4J3ZA

Crystal structure of mandelate racemase/muconate lactonizing enzyme from jannaschia sp. ccs1
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
388
structure length
388
Chain Sequence
VKLDTLDIFAVAPPPPGWGGRYWLLVRVTTDTGLTGLGEVYAAGVGPEAMTHVIHDVFTRHMRGEDPANIELMSRRAHSSGFTQRPDPTVFGAFSGLEMACWDILGKARDCPVWAMLGGKMNDRIRAYTYLYPEPHHDTNAFWTSPEMAAESAAARVAEGYTAVKFDPAGPYTMRGGHMPALSDIDLSARFCAAIRDAVGTQADLLFGTHGQFAPAGAIRLAKAIEPYDPLWYEEPIPPDNLPGLSEVAAHTSIPIATGERLTGVTEFTQALHHGARILQPALGRAGGIWEGKKIATLAAAFGAQLAPHLYAGPVEWAANVHLGVSCPNLLMVEAIETPFHEALVTGRPRVENGFVAAPDAPGLGITLNDAIANAHRYTGNRLHLEMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of mandelate racemase/muconate lactonizing enzyme from Jannaschia sp. CCS1
rcsb
source organism Jannaschia sp.
molecule tags Isomerase
total genus 123
structure length 388
sequence length 388
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4j3zA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4j3zA01
1PDZA 3I6EA 2QJNA 4Z17A 3V5CA 1R0MA 4H2HA 3SSZA 3P3BA 4DWDA 1JPMA 2AKZA 3ES7A 4E6MA 4E5TA 1DTNA 3R0KA 4DHGA 2AL1A 3H8AA 2ONEA 2OVLA 1P48A 2OZ3A 4DX3A 3OZMA 4GIRA 2OLAA 3RGTA 3DFHA 1EBGA 4MKSA 3DERA 2GSHA 2AL2A 3N4EA 2P0IA 3D47A 3ZLFA 3CYJA 5IDZA 4HCHA 4GYPC 4A6GA 2DW7A 3QKEA 1L8PA 3VC5A 2PU1A 3ZLHA 1SJAA 3SQSA 2RDXA 4M6UA 3NO1A 3ZVHB 1FHVA 3H12A 3MWCA 4GYPA 2GGIA 3FYYA 4HCLA 3ENLA 3VFCA 3R0UA 3T6CA 2FKPA 3TTEA 2P8CA 1TZZA 2PCEA 2PPGA 3R25A 3QTPA 3HPFA 2OO6A 3UJFA 2XH2A 3UJ2A 2PP1A 3IJIA 4MMWA 1ELSA 1JDFA 4IP4A 3MZNA 1WUFA 1ECQA 3V3WA 4ZA0A 4GISA 4H1ZA 4HNCA 3PWIA 2CHRA 3VC6A 2GL5A 3TWAA 4IP5A 2HZGA 4KWSA 1ONEA 2ZC8A 3UCCA 2QJMA 2OG9A 5BOEA 2QDEA 1MDRA 4G7FA 2GGEA 3MSYA 4J3ZA 2XSXA 3R11A 5J04A 4G8TA 4HPNA 2OX4A 4ROPA 1BQGA 2PMQA 1TE6A 3CT2A 3GD6A 3JW7A 3MQTA 3DFYA 3TJIA 3CK5A 3BSMA 4KPLA 2PU0A 3TW9A 3U4FA 3MY9A 2FYMA 5EU9A 2XH0A 1JPDX 2XH4A 2PSNA 2PTXA 3QPEA 3TOYA 2PTWA 3TWBA 4DXKA 4J1OA 2P8BA 4YWSA 3CB3A 3QLDA 4EWJA 3RR1A 3PWGA 2OZTA 1WUEA 4M0XA 5BOFA 2AKMA 3ZVIA 4GFIA 3THUA 2OPJA 1EC7A 5ENLA 3T9PA 1SJDA 3TQPA 1KCZA 3OZYA 1R6WA 3R1ZA 3FVDA 2PGWA 3T4WA 3GO2A 4ENLA 3BJSA 2MNRA 3OP2A 4H83A 2PS2A 4DYEA 4KT2A 1MUCA 2HXTA 3STPA 3RITA 2OFJA 3GY1A 3EEZA 1JCTA 3UJEA 4IHCA 2ZADA 2OZ8A 1KKOA 3S47A 3U9IA 3VCNA 3TCSA 3JVAA 3RO6A 1PDYA 2PA6A 2QVHA 4A35A 4IL0A 4FP1A 3DG3A 4GGBA 5FJTA 1NELA 3T8QA 1IYXA 5FJOA 3K1GA 2OQHA 4A3RA 3VA8A 3FJ4A 2O56A 3H7VA 4MGGA 2QJJA 2QGYA 3DESA 1EBHA 2MUCA 4GGHA 3I6TA 4E8GA 4IZGA 4HYRA 3V5FA 5FJUA 1F9CA 4FI4A 3KUMA 3IK4A 4E4UA 4HCDA 4GMEA 4X2PA 2POZA 1E9IA 1YEYA 3TJ4A 1P43A 2QDDA 1RVKA 3EKGA 3ZLGA 3FXGA 3IJQA 3CAWA 3UCDA 2PGEA 1XS2A 3N4FA 3Q45A 4E4FA 2QQ6A 1NU5A 3UGVA 2GDQA 2P88A 4HNLA 1MDLA 3SN4A 1SJBA 3MUCA 2PP3A 4H19A 3BOXA 2I5QA 4JN8A 3DIPA 2PTYA 3N6HA 1XPYA 4Z1YA 3Q4DA 4HN8A 1FHUA 2AL2B 1TKKA 3I4KA 4KEMA 3OPSA 3V4BA 2OKTA 2P3ZA 3IJLA 3R10A 3RRAA 6ENLA 3SN1A 2XH7A 3ZVHA 2PP0A 4IT1A 3CXOA 1MRAA 4K2SA 2GGGA 3PFRA 3P0WA 3ES8A 3OW1A 2HNEA 3FV9A 3NFUA 3UXKA 4DN1A 1EC8A 3DEQA 1KKRA 3D46A 3JZUA 2GGHA 4JHMA 4K8GA 3H70A 4K1WA 3FCPA 3SN0A 3B97A 3QN3A 3RCYA 2OQYA 2PODA 3PK7A 3UJRA 1SJCA 3N6JA 5FJRA 3UXLA 1BKHA 3DGBA 1KD0A 3UJSA 3GC2A 3NZGA 4JN7A 3SBFA 4F4RA 3MKCA 2NQLA 2DW6A 3DDMA 3VCCA 2XGZA 1W6TA 3NXLA 2PTZA 3S5SA 2GGJA 3P93A 5FJPA 3VDGA 3DG6A 1OEPA 4ZCWA 1MNSA 4IL2A 3OTRA 1EC9A 3DG7A 3SJNA 2HXUA 7ENLA
chains in the Genus database with same CATH superfamily
2E9LA 4HB7A 1LLWA 1NOWA 1DP0A 1RALA 1K9TA 1M7OA 4DWDA 4DY1A 2OODA 1JDEA 1S5MA 5FJJA 3W00A 3AXMA 4QEEA 2ZQ0A 3IGHX 4IIHA 4XB3A 2VX6A 2EHHA 3KHJA 3LDVA 1V08A 3C0JA 4NUWA 1TRIA 1JXJA 1W17A 3RGTA 3UEQA 3QSTA 5DF0A 5U4NA 5G2IA 4CN1A 2XGIA 3KOFA 1CXEA 1YTKA 4AVNA 3L2MA 3L0KA 3BMVA 2CLLA 1I1XA 3Q94A 2W0HA 1RA5A 2P50A 4B5VA 1E9ZB 1EA9C 1GVEA 4XAGA 4ADSA 2W92A 1MXDA 1PIFA 1XQKA 3LLXA 4HA0A 4XTIA 4JQAA 3U5UA 1LWHA 1OZMA 1THFD 1LBMA 2QCNA 1EGVA 3RM8A 1Z6KA 2C1GA 4XTDA 3WDIA 1X98A 1SJAA 1E4NA 1J93A 3MJYA 5G4WA 2G3FA 1R7AA 4TOQA 4YVVA 5LA0A 3G77A 1TJ1A 4O0ZA 3CTLA 3P60A 3WNNA 2WMFA 1WX0A 4ZE4A 1I2NA 4JCMA 4DNHA 1LT7A 4D72A 2GSJA 4Q6JA 3U7BA 2X41A 1TV4A 3TEVA 1V0MA 2PPGA 1EHAA 4C1NA 2PRLA 1IWPA 1KGUA 4WZHA 3IJIA 4XKYB 1UJQA 4WKAA 3NCOA 3OJGA 4GIEA 2DT1A 3MJMA 1E0XA 3WN6A 3S83A 2WMHA 4Z2LA 1MW1A 1KM3A 2Z1BA 1TJPA 1CLVA 3OB8A 5BXSA 3M0YA 1MQRA 4MM1A 5LIUX 1EWEA 2BX7A 3GAKA 1JRPA 4W84A 2PGRA 3G1VA 5IHSA 3AJ7A 3WLLA 2QULA 5IRPA 5EB8A 2QDEA 1FWTA 3M43A 1BPLB 5K7JA 3QGAC 4PTVA 1ZAHA 2XVNA 3R43A 4D71A 5EMKA 3JW7A 3CK5A 2ZDRA 3UWYA 3RO8A 3UZZA 3V18A 4OV9A 5G2HA 3TN5A 4DM2A 1XM3A 5E6YA 1Q8JA 4AHQA 2C3ZA 3M6YA 4NI3A 4A2SA 2D22A 2GR1A 5BW6A 2VZTA 4XISA 2G4JA 2PTXA 3H2FA 2NX3A 2XFWA 3THDA 1A5UA 2H9AB 4K6AA 4PCPA 3SJ3A 4J3XA 3MZ2A 2WCSA 3AMCA 6XIAA 2OT1A 3WLPA 1E0TA 4RPPA 2J25A 4LUSB 1OIFA 3QKZA 2I17A 2ZC1A 3H24A 3NQ6A 5IOBA 1TYTA 5FL0A 5TNVA 4C91A 3AICA 3MKKA 1VAHA 1PZ3A 5ABTA 1MEIA 4B2DA 4JN6A 1K77A 4UMBA 1DV7A 2GK1B 1KQZA 3KE0A 1GQJA 3QV7A 3C61A 2XSBA 4GBDA 2HROA 4UTMA 1LUCB 3ITOA 1TZ7A 1J0HA 2X2YA 1ZY9A 1IXOA 3VGFA 4LF2A 4LAZA 4NZ5A 4J2PA 1MQQA 3S47A 5A8QA 1NFBA 3W6YA 2WLZA 3EB2A 1G5AA 4LY8A 1XV8A 1EO7A 5FJOA 