2PP0A

Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
395
structure length
395
Chain Sequence
SANSDAVTYAKAANTRTAAETGDRIEWVKLSLAFLPLATPVSDAKVLTGRQKPLTEVAIIIAEIRSRDGFEGVGFSYSKRAGGQGIYAHAKEIADNLLGEDPNDIDKIYTKLLWAGASVGRSGMAVQAISPIDIALWDMKAKRAGLPLAKLLGAHRDSVQCYNTSGGFLHTPLDQVLKNVVISRENGIGGIKLKVGQPNCAEDIRRLTAVREALGDEFPLMVDANQQWDRETAIRMGRKMEQFNLIWIEEPLDAYDIEGHAQLAAALDTPIATGEMLTSFREHEQLILGNASDFVQPDAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVHLHLSAAYPLEPWLEHFEWLNPLFNEQLELRDGRMWISDRHGLGFTLSEQARRWTQLTCEFGKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-talarate/Galactarate Dehydratase
publication title Evolution of enzymatic activities in the enolase superfamily: L-talarate/galactarate dehydratase from Salmonella typhimurium LT2.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 137
structure length 395
sequence length 395
chains with identical sequence B, C
ec nomenclature ec 4.2.1.156: L-talarate dehydratase.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2pp0A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2pp0A01
1EBHA 1SJCA 3N6JA 3R1ZA 1SJBA 4JN7A 3BSMA 2XH2A 3PFRA 2NQLA 2HZGA 2PP0A 3K1GA 3MUCA 1EBGA 1MDLA 3I4KA 2AL2B 2ZC8A 3HPFA 3THUA 3VCCA 3DFHA 3T6CA 1SJDA 5EU9A 3UGVA 3U9IA 5J04A 1W6TA 3VC6A 3N4EA 4GMEA 2OVLA 4ENLA 2OZTA 2OKTA 3RGTA 4E4UA 3P93A 3NZGA 3V5FA 3CT2A 2DW6A 4A3RA 3UCDA 4G8TA 4H2HA 3SSZA 2P8BA 2PTWA 2XH4A 3P0WA 1F9CA 3R10A 3NXLA 7ENLA 4GFIA 3S5SA 2GGHA 4Z1YA 2PCEA 4IHCA 1EC9A 2GGJA 3TW9A 4M6UA 1L8PA 2GSHA 3T4WA 2PSNA 2OPJA 3DG6A 3ENLA 3RCYA 2AL2A 2PS2A 4HPNA 4DYEA 1JCTA 3H8AA 1TKKA 3UCCA 1FHUA 4FP1A 2FKPA 3GD6A 1NU5A 2ONEA 3UXLA 1DTNA 3R25A 4H83A 4JN8A 4ZA0A 3D47A 4M0XA 4HCHA 1E9IA 6ENLA 2PA6A 3IK4A 3V5CA 4KT2A 2GGEA 4DHGA 4IZGA 4GISA 3VFCA 1R0MA 4GGHA 3QKEA 2MUCA 2MNRA 3OZYA 3V4BA 2XSXA 1XPYA 3MZNA 4A35A 4H1ZA 1TE6A 2QDDA 1EC7A 3TJ4A 4KPLA 2DW7A 5FJOA 3CB3A 5FJTA 4E8GA 3P3BA 4X2PA 4IP5A 3VA8A 4GYPC 3TWAA 4HCDA 3TQPA 2PGWA 3FJ4A 3FXGA 1RVKA 2P0IA 4K2SA 2XGZA 3PK7A 3QLDA 3OZMA 3FV9A 3Q45A 4E4FA 3SN0A 4E6MA 4IP4A 1KKRA 3GY1A 3UJ2A 2PU0A 3GC2A 4DX3A 5FJPA 4MKSA 3ZLFA 2OLAA 3DEQA 3I6TA 3PWGA 3RR1A 3R11A 1BKHA 2P8CA 4KWSA 3CK5A 2PTXA 2AKMA 1XS2A 1JPMA 2QVHA 2P3ZA 3VC5A 3ZLHA 3H12A 3BJSA 4DXKA 4GIRA 3DG7A 2HNEA 3H70A 2OX4A 3H7VA 3FVDA 2I5QA 3ES8A 3JVAA 3ZVHB 3TTEA 4HN8A 1WUFA 1P43A 4K1WA 4HYRA 1JPDX 3SQSA 3TOYA 2QJNA 3T8QA 4DWDA 3KUMA 4FI4A 1SJAA 4HNCA 3JW7A 3RITA 3UJSA 3PWIA 2OG9A 3NFUA 5FJUA 1MDRA 3STPA 3TWBA 3DERA 3CAWA 3R0UA 4K8GA 5IDZA 3R0KA 3UJEA 3ES7A 1KD0A 2QGYA 4A6GA 3IJIA 3FYYA 4YWSA 1KCZA 2PGEA 3MQTA 2QQ6A 3U4FA 1EC8A 4G7FA 2PTZA 2OQHA 2PODA 3ZVHA 4JHMA 2P88A 4Z17A 2QJJA 3OTRA 3NO1A 3DESA 3V3WA 3FCPA 5FJRA 3VCNA 2AKZA 2PP1A 3B97A 4ROPA 3OPSA 3DGBA 3Q4DA 3TCSA 1P48A 4F4RA 2PP3A 3OP2A 1YEYA 3MKCA 2PU1A 2OO6A 1PDYA 4HCLA 1MUCA 4MGGA 1IYXA 5BOEA 1MNSA 3SJNA 4E5TA 3DFYA 3ZLGA 3DG3A 4EWJA 2OZ3A 2OFJA 2O56A 1TZZA 3D46A 3MSYA 2HXUA 3JZUA 1JDFA 4J3ZA 3DDMA 2QJMA 1KKOA 3OW1A 4GGBA 2PMQA 3EEZA 2GDQA 2GL5A 1NELA 5ENLA 4IL0A 1ELSA 2OQYA 4H19A 3SN1A 1WUEA 3S47A 2RDXA 4MMWA 3IJQA 2PPGA 4IT1A 2AL1A 3MY9A 1PDZA 2PTYA 1R6WA 3GO2A 4IL2A 1OEPA 4DN1A 3QTPA 3T9PA 3N4FA 1ECQA 4GYPA 3DIPA 1BQGA 3UJFA 3UJRA 3QPEA 3UXKA 3N6HA 3QN3A 3ZVIA 3I6EA 3VDGA 2GGIA 2CHRA 3SN4A 4ZCWA 2FYMA 2XH7A 3IJLA 3SBFA 2ZADA 3TJIA 2POZA 5BOFA 2HXTA 2XH0A 4HNLA 3MWCA 3RRAA 1FHVA 2GGGA 1MRAA 4J1OA 3BOXA 3RO6A 4KEMA 3CYJA 2QDEA 2OZ8A 3CXOA 3EKGA 1ONEA
chains in the Genus database with same CATH superfamily
5AC8A 3BSMA 1DL3A 2QKFA 1YRRA 2WJZA 3DFTA 5I2UA 1UR9A 4HU8A 4PSPA 3NR0A 2HPIA 1EO5A 3VOIA 1RVGA 1XRTA 1ZK7A 4KW2A 4DVOA 4QQUA 1YXYA 2X0SA 5CC5A 1XUZA 3HZ3A 1BAGA 3B9AA 1HP4A 3BURA 4Z2HA 5K4ZA 1B3VA 4IQJA 3MHUA 3SSZA 1S3TC 7XIMA 2D0GA 3L4YA 5FSEC 3UPBA 3CV6A 2ZIDA 1IEIA 5EFDA 3Q37A 1TMHA 3G77A 1GEUA 5C5YA 5DMYA 4DJED 4DJFC 4E0CA 3A22A 3EX1A 3GFZA 4D8LA 4EQRA 2MANA 3A6OA 2I1OA 3TJLA 2V5BA 3B8DA 5I24A 4AD3A 1VB9A 5MHBA 3V1PA 4FIRA 1ZAJA 4MY8A 2X0YA 1PPIA 2I9UA 2WCAA 3D6NA 4O0KA 2XG9A 3ZT6A 1PL9A 4L9YA 2YCLB 1KTBA 2PDLA 4GI8A 3I7QA 1ALDA 2QCEA 3TTYA 4CUCA 2GWNA 4UNKA 5FD0A 2A7PA 4ORIA 3RK8A 3OU8A 1SR9A 1QU4A 4OKDA 3O07A 1TV2A 3OYXA 3WLHA 3WLIA 1X96A 3CUGA 1HKWA 4L6OA 1BXBA 3C2EA 3WUEA 3LENA 1TPC1 1P6CA 3OEXA 4ICNA 3VD7A 3CPRA 2AAAA 2YDRA 3GUWA 4GY1A 4XQ6A 5JRBA 4S3DA 2J78A 2O9PA 2YL9A 4YTTA 3A7UA 3PSWA 3T8LA 2YCLA 3N2OA 2ZUUA 1Y5WA 1TVPA 3CMGA 3FJ4A 3TOPA 2BHYA 3M44A 3KOZA 2B7OA 1O95A 4KWWA 3VNMA 4AY1A 2CITA 1US2A 2ZUVA 4ZOEA 1XBXA 2NT1A 4LUIA 5HPOA 2VX6A 1WXYA 2HCVA 1ZU8A 4EF9A 3KBWA 1D7FA 3JUGA 2PI6A 3QFAA 3ARTA 2OU4A 3PBUA 3F4CA 3G8RA 3QSTA 3TTSA 1QDSA 3NM3A 1KV8A 3A4XA 4FXJA 3HB9A 2VELA 5DQPA 1QR7A 1XDJA 4HA3A 4QR6A 5BWAA 3CGCA 3G1YA 4MVAA 4UTLA 2WPCA 3CO8A 1OF8A 2OOGA 2R6OA 1B3ZA 1MFVA 2I5QA 3ES8A 1UKQA 1P43A 2ICSA 4CVWA 4WD0A 1W32A 5L9FA 1KM6A 1TX2A 3O6YX 2R82A 4K7VA 4U5IA 3LHUA 4O4WA 3WJZA 4ALDA 2EAWA 1IT7A 3P61A 5AHEA 3PSVA 5DELA 1OIMA 1BXCA 4YHEA 5E0FA 4GVIA 2DPEA 3MCMA 3ICJA 4IGNA 3RMEA 2DJXA 4BEQA 4DJEC 4RX0A 3NFUA 4MLRA 2PDNA 1D7YA 4X2RA 1E6NA 3R0UA 1NF7A 3H2EA 1W3NA 3T0TA 1VCGA 