4J3ZA

Crystal structure of mandelate racemase/muconate lactonizing enzyme from jannaschia sp. ccs1
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
388
structure length
388
Chain Sequence
b'VKLDTLDIFAVAPPPPGWGGRYWLLVRVTTDTGLTGLGEVYAAGVGPEAMTHVIHDVFTRHMRGEDPANIELMSRRAHSSGFTQRPDPTVFGAFSGLEMACWDILGKARDCPVWAMLGGKMNDRIRAYTYLYPEPHHDTNAFWTSPEMAAESAAARVAEGYTAVKFDPAGPYTMRGGHMPALSDIDLSARFCAAIRDAVGTQADLLFGTHGQFAPAGAIRLAKAIEPYDPLWYEEPIPPDNLPGLSEVAAHTSIPIATGERLTGVTEFTQALHHGARILQPALGRAGGIWEGKKIATLAAAFGAQLAPHLYAGPVEWAANVHLGVSCPNLLMVEAIETPFHEALVTGRPRVENGFVAAPDAPGLGITLNDAIANAHRYTGNRLHLEMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of mandelate racemase/muconate lactonizing enzyme from Jannaschia sp. CCS1
rcsb
source organism Jannaschia sp.
molecule tags Isomerase
total genus 123
structure length 388
sequence length 388
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4j3zA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4j3zA01
3CB3A 1MUCA 2OQYA 3FXGA 2GL5A 3CT2A 1L8PA 3DESA 4IP4A 4H19A 3SSZA 2AL1A 2PP1A 2OZ3A 3UJFA 3SN4A 2PTZA 3QPEA 4FI4A 3Q4DA 1WUEA 2PPGA 2PP3A 2PSNA 2GGJA 3V4BA 4HYRA 1R0MA 3HPFA 3N6JA 4IZGA 5ENLA 3DEQA 3T4WA 1IYXA 3IK4A 3T9PA 3JW7A 2P8BA 3UGVA 4E4FA 3Q45A 3RGTA 4FP1A 3T8QA 1ECQA 3IJQA 2QJMA 1TZZA 2XH0A 3CYJA 3RR1A 1EBGA 3TQPA 1MRAA 3TTEA 2PU1A 4MGGA 2OZTA 2HNEA 2OQHA 1BKHA 7ENLA 4GYPA 1EBHA 3N4EA 3SBFA 3R1ZA 3ZVIA 3B97A 1JPDX 3DDMA 4G7FA 3GC2A 5FJUA 4E8GA 1JPMA 3QN3A 1JCTA 1SJBA 2PGEA 1MDLA 2QDDA 3H8AA 2QQ6A 3CXOA 3DG6A 3UJ2A 3IJLA 3NXLA 4HCHA 4K1WA 1EC9A 4E6MA 3IJIA 4GGBA 3ZLGA 1W6TA 4HPNA 1XPYA 4E4UA 4K8GA 3VDGA 4GYPC 4J1OA 4ENLA 1YEYA 3STPA 1ONEA 4A35A 2XSXA 3OP2A 2XH4A 3T6CA 3DGBA 3MUCA 1E9IA 1SJDA 3ZLFA 3FCPA 2XH2A 3MY9A 3VC5A 4MKSA 1FHUA 4H83A 3RCYA 1ELSA 3TOYA 3FVDA 1BQGA 3DIPA 3NO1A 4X2PA 4JN8A 3JZUA 3NFUA 3TWAA 2GGGA 1MNSA 1RVKA 2QVHA 3MSYA 4K2SA 3UXLA 5EU9A 3R0UA 4IL2A 3FYYA 4IT1A 3VFCA 4IL0A 1TKKA 4DWDA 4ZA0A 4DHGA 2XGZA 2HXTA 3I4KA 5BOEA 3MWCA 2QJJA 3OW1A 2OG9A 1F9CA 2PU0A 2HXUA 3DFYA 3VC6A 4M6UA 4F4RA 5FJRA 3JVAA 1DTNA 1R6WA 3TW9A 2PP0A 3OZMA 4J3ZA 4HCDA 1NU5A 4A6GA 3DERA 2QJNA 2P88A 3QKEA 1KKOA 3UCDA 3SQSA 4HN8A 3FJ4A 6ENLA 3GD6A 3ES7A 1MDRA 3SN1A 1FHVA 3DG3A 3PFRA 3BOXA 3R11A 2XH7A 1KCZA 1OEPA 2AKZA 1PDZA 3VA8A 2GDQA 2RDXA 2MUCA 3P0WA 3ES8A 3TCSA 1XS2A 3QTPA 3PWGA 1P48A 4JN7A 2OX4A 3NZGA 2ONEA 4Z1YA 3SJNA 2PGWA 2OZ8A 2OFJA 2OLAA 4GIRA 3UXKA 3ENLA 3PK7A 2QDEA 3U9IA 4DX3A 2FKPA 2AKMA 3R10A 3FV9A 2ZADA 3R0KA 2AL2A 4M0XA 3UJSA 2PTYA 4IP5A 3V3WA 3UCCA 5FJTA 3K1GA 3OPSA 1P43A 5BOFA 4H2HA 2P0IA 3N6HA 2PA6A 2I5QA 2MNRA 2AL2B 3S47A 4G8TA 3I6TA 3H12A 4HCLA 3THUA 2GGEA 4E5TA 4GGHA 4H1ZA 1NELA 3CAWA 1EC8A 2ZC8A 1KKRA 4DYEA 4YWSA 3GO2A 3ZVHA 3H70A 2CHRA 5FJPA 2P8CA 1JDFA 3EEZA 1WUFA 1EC7A 4EWJA 3UJEA 2P3ZA 2POZA 3V5CA 2PTXA 3H7VA 3ZVHB 3MZNA 4IHCA 2OKTA 4DXKA 2OVLA 2PCEA 3KUMA 1KD0A 3P3BA 2GSHA 3UJRA 4MMWA 3QLDA 3V5FA 1SJAA 3PWIA 2GGIA 2GGHA 2OO6A 4KEMA 2PTWA 3TJIA 2PODA 2FYMA 3MKCA 4GMEA 3RO6A 4Z17A 4KPLA 4KWSA 2PMQA 3R25A 3SN0A 2OPJA 4GISA 3N4FA 3BSMA 2HZGA 4HNLA 3RRAA 3MQTA 3D47A 3VCNA 3U4FA 3ZLHA 2PS2A 2NQLA 3BJSA 3TJ4A 3RITA 3DFHA 2DW7A 3CK5A 3GY1A 3I6EA 4GFIA 3S5SA 2O56A 4HNCA 1TE6A 1SJCA 3OZYA 5J04A 4KT2A 4DN1A 4ROPA 2QGYA 3OTRA 4JHMA 3TWBA 3P93A 3DG7A 3D46A 1PDYA 2DW6A 3EKGA 5IDZA 4ZCWA 3VCCA 4A3RA 5FJOA
chains in the Genus database with same CATH superfamily
2CLOA 3W1MA 3W2NA 4LY4A 3SDOA 1R46A 3WH8A 3IJDA 5MF5A 3CQIA 5D33A 4UTTC 1OX4A 1D8WA 2JF6A 3VAVA 1YMYA 3DI0A 1CNVA 4BWLC 4MM1A 1CTNA 2VVNA 5EMYA 1N61C 4UFJA 4H7VA 5D2XA 2PP3A 1GQLA 5AY7A 1OYCA 4MKVA 2ZTKA 3GH7A 3AXXA 3EDFA 4RXGA 1RK6A 4RW3A 5LSMA 4E4FA 3I3EA 3A9IA 3KW3A 1VFLA 4BHYA 3CTLA 3LM7A 2DZVA 1T41A 3P82A 1HL8A 3S6OA 1VEMA 3VIMA 4XWUA 2J7HA 3RR1A 1F8IA 1H1ZA 5D4YA 2J8FA 1B4KA 2XSBA 3ARSA 1IXNA 1HW6A 1EHAA 1F3WA 4KEZA 1JCJA 1BSIA 3WQOA 3HV8A 4IIBA 3VIGA 4D72A 1P0BA 4G7FA 3BC9A 3ANVA 3VGEA 1JQVA 2NXIA 1VFFA 3M0LA 5KSWA 3L0GA 1A5NC 3M6DA 3M0ZA 1HJWA 1KB3A 3UT0A 5GVJA 1GEHA 5FD0A 7TIMA 4DM1A 1XYCA 1TVPA 4CU8A 3FFSA 2PWHA 2IW0A 1GVFA 3H4XA 2VDIA 2WHJA 2R9RA 3PZTA 3QC3A 1ZS2A 1ZJIA 5M2FX 2PC8A 2FVKA 4O1CA 3FXYA 3EXRA 3DENA 3U3HA 1KFCA 3S1WA 2Z29A 4MWAB 2XH2A 4FF7A 4NRSA 3UWWA 4IG2A 2Z1KA 1XUZA 3WQFA 1BQGA 5M3WA 2INFA 3TW6A 1UPPA 4UMCA 4FX7A 1US3A 3NA8A 2FLIA 3DOPA 2WPBA 1Q6FA 5H6HA 4AEOA 2J74A 2VFGA 4GI9A 1W32A 4L61A 2I9UA 4IXHA 1X1ZA 4DZHA 2WCSA 3KCOA 1LZOA 3FYYA 3VFCA 2VM8A 5DANA 1MVYA 1FA2A 5MKGA 2VC6A 3ZSSA 3F4VA 1CENA 1OGBA 1XRFA 2OG9A 2EQDA 2HK1A 4PUUA 3T2QA 5BXRA 3E2SA 4J7RA 1GUVA 1TJ2A 2EJAA 3S6TA 4U5KA 2QR6A 2XN2A 3IEBA 2EXOA 1V5XA 2B7OA 1PTGA 3TC6A 4V1YA 1HQTA 2HK0A 2PP0A 2Y4SA 3D3AA 1OM0A 3FGCA 4DO7A 1XANA 3EB2A 1NH6A 3VDBA 4KCUA 4H4XA 5HJLA 3AS1A 1VZWA 4KQNA 3B9DA 2G0WA 5C7VA 1X38A 1X2GA 3EDEA 1H3GA 3K2GA 4IMCA 4UTMA 1V59A 4JIEA 1HP5A 2GDQA 1R3QA 3QV9A 3CUZA 2HV5A 3A64A 1QASA 2CWXA 2C79A 3GRIA 3EYPA 3SQLA 2LLEA 3GXDA 5LNSA 1AFSA 1PKYA 3FY1A 1OIFA 3R8RA 3P60A 5GJNA 3NWRA 3TNBA 3FJ6A 4LALA 4W85A 4HJFA 3QY7A 4LAUA 4REQB 3C3NA 4MB4A 5I3KA 4F0SA 1W5QA 6A3HA 2PDMA 1AW5A 3L7RA 2VR2A 