2OQHA 4D1IA 1BG4A 1FEAA 5AC7A 3AJXA 4F2BA 2F2KA 2O56A 1J4EA 1JRCA 3HFTA 3G1AA 3MO7A 2WC4A 4F0RA 5K4XA 2PDPA 5LNRA 4DWSC 2C71A 5FCZA 3II1A 3UP8A 1GOMA 1XC6A 5DELA 2XISA 3VDAA 1XFCA 1K02A 1S39A 1V6WA 5DCDA 2RUSA 4IFKA 1ME9A 2VO5A 4F9JA 3WJXA 2VJXA 4R3UA 3OG2A 1DWFM 1O1ZA 3UETA 4L7ZA 4LW7A 1SR9A 3ZMRA 5H8PA 1GZGA 2J24A 3ORWA 3ZQ9A 2XUCA 4M51A 1W3KA 4DJFA 3BAWA 5EY5A 1GEQA 1EOKA 1OYAA 3ZLGA 3W1UA 1UROA 1L6YA 3C2YA 3W2UA 5CPTA 3FX4A 3QM3A 1MDLA 3B40A 1UD2A 3MC5A 3M0XA 2FZ8A 3HB9A 4LEFA 1JAEA 4XX6A 4B91A 3UVAA 1E6QM 1GSNA 1IHIA 3WENA 1VC4A 2QPXA 5KZDA 4BEQA 4ML9A 1XX1A 2DIJA 4Q22A 2ZUMA 3GXPA 2QCMA 3MV01 5F4XA 1KBIA 4JIEA 1KFLA 1XIMA 4MNJA 2FZ9A 1G01A 4IH3A 2PEVA 1PJ9A 4S38A 3SQLA 5L9FA 3H54A 3SN1A 2FDSA 4UOQA 4ZQCA 4C7GA 1KBLA 4YCOA 3KP1A 3WK2A 1XHCA 2GQAA 1TR9A 3NWRA 5A3HA 3UZYA 1HVQA 3N14A 4L4MA 2YZ5A 1U1HA 3AZTA 4I5UA 3WQ5A 1F76A 4Q7NA 1XG4A 3H70A 2XIMA 2GVEA 3VNYA 2Z6IA 3W86A 2A2IA 1A5KC 2FB2A 3DYPA 1PWMA 4RK8A 1ZSXA 2R9RA 3NJ3A 3WMBA 4YPJA 5CLTA 2YXXA 1UIOA 4HNUA 1KM6A 3C56A 3HGRA 1TMHA 2D2HA 4C6KA 5CAHA 2DH3A 2G0WA 4GZJA 1XP3A 1Q8AA 5FEZA 4AD2A 5F2GA 2GR0A 3LPOA 3BICA 3K8LA 3W1NA 2XGZA 4HNOA 5G2WA 5CLWA 3N9SA 4QM1A 1FHLA 4FLRA 1I75A 3OBKA 2FH6A 4ZCWA 1XCWA 2E3TA 2HBXA 1LORA 2B4GA 4UTLA 1UOKA 3GR4A 4U5IA 3TTSA 2HXUA 7ENLA 2VEIA 2VVNA 3C2VA 1VFSA 4Z17A 1OCQA 3L2LA 2DP3A 3LERA 4MYAA 1D9EA 4GI9A 3ES7A 2V69A 3GZ3A 1QFEA 2J7EA 3LTSA 1I8JA 4WQ6A 1NDVA 4JTCA 2OLSA 4AY8A 1VYSX 4J3TA 4LWWA 1HL8A 1CPUA 4GIRA 4KMQA 4Y9NA 5CPOA 4OOUA 4CNUA 3D47A 4AYSA 3CC1A 2A6NA 2PGFA 3LM3A 2NW0A 3HTWA 3A24A 2C13A 2YQUA 2GQWA 3L4TA 3O1NA 2O9OA 1YDOA 3NVDA 1LL6A 3I3EA 1UP2A 2A3HA 2DUXA 1GNXA 2OO0A 1KGXA 3AIRA 3HZ3A 4CQAA 6PTDA 3NQ8A 2DJLA 2GQ3A 1W54A 2O7QA 3TOPA 2J7CA 4M56A 2BY2A 5GJMA 1KN0A 4QITA 4URIA 2WPBA 1UR0A 3Q37A 4O28A 2J6XA 4EE9A 5CXPA 1BSLA 4HD5A 3OLIA 1Z48A 3KTCA 2CXEA 3SURA 2PCEA 4MWAB 1A4LA 2FPYA 4F3HA 4KQNA 3XISA 4A8IA 2W4XA 1OFQA 1MZRA 5JIPA 2XIBA 1WYGA 2XH2A 4L9ZA 3CWOX 4Y9AA 4TVUA 3N19B 4O0KA 5GNYA 4FLQA 1CGTA 1TX2A 3WQPA 1KXHA 6A3HA 3QXBA 1ZUAX 5DXYA 1XSKA 2GL5A 4HPHA 1K6WA 3QC0A 3A5FA 4JQ2A 1A3HA 3GUWA 1TZ9A 2DZSA 3NIYA 2WVVA 3RLHA 3KHDA 3VO0A 5J04A 4G8TA 2DFAA 3UR5A 1EGZA 1GVSA 2Z1VA 4HBKA 1AH4A 3MQTA 4CGTA 2GVJA 3ARPA 5DBUA 1UQZA 3S2LA 1KM5A 3CS2A 3I65A 3VTRA 1EJSC 5EU9A 5D38A 3KBNA 3MMUA 1ISZA 1G4PA 1PEZA 2A3AA 3KCLA 2D24A 2DZVA 5C5YA 2PTWA 1TYGA 4GYFA 3MDWA 1FWDC 3TWBA 4JYEA 2GJXB 3K2GA 2VFGA 1PX3A 5T9BG 1RJPA 4DBEA 3W2LA 1F73A 3EPNA 2V63A 1WUEA 3TC7A 3IJ8A 3OHMB 6REQA 4I5XA 4EF9A 1EH9A 5ENLA 2ZA3A 2FVLA 1YPFA 2JBMA 3FVDA 2DSVA 1D7FA 1DORA 3ANVA 1UZ4A 1SFLA 3VU2A 1IZCA 5DFAA 3MI3A 3T0CA 3BVJA 3KRSA 5CPMA 4UFHA 4J28A 4LVBA 2DZWA 1IEWA 2Y24A 3UJEA 3GDKA 3OG3A 4C7DA 5B80A 3BH4A 4FNTA 3UZ5A 4M1RA 3KRZA 1OF6A 4H2CA 3UWWA 2DZTA 2VFEA 2QVHA 1N8IA 4NRSA 5D9MA 3AS3A 2PD5A 1RQBA 4L4OA 3PY2A 1SU5A 4UTTA 3P5YA 4K3ZA 2ODOA 4HZ7A 4DNMA 1P6BA 3CMFA 1VJSA 4JPGA 2NLIA 4Q32A 3ZT6A 4DZIA 1S7MA 2OSWA 3NL2A 2C0HA 3PTKA 4O11A 4O1BA 1ONFA 1R3VA 3W71A 2VOMA 4LRTA 1GQLA 4CD7A 1XINA 3QSRA 3UYCA 4V33A 1Q6QA 1J0YA 5I3IA 3SO7A 5JQ9A 4Q4RA 3VIMA 3EZ4A 1DOSA 4GNVA 1JULA 1V8EA 2V3AA 2VZVA 3V5FA 3CHVA 4H01A 3AIBA 1PZ2A 1TJRA 3O0HA 1YEYA 1IIGA 4KH2A 3BK0A 1JUEA 3FDKA 4H4PA 1SMDA 4RX0A 5AC6A 5AYYA 2QQ6A 4E4PA 2RFGA 2GDQA 4NAFB 1AUSL 1SJBA 3GHTA 2H8XA 4LYKA 4UNLA 3KAOA 2TSYA 1V3JA 5HPCA 3LSCA 1UR3M 3WQCA 5CPNA 3VKJA 5C6MA 3AS0A 1O5RA 3PWAA 1NY1A 1UC4A 1WZAA 2P5NA 3Q2DA 2A8XA 2QMJA 2GVGA 1V0NA 2C16A 1CI1A 1ZBKA 1R2RA 2AAQA 2ZVRA 4C7FA 4EP8C 5JVLA 2V5BA 2VC9A 1FWNA 1AW2A 2OGJA 4KPRA 7PTDA 1QI5A 1AOGA 2PF0A 2DUZA 1K03A 3HURA 4LUTA 1XYZA 2DDXA 3GX9A 3UWVA 1S3TC 1GQKA 3V75A 4OBSA 1CBGA 3KZPA 4KWVA 1GJUA 1C8XA 1E6PA 2GUBA 4X3ZA 1ITCA 2IUZA 1ZPTA 1BKHA 2BP1A 4LUJA 4JN7A 2V5LA 1TMLA 5TR3A 3MI2A 3WD2A 5H8MA 1VPYA 3WL1A 4WJXA 4PMQA 2BC0A 3O0KA 4XZMX 3XINA 5FJPA 1JVNA 4FK9A 1MMFA 2HS6A 2UY2A 4H9YA 3BGJA 1R3QA 1YXCA 2GFTA 5AYBA 5JRBA 2J3NA 2VUNA 3VIHA 5JXQA 3NEVA 3HIJA 3WZ0E 2V3GA 1BKSA 2E1WA 2ALRA 3TN3A 1OGGA 1JPMA 4JAWA 4LAUA 3W53A 5A6JA 2FZDA 4DJDD 1AW1A 3PB0A 4CCCA 3LN3A 5K9XA 3SFWA 1TPB1 2IKGA 1JPKA 3S6TA 1PCKA 3C2EA 3WUGA 4R53A 3ITGA 3GKAA 2PDLA 3G6LA 2DH2A 1XIJA 4P8WA 4AG0A 3V36A 4O4VA 2OWWA 2G4FA 4B9YA 1OX5A 4U2ZA 4IXXA 1VFLA 4GYPC 3TUUA 4PMRA 1YYAA 1PZ0A 4K8DA 3T09A 4J40A 4UFIA 2CC0A 4AHOA 3F4DA 3R12A 1W3LA 1J96A 2TAAA 1LQ2A 3LRMA 4QDMA 1OHLA 3F4CA 3KS5A 1KRBC 4R88A 1Y0EA 2C3DA 1QI3A 2WXDM 3ITXA 3ARRA 2VGBA 3NA8A 2VRKA 3O07A 3F2BA 2MANA 4W9TA 1KM0A 1Q45A 4PUKA 1K8YA 4WUIA 4OV4A 1Y65A 4NU7A 3O2LA 1AW5A 2V3FA 6TAAA 2ZVIA 3FOKA 2B0MA 2C79A 4LBUA 4O1EA 3SY8A 4AD5A 1XIHA 3KL3A 1J5SA 3G0SA 3SIMA 4MMWA 3HJZA 3RAOA 3K46A 1VIWA 3VI2A 3UW6A 1QTWA 5FD0A 4A8LA 4HKPA 1FDZA 1PV8A 5D03A 2IQDA 4XWUA 3KFTA 4RL3A 1ZU8A 3TWAA 4EK7A 4H9TA 3U3HA 5A69A 1DJWA 1EDGA 4YYCA 1B3WA 4C6NA 1DJHA 1HFBA 2YDSA 4XIAA 2EPNA 1AZ2A 2DJXA 3SIZA 2Z1XA 1B9BA 4N6EA 3AYVA 1BF6A 1MW3A 1XSJA 1F3WA 3OQ8A 2WHKA 2O9TA 4IIEA 1MEWA 3U7VA 3VNMA 5G1MA 3FGCA 4H9VA 4ERGA 4Z42C 1JPDX 4UTWA 2QCEA 1GVQA 4XZWA 4J3UA 1V7AA 3TOYA 5I24A 3LEPA 1JZ8A 3LLDA 2XGBA 4J1OA 2WOVA 1F8IA 