1NHQA

Crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
447
structure length
447
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analyses of NADH peroxidase Cys42Ala and Cys42Ser mutants: active site structures, mechanistic implications, and an unusual environment of Arg 303.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
molecule keywords NADH PEROXIDASE
total genus 136
structure length 447
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhqA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhqA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhqA02
2E4GA 4YTNA 4GUVA 3II4A 1ZMCA 1PBFA 5IQ4A 4K7ZA 4Y4LA 3V3NA 2X8HA 3AE3A 2GR1A 2R0CA 4BV6A 4X9MA 4H2QA 4I58A 1IUTA 4A79A 4REKA 3AEDA 2TPRA 3L8KA 4PAAA 4FDCB 4CY6A 1RP0A 4J56A 2NVKX 3CGDA 1IUSA 2WEUA 3CPJG 3VR9A 2OA1A 1S3BA 4H4SA 3AD9B 5KVIA 1DOEA 1JRZA 2GMHA 4U2SA 3SGLA 2FBWA 1DXLA 5C3JA 1GV4A 1H6VA 4K8DA 4BK3A 3KA7A 1EL9A 1ZP0A 2F5ZA 4B66A 3NYCA 1PJ5A 1H83A 2V60A 4IVMB 4C3XA 4B67A 3T37A 4K5SA 1E1MA 4U8KA 3EANA 1FL2A 3JSKA 1MOKA 1H81A 4X9NA 5EB5A 3EF6A 1OJDA 5J60A 5KOWA 2YVJA 1TYTA 1FEBA 4H4ZA 2WQYA 2QA2A 2YG5A 4OPCA 2YLRA 4J2WA 1CJ2A 2WPCA 1NG3A 1S2YA 1Z6LA 2YLTA 2C7GA 2YVGA 1GRHA 4CY8A 1JEHA 3NNEA 3C4AA 1XDIA 2QAEA 2R9ZA 1NPXA 2EQ9A 4USRA 4H50A 3V76A 2JB2A 1JNRA 4ZCCA 1NAAA 1Y56A 5FS6A 4AOSA 2X99A 4EQWA 3LXDA 4EIPA 4TM0A 3NT6A 3PS9A 2R4EA 4KPRA 4JY2A 3IHMA 4USQA 1AOGA 2YWLA 2AAQA 1TYPA 2WDRA 4AP1A 2BK3A 3M13A 1QO8A 3FPZA 4EMIA 2GMJA 1ZMDA 1H82A 4OPUA 1LPFA 4LU6A 3DJGX 2BC0A 3UKQA 2VVMA 3BI4A 4APNA 4FK1A 3GYIA 1QLBA 1GETA 4I59A 5JCKA 4AP3A 2GF3A 3DGHA 3ABVA 2XFQA 4YKFA 4XXGA 4C77A 1FCDA 2YM2A 4XWZA 1LV0A 1IUWA 4RG4A 4Z25A 3Q6JA 2R46A 1PS9A 4CNJA 5GSNA 3CGEA 1F8SA 2BS2A 2WHDA 2HQMA 2YM1A 1F8WA 4OPIA 4Y4MA 3ZYXA 1YKJA 4U8LA 1PJ6A 5U63A 3DK9A 4UDPA 4J31A 4YWOA 2JB3A 4P9SA 4ZN0A 4U8OA 4DSGA 2B76A 4UP3A 2Y6QA 4D03A 1DOCA 4IV9A 4YKGA 3NTAA 4BJYA 1ONFA 3OZ2A 1BWCA 3VRAA 3Q9TA 2VVLG 4U8NA 1K4QA 1KF6A 4K5RA 1DOBA 2YG4A 2BABA 1B37A 4H2NA 2VVLA 4H2RA 1K0LA 4TM4A 4DNAA 1E1NA 1N4WA 4OPLA 1ZOYA 2XVEA 2C65A 3C96A 3M12A 4JN9A 2DKHA 3K30A 3UP4A 4OPGA 3IC9A 1KSUA 1KSSA 1UKVG 1XANA 2WBAA 4KX6A 1ZK7A 1OJTA 2WETA 5EB4A 4H4YA 4Z2UA 3GRSA 1GESA 4GF7A 1PXBA 3UKKA 1OJAA 5U25A 1ZKQA 1EL8A 2RGOA 1L9CA 4Z43A 3UTHA 4UDRA 4E0VA 2XVFA 3QFBA 2ACZA 4OPDA 3NK1X 2C3DA 4K22A 2X50A 4TLXA 3RP7A 3SQPA 3DA1A 5GRTA 3UKFA 4DSHA 4A99A 2GEWA 1GRFA 3P4PA 2YQUA 1CC6A 2XFPA 1GNDA 3CNDA 3QJ4A 3S5WA 3NLCA 3ICRA 4CNKA 4Z26A 2VQ7A 4YSXA 2FJDA 2FJAA 3S61A 3GDNA 1Q1WA 3ADAB 3HZLA 4Z44A 1V59A 4NTEA 2R4JA 5EOWA 4A6NA 1L0VA 2OALA 4N9XA 4Z2TA 4H4PA 3FG2P 2C75A 3NH3X 5C2TA 5BVAA 4U8JA 4RG3A 2CDUA 4EM4A 3UKHA 2ZBWA 2V3AA 3B3RA 1P2EA 3CPHG 4YXDA 1GREA 2GRTA 4GDEA 4YSHA 3AEFA 2OAMA 2PYXA 4EMWA 3C4NA 3FIMB 3NRNA 2C64A 1RYIA 4H2PA 4OCGA 4Y4NA 4Z2RA 4H4TA 1FECA 1PBCA 4C3YA 1Q9IA 1YQ3A 2Q7VA 1DODA 2B9XA 3G5QA 3ICTA 3IHGA 3LJPA 1LTXR 3O0HA 1JRYA 4RSLA 2WP6A 2J3NA 3SFEA 1PBBA 4B65A 4NEVA 3UCLA 2XLUA 2YR6A 1GRGA 2PHHA 1CBOA 2APGA 3I6DA 3ALMA 4JDRA 1O5WA 5M10A 2XFNA 2XCGA 1PHHA 1TDKA 1NHSA 3UP5A 1H84A 2EQ7A 4JQ9A 1BKWA 4UDQA 4CRTA 4GR1A 3GRTA 2V6OA 4LA1A 1D4DA 1QJDA 1M6IA 2ARDA 2YLZA 3DH9A 3ALJA 1JOAA 4O5QA 1S2QA 4IA6A 4B68A 3KKJA 2BYBA 3GWFA 3AXBA 5FS8A 4AT0A 3CN8A 1ZOVA 2BCGG 4NTCA 2FJEA 3BI2A 3ISHA 4ICYA 2IVDA 2I0ZA 4D04A 4O5UA 2GVCA 4ZCDA 2JBVA 1GSNA 2O9ZA 3CTYA 2XLTA 3PVCA 3UTGA 4J34A 2WS3A 5KVHA 1JNZA 2H88A 4YTMA 3COXA 3BHKA 3K7TA 2YR4A 3AEEA 1TRBA 3NKSA 2H89A 3ATRA 2VRMA 4LIIA 2B9WA 2B9YA 2YG3A 2R0GA 3QSEA 2YG7A 2IIDA 3L1RA 5KRQA 2GH5A 1CJ3A 4U2LA 1GALA 1W4XA 3AE4A 3UOXA 1D7YA 3CNPA 2WOVA 2Q0KA 1YY5A 4CBQA 2JAEA 1TDEA 1KNPA 2TMDA 3AE6A 2GAGB 1BGJA 4DGKA 3NK2X 1GT8A 1VQWA 4ADWA 1NENA 3B6DA 3M0OA 1KDGA 1ZDLA 3NYFA 1PN0A 1TDOA 1N4VA 3QVPA 4GRTA 4FX9A 2BC1A 1GTEA 1DJQA 4BJZA 3GD4A 3BNUA 1GXFA 3REDA 4U8IA 2ZZ0A 2CULA 5DBJA 1N4UA 1BGNA 2XFUA 4OVIA 1P2HA 5LV9A 1NG4A 1O95A 2VZ2A 2JKCA 1JU2A 1JRXA 3UOVA 2QCUA 1H86A 2GR2A 3GSIA 4H4VA 1MO9A 1GERA 3NK0X 4C74A 5U1OA 1XPQA 3DJEA 1F3PA 2QA1A 5BRTA 3AEBA 5FS9A 5ER0A 1CF3A 1REOA 1NHQA 1NDAA 3CGBA 4NEWA 2B7RA 2WOWA 3AWIA 1PBDA 2BK4A 4TM3A 3UTEA 4A5LA 3H4KA 4B1BA 4M52A 1IUVA 3DGZA 4EQSA 2C3CA 2Y6RA 3AYLA 3F8RA 3AE2A 3F8DA 4H4RA 3GYJA 3R9UA 3DK4A 3EAOA 4GCMA 1MXTA 1ZY8A 1NHRA 2WPFA 4GDPA 2WPEA 3FMWA 2C67A 4A9WA 5KXJA 4HA6A 3ZDNA 2OLOA 5BUKA 3IWAA 2GQFA 3D1CA 1XHCA 2Q6UA 2BK5A 1D4EA 3AE7A 1YQZA 5J7XA 3KD9A 4EIQA 3EPTA 1CC2A 1CHUA 1E1LA 1Q1RA 4B63A 4A65A 1Y56B 4U8PA 3VR8A 4JY3A 1S3EA 1LJ1A 2YR5A 5FS7A 2BA9A 1D7LA 3VQRA 2YG6A 1DJNA 1IUUA 2AR8A 1K0JA 3ALLA 2YAUA 5M0ZA 3LZXA 2X3NA 1LQTA 1TDNA 1PXAA 5HY5A 4EM3A 1CC4A 3LZWA 4H4QA 5JCNA 3AD7B 3H8LA 3QSMA 1E1KA 4H4XA 1ELIA 1SEZA 3GDPA 2EQ6A 2XLRA 2V61A 2GR0A 3AE8A 3G5SA 3LOVA 2C70A 3AE9A 1EL7A 2GB0A 2Z5XA 4IVOB 2R45A 1VRQB 2C72A 3ATQA 1M64A 1Y0PA 2C66A 1EL5A 2VRLA 5JCLA 2C76A 3K7MX 2WU2A 3LADA 4B64A 1GRTA 3P4QA 5HYMA 1O94A 1E39A 3NN6X 1LQUA 3AEAA 2WDQA 1N1PA 2A87A 2EQ8A 3DJDA 2A8XA 2YVFA 4A6NB 2Q0LA 3GD3A 2V5ZA 3GWDA 3D8XA 1ZX9A 1GEUA 3KU9A 5EBKA 4TLZA 3DMEA 1BZLA 2XVJA 1PJ7A 1DNCA 2BXSA 1COYA 3BI5A 4ECHA 3KLJA 1BF3A 2WDVA 1TDFA 1X31B 4YT0A 3AEGA 3UTFA 3VRDB 3P4RA 1E6EA 1IUXA 1E7PA 4FK1C 3ITJA 4WX1A 1D5TA 5IPYA 4TM1A 1K0IA 2Z5YA 3KVEA 2XFOA 3AD8B 1FOHA 3CNJA 4J33A 3SFDA 2GV8A 3AYJA 1F6MA 2OLNA 1YQ4A 4YSZA 2R0PA 2WU5A 1GRBA 4J57A 3AB1A 3UKPA 3E1TA 2BCPA 3NTDA 2XYOA 1KFYA 1F8RA 2A89A 2WP9A 4U8MA 3RP6A 2WOIA 1H7WA 2E1MA 4MJWA 4BK1A 2X8CA 4BURA 3CNTA 3NIXA 3KPFA 4BK2A 3CNSA 4H7UA 1PXCA 4XWRA 2ZZCA 4EMJA 2IVEA 2XVIA 1EBDA 4X4JA 3DK8A 5CQFA 5IQ1A 1NHPA 1CJCA 2XLSA 3CPIG 2ZZBA 2DKIA 2C73A 2RGHA 4JNQA 1HYUA 3H8IA 2X8GA 2XVHA 1KNRA 2WESA 2VOUA 3AYIA 3BHFA 4IA5A 3QFAA 5JCIA 1H7XA 1VG0A 2RABA 4CCQA 1VG9A 3ICSA 4J36A 2FJBA 3UKAA 5L46A 2YLXA 2BS4A 3GMBA 3I3LA 4CCRA 2W0HA 5TR3A 5HHFA 3RHAA 4WCTA 3RP8A 3GMCA 4YTPA 3AE1A 3F8PA 3RNMA 3UKLA 3NYEA 2BS3A 3OC4A 1D4CA 1OJCA 3SM8A 3QVRA 1B8SA 3BNMA 3IF9A 2JK6A 3AECA 2NPXA 2GAHB 4HB9A 1B5QA 4B69A 2XDOA 3NG7X 1L9DA 5CKUA 3AE5A 2GR3A 5KWFA 3NN0X 4NZHA 2RGJA 3UOZA 4AOXA 1IJHA 3K7QX 3FBSA 1LVLA 1FEAA 1RSGA 2AQJA 2UZZA 3G5RA 4AT2A 3NHOX 4H4UA 1GRAA 4JNAA 2YLWA 4PABA 1VDCA 1L9EA 1GOSA 1PBEA 2BXRA 3WE0A 1GTHA 1NEKA 1B4VA 5BULA 4K2XA 2CFYA 5KOXA 4YSYA 1GPEA 3CIRA 1CL0A 5HXIA 2XLPA 4A7AA 2E5VA 4H4WA 3V3OA 4OPTA 3P9UA 2JB1A 4EQRA 3P1WA 2CVJA 4Z24A 4U2TA 3CGCA 1OJ9A 1PDHA 3P4SA 3PO7A 3LB8A 4EQXA 3UOYA 3QSSA 2WP5A 3VRBA 3URHA 5JCMA 1CJ4A 2V3BA 2VQBA 2GQWA 3DJJA 5FMHA 2BACA 3NGCX 4C5OA 2B7SA 2YLSA 4NTDA
chains in the Genus database with same CATH superfamily
