3OZMA

Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
386
structure length
386
Chain Sequence
SLKITEVKAHALSTPIPERMRVESGAGLKLNRQMILVEVRTDEGVTGVGSPSGPYDLAVLKRAIEDVIGPQLIGEDPANINYLWHKVFHGEVSRNLGHRSVGIAAMSGVDIALWDLKGRAMNQPIYQLLGGKFHTRGVRAYASSIYWDLTPDQAADELAGWVEQGFTAAKLKVGRAPRKDAANLRAMRQRVGADVEILVDANQSLGRHDALAMLRILDEAGCYWFEEPLSIDDIEGHRILRAQGTPVRIATGENLYTRNAFNDYIRNDAIDVLQADASRAGGITEALAISASAASAHLAWNPHTFNDIITVAANLHLVAASPHPAMFEWDITHNDLMTRLASYDLKLENGLVQPPQGPGLGFEIDWDFVAAHAWKGEPAIGAGHGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative mandelate racemase
publication title Crystal structure of enolase superfamily member from Bordetella bronchiseptica complexed with Mg, m-Xylarate and L-Lyxarate
rcsb
source organism Bordetella bronchiseptica
molecule tags Transferase
total genus 132
structure length 386
sequence length 386
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ozmA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ozmA01
4E5TA 3DG3A 3R25A 3S5SA 4GMEA 4F4RA 2PP3A 3DFHA 3H12A 4DN1A 2GGIA 3JZUA 1L8PA 4ENLA 2GGGA 1EBHA 2PP1A 4Z17A 3TWAA 4E6MA 3NO1A 4IP5A 2PTZA 3VC6A 2AL2B 3ES8A 3U4FA 4G7FA 4M0XA 3UJSA 4KWSA 2OZ8A 3GD6A 4JN7A 3H70A 3STPA 3TOYA 4A3RA 7ENLA 3NXLA 2O56A 3RGTA 4FI4A 3SN0A 3NFUA 3BSMA 3N4EA 2OX4A 2OLAA 2P0IA 4DX3A 1JPDX 4HCLA 1EC8A 2OG9A 3R11A 4YWSA 1PDYA 4K8GA 4H83A 2HNEA 3TJ4A 1BKHA 3JVAA 3SQSA 3ZVIA 1MDLA 3V5CA 2ZADA 2PCEA 2QVHA 3KUMA 1NU5A 1E9IA 4K2SA 4ZA0A 2OQHA 3DG7A 2CHRA 3TJIA 3I6EA 3VC5A 3R0UA 2AL2A 2PPGA 3PFRA 1IYXA 2PTYA 3QN3A 3MY9A 4MKSA 3IK4A 5BOEA 2I5QA 3H7VA 1MRAA 2ONEA 3CK5A 4GFIA 1ECQA 3R1ZA 3FXGA 2P88A 3CAWA 1EC9A 2MUCA 2GSHA 4HPNA 2XGZA 3GC2A 3TCSA 1OEPA 2OVLA 2PA6A 2GL5A 3QPEA 3PK7A 3UXLA 3V3WA 4ZCWA 2XH4A 3QLDA 1WUFA 3SJNA 2AKZA 3V4BA 3DFYA 4DHGA 5FJPA 3DDMA 4KPLA 4H2HA 4KT2A 2FKPA 4E4FA 3BJSA 2PS2A 2OQYA 1JCTA 6ENLA 4FP1A 1KKOA 3DGBA 3SBFA 2OFJA 4GGHA 3GO2A 2HXTA 1P43A 2PSNA 4X2PA 1XPYA 3P3BA 2PGEA 3PWGA 3Q45A 3V5FA 3VDGA 3ES7A 1SJBA 1KKRA 3IJIA 1TZZA 4H19A 3RO6A 3T6CA 5FJUA 1TE6A 2QDEA 3N4FA 3ENLA 4E4UA 2PP0A 2GDQA 1MUCA 3RR1A 4EWJA 2P8CA 4HCDA 3P0WA 1ONEA 2XSXA 3VA8A 5FJOA 3QTPA 4HYRA 4ROPA 1JPMA 4MGGA 4DWDA 3FCPA 3D47A 3EEZA 4Z1YA 2QDDA 4HN8A 3UJ2A 1JDFA 4JN8A 3JW7A 1NELA 3I4KA 2OZ3A 2XH2A 2OZTA 4H1ZA 4JHMA 2GGHA 4IL0A 2PGWA 3PWIA 2AL1A 4IP4A 2PTXA 3MSYA 4GISA 4DYEA 3FYYA 4J3ZA 5FJRA 3UJEA 3FV9A 3NZGA 2QGYA 3ZLHA 2XH7A 4GYPC 3H8AA 2QJMA 4IZGA 1F9CA 4IL2A 1MNSA 3SSZA 3OW1A 1DTNA 4KEMA 1FHVA 4A6GA 3BOXA 3SN1A 3D46A 1XS2A 3THUA 3IJQA 3DG6A 1TKKA 4GIRA 3DIPA 3RITA 2GGEA 3FJ4A 3U9IA 3MWCA 3MZNA 3OTRA 3RRAA 3EKGA 3N6HA 1R0MA 1EC7A 4J1OA 4HNCA 2PMQA 3VCNA 3FVDA 5J04A 2HZGA 3OZYA 2PU1A 5BOFA 4MMWA 2RDXA 3OZMA 3TTEA 1SJCA 3K1GA 2PODA 3R10A 2FYMA 2OO6A 3ZVHB 3CYJA 3OP2A 4M6UA 4IHCA 3T8QA 3TQPA 2XH0A 2PTWA 1PDZA 1FHUA 3DEQA 4HCHA 2PU0A 3S47A 4DXKA 1SJAA 3GY1A 2OKTA 1EBGA 3DESA 1P48A 3T9PA 1KCZA 2OPJA 2HXUA 3VCCA 2QJJA 4GGBA 3TW9A 3P93A 2P8BA 2QJNA 5ENLA 4GYPA 3UJFA 3ZLFA 4E8GA 2GGJA 1RVKA 3ZLGA 2MNRA 3VFCA 3TWBA 3MUCA 3UGVA 5FJTA 1WUEA 4A35A 1MDRA 3MKCA 1BQGA 3RCYA 3UXKA 3R0KA 3I6TA 4HNLA 3ZVHA 2ZC8A 2DW6A 3CT2A 3UCDA 1W6TA 3UJRA 3MQTA 1KD0A 3UCCA 3Q4DA 3N6JA 4G8TA 4K1WA 3CB3A 1ELSA 5EU9A 3B97A 2QQ6A 2P3ZA 1SJDA 2NQLA 3OPSA 3DERA 4IT1A 5IDZA 1YEYA 3QKEA 2POZA 3CXOA 3HPFA 2DW7A 2AKMA 3IJLA 3SN4A 3T4WA 1R6WA
chains in the Genus database with same CATH superfamily
2G37A 3O05A 3WNKA 2JIWA 5D33A 1Q2RA 1V97A 5AKQA 3IAPA 4J2MA 1TZ9A 4MKVA 2GGIA 1JZ2A 4XD6A 4B2DD 3VZYA 4E6MA 1Q2SA 1E6NA 5DXYA 1Y7VA 2WVTA 4O16A 4A4AA 5G2IA 2VVNA 1KM2A 4WDWA 3WDIA 4M0XA 3IIPA 5FAGA 3H70A 1EF3A 3BAWA 4AF0B 5C70A 1ZY9A 3WLIA 3SN0A 2ZXDA 3WFZA 2IQTA 5E0FA 2V5LA 2VMFA 1TRIA 1N8FA 1I4NA 2TAAA 4EMWA 5HR7A 2F38A 1F74A 2GJXB 1TPB1 3N12A 3VAVA 5A8GA 3BQ6A 3RHGA 3O16A 3SRHA 3M0IA 1G9HA 1W5MA 3CHDA 2HVMA 2BVDA 4G5DA 3AS2A 1UA7A 1BZLA 3PZUA 3GDBA 3FSTA 3NL2A 4KWUA 1TTIA 4E2DA 3SQMA 3QN3A 4C6DA 4MKSA 4UTJA 1HP5A 4AF0A 1E9LA 1NQ6A 4PL2A 1RBLA 1KFWA 4V33A 1J10A 2CHNA 3B8UA 1KB3A 2VZVA 1YDVA 5FD0A 1OABA 5DCEA 3CBWA 3M5XA 3R1ZA 1ITUA 2BLEA 3WUGA 1GTEA 2GJXA 3VOCA 4P8XA 3GG8A 4CNUA 3CM4A 3N25A 1M04A 3QLDA 1JYVA 3ITGA 5AZ1A 2ISVA 4R34A 3V4BA 4M1BA 1V3IA 1PHWA 5H8PA 4TTGA 3AUJA 3HRDC 1GOXA 4MVAA 1U83A 1PYMA 3GIQA 5C9UA 5XIAA 3AHTA 4C6PA 1DIDA 4E4FA 4HMDA 5EMJA 1Q7QA 4O54A 2BASA 3EA3A 4C6MA 4LS2A 1HGWA 4NNAA 1OF8A 5T9CE 2FZMA 1QNPA 3WFAA 4MB5A 3KHJA 1CZ1A 3ITOA 1B3XA 1BSIA 2X0HA 1OCJA 4DJEC 1UJQA 4MNJA 2EKGA 5LHEA 3RLGA 1FWWA 4NZJA 1ICSA 1K70A 5K7JA 5I09A 2BHUA 5A8QA 3CEPA 1GEHA 2BTMA 4F66A 2V5DA 2X8CA 3WLTA 3DHPA 4OE7A 4H8UA 3P0WA 4LRTA 1Q1WA 5LA2A 4PEKA 1A50A 1WKDA 7TAAA 2ZBTA 3CZ8A 