4JN8A

Crystal structure of an enolase (putative galactarate dehydratase, target efi-500740) from agrobacterium radiobacter, bound sulfate, no metal ion, ordered active site
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
395
structure length
395
Chain Sequence
MKIDRMRVFMTRDKDRPRVIVALDTDDGLTGWGECYNHGPDKALPPILDYLYGFLSGQDPTRIDYLVNLLIQQSRFPPGALGLSAISALDHCLWDLSAKAANVPVYKLLGGAVRDRVKVYAGVYTAPDAPAARDEFDRLNAEWGFTAFKLSPWRVDIHAHRWGNVVKASADYFRSLRETVRDDYEIAFDAHAQIFEPVAARQLGNALAPYDPLFYEEPLRPENIDMWGDLKQGLNCVLATGESLYNRNEFLRLLQVKGADLIQPDICVVGGISEMRRIATLAEAYFVGVAPHNPMGPLATAVNVHFSAATQNFRILEYRLPKGQAYVYGGKDIEKRQGETRYVVDPYLPKDGYLELRPDRPGWGVEMDEKAMEEEGYIHWQRRVPKRPDGSYAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords ENOLASE
publication title Crystal structure of an enolase (putative galactarate dehydratase, target efi-500740) from agrobacterium radiobacter, bound sulfate, no metal ion, ordered active site
rcsb
source organism Agrobacterium radiobacter k84
total genus 132
structure length 395
sequence length 395
ec nomenclature
pdb deposition date 2013-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4jn8A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4jn8A01
3JZUA 3ENLA 2QJMA 3JW7A 4A3RA 2PCEA 4E4UA 3OPSA 3VDGA 2GGIA 3GC2A 2PP0A 3ZVIA 2HXUA 3FYYA 4A35A 3N4EA 3RITA 3I6EA 5BOFA 4JHMA 3OW1A 3HPFA 3DFHA 5EU9A 1KD0A 3SJNA 3THUA 2XH0A 3I6TA 5FJUA 3DG7A 2PA6A 3U4FA 3UJFA 3QLDA 3T9PA 1DTNA 3S5SA 3DDMA 1EBHA 3ZLFA 2PTXA 3SN1A 4DXKA 2MNRA 3DIPA 4ROPA 4DWDA 4H1ZA 1EC8A 3FJ4A 3NO1A 3DERA 3SN4A 4ZA0A 1E9IA 3EEZA 4A6GA 2PTWA 3UJ2A 1KCZA 2PMQA 3OZYA 1ONEA 4IZGA 3QKEA 3QN3A 3T6CA 1R0MA 3PWGA 4F4RA 2PTYA 4KWSA 2PGWA 3P0WA 1OEPA 1R6WA 1FHVA 3MZNA 4GFIA 3H12A 3MKCA 4DX3A 4IP5A 3FV9A 3K1GA 3NZGA 4YWSA 2OG9A 2OLAA 2OZ3A 1BQGA 3CT2A 3TWBA 2GGEA 1EC9A 4DYEA 3OZMA 3DEQA 1MUCA 3OTRA 3V5FA 3UCCA 3PK7A 3MUCA 1PDZA 4HCDA 3ZLGA 1ECQA 1FHUA 3CXOA 1SJBA 3RR1A 4M6UA 4ENLA 3V5CA 4KT2A 3TJIA 2QDDA 3BOXA 3S47A 3H70A 3N4FA 3MWCA 2OX4A 4JN7A 1P43A 3I4KA 4MGGA 3GY1A 1NU5A 2PSNA 3R11A 3CB3A 5FJOA 3N6HA 2QQ6A 3CYJA 2ZC8A 4GGHA 2HXTA 3H8AA 1SJDA 2OPJA 1KKRA 2I5QA 3PFRA 3R0UA 3FXGA 2ONEA 3UJSA 3U9IA 2HZGA 4GIRA 2CHRA 2RDXA 2POZA 3VCCA 4E4FA 7ENLA 3P3BA 4ZCWA 1IYXA 3P93A 3IJQA 4HCHA 2PS2A 2AL1A 2PGEA 2GDQA 3NXLA 1P48A 3QTPA 2PP1A 3VC5A 2P3ZA 3OP2A 2XH4A 3N6JA 2GSHA 1XPYA 4FI4A 1RVKA 2QGYA 3UCDA 5IDZA 1W6TA 1MDLA 3RO6A 1PDYA 3DG3A 4HN8A 2PU0A 2ZADA 2OO6A 1WUEA 3R0KA 4G8TA 3RRAA 2FKPA 4X2PA 3TOYA 3TW9A 4GYPA 1EC7A 3MSYA 4E6MA 1MNSA 2MUCA 1ELSA 4K1WA 3UJEA 3V4BA 1TE6A 3B97A 3IJIA 1JPDX 3ES8A 3BJSA 4HNLA 4J3ZA 1WUFA 4MMWA 4IP4A 3V3WA 3R10A 1YEYA 3TJ4A 2OZ8A 4Z1YA 3Q4DA 3T4WA 2GL5A 3VFCA 2HNEA 3PWIA 3CAWA 2PTZA 2GGJA 3FCPA 2PODA 4MKSA 3TTEA 3D47A 4HCLA 1NELA 2DW7A 2QVHA 3T8QA 1TZZA 5FJTA 5BOEA 5FJRA 3BSMA 2P8CA 3UJRA 1JDFA 4DN1A 1MDRA 3CK5A 1TKKA 2XSXA 4Z17A 2OVLA 3MY9A 1L8PA 3TQPA 3DESA 4IHCA 4HPNA 2QDEA 1SJAA 2QJJA 1SJCA 2GGGA 1F9CA 4KEMA 3MQTA 4IT1A 2PPGA 3VA8A 3FVDA 3SQSA 3D46A 4HNCA 3ZLHA 4FP1A 1JPMA 1XS2A 1EBGA 2OFJA 3ZVHB 3SSZA 4K8GA 2P88A 4E8GA 4EWJA 3JVAA 4GISA 3ZVHA 2P0IA 2AKZA 3SBFA 3KUMA 2OQYA 2OZTA 3R1ZA 2PU1A 3STPA 2GGHA 2QJNA 4G7FA 3DG6A 3UXLA 3TCSA 3EKGA 3GO2A 4H83A 3VC6A 3ES7A 5FJPA 6ENLA 2PP3A 4HYRA 1JCTA 2XH2A 4IL2A 4E5TA 3DGBA 5ENLA 2OKTA 4GYPC 4J1OA 4M0XA 1MRAA 3UGVA 2FYMA 3TWAA 2DW6A 2O56A 3IK4A 3QPEA 3RGTA 3DFYA 3UXKA 2NQLA 2XH7A 4KPLA 4H2HA 3SN0A 1KKOA 2XGZA 3IJLA 2OQHA 1BKHA 4K2SA 4JN8A 4GGBA 3Q45A 3H7VA 2P8BA 3GD6A 2AKMA 4GMEA 2AL2B 4DHGA 3NFUA 4IL0A 4H19A 5J04A 3R25A 3VCNA 2AL2A 3RCYA
chains in the Genus database with same CATH superfamily
1ONXA 2W9MA 2IPJA 1S7MA 4IGHA 4MWAB 2BMBA 4W89A 3H21A 4V33A 1BYDA 1MEWA 2RDUA 1HFBA 2HS8A 3AXMA 2O92A 3AMGA 2QCFA 3RFAA 1H60A 4D9PA 3ZXWA 4FOJA 4NAEB 2FVMA 2PDHA 3P2VA 2X8RA 4NVTA 3OA3A 4FOKA 4O11A 3Q6JA 2CZEA 1XH0A 1EC8A 4JFTA 1UZDA 1P4CA 2V30A 3GYEA 3V7PA 1IHIA 1XYLA 3DYMA 3WJWA 3CIXA 1C7TA 1XGEA 2X8HA 1XBZA 2WHKA 1LL6A 3WEZA 5LNUA 2BDQA 3P0XA 3VINA 3RPTA 1WKEA 3BE7A 1JUBA 2VYOA 4BQ3A 4ZQOA 2GR2A 3FV9A 4M6PA 2CLKA 1KXHA 5ABEA 4LB4A 1XYMA 4PUUA 1VP5A 1EJVC 4JFWA 3R07C 3W7OA 3B04A 1VF8A 1IE7C 3RM9A 3PSWA 4NZ4A 3DEQA 4GXPA 2F9RA 2Z6IA 3LBCA 5F1VA 3APGA 1SZNA 5HANA 5DN1A 5E70A 1QOQA 2YL9A 1XGZA 1VYPX 4YYFA 3TJIA 4LTSA 1W1VA 4H04A 2W0HA 2CBIA 1UOZA 2QDDA 1M01A 2J79A 3B8WA 3OG3A 3IJ6A 4KCTA 4L9XA 1HGYA 4W5ZA 2HMCA 3CNYA 1CGUA 5JCNA 1A5BA 3CLMA 1FWJC 1TTQA 1V0NA 3W81A 4C7FA 2CLLA 5LIXX 3H4KA 4QG8A 3GXDA 3SSJA 3NOYA 3WD4A 1WZLA 1QI3A 3HURA 3NQGA 1XWYA 4ZSTA 1UR1A 1QK2A 1J2WA 1SJDA 2OPJA 4W4QA 1N8WA 1Y65A 4JYEA 2V5DA 3BOLA 2KAUC 3BAWA 2V38A 4MM1A 5MKGA 4UTFA 5JH1A 3UJSA 1E71M 2XIBA 1E4NA 4CNTA 5GNXA 3FDKA 1EDQA 1OD8A 3SIZA 5IDIA 4MLJA 3WQGA 2ZE3A 2VL4A 3W23A 1V6YA 3KBWA 1GKRA 3LXAA 3ME3A 1UWTA 3RMEA 4MWAE 2EF9A 2WVVB 5GQBA 4ZO8A 4GCAA 3IGSA 3CLWA 4XD6A 3B4YA 1GQLA 1XG4A 1UKQA 5I23A 1N7KA 3VO0A 2BVYA 5HPOA 4LX4A 3VU2A 1GW9A 1KBBA 4MUZA 4L61A 5CZJA 3QTPA 4ZGYA 2ZWYA 1OFEA 3S1WA 1IT0A 1OADA 4O50A 4V28A 4DO5A 3GW3A 4DPQA 1RVKA 1KB3A 2VZTA 1R47A 4MFDA 1J12A 3FOKA 2CYGA 3R0DA 4U2YA 2ZADA 1ALDA 1M65A 