5LXXA 1SMAA 3K4AA 1UD2A 1WV2A 3F2DA 3UGRA 3IVUA 3GVRA 5E0KA 2XVGA 3AMLA 4Q4SA 4JHMA 1J01A 4CU8A 2R1PA 1B90A 3K8LA 2BDQA 2REQB 3VCNA 1WP6A 4H9ZA 1D8WA 2FHFA 1O68A 4I9TA 1E15A 1FCVA 4W87A 2NQHA 4PCNA 3FJ6A 4ZXLA 3NJ3A 4GXWA 3N9RA 1A5BA 3RU8X 5C0QA 4M52A 2JQXA 5DY2A 4U4MA 1R3SA 2QCLA 2DZVA 3TK7A 5KMYA 2JEQA 2XUCA 4DNHA 3B8UA 4AF0B 2GOKA 3A13A 2OT0A 1VKFA 1ITUA 4XISA 4E5TA 3T2OA 2A85A 4L4LA 3DFSA 1SR0A 4L4MA 4NVTA 2V3DA 4J3ZA 3MP3A 4V28A 4M6VA 3OYZA 2PD9A 2UY5A 4JTRA 2VX7A 3BG9A 6PTDA 1A0DA 2REQA 2OQYA 1B1YA 1DBTA 1U22A 2J4GA 3RCNA 2E7FA 2C13A 1AD1A 2PTYA 2VDHA 1A3HA 1ISYA 2Q3RA 4IGSA 4Z08A 5F2IA 3F4WA 3SDOA 3N4FA 4Z42C 1KM0A 2FVLA 5GVJA 3WQDA 3O3RA 5LNVA 1XI3A 4NUWA 3B0VC 3EANA 2J8FA 3DIPA 5E1QA 3EEGA 2FDSA 2NSOA 4PL2A 1Z32X 3T07A 3UJRA 3UXKA 4AF0A 4EOUA 3M7WA 1ML1A 1JZ4A 3NRZB 2BASA 3LUTA 1XUUA 3W7MA 2QCCA 3F4DA 2YVGA 4MB1A 2DQWA 3AIUA 3UPMA 1RJQA 3VI2A 2EQ7A 3BLFA 3W01A 4D71A 4B5UA 1RLDA 3GNXA 3RG6A 1OC5A 1X8FA 3SO7A 2R14A 4HT3A 2V2HA 3LTSA 3O8AA 3KDNA 2INFA 1HX0A 1IZKA 4MB4A 5BMXA 2A7RA 1O1HA 1O7AA 4UC5A 5D2YA 5MF5A 2IXUA 3WL0A 2WO5A 3TDFA 3I4KA 3MCOA 3RM9A 1SVDA 3PNZA 3BPWA 1J0HA 2Z28A 4IGHA 2WMFA 3K4DA 3SRDA 1C8XA 1HXJA 3QC0A 4Y8EA 1HO4A 3UESA 1NWTA 3STFA 3KEHA 3M0XA 2VTFA 3DKJA 4TXEA 1A49A 5DMLA 1H49A 4WK9A 4XKMA 3SUSA 3NZGA 2YLAA 2G5WA 3V5FA 1UWAA 3UCDA 3MA8A 2J7GA 3OLDA 4N7QA 1JF6A 2DH2A 4BF9A 1PKMA 3WK3A 4V1XA 4ZO7A 1K8CA 4ZB0A 3W4RA 2FH6A 3DU0A 3DYMA 4D9PA 2CKRA 2XU2A 4Z1YA 1RR2A 4JR5A 3TROA 3G0XA 1DJQA 1OK4A 1UP0A 3GNNA 1UYQA 2CLEA 2G50A 3L4XA 3ZT7A 1OSEA 3VKJA 9XIAA 4ONVA 4UCFA 3HO8A 5CG0A 3HGOA 1BFNA 1JRBA 4IMDA 2ZRWA 1C9DA 4JIRA 1V5XA 4GCAA 1DTNA 3WFAA 1ISXA 3VOFA 2WWDA 3FHAA 4EVZA 1Y5XA 3AZRA 2E25A 3UBPC 2BG5A 1GUVA 4FOUA 4CU7A 1LLWA 2C15A 4GNKB 1KBKA 2H9AB 2MUCA 3AQUA 1SB3B 4X0VA 5ABTA 1SM9A 3SRFA 3AISA 4GY0A 3ZFHA 5A95A 4PB3A 3SCQA 3SFWA 3GD4A 2OR2A 2GJLA 3BICA 1I2QA 1XDLA 2DGAA 3A21A 1W1IE 5XINA 2DP3A 2ZX9A 3VIKA 1QBAA 5HR6A 2A3HA 1Q7ZA 3CU2A 2GDUA 2OO0A 3PTDA 1ICSA 1RVKA 3IIZA 2X41A 3MSGA 4MNKA 1NVMA 1W91A 2GVGA 1KCLA 2WSPA 3M0JA 3FK4A 1AQFA 3BWWA 4L7ZA 4JTQA 5U1OA 4IFRA 3G22A 4P8WA 4TO8A 3PBWA 2H9AA 5DXXA 2PRHA 1NIUA 1PVNA 2P53A 1KN0A 3VD3A 2J7FA 2PDFA 4UR8A 3R11A 4BQ4A 4EXBA 2ALDA 2ZXQA 3R8HA 5C9XA 2Y70A 4AISA 3DX5A 3N9SA 1Q45A 3M43A 1FOBA 1SQ7A 1EOMA 1MEWA 2JALA 3H70A 2Z2AA 3FLUA 2H8ZA 3MMTA 4MJ2A 4NNCA 1EA9C 4P5UA 2XVNA 1A0CA 3JVAA 2WJEA 5DN1A 2P1FA 1TG7A 3WK0A 4ZE4A 1CXKA 3WG6A 4C6MA 4C7DA 1WOBA 4XIAA 2XIOA 5G1TA 3NGJA 5DCBA 4UQDA 4GO8A 2GVJA 2Y5EA 3E2RA 4BA0A 4KWUA 1LYXA 3WMBA 4DZAA 1SYTA 4C6IA 1J11A 4DNAA 1KNWA 1M7JA 3KRBA 3W2NA 5FJUA 2XIBA 4IPIA 3AYRA 4UQEA 2NVCA 3AHVA 1W2PA 2FTPA 1XG3A 3GK0A 1HKJA 4NEVA 4AC7C 4DI8A 4PTMA 1KRCC 4G7FA 2PTZA 3WLRA 4IGMA 2P88A 2GQ9A 3DESA 3V3WA 1OGSA 1N55A 4C65A 2C1IA 2I57A 1IEXA 3JS3A 4OIFA 4AC1X 1ADDA 3IV3A 3CL8A 4GA8A 1IE7C 2OYLA 1XSJA 5F4XA 3APGA 1AZ2A 1V51A 3A47A 4EMIA 4PUMA 2E1DA 1ZTVA 1NAL1 5BOEA 5DRCA 1Q6QA 4B16A 3OIXA 1JGMA 1EWDA 1UZ1A 1JZ2A 5DCEA 3CUJA 1JIBA 3NEHA 4ZQRA 2ZRXA 4X9YA 1B3OA 3C0QA 3W7OA 3D46A 2HXUA 1EGMA 4S2CA 1ZBKA 4GPNA 1C9WA 3DDMA 3F4VA 3EEZA 4TTUA 3B06A 1GTHA 1UR4A 5A8GA 1A47A 1ZJHA 4J57A 5T26A 4IMEA 1NFBA 5AHMA 3RXZA 3II1A 3IJQA 4B15A 1F8WA 1R2SA 4HTYA 4LUTB 1V03A 3KVLA 3Q65A 4O10A 1E6ZA 2XIJA 3LPOA 1CGUA 3EOEA 3HIJA 4FX7A 4IWWA 3VUPA 1TPUA 3I65A 4DZIA 3EZ4A 4M1BA 2QEZA 3MI3A 1XYLA 1KCXA 4PUNA 3H7RA 4AIUA 1ENUA 4EQXA 3UWEA 2DUXA 3VPLA 4H4IA 2QMJA 5CZTA 3A3WA 3SCSA 3SI9A 5FEWA 3LQGA 1OY0A 4NZ1A 3HURA 4JFSA 3KOWA 1O5XA 3I7SA 4GHRA 4LUTA 3W83A 4WR3A 1UH3A 2ISDA 4GYJA 2NQLA 4JQ1A 1EBGA 1RV8A 1XGDA 4X60A 4EK7A 3N04A 1JD9A 2CC0A 3AIRA 4GUHA 3UY8A 5JXQA 4W8AA 4X63A 4WEVX 4AH7A 2X8GA 1J6PA 2R24A 3H6OA 5FS6A 5K9XA 3W1MA 3MO7A 3DBPA 1E3ZA 1W31A 3EKLA 4P7LA 4H4RA 1FHLA 3FEQA 1ICQA 3OLGA 2QJHA 1ZSXA 3KVMA 3URBA 3WF4A 4F0KA 3PR2A 2GJXB 5D03A 1FEBA 2SFPA 3WQWA 4PMYA 2YDAA 1P0NA 1TV4A 4I90A 1EKOA 1XCXA 3WQ6A 2XVKA 3VYLA 1F6KA 4RDZA 1XF0A 4CQ8A 2PSNA 4F66A 4NZCA 5I3GA 4JY9A 1H11A 3NVZB 1H1NA 1QWGA 3GNPA 3GBEA 3MSRA 4JCMA 1W54A 3MUIA 1H2IA 2QLYA 1ZCOA 3OGSA 3S6DA 1GPFA 5IM51 1DIKA 5CPSA 2CWNA 3NL3A 1CXEA 1XM3A 4LEFA 4M8UA 4EPEC 4H7ZA 2Y63A 1HW6A 1X38A 3ARZA 1ICPA 3CQKA 2A7NA 5K9DA 1E0TA 4TQTA 2GJXA 3QKEA 1W5PA 3RHGA 3GG8A 3V5OA 3VCRA 4XD6A 4AEEA 1FDYA 4QISA 3WQCA 3L4UA 2F9RA 2C3DA 1TE6A 1S38A 3M6DA 2GUYA 4HOXA 1GHRA 1T41A 4JIPA 1KM1A 5CAHA 2RABA 4GJIA 2JGYA 3REQB 1DJNA 4UFMA 1J2WA 2WZMA 2VCBA 4K2SA 2CFFA 2OJPA 3PK7A 3SIMA 4AZIA 3NVDA 3TYZA 2WC3A 1BHGA 1Q85A 1E9LA 2PF8A 3FA5A 4XBSA 4W8LA 3W38A 1WDPA 3VGGA 1KKRA 1ZJBA 2FZ9A 1S2CA 4C5YA 4DX3A 3N3MA 4B5NA 4K37A 1NHPA 4QDMA 5GRTA 2X40A 8TIMA 1R5YA 2V9DA 2C1GA 4FB7A 1E6SM 2ADAA 1I75A 4GBUA 3NIYA 1XYAA 4UQCA 1MUWA 3BJSA 4XAZA 3LGDA 3GC4A 1N60C 3LDVA 3REQA 2GJNA 4NJJA 1J8VA 2C16A 3L4WA 4MLJA 2IQTA 4MDPA 4AMCA 1WUFA 3H23A 3LHZA 3DK8A 2EO7A 3SQSA 2OEMA 3PUEA 3G0SA 1KQYA 3GDRA 2QF7A 3OO2A 5CSYA 2CBVA 3WMLA 1VFTA 4NYUA 3B0XA 1JYNA 3ALFA 3NDYA 3EXRA 2ZVIA 3RLUA 1MW0A 1VD6A 1CYGA 1UR8A 3TLQA 1WNOA 3SGZA 5E93A 4HA4A 5DO8A 3AICA 3CAWA 4NYYA 4OUIA 2VVSA 3JRKA 3W1PA 1VH7A 4M5PA 4A6GA 