4L7ZA 2VYOA 3EDDA 4M3PA 1JCYA 2Z1SA 4Q8NA 2YX0A 3W74A 4QJ1A 4OIFA 1P0BA 3S1UA 4AX7A 3P80A 3RF9A 3PNZA 1YE6A 4XBSA 5FS8A 1GVIA 1TQXA 1DQXA 3TEVA 1F4AA 1TIWA 4YTRA 3HO8A 4C91A 2YXXA 1QT1A 5CKSA 1XC4A 3UXAA 1JF5A 4JCLA 2PRLA 2CU0A 5F2MA 3KCJA 3LBCA 4KBXA 5A6TC 1DIOA 1VLIA 1XV8A 2Y1HA 2NQ5A 1MO0A 3OC4A 1WNOA 1U33A 2TPSA 3F4WA 4O1EA 2XN1A 3MU7A 3IVTA 4HSOA 1BGGA 3RYSA 2VENA 4AZCB 4CQ8A 1U1HA 3KOWA 2BCPA 2Y85A 5LGZA 1Z41A 3TU9A 2DUAA 4KMQA 1AH4A 2J8FA 2VZTA 3L68A 4B5VA 4OV4A 3S5NA 4DO7A 4ZBCA 4JQ4A 2C15A 3VCNA 3NVZB 2OXNA 4IIGA 1X38A 2RDWA 2PU1A 4BF7A 3CAQA 3EBVA 2RDXA 2CZVA 3PR2A 1ECEA 1JL8A 4JDBA 3PN8A 4GQGA 1YADA 1DEDA 3ITCA 4N7QA 2GYIA 2HDJA 8XIMA 4WDXA 2JF6A 3ZSSA 2E8YA 3NL6A 3PTDA 3SCUA 3T8QA 2CLEA 1JUKA 2EG8A 3TR9A 5F4WA 1FHUA 1XRSA 3A6OA 1NHQA 2DZTA 4D1IA 4AZCA 2WWCA 1YE4A 3N6QA 2E77A 1SO4A 2D69A 1M53A 2QUUA 3EF6A 2GJLA 4HSNA 4ADTA 3PUOA 4G6CA 2E4TA 3MP5A 3PS7A 4R85A 1R85A 2ACQA 4C1LA 4UB9A 1B3VA 3NQCA 5ABEA 1OIMA 1RP8A 1T6MA 3KRUA 1G5AA 2YCIX 3T08A 3NWRA 4POCA 4Z1CA 3DU0A 3TVAA 1EGVA 2V2HA 2PF0A 4M6PA 2C3CA 2WOIA 1H50A 3TH6A 1QW9A 1IR2A 2E6FA 1CGTA 2D2HA 2HS6A 4BY3A 3CT2A 4LAMA 4OWGA 2DZXA 1KD0A 3B8TA 3Q4DA 3QZ6A 1MEIA 3BLKA 1F6PA 3N6JA 3WN6A 3C2FA 4NXKA 2DEPA 6CGTA 2QQ6A 4MFDA 5CZKA 3OA5A 2TSYA 2WHKA 1PUDA 3OPSA 3N1AA 2G3NA 4P7QA 2EAWA 1K4QA 2NX1A 1P6CA 2PD9A 4TMBA 3AYTA 4JX5A 3SN4A 4DF2A 4PSPA 3FGCB 1UIPA 4YHEA 1R6WA 2V81A 4L9ZA 4BF9A 4DRSA 4C1NA 1LL4A 3R25A 3VOGA 4A2SA 1IQ8A 1U22A 5BOOA 3DFHA 1WYIA 6TAAA 1N60C 1LF1A 3WD2A 4D6JA 3M43A 2VFIA 3WIJA 4I9JA 3BE7A 5BRBA 4D2JA 1UB3A 2XVGA 4H9YA 3RK8A 4QQ3A 2VEGA 1B2YA 4O18A 4QE1A 4JZ5A 3F2BA 5FKYA 2JKAA 7ENLA 2FIQA 3STCA 4CKQA 4WD0A 3W73A 4J3TA 4B9YA 3EXTA 1OGBA 3EMQA 4YYFA 4IQDA 3S2CA 3FGCA 3GXMA 1QPOA 1MXGA 3W7NA 3B0YA 4QHRA 4LFYA 3TJXA 3EXRA 4ROQA 4H83A 5CC5A 1NQKA 3AXIA 5C9ZA 5HNUA 2VUNA 4NXSA 3WDJA 1XX1A 4AD5A 2EG7A 1G4TA 3LS9A 4K2SA 2DIKA 3S0CA 1B54A 2VEKA 3AMDA 1V6YA 1YBQB 1HJVA 5IHSA 3KL0A 4CQBA 4DZIA 4B5UA 5HMFA 1W5NA 2CKRA 4M51A 3KDOA 4HD5A 3UNTA 4J35A 2I1OA 2PBGA 4GX8A 1OX6A 2FZNA 1FH7A 3MCNA 5LNUA 3AWNA 1ZSXA 4FOJA 2XSAA 1HQTA 2X09A 1AZ2A 3HIJA 3KBVA 1DJXA 1ISYA 1UZ4A 2YSWA 3LCFA 2EQ7A 1W3LA 4OJYA 3NSMA 1MI3A 2ABAA 3A47A 5CPLA 3PPGA 2OYKA 1WUFA 3U57A 2Z1VA 3PANA 1E6XM 3H54A 4NJHA 3KBWA 4GXMA 3WD4A 1K02A 4NRRA 1S39A 2ZX5A 1YBQA 5CJMA 3RCNA 1TFVA 1JRPA 5FESA 3FVMA 4KT2A 4Y9AA 3QW3A 2YYUA 4YYCA 1JCTA 1QPQA 1PKNA 5HMEA 3P5YA 3GXIA 1KN0A 3H2OA 3AYSA 3RM8A 3CEUA 1E1EA 4JQ1A 5D9MA 1K4GA 1JQXA 3CL7A 1XPYA 3GNPA 1GQLA 2XVNA 4MZYA 2I9UA 1A3HA 4F40A 3AXHA 4PMDA 1Q6RA 3BGAA 1PB0A 1QW7A 4H19A 2TYSA 4JFTA 5D9NA 5D2VA 4EACA 3P62A 4C6CA 3AHZA 1ADOA 4MM1A 2CXEA 4LWWA 3VIPA 4QJ4B 3ENLA 1KXQA 1VENA 2P5NA 2DSVA 4RL3A 3LTSA 2EBNA 2EPOA 1E15A 1V08A 4GABA 4RZ5A 5H8UA 3GDMA 1WE5A 5CSUA 5DMLA 4PMZA 3GHTA 2VX4A 2D3LA 4MWAD 3D0CA 3N4AA 3LI1A 3ORWA 3VOFA 2C0AA 3P2VA 1EF2A 3YPIA 1JRBA 2XGBA 5DMMA 4FLOA 2OZ3A 1N62C 1VAHA 4ADUA 1M9HA 1WP6A 2OZTA 2ISWA 4E8CA 3UFYA 3PWIA 4O28A 4WF7A 1UD4A 3E0FA 1XW8A 4AD3A 3W82A 3QQ0A 1SW0A 1S38A 4GCXA 1K8YA 2GJRA 1LQ2A 1YNPA 3P0XA 5E5CA 2A3AA 4W93A 1OYCA 4RNHA 3UZJA 5GJMA 1CGXA 1HO4A 1Z48A 2QCMA 1DORA 3HZ3A 4DLMA 4A3YA 1BQCA 3L0KA 4KEZA 4B92A 3LNMA 3W76A 3I10A 1I2RA 2OKOA 2V82A 2QAEA 2WSPA 2PLMA 3DK8A 5FJIA 3QVQA 1JCXA 1MUWA 4FHAA 2R9ZA 2WPCA 3N6HA 2XYLA 3AHXA 3WLNA 2IPJA 5HQLA 2VX7A 4EXQA 2ZFAA 3DECA 3LHZA 4PH6A 1ALDA 2CNCA 4TU1A 1HJQA 2DSZA 3SY1A 5JCIA 3S6OA 5AECA 2PCQA 4EPDC 2IKIA 5GNZA 1SJCA 2GH5A 2VEPA 4D8ZA 1LVLA 1HL8A 4H9TA 4MG4A 1DJQA 4EP8C 1V3MA 1TRDA 4LH8A 4JCMA 2Y61A 4JTGA 3TQPA 2PTWA 3ZZ1A 3H22A 2X7WA 1OC6A 1RCXB 1E43A 3VKDA 4LAZA 1IEWA 3GDKA 4AFYA 5HNTA 1PXGA 2OODA 3UF9A 3VCCA 1U5JA 2F8QA 1NFGA 3E0VA 3NR0A 3B8DA 4MUPA 4PR4A 5CEWA 1KBBA 3NDYA 4S3KA 3RPTA 2ZUMA 2WVSA 1DQUA 1KW1A 3NXFA 3ZLGA 4FNRA 3WD1A 3TWBA 1QPRA 1G7VA 4AX6A 4H4IA 3R43A 1TV5A 3RCYA 1NWTA 2A0NA 3MQTA 3IJ9A 1RQHA 3OHMB 3N3MA 1SUXA 1SR9A 4MOZA 2LLEA 3ARSA 3SCTA 1HZYA 3FKKA 3SCPA 4CN6A 4LF1A 1UD6A 4WDUA 1KLZA 3BW2A 3HQOA 1VRXA 3N34A 4OBTA 4UTTC 3DERA 1JDEA 2XVPA 2VD9A 5TAOA 2HEJA 1OZQA 3SZ8A 3U5UA 3U8GA 1NOUA 3A3XA 1SO5A 2IPGA 3DG3A 3S5SA 4IF2A 4KH2A 1YKWA 1X98A 2UY3A 1EIBA 3CHCA 4M7SA 3QM3A 3H12A 3BG3A 4EM4A 4CN4A 1R3WA 3LHVA 3WF0A 4AWUA 1FECA 1DXFA 3TWAA 4JY9A 3RDKA 2E5AA 2Y7EA 1R3SA 1JPHA 2YCJA 1GESA 2PTZA 1JCMP 3W2NA 2A4AA 2VFEA 1EHAA 1DWAM 2IXVA 4IM4A 2ATMA 3T0AA 1TVLA 3REQB 2OGJA 1LQAA 3TYEA 1WQ5A 4OUEA 1TMQA 4PMRA 5BW6A 4A3RA 2O56A 3AIBA 2FGZA 4Q8TA 5T26A 5JH2A 1WDSA 1Z8AA 3UWYA 4EM3A 2ACRA 1ZTVA 5IDIA 2RAGA 2O55A 1RK5A 2QCEA 5CG0A 1A3XA 1Q4NX 4HCLA 4BV6A 3M1ZA 5CZSA 4ZSUA 2Q8LA 3R2GA 3HBLA 4DWSD 3CUJA 1MDLA 1W1TA 2QZRA 3O7UA 1CNVA 