1NHQA

Crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
447
structure length
447
Chain Sequence
b'MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title Crystallographic analyses of NADH peroxidase Cys42Ala and Cys42Ser mutants: active site structures, mechanistic implications, and an unusual environment of Arg 303.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
total genus 136
structure length 447
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhqA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhqA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhqA02
3NNEA 1PS9A 2VRLA 1NAAA 1JRYA 1TDNA 4TM0A 3CGBA 3QVPA 4Z26A 1PJ6A 1F3PA 4CNKA 1H84A 2QA1A 3K7QX 4K8DA 3H4KA 2IIDA 1Y0PA 4JDRA 5IPYA 3CGDA 1IUSA 1GREA 1NHSA 2B9YA 5IQ1A 4IVOB 1V59A 4H4TA 1ZMCA 3GD3A 4UP3A 4OPTA 3UKKA 4A7AA 3NKSA 2FJBA 4I58A 3EAOA 4E0VA 4B67A 2PHHA 5KRQA 4HB9A 5L46A 2AQJA 5DBJA 1EBDA 1EL8A 2IVEA 2BCGG 4YWOA 5EBKA 4P9SA 2RGHA 2YAUA 4H4ZA 5HXIA 3P4QA 3CNDA 1D7YA 4EQXA 3AECA 1SEZA 4A9WA 3AE7A 3GWFA 4NTDA 5EB4A 2QCUA 3S61A 1FOHA 5BVAA 2CFYA 3RNMA 1TDEA 3IHGA 3I3LA 3GRTA 3QSSA 3REDA 1EL5A 2V3BA 3GWDA 1GOSA 4USRA 3I6DA 2YVGA 1COYA 2YG3A 3WE0A 1QO8A 1GPEA 3SFDA 4EMJA 2GQFA 1H7WA 3T37A 1GTHA 3FPZA 1NPXA 4H4RA 2GV8A 3II4A 1NG3A 1ZOYA 1GERA 1P2EA 4RSLA 5GSNA 5KWFA 1NHQA 3NG7X 1QLBA 3ATRA 4ICYA 3ICTA 3EF6A 2C66A 4J34A 3NN0X 1LJ1A 4APNA 3NYEA 3KVEA 2B7SA 4JNQA 2CVJA 1ONFA 2Q6UA 1EL7A 5IQ4A 3AE1A 1CC2A 1YY5A 1RSGA 3COXA 1PXCA 3V3OA 1IJHA 2JAEA 4M52A 1ZMDA 3DGZA 3BHKA 1BKWA 1KFYA 4H2RA 4NEVA 3GYJA 1D4EA 2XDOA 1X31B 2WBAA 3LB8A 4H50A 3LZWA 2BC1A 4REKA 4Z44A 2EQ6A 1CJ4A 4AOSA 2YR5A 2EQ9A 5KOWA 1IUWA 3C96A 4BURA 2BACA 4IA5A 4PABA 5J7XA 1H81A 2Z5XA 5FS7A 1ZK7A 2CDUA 4H4UA 4CY8A 5FMHA 2BABA 3ZYXA 1KDGA 4EM4A 2B9WA 2E1MA 1KNRA 2GF3A 2GQWA 4DGKA 1FEAA 1TRBA 3AE5A 3AXBA 4C77A 4B66A 4GR1A 4H4WA 2BS4A 3IHMA 3SM8A 2YVFA 3UOZA 5KXJA 4DSHA 3G5RA 3QSEA 1NEKA 4FDCB 3AB1A 2CULA 4NTCA 1VG0A 1ELIA 4PAAA 2ZZBA 4B65A 1GRGA 3NTAA 3O0HA 1E7PA 5LV9A 2JK6A 3PO7A 2A87A 4CRTA 4ADWA 1CJ3A 1NDAA 5BULA 4H4PA 2BXRA 3AWIA 1M64A 3AYJA 4YSYA 4XXGA 4Y4LA 2XVJA 4GUVA 4C74A 1H6VA 5EB5A 5U1OA 4FK1C 2OAMA 3EPTA 3NN6X 4Z25A 5KOXA 3DJGX 1PBDA 3L8KA 2VVMA 3NHOX 4B68A 4TM4A 4U8PA 4TLXA 3UKQA 3ALMA 4JY3A 2YQUA 3LADA 3AYIA 3CNSA 3M12A 2X8GA 2BK4A 3QJ4A 1TDKA 4GRTA 2BYBA 2XLRA 1JRZA 2YLWA 4H7UA 4MJWA 2WPEA 2Z5YA 4EIQA 2GRTA 3AYLA 3V3NA 2GB0A 3AEEA 1NG4A 2B9XA 2VVLG 4B63A 3DJDA 3ZDNA 4C3YA 5U25A 2ZBWA 1KSSA 1F6MA 4LA1A 3QFBA 2YG7A 3AE2A 2Q0LA 3P4RA 4YTNA 3NK0X 4YTPA 2YM1A 3GMBA 2XLTA 2Y6QA 1NHPA 4U2SA 4A5LA 1LV0A 5C2TA 3CGCA 1CHUA 4C3XA 4HA6A 4KX6A 2YLRA 1LTXR 3FBSA 4UDRA 5M0ZA 3LXDA 1PDHA 1O95A 3NK1X 1GRFA 1JNRA 3KPFA 3QSMA 4OPCA 2R4EA 2XVHA 3G5SA 1N4UA 5J60A 2B76A 1LPFA 2XLSA 4WCTA 4NEWA 3R9UA 3VRAA 1L9CA 2FJEA 2X3NA 4FX9A 3FMWA 1YKJA 2R45A 3NH3X 1MO9A 3AD9B 3BI4A 4RG3A 4TLZA 3UP4A 4Z2RA 4A65A 3UTGA 1P2HA 3CNTA 4EQSA 4JQ9A 3GDNA 4U8JA 4K5RA 3NRNA 1N1PA 4OCGA 3PS9A 3UOXA 2VVLA 1KF6A 2C7GA 1H83A 4J33A 2FBWA 2XFNA 2AAQA 5JCLA 3C4NA 2WOWA 2WS3A 3L1RA 1GALA 2W0HA 3K7MX 4J36A 2IVDA 2XVFA 2JBVA 4Y4MA 1E1MA 3P4SA 1HYUA 2TMDA 5HHFA 1CL0A 3ALJA 1ZDLA 1VQWA 1PJ7A 3DH9A 2GAHB 2E4GA 1F8WA 2Y6RA 3S5WA 4IV9A 3AD8B 2OA1A 4CBQA 1CBOA 3DJEA 4A99A 4B1BA 2NVKX 5HY5A 4H4SA 1TYTA 4OPGA 2YM2A 1IUTA 2X50A 2BS2A 4BV6A 3RP7A 2WU2A 2C73A 2WOIA 1Y56A 1GRTA 4H4QA 1PXAA 1DNCA 1PBBA 4LU6A 1DOEA 1YQ4A 4YXDA 2GVCA 1K0LA 1OJCA 5EOWA 3ALLA 1F8SA 1S3EA 3UOVA 3LZXA 3UP5A 3NK2X 4UDQA 3P1WA 4RG4A 1Y56B 4WX1A 1Q1WA 5BUKA 1AOGA 2Q0KA 3B6DA 3DK9A 4X9NA 1TYPA 2X99A 1CC6A 4XWRA 1PJ5A 3VQRA 1GV4A 2R46A 2EQ8A 1DJQA 2YR4A 3OZ2A 1JOAA 1ZX9A 1XPQA 2O9ZA 2VZ2A 2YLSA 3AEGA 3NTDA 1S2YA 3EANA 1D4CA 4EIPA 1BGJA 4DNAA 1VDCA 4XWZA 3VRDB 4GDPA 2WOVA 3BNUA 3DK8A 2GEWA 1NENA 4BK2A 3GDPA 1ZY8A 2VQBA 1CJ2A 2BCPA 1GTEA 2V61A 4GCMA 4I59A 3NLCA 3ICSA 5TR3A 2GMJA 1RYIA 3KA7A 4B69A 4YSXA 1PHHA 4BK3A 3AEFA 4BJYA 5JCIA 3UTFA 4OPUA 1S2QA 4D04A 3NYFA 1PBEA 1FCDA 1K0JA 1L9EA 1TDFA 2BXSA 5CQFA 3SFEA 4H4VA 2E5VA 4UDPA 5JCNA 3AE8A 3CTYA 1IUXA 4NTEA 5C3JA 2JB3A 4AT0A 2EQ7A 3OC4A 3VR9A 1YQZA 3K7TA 1XDIA 3SQPA 2GR2A 5JCKA 3H8IA 1RP0A 3K30A 4U2TA 4LIIA 3P4PA 3QFAA 2YVJA 4J56A 1ZKQA 3NIXA 2YG5A 3UKHA 2XFPA 4D03A 1GETA 2WESA 3VRBA 2QAEA 3UKAA 2A8XA 2WEUA 3NT6A 1H82A 4OPLA 4B64A 1MOKA 2VRMA 3BNMA 1NHRA 1M6IA 2F5ZA 4H4YA 3IF9A 2WDRA 2C72A 1FEBA 1DXLA 3DK4A 1PBFA 5GRTA 4U8MA 1DOBA 2R0CA 5FS9A 4U8NA 4O5QA 4K22A 4X4JA 1W4XA 2BK5A 3KLJA 4USQA 4FK1A 2V3AA 2V5ZA 2H88A 4J2WA 4N9XA 3UKPA 4Z2TA 1BZLA 2BC0A 2YLXA 3URHA 1Q9IA 4YTMA 3BI2A 1GRBA 3Q9TA 3ADAB 3HZLA 1DODA 3C4AA 2C64A 3P9UA 2J3NA 3ATQA 1BGNA 2AR8A 4U8IA 4JN9A 4YSZA 3BI5A 1GESA 3PVCA 1LQUA 2WP5A 1H86A 1OJAA 1CF3A 1ZP0A 3QVRA 4YKFA 3CIRA 2YG4A 4TM3A 4AP1A 3DJJA 2OLNA 2XYOA 3AE6A 4ECHA 1FECA 1GNDA 2RGOA 1B4VA 4ZCDA 4C5OA 1K4QA 2XFOA 4EQRA 4O5UA 5CKUA 4TM1A 1BWCA 3UOYA 1BF3A 1E1LA 2GR1A 2JB1A 1JRXA 4EM3A 1REOA 1VRQB 5M10A 2XLUA 2YLTA 3LJPA 1DJNA 2GR0A 3RHAA 3UKLA 2WDVA 4GF7A 1OJTA 1PN0A 1H7XA 1ZOVA 3CPIG 4J31A 2ZZCA 1PXBA 4U8KA 3RP6A 4OVIA 2WQYA 2V60A 3H8LA 3SGLA 3ICRA 2C75A 1GEUA 2GMHA 3D8XA 2ACZA 4Z43A 3JSKA 3CNPA 4H2NA 2BK3A 2C65A 4OPDA 1K0IA 4K5SA 2V6OA 2APGA 1OJ9A 4YKGA 1E1NA 1N4VA 1IUVA 2FJAA 2VOUA 4JY2A 1F8RA 1D5TA 1UKVG 1GXFA 2VQ7A 2UZZA 1B37A 5ER0A 2YWLA 4ZN0A 4DSGA 4Z24A 4J57A 1LVLA 5HYMA 2C3CA 3GD4A 1LQTA 3ISHA 2WPFA 4ZCCA 1YQ3A 4CNJA 2OLOA 4H2PA 3DGHA 4H4XA 2ZZ0A 1XHCA 4K2XA 3KKJA 1PBCA 2R0PA 3NGCX 2PYXA 2R4JA 2WU5A 2YLZA 3Q6JA 3AE9A 3ABVA 1CJCA 1L0VA 3ITJA 4IVMB 1GRAA 4Z2UA 2WP9A 3AEDA 3BHFA 3NYCA 4CCQA 1D4DA 1KSUA 4EMWA 3V76A 5KVIA 3IC9A 1JNZA 1IUUA 2RABA 5U63A 3UKFA 4X9MA 1OJDA 3GYIA 3F8PA 1KNPA 1VG9A 2HQMA 5JCMA 3FIMB 4AOXA 2TPRA 2WETA 3UCLA 1N4WA 3IWAA 1TDOA 2JKCA 4U2LA 1D7LA 2I0ZA 2WP6A 3DMEA 4CY6A 1B5QA 3E1TA 2ARDA 3M13A 3DA1A 2WHDA 3CPJG 4YT0A 1EL9A 1DOCA 4KPRA 2XVEA 2GR3A 2WDQA 4OPIA 3GSIA 3AE4A 1CC4A 1XANA 2C3DA 1QJDA 2XLPA 2R0GA 3CPHG 2XCGA 4K7ZA 1FL2A 1Z6LA 3RP8A 4BK1A 3KU9A 3UTEA 2GH5A 1E1KA 3FG2P 1E6EA 3GRSA 1Q1RA 3B3RA 4Y4NA 2C76A 2BA9A 3M0OA 4H2QA 5FS8A 2NPXA 3UTHA 3AE3A 2XVIA 3CN8A 3F8DA 2JB2A 2X8HA 4EMIA 2A89A 4AP3A 1S3BA 2DKHA 2RGJA 4NZHA 2BS3A 2FJDA 3KD9A 1JEHA 2YG6A 4BJZA 2Q7VA 2X8CA 1O94A 4JNAA 2DKIA 3CNJA 1B8SA 4A6NA 4IA6A 4EQWA 4AT2A 1MXTA 1JU2A 3G5QA 3AD7B 5KVHA 3D1CA 2YR6A 2GAGB 5BRTA 3CGEA 1L9DA 3VR8A 2R9ZA 3AEBA 2OALA 3F8RA 4A79A 2XFUA 4A6NB 1GSNA 2C70A 2C67A 3GMCA 1GT8A 2H89A 2XFQA 3AEAA 4U8LA 4GDEA 2QA2A 4U8OA 1GRHA 2WPCA 1O5WA 3LOVA 5FS6A 4YSHA 2B7RA 1E39A 4CCRA
chains in the Genus database with same CATH superfamily
