4J3ZA

Crystal structure of mandelate racemase/muconate lactonizing enzyme from jannaschia sp. ccs1
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
388
structure length
388
Chain Sequence
VKLDTLDIFAVAPPPPGWGGRYWLLVRVTTDTGLTGLGEVYAAGVGPEAMTHVIHDVFTRHMRGEDPANIELMSRRAHSSGFTQRPDPTVFGAFSGLEMACWDILGKARDCPVWAMLGGKMNDRIRAYTYLYPEPHHDTNAFWTSPEMAAESAAARVAEGYTAVKFDPAGPYTMRGGHMPALSDIDLSARFCAAIRDAVGTQADLLFGTHGQFAPAGAIRLAKAIEPYDPLWYEEPIPPDNLPGLSEVAAHTSIPIATGERLTGVTEFTQALHHGARILQPALGRAGGIWEGKKIATLAAAFGAQLAPHLYAGPVEWAANVHLGVSCPNLLMVEAIETPFHEALVTGRPRVENGFVAAPDAPGLGITLNDAIANAHRYTGNRLHLEMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of mandelate racemase/muconate lactonizing enzyme from Jannaschia sp. CCS1
rcsb
source organism Jannaschia sp.
total genus 123
structure length 388
sequence length 388
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4j3zA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4j3zA01
2PMQA 4J1OA 2OX4A 1MDLA 1JCTA 2PSNA 1XPYA 4HYRA 1IYXA 2PS2A 2XH7A 4E4UA 3TWBA 4JHMA 3RGTA 2PP0A 3BOXA 1TZZA 5EU9A 3DEQA 1TE6A 1PDZA 4GISA 3VCNA 3SN1A 2PODA 3SQSA 4HN8A 2OG9A 4G7FA 2OKTA 3T8QA 3V4BA 3DG3A 3DG7A 3U4FA 3UJEA 3KUMA 3ZLFA 1OEPA 4DWDA 3SN0A 3V5FA 4K1WA 3SSZA 3FCPA 3PFRA 4ZCWA 3T6CA 3P93A 2NQLA 2OVLA 3CYJA 3NXLA 3Q45A 7ENLA 1JPDX 3ZLGA 5FJTA 2QVHA 3VFCA 2PP1A 3JVAA 1F9CA 3DDMA 3R0KA 2OPJA 3CT2A 3PWIA 1EC8A 3H70A 3DESA 3FVDA 1PDYA 2GGGA 2MNRA 4Z17A 3NZGA 4ENLA 2RDXA 3STPA 3P0WA 2PA6A 1ELSA 4E5TA 3TW9A 3UJFA 1BKHA 2PP3A 1NU5A 4KEMA 3SN4A 2PU1A 2PTXA 1RVKA 3UXKA 2PPGA 5BOEA 3RO6A 3VC5A 2PCEA 3VDGA 3PK7A 3OZYA 2XSXA 4H19A 4GYPA 4GYPC 4A3RA 1P43A 2FYMA 5FJUA 3I6EA 1JDFA 4KWSA 4DYEA 4YWSA 3P3BA 3TJIA 2QDDA 4HNCA 4E6MA 3RR1A 1TKKA 2PTZA 4HCLA 3CK5A 3THUA 3ZVHB 3R0UA 4DX3A 5IDZA 2HXUA 3DIPA 2GDQA 4DHGA 2OZTA 3NO1A 3MWCA 4IZGA 3TJ4A 2OZ8A 5ENLA 2QDEA 3GC2A 3N6HA 3IJLA 3IJIA 3IK4A 2HZGA 2AL2A 3ZVIA 3D47A 4A35A 4ZA0A 4KPLA 3DERA 3VCCA 1EC9A 3MKCA 1KCZA 2MUCA 4MGGA 3GD6A 1SJBA 1WUFA 3T9PA 3GO2A 3UGVA 4G8TA 1EBGA 3GY1A 3MZNA 3I6TA 4DN1A 1KKRA 2OLAA 3UCCA 3OP2A 3DFHA 3OW1A 3CXOA 2CHRA 2OQHA 3TCSA 3T4WA 2ONEA 2QJJA 3S5SA 5FJPA 3IJQA 3H12A 3ENLA 1ONEA 3TQPA 4MKSA 1DTNA 2DW7A 3MQTA 3TOYA 2QQ6A 4IT1A 3QLDA 4FP1A 3I4KA 2HNEA 3N6JA 3UJSA 2AL2B 3B97A 2PGWA 4J3ZA 4GMEA 2AL1A 4HCHA 4M6UA 5BOFA 2XH4A 3H7VA 4IL0A 3RCYA 4H83A 2OZ3A 4K2SA 3MUCA 3N4EA 1FHUA 1NELA 3SJNA 4X2PA 3VC6A 3TWAA 1XS2A 3Q4DA 5J04A 2AKMA 2OO6A 3FV9A 3HPFA 1R6WA 3EEZA 3DG6A 2AKZA 2ZADA 3UXLA 1YEYA 4K8GA 5FJRA 2QJMA 3ES8A 4E4FA 2GGJA 4FI4A 1SJAA 3D46A 3V3WA 3QTPA 4IL2A 1W6TA 3R11A 3PWGA 3CAWA 1KD0A 6ENLA 4GFIA 3R1ZA 2P8BA 3NFUA 3BSMA 4F4RA 2P3ZA 2GGHA 3BJSA 3H8AA 1ECQA 2DW6A 1JPMA 4EWJA 3UCDA 3JW7A 3V5CA 2POZA 3EKGA 2HXTA 3FJ4A 2GSHA 2I5QA 4E8GA 2PTYA 3N4FA 1EBHA 2PGEA 2OQYA 4H1ZA 5FJOA 3UJRA 4GGHA 1MDRA 3ZLHA 4H2HA 1SJDA 1SJCA 4IP4A 2PTWA 2P8CA 1R0MA 4HPNA 1BQGA 3QKEA 4IHCA 3MSYA 3SBFA 3UJ2A 3DGBA 4GIRA 4IP5A 2GGEA 3R10A 3VA8A 4JN8A 1L8PA 3OZMA 4M0XA 1MRAA 3U9IA 2P88A 1P48A 3K1GA 3JZUA 4HNLA 2QJNA 3FXGA 3MY9A 3RRAA 3S47A 4Z1YA 1EC7A 4HCDA 2XGZA 3ZVHA 1MNSA 4DXKA 1MUCA 3TTEA 3FYYA 2FKPA 3QN3A 1E9IA 2P0IA 2PU0A 1KKOA 2XH2A 1FHVA 4MMWA 2QGYA 3R25A 3OTRA 1WUEA 3CB3A 2ZC8A 3RITA 2O56A 3ES7A 4A6GA 4ROPA 4GGBA 2GL5A 2GGIA 2OFJA 2XH0A 3OPSA 4JN7A 4KT2A 3QPEA 3DFYA
chains in the Genus database with same CATH superfamily
3E3HA 3DC8A 1UWQA 2GJXB 4XVEA 4PTNA 5GNYA 1JXKA 4ZOHB 5IOBA 4H00A 1J96A 3WLPA 3EA1A 2XH7A 3WFLA 5G4EA 3MS8A 3TTOA 3V75A 1YW1A 3BAXA 3KLJA 3EOSA 4ZQRA 2D73A 2RJHA 4WKHA 3VNDA 1KFKA 4RE0A 4OBRA 3VCNA 1JYXA 3WBXA 1LLWA 2AQWA 4GOAA 3C52A 4GJIA 1FH8A 2E0PA 3LU2A 4DZIA 2EHHA 1JULA 4IIEA 3MKKA 3QYSA 3TYDA 2ZWZA 2VFHA 3GXFA 5M3WA 1H7PA 4J9JA 3LV6A 1SUXA 2J7HA 2CZFA 4A8NA 3NR0A 1W2VA 3VPLA 1N8WA 1NHRA 3W24A 4DNHA 1GETA 3BSHA 3LY0A 4WXYA 3FSTA 5A95A 2F84A 5LHEA 3CIWA 3SY5A 3W7KA 4HU3A 4GRSA 3ICJA 5FI8A 1C8QA 4AY7A 4XTDA 2FB2A 4LVDA 4KERA 4H3DA 4XTIA 1GPWA 2VZUA 5DCDA 2VDHA 1CT5A 2FZBA 2PLJA 2QGHA 3O2LA 1QTWA 5D9OA 3PWIA 4FNPA 3H70A 3DESA 1H7OA 1J0IA 1DJYA 4URIA 3GTHA 1UBPC 2EAWA 3DGZA 3QTGA 2X8GA 1Z6KA 3PC0A 3AMLA 2Y6ZA 3E1F1 3P5YA 1ZAIA 1GESA 2XM1A 1S2WA 4F0LA 2BSLA 3BMWA 3T40A 4JHOA 1T99A 1TG7A 4WF7A 1B31A 3SUVA 2Y2WA 3UZZA 3EPOA 4N9DA 1PSCA 4FXRA 4UTHA 2RKXA 5DRIA 1RLCL 4PFHA 4H41A 2DZTA 1UKQA 4LAZA 3DECA 2BODX 3N18A 1KM1A 1CB7B 3P8JA 3S8HA 3CGDA 3P3BA 2HRWA 3XINA 4IJRA 2RGLA 3BE7A 2H9AA 4A8IA 1VH7A 1GEHA 2PTZA 4F9JA 1H0IA 3H2NA 2WCAA 3WUGA 4KW2A 4XKMA 3GTNA 3NL3A 1EPVA 1Q6LA 5KSWA 3ZJ7A 2WXDM 4H4WA 2X1RA 2V3GA 2CXEA 2WK2A 4QFUA 4YS1A 3ARWA 2ZVRA 5HINA 5FL1A 4HJWA 5LHFA 3VTRA 4GUJA 1Z32X 3II4A 4PUNA 4H9ZA 8XIMA 1V6UA 1XH1A 3D6NA 2VELA 2WZTA 4KWOA 4JZ5A 4WKAA 1OK4A 3SQMA 4JQ9A 1XC4A 2X7WA 1X1OA 2XGBA 4BY3A 4DXVA 3KCJA 4ZO8A 4ZODA 1KKRA 1NJJA 2OLAA 3OP2A 1CEOA 3ZR6A 1THFD 4PMOA 3G6LA 4BQ5A 3SRKA 5F4SA 2YR1A 2I5IA 5J5RA 2QJJA 3HG5A 5A8NA 2Q02A 2PDUA 5FJPA 1R2SA 2YSWA 1UUMA 4P7OA 3NZPA 1JQVA 4FF7A 3TQPA 2YZ5A 4KEVA 1JCXA 4PZVA 5CZ0A 2DORA 2ZX9A 1H09A 1KXVA 1U1JA 3Q37A 1G01A 1MW3A 1QBBA 4H4QA 1GERA 4CNUA 1D8WA 4HCHA 