4J3ZA

Crystal structure of mandelate racemase/muconate lactonizing enzyme from jannaschia sp. ccs1
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
388
structure length
388
Chain Sequence
VKLDTLDIFAVAPPPPGWGGRYWLLVRVTTDTGLTGLGEVYAAGVGPEAMTHVIHDVFTRHMRGEDPANIELMSRRAHSSGFTQRPDPTVFGAFSGLEMACWDILGKARDCPVWAMLGGKMNDRIRAYTYLYPEPHHDTNAFWTSPEMAAESAAARVAEGYTAVKFDPAGPYTMRGGHMPALSDIDLSARFCAAIRDAVGTQADLLFGTHGQFAPAGAIRLAKAIEPYDPLWYEEPIPPDNLPGLSEVAAHTSIPIATGERLTGVTEFTQALHHGARILQPALGRAGGIWEGKKIATLAAAFGAQLAPHLYAGPVEWAANVHLGVSCPNLLMVEAIETPFHEALVTGRPRVENGFVAAPDAPGLGITLNDAIANAHRYTGNRLHLEMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of mandelate racemase/muconate lactonizing enzyme from Jannaschia sp. CCS1
rcsb
source organism Jannaschia sp.
molecule tags Isomerase
total genus 123
structure length 388
sequence length 388
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4j3zA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4j3zA01
2PODA 4MGGA 3TTEA 3OPSA 4G7FA 4DWDA 4GFIA 3VFCA 3T9PA 4GYPC 3DG3A 2QJNA 4E5TA 3FYYA 2P0IA 3UGVA 2QQ6A 2MNRA 3P0WA 3DESA 2PP0A 3TJIA 3U9IA 2AKZA 2HXTA 5FJUA 3EKGA 1NELA 3JVAA 3P3BA 3ZVHB 3TCSA 3IJQA 4K1WA 1SJCA 1PDZA 4ZA0A 2OQHA 3PWGA 2PU1A 1WUFA 3UJRA 3H7VA 1JCTA 2PMQA 1XPYA 3DFYA 2OLAA 2PCEA 7ENLA 3GC2A 3OZYA 2HXUA 1EBHA 5FJPA 2GSHA 5FJTA 2GGIA 2GGHA 3EEZA 3QKEA 1OEPA 3JZUA 2OPJA 1MRAA 3SN4A 2FYMA 2I5QA 1SJAA 2ZADA 4F4RA 1JDFA 3ZVHA 1KCZA 2OX4A 2OQYA 4H83A 3IJLA 3S5SA 1TKKA 3ES7A 3UXKA 3ES8A 4IT1A 1BKHA 2QJJA 2PGEA 4H19A 3SN1A 4JN7A 2GDQA 4HPNA 4IP5A 1NU5A 2P3ZA 3UJ2A 4A35A 3DG6A 3NO1A 3V3WA 3CXOA 1SJDA 1JPDX 2NQLA 5EU9A 1XS2A 5ENLA 3OW1A 2O56A 3IJIA 4HNCA 2HNEA 3DG7A 3MZNA 3SSZA 3I6TA 3V4BA 4K8GA 3PK7A 2PA6A 3UJSA 3MKCA 1EC8A 4H2HA 3H12A 2PPGA 2QGYA 3QN3A 4A3RA 3RGTA 3NFUA 3DFHA 3R0UA 2DW6A 2OVLA 2AKMA 4ZCWA 3GD6A 3PWIA 3ZLHA 3DERA 3ENLA 3D46A 2ONEA 4GIRA 1TE6A 5BOFA 3H70A 4J3ZA 4HN8A 2P88A 2QJMA 3VCCA 4E6MA 2PTZA 3CB3A 3SBFA 3CAWA 4MMWA 3CYJA 4HNLA 3TOYA 1F9CA 2XH0A 3OZMA 4HCDA 1FHVA 1W6TA 3UCCA 2OO6A 1P43A 3QPEA 1MUCA 2GL5A 1R6WA 3TQPA 1ELSA 4GYPA 3DDMA 2POZA 2XSXA 4X2PA 1EC7A 4H1ZA 4DN1A 4MKSA 3UCDA 2AL1A 2AL2B 6ENLA 4DXKA 3QLDA 2ZC8A 3R10A 3FXGA 1DTNA 3TW9A 3Q45A 3Q4DA 3QTPA 3MWCA 1MDRA 1KKRA 1EBGA 3IK4A 3R1ZA 3VDGA 3FV9A 2P8CA 5J04A 3PFRA 4Z17A 1KD0A 3MY9A 3VA8A 3N4FA 3NXLA 2XH4A 3RRAA 3KUMA 4JN8A 3ZLFA 1ONEA 3U4FA 1WUEA 2QDDA 2FKPA 4YWSA 3DGBA 2MUCA 1E9IA 3VCNA 4HCLA 2PTYA 2AL2A 1P48A 3JW7A 3R11A 2XH7A 4M6UA 3RR1A 2OKTA 2OZTA 4ENLA 3P93A 3CK5A 2PTWA 1PDYA 2GGGA 1SJBA 4K2SA 3SJNA 4Z1YA 2P8BA 1YEYA 3DIPA 3FJ4A 3T8QA 3RO6A 4HCHA 3R25A 3UJFA 3T6CA 2DW7A 3MSYA 4GMEA 4JHMA 4G8TA 4KEMA 4GGBA 3VC6A 2XH2A 1EC9A 3H8AA 4EWJA 3TJ4A 1TZZA 1RVKA 2PU0A 4A6GA 5FJOA 4IL2A 5BOEA 1MNSA 4HYRA 2OZ8A 2PTXA 3BSMA 4IP4A 5FJRA 3NZGA 3UXLA 4IHCA 3VC5A 3RITA 3N4EA 2HZGA 4J1OA 1JPMA 4IZGA 3GO2A 4DYEA 4GGHA 3ZVIA 3N6JA 2PP1A 3UJEA 4E4FA 3DEQA 4KPLA 4DHGA 3FVDA 3RCYA 1IYXA 4E4UA 4ROPA 3S47A 1FHUA 2QVHA 4FI4A 1R0MA 1BQGA 1ECQA 3THUA 3BJSA 3N6HA 2RDXA 3SQSA 3MUCA 2PP3A 2PSNA 3HPFA 3T4WA 2GGEA 3BOXA 3OP2A 2OFJA 3B97A 3V5CA 1MDLA 4E8GA 3R0KA 3GY1A 3CT2A 2GGJA 3MQTA 3OTRA 3I6EA 3K1GA 4DX3A 2QDEA 5IDZA 3STPA 3TWBA 3ZLGA 4KWSA 2CHRA 4IL0A 2OG9A 2OZ3A 3V5FA 2PGWA 4M0XA 3FCPA 3SN0A 2XGZA 1KKOA 4GISA 4FP1A 2PS2A 3TWAA 3I4KA 1L8PA 4KT2A 3D47A
chains in the Genus database with same CATH superfamily
2CZVA 1CIUA 3NL2A 4NZ1A 1TTQA 4XWUA 2ZUWA 4ZO9A 5DCBA 3BOFA 2HQAA 3DFPA 1W1YA 1E6PA 2PP0A 5CC5A 3GRTA 5CKSA 4IGNA 4Y2WA 3TX9A 2WMKA 2FZ9A 3LS9A 3BG9A 3WLRA 4JTKA 1FXPA 3JVAA 2NUYA 5XIAA 3ZVHB 1V0NA 1GYLA 3TLLA 4BEUA 4W7WA 4JQ1A 5LIYX 2GUUA 3W1PA 4EM3A 4B9ZA 3HN3A 4OV4A 4Q8WA 1UJPA 4NL1A 2O9RA 7ENLA 1EJXC 3G1XA 1MW0A 3WQ5A 3S2NA 5FJTA 3WUEA 3UPWA 2VDIA 1TWWA 4CLMA 4XBJA 2V3GA 2BX7A 4LYPA 3L5MA 1SJAA 2BVDA 1EJRC 1FOBA 1ISVA 3APTA 3LMYA 3GIPA 4ES4A 1CI1A 4W8AA 3IV8A 1QPNA 3CO8A 1TZ7A 4DELA 1EB3A 1B4EA 3N9KA 4NG3A 1Q6DA 2GJPA 3K1DA 1RJQA 2Y5EA 3LTPA 1RK6A 3UYCA 4IP5A 5H6HA 1DTUA 1ZTVA 3LPFA 4ML4A 2ZX5A 3SR7A 2WPGA 2VC5A 4XD5A 4YIWA 3TQ0A 3SRKA 3DG7A 3AIVA 3SSZA 3CGBA 4N9BA 2OEKA 3FOKA 5BZAA 3LK6A 2V3EA 3B03A 4IJCA 3R89A 4QHRA 2VEFA 1Y5XA 2VM8A 2HBXA 3COTA 2XFFA 3GVVA 3C0LA 3RPMA 3KDNA 2XVNA 3OVPA 4HU0A 5A2BA 3POCA 5KZEA 3ABRA 2F84A 2PF0A 3VGHA 3BURA 1WKYA 1M7JA 4HTYA 3VPLA 5BU9A 3W1MA 3VCCA 4KW2A 1OJTA 1I2OA 1VF8A 2ACRA 3THAA 3CYJA 3W1UA 1F9CA 1XIIA 1R2TA 1QOPA 1W56A 1UPMB 1FHLA 4IGSA 4TMCA 1VFSA 4HSOA 1WO2A 1CGTA 4Q4OA 1GVSA 3AUJA 3MMDA 2QPXA 3GDMA 1GVYA 2CXEA 3NWRA 4AC7C 1E3XA 1Q3NA 2R1MA 4IQDA 2QT3A 3T05A 2VURA 4REQB 4Q4KA 2BY3A 4AZ7A 4S3BA 2ZVIA 9XIAA 1XYCA 3RDKA 3L68A 3UNTA 2VR2A 1NM9A 4MWAC 3B0PA 2EQ6A 5C9ZA 2NQJA 5C9UA 2WC4A 2D2GA 1SGJA 2YLLA 1B3ZA 2Z29A 3L5AA 3CH9A 4XAFA 1V0LA 3WN6A 3AJ7A 5XINA 2PF8A 3H26A 3OVGA 4BK9A 3EWZA 2VNCA 4Q8PA 4NF7A 3W1LA 5A8OA 1HKWA 1W1A1 1W9BM 2OLHA 3C0SA 4FA3A 3Q37A 3T55A 4L4LA 3GKFA 3M0LA 4PSRA 3WNOA 1HGYA 2AQWA 5BROA 3GC5A 3B8UA 4OV9A 5HNUA 3KZSA 2PTWA 4L6HA 1E0VA 3A23A 3WQ6A 5CBIA 1GZGA 4NZJA 1TPUA 4U3AA 2YW4A 5HPOA 2ZVRA 3DIPA 4PFHA 4L64A 4X2RA 1UZDA 