1KKOA 3UJ2A 3CGBA 1PJ6A 4CNKA 3SXIA 3VCNA 3H4KA 2OQHA 3MY9A 2B9YA 1R6WA 2PTWA 4H4TA 2OZ8A 3UKKA 2FJBA 4B67A 2AQJA 1EBDA 4HPNA 2IVEA 3S5SA 2BCGG 4YWOA 2GL5A 4DYEA 3AE7A 3RNMA 3GRTA 1EL5A 2PS2A 3I6DA 2YVGA 1COYA 1QO8A 3SFDA 3OW1A 1H7WA 3T37A 1NPXA 3II4A 1ZOYA 1P2EA 2GGIA 1NHQA 3NG7X 3ICTA 2C4CA 1FO4A 3NN0X 3UJRA 4APNA 3KVEA 2B7SA 1N5WC 2GGHA 2Q6UA 1EL7A 1RSGA 1IJHA 1ZMDA 4H2RA 1KFYA 3T2KA 2XDOA 1X31B 1P43A 3LB8A 4GFIA 3C96A 2BACA 4IA5A 5J7XA 5FS7A 1F9CA 2PP0A 3VCCA 3NFUA 3N4FA 3ZYXA 2GF3A 4G8TA 5BOFA 1W6TA 1TRBA 3AE5A 4DX3A 3G5RA 1VG0A 1RM6B 4PAAA 3O0HA 5LV9A 2JK6A 3PO7A 1CJ3A 1NDAA 2OX4A 4H4PA 2BXRA 3AWIA 3AYJA 4YSYA 3UGVA 2XVJA 4GUVA 4C74A 5U1OA 3NN6X 3EPTA 4Z25A 3DJGX 4TVYA 2P8CA 5FJPA 4JN7A 4TLXA 3UKQA 2X8GA 4GRTA 2BYBA 2YLWA 4H7UA 4GIRA 2WPEA 2GRTA 3ZLFA 3V3NA 2VVLG 3T31A 5U25A 2ZBWA 3QFBA 3ZLGA 2Q0LA 4YTNA 4YTPA 2P8BA 2XLTA 3NXLA 5C2TA 4UDRA 3LXDA 3L5OA 3VRAA 2X3NA 1YKJA 3AD9B 4A65A 1TZZA 4U8JA 1ECQA 2VVLA 2XFNA 1GALA 3DGBA 4J36A 2XVFA 1E1MA 4KWSA 3SY4A 5HHFA 1ZDLA 1VQWA 1PJ7A 3DH9A 4A3RA 3S5WA 3UJEA 4IV9A 2OA1A 4CBQA 1KCZA 4A99A 5HY5A 1TYTA 3MKCA 1DTNA 2ZADA 1PBBA 3I4KA 4HCDA 3QTPA 5EOWA 3ZVIA 1S3EA 4Z1YA 1Y56B 1Q1WA 2PTZA 3VQRA 2AKMA 1GV4A 2R46A 2EQ8A 1JOAA 1ZX9A 3AM9A 1D4CA 4DNAA 4GDPA 3BNUA 1CJ2A 2V61A 4I59A 5TR3A 4B69A 3SYIA 3NZGA 3ZVHB 1BKHA 2BXSA 2FYMA 2BRYA 5JCNA 3CTYA 3SN4A 1IUXA 1OEPA 3P93A 2JB3A 4AT0A 3SQPA 3R0UA 1RP0A 4HN8A 3P4PA 3NIXA 2YG5A 3D9XA 2XFPA 2A8XA 2WEUA 3DG3A 3BNMA 4H2HA 1M6IA 1FEBA 5GRTA 2R0CA 5FS9A 4X4JA 4FK1A 2V3AA 2V5ZA 3UKPA 2OZ3A 4KT2A 3CXBA 2YLXA 3NS1B 1N63C 3BI2A 2J3NA 2OQYA 4U8IA 3DEQA 4JN9A 3PVCA 4JHMA 3A7RA 2MNRA 4J3ZA 2XH0A 2OLNA 4ZOHB 1GNDA 4ZCDA 1K4QA 4EQRA 4O5UA 3VC6A 3UOYA 1E1LA 1VDVA 2OKTA 2JB1A 1KD0A 3VFCA 3CPIG 2ZZCA 4U8KA 3H8LA 2C75A 2AL1A 4HCLA 4Z43A 2OO6A 4H2NA 1WUFA 1N4VA 1IUVA 2FJAA 1MDLA 3ENLA 1B37A 5ER0A 4ZN0A 3SZCA 5KNLA 4Z24A 5HYMA 2C3CA 3GD4A 2WPFA 4IL2A 1XHCA 3KKJA 1PBCA 3NGCX 2PYXA 4IHCA 2WU5A 1SJBA 3ITJA 4IVMB 4Z2UA 2WP9A 2PSNA 1D4DA 5KVIA 3IC9A 3FCPA 1OJDA 4AOXA 5G5HB 2WETA 1X2GA 3IWAA 1TDOA 1D7LA 3T9PA 3DMEA 4CY6A 1B5QA 1N61C 4OPIA 4GYPC 1CC4A 3AE4A 2C3DA 3CPHG 3TWAA 4BK1A 3FG2P 3B3RA 2BA9A 3M0OA 4H2QA 3DESA 3T8QA 2JB2A 3KPKA 2Q7VA 4JNAA 3TW9A 4AT2A 1JU2A 5KVHA 1JCTA 5BRTA 3VR8A 2OALA 3F8RA 3HPFA 3NVWB 4U8LA 2QA2A 2B7RA 1ZXIC 1PS9A 1JRYA 4TM0A 5KMSA 2I5QA 3QVPA 1F3PA 1GREA 4OPTA 3EAOA 5KRQA 3SZFA 5L46A 1SB3B 1NELA 5EBKA 2RGHA 4K1WA 2YAUA 4H4ZA 3P4QA 3UXKA 3CNDA 3AECA 4A9WA 5EB4A 2QCUA 2CFYA 1TDEA 3I3LA 3PWGA 3REDA 3GWDA 4USRA 2GQFA 4ZA0A 4KPLA 3PG6A 4M6UA 3EF6A 1RVKA 4JNQA 1YY5A 3V3OA 2JAEA 4M52A 1BKWA 4NEVA 3GYJA 2WBAA 3LZWA 4Z44A 4AOSA 2YR5A 2EQ9A 5KOWA 4BURA 4PABA 4G73A 3T0KA 2CDUA 4H4UA 3JZUA 2BABA 4IZGA 4EM4A 2GQWA 4DGKA 4H83A 1FEAA 3DG6A 4B66A 3SM8A 2XH7A 3QSEA 1ELIA 2QVHA 2ZZBA 1E7PA 2A87A 4CRTA 1T3QC 3ES7A 3GYXA 5BULA 3Q4DA 4G74A 4FK1C 5KOXA 1PBDA 2VVMA 4B68A 4TM4A 3LADA 3RITA 3CNSA 2BK4A 2W54A 4MJWA 3AYLA 1NG4A 3ZDNA 3HRDC 5EU9A 3NK0X 1LV0A 1CHUA 4C3XA 4OPCA 3QSMA 1JNRA 2R4EA 3GD6A 3G5SA 1N4UA 2PPGA 2B76A 3R9UA 4FX9A 3FV9A 3NH3X 1MO9A 4RG3A 4DWDA 4JQ9A 3GDNA 3CK5A 4K5RA 3PS9A 1H83A 3NRZB 2AAQA 3SSZA 2WOWA 2WS3A 3A7UA 3K7MX 2IVDA 2JBVA 1CL0A 1N60C 2Y6RA 3AD8B 1CBOA 4B1BA 2YM2A 4BV6A 5JRBA 2C73A 1PXAA 1ONEA 3BSMA 1DOEA 4YXDA 2GVCA 1OJCA 3ALLA 3UOVA 3NK2X 1JPMA 3TJIA 1DJQA 1XPQA 2VZ2A 3AEGA 3EANA 1BGJA 1VDCA 2GEWA 3PWIA 4BK2A 3GDPA 2VQBA 1WYGA 2BCPA 4A35A 1RYIA 3KA7A 4BK3A 3AEFA 5JCIA 1FCDA 1TDFA 5CQFA 3SFEA 4UDPA 2GSHA 1EC7A 4FI4A 2EQ7A 3SZWA 3VR9A 3CB3A 3K1GA 1JPDX 4LIIA 3QFAA 2YVJA 4J56A 2WESA 4GYPA 1H82A 2F5ZA 4H4YA 3D46A 1DXLA 2PU1A 4U8MA 2PTYA 4H19A 4K22A 2GGJA 2BK5A 4J2WA 4Z2TA 1BZLA 4YTMA 1GRBA 3Q9TA 3ZLHA 1DODA 3P9UA 3CXOA 2AR8A 4YSZA 3R10A 4G6HA 3UXLA 3BI5A 1GESA 4KEMA 1H86A 1ZP0A 2P88A 4ECHA 2OVLA 2RGOA 1B4VA 2XFOA 3DIPA 3D47A 2QGYA 1BF3A 2PP3A 2GR1A 1JRXA 5M10A 1SJCA 2GR0A 2WDVA 4J1OA 4YWSA 1OJTA 1PXBA 3RP6A 3STPA 2ONEA 2WQYA 1FFUC 1EBHA 3HYXA 1GEUA 4ENLA 3TOYA 2OFJA 2PA6A 3CNPA 1K0IA 4HNLA 4K5SA 2VOUA 4JY2A 1UKVG 4IP5A 4II3A 3ISHA 3OZYA 3B9JB 4CNJA 3MZNA 3P0WA 3U9IA 3NO1A 2R0PA 3QLDA 3TCSA 4K2XA 3AE9A 1L0VA 1CJCA 4NWZA 1TE6A 1KSUA 3V76A 3KUMA 1JNZA 1IUUA 4X9MA 3GYIA 3MWCA 3T2YA 3DFHA 2TPRA 3UCLA 4U2LA 2WP6A 3FVDA 4K8GA 3E1TA 2ARDA 2WHDA 3CPJG 1EL9A 1DOCA 3RRAA 2WDQA 2AKZA 1QJDA 1FL2A 1Z6LA 3RP8A 3KU9A 1E6EA 5FS8A 4MMWA 3AE3A 3F8DA 2E3TA 2POZA 4BJZA 1O94A 3VA8A 2DKIA 4IP4A 2GAGB 1GSNA 3GMCA 1GT8A 2XFQA 3AEAA 4GDEA 2WPCA 3LOVA 5FS6A 2QDEA 4YSHA 1EC9A 1E39A 4IT1A 4CCRA 3NNEA 1WUEA 3V5CA 1NAAA 4G7FA 1VQZA 1TDNA 4Z26A 1Y0PA 4JDRA 5IPYA 1IUSA 3CMMA 4II2A 1NHSA 5IQ1A 4IVOB 3BOXA 1ZMCA 4UP3A 4A7AA 3NKSA 4E0VA 2PHHA 1EL8A 5BOEA 3R07C 5HXIA 4EQXA 1FOHA 3QSSA 2V3BA 2YG3A 3WE0A 1GPEA 4G6GA 1GTHA 3FPZA 2GV8A 1GERA 4GGHA 5KWFA 1XS2A 1QLBA 4GMEA 4J34A 3MSYA 3NYEA 2CVJA 1ONFA 5IQ4A 3AE1A 1CC2A 1PXCA 3DGZA 1D4EA 1ELSA 4H50A 2BC1A 2EQ6A 1IUWA 1R0MA 1H81A 1ZK7A 4CY8A 5FMHA 3H70A 1KDGA 2E1MA 1KNRA 3AXBA 4H4WA 3UOZA 4DSHA 3AB1A 2CULA 3OP2A 4B65A 1GRGA 4ADWA 1FIQB 4XXGA 4GAVA 3IK4A 1H6VA 4K2SA 3UJSA 3NHOX 2QJMA 4U8PA 3ALMA 3QJ4A 2XLRA 1JRZA 1JDFA 4EIQA 2PCEA 2GB0A 3H12A 2B9XA 3A7AA 3DJDA 2HZGA 1F6MA 4LA1A 3AE2A 2PGEA 5KMQA 3GMBA 1XPYA 4U2SA 3CGCA 5M0ZA 3NK1X 1GRFA 2XVHA 3MQTA 4DN1A 5J60A 5FJRA 1LPFA 2XLSA 2DW7A 2FJEA 3FMWA 4Z2RA 3UP4A 4TLZA 3UTGA 3CNTA 4EQSA 3R1ZA 3QN3A 1KF6A 2C7GA 3OZMA 2W0HA 3PK7A 3T2ZA 3GO2A 3P4SA 3GC2A 3I6TA 2GAHB 4H4SA 2X50A 1GRTA 4H4QA 1DNCA 1YQ4A 1K0LA 2XGZA 1F8SA 4UDQA 3P1WA 4RG4A 1AOGA 2Q0KA 4X9NA 1TYPA 1CC6A 4XWRA 1PJ5A 3R25A 2YR4A 3OZ2A 2O9ZA 2YLSA 1S2YA 3R11A 3VRDB 2WOVA 1NENA 3EUB3 3NLCA 5KMRA 4YSXA 1PHHA 3HYVA 4OPUA 4FP1A 3NYFA 1K0JA 2ZC8A 4H4VA 4DHGA 3CT2A 3AE8A 4NTEA 3U4FA 1JRPA 1YQZA 1XDIA 4HYRA 3K30A 4U2TA 4D03A 1GETA 2QAEA 3UKAA 2AL2A 3NT6A 2HXTA 1NU5A 2PTXA 4NNJA 1MOKA 3IF9A 2WDRA 2C72A 1PBFA 1DOBA 3P3BA 1SJDA 2FKPA 1W4XA 3KLJA 1SJAA 3I6EA 1MRAA 3ATQA 3OPSA 1BGNA 2P3ZA 1V97A 2WP5A 3QVRA 4YKFA 3CIRA 1YEYA 4TM3A 3DJJA 4Z17A 1VRQB 2YLTA 2E5AA 3RHAA 3IJLA 1H7XA 2V60A 3SGLA 3ICRA 2GMHA 2ACZA 1BQGA 2BK3A 1MUCA 2V6OA 3BJSA 2APGA 2PGWA 1OJ9A 4YKGA 1E1NA 1F8RA 1D5TA 5FJTA 1GXFA 2UZZA 2YWLA 4DSGA 3N6JA 2HNEA 3AN1A 4J57A 1LQTA 4ZCCA 4M0XA 2GGGA 1YQ3A 4H2PA 4H4XA 2ZZ0A 2O56A 2YLZA 2R4JA 3Q6JA 3ABVA 1GRAA 3BHFA 2W3SA 3NYCA 4CCQA 2OZTA 4EMWA 1STZA 2RABA 3F8PA 4HCHA 2HQMA 5JCMA 1FHVA 3N4EA 1KKRA 4H1ZA 2JKCA 1EC8A 3V3WA 3M13A 4YT0A 4KPRA 2QQ6A 3GSIA 2QJJA 2PU0A 3UTEA 3GRSA 1Q1RA 2RDXA 3EEZA 4Y4NA 4GAPA 2NPXA 2HXUA 3UTHA 2X8HA 2A89A 2DKHA 2BS3A 2FJDA 3KD9A 1JEHA 2YG6A 3T14A 2QJNA 1IYXA 3CNJA 1B8SA 4A6NA 4IA6A 3R0KA 4EQWA 1MXTA 3D1CA 2YR6A 3FYYA 3CGEA 3Q45A 2H89A 4U8OA 7ENLA 3SZ0A 2PODA 3SN0A 3MUCA 4F4RA 3JW7A 2VRLA 5J04A 3UCDA 1H84A 2QA1A 3K7QX 4K8DA 3JVAA 2IIDA 