5C8BB 4L6DA 1E6PA 1K9DA 4MFEA 4KGLA 5DANA 1DP0A 1GOQA 3M6YA 3R0DA 5T26A 5EPDA 4RDWA 1LT8A 1VYRA 4NZFA 4R3UA 3CUJA 4UTIA 2V5CA 4UFMA 3CGBA 1G94A 3S42A 4U4MA 4EXAA 3VD9A 1E0WA 4IMGA 3L4WA 5DLCA 3F5LA 5A1AA 1MWOA 4JQ2A 1RALA 3WF0A 3TYAA 3RAOA 3E2SA 1O5XA 3L2MA 5I6SA 5F2MA 3P84A 1TQJA 4FI4A 5A8MA 5CAHA 2TODA 3WIJA 2ACQA 4PCSA 4LYQA 1ZZMA 2Z00A 3NYDA 2BNJA 2DEPA 4PMZA 4CD4A 3BLFA 3WK3A 3LNMA 4Z0JA 1QDSA 1JPMA 5I07A 5BYWA 1YXDA 1J2WA 1UD5A 3W86A 1CENA 1E9YB 1DJNA 2INZA 3V5CA 3L8KA 4MZ8A 4EF8A 5BRQA 3SFWA 4ACZB 3VGHA 5CPNA 1OYAA 4X61A 3SY8A 2BS9A 1QI0A 3GS6A 3TXVA 5G5GB 1SW0A 5LGXA 1A5AA 4RL3A 3FVMA 1SJDA 1V0NA 2YAUA 2ANUA 3L5AA 1XQKA 4CEUC 1TPEA 2GPTA 2JF6A 3ITVA 4X63A 4I8DA 4M0XA 1EQPA 1GVOA 5FAJA 5CJNA 2C1GA 3IC9A 1KW1A 3T8LA 1E9ZB 3WCZA 4Y2WA 1XCWA 1YPXA 3FAXA 1MO9A 3SW6A 1Q2RA 3VFLA 3WLLA 2A3EA 2PURA 1A0EA 1UWAA 2ZTKA 3O16A 3QN3A 1XD1A 4N42A 4H8HA 3WENA 1LF1A 3CB3A 2FTYA 3PUGA 4F40A 2ZC8A 4LUSB 2F5ZA 3TYZA 3G0UA 1UPPA 3E0FA 1G7VA 4Q8WA 3GNNA 2WCGA 5M17A 4LVGA 1Q66A 1IR2A 5JH2A 2V5DA 3PUEA 1IV8A 4K3ZA 3VX0A 5CC7A 1UQZA 1Q8AA 1TR1A 2OX4A 1B4KA 4V1XA 4QNWA 4A3HA 2V3BA 3IVTA 3WD3A 5DCBA 4C7GA 4K1GA 4AU0A 3VIOA 4CQDA 1I4NA 4F0HA 5I3KA 2D0HA 3VIIA 1GJUA 1F73A 4DJED 4G7FA 1ZHAA 2V3AA 2ZX6A 4LH8A 4DJDC 3QHOA 3C6CA 5AOUA 3UZ5A 1Y5VA 4O11A 1TVPA 1TV5A 1XBZA 1ZB5A 5FAGA 4H4UA 1Q6QA 4RZBA 5ABFA 5IDIA 5TNVA 3PFRA 3AWNA 1E56A 4MUPA 1AJZA 4B5UA 2PRLA 2PDCA 4IFKB 1KRBC 5F2IA 1L8NA 3EOLA 1V51A 3VFCA 5J8LA 2Y63A 3O07A 3WNNA 3HO8A 4C1NA 1RJQA 1DKWA 4GC3A 4GZEA 3HURA 3I3BA 5LXEA 1K4GA 3PP7A 3K5XA 4NY2A 2YDSA 4B15A 3AHVA 4GVGA 2WSKA 1LWIA 5I03A 2Y62A 3V0SA 3A7AA 4CCDA 1MEIA 3NA8A 4BQ3A 1ADOA 3U4AA 4MWAA 4CD8A 2PGFA 3PTDA 1SFLA 4JTLA 4M56A 2YCKX 5FL0A 2DPEA 8CGTA 4B5NA 1B9ZA 1EUAA 4KRUA 2QULA 3AZRA 4AC7C 2YQUA 2XHYA 4RE2A 1JI2A 3KOZA 1JCYA 4LFYA 1BGGA 2DJLA 1MZHA 3WG6A 3L4VA 3MI6A 3CZJA 4H4YA 4DAFA 4FAMA 1VBJA 3ZT7A 1GVFA 4XAYA 2TMDA 5AYYA 4B4FA 2J9XA 3T08A 1ADSA 2Y7EA 2VFIA 3THAA 1XCXA 3D5HA 3PN8A 4OZOA 3RHGA 1KM6A 2QDDA 4EMIA 5I3DA 1X96A 1SU5A 3B4YA 1ZNNA 5HQLA 3CZEA 4A2SA 1GOIA 4HCLA 2XPKA 4XO6A 3BO9A 1CGTA 1M01A 2PDLA 2WVVB 4PTMA 4GZ7A 5DY2A 3RNMA 3FNDA 1CXLA 2NXIA 4ZOCA 5BWAA 1RPXA 3V35A 2V82A 3S9ZA 3IK4A 2B0MA 3VKJA 2YA2A 4YTSA 1MXSA 4U5KA 3TR9A 4C90A 2BMBA 4RV8A 2ZRVA 1A5SA 4QJ1A 2DU2A 2MUCA 1T6MA 4Q8VA 3GQYA 3M41A 1ZKQA 4LC6A 3BG9A 2FZ9A 2C19A 3GY1A 1KA9F 3TMQA 3L4TA 2Q01A 1PJ9A 4ZL1A 3LB0A 4I7UA 1REQB 3TH6A 2CHRA 3PB2A 1PTGA 1J6PA 4CQCA 1F05A 1W54A 2GDVA 1AZ1A 5CQ1A 1KC7A 5DY3A 3GNXA 4LSBA 3H12A 3H2MA 2ZRZA 4Y9OA 3VIFA 3EAUA 3QLDA 3H4GA 3W2UA 1I2RA 3C3UA 4ICMA 4NZ5A 3MUXA 2ZE0A 3AYSA 1KXHA 2BOFX 4LANA 5C9UA 1GEQA 3QQWA 1I8JA 3A64A 3VNJA 4E38A 4H6KA 1DWGM 4MFDA 1WDDA 1POKA 4O1EA 1UR4A 3GB6A 1OINA 4PUDA 4CVUA 4KFPA 3NURA 3R89A 3UWYA 3N34A 4J4KA 4DAIA 1EF2A 1JFHA 1R5YA 2HROA 2ZTJA 3ATYA 3CGCA 3QQ0A 4H83A 3KRUA 3G1RA 1GTEA 2OZ3A 4K2SA 1FTXA 4GQRA 3WQ4A 3SJNA 2REQB 1HUVA 4ZGYA 3B06A 4JIHA 2V30A 3ZO9A 1CGXA 2NQ9A 1R9YA 2X8HA 4S3KA 1ZCCA 3S83A 4Z1DA 3SECA 1C9WA 3LYEA 4E4FA 7PTDA 3KWSA 1QI4A 4R5EA 2C3ZA 1QNQA 1ODZA 5MKGB 1R87A 1XHGA 3W7PA 4C65A 4JQ3A 1LL7A 3UNTA 3NFUA 4F4RA 3WNLA 1BFNA 1M7OA 5FIPA 1WZMA 4NNAA 4F0MA 1Z44A 3L0GA 3TONA 2PRMA 1H1NA 4CU6A 4Q4MA 3SR7A 2HK0A 1BLIA 4AWSA 1QNOA 4XKYA 3G0SA 2WANA 4FLOA 4DBUA 4DF1A 3H23A 4E8GA 4DJFC 1FDYA 2DGAA 5D2TA 4GX9A 3ALFA 3FJLA 1ZP4A 1PWMA 3EB3A 3G0XA 3RF9A 4CN6A 2VGBA 3TKFA 5EMLA 4D6HA 3WK0A 1TO3A 1TMLA 1N5XA 3R10A 1RM6B 4PRWA 1O60A 1TA3B 3E2RA 1SO4A 1P48A 3HF3A 2BY2A 1H7XA 8A3HA 4AG0A 2AQOA 3AU6A 3RXZA 4RDYA 4H4ZA 1H5VA 2YCEA 3OG3A 5M03A 2W0UA 1BVWA 3AISA 4MNMA 5KZDA 1CPUA 4EPBC 3W87A 1HG3A 3LK6A 1JVNA 4DXXA 1XFBA 4LUJA 1P0NA 2QGYA 1FECA 3R25A 4LCQA 1WUEA 3TZNA 2ODOA 1FHLA 4ZTXA 1OSEA 2BFGA 3A4WA 1WDWA 3FLUA 1V59A 3QMRA 1UPMB 1V6XA 1C29A 5LXXA 3PTMA 2R9RA 6XIMA 4AAJA 1UYQA 2X99A 1OZMA 3OPSA 3T78A 4LPCA 2HBXA 3H4XA 2JEQA 4NZCA 1JCTA 1SR0A 4EVZA 1J2BA 4HYRA 3WLOA 4C5ZA 4GKTA 2Y7GA 1LOSA 3KL3A 4CNSA 1E1CA 3RYSA 2CLPA 3WD0A 3ARXA 1X7FA 3KDOA 2GJNA 3NQAA 2JIWA 1EP3A 2XZ7A 1FQ0A 3W53A 3S46A 1D3CA 2P0OA 3BTNA 4XBKA 3HIJA 4IPPA 4JFTA 2CZVA 3DG7A 3L5LA 2OYLA 3GD4A 1A5KC 1X8FA 4X0NA 1P7TA 5I3IA 1H60A 1XYBA 3GNDA 4K1WA 1OX4A 1W3LA 4UFJA 3OGRA 2Z2AA 3HBLA 2Q8ZA 1EHAA 1G4EA 1GOMA 4O53A 5FACA 1I2OA 4JYDA 3YPIA 2J62A 3F4NA 4W4QA 3AIWA 1K03A 2YOCA 1GVEA 3LERA 5D37A 5FJTA 2QVHA 3OZOA 4O1DA 2EG8A 3B9DA 3JRKA 1L0PA 1BYCA 1F76A 4Y7EA 4K6AA 1VBUA 4IGMA 2HVOA 1SFSA 1QU4A 2QVNA 2VC5A 1R9ZA 4GUIA 4YHGA 1Q63A 1VR6A 4V1YA 3KCLA 2W67A 1XF0A 5D38A 3CL6A 1V6VA 4L9ZA 1JL8A 5AYBA 3UXIA 2A6NA 1Y8BA 5D9PA 5JVLA 5BU9A 5LNVA 3RFAA 1FBAA 1NF0A 1ZENA 4KEZA 5BROA 3NZQA 1MEWA 3SN4A 3USBA 1FWDC 4PULA 5CC5A 5PTDA 1V3HA 3EA2A 4R53A 3PPHA 2X0SA 3EF6A 5F4WA 4W87A 4DUWA 3AHYA 3WMLA 3PK7A 4NASA 1XIMA 1XQLA 4WDUA 4HMCA 4Q6XA 7REQB 2E9LA 4H9TA 4HNNA 4AYSA 4HU4A 5C9WA 1TSIA 2GWNA 3W2JA 4LT9A 1GOKA 1H50A 3BZJA 4L1GA 1JR1A 4TV5A 2Z28A 4MOZA 3TR2A 1IGWA 1UJPA 4AEOA 1ENUA 1GNXA 4JKLA 3RLHA 2F61A 5CPTA 2R6OA 1EYEA 3MCMA 1XGZA 1K6WA 2TSYA 2X1IA 1GV4A 1JCLA 3O6CA 1XCFA 3C86A 2GH5A 4Q4KA 1XLAA 5E6ZA 3AS3A 