3KPKA 1ZMCA 4H1ZA 4NWZA 2R0CA 4I58A 3TWBA 4A79A 3AEDA 3L8KA 2AL2A 4M6UA 3SN1A 5KVIA 5KMRA 4U2SA 1GV4A 1H6VA 1EL9A 2GGIA 3HYWA 4GYPA 1R0MA 4B67A 1E1MA 3EANA 1FL2A 1H81A 5EB5A 3T0KA 4OPCA 1TYTA 4H4ZA 2QA2A 2YLRA 1NG3A 1S2YA 2YLTA 4H83A 2C7GA 3C4AA 2PPGA 2JB2A 1NAAA 3DEQA 1Y56A 3PS9A 2R4EA 1RVKA 1AOGA 3SZWA 1TYPA 3SBFA 4GISA 1QO8A 4LU6A 1RM6B 3UKQA 4I59A 4XXGA 4MKSA 1FCDA 1F8SA 2BS2A 4OPIA 4Y4MA 3HRDC 4U8LA 5U63A 4UDPA 5KNLA 4J31A 4P9SA 2I5QA 4U8OA 2B76A 4D03A 3N4EA 3V5CA 1ONFA 1BWCA 3EUB3 4K5RA 2YG4A 4DNAA 4A6GA 1ZOYA 3C96A 2DKHA 1PDYA 3UP4A 3OTRA 1ZK7A 4K8GA 2WETA 1GESA 4GF7A 1NU5A 1ZKQA 4KT2A 1L9CA 3UTHA 2XVFA 3QFBA 2ACZA 3SQPA 2YQUA 1CC6A 3NLCA 2OVLA 3ICRA 1KN0A 2FJDA 2FJAA 3ADAB 3HZLA 5FJPA 4NTEA 2R4JA 3R10A 4Z2TA 4H4PA 5BVAA 2V3AA 4GGHA 4GDEA 3IJQA 2OAMA 3NRNA 2C64A 4C3YA 1Q9IA 3G5QA 1OEPA 1JRYA 2OZ3A 3SFEA 2PP1A 3MSYA 1GRGA 3UJSA 4E6MA 2APGA 1IYXA 4JDRA 1PHHA 3UP5A 4GR1A 2V6OA 4O5QA 3A7AA 6ENLA 4IA6A 2MUCA 5FS8A 4NTCA 2I0ZA 2GVCA 3PVCA 4ROPA 3UTGA 4J34A 4IL0A 2H88A 2HXTA 3AEEA 4LIIA 4DX3A 3UCDA 3QSEA 2YG7A 5KRQA 4U2LA 3RGTA 1W4XA 3CNPA 2WOVA 3JW7A 1TDEA 3AE6A 3NK2X 1VQWA 3B6DA 1WUEA 3VC5A 1N4VA 4FX9A 2BC1A 3MUCA 1GTEA 4U8IA 3TQPA 2OX4A 1N61C 5DBJA 1BGNA 2VZ2A 2GR2A 1GERA 3NK0X 4C74A 5BRTA 5FS9A 1W6TA 3QN3A 2WOWA 3UTEA 4TM3A 3H4KA 3ES8A 1SJDA 4M52A 1IUVA 3R9UA 3DK4A 1JCTA 1MXTA 1NHRA 2WPEA 3ZDNA 4K1WA 3IWAA 2BK5A 3OZYA 2PGEA 3EPTA 4B63A 3SZCA 4U8PA 3GY1A 2YG6A 1IUUA 2YAUA 1LQTA 1TDNA 1CC4A 3LZWA 5JCNA 4H4XA 3GDPA 2HXUA 3PG6A 1BKHA 2C70A 3AE9A 1EL5A 2OO6A 5JCLA 3K7MX 2XH7A 2WU2A 4B64A 4KWSA 5HYMA 1E39A 2QQ6A 3JZUA 1LQUA 3AEAA 2EQ8A 2A8XA 2V5ZA 3VFCA 3AMZA 4MGGA 5EBKA 4TLZA 1BZLA 3VCNA 1E6EA 5IPYA 4WX1A 1D5TA 3KVEA 3CNJA 3CAWA 4GMEA 2OLNA 1GRBA 3P93A 2BCPA 4U8MA 2FYMA 3KPFA 2ZZCA 1FO4A 3AN1A 3HPFA 2DKIA 2C73A 3H8IA 1KNRA 3AYIA 2VOUA 1VG0A 2RABA 3ICSA 5HHFA 4WCTA 2GGHA 2QJJA 3GMCA 3RNMA 1XPYA 3TJ4A 3IF9A 3AECA 3SQSA 1BQGA 4HB9A 2XDOA 3IJLA 3VC6A 3NG7X 2PMQA 5KWFA 4AOXA 3K7QX 1FEAA 1EC9A 3G5RA 3NHOX 4DXKA 4H4UA 1GOSA 1PBEA 3STPA 1B4VA 5BULA 2CFYA 3TOYA 4HCHA 3N4FA 1OJ9A 3A7UA 3LB8A 3QSSA 4HN8A 4HNLA 5IDZA 3NVWB 4C5OA 3AE3A 2B7SA 5M10A 3B97A 2PS2A 4KPLA 3II4A 4Y4LA 4X9MA 2OZTA 4H2QA 4ENLA 3OPSA 4PAAA 2PCEA 5FJTA 4HNCA 3CPJG 3CYJA 3AM9A 1JRZA 2GMHA 3H12A 2FBWA 5C3JA 2XH4A 4BK3A 3NYCA 4IVMB 4K5SA 4U8KA 1JROA 5KOWA 3EF6A 2YVJA 2YG5A 2GGJA 3BSMA 2PODA 4J2WA 1CJ2A 2WPCA 4CY8A 3S5SA 1JEHA 1EBGA 3ZVIA 2EQ9A 4G8TA 4H50A 2P88A 1JNRA 4AOSA 4EQWA 3LXDA 1WYGA 3NXLA 2YWLA 2BK3A 4EMIA 2GMJA 1H82A 2OLAA 3BI4A 1GETA 3DGHA 3ABVA 4YKFA 4EWJA 4IT1A 4IZGA 3CGEA 3CXOA 1T3QC 2WHDA 2HQMA 2JB3A 4ZN0A 3VRAA 2ZC8A 4U8NA 1KF6A 2VVLA 3HYVA 1K0LA 3L5OA 1E1NA 4IL2A 3FV9A 1XANA 2WBAA 3SR6B 3T2ZA 4GGBA 2BRYA 4X2PA 5U25A 1EL8A 4UDRA 2C3DA 2X50A 3RP7A 3QKEA 3DA1A 3UKFA 4DSHA 4A99A 4YWSA 4HCDA 3MKCA 3K1GA 3S61A 4DWDA 5EOWA 4A6NA 3NH3X 3VA8A 2ZBWA 3B3RA 4YXDA 1ZXIC 3UJFA 4YSHA 3AEFA 4Y4NA 4OCGA 1PBCA 3ZLGA 3IHGA 3ICTA 2B9XA 3R0KA 2J3NA 1PBBA 2P8CA 3UCLA 2YR6A 3I6DA 3ALMA 3NVYB 1O5WA 2XCGA 1BKWA 4UDQA 1D4DA 1M6IA 2ARDA 4NNJA 1S2QA 3KKJA 3ZVHA 1VDVA 2FJEA 3BI2A 4ICYA 2P3ZA 1GSNA 1SJAA 2O9ZA 2XLTA 2WS3A 1JNZA 3TWAA 4YTMA 2PTXA 3COXA 3N6HA 3NKSA 2GSHA 3ENLA 2PGWA 2B9YA 2QDEA 2IIDA 4FI4A 1GALA 3AE4A 4Z1YA 1PDZA 2TMDA 1GT8A 1KDGA 1MDLA 4MMWA 1TDOA 1ECQA 3QVPA 3REDA 1GXFA 1N4UA 2AL2B 1P2HA 5LV9A 3UOVA 2QCUA 1H86A 3GSIA 4H4VA 2QDDA 3D46A 1F3PA 1H2IA 3DG3A 5KMSA 5ER0A 3CGBA 2BK4A 4A5LA 3UJ2A 1EC8A 2QJMA 3AYLA 3DGZA 2OQHA 3DGBA 2W54A 4GCMA 3DERA 3FCPA 5KXJA 1D4EA 3AE7A 3I6EA 4EIQA 1CC2A 1CHUA 1E1LA 4A65A 3VR8A 2C4CA 4JY3A 1LJ1A 2BA9A 1D7LA 4A35A 1DJNA 1K0JA 4H19A 3LZXA 2X3NA 5HY5A 4H4QA 3AD7B 3ZLHA 3H8LA 3QSMA 4JN7A 2EQ6A 3T14A 1FFUC 5EU9A 1R6WA 3DESA 2C72A 1M64A 1Y0PA 2C66A 3LADA 4DYEA 3DDMA 3NN6X 3DJDA 3PFRA 3TJIA 3DG7A 3KU9A 1EC7A 3R0UA 2OQYA 1COYA 3BI5A 4ECHA 4IHCA 1BF3A 2WDVA 1TDFA 3AEGA 3VRDB 4FK1C 3TCSA 2Z5YA 2XFOA 3SFDA 1YQ4A 2R0PA 2WU5A 3E1TA 3RO6A 3NTDA 4G74A 2XYOA 1TZZA 2WP9A 1JPDX 4MJWA 2PP3A 4BURA 3NIXA 4BK2A 3CNSA 2XVIA 1EBDA 4X4JA 3DK8A 1NHPA 2XLSA 2W55A 2X8GA 2XVHA 3BHFA 2CHRA 3V4BA 1VG9A 3UKAA 2P8BA 2FJBA 1F9CA 2DW6A 3BJSA 3RRAA 3UKLA 3NYEA 1N63C 3OC4A 1OJCA 3QVRA 1SB3B 2JK6A 2QVHA 2GAHB 1VQZA 3R07C 2GR3A 3NN0X 2RGJA 3FBSA 3PWIA 1RSGA 2UZZA 4AT2A 1XS2A 1STZA 1GRAA 2YLWA 2BXRA 3WE0A 1NEKA 5FJUA 5KOXA 3CIRA 4A3RA 4H4WA 3V3OA 3P9UA 3TTEA 2JB1A 4Z24A 3RR1A 4U2TA 4HYRA 3P4SA 3OW1A 3SXIA 4EQXA 3UOYA 3VRBA 5JCMA 2VQBA 1P48A 2PTYA 3NGCX 5FMHA 3VR9A 2YLZA 2YLSA 4NTDA 3Q4DA 4YTNA 4GUVA 5IQ4A 4K7ZA 3V3NA 4Z17A 3KUMA 1IUTA 2TPRA 2BRAA 4CY6A 4FDCB 1MDRA 4J56A 2NVKX 3CGDA 4GIRA 1DOEA 1ZP0A 3CMMA 4B66A 3DG6A 1PJ5A 3SZFA 4X9NA 1OJDA 2WQYA 3T8QA 3NNEA 2E5AA 3SJNA 2R9ZA 4USRA 3V76A 3V3WA 4TVYA 5FS6A 4DN1A 2X99A 3NT6A 4DHGA 4KPRA 4JY2A 3IHMA 4AP1A 4TVWA 1ZMDA 1LPFA 3DJGX 2BC0A 1FHVA 2OFJA 2VVMA 4APNA 3GYIA 1QLBA 5JCKA 2GF3A 2XFQA 4C77A 3T2YA 4XWZA 2YM2A 1LV0A 4RG4A 4Z25A 2R46A 4CNJA 2YM1A 1F8WA 1YKJA 3DK9A 4HPNA 4DSGA 2XGZA 2Y6QA 3P3BA 1DOCA 4YKGA 4KEMA 4BJYA 3OZ2A 3Q9TA 3MQTA 1B37A 3NS1B 4H2RA 4TM4A 4JHMA 1N4WA 3M12A 4OPGA 3IC9A 1KSUA 3ES7A 1N5XA 1KSSA 1UKVG 4Z2UA 3GYXA 3GRSA 2MNRA 3UKKA 1OJAA 3N6JA 4Z43A 5KMQA 4E0VA 4ZCWA 5KMPA 4GAVA 2GEWA 2XFPA 1GNDA 3CNDA 1WUFA 4CNKA 4Z26A 3ETRB 2VQ7A 4YSXA 3GDNA 4ZA0A 4Z44A 4GYPC 3DFHA 1L0VA 2OALA 4N9XA 3FG2P 4U8JA 2OG9A 4RG3A 2CDUA 3NO1A 1P2EA 1GREA 2PYXA 4EMWA 1RYIA 4H4TA 1FECA 5G5HB 1YQ3A 4HCLA 1LTXR 4RSLA 2WP6A 1YEYA 2HNEA 3CK5A 4B65A 2XLUA 2FKPA 1CBOA 3FXGA 2XFNA 1TDKA 1NHSA 4JQ9A 4CRTA 3D9XA 1L8PA 3DH9A 4B68A 3GWFA 3AXBA 2BCGG 3ISHA 2IVDA 4O5UA 4G7FA 3BHKA 3L1RA 3UOXA 3SN0A 2Q0KA 1N62C 3ZLFA 4CBQA 3V5FA 2GAGB 3M0OA 3GD6A 1PN0A 3PK7A 4GRTA 3GD4A 2OZ8A 2CULA 4OVIA 2JKCA 1JU2A 1MRAA 1MO9A 2ONEA 2RDXA 5U1OA 1XPQA 2QA1A 3AEBA 1NHQA 3AWIA 4NEWA 4B1BA 3F8RA 3F8DA 3GYJA 3T6CA 3D47A 2WPFA 3UJEA 4GDPA 3FMWA 2OLOA 5BUKA 2OKTA 4JN8A 3D1CA 1XHCA 2Q6UA 1Q1RA 5FS7A 3VQRA 2AR8A 3ALLA 1PXAA 4K2SA 3VDGA 3THUA 1ELIA 1SEZA 2XLRA 2V61A 2GR0A 1EL7A 2Z5XA 2R45A 5JRBA 4FP1A 3ATQA 2VRLA 2ZADA 4J1OA 1GRTA 3P4QA 1O94A 4G6GA 2WDQA 2A87A 2YVFA 4A6NB 2Q0LA 3GD3A 2GL5A 3D8XA 3DMEA 1PJ7A 1DNCA 5FJRA 4YT0A 1X2GA 3P4RA 1IUXA 1X2HA 1E7PA 4G73A 3MWCA 2GV8A 2PTZA 3T9PA 3AYJA 1F6MA 3EEZA 4YSZA 4J57A 3AB1A 3UKPA 1F8RA 2PP0A 5FJOA 4ZOHB 2WOIA 2X8CA 4F4RA 3CNTA 4XWRA 5CQFA 3CPIG 3UXKA 2ZZBA 5BOEA 1HYUA 3VCCA 3QPEA 3DIPA 2WESA 4IA5A 1H7XA 4CCQA 3SX6A 4G9KA 5L46A 2YLXA 3GMBA 3I3LA 2W0HA 3CB3A 1FFVC 4YTPA 3AE1A 2BS3A 1B8SA 3BNMA 2QJNA 3NVVB 1B5QA 1SJBA 1L9DA 5CKUA 3AE5A 1IJHA 1SJCA 1LVLA 2AQJA 3FYYA 1FHUA 1VDCA 1L9EA 3QLDA 4YSYA 1GPEA 3IJIA 1CL0A 5HXIA 2XLPA 2E5VA 3S47A 4EQRA 3P1WA 2CVJA 3PO7A 1P43A 2BACA 2E4GA 1PBFA 2X8HA 2GR1A 4BV6A 2QGYA 4REKA 3OZMA 1RP0A 1IUSA 3H8AA 2WEUA 1ELSA 2OA1A 1S3BA 