2ACZ A;  3RP6 A;  2VOU A;  2GMH A;  4CBQ A;  3AE1 A;  1F6M A;  3C4A A;  3K7M X;  5KMR A;  4EM4 A;  3SGL A;  3IHM A;  3NK2 X;  3P4R A;  1IUS A;  4Z2T A;  2VRM A;  3VQR A;  1NG4 A;  2E1M A;  2GR3 A;  1M64 A;  2E4G A;  2QA2 A;  3CIR A;  3NRN A;  3EPT A;  1TRB A;  1O95 A;  2YLW A;  2YR5 A;  3FIM B;  3EAN A;  3GDP A;  4U8P A;  3WE0 A;  4CNJ A;  4EIQ A;  5KMS A;  3CND A;  4YTM A;  5EB4 A;  1N4W A;  2GH5 A;  1REO A;  4II2 A;  1EL5 A;  3RP7 A;  1ZX9 A;  4OPC A;  4TM4 A;  2Z5Y A;  2V61 A;  1NDA A;  3P1W A;  4EQR A;  2B9X A;  1RSG A;  4HB9 A;  2BAB A;  3P4P A;  2YAU A;  4GAV A;  3ICS A;  1CJ4 A;  3R9U A;  5HXI A;  4C3Y A;  3ALJ A;  3UOX A;  1TYP A;  3AEF A;  3KD9 A;  1NEN A;  3V76 A;  3T2Y A;  1L9E A;  1RP0 A;  4EQS A;  4I59 A;  2F5Z A;  3PG6 A;  4EMW A;  2FBW A;  1TDN A;  3SFD A;  5JRB A;  4BJY A;  4ZN0 A;  4YSY A;  4NTE A;  4FX9 A;  4M52 A;  3CNT A;  4CCR A;  1ZMC A;  2A8X A;  3LZX A;  3NYE A;  4X4J A;  5IQ4 A;  3AEG A;  3DJE A;  3JSK A;  1H86 A;  1GRH A;  2IVE A;  2DKI A;  4II3 A;  3P4Q A;  1FEC A;  4JY2 A;  2GF3 A;  2FJB A;  3QFA A;  1GET A;  1DOE A;  4J34 A;  2FJD A;  3AED A;  1YQ4 A;  5JCL A;  1YKJ A;  2APG A;  2Q6U A;  5IQ1 A;  4YXD A;  4J36 A;  4J56 A;  4H2R A;  1GPE A;  3UTE A;  4YSH A;  2XLP A;  1B37 A;  1L9D A;  4ICY A;  1RYI A;  2JBV A;  1TYT A;  3HZL A;  2YQU A;  4ZCC A;  1S3B A;  2R4E A;  4YKG A;  4EMI A;  5CQF A;  1Q1R A;  1CC4 A;  3ICT A;  4K2X A;  5BUL A;  3ALL A;  1D7L A;  5U1O A;  4EMJ A;  3GSI A;  1JNZ A;  4A65 A;  2WHD A;  2Q0L A;  2YG4 A;  3C4N A;  3CPJ G;  4NEW A;  3SZW A;  3IF9 A;  3L8K A;  5KMQ A;  3NIX A;  3LJP A;  2X8G A;  2XVH A;  4BUR A;  4H4X A;  1CHU A;  3GRT A;  3CGC A;  3FPZ A;  4B64 A;  4JQ9 A;  4CY6 A;  1E1N A;  1W4X A;  3L5O A;  2R45 A;  1DXL A;  3NG7 X;  4D04 A;  5C2T A;  3ATQ A;  3ZDN A;  4IVO B;  2WQY A;  3RNM A;  3SXI A;  2Z5X A;  4U2T A;  2C76 A;  2J3N A;  4APN A;  1Z6L A;  4A7A A;  1QJD A;  1CC6 A;  3ATR A;  1FEA A;  1MXT A;  2ZZC A;  4JDR A;  3KPF A;  5EB5 A;  2C3C