4HMDA 5HJYA 5AHIA 2YBTA 1SSGA 2QDEA 3IJDA 2E09A 3D47A 4P8XA 3GG1A 3UY8A 3AMCA 3RM4A 5JRBA 1BYDA 1E6NA 2E5BA 1R38A 1IEVA 3VDAA 3W82A 3PM6A 3QFAA 3MC5A 1XLGA 2OYMA 1D7FA 1BQCA 4MB3A 2DY3A 5I06A 1LORA 4NIRA 4F79A 1XBYA 4MYAA 4N9BA 3QV6A 3W7MA 1W1VA 4PC8A 3SUSA 2Q09A 4AD0A 3JZEA 5U25A 3TCSA 1Q3NA 3S5SA 4PMQA 4AYGA 3NM1A 4QITA 3ITGA 2PRHA 1OFPA 2VMFA 3APYA 4O0ZA 1V6TA 3BAKA 3LLXA 1GRHA 3WF2A 1R3SA 2VVNA 2XU2A 5LA1A 2D3LA 2AL1A 2VEMA 5FF4A 1F07A 1RR2A 1Q45A 1NWRA 2WZEA 4AD5A 1R85A 4CD6A 3R2GA 2NQHA 2X05A 5E0KA 4YYFA 3GYEA 3NYZA 4LNCA 4WUIA 2EG6A 5C5YA 3W74A 3AUOA 1XC6A 5J5DA 2F8QA 2R8WA 1KLZA 3GXDA 5FF7A 2WC3A 2YX0A 1GREA 3IUDA 4GYJA 4L6HA 1PIIA 2Q6ZA 3DXIA 3NDOA 1J18A 4K8GA 4XIMA 3BJFA 3ZWSA 1Y65A 3W2NA 3AZTA 3VIJA 3Q67A 1EZ2A 1SJAA 1ISYA 2G3JA 1S1RA 3T0TA 3HA1A 1OJTA 5A6KA 4WXZA 4Y6GA 3S1UA 4HPXA 3R1ZA 3BSMA 4JBRA 2PC8A 1HFBA 3LHWA 5E70A 4BWLA 4HU8A 1RJRA 3AMDA 2EPKX 1E0XA 1C7TA 2WKJA 1GWJA 1HW6A 3FJ4A 2MANA 1NOWA 1IR1A 5A8OA 5FJOA 3UJRA 3D3FA 4D6DA 3H21A 3L4ZA 4CNNA 4IGHA 3CHVA 5G2HA 3ABQA 1F74A 3DU0A 1UKTA 3E2VA 2QS8A 2WLZA 2W4XA 1XIFA 3ARUA 2ZZCA 1A3WA 2XVLA 1LWJA 1JF5A 5HK4A 4KF1A 4XB3A 3T1GA 1IHIA 1IXPA 3DC0A 2DZSA 4ZBCA 2A0NA 4IG2A 3R8RA 2FVMA 5HMDA 3FXGA 3HFTA 1LQ2A 1NFPA 5L9FA 3C4UA 3ECQA 4O50A 3QY7A 3SAZA 1UR2A 5D05A 3W7EA 4GCXA 3COTA 2FKPA 4Q4QA 3MP5A 2P0IA 1XRFA 4HZ8A 1KKOA 2D3NA 4BURA 3RITA 1UD8A 3G8RA 3CTTA 1KM4A 3CH9A 1NPXA 3WN6A 4I9MA 1W1YA 2ZZ4A 3RM8A 1UH2A 1GRBA 3APGA 3IACA 3W1LA 3PG8A 4AVFA 4JFWA 2E6FA 1VS1A 4DBSA 1EWDA 3TQVA 4ZSTA 1HKJA 1BXCA 5CZTA 3QZ6A 3RGTA 2X1UA 4LUTA 4JEJA 3VOHA 3DFNA 4CQ8A 3OJGA 2XVNA 3AS1A 1ICPA 2ISFA 4RKAA 1DJZA 3CHDA 4HA0A 9XIMA 4IPNB 1UWSA 3LMYA 3FN9A 4FDCB 3UA4A 1E9LA 4M81A 1LZOA 3G3MA 2PDNA 3RM9A 2JGQA 1NQKA 3RJXA 1FVPA 4B91A 3ZT5A 1GKPA 5LZLA 4BR1A 3RPTA 2WNZA 1XGDA 2V0TA 2QPXA 2V68A 3NVTA 4GG9A 2DZVA 3C8NA 4LTSA 3LEPA 3LN3A 4JDBA 2DSVA 1PIGA 2V6OA 3AIVA 1ZAJA 2QR6A 3AC0A 1JZ6A 1K8CA 2QLYA 3W29A 3R0KA 2YDRA 4YLWA 5JCLA 2HE8A 3WQ5A 3O0KA 1VPYA 3W83A 2G50A 3BGAA 4ASTA 3UG4A 4KEUA 3VYLA 4JTIA 3CV6A 4PRRA 1V8EA 4EMJA 4HVXA 3DH9A 2BHUA 5CGQA 4IUGA 4C6PA 1ME8A 3P80A 4MLJA 4W8LA 5CJ5A 3PBGA 3W7NA 3L0KA 1AQHA 3GH4A 3BLPX 3CV1A 4NF7A 2WNNA 3HGOA 2OGYA 1UHVA 1PKLA 2WSPA 1V3IA 4YTTA 2YGYA 4IXHA 3W07A 2BGSA 3RO6A 1QHOA 4TVWA 4AHOA 2XWEA 1J5SA 3L21A 2E9BA 1ONFA 4H19A 4AVNA 5HANA 3CTLA 2Y4SA 2VZTA 3W73A 3I7SA 1ISVA 1HKWA 3A5VA 3QEZA 4S3CA 1BYAA 4YJ5A 3VIMA 3GDTA 3RU6A 5AKQA 2NVKX 1GPFA 2YDQA 2EQ8A 4W7WA 3C2EA 3OLEA 1Q2SA 4LIIA 3QR1A 4M6QA 4LALA 4AZHA 3KWXA 4XAGA 3DOPA 5LIYX 1KBLA 4F48A 3MWAA 3BH4A 4A29A 4UTLA 5G2WA 4ZB2A 2FDSA 5EL1A 1XH2A 4O1AA 4YPJA 1GOXA 2Z2UA 3TTQA 1B3XA 4MNKA 2CLEA 4FNRA 1T8XA 4TVCA 2GZXA 2J7CA 4CN4A 1DJWA 3AXMA 1AQFA 4OBTA 2HS6A 4UZSA 3THCA 3B04A 2BC0A 3NG3A 1TRIA 4CVWA 2ZCGA 4GI8A 2ZXBA 2XN0A 2WOIA 3C56A 4O17A 1S3HA 3GD3A 1W91A 1WO2A 2IXUA 4GVFA 4HYVA 3MVIA 4DF2A 5FF2A 2B7OA 4BF9A 1B9BA 2UY4A 3HB9A 3J7HA 3OBKA 4IXXA 5HR6A 3IJ7A 2A2IA 4QM1A 4ZFMA 5MKGA 4NYUA 1SMDA 1W56A 3B8VA 1DE6A 3RR4A 1A5MC 5E9AA 4LX4A 5G1YA 1PL9A 3TLQA 1V02E 2VCCA 1GEUA 2WVUA 5GPRA 1DXLA 4IMAA 2VR5A 2G97A 2XH4A 3ABSA 3E0LA 5EBUA 4M6VA 4L4OA 3OVPA 1S2TA 1AZ2A 4UOZA 1XGEA 1NIUA 3M0ZA 3GDKA 4QDMA 2A8XA 2QDGA 4LV9A 1MW1A 2AKZA 1BTCA 3MMWA 1LJYA 4REQB 2VX4A 4JTQA 1V0KA 3W1NA 3ES8A 4ILSA 2PF0A 5CSYA 4JL2A 2A21A 4ECLA 2W91A 4ZQNA 5H2ZA 1TWSA 1KD0A 2J9ZA 6XIAA 3PZTA 3BJSA 4ZTYA 3WX7A 1RQHA 5ABTA 1RUSA 3ONBA 2A6LA 3RIKA 3G8EA 2ZZ0A 5DF0A 2VR2A 2H8XA 2POZA 4S3AA 1WE5A 2HXTA 3H22A 4AB4A 3CC1A 1KRMA 4M1BA 3BGJA 3W85A 1RCQA 2ZC1A 2OZ0A 4M7TA 3MYPA 3TSBA 1UR0A 1X98A 3DI0A 4MPKA 2X41A 4AXNA 4LUIA 4DWSB 2IPJA 3W7LA 4KCUA 3P5ZA 4U33A 1SJCA 3MUZ1 4MG4A 1XR2A 4L80A 4JIIX 3W7RA 4O18A 3RN6A 3A9BA 2WM1A 2XSBA 1UIPA 3W7IA 1MRAA 2P88A 1LRTA 2QJNA 1GZJA 3IJ9A 4J2MA 4FXSA 3NS1B 3ARTA 3M5VA 4CEXC 1VIZA 4C1LA 2WM0A 4US5D 3T0BA 3UG5A 5IFPA 2E6DA 4NJGA 1XLDA 3VGBA 3ATZA 4HPGA 2JKEA 4ATDA 3URAA 4MMWA 5A2CA 5HATA 2CKSA 4WSKA 2HCVA 1K7FA 3U7VA 4BI5A 1JCJA 3CQJA 4D6GA 4L65A 3BAJA 4JKMA 3PFMA 2GRTA 2CLOA 2OFJA 4E2OA 3KRBA 5FF3A 2O4MA 1EDQA 2V3FA 4DO6A 2Y1HA 4QJ3B 1XM3A 2G4JA 3EWUA 4N4PA 2DZAA 1VYSX 4MDPA 5JBFA 3UF9A 4N2YA 4L9XA 3V0UA 2PS2A 4E4UA 1FDZA 1RH9A 4FIRA 2WMHA 3SEPA 1AW1A 4JHMA 2PP0A 4E0CA 5EU9A 3SRHA 1KXQA 2CEQA 1TE6A 3E49A 3U7BA 3O1NA 4WEVX 2YVJA 3DH7A 2UY2A 2XG9A 3D3AA 1UCWA 1E6ZA 1EA9C 4HT3A 1UROA 2C14A 2WQPA 4PMXA 2GQAA 4K37A 3IIVA 2DP3A 4DNMA 3EWBX 3EB2A 4BCEA 2W6RA 3CEUA 1TYTA 3B40A 2PWEA 3DUGA 2J7GA 2WMIB 3CPRA 3SCOA 2WHJA 3WLHA 3WBEA 5EMUA 4U10A 1VJSA 2OVLA 3NXLA 1M41A 1IWPA 5TIMA 3FS2A 2QUMA 4J3UA 3QMTA 3POCA 3W22A 1OC7A 3TN3A 1FUYA 3TLLA 4HK5A 1Z42A 5IHRA 4UR9A 1FCVA 1LP6A 1P6WA 1JDAA 2Q3OA 3KE0A 1TV2A 1DNCA 5C2GA 3OBEA 3W23A 1TJ0A 2PLKA 4WJ8A 4QISA 3GVWA 4GPNA 5EKYA 3NZRA 3FVDA 1DWIM 1VFTA 1N8IA 4Z17A 3UGRA 4WJEA 2C6QA 4BF5A 4FNUA 1ELSA 3TJLA 1Q1RA 3A12A 5HMEA 1GONA 3EA3A 3B0YA 1FA2A 1QMLA 2YLAA 1TREA 3GTIA 2L5HA 3LXCA 1OCNA 4QLKA 4L1WA 3ZS4A 3E2QA 4A3QA 2BVTA 3L4YA 1IT0A 1S5WA 2VFGA 4L9YA 4Z1CA 1XUUA 1S5MA 4H9VA 2KAUC 3VO0A 3ITYA 1V5XA 3PBMA 4NQ1A 2ON3A 4XISA 