2PP0A

Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
395
structure length
395
Chain Sequence
SANSDAVTYAKAANTRTAAETGDRIEWVKLSLAFLPLATPVSDAKVLTGRQKPLTEVAIIIAEIRSRDGFEGVGFSYSKRAGGQGIYAHAKEIADNLLGEDPNDIDKIYTKLLWAGASVGRSGMAVQAISPIDIALWDMKAKRAGLPLAKLLGAHRDSVQCYNTSGGFLHTPLDQVLKNVVISRENGIGGIKLKVGQPNCAEDIRRLTAVREALGDEFPLMVDANQQWDRETAIRMGRKMEQFNLIWIEEPLDAYDIEGHAQLAAALDTPIATGEMLTSFREHEQLILGNASDFVQPDAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVHLHLSAAYPLEPWLEHFEWLNPLFNEQLELRDGRMWISDRHGLGFTLSEQARRWTQLTCEFGKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords L-talarate/Galactarate Dehydratase
publication title Evolution of enzymatic activities in the enolase superfamily: L-talarate/galactarate dehydratase from Salmonella typhimurium LT2.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 137
structure length 395
sequence length 395
chains with identical sequence B, C
ec nomenclature ec 4.2.1.156: L-talarate dehydratase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2pp0A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2pp0A01
4Z1YA 2XGZA 5FJOA 3TJ4A 3UJRA 3DG7A 4IL2A 2QJMA 4EWJA 4HYRA 3T4WA 2DW7A 2PTYA 4A35A 4G8TA 2AKZA 4KT2A 4GGHA 3DG3A 2XH2A 2PSNA 3OZYA 3CK5A 3ZLHA 3SBFA 3SN1A 3TCSA 4GFIA 2AL2A 2P3ZA 5J04A 3B97A 1EBGA 5BOEA 3N4EA 5FJRA 3TQPA 2HZGA 3OZMA 4IT1A 2GGJA 3DESA 3IK4A 3QLDA 4GMEA 3R1ZA 3QPEA 3QKEA 4FI4A 3FVDA 4HNLA 3DDMA 3NFUA 1JPMA 3ES7A 4HCHA 4K8GA 3BJSA 2FKPA 3P0WA 1RVKA 1F9CA 2OPJA 2PS2A 2XSXA 4K1WA 3ZVHB 2PCEA 3UXKA 2AL2B 3R0KA 2OVLA 4GIRA 3D46A 4GISA 4E5TA 3UCCA 2O56A 3HPFA 1EC9A 4JN8A 3CT2A 1TKKA 1XPYA 5BOFA 3DIPA 1MRAA 2PGEA 3TOYA 3U9IA 1BKHA 2OZ3A 3ES8A 2P88A 4DWDA 1SJBA 2PU0A 3VC5A 2OFJA 1JDFA 3UXLA 2QQ6A 4A6GA 3Q45A 3GD6A 2QVHA 4E6MA 2QJJA 2XH0A 3V5CA 3DEQA 2MUCA 1WUEA 3T9PA 2ZC8A 3PWGA 3IJLA 1NU5A 4HNCA 4G7FA 5FJPA 2GSHA 5EU9A 3UJFA 1SJAA 4MKSA 2PP1A 2OKTA 4JHMA 1P43A 4E4FA 3CB3A 3DGBA 3FXGA 3V4BA 4ROPA 3UJEA 5IDZA 4HCDA 5ENLA 3SN0A 4IP4A 3FV9A 1KCZA 1ELSA 3MKCA 1FHUA 2OZTA 4MMWA 4KPLA 1P48A 2QGYA 2PTWA 4KWSA 3ZVHA 1JCTA 3EEZA 3P3BA 4JN7A 3THUA 4M6UA 1E9IA 3H7VA 3MSYA 4HCLA 2OQYA 1R6WA 1EBHA 3D47A 3ZVIA 3FJ4A 3N4FA 4HN8A 2AL1A 2PTZA 3NXLA 3R11A 3DFYA 4ENLA 1MNSA 2PODA 3CAWA 2GGEA 3R25A 3TTEA 2PTXA 2OO6A 4DYEA 3V3WA 2MNRA 2OZ8A 3MQTA 1EC7A 2NQLA 1XS2A 3STPA 3TW9A 2PMQA 3PWIA 3JW7A 2GGGA 4MGGA 3PFRA 3SSZA 2P8BA 3RO6A 2QDEA 3SQSA 4GYPA 3ENLA 3SJNA 4GYPC 3ZLFA 4DXKA 1R0MA 1MDLA 3H12A 1ONEA 3RR1A 3UGVA 3RRAA 3P93A 4IL0A 1MUCA 1MDRA 3BOXA 3MUCA 3UCDA 4K2SA 3VCNA 2GGIA 4A3RA 2QDDA 3FCPA 1L8PA 4FP1A 7ENLA 2DW6A 4H19A 2OQHA 3FYYA 3VCCA 1FHVA 1OEPA 2PP3A 3OP2A 3QTPA 3OTRA 3JVAA 2XH4A 2PPGA 3NZGA 3TJIA 4F4RA 1WUFA 3I6EA 1TZZA 2OG9A 1W6TA 2OLAA 4DHGA 2FYMA 4IZGA 3I6TA 3DFHA 3MY9A 3QN3A 3DERA 4J1OA 3S5SA 1IYXA 3CYJA 3T8QA 4YWSA 2HXUA 3VDGA 4J3ZA 2PP0A 3N6JA 4E8GA 3Q4DA 2RDXA 1PDZA 3JZUA 3PK7A 4H2HA 4HPNA 3OPSA 2POZA 4M0XA 3IJIA 3OW1A 3S47A 2AKMA 3TWBA 2CHRA 2HNEA 4DN1A 2I5QA 3VC6A 4X2PA 2PU1A 3KUMA 2ZADA 2P0IA 4ZCWA 3IJQA 5FJTA 3R0UA 1EC8A 3VFCA 2P8CA 2OX4A 4KEMA 3U4FA 3H70A 3H8AA 3R10A 3N6HA 2XH7A 1KKOA 4GGBA 2PGWA 4Z17A 3RITA 4DX3A 3ZLGA 3VA8A 1TE6A 1SJDA 1BQGA 2GDQA 2HXTA 3MZNA 4H83A 3NO1A 1DTNA 3I4KA 1KKRA 2PA6A 3TWAA 5FJUA 3EKGA 3V5FA 3K1GA 1KD0A 1PDYA 3CXOA 3GO2A 3SN4A 3T6CA 3GY1A 2GL5A 2QJNA 3DG6A 3RGTA 4E4UA 3MWCA 4IP5A 3UJSA 2GGHA 1JPDX 1SJCA 3GC2A 1YEYA 3UJ2A 1NELA 6ENLA 3RCYA 2ONEA 4ZA0A 4IHCA 1ECQA 3BSMA 4H1ZA
chains in the Genus database with same CATH superfamily
3LSBA 5CC6A 3EMZA 2V81A 4S3AA 3CEPA 1O1ZA 4PE8A 3PAJA 1N8IA 4GG9A 1W17A 2CCRA 2ATSA 1BGGA 1M9HA 4LF2A 3EWBX 1LBMA 3OGVA 1SU5A 2CBVA 4E2DA 1H09A 1MMFA 1OD0A 3MSDA 3FA4A 2Z00A 1XLEA 2VWTA 3TH6A 2E6YA 4M8UA 5D2VA 4Y7EA 5FJRA 1ZY9A 2F6UA 4HT3A 1PVNA 1K3UA 2FZ9A 5EYWA 1F3EA 2Y62A 3BLKA 4B5UA 4AZGA 3BOLA 1J6OA 4OU1A 3OJGA 3TSBA 3ARVA 4DWSD 1MEWA 2PDNA 4EXQA 4YVXA 1GJWA 2AAMA 2W3ZA 1OFQA 3WNLA 4IQEA 2PDPA 1F3PA 1RVKA 1F9CA 4MG4A 4KFNA 3WQVA 1ZNNA 1QFEA 1PTDA 3AWOA 5E9AA 3G1DA 3TFCA 1R38A 3Q94A 2Z1SA 3DBNA 2WQPA 2GWNA 2D0GA 2E5AA 4O1BA 3ABZA 5D2YA 4M80A 1XKYA 4S3GA 4AIEA 1RUSA 3B9NA 1OYBA 1QK2A 5D30A 3SR7A 5T91A 1SUXA 3UNDA 1TUXA 3W73A 3CGDA 4AUBA 4FIRA 1KC7A 3IJ8A 5E0CA 5FIPA 5I6SA 3HFYA 1S5VA 1P0NA 5DMMA 2VP8A 3G1SA 2QJJA 4GY7A 3W82A 2EG6A 3TN4A 1W1YA 4J3XA 2A85A 3S8HA 4DNMA 5EU9A 3VKCA 3UJFA 3WD1A 1FWSA 1EJSC 3GSMA 3KFTA 1CGWA 3FXGA 4ZQOA 5C2XA 3W1RA 5AVHA 3PN8A 2V5LA 2VVSA 5A8PA 4MIMA 2XWEA 4FDCB 1FVPA 5D2TA 3PNUA 4LVBA 4CNPA 4DZ5A 2A7NA 3K5XA 3CLWA 3OB8A 2X1UA 1DXFA 2CZ5A 2GRTA 5DY2A 1TJRA 3BDKA 3UG5A 3EEZA 2JEPA 4M6VA 5I24A 3MKVA 4AVFA 1QU4A 3EPNA 3GG8A 4DO4A 2X41A 5FOOA 3SADA 1PZ2A 5AHFA 2CZVA 1TIMA 2VR2A 4OIFA 2B7OA 2A4AA 3HW2A 2VDGA 5M17A 4A2SA 1EBDA 1GEUA 3VDAA 4H3DA 2G97A 9CGTA 4KH2A 1ISWA 2VTFA 1Q6FA 1CXHA 2DORA 2NUYA 2OMAA 1E5NA 4PMRA 3SIMA 3TP4A 3W7HA 1UWRA 3WF4A 4NJIA 2ZTKA 1YDVA 5I02A 3AHYA 4MYXA 3M41A 3W7DA 1UPMB 2DP3A 4LWWA 3W7QA 1UWQA 1UP3A 3QY7A 1W1TA 2JKPA 3WDJA 2QDEA 4GYPC 2C6QA 3RX2A 5IFPA 3GS6A 4OFCA 1KRAC 3SCPA 4LCQA 2FFIA 3EWYA 3PZUA 2Y88A 1AODA 3A5VA 3E3HA 3N29A 