1NHQA

Crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
447
structure length
447
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analyses of NADH peroxidase Cys42Ala and Cys42Ser mutants: active site structures, mechanistic implications, and an unusual environment of Arg 303.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
molecule keywords NADH PEROXIDASE
total genus 136
structure length 447
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhqA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhqA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhqA02
2PYXA 2B9WA 5JCIA 3LZXA 2OLOA 3AE9A 3KU9A 2C73A 2YM1A 1VQWA 4GRTA 1DODA 3AE7A 4B69A 4CBQA 1TRBA 3DK4A 4OPDA 2FJAA 2YQUA 3T37A 3CNTA 3CGEA 3ATRA 4ZCCA 2A89A 3RP8A 4TLZA 4Z24A 3V76A 2GRTA 2VQBA 2WPFA 3VRBA 5FS9A 1EL9A 4O5UA 2AAQA 2YLRA 3NYCA 2JB2A 1CHUA 5HXIA 3UOXA 3GDNA 4CNKA 4H4VA 3I3LA 3DJJA 2C3CA 5KOWA 1JRYA 3NK2X 2W0HA 4EMJA 1PN0A 3ADAB 2X3NA 2E4GA 3UKLA 4U8LA 1Y0PA 1E1KA 2BYBA 2YVJA 1DNCA 3GDPA 5ER0A 4U8JA 4O5QA 4H4YA 1YQ4A 3UKAA 3UTGA 2YLSA 4J2WA 1E7PA 3GYJA 5JCKA 3FMWA 3SGLA 3Q6JA 4CNJA 4UDQA 4OPTA 4Y4MA 4A6NB 2VRLA 3ICSA 1GALA 3QVRA 4YTPA 4X9NA 1LQTA 1E39A 3ICRA 1CBOA 3P4SA 1LVLA 1JEHA 2XLUA 4J56A 1FECA 4AP1A 3AE1A 3DJGX 5FMHA 3NT6A 2VQ7A 4EQRA 3KA7A 2CVJA 2IVDA 2XCGA 2VOUA 1OJ9A 1OJAA 3VR8A 3P4RA 4JDRA 4U2LA 2WPCA 4E0VA 3F8DA 3DA1A 1BWCA 1TDKA 3CPIG 3QJ4A 4HA6A 2BCGG 3QVPA 4JY2A 4RG3A 1ZK7A 4D03A 3GRSA 1TYPA 2XFUA 1QJDA 4JNAA 1P2EA 1PJ6A 4KX6A 3H8IA 3SQPA 5KXJA 2WU2A 3GWFA 2YWLA 2YVGA 3ZDNA 1BGJA 1CC4A 1H86A 1EL8A 3UCLA 4H4UA 3UKKA 2O9ZA 3QSSA 3DJEA 2GQFA 2WDRA 4ECHA 4MJWA 3P9UA 2AQJA 2RGHA 4K8DA 1GETA 1CJ4A 1N4UA 1XANA 3H4KA 2BA9A 5C2TA 1FCDA 2ACZA 1L9EA 3AD7B 3AD9B 3UOYA 4CY6A 2Q0KA 3G5SA 2YR6A 2GH5A 4EQXA 2XDOA 3NYFA 4FDCB 1OJTA 2R4JA 3NIXA 1FEAA 2FJDA 4IVMB 1LJ1A 1GT8A 3UKQA 1ZP0A 3S61A 5JCNA 1KSSA 2GAGB 2E5VA 2ZBWA 3NK0X 3QSEA 1OJDA 3DK8A 4JNQA 4NTDA 1L9CA 3VQRA 3CNDA 2ZZBA 3NN6X 2GMJA 4OPCA 4APNA 2YAUA 1PBFA 1DOCA 1L0VA 3S5WA 3JSKA 3IF9A 3AE2A 5J60A 1B5QA 4N9XA 2CFYA 2VVLG 4YTNA 1K0IA 4BK1A 4C3XA 1GTHA 4ZN0A 3RP7A 1GESA 1EBDA 4M52A 3SFEA 4FK1C 3RP6A 3B3RA 5JCLA 4BV6A 2VZ2A 2YG7A 2WHDA 3K7TA 1NDAA 2RGOA 2R0GA 1YQ3A 5FS8A 2PHHA 4UP3A 1NENA 3VRDB 2GVCA 1COYA 3P4QA 5IPYA 4H2RA 3ZYXA 1GRFA 3CNSA 2XYOA 4EMWA 1H83A 1KFYA 3CGDA 4YKFA 2HQMA 2GEWA 1TDEA 3II4A 1ZMCA 4ADWA 3H8LA 2OAMA 4USRA 4A7AA 2JK6A 3AB1A 3ALJA 2FBWA 4U2SA 4GCMA 1MOKA 1IUSA 3CNPA 2GR3A 1CF3A 1LV0A 1CL0A 1NHQA 2WPEA 1DJQA 4LA1A 5HHFA 3V3OA 2EQ7A 4OPUA 1ZY8A 1PBDA 2B76A 4P9SA 2WOWA 4B66A 1YQZA 4A99A 2GR0A 1MO9A 3ITJA 4NEWA 1JNRA 3M12A 4NTCA 4YSZA 4YTMA 4B68A 4K22A 2R0PA 4C77A 2JBVA 4TM3A 3M0OA 2YG5A 4Z26A 1VG0A 1V59A 3NRNA 1UKVG 3FG2P 1DJNA 4GDPA 1TDFA 1QO8A 2EQ6A 2Z5XA 1PJ7A 4ICYA 3QSMA 3D8XA 2YLZA 4H2PA 4XWZA 4H2NA 2TMDA 2B7RA 5KVHA 3AD8B 3AE8A 1PHHA 1O94A 2V3BA 3UP5A 2X8GA 3VR9A 1TDOA 4A9WA 2WP9A 2X99A 3AEDA 4H4SA 2I0ZA 5IQ1A 2Q7VA 4NTEA 2X8HA 4A5LA 1PXAA 2C70A 1IJHA 2R4EA 2V3AA 3ALLA 1PS9A 1D7YA 4TM0A 2BS2A 4U8MA 3URHA 4OVIA 3AE3A 3F8RA 3GYIA 2C67A 3DMEA 2V6OA 5CKUA 3Q9TA 3UTFA 3UKFA 4AT0A 1GTEA 1RP0A 4Y4NA 3IC9A 4AP3A 2WOIA 3AEEA 1B4VA 4U8NA 4NEVA 5DBJA 3UTEA 5EOWA 1NG3A 4YT0A 3KPFA 1H7XA 2C64A 1D5TA 5EB4A 3GSIA 2QA2A 3NN0X 3EF6A 4CY8A 1ZX9A 4TLXA 2V60A 4J36A 1F3PA 4Z2TA 1GOSA 4U8PA 1Q1RA 1AOGA 3AXBA 4YSXA 3BI5A 3ATQA 3PS9A 2C66A 3EPTA 5TR3A 4H4QA 2WESA 2XLSA 3OZ2A 4I59A 4JY3A 2BK3A 1X31B 1ZOYA 4DNAA 1GV4A 4HB9A 2A8XA 3AWIA 1Q1WA 1B8SA 1JRXA 3NG7X 2DKHA 1PXCA 1Y56B 3CPHG 4K7ZA 4EIQA 1L9DA 1IUXA 1XHCA 2V61A 3UP4A 4H2QA 2R46A 1D4DA 2WDQA 3LZWA 5IQ4A 2V5ZA 1NPXA 4A65A 4H4TA 1EL7A 2OLNA 3CPJG 4IA5A 4JN9A 4GF7A 1BZLA 2WU5A 3FBSA 3GRTA 4Y4LA 4BURA 5KOXA 2WOVA 2YR4A 2YG3A 3KKJA 4EQSA 3AYJA 2ZZ0A 3EAOA 5U25A 4WCTA 2WP6A 3V3NA 3G5QA 4Z2UA 3FIMB 4BK2A 1GNDA 4U8OA 1NG4A 2GQWA 1D4EA 3UKHA 4DGKA 3AYLA 4BJYA 4IA6A 5BUKA 3LXDA 2JB3A 2XVHA 2BXRA 3NHOX 4B1BA 1D4CA 3DGZA 4H4WA 2XVIA 3AYIA 1GEUA 1P2HA 2J3NA 1BKWA 2GMHA 3ICTA 3PVCA 4FK1A 1GRBA 1XPQA 2BC0A 4C74A 4H4RA 3ISHA 4PABA 1Q9IA 2WBAA 3D1CA 4B63A 3K7MX 2XFPA 4YSYA 3SM8A 1FL2A 1EL5A 2H89A 1O95A 3DGHA 4EIPA 2BS4A 4Z43A 4KPRA 1GXFA 4TM4A 3KLJA 3FPZA 1TYTA 3GD3A 4PAAA 1BF3A 2C65A 4B64A 3L8KA 2C7GA 1LPFA 1TDNA 2YVFA 2YLTA 3LB8A 1GPEA 1SEZA 2VVMA 2EQ9A 2XVEA 2XLTA 1IUTA 2WETA 4J34A 4LU6A 4USQA 5FS7A 3SFDA 2R0CA 2GR2A 3AECA 3CN8A 3G5RA 4DSGA 4H50A 4EMIA 2BABA 4D04A 3P4PA 3R9UA 2YLXA 5M0ZA 1N4WA 1F8WA 5KRQA 2XFNA 1ZMDA 4YWOA 2BC1A 2A87A 1DXLA 3DH9A 4FX9A 4YKGA 2BK4A 3DK9A 1MXTA 2VRMA 4AOXA 1FOHA 1XDIA 2QAEA 2YLWA 3ABVA 1CJ2A 1S2QA 2XLRA 2GB0A 4ZCDA 3NYEA 4XWRA 3BI4A 3M13A 3VRAA 2Y6QA 3NLCA 4XXGA 2GF3A 1E1NA 4U8KA 2VVLA 3PO7A 3COXA 3C4NA 4REKA 1D7LA 1ZOVA 4Z25A 2XVJA 3DJDA 1RSGA 1H7WA 3QFAA 1IUVA 1K0JA 1VG9A 4EM3A 1PBEA 1JOAA 2GV8A 2XVFA 1S3EA 1NHPA 2C72A 3P1WA 2YG4A 2CULA 3NNEA 2OALA 2C75A 3GMBA 4H4XA 1YKJA 4LIIA 3WE0A 3NKSA 3REDA 1W4XA 2YG6A 4A79A 2BS3A 3BNUA 5KVIA 2APGA 2QA1A 1NHSA 5KWFA 1N1PA 1FEBA 3AE4A 2Y6RA 4CRTA 1H82A 3CTYA 4OPIA 1JNZA 1PDHA 4GR1A 2H88A 1CJCA 5BULA 3AEBA 4GDEA 5J7XA 3BHKA 1DOBA 5BVAA 4X9MA 5FS6A 5JCMA 1E1MA 3RNMA 1H81A 3O0HA 2GAHB 1K0LA 1OJCA 2JAEA 2Z5YA 1QLBA 4BJZA 5HYMA 2XFOA 4TM1A 1O5WA 1RYIA 3HZLA 4Z44A 1ONFA 1CC6A 4H7UA 5U63A 2BCPA 1KNPA 5C3JA 2RGJA 3B6DA 1B37A 1Y56A 3K7QX 1CJ3A 3BHFA 4H4ZA 3CNJA 3AEAA 3BI2A 2BACA 4A6NA 1KSUA 4GUVA 1BGNA 2JKCA 2IVEA 2BK5A 5EBKA 4UDPA 2TPRA 4OPLA 4C3YA 1NHRA 4J31A 2DKIA 1H6VA 2C3DA 2B9YA 2IIDA 1GRAA 1K4QA 4RSLA 2GR1A 1VDCA 3L1RA 5HY5A 1ZDLA 4DSHA 3F8PA 4OPGA 1F6MA 3GMCA 1PJ5A 2F5ZA 4K5SA 4H4PA 4J57A 4B67A 4YXDA 2WP5A 3LADA 1S2YA 3GD4A 2X8CA 3LJPA 1Z6LA 3AE6A 4J33A 1NAAA 4JQ9A 2E1MA 1E1LA 2YM2A 4EQWA 1IUWA 3IHMA 1CC2A 1JU2A 1KDGA 2UZZA 2WS3A 3NTAA 1VRQB 2YR5A 1KNRA 2FJEA 5GSNA 4YSHA 1LTXR 5GRTA 3NGCX 3KD9A 1PBBA 3CIRA 1NEKA 1HYUA 4BK3A 1PBCA 1LQUA 2C76A 4IV9A 4B65A 3UOZA 2NVKX 1GSNA 2WEUA 1DOEA 2EQ8A 4OCGA 2R9ZA 3K30A 2RABA 2NPXA 4X4JA 1REOA 3CGBA 1JRZA 1GRHA 4EM4A 1ELIA 1GERA 4K5RA 5M10A 3C4AA 3NH3X 2ZZCA 2AR8A 5EB5A 4U2TA 3AEFA 3E1TA 2FJBA 1M6IA 2CDUA 3CGCA 3QFBA 3ALMA 3NTDA 5CQFA 3UKPA 1M64A 2Q6UA 3OC4A 1F8SA 3NK1X 1H84A 3IHGA 2R45A 3GWDA 3UTHA 1GRTA 2X50A 1PXBA 4K2XA 4WX1A 3UOVA 4Z2RA 3KVEA 2B7SA 1ZKQA 4NZHA 2ARDA 2WDVA 5LV9A 2QCUA 3EANA 1IUUA 2WQYA 4I58A 3AEGA 2XFQA 3AE5A 1YY5A 4C5OA 1GRGA 2XLPA 1GREA 3LOVA 4AOSA 4U8IA 4AT2A 4UDRA 1E6EA 5L46A 5BRTA 1N4VA 3I6DA 2JB1A 2BXSA 3BNMA 1KF6A 5U1OA 1F8RA 3RHAA 4CCRA 2B9XA 4RG4A 3C96A 2OA1A 4IVOB 2Q0LA 3IWAA 4CCQA 1S3BA
chains in the Genus database with same CATH superfamily