2C1HA 2INEA 3ANUA 4H04A 3EOUA 5A94A 5K3VA 4YHGA 4MJMA 3A3XA 1ESWA 2PDXA 3SR6B 3GU2A 2XWEA 4XVEA 1MO0A 2WSQA 3HG5A 4HMEA 4X63A 1TSIA 3T08A 3C5QA 2O92A 1R7OA 3TW6A 3OVPA 2VEGA 1MFUA 4H83A 1O12A 3QF0A 4GOAA 4NX5A 3NQ2A 3V1PA 4XO7A 3CQJA 2B81A 4RE3A 3GXFA 1PYFA 5IHRA 3TKFA 3IS4A 3PG8A 3WH6A 3MW7A 4AMCA 3QQ0A 4DBUA 2Y2WA 4FP1A 4XZ9A 4DELA 3QLLA 1K1DA 1XCFA 5HJXA 2W9MA 3IWPA 4B5NA 1JZ7A 2CZFA 3GDRA 4KRUA 5C2GA 1V6TA 3VA8A 4M24A 3F03K 1BFNA 1WV2A 3LMYA 5I7GA 1K70A 1LPFA 2B7NA 1LWIA 3HPZA 3P67A 4OVXA 1C92A 4DAFA 3ARZA 2BDQA 4GGHA 4AF0B 1TWWA 1F3PA 1AA1B 1RPKA 3T8LA 1K9EA 4GXWA 4JTUA 4ES4A 3KUMA 1VBUA 2F38A 1N62C 4L6HA 1V02E 2VCCA 4HCDA 1T8QA 1NF7A 4GQRA 3STCA 3B0YA 1XW8A 4Q4KA 2IS7A 4DPQA 2BXZA 2SFPA 1RLCL 1YRRA 3BCJA 2VR5A 4TTUA 4O1FA 1Z9AA 3A13A 3W7JA 1TV7A 1R47A 3SN4A 3B03A 3DIPA 3N9KA 3NQEA 3GXMA 4H8NA 1E72M 2X50A 3KS6A 5ABFA 4P7OA 3W25A 3GRTA 1KXVA 4O52A 4KERA 2CITA 3GXDA 5C70A 3DHDA 7XIMA 4MWAC 2XVKA 3GU9A 3TJXA 2J79A 2Y7EA 4IIGA 3TW7A 1IZKA 3ARUA 2EAWA 4Q4SA 3G24A 4LS2A 2ZZBA 4J35A 2QCDA 3A47A 4IIFA 4R27A 4C1KA 1GEUA 3DEQA 4HA4A 4HSHA 4LBSA 1TV2A 5TAOA 1UZDA 2CNCA 2AQVA 4LX4A 1W3TA 2Q09A 1JNDA 2ZXAA 4HHLA 4D8AA 1EP1A 4GD0A 3TH6A 2PWVA 3ZFHA 3GVWA 5CG7A 5KZ6A 1V5XA 5HATA 1L6GA 3RNDA 4S3KA 1IV8A 3DGBA 4JTQA 1KD0A 3H55A 5HQLA 4GJJA 4LH8A 3K1DA 3MUZ1 3RX3A 3W81A 4QCEA 2B7OA 4MWAE 3PZUA 2QR6A 2JKAA 3DBNA 5DRIA 3IVSA 4JEJA 3DG6A 1D7KA 4XG1A 1DJGA 1R9ZA 3CHDA 4G7EA 3NQDA 1T40A 3REQA 2AGKA 1C8YA 1IEVA 3ALGA 1POJA 3P3BA 2Y4SA 1P0BA 1HW6A 2Z28A 1B31A 2YB4A 3G5EA 3GHRA 4ZZ9A 3WQOA 2VRQA 3PJWA 4KEVA 5CJMA 1WYIA 1XYBA 1ECEA 1P5BA 4MAVA 3C6CA 1W2VA 3EXSA 5HANA 1W1VA 1U83A 4HSOA 4JGDA 4W4QA 3I7QA 1OD8A 1AQFA 4HTYA 2HJPA 5T26A 3DYMA 2JE8A 3GRSA 2PI6A 3K13A 3TAKA 2J62A 4D8ZA 5AHIA 3CZLA 2PU1A 4BHYA 1FDYA 1JL8A 5G5GB 4O0QA 3VOFA 3POHA 4O4WA 1K4QA 4QROA 5EMLA 2A7NA 4LAMA 4A22A 2RABA 4J3VA 2GGIA 2UY4A 1KGWA 4DUWA 1K6AA 1LP6A 1MEHA 3VNIA 1MI3A 1XLEA 3N15A 2WOWA 1P0KA 2WKLA 3T6CA 2FVMA 3T81A 4WSKA 4L9YA 3W7HA 3A4AA 4M29A 4QR6A 5A8MA 3F2CA 3MKVA 2V5DA 3I68A 2IKJA 5LYRA 4MLJA 5AHEA 3W1TA 3ZWSA 1WZMA 3L4XA 2ZKMX 1J18A 2NPXA 4P7NA 3MUY1 5J8LA 3UD6A 4U28A 4TMCA 2VCBA 4XVDA 4PCTA 4X9YA 1N8FA 2E6AA 1HF6A 1I9CB 3GR8A 3UZWA 2FJKA 4F0HA 4X61A 5EBUA 4PB4A 3R58A 1FOBA 4Q7BA 4GI6A 1WB0A 4LANA 6ALDA 4HZ8A 1SPQA 1ENUA 3E5BA 3S42A 4F79A 3NDYA 1R3RA 1UH2A 7CGTA 5I79A 5C54A 1GV4A 1HT6A 2E1DA 3H23A 4G7FA 4BS0A 3MSYA 1OYCA 3R11A 3BCFA 5D02A 3WYZA 3PBMA 4ROPA 1VLIA 3VE7A 2QCCA 1V3LA 4RDZA 3BSHA 2YCLA 3EF6A 3UT0A 4CN6A 2D0FA 4XUYA 5E1QA 1AL7A 4CU7A 3EX4A 4HQVA 3FDGA 1XBVA 3KEHA 2C6QA 1LG1A 1RCQA 1S1PA 4JX5A 4DWSA 1VBHA 4AISA 1ZALA 5LA2A 4ZOEA 1KWGA 1W9VA 4XZNX 1F6PA 2PDWA 4HMDA 1VLWA 2BXVA 3RR1A 4AEOA 2ACRA 4NG3A 4JTRA 7TIMA 2Y61A 1IF2A 4M0XA 1JF5A 5FESA 4ICNA 4MVAA 2VURA 1OK6A 2VX7A 4J4KA 5AVNA 3TQPA 4EPKA 3DK4A 4N42A 4BCEA 1L2QA 1Q66A 1G6CA 4GYKA 1TPWA 2O9RA 5U25A 1XJBA 2ZTJA 3C2OA 4AIBA 3VZYA 4LAKA 2JEPA 3R94A 2CLMA 1XLLA 4HHHA 3BJTA 4D6DA 3HN3A 3RITA 3BLEA 3GVRA 3EEZA 4GJIA 5CQ1A 1XICA 2CLEA 3QMRA 3VMPA 3S6OA 3UZJA 1KKOA 2ZOXA 2I5GA 3BSGA 3O6YX 3GM8A 5ECVA 1XC4A 3LBMA 3W9ZA 1CXLA 1PBGA 1SFJA 3P62A 2DZBA 2QAFA 3CASA 2V5KA 3B05A 1XWYA 4MFDA 4OHQA 1R3WA 2YA0A 1MFVA 3AHYA 3WQ4A 4H6KA 1UYQA 2YKKA 3TONA 6CGTA 1GTEA 4E8GA 1EPVA 3NQMA 1QNRA 2BOGX 5DX7A 5I00A 1ZRQA 2WVVB 3R6IA 4LVDA 3KVKA 2J7HA 2GOUA 3GG1A 2Z25A 2EPLX 5IBXC 1NFGA 4NJJA 2BLEA 4O12A 1D3CA 7A3HA 2ZUVA 4Q4OA 1DYSA 5EMUA 1K9DA 2BZNA 2YL6A 4UR8A 1Q1WA 3WQEA 4H19A 2X1TA 4BQ4A 4D6GA 4TVDA 4JYDA 2D2JA 4HOXA 1V77A 1GZJA 1H7XA 3DGZA 1HUVA 4ZE5A 1UPPA 1PKMA 1QOXA 3W28A 3OPSA 5PTDA 1K7EA 1HKJA 1FH9A 1Q65A 4B9ZA 3GAYA 4IUOA 3F4VA 3LHYA 2IXUA 3BL3A 5JUVA 4CKQA 3P61A 5A2BA 4LA1A 1FWBC 2YA2A 3P0WA 3GSMA 1PKYA 1Z3NA 1AL8A 3G8EA 4HMCA 3WD1A 4Q6XA 1Q6CA 4M52A 3RG6A 3UA4A 4UNKA 1UH3A 3WLTA 1YLVA 4LGXA 2HCVA 3GW3A 4Z0JA 3SUVA 1J6OA 3RYSA 2X0SA 2VP8A 3FW6A 3B4UA 1B3XA 8XIMA 4H9MA 3UERA 3N6JA 1C7TA 2DT2A 3WH7A 1DWAM 1TREA 2EXOA 5A8OA 4WXYA 3SBFA 2V8ZA 4NQ1A 2QF8A 4N02A 1JAKA 1FCUA 4AIEA 1FX6A 5FEPA 4P61A 1AQMA 2AMXA 4AX6A 5GJNA 2NWRA 4KRTA 1UD3A 1R8LA 5D9PA 3P93A 2QAPA 2WKJA 3U4AA 1Y7VA 2HE5A 4X2RA 2IPJA 4HMNA 1MNSA 4ATLA 2WV8A 3GXIA 4GUIA 4OZOA 1Z69A 4HK6A 2Y63A 1O66A 4H2HA 1XKYA 2Z27A 3S1VA 2AKZA 3TNBA 1PXGA 3DFPA 2PDKA 1AQHA 4W87A 3HQNA 4PMUA 4E5TA 3WQ8A 4FXJA 1VPQA 4QSFA 2XIIA 1IGWA 2VFIA 5D09A 2ZZ6A 2ONEA 4IXHA 3I3BA 1VBRA 4I7UA 1GQNA 4CNOA 1BLIA 3OBEA 4IWWA 1KRMA 4MKSA 3VOCA 2B7QA 4GNJA 2REQB 3MP4A 4IMFA 4GCXA 3W3OA 3ZLFA 4WD0A 4CVUA 1E1CA 3AISA 3EA2A 4HCHA 2HS8A 3E02A 4JR5A 1ZP4A 4PRWA 1WKFA 3EX2A 1LYXA 3E96A 1E73M 1CXFA 3H2CA 3TV8A 2EEXA 4N9CA 1UKOA 4IM4A 4EMWA 3IANA 2QLYA 3ZLHA 4PTNA 4JX6A 3PPCA 4CEUC 4ALDA 1M7JA 2RDXA 3NO1A 2VZSA 3QGKC 4JQ4A 1TQJA 3A7AA 3DI0A 2V0TA 1FWHC 4DZAA 4EF8A 3DFSA 4FA3A 2I7GA 4XZHA 1REQA 2YZRA 4LU0A 4HJWA 4PMDA 1EXPA 1QO2A 3AQUA 4FLSA 3QTPA 2OO6A 4KFOA 5CG0A 2G97A 1ZJAA 4NVTA 2FGLA 1FHDA 2VOTA 3MHFA 4GZ7A 5JCIA 2IPGA 3T2PA 4UR9A 3O16A 1JDDA 4ZODA 1VP5A 5LKYA 4R85A 4KGLA 1DWIM 1W9DM 1OX6A 4FOUA 2PRHA 4HTBA 4YS1A 1HIZA 4JIQA 4ROQA 4RV3A 1W5MA 