4JN8A

Crystal structure of an enolase (putative galactarate dehydratase, target efi-500740) from agrobacterium radiobacter, bound sulfate, no metal ion, ordered active site
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
395
structure length
395
Chain Sequence
MKIDRMRVFMTRDKDRPRVIVALDTDDGLTGWGECYNHGPDKALPPILDYLYGFLSGQDPTRIDYLVNLLIQQSRFPPGALGLSAISALDHCLWDLSAKAANVPVYKLLGGAVRDRVKVYAGVYTAPDAPAARDEFDRLNAEWGFTAFKLSPWRVDIHAHRWGNVVKASADYFRSLRETVRDDYEIAFDAHAQIFEPVAARQLGNALAPYDPLFYEEPLRPENIDMWGDLKQGLNCVLATGESLYNRNEFLRLLQVKGADLIQPDICVVGGISEMRRIATLAEAYFVGVAPHNPMGPLATAVNVHFSAATQNFRILEYRLPKGQAYVYGGKDIEKRQGETRYVVDPYLPKDGYLELRPDRPGWGVEMDEKAMEEEGYIHWQRRVPKRPDGSYAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOLASE
publication title Crystal structure of an enolase (putative galactarate dehydratase, target efi-500740) from agrobacterium radiobacter, bound sulfate, no metal ion, ordered active site
rcsb
source organism Agrobacterium radiobacter k84
molecule tags Lyase
total genus 132
structure length 395
sequence length 395
ec nomenclature
pdb deposition date 2013-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4jn8A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4jn8A01
3V5FA 4IT1A 3U9IA 3RO6A 4EWJA 3T9PA 4G8TA 2OX4A 3THUA 1WUEA 4DYEA 3QN3A 1FHUA 3SJNA 2OG9A 1KKRA 3H70A 3R25A 3TWBA 4M6UA 2POZA 3UCDA 2FYMA 3SBFA 5J04A 4K1WA 2P0IA 3DGBA 3ZVHA 1SJDA 5FJRA 2OLAA 3SQSA 2HXTA 4GIRA 3MQTA 1EC8A 1JPDX 3UGVA 4J1OA 2PTYA 3H7VA 3SN0A 3ZVHB 4GYPC 3RITA 3DG3A 4GYPA 3ES8A 3TJIA 3RCYA 4A6GA 1ECQA 4FP1A 3QTPA 3RGTA 3TOYA 2PCEA 3OP2A 4IL2A 4DWDA 2PP0A 4GGBA 3SN1A 2OQYA 1MNSA 1TZZA 3IJQA 5BOFA 3R1ZA 3TWAA 3EKGA 5ENLA 1MRAA 2PP1A 4DN1A 3ZVIA 4GMEA 3FV9A 2MNRA 4H1ZA 3TCSA 3ZLFA 4HYRA 3GY1A 3MSYA 4F4RA 3R11A 7ENLA 3U4FA 3MZNA 3BJSA 1L8PA 3UJEA 3QLDA 2QVHA 3TJ4A 2PODA 2PTWA 3DEQA 4GFIA 2P8CA 2ZC8A 2PMQA 3QPEA 4H2HA 3VC6A 3FYYA 4M0XA 3QKEA 3I6TA 4ZCWA 4J3ZA 3OZMA 3OTRA 1EC9A 2GGEA 2OVLA 3MUCA 2QJMA 3TQPA 3P0WA 1JCTA 2OQHA 2AL2A 3BOXA 4FI4A 2PGWA 3IJLA 1TKKA 2HXUA 1E9IA 2PU1A 2AKMA 1IYXA 2AL2B 2AKZA 2OZ3A 3BSMA 4H83A 3CB3A 3H12A 4ROPA 4IL0A 3UXLA 3N4FA 1EC7A 2XSXA 1EBGA 1MDLA 1JDFA 4IP5A 3R0UA 3VCCA 3DFYA 2MUCA 1OEPA 3UJFA 2XH2A 2HZGA 2RDXA 3FXGA 2CHRA 2PSNA 5FJPA 2O56A 3DIPA 3P3BA 4K2SA 1NU5A 1XPYA 4Z17A 3DESA 3FJ4A 1KKOA 3DFHA 3I6EA 2PA6A 2GDQA 3K1GA 2PU0A 4A35A 3D47A 2OZ8A 3V5CA 1NELA 3MWCA 4G7FA 4A3RA 3ES7A 4JHMA 2XH0A 3CK5A 2PS2A 4KWSA 3N6JA 3UJSA 1YEYA 2GGGA 4DX3A 4HNLA 4JN8A 4IHCA 3UXKA 3MY9A 1MUCA 2P88A 3JVAA 2QQ6A 3EEZA 1SJCA 4HCHA 2I5QA 2OPJA 3DG7A 3DG6A 4MMWA 4KPLA 3R10A 4KEMA 1MDRA 3GC2A 1RVKA 2ZADA 3ENLA 2QDDA 3VDGA 2PP3A 4HCDA 3HPFA 3MKCA 4HN8A 5FJTA 2OKTA 3PFRA 4IZGA 4HNCA 3TTEA 1EBHA 1R6WA 4E8GA 3CXOA 4MGGA 3UCCA 1P43A 3KUMA 1DTNA 3CYJA 2QDEA 2P8BA 3P93A 4ENLA 3DDMA 2GL5A 3UJRA 3Q4DA 3NO1A 2NQLA 3VA8A 2OO6A 4IP4A 3GO2A 1PDZA 3RR1A 3T8QA 3OZYA 3CT2A 4YWSA 2AL1A 3OW1A 2GGIA 3RRAA 1KCZA 3NFUA 3T6CA 2DW7A 4ZA0A 4Z1YA 3GD6A 2QGYA 1KD0A 3NZGA 3FCPA 3IK4A 1P48A 4MKSA 2PGEA 3H8AA 2PTXA 3PWIA 2PTZA 1JPMA 2ONEA 4E6MA 3VCNA 3V4BA 3CAWA 4DXKA 3N6HA 1ELSA 2XH7A 1BQGA 1PDYA 3T4WA 2QJNA 1TE6A 3S47A 4X2PA 1SJBA 3SN4A 2HNEA 2XH4A 4KT2A 3ZLHA 3UJ2A 4E5TA 4E4FA 2GSHA 3I4KA 3STPA 4K8GA 4GISA 2OFJA 2GGJA 1SJAA 5BOEA 3PWGA 3TW9A 3DERA 3V3WA 5FJUA 5EU9A 3D46A 3ZLGA 3N4EA 3SSZA 4GGHA 3NXLA 1XS2A 2XGZA 2PPGA 4JN7A 3JW7A 1WUFA 2FKPA 3IJIA 2P3ZA 4E4UA 3R0KA 1F9CA 3FVDA 3VFCA 2DW6A 2OZTA 1R0MA 4HPNA 1BKHA 6ENLA 4H19A 2GGHA 3JZUA 5FJOA 5IDZA 3Q45A 4DHGA 3PK7A 3OPSA 3B97A 1ONEA 3VC5A 1FHVA 2QJJA 1W6TA 4HCLA 3S5SA
chains in the Genus database with same CATH superfamily
3M16A 4ZSUA 4E2DA 3LS9A 1BQCA 4G8TA 4EIVA 3ZWTA 2WLZA 2QUUA 1ZBWA 2BP1A 4NSBA 1FFUC 3OGRA 4HA1A 2BS9A 5CPLA 1IIHA 5K3VA 4GCXA 1HP5A 2POTA 2Z1XA 3W38A 1MQQA 3GC5A 3KBSA 1KFLA 3VZYA 5LGZA 4IMCA 2VWSA 1QOXA 1T8XA 5FJRA 2WCAA 5K2ZA 1R3TA 1V8EA 2E6AA 2VEFA 3BLKA 4OHQA 3AU2A 2J9YA 3W29A 1ZLPA 3VDBA 1FBAA 2PTYA 3LUTA 3PANA 4GYFA 3T78A 3HJEA 4GXMA 1KV5A 1FXPA 3LB8A 1DJZA 4J28A 2QCNA 4UR8A 4QLLA 1F7BA 5BZAA 3TOYA 2PCEA 3H24A 4DWSB 4V33A 4GVGA 1XKJA 4IIFA 4AWEA 2PWVA 1MFVA 5EMKA 1B1YA 4JTQA 3O6DA 4RDWA 3P67A 4D8ZA 1D3HA 4JICA 1P7TB 3SIMA 3GKFA 5I07A 4A2RA 2QCCA 4UTTC 1EWEA 2I14A 3ABOA 4H2CA 5C5YA 2PUZA 1NDVA 4KIRA 3N2MA 5AC5A 1NOFA 3L2MA 4MJMA 1U5VA 1LZOA 2E1DA 4J56A 2OVLA 2QUVA 3VNYA 4I8YA 2J62A 3EDKA 3TYAA 1B3ZA 1EGZA 4U3AA 3VGHA 4FI4A 1FOBA 4B9YA 4F0HA 3RMEA 3W1LA 1E9IA 2NX1A 5D05A 4OBSA 1QDSA 1VHCA 1IYXA 4IFRA 2FVMA 3UG5A 3ZFHA 1QW8A 2X1IA 1F3XA 4H83A 2IPGA 4HA4A 3AXXA 4CN4A 1Z44A 3C2RA 1A80A 1ZSXA 2EQ8A 1LORA 5DELA 5I2UA 3LGDA 1BWKA 1SFSA 1F6KA 3NQ7A 2D73A 1VPQA 2QLYA 4XZMX 3OYZA 1HJXA 4YCPA 4QNWA 4K7ZA 3OU8A 2EGZA 4CCDA 4PUMA 1TR9A 1UWSA 3SSJA 4O16A 5GVJA 1E4NA 1ZHAA 1QR7A 2Q8LA 2UV8G 5EMJA 1UJQA 1JOAA 3LX9A 2AAQA 3T0CA 4IFKA 1OGSA 1CLKA 2PDMA 1RK6A 3VU2A 3TYCA 3NQFA 3LYEA 3UY7A 2X8HA 2PAJA 3IJ7A 2XN2A 1EOKA 2BGNE 1YEYA 4P7NA 3TC3A 2YA1A 1K8ZA 2GQAA 3AIWA 5A6KA 1EEPA 4AY1A 4HU8A 2AAMA 4G2DA 4WGXA 2BVTA 3ITTA 1V93A 3SCQA 4N7QA 1YE4A 3JVAA 3W28A 4GXPA 2ABBA 2FTPA 4AW7A 2XFRA 3BARA 