4JS3A 3S83A 4DXXA 2BOEX 4V1YA 3WLIA 1A4LA 4ATLA 4O50A 2ZWZA 2W5FA 5JCKA 3UBPC 3VKJA 4B5WA 3ZSSA 1E51A 1DXLA 3GD3A 4WDWA 4AG0A 3B04A 4C6KA 5HR7A 3MMTA 5AZ0A 4B16A 4BR1A 1ZU8A 2XH2A 3T07A 2Z1WA 4M24A 1UKQA 3LMZA 1V7AA 4OUIA 1GOOA 3W02A 4WY0A 5EY5A 3EA3A 3WK2A 2FQIA 1FP9A 2GVJA 1NOFA 4PCFA 3A5FA 4IUOA 4R33A 3CAKA 4AY8A 3T09A 2QUTA 1A5BA 1W3KA 3HG3A 2QGHA 4C65A 1FWWA 2RGMA 2EPKX 1QU4A 4JGDA 3NGJA 4DPQA 3RITA 3DAQA 4OGZA 3KS6A 2VOTA 3KBNA 4Q4RA 4LUYA 1J79A 2WM1A 3WEOA 2INFA 3S9YA 3NSXA 1Q13A 2WZHA 5DXXA 1R85A 4ZTXA 1RQBA 3KOWA 1SUXA 4MIMA 4FXFA 1KB3A 3EPNA 4HHLA 5CZKA 4CD4A 2OWXA 4WDUA 2AAMA 3RX2A 7TAAA 4F9JA 2PP3A 2BC0A 2Z6JA 4K38A 4QEHA 2GR3A 2HCVA 5FMHA 3RAOA 4JBRA 1MDLA 2VUNA 4JEJA 4WKAA 2FTPA 2NT1A 2KAUC 4OQVA 1MQQA 1TPDA 5I3JA 4GI4A 4O0ZA 2HTMA 3CZ8A 2XG9A 2VC7A 2YCLB 4LV9A 4K7VA 2QMKA 2Q3OA 1Q1WA 5E0KA 3FDKA 4ZOCA 3O1NA 4TVYA 1TPB1 3MSGA 5DELA 1QFEA 5FEXA 3MV11 4OBRA 5K4ZA 1KRMA 3UWYA 3QGVA 4W84A 1J5TA 2ZX8A 2CHNA 4LUJA 3D47A 1ZS2A 3HQ1A 4AIOA 4H00A 2D1ZA 3DK4A 2DZBA 1HO4A 2VEIA 2XYLA 4XAPA 1ZRQA 3EDDA 3BLPX 4ZQRA 3N3MA 4DO7A 1NFBA 2W0UA 1JYXA 2R1KA 5FL1A 2EPHA 3EA1A 4QSFA 4MB5A 2AKZA 4KGLA 2PDGA 1MVYA 2ASHA 1R3TA 3AWOA 5CAHA 4ZO7A 1UZ4A 3RNMA 2FVKA 2VQTA 4ERAA 4DBSA 3S9ZA 2Q3RA 3H2FA 1XYLA 2WZMA 3ABXA 2BY1A 1QHOA 3IAQA 4U10A 2WMFA 3F03K 3GH5A 4L61A 1MW2A 1JCTA 1CWYA 1Y7VA 2NZLA 3BUVA 3LXAA 4DJDC 2DIKA 8RUCA 1PZ1A 1EQPA 5CPMA 1GXFA 4M19A 3GH4A 2RABA 1SW3A 3M0IA 5KETA 4UNIA 3A5VA 2ZBTA 4UFMA 3RN6A 2OPJA 1JD7A 4D72A 4P7NA 1A50A 2WSKA 3W88A 1ESWA 4YMZA 2WVUA 1ZXIC 2WHKA 3IVSA 4O18A 1FP8A 3R8HA 4DI9A 1JCYA 3RR4A 3VOHA 4XVDA 1IXNA 1N60C 1FUYA 2QJJA 5FI8A 2E3TA 3SN1A 2X8GA 4HPNA 5A8PA 1BFNA 2P0OA 4GE8A 4TIMA 1OGBA 2XIIA 2X0YA 2CCRA 3AFBA 5EU9A 2JIWA 4LRTA 1TUFA 5ENLA 4GO8A 4HNOA 3TN6A 4ZQNA 3RRXA 3B3DA 1VYSX 1EF3A 5C2GA 3MHUA 3VNLA 3WJWA 4UTKA 1JL8A 4I6KA 4XZBA 1K9EA 4GYKA 5FF0A 1EL3A 2A21A 4MHBA 3H12A 5A8QA 1J9YA 4TU1A 3RG6A 4A3QA 3NFUA 3R0UA 1N61C 2W9MA 5DT7A 1EWDA 2D3LA 2X0HA 3UF9A 4D71A 2R94A 3BARA 4GIRA 1XG3A 4NZCA 3ZR4A 2J8GA 1B57A 4FX6M 4APNA 4HN8A 1E73M 1U1JA 3GNNA 1V08A 3VE9A 1DIKA 2BNJA 2DH3A 3W26A 3CQKA 4NNAA 2QAPA 4IPLA 1T5AA 1EBDA 2EPNA 3N2XA 3QMTA 2L5HA 4YTSA 3BH4A 3GDKA 3AYRA 4LUSB 2DJXA 4DB7A 1AL7A 2VFEA 3ICJA 4B5XA 3SQLA 3HPAA 1W1B1 3IJ8A 2WPEA 4GBUA 3WQFA 2PDJA 2OOFA 2XHYA 4XKYA 3WCZA 4CQBA 3OGRA 1AOGA 2OOGA 4PTVA 1F3EA 4NAEA 4C60A 3U0HA 4MWAD 1S2AA 1IZKA 5I77A 1F3WA 4I8YA 2AL1A 3KBWA 3W7IA 1AH0A 3PUOA 1DWIM 2Y24A 1JRCA 1NFGA 1VLIA 3Q4DA 5DMNA 5FAGA 3MWCA 1UWRA 4FB7A 3ETRB 4C1NA 1Q6CA 3IK4A 4BCEA 4FOUA 3W2NA 2QPSA 3H2AA 4JTJA 2JKEA 4KERA 1OIMA 3TNBA 1H49A 4ORMA 3PC0A 2XH4A 4KFNA 1XSJA 3NM1A 3B4YA 4DBUA 3U8GA 2QIWA 4GY7A 3R12A 3U4FA 1UD6A 1LLWA 3AYVA 3CZGA 5FSEC 3F4WA 2FHFA 4JKKA 1P48A 2FHBA 3NRZB 3M64A 4QG8A 3J7HA 3DHPA 1Q45A 1EJSC 4WOZA 3TTSA 2OX1A 2WPCA 1Y5WA 3RIKA 1TB3A 2F6XA 4WY0F 5FIPA 3RPTA 4CCDA 4I5XA 3GDBA 3AXKA 4QDMA 5EMYA 2VFIA 4P2VA 1I1XA 2GJRA 1UA7A 1B30A 5JCMA 5G1MA 4CNUA 4JTGA 4ADSA 3W1TA 4CCZA 1TREA 2OGJA 1LBMA 2GVGA 4TO8A 1W32A 2WOQA 4W5ZA 3THCA 3W7MA 3GHSA 5GJMA 2G4FA 3C56A 2YIHA 5AZ1A 1K6WA 2BBFA 3N9SA 3AHVA 1J93A 4G9PA 3PWAA 3THQA 3KVJA 4J57A 3H8AA 1EC9A 4UTWC 1L6WA 1TZZA 1A47A 3EUB3 1RVKA 3LV6A 1V02E 2QF7A 1UD3A 4HYRA 2XFRA 3ZSTA 1TPWA 1KWGA 1SO6A 3BSMA 4GX8A 5FJRA 2CLFA 5HMFA 4WZHA 3G24A 4N9DA 1CW2A 2CBJA 1B3XA 2TODA 4M6VA 2ZIDA 4ZSUA 1HJVA 2RDWA 1TRDA 1H63A 3DBPA 1PTGA 1B3WA 2EG6A 1UPPA 1D8CA 3ZM8A 4HVXA 3IS4A 1YRRA 3TDFA 4UR7A 5F7UA 1CXKA 3PTKA 1GYMA 4ZQOA 2QUMA 1E3ZA 3IRDA 3O8AA 4FR1A 1AD1A 2TSYA 4C6LA 1H7OA 3O6DA 4LEQA 3CT2A 2J8TA 3GNRA 1PIIA 2I17A 4GH1A 3WH9A 1E0WA 3CMFA 1OYCA 3LPGA 1XD1A 4KWVA 2VZUA 3STPA 4LOCA 3TWBA 3EOLA 1FRBA 1KR0A 3BAKA 4PCSA 3BMVA 5C55A 3GNPA 1RXOB 2RFGA 2R91A 4KWWA 5BXTA 1F6KA 1KGWA 3IVTA 1KFKA 3D0CA 4MOZA 1SZGA 4A8LA 4MPQA 4G6CA 3ISIX 5EYWA 2NSXA 1SVDA 4KT2A 1IQ8A 1OT1A 1VIZA 1YQ2A 4DNHA 2OMAA 1TMLA 1KM1A 1P0EA 1H62A 2QCDA 2V81A 2Q8LA 1C3FA 2O9OA 2CXGA 4LF2A 1MO9A 1ZALA 4E2OA 2J24A 4WXZA 2WQDA 1KA9F 3GRSA 4IIFA 1RJPA 2AQOA 4JHOA 3I7SA 1MEIA 3PBUA 2E0PA 2QDGA 5KMYA 5C7VA 1K7EA 1AVAA 1XWYA 1F8WA 1GVFA 4JYFA 4WUIA 4DJDD 5HBFA 3ATYA 1KCLA 3FA4A 3L2LA 4BJHA 4D6FA 1YNQA 3DFYA 4MZ1A 5E09A 4F40A 5G5IA 1OGGA 2E67A 2HXUA 2W92A 5HUOA 1GPFA 2VYOA 4F2BA 1R2SA 3B0YA 5HK4A 4H8VA 1J6OA 1OX6A 2HROA 4TV5A 5LA2A 5HUPA 3W6LA 5AC4A 1ZGDA 4Z1AA 4IQJA 3P62A 2VC6A 2XIBA 1TJ1A 2YFOA 5EMUA 4N6EA 4P8WA 2P10A 3T42A 1SM9A 2V67A 5GNXA 4ZFMA 1UBPC 1UKOA 4YTRA 3VCRA 4W9TA 1BTCA 1AW5A 1ADDA 4A8IA 3W7EA 1GWJA 3MYPA 4WKFA 3CMJA 4YCPA 2WSYA 1JPDX 4HPJA 2NLIA 1YMYA 3H22A 5BCAA 3PSVA 4K7ZA 1CB2A 2H8ZA 2O56A 1DWAM 3SRDA 1Y0EA 4HNCA 3MZNA 4FMVA 3DFOA 4LS0A 4E3TA 1TUXA 1X1NA 1RR2A 5HPCA 1A5LC 3CGEA 4IM4A 4ATWA 1ZP4A 2Z7KA 1WBHA 7PTDA 5D9PA 1LRTA 2DV0A 3VGFA 3DJJA 1DJYA 2XVKA 3HM7A 4UFJA 3GD6A 5AN7A 5A3HA 1B90A 2HNHA 3DERA 1I2QA 3IAPA 3RLGA 1TWDA 1P6BA 3UERA 2ANUA 4QCEA 4OBSA 3SEPA 3GUGA 3TFCA 1IT0A 4QLLA 2QJMA 2F2KA 2PWDA 1UKPA 3LERA 4GUHA 3M6YA 3K30A 2QJHA 3REQA 5KEZA 2YDRA 2NPXA 1CECA 4FOJA 1DWFM 2D2OA 4W89A 2XZ7A 4JL1A 2OO6A 5TF0A 5L9FA 1SMDA 1P43A 