1J8VA 3PSWA 4OBSA 4QG9A 1O5KA 3GLCA 1ESWA 3PC0A 1CEOA 4GIAA 1R2RA 2PWVA 2Z1KA 2IPGA 1FWHC 2INFA 4K68A 3BJTA 4D6HA 3OIHA 1Q1WA 4NYYA 3QHNA 1AZ2A 3TSMA 2PP3A 4RDWA 2AMXA 4KWOA 2WMKA 4EACA 1F61A 3CWNA 4IJBA 4S3DA 4HQVA 1KM6A 2GVGA 1JPHA 3T2QA 1YDNA 1ODZA 4L1XA 2XU2A 4JQ4A 5HMEA 4O0KA 3NSNA 1XLAA 3IC9A 3E0FA 3T42A 2X8GA 1UKQA 1K7EA 3SUVA 4LUJA 3WMBA 5FS6A 3LHYA 4MWAD 1VYPX 2DV0A 3RNDA 4E8GA 3MYOA 3OLEA 2Y5EA 2ZUVA 4GUIA 4JNYA 1FFQA 3UT0A 3ARSA 3OW1A 4ZGYA 1TZ7A 1I8JA 2WSPA 4TV5A 2ANUA 3IVSA 4N2YA 3VD3A 4NAEA 3A23A 1CX9A 4LAMA 1YXDA 5A6AA 2V30A 3WQCA 2J13A 3VAVA 1V08A 3DAQA 5TBOA 4JL1A 2QCEA 1L6WA 2H8ZA 4B5VA 3M0XA 3UEQA 1CTNA 4GJIA 2FB3A 4LB4A 1TPVA 1X38A 3E49A 1CXKA 2D0FA 3H8AA 4H9ZA 1R9XA 1K7FA 1D3CA 2XH7A 2V9DA 5IFTA 1XGEA 3F4CA 4IPPA 1FCVA 4FB7A 4FNQA 2ODOA 1I6NA 4RZ6A 2OWCA 1UH4A 1UR9A 4S39A 3RPTA 5GNYA 5FESA 1QTWA 3HURA 2QAEA 3EX4A 1ZAIA 2DSVA 4S2BA 1GVQA 1OADA 1AQFA 2WK2A 3K1GA 2R8WA 3BJFA 4REQB 3WBEA 4AXNA 3PWAA 2BTMA 3T05A 2XUCA 3OO2A 3MHGA 4Z2KA 1OIMA 4KMQA 1DVJA 1HGYA 3KAOA 4HBKA 3WEZA 1S39A 1Q8AA 1HNYA 2Z1XA 1VFOA 1QMLA 1MXDA 3ZIZA 1TV5A 3NXFA 3G22A 1I1WA 3WUEA 4BR1A 2NUXA 2X1RA 5HA7A 2OQLA 1VIZA 1JF6A 1T6MA 5FJOA 2H90A 3PUEA 4XUGA 2BY0A 2J9ZA 4DAIA 2NQJA 2V0TA 3P2VA 4O16A 4UFKA 3CUHA 3M0ZA 3KLJA 2WJZA 2VT0A 4F0KA 3C4UA 1R3TA 4JIQA 2VX6A 4NX0A 3I10A 2W54A 4PTDA 5HXMA 1PO9A 2V5CA 1GJUA 2ZYFA 1KQYA 2ESCA 3MI2A 1PKNA 3KZPA 3H53A 4G6CA 2O4QA 3PULA 2J9YA 4UTWA 4AX7A 2XFYA 3RM8A 3B06A 4DNAA 1RH9A 3DCPA 5DN1A 4UMBA 4XBKA 3CJPA 4K1WA 1GQNA 1QO5A 2DT1A 2D1ZA 3CXBA 3W23A 3CL7A 4C6LA 3R0KA 2WOVA 3WH5A 3NVTA 4B5WA 3TW7A 1OVDA 5F4WA 4JTRA 2FHFA 3VUSA 5TD4A 1BFNA 4JN8A 1HL2A 4H9MA 3B9EA 1ZJHA 1JI2A 1KFJA 4UUIA 2CLKA 4KERA 1GG1A 1FDJA 2KX9A 2R24A 4H50A 2OZ3A 4HP5A 4FO4A 2NW0A 2V67A 1NHPA 4H4RA 3A24A 2E8ZA 4D6JA 4KWWA 4M56A 2FQIA 3AXIA 2CKRA 2BY3A 4K8HA 5JIWA 1RP9A 2R1PA 1KN0A 2J8TA 1EGZA 3KBVA 1XLIA 2XSBA 2FIQA 3NPVA 3O15A 3NZQA 2QNEA 1UWIA 3T9PA 4H6QA 1EGMA 4HNCA 2GYIA 2J7CA 4PSPA 2OTDA 1MFUA 1J79A 3NG3A 1RCOB 2C1GA 1ZGDA 4O4WA 4QRNA 1PS9A 4X22A 1DWGM 3LXDA 3UPMA 1SO6A 3LBOA 3UJEA 4JNMA 1UYQA 4LC6A 1QNOA 3QZEA 5ENLA 5U25A 5RUBA 1KR0A 2VEIA 3S2NA 3AIVA 4CD8A 1LM1A 7ODCA 4URIA 3ZVHA 4O53A 5FCZA 1JCTA 3W1PA 2ZA3A 3O6AA 3OIXA 1L6SA 1YRRA 3M5YA 4IIBA 1YNYA 2CBJA 4D6FA 4XD5A 1CPUA 1C9WA 1F2JA 1XBZA 3BLPX 1UP2A 1EZ2A 1NF7A 1RY8A 1LRNA 1ITXA 1I2NA 5K4ZA 5D8ZA 3LCGA 2ZZ2A 4MTVA 3W02A 3V3WA 4BS0A 1QHZA 1OHLA 3VGDA 3G2GA 1JD7A 4LANA 3FG2P 1U33A 2VZVA 3VTRA 2X2GA 3CH0A 2KZHA 4CD5A 2WKLA 3L7RA 1PTGA 1VJIA 2GGGA 3ALGA 1QPOA 2Y7DA 5ABEA 2GFTA 3OG2A 4PZVA 3QTGA 3PBGA 1K03A 1SW0A 3FYOA 2W9MA 3ZLFA 4DXKA 3A4WA 2XZ9A 2B7NA 6PTDA 1W3KA 3UFYA 1NWSA 3GW3A 4GR1A 1ZK7A 2XJ7A 3LUTA 3P93A 3EDEA 5E70A 4Q4SA 2PE4A 5E93A 1QI0A 3V5OA 1JZ2A 3O0KA 3PSVA 2ZOXA 6ALDA 2VD9A 1EP1A 1J9YA 4WDUA 3B0YA 1V3HA 1OYCA 3UWUA 1T0OA 4K8DA 4Q8TA 3GUWA 1KM2A 1KBIA 2CLIA 4QNWA 3T1GA 3S2CA 1E1EA 2W92A 5K9CA 4US5D 5TNVA 5G2IA 3JVAA 2YLLA 4GJ1A 3NQMA 5FF2A 1G0CA 3D0CA 3H2NA 3QM3A 1A5UA 4AF0A 1WUFA 4J7RA 1M41A 4V1YA 4NX5A 2D2OA 3UWZA 3WK2A 4GWEA 4J1OA 3DGZA 3W81A 2IXUA 4GO9A 5MF5A 2KAUC 4LQ1A 3GVQA 4P8WA 2FTPA 5I3KA 2YW3A 5A3HA 3V35A 1RALA 1EF3A 4JDYA 3Q4DA 3LCXA 3T0DA 1H1YA 3KBJA 4OUIA 1PHQA 4MLJA 2IUZA 2W6RA 4BV6A 1HO4A 4AF0B 2OLHA 1GHRA 3LNMA 3EX6A 2AKMA 2PCQA 3P7YA 4IPLA 4H00A 4DO5A 3DHPA 3M46A 5FEPA 1Q4WA 3LD5A 4GI4A 1E6QM 2JK2A 4QP0A 3R8GA 5LNVA 1GZJA 4MLRA 3ZS4A 3T40A 4HNOA 3TYDA 1R87A 1ZSXA 4V33A 1Q63A 3N18A 5J5DA 1TYGA 3S1WA 3IJ6A 4RZ5A 5CPTA 2AGTA 3HPZA 1TR9A 2NXIA 1JCLA 4KBXA 1SW3A 5CGMA 1UQZA 5FF7A 4D8ZA 5G5GB 8RUCA 3GR4A 1KKRA 4M52A 3CQHA 5MKGA 3RF9A 3B8DA 4C6IA 2DZXA 1E1FA 2NVAA 1XHCA 3W83A 3BG3A 3W0KA 5A95A 1DWIM 4WK9A 1KD0A 5AHLA 3KHJA 4NASA 3G1HA 3U2EA 3GO2A 4MOZA 2ZE0A 1OFBA 5AOUA 4PB5A 3O16A 3LI0A 4H04A 3CU2A 2R14A 4DQWA 2WJDA 1SO4A 5D32A 1CI1A 4P8UA 5C9WA 5T9CE 3GQYA 1H5YA 4PC8A 5PTDA 4AVOA 3W7OA 4C6BA 1MOKA 1R85A 3W37A 4V1XA 4AY1A 2VVNA 5HWJA 1OT1A 2HRWA 1T41A 3WDQA 2Q09A 1FQ0A 5FF0A 2JKAA 3A6OA 1GOIA 3LBCA 1LRQA 2W66A 4WOZA 2AKZA 4LW7A 3KRBA 4RX0A 3URHA 5A6BA 1AG1O 3OHMB 1TQXA 2VZOA 1Q13A 3CWOX 3DFSA 2HVOA 1B0IA 1K4GA 1I0DA 1HJQA 2QPXA 1V3IA 4EQWA 1GRHA 4IT1A 5FD0A 4NZ1A 3Q37A 4EX4A 2DSUA 3PJXA 4QDPA 4LC8A 2XVGA 1PXGA 4EQSA 4V27A 3FJLA 3LPGA 3BARA 3MUXA 2Z2BA 2XSXA 1BWCA 5CZJA 2FVLA 4F3HA 2XGBA 1C29A 1Q1RA 2WM1A 5LXEA 4JTEA 2ISVA 1B31A 1WDDA 2CPUA 3UCCA 4OVXA 3VNLA 2VCBA 1KBJA 1X1NA 2O9PA 5G5HB 1XCXA 5LSMA 4XKMA 2VDIA 3GNXA 3P67A 4GQRA 4JQ9A 3TOYA 3W25A 2W91A 3QJAA 2Y2WA 3NQAA 3P74A 1XIHA 5E0KA 1A4LA 2FGZA 4RJEA 3NURA 3PTQA 1P1MA 3CV6A 2VRKA 3OA3A 1FHLA 3CHEA 4AU0A 3LZ3A 4CQBA 3UZYA 3NSMA 3W28A 2JF6A 4KS0A 5F2LA 4E6MA 3V5CA 3USZA 1KCLA 1DE6A 3D5HA 4G7FA 1TREA 2BVTA 5CZ0A 1JPKA 1SJAA 4MADA 3H7UA 1JYNA 5HK4A 4FHAA 4DUVA 5LIWX 2CDUA 1NARA 3FX4A 3SRHA 4PMVA 4K7ZA 5FJIA 2W61A 5A8NA 2QHAA 4C90A 4PTMA 3EWUA 3N2BA 3APYA 4L6HA 4HHLA 1VBUA 5I79A 3AS3A 2I5IA 4C1NA 2YR1A 3AUJA 2A2IA 3LMZA 5EFFA 2CEQA 3E1F1 3LHVA 3T8LA 1BPLB 5GVJA 3GH7A 4CCDA 3M16A 1F07A 1RXOB 2WVSA 2V5JA 4UNLA 3MSYA 4DLMA 4KIEA 2DFAA 4CKQA 1CXIA 1YE4A 2YX0A 4C1NB 3BLIA 