2B81A 1OG6A 1L8NA 4S3FA 3CTLA 4JHOA 4XSMA 4JIQA 3C8NA 1P0EA 1M01A 1E72M 3M44A 4I7WA 1JG9A 2Z27A 1EZ2A 4UTFA 3R0UA 5U7SA 1F8IA 3AIVA 3WBEA 4AXKA 4YTSA 2WAGA 3REQA 3AAMA 1OCQA 4LBSA 5HXMA 2YQUA 4GJJA 4TUFA 4ZO7A 4DY1A 5BOEA 2HNHA 1GG1A 3LI0A 4Y90A 1FXQA 1VBUA 1XR2A 3W83A 2QLYA 3NEHA 2CLKA 4JQAA 2EHHA 2FH6A 3CAWA 3DFOA 3B8VA 3CMFA 4LX4A 1FCQA 3CO8A 3QXBA 4MIMA 1V6XA 2E9BA 5JQ9A 3VIMA 2INFA 5A6SA 3PNUA 1OJXA 1Z9AA 2JQXA 4WKHA 2XH4A 2NXIA 4ORMA 1MW0A 1SB3B 4A05A 4WK9A 2OZ0A 4FXFA 1KCXA 1JR1A 1OYAA 4RV3A 4DHGA 1K7EA 2A3BA 3CIWA 3DDMA 4M1RA 1LUCB 3BO9A 1HJSA 4B4FA 1QK0A 2J9XA 1YYAA 3E0LA 3TAKA 4WOQA 3M6YA 4O1AA 3T42A 3GU9A 3H4XA 1KRCC 3TCEA 2PD5A 4JICA 3TQVA 1L6YA 3LMZA 4JIPA 4E0CA 4GYJA 2F7FA 3A24A 4S3CA 4ATWA 3DBPA 3OVRA 3PWGA 2Z24A 4DO5A 1P0KA 4XAFA 1A5CA 5M5DA 1CX9A 3ONCA 2FDSA 4UCFA 4GXPA 3LTPA 3THAA 1BRLB 3B3DA 1W1B1 2W0UA 2OELA 3QFAA 1G0CA 1VPQA 4H3DA 1UH3A 2PDNA 2A5HA 1TPUA 1FKXA 4NT0A 4A8NA 3VOJA 2V63A 4FLQA 4UR8A 3WNMA 2WC3A 1KQYA 1VS1A 1HXJA 1LDCA 4KIEA 2Y8KA 4PCTA 1FUYA 4O1BA 3HQPA 4UZUA 1JPMA 1LUCA 1IT0A 1NIUA 2ZZ1A 3M5ZA 2WZIA 3GBEA 4I9AA 1VGAA 1ZBCA 1BAGA 3UY8A 2JF7A 1ZK7A 2V6AA 3KL3A 4L61A 3W1LA 5D8ZA 3DKJA 5F1UA 1J6OA 1GRTA 4IMAA 2R91A 3RPDA 2C19A 3V7PA 3WMBA 1BRLA 1TX2A 3SFWA 1BKSA 4AY1A 4ZOAA 3I7RA 3H8AA 1XYFA 2QJMA 2ON3A 3SDOA 3AIQA 3TTSA 4GQBA 1LLOA 5C9XA 1WB0A 2ZRVA 4RE4A 4AHOA 4KEMA 4AZIA 3W6YA 3QSTA 1JGIA 1X8CA 1XL9A 1DKWA 3HF3A 2DZSA 3S9IA 4JX4A 2VVSA 3DG6A 1XLGA 3DIPA 3RITA 3UWWA 4N0RA 1XIMA 3N2MA 3QV9A 4CNSA 2FJUB 3WUFA 5I23A 4IMDA 3HG2A 1KM1A 2QDHA 1SFSA 2QPUA 2ZRWA 1Z32X 5ECUA 1EJVC 3E3HA 3K4DA 4MZ1A 5KZDA 4EWND 3VU2A 3FVDA 1XQKA 3M0VA 3EWZA 3E74A 3SQLA 2GR0A 1VHCA 1RJQA 1RBOB 4KS0A 1V3HA 3T05A 1XSIA 5CSRA 4CQCA 2OEMA 4KPRA 2H3DA 3ARTA 4O1CA 3TN5A 4PUKA 3G77A 4NJGA 5CPSA 2QJGA 4LB3A 2F6XA 3AN1A 5C2GA 5I0DA 3B4YA 1E71M 5HJYA 2WPBA 1EJ7L 4IXXA 2HWGA 3P74A 1R3VA 4GYFA 1EA0A 3JS3A 4O14A 5A6BD 2QIWA 3HG4A 1MXDA 1ZHAA 2REQB 4O8RA 3CGEA 1MW1A 5IFPA 2YKKA 3O06A 4WXYA 1XLAA 3WMSA 2GWNA 3MUIA 2OSYA 1O6IA 3DBNA 5HUOA 1FCVA 1B5TA 4JEQA 2I56A 5EMYA 1A5BA 2WNWA 1TQJA 3FSUA 1R7OA 4NY2A 1POJA 3EWBX 4KCVA 2HBXA 1SR0A 3N9SA 4WY0B 1ZJBA 3VILA 2IPFA 3MJMA 3DN5A 3UG5A 4U4MA 3D9XA 3FN9A 4HIBA 4UMBA 1SJDA 1L9WA 1VIZA 1H5VA 3PJXA 4JYDA 1YDYA 1EQCA 1HJUA 4IT1A 3T55A 5IDZA 1YEYA 1G6CA 2REQA 3TONA 1PSCA 4J3XA 1XJBA 5D2XA 1UD2A 5FEWA 3T40A 1XG3A 1Q6CA 5T8GA 4PMNA 3PAJA 3OBAA 2HMCA 1O4UA 1B3ZA 4XD4A 4O1FA 2XHYA 4ML4A 1NWRA 5E0KA 1EDQA 1T8QA 4PMYA 2R14A 2AQWA 3W1MA 3WBYA 1J4EA 2WCSA 2NVCA 3KEHA 3CNYA 5EPDA 5MF5A 3NO1A 4B5XA 2ZZ0A 3LLFA 3DFTA 2X7VA 4WY0A 4EPBC 4NASA 4MB3A 1KRBC 4PMQA 3VNLA 1EIXA 4YS1A 1Q6DA 3KTXA 5E9AA 4JN7A 2ZDSA 2VTFA 1A80A 3FW6A 3BQ5A 4IPIA 4KFNA 3CV7A 3KOFA 1ZX9A 4RNJA 4NAFB 1R38A 1XKJA 5FS7A 3CL8A 3EMCA 4IFRA 4JN6A 1LOLA 3IRSA 4PMXA 3W37A 5DY3A 3BC9A 3HA1A 4GE8A 4UIOA 1PDYA 4KETA 2DQWA 2Q3OA 3R13A 4RZ4A 3UW6A 4B5WA 3MCMA 1N8IA 2J66A 1FA2A 1G01A 2WXDM 2BFGA 4H4ZA 1AL8A 2HROA 3L0NA 4GQ0A 2ZXBA 1H11A 3IRDA 2QIIA 2OQHA 4RW3A 1J0JA 3TJIA 3QJAA 4XISA 3AIEA 4NNCA 2DZUA 8A3HA 3LSCA 2G5WA 3D6NA 1PVNA 1IYXA 4FK9A 2UBPC 4IFKB 3K4WA 5D4YA 2IQDA 5BRQA 2GVJA 4A8LA 1EDTA 3CMJA 4IIFA 3MSDA 2NSOA 2J8GA 4IIDA 3NPUA 3UWVA 1NAL1 3CK5A 4NAFA 3NQFA 2J6VA 3OZOA 1Q5MA 3Q2DA 1VBHA 1CBGA 1J01A 1F05A 1G4SA 3JU2A 2YVJA 5BMWA 3WMLA 2BV9A 4PC8A 3CZJA 3WY1A 3N19B 2FHCA 5TD4A 3BG9A 3PFMA 3U7BA 1I2NA 3WH6A 4BI7A 1BF2A 4XIAA 4JTFA 1JXKA 1I0DA 3DFYA 2CFFA 4Z2LA 3AI0A 4JDYA 1EL3A 3NGFA 4WEVX 2BHZA 1XLFA 3S3GA 4H2HA 2YVFA 4IFKA 3UVAA 2NV1A 4JIHA 3WQFA 4IOTA 3N9RA 4GI9A 1FDYA 2GR2A 3QFBA 4UFJA 3TW7A 3B03A 5JU6A 3I7SA 4UZSA 3W1TA 1C92A 2I14A 4NF7A 3T8LA 4X2PA 4GD0A 3WQ5A 3L5OA 2FGBA 4YLWA 3ES7A 1JCNA 1FEAA 4ML9A 1W2PA 2XUCA 5T9BG 3W86A 5D2YA 5JBEA 1DXEA 4K1GA 2C18A 3KLKA 4G2DA 3GLCA 3ME3A 4FX8A 2ZC1A 4AWTA 3NRZB 1X6NA 3QKZA 2DU2A 3W25A 3DGZA 1K9DA 4UR9A 1RD5A 5CSSA 5D8WA 4DVOA 5I03A 3IUIA 4JFVA 1OF6A 2BC0A 3GU1A 2J13A 3L23A 1FWBC 3PZGA 4HMCA 5HWNA 5J5RA 4JN8A 3LCGA 3JW7A 5BWAA 2X16A 1NELA 2UV8G 4D6HA 1F3TA 3IUHA 4ADSA 4GY0A 4LUTB 3WENA 2G95A 4PFMA 1AJ0A 4AWEA 1B3OA 4DYEA 9XIMA 4I9TA 4C6FA 3GE7A 4FNQA 3STGA 3NZGA 1HG3A 2F6UA 1TWSA 3GG1A 1KCKA 4GYPC 5G4WA 2X8GA 3ARQA 1GUVA 3B9NA 2DH2A 1EOKA 4K8HA 2ZICA 1R30A 4F2UA 3MB9A 2XZ7A 3CWOX 3S5ZA 3RN6A 1XLLA 1GJWA 3O8AA 3AICA 3R7MA 2VC7A 1YW1A 1J18A 4OZOA 2QUMA 4LAUA 4TV5A 4H7VA 1G4EA 3CLWA 4GVHA 3FJ4A 1JI2A 1W5QA 5JBDA 4UWMA 2VEMA 4LUTA 1SZNA 3PHAA 4HPHA 3WNPA 1Q8JA 1EKOA 3OQEA 5KVIA 3VKBA 3LPGA 1CLXA 2PLKA 1D3CA 1YXDA 1I60A 4ZFMA 5LA1A 3AU6A 3WQCA 4QG6A 3LPOA 3CQHA 3ARPA 2NWRA 3L0GA 3OU8A 4UTWA 1TV4A 5EA9A 3T81A 5F2IA 3MDUA 2Y8VA 3TN3A 5MHBA 1HP4A 1F8WA 1XIEA 