2YM1A 3DK4A 4A35A 5FS9A 2YLRA 1CHUA 4CNKA 3I3LA 1JRYA 3UKLA 4U8LA 1Y0PA 2BYBA 2YVJA 1DNCA 3S47A 3GDPA 4U8JA 3VCNA 1YQ4A 3UKAA 2OKTA 3UTGA 2YLSA 1E7PA 3FMWA 3Q6JA 2PTXA 4A6NB 3ICSA 1LQTA 1STZA 3P4SA 2XLUA 1JEHA 3MKCA 4AP1A 5FMHA 2OLAA 4HCDA 4EQRA 2IVDA 2CVJA 2XCGA 2VOUA 4HCHA 2WPCA 3CPIG 5FJTA 2BCGG 3QVPA 2XSXA 2XFUA 1QJDA 2DW6A 1BQGA 4KX6A 3H8IA 3GWFA 1FHUA 1R6WA 1MRAA 1CC4A 2WDRA 4MJWA 1SJBA 4K8DA 2FKPA 1FCDA 2O56A 4CY6A 3T9PA 3TCSA 2XDOA 3NYFA 1FEAA 3UKQA 3SZ0A 5JCNA 2GAGB 2ZBWA 3NK0X 1OJDA 4JNQA 3RGTA 3CNDA 1L0VA 4GFIA 3DEQA 1B5QA 3A7UA 2VVLG 3DG7A 3CXOA 1GTHA 1KKRA 4M52A 1JCTA 2YG7A 2GGHA 3K7TA 1PDZA 5FS8A 2GVCA 3P4QA 4X2PA 3VDGA 3H70A 3CGDA 1TDEA 3OZYA 2FBWA 1FIQB 2OO6A 4GCMA 4U2SA 3NZGA 1CF3A 1LV0A 1DJQA 1ELSA 4II2A 4G73A 3ITJA 3IJQA 4NEWA 1JNRA 4NTCA 3UXKA 2YG5A 4Z26A 4ENLA 3FG2P 2Z5XA 4A3RA 4Z1YA 3UJSA 3UP5A 2PGWA 4E6MA 1OEPA 1PXAA 3ALLA 2V3AA 1PS9A 4TM0A 5ENLA 4U8MA 5EU9A 3ES7A 2C67A 3DMEA 2V6OA 3Q9TA 3TQPA 1GTEA 4U8NA 3AEEA 3UTEA 1NELA 3KPFA 4TLXA 4U8PA 2OVLA 3BI5A 1SJCA 3ATQA 2C66A 4H4QA 2WESA 3OZ2A 4M6UA 3R1ZA 1PXCA 3CPHG 1L9DA 3UP4A 2WDQA 1D4DA 4A65A 4H4TA 3CPJG 3DIPA 2P3ZA 1BZLA 3GRTA 2YG3A 4DN1A 4MKSA 2BRYA 4Z2UA 1H2IA 1W6TA 4BK2A 4MGGA 2GQWA 1D4EA 3AN1A 4B1BA 1V97A 4H4WA 2PTZA 3MY9A 4GIRA 2XVIA 1GEUA 3AYIA 2J3NA 4J1OA 1FL2A 1EL5A 3UJ2A 4Z43A 3ETRB 4KPRA 4IP4A 3FPZA 1TYTA 1ZXIC 3GD3A 3NVWB 3ZVHA 1LPFA 1P48A 3LB8A 1SEZA 2EQ9A 4USQA 4GGHA 2R0CA 3AECA 2P88A 4D04A 3R9UA 5M0ZA 1KCZA 1ZMDA 2A87A 3STPA 1KD0A 3L5OA 2GB0A 4ZCDA 2HNEA 3VRAA 4G7FA 3BI4A 2OPJA 3PO7A 4Z25A 1RSGA 3TW9A 1PBEA 1NHPA 2YG4A 2OALA 4IL2A 4JN8A 3REDA 5KWFA 1NHSA 3AE4A 4OPIA 1PDHA 4GR1A 5BULA 3AEBA 4GDEA 1SJAA 1H81A 1K0LA 2GDQA 3T4WA 4Z44A 3ES8A 2RGJA 3B6DA 3AEAA 1KSUA 4GUVA 1NHRA 4J31A 1H6VA 3NVYB 4ZOHB 4OPGA 1X2GA 1WUFA 1PJ5A 4K5SA 4J57A 5BOEA 3LADA 3GD4A 4J33A 3AE6A 4JQ9A 2E1MA 2GGEA 3V5CA 3IHMA 2WS3A 2YR5A 1KNRA 5GSNA 3R0UA 5GRTA 1PBBA 1HYUA 1LQUA 4IP5A 3UOZA 1GSNA 2EQ8A 4OCGA 2RABA 2HXUA 4E4FA 3DDMA 3THUA 3V4BA 3NH3X 2ZZCA 2AR8A 3ALMA 3NTDA 3UJEA 3VA8A 1F8SA 3I6EA 3UTHA 1PXBA 4K2XA 4WX1A 2B7SA 1ZKQA 2ARDA 2QDEA 2WDVA 3UXLA 4TVYA 3JW7A 4I58A 2XFQA 4C5OA 3EUB3 1GRGA 3LOVA 1GREA 5BRTA 1N63C 2BXSA 4IL0A 4DXKA 2OZTA 2QJJA 4CCQA 4KEMA 2W55A 3LZXA 3AE9A 2C73A 1VQWA 3AE7A 4B69A 1TRBA 2FJAA 3ATRA 3RP8A 4TLZA 4Z24A 3V76A 1EC9A 2VQBA 2WPFA 3VRBA 1EL9A 2AAQA 3NYCA 3UOXA 3DJJA 2C3CA 5KOWA 4EMJA 3ADAB 2X3NA 4M0XA 2PTYA 3P3BA 1E1KA 3SGLA 4CNJA 1GALA 3MZNA 3SZWA 3NT6A 3KA7A 1OJAA 4JDRA 4H83A 1SB3B 3DA1A 1BWCA 4JHMA 3SN4A 3QJ4A 4JY2A 4RG3A 3BSMA 3PG6A 5KXJA 3ZVIA 2YVGA 1BGJA 1H86A 1EL8A 4H4UA 2O9ZA 3DJEA 3P9UA 3CB3A 3UOYA 4G9KA 2YR6A 4GAPA 1OJTA 2R4JA 2FJDA 4IVMB 2PU0A 1KSSA 2I5QA 2E5VA 3QSEA 2YAUA 3IF9A 3AE2A 4HNLA 4HN8A 4BK1A 4ZN0A 2PP0A 1EBDA 3SFEA 3SX6A 3B3RA 1MNSA 2R0GA 4UP3A 2AL2A 1COYA 3CNSA 2XYOA 1H83A 2HQMA 3SXIA 3II4A 4ADWA 3H8LA 3HW2A 4HNCA 4USRA 5IDZA 3AB1A 3MUCA 3I4KA 3CNPA 2GR3A 1CL0A 2WPEA 4LA1A 3SN0A 2EQ7A 4OPUA 1ZY8A 1MO9A 4YSZA 3M12A 4K22A 2R0PA 4C77A 2JBVA 1N5XA 1EC8A 1VG0A 1QO8A 1PJ7A 3QSMA 3VFCA 3D8XA 2TMDA 2B7RA 5KVHA 3AE8A 1PHHA 2QJNA 1O94A 2V3BA 3HRDC 2P8BA 1TDOA 4A9WA 3MWCA 4H4SA 4NTEA 1MDLA 3TJIA 1D7YA 2BS2A 4OVIA 3AE3A 4AT0A 5CKUA 4Y4NA 5DBJA 4NEVA 3GYXA 2C64A 3SBFA 2XH4A 5EB4A 3NN0X 3EF6A 3T2KA 4CY8A 1F3PA 4Z2TA 3T6CA 1GOSA 3CMMA 3N4EA 3PS9A 2XLSA 1L8PA 4DNAA 1GV4A 1JRXA 1Y56B 2OQHA 1IUXA 4H2QA 2R46A 2V5ZA 1EL7A 2XH0A 4GF7A 4GGBA 3T14A 1FHVA 4Y4LA 5KOXA 2RDXA 3AYJA 3DGBA 4H2HA 4ROPA 2PSNA 3V3NA 3G5QA 4DGKA 3AYLA 4IA6A 5BUKA 1N61C 4FK1A 1GRBA 3MSYA 2BC0A 4C74A 2MUCA 4H4RA 3ISHA 4PABA 2XFPA 4YSYA 1O95A 4EIPA 3FYYA 2BS4A 1BF3A 2XLTA 4LU6A 2QQ6A 3QTPA 3SFDA 3PK7A 3FVDA 3P4PA 2QVHA 3SYIA 2YLXA 1F8WA 4YKGA 4FX9A 4E8GA 3U9IA 1MXTA 4DWDA 4JN7A 2W3SA 4KWSA 2YLWA 1CJ2A 2PMQA 3NLCA 4XXGA 3T2ZA 3QFAA 1VG9A 4EM3A 1JOAA 2XVFA 2C72A 3WE0A 3OPSA 2YG6A 2QA1A 1N1PA 3CTYA 1JNZA 1CJCA 3P0WA 3BHKA 5BVAA 4X9MA 5FS6A 1KKOA 1E1MA 3RNMA 1EBHA 3O0HA 1OJCA 2Z5YA 4KPLA 1O5WA 1ONFA 5C3JA 2FYMA 3T0KA 3RR1A 3BI2A 2BACA 2JKCA 2IVEA 3NRZB 3BOXA 2GR1A 4DSHA 3FXGA 3T8QA 3F8PA 4IHCA 2F5ZA 4H4PA 4B67A 3SQSA 4GISA 2YM2A 1IUWA 5G5GB 1VRQB 4G8TA 3SZCA 3KD9A 3CT2A 1PBCA 4IV9A 4GYPC 1N62C 2PP3A 4EM4A 1ELIA 1GERA 4K5RA 4U2TA 2FJBA 3OC4A 1E9IA 4K2SA 3IHGA 3GWDA 1GRTA 2X50A 2QGYA 3KVEA 4FI4A 1ECQA 2QCUA 1IUUA 2XLPA 1JPMA 1NU5A 4AT2A 1E6EA 5G5HB 1KF6A 3RHAA 3C96A 3N6HA 3IWAA 1S3BA 3OW1A 3NVVB 2B9WA 5JCIA 2OLOA 4F4RA 5BOFA 4CBQA 4OPDA 4GMEA 3CNTA 4ZCCA 2A89A 1YEYA 3MQTA 1ONEA 3GDNA 3NS1B 2W0HA 1PN0A 3N4FA 2AL2B 5ER0A 4O5QA 4GYPA 3GYJA 5JCKA 4UDQA 4Y4MA 2VRLA 4ZA0A 3NXLA 3HYVA 4X9NA 3CK5A 1E39A 1LVLA 3TJ4A 2VQ7A 2OQYA 3UCCA 3P4RA 7ENLA 3N6JA 4DHGA 1TDKA 4HA6A 3GRSA 3KUMA 3PFRA 4JNAA 1P2EA 3ZDNA 4G6GA 3IJLA 3UKKA 3QSSA 4ECHA 2W54A 2AQJA 1GETA 1XANA 3H4KA 2ACZA 2OZ8A 3AD7B 3AD9B 2GL5A 2GH5A 1RM6B 3OTRA 3ZLHA 4IZGA 1L9CA 3NN6X 4OPCA 1PBFA 2AL1A 2GGIA 3JSKA 3QN3A 2GGJA 3DFYA 4N9XA 2CFYA 1K0IA 3Q4DA 4HCLA 3RP7A 3IK4A 3RP6A 4BV6A 2VZ2A 2WHDA 2PHHA 3SN1A 4H2RA 4EMWA 1KFYA 4ZCWA 1ZMCA 2OAMA 5FJPA 1KN0A 2E3TA 3B97A 1IUSA 1NHQA 5HHFA 1PBDA 1YQZA 2GR0A 1RVKA 3TTEA 4YTMA 4B68A 3FJ4A 4TM3A 3M0OA 1V59A 3NRNA 1UKVG 1DJNA 3FV9A 3QKEA 2EQ6A 4ICYA 3SY4A 4H2PA 3R0KA 4XWZA 4H2NA 3FCPA 4GAVA 3VR9A 2BRAA 2X99A 2ONEA 4YWSA 4A5LA 4EWJA 2C70A 2R4EA 2AKZA 4Z17A 3UTFA 3GYIA 4AP3A 1JPDX 1NG3A 3CYJA 3SSZA 1ZX9A 2V60A 3GC2A 4YSXA 3DERA 4JY3A 3EPTA 5TR3A 3ENLA 1P43A 2MNRA 2CHRA 1B8SA 3DFHA 2DKHA 4EIQA 2GGGA 2V61A 1PDYA 3LZWA 5IQ4A 1N5WC 1NPXA 4JN9A 2OLNA 3FBSA 2YR4A 1FFUC 4EQSA 1TZZA 3EAOA 5U25A 3ZVHB 1GNDA 4U8OA 3UKHA 2W3RA 3LXDA 3DGZA 2GSHA 1BKWA 2GMHA 3ICTA 3D1CA 2PU1A 3K7MX 3SM8A 2H89A 4TM4A 3KLJA 3R25A 4B64A 2YLTA 2VVMA 1GPEA 2XVEA 6ENLA 4NNJA 1IUTA 2WETA 5KMQA 5FS7A 2GR2A 4H50A 4G6HA 1XS2A 3DH9A 2BK4A 1WUEA 4MMWA 2XLRA 4XWRA 3M13A 2Y6QA 1E1NA 3VC6A 2VVLA 3S5SA 1H7WA 1IUVA 3NNEA 2C75A 3GMBA 4H4XA 1YKJA 3NVZB 4A79A 3BNUA 1FEBA 2Y6RA 4CRTA 1H82A 1WYGA 2H88A 5J7XA 1DOBA 3BJSA 5JCMA 2GAHB 1QLBA 2XFOA 4TM1A 1RYIA 3HZLA 4H7UA 5U63A 2BCPA 1Y56A 3BHFA 4H4ZA 3CNJA 4A6NA 1BGNA 4OPLA 4C3YA 2DKIA 2C3DA 1GRAA 3DG6A 1ZDLA 3GD6A 1F6MA 3GMCA 3JZUA 2PGEA 2WP5A 3TWAA 3LJPA 1NAAA 1E1LA 4EQWA 1CC2A 2UZZA 2HXTA 4YSHA 3TWBA 2WEUA 3UJFA 1REOA 3CGBA 3A7RA 3SR6B 5M10A 3C4AA 5EB5A 4DX3A 3E1TA 3UKPA 2CDUA 3QFBA 1M64A 2Q6UA 3NK1X 1H84A 2R45A 1R0MA 3ZLFA 2WQYA 3AE5A 3RITA 1YY5A 4AOSA 2PS2A 4UDRA 5L46A 1N4VA 4G74A 2HZGA 5U1OA 2B9XA 3RRAA 2Q0LA 4DYEA 3JVAA 2PYXA 3KU9A 4GRTA 1DODA 4K8GA 2YQUA 3T37A 3CGEA 4H19A 1JRPA 2GRTA 4O5UA 2JB2A 5HXIA 4H4VA 1XPYA 3CAWA 3NK2X 2E4GA 4HYRA 4H4YA 1F9CA 4J2WA 2E5AA 3UCDA 3DG3A 3HYXA 4OPTA 3QVRA 4YTPA 3ICRA 1CBOA 3B9JB 4J56A 1FECA 3AE1A 3DJGX 3OZMA 1OJ9A 3AMZA 3VR8A 4U2LA 3T2YA 4E0VA 3F8DA 1ZK7A 4D03A 1DTNA 1TYPA 4A6GA 1PJ6A 