3H54A 1RBLA 1EO7A 4F9JA 1B57A 5FACA 3HMCA 4XAPA 1QCWA 4WEVX 4GZ7A 1YBQA 3TYZA 2OZ0A 4ZB5A 2J8FA 3EB3A 3IACA 2BP1A 3LCWA 2O4MA 3QMSA 4DLFA 5A8QA 3PWIA 3OG3A 4NJKA 2FZDA 3FA3A 1KLZA 1IHIA 4LBSA 3SQSA 3ATZA 1UPPA 2YBTA 7REQA 4H8VA 1MDLA 3AXKA 3VD4A 1CZ1A 1DV7A 2I16A 4AWEA 3RPMA 1AQHA 2PRLA 3FJNA 1VIWA 2O7QA 1YBQB 3WNKA 1GRTA 3B9AA 3STGA 2EJAA 2X8CA 3LNPA 1RVGA 2V2CA 4Y9AA 4TIMA 3IS4A 4FMVA 4U2YA 4L5ZA 3C3NA 2G0WA 1WYGA 9XIAA 3WSUA 5DEZA 1TUFA 3IGHX 5LNUA 2F9RA 2XG9A 1TWZA 1OF6A 2JKEA 5HNNA 2WVTA 1WA3A 7REQB 1ONFA 4K3ZA 3N9RA 3L21A 2J78A 4C6EA 3CAQA 5AFDA 3RXZA 1XX1A 1NTHA 1E4NA 2PPGA 4LVFA 4ADTA 2JF7A 1VBGA 5KITA 4GA8A 4MAVA 1WKEA 4I3GA 3W74A 1XF0A 2QUMA 1XCWA 4UFLA 3MHFA 3P62A 1C8XA 3BK0A 1JI1A 3N73A 4H7VA 1R2SA 2WO5A 2D2GA 3CGEA 1MWOA 4OUEA 2HXUA 3F5KA 4D6CA 1RP8A 1NDYA 4M6PA 1XH1A 4MUZA 1VLWA 3LRMA 3NCOA 4HNNA 4WDWA 4ZZ9A 1FWDC 1UIPA 4H6RA 1RQEA 3W07A 3RPDA 3BC9A 3A12A 1A5CA 4ZO6A 3G8RA 2Z0IA 4DRSA 3FW6A 1YMYA 4FF5A 4NHVA 4AD3A 2ZZBA 2WLZA 5F7UA 1EHAA 1H3GA 3R0UA 3KOFA 1TELA 1FFUC 1K9EA 4DPPA 1M01A 3PP7A 2OSXA 4WY0F 4A3QA 1W2VA 4KCWA 3U4FA 2EPMX 4UNIA 1K9DA 1HKVA 3HTWA 1JZ5A 3QY8A 1OYAA 1XLGA 5D9PA 1E15A 3SCRA 4JD4A 3WH7A 3VA8A 1TE6A 4DVOA 1VHCA 2GDQA 2HXTA 1UD8A 4GKLA 4EP8C 3OA5A 4Q8UA 1V6TA 4MZ1A 4R5EA 3EF6A 3L4WA 2DGAA 2O55A 4UTLA 4O1FA 1JZ7A 3IUHA 4WKAA 4M7TA 1AL7A 1F4HA 1G01A 4AZCA 3T0BA 3IIZA 3RGTA 3KWXA 5JCMA 5A2AA 2X40A 1HX0A 5I77A 1S5WA 5HNTA 3PBVA 3ZZ1A 3TUUA 4BI7A 4GNJA 4JDRA 3KOZA 1ISYA 4ADUA 1NPXA 1NDWA 2DZVA 2XDFA 1XRSA 1TPEA 2L5HA 2Y61A 3RCMA 4Z1YA 4ILSA 3A4AA 3WMLA 3BO9A 4AZCB 4PEEA 3UJRA 4QE5A 4Z42C 1G4TA 3WBWA 3SFWA 2J7EA 1CXFA 5BU9A 4CU6A 2WLYA 3SBFA 2P76A 4AZ7A 3BW4A 1Q5MA 4L80A 2HZGA 4GRTA 4EMIA 4IQDA 3HGSA 2GGJA 4JQAA 1VBHA 3CUJA 3W87A 3G1XA 4R53A 1JGMA 4RZ4A 5DY3A 1KGUA 1XSKA 3KOWA 2WSRA 4OE7A 1OT2A 3VKKA 3BLEA 5HR7A 2FKPA 2PS2A 2Q02A 3IIOA 4U4MA 3LDVA 2HBXA 3TVAA 1QUMA 2GOUA 1IIHA 3QLLA 3B40A 2W67A 4JIEA 3VOCA 5JH2A 3TXVA 2ZRUA 3G8EA 1FP9A 3ERPA 4XBSA 1NOUA 5D8WA 1JF5A 1W9PA 1RHCA 2ZX9A 2ZTJA 1V4YA 2DSWA 3LRLA 3EUB3 4DWDA 3F4NA 1P0KA 3R0DA 2OYMA 3BLOA 4DYKA 1KRBC 4UR8A 3W7PA 1U5JA 4M51A 3Q45A 2NT0A 3G24A 8XIMA 5I3HA 5DANA 5AKQA 2BOFX 1TCDA 4EQXA 3RM4A 4FOJA 3CYVA 5E5CA 2OYKA 1OQFA 3P61A 3DGHA 3COTA 3B4YA 1KFBA 3S46A 4JHMA 2G3NA 1A47A 1OINA 4OKDA 3O8AA 2J25A 3ZSSA 2JK6A 2RDTA 5GQBA 3MB9A 2BVYA 4H9VA 4J2PA 2DJLA 3KX6A 2X0HA 4CUCA 4HPHA 2DY3A 1SQ7A 3MCOA 4Z2HA 3URQA 2OZTA 4NZCA 4IICA 3C61A 4C6CA 4E38A 5DMNA 4LEFA 1U1HA 2C13A 4WR3A 1E72M 1XLCA 5JRBA 3R13A 3UWVA 5KSWA 1L6GA 1QWGA 3AMGA 3TV8A 1JXJA 4PB3A 1BVWA 3AZRA 2DVUA 3RX3A 3YPIA 1PZ1A 4C91A 4N6FA 4E3TA 4PUNA 2FGBA 1KBKA 4NZ4A 1PWMA 3TKFA 2WHJA 3TMQA 3NR0A 5HJLA 1EIXA 3KEHA 4GQ0A 2R82A 4DB7A 3EB4A 4J28A 4QAIA 2VENA 2Z2UA 2Q8ZA 2HVNA 1RLDA 1XD0A 1EQCA 1PJ9A 3FDGA 2FB2A 3T81A 5A6BD 5JBDA 1GSNA 4H9TA 3K4AA 4O4VA 3LHTA 1GEQA 3MSRA 4R7OA 4Z1BA 3CS2A 1W9VA 3GRTA 2OJPA 4AEOA 3UG4A 1ICQA 2ABAA 4ML4A 4Z2IA 1QNVA 4XD3A 3HF3A 3OBEA 4F40A 3FSUA 4BA0A 4OQVA 2YFNA 3UXIA 1XGZA 2GDVA 3TYUA 2CZFA 3KRZA 1X8FA 4CN4A 4EXBA 1XINA 5ABTA 3WLQA 5F1UA 1XG3A 1ZJBA 4PB4A 4PBGA 5LA2A 2GGIA 3SUTA 3WJZA 1E3XA 5EPDA 3GRIA 1RLCL 4FSAA 2E25A 2VZTA 2J7DA 3UETA 4CU7A 4GI8A 1DQXA 7TAAA 4P7LA 5HQMA 3KDNA 5JUVA 3FYYA 4UOZA 5HUOA 4DJFA 1F3XA 3VIKA 5D38A 2YAUA 4RL3A 3THAA 2OT0A 4C6MA 1HXJA 1US2A 2YB4A 1YTEA 4GHRA 2PWEA 2BMBA 2QAFA 4JTKA 4ECLA 2V3AA 5FI8A 4P7QA 1UKOA 1VZWA 1OC6A 4IZGA 4W93A 3ZO9A 2A3EA 4MNJA 5FL0A 2H8XA 2QJHA 4B2DA 4JYFA 3U6WA 3PR2A 3NVDA 2ZA1A 3CPUA 1AA1B 3WFAA 1AFSA 4TMCA 4DJEC 3I7SA 1ZDLA 1A5NC 2IS7A 4G7EA 1F4AA 3MV11 4FNRA 3LGEA 5HJXA 1K02A 3GDMA 1B3OA 3DECA 2J3NA 2YDQA 1EGVA 1R86A 4J3UA 2ACRA 3S1XA 4CEUC 4JAWA 3GFZA 4W8LA 1LUCA 4IQLA 2BX7A 1WPCA 3JZEA 1S2CA 2CIPA 3KCOA 4OHQA 5CCZA 4S3JA 3W7GA 2DZWA 2FPVA 3AISA 1WV2A 4ZXOA 4UQAA 4GVGA 3VOGA 1PZ0A 1GV4A 1KRCC 2CNCA 2DQXA 5I06A 4ZCWA 2FDMA 1DORA 4W7VA 1OB0A 5U1OA 1GOMA 4G7EB 2C15A 3UD6A 1RPXA 3K13A 3SCQA 3WDRA 2P8CA 4PRTA 4PUKA 3QRHA 3M0MA 3ORWA 1R8LA 1LUCB 2ZIDA 1X6NA 1C9DA 4HPXA 1Q85A 2V82A 3M0JA 1WAUA 1GVEA 4O50A 1DQWA 3GYEA 4R7JA 3K4WA 1EJTC 1JOAA 5U7SA 1Q6QA 1H61A 2DSZA 1V6XA 3TAOA 1DWAM 1M65A 4AFYA 3MUAA 4LT9A 1SW7A 3U8GA 3M6DA 3FA5A 5G4EA 1QK0A 1AH3A 2ZX7A 2PWFA 1ADDA 2IQDA 2PDCA 3DU0A 4EF9A 4X9SA 1W37A 1Q7MA 1LCOA 2PGRA 4EAYA 4F2UA 3P82A 3L5LA 2YXXA 3GHTA 4HIBA 1WZKA 4PCFA 2DZAA 3HJEA 3B0PA 5FEXA 4IHCA 1N62C 6TIMA 4IIFA 5FMHA 1FEAA 3IUIA 1DOSA 3I3BA 1GG0A 2BV9A 3CO4A 1YNPA 1OX4A 3M0KA 4ZQRA 3DG7A 4FOUA 3TYAA 1GTHA 1Q7QA 4KT2A 4O14A 1LL4A 3JU2A 4FNSA 2G3JA 1UWSA 2QUUA 3KBWA 2H3BA 3M9YA 3EOEA 3UR5A 1IZKA 4GI6A 1I45A 4CD4A 4NEWA 3CHVA 2E5DA 4YWIA 1OC7A 3ZWSA 1XD1A 1F05A 4W9TA 4O54A 2PRMA 4I5RA 3RK8A 4EM4A 4LX4A 4Y96A 1OX4B 2FHBA 4PMQA 1OSEA 3U2OA 3UXAA 2XIQA 3CT7A 4MY1A 1G4SA 5CZSA 2Y8UA 2WC3A 2CYGA 4ZO7A 3VGEA 4D1IA 3P5YA 1G94A 5E6ZA 2P50A 3CH9A 5CC5A 3EMQA 3G77A 3M07A 1PYMA 3W3OA 1B1YA 3D9XA 3W1LA 4EAMA 2HE8A 3OVPA 4AD2A 1CWYA 3O6YX 1W5OA 1K1DA 2WJEA 1BLIA 4QJ4B 3WQWA 3VUPA 3VU2A 4XVEA 5FS9A 4CEXC 3LOTA 1X1OA 1GVRA 5EY5A 4D6DA 3RN6A 4ZEPA 2V3GA 1V6VA 1VBRA 3VMPA 2VM8A 4WZHA 