2FJUB 2ZUSA 3B9NA 5AYXA 3ZJ7A 4CUCA 4E8DA 1LM1A 3G1RA 3BPWA 4AD4A 1A5LC 3WDQA 2IW0A 4UXDA 1J2WA 3WMCA 1O5XA 3BW2A 1P4CA 4H7VA 3BQ5A 3EKLA 4S3AA 1TE6A 2INFA 5GNXA 2V6AA 2X1RA 4M82A 3L5AA 3CT7A 4F8XA 4J57A 2OX1A 2OXNA 3P82A 3NRZB 1GPFA 4OBRA 2I9UA 3GK0A 4YMZA 3NVWB 3KBMA 1V4YA 1BD0A 1RY8A 3GNDA 1FRBA 3RLUA 4IMCA 1AVAA 2ATMA 4HPXA 1PE1A 4GVIA 2YLAA 4F0KA 1BRLA 1XI3A 2FDMA 2GQ9A 4GVHA 3TZNA 4B16A 2WNZA 4DAIA 2DSZA 1NHPA 1F8WA 2WM1A 3WQ6A 4CVWA 3ITCA 4ENLA 5A6BD 5BXPA 5EL1A 2FLIA 3GYEA 4M7SA 5LA1A 3TSDA 4GUFA 3NPVA 3MYPA 5HWJA 3KLJA 2HXTA 2ISSA 1QUMA 3S46A 4H4VA 2GLKA 4TQTA 1JXKA 3N2XA 3ERPA 4N6FA 3ARTA 4IHCA 1O68A 4TVWA 3MDUA 3PNZA 1P7TA 1Q6EA 5BCAA 1HJQA 2E4TA 5FF4A 4US5A 3NOEA 1PDYA 5G4HC 4KBXA 4A29A 4DBWA 1U30A 3DFQA 2OYLA 2OKOA 3A9BA 3CV7A 1GETA 4FIRA 4BURA 1O60A 3MB9A 1XDMA 2PRMA 4GACA 1GOKA 2FGBA 4H8HA 4IGMA 3W38A 3FJ4A 3AMZA 3BDKA 3WK3A 3MMDA 3LPFA 1LLOA 4BV6A 4NJIA 2WZEA 5A6SA 2WK2A 4ZQMA 5D2WA 1EOMA 4DJFC 5HMEA 2V67A 4XSLA 4NZCA 4LB4A 2CYGA 2VGIA 1RA0A 1B3ZA 1F9CA 4Q8PA 1LQ0A 3FNDA 1X38A 4QQUA 1I4NA 3C0SA 2DY3A 4F2TA 3WLRA 3EB3A 3A4JA 3TSBA 4LC6A 4ZQNA 3TIMA 4P5UA 3RF9A 2NWSA 4PZVA 4LFYA 1LRNA 3EAOA 5EKYA 1S2AA 3QBUA 1A47A 1BG9A 3FGCB 3W7LA 1C8VA 1TWSA 2QPUA 1DXLA 1Q3NA 4PUDA 4HU3A 3URBA 1FFRA 3E0IA 4I3GA 3Q4DA 3CQHA 3HQ1A 4OT7A 3L66A 1ZTVA 4LYRA 2YVGA 1FHUA 3E3HA 1EIXA 3EWYA 1RBAA 4LUSA 1LL4A 1BSIA 2PB1A 4L65A 3GFXA 1UQYA 3E2RA 2Z6JA 1E6XM 3T07A 1QT1A 3AO0A 4JKKA 1R3SA 1FDJA 1P0DA 3B8WA 1VCGA 3ZVHA 4PA8A 4ORIA 5BOOA 1LUCA 3CPGA 2FTYA 5FS7A 1OZQA 1Q7QA 3N12A 3QGVA 5LXXA 4QFUA 5CSYA 4Q8OA 1DXFA 3PM6A 2GPTA 2G3MA 4O1DA 3I4EA 4WOQA 1D2KA 4S39A 1ONWA 2WHMA 5LNWA 3T55A 1J10A 1ZJIA 7ODCA 3N2CA 2Z7GA 5FJRA 2WZMA 3S1GA 3IUIA 2ZWYA 4Z2GA 3GLCA 4GJ1A 3P6LA 1L8NA 2YJQA 2X30A 2XSAA 4RUBA 2YAUA 1IT7A 8CGTA 1XLKA 3E49A 3RNMA 2VEFA 3C4UA 3IVUA 3PBUA 5B7ZA 5MHBA 5C2CA 4E8CA 2EPOA 4FS9A 3WQVA 3TFCA 1RZMA 4LEQA 1VIZA 4GR1A 3USBA 1RJRA 2EJ1A 2QCLA 1UZHA 5A6AA 3WEZA 3LXAA 2HISA 1TCMA 3WF3A 3L67A 4WR3A 3S2NA 3QH2A 4YNGA 1ISVA 3H8AA 4IGHA 4MY8A 2X1SA 4DX3A 3S1UA 4Z2IA 3IIZA 3U48A 4DVOA 2ZRYA 5IDZA 4YTUA 4K1GA 5A6KA 1DPMA 3R4IA 3AWOA 5EBAA 5ABFB 3M41A 3GIPA 1MUWA 5CKSA 3OYZA 2WNQA 1XLFA 3LXCA 4QE4A 3LHTA 3FYOA 1FA2A 3SCNA 5FS8A 3UVIA 2IQTA 1GRHA 3CHEA 1Z32X 3W29A 3G0XA 2VWTA 4JL1A 3SQSA 2WJZA 3QYSA 1PZ1A 4RCXA 1QI2A 2WZIA 1WZKA 2PDFA 3AIWA 3CL7A 2QCDB 4FOJA 1RV8A 4PTDA 4QQ3A 1TZZA 1FFUC 1XLGA 3MCMA 2E6DA 3T78A 3VMOA 5CCZA 4IMGA 3EMZA 4IG2A 4UTKA 2ZZ0A 1ZJBA 5KITA 3UJFA 3OO2A 2A1YA 2HNHA 3NDZA 2QDGA 3VGBA 1DHPA 3SQPA 4H9XA 4KIEA 1CLXA 2TYSA 2X16A 3P80A 3EOEA 3GTXA 4JDBA 3EX1A 5XIAA 2AAAA 1ECQA 4PC8A 1F8MA 1XLAA 3AALA 1R85A 3VC6A 2VM8A 3KZSA 4O54A 2DEPA 2ISDA 1UP3A 1EJ7L 1TFVA 2P10A 2YOCA 2YCIX 3CH9A 2OG9A 2P0OA 1V3KA 3IIXA 4V27A 1I2RA 4HPNA 3VCRA 5IFTA 3VNLA 3QFWA 3GD6A 1FFQA 3OEXA 4ZOBA 2Y62A 5D33A 3WLNA 3ZT7A 5HINA 3T0AA 4HHPA 3E2SA 4H4QA 1WDPA 2WWDA 3KCJA 3VABA 1X1ZA 1OADA 2JK2A 1IIHA 1HO4A 2Y1HA 3MV11 5HJLA 1ODUA 2BHZA 4W85A 4LIIA 1ICPA 3T44A 2Z26A 4B90A 3AU2A 3PP7A 4ZB0A 4JFVA 5C7VA 2YA1A 2OPJA 1UWSA 2PDCA 5A1AA 3DGHA 1VQTA 2RJGA 2Q8LA 1GYNA 2VEKA 1FWCC 4XBSA 1H51A 3O63A 3W7IA 1W3HA 3PUGA 3OODA 3WLQA 3P81A 5REQB 3QY7A 1SO6A 1DNCA 2V30A 2ZRUA 2NSOA 2HVMA 2DSUA 1VQZA 3FSUA 4UTTC 3W82A 3SCQA 4V2XA 3VDHA 2J8FA 1CWYA 4IJRA 2QJGA 2OZ8A 3ITVA 2YL9A 3NO3A 1NVMA 2QUMA 3VDCA 8A3HA 5G4EA 5FS6A 2BXYA 1NWTA 2C14A 3U0HA 3VIGA 1NFPA 5D9OA 2DVXA 2C8NA 1HL9A 2PC4A 2VFFA 4ZTXA 1OVDA 3QC3A 4GG9A 3FJLA 1NHSA 3QHNA 4KKXA 4Q8MA 4CNPA 4AH7A 4X22A 2RDTA 5AHNA 1XYLA 1C90A 2DV0A 1FKXA 4MGGA 3HPXA 3BV4A 2NUWA 3HG3A 3DESA 4H00A 3S4TA 2CXGA 2V38A 1W1IE 1NDAA 4A3UA 3SCOA 2X09A 5D05A 2QYGA 2F61A 5D9NA 5FJUA 4UOZA 4FI4A 2PZ0A 1GEHA 4E4UA 4UQBA 4J9JA 4F9DA 2IPWA 2GJPA 2V3EA 3K5XA 1M3UA 4M19A 4DIAA 3KDOA 4FF5A 4YTQA 3OGVA 4DUVA 2WPFA 3PZVA 2D20A 1X1OA 1UA3A 4IFRA 1XYAA 5A8GA 3D5HA 1KFEA 1EYEA 5HNNA 3CIVA 3UXIA 5KTLA 5G1YA 1T7LA 3CAWA 4IQDA 3FKKA 2GDUA 5KVIA 1NU5A 2ZUUA 4FR1A 3L68A 4UWMA 3L4YA 3KRUA 1VCFA 2HPMA 3H26A 1J8VA 3RCNA 5I3GA 4FNRA 4L9XA 4NZ4A 4AVOA 1UP0A 2WMJA 3M5YA 4L5ZA 3P84A 5FF2A 2D2GA 4WJ8A 2AL2B 4JTLA 1S5WA 3TLQA 3B9JB 1E1FA 4LV9A 2Z2BA 5BU6A 4A8RA 2VC6A 1IR1A 3SAZA 4UB9A 4JTDA 4I9JA 3W02A 1W32A 3PAJA 2I5IA 4PUUA 1QO5A 4OFCA 4J5NA 4QDWA 1KCLA 4NF7A 4MB4A 1UKQA 1UW9A 2ZZ3A 3U57A 3EOOA 1JEHA 2GDVA 3GE7A 1KCKA 1K3UA 4K38A 1UMYA 4WEVX 3SY5A 3ZR5A 5F4SA 2VTFA 2ZUTA 1W2PA 3SECA 4DNAA 3VOGA 1KTCA 3WG6A 4HNNA 4DUXA 4HPJA 4XAYA 3DX5A 3KTXA 3LCIA 2WBKA 5E0FA 5BXRA 2ZZ5A 1A0DA 4C90A 4PUWA 3NR0A 3NQVA 4MNMA 4AW7A 2PLMA 1OG0A 4JS3A 4WVXA 3H4KA 3NAVA 3RMEA 1KFKA 3NZGA 2ZFAA 1BGAA 2XYLA 3WH5A 2WBGA 3N6QA 2D3LA 3DHPA 1MZHA 4GKTA 3SUTA 3L5OA 1BXBA 2D23A 3BE7A 5IDIA 3LHZA 2NZLA 4H4YA 4BQ5A 4POCA 1NWRA 1TVPA 3OTRA 3K30A 2NV9A 3QTGA 3CEPA 4L6DA 2FPVA 2EG6A 4PRRA 3M07A 1G4EA 3N25A 4HT3A 3VNKA 4CN4A 2E5BA 3WQFA 4REQB 4YN5A 2BVTA 3NL6A 1FXQA 1DTNA 1FP9A 1TIWA 4D6IA 3W75A 3QZAA 5JH1A 2CLKA 1P48A 5JCLA 1KV5A 1FWEC 1BYDA 2O55A 1NOFA 4ZB2A 4A21A 2R14A 4UFJA 1GRAA 3W7NA 2NUYA 3IV8A 5DY2A 2OLHA 2EKGA 1JG9A 3OIHA 7REQB 3ZZ1A 1HJXA 2QNEA 