1FFVC 3SQPA 2WU2A 2YWLA 2PODA 4IT1A 3UCLA 3VCCA 4E5TA 2GQFA 2RGHA 1CJ4A 1N4UA 2BA9A 5C2TA 3TOYA 1L9EA 2Q0KA 3G5SA 2AKMA 4EQXA 4FDCB 3NIXA 1LJ1A 1GT8A 4NWZA 1ZP0A 3CXBA 3S61A 3Q45A 3DK8A 4NTDA 5KNLA 3VQRA 2ZZBA 2GMJA 1TE6A 4APNA 5KMSA 1DOCA 3S5WA 2XH7A 5J60A 4YTNA 4C3XA 1GESA 4FK1C 5JCLA 1NDAA 2RGOA 1YQ3A 2PTWA 1NENA 3VRDB 3UJRA 5IPYA 3ZYXA 1GRFA 1S7MA 1T3QC 3NFUA 4YKFA 3H8AA 2GEWA 4K1WA 2OG9A 3R07C 4A7AA 2JK6A 3ALJA 1MOKA 5J04A 1FO4A 2PP1A 3V3OA 4P9SA 2B76A 4B66A 2WOWA 4A99A 1MUCA 3KPKA 2QJMA 3H12A 4GDPA 1TDFA 1MDRA 2YLZA 3AD8B 2X8GA 2WP9A 2POZA 3AEDA 2I0ZA 5IQ1A 2Q7VA 2X8HA 3P93A 3D46A 1IJHA 3URHA 3T31A 3F8RA 2C4CA 2QDDA 3UKFA 1RP0A 3IC9A 2WOIA 1B4VA 5EOWA 4YT0A 3A7AA 1H7XA 1VDVA 3QLDA 1D5TA 2DW7A 3GSIA 2QA2A 4J36A 3PWGA 1Q1RA 1AOGA 3AXBA 4H1ZA 4I59A 2BK3A 1X31B 1ZOYA 4HB9A 2A8XA 3AWIA 5FJOA 1Q1WA 3NG7X 4K7ZA 3D9XA 1XHCA 4IA5A 2OZ3A 2WU5A 4BURA 2WOVA 3KKJA 2ZZ0A 4WCTA 2WP6A 3FIMB 1NG4A 3ZLGA 4BJYA 1VQZA 2JB3A 2XVHA 2BXRA 3NHOX 1D4CA 1JDFA 3DESA 1P2HA 3PVCA 1XPQA 1Q9IA 2WBAA 1EC7A 5JRBA 4B63A 1IYXA 2XGZA 3QPEA 3DGHA 1GXFA 1N60C 3R11A 2OX4A 4PAAA 2C65A 3L8KA 4HPNA 2C7GA 1TDNA 2YVFA 2P0IA 3D47A 4J34A 1JROA 1SJDA 3PWIA 2ZADA 3CN8A 3G5RA 4DSGA 4EMIA 2BABA 3UGVA 3VC5A 2ZC8A 1N4WA 5KRQA 2XFNA 4YWOA 2BC1A 1DXLA 3NO1A 3DK9A 5KMPA 2VRMA 4AOXA 1FOHA 1XDIA 3OP2A 2QAEA 3ABVA 2PPGA 1S2QA 3NYEA 2PCEA 2GF3A 4U8KA 3U4FA 3C4NA 3COXA 4REKA 3AM9A 3GO2A 3R10A 1D7LA 1ZOVA 2XVJA 3DJDA 1K0JA 1EBGA 3P1WA 2GV8A 1S3EA 2CULA 5FJRA 3EEZA 4LIIA 3NKSA 4FP1A 1W4XA 2BS3A 5KVIA 2APGA 1BKHA 3I6TA 3V5FA 2JAEA 3HYWA 4BJZA 3SZFA 5HYMA 4J3ZA 4II3A 1CC6A 1KNPA 1B37A 3K7QX 1CJ3A 5KMRA 2PA6A 2XH2A 2BK5A 5EBKA 4KT2A 4UDPA 2TPRA 2B9YA 2IIDA 4RSLA 1K4QA 1VDCA 3L1RA 5HY5A 3SJNA 5FJUA 4YXDA 1S2YA 2P8CA 2X8CA 1Z6LA 3GY1A 2OFJA 3HPFA 1X2HA 1JU2A 1KDGA 3NTAA 2FJEA 1LTXR 4E4UA 3NGCX 4TVWA 1NEKA 3EKGA 3CIRA 4BK3A 2C76A 4B65A 3IJIA 2NVKX 3K1GA 1DOEA 2R9ZA 3K30A 2NPXA 4X4JA 1JRZA 1GRHA 3AEFA 1M6IA 5CQFA 3CGCA 3UOVA 4Z2RA 3H7VA 4NZHA 1TKKA 5LV9A 3EANA 3AEGA 2NQLA 3RO6A 4U8IA 3I6DA 2JB1A 3BNMA 1F8RA 3RCYA 4CCRA 4RG4A 3V3WA 2OA1A 4IVOB
chains in the Genus database with same CATH topology
2PYXA 2B9WA 5JCIA 3LZXA 2OLOA 3AE9A 3KU9A 2C73A 2YM1A 1VQWA 4GRTA 1DODA 3AE7A 4B69A 4CBQA 1TRBA 3DK4A 4OPDA 2FJAA 2YQUA 3T37A 3CNTA 3CGEA 3ATRA 4ZCCA 2A89A 3RP8A 4TLZA 4Z24A 3V76A 2GRTA 2VQBA 2WPFA 3VRBA 5FS9A 1EL9A 4O5UA 2AAQA 2YLRA 3NYCA 2JB2A 1CHUA 5HXIA 3UOXA 3GDNA 4CNKA 4H4VA 3I3LA 3DJJA 2C3CA 5KOWA 1JRYA 3NK2X 2W0HA 4EMJA 1PN0A 3ADAB 2X3NA 2E4GA 3UKLA 4U8LA 1Y0PA 1E1KA 2BYBA 2YVJA 1DNCA 3GDPA 5ER0A 4U8JA 4O5QA 4H4YA 1YQ4A 3UKAA 3UTGA 2YLSA 4J2WA 1E7PA 3GYJA 5JCKA 3FMWA 3SGLA 3Q6JA 4CNJA 4UDQA 3HYXA 4OPTA 4Y4MA 4A6NB 2VRLA 3ICSA 1GALA 3QVRA 4YTPA 3HYVA 4X9NA 1LQTA 1E39A 3ICRA 1CBOA 3P4SA 1LVLA 1JEHA 2XLUA 4J56A 1FECA 3SZWA 4AP1A 3AE1A 3DJGX 5FMHA 3NT6A 2VQ7A 4EQRA 3KA7A 2CVJA 2IVDA 2XCGA 2VOUA 1OJ9A 1OJAA 3VR8A 3P4RA 4JDRA 4U2LA 2WPCA 3T2YA 4E0VA 3F8DA 3DA1A 1BWCA 1TDKA 3CPIG 3QJ4A 4HA6A 2BCGG 3QVPA 4JY2A 4RG3A 1ZK7A 4D03A 3GRSA 3PG6A 1TYPA 2XFUA 1QJDA 4JNAA 1P2EA 1PJ6A 4KX6A 3H8IA 3SQPA 5KXJA 2WU2A 3GWFA 2YWLA 2YVGA 3ZDNA 1BGJA 1CC4A 1H86A 1EL8A 4G6GA 3UCLA 4H4UA 3UKKA 2O9ZA 3QSSA 3DJEA 2GQFA 2WDRA 4ECHA 4MJWA 3P9UA 2AQJA 2RGHA 4K8DA 1GETA 1CJ4A 1N4UA 1XANA 3H4KA 2BA9A 5C2TA 1FCDA 2ACZA 1L9EA 3AD7B 3AD9B 3UOYA 4G9KA 4CY6A 2Q0KA 3G5SA 2YR6A 2GH5A 4EQXA 2XDOA 3NYFA 4FDCB 1OJTA 2R4JA 3NIXA 4GAPA 1FEAA 2FJDA 4IVMB 1LJ1A 1GT8A 4NWZA 3UKQA 3SZ0A 1ZP0A 3S61A 5JCNA 1KSSA 2GAGB 2E5VA 2ZBWA 3NK0X 3QSEA 1OJDA 3DK8A 4JNQA 4NTDA 5KNLA 1L9CA 3VQRA 3CNDA 2ZZBA 3NN6X 2GMJA 4OPCA 4APNA 2YAUA 1PBFA 5KMSA 1DOCA 1L0VA 3S5WA 3JSKA 3IF9A 3AE2A 5J60A 1B5QA 4N9XA 2CFYA 2VVLG 4YTNA 1K0IA 4BK1A 4C3XA 1GTHA 4ZN0A 3RP7A 1GESA 1EBDA 4M52A 3SFEA 4FK1C 3RP6A 3SX6A 3B3RA 5JCLA 4BV6A 2VZ2A 2YG7A 2WHDA 3K7TA 1NDAA 2RGOA 2R0GA 1YQ3A 5FS8A 2PHHA 4UP3A 1NENA 3VRDB 2GVCA 1COYA 3P4QA 5IPYA 4H2RA 3ZYXA 1GRFA 1S7MA 2XYOA 3CNSA 4EMWA 1H83A 1KFYA 3CGDA 4YKFA 2HQMA 2GEWA 3SXIA 1TDEA 3II4A 1ZMCA 4ADWA 3H8LA 2OAMA 4USRA 4A7AA 2JK6A 3AB1A 3ALJA 3UTFA 1KN0A 2FBWA 4U2SA 4GCMA 1MOKA 1IUSA 3CNPA 2GR3A 1CF3A 1LV0A 1CL0A 1NHQA 2WPEA 1DJQA 4LA1A 5HHFA 3V3OA 4II2A 2EQ7A 4OPUA 1ZY8A 1PBDA 2B76A 4G73A 2WOWA 4P9SA 4B66A 1YQZA 4A99A 2GR0A 1MO9A 3ITJA 4NEWA 1JNRA 3M12A 4NTCA 4YSZA 3KPKA 4YTMA 4B68A 4K22A 2R0PA 4C77A 2JBVA 4TM3A 3M0OA 2YG5A 4Z26A 1VG0A 1V59A 3NRNA 1UKVG 3FG2P 1DJNA 4GDPA 1TDFA 1QO8A 2EQ6A 2Z5XA 1PJ7A 4ICYA 3QSMA 3D8XA 2YLZA 4H2PA 4XWZA 3SY4A 4H2NA 2TMDA 2B7RA 5KVHA 3AD8B 4GAVA 3AE8A 1PHHA 1O94A 2V3BA 3UP5A 2X8GA 3VR9A 1TDOA 4A9WA 2BRAA 2WP9A 2X99A 3AEDA 4H4SA 2I0ZA 5IQ1A 2Q7VA 4NTEA 2X8HA 4A5LA 1PXAA 2C70A 1IJHA 2R4EA 2V3AA 3ALLA 1PS9A 1D7YA 4TM0A 2BS2A 4U8MA 3URHA 4OVIA 3AE3A 3F8RA 3GYIA 2C67A 3DMEA 2V6OA 2C4CA 3Q9TA 5CKUA 3T31A 3UKFA 4AT0A 1GTEA 1RP0A 4Y4NA 3IC9A 4AP3A 2WOIA 3AEEA 1B4VA 4U8NA 4NEVA 5DBJA 3UTEA 5EOWA 1NG3A 4YT0A 3KPFA 3GYXA 1H7XA 2C64A 1D5TA 5EB4A 3GSIA 2QA2A 3NN0X 3EF6A 3T2KA 1ZX9A 4TLXA 4CY8A 2V60A 4J36A 1F3PA 4Z2TA 1GOSA 3CMMA 4U8PA 1Q1RA 1AOGA 3AXBA 4YSXA 3BI5A 3ATQA 3PS9A 2C66A 3EPTA 5TR3A 4H4QA 2WESA 2XLSA 3OZ2A 4I59A 4JY3A 2BK3A 1X31B 1ZOYA 4DNAA 1GV4A 4HB9A 2A8XA 3AWIA 1Q1WA 1B8SA 1JRXA 3NG7X 2DKHA 1PXCA 1Y56B 3CPHG 4K7ZA 4EIQA 1L9DA 3D9XA 1IUXA 1XHCA 2V61A 3UP4A 4H2QA 2R46A 1D4DA 2WDQA 3LZWA 5IQ4A 2V5ZA 1NPXA 4A65A 4H4TA 1EL7A 2OLNA 3CPJG 4IA5A 4JN9A 4GF7A 1BZLA 2WU5A 3FBSA 3GRTA 3T14A 4Y4LA 4BURA 5KOXA 2WOVA 2YR4A 2YG3A 3KKJA 4EQSA 3AYJA 2ZZ0A 3EAOA 5U25A 4WCTA 2WP6A 3V3NA 3G5QA 2BRYA 4Z2UA 1H2IA 3FIMB 4BK2A 1GNDA 4U8OA 1NG4A 2GQWA 1D4EA 3UKHA 4DGKA 3AYLA 4BJYA 4IA6A 5BUKA 3LXDA 2JB3A 2XVHA 2BXRA 3NHOX 4B1BA 1D4CA 3DGZA 4H4WA 2XVIA 3AYIA 1GEUA 1P2HA 2J3NA 1BKWA 2GMHA 3ICTA 3PVCA 4FK1A 1GRBA 1XPQA 2BC0A 4C74A 4H4RA 3ISHA 4PABA 1Q9IA 2WBAA 3D1CA 5JRBA 4B63A 3K7MX 2XFPA 4YSYA 3SM8A 1FL2A 1EL5A 2H89A 1O95A 3DGHA 4EIPA 2BS4A 4Z43A 4KPRA 1GXFA 4TM4A 3KLJA 3FPZA 1TYTA 3GD3A 4PAAA 1BF3A 2C65A 4B64A 3L8KA 2C7GA 1LPFA 1TDNA 2YVFA 2YLTA 3LB8A 1GPEA 1SEZA 2VVMA 2EQ9A 2XVEA 2XLTA 1IUTA 2WETA 4J34A 4LU6A 4NNJA 4USQA 5KMQA 5FS7A 3SFDA 2R0CA 2GR2A 3AECA 3CN8A 3G5RA 4DSGA 4H50A 4EMIA 2BABA 4D04A 3P4PA 4G6HA 3R9UA 3SYIA 2YLXA 5M0ZA 1N4WA 1F8WA 5KRQA 2XFNA 1ZMDA 4YWOA 2BC1A 2A87A 1DXLA 3DH9A 4FX9A 4YKGA 2BK4A 3DK9A 5KMPA 1MXTA 2VRMA 4AOXA 1FOHA 1XDIA 2QAEA 3L5OA 2YLWA 1CJ2A 1S2QA 2XLRA 2GB0A 3ABVA 4ZCDA 3NYEA 4XWRA 3BI4A 3M13A 3VRAA 2Y6QA 3NLCA 4XXGA 2GF3A 1E1NA 4U8KA 2VVLA 3T2ZA 3PO7A 3COXA 3C4NA 4REKA 1D7LA 1ZOVA 4Z25A 2XVJA 3DJDA 1RSGA 1H7WA 3QFAA 1IUVA 1K0JA 1VG9A 4EM3A 1PBEA 1JOAA 2GV8A 2XVFA 1S3EA 1NHPA 2C72A 3P1WA 2YG4A 2CULA 3NNEA 2OALA 2C75A 