2HEJA 1E6ZA 4W87A 1NIUA 5KZMA 2XISA 4GYJA 4HJWA 3MI3A 2P1FA 5E0FA 3RMJA 1OD8A 2QCLA 4R85A 4K7YA 5HATA 3S0CA 4UFIA 1CT5A 1VFHA 4H4TA 1GT8A 3IARA 3PM6A 1AK5A 3DGBA 4DF1A 1IV8A 1W1A1 2OOFA 3VGHA 5D9NA 1EDQA 4UQBA 1CIUA 1JROA 3PZOA 4JBRA 1XWYA 3LB8A 4HN4A 3WCZA 1OC5A 1K8CA 2CLFA 1TE1A 4HSHA 1J0JA 2CWXA 3ABQA 3TJLA 4MPKA 1V7AA 1XRTA 2V63A 4XZIA 5C54A 4J35A 1PB0A 2G4JA 1KGWA 4ERGA 1G67A 1S46A 3WF1A 4AMAA 5KVIA 4LS2A 1XG4A 1B3ZA 3M5ZA 2Y7FA 4MJ4A 4F0HA 1SVDA 2QDGA 4ZE5A 8TIMA 3GR7A 4Z0JA 3IGSA 3GNDA 4KEZA 2QULA 1QI3A 4HCLA 2J75A 1VD6A 3ZVIA 3BQ5A 3W71A 4FXSA 2BLEA 3SQLA 2PWGA 3EDDA 1KTBA 2ZZ5A 3SY1A 4MJZA 3H4GA 4B9YA 2YVJA 5M2FX 2G4FA 1RJQA 1HVXA 5FA5A 1M7PA 1LTDA 2YPIA 3LPFA 1HVQA 4AIOA 3N25A 5CSRA 4IUGA 1LQ2A 5BCAA 4AD4A 2W4XA 1JJKA 3LA4A 1VJSA 4TU1A 1OF8A 1UKPA 2QS8A 1T96A 1D7YA 2ZQ0A 1T5AA 1XLDA 2J7BA 2AQVA 2EQ8A 2XFRA 4GYPA 4H8NA 5AECA 3VGBA 1L9WA 4RDYA 3SGZA 1P0BA 3PJWA 1FWRA 3UZ5A 2V6AA 1GXFA 2DZSA 1GTEA 1MUCA 3UCDA 1KA9F 2DT0A 3C0JA 3O9NA 1JZ3A 1TPDA 5I00A 3DN5A 1CNVA 3EOSA 4LCSA 4MWAC 2ZX8A 4X60A 4PEKA 1FH7A 4L9YA 4BEQA 1WKFA 3E0VA 4ERAA 1DIKA 4RNJA 4YLWA 1VCGA 2YIHA 1IT7A 4AZHA 1IEQA 3LADA 2ZXAA 3ZJKA 1X2GA 4NI3A 3I7RA 4J40A 3B0UX 4HHHA 1Y65A 2QKFA 2ZXDA 1HKJA 4CQ8A 2V68A 2JEQA 2YDRA 2OLAA 1JGIA 3FGCA 3PAOA 5EMLA 2R9RA 3FY1A 5D05A 5D9OA 5LIYX 4LYRA 3ABOA 3I6TA 5DF0A 4H2CA 1KBLA 3IWPA 1B9BA 4RE3A 2WMIA 4NNAA 3UA3A 2HVMA 1YTDA 1MQRA 4L9XA 5I0DA 4M81A 2QCMA 2OEJA 3TDFA 3BL3A 2EPOA 2CHNA 3CASA 4HK6A 3HPSA 3KP0A 3M5VA 1CBGA 3MDUA 4A8IA 4XKYA 3TX9A 5ABHA 3BG9A 3BAKA 2VJXA 4CNOA 3N12A 2PDMA 3S47A 2HK0A 5A2CA 3FGCB 3VE7A 5J5RA 2V3DA 4YTRA 3L4ZA 4QCFA 1J18A 1XIEA 1J93A 4IFRA 4MNLA 4J4KA 3A9BA 4C6OA 1N60C 4IWWA 1VENA 1OFOA 4IH3A 1FWTA 3NZ1A 1EC8A 5DELA 4U3CA 2FZNA 4XKYB 4QDWA 1TTIA 2ISDA 5G1TA 2PDLA 4FR1A 2CWNA 2GVLA 5HUPA 3N6HA 1GKPA 3SCNA 4H4ZA 3B0VC 1FFRA 3UR2A 3QR1A 3GD3A 3THQA 1SR0A 4BI5A 1DXIA 3C52A 4EF8A 1UR8A 3NO1A 3WN6A 3E2QA 2GSEA 2WANA 2ZC1A 1B3XA 3GNRA 1VB9A 4WJEA 4TVWA 2ZUTA 3QC3A 3AXXA 2WZMA 3GDLA 3L8KA 4ZTXA 1NOFA 3L12A 2YVFA 1C7TA 4TVYA 4TQTA 3AYRA 3ARXA 3MS8A 1X6LA 3T0AA 1FA2A 2UY2A 2A3HA 3MUY1 4WKFA 4Q32A 2QUNA 2XGZA 2PLJA 3SY5A 4UZSA 3NDOA 3WNOA 1FX6A 3EBVA 2CU0A 1VPQA 3P0XA 2ZRWA 4H4SA 4DJFD 5BXTA 3S4TA 3UG3A 3SRFA 4G8TA 4DI8A 5K9DA 3SCSA 1ZBWA 2C7FA 1HTIA 3WL1A 2GVJA 2A6NA 3PS7A 5DCBA 4CQAA 4ZVJA 3NA8A 4GFIA 5BYWA 1UZ1A 2WYSA 3UCQA 3QC0A 1RK6A 5D37A 1EX1A 3UXDA 1QNRA 2Y0FA 4L1WA 4GKTA 4LYKA 2Q8LA 1AD1A 1R3QA 1R9ZA 3WLPA 5DMYA 1PX3A 4B2DD 1CGUA 3EA3A 3P80A 3R1ZA 5K2ZA 2BY2A 4FS9A 3OU8A 4H6EA 1KR1A 1MO0A 2CBUA 2CLMA 2WVVB 5CPQA 1IWPA 3RLGA 5FSEC 4HK7A 4DO6A 2W0UA 1BRLA 1CGYA 2D2HA 4JQ3A 4DI9A 4XB3A 1V8EA 2ACSA 1ONRA 2OVLA 2E09A 4Q8NA 4JPGA 3QV8A 4CQ9A 2WMGA 4D8AA 1KXHA 1PEZA 5KMYA 2QUVA 1EC9A 2PDGA 1GQJA 3T2PA 4RE4A 1WKDA 1E0TA 3AIQA 3U9IA 5CJNA 1H51A 4IJCA 3RUBL 3AU6A 2P88A 3WLHA 3S6TA 1BRLB 3AYTA 1Q6OA 5B80A 4TVDA 3NVVB 2GUYA 4PA8A 1A3WA 1VGAA 3IVUA 1X96A 3IEBA 3F1QA 2Y8VA 1KXTA 1FIQB 3E0LA 4HMNA 3MMWA 1AD4A 2MUCA 1UW9A 2BVDA 2ZC8A 4A22A 2DVTA 3ANYA 4QE1A 4QQ3A 2QCGA 4S3FA 2VFFA 1MNZA 3L67A 1HF6A 2PB1A 3HG2A 2A3AA 4B90A 5XINA 3TN6A 3WD3A 2G3IA 5A1AA 3K30A 2WCGA 2O7SA 3LSCA 1K9FA 2WBAA 5BRPA 3SN0A 1F5ZA 4ZO8A 3C8FA 1TV3A 1OGBA 4O19A 3NL5A 1LJYA 1FHUA 2VRQA 1T8XA 1NHRA 1GQKA 2EGZA 3GTNA 1CYGA 2PTWA 4O1CA 1DJYA 1A5SA 3WG6A 5IM51 1W9XA 4GABA 4WD0A 1AJ0A 1F3WA 2DU2A 3F7JA 5HBFA 2YZ5A 3H6OA 4LUTA 3DC8A 2V38A 3PUOA 4LPCA 1OCNA 1YPXA 4HN8A 4BY3A 1UUQA 4DEFA 1W1IE 1ZL1A 4ENLA 3CAWA 4LTSA 1S38A 2X2YA 3EKZA 3H2MA 1GUVA 3WBXA 3JUGA 1VFFA 3FEQA 3WF2A 2YA2A 3N9KA 3VIFA 1K7XA 4PCTA 3P8JA 4WQ6A 4JN6A 2WOIA 3GYCA 4PL2A 1FECA 1LLZA 3VZYA 4ZQNA 2DIEA 1WDPA 2VX5A 2PDJA 1FWCC 2VRJA 3K46A 4LUTB 2CITA 3TYBA 3SSZA 2P8BA 1ALDA 3AZTA 3JS3A 4UFMA 2FMNA 2IKHA 1PKMA 4B91A 1NJJA 3GC5A 4GLEA 2GJPA 5DCEA 1XFBA 3MUCA 4WXZA 3UZXA 3RO8A 4ZOEA 3F5LA 1GHSA 3FAXA 4W86A 4KF1A 4PTNA 4A3UA 1AVAA 3MZ2A 1HJWA 1FHVA 3FS2A 3W2NA 3OP2A 1VQTA 4LVDA 4IXXA 4W89A 2YA1A 3H22A 4IGSA 5LIUX 4HZMA 3I3DA 3VCRA 3QSTA 3DOPA 5AYXA 1R3VA 4MDOA 1QBBA 4NI8A 3SCWA 3V18A 4ZFCA 2NT1A 3LHZA 1XGDA 2FJKA 3ITXA 2VQUA 4JQ1A 3W85A 4JY8A 1YDOA 3WNPA 5CG0A 1H7OA 1GVOA 1XL9A 3QF0A 1IT0A 3DERA 1EJRC 1V6YA 5H91A 3LS9A 3T8QA 3WYZA 3M7SA 4AC1X 2PDIA 4ICNA 1BWLA 4K6AA 1U2YA 3UZWA 3TK7A 4I5UA 2PAJA 3BICA 4LH8A 4FF7A 3MA8A 1CGTA 3B04A 4GE8A 3TLQA 1DHPA 5A6MA 2VQTA 4B9ZA 5A8MA 3AHZA 1E4IA 1QPKA 5C7HA 1PL9A 3U7BA 3PJUA 4AMCA 2R6OA 4C6FA 4FIQA 4NILA 4N0RA 3WEOA 3VIHA 5CJ5A 4RW5A 1ZCCA 3F4WA 1JULA 3TE9A 1NDVA 3VFCA 3N2TA 3AMLA 1XW8A 1TX0A 3G6MA 1ZJAA 1E71M 3WENA 4AISA 1PPIA 3ITYA 4KPRA 4B5SA 2X99A 2XN1A 4K8EA 1J96A 4ZE4A 3W7LA 1YXCA 4GGBA 3PTMA 4QJ1A 2AAQA 2C18A 1W3NA 3RITA 4H4PA 5DLCA 4ZOHB 5AHIA 3VILA 4F2BA 5C9RA 4D9PA 3GHRA 4J2MA 5HWNA 1TCMA 3NQEA 4IMFA 4O15A 4JYEA 3TWAA 3CUGA 2QEZA 4AYGA 1N5XA 4LOCA 1I0BA 2OODA 2QCFA 1AJ2A 5FJJA 3HA1A 4YNGA 1HP4A 3BH4A 3KRUA 3K1DA 3GRSA 2C91A 3DZ1A 4H4YA 3A3HA 4O1EA 1WX0A 2I5GA 4YYFA 2IPJA 3MMUA 1NELA 1LPFA 4FNUA 3VIOA 4DJDA 3CAKA 3VMOA 2WNWA 2VEKA 3UVIA 5I7GA 1BXBA 1E6NA 3CV2A 2NX1A 1T40A 3OC4A 1OG6A 3M0VA 3L9CA 4DZIA 