4N4PA 2PDBA 4Z1AA 1DJIA 2WK2A 1GRGA 1BRLA 2CFYA 2VJXA 2MUCA 1QUMA 2E6YA 1VZWA 2OLSA 4DF0A 3BJSA 4B4HA 4MG4A 1WUFA 4GI9A 3TYUA 1GRTA 3R94A 1MQPA 4LEQA 2XN1A 1CW2A 3CMGA 2ACQA 2G96A 1LG1A 2R6OA 2QCDA 3BW2A 1LVLA 2HNEA 3DFPA 2J8TA 2R1KA 3LCHA 1CGXA 3S3GA 4HTBA 4RX0A 3VNLA 1E1EA 4RZ4A 4UMBA 4XWUA 4JIPA 3VKAA 3TTEA 1I60A 1QVBA 3PPCA 1RSCA 3UZXA 7CGTA 3ZJ6A 1BSLA 1W0MA 1RP9A 1GT8A 4C6NA 1MQRA 1MDRA 2HBXA 1V3HA 3RG6A 4C6JA 4Z17A 1VAHA 5DLCA 4GIYA 1IEQA 2Y7DA 1DL3A 1I1WA 3K4DA 1AH3A 5HJLA 3WNMA 1F73A 4NL1A 4H50A 3MMTA 3CWOX 4QJ4B 3KM8A 5TNVA 4RV3A 2R9RA 3VNMA 4YPJA 5ER0A 2X2YA 3CZGA 2VP8A 1DE5A 3LTPA 2OFJA 2J77A 1K9EA 1QXLA 4QDMA 4C1NB 2ZUMA 1W56A 2HPIA 4G5DA 4LV4A 5TBOA 5JQ9A 1Q6GA 4QQUA 1L2QA 1XSKA 2FQIA 4Q8QA 3DG6A 4H6EA 4GRSA 4YTRA 6ENLA 3ZIZA 3AS3A 3W70A 2XH2A 1FY6A 2Z27A 1CXEA 1BF2A 4DJFD 1X1OA 1TPC1 4ICCX 3W7HA 4J1OA 4M0XA 3POCA 1QO5A 5FEPA 5IHRA 2Z25A 3TZFA 2PDUA 4Z2GA 4G9PA 1Z6KA 4PUNA 1VQTA 3ABZA 1C8QA 4IPJA 5XINA 1ZDLA 3BUVA 2VEIA 3QR0A 5A6BD 2WBGA 4PMQA 1JYXA 2B7OA 2ISWA 4D1JA 2WP5A 3WL1A 1R30A 1QNVA 3R4IA 4GGBA 3KDNA 2O4QA 2VZSA 1ZBCA 4CCDA 2OMAA 2QXWA 1A5MC 3B05A 4KRUA 4H19A 2AAQA 2J7GA 2FTYA 3SY5A 1FFQA 3HPZA 4M3PA 3ARSA 4PMVA 4M1BA 1EPXA 5B7ZA 1LWHA 4XVDA 3R89A 1XV8A 4HIBA 1N5XA 2JQXA 3HTWA 3WBXA 2Y70A 2WSRA 3NWRA 3BOFA 2CC0A 1UKSA 4O16A 4MZ8A 3WLHA 4GNVA 3G6LA 1UG6A 1F3WA 1KRBC 4ZQNA 1H7RA 4A35A 1K77A 3IRSA 5I24A 2R1PA 4L4LA 3NZ1A 1MWOA 1XIFA 4HU3A 3KW3A 4G2DA 1TPVA 1J0KA 4RNJA 5FJUA 1S5MA 1THFD 1TWSA 2YL6A 4I5XA 5MHBA 4NILA 1J2BA 5FESA 3IRDA 2V6OA 4DXKA 2E1WA 2CCRA 3A13A 2XM2A 2V67A 1GOIA 3TYEA 3F2DA 1UWQA 3H2NA 3IAQA 4OFCA 5CH9A 4KF1A 1LOSA 2PF0A 2WLYA 3VNZA 2Y5SA 5HWNA 1OJXA 2B4GA 5FF3A 1TFVA 3ARVA 1B31A 4M24A 4LOCA 2X7WA 4RPPA 2I9EA 1HKVA 4PGLA 5DMLA 3G18A 4YJ5A 3NZGA 1PVNA 3C8NA 1XW8A 3S9YA 3WLQA 2ZC1A 1RBOB 2J7FA 3ITCA 5B7YA 4GLEA 1AK5A 4HHMA 3OTRA 2CLPA 3GVWA 3EA3A 2QAPA 4GVGA 3MUCA 5BMWA 1GJUA 2VFEA 4M29A 1EWDA 4WDWA 1AL8A 4IIFA 3LTYA 4NI8A 2HCVA 2CEQA 1NHQA 3M0HA 1OJTA 2W27A 3TSBA 3L4XA 1KCLA 1N82A 1G6CA 2PDLA 4ZL1A 4OQVA 4M51A 3UZJA 5AHFA 2Y63A 3W24A 3DUGA 5LIKX 3M0IA 2AAAA 5G5GB 1JAEA 2V3GA 4GQRA 3OVGA 1LTDA 2YL5A 2B81A 2XSAA 4LRTA 7TAAA 5E9XA 1KCKA 4AIBA 1ECEA 1I2RA 2YYUA 3NPVA 4H4YA 2MANA 1MI3A 5AC8A 4IMEA 2HV5A 3D6NA 3THAA 3EWZA 1A49A 3AXKA 4M81A 3IIZA 2I5QA 3GKAA 4UFHA 5C6MA 1QI2A 3O0KA 1GUVA 3KCLA 1XDIA 3AYRA 3FEMA 2A21A 2Y8UA 3ZT7A 3F5JA 1QASA 4HPGA 3CO4A 1C90A 3VMPA 1IZCA 1V4YA 1CCWB 4KIEA 2XFYA 4Q4MA 4LALA 3TN3A 1NF0A 1FEBA 4CN4A 4DYJA 2X1RA 3K8LA 4GY7A 3B0YA 3UYIA 2PP1A 3PWAA 3CZKA 4LYPA 1DHKA 4DXXA 4TO8A 3N6JA 1VFUA 4PMYA 1VFHA 3UCDA 4ZVJA 3GNNA 3L4YA 5HULA 2VDIA 3NM1A 1W8SA 3SGUA 3QOKA 3TTOA 4TOQA 4ADWA 3B8VA 1O5XA 2X8GA 3WLIA 1P7TA 2FKPA 4TVDA 4K1GA 1PHWA 4IQEA 3PSVA 1UD6A 4LBSA 2J8FA 4ORMA 4V15A 3GQYA 2VD9A 3UR7A 1XGDA 2G3JA 2WJDA 1DKWA 4BCEA 3MV01 3M6DA 2Z1SA 1JPDX 4EMJA 3GIYA 4J3ZA 3NQDA 4HA0A 3AHYA 3GIPA 1CXLA 4BURA 1FFUC 1KFCA 5LNWA 4PZVA 2BCPA 3UZWA 2ZUUA 3TJ4A 1V0KA 2QCCA 3VD9A 1QDSA 1E0WA 1RY8A 1V02E 2GL5A 3UQNA 3VFCA 4FR6A 4BI6A 2WOIA 4ZB2A 2PTZA 3EKLA 3P84A 1HVXA 2QUMA 3FCPA 1LT8A 3S0CA 4CD4A 3GDKA 1NVMA 3BMWA 3LK6A 5FJTA 4JTJA 3QZ6A 5I3HA 2ZFAA 2AMGA 3L7RA 4U3CA 4UFIA 1ZKQA 3NIYA 1VS1A 3VE7A 4DPPA 1WBJA 2C16A 4UTIA 2P0OA 4JCMA 1L8PA 1W1A1 2ICSA 1TPFA 1PS9A 5KETA 1SJAA 1ZJHA 3L2IA 5L6UA 2EPKX 1CT5A 5K4ZA 2NUYA 2Z7GA 5DRCA 2QR6A 5TQLA 1IWPA 4KEMA 1DWHM 4IXXA 4CQBA 3NDZA 1HL2A 4GABA 3TR9A 1A5AA 3AZSA 3SUVA 4TX9A 3SEPA 3IVSA 5IXEA 3MSDA 3GRTA 1QW8A 4Z0SA 2YXGA 1WKYA 1JRCA 4JBRA 4AXKA 5H8UA 2EO7A 3HV8A 2BGSA 4DLMA 4N6EA 1ME8A 1JYVA 2EPNA 3UG3A 4WY0B 3ZT5A 2A1YA 3LM3A 4JTLA 1HJVA 3DK9A 3DHUA 1IZKA 4DXVA 1V08A 2YR1A 3C52A 4GZJA 2WCGA 4TIMA 2CW6A 2WM1A 4FXRA 3EXTA 2J25A 2VHLA 2OWXA 1EH9A 5HQLA 1XH2A 3BAXA 2E6DA 2PLKA 3KE0A 4K7ZA 5LA2A 2Q3OA 3BLIA 3CPUA 1OFQA 2L5HA 3W2MA 4Y8FA 3GBEA 3CQKA 1DXEA 4JN8A 3Q45A 4L4OA 4H9YA 5A69A 1RD6A 1WOBA 3W7RA 3WFAA 2ZZ2A 4GNKB 3B9EA 4Q8OA 2BV9A 4LB3A 3HA1A 3CUZA 3LHUA 4PEEA 1J0YA 1W5OA 2RHGA 3OO2A 2PRLA 4F0MA 2ZRXA 4DYKA 4LAKA 3MO4A 4H3DA 2GDVA 3VDGA 1FO4A 2VGGA 2YBTA 3N4EA 1VBHA 4H8UA 1GHSA 2V69A 3V0TA 2Z1VA 1XLLA 1W9VA 2WC4A 1W9UA 4EAYA 3LU2A 4ERGA 4PRRA 4LCRA 3QLDA 3L4WA 4E2OA 3G1HA 4AVFA 3DDMA 2WMIA 3NO3A 1Q1WA 5IBXC 4AEEA 2HE5A 2OEMA 3FJ4A 1CB7B 1RV8A 1VBUA 5FS8A 3MCNA 2O7QA 2D73A 2FFIA 4AMCA 3GNOA 3ABQA 1HT6A 3S2JA 4Q6JA 2QAEA 3W7KA 4GKTA 2WVUA 3EDKA 3P0WA 4ACYA 3VKKA 1ZALA 5CQ1A 1LOQA 1OF6A 2FGZA 3S8HA 4XD4A 3VAVA 2C3ZA 1NSJA 4JNYA 3KVJA 3FW6A 3NEHA 2QDHA 4QE4A 6TIMA 1M68A 1PZ3A 2NLYA 2W3ZA 3RPDA 2JF7A 1E40A 2DT1A 1J9YA 3KWXA 1PKNA 2VWTA 3ZR6A 1QPQA 4JTCA 3S5NA 4WDTA 3MBDA 3G8EA 1X1NA 2YJQA 4O0ZA 4UOQA 1N5WC 4N6FA 4S3KA 3WD2A 4ZENA 1AZ1A 1NPXA 1V59A 3C61A 4C6IA 7REQB 1VJIA 3REQB 5CBBA 5M2FX 4MPQA 3CASA 3M46A 4JTQA 1XLFA 1MO0A 1TV4A 5A1AA 2I17A 3AIEA 3W2KA 2XISA 1EBDA 4TTUA 4GBDA 4AX6A 1SO6A 4AC1X 1VB9A 4EM4A 4H7VA 4ILSA 5A6MA 2V5KA 1ZENA 4ZB0A 5DRIA 5C9ZA 5K9DA 5KSWA 4LYQA 4UWMA 3HFTA 3VD4A 1QU4A 3IIOA 4H4QA 4H9UA 3PZ9A 3VX1A 1F3EA 2WZTA 3MDUA 3VD5A 1FWGC 1KR1A 1ME9A 1X8CA 3NVZB 5I6SA 2POTA 4UTUA 2ZX9A 1SFJA 1R2SA 3BSGA 4RZ5A 4BF9A 