1VQZA 3C3UA 2PDCA 4LCSA 2R1KA 3FKKA 4TVDA 1K9EA 2PUZA 3QOKA 3L5OA 3WF2A 3WFLA 1GOXA 4KGLA 1AA1B 2CXGA 2WHJA 2DDXA 3P74A 3QOMA 4TX8A 4A8IA 3KCLA 2ZZ0A 3NQVA 3Q6JA 3NXFA 1JDEA 2I14A 3GU1A 4J35A 1VJIA 5CSSA 3N25A 1XLGA 1Q63A 2J27A 4DYJA 2ZWYA 2CLHA 7PTDA 3H4XA 5T9CE 3WBEA 4ICMA 4YLWA 2HS8A 3DK9A 5FCZA 5C6MA 1KGUA 4CN6A 1GETA 3AMCA 1NM9A 1M6IA 1XSIA 3G3MA 4AHQA 5FIPA 3JU2A 3L4VA 1O5QA 1S2TA 2ZE3A 4JX5A 3S0CA 3T0DA 4Q6XA 3S9IA 1Q4NX 3TQKA 4AIEA 4HPHA 3WIJA 2Q02A 1PTAA 5KEZA 2Z1XA 1E55A 1VFLA 4GGBA 1EQCA 2XTKA 3Q67A 1UKSA 3K4WA 4TV6A 3HGSA 2ZX7A 4Q7IA 3WLQA 1HVXA 3AIBA 6REQB 1EYWA 4H8HA 4NI3A 5I06A 1JPKA 4AD0A 2I7GA 3ARSA 2IPJA 1OEPA 5GNYA 1HJXA 1CI1A 4LEQA 3W9ZA 1ECQA 1XLIA 3RYSA 3RPMA 3MW7A 1LRTA 4Y9AA 5M2FX 3VGBA 1UB3A 3NOYA 1LLOA 1U5HA 3WDJA 3OQEA 4H3DA 3IUDA 4ZCWA 1NWUA 2E9MA 3VNJA 2BWGA 1SGJA 2EXOA 4F0HA 3IJLA 3M0VA 3TH6A 1C8VA 5EMYA 1V02A 3WDIA 1E1FA 1QPOA 1F3TA 4HNLA 4YU1A 1R46A 5H6HA 4J28A 3U6WA 1XICA 3GQYA 3W3OA 3KAOA 1MQPA 5CLTA 1MI3A 1VGAA 3CIWA 4KEMA 4GH1A 4M6PA 6REQA 3A24A 4JTDA 1QNVA 4KIRA 5A2AA 4QDPA 4WJ8A 1TYTA 1FWDC 2XIQA 4V1YA 3GAYA 1KXQA 3M5ZA 1TMQA 3B9OA 4Y9PA 4F3HA 1XBZA 1EP3A 4AZ6A 1YLVA 2NXGA 2XN1A 3NZPA 5I79A 1J2BA 2BY1A 4GI4A 2PD5A 4JPGA 3NO5A 4NJHA 4K6AA 1T8QA 4IQEA 1D3CA 3H53A 5FS7A 2DJLA 3GB6A 4N42A 2FVMA 5I23A 1XKYA 3T55A 4CCDA 1CLKA 4AD1A 2WNWA 5JH1A 5D38A 1NEYA 3NQAA 3RNDA 3W76A 1K8YA 1YW1A 2NVDA 7ENLA 4LT9A 1LROA 3UYCA 1TPEA 2JF7A 1EO7A 1YDYA 1UG6A 3MBDA 1JL8A 5C8BB 4MWAE 4JNZA 2BX7A 3VIGA 3N2TA 3DI0A 3RCYA 4UQBA 2F84A 3W2KA 4CN1A 4QEEA 1XH2A 1XISA 4R7OA 3UCCA 4QE5A 2CESA 4PH6A 5E6YA 5AYXA 1H41A 3EDDA 3AOFA 3QGAC 3HG3A 4MFDA 4MJ4A 3U5UA 3UR7A 2PC4A 1NOWA 3T2PA 1UPPA 1YXDA 5HNUA 1UQYA 5CGMA 4Z2LA 3RNMA 3FY1A 3ZJ6A 1RD5A 3AWNA 2HBVA 1TTIA 4KT2A 1XP3A 3TXVA 4RNIA 1DJYA 2TMDA 3LI0A 3LX9A 4PMNA 4WKAA 1U1UA 5FAJA 4AVFA 1A5SA 3WCZA 4B4FA 2O0TA 3RAOA 3AXHA 4A35A 1K8ZA 3QV6A 4H7VA 4IIGA 2DT3A 2A3CA 2E5BA 3FAXA 5AC4A 4KERA 1EC7A 2BHZA 2ODOA 2WYSA 2VHLA 3O7UA 1AH3A 3U2ZA 1KO0A 3CUHA 3G1XA 1DVJA 4BV6A 2HTMA 2XM2A 3ABXA 2V5LA 4KCVA 2IKGA 4UFIA 3DCPA 4O1AA 4AXKA 4NI8A 4H4SA 1R3QA 4O1FA 2WOQA 4S39A 3VIMA 4WUIA 2XVPA 1UJPA 5FMHA 5K3VA 1KR1A 2QUTA 4I9MA 1Q6CA 1I2RA 4FS9A 3S6TA 2VEMA 1IR2A 4ES4A 2B0MA 2V2DA 4LUJA 2G4FA 1MUMA 5LIYX 2GVEA 4F9DA 4PMDA 4IJRA 5TR3A 3EX2A 1RPKA 4NILA 4GFSA 1OG0A 4KIEA 1XGZA 4LY4A 2YYUA 3H12A 4Z0JA 4BFAA 1JZ6A 3TE9A 1W1ZA 1CX9A 4LVFA 5H1WA 2ON3A 4JIQA 2I17A 1KB3A 5AC5A 3H2AA 4HHLA 5AYYA 2W0HA 4NX5A 4IPJA 4BI5A 3P5ZA 5C9RA 3U48A 4OGZA 1VEOA 4M6QA 4CU6A 3KLLA 1XIDA 3H26A 1R7AA 3DJJA 1UR0A 1YNPA 2QJNA 3AWOA 3G1VA 3E0LA 4PODA 1HO1A 2Z1SA 4V15A 1VFUA 4EMJA 4NASA 1SZGA 3GLCA 3SEPA 3W6YA 4EAMA 3IAQA 1TPVA 3H54A 3U2CA 4QS6A 2ZXBA 5FEXA 1QJWA 3LCXA 5DANA 1DWFM 1X1OA 2J13A 3T1GA 1DIOA 2Y62A 3WQPA 1MEHA 3FOKA 4O1DA 3W00A 1IR1A 3PAJA 4YCPA 2E5CA 2ACUA 4UTMA 3GNRA 3VNKA 2Y8UA 2A1YA 3KFTA 3RRXA 3W07A 1P0BA 1A5UA 5KTLA 1H5VA 1DJXA 3BL3A 3SIZA 3EWBX 3NQ6A 4DAFA 1J79A 4LBUA 3WLPA 3PZNA 1W3LA 4ROPA 3MO4A 4QXIA 3TCSA 4K7ZA 2A2IA 5DXYA 4MYXA 1JI2A 3LRKA 1S5NA 4C7FA 4K8HA 4BURA 2EPMX 1XCWA 2TPRA 2PU1A 4EP8C 5HMFA 3ANVA 3BE7A 5DT7A 4NSBA 1SZRA 2D0HA 1V7YA 1GRBA 5D32A 2PWDA 4U31A 4B9ZA 5A94A 4QNEA 1VRXA 3B04A 4YWOA 5GJMA 1BVNP 5G5IA 5B7ZA 2VI0A 2CLIA 3OA5A 4JFWA 2J77A 2RGLA 3VU2A 3LN3A 4P7RA 2VEFA 3P2VA 3DFYA 3NQ8A 3HTWA 2GDVA 3EPMA 4Z1DA 2QDGA 1TZZA 3C0JA 1W3TA 5J5DA 5HATA 1XLKA 1VPQA 2FPVA 2H3DA 1GNXA 5DBUA 2PRLA 2V3EA 4JTUA 5HUPA 1NARA 1YBQB 1PWMA 2CCRA 1P1XA 1HL2A 1SMDA 1W3IA 4LS2A 1FHDA 1XQKA 5H2ZA 3URNA 1J0JA 2QIWA 3DC0A 2VUYA 1F74A 1AJ2A 2VZOA 1STZA 4A2SA 4IJCA 3ZJ7A 2XJ7A 1LOSA 4DZ5A 5IFTA 3CZGA 3LLDA 4GD0A 2WPEA 4YTUA 1QI2A 3POCA 2CHRA 3ZR6A 2X8HA 3WN6A 2UBPC 2G97A 1L9WA 1HTIA 5JBFA 5FF4A 4D1JA 3VGHA 3MTWA 4PUEA 2PBOA 2VZUA 1YBQA 4QE1A 4AYGA 1RZMA 3W26A 4CD6A 2C18A 2FB2A 1P0EA 3IGUA 4GBDA 3K13A 4FR1A 1ZHAA 3CYJA 6CGTA 2GOUA 3QF0A 2HRWA 4OZOA 2RUSA 3WH9A 3QFBA 4NF7A 4MWAC 3LA4A 5F4WA 3OZOA 5AOUA 4YTRA 2DV0A 1AZ1A 2ZC8A 1PKYA 4WDWA 1WO2A 5A6LA 3DFHA 5IHSA 1E0UA 3KW3A 4QG6A 3VNDA 4R7WA 3SUUA 3STEA 2DT2A 3HMCA 2YIHA 2YW4A 1V4YA 4IG2B 2VT0A 3UG3A 3MYPA 2ZX6A 5EGRA 4H4WA 3M46A 1XLLA 3QSRA 3CT2A 1NDYA 2KAUC 3UWYA 1IIGA 4AVNA 4H2HA 1MO0A 3PPCA 1PHWA 3FJNA 3SW6A 1NSJA 4YL2A 2WKJA 4A3QA 4XZIA 2DU2A 1XX1A 3P8IA 3P81A 3H4KA 3NSXA 2EG6A 5EFFA 1CBGA 4B5VA 4UFHA 2ZQ0A 3F7JA 1LBFA 4HN4A 3EKZA 1NDVA 4H2CA 3ENLA 3NURA 4KBXA 1V3HA 4DUOA 2XM1A 3RILA 3DFPA 1AFSA 3RX3A 1TWZA 4UMAA 1KM3A 4PCSA 2GJRA 2HVNA 4PMQA 4DYEA 4I5UA 1WXZA 4BZYA 2G4JA 3LS9A 3AZSA 2Z1WA 3E2QA 4GYFA 3UERA 3GD6A 1DE6A 4IG2A 5CZSA 3PG8A 3HPZA 4O8AA 1XHGA 3QTGA 3R8RA 2H90A 1J0IA 2VO5A 5E09A 1SZEA 3ZMRA 1VYPX 3QHNA 3W7HA 4GISA 1R7OA 3MV11 2YW3A 3DI1A 4JD4A 3R07C 1DQXA 1ME8A 5D9OA 3QYQA 4WSKA 4OOZA 3DFOA 1V8EA 4RE3A 2G3IA 4GKTA 5AC7A 1NDWA 3M0LA 2J8GA 4IM4A 5I6SA 4NXKA 2ZX5A 3G1SA 1KBLA 3GTIA 2IUZA 5H91A 2VOTA 3N2CA 4NY2A 1B5TA 1T6MA 3HV9A 4R34A 1DQUA 2EJAA 1BYDA 2OGJA 3H2FA 2J7DA 4JFVA 3W7PA 2FGBA 3GKFA 1L6FA 1AJZA 4LANA 3WH6A 3A12A 3KTSA 4YWIA 4W86A 3W74A 1XXXA 2OGYA 5HJYA 2VR5A 4IFOA 3O15A 3QLDA 2A8XA 2X1TA 2Y8VA 2OLHA 