1OJTA 3HPZA 7TIMA 3TK7A 1HJXA 1W5OA 3LHTA 5D9OA 1PS9A 2BY3A 2X1UA 3KE0A 1ZPTA 4HCHA 4TR9A 4XUYA 1GKPA 5TQLA 3SY5A 4AC7C 8CGTA 3VIGA 2QAPA 2O0TA 2V0TA 4Z2GA 1RQEA 1LJYA 2QJJA 3NJ3A 3PB2A 1R3QA 3WD3A 2WQDA 4WLCA 4F0KA 4S3DA 1T3QC 5FI8A 3C0LA 5DMNA 1U30A 2PDCA 4Q8MA 1LG2A 4ZE5A 2B7QA 4LRSA 4Q4SA 1WXZA 3VNIA 1S5WA 3PSVA 3LD5A 2VL4A 2FGLA 4GINA 2WHMA 1CXEA 3FYOA 4AWSA 4NRSA 2YZ5A 4QLJA 4OQVA 1XBZA 1AW5A 4UC5A 3AIUA 3DC0A 1M1BA 4FOKA 1PZ1A 1G4PA 6PTDA 5FEZA 3DOPA 1JAKA 4GI8A 1VCFA 3UPBA 4GUHA 1KBLA 3HPFA 1XLIA 5AHFA 3H26A 4F9DA 3VVGA 4Z2IA 5IHRA 2DV0A 2YFOA 3NPXA 3WD0A 1GRFA 2R8WA 3V75A 2Q8ZA 3WELA 2NQ9A 3TC3A 3A13A 1B3YA 4FF5A 2ZUVA 3F5JA 5JCNA 2GVEA 1QNQA 4Y7EA 3NGJA 1SPQA 1XYLA 2XWEA 3RX4A 1HO1A 3G1AA 5ABFB 3WK3A 2DDXA 1H51A 4Q8PA 4GO9A 4IP5A 3AJXA 1XCFA 3K8LA 5FAJA 3VDBA 4QJ5B 3PULA 4PCSA 1GYNA 3UJSA 1UUOA 4OUIA 4IIHA 3GD6A 4Q8VA 4H4XA 3JZEA 1GGOA 3KAOA 2BHYA 4MDPA 1QRQA 1A53A 1XBYA 3RUBL 2OO0A 1XINA 3OGVA 3O9NA 3CTTA 3E1F1 1AW1A 3N29A 1J9YA 4HMEA 3R07C 3MUY1 3NAVA 3V18A 2Z1BA 1AQMA 2FTPA 5CSYA 2YXGA 4ZOEA 5LIYX 2YJQA 2B4GA 1WKFA 4C6JA 1EC8A 3W7RA 4B9ZA 2X2GA 3SJ3A 3ITVA 5CBBA 2FB3A 1RR2A 5K2ZA 3L4UA 1XP3A 1UYQA 3PZOA 5ABFA 1E9IA 3VMOA 3HGOA 4NX0A 3QY8A 2IMRA 3R5EA 2Y62A 2MANA 3GR8A 1MMFA 4LVAA 4XZBA 5GNYA 5U1OA 4FIQA 4W7UA 4DXVA 1C9DA 2D1ZA 4QIUA 1E6QM 4A3HA 4JQ9A 4R33A 3WDRA 2EQDA 2JFEX 3ATYA 1A0EA 3BJFA 4GIYA 4PUUA 4MJ4A 2QXWA 5JVLA 3O1NA 1H1NA 1DL3A 2CW6A 2J75A 2YDAA 4GWEA 4LS1A 2BVTA 3TTQA 2MUCA 1L2QA 4CU8A 4M82A 2YDRA 3SCWA 4D9PA 4NP7A 4UNLA 3LCWA 3TCSA 3UPWA 1SO3A 2W3RA 2H3BA 3ARXA 3EB4A 1MNZA 2PWVA 3V3WA 2J47A 1KCLA 1M68A 4BI5A 3SJNA 4HSHA 4IIEA 4FPSA 5DFAA 2H90A 5A69A 4KRZA 3HQ1A 1B90A 2VDHA 5FJJA 3A64A 1F3PA 4UOQA 1ZDLA 4Q4RA 1XI3A 4WSKA 3S1WA 5HULA 4L80A 4R53A 3ZT6A 1BWVA 1X1NA 1QNOA 4IJBA 1U5VA 1FWEC 4K37A 4NHVA 4AEEA 1E5JA 1SMAA 2H8XA 2OJPA 3GO2A 3SUVA 3ZYZA 1HNYA 2QCLA 2ZIDA 3RAOA 2OT0A 3CASA 1CYGA 1KBIA 1A0CA 4LANA 3N11A 4K39A 4IG2B 4CCZA 1NP0A 3TOPA 4I7VA 4UR7A 3OG2A 3WF4A 1JFHA 1E70M 1Z42A 1DJWA 4FLSA 5CLTA 3LA4A 3MANA 1ITXA 4MJZA 4JFUA 1TO3A 1CLVA 2RDTA 2Y7DA 4D6GA 3VM7A 2C14A 1H5YA 3VA8A 3DXIA 4CN1A 5HOSA 2ZRXA 3LSBA 4PTWA 4DO4A 1PTGA 1X6UA 4LUJA 3WFLA 2QDDA 1IXOA 2EPHA 1NEYA 1K8ZA 3NVTA 3CPRA 3I68A 4BA0A 3TYAA 4TO8A 2VZSA 4JHMA 1NPXA 1BYDA 2GGHA 4C1KA 2NLIA 3HFYA 1WPCA 4IMFA 3A23A 4IG2A 3SEPA 4A8IA 1Z7AA 4EK7A 4IWWA 3VI2A 3APYA 3WUEA 1SW7A 3DI1A 5CPQA 1VBJA 1TR9A 1A4MA 3R94A 1WZLA 4MJMA 1TUFA 3DK4A 2ZA1A 5D05A 4AIOA 2GVYA 2DFAA 4ZODA 3PUGA 3GK0A 1ADDA 3B40A 2FLIA 1V3KA 1TIMA 3H53A 3SN1A 3THUA 4NAEB 4TVDA 4M7TA 5D04C 5DBUA 3FHQA 1VJSA 5IFTA 2VT0A 1C90A 4JTAA 4NQ1A 3H2MA 1R47A 2DQXA 1XGDA 4Q8WA 4MLRA 3DCPA 4GNJA 1EJUC 3LUTA 5GNXA 3T0TA 5IRPA 1UQYA 1F5ZA 1U1UA 2DH3A 1GG0A 4P8WA 3W4RA 3VGGA 3BAIA 3M0HA 3KLJA 3WDHA 3TA6A 3C86A 4GKTA 3MHGA 5GPRA 4IICA 3IV8A 4LUYA 3R89A 1BTMA 2OQLA 3KVKA 2AOSA 1J5SA 4NAEA 2G0WA 3UNDA 1K6WA 3BCFA 2ZZ4A 4J3SA 2WBAA 3OYXA 3MPGA 1Q63A 4KKXA 2HPIA 2BGQA 1H6VA 2ODOA 5CG7A 4GZ7A 1UBSA 3EMZA 4JGDA 4L6HA 3BLDA 4JS3A 1K8CA 3N18A 4DYJA 2VFFA 3SRDA 2A6NA 3KVMA 2O9OA 1BYCA 2V3AA 5GJNA 2PWGA 4IH3A 3RLHA 3UJRA 2DZVA 4UTKA 4LA1A 2VR5A 4WHBA 3HM7A 4WJXA 3LZ5A 3CHVA 4A3QA 3ARRA 3CWNA 1SGJA 4GG9A 4EMJA 4A3UA 3VE7A 3B0VC 2J4GA 1AJ2A 3WCZA 2CLHA 2E6AA 3GNOA 1Q8AA 4QM1A 4ZL1A 4WSHA 5D02A 5C9RA 3II1A 1VEMA 1MEWA 2W3ZA 1W3KA 4B4HA 1FCUA 4N9BA 4GYKA 4JIRA 2ZZ3A 4H41A 1KTCA 3KCLA 1QTWA 4QNWA 4KESA 1V77A 3FY1A 3UR8A 3SCVA 4P5UA 3U0HA 4JQ2A 1TUXA 1J0HA 2TMDA 4GHRA 3UESA 5D32A 3W7DA 1XRFA 2GUBA 4U10A 1X7FA 2C3ZA 4AW7A 1UZ1A 1QNSA 3BARA 1LROA 3TOYA 4KWVA 1J79A 1H7XA 5IXEA 2WC7A 4HU8A 3LXDA 3VOHA 1EWEA 3MI6A 3ANUA 1FFQA 4HA1A 4R3UA 1F07A 4YTUA 2V3BA 2WW5A 1S2CA 4DX3A 4H7ZA 1GERA 3BH4A 2TRSA 3PG6A 2FPYA 2D2JA 2YBVA 4LXFA 1TR1A 4F8XA 3JVAA 3TV8A 3SQSA 2DSKA 3NIYA 1WBHA 1V0KA 1SSDA 1UHVA 2ZADA 4U2ZA 4GZEA 3FK4A 2P53A 2VOTA 4YXGA 4WKFA 1LWJA 1W3NA 3BOFA 4ZQRA 1E56A 3EWUA 3IUDA 2CLPA 5KETA 1YX1A 2V9DA 3O6YX 3H4KA 4C7GA 2Q02A 1QCWA 5AY7A 1MRAA 5A6JA 1R86A 1GYLA 3TMLA 3C2OA 1UPPA 3VX0A 4KRUA 1TPC1 4ZSTA 1FEBA 3CXBA 1XLJA 1LZOA 1GZJA 3XINA 4FXRA 1FO4A 1A5MC 5HK4A 3IV3A 1J8VA 5FACA 2GL5A 3S5YA 5AOUA 3EAOA 3GRIA 2HTMA 2QPSA 3S9YA 3QLLA 3NL5A 1E3XA 3EOLA 5EMLA 3HTWA 4HT3A 4FNSA 3SGUA 1QI0A 1CW2A 1JFXA 4MY8A 3NCOA 3W7GA 1BG4A 4RLIA 2PS2A 4EAMA 1H4PA 4DO6A 4FP1A 3ID7A 4XZNX 2FZBA 1BXNA 3SBFA 4H4TA 4PTXA 3UVIA 3NVWB 3L4XA 2CITA 2V38A 3E0WA 1LOQA 1UC5A 5A8MA 2C3DA 4NZ4A 4O50A 3GAYA 5G2WA 2X1IA 3WBXA 1TV2A 4BQ5A 1NSJA 1W91A 1KO0A 3EPOA 1ZP4A 3N4FA 3UA4A 3SI9A 1K77A 4MY9A 1NARA 9XIAA 3P81A 4UMCA 3GFXA 3SUSA 4PBGA 1QXLA 2D73A 4GUIA 3PM6A 3QTPA 1O1HA 2FFIA 4I6KA 3IGHX 3P5ZA 1E51A 