2Z6JA 3LMZA 1Z9AA 1JDFA 4J40A 1DXIA 1O12A 4JEQA 1AL8A 4MIMA 1GGOA 2XDFA 3LPFA 4NI3A 1AD1A 3Q6JA 1MSSA 5G1MA 2O9OA 4GXWA 5AY7A 5EA9A 4CU8A 2W54A 2AAMA 1JROA 2PWUA 3UPMA 1BGAA 2VVSA 3BAIA 1RD6A 3LX9A 3MJYA 1E15A 1W8GA 3EX2A 1GRAA 1GG1A 3MSGA 3IJLA 1RBLA 1US0A 1VBHA 3SB0A 2G3MA 4MY1A 4M7SA 3FGCB 1I0BA 3WELA 4Y9PA 3PTQA 3B0VC 4XZIA 4JTUA 1N61C 3M46A 3BQ5A 4JX4A 2FHFA 1QATA 4JOMA 1J4EA 3EDJA 2G4FA 4XBJA 2C18A 2BOGX 3U2OA 3LUTA 1TIWA 5CBBA 3ARQA 3OA5A 4GO9A 1XDIA 1F3WA 1RSCA 1POJA 2D2GA 4HU0A 2OJPA 3TYEA 4S3GA 4WY0B 4IMCA 1EX1A 2CHOA 4XD5A 3GK0A 3RILA 2DZWA 2XINA 5JMUA 4L56A 3OLDA 3VNYA 1XDJA 2WWDA 1WA3A 1PX4A 4H4PA 4HSOA 3IJQA 6A3HA 4KFNA 4CQ9A 3ENLA 4WDTA 2Y61A 1M68A 3PBUA 2DDXA 3R07C 4DO5A 4FP1A 3LSBA 3PZVA 5RUBA 2WJFA 1LPFA 1TWIA 3ABRA 4KIEA 3A3XA 3W25A 1TTPA 3LM3A 4MVAA 4AZBA 3W28A 4K38A 4EE9A 2WB5A 6CGTA 1DXFA 2X1TA 3FKKA 4JCMA 4MYXA 2VWSA 4DZ5A 4TX8A 4HOWA 1M7XA 3TDFA 1HKMA 4H2CA 3WD1A 1GVSA 1BKSA 1CTNA 1Q7QA 2WSRA 2WVSA 2V8ZA 2WPGA 3ZOAA 5JBDA 4QRNA 1WBJA 3K4WA 1UC5A 1UH4A 3HGSA 1H49A 2XN1A 2Y5JA 3IANA 4AY1A 2VZSA 1W17A 4GYFA 4XD4A 3CNYA 4DJEC 1RVGA 1N82A 2WOQA 2ZADA 4NEWA 4H7VA 4OUEA 3TUUA 5IM51 3B9OA 1QOPA 1TIMA 4CNPA 1YDVA 2ESCA 3BOFA 1R30A 3PANA 3D46A 2WLYA 4G7EB 1VFMA 3M5YA 4RCXA 4QGCA 2TPSA 2ZX7A 1ONWA 6ENLA 1D9EA 2P8BA 3H4WA 1W9UA 4O0KA 1QW7A 3UBPC 1QPKA 4CCCA 1HKKA 1TMHA 2DZBA 4A4AA 1A0CA 3VGFA 3OQEA 1TX2A 3H7RA 3CYVA 1RXOB 4JY8A 4E8CA 1DE5A 2J4GA 3N14A 3W4RA 2PTYA 3N4FA 1J5TA 4XD3A 2PGEA 2Y89A 1G69A 1RAKA 5CAKA 5TQLA 1IEQA 2P8CA 3BCFA 1E43A 1H7WA 3V1HA 3QKEA 4QG8A 4BA0A 2D23A 4I7VA 4JHZA 5CPMA 4MNJA 2R1NA 4MZ1A 4IIBA 1GZ1A 1O7AA 2B81A 3GHRA 4L5ZA 2D2JA 1DJIA 4AD2A 3N11A 2JKPA 3WQOA 3DENA 1UG6A 2D0GA 4GWEA 4W8BA 2PZ0A 1M7PA 1GJPA 2YA0A 1HJXA 4NXSA 2PD5A 4S3DA 4PL1A 3S6TA 3FJ6A 4W7UA 2DIKA 4L6OA 5FEZA 3ES7A 3IAQA 3S1VA 5AZ0A 1XJBA 1BD0A 4LC8A 1LQAA 4UCFA 1C9DA 3A7UA 3TP4A 1QRQA 1K02A 2GGIA 3DFQA 4FX9A 3ABOA 5FS6A 4CKQA 1JPKA 3IARA 3PTKA 1BRLB 4JNMA 4CD5A 4W7VA 1NP0A 1CECA 1X97A 3V7PA 9CGTA 1E6SM 1J93A 3GXTA 1KFBA 2ACUA 4XQ6A 5G2IA 2FIQA 2ZZBA 4E3TA 1CB2A 4ES4A 3TJXA 2A3LA 3I10A 3WEOA 2DZUA 3LBCA 1TYPA 1RP8A 4GXPA 4J5NA 2VFEA 2VEGA 1XSIA 4UOJA 3V4BA 4NX5A 1FWFC 2GVGA 1EX5A 4WHBA 4LGXA 4DM1A 3C2FA 1VFUA 2WSYA 3DKLA 1W1ZA 2A3AA 3T6CA 4RE4A 4CUCA 1R86A 1W0MA 2A7PA 2PAJA 5AZ1A 5CCZA 3CB8A 4BV6A 3GU2A 1JPDX 4LEFA 3U48A 4MJMA 1H6VA 5F2GA 1MFUA 3R7MA 1V3KA 2WW5A 3W71A 3JVAA 1P1MA 1KLYA 4HMEA 5EMMA 3GNOA 1G4SA 3AHXA 4WOZA 3CJPA 3USZA 2CWNA 5K2ZA 1VJIA 4EXQA 4JTSA 3R13A 1VBRA 2GOUA 3S6OA 2PWFA 3WDHA 4XX6A 4O1FA 4H6RA 2FTPA 1HJUA 2YB4A 4H6EA 1OFRA 5KETA 2PA6A 1EIXA 4LV4A 3H7UA 3QXBA 3LGDA 5FS8A 2WAGA 3AXIA 4D9PA 4Q4RA 3JUGA 4Q8TA 4AC1X 4AFYA 1C8XA 2PU1A 2OR2A 3ISIX 2ZA3A 3LBMA 4C6NA 1RVKA 3HM7A 4OECA 4ZO9A 4LQ1A 4O28A 4O12A 3A47A 2BC1A 4GUFA 1NY1A 5HJXA 1MW0A 2NSOA 2GVEA 1DTUA 5CG0A 3QGAC 4ZB0A 2YKKA 3I6EA 1M3UA 2J66A 1PBGA 1AA1B 5LKYA 4FX7A 4HNCA 3UR7A 1U33A 4IWWA 4DWSC 3VD7A 4GI6A 3AN1A 1TMQA 4HTBA 3GVQA 4IIGA 3AIEA 3M7SA 3AMKA 1AFSA 1AQ0A 1NSJA 1F8MA 2I1OA 3XISA 2QUVA 2ZXAA 1KGUA 4PODA 2CYGA 4UTTC 2GDQA 1BF2A 1LRNA 3W37A 3PG6A 3LS9A 2DFAA 3W84A 2WOVA 3IGSA 4E8DA 2HWGA 4JX6A 2DV0A 3LZ5A 4GIYA 3HPZA 4EPEC 3MKCA 5CXPA 4JIEA 4WY0F 1QNVA 1YQ2A 2VRKA 3IV8A 3RMEA 1BVZA 3C61A 3ME3A 2X1SA 1LUCB 3LTPA 4QDPA 3AALA 1Q6FA 1XLIA 3GW0A 4MJ2A 1V6YA 1FO4A 4Q4PA 1XLEA 1A4LA 4GE8A 3WBYA 3TMLA 3NOYA 5JUVA 3K30A 1FCBA 4X0VA 3ZSTA 1CLXA 3SZ8A 2NX3A 3T4WA 4DF0A 3MBFA 4QXIA 3KRSA 4H4XA 4L4PA 3HW2A 3U57A 4AY8A 1N55A 1TE1A 4GUGA 3MQTA 2QQ6A 3BANA 3GHTA 3EKLA 2ZWYA 4AIOA 5AYZA 2X09A 2R1MA 4R7WA 4HBKA 3W7CA 4GBDA 3H6OA 1T0OA 4JD4A 1XIHA 1F3TA 1C3FA 5AHLA 2VC6A 2ABBA 4LAKA 2J8TA 3DHFA 5KITA 3LXDA 5B7ZA 1P4CA 4P8VA 3V18A 2HTMA 2RFGA 3AROA 3TFCA 2BXZA 2DIEA 4DWSA 3L9CA 2OO6A 3B9AA 2PC4A 1XISA 1Q8JA 4B9YA 1PCWA 4WGHA 2PDWA 4M82A 3KHDA 4HIBA 2G5WA 1DL3A 4LY4A 3QSRA 4WKFA 3UZYA 4JAWA 4HA4A 2WOWA 4C91A 2B31A 3TEVA 1QW9A 3VOCA 1UMYA 3W00A 1F8WA 2W92A 4DBWA 2OGJA 2P3ZA 2GGHA 4GFSA 1Q7MA 4WR3A 5LIWX 5CBJA 3AICA 2GSEA 3DI1A 1KBIA 3NO3A 2GSHA 4AHQA 1EJ7L 2RAGA 4U5IA 1UOKA 3MYOA 3PNUA 5DMNA 1YE4A 1MDRA 1XH0A 1QUMA 4QQUA 1X1ZA 1TR9A 4IGSA 4ALDA 5XIAA 1Q6OA 1EH9A 1J01A 1RQBA 2IMRA 4LCRA 2NV1A 2YL9A 3WK1A 1J10A 1PVNA 3EWWA 3RJYA 3EUB3 4AHPA 4ADWA 1L8PA 1O94A 3AIRA 4FF5A 5DX7A 5CLTA 1PYFA 3SURA 1KFJA 1EC7A 1L9WA 2Z2BA 3MI3A 2ZXDA 2QPUA 2FPTA 3ZVHA 5I5RA 1JNEA 4FO4A 2QCDA 2J13A 3T2QA 2WC7A 3G77A 3UR2A 2XH2A 4ZQCA 4M80A 4NI8A 1CNVA 5E5CA 4GQBA 3MBDA 3WUBA 2YW4A 3SGUA 5SWUA 5GQBA 2RGMA 2PD9A 4RNIA 3HQPA 4AUBA 1ZPTA 2OEMA 4OKDA 3W6YA 2OMAA 4D6IA 4JN7A 3EDFA 3OEXA 5K9CA 1QI3A 2EGZA 4FS9A 1H1YA 4UTJA 1W9DM 2PSNA 4FK9A 3NUKA 3F03K 3QFWA 1KTNA 2Y85A 4QJ4B 3LQGA 3SADA 3VNKA 1CIUA 2BLEA 1H7RA 2WKLA 3DEQA 4F3HA 1GOWA 2WPBA 3P67A 3AMZA 4H4VA 1C93A 1NDYA 4XK2A 3LPPA 2OKTA 2CWXA 2VD8A 1QNRA 1DEDA 4LNYA 3RCMA 3V5OA 1LL4A 7ODCA 2OWCA 2C8NA 4RLIA 2JF7A 2VUYA 1QO2A 2FZMA 4ATWA 4UQAA 4EWND 3NQ6A 3M5XA 4K39A 5CPLA 1LLZA 4J28A 2QF8A 4X3ZA 3O6YX 1XRSA 3T55A 2YZRA 3P74A 2BB0A 4I3GA 3LG3A 4RK8A 3BMXA 3W2MA 1CGUA 4B2DA 2HPMA 4K68A 1YBQB 