3GMBA 4H4XA 1YKJA 4LIIA 3WE0A 3NKSA 3REDA 1W4XA 2YG6A 4A79A 2BS3A 3BNUA 5KVIA 2APGA 2QA1A 1NHSA 5KWFA 1N1PA 1FEBA 3AE4A 2Y6RA 4CRTA 1H82A 3CTYA 4OPIA 1JNZA 1PDHA 4GR1A 2H88A 1CJCA 5BULA 3AEBA 4GDEA 5J7XA 3BHKA 1DOBA 5BVAA 4X9MA 5FS6A 5JCMA 1E1MA 3RNMA 1H81A 3O0HA 2GAHB 1K0LA 1OJCA 2JAEA 2Z5YA 3HYWA 1QLBA 4BJZA 3SZFA 5HYMA 2XFOA 4TM1A 1O5WA 1RYIA 4II3A 3HZLA 4Z44A 1ONFA 1CC6A 4H7UA 5U63A 2BCPA 1KNPA 5C3JA 2RGJA 3B6DA 3T0KA 1B37A 1Y56A 3K7QX 1CJ3A 3BHFA 4H4ZA 3CNJA 5KMRA 3AEAA 3BI2A 2BACA 4A6NA 1KSUA 4GUVA 1BGNA 2JKCA 2IVEA 2BK5A 5EBKA 4UDPA 2TPRA 4OPLA 4C3YA 1NHRA 4J31A 2DKIA 1H6VA 2C3DA 2B9YA 2IIDA 1GRAA 1K4QA 4RSLA 2GR1A 1VDCA 3L1RA 5HY5A 1ZDLA 4DSHA 3F8PA 4OPGA 1F6MA 3GMCA 1PJ5A 2F5ZA 4K5SA 4H4PA 4J57A 4B67A 4YXDA 2WP5A 3LADA 1S2YA 3GD4A 2X8CA 3LJPA 1Z6LA 3AE6A 4J33A 1NAAA 4JQ9A 2E1MA 1E1LA 2YM2A 4EQWA 1IUWA 3IHMA 1CC2A 1JU2A 1KDGA 2UZZA 2WS3A 3NTAA 1VRQB 2YR5A 1KNRA 2FJEA 5GSNA 4YSHA 1LTXR 5GRTA 3NGCX 3SZCA 3KD9A 1PBBA 3CIRA 1NEKA 1HYUA 4BK3A 1PBCA 1LQUA 2C76A 4IV9A 4B65A 3UOZA 2NVKX 1GSNA 2WEUA 1DOEA 2EQ8A 4OCGA 2R9ZA 3K30A 2RABA 2NPXA 4X4JA 1REOA 3CGBA 1JRZA 1GRHA 4EM4A 1ELIA 1GERA 4K5RA 5M10A 3C4AA 3NH3X 2ZZCA 2AR8A 5EB5A 4U2TA 3AEFA 3E1TA 2FJBA 1M6IA 2CDUA 3CGCA 3QFBA 3ALMA 3NTDA 5CQFA 3UKPA 1M64A 2Q6UA 3OC4A 1F8SA 3NK1X 1H84A 3IHGA 2R45A 3GWDA 3UTHA 1GRTA 2X50A 1PXBA 4K2XA 4WX1A 3UOVA 4Z2RA 3KVEA 2B7SA 1ZKQA 4NZHA 2ARDA 2WDVA 5LV9A 2QCUA 3EANA 1IUUA 2WQYA 4I58A 3AEGA 2XFQA 3AE5A 1YY5A 4C5OA 1GRGA 2XLPA 1GREA 3LOVA 4AOSA 4U8IA 4AT2A 4UDRA 1E6EA 5L46A 5BRTA 1N4VA 3I6DA 2JB1A 4G74A 2BXSA 3BNMA 1KF6A 5U1OA 1F8RA 3RHAA 4CCRA 2B9XA 4RG4A 3C96A 2OA1A 4IVOB 2Q0LA 3IWAA 4CCQA 1S3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYX A;  2B9W A;  5JCI A;  3LZX A;  2OLO A;  3AE9 A;  3KU9 A;  2C73 A;  2YM1 A;  1VQW A;  4GRT A;  1DOD A;  3AE7 A;  4B69 A;  4CBQ A;  1TRB A;  3DK4 A;  4OPD A;  2FJA A;  2YQU A;  3T37 A;  3CNT A;  3CGE A;  3ATR A;  4ZCC A;  2A89 A;  3RP8 A;  4TLZ A;  4Z24 A;  3V76 A;  2GRT A;  2VQB A;  2WPF A;  3VRB A;  5FS9 A;  1EL9 A;  4O5U A;  2AAQ A;  2YLR A;  3NYC A;  2JB2 A;  1CHU A;  5HXI A;  3UOX A;  3GDN A;  4CNK A;  4H4V A;  3I3L A;  3DJJ A;  2C3C A;  5KOW A;  1JRY A;  3NK2 X;  2W0H A;  4EMJ A;  1PN0 A;  3ADA B;  2X3N A;  2E4G A;  3UKL A;  4U8L A;  1Y0P A;  1E1K A;  2BYB A;  2YVJ A;  1DNC A;  3GDP A;  5ER0 A;  4U8J A;  4O5Q A;  4H4Y A;  1YQ4 A;  3UKA A;  3UTG A;  2YLS A;  4J2W A;  1E7P A;  3GYJ A;  5JCK A;  3FMW A;  3SGL A;  3Q6J A;  4CNJ A;  4UDQ A;  4OPT A;  4Y4M A;  4A6N B;  2VRL A;  3ICS A;  1GAL A;  3QVR A;  4YTP A;  4X9N A;  1LQT A;  1E39 A;  3ICR A;  1CBO A;  3P4S A;  1LVL A;  1JEH A;  2XLU A;  4J56 A;  1FEC A;  4AP1 A;  3AE1 A;  3DJG X;  5FMH A;  3NT6 A;  2VQ7 A;  4EQR A;  3KA7 A;  2CVJ A;  2IVD A;  2XCG A;  2VOU A;  1OJ9 A;  1OJA A;  3VR8 A;  3P4R A;  4JDR A;  4U2L A;  2WPC A;  4E0V A;  3F8D A;  3DA1 A;  1BWC A;  1TDK A;  3CPI G;  3QJ4 A;  4HA6 A;  2BCG G;  3QVP A;  4JY2 A;  4RG3 A;  1ZK7 A;  4D03 A;  3GRS A;  1TYP A;  2XFU A;  1QJD A;  4JNA A;  1P2E A;  1PJ6 A;  4KX6 A;  3H8I A;  3SQP A;  5KXJ A;  2WU2 A;  3GWF A;  2YWL A;  2YVG A;  3ZDN A;  1BGJ A;  1CC4 A;  1H86 A;  1EL8 A;  3UCL A;  4H4U A;  3UKK A;  2O9Z A;  3QSS A;  3DJE A;  2GQF A;  2WDR A;  4ECH A;  4MJW A;  3P9U A;  2AQJ A;  2RGH A;  4K8D A;  1GET A;  1CJ4 A;  1N4U A;  1XAN A;  3H4K A;  2BA9 A;  5C2T A;  1FCD A;  2ACZ A;  1L9E A;  3AD7 B;  3AD9 B;  3UOY A;  4CY6 A;  2Q0K A;  3G5S A;  2YR6 A;  2GH5 A;  4EQX A;  2XDO A;  3NYF A;  4FDC B;  1OJT A;  2R4J A;  3NIX A;  1FEA A;  2FJD A;  4IVM B;  1LJ1 A;  1GT8 A;  3UKQ A;  1ZP0 A;  3S61 A;  5JCN A;  1KSS A;  2GAG B;  2E5V A;  2ZBW A;  3NK0 X;  3QSE A;  1OJD A;  3DK8 A;  4JNQ A;  4NTD A;  1L9C A;  3VQR A;  3CND A;  2ZZB A;  3NN6 X;  2GMJ A;  4OPC A;  4APN A;  2YAU A;  1PBF A;  1DOC A;  1L0V A;  3S5W A;  3JSK A;  3IF9 A;  3AE2 A;  5J60 A;  1B5Q A;  4N9X A;  2CFY A;  2VVL G;  4YTN A;  1K0I A;  4BK1 A;  4C3X A;  1GTH A;  4ZN0 A;  3RP7 A;  1GES A;  1EBD A;  4M52 A;  3SFE A;  4FK1 C;  3RP6 A;  3B3R A;  5JCL A;  4BV6 A;  2VZ2 A;  2YG7 A;  2WHD A;  3K7T A;  1NDA A;  2RGO A;  2R0G A;  1YQ3 A;  5FS8 A;  2PHH A;  4UP3 A;  1NEN A;  3VRD B;  2GVC A;  1COY A;  3P4Q A;  5IPY A;  4H2R A;  3ZYX A;  1GRF A;  3CNS A;  2XYO A;  4EMW A;  1H83 A;  1KFY A;  3CGD A;  4YKF A;  2HQM A;  2GEW A;  1TDE A;  3II4 A;  1ZMC A;  4ADW A;  3H8L A;  2OAM A;  4USR A;  4A7A A;  2JK6 A;  3AB1 A;  3ALJ A;  2FBW A;  4U2S A;  4GCM A;  1MOK A;  1IUS A;  3CNP A;  2GR3 A;  1CF3 A;  1LV0 A;  1CL0 A;  1NHQ A;  2WPE A;  1DJQ A;  4LA1 A;  5HHF A;  3V3O A;  2EQ7 A;  4OPU A;  1ZY8 A;  1PBD A;  2B76 A;  4P9S A;  2WOW A;  4B66 A;  1YQZ A;  4A99 A;  2GR0 A;  1MO9 A;  3ITJ A;  4NEW A;  1JNR A;  3M12 A;  4NTC A;  4YSZ A;  4YTM A;  4B68 A;  4K22 A;  2R0P A;  4C77 A;  2JBV A;  4TM3 A;  3M0O A;  2YG5 A;  4Z26 A;  1VG0 A;  1V59 A;  3NRN A;  1UKV G;  3FG2 P;  1DJN A;  4GDP A;  1TDF A;  1QO8 A;  2EQ6 A;  2Z5X A;  1PJ7 A;  4ICY A;  3QSM A;  3D8X A;  2YLZ A;  4H2P A;  4XWZ A;  4H2N A;  2TMD A;  2B7R A;  5KVH A;  3AD8 B;  3AE8 A;  1PHH A;  1O94 A;  2V3B A;  3UP5 A;  2X8G A;  3VR9 A;  1TDO A;  4A9W A;  2WP9 A;  2X99 A;  3AED A;  4H4S A;  2I0Z A;  5IQ1 A;  2Q7V A;  4NTE A;  2X8H A;  4A5L A;  1PXA A;  2C70 A;  1IJH A;  2R4E A;  2V3A A;  3ALL A;  1PS9 A;  1D7Y A;  4TM0 A;  2BS2 A;  4U8M A;  3URH A;  4OVI A;  3AE3 A;  3F8R A;  3GYI A;  2C67 A;  3DME A;  2V6O A;  5CKU A;  3Q9T A;  3UTF A;  3UKF A;  4AT0 A;  1GTE A;  1RP0 A;  4Y4N A;  3IC9 A;  4AP3 A;  2WOI A;  3AEE A;  1B4V A;  4U8N A;  4NEV A;  5DBJ A;  3UTE A;  5EOW A;  1NG3 A;  4YT0 A;  3KPF A;  1H7X A;  2C64 A;  1D5T A;  5EB4 A;  3GSI A;  2QA2 A;  3NN0 X;  3EF6 A;  4CY8 A;  1ZX9 A;  4TLX A;  2V60 A;  4J36 A;  1F3P A;  4Z2T A;  1GOS A;  4U8P A;  1Q1R A;  1AOG A;  3AXB A;  4YSX A;  3BI5 A;  3ATQ A;  3PS9 A;  2C66 A;  3EPT A;  5TR3 A;  4H4Q A;  2WES A;  2XLS A;  3OZ2 A;  4I59 A;  4JY3 A;  2BK3 A;  1X31 B;  1ZOY A;  4DNA A;  1GV4 A;  4HB9 A;  2A8X A;  3AWI A;  1Q1W A;  1B8S A;  1JRX A;  3NG7 X;  2DKH A;  1PXC A;  1Y56 B;  3CPH G;  4K7Z A;  4EIQ A;  1L9D A;  1IUX A;  1XHC A;  2V61 A;  3UP4 A;  4H2Q A;  2R46 A;  1D4D A;  2WDQ A;  3LZW A;  5IQ4 A;  2V5Z A;  1NPX A;  4A65 A;  4H4T A;  1EL7 A;  2OLN A;  3CPJ G;  4IA5 A;  4JN9 A;  4GF7 A;  1BZL A;  2WU5 A;  3FBS A;  3GRT A;  4Y4L A;  4BUR A;  5KOX A;  2WOV A;  2YR4 A;  2YG3 A;  3KKJ A;  4EQS A;  3AYJ A;  2ZZ0 A;  3EAO A;  5U25 A;  4WCT A;  2WP6 A;  3V3N A;  3G5Q A;  4Z2U A;  3FIM B;  4BK2 A;  1GND A;  4U8O A;  1NG4 A;  2GQW A;  1D4E A;  3UKH A;  4DGK A;  3AYL A;  4BJY A;  4IA6 A;  5BUK A;  3LXD A;  