1NHQA

Crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
447
structure length
447
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase (h2o2(a))
molecule keywords NADH PEROXIDASE
publication title Crystallographic analyses of NADH peroxidase Cys42Ala and Cys42Ser mutants: active site structures, mechanistic implications, and an unusual environment of Arg 303.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 136
structure length 447
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhqA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhqA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhqA02
1P2HA 1PXCA 4H4QA 2Q7VA 3REDA 1OJCA 2YQUA 1GSNA 4BURA 2XFNA 1PXAA 1K0IA 3ABVA 1FEBA 1IUTA 1KSUA 2BC1A 2R45A 1CL0A 3QSSA 2YLZA 4GF7A 2XDOA 4ZCDA 3CPJG 1YQ4A 3GRTA 4A6NB 1ZMCA 3UCLA 1ONFA 2WHDA 4I58A 4J36A 3CNJA 4NTCA 4A65A 5BUKA 2GR2A 2VQBA 4DGKA 2OALA 2GR1A 4U8LA 2XFUA 3IF9A 2BYBA 2W0HA 1VG9A 1NHRA 3FG2P 3DMEA 3EAOA 1BKWA 2C72A 2TMDA 2WU2A 1RP0A 4IA6A 4M52A 1JRXA 3L8KA 2EQ8A 3AE4A 1NEKA 2JB2A 2BK3A 3NHOX 4EM3A 2GQWA 2YG7A 4NZHA 3SGLA 4ICYA 3Q6JA 5JCLA 1PJ6A 5J7XA 4DSGA 2ZZ0A 3NLCA 4Z2UA 4H4ZA 2C75A 2B9YA 3SM8A 2ARDA 5HY5A 1Y56A 1GALA 1TDKA 3BHKA 4EIQA 1GTHA 1VQWA 5KVIA 1DJQA 4UDPA 2XYOA 5C2TA 2YWLA 2YR5A 3NK0X 1BGJA 4XWZA 2BCPA 5HHFA 4B64A 3URHA 2PYXA 2YG5A 4N9XA 1OJAA 4EMWA 1PBBA 1REOA 2RGOA 3BHFA 3K30A 1BWCA 2B9WA 3NTDA 4Y4NA 3GMBA 4GDEA 1SEZA 3IHMA 3QFAA 4H2NA 3BNUA 1GT8A 1PS9A 2YLSA 1HYUA 1E39A 2B7RA 3CNTA 4B65A 4AOXA 2OLNA 4Z26A 3UTEA 3I3LA 3CPIG 2IVEA 3NYCA 4Z44A 4Y4LA 2YR4A 3UTFA 3FIMB 4CRTA 2FJEA 4KPRA 1O5WA 3COXA 4Z25A 2CDUA 4AT0A 3AE7A 3EF6A 1NHPA 3AEEA 1VRQB 5JCNA 3V76A 1DODA 3UOYA 1FECA 3I6DA 3CGDA 1B5QA 3FPZA 3PVCA 4OPIA 2YG4A 2B9XA 3II4A 4BK1A 4ZCCA 1DJNA 1DOEA 2WESA 3NYEA 4REKA 2RABA 2V3AA 2WDRA 3AEFA 3NK1X 4J2WA 4Z2TA 2Q6UA 5U25A 3JSKA 3B6DA 4Z24A 4LIIA 2GR3A 1DNCA 5ER0A 2GAHB 1K0JA 3AYLA 3M12A 2EQ7A 3KLJA 3RP6A 2YG3A 3LADA 3V3OA 3E1TA 4K5SA 2X99A 2GVCA 2VVLG 3AD9B 3G5SA 3IHGA 5U63A 2JB1A 4OPGA 3UP5A 1GRAA 4BK2A 1ZOYA 3NGCX 3ICRA 1GREA 2V3BA 1E1LA 2QA2A 3DGZA 3P4PA 3NNEA 5EB4A 1F8SA 2UZZA 2RGJA 4C77A 4YKFA 3ITJA 2WP5A 1B4VA 2C73A 1LPFA 2ZBWA 3V3NA 2NPXA 4J56A 2VRMA 4D03A 2OA1A 1CF3A 3SQPA 4K7ZA 2VRLA 3CIRA 1L9CA 2YLWA 3ALLA 2BA9A 3G5RA 2A89A 4K22A 4CCRA 4K5RA 1V59A 4E0VA 4U8PA 3AE9A 4LU6A 5DBJA 1FEAA 3LJPA 1IUWA 3L1RA 3P4RA 2WDVA 3GWDA 2XVHA 2WOIA 1H81A 4BJZA 1DXLA 1H82A 4AP1A 4UP3A 4YXDA 4U2TA 1S3BA 3NIXA 1GRGA 2R0GA 3NK2X 3OC4A 1L9DA 3D1CA 5IPYA 5FS8A 2HQMA 4YTPA 3NN6X 3AE1A 3ALJA 3PO7A 2JAEA 2X50A 4NEVA 4O5UA 2GQFA 1RSGA 3GDNA 4YTMA 4H50A 3B3RA 1GXFA 2GRTA 4TLZA 1GNDA 3NYFA 2E5VA 4JN9A 3RNMA 2R4EA 1EL9A 5FMHA 4Z43A 1BF3A 5KOXA 1H7XA 1K4QA 2VOUA 2BS3A 3GRSA 2V61A 3HZLA 1FL2A 4U8MA 2C64A 5KOWA 5M0ZA 2EQ9A 1PDHA 4IVMB 1GOSA 3KKJA 3ATRA 1OJDA 1K0LA 4CBQA 4JQ9A 3QSMA 1EL8A 1YQZA 4A99A 4JY3A 1TDOA 3AYJA 3UKHA 1LQTA 1ELIA 2WPCA 3CTYA 1TDNA 4BV6A 2QAEA 4NEWA 2YM2A 4CNKA 1CHUA 1PBEA 2XFOA 3C4NA 1EL7A 3P4QA 4H4VA 2DKIA 3UP4A 3S61A 4MJWA 4EQRA 2X8CA 1N1PA 2C70A 4GCMA 3C4AA 1COYA 1N4WA 2C76A 1NENA 1VG0A 3KVEA 1GETA 4IV9A 1JNZA 3GYIA 4TM1A 3RHAA 2ZZCA 1KFYA 2C65A 4CNJA 4JDRA 3AYIA 4TLXA 1GERA 1BZLA 3UOVA 1M6IA 4H4UA 1N4UA 2OLOA 4NTEA 3VQRA 5KWFA 3ADAB 1JEHA 3P1WA 2C3DA 2F5ZA 4B67A 1GRBA 2A8XA 4FDCB 4UDRA 3NG7X 3NT6A 4H4RA 3AE8A 5EBKA 1ZMDA 1IUVA 4U2SA 4J57A 3CN8A 4CY8A 4X9NA 5HXIA 1LVLA 4P9SA 1IJHA 4I59A 5J60A 2X3NA 2E1MA 5GRTA 2BK5A 3UOXA 3M13A 1NAAA 2RGHA 2IIDA 4DNAA 3CNSA 3H8IA 2EQ6A 5FS6A 3AECA 5M10A 2C67A 4X4JA 2GAGB 2XLUA 2A87A 2WU5A 3AEBA 1CJ3A 2VQ7A 2QCUA 4NTDA 5FS9A 2JK6A 4DSHA 2PHHA 1PXBA 2XVEA 4IA5A 3UKKA 1TYTA 1PHHA 5JCMA 4ADWA 3CGEA 1DOCA 1E7PA 1L9EA 4FX9A 3CNDA 3LZXA 3NN0X 3AE6A 1GRHA 2AAQA 1JOAA 4OCGA 4XWRA 4D04A 4GUVA 3AE5A 1D4CA 2AR8A 1Y0PA 2FJDA 1L0VA 3K7MX 1JNRA 4K8DA 3S5WA 2WS3A 4A6NA 1ZKQA 4RG3A 1ZY8A 3CGCA 3DK9A 5KRQA 3KPFA 2R0CA 3FBSA 2ZZBA 4YWOA 3KA7A 1ZDLA 4TM0A 3SFDA 1KSSA 2WP6A 1VDCA 3ZDNA 1GV4A 3GYJA 1OJ9A 1B37A 4JNAA 5KXJA 3AB1A 3AD8B 3LB8A 2Y6QA 4A7AA 4J31A 4H4WA 1F8RA 1H6VA 1TDFA 1LQUA 2YLRA 3ATQA 1XPQA 1DOBA 3F8PA 4KX6A 4CCQA 4APNA 1IUSA 1Y56B 4U8NA 4HB9A 3VR9A 3ICSA 1ZK7A 3H8LA 4YSXA 1F3PA 1YY5A 1LV0A 3H4KA 3PS9A 4ECHA 2DKHA 4A5LA 2BXRA 3D8XA 4PABA 2AQJA 3ISHA 1S3EA 2YVGA 2WEUA 1PJ5A 4EQXA 4BJYA 2C3CA 5JCKA 5EOWA 2APGA 1F8WA 4J34A 3DA1A 2YVJA 4YKGA 4B68A 1BGNA 1QO8A 1FCDA 2FBWA 1ZOVA 3F8RA 3RP8A 3DK4A 1QLBA 3AEGA 4B1BA 2BK4A 5CQFA 3UKQA 4H2QA 2XCGA 4JNQA 2YLTA 2FJAA 4EMIA 2GMHA 1Q1RA 1RYIA 3QFBA 3EPTA 5L46A 3ICTA 2WBAA 2JKCA 2CULA 3CGBA 2Z5YA 4EQWA 2GR0A 5JCIA 1E1NA 3ZYXA 1Q1WA 1KDGA 1GPEA 2OAMA 3BI5A 1PJ7A 1TDEA 5EB5A 2XFPA 3DK8A 5FS7A 2IVDA 1EBDA 3OZ2A 4J33A 3VRBA 1W4XA 3WE0A 4H7UA 1NPXA 2X8HA 4GR1A 2BCGG 1D4DA 2YG6A 1S2QA 2Z5XA 2GEWA 3QJ4A 4YTNA 4H4TA 4A9WA 4EMJA 1JRZA 2WDQA 4OPLA 1NDAA 1Z6LA 1D5TA 2V6OA 3DJGX 4XXGA 3LZWA 1GESA 3F8DA 4U8JA 1GEUA 2WOWA 5TR3A 3UKFA 1P2EA 2GMJA 3NTAA 1LJ1A 3DH9A 5BVAA 4B63A 4X9MA 4TM3A 4WX1A 3VRAA 5IQ1A 5BULA 2XVFA 2WETA 2WOVA 1F6MA 2Y6RA 1CC6A 3AWIA 2BC0A 1N4VA 4C3XA 3UKLA 3P4SA 1CBOA 4LA1A 1MXTA 4AT2A 1YQ3A 1PBFA 3R9UA 1ZX9A 1E1KA 1S2YA 3AEAA 3P9UA 4CY6A 4EIPA 2XLTA 3K7QX 2NVKX 3AD7B 3DJDA 1NHQA 3O0HA 4H4SA 2R0PA 2YM1A 3AE2A 2GB0A 2XVIA 4B66A 2Q0KA 3QVPA 3VRDB 3BI4A 2C66A 5HYMA 3NRNA 4C3YA 4USQA 4H4PA 2GF3A 2YLXA 2O9ZA 3KU9A 2V5ZA 1NG3A 2X8GA 4GRTA 5IQ4A 2WQYA 3GDPA 4U2LA 4GDPA 1ZP0A 2H88A 3G5QA 2XLRA 2V60A 3K7TA 2BACA 1KNRA 3CNPA 1O95A 1XHCA 2WPEA 3GD3A 5CKUA 1CJ4A 1XDIA 2WP9A 4C74A 5LV9A 1GTEA 1IUXA 4WCTA 2YAUA 2XVJA 3NKSA 4UDQA 1JU2A 4YSHA 1FOHA 2B76A 1CC4A 1TRBA 4OPCA 1EL5A 3UTGA 1PBDA 4JY2A 2R46A 4YT0A 1JRYA 4Z2RA 3IC9A 2VZ2A 4OPUA 3FMWA 1H7WA 2J3NA 3GSIA 4H4XA 3UOZA 1IUUA 3UKAA 4AOSA 2QA1A 3IWAA 3DGHA 1H84A 5GSNA 2TPRA 2XLSA 2Q0LA 1NHSA 1H86A 4HA6A 4U8OA 1O94A 2FJBA 3QSEA 1E6EA 1PBCA 4AP3A 4B69A 1OJTA 2B7SA 3GMCA 4OVIA 1KNPA 3UKPA 4BK3A 1MOKA 2GV8A 3VR8A 2VVMA 4Y4MA 1M64A 3QVRA 4YSZA 1MO9A 1NG4A 1CJ2A 3BI2A 2YR6A 1QJDA 2JB3A 3T37A 1XANA 1D7LA 4U8KA 4H2PA 1YKJA 3Q9TA 4OPTA 2BS4A 3CPHG 2CFYA 1UKVG 4EM4A 4U8IA 3SFEA 1E1MA 3BNMA 2VVLA 3C96A 5BRTA 3KD9A 4TM4A 2CVJA 3LOVA 1GRFA 3LXDA 2JBVA 4EQSA 4FK1A 2BS2A 3UTHA 1AOGA 1D4EA 2XFQA 1TYPA 1PN0A 4IVOB 3DJEA 3NH3X 3ALMA 3AEDA 4A79A 4OPDA 1KF6A 3GWFA 2XLPA 3DJJA 4RSLA 2YVFA 1GRTA 3AXBA 3M0OA 2C7GA 4USRA 4C5OA 2ACZA 2GH5A 4H4YA 4K2XA 3GD4A 4RG4A 2WPFA 5U1OA 5KVHA 1H83A 1LTXR 1X31B 4ZN0A 2H89A 4FK1C 2BABA 1D7YA 2E4GA 4YSYA 1CC2A 3EANA 3RP7A 1CJCA 4H2RA 4O5QA 2I0ZA 4PAAA 2BXSA 2R4JA 1B8SA 3AE3A 5C3JA 2R9ZA 1Q9IA
chains in the Genus database with same CATH superfamily