1CECA 2ZVRA 3RO8A 3ERPA 4NT0A 2E9LA 2Z1XA 3APYA 1SFSA 3BLFA 5AKQA 5HWJA 3EMZA 1LLWA 3PPHA 2E68A 1AQFA 1OC6A 4KEZA 2W62A 2XVNA 3NQEA 3TXZA 1CI1A 3IJQA 1BVZA 4BF5A 2ZWZA 5EGRA 4IMDA 1JYWA 1PKLA 1UWIA 2FPTA 3PJTA 4A8IA 2V3DA 5EMKA 4Q4KA 1XPYA 4LF1A 5A8QA 5HMSA 5CPMA 3ZJ8A 2BNJA 1PDYA 3A7RA 1TPB1 2OO6A 2W63A 3QF0A 1RJQA 2CBUA 3WDPP 4XIAA 4F40A 1DV7A 4MFEA 2Z7KA 1VH7A 1REQA 1I0BA 3PZMA 1EA0A 1U22A 1XRTA 1OFPA 3WLOA 2HS6A 3WD1A 2PCQA 4FDCB 2C14A 3GXPA 3VGBA 4D8AA 3ITLA 1YE4A 1XM3A 4B3LA 1HJUA 2JALA 5DF0A 3WX7A 4D8ZA 2Y8VA 1UH4A 3D5HA 3INPA 3KS6A 1ITUA 2VXNA 1BWVA 3AYSA 1E0TA 3USBA 3WENA 4MKSA 3D47A 2GQ8A 4MYAA 4GD0A 3CYVA 3NYDA 1SGJA 2ZIDA 4I7WA 3SR7A 4JXCA 1X6NA 4US6A 3SGZA 5EFFA 3CZLA 3P60A 3GFYA 5AHLA 3D0CA 5HXMA 3I3DA 3BG5A 1V6WA 4BA0A 3WQ4A 1AJ0A 4X60A 1H5VA 3OC4A 4PMDA 2GGGA 4Q7NA 3FSTA 1F9CA 5BMXA 2XINA 2GZXA 3L5LA 1H7NA 3E2VA 2GJNA 3KTSA 3KOYA 4NU7A 3B8DA 2GK1A 2P50A 1Z7AA 1PXGA 3U0HA 1EP3A 5CPNA 2F5ZA 3MO7A 2QJNA 1GZ1A 4QISA 1EQCA 3ARYA 4LV9A 5JBDA 4Q8NA 3R7MA 1YHTA 5BXSA 2PP3A 3ZYZA 3OEXA 3WNNA 4S39A 1SZFA 4HOXA 1A5LC 1GEHA 4GYPC 2IQDA 2DQXA 3SDOA 4RDWA 3ZR4A 4NJKA 5F2IA 3B9NA 4AD2A 1XLHA 4Z1BA 2CBVA 3IK4A 4TMBA 1P0KA 8RUCA 2WHMA 4XUGA 3DOPA 1LORA 4LANA 3A3WA 4J2PA 1DWIM 2PLJA 1EGVA 4UR9A 3H24A 4JDYA 5IFPA 1FX6A 2AL2B 2R82A 1H7PA 3MUZ1 1JEHA 4GI4A 1XLIA 4MTVA 3AN1A 2CZVA 1VRXA 1H0GA 3C3UA 3MDWA 3C8FA 3L4UA 4RUBA 3W37A 3VCRA 3W1UA 2J24A 3CC1A 4M82A 4GVFA 2O0TA 4AZ6A 3OA5A 4WRHA 5HR6A 4B5NA 6PTDA 4M8UA 3PZOA 3DGRA 3E2QA 2E3TA 1PIGA 2VZVA 5G4WA 3CUGA 3SO7A 2QCEA 4PH6A 3OW1A 3WQFA 3ZS4A 4URIA 2E40A 1ZY8A 1FWDC 4NNCA 4L1XA 4NYUA 2BHZA 4AWSA 3L0KA 3DG7A 3U4FA 3N25A 3S5SA 3VIGA 2B31A 2Z24A 3DBNA 2BASA 3SN1A 5REQA 4UOJA 3ANVA 2X7VA 3NO1A 3VGEA 1XJBA 3VZXA 2H9AB 4A6GA 3G1DA 3F5LA 2PWVA 4UNKA 3D9XA 4LC6A 4XUYA 4PODA 4JZ5A 2QCGA 2XVPA 3FGCA 3DX5A 1J5SA 3QHNA 4H8HA 4CD6A 1ONFA 2NQHA 5CGMA 1J8VA 1FCBA 4IMFA 5I3JA 1FHVA 1EJTC 2C1IA 1N2VA 3STCA 3H12A 1QWKA 2WBKA 3VGGA 1TREA 1R5YA 3PB2A 2EPOA 3KTCA 2X0SA 5M1TA 2A4AA 4C6DA 1CTNA 2OZ3A 3AHXA 4IPNB 4LEFA 2PF8A 3M0VA 4DYEA 2P76A 3NEVA 1L6WA 2J4GA 4S3BA 4XTDA 2VD8A 1E3ZA 2WC3A 5CKSA 1W1PA 1FCVA 2I5GA 2XU2A 3BLEA 5TF0A 1XFBA 1BSIA 1IT8A 3V5CA 2DORA 2XTKA 3VGHA 3QFBA 3GYCA 4TXEA 3CUIA 3KTXA 5JCLA 3GXNA 5EBAA 3WK1A 4FNPA 2Q01A 3E2SA 4FIQA 4GX9A 2WQPA 1KRAC 2PDPA 3IARA 2FGBA 4G7EA 3WNPA 1EXBA 2E77A 4JIIX 1E4LA 3UESA 2HDJA 1XD1A 3SADA 1NU5A 1KXQA 2NVAA 2PSNA 4QR6A 3CYJA 3NTYA 4Z2HA 4GGHA 1KKRA 2CKRA 4FX7A 4JHOA 2REQA 2PGFA 1RBLA 3B9DA 2CLMA 3GTIA 4IMAA 5KTLA 1A3HA 2YCJA 3AUJA 3UNDA 3EPMA 4KCVA 4RNIA 1XYFA 1E6ZA 4O17A 3FYPA 3PZQA 5A6SA 1GETA 1HQTA 3UNTA 1ZAJA 1B30A 4GUJA 3ZFHA 1K1DA 4GH3A 2YXXA 4IGNA 4G1KA 3TZNA 1TQXA 5LA0A 2PD9A 2P53A 1VEPA 3JUGA 1N8FA 1R86A 3H54A 3GVRA 1S3HA 1V97A 1UUOA 3OIXA 4OT7A 5FJJA 5IFTA 2XSBA 1S5VA 1EDGA 5E0KA 1EZWA 1TRDA 2GSHA 3WYZA 4NY2A 4TV5A 4EPKA 4CNUA 1M6IA 3GDTA 4OUIA 1O5RA 2DUAA 2GSEA 3IUHA 1HKWA 2NUXA 3HPXA 3E0IA 1EYWA 3KLLA 5CC3A 1S2CA 1KN0A 5A3HA 1ZU8A 4L65A 1XC6A 4E6MA 3IGXA 1Y5WA 4AEOA 1FH8A 4REQA 4AYSA 3MI2A 2JIWA 3UERA 3LRMA 4E8CA 3LADA 4LY8A 4NF7A 3AICA 3NVYB 4HPXA 2I14A 1XDLA 4QG9A 1OYAA 2GJXB 1S38A 4Z1YA 4Q4PA 1L6FA 1E1CA 4ZBCA 3AXIA 2GQWA 3RYSA 4NZ5A 2W6RA 3CAWA 2CLEA 4BZYA 1WXJA 3ARRA 4ATWA 4J3UA 3OGSA 1GJPA 4N42A 3OVRA 2AQOA 4IH3A 5A5WA 1X6LA 3UJRA 1V3LA 3VMNA 3EX4A 1A5NC 3RLVA 3EWBX 3ARXA 3NQAA 1IEIA 3CUFA 2PDYA 4O1DA 3MI3A 3Q2DA 1WDWA 4PMZA 1QFEA 2FLIA 1C92A 2ISFA 4J56A 3B0XA 3MCOA 3ZQ9A 4HP5A 4C6QA 3PTQA 4PMNA 4D6CA 3H2EA 3R8HA 4HSOA 1SFLA 4AY1A 4EKJA 1H2IA 4W9TA 1UZ4A 4MPKA 3WBEA 4ACZB 3KHJA 2QF8A 3TSMA 3EDDA 2NQJA 1AD1A 1D3GA 5IBXA 6XIMA 2FH8A 2QNEA 4E8GA 3W1AA 5D2XA 2INZA 5A6KA 3ZSSA 3W7IA 4UTLA 3NO5A 4HYWA 1ZGDA 2P3EA 3KUMA 3GD4A 1UR2A 1E9LA 4LSBA 3VKJA 1UBSA 1W31A 4IISA 2QPXA 3ID7A 4DJFC 1GYNA 2V2HA 4HYRA 2J66A 3ARPA 5D2WA 3TIMA 1KBKA 1MUWA 3DGBA 3UXDA 5FS7A 4GYFA 2BHYA 4F2BA 3N9RA 5I3DA 1BF6A 2VFHA 2HSAA 4LYRA 5J5RA 4UQCA 2HPMA 2E5AA 1SW0A 2PDKA 3RGTA 4GCXA 3Q94A 3RK8A 4W8BA 2W66A 2NX3A 2CZ5A 1AJ2A 3OODA 1TWIA 4IG2B 5CLWA 5FF4A 3DENA 1R9ZA 3JS3A 4K2SA 3DCPA 1FQ0A 3NQVA 3KVLA 4KMQA 1VJZA 1CPUA 3KBNA 4AIUA 5BYWA 1Q6CA 2R24A 3EA1A 4LUTA 1GZGA 4HSHA 3NXFA 2G3IA 3A4JA 3KCOA 2VRKA 5GNZA 4HB7A 4N9BA 4Y96A 3M44A 4H6RA 5A6AA 3BJTA 1ZPTA 1W3IA 4TVWA 1J0IA 4AISA 4A3RA 3EOUA 5LNVA 2XVGA 1DWJM 3N9SA 3E5BA 4J3WA 5IHSA 3O07A 5C8BB 1WDQA 2RJGA 4X63A 1V7YA 1DIOA 5J8LA 3C3NA 1B9BA 5H1WA 2NSXA 5C2CA 1GJWA 2ADAA 4FLSA 3RITA 4ATDA 3CHVA 4EXQA 3RF9A 4LBUA 3HPFA 5EU9A 3SJNA 1IWBA 4LUJA 4PUMA 3KZSA 3AS2A 1DJWA 3KBMA 2FB2A 1JEZA 5KMYA 2BZNA 3DKLA 1W5MA 3F4WA 1UR4A 3VGDA 1VYRA 4IIDA 2AQVA 4AQLA 1XICA 3ZWSA 1Q85A 3AMZA 3N2XA 3Q67A 2CLOA 4OE7A 1TYPA 2CHNA 1YPIA 2GPTA 2FPYA 1OEPA 3TTSA 3CQJA 4MB1A 4BQ2A 4ZXOA 1EGZA 4JL2A 5JBEA 5CZ0A 2GWGA 2BG5A 4C6EA 3FEQA 3ABOA 3IS4A 3GC4A 1D8CA 4M19A 1TTPA 3WDHA 5EMLA 2PWUA 5AHEA 1RQEA 4KS0A 1JYNA 4RW5A 4LS2A 4B5TA 5DO8A 3AZRA 3TR2A 1JDEA 1EC9A 3FA4A 2VT0A 4GZ7A 1Q8AA 2V3FA 4YLWA 4NJGA 3W1TA 2RABA 1KQYA 2PWDA 3S42A 1M9HA 5BCAA 1PL9A 2ATMA 4RJEA 1YQZA 2C3DA 4M6UA 3WMSA 4FF7A 3MP5A 3NL6A 3W7DA 3TYBA 5FD0A 1ODUA 4MOZA 