4H4SA 3UJRA 3AD9B 3FVDA 3SGLA 1DXLA 4K8DA 3KA7A 2F5ZA 3ZVHB 1H83A 2V60A 4C3XA 3T37A 3UXLA 3JSKA 1MOKA 5J60A 4IP5A 1FEBA 1Z6LA 3NFUA 3DFYA 2YVGA 1GRHA 1XDIA 2QAEA 1NPXA 4ZCCA 4EIPA 4TM0A 4II3A 3IK4A 1V97A 3RITA 4USQA 2AAQA 2WDRA 3M13A 3FPZA 3EKGA 4OPUA 1JRPA 4FK1A 5C2TA 4AP3A 3RCYA 2HZGA 1IUWA 3I6TA 1KD0A 3Q6JA 1PS9A 5GSNA 3SSZA 3ZYXA 1PJ6A 2GGGA 3R25A 4YWOA 4UP3A 4IV9A 3NTAA 5ENLA 2VVLG 3Q45A 1K4QA 1DOBA 3UCCA 2BABA 4H2NA 4OPLA 2XVEA 2C65A 4JN9A 3K30A 3PWGA 4KX6A 2W3RA 5EB4A 1OJTA 4H4YA 1PXBA 2RGOA 3JVAA 3P0WA 4OPDA 4E8GA 3NK1X 4K22A 1JPMA 4TLXA 3BOXA 5GRTA 1GRFA 3P4PA 3S5WA 3QJ4A 3MZNA 3QTPA 4H2HA 1Q1WA 1V59A 2AKZA 1EBHA 1E9IA 2XH2A 2C75A 3T31A 3GC2A 2GDQA 4EM4A 3UKHA 3OP2A 3CPHG 2GRTA 3NVZB 4H2PA 3C4NA 3FIMB 4Z2RA 2Q7VA 3LJPA 1DODA 3O0HA 1S7MA 4NEVA 2PHHA 2POZA 3U9IA 3T2KA 1H84A 1MNSA 2EQ7A 3GRTA 4LA1A 1QJDA 3ALJA 3HYXA 1JOAA 4II2A 2PSNA 3MY9A 2BYBA 4AT0A 3I4KA 3CN8A 1ZOVA 4D04A 4ZCDA 2JBVA 3CTYA 5KVHA 3K7TA 1KKOA 2YR4A 1TRBA 2H89A 3ATRA 3R11A 2VRMA 2B9WA 2W3SA 2YG3A 2R0GA 3SY4A 3T4WA 2PU1A 3TW9A 4G6HA 2GH5A 1TKKA 1CJ3A 1D7YA 1YY5A 2JAEA 1KNPA 3A7RA 1BGJA 4DGKA 4ADWA 1NENA 1ZDLA 3NYFA 1DJQA 4BJZA 3BNUA 2ZZ0A 2XFUA 1NG4A 1O95A 4GAPA 1JRXA 3CT2A 3DJEA 4E5TA 1CF3A 1REOA 1NDAA 2B7RA 1PBDA 3SN4A 2OPJA 4EQSA 2C3CA 2Y6RA 3AE2A 4E4UA 4H4RA 3EAOA 1ZY8A 2C67A 4A9WA 2XH0A 4HA6A 2GQFA 1YQZA 2AKMA 5J7XA 3KD9A 1Y56B 1S3EA 2E3TA 2YR5A 5M0ZA 1TE6A 4EM3A 5J04A 1E1KA 1KKRA 3AE8A 3NZGA 4J3ZA 3G5SA 3LOVA 2GB0A 4IVOB 7ENLA 1VRQB 4M0XA 2C76A 2O56A 2DW7A 2P0IA 2XSXA 1N1PA 3B9JB 4IP4A 3GWDA 4E4FA 1ONEA 1GEUA 1ZX9A 2XVJA 2BXSA 3KLJA 1X31B 3UTFA 3CXBA 3SZ0A 3ITJA 4TM1A 1K0IA 3AD8B 4J33A 1FOHA 1FIQB 1N5WC 1KFYA 2A89A 3RP6A 1H7WA 2E1MA 4BK1A 3HW2A 4H7UA 1PXCA 2NQLA 4EMJA 2PA6A 3R1ZA 2IVEA 5IQ1A 1CJCA 2RGHA 4JNQA 3QFAA 1KCZA 5JCIA 4J36A 2BS4A 4CCRA 1MUCA 5TR3A 3RHAA 3RP8A 3F8PA 3H70A 3SM8A 1D4CA 5BOFA 2NPXA 4B69A 1NELA 4NZHA 3UOZA 3FJ4A 2GGEA 4GFIA 4JNAA 4PABA 3U4FA 1GTHA 4K2XA 3GO2A 3SYIA 2PTWA 4A7AA 3UGVA 4OPTA 5G5GB 2AL1A 3CGCA 3NRZB 1N60C 1PDHA 2PU0A 2WP5A 3URHA 2V3BA 1CJ4A 1DTNA 2GQWA 3H7VA 3DJJA 1JDFA
chains in the Genus database with same CATH topology
2E4GA 3KPKA 4YTNA 4GUVA 3II4A 1ZMCA 1PBFA 5IQ4A 4K7ZA 4Y4LA 3V3NA 2X8HA 3AE3A 2GR1A 4NWZA 2R0CA 4BV6A 4X9MA 4H2QA 4I58A 1IUTA 4A79A 4REKA 3AEDA 2TPRA 2BRAA 3L8KA 4PAAA 4FDCB 4CY6A 1RP0A 4J56A 2NVKX 3CGDA 1IUSA 2WEUA 3CPJG 3VR9A 2OA1A 1S3BA 4H4SA 3AD9B 5KVIA 1DOEA 1JRZA 5KMRA 2GMHA 4U2SA 3SGLA 2FBWA 1DXLA 5C3JA 1GV4A 1H6VA 4K8DA 4BK3A 3KA7A 1EL9A 1ZP0A 3CMMA 2F5ZA 3HYWA 3NYCA 1PJ5A 4B66A 1H83A 2V60A 4IVMB 4C3XA 4B67A 3T37A 4K5SA 1E1MA 4U8KA 3EANA 1FL2A 3JSKA 1MOKA 1H81A 4X9NA 5EB5A 3EF6A 1OJDA 3T0KA 3SZFA 5J60A 2YVJA 1TYTA 1FEBA 4H4ZA 2WQYA 2QA2A 2YG5A 4OPCA 2YLRA 4J2WA 1CJ2A 2WPCA 1NG3A 1S2YA 1Z6LA 2YLTA 2C7GA 2YVGA 1GRHA 4CY8A 1JEHA 3NNEA 3C4AA 1XDIA 2QAEA 2R9ZA 1NPXA 2EQ9A 4USRA 4H50A 3V76A 2JB2A 1JNRA 4ZCCA 1NAAA 1Y56A 5FS6A 4AOSA 2X99A 4EQWA 3LXDA 4EIPA 4TM0A 3NT6A 3PS9A 4II3A 2R4EA 4KPRA 4JY2A 3IHMA 4USQA 1AOGA 2YWLA 2AAQA 3SZWA 1TYPA 2WDRA 4AP1A 2BK3A 3M13A 1QO8A 3FPZA 4EMIA 2GMJA 1ZMDA 1H82A 4OPUA 1LPFA 4LU6A 3DJGX 2BC0A 3UKQA 2VVMA 3BI4A 4APNA 4FK1A 3GYIA 1QLBA 1GETA 4I59A 5JCKA 4AP3A 2GF3A 3DGHA 3ABVA 2XFQA 4YKFA 4XXGA 4C77A 3T2YA 1FCDA 2YM2A 4XWZA 1LV0A 1IUWA 4RG4A 4Z25A 3Q6JA 2R46A 1PS9A 4CNJA 5GSNA 3CGEA 1F8SA 2BS2A 2WHDA 2HQMA 2YM1A 1F8WA 4OPIA 4Y4MA 3ZYXA 1YKJA 4U8LA 1PJ6A 5U63A 3DK9A 4UDPA 5KNLA 4J31A 4YWOA 2JB3A 4P9SA 4ZN0A 4U8OA 4DSGA 2B76A 4UP3A 2Y6QA 4D03A 1DOCA 4IV9A 4YKGA 3NTAA 4BJYA 1ONFA 3OZ2A 1BWCA 3VRAA 3Q9TA 2VVLG 4U8NA 1K4QA 1KF6A 4K5RA 1DOBA 2YG4A 2BABA 1B37A 4H2NA 2VVLA 4H2RA 3HYVA 1K0LA 4TM4A 3L5OA 4DNAA 1E1NA 1N4WA 4OPLA 1ZOYA 2XVEA 2C65A 3C96A 3M12A 4JN9A 2DKHA 3K30A 3UP4A 4OPGA 3IC9A 1KSUA 1KSSA 1UKVG 1XANA 2WBAA 4KX6A 1ZK7A 1OJTA 2WETA 5EB4A 4H4YA 3GYXA 3T2ZA 3GRSA 4Z2UA 1GESA 4GF7A 1PXBA 2BRYA 3UKKA 1OJAA 5U25A 1ZKQA 1EL8A 2RGOA 1L9CA 4Z43A 5KMQA 3UTHA 4UDRA 4E0VA 2XVFA 3QFBA 2ACZA 4OPDA 3NK1X 2C3DA 4K22A 2X50A 4TLXA 3RP7A 5KMPA 3SQPA 3DA1A 5GRTA 3UKFA 4DSHA 4A99A 4GAVA 2GEWA 1GRFA 3P4PA 2YQUA 1CC6A 2XFPA 1GNDA 3CNDA 3QJ4A 3S5WA 3NLCA 3ICRA 4CNKA 4Z26A 2VQ7A 4YSXA 1KN0A 2FJDA 2FJAA 3GDNA 1Q1WA 3S61A 3ADAB 3HZLA 4Z44A 1V59A 4NTEA 2R4JA 5EOWA 4A6NA 1L0VA 2OALA 4N9XA 4Z2TA 4H4PA 3FG2P 2C75A 3T31A 3NH3X 5C2TA 5BVAA 4U8JA 4RG3A 2CDUA 4EM4A 3UKHA 2ZBWA 2V3AA 3B3RA 1P2EA 3CPHG 4YXDA 1GREA 2GRTA 4GDEA 4YSHA 3AEFA 2OAMA 2PYXA 4EMWA 3C4NA 3FIMB 3NRNA 2C64A 1RYIA 4H2PA 4OCGA 4Y4NA 4Z2RA 4H4TA 1FECA 1PBCA 4C3YA 1Q9IA 1YQ3A 2Q7VA 1DODA 2B9XA 3G5QA 3ICTA 3IHGA 3LJPA 1LTXR 3O0HA 1JRYA 4RSLA 2WP6A 2J3NA 3SFEA 1PBBA 1S7MA 4B65A 4NEVA 3UCLA 2XLUA 2YR6A 1GRGA 2PHHA 1CBOA 2APGA 3I6DA 3ALMA 4JDRA 1O5WA 5M10A 2XFNA 2XCGA 1PHHA 1TDKA 3T2KA 1NHSA 3UP5A 1H84A 2EQ7A 4JQ9A 3D9XA 1BKWA 4UDQA 4CRTA 4GR1A 3GRTA 2V6OA 4LA1A 1D4DA 1QJDA 1M6IA 2ARDA 2YLZA 3DH9A 3ALJA 1JOAA 3HYXA 4II2A 4O5QA 4NNJA 1S2QA 4IA6A 4B68A 3KKJA 2BYBA 3GWFA 3AXBA 5FS8A 4AT0A 3CN8A 1ZOVA 2BCGG 4NTCA 2FJEA 3BI2A 3ISHA 4ICYA 2IVDA 2I0ZA 4D04A 4O5UA 5KOWA 2GVCA 4ZCDA 2JBVA 1GSNA 2O9ZA 3CTYA 2XLTA 3PVCA 3UTGA 4J34A 2WS3A 5KVHA 1JNZA 2H88A 4YTMA 3COXA 3BHKA 3K7TA 2YR4A 3AEEA 1TRBA 3NKSA 2H89A 3ATRA 2VRMA 4LIIA 2B9WA 2B9YA 2YG3A 2R0GA 3SY4A 3QSEA 2YG7A 2IIDA 3L1RA 4G6HA 5KRQA 2GH5A 1CJ3A 4U2LA 1GALA 1W4XA 3AE4A 3UOXA 1D7YA 3CNPA 2WOVA 2Q0KA 1YY5A 4CBQA 2JAEA 1TDEA 1KNPA 2TMDA 3AE6A 2GAGB 1BGJA 4DGKA 3NK2X 1GT8A 1VQWA 4ADWA 1NENA 3B6DA 3M0OA 1KDGA 1ZDLA 3NYFA 1PN0A 1TDOA 1N4VA 3QVPA 4GRTA 4FX9A 2BC1A 1GTEA 1DJQA 4BJZA 3GD4A 3BNUA 1GXFA 3REDA 4U8IA 2ZZ0A 2CULA 5DBJA 1N4UA 1BGNA 2XFUA 4OVIA 1P2HA 5LV9A 1NG4A 1O95A 2VZ2A 4GAPA 2JKCA 1JU2A 1JRXA 3UOVA 2QCUA 1H86A 2GR2A 3GSIA 4H4VA 1MO9A 1GERA 3NK0X 4C74A 5U1OA 1XPQA 3DJEA 1F3PA 2QA1A 5BRTA 3AEBA 5FS9A 1H2IA 5KMSA 5ER0A 1CF3A 1REOA 1NHQA 1NDAA 3CGBA 4NEWA 2B7RA 2WOWA 3AWIA 1PBDA 2BK4A 4TM3A 3UTEA 4A5LA 3H4KA 4B1BA 4M52A 1IUVA 3DGZA 4EQSA 2C3CA 2Y6RA 3AYLA 3F8RA 3AE2A 3F8DA 4H4RA 3GYJA 3R9UA 3DK4A 3EAOA 4GCMA 1MXTA 1ZY8A 1NHRA 2WPFA 4GDPA 2WPEA 3FMWA 2C67A 4A9WA 5KXJA 4HA6A 3ZDNA 2OLOA 5BUKA 3IWAA 2GQFA 3D1CA 1XHCA 2Q6UA 2BK5A 1D4EA 3AE7A 1YQZA 5J7XA 3KD9A 4EIQA 3EPTA 1CC2A 1CHUA 1E1LA 1Q1RA 3SZCA 4B63A 4A65A 1Y56B 4U8PA 3VR8A 2C4CA 4JY3A 1S3EA 1LJ1A 2YR5A 5FS7A 2BA9A 1D7LA 3VQRA 2YG6A 1DJNA 1IUUA 2AR8A 1K0JA 3ALLA 2YAUA 5M0ZA 3LZXA 2X3NA 1LQTA 1TDNA 1PXAA 5HY5A 4EM3A 1CC4A 3LZWA 4H4QA 5JCNA 3AD7B 3H8LA 3QSMA 1E1KA 4H4XA 1ELIA 1SEZA 3GDPA 2EQ6A 2XLRA 2V61A 2GR0A 3PG6A 3AE8A 3T14A 3G5SA 3LOVA 2C70A 3AE9A 1EL7A 2GB0A 2Z5XA 4IVOB 2R45A 5JRBA 1VRQB 2C72A 3ATQA 1M64A 1Y0PA 2C66A 1EL5A 2VRLA 5JCLA 2C76A 3K7MX 2WU2A 