2NQZA 4QFUA 1MWOA 4CQDA 5M03A 4GUIA 1XC4A 4MSSA 2C13A 1E4IA 3APTA 5AYBA 2R24A 2OKTA 3SECA 1EBHA 3UXDA 4HA3A 4KCVA 4DQWA 1HL8A 3GHTA 1M7PA 4QCFA 1L6WA 6REQA 1NIUA 1M53A 1FH9A 4YYCA 3KP1A 1RPKA 3P93A 2CNCA 2V68A 4MDOA 3TC7A 4Q8MA 1BSIA 1W5NA 3PVFA 3OA5A 1F8WA 1G67A 2FZNA 4ICNA 1VFTA 3LQLA 4G6CA 5FEPA 1F8IA 2NWRA 3SAZA 1TVNA 2XFYA 4RV8A 2XVGA 3WBXA 5LKYA 2CXGA 5D2XA 5AB3A 2QGYA 2L5HA 4LGXA 3EDEA 5KZDA 3FW6A 3IIPA 5GQBA 4A8LA 1JAKA 3N2TA 4US6A 3SCUA 4N4PA 1C91A 3WKZA 1PZ1A 3H8AA 2GH5A 1UR3M 2E5BA 1WA3A 3LG3A 2WVVB 1LTDA 3NWRA 4GJIA 3EX2A 3FG2P 3RIKA 4WEVX 3EA1A 3B8IA 1AODA 2DIJA 3ETRB 4J40A 4WSJA 4AEFA 4DJED 4BS0A 4MY9A 3HG3A 5BW6A 4NZCA 3E6EA 3K4WA 1YIXA 3WDPP 3T4WA 4R9OA 5H91A 4Q8TA 2YXXA 3S47A 1O94A 3KHDA 1ONWA 2IPWA 3DK8A 3A7AA 2RH9A 2DPEA 4NJHA 3EOUA 3PBVA 1OF8A 4LB3A 4D6CA 2NVKX 4UWMA 5A1AA 2A7PA 3DYMA 3QYSA 4K38A 2RUSA 5ECVA 2OWXA 1W9UA 1JROA 1LRNA 5AHMA 1IT0A 5FJUA 4U5KA 3C8FA 3E2SA 3ZLGA 2YVGA 1KWGA 3RM8A 2XGZA 1H7OA 1JCJA 4PCNA 5G5HB 4FLQA 3MBFA 4HZ6A 5G4EA 2WO5A 1JYXA 2ZVIA 2VR4A 3FN9A 2C6QA 1G0CA 1BKHA 2Z6IA 4IGSA 5A6JA 3AMGA 4JKLA 1WZAA 2GGHA 1GJWA 2J8TA 3NZ1A 5U4NA 3VX0A 4AUBA 3PBYA 4KFPA 3S46A 3GZ3A 3R94A 4KRTA 2F7FA 2RAGA 4GX8A 2OOGA 3S5SA 4APNA 2E6YA 3QOKA 4H4TA 2ZRVA 1WUEA 2NV1A 1SZEA 3BANA 5HWJA 3WLMA 3GHSA 3HV8A 5D30A 3EOOA 1T40A 3QR0A 1RM6B 3MU7A 4ZOBA 3VNMA 3W1XA 1E40A 1K9DA 1XJBA 3I3BA 3VD7A 4DUVA 2BHUA 4DBWA 1IEVA 3UYIA 2OLAA 1TVLA 4ZFMA 3TR9A 1OK4A 3TTQA 3H53A 1J5SA 2IPFA 1V7AA 2HISA 3UT0A 3CASA 4LAKA 3RNDA 3QR3A 1KCKA 3CAVA 3SN0A 3OJGA 2GUBA 3BSHA 3ZVHB 1X98A 3AIUA 3QHOA 1J93A 4OU1A 5TAOA 3A5FA 2PDJA 5LA0A 3WF4A 5JRBA 2J27A 3V1HA 2BY2A 4DBDA 5FS8A 2QCEA 3OP2A 3NS1B 3T44A 4P7RA 5KETA 2REQA 4X3ZA 3H7UA 3QC0A 3R1ZA 3B9JB 3H23A 1OWQA 1HJSA 2Z7GA 3G22A 1W31A 1NDZA 1JVNA 3A7RA 1TG7A 4JD4A 3CUZA 3I3EA 1VFLA 5BRQA 2VDGA 2PDIA 1R38A 1REQB 3QJAA 3LI0A 2V3BA 1R2SA 4GUFA 4OZOA 1IGWA 2DJXA 5CZ0A 1DHKA 5E6ZA 4W88A 1TMLA 4GG9A 3AMLA 4JCMA 2CIPA 2GGEA 1W3LA 5HBFA 1FWSA 2QJGA 3VNLA 3G8EA 5KTLA 1GORA 4QG9A 2BTMA 1UZ1A 4AXKA 3VUSA 1ZENA 2QVNA 2CLEA 4R88A 3AICA 5A3HA 5M2FX 2VRJA 5MKGA 2G3NA 1QHPA 1B2YA 2RFGA 4W7VA 3BSMA 1PO9A 2G0WA 5ER0A 1H61A 1Q8JA 4KRZA 2AGKA 3H22A 4UOJA 4K6AA 4XUYA 3AAMA 1V6YA 2DDXA 2ICSA 4V15A 3VCCA 1H7RA 2X99A 3H4XA 2ZA2A 2GVEA 2YPIA 3CO8A 5E09A 3A7UA 1AW5A 2QW5A 4R7OA 2XZ7A 4LRSA 4O1DA 1U1UA 2YBVA 2YCLA 3THQA 1GVSA 3SRHA 4N02A 4RXFA 3OVQA 2R1PA 4JNMA 2V6AA 1W9PA 3W0KA 1M3UA 1UR8A 4J3SA 4RE2A 3S5OA 4N9EA 1XIDA 3AROA 2BVYA 5ECUA 2PBGA 4U5IA 4ACYA 1MNZA 1W2PA 5U7SA 2FB2A 2GK1A 1EJUC 3SW6A 1XLIA 1SMDA 4I7WA 4KWSA 3UJSA 3CHDA 3OOQA 1RD5A 2ZZ3A 4EX4A 4JN8A 4OWGA 1TJPA 4Y9AA 3LXAA 4IQLA 1A0DA 4AIUA 2VCBA 3RM9A 1GZGA 2WJFA 3IWPA 2VEKA 1FKXA 5CPQA 3IS4A 2QPSA 3O15A 3DG7A 4ZEPA 3DG6A 2CZDA 3OGVA 4IQJA 5AYIA 5JCIA 3PUDA 1AH4A 4LUJA 1ITQA 4PL2A 1IXPA 5HA7A 1XDIA 1K4GA 5C8BB 5JMUA 1ITXA 3CYVA 2C71A 5A8NA 2KZHA 2WCGA 5FJTA 3WH5A 5AY7A 1B3XA 1DE6A 4KS0A 3W26A 3MS8A 2X7VA 4CD5A 1Z48A 3LU2A 1WX0A 3DI1A 2A3EA 4FIQA 1F4AA 1OX4A 1EJ7L 2HWGA 4NIRA 4I5UA 4EPEC 1ZP3A 3GVQA 4KETA 2XU2A 3NM3A 1NJJA 3NR0A 2WM0A 3PAOA 4HN4A 3DJGX 2VC6A 3M0JA 3FAXA 5CJNA 1TRIA 4J27A 4AZHA 4IIHA 3WD3A 3GG0A 2OYMA 3M0HA 4NJJA 1JNDA 1GOMA 2HBVA 3LZ5A 1TWZA 3WL0A 4PTWA 1HTIA 1A0CA 2NSOA 1CGVA 1CLXA 1XYBA 2A3AA 4LY8A 4FLSA 1E3ZA 1LDCA 3NZGA 3W1UA 1LL6A 3TJLA 2ZOXA 3LB0A 5EFFA 1TPDA 3PULA 5A8PA 1TCMA 4XZBA 4WLCA 4P2VA 3W71A 2YDRA 3SY8A 3N25A 3S9YA 3WUBA 2OLSA 4PMVA 3WL1A 1T8QA 3W84A 2E25A 3GRIA 3TSBA 1LOLA 1B0IA 3T2OA 4GJJA 4JYDA 4UQBA 1QOQA 1EXPA 3CT7A 4MB5A 5LHFA 1XLMA 1PDYA 2MANA 2ZE3A 3GRSA 2BFGA 1E6PA 5EPDA 4LYPA 1XDMA 2OXNA 2O9TA 3RLGA 3TYUA 4NNAA 3I4KA 1LLWA 3RMJA 2W63A 1EQPA 3CL8A 3WZ0E 3LD5A 4PRRA 4NKCA 2ZICA 1JD7A 1Y7VA 3PWGA 4MJZA 1L6FA 2NUWA 1L2QA 3BOLA 4KFOA 3NVZB 3LPOA 4ZO9A 3KL5A 4H9MA 5BWFA 3PTKA 3B0VC 4J35A 2F6UA 3SUTA 4AZCB 2DH3A 4CQAA 2BY3A 3MV11 4O54A 3UETA 4JN7A 2XSAA 1SO5A 2UWFA 2NQJA 1HG3A 1V6WA 2WZTA 5BWAA 3AIVA 2YVJA 3HPXA 3ZS4A 2NLYA 3KBVA 5KZMA 1GOQA 3WLQA 1E6QM 5FJOA 2CPUA 3U8GA 3GTNA 3O0KA 3MCMA 4NG3A 3PM6A 4K8DA 1OC7A 2VC9A 5FF3A 4EWJA 1K03A 1GKRA 3F4WA 3F2DA 2WSPA 3T08A 3T0BA 2BXYA 3I10A 3CHVA 1ZMCA 3EWCA 4TOQA 2OEKA 3VNKA 2Y24A 4CN6A 4LYKA 3WX7A 1XH1A 1WE5A 4M6UA 4MAZA 1TVPA 2QMJA 4OJYA 3C0JA 2NUXA 1UIOA 3MVIA 1Q6QA 1ISZA 4NF7A 1XYLA 5IRPA 4R9XA 5KZEA 1RD6A 4QS5A 3DFTA 3WBEA 2A3HA 3GTFA 1C7TA 4JY9A 4YCOA 3CWOX 3CZLA 5ABFA 1P4CA 2Z1KA 1ISYA 1NQ6A 2V3AA 1LG1A 3HG4A 4O53A 4UMAA 3THAA 1FXQA 4FOUA 2WZMA 2DQXA 3VYLA 5IM51 3RILA 9XIAA 1YDYA 4IFOA 4YTRA 4XD3A 4JL1A 1XIBA 1GVRA 5FS7A 2OKOA 2GJXB 2OQYA 3VABA 1EDQA 1JDAA 1WKFA 5E9XA 1TR1A 4BR1A 4LIIA 2Z2UA 4GMEA 1R30A 4NZ1A 2BMBA 1HJVA 3UJEA 1L8PA 3AMKA 2VNCA 5CZTA 2QVHA 5C7VA 4BCEA 3W88A 1F05A 4RE4A 4GH1A 3M9YA 4FALA 1UPPA 4KCUA 1TO3A 1GTHA 4UNLA 2EQDA 4HP5A 2WAGA 3IV3A 1TUXA 3F4CA 1YHTA 1YYAA 2UY3A 2XTKA 3OODA 4Y9OA 3R0DA 3LZ3A 4UMCA 3TYDA 1HKJA 3EXSA 1EF2A 1B3OA 1Q6LA 3EWDA 3AISA 5CLWA 4REQA 1GQNA 2OB3A 4PMUA 3K8LA 4TX8A 1CXKA 1FWAC 3W86A 2OTDA 1SR9A 4K1GA 3KWXA 4TIMA 4EMWA 2IMRA 1BVZA 4ZQPA 3KL0A 1JDEA 4O1FA 1HN1A 1X96A 1HL9A 3WD4A 4A29A 1I2NA 3UEQA 1IWAA 