1H4PA 1XC4A 3NQFA 3AIRA 1DQXA 4Q8MA 3O16A 1E0VA 2EBNA 1SO4A 1WPCA 3TROA 4O1AA 3LCXA 2OYMA 2G3NA 1VFOA 1H7OA 3EDFA 1Z44A 2VNCA 2KZHA 1SPQA 3GNRA 3R11A 3WQ5A 1KRMA 2QQ6A 1CGTA 2WAGA 1W3NA 1JXJA 3U2OA 4OIFA 3OQ8A 4LAUA 1GV4A 4JYFA 5MKGB 3WH9A 4H4ZA 2VEGA 2C8NA 1UOKA 4EQSA 2NV1A 2E67A 4OJYA 1ZS2A 4KWWA 3W6YA 4LGXA 3RIKA 3FS2A 4NZ3A 1OG0A 5FSDC 4IJBA 2J27A 3JZEA 1K70A 1OVDA 4OECA 1KXVA 1S5NA 3WD0A 2VR2A 3GNPA 2QF7A 1HO1A 3WNLA 1GOOA 1DEDA 4J3SA 1UR9A 5ABHA 4C6PA 2V5BA 7ENLA 3RU8X 4AXNA 1BZLA 3CAKA 1ZMCA 1LDCA 1QRQA 3WFLA 5HMFA 5I0DA 3PG9A 3FA5A 4US5A 1NDVA 3BAJA 3UWYA 3ONCA 2EG8A 3URQA 3UVAA 5HJYA 2H3BA 1EL3A 2W91A 3E12A 4M52A 3L4TA 2HJPA 2WNZA 5IDZA 3C2OA 3QY8A 1RPKA 1R3YA 5AC6A 3B0VC 3DFSA 4QCEA 4O1BA 4I7UA 1MDLA 1XBYA 2XJ7A 3BLLA 1RLCL 3BVJA 1BRLB 1E9YB 2ZUVA 4NXSA 3WY1A 1OC5A 4EAMA 1K8XA 3TOYA 1JF6A 1M7JA 4GYPA 3DKJA 1C91A 1VCGA 2CHOA 2WMFA 1AW1A 3T78A 3V4BA 2WOQA 2RUSA 3RRXA 1E55A 1Q7MA 3IJIA 3ATZA 3UWUA 3W83A 2VDGA 1H41A 4A2SA 3O6DA 4XKYA 2YBVA 3R10A 4PCSA 1K7EA 2X50A 4GH1A 4QP0A 2QCDB 2BHUA 4ZQCA 3XIMA 1F3TA 3F5KA 3FHQA 4LW7A 1UD2A 3PWIA 2C7FA 3H22A 1FWCC 1NWUA 1XKYA 4YTTA 3QY7A 3IAPA 2PODA 2XIOA 4H2CA 4K39A 4B3ZA 2QVHA 1NP2A 3OZPA 3ITGA 1IQ8A 2BOEX 3WF2A 3W1NA 1GTHA 1JDFA 2PLMA 3G1YA 4DN1A 4QIUA 3HPSA 1MUMA 1VYSX 4ZTYA 1PEZA 1FKXA 3TN5A 1FFRA 3AIBA 1F6YA 2F6KA 4QSHA 3OQEA 1RK6A 1T8QA 3F4CA 1XFCA 3U2CA 3TONA 3M0JA 4HNVA 4JTFA 4FP1A 2PDJA 4D6JA 4CGTA 2NVCA 3EXSA 1EBGA 3WH7A 2VR4A 4E0CA 3ABRA 2C71A 1O4UA 2DVXA 1JROA 3JVAA 3M07A 2D22A 2J13A 5C9UA 1JULA 4U5IA 2OQYA 1QPKA 2PU1A 3PS7A 1UQZA 2YL8A 4G7FA 3UXLA 4EACA 3I7QA 3S2CA 1I6NA 3GHRA 2YCLA 2WZIA 3T08A 2QDGA 3W7JA 1JUKA 4C91A 4GYJA 3HM7A 5FF2A 4JTKA 4NZFA 2FIQA 3CO8A 2QUVA 3G1AA 3I10A 1YDNA 4WK9A 1TPWA 2WNQA 3LV6A 3M64A 4ADUA 3UXKA 1YTEA 2BOFX 3QSRA 1K8YA 4H2HA 1B3YA 3QJAA 4HA4A 2PLCA 3K4WA 1S2AA 1HJXA 3HGOA 1TE1A 3KZPA 2ZDSA 2ZXBA 4YL2A 1D7KA 3W82A 2W54A 2FVLA 3PZVA 2AKMA 1OX4A 4DHGA 3BV4A 1U5HA 1GERA 4F8XA 5I00A 4IP7A 3LGEA 4FZIA 3G1VA 3SRDA 4JFUA 5BXRA 2PWHA 3S4TA 1AJZA 4AUBA 3JW7A 2CBJA 4W85A 5CC5A 1W9BM 1UR8A 1XX1A 4A3UA 3W0KA 1TB3A 2GVEA 3R79A 3DI1A 2WNWA 4HPHA 1PTAA 4S3FA 3EPOA 4PFMA 2Z2UA 3IJDA 4W8LA 4DO4A 2FZDA 1MXSA 4JQ2A 4R5EA 1NQKA 2EG7A 1E51A 2RKXA 3QV9A 4NJHA 3W85A 3TN4A 2ZZ0A 3OOQA 4P8XA 3HJZA 3AZTA 4MJ2A 2YVGA 3VABA 2XH0A 3PAOA 5I7GA 3OB8A 4QFUA 3N17A 3TNBA 2P5NA 2PTXA 2ZX7A 5H91A 1D3CA 1HJQA 2BC0A 5B80A 3LM7A 4H1ZA 4HKPA 4XD5A 4XAZA 1XPGA 3BK0A 4Q8VA 2Y85A 4Z2LA 3KBSA 4W87A 3CIWA 3GTHA 5HBFA 1LQ0A 3U57A 3L0GA 1EJWC 1M5WA 3SUWA 3MUY1 3W1XA 2OZ0A 2PTYA 5I02A 3WJYA 1H5YA 3UF9A 1GPFA 3FIGA 1T99A 4J3VA 4FNRA 4IX0A 5H8PA 1YBQA 4NZ1A 1TPUA 3EA2A 3UPMA 3NNTA 5BNKA 3PUOA 4POCA 4YWSA 2VCBA 4H4VA 2FHFA 4PA8A 4GWEA 3MUAA 4UQ9A 1PYMA 2I16A 1LG2A 3G0SA 3S1XA 4GQQA 4YYCA 4EOUA 4B5SA 3PPGA 5A2BA 2QW5A 2GVYA 4AF0A 3NG3A 1M04A 4JQ3A 3F4NA 1VLWA 3IV8A 4XX6A 2HK1A 2WPBA 1LLOA 1A5UA 3MT1A 1NHPA 3KP1A 5EBUA 4OBSA 3TX9A 3RN6A 2OLHA 2ATSA 4NJIA 4XBKA 3LYEA 4HPJA 3QOMA 4Q4SA 4PTWA 3BGAA 4XTIA 3A4WA 3H70A 3IIXA 3TC7A 4UQAA 1BTMA 4X61A 1VPQA 2FDMA 4MWAA 2V2CA 2ZICA 5C55A 1L9WA 3HG2A 4YMZA 5FIPA 3LCGA 1HO4A 4WVXA 3LGGA 4WKHA 1XSIA 1W32A 3G24A 3PUEA 3VE9A 3QR3A 4ERIA 2WKJA 2VRQA 1JZ2A 2WJEA 4MKVA 2TAAA 3HBLA 5LA1A 2IQ0A 4AY7A 4CN1A 2PI6A 1G1YA 2UY2A 3HGJA 4JS3A 1XXXA 3V5OA 2CNCA 3TC6A 3GU2A 3CV7A 1YMYA 4PCFA 1GXFA 2CHRA 4FX9A 1GOKA 3MV11 5A6JA 4UFJA 5LGZA 1CX9A 5FEWA 4DM2A 1UYQA 4O8AA 1VBJA 2SFPA 1KV8A 1SW3A 1P0DA 1S2VA 3ARUA 3P5ZA 4J40A 4BF7A 4BQ4A 2GJRA 4L6DA 2R94A 1UWSA 2GDQA 3HMCA 5XIAA 1GVIA 3NSMA 4C5YA 3W1QA 4JQ4A 2Z0IA 4H4SA 1UZ1A 2ZX6A 2GJLA 3QY6A 2GQ9A 4G1NA 4IFOA 3V0SA 1DJXA 1MW2A 1FRBA 1NFPA 1CNVA 4DJFA 1HL9A 1P7TB 1E6RA 3RJXA 2VDHA 3MWAA 2XVLA 4DWSD 1JJKA 2XGIA 4R88A 3C0SA 2WLZA 1X8FA 5M03A 5FF0A 4I5RA 3L2LA 1V0MA 3WQVA 3UJEA 4IPPA 2PDMA 1PSCA 3GVGA 2AQWA 3A7AA 5A6BA 2IKJA 3UVIA 3ITTA 1X97A 1XR2A 2YLAA 4S3CA 4RDYA 3N1AA 5TD4A 2WSPA 1JG9A 2WKLA 5ABTA 5JVLA 1YEYA 2VEPA 4PUJA 4EPEC 4CUCA 3HW2A 3DGZA 3SZ8A 3B8SA 5JRBA 2A2IA 4WOQA 2DT0A 2EPMX 2WCAA 3V1HA 2O4MA 2UY3A 3M0MA 3S1UA 4AVNA 4HCLA 5FOOA 3IIVA 1B5TA 4FNTA 4BY3A 4DELA 1YNQA 3P74A 3CHEA 1DXFA 1OQFA 3KRSA 3L5MA 3DJGX 2XZ7A 1TKKA 2DQWA 1WDPA 2E4TA 4DF1A 4GY0A 1XINA 3FJNA 4K7VA 1HKIA 1PJ9A 2GRTA 2DZPA 3DESA 3HN3A 3UETA 3B9JB 3QYSA 3HV9A 1OIMA 4O13A 1OGSA 1H1NA 4NQ1A 4O28A 2Q8LA 2Y4SA 4B5WA 4MAZA 5I3KA 1UZHA 4IT1A 4XZLX 2YB4A 5DMYA 4K8DA 3WQOA 5FAJA 4BKNA 3WMLA 1XUZA 2OWCA 4J5NA 2QUNA 3MUIA 2P88A 4H7ZA 4OWGA 4WJ8A 3QQ0A 1DYSA 1MVYA 1JDCA 1R3SA 4I9JA 2E5CA 3KLKA 4IJRA 4YCOA 5CZKA 3VI2A 4Y9AA 4U33A 5D4YA 4AZGA 5AC4A 1RH9A 2W5FA 1H63A 4TX8A 5HUPA 1EGMA 2X16A 3WNOA 3L67A 2IS7A 4JOMA 1JD9A 3QC3A 2YPIA 3HGSA 4GHRA 2J3NA 8TIMA 3GC5A 3SUUA 1XYZA 3LGDA 3CV1A 1GOMA 3V1PA 4B2DA 4I5UA 3SN0A 1NDYA 4JIRA 2A3AA 2O55A 4MHBA 1XLGA 4GE8A 2D0HA 4QJ1A 1UJPA 4TR9A 3STFA 4PUWA 4DZIA 4I6KA 4NI3A 3A9IA 3VDBA 3M0YA 1D7YA 1I1XA 3TQKA 2QHAA 3TVAA 2O9PA 1HKKA 1FCQA 4NEWA 1GRBA 3URHA 8A3HA 5U4NA 6XIAA 5LNRA 2ABAA 2ON3A 1Y5XA 1JI1A 2DT3A 7A3HA 3WL0A 2Y2WA 3LN3A 1MO9A 3B06A 4CEXC 1E43A 3BXWA 1EYEA 3L0NA 1F4AA 3SCOA 3WUBA 3GC2A 5J5DA 3TAOA 