3LADA 4B64A 1GRTA 3P4QA 5HYMA 1O94A 1E39A 4G6GA 3NN6X 1LQUA 3AEAA 2WDQA 1N1PA 2A87A 2EQ8A 3DJDA 2A8XA 2YVFA 4A6NB 2Q0LA 3GD3A 2V5ZA 3GWDA 3D8XA 1ZX9A 1GEUA 3KU9A 5EBKA 4TLZA 3DMEA 1BZLA 2XVJA 1PJ7A 1DNCA 2BXSA 1COYA 3BI5A 4ECHA 3KLJA 1BF3A 2WDVA 1TDFA 1X31B 4YT0A 3AEGA 3UTFA 3VRDB 3P4RA 1E6EA 3SZ0A 1IUXA 1E7PA 4FK1C 3ITJA 4G73A 1D5TA 4WX1A 5IPYA 4TM1A 1K0IA 2Z5YA 3KVEA 2XFOA 3AD8B 1FOHA 3CNJA 4J33A 3SFDA 2GV8A 3AYJA 1F6MA 2OLNA 1YQ4A 4YSZA 2R0PA 2WU5A 1GRBA 4J57A 3AB1A 3UKPA 3E1TA 2BCPA 3NTDA 4G74A 2XYOA 1KFYA 1F8RA 2A89A 2WP9A 4U8MA 3RP6A 2WOIA 1H7WA 2E1MA 4MJWA 4BK1A 2X8CA 4BURA 3CNTA 3NIXA 3KPFA 4BK2A 3CNSA 4H7UA 1PXCA 4XWRA 2ZZCA 4EMJA 2IVEA 2XVIA 1EBDA 4X4JA 3DK8A 5CQFA 5IQ1A 1NHPA 1CJCA 2XLSA 3CPIG 2ZZBA 2DKIA 2C73A 2RGHA 4JNQA 1HYUA 3H8IA 2X8GA 2XVHA 1KNRA 2WESA 2VOUA 3AYIA 3BHFA 4IA5A 3QFAA 5JCIA 1H7XA 1VG0A 2RABA 4CCQA 3SX6A 1VG9A 3ICSA 4G9KA 2FJBA 4J36A 3UKAA 2YLXA 2BS4A 5L46A 3GMBA 3I3LA 4CCRA 2W0HA 5TR3A 5HHFA 3RHAA 4WCTA 3RP8A 3GMCA 4YTPA 3AE1A 3F8PA 3RNMA 3UKLA 3NYEA 2BS3A 3OC4A 1D4CA 1OJCA 3SM8A 3QVRA 1B8SA 3BNMA 3IF9A 2JK6A 3AECA 2NPXA 2GAHB 4HB9A 1B5QA 4B69A 2XDOA 3NG7X 1L9DA 5CKUA 3AE5A 2GR3A 5KWFA 3NN0X 4NZHA 2RGJA 3UOZA 4AOXA 1IJHA 3K7QX 3FBSA 1LVLA 1FEAA 1RSGA 2AQJA 2UZZA 3G5RA 4AT2A 3NHOX 4H4UA 1GRAA 4JNAA 2YLWA 4PABA 1VDCA 1L9EA 1GOSA 1PBEA 2BXRA 3WE0A 1GTHA 1NEKA 1B4VA 5BULA 4K2XA 3SYIA 2CFYA 5KOXA 4YSYA 1GPEA 3CIRA 1CL0A 5HXIA 2XLPA 4A7AA 2E5VA 4H4WA 3V3OA 4OPTA 3P9UA 2JB1A 4EQRA 3P1WA 2CVJA 4Z24A 4U2TA 3CGCA 1OJ9A 1PDHA 3P4SA 3PO7A 3LB8A 4EQXA 3SXIA 3UOYA 3QSSA 2WP5A 3VRBA 3URHA 5JCMA 2V3BA 1CJ4A 2VQBA 2GQWA 3DJJA 5FMHA 2BACA 3NGCX 4C5OA 2B7SA 2YLSA 4NTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E4G A;  4YTN A;  4GUV A;  3II4 A;  1ZMC A;  1PBF A;  5IQ4 A;  4K7Z A;  4Y4L A;  3V3N A;  2X8H A;  3AE3 A;  2GR1 A;  2R0C A;  4BV6 A;  4X9M A;  4H2Q A;  4I58 A;  1IUT A;  4A79 A;  4REK A;  3AED A;  2TPR A;  3L8K A;  4PAA A;  4FDC B;  4CY6 A;  1RP0 A;  4J56 A;  2NVK X;  3CGD A;  1IUS A;  2WEU A;  3CPJ G;  3VR9 A;  2OA1 A;  1S3B A;  4H4S A;  3AD9 B;  5KVI A;  1DOE A;  1JRZ A;  2GMH A;  4U2S A;  3SGL A;  2FBW A;  1DXL A;  5C3J A;  1GV4 A;  1H6V A;  4K8D A;  4BK3 A;  3KA7 A;  1EL9 A;  1ZP0 A;  2F5Z A;  4B66 A;  3NYC A;  1PJ5 A;  1H83 A;  2V60 A;  4IVM B;  4C3X A;  4B67 A;  3T37 A;  4K5S A;  1E1M A;  4U8K A;  3EAN A;  1FL2 A;  3JSK A;  1MOK A;  1H81 A;  4X9N A;  5EB5 A;  3EF6 A;  1OJD A;  5J60 A;  5KOW A;  2YVJ A;  1TYT A;  1FEB A;  4H4Z A;  2WQY A;  2QA2 A;  2YG5 A;  4OPC A;  2YLR A;  4J2W A;  1CJ2 A;  2WPC A;  1NG3 A;  1S2Y A;  1Z6L A;  2YLT A;  2C7G A;  2YVG A;  1GRH A;  4CY8 A;  1JEH A;  3NNE A;  3C4A A;  1XDI A;  2QAE A;  2R9Z A;  1NPX A;  2EQ9 A;  4USR A;  4H50 A;  3V76 A;  2JB2 A;  1JNR A;  4ZCC A;  1NAA A;  1Y56 A;  5FS6 A;  4AOS A;  2X99 A;  4EQW A;  3LXD A;  4EIP A;  4TM0 A;  3NT6 A;  3PS9 A;  2R4E A;  4KPR A;  4JY2 A;  3IHM A;  4USQ A;  1AOG A;  2YWL A;  2AAQ A;  1TYP A;  2WDR A;  4AP1 A;  2BK3 A;  3M13 A;  1QO8 A;  3FPZ A;  4EMI A;  2GMJ A;  1ZMD A;  1H82 A;  4OPU A;  1LPF A;  4LU6 A;  3DJG X;  2BC0 A;  3UKQ A;  2VVM A;  3BI4 A;  4APN A;  4FK1 A;  3GYI A;  1QLB A;  1GET A;  4I59 A;  5JCK A;  4AP3 A;  2GF3 A;  3DGH A;  3ABV A;  2XFQ A;  4YKF A;  4XXG A;  4C77 A;  1FCD A;  2YM2 A;  4XWZ A;  1LV0 A;  1IUW A;  4RG4 A;  4Z25 A;  3Q6J A;  2R46 A;  1PS9 A;  4CNJ A;  5GSN A;  3CGE A;  1F8S A;  2BS2 A;  2WHD A;  2HQM A;  2YM1 A;  1F8W A;  4OPI A;  4Y4M A;  3ZYX A;  1YKJ A;  4U8L A;  1PJ6 A;  5U63 A;  3DK9 A;  4UDP A;  4J31 A;  4YWO A;  2JB3 A;  4P9S A;  4ZN0 A;  4U8O A;  4DSG A;  2B76 A;  4UP3 A;  2Y6Q A;  4D03 A;  1DOC A;  4IV9 A;  4YKG A;  3NTA A;  4BJY A;  1ONF A;  3OZ2 A;  1BWC A;  3VRA A;  3Q9T A;  2VVL G;  4U8N A;  1K4Q A;  1KF6 A;  4K5R A;  1DOB A;  2YG4 A;  2BAB A;  1B37 A;  4H2N A;  2VVL A;  4H2R A;  1K0L A;  4TM4 A;  4DNA A;  1E1N A;  1N4W A;  4OPL A;  1ZOY A;  2XVE A;  2C65 A;  3C96 A;  3M12 A;  4JN9 A;  2DKH A;  3K30 A;  3UP4 A;  4OPG A;  3IC9 A;  1KSU A;  1KSS A;  1UKV G;  1XAN A;  2WBA A;  4KX6 A;  1ZK7 A;  1OJT A;  2WET A;  5EB4 A;  4H4Y A;  4Z2U A;  3GRS A;  1GES A;  4GF7 A;  1PXB A;  3UKK A;  1OJA A;  5U25 A;  1ZKQ A;  1EL8 A;  2RGO A;  1L9C A;  4Z43 A;  3UTH A;  4UDR A;  4E0V A;  2XVF A;  3QFB A;  2ACZ A;  4OPD A;  3NK1 X;  2C3D A;  4K22 A;  2X50 A;  4TLX A;  3RP7 A;  3SQP A;  3DA1 A;  5GRT A;  3UKF A;  4DSH A;  4A99 A;  2GEW A;  1GRF A;  3P4P A;  2YQU A;  1CC6 A;  2XFP A;  1GND A;  3CND A;  3QJ4 A;  3S5W A;  3NLC A;  3ICR A;  4CNK A;  4Z26 A;  2VQ7 A;  4YSX A;  2FJD A;  2FJA A;  3S61 A;  3GDN A;  1Q1W A;  3ADA B;  3HZL A;  4Z44 A;  1V59 A;  4NTE A;  2R4J A;  5EOW A;  4A6N A;  1L0V A;  2OAL A;  4N9X A;  4Z2T A;  4H4P A;  3FG2 P;  2C75 A;  3NH3 X;  5C2T A;  5BVA A;  4U8J A;  4RG3 A;  2CDU A;  4EM4 A;  3UKH A;  2ZBW A;  2V3A A;  3B3R A;  1P2E A;  3CPH G;  4YXD A;  1GRE A;  2GRT A;  4GDE A;  4YSH A;  3AEF A;  2OAM A;  2PYX A;  4EMW A;  3C4N A;  3FIM B;  3NRN A;  2C64 A;  1RYI A;  4H2P A;  4OCG A;  4Y4N A;  4Z2R A;  4H4T A;  1FEC A;  1PBC A;  4C3Y A;  1Q9I A;  1YQ3 A;  2Q7V A;  1DOD A;  2B9X A;  3G5Q A;  3ICT A;  3IHG A;  3LJP A;  1LTX R;  3O0H A;  1JRY A;  4RSL A;  2WP6 A;  2J3N A;  3SFE A;  1PBB A;  4B65 A;  4NEV A;  3UCL A;  2XLU A;  2YR6 A;  1GRG A;  2PHH A;  1CBO A;  2APG A;  3I6D A;  3ALM A;  4JDR A;  1O5W A;  5M10 A;  2XFN A;  2XCG A;  1PHH A;  1TDK A;  1NHS A;  3UP5 A;  1H84 A;  2EQ7 A;  4JQ9 A;  1BKW A;  4UDQ A;  4CRT A;  4GR1 A;  3GRT A;  2V6O A;  4LA1 A;  1D4D A;  1QJD A;  1M6I A;  2ARD A;  2YLZ A;  3DH9 A;  3ALJ A;  1JOA A;  4O5Q A;  1S2Q A;  4IA6 A;  4B68 A;  3KKJ A;  2BYB A;  3GWF A;  3AXB A;  5FS8 A;  4AT0 A;  3CN8 A;  1ZOV A;  2BCG G;  4NTC A;  2FJE A;  3BI2 A;  3ISH A;  4ICY A;  2IVD A;  2I0Z A;  4D04 A;  4O5U A;  2GVC A;  4ZCD A;  2JBV A;  1GSN A;  2O9Z A;  3CTY A;  2XLT A;  3PVC A;  3UTG A;  4J34 A;  2WS3 A;  5KVH A;  1JNZ A;  2H88 A;  4YTM A;  3COX A;  3BHK A;  3K7T A;  2YR4 A;  3AEE A;  1TRB A;  3NKS A;  2H89 A;  3ATR A;  2VRM A;  4LII A;  2B9W A;  2B9Y A;  2YG3 A;  2R0G A;  3QSE A;  2YG7 A;  2IID A;  3L1R A;  5KRQ A;  2GH5 A;  1CJ3 A;  4U2L A;  1GAL A;  1W4X A;  3AE4 A;  3UOX A;  1D7Y A;  3CNP A;  2WOV A;  2Q0K A;  1YY5 A;  4CBQ A;  2JAE A;  1TDE A;  1KNP A;  2TMD A;  3AE6 A;  2GAG B;  1BGJ A;  4DGK A;  3NK2 X;  1GT8 A;  1VQW A;  4ADW A;  1NEN A;  3B6D A;  3M0O A;  1KDG A;  1ZDL A;  3NYF A;  1PN0 A;  1TDO A;  1N4V A;  3QVP A;  4GRT A;  4FX9 A;  2BC1 A;  1GTE A;  1DJQ A;  4BJZ A;  3GD4 A;  3BNU A;  1GXF A;  3RED A;  4U8I A;  2ZZ0 A;  2CUL A;  5DBJ A;  1N4U A;  1BGN A;  2XFU A;  4OVI A;  1P2H A;  