3R10A 3FV9A 4AH7A 1OK6A 1YNPA 1W3LA 3WBEA 1PYFA 1NHPA 2QKFA 3SY8A 1H51A 2FTYA 3BV7A 2AAMA 4C6CA 1V3MA 4NT0A 4PBEA 3PF3A 2BVTA 5CSSA 4DO6A 2Y7GA 4OBSA 1XLHA 2VWSA 4XBJA 2FZMA 1G4TA 3NZ1A 3H2NA 2VR5A 3NL3A 2AQOA 3UW6A 4KWWA 4ATWA 4DYEA 3LCXA 1I6NA 3SRKA 2HE5A 3UR2A 2Z7GA 3WQWA 5FS8A 3SQPA 3ITGA 4KCTA 2WJDA 1B5TA 1E5NA 1KBBA 2R91A 4HA1A 1UP3A 2WW5A 4M7SA 4O10A 4H8VA 1GPFA 4JIQA 4PUWA 1RQBA 3MZNA 1IV8A 5HJXA 1BWLA 1Z9AA 1QCWA 3L66A 1V7AA 2DZAA 3P62A 3SCVA 3LZ3A 3F5KA 2Y8VA 2OO6A 2ANUA 3NZQA 3GFXA 4MWAE 5ECVA 2QEZA 2R14A 4BZYA 4AISA 2P10A 1C29A 4P7QA 3N4FA 1Q4WA 3NL2A 1AQFA 2HDJA 4C91A 3KLKA 3MS8A 1GESA 3RG6A 3DFHA 3ZIZA 1O5QA 3BWWA 4C6NA 1OABA 2PI6A 3LTPA 4IUOA 4AZCB 2PDXA 3AU6A 1AQHA 4CNUA 3H7UA 8TIMA 1ZX9A 3MI6A 2WZHA 3G1XA 3WBWA 4A3RA 1BFNA 1GVQA 3GH4A 5CKSA 4O4WA 3EA2A 2VI0A 3UYIA 1AH3A 3PTQA 4I9JA 2CLHA 2GQWA 3W27A 4H4RA 1S2VA 4RE3A 3BW4A 2Z26A 3ITLA 2R82A 2ZXQA 4UCGA 2OT0A 3DFQA 2VENA 3OJGA 1UH4A 1HKMA 2A7RA 4ZFMA 2EQ9A 4CEXC 3N04A 1EA0A 5C7HA 4CNOA 3JUGA 3M0HA 5C2CA 3N13A 3POCA 1N60C 3JZEA 4NAEB 2RDTA 4TX8A 4GY1A 4NU7A 2E1DA 2HS6A 1RA5A 1YLVA 4DEFA 3KP0A 4LA1A 4NY2A 3M64A 4FP1A 1UR0A 4UTKA 3W72A 2V3BA 4DWSC 1ZDLA 3GG8A 3TQPA 4M51A 3CV7A 3KVLA 1OSEA 2XVKA 3KLJA 1AH0A 4MADA 1HJXA 2GR1A 4FNQA 4I90A 3MW7A 3WLMA 1JPDX 1XX1A 3VGFA 3FEMA 4OGZA 3URHA 4JOMA 4RJEA 2XVNA 3E02A 5FAJA 3TAKA 4KFOA 2RKXA 2OGYA 2CLKA 3MBDA 1J5SA 4Q4QA 4CLMA 3DHFA 4XTDA 4I5UA 4MUPA 2Z00A 1FWGC 1OHLA 5CJ5A 1XYAA 3K4AA 5CH9A 4FNUA 4ROQA 2B7NA 3BW2A 2A8XA 4YLWA 1Y8BA 1U5JA 2XH4A 1A0DA 1TPUA 4XAZA 1EOKA 3LZ5A 4JYDA 3VC5A 3MP3A 3WDJA 4FR6A 3LPGA 3WJYA 3UG4A 1JZ5A 3TR9A 1ELSA 3GBDA 4RUBA 3R13A 3MMWA 4LF1A 1Q45A 4S3CA 4NJGA 2PE4A 3VOJA 3UZYA 3QR1A 3G8EA 3WH9A 4QG8A 3KRSA 3IRSA 2VEMA 3UXLA 2YXXA 2I7GA 3K4DA 1NDZA 3DN5A 4ZA0A 4AY1A 4FDCB 1E56A 2GJPA 4P7OA 2YA2A 4WK9A 1HJUA 4Y6GA 4NXSA 3VD9A 2VJXA 3VU2A 3RLHA 1PJ9A 3DK4A 1EYWA 3WBAA 4D9PA 3W86A 2Q02A 1FHDA 2WOQA 4WF7A 3A3WA 1V08A 1IZCA 2H8XA 3S4TA 1W1TA 3CU2A 1V0LA 3W7NA 4AVFA 1TPDA 4K7ZA 2YCIX 3FHQA 1XLLA 4J5NA 3I65A 2PLKA 3CUJA 5D09A 4NNAA 4ZB5A 4J2MA 5AHMA 2O7SA 2YVGA 5CZTA 1J12A 3R43A 4GKTA 6CGTA 3DG3A 3WL0A 3W7CA 1L9WA 5HNUA 4QITA 3WDRA 3EKZA 5I3HA 1PTDA 3LHVA 3WQGA 4IQJA 1NJJA 4FOJA 1MFVA 3NQFA 4D8AA 4HKPA 3AO0A 1HVXA 1BWVA 2WHKA 1OD8A 2QJGA 3HW2A 1GQJA 2PGWA 4F2TA 3QY8A 4S38A 3LHUA 5IBXA 1CLVA 5JH2A 1LDCA 3GTHA 1JULA 3GVWA 2FZ9A 2X0YA 3W7QA 5CEWA 1UYQA 4UQEA 3POHA 1FCVA 3MO7A 4MJ4A 2BGNE 1STZA 3SUWA 2PTYA 3C86A 4QS5A 3W1PA 4BFAA 2VZVA 4GK8A 3STEA 1S46A 1EX1A 5C9UA 3BZGA 2X2GA 2Z25A 1GONA 3WNMA 3DU0A 1ICPA 3ICJA 4I8YA 4US5D 2P0OA 3B9EA 5CPTA 4R7JA 2XVLA 4DJFD 3CAQA 4J27A 3G1FA 4GQBA 4TVWA 1DIKA 1DWHM 1TPB1 2A5HA 3H70A 3GM8A 1B3VA 4H2CA 4EMWA 1JDFA 1WX0A 2PBGA 1M41A 1FEBA 1OFDA 5F1UA 3HQPA 3VNDA 5EBKA 2P3ZA 3ZJ7A 2EQ7A 3H7VA 1QO5A 1TV2A 4MHBA 1MEIA 3AIEA 4LTSA 1A4MA 2Q8XA 5DRCA 4GC4A 4N6FA 2CZDA 3UR8A 1RLDA 1T96A 4QP0A 4M3PA 2VX6A 3QFWA 5F1VA 3TYAA 5CPSA 2ACQA 1DQXA 3QQ1A 4EQSA 3BQ6A 3GWQA 1XYZA 5DMMA 3CWNA 2GGIA 4U10A 4U33A 3QOMA 1XCFA 1ZAJA 2FYMA 3RO6A 4V27A 5A69A 4Y9AA 2QMJA 4X9SA 2W63A 3AUOA 3TFXA 4Z0SA 5A2BA 2HZGA 2TRSA 5DXXA 3CQ0A 4O18A 2J7BA 3DAQA 3VCNA 2QCFA 1REQB 4US6A 4EAMA 5CJMA 1AODA 3R58A 4P7NA 4NIRA 2NVAA 3QZ6A 4Q3MA 5BROA 3LXAA 1YADA 3ATZA 2GH5A 5ER0A 3T44A 1NEYA 1ADOA 5AYYA 3UXAA 2G4FA 3V0TA 4JFWA 2GR3A 4F8XA 3U0HA 1RVGA 2W66A 2VVSA 3PC0A 3FSTA 3D5HA 4C6BA 3NR0A 1WV2A 4ZOHB 2XM2A 2ADAA 3W71A 3LBMA 1QI4A 2BGQA 4HU4A 2X0HA 3ARUA 2G95A 5GNZA 4PMRA 2C0AA 3SN4A 5G4EA 3FYOA 4FXJA 6REQB 1WUEA 2W54A 4L5ZA 3G6LA 2GGJA 4Z0JA 4Q8TA 4AF0B 1EA9C 3LPOA 2E68A 1MXGA 4AXKA 1GOKA 2NQ9A 2ZIDA 3VVGA 3V1HA 2Q3RA 3EXTA 1VD6A 2V3EA 2YFNA 1WZMA 1Y5XA 5EY5A 3BO9A 3KBMA 4CUCA 2IUZA 3T2PA 1IZJA 5HAOA 3WX7A 2PCQA 1DXIA 1X39A 3XIMA 3PZ9A 3GHUA 3W7OA 2QMKA 3L4YA 2YLAA 3I68A 3VD3A 1JFHA 3GBEA 2ZA3A 3OA5A 3HURA 1S3TC 2G3FA 1MOKA 1RSCA 4LV4A 1LJYA 3SR6B 2GRTA 2JIWA 2ODOA 3ERPA 4IPJA 1W3HA 3DDMA 4OOUA 1S1RA 1H50A 2WV8A 5JXQA 4E8GA 1JPMA 2PDKA 2PRMA 3WMBA 4Q7NA 3DECA 2E9MA 3PVFA 1MNZA 5BNKA 5KZ6A 1F05A 4XSMA 1POKA 3DG6A 1H1NA 1BG4A 2CLPA 3CV6A 3PWAA 5BXTA 4IGNA 3OVQA 3LCIA 1UC5A 1T0OA 4HNVA 5JBDA 1CEOA 3WKZA 3VIIA 4CCCA 1LWHA 1QMLA 1YTKA 1M6IA 4X22A 1BKSA 1DWIM 1YNQA 3L2LA 2WMIB 1GZJA 5TR3A 2ESCA 2DIKA 1R9ZA 2QCHA 2WHMA 4YCOA 3GNDA 2RFGA 2R9ZA 3FKRA 4JTKA 1ESWA 3M0YA 3NO1A 1I2OA 4NZJA 4ZQMA 4MNJA 2GGGA 3M0MA 2HTMA 3M16A 4RDWA 5AZ1A 3SO7A 4ZQRA 4O11A 3FN9A 2ZXDA 3MU7A 1AJZA 5DMNA 4M24A 3MCMA 2CLFA 3VKBA 2TYSA 4D6EA 3AN1A 1EFZA 1P7TA 4PFMA 1FWIC 3L5MA 4RR4A 5HR6A 4B5WA 2YFOA 3W23A 4ADTA 1A5MC 1VPXA 1W2PA 2WZEA 4DRSA 4HCDA 2PDYA 4AU0A 1H7OA 3AM9A 2XGIA 1GG0A 2I14A 3THAA 3IAPA 2GVJA 4JTGA 4C5YA 2WOWA 4DJDD 3QRHA 3CPRA 3PFRA 2C15A 3R11A 1NP2A 2F9RA 3VA8A 5HANA 5BXSA 2O7QA 1O68A 1MUWA 3WQ8A 3P84A 4OTKA 4UQ9A 3DGZA 3O9NA 3WD0A 4B15A 4FLQA 3VOIA 1V6VA 2WC7A 4BQ3A 2DIEA 9RUBA 1VDVA 3RYSA 3NOEA 3QYSA 1V6YA 2VQUA 4DY1A 1BXBA 3LXDA 3KOXA 3USZA 1A53A 3SI9A 1WDPA 4RNHA 1WXZA 4HHHA 2FPVA 1RBAA 1MSSA 5G2IA 3KTXA 4XVEA 1SW3A 2YW4A 1GERA 2YDAA 1F4AA 1KFWA 2F6UA 4QNWA 4GUIA 2HVOA 3MP5A 4O1AA 