5CZKA 1S5NA 2GQ8A 4KBXA 2CW6A 1F9CA 4PMVA 1I45A 1ZAHA 2XVKA 4UCGA 3CWNA 3NCOA 2XISA 5JCKA 1NHQA 3DJJA 2VL4A 3QH2A 1E0TA 3ZIZA 1V4YA 4DEFA 4E3VA 3EMQA 5AECA 3S2JA 2ICSA 4AF0B 1ZSXA 4O19A 2V3DA 4J7RA 3UWUA 2E9MA 1A5LC 4WRHA 1I0DA 3W6LA 3GIYA 4DELA 3PWAA 3GDBA 3FW6A 3B9NA 4GX8A 4C6EA 2CLKA 2EG7A 1J0JA 4F8XA 2J88A 3UXKA 3VC5A 5AC6A 4PSRA 1KWGA 2W9MA 3I4EA 5DELA 2HPIA 4AX7A 4JYEA 2J75A 1V08A 4A3RA 3H2AA 2C71A 1BXBA 3VDBA 3RDKA 8RUCA 3H2FA 3KS6A 3TOPA 1FH7A 3PBVA 2QAEA 2YL5A 2J77A 2ZZ6A 3HG4A 1TKKA 2BVYA 1ZALA 4FNQA 3TIMA 1Z3NA 3CQ0A 4DX3A 5IDZA 4M5PA 1XV8A 1MQQA 4NHVA 5MF5A 3KOFA 3KDNA 1V93A 4DHGA 2GJLA 1JYVA 4J3XA 3WF3A 2GR2A 5DFAA 5EGRA 3NDYA 1AK5A 4CU7A 3DCPA 3R58A 5CG7A 2CBJA 1SW7A 1W3JA 4CNTA 5HNUA 4GQ0A 4EPKA 4I5XA 3E5BA 1VQTA 3W72A 4NUWA 2PI6A 1UASA 2DT1A 1O66A 3AWOA 3GSMA 1TJRA 5K7JA 1TJ2A 4V2XA 4EX4A 2PBGA 1PCKA 3K13A 1OT1A 3UVAA 3NGJA 4BK9A 1TPB1 3VIHA 1HJVA 2A3BA 2HVNA 4QS5A 4ZOAA 4AW7A 1DPMA 5AC4A 2DZPA 1HXJA 4KWUA 3EANA 4FOKA 3AQUA 3P82A 2Z7KA 4UTUA 2FHBA 2F9RA 1JIBA 2WNQA 1W3TA 2J8FA 1YKWA 2C13A 3W9ZA 3TOYA 3OHIA 1B5TA 3G1HA 4UTWC 2FPVA 3N6JA 3W3OA 1QHZA 4J3ZA 4M52A 3HN3A 3CIXA 1TZ9A 3U5UA 1UR1A 2OTDA 4O4WA 1FY6A 3GYCA 4PUWA 5F7UA 1B3YA 4J3VA 4EP8C 2RABA 1O68A 4HZ6A 5AHNA 4GY7A 1DYSA 1X2HA 4H8NA 5LNWA 2BGQA 4FOJA 1KV8A 5FMHA 1FHUA 4JTJA 1EUNA 3OIXA 1FFVC 3IUHA 1XYZA 3BQ6A 4A05A 8TIMA 2W62A 3EEZA 3DG6A 3L68A 3I3DA 2INEA 3HRDC 1KFEA 3VDHA 2WV8A 2TPRA 3TSDA 5H91A 1UD2A 4P7QA 7CGTA 1LLOA 4YWOA 4QLJA 4IIHA 3CL8A 3GR4A 1J9YA 2QEZA 3F2CA 1GKRA 2GQ9A 3TNBA 1KN0A 3NQBA 4GFIA 4D72A 1GQLA 1HTIA 1ZJIA 2Y8VA 3PJWA 4JFUA 4DJDD 3R8HA 2YCLA 4C7DA 4MWAE 1FX6A 2WSQA 8XIAA 3BAYA 4RDVA 3II1A 2FFIA 2C3CA 4B5SA 5EFFA 1JEHA 5I3GA 1R8LA 3RX4A 4BJHA 2VEIA 1EYWA 2BBFA 5HMSA 2Z1VA 1FFRA 4D71A 1S2VA 2NLIA 1TELA 1QNSA 2VX6A 1XYMA 4TTUA 4DI8A 4UFHA 3TC3A 3ZLHA 5C55A 3CWHA 4H2HA 4LYRA 5M5DA 1BRLA 1G9HA 2W66A 3B0UX 3STCA 2CZDA 4IP4A 2PTWA 2I56A 2R14A 3TNOA 4JDYA 2QIIA 2G95A 3LI0A 4PFMA 3ZSSA 1SYTA 2JEPA 1EO7A 1W5OA 1I60A 4W84A 4QDWA 1YYAA 1MNZA 4C6LA 4JFSA 3MJMA 4H4RA 1WYIA 2FH6A 3CV2A 3HPSA 3LRLA 4C6QA 2DT0A 2ZRWA 4BFAA 1Z48A 1LRQA 2EPHA 1R7OA 2CU0A 3UWEA 5A94A 1FWCC 2NW0A 3PUDA 1ZCOA 2XWDA 3E74A 4XZLX 1N60C 4DM2A 3A3HA 2VFFA 2C1HA 3T0DA 3EXSA 3ARPA 1YRRA 1W3NA 3QPYA 3OODA 3LCLA 3L65A 2GFTA 1YQZA 2FJKA 3WNOA 1O1ZA 3P8IA 1HQTA 2YVGA 3LTSA 5BRPA 3DJGX 5DQPA 1OF6A 1UWRA 6TIMA 5FA5A 4NAEB 1IYXA 3S2NA 1Y7VA 4MKNA 5CEWA 2BDQA 5A6JA 4ERIA 5KMYA 1W3HA 5LNRA 5CBIA 2X42A 4R34A 4IFRA 3E6EA 4Q8MA 3RLVA 3ITCA 5C6MA 2F7FA 1XW8A 3L5MA 3QR3A 5BXPA 1OADA 5EY5A 1AL7A 5JH1A 3S5NA 5E0FA 1TV4A 1TPH1 3RX3A 3RU8X 3OA3A 4ORMA 3N15A 4C5YA 3ZM8A 1JZ8A 3G24A 5D2YA 3MSRA 1DWAM 2E28A 2O9RA 1X8CA 1RPKA 2GR1A 4ICNA 3BLIA 4FXJA 1E1EA 1IF2A 3WD4A 2V38A 4PN2A 1WPCA 4E2DA 1GQIA 1NWUA 5T9BG 2E5AA 1QPNA 7XIMA 5AVNA 2J24A 3CT2A 3N25A 4J3WA 4R9XA 1E6QM 4A3YA 3WD2A 1LBMA 5HPCA 4K7VA 3RG6A 4N9CA 3CZGA 4DBDA 4NEVA 4PUKA 3VM5A 2J7BA 3W70A 1JOAA 3P0WA 4PSPA 1OIFA 2V5JA 3VNLA 4JDRA 2NQZA 3T44A 1GCYA 1CZ1A 4J35A 3UWWA 2VEKA 4FOUA 4IJBA 2JE8A 5E6YA 3BL3A 4KEMA 1V3MA 4K7YA 3MMTA 4ZO6A 1OD0A 2BP1A 1E4MM 2ATMA 4IOTA 2PDIA 4F2TA 1O5QA 2TAAA 3WLMA 3P6LA 4GYPC 3UWQA 4K8DA 4H9YA 4DYKA 5FJUA 3SFKA 2BASA 3SGGA 1H41A 3M07A 3QC3A 4IISA 4CNOA 4WSJA 5LIUX 1KRAC 2PDMA 2IQ0A 2FMNA 2QW5A 5D2XA 2ZICA 2DJXA 3PPFA 1U5HA 2EQ7A 1V02A 3EKZA 2WMFA 2ZDSA 1T40A 1EXBA 3MPGA 4UMAA 1U83A 3QQ1A 4MDOA 3BV4A 2ZUMA 1PZ1A 3LCGA 1B3VA 1SQ7A 1WQ5A 5DBTA 5HA7A 3FEQA 3UR8A 3WSUA 1FOBA 1E6XM 1JCMP 3N6HA 3ITLA 2IS7A 1NWTA 2OCZA 4J56A 1HGWA 1GW9A 3TN4A 3EXTA 1SJBA 5LIKX 3BCJA 4Z2HA 4E2BA 1NDVA 3CPGA 1SO3A 2NPXA 3MTWA 5LA2A 4LBSA 3MU7A 4GYKA 1EBGA 5C7HA 1XHCA 1KFCA 3I6TA 3W7JA 1B54A 5CPSA 1YNYA 2XUCA 4UFIA 3M6DA 4FX6M 4PA8A 4S2CA 5AN7A 3C0JA 4YVVA 4CD7A 3WY1A 2ONEA 5ABGA 5LNSA 1SPQA 2POTA 4FEZA 3T2PA 1DQWA 1DIEA 4ZOBA 4FLQA 3WH7A 4LRSA 4IT1A 4XO7A 1F3PA 4UMCA 1XYFA 2W27A 3KS5A 4B3KA 4O8AA 3FYPA 1IWBA 1PHWA 1VC4A 2YXXA 3LHZA 4Y8EA 4IM4A 1E70M 4R7OA 5HMFA 1C7SA 4A8RA 1OFBA 2IPFA 3PAOA 3QY6A 3RCYA 3OGVA 4LBUA 4Q4OA 3MUCA 5TF0A 1TPDA 1WNOA 3WDQA 2YVFA 3NVYB 1XS2A 3AYVA 3IIZA 5LIXX 2AMXA 3A9IA 2WPEA 3E12A 1EGVA 3B8IA 4D1IA 3UXLA 5I00A 3G3DA 1BWLA 2CIPA 1CXIA 1QPOA 3NQCA 3GXMA 1A0DA 3FFSA 3EWCA 2ACSA 3WYZA 4EMWA 1EP1A 1W6TA 1NOUA 2Z1BA 1E40A 3VIKA 3SCSA 2OWWA 1R2RA 4ZE4A 1LBLA 2VDGA 3JW7A 2BY1A 4RUBA 2ZRUA 1QNPA 1NFBA 4KCTA 2GUUA 2PDJA 1KFLA 3K4AA 4Q8UA 1DQUA 4JYFA 5BZAA 2H9AB 3TCEA 4J3SA 3S4TA 2E8YA 3SRFA 4JKKA 4PUEA 1VF8A 3TFXA 4PGLA 4K8HA 1HVXA 2YL6A 3OVGA 2FHCA 1UJQA 4IH3A 3MZ2A 1L2QA 3OZMA 5ER0A 1XYCA 1H11A 3AXHA 4HNLA 2NVDA 4ZSUA 2Z24A 3HMJG 1WAUA 3KX6A 3ZXWA 3C0SA 4IX2A 5K4XA 5A6AA 1EWEA 1YMYA 3S1XA 1Q7ZA 3A4JA 2QCNA 1S38A 1NVMA 1LG2A 3NM3A 4IIFA 1ITCA 2VX7A 1GK8A 1VRDA 1FWNA 1MW2A 3AFBA 3EEGA 3VZZA 5KZMA 1ZU8A 2A79A 3QW3A 1SFJA 3F2BA 1UUQA 1GKQA 4O52A 1RHCA 2BOEX 4P8WA 2J78A 4JN6A 4M24A 1TV7A 1OGSA 1Q6CA 2DUXA 4HZMA 1FWWA 2PMQA 2EXOA 1OGGA 4IIDA 2WYSA 1BG9A 4LVFA 3MHFA 1PS9A 4I5UA 1WKYA 2VCBA 3DYMA 4DNAA 4W8AA 3AM9A 1EQCA 1Q4NX 2YBUA 3TC6A 1L6WA 3W6MA 4IP7A 4GISA 3N29A 1Q5MA 