3DFYA 3N6JA 1X2GA 2OKTA 1KSUA 2BC1A 1CL0A 1BKHA 3NFUA 2WHDA 4I58A 4NTCA 2OALA 4GAVA 2NQLA 1VG9A 1NHRA 3DMEA 4E4UA 1JRXA 3NHOX 2GQWA 4NZHA 4ICYA 4DSGA 3NLCA 4H4ZA 3DG7A 5HY5A 1Y56A 1TDKA 5C2TA 3NK0X 2BCPA 5HHFA 1OJAA 1PBBA 1BWCA 3MUCA 3NTDA 3SJNA 1PS9A 2YLSA 3UJSA 1HYUA 3CNTA 2PTWA 1RVKA 3NYCA 3SYIA 3UTFA 2FJEA 4KPRA 3COXA 4Z25A 1NHPA 4GAPA 3I6DA 2YG4A 4DHGA 1DOEA 3AEFA 4Z2TA 5U25A 3B6DA 1DNCA 1K0JA 1XPYA 4X2PA 2EQ7A 2YG3A 3LADA 3GY1A 2X99A 2GVCA 1FIQB 3IHGA 3TOYA 3KPKA 1ZOYA 3NNEA 2UZZA 3P3BA 2WP5A 2C73A 2E3TA 3CIRA 3EUB3 3ALLA 2A89A 4CCRA 4LU6A 1FEAA 1KD0A 2XVHA 4AP1A 4UP3A 4GFIA 3PFRA 3ES8A 3D1CA 5FS8A 4YTPA 3NN6X 1FFUC 3ALJA 3PO7A 2JAEA 4YTMA 3B3RA 1EL9A 2DW7A 5FMHA 1BF3A 3Q4DA 1H7XA 1VQZA 4IVMB 4CBQA 4JQ9A 3DDMA 3QSMA 3RCYA 3AYJA 2W3RA 4GIRA 4CNKA 3VDGA 3S61A 3SZFA 2X8CA 3C4AA 1N4WA 1JROA 1JNZA 4TM1A 4CNJA 3AYIA 1BZLA 3VQRA 5KWFA 4B67A 2A8XA 3NG7X 3NT6A 3AE8A 5EBKA 3SQSA 4U2SA 4P9SA 2E1MA 2BK5A 1NAAA 2RGHA 2QJNA 5FS6A 3AECA 5M10A 2GAGB 1CJ3A 2VQ7A 1YEYA 2QCUA 5FS9A 1TYTA 4ADWA 1EC7A 2AAQA 4K8DA 3D47A 2ZZBA 3KA7A 3UXKA 1ZDLA 2P0IA 2WP6A 1GV4A 4JHMA 5KXJA 3LB8A 4A7AA 4H4WA 1TDFA 4KEMA 1XPQA 1IUSA 4YSXA 1BQGA 4TVWA 1YY5A 2DKHA 2OLAA 2BXRA 3CAWA 3ISHA 4Z17A 3SN1A 1F8WA 2MNRA 2FBWA 4HPNA 3RGTA 2FKPA 1ZOVA 3F8RA 3ZVHA 1QLBA 3T4WA 2BK4A 3IK4A 3T0KA 4HNLA 4JNQA 2E5AA 4EMIA 3ICTA 2JKCA 3BSMA 3CGBA 3R11A 1E1NA 5BOEA 5FS7A 3WE0A 2PGEA 3OW1A 3ZVIA 4YTNA 4A9WA 1JRZA 4HNCA 4XXGA 3T8QA 2WOWA 5TR3A 4WX1A 4ROPA 1SJBA 4C3XA 4LA1A 1YQ3A 3HW2A 1E1KA 3UJ2A 3AEAA 5KMSA 3PWIA 2YM1A 4MKSA 3QVPA 5HYMA 1RM6B 4USQA 3I6EA 2GF3A 2V5ZA 2PP1A 3NZGA 2WQYA 2H88A 2V60A 2BACA 3CNPA 5FJOA 4C74A 2B76A 4IHCA 3UTGA 4JY2A 4YT0A 3ZLHA 3IC9A 2PSNA 4AOSA 3IWAA 4U8OA 1FHUA 2FJBA 1OJTA 4G6HA 4OVIA 3QVRA 4YSZA 3T37A 2PP3A 1D7LA 1YKJA 4U8IA 3CPHG 4EM4A 4HN8A 3C96A 3KD9A 2CVJA 3MY9A 1TYPA 1PN0A 4HCHA 1MDLA 3HYXA 1NU5A 2ZC8A 4H4YA 4K2XA 3DG3A 4FK1C 2E4GA 3EANA 1CJCA 3R10A 2R4JA 4J1OA 3AE3A 3R0UA 2R9ZA 1Q9IA 4DXKA 1P2HA 4H4QA 2YQUA 2XFNA 1K0IA 1FEBA 3D9XA 2P8BA 3VC5A 4ZCDA 2XDOA 3CPJG 1YQ4A 1ZMCA 1P43A 3UCLA 2DW6A 5BUKA 3CNJA 5FJUA 2GR1A 2BYBA 2AL2B 2W0HA 3SR6B 3CXBA 2TMDA 4M52A 2HZGA 2BK3A 3BJSA 4EM3A 3Q6JA 1PJ6A 2ARDA 1N63C 3S47A 4UDPA 2XYOA 2YR5A 2PYXA 2YG5A 3BHFA 5IDZA 3GMBA 1FFVC 3GYXA 3QFAA 1GT8A 1E39A 3U4FA 1W6TA 3UTEA 3I4KA 4Y4LA 2YR4A 3N6HA 2CDUA 1FO4A 3SX6A 5FJPA 1DODA 3VA8A 1FECA 1B5QA 4OPIA 2B9XA 3II4A 4ZCCA 3NYEA 2RABA 3NK1X 4J2WA 3JSKA 4Z24A 1R6WA 3AN1A 5ER0A 3AYLA 3M12A 1KKRA 3E1TA 3G5SA 4OPGA 2QA2A 3DGZA 5EB4A 4C77A 4YKFA 4ENLA 3V3NA 2NPXA 4J56A 2OA1A 3SQPA 2VRLA 1L9CA 2YLWA 3G5RA 2BA9A 1V59A 4U8PA 3L1RA 2WDVA 3GWDA 2WOIA 3SZCA 1H82A 2RDXA 4YXDA 3OC4A 1L9DA 3AE1A 1EBHA 4ZOHB 1GXFA 2GRTA 1GNDA 3RNMA 3THUA 4Z43A 4M0XA 1JCTA 2ONEA 2HXTA 1K4QA 2BS3A 3Q45A 4U8MA 5KOWA 5M0ZA 4ZA0A 3VCNA 4A99A 4JY3A 1TDOA 3UKHA 2PGWA 1MDRA 2P88A 4BV6A 4NEWA 1FHVA 1PBEA 2XFOA 1EL7A 3P4QA 4H4VA 3UP4A 3MSYA 1N1PA 1COYA 4IV9A 3GYIA 3TJ4A 4IL0A 4JDRA 4TLXA 3PWGA 1M6IA 4H4UA 2OLOA 3ADAB 1JEHA 3P1WA 4YWSA 4NNJA 2F5ZA 1N61C 4CY8A 3T9PA 1PDZA 2PS2A 4JN8A 4X4JA 3UJEA 2A87A 3TW9A 4NTDA 2JK6A 4DSHA 2PHHA 2XVEA 3UKKA 1PHHA 3AE6A 1GRHA 4OCGA 4XWRA 4D04A 3AE5A 1D4CA 1Y0PA 4RG3A 3CGCA 3KPFA 2OQHA 3ZDNA 3AB1A 4J31A 4KX6A 1DOBA 4HB9A 4ECHA 3PS9A 3D8XA 3PG6A 2AQJA 3OTRA 2YVGA 4BJYA 4F4RA 5EOWA 2QGYA 1FCDA 5G5GB 2BRYA 1WUEA 2FJAA 1JPDX 1Q1RA 3EPTA 3QFBA 3QPEA 2WBAA 5JCIA 1Q1WA 3BI5A 1PJ7A 1TDEA 1EBDA 3OZ2A 3FXGA 5FJTA 2X8HA 4H7UA 5KNLA 4GR1A 1D4DA 2YG6A 3QJ4A 7ENLA 1NDAA 2V6OA 3F8DA 3DFHA 2WETA 2Y6RA 3P4SA 5J04A 1CBOA 4AT2A 3R9UA 1ZX9A 3I6TA 2NVKX 3DJDA 1NHQA 3O0HA 3AE2A 3BI4A 2XGZA 3KU9A 2O9ZA 4ZCWA 1NG3A 3BOXA 4GRTA 2W3SA 2GDQA 1O95A 2AL1A 2WPEA 1CJ4A 1XDIA 1GTEA 1R0MA 1CC4A 4E5TA 1EL5A 1JRYA 2VZ2A 3B9JB 3SXIA 3DGHA 1NHSA 4A6GA 3DERA 4AP3A 3QTPA 1E6EA 1JDFA 3SN4A 4BK3A 1MOKA 4Y4MA 1NG4A 3BI2A 1CJ2A 3CK5A 4H2PA 3IJQA 2BS4A 3SFEA 2OFJA 2GGJA 5BRTA 3LOVA 3UTHA 1D4EA 3NH3X 3VC6A 2AKMA 4A79A 4OPDA 2XH0A 4IZGA 1KF6A 2XLPA 4DX3A 3AXBA 3M0OA 4C5OA 4RG4A 2WPFA 4E6MA 2BABA 1D7YA 2OZ8A 3DESA 2P3ZA 2I0ZA 1JRPA 4H83A 3IF9A 1EC8A 1PXCA 3REDA 1OJCA 4BURA 2ZADA 3ABVA 1IUTA 2R45A 1N5XA 3QSSA 2YLZA 4A35A 4GF7A 3GRTA 2GL5A 4A6NB 2QQ6A 3SY4A 1ONFA 4J36A 4G8TA 3TCSA 3EAOA 1RP0A 3L8KA 2EQ8A 3UJRA 1NEKA 3SGLA 5JCLA 5J7XA 3L5OA 2C75A 3SM8A 5KMPA 5BOFA 1ONEA 4KPLA 4EIQA 1GTHA 3SZWA 1BGJA 4XWZA 3URHA 2FYMA 4EMWA 3CB3A 3K30A 3DEQA 2B9WA 4DWDA 1SEZA 4K8GA 3BNUA 2B7RA 4Z26A 2IVEA 4Z44A 3FIMB 4CRTA 3AE7A 3T2YA 3AMZA 4IT1A 1IYXA 5JCNA 3UOYA 3FPZA 4BK1A 2WESA 2MUCA 2Q6UA 4JN7A 4LIIA 2GR3A 2GAHB 3KLJA 3V3OA 3AD9B 1GRAA 3ICRA 1GREA 2V3BA 4GYPA 1F8SA 4J3ZA 3ITJA 2GSHA 4FP1A 3V3WA 1MNSA 3NVVB 4D03A 4K7ZA 3SSZA 3CXOA 4GMEA 4K5RA 4E0VA 5DBJA 3LJPA 1IUWA 4E8GA 3T14A 3JZUA 3IJIA 3TQPA 4U2TA 1S3BA 2QDEA 2P8CA 1L8PA 3NIXA 1GRGA 2R0GA 3NK2X 3QLDA 5IPYA 3VCCA 2X50A 4NEVA 1RSGA 3MQTA 1MRAA 4TLZA 2E5VA 4JN9A 3RO6A 3GRSA 2EQ9A 1SJAA 1GOSA 2OX4A 2PMQA 1OJDA 1K0LA 3ATRA 3OZMA 1EL8A 1YQZA 3D46A 4KWSA 1LQTA 2QAEA 2YM2A 3C4NA 3CT2A 2C70A 4GCMA 2C76A 2OZ3A 2HXUA 2ZZCA 3RHAA 1KFYA 2C65A 1GERA 4UDRA 1WUFA 4HYRA 4GGBA 1ZMDA 1IUVA 4J57A 1ZXIC 4X9NA 5J60A 1IJHA 2X3NA 2HNEA 2AKZA 2IIDA 4DNAA 3H8IA 2C67A 2PCEA 3QKEA 2XLUA 2WU5A 4G74A 2PU1A 3OPSA 1PXBA 4IA5A 5JCMA 2GGHA 1E7PA 4FX9A 3NN0X 1JOAA 2AR8A 3UCCA 3K7MX 3S5WA 1ZKQA 2OZTA 3FBSA 1KSSA 1B37A 4JNAA 2PA6A 5FJRA 1F8RA 1H6VA 1LQUA 2YLRA 3F8PA 4G6GA 4APNA 1Y56B 4U8NA 3ICSA 1ZK7A 3H8LA 1F3PA 3UJFA 3GC2A 4A5LA 3EEZA 2PTZA 4PABA 2C4CA 1S3EA 1PJ5A 2APGA 4YKGA 4B68A 1QO8A 1KCZA 3DK4A 3AEGA 4B1BA 5CQFA 2YLTA 2GMHA 5L46A 2PPGA 4EQWA 3NO1A 2GR0A 3ZYXA 1KDGA 2OAMA 2IVDA 4J33A 1NPXA 2BCGG 2Z5XA 4EMJA 5EU9A 1D5TA 4H2HA 2PP0A 2OG9A 3LZWA 4U8JA 1GEUA 3UKFA 2GMJA 3NTAA 4B63A 4X9MA 3VRAA 5IQ1A 3NXLA 2I5QA 2WOVA 4IP4A 1F6MA 1F9CA 3AWIA 1N4VA 1MXTA 3FV9A 1PBFA 3P9UA 4CY6A 4EIPA 4DYEA 2XLTA 3K7QX 1EBGA 4H4SA 2R0PA 2Q0KA 2GGEA 4HCLA 4C3YA 4H4PA 2YLXA 2XH4A 2XLRA 3K7TA 1SB3B 1NELA 3QN3A 3GD3A 1N5WC 5G5HB 5LV9A 1IUXA 4WCTA 2YAUA 3NKSA 4YSHA 1TRBA 1PBDA 4Z2RA 5JRBA 3FMWA 3DG6A 1H7WA 3GSIA 4H4XA 3UOZA 1IUUA 1H2IA 1PDYA 3UKAA 5GSNA 2Q0LA 1O94A 4IL2A 4B69A 4G9KA 1KNPA 3UKPA 2QJMA 2VVMA 3TWBA 1M64A 1EC9A 4GGHA 1QJDA 1SJCA 1XANA 4U8KA 3N4EA 3Q9TA 3FJ4A 1E1MA 3BNMA 3TWAA 4TM4A 2XH7A 1GRFA 3LXDA 2JBVA 3UCDA 4FK1A 1AOGA 2XFQA 3DJEA 3AEDA 3DJJA 4RSLA 2YVFA 1GRTA 2C7GA 4GYPC 3NVZB 3GD4A 4HCDA 5U1OA 5KVHA 1X2HA 1CC2A 3RP7A 4O5QA 4DN1A 1B8SA 2Q7VA 1JPMA 1GSNA 1PXAA 3MWCA 3ZLGA 1STZA 3IJLA 2POZA 4A65A 2GR2A 2VQBA 4DGKA 3DIPA 4U8LA 3JW7A 2XFUA 2PODA 3FG2P 1ELSA 3ES7A 1BKWA 2C72A 2WU2A 3CYJA 4IA6A 3AE4A 2JB2A 3H7VA 2YG7A 4Z2UA 2ZZ0A 2B9YA 3R07C 1GALA 3BHKA 1VQWA 5KVIA 1DJQA 2YWLA 4B64A 1N60C 4N9XA 2CHRA 1REOA 2RGOA 1WYGA 4GDEA 4Y4NA 3IHMA 