2VI0A 1YNPA 1R8LA 5IBXA 3LM7A 7XIMA 3NQMA 2E9LA 3T78A 2JFEX 2VX5A 2XGIA 4FIRA 2PZ0A 2W61A 3S3GA 3TONA 3ZFHA 3GTHA 1J01A 1YNYA 2BVYA 3HGJA 5HDRA 3QEZA 1VIWA 4QBXA 1CGVA 4PUJA 1XM3A 4YJ5A 5CH9A 1SW0A 1ZLPA 1BZLA 2BGQA 3ARRA 3GAKA 3R1ZA 1EH9A 3NVYB 1Q6GA 3M5YA 4D1JA 4Z17A 5LIWX 5A1AA 4GCAA 4GIEA 1WDRA 1KD0A 3PZQA 1YTKA 1WX0A 3ABSA 3WNNA 5CC6A 4F66A 2G97A 1U30A 2QDDA 2FKPA 3RJYA 1TTJA 1S5TA 1TPH1 2Z1BA 1YXCA 4GO9A 5JQ9A 4XAYA 3ARYA 4ZODA 3R11A 5I3IA 4NU7A 4KIEA 3QR0A 1NDWA 4FX7A 3LTYA 2DFAA 2HVOA 3O0FA 2BY0A 1EUAA 3WJZA 2VFDA 4BI7A 1J0KA 4LRSA 1EP2A 4HPGA 4K7YA 4WY0B 1GYNA 3CUXA 5U4NA 4IISA 5H91A 1UROA 1XIGA 4CD5A 4HU8A 1LWJA 4UC5A 4XK2A 5A6BA 5HWNA 3R25A 3EWWA 3L5OA 3B40A 1O60A 3W74A 2ZZ5A 3C3UA 1XRTA 5TAOA 3SUSA 1YDOA 1NQ6A 3PNUA 1GQIA 3NOEA 3TNOA 2ZA2A 4YWIA 1XLHA 1P1MA 3W6YA 2FJKA 2W67A 2VDGA 1LUCA 3UWZA 3LB0A 3U5UA 1FKWA 1RD5A 1GEHA 3W71A 4J3UA 4QIUA 2QXWA 1CZ1A 4IOTA 1E1EA 1X6NA 1XIMA 3ZO9A 5FS6A 1KTBA 2P50A 1MW3A 4EOUA 4H6QA 4S3GA 4O19A 2R82A 3OYZA 1PX8A 5DANA 3W1AA 3ZVIA 4UTUA 5CPQA 1R3SA 4MY1A 4TTGA 3G1VA 4AEEA 1HQTA 4LGXA 2XSAA 4CNOA 4IFKA 1H6VA 1RUSA 3V0SA 4NX5A 1N2VA 1ECQA 3ZS4A 2PSNA 3PG8A 1NAL1 3QOMA 3EMZA 3GXIA 2YR1A 4LB4A 1TCMA 1UB3A 3ITOA 3VX1A 5T91A 1NWUA 3OTRA 4UTTA 1WCGA 4CD6A 1I0DA 1PAMA 3W25A 2CYGA 4F8XA 5IFTA 1DE6A 3T0BA 4XAZA 2PUZA 1WYGA 4YL2A 4QQ3A 2TPRA 3NQEA 2ZZ1A 4GNJA 2CHRA 1C9DA 2CC0A 3HW2A 3II4A 2WJEA 3O63A 5DRIA 1TYPA 5E93A 4IPJA 3B0VC 2YBVA 4DI8A 5KTLA 1IEIA 3RILA 2CKRA 4AAJA 4S2BA 3L8KA 4U33A 2CLLA 2VCAA 5I07A 4GXWA 1EDGA 4PBGA 2PLJA 2ON3A 4O53A 3GWQA 4G7FA 1OGSA 4TTUA 3ITYA 4CVWA 1YTDA 2BFGA 4HHPA 1F76A 2I56A 2EG7A 4F0HA 4EMWA 2JF7A 4W8BA 4OVXA 4LX4A 3U9IA 1EX5A 4NRRA 4RE4A 1RBOB 1CGWA 1VYRA 3GH7A 2O4QA 1O7AA 4KPRA 4EWND 1JDAA 2GDUA 3QZAA 5CZTA 2PLKA 4B15A 1UJQA 1NDVA 3OQ8A 4KCVA 4HYWA 3GU9A 4RV8A 1H7PA 1X38A 3CTTA 1S3HA 2PWEA 1CXEA 4J56A 1MUWA 1W1IE 1XPYA 3BAYA 3H4XA 3PJXA 3A24A 3O15A 1DEDA 2QPUA 4AVNA 3GTNA 3HU7A 3CV1A 3PBYA 4JIHA 2Z25A 4NXKA 4GQRA 4HBKA 1W5OA 3QHOA 1ZY8A 3JZUA 2VC9A 1K9TA 4KGJA 2WYSA 1JNDA 4MZYA 1HGWA 2NQHA 3NZ1A 3VDBA 4H83A 3RU8X 1CYGA 3BO9A 1TYGA 4PA8A 4XG1A 4AD2A 4JD4A 1XC6A 3EMCA 4V27A 3IK2A 3PUEA 1V51A 2FZBA 4IPIA 4JN7A 1OD8A 3DYOA 3BPWA 2FZMA 3P60A 5CGQA 5TD4A 3UG5A 1Z44A 4TR9A 4HYVA 1J11A 4XV0A 5FKYA 1RAKA 2PEVA 3WBXA 1S5VA 3S2MA 3C2YA 1SZEA 5TQLA 3RMJA 2D3NA 5F4WA 3TN5A 5D32A 5JCNA 1AJZA 1KFBA 5C9RA 3WLNA 4NZFA 1W5MA 1VGAA 2Y89A 2QGYA 3QMSA 3S1UA 4ORIA 4KRZA 3KL3A 3NPVA 4ZEPA 1O95A 3L4UA 4XKYB 5F4XA 4NAEB 2E6FA 3WIJA 2B7QA 1TMQA 3DFTA 4ROQA 4FIQA 3WL0A 4MDPA 3GZ3A 2GWGA 2Z4GA 3M0VA 4N9EA 4LUTB 1LT7A 4IGMA 3GE7A 3CPRA 1ZCOA 1W6TA 2HJPA 2YBUA 5KINA 1IT7A 4NZ4A 1IWBA 5BMWA 3UXAA 2WB5A 3PF3A 3W27A 5MKGA 4ZO8A 3LLDA 5TNVA 2CWXA 1FX6A 1J0IA 1W1ZA 4ERIA 3FXYA 2H3BA 3HBLA 2O9PA 4MF4A 3HFYA 2GVEA 3U5YA 6ENLA 3R07C 1TE1A 3A7UA 3FNDA 5I3GA 1WAWA 1AW2A 5EBKA 1BWCA 1UQZA 2YZRA 1NOWA 3P5ZA 1HO1A 4D6DA 3FV9A 2RHGA 2P8CA 2XVPA 2ALRA 1ZBVA 1RV8A 3URAA 2QCNA 4GC3A 2VR4A 2ZUUA 2OELA 4DBWA 3O0HA 5BXPA 3CUJA 3W73A 1UR4A 4IFRA 4K8EA 1OFBA 5I3DA 4JTLA 1L2UA 1ZJIA 1PIFA 2XH7A 3O3RA 1EO5A 3WH8A 3UXIA 4LWWA 4LVDA 1MYRA 2HPIA 5EBUA 3RR1A 4C6MA 5D2TA 4JTHA 4S1FA 3P93A 1X98A 4RUBA 4ADWA 2BHUA 4EVZA 1PDYA 4HA1A 3F2BA 2BZNA 4GA8A 1R87A 3SJNA 2Y88A 3DC0A 3P67A 1YPXA 3M44A 3WJXA 3AMLA 1JOAA 4NYYA 4CNNA 3TW6A 4UQ9A 3HV9A 4GUGA 1XD0A 3CIWA 3GRIA 2F38A 5AYBA 2DW7A 2PE4A 2QUVA 3MPGA 3UJFA 4DPPA 2GR2A 3AIBA 1DJNA 1B5TA 1V3JA 3BLEA 1UMLA 2B7PA 4FLOA 3VOIA 4MDOA 1JRPA 3WSUA 4JAWA 3VOJA 2OEMA 1WE5A 3VC6A 4AZ5A 1O66A 1TTIA 1LG2A 3MJMA 4CVUA 3W07A 2WSRA 3UR5A 4JCMA 4A6GA 1EFZA 4Q7NA 1DE5A 4V2XA 1RY0A 4Q8UA 3PANA 1IT8A 4GNKB 4GIYA 5K9DA 4FR6A 2VENA 3NZQA 2D69A 1F7BA 1WAUA 1FFRA 4HJFA 1S3TC 1XGZA 4DNAA 3N4EA 3GO2A 1OZQA 4Q3MA 2CLOA 1XW8A 1DXFA 4KPLA 3FVDA 1WPCA 3ITVA 5A95A 1S1RA 4XBKA 3KDOA 3VGBA 1C29A 3QQ1A 4YHEA 4BI6A 5A2AA 3FW6A 5H8UA 2VQUA 4JTEA 1XDLA 5I2UA 2WP6A 3QFEA 3UPBA 3ZZ1A 3SQSA 3HPFA 4W7VA 4B91A 3QQWA 3GHTA 3CGCA 2E4TA 2QCDB 1PL9A 6CGTA 5LSMA 1W91A 2V3FA 4B4HA 1BG4A 4CU6A 1UD2A 3E2QA 3KBJA 3LY0A 3VKKA 3GTIA 4LS2A 4NJKA 3T2OA 1OM0A 4XZMX 2BOFX 4TXEA 2HVNA 4LSBA 4BWLA 1YIXA 1H3GA 3EDEA 2PBGA 2YAUA 4R9OA 2NV1A 1GKPA 1TPC1 1NHQA 3CZLA 3HQPA 4LF1A 2P5NA 3OPSA 3KBSA 2O55A 3E0WA 3L4XA 2BCPA 1ZFJA 2J25A 5CCZA 4GUFA 1V6XA 2QJNA 4JKLA 2G0WA 5M03A 4FNSA 1MNZA 3FEMA 1RY8A 1VBJA 3MYOA 4JTRA 1M7PA 4NHVA 1XRSA 1RPKA 2PDKA 3EKGA 1QTWA 3PR2A 2YXOA 1LQ2A 3AMDA 1XI3A 4NYUA 3RLUA 4JNYA 1H1YA 3IJQA 4K1WA 3UG3A 4PZVA 3WDIA 3HGOA 1OWQA 2V2DA 2XU2A 5T26A 3G0UA 3W4RA 2C71A 2DZXA 4JFVA 2ZE0A 5F4SA 5MHBA 5HATA 4DZAA 1W8SA 5C71A 4N4QA 3EYPA 5FA5A 2JEQA 5B80A 4GJIA 3AMZA 2I5IA 4YN5A 3CLMA 4DUOA 2PCQA 4HK6A 2OX4A 2A4AA 5F1UA 4ZBCA 3EKZA 3WELA 3RJXA 1I9CB 5U25A 4XISA 3IJLA 3T44A 4N6FA 3AU6A 3K2GA 1V77A 2ATMA 3GVGA 1J0YA 1NU5A 2P3ZA 4G1KA 4E8DA 5D2WA 4Q8MA 1C8YA 2RGLA 4OHQA 5DMMA 3BLDA 3G1AA 4M7TA 3WFZA 5JH1A 2EQ9A 2OXNA 3N25A 4JIIX 2WHLA 1XYMA 3MV01 4FX9A 2Z1KA 3C86A 3QY6A 3FJNA 4MFEA 1J10A 2CLMA 2NV2A 2PDHA 2Q02A 1TPEA 1UH3A 1E6ZA 4O1AA 2I9EA 3MP5A 4DYJA 3OLEA 3REQB 2EKGA 