5LV9 A;  1NG4 A;  1O95 A;  2VZ2 A;  2JKC A;  1JU2 A;  1JRX A;  3UOV A;  2QCU A;  1H86 A;  2GR2 A;  3GSI A;  4H4V A;  1MO9 A;  1GER A;  3NK0 X;  4C74 A;  5U1O A;  1XPQ A;  3DJE A;  1F3P A;  2QA1 A;  5BRT A;  3AEB A;  5FS9 A;  5ER0 A;  1CF3 A;  1REO A;  1NHQ A;  1NDA A;  3CGB A;  4NEW A;  2B7R A;  2WOW A;  3AWI A;  1PBD A;  2BK4 A;  4TM3 A;  3UTE A;  4A5L A;  3H4K A;  4B1B A;  4M52 A;  1IUV A;  3DGZ A;  4EQS A;  2C3C A;  2Y6R A;  3AYL A;  3F8R A;  3AE2 A;  3F8D A;  4H4R A;  3GYJ A;  3R9U A;  3DK4 A;  3EAO A;  4GCM A;  1MXT A;  1ZY8 A;  1NHR A;  2WPF A;  4GDP A;  2WPE A;  3FMW A;  2C67 A;  4A9W A;  5KXJ A;  4HA6 A;  3ZDN A;  2OLO A;  5BUK A;  3IWA A;  2GQF A;  3D1C A;  1XHC A;  2Q6U A;  2BK5 A;  1D4E A;  3AE7 A;  1YQZ A;  5J7X A;  3KD9 A;  4EIQ A;  3EPT A;  1CC2 A;  1CHU A;  1E1L A;  1Q1R A;  4B63 A;  4A65 A;  1Y56 B;  4U8P A;  3VR8 A;  4JY3 A;  1S3E A;  1LJ1 A;  2YR5 A;  5FS7 A;  2BA9 A;  1D7L A;  3VQR A;  2YG6 A;  1DJN A;  1IUU A;  2AR8 A;  1K0J A;  3ALL A;  2YAU A;  5M0Z A;  3LZX A;  2X3N A;  1LQT A;  1TDN A;  1PXA A;  5HY5 A;  4EM3 A;  1CC4 A;  3LZW A;  4H4Q A;  5JCN A;  3AD7 B;  3H8L A;  3QSM A;  1E1K A;  4H4X A;  1ELI A;  1SEZ A;  3GDP A;  2EQ6 A;  2XLR A;  2V61 A;  2GR0 A;  3AE8 A;  3G5S A;  3LOV A;  2C70 A;  3AE9 A;  1EL7 A;  2GB0 A;  2Z5X A;  4IVO B;  2R45 A;  1VRQ B;  2C72 A;  3ATQ A;  1M64 A;  1Y0P A;  2C66 A;  1EL5 A;  2VRL A;  5JCL A;  2C76 A;  3K7M X;  2WU2 A;  3LAD A;  4B64 A;  1GRT A;  3P4Q A;  5HYM A;  1O94 A;  1E39 A;  3NN6 X;  1LQU A;  3AEA A;  2WDQ A;  1N1P A;  2A87 A;  2EQ8 A;  3DJD A;  2A8X A;  2YVF A;  4A6N B;  2Q0L A;  3GD3 A;  2V5Z A;  3GWD A;  3D8X A;  1ZX9 A;  1GEU A;  3KU9 A;  5EBK A;  4TLZ A;  3DME A;  1BZL A;  2XVJ A;  1PJ7 A;  1DNC A;  2BXS A;  1COY A;  3BI5 A;  4ECH A;  3KLJ A;  1BF3 A;  2WDV A;  1TDF A;  1X31 B;  4YT0 A;  3AEG A;  3UTF A;  3VRD B;  3P4R A;  1E6E A;  1IUX A;  1E7P A;  4FK1 C;  3ITJ A;  4WX1 A;  1D5T A;  5IPY A;  4TM1 A;  1K0I A;  2Z5Y A;  3KVE A;  2XFO A;  3AD8 B;  1FOH A;  3CNJ A;  4J33 A;  3SFD A;  2GV8 A;  3AYJ A;  1F6M A;  2OLN A;  1YQ4 A;  4YSZ A;  2R0P A;  2WU5 A;  1GRB A;  4J57 A;  3AB1 A;  3UKP A;  3E1T A;  2BCP A;  3NTD A;  2XYO A;  1KFY A;  1F8R A;  2A89 A;  2WP9 A;  4U8M A;  3RP6 A;  2WOI A;  1H7W A;  2E1M A;  4MJW A;  4BK1 A;  2X8C A;  4BUR A;  3CNT A;  3NIX A;  3KPF A;  4BK2 A;  3CNS A;  4H7U A;  1PXC A;  4XWR A;  2ZZC A;  4EMJ A;  2IVE A;  2XVI A;  1EBD A;  4X4J A;  3DK8 A;  5CQF A;  5IQ1 A;  1NHP A;  1CJC A;  2XLS A;  3CPI G;  2ZZB A;  2DKI A;  2C73 A;  2RGH A;  4JNQ A;  1HYU A;  3H8I A;  2X8G A;  2XVH A;  1KNR A;  2WES A;  2VOU A;  3AYI A;  3BHF A;  4IA5 A;  3QFA A;  5JCI A;  1H7X A;  1VG0 A;  2RAB A;  4CCQ A;  1VG9 A;  3ICS A;  4J36 A;  2FJB A;  3UKA A;  5L46 A;  2YLX A;  2BS4 A;  3GMB A;  3I3L A;  4CCR A;  2W0H A;  5TR3 A;  5HHF A;  3RHA A;  4WCT A;  3RP8 A;  3GMC A;  4YTP A;  3AE1 A;  3F8P A;  3RNM A;  3UKL A;  3NYE A;  2BS3 A;  3OC4 A;  1D4C A;  1OJC A;  3SM8 A;  3QVR A;  1B8S A;  3BNM A;  3IF9 A;  2JK6 A;  3AEC A;  2NPX A;  2GAH B;  4HB9 A;  1B5Q A;  4B69 A;  2XDO A;  3NG7 X;  1L9D A;  5CKU A;  3AE5 A;  2GR3 A;  5KWF A;  3NN0 X;  4NZH A;  2RGJ A;  3UOZ A;  4AOX A;  1IJH A;  3K7Q X;  3FBS A;  1LVL A;  1FEA A;  1RSG A;  2AQJ A;  2UZZ A;  3G5R A;  4AT2 A;  3NHO X;  4H4U A;  1GRA A;  4JNA A;  2YLW A;  4PAB A;  1VDC A;  1L9E A;  1GOS A;  1PBE A;  2BXR A;  3WE0 A;  1GTH A;  1NEK A;  1B4V A;  5BUL A;  4K2X A;  2CFY A;  5KOX A;  4YSY A;  1GPE A;  3CIR A;  1CL0 A;  5HXI A;  2XLP A;  4A7A A;  2E5V A;  4H4W A;  3V3O A;  4OPT A;  3P9U A;  2JB1 A;  4EQR A;  3P1W A;  2CVJ A;  4Z24 A;  4U2T A;  3CGC A;  1OJ9 A;  1PDH A;  3P4S A;  3PO7 A;  3LB8 A;  4EQX A;  3UOY A;  3QSS A;  2WP5 A;  3VRB A;  3URH A;  5JCM A;  1CJ4 A;  2V3B A;  2VQB A;  2GQW A;  3DJJ A;  5FMH A;  2BAC A;  3NGC X;  4C5O A;  2B7S A;  2YLS A;  4NTD A; 
#chains in the Genus database with same CATH topology
 3KPK A;  1ZMC A;  4H1Z A;  4NWZ A;  2R0C A;  4I58 A;  3TWB A;  4A79 A;  3AED A;  3L8K A;  2AL2 A;  4M6U A;  3SN1 A;  5KVI A;  5KMR A;  4U2S A;  1GV4 A;  1H6V A;  1EL9 A;  2GGI A;  3HYW A;  4GYP A;  1R0M A;  4B67 A;  1E1M A;  3EAN A;  1FL2 A;  1H81 A;  5EB5 A;  3T0K A;  4OPC A;  1TYT A;  4H4Z A;  2QA2 A;  2YLR A;  1NG3 A;  1S2Y A;  2YLT A;  4H83 A;  2C7G A;  3C4A A;  2PPG A;  2JB2 A;  1NAA A;  3DEQ A;  1Y56 A;  3PS9 A;  2R4E A;  1RVK A;  1AOG A;  3SZW A;  1TYP A;  3SBF A;  4GIS A;  1QO8 A;  4LU6 A;  1RM6 B;  3UKQ A;  4I59 A;  4XXG A;  4MKS A;  1FCD A;  1F8S A;  2BS2 A;  4OPI A;  4Y4M A;  3HRD C;  4U8L A;  5U63 A;  4UDP A;  5KNL A;  4J31 A;  4P9S A;  2I5Q A;  4U8O A;  2B76 A;  4D03 A;  3N4E A;  3V5C A;  1ONF A;  1BWC A;  3EUB 3;  4K5R A;  2YG4 A;  4DNA A;  4A6G A;  1ZOY A;  3C96 A;  2DKH A;  1PDY A;  3UP4 A;  3OTR A;  1ZK7 A;  4K8G A;  2WET A;  1GES A;  4GF7 A;  1NU5 A;  1ZKQ A;  4KT2 A;  1L9C A;  3UTH A;  2XVF A;  3QFB A;  2ACZ A;  3SQP A;  2YQU A;  1CC6 A;  3NLC A;  2OVL A;  3ICR A;  1KN0 A;  2FJD A;  2FJA A;  3ADA B;  3HZL A;  5FJP A;  4NTE A;  2R4J A;  3R10 A;  4Z2T A;  4H4P A;  5BVA A;  2V3A A;  4GGH A;  4GDE A;  3IJQ A;  2OAM A;  3NRN A;  2C64 A;  4C3Y A;  1Q9I A;  3G5Q A;  1OEP A;  1JRY A;  2OZ3 A;  3SFE A;  2PP1 A;  3MSY A;  1GRG A;  3UJS A;  4E6M A;  2APG A;  1IYX A;  4JDR A;  1PHH A;  3UP5 A;  4GR1 A;  2V6O A;  4O5Q A;  3A7A A;  6ENL A;  4IA6 A;  2MUC A;  5FS8 A;  4NTC A;  2I0Z A;  2GVC A;  3PVC A;  4ROP A;  3UTG A;  4J34 A;  4IL0 A;  2H88 A;  2HXT A;  3AEE A;  4LII A;  4DX3 A;  3UCD A;  3QSE A;  2YG7 A;  5KRQ A;  4U2L A;  3RGT A;  1W4X A;  3CNP A;  2WOV A;  3JW7 A;  1TDE A;  3AE6 A;  3NK2 X;  1VQW A;  3B6D A;  1WUE A;  3VC5 A;  1N4V A;  4FX9 A;  2BC1 A;  3MUC A;  1GTE A;  4U8I A;  3TQP A;  2OX4 A;  1N61 C;  5DBJ A;  1BGN A;  2VZ2 A;  2GR2 A;  1GER A;  3NK0 X;  4C74 A;  5BRT A;  5FS9 A;  1W6T A;  3QN3 A;  2WOW A;  3UTE A;  4TM3 A;  3H4K A;  3ES8 A;  1SJD A;  4M52 A;  1IUV A;  3R9U A;  3DK4 A;  1JCT A;  1MXT A;  1NHR A;  2WPE A;  3ZDN A;  4K1W A;  3IWA A;  2BK5 A;  3OZY A;  2PGE A;  3EPT A;  4B63 A;  3SZC A;  4U8P A;  3GY1 A;  2YG6 A;  1IUU A;  2YAU A;  1LQT A;  1TDN A;  1CC4 A;  3LZW A;  5JCN A;  4H4X A;  3GDP A;  2HXU A;  3PG6 A;  1BKH A;  2C70 A;  3AE9 A;  1EL5 A;  2OO6 A;  5JCL A;  3K7M X;  2XH7 A;  2WU2 A;  4B64 A;  4KWS A;  5HYM A;  1E39 A;  2QQ6 A;  3JZU A;  1LQU A;  3AEA A;  2EQ8 A;  2A8X A;  2V5Z A;  3VFC A;  3AMZ A;  4MGG A;  5EBK A;  4TLZ A;  1BZL A;  3VCN A;  1E6E A;  5IPY A;  4WX1 A;  1D5T A;  3KVE A;  3CNJ A;  3CAW A;  4GME A;  2OLN A;  1GRB A;  3P93 A;  2BCP A;  4U8M A;  2FYM A;  3KPF A;  2ZZC A;  1FO4 A;  3AN1 A;  