2RDXA 4AF0A 1E9YB 1EYWA 1JEHA 1JZ3A 2VCCA 4BEUA 1SSGA 4GZIA 4HZ8A 2WV8A 2INEA 3VIIA 3W23A 2ZE0A 2YZRA 2HQAA 4JYFA 3AWOA 4ZGYA 2NWSA 3AHVA 4YL2A 3DFHA 4MB4A 2YYTA 2E3TA 1D3GA 1ESWA 3G1DA 4GABA 2GR1A 2YL5A 1CYGA 1W3NA 2YBUA 1RQEA 1EF3A 1R3YA 3LPFA 3F4NA 3FYPA 1Q3NA 3B9EA 1B4KA 1RBLA 3P61A 5BU6A 4L64A 4ONVA 1BTCA 4NJGA 2GQ9A 2PURA 4K7VA 4CN1A 4IHCA 5E0KA 1OBAA 3IK2A 3SADA 5AC6A 4L5ZA 1XPGA 3LTPA 1LQ2A 4UR7A 3APGA 4GWEA 2WC4A 4C6PA 1ZMDA 3FYOA 3M5XA 2VRKA 4G9PA 1BWLA 2X1RA 1G01A 4R34A 4CVUA 9XIMA 3ABSA 3L4YA 1WQ5A 1GHRA 1IF2A 4HCDA 1JDCA 1XGDA 3MKCA 3VOJA 2X05A 4DO7A 1E43A 4FLRA 5A6SA 4IMFA 4LUYA 1KTNA 4RNHA 4QQUA 1IR2A 1EIBA 3BDKA 4OUIA 2QF7A 1WZMA 3PSWA 3MT1A 1W1A1 1UR2A 1JFXA 4TXEA 3MO4A 4DZAA 5XIAA 2J8FA 1EPVA 1I6NA 3K46A 3CMGA 3M1ZA 1EGMA 2B7PA 1JL8A 1EYEA 1MQRA 3ZZ1A 1LBLA 4GBDA 3CH0A 1DVJA 2BGQA 1OG0A 2CFFA 4YIWA 2V3GA 1KFBA 1GEQA 3T1GA 4M19A 2O92A 1TJRA 4HOXA 4GXWA 1FDJA 5EL1A 3V75A 3AYRA 1GK8A 4ZA0A 4ZTYA 4C7DA 2GVJA 1VLWA 5SWUA 2ZXAA 2C3DA 3NQVA 5BYWA 4AYGA 1RUSA 3E2VA 2VCAA 2XIJA 2ZXBA 1Q6OA 5C54A 4DBSA 1PYFA 1GUVA 4PEEA 5D2YA 4LT9A 1OSEA 3O3RA 1UZHA 1W1B1 1E1FA 2FH6A 1X38A 1X1ZA 4DUWA 4Q7BA 3SCNA 1IV8A 4B5TA 1N8IA 3M0KA 1DV7A 4U3CA 1V0LA 2BC1A 2Q8ZA 1QPQA 4FMVA 1OCBA 1XLDA 4HMEA 2J9XA 3CUIA 4IP7A 3IRSA 2XH7A 2Y7DA 4ORIA 4L4OA 2RHGA 3GYEA 4TUFA 4FNQA 3NTYA 1TPEA 5D02A 5CJ5A 4P7QA 1FWIC 2XH4A 5CJMA 4S3EA 3ZLHA 5FESA 3TIMA 1LLZA 4E4FA 1R3WA 5EBUA 1PKMA 2PC4A 4JDBA 1C7SA 1SMAA 3W1NA 2H3DA 4N4QA 5G4WA 3PTMA 1D8CA 2VX7A 4H6KA 3V3WA 3E96A 1TZ9A 3W7RA 1VIWA 3NXLA 2CLPA 1GJUA 1JG9A 2P10A 4NP7A 2VMFA 1TREA 5HMFA 3EGJA 4ZL1A 4PCPA 4G56A 3H55A 4Q7IA 2J7GA 3L4VA 1XV8A 3CQHA 2EPKX 4L1GA 2QJJA 1JGMA 1OK6A 5CGTA 3C6CA 1DXEA 4GIYA 4GJ1A 3WJYA 3V5FA 1GWJA 1F2JA 3BURA 3KOZA 3PZ9A 4Z08A 3T9PA 5C9XA 4FF7A 3W2MA 3KWSA 4JTKA 3QN3A 4WOZA 2CYGA 4YWOA 1CT5A 1CECA 3AALA 2R9RA 1EXBA 1KKRA 2ACUA 2DH2A 2ACRA 1XW8A 3G1XA 2POZA 4PC8A 2JK6A 2J4GA 4R7JA 3G1SA 3WH8A 1E1EA 3TFCA 3ZOAA 3CHFA 1UB3A 3B40A 1UZDA 1ISXA 2ZTKA 4LAZA 2BVDA 3IPWA 4C6FA 3QQ1A 2HXTA 1MSSA 2Y70A 1GTEA 4WY0A 4FNUA 4XSLA 1EX1A 2VZOA 1WXYA 3A47A 3A9BA 2R94A 4UXDA 3W2NA 3GFYA 4WXYA 4QLKA 2IS7A 4H8VA 3L5OA 1R47A 3D0CA 3WJWA 3H26A 4DJFC 1CWYA 2Y89A 4PUUA 4H9VA 2JBMA 1KV8A 3VOGA 1UC5A 3O9NA 3QPZA 2YCJA 2Z25A 3TP4A 3CAQA 1JCXA 3FV9A 3RG6A 4CNUA 3GY1A 3R11A 5F1UA 3W2LA 3G24A 2RJGA 1AD1A 3RHGA 1PV8A 2D20A 3GD3A 1ONXA 3FEQA 1S2WA 2PI6A 5A95A 2WPBA 3CS2A 2Y2WA 4GFIA 4UB9A 2J79A 3N2BA 3ANUA 3PG9A 1EA0A 1F6PA 1TUFA 3ARRA 5G1MA 1OFEA 1EHNA 3I6TA 3ICJA 1JZ5A 4ZCWA 4I9TA 2Y8KA 4F0RA 1TWDA 5TBOA 1V08A 3O63A 1TX0A 4XO6A 5H8PA 2EBNA 3OVGA 1PPIA 1OC5A 1Q1RA 1XH0A 4LUSA 4NQ1A 4GQGA 5A69A 3KZSA 5D9PA 3CEUA 4N9CA 5K7JA 3P0XA 2BXVA 1J01A 1ZAJA 5HPCA 1BYBA 4MWAA 1M6JA 2IQDA 2PDNA 1ISVA 4XB3A 3LI1A 3M0XA 1LPFA 4IL0A 1PTGA 2D0HA 2G4FA 3W4RA 2D2JA 4PMNA 4JDRA 2PRLA 5J5RA 1JDFA 4GUGA 2JFEX 4NASA 1CDGA 3UWUA 2GR0A 4ADTA 1UWQA 1AZ2A 1JPHA 2TRSA 4GVHA 4URIA 1NP0A 4XAFA 2A8XA 1PWLA 3VNDA 4Q6JA 1F3PA 2QCDA 1P6CA 2YW4A 3O0FA 4LC6A 2NT1A 4AIOA 3OGSA 1U83A 3L2IA 3BC9A 4PUDA 5DO8A 2NSXA 1O5RA 2AAAA 1FRBA 1B3WA 2HE8A 3QV7A 3R7MA 2WOQA 3CZJA 2X7WA 1UP2A 3IC9A 4FDCB 2GOUA 4D6IA 1VC4A 1QO2A 4IQDA 1GHSA 3AZTA 4UTWC 2EO7A 2V63A 1HFBA 4EAYA 1GNXA 1KCLA 3W75A 1JR1A 3VVGA 4LCSA 1E5JA 4ZXLA 4DUOA 2D2GA 2J88A 2WKLA 2QULA 1V79A 4W5UA 2VELA 4FEZA 1ZK7A 1IZCA 1VF8A 2YLAA 1KFWA 3FKKA 3N9KA 1SZFA 3VZZA 5FD0A 4ZOHB 2Z1VA 1R85A 2XUCA 1VEOA 3NQMA 3AFBA 4V28A 4KEMA 4LS1A 4MFEA 2GVGA 4EANA 2ZADA 5BXPA 1FY6A 3PB0A 4UTLA 4B15A 1PKNA 4IZGA 1IE7C 5D9OA 4RXGA 1D7YA 3L5AA 3GXMA 4WX2A 2HJPA 2E7FA 5F2LA 1B9BA 4QG8A 3STFA 4WRHA 1XG4A 4YS1A 5AHNA 2ADAA 3SCWA 2EG8A 4PTNA 1ADOA 2WMIB 3S0CA 1DIEA 1JPKA 3NAVA 2C7FA 4FX6M 1RH9A 3CQKA 4YTTA 4QJ3B 1MQPA 3OZYA 2AL1A 3DH7A 1F3TA 3STGA 1K6AA 5AECA 1KCZA 1CXEA 1FWGC 1GQLA 6XIAA 3QXBA 2I1OA 1JNEA 1XI3A 2X1SA 2EJAA 3ORWA 2D0FA 4UFLA 5HNTA 4MZ8A 2NUYA 1US0A 1QFEA 3C2EA 4OV4A 1IXOA 4PUKA 3S2NA 2PTXA 2DVUA 1W1YA 1PHWA 3VFLA 5AHLA 2QJIA 3NQGA 1W56A 2H90A 4WCJA 1E0XA 1CCWB 3W74A 5FF4A 2Z0IA 3B4UA 3DGRA 4H4PA 3FJNA 4LUIA 1DYSA 5JBDA 4W9TA 3HW2A 4R5EA 5G1TA 1GRHA 1ELSA 1GRBA 3KBWA 2DIEA 4DJDC 3QEZA 3IUIA 3GTIA 3ZJ8A 2CU0A 3A64A 1QUMA 1KBLA 2R1NA 3ITOA 4Q3MA 5RUBA 1BSLA 4WJ8A 3ZJ6A 1P7TA 4KF1A 3CAKA 2YSWA 4K8GA 4GISA 3R12A 1WPCA 4O15A 4ERIA 1C9WA 1S5WA 4DF0A 2C3CA 1RR2A 1E0UA 1H7NA 2P76A 5FF7A 1XLCA 2G3MA 3RDKA 3KRUA 4HU0A 3DERA 5C9UA 3TFXA 3ZMRA 2VURA 1A47A 4A3YA 1Q6CA 1XCXA 4XBJA 4YTUA 1WAWA 3LLXA 1C8YA 4MWAE 2FKPA 3KOXA 3R0KA 5BXRA 3VGBA 2GLKA 2VO5A 1QVBA 3AIBA 2OZTA 3M0ZA 3GW3A 1SZNA 1V3HA 4O1BA 4QSHA 1RXOB 1XBVA 1IEXA 3ERPA 1A3XA 4IJRA 2CHNA 1JZ6A 3IAPA 3N1AA 3L0GA 4X22A 4POCA 3CQ0A 1VFMA 5C0QA 2XGBA 1VCFA 1QAPA 2HROA 1JGIA 3URHA 3OB8A 3DGHA 1ZAHA 1E0TA 4PB3A 3O6CA 5AVHA 1A0EA 1PVNA 4D6DA 1KBKA 1X8CA 4M80A 2GUYA 3UA4A 4P5UA 3WDIA 5CSRA 3GIYA 4PTDA 4JL2A 3QSTA 3AUOA 3MHFA 2QF8A 1XGZA 1XDLA 4O8AA 3ALFA 1IWPA 2ATSA 5CPTA 4JFVA 4JXCA 3BSGA 3WUGA 4ZB5A 1Y0EA 3VM7A 4GYPC 4RLIA 2ZA1A 5I03A 3ECQA 4IISA 1YQZA 1HW6A 1ECQA 1HKWA 1UH4A 1WYIA 3U6WA 1UA7A 3HG2A 3SGGA 5E0FA 2HDJA 1VYRA 3LM7A 1E70M 3QY6A 4IQEA 1TZZA 