2PDNA 4HKPA 3GG0A 4D6EA 2ZRUA 4EQWA 4H8NA 4LNCA 1ZKQA 3L2MA 4YS1A 2EQ7A 3GDTA 3OLGA 2E6AA 3PWIA 1A0CA 5JH2A 1FWDC 2B0MA 4D6HA 1JQVA 2NWSA 3EEGA 3AMKA 1BWLA 3W1XA 3H70A 5D05A 2GPTA 4J3ZA 3MB9A 4HU4A 2P53A 2Q6ZA 4O17A 1GEQA 1W9DM 3VK5A 4E6MA 5EB8A 3S6TA 3PUGA 2GJXA 2G5WA 3CAWA 5LNWA 4W85A 2V69A 3A3WA 3OZMA 2DZWA 3CL8A 4I3GA 4R3UA 2YB4A 3CL7A 3WD0A 2CFFA 2HK1A 4AWSA 4X22A 3RMEA 4LANA 2ZUMA 1EEXA 3VD4A 2WXDM 3OG3A 1EC7A 4PULA 2F2HA 4CQAA 3ARUA 1TG7A 1M04A 1GHSA 1ZPTA 2BP1A 5I24A 1Z42A 3H2NA 1GVEA 4ATDA 2PDWA 2VD9A 4US5D 3F7JA 4WK9A 4O15A 3UXDA 1UWSA 3KM8A 2FTYA 4RE0A 3W2LA 1CB7B 3VTRA 3IACA 3DFQA 2IQ0A 4O8RA 2ZUVA 3T08A 3EANA 4DF1A 4V33A 3MY9A 4DO6A 5AC5A 1OCQA 1EOKA 3KCLA 2A7RA 4LC8A 3TKFA 4PUDA 4LYQA 4YWSA 1DJWA 5GPRA 2MUCA 5FAJA 4IJRA 5EMJA 3NM3A 3I10A 1TJRA 1I60A 1QAPA 2WNQA 3NQGA 2CLIA 1M53A 2D20A 4W87A 2OKTA 4UQEA 3PAJA 1CLKA 3BAXA 4KETA 4V15A 2DT2A 3H4GA 1G4PA 2VRJA 1XIFA 3CK5A 1I4NA 3HG2A 4LA1A 1LUCB 4KIRA 1W8GA 4UB9A 2GQ3A 1YXDA 5HMDA 4XTIA 3ZQ9A 2CLKA 4S23A 4UZUA 4M3PA 4O13A 3SADA 4AX7A 4NUWA 4QITA 3BGAA 4NX0A 3MC5A 4PH6A 1WOAA 4DO4A 3OODA 1FDYA 4KEMA 1OK6A 4F0KA 2EEXA 3HPXA 5I0DA 4IQEA 3M0KA 4RE2A 3W2MA 4IFKB 5FACA 5AY7A 2XN2A 3W1RA 5AYYA 3WK0A 1IZCA 1MNSA 1PV8A 4AVOA 1TX2A 2WVTA 4XZIA 3FHAA 3KVLA 3N15A 3UXLA 3BGJA 1SFTA 4QLJA 1TV7A 5CSYA 4LH8A 1JNEA 1TMHA 2VUYA 4AWTA 3HTWA 4OIFA 1FDZA 1XBVA 1PE1A 2PWVA 5D8WA 4E4FA 2INEA 2VFFA 1QPQA 4NT0A 4LY8A 4Y8EA 1IEQA 4Q8TA 1FHUA 5IRPA 3QMRA 2VEGA 1FY6A 1YPIA 3WQOA 3DHDA 2YVGA 3ITLA 4EQSA 1F05A 2HWGA 4H8UA 3K13A 2YXXA 1P5BA 3GY1A 1UHVA 2TMDA 4M5PA 3PY2A 3UEQA 2E5CA 1QO5A 3NYDA 1JXJA 1XLFA 2YL6A 3QRHA 1N8WA 4KH2A 3UESA 5TIMA 2NVKX 2Z24A 3UZ5A 3AHYA 4GIAA 3DN5A 4MWAA 3P5YA 4I5RA 1NARA 4RJEA 1UUOA 4G2DA 3G0SA 2WOIA 4OU1A 3TSBA 1R9ZA 2VX6A 3TQKA 1ITXA 1TJ2A 1ODZA 2C0HA 1S2UA 2J7DA 1OYAA 5JCIA 4HZMA 1F4HA 1XR2A 3FKRA 4EACA 4BEQA 3CWHA 5KSWA 5JBDA 2D0HA 2HSAA 3ZMRA 3WO8A 6TAAA 1BF6A 2ZUNA 5J5DA 4HMNA 1UR0A 1FHDA 3K4DA 3VZXA 2X2GA 1M41A 2CBVA 4GQGA 4L1WA 5DT5A 1PJ9A 1GETA 1THFD 3P0WA 2XFWA 3PM6A 2ISFA 2YA2A 4RXFA 2WPFA 3BSGA 4QP0A 2INZA 4HOWA 4HQVA 4IPPA 3AS1A 1GRBA 1LM1A 3DYPA 3VIPA 3MI2A 3UPMA 3ZR6A 2PU1A 1R3YA 3NVWB 3LEPA 4LBUA 3QV9A 4IXHA 1VRDA 5FF3A 3AALA 3PZNA 3SY8A 5D03A 1GKRA 5REQB 2ZZ4A 4D9PA 2ZRZA 4ZENA 1QW8A 3UVAA 2BGNE 3FVMA 3W2JA 4LNYA 4E0CA 1DVJA 4H9VA 8XIAA 4IGHA 4B4FA 3AXIA 3N11A 3E38A 4CEXC 3CB8A 2PLMA 3E0LA 3UNDA 6XIMA 1JROA 4GBDA 3LZ5A 3RCMA 3OC4A 5IHSA 5EL1A 5A8MA 4WGHA 1BYBA 1QNQA 1RK5A 2GVYA 4MJ4A 3KOFA 1E6SM 3VD9A 5I06A 3SQMA 1S2TA 4HNVA 3AM9A 3T40A 4EAMA 3ELFA 4DM1A 3ONBA 3OW1A 1JQXA 1MQRA 4D6IA 3GC4A 3V1HA 3HMJG 3AZTA 2ZRWA 3I6TA 2BHYA 1M01A 1P6CA 3QXBA 1QK0A 1TIWA 2WLZA 2W27A 3B9EA 4QR6A 1JUEA 4PUNA 4ACYA 3OU8A 4JDYA 5JU6A 5A6LA 2ADAA 2WCAA 2ISDA 2OVLA 3DOPA 1W9XA 4IIHA 5MKGB 3RHGA 5GNYA 2CBIA 1G69A 3B9AA 1VFTA 1P7TA 1XYAA 3E9AA 1QOQA 2P88A 4CD7A 4X9YA 1ITQA 1EJTC 3WF2A 4X3ZA 4D1IA 4TVUA 4WDXA 1I8JA 4MMWA 3LCIA 2R14A 3QBUA 1ITCA 4XTDA 4BZYA 2HS6A 1MW1A 3ONCA 3V7PA 3BAIA 4TX6A 2JGYA 2ZCGA 5HMSA 4FAMA 4LTSA 3O6AA 3M0HA 1XCXA 4FNRA 2BS9A 1VC4A 2ZQ0A 1OZMA 4F79A 3GVQA 4JTTA 5BW6A 3T81A 3CASA 2X30A 2Q09A 2C79A 1GK8A 3O05A 1OG6A 4X2PA 2VJXA 3KVKA 3C52A 2DSVA 1KM2A 3QYQA 5I03A 3W7CA 3W37A 4A4AA 4LB3A 3ZT5A 1PYMA 4HPXA 2J13A 3P2VA 1EBGA 1Y65A 4HMCA 2QJGA 4ZSTA 4FPSA 4L1XA 1IR1A 3RLHA 3OGSA 4DLFA 5DY2A 3DGZA 3UT0A 3N4FA 4L4PA 2V5JA 4AHOA 4DJDA 3NTYA 4NXSA 5EMLA 5DO8A 2WJZA 4C5YA 3IIZA 4JQAA 5A6JA 4XKMA 5CBBA 4R88A 1VEOA 3VFLA 1WKFA 1XRVA 1X2HA 1GQNA 1JPHA 4HZ6A 1S46A 2WJDA 4AXKA 1NSJA 3WF4A 4GCXA 1XISA 2DZUA 2GQAA 1CXFA 1XBZA 1V3KA 1C93A 4M1RA 4EPDC 3LYEA 2BHZA 3B0XA 1XH1A 3DGRA 2WWDA 1Q85A 2PGFA 4E38A 3GBDA 4GXMA 5CPOA 1R47A 4HCHA 4DYKA 2BODX 1H2JA 3MBDA 4FS9A 2YGYA 2XIOA 3VOFA 1QNVA 3V0TA 2ISVA 3BAWA 1AUSL 2NVCA 2WWCA 3BJTA 2IXUA 4H8HA 4Q32A 3TR2A 2A85A 3RLVA 2XTKA 3ARWA 5DCDA 1HJUA 2MANA 1F74A 4UMCA 3APGA 2YSWA 1HL8A 3ME3A 3AIQA 4JY9A 4WKHA 3WEZA 1FQ0A 1S2VA 3PZVA 4O11A 5K9CA 2GLKA 4RX0A 3CQJA 3QPYA 5JMUA 2JKAA 1KRBC 5HANA 2E9BA 3G1YA 1EPVA 5HOSA 4RXGA 2WJFA 3W3OA 1W3HA 2WCGA 3MKVA 2FB2A 1AH4A 4IF2A 1AK5A 4DIAA 3HPZA 3MMWA 1JG9A 1VP5A 3EAUA 3NQCA 4JDBA 5A2CA 3OIHA 4PCPA 2C3DA 4GZIA 2GJLA 3OHMB 2CEQA 3TMLA 4JEQA 2GUBA 1W1VA 5M1TA 4UOQA 2B81A 1LOQA 4RNJA 3VIHA 1H5YA 5I5RA 3G1DA 1JR1A 3VABA 3QJAA 1SMAA 3KHDA 1MXGA 3R0DA 3OBEA 4WSJA 4K8DA 2F6KA 1VJSA 1B1YA 5LYRA 4MY9A 1LYXA 4GZEA 3CHVA 1WDSA 2XIJA 2G37A 3FY1A 2OZ3A 4GVHA 3P82A 3V5FA 4DBEA 2BY2A 1VYPX 2F61A 3NVVB 1VQTA 3UZYA 3VD7A 2HVMA 2PS2A 1OBAA 4KFPA 6PTDA 1L8PA 1XIBA 3NDOA 2O7QA 4QJ1A 1R7AA 4RW5A 3HPSA 4NJHA 4FNUA 2WM0A 2Y62A 1E6NA 4PCTA 1T99A 4C6BA 5BRBA 4LY4A 2FGLA 1R9YA 4O10A 4W93A 2ICSA 3NS1B 2NXIA 3QFAA 3FSUA 4ASTA 4DRSA 5I7GA 4E3VA 1QWKA 3UWEA 4PTDA 1LBFA 2DSZA 2YB1A 3V5OA 4MVAA 1REQA 3AJXA 1SJCA 2DT3A 3UR8A 2X1RA 5JIPA 3R79A 1BVZA 2C8NA 4FEZA 5I79A 2Y6ZA 3N73A 3D3FA 1X39A 3SGGA 1GQJA 3MP3A 4JPGA 3IV3A 3BW4A 4UR8A 3SCTA 1EKOA 3NVTA 2FDSA 5G1TA 1UC4A 2FYMA 2QHAA 1F4AA 2A3AA 1NF0A 1AA1B 3WQ8A 1UP0A 3CZJA 5DQPA 4C5ZA 2FH8A 1BRLA 4Y8FA 1EYWA 3ZJ6A 1PKNA 1U5HA 3UWUA 