2CC0A 3ZMRA 1QASA 2EJAA 4FXFA 4TOQA 4DJDA 1SB3B 2WPFA 3W7QA 1WBHA 1RBOB 4V15A 3N2TA 2WJZA 1E0UA 3ZLFA 2OX1A 3SN0A 4R88A 3QMSA 3SSJA 2I9UA 2VEPA 3G6MA 1RQEA 4PTVA 4PUJA 1XIIA 3GRIA 1FKWA 4AWEA 2X2YA 2JIEA 1UOZA 3GDRA 3KOWA 2HNHA 3GWQA 3OVQA 1P1XA 2DVUA 4MADA 2AAAA 1OABA 4D6EA 2OSXA 4H7ZA 1SW3A 1OK6A 1H4PA 2R1PA 1EPXA 1OBAA 2GDUA 4JIQA 2ALDA 3SIZA 1WP6A 4C6MA 4Z42C 3KW3A 1T7LA 3OIHA 1LM1A 4TTGA 2BHYA 4JXCA 4U31A 4ENLA 2J79A 4Z1BA 3PZMA 4IPJA 2GOKA 3TU9A 1BEUA 3GC4A 5C0QA 2FQIA 2Q3RA 3GFXA 3VOJA 4H4TA 1XLHA 1VPQA 2PP3A 4EQSA 3SCWA 2D24A 3L2IA 1GVQA 3NL2A 3B03A 2VJXA 4DY1A 1IT7A 3S2CA 1ZBKA 1O1HA 1R3TA 4NRRA 2AOSA 2CITA 4GLEA 2VT0A 3INPA 5A5WA 4Y90A 3VD3A 1UKSA 1H5YA 5EMYA 3BICA 1RZMA 3F7JA 5FSDC 4UR7A 5CPOA 3DFOA 4UIOA 4PB4A 1JUEA 4YNGA 4YTQA 1X6NA 3IGUA 5DMMA 1ZQ5A 4U2YA 2O0TA 1OCQA 3CV7A 5HR7A 5EB8A 4HZ7A 1BYBA 1CBGA 1QVBA 1MEHA 1TUXA 3ARZA 4FZIA 3TSMA 4G6CA 4DUXA 3UQNA 1AVAA 2GLKA 1WDRA 4D8AA 5C54A 2DIJA 2VDIA 3CAKA 4GI9A 4C6CA 1YXCA 4AWTA 4Z0SA 3VU2A 2WMJA 2Z0IA 3KP1A 4OHQA 3BAWA 4GIAA 4PUMA 3O9NA 3WJWA 5REQB 3ELFA 2PLCA 1DIDA 4QE4A 1B30A 4HOXA 5AYIA 5FOOA 2Q8XA 6REQA 3QBUA 5CC6A 1ZUAX 1OFAA 2DT3A 5E09A 1JNDA 3T9PA 1L6SA 2H3DA 1RA0A 1HF6A 4XSLA 3WMBA 2V5KA 4RNJA 1LDCA 3U2ZA 3SR6B 1K70A 4HB7A 1TPFA 1XICA 2P50A 4DN1A 3G1AA 4LXFA 3NL5A 1BTMA 1FXPA 2GJXA 1GYMA 3OW1A 3WH5A 1WXZA 1XYAA 2NVAA 4HMNA 2VC9A 1PZ3A 4G9PA 5FCZA 3UT0A 1ONEA 4AIEA 1SZFA 5I3FA 3UCQA 1GT8A 2QCEA 4PYSA 3S2MA 2G3NA 3CUFA 4GY1A 3NJ3A 2AL2B 3KEHA 3WMSA 3NSNA 3N1AA 4KQNA 3VKBA 4D6CA 3O6AA 1J0KA 2QUUA 2NXGA 2BY0A 3BLOA 3TQ0A 4Q8NA 3UU0A 4C1NB 4HK6A 3S6DA 5I09A 2GVYA 3GRTA 1E71M 3W1RA 1OFOA 3FX4A 4GIEA 1W5QA 1AH3A 3TWAA 5CC3A 3LCXA 3GLCA 4GXMA 1FFQA 4MWAB 1T41A 3SCVA 1I2NA 2H90A 3EOEA 1ICQA 3H55A 1M65A 1GVIA 2X0HA 3SCUA 2ZKMX 1UUOA 5AC8A 5FJRA 2EF9A 3BVJA 4UC5A 3CS2A 1A47A 3DFSA 5BMWA 3P2VA 2QJIA 5DBUA 3TROA 1UZHA 1ODUA 3EX6A 4LBRA 3G1XA 3CT7A 3E02A 4IL2A 4PMYA 3OLIA 1AD4A 3OU8A 2EQDA 3GUGA 1GG0A 2YPIA 5EYWA 4HP5A 3L7RA 1UP0A 1NH6A 1JI1A 1YTDA 1EL3A 5FESA 4GO8A 2GK1B 2A1YA 1F4AA 5BXSA 3NQGA 2Z6IA 4DJFA 4JICA 1N7KA 1BG4A 3MHGA 3NDZA 1YDOA 1XANA 3A3WA 3URQA 3EAOA 3CM4A 3TAOA 1OC5A 4B92A 3BLKA 2QZRA 2IKHA 4IQDA 1R0MA 1BQGA 4N9EA 4H9MA 3WMCA 4NAEA 5IFTA 1PIFA 3MP3A 2V6AA 4IHCA 4TX9A 4JFVA 3SBFA 1U5VA 3E9AA 2QCCA 5LNUA 3CPUA 4IP5A 4WSHA 4M3PA 5GJMA 3FA3A 3U9IA 3REQB 1FDJA 1EJWC 3N04A 1CX9A 2OT0A 4LEQA 1KCXA 3ANUA 3PHAA 2H8ZA 4H7CA 3T0CA 3UERA 4DPQA 3AYTA 3QZEA 4LCSA 3FXYA 2O7SA 1FWBC 3FYYA 4Q7BA 3HPXA 3VM7A 3S9IA 3OTRA 3MV11 2I14A 4ROPA 4GGBA 3L4XA 3CZLA 3GE7A 1W3KA 3KBSA 4J27A 4UFKA 2BVWA 2A5HA 3Q94A 4XIAA 4C6DA 1MZRA 2CPUA 1X6LA 4J1OA 4JPGA 2BGNE 2OWXA 2X16A 1XPYA 1STZA 1EJVC 4O16A 3N2XA 5CSUA 1J0HA 5D33A 1VCFA 2XIBA 1A5NC 1MUMA 1TTIA 1E0VA 3QYQA 4K8EA 2ZUVA 5GJPA 3QV8A 4ZXOA 4XWUA 4S3JA 3G1DA 2OG9A 2ZUUA 3MO4A 2J7EA 1R3QA 3T8QA 4IMDA 2J47A 5HBFA 3IGHX 3DG3A 3U4FA 4EKJA 1XG3A 1ZMDA 3WJYA 5HAOA 2VRJA 4BHYA 3LGGA 3FCPA 3TK7A 3IJ8A 1PXGA 4N4QA 3WBWA 1SSDA 3LM7A 2WBKA 3LB8A 2G96A 5CGTA 4B5WA 1XLBA 1XIJA 3GX9A 3DK4A 4FB7A 3N9KA 3RNDA 3SUTA 4TO8A 4FLSA 5I0DA 3WLKX 2XZ9A 3LADA 1Q4WA 1VZWA 3QW4B 1JZ5A 3LXAA 1VAHA 4LW7A 1A5OC 2PDYA 1A4MA 4GNVA 1IIHA 3CAQA 3B9EA 3G1VA 5AHMA 4O15A 1M9HA 4X2RA 3M7WA 5F1VA 3KBWA 2CETA 4GRTA 4RZ6A 2BCPA 2RDXA 4POCA 3VABA 4OGZA 2XYLA 3K46A 1L6GA 4AD4A 4E5TA 3WDJA 5BOOA 4CQBA 1S7MA 3B9JB 1NF7A 3RMJA 3FIGA 3SQLA 3WDIA 1KM5A 1Y0EA 2D2OA 4QP0A 4R27A 3MSDA 3CAVA 1JF6A 4OU1A 3STFA 3G1FA 4RDZA 3PULA 4EM4A 1DWFM 1XIGA 1JZ2A 2QNEA 2W79A 1EFZA 4ACZA 2IW0A 1CGWA 3T05A 2CNCA 1XWYA 2ZZ3A 4S3BA 5E0CA 1N5WC 4L1XA 3VNIA 3KBNA 1OB0A 2W0HA 5D2VA 2G3FA 2JGYA 3ITXA 3K8MA 2Y88A 4PRTA 1OCBA 1XPGA 2CLFA 3IWPA 1MUWA 3KHJA 4MY8A 4NAFB 3THUA 2WNWA 1LWHA 4H9UA 2D2HA 1GJWA 1TCMA 3EX4A 3UPWA 1OFEA 3MWCA 4IZGA 3W1UA 3TJ4A 5ENLA 2IKGA 4LF1A 4MB1A 1OT2A 3LHVA 4NZ1A 4DZAA 1S5VA 4A35A 5A6MA 3UWVA 3ZYZA 4MNLA 2I57A 1Z69A 2ZZ1A 3ZWTA 2W3ZA 5C9RA 1EA0A 4R7JA 3A22A 4OOZA 3L23A 4LUSA 1A80A 3BDKA 2C1IA 1ISXA 1EDGA 3AUJA 2YA1A 3EDDA 3VKAA 5IBXC 4BI7A 1CXEA 4GNKB 4G1NA 3MKVA 1E1CB 3WQEA 1QO5A 5EMKA 1T3QC 1VIWA 3V1PA 3WQ6A 3WJXA 2OSWA 2E7FA 4QE1A 2CLHA 3QVQA 2VC7A 3WQWA 3FY1A 2IQDA 3CXOA 2JFEX 5AHFA 4GHRA 3MV01 5A6BA 2OYKA 3H26A 3O8AA 1P7TB 2QUTA 5D9NA 1JFXA 1OX4B 2QAPA 3WZ0E 4OIFA 3GVRA 3B0XA 3CBWA 4G5DA 1MRQA 1OC6A 1VFSA 2AQVA 3VNZA 1DORA 5I2UA 1VHNA 1BWVA 2CESA 4B90A 2CZEA 2YJQA 1BVNP 4DRSA 4JTHA 1Z41A 1KB3A 1U30A 2V69A 2Y0FA 3EMCA 3GR7A 3NZ1A 3P60A 3VINA 1ESWA 1BWCA 1PTDA 1BXNA 3LSCA 4HOZA 1F5ZA 3T4CA 3W75A 5GJNA 5BU6A 3DHPA 3EBVA 1NELA 1RD5A 1OIMA 2WP6A 4IFKA 1V7YA 3Q4DA 4UUIA 5BCAA 1M03A 3CUGA 1B1YA 2XSAA 3AZSA 3BMVA 1IZKA 4TVUA 4E2VA 6TAAA 5I3JA 2QMKA 3E96A 3T07A 1DQXA 1H2JA 2RUSA 4UXDA 1YX1A 5DEZA 4F9DA 2EJ1A 1IIGA 2NVCA 4YCOA 3T42A 4JY9A 1JDCA 3I65A 4PH6A 3GRSA 4KCWA 1W5PA 4S3FA 3LD5A 2E67A 1LROA 2DW6A 3WDPP 3THDA 1KQYA 3GNRA 4GKLA 4QROA 4GD0A 1C8YA 2YCJA 4HHPA 3EKGA 3W2KA 3WJZA 2GJPA 4LWWA 5IBXA 2I5QA 5TD4A 4N0RA 3GVGA 4LA1A 4AIUA 2IQTA 4GGHA 4L61A 1FCQA 4TMCA 2ZOXA 1OF8A 4XVDA 5HDRA 1FP8A 1FH9A 5HNRA 4KWWA 1G1YA 4BF7A 4C6FA 