3CGDA 3QPEA 1V59A 3GD3A 2PP1A 4I58A 4HB9A 5DBJA 4P9SA 1D7YA 1SEZA 3GWFA 4NTDA 3S61A 3RR1A 5BVAA 3IHGA 1GOSA 1E9IA 4EMJA 3IJQA 1MDRA 4H4RA 1NG3A 5GSNA 4RSLA 3TQPA 3ATRA 4ICYA 3IJIA 2C66A 1LJ1A 5ENLA 2OLAA 2GGEA 4G9KA 3COXA 3BHKA 3SR6B 4REKA 1CJ4A 2Z5XA 5FJOA 2B9WA 4C77A 4GR1A 2BS4A 3IHMA 5KXJA 2YVFA 1NEKA 4FDCB 2W55A 4NTCA 3SX6A 3NTAA 1H2IA 2QDDA 1M64A 3UCCA 4Y4LA 4ROPA 5EB5A 2OAMA 3L8KA 6ENLA 1JROA 4GISA 2P0IA 4JY3A 2YQUA 3ES8A 3AYIA 3M12A 1TDKA 2Z5YA 3AEEA 4B63A 3DERA 3VC5A 4JN8A 4C3YA 1KSSA 4A6GA 3SQSA 3P4RA 1FFVC 2YG7A 3B97A 3N6HA 3RCYA 2YM1A 2Y6QA 1NHPA 4A5LA 4HA6A 4KX6A 2YLRA 4ZCWA 1LTXR 3FBSA 1PDHA 1O95A 3KPFA 3AMZA 1S7MA 4WCTA 4NEWA 1L9CA 2R45A 3BI4A 1P2HA 3EKGA 3NRNA 1N1PA 4OCGA 3UOXA 4GGBA 4J33A 2FBWA 5JCLA 3C4NA 3L1RA 4Y4MA 3DG7A 1HYUA 3H7VA 2TMDA 3T6CA 3ALJA 2E4GA 1F8WA 3DJEA 3V4BA 2NVKX 4OPGA 1IUTA 2BS2A 3RP7A 2WU2A 2WOIA 3THUA 1Y56A 3VDGA 4LU6A 3UJFA 5FJUA 4TVWA 4E4FA 3LZXA 3UP5A 4WX1A 3B6DA 4E8GA 3DK9A 2W3RA 4X2PA 2X99A 4E4UA 3PFRA 3TJ4A 3NTDA 2XH2A 4EIPA 1TKKA 2OG9A 4XWZA 1EBGA 3DK8A 1N5XA 1KN0A 1ZY8A 1GTEA 3GY1A 4GCMA 3ZVHA 1FHUA 3ICSA 2GMJA 3HW2A 4BJYA 3UTFA 1S2QA 4D04A 4E5TA 1PBEA 1L9EA 2E5VA 3RGTA 5C3JA 3OC4A 3K7TA 3H8AA 3CAWA 2GR2A 5JCKA 3H8IA 5IDZA 3UKHA 1ZKQA 3VRBA 4OPLA 3FJ4A 2DW6A 4B64A 3TWBA 2VRMA 1NHRA 3NVYB 3DK4A 2AL2B 4U8NA 4O5QA 4USQA 2H88A 4IL0A 4N9XA 2BC0A 3URHA 1Q9IA 2BRAA 3ADAB 3HZLA 3SN1A 2XH4A 3C4AA 2C64A 3CYJA 3RO6A 1P48A 2NQLA 2PMQA 4MKSA 1LQUA 1OJAA 1CF3A 2YG4A 4AP1A 2XYOA 3AE6A 1FECA 4C5OA 5CKUA 4TM1A 1L8PA 1BWCA 4E6MA 2GDQA 4EM3A 1REOA 2XLUA 3LJPA 3V5FA 1DJNA 3UKLA 4GF7A 1PN0A 4J31A 1ZOVA 2XSXA 4OVIA 3D8XA 3FXGA 3JSKA 2C65A 4OPDA 5KMPA 1PDZA 1MNSA 2VQ7A 2CHRA 3DDMA 1LVLA 4HNCA 3SBFA 2OLOA 3DGHA 3QKEA 1X2HA 2MUCA 3S47A 1PDYA 3AEDA 3OTRA 3TTEA 3T4WA 5U63A 3UKFA 1KNPA 1VG9A 3FIMB 4DXKA 1N4WA 2I0ZA 4MGGA 2OPJA 3DA1A 3NVZB 2XVEA 3DFYA 2GR3A 1XANA 2XLPA 2R0GA 2XCGA 4K7ZA 2GH5A 1E1KA 2C76A 3NVVB 2XVIA 3SJNA 3CN8A 4EMIA 4AP3A 1S3BA 2RGJA 4NZHA 4EWJA 3ETRB 2X8CA 3G5QA 3AD7B 1L9DA 2R9ZA 3AEBA 4A79A 2XFUA 4A6NB 1N62C 2C70A 2C67A 5G5GB 3HYWA 1GRHA 1O5WA 5BUKA
chains in the Genus database with same CATH topology
3NNEA 1PS9A 2VRLA 1NAAA 1JRYA 1TDNA 4TM0A 3CGBA 5KMSA 3QVPA 4Z26A 1PJ6A 1F3PA 4CNKA 3SXIA 1H84A 2QA1A 3K7QX 4K8DA 3H4KA 2IIDA 1Y0PA 4JDRA 5IPYA 3CGDA 1IUSA 3CMMA 4II2A 1GREA 1NHSA 2B9YA 3SZ0A 5IQ1A 4IVOB 1V59A 4H4TA 1ZMCA 3GD3A 4UP3A 4OPTA 3UKKA 4A7AA 3NKSA 2FJBA 4I58A 3EAOA 4E0VA 4B67A 2PHHA 3SZFA 5KRQA 4HB9A 5L46A 2AQJA 5DBJA 1EBDA 1EL8A 2IVEA 2BCGG 4YWOA 5EBKA 4P9SA 2RGHA 2YAUA 4H4ZA 5HXIA 3P4QA 3CNDA 1D7YA 4EQXA 3AECA 1SEZA 4A9WA 3AE7A 3GWFA 4NTDA 5EB4A 2QCUA 3S61A 1FOHA 5BVAA 2CFYA 3RNMA 1TDEA 3IHGA 3I3LA 3GRTA 3QSSA 3REDA 2V3BA 1EL5A 3GWDA 1GOSA 4USRA 3I6DA 2YVGA 1COYA 2YG3A 3WE0A 1QO8A 1GPEA 3SFDA 4EMJA 2GQFA 4G6GA 1H7WA 3T37A 1GTHA 3FPZA 1NPXA 4H4RA 3PG6A 2GV8A 3II4A 1NG3A 1ZOYA 1GERA 1P2EA 4RSLA 5GSNA 5KWFA 1NHQA 3NG7X 1QLBA 3ATRA 4ICYA 3ICTA 3EF6A 2C66A 2C4CA 4J34A 3NN0X 1LJ1A 4APNA 3NYEA 3KVEA 2B7SA 4JNQA 2CVJA 1ONFA 2Q6UA 4G9KA 1EL7A 5IQ4A 3AE1A 1CC2A 1YY5A 1RSGA 3COXA 1PXCA 3V3OA 1IJHA 2JAEA 4M52A 1ZMDA 3DGZA 3BHKA 1BKWA 1KFYA 4H2RA 3T2KA 4NEVA 3GYJA 1D4EA 2XDOA 1X31B 2WBAA 3LB8A 4H50A 3LZWA 2BC1A 4REKA 4Z44A 2EQ6A 1CJ4A 4AOSA 2YR5A 2EQ9A 5KOWA 1IUWA 3C96A 4BURA 2BACA 4IA5A 4PABA 5J7XA 1H81A 2Z5XA 4G73A 5FS7A 3T0KA 1ZK7A 2CDUA 4H4UA 4CY8A 5FMHA 2BABA 3ZYXA 1KDGA 4EM4A 2B9WA 2E1MA 1KNRA 2GF3A 2GQWA 4DGKA 1FEAA 1TRBA 3AE5A 3AXBA 4C77A 4B66A 4GR1A 4H4WA 2BS4A 3IHMA 3SM8A 2YVFA 3UOZA 5KXJA 4DSHA 3G5RA 3QSEA 1NEKA 4FDCB 3AB1A 2CULA 4NTCA 1VG0A 1ELIA 3SX6A 4PAAA 2ZZBA 4B65A 1GRGA 3NTAA 3O0HA 1E7PA 5LV9A 2JK6A 3PO7A 2A87A 4CRTA 4ADWA 1CJ3A 1H2IA 1NDAA 3GYXA 5BULA 4H4PA 2BXRA 3AWIA 1M64A 3AYJA 4YSYA 4XXGA 4Y4LA 2XVJA 4GAVA 4G74A 4GUVA 1H6VA 5EB5A 4C74A 5U1OA 4FK1C 2OAMA 3EPTA 3NN6X 4Z25A 5KOXA 3DJGX 1PBDA 3L8KA 2VVMA 3NHOX 4B68A 4TM4A 4U8PA 4TLXA 3UKQA 3ALMA 4JY3A 2YQUA 3LADA 3AYIA 3CNSA 3M12A 2X8GA 2BK4A 3QJ4A 1TDKA 4GRTA 2BYBA 2XLRA 1JRZA 2YLWA 4H7UA 4MJWA 2WPEA 2Z5YA 4EIQA 2GRTA 3AYLA 3V3NA 2GB0A 3AEEA 1NG4A 2B9XA 2VVLG 4B63A 3T31A 3DJDA 3ZDNA 4C3YA 5U25A 2ZBWA 1KSSA 1F6MA 4LA1A 3QFBA 2YG7A 3AE2A 2Q0LA 3P4RA 4YTNA 3NK0X 4YTPA 2YM1A 5KMQA 3GMBA 2XLTA 2Y6QA 1NHPA 4U2SA 4A5LA 1LV0A 5C2TA 3CGCA 1CHUA 4C3XA 4HA6A 4KX6A 2YLRA 1LTXR 3FBSA 4UDRA 5M0ZA 3LXDA 1PDHA 1O95A 3NK1X 1GRFA 1JNRA 3KPFA 3QSMA 4OPCA 2R4EA 2XVHA 3G5SA 1N4UA 1S7MA 5J60A 3L5OA 2B76A 1LPFA 2XLSA 4WCTA 4NEWA 3R9UA 3VRAA 1L9CA 2FJEA 2X3NA 4FX9A 3FMWA 1YKJA 2R45A 3NH3X 1MO9A 3AD9B 3BI4A 4RG3A 4TLZA 3UP4A 4Z2RA 4A65A 3UTGA 1P2HA 3CNTA 4EQSA 4JQ9A 3GDNA 4U8JA 4K5RA 3NRNA 1N1PA 4OCGA 3PS9A 3UOXA 2VVLA 1KF6A 2C7GA 1H83A 4J33A 2FBWA 2XFNA 2AAQA 5JCLA 3C4NA 2WOWA 2WS3A 3L1RA 1GALA 2W0HA 3K7MX 4J36A 2IVDA 3T2ZA 2XVFA 2JBVA 4Y4MA 1E1MA 3P4SA 3SY4A 1HYUA 2TMDA 5HHFA 1CL0A 3ALJA 1ZDLA 1VQWA 1PJ7A 3DH9A 2GAHB 2E4GA 1F8WA 2Y6RA 3S5WA 4IV9A 3AD8B 2OA1A 4CBQA 1CBOA 3DJEA 4A99A 4B1BA 2NVKX 5HY5A 4H4SA 1TYTA 4OPGA 2YM2A 1IUTA 2X50A 2BS2A 4BV6A 5JRBA 3RP7A 2WU2A 2C73A 2WOIA 1Y56A 1GRTA 4H4QA 1PXAA 1DNCA 1PBBA 4LU6A 1DOEA 1YQ4A 4YXDA 2GVCA 1K0LA 1OJCA 5EOWA 3ALLA 1F8SA 1S3EA 3UOVA 3LZXA 3UP5A 3NK2X 4UDQA 3P1WA 4RG4A 1Y56B 4WX1A 1Q1WA 5BUKA 1AOGA 2Q0KA 3B6DA 3DK9A 4X9NA 1TYPA 2X99A 1CC6A 4XWRA 1PJ5A 3VQRA 1GV4A 2R46A 2EQ8A 1DJQA 2YR4A 3OZ2A 1JOAA 1ZX9A 1XPQA 2O9ZA 2VZ2A 2YLSA 3AEGA 3NTDA 1S2YA 3EANA 1D4CA 4EIPA 1BGJA 4DNAA 1VDCA 4XWZA 3VRDB 4GDPA 2WOVA 3BNUA 3DK8A 2GEWA 1NENA 4BK2A 1KN0A 3GDPA 1ZY8A 2VQBA 1CJ2A 2BCPA 1GTEA 2V61A 4GCMA 4I59A 3NLCA 3ICSA 5TR3A 5KMRA 2GMJA 1RYIA 3KA7A 3SYIA 4B69A 4YSXA 1PHHA 4BK3A 3AEFA 4BJYA 5JCIA 3UTFA 3HYVA 4OPUA 1S2QA 4D04A 3NYFA 1PBEA 1FCDA 1K0JA 1L9EA 1TDFA 2BXSA 5CQFA 3SFEA 4H4VA 2E5VA 4UDPA 2BRYA 5JCNA 3AE8A 3CTYA 1IUXA 4NTEA 5C3JA 2JB3A 4AT0A 2EQ7A 3OC4A 3SZWA 3VR9A 1YQZA 3K7TA 1XDIA 3SQPA 2GR2A 5JCKA 3H8IA 1RP0A 3K30A 4U2TA 4LIIA 3P4PA 3QFAA 2YVJA 4J56A 1ZKQA 3NIXA 2YG5A 3D9XA 2XFPA 3UKHA 4D03A 1GETA 2WESA 3VRBA 2QAEA 3UKAA 2A8XA 2WEUA 3NT6A 1H82A 4OPLA 4NNJA 4B64A 1MOKA 2VRMA 3BNMA 1NHRA 1M6IA 2F5ZA 4H4YA 3IF9A 2WDRA 2C72A 1FEBA 1DXLA 3DK4A 1PBFA 5GRTA 4U8MA 1DOBA 2R0CA 5FS9A 4U8NA 4O5QA 4K22A 4X4JA 1W4XA 2BK5A 3KLJA 4USQA 4FK1A 2V3AA 2V5ZA 2H88A 4J2WA 4N9XA 3UKPA 4Z2TA 1BZLA 2BC0A 2YLXA 3URHA 1Q9IA 4YTMA 3BI2A 1GRBA 2BRAA 3ADAB 3HZLA 3Q9TA 1DODA 3C4AA 2C64A 3P9UA 2J3NA 3ATQA 1BGNA 2AR8A 4U8IA 4JN9A 4YSZA 4G6HA 3BI5A 1GESA 3PVCA 1LQUA 2WP5A 1H86A 1OJAA 1CF3A 1ZP0A 3QVRA 4YKFA 3CIRA 2YG4A 4TM3A 4AP1A 3DJJA 2OLNA 2XYOA 3AE6A 4ECHA 1FECA 1GNDA 2RGOA 1B4VA 4ZCDA 4C5OA 1K4QA 2XFOA 4EQRA 4O5UA 5CKUA 4TM1A 1BWCA 3UOYA 1BF3A 1E1LA 2GR1A 2JB1A 