4H2NA 3T2KA 3ZVHB 1VDVA 2GGGA 4B65A 4AOXA 2OLNA 3I3LA 3CPIG 3NS1B 1O5WA 2W54A 4AT0A 3EF6A 3AEEA 1VRQB 3V76A 3CGDA 3PVCA 3SZ0A 1DJNA 4REKA 1KN0A 2V3AA 2WDRA 3A7AA 3DGBA 4II3A 2OO6A 3HYWA 2PU0A 3OP2A 3RP6A 4K5SA 5IQ4A 2VVLG 5U63A 3UP5A 2JB1A 4BK2A 3NGCX 2OVLA 4G7FA 1E1LA 3P4PA 2RGJA 3MKCA 1B4VA 2ZBWA 1LPFA 2VRMA 1CF3A 5KMRA 4K22A 3AE9A 3P4RA 3SBFA 1N62C 1H81A 4GISA 5KMQA 4BJZA 1DXLA 3CMMA 3OZYA 2HQMA 3NRZB 6ENLA 4O5UA 2GQFA 3GDNA 4H50A 1S7MA 3NYFA 3P0WA 3NVYB 2R4EA 5KOXA 1E9IA 2VOUA 2V61A 3HZLA 3MZNA 1FL2A 3FVDA 2C64A 3PK7A 3R0KA 1PDHA 3KKJA 3FYYA 1V97A 1ELIA 2WPCA 3CTYA 1TDNA 3STPA 1CHUA 2XSXA 2DKIA 3TJIA 4MJWA 4EQRA 1NENA 1VG0A 4Z1YA 1GETA 3KVEA 3EKGA 3UOVA 1N4UA 4NTEA 2C3DA 1OEPA 4E4FA 1GRBA 3ENLA 4FDCB 4H4RA 4FI4A 3CN8A 5HXIA 1LVLA 4I59A 1ECQA 5GRTA 3UOXA 3M13A 3CNSA 1TE6A 2EQ6A 4IP5A 3R25A 2QVHA 5ENLA 3AEBA 1DOCA 3CGEA 3H12A 3B97A 1L9EA 3LZXA 3CNDA 1TKKA 4GUVA 2FJDA 1L0VA 1JNRA 2WS3A 4A6NA 1ZY8A 3DK9A 5KRQA 2R0CA 4YWOA 4TM0A 4MGGA 3SFDA 3V5CA 1VDCA 3GYJA 1OJ9A 3UGVA 2QDDA 4MMWA 4G73A 3AD8B 2Y6QA 3HYVA 1T3QC 3ATQA 4CCQA 3SN0A 3GD6A 3RRAA 3VR9A 1LV0A 3H4KA 3U9IA 3AM9A 2WEUA 4EQXA 2XH2A 3R1ZA 2C3CA 5JCKA 3T6CA 4J34A 4NWZA 3DA1A 2YVJA 1BGNA 3RP8A 3UKQA 4H2QA 2XCGA 3P93A 1RYIA 1P48A 3JVAA 2CULA 3T31A 2Z5YA 3VFCA 1DTNA 3S5SA 1GPEA 5EB5A 4A3RA 2XFPA 3DK8A 3N4FA 3VRBA 1W4XA 4M6UA 3V4BA 1S2QA 2GEWA 1TZZA 4H4TA 2WDQA 4OPLA 1Z6LA 3DJGX 3HRDC 1GESA 3ZLFA 1P2EA 1LJ1A 3DH9A 2GGIA 5BVAA 4H19A 4TM3A 2BRAA 5BULA 2XVFA 3TTEA 1CC6A 2BC0A 4KT2A 3UKLA 3V5FA 1S2YA 3A7RA 3AD7B 3FCPA 2W55A 2PTXA 2GB0A 2XVIA 4B66A 2O56A 3VRDB 2C66A 3NRNA 2PTYA 1KKOA 3GO2A 2X8GA 3GDPA 4U2LA 4GDPA 4K2SA 1ZP0A 3G5QA 2OPJA 4EWJA 1XS2A 2OQYA 1KNRA 4TVYA 3RR1A 1XHCA 5CKUA 2WP9A 2XVJA 4UDQA 1JU2A 3H8AA 1FOHA 3UXLA 4OPCA 3H70A 2R46A 4OPUA 2J3NA 1MUCA 4K1WA 2AL2A 2QA1A 3K1GA 1H84A 2TPRA 3ETRB 2XLSA 1H86A 4HA6A 3QSEA 1SJDA 1PBCA 2B7SA 3GMCA 2GV8A 3VR8A 3KUMA 1MO9A 3T2ZA 3HPFA 2YR6A 2JB3A 4OPTA 2CFYA 1UKVG 2VVLA 4EQSA 3NVWB 2BS2A 4IVOB 3ALMA 3GWFA 2QJJA 4USRA 2ACZA 2GH5A 4II2A 1H83A 1LTXR 1X31B 4ZN0A 2H89A 4YSYA 4PAAA 2BXSA 3RITA 5C3JA 4H1ZA 4H2RA 3A7UA
chains in the Genus database with same CATH topology
1P2HA 1PXCA 4H4QA 2Q7VA 3REDA 1OJCA 2YQUA 1GSNA 4BURA 2XFNA 1PXAA 1K0IA 3ABVA 1FEBA 1IUTA 3D9XA 2BC1A 1KSUA 2R45A 1CL0A 3QSSA 2YLZA 4GF7A 2XDOA 4ZCDA 3CPJG 1YQ4A 3GRTA 4A6NB 1ZMCA 3SY4A 3UCLA 1ONFA 2WHDA 4I58A 4J36A 3CNJA 4NTCA 4A65A 5BUKA 2GR2A 2VQBA 4DGKA 2OALA 2GR1A 4GAVA 4U8LA 2XFUA 3IF9A 2BYBA 2W0HA 1VG9A 1NHRA 3FG2P 3DMEA 3EAOA 1BKWA 2C72A 2TMDA 2WU2A 1RP0A 4IA6A 4M52A 1JRXA 3L8KA 2EQ8A 3AE4A 1NEKA 2JB2A 2BK3A 3NHOX 4EM3A 2GQWA 2YG7A 4NZHA 3SGLA 4ICYA 3Q6JA 5JCLA 1PJ6A 5J7XA 4DSGA 2ZZ0A 3NLCA 4Z2UA 4H4ZA 3L5OA 2B9YA 2C75A 3SM8A 5KMPA 2ARDA 5HY5A 1Y56A 1GALA 1TDKA 3BHKA 4EIQA 1GTHA 1VQWA 5KVIA 1DJQA 4UDPA 2XYOA 3SZWA 2YWLA 5C2TA 2YR5A 3NK0X 1BGJA 4XWZA 2BCPA 5HHFA 4B64A 3URHA 2PYXA 2YG5A 4N9XA 1OJAA 4EMWA 1PBBA 1REOA 2RGOA 3BHFA 3K30A 1BWCA 2B9WA 3NTDA 4Y4NA 3GMBA 4GDEA 1SEZA 3GYXA 3IHMA 3QFAA 4H2NA 3BNUA 1GT8A 1PS9A 3T2KA 2YLSA 1HYUA 1E39A 2B7RA 3CNTA 4B65A 4AOXA 2OLNA 4Z26A 3UTEA 3I3LA 3CPIG 2IVEA 3NYCA 4Z44A 4Y4LA 2YR4A 3SYIA 3UTFA 3FIMB 4CRTA 2FJEA 4KPRA 1O5WA 3COXA 4Z25A 2CDUA 4AT0A 3AE7A 3T2YA 3EF6A 1NHPA 3SX6A 3AEEA 1VRQB 5JCNA 3V76A 1DODA 3UOYA 1FECA 4GAPA 3I6DA 3CGDA 1B5QA 3FPZA 3PVCA 4OPIA 2YG4A 2B9XA 3II4A 3SZ0A 4BK1A 4ZCCA 1DJNA 1DOEA 2WESA 3NYEA 4REKA 2RABA 1KN0A 2V3AA 2WDRA 3AEFA 3NK1X 4II3A 4J2WA 4Z2TA 3HYWA 2Q6UA 5U25A 3JSKA 3B6DA 4Z24A 4LIIA 2GR3A 1DNCA 5ER0A 2GAHB 1K0JA 3AYLA 3M12A 2EQ7A 3KLJA 3RP6A 2YG3A 3LADA 3V3OA 3E1TA 4K5SA 2X99A 2GVCA 2VVLG 3AD9B 3G5SA 3IHGA 5U63A 2JB1A 3KPKA 4OPGA 1GRAA 3UP5A 4BK2A 1ZOYA 3NGCX 3ICRA 1GREA 2V3BA 1E1LA 2QA2A 3DGZA 3P4PA 3NNEA 5EB4A 1F8SA 2UZZA 2RGJA 4C77A 4YKFA 3ITJA 2WP5A 1B4VA 2C73A 1LPFA 2ZBWA 3V3NA 2NPXA 4J56A 2VRMA 4D03A 2OA1A 1CF3A 3SQPA 4K7ZA 2VRLA 3CIRA 5KMRA 1L9CA 2YLWA 3ALLA 2BA9A 3G5RA 2A89A 4K22A 4CCRA 4K5RA 1V59A 4E0VA 4U8PA 3AE9A 4LU6A 5DBJA 1FEAA 3LJPA 1IUWA 3L1RA 3P4RA 2WDVA 3GWDA 2XVHA 2WOIA 1H81A 5KMQA 4BJZA 1DXLA 3SZCA 3T14A 1H82A 4AP1A 4UP3A 4YXDA 4U2TA 1S3BA 3CMMA 3NIXA 1GRGA 2R0GA 3NK2X 3OC4A 1L9DA 3D1CA 5IPYA 5FS8A 2HQMA 4YTPA 3NN6X 3AE1A 3ALJA 3PO7A 2JAEA 2X50A 4NEVA 4O5UA 2GQFA 1RSGA 3GDNA 4YTMA 4H50A 3B3RA 1GXFA 1S7MA 2GRTA 4TLZA 1GNDA 3NYFA 2E5VA 4JN9A 3RNMA 2R4EA 1EL9A 5FMHA 4Z43A 1BF3A 5KOXA 1H7XA 1K4QA 2VOUA 2BS3A 3GRSA 2V61A 3HZLA 1FL2A 4U8MA 2C64A 5KOWA 5M0ZA 2EQ9A 1PDHA 4IVMB 1GOSA 3KKJA 3ATRA 1OJDA 1K0LA 4CBQA 4JQ9A 3QSMA 1EL8A 1YQZA 4A99A 4JY3A 1TDOA 3AYJA 3UKHA 1LQTA 1ELIA 2WPCA 3CTYA 1TDNA 4BV6A 2QAEA 4NEWA 2YM2A 4CNKA 1CHUA 1PBEA 2XFOA 3C4NA 1EL7A 3P4QA 4H4VA 2DKIA 3UP4A 3S61A 3SZFA 4MJWA 4EQRA 2X8CA 1N1PA 2C70A 4GCMA 3C4AA 1COYA 1N4WA 2C76A 1NENA 1VG0A 3KVEA 1GETA 4IV9A 1JNZA 3GYIA 4TM1A 3RHAA 2ZZCA 1KFYA 2C65A 4CNJA 4JDRA 3AYIA 4TLXA 1GERA 1BZLA 3UOVA 1M6IA 4H4UA 1N4UA 2OLOA 4NTEA 3VQRA 5KWFA 3ADAB 1JEHA 3P1WA 2C3DA 4NNJA 2F5ZA 4B67A 1GRBA 2A8XA 4FDCB 4UDRA 3NG7X 3NT6A 4H4RA 3AE8A 5EBKA 1ZMDA 1IUVA 4U2SA 4J57A 3CN8A 4CY8A 4X9NA 5HXIA 1LVLA 4P9SA 1IJHA 4I59A 5J60A 2X3NA 2E1MA 5GRTA 2BK5A 3UOXA 3M13A 1NAAA 2RGHA 2IIDA 4DNAA 3CNSA 3H8IA 2EQ6A 5FS6A 3AECA 5M10A 2C67A 4X4JA 2GAGB 2XLUA 2A87A 2WU5A 3AEBA 1CJ3A 2VQ7A 4G74A 2QCUA 4NTDA 5FS9A 2JK6A 4DSHA 2PHHA 1PXBA 2XVEA 4IA5A 3UKKA 1TYTA 1PHHA 5JCMA 4ADWA 3CGEA 1DOCA 1E7PA 1L9EA 4FX9A 3CNDA 3LZXA 3NN0X 3AE6A 1GRHA 2AAQA 1JOAA 4OCGA 4XWRA 4D04A 4GUVA 3AE5A 1D4CA 2AR8A 1Y0PA 2FJDA 1L0VA 3K7MX 1JNRA 4K8DA 3S5WA 2WS3A 4A6NA 1ZKQA 4RG3A 1ZY8A 3CGCA 3DK9A 5KRQA 3KPFA 2R0CA 3FBSA 2ZZBA 4YWOA 3KA7A 1ZDLA 4TM0A 3SFDA 1KSSA 2WP6A 1VDCA 3ZDNA 1GV4A 3GYJA 1OJ9A 1B37A 4JNAA 5KXJA 4G73A 3AB1A 3AD8B 3LB8A 2Y6QA 3HYVA 4A7AA 4J31A 4H4WA 1F8RA 1H6VA 1TDFA 1LQUA 2YLRA 3ATQA 1XPQA 1DOBA 3F8PA 4G6GA 4KX6A 4APNA 4CCQA 1IUSA 1Y56B 4U8NA 4HB9A 3VR9A 3ICSA 1ZK7A 3H8LA 4YSXA 1F3PA 1YY5A 1LV0A 3H4KA 3PS9A 4ECHA 2DKHA 4A5LA 2BXRA 3PG6A 3D8XA 4PABA 2C4CA 2AQJA 3ISHA 1S3EA 2YVGA 2WEUA 1PJ5A 4EQXA 4BJYA 2C3CA 5JCKA 5EOWA 2APGA 1F8WA 4J34A 4NWZA 3DA1A 2YVJA 4YKGA 4B68A 1BGNA 1QO8A 1FCDA 2FBWA 1ZOVA 3F8RA 3RP8A 3DK4A 2BRYA 1QLBA 3AEGA 4B1BA 2BK4A 5CQFA 3UKQA 3T0KA 4H2QA 2XCGA 4JNQA 2YLTA 2FJAA 4EMIA 2GMHA 1Q1RA 1RYIA 3QFBA 3EPTA 5L46A 3ICTA 2WBAA 2JKCA 2CULA 3T31A 3CGBA 2Z5YA 4EQWA 2GR0A 5JCIA 1E1NA 3ZYXA 1Q1WA 1KDGA 1GPEA 2OAMA 3BI5A 1PJ7A 1TDEA 5EB5A 2XFPA 3DK8A 5FS7A 2IVDA 1EBDA 3OZ2A 4J33A 3VRBA 1W4XA 3WE0A 4H7UA 1NPXA 2X8HA 5KNLA 4GR1A 2BCGG 1D4DA 2YG6A 1S2QA 2Z5XA 2GEWA 3QJ4A 4YTNA 4H4TA 4A9WA 4EMJA 1JRZA 2WDQA 4OPLA 1NDAA 1Z6LA 1D5TA 2V6OA 3DJGX 4XXGA 3LZWA 1GESA 3F8DA 4U8JA 1GEUA 