A;  1NEK A;  2C73 A;  3AEE A;  4XXG A;  3F8D A;  3BNU A;  1PBE A;  3GMC A;  4AOS A;  5DBJ A;  1XDI A;  5BUK A;  1BWC A;  1GER A;  3RHA A;  1PXA A;  3NKS A;  3AXB A;  2NPX A;  2GEW A;  1H82 A;  2EQ6 A;  1GRF A;  1PXC A;  2E5V A;  1K0I A;  4KX6 A;  3DK9 A;  2CVJ A;  2R46 A;  2HQM A;  1ELI A;  1L9C A;  2C66 A;  4E0V A;  4EQX A;  2VVL A;  4BJZ A;  4TM1 A;  4I58 A;  4ADW A;  4XWR A;  3CPI G;  2QCU A;  1GAL A;  2V3A A;  4TLZ A;  2CDU A;  1DNC A;  3AEC A;  3CN8 A;  4TM0 A;  2A87 A;  5GSN A;  2WP9 A;  1B8S A;  1NHS A;  3AB1 A;  3NN0 X;  3Q9T A;  2BK5 A;  4UDP A;  4NEV A;  1FL2 A;  4H4T A;  3GYI A;  4U2S A;  3AYL A;  1YQ3 A;  4IA6 A;  2WDV A;  3BI5 A;  4H7U A;  4H2N A;  4C74 A;  2GAG B;  1LTX R;  3NK1 X;  2W0H A;  3UKL A;  1GRB A;  2FJE A;  4YKF A;  4H4Z A;  4K5S A;  3RP8 A;  4C5O A;  1ZOV A;  4IVM B;  4NNJ A;  2YWL A;  5KOX A;  4NTD A;  2B9W A;  1N4U A;  3DME A;  4X9N A;  4G74 A;  2GQW A;  2YLR A;  2ZBW A;  4H50 A;  1OJT A;  2XVJ A;  3VR8 A;  5L46 A;  1K4Q A;  5HHF A;  4WX1 A;  2YVG A;  2Q7V A;  4LA1 A;  3P9U A;  2VVL G;  2ZZ0 A;  4GRT A;  1DJQ A;  4FDC B;  3UKA A;  4AOX A;  1NG3 A;  2XYO A;  2YG6 A;  1OJD A;  1ZOY A;  2H88 A;  1JEH A;  1BKW A;  3UTG A;  3K7T A;  4DGK A;  4A9W A;  4FK1 C;  2JB1 A;  1ZY8 A;  2EQ8 A;  3QVR A;  3UP5 A;  3DJJ A;  4CNK A;  1EL8 A;  1PJ5 A;  1GOS A;  3PS9 A;  3NYF A;  3CMM A;  3LAD A;  4H2P A;  3VRA A;  4KPR A;  4GCM A;  1NHP A;  5KWF A;  3GYX A;  3PO7 A;  3KU9 A;  4GR1 A;  1NHQ A;  3CNS A;  3GRS A;  4NWZ A;  2R4J A;  1JOA A;  3M0O A;  4Z24 A;  3EAO A;  4HA6 A;  4B68 A;  2FJA A;  4REK A;  4XWZ A;  2VVM A;  4USR A;  2C65 A;  1K0J A;  5EBK A;  2BXR A;  2RAB A;  4FK1 A;  4RG4 A;  3SZF A;  1ZKQ A;  1JU2 A;  2XLS A;  1OJC A;  4UDR A;  4G73 A;  2XFN A;  4C3X A;  1KN0 A;  1S7M A;  2R0P A;  2QAE A;  3OC4 A;  1EL9 A;  4DSG A;  1DOB A;  2XLR A;  2X3N A;  2AR8 A;  1Y56 A;  4AT0 A;  2X8C A;  2WOV A;  4DNA A;  1H83 A;  2Y6Q A;  3M13 A;  4Y4M A;  3SYI A;  3HYW A;  3DJD A;  3DK4 A;  2XLT A;  