1LUCA 3LV6A 3VDCA 4EF8A 1H1YA 1E1EA 2Z2AA 4NX0A 3WMCA 4OE7A 4EACA 3S47A 3VIHA 1DVJA 2J7GA 4LB4A 1CI1A 3E0FA 1DOSA 5U4NA 4H50A 1V0NA 4L1XA 1HL2A 4IIGA 1JFXA 3CTTA 3GXIA 4AZIA 1YTDA 1W8GA 4ALDA 2WC4A 4PCPA 1EQCA 1Q6OA 1G6CA 3SZ8A 1B54A 1I60A 1XIFA 3SUVA 5K9DA 5F2IA 4BEQA 4HT3A 3AMZA 4H4SA 1BVWA 4OWGA 1U2YA 2WZTA 3MSRA 2H9AB 1EKOA 2POTA 2X8RA 1EOMA 2PWEA 1M3UA 1QR7A 2WMGA 2QCNA 3CIWA 2MANA 1CB7B 5TF0A 4P8XA 1ZY9A 1ZSXA 3A23A 4B5XA 4D6DA 2NUWA 1UHVA 4H9XA 5LGXA 5BMWA 3W22A 2OZ0A 1NM9A 2A6LA 3QC0A 2DDXA 2EJ1A 4U2YA 1D7YA 2RDUA 3PAOA 2RGMA 5F2MA 2VCCA 3M07A 4KPLA 4GXWA 1J8VA 3B9AA 3R25A 4GRSA 1RP8A 2VQTA 1XLEA 3H22A 2YCLB 3TYEA 4P8WA 1E73M 1HJQA 3QVQA 4AHPA 1V7YA 5F7UA 3MDUA 1VH7A 2BNJA 3P8JA 5AHLA 3W82A 3T0BA 2VXNA 3BJSA 3IIVA 3PPGA 4PEKA 4LAKA 2C3CA 4JBRA 1ZP3A 4ZOCA 4CVWA 3CHDA 2O9OA 5CAHA 1QJWA 2NT0A 4R33A 4JTCA 3HPSA 3D0CA 5BXPA 4E0CA 4L9ZA 4Q8MA 3TP4A 1YQZA 2AAQA 1C9DA 1QBBA 2NT1A 3P93A 4M56A 2DW6A 3A5VA 5G1TA 3IIOA 1HO4A 1AD4A 1PPIA 5EMMA 2OQYA 5DMLA 3EUB3 1ZLPA 3WQ6A 1IT0A 3N11A 3QYQA 3KHDA 3NDOA 3SUSA 5CCZA 3GIQA 3LQGA 4XAPA 3VNZA 4H41A 1LORA 1FP8A 2PEVA 2ABBA 4LUIA 5DT5A 3ISIX 3AWOA 4NJJA 2WSRA 1PVNA 2WVUA 4Z42C 4O0ZA 2PSNA 5T26A 4CU7A 4ZXOA 1EJRC 1L6FA 1JIBA 1K9TA 3QW4B 2Y5SA 1IEWA 3UWVA 3UG8A 4TVCA 4L6DA 1CGUA 2W91A 4RE4A 4K6AA 3WLOA 5H8UA 5FMHA 4S2BA 1SMAA 5FJIA 3BG9A 4O8AA 2O92A 2VDGA 3QSRA 3CHFA 4H4VA 2BZNA 4H6QA 1TV8A 1SZGA 3AAMA 5KVIA 2QDHA 2W62A 1JCLA 2Y1HA 1ISVA 3EKLA 4BJHA 2V5BA 1DJYA 1JEZA 3CEUA 3AS0A 2E1WA 3WLQA 2J7FA 1K7EA 4XKYB 2YX0A 3NQBA 5IFPA 4L4PA 4XZHA 1X6UA 3ARYA 3HJEA 3QN3A 3HG5A 5I06A 1Q2SA 4NL1A 1K8ZA 5D9OA 1MDLA 4GIAA 2YL5A 3TX9A 2R24A 2VELA 5A8MA 4LWWA 5TQLA 4OJYA 2OWWA 4L9XA 1JRBA 1T99A 2KZHA 4H6EA 1VGAA 1F61A 3HQ1A 4GYJA 4E6MA 3IJIA 1JAEA 1SPQA 1TVNA 1K6AA 1BXCA 4O1EA 4A35A 3LB8A 3IJ7A 4EXBA 3T6CA 2PDWA 1I0BA 2ZE3A 1FHUA 1I2QA 3SY1A 4QE4A 1UKOA 1RCXB 2VGFA 1TREA 1HX0A 3RR4A 2R6OA 1TA3B 4S23A 1QNQA 2VX5A 5KEZA 4Z2KA 4M8UA 1GKRA 4GX9A 1LOSA 1EGMA 1XCXA 4QE1A 3WJZA 3N6QA 1Z69A 3TIMA 3R0UA 3EEGA 3AXMA 4MYAA 3FYPA 4R7OA 3W76A 1A0EA 5G1YA 2ISVA 1T3QC 4OV9A 4PN2A 2ZX6A 5DY3A 2HXUA 3F5JA 3P7YA 4CKQA 3VD4A 2XDFA 1H62A 4WOQA 1XQLA 8XIMA 4P5UA 3TW9A 2XIBA 2V2CA 2QIIA 1DXFA 2YR1A 5AC8A 3V75A 4A2RA 3V36A 2QZRA 3MPGA 1I2NA 2WMHA 5I09A 3BV4A 4HN8A 4US5A 3WLNA 4S3JA 1VBJA 3WEOA 3GC4A 4DJFA 1VCFA 2RJHA 1RD5A 3P80A 5A8GA 3OLDA 1FIQB 3DK8A 2WYSA 2W6RA 3OGVA 1JD7A 3WH6A 3ALGA 4KWOA 4LVDA 3GDRA 2W3ZA 2OX4A 2E67A 2FTWA 3T4CA 3AU2A 2NLYA 3MB9A 2OEMA 2AGKA 1XRSA 1O1ZA 2J9YA 5BOOA 3KL0A 4JTAA 1UKTA 4AD5A 5D8ZA 2VL4A 5ABHA 3ZT6A 4NI3A 2I1OA 3MSGA 4HTBA 1ZAIA 1SO4A 4H4WA 2CZFA 4XZWA 1KFKA 2DU2A 3UWEA 4XUGA 1E4NA 3PB2A 3V3WA 5FJTA 2XFFA 1OFPA 5DF0A 1AW2A 3BGJA 4W8LA 2ZZ4A 5BOFA 2HE8A 2JQXA 4ZMGA 2XZ9A 1XGDA 4UR9A 1M7JA 1NVMA 3LV5A 1E0TA 2PRLA 4Q8PA 2DSWA 3EMQA 3AYTA 1KKRA 2V8ZA 5LNUA 3KEHA 4CQBA 3AIBA 5A2AA 3A6OA 2P8CA 1A5SA 1BTCA 4QTGA 3CEPA 3W1LA 5IHSA 4OFCA 1MZHA 1S3HA 4HPHA 1OX4B 1X8CA 3WYZA 3N4AA 1QW8A 2WKJA 2J7EA 1GVOA 2PTXA 4WCJA 4NJHA 2OXNA 1OFRA 1TR1A 4JY9A 4AIUA 3ZVHB 1IE7C 4DXKA 3KBVA 4L1WA 4N0RA 3KCLA 3N25A 3AWNA 2FVMA 4C1KA 4PMUA 4AUBA 1D9EA 4DXVA 2IPWA 3UJRA 3F5LA 2BDQA 4BEUA 1JI2A 1RCQA 4CD7A 3FX4A 4QNEA 1OYAA 3E9AA 1VC4A 2GQ8A 4LCQA 2NQJA 1F4HA 1KGUA 1OFOA 1VAHA 9XIMA 3ZWTA 4OIFA 4W9TA 2BS9A 1UR8A 3DHPA 4R53A 4DNMA 3S1UA 1A5UA 1Z8AA 5FL0A 1X96A 2NQLA 1XH2A 2A3LA 3M6YA 4WQ6A 5I3IA 3H7RA 3ITXA 3GFYA 5CZ0A 3GB6A 1EWEA 2YCEA 1TE6A 2JALA 2J75A 2BVWA 4M82A 2C14A 2J13A 4KCVA 3G5EA 1QI0A 5KTLA 2NVDA 3OTRA 4GA8A 1PDYA 4WY0F 3RX4A 4A22A 1OFAA 5JCIA 1XIHA 1VFTA 3B9OA 3KRZA 3PBWA 4EM4A 1M7PA 3BG5A 3AS2A 4Q33A 3UU0A 4H4PA 4H19A 3HQNA 1L8NA 2HPMA 4HNTA 4RPQA 5ABFB 4NAEA 2AL1A 1EJXC 3ABRA 2OZ3A 3OYZA 4ZB0A 3LUTA 2PTZA 4FI4A 2XIOA 4DO4A 2GLKA 2YA0A 4YTRA 3MJMA 4PBGA 3GIPA 4IG2B 4IIDA 1W1IE 2ZE0A 4PMXA 1H7RA 1NWTA 4GINA 4MAVA 2DZXA 1W9VA 1W1PA 2NX1A 2ZZ6A 5D8WA 3OG2A 3UY7A 3G1HA 3TAOA 2HBVA 2O9TA 1XF0A 4TU1A 3T8QA 3C8FA 3EAUA 1KV5A 1MQRA 4JEQA 1TZZA 4AY8A 1XBVA 1Y5VA 4M81A 3IJ6A 4ZOAA 3FDKA 1X1OA 1FWAC 2C3ZA 3LENA 1VCVA 4FX6M 4ZO8A 5MKGB 4LT9A 3PZUA 4AD4A 2OQHA 5EMJA 7ENLA 1Q85A 2C16A 3SRHA 1TWSA 3BARA 4ZE5A 4YYCA 2GUUA 5HJYA 4B9ZA 5I77A 1KRCC 4O16A 5LHEA 4G5DA 4RNJA 3RILA 3NL6A 1QO2A 1Z3NA 3I10A 3ZJ6A 5DCDA 5CBJA 4LXFA 4ZFCA 3H24A 3VNKA 3PY2A 4DI9A 3KOFA 2NWSA 4YXGA 1XSIA 3UD6A 4CCEA 1CLKA 2D0FA 4ONVA 3AMCA 4GR1A 4QIUA 1G69A 4LS2A 1R9XA 5JQ9A 4HSHA 1TELA 3NVVB 3ZR4A 3TXZA 5I23A 3B9JB 4LAMA 4AIEA 3LHTA 3TC7A 3PAJA 1UBPC 3VIFA 3BAKA 4JDYA 3APTA 4NKCA 3F4CA 3BOFA 4J1OA 4WGXA 3T78A 4ENLA 4TVYA 3RM8A 4E38A 2C7FA 3N34A 1Q6CA 1LRQA 2JGQA 4RE0A 4IFKA 3LNPA 1BQCA 4UZUA 5DMYA 4DJDA 3S3GA 2W61A 1SR0A 3B4YA 3RCYA 2CBJA 1BYDA 4HOWA 1UUOA 4V33A 5KZDA 1T6MA 1LRTA 3VDHA 4DUVA 5KETA 3RPMA 2NUXA 2OLHA 3Q2DA 4S39A 1V0MA 1XV8A 2FJKA 4IJBA 1BVNP 5CPNA 5F4WA 1JNDA 3VGBA 3UVIA 4Y90A 4MSSA 1XJBA 1VHNA 2HXTA 4M7TA 2Q8ZA 1RLCL 4PUKA 3MWCA 3OW1A 4H7ZA 4XIMA 3CZJA 5F2GA 3C2VA 4HPJA 1E1FA 3NQ2A 1FH8A 3UXDA 4KGJA 4AD2A 1IR1A 1NFPA 2Y62A 1ZK7A 4ADWA 1J0IA 4AZ7A 3DERA 3QV8A 3AHXA 1J96A 2BY1A 4BK9A 5DELA 