2WOWA 5TR3A 3UKFA 1P2EA 2GMJA 3NTAA 1LJ1A 3DH9A 5BVAA 4B63A 4X9MA 4TM3A 4WX1A 3VRAA 5IQ1A 2BRAA 5BULA 2XVFA 2WETA 2WOVA 1F6MA 2Y6RA 1CC6A 3AWIA 2BC0A 1N4VA 4C3XA 3UKLA 3P4SA 1CBOA 4LA1A 1MXTA 4AT2A 1YQ3A 1PBFA 3R9UA 1ZX9A 1E1KA 1S2YA 3AEAA 3P9UA 4CY6A 4EIPA 2XLTA 3K7QX 2NVKX 3AD7B 3DJDA 5KMSA 1NHQA 3O0HA 4H4SA 2R0PA 2YM1A 3AE2A 2GB0A 2XVIA 4B66A 2Q0KA 3QVPA 3VRDB 3BI4A 2C66A 5HYMA 3NRNA 4C3YA 4USQA 4H4PA 2GF3A 2YLXA 2O9ZA 3KU9A 2V5ZA 1NG3A 2X8GA 4GRTA 5IQ4A 2WQYA 3GDPA 4U2LA 4GDPA 1ZP0A 2H88A 3G5QA 2XLRA 2V60A 3K7TA 2BACA 1KNRA 3CNPA 1O95A 1XHCA 2WPEA 3GD3A 5CKUA 1CJ4A 1XDIA 2WP9A 4C74A 5LV9A 1GTEA 1IUXA 4WCTA 2YAUA 2XVJA 3NKSA 4UDQA 1JU2A 4YSHA 1FOHA 2B76A 1CC4A 1TRBA 4OPCA 1EL5A 3UTGA 1PBDA 4JY2A 2R46A 4YT0A 1JRYA 4Z2RA 3IC9A 2VZ2A 5JRBA 4OPUA 3FMWA 1H7WA 2J3NA 3GSIA 4H4XA 3UOZA 1IUUA 1H2IA 3SXIA 3UKAA 4AOSA 2QA1A 3IWAA 3DGHA 1H84A 5GSNA 2TPRA 2XLSA 2Q0LA 1NHSA 1H86A 4HA6A 4U8OA 1O94A 2FJBA 3QSEA 1E6EA 1PBCA 4G9KA 4AP3A 4B69A 1OJTA 2B7SA 3GMCA 4G6HA 4OVIA 1KNPA 3UKPA 4BK3A 1MOKA 2GV8A 3VR8A 2VVMA 4Y4MA 1M64A 3QVRA 4YSZA 1MO9A 1NG4A 1CJ2A 3BI2A 2YR6A 3T2ZA 1QJDA 2JB3A 3T37A 1XANA 1D7LA 4U8KA 4H2PA 1YKJA 3Q9TA 4OPTA 2BS4A 3CPHG 2CFYA 1UKVG 4EM4A 4U8IA 3SFEA 1E1MA 3BNMA 2VVLA 3C96A 5BRTA 3KD9A 4TM4A 2CVJA 3LOVA 1GRFA 3LXDA 2JBVA 4EQSA 4FK1A 2BS2A 3UTHA 1AOGA 1D4EA 2XFQA 1TYPA 1PN0A 4IVOB 3DJEA 3NH3X 3ALMA 3AEDA 4A79A 3HYXA 4OPDA 1KF6A 3GWFA 2XLPA 3DJJA 4RSLA 2YVFA 1GRTA 3AXBA 3M0OA 2C7GA 4USRA 4C5OA 2ACZA 2GH5A 4H4YA 4K2XA 3GD4A 4RG4A 2WPFA 5U1OA 5KVHA 4II2A 1H83A 1LTXR 1X31B 4ZN0A 2H89A 4FK1C 2BABA 1D7YA 2E4GA 4YSYA 1CC2A 3EANA 3RP7A 1CJCA 4H2RA 4O5QA 2I0ZA 4PAAA 2BXSA 2R4JA 1B8SA 3AE3A 5C3JA 2R9ZA 1Q9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P2H A;  1PXC A;  4H4Q A;  2Q7V A;  3RED A;  1OJC A;  2YQU A;  1GSN A;  4BUR A;  2XFN A;  1PXA A;  1K0I A;  3ABV A;  1FEB A;  1IUT A;  1KSU A;  2BC1 A;  2R45 A;  1CL0 A;  3QSS A;  2YLZ A;  4GF7 A;  2XDO A;  4ZCD A;  3CPJ G;  1YQ4 A;  3GRT A;  4A6N B;  1ZMC A;  3UCL A;  1ONF A;  2WHD A;  4I58 A;  4J36 A;  3CNJ A;  4NTC A;  4A65 A;  5BUK A;  2GR2 A;  2VQB A;  4DGK A;  2OAL A;  2GR1 A;  4U8L A;  2XFU A;  3IF9 A;  2BYB A;  2W0H A;  1VG9 A;  1NHR A;  3FG2 P;  3DME A;  3EAO A;  1BKW A;  2C72 A;  2TMD A;  2WU2 A;  1RP0 A;  4IA6 A;  4M52 A;  1JRX A;  3L8K A;  2EQ8 A;  3AE4 A;  1NEK A;  2JB2 A;  2BK3 A;  3NHO X;  4EM3 A;  2GQW A;  2YG7 A;  4NZH A;  3SGL A;  4ICY A;  3Q6J A;  5JCL A;  1PJ6 A;  5J7X A;  4DSG A;  2ZZ0 A;  3NLC A;  4Z2U A;  4H4Z A;  2C75 A;  2B9Y A;  3SM8 A;  2ARD A;  5HY5 A;  1Y56 A;  1GAL A;  1TDK A;  3BHK A;  4EIQ A;  1GTH A;  1VQW A;  5KVI A;  1DJQ A;  4UDP A;  2XYO A;  5C2T A;  2YWL A;  2YR5 A;  3NK0 X;  1BGJ A;  4XWZ A;  2BCP A;  5HHF A;  4B64 A;  3URH A;  2PYX A;  2YG5 A;  4N9X A;  1OJA A;  4EMW A;  1PBB A;  1REO A;  2RGO A;  3BHF A;  3K30 A;  1BWC A;  2B9W A;  3NTD A;  4Y4N A;  3GMB A;  4GDE A;  1SEZ A;  3IHM A;  3QFA A;  4H2N A;  3BNU A;  1GT8 A;  1PS9 A;  2YLS A;  1HYU A;  1E39 A;  2B7R A;  3CNT A;  4B65 A;  4AOX A;  2OLN A;  4Z26 A;  3UTE A;  3I3L A;  3CPI G;  2IVE A;  3NYC A;  4Z44 A;  4Y4L A;  2YR4 A;  3UTF A;  3FIM B;  4CRT A;  2FJE A;  4KPR A;  1O5W A;  3COX A;  4Z25 A;  2CDU A;  4AT0 A;  3AE7 A;  3EF6 A;  1NHP A;  3AEE A;  1VRQ B;  5JCN A;  3V76 A;  1DOD A;  3UOY A;  1FEC A;  3I6D A;  3CGD A;  1B5Q A;  3FPZ A;  3PVC A;  4OPI A;  2YG4 A;  2B9X A;  3II4 A;  4BK1 A;  4ZCC A;  1DJN A;  1DOE A;  2WES A;  3NYE A;  4REK A;  2RAB A;  2V3A A;  2WDR A;  3AEF A;  3NK1 X;  4J2W A;  4Z2T A;  2Q6U A;  5U25 A;  3JSK A;  3B6D A;  4Z24 A;  4LII A;  2GR3 A;  1DNC A;  5ER0 A;  2GAH B;  1K0J A;  3AYL A;  3M12 A;  2EQ7 A;  3KLJ A;  3RP6 A;  2YG3 A;  3LAD A;  3V3O A;  3E1T A;  4K5S A;  2X99 A;  2GVC A;  2VVL G;  3AD9 B;  3G5S A;  3IHG A;  5U63 A;  2JB1 A;  4OPG A;  3UP5 A;  1GRA A;  4BK2 A;  1ZOY A;  3NGC X;  3ICR A;  1GRE A;  2V3B A;  1E1L A;  2QA2 A;  3DGZ A;  3P4P A;  3NNE A;  5EB4 A;  1F8S A;  2UZZ A;  2RGJ A;  4C77 A;  4YKF A;  3ITJ A;  2WP5 A;  1B4V A;  2C73 A;  1LPF A;  2ZBW A;  3V3N A;  2NPX A;  4J56 A;  2VRM A;  4D03 A;  2OA1 A;  1CF3 A;  3SQP A;  4K7Z A;  2VRL A;  3CIR A;  1L9C A;  2YLW A;  3ALL A;  2BA9 A;  3G5R A;  2A89 A;  4K22 A;  4CCR A;  4K5R A;  1V59 A;  4E0V A;  4U8P A;  3AE9 A;  4LU6 A;  5DBJ A;  1FEA A;  3LJP A;  1IUW A;  3L1R A;  3P4R A;  2WDV A;  3GWD A;  2XVH A;  2WOI A;  1H81 A;  4BJZ A;  1DXL A;  1H82 A;  4AP1 A;  4UP3 A;  4YXD A;  4U2T A;  1S3B A;  3NIX A;  1GRG A;  2R0G A;  3NK2 X;  3OC4 A;  1L9D A;  3D1C A;  5IPY A;  5FS8 A;  2HQM A;  4YTP A;  3NN6 X;  3AE1 A;  3ALJ A;  3PO7 A;  2JAE A;  2X50 A;  4NEV A;  4O5U A;  2GQF A;  1RSG A;  3GDN A;  4YTM A;  4H50 A;  3B3R A;  1GXF A;  2GRT A;  4TLZ A;  1GND A;  3NYF A;  2E5V A;  4JN9 A;  3RNM A;  2R4E A;  1EL9 A;  5FMH A;  4Z43 A;  1BF3 A;  5KOX A;  1H7X A;  1K4Q A;  2VOU A;  2BS3 A;  3GRS A;  2V61 A;  3HZL A;  1FL2 A;  4U8M A;  2C64 A;  5KOW A;  5M0Z A;  2EQ9 A;  1PDH A;  4IVM B;  1GOS A;  3KKJ A;  3ATR A;  1OJD A;  1K0L A;  4CBQ A;  4JQ9 A;  3QSM A;  1EL8 A;  1YQZ A;  4A99 A;  4JY3 A;  1TDO A;  3AYJ A;  3UKH A;  1LQT A;  1ELI A;  2WPC A;  3CTY A;  1TDN A;  4BV6 A;  2QAE A;  4NEW A;  2YM2 A;  4CNK A;  1CHU A;  1PBE A;  2XFO A;  3C4N A;  1EL7 A;  3P4Q A;  4H4V A;  2DKI A;  3UP4 A;  3S61 A;  4MJW A;  4EQR A;  2X8C A;  1N1P A;  2C70 A;  4GCM A;  3C4A A;  1COY A;  1N4W A;  2C76 A;  1NEN A;  1VG0 A;  3KVE A;  1GET A;  4IV9 A;  1JNZ A;  3GYI A;  4TM1 A;  3RHA A;  2ZZC A;  1KFY A;  2C65 A;  4CNJ A;  4JDR A;  3AYI A;  4TLX A;  1GER A;  1BZL A;  3UOV A;  1M6I A;  4H4U A;  1N4U A;  2OLO A;  4NTE A;  3VQR A;  5KWF A;  3ADA B;  1JEH A;  3P1W A;  2C3D A;  2F5Z A;  4B67 A;  1GRB A;  2A8X A;  4FDC B;  4UDR A;  3NG7 X;  3NT6 A;  4H4R A;  3AE8 A;  5EBK A;  1ZMD A;  1IUV A;  4U2S A;  4J57 A;  3CN8 A;  4CY8 A;  4X9N A;  5HXI A;  1LVL A;  4P9S A;  1IJH A;  4I59 A;  5J60 A;  2X3N A;  2E1M A;  5GRT A;  2BK5 A;  3UOX A;  3M13 A;  1NAA A;  2RGH A;  2IID A;  4DNA A;  3CNS A;  3H8I A;  2EQ6 A;  5FS6 A;  3AEC A;  5M10 A;  2C67 A;  4X4J A;  2GAG B;  2XLU A;  2A87 A;  2WU5 A;  3AEB A;  1CJ3 A;  2VQ7 A;  2QCU A;  4NTD A;  5FS9 A;  2JK6 A;  4DSH A;  2PHH A;  1PXB A;  2XVE A;  4IA5 A;  3UKK A;  1TYT A;  1PHH A;  5JCM A;  4ADW A;  3CGE A;  1DOC A;  1E7P A;  1L9E A;  4FX9 A;  3CND A;  3LZX A;  3NN0 X;  3AE6 A;  1GRH A;  2AAQ A;  1JOA A;  4OCG A;  4XWR A;  4D04 A;  4GUV A;  3AE5 A;  1D4C A;  2AR8 A;  1Y0P A;  2FJD A;  1L0V A;  3K7M X;  1JNR A;  4K8D A;  3S5W A;  2WS3 A;  4A6N A;  1ZKQ A;  4RG3 A;  1ZY8 A;  3CGC A;  3DK9 A;  5KRQ A;  3KPF A;  2R0C A;  3FBS A;  2ZZB A;  4YWO A;  