3HPF A;  2DKI A;  2C73 A;  3H8I A;  1KNR A;  3AYI A;  2VOU A;  1VG0 A;  2RAB A;  3ICS A;  5HHF A;  4WCT A;  2GGH A;  2QJJ A;  3GMC A;  3RNM A;  1XPY A;  3TJ4 A;  3IF9 A;  3AEC A;  3SQS A;  1BQG A;  4HB9 A;  2XDO A;  3IJL A;  3VC6 A;  3NG7 X;  2PMQ A;  5KWF A;  4AOX A;  3K7Q X;  1FEA A;  1EC9 A;  3G5R A;  3NHO X;  4DXK A;  4H4U A;  1GOS A;  1PBE A;  3STP A;  1B4V A;  5BUL A;  2CFY A;  3TOY A;  4HCH A;  3N4F A;  1OJ9 A;  3A7U A;  3LB8 A;  3QSS A;  4HN8 A;  4HNL A;  5IDZ A;  3NVW B;  4C5O A;  3AE3 A;  2B7S A;  5M10 A;  3B97 A;  2PS2 A;  4KPL A;  3II4 A;  4Y4L A;  4X9M A;  2OZT A;  4H2Q A;  4ENL A;  3OPS A;  4PAA A;  2PCE A;  5FJT A;  4HNC A;  3CPJ G;  3CYJ A;  3AM9 A;  1JRZ A;  2GMH A;  3H12 A;  2FBW A;  5C3J A;  2XH4 A;  4BK3 A;  3NYC A;  4IVM B;  4K5S A;  4U8K A;  1JRO A;  5KOW A;  3EF6 A;  2YVJ A;  2YG5 A;  2GGJ A;  3BSM A;  2POD A;  4J2W A;  1CJ2 A;  2WPC A;  4CY8 A;  3S5S A;  1JEH A;  1EBG A;  3ZVI A;  2EQ9 A;  4G8T A;  4H50 A;  2P88 A;  1JNR A;  4AOS A;  4EQW A;  3LXD A;  1WYG A;  3NXL A;  2YWL A;  2BK3 A;  4EMI A;  2GMJ A;  1H82 A;  2OLA A;  3BI4 A;  1GET A;  3DGH A;  3ABV A;  4YKF A;  4EWJ A;  4IT1 A;  4IZG A;  3CGE A;  3CXO A;  1T3Q C;  2WHD A;  2HQM A;  2JB3 A;  4ZN0 A;  3VRA A;  2ZC8 A;  4U8N A;  1KF6 A;  2VVL A;  3HYV A;  1K0L A;  3L5O A;  1E1N A;  4IL2 A;  3FV9 A;  1XAN A;  2WBA A;  3SR6 B;  3T2Z A;  4GGB A;  2BRY A;  4X2P A;  5U25 A;  1EL8 A;  4UDR A;  2C3D A;  2X50 A;  3RP7 A;  3QKE A;  3DA1 A;  3UKF A;  4DSH A;  4A99 A;  4YWS A;  4HCD A;  3MKC A;  3K1G A;  3S61 A;  4DWD A;  5EOW A;  4A6N A;  3NH3 X;  3VA8 A;  2ZBW A;  3B3R A;  4YXD A;  1ZXI C;  3UJF A;  4YSH A;  3AEF A;  4Y4N A;  4OCG A;  1PBC A;  3ZLG A;  3IHG A;  3ICT A;  2B9X A;  3R0K A;  2J3N A;  1PBB A;  2P8C A;  3UCL A;  2YR6 A;  3I6D A;  3ALM A;  3NVY B;  1O5W A;  2XCG A;  1BKW A;  4UDQ A;  1D4D A;  1M6I A;  2ARD A;  4NNJ A;  1S2Q A;  3KKJ A;  3ZVH A;  1VDV A;  2FJE A;  3BI2 A;  4ICY A;  2P3Z A;  1GSN A;  1SJA A;  2O9Z A;  2XLT A;  2WS3 A;  1JNZ A;  3TWA A;  4YTM A;  2PTX A;  3COX A;  3N6H A;  3NKS A;  2GSH A;  3ENL A;  2PGW A;  2B9Y A;  2QDE A;  2IID A;  4FI4 A;  1GAL A;  3AE4 A;  4Z1Y A;  1PDZ A;  2TMD A;  1GT8 A;  1KDG A;  1MDL A;  4MMW A;  1TDO A;  1ECQ A;  3QVP A;  3RED A;  1GXF A;  1N4U A;  2AL2 B;  1P2H A;  5LV9 A;  3UOV A;  2QCU A;  1H86 A;  3GSI A;  4H4V A;  2QDD A;  3D46 A;  1F3P A;  1H2I A;  3DG3 A;  5KMS A;  5ER0 A;  3CGB A;  2BK4 A;  4A5L A;  3UJ2 A;  1EC8 A;  2QJM A;  3AYL A;  3DGZ A;  2OQH A;  3DGB A;  2W54 A;  4GCM A;  3DER A;  3FCP A;  5KXJ A;  1D4E A;  3AE7 A;  3I6E A;  4EIQ A;  1CC2 A;  1CHU A;  1E1L A;  4A65 A;  3VR8 A;  2C4C A;  4JY3 A;  1LJ1 A;  2BA9 A;  1D7L A;  4A35 A;  1DJN A;  1K0J A;  4H19 A;  3LZX A;  2X3N A;  5HY5 A;  4H4Q A;  3AD7 B;  3ZLH A;  3H8L A;  3QSM A;  4JN7 A;  2EQ6 A;  3T14 A;  1FFU C;  5EU9 A;  1R6W A;  3DES A;  2C72 A;  1M64 A;  1Y0P A;  2C66 A;  3LAD A;  4DYE A;  3DDM A;  3NN6 X;  3DJD A;  3PFR A;  3TJI A;  3DG7 A;  3KU9 A;  1EC7 A;  3R0U A;  2OQY A;  1COY A;  3BI5 A;  4ECH A;  4IHC A;  1BF3 A;  2WDV A;  1TDF A;  3AEG A;  3VRD B;  4FK1 C;  3TCS A;  2Z5Y A;  2XFO A;  3SFD A;  1YQ4 A;  2R0P A;  2WU5 A;  3E1T A;  3RO6 A;  3NTD A;  4G74 A;  2XYO A;  1TZZ A;  2WP9 A;  1JPD X;  4MJW A;  2PP3 A;  4BUR A;  3NIX A;  4BK2 A;  3CNS A;  2XVI A;  1EBD A;  4X4J A;  3DK8 A;  1NHP A;  2XLS A;  2W55 A;  2X8G A;  2XVH A;  3BHF A;  2CHR A;  3V4B A;  1VG9 A;  3UKA A;  2P8B A;  2FJB A;  1F9C A;  2DW6 A;  3BJS A;  3RRA A;  3UKL A;  3NYE A;  1N63 C;  3OC4 A;  1OJC A;  3QVR A;  1SB3 B;  2JK6 A;  2QVH A;  2GAH B;  1VQZ A;  3R07 C;  2GR3 A;  3NN0 X;  2RGJ A;  3FBS A;  3PWI A;  1RSG A;  2UZZ A;  4AT2 A;  1XS2 A;  1STZ A;  1GRA A;  2YLW A;  2BXR A;  3WE0 A;  1NEK A;  5FJU A;  5KOX A;  3CIR A;  4A3R A;  4H4W A;  3V3O A;  3P9U A;  3TTE A;  2JB1 A;  4Z24 A;  3RR1 A;  4U2T A;  4HYR A;  3P4S A;  3OW1 A;  3SXI A;  4EQX A;  3UOY A;  3VRB A;  5JCM A;  2VQB A;  1P48 A;  2PTY A;  3NGC X;  5FMH A;  3VR9 A;  2YLZ A;  2YLS A;  4NTD A;  3Q4D A;  4YTN A;  4GUV A;  5IQ4 A;  4K7Z A;  3V3N A;  4Z17 A;  3KUM A;  1IUT A;  2TPR A;  2BRA A;  4CY6 A;  4FDC B;  1MDR A;  4J56 A;  2NVK X;  3CGD A;  4GIR A;  1DOE A;  1ZP0 A;  3CMM A;  4B66 A;  3DG6 A;  1PJ5 A;  3SZF A;  4X9N A;  1OJD A;  2WQY A;  3T8Q A;  3NNE A;  2E5A A;  3SJN A;  2R9Z A;  4USR A;  3V76 A;  3V3W A;  4TVY A;  5FS6 A;  4DN1 A;  2X99 A;  3NT6 A;  4DHG A;  4KPR A;  4JY2 A;  3IHM A;  4AP1 A;  4TVW A;  1ZMD A;  1LPF A;  3DJG X;  2BC0 A;  1FHV A;  2OFJ A;  2VVM A;  4APN A;  3GYI A;  1QLB A;  5JCK A;  2GF3 A;  2XFQ A;  4C77 A;  3T2Y A;  4XWZ A;  2YM2 A;  1LV0 A;  4RG4 A;  4Z25 A;  2R46 A;  4CNJ A;  2YM1 A;  1F8W A;  1YKJ A;  3DK9 A;  4HPN A;  4DSG A;  2XGZ A;  2Y6Q A;  3P3B A;  1DOC A;  4YKG A;  4KEM A;  4BJY A;  3OZ2 A;  3Q9T A;  3MQT A;  1B37 A;  3NS1 B;  4H2R A;  4TM4 A;  4JHM A;  1N4W A;  3M12 A;  4OPG A;  3IC9 A;  1KSU A;  3ES7 A;  1N5X A;  1KSS A;  1UKV G;  4Z2U A;  3GYX A;  3GRS A;  2MNR A;  3UKK A;  1OJA A;  3N6J A;  4Z43 A;  5KMQ A;  4E0V A;  4ZCW A;  5KMP A;  4GAV A;  2GEW A;  2XFP A;  1GND A;  3CND A;  1WUF A;  4CNK A;  4Z26 A;  3ETR B;  2VQ7 A;  4YSX A;  3GDN A;  4ZA0 A;  4Z44 A;  4GYP C;  3DFH A;  1L0V A;  2OAL A;  4N9X A;  3FG2 P;  4U8J A;  2OG9 A;  4RG3 A;  2CDU A;  3NO1 A;  1P2E A;  1GRE A;  2PYX A;  4EMW A;  1RYI A;  4H4T A;  1FEC A;  5G5H B;  1YQ3 A;  4HCL A;  1LTX R;  4RSL A;  2WP6 A;  1YEY A;  2HNE A;  3CK5 A;  4B65 A;  2XLU A;  2FKP A;  1CBO A;  3FXG A;  2XFN A;  1TDK A;  1NHS A;  4JQ9 A;  4CRT A;  3D9X A;  1L8P A;  3DH9 A;  4B68 A;  3GWF A;  3AXB A;  2BCG G;  3ISH A;  2IVD A;  4O5U A;  4G7F A;  3BHK A;  3L1R A;  3UOX A;  3SN0 A;  2Q0K A;  1N62 C;  3ZLF A;  4CBQ A;  3V5F A;  2GAG B;  3M0O A;  3GD6 A;  1PN0 A;  3PK7 A;  4GRT A;  3GD4 A;  2OZ8 A;  2CUL A;  4OVI A;  2JKC A;  1JU2 A;  1MRA A;  1MO9 A;  2ONE A;  2RDX A;  5U1O A;  1XPQ A;  2QA1 A;  3AEB A;  1NHQ A;  3AWI A;  4NEW A;  4B1B A;  3F8R A;  3F8D A;  3GYJ A;  3T6C A;  3D47 A;  2WPF A;  3UJE A;  4GDP A;  3FMW A;  2OLO A;  5BUK A;  2OKT A;  4JN8 A;  3D1C A;  1XHC A;  2Q6U A;  1Q1R A;  5FS7 A;  3VQR A;  2AR8 A;  3ALL A;  1PXA A;  4K2S A;  3VDG A;  3THU A;  1ELI A;  1SEZ A;  2XLR A;  2V61 A;  2GR0 A;  1EL7 A;  2Z5X A;  2R45 A;  5JRB A;  4FP1 A;  3ATQ A;  2VRL A;  2ZAD A;  4J1O A;  1GRT A;  3P4Q A;  1O94 A;  4G6G A;  2WDQ A;  2A87 A;  2YVF A;  4A6N B;  2Q0L A;  3GD3 A;  2GL5 A;  3D8X A;  3DME A;  1PJ7 A;  1DNC A;  5FJR A;  4YT0 A;  1X2G A;  3P4R A;  1IUX A;  1X2H A;  1E7P A;  4G73 A;  3MWC A;  2GV8 A;  2PTZ A;  3T9P A;  3AYJ A;  1F6M A;  3EEZ A;  4YSZ A;  4J57 