1JRXA 4EM3A 1REOA 1VRQB 5M10A 2XLUA 2YLTA 3LJPA 1DJNA 2GR0A 3RHAA 3UKLA 2WDVA 4GF7A 1OJTA 1PN0A 1H7XA 1ZOVA 3CPIG 4J31A 2ZZCA 1PXBA 4U8KA 3RP6A 4OVIA 2WQYA 2V60A 3H8LA 3SGLA 3HYXA 3ICRA 2C75A 1GEUA 2GMHA 3D8XA 2ACZA 4Z43A 3JSKA 3CNPA 4H2NA 2BK3A 2C65A 4OPDA 1K0IA 4K5SA 2V6OA 2APGA 1OJ9A 5KMPA 4YKGA 1E1NA 1N4VA 1IUVA 2FJAA 2VOUA 4JY2A 1F8RA 1D5TA 1UKVG 1GXFA 2VQ7A 2UZZA 1B37A 5ER0A 2YWLA 4ZN0A 4DSGA 3SZCA 5KNLA 4Z24A 4J57A 1LVLA 4II3A 5HYMA 2C3CA 3GD4A 1LQTA 3ISHA 2WPFA 4ZCCA 1YQ3A 4CNJA 2OLOA 4H2PA 3DGHA 4H4XA 2ZZ0A 1XHCA 4K2XA 3KKJA 1PBCA 2R0PA 3NGCX 2PYXA 2R4JA 2WU5A 2YLZA 3Q6JA 3AE9A 3ABVA 1CJCA 1L0VA 3ITJA 4IVMB 1GRAA 4Z2UA 4NWZA 2WP9A 3AEDA 3BHFA 3NYCA 4CCQA 1D4DA 1KSUA 4EMWA 3V76A 5KVIA 3IC9A 1JNZA 1IUUA 2RABA 5U63A 3UKFA 4X9MA 1OJDA 3GYIA 3F8PA 1KNPA 1VG9A 3T2YA 2HQMA 5JCMA 3FIMB 4AOXA 2TPRA 2WETA 3UCLA 1N4WA 3IWAA 1TDOA 2JKCA 4U2LA 1D7LA 2I0ZA 2WP6A 3DMEA 4CY6A 1B5QA 3E1TA 2ARDA 3M13A 3DA1A 2WHDA 3CPJG 4YT0A 1EL9A 1DOCA 4KPRA 2XVEA 2GR3A 2WDQA 4OPIA 3GSIA 3AE4A 1CC4A 1XANA 2C3DA 1QJDA 2XLPA 2R0GA 3CPHG 2XCGA 4U8OA 4K7ZA 1FL2A 1Z6LA 3RP8A 4BK1A 3KU9A 3UTEA 2GH5A 1E1KA 3FG2P 1E6EA 3GRSA 1Q1RA 3B3RA 4Y4NA 2C76A 2BA9A 3M0OA 4H2QA 5FS8A 4GAPA 2NPXA 3UTHA 3AE3A 2XVIA 3CN8A 3F8DA 2JB2A 2X8HA 4EMIA 2A89A 4AP3A 1S3BA 2DKHA 2RGJA 4NZHA 2BS3A 3KPKA 2FJDA 3KD9A 1JEHA 2YG6A 3T14A 4BJZA 2Q7VA 2X8CA 1O94A 4JNAA 2DKIA 3CNJA 1B8SA 4A6NA 4IA6A 4EQWA 4AT2A 1MXTA 1JU2A 3G5QA 3AD7B 5KVHA 3D1CA 2YR6A 2GAGB 5BRTA 3CGEA 1L9DA 3VR8A 2R9ZA 3AEBA 2OALA 3F8RA 4A79A 2XFUA 4A6NB 1GSNA 2C70A 2C67A 3GMCA 1GT8A 2H89A 2XFQA 3AEAA 4U8LA 4GDEA 2QA2A 3HYWA 1GRHA 2WPCA 1O5WA 3LOVA 5FS6A 4YSHA 2B7RA 1E39A 4CCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NNE A;  1PS9 A;  2VRL A;  1NAA A;  1JRY A;  1TDN A;  4TM0 A;  3CGB A;  3QVP A;  4Z26 A;  1PJ6 A;  1F3P A;  4CNK A;  1H84 A;  2QA1 A;  3K7Q X;  4K8D A;  3H4K A;  2IID A;  1Y0P A;  4JDR A;  5IPY A;  3CGD A;  1IUS A;  1GRE A;  1NHS A;  2B9Y A;  5IQ1 A;  4IVO B;  1V59 A;  4H4T A;  1ZMC A;  3GD3 A;  4UP3 A;  4OPT A;  3UKK A;  4A7A A;  3NKS A;  2FJB A;  4I58 A;  3EAO A;  4E0V A;  4B67 A;  2PHH A;  5KRQ A;  4HB9 A;  5L46 A;  2AQJ A;  5DBJ A;  1EBD A;  1EL8 A;  2IVE A;  2BCG G;  4YWO A;  5EBK A;  4P9S A;  2RGH A;  2YAU A;  4H4Z A;  5HXI A;  3P4Q A;  3CND A;  1D7Y A;  4EQX A;  3AEC A;  1SEZ A;  4A9W A;  3AE7 A;  3GWF A;  4NTD A;  5EB4 A;  2QCU A;  3S61 A;  1FOH A;  5BVA A;  2CFY A;  3RNM A;  1TDE A;  3IHG A;  3I3L A;  3GRT A;  3QSS A;  3RED A;  1EL5 A;  2V3B A;  3GWD A;  1GOS A;  4USR A;  3I6D A;  2YVG A;  1COY A;  2YG3 A;  3WE0 A;  1QO8 A;  1GPE A;  3SFD A;  4EMJ A;  2GQF A;  1H7W A;  3T37 A;  1GTH A;  3FPZ A;  1NPX A;  4H4R A;  2GV8 A;  3II4 A;  1NG3 A;  1ZOY A;  1GER A;  1P2E A;  4RSL A;  5GSN A;  5KWF A;  1NHQ A;  3NG7 X;  1QLB A;  3ATR A;  4ICY A;  3ICT A;  3EF6 A;  2C66 A;  4J34 A;  3NN0 X;  1LJ1 A;  4APN A;  3NYE A;  3KVE A;  2B7S A;  4JNQ A;  2CVJ A;  1ONF A;  2Q6U A;  1EL7 A;  5IQ4 A;  3AE1 A;  1CC2 A;  1YY5 A;  1RSG A;  3COX A;  1PXC A;  3V3O A;  1IJH A;  2JAE A;  4M52 A;  1ZMD A;  3DGZ A;  3BHK A;  1BKW A;  1KFY A;  4H2R A;  4NEV A;  3GYJ A;  1D4E A;  2XDO A;  1X31 B;  2WBA A;  3LB8 A;  4H50 A;  3LZW A;  2BC1 A;  4REK A;  4Z44 A;  2EQ6 A;  1CJ4 A;  4AOS A;  2YR5 A;  2EQ9 A;  5KOW A;  1IUW A;  3C96 A;  4BUR A;  2BAC A;  4IA5 A;  4PAB A;  5J7X A;  1H81 A;  2Z5X A;  5FS7 A;  1ZK7 A;  2CDU A;  4H4U A;  4CY8 A;  5FMH A;  2BAB A;  3ZYX A;  1KDG A;  4EM4 A;  2B9W A;  2E1M A;  1KNR A;  2GF3 A;  2GQW A;  4DGK A;  1FEA A;  1TRB A;  3AE5 A;  3AXB A;  4C77 A;  4B66 A;  4GR1 A;  4H4W A;  2BS4 A;  3IHM A;  3SM8 A;  2YVF A;  3UOZ A;  5KXJ A;  4DSH A;  3G5R A;  3QSE A;  1NEK A;  4FDC B;  3AB1 A;  2CUL A;  4NTC A;  1VG0 A;  1ELI A;  4PAA A;  2ZZB A;  4B65 A;  1GRG A;  3NTA A;  3O0H A;  1E7P A;  5LV9 A;  2JK6 A;  3PO7 A;  2A87 A;  4CRT A;  4ADW A;  1CJ3 A;  1NDA A;  5BUL A;  4H4P A;  2BXR A;  3AWI A;  1M64 A;  3AYJ A;  4YSY A;  4XXG A;  4Y4L A;  2XVJ A;  4GUV A;  4C74 A;  1H6V A;  5EB5 A;  5U1O A;  4FK1 C;  2OAM A;  3EPT A;  3NN6 X;  4Z25 A;  5KOX A;  3DJG X;  1PBD A;  3L8K A;  2VVM A;  3NHO X;  4B68 A;  4TM4 A;  4U8P A;  4TLX A;  3UKQ A;  3ALM A;  4JY3 A;  2YQU A;  3LAD A;  3AYI A;  3CNS A;  3M12 A;  2X8G A;  2BK4 A;  3QJ4 A;  1TDK A;  4GRT A;  2BYB A;  2XLR A;  1JRZ A;  2YLW A;  4H7U A;  4MJW A;  2WPE A;  2Z5Y A;  4EIQ A;  2GRT A;  3AYL A;  3V3N A;  2GB0 A;  3AEE A;  1NG4 A;  2B9X A;  2VVL G;  4B63 A;  3DJD A;  3ZDN A;  4C3Y A;  5U25 A;  2ZBW A;  1KSS A;  1F6M A;  4LA1 A;  3QFB A;  2YG7 A;  3AE2 A;  2Q0L A;  3P4R A;  4YTN A;  3NK0 X;  4YTP A;  2YM1 A;  3GMB A;  2XLT A;  2Y6Q A;  1NHP A;  4U2S A;  4A5L A;  1LV0 A;  5C2T A;  3CGC A;  1CHU A;  4C3X A;  4HA6 A;  4KX6 A;  2YLR A;  1LTX R;  3FBS A;  4UDR A;  5M0Z A;  3LXD A;  1PDH A;  1O95 A;  3NK1 X;  1GRF A;  1JNR A;  3KPF A;  3QSM A;  4OPC A;  2R4E A;  2XVH A;  3G5S A;  1N4U A;  5J60 A;  2B76 A;  1LPF A;  2XLS A;  4WCT A;  4NEW A;  3R9U A;  3VRA A;  1L9C A;  2FJE A;  2X3N A;  4FX9 A;  3FMW A;  1YKJ A;  2R45 A;  3NH3 X;  1MO9 A;  3AD9 B;  3BI4 A;  4RG3 A;  4TLZ A;  3UP4 A;  4Z2R A;  4A65 A;  3UTG A;  1P2H A;  3CNT A;  4EQS A;  4JQ9 A;  3GDN A;  4U8J A;  4K5R A;  3NRN A;  1N1P A;  4OCG A;  3PS9 A;  3UOX A;  2VVL A;  1KF6 A;  2C7G A;  1H83 A;  4J33 A;  2FBW A;  2XFN A;  2AAQ A;  5JCL A;  3C4N A;  2WOW A;  2WS3 A;  3L1R A;  1GAL A;  2W0H A;  3K7M X;  4J36 A;  2IVD A;  2XVF A;  2JBV A;  4Y4M A;  1E1M A;  3P4S A;  1HYU A;  2TMD A;  5HHF A;  1CL0 A;  3ALJ A;  1ZDL A;  1VQW A;  1PJ7 A;  3DH9 A;  2GAH B;  2E4G A;  1F8W A;  2Y6R A;  3S5W A;  4IV9 A;  3AD8 B;  2OA1 A;  4CBQ A;  1CBO A;  3DJE A;  4A99 A;  4B1B A;  2NVK X;  5HY5 A;  4H4S A;  1TYT A;  4OPG A;  2YM2 A;  1IUT A;  2X50 A;  2BS2 A;  4BV6 A;  3RP7 A;  2WU2 A;  2C73 A;  2WOI A;  1Y56 A;  1GRT A;  4H4Q A;  1PXA A;  1DNC A;  1PBB A;  4LU6 A;  1DOE A;  1YQ4 A;  4YXD A;  2GVC A;  1K0L A;  1OJC A;  5EOW A;  3ALL A;  1F8S A;  1S3E A;  3UOV A;  3LZX A;  3UP5 A;  3NK2 X;  4UDQ A;  3P1W A;  4RG4 A;  1Y56 B;  4WX1 A;  1Q1W A;  5BUK A;  1AOG A;  2Q0K A;  3B6D A;  3DK9 A;  4X9N A;  1TYP A;  2X99 A;  1CC6 A;  4XWR A;  1PJ5 A;  3VQR A;  1GV4 A;  2R46 A;  2EQ8 A;  1DJQ A;  2YR4 A;  3OZ2 A;  1JOA A;  1ZX9 A;  1XPQ A;  2O9Z A;  2VZ2 A;  2YLS A;  3AEG A;  3NTD A;  1S2Y A;  3EAN A;  1D4C A;  4EIP A;  1BGJ A;  4DNA A;  1VDC A;  4XWZ A;  3VRD B;  4GDP A;  2WOV A;  3BNU A;  3DK8 A;  2GEW A;  1NEN A;  4BK2 A;  3GDP A;  1ZY8 A;  2VQB A;  1CJ2 A;  2BCP A;  1GTE A;  2V61 A;  4GCM A;  4I59 A;  3NLC A;  3ICS A;  5TR3 A;  2GMJ A;  1RYI A;  3KA7 A;  4B69 A;  4YSX A;  1PHH