4UQEA 3S2JA 1W0MA 1FTXA 4X0NA 3SCTA 4NZJA 5F4XA 4DN1A 1SFTA 2VEIA 2ZRXA 5FIPA 1UR0A 3NXFA 3BG9A 4QM1A 3H2MA 4GNJA 3SQPA 1C9DA 1Z7AA 1GOWA 4BK9A 2CLOA 5CC3A 5T91A 2A85A 4FIRA 2O55A 3G0UA 2CLHA 1ZJHA 4H2HA 1XXXA 6XIMA 2WK2A 4IJBA 4IIBA 2E6DA 3DXIA 1R3SA 3EEGA 4PR4A 2QJMA 3N15A 2BV9A 5EMLA 3BCDA 3W7IA 1W37A 3FDGA 1XRSA 3WH9A 1EUNA 2Z1BA 4L9XA 3H21A 4QDPA 3VKKA 1LQ0A 5LNSA 4J3TA 5CQ1A 3VIHA 4B5XA 5MKGB 1EC7A 1Q13A 2QGHA 1MZRA 2H9AA 4KW2A 5LHEA 4IP5A 4ZXOA 4ZSTA 2I17A 1OJXA 3P74A 4XZLX 4Q8PA 5DBUA 3SFWA 2JF7A 4EK7A 5AC8A 4BWLC 1E1CA 3EPOA 2X0YA 2XIOA 3II4A 2C3ZA 4L6OA 1FWCC 4OV9A 1G4TA 3U2EA 1RBOB 5HULA 5TQLA 1JCYA 4X2RA 3S42A 2BNJA 2G41A 3NJ3A 2VL4A 3WJZA 4OECA 4RE3A 1XLLA 3AIQA 3EMQA 1E73M 2HV5A 4FSAA 3LCXA 4NNBA 2WJDA 1YE6A 3MUAA 4D6JA 5HR6A 1AUSL 3MCOA 5BMWA 4CQ9A 1B3VA 1YPFA 2VKZG 1KRMA 3EXTA 4CCCA 4LW7A 4LWWA 1UYQA 3OHMB 3L12A 4DX3A 2F84A 1WB0A 1QASA 5A6TC 4AWTA 1W9VA 2YCEA 5IHSA 3RXZA 2GK1B 2D0GA 1OB0A 4IIDA 3KBJA 3CUJA 1G4EA 1OFAA 2R9ZA 4EPKA 3GR4A 4XX6A 5IFTA 5IBXC 2YA0A 4Z42C 1UR9A 1BTMA 1HGWA 5CPOA 2RDTA 2CC0A 2ESCA 4EWND 1R2RA 4MWAD 3SZ8A 3NYDA 3VI2A 3MW7A 3PPCA 4PTXA 1J79A 3GBEA 4HNCA 3TTEA 4TV6A 1RCQA 1LCOA 1GSNA 3VOHA 3NOYA 1S2AA 2VEMA 1S2CA 4CVWA 1WV2A 1AG1O 2V38A 2HBXA 2D69A 3BOFA 3BK0A 3U2OA 3CYJA 2FZ9A 2DT0A 2W79A 3SB0A 2XVKA 4FPSA 5HMSA 1NM9A 3UQNA 3IGUA 3WEZA 4MYXA 4D8LA 2NQLA 1ME8A 3K8MA 2QAEA 3GAKA 1PDZA 4HNVA 3H4KA 4YWSA 2B0MA 1OT2A 4Y7EA 2DW7A 2GJNA 1V6UA 3QGAC 3GXPA 3LHWA 1F61A 1TTQA 3ZT7A 1MEIA 3N12A 1E56A 3W2UA 2PGEA 8A3HA 1I0DA 5JQ9A 1ZU8A 4L6DA 3AXIA 2BWGA 4Q4RA 4PL1A 1JD9A 1FWTA 3PWIA 2WXDM 4FX9A 2PTZA 3NQBA 1DL3A 3PZQA 2A3BA 3G1AA 4ZBCA 4XD6A 1VFUA 4A8IA 3LCHA 1NOUA 3MA8A 4FOKA 4IX0A 4IPJA 1OYBA 2HNHA 2PDHA 4WUIA 1OFPA 1JI2A 3UZYA 2VI0A 4DBUA 5AYXA 4IIGA 3VD3A 3H6OA 2D22A 4PMOA 1KA9F 1L0PA 3NQEA 2DZVA 2DJLA 1ZB5A 3TYBA 3SN4A 4ZFCA 5B80A 4O18A 4JQ9A 4QJ5B 4ATDA 2VYOA 1X97A 3VGDA 2HK1A 4DO6A 1WCGA 3PBWA 4LVFA 4JTRA 4XKYB 3PY2A 2OGJA 3MP4A 3OIXA 3H2CA 4S3BA 4DUXA 4QDWA 5KSWA 1IEWA 1J0YA 3ZT5A 1IR1A 1QBBA 4JX4A 2A79A 5J5DA 5DMLA 3TTSA 1JUKA 2HQMA 3WDJA 1PSCA 4QEHA 4LUTA 1RA5A 3KTXA 4F8XA 4HPNA 3QFAA 3LHVA 4S2BA 3NQ6A 3U4AA 3WLOA 3KL3A 1V6TA 3Q45A 1IT8A 2V8ZA 1A5NC 3LLFA 1FHVA 2WNNA 3EMCA 1NHPA 3GRTA 3UZWA 1NFGA 3P60A 4JTLA 3A21A 5E6YA 3A4XA 5HWMA 2OELA 3SIZA 3EWUA 3ZJ7A 3T0AA 1ME7A 4RDZA 4BKNA 1I75A 1Q4NX 4O0ZA 3HV9A 1QI2A 1UPMB 2BODX 1VJZA 3PG6A 3BW2A 1GVOA 2ACSA 4MLRA 2IXUA 2PZNA 2CLKA 2X30A 2WHKA 1JFHA 4JEQA 3SR7A 4JTFA 3UZJA 2FVLA 1G5AA 4ZO6A 3CWNA 3UU0A 4QRNA 2WBGA 3HU7A 4Y6GA 3E02A 4ACZA 3SQSA 4IPLA 4YNGA 3HPAA 2OOFA 3G1HA 1TA3A 1VBHA 4PA8A 4AZGA 5CC5A 3IUDA 1E0VA 3NGJA 4C6BA 2RABA 1CPUA 2XFWA 3SUVA 4GYPA 1XSKA 3E0FA 5T9BG 4DELA 3WUFA 3P8JA 2YCIX 1CEOA 4O1CA 5ABFB 2INZA 3MWAA 2ZUMA 3AS1A 1EZ2A 4UFJA 4JBRA 3SO7A 3CUGA 5HNRA 2O4MA 3A3HA 5DRIA 4G7EA 1KM0A 2PP1A 1OFDA 3CL6A 4PMXA 1R3RA 3CTTA 4JIIX 1FDYA 1LRTA 1XIIA 3U4FA 1J2WA 1GRAA 3I7SA 1HIZA 1UWAA 4MHBA 4PMQA 4KFNA 4RDVA 2OJPA 5B7YA 4GI4A 4EXBA 3FYYA 1ZL1A 1JZ7A 1P0DA 3HM7A 3L8KA 1ZCOA 3N29A 4K3ZA 3UYCA 1IGSA 1A5OC 4GX9A 3UWQA 3DZ1A 3POHA 2P0OA 1KFJA 2DY3A 3G5EA 5FL0A 2VJXA 2PU1A 2Q01A 2G5WA 3KDNA 4J3UA 2OU4A 1XICA 3UESA 3VX1A 1G4PA 1UW9A 1JUBA 4DNAA 1J96A 3QM3A 3VMNA 3PS7A 4NILA 3SI9A 4M6QA 3UZ5A 3FGCB 2XIMA 1XIEA 3BMWA 4ZB0A 3EDJA 6A3HA 5CH9A 3REQA 4AZIA 4C1LA 3AYSA 2W61A 3C86A 1ZXIC 3ABZA 3W7QA 1QPRA 3CH9A 1QNOA 5GNZA 1W5OA 3ARXA 2CETA 4TTUA 4M3PA 3KZPA 4K2SA 4PSPA 2DT1A 3WNNA 1Z6KA 1WOAA 2I7GA 1XLFA 3FJ4A 3BVJA 4AF0B 4AB4A 3UVAA 4XIMA 2CWNA 4EVZA 4E8DA 2Y62A 3OEXA 4JHOA 2BG5A 3RN6A 4UTKA 4M5PA 4UTMA 2I5GA 4XZ9A 2DSKA 1U5HA 1GETA 1CXLA 3WQDA 2Y5SA 4EMIA 4MB1A 2VOMA 5L6UA 4RDYA 3KVLA 3VZXA 2WPFA 2GVLA 3A5VA 3CIVA 3N2XA 2FJUB 3MY9A 4NL1A 4QNEA 3MHGA 1UR4A 3NPVA 5FEZA 3SUSA 2EKCA 4ZENA 1OY0A 1H63A 1SZGA 3VM5A 2VX4A 2V6OA 3TTYA 1W3HA 1J5TA 1GPFA 5HQEA 4D6HA 3TLLA 1JYNA 3F4DA 2ZFAA 3WBYA 3W1MA 1O12A 4GNKB 2PDQA 4CGTA 1LOQA 1TV5A 1LVLA 4M24A 2WMGA 2YX0A 4AEOA 3TW6A 1KXQA 2PD9A 1P43A 2NT0A 3GLCA 3KUMA 2QYGA 1YTDA 3VDAA 5LIWX 5GNYA 3S83A 2YGYA 1EP3A 2DZBA 2E6FA 4LF2A 2A0NA 3WK1A 1VKFA 1MZHA 1GCYA 3Q4DA 4K7YA 1RPXA 3M4HA 2HEJA 1XYFA 2OO6A 1GQJA 1FWRA 1CTNA 3BV4A 1TPFA 1V5XA 2V67A 4U31A 3RAOA 3T8QA 4AZBA 5HNUA 4TQTA 4BI7A 4HGXA 2ANUA 3HPZA 5BCAA 2ZZ6A 4BHYA 3EMZA 3DHFA 3IACA 5C9WA 7PTDA 1YQ2A 3ZM8A 3PPFA 1CI1A 1OX6A 5JH2A 4XG1A 3IK4A 5D32A 1SQ7A 1P48A 1TWWA 4L4LA 5FF0A 1VCGA 1WDWA 5M5DA 1HXJA 1R9XA 3E2QA 1VJSA 2WVTA 4AD2A 1UUQA 1BRLA 3EANA 5AVNA 4KESA 3LN3A 1JPMA 4QGCA 5FF2A 1IQ8A 3UPMA 2VEPA 4ADUA 3NVVB 3IEBA 3GDRA 2X8RA 3UGRA 4W7WA 1V4YA 2GJXA 1QI5A 2WOWA 1FWJC 3WK0A 1PJ9A 1U2YA 2ZUNA 1GJPA 2BLEA 3GZAA 4ZOAA 4CD7A 1KLZA 3F03K 4GRSA 4UOQA 3ARQA 4YJ5A 1NWUA 1H41A 1EQCA 5LIKX 3MV01 4FOJA 2JEPA 3N17A 1RJRA 1DHPA 1E6XM 4KT2A 5KEZA 4CQ8A 3UR2A 1B5TA 3WELA 1A50A 1QXLA 4MTVA 2QCFA 7A3HA 1W1TA 4PBEA 5I3HA 4LXFA 1NY1A 2HS6A 2WZHA 1QI4A 4UR9A 3PC0A 3MMUA 4GOAA 2VDHA 3T05A 5JBEA 3GB6A 1U33A 4GYJA 4B16A 4B92A 1E0WA 3S4TA 1A4MA 4KGJA 1DQXA 2FPTA 1V3JA 1R3QA 5GJPA 4MAVA 3WDHA 4QS6A 4O11A 4UFMA 1E9LA 3FVDA 2X8CA 3AC0A 2AMXA 1BFNA 4WJXA 1SSDA 4WVXA 