1LOLA 1S2TA 2NQZA 2QJMA 3K2GA 4KCVA 3W7IA 3N15A 1J01A 4EWJA 4BQ2A 5CEWA 1WXJA 4UR7A 4GGHA 4QTGA 2I56A 1XFCA 2R9ZA 3GTHA 1KB3A 2BGNE 2ZFAA 3WZ0E 4LV4A 3BV4A 4BJHA 4L4MA 1REQA 3LCHA 4NZJA 3GHUA 4ROQA 1EBGA 2A21A 4V15A 1JCJA 3NGFA 4J9JA 3T4CA 3QVQA 1BXNA 3WQ6A 1ZENA 3DESA 2NX3A 5CPMA 1VHNA 3TROA 3MMTA 1UBSA 4IIHA 3V16A 5LXXA 2Y1HA 4HHPA 1NP2A 3DFTA 3CLMA 4JCMA 4PCPA 1E9YB 3G3DA 1TWWA 3TSDA 3P0WA 4DUOA 3QZAA 3H2EA 3PB0A 1XLHA 1REQB 3EMCA 1OK6A 2JE8A 3IIVA 2YLAA 2BODX 4E5TA 1ZQ5A 3N34A 2VCCA 3HQ1A 1E4LA 5JIPA 2YDAA 2YJQA 4MDPA 1A5LC 1ZAHA 4NG3A 3PPCA 2PGEA 1IF2A 3K4DA 3ABRA 4KGJA 1SJBA 1DJIA 2PU0A 1DTUA 1QRQA 3KVKA 1UUMA 3I4EA 3XISA 2Z24A 3SCOA 1O68A 1YNQA 1BSIA 3RM9A 4WGHA 5A69A 4IPNB 2ALRA 5CLTA 3ZYZA 2V2HA 1KFKA 3MI6A 3PWGA 4G56A 3G3MA 5FJPA 1MUMA 1IIGA 1GZGA 4GUHA 2PP1A 1VCFA 4A05A 4QJ5B 2Y5JA 1ITCA 5HMSA 2WW5A 3TLLA 4WRHA 3SUUA 1CW2A 1BF6A 4PBEA 1UR3M 3E5BA 1OJTA 3QSRA 4Q22A 4RK8A 3SCVA 4HKPA 1F74A 2UV8G 3MKCA 1XICA 3BAWA 3RYSA 1UROA 3M1ZA 2INEA 1VFMA 2NSXA 4EPKA 4ACYA 1J0HA 2C1HA 1OWQA 2D20A 4RR4A 4MB3A 5I03A 2GR3A 1BTCA 3THUA 2B7PA 4AAJA 3NRZB 2PWDA 4M6UA 2HQAA 4MJ2A 1AMKA 3O2LA 4L7ZA 1HW6A 1R6WA 3SRKA 2WWCA 3WDPP 2AL1A 5TF0A 4GC3A 2NXGA 1A5OC 4PSRA 3NXLA 1BWVA 1TV8A 1LRTA 3DFYA 3E2VA 2CESA 4F0LA 5CQ1A 1PE1A 2ZXQA 4P61A 2IXVA 2ALDA 1H60A 1DYSA 3M4HA 1OGSA 1OGGA 1H7XA 4PL1A 2ZUNA 4NJHA 3MQTA 3BVJA 2TPSA 3B9OA 4HVXA 1I1XA 4GPNA 3WKZA 4MB5A 2V3BA 2QJIA 4D1JA 1MRQA 1T99A 2CFYA 4FX8A 5IRPA 5E1QA 3QFEA 3RO6A 5ABGA 1GORA 2Y89A 3DJGX 2E1WA 3LV5A 1FKXA 2HPIA 1WZAA 5AC7A 2J79A 1TX2A 1ZZMA 3CQJA 4Y6GA 4KQNA 4HK5A 2TAAA 1TV4A 3BOXA 4RPPA 4D8LA 3HJZA 4IXHA 1GESA 4BF7A 4Q8OA 1Y7VA 2VEPA 2VZUA 5REQA 4UQ9A 4L4LA 4H19A 1HQTA 2YXGA 3L4VA 1FWAC 2FPYA 4QFUA 1TPC1 3CGTA 4X63A 1K6WA 2O9RA 3GFYA 3ARZA 5AB3A 1CLXA 7TIMA 5AC8A 3WK3A 1I2RA 2WM0A 1DL3A 1XBXA 4RCXA 4ATWA 2CHOA 1BKSA 1BVNP 1W6TA 5CZKA 1E56A 1GOXA 3IK2A 1IEWA 4ZQMA 2DIKA 5REQB 4CVUA 1ZBKA 3LG3A 3ARPA 1G7UA 5HPOA 2DH2A 3M44A 3VOHA 3V1HA 1QNQA 1QDSA 2WVUA 2NX9A 3ZJ7A 2D0HA 2YYTA 3PK7A 1Z3NA 2I9UA 2POZA 4GACA 1Z44A 4C6KA 1OIFA 3RNMA 1K77A 3WNNA 3TWBA 4Q8MA 2BNJA 1CLKA 1JDCA 4INFA 4BKNA 2GSJA 4S1FA 4X2PA 3W4RA 2HPMA 4AEFA 2INZA 3CHFA 2XIOA 3G18A 3VKJA 4DO7A 4IOTA 2VELA 2PBGA 1H1ZA 2I7GA 4C6JA 3L5OA 2DUXA 1K4QA 1TQJA 1S2UA 2VOTA 4Z17A 2BXZA 3KBSA 4O13A 5ABFA 4JL2A 2GVEA 4XX6A 4AIBA 3Q65A 3OVRA 1SZEA 3B0XA 3L4UA 4D6IA 4PMOA 3E38A 4H01A 4ASTA 4HMEA 3WY1A 3MO4A 5D02A 4BWLA 3VDBA 1NHSA 3URBA 3AWNA 3ONCA 3ICJA 1GW1A 3AJXA 3KL5A 4DYJA 4XIMA 1H7PA 2WSKA 3IPWA 3EKGA 3T44A 1VR6A 1QNSA 5I78A 1JFXA 2P5NA 1PHWA 3BSHA 5ABFB 4WKHA 1KM1A 1LBLA 2GGHA 3IGUA 1SJCA 1E1CA 3GC2A 5FAJA 3I6RA 3ITVA 3VYLA 3P81A 1ML1A 6ENLA 3RLVA 2XINA 4JY9A 2YCLA 4Z1AA 1E43A 4GIYA 2WWDA 5BROA 5CAKA 4P5UA 5AHEA 2J27A 4H9XA 1EKOA 4RXGA 5HMDA 4HYRA 1UHVA 2ADAA 1ZBCA 1JL8A 1EP2A 1E1CB 2VKZG 2OELA 4JFUA 5EBUA 3EWDA 4PMNA 5TAOA 3HQNA 3ZLHA 1G6CA 1Z32X 2AL2A 2P3ZA 1VP5A 4FXFA 3BAYA 2YCLB 2ZDSA 1X6UA 1JUKA 2NV1A 4BF5A 3UVAA 1DJQA 3THDA 2ZZ3A 4A8LA 1VQZA 3LU2A 3NIYA 4WHBA 4Y8EA 4MAZA 4M7SA 4GMEA 4AD5A 2VL4A 3QPEA 5IHRA 3KCJA 1XQKA 1F8WA 3LLDA 1JD9A 3MMDA 1MEHA 2OPJA 3M7WA 1H2JA 1Z8AA 2AL2B 4IIDA 4CQDA 1SMAA 4Y9NA 2VXNA 2PWUA 1QPNA 1QOQA 4QLJA 2XIJA 4I9AA 1QW9A 3H24A 3CT2A 4GUJA 4KIRA 2YSWA 3NO5A 1TKKA 4XSMA 4AYSA 3DIPA 1UIOA 3U7VA 3PHAA 4R3UA 4BI6A 4XAYA 1E6RA 1QASA 1THFD 1W1PA 3GBEA 3LENA 4GXPA 2E40A 1L6YA 5IXEA 3NPWA 4Q6XA 1ZKQA 2YGYA 1J6PA 5CC3A 3LEPA 1AUSL 4NXKA 3NQ7A 2XH0A 4JEJA 1TTQA 4L61A 4RW3A 1RQBA 2GH5A 4MFEA 3R94A 5JCKA 1NP0A 4EXAA 1MW0A 2NPXA 4LGXA 2BBFA 4F9DA 3MO7A 4FXRA 4DM1A 4J3WA 3C6CA 1KRMA 4XZNX 3GH4A 5H1WA 3E12A 1S2AA 2WP6A 1IE7C 3GAYA 4I8YA 1XLMA 3DFNA 4DZHA 2VFEA 2DIJA 1Z89A 3UY8A 2YBUA 1BVZA 3KW3A 4U5KA 3W00A 2WC7A 3E9AA 3CV7A 1MXSA 1R3SA 4JN7A 1RV8A 1FWJC 2EPNA 2VD8A 4OTKA 1UKTA 1UA7A 1WCGA 3H7VA 5I07A 3BAJA 3WH9A 3ANVA 4XD4A 3IRDA 5EMJA 3RDKA 3V75A 1BAGA 1O1HA 2PD5A 4G1NA 1VRDA 1NFGA 4E4PA 4IX2A 1KCXA 4WSHA 3AHVA 3WD2A 3URNA 3TNBA 1N5WC 4OT7A 4ZL1A 2X05A 2ON3A 5DXXA 3CWHA 3RIKA 4D72A 2HDJA 3ARTA 1R5YA 3UG8A 3WLLA 2YCJA 3LTPA 5GNZA 1H49A 4JGDA 4YCPA 2IKGA 1WZLA 3WF0A 4WY0A 4CGTA 2ZZ6A 2OSWA 3FKRA 1EOKA 3ENLA 1D2KA 4AZBA 2J62A 4XAZA 4NAEB 1D8WA 3A5FA 4QS5A 4JYDA 1KV5A 4XVDA 4HNUA 1UQYA 4JZ5A 1FTXA 1LL7A 2E6DA 1OX5A 1D9EA 3OHIA 3VKBA 1VS1A 1MQPA 3E2SA 4LS1A 1W3IA 2V69A 4WVXA 1L8PA 1ZLPA 3EA1A 4IG2A 1OCQA 2WHLA 5JU6A 4MKVA 1ZY8A 4WY0B 4LAOA 1TJ0A 3WH6A 2ZXBA 3HU7A 1ZMDA 1VF8A 4J3TA 3SQMA 1W3JA 3WDHA 3N6QA 1FCQA 1N8FA 3GU2A 3TJIA 4Q7BA 4LNYA 3LY0A 3I6EA 3ONBA 2PGFA 4HJFA 4IG2B 1YE6A 2QPSA 1FH8A 3DFHA 2VOMA 1KFCA 1ZRQA 2WNNA 4KFPA 1HJSA 2W5FA 4GCAA 1FWWA 4WJ8A 1PAMA 2FVMA 4YWSA 3M5XA 1AQ0A 2HCVA 3NJ3A 3NO3A 2FJUB 4DJEA 4JKMA 4LF1A 3LN3A 4CN1A 1PIFA 5G1YA 3V1PA 2EQ6A 2TSYA 2YZRA 2CHRA 2WV8A 2X7WA 2NQ5A 3O06A 2G3FA 4R9XA 3VNIA 3JR2A 3SM0A 2ZBTA 1MW3A 5HJYA 3KUMA 1F8IA 2NVKX 3DI0A 5AZ0A 1FEBA 1SZNA 2OWXA 3HV8A 5LNRA 1E0XA 1R7OA 2QLYA 2VX4A 1V97A 3O1NA 4M82A 4P8VA 2EPHA 3BGGA 1SZRA 5E09A 4UFHA 2NQHA 3VNZA 3H70A 4Q7NA 3ZQ9A 3E0WA 3GNPA 2JIWA 2UBPC 1ONXA 2V5DA 3UGRA 1I60A 5DFAA 1ITUA 