A;  4BK3 A;  3AEF A;  4BJY A;  5JCI A;  3UTF A;  4OPU A;  1S2Q A;  4D04 A;  3NYF A;  1PBE A;  1FCD A;  1K0J A;  1L9E A;  1TDF A;  2BXS A;  5CQF A;  3SFE A;  4H4V A;  2E5V A;  4UDP A;  5JCN A;  3AE8 A;  3CTY A;  1IUX A;  4NTE A;  5C3J A;  2JB3 A;  4AT0 A;  2EQ7 A;  3OC4 A;  3VR9 A;  1YQZ A;  3K7T A;  1XDI A;  3SQP A;  2GR2 A;  5JCK A;  3H8I A;  1RP0 A;  3K30 A;  4U2T A;  4LII A;  3P4P A;  3QFA A;  2YVJ A;  4J56 A;  1ZKQ A;  3NIX A;  2YG5 A;  3UKH A;  2XFP A;  4D03 A;  1GET A;  2WES A;  3VRB A;  2QAE A;  3UKA A;  2A8X A;  2WEU A;  3NT6 A;  1H82 A;  4OPL A;  4B64 A;  1MOK A;  2VRM A;  3BNM A;  1NHR A;  1M6I A;  2F5Z A;  4H4Y A;  3IF9 A;  2WDR A;  2C72 A;  1FEB A;  1DXL A;  3DK4 A;  1PBF A;  5GRT A;  4U8M A;  1DOB A;  2R0C A;  5FS9 A;  4U8N A;  4O5Q A;  4K22 A;  4X4J A;  1W4X A;  2BK5 A;  3KLJ A;  4USQ A;  4FK1 A;  2V3A A;  2V5Z A;  2H88 A;  4J2W A;  4N9X A;  3UKP A;  4Z2T A;  1BZL A;  2BC0 A;  2YLX A;  3URH A;  1Q9I A;  4YTM A;  3BI2 A;  1GRB A;  3Q9T A;  3ADA B;  3HZL A;  1DOD A;  3C4A A;  2C64 A;  3P9U A;  2J3N A;  3ATQ A;  1BGN A;  2AR8 A;  4U8I A;  4JN9 A;  4YSZ A;  3BI5 A;  1GES A;  3PVC A;  1LQU A;  2WP5 A;  1H86 A;  1OJA A;  1CF3 A;  1ZP0 A;  3QVR A;  4YKF A;  3CIR A;  2YG4 A;  4TM3 A;  4AP1 A;  3DJJ A;  2OLN A;  2XYO A;  3AE6 A;  4ECH A;  1FEC A;  1GND A;  2RGO A;  1B4V A;  4ZCD A;  4C5O A;  1K4Q A;  2XFO A;  4EQR A;  4O5U A;  5CKU A;  4TM1 A;  1BWC A;  3UOY A;  1BF3 A;  1E1L A;  2GR1 A;  2JB1 A;  1JRX A;  4EM3 A;  1REO A;  1VRQ B;  5M10 A;  2XLU A;  2YLT A;  3LJP A;  1DJN A;  2GR0 A;  3RHA A;  3UKL A;  2WDV A;  4GF7 A;  1OJT A;  1PN0 A;  1H7X A;  1ZOV A;  3CPI G;  4J31 A;  2ZZC A;  1PXB A;  4U8K A;  3RP6 A;  4OVI A;  2WQY A;  2V60 A;  3H8L A;  3SGL A;  3ICR A;  2C75 A;  1GEU A;  2GMH A;  3D8X A;  2ACZ A;  4Z43 A;  3JSK A;  3CNP A;  4H2N A;  2BK3 A;  2C65 A;  4OPD A;  1K0I A;  4K5S A;  2V6O A;  2APG A;  1OJ9 A;  4YKG A;  1E1N A;  1N4V A;  1IUV A;  2FJA A;  2VOU A;  4JY2 A;  1F8R A;  1D5T A;  1UKV G;  1GXF A;  2VQ7 A;  2UZZ A;  1B37 A;  5ER0 A;  2YWL A;  4ZN0 A;  4DSG A;  4Z24 A;  4J57 A;  1LVL A;  5HYM A;  2C3C A;  3GD4 A;  1LQT A;  3ISH A;  2WPF A;  4ZCC A;  1YQ3 A;  4CNJ A;  2OLO A;  4H2P A;  3DGH A;  4H4X A;  2ZZ0 A;  1XHC A;  4K2X A;  3KKJ A;  1PBC A;  2R0P A;  3NGC X;  2PYX A;  2R4J A;  2WU5 A;  2YLZ A;  3Q6J A;  3AE9 A;  3ABV A;  1CJC A;  1L0V A;  3ITJ A;  4IVM B;  1GRA A;  4Z2U A;  2WP9 A;  3AED A;  3BHF A;  3NYC A;  4CCQ A;  1D4D A;  1KSU A;  4EMW A;  3V76 A;  5KVI A;  3IC9 A;  1JNZ A;  1IUU A;  2RAB A;  5U63 A;  3UKF A;  4X9M A;  1OJD A;  3GYI A;  3F8P A;  1KNP A;  1VG9 A;  2HQM A;  5JCM A;  3FIM B;  4AOX A;  2TPR A;  2WET A;  3UCL A;  1N4W A;  3IWA A;  1TDO A;  2JKC A;  4U2L A;  1D7L A;  2I0Z A;  2WP6 A;  3DME A;  4CY6 A;  1B5Q A;  3E1T A;  2ARD A;  3M13 A;  3DA1 A;  2WHD A;  3CPJ G;  4YT0 A;  1EL9 A;  1DOC A;  4KPR A;  2XVE A;  2GR3 A;  2WDQ A;  4OPI A;  3GSI A;  3AE4 A;  1CC4 A;  1XAN A;  2C3D A;  1QJD A;  2XLP A;  2R0G A;  3CPH G;  2XCG A;  4K7Z A;  1FL2 A;  1Z6L A;  3RP8 A;  4BK1 A;  3KU9 A;  3UTE A;  2GH5 A;  1E1K A;  3FG2 P;  1E6E A;  3GRS A;  1Q1R A;  3B3R A;  4Y4N A;  2C76 A;  2BA9 A;  3M0O A;  4H2Q A;  5FS8 A;  2NPX A;  3UTH A;  3AE3 A;  2XVI A;  3CN8 A;  3F8D A;  2JB2 A;  2X8H A;  4EMI A;  2A89 A;  4AP3 A;  1S3B A;  2DKH A;  2RGJ A;  4NZH A;  2BS3 A;  2FJD A;  3KD9 A;  1JEH A;  2YG6 A;  4BJZ A;  2Q7V A;  2X8C A;  1O94 A;  4JNA A;  2DKI A;  3CNJ A;  1B8S A;  4A6N A;  4IA6 A;  4EQW A;  4AT2 A;  1MXT A;  1JU2 A;  3G5Q A;  3AD7 B;  5KVH A;  3D1C A;  2YR6 A;  2GAG B;  5BRT A;  3CGE A;  1L9D A;  3VR8 A;  2R9Z A;  3AEB A;  2OAL A;  3F8R A;  4A79 A;  2XFU A;  4A6N B;  1GSN A;  2C70 A;  2C67 A;  3GMC A;  1GT8 A;  2H89 A;  2XFQ A;  3AEA A;  4U8L A;  4GDE A;  2QA2 A;  4U8O A;  1GRH A;  2WPC A;  1O5W A;  3LOV A;  5FS6 A;  4YSH A;  2B7R A;  1E39 A;  4CCR A; 
#chains in the Genus database with same CATH topology
 1KKO A;  3UJ2 A;  3CGB A;  1PJ6 A;  4CNK A;  3SXI A;  3VCN A;  3H4K A;  2OQH A;  3MY9 A;  2B9Y A;  1R6W A;  2PTW A;  4H4T A;  2OZ8 A;  3UKK A;  2FJB A;  4B67 A;  2AQJ A;  1EBD A;  4HPN A;  2IVE A;  3S5S A;  2BCG G;  4YWO A;  2GL5 A;  4DYE A;  3AE7 A;  3RNM A;  3GRT A;  1EL5 A;  2PS2 A;  3I6D A;  2YVG A;  1COY A;  1QO8 A;  3SFD A;  3OW1 A;  1H7W A;  3T37 A;  1NPX A;  3II4 A;  1ZOY A;  1P2E A;  2GGI A;  1NHQ A;  3NG7 X;  3ICT A;  2C4C A;  1FO4 A;  3NN0 X;  3UJR A;  4APN A;  3KVE A;  2B7S A;  1N5W C;  2GGH A;  2Q6U A;  1EL7 A;  1RSG A;  1IJH A;  1ZMD A;  4H2R A;  1KFY A;  3T2K A;  2XDO A;  1X31 B;  1P43 A;  3LB8 A;  4GFI A;  3C96 A;  2BAC A;  4IA5 A;  5J7X A;  5FS7 A;  1F9C A;  2PP0 A;  3VCC A;  3NFU A;  3N4F A;  3ZYX A;  2GF3 A;  4G8T A;  5BOF A;  1W6T A;  1TRB A;  3AE5 A;  4DX3 A;  3G5R A;  1VG0 A;  1RM6 B;  4PAA A;  3O0H A;  5LV9 A;  2JK6 A;  3PO7 A;  1CJ3 A;  1NDA A;  2OX4 A;  4H4P A;  2BXR A;  3AWI A;  3AYJ A;  4YSY A;  3UGV A;  2XVJ A;  4GUV A;  4C74 A;  5U1O A;  3NN6 X;  3EPT A;  4Z25 A;  3DJG X;  4TVY A;  2P8C A;  5FJP A;  4JN7 A;  4TLX A;  3UKQ A;  2X8G A;  4GRT A;  2BYB A;  2YLW A;  4H7U A;  4GIR A;  2WPE A;  2GRT A;  3ZLF A;  3V3N A;  2VVL G;  3T31 A;  5U25 A;  2ZBW A;  3QFB A;  3ZLG A;  2Q0L A;  4YTN A;  4YTP A;  2P8B A;  2XLT A;  3NXL A;  5C2T A;  4UDR A;  3LXD A;  3L5O A;  3VRA A;  2X3N A;  1YKJ A;  3AD9 B;  4A65 A;  1TZZ A;  4U8J A;  1ECQ A;  2VVL A;  2XFN A;  1GAL A;  3DGB A;  4J36 A;  2XVF A;  1E1M A;  4KWS A;  3SY4 A;  5HHF A;  1ZDL A;  1VQW A;  1PJ7 A;  3DH9 A;  4A3R A;  3S5W A;  3UJE A;  4IV9 A;  2OA1 A;  4CBQ A;  1KCZ A;  4A99 A;  5HY5 A;  1TYT A;  3MKC A;  1DTN A;  2ZAD A;  1PBB A;  3I4K A;  4HCD A;  3QTP A;  5EOW A;  3ZVI A;  1S3E A;  4Z1Y A;  1Y56 B;  1Q1W A;  2PTZ A;  3VQR A;  2AKM A;  1GV4 A;  2R46 A;  2EQ8 A;  1JOA A;  1ZX9 A;  3AM9 A;  1D4C A;  4DNA A;  4GDP A;  3BNU A;  1CJ2 A;  2V61 A;  4I59 A;  5TR3 A;  4B69 A;  3SYI A;  3NZG A;  3ZVH B;  1BKH A;  2BXS A;  2FYM A;  2BRY A;  5JCN A;  3CTY A;  3SN4 A;  1IUX A;  1OEP A;  3P93 A;  2JB3 A;  4AT0 A;  3SQP A;  3R0U A;  1RP0 A;  4HN8 A;  3P4P A;  3NIX A;  2YG5 A;  3D9X A;  2XFP A;  2A8X A;  2WEU A;  3DG3 A;  3BNM A;  4H2H A;  1M6I A;  1FEB A;  5GRT A;  2R0C A;  5FS9 A;  4X4J A;  4FK1 A;  2V3A A;  2V5Z A;  3UKP A;  2OZ3 A;  4KT2 A;  3CXB A;  2YLX A;  3NS1 B;  1N63 C;  3BI2 A;  2J3N A;  2OQY A;  4U8I A;  3DEQ A;  4JN9 A;  3PVC A;  4JHM A;  3A7R A;  2MNR A;  4J3Z A;  2XH0 A;  2OLN A;  4ZOH B;  1GND A;  4ZCD A;  1K4Q A;  4EQR A;  4O5U A;  3VC6 A;  3UOY A;  1E1L A;  1VDV A;  2OKT A;  2JB1 A;  1KD0 A;  3VFC A;  3CPI G;  2ZZC A;  4U8K A;  3H8L A;  2C75 A;  2AL1 A;  4HCL