1X7IA 2A5HA 4GNVA 2WB5A 3UD6A 1WXJA 4B3LA 3LSBA 2DVTA 3W76A 5EY5A 2YFOA 3GH5A 1J12A 4LVDA 1TPH1 2F6KA 3CNYA 4MKVA 2V5CA 2ZDSA 2EF9A 2YQUA 2F2HA 1ICQA 1UJPA 4BF7A 2J47A 3V5OA 5H6HA 1Q45A 3RPDA 1DJGA 1FHUA 3W82A 1TQJA 4PUNA 2QUTA 3SEPA 2INFA 2OCZA 1XG3A 3WY1A 3BICA 1AJ0A 4WR3A 4N42A 1R7OA 2J7BA 1WDSA 3MMTA 1AL7A 1VEMA 4HPHA 3L4WA 3MUY1 3UGVA 4ECLA 1MXDA 2P1FA 1XYMA 3RX4A 3TQKA 3M5ZA 1Q6EA 1XLGA 2X8GA 1UG6A 3OA3A 3EX1A 1VPYA 1X1OA 4WY0B 1VPXA 3H2OA 3ITLA 1DBTA 2D2HA 1QCWA 4RZ6A 4I9JA 4P7LA 3AJXA 3AN1A 1A53A 1W91A 1Z42A 3FAWA 5H8MA 1IHIA 2FH8A 3WQ6A 3CLMA 3RUBL 1FEBA 1X7FA 4RZ5A 3VGEA 2J78A 4PFMA 2GQ3A 4YVXA 3T2QA 4I6KA 3LLDA 4E38A 3WH7A 4EAMA 4U2YA 1HJQA 5AC4A 1GREA 1XFCA 2ZC8A 3TKFA 2ZC1A 2PWEA 4H9TA 3W25A 3FIGA 3WLSA 1JCTA 2WCSA 2DU2A 4MF4A 3AI0A 4WDWA 2QXWA 4R85A 4E8CA 1R2TA 2DZWA 5IHRA 1WKEA 2F61A 1PTAA 4DRSA 4INFA 2AQVA 1VRXA 3QQ0A 1BF6A 2Y85A 4LUSB 2I16A 1UR1A 2CFYA 1UBSA 1P0KA 4IG2B 1EJWC 3G3DA 3R0UA 4MWAB 1U1JA 1VYPX 1R9YA 3TOPA 3WN6A 1R87A 5DN1A 3VE9A 2MUCA 3CBWA 1E6ZA 2PDLA 1RHCA 3DI0A 1UKQA 4TVYA 2GSEA 3UVIA 3D9XA 3WFAA 3XINA 2QUNA 4XBKA 3GDLA 1CGUA 2IKJA 4EOUA 3I6EA 4LANA 4AVFA 3OBAA 5H8UA 3GE7A 5EMUA 2V30A 2PU0A 3QZ6A 4Z0SA 3RU8X 3H4WA 2BBFA 1Z32X 4RNJA 1ZUAX 4QAIA 4AWUA 2YDQA 4YN5A 4Q8NA 1PIFA 2YDSA 1BAGA 4PE8A 2CW6A 1K7EA 2CBJA 5D2WA 3UPWA 4HNLA 2V2DA 3EOEA 1YBQA 3HQNA 4KEUA 1TSIA 4IJCA 3QLLA 5D8ZA 2QCMA 4DY1A 3A6OA 5HUPA 3R4IA 3RK8A 2G50A 2DT2A 3USZA 4QE1A 2I5QA 2OPJA 3G1RA 4DI9A 1H4PA 1OD8A 1STZA 8CGTA 3R10A 2UY2A 4PTMA 3MYPA 1RVKA 4R27A 1KM2A 3LXDA 3HTWA 4H6QA 5I00A 1PX3A 3CC1A 2WMFA 3TN5A 5HPOA 3KP0A 4MKNA 4AIBA 1KNWA 4JTUA 4YHEA 3ZSSA 2ZZBA 3UCCA 1LUCA 4GIEA 4O0QA 1HP4A 5G4HC 2NLIA 3GFXA 4MFDA 5ABEA 5DY2A 1V3MA 1VFFA 3NOEA 4JIEA 1K8YA 2DZPA 1Y5XA 1A3WA 3QZAA 2WSKA 1A49A 1BD0A 3VMOA 5CG7A 2OYKA 3ABQA 1EJXC 2CZEA 4JTGA 2ZTJA 3BCFA 4FXSA 3KRBA 3BW4A 1F3EA 1U22A 4DF2A 2VTFA 1GVFA 2DZXA 2E5DA 4XTDA 3UR7A 3E9AA 4JEJA 1LBMA 1VHNA 4M29A 3N04A 1Y5VA 1P0NA 3S5YA 3P14A 2CITA 3WLHA 1OCQA 4HZ7A 2YL9A 1AA1B 3WQOA 4U4MA 5HANA 3FHAA 2EQ7A 2F9RA 4CNPA 2O0TA 4NI3A 2FPVA 3GG8A 1AMYA 3CM4A 4KWOA 1G1YA 5D9NA 2QDHA 4L56A 4JTCA 4AD4A 2Z27A 1QRQA 3D6NA 1WKDA 4WF7A 2OSXA 3QF0A 4GHRA 3DYOA 3EXRA 4W8AA 1RLCL 1EO7A 3B0PA 2FTWA 3DFSA 3BAWA 2X2YA 1RCOB 3VIKA 1VB9A 2QPUA 3D5HA 4UTUA 4H4ZA 1W8SA 3A4AA 1XX1A 3WLTA 1CGYA 1YNQA 3AS2A 3I68A 3FNDA 2NXGA 5H1WA 1XIJA 4C6NA 4UZUA 4XSMA 1BG4A 4RL3A 4C6KA 4XAZA 4OOZA 1OADA 1OCNA 3EUB3 3R07C 2ZUUA 4HHPA 4NI8A 3NA8A 2NQ9A 3A24A 4H4WA 1GV4A 4LSBA 2V3DA 2Z1WA 1FFQA 4MVAA 4F2TA 4PCFA 3QZEA 2Q3OA 2HE5A 4JFSA 2XFFA 2DW6A 2OGYA 2WSRA 2V9DA 1O5KA 1Z9AA 1MO9A 1MO0A 4DO4A 3M7SA 1ZS2A 3BUVA 4ZOCA 4B9ZA 3TA9A 1VENA 4YVPA 3NZPA 3LADA 3LQGA 4PMDA 1KFCA 3DBNA 1XLHA 4I5XA 1LL7A 2EPLX 3K30A 3PPGA 1QI3A 3S5NA 4DYEA 1W1VA 1HUVA 3HO8A 3KLKA 1HT6A 2UY4A 3N34A 2YBTA 4PYSA 3R25A 3LMYA 4DZIA 1CX9A 4K1WA 2ACQA 3DGBA 3NG3A 3W7NA 1KN0A 3DAQA 4WSHA 2W66A 1IEIA 3AZRA 1QNPA 3K5XA 4GIRA 4J1OA 3TTOA 2ZRZA 1UH2A 3BAXA 3EDDA 1CB2A 3BMXA 1TX2A 5IFPA 4GACA 1GG0A 4M7TA 1EBDA 1W5MA 4S1FA 3PPHA 1XIGA 1VFSA 3L0NA 3KE0A 4WHBA 3VGFA 1CENA 1I4NA 3WSUA 5F2MA 2VENA 1V59A 1SR0A 1WBJA 3GHRA 1UIPA 2BXZA 2DSUA 1W9DM 2WPCA 5I5RA 3CEPA 3MYOA 4PBGA 3MSYA 4H4RA 5HUOA 4R3UA 1LM1A 1S5NA 3GU9A 2Z26A 4L9YA 2OQLA 1FFVC 3HF3A 2FB3A 3ATYA 3SUWA 2WWCA 5BMXA 4XTIA 3CV2A 4HKPA 2V82A 4PGLA 1OYAA 2WW5A 3IJLA 3TYEA 1TKKA 1GW9A 2AKMA 5DCDA 2WMIA 1ZJAA 5D4YA 3QW3A 3VDCA 1Y8BA 3BQ5A 4PULA 3F1QA 3UXLA 3WLIA 5DRCA 1Z8AA 3LY0A 4Y9MA 5IOBA 1UH3A 5EB8A 1K9FA 3C2OA 5A8OA 2GVYA 2NVAA 3DFYA 3MI6A 5HATA 4NX5A 2WJZA 4U28A 2HZGA 3OG2A 2H9AB 1UKPA 3T2PA 4W89A 3DIPA 3WLRA 3LPPA 3P3BA 1E1CB 2C14A 1TB3A 3TSDA 2TAAA 5C9ZA 1KXVA 1J10A 1X2HA 3GXNA 3K8KA 4MUZA 1PAMA 3WF2A 1JQVA 3O7UA 3PUOA 1FUYA 3BW3A 2ZUWA 3II1A 3LHUA 1NELA 1XDJA 3PZOA 3HGSA 2NV2A 4XD5A 4US5A 2D24A 3DFOA 3WF0A 3WMLA 4FXRA 3LSCA 3RPTA 1V3KA 1M5WA 3O6AA 3P7YA 3CK5A 3NL2A 4BF5A 4YU1A 2GGGA 4YVVA 2OT1A 1JQXA 1XC6A 2G95A 2BOFX 4J7RA 1V02A 3MKKA 1XSJA 4H9UA 5BRPA 5AC7A 2PC8A 1DXLA 3G18A 4LNCA 3EF6A 2JGQA 4AX6A 4LVGA 4KWUA 1EDGA 1XH2A 3EA3A 2XVNA 2CHOA 2PGRA 4YLWA 4NZ3A 5I79A 4GC3A 3SURA 3BJFA 3ZR4A 3ENLA 1GYLA 3L66A 3RR4A 1TPUA 4ZQRA 1EH9A 1KFKA 2E77A 4LAUA 1OZQA 1O6IA 1J6OA 3WDRA 4IXHA 3IIZA 3QMTA 3R8HA 4DIAA 3WYZA 1T41A 4JTHA 4MGGA 1EPXA 1TYGA 1V51A 5K9DA 1N7KA 1F8MA 2HRWA 3MO7A 1BXNA 2B4GA 2FFCA 1JPIA 2C15A 2Z29A 4IF2A 3R58A 1KB3A 2WC3A 5F7UA 3GQYA 1IT7A 1NP2A 3S1UA 3KVMA 3WQCA 1K6WA 3RR1A 3A4JA 1TMHA 5CGQA 4C5YA 2XYLA 4D8AA 4M1RA 4LTSA 2VGIA 4Z1YA 2O7SA 3F5LA 3ANVA 3ITVA 2FIQA 3Q58A 3P62A 1SB3B 3TH6A 1BYAA 4GBUA 4AEEA 4JFUA 3CV1A 1SZRA 2E5AA 3AHZA 4AXNA 2BC0A 3VE7A 5DLCA 2DVXA 3PR2A 3LPGA 5CAKA 3IRDA 4GY0A 4GI6A 3VK5A 1N55A 4ORMA 1VBJA 2BHZA 7TIMA 1TPC1 4XKMA 2G8ZA 3T4CA 4M56A 3C2FA 3BGJA 1KRAC 3G0SA 4FXJA 4QXIA 4H3DA 4BF9A 4JKMA 2D2OA 3QY7A 1FECA 2EPHA 2J75A 3IANA 2BB0A 2YAUA 3LCFA 2XZ9A 1TQXA 4RW5A 1W9BM 4B91A 4HMNA 4C6EA 1RK5A 2IXVA 4MNLA 4FF5A 1K7FA 2HNEA 3UERA 3UJ2A 2VFHA 3RCNA 2WPGA 2WOIA 3UNTA 4EKJA 4QLJA 3AS3A 4I9MA 2JIEA 4D6FA 1LYXA 4H8HA 2YB4A 3B8TA 2C91A 1FP8A 1DWFM 1DWAM 1VS1A 3W83A 1VRDA 