3SN0A 3CAQA 2OEJA 3CZKA 4GR1A 4FIQA 1YPIA 3FG2P 2PU0A 4IUOA 2R91A 3U7VA 1ODZA 1CXLA 1X1ZA 2OLAA 1HGYA 2OEKA 2E0PA 1J0YA 4XZLX 2YDQA 4A3HA 1LWJA 5TF0A 3JR2A 1ITQA 2BODX 2JF6A 1E4IA 4MHBA 1K6AA 5HNTA 3QY7A 1M03A 1OIFA 2ZOXA 3VDAA 1FWTA 3S2NA 2QCFA 1GGOA 1DTUA 4RNHA 4EE9A 3NUKA 1FWNA 3VVGA 4E2DA 1C8QA 2W3ZA 4DJDA 4LF2A 2WW5A 1IV8A 4B5WA 4LVDA 4WY0F 4AWSA 3K2GA 3EB2A 5KZEA 3G1HA 5LNWA 1KWGA 1HKIA 1ZY9A 4ZFCA 1I45A 4PR4A 2CW6A 3GW3A 4HNUA 1OFEA 3QEZA 4H4ZA 2GFTA 3DHFA 1TJ2A 4CQDA 3L0KA 3LCWA 2C71A 4WY0B 4N9CA 1FWIC 4LRTA 3V0SA 1KXHA 3LV5A 2J88A 3KDOA 5EY5A 1XD1A 3ZXWA 8XIAA 2RGMA 2YCJA 3LB0A 3FSTA 5T8GA 4PFMA 3RU6A 2RKXA 3CHFA 3FFSA 4POCA 3WKZA 1TREA 3IIPA 1POJA 5LHFA 2C19A 3O6DA 4U2ZA 1HUVA 4Z1BA 1GQIA 4H6KA 1PYMA 1ZALA 3WBXA 2PURA 4JAWA 2PODA 4HYVA 1N62C 1TUXA 1FH7A 3VO0A 2QJJA 3EOLA 4HSHA 3HRDC 3H4WA 3I3EA 3CGEA 1IXNA 5KVIA 3N2MA 2HE8A 4MAVA 2YBUA 3H7UA 4RPQA 4LBRA 2AKZA 3TP4A 1HP5A 2GR0A 1EB3A 5D9NA 1EA0A 3ZSSA 1UW9A 1G4PA 3FDKA 1KGWA 3OPSA 2BHUA 4WY0A 3AJ7A 1P48A 3PG9A 4L1GA 4O52A 2DH3A 4PBEA 1CGVA 1J5SA 1GVYA 2FMNA 3F4NA 4WZHA 1RJRA 5A8PA 5A3HA 7A3HA 4G7EB 1DXFA 4PUDA 4HCLA 4ZTXA 1Q1WA 2G96A 3B8IA 3W7IA 1JAKA 4HJFA 1U83A 3WNPA 2PZ0A 2OX1A 3HBLA 4AD2A 2WHKA 4PRTA 3UZWA 1GQKA 1NQKA 3SECA 1M7OA 4RNFA 4HD5A 2OZ3A 4J3WA 3MDWA 1Q8JA 3P6LA 1ZBCA 3QVQA 2CHOA 4AX6A 2NQJA 4S38A 2QJMA 1RCQA 3QFEA 4W85A 2F7FA 2VVNA 1QK0A 3C3NA 4C1NB 5D2XA 2WC7A 2RJGA 1FCUA 4HA0A 1QT1A 1G94A 4CQAA 3CEPA 1X39A 4JX6A 1VLWA 3ABRA 1UWTA 5FESA 3PUGA 1Z7AA 3W7NA 4DBEA 3B0UX 2V81A 1MO9A 5BNKA 1F7BA 3S8HA 1LL7A 2DT0A 2VGGA 3VMNA 4G7EA 1XLDA 3QTPA 1SSGA 3AALA 4RZBA 5DX7A 4ORMA 1DOSA 1GRAA 3UD6A 1T0OA 2WPBA 3S9YA 4QX4A 2VWTA 4ZQMA 4J5NA 2NSXA 3CT7A 3W0KA 2G3JA 1QO2A 1N8WA 1GRTA 1U1JA 4IIFA 2FQIA 1Y0EA 3ANUA 1GHSA 1ZJIA 2HXTA 3BLIA 4IMFA 4C1NA 2GVLA 1KFEA 2WB5A 1NF0A 3CGBA 2ZTKA 3ME3A 1XFCA 1G1YA 3UWVA 1TPB1 3BOXA 1GQJA 1LCOA 4LSBA 1OFRA 2W3RA 5G5HB 3CXOA 1UROA 1XIFA 4GVFA 1B3YA 4Q4OA 3NQDA 4HPXA 1XYCA 2V5DA 4U5KA 5FF2A 5FS8A 1WKDA 2CLFA 2YFOA 1R2TA 2Z2UA 4J27A 3VE7A 3ITTA 3VK5A 3EXSA 1CT5A 4EXQA 2H6RA 4RR4A 4EQWA 2VRJA 1IT0A 3HPAA 1VBRA 1XH0A 5C2CA 3VCCA 3T6CA 1SJDA 5I5RA 5CKSA 5A2CA 5EBUA 1I4NA 3GHRA 4JTLA 5CGQA 2Y8KA 5BXPA 2QYGA 5EA9A 2AGTA 3E0IA 5BRBA 3BGGA 2ACQA 2CHNA 2EPLX 1HFBA 4CNSA 3C52A 5GQBA 3P93A 2XZ7A 1THFD 4QE4A 1XLEA 2FIQA 3TX9A 2AQOA 1HJUA 3IVSA 3GHUA 1AODA 4ZR8A 3CLMA 2TAAA 5GNZA 3NXLA 4UOQA 1EFZA 4G1KA 4S2BA 2LLEA 3M5XA 1X6NA 4OBTA 4LNCA 3RDKA 3O2LA 2X1SA 4JYFA 2O7QA 3EA1A 1C93A 1XBYA 4B3LA 4XV0A 3BGAA 2Q8XA 2VR2A 4REQB 3MCNA 2ZUTA 1M7XA 1T8XA 4IF2A 4A4AA 4GNVA 3UA4A 3NQEA 1XL9A 1LWIA 2V2CA 5LIKX 3EDEA 3WLKX 5HXMA 1ZLPA 4RE2A 3QKZA 2IKHA 5KZ6A 1R9YA 1HQTA 3D47A 1O94A 1RBOB 3MYOA 2X7WA 2H8XA 4ZO8A 1H50A 4I5RA 4EF8A 3ARXA 5FSDC 1LZOA 3HGJA 3RM4A 3W7QA 4INFA 5ABEA 4R33A 2MNRA 2C0HA 1NFPA 3OZYA 1MVYA 3QMTA 4FA3A 4LB4A 3LTYA 3PPFA 1E0VA 1NDAA 1WKFA 3AU2A 4Y9NA 1W3HA 5FJOA 4AWEA 4REQA 1PYFA 3MP4A 4HZ8A 1E6PA 3W7LA 1JULA 2ZDSA 2RAGA 3S46A 1OYAA 2TPSA 3ETRB 3TWAA 3MUAA 3SADA 4S3BA 3WQVA 4H6EA 4M29A 2Z7GA 4W89A 4XZWA 3BARA 3EPOA 5U7SA 4E6MA 1SFJA 3INPA 1OD0A 1BKSA 4ZTYA 2VKZG 1W8SA 4AQLA 1S7MA 4LUYA 5M1TA 2DQXA 1MFUA 3HG2A 1B30A 1P6BA 1XRVA 1GCYA 4O4VA 3W28A 4MIMA 5AY7A 1BKHA 5E9XA 1PJ9A 4PMXA 5EMKA 1JYWA 1OD8A 1LT7A 1CW2A 3RPTA 4LY8A 1WOAA 2BOEX 3ZLHA 4KEVA 1FWJC 1NH6A 3U0HA 2OX4A 3FVDA 3THCA 1A3WA 1XIMA 1OX5A 1UD3A 3GH4A 3W7CA 5I0DA 5TQLA 4HN8A 2VC9A 5AN7A 2WKLA 5AYIA 4K1GA 4DJDD 4EACA 3ERPA 1EP1A 5AC6A 4W9TA 3ARQA 3VE9A 7CGTA 3TOYA 3TTOA 3TKFA 1QNOA 4HPGA 5AYBA 1BYAA 3R7MA 4AVOA 1NWSA 4Q8QA 1FDJA 4JFUA 4AB4A 3I68A 4X9SA 1P0DA 3IS4A 1FFVC 3RITA 2JEPA 1Q5MA 3K1DA 4H9UA 4U2YA 3K8MA 5G5GB 1KV5A 2FTWA 5TBOA 1NHSA 1EF2A 3VDHA 2QCMA 1DHPA 1HJWA 4Q4MA 2WCGA 1G0CA 1FWAC 2PGEA 2F2HA 2B31A 4MTVA 4OV4A 3GZ3A 3LMYA 5CPNA 3UXDA 3O63A 4Y2WA 1UA7A 4CNOA 3GDTA 1VYSX 2CNCA 3CM4A 2FPTA 4YHGA 1E9ZB 1E6XM 2Z25A 3OQ8A 2IKIA 3WNNA 1FWFC 3B8WA 1ZDLA 1GXFA 3OBKA 4R9OA 4JTEA 1R87A 2Z24A 3SB0A 3DC8A 3B97A 2D2JA 1FFRA 3WO8A 1J0ZA 2BFGA 3MVIA 4PGLA 3EDKA 1JDCA 3TNOA 3WEZA 1YKWA 3O9NA 1I6NA 2INEA 3EDJA 4NZ3A 4U33A 4UTHA 3AM9A 1AW2A 2EJ1A 4RE4A 5CZ0A 4LVBA 5J8LA 3UEQA 4DIAA 5D2VA 2GQAA 1VBGA 2FZBA 2O56A 3CL7A 4JTFA 2W61A 3H4GA 3JZUA 3L68A 2YZ5A 5CSUA 3BCJA 5XIAA 3OW1A 3W6LA 3GC5A 3TQ0A 3N19B 2GDQA 2YX0A 1TO3A 2W27A 2YFNA 3VKKA 5JCMA 1TE1A 3S47A 4UMBA 5DLCA 4NJKA 1XLBA 1EDTA 2AL1A 2HVMA 1PDZA 3AYSA 1PXGA 3WEOA 5E6ZA 2OZ0A 5KZDA 5I3FA 4JOMA 4NJIA 3BLPX 2J75A 3L23A 2HE5A 3R0DA 5HANA 1DIEA 1FWCC 2VQUA 4WOQA 1FXPA 3IRDA 4YS1A 5EMUA 4ASTA 1YYAA 3VD5A 4AHOA 3N6HA 2NXIA 3SQPA 3AHXA 2V6OA 2IPGA 3BANA 3E1F1 1EJTC 1SO4A 5IDIA 3T40A 5FACA 1Q8AA 2F38A 4FOKA 1LUCB 4Z2KA 2ZADA 1EOKA 5DCDA 1ONFA 1I8JA 1AH4A 2QULA 2NT0A 1Q6LA 3VKDA 4QHRA 3W24A 3M0YA 1VBHA 5JU6A 2QDEA 2QUMA 4CEXC 1QATA 4JN7A 1IEQA 3BJTA 3RIKA 4BR1A 1QHOA 1R9XA 1QPRA 4ICCX 3NQFA 1JCLA 3S9ZA 2WJFA 4F0RA 2W0UA 4RE0A 1RSCA 5F7UA 3IJ7A 3H2CA 3NVYB 4GJJA 3UGVA 3FVMA 1US0A 3NDOA 2EHHA 3UCQA 4C6FA 5CBJA 2BZNA 3ID7A 4ENLA 1LUCA 4EANA 3CL6A 3WNMA 4BQ2A 3WF0A 3FS2A 3BAWA 2VFHA 2JKEA 4QJ3B 7REQA 3SRHA 4XO7A 