3ZOAA 2VELA 3FYOA 3S5SA 3PAOA 3SCWA 1AZ2A 4E2VA 4HOXA 4Y9AA 1BKHA 1UH2A 3EB4A 1H1NA 4GR1A 4BWLC 1POKA 2YOCA 1B31A 2DVUA 4PUUA 5GQBA 3UJ2A 4XQ6A 4NZ3A 5CGTA 2HRWA 3V3WA 1L6SA 2IKIA 2X8CA 4M82A 3T4CA 4N4PA 2GRTA 1POJA 1UZHA 3PB2A 3VI2A 2E7FA 5IFPA 4IG2A 4IQLA 1XV8A 1CENA 2GJXB 1L6GA 3T2PA 4OZOA 3T0TA 3FDGA 3U48A 3KVMA 3W38A 3MP4A 5FEWA 1FA2A 2FPVA 3BLFA 2A3BA 3IIXA 3QN3A 4QJ4B 2CIPA 1W3LA 4GACA 2G3FA 3MSRA 2GYIA 2VGGA 4QTGA 1EIBA 1A49A 3RX3A 2NXHA 3Q65A 4HTBA 1W3NA 1G5AA 3CGTA 3N4AA 1TZ9A 4LT9A 1X8CA 1UP3A 4OWGA 1TE6A 3RO8A 4Q6JA 2IQTA 3ZIZA 3MUY1 1VFUA 2E40A 1OABA 3WDHA 3M9YA 3A4XA 3C2FA 4RPPA 3WNPA 1W5PA 1MZRA 1CXHA 5D4YA 3BMWA 3KOZA 4GH3A 4MNMA 2A6LA 3QPEA 1MUCA 4OBTA 3AUOA 1WZKA 1GJUA 3S5NA 3QSRA 4MYAA 4K39A 3FEQA 4IXXA 3E02A 4AZCA 3KW3A 1RBLA 1XLCA 3T0CA 2J9XA 4JZ5A 3WEMA 2V82A 4IMEA 2VXNA 2ZC8A 1EP3A 2X1UA 3S2LA 4JHZA 3TW9A 1UBSA 3UQNA 2C3CA 1WDWA 4BF9A 4FNPA 1VBHA 3BCJA 3ERPA 3PP7A 1M03A 3M41A 3OOQA 3U2CA 5GRTA 3AZSA 5BRPA 3BTNA 4FXJA 1A5KC 3W7HA 1PSCA 3SR6B 4K3ZA 4BY3A 1OCJA 5H8MA 5J04A 3EDKA 2WZIA 3GZAA 1E15A 3DI1A 1GONA 1OB0A 3TE9A 2EJAA 2C1HA 4ALDA 1I45A 4ICNA 3VOGA 4C7FA 1T41A 3QSTA 4H9UA 3UA3A 3PBGA 5HXMA 3N29A 1K6AA 1IXOA 5KZ6A 3GKAA 3JW7A 1L8NA 5CG7A 3R2GA 4JCLA 4N42A 4EIVA 2J8FA 3GW0A 1PBGA 3VM7A 4LV4A 3B4UA 1ME7A 2Y8KA 2OZTA 5DY3A 3KAOA 4OE7A 2E8YA 1GQKA 4AIEA 2CBUA 3GDRA 5EMMA 3OYXA 1ZBKA 4PMOA 3KLKA 1E43A 3L4YA 1OX4A 1A5NC 1SJBA 4L6OA 1UCWA 3UD6A 1YEYA 3UETA 1XL9A 4JY8A 5ABHA 4YWOA 1V59A 1M7OA 3LBMA 3OA3A 4XUGA 2OO0A 5AHEA 1JGIA 3W9ZA 4LALA 1D7YA 2JALA 4HMEA 2C0AA 2GZXA 1OSEA 4DJFC 3TVAA 4QS5A 3LBCA 1E6QM 1WYIA 4JNZA 5D9MA 1ZZMA 1V79A 1ZSXA 4OOZA 5C9WA 4JX6A 1I2RA 1LRNA 4Q4QA 1V6UA 3ARPA 4IL2A 1WXYA 2Y5JA 1VFHA 2QUNA 5M3WA 2OZ8A 1L2QA 2JBMA 2OSYA 2W54A 4PR4A 2NX9A 1A53A 1E56A 1ISYA 2E5DA 5DX7A 4FZIA 3QR3A 1QT1A 4H4TA 4NI3A 3HG4A 3CS2A 3A9BA 2WMHA 4J1OA 3C5QA 1JCJA 4DYEA 2HMCA 4CNSA 4A29A 4ACZA 3RM4A 3W7OA 4WJEA 3N14A 2ZKMX 3LD5A 4ICMA 2GQWA 3RCYA 4MWAB 2OYKA 2B7OA 4JR5A 1FFUC 1GOKA 2J78A 4M56A 4FI4A 4R5EA 3TA9A 2Q71A 1EDTA 4LVAA 1HG3A 4HIBA 4MSSA 3UZZA 5CJNA 2A5HA 4PUWA 1PWMA 3T4WA 5ABFA 4QE5A 3V5CA 2WKLA 3EWBX 1DJZA 4E8GA 2ZXBA 4NNCA 3R0KA 2A3EA 3GG1A 4ZQPA 1BSIA 1XQLA 2QMJA 2XINA 3GIQA 3MI3A 1UIPA 2HEJA 2V38A 3RXZA 1BHGA 3D6NA 5KVIA 3WYZA 1W3JA 2Z2AA 3S6OA 3MWAA 2PI6A 3NVZB 4AH7A 5JIWA 1BXBA 1P0KA 3W83A 4UIOA 4NEVA 3TYCA 3CXBA 1VRXA 1ICSA 3TAKA 3GTXA 4KFOA 2FIQA 2XGZA 1QI5A 3WH5A 3NO3A 3GIYA 1EYEA 4EPKA 1EGVA 3QGAC 3VMPA 3S4TA 1R46A 2DSKA 3N2TA 3BDKA 5C2CA 1CDGA 1H11A 1HKIA 1N5WC 5C9XA 1JPIA 3ITGA 4DAFA 1EJUC 3EB2A 1E4LA 5H2ZA 3C8NA 3UWQA 3W7QA 1X97A 2MNRA 1JYVA 1V3IA 2X40A 1OFAA 1WNOA 1SO4A 2VEPA 4GQ0A 1R3VA 4X63A 3UWWA 2NQ5A 1WB0A 4Z1DA 4PMYA 1BWVA 3ARSA 1NTHA 3MU7A 1EWEA 1CT5A 1PZ3A 1JFHA 3MCNA 3N17A 2H9AA 2P76A 3NDYA 3PWGA 3RM9A 3LI1A 5BNKA 2OLAA 1XKYA 3LHWA 3UR7A 1PZ2A 2ZWYA 1HVQA 3LI0A 1FBAA 2GDVA 4I7UA 4IMCA 3W7KA 3T8LA 3FAXA 1JJKA 4F0MA 3S2JA 3D3AA 2QCFA 1WXZA 1TV3A 2UBPC 3R43A 1CGXA 3BLIA 1QW9A 2ZZ6A 1KCZA 4FNTA 2BMBA 1NWSA 1DBTA 4J4KA 1XHGA 1ZDLA 1EHNA 7ODCA 5D38A 5EFFA 4S3DA 3MDUA 3WDJA 2YL5A 3KTCA 1LORA 4PB4A 3W00A 1A5OC 4H9XA 4HMDA 2RUSA 1GHRA 1KM5A 3LPPA 1XLLA 2W0HA 1K70A 1AD4A 4PRWA 3UW6A 1C8QA 1P7TB 4IPNB 1OY0A 2JK6A 2C3ZA 4MWAE 2W4XA 1CXIA 4B3KA 4EMJA 1TVLA 2TAAA 3H2EA 3K8KA 3DXIA 4QDWA 4D8ZA 3BSHA 5I78A 4CD8A 4RNIA 3AWNA 4Q8QA 4ICCX 5BRQA 4A2RA 1VB9A 3EDFA 1GVOA 1OC7A 1NOUA 3I65A 3QY7A 4F9DA 3U2OA 3B8IA 4JOMA 4U5KA 2ONEA 3ZJ8A 2J6XA 1J2BA 1RALA 2WBGA 1WQ5A 5ECUA 1SO5A 2JQXA 4H4XA 5HNNA 1K1DA 1VS1A 2ZRXA 3NXFA 2PTZA 1CNVA 3C6CA 3CBWA 4HK7A 5T9CE 1I0BA 1V03A 3HRDC 2ALDA 3WK3A 3VGGA 1F8IA 1H5VA 3AU2A 2G4JA 1GNXA 4HNLA 2XN0A 3IWPA 4UXDA 3ZR5A 3HURA 4QQUA 1SSDA 4RKAA 4M6QA 2FVMA 1QXLA 2A6NA 5I6SA 1R3RA 2R6OA 3GR4A 1G9HA 2Y7GA 1OADA 2EGZA 4DVOA 4Q22A 4Z2KA 3I7RA 1NP2A 3E2VA 3GQYA 1DJXA 3BG3A 1JPKA 2YFNA 1RLDA 3LCHA 3GXDA 1XLJA 3ARXA 1OFEA 3SCSA 4B5NA 1PWLA 1LWHA 1ONFA 2DDXA 2WNWA 5TR3A 5LKYA 1PVNA 1ISZA 3PFRA 3WH7A 4YVPA 3SIMA 4D6GA 1Q6RA 5CPTA 3VA8A 2E5AA 5EBAA 1RVGA 4BFAA 4G56A 1XPGA 2G41A 3ZT7A 3DHUA 2XUCA 2V30A 1E40A 3H7RA 3TAOA 2V3BA 5GJNA 5EGRA 3TYZA 4F2TA 4H6KA 2OCZA 4CNPA 2GWNA 1DJGA 3M0XA 1BVWA 1JVNA 2YA0A 5CG0A 1J0ZA 3C2EA 3NURA 2B4GA 1HP4A 2O4MA 4FSAA 2ZX9A 4YNGA 3VILA 4K2SA 4A3YA 2ZYFA 4FALA 1QOXA 1Q6LA 1ZJAA 3O0KA 4A8RA 4NEWA 3U2ZA 4DJFD 1GSNA 1GCYA 3NYZA 4Z1CA 3BL3A 3GNDA 1YE6A 4JDRA 4J5NA 4LYKA 1J4EA 3UZWA 1JYWA 3N2BA 2RJGA 5CC7A 1R5YA 4G8TA 2EO7A 4O14A 1B54A 1EX1A 2KZHA 3NSMA 4P8XA 1GG1A 4GGBA 4WEVX 3POHA 1W5NA 2OT1A 5D02A 1HF6A 1V0KA 1W0MA 3TJ4A 5C54A 3DK9A 1S5NA 2R1PA 3E2SA 1PZ0A 5LNRA 2XFYA 2GOKA 3GK0A 3RCNA 1DJHA 3GVRA 3USZA 2A3LA 2XWDA 2HZGA 5C0QA 3RYSA 1JCXA 3KLJA 1MI3A 3TXVA 3LXDA 4LAUA 3TXZA 1P0NA 5K4XA 3S1GA 3CEUA 1QO2A 3KEHA 2GH5A 1RCOB 3GYCA 5AHNA 3VUSA 3WLLA 3S47A 4U28A 1HKKA 1BQGA 3BJSA 3W1QA 2F7FA 2QW5A 3T0AA 2OFJA 3TLQA 1YTEA 1LROA 4D8AA 4QEEA 3EWYA 5A6AA 3G8EA 1KR1A 5E6ZA 4MJZA 4H7CA 1EA0A 5G5GB 2FZNA 2PFHA 1H7NA 1AQ0A 3EKLA 1UC5A 1Q5MA 4KF1A 2PWUA 3EWCA 2NVAA 5LGXA 3L4WA 2DQXA 5KITA 2ZUSA 5FSDC 1UG6A 2ZA3A 2PDXA 