1SFLA 4UTTA 1J18A 2QAFA 1KGUA 2XSBA 3TN4A 3SCRA 3S1GA 3UWYA 3M64A 4J57A 3B9DA 4E3TA 2OZ0A 3AHXA 2PWGA 2XVPA 1F9CA 1HKIA 3PNUA 1TV3A 3ZWSA 3W87A 1EX5A 2J66A 6ENLA 2GJRA 3VTRA 1ZNNA 3DC8A 3IIOA 4V1XA 4DHGA 1YRRA 2EG6A 1QO5A 3OPSA 1W1PA 1SM9A 4LUTB 4O0KA 3EKZA 2EXOA 1N62C 3R43A 1TV4A 3THUA 3WQPA 3M0LA 5CBBA 3HMJG 3QV8A 4JKKA 3SQMA 1P1XA 3ZJKA 1FQ0A 1D2KA 3A23A 4ICMA 3NZQA 2F5ZA 4GI8A 2G97A 3MJMA 1YADA 1Q7MA 1FWEC 3EX4A 3SCOA 2P0IA 1BYDA 1HX0A 1YDVA 2PB1A 3JR2A 2BZNA 3GNRA 2QJHA 5FJJA 3NQ8A 4I9AA 5A6LA 4JQ1A 3QSRA 1V02E 4ACZB 1JDDA 2ZRWA 6TIMA 5C7HA 1RQBA 2ZXQA 4PCTA 2ZX9A 1EB3A 4XK2A 1TPVA 1TA3B 5A6AA 1NHRA 3WD1A 2Q71A 4A6GA 3GDKA 4S3KA 4H4XA 3FA4A 4PODA 1YNPA 3ANYA 4V1YA 4DWDA 4EQXA 4QROA 1FX6A 1AOGA 1ZKQA 1BG9A 4B5NA 1HF6A 4JIRA 1BZLA 1D8WA 3O07A 1H50A 3RM4A 4I6VA 3GVGA 3T40A 3DECA 5CBIA 3GNXA 3WBAA 1HQTA 3QLDA 4G7EB 2XDFA 2YCKX 3TJ4A 5KMYA 5DCEA 3KCJA 2E8ZA 1KBBA 5HJYA 2PMQA 4JTTA 1FDZA 2I56A 3B8DA 3URBA 1QK2A 4UTIA 4F0MA 3JU2A 1A4LA 1XSIA 5GNXA 2OQHA 3LNPA 3WQGA 1GQIA 3TEVA 4NRRA 1XYCA 3WBWA 1DE5A 3BXWA 1KXTA 5AFDA 5I7GA 4Z2JA 4U10A 1F76A 3OO2A 5I3KA 4JTSA 1ZY8A 3B9AA 1MUMA 1UD2A 1MDLA 5CCZA 1SW7A 1E6NA 4EXQA 3W1PA 3W70A 1TV8A 1IEQA 3AZSA 5D2TA 3FXGA 4F48A 3HQOA 4Z2KA 2J7EA 3C3UA 1W1ZA 3REQB 2Q09A 2PDKA 1GEUA 4A3QA 5T26A 1ZQ5A 3K4DA 2YVFA 3KX6A 1KR0A 5I6SA 1N63C 3W9ZA 3TJXA 3WLNA 4IMAA 4CNOA 2IQ0A 3VAVA 3O0HA 1ZTVA 3SFKA 5EBKA 3JZEA 3FA5A 3L4ZA 4DO5A 3GH4A 2VP8A 4A8NA 4JGDA 3T07A 2WZIA 3N4AA 3TZNA 4OQVA 2WZEA 1SYTA 3F5KA 1HGYA 4PZVA 2HSAA 3VPLA 4NZFA 4XUGA 1ZALA 4CNTA 2X1UA 3EX3A 1A5BA 4HJWA 2WPEA 4XKYA 1V3IA 3SCSA 3LHYA 1H2JA 1VZWA 4MY8A 2IKIA 1R7AA 3BZGA 1H60A 4XISA 1W3IA 2ZVRA 6TAAA 1Q85A 4NXKA 3G6MA 2C0AA 4E2BA 1LOSA 3ITXA 4LEQA 3RPMA 2J77A 5XIMA 2QV5A 1KGWA 3NL5A 2EJ1A 3GNNA 4RNFA 2CZVA 3GVWA 1E51A 5HOSA 3H2NA 4EM4A 3PUGA 5I3IA 4DNMA 3WNOA 5HMEA 3DDMA 1EZWA 3FOKA 4OBRA 3VA8A 5CSUA 5JUVA 2EQ9A 3NVDA 4FS9A 3DFNA 3NFUA 3T6CA 4OIFA 3BH4A 3GD6A 2YXGA 5I3GA 4US5D 4IPIA 4RKAA 2E67A 3WIJA 2OYLA 2VQUA 3FCPA 5FOOA 3MB9A 7REQB 3QW4B 2VFFA 4G1NA 4PFHA 1L6GA 3L67A 1JJKA 1N2VA 4IXXA 3NYZA 3R8RA 5I78A 4P8WA 2NXIA 5G2IA 2ZZ1A 4Q4KA 2CERA 4Y9PA 3A22A 1GG1A 3O6YX 4IPPA 3N2CA 3GVVA 3B0YA 4ZQMA 4E6MA 2R6OA 3H2FA 3AXKA 2XPKA 1WDDA 5JU6A 2R1KA 1BRLB 4ZO8A 4OE7A 2CZFA 3N6HA 3O05A 1Q2SA 5FA5A 1DXFA 9RUBA 3ZIZA 4LJ3A 1ZY9A 4RZ4A 4NVTA 3WNLA 2WQDA 3RLVA 1P6WA 4Z2IA 4O10A 4F3HA 2V69A 1I2QA 3DN5A 1W3TA 3K2GA 3NRZB 3LNMA 5CSSA 4JQ2A 1AW2A 2E1WA 3EPMA 2PDXA 1M7XA 2ZA3A 2WKJA 1OIFA 5FACA 5LYRA 1XBYA 1KQYA 3POCA 3P2VA 3SQLA 1E4MM 3GFZA 3N4EA 4ML4A 5BNKA 1NWSA 3QHMA 2QCGA 3W2KA 3BJTA 4H6EA 3AYTA 3OZOA 4PUJA 5I77A 1YXDA 4KWWA 4HB7A 2R1LA 3PJUA 1LP6A 4UNIA 1S2UA 4J2PA 3LGEA 3PK7A 4WDXA 3LTYA 4AU0A 2WHMA 3ITCA 4JHZA 1VFHA 3F7JA 3FGCA 4CLMA 1A5UA 2W3RA 3RO6A 5CKSA 4S3DA 4Z1BA 1LBFA 4BY3A 4HHLA 1EGVA 4ERGA 3IVUA 1K4QA 1GKPA 4IUOA 5L9FA 3C4UA 2VFIA 1H51A 1FP9A 1TMQA 5IDIA 2D3LA 3N3MA 4S2CA 5FAGA 1AFSA 3MQTA 5G2HA 1ICSA 4XO7A 4BURA 4KEZA 5REQA 1PWMA 3RITA 1N82A 3AWNA 1R46A 4GIAA 4BQ5A 1S3HA 3WH6A 1JRBA 4P8UA 4O19A 3S6OA 3MI2A 4LH8A 3S3GA 4W4QA 3PWAA 5AKQA 1YXYA 1V77A 1GVYA 2XWDA 1UOZA 3UY8A 1HKMA 3A9IA 4OKDA 3W72A 4GVFA 5CLTA 4JIQA 2VUYA 3T8LA 4RX0A 4AMCA 2MNRA 4RPQA 3QVQA 3CIXA 2EAWA 3ZXWA 2A3CA 2PE4A 2VD8A 4C7GA 3G0XA 1LROA 4ZQOA 4GUHA 3GU2A 4Q8OA 1QNQA 3HOJA 3S9IA 1VIZA 2OEMA 3BAIA 1VP5A 2VGGA 1XQLA 4M0XA 4Y2WA 2BDQA 1YNYA 4ALDA 4N0RA 1Q65A 1KBIA 3TQPA 4H7ZA 4A22A 4IGHA 5BU9A 3KVJA 3QV9A 1UMLA 4JQAA 3R5EA 4FX7A 1PKLA 1H11A 4MJ4A 3BLDA 5EA9A 1MYRA 1TE1A 4F0SA 4Q22A 4NXSA 3CB3A 2VFEA 3NVYB 5LNWA 3QFEA 4JOMA 1FA2A 1EBGA 2QMKA 3NQDA 1QPKA 2W91A 4YMZA 2ISDA 4H50A 3KCLA 2H3BA 4D9PA 4OOUA 5FJPA 5EGRA 1ZJBA 3TN6A 5E1QA 4LU0A 3LCIA 2E0PA 4Z17A 5G5IA 3QMRA 5JCNA 2YA2A 2OWCA 6PTDA 2VGFA 3TCEA 3AU6A 2BY0A 2E5CA 4FK9A 4AVNA 2GDQA 1J0KA 3TAOA 4B5UA 1FH7A 2OZ8A 1NWTA 1ITCA 1IWBA 5C2XA 3LV6A 3WQVA 4FA3A 1O5QA 5TR3A 1CGTA 2PCQA 3ES7A 3OVPA 4R53A 4WOQA 2R14A 1EO5A 2XH0A 3PZGA 4QHRA 2JF6A 1VD6A 1L6YA 4HPGA 3L9CA 4U33A 1CW2A 2ZWZA 2ZDRA 3GXFA 3DHUA 2A7NA 2YJQA 5BXTA 4JQ3A 5EBAA 3WK3A 4F0KA 2DZAA 2FDSA 1XF0A 3B03A 2ZUVA 4JAWA 1YBQB 4L9ZA 4IH3A 1Q6DA 2GRTA 3I4EA 3W7GA 1EA9C 4KPLA 5G1YA 3GC2A 1KTBA 3SUUA 4W87A 4TVWA 2I5IA 3HPFA 4JX6A 2VC7A 2QZRA 3W1QA 1TWSA 1NPXA 3VIFA 3SR6B 2V5JA 2C8NA 2ZZCA 2WBKA 2JKAA 3DH9A 4S38A 3M6YA 4MPKA 1W54A 3G77A 5FI8A 4ZR8A 1LUCB 3DU0A 4AG0A 1RJQA 3UJRA 4XVDA 2FHFA 2Z00A 5D03A 4IP4A 3BLOA 1JZ8A 1TYTA 1S39A 3Q2DA 3IJDA 2XVLA 4E2OA 5BXSA 1GXFA 2W55A 1X39A 2JIWA 3NIYA 4TU1A 1KM1A 3IIVA 2Z1SA 1FEAA 3URAA 4BV6A 3RCMA 3STEA 3W2JA 1LJYA 2VOTA 4ERAA 3TLQA 3C0LA 1H6VA 5LNVA 2Z4GA 4AFYA 3CGDA 1BXBA 1KM4A 1V0KA 3OC4A 4DNHA 4M6PA 3M0YA 3ARWA 1H5YA 3ZQ9A 3DKJA 3OLEA 3OBKA 1WDPA 5LZLA 3SGUA 2WKGA 2DZTA 2X2GA 3IIXA 1XYAA 4NHVA 2PEVA 2CLLA 3G1FA 3T42A 4ES4A 1M65A 4JR5A 1EJSC 1OFOA 3HQ1A 1TE6A 3WQWA 3XIMA 4WKHA 1I2RA 3PAJA 1K77A 4FR1A 1BHGA 4BZYA 3VKCA 2OFJA 4P8XA 4R33A 4GQRA 5I09A 2VRQA 5D09A 4O4WA 1RAKA 4EPDC 4H4IA 3TW9A 3LK6A 5I23A 2Q3RA 4TR9A 1UKTA 3KFTA 3AM9A 1CXIA 3N3TA 2VDIA 1UMYA 3RFAA 2DZUA 2V2HA 3WQFA 3TONA 3LCGA 1V03A 3TUUA 4ZVJA 4K8HA 3GTXA 