A;  3AB1 A;  3UKP A;  1F8R A;  2PP0 A;  5FJO A;  4ZOH B;  2WOI A;  2X8C A;  4F4R A;  3CNT A;  4XWR A;  5CQF A;  3CPI G;  3UXK A;  2ZZB A;  5BOE A;  1HYU A;  3VCC A;  3QPE A;  3DIP A;  2WES A;  4IA5 A;  1H7X A;  4CCQ A;  3SX6 A;  4G9K A;  5L46 A;  2YLX A;  3GMB A;  3I3L A;  2W0H A;  3CB3 A;  1FFV C;  4YTP A;  3AE1 A;  2BS3 A;  1B8S A;  3BNM A;  2QJN A;  3NVV B;  1B5Q A;  1SJB A;  1L9D A;  5CKU A;  3AE5 A;  1IJH A;  1SJC A;  1LVL A;  2AQJ A;  3FYY A;  1FHU A;  1VDC A;  1L9E A;  3QLD A;  4YSY A;  1GPE A;  3IJI A;  1CL0 A;  5HXI A;  2XLP A;  2E5V A;  3S47 A;  4EQR A;  3P1W A;  2CVJ A;  3PO7 A;  1P43 A;  2BAC A;  2E4G A;  1PBF A;  2X8H A;  2GR1 A;  4BV6 A;  2QGY A;  4REK A;  3OZM A;  1RP0 A;  1IUS A;  3H8A A;  2WEU A;  1ELS A;  2OA1 A;  1S3B A;  4H4S A;  3UJR A;  3AD9 B;  3FVD A;  3SGL A;  1DXL A;  4K8D A;  3KA7 A;  2F5Z A;  3ZVH B;  1H83 A;  2V60 A;  4C3X A;  3T37 A;  3UXL A;  3JSK A;  1MOK A;  5J60 A;  4IP5 A;  1FEB A;  1Z6L A;  3NFU A;  3DFY A;  2YVG A;  1GRH A;  1XDI A;  2QAE A;  1NPX A;  4ZCC A;  4EIP A;  4TM0 A;  4II3 A;  3IK4 A;  1V97 A;  3RIT A;  4USQ A;  2AAQ A;  2WDR A;  3M13 A;  3FPZ A;  3EKG A;  4OPU A;  1JRP A;  4FK1 A;  5C2T A;  4AP3 A;  3RCY A;  2HZG A;  1IUW A;  3I6T A;  1KD0 A;  3Q6J A;  1PS9 A;  5GSN A;  3SSZ A;  3ZYX A;  1PJ6 A;  2GGG A;  3R25 A;  4YWO A;  4UP3 A;  4IV9 A;  3NTA A;  5ENL A;  2VVL G;  3Q45 A;  1K4Q A;  1DOB A;  3UCC A;  2BAB A;  4H2N A;  4OPL A;  2XVE A;  2C65 A;  4JN9 A;  3K30 A;  3PWG A;  4KX6 A;  2W3R A;  5EB4 A;  1OJT A;  4H4Y A;  1PXB A;  2RGO A;  3JVA A;  3P0W A;  4OPD A;  4E8G A;  3NK1 X;  4K22 A;  1JPM A;  4TLX A;  3BOX A;  5GRT A;  1GRF A;  3P4P A;  3S5W A;  3QJ4 A;  3MZN A;  3QTP A;  4H2H A;  1Q1W A;  1V59 A;  2AKZ A;  1EBH A;  1E9I A;  2XH2 A;  2C75 A;  3T31 A;  3GC2 A;  2GDQ A;  4EM4 A;  3UKH A;  3OP2 A;  3CPH G;  2GRT A;  3NVZ B;  4H2P A;  3C4N A;  3FIM B;  4Z2R A;  2Q7V A;  3LJP A;  1DOD A;  3O0H A;  1S7M A;  4NEV A;  2PHH A;  2POZ A;  3U9I A;  3T2K A;  1H84 A;  1MNS A;  2EQ7 A;  3GRT A;  4LA1 A;  1QJD A;  3ALJ A;  3HYX A;  1JOA A;  4II2 A;  2PSN A;  3MY9 A;  2BYB A;  4AT0 A;  3I4K A;  3CN8 A;  1ZOV A;  4D04 A;  4ZCD A;  2JBV A;  3CTY A;  5KVH A;  3K7T A;  1KKO A;  2YR4 A;  1TRB A;  2H89 A;  3ATR A;  3R11 A;  2VRM A;  2B9W A;  2W3S A;  2YG3 A;  2R0G A;  3SY4 A;  3T4W A;  2PU1 A;  3TW9 A;  4G6H A;  2GH5 A;  1TKK A;  1CJ3 A;  1D7Y A;  1YY5 A;  2JAE A;  1KNP A;  3A7R A;  1BGJ A;  4DGK A;  4ADW A;  1NEN A;  1ZDL A;  3NYF A;  1DJQ A;  4BJZ A;  3BNU A;  2ZZ0 A;  2XFU A;  1NG4 A;  1O95 A;  4GAP A;  1JRX A;  3CT2 A;  3DJE A;  4E5T A;  1CF3 A;  1REO A;  1NDA A;  2B7R A;  1PBD A;  3SN4 A;  2OPJ A;  4EQS A;  2C3C A;  2Y6R A;  3AE2 A;  4E4U A;  4H4R A;  3EAO A;  1ZY8 A;  2C67 A;  4A9W A;  2XH0 A;  4HA6 A;  2GQF A;  1YQZ A;  2AKM A;  5J7X A;  3KD9 A;  1Y56 B;  1S3E A;  2E3T A;  2YR5 A;  5M0Z A;  1TE6 A;  4EM3 A;  5J04 A;  1E1K A;  1KKR A;  3AE8 A;  3NZG A;  4J3Z A;  3G5S A;  3LOV A;  2GB0 A;  4IVO B;  7ENL A;  1VRQ B;  4M0X A;  2C76 A;  2O56 A;  2DW7 A;  2P0I A;  2XSX A;  1N1P A;  3B9J B;  4IP4 A;  3GWD A;  4E4F A;  1ONE A;  1GEU A;  1ZX9 A;  2XVJ A;  2BXS A;  3KLJ A;  1X31 B;  3UTF A;  3CXB A;  3SZ0 A;  3ITJ A;  4TM1 A;  1K0I A;  3AD8 B;  4J33 A;  1FOH A;  1FIQ B;  1N5W C;  1KFY A;  2A89 A;  3RP6 A;  1H7W A;  2E1M A;  4BK1 A;  3HW2 A;  4H7U A;  1PXC A;  2NQL A;  4EMJ A;  2PA6 A;  3R1Z A;  2IVE A;  5IQ1 A;  1CJC A;  2RGH A;  4JNQ A;  3QFA A;  1KCZ A;  5JCI A;  4J36 A;  2BS4 A;  4CCR A;  1MUC A;  5TR3 A;  3RHA A;  3RP8 A;  3F8P A;  3H70 A;  3SM8 A;  1D4C A;  5BOF A;  2NPX A;  4B69 A;  1NEL A;  4NZH A;  3UOZ A;  3FJ4 A;  2GGE A;  4GFI A;  4JNA A;  4PAB A;  3U4F A;  1GTH A;  4K2X A;  3GO2 A;  3SYI A;  2PTW A;  4A7A A;  3UGV A;  4OPT A;  5G5G B;  2AL1 A;  3CGC A;  3NRZ B;  1N60 C;  1PDH A;  2PU0 A;  2WP5 A;  3URH A;  2V3B A;  1CJ4 A;  1DTN A;  2GQW A;  3H7V A;  3DJJ A;  1JDF A; 
#chains in the Genus database with same CATH homology
 2E4G A;  3KPK A;  4YTN A;  4GUV A;  3II4 A;  1ZMC A;  1PBF A;  5IQ4 A;  4K7Z A;  4Y4L A;  3V3N A;  2X8H A;  3AE3 A;  2GR1 A;  4NWZ A;  2R0C A;  4BV6 A;  4X9M A;  4H2Q A;  4I58 A;  1IUT A;  4A79 A;  4REK A;  3AED A;  2TPR A;  2BRA A;  3L8K A;  4PAA A;  4FDC B;  4CY6 A;  1RP0 A;  4J56 A;  2NVK X;  3CGD A;  1IUS A;  2WEU A;  3CPJ G;  3VR9 A;  2OA1 A;  1S3B A;  4H4S A;  3AD9 B;  5KVI A;  1DOE A;  1JRZ A;  5KMR A;  2GMH A;  4U2S A;  3SGL A;  2FBW A;  1DXL A;  5C3J A;  1GV4 A;  1H6V A;  4K8D A;  4BK3 A;  3KA7 A;  1EL9 A;  1ZP0 A;  3CMM A;  2F5Z A;  3HYW A;  3NYC A;  1PJ5 A;  4B66 A;  1H83 A;  2V60 A;  4IVM B;  4C3X A;  4B67 A;  3T37 A;  4K5S A;  1E1M A;  4U8K A;  3EAN A;  1FL2 A;  3JSK A;  1MOK A;  1H81 A;  4X9N A;  5EB5 A;  3EF6 A;  1OJD A;  3T0K A;  3SZF A;  5J60 A;  2YVJ A;  1TYT A;  1FEB A;  4H4Z A;  2WQY A;  2QA2 A;  2YG5 A;  4OPC A;  2YLR A;  4J2W A;  1CJ2 A;  2WPC A;  1NG3 A;  1S2Y A;  1Z6L A;  2YLT A;  2C7G A;  2YVG A;  1GRH A;  4CY8 A;  1JEH A;  3NNE A;  3C4A A;  1XDI A;  2QAE A;  2R9Z A;  1NPX A;  2EQ9 A;  4USR A;  4H50 A;  3V76 A;  2JB2 A;  1JNR A;  4ZCC A;  1NAA A;  1Y56 A;  5FS6 A;  4AOS A;  2X99 A;  4EQW A;  3LXD A;  4EIP A;  4TM0 A;  3NT6 A;  3PS9 A;  4II3 A;  2R4E A;  4KPR A;  4JY2 A;  3IHM A;  4USQ A;  1AOG A;  2YWL A;  2AAQ A;  3SZW A;  1TYP A;  2WDR A;  4AP1 A;  2BK3 A;  3M13 A;  1QO8 A;  3FPZ A;  4EMI A;  2GMJ A;  1ZMD A;  1H82 A;  4OPU A;  1LPF A;  4LU6 A;  3DJG X;  2BC0 A;  3UKQ A;  2VVM A;  3BI4 A;  4APN A;  4FK1 A;  3GYI A;  1QLB A;  1GET A;  4I59 A;  5JCK A;  4AP3 A;  2GF3 A;  3DGH A;  3ABV A;  2XFQ A;  4YKF A;  4XXG A;  4C77 A;  3T2Y A;  1FCD A;  2YM2 A;  4XWZ A;  1LV0 A;  1IUW A;  4RG4 A;  4Z25 A;  3Q6J A;  2R46 A;  1PS9 A;  4CNJ A;  5GSN A;  3CGE A;  1F8S A;  2BS2 A;  2WHD A;  2HQM A;  2YM1 A;  1F8W A;  4OPI A;  4Y4M A;  3ZYX A;  1YKJ A;  4U8L A;  1PJ6 A;  5U63 A;  3DK9 A;  4UDP A;  5KNL A;  4J31 A;  4YWO A;  2JB3 A;  4P9S A;  4ZN0 A;  4U8O A;  4DSG A;  2B76 A;  4UP3 A;  2Y6Q A;  4D03 A;  1DOC A;  4IV9 A;  4YKG A;  3NTA A;  4BJY A;  1ONF A;  3OZ2 A;  1BWC A;  3VRA A;  3Q9T A;  2VVL G;  4U8N A;  1K4Q A;  1KF6 A;  4K5R A;  1DOB A;  2YG4 A;  2BAB A;  1B37 A;  4H2N A;  2VVL A;  4H2R A;  3HYV A;  1K0L A;  4TM4 A;  3L5O A;  4DNA A;  1E1N A;  1N4W A;  4OPL A;  1ZOY A;  2XVE A;  2C65 A;  3C96 A;  3M12 A;  4JN9 A;  2DKH A;  3K30 A;  3UP4 A;  4OPG A;  3IC9 A;  1KSU A;  1KSS A;  1UKV G;  1XAN A;  2WBA A;  4KX6 A;  1ZK7 A;  1OJT A;  2WET A;  5EB4 A;  4H4Y A;  3GYX A;  3T2Z A;  3GRS A;  4Z2U A;  1GES A;  4GF7 A;  1PXB A;  2BRY A;  3UKK A;  1OJA A;  5U25 A;  1ZKQ A;  1EL8 A;  2RGO A;  1L9C