2JB3 A;  2XVH A;  2BXR A;  3NHO X;  4B1B A;  1D4C A;  3DGZ A;  4H4W A;  2XVI A;  3AYI A;  1GEU A;  1P2H A;  2J3N A;  1BKW A;  2GMH A;  3ICT A;  3PVC A;  4FK1 A;  1GRB A;  1XPQ A;  2BC0 A;  4C74 A;  4H4R A;  3ISH A;  4PAB A;  1Q9I A;  2WBA A;  3D1C A;  4B63 A;  3K7M X;  2XFP A;  4YSY A;  3SM8 A;  1FL2 A;  1EL5 A;  2H89 A;  1O95 A;  3DGH A;  4EIP A;  2BS4 A;  4Z43 A;  4KPR A;  1GXF A;  4TM4 A;  3KLJ A;  3FPZ A;  1TYT A;  3GD3 A;  4PAA A;  1BF3 A;  2C65 A;  4B64 A;  3L8K A;  2C7G A;  1LPF A;  1TDN A;  2YVF A;  2YLT A;  3LB8 A;  1GPE A;  1SEZ A;  2VVM A;  2EQ9 A;  2XVE A;  2XLT A;  1IUT A;  2WET A;  4J34 A;  4LU6 A;  4USQ A;  5FS7 A;  3SFD A;  2R0C A;  2GR2 A;  3AEC A;  3CN8 A;  3G5R A;  4DSG A;  4H50 A;  4EMI A;  2BAB A;  4D04 A;  3P4P A;  3R9U A;  2YLX A;  5M0Z A;  1N4W A;  1F8W A;  5KRQ A;  2XFN A;  1ZMD A;  4YWO A;  2BC1 A;  2A87 A;  1DXL A;  3DH9 A;  4FX9 A;  4YKG A;  2BK4 A;  3DK9 A;  1MXT A;  2VRM A;  4AOX A;  1FOH A;  1XDI A;  2QAE A;  2YLW A;  3ABV A;  1CJ2 A;  1S2Q A;  2XLR A;  2GB0 A;  4ZCD A;  3NYE A;  4XWR A;  3BI4 A;  3M13 A;  3VRA A;  2Y6Q A;  3NLC A;  4XXG A;  2GF3 A;  1E1N A;  4U8K A;  2VVL A;  3PO7 A;  3COX A;  3C4N A;  4REK A;  1D7L A;  1ZOV A;  4Z25 A;  2XVJ A;  3DJD A;  1RSG A;  1H7W A;  3QFA A;  1IUV A;  1K0J A;  1VG9 A;  4EM3 A;  1PBE A;  1JOA A;  2GV8 A;  2XVF A;  1S3E A;  1NHP A;  2C72 A;  3P1W A;  2YG4 A;  2CUL A;  3NNE A;  2OAL A;  2C75 A;  3GMB A;  4H4X A;  1YKJ A;  4LII A;  3WE0 A;  3NKS A;  3RED A;  1W4X A;  2YG6 A;  4A79 A;  2BS3 A;  3BNU A;  5KVI A;  2APG A;  2QA1 A;  1NHS A;  5KWF A;  1N1P A;  1FEB A;  3AE4 A;  2Y6R A;  4CRT A;  1H82 A;  3CTY A;  4OPI A;  1JNZ A;  1PDH A;  4GR1 A;  2H88 A;  1CJC A;  5BUL A;  3AEB A;  4GDE A;  5J7X A;  3BHK A;  1DOB A;  5BVA A;  4X9M A;  5FS6 A;  5JCM A;  1E1M A;  3RNM A;  1H81 A;  3O0H A;  2GAH B;  1K0L A;  1OJC A;  2JAE A;  2Z5Y A;  1QLB A;  4BJZ A;  5HYM A;  2XFO A;  4TM1 A;  1O5W A;  1RYI A;  3HZL A;  4Z44 A;  1ONF A;  1CC6 A;  4H7U A;  5U63 A;  2BCP A;  1KNP A;  5C3J A;  2RGJ A;  3B6D A;  1B37 A;  1Y56 A;  3K7Q X;  1CJ3 A;  3BHF A;  4H4Z A;  3CNJ A;  3AEA A;  3BI2 A;  2BAC A;  4A6N A;  1KSU A;  4GUV A;  1BGN A;  2JKC A;  2IVE A;  2BK5 A;  5EBK A;  4UDP A;  2TPR A;  4OPL A;  4C3Y A;  1NHR A;  4J31 A;  2DKI A;  1H6V A;  2C3D A;  2B9Y A;  2IID A;  1GRA A;  1K4Q A;  4RSL A;  2GR1 A;  1VDC A;  3L1R A;  5HY5 A;  1ZDL A;  4DSH A;  3F8P A;  4OPG A;  1F6M A;  3GMC A;  1PJ5 A;  2F5Z A;  4K5S A;  4H4P A;  4J57 A;  4B67 A;  4YXD A;  2WP5 A;  3LAD A;  1S2Y A;  3GD4 A;  2X8C A;  3LJP A;  1Z6L A;  3AE6 A;  4J33 A;  1NAA A;  4JQ9 A;  2E1M A;  1E1L A;  2YM2 A;  4EQW A;  1IUW A;  3IHM A;  1CC2 A;  1JU2 A;  1KDG A;  2UZZ A;  2WS3 A;  3NTA A;  1VRQ B;  2YR5 A;  1KNR A;  2FJE A;  5GSN A;  4YSH A;  1LTX R;  5GRT A;  3NGC X;  3KD9 A;  1PBB A;  3CIR A;  1NEK A;  1HYU A;  4BK3 A;  1PBC A;  1LQU A;  2C76 A;  4IV9 A;  4B65 A;  3UOZ A;  2NVK X;  1GSN A;  2WEU A;  1DOE A;  2EQ8 A;  4OCG A;  2R9Z A;  3K30 A;  2RAB A;  2NPX A;  4X4J A;  1REO A;  3CGB A;  1JRZ A;  1GRH A;  4EM4 A;  1ELI A;  1GER A;  4K5R A;  5M10 A;  3C4A A;  3NH3 X;  2ZZC A;  2AR8 A;  5EB5 A;  4U2T A;  3AEF A;  3E1T A;  2FJB A;  1M6I A;  2CDU A;  3CGC A;  3QFB A;  3ALM A;  3NTD A;  5CQF A;  3UKP A;  1M64 A;  2Q6U A;  3OC4 A;  1F8S A;  3NK1 X;  1H84 A;  3IHG A;  2R45 A;  3GWD A;  3UTH A;  1GRT A;  2X50 A;  1PXB A;  4K2X A;  4WX1 A;  3UOV A;  4Z2R A;  3KVE A;  2B7S A;  1ZKQ A;  4NZH A;  2ARD A;  2WDV A;  5LV9 A;  2QCU A;  3EAN A;  1IUU A;  2WQY A;  4I58 A;  3AEG A;  2XFQ A;  3AE5 A;  1YY5 A;  4C5O A;  1GRG A;  2XLP A;  1GRE A;  3LOV A;  4AOS A;  4U8I A;  4AT2 A;  4UDR A;  1E6E A;  5L46 A;  5BRT A;  1N4V A;  3I6D A;  2JB1 A;  2BXS A;  3BNM A;  1KF6 A;  5U1O A;  1F8R A;  3RHA A;  4CCR A;  2B9X A;  4RG4 A;  3C96 A;  2OA1 A;  4IVO B;  2Q0L A;  3IWA A;  4CCQ A;  1S3B A; 
#chains in the Genus database with same CATH topology
 2YM1 A;  3DK4 A;  4A35 A;  5FS9 A;  2YLR A;  1CHU A;  4CNK A;  3I3L A;  1JRY A;  3UKL A;  4U8L A;  1Y0P A;  2BYB A;  2YVJ A;  1DNC A;  3S47 A;  3GDP A;  4U8J A;  3VCN A;  1YQ4 A;  3UKA A;  2OKT A;  3UTG A;  2YLS A;  1E7P A;  3FMW A;  3Q6J A;  2PTX A;  4A6N B;  3ICS A;  1LQT A;  1STZ A;  3P4S A;  2XLU A;  1JEH A;  3MKC A;  4AP1 A;  5FMH A;  2OLA A;  4HCD A;  4EQR A;  2IVD A;  2CVJ A;  2XCG A;  2VOU A;  4HCH A;  2WPC A;  3CPI G;  5FJT A;  2BCG G;  3QVP A;  2XSX A;  2XFU A;  1QJD A;  2DW6 A;  1BQG A;  4KX6 A;  3H8I A;  3GWF A;  1FHU A;  1R6W A;  1MRA A;  1CC4 A;  2WDR A;  4MJW A;  1SJB A;  4K8D A;  2FKP A;  1FCD A;  2O56 A;  4CY6 A;  3T9P A;  3TCS A;  2XDO A;  3NYF A;  1FEA A;  3UKQ A;  3SZ0 A;  5JCN A;  2GAG B;  2ZBW A;  3NK0 X;  1OJD A;  4JNQ A;  3RGT A;  3CND A;  1L0V A;  4GFI A;  3DEQ A;  1B5Q A;  3A7U A;  2VVL G;  3DG7 A;  3CXO A;  1GTH A;  1KKR A;  4M52 A;  1JCT A;  2YG7 A;  2GGH A;  3K7T A;  1PDZ A;  5FS8 A;  2GVC A;  3P4Q A;  4X2P A;  3VDG A;  3H70 A;  3CGD A;  1TDE A;  3OZY A;  2FBW A;  1FIQ B;  2OO6 A;  4GCM A;  4U2S A;  3NZG A;  1CF3 A;  1LV0 A;  1DJQ A;  1ELS A;  4II2 A;  4G73 A;  3ITJ A;  3IJQ A;  4NEW A;  1JNR A;  4NTC A;  3UXK A;  2YG5 A;  4Z26 A;  4ENL A;  3FG2 P;  2Z5X A;  4A3R A;  4Z1Y A;  3UJS A;  3UP5 A;  2PGW A;  4E6M A;  1OEP A;  1PXA A;  3ALL A;  2V3A A;  1PS9 A;  4TM0 A;  5ENL A;  4U8M A;  5EU9 A;  3ES7 A;  2C67 A;  3DME A;  2V6O A;  3Q9T A;  3TQP A;  1GTE A;  4U8N A;  3AEE A;  3UTE A;  1NEL A;  3KPF A;  4TLX A;  4U8P A;  2OVL A;  3BI5 A;  1SJC A;  3ATQ A;  2C66 A;  4H4Q A;  2WES A;  3OZ2 A;  4M6U A;  3R1Z A;  1PXC A;  3CPH G;  1L9D A;  3UP4 A;  2WDQ A;  1D4D A;  4A65 A;  4H4T A;  3CPJ G;  3DIP A;  2P3Z A;  1BZL A;  3GRT A;  2YG3 A;  4DN1 A;  4MKS A;  2BRY A;  4Z2U A;  1H2I A;  1W6T A;  4BK2 A;  4MGG A;  2GQW A;  1D4E A;  3AN1 A;  4B1B A;  1V97 A;  4H4W A;  2PTZ A;  3MY9 A;  4GIR A;  2XVI A;  1GEU A;  3AYI A;  2J3N A;  4J1O A;  1FL2 A;  1EL5 A;  3UJ2 A;  4Z43 A;  3ETR B;  4KPR A;  4IP4 A;  3FPZ A;  1TYT A;  1ZXI C;  3GD3 A;  3NVW B;  3ZVH A;  1LPF A;  1P48 A;  3LB8 A;  1SEZ A;  2EQ9 A;  4USQ A;  4GGH A;  2R0C A;  3AEC A;  2P88 A;  4D04 A;  3R9U A;  5M0Z A;  1KCZ A;  1ZMD A;  2A87 A;  3STP A;  1KD0 A;  3L5O A;  2GB0 A;  4ZCD A;  2HNE A;  3VRA A;  4G7F A;  3BI4 A;  2OPJ A;  3PO7 A;  4Z25 A;  1RSG A;  3TW9 A;  1PBE A;  1NHP A;  2YG4 A;  2OAL A;  4IL2 A;  4JN8 A;  3RED A;  5KWF A;  1NHS A;  3AE4 A;  4OPI A;  1PDH A;  4GR1 A;  5BUL A;  3AEB A;  4GDE A;  1SJA A;  1H81 A;  1K0L A;  2GDQ A;  3T4W A;  4Z44 A;  3ES8 A;  2RGJ A;  3B6D A;  3AEA A;  1KSU A;  4GUV A;  1NHR A;  4J31 A;  1H6V A;  3NVY B;  4ZOH B;  4OPG A;  1X2G A;  