A;  4Z43 A;  2OO6 A;  4H2N A;  1WUF A;  1N4V A;  1IUV A;  2FJA A;  1MDL A;  3ENL A;  1B37 A;  5ER0 A;  4ZN0 A;  3SZC A;  5KNL A;  4Z24 A;  5HYM A;  2C3C A;  3GD4 A;  2WPF A;  4IL2 A;  1XHC A;  3KKJ A;  1PBC A;  3NGC X;  2PYX A;  4IHC A;  2WU5 A;  1SJB A;  3ITJ A;  4IVM B;  4Z2U A;  2WP9 A;  2PSN A;  1D4D A;  5KVI A;  3IC9 A;  3FCP A;  1OJD A;  4AOX A;  5G5H B;  2WET A;  1X2G A;  3IWA A;  1TDO A;  1D7L A;  3T9P A;  3DME A;  4CY6 A;  1B5Q A;  1N61 C;  4OPI A;  4GYP C;  1CC4 A;  3AE4 A;  2C3D A;  3CPH G;  3TWA A;  4BK1 A;  3FG2 P;  3B3R A;  2BA9 A;  3M0O A;  4H2Q A;  3DES A;  3T8Q A;  2JB2 A;  3KPK A;  2Q7V A;  4JNA A;  3TW9 A;  4AT2 A;  1JU2 A;  5KVH A;  1JCT A;  5BRT A;  3VR8 A;  2OAL A;  3F8R A;  3HPF A;  3NVW B;  4U8L A;  2QA2 A;  2B7R A;  1ZXI C;  1PS9 A;  1JRY A;  4TM0 A;  5KMS A;  2I5Q A;  3QVP A;  1F3P A;  1GRE A;  4OPT A;  3EAO A;  5KRQ A;  3SZF A;  5L46 A;  1SB3 B;  1NEL A;  5EBK A;  2RGH A;  4K1W A;  2YAU A;  4H4Z A;  3P4Q A;  3UXK A;  3CND A;  3AEC A;  4A9W A;  5EB4 A;  2QCU A;  2CFY A;  1TDE A;  3I3L A;  3PWG A;  3RED A;  3GWD A;  4USR A;  2GQF A;  4ZA0 A;  4KPL A;  3PG6 A;  4M6U A;  3EF6 A;  1RVK A;  4JNQ A;  1YY5 A;  3V3O A;  2JAE A;  4M52 A;  1BKW A;  4NEV A;  3GYJ A;  2WBA A;  3LZW A;  4Z44 A;  4AOS A;  2YR5 A;  2EQ9 A;  5KOW A;  4BUR A;  4PAB A;  4G73 A;  3T0K A;  2CDU A;  4H4U A;  3JZU A;  2BAB A;  4IZG A;  4EM4 A;  2GQW A;  4DGK A;  4H83 A;  1FEA A;  3DG6 A;  4B66 A;  3SM8 A;  2XH7 A;  3QSE A;  1ELI A;  2QVH A;  2ZZB A;  1E7P A;  2A87 A;  4CRT A;  1T3Q C;  3ES7 A;  3GYX A;  5BUL A;  3Q4D A;  4G74 A;  4FK1 C;  5KOX A;  1PBD A;  2VVM A;  4B68 A;  4TM4 A;  3LAD A;  3RIT A;  3CNS A;  2BK4 A;  2W54 A;  4MJW A;  3AYL A;  1NG4 A;  3ZDN A;  3HRD C;  5EU9 A;  3NK0 X;  1LV0 A;  1CHU A;  4C3X A;  4OPC A;  3QSM A;  1JNR A;  2R4E A;  3GD6 A;  3G5S A;  1N4U A;  2PPG A;  2B76 A;  3R9U A;  4FX9 A;  3FV9 A;  3NH3 X;  1MO9 A;  4RG3 A;  4DWD A;  4JQ9 A;  3GDN A;  3CK5 A;  4K5R A;  3PS9 A;  1H83 A;  3NRZ B;  2AAQ A;  3SSZ A;  2WOW A;  2WS3 A;  3A7U A;  3K7M X;  2IVD A;  2JBV A;  1CL0 A;  1N60 C;  2Y6R A;  3AD8 B;  1CBO A;  4B1B A;  2YM2 A;  4BV6 A;  5JRB A;  2C73 A;  1PXA A;  1ONE A;  3BSM A;  1DOE A;  4YXD A;  2GVC A;  1OJC A;  3ALL A;  3UOV A;  3NK2 X;  1JPM A;  3TJI A;  1DJQ A;  1XPQ A;  2VZ2 A;  3AEG A;  3EAN A;  1BGJ A;  1VDC A;  2GEW A;  3PWI A;  4BK2 A;  3GDP A;  2VQB A;  1WYG A;  2BCP A;  4A35 A;  1RYI A;  3KA7 A;  4BK3 A;  3AEF A;  5JCI A;  1FCD A;  1TDF A;  5CQF A;  3SFE A;  4UDP A;  2GSH A;  1EC7 A;  4FI4 A;  2EQ7 A;  3SZW A;  3VR9 A;  3CB3 A;  3K1G A;  1JPD X;  4LII A;  3QFA A;  2YVJ A;  4J56 A;  2WES A;  4GYP A;  1H82 A;  2F5Z A;  4H4Y A;  3D46 A;  1DXL A;  2PU1 A;  4U8M A;  2PTY A;  4H19 A;  4K22 A;  2GGJ A;  2BK5 A;  4J2W A;  4Z2T A;  1BZL A;  4YTM A;  1GRB A;  3Q9T A;  3ZLH A;  1DOD A;  3P9U A;  3CXO A;  2AR8 A;  4YSZ A;  3R10 A;  4G6H A;  3UXL A;  3BI5 A;  1GES A;  4KEM A;  1H86 A;  1ZP0 A;  2P88 A;  4ECH A;  2OVL A;  2RGO A;  1B4V A;  2XFO A;  3DIP A;  3D47 A;  2QGY A;  1BF3 A;  2PP3 A;  2GR1 A;  1JRX A;  5M10 A;  1SJC A;  2GR0 A;  2WDV A;  4J1O A;  4YWS A;  1OJT A;  1PXB A;  3RP6 A;  3STP A;  2ONE A;  2WQY A;  1FFU C;  1EBH A;  3HYX A;  1GEU A;  4ENL A;  3TOY A;  2OFJ A;  2PA6 A;  3CNP A;  1K0I A;  4HNL A;  4K5S A;  2VOU A;  4JY2 A;  1UKV G;  4IP5 A;  4II3 A;  3ISH A;  3OZY A;  3B9J B;  4CNJ A;  3MZN A;  3P0W A;  3U9I A;  3NO1 A;  2R0P A;  3QLD A;  3TCS A;  4K2X A;  3AE9 A;  1L0V A;  1CJC A;  4NWZ A;  1TE6 A;  1KSU A;  3V76 A;  3KUM A;  1JNZ A;  1IUU A;  4X9M A;  3GYI A;  3MWC A;  3T2Y A;  3DFH A;  2TPR A;  3UCL A;  4U2L A;  2WP6 A;  3FVD A;  4K8G A;  3E1T A;  2ARD A;  2WHD A;  3CPJ G;  1EL9 A;  1DOC A;  3RRA A;  2WDQ A;  2AKZ A;  1QJD A;  1FL2 A;  1Z6L A;  3RP8 A;  3KU9 A;  1E6E A;  5FS8 A;  4MMW A;  3AE3 A;  3F8D A;  2E3T A;  2POZ A;  4BJZ A;  1O94 A;  3VA8 A;  2DKI A;  4IP4 A;  2GAG B;  1GSN A;  3GMC A;  1GT8 A;  2XFQ A;  3AEA A;  4GDE A;  2WPC A;  3LOV A;  5FS6 A;  2QDE A;  4YSH A;  1EC9 A;  1E39 A;  4IT1 A;  4CCR A;  3NNE A;  1WUE A;  3V5C A;  1NAA A;  4G7F A;  1VQZ A;  1TDN A;  4Z26 A;  1Y0P A;  4JDR A;  5IPY A;  1IUS A;  3CMM A;  4II2 A;  1NHS A;  5IQ1 A;  4IVO B;  3BOX A;  1ZMC A;  4UP3 A;  4A7A A;  3NKS A;  4E0V A;  2PHH A;  1EL8 A;  5BOE A;  3R07 C;  5HXI A;  4EQX A;  1FOH A;  3QSS A;  2V3B A;  2YG3 A;  3WE0 A;  1GPE A;  4G6G A;  1GTH A;  3FPZ A;  2GV8 A;  1GER A;  4GGH A;  5KWF A;  1XS2 A;  1QLB A;  4GME A;  4J34 A;  3MSY A;  3NYE A;  2CVJ A;  1ONF A;  5IQ4 A;  3AE1 A;  1CC2 A;  1PXC A;  3DGZ A;  1D4E A;  1ELS A;  4H50 A;  2BC1 A;  2EQ6 A;  1IUW A;  1R0M A;  1H81 A;  1ZK7 A;  4CY8 A;  5FMH A;  3H70 A;  1KDG A;  2E1M A;  1KNR A;  3AXB A;  4H4W A;  3UOZ A;  4DSH A;  3AB1 A;  2CUL A;  3OP2 A;  4B65 A;  1GRG A;  4ADW A;  1FIQ B;  4XXG A;  4GAV A;  3IK4 A;  1H6V A;  4K2S A;  3UJS A;  3NHO X;  2QJM A;  4U8P A;  3ALM A;  3QJ4 A;  2XLR A;  1JRZ A;  1JDF A;  4EIQ A;  2PCE A;  2GB0 A;  3H12 A;  2B9X A;  3A7A A;  3DJD A;  2HZG A;  1F6M A;  4LA1 A;  3AE2 A;  2PGE A;  5KMQ A;  3GMB A;  1XPY A;  4U2S A;  3CGC A;  5M0Z A;  3NK1 X;  1GRF A;  2XVH A;  3MQT A;  4DN1 A;  5J60 A;  5FJR A;  1LPF A;  2XLS A;  2DW7 A;  2FJE A;  3FMW A;  4Z2R A;  3UP4 A;  4TLZ A;  3UTG A;  3CNT A;  4EQS A;  3R1Z A;  3QN3 A;  1KF6 A;  2C7G A;  3OZM A;  2W0H A;  3PK7 A;  3T2Z A;  3GO2 A;  3P4S A;  3GC2 A;  3I6T A;  2GAH B;  4H4S A;  2X50 A;  1GRT A;  4H4Q A;  1DNC A;  1YQ4 A;  1K0L A;  2XGZ A;  1F8S A;  4UDQ A;  3P1W A;  4RG4 A;  1AOG A;  2Q0K A;  4X9N A;  1TYP A;  1CC6 A;  4XWR A;  1PJ5 A;  3R25 A;  2YR4 A;  3OZ2 A;  2O9Z A;  2YLS A;  1S2Y A;  3R11 A;  3VRD B;  2WOV A;  1NEN A;  3EUB 3;  3NLC A;  5KMR A;  4YSX A;  1PHH A;  3HYV A;  4OPU A;  4FP1 A;  3NYF A;  1K0J A;  2ZC8 A;  4H4V A;  4DHG A;  3CT2 A;  3AE8 A;  4NTE A;  3U4F A;  1JRP A;  1YQZ A;  1XDI A;  4HYR A;  3K30 A;  4U2T A;  4D03 A;  1GET A;  2QAE A;  3UKA A;  2AL2 A;  3NT6 A;  2HXT A;  1NU5 A;  2PTX A;  4NNJ A;  1MOK A;  3IF9 A;  2WDR A;  2C72 A;  1PBF A;  1DOB A;  3P3B A;  1SJD A;  2FKP A;  1W4X A;  3KLJ A;  1SJA A;  3I6E A;  1MRA A;  3ATQ A;  3OPS A;  1BGN A;  2P3Z A;  1V97 A;  2WP5 A;  3QVR A;  4YKF A;  3CIR A;  1YEY A;  4TM3 A;  3DJJ A;  4Z17 A;  1VRQ B;  2YLT A;  2E5A A;  3RHA A;  3IJL A;  1H7X A;  2V60 A;  3SGL A;  3ICR A;  2GMH A;  2ACZ A;  1BQG A;  2BK3 A;  1MUC A;  2V6O A;  3BJS A;  2APG A;  2PGW A;  1OJ9 A;  4YKG A;  1E1N A;  1F8R A;  1D5T A;  5FJT A;  1GXF A;  2UZZ A;  2YWL A;  4DSG A;  3N6J A;  2HNE A;  3AN1 A;  4J57 A;  1LQT A;  4ZCC A;  4M0X A;  2GGG A;  1YQ3 A;  4H2P A;  4H4X A;  2ZZ0 A;  2O56 