2NT0A 3CAVA 5A6TC 1REQB 5M2FX 4S3FA 1F73A 3TWAA 4US5A 2OSWA 3WLTA 5CEWA 2GK1A 3E0IA 2J77A 1FKXA 1TYTA 1MWOA 4UFHA 5DBTA 4GFIA 4Y96A 3OVQA 5IXEA 3HMCA 1HJXA 3DG3A 3LSBA 2X05A 4Q7IA 1H0GA 3CHEA 4BKNA 4WD0A 2FGBA 4QFUA 3DESA 5BYWA 3GAYA 1V7YA 2HXTA 4J27A 1SW7A 3SCQA 3B0UX 3CC1A 2ZA1A 3PZ9A 5A6KA 2YVFA 1BRLB 2BGSA 3S6DA 1VR6A 4XD3A 4QX4A 3TOPA 4AWUA 1BYCA 1N63C 4D6JA 1ISWA 3NSNA 4R9XA 1PEZA 4JFSA 4MTVA 4IX0A 4GUJA 4RNFA 3JR2A 2YCEA 1XBXA 2J7BA 1E6RA 4QNEA 3F1QA 3L21A 3VUPA 1Q6FA 4HZ8A 1ZAHA 2GSHA 4A22A 4R34A 3MZ2A 3W84A 4AXNA 2DSUA 1S39A 2AAAA 3GTFA 2C6QA 3LNPA 3DFSA 4IG2B 4CCEA 1LVLA 1K4QA 2YA1A 4O0QA 1JDFA 1QBBA 3AO0A 2WQPA 1OFPA 3ES7A 5LNUA 1LBLA 3CUFA 1FWRA 1RP9A 5BWFA 3WMSA 5LIXX 1E70M 1C8VA 1ZCCA 3E74A 1IZJA 3CUGA 3W76A 2IPWA 3VKCA 3PSWA 3TCEA 3NQAA 4Y90A 2P1FA 3FJLA 4C6QA 2VZSA 4JL2A 3DECA 2DU2A 5H1WA 3KHJA 2HDJA 4K8GA 2CLPA 1UD5A 3UJSA 5U7SA 3CQ0A 4RZ5A 4IX2A 4DF2A 2V0TA 4QS6A 2XM2A 1XCWA 3DZ1A 1D9EA 1UH4A 1ONXA 1B0IA 4JTDA 5DMYA 2Y1HA 1EZ2A 3H7UA 2BSLA 2Y85A 4K68A 4AZCB 1XX1A 1FCQA 2BDQA 3VX0A 5BOFA 3PG9A 1Z3NA 3B8TA 2PD5A 1MXSA 3Q67A 1TVPA 3TUUA 4EK7A 4UCFA 3IRSA 3CNYA 3F5JA 6A3HA 2VX7A 2IKHA 3WNLA 3NZPA 4HP5A 3RUBL 3SECA 4S39A 4H4PA 1K9FA 4DNMA 3UCCA 4XAGA 2ATSA 4X60A 3MBFA 3PPHA 4MJMA 5E1QA 3KZPA 4B9YA 1KW1A 1G1YA 2Z26A 2BWGA 1X96A 1H7RA 1DYSA 3A4WA 3W7RA 3A4JA 4JIPA 3STCA 4UTMA 4Z2HA 2PC4A 3QHNA 3SCPA 5CQ1A 3R10A 1O68A 3IGXA 3PNZA 4XO7A 4QGCA 3FIGA 1P0BA 1JZ3A 2VO5A 2WKGA 3DKLA 2QV4A 4MUZA 1JCNA 4LW7A 4C6EA 4Y9NA 4BS0A 3EOSA 4K36A 3OHIA 4DLMA 3N1AA 2E9MA 3W87A 3DUGA 1W9VA 4RLIA 1EXBA 1B2YA 4L7ZA 1XINA 2G8ZA 4EANA 2YLAA 2FLIA 3KUMA 5LA1A 2ZICA 4JX4A 4JN8A 4FNQA 2NXGA 4W7UA 4YHGA 2I1OA 3L0KA 3KLLA 3QV7A 4FLRA 5C5YA 2EBNA 3W2KA 1XP3A 1FWTA 4C7GA 5CPLA 3VDCA 4LCSA 4TVDA 2C15A 4GHRA 2Y70A 1OG0A 2EHHA 2JGQA 4QISA 2WHMA 1GJPA 3U7BA 1JZ5A 1W17A 3PBMA 2CZ5A 3L5LA 4DM2A 3CZEA 4CKQA 2WNNA 1TV4A 3G3DA 2P3EA 4J2PA 2NW0A 4N0RA 1KXHA 4H01A 4TV6A 4ACZB 2DEPA 3BCDA 4NP7A 4IIBA 4RR4A 4UUIA 1VENA 1UMYA 3MUXA 3LHVA 2H90A 1JRBA 3W7PA 2QV5A 1OQFA 4DO5A 3ATZA 2AMXA 3AROA 4ZO6A 2WC3A 5M5DA 1H50A 4NKCA 1WP6A 3LQLA 1O5QA 3KFTA 3MS8A 4B5VA 2VGBA 4XD6A 1I2NA 5ABFB 2QIIA 1XLGA 3HOJA 1XGEA 3MDWA 1OJXA 1GREA 1GOMA 4PMDA 1UP2A 2ACQA 2IQDA 3B9DA 1N7KA 3EOUA 2PP1A 3DC8A 3SGUA 1H09A 2YCIX 3G1RA 3DEQA 3A13A 3G2GA 3B9OA 5D37A 1TV5A 3C2RA 3CIVA 3PZUA 2IUZA 3A7AA 4GQBA 4PN2A 3EX3A 3LX9A 4PMJA 4XZNX 4H9TA 3FAWA 3FG2P 2RDXA 1WKDA 2PDLA 3M47A 1HX0A 2R9RA 3T1GA 3I3EA 3QYSA 4HT3A 4UNLA 5HWMA 3FK4A 1HN1A 4EAYA 2GGJA 2FMOA 4DX3A 4M81A 3GXMA 2QDEA 3GHUA 1Q66A 1VCVA 3VIOA 3GFZA 1JI2A 3WQCA 4Q8VA 1RA0A 1J12A 5AFDA 2YDSA 5CZ0A 1F6YA 2AAQA 2X1SA 3WD2A 1QNPA 3N3TA 3EWDA 4PEEA 1XH2A 2H9AB 1XLDA 1QR7A 2ODOA 1IGWA 2QKFA 4G5DA 1IF2A 3TTEA 1J8VA 1V3MA 1M6JA 1DPMA 1L0PA 5SWUA 3CIXA 3N34A 3OLIA 3WF1A 2WOVA 3FYYA 1ZY9A 4A05A 3MT1A 4WHBA 3HGRA 1DQWA 3QC0A 3KS5A 3SUUA 1EP1A 4GXPA 2FPTA 4H4YA 1NELA 1QI3A 2IPJA 2NX1A 3W29A 3KTXA 3WDQA 1T7LA 3UWVA 4I5UA 4HJWA 5KVHA 3ORWA 1SSGA 4RDWA 3A4AA 2Z6IA 3AI0A 2CFYA 2ZFAA 2WVVA 1WUFA 3UJRA 3LOTA 1T0OA 2WMJA 2HK0A 3AS0A 5CXPA 1Z89A 1ZBWA 1D2KA 4C6FA 3DKJA 3GC2A 3OZYA 1HIZA 1O4UA 4HSNA 4PMVA 4M6PA 2OODA 1F8MA 3T0DA 2I5QA 4CQ8A 4L56A 2HE8A 4P7QA 2V63A 3EXTA 1MSSA 4GYJA 5KZMA 1KCKA 1OCBA 4H9YA 3TYDA 1FIQB 1TKKA 4PTMA 4IT1A 5C2XA 2GR0A 4NIRA 4UOZA 3K4AA 1BKSA 5AC7A 3FA5A 1RCQA 3BWWA 4F3HA 4H41A 1WDPA 4L80A 4Y6GA 1X1ZA 4QNWA 1G6CA 1O12A 1SR9A 3DG6A 3NO1A 1NDYA 3BMXA 3CXOA 2JEPA 4R7JA 3KWSA 2OGYA 4ILSA 4UMBA 1EJVC 1Q7QA 4O0KA 1XS2A 5HAOA 4EQRA 3SM0A 1ODUA 1W54A 1GRTA 3G77A 5FS8A 5LIUX 3IJIA 4C1LA 4A8NA 2EPMX 4R53A 3IGUA 1M65A 3PK7A 4QJ5B 1KGUA 2ZC1A 5T9BG 5D33A 2NQ9A 1VKFA 4C90A 1T40A 3WLSA 2PPGA 2ZRYA 2I16A 1NDAA 3H2CA 3DFHA 4FXSA 1GERA 4AQLA 2AKMA 3PJUA 2F5ZA 4AD3A 3F4NA 3P6LA 2PWGA 1RZMA 1PKYA 2FZ8A 3D46A 3TC7A 2Q01A 4M7SA 2GFTA 1XSIA 2NLYA 2WBKA 5IM51 4NRSA 1NQKA 1OHLA 1H1ZA 1R86A 3RK8A 2X7VA 2PGRA 1RQHA 2HPMA 1TVNA 3M43A 1LWIA 3C8FA 5MF5A 3BK0A 4I8DA 4BQ5A 2ZZ3A 5CPSA 3O6CA 5EA9A 1DIEA 5JVLA 1DWHM 3H24A 3EX1A 3NCOA 1SFLA 3L4ZA 1L6FA 2PDPA 1D8WA 2VP8A 1SZFA 3DDMA 2OZ0A 2PZNA 4UQDA 4MKSA 4S3CA 1JAEA 1F3PA 1KM4A 3G6MA 1UR1A 1BF2A 2VRKA 5FS9A 2E28A 1Y5VA 1UKTA 1J96A 3NA8A 2J9ZA 4H4SA 3Q45A 4JYDA 2VD8A 2WSPA 2WLYA 3LRKA 3G18A 1KKRA 1AFSA 1C92A 4AD4A 2V3AA 1CGYA 4WCJA 1JFXA 1GVIA 4DWSC 3BW2A 1VBRA 3AN1A 4GY0A 3N9RA 4LEFA 2NQZA 5EKYA 4G7EA 4AB4A 3K4WA 1VPXA 1O1ZA 3ZLFA 1SR0A 1ZP3A 3N19B 3TA6A 1V0MA 2DY3A 4C6NA 1OFRA 4UNKA 4O12A 3VCNA 4C6DA 1ZK7A 4M6UA 1DXIA 1Z8AA 4E8CA 3QR1A 5E9AA 5CZJA 1BGAA 3LUTA 3DJGX 1VD6A 4DQWA 2IS7A 3M6DA 2QF8A 2CZEA 3E2RA 4N9CA 2AGTA 4IMAA 2EKCA 2PDMA 4OKDA 3WX7A 5F2IA 4Z08A 1PPIA 5T8GA 1OF8A 3IARA 3STEA 4MY8A 3T6CA 1U2YA 3KOXA 2VX4A 4AZ6A 4BF7A 4URIA 3MSYA 4L4MA 3ECQA 4ECLA 4HK5A 1I75A 2J66A 2R8WA 2YBTA 3NQVA 2JE8A 3WQGA 4GYFA 2ZTKA 4PMXA 3KCOA 4EXBA 1GVQA 5CBJA 4MAVA 1H0IA 2OYMA 4CN6A 2OYLA 1TCDA 2UZ9A 5FF7A 5G2HA 3R58A 2PU0A 2C13A 3QW3A 5IOBA 1KBLA 1M7XA 2PTXA 2XJ7A 2R1NA 1QATA 2C91A 2VWTA 4AUBA 1SZNA 1B9BA 3MUZ1 4MB3A 3VVGA 3VC5A 1J0HA 4A21A 3IUDA 2CERA 2V5LA 4RW3A 