1ITQA 5XIMA 1EP3A 1A5AA 4GUHA 3ZSSA 1KNWA 2V9DA 5AZ0A 1FCBA 1XDLA 2J7GA 4D6FA 1PX8A 3NGFA 2EPHA 3V0TA 3WKZA 1M6IA 1DTUA 4XD4A 4KETA 3CAKA 1UASA 4P7RA 3T4CA 1FHVA 1DQUA 1Z42A 3ITYA 1FBAA 4IOTA 3NUKA 1XYCA 3P0XA 2B31A 1XR2A 4WOZA 1W1A1 3N2MA 1RLDA 3UXAA 3OVRA 3R25A 1MW0A 2CLFA 1QCWA 1ZHAA 3HPFA 2PTDA 2E6YA 3CV2A 1S2CA 2R24A 3GVGA 2VEMA 1J0KA 4MYXA 4HZ6A 2Y5JA 4IP4A 1Q6OA 3VZXA 1BEUA 3MMTA 3GNOA 4ZA0A 4NYUA 4NL1A 1TPH1 1NP0A 4W86A 4HK5A 5K9DA 5HUPA 4X9SA 2OOGA 1OBAA 3PF3A 4G6CA 4MLRA 1G69A 1OK4A 1ONEA 3GWQA 1UR8A 1PL9A 3QV9A 3M7WA 3L2IA 5FF3A 4EQSA 1QMLA 4QX4A 1A49A 2DPEA 4RZ6A 4DJEA 3DFYA 2W54A 2ZA2A 3N04A 2VR4A 4YJ5A 4RW3A 3JZEA 3VNZA 3TMQA 3BLPX 3NVZB 5TQLA 3SY1A 4DRSA 4ZO9A 4TVCA 2Z29A 5HR6A 3E0LA 1E4MM 2O9PA 3L0NA 5EA9A 1B4KA 2J13A 3WF0A 1FWWA 3L4VA 4B3LA 2P8BA 3CYVA 3NQ7A 3KCOA 3QW4B 5I6SA 3W2KA 3PWGA 1KLZA 3NPXA 2RKXA 1HJSA 3ZJ8A 4GFIA 1VH7A 2UV8G 4A3HA 4F2UA 5IBXA 3W7CA 4CNSA 1J5TA 1EB3A 3N34A 1DJXA 4B2DD 4IUGA 4AY1A 2D3NA 4P8XA 5D30A 1OT1A 4WKFA 1YXYA 3AYSA 3GTFA 1N5XA 3C2RA 4AD3A 4GE8A 3CV1A 4C6CA 4NAEB 5EBKA 3GY1A 1NQKA 2ISWA 1ADOA 3QPYA 3DZ1A 2Z00A 1JCTA 5BRPA 3AUJA 4QJ5B 4IX2A 3MHGA 2VDGA 1JYXA 2CBVA 1A80A 5D2VA 5LGZA 4OE7A 1PIGA 3EDJA 4Y9OA 1CZ1A 1M9HA 3TE9A 2J9YA 2Z4GA 4HNVA 3EUB3 4H4SA 4JTJA 1KFWA 4OTKA 5KEZA 2OJPA 3QMSA 3BC9A 4DI8A 1G94A 4H4UA 3EWBX 3C3NA 3IPWA 5FS9A 4EOUA 1JD7A 1RK5A 1NPXA 3W1PA 1Q6RA 3NPWA 1EBHA 3L65A 3GFYA 4PCNA 4E2DA 4IZGA 5M03A 1VFFA 2O4MA 2PWFA 1J11A 3BOFA 2HSAA 4FF7A 4ZENA 3VFLA 3VOHA 3M0KA 2VGGA 4PFMA 1E9IA 3L4ZA 2NSXA 4MAZA 3STGA 1Z7AA 4AIOA 2FHFA 1MRQA 5DY3A 4DJFD 1BXCA 2TODA 4BZYA 1E6RA 1KBJA 4EXQA 1EEPA 2HMCA 4P8UA 3OA5A 3W01A 3UG5A 2DZPA 1QWKA 4KCWA 3FEMA 1VRDA 1VJIA 2J78A 2PP3A 1G9HA 2J27A 4JN8A 2WP6A 2CPUA 2C18A 3ONBA 2PTYA 1WDWA 1NQ6A 3GTIA 1MUMA 2WC7A 4PRTA 1BRLB 4MTVA 1B3YA 2E68A 1G67A 4PSPA 4NP7A 4AYGA 1GT8A 2DIKA 3CAVA 3GB6A 3M64A 3WBAA 1VCVA 4GZEA 4IQLA 4LS1A 1GREA 1RCOB 4JDRA 3MHUA 3ALFA 1TJ2A 1B90A 1DL3A 5A95A 5ABHA 2CKSA 3RCMA 4PCFA 2C15A 2FZNA 2J66A 2DSKA 2GGHA 1TG7A 2W3SA 4QEHA 4PE8A 2E6FA 1W5NA 3PUOA 4J27A 1DJQA 3OIXA 3AZRA 1P7TB 3B06A 2VRJA 3UJRA 2O4QA 4R33A 1A5SA 2VDIA 3N17A 4PB5A 3T0TA 4NNAA 5HDRA 2PLCA 2UBPC 1SSDA 3MKCA 2X7WA 1RQHA 3TC3A 4AF0A 3EANA 1W5OA 2W5FA 3NXLA 4Y8EA 3TYDA 2WPEA 3FSTA 4YTRA 1S2UA 1GJWA 4D6EA 1EA0A 3VDGA 1BYCA 3NM3A 3OC4A 5HNRA 1P1MA 4FR6A 5J5DA 4B5WA 2WOIA 8XIAA 3RU6A 3IIVA 4UMCA 4MADA 3I6EA 1Q4WA 4FDCB 4MY9A 3U8GA 3LXDA 3G3MA 2QMKA 5I3JA 1PO9A 3EA3A 3GRIA 3TLLA 2PWDA 2YL8A 4RR4A 2AOSA 4FIQA 3VMNA 4EWND 1EUNA 1GRBA 2A3CA 1Q2SA 3A4XA 4R9OA 4F40A 3PFMA 2ACUA 1EBGA 1H1ZA 1FCQA 3WF1A 3EMCA 1UB3A 4QBXA 4U3AA 3PBWA 1YBQA 2TPSA 3VUSA 2ZZ7A 5KMYA 3P8IA 3QFEA 4C5YA 3PZNA 1EJUC 4QCFA 4ONVA 1S5NA 4YLWA 3R0DA 4GUGA 4ADWA 1K7XA 4EVZA 5EFDA 1TYPA 3G1SA 1GRFA 3WLIA 4JD4A 3UF9A 1BXNA 1FWSA 3W72A 3LGEA 3OHIA 3UY7A 3EMQA 5H91A 1JEZA 1AZ1A 4N9BA 3NVVB 1ME8A 3JS3A 1YPXA 2ZXQA 1CW2A 2XZ9A 3ZVHB 3PUDA 1KFJA 3WDPP 3PANA 3TQKA 4HCLA 1PWLA 4FZIA 4OJYA 5TF0A 3N2TA 1X7FA 1JDAA 3BURA 3NYDA 3DAQA 3OOQA 4PSRA 3E9AA 1U33A 4FXSA 2V68A 2I14A 3DBPA 4UFMA 4HP5A 2RHGA 4FEZA 4BF9A 3PSWA 1VD6A 2VQTA 3BOLA 4MJZA 1Y5WA 2BFGA 2PUZA 4GISA 4H1ZA 3M6DA 3DECA 2BASA 1Q13A 5BU9A 3PZQA 1KXTA 1PYMA 4PMYA 4LNCA 1H7RA 2HZGA 2X0YA 3NPUA 4GK8A 4MY1A 5T8GA 4W8BA 2OMAA 4MSSA 3W2MA 3W70A 1SVDA 3HGSA 3W4RA 1XFBA 2YBVA 4JIIX 3O6AA 1DIEA 3GQYA 3LI0A 2ABBA 3ZSTA 1N55A 3A64A 3EKZA 1DJYA 3T1GA 2DORA 4NJKA 3N3MA 1LVLA 1U2YA 3QZ6A 1UKSA 4TV5A 3WJSA 2X7VA 3QHMA 2PLKA 2XH0A 3EGJA 3OQEA 2X1UA 1SFSA 3NO5A 1G4TA 5CZ0A 5ER0A 4DZ5A 3CHFA 2A85A 3QLDA 1F3EA 1NF0A 3E2VA 3IAQA 1FCVA 1XLDA 5HWMA 5BOFA 2AKMA 3UGRA 3G18A 1UD6A 1ZBWA 3LU2A 3NEHA 4HOZA 1I1WA 2WSPA 1X8FA 5D32A 4QGCA 3K4WA 4IMEA 1SQ7A 4Z1DA 1CB2A 1GG0A 1BTCA 2HQAA 1DIDA 3PAOA 4RJEA 3BAXA 3LQLA 5BNKA 3STPA 4EPEC 1TELA 1I0DA 3S2CA 4IISA 4WCJA 2PC8A 4Y9MA 4Z1AA 4M8UA 2GVLA 3AYRA 3E6EA 3GR7A 3B8DA 4IL0A 5I06A 2ZTKA 4FX7A 3AIVA 4IG2B 1SW0A 4Z08A 4HGXA 4WK9A 3RFAA 1WXYA 1RUSA 2DT0A 3A21A 5M17A 2X8GA 4F48A 1AFSA 1UH4A 1NP2A 1XUUA 1YX1A 4N2YA 2B7PA 1WOBA 2E3ZA 2CESA 3CB8A 5M5DA 4WSHA 2X8RA 4ZQPA 4JFUA 5CSSA 4JQ9A 1GOOA 2VL4A 3AHZA 3I10A 1LG2A 3L4WA 2WWCA 3L8KA 5EMJA 2ZXBA 5CPQA 4ZVJA 2QDDA 1GW9A 3UWUA 4S23A 5EFFA 3EOSA 3WUFA 1G0CA 1IEXA 1XDJA 4MZYA 1EEXA 2PGEA 3M0MA 4O16A 4JY8A 5FA5A 1HQTA 1E3ZA 4L80A 3N3TA 2Y8KA 3WD4A 1JZ3A 2Z7KA 3RDKA 5TD4A 3N6HA 1M6JA 2QCHA 1E9LA 3AXKA 1N60C 1YHTA 3M0ZA 2QHAA 3CUFA 4C6BA 1X6LA 2HE8A 4LNYA 3V4BA 1I0BA 5JMUA 4CQBA 1FTXA 3M1ZA 4ATWA 3MVIA 3UWZA 3WBWA 4ZGYA 1CX9A 4A4AA 1E0VA 3FK4A 2ZICA 4C1LA 3B0VC 5GVJA 2AQOA 2VGFA 3UWQA 5E70A 1SW7A 1EBDA 3DCPA 4EXAA 2W91A 2A3BA 2WZHA 2Y0FA 2DZXA 4Y8FA 4HVXA 5HOSA 3CJPA 2FQIA 3D46A 3JZUA 4NYYA 2VFDA 1DJNA 3QY6A 3ARWA 3CHCA 5CSRA 4K8GA 2W61A 4KESA 1H7WA 1P0EA 2NQHA 4W88A 1SZGA 4WSJA 2JGQA 3QQ1A 5HWNA 1RM6B 4AZGA 1UUOA 3AM9A 1VFTA 5M2FX 3AROA 4M3PA 1K8XA 1WDDA 1MNZA 3SQMA 4KWUA 3ABOA 3B3DA 3WH8A 3B0UX 1OC5A 3DKLA 3BZGA 1IXNA 2W79A 5JH2A 3RPDA 2Y85A 1O1HA 3VD9A 3A6OA 4F4RA 5T9CE 4UTIA 2VEPA 4EKJA 1H0IA 1TWZA 4U4MA 4B5UA 1RR2A 2BY1A 4JIPA 3TN4A 1WPCA 