1FOBA 2VURA 3PPFA 4QE5A 1WKYA 2E6FA 4PMVA 2VT0A 2VZTA 1HJSA 3FS2A 4Q8OA 5DO8A 4UTHA 3C0SA 1PDZA 4MY9A 3T81A 3H4KA 4P2VA 1W9XA 4KFPA 2NV9A 4IOTA 3ZR5A 4WDUA 3TV8A 4ECLA 4LYQA 4KS0A 1LQ0A 2ZUVA 2J6VA 3PWGA 1PIFA 1X98A 1RJPA 1KO0A 3B9NA 2WC3A 1E9LA 4FNPA 1ME9A 2IXUA 5DQPA 1WO2A 1WXJA 2Z7KA 2HVMA 4E2OA 3C2FA 3R8HA 2GR0A 2CWNA 3CH0A 3BANA 2PDBA 3MUY1 2DT0A 3TMQA 4KH2A 3THQA 1JRPA 1TRIA 1IIHA 2FHCA 4DIAA 2ZDRA 2X8CA 2JKEA 5C8BB 4NEVA 1A3XA 5HMDA 3T2OA 2CLEA 3EF6A 3DKLA 3OPSA 3C5QA 4EK7A 1DNCA 2W0HA 2I5QA 1VYRA 3L4VA 2E40A 3V7PA 1YE6A 4HMDA 1GOWA 1O5RA 3RMJA 3E5PA 4NZ1A 5A8NA 3GHRA 2V5LA 2NV2A 1QW9A 2E25A 2NX9A 2UV8G 3CGEA 4OUEA 4MWAC 2O9PA 1TE1A 4RKAA 5FJPA 4I9TA 2G3IA 3MYOA 3BK0A 4ZSTA 2Q01A 2D2GA 4H9ZA 1BPLB 1XQKA 4KF1A 5IM51 1BWCA 1Z32X 1LLOA 3A21A 3SSJA 3WF1A 1GZ1A 4FEZA 2OKTA 1Q7MA 1EO5A 2OVLA 3PZOA 2BBFA 2W67A 3F7JA 1XISA 3KUMA 2DQWA 4C7GA 2GR2A 3KDOA 2EO7A 3H54A 1EYEA 1BHGA 4C7FA 4PMQA 3EPOA 2ALDA 3QPZA 1GRBA 4GZEA 3WUBA 3ATYA 4FLOA 4HZ7A 4PZVA 4N6EA 3E0VA 3MUIA 1C90A 1UQYA 4JS3A 1REQA 3L9CA 4PODA 2J4GA 4E2VA 4IGHA 4UQCA 3ABQA 1JZ8A 2FPYA 1LM1A 4GQ0A 4HOXA 3M43A 3HGJA 1QI5A 8XIAA 2YSWA 4LV9A 2JK6A 1SW0A 3LTYA 1EZ2A 3LK6A 3VINA 1NDVA 1VFSA 4EWND 2V63A 3GXMA 3HFTA 4LFYA 3NNTA 2QPUA 2ZUMA 4IIHA 1Q1RA 4H6RA 4DBUA 2A4AA 1XR2A 4FXSA 4W5ZA 2Z28A 1BG9A 4I3GA 3Q94A 4N4QA 4H00A 2PF0A 3GDBA 1AZ1A 1UOZA 4MZYA 3TWBA 3DHUA 1DXEA 4Y9OA 1YTEA 3LXCA 4H9UA 4LANA 2YZRA 3T42A 4JQ4A 3N2MA 3BCDA 5CC7A 1QPRA 1RAKA 3LBCA 3GC5A 4Y8FA 2PWFA 3WLLA 4PMNA 3O63A 2YDQA 3IUHA 3TZNA 2VCBA 2JEQA 3DESA 2PDJA 4F48A 1SZEA 2CU0A 5TNVA 2UY3A 1QWGA 3A4WA 4RZBA 1F8MA 3H2EA 1F3XA 4Z2HA 4YN5A 1IF2A 5REQA 5A6TC 3AI0A 3QXBA 5MHBA 2G97A 1XIBA 1ZJHA 3H2CA 1UD3A 1JDEA 5EL1A 2DVXA 4NF7A 2HQMA 3N6JA 4O54A 2NQ5A 1M7OA 3R8GA 2YOCA 3ANUA 1UJPA 3JW7A 2P8BA 3N1AA 2CPUA 3EPNA 4XBKA 3B03A 4KWUA 1S39A 5DEZA 4Z1CA 3GKFA 4O12A 2VZUA 3NSNA 5D9NA 3A7RA 2CCRA 1HGWA 1ZGDA 2J27A 4H9TA 4PTNA 1MRAA 4UUIA 1ZY8A 1D2KA 4UB9A 1UWQA 3OVRA 3EGJA 4IPNB 2V6AA 1E0VA 1ECEA 2G41A 1NY1A 1XIJA 2E7FA 4YWOA 4CU6A 5AVNA 4QEHA 2D1ZA 2Y5EA 5C70A 4HA3A 3C0QA 2X05A 3GXNA 2C13A 2EPHA 4AX7A 4XQ6A 3O15A 3WEMA 5IOBA 2F6KA 3LHZA 3MHGA 3TLLA 2I5GA 2PGEA 2DVTA 1F7BA 1TWWA 3MYPA 4MAZA 3RX2A 4WEVX 3ZT7A 5AFDA 1V02E 4AZ5A 3IJLA 3UXIA 5C2GA 2WMIA 3AIQA 1XLJA 3NXLA 1P4CA 5I78A 3RN6A 3AS3A 4MTVA 2HS8A 2BTMA 3OGRA 1UC4A 4DJED 1KN0A 3BURA 1Q4NX 1H5YA 4WXZA 2NV1A 2G8ZA 3BCJA 1Q2RA 3BGAA 3EMCA 3B3DA 1CGTA 3UY8A 1WYIA 4GRTA 4D2JA 3O8AA 3OP2A 9XIAA 1A50A 4GKLA 4RDZA 1U1UA 1SJDA 3P61A 4JPGA 4IPIA 4IH3A 4KRZA 1UD4A 2RDWA 2Y2WA 3JRKA 4NP7A 2TMDA 1Z41A 2IQTA 3VX1A 1LL7A 3LD5A 2F2KA 2UZ9A 2BG5A 2FGZA 3RCMA 2V3AA 1W3KA 5JCMA 5CXPA 3PJUA 3EAOA 4MY8A 2EG6A 3HRDC 1MNSA 3GTFA 3VIJA 3FDGA 1RPXA 2Y88A 1E15A 3UZXA 5EU9A 1R3SA 2YJQA 2BOEX 1EXPA 2ZXAA 3QR0A 1YNYA 2EPOA 3FA5A 3PBUA 3F4DA 4XV0A 5FOOA 5ABEA 1KV8A 2QJJA 1JUEA 5HMSA 3LGGA 4JQ2A 3R7MA 5JU6A 3VM7A 1Q66A 3SY5A 4ZQOA 2XYLA 3MT1A 2QS8A 1I4NA 2ZA1A 4WJ8A 4TO8A 1DTNA 1R6WA 3HJZA 1OCQA 5E1QA 4QCFA 5BW6A 4ORMA 1N63C 3UPMA 1WE5A 3L21A 5C5YA 2AMXA 2QJNA 4Z2GA 3WUFA 3T09A 4CNTA 2WJZA 4XUYA 5LNWA 1TMLA 4TUFA 1JJKA 1UWTA 3A4AA 3FIGA 4ZOEA 3GD3A 4INFA 3W1QA 1KCZA 1F5ZA 3TTSA 4F9DA 4GQQA 1RBOB 4LX4A 1B9ZA 3M4HA 3WK2A 3O06A 2WXDM 3PBMA 4LF2A 3NZGA 3GU9A 3QOKA 4CQ9A 2EF9A 3TROA 2OFJA 2BLEA 1QNPA 3EWBX 3H23A 2XPKA 4C5ZA 1XG4A 1IIGA 3NURA 4Y9PA 4GLEA 3ZSTA 5CG7A 3UR5A 2AKMA 3PULA 3GAKA 2YCKX 2O9RA 2PWUA 2ZVIA 4LAZA 3BAWA 1UUQA 3GTNA 2XM1A 1XHGA 2WNWA 2ZZ1A 3LY0A 3OO2A 5E9AA 2HWGA 3UERA 3PNUA 1K77A 3CS2A 4GI8A 2EHHA 5DLCA 5LA2A 3V0UA 1KM2A 4L1GA 4QDPA 4WSKA 4NYYA 4HZMA 3THUA 1HNYA 4OHQA 3U2ZA 3AYRA 1GRHA 3Q67A 2WP5A 4HNNA 3LMZA 4X9YA 3MO4A 3GD4A 5D02A 2H9AA 5FJJA 5FF3A 3UZWA 3ABSA 4LYKA 1CPUA 4AAJA 4WKAA 3ZMRA 3S5NA 2VYOA 3HGSA 4JQAA 3OIXA 4GE8A 3MWAA 7REQB 3H2OA 3FAXA 1EJ7L 3ZWSA 1PCKA 1JZ7A 3TZFA 4H4UA 2JK2A 3GIYA 3HU7A 3EMZA 1N5WC 3MZ2A 3MSDA 4K36A 3PSVA 2YCLA 1JDAA 2OMAA 3C3UA 1OADA 1SW7A 3PWIA 4G6CA 2UBPC 1XDMA 3AC0A 3B0PA 1JUBA 4ZQPA 3LXBA 4B92A 4ZR8A 4ES4A 2PDQA 3GFZA 3URQA 3MUXA 2BHUA 3GLCA 5A3HA 3A7UA 4GQGA 1V6XA 4ASTA 2H90A 2V30A 2ZOXA 3WNNA 4B91A 4F9JA 1C8XA 4LOCA 1SJCA 3B04A 2H3DA 1JI1A 1Q6RA 6TAAA 3QY6A 3BAIA 1KA9F 1RV8A 4UTUA 1W1VA 2OOGA 4ZBCA 2PDNA 1R3VA 4KEUA 1K6WA 2Q8LA 1FWEC 4UQBA 2HVNA 3IV8A 1KQYA 4DPQA 1M68A 4L6HA 4YS1A 3M0KA 3GHSA 3QV7A 2PLCA 4IPPA 3CUGA 4R34A 1L6WA 1EF2A 4PMZA 3TJLA 2NQHA 4NZ4A 1EL3A 1YDNA 5FESA 3DH7A 4H3DA 1R86A 2INEA 1TYGA 3KWXA 2DQXA 3O7UA 2P76A 3UJFA 3QFBA 5AC5A 4GACA 3U5YA 3G1AA 5CPQA 4AC1X 3UYCA 1TWDA 2UY5A 1J6OA 3LNMA 4JFTA 1JZ2A 4IZGA 3K8LA 1GK8A 4GUFA 3DHDA 3ECQA 1UIOA 2QCGA 2WCGA 3B0XA 2BC0A 3NDZA 1Q8JA 3I7SA 3KVKA 1QWKA 4J4KA 1CIUA 4GVFA 4UFMA 1EBGA 1R3YA 4AZGA 4MLRA 4PMJA 1K70A 2PU1A 4DAFA 2XJ7A 3CJPA 2X0SA 5EPDA 2G4JA 2YBTA 1ITQA 1EBHA 3PJTA 1V97A 1ZU8A 4QDMA 1P7TB 4PB5A 3ZO9A 3SBFA 2FQIA 1S5NA 3LRKA 1LL4A 4IX2A 4QROA 3QFEA 2J9ZA 3TONA 1VYSX 1V3JA 4N42A 1R85A 3LGEA 1W9DM 4HN4A 3BAXA 4MKNA 4FAMA 3W29A 1AW1A 1GVYA 2YZ5A 1GORA 1SM9A 1EUAA 1GRAA 4Z2JA 2V67A 2ZC1A 3PPCA 2H8ZA 1MQPA 3BSHA 2PBOA 3QMTA 4JAWA 