2DQWA 3WMLA 3BANA 5BOOA 4O28A 5K7JA 5A5WA 1R7OA 4DZHA 5RUBA 4NQ1A 1FCUA 5CSUA 1TJPA 5GVJA 5A6MA 4Y9MA 1HXJA 4JQ3A 4M8UA 2GQ8A 2YYTA 2AMGA 3WJYA 2Y0FA 1MXDA 1FFVC 4O52A 3D5HA 3CV6A 4FF5A 3MVIA 2C19A 1OC6A 1JZ7A 2FGZA 2CWNA 1FWEC 2IPFA 4N02A 5AYIA 2RH9A 2GK1B 4HZ7A 3M0ZA 2QCHA 3QY8A 2I9UA 3ARVA 4UCGA 4IIEA 1Z48A 1X2GA 2C1GA 1FTXA 3SCVA 4KRTA 1HFBA 3BVJA 4K6AA 4C6CA 4DJEC 2VVNA 1KFLA 1KCXA 3GVWA 3ANUA 2FFCA 3LLXA 1H61A 3DYMA 1E5NA 4TOQA 2WZEA 1ML1A 1NPXA 2H8XA 1V97A 5E9XA 5AC6A 4DXVA 3LN3A 1PXGA 4L6DA 1UWTA 4QG9A 1J5SA 1XUUA 1IEVA 1XLEA 2WW5A 2PODA 2X1IA 4KEZA 1LOSA 1JF6A 3I6RA 3VGDA 1JCLA 1OINA 3VXGA 3HQNA 4AISA 3BV7A 4GYPC 3UVIA 3GG7A 2QQ6A 4EE9A 1GZ1A 2V2CA 5BXSA 1XKJA 1M1BA 1A5MC 3FGCA 4L9ZA 1HZYA 3TU9A 3ANVA 4LVGA 1I6NA 3CHCA 3PN8A 3WUBA 5FF4A 5AVHA 4KEVA 3IJ9A 3S1VA 3PB0A 3HFTA 3WLMA 4O54A 1XYFA 4AY7A 3NDZA 5EPDA 3SUWA 5TBOA 3V16A 4AU0A 4C1NB 1ZB5A 1FWIC 1SU5A 4MG4A 3WLPA 4FLSA 1PDZA 4LU0A 3CAQA 2ZDRA 2VEMA 4GX9A 5CSSA 5HQLA 4M52A 3SCRA 4KCUA 1G4EA 4QE4A 2G95A 2X1TA 2Z7GA 1ZMDA 4GABA 5FJPA 2FB3A 3QW4B 4YLWA 4EX4A 2GGIA 2Y8UA 4C6OA 4JX5A 1XDJA 1G7UA 1Z7AA 4PTNA 5F2LA 3BCFA 1IIHA 1J0JA 5A8GA 1E9ZB 3MKKA 4E2BA 1GGOA 1AL8A 1XIJA 3QZEA 2J3NA 2NVDA 4IJBA 3SJ3A 3PBVA 4F4RA 2O7SA 4Z2JA 3WFAA 4Z2IA 4GVIA 1AW1A 4WX2A 1RSCA 1F07A 3ES8A 3NPUA 4GI6A 3UXKA 2F6UA 3M4HA 3P81A 1XIEA 2DGAA 3LRLA 2Z2UA 4CQ9A 4NJGA 2GDQA 1RHCA 2C16A 3F2DA 4YVXA 3CUIA 3IIOA 2ABAA 3N12A 3AHZA 4RNHA 3B9JB 1R2RA 2DSWA 4I90A 5G2WA 4PB5A 3WZ0E 4DY1A 1Q63A 1JUBA 3FX4A 1F5ZA 3VDHA 4U5IA 1HKMA 2YW3A 4O1CA 4FHAA 2CDUA 5HR6A 2ZZ7A 3C61A 3V4BA 3LPOA 1G7VA 2PA6A 1L6YA 5G5HB 4O1DA 1MMFA 3E6EA 5AYZA 3VNJA 1MFVA 1N8FA 4PFMA 5CLTA 2QLYA 1TWSA 1UR9A 4ZCWA 1A3XA 3R94A 3GX9A 1RJRA 3L4TA 2A3HA 4P7OA 1BYDA 3TYBA 1LQ0A 4ONVA 3GB6A 1E5JA 1W2PA 1E1FA 2V6OA 1SFJA 4JYEA 1CLVA 3L0NA 1MUMA 3THDA 4AWEA 4EQXA 4S3EA 2ZDSA 1G4TA 4QLKA 5LNVA 1LJYA 3TOYA 3E1F1 3MUIA 3TSDA 2ZUTA 4CN1A 2YQUA 4AFYA 1NWRA 4JFUA 1XH0A 1VQZA 1K4GA 4PYSA 3VDAA 7REQA 3L7RA 4LS1A 4HB7A 2SFPA 4ZFCA 4GD0A 2EAWA 4EPEC 1JGMA 3TQPA 1E9YB 4MADA 2E8ZA 1R38A 2DT0A 1FWNA 1O1HA 3EXRA 2Q8XA 1FEAA 3IC9A 3M7WA 3EAOA 2Y2WA 3ALFA 5I3HA 4GZ7A 1JULA 4H4ZA 4DWSD 1BAGA 3HGSA 1W3TA 2GVLA 2YJQA 3Q94A 3VDGA 3S5YA 1QHZA 3A22A 1HT6A 1LP6A 3W7JA 4AC1X 3VIFA 4EKJA 2C7FA 3G22A 2AGKA 3FKKA 5ABGA 1S5MA 1YXYA 2BG5A 3KRUA 5LGZA 3GYEA 3ABZA 2W66A 1UOZA 2AL2A 4DUWA 3LTSA 1AQFA 3PS7A 4H3DA 5JCLA 2X8HA 3Q6JA 1OX5A 3SB0A 2AOSA 3AICA 3CV7A 4O4WA 2NV9A 1EPXA 3W24A 2OKOA 1T3QC 1N8IA 3RO6A 3N2MA 3VKDA 2J7FA 1KFCA 4HA4A 1C9WA 3L66A 1V3HA 1V8EA 1QW7A 4KWUA 1RM6B 4HSHA 2E6DA 5AHFA 3MTWA 2G3IA 2VKZG 1J18A 3A9IA 3IJ6A 1NVMA 2VZVA 1DJQA 4EF8A 8A3HA 4EWJA 4MB1A 5B7ZA 2WHJA 2REQA 3KRZA 4OTKA 5D30A 1WZMA 1FWAC 3BC9A 3E0FA 3R8RA 3TMQA 4MKNA 1FDJA 5E70A 1NHSA 3CWNA 2ZXDA 1UZ1A 1NP0A 1O5RA 4O1BA 5FCZA 2J7GA 4KCWA 1IV8A 4LXFA 1DIDA 4TUFA 1OCNA 3UJEA 1V6YA 3FN9A 4QE1A 4DUXA 4Q8NA 1TO3A 4E4UA 4LUTA 4ROPA 2QNEA 2ZTJA 3VU2A 3KWXA 5G4HC 5D2YA 1ICQA 3CZKA 3VINA 4NJIA 4RDYA 4WRHA 2EQ8A 2UY3A 4PMNA 2QJIA 4Q4MA 5I23A 2GGEA 3BOXA 1E4MM 5JXQA 2VRQA 1K03A 3WDRA 3DBNA 2X50A 2UY4A 4DJED 1K7FA 4NJJA 3MQTA 1X6LA 1QDSA 2BASA 2OWWA 3GFYA 3MMUA 3NJ3A 5DMLA 2EF9A 3HV8A 1K8XA 4H7ZA 1HJWA 5C6MA 2OG9A 1VEPA 4UWMA 2BXZA 4CU7A 3STGA 2PGWA 3KP1A 3VIGA 2ZZ2A 1FO4A 1KKOA 3SSJA 4C6IA 4B92A 2WVVB 3LRMA 1AH3A 3EZ4A 2BOGX 2EPLX 3WL1A 4TQTA 4DUVA 1KM6A 4E5TA 1UKSA 1QHPA 1VFMA 2NUWA 3N04A 1RLCL 3B9NA 1HJQA 3W7DA 3GXNA 4AMCA 3GNOA 3TYUA 2QZRA 1OVDA 3UA4A 5LZLA 1A5CA 1KLYA 3N6QA 2E5BA 3OIXA 3AMGA 2BVTA 4NY2A 4H4QA 2FPYA 4PMUA 3A3XA 4PBFA 3IIVA 3EX4A 4LAZA 4B2DD 1JF5A 3O7UA 3RM8A 3AYSA 4Q33A 3A47A 2OQHA 1UUQA 1UWQA 4UZSA 3OBAA 2PCEA 4EXQA 1UUMA 3L0GA 4DJFA 3HA1A 1MZHA 5D2VA 3QKEA 4RCXA 1DOSA 4B5TA 5ABEA 1MRAA 3SCOA 3MHGA 5F2MA 1Q2SA 3D9XA 3Q58A 3PUDA 3P80A 2FJUB 4KEUA 1YBQA 4ZQCA 3MO7A 1PHQA 2J7HA 1KXVA 4HD5A 4JIEA 4KWOA 4PSPA 3KP0A 1GPWA 1V5XA 5DEZA 1AJ0A 1B3YA 3R8GA 3C0JA 2XN1A 3TQVA 1QASA 1BSLA 7TIMA 3QKZA 3N2OA 4KKXA 1BXCA 2VGFA 3DX5A 2V5CA 3APYA 2ZZ0A 3W0KA 1X1OA 3BV4A 7A3HA 1GTEA 2WV8A 5LNSA 4UBPC 3WUGA 2CLHA 1ZMCA 1GRFA 3U3HA 1TPVA 1TFVA 5E6YA 1R9XA 3AZRA 2DT1A 3NQ2A 2Y4SA 3LGEA 4MUPA 3UCQA 1XLIA 2RDUA 2WCSA 4A3RA 3RGTA 4XIMA 1XRFA 3GSMA 4NAFA 3WD3A 3W28A 1LDCA 1D3CA 2XIMA 4AZHA 3EBVA 3QGKC 4ADTA 3ZLHA 5JBFA 3OB8A 4U31A 3VGEA 3I4EA 1U5VA 1G4SA 4J2MA 3K8MA 1VJIA 3LHYA 3URHA 1GT8A 2WO5A 3DI0A 3UZJA 3BLKA 4P7LA 4FF7A 2D22A 1ZAIA 4FXRA 1RD6A 4JIRA 4PGLA 1A3WA 2PD9A 2ZRVA 5F1VA 5FD0A 2CZFA 2XH0A 4ZB5A 3LQGA 1IXQA 3NZRA 1GRAA 3VM5A 1F61A 2Y7DA 3QOKA 3SW6A 1JI1A 4CQCA 1ZQ5A 4L5ZA 4G7EB 1ME9A 4LBRA 3HB9A 2HS8A 4M51A 3LCXA 3QFBA 3V36A 3U2EA 4AYSA 1EHAA 4LCQA 2PAJA 5HQEA 4GRTA 4JTIA 2TPSA 2FMNA 2ZZBA 1WOBA 4H4VA 1XYZA 3EXSA 4JQ2A 3BLLA 4DZ5A 3FXGA 1PCKA 1HVXA 2OTDA 4GKTA 4AHPA 1JEHA 3QTPA 1TSIA 2Y8VA 2UY5A 3H4KA 3UGRA 2XDFA 9CGTA 3H54A 2YL9A 1LLOA 1XC4A 5CZSA 2PTDA 3QM3A 3NXLA 3RRAA 4K37A 1PO9A 4QRNA 4TVCA 5IHRA 1ONEA 2C1IA 1UYQA 2PRHA 1ADOA 1FXQA 1S38A 4INFA 3OEXA 1T8XA 3DHFA 3RFAA 3GHRA 4H6RA 4O4VA 1ENUA 1DL3A 4GLEA 2CHOA 2W62A 2ISWA 2YCKX 1S7MA 3MA8A 2J75A 