3F4CA 5H8MA 2CFFA 2QHAA 4UQDA 3STEA 3LLFA 1SO5A 1NDAA 2C16A 4YU1A 3CMJA 1BWKA 1ECEA 3KCOA 4KESA 4Q8OA 1FKXA 4ROQA 3KBVA 3JZUA 3MY9A 4C6KA 3DAQA 3KVLA 5A6SA 5D03A 1VEPA 1ZLPA 1RCOB 5KVIA 1PHQA 3BARA 2Z1KA 1IEIA 1BSIA 2I17A 2R1KA 1F2JA 1E3ZA 2D0FA 4DLFA 2I9EA 2WVVA 3L66A 3BW3A 2PDPA 5HWJA 5HUOA 2J6XA 3R4IA 1KCLA 4AZIA 1ME9A 1PO9A 3WQDA 2Z1WA 1XXXA 3LOTA 3VK5A 3VIPA 3EX1A 2GR3A 1PKYA 3SUWA 4L7ZA 3VILA 1ZBVA 3N2CA 3CLWA 4RXGA 2PDQA 2WBGA 1K8YA 3QPEA 1EOKA 2V5BA 1UD6A 1DJHA 4UB9A 3RLGA 3KZSA 3TTYA 4PEKA 3ZFHA 1LQ0A 4Q6JA 5KINA 2QKFA 4ZVJA 5EBKA 3N12A 5LYRA 3HJEA 1K9TA 2R82A 3UXDA 5I7GA 3A23A 3SQSA 1GW1A 4B4HA 1UA3A 1U1UA 4EM3A 3ITTA 1REQA 5KEZA 1PWLA 3M4HA 2QYGA 5JU6A 2VO5A 1RCXB 4S38A 5DT7A 3WDRA 4MM1A 2JBMA 4OOUA 4GABA 1ZRQA 2CCRA 5BW6A 3SSZA 3VOGA 1N63C 1FEBA 3LCHA 3N17A 4B3LA 1YNPA 1M04A 3PJUA 3W7OA 3IUIA 4TX6A 7ENLA 4PL2A 3VE9A 3ZLGA 3NQFA 9XIAA 3TC7A 1MQRA 3IRDA 5DMYA 1ZFJA 3PSVA 4MSSA 2OXNA 4AZCB 1PEZA 4EXBA 4A22A 3WLIA 3EDEA 3DDMA 2XVPA 4EF9A 1JRBA 2OPJA 4HNOA 1TCDA 2A7NA 1OQFA 2D20A 1US2A 4MAVA 2REQA 1AUSL 1W9XA 3BLLA 1EC8A 2EQ6A 3W27A 4MWAC 2ALRA 2CBVA 2GGGA 4R33A 1L6YA 1AMKA 4NRSA 4Y9AA 2BX7A 4EQXA 2GUYA 1E4NA 4JR5A 5H8PA 4D2JA 2WBAA 2G41A 1HT6A 1S46A 5LGZA 1XKYA 4YCPA 4P7RA 1MXGA 3THQA 3U5YA 5I23A 4YVPA 2NUYA 5I78A 3GZAA 1SM9A 3VCRA 1XBXA 4JTTA 2JKAA 3N2BA 1F3EA 3UW6A 4ZQPA 5T8GA 5REQA 1CW2A 3GTFA 1I6NA 1TV8A 3ZJKA 3NQMA 4Y9MA 2ZUTA 3GDMA 1GQNA 1FFUC 4WX2A 3NVWB 1P43A 4JQ4A 4AMAA 3WH8A 1XSJA 4HNVA 1YNQA 4IGNA 1WYGA 1PTAA 3CO8A 1SFTA 1EBDA 1AQMA 2NX1A 4IG2B 4NP7A 4M19A 2E1DA 2O55A 2Z1XA 3RR1A 4HJFA 1X6UA 5ABEA 3FHAA 3W1QA 1F6PA 3FHQA 4W93A 1C92A 3W88A 3L5OA 1VQZA 4JNYA 3WQCA 1XSKA 2RHGA 3BG3A 1TA3A 2EPOA 4HN4A 1G4PA 2CLLA 3C8FA 5DO8A 2DT2A 1SMAA 1LVLA 2FPYA 2VCAA 1YADA 3KLKA 3C2YA 3WQFA 2AL2A 4KPLA 4QEHA 1M1BA 3TW7A 3FKRA 1QK2A 4W86A 4P2VA 2ACRA 3NSMA 1OG0A 3VI2A 5E93A 3WK2A 1WXJA 4P5UA 4KRTA 2ZIDA 1QK0A 4ZENA 4L4LA 1A3HA 2FTWA 3MZNA 3MUY1 4RE3A 1HL2A 4LUTB 1K3UA 1R47A 4L64A 1QXLA 1C91A 1AH4A 3TX9A 1SZRA 3KBMA 1IZCA 1HO1A 5AB3A 1FP9A 4O14A 2YXGA 2GVJA 1VCVA 4MJZA 4H9XA 2PCQA 2NQ5A 4UBPC 2DW7A 4MZYA 2O4QA 1WCGA 2HNEA 1XG4A 2CZ5A 3PG9A 3VE7A 3UJSA 1HL9A 4UQ9A 3B97A 4TIMA 4GMEA 3RPMA 1D2KA 1PB0A 2TYSA 4IFOA 3PY2A 2PWHA 5GRTA 1VEOA 2NT1A 1ZXIC 4S39A 3ZZ1A 2O9PA 3MT1A 1KGXA 2H6RA 2DSKA 3S1WA 2GK1A 3DK8A 3EDKA 2NX9A 3FSUA 4IJCA 3E0WA 5F1UA 3W1AA 4W5ZA 2JK2A 1XBVA 3LRMA 1CXKA 5J04A 1EOMA 2WJDA 1AJ2A 3GU9A 5GNZA 1D7YA 3IIPA 3M0LA 3W7GA 2C0HA 2QIWA 1IQ8A 2XFWA 1BHGA 1I1WA 2EQ9A 1YEYA 3QOKA 1HGYA 3VNMA 1WZLA 2A3HA 2QJMA 5C2CA 1G5AA 1DXEA 4PMRA 2EPLX 3EOUA 3SIMA 3REQA 3W38A 1VYPX 2V2HA 4AZ5A 2WZHA 3PWGA 1IZJA 2VEFA 2J27A 1JUBA 1O5KA 3H8AA 5JCMA 4FA3A 1ECQA 4AZ7A 1NAL1 4MY9A 3N13A 1MOKA 3GAKA 3UCDA 1JDEA 4DO4A 3FYOA 3FDGA 1CXHA 5D8ZA 4BKNA 3EPMA 4ZQMA 4TVYA 1EBHA 4IQEA 3DKJA 3T2OA 1H0GA 1I2PA 5EMJA 2RH9A 1EB3A 1ZL1A 4NL1A 4GACA 3M0XA 3FA5A 3V36A 1KRCC 3VGDA 4Z2GA 2FDMA 1XIEA 3PZOA 3HGJA 3FEMA 1HJWA 7REQA 5EBAA 1F6YA 3MSYA 2J3NA 4RV3A 2V3EA 3TTSA 1VGAA 4OBSA 2NQJA 3NGFA 1JYNA 4TVDA 2DSUA 3MW7A 3HTWA 1U2YA 4FALA 4Z1YA 4O0QA 2ZUNA 1JZ4A 1UZ4A 2PDGA 2X50A 4ERGA 1MNSA 2A7RA 1CCWB 3GKAA 3TV8A 3WQVA 2JK6A 4GNJA 3LENA 4AZGA 2FGLA 3DHUA 1FWJC 3CH0A 3L67A 3F4WA 3OVRA 3LPGA 4HGXA 3N6QA 3WL1A 3CGEA 3WEZA 3QFBA 5EFDA 4CCZA 5C71A 3UA3A 1K7EA 3DFYA 3AI0A 1XIDA 4B3ZA 5KVHA 1ONRA 5HPOA 4TQTA 5CPQA 3R6IA 3W1PA 1J0YA 4ML4A 2WWCA 2VZOA 2V63A 1JZ3A 3I7RA 2P1FA 4H4IA 4AZ6A 2FMOA 4DWSD 4M51A 3ETRB 3SN1A 1R3YA 4K36A 3N3MA 3BZGA 4HN8A 2IPWA 4RZ5A 1H2IA 4AWUA 4JTRA 1XLJA 2Z4GA 3LTYA 4GBUA 1FHDA 2E77A 3DBNA 3KUMA 3VUSA 2OEKA 4LOCA 4DWDA 2G8ZA 3AYRA 1QOQA 3VVGA 2GVLA 4HHLA 2PE4A 4GJJA 3P62A 3S5YA 2W5FA 3PB0A 2NQLA 1JUKA 4YWIA 4Z2IA 1DJXA 2PEVA 1TWWA 1KWKA 1MO0A 5FS9A 1X2GA 1G0CA 2J8GA 4OFCA 2Z25A 1EIBA 4FNSA 2NWSA 2IKJA 2P10A 3SCQA 3FA4A 2W55A 4WVXA 3KP0A 2NUWA 1KR0A 1EJTC 1TPWA 1FCUA 3KFTA 1QWGA 1GVYA 3CQHA 5ABHA 5HNNA 2R91A 1QPRA 3T7VA 3A5FA 3NTYA 1GHRA 1IE7C 2HSAA 2ASHA 2E5DA 2E68A 3AIBA 4EPDC 3NPVA 2R24A 4MAZA 4NU7A 4NAFA 4XG1A 3PZIA 1JQXA 2QV5A 1XFCA 5MHBA 1KNWA 1WAWA 1Q1WA 2PWVA 3UJFA 4BQ2A 3G1SA 4CLMA 3URBA 3AJ7A 1NU5A 3ITOA 2E1WA 4DZHA 3B8TA 1FRBA 4UTFA 1CYGA 3M0HA 5TAOA 1HP5A 4ERAA 1B4EA 1Y5XA 4HA1A 3CMGA 5BMXA 2DVTA 1S5TA 2ZQ0A 3ANYA 3F2DA 1AW2A 1SZEA 3T0AA 1F4HA 3G18A 4WDXA 1XRVA 4JIRA 5FJIA 5AYXA 4DVOA 3AJXA 3QY8A 4WGXA 3UG3A 1OVDA 2A3CA 4NJIA 1IEWA 4DIAA 1XDLA 2E4TA 4G2DA 3IVSA 1JPHA 2PZNA 4JTEA 1FWSA 4PUUA 4F2BA 2B7NA 2WP5A 2ZYFA 2YIHA 2XTKA 5M2FX 2DVXA 4KKXA 1V0LA 5FS7A 3OBAA 4A21A 4XV0A 1UBSA 4IX0A 3S5OA 3AU2A 2C3DA 4QIUA 3MVTA 2Y7DA 3F5JA 4Y8FA 4H4SA 4LJ3A 2YYUA 5A2BA 2VQTA 1KCZA 4OJYA 5FSEC 2J7DA 1ZJHA 4P8UA 1KBJA 5TR3A 4DUOA 3ARSA 5D9MA 4XZWA 5GVJA 2IXVA 4O4VA 2YW3A 1NFGA 3CGTA 1NDWA 1WUFA 3BUVA 3LI1A 3UG8A 1FWAC 3NEHA 3KOXA 2Y5SA 1WDPA 4GH3A 4IMEA 1Q6EA 2Z7GA 4KH2A 5DT5A 3UCCA 4B2DD 1TZ7A 3AMGA 3UZXA 3A24A 3APTA 3SCRA 3GC5A 4D8LA 3DFHA 1KCKA 1A50A 1E5NA 1RA5A 5KTLA 1YDYA 2VD9A 4UWMA 4FIQA 4MKSA 3NRZB 4X60A 1AH0A 3GDLA 4Q7NA 1O6IA 4IPLA 1QAPA 2X0YA 3LHUA 1NARA 2VENA 1VENA 1EKOA 3PSWA 4QAWA 