4DWDA 3IEBA 3GZAA 1WDDA 1B1YA 4LUIA 4Z1YA 3T2PA 1JDFA 2FVMA 5TF0A 3A5FA 4J28A 3WLLA 1PIIA 2QF7A 1UWQA 1VC4A 3EGJA 4F0RA 3EOEA 3W53A 3TTYA 3GRTA 1R87A 1JROA 1TB3A 2AMXA 1W9BM 2PWFA 4L1GA 5F4SA 5HBFA 5FEXA 5M2FX 4A29A 4O53A 1PZ3A 3URAA 3GHRA 3DI0A 3E49A 1F6KA 1W56A 3MDWA 4WDTA 4EVZA 5G1TA 3MVIA 1DV7A 4RDVA 1HKIA 3N04A 1E6ZA 4H04A 3LK6A 2PDMA 2IQ0A 4A6GA 4UFIA 2A79A 3VO0A 1TA3B 3SO7A 3D46A 2VQTA 1E0XA 4YWOA 4BJHA 4P8VA 5D2TA 2GGEA 1BXCA 3FHAA 2Q8XA 1KM4A 2YA1A 1CENA 5G5GB 1B0IA 3S9ZA 3VNDA 3P7YA 1VYPX 1NHPA 2GLKA 1EC7A 1LOSA 1XICA 1X1OA 1GONA 2G3JA 5J04A 2ACSA 2FZ8A 3BW3A 3NL3A 4GY1A 2EQ8A 2PDHA 1OGGA 1YRRA 3ZR4A 1A49A 3N2TA 2WSKA 2FYMA 4XKYB 3LNPA 3EPNA 3RLVA 2KAUC 3GDTA 3SURA 4RJEA 4QAWA 3TYZA 1MQPA 3W6MA 5EY5A 2YA0A 5G1YA 3IVSA 2PU0A 1TA3A 2QDGA 2OKTA 2ZZBA 4YCPA 4AZ5A 5REQB 2R82A 1JRCA 4R88A 1TWDA 1CT5A 1H7NA 3ZIZA 1JZ4A 1QO2A 3ZJ6A 4XZMX 1VFFA 1ZUAX 4HNUA 4U3AA 2QJNA 1UR0A 2JK6A 3UJFA 3HG5A 1TV3A 3ZLFA 3DFPA 3QQ1A 2MNRA 3HPSA 2CBUA 3E9AA 3WQOA 3MZ2A 3VFCA 1V3JA 1EPVA 1KR1A 1WXJA 4H8HA 4HTBA 1EO7A 1DJHA 2X1TA 2DPEA 1GRAA 3GVWA 3G8RA 4XKYA 2W67A 3WNNA 4NILA 1EX5A 1ICPA 2VOMA 3RM9A 2CLLA 1V02A 1EXBA 4OU1A 3NA8A 3E2VA 1N8WA 4PCFA 4ATDA 2ZOXA 1H3GA 4WZHA 2QHAA 2W66A 3BLPX 4DJFC 3VIJA 5A5WA 3P82A 1M5WA 4EX4A 2I5GA 3K5XA 1K7XA 2GZXA 5REQA 4BWLA 4L9XA 2D0FA 1S1PA 3EX3A 2FHBA 3CXOA 1W9VA 1E3ZA 4GQQA 2AKMA 1HIZA 3DHUA 4IQLA 1X39A 2C1GA 1ZCOA 3WSUA 3OZPA 3GC4A 1AQFA 4H4UA 4C6OA 2X2YA 3OLDA 4MKNA 1OFRA 1BWKA 3EEGA 1ZAJA 3B0PA 1BEUA 1FWGC 4JKLA 5HPCA 3G3MA 3AXMA 1EHNA 3N13A 1OCBA 3VIOA 5KVHA 4UUIA 2PP1A 3UZZA 1ISZA 3K2GA 4QXIA 5I7GA 5I78A 3F5KA 1S2TA 4NKCA 1BFNA 5AC6A 3U7VA 2Z26A 3R12A 7ODCA 1DPMA 3V35A 1IWAA 3G22A 5CC3A 4HP5A 2JALA 3PC0A 4P8UA 2BGSA 3FDKA 4B3LA 2VELA 2PWDA 5DN1A 1IXQA 2O9PA 3T2OA 1VJZA 2CIPA 2E6DA 5EYWA 3LG3A 3BSMA 1V6TA 2BC1A 1HKJA 3N4EA 3ITXA 3N2CA 3NQ2A 1ENUA 3P8IA 4JNZA 1VLWA 3C3UA 1BYAA 2ISSA 2EPLX 1PPIA 4NUWA 2VX6A 2ZA3A 3V5CA 4MY1A 2YFNA 1OFPA 4FX7A 4NZFA 4O19A 3KUMA 4MFEA 2WANA 2DZAA 4AD2A 2PB1A 1VPXA 5DEZA 3OIXA 4UTTA 3N2OA 2VFGA 2WCGA 3DYPA 3ITYA 3QY6A 5I00A 3SIZA 1EX1A 4JTJA 3P84A 1N61C 4QEHA 2CERA 4ONVA 1U1JA 4ZQPA 2G3MA 4ZOHB 1WX0A 3LV6A 4YVXA 3CJPA 2GSEA 4LGXA 4LAKA 4O10A 4J3UA 1E9ZB 5LIUX 4WJ8A 1I75A 2J77A 3AC0A 1F61A 2W91A 1WYGA 2ABBA 1GOQA 4R7OA 3UU0A 3QW4B 4J5NA 5LXEA 4QR6A 1XCXA 3VDCA 3UERA 3D3AA 4XAZA 2HQAA 4GUGA 2Y5EA 3VKKA 1PCKA 4QCFA 4MPKA 1EYEA 2D20A 3WH9A 3JUGA 1THFD 2B0MA 1E4NA 1W31A 1KFBA 3C56A 3C3NA 5U25A 3VGEA 1G94A 1QMLA 4MADA 2FKPA 2VC9A 2F84A 3W1UA 3G1RA 5C0QA 3OODA 1FWJC 1KC7A 4S3JA 6ENLA 1DOSA 1I0BA 3EX2A 1Z69A 1AH3A 1WDWA 2AQOA 2ZA2A 4RDZA 3PZ9A 3TYDA 3DFQA 3A9BA 1TG7A 4S2BA 3VDGA 2XJ7A 4CVUA 5I77A 4ZQNA 4N2YA 3TXZA 4IIBA 3C2YA 2QPXA 1SVDA 2Z25A 3CAKA 4O13A 3CHEA 4LBRA 2HCVA 1ZBKA 4DNHA 3W01A 2VUYA 1PKYA 2GDQA 5G5HB 2E1DA 4HB7A 3AM9A 2H6RA 3QR3A 3UY7A 4RE0A 2CLMA 3B9OA 3QPZA 3UWEA 2CESA 1P5BA 5FJOA 3N15A 4XO7A 3A21A 2ZE0A 2QUTA 4MYAA 5AYZA 1A3WA 2PWEA 1JXJA 3D47A 3BZGA 2IKJA 4GUJA 1Y65A 5EFDA 2FPVA 4LC6A 1RH9A 2XH2A 1R7AA 3EWWA 1KGXA 4IMCA 3KZSA 3TXVA 1OHLA 3EKLA 5K9XA 2XIJA 1XYZA 4PRWA 4UQBA 3WYZA 1Q85A 3ARYA 1Y5XA 3GXTA 3HPXA 3C0JA 4H4PA 3FV9A 3OG3A 4JTQA 4GZIA 4E3VA 4B90A 4I8DA 1X2HA 3WQ6A 3APTA 1NY1A 3GC5A 3MS8A 3SCOA 4DBEA 3BSGA 1KM3A 3USZA 1ZENA 4KQNA 1F9CA 3GYCA 2C1IA 3QF0A 3UZXA 4DYKA 4UOZA 1G67A 4RZBA 2HV5A 1OINA 3GZ3A 3BWWA 2CZ5A 2Q01A 1KXVA 1T8XA 3BOXA 3M16A 1K6AA 2GQ9A 1JCLA 1XS2A 5I06A 2W3SA 3MBDA 4NEVA 5BNKA 5BXRA 3W28A 4JFSA 3MUAA 3WJWA 1JJKA 2YBUA 5LIKX 4U28A 2Y70A 5CJNA 3WZ0E 1A5UA 3CWHA 4LV9A 2HZGA 3OZYA 1PTDA 2GJPA 4CVWA 3EKZA 4MMWA 3U2EA 2EJ1A 5HINA 4LBUA 1SMDA 4HNNA 5D9PA 2EPNA 3PJUA 4TTUA 3FJNA 2FTWA 5AHIA 4AIUA 4F2BA 2GK1B 1PBGA 3CYJA 2B7OA 2PDLA 1C8VA 4YNGA 1DJIA 3QPYA 4GFSA 1PKLA 1R9YA 1VR6A 3THCA 4S3BA 2XH0A 1TPEA 1GKQA 3TN6A 1XWYA 3GR4A 1KR0A 3HMJG 1RV8A 5D09A 2X8HA 3CQJA 2VEIA 1UUQA 1WKEA 4GA8A 4RE2A 2J24A 3K30A 2W5FA 4LTSA 1DXIA 1DVJA 3VTRA 2XM1A 4C6BA 4K8EA 1W32A 3BDKA 5ECVA 4WJEA 1Q1RA 2BY2A 4JTDA 3NQDA 4E8GA 1MFUA 4NJIA 4Z2HA 4UFMA 3U3HA 1H2JA 5LA0A 3KVJA 1ONXA 4H6QA 2I17A 1LBLA 2GK1A 1W6TA 3HJEA 4MB1A 2G97A 3M47A 1UD8A 4PN2A 1F3XA 2VKZG 1QVBA 2ZXAA 4C6QA 4FZIA 3BGGA 5M1TA 2FH8A 4LPCA 1YIXA 3RILA 1TV8A 2NQLA 3LCIA 2VGBA 3MYOA 1LLZA 1Q6FA 4DZ5A 4ZENA 3G6LA 4OT7A 5F1VA 3A4AA 4U5IA 1UD5A 1K9TA 1S5TA 4K7ZA 3GM8A 4US5A 1Q7ZA 1TE1A 4LVGA 5L9FA 3I6RA 4FO4A 1M7PA 3KOZA 3ATZA 3C52A 1GJUA 4JTRA 3PTQA 4CCDA 2RJHA 1SSGA 3F7JA 1KA9F 1W3JA 2Q09A 3PBMA 4XIMA 1AODA 3U2OA 2CZDA 3VIFA 1OFEA 3VC6A 5F4XA 9CGTA 1XISA 1VF8A 4QP0A 2OZ8A 1BG9A 4WRHA 2RGLA 3FIGA 3H24A 4GR1A 3AS1A 4V2XA 2PBOA 3HGSA 2Y2WA 1Q66A 3QZAA 3V5OA 2A7RA 