1XYBA 1IXPA 1X8FA 4XB3A 3TYEA 1YW1A 1AJ2A 3BAJA 2GGGA 5CJ5A 4Z1YA 1O5KA 3W75A 2P8BA 3YPIA 5AECA 2HBVA 1VDVA 5GNZA 1QRQA 3P14A 5HA7A 4GC4A 2QCMA 2NSOA 1JZ4A 1Q4WA 1GOXA 5I02A 3WJSA 2LLEA 1EO7A 1IWAA 4GMEA 1HL9A 4OOUA 4H4WA 2OLSA 3PZIA 4NI8A 3INPA 1WDDA 4AHQA 2G3MA 1NY1A 1O6IA 1W1PA 3KOYA 1YE4A 1XJBA 1DHPA 3AC0A 1TV2A 2GOUA 2VR5A 4A2SA 1K8CA 3LV5A 3SAZA 4G1NA 1P6WA 1X7IA 2D0GA 1UR3M 3RNDA 1NWTA 3C2VA 5FJOA 3VYLA 1X6UA 1YADA 3EMQA 4XZWA 4LAOA 5A69A 2E3ZA 4Q4PA 2O9TA 3XISA 1MEWA 4PODA 1YQZA 1EIXA 1HNYA 2PWHA 4PCNA 4B3ZA 1AQHA 3H53A 4P61A 5HQMA 4NSBA 3S0CA 1A5UA 1TQXA 4PE8A 2X7WA 3M16A 3F2CA 2GR1A 2R9ZA 1NH6A 3EOEA 1IYXA 1G01A 2DUZA 3QQ0A 2G50A 3FSTA 2QCLA 1KRCC 3O6YX 3NO5A 3R5EA 4YXGA 2NX3A 3SCUA 5DF0A 2WMIA 3QF0A 2Y7EA 1MEHA 3V35A 2YL8A 1XLKA 3H21A 3SZ8A 1Z32X 2A7NA 3VNIA 4I6VA 2YVJA 2Z1SA 4E2DA 2XM1A 2X2YA 3TJXA 4IP7A 2OSXA 3AAMA 1DJIA 3SQPA 1KBBA 1Q6QA 3LNMA 3G8RA 3NQ7A 4ZOEA 4DBDA 3M5VA 3FGCB 2DZTA 2V5KA 1QJWA 4AF0A 2CETA 1UR8A 2YCJA 2QULA 3G1HA 1DWGM 3SFKA 4CU8A 3WY1A 5CSRA 3FCPA 1Z41A 1RQEA 4F48A 1PX3A 4J3VA 3UG4A 4FP1A 2XWEA 4XZHA 4AZBA 4AEFA 2DPEA 4GK8A 4GNVA 4AX6A 1H4PA 4MGGA 2W63A 1UQYA 4WDTA 5AKQA 3G1SA 3W86A 1XIDA 1M6IA 2FDMA 3ITCA 2ZXQA 3PZOA 1KN0A 5DRCA 3EX2A 5LA0A 4O16A 4D2JA 4H9MA 1TRIA 1H51A 1KGXA 2D24A 3WLQA 3TCSA 1MRQA 2WOWA 4GQQA 1GG0A 1GKQA 4WVXA 2QEZA 3DFNA 4K1GA 2DP3A 4ZA0A 2Y5SA 1PTAA 4QXIA 1YDVA 2VZOA 1UA3A 1UWIA 4AVFA 3HF3A 1NDZA 1F2JA 1BGGA 3XIMA 2DZPA 1D3GA 3MSDA 3KCJA 1BD0A 1CPUA 2WKJA 5I09A 4YTQA 5CGMA 3GU2A 3S46A 3PZGA 1FEBA 1QI2A 3QHMA 1FVPA 5HULA 3F5LA 3CTLA 4C6JA 3TIMA 1W9UA 3VKAA 1R3QA 1M9HA 4GY1A 3SFWA 3SY5A 3URNA 5D8ZA 4YTUA 4TMBA 4U2YA 4WSHA 4UQAA 1RBAA 1F3TA 1UWUA 4HU3A 1OFOA 2KX9A 3FS2A 2VL4A 3IEBA 9RUBA 2W3SA 3VMOA 1GJWA 1AG1O 4CQDA 3GXFA 1Q6EA 4BQ4A 4AW7A 1K8ZA 3BICA 1V3LA 3ZWSA 1K77A 5CC3A 1QI4A 4HNNA 4ADUA 4PTWA 1K4HA 4RZ6A 2J6VA 5C70A 3QTGA 3MJYA 2VGIA 2VT0A 4HHMA 7REQB 4AZGA 2X16A 2DW6A 4GPNA 3S9IA 1ME8A 3HIJA 2IPGA 1KFWA 2PDUA 3WQEA 3P8IA 2VVSA 2Z1XA 8CGTA 1EDQA 2VCBA 1Q8AA 3AISA 1RP8A 3II1A 3LXBA 3K46A 2XPKA 4KS0A 3E5PA 1KBJA 2CLEA 3M0MA 5D09A 3LU2A 1JEZA 3GFXA 1G0CA 3U6WA 3NL5A 2VOMA 3MUAA 4BA0A 3N13A 5A6SA 3WQVA 3JRKA 1BPLB 4EM4A 1T96A 1CBGA 2DVTA 2VEKA 6XIAA 3L12A 5FJJA 1ONRA 1T8QA 1Q1RA 3LG3A 3LLFA 5D04C 1W2VA 3WNKA 1JAKA 2VMFA 4R85A 3GW3A 4HA0A 5I3KA 2J88A 1H7WA 3UY8A 3QPZA 1US3A 5F2GA 4L9YA 5E0CA 3UFYA 3AXMA 3WD1A 5A8NA 2AL2B 4IFOA 3QLDA 4MAZA 1GW9A 3IGHX 4JN6A 4QCFA 2A8XA 3UG8A 1E1CA 3WF3A 4TVWA 3W1NA 1IR2A 2OJPA 4QSHA 2JIEA 4I9TA 1CX9A 1EZWA 3BQ5A 4AZIA 2VDHA 3QV6A 2B31A 3EWUA 3VNYA 3TW7A 1IEXA 5REQA 1JD9A 1FWJC 2Q8ZA 3O06A 2DH2A 3ITTA 2PTYA 2ACSA 5IDIA 1OD0A 4FO4A 1U5JA 1QNOA 2DORA 4BF5A 3NIYA 4P7RA 1FWSA 5AYXA 3UP8A 3URQA 4ENLA 1N5XA 5HNTA 2REQB 1D7FA 2D2JA 3B8WA 1KBKA 4FOKA 1PTDA 3GXPA 2Y61A 1H7XA 3WK1A 5HMEA 3CH0A 4GG9A 3VIKA 1XGDA 4OJYA 4N2YA 5G1YA 1LF1A 3FA3A 1DV7A 1GORA 3URBA 3F4DA 2BXYA 1UD8A 4M80A 2G96A 1VLWA 4TX8A 3WLOA 1OC5A 4O8AA 1B3VA 3LHZA 3H23A 2FTWA 1E4NA 3KRBA 3C4UA 2CPUA 1TR1A 2OQLA 3B8SA 4BV6A 2QCGA 1KXQA 1Z9AA 4H04A 1QUMA 1PKMA 5BOEA 4J3TA 4J35A 5FOOA 4IP4A 4JTFA 3NZGA 3NVDA 5EFDA 1AMYA 3KBVA 1AMKA 1ZL1A 4YU1A 3CUZA 4Q7BA 4ZOBA 3UR2A 1K7XA 1XLAA 4DAIA 3GUWA 4XD4A 1LPFA 5BU6A 4GGHA 3ITXA 1XIHA 3DH7A 1TV8A 3NUKA 1DIOA 3PPGA 3V18A 2E6YA 1ZJBA 2Z2BA 3WLJA 3H2MA 1NHRA 1QNRA 3W70A 2E25A 1W1TA 3S2CA 4W88A 1EQCA 1W37A 3LHUA 3MANA 4H4UA 3THUA 3K8LA 3H2OA 3N6HA 3FFSA 4ZOAA 4JTAA 4ZVJA 1LL6A 2V5DA 3OP2A 3W22A 1B9ZA 2I7GA 1TELA 4WQ6A 4O1FA 2O92A 2IKGA 4ZTYA 4I9JA 3W7NA 1EJ7L 3DENA 4MNKA 5HJLA 3ZLGA 1C8XA 1IGSA 1U1HA 3EOOA 4IL0A 4ZGYA 4LBSA 5K9XA 3CHDA 5AHIA 1XCFA 3IJDA 1HP5A 2WZTA 1DXEA 3NQ8A 4PL2A 2OT0A 4M0XA 2VWSA 4GWEA 4J28A 1CGUA 3SURA 2A79A 1XXXA 3ZYZA 2FFIA 1XLMA 4MB4A 1HW6A 1IIGA 4LPCA 5G4WA 3KX6A 1FFQA 3CWOX 2RJHA 3VE7A 5HJXA 4LYRA 3JS3A 1HUVA 1YDNA 3VNKA 3S8HA 2GUYA 4DWDA 4Z0SA 1EJWC 4B5UA 3VFCA 4ZXLA 3IIPA 4UTIA 3NOYA 2PDBA 1ZUAX 3OG2A 1GRHA 1GEUA 3VD5A 3LCLA 1EGZA 2EPOA 3VD3A 2O0TA 2I57A 2W3RA 3ZWTA 1P1XA 2IMRA 4YPJA 1WBJA 1KM0A 4B5SA 2ESCA 1W5QA 3MHFA 4P8VA 1YBQB 2E77A 2D23A 5FL0A 4HN4A 1KBIA 3DGHA 1OIFA 4ZQMA 1B3OA 3TTOA 2Y63A 3WH6A 3P0XA 4CCCA 2G3JA 1FH9A 2YYUA 3W53A 3WF0A 3M0YA 1E4IA 1K8YA 1EBHA 1QI0A 2QAFA 1Q7MA 1YX1A 2GGHA 3IUIA 3EPOA 1ITUA 1YYAA 1EGMA 4HHHA 1LG1A 1XF0A 4ZB0A 5U1OA 5CAKA 1B4KA 1QVBA 1CEOA 4GINA 4L1GA 3PTMA 3OZOA 2OQYA 5AC8A 2ACUA 3AIRA 1S1PA 1QPRA 3O2LA 3SIZA 3IUHA 4Q4SA 3ARQA 5DBUA 3E12A 3TYAA 2FZDA 3ZT6A 3SI9A 3L65A 4NAFB 2DZVA 4L4OA 1K02A 4MNLA 3HJEA 3PPCA 4A35A 3MI6A 3LM3A 3EDJA 3TK7A 1J6PA 2H6RA 1NHPA 3WMCA 3V75A 4LJ3A 1BQCA 3LSCA 3A12A 4A3UA 1A0DA 1XQKA 2A7PA 2HNEA 2OU4A 3BW3A 4IIDA 4X0VA 3W7LA 5HWJA 1KFEA 3BZJA 3H6OA 4GVFA 1L9WA 4XX6A 1XG4A 4H2HA 1GOQA 2D73A 2DZSA 3EGJA 2J9YA 2WANA 3H55A 4GI9A 2XGBA 2OB3A 3CLWA 4JTUA 3PBWA 1BG9A 3BZGA 4Z0JA 4US6A 4RZ4A 1WZAA 4R27A 1HL2A 2WAGA 4P5UA 3NEVA 1YLVA 1VEMA 4S3JA 4F0SA 4GZJA 1ZX9A 1XHCA 1A5SA 2ABBA 1JXKA 8XIMA 3HO8A 3KXQA 3Q2DA 3VIJA 1PX4A 3SBFA 3SUTA 1Y8BA 3LCGA 5LHEA 1Q2RA 4HCDA 1FHVA 4WJ8A 1VZWA 4TX9A 3RPDA 1I2PA 3SUVA 1R6WA 5PTDA