1WUF A;  1PJ5 A;  4K5S A;  4J57 A;  5BOE A;  3LAD A;  3GD4 A;  4J33 A;  3AE6 A;  4JQ9 A;  2E1M A;  2GGE A;  3V5C A;  3IHM A;  2WS3 A;  2YR5 A;  1KNR A;  5GSN A;  3R0U A;  5GRT A;  1PBB A;  1HYU A;  1LQU A;  4IP5 A;  3UOZ A;  1GSN A;  2EQ8 A;  4OCG A;  2RAB A;  2HXU A;  4E4F A;  3DDM A;  3THU A;  3V4B A;  3NH3 X;  2ZZC A;  2AR8 A;  3ALM A;  3NTD A;  3UJE A;  3VA8 A;  1F8S A;  3I6E A;  3UTH A;  1PXB A;  4K2X A;  4WX1 A;  2B7S A;  1ZKQ A;  2ARD A;  2QDE A;  2WDV A;  3UXL A;  4TVY A;  3JW7 A;  4I58 A;  2XFQ A;  4C5O A;  3EUB 3;  1GRG A;  3LOV A;  1GRE A;  5BRT A;  1N63 C;  2BXS A;  4IL0 A;  4DXK A;  2OZT A;  2QJJ A;  4CCQ A;  4KEM A;  2W55 A;  3LZX A;  3AE9 A;  2C73 A;  1VQW A;  3AE7 A;  4B69 A;  1TRB A;  2FJA A;  3ATR A;  3RP8 A;  4TLZ A;  4Z24 A;  3V76 A;  1EC9 A;  2VQB A;  2WPF A;  3VRB A;  1EL9 A;  2AAQ A;  3NYC A;  3UOX A;  3DJJ A;  2C3C A;  5KOW A;  4EMJ A;  3ADA B;  2X3N A;  4M0X A;  2PTY A;  3P3B A;  1E1K A;  3SGL A;  4CNJ A;  1GAL A;  3MZN A;  3SZW A;  3NT6 A;  3KA7 A;  1OJA A;  4JDR A;  4H83 A;  1SB3 B;  3DA1 A;  1BWC A;  4JHM A;  3SN4 A;  3QJ4 A;  4JY2 A;  4RG3 A;  3BSM A;  3PG6 A;  5KXJ A;  3ZVI A;  2YVG A;  1BGJ A;  1H86 A;  1EL8 A;  4H4U A;  2O9Z A;  3DJE A;  3P9U A;  3CB3 A;  3UOY A;  4G9K A;  2YR6 A;  4GAP A;  1OJT A;  2R4J A;  2FJD A;  4IVM B;  2PU0 A;  1KSS A;  2I5Q A;  2E5V A;  3QSE A;  2YAU A;  3IF9 A;  3AE2 A;  4HNL A;  4HN8 A;  4BK1 A;  4ZN0 A;  2PP0 A;  1EBD A;  3SFE A;  3SX6 A;  3B3R A;  1MNS A;  2R0G A;  4UP3 A;  2AL2 A;  1COY A;  3CNS A;  2XYO A;  1H83 A;  2HQM A;  3SXI A;  3II4 A;  4ADW A;  3H8L A;  3HW2 A;  4HNC A;  4USR A;  5IDZ A;  3AB1 A;  3MUC A;  3I4K A;  3CNP A;  2GR3 A;  1CL0 A;  2WPE A;  4LA1 A;  3SN0 A;  2EQ7 A;  4OPU A;  1ZY8 A;  1MO9 A;  4YSZ A;  3M12 A;  4K22 A;  2R0P A;  4C77 A;  2JBV A;  1N5X A;  1EC8 A;  1VG0 A;  1QO8 A;  1PJ7 A;  3QSM A;  3VFC A;  3D8X A;  2TMD A;  2B7R A;  5KVH A;  3AE8 A;  1PHH A;  2QJN A;  1O94 A;  2V3B A;  3HRD C;  2P8B A;  1TDO A;  4A9W A;  3MWC A;  4H4S A;  4NTE A;  1MDL A;  3TJI A;  1D7Y A;  2BS2 A;  4OVI A;  3AE3 A;  4AT0 A;  5CKU A;  4Y4N A;  5DBJ A;  4NEV A;  3GYX A;  2C64 A;  3SBF A;  2XH4 A;  5EB4 A;  3NN0 X;  3EF6 A;  3T2K A;  4CY8 A;  1F3P A;  4Z2T A;  3T6C A;  1GOS A;  3CMM A;  3N4E A;  3PS9 A;  2XLS A;  1L8P A;  4DNA A;  1GV4 A;  1JRX A;  1Y56 B;  2OQH A;  1IUX A;  4H2Q A;  2R46 A;  2V5Z A;  1EL7 A;  2XH0 A;  4GF7 A;  4GGB A;  3T14 A;  1FHV A;  4Y4L A;  5KOX A;  2RDX A;  3AYJ A;  3DGB A;  4H2H A;  4ROP A;  2PSN A;  3V3N A;  3G5Q A;  4DGK A;  3AYL A;  4IA6 A;  5BUK A;  1N61 C;  4FK1 A;  1GRB A;  3MSY A;  2BC0 A;  4C74 A;  2MUC A;  4H4R A;  3ISH A;  4PAB A;  2XFP A;  4YSY A;  1O95 A;  4EIP A;  3FYY A;  2BS4 A;  1BF3 A;  2XLT A;  4LU6 A;  2QQ6 A;  3QTP A;  3SFD A;  3PK7 A;  3FVD A;  3P4P A;  2QVH A;  3SYI A;  2YLX A;  1F8W A;  4YKG A;  4FX9 A;  4E8G A;  3U9I A;  1MXT A;  4DWD A;  4JN7 A;  2W3S A;  4KWS A;  2YLW A;  1CJ2 A;  2PMQ A;  3NLC A;  4XXG A;  3T2Z A;  3QFA A;  1VG9 A;  4EM3 A;  1JOA A;  2XVF A;  2C72 A;  3WE0 A;  3OPS A;  2YG6 A;  2QA1 A;  1N1P A;  3CTY A;  1JNZ A;  1CJC A;  3P0W A;  3BHK A;  5BVA A;  4X9M A;  5FS6 A;  1KKO A;  1E1M A;  3RNM A;  1EBH A;  3O0H A;  1OJC A;  2Z5Y A;  4KPL A;  1O5W A;  1ONF A;  5C3J A;  2FYM A;  3T0K A;  3RR1 A;  3BI2 A;  2BAC A;  2JKC A;  2IVE A;  3NRZ B;  3BOX A;  2GR1 A;  4DSH A;  3FXG A;  3T8Q A;  3F8P A;  4IHC A;  2F5Z A;  4H4P A;  4B67 A;  3SQS A;  4GIS A;  2YM2 A;  1IUW A;  5G5G B;  1VRQ B;  4G8T A;  3SZC A;  3KD9 A;  3CT2 A;  1PBC A;  4IV9 A;  4GYP C;  1N62 C;  2PP3 A;  4EM4 A;  1ELI A;  1GER A;  4K5R A;  4U2T A;  2FJB A;  3OC4 A;  1E9I A;  4K2S A;  3IHG A;  3GWD A;  1GRT A;  2X50 A;  2QGY A;  3KVE A;  4FI4 A;  1ECQ A;  2QCU A;  1IUU A;  2XLP A;  1JPM A;  1NU5 A;  4AT2 A;  1E6E A;  5G5H B;  1KF6 A;  3RHA A;  3C96 A;  3N6H A;  3IWA A;  1S3B A;  3OW1 A;  3NVV B;  2B9W A;  5JCI A;  2OLO A;  4F4R A;  5BOF A;  4CBQ A;  4OPD A;  4GME A;  3CNT A;  4ZCC A;  2A89 A;  1YEY A;  3MQT A;  1ONE A;  3GDN A;  3NS1 B;  2W0H A;  1PN0 A;  3N4F A;  2AL2 B;  5ER0 A;  4O5Q A;  4GYP A;  3GYJ A;  5JCK A;  4UDQ A;  4Y4M A;  2VRL A;  4ZA0 A;  3NXL A;  3HYV A;  4X9N A;  3CK5 A;  1E39 A;  1LVL A;  3TJ4 A;  2VQ7 A;  2OQY A;  3UCC A;  3P4R A;  7ENL A;  3N6J A;  4DHG A;  1TDK A;  4HA6 A;  3GRS A;  3KUM A;  3PFR A;  4JNA A;  1P2E A;  3ZDN A;  4G6G A;  3IJL A;  3UKK A;  3QSS A;  4ECH A;  2W54 A;  2AQJ A;  1GET A;  1XAN A;  3H4K A;  2ACZ A;  2OZ8 A;  3AD7 B;  3AD9 B;  2GL5 A;  2GH5 A;  1RM6 B;  3OTR A;  3ZLH A;  4IZG A;  1L9C A;  3NN6 X;  4OPC A;  1PBF A;  2AL1 A;  2GGI A;  3JSK A;  3QN3 A;  2GGJ A;  3DFY A;  4N9X A;  2CFY A;  1K0I A;  3Q4D A;  4HCL A;  3RP7 A;  3IK4 A;  3RP6 A;  4BV6 A;  2VZ2 A;  2WHD A;  2PHH A;  3SN1 A;  4H2R A;  4EMW A;  1KFY A;  4ZCW A;  1ZMC A;  2OAM A;  5FJP A;  1KN0 A;  2E3T A;  3B97 A;  1IUS A;  1NHQ A;  5HHF A;  1PBD A;  1YQZ A;  2GR0 A;  1RVK A;  3TTE A;  4YTM A;  4B68 A;  3FJ4 A;  4TM3 A;  3M0O A;  1V59 A;  3NRN A;  1UKV G;  1DJN A;  3FV9 A;  3QKE A;  2EQ6 A;  4ICY A;  3SY4 A;  4H2P A;  3R0K A;  4XWZ A;  4H2N A;  3FCP A;  4GAV A;  3VR9 A;  2BRA A;  2X99 A;  2ONE A;  4YWS A;  4A5L A;  4EWJ A;  2C70 A;  2R4E A;  2AKZ A;  4Z17 A;  3UTF A;  3GYI A;  4AP3 A;  1JPD X;  1NG3 A;  3CYJ A;  3SSZ A;  1ZX9 A;  2V60 A;  3GC2 A;  4YSX A;  3DER A;  4JY3 A;  3EPT A;  5TR3 A;  3ENL A;  1P43 A;  2MNR A;  2CHR A;  1B8S A;  3DFH A;  2DKH A;  4EIQ A;  2GGG A;  2V61 A;  1PDY A;  3LZW A;  5IQ4 A;  1N5W C;  1NPX A;  4JN9 A;  2OLN A;  3FBS A;  2YR4 A;  1FFU C;  4EQS A;  1TZZ A;  3EAO A;  5U25 A;  3ZVH B;  1GND A;  4U8O A;  3UKH A;  2W3R A;  3LXD A;  3DGZ A;  2GSH A;  1BKW A;  2GMH A;  3ICT A;  3D1C A;  2PU1 A;  3K7M X;  3SM8 A;  2H89 A;  4TM4 A;  3KLJ A;  3R25 A;  4B64 A;  2YLT A;  2VVM A;  1GPE A;  2XVE A;  6ENL A;  4NNJ A;  1IUT A;  2WET A;  5KMQ A;  5FS7 A;  2GR2 A;  4H50 A;  4G6H A;  1XS2 A;  3DH9 A;  2BK4 A;  1WUE A;  4MMW A;  2XLR A;  4XWR A;  3M13 A;  2Y6Q A;  1E1N A;  3VC6 A;  2VVL A;  3S5S A;  1H7W A;  1IUV A;  3NNE A;  2C75 A;  3GMB A;  4H4X A;  1YKJ A;  3NVZ B;  4A79 A;  3BNU A;  1FEB A;  2Y6R A;  4CRT A;  1H82 A;  1WYG A;  2H88 A;  5J7X A;  1DOB A;  3BJS A;  5JCM A;  2GAH B;  1QLB A;  2XFO A;  4TM1 A;  1RYI A;  3HZL A;  4H7U A;  5U63 A;  2BCP A;  1Y56 A;  3BHF A;  4H4Z A;  3CNJ A;  4A6N A;  1BGN A;  4OPL A;  4C3Y A;  2DKI A;  2C3D A;  1GRA A;  3DG6 A;  1ZDL A;  3GD6 A;  1F6M A;  3GMC A;  3JZU A;  2PGE A;  2WP5 A;  3TWA A;  3LJP A;  1NAA A;  1E1L A;  4EQW A;  1CC2 A;  2UZZ A;  2HXT A;  4YSH A;  3TWB A;  2WEU A;  3UJF A;  1REO A;  3CGB A;  3A7R A;  3SR6 B;  