2WB5A 5I0DA 2J7BA 2OQLA 1U1UA 1EYWA 4UOJA 1OEPA 3LV5A 5EYWA 1KA9F 1FWAC 1IT0A 4PN2A 3W2NA 4DUOA 1FY6A 3TYBA 1GXFA 2BHUA 2JFEX 3S1WA 1XIBA 3CZGA 1R0MA 3VIFA 4PFHA 1HP4A 3CGBA 5A6MA 3QY8A 3EXTA 1XD1A 2OGYA 3HG2A 4E6MA 3LCWA 2GRTA 2EG7A 2RGLA 4CEXC 3T7VA 1UWIA 3LRLA 4P7LA 4XD3A 3MCNA 2BCPA 2XFYA 4D9PA 3IGUA 3B8TA 3N4EA 2P0IA 1K7FA 1YNQA 5ECUA 4FMVA 4BR1A 2ZX6A 2DW7A 2CDUA 2XIQA 3EDDA 3GG7A 4IQEA 4JNZA 1MYRA 4QJ3B 4ERIA 3MI6A 1JZ4A 3BUVA 4TX8A 3A3HA 1GW1A 4MDPA 4IPNB 3TDFA 1XCXA 3PULA 3W87A 1Q4NX 4FXRA 2NQ9A 4L6OA 3CQIA 2NUXA 1Q7MA 3TAOA 2QAEA 1W1ZA 4E2VA 5CC7A 4N9DA 3CZKA 1UKTA 1UWUA 1OIMA 1BGGA 3AMKA 3V16A 1JPHA 1JGMA 1TTPA 3GTNA 4DLMA 3FHAA 4YCPA 4IPIA 2XZ7A 3VGEA 1EP2A 3V1HA 4AU0A 1XG3A 2ZX7A 3S5ZA 4JXCA 4Z2JA 1QOQA 3UJ2A 1AMYA 5C8BB 2QUUA 1CENA 1E6SM 4DZHA 2Z1SA 3CL8A 3HQPA 2WVSA 3VYLA 2JF7A 1EFZA 1LDCA 1TTJA 1WUFA 2E67A 1BVNP 4IIDA 4W8AA 3V3WA 2VFHA 2KX9A 2Y70A 1V93A 4GZIA 2BWGA 3L4UA 3AIEA 4GHRA 5KSWA 4WHBA 2BODX 2ZC8A 4QE5A 3H6OA 3N9RA 4HNTA 3R8GA 3PZTA 1ZKQA 3O0FA 3V7PA 3VKCA 4ZO7A 3GHUA 3LCHA 4MDOA 2R1MA 3WQWA 3KXQA 3RM9A 3S8HA 4LXFA 2PU0A 1O5QA 4D6HA 1BWVA 2ISFA 4GC4A 5JCNA 4JFWA 3M16A 5C9UA 3VAVA 3HA1A 2XH4A 4PMJA 5M1TA 3NVTA 2DT3A 1R9YA 4UUIA 1PTAA 4Q8WA 5CC6A 1KWKA 1WDSA 3CB3A 4YTTA 2DZAA 3CH0A 1QASA 2PZNA 2REQA 3ZVIA 2Z1WA 3N4AA 3TVAA 4ZXLA 3AMDA 2CFFA 3EEGA 3AU6A 3C52A 1QR7A 4BF5A 3E38A 8RUCA 2GJRA 1L0PA 1ONRA 1PPIA 1EWDA 5D2XA 3IEBA 1RP9A 1UWRA 2PS2A 3CL6A 2X2GA 2DVTA 3LZ5A 4D6JA 2Y89A 3O05A 2IXVA 3SEPA 4QTGA 3EDFA 3STEA 1E43A 1QDSA 3OLDA 1UR2A 2ZADA 4AVFA 4DXXA 3U9IA 1H11A 2D0GA 4RDWA 1TQXA 3VCNA 4AZIA 2QXWA 4F66A 3L0GA 1D8CA 1MW2A 1QI4A 1JUBA 2GWNA 3CUZA 3AHXA 1T5AA 1KR1A 4WXZA 2C0AA 2TRSA 5AVHA 2YCEA 3K1GA 2OWCA 4CD6A 1JI1A 3S6DA 2X40A 4H3DA 3II4A 4FNPA 1QW8A 3PZ9A 3LADA 3W7QA 4XZBA 5D4YA 5F1UA 1O95A 3F1QA 2QGYA 4QJ4B 1QK2A 2TPRA 3W0KA 3GVVA 1VEOA 3BCDA 1OM0A 2BHYA 3RN6A 1HTIA 1IR2A 5KETA 3UY8A 1OX4B 2R9ZA 3KVMA 4YTSA 3CIXA 4UFLA 3RIKA 2YFOA 3SUUA 5U7SA 1S1RA 3G22A 1M5WA 5BMWA 2AGTA 3BAIA 3KBJA 1SZEA 1H6VA 4S3BA 1OGSA 5BZAA 1XF0A 2VR2A 4BA0A 1CXHA 3O8AA 1GUVA 2NXGA 1P43A 5DMLA 4H6QA 5HR7A 4NY2A 4MKVA 1QW9A 4AXKA 5DBTA 1GVYA 5JBFA 3HO8A 1EZWA 3QR0A 1GVOA 3BWWA 5FL1A 4JFTA 2P88A 4HNLA 2CZ5A 1GRGA 1JCMP 4JTAA 1V6VA 1XPYA 4GPNA 4Z1YA 4I9MA 3O6CA 1HJUA 2OEJA 2YFNA 2ZRVA 2ZDSA 3WCZA 3QJAA 1XANA 2HK0A 2WCAA 4DYJA 1WBHA 5KZMA 3VX1A 3VILA 3TCEA 1IXPA 3VE9A 4EQRA 1ZLPA 4GO9A 3TSMA 1QNOA 1CXIA 3FXYA 2J47A 2QIIA 3TXZA 4YWIA 1HKKA 1RCXB 2G8ZA 2OCZA 3W84A 2NV1A 2X1IA 2YW4A 4YVPA 2QUTA 4DO4A 2GGGA 2HNEA 3AS1A 3L21A 3NFUA 2KAUC 1KFCA 2BSLA 3VXGA 2GUUA 4XZLX 3VNDA 1UZ1A 3BLDA 2YCJA 4K1WA 3ITLA 4E0CA 5GJPA 1CEOA 3AFBA 1Y5VA 4C6IA 2FMOA 4QISA 3QMTA 2ISVA 3PB2A 2PAJA 1KRCC 1VBGA 2BGQA 4NHVA 5C2XA 3RMJA 4LOCA 2JGYA 1KR0A 3E2QA 3SGZA 4C6PA 1QPKA 3UZXA 3HV8A 1GHSA 1M68A 1TA3A 3VGGA 1RK6A 5HK4A 1ISWA 3TTQA 2A21A 3A12A 4LVFA 4PULA 4JHZA 3D9XA 4PMZA 3VDBA 3CNYA 5CH9A 2EO7A 3KTSA 1WNOA 1UMLA 3DG7A 3NQCA 4CD4A 3G1FA 2ANUA 3R89A 2QJNA 1FP8A 1L9WA 3WNMA 4MB1A 3EX6A 1BYBA 1NSJA 1L6FA 3FYPA 3W7DA 3M5XA 1HGWA 3MU7A 4M7TA 3EB4A 4QG9A 3LSBA 1VFHA 3PTQA 1US3A 1VHNA 4C6MA 1UBPC 2WJFA 1M41A 3BW4A 1XH1A 4CD5A 3M0HA 1L6SA 3IVTA 3M0VA 5U1OA 3LK6A 2G3JA 3OZPA 4CQ8A 4J56A 1GONA 1AD1A 4RNFA 2CLPA 3WK0A 3RX2A 3IJ9A 1W31A 3RLGA 1E5NA 1N7KA 1QNQA 4S3EA 2VC7A 3LX9A 4IP7A 4FNUA 4HJFA 4TO8A 5BWFA 1X1NA 1VB9A 1W8GA 2V82A 2ZE3A 5E09A 4I5RA 5FAGA 3LCGA 2JIEA 3ENLA 1UWTA 3RRXA 5AFDA 1RD5A 1J0IA 4FXFA 4INFA 3W24A 4QS5A 4A3YA 2E77A 3AI0A 3INPA 2YVFA 4JY9A 2PDIA 2F5ZA 2PP1A 1R86A 1QHOA 4FSAA 1ZBVA 2XN0A 1JUKA 2QIWA 4O19A 1PTDA 3P7YA 2WQPA 3GH7A 3TROA 1F05A 3PJXA 2W63A 3B9OA 5DMNA 1UD4A 4AZBA 1RPXA 4GXPA 2NXHA 4M6QA 2XDFA 2W3ZA 1AQ0A 3GZAA 3N11A 4DBSA 4IP5A 2BY3A 3BQ6A 4OQVA 5DQPA 1XISA 3BXWA 1MDRA 1ZNNA 3I6RA 2GGEA 1E0UA 5DT5A 1B4EA 3L12A 5I03A 1BQGA 3IK2A 4AUBA 3CT2A 2H90A 1B0IA 3KBSA 1V03A 1POKA 1OY0A 3GDLA 2C19A 5MKGB 3GS6A 3KP0A 1RXOB 5LHFA 4XAPA 4DWSD 1M04A 3NTYA 3OLEA 1OYBA 2WPCA 3T40A 3S9YA 2EKCA 4HOWA 1NM9A 4W7WA 4YWSA 4CQ9A 2HTMA 4EWJA 3NVYB 1EDQA 2OZTA 4TUFA 2BNJA 3OA3A 2XU2A 4IJBA 3IIOA 5BRBA 3FEQA 1LOLA 3R7MA 5C9ZA 2YLLA 1T8XA 1UR9A 1YBQB 3NYZA 1YXDA 4LUIA 4IQJA 4EQXA 3OGRA 3PC0A 3EOLA 3G6MA 1V51A 3VKKA 2XWDA 3ARXA 3TX9A 3VM5A 4M81A 1X6NA 3MP5A 1MUCA 4JZ5A 1AH0A 4KEZA 1RH9A 3VD5A 2VWSA 3O15A 1FWGC 2ALDA 3CGTA 1OC7A 2UY5A 1B30A 1T6MA 4WY0B 1S5TA 2ON3A 2EPMX 1CCWB 1QRQA 4GQ0A 5DCBA 3TQ0A 3LTPA 1JNEA 1TCDA 4ZBCA 4A35A 5C9WA 4ZOAA 4E2OA 1DQWA 5DMYA 2ZE0A 3LPGA 1UUMA 4ASTA 2W0UA 1RBLA 1CTNA 3LMZA 1I2QA 3EPMA 2QKFA 2WHJA 2VELA 2WVUA 2YGYA 4U33A 3SRFA 3URQA 4MZ8A 1FWIC 3EDEA 1W37A 3I6TA 1GQIA 2LLEA 2ZXDA 3LBOA 3LUTA 1XLIA 1V97A 4DPPA 1IEQA 4Q33A 3KWXA 2POTA 1HVXA 1IEIA 3EWUA 1PX4A 1WBJA 3PNUA 4AHPA 3LLFA 2F6KA 4GMEA 3ME3A 2QW5A 2EF9A 1YDVA 1OINA 1UPMB 1TWDA 1JCYA 1W1PA 1A4MA 4MJ4A 2J88A 3DGRA 1E6NA 4EMIA 3VPLA 2ZZ1A 3PTDA 3QOMA 3PPHA 3N4FA 4K7VA 3BGGA 1VS1A 4W93A 2X8HA 3VD4A 4WDWA 3ZR4A 3MUCA 3ATYA 1VDVA 1WO2A 4Q3MA 2VUYA 3G3DA 3N13A 4JKMA 3SADA 1VJZA 1KM1A 1DWGM 5AC4A 4AAJA 2WMIB 3A7RA 2QCFA 2HWGA 1ADDA 