3PB0A 1JUBA 4ZMGA 5A69A 5BWFA 4HVXA 5MKGB 1W3KA 4JHZA 1AMYA 1EYEA 4UQAA 2R1NA 4ROQA 3FYOA 4CVUA 3L66A 3TUUA 2ABAA 4B92A 3TW9A 1BEUA 2QF8A 1EGZA 3LPPA 1RALA 2I16A 1FCBA 2XWDA 4LTSA 3DG6A 2RJHA 4ZB2A 2G37A 3HG5A 1GEHA 4HOZA 3WBYA 1ZP3A 4JTIA 3SAZA 1LT8A 1JYVA 4TMCA 3HW2A 3E0WA 3PJUA 3ZM8A 2X2GA 2NVKX 4JEQA 1VZWA 1VBJA 2C6QA 1K1DA 1MZHA 4H83A 1W1PA 3SGGA 4JN8A 5LYRA 3LSBA 4C1KA 4JIEA 3IK4A 4ZFMA 4N6FA 5BXRA 3GXIA 3NGFA 3GYEA 3MUY1 1ZUAX 2XIMA 3SSJA 1AQMA 3WBWA 4KF1A 2PWFA 1R85A 2J47A 1A5LC 4GGHA 3VZZA 4GJ1A 3T0BA 5MKGA 4XAFA 4NXSA 4PUWA 2CLLA 5CLWA 4XD4A 2NVAA 4GWEA 1P0KA 3MZNA 2WJDA 2QAEA 3WL1A 3K46A 4A05A 4J40A 1B57A 4B5XA 1O1ZA 3VGEA 1XLHA 3PJTA 1W8GA 1GRFA 1H63A 2NQZA 5K9CA 2XPKA 3M07A 1PX8A 3VA8A 1CLVA 1GKQA 2BCPA 2PGWA 3XIMA 1F3EA 1UMYA 3LM3A 1OFOA 3ZIZA 3NL5A 3WDRA 3AHZA 3TYBA 7TAAA 3II4A 3S2LA 5FI8A 3T09A 1OZQA 4ADTA 1K3UA 1EJUC 1YNYA 2AMGA 1BYCA 2NX1A 1QWKA 1TSIA 4LALA 3O05A 1S5WA 4ZVJA 3THDA 3LCGA 1K4GA 3IIVA 1DWIM 4QJ4B 4V33A 5A8NA 5LGXA 3I6TA 4KWSA 4IQLA 3KP0A 3U57A 1F05A 3VOCA 1H0GA 1UOZA 1XKJA 4IP7A 2FFCA 1TTPA 4DXKA 4AYSA 5HOSA 1B9BA 3H2MA 1HKVA 2DSUA 4FX9A 4DY1A 2QZRA 3VAVA 1WB0A 4BF5A 4C90A 3V0UA 3CV2A 1S1PA 1IWBA 2UY2A 4JGDA 3VMOA 3MMDA 3W82A 2E40A 4D6DA 3PM6A 5LIXX 4I6KA 2X1IA 3TV8A 2CFYA 1EL3A 2QUUA 4W5UA 4MY9A 3LSCA 4DELA 2PWEA 1ZMCA 3C0LA 4HA1A 5CBBA 1H1YA 3L12A 2WPGA 4L6DA 3PPHA 2EKCA 2BNJA 1UWSA 1EJSC 3P84A 3ITXA 5IDZA 3R0KA 3N11A 1R38A 3WJSA 1TPWA 4H00A 3DOPA 2BTMA 3DGRA 2CXEA 3DKLA 4J2MA 1OK6A 3AIVA 1VJSA 4XX6A 4QAWA 3UZYA 3SGUA 4O1EA 1PX3A 6ALDA 4PEKA 3WQGA 5HA7A 5JCNA 4KETA 4ERGA 2XFYA 1TVNA 2VUNA 5CEWA 3KTXA 2R94A 3BSHA 4GRSA 3LU2A 3CTTA 3TN5A 5FJJA 4F4RA 5KSWA 1D9EA 3CEUA 1MRQA 1EHAA 1A4MA 2PTDA 4MGGA 4UXDA 3RR4A 5JUVA 4D8AA 4AZHA 1TZ7A 1OC6A 5ABFB 1I1WA 4H4XA 2JBMA 3WNLA 2X30A 2BVYA 3CQIA 1ZMDA 6TIMA 4TTGA 4MUZA 2X05A 3C2FA 4W4QA 3LNMA 3A9IA 3ATYA 4A3UA 1A5NC 1JDFA 3MUXA 1C90A 3SURA 5BU6A 1TJ1A 1HZYA 3THAA 1XLCA 1M7PA 3WNKA 1A3XA 1H09A 1RUSA 3LCFA 1A4LA 5CPTA 1RY0A 2Y7FA 3DFNA 1Q7QA 3OGVA 3VFLA 3NWRA 2PLMA 2CZEA 1AL8A 1U1HA 1HGWA 2PPGA 4CQCA 3WJXA 4F9JA 2NXHA 1K9FA 1W2VA 1UHVA 3AFBA 4IL2A 3GIQA 4A2RA 1TUFA 3GH7A 3T9PA 4M7SA 4PE8A 4GYPA 3CGTA 4JYDA 5EBAA 4HBKA 5FAGA 1ME7A 3DENA 1K9TA 3VKBA 3I4EA 5ABFA 3BAXA 4RV3A 2YXGA 3GVVA 4JNYA 4NQ1A 3I6EA 1UUOA 1WXJA 2QHAA 1X97A 4R5EA 1QHPA 4RW3A 4BCEA 4IMGA 1TWDA 1LLZA 2XZ9A 4AUBA 3SQLA 4I7WA 3IAPA 1ONXA 3MWCA 1UASA 1Z41A 3BQ5A 4GYKA 2HK0A 3PF3A 2VMFA 4BJHA 4GUFA 4LGXA 1GV4A 1TJ0A 2WQDA 2J6XA 3S5YA 3GE7A 3MUZ1 3BG3A 1KBIA 3CV7A 1OX4B 1BYBA 4XZMX 1EIXA 1OCBA 4H9XA 3W6MA 2XH2A 4UBPC 2X1UA 1MDLA 4L6HA 2J25A 3O6CA 1MXGA 5EL1A 4CD4A 1Z6KA 3QRHA 1O12A 5J04A 1W6TA 4OU1A 3LMZA 4NRSA 2WVVB 4GMEA 4ZOHB 3W7EA 5D37A 3GU9A 4O53A 4M7TA 2NW0A 4DBSA 4UZUA 4PL1A 3LK6A 3RO8A 3TIMA 2OKTA 3PZUA 4A3RA 2EGZA 4G8TA 4R88A 4XWUA 3AYTA 2PEVA 4D6JA 2O9TA 5JVLA 1U30A 2VXNA 3AIQA 4DBDA 1AD4A 5DMMA 2X42A 4JKMA 1MOKA 2PCEA 4IHCA 1JXKA 3A9BA 1L2QA 3MZ2A 4IMCA 3UYIA 1A5OC 1OX4A 3MI2A 4GIAA 1G4EA 2R9RA 2CZVA 2JE8A 5C70A 3IACA 4HP5A 1U2YA 4GACA 2WOVA 3FN9A 3NPXA 3G18A 3PS7A 4GUIA 1UWUA 1TYGA 4BQ5A 2QV5A 3FNDA 4MB5A 2DZWA 1CCWB 2CBUA 2WVVA 3M9YA 3WLLA 1EWEA 1NU5A 3AS3A 4HHMA 4DUWA 1CEOA 4M24A 5LZLA 1UCWA 4DWSC 2YR1A 2EQDA 4GQQA 3VFCA 3VDCA 4LC8A 4QCEA 3TA9A 1RP9A 2BVDA 5LNUA 4NG3A 3GIYA 4YVXA 1IQ8A 3SY5A 1BGAA 4QITA 3W81A 5G4WA 1WZAA 2CYGA 4H50A 3EF6A 1ME9A 1RH9A 2D20A 2VM8A 3QGVA 3IVTA 3TJ4A 4A8NA 4RXFA 3PNUA 4J3VA 4ZO9A 4FO4A 2J7HA 3LLXA 4DB7A 3IC9A 5IOBA 4S3EA 1XYMA 3TQPA 2D3LA 4Z1CA 3KL5A 4WCJA 2X50A 2VCAA 2XGZA 1OFDA 2VQTA 3BC9A 1HKMA 3Q45A 4E4FA 4GKLA 1AQHA 2ZE0A 3BLOA 3CUFA 2ATSA 5EB8A 1KBJA 1I2NA 1X7FA 2EG7A 2Y1HA 1S5TA 4JEJA 3CZJA 1H0IA 3ZO9A 1O4UA 3PWGA 3D3FA 3CK5A 4JYEA 3DH7A 1XS2A 3UG4A 5H8PA 3GVQA 4E38A 2P3ZA 3WSUA 3ONCA 3EWWA 2WANA 2HNEA 3W7DA 2ATMA 1MW2A 1NFGA 2YXXA 2ZA3A 2WK2A 4P8VA 1CXHA 1WDDA 3EMQA 4WKFA 2C91A 1JPDX 1MXDA 4JY8A 4OFCA 1C92A 1XANA 2BGNE 4H7CA 1JDAA 1S5VA 1LQAA 4QIUA 2B81A 4FSAA 1UR3M 3KBVA 1VHNA 3M0IA 3GYCA 2A21A 5D8WA 1E71M 3O0FA 3GM8A 3TW6A 1M1BA 1XIGA 4JQ3A 3MDUA 2WQPA 1KFKA 4RNJA 5G2WA 1LOQA 4BWLC 1T40A 4XUGA 4WRHA 3CZEA 3UVAA 2QGYA 3BVJA 3NQ7A 1UZ4A 4CQ9A 1JXJA 1LOLA 2BY0A 1EC8A 5IBXC 3V7PA 3EWZA 1L6SA 1W9UA 3N18A 1UQZA 3FCPA 3QPYA 1TCMA 4AG0A 3HFTA 2GUUA 2A4AA 3UT0A 2XN2A 5A8OA 4GX8A 2Z7KA 2ZVRA 2DZTA 3MANA 1JEZA 2PP1A 4B91A 1L0PA 3V36A 1R3YA 1G01A 2OT1A 3WMSA 4Q3MA 1K7XA 4XIMA 1OJTA 3T81A 2CERA 3WEMA 3L2IA 3W85A 5DFAA 4LX4A 3B8SA 4RK8A 4GC4A 3RN6A 1I2OA 1IZCA 4O11A 3S1GA 3I3DA 2PLKA 5HINA 4LU0A 1R3RA 3PVFA 3FA3A 4JKLA 3ZLGA 3M16A 5I03A 3LD5A 1KQZA 1IEVA 1TQXA 3WD3A 4IIHA 3MSYA 1WQ5A 5B80A 2W91A 3SCUA 3PZMA 3B0YA 1H4PA 2Z27A 2QCNA 3A5VA 3TW7A 2PDXA 3SN1A 4ZEPA 3CWHA 3IEBA 2JK2A 3P60A 3QR3A 4BI6A 1AL7A 4KGJA 2O4MA 2VDGA 1ZGDA 2OODA 1AOGA 1BG4A 4AU0A 4DN1A 4MZ8A 3IIXA 1QPQA 2HMCA 1X7IA 2BC0A 4CNTA 4GX9A 3H21A 1C91A 2WP6A 4QSHA 2W66A 2NV2A 2J24A 1BSIA 3ZQ9A 4IXHA 1MSSA 2Y6ZA 1T7LA 2J66A 5BRPA 1EGVA 4UTUA 3W71A 1RPXA 4XAPA 3S1UA 1YTDA 4QLLA 3S3GA 3UZXA 2CZDA 1SZNA 3N6QA 4PTVA 3S1XA 4MJZA 1M53A 3RRAA 2HK1A 4IJBA 1ZNNA 