A;  2YLZ A;  2R4J A;  3Q6J A;  3ABV A;  1GRA A;  3BHF A;  2W3S A;  3NYC A;  4CCQ A;  2OZT A;  4EMW A;  1STZ A;  2RAB A;  3F8P A;  4HCH A;  2HQM A;  5JCM A;  1FHV A;  3N4E A;  1KKR A;  4H1Z A;  2JKC A;  1EC8 A;  3V3W A;  3M13 A;  4YT0 A;  4KPR A;  2QQ6 A;  3GSI A;  2QJJ A;  2PU0 A;  3UTE A;  3GRS A;  1Q1R A;  2RDX A;  3EEZ A;  4Y4N A;  4GAP A;  2NPX A;  2HXU A;  3UTH A;  2X8H A;  2A89 A;  2DKH A;  2BS3 A;  2FJD A;  3KD9 A;  1JEH A;  2YG6 A;  3T14 A;  2QJN A;  1IYX A;  3CNJ A;  1B8S A;  4A6N A;  4IA6 A;  3R0K A;  4EQW A;  1MXT A;  3D1C A;  2YR6 A;  3FYY A;  3CGE A;  3Q45 A;  2H89 A;  4U8O A;  7ENL A;  3SZ0 A;  2POD A;  3SN0 A;  3MUC A;  4F4R A;  3JW7 A;  2VRL A;  5J04 A;  3UCD A;  1H84 A;  2QA1 A;  3K7Q X;  4K8D A;  3JVA A;  2IID A;  3CGD A;  3QPE A;  1V59 A;  3GD3 A;  2PP1 A;  4I58 A;  4HB9 A;  5DBJ A;  4P9S A;  1D7Y A;  1SEZ A;  3GWF A;  4NTD A;  3S61 A;  3RR1 A;  5BVA A;  3IHG A;  1GOS A;  1E9I A;  4EMJ A;  3IJQ A;  1MDR A;  4H4R A;  1NG3 A;  5GSN A;  4RSL A;  3TQP A;  3ATR A;  4ICY A;  3IJI A;  2C66 A;  1LJ1 A;  5ENL A;  2OLA A;  2GGE A;  4G9K A;  3COX A;  3BHK A;  3SR6 B;  4REK A;  1CJ4 A;  2Z5X A;  5FJO A;  2B9W A;  4C77 A;  4GR1 A;  2BS4 A;  3IHM A;  5KXJ A;  2YVF A;  1NEK A;  4FDC B;  2W55 A;  4NTC A;  3SX6 A;  3NTA A;  1H2I A;  2QDD A;  1M64 A;  3UCC A;  4Y4L A;  4ROP A;  5EB5 A;  2OAM A;  3L8K A;  6ENL A;  1JRO A;  4GIS A;  2P0I A;  4JY3 A;  2YQU A;  3ES8 A;  3AYI A;  3M12 A;  1TDK A;  2Z5Y A;  3AEE A;  4B63 A;  3DER A;  3VC5 A;  4JN8 A;  4C3Y A;  1KSS A;  4A6G A;  3SQS A;  3P4R A;  1FFV C;  2YG7 A;  3B97 A;  3N6H A;  3RCY A;  2YM1 A;  2Y6Q A;  1NHP A;  4A5L A;  4HA6 A;  4KX6 A;  2YLR A;  4ZCW A;  1LTX R;  3FBS A;  1PDH A;  1O95 A;  3KPF A;  3AMZ A;  1S7M A;  4WCT A;  4NEW A;  1L9C A;  2R45 A;  3BI4 A;  1P2H A;  3EKG A;  3NRN A;  1N1P A;  4OCG A;  3UOX A;  4GGB A;  4J33 A;  2FBW A;  5JCL A;  3C4N A;  3L1R A;  4Y4M A;  3DG7 A;  1HYU A;  3H7V A;  2TMD A;  3T6C A;  3ALJ A;  2E4G A;  1F8W A;  3DJE A;  3V4B A;  2NVK X;  4OPG A;  1IUT A;  2BS2 A;  3RP7 A;  2WU2 A;  2WOI A;  3THU A;  1Y56 A;  3VDG A;  4LU6 A;  3UJF A;  5FJU A;  4TVW A;  4E4F A;  3LZX A;  3UP5 A;  4WX1 A;  3B6D A;  4E8G A;  3DK9 A;  2W3R A;  4X2P A;  2X99 A;  4E4U A;  3PFR A;  3TJ4 A;  3NTD A;  2XH2 A;  4EIP A;  1TKK A;  2OG9 A;  4XWZ A;  1EBG A;  3DK8 A;  1N5X A;  1KN0 A;  1ZY8 A;  1GTE A;  3GY1 A;  4GCM A;  3ZVH A;  1FHU A;  3ICS A;  2GMJ A;  3HW2 A;  4BJY A;  3UTF A;  1S2Q A;  4D04 A;  4E5T A;  1PBE A;  1L9E A;  2E5V A;  3RGT A;  5C3J A;  3OC4 A;  3K7T A;  3H8A A;  3CAW A;  2GR2 A;  5JCK A;  3H8I A;  5IDZ A;  3UKH A;  1ZKQ A;  3VRB A;  4OPL A;  3FJ4 A;  2DW6 A;  4B64 A;  3TWB A;  2VRM A;  1NHR A;  3NVY B;  3DK4 A;  2AL2 B;  4U8N A;  4O5Q A;  4USQ A;  2H88 A;  4IL0 A;  4N9X A;  2BC0 A;  3URH A;  1Q9I A;  2BRA A;  3ADA B;  3HZL A;  3SN1 A;  2XH4 A;  3C4A A;  2C64 A;  3CYJ A;  3RO6 A;  1P48 A;  2NQL A;  2PMQ A;  4MKS A;  1LQU A;  1OJA A;  1CF3 A;  2YG4 A;  4AP1 A;  2XYO A;  3AE6 A;  1FEC A;  4C5O A;  5CKU A;  4TM1 A;  1L8P A;  1BWC A;  4E6M A;  2GDQ A;  4EM3 A;  1REO A;  2XLU A;  3LJP A;  3V5F A;  1DJN A;  3UKL A;  4GF7 A;  1PN0 A;  4J31 A;  1ZOV A;  2XSX A;  4OVI A;  3D8X A;  3FXG A;  3JSK A;  2C65 A;  4OPD A;  5KMP A;  1PDZ A;  1MNS A;  2VQ7 A;  2CHR A;  3DDM A;  1LVL A;  4HNC A;  3SBF A;  2OLO A;  3DGH A;  3QKE A;  1X2H A;  2MUC A;  3S47 A;  1PDY A;  3AED A;  3OTR A;  3TTE A;  3T4W A;  5U63 A;  3UKF A;  1KNP A;  1VG9 A;  3FIM B;  4DXK A;  1N4W A;  2I0Z A;  4MGG A;  2OPJ A;  3DA1 A;  3NVZ B;  2XVE A;  3DFY A;  2GR3 A;  1XAN A;  2XLP A;  2R0G A;  2XCG A;  4K7Z A;  2GH5 A;  1E1K A;  2C76 A;  3NVV B;  2XVI A;  3SJN A;  3CN8 A;  4EMI A;  4AP3 A;  1S3B A;  2RGJ A;  4NZH A;  4EWJ A;  3ETR B;  2X8C A;  3G5Q A;  3AD7 B;  1L9D A;  2R9Z A;  3AEB A;  4A79 A;  2XFU A;  4A6N B;  1N62 C;  2C70 A;  2C67 A;  5G5G B;  3HYW A;  1GRH A;  1O5W A;  5BUK A; 
#chains in the Genus database with same CATH homology
 3NNE A;  1PS9 A;  2VRL A;  1NAA A;  1JRY A;  1TDN A;  4TM0 A;  3CGB A;  5KMS A;  3QVP A;  4Z26 A;  1PJ6 A;  1F3P A;  4CNK A;  3SXI A;  1H84 A;  2QA1 A;  3K7Q X;  4K8D A;  3H4K A;  2IID A;  1Y0P A;  4JDR A;  5IPY A;  3CGD A;  1IUS A;  3CMM A;  4II2 A;  1GRE A;  1NHS A;  2B9Y A;  3SZ0 A;  5IQ1 A;  4IVO B;  1V59 A;  4H4T A;  1ZMC A;  3GD3 A;  4UP3 A;  4OPT A;  3UKK A;  4A7A A;  3NKS A;  2FJB A;  4I58 A;  3EAO A;  4E0V A;  4B67 A;  2PHH A;  3SZF A;  5KRQ A;  4HB9 A;  5L46 A;  2AQJ A;  5DBJ A;  1EBD A;  1EL8 A;  2IVE A;  2BCG G;  4YWO A;  5EBK A;  4P9S A;  2RGH A;  2YAU A;  4H4Z A;  5HXI A;  3P4Q A;  3CND A;  1D7Y A;  4EQX A;  3AEC A;  1SEZ A;  4A9W A;  3AE7 A;  3GWF A;  4NTD A;  5EB4 A;  2QCU A;  3S61 A;  1FOH A;  5BVA A;  2CFY A;  3RNM A;  1TDE A;  3IHG A;  3I3L A;  3GRT A;  3QSS A;  3RED A;  2V3B A;  1EL5 A;  3GWD A;  1GOS A;  4USR A;  3I6D A;  2YVG A;  1COY A;  2YG3 A;  3WE0 A;  1QO8 A;  1GPE A;  3SFD A;  4EMJ A;  2GQF A;  4G6G A;  1H7W A;  3T37 A;  1GTH A;  3FPZ A;  1NPX A;  4H4R A;  3PG6 A;  2GV8 A;  3II4 A;  1NG3 A;  1ZOY A;  1GER A;  1P2E A;  4RSL A;  5GSN A;  5KWF A;  1NHQ A;  3NG7 X;  1QLB A;  3ATR A;  4ICY A;  3ICT A;  3EF6 A;  2C66 A;  2C4C A;  4J34 A;  3NN0 X;  1LJ1 A;  4APN A;  3NYE A;  3KVE A;  2B7S A;  4JNQ A;  2CVJ A;  1ONF A;  2Q6U A;  4G9K A;  1EL7 A;  5IQ4 A;  3AE1 A;  1CC2 A;  1YY5 A;  1RSG A;  3COX A;  1PXC A;  3V3O A;  1IJH A;  2JAE A;  4M52 A;  1ZMD A;  3DGZ A;  3BHK A;  1BKW A;  1KFY A;  4H2R A;  3T2K A;  4NEV A;  3GYJ A;  1D4E A;  2XDO A;  1X31 B;  2WBA A;  3LB8 A;  4H50 A;  3LZW A;  2BC1 A;  4REK A;  4Z44 A;  2EQ6 A;  1CJ4 A;  4AOS A;  2YR5 A;  2EQ9 A;  5KOW A;  1IUW A;  3C96 A;  4BUR A;  2BAC A;  4IA5 A;  4PAB A;  5J7X A;  1H81 A;  2Z5X A;  4G73 A;  5FS7 A;  3T0K A;  1ZK7 A;  2CDU A;  4H4U A;  4CY8 A;  5FMH A;  2BAB A;  3ZYX A;  1KDG A;  4EM4 A;  2B9W A;  2E1M A;  1KNR A;  2GF3 A;  2GQW A;  4DGK A;  1FEA A;  1TRB A;  3AE5 A;  3AXB A;  4C77 A;  4B66 A;  4GR1 A;  4H4W A;  2BS4 A;  3IHM A;  3SM8 A;  2YVF A;  3UOZ A;  5KXJ A;  4DSH A;  3G5R A;  3QSE A;  1NEK A;  4FDC B;  3AB1 A;  2CUL A;  4NTC A;  1VG0 A;  1ELI A;  3SX6 A;  4PAA A;  2ZZB A;  4B65 A;  1GRG A;  3NTA A;  3O0H A;  1E7P A;  5LV9 A;  2JK6 A;  3PO7 A;  2A87 A;  4CRT A;  4ADW A;  1CJ3 A;  1H2I A;  1NDA A;  3GYX A;  5BUL A;  4H4P A;  2BXR A;  3AWI A;  1M64 A;  3AYJ A;  4YSY A;  4XXG A;  4Y4L A;  2XVJ A;  4GAV A;  4G74 A;  4GUV A;  1H6V A;  5EB5 A;  4C74 A;  5U1O A;  4FK1 C;  2OAM A;  3EPT A;  3NN6 X;  4Z25 A;  5KOX A;  3DJG X;  1PBD A;  3L8K A;  2VVM A;  3NHO X;  4B68 A;  4TM4 A;  4U8P A;  4TLX A;  3UKQ A;  3ALM A;  4JY3 