1K4GA 1FIQB 4JHMA 2VFIA 4HMCA 3AS1A 3LG3A 3W29A 3NPWA 5K3VA 5G1YA 2WMIB 3LXBA 3HQ1A 1M41A 1KCXA 3P62A 2ZZ6A 4NJJA 1LRNA 2A6NA 3N11A 1R85A 2VO5A 1W9XA 1ZP4A 4JIHA 4K8HA 3VIJA 4DUXA 3NOEA 3OZOA 4C1NA 3EAUA 1ONEA 2VZOA 2YYTA 1XDJA 2NQZA 4F0SA 1LLZA 1HP5A 3CEPA 4YXGA 3PY2A 1UKOA 2GR1A 3MZNA 1C93A 3FKRA 5RUBA 3RUBL 4I9AA 3MKCA 5BRBA 5HJXA 3K1GA 4FNQA 3VDCA 1HN1A 2PD5A 4FXJA 2FHCA 4JL1A 2OXNA 3VMOA 3MP3A 2WWCA 4ZO7A 4DB7A 2PB1A 1YXCA 4AHQA 3B3DA 1VEOA 2JK6A 4NSBA 3OYZA 3P14A 2OTDA 4TVCA 1GOXA 5I3IA 1CLVA 3L5OA 3NVTA 3CGCA 3K5XA 3BURA 1TV7A 1ZB5A 1XG3A 5A8OA 4PRTA 3GVQA 3FXYA 5D04C 4LU0A 3WD3A 3HG5A 3TXVA 5DXXA 1BKSA 4F0RA 4JHZA 4GXMA 1XYBA 3RDKA 3MWCA 3MA8A 3LPFA 1FWFC 1ZAHA 3I7RA 2V3EA 3AIUA 1RD5A 1XRFA 1EIBA 2BWGA 4NXKA 1F05A 4HK5A 3ARZA 4TVUA 3FN9A 4PSPA 1OCJA 2IXUA 3N6HA 2D3NA 1UUMA 4JTSA 1RVGA 3BPWA 4A05A 3BSHA 1FWEC 2J47A 2PRMA 2XIIA 4NX0A 3TYCA 3E38A 3E5PA 3UG5A 2Z1WA 3T44A 2WBAA 4C6MA 2X41A 1FHDA 3WQWA 1H61A 1UPMB 4OHQA 4R3UA 3EOSA 4KERA 5JMUA 2J9ZA 1YNPA 4DJDD 4OTKA 4PB5A 2QCNA 3HF3A 5HQEA 3P3BA 3IJ8A 5LXXA 1LYXA 1YRRA 3ISIX 1VGAA 3K1DA 3F1QA 2XFWA 1E9ZB 4GACA 2R91A 3LD5A 1MZRA 2ZXAA 1LBFA 4CN6A 3OP2A 3T7VA 4Y9PA 3W7GA 1GRFA 3WEOA 1TPDA 4HMDA 4APNA 1S1RA 1G67A 1P0BA 4J4KA 3RO6A 2Q71A 3QH2A 4HU8A 1RALA 1FP8A 3R0KA 3HU7A 2OGJA 3AS0A 3S5YA 3R58A 4Z2JA 1M3UA 1EC7A 1F4HA 3MSYA 4XVEA 1ZCOA 3ZWTA 3W07A 1YKWA 1REQB 5D8ZA 4NEVA 3OVQA 2OOGA 4WR3A 2VELA 4HNLA 3A5VA 4K3ZA 1W8GA 1R3TA 5HWMA 1J4EA 3RILA 4DF2A 2C15A 5D8WA 3GWQA 3HG4A 3STEA 4CCCA 3AYTA 3GXTA 2G3MA 2WSKA 3QFWA 4HQVA 2NVKX 2H8XA 3H2MA 4H41A 3O15A 3L4ZA 4WKAA 2BB0A 2WMHA 4CU6A 3VVGA 2E8YA 4Z1DA 4GOAA 3H4WA 2YB1A 3CZEA 2EJ1A 2DZUA 2C91A 3CL8A 3BSMA 5A8MA 1YPFA 3N18A 3LSCA 3A3XA 3SIMA 5AZ0A 4HNTA 2XSXA 2OVLA 1A5KC 4RDVA 3WQEA 4D6GA 4PYSA 2YW3A 2QDEA 4IX2A 4YVVA 1BYAA 2WP6A 3GM8A 1XBXA 2PPGA 2YQUA 3FVDA 5GRTA 3BTNA 3WLKX 4X0VA 3EOLA 2GK1B 2PWFA 4OU1A 1N60C 1QATA 3VZZA 4HK6A 4FXFA 3SSZA 2RAGA 5HQMA 4JX6A 3VNDA 3CGBA 1Q4NX 1P6BA 2AKZA 5CG7A 3SBFA 3LLDA 3STPA 4WZHA 3WQDA 4UOZA 5M5DA 2V3AA 1DWFM 3GO2A 3CAVA 2AGTA 1HG3A 3N3MA 1EF3A 3VNIA 4L4PA 4QDWA 5BW6A 3NQBA 4DUWA 2OKTA 2B7NA 4R33A 1X39A 2WCSA 4DBWA 2W67A 3UT0A 1Y0EA 4K37A 3OBAA 1U5JA 2DVTA 4UZSA 1V0LA 3P82A 2VRJA 1DE6A 3EYPA 5U1OA 4JKMA 2ZXQA 3QFEA 9XIAA 2PWGA 2WHLA 5EL1A 3DHDA 3NURA 4Q33A 4Z2KA 1L6GA 3H7VA 2RGLA 4QDPA 3GD6A 2I56A 3TFXA 4HN4A 2WM0A 3BC9A 1O1ZA 4ADTA 4JDRA 1C8VA 1OGGA 4RE4A 2VI0A 1QK0A 2NV2A 4QBXA 3WDJA 3RCYA 3ECQA 2EHHA 2JE8A 4JNZA 4B4FA 1GPWA 4O4VA 4BJHA 5BU9A 1MFUA 1DIDA 2A85A 3NL2A 5IM51 4P7OA 4BI5A 1OFBA 3RMJA 1ZFJA 3FYYA 4FX6M 4MJ4A 1AZ2A 4DZHA 2ZRVA 4K8EA 1BVWA 5A2AA 3IUDA 3TTQA 2QMKA 1QHOA 3M7WA 4D72A 1FWAC 2BY1A 5D37A 2NUWA 1V5XA 3THUA 5D30A 1S3TC 2PA6A 3R2GA 5REQB 3QV6A 4DBEA 1DTNA 3LOTA 1GRAA 2CLFA 2A3LA 1TVNA 1RCXB 3I6RA 5C9XA 1MYRA 3CH9A 3QXBA 4XSLA 3FGCB 3E1F1 4Q32A 3WF4A 3UJ2A 2AAMA 2E0PA 1MXDA 4R85A 4CU8A 1WAWA 3EX2A 1WZAA 3H7UA 3URBA 3PC0A 2Z2BA 3A12A 1H3GA 3R43A 2WYSA 1JD7A 1POJA 2X0YA 3KL3A 4HK7A 1OZQA 4H4TA 4GFIA 3CS2A 3S9IA 3VKDA 2J62A 4ZOEA 4F2TA 3NSNA 2OELA 2YBUA 3UXIA 4QLLA 4UTJA 3DN5A 4J35A 2OLAA 3WLTA 1K9FA 1WA3A 3PUGA 4W7UA 3CGDA 3W71A 2BXVA 1XH1A 1UD8A 5ECUA 1B3VA 3QW4B 3A6OA 1PX3A 4KQNA 1WV2A 2GYIA 3EBVA 1GVRA 4HBKA 2X05A 1PDZA 3N34A 4DRSA 1JPKA 1GESA 3AMCA 3KEHA 3RR1A 2TRSA 1FH7A 4NIRA 3HB9A 1B0IA 3VPLA 1YTKA 5LZLA 2V68A 1UMYA 3PPFA 4QX4A 3FY1A 4TVYA 3G8RA 5HMEA 1FDZA 4RPQA 3VGFA 5DBTA 3EX3A 2ACSA 3MJMA 1UIOA 2NT1A 4PB3A 4JN7A 4PUKA 4UUIA 3VIKA 4B5VA 3TK7A 4AAJA 1GG0A 4U4MA 2NZLA 2HVNA 3TA6A 1NH6A 4MWAD 4LVFA 2NSOA 4CKQA 2C1HA 2CZDA 2ABBA 3AHVA 1W91A 3NPXA 2REQB 3T0CA 1RY0A 1E6XM 3KP0A 4JX4A 5DY2A 4FLQA 4HZ8A 1I0DA 2DIKA 1XQKA 1KFJA 1Q6RA 3M43A 3W2NA 3CQ0A 3HQOA 2JBMA 3GUGA 4A4AA 3S6TA 1XISA 1PYFA 3G3MA 3GDBA 4GUFA 1VJSA 1F7BA 1TJ0A 1VFFA 2BVDA 4A21A 4D2JA 2POZA 2WVSA 1RP8A 5CAKA 2Y7GA 2EAWA 3C2EA 4E4FA 4LF2A 1KM0A 4F9JA 4R53A 5HR7A 4GPNA 3T55A 4YNGA 1HUVA 1IYXA 3PBMA 2XWEA 3P93A 2D0FA 2BS9A 3LXDA 2YCKX 3CV2A 2VX7A 2R1NA 4L1WA 5IRPA 3SCSA 4DZ5A 1KM2A 1CBGA 2D2OA 5G4EA 5EMMA 1WO2A 1L8NA 1D8WA 1B4KA 2IKHA 3H2OA 4GC4A 2HEJA 3EX6A 3M16A 1TYGA 2QZRA 3KOXA 3LZ3A 4XG1A 3T42A 3WH6A 1WE5A 3R6IA 5DMNA 3GZAA 9XIMA 2J9YA 4UTWC 3MP4A 4REQB 1E0XA 1TWDA 5CBJA 4MIMA 4ZR8A 1FP9A 3S2MA 5AB3A 3B97A 2Q02A 3NJ3A 5FL0A 1TPH1 2DEPA 2VQUA 1LBLA 1UASA 3WLSA 2X42A 1OC7A 1FWNA 1TWWA 1PV8A 1WP6A 3IUIA 4HNUA 5PTDA 4IGMA 3CAQA 4QM1A 1NARA 2VUNA 1P0EA 1Z41A 1PUDA 1QI4A 1ZJIA 4F48A 3N3TA 1J5TA 3KHDA 2GWNA 4CQ8A 3BCDA 4DI9A 4WSHA 1N61C 4DY1A 5AHNA 2FDSA 3O0FA 5FJRA 3FG2P 2Y5EA 3QYQA 1LM1A 5LIYX 4HYVA 3EF6A 3M0ZA 5DMMA 3IANA 5AHMA 4ZMGA 1UKTA 1TR9A 2ISVA 5JUVA 1HP4A 1XLBA 1ISWA 1JXKA 3G0UA 3TQPA 2VOTA 3LI0A 1EB3A 2GJPA 1SSGA 2D23A 4UQBA 3RM4A 2OSXA 1QNPA 1A80A 1UP0A 1ZBKA 1W2PA 3A64A 4CNSA 1LWJA 4YTUA 1K03A 2I5IA 4NNAA 1J01A 1TSIA 4Q8WA 2QLYA 3U2EA 1GVEA 3ZVHA 3VM7A 2RDTA 3MHUA 3H6OA 4GUHA 3QMTA 4S2BA 3WO8A 3FYOA 4G6CA 3IGUA 4QAWA 1KO0A 3BG3A 4H83A 1R8LA 3CZJA 4LAMA 1HJWA 1Q3NA 3L9CA 5FI8A 4GA8A 4JTUA 4IFKB 4ZQMA 1EUAA 2DZTA 4HZ6A 1D9EA 5HNUA 1BD0A 3II4A 5F7UA 2DH2A 4BR1A 4MZ1A 1OHLA 1I2QA 2GSJA 