5CZKA 4GYKA 1YMYA 1KQZA 2ZYFA 1PKYA 4E4UA 2O4QA 1POJA 1XHGA 2VXNA 4DAFA 1SO3A 3NQAA 2WP6A 1PL9A 3M47A 4ATWA 1QW7A 4GY1A 4IG2A 2PRMA 3GVRA 4PTVA 2J8GA 4HNTA 3ID7A 2EPNA 1TPB1 1RA0A 3L5MA 4IT1A 4ZTXA 4WZHA 4XD4A 5JVLA 3AQUA 4B4HA 2OX4A 2I57A 3ALGA 1K8XA 2Y7GA 5C2GA 1XD1A 1UA3A 5F2IA 4DXVA 2Y63A 2TODA 3BG5A 4IPNB 3UCDA 1DKWA 3QTGA 1F5ZA 2JALA 1QT1A 1JAEA 2J9ZA 3WFZA 3B8UA 1EFZA 1BVNP 1X8FA 3V0UA 3WMSA 3H7VA 3C52A 4PCSA 4PMRA 4ILSA 1JZ4A 1RALA 1XLEA 2P5NA 1N60C 1ZRQA 2CLIA 3HB9A 2RDWA 1XUZA 2WHJA 4AD3A 2Y88A 3V35A 4GGBA 2XJ7A 2WM1A 4AVOA 5GJNA 1OG6A 5E93A 4GKTA 1KR1A 2CESA 4HD5A 1WAUA 4KBXA 3QMSA 2QV4A 1XLBA 3L23A 2J7FA 4WIWA 3WQ5A 4JCLA 4I3GA 1JXKA 3EAUA 1H49A 3DEQA 2PTWA 3EB3A 2C1HA 3IGSA 3MMWA 4PRWA 3JS3A 4ROQA 1C92A 2UY5A 4O52A 3MSGA 3NCOA 3OVRA 4E4PA 3M0IA 4DVOA 4AIEA 1DQWA 1H09A 2BSLA 2EPOA 1ADSA 3OTRA 4C1NB 1WXZA 1GW1A 1KTCA 3MUCA 3N73A 1XCFA 2V2CA 3UP8A 2AL2A 5I02A 1B31A 2GSJA 3S2CA 1KW1A 3N18A 1QMLA 2HXUA 3B0XA 3TN3A 4EE9A 2H8ZA 3W27A 2J25A 1YDOA 3WLPA 2W9MA 2AKZA 3MVTA 4D6EA 1H7WA 3QY8A 3N4FA 3QYQA 5I3FA 3WMBA 4AHQA 2XSXA 5E0CA 3NDYA 5JBFA 1KGXA 4AHOA 2QDGA 3UJFA 1WDRA 1Q6RA 2GZXA 4M7SA 4UFHA 4HSOA 5J8LA 1JRPA 2CHRA 2PSNA 3P84A 1ML1A 4YPJA 1X1NA 2Y4SA 3CGCA 5DANA 5HMDA 3DESA 2QNEA 1SW3A 2O9RA 1UWIA 2CBUA 3HMCA 3KM8A 3GDBA 2Y6ZA 1G4SA 3TNBA 4MNMA 2W6RA 4A35A 2DQWA 3V5CA 3E1F1 3QBUA 3MWCA 3HGOA 4NT0A 1A5SA 2FJKA 4QEEA 2V5KA 3H54A 2GWGA 1OIMA 1MXSA 3N6JA 3PHAA 2FGLA 3EWWA 2BHYA 3B9NA 3I3DA 3UZXA 2PWFA 1GPWA 1M1BA 4GLEA 3BZJA 1D3CA 2PTDA 1UP3A 1CB7B 1SJCA 2J6XA 1AQFA 1AJZA 3OYXA 3W73A 4JPGA 4NAFB 3RX3A 1GERA 1G94A 1FWDC 3FX4A 4H9ZA 3FS2A 3VDGA 4HK6A 5FKYA 2WOVA 3PFRA 2ZQ0A 3VIMA 1R6WA 4PUWA 4PSRA 3SRDA 4H7VA 8RUCA 1K7XA 4PEKA 2OEJA 4MUPA 1TIMA 4CEUC 3O8AA 2J3NA 4D72A 1XKYA 3WJXA 3E0VA 4DF1A 2P8BA 1NSJA 4WGHA 1ALDA 4HOWA 3BLFA 3CV7A 1TWIA 3MI3A 1NOWA 2G3FA 3NO1A 4J3VA 4Z1CA 5U25A 4UNKA 3IV8A 2KAUC 5E9AA 1BWCA 3P81A 4V2XA 1I45A 1TTPA 5KZ6A 4HNNA 3UXIA 1MUWA 3DOPA 4AX7A 2TSYA 4LA1A 3LERA 1YXCA 3TDFA 4LY4A 4EP8C 1JCLA 4TO8A 3ONCA 2OT0A 4GUJA 4RNIA 4W84A 2BOEX 4HNUA 3VNJA 2WLYA 2W62A 3MHUA 4KPRA 1UC4A 2TMDA 4C7FA 2DUXA 3E12A 5MHBA 3E2RA 1J8VA 1J9YA 1S3TC 3W1AA 1OQFA 4TVCA 2EHHA 1GVEA 4L1WA 1MRQA 3W7MA 1EL3A 1DWIM 4W7UA 4AZ5A 1E71M 3UWZA 1ECEA 3UWVA 3VCNA 4UFKA 1O66A 3IVSA 1GZ1A 2X40A 3Q65A 1V0MA 1XRVA 2CLFA 4B3ZA 1K3UA 4IWWA 4EXAA 1BQGA 2RGMA 3E0IA 3N6QA 4LQ1A 4DJFA 1LT7A 1XIMA 1KM5A 3FSUA 4X2PA 4B5WA 3DENA 3DKLA 1NEYA 1EIXA 1F6YA 1FHDA 3NUKA 3S1XA 3C56A 1RBAA 1AD4A 1JF6A 3QFWA 4F0LA 1K70A 1ODZA 3U3HA 1VYSX 1O5XA 2FQIA 4Q8WA 2JGYA 1L2UA 4AH7A 2PDCA 2CDUA 4LB4A 4M82A 4MNKA 3VD9A 3MCNA 2VEGA 5EU9A 1E55A 2FMNA 2B31A 4GGHA 4FNPA 1QNRA 4LV4A 4Q4SA 3KLLA 2A4AA 3JW7A 3BQ6A 1QOPA 3U2ZA 3V7PA 1U1HA 2IKHA 2HVNA 2BASA 2FZ8A 3V0TA 3LRKA 4WQ6A 1WZLA 2WHLA 1S5VA 4ZQCA 1DIDA 5IDZA 3CXBA 2PDYA 3ZYZA 1TIWA 2R8WA 1MXGA 3LRLA 5BOOA 1K4HA 3A3WA 4NRSA 3W6YA 2EG7A 2X16A 3KBMA 1KCXA 2YL6A 3ARVA 3GWQA 3T0DA 4HJFA 2PDWA 5LSMA 4LS0A 2WANA 3CGTA 1FCVA 3T09A 4JYEA 3QQWA 5KINA 5I0DA 1QPNA 4JFTA 3ABXA 4AC1X 3Q37A 4NEVA 4Y96A 1S46A 4AQLA 5LIUX 4LNYA 2YLLA 3L0KA 2XN1A 2ODOA 5F4WA 5PTDA 1FKWA 4C90A 1GVQA 1S2TA 2VZTA 3LOTA 3VOCA 3KRZA 2OX1A 5HDRA 1YTKA 1EJTC 3UWWA 3DG3A 4LBSA 4CD4A 2J74A 2PFHA 3U2CA 5D9MA 5ABHA 4W8BA 4DBEA 1W3JA 2RDUA 2J7HA 3EA2A 4FP1A 1D7FA 4O1AA 3FXYA 1AMKA 1Q5MA 3RGTA 1TZ7A 4GQBA 3KHJA 9CGTA 4HSHA 3PZUA 4UTWA 4NX0A 3N13A 3TWAA 1GOXA 3EKGA 5CG0A 1H0IA 1MRAA 1THFD 3SY1A 1XISA 3L4XA 3K1DA 3TA6A 4DYKA 4XBSA 2ZIDA 3MMDA 2WC7A 1P0EA 3AS0A 1H7PA 3N14A 4JS3A 4X61A 2UZ9A 2R82A 4CCZA 5DX7A 3F2CA 1T6MA 3WK2A 1DEDA 3KTCA 2QEZA 3VXGA 3E3HA 3KBNA 4FHAA 3RU6A 1ONFA 1GONA 2Y1HA 4J3ZA 3OZMA 3M46A 1EC9A 3VD5A 3HFTA 2BGSA 2BOGX 3IVTA 1MMFA 2OLHA 3W1TA 2X1TA 3LEPA 1MW3A 3G6LA 1Z41A 2I9EA 5JIWA 3PNZA 4EQRA 3LHZA 4GE8A 4JTEA 3UF9A 3NPUA 1NWRA 2XIBA 5FSEC 4J2MA 1FWHC 7TAAA 4MZYA 1RP8A 2O9PA 4TVUA 1EWDA 4C6DA 4LVBA 1RVGA 2XISA 2DEPA 3USBA 1SPQA 2JEQA 3NGFA 3GNPA 1LWHA 3TSMA 3BPWA 4DB7A 2J7CA 2TPSA 2HCVA 2FFIA 3VDHA 2YR1A 1GT8A 4QTGA 3J7HA 1B90A 1O1ZA 2JKEA 1ICPA 3MSRA 5HR7A 4B5VA 1A5CA 3HFYA 4HQVA 3BGGA 2RKXA 2WP5A 4AD1A 2NX9A 3T7VA 4GKLA 1NAL1 2ZZ0A 4DLMA 3VMPA 2O9OA 4MPQA 1GKQA 1G69A 3NZRA 4RW3A 1HO4A 3A12A 3B8WA 3KW3A 3IARA 3WJSA 5JCKA 2P53A 3NO3A 1Z89A 5LXEA 3CUXA 2WJEA 4I8DA 1US2A 3VIJA 3WMCA 4DJDA 4HSNA 4LALA 4ASTA 1H1YA 2GUUA 2NX3A 3E5PA 4LBUA 2YOCA 5D37A 1I9CB 3M44A 1B54A 1T5AA 4LF1A 1Y65A 2W0HA 4HCHA 4MZ1A 2F8QA 4KKXA 4ZOEA 2XIIA 4NJIA 4XV0A 4YYFA 3STCA 3N11A 5FEXA 2V5DA 4HT3A 4L65A 1QW9A 1KRBC 4HU4A 3MC5A 3F2BA 3M5YA 3MKVA 2OO0A 4OBTA 3TR2A 1I2PA 1MW0A 1D7KA 4E8GA 4EQSA 1FWNA 2FVKA 3U57A 1EHAA 5BRBA 2C1IA 3PZTA 1FH8A 3Q67A 4FNRA 5HXMA 3FFSA 5AHFA 2C18A 3R8GA 4AC7C 2IW0A 5KVHA 1GYMA 3FJ6A 3NQCA 3TC6A 1M7JA 4MWAC 1NF7A 4HYVA 5C9RA 5TF0A 2GL5A 2E9MA 4X9YA 3KOYA 2Y0FA 3AMZA 4YXGA 3W7KA 3DK4A 4H41A 1KM6A 3MUXA 4WK9A 4EF8A 3CPUA 3TZFA 2NPXA 3OW1A 1KC7A 4PBFA 4LCRA 4A8RA 2Z24A 2WVUA 1I2OA 3W7HA 3T81A 4WDTA 4UQCA 3S9ZA 5FMHA 1VCVA 3OLIA 3MBDA 4MM1A 5E70A 2XHYA 1W3KA 5XINA 2QR6A 1PX8A 1DJQA 2HPMA 3LXCA 2YKKA 4BFAA 3CZKA 1PHQA 3W7PA 5DBTA 1P6BA 