5M10 A;  3C4A A;  5EB5 A;  4DX3 A;  3E1T A;  3UKP A;  2CDU A;  3QFB A;  1M64 A;  2Q6U A;  3NK1 X;  1H84 A;  2R45 A;  1R0M A;  3ZLF A;  2WQY A;  3AE5 A;  3RIT A;  1YY5 A;  4AOS A;  2PS2 A;  4UDR A;  5L46 A;  1N4V A;  4G74 A;  2HZG A;  5U1O A;  2B9X A;  3RRA A;  2Q0L A;  4DYE A;  3JVA A;  2PYX A;  3KU9 A;  4GRT A;  1DOD A;  4K8G A;  2YQU A;  3T37 A;  3CGE A;  4H19 A;  1JRP A;  2GRT A;  4O5U A;  2JB2 A;  5HXI A;  4H4V A;  1XPY A;  3CAW A;  3NK2 X;  2E4G A;  4HYR A;  4H4Y A;  1F9C A;  4J2W A;  2E5A A;  3UCD A;  3DG3 A;  3HYX A;  4OPT A;  3QVR A;  4YTP A;  3ICR A;  1CBO A;  3B9J B;  4J56 A;  1FEC A;  3AE1 A;  3DJG X;  3OZM A;  1OJ9 A;  3AMZ A;  3VR8 A;  4U2L A;  3T2Y A;  4E0V A;  3F8D A;  1ZK7 A;  4D03 A;  1DTN A;  1TYP A;  4A6G A;  1PJ6 A;  1FFV C;  3SQP A;  2WU2 A;  2YWL A;  2POD A;  4IT1 A;  3UCL A;  3VCC A;  4E5T A;  2GQF A;  2RGH A;  1CJ4 A;  1N4U A;  2BA9 A;  5C2T A;  3TOY A;  1L9E A;  2Q0K A;  3G5S A;  2AKM A;  4EQX A;  4FDC B;  3NIX A;  1LJ1 A;  1GT8 A;  4NWZ A;  1ZP0 A;  3CXB A;  3S61 A;  3Q45 A;  3DK8 A;  4NTD A;  5KNL A;  3VQR A;  2ZZB A;  2GMJ A;  1TE6 A;  4APN A;  5KMS A;  1DOC A;  3S5W A;  2XH7 A;  5J60 A;  4YTN A;  4C3X A;  1GES A;  4FK1 C;  5JCL A;  1NDA A;  2RGO A;  1YQ3 A;  2PTW A;  1NEN A;  3VRD B;  3UJR A;  5IPY A;  3ZYX A;  1GRF A;  1S7M A;  1T3Q C;  3NFU A;  4YKF A;  3H8A A;  2GEW A;  4K1W A;  2OG9 A;  3R07 C;  4A7A A;  2JK6 A;  3ALJ A;  1MOK A;  5J04 A;  1FO4 A;  2PP1 A;  3V3O A;  4P9S A;  2B76 A;  4B66 A;  2WOW A;  4A99 A;  1MUC A;  3KPK A;  2QJM A;  3H12 A;  4GDP A;  1TDF A;  1MDR A;  2YLZ A;  3AD8 B;  2X8G A;  2WP9 A;  2POZ A;  3AED A;  2I0Z A;  5IQ1 A;  2Q7V A;  2X8H A;  3P93 A;  3D46 A;  1IJH A;  3URH A;  3T31 A;  3F8R A;  2C4C A;  2QDD A;  3UKF A;  1RP0 A;  3IC9 A;  2WOI A;  1B4V A;  5EOW A;  4YT0 A;  3A7A A;  1H7X A;  1VDV A;  3QLD A;  1D5T A;  2DW7 A;  3GSI A;  2QA2 A;  4J36 A;  3PWG A;  1Q1R A;  1AOG A;  3AXB A;  4H1Z A;  4I59 A;  2BK3 A;  1X31 B;  1ZOY A;  4HB9 A;  2A8X A;  3AWI A;  5FJO A;  1Q1W A;  3NG7 X;  4K7Z A;  3D9X A;  1XHC A;  4IA5 A;  2OZ3 A;  2WU5 A;  4BUR A;  2WOV A;  3KKJ A;  2ZZ0 A;  4WCT A;  2WP6 A;  3FIM B;  1NG4 A;  3ZLG A;  4BJY A;  1VQZ A;  2JB3 A;  2XVH A;  2BXR A;  3NHO X;  1D4C A;  1JDF A;  3DES A;  1P2H A;  3PVC A;  1XPQ A;  1Q9I A;  2WBA A;  1EC7 A;  5JRB A;  4B63 A;  1IYX A;  2XGZ A;  3QPE A;  3DGH A;  1GXF A;  1N60 C;  3R11 A;  2OX4 A;  4PAA A;  2C65 A;  3L8K A;  4HPN A;  2C7G A;  1TDN A;  2YVF A;  2P0I A;  3D47 A;  4J34 A;  1JRO A;  1SJD A;  3PWI A;  2ZAD A;  3CN8 A;  3G5R A;  4DSG A;  4EMI A;  2BAB A;  3UGV A;  3VC5 A;  2ZC8 A;  1N4W A;  5KRQ A;  2XFN A;  4YWO A;  2BC1 A;  1DXL A;  3NO1 A;  3DK9 A;  5KMP A;  2VRM A;  4AOX A;  1FOH A;  1XDI A;  3OP2 A;  2QAE A;  3ABV A;  2PPG A;  1S2Q A;  3NYE A;  2PCE A;  2GF3 A;  4U8K A;  3U4F A;  3C4N A;  3COX A;  4REK A;  3AM9 A;  3GO2 A;  3R10 A;  1D7L A;  1ZOV A;  2XVJ A;  3DJD A;  1K0J A;  1EBG A;  3P1W A;  2GV8 A;  1S3E A;  2CUL A;  5FJR A;  3EEZ A;  4LII A;  3NKS A;  4FP1 A;  1W4X A;  2BS3 A;  5KVI A;  2APG A;  1BKH A;  3I6T A;  3V5F A;  2JAE A;  3HYW A;  4BJZ A;  3SZF A;  5HYM A;  4J3Z A;  4II3 A;  1CC6 A;  1KNP A;  1B37 A;  3K7Q X;  1CJ3 A;  5KMR A;  2PA6 A;  2XH2 A;  2BK5 A;  5EBK A;  4KT2 A;  4UDP A;  2TPR A;  2B9Y A;  2IID A;  4RSL A;  1K4Q A;  1VDC A;  3L1R A;  5HY5 A;  3SJN A;  5FJU A;  4YXD A;  1S2Y A;  2P8C A;  2X8C A;  1Z6L A;  3GY1 A;  2OFJ A;  3HPF A;  1X2H A;  1JU2 A;  1KDG A;  3NTA A;  2FJE A;  1LTX R;  4E4U A;  3NGC X;  4TVW A;  1NEK A;  3EKG A;  3CIR A;  4BK3 A;  2C76 A;  4B65 A;  3IJI A;  2NVK X;  3K1G A;  1DOE A;  2R9Z A;  3K30 A;  2NPX A;  4X4J A;  1JRZ A;  1GRH A;  3AEF A;  1M6I A;  5CQF A;  3CGC A;  3UOV A;  4Z2R A;  3H7V A;  4NZH A;  1TKK A;  5LV9 A;  3EAN A;  3AEG A;  2NQL A;  3RO6 A;  4U8I A;  3I6D A;  2JB1 A;  3BNM A;  1F8R A;  3RCY A;  4CCR A;  4RG4 A;  3V3W A;  2OA1 A;  4IVO B; 
#chains in the Genus database with same CATH homology
 2PYX A;  2B9W A;  5JCI A;  3LZX A;  2OLO A;  3AE9 A;  3KU9 A;  2C73 A;  2YM1 A;  1VQW A;  4GRT A;  1DOD A;  3AE7 A;  4B69 A;  4CBQ A;  1TRB A;  3DK4 A;  4OPD A;  2FJA A;  2YQU A;  3T37 A;  3CNT A;  3CGE A;  3ATR A;  4ZCC A;  2A89 A;  3RP8 A;  4TLZ A;  4Z24 A;  3V76 A;  2GRT A;  2VQB A;  2WPF A;  3VRB A;  5FS9 A;  1EL9 A;  4O5U A;  2AAQ A;  2YLR A;  3NYC A;  2JB2 A;  1CHU A;  5HXI A;  3UOX A;  3GDN A;  4CNK A;  4H4V A;  3I3L A;  3DJJ A;  2C3C A;  5KOW A;  1JRY A;  3NK2 X;  2W0H A;  4EMJ A;  1PN0 A;  3ADA B;  2X3N A;  2E4G A;  3UKL A;  4U8L A;  1Y0P A;  1E1K A;  2BYB A;  2YVJ A;  1DNC A;  3GDP A;  5ER0 A;  4U8J A;  4O5Q A;  4H4Y A;  1YQ4 A;  3UKA A;  3UTG A;  2YLS A;  4J2W A;  1E7P A;  3GYJ A;  5JCK A;  3FMW A;  3SGL A;  3Q6J A;  4CNJ A;  4UDQ A;  3HYX A;  4OPT A;  4Y4M A;  4A6N B;  2VRL A;  3ICS A;  1GAL A;  3QVR A;  4YTP A;  3HYV A;  4X9N A;  1LQT A;  1E39 A;  3ICR A;  1CBO A;  3P4S A;  1LVL A;  1JEH A;  2XLU A;  4J56 A;  1FEC A;  3SZW A;  4AP1 A;  3AE1 A;  3DJG X;  5FMH A;  3NT6 A;  2VQ7 A;  4EQR A;  3KA7 A;  2CVJ A;  2IVD A;  2XCG A;  2VOU A;  1OJ9 A;  1OJA A;  3VR8 A;  3P4R A;  4JDR A;  4U2L A;  2WPC A;  3T2Y A;  4E0V A;  3F8D A;  3DA1 A;  1BWC A;  1TDK A;  3CPI G;  3QJ4 A;  4HA6 A;  2BCG G;  3QVP A;  4JY2 A;  4RG3 A;  1ZK7 A;  4D03 A;  3GRS A;  3PG6 A;  1TYP A;  2XFU A;  1QJD A;  4JNA A;  1P2E A;  1PJ6 A;  4KX6 A;  3H8I A;  3SQP A;  5KXJ A;  2WU2 A;  3GWF A;  2YWL A;  2YVG A;  3ZDN A;  1BGJ A;  1CC4 A;  1H86 A;  1EL8 A;  4G6G A;  3UCL A;  4H4U A;  3UKK A;  2O9Z A;  3QSS A;  3DJE A;  2GQF A;  2WDR A;  4ECH A;  4MJW A;  3P9U A;  2AQJ A;  2RGH A;  4K8D A;  1GET A;  1CJ4 A;  1N4U A;  1XAN A;  3H4K A;  2BA9 A;  5C2T A;  1FCD A;  2ACZ A;  1L9E A;  3AD7 B;  3AD9 B;  3UOY A;  4G9K A;  4CY6 A;  2Q0K A;  3G5S A;  2YR6 A;  2GH5 A;  4EQX A;  2XDO A;  3NYF A;  4FDC B;  1OJT A;  2R4J A;  3NIX A;  4GAP A;  1FEA A;  2FJD A;  4IVM B;  1LJ1 A;  1GT8 A;  4NWZ A;  3UKQ A;  3SZ0 A;  1ZP0 A;  3S61 A;  5JCN A;  1KSS A;  2GAG B;  2E5V A;  2ZBW A;  3NK0 X;  3QSE A;  1OJD A;  3DK8 A;  4JNQ A;  4NTD A;  5KNL A;  1L9C A;  3VQR A;  3CND A;  2ZZB A;  3NN6 X;  2GMJ A;  4OPC A;  4APN A;  2YAU A;  1PBF A;  5KMS A;  1DOC A;  1L0V A;  3S5W A;  3JSK A;  3IF9 A;  3AE2 A;  5J60 A;  1B5Q A;  4N9X A;  2CFY A;  2VVL G;  4YTN A;  1K0I A;  4BK1 A;  4C3X A;  1GTH A;  4ZN0 A;  3RP7 A;  1GES A;  1EBD A;  4M52 A;  3SFE A;  4FK1 C;  3RP6 A;  3SX6 A;  3B3R A;  5JCL A;  4BV6 A;  2VZ2 A;  2YG7 A;  2WHD A;  3K7T A;  1NDA A;  2RGO A;  2R0G A;  1YQ3 A;  5FS8 A;  2PHH A;  4UP3 A;  1NEN A;  3VRD B;  2GVC A;  1COY A;  3P4Q A;  5IPY A;  4H2R A;  3ZYX