3KA7 A;  1ZDL A;  4TM0 A;  3SFD A;  1KSS A;  2WP6 A;  1VDC A;  3ZDN A;  1GV4 A;  3GYJ A;  1OJ9 A;  1B37 A;  4JNA A;  5KXJ A;  3AB1 A;  3AD8 B;  3LB8 A;  2Y6Q A;  4A7A A;  4J31 A;  4H4W A;  1F8R A;  1H6V A;  1TDF A;  1LQU A;  2YLR A;  3ATQ A;  1XPQ A;  1DOB A;  3F8P A;  4KX6 A;  4CCQ A;  4APN A;  1IUS A;  1Y56 B;  4U8N A;  4HB9 A;  3VR9 A;  3ICS A;  1ZK7 A;  3H8L A;  4YSX A;  1F3P A;  1YY5 A;  1LV0 A;  3H4K A;  3PS9 A;  4ECH A;  2DKH A;  4A5L A;  2BXR A;  3D8X A;  4PAB A;  2AQJ A;  3ISH A;  1S3E A;  2YVG A;  2WEU A;  1PJ5 A;  4EQX A;  4BJY A;  2C3C A;  5JCK A;  5EOW A;  2APG A;  1F8W A;  4J34 A;  3DA1 A;  2YVJ A;  4YKG A;  4B68 A;  1BGN A;  1QO8 A;  1FCD A;  2FBW A;  1ZOV A;  3F8R A;  3RP8 A;  3DK4 A;  1QLB A;  3AEG A;  4B1B A;  2BK4 A;  5CQF A;  3UKQ A;  4H2Q A;  2XCG A;  4JNQ A;  2YLT A;  2FJA A;  4EMI A;  2GMH A;  1Q1R A;  1RYI A;  3QFB A;  3EPT A;  5L46 A;  3ICT A;  2WBA A;  2JKC A;  2CUL A;  3CGB A;  2Z5Y A;  4EQW A;  2GR0 A;  5JCI A;  1E1N A;  3ZYX A;  1Q1W A;  1KDG A;  1GPE A;  2OAM A;  3BI5 A;  1PJ7 A;  1TDE A;  5EB5 A;  2XFP A;  3DK8 A;  5FS7 A;  2IVD A;  1EBD A;  3OZ2 A;  4J33 A;  3VRB A;  1W4X A;  3WE0 A;  4H7U A;  1NPX A;  2X8H A;  4GR1 A;  2BCG G;  1D4D A;  2YG6 A;  1S2Q A;  2Z5X A;  2GEW A;  3QJ4 A;  4YTN A;  4H4T A;  4A9W A;  4EMJ A;  1JRZ A;  2WDQ A;  4OPL A;  1NDA A;  1Z6L A;  1D5T A;  2V6O A;  3DJG X;  4XXG A;  3LZW A;  1GES A;  3F8D A;  4U8J A;  1GEU A;  2WOW A;  5TR3 A;  3UKF A;  1P2E A;  2GMJ A;  3NTA A;  1LJ1 A;  3DH9 A;  5BVA A;  4B63 A;  4X9M A;  4TM3 A;  4WX1 A;  3VRA A;  5IQ1 A;  5BUL A;  2XVF A;  2WET A;  2WOV A;  1F6M A;  2Y6R A;  1CC6 A;  3AWI A;  2BC0 A;  1N4V A;  4C3X A;  3UKL A;  3P4S A;  1CBO A;  4LA1 A;  1MXT A;  4AT2 A;  1YQ3 A;  1PBF A;  3R9U A;  1ZX9 A;  1E1K A;  1S2Y A;  3AEA A;  3P9U A;  4CY6 A;  4EIP A;  2XLT A;  3K7Q X;  2NVK X;  3AD7 B;  3DJD A;  1NHQ A;  3O0H A;  4H4S A;  2R0P A;  2YM1 A;  3AE2 A;  2GB0 A;  2XVI A;  4B66 A;  2Q0K A;  3QVP A;  3VRD B;  3BI4 A;  2C66 A;  5HYM A;  3NRN A;  4C3Y A;  4USQ A;  4H4P A;  2GF3 A;  2YLX A;  2O9Z A;  3KU9 A;  2V5Z A;  1NG3 A;  2X8G A;  4GRT A;  5IQ4 A;  2WQY A;  3GDP A;  4U2L A;  4GDP A;  1ZP0 A;  2H88 A;  3G5Q A;  2XLR A;  2V60 A;  3K7T A;  2BAC A;  1KNR A;  3CNP A;  1O95 A;  1XHC A;  2WPE A;  3GD3 A;  5CKU A;  1CJ4 A;  1XDI A;  2WP9 A;  4C74 A;  5LV9 A;  1GTE A;  1IUX A;  4WCT A;  2YAU A;  2XVJ A;  3NKS A;  4UDQ A;  1JU2 A;  4YSH A;  1FOH A;  2B76 A;  1CC4 A;  1TRB A;  4OPC A;  1EL5 A;  3UTG A;  1PBD A;  4JY2 A;  2R46 A;  4YT0 A;  1JRY A;  4Z2R A;  3IC9 A;  2VZ2 A;  4OPU A;  3FMW A;  1H7W A;  2J3N A;  3GSI A;  4H4X A;  3UOZ A;  1IUU A;  3UKA A;  4AOS A;  2QA1 A;  3IWA A;  3DGH A;  1H84 A;  5GSN A;  2TPR A;  2XLS A;  2Q0L A;  1NHS A;  1H86 A;  4HA6 A;  4U8O A;  1O94 A;  2FJB A;  3QSE A;  1E6E A;  1PBC A;  4AP3 A;  4B69 A;  1OJT A;  2B7S A;  3GMC A;  4OVI A;  1KNP A;  3UKP A;  4BK3 A;  1MOK A;  2GV8 A;  3VR8 A;  2VVM A;  4Y4M A;  1M64 A;  3QVR A;  4YSZ A;  1MO9 A;  1NG4 A;  1CJ2 A;  3BI2 A;  2YR6 A;  1QJD A;  2JB3 A;  3T37 A;  1XAN A;  1D7L A;  4U8K A;  4H2P A;  1YKJ A;  3Q9T A;  4OPT A;  2BS4 A;  3CPH G;  2CFY A;  1UKV G;  4EM4 A;  4U8I A;  3SFE A;  1E1M A;  3BNM A;  2VVL A;  3C96 A;  5BRT A;  3KD9 A;  4TM4 A;  2CVJ A;  3LOV A;  1GRF A;  3LXD A;  2JBV A;  4EQS A;  4FK1 A;  2BS2 A;  3UTH A;  1AOG A;  1D4E A;  2XFQ A;  1TYP A;  1PN0 A;  4IVO B;  3DJE A;  3NH3 X;  3ALM A;  3AED A;  4A79 A;  4OPD A;  1KF6 A;  3GWF A;  2XLP A;  3DJJ A;  4RSL A;  2YVF A;  1GRT A;  3AXB A;  3M0O A;  2C7G A;  4USR A;  4C5O A;  2ACZ A;  2GH5 A;  4H4Y A;  4K2X A;  3GD4 A;  4RG4 A;  2WPF A;  5U1O A;  5KVH A;  1H83 A;  1LTX R;  1X31 B;  4ZN0 A;  2H89 A;  4FK1 C;  2BAB A;  1D7Y A;  2E4G A;  4YSY A;  1CC2 A;  3EAN A;  3RP7 A;  1CJC A;  4H2R A;  4O5Q A;  2I0Z A;  4PAA A;  2BXS A;  2R4J A;  1B8S A;  3AE3 A;  5C3J A;  2R9Z A;  1Q9I A; 
#chains in the Genus database with same CATH topology
 3DFY A;  3N6J A;  1X2G A;  2OKT A;  1KSU A;  2BC1 A;  1CL0 A;  1BKH A;  3NFU A;  2WHD A;  4I58 A;  4NTC A;  2OAL A;  4GAV A;  2NQL A;  1VG9 A;  1NHR A;  3DME A;  4E4U A;  1JRX A;  3NHO X;  2GQW A;  4NZH A;  4ICY A;  4DSG A;  3NLC A;  4H4Z A;  3DG7 A;  5HY5 A;  1Y56 A;  1TDK A;  5C2T A;  3NK0 X;  2BCP A;  5HHF A;  1OJA A;  1PBB A;  1BWC A;  3MUC A;  3NTD A;  3SJN A;  1PS9 A;  2YLS A;  3UJS A;  1HYU A;  3CNT A;  2PTW A;  1RVK A;  3NYC A;  3SYI A;  3UTF A;  2FJE A;  4KPR A;  3COX A;  4Z25 A;  1NHP A;  4GAP A;  3I6D A;  2YG4 A;  4DHG A;  1DOE A;  3AEF A;  4Z2T A;  5U25 A;  3B6D A;  1DNC A;  1K0J A;  1XPY A;  4X2P A;  2EQ7 A;  2YG3 A;  3LAD A;  3GY1 A;  2X99 A;  2GVC A;  1FIQ B;  3IHG A;  3TOY A;  3KPK A;  1ZOY A;  3NNE A;  2UZZ A;  3P3B A;  2WP5 A;  2C73 A;  2E3T A;  3CIR A;  3EUB 3;  3ALL A;  2A89 A;  4CCR A;  4LU6 A;  1FEA A;  1KD0 A;  2XVH A;  4AP1 A;  4UP3 A;  4GFI A;  3PFR A;  3ES8 A;  3D1C A;  5FS8 A;  4YTP A;  3NN6 X;  1FFU C;  3ALJ A;  3PO7 A;  2JAE A;  4YTM A;  3B3R A;  1EL9 A;  2DW7 A;  5FMH A;  1BF3 A;  3Q4D A;  1H7X A;  1VQZ A;  4IVM B;  4CBQ A;  4JQ9 A;  3DDM A;  3QSM A;  3RCY A;  3AYJ A;  2W3R A;  4GIR A;  4CNK A;  3VDG A;  3S61 A;  3SZF A;  2X8C A;  3C4A A;  1N4W A;  1JRO A;  1JNZ A;  4TM1 A;  4CNJ A;  3AYI A;  1BZL A;  3VQR A;  5KWF A;  4B67 A;  2A8X A;  3NG7 X;  3NT6 A;  3AE8 A;  5EBK A;  3SQS A;  4U2S A;  4P9S A;  2E1M A;  2BK5 A;  1NAA A;  2RGH A;  2QJN A;  5FS6 A;  3AEC A;  5M10 A;  2GAG B;  1CJ3 A;  2VQ7 A;  1YEY A;  2QCU A;  5FS9 A;  1TYT A;  4ADW A;  1EC7 A;  2AAQ A;  4K8D A;  3D47 A;  2ZZB A;  3KA7 A;  3UXK A;  1ZDL A;  2P0I A;  2WP6 A;  1GV4 A;  4JHM A;  5KXJ A;  3LB8 A;  4A7A A;  4H4W A;  1TDF A;  4KEM A;  1XPQ A;  1IUS A;  4YSX A;  1BQG A;  4TVW A;  1YY5 A;  2DKH A;  2OLA A;  2BXR A;  3CAW A;  3ISH A;  4Z17 A;  3SN1 A;  1F8W A;  2MNR A;  2FBW A;  4HPN A;  3RGT A;  2FKP A;  1ZOV A;  3F8R A;  3ZVH A;  1QLB A;  3T4W A;  2BK4 A;  3IK4 A;  3T0K A;  4HNL A;  4JNQ A;  2E5A A;  4EMI A;  3ICT A;  2JKC A;  3BSM A;  3CGB A;  3R11 A;  1E1N A;  5BOE A;  5FS7 A;  3WE0 A;  2PGE A;  3OW1 A;  3ZVI A;  4YTN A;  4A9W A;  1JRZ A;  4HNC A;  4XXG A;  3T8Q A;  2WOW A;  5TR3 A;  4WX1 A;  4ROP A;  1SJB A;  4C3X A;  4LA1 A;  1YQ3 A;  3HW2 A;  1E1K A;  3UJ2 A;  3AEA A;  5KMS A;  3PWI A;  2YM1 A;  4MKS A;  3QVP A;  5HYM A;  1RM6 B;  4USQ A;  3I6E A;  2GF3 A;  2V5Z A;  2PP1 A;  3NZG A;  2WQY A;  2H88 A;  2V60 A;  2BAC A;  3CNP A;  5FJO A;  4C74 A;  2B76 A;  4IHC A;  3UTG A;  4JY2 A;  4YT0 A;  3ZLH A;  3IC9 A;  2PSN A;  4AOS A;  3IWA A;  4U8O A;  1FHU A;  2FJB A;  1OJT A;  4G6H A;  4OVI A;  3QVR A;  4YSZ A;  3T37 A;  2PP3 A;  1D7L