2YBVA 1UQYA 1XINA 2A4AA 2BXYA 3NQVA 3BWWA 3LZ3A 4M6UA 1JGIA 2A85A 3DK9A 2P5NA 2XIIA 2XIOA 3B8SA 4UZUA 1RK5A 2VYOA 1UZ1A 1WDQA 3G2GA 5FJJA 1WDSA 2J9YA 3TQKA 1K4QA 1P0BA 4UQEA 5HWNA 1NHPA 1QPQA 2FZNA 3UPBA 1UIOA 4N6FA 4OUIA 1O4UA 3MCNA 4DJEA 2V5LA 2IPGA 4PR4A 1ALDA 4WJXA 5ECVA 3LLDA 5LA0A 1D7KA 3KLLA 2PDHA 1H62A 1OFDA 4MLRA 2VGFA 2DSZA 4LVAA 4HSHA 3SDOA 4KMQA 4H8VA 3V3WA 1XIBA 2C91A 1GYNA 3GW3A 2QDHA 3CAWA 2Z1SA 4GJ1A 3WJSA 2OEJA 1I1XA 2VXNA 2XIQA 1E5JA 3SCPA 1EEPA 1HJSA 4BWLC 3IGXA 2V2CA 4AIBA 4HHHA 4NG3A 4S1FA 2E25A 1VKFA 1K1DA 1PPIA 1P5BA 3CO4A 1W1IE 4DPPA 4H1ZA 4ZXLA 1E6RA 1XL9A 4M1RA 5DN1A 1KBBA 2CBIA 1UR3M 3U0HA 4PBEA 3BCDA 4X22A 2GQWA 3HG3A 3QOMA 1WXYA 1V3LA 1HNYA 2ZVIA 2EKGA 2XM2A 4OT7A 1B2YA 3SGZA 4YTRA 2ZUWA 2DH3A 1WKFA 3URNA 4D6FA 4HSNA 4ATLA 4RZ4A 4EQWA 1GSNA 2YB1A 3UZWA 1RP9A 3KTCA 4Q33A 5D30A 4HCDA 3VD4A 1CGVA 4QEEA 3SCTA 4U28A 5HXMA 1A53A 1DHPA 1YPIA 1DVJA 5I79A 3D9XA 5XINA 3ABZA 4QSFA 1W1A1 4B5XA 4MKVA 2PU0A 1E73M 3QPZA 2YLLA 4IPIA 2OLHA 5CGMA 2R1LA 2NV9A 4GZJA 4ZZ9A 2E3ZA 4NNBA 1V0MA 3B0PA 5DXXA 2KX9A 4RW3A 1W1TA 1PX8A 1B3WA 1PV8A 4NKCA 4AD1A 3IV3A 4EOUA 4I5RA 4PCTA 4BS0A 2XFFA 3NQ2A 4AZCA 4AEEA 3KRZA 4C1KA 2WCSA 3BOLA 3TN6A 1W2PA 3P61A 4US6A 1TZZA 3NVZB 3LPOA 1D3GA 2PODA 3R5EA 2RDWA 4B9ZA 2OLSA 2VURA 3HFYA 2CDUA 3PZ9A 4PCPA 2DQXA 4BZYA 4TR9A 2P53A 3WL0A 3W02A 4QBXA 3L2LA 1EGZA 4FNTA 3B4UA 4HK7A 4QS6A 1TX0A 2CFYA 1AW5A 3KZPA 3MP4A 2Q71A 2WZMA 3OYZA 4ZO7A 3M0IA 4UMBA 2GYIA 1RJPA 3OO2A 4PBGA 5IHSA 4FX8A 4DUVA 4QCEA 2WVTA 5E9XA 3R8GA 5I24A 3ARYA 3HV8A 2HDJA 1UW9A 3OOQA 3A7RA 1FWGC 1SO6A 3PF3A 2R9ZA 2NXHA 5FEXA 4X9YA 2FZDA 2MNRA 4IUOA 1OGBA 3R94A 3NVVB 1XYLA 1HZYA 3H4KA 3N2MA 4REQA 4APNA 3UXAA 1OJXA 3U2EA 4DLMA 2RDTA 1QJWA 1HX0A 1M7JA 1ME7A 3BV7A 3S0CA 4PMJA 1M6IA 4FMVA 1BKHA 1DHKA 3K8LA 4IQLA 2AGTA 1UWUA 1C90A 5I02A 5HQMA 2UY3A 3M16A 2X2GA 1E4IA 4D1JA 4RNFA 3M43A 4Q8PA 3TYUA 3FK4A 2PPGA 3LCWA 4W9TA 3M0VA 4WQ6A 3WH9A 4I7WA 2C15A 4KFOA 3OZYA 1TRDA 3L4UA 3N9SA 5AVHA 2FYMA 3U3HA 4TU1A 2FJUB 5K9DA 3ALGA 2C0AA 3A6OA 2F38A 4DYEA 3M0MA 4ICCX 2NWRA 2V67A 4C7FA 3MI2A 1UB3A 3TE9A 3SI9A 1UR8A 3KAOA 4GQQA 4UQBA 5BXTA 4LAUA 4W5UA 3VOIA 2OQLA 1LL6A 3OC4A 4H50A 3TVAA 4UTTA 2FGBA 1L2UA 3U8GA 7TIMA 3GC2A 4C6JA 2UZ9A 1TVLA 2HZGA 3C3NA 2RDUA 3UWZA 4RW5A 4O57A 1W9VA 3IS4A 4WLCA 2ZZ7A 3N9RA 2HQMA 4QLLA 4WZHA 1JJKA 1GVRA 1GHSA 4QR6A 1V97A 1P6CA 4GVHA 4W85A 3NPXA 1JPIA 1XUZA 3UGVA 4G8TA 1W31A 3O06A 4WIWA 4EK7A 1VFLA 5HOSA 4K7ZA 4QSHA 3NNTA 4XZBA 2TRSA 1Q85A 4YL2A 2BG5A 3B3DA 2B7PA 5ECUA 1OZQA 4NZJA 3GH5A 5JQ9A 5BXRA 1A3XA 2CERA 4XAZA 1D8CA 3HQNA 1KQZA 3MHUA 4NT0A 2W3RA 4UR8A 5CKSA 3S9YA 1TTQA 1PZ2A 3SJ3A 4YYCA 3CASA 3WKZA 3O15A 4ONVA 3VZYA 2PGWA 3VMOA 2E8ZA 2DQWA 3CQIA 1EJUC 4UFLA 2WMIA 1UD3A 3R12A 2OSYA 1R46A 3QLLA 1HKIA 1UWTA 3CIVA 4GI4A 4ZEPA 1TUFA 2J74A 3KVKA 3CZ8A 3VC6A 4Z2KA 5IXEA 3ARRA 2ZZ5A 2BXVA 3H2CA 4YIWA 2SFPA 1V7AA 1E1FA 4H04A 3I68A 3RRXA 3TZFA 2CXGA 2PUZA 4OTKA 3FOKA 4I9AA 4NJHA 3CUHA 1J8VA 1Q13A 2O7QA 3WNKA 3RUBL 1Q6GA 2X8RA 4NJJA 1RK6A 1W8SA 3BW2A 3WNMA 3LRKA 2GGJA 1G4TA 5BRBA 4MPQA 2I7GA 3AOFA 4IICA 3C0QA 5A8GA 4TUFA 4YVXA 1ITUA 1N2VA 1F8IA 2G3IA 4XZ9A 4RXFA 4TMBA 1QW8A 4AXKA 2WHLA 1PKMA 4JX5A 5G1TA 1AG1O 4P7NA 1QBAA 1UZDA 5D2WA 4UNLA 3KTSA 1SGJA 1VBGA 3VZXA 4MHBA 2OB3A 4U3AA 1B3ZA 4E4PA 2QF7A 3OGSA 1KTCA 2ZBTA 4GR1A 1ZJBA 3TYCA 3NL6A 2WMKA 3N4AA 1VLIA 1T96A 4QE5A 1K9FA 3M1ZA 3ABXA 5H1WA 2VOMA 3SY1A 3WF4A 1VJZA 3VUPA 1JD7A 1O95A 1ZX9A 1ICSA 4HPNA 1YLVA 3WLQA 4QHRA 3UJ2A 3HPAA 3DGBA 3KBJA 3QKZA 3ONCA 4XBSA 3H2EA 1PZ0A 1S2UA 3BC9A 1M6JA 2YYTA 3UETA 3VXGA 5HUPA 3O3RA 1Q6RA 1MUCA 4F0RA 1VEMA 5K3VA 4FR1A 3LHYA 3NQ8A 5JIWA 1SR9A 1J79A 2R94A 1B90A 2E6YA 5HWMA 4LS2A 1B0IA 1Z8AA 1A49A 1NDZA 4Q7IA 4FHAA 4Y9NA 3EXRA 1ISZA 3FGCA 1ZK7A 2J7FA 4U3CA 3UYIA 3KL0A 1R3RA 2HV5A 3TA6A 3QZAA 2VUNA 3E38A 3EZ4A 1SZNA 2QJGA 4PEEA 4JTCA 3E0VA 4Q4SA 3T09A 2BWGA 3GHUA 3P14A 1DV7A 2VTFA 4BQ4A 1K9EA 3R79A 1ADDA 5GNXA 4EIVA 1PDZA 1NM9A 1TWDA 3MUIA 1CI1A 3GHSA 4DBEA 4WY0A 1GRGA 2PDBA 3H54A 1QFEA 3NAVA 2HQAA 3P81A 1WZKA 4M6PA 1AMYA 1QI5A 2YFOA 3G1YA 3UJEA 4LAMA 1TJPA 2HBVA 4AX6A 4AMCA 3KL5A 3V5FA 3DZ1A 2QMJA 1R7AA 1IXNA 2W3SA 1TVNA 1LOQA 1LOLA 1WKDA 5LSMA 3EB4A 5B80A 5C7VA 1CGYA 3Q45A 5FKYA 1ZTVA 1TTJA 3GH7A 1UA7A 2H3BA 3UD6A 1UP2A 1YE6A 4ACYA 4LS0A 1VB9A 4A8LA 5AC7A 1BSLA 2OODA 5U4NA 1PE1A 1FEAA 3I3EA 1XLFA 2WQDA 3U2CA 3QF0A 1GOOA 1TFVA 2HE5A 6PTDA 3ORWA 4PE8A 3VIGA 4WOQA 2F6UA 4YHEA 1HKVA 3TXZA 3DGHA 3WFZA 4QJ5B 1UMLA 4V28A 1ITQA 2WZIA 3W76A 1EGMA 2PGRA 3NZGA 4Z1AA 4J2PA 4KRZA 3STPA 1JZ7A 3WO8A 3S2LA 5FF0A 3B8DA 1BAGA 3K4DA 1I9CB 3ARVA 3TW9A 2YDAA 1G67A 2Y7FA 4CQAA 2GUBA 1XD0A 2X30A 4G7EA 4I9JA 3W26A 1JRCA 3VKCA 1XKJA 3WLRA 1F6KA 1K77A 3ZT6A 1LBFA 5BOEA 1TB3A 1R9XA 3VDCA 1MYRA 1ISWA 2PCEA 3VDGA 3LCIA 3HJZA 3QC0A 4H6QA 1HP4A 2FB3A 1R2TA 3AHTA 3EPNA 4PB5A 2CLMA 1W9BM 1D3HA 3CQKA 3GAYA 4A2RA 5A8QA 2BVDA 2NUXA 4WCJA 2DH2A 1VFFA 1VLWA 3T81A 3VMPA 3S3GA 1YTEA 3OG2A 4NSBA 3TN5A 2W61A 3CK5A 4PTDA 3ZVHB 1KM0A 1B3OA 1EF3A 2VM8A 3OZPA 1UD4A 2QCDB 3W01A 3DIPA 4QG9A 4GVIA 3NO1A 1S3TC 2UBPC 1OG6A 1WOAA 3BSGA