3W2KA 1IZJA 4H83A 4JHOA 3NQDA 2Y6ZA 1BZLA 4NZFA 3UPWA 3SR6B 1ODUA 2QZRA 2ZZ0A 1JZ8A 1GOKA 1E3ZA 2G37A 4TMBA 2GQ9A 2WPCA 4UC5A 1TVNA 1F6YA 5BXPA 4LFYA 4DM2A 1QI4A 3AMKA 3VI2A 4HPGA 3DENA 7A3HA 4S23A 2BXYA 3TZFA 5HQLA 1TMHA 4GOAA 4DUWA 4UQCA 1JG9A 1YEYA 3EXRA 3RJXA 1RR2A 3PBUA 2QMKA 2YXOA 4UTFA 4A2RA 4PFHA 1KWKA 1ECQA 3BSMA 1UD3A 1IQ8A 4DWSA 3KRSA 4AQLA 3DKLA 5EMMA 1FO4A 1MW1A 1Z9AA 3E5PA 1JPIA 3SEPA 1NFPA 4O0QA 2PTYA 4A35A 1N7KA 1A0EA 1LP6A 4LSBA 4JFWA 4QXIA 1MO9A 2A7PA 1B3WA 3FXYA 1Q7ZA 4O10A 3N4EA 4P2VA 2GPTA 2F6KA 1SZGA 1DWHM 4W84A 1F6KA 4W7WA 5HNUA 3GXIA 4GBDA 1XDIA 5JCLA 1VBJA 3FN9A 4B15A 1DKWA 1SB3B 4FI4A 3H4KA 4WUIA 3ZSTA 1PV8A 3HG3A 4ADSA 5EA9A 3ABSA 1EEPA 4Q7IA 3ZVHB 2PCEA 3S83A 5ER0A 3WUFA 4GBUA 3FKKA 4GISA 3OLGA 2CXGA 4AHPA 4KEVA 4KEUA 3WF3A 1Z69A 3VINA 2I57A 1P5BA 1BKHA 2VC9A 5M5DA 3ES8A 1X98A 3TN5A 4HB7A 3UQNA 3L68A 1DE5A 2VGIA 3AIBA 4QGCA 3TTSA 2XN0A 4A6GA 3K8KA 5JBFA 3AIWA 3T2OA 3APGA 4I9TA 1TYPA 3OQ8A 2POTA 3IANA 2WCAA 4EIVA 1IGWA 4H8UA 6XIMA 3MW7A 1G9HA 3R79A 3PUDA 5HULA 4GRSA 2DSKA 5AVNA 3VIIA 3NVYB 1Q6RA 1JXKA 5C2GA 1M3UA 2W55A 5GJPA 3B8UA 4ORMA 2YQUA 1FRBA 1H7NA 1BGAA 1A53A 5JQ9A 4JX6A 1TVPA 4ROPA 4TVUA 3F4DA 2J88A 1EJUC 3M43A 3CZJA 4UFJA 1CENA 1M5WA 3PPHA 3H21A 3V7PA 3W1XA 4KWSA 1MVYA 1QI2A 1R3RA 2EJ1A 4IUOA 2XIBA 1V7YA 1WKYA 2F7FA 4GY0A 1VKFA 1ZALA 1WYIA 4K37A 3STCA 4OJYA 1WB0A 2HBVA 2IMRA 2DVXA 3M64A 3U5YA 8XIAA 3WJWA 3QQ0A 3N2MA 3BE7A 5MHBA 1H7RA 5HWMA 5C9XA 3LXBA 4X2RA 1EYWA 3LB0A 1U22A 2E8YA 2OR2A 1XSJA 3GNNA 4H4VA 1LDCA 3S1UA 3NS1B 1JRBA 3DBPA 2V2DA 4TO8A 3QFBA 1JAEA 3G0UA 4PMUA 2GJXA 2H6RA 3WQFA 4LRTA 5BW6A 1QI5A 3MVTA 4IMGA 3LM3A 3T09A 3TR9A 1X39A 4TTGA 1EWDA 2A3CA 4EANA 3FIGA 3C2RA 3II1A 2W27A 4YU1A 5F1VA 3UZJA 4L4OA 3T55A 1V02E 1HKMA 2XSAA 1OCBA 4OOZA 1FFVC 3ANUA 2GWGA 2FZBA 4PCNA 3REQA 1E9ZB 4MWAA 3DYPA 5LIKX 3RHGA 3A7RA 1B90A 3HPXA 1M7JA 4E2BA 2C71A 4DBEA 3DHDA 3VNYA 5C9ZA 6REQA 4K36A 1RSCA 1I2OA 1TSIA 4KGLA 3RMEA 3WDIA 3DFQA 3FHQA 3LMYA 5LA1A 4BFAA 2BZNA 5MKGB 2FYMA 5H2ZA 3VOIA 2ZUUA 2ZUSA 4DJDC 1QO2A 4GK8A 3REQB 3ETRB 3MY9A 4N4QA 4MWAB 4HD5A 4ZQPA 4BK9A 3CC1A 2QPUA 3MDWA 1N55A 2XPKA 4KRTA 4X61A 3DH7A 2D22A 1FDYA 2PP0A 3N6JA 3GDKA 3S9YA 2VDHA 3G1RA 2J7GA 3KTCA 3KTXA 2OOGA 1GNXA 2C14A 4HZ6A 4ZOCA 3E96A 3OPSA 3IJ9A 3QHOA 1RPKA 5XIMA 2Y7EA 2F2KA 3HIJA 3U4AA 1FWGC 2RGMA 1AZ1A 1N63C 5C2CA 5TR3A 1H62A 3C0SA 4C6PA 2P53A 2FHCA 1M53A 1IR1A 4AY7A 3CZEA 4KEMA 2C16A 3W76A 3HB9A 4B3ZA 2BFGA 3HOJA 2AMGA 2J6VA 1GWJA 1OFAA 1ZFJA 1CGVA 3WQ4A 5BOOA 5M03A 5D9MA 3SURA 1KM3A 4BEUA 2BGQA 3L0GA 2ZZ1A 5HDRA 9XIMA 5DXYA 2PA6A 4O1AA 3GKFA 1EJXC 1UD2A 2A79A 1UOKA 1J5TA 4QDMA 4LU0A 2R1NA 2YW4A 4UOQA 4XBJA 4M1BA 4JTIA 5LYRA 3LQGA 2WZTA 1OZQA 1IXNA 3T6CA 4DBWA 3WX7A 3KE0A 3E2RA 4EMJA 3DG6A 4ZSUA 1W0MA 4LY4A 1E70M 1VRXA 4YYCA 4L1GA 1SFJA 2GVYA 3MJYA 3UP8A 1KW1A 1Q66A 3W7KA 3UJ2A 2YL8A 1NY1A 3HRDC 1G69A 3DI1A 1OFRA 2HS6A 4JTHA 2PURA 1R47A 3PZ9A 4Q8VA 5AC4A 1OX6A 4LAKA 2Y7GA 2YOCA 4XV0A 4YTQA 4AHOA 2DUAA 2EAWA 1A4MA 3GBDA 3MHUA 1V03A 4QISA 5GJNA 1R3WA 2Y8KA 3P60A 1JEZA 2QV5A 4W5UA 2D2JA 3T07A 1E0WA 1F76A 1GREA 2BHZA 3W1AA 1J5SA 1A5BA 1GERA 4B3KA 4K7VA 5KZDA 4PUDA 4LJ3A 4FLRA 3IK4A 3DXIA 2WOWA 3OLDA 5I2UA 1A50A 3KM8A 3N4AA 3ZJ8A 4AX6A 4HNLA 3LTSA 4FNTA 2VUNA 4TXEA 1Q65A 4DJED 1PYFA 2ACQA 4GX9A 4JQ2A 4U10A 3UXKA 2RDUA 1CB7B 4WLCA 1UASA 1OJXA 1V0KA 2YYUA 4RV8A 3AIRA 3A7AA 1US0A 3MT1A 5CXPA 3EOOA 1EFZA 4H7ZA 1FWEC 4YTTA 2R1KA 3GR8A 2C3CA 3R43A 4FX7A 4ZTYA 3WQGA 3KOYA 3W2MA 1AL8A 4WSKA 3ZWTA 4HA1A 1ME9A 2ATMA 4XZ9A 4N7QA 3TA6A 1AH0A 1Z48A 2XGIA 1JDFA 5BMWA 4L4PA 5BXSA 1DXLA 2GLKA 1ISXA 1BYCA 3BAXA 1MEIA 3M47A 1DIDA 1V77A 3KVLA 3SUSA 3G0XA 3ZT6A 4ZR8A 1EDTA 2DDXA 1E9LA 1ZJIA 2ZX5A 3LPPA 1DEDA 4W88A 4ZOBA 4E0CA 2XM2A 1X8CA 4QR6A 4NSBA 4GVFA 5IBXC 3PZVA 2CW6A 1ZU8A 5TIMA 1D7FA 4WCJA 2VO5A 3FV9A 3VE9A 4IPJA 3PTKA 3ARWA 1JCMP 4HSOA 1R7AA 2J7FA 4JOMA 1UKSA 4AHQA 4FNPA 3C0QA 1IEVA 5H6HA 2PLMA 2QGHA 2ZVRA 1BD0A 4TX8A 1XR2A 3A3XA 1Q2RA 3WL0A 1TRIA 3D6NA 2X16A 4NT0A 1DPMA 2OT1A 4W85A 2JQXA 1PKYA 5JVLA 3OVGA 3U0HA 4O8RA 3VOFA 4Y9PA 2OQYA 4QCEA 3WBAA 3WELA 2PTZA 1S1PA 3GZ3A 2O9TA 1KXQA 4U3AA 3W29A 1MFVA 1TJPA 3UPBA 1JYWA 4LVGA 2ZA2A 1HUVA 1U5VA 1GGOA 1G4EA 2ISSA 2QT3A 4GNVA 5CSUA 2YL5A 4BHYA 5ECVA 4HA0A 3AS0A 4CNNA 5CAHA 1PWLA 3I65A 5K9XA 1E4MM 1RBAA 1EB3A 2PDHA 1T7LA 4W4QA 2Y5SA 1A3HA 1IWAA 2VFGA 5DT5A 4AB4A 4US5A 3VOJA 1C3FA 1E0UA 1Q8JA 2VFHA 1GPFA 1R0MA 4IM4A 3W26A 5DMLA 3CMFA 1U1JA 4YL2A 1GQIA 1ZXIC 1A80A 3FSTA 1NOWA 1ISZA 7XIMA 4GQBA 3LV6A 4BWLC 2PDBA 1H50A 1KTNA 4UR9A 2YVGA 4L6DA 3DFPA 2QR6A 2FZ8A 4C6QA 2DW6A 4A4AA 5A6KA 2OQHA 5DBUA 4HA4A 4WIWA 2YKKA 3QTPA 1PCWA 4LA1A 4ZFMA 1JNDA 1GVSA 1JUBA 3AROA 1GYNA 2J9XA 2C3ZA 4WDTA 1HZYA 4QSHA 5J8LA 3PZGA 1S5NA 2OG9A 3WQPA 4IJRA 4MJMA 3VMNA 1HKKA 2WPGA 4EOUA 1FCUA 3QYQA 5AC6A 1O5QA 3NL6A 2W62A 4K1GA 1Z41A 3ZFHA 1IYXA 1LL6A 1W31A 4L56A 3TEVA 1WOAA 5HMFA 4IFKA 1WQ5A 3C3UA 3LLFA 5U4NA 2RDXA 1PDZA 3AXHA 1QHOA 1OG0A 1MXGA 1Y8BA 3IJIA 4V28A 3RFAA 3W6LA 4JIRA 3W84A 5C7VA 4QG6A 4UOJA 2EPKX 3LI1A 3VC6A 3GXFA 1JFHA 3MP3A 3W86A 2I14A 2BDQA 5A6JA 3CB8A 4TX9A 4IFKB 5BWAA 