A;  1YKJ A;  4U8I A;  3CPH G;  4EM4 A;  4HN8 A;  3C96 A;  3KD9 A;  2CVJ A;  3MY9 A;  1TYP A;  1PN0 A;  4HCH A;  1MDL A;  3HYX A;  1NU5 A;  2ZC8 A;  4H4Y A;  4K2X A;  3DG3 A;  4FK1 C;  2E4G A;  3EAN A;  1CJC A;  3R10 A;  2R4J A;  4J1O A;  3AE3 A;  3R0U A;  2R9Z A;  1Q9I A;  4DXK A;  1P2H A;  4H4Q A;  2YQU A;  2XFN A;  1K0I A;  1FEB A;  3D9X A;  2P8B A;  3VC5 A;  4ZCD A;  2XDO A;  3CPJ G;  1YQ4 A;  1ZMC A;  1P43 A;  3UCL A;  2DW6 A;  5BUK A;  3CNJ A;  5FJU A;  2GR1 A;  2BYB A;  2AL2 B;  2W0H A;  3SR6 B;  3CXB A;  2TMD A;  4M52 A;  2HZG A;  2BK3 A;  3BJS A;  4EM3 A;  3Q6J A;  1PJ6 A;  2ARD A;  1N63 C;  3S47 A;  4UDP A;  2XYO A;  2YR5 A;  2PYX A;  2YG5 A;  3BHF A;  5IDZ A;  3GMB A;  1FFV C;  3GYX A;  3QFA A;  1GT8 A;  1E39 A;  3U4F A;  1W6T A;  3UTE A;  3I4K A;  4Y4L A;  2YR4 A;  3N6H A;  2CDU A;  1FO4 A;  3SX6 A;  5FJP A;  1DOD A;  3VA8 A;  1FEC A;  1B5Q A;  4OPI A;  2B9X A;  3II4 A;  4ZCC A;  3NYE A;  2RAB A;  3NK1 X;  4J2W A;  3JSK A;  4Z24 A;  1R6W A;  3AN1 A;  5ER0 A;  3AYL A;  3M12 A;  1KKR A;  3E1T A;  3G5S A;  4OPG A;  2QA2 A;  3DGZ A;  5EB4 A;  4C77 A;  4YKF A;  4ENL A;  3V3N A;  2NPX A;  4J56 A;  2OA1 A;  3SQP A;  2VRL A;  1L9C A;  2YLW A;  3G5R A;  2BA9 A;  1V59 A;  4U8P A;  3L1R A;  2WDV A;  3GWD A;  2WOI A;  3SZC A;  1H82 A;  2RDX A;  4YXD A;  3OC4 A;  1L9D A;  3AE1 A;  1EBH A;  4ZOH B;  1GXF A;  2GRT A;  1GND A;  3RNM A;  3THU A;  4Z43 A;  4M0X A;  1JCT A;  2ONE A;  2HXT A;  1K4Q A;  2BS3 A;  3Q45 A;  4U8M A;  5KOW A;  5M0Z A;  4ZA0 A;  3VCN A;  4A99 A;  4JY3 A;  1TDO A;  3UKH A;  2PGW A;  1MDR A;  2P88 A;  4BV6 A;  4NEW A;  1FHV A;  1PBE A;  2XFO A;  1EL7 A;  3P4Q A;  4H4V A;  3UP4 A;  3MSY A;  1N1P A;  1COY A;  4IV9 A;  3GYI A;  3TJ4 A;  4IL0 A;  4JDR A;  4TLX A;  3PWG A;  1M6I A;  4H4U A;  2OLO A;  3ADA B;  1JEH A;  3P1W A;  4YWS A;  4NNJ A;  2F5Z A;  1N61 C;  4CY8 A;  3T9P A;  1PDZ A;  2PS2 A;  4JN8 A;  4X4J A;  3UJE A;  2A87 A;  3TW9 A;  4NTD A;  2JK6 A;  4DSH A;  2PHH A;  2XVE A;  3UKK A;  1PHH A;  3AE6 A;  1GRH A;  4OCG A;  4XWR A;  4D04 A;  3AE5 A;  1D4C A;  1Y0P A;  4RG3 A;  3CGC A;  3KPF A;  2OQH A;  3ZDN A;  3AB1 A;  4J31 A;  4KX6 A;  1DOB A;  4HB9 A;  4ECH A;  3PS9 A;  3D8X A;  3PG6 A;  2AQJ A;  3OTR A;  2YVG A;  4BJY A;  4F4R A;  5EOW A;  2QGY A;  1FCD A;  5G5G B;  2BRY A;  1WUE A;  2FJA A;  1JPD X;  1Q1R A;  3EPT A;  3QFB A;  3QPE A;  2WBA A;  5JCI A;  1Q1W A;  3BI5 A;  1PJ7 A;  1TDE A;  1EBD A;  3OZ2 A;  3FXG A;  5FJT A;  2X8H A;  4H7U A;  5KNL A;  4GR1 A;  1D4D A;  2YG6 A;  3QJ4 A;  7ENL A;  1NDA A;  2V6O A;  3F8D A;  3DFH A;  2WET A;  2Y6R A;  3P4S A;  5J04 A;  1CBO A;  4AT2 A;  3R9U A;  1ZX9 A;  3I6T A;  2NVK X;  3DJD A;  1NHQ A;  3O0H A;  3AE2 A;  3BI4 A;  2XGZ A;  3KU9 A;  2O9Z A;  4ZCW A;  1NG3 A;  3BOX A;  4GRT A;  2W3S A;  2GDQ A;  1O95 A;  2AL1 A;  2WPE A;  1CJ4 A;  1XDI A;  1GTE A;  1R0M A;  1CC4 A;  4E5T A;  1EL5 A;  1JRY A;  2VZ2 A;  3B9J B;  3SXI A;  3DGH A;  1NHS A;  4A6G A;  3DER A;  4AP3 A;  3QTP A;  1E6E A;  1JDF A;  3SN4 A;  4BK3 A;  1MOK A;  4Y4M A;  1NG4 A;  3BI2 A;  1CJ2 A;  3CK5 A;  4H2P A;  3IJQ A;  2BS4 A;  3SFE A;  2OFJ A;  2GGJ A;  5BRT A;  3LOV A;  3UTH A;  1D4E A;  3NH3 X;  3VC6 A;  2AKM A;  4A79 A;  4OPD A;  2XH0 A;  4IZG A;  1KF6 A;  2XLP A;  4DX3 A;  3AXB A;  3M0O A;  4C5O A;  4RG4 A;  2WPF A;  4E6M A;  2BAB A;  1D7Y A;  2OZ8 A;  3DES A;  2P3Z A;  2I0Z A;  1JRP A;  4H83 A;  3IF9 A;  1EC8 A;  1PXC A;  3RED A;  1OJC A;  4BUR A;  2ZAD A;  3ABV A;  1IUT A;  2R45 A;  1N5X A;  3QSS A;  2YLZ A;  4A35 A;  4GF7 A;  3GRT A;  2GL5 A;  4A6N B;  2QQ6 A;  3SY4 A;  1ONF A;  4J36 A;  4G8T A;  3TCS A;  3EAO A;  1RP0 A;  3L8K A;  2EQ8 A;  3UJR A;  1NEK A;  3SGL A;  5JCL A;  5J7X A;  3L5O A;  2C75 A;  3SM8 A;  5KMP A;  5BOF A;  1ONE A;  4KPL A;  4EIQ A;  1GTH A;  3SZW A;  1BGJ A;  4XWZ A;  3URH A;  2FYM A;  4EMW A;  3CB3 A;  3K30 A;  3DEQ A;  2B9W A;  4DWD A;  1SEZ A;  4K8G A;  3BNU A;  2B7R A;  4Z26 A;  2IVE A;  4Z44 A;  3FIM B;  4CRT A;  3AE7 A;  3T2Y A;  3AMZ A;  4IT1 A;  1IYX A;  5JCN A;  3UOY A;  3FPZ A;  4BK1 A;  2WES A;  2MUC A;  2Q6U A;  4JN7 A;  4LII A;  2GR3 A;  2GAH B;  3KLJ A;  3V3O A;  3AD9 B;  1GRA A;  3ICR A;  1GRE A;  2V3B A;  4GYP A;  1F8S A;  4J3Z A;  3ITJ A;  2GSH A;  4FP1 A;  3V3W A;  1MNS A;  3NVV B;  4D03 A;  4K7Z A;  3SSZ A;  3CXO A;  4GME A;  4K5R A;  4E0V A;  5DBJ A;  3LJP A;  1IUW A;  4E8G A;  3T14 A;  3JZU A;  3IJI A;  3TQP A;  4U2T A;  1S3B A;  2QDE A;  2P8C A;  1L8P A;  3NIX A;  1GRG A;  2R0G A;  3NK2 X;  3QLD A;  5IPY A;  3VCC A;  2X50 A;  4NEV A;  1RSG A;  3MQT A;  1MRA A;  4TLZ A;  2E5V A;  4JN9 A;  3RO6 A;  3GRS A;  2EQ9 A;  1SJA A;  1GOS A;  2OX4 A;  2PMQ A;  1OJD A;  1K0L A;  3ATR A;  3OZM A;  1EL8 A;  1YQZ A;  3D46 A;  4KWS A;  1LQT A;  2QAE A;  2YM2 A;  3C4N A;  3CT2 A;  2C70 A;  4GCM A;  2C76 A;  2OZ3 A;  2HXU A;  2ZZC A;  3RHA A;  1KFY A;  2C65 A;  1GER A;  4UDR A;  1WUF A;  4HYR A;  4GGB A;  1ZMD A;  1IUV A;  4J57 A;  1ZXI C;  4X9N A;  5J60 A;  1IJH A;  2X3N A;  2HNE A;  2AKZ A;  2IID A;  4DNA A;  3H8I A;  2C67 A;  2PCE A;  3QKE A;  2XLU A;  2WU5 A;  4G74 A;  2PU1 A;  3OPS A;  1PXB A;  4IA5 A;  5JCM A;  2GGH A;  1E7P A;  4FX9 A;  3NN0 X;  1JOA A;  2AR8 A;  3UCC A;  3K7M X;  3S5W A;  1ZKQ A;  2OZT A;  3FBS A;  1KSS A;  1B37 A;  4JNA A;  2PA6 A;  5FJR A;  1F8R A;  1H6V A;  1LQU A;  2YLR A;  3F8P A;  4G6G A;  4APN A;  1Y56 B;  4U8N A;  3ICS A;  1ZK7 A;  3H8L A;  1F3P A;  3UJF A;  3GC2 A;  4A5L A;  3EEZ A;  2PTZ A;  4PAB A;  2C4C A;  1S3E A;  1PJ5 A;  2APG A;  4YKG A;  4B68 A;  1QO8 A;  1KCZ A;  3DK4 A;  3AEG A;  4B1B A;  5CQF A;  2YLT A;  2GMH A;  5L46 A;  2PPG A;  4EQW A;  3NO1 A;  2GR0 A;  3ZYX A;  1KDG A;  2OAM A;  2IVD A;  4J33 A;  1NPX A;  2BCG G;  2Z5X A;  4EMJ A;  5EU9 A;  1D5T A;  4H2H A;  2PP0 A;  2OG9 A;  3LZW A;  4U8J A;  1GEU A;  3UKF A;  2GMJ A;  3NTA A;  4B63 A;  4X9M A;  3VRA A;  5IQ1 A;  3NXL A;  2I5Q A;  2WOV A;  4IP4 A;  1F6M A;  1F9C A;  3AWI A;  1N4V A;  1MXT A;  3FV9 A;  1PBF A;  3P9U A;  4CY6 A;  4EIP A;  4DYE A;  2XLT A;  3K7Q X;  1EBG A;  4H4S A;  2R0P A;  2Q0K A;  2GGE A;  4HCL A;  4C3Y A;  4H4P A;  2YLX A;  2XH4 A;  2XLR A;  3K7T A;  1SB3 B;  1NEL A;  3QN3 A;  3GD3 A;  1N5W C;  5G5H B;  5LV9 A;  1IUX A;  4WCT A;  2YAU A;  3NKS A;  4YSH A;  1TRB A;  1PBD A;  4Z2R A;  5JRB A;  3FMW A;  3DG6 A;  1H7W A;  3GSI A;  4H4X A;  3UOZ A;  1IUU A;  1H2I A;  1PDY A;  3UKA A;  5GSN A;  2Q0L A;  1O94 A;  4IL2 A;  4B69 A;  4G9K A;  1KNP A;  3UKP A;  2QJM A;  2VVM A;  3TWB A;  1M64 A;  1EC9 A;  4GGH A;  1QJD A;  1SJC A;  1XAN A;  4U8K A;  3N4E A;  3Q9T A;  3FJ4 A;  1E1M