3CGDA 4OHQA 3OBEA 3GU2A 3OEXA 1HL9A 2HE5A 6XIMA 4JTTA 1BTCA 1CLKA 3NQMA 4U3CA 4B91A 1CXKA 4K3ZA 3KWXA 3O0KA 4BI6A 3R0DA 1X2GA 3AQUA 2PCEA 3GD3A 3HJZA 2V3EA 4HK5A 4APNA 4ZA0A 1QWKA 3F1QA 4DBUA 3GX9A 3OGSA 2EEXA 2Z2BA 4PMOA 2WNZA 4ZOCA 1E0UA 3GDRA 3BTNA 3KCOA 3KRSA 4GI4A 3A7RA 3FLUA 1KM6A 2E7FA 1XH2A 3G3DA 2ZUNA 4M24A 2I5QA 2ONEA 3TC7A 4GCAA 4I90A 4AUBA 3THDA 1B3WA 2ACUA 1RA5A 2PTDA 4FOUA 4AZ7A 2ZTJA 2VC5A 3W81A 5AHMA 3W7PA 1FWAC 4LUSB 1V8EA 1XLEA 2Y0FA 2XGZA 4XAYA 5E1QA 4E2OA 1J2BA 3GW3A 3EWXA 4JXCA 4GIEA 2NVAA 4KFOA 1LL6A 1TYPA 3S1VA 5DO8A 4EF8A 3CIVA 1V7AA 2HVNA 3J7HA 4BHYA 2W9MA 4NNBA 4X60A 4GO8A 3MI2A 2OSXA 4IX0A 2YL5A 1L6WA 4INFA 1WXYA 1BVZA 1WDQA 1S1RA 2EPMX 3CZGA 1O5XA 1ICQA 1ODUA 3AHYA 1MOKA 3H4GA 1DYSA 2YIHA 3V0TA 5DMYA 3NDOA 2FJKA 2C0HA 3CZLA 3ABSA 4GGHA 4LVBA 3U6WA 3TZFA 5I3JA 1PEZA 2R1MA 1GV4A 4YL2A 3TP4A 1UR9A 4HHHA 3LGGA 4DEFA 4Z0JA 4PB3A 3Q45A 1ZS2A 4LEFA 3WQGA 1TZZA 4F0MA 1TWWA 1TYGA 1RLDA 5A6KA 3L4TA 2QDEA 5C8BB 2ZQ0A 4V15A 4E4UA 3PBVA 1V0MA 5G1MA 2O7SA 3SUUA 4DI9A 2W61A 1H2IA 4HK7A 1QW8A 3HQNA 1Z89A 3FCPA 4HNOA 3LHWA 2GR3A 3BW4A 2A6LA 1W54A 4W9TA 3WQWA 1MXSA 1DJZA 2X0SA 6XIAA 2E9MA 4ZE4A 2VZOA 3VX1A 4DJDC 1RZMA 1E73M 3VD7A 1W1PA 2XGIA 3A5VA 3AROA 1HT6A 3SRKA 3FEQA 3A7AA 4W4QA 3U4AA 1OK4A 5HAOA 1ML1A 4DIAA 3L65A 4UNKA 1X1ZA 4XQ6A 3ZLHA 4AZHA 2QMKA 5DX7A 1XHCA 4Q4MA 2W55A 3TROA 5JXQA 3QC0A 5AYYA 4ADWA 3SSZA 1TPWA 1GVYA 3GHSA 1FWTA 3MCOA 8TIMA 3IIVA 3VFLA 1R2RA 4RCXA 2JEPA 4PSRA 2YLAA 3SIMA 3G1FA 3AMLA 1YNQA 3WUBA 3UETA 4EQRA 1JF6A 2C91A 2BDQA 1LT7A 2VDGA 4K36A 3MWCA 2DORA 1S5NA 1QI5A 5JIWA 1J5TA 5TR3A 2G3IA 3VE9A 3IGUA 1J6PA 1SU5A 1GVSA 1DQWA 3NQAA 2ZTKA 4DQWA 4D8LA 3CQKA 2F5ZA 4DBSA 1YDOA 3TTEA 2ZE3A 4V1XA 3M0KA 2NV9A 1S2UA 4CCEA 4FXSA 2QUNA 5BU9A 3OP2A 4YPJA 2TODA 3IVUA 5A6LA 4V28A 3SCRA 4URIA 2NUYA 4ZO9A 3V36A 4V1YA 3FA4A 3MHFA 1UKQA 1TJ0A 2OR2A 3KVLA 1AD4A 3AMKA 3NZPA 2WQPA 4MUZA 1P48A 2BP1A 1CXHA 3IS4A 4DAFA 3RU8X 2ZZ6A 3ARWA 1EBDA 1XANA 1V7YA 3COTA 4MJ2A 1XYCA 4QX4A 4PTDA 3TW9A 1GT8A 1XIFA 4PCPA 4GYPA 1H7RA 4QS5A 2RDUA 4KFPA 3OIHA 1P6BA 2AAMA 3MUCA 1F3WA 5M17A 4CQDA 4A35A 4CD5A 1O68A 4P61A 4NVTA 4Y8FA 2CDUA 3UXDA 3R0KA 4FS9A 3HMCA 2FVLA 1GVFA 3AIRA 2XVLA 1Q13A 3M41A 2YW4A 4IGMA 3N14A 5JCMA 1XUUA 4CNTA 3ANYA 2VRQA 3I3BA 4Y96A 5GJPA 3QV8A 1FWSA 3W1RA 6REQB 1ELSA 4GRSA 2GFTA 1O1ZA 3CUIA 3BLOA 1DHKA 2P76A 3LENA 3E5PA 4F2TA 2XINA 3PSWA 3NS1B 3E96A 4W7VA 2G3FA 4HA0A 3WO8A 3QKEA 1VQZA 2VI0A 4ATLA 5BU6A 1S46A 5CC7A 3H23A 2A3CA 3LXCA 4K38A 1EUAA 4LY4A 5FS9A 2Z00A 4TQTA 1JOAA 8RUCA 2J78A 2DVTA 4ZMGA 4FR6A 1UR1A 1RXOB 4MF4A 2WVVB 3FAWA 4S23A 2A3EA 3JZUA 2ZZ7A 3PZIA 2GGGA 4Z17A 3TFCA 3TJLA 3VNYA 1OFOA 1Y0EA 3Q58A 3MV11 3UXIA 5C6MA 2QKFA 2HISA 2QCCA 1VP5A 4Q32A 6REQA 1EFZA 4EPEC 3VNMA 4KWSA 5I5RA 3TAOA 4J2PA 2WKGA 2WM1A 2QCGA 3NZ1A 1K03A 3QQWA 4JTCA 4J56A 3FX4A 2Y88A 3EZ4A 1NHSA 4HKPA 3SB0A 3KM8A 1OCNA 1RD6A 1UW9A 5CZJA 2VGIA 1JPDX 2D24A 1QFEA 1GOMA 1PAMA 2Z6IA 2G4JA 2HNEA 3C0SA 3TJ4A 1I2PA 2WVVA 1RK6A 4U33A 1GWJA 1W8GA 3W00A 3M4HA 2WP5A 4Z2KA 3SRFA 3QMSA 3A4XA 2YBTA 4AH7A 3FKRA 1US2A 2BOEX 2INZA 2UZ9A 3URQA 1IT7A 1D7YA 3IK2A 1JEHA 4ES4A 1XIHA 3IK4A 2WJDA 3LCLA 3H7VA 5HA7A 2PC4A 2QNEA 4DELA 1CB7B 1R2TA 4O4WA 3UQNA 1S5MA 2Q71A 2GWGA 4GOAA 1KRMA 4O11A 2F2KA 3FXGA 1QO5A 2NSXA 5KITA 3NOEA 2ZVRA 4AAJA 4OBRA 4HTYA 1DJYA 3LGEA 3RFAA 1BWLA 1MO9A 2P0OA 3PK7A 4ZCWA 4X61A 4XZIA 5FCZA 4RNFA 1KM0A 2XN0A 1QPKA 3CB8A 1JIBA 1YPIA 1W9XA 4RZ6A 2OOFA 1XLKA 3L67A 4PULA 2ISFA 2AKZA 1MQRA 2GOUA 3W26A 1TPFA 2V2DA 2CLIA 3OOQA 4NIRA 1V0NA 3GFYA 2H9AB 3MP4A 1UR2A 1GQIA 2AGKA 1UP0A 1PWLA 4RK8A 5DCBA 1MZHA 4LS0A 3UR5A 2GSJA 5FEPA 2Y89A 1A5NC 2QJHA 1R2SA 2WJFA 1QDSA 3T6CA 4N42A 2C79A 4TX8A 2QYGA 2J7CA 4JYEA 3TA9A 4DM1A 4BR1A 3GNRA 1VDVA 5I79A 3VM5A 4JAWA 5T91A 3RR1A 1L6FA 1KFEA 2P8CA 3IIXA 3Q67A 4EF9A 3DH9A 2BOFX 4C5YA 3RXZA 1EP3A 3S1GA 1ZXIC 4HHLA 1IR1A 4MGGA 3JRKA 1MZRA 1KXHA 7XIMA 3BGJA 2H9AA 3ALFA 3UJ2A 1EEPA 3WBAA 1JPIA 3CPUA 2PFHA 1IZJA 3VNJA 1VQTA 2G8ZA 5KTLA 4S38A 2BVWA 3VNKA 4PRRA 3PG8A 4H9XA 5FF0A 1QR7A 5E0CA 3GXFA 1H60A 2DVUA 2JGYA 2ZUWA 5A2AA 1HUVA 1M03A 1I9CB 3CC1A 1CECA 3GW0A 3CIXA 4LC8A 1ZJAA 1VHNA 1C29A 4JPGA 2D3NA 4JNMA 1V03A 3OW1A 3VKJA 1W1A1 1FH9A 4UXDA 4QSHA 3G1SA 4PEEA 4PUWA 1OWQA 3NPWA 4F48A 2PDJA 3T4CA 4JTSA 4TVYA 3MVTA 3ARZA 3SGZA 1R0MA 3GQYA 2BY1A 3UPMA 2OLSA 4AYSA 5DY2A 1CB2A 1UA3A 4FSAA 3BCJA 4GLEA 3NSNA 1EQPA 3RMEA 3H2FA 1KGWA 3QZEA 5A1AA 2OO6A 3PBUA 3ZWTA 3BLEA 1IV8A 3S2JA 1QOXA 3CPGA 1GOKA 2JKEA 3QGVA 4BKNA 3GTXA 4CD4A 4S3EA 3GFZA 1S2VA 4I8YA 1I2QA 3R8HA 1F3EA 3DUGA 1PIFA 1UCWA 3LEPA 4HMNA 1KM5A 1IXNA 1TJRA 1OK6A 3NVDA 2J74A 1R3TA 3WH5A 1L0PA 3QR1A 5DRCA 2GGJA 1EXPA 