4CNTA 1PIGA 4ICCX 3SGGA 5EMKA 3THCA 3EA2A 1CCWB 1V0LA 3RILA 3D3AA 3PG8A 4DBDA 1QW7A 1XRVA 4MM1A 2D3NA 1GOQA 1V3MA 1LG1A 4HTBA 1LWHA 3ZR5A 4AC7C 1BQGA 4PUEA 4BQ3A 5HANA 3NL3A 4IMAA 2E9BA 2A6LA 4RZBA 1OBAA 3NQ8A 1EUNA 3D3FA 1L8NA 2OXNA 1CXLA 4OV9A 3NQVA 2GUUA 2NXHA 5XIAA 1J2BA 5F2GA 3GY1A 1TV7A 3B03A 4Z2LA 3VKAA 2VGBA 2X1IA 1YPFA 1W8SA 3HGRA 3MWCA 2PLKA 2B81A 1HKWA 3IAPA 4I5XA 4XISA 2DEPA 5CH9A 1WXYA 3U3HA 1DP0A 3BTNA 2YL9A 4KFOA 3PBMA 3W72A 1OABA 4HYVA 1QPRA 5CG7A 5LNSA 2RH9A 3HG5A 3MSGA 4OZOA 3WMSA 3TYEA 2P10A 4NRSA 1A5KC 3TJ4A 1SGJA 4FZIA 2WPFA 1R3YA 1V6WA 4IL2A 2CBIA 3QBUA 2DZPA 3T4WA 1HP5A 4FEZA 1L6FA 3BWWA 3KZSA 1BG9A 1M04A 1CB2A 3PBWA 4PTXA 3VZXA 1WBJA 2XH2A 1W1VA 3AU2A 2Z28A 1O94A 3UWQA 2PDXA 4OBRA 2GR1A 3NDZA 1F7BA 1O6IA 3FFSA 4GVHA 3TMLA 1EO5A 3IVTA 3NEVA 1NAL1 1LQAA 1FOBA 2Z1VA 3AS1A 2MANA 3R2GA 2ISWA 3RAOA 3QKEA 3BZJA 1K8XA 3DDMA 4PRWA 3N9SA 1R2TA 1TG7A 3ES7A 1XDMA 4UTKA 5M3WA 4PMZA 3BUVA 1W3HA 3LCIA 1TB3A 1LLWA 1X1ZA 2HSAA 1J0YA 1TJ2A 1XISA 3AHTA 4REQA 3UR7A 1VFLA 1F6PA 3H2OA 3RLHA 1LT8A 3K8LA 3FEMA 4AIUA 4JTSA 4I9MA 2ISFA 2PWHA 1XQLA 1NM9A 2O56A 4P7OA 5FEWA 3B8IA 3NOEA 2E5CA 3TA9A 1BHGA 2WSYA 1O5RA 3MVIA 2FFCA 3F5JA 1MZRA 3KP1A 1SZFA 3LTYA 3GG7A 2YFOA 2A3LA 4LVAA 2XIIA 3MU7A 1TZ9A 4XAFA 4F48A 2HV5A 2ZVIA 2NV2A 4M19A 2QVHA 3N14A 1RY0A 2VC6A 3BZGA 1UR1A 3QQWA 4EPDC 2ZWZA 3F2DA 2VEGA 3ITTA 3ABXA 4XZLX 1JUEA 5A2BA 4GVIA 3L4TA 1MSSA 4MKSA 2AAAA 4IF2A 3VM5A 2F38A 3ARQA 3OBAA 3VO0A 3MBDA 3VABA 2RABA 1XPGA 1MYRA 2IKIA 3MYPA 3EPOA 1O5XA 5EFDA 5FF3A 4I90A 1XYMA 1UWUA 3UY7A 4EPBC 5IDZA 3C5QA 3WQ5A 4LXFA 3EB2A 3UU0A 2D73A 1NDZA 3LRKA 1Q6DA 2PDYA 2Z2AA 3L4XA 1D7KA 3S6OA 2DPEA 4E2OA 3KBMA 2HNHA 4PTVA 4AVNA 4JDBA 1JZ4A 1C92A 1DJGA 1S1RA 4UTIA 1K9TA 5F4SA 1H2IA 3P3BA 1FWFC 1H6VA 2WPEA 4Q4MA 3LHUA 2C19A 2E0PA 3PZNA 4FOKA 1W9BM 2IKJA 1P1XA 3GK0A 3N4FA 2WBGA 3II4A 3ITCA 1AW2A 2PODA 3CL8A 4DF2A 2GGEA 1JQVA 3U5UA 4JKKA 3R25A 3FVMA 4TV6A 1S3TC 1RA0A 3CMGA 2DQWA 3CGCA 1XLBA 3G1FA 3T7VA 1V0MA 1JAKA 4B92A 3STPA 1BYAA 2PMQA 2V3FA 3QKZA 3CQ0A 3GHSA 3LX9A 3L23A 4C60A 3NSXA 3IRSA 4UQEA 3DK4A 4JTCA 4W8AA 2BC0A 3H12A 4IQJA 1RZMA 3AC0A 2ZKMX 4G2DA 3RR1A 4DBSA 1D8CA 1UH3A 1W5PA 1UMLA 3C8NA 4OGZA 3UYIA 3ZM8A 4IL0A 3IUDA 4NRRA 2RGLA 4RKAA 3AMDA 4K2SA 1O4UA 2WAGA 3VCNA 4A3RA 5AYYA 3FCPA 3TQKA 4RNHA 3G1YA 2DJXA 2YCIX 2ZRYA 3EXSA 3TONA 3G1AA 3FOKA 2GQAA 4JTTA 1OEPA 1PSCA 4J27A 3GKAA 4N02A 3NPXA 4A8RA 4B4HA 3DFOA 4HA3A 1H11A 3ARUA 1BSLA 4GJJA 5CGQA 2C1IA 1C7SA 2Z25A 1ADOA 2XVPA 3S2MA 4F4RA 1DBTA 7CGTA 5JXQA 3FHAA 3QQ1A 5C6MA 2XTKA 1J11A 4H4QA 1M03A 3KLLA 2PFHA 3TR2A 3GX9A 1PX8A 3MPGA 5L9FA 1OCJA 4DWSC 3CYJA 4BQ4A 2REQA 3EXTA 1SMDA 3CAVA 4PYSA 3DHUA 4QE4A 5FS8A 5I3FA 2W3SA 2NV9A 4EQRA 1H0GA 1UWAA 4EE9A 3NM3A 1PIIA 2EG8A 4Z2GA 2VC7A 4LUYA 5AHMA 3QV6A 4QX4A 2B4GA 4FXJA 5B7YA 5IHSA 1DWFM 1JRPA 4H9UA 3HFTA 2ZADA 4GFSA 2QUTA 4JFVA 1UZ4A 3WH8A 4YVPA 9RUBA 2REQB 4YHEA 1O12A 1YIXA 1N2VA 2F8QA 2Z7KA 4FA3A 1IXPA 1RCXB 3BOFA 2OCZA 3CUFA 1V3LA 2OKOA 6TAAA 2WHKA 3QW3A 1R9YA 1ZAJA 1A3XA 3B3DA 1XLLA 4GZEA 3GDBA 4AH7A 4LAZA 5IDIA 5KETA 3S5YA 3QMTA 4C7GA 1IT8A 4ZSTA 4FALA 2PGWA 4LBUA 3F03K 1JR1A 3ZLGA 2XVLA 4QLLA 1SJDA 2H9AA 1XH2A 5AYZA 4IP7A 3ID7A 1FCBA 2QIWA 3AMCA 2X8RA 3N19B 1RD5A 4O57A 2VCAA 3CMJA 2WSQA 2E4TA 3FDKA 2D3LA 3S5OA 3W7NA 3NOYA 4Z08A 3BQ6A 4KRZA 4MY9A 3FK4A 4QNEA 1A0DA 3UYCA 2GL5A 4Q4OA 1XIDA 4PUMA 4E4UA 2WCSA 4MKNA 4K39A 5CKSA 4IIEA 1Y5WA 1WDWA 1XCFA 3KS6A 1OFEA 2H9AB 3HBLA 3DYOA 1KNWA 1JYVA 5G4WA 2G96A 4PR4A 3VIPA 1TTPA 1W54A 3TC7A 4NNBA 4XZHA 4CCEA 2PDKA 3EDJA 5LNWA 4JX5A 1VCVA 2IPWA 4QQUA 2BG5A 1Z6KA 5GPRA 4FAMA 2AQWA 5I23A 3IAQA 4S3CA 4IMCA 1K4HA 3CPGA 4AWSA 4O52A 1AW5A 3OZPA 3MBFA 1WOBA 2PSNA 1X2HA 2ASHA 4PMYA 2VFIA 4A29A 4JTUA 4CQCA 2GJLA 4ZBCA 1YX1A 4NVTA 4YVVA 1HJXA 4HTYA 5BOEA 4M1RA 3EDFA 2E7FA 4UTJA 4WDXA 1KBBA 3KHDA 5BU6A 4PODA 3GVVA 4TR9A 3PZIA 3DX5A 1O60A 3GZAA 4ONVA 4FPSA 2BCPA 4GZIA 5JBEA 4P8XA 4IGHA 2RHGA 1GPWA 3T08A 4MSSA 1VJZA 2BSLA 4I7VA 3W1NA 2WNQA 4HCHA 4K8GA 4S3BA 1Q4NX 2H3DA 4YJ5A 2OU4A 4XZBA 1ZP3A 5KEZA 4OV4A 4NU7A 4DZAA 2XZ7A 3QEZA 3ZMRA 4ORIA 3D46A 4FLOA 4N9CA 3TU9A 2HS8A 3QGVA 1WO2A 3T0CA 1LVLA 5A8GA 3VIGA 5C71A 1QVBA 1UMYA 5BOFA 4GUFA 3CQKA 1LOQA 4JHZA 3R8HA 3LYEA 2GQWA 1N61C 1B30A 3VNMA 1RJRA 1BXCA 4Q4KA 2F84A 1TPH1 1ZX9A 1S2VA 1EP3A 1TMQA 3CQIA 3RX4A 4ZMGA 4XQ6A 3EX1A 5GNXA 1R46A 2ZE3A 1WUEA 3B8TA 4XIAA 3S6DA 2WPBA 2VZSA 1A0CA 1NU5A 3WLIA 1S5MA 3L2LA 6A3HA 3GXPA 4U31A 2VMFA 2QXWA 4AEEA 1Q6EA 2X50A 2WJFA 3KXQA 3O05A 4E4FA 3IIPA 1HGWA 3O6DA 1VFTA 1W9DM 4HOZA 2C0HA 4YXGA 2QVNA 3SI9A 3XIMA 4AD1A 3HG4A 2WZEA 4LAUA 5CZTA 4TX6A 4I7UA 2W0HA 3FNDA 4YCOA 5EBKA 1TPB1 3I3EA 4TOQA 4Q33A 2OLSA 4KPLA 3S5ZA 2HE5A 4Y2WA 3TN3A 4EPEC 2VX7A 4ATLA 2F6XA 1NSJA 2Z6JA 3R6IA 3WBYA 1Q45A 1B4EA 4QLKA 3AXMA 3GU1A 1EBHA 1Q6GA 4GXMA 1YLVA 1U30A 5EMYA 3CUZA 4CCZA 1D3GA 5HNRA 2Q3RA 3GDTA 1VEOA 1TYTA 4GUGA 1PBGA 3S42A 2VR5A 2A7RA 2WMIB 5A8OA 3OVQA 2OO6A 3S2JA 3G5EA 1E73M 4DUXA 2HWGA 2J6XA 1S3HA 1M6JA 3W22A 3O07A 3JW7A 1QPQA 4EKJA 2QAPA 1IWBA 4KKXA 1C90A 2Y24A 3QOMA 2YCEA 2FZMA 1ONEA 2ZRVA 3TZNA 2IPFA 3PVFA 4FLSA 