A;  3BNM A;  3TWA A;  4TM4 A;  2XH7 A;  1GRF A;  3LXD A;  2JBV A;  3UCD A;  4FK1 A;  1AOG A;  2XFQ A;  3DJE A;  3AED A;  3DJJ A;  4RSL A;  2YVF A;  1GRT A;  2C7G A;  4GYP C;  3NVZ B;  3GD4 A;  4HCD A;  5U1O A;  5KVH A;  1X2H A;  1CC2 A;  3RP7 A;  4O5Q A;  4DN1 A;  1B8S A;  2Q7V A;  1JPM A;  1GSN A;  1PXA A;  3MWC A;  3ZLG A;  1STZ A;  3IJL A;  2POZ A;  4A65 A;  2GR2 A;  2VQB A;  4DGK A;  3DIP A;  4U8L A;  3JW7 A;  2XFU A;  2POD A;  3FG2 P;  1ELS A;  3ES7 A;  1BKW A;  2C72 A;  2WU2 A;  3CYJ A;  4IA6 A;  3AE4 A;  2JB2 A;  3H7V A;  2YG7 A;  4Z2U A;  2ZZ0 A;  2B9Y A;  3R07 C;  1GAL A;  3BHK A;  1VQW A;  5KVI A;  1DJQ A;  2YWL A;  4B64 A;  1N60 C;  4N9X A;  2CHR A;  1REO A;  2RGO A;  1WYG A;  4GDE A;  4Y4N A;  3IHM A;  4H2N A;  3T2K A;  3ZVH B;  1VDV A;  2GGG A;  4B65 A;  4AOX A;  2OLN A;  3I3L A;  3CPI G;  3NS1 B;  1O5W A;  2W54 A;  4AT0 A;  3EF6 A;  3AEE A;  1VRQ B;  3V76 A;  3CGD A;  3PVC A;  3SZ0 A;  1DJN A;  4REK A;  1KN0 A;  2V3A A;  2WDR A;  3A7A A;  3DGB A;  4II3 A;  2OO6 A;  3HYW A;  2PU0 A;  3OP2 A;  3RP6 A;  4K5S A;  5IQ4 A;  2VVL G;  5U63 A;  3UP5 A;  2JB1 A;  4BK2 A;  3NGC X;  2OVL A;  4G7F A;  1E1L A;  3P4P A;  2RGJ A;  3MKC A;  1B4V A;  2ZBW A;  1LPF A;  2VRM A;  1CF3 A;  5KMR A;  4K22 A;  3AE9 A;  3P4R A;  3SBF A;  1N62 C;  1H81 A;  4GIS A;  5KMQ A;  4BJZ A;  1DXL A;  3CMM A;  3OZY A;  2HQM A;  3NRZ B;  6ENL A;  4O5U A;  2GQF A;  3GDN A;  4H50 A;  1S7M A;  3NYF A;  3P0W A;  3NVY B;  2R4E A;  5KOX A;  1E9I A;  2VOU A;  2V61 A;  3HZL A;  3MZN A;  1FL2 A;  3FVD A;  2C64 A;  3PK7 A;  3R0K A;  1PDH A;  3KKJ A;  3FYY A;  1V97 A;  1ELI A;  2WPC A;  3CTY A;  1TDN A;  3STP A;  1CHU A;  2XSX A;  2DKI A;  3TJI A;  4MJW A;  4EQR A;  1NEN A;  1VG0 A;  4Z1Y A;  1GET A;  3KVE A;  3EKG A;  3UOV A;  1N4U A;  4NTE A;  2C3D A;  1OEP A;  4E4F A;  1GRB A;  3ENL A;  4FDC B;  4H4R A;  4FI4 A;  3CN8 A;  5HXI A;  1LVL A;  4I59 A;  1ECQ A;  5GRT A;  3UOX A;  3M13 A;  3CNS A;  1TE6 A;  2EQ6 A;  4IP5 A;  3R25 A;  2QVH A;  5ENL A;  3AEB A;  1DOC A;  3CGE A;  3H12 A;  3B97 A;  1L9E A;  3LZX A;  3CND A;  1TKK A;  4GUV A;  2FJD A;  1L0V A;  1JNR A;  2WS3 A;  4A6N A;  1ZY8 A;  3DK9 A;  5KRQ A;  2R0C A;  4YWO A;  4TM0 A;  4MGG A;  3SFD A;  3V5C A;  1VDC A;  3GYJ A;  1OJ9 A;  3UGV A;  2QDD A;  4MMW A;  4G73 A;  3AD8 B;  2Y6Q A;  3HYV A;  1T3Q C;  3ATQ A;  4CCQ A;  3SN0 A;  3GD6 A;  3RRA A;  3VR9 A;  1LV0 A;  3H4K A;  3U9I A;  3AM9 A;  2WEU A;  4EQX A;  2XH2 A;  3R1Z A;  2C3C A;  5JCK A;  3T6C A;  4J34 A;  4NWZ A;  3DA1 A;  2YVJ A;  1BGN A;  3RP8 A;  3UKQ A;  4H2Q A;  2XCG A;  3P93 A;  1RYI A;  1P48 A;  3JVA A;  2CUL A;  3T31 A;  2Z5Y A;  3VFC A;  1DTN A;  3S5S A;  1GPE A;  5EB5 A;  4A3R A;  2XFP A;  3DK8 A;  3N4F A;  3VRB A;  1W4X A;  4M6U A;  3V4B A;  1S2Q A;  2GEW A;  1TZZ A;  4H4T A;  2WDQ A;  4OPL A;  1Z6L A;  3DJG X;  3HRD C;  1GES A;  3ZLF A;  1P2E A;  1LJ1 A;  3DH9 A;  2GGI A;  5BVA A;  4H19 A;  4TM3 A;  2BRA A;  5BUL A;  2XVF A;  3TTE A;  1CC6 A;  2BC0 A;  4KT2 A;  3UKL A;  3V5F A;  1S2Y A;  3A7R A;  3AD7 B;  3FCP A;  2W55 A;  2PTX A;  2GB0 A;  2XVI A;  4B66 A;  2O56 A;  3VRD B;  2C66 A;  3NRN A;  2PTY A;  1KKO A;  3GO2 A;  2X8G A;  3GDP A;  4U2L A;  4GDP A;  4K2S A;  1ZP0 A;  3G5Q A;  2OPJ A;  4EWJ A;  1XS2 A;  2OQY A;  1KNR A;  4TVY A;  3RR1 A;  1XHC A;  5CKU A;  2WP9 A;  2XVJ A;  4UDQ A;  1JU2 A;  3H8A A;  1FOH A;  3UXL A;  4OPC A;  3H70 A;  2R46 A;  4OPU A;  2J3N A;  1MUC A;  4K1W A;  2AL2 A;  2QA1 A;  3K1G A;  1H84 A;  2TPR A;  3ETR B;  2XLS A;  1H86 A;  4HA6 A;  3QSE A;  1SJD A;  1PBC A;  2B7S A;  3GMC A;  2GV8 A;  3VR8 A;  3KUM A;  1MO9 A;  3T2Z A;  3HPF A;  2YR6 A;  2JB3 A;  4OPT A;  2CFY A;  1UKV G;  2VVL A;  4EQS A;  3NVW B;  2BS2 A;  4IVO B;  3ALM A;  3GWF A;  2QJJ A;  4USR A;  2ACZ A;  2GH5 A;  4II2 A;  1H83 A;  1LTX R;  1X31 B;  4ZN0 A;  2H89 A;  4YSY A;  4PAA A;  2BXS A;  3RIT A;  5C3J A;  4H1Z A;  4H2R A;  3A7U A; 
#chains in the Genus database with same CATH homology
 1P2H A;  1PXC A;  4H4Q A;  2Q7V A;  3RED A;  1OJC A;  2YQU A;  1GSN A;  4BUR A;  2XFN A;  1PXA A;  1K0I A;  3ABV A;  1FEB A;  1IUT A;  3D9X A;  2BC1 A;  1KSU A;  2R45 A;  1CL0 A;  3QSS A;  2YLZ A;  4GF7 A;  2XDO A;  4ZCD A;  3CPJ G;  1YQ4 A;  3GRT A;  4A6N B;  1ZMC A;  3SY4 A;  3UCL A;  1ONF A;  2WHD A;  4I58 A;  4J36 A;  3CNJ A;  4NTC A;  4A65 A;  5BUK A;  2GR2 A;  2VQB A;  4DGK A;  2OAL A;  2GR1 A;  4GAV A;  4U8L A;  2XFU A;  3IF9 A;  2BYB A;  2W0H A;  1VG9 A;  1NHR A;  3FG2 P;  3DME A;  3EAO A;  1BKW A;  2C72 A;  2TMD A;  2WU2 A;  1RP0 A;  4IA6 A;  4M52 A;  1JRX A;  3L8K A;  2EQ8 A;  3AE4 A;  1NEK A;  2JB2 A;  2BK3 A;  3NHO X;  4EM3 A;  2GQW A;  2YG7 A;  4NZH A;  3SGL A;  4ICY A;  3Q6J A;  5JCL A;  1PJ6 A;  5J7X A;  4DSG A;  2ZZ0 A;  3NLC A;  4Z2U A;  4H4Z A;  3L5O A;  2B9Y A;  2C75 A;  3SM8 A;  5KMP A;  2ARD A;  5HY5 A;  1Y56 A;  1GAL A;  1TDK A;  3BHK A;  4EIQ A;  1GTH A;  1VQW A;  5KVI A;  1DJQ A;  4UDP A;  2XYO A;  3SZW A;  2YWL A;  5C2T A;  2YR5 A;  3NK0 X;  1BGJ A;  4XWZ A;  2BCP A;  5HHF A;  4B64 A;  3URH A;  2PYX A;  2YG5 A;  4N9X A;  1OJA A;  4EMW A;  1PBB A;  1REO A;  2RGO A;  3BHF A;  3K30 A;  1BWC A;  2B9W A;  3NTD A;  4Y4N A;  3GMB A;  4GDE A;  1SEZ A;  3GYX A;  3IHM A;  3QFA A;  4H2N A;  3BNU A;  1GT8 A;  1PS9 A;  3T2K A;  2YLS A;  1HYU A;  1E39 A;  2B7R A;  3CNT A;  4B65 A;  4AOX A;  2OLN A;  4Z26 A;  3UTE A;  3I3L A;  3CPI G;  2IVE A;  3NYC A;  4Z44 A;  4Y4L A;  2YR4 A;  3SYI A;  3UTF A;  3FIM B;  4CRT A;  2FJE A;  4KPR A;  1O5W A;  3COX A;  4Z25 A;  2CDU A;  4AT0 A;  3AE7 A;  3T2Y A;  3EF6 A;  1NHP A;  3SX6 A;  3AEE A;  1VRQ B;  5JCN A;  3V76 A;  1DOD A;  3UOY A;  1FEC A;  4GAP A;  3I6D A;  3CGD A;  1B5Q A;  3FPZ A;  3PVC A;  4OPI A;  2YG4 A;  2B9X A;  3II4 A;  3SZ0 A;  4BK1 A;  4ZCC A;  1DJN A;  1DOE A;  2WES A;  3NYE A;  4REK A;  2RAB A;  1KN0 A;  2V3A A;  2WDR A;  3AEF A;  3NK1 X;  4II3 A;  4J2W A;  4Z2T A;  3HYW A;  2Q6U A;  5U25 A;  3JSK A;  3B6D A;  4Z24 A;  4LII A;  2GR3 A;  1DNC A;  5ER0 A;  2GAH B;  1K0J A;  3AYL A;  3M12 A;  2EQ7 A;  3KLJ A;  3RP6 A;  2YG3 A;  3LAD A;  3V3O A;  3E1T A;  4K5S A;  2X99 A;  2GVC A;  2VVL G;  3AD9 B;  3G5S A;  3IHG A;  5U63 A;  2JB1 A;  3KPK A;  4OPG A;  1GRA A;  3UP5 A;  4BK2 A;  1ZOY A;  3NGC X;  3ICR A;  1GRE A;  2V3B A;  1E1L A;  2QA2 A;  3DGZ A;  3P4P A;  3NNE A;  5EB4 A;  1F8S A;  2UZZ A;  2RGJ A;  4C77 A;  4YKF A;  3ITJ A;  2WP5 A;  1B4V A;  2C73 A;  1LPF A;  2ZBW A;  3V3N A;  2NPX A;  4J56 A;  2VRM A;  4D03 A;  2OA1 A;  1CF3 A;  3SQP A;  4K7Z A;  2VRL A;  3CIR A;  5KMR A;  1L9C A;  2YLW A;  3ALL A;  2BA9 A;  3G5R A;  2A89 A;  