2DUAA 4DF1A 4UZSA 4DLFA 1QU4A 1A50A 1IGSA 3BLIA 4R7OA 1DJIA 3RPTA 1UR4A 5REQA 1B3OA 3N1AA 3BG9A 5I07A 3RX4A 2WZTA 2XN1A 4LAOA 1F4HA 1HL2A 4K2SA 1PTGA 4HK7A 1ZENA 1UD5A 3MMWA 3GD3A 2G96A 3HPSA 3W6MA 1CGXA 5I02A 1DE6A 4ATDA 3D3FA 3UG8A 1VKFA 4RXGA 5AOUA 2XG9A 4L4LA 1V79A 3RUBL 3HV9A 3TNOA 3M0JA 1CB7B 4C6OA 2A0NA 4JNYA 2UWFA 3R5EA 1YDNA 4IGNA 3O06A 2BV9A 1A53A 1E4LA 3CZEA 5TIMA 3DENA 3SI9A 1B5TA 3H2EA 3NOYA 2EPKX 4PGLA 3L5MA 4V15A 5HUOA 1UKPA 1ZJHA 3THCA 2PE4A 4W5UA 2CKRA 1H62A 4K39A 2J74A 3TU9A 2ATSA 5AECA 1FH7A 3CGEA 3A7UA 3MBDA 2X05A 3L9CA 2YDQA 1VENA 4I7WA 1Q7ZA 3SUWA 4MPKA 3R79A 2YXOA 2Y7DA 1PS9A 4O17A 3QFAA 2WNNA 1XRFA 5CPSA 2BG5A 1YADA 3PUEA 4K37A 1ZP3A 2DZUA 1T0OA 4B3KA 1H0GA 3IRDA 3GNPA 1A3XA 3GNRA 4AEFA 2EJAA 5FACA 5D2YA 2PDUA 2QF7A 3GTHA 1JCNA 2E8ZA 3W1AA 2A6LA 1JD9A 1LJYA 3DERA 2AL2A 1K4GA 3W2JA 2Z2AA 1FO4A 1I2OA 1Q85A 4LYPA 4AZCB 5E0CA 4B5XA 2F6XA 2BOEX 1S2TA 1HJVA 3QKEA 1D8WA 1F07A 2CZVA 3IUHA 2FIQA 3ARVA 1OC6A 4IICA 3BARA 1Q6FA 1CIUA 1WE5A 3DUGA 1N2VA 4KIRA 3EBVA 3PN8A 3WQGA 5IXEA 5K4ZA 3QW3A 2WQDA 1QATA 3VIJA 3FA4A 1U5VA 2R91A 4A2RA 4H41A 4HU8A 1X7IA 2QV5A 3TTEA 3VIKA 1TPVA 3C86A 5LNUA 2ZUNA 5BYWA 5I23A 3JR2A 1W9PA 4X0NA 4GLEA 1A5NC 3LZ3A 5FF7A 4Y9PA 4DI9A 1WXZA 3RHGA 1E51A 2NV2A 2VD8A 1NDZA 2HK1A 4PCSA 1V6YA 4W7UA 5LNSA 1OFAA 3WD3A 1XIDA 2Q3RA 4UFKA 3A23A 1RP8A 4HN4A 4DJEC 5L6UA 2CCRA 1JYWA 4ZFMA 3J7HA 3VNJA 5E9XA 1R2SA 5BROA 1W5QA 3UXDA 4IMDA 3WY1A 1J9YA 3GFZA 3QEZA 4ZFCA 3M7SA 2NLYA 5BOEA 4K36A 2EBNA 3WLJA 3KX6A 5JCMA 2CERA 1H5VA 3BG3A 3B0PA 4HU4A 4KPLA 3LTYA 3WNLA 3ABSA 2G3NA 2FYMA 4REQA 3SB0A 4MUPA 3CWHA 5A6LA 2YXGA 2PCQA 3EDKA 1RBOB 4CCZA 4WKHA 1XL9A 1J79A 4EANA 6TIMA 2FTPA 5FIPA 4NJHA 3PZMA 1H4PA 3LBCA 1EJVC 1XYFA 2E8YA 1D3HA 4Q4PA 1RVGA 5AHLA 4P8VA 1JF6A 1GVFA 2A4AA 3V35A 2NQJA 3IGXA 3H2MA 7REQA 4FALA 1KTBA 4L64A 4AXNA 1ML1A 1TIMA 1GPWA 1RHCA 3GO2A 3ZO9A 4PBEA 3NQBA 3TTOA 4S3DA 2IMRA 1GYMA 3B8UA 4FOKA 1AJZA 1M65A 4ACZB 4XAZA 4M80A 1H7PA 3G1YA 1ISXA 4KT2A 1TV8A 1ME7A 3NL3A 3SCSA 5SWUA 1ZB5A 1SZRA 1H61A 4M6VA 1KM2A 3W27A 4NJGA 1S3HA 1F6KA 4DM1A 4FNQA 4US5D 1LZOA 2RDWA 1WA3A 3MYOA 2QT3A 2PA6A 1NHQA 3BG5A 3NURA 3PG6A 1CGYA 2IKIA 4AIUA 4AWUA 4GGBA 3NZQA 3NNTA 1JCLA 4D6CA 3Q65A 2QJHA 2I16A 4XV0A 1U5HA 4OUIA 2VVSA 3P74A 4YU1A 1EGMA 2CU0A 3OGSA 4Y7EA 4EAYA 2QUVA 3I7SA 3KWSA 3B9AA 3M4HA 4IPLA 3H4GA 2DQXA 4LSBA 4JKLA 1E4IA 1X6UA 4B5SA 4ECLA 1JCJA 4RNJA 3IUDA 9XIAA 3LOTA 1XDIA 2KZHA 1OJTA 1NHRA 1FUYA 4GY1A 4DO5A 2POZA 3WBEA 1HJWA 3UNDA 3ZWTA 1OQFA 2NT1A 1RVKA 3QV6A 5I3DA 3MUIA 4F0SA 2Y5SA 1EJXC 1EUAA 3UCDA 1T99A 1S2VA 1XS2A 1H50A 1RSCA 3LHVA 3CGDA 1LCOA 3GUGA 2R1PA 5FSDC 2OZ0A 1L2UA 4QP0A 4IPJA 4NXKA 1XKJA 1KXQA 4L1GA 1VR6A 3BOXA 1QWGA 2AAMA 4UQ9A 1XLCA 3MBFA 5G5HB 3I4KA 1OFPA 1YMYA 4P7QA 5DEZA 1O7AA 1UA7A 2V81A 5D04C 1KBBA 3W76A 4Y96A 2OKTA 5LIXX 4RZ4A 2FGZA 2P3ZA 4US6A 1FWRA 1YE4A 3RRAA 1KRAC 2NX9A 2Y5EA 3E0FA 3LCFA 3FVMA 3TA6A 4NSBA 3B04A 2BOFX 1XH2A 2EGZA 3W83A 3FG2P 2J4GA 1UWQA 3NL5A 4IT1A 4NAEA 1TWIA 4I8YA 3OW1A 3GC4A 1EC8A 1F5ZA 2ZX8A 2Q6ZA 4WLCA 1PVNA 4JTEA 1IZJA 2OT0A 4PBGA 4L1XA 1A5CA 3FAWA 1J12A 1OT2A 2XVLA 5KZEA 2JF6A 2ZZ4A 4AB4A 1PKLA 3AN1A 2W55A 1XIEA 2OQYA 3NQGA 4GUJA 1SJCA 4CLMA 5CZJA 2PDGA 3WJWA 4FX6M 2WJDA 4W7VA 1PHQA 1LROA 5C0QA 4WX2A 1JFHA 1QPQA 1FEBA 3H2OA 2FHBA 3W23A 4S2BA 1LBLA 1QXLA 1BF2A 3DHFA 4Z1CA 1F3TA 3VIPA 5HMDA 1DXEA 5CBJA 1ZAIA 4LPCA 1BAGA 4IL2A 1YIXA 3MSGA 5AN7A 2X99A 4W89A 5CGTA 3BV7A 2OWXA 4DO7A 5DXXA 3S0CA 1V0KA 4IGSA 1RJQA 2RAGA 3SRHA 2J6VA 3ID7A 4BY3A 3CMGA 3CMJA 4Y90A 2JKPA 5MF5A 4UCFA 1CNVA 1OF8A 1HP5A 2CBUA 1QHZA 1P1XA 2E09A 3WLKX 3DC8A 5RUBA 4XD6A 1VEPA 1I45A 1IWBA 1E1EA 4S1FA 1UD8A 1EX5A 2G3IA 4AD0A 4BEUA 2YDRA 3ZYZA 4EPBC 5AHMA 2NVDA 2G95A 3SGGA 4JDYA 4ZQOA 1RAKA 3L5LA 3F5LA 1L8PA 5AY7A 3COTA 4WJEA 3W74A 3M9YA 2W67A 5I3FA 1E70M 1EIBA 4R7JA 1AJ0A 3GHSA 3AXHA 3C2FA 1ZMDA 5FOOA 1DEDA 3RILA 2FHCA 2PURA 2VZOA 5FF0A 4GQBA 3FYYA 4NKCA 1ZAJA 1NJJA 4TX6A 3ZM8A 2R82A 3KBWA 1G7VA 2J9ZA 1CDGA 5AZ1A 3DJGX 4WF7A 1GHRA 3L23A 1EKOA 4QLKA 2ZRZA 4GVGA 4H4WA 3MP3A 3NZPA 4NRRA 3LA4A 1PUDA 5HMSA 1PB0A 4YVXA 3CUGA 4CD8A 4LUYA 2WO5A 3DHUA 1JDFA 3S5OA 3KOXA 4UTFA 5JBDA 3WFZA 4ZOHB 4QSHA 5DLCA 2F9RA 3EWZA 2FB3A 3PWIA 3AYTA 3KBVA 3VD7A 4B4FA 3WMLA 5I78A 4C6DA 2Q3OA 4A3QA 3G1DA 1E55A 4O8AA 4AMAA 2JKEA 3VIOA 1TA3B 2PLJA 4R7WA 1H41A 1VHCA 2CEQA 4WDTA 1G4SA 3SCTA 3S3GA 1EZ2A 2CHOA 4NASA 5LIYX 1GTHA 1S2WA 1JOAA 3H4XA 3MANA 3BTNA 3T2QA 5CBBA 3BSMA 1KCXA 3ZS4A 3TW9A 3P2VA 3CQKA 4ZTYA 2E0PA 3MY9A 1JFXA 2PDMA 3HG4A 1WZLA 2A79A 1KFBA 3CEUA 1J0JA 2WNWA 3K8KA 2PSNA 3QPEA 4BQ3A 1GKQA 1H7OA 4O50A 4QDPA 4E3TA 3LRKA 1XBZA 3QZEA 3S2JA 4UQEA 1LOSA 4RXFA 3FY1A 1H49A 3MUAA 3FA3A 2ZZ2A 2ADAA 3G1HA 1EXBA 1YE6A 2PDBA 3CXBA 4I9TA 3CUHA 1EC7A 5KINA 4RNIA 4ILSA 3GIYA 4KGJA 3EWWA 1DVJA 4H6EA 1NAL1 3BJSA 1OGBA 3HGOA 3Q58A 3KM8A 3JU2A 1W3NA 3RR4A 2HVOA 2OFJA 3HGJA 3ZOAA 4G5DA 4F0LA 4LTSA 4GRTA 3XIMA 4PUJA 3W7KA 2YVJA 1HKWA 1HNYA 1VBJA 4DXVA 2NXIA 4H4TA 1EO5A 2HQMA 4LV4A 4H6RA 4MWAD 4JYFA 4OUEA 3ZIZA 2JEQA 2PWHA 1ZFJA 2BVWA 4M5PA 5FJTA 5A6TC 5DT7A 1QHPA 2GVYA 3G2GA 1ZQ5A 4Z0SA 