4NZJA 4XO6A 1OABA 1R3VA 4KCWA 1RD6A 1C29A 3UR5A 1UP2A 2C79A 1DKWA 3T4CA 4J3SA 1RM6B 1TZ9A 3P7YA 1ONEA 3EWYA 2E6FA 1PIGA 4HKPA 4RXGA 2UV8G 3MJYA 3UR2A 2GSEA 3ALGA 4LQ1A 1AK5A 3OOQA 3AI0A 3NSMA 3TZNA 2GQWA 1GVSA 3RLGA 3C2YA 3VC6A 3UA3A 3CB8A 1OFBA 1P6WA 2J9ZA 4Y96A 1PZ3A 1OCQA 3TYCA 4IOTA 2OZTA 3VX0A 4EM4A 3RGTA 2BS9A 3ABSA 5FOOA 1OGGA 3KBJA 3WK1A 2A3AA 1ZY8A 3KOXA 4JCLA 1MW1A 3OHMB 4RKAA 4UNIA 1Q13A 1XGEA 2YCKX 4UB9A 3KWXA 3DGZA 1DWJM 3S5SA 2Q6ZA 3O1NA 1EZ2A 3L67A 3C6CA 4B4HA 4DO6A 3TJXA 4W84A 1QBBA 4PB5A 4Q8OA 1YDNA 1UKTA 3UR8A 1VAHA 3LHVA 3HFYA 1XCFA 2WCSA 2GSJA 4LJ3A 4LNYA 4NU7A 3F2CA 5GPRA 1DORA 1QOQA 5C54A 1E43A 3RX4A 4YYFA 1XPGA 2DZXA 1ZRQA 2V5JA 5DF0A 3RF9A 3BLDA 3AHYA 3B9JB 1OADA 5HWMA 4A21A 5C7HA 5LIWX 1XIIA 3RX2A 1TR9A 1PIFA 1QO5A 3GX9A 1ITXA 3DHDA 1SO5A 1X6LA 4P2VA 4E2BA 2VFIA 1FQ0A 5F2LA 4Q8NA 3WD1A 1J9YA 2GR1A 3DBNA 2BP1A 4OOUA 1X98A 4F0MA 5HR7A 2V5CA 2XSXA 1XPYA 2D0FA 4Z1AA 2XIIA 3CWNA 1JCJA 4O8RA 1OFPA 3I3BA 1MYRA 4RUBA 1DE5A 4HJWA 3L8KA 3PN8A 1V3JA 3KL0A 4I8YA 1FP9A 1CGWA 1DNCA 3TEVA 2YA2A 5H8MA 4GYPC 1RP8A 1VFOA 3HQ1A 2VX5A 4KS0A 3H2OA 3R89A 1GK8A 3ORWA 3EOSA 1FH8A 4O50A 1XWYA 2J7EA 1E56A 5TIMA 4IP4A 3V0TA 3PHAA 2E9BA 4O16A 3GY1A 3ITLA 3UQNA 1CENA 4YVVA 1ZBWA 1GVQA 2EPNA 4FHAA 4XVDA 7TIMA 4C5ZA 1TWIA 2CWXA 4KPRA 2E3TA 3TYUA 1BLIA 2P8CA 2Q8LA 2HBXA 3EGJA 2XYLA 3EBVA 4AX7A 4L9XA 3L7RA 2OTDA 4I3GA 3DG7A 5DY3A 2E8ZA 4CCEA 1W5NA 2NLIA 2WXDM 3NEVA 1V6VA 4D2JA 1XDMA 3VIPA 1M04A 3ZVHB 1GPWA 3G2GA 4JTCA 4C6NA 4KRZA 2Y0FA 1R9ZA 4K1WA 5CPLA 2PWUA 4PMOA 2BXYA 3OA3A 1VIWA 3LCIA 3CYVA 1TELA 2PB1A 3DUGA 3IUHA 1OM0A 3MU7A 2XVLA 1KXTA 4AZCB 2V30A 2W5FA 1VR6A 1ITCA 2FHCA 2AGKA 3LQLA 1PIIA 3U8GA 2PDIA 3E6EA 3MSDA 3I6RA 3G5EA 3WDHA 3UJSA 2OG9A 3QJAA 4YVPA 2W9MA 3WK2A 1N63C 3DERA 4D6CA 1N7KA 2O55A 1EDQA 2L5HA 1LM1A 4GRTA 1UOKA 4HSNA 4PB4A 3T0CA 1E9YB 2OMAA 2FH8A 4G1NA 4YMZA 4D6EA 2NUWA 5GJNA 1NHQA 3V18A 3LGEA 2E09A 3ZVHA 1TVLA 5K4XA 2Z26A 1I0DA 1WX0A 2Y7DA 2Z1KA 3VGDA 2DZUA 2E3ZA 2XWEA 3DK4A 2DVUA 4AZCA 5I7GA 3EX4A 4KFOA 3DGBA 4PCPA 3Q4DA 3W7RA 2ISSA 8RUCA 2PP3A 1EX5A 2VEGA 3GXFA 1ODUA 5DT5A 4UTJA 2GPTA 2V63A 3N73A 4D1IA 4P61A 2QW5A 2QDHA 1ZBVA 4MF4A 2EEXA 3RJYA 3FAWA 1GQLA 2B7PA 3EOOA 1OVDA 4PBFA 2FMOA 3KHJA 1TRDA 4C6CA 5KZMA 1UUQA 3PTQA 3KRUA 4ZBCA 3KM8A 4TVCA 5CJNA 3L2LA 5HWJA 3BG5A 2QAFA 2NLYA 4HMDA 5FEPA 2VD8A 4AWUA 1LBLA 3W73A 3WD2A 3VIIA 1Q6EA 4GZJA 4ML4A 1E4MM 1XYBA 1O5KA 4IT1A 1M6JA 4YNGA 2HQMA 4US6A 4D6HA 3UG8A 4LFYA 1FX6A 1K70A 4PUUA 1W1TA 3K8KA 4PTXA 3WQFA 3AMDA 1JFHA 1WDWA 4L4OA 1DV7A 1KFLA 3ITCA 4AMAA 1CB2A 1CWYA 3IGSA 1GYNA 1B3XA 3A7AA 1CIUA 2PDPA 3WUBA 2GH5A 1IEWA 2HVOA 3SN4A 1UP3A 3KX6A 2GRTA 2VZTA 3S2MA 1PTGA 4RDVA 5HPCA 5E70A 2GZXA 2OLSA 3RCMA 3G8EA 3IWPA 2VFFA 4L1WA 1DWAM 5C2XA 3KZPA 1WBJA 4MPQA 3C8NA 4DZHA 3SUWA 4XTDA 3S6OA 3W53A 1S3HA 4UMCA 2WC4A 2V3GA 1BSLA 2CKSA 5BYWA 1BF6A 1SW7A 4AWTA 3N12A 1LTDA 3VMPA 2FLIA 1YX1A 4FX6M 3N6JA 1SJBA 3BOFA 1F6PA 3D0CA 1FFQA 1MZRA 4B2DA 3EAUA 4S23A 4AD5A 4M1RA 1B4EA 3PTKA 1E6RA 3GDMA 3L4ZA 3KTCA 1OHLA 1S5MA 3U9IA 1W56A 1M68A 1QI3A 1GKRA 4ILSA 4MWAB 3QV8A 4LAKA 1OB0A 3QQWA 3L65A 1RQEA 4KCTA 1WAWA 2P8BA 1QCWA 3AYVA 1EIBA 2A6NA 3P0WA 2O7SA 4QFUA 2Z1BA 3RPDA 1KM5A 2AQWA 4GFIA 4C91A 1R8LA 3O6AA 2Y5JA 1VRDA 1LWHA 1UZDA 4MOZA 4F0LA 4H4TA 1QW8A 3T4WA 2YLLA 3M5VA 3BAYA 4D72A 4PRRA 4K36A 3H8AA 4UQ9A 1TPH1 4GO9A 3F5KA 1H3GA 3T08A 1JAEA 1UC4A 1E51A 1V3MA 3UXLA 4ADSA 4MWAA 3CS2A 1UJQA 1AVAA 2PDWA 4UFJA 4O18A 4HCHA 1E9IA 4X22A 3LXCA 1MEIA 3TA6A 2PBGA 3B4YA 4Q8WA 3B05A 4J3XA 1R0MA 1SZFA 3LNPA 3W37A 4H8NA 3U7BA 3LERA 3NSNA 2HEJA 5AZ1A 2DSKA 4B3KA 2DIKA 4PMUA 3U2EA 3DGHA 3QR1A 1K4QA 3LHWA 4JIHA 3TYAA 4NNBA 4KPLA 3KCOA 3DFQA 2DW7A 3B9NA 3E02A 4J3UA 3U3HA 4Q33A 4R3UA 4DPPA 3ZZ1A 1EJ7L 4AZ7A 2D69A 4N9DA 1TV7A 4X3ZA 1QUMA 1B54A 5M17A 3KOFA 3O16A 4IX2A 2I5GA 1Q2SA 3L0NA 1YE4A 5HMDA 3AXIA 3BAKA 2J79A 3Q58A 1GOMA 4L80A 4DF1A 1K6WA 2QMKA 1EXPA 2VFGA 3EWXA 1XC4A 1RA5A 4AFYA 3ZLFA 4E3TA 1V97A 3C61A 4WSJA 4O14A 2DT1A 2ISFA 3GH5A 3RR1A 3S1VA 3R43A 1SFTA 3CMJA 2ZUWA 3GR4A 2PFHA 4C6JA 5U25A 3WBAA 2EQ9A 3W7KA 1E40A 4GIRA 4UWMA 3D3AA 3W7JA 2QUNA 3PZTA 3GDLA 3TTEA 2JKPA 3T44A 1QPKA 2POTA 2D2OA 4HYRA 1W17A 3W1TA 4PC8A 1T99A 2QPSA 5DEZA 4LAUA 3TTQA 1AG1O 3GTNA 1SW0A 4FZIA 4ACYA 3LLFA 5J5RA 2PWHA 1XQLA 5LNRA 2V38A 3W23A 2VX4A 4JQ4A 3LI1A 4MUPA 3VKAA 1JFXA 3M7SA 3R13A 4UTTA 1CXFA 2YJQA 2EKGA 2Y88A 4AEFA 4MFEA 3IRSA 3SCVA 4HNCA 4AW7A 2A3EA 5C71A 2QCGA 5IRPA 5JBDA 2XINA 3NPVA 2OWXA 1V7AA 3QHOA 1KD0A 4Y9OA 3H55A 4K3ZA 2X16A 5CPMA 3VUSA 4QLJA 2AMXA 1SO3A 3GAKA 3CJPA 3TFCA 5BZAA 3OBEA 3WLMA 2A6LA 1M01A 1JZ5A 4J3TA 2WM0A 4P7NA 4W88A 4JQ2A 4F0SA 1GG0A 3TN4A 5FJRA 1Y5VA 3B0PA 4XZNX 3V1HA 2QXWA 3WNOA 1IT8A 1W1A1 5AHIA 4ATDA 3FKRA 3ABOA 3W1NA 4DUXA 3AXKA 1JCXA 2ZICA 3CUIA 3TXZA 1Z9AA 2WZEA 3HPSA 5KINA 2OO6A 2W55A 1DP0A 2CBJA 2X8CA 1X1NA 4Y7EA 4RLIA 5HJLA 1ISZA 4C6OA 1UR1A 4W93A 4OE7A 1BRLB 4O1BA 1VDVA 2J62A 3LXDA 3UZ5A 3PANA 4JTTA 1Q1RA 3ZWTA 3LM7A 4WXZA 2AOSA 1TB3A 2NPXA 3H22A 5JCLA 5H8UA 5EPDA 3TR9A 3LEPA 1SO6A 2OFJA 3BSGA 5IXEA 3R94A 4GG9A 2YB4A 3CLWA 1KRMA 1JRCA 2BLEA 3NYDA 4EPBC 