3VZXA 2V3GA 5B7YA 3QFWA 1W3TA 1J12A 5FJTA 1ISXA 4M6VA 3CO4A 4GNKB 3WK2A 5I2UA 3T09A 4EANA 5HANA 1TYTA 3I6TA 3DYMA 2ZC8A 2VD8A 1RSCA 1CXLA 1NWSA 4PTNA 2X1SA 4XZWA 2E09A 4IXHA 1F6YA 3EWCA 4H6EA 3B0XA 2OYLA 4HU3A 3RCMA 1K7FA 2GRTA 3W70A 3L5AA 4H4YA 4KWOA 1YXYA 4OVXA 3GWQA 4ZR8A 3GNDA 4NYYA 3OVPA 3PZQA 2RH9A 1V4YA 2A3LA 5CC6A 4QISA 1FWIC 3T1GA 1R8LA 2CBIA 4S3GA 4K7YA 3B0UX 1O7AA 1ISWA 1VCGA 2AGTA 2CC0A 1V51A 3MUXA 3QBUA 1ZBVA 4AD4A 4TIMA 2WZEA 2YL6A 2OYMA 4Q4PA 4PTVA 4E2VA 1IGSA 2FMOA 4ACZB 3MMTA 5FF3A 4YHGA 3A4JA 1S5VA 4C6IA 5F2GA 2NXGA 3MO4A 2CPUA 4MAZA 3EOSA 2R6OA 2FFCA 3GNXA 4UCGA 4DF1A 2Y8UA 1OFAA 5I3KA 3PTMA 3NXLA 4GPNA 1XF0A 1FTXA 1AOGA 3B04A 4IX2A 4NZ3A 3NFUA 2E25A 5AYXA 1WOAA 2V2CA 1TSIA 4WGHA 4R7WA 4GK8A 2P0IA 2JKPA 3CV1A 3WF1A 3UEQA 3QV6A 1TTPA 4AIEA 1FH8A 1QHPA 3CGCA 2PC8A 2Q6ZA 1NU5A 1V5XA 4F0SA 4ACZA 5DCDA 4MWAC 4CU7A 1O12A 3CLMA 3IANA 5BROA 4F79A 4N9EA 3LRLA 2GJNA 4LYRA 2PTYA 4EIVA 3MY9A 2WJZA 4TXEA 1HGYA 3W2MA 2J7BA 4C6KA 2WJEA 3UZ5A 4AZ6A 2E67A 2DJLA 2YCKX 3HGRA 2ESCA 3WQ4A 1X97A 2VEFA 2PGRA 2WSYA 1XLDA 3ONBA 3VNZA 2QCNA 4FALA 2GSHA 1ZNNA 3AYVA 1B57A 3W1XA 1P1MA 4QE4A 2HK1A 4X9YA 3MV01 4I5RA 3E38A 4QDMA 3ZSTA 1RAKA 4LB4A 3W7QA 4GJIA 1UOKA 3VD5A 5PTDA 3CH0A 1HKMA 3G1HA 3PF3A 3S42A 3KDNA 1EP2A 1K9EA 4HYVA 2Z1WA 1JZ7A 4GXWA 2KZHA 4PMUA 4Z08A 1JYWA 1ITCA 1LG1A 1TWZA 1GTHA 1P7TB 4YMZA 5CJ5A 1UWIA 1XBXA 2WLYA 3DGBA 4YTTA 2PWHA 1ZBWA 4GC3A 3WJSA 3GKAA 4ICNA 2CETA 3VMNA 3AZTA 4E38A 4JQ3A 5HQMA 1AZ1A 1C8QA 4L4MA 1PCWA 3LCHA 3P3BA 3CS2A 2E5BA 3TYCA 4NJJA 2ZDRA 3W7CA 1GREA 4KF1A 2VRJA 3NSXA 1XIGA 5FJUA 2CZEA 2ZRUA 1Y8BA 4GBUA 4QS6A 4JTEA 4DF0A 3L66A 1OC5A 2XN2A 5F7UA 3O2LA 2D22A 1A47A 4GH1A 3DKLA 4RV8A 4YCOA 4AZGA 4WCJA 1GJPA 4EWJA 1TJ1A 1J0ZA 3WQEA 4J57A 2FZDA 2W0HA 3N2BA 2QW5A 1E6SM 3L4ZA 2PRHA 3O6CA 2HS8A 1P7TA 2ZWYA 1E1CB 2J79A 3HFTA 1S7MA 4XG1A 1PYFA 4L4OA 3W23A 3GVRA 4EKJA 5E9XA 5H6HA 2YXOA 2XIQA 1F73A 4WQ6A 1NDVA 3D5HA 1N55A 3ZT5A 5CBIA 1XBVA 1W5PA 3STFA 4X2RA 3PZMA 5IOBA 4FNUA 1Q65A 3G0SA 3RU6A 2UY5A 1P6WA 1MW2A 4GACA 1V79A 3PZNA 2NUWA 3ZFHA 4Q22A 3W1NA 1VYSX 3UWZA 3VD9A 2IKHA 3NVVB 2XH7A 2DIEA 3PVFA 1B4EA 3CYVA 3W85A 1D3GA 2BBFA 1ONFA 2J62A 1FHDA 5G2HA 4BS0A 4D8AA 1OG0A 3AJ7A 4ZVJA 1X6LA 5AZ0A 1FHVA 2GQ8A 5DXXA 3MMUA 5BXTA 5DELA 2CHOA 5FIPA 1E1CA 3SCNA 4CD8A 4XX6A 3IJQA 2INEA 5IBXC 3U9IA 2BXVA 4GZJA 3GNNA 4CCCA 3RRAA 2WO5A 1R3RA 2POTA 3NZRA 3O6AA 1NH6A 3BLIA 3GTNA 3W0KA 1XSKA 1A5AA 1U2YA 3AS0A 3BANA 1JD9A 3QC3A 3GR7A 2DIJA 2Z4GA 1JEZA 2FTYA 2WVUA 4L5ZA 4BURA 1P0NA 3HV9A 3K1GA 3C2RA 1UIOA 1U5HA 1UKOA 2V67A 3L7RA 4QBXA 3PB0A 3C2VA 2I16A 1VJIA 4LSBA 3OYZA 4JY8A 3SM0A 4IPLA 2B7NA 3B06A 3DGHA 3QH2A 3IIOA 3S47A 4KERA 3AIWA 3BG5A 1XIBA 3TX9A 3WJYA 4JDRA 5I3HA 1TMLA 4N4QA 5A8PA 4PTMA 1IXPA 3E2QA 3U2ZA 3ARUA 3KWSA 2X30A 4DLFA 5DT7A 3PG9A 3L4WA 4X9SA 1XPGA 3UG8A 5AVHA 3P93A 4DWSC 2OX1A 2P8BA 4MAVA 2CEQA 3BZJA 1BGAA 4GUFA 5E70A 2GR1A 5EL1A 1E4MM 4PGLA 4BQ3A 2RGMA 1N5WC 3WG6A 3MKCA 4JTIA 3UG3A 2XFRA 3M07A 4HNLA 3OO2A 4GVFA 3F5LA 3ERPA 2ZKMX 3EX1A 4UQ9A 1E55A 4J40A 2YW3A 3EYPA 1ZL1A 1UR4A 3LRMA 2E9LA 1T96A 4ERGA 4CD6A 5EU9A 2Y7FA 3BCDA 3L2LA 1C8YA 3ABRA 4EQWA 3AZSA 4NEWA 1OD0A 1FFRA 1C7SA 1FOBA 5XIMA 2WKLA 2QUVA 1E40A 4B16A 3RRXA 2OCZA 1D3HA 1FWCC 1X8FA 1WCGA 2RKXA 1EB3A 1F4HA 3T07A 2OGYA 2PAJA 3M7SA 3M5VA 4V27A 5A3HA 1EEXA 3MW7A 1ONWA 4GC4A 2ZZ5A 2W62A 6ALDA 3VXGA 3OLEA 5DANA 3A7UA 1CI1A 3VGHA 1EBHA 3LX9A 2R1NA 2J9ZA 1XGZA 5BRPA 2PDUA 2X8RA 1I2OA 2KX9A 3B8SA 4L4PA 1FWDC 2AL2B 1FDZA 1GVQA 2NVKX 1R9ZA 3S46A 1VFMA 3G1VA 5JIPA 5F2LA 4LW7A 3PBWA 1OADA 3U5YA 2WPGA 5D03A 5LNWA 4K6AA 3UYIA 1OD8A 3BJTA 5HPOA 4I5UA 3I65A 2XFFA 2WYSA 4FI4A 3LB8A 1US0A 4AZBA 2PZNA 2QMJA 3SR7A 1QNRA 3L2MA 4Y9PA 4M80A 3PZTA 3TN4A 3C2EA 2B31A 1UG6A 1PL9A 5I3FA 3URHA 1MEHA 2CKSA 4HOZA 1PE1A 2DZBA 5LKYA 1MSSA 3V1PA 1Q45A 1BKHA 1IE7C 1TJPA 2O4MA 3WBWA 1IT8A 3GTHA 4C1NB 4DJFA 3KRBA 1H1ZA 2DT0A 4DM2A 1XRTA 2BGNE 3WLOA 3ABOA 3TMQA 4NI8A 3IAQA 4LEQA 3W7LA 2AL2A 1TWIA 1WDRA 3W2UA 3PFRA 2UY2A 1SM9A 3QMRA 2HQMA 1UKPA 1B30A 5J8LA 5LGXA 3WH8A 5C2CA 2GDUA 5I24A 1IEXA 2WMGA 4LCSA 1Q6GA 2IXUA 2A7PA 1E1FA 1D8WA 3S4TA 2X42A 2OU4A 3AXXA 2F2HA 3Q37A 4MNMA 4GKLA 1W9UA 1AMKA 4FXJA 4L4LA 4O12A 4MNKA 4ZQMA 2NT1A 2OVLA 1HN1A 1H7WA 1X96A 3UZYA 3H2CA 2XISA 4PL1A 3VIHA 4B3ZA 3MC5A 4HZ8A 4ZO8A 5A6AA 1V6VA 1T40A 4KCUA 1I45A 2FHFA 5KMYA 1CDGA 4X0NA 1UBPC 3GIPA 5FJPA 1POKA 2ZVIA 1HL2A 1VBRA 4F0LA 2C16A 1ZAHA 2PDKA 1DP0A 3KRZA 2WHJA 2OFJA 1ZAIA 1M7JA 4WOZA 2HXTA 3H2NA 4ZZ9A 2QGHA 4ICCX 3VMPA 3NQGA 1DWFM 4P7LA 1EGMA 2XIBA 1BPLB 3H7RA 3QHMA 2QCHA 4ZTYA 3WLSA 2EQ6A 1H41A 2WMIB 3KBNA 2PDFA 4G1NA 2VO5A 3FEMA 3AYRA 4QG8A 1LCOA 4K8DA 3EXSA 3AZRA 