2QDHA 2EQDA 2IQ0A 4XKMA 2W66A 4UMAA 4KS0A 5FJIA 3W1LA 3WLSA 1XIFA 5C9XA 5AC5A 5D37A 3AWNA 3CWNA 3DXIA 2MUCA 2WM0A 1YQ2A 3TA9A 2Q8XA 4S3GA 2CFYA 4C6LA 3A4WA 1SM9A 1W91A 2TMDA 4MJ2A 5HQMA 1E0WA 4TU1A 3NZRA 2QPSA 3NSNA 2PWUA 4NZFA 3W85A 4FPSA 4GIYA 3LG3A 3WJYA 4JTHA 5G1TA 4GI4A 1EPXA 4JHOA 4O18A 2AQWA 2CZDA 3SCPA 1KB3A 3M47A 5A5WA 4OBTA 1I60A 2PFHA 4C60A 4JNMA 4FLOA 1CXKA 3IJQA 2GYIA 1DQXA 2CBIA 3W7GA 1GVRA 4RV8A 4APNA 1YTDA 1AMKA 3GXTA 1EHNA 5HMFA 1FQ0A 2I5QA 1OSEA 4A05A 4Q4QA 3ICJA 4ZO6A 4DB7A 1CLKA 3EA1A 2D73A 2HVNA 2YB1A 1QK0A 2IKHA 3W1RA 2J77A 2WVTA 1BWLA 1Q5MA 1UJPA 2E25A 1I6NA 4JFSA 1GOIA 3LGDA 4ZO8A 3KVJA 5E6ZA 5E9AA 1U22A 3FJ6A 3NQAA 4PMOA 1MRAA 3ONCA 2PDNA 4ZL1A 1VGAA 4LJ3A 3TR9A 4H4XA 2ZYFA 2EQ8A 1E5JA 3N2BA 2CWNA 1Q6GA 1ONXA 3WD0A 3Q6JA 4OU1A 3PBYA 3W37A 4C1NB 3BW3A 3UQNA 1HZYA 3PK7A 1S46A 4X60A 1IE7C 1XGDA 4K7YA 4CQCA 5AKQA 3GBDA 3UXLA 3T42A 4K8EA 2BC1A 1R87A 4EX4A 1E15A 3CLWA 1OFDA 2F8QA 4Q8VA 2GOKA 3AUOA 3UESA 4CQDA 3SDOA 2D2OA 2DW6A 3H53A 5E5CA 1EF2A 3AMLA 1VEMA 3SM0A 1M7PA 2PTZA 3HQOA 1OABA 2QCGA 5M3WA 3O7UA 2XTKA 4JIHA 4BWLA 2WSKA 3B4YA 1SO3A 3CPRA 3WFAA 3APTA 3N29A 1H1YA 3MUXA 4PB3A 2GR3A 3M5VA 1TVLA 1JRBA 4QAWA 3R8HA 2YBUA 3CTTA 4AZ7A 2D69A 2CLHA 2VYOA 5CZKA 3POCA 1OFBA 1EJWC 1VYPX 1W5PA 4DJDA 4UNIA 4AY7A 4BI7A 4DHGA 4V1YA 1LRQA 3DJJA 2QEZA 2OLAA 1EDTA 3OZOA 3K4AA 4JCLA 3VOIA 1OFOA 2WSRA 3EAUA 4R9XA 3CYJA 1JI2A 4Y6GA 4X0VA 1CGUA 1YTEA 3QPZA 3RM4A 1LL7A 2QVNA 3GG8A 2DVUA 3W73A 2I1OA 3CUJA 1GOQA 1TPC1 1UG6A 3BLLA 1DHKA 1X97A 1VF8A 4JL2A 1B2YA 4ZSUA 1JCXA 4JTKA 3HMJG 3MWCA 2I56A 3BAYA 3R0UA 1F3XA 4ICCX 2FKPA 1SZNA 2P8CA 5H2ZA 3NM1A 2YBTA 5H8UA 4UC5A 4YXGA 1E56A 5LSMA 3WK1A 1X39A 4NILA 1EJTC 3NSMA 1WDRA 4Z2HA 2PDJA 3FIGA 2UZ9A 1XXXA 1TVNA 4TV6A 4Q8QA 3EPOA 1SO5A 3ISIX 4XBJA 3AXIA 4EXBA 2Q71A 3H2AA 1OD0A 4UTJA 4HNCA 4NNBA 3ATZA 1VZWA 4B92A 4J2MA 1R5YA 3LGGA 3WBXA 3LB0A 2FZMA 2D0HA 3GBEA 4UIOA 3ABRA 1A5BA 4QIUA 4RNHA 2ZRXA 3OVQA 3FFSA 3APYA 3UCCA 1H60A 2E28A 3NG3A 3UA3A 1KO0A 4IFKB 4DJED 3SGUA 3DYOA 4LS0A 3B8IA 4NZ3A 5LNVA 5DN1A 1A5MC 2ESCA 3TYEA 3AHTA 4FNSA 1JZ6A 2XN2A 4KCTA 4G56A 3TC6A 4DYKA 1M53A 3BMXA 3SUSA 1ALDA 2VXNA 3DK9A 4TVYA 3PBVA 1QNSA 3VX0A 4DXKA 4JQ3A 1NWUA 3ABZA 4O14A 2X8CA 3W7MA 2HV5A 3B9DA 1GJPA 3S5YA 4HHMA 5DRCA 3FN9A 1NTHA 1YW1A 3RK8A 3IJ6A 5BWAA 3T9PA 5DMMA 2Y7FA 3AXXA 1XRVA 2XJ7A 4L61A 5F7UA 2F84A 2PGWA 3CO4A 6XIMA 3KVLA 3T4WA 5CAKA 1F2JA 4UQCA 5FKYA 1XSIA 1XLMA 3WIJA 3OP2A 2VENA 2YYTA 1SSGA 2J75A 3WEOA 2P76A 4IJCA 1MXGA 1FXPA 2E9BA 3WF4A 9CGTA 3GKFA 1C3FA 3OBAA 3H7UA 3SW6A 2OEMA 3QR1A 4EM3A 1HKMA 1H63A 3RO6A 2V3DA 3UG4A 2J8TA 1RQEA 3QFBA 3N73A 2V5CA 4M6PA 3MPGA 3IAPA 1QBAA 4KF1A 3LYEA 3CBWA 4N0RA 3NS1B 3A3WA 4J3SA 1H09A 3W88A 5HA7A 2HDJA 4C6FA 4KEUA 4JX4A 1OG6A 3MS8A 3EX3A 3CQ0A 3GXNA 3NDOA 3NGJA 1C9WA 3EXRA 5CGQA 1U5JA 4MIMA 2F2HA 4DF0A 4X2PA 4O15A 1JZ2A 4AWSA 4U10A 5LZLA 1XLJA 4C65A 3BLFA 4V1XA 2CHNA 1ITUA 3PHAA 3SRKA 2A3LA 3Q45A 3VIIA 1FIQB 2BVDA 1IXQA 4NNCA 5C71A 3BGAA 1H2IA 4KW2A 2W3RA 1BVWA 1KC7A 2QGHA 1SGJA 4Q4MA 3WUBA 2WC3A 3ARQA 4KEMA 4LVGA 3Q67A 4U3CA 3WLOA 3HFYA 9XIMA 4ICMA 1SZFA 2CLIA 2ZZCA 3GYCA 4I6KA 2JQXA 2Y8UA 3U6WA 3WH9A 5CGMA 2INZA 3KLKA 2EG8A 3MWAA 1SYTA 2PP0A 1C9DA 3E5PA 2CIPA 2DU2A 1GWJA 3QOKA 3FS2A 1DKWA 1WKDA 1UOZA 2BB0A 3MSDA 3IJ7A 5A8PA 1Q1RA 4LVAA 1Z89A 3W7EA 4GX9A 3R8RA 2F7FA 1KKRA 5B7YA 1PIIA 1BYAA 3SCRA 3CZ8A 4FAMA 1W1TA 3GD4A 1GZ1A 1NDYA 2RGMA 3USZA 2Z1KA 3LNMA 5HPOA 4FB7A 3L7RA 3CM4A 1C29A 1XHGA 4GINA 2PWGA 2E5CA 4MF4A 1GK8A 2NVAA 1UCWA 3RLVA 4UQDA 3VOJA 1W56A 4H7CA 1TB3A 4F0MA 3GC2A 3DFTA 3LNPA 1F4AA 4IIBA 1CT5A 4PL2A 3QV8A 3MSRA 5JIWA 4I90A 2FFCA 4JEQA 5FMHA 3SFKA 1N61C 4GY7A 1FECA 1OX4A 4WRHA 2GGJA 4DBDA 3TZFA 5CSUA 3SSJA 3U5YA 1EQPA 1MVYA 1X2HA 5JU6A 4G9PA 5EMMA 1ZL1A 2WP5A 4EIVA 3P14A 2Y7GA 1XRTA 2FPTA 3UBPC 1PDZA 4N4PA 2XIJA 3CUIA 3ITTA 3KL0A 4WY0F 5K9CA 1VFMA 3SSZA 1LT8A 2P1FA 1JYVA 1H5YA 4NI8A 4GA8A 1LTDA 1QOPA 4DO6A 4XUGA 3LM7A 1Y8BA 1K9FA 2BY0A 3S1XA 1B1YA 1HX0A 1TTIA 5AC8A 1HG3A 4I8DA 2AL1A 1F7BA 2X0HA 1BZLA 3DFHA 2R1KA 1K4HA 5EPDA 2ZIDA 3H22A 3CV6A 4UBPC 3V5OA 2GSHA 1SMAA 6REQB 1XQLA 3UR8A 1QPNA 3IARA 4O57A 2P3EA 2PDHA 4PMXA 1LOQA 1IQ8A 4LQ1A 2BTMA 3WQDA 1JR1A 2CW6A 1SR0A 1G7UA 4HYVA 4CNNA 2HRWA 3LCLA 3VC5A 4BK9A 4QLLA 1DBTA 4S3FA 3D3AA 3GH4A 3TK7A 3E12A 3FA5A 1P6WA 4K8HA 3TJLA 4QE1A 1JDCA 1JIBA 4M6UA 2ASHA 5I09A 3BMWA 3P5ZA 4O13A 3H12A 3THQA 3W7PA 4S3CA 5ABGA 3HM7A 1YQZA 3VFCA 3MVTA 2OEKA 1EQCA 5FAJA 1W3IA 3TYZA 3K4DA 4PR4A 4DEFA 5E93A 2YSWA 2XFFA 1X8CA 1KLYA 2Y88A 1XGEA 2J9XA 1DWHM 3DH7A 4I9AA 4PEKA 5DANA 4NZJA 4GFSA 2A7PA 2NVKX 3VUPA 2OU4A 5I2UA 4UQAA 3AS2A 4LBRA 1PKNA 1EJRC 4RZBA 3MTWA 5CZSA 4QXIA 5DO8A 2QV4A 3O3RA 1TMQA 5HJYA 3VKBA 4D8LA 4J3ZA 2PMQA 1W0MA 1OJXA 4LT9A 2V2HA 3W1XA 3P8JA 3FHQA 4O1AA 5J5RA 4MB5A 4RLIA 4RE2A 4GH1A 4H4ZA 4XSMA 4ZOCA 4YHEA 3U2CA 1VFOA 4DQWA 2WSYA 3K8MA 5LHEA 2Q02A 4H7ZA 4CU6A 1DE5A 1QW7A 1JYNA 1WXJA 1N8WA 2CZEA 1ODZA 3U2ZA 2G41A 3U2OA 4I6VA 1JROA 2Z2UA 4XBKA 1UBSA 5F2LA 1KCZA 1R3YA 4GQGA 3DI1A 4CCDA 1XBYA 5AHFA 3BAJA 3F2DA 4PUNA 4L4PA 3EWCA 4JQ1A 1MXSA 1F6YA 1R3TA 2MNRA