4BEUA 3QW3A 5A6TC 1NTHA 1WAUA 5ECUA 5ENLA 4UOJA 6TAAA 4X0NA 1XRFA 2OQLA 2QGHA 2J9XA 2WMKA 3AC0A 3A3HA 4GUJA 2FFIA 3ZWSA 4OWGA 1AQ0A 4ZGYA 3TVAA 3N1AA 1YADA 3WJWA 3IJ9A 2C8NA 2NX9A 1LDCA 4XZ9A 3NQBA 1FEAA 1BRLA 4Q32A 2WHMA 4DO5A 1BQGA 3VIJA 4F48A 4Y9MA 3ZVIA 2VENA 4Q8UA 4FOJA 1RY8A 4QM1A 1ZXIC 3B3DA 3GR8A 4DM1A 1YPFA 3NCOA 5A6JA 3E3HA 1Q6RA 2A0NA 1DQWA 4C6EA 1P1MA 2Z6JA 4LB3A 3GDKA 1H7XA 3QV9A 1FHVA 5I78A 4AY8A 1LRQA 3M4HA 3VINA 3F5LA 6A3HA 5AHNA 1OGBA 4HHPA 1WBHA 1FKXA 2GK1B 4JDBA 3GHSA 3QZEA 3F03K 5HJXA 3PWAA 4KESA 4PYSA 2HPMA 1XR2A 1OYBA 4K39A 1W5OA 2QR6A 2ZA1A 1EJXC 3HPFA 1GQNA 3VNLA 5I3JA 3THUA 3R2GA 4P7QA 4APNA 2HS6A 5JIWA 4M51A 2ZRZA 4B2DD 4XB3A 4O13A 4NAFB 2X09A 3SCRA 4WDXA 3BO9A 3PUDA 3R79A 3UFYA 3XINA 3URQA 5HMSA 2Z00A 3VGFA 1V93A 4YTQA 1CXIA 1DXEA 3ARRA 4WGHA 1F3XA 3NA8A 4KKXA 4FXFA 5I77A 3IJDA 4LYPA 4O12A 4N9BA 3BCDA 3WQ8A 3T0AA 2EBNA 3R10A 4NL1A 3FIGA 4XKYB 4IPPA 2GK1A 4HK6A 2QJGA 5G2IA 1X2GA 3VZYA 5CC3A 2GGJA 3W2MA 3AUOA 5CG7A 4GZIA 2GSHA 3BDKA 2CPUA 4PMVA 3SCPA 2FB3A 3IJ8A 3G1RA 1EZWA 3WX7A 1MQQA 1OX6A 1KGXA 3W7GA 2BVWA 1AW1A 2R9ZA 1TKKA 1ISVA 4DRSA 1TIWA 3GG1A 3ECQA 4NAFA 2FKPA 3RUBL 4C6KA 1BG9A 3KOYA 2E28A 3BMXA 2D24A 1XSKA 1D8CA 4M0XA 1NJJA 3AMZA 3TYDA 3V5CA 1KFCA 1W3JA 1W9VA 3GFYA 2GGEA 5EMLA 4MWAD 1WZMA 2DZPA 1PKLA 3WJYA 5KITA 4IZGA 4KCUA 2BOFX 4C60A 4WKHA 5C2GA 2WBGA 2G8ZA 3C2RA 3SQMA 3TMLA 1WZLA 3QPZA 4XKYA 1H1ZA 1EH9A 2VZSA 1GT8A 4RCXA 4UNLA 1M65A 4FR6A 3R8GA 4CCCA 3BMWA 2IPWA 3S5OA 1VFSA 1N8IA 4B5SA 1LG2A 5FL0A 3OLIA 3ZR5A 2WSRA 4QJ1A 4HIBA 2V5KA 1Q6GA 3NG3A 2VZVA 2EPHA 4L9ZA 5LSMA 3BJFA 1GW9A 4Y6GA 3N17A 4N4PA 3W1AA 3CHDA 5CGTA 4HCDA 5LHEA 3G24A 2TODA 3THQA 5A6MA 1Z44A 4Q22A 4HU0A 3L9CA 1YMYA 3V75A 4RW5A 3OVRA 4DAIA 3APYA 4D6IA 1PAMA 4PSRA 1GTEA 3USZA 4L61A 1ONRA 2Y5SA 1PUDA 3W70A 3FYPA 2WSKA 1LP6A 3ARUA 3NVWB 3DEQA 1KA9F 1LL4A 4NJGA 3WENA 3NPUA 1D7KA 1ZAIA 3LPFA 1JPMA 3CUXA 3PZOA 4MG4A 5HK4A 2A3BA 2GWGA 3I7RA 1K8XA 2NWSA 3VABA 3QYSA 2Z29A 3GVGA 4Q4QA 6XIAA 3CAKA 4JDRA 3P14A 1B0IA 1MXSA 3N4AA 2PLCA 1KC7A 1KFJA 4MYAA 1E0WA 2EPOA 1XIHA 1DJGA 4DUVA 1A5AA 2UZ9A 5I3IA 1FRBA 4EXAA 1F8IA 2IXVA 1LORA 1XRSA 3CHEA 4XVEA 5A1AA 4JX4A 4GLEA 3ARVA 2PRMA 5ER0A 4JICA 2O9OA 3UZZA 3QMRA 2NV9A 4H9YA 4ML9A 3JW7A 3PTMA 3M0HA 7ODCA 1V0LA 3HJZA 4GQBA 3TWBA 1I2PA 3PJXA 4AXNA 3HGRA 1CGTA 3IJIA 3FYYA 2WSQA 3KVJA 3USBA 4HNVA 5CZJA 1JQXA 4Q4PA 2WV8A 3OG2A 3AIWA 1ZS2A 2RHGA 3QQ1A 3W87A 1TTJA 4DLMA 3WQ4A 5CBIA 5D09A 3QGKC 1XG4A 1WYGA 2YBTA 4GI6A 1JI1A 1Q3NA 1JZ8A 2ZUSA 3TCEA 1W9XA 2QVNA 2NV1A 1QW9A 4FNPA 4XAGA 4GK8A 4OBRA 3MB9A 4XK2A 4AY7A 3GXMA 2VGBA 4ADWA 2DZSA 2O4QA 1CPUA 3WD0A 1QNSA 1F73A 1FFUC 2PGRA 4Q4RA 3PZVA 1UD4A 5I02A 1W0MA 1IXOA 1G67A 3S83A 3UETA 2DVXA 2ZZ7A 5LNSA 1Z48A 1TV3A 3UU0A 3E0FA 4J2PA 4HYWA 1UIOA 1F3PA 1V3LA 2PDMA 2QCHA 2YSWA 1F4AA 3N15A 1ELSA 1H7WA 4H19A 3ABQA 3PUOA 4LYRA 2NQ5A 1WUEA 4AZBA 1LJYA 3WF3A 5L6UA 2RDXA 1BXNA 2E6AA 4N4QA 3A3XA 1RA0A 3LBCA 3EXTA 3UXIA 1R6WA 2W6RA 2WWCA 3GTHA 3V16A 3K30A 1RJPA 4QLKA 2PGFA 4F2UA 3RLHA 5FF3A 1POKA 3B40A 3PPGA 2YZRA 3P0XA 1F2JA 3HQOA 1BTMA 4C6DA 2BY2A 4D6GA 3AN1A 3UZJA 3WQOA 1Z3NA 4QCFA 4HU4A 1DHKA 3LHTA 4YYCA 5TD4A 3HQNA 1J12A 1TJRA 3KS5A 1HG3A 4HQVA 4TUFA 3LHYA 3BXWA 1E4LA 1EPVA 2YAUA 5AVHA 1QK2A 3NL6A 3TJIA 4H04A 2DIEA 2BY3A 4QRNA 4LV4A 2BOGX 3QXBA 3A4JA 3K5XA 1TQJA 3NYZA 3V35A 1IWPA 3IK2A 4CN4A 3AO0A 5JCIA 4E2OA 3F2BA 1QI0A 3PBYA 1QOPA 1EBHA 1V6UA 3IJ6A 4WGXA 4G56A 1GOOA 4XZBA 2O9RA 3NS1B 2PP0A 1YXCA 3G3DA 4UTTC 3G6LA 4UFKA 5FKYA 3CGDA 2V6AA 5K7JA 2E4TA 2B4GA 4WJEA 3VD9A 1TFVA 1JF5A 1K9DA 2ZA2A 4ZOBA 2EF9A 3WUGA 1CECA 4GVGA 4CD5A 5HNNA 4FNTA 3W1UA 2CBIA 4ACZB 1K77A 4W7VA 1LL6A 3VKCA 2G3MA 2DW6A 3CIXA 3UP8A 1XD0A 1VQTA 3DHUA 1REQB 1S2WA 2YA0A 5A6KA 1EBDA 4Q7BA 4YJ5A 1DJZA 4LA1A 1JD7A 2ZUNA 1H7NA 2PC8A 1G5AA 2E5AA 1QW7A 3GRSA 1L8PA 3WLOA 3ITOA 1J93A 4JL2A 1V3KA 1F4HA 3QH2A 4ZENA 3GXDA 4PCTA 1QHZA 3N9KA 2BV9A 1RLCL 3FW6A 4J9JA 4H4VA 5EBKA 3H2NA 4NIRA 2PDHA 1FWHC 3P67A 5C55A 1GOWA 3UNTA 5G4HC 2BB0A 2DVTA 4ACZA 1KRBC 6ENLA 3WQ5A 5D30A 1EJRC 1U5JA 3STGA 4QSFA 2XFWA 1XDIA 1REQA 3W25A 1KR0A 1VFMA 3T78A 1ZKQA 3UPWA 2HNHA 4PULA 3MKKA 4H4QA 4ZOCA 4KMQA 2FVKA 1I60A 1U33A 3W1RA 4H4PA 3C8FA 2J6VA 4HNTA 1I9CB 5FF7A 5EMMA 1BVWA 4LYKA 1JPIA 4M82A 4P7OA 3A23A 3B9EA 3L2MA 1MNZA 2VC5A 4WVXA 1E0XA 3L4TA 3RLVA 5EKYA 2XHYA 4GOAA 1VP5A 1VPXA 5G2HA 2D23A 4J7RA 2UY3A 1QAPA 2Z0IA 3UVIA 4UTFA 3W2LA 4B9YA 1UR2A 1DWHM 1F8MA 1N5XA 1A50A 3FV9A 1GOIA 4GNJA 4MJMA 2C3CA 4R9XA 4U10A 1NOFA 2V3FA 1N61C 5LKYA 4YTSA 4MKSA 1EEXA 1QVBA 1FECA 1CZ1A 4IX0A 1PB0A 2G95A 3CIVA 5D2WA 1F07A 1GYLA 3BLKA 3W88A 3E2VA 3PC0A 3OVQA 4ZO6A 4C6PA 3GDBA 3LTPA 4UUIA 4O0ZA 3UG5A 4MKNA 4EAYA 4FMVA 2UY4A 5CPOA 1VENA 4M19A 3W1LA 4PTNA 3NAVA 5T9BG 3AXMA 1SPQA 3W86A 4ERIA 1OF6A 1XINA 2WM1A 3ZJ8A 1X6UA 4FALA 2ISWA 3SM0A 5A6AA 1LPFA 4S3FA 1BWCA 2DY3A 1K03A 4P8XA 4Q6JA 5TAOA 4UOZA 4M80A 2WNZA 4ZSTA 2C7FA 2VYOA 1M5WA 2Y7EA 1XIJA 4N9EA 1G6CA 4JDYA 1IGWA 3PZ9A 4DI9A 3M64A 3ES7A 4MB3A 4UIOA 3R4IA 3MQTA 5BXSA 2PDJA 2OQHA 3LXBA 3VNYA 3W27A 4TV5A 2D1ZA 5F4SA 2J8TA 1E72M 3ARPA 5G4EA 4ZOAA 2EQ6A 1NPXA 