2O56A 3OBKA 5D09A 1OFOA 3EB4A 1T7LA 1TV8A 1FDYA 4FNSA 1O7AA 4AMAA 1W1IE 4WD0A 2GH5A 3KRBA 4RK8A 3L65A 3IJLA 3SCWA 4B2DD 4NZCA 2OGYA 2YW4A 4QLJA 3GXIA 4LJ3A 5FJIA 2Q6ZA 5A8PA 3QW3A 4ECLA 4ZE4A 3GD3A 1DP0A 4LUTB 1XANA 3LQLA 1OINA 1WDSA 3WF3A 4W86A 5T8GA 4IUGA 2OX1A 1WB0A 4QAIA 4X0NA 4O53A 3VK5A 4HHHA 2Z4GA 2PCEA 4Q4OA 1W5PA 3DH9A 2GUYA 1C29A 1JIBA 3K8MA 4PFHA 4JTGA 2WJZA 4MY8A 1L2UA 2XN0A 3ZR5A 4YWOA 1PX4A 5LGXA 4PCPA 2WANA 3PG8A 4GKLA 2YDRA 3SRFA 1MFVA 1P6CA 4O0QA 1HW6A 2G3FA 4GJIA 5DCBA 4LVAA 1UUQA 1H6VA 4V1YA 2ZZ3A 4O10A 3JU2A 3LLFA 3CHFA 3MANA 1KLYA 4KBXA 1JZ5A 3FA3A 1K6AA 4UXDA 2VCAA 1XIMA 2CWNA 5CAHA 4F4RA 1GEUA 1SR9A 2O9RA 6TAAA 1E73M 3IWPA 3P81A 1TMHA 3VD3A 4A22A 4UBPC 1XSJA 4J3TA 2X0HA 2DIJA 3C0LA 1B54A 4FR1A 3I7SA 4JICA 4MDOA 4CCEA 1BQGA 3MUXA 4TV6A 3LHZA 4JY9A 5CC6A 1XF0A 5AZ1A 1GSNA 4CQ9A 1FHUA 5GVJA 4TTGA 2JKEA 1OYBA 1OG6A 4IQLA 2YXOA 1Z32X 2G5WA 2W0UA 4BFAA 1C8YA 1MEHA 1I2PA 4FX8A 3T8LA 4DBSA 1BAGA 1HVQA 4GO9A 1TG7A 4ZXLA 3EWXA 4QGCA 3AC0A 2PE4A 5KZEA 1UROA 3NDOA 3W2UA 1PTGA 1Q45A 4N7QA 4MGGA 3PF3A 4RNHA 1YXYA 1QAPA 2ZDRA 3N04A 4JPGA 1G4PA 2CFFA 1FA2A 3AQUA 3UWEA 1U1UA 3RR4A 2JEQA 1KA9F 1JDAA 3P7YA 4CEUC 3AO0A 1SQ7A 2J7CA 2H90A 4GQ0A 2QYGA 4UZUA 3U2ZA 5CSYA 1EXPA 2ONEA 1EO7A 4FF5A 3OHIA 1UD4A 1RBAA 1Q2SA 2PWEA 2CITA 3EOOA 4BK9A 3MZ2A 1FTXA 4M6QA 4DNHA 4ML9A 2RDXA 2EQ8A 2QPUA 4O54A 2XHYA 3VCCA 3BG9A 4H9MA 3LMYA 3CMJA 2H9AA 4WDUA 3AFBA 4W93A 1ONWA 2EEXA 5D9PA 1C3FA 2EPHA 2WC7A 1JFXA 2XIJA 3T40A 3TOPA 4P7NA 3TMQA 4YU1A 1B2YA 3CL7A 4J27A 1T0OA 3ITXA 1TO3A 1W3JA 4UIOA 4KETA 1XBVA 5D2VA 2EQ7A 2BBFA 5FS9A 4UCFA 3ITYA 1H2JA 3DFOA 1GQJA 3TQVA 1L6SA 3AUOA 2F61A 2V63A 3A3HA 2JGYA 4DWSC 3LZ5A 4XBJA 3USZA 4JY8A 4AZCB 5JCMA 1VIZA 1PTDA 1KTNA 1J11A 5IOBA 5E5CA 3S5OA 4MNKA 4LH8A 2ZZ5A 1LUCA 3VOGA 1LL7A 1VBRA 4F0KA 1DQUA 2A3HA 5KVHA 1ZBVA 1TTIA 1NOFA 4P8WA 4DIAA 1OCQA 3N13A 3ES8A 3UD6A 3W2LA 1KBIA 4XKYB 3ONBA 4MMWA 1W1B1 4O1EA 4UFLA 3PTKA 2PDXA 4UTTC 1V77A 2DSKA 3LX9A 1TJPA 3VIOA 4FK9A 2C79A 1N55A 4FSAA 3Q4DA 2PZ0A 1DQWA 3GFZA 1VRDA 2GOKA 5EKYA 4ZFMA 2YSWA 4J2MA 3HMJG 3CMFA 3WK3A 1FOBA 1XIJA 2OEKA 1KFBA 2AMXA 1H49A 3Q37A 6ALDA 3SAZA 4W84A 3F4VA 3DC0A 1EZ2A 2ODOA 1TA3A 4B91A 3C2VA 3W87A 1W3TA 1ZXIC 3LPOA 2E3ZA 3QSTA 1KM3A 1S39A 4OOZA 5CC7A 4H4XA 3TYZA 1TRIA 2XG9A 3O6YX 2OO0A 3BQ5A 2ZUTA 1US2A 3K13A 1D2KA 2XVKA 5CGQA 4YTSA 3TMLA 3HQPA 1IIGA 1TX0A 4IFRA 2OOFA 3LHTA 5KINA 1F6PA 1OWQA 3RNMA 3NYZA 3M5VA 5CXPA 3GH4A 3CPRA 2F8QA 3W72A 3NQ6A 4MADA 2W3SA 3XINA 1YQ2A 3IVUA 4LVBA 4B92A 3UW6A 4EWJA 1Z42A 1CDGA 3LERA 5E6YA 1LZOA 2XYLA 5HNTA 1OSEA 4IWWA 2YX0A 3CTTA 1J10A 1NOWA 4JTIA 4EMWA 1H51A 1NM9A 5A94A 2ISSA 2ZA2A 1G4EA 4IL2A 6REQA 3E0FA 4I9MA 1M03A 2WSYA 4UMAA 3AMLA 4A2RA 5BOOA 4CQCA 3UPBA 4QJ3B 3D3AA 4ONVA 3AOFA 1ISZA 3KFTA 3TWAA 4P61A 4C6FA 4LBRA 2CETA 1GK8A 5BWFA 9CGTA 2CESA 2DJLA 1K8ZA 1XIEA 3CUXA 2HROA 3PJWA 4B16A 2YDAA 3OG2A 2EJAA 2H8ZA 2XGZA 3QZAA 2G97A 4WJEA 1DWGM 1LCOA 3LS9A 4WOZA 1U1HA 2Y88A 1OX4B 3GVVA 4L7ZA 4UFKA 1QOXA 2P8BA 1RM6B 2IXVA 1ADSA 4UFMA 1KC7A 3K4AA 3W86A 3KCJA 3W27A 2YCEA 5G2IA 4NG3A 1TMLA 3TC3A 1U30A 1VFMA 4RE3A 5CEWA 1DNCA 2BY2A 4XAGA 4O18A 3TUUA 1X7FA 4XZBA 1W17A 4B9YA 1OD0A 2VCCA 2JK2A 4RXFA 1PX8A 4AIEA 2X1SA 3SQPA 4N9CA 1XLMA 4E3TA 5F4SA 3AXHA 4Y8EA 4Z2IA 1JZ3A 3CL6A 1JL8A 4YVPA 2BGNE 1KD0A 4X9YA 3ALFA 3FHAA 3HOJA 2TODA 4YCPA 2EKGA 2XM1A 4DI8A 2YAUA 1YDOA 3WLJA 3MBFA 1AQMA 4ROPA 3ZOAA 4DWDA 1A5OC 5DELA 4ACZA 4JD4A 5CPOA 5CPTA 3PFMA 5LSMA 1LF1A 1A4MA 1DOSA 3YPIA 4UC5A 3T6CA 2F6UA 4KWSA 1UA3A 1DVJA 5ECVA 3WIJA 3W4RA 1JOAA 1Q8JA 2V9DA 3DHFA 4OOUA 4FHAA 4AH7A 2DZBA 1BGGA 1ZJAA 3W7MA 3LB8A 3CT2A 1J0HA 4AFYA 1UPPA 1I4NA 3VYLA 4AF0B 2WB5A 4OVXA 3OZMA 4DJEC 3NL5A 3AI0A 3PK7A 1ZHAA 2BOGX 1F2JA 4P7LA 1LWIA 4L6OA 5EB8A 3C56A 4UTWA 4LWWA 2QIIA 1GVOA 4O8RA 3EXRA 5F4XA 3BLDA 2HE8A 1ZRQA 4WGHA 3OBEA 3TYAA 4L64A 2WKGA 3S47A 3EX1A 1H09A 2PC4A 1PAMA 3S1GA 2ZXDA 5CLTA 5CSRA 3N19B 1NY1A 3L66A 3T05A 1WXZA 5JBFA 4ICNA 1UW9A 3OJGA 2DPEA 2GOUA 6A3HA 4ORIA 3LHYA 5CJNA 1OIFA 3DBPA 3HO8A 3DXIA 3R0UA 1T3QC 3PJXA 3PTDA 2CERA 2GFTA 3E3HA 3NR0A 3V0UA 3A22A 1Q6QA 4V27A 3AHZA 4J28A 3WJXA 3S1VA 3QKZA 1FDJA 4UR7A 2Y89A 3PUDA 4FPSA 1E56A 3ETRB 3HRDC 4DJDC 3ORWA 4JNMA 3VNKA 3MYOA 2X2GA 5C2GA 4PTNA 4AW7A 4WF7A 1OY0A 4D6DA 3W28A 5G2HA 5KEZA 1K8CA 2FZNA 3FK4A 1W1TA 5DT5A 2PDWA 3QMSA 1KFEA 3KRUA 4LCQA 2J75A 5G1TA 1WDDA 3ZM8A 2DVUA 1IT7A 2E28A 1XL9A 3N14A 3GDLA 3M5YA 4Z42C 1WX0A 4S38A 4LT9A 3BCFA 2JGQA 3KOFA 3VC5A 3GXFA 3GSMA 1SZGA 1V93A 1YTDA 2XH4A 1JRPA 3BQ6A 5C5YA 2PDCA 1ZSXA 3L5AA 1QI0A 1TJ2A 1TV3A 3DG3A 3T0TA 3U5YA 5I3GA 4P5UA 4GX8A 5DQPA 1EJRC 3SECA 3W9ZA 2OSYA 1J6PA 1KNWA 1HX0A 2J9XA 1DJNA 5H6HA 1G5AA 1AL7A 3K2GA 1VEMA 5AC7A 1L0PA 5H8MA 4H9TA 4JKKA 1JCJA 2JKPA 4OV4A 4DUVA 4HT3A 2JEPA 2YIHA 1FXQA 1J0ZA 2FVKA 5FL1A 1TMQA 1TV5A 2RFGA 3WJZA 2Q09A 1SO3A 3U48A 2D20A 3LXCA 4PULA 4DAFA 4Q3MA 1ICPA 1QNQA 4GYKA 2P10A 3ANYA 3LA4A 1IXOA 3PN8A 1CGYA 4PTXA 3U8GA 1JZ8A 2G41A 2PC8A 4O1FA 2DV0A 3W00A 3W1RA 5JU6A 4UTMA 4DEFA 1Y8BA 4IGSA 2HVMA 5CPQA 3W1LA 5E0FA 4IHCA 3DK8A 3RCMA 3FAWA 3IJ7A 1KR0A 5C7HA 2QJJA 1SJCA 1ICSA 2C1GA 2Y6ZA 1ITXA 