4K22 A;  4CCR A;  4K5R A;  1V59 A;  4E0V A;  4U8P A;  3AE9 A;  4LU6 A;  5DBJ A;  1FEA A;  3LJP A;  1IUW A;  3L1R A;  3P4R A;  2WDV A;  3GWD A;  2XVH A;  2WOI A;  1H81 A;  5KMQ A;  4BJZ A;  1DXL A;  3SZC A;  3T14 A;  1H82 A;  4AP1 A;  4UP3 A;  4YXD A;  4U2T A;  1S3B A;  3CMM A;  3NIX A;  1GRG A;  2R0G A;  3NK2 X;  3OC4 A;  1L9D A;  3D1C A;  5IPY A;  5FS8 A;  2HQM A;  4YTP A;  3NN6 X;  3AE1 A;  3ALJ A;  3PO7 A;  2JAE A;  2X50 A;  4NEV A;  4O5U A;  2GQF A;  1RSG A;  3GDN A;  4YTM A;  4H50 A;  3B3R A;  1GXF A;  1S7M A;  2GRT A;  4TLZ A;  1GND A;  3NYF A;  2E5V A;  4JN9 A;  3RNM A;  2R4E A;  1EL9 A;  5FMH A;  4Z43 A;  1BF3 A;  5KOX A;  1H7X A;  1K4Q A;  2VOU A;  2BS3 A;  3GRS A;  2V61 A;  3HZL A;  1FL2 A;  4U8M A;  2C64 A;  5KOW A;  5M0Z A;  2EQ9 A;  1PDH A;  4IVM B;  1GOS A;  3KKJ A;  3ATR A;  1OJD A;  1K0L A;  4CBQ A;  4JQ9 A;  3QSM A;  1EL8 A;  1YQZ A;  4A99 A;  4JY3 A;  1TDO A;  3AYJ A;  3UKH A;  1LQT A;  1ELI A;  2WPC A;  3CTY A;  1TDN A;  4BV6 A;  2QAE A;  4NEW A;  2YM2 A;  4CNK A;  1CHU A;  1PBE A;  2XFO A;  3C4N A;  1EL7 A;  3P4Q A;  4H4V A;  2DKI A;  3UP4 A;  3S61 A;  3SZF A;  4MJW A;  4EQR A;  2X8C A;  1N1P A;  2C70 A;  4GCM A;  3C4A A;  1COY A;  1N4W A;  2C76 A;  1NEN A;  1VG0 A;  3KVE A;  1GET A;  4IV9 A;  1JNZ A;  3GYI A;  4TM1 A;  3RHA A;  2ZZC A;  1KFY A;  2C65 A;  4CNJ A;  4JDR A;  3AYI A;  4TLX A;  1GER A;  1BZL A;  3UOV A;  1M6I A;  4H4U A;  1N4U A;  2OLO A;  4NTE A;  3VQR A;  5KWF A;  3ADA B;  1JEH A;  3P1W A;  2C3D A;  4NNJ A;  2F5Z A;  4B67 A;  1GRB A;  2A8X A;  4FDC B;  4UDR A;  3NG7 X;  3NT6 A;  4H4R A;  3AE8 A;  5EBK A;  1ZMD A;  1IUV A;  4U2S A;  4J57 A;  3CN8 A;  4CY8 A;  4X9N A;  5HXI A;  1LVL A;  4P9S A;  1IJH A;  4I59 A;  5J60 A;  2X3N A;  2E1M A;  5GRT A;  2BK5 A;  3UOX A;  3M13 A;  1NAA A;  2RGH A;  2IID A;  4DNA A;  3CNS A;  3H8I A;  2EQ6 A;  5FS6 A;  3AEC A;  5M10 A;  2C67 A;  4X4J A;  2GAG B;  2XLU A;  2A87 A;  2WU5 A;  3AEB A;  1CJ3 A;  2VQ7 A;  4G74 A;  2QCU A;  4NTD A;  5FS9 A;  2JK6 A;  4DSH A;  2PHH A;  1PXB A;  2XVE A;  4IA5 A;  3UKK A;  1TYT A;  1PHH A;  5JCM A;  4ADW A;  3CGE A;  1DOC A;  1E7P A;  1L9E A;  4FX9 A;  3CND A;  3LZX A;  3NN0 X;  3AE6 A;  1GRH A;  2AAQ A;  1JOA A;  4OCG A;  4XWR A;  4D04 A;  4GUV A;  3AE5 A;  1D4C A;  2AR8 A;  1Y0P A;  2FJD A;  1L0V A;  3K7M X;  1JNR A;  4K8D A;  3S5W A;  2WS3 A;  4A6N A;  1ZKQ A;  4RG3 A;  1ZY8 A;  3CGC A;  3DK9 A;  5KRQ A;  3KPF A;  2R0C A;  3FBS A;  2ZZB A;  4YWO A;  3KA7 A;  1ZDL A;  4TM0 A;  3SFD A;  1KSS A;  2WP6 A;  1VDC A;  3ZDN A;  1GV4 A;  3GYJ A;  1OJ9 A;  1B37 A;  4JNA A;  5KXJ A;  4G73 A;  3AB1 A;  3AD8 B;  3LB8 A;  2Y6Q A;  3HYV A;  4A7A A;  4J31 A;  4H4W A;  1F8R A;  1H6V A;  1TDF A;  1LQU A;  2YLR A;  3ATQ A;  1XPQ A;  1DOB A;  3F8P A;  4G6G A;  4KX6 A;  4APN A;  4CCQ A;  1IUS A;  1Y56 B;  4U8N A;  4HB9 A;  3VR9 A;  3ICS A;  1ZK7 A;  3H8L A;  4YSX A;  1F3P A;  1YY5 A;  1LV0 A;  3H4K A;  3PS9 A;  4ECH A;  2DKH A;  4A5L A;  2BXR A;  3PG6 A;  3D8X A;  4PAB A;  2C4C A;  2AQJ A;  3ISH A;  1S3E A;  2YVG A;  2WEU A;  1PJ5 A;  4EQX A;  4BJY A;  2C3C A;  5JCK A;  5EOW A;  2APG A;  1F8W A;  4J34 A;  4NWZ A;  3DA1 A;  2YVJ A;  4YKG A;  4B68 A;  1BGN A;  1QO8 A;  1FCD A;  2FBW A;  1ZOV A;  3F8R A;  3RP8 A;  3DK4 A;  2BRY A;  1QLB A;  3AEG A;  4B1B A;  2BK4 A;  5CQF A;  3UKQ A;  3T0K A;  4H2Q A;  2XCG A;  4JNQ A;  2YLT A;  2FJA A;  4EMI A;  2GMH A;  1Q1R A;  1RYI A;  3QFB A;  3EPT A;  5L46 A;  3ICT A;  2WBA A;  2JKC A;  2CUL A;  3T31 A;  3CGB A;  2Z5Y A;  4EQW A;  2GR0 A;  5JCI A;  1E1N A;  3ZYX A;  1Q1W A;  1KDG A;  1GPE A;  2OAM A;  3BI5 A;  1PJ7 A;  1TDE A;  5EB5 A;  2XFP A;  3DK8 A;  5FS7 A;  2IVD A;  1EBD A;  3OZ2 A;  4J33 A;  3VRB A;  1W4X A;  3WE0 A;  4H7U A;  1NPX A;  2X8H A;  5KNL A;  4GR1 A;  2BCG G;  1D4D A;  2YG6 A;  1S2Q A;  2Z5X A;  2GEW A;  3QJ4 A;  4YTN A;  4H4T A;  4A9W A;  4EMJ A;  1JRZ A;  2WDQ A;  4OPL A;  1NDA A;  1Z6L A;  1D5T A;  2V6O A;  3DJG X;  4XXG A;  3LZW A;  1GES A;  3F8D A;  4U8J A;  1GEU A;  2WOW A;  5TR3 A;  3UKF A;  1P2E A;  2GMJ A;  3NTA A;  1LJ1 A;  3DH9 A;  5BVA A;  4B63 A;  4X9M A;  4TM3 A;  4WX1 A;  3VRA A;  5IQ1 A;  2BRA A;  5BUL A;  2XVF A;  2WET A;  2WOV A;  1F6M A;  2Y6R A;  1CC6 A;  3AWI A;  2BC0 A;  1N4V A;  4C3X A;  3UKL A;  3P4S A;  1CBO A;  4LA1 A;  1MXT A;  4AT2 A;  1YQ3 A;  1PBF A;  3R9U A;  1ZX9 A;  1E1K A;  1S2Y A;  3AEA A;  3P9U A;  4CY6 A;  4EIP A;  2XLT A;  3K7Q X;  2NVK X;  3AD7 B;  3DJD A;  5KMS A;  1NHQ A;  3O0H A;  4H4S A;  2R0P A;  2YM1 A;  3AE2 A;  2GB0 A;  2XVI A;  4B66 A;  2Q0K A;  3QVP A;  3VRD B;  3BI4 A;  2C66 A;  5HYM A;  3NRN A;  4C3Y A;  4USQ A;  4H4P A;  2GF3 A;  2YLX A;  2O9Z A;  3KU9 A;  2V5Z A;  1NG3 A;  2X8G A;  4GRT A;  5IQ4 A;  2WQY A;  3GDP A;  4U2L A;  4GDP A;  1ZP0 A;  2H88 A;  3G5Q A;  2XLR A;  2V60 A;  3K7T A;  2BAC A;  1KNR A;  3CNP A;  1O95 A;  1XHC A;  2WPE A;  3GD3 A;  5CKU A;  1CJ4 A;  1XDI A;  2WP9 A;  4C74 A;  5LV9 A;  1GTE A;  1IUX A;  4WCT A;  2YAU A;  2XVJ A;  3NKS A;  4UDQ A;  1JU2 A;  4YSH A;  1FOH A;  2B76 A;  1CC4 A;  1TRB A;  4OPC A;  1EL5 A;  3UTG A;  1PBD A;  4JY2 A;  2R46 A;  4YT0 A;  1JRY A;  4Z2R A;  3IC9 A;  2VZ2 A;  5JRB A;  4OPU A;  3FMW A;  1H7W A;  2J3N A;  3GSI A;  4H4X A;  3UOZ A;  1IUU A;  1H2I A;  3SXI A;  3UKA A;  4AOS A;  2QA1 A;  3IWA A;  3DGH A;  1H84 A;  5GSN A;  2TPR A;  2XLS A;  2Q0L A;  1NHS A;  1H86 A;  4HA6 A;  4U8O A;  1O94 A;  2FJB A;  3QSE A;  1E6E A;  1PBC A;  4G9K A;  4AP3 A;  4B69 A;  1OJT A;  2B7S A;  3GMC A;  4G6H A;  4OVI A;  1KNP A;  3UKP A;  4BK3 A;  1MOK A;  2GV8 A;  3VR8 A;  2VVM A;  4Y4M A;  1M64 A;  3QVR A;  4YSZ A;  1MO9 A;  1NG4 A;  1CJ2 A;  3BI2 A;  2YR6 A;  3T2Z A;  1QJD A;  2JB3 A;  3T37 A;  1XAN A;  1D7L A;  4U8K A;  4H2P A;  1YKJ A;  3Q9T A;  4OPT A;  2BS4 A;  3CPH G;  2CFY A;  1UKV G;  4EM4 A;  4U8I A;  3SFE A;  1E1M A;  3BNM A;  2VVL A;  3C96 A;  5BRT A;  3KD9 A;  4TM4 A;  2CVJ A;  3LOV A;  1GRF A;  3LXD A;  2JBV A;  4EQS A;  4FK1 A;  2BS2 A;  3UTH A;  1AOG A;  1D4E A;  2XFQ A;  1TYP A;  1PN0 A;  4IVO B;  3DJE A;  3NH3 X;  3ALM A;  3AED A;  4A79 A;  3HYX A;  4OPD A;  1KF6 A;  3GWF A;  2XLP A;  3DJJ A;  4RSL A;  2YVF A;  1GRT A;  3AXB A;  3M0O A;  2C7G A;  4USR A;  4C5O A;  2ACZ A;  2GH5 A;  4H4Y A;  4K2X A;  3GD4 A;  4RG4 A;  2WPF A;  5U1O A;  5KVH A;  4II2 A;  1H83 A;  1LTX R;  1X31 B;  4ZN0 A;  2H89 A;  4FK1 C;  2BAB A;  1D7Y A;  2E4G A;  4YSY A;  1CC2 A;  3EAN A;  3RP7 A;  1CJC A;  4H2R A;  4O5Q A;  2I0Z A;  4PAA A;  2BXS A;  2R4J A;  1B8S A;  3AE3 A;  5C3J A;  2R9Z A;  1Q9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...