4Q4RA 1JD9A 5CQ1A 2X42A 5BU6A 1LBMA 3MTWA 4Q4SA 4BQ4A 1B57A 4GGBA 3IK2A 1A5OC 1W9UA 4X3ZA 4E4UA 1B0IA 3T0AA 1M7XA 1TA3A 4O1DA 4YNGA 3AHTA 1FFQA 1KBLA 3H2MA 4J3TA 3R94A 1XD0A 3S1XA 3S0CA 4MKSA 2V82A 3AMLA 1EDQA 1DIOA 3RXZA 5K4XA 4U2ZA 3WZ0E 4DYJA 1S2WA 5FF2A 1K3UA 1P0KA 2J9XA 5HINA 2E9LA 4ACYA 3W00A 4UTWA 5H8MA 4K1GA 1DWGM 1TWIA 4I5XA 3PTMA 1HKIA 3WUEA 4IT1A 2IPGA 2YQUA 1LUCB 1PZ1A 1CGVA 2WM1A 4PMYA 2DSZA 1YPXA 3HV9A 3UG3A 3QQWA 4JTLA 1E9ZB 1B3ZA 3EOLA 9CGTA 3BXWA 1F6YA 1WOBA 3R4IA 3W2UA 1JGMA 4EANA 3O6CA 3QHMA 4O50A 5FJRA 3UA3A 2VCAA 2WSKA 5CSUA 5LNRA 1YE4A 4JYEA 1BYBA 1HXJA 4PUDA 3KRBA 4E2BA 1GJPA 1HZYA 4B4HA 1EJVC 1KFJA 1TFVA 4GUHA 3RJYA 4GD0A 1NOUA 4XD5A 3QKEA 3IRDA 2F84A 1QDSA 3DYPA 2WQPA 4KIRA 3SUUA 1OFEA 3GD6A 1MDRA 2WOIA 1QPKA 4Q7BA 1I2RA 1RZMA 3KE0A 1OEPA 3WO8A 2IQ0A 4AY7A 3U2OA 1BZLA 2MUCA 3TKFA 4DO5A 4EPDC 1OF6A 1XBXA 4KRTA 5CLTA 2YGYA 1XIEA 5CBIA 1WDRA 1V3LA 2ON3A 1GOIA 3MMTA 2DJLA 3F4WA 4DUWA 3WJSA 5FEWA 4M1BA 2PGFA 2V5JA 4IGSA 1US2A 4O14A 4K7VA 1UJQA 4GABA 3U9IA 2J77A 2BY3A 4WR3A 3WD2A 1O12A 1DYSA 2CDUA 4O1BA 2QAEA 3L2IA 4D6CA 3MDWA 2O0TA 4ADUA 5HPCA 2ZUWA 3WLKX 3U7BA 3ZM8A 1FH7A 3S9IA 3QPYA 3HFYA 4H2HA 2FZNA 2I17A 3FA3A 4DNHA 2VR4A 5M5DA 4R88A 1P6WA 1GKQA 1KFLA 3H12A 1UR4A 1TIWA 4WSJA 1FDZA 1VJIA 4GGHA 4XG1A 2SFPA 4O0KA 4OV4A 6ALDA 1IXPA 3WG6A 3ZVHA 4JL1A 2HMCA 1HKJA 3K46A 5D03A 2CHRA 3W24A 4EXQA 2WPFA 2A3AA 3U4AA 4NQ1A 2PF8A 1J0YA 3V5CA 1JCMP 4XD6A 1JDCA 3AIUA 1KC7A 3T0DA 3K5XA 1L6GA 1TPWA 3NEVA 4IHCA 5AOUA 2DV0A 4YCPA 1D3HA 3VOHA 1EDTA 4RX0A 1GW9A 1VQTA 2DZPA 4A05A 3SQMA 2VKZG 5E0FA 3HBLA 4F2UA 5KZEA 4HU8A 3W0KA 2BHZA 3OOQA 1LRNA 4AX6A 1ZRQA 5XIMA 3STCA 4HIBA 4W4QA 5JBFA 2XFRA 4JHZA 1N8IA 3UNTA 2EKCA 4HOZA 3ITOA 1VBHA 4I9AA 2PMQA 4AEFA 3CZLA 4P8UA 1LBLA 2FH8A 1KRMA 3I7RA 2YBVA 2BXZA 4JTSA 1NWRA 3BSMA 2ALRA 2V38A 1B1YA 2D69A 3T05A 1WZLA 2NSXA 3BLFA 1DEDA 1MI3A 5EBAA 3G3DA 3DFPA 2JIEA 2YXGA 3MKVA 3CK5A 3WF2A 3I6EA 3PZNA 6PTDA 3BLDA 3CC1A 2TPRA 4W84A 1ADDA 4JXCA 4O15A 2XWEA 2NW0A 2ZRXA 4HSOA 1VS1A 3LMYA 4LEQA 4EOUA 4R9XA 3GG7A 4M6PA 2HQAA 5A94A 5ABFA 5FJOA 4KGLA 1SZFA 2J66A 4XO6A 2BB0A 3P81A 3DBNA 1JCXA 1ONRA 3FXGA 2GL5A 1QK0A 4CCZA 2D3LA 4ZODA 2WZIA 4ZSUA 1TV3A 5C54A 2IXVA 5CPOA 1XLCA 3A5FA 4NZCA 4OBTA 2A21A 3KZSA 3VILA 5LIYX 2CXEA 5J5DA 1QUMA 3IGSA 1EUNA 2FDSA 1EO7A 4GY0A 4UTLA 2V2DA 1GYLA 4EF9A 4W7VA 2ISSA 4BA0A 1U5VA 4DVOA 1C7SA 5I0DA 2VDHA 1QOXA 3AISA 3QSTA 4AHOA 1EJTC 1Q7ZA 3N9SA 2WSQA 4DJEA 2Z1BA 2GDVA 5CZJA 2VUYA 4AIBA 1BLIA 3ARQA 3G18A 4ZQNA 4JQ3A 1UZ4A 2ZRWA 1TSIA 3L4ZA 4L9YA 1B3OA 2E8ZA 4GYPA 2FMNA 3GG0A 4J3SA 1LLWA 4DWSD 2NVKX 3PUOA 4HGXA 5HR7A 3E0WA 3ZVIA 4RLIA 1RALA 3W7LA 1DJXA 3LS9A 4DUXA 1UCWA 5CSRA 3W6LA 3KL5A 1OX6A 1WCGA 4XZ9A 2V9DA 2NSOA 5DBTA 3QMSA 1LQAA 3NQMA 3OHMB 2GVLA 4GBDA 5AVHA 3WDPP 1KCKA 1JYWA 3NSXA 4PBFA 3SB0A 3W87A 4UZSA 4LNYA 4WGHA 1BGAA 1TPVA 2WWDA 2GVEA 5HA7A 1JYXA 3RLUA 1PWLA 3DJGX 1I9CB 4AXNA 3SW6A 4JX6A 3TUUA 3SURA 2GJNA 5HK4A 1WKFA 5JMUA 3THCA 1ADSA 1TV7A 1NDWA 3AFBA 3BSGA 3KP1A 2DT3A 3U2CA 3VK5A 4H83A 3GXFA 3TN5A 4AWEA 1PWMA 4CNPA 3QHNA 1VQZA 1MO0A 4N2YA 5HDRA 3CZKA 3MUAA 5FIPA 4PYSA 1AD1A 3WLJA 3JZUA 1RXOB 4YU1A 4JIRA 2E5AA 3ZT5A 1DPMA 3O6YX 3H6OA 1VB9A 1W8SA 2I5IA 3WQPA 4W7WA 1H61A 3UZZA 1XRVA 2FFCA 1NHSA 4Y9MA 1BAGA 4ERGA 3HA1A 2VGGA 1ZL1A 2YXOA 1L2QA 4ZE4A 1RBLA 2X50A 4F4RA 4FLSA 4K3ZA 2P5NA 2QUNA 3V1PA 3TMLA 2D22A 4QHRA 3VO0A 4M29A 4RZ6A 3S6DA 1UR3M 1TRDA 4IMGA 4FALA 4GC3A 5AYXA 1I45A 4MYXA 3M44A 4QJ1A 4XZMX 3IGHX 3F2BA 4YL2A 4NAFA 2ASHA 3O05A 4AVOA 2BOFX 2D20A 4JQ1A 3LG3A 1V8EA 1PSCA 5G4WA 5I03A 4LNCA 3NQ7A 1C7TA 3BQ5A 4LRSA 3WQDA 3TCSA 2DZWA 3EANA 4EM3A 3GE7A 3VTRA 3RHGA 4MDPA 3QHOA 1P48A 3KRUA 2DORA 2QPXA 4H9MA 2J78A 3BTNA 1PE1A 2UY2A 3S1GA 2Y5JA 3SJNA 5E93A 4JNMA 2AMGA 2WNZA 1AQ0A 2XN1A 1TJ0A 3ZZ1A 3UXKA 1Q6LA 4Z08A 2EG8A 3MI2A 5JIWA 1K7FA 4RDYA 4KKXA 1XLGA 1TPFA 2QNEA 3W3OA 1GVRA 1XD1A 4S3GA 2JBMA 3GQYA 4PCNA 4IMEA 4ZTXA 1S5WA 6XIAA 1C8QA 3HMCA 2IKGA 1K9FA 1QPNA 5IHRA 1SFSA 2EAWA 1TUFA 1IEVA 1R30A 1FH9A 2Z4GA 1PL9A 3HG3A 3UPWA 2PA6A 1B3WA 1X6LA 1V02A 1LG2A 3NQEA 3R6IA 2V69A 1M01A 4BKNA 3CAWA 3W53A 3MC5A 4QM1A 4YWSA 3WNOA 2PB1A 1MYRA 4E8CA 3ZS4A 4LBRA 1P0EA 4M80A 1MW3A 2BODX 5AYIA 3LBOA 4UQDA 4XZLX 1IXOA 3IACA 1GOXA 4DZAA 3P5ZA 1ISXA 4WHBA 3TOPA 1CXLA 1PZ0A 1CW2A 1XUUA 4O8RA 5K3VA 1JCYA 4DQWA 3R79A 2GQ9A 4K38A 2YLLA 3N29A 5CPLA 3VOGA 5FEPA 3PZIA 3VGDA 2WB5A 3VD5A 2PDUA 1R38A 1MW0A 4DF2A 2Z24A 4WVXA 1XYFA 4WDTA 4UTWC 1NOWA 2HNHA 3KFTA 1TZ7A 3T40A 1S5TA 2QCDB 5HQMA 3BVJA 1GGOA 1FWSA 4MNMA 4KWSA 3VMPA 2X16A 1V6UA 5FEZA 4GISA 3KS6A 3DC8A 4C7DA 5HOSA 2ACRA 1Q8AA 4EMIA 3MQTA 3GZ3A 1XLAA 1BYCA 3TLQA 4BWLA 4QJ4B 4AZ6A 3SEPA 4Q8UA 2QUTA 3G6MA 4TV5A 1W9PA 3G1SA 2R94A 4KCWA 3W1RA 3BL3A 1ISZA 1Q6QA 3OZYA 7PTDA 5G2WA 1G9HA 2UY4A 1C9WA 2Z6IA 1UZHA 1NIUA 4GUGA 2NZLA 5CGQA 2QUVA 1RY8A 5A2CA 1PB0A 2AQWA 4XZNX 3SFWA 4QDWA 4ADSA 4Z1DA 5AHEA 1UWSA 2WPCA 1Q1WA 4K68A 1MUCA 5I00A 2WP6A 1E71M 3EB3A 1L0PA 3NQ8A 4M1RA 5K7JA 1GOQA 1O4UA 2OSYA 4W88A 2WKGA 5FCZA 4QAIA 3B0UX 1OCNA 4IP4A 2I16A 3VNLA 4A3QA 4B3LA 2Y70A 4I6KA 3TH6A 2PP1A 3B05A 1K4GA 