3LPPA 1XCFA 1U33A 2YZRA 3D46A 1VBGA 3L2MA 3I4EA 5FCZA 1J79A 1HNYA 4J7RA 3UP8A 4O4WA 1O68A 2FJKA 1UJQA 4R9XA 1JCMP 4LXFA 2W3RA 5I03A 3MMDA 1QW9A 2WOVA 4PUDA 3C6CA 2VMFA 4YS1A 1UWUA 3ZJ7A 3BANA 2CWXA 4H9VA 4PSRA 3T1GA 1Q63A 1I75A 3AISA 3DI0A 1FXPA 2VR5A 4X9SA 3Q58A 3IVTA 5T26A 2FYMA 3G0XA 4HZ7A 4EQXA 3MSRA 1JQXA 1FUYA 3KBVA 1W1ZA 3TP4A 4EVZA 3DFYA 1ZY9A 3B8IA 4HSNA 4E3VA 3QPZA 3SCNA 4CNOA 3SW6A 4RE2A 5HDRA 1BWLA 5HOSA 4FMVA 3LRLA 3WDRA 1DORA 3WUGA 2CU0A 3QGKC 1WQ5A 1DJYA 3NQ2A 3BZJA 3AYVA 3RX3A 4AD5A 3NFUA 4IL0A 3PZNA 1KQZA 1W9DM 4E2DA 5BXTA 3G5EA 4KIRA 3JZUA 3J7HA 1IR2A 4I6VA 4XZMX 2ZUSA 1HL8A 1M6JA 3LLXA 1H7XA 1IGWA 1V3JA 4I8YA 5LIUX 3ZVIA 1B90A 4Y7EA 4Q8PA 2W61A 4ZODA 1ZLPA 4K36A 3B8TA 4K6AA 1XP3A 4WHBA 4GI6A 2EQ6A 2RGMA 2Q3RA 4IF2A 1Z48A 4XAYA 2R8WA 5AYZA 3WEMA 3AXXA 3QC0A 1Q4WA 4GIEA 2CLHA 4ZSUA 3ITVA 1UMLA 3VOJA 1R7OA 3DIPA 3WLNA 2DZAA 3P61A 1YYAA 1EX5A 4NHVA 3AHTA 3ZO9A 3SN4A 2F2KA 3BL3A 4PUEA 2VENA 4FEZA 1F3PA 1P1XA 3N2CA 3QZEA 4JTAA 4IZGA 2Y0FA 2OQLA 1AVAA 1IXNA 1V7AA 1TCDA 2PGWA 3LNPA 1DXLA 4W7VA 5FMHA 3PBVA 1FWRA 3DU0A 3T09A 1CXIA 3VILA 4DX3A 3UG4A 4H9ZA 4F0HA 3M5ZA 3VOFA 9RUBA 3VXGA 3EWWA 1QW7A 4ALDA 3W7NA 3HJEA 4DWSA 3GU9A 2YDQA 2WZEA 2VFFA 3PANA 2V8ZA 1W5NA 4GJJA 4LC8A 1GQNA 3HZ3A 4BEUA 1UCWA 3GLCA 3T81A 4N4QA 4PEKA 1V6UA 1TCMA 1Q2RA 1CEOA 5E93A 4Z08A 5C9WA 3UPWA 2ACRA 4UTTA 3EMQA 4E2BA 4C6BA 3FJLA 2FZBA 4PB4A 2ZA1A 3UFYA 1BYCA 3KS5A 4WXZA 5EMYA 4MWAC 3IJ9A 3M7SA 4MB4A 4U2ZA 4H4IA 1JCXA 1XDMA 2TPRA 4R27A 1B4EA 1OT2A 1XLDA 5G1MA 1BYBA 3VKCA 5T91A 3BCJA 3AIWA 4PMUA 3AU6A 1C8XA 4DBDA 4CNNA 4S1FA 3PFRA 4NAFB 2X30A 5HMDA 2TMDA 2V3BA 4JYDA 4QTGA 2XUCA 4YHGA 4F0LA 2DH3A 3U9IA 1AODA 4JAWA 2RJHA 3M0LA 2G4FA 1BVNP 1J6OA 1DJHA 1X6UA 3W76A 4OBRA 4UMCA 1E6QM 4AWEA 1NDWA 3LB0A 3O9NA 4MJZA 4BWLC 2GQAA 3G77A 2YGYA 3DGHA 3UR2A 3GU1A 3QQ1A 4JQ1A 4L9ZA 1YPXA 4ZCWA 3G22A 3RNDA 4R34A 2E6FA 3GB6A 3MI6A 4UTHA 1FWSA 2AL1A 2D24A 2PGEA 4IQJA 1H50A 1S2TA 3AMDA 4TMCA 2ZUNA 1YXDA 2ALRA 4GJ1A 3DFNA 3R8GA 4FI4A 1JZ4A 5C70A 1JNDA 3EPNA 2A3EA 3VIMA 3A21A 4IXHA 4NX5A 1WUEA 4L1GA 5CZTA 3RRAA 3N15A 1P0NA 2ACUA 3KVMA 3S46A 3RU6A 1KBJA 1RAKA 4I8DA 3P67A 4S3GA 3TW9A 4C1LA 4DO7A 1PZ1A 4OZOA 3FDGA 4K1WA 4EM3A 3WUFA 7ODCA 5D38A 3ZJKA 1B3ZA 1DJGA 4UTKA 1TVLA 4IP4A 2VVSA 4I3GA 1GCYA 5DT7A 4DQWA 1E6SM 3IGHX 2VGBA 1BEUA 3GHSA 3VDHA 2E5DA 1BHGA 3W02A 3V36A 4UNLA 1RXOB 3MTWA 2WV8A 4GFSA 1TJ1A 2A7NA 1IF2A 2OJPA 1T41A 1Q7ZA 1VC4A 2VOMA 3B8UA 2GUUA 3UWQA 4AD0A 1ONRA 2Y5JA 1KM6A 3EWDA 3URAA 1A50A 4NUWA 4WSKA 3TA9A 1SW7A 2P8CA 3U7VA 3EGJA 1TTJA 8XIMA 3QM3A 4ZFCA 3PZTA 3KX6A 4OKDA 2NWSA 4EQRA 1OX5A 3MY9A 1R7AA 1QPNA 1ME7A 3C2FA 4A29A 2P1FA 3TLQA 4LUSA 1UR3M 2FH6A 4K38A 4PBFA 3L21A 3WUEA 4KWOA 3SJ3A 5CPSA 5LKYA 4JEQA 4UR8A 3U4AA 4HNCA 4UB9A 2X09A 3GW0A 2W55A 1E6NA 1IEWA 4L5ZA 2WSQA 4IIHA 2F38A 4GISA 1NHRA 1QR7A 3DH7A 4M5PA 1LPFA 3NVWB 6CGTA 1WNOA 2OZTA 5I77A 3R1ZA 2ASHA 4XK2A 3K8KA 2I1OA 3TCSA 5M17A 3F7JA 3M0XA 4RV8A 2X1TA 3ES7A 1Q6FA 1JZ6A 2FGLA 4X22A 4L6HA 3H4GA 3GRSA 1HXJA 4IQDA 1RUSA 2OEJA 3OGVA 3O05A 3MU7A 4EXBA 4HOZA 1Y5VA 1G94A 4LVDA 1NJJA 1ODZA 1JGIA 2ZZ1A 1AW5A 3DZ1A 3IACA 4U3AA 1O5KA 3FX4A 3Q65A 1UR0A 4ZOBA 1G4SA 4DJEA 5CG0A 3SGGA 2F7FA 1UB3A 3W7EA 3N4AA 4ZE5A 2OQHA 1GREA 2Q8ZA 1GKQA 1YW1A 1Z9AA 2G0WA 4Y90A 1DBTA 4OUEA 4W88A 4GMEA 4EK7A 3EWCA 2A7RA 2PFHA 3DECA 3S2NA 2OSWA 2NXIA 3QR1A 3T2OA 2BFGA 2OT1A 3THQA 5DEZA 2E9MA 4A3QA 4K7YA 4QRNA 4LVGA 1V3KA 2QJHA 3ARTA 3OGRA 1XD0A 5AECA 1VD6A 1W3HA 1RQHA 3LSBA 1X2GA 5BU6A 1ENUA 1XRSA 2WXDM 2GGIA 1SVDA 3G1RA 2ZOXA 2QIWA 3WQPA 3STGA 3WLLA 4KRZA 4H8NA 4MJMA 1MW1A 3DFHA 1EJXC 3N6QA 3RLHA 1LL4A 5U7SA 3UJFA 1AMKA 3OVPA 3T9PA 4JTEA 1MRQA 1ITCA 1UBPC 4R9OA 1IR1A 4DJDA 4B90A 3W25A 1ISYA 1QPRA 2PBOA 4CQAA 5C7VA 5AVNA 1NEYA 3CH0A 1EHAA 1RLDA 2B7PA 3SFWA 3MS8A 2EQ9A 3MPGA 3JRKA 3G2GA 4XD3A 3PBWA 1A53A 4KPRA 4D6FA 2ZBTA 3LRKA 3QBUA 4Q7IA 3C0QA 1F8IA 4DNMA 1DPMA 1ISVA 3ANUA 3DFTA 5FEZA 1QBBA 2Y62A 1T40A 3GS6A 2E1DA 1WKFA 1VCFA 4LFYA 3S83A 4XKMA 4KESA 2QEZA 2DUXA 3ABXA 4F66A 4ADSA 5D2YA 1UP2A 3A4AA 2GGEA 2WPEA 3F4DA 1O5QA 5AY7A 1TYTA 3UCCA 1V6XA 3C4UA 3SR6B 3KRZA 3CXBA 3RX2A 3VNJA 1DTUA 2BP1A 1VQZA 2IPWA 1UIPA 3N2MA 1WOAA 1OZMA 4Y9OA 2PTDA 2E5BA 3SUSA 1L6YA 2QVNA 4MVAA 4OBTA 4O15A 4GZIA 2G95A 3PZIA 3AIQA 1G0CA 3RCNA 4QNWA 1R3VA 1R9XA 1Q6EA 2XZ9A 1K4HA 4NRSA 2J7DA 1CB2A 2ZYFA 3W1MA 5F1UA 4N9DA 1A3XA 2HXTA 4BI7A 1ZCCA 4KCWA 2GVLA 1EJ7L 4D6IA 3MHFA 1KTCA 1ITQA 1D3HA 2HTMA 5LHEA 5AYIA 4GVIA 5E1QA 1B1YA 4NKCA 2ESCA 2UV8G 1E15A 2VX6A 3L8KA 4AVOA 1TPEA 1WAUA 2D0GA 1IGSA 1GTEA 3IV3A 1DJQA 1QI5A 2VWSA 4NYYA 3GR7A 2DZSA 4Q4QA 1G7UA 1U1JA 1BXBA 4O14A 3W2JA 4PR4A 1XHCA 1GONA 3SQMA 1LRQA 1NF7A 5FF7A 1JUEA 3W6LA 2PS2A 2VC6A 2DSUA 4PTMA 3S5ZA 3W6MA 1YIXA 1JZ7A 1K6WA 4KWVA 3BW4A 3G6MA 2VVNA 2PUZA 5BRQA 4V2XA 2FJUB 2VGFA 1EO5A 2VEKA 4AD1A 2Y8KA 1W2VA 3LUTA 4O1CA 2IKIA 2PU0A 4FAMA 4XV0A 3N73A 4G8TA 3QMRA 3GIQA 4RL3A 2FZ9A 4X2PA 4L4MA 2QV4A 1F61A 4CVWA 5CBIA 4FB7A 4XO6A 4GINA 4LRSA 4HHPA 1AFSA 1HZYA 4PL1A 1YE6A 3GXMA 5M3WA 4O57A 3NAVA 1K02A 1J93A 4JR5A 1OF8A 2OCZA 1QHZA 2BX7A 2ZE0A 3DYPA 2VKZG 2WMJA 4RR4A 5E09A 3THCA 4EE9A 1EP2A 