A;  2YQU A;  3LAD A;  3AYI A;  3CNS A;  3M12 A;  2X8G A;  2BK4 A;  3QJ4 A;  1TDK A;  4GRT A;  2BYB A;  2XLR A;  1JRZ A;  2YLW A;  4H7U A;  4MJW A;  2WPE A;  2Z5Y A;  4EIQ A;  2GRT A;  3AYL A;  3V3N A;  2GB0 A;  3AEE A;  1NG4 A;  2B9X A;  2VVL G;  4B63 A;  3T31 A;  3DJD A;  3ZDN A;  4C3Y A;  5U25 A;  2ZBW A;  1KSS A;  1F6M A;  4LA1 A;  3QFB A;  2YG7 A;  3AE2 A;  2Q0L A;  3P4R A;  4YTN A;  3NK0 X;  4YTP A;  2YM1 A;  5KMQ A;  3GMB A;  2XLT A;  2Y6Q A;  1NHP A;  4U2S A;  4A5L A;  1LV0 A;  5C2T A;  3CGC A;  1CHU A;  4C3X A;  4HA6 A;  4KX6 A;  2YLR A;  1LTX R;  3FBS A;  4UDR A;  5M0Z A;  3LXD A;  1PDH A;  1O95 A;  3NK1 X;  1GRF A;  1JNR A;  3KPF A;  3QSM A;  4OPC A;  2R4E A;  2XVH A;  3G5S A;  1N4U A;  1S7M A;  5J60 A;  3L5O A;  2B76 A;  1LPF A;  2XLS A;  4WCT A;  4NEW A;  3R9U A;  3VRA A;  1L9C A;  2FJE A;  2X3N A;  4FX9 A;  3FMW A;  1YKJ A;  2R45 A;  3NH3 X;  1MO9 A;  3AD9 B;  3BI4 A;  4RG3 A;  4TLZ A;  3UP4 A;  4Z2R A;  4A65 A;  3UTG A;  1P2H A;  3CNT A;  4EQS A;  4JQ9 A;  3GDN A;  4U8J A;  4K5R A;  3NRN A;  1N1P A;  4OCG A;  3PS9 A;  3UOX A;  2VVL A;  1KF6 A;  2C7G A;  1H83 A;  4J33 A;  2FBW A;  2XFN A;  2AAQ A;  5JCL A;  3C4N A;  2WOW A;  2WS3 A;  3L1R A;  1GAL A;  2W0H A;  3K7M X;  4J36 A;  2IVD A;  3T2Z A;  2XVF A;  2JBV A;  4Y4M A;  1E1M A;  3P4S A;  3SY4 A;  1HYU A;  2TMD A;  5HHF A;  1CL0 A;  3ALJ A;  1ZDL A;  1VQW A;  1PJ7 A;  3DH9 A;  2GAH B;  2E4G A;  1F8W A;  2Y6R A;  3S5W A;  4IV9 A;  3AD8 B;  2OA1 A;  4CBQ A;  1CBO A;  3DJE A;  4A99 A;  4B1B A;  2NVK X;  5HY5 A;  4H4S A;  1TYT A;  4OPG A;  2YM2 A;  1IUT A;  2X50 A;  2BS2 A;  4BV6 A;  5JRB A;  3RP7 A;  2WU2 A;  2C73 A;  2WOI A;  1Y56 A;  1GRT A;  4H4Q A;  1PXA A;  1DNC A;  1PBB A;  4LU6 A;  1DOE A;  1YQ4 A;  4YXD A;  2GVC A;  1K0L A;  1OJC A;  5EOW A;  3ALL A;  1F8S A;  1S3E A;  3UOV A;  3LZX A;  3UP5 A;  3NK2 X;  4UDQ A;  3P1W A;  4RG4 A;  1Y56 B;  4WX1 A;  1Q1W A;  5BUK A;  1AOG A;  2Q0K A;  3B6D A;  3DK9 A;  4X9N A;  1TYP A;  2X99 A;  1CC6 A;  4XWR A;  1PJ5 A;  3VQR A;  1GV4 A;  2R46 A;  2EQ8 A;  1DJQ A;  2YR4 A;  3OZ2 A;  1JOA A;  1ZX9 A;  1XPQ A;  2O9Z A;  2VZ2 A;  2YLS A;  3AEG A;  3NTD A;  1S2Y A;  3EAN A;  1D4C A;  4EIP A;  1BGJ A;  4DNA A;  1VDC A;  4XWZ A;  3VRD B;  4GDP A;  2WOV A;  3BNU A;  3DK8 A;  2GEW A;  1NEN A;  4BK2 A;  1KN0 A;  3GDP A;  1ZY8 A;  2VQB A;  1CJ2 A;  2BCP A;  1GTE A;  2V61 A;  4GCM A;  4I59 A;  3NLC A;  3ICS A;  5TR3 A;  5KMR A;  2GMJ A;  1RYI A;  3KA7 A;  3SYI A;  4B69 A;  4YSX A;  1PHH A;  4BK3 A;  3AEF A;  4BJY A;  5JCI A;  3UTF A;  3HYV A;  4OPU A;  1S2Q A;  4D04 A;  3NYF A;  1PBE A;  1FCD A;  1K0J A;  1L9E A;  1TDF A;  2BXS A;  5CQF A;  3SFE A;  4H4V A;  2E5V A;  4UDP A;  2BRY A;  5JCN A;  3AE8 A;  3CTY A;  1IUX A;  4NTE A;  5C3J A;  2JB3 A;  4AT0 A;  2EQ7 A;  3OC4 A;  3SZW A;  3VR9 A;  1YQZ A;  3K7T A;  1XDI A;  3SQP A;  2GR2 A;  5JCK A;  3H8I A;  1RP0 A;  3K30 A;  4U2T A;  4LII A;  3P4P A;  3QFA A;  2YVJ A;  4J56 A;  1ZKQ A;  3NIX A;  2YG5 A;  3D9X A;  2XFP A;  3UKH A;  4D03 A;  1GET A;  2WES A;  3VRB A;  2QAE A;  3UKA A;  2A8X A;  2WEU A;  3NT6 A;  1H82 A;  4OPL A;  4NNJ A;  4B64 A;  1MOK A;  2VRM A;  3BNM A;  1NHR A;  1M6I A;  2F5Z A;  4H4Y A;  3IF9 A;  2WDR A;  2C72 A;  1FEB A;  1DXL A;  3DK4 A;  1PBF A;  5GRT A;  4U8M A;  1DOB A;  2R0C A;  5FS9 A;  4U8N A;  4O5Q A;  4K22 A;  4X4J A;  1W4X A;  2BK5 A;  3KLJ A;  4USQ A;  4FK1 A;  2V3A A;  2V5Z A;  2H88 A;  4J2W A;  4N9X A;  3UKP A;  4Z2T A;  1BZL A;  2BC0 A;  2YLX A;  3URH A;  1Q9I A;  4YTM A;  3BI2 A;  1GRB A;  2BRA A;  3ADA B;  3HZL A;  3Q9T A;  1DOD A;  3C4A A;  2C64 A;  3P9U A;  2J3N A;  3ATQ A;  1BGN A;  2AR8 A;  4U8I A;  4JN9 A;  4YSZ A;  4G6H A;  3BI5 A;  1GES A;  3PVC A;  1LQU A;  2WP5 A;  1H86 A;  1OJA A;  1CF3 A;  1ZP0 A;  3QVR A;  4YKF A;  3CIR A;  2YG4 A;  4TM3 A;  4AP1 A;  3DJJ A;  2OLN A;  2XYO A;  3AE6 A;  4ECH A;  1FEC A;  1GND A;  2RGO A;  1B4V A;  4ZCD A;  4C5O A;  1K4Q A;  2XFO A;  4EQR A;  4O5U A;  5CKU A;  4TM1 A;  1BWC A;  3UOY A;  1BF3 A;  1E1L A;  2GR1 A;  2JB1 A;  1JRX A;  4EM3 A;  1REO A;  1VRQ B;  5M10 A;  2XLU A;  2YLT A;  3LJP A;  1DJN A;  2GR0 A;  3RHA A;  3UKL A;  2WDV A;  4GF7 A;  1OJT A;  1PN0 A;  1H7X A;  1ZOV A;  3CPI G;  4J31 A;  2ZZC A;  1PXB A;  4U8K A;  3RP6 A;  4OVI A;  2WQY A;  2V60 A;  3H8L A;  3SGL A;  3HYX A;  3ICR A;  2C75 A;  1GEU A;  2GMH A;  3D8X A;  2ACZ A;  4Z43 A;  3JSK A;  3CNP A;  4H2N A;  2BK3 A;  2C65 A;  4OPD A;  1K0I A;  4K5S A;  2V6O A;  2APG A;  1OJ9 A;  5KMP A;  4YKG A;  1E1N A;  1N4V A;  1IUV A;  2FJA A;  2VOU A;  4JY2 A;  1F8R A;  1D5T A;  1UKV G;  1GXF A;  2VQ7 A;  2UZZ A;  1B37 A;  5ER0 A;  2YWL A;  4ZN0 A;  4DSG A;  3SZC A;  5KNL A;  4Z24 A;  4J57 A;  1LVL A;  4II3 A;  5HYM A;  2C3C A;  3GD4 A;  1LQT A;  3ISH A;  2WPF A;  4ZCC A;  1YQ3 A;  4CNJ A;  2OLO A;  4H2P A;  3DGH A;  4H4X A;  2ZZ0 A;  1XHC A;  4K2X A;  3KKJ A;  1PBC A;  2R0P A;  3NGC X;  2PYX A;  2R4J A;  2WU5 A;  2YLZ A;  3Q6J A;  3AE9 A;  3ABV A;  1CJC A;  1L0V A;  3ITJ A;  4IVM B;  1GRA A;  4Z2U A;  4NWZ A;  2WP9 A;  3AED A;  3BHF A;  3NYC A;  4CCQ A;  1D4D A;  1KSU A;  4EMW A;  3V76 A;  5KVI A;  3IC9 A;  1JNZ A;  1IUU A;  2RAB A;  5U63 A;  3UKF A;  4X9M A;  1OJD A;  3GYI A;  3F8P A;  1KNP A;  1VG9 A;  3T2Y A;  2HQM A;  5JCM A;  3FIM B;  4AOX A;  2TPR A;  2WET A;  3UCL A;  1N4W A;  3IWA A;  1TDO A;  2JKC A;  4U2L A;  1D7L A;  2I0Z A;  2WP6 A;  3DME A;  4CY6 A;  1B5Q A;  3E1T A;  2ARD A;  3M13 A;  3DA1 A;  2WHD A;  3CPJ G;  4YT0 A;  1EL9 A;  1DOC A;  4KPR A;  2XVE A;  2GR3 A;  2WDQ A;  4OPI A;  3GSI A;  3AE4 A;  1CC4 A;  1XAN A;  2C3D A;  1QJD A;  2XLP A;  2R0G A;  3CPH G;  2XCG A;  4U8O A;  4K7Z A;  1FL2 A;  1Z6L A;  3RP8 A;  4BK1 A;  3KU9 A;  3UTE A;  2GH5 A;  1E1K A;  3FG2 P;  1E6E A;  3GRS A;  1Q1R A;  3B3R A;  4Y4N A;  2C76 A;  2BA9 A;  3M0O A;  4H2Q A;  5FS8 A;  4GAP A;  2NPX A;  3UTH A;  3AE3 A;  2XVI A;  3CN8 A;  3F8D A;  2JB2 A;  2X8H A;  4EMI A;  2A89 A;  4AP3 A;  1S3B A;  2DKH A;  2RGJ A;  4NZH A;  2BS3 A;  3KPK A;  2FJD A;  3KD9 A;  1JEH A;  2YG6 A;  3T14 A;  4BJZ A;  2Q7V A;  2X8C A;  1O94 A;  4JNA A;  2DKI A;  3CNJ A;  1B8S A;  4A6N A;  4IA6 A;  4EQW A;  4AT2 A;  1MXT A;  1JU2 A;  3G5Q A;  3AD7 B;  5KVH A;  3D1C A;  2YR6 A;  2GAG B;  5BRT A;  3CGE A;  1L9D A;  3VR8 A;  2R9Z A;  3AEB A;  2OAL A;  3F8R A;  4A79 A;  2XFU A;  4A6N B;  1GSN A;  2C70 A;  2C67 A;  3GMC A;  1GT8 A;  2H89 A;  2XFQ A;  3AEA A;  4U8L A;  4GDE A;  2QA2 A;  3HYW A;  1GRH A;  2WPC A;  1O5W A;  3LOV A;  5FS6 A;  4YSH A;  2B7R A;  1E39 A;  4CCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...