2EQ9 A;  4K5R A;  2BXS A;  1YY5 A;  3ITJ A;  1Q9I A;  3OZ2 A;  4K22 A;  1BGN A;  4BK2 A;  4YSX A;  3KKJ A;  4A5L A;  1DJN A;  2YVJ A;  1GV4 A;  1CJ3 A;  1P2H A;  4TM3 A;  1JNR A;  1TDE A;  1O5W A;  1KSS A;  4U8K A;  4B1B A;  4Z2R A;  1PJ6 A;  1GEU A;  1IJH A;  2C4C A;  3AYJ A;  4JNA A;  4Z44 A;  2GRT A;  2X50 A;  3IC9 A;  1IUT A;  3VRD B;  2Y6R A;  5FMH A;  1E1L A;  2EQ7 A;  3COX A;  4P9S A;  4Z43 A;  1MOK A;  4ECH A;  2XVF A;  1H7W A;  5U63 A;  3VR9 A;  2GR1 A;  1E6E A;  1XHC A;  1OJA A;  2YLX A;  1B4V A;  1S3E A;  2BK3 A;  1MO9 A;  1KNP A;  1Y0P A;  2OLO A;  2BC1 A;  3D1C A;  1N1P A;  4UP3 A;  1ZP0 A;  4IV9 A;  3S5W A;  4YSZ A;  2JB2 A;  1XPQ A;  3I3L A;  1E1K A;  3NTD A;  3PVC A;  4A99 A;  3AE5 A;  4IA5 A;  1ZMD A;  3FG2 P;  2IID A;  3HYX A;  3CPH G;  3AE9 A;  2VRL A;  3UP4 A;  1LJ1 A;  1F8S A;  3AEB A;  2C64 A;  3AE4 A;  3HYV A;  2GVC A;  3LXD A;  1KNR A;  2RGJ A;  1GSN A;  1F8W A;  1M6I A;  3UKH A;  3QVP A;  2C70 A;  4Y4N A;  3ABV A;  3UKF A;  1VQW A;  2OA1 A;  1BF3 A;  2C3D A;  3E1T A;  3RED A;  3T2K A;  3V3O A;  4U8I A;  3CNP A;  2RGH A;  2BC0 A;  4H4U A;  4H4Q A;  1VG9 A;  4RSL A;  1K0L A;  1HYU A;  3UCL A;  1AOG A;  4AP1 A;  1D4E A;  2XFP A;  1GXF A;  3AYI A;  1D4D A;  5C3J A;  3M12 A;  1GRA A;  2R9Z A;  2PHH A;  1SEZ A;  4JNQ A;  1Y56 B;  5FS8 A;  1GTH A;  1QO8 A;  1TDF A;  4H4Y A;  2WPC A;  2JB3 A;  3SFE A;  5ER0 A;  4OPG A;  4OPI A;  5KXJ A;  4BV6 A;  4BK1 A;  4GAP A;  1FEB A;  4LU6 A;  3DK8 A;  3UKQ A;  3AWI A;  3BI2 A;  3KA7 A;  1ONF A;  1CF3 A;  2Q0K A;  3BI4 A;  2CFY A;  2O9Z A;  4OPU A;  4BK3 A;  4CRT A;  5BRT A;  2X8H A;  5M0Z A;  5KMP A;  5M10 A;  4U8O A;  2TMD A;  3FBS A;  3DGZ A;  1CBO A;  2I0Z A;  4Y4L A;  1D7Y A;  1L0V A;  2BRY A;  4N9X A;  2YG3 A;  3KPK A;  5HYM A;  4DSH A;  3B3R A;  3NGC X;  3GWF A;  2YVF A;  2WPE A;  3C96 A;  4B63 A;  3GYJ A;  2WS3 A;  2YLT A;  5JCN A;  4U8L A;  3V3N A;  1DOD A;  4OPD A;  2YG7 A;  2WPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...