2CBUA 4RNIA 1VFOA 4IFKB 1OFQA 3CUXA 3GSMA 3VABA 1WAUA 1OJTA 5AHNA 6XIMA 3GTXA 1SZRA 1NSJA 3IK4A 2PLJA 1E6SM 4XVDA 1JR1A 4D6GA 3W75A 3QGAC 3RM9A 1WOAA 2VC7A 3TYUA 4D6HA 1CB2A 1E5JA 5EMUA 1QPQA 2QJMA 1A49A 4XD4A 1IEIA 1QTWA 3J7HA 1QXLA 3TW7A 1JZ3A 2PD9A 4GYFA 3N2TA 4K8EA 1KR1A 2CKRA 2QCLA 4GZ7A 2W0UA 1O95A 3CMJA 2Y89A 4J56A 3HM7A 1GVIA 3C2OA 4XAFA 2Q09A 2PZNA 3CV1A 1DKWA 1XINA 1F73A 1GG1A 1V79A 3WF3A 4W5UA 2XIQA 4UFKA 3C52A 3L4UA 1UD2A 3P6LA 3BCFA 2JFEX 4IF2A 5ABGA 4BI6A 1E6ZA 1MZRA 4OT7A 1DE6A 4YJ5A 1KM3A 2BVDA 1EZWA 2BFGA 2QQ6A 4YVVA 4O57A 3S2NA 4HK6A 2BMBA 1RP9A 4LYPA 1EIBA 2OWCA 3SM0A 4NJIA 3C2YA 5C55A 3SCQA 3GUGA 3HN3A 4N9EA 8A3HA 3H2AA 2EQ8A 2EEXA 5CG0A 5C9WA 1QNSA 3MP4A 1E0XA 2ZRUA 3WK0A 3L12A 4AWUA 4X61A 1UZDA 2PWGA 5I07A 3ARXA 3NJ3A 3S5ZA 3S2CA 2BV9A 3WMLA 3E1F1 1CX9A 5KMYA 4IFRA 1VFUA 1H7NA 2P1FA 4FOUA 3UETA 1PHWA 2X99A 1KW1A 1NF7A 3FG2P 2CITA 1RVKA 4LC6A 4JKLA 5JBEA 3EDKA 2WJFA 4L6OA 3EZ4A 1JZ4A 1I8JA 1TX2A 5I3JA 4JTJA 3VZXA 1GHRA 4EPEC 3F4NA 3U48A 1PAMA 4GI6A 4OBRA 2JKAA 5M1TA 4V1XA 3IAQA 1HKWA 4M6UA 3DFSA 2ICSA 4G7EB 1EP2A 3LPPA 1TTPA 1RQHA 4M6QA 3OBAA 3ME3A 5A8PA 2A3HA 1YDVA 2D2OA 1SSGA 3W7MA 4HHPA 4HPGA 4A6GA 4LJ3A 2Q71A 4NYUA 2R1LA 1D3GA 3T07A 4UXDA 1VF8A 5JUVA 1GJWA 3FJ4A 5CLWA 3SIZA 1FHVA 1F74A 3BMVA 3BOXA 3RIKA 4NZ5A 2GWNA 5BMXA 3VNIA 3TVAA 1G5AA 4WDWA 1UWUA 3M7WA 1WB0A 1AMYA 1EEXA 1CXIA 4GHRA 1YPFA 4NX5A 1OG6A 1T8QA 3S2JA 4UNIA 1VPQA 1W5PA 4LEFA 1ME8A 1HKVA 1EB3A 5JVLA 2OLAA 4R3UA 1CXFA 1EPVA 5BYWA 3TFCA 2ZRVA 4Q4MA 2AAAA 4JNYA 3KOYA 5J5RA 2AQVA 3ELFA 5I02A 4MZ1A 4XZBA 4NILA 4JIIX 3VUSA 3GYEA 1GVEA 3DCPA 1T5AA 1UH3A 3SR7A 2CYGA 3NQAA 2OWXA 4RZ4A 4YMZA 1GW1A 3M7SA 3C2EA 3PTDA 2B0MA 3RPDA 3AYSA 3Q58A 1TG7A 2DVUA 4G9PA 1JXJA 4B5TA 3VKCA 1W0MA 2ZICA 1HT6A 3M9YA 4LQ1A 3FW6A 4IIFA 1I1XA 4ERAA 5A6SA 4HMEA 7REQA 5ECUA 1F8WA 1XDJA 2OSWA 3RAOA 3PPHA 3NQVA 1YPIA 1EWDA 3W85A 4BR1A 1GQKA 5CC6A 4K37A 4PUNA 2QJIA 3P8IA 2W92A 4A3YA 5REQB 1US0A 2VNCA 1EJUC 1KD0A 1PV8A 4QLLA 1XH0A 2XG9A 1XDLA 5A6LA 2RUSA 2Y7DA 3W74A 1XM3A 3SCTA 1AZ2A 4FMVA 2WMKA 1ZBCA 2D2HA 2Y0FA 4JL2A 5D30A 3FJNA 1H7WA 1OT2A 1FKWA 3PSWA 4X63A 1WXYA 3D6NA 2NXHA 5AHFA 4A3HA 4AD1A 3REQB 5U7SA 4PC8A 2QPSA 3ZYZA 1FEAA 3HPXA 2J3NA 1A3HA 2NVCA 4LVGA 3OG3A 1R87A 1ICQA 1NAL1 1TPC1 3ONBA 3TJ4A 3RITA 3NEHA 1THFD 6TIMA 2CNCA 4MY1A 3KBWA 3ALFA 4HNCA 1TTIA 4W8BA 4PSRA 5J04A 2HRWA 4I5RA 1K8YA 2RGLA 3KDNA 1TCMA 4W93A 3UQNA 1UMYA 3CO8A 3D46A 1M9HA 5DBUA 1Y7VA 3RCNA 3B8VA 1VEOA 2OEKA 3ITCA 1Q7QA 1LT8A 2C1GA 3WN6A 3LQLA 2BXVA 3NYDA 3UCQA 3WDHA 5HNRA 4MDOA 2X2YA 4Q6XA 1VKFA 2CESA 4PA8A 4PUEA 4A8IA 1TB3A 1TQXA 3WLPA 3N73A 1NQKA 3G1YA 4GH1A 1FWNA 1WA3A 1FKXA 2E9BA 2H6RA 3SADA 4NEWA 1GTHA 4GZJA 4MG4A 2V5CA 4B5SA 3HTWA 1K9EA 1A5LC 4KEVA 3WD3A 3PBVA 2WLYA 3MMUA 1UIPA 4AMAA 3G1RA 4UQAA 3VUPA 3PUGA 1W17A 1I0DA 3LSBA 3UGVA 3NXFA 4DBEA 2X1IA 4EPBC 1VEPA 3OODA 1ECQA 4OU1A 3EWWA 4DAIA 3RF9A 1MEHA 4K8DA 1E6RA 1NFBA 2GJXB 4FXFA 2HJPA 3IIPA 1XBYA 4H9VA 4QSFA 1HUVA 3GVGA 3B06A 4GIYA 3FA4A 4B16A 3FVMA 4X0VA 4Y96A 2D0HA 4Z1BA 3WELA 4TTUA 3NAVA 2YPIA 1F07A 1A4LA 4GJIA 2Z1SA 1H7XA 5E6ZA 2ZX8A 1E72M 3N4EA 4UNKA 3NO3A 3M46A 3IC9A 1KRBC 5FJUA 1SJBA 1XXXA 2I9EA 3GUWA 3OU8A 2J88A 1RQEA 3NZPA 4D1JA 3T8LA 5AYZA 4AYGA 4TQTA 1ZENA 3L65A 2ZFAA 3HZ3A 3DYMA 4PMDA 2QJHA 3UJ2A 2VP8A 2EPLX 4PSPA 1CGWA 4ZO6A 4NVTA 2ABAA 2XFYA 4QGCA 3LCLA 3NRZB 1R2TA 3ZLGA 1W6TA 3U57A 1IWPA 4F0MA 3VGGA 4BF5A 3VDGA 2TAAA 4L65A 1C92A 4JR5A 2PWDA 4YIWA 1W56A 4GFSA 1TTQA 3FEQA 4EQXA 2VC5A 2OLSA 4R7WA 1DJNA 4LIIA 4IICA 4F0HA 4WY0B 2I57A 1SR9A 1PYMA 3MVTA 4RXFA 3PUDA 3WFLA 4U5IA 1W3IA 1AK5A 4UFLA 4W89A 2A79A 3EDJA 3V0SA 5LNVA 4X2PA 1JRCA 2GUYA 3GU2A 3PANA 1G1YA 3VE7A 4HK5A 3U8GA 5L9FA 4AZHA 2GVYA 3BH4A 7TAAA 1H11A 3GNNA 3RLVA 1U30A 3I4KA 2CHNA 4NSBA 3M5YA 3S9YA 2WZMA 1GRTA 4DBWA 4HA0A 3VE9A 3LPFA 3QFAA 4K7YA 2OU4A 4P7LA 1GEQA 3AMGA 1Q6DA 2QVNA 1XI3A 3L8KA 1CCWB 5A6BD 4PEEA 3EDDA 5G5IA 3PUEA 3GDTA 3NPVA 1LWIA 1FWWA 1WAWA 4H4ZA 1ICSA 1E4LA 4UTIA 2VEGA 1JQXA 1GSNA 3W73A 3M0VA 2BVYA 1UB3A 2X7VA 3URBA 2XSAA 5I24A 4F40A 2C8NA 1J01A 2RDXA 3KBSA 2CLMA 3NOYA 2PWVA 5TD4A 4F0KA 4YPJA 3MUZ1 4WJXA 2WBKA 5IDIA 2QGHA 3CAVA 3RU6A 3PS7A 2X8HA 3VKAA 2ONEA 5AC6A 1WYGA 1OVDA 2IPFA 5F4XA 2B81A 4QXIA 2DFAA 3IVSA 4AEEA 2VTFA 4FX9A 1Y5WA 1U5HA 2BP1A 2YDRA 4IMAA 3W6MA 4O13A 2ZADA 1C91A 1DJQA 2F61A 2V3DA 4LBSA 4TOQA 3C6CA 4LU0A 3IV3A 5TIMA 2FFIA 1FVPA 5DX7A 1KFBA 2OR2A 2RAGA 4YVPA 4HHLA 2P0IA 4HZ8A 1YQ2A 1PZ2A 3E2QA 2F6XA 4P7RA 5HXMA 4E5TA 2ZC8A 4JNZA 5JCNA 1BD0A 1UASA 3KLLA 5IBXC 3GO2A 4PCSA 5LYRA 3OLEA 3LLXA 4ICMA 4FSAA 3ZXWA 4BY3A 4CD4A 2NQZA 4MZ8A 1FFVC 4DZ5A 1SO3A 4PTVA 3SGGA 2E28A 1H0IA 3A13A 3L4WA 3RNMA 1Q3NA 4ICNA 4S1FA 1PKLA 2VFEA 3UF9A 2VEKA 3U7VA 3WLTA 3N2XA 2EPKX 3ARPA 3DYOA 2A6NA 3LI0A 4KIEA 3QZEA 1H4PA 3GK0A 1IGWA 4JIPA 4ZQCA 4NRRA 2GGHA 3VOFA 2VRJA 1PXGA 3NCOA 4O0QA 4HVXA 4GZIA 1TVLA 2VFHA 2QF8A 4G1KA 3VI2A 5KVHA 4Z17A 3GYCA 2DUAA 4W8AA 3FAWA 2GUBA 4P61A 1HFBA 4ZENA 3R07C 2E6DA 3T0CA 5KINA 4HNLA 1KCXA 4F0RA 1Z44A 4FX8A 1YYAA 3ZLHA 1VPYA 3VPLA 4R9OA 2NWRA 1IXQA 2OYLA 4C1LA 2A3BA 1V77A 3M1ZA 4ZXLA 