1TO3A 5BRQA 3ISIX 1LF1A 3IGXA 5AN7A 3O3RA 1XUZA 4W8BA 3GXDA 3P5ZA 1L2UA 1H1NA 2EXOA 4RUBA 4PN2A 3W2LA 3NAVA 4TTUA 1EL3A 2Z1BA 3WO8A 2OEKA 3RRXA 4JIIX 4DXXA 5A6LA 3IV3A 3KDOA 4MFDA 1ZHAA 3WD4A 4HU4A 1NVMA 4FX9A 4NQ1A 3NWRA 4Q4RA 4C7FA 3N3MA 1NHQA 2XWDA 3P8IA 3DC0A 2Y63A 2FGLA 2YL6A 1IR2A 3NQ2A 1XRFA 4K38A 1VEMA 2ZZ4A 3SCUA 2NQ9A 1E6SM 3IIXA 1VYRA 4HU0A 3W9ZA 1HL8A 4NAFA 4J3SA 1KQZA 1HO1A 3QN3A 3CIVA 4YN5A 3STFA 4LYPA 4Z2JA 2QF8A 5B7ZA 3S5SA 5KINA 2PZNA 3TC6A 1GONA 3CHDA 3TCEA 2WZHA 3CIWA 3O6CA 1QT1A 3GW0A 1XXXA 3B8WA 2E77A 4DAFA 4M0XA 3WLRA 3ITGA 1F8MA 4RXFA 4D2JA 3LZ5A 2ABBA 4I9JA 2ZWYA 4KETA 4F2TA 3S9IA 2D69A 2QF7A 1P7TA 4NAFB 2UY4A 5AHNA 5H8PA 5AYIA 3VPLA 3CUXA 4YHGA 4MNMA 1RCQA 4H41A 3PUGA 4HOXA 2P0IA 3S2LA 1KFEA 1KLYA 4UTUA 5LZLA 4GZJA 4L9ZA 5DBTA 3BCFA 4GYFA 3OGSA 1RD6A 4RNFA 3RJYA 5CBJA 3FYPA 5A94A 1WDRA 4JTFA 1P7TB 2WP5A 1W5MA 3AO0A 2YCKX 4S3KA 4F0MA 4UTHA 3VKDA 1NF0A 2E28A 3ZR4A 4ZODA 4JX4A 3BV7A 1GYMA 1XIGA 1TPFA 1WXZA 3UF9A 3KS5A 4CNSA 3KL0A 1E0VA 1KM5A 1SO3A 1W9UA 1JRCA 4B4FA 1EPXA 1PDYA 3VGFA 3SN4A 4AD0A 1V59A 4O28A 1HJVA 1GETA 1CLVA 4GCXA 3CBWA 3CGBA 2VGFA 2RJGA 4RLIA 1K8YA 3CZGA 1CXEA 2AQOA 2ZZCA 5HR6A 4NF7A 1DJZA 3QMRA 4DELA 1XYBA 4IGNA 1HJUA 1Q3NA 2R1MA 4ZA0A 3HO8A 4L65A 3INPA 2PTDA 1EH9A 2A1YA 2JGQA 1P0EA 2PF8A 4JFTA 1G4PA 1I9CB 3KWSA 3C0LA 3GG1A 2HMCA 4NUWA 3SDOA 3A47A 4CVWA 3HV9A 3OBKA 5KTLA 1V3JA 2EQDA 4LEQA 1PZ3A 2GZXA 3B8VA 1ZS2A 1W5NA 4M29A 4J5NA 3EYPA 4JEQA 4O11A 3MP4A 4PMXA 3POCA 1VAHA 1WP6A 2X42A 4JS3A 5FS7A 3KCLA 1QHPA 1ME8A 1XYLA 3EPMA 2NWRA 5LA0A 3L65A 1V93A 3FVDA 5C70A 3NFUA 3MJMA 1STZA 4KCTA 1M6IA 5CSYA 1M7XA 2E67A 2VYOA 4US6A 4ZO9A 5KZ6A 3WLTA 2Y4SA 1FWNA 4ERIA 2FVKA 1W2PA 4HNVA 4C65A 1KM0A 4LALA 1WDQA 1DWJM 3SY8A 3HPFA 2XFWA 2V6OA 1E5JA 3LK6A 1IEIA 4AZ5A 3GUGA 1PX4A 1Z7AA 3PG9A 1UOZA 3NVWB 3PZQA 4PRRA 6XIAA 1WDSA 5I3DA 4GINA 2XM1A 3UXLA 3U48A 3ZR6A 2WB5A 3W24A 1TMLA 3W70A 1NEYA 5JH1A 5D09A 3H26A 3P6LA 3DEQA 3E02A 3IJLA 1V5XA 1KGXA 2UY5A 2R94A 4B5TA 1ONWA 3EOLA 2LLEA 3W38A 4MWAE 2VC5A 2OWWA 4JKLA 1P43A 2J8GA 4QITA 1LLOA 4Y9OA 3CV1A 1DIEA 4UMCA 2RDWA 4HCDA 3SIZA 2ZRZA 4RNIA 4WXYA 1KCZA 1ELSA 3SW6A 5C0QA 2EKGA 4POCA 1NH6A 1GYLA 1DJXA 5G2WA 4NJGA 2V5KA 3WLNA 3EZ4A 4MB1A 4P7RA 3AIEA 3QYSA 2ZICA 2NSOA 4Q8QA 1I2QA 1UR0A 4U33A 1WZMA 2JFEX 1J0KA 3F2BA 3TXZA 1XBYA 3D47A 1C91A 4H4UA 1T8QA 4AY8A 3UWWA 2BC1A 1ISVA 1XKJA 3ITLA 1MNSA 4X3ZA 1EPVA 2ZCGA 3SO7A 3TTEA 1XIFA 3N11A 5HQEA 3ECQA 2CLPA 3CPRA 2X1TA 1GEHA 2J4GA 2UWFA 2MNRA 2OZ8A 2Z7GA 3R4IA 1UD6A 5G1MA 1XS2A 1AH4A 4BZYA 2PBOA 1FH9A 3UA4A 1VYSX 1EA0A 1AOGA 1TFVA 4A3YA 1HKIA 5EL1A 4PCSA 2NUWA 1XC6A 4RE0A 4JTLA 3BMXA 1ZPTA 3VIMA 5D33A 2PUZA 1LWIA 1GK8A 1VH7A 1ZUAX 1UC5A 3AFBA 3L5MA 3A7UA 1YXYA 3S5NA 1V51A 3NL2A 1MUWA 1XYZA 3W2UA 2G41A 1GW9A 2CZEA 4JTDA 1N8WA 2TRSA 1EOMA 3P14A 4O17A 2XH4A 1XBVA 2X30A 4M24A 1UD5A 1T3QC 3EKLA 3GU9A 5AC5A 1CECA 5D2XA 2CC0A 4KWVA 3EEGA 1P6WA 1F73A 1LORA 3NTYA 3EWXA 4L6OA 1UB3A 4G9PA 2WNZA 1FWIC 3H23A 1UZDA 8CGTA 1DXEA 3TC3A 2NLYA 3W1TA 3BLLA 1LOSA 5SWUA 1LZOA 4AXKA 3KBNA 2A5HA 1ICSA 4HPNA 3SQPA 4M6QA 6CGTA 1JQXA 4LIIA 4LBRA 3WQ8A 4BF9A 4QHRA 3LM7A 2HNEA 2BHUA 4LV9A 2BXVA 1VPYA 4Q8PA 3AMZA 1VDVA 3BLFA 2HJPA 2P0OA 3UBPC 2BVWA 3H4XA 5DRIA 1ITQA 4ZB2A 1UG6A 5FJTA 4C1LA 4O0ZA 3HGOA 1U83A 1SSGA 3HQOA 3N2CA 1LG2A 3WUBA 5T8GA 2GOKA 4H4XA 4P7NA 3R12A 2ZUMA 1JYXA 2OX4A 1J4EA 1HT6A 3R10A 1L2QA 4ADWA 1KKOA 5F4XA 4XZMX 2XFFA 2UY3A 4DPQA 4DX3A 3HZ3A 1U1UA 2OGJA 1W1ZA 3STEA 4JIHA 4HMDA 4O12A 4XO7A 1JVNA 3TTOA 1FHDA 1E55A 2PDQA 2TODA 4NL1A 5FL1A 3GIPA 3B4UA 1K8ZA 1ZBVA 1ECEA 3V5FA 5H8UA 1KV8A 1XYAA 4HPJA 3B8SA 4HSNA 3R58A 3SJ3A 4R33A 5FKYA 1QNPA 3QPYA 4IP5A 3ATYA 5GRTA 3ME3A 2VUYA 4I6KA 3V0SA 4QIUA 2BB0A 3H2FA 1B3YA 3RCYA 1POKA 3IV8A 2ONEA 1P6CA 3WIJA 1AJZA 5CPLA 1P4CA 2QMJA 4CCCA 3M0LA 2TMDA 1YW1A 3A22A 4C7DA 4ML9A 2OB3A 2Z29A 4UCFA 2PDFA 3PFMA 1BWKA 3UWYA 3C56A 1EF2A 4UQDA 2OX1A 5KVHA 3W53A 4S3EA 2DW7A 2Z4GA 3S3GA 2WXDM 3M0IA 2VHLA 2BY1A 2DT3A 2E68A 1SR9A 3WLKX 3H4WA 4N6EA 3DUGA 3OZYA 4KWUA 2YA0A 3DJJA 2CLHA 4KCUA 1ZMCA 3PZTA 5TQLA 3TCSA 1YQ2A 2Q71A 1TWDA 1NDAA 4GX8A 3KLKA 3QGAC 4LB3A 3WLOA 4JFSA 4MNKA 1XLJA 4UTTA 3A9IA 1JCXA 4QBXA 3HGJA 3BSGA 3QY6A 4LY8A 5G2HA 3R89A 1GRAA 3QLDA 3RLUA 4UTWC 4JXCA 3GAKA 5KZEA 5A5WA 3AAMA 3RCNA 1SM9A 1W56A 3A21A 3BW2A 2PI6A 4ATDA 4ZB0A 1F3TA 4XAGA 3N13A 2BOEX 3I68A 2JALA 3VNKA 5HOSA 1BTMA 1FY6A 4GO8A 1LWJA 4HMCA 3GTIA 1C8YA 1OK4A 1RM6B 2E6FA 3VZZA 3QPZA 2WOQA 4I8DA 3L66A 3SZ8A 2A8XA 2GJNA 4HU8A 3EDKA 2FPTA 4CD6A 3GFXA 3VK5A 1YQZA 1UR2A 4D71A 1LQ0A 4G5DA 4WJXA 4R7WA 3UNTA 1N82A 5CBIA 1MQQA 3AZSA 3NGJA 4GQGA 1V0NA 1JCNA 2QQ6A 1TWSA 2PF0A 1A49A 1XJBA 1MZHA 2I9EA 1EJWC 1A5MC 2X0SA 3C2VA 3M0YA 1US3A 2FH6A 3CEUA 3PY2A 5ECUA 3MP5A 3EX3A 1B4KA 3W7MA 3W7RA 3CB3A 2TYSA 1UA3A 4C5YA 3KVMA 4JCLA 3V4BA 1OZMA 3TTQA 3N1AA 1W5QA 2NLIA 5IBXA 1BG4A 5F2MA 3L2IA 3WNMA 1FUYA 5I3GA 1GVFA 3GM8A 3PBYA 1X7IA 2YDSA 1DNCA 1P48A 3WLSA 1B3VA 1KFLA 2V3EA 1TVLA 5D03A 1E6PA 4C6NA 4LCRA 3N04A 1JDEA 3RU8X 1FP8A 5A6TC 1E9IA 2WBKA 4RV3A 1FXPA 3QHMA 5FSDC 1ZB5A 4H7CA 3LCLA 4IISA 4OBTA 2VEFA 3R11A 3F4VA 3ITOA