4L80A 4GBUA 1GOQA 2J8GA 4XZNX 1MW0A 1MW3A 3SUTA 4JIEA 4W5UA 3C2RA 1GG1A 3SFKA 1NFGA 3CUJA 4AYGA 5LIWX 4RE0A 3B40A 1KV5A 3LCIA 3CB8A 3T2QA 4S3AA 3MB9A 1EP1A 2FHBA 1PB0A 2Q8XA 4MKNA 1J0JA 3E49A 2ZZBA 1XLCA 1Z8AA 1FWBC 2DSZA 5E9AA 1AA1B 3FJ6A 5TAOA 4TX6A 3CIVA 1AH4A 2CXEA 2PDIA 2UZ9A 1WDRA 1OYCA 1Z3NA 1NWSA 1PZ2A 5A8GA 3M41A 4M6VA 4JGDA 1KM5A 3ZVHB 1BG9A 3ARQA 1Q1RA 4GK8A 3WK0A 2YOCA 4P7RA 1IXQA 5U25A 2ZRWA 1EIXA 3NPUA 3OU8A 4MY1A 1T6MA 4IIEA 3RLGA 2ZRZA 3BO9A 3E74A 1AG1O 1UWAA 4Q8UA 1E6PA 4S23A 1C9DA 1HTIA 5FJPA 3VC6A 3H23A 4ZZ9A 1OX6A 2QKFA 1UC5A 3NL3A 1CWYA 1QMLA 1KTBA 4UQDA 2PAJA 4L9YA 5DY3A 3ALGA 1JI2A 4GXWA 2DW6A 1KW1A 2H3DA 3QPEA 3SCQA 1ZL1A 2XIMA 3COTA 3PG6A 2XH7A 2QJGA 1OCNA 2C3CA 2Y7EA 4AD3A 3AIVA 1JAKA 1R9YA 1P5BA 5C9RA 4QNEA 2I7GA 5ABFA 1BQCA 1SFTA 1A5CA 1Z69A 4QS6A 3CZ8A 1F8WA 3JR2A 3RLUA 4R7JA 2X40A 5I06A 4B3KA 2VX5A 2OT0A 3R25A 3NZQA 3VCNA 4JCLA 2TSYA 4DUOA 2WMKA 3PZUA 2GVGA 4XZHA 1QOPA 1RK5A 3AJ7A 2V6AA 1A3WA 5FKYA 4QJ5B 3NA8A 3LPGA 4HZMA 3DYOA 3P80A 4LCSA 4UQEA 3CWHA 4F9DA 3KXQA 1US3A 5BZAA 2A8XA 1AUSL 3DAQA 2JIEA 2PP0A 2QCHA 1IEXA 2OR2A 2CIPA 3SY8A 2I9UA 3TYDA 1CIUA 5HA7A 5JXQA 5CSUA 3OLGA 1SSDA 4I7VA 5LYRA 4NAEA 3I6TA 4B5UA 5G5IA 4JTHA 4P7QA 3WF0A 2ALDA 5F2LA 5AVHA 2CKSA 3SM0A 3TV8A 4EMIA 3GAYA 3NZRA 3HG3A 4RDZA 2BSLA 3LY0A 2HNHA 2PTWA 3AWOA 3I3BA 1KWGA 4BWLA 1EFZA 2J6XA 3QKEA 5HAOA 1DIKA 3QN3A 1IXPA 4DBUA 4CLMA 3TE9A 2BY0A 3O6CA 3AM9A 4JIQA 3GKFA 2NPXA 1TUXA 3U6WA 1UC4A 5CSSA 5CZSA 4IP5A 4NP7A 3OHMB 1NP0A 2A5HA 2YA2A 4XISA 4BV6A 3WN6A 5FEXA 1IV8A 4MY9A 3WQ6A 3CM4A 3TWBA 3C2YA 3SY1A 4PE8A 1MUCA 1S5TA 1JVNA 4ZQPA 1ZK7A 4HCDA 4JQAA 1SMDA 1CLKA 3CXOA 4Z1CA 1SJBA 5GNYA 4J57A 2G4JA 1UWRA 4LQ1A 2CXGA 3FVMA 3QPYA 2R9ZA 2HQMA 3GUWA 1EPVA 1PWLA 1UH2A 4ZTXA 3N2BA 3WELA 5K9XA 4IIGA 4EF8A 3WCZA 3MVTA 3WQ8A 3ABSA 4XZ9A 2VC9A 1NQ6A 5C0QA 3UZYA 4WKFA 4P8UA 3E9AA 2A0NA 3C0JA 1ZX9A 3TSDA 1O6IA 2ZC8A 3G1SA 2VC7A 3VTRA 3W74A 1RZMA 4ML4A 2JKAA 3GHUA 1O66A 1CZ1A 2FMNA 4PCNA 3OLDA 4AHPA 3TFCA 2WPGA 4YVXA 1E0UA 1OFAA 5BXPA 4N9EA 4HMNA 1O94A 2V5JA 5I5RA 5JCIA 3B4UA 1R46A 3T0DA 3EZ4A 1SUXA 2ISDA 1GKPA 2J88A 3E96A 4WQ6A 1RCQA 3WBWA 4AD4A 4HU0A 3UA4A 4WGXA 1G4TA 1RQBA 2QV5A 1XI3A 4OGZA 2GQ3A 5CJ5A 4E4PA 4F2UA 4HA1A 3QRHA 3BGGA 2WVVA 2V5CA 2V5LA 4QS5A 4IICA 4YTQA 3LHVA 1ADDA 3II1A 3UBPC 1P48A 1GNXA 3ARWA 1EF2A 4HA3A 4CQDA 3T4CA 3W26A 4AZIA 3LCFA 3UY7A 4WIWA 3CT7A 1IEVA 1GOWA 3EEGA 4LUYA 4RZBA 2BXZA 2E9BA 2D2HA 5C2XA 2ZA3A 1A0DA 5AOUA 2ANUA 5JIPA 1LUCB 4O19A 3LENA 2VC5A 2CLIA 1BXNA 4EQWA 2YZ5A 2XN2A 3SCRA 3ELFA 1GRHA 2OB3A 1IIHA 1YX1A 3M47A 3BV7A 2WJFA 2RDWA 1XYAA 3TDFA 1RA0A 4MZYA 2WNNA 3IEBA 1QHPA 4KCUA 4YIWA 1WKDA 3KL0A 2J7BA 4A8LA 4P8VA 5AYXA 1T96A 3WF1A 3UWVA 1ML1A 4JFVA 4C6KA 4DO6A 2GGJA 1BTCA 3PB0A 1KGUA 3A47A 4XAPA 1NELA 2DW7A 4CD7A 3PNUA 1MQQA 4GZEA 4MUPA 1AMYA 1TA3B 1W9PA 4ES4A 4QEEA 4IJCA 4H4RA 1XIDA 4C60A 2QAFA 7TIMA 2E25A 1KRCC 1AQHA 3AROA 4Y9NA 3O06A 1A4LA 3TJXA 1PHQA 1PZ0A 3FFSA 3UA3A 2ZUWA 3BMXA 3PTMA 4D6HA 1VPXA 2YFOA 3T0BA 2VEMA 2F84A 3ZT6A 4PBEA 4KRTA 5GJMA 1FVPA 2X8CA 4WUIA 1NFBA 2NLIA 3OYXA 4FA3A 3W22A 3KVKA 2F2HA 4R7OA 5TR3A 3CBWA 2WVTA 4WXYA 3BICA 2Z6JA 4AWUA 1EEXA 3IPWA 4IMCA 4D71A 1KFKA 4QG6A 1XLJA 2A3CA 4BHYA 2GGHA 1F5ZA 1NAL1 3WKZA 5FA5A 1QT1A 4H4WA 2ZRYA 5D9NA 1HF6A 6REQB 3O7UA 4AZ5A 1R2RA 3CGTA 3UEQA 4B15A 1GQKA 1JCTA 1FWWA 3GE7A 1VIWA 4BEQA 1K7FA 1PPIA 1B3OA 3DFQA 3EOEA 3SQLA 4Q6XA 1M1BA 3UGVA 4GUGA 4GR1A 1JDDA 3CPGA 3PM6A 3GR4A 3N12A 2PEVA 3UWZA 4JKLA 1EOMA 1YDYA 4MYXA 3E02A 4KPLA 1QBAA 3WMCA 3OLEA 4FNUA 1V6VA 3FLUA 3POHA 2G8ZA 5I2UA 1GGOA 4DJED 1PKMA 2DUZA 4AU0A 1EOKA 3B9OA 3LV5A 1EEPA 4XSMA 1CLXA 4C90A 4IPLA 5K4XA 2DZXA 1R38A 3G3DA 3GX9A 3UZ5A 1ZNNA 5CCZA 2J6VA 2QCMA 3CHDA 3EKZA 1V51A 5K7JA 3RAOA 3QVQA 2QJMA 2FB3A 4IM4A 4XBSA 2C13A 4E4UA 5BRPA 2W4XA 3P8IA 3LCLA 1KLZA 4EPBC 3OPSA 2HWGA 1G69A 3UWWA 4H6KA 4CVUA 1O1HA 5DXYA 1MNZA 2HXUA 4PCTA 3UY8A 2CZFA 2W92A 3SRKA 4WY0F 1KM4A 3TEVA 2AOSA 3PBUA 4FLOA 1HJSA 1RR2A 1CENA 1EBHA 1K3UA 2X1UA 3W7PA 4NRRA 1RJRA 1I2OA 3QGAC 1SZEA 3W75A 2IW0A 1W1YA 5BROA 5AYBA 1UHVA 3GDMA 4PMJA 1YNYA 3URNA 4JTRA 4L56A 1V8EA 4PN2A 3OZYA 2Z26A 1VFLA 2QGHA 2I57A 4GRTA 2V81A 2QPSA 3KOWA 1KGWA 1R0MA 1H0IA 2BVWA 3LTSA 3FKKA 4QITA 4X2RA 3MJYA 4D8LA 1UKPA 1HKJA 1SZRA 3BLKA 4IFKA 1IWAA 3EB3A 1V02A 3RJYA 4EANA 1MOKA 5H2ZA 2OG9A 2X1IA 4HU4A 2A6LA 4C6CA 2J7EA 1ZP3A 4KFNA 1PWMA 3NGFA 3AALA 3WFZA 1GVQA 1V6TA 3V5FA 4A3YA 1XKJA 5LXEA 2WO5A 1QTWA 1US0A 2NT0A 3T0AA 4EXAA 1ECQA 4WSJA 4XZWA 2CDUA 5I3FA 3BAKA 1TV2A 4KGJA 1VKFA 4LAOA 4Y2WA 1RHCA 4XAFA 3IC9A 2Y1HA 1UD5A 3MVIA 5TIMA 3I68A 3QQWA 3BW3A 5I09A 1KM1A 3V16A 5KZDA 3U3HA 4ROQA 3VM5A 2IMRA 1GW1A 4Y6GA 2OX4A 2FZMA 2EG6A 4P2VA 1WYGA 1EJUC 3GY1A 3CHCA 4H4PA 4XB3A 1CGWA 5FJOA 1A5SA 4MNJA 3A7UA 3NVVB 3L68A 3WBYA 5CGTA 2XFRA 5E0CA 4WEVX 3W7CA 4HHLA 4MAVA 2XDFA 4LY4A 1NDZA 5DCEA 1TIMA 1Y7VA 3E0VA 4EPDC 2CPUA 3B03A 1J96A 3SB0A 4B9ZA 1H11A 2KX9A 5EY5A 2IKGA 3ATYA 5E6ZA 3FAXA 5I07A 1JCYA 3WBAA 3VX0A 3A24A 4AZ7A 4MNLA 1H62A 3VIHA 5JIWA 2WMGA 2OU4A 4RLIA 4UNIA 2E09A 1STZA 1TELA 2YA1A 2INEA 1MZHA 2OYLA 1F76A 3O63A 3MSGA 4EIVA 2FTWA 5C54A 1GVYA </