1GXFA 2DSUA 1GOMA 4B5NA 3BJTA 4PUJA 1OJXA 1H63A 2TSYA 3ABXA 4KT2A 3ARVA 1J2BA 4ROPA 2CZ5A 1XP3A 5G4HC 3NGFA 4DF1A 3ABZA 4RZ5A 1QOQA 1KXHA 3CZEA 2L5HA 3B8TA 3CNYA 1OINA 3ID7A 1MXDA 5EYWA 1WDWA 2XIIA 1XLDA 3CH9A 1CXKA 3LDVA 3G3MA 4EX4A 3VZYA 3M47A 2O4MA 2X8GA 1L8PA 1SO6A 1CYGA 1H41A 3IJ8A 1W3JA 3NPWA 1XYLA 2VMFA 4XISA 3DXIA 1VR6A 5T9CE 3QPEA 4GUJA 3W01A 1DHKA 3KWSA 1ZNNA 4W86A 1FP9A 3CT7A 1EQPA 5DXYA 3V4BA 2PDIA 1RR2A 1W5OA 1YHTA 3DEQA 3T4WA 3WL1A 3N15A 1VBRA 3T9PA 1IEQA 1G4SA 3G1VA 2BC1A 4FA3A 3GU1A 2YYUA 4U31A 4Z1AA 4Q22A 4ZTYA 3WJXA 2W4XA 5D9PA 2WNNA 2CFYA 3H53A 5K9XA 4TXEA 4GO9A 4MGGA 2OZTA 4R27A 1U83A 1Q6GA 4DNAA 2EGZA 2OT1A 3WNKA 4NNCA 1PEZA 5EMLA 3KCJA 2GOUA 1OF8A 1W1B1 3V35A 4RW5A 3O3RA 5GJMA 3SECA 4MB1A 1TQJA 1PZ3A 3R1ZA 3B97A 2H3BA 1E6NA 2YDSA 4EVZA 2V6OA 3VOCA 2VX4A 3BUVA 2RJGA 5LIWX 4UTFA 3WQ4A 3MI3A 2F38A 1O5XA 4JY8A 1G7UA 1OZQA 3FKKA 4IGMA 2A2IA 4DBDA 2BGSA 2Y61A 4UR8A 2XVPA 3SCOA 3UPBA 5AHIA 3ITVA 1K4HA 7ODCA 1XL9A 1FWCC 3LEPA 5CZSA 2ZA2A 5GRTA 1JYNA 1E43A 4HPNA 2YL8A 2YB4A 1TPEA 1TZ9A 2BWGA 3EA3A 4C6EA 4J35A 2QULA 4ACZB 1NP0A 3ZFHA 3DFOA 1E9IA 1V6WA 3TN6A 1PKNA 4L4OA 3TTQA 4WD0A 3H2FA 3TOYA 2X1RA 3NG3A 2CFFA 5CBBA 2CHOA 5E70A 1VIZA 1LL6A 2WM0A 3DIPA 4G1NA 3K1DA 5EB8A 3W2JA 4C6PA 2VFIA 1PS9A 3TYBA 3WFZA 3D3FA 3M5ZA 4R5EA 2WWCA 5AKQA 1YBQA 2QVHA 3MSYA 4XIAA 3KM8A 1KM1A 2ACSA 3LCHA 3BJFA 1NFGA 5A1AA 1FDYA 3VKDA 2G3NA 2XGZA 3WNLA 1O1HA 2J25A 5BRBA 4Q8QA 4LPCA 4XX6A 3GDMA 1XYBA 3LADA 2PU0A 4QRNA 2VEPA 1XHCA 5LGZA 1PO9A 1OX5A 1N8FA 3G8RA 3JVAA 3W07A 4Y2WA 4UCFA 4RE2A 4B5UA 3BG3A 3OZMA 1DORA 1IWBA 1E9YB 3KXQA 4UR7A 4LUJA 1ZMCA 3GNXA 1MO9A 3TDFA 1NOFA 2UWFA 1S7MA 4CVUA 3SCNA 2RABA 2EQ6A 1XSJA 3O1NA 1TX0A 2FZ8A 4MB5A 1CDGA 2GJRA 3PFMA 3S42A 3PNZA 3SQSA 3BAYA 2XU2A 2Z27A 2X1SA 4A4AA 3MANA 5FF0A 2NX3A 5L6UA 2JE8A 1K7XA 2I56A 2WSYA 4B4FA 1HIZA 4GNKB 2QIWA 3ES8A 1XS2A 5DRIA 1UD6A 4ILSA 5I2UA 3TC3A 1H6VA 5AC7A 3SCUA 1O94A 1SYTA 3HG4A 4IP7A 4J3VA 2ZZBA 4E2DA 1ZMDA 1PX3A 1VFMA 1ZTVA 4C6QA 2CERA 1XLBA 5E09A 1FXPA 2B7QA 3PBGA 3W7EA 1EF3A 5HBFA 4M5PA 3NVDA 4DX3A 4WOZA 2FKPA 1E4MM 4C6OA 2ZX5A 1S5VA 4DELA 3S5YA 5I3FA 3OHIA 3PP7A 1JVNA 2P50A 2ISFA 1OBAA 4M0XA 2G50A 5HPOA 3E5BA 1PX4A 2E6YA 3ITTA 2OELA 3SAZA 1KNWA 4D6JA 1C3FA 2V81A 3PG6A 3VX0A 1GYMA 5I5RA 1VJZA 2DSKA 2YBUA 3UWUA 4R85A 3AYVA 3HOJA 3MBFA 3EA1A 3CLWA 2CBVA 3WH7A 2FZDA 3TXVA 3LX9A 3CLMA 1M03A 1EC8A 5G2HA 2Z2BA 1QT1A 2C19A 1DWFM 4YWIA 5CJNA 4Y8EA 2HISA 1FWFC 4HU0A 3LM3A 1KM6A 2YCJA 1J10A 1QAPA 3EEZA 4DM2A 4EWJA 1MEWA 2PD5A 3DGRA 4JX4A 4ZZ9A 2IMRA 5EKYA 3ANYA 4GCXA 4MWAD 3TR2A 1SB3B 4AHQA 3NTYA 3NVZB 2BY2A 4JQ9A 1WQ5A 2QCDA 5LZLA 2XIJA 4Q4PA 3UVAA 4U4MA 2GSHA 4BS0A 1VRDA 4RV3A 3P67A 3SGZA 1ALDA 1XGEA 4BCEA 3VXGA 4ICCX 1SJAA 3IIXA 3U6WA 1TJPA 3NL5A 4I7VA 2ISWA 1EDGA 3PG9A 1KFEA 5GPRA 5K2ZA 3SN0A 4FS9A 2B7PA 4QEEA 4MJZA 5FS6A 4JGDA 2IKJA 3QM3A 2DSVA 3RRAA 1KWKA 1UR2A 3N3MA 2PS2A 1KGXA 3A12A 3B8IA 1TV4A 4CQCA 3DK9A 2C0HA 3OA3A 3BLOA 2F2HA 3GY1A 2A7NA 2GDUA 5LHFA 4CNNA 3F03K 3H4WA 1E6PA 3K13A 3UG5A 4ERIA 4HZ6A 1E55A 4BF7A 1D7KA 4D8LA 3VDAA 3EWXA 3HGOA 3TQKA 3F2CA 4LCSA 4Q8WA 3TEVA 1GPWA 1SZNA 4HQVA 1ZQ5A 3CL8A 1E0WA 3DI1A 3GX9A 3KOZA 3FHAA 1CZ1A 1CBGA 1XYMA 1KWGA 3PJXA 4PTMA 4NNBA 2XHYA 4CN6A 1OYBA 1Q6EA 3H26A 5RUBA 1ODUA 1JDDA 1OC7A 2AGTA 5BRQA 1BF2A 2HCVA 2WBGA 1X8FA 3S2LA 1XBZA 2PPGA 4CD5A 4K8HA 3TSBA 1KTCA 1BEUA 1KR0A 1R0MA 3S46A 1DV7A 4FK9A 5ENLA 1FCBA 1IYXA 1PIIA 2QV5A 1Y65A 3BZJA 3VNJA 3OZPA 1AQMA 1G0CA 4H8NA 2PDLA 4O52A 4JFUA 1DXLA 4AFYA 4L80A 3CYJA 2D3NA 3MV01 4H4YA 1EIXA 5H8PA 2Z6JA 2XUCA 3TTEA 1FUYA 4J2PA 1PKMA 2WJEA 4QAWA 4ZO9A 1BKHA 1GJUA 1SO5A 5FAGA 4AWTA 1DQWA 3KHJA 1AUSL 1T40A 1XICA 1T8XA 3GC2A 3KVJA 3CMGA 3QF0A 1ZXIC 1WBJA 2NUYA 5D2TA 2E5CA 1G94A 2CKSA 1JCTA 5D2VA 4C6KA 4B3ZA 2X40A 8RUCA 4HP5A 4QISA 4LSBA 5XINA 4C6JA 3HB9A 3W81A 3H8AA 3E49A 4NAFB 5E9XA 1K02A 1OCJA 4MVAA 3GTIA 2ZZ3A 1ZAHA 3IS4A 4I6VA 5G5GB 4GNVA 4H4QA 1UKPA 1P6CA 5HMFA 4S3AA 1T7LA 4H04A 1UA3A 4DF0A 3W84A 1L2UA 1LPFA 3CHCA 3SRFA 5A6BA 1R2RA 1TCDA 4X60A 3STPA 1PIGA 3S1VA 2XINA 1G7VA 2VUNA 2VGBA 3DGBA 3EOEA 3ZLFA 1DTUA 3A22A 1XH1A 1HVQA 2ZRYA 5C9RA 4MB3A 5AB3A 1MUMA 2YYTA 1CXHA 1S2UA 3TQ0A 3JU2A 5A8QA 1XLIA 5FF7A 1Q5MA 4BI5A 3TTYA 1V3KA 3QH2A 1R2SA 3QGKC 1YW1A 1K4QA 3GR4A 1KXTA 2PDFA 4GXMA 3RO8A 4J3XA 4G7EA 1OGGA 5AYBA 3BLLA 4JTHA 4XAYA 1VENA 5F4SA 1IEXA 1QVBA 3GVQA 3WENA 2ZZ0A 2EKGA 1SU5A 3EX2A 5D05A 4C1NA 2R8WA 2WVTA 3OC4A 3AXIA 4WUIA 1NWSA 3CWOX 2AOSA 4WZHA 3W1XA 3DFYA 3AZTA 2DH2A 1EGZA 1FCQA 4CQDA 3QZAA 3GH5A 4QFUA 2REQB 1XLFA 1KTBA 1ITXA 1FXQA 3H55A 3WD4A 4RV8A 4CD6A 4BURA 5HQLA 3EOSA 2FHFA 3P2VA 4LUYA 5H2ZA 4N9CA 1POJA 1U22A 1W2VA 1LTDA 2YL9A 2P88A 5K9CA 3S83A 1W37A 1M53A 3E0IA 1CECA 3WF4A 1E1CA 5AZ0A 3A9BA 4N4PA 3RPTA 4H4IA 4M19A 2EPMX 1GHSA 3AMKA 3LCFA 4PUMA 2IS7A 5HUOA 1X6NA 1OT1A 4HU3A 4GBUA 3HF3A 3N9KA 1G4EA 2XFWA 4B5VA 4JN7A 4HK7A 4HMNA 4CN4A 3ARWA 2OZ8A 3CUIA 3E2VA 1XW8A 1LOQA 3UNDA 3PK7A 2QLYA 4KETA 4AB4A 5JRBA 3RUBL 1ZALA 4EE9A 1KXQA 3OBKA 3OIHA 3AZSA 1QBAA 3UCCA 4CEUC 4XTIA 3L2MA 3G0SA 4DZIA 3UP8A 4KERA 4PCFA 1HF6A 4DJFC 3N6HA 