3D9XA 3BOLA 3EDFA 2VCCA 1V08A 3LGGA 4GCXA 2Z6IA 1HT6A 3D5HA 9RUBA 1TX0A 4PMJA 1W1YA 1NHRA 4Q7NA 1TWWA 3MKCA 3AS0A 9XIMA 2PLJA 1JNEA 4HOWA 2G0WA 1G7UA 5A8QA 2ZZCA 2GUBA 2WVSA 3P5YA 3OBAA 3PBVA 4O1CA 1ZJAA 1HVQA 1KTCA 4FLSA 2YGYA 1P4CA 4K8DA 5ABGA 3DG3A 3WZ0E 1S2AA 1RK6A 4HZMA 4KQNA 3FGCB 3SZ8A 1JYXA 2BMBA 3WH8A 1KM4A 1UH2A 5FS9A 4B3ZA 4CNPA 1XW8A 2ACRA 2QPXA 2DZBA 1BF2A 3QM3A 3AU6A 4C1LA 1TWSA 3BW3A 3UY7A 3MKVA 2XDFA 2WP5A 2V67A 3W2UA 4CGTA 1BZLA 5M3WA 3AJXA 3NL2A 2PAJA 2DFAA 1VCFA 2WZIA 4OBSA 1PSCA 2P76A 4UTWA 1ADSA 1FBAA 1OFQA 3TC7A 1DWGM 1GERA 4NZ4A 2ASHA 1WZKA 1UC5A 4QQ3A 1XHCA 1F76A 3PZGA 3S2CA 3QPEA 4JNMA 4JIIX 2GGIA 3EMCA 1GESA 2FYMA 3BW4A 3LCLA 3WF1A 2W3SA 4OT7A 3FGCA 4H6RA 3SBFA 1YDVA 3UXAA 1XBVA 5AZ0A 4RJEA 1BGGA 5IHRA 3LG3A 1UWRA 2GGGA 1PZ0A 3QR0A 3W02A 3WUFA 4LVAA 1JEHA 1TPDA 2PDGA 4TX6A 2E1WA 3L5AA 5AHLA 2Q71A 5F1VA 4J1OA 2WOIA 1P5BA 1HF6A 5FF0A 1EF3A 4XZHA 2HROA 4ADUA 3AUJA 1OCJA 1OINA 3NZQA 4FLOA 4YCOA 1H7OA 1PEZA 4FF5A 1K7FA 4B90A 5C9WA 3MUCA 2V3AA 1RK5A 2AL2B 1J96A 3GSMA 4NP7A 4PA8A 1J5TA 3UF9A 1IWAA 3L21A 5EU9A 5DBTA 4HSOA 1T5AA 2JK6A 3CV1A 5D05A 3N4EA 4BHYA 1FIQB 5JCKA 1W9BM 5AB3A 3ONBA 1F3WA 2PWGA 4E4UA 2X8RA 1WA3A 4FLRA 1T96A 2HWGA 4US5A 5F1UA 2ZRVA 4GQGA 4KWOA 2ANUA 1OJXA 5CSRA 4F2TA 1V79A 2QT3A 4YPJA 1F9CA 2R1LA 5AFDA 4IH3A 1EJWC 1DPMA 2WNNA 3EA2A 1H61A 3CASA 3J7HA 3T05A 1W5MA 3GKAA 4PN2A 3NM1A 1L6WA 4E8CA 1V3IA 2A5HA 1BD0A 1YNQA 1PO9A 1GOKA 2YPIA 2AL2A 2PS2A 1YDOA 4HPNA 1E1CB 4XD5A 1JR1A 2V82A 1BPLB 1LBMA 1FHUA 5D4YA 2RFGA 4LUSB 2VWSA 1VFFA 3W1QA 3VZXA 5I07A 1EQPA 3W2JA 3R25A 1EDGA 4EPDC 4PTDA 3MS8A 1GVFA 1JZ7A 2ABBA 2HV5A 4QS5A 4ZQNA 1UD8A 3WH7A 2CLPA 2FGZA 4ZZ9A 4I8DA 1SFSA 3NZRA 2VEPA 4I7VA 2R8WA 4GH3A 1XLJA 4R53A 2W79A 3WLJA 2D2HA 4O28A 3M0KA 2C1HA 4H01A 2Y24A 4H1ZA 2P50A 1D2KA 3A7RA 3VIFA 2I5IA 1JOAA 2IS7A 4MSSA 4GZ7A 4DWSB 1HJVA 3N14A 5CJMA 1E1CA 2YL8A 4X2PA 1QOXA 3EX6A 3SCNA 3TAOA 1AMKA 5A5WA 2WLYA 3RJXA 2TSYA 3GTXA 4LUSA 4H9MA 3QBUA 2WVUA 2RDTA 3AS1A 3GXNA 3PG6A 4QTGA 1DJWA 1E70M 1JGIA 3FXGA 2VFEA 3ANYA 5IFPA 4GE8A 1NP0A 3TC6A 3OZMA 4ZODA 3URAA 4ZSUA 4FNRA 3EWCA 2FJUB 5CC6A 3GRTA 1L6YA 2EG8A 3B03A 3FHQA 3GIPA 3C5QA 3GC2A 3TONA 2QCDB 5FJPA 1QMLA 2Y4SA 1IGSA 1VLIA 4RL3A 2C14A 2ZZ3A 1PKNA 1H51A 1VEPA 3IV8A 4QBXA 2ACSA 3GD3A 2V8ZA 4JTSA 2W54A 2QVHA 4DWSA 1VF8A 4JXCA 4WXYA 1Q6OA 1SFLA 1TRIA 3MVTA 4WHBA 2H3BA 1Z69A 1PHQA 4GI9A 1DJHA 3H7VA 3GVWA 1HKKA 1MQRA 3CPGA 1KM2A 3G1FA 3VNIA 4PRWA 4AIOA 3ZT5A 4LS1A 3W72A 1Y8BA 3VM7A 2OSXA 2W92A 2A3LA 3LZ3A 4HZ7A 4KWVA 4S1FA 4MZYA 4TIMA 1FCQA 5BOOA 3KUMA 4FXSA 4IICA 2QCDA 1IIHA 2ZX8A 2YDSA 1O60A 3PWIA 4Q8TA 3BV4A 5LGZA 1LRNA 2WLZA 1PZ1A 1GSNA 4G5DA 1QNQA 2CLOA 1FWWA 3URHA 4JTHA 3DECA 5CJ5A 1CDGA 4HMNA 1KCZA 4S3JA 3M6YA 2QQ6A 3U4FA 1OC7A 3CC1A 7REQB 2X99A 4MDOA 2B7QA 1TR1A 1W9PA 1H6VA 4W8BA 1S2VA 3OTRA 3AS2A 1JRPA 3NO1A 1GW1A 2BXVA 5CQ1A 5CC7A 4OJYA 1KTNA 1XIEA 1D3GA 4TR9A 3CQJA 3WH5A 3HM7A 3H24A 4PZVA 1A80A 1VIZA 1W5QA 3OP2A 1CLXA 4IXXA 5JMUA 4TU1A 2HJPA 2VEKA 3W1XA 4N02A 3ZOAA 4JQAA 4UFLA 4FEZA 4LVGA 2E9LA 3JZEA 4O54A 5BCAA 3KHDA 2CIPA 4PUKA 2GLKA 2YQUA 5I3DA 4XUYA 3OIHA 2W67A 4AHPA 4M3PA 4I5XA 5FL1A 1WDRA 2P3EA 4NRRA 3FEMA 1OG6A 4GABA 4UZSA 3VIOA 8CGTA 2F6UA 4K38A 4B5TA 1TJPA 1R3TA 3C4UA 1KKOA 2CLMA 1CGYA 1NELA 2ZWZA 3SCOA 1A5KC 3F1QA 4EM3A 1WPCA 3BLLA 4BWLA 1Q6DA 3SY8A 5F2MA 4XG1A 2GR3A 5ECVA 3BAIA 1ZCCA 4GINA 4LYQA 1ZZMA 3IGHX 4AZ5A 5IBXA 1TIMA 1V02E 3P8JA 4FNUA 3HG4A 2J7CA 2X1RA 5T91A 1GRGA 4H8VA 1X8CA 4NNAA 4JFTA 3MPGA 4ZQCA 4Q8PA 2Y7GA 3QN3A 4TOQA 3KZSA 2VL4A 2ZXDA 2XH7A 3FA4A 3C56A 3N34A 4MY1A 1J18A 2OCZA 3OGRA 4D8ZA 5BOFA 2F6KA 3WLTA 3WDQA 5HQEA 2R1MA 4L65A 2RH9A 2DSWA 4H9VA 2TYSA 4AIBA 3BK0A 2DUZA 1MRAA 1V6TA 4FXRA 2JIWA 3S42A 4QG9A 1YTKA 2QS8A 3BZJA 3IARA 3EKGA 1EEPA 2A79A 4BQ3A 1GREA 3M47A 3TLLA 3NTYA 2Z4GA 3CUZA 4O57A 2YL6A 4JKKA 4LCQA 2QPUA 3PFRA 3T42A 4IPLA 1RQHA 4L56A 1OZMA 3GXTA 5HWNA 1QASA 1GVEA 3PJWA 3QZ6A 3B8TA 1TMLA 1E5JA 2VC6A 4I9JA 4TVUA 2X2YA 1E4NA 1V59A 5JH2A 1V6YA 5D02A 2EQ8A 3MP5A 2NZLA 1BTCA 4Z2GA 1FUYA 2I9EA 2HISA 3KE0A 3NNTA 5G1YA 5A8MA 3LY0A 1IXQA 3FDGA 2VRQA 1ZFJA 2PTWA 2NUYA 1KFBA 2IKJA 4WSHA 1EX1A 2XH4A 3M1ZA 3ARWA 2OELA 1KLZA 3SUVA 3AXXA 3QV7A 4US5D 1FWRA 1EC9A 4LH8A 1ZP4A 2ZRUA 2PF0A 1H5YA 2QIIA 1ONWA 3W75A 3KBSA 3QW4B 4O17A 1XYFA 3KP1A 1SU5A 4NT0A 3KXQA 2DZAA 1GKPA 2WMIB 4RZ5A 5FJIA 4XAYA 1DXIA 2C3ZA 3EB3A 4DM2A 5I3HA 5E9AA 2FZ8A 4RDYA 4HPJA 4H9TA 1TA3B 1XFBA 6XIMA 3DYPA 3AZTA 2WHLA 2OYKA 1G7VA 3V4BA 3VOJA 1TPFA 2ZCGA 3RMJA 1GZ1A 2QUVA 1UUMA 1E1EA 2PDBA 1L6GA 1JG9A 1V0KA 4ZXOA 1WKEA 3CWOX 4W7UA 3YPIA 1N8FA 3WDPP 3EAOA 4JTGA 3CB3A 2CZ5A 3MI6A 5FJTA 1ZX9A 5LA0A 4UTWC 3P3BA 4JL1A 4IP5A 3SCTA 2KX9A 4XBKA 1PZ2A 4C7GA 3HA1A 4QDWA 1SSDA 1VC4A 4CD7A 3GG7A 4G9PA 1AJ0A 1H7RA 3P80A 2WMIA 2ZBTA 2YVFA 8A3HA 4N0RA 4DQWA 3OVPA 2HSAA 1A0EA 4U3CA 5E5CA 1VBUA 1JVNA 1TA3A 4LXFA 1KRAC 1HN1A 2WMHA 1LG1A 4TVYA 4R27A 5REQB 4S3GA 1C7TA 4ZQPA 4BI7A 3SFKA 2XFFA 5M5DA 3BGJA 1GEQA 3CAVA 5JIPA 1F61A 1RBLA 3EWUA 2V68A 1QNRA 4HNOA 1E5NA 4WQ6A 1J4EA 1VS1A 5LXEA 2ZRYA 4MKVA 5HAOA 1G69A 3G0UA 4DWSD 4HMCA 3ZS4A 3E9AA 1XYZA