5TD4A 1VQZA 1OT1A 3AIRA 3TYZA 1M9HA 5TIMA 2G37A 3K4AA 2E68A 1QHZA 2W5FA 4C65A 4GA8A 1DPMA 1OD0A 5DXYA 2OSWA 3A3XA 2WMJA 4LV9A 3PSVA 4EMJA 1OABA 3KOWA 4X63A 4S23A 4CEXC 1NHQA 2X0HA 3L21A 5A6MA 1CBGA 2HMCA 4O17A 1Z3NA 4Q8QA 5FAJA 3L68A 4C6QA 2XGIA 3MSDA 5HJXA 4B4FA 1H1ZA 3STPA 1UD8A 4R7WA 1RJPA 1OF6A 4UTHA 4DM2A 4M51A 3NNTA 3GNDA 1F4HA 4FB7A 2IUZA 4KMQA 1T0OA 1X2GA 3NSNA 1YPIA 1J6PA 2E09A 1XS2A 1UOKA 1TPWA 2PPGA 1QNSA 5AZ0A 5CAHA 1WUFA 4S3CA 3PB2A 4NAEA 2YYUA 3AMCA 2PWHA 3B06A 3Q6JA 1FCQA 3NURA 5AOUA 4IMGA 3FSTA 1W2VA 4WKFA 3NSXA 2W0UA 2AOSA 4LCQA 1YX1A 1F74A 1RV8A 4UOZA 5AYYA 1ONEA 3UPBA 1W6TA 4HCLA 4OFCA 4MLJA 1XLAA 3CPGA 4ATLA 4BI6A 4DPPA 1DOSA 1LL4A 3CMFA 2E4TA 4HPJA 2BY1A 3SJNA 3WUEA 2OG9A 3HPSA 4TV5A 4H6RA 3HURA 1O1HA 3MZ2A 4GO8A 3SGZA 5K4ZA 3AO0A 2PLJA 4OTKA 2GPTA 4BWLA 2PDFA 1WKYA 1M6IA 5JXQA 2ISVA 5I06A 1AW1A 2HVOA 3BGAA 4MIMA 4L6HA 4S39A 2ZRYA 4DJFD 1DJWA 1XUUA 1C8VA 3P5YA 4J9JA 3UR8A 1E3XA 1XANA 3M5VA 3EPNA 3VINA 1H3GA 3MP3A 4DWSC 3VKDA 3ES8A 1L8NA 4O50A 2H6RA 2XIQA 3NL6A 3RCYA 4I7VA 3W01A 1H1NA 4Y8EA 2IKGA 5REQB 1LT8A 3MUZ1 2A6NA 2NW0A 2C19A 3PTDA 3WQ4A 3W22A 4IL2A 4S3AA 4RJEA 3PUEA 4H04A 3M7WA 3M0VA 3R13A 5HQMA 1QHOA 5BOFA 2VR2A 2CBVA 5K9CA 4RCXA 3TCSA 3MJYA 1AL8A 2QHAA 3W02A 4CCEA 3EWBX 4HBKA 3MZNA 3T55A 3GW0A 1LF1A 1DNCA 4AY7A 3RNMA 5IBXA 5I3JA 3VOIA 4AHPA 1US3A 1LQAA 4XZHA 5A5WA 4DI8A 2PRHA 4UMBA 1S1RA 4S3FA 3QKEA 4A05A 2WWDA 3QPYA 4HIBA 2PLKA 3EBVA 5GRTA 1JF5A 2QPXA 3CZ8A 1MEHA 4HU3A 2Q8XA 2PGWA 4GK8A 5HQLA 4OVXA 1OZMA 4AAJA 1ISWA 3W53A 1AH0A 4UTFA 1RCXB 4M8UA 2VC5A 1JRCA 3AXMA 2ZZ5A 2FLIA 4GH3A 2UBPC 1U5JA 5CPMA 3SJ3A 3EB4A 3NEVA 3K13A 5DT7A 1CNVA 3SCVA 3ZT6A 1A5LC 1TELA 2FZBA 3W6MA 1MW2A 4ZQNA 4B2DA 3H7RA 7REQA 3I7RA 2VHLA 1Q63A 1ZPTA 3W7DA 2FTYA 3AIEA 5DFAA 1DWHM 2FZDA 5I24A 1V6XA 5LNRA 1U30A 1EOMA 3PBGA 4QQ3A 4XZWA 1AQHA 5F2GA 5JCMA 4HOZA 4Y8FA 2VZSA 1S38A 1CGXA 1W17A 4GPNA 3PBMA 3INPA 1JYWA 4J3WA 2QIWA 4HTBA 4AY8A 2JK2A 3AYVA 4NEWA 1SGJA 4DZHA 2J24A 3EOLA 4G7FA 1VEPA 4JHMA 5B7ZA 3FEMA 1E6SM 3VKBA 2P50A 1OC6A 1V3LA 1T99A 2G4JA 3E38A 1O4UA 4XQ6A 2BVWA 4P61A 4DXXA 1OJTA 2ALDA 3PP7A 1K9EA 3RO8A 2J6VA 5GJMA 4N9BA 3PF3A 3EEZA 2GDVA 3VILA 4MMWA 2QCLA 1VGAA 2D1ZA 3HA1A 1G6CA 1LWIA 3KVKA 1OCJA 4JDYA 5HNNA 1BPLB 1JUEA 3SRKA 4GZ7A 5CEWA 2DIKA 4RK8A 3KRSA 3PJXA 3BO9A 3LCWA 3S5ZA 4O14A 3WCZA 1KRCC 2X09A 3UG8A 2W54A 1ZBVA 3I6RA 4MDPA 4ZO7A 1HL2A 1PIIA 4E0CA 1RZMA 4ENLA 1PCKA 1QWKA 1UWRA 3HBLA 4H8NA 4BQ3A 1PE1A 1Q4WA 3QV6A 2WMKA 1OHLA 5HK4A 2GYIA 3GIQA 1Q66A 1M03A 2ZUSA 3CHCA 1PYMA 3WF1A 1B57A 4RE0A 2CKSA 4G5DA 3RF9A 4C6LA 1OGBA 1MOKA 4M1BA 5M1TA 3OBEA 1BLIA 4X0VA 3SCPA 2JQXA 3B05A 4LPCA 3OLDA 4DLFA 3N2OA 3VNIA 4IMEA 3ARUA 3LA4A 3ARTA 2A1YA 4AD0A 5HAOA 4C1KA 1ZBKA 1ZJIA 4ZB2A 1GVIA 4MB3A 4DJDD 4I7UA 3DGZA 1O95A 3GC4A 3CGEA 1TTJA 3QGVA 3TMLA 1W1IE 1B9ZA 3LBOA 3OIHA 4IFKB 4A2SA 1DJNA 2QAPA 4CD8A 1BEUA 5IXEA 1E6RA 2X50A 3ATZA 3M0MA 3S8HA 1B30A 4ADWA 4QJ1A 3FA3A 3WLKX 3NEHA 3WNMA 1WBHA 4NYYA 2GOKA 4LOCA 2F6XA 1H5VA 4JTJA 1WO2A 4F79A 4H7CA 3HJZA 3R2GA 2ZX7A 1EKOA 1E72M 1N8FA 4E5TA 3GG1A 3GDTA 3W85A 2E8YA 3TK7A 5DXXA 1V6VA 4QG6A 4ADSA 4GZJA 3L5LA 3O1NA 2JKPA 1ZP4A 4JQ4A 3NVWB 5LGXA 1VAHA 4WKAA 1CXHA 4C6MA 2YXOA 4QSFA 1GESA 3SSZA 1J0IA 3N9SA 3IJ9A 4B5SA 3HN3A 1NVMA 3TX9A 4CQBA 4KIEA 5DCBA 3PJWA 4H9YA 1HVXA 1GOKA 3XISA 1GZJA 1VH7A 1VR6A 4HA0A 6REQB 3SY5A 3UFYA 3GAYA 4UFIA 3EWZA 4PB5A 1GEHA 3GS6A 3QRHA 4Q4MA 5ABTA 4H19A 3LMZA 3S2MA 4GCAA 2PGFA 1O68A 3BTNA 3V1PA 1T3QC 2CBIA 5DMYA 1X6UA 4H4YA 3VC5A 4PMJA 5FS9A 2ISFA 2Y7FA 4FNTA 4I5RA 1VQTA 3RLUA 3FLUA 1O7AA 4QAWA 2X0SA 3U5UA 3C2YA 2RJHA 4XWUA 1TYPA 2GQ8A 2OWWA 4AZ7A 4HMDA 1T96A 3WD2A 1ZZMA 3GXDA 1M7OA 1YPXA 3F4VA 3NPXA 3CQIA 5HINA 4AD5A 3C8NA 1NFBA 3TWBA 1PZ0A 5CBJA 1P1MA 1M41A 2EEXA 3FJLA 3SBFA 3UA3A 2ON3A 1AVAA 3MDWA 4H4VA 3C5QA 3EOSA 3W3OA 3BLIA 3DFQA 4NY2A 1XP3A 1A5AA 1JPDX 4IM4A 5HWNA 2GFTA 3IJ6A 4W8LA 3NDOA 3H4GA 1TV2A 4CNSA 3OZPA 3B8SA 1WP6A 1J4EA 3WNKA 3WF3A 4J3XA 4DWSA 1FFRA 2RGLA 5MF5A 4BQ4A 1MI3A 4C5ZA 4H4UA 1VDVA 5CC7A 3LBMA 1G7UA 1HJWA 4Q33A 4M81A 4DM1A 4IX2A 5I3DA 4QJ4B 2F2KA 2YW3A 3BLLA 3HRDC 2CKRA 1PZ2A 3IJQA 4N6EA 2FPYA 1ZX9A 2GDUA 2AQOA 3V0SA 4O12A 5CZJA 5ENLA 3TVAA 2YIHA 4H1ZA 5DQPA 4NYUA 3ZLFA 4HYRA 2XWEA 1PZ3A 4F4RA 7ENLA 5FJIA 4WSKA 2VX6A 1DJHA 5CZSA 4X9SA 1BWVA 3KXQA 2PD5A 4LYQA 2ZX6A 3V18A 3BV7A 4L80A 3EWXA 3ONBA 2P8CA 5LXXA 3QPEA 4P7OA 2A3LA 2VUNA 3B0UX 1UASA 2J13A 1NHSA 4DYJA 3WLJA 4O57A 4PN2A 3VNZA 1XHCA 3GYCA 2A7RA 1Y5WA 3O2LA 5LA1A 3PG8A 3V16A 4HVXA 3R89A 2WSQA 2G96A 3YPIA 3LM3A 2ZXDA 4C60A 3VO0A 1R8LA 1SO6A 2AL2B 2OZ3A 3NQ2A 3RYSA 1S1PA 2ISWA 2ALRA 3H12A 3P80A 4ROPA 5ABGA 1GRFA 1XIFA 4HHHA 1HKKA 4MOZA 3WQ8A 3LCLA 1HJUA 4ZE5A 3OQ8A 3TU9A 4N6FA 4S3GA 3CU2A 4MJ2A 4JZ5A 4HYWA 3QGKC 4L7ZA 1O60A 3URNA 4UIOA 2O56A 1HVQA 4AMAA 2ZX5A 1TJ0A 3CZEA 2A21A 2ZZ4A 2PBOA 1XFBA 3TXZA 5EFDA 4C6CA 3BG3A 3PFMA 1UQYA 3ISIX 2HVMA 4A21A 4Q4OA 4HHMA 3P6LA 3W1RA 1EJRC 1HZYA 3AOFA 4B90A 4A3RA 1YLVA 2FGBA 3ARPA 1XRFA 1UCWA 3LDVA 1N5WC 4QCEA 1I1WA 2EQ6A 5KITA 1NARA 2PLCA 4Z2HA 3GUWA 2DGAA 1SU5A 2FMOA 1SW0A 2VR5A 1P0BA 4LAMA 1ENUA 3CV6A 1TFVA 4Q32A 2IPJA 3ITYA</