A;  1GRF A;  1S7M A;  2XYO A;  3CNS A;  4EMW A;  1H83 A;  1KFY A;  3CGD A;  4YKF A;  2HQM A;  2GEW A;  3SXI A;  1TDE A;  3II4 A;  1ZMC A;  4ADW A;  3H8L A;  2OAM A;  4USR A;  4A7A A;  2JK6 A;  3AB1 A;  3ALJ A;  3UTF A;  1KN0 A;  2FBW A;  4U2S A;  4GCM A;  1MOK A;  1IUS A;  3CNP A;  2GR3 A;  1CF3 A;  1LV0 A;  1CL0 A;  1NHQ A;  2WPE A;  1DJQ A;  4LA1 A;  5HHF A;  3V3O A;  4II2 A;  2EQ7 A;  4OPU A;  1ZY8 A;  1PBD A;  2B76 A;  4G73 A;  2WOW A;  4P9S A;  4B66 A;  1YQZ A;  4A99 A;  2GR0 A;  1MO9 A;  3ITJ A;  4NEW A;  1JNR A;  3M12 A;  4NTC A;  4YSZ A;  3KPK A;  4YTM A;  4B68 A;  4K22 A;  2R0P A;  4C77 A;  2JBV A;  4TM3 A;  3M0O A;  2YG5 A;  4Z26 A;  1VG0 A;  1V59 A;  3NRN A;  1UKV G;  3FG2 P;  1DJN A;  4GDP A;  1TDF A;  1QO8 A;  2EQ6 A;  2Z5X A;  1PJ7 A;  4ICY A;  3QSM A;  3D8X A;  2YLZ A;  4H2P A;  4XWZ A;  3SY4 A;  4H2N A;  2TMD A;  2B7R A;  5KVH A;  3AD8 B;  4GAV A;  3AE8 A;  1PHH A;  1O94 A;  2V3B A;  3UP5 A;  2X8G A;  3VR9 A;  1TDO A;  4A9W A;  2BRA A;  2WP9 A;  2X99 A;  3AED A;  4H4S A;  2I0Z A;  5IQ1 A;  2Q7V A;  4NTE A;  2X8H A;  4A5L A;  1PXA A;  2C70 A;  1IJH A;  2R4E A;  2V3A A;  3ALL A;  1PS9 A;  1D7Y A;  4TM0 A;  2BS2 A;  4U8M A;  3URH A;  4OVI A;  3AE3 A;  3F8R A;  3GYI A;  2C67 A;  3DME A;  2V6O A;  2C4C A;  3Q9T A;  5CKU A;  3T31 A;  3UKF A;  4AT0 A;  1GTE A;  1RP0 A;  4Y4N A;  3IC9 A;  4AP3 A;  2WOI A;  3AEE A;  1B4V A;  4U8N A;  4NEV A;  5DBJ A;  3UTE A;  5EOW A;  1NG3 A;  4YT0 A;  3KPF A;  3GYX A;  1H7X A;  2C64 A;  1D5T A;  5EB4 A;  3GSI A;  2QA2 A;  3NN0 X;  3EF6 A;  3T2K A;  1ZX9 A;  4TLX A;  4CY8 A;  2V60 A;  4J36 A;  1F3P A;  4Z2T A;  1GOS A;  3CMM A;  4U8P A;  1Q1R A;  1AOG A;  3AXB A;  4YSX A;  3BI5 A;  3ATQ A;  3PS9 A;  2C66 A;  3EPT A;  5TR3 A;  4H4Q A;  2WES A;  2XLS A;  3OZ2 A;  4I59 A;  4JY3 A;  2BK3 A;  1X31 B;  1ZOY A;  4DNA A;  1GV4 A;  4HB9 A;  2A8X A;  3AWI A;  1Q1W A;  1B8S A;  1JRX A;  3NG7 X;  2DKH A;  1PXC A;  1Y56 B;  3CPH G;  4K7Z A;  4EIQ A;  1L9D A;  3D9X A;  1IUX A;  1XHC A;  2V61 A;  3UP4 A;  4H2Q A;  2R46 A;  1D4D A;  2WDQ A;  3LZW A;  5IQ4 A;  2V5Z A;  1NPX A;  4A65 A;  4H4T A;  1EL7 A;  2OLN A;  3CPJ G;  4IA5 A;  4JN9 A;  4GF7 A;  1BZL A;  2WU5 A;  3FBS A;  3GRT A;  3T14 A;  4Y4L A;  4BUR A;  5KOX A;  2WOV A;  2YR4 A;  2YG3 A;  3KKJ A;  4EQS A;  3AYJ A;  2ZZ0 A;  3EAO A;  5U25 A;  4WCT A;  2WP6 A;  3V3N A;  3G5Q A;  2BRY A;  4Z2U A;  1H2I A;  3FIM B;  4BK2 A;  1GND A;  4U8O A;  1NG4 A;  2GQW A;  1D4E A;  3UKH A;  4DGK A;  3AYL A;  4BJY A;  4IA6 A;  5BUK A;  3LXD A;  2JB3 A;  2XVH A;  2BXR A;  3NHO X;  4B1B A;  1D4C A;  3DGZ A;  4H4W A;  2XVI A;  3AYI A;  1GEU A;  1P2H A;  2J3N A;  1BKW A;  2GMH A;  3ICT A;  3PVC A;  4FK1 A;  1GRB A;  1XPQ A;  2BC0 A;  4C74 A;  4H4R A;  3ISH A;  4PAB A;  1Q9I A;  2WBA A;  3D1C A;  5JRB A;  4B63 A;  3K7M X;  2XFP A;  4YSY A;  3SM8 A;  1FL2 A;  1EL5 A;  2H89 A;  1O95 A;  3DGH A;  4EIP A;  2BS4 A;  4Z43 A;  4KPR A;  1GXF A;  4TM4 A;  3KLJ A;  3FPZ A;  1TYT A;  3GD3 A;  4PAA A;  1BF3 A;  2C65 A;  4B64 A;  3L8K A;  2C7G A;  1LPF A;  1TDN A;  2YVF A;  2YLT A;  3LB8 A;  1GPE A;  1SEZ A;  2VVM A;  2EQ9 A;  2XVE A;  2XLT A;  1IUT A;  2WET A;  4J34 A;  4LU6 A;  4NNJ A;  4USQ A;  5KMQ A;  5FS7 A;  3SFD A;  2R0C A;  2GR2 A;  3AEC A;  3CN8 A;  3G5R A;  4DSG A;  4H50 A;  4EMI A;  2BAB A;  4D04 A;  3P4P A;  4G6H A;  3R9U A;  3SYI A;  2YLX A;  5M0Z A;  1N4W A;  1F8W A;  5KRQ A;  2XFN A;  1ZMD A;  4YWO A;  2BC1 A;  2A87 A;  1DXL A;  3DH9 A;  4FX9 A;  4YKG A;  2BK4 A;  3DK9 A;  5KMP A;  1MXT A;  2VRM A;  4AOX A;  1FOH A;  1XDI A;  2QAE A;  3L5O A;  2YLW A;  1CJ2 A;  1S2Q A;  2XLR A;  2GB0 A;  3ABV A;  4ZCD A;  3NYE A;  4XWR A;  3BI4 A;  3M13 A;  3VRA A;  2Y6Q A;  3NLC A;  4XXG A;  2GF3 A;  1E1N A;  4U8K A;  2VVL A;  3T2Z A;  3PO7 A;  3COX A;  3C4N A;  4REK A;  1D7L A;  1ZOV A;  4Z25 A;  2XVJ A;  3DJD A;  1RSG A;  1H7W A;  3QFA A;  1IUV A;  1K0J A;  1VG9 A;  4EM3 A;  1PBE A;  1JOA A;  2GV8 A;  2XVF A;  1S3E A;  1NHP A;  2C72 A;  3P1W A;  2YG4 A;  2CUL A;  3NNE A;  2OAL A;  2C75 A;  3GMB A;  4H4X A;  1YKJ A;  4LII A;  3WE0 A;  3NKS A;  3RED A;  1W4X A;  2YG6 A;  4A79 A;  2BS3 A;  3BNU A;  5KVI A;  2APG A;  2QA1 A;  1NHS A;  5KWF A;  1N1P A;  1FEB A;  3AE4 A;  2Y6R A;  4CRT A;  1H82 A;  3CTY A;  4OPI A;  1JNZ A;  1PDH A;  4GR1 A;  2H88 A;  1CJC A;  5BUL A;  3AEB A;  4GDE A;  5J7X A;  3BHK A;  1DOB A;  5BVA A;  4X9M A;  5FS6 A;  5JCM A;  1E1M A;  3RNM A;  1H81 A;  3O0H A;  2GAH B;  1K0L A;  1OJC A;  2JAE A;  2Z5Y A;  3HYW A;  1QLB A;  4BJZ A;  3SZF A;  5HYM A;  2XFO A;  4TM1 A;  1O5W A;  1RYI A;  4II3 A;  3HZL A;  4Z44 A;  1ONF A;  1CC6 A;  4H7U A;  5U63 A;  2BCP A;  1KNP A;  5C3J A;  2RGJ A;  3B6D A;  3T0K A;  1B37 A;  1Y56 A;  3K7Q X;  1CJ3 A;  3BHF A;  4H4Z A;  3CNJ A;  5KMR A;  3AEA A;  3BI2 A;  2BAC A;  4A6N A;  1KSU A;  4GUV A;  1BGN A;  2JKC A;  2IVE A;  2BK5 A;  5EBK A;  4UDP A;  2TPR A;  4OPL A;  4C3Y A;  1NHR A;  4J31 A;  2DKI A;  1H6V A;  2C3D A;  2B9Y A;  2IID A;  1GRA A;  1K4Q A;  4RSL A;  2GR1 A;  1VDC A;  3L1R A;  5HY5 A;  1ZDL A;  4DSH A;  3F8P A;  4OPG A;  1F6M A;  3GMC A;  1PJ5 A;  2F5Z A;  4K5S A;  4H4P A;  4J57 A;  4B67 A;  4YXD A;  2WP5 A;  3LAD A;  1S2Y A;  3GD4 A;  2X8C A;  3LJP A;  1Z6L A;  3AE6 A;  4J33 A;  1NAA A;  4JQ9 A;  2E1M A;  1E1L A;  2YM2 A;  4EQW A;  1IUW A;  3IHM A;  1CC2 A;  1JU2 A;  1KDG A;  2UZZ A;  2WS3 A;  3NTA A;  1VRQ B;  2YR5 A;  1KNR A;  2FJE A;  5GSN A;  4YSH A;  1LTX R;  5GRT A;  3NGC X;  3SZC A;  3KD9 A;  1PBB A;  3CIR A;  1NEK A;  1HYU A;  4BK3 A;  1PBC A;  1LQU A;  2C76 A;  4IV9 A;  4B65 A;  3UOZ A;  2NVK X;  1GSN A;  2WEU A;  1DOE A;  2EQ8 A;  4OCG A;  2R9Z A;  3K30 A;  2RAB A;  2NPX A;  4X4J A;  1REO A;  3CGB A;  1JRZ A;  1GRH A;  4EM4 A;  1ELI A;  1GER A;  4K5R A;  5M10 A;  3C4A A;  3NH3 X;  2ZZC A;  2AR8 A;  5EB5 A;  4U2T A;  3AEF A;  3E1T A;  2FJB A;  1M6I A;  2CDU A;  3CGC A;  3QFB A;  3ALM A;  3NTD A;  5CQF A;  3UKP A;  1M64 A;  2Q6U A;  3OC4 A;  1F8S A;  3NK1 X;  1H84 A;  3IHG A;  2R45 A;  3GWD A;  3UTH A;  1GRT A;  2X50 A;  1PXB A;  4K2X A;  4WX1 A;  3UOV A;  4Z2R A;  3KVE A;  2B7S A;  1ZKQ A;  4NZH A;  2ARD A;  2WDV A;  5LV9 A;  2QCU A;  3EAN A;  1IUU A;  2WQY A;  4I58 A;  3AEG A;  2XFQ A;  3AE5 A;  1YY5 A;  4C5O A;  1GRG A;  2XLP A;  1GRE A;  3LOV A;  4AOS A;  4U8I A;  4AT2 A;  4UDR A;  1E6E A;  5L46 A;  5BRT A;  1N4V A;  3I6D A;  2JB1 A;  4G74 A;  2BXS A;  3BNM A;  1KF6 A;  5U1O A;  1F8R A;  3RHA A;  4CCR A;  2B9X A;  4RG4 A;  3C96 A;  2OA1 A;  4IVO B;  2Q0L A;  3IWA A;  4CCQ A;  1S3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...