A;  4Z43 A;  5KMQ A;  3UTH A;  4UDR A;  4E0V A;  2XVF A;  3QFB A;  2ACZ A;  4OPD A;  3NK1 X;  2C3D A;  4K22 A;  2X50 A;  4TLX A;  3RP7 A;  5KMP A;  3SQP A;  3DA1 A;  5GRT A;  3UKF A;  4DSH A;  4A99 A;  4GAV A;  2GEW A;  1GRF A;  3P4P A;  2YQU A;  1CC6 A;  2XFP A;  1GND A;  3CND A;  3QJ4 A;  3S5W A;  3NLC A;  3ICR A;  4CNK A;  4Z26 A;  2VQ7 A;  4YSX A;  1KN0 A;  2FJD A;  2FJA A;  3GDN A;  1Q1W A;  3S61 A;  3ADA B;  3HZL A;  4Z44 A;  1V59 A;  4NTE A;  2R4J A;  5EOW A;  4A6N A;  1L0V A;  2OAL A;  4N9X A;  4Z2T A;  4H4P A;  3FG2 P;  2C75 A;  3T31 A;  3NH3 X;  5C2T A;  5BVA A;  4U8J A;  4RG3 A;  2CDU A;  4EM4 A;  3UKH A;  2ZBW A;  2V3A A;  3B3R A;  1P2E A;  3CPH G;  4YXD A;  1GRE A;  2GRT A;  4GDE A;  4YSH A;  3AEF A;  2OAM A;  2PYX A;  4EMW A;  3C4N A;  3FIM B;  3NRN A;  2C64 A;  1RYI A;  4H2P A;  4OCG A;  4Y4N A;  4Z2R A;  4H4T A;  1FEC A;  1PBC A;  4C3Y A;  1Q9I A;  1YQ3 A;  2Q7V A;  1DOD A;  2B9X A;  3G5Q A;  3ICT A;  3IHG A;  3LJP A;  1LTX R;  3O0H A;  1JRY A;  4RSL A;  2WP6 A;  2J3N A;  3SFE A;  1PBB A;  1S7M A;  4B65 A;  4NEV A;  3UCL A;  2XLU A;  2YR6 A;  1GRG A;  2PHH A;  1CBO A;  2APG A;  3I6D A;  3ALM A;  4JDR A;  1O5W A;  5M10 A;  2XFN A;  2XCG A;  1PHH A;  1TDK A;  3T2K A;  1NHS A;  3UP5 A;  1H84 A;  2EQ7 A;  4JQ9 A;  3D9X A;  1BKW A;  4UDQ A;  4CRT A;  4GR1 A;  3GRT A;  2V6O A;  4LA1 A;  1D4D A;  1QJD A;  1M6I A;  2ARD A;  2YLZ A;  3DH9 A;  3ALJ A;  1JOA A;  3HYX A;  4II2 A;  4O5Q A;  4NNJ A;  1S2Q A;  4IA6 A;  4B68 A;  3KKJ A;  2BYB A;  3GWF A;  3AXB A;  5FS8 A;  4AT0 A;  3CN8 A;  1ZOV A;  2BCG G;  4NTC A;  2FJE A;  3BI2 A;  3ISH A;  4ICY A;  2IVD A;  2I0Z A;  4D04 A;  4O5U A;  5KOW A;  2GVC A;  4ZCD A;  2JBV A;  1GSN A;  2O9Z A;  3CTY A;  2XLT A;  3PVC A;  3UTG A;  4J34 A;  2WS3 A;  5KVH A;  1JNZ A;  2H88 A;  4YTM A;  3COX A;  3BHK A;  3K7T A;  2YR4 A;  3AEE A;  1TRB A;  3NKS A;  2H89 A;  3ATR A;  2VRM A;  4LII A;  2B9W A;  2B9Y A;  2YG3 A;  2R0G A;  3SY4 A;  3QSE A;  2YG7 A;  2IID A;  3L1R A;  4G6H A;  5KRQ A;  2GH5 A;  1CJ3 A;  4U2L A;  1GAL A;  1W4X A;  3AE4 A;  3UOX A;  1D7Y A;  3CNP A;  2WOV A;  2Q0K A;  1YY5 A;  4CBQ A;  2JAE A;  1TDE A;  1KNP A;  2TMD A;  3AE6 A;  2GAG B;  1BGJ A;  4DGK A;  3NK2 X;  1GT8 A;  1VQW A;  4ADW A;  1NEN A;  3B6D A;  3M0O A;  1KDG A;  1ZDL A;  3NYF A;  1PN0 A;  1TDO A;  1N4V A;  3QVP A;  4GRT A;  4FX9 A;  2BC1 A;  1GTE A;  1DJQ A;  4BJZ A;  3GD4 A;  3BNU A;  1GXF A;  3RED A;  4U8I A;  2ZZ0 A;  2CUL A;  5DBJ A;  1N4U A;  1BGN A;  2XFU A;  4OVI A;  1P2H A;  5LV9 A;  1NG4 A;  1O95 A;  2VZ2 A;  4GAP A;  2JKC A;  1JU2 A;  1JRX A;  3UOV A;  2QCU A;  1H86 A;  2GR2 A;  3GSI A;  4H4V A;  1MO9 A;  1GER A;  3NK0 X;  4C74 A;  5U1O A;  1XPQ A;  3DJE A;  1F3P A;  2QA1 A;  5BRT A;  3AEB A;  5FS9 A;  1H2I A;  5KMS A;  5ER0 A;  1CF3 A;  1REO A;  1NHQ A;  1NDA A;  3CGB A;  4NEW A;  2B7R A;  2WOW A;  3AWI A;  1PBD A;  2BK4 A;  4TM3 A;  3UTE A;  4A5L A;  3H4K A;  4B1B A;  4M52 A;  1IUV A;  3DGZ A;  4EQS A;  2C3C A;  2Y6R A;  3AYL A;  3F8R A;  3AE2 A;  3F8D A;  4H4R A;  3GYJ A;  3R9U A;  3DK4 A;  3EAO A;  4GCM A;  1MXT A;  1ZY8 A;  1NHR A;  2WPF A;  4GDP A;  2WPE A;  3FMW A;  2C67 A;  4A9W A;  5KXJ A;  4HA6 A;  3ZDN A;  2OLO A;  5BUK A;  3IWA A;  2GQF A;  3D1C A;  1XHC A;  2Q6U A;  2BK5 A;  1D4E A;  3AE7 A;  1YQZ A;  5J7X A;  3KD9 A;  4EIQ A;  3EPT A;  1CC2 A;  1CHU A;  1E1L A;  1Q1R A;  3SZC A;  4B63 A;  4A65 A;  1Y56 B;  4U8P A;  3VR8 A;  2C4C A;  4JY3 A;  1S3E A;  1LJ1 A;  2YR5 A;  5FS7 A;  2BA9 A;  1D7L A;  3VQR A;  2YG6 A;  1DJN A;  1IUU A;  2AR8 A;  1K0J A;  3ALL A;  2YAU A;  5M0Z A;  3LZX A;  2X3N A;  1LQT A;  1TDN A;  1PXA A;  5HY5 A;  4EM3 A;  1CC4 A;  3LZW A;  4H4Q A;  5JCN A;  3AD7 B;  3H8L A;  3QSM A;  1E1K A;  4H4X A;  1ELI A;  1SEZ A;  3GDP A;  2EQ6 A;  2XLR A;  2V61 A;  2GR0 A;  3PG6 A;  3AE8 A;  3T14 A;  3G5S A;  3LOV A;  2C70 A;  3AE9 A;  1EL7 A;  2GB0 A;  2Z5X A;  4IVO B;  2R45 A;  5JRB A;  1VRQ B;  2C72 A;  3ATQ A;  1M64 A;  1Y0P A;  2C66 A;  1EL5 A;  2VRL A;  5JCL A;  2C76 A;  3K7M X;  2WU2 A;  3LAD A;  4B64 A;  1GRT A;  3P4Q A;  5HYM A;  1O94 A;  1E39 A;  4G6G A;  3NN6 X;  1LQU A;  3AEA A;  2WDQ A;  1N1P A;  2A87 A;  2EQ8 A;  3DJD A;  2A8X A;  2YVF A;  4A6N B;  2Q0L A;  3GD3 A;  2V5Z A;  3GWD A;  3D8X A;  1ZX9 A;  1GEU A;  3KU9 A;  5EBK A;  4TLZ A;  3DME A;  1BZL A;  2XVJ A;  1PJ7 A;  1DNC A;  2BXS A;  1COY A;  3BI5 A;  4ECH A;  3KLJ A;  1BF3 A;  2WDV A;  1TDF A;  1X31 B;  4YT0 A;  3AEG A;  3UTF A;  3VRD B;  3P4R A;  1E6E A;  3SZ0 A;  1IUX A;  1E7P A;  4FK1 C;  3ITJ A;  4G73 A;  1D5T A;  4WX1 A;  5IPY A;  4TM1 A;  1K0I A;  2Z5Y A;  3KVE A;  2XFO A;  3AD8 B;  1FOH A;  3CNJ A;  4J33 A;  3SFD A;  2GV8 A;  3AYJ A;  1F6M A;  2OLN A;  1YQ4 A;  4YSZ A;  2R0P A;  2WU5 A;  1GRB A;  4J57 A;  3AB1 A;  3UKP A;  3E1T A;  2BCP A;  3NTD A;  4G74 A;  2XYO A;  1KFY A;  1F8R A;  2A89 A;  2WP9 A;  4U8M A;  3RP6 A;  2WOI A;  1H7W A;  2E1M A;  4MJW A;  4BK1 A;  2X8C A;  4BUR A;  3CNT A;  3NIX A;  3KPF A;  4BK2 A;  3CNS A;  4H7U A;  1PXC A;  4XWR A;  2ZZC A;  4EMJ A;  2IVE A;  2XVI A;  1EBD A;  4X4J A;  3DK8 A;  5CQF A;  5IQ1 A;  1NHP A;  1CJC A;  2XLS A;  3CPI G;  2ZZB A;  2DKI A;  2C73 A;  2RGH A;  4JNQ A;  1HYU A;  3H8I A;  2X8G A;  2XVH A;  1KNR A;  2WES A;  2VOU A;  3AYI A;  3BHF A;  4IA5 A;  3QFA A;  5JCI A;  1H7X A;  1VG0 A;  2RAB A;  4CCQ A;  3SX6 A;  1VG9 A;  3ICS A;  4G9K A;  2FJB A;  4J36 A;  3UKA A;  2YLX A;  2BS4 A;  5L46 A;  3GMB A;  3I3L A;  4CCR A;  2W0H A;  5TR3 A;  5HHF A;  3RHA A;  4WCT A;  3RP8 A;  3GMC A;  4YTP A;  3AE1 A;  3F8P A;  3RNM A;  3UKL A;  3NYE A;  2BS3 A;  3OC4 A;  1D4C A;  1OJC A;  3SM8 A;  3QVR A;  1B8S A;  3BNM A;  3IF9 A;  2JK6 A;  3AEC A;  2NPX A;  2GAH B;  4HB9 A;  1B5Q A;  4B69 A;  2XDO A;  3NG7 X;  1L9D A;  5CKU A;  3AE5 A;  2GR3 A;  5KWF A;  3NN0 X;  4NZH A;  2RGJ A;  3UOZ A;  4AOX A;  1IJH A;  3K7Q X;  3FBS A;  1LVL A;  1FEA A;  1RSG A;  2AQJ A;  2UZZ A;  3G5R A;  4AT2 A;  3NHO X;  4H4U A;  1GRA A;  4JNA A;  2YLW A;  4PAB A;  1VDC A;  1L9E A;  1GOS A;  1PBE A;  2BXR A;  3WE0 A;  1GTH A;  1NEK A;  1B4V A;  5BUL A;  4K2X A;  3SYI A;  2CFY A;  5KOX A;  4YSY A;  1GPE A;  3CIR A;  1CL0 A;  5HXI A;  2XLP A;  4A7A A;  2E5V A;  4H4W A;  3V3O A;  4OPT A;  3P9U A;  2JB1 A;  4EQR A;  3P1W A;  2CVJ A;  4Z24 A;  4U2T A;  3CGC A;  1OJ9 A;  1PDH A;  3P4S A;  3PO7 A;  3LB8 A;  4EQX A;  3SXI A;  3UOY A;  3QSS A;  2WP5 A;  3VRB A;  3URH A;  5JCM A;  2V3B A;  1CJ4 A;  2VQB A;  2GQW A;  3DJJ A;  5FMH A;  2BAC A;  3NGC X;  4C5O A;  2B7S A;  2YLS A;  4NTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...