4NZFA 3WEZA 2E3ZA 1TWZA 3OLIA 2AL2B 3PM6A 1OG0A 1J93A 4HCLA 1H0GA 1NHQA 4HTYA 2GGEA 3P14A 2CZVA 2OCZA 5BZAA 1GRFA 2OJPA 2VHLA 4WX2A 4IXXA 3TJXA 2Y63A 1WUFA 2E4TA 4PB4A 1SFTA 1B30A 1EC7A 3O07A 2OOFA 4ZO7A 4PH6A 1M1BA 2WVVA 2POZA 1Z6KA 1RHCA 1XPGA 3TNOA 2E5DA 1Z7AA 1H5VA 1OB0A 1W3NA 3BICA 2PCEA 2V0TA 2YVFA 1R3WA 3YPIA 1FTXA 3CHVA 4M52A 4LGXA 3GZAA 2HBXA 3WF0A 4BV6A 3O16A 5E0CA 3BW3A 3REQA 3W2MA 5HATA 3NO5A 1H2JA 3QLDA 2P3EA 3LRLA 2Y8UA 3WLIA 1JPHA 4KEMA 3BLIA 4O17A 1P0DA 3L4TA 1ENUA 2D23A 1BVZA 1IR2A 3MKCA 3N2BA 3TK7A 1JYVA 1OK4A 3MHFA 1FFRA 3VD7A 3IANA 2BXYA 4AQLA 2NXGA 5I3GA 4CNSA 5C2XA 3M5XA 3IUDA 4GWEA 3SCWA 4LUSA 4LY8A 4XSLA 5DFAA 1JF5A 1RCOB 2CLIA 3EPMA 4Y7EA 3E3HA 1VP5A 1TTJA 4D71A 4S3KA 3UWYA 2DZUA 1UKSA 4QCEA 3B8SA 3LLFA 1V0KA 3MHUA 4X0NA 2GSEA 4H9YA 1GZGA 3W9ZA 4DN1A 5DCBA 3LHYA 3QTGA 3CGBA 5D38A 1QOPA 2XIMA 3VNYA 4L7ZA 3GNOA 4C6MA 3WDQA 2G5WA 3QLLA 1QHOA 3CB3A 1DBTA 2G37A 1E6QM 3VIOA 1XFBA 2PGRA 4MIMA 5SWUA 3G24A 1UMLA 1EH9A 3W6YA 2PTDA 1MWOA 4MFEA 2PAJA 1YXDA 2RH9A 4NASA 5E0KA 2WOVA 5JCLA 1A3WA 4LCRA 1EHNA 3BMWA 1B3YA 5A5WA 4LVFA 2Q3OA 2ZWYA 4QG6A 4FNRA 2VD8A 3PZVA 4RPPA 5D2YA 3W37A 3V18A 3AALA 4U3AA 3HPFA 3W25A 2GJXA 2E8YA 1FFUC 4S3BA 1M6JA 4L64A 4PGLA 2ZX9A 4LUTB 2VD9A 3M41A 4W7UA 4H7CA 3GNRA 3TE9A 3WLHA 3GNPA 3Q45A 3OVPA 1ZBVA 1E4IA 1OD0A 2CXGA 1UZ1A 2ZVRA 2CW6A 1Q65A 2XH0A 3CV2A 3TYZA 4FLRA 3CL6A 2V3GA 3WQEA 3NZRA 4FIQA 3RNDA 4HD5A 4GIEA 1N55A 2WAGA 4JDRA 3EWUA 3DKJA 1BGGA 5HNNA 1X1NA 2BHYA 1UQZA 5CC3A 3COTA 3AHYA 1BRLB 3AXHA 4JTDA 1J0ZA 3VKJA 2E6AA 1A47A 2YKKA 1A5BA 3OYXA 3CZGA 1IHIA 2QCEA 3AUJA 3MCNA 4TMCA 1LOLA 1QHPA 1JPKA 3HPAA 4L56A 5A6JA 2PC4A 4CCDA 2WVSA 4HCHA 4WY0A 4K1WA 5FKYA 3ABOA 1UP0A 3KBNA 3NM1A 4GNJA 1S2AA 1LWJA 5BWFA 2QCMA 1YEYA 4FB7A 2PRHA 2XISA 2QAFA 1FO4A 1IT7A 2WKLA 3ORWA 2IPJA 3VM5A 4QLJA 4HYWA 4IWWA 1O5KA 3TA9A 4UIOA 4E3VA 1QRQA 4TMBA 5AECA 3G0XA 4KRUA 3PZQA 3FVDA 4X2RA 5H1WA 3DH9A 4JFVA 1VJSA 3VIPA 2CC0A 3N17A 2PUZA 4KESA 4F0LA 3KOWA 1ONWA 4XKMA 1H2IA 2CZEA 4IL2A 2R1PA 1IZKA 4H8UA 3W88A 3KL3A 1TR9A 1FWRA 3DBPA 1W9BM 1IGSA 4C90A 3CYVA 2QF7A 4TTGA 1TYTA 4IMFA 1MQQA 3FNDA 3LTSA 1GT8A 3UGRA 1HN1A 1XSKA 2TODA 1EPXA 1ITUA 2OO0A 2X30A 3B8UA 4DJDC 4D6IA 1KBIA 4PRRA 3I3DA 3WMSA 1P6BA 2F7FA 3NSMA 1M65A 4LAOA 1WBHA 1JUKA 1DJZA 4N02A 3SCRA 1DIDA 1DP0A 4TV6A 4PL2A 3TSDA 3L23A 5M03A 4IQLA 3LN3A 1GCYA 1TO3A 2AKZA 1LLZA 3W4RA 2G3MA 1NTHA 3G2GA 1ZB5A 3P0WA 3O6DA 1UG6A 3W38A 3APGA 3LCGA 4IIEA 4UOQA 2DP3A 4N9DA 5DT7A 4BI7A 1XWYA 1EP3A 4GX8A 3XINA 3HIJA 3WD1A 2GK1B 1OIMA 5CSYA 4JCLA 2HPIA 3OVGA 4MWAA 5TAOA 1WPCA 4GOAA 4Q8NA 2WSPA 3RRXA 3WQVA 4N7QA 5C6MA 4DLFA 1P1MA 1TPH1 1RJQA 3G77A 3UJSA 3GR7A 3W2KA 1N62C 1ISYA 4LRTA 3W26A 2C18A 3SGUA 3W1UA 4DB7A 1LVLA 3WIJA 2FPTA 4H8HA 4MJMA 3BLKA 4V28A 1JZ6A 3WBYA 3O6AA 4JDBA 2XN0A 5J8LA 5EFDA 2MNRA 1F76A 5FACA 1ONFA 4H1ZA 4IFOA 1NQ6A 2GVGA 1MW2A 2F5ZA 4RL3A 1UP2A 5CAKA 2G3JA 3THDA 3USBA 4NHVA 4DWSB 2PURA 4YHGA 1W54A 5CC5A 3T0TA 2WK2A 4F3HA 3AJ7A 4PCTA 4AMCA 1HGYA 1TMHA 4B9YA 2E77A 3CGCA 1YX1A 3HGRA 4JYFA 4GCAA 1UR9A 4AW7A 1R8LA 1MMFA 1WZAA 3NUKA 1E0UA 4BF9A 2XGBA 4G56A 4QG9A 1OQFA 4DLMA 3APYA 3WK3A 2BASA 3AOFA 3WJWA 1RUSA 3EWCA 4HJWA 3O0HA 1ONXA 1PUDA 1JEHA 4YTTA 4DYKA 4OECA 5T8GA 5DCEA 4CQ8A 2XTKA 4LVAA 1E3XA 2A85A 2ATSA 2OTDA 2X1UA 4REQA 4A2SA 5EMKA 1AOGA 4PRWA 3B8WA 4L4MA 1I1WA 2Y7EA 3STGA 3A3XA 2OQLA 3BDKA 4F79A 2QHAA 4JHOA 3IUIA 3QEZA 3B40A 3QGVA 4AIOA 3MKKA 5FF4A 1H09A 1TMQA 5D04C 4OVXA 3NGJA 1V51A 4JTRA 4J3UA 3NVTA 2B31A 1FWJC 4GFIA 2DY3A 1N82A 1V4YA 3IWPA 3TTOA 5U25A 4O4VA 3AJXA 1V03A 4TX9A 3BGGA 4JFSA 2QGYA 2BX7A 1A80A 3GR8A 3KVMA 4JX5A 3RJXA 2VRKA 3N12A 1P1XA 3DG7A 2INZA 5IDZA 3EKGA 3VCCA 1ZJAA 3CMFA 2OX1A 3AIWA 3CB8A 3QW3A 4V15A 5EFFA 1F2JA 1D3CA 1PTAA 3ITYA 1VFHA 3BOLA 4JN6A 3TQVA 2JF7A 3CT2A 3LCWA 1R9YA 3SSZA 1XFCA 2PLMA 1EJWC 1K8CA 1VRXA 1B4EA 1HKKA 2BSLA 2OEJA 1YKWA 1J5TA 5GJPA 2IKIA 3WDIA 5AC4A 3ARZA 3IGXA 1L6SA 4FR1A 4AVNA 1YXCA 2FHBA 1IT8A 2QCCA 1KM0A 4MPKA 1NWUA 1XLKA 1Z42A 3BMXA 3EWYA 1KGWA 3CPUA 3TN4A 1SSDA 2VGIA 1U33A 3DFNA 4OQVA 2BCPA 3RGTA 4Z2LA 1LG1A 4F2BA 1ZUAX 3IJQA 3VNMA 1B2YA 4JICA 2DZBA 3AIRA 1B31A 2DIJA 3AZRA 1SUXA 3E74A 1B3XA 2YB1A 3A4XA 3EX3A 1R5YA 3WLSA 2W3SA 3GDKA 1FY6A 1V93A 1W1A1 2PDHA 3W7DA 3UWZA 1DJGA 1MW1A 3QJAA 1KBJA 3QR3A 1GEUA 8CGTA 2J7DA 3SIMA 2HEJA 2FJUB 4WLCA 3L0KA 4RCXA 3N9RA 4AZCA 3E38A 3M0XA 3B0YA 2ZZ7A 3G22A 2DEPA 2ISDA 1VBGA 3I7QA 1NF0A 2ZQ0A 3CXOA 3W7GA 4A8NA 4ACZA 2DJXA 2GJLA 2WBAA 1O60A 1JPIA 3KX6A 3E6EA 3NYZA 4IJRA 1EC9A 1JOAA 1AVAA 1R47A 4C65A 1IQ8A 4RDVA 2VEIA 1ZCCA 3ARRA 3WH5A 4ZGYA 4J57A 5T91A 5HQEA 3W1TA 1MRQA 1O7AA 4O53A 5LIUX 4NXKA 2XSXA 2ATMA 3NM3A 3FOKA 2Y85A 1X2HA 3R0DA 1W1ZA 4JKKA 1AG1O 3FCPA 3DGHA 1F6KA 3L68A 1X7IA 2E0PA 3ARTA 3LA4A 3Q37A 1RM6B 7A3HA 4W87A 2HROA 2ZRZA 4XZIA 3RM4A 3NFUA 2FGLA 1XIMA 2VEFA 5D37A 2QDGA 4K2SA 2A3EA 1SFJA 2FH6A 1D7FA 3HPZA 1XDIA 3RMEA 2EBNA 1U1HA 2FVLA 4IJCA 3HMJG 4MFDA 4DWDA 3JR2A 1QU4A 5HWJA 1GETA 4MF4A 3S5OA 4OOZA 1S1PA 2FB2A 3NPUA 1ME7A 1KLZA 1UW9A 3EOUA 1BWKA 3AICA 3VC6A 3PB0A 5F2LA 2V5KA 4QBXA 5CGMA 3GRSA 2JGYA 4XB3A 1XIGA <