4TX9A 4UTMA 3UT0A 2Z6JA 2GVLA 4AEFA 2J7EA 2WNQA 3CHFA 5CPTA 3H2EA 4HCDA 4IGHA 4QFUA 4IQEA 3IGSA 2NQHA 2WMJA 2CWXA 4XTDA 3VUPA 3HU7A 1SZRA 2PF8A 1GHRA 3AMGA 3EEZA 2ZUTA 1ZJHA 4PE8A 3VGFA 5I07A 1LRNA 4LCQA 4KEUA 4P2VA 2OSWA 2PEVA 2FPTA 4LQ1A 1LWHA 4DBDA 4JOMA 4J3ZA 4IGSA 3AMZA 1Y5VA 2WMIA 1RY0A 2P3EA 1V3LA 4D71A 3ABQA 1TV7A 3T44A 3SCSA 2ZXQA 3UP8A 4UQAA 3G0XA 2CBJA 2DT1A 1FQ0A 1M65A 3MKVA 3RJXA 3M0JA 4D6EA 2ZZCA 3H21A 2X50A 3LRKA 3URNA 2RFGA 3G1DA 5C5YA 3XIMA 5JCKA 3M64A 3W9ZA 3NQ6A 2IPWA 2VM8A 4X63A 4A8RA 1CIUA 3M0LA 2WOVA 5AC4A 1JDCA 4GIRA 1NHRA 5AN7A 4L6OA 2E68A 3OTRA 1RJPA 1FY6A 1C3FA 3GHUA 3BICA 3BK0A 4J1OA 3PUEA 4ZB0A 5BOFA 1EJXC 1KWKA 3EB3A 5HJLA 3S6DA 2XDFA 3OZMA 4AYGA 4ZB2A 2WZTA 1NWUA 1OX4B 3XISA 3ZR5A 1NM9A 3DHFA 1VIWA 4DUOA 1EH9A 3AMCA 3QV7A 1REQB 2YOCA 4RR4A 3QTGA 3Q65A 5C7VA 1LORA 4YN5A 4ZTXA 3QYQA 1PDZA 2HK0A 3HV8A 3LB0A 3ECQA 1XDJA 2X05A 2CLOA 2WSRA 4DZAA 2PWUA 1VFTA 3LPFA 4NJKA 2ISDA 2AMGA 1ZCCA 2Z1XA 4I3GA 1EJTC 4H01A 3IGXA 3VINA 3WLKX 4AY8A 2QULA 2W54A 1T7LA 1N7KA 4W5ZA 1YMYA 3AHVA 1JDDA 1GEUA 4QQUA 3Q94A 3L9CA 1OX4A 1BQGA 3OLGA 3WLRA 1NDWA 3KXQA 3PZVA 1REQA 3M0ZA 4WIWA 4KIRA 2RABA 3O07A 1UQZA 3ZT7A 5AB3A 1JPKA 3IJDA 2A2IA 2ZRZA 3LYEA 1FHLA 2EO7A 4YVPA 1VEPA 4L56A 4UMAA 3IJLA 4H8NA 3VKCA 3CUHA 2FQIA 3TLQA 4B5SA 2OWXA 2VP8A 1RPXA 4BQ4A 1F8MA 1QBAA 3KX6A 4DAIA 4HA3A 4C7DA 1GETA 4A22A 3LM7A 2DT2A 3NO3A 4HVXA 1XLHA 4A2RA 3C8FA 3QR0A 1OYBA 1IHIA 4M19A 3NEVA 4BWLC 4HNTA 4UFKA 3VYLA 3W02A 2C8NA 2PDBA 2YVGA 1GQKA 2VDIA 6TIMA 1XXXA 1AFSA 1XSJA 1CGVA 4US5D 3FYPA 2EKCA 1OM0A 4G7FA 2UY4A 3KOXA 3WEZA 2R1PA 3F4VA 3IACA 1IEQA 1S2AA 3B8IA 3LHUA 2R1LA 1M6IA 3KHDA 3P67A 1UPMB 3QY7A 2VURA 4R27A 5CZ0A 1FIQB 3G5EA 1FXPA 2VC6A 3H4WA 1NFPA 1OT1A 1H62A 2OLAA 2V69A 1GKRA 2WOQA 3EDFA 3WJZA 4JFWA 5H2ZA 3E12A 1UKTA 2VCBA 1WZAA 3NNTA 4G9PA 2VNCA 5H91A 4FIRA 3UR2A 4MYXA 4W86A 1EA9C 1GPFA 2PPGA 2CLFA 1RLCL 2YCLB 4E8DA 3MT1A 3TKFA 4IP7A 4X22A 4MNLA 4DBWA 3EUB3 1KTNA 4HOXA 4J4KA 5C54A 4O52A 1EDGA 5HDRA 1JULA 5RUBA 2Y5JA 1H61A 1IF2A 2YL9A 2PRMA 3W7JA 2WMFA 3IIZA 1J0YA 3GTFA 5A6MA 1GCYA 2C7FA 3NYZA 2JEQA 1CCWB 5E09A 1OEPA 2PA6A 4XKMA 3VCRA 3BMVA 2EG6A 2DUZA 1YXCA 2Q3RA 1ZRQA 2YGYA 1OX5A 2E0PA 4JTUA 5AYIA 2Z28A 1GHSA 1CEOA 2PDYA 2YCLA 1KTBA 5CAKA 3WEMA 3H6OA 4DJEA 1ZALA 4PA8A 1KKOA 1RJRA 2V68A 2F61A 4NL1A 1XFBA 5K9DA 4HA4A 3C5QA 4REQB 5HNRA 3L12A 4B5TA 1BLIA 1N5XA 4Q8UA 2PSNA 4OGZA 2ZZ2A 1YLVA 4IJRA 5LIWX 2PGEA 3M0MA 4XAGA 4FA3A 4UNIA 4BEQA 4C6LA 3AISA 4LVFA 4L64A 3TDFA 4DB7A 1HX0A 3BAKA 2CCRA 2XFYA 3UG4A 1F76A 1SW3A 2PE4A 1MVYA 3GSMA 1ESWA 3W22A 2XG9A 1QOPA 5CLWA 1HVQA 2JK2A 1CGWA 1IWBA 4Q7IA 3VABA 1XUZA 3OJGA 2EGZA 2WB5A 2W27A 3R8RA 1A5LC 2A3HA 4LVDA 2JGQA 1KFCA 2OOGA 3A9IA 1WAWA 4REQA 1KFJA 3SUWA 1PHQA 3L4VA 3I4KA 1XGEA 1W17A 3W3OA 2YLLA 3UD6A 3NQ7A 3UBPC 3T78A 3WNOA 5TNVA 2AL1A 1JYXA 3MBFA 3DH7A 3G18A 2G50A 1GQJA 4JTKA 1XLMA 1O66A 3I3EA 1QNVA 3KS5A 4H50A 1ITQA 1H0GA 3HG3A 3UJEA 1N82A 5BZAA 4HPXA 2XFWA 3ZS4A 4BZYA 5BYWA 2YZRA 2NX9A 3POCA 3WJXA 5LXXA 4Y8EA 3OB8A 2J7DA 4J7RA 3N2XA 4IZGA 4CLMA 4UQCA 1MNSA 3ARVA 1NP2A 2NX3A 3VOIA 4J3VA 3S2LA 3MHUA 2OEKA 1CTNA 5A8NA 7PTDA 4I5XA 5FF7A 1XQLA 1JYNA 3W87A 4ZQCA 3GH7A 3TSBA 1XYBA 3DFNA 5BXPA 4XWUA 2ASHA 1KRAC 1ZJIA 2V5CA 4GIAA 4MTVA 5A2CA 3QEZA 1DWIM 3UZWA 4XBKA 5FSEC 3T0BA 2WM0A 5HNNA 2RUSA 1H09A 1JGMA 2W63A 3W2KA 4FR1A 4Q7NA 1DWJM 2QVNA 1W3IA 1EPXA 3ZVHB 3DC8A 1TPVA 2E6YA 3FJLA 1RHCA 4IHCA 5CBJA 1ADSA 4AC1X 2E3TA 1W2VA 2I9EA 4CNOA 4N6EA 5AYBA 3RX3A 5HQEA 4U31A 4DJDA 2A85A 3DEQA 1TVNA 3GY1A 4L6DA 3WQ8A 1ZB5A 5K9CA 3GXPA 1FP9A 2TPRA 2J8TA 1PJ9A 4UTUA 5EBUA 3EPMA 3R79A 3R58A 2HXUA 4W89A 2O9RA 1QI3A 1HKVA 3CQ0A 4PFHA 2VHLA 5HR6A 2HSAA 1SQ7A 2GOKA 3WNLA 3AS3A 5G4HC 3WX7A 5LZLA 4LCRA 4CD7A 4ZB5A 4CEXC 3EA2A 3GUGA 3ZVHA 2CWNA 3UA3A 2DW6A 5EGRA 1JNDA 3P61A 4MDOA 3TFXA 1ZGDA 5A94A 4PUMA 2OEJA 2IW0A 1XYAA 4IMEA 1T0OA 1D7FA 2DP3A 4M8UA 1DE5A 5DF0A 4P7RA 4QITA 5HMDA 1YQZA 3GAKA 3FXYA 3GUWA 3CUZA 3R6IA 2NW0A 3SECA 2HJPA 4ERAA 2NUXA 4CNPA 4AVNA 4G7EB 4B2DA 5AFDA 3RNMA 3CGTA 4MB4A 3HB9A 4GQRA 1O5QA 3D3FA 3ZO9A 1A5SA 4E5TA 2NQJA 1TX0A 2E40A 1OB0A 4R9XA 2QF8A 2J7FA 3DENA 4O8AA 2Y5SA 5GRTA 3CT7A 2JE8A 1GZGA 4ZQOA 2O4QA 3OBKA 3SSJA 4LU0A 1FWHC 3NM3A 1BHGA 3GB6A 4Y9OA 3MWAA 1ISVA 2WV8A 2DGAA 2DSWA 3U48A 5H8MA 2W4XA 1TCMA 1K3UA 3SAZA 3CH9A 5AC8A 1IEIA 1GVEA 3RGTA 4G7EA 1EJWC 1ME8A 3EOUA 4FLRA 4ZEPA 2C13A 4RDWA 2ZWZA 4US6A 1Z6KA 1XCWA 2ALRA 4W8LA 2BY0A 1Q6EA 3B4UA 2AAQA 2VWTA 1E4LA 1MWOA 1QHZA 4K8GA 1J11A 2YYTA 1AL7A 1DIKA 2E1WA 3FDGA 3W71A 2YCEA 4RXFA 1XDLA 4EXBA 2YDQA 1A4LA 3MSRA 2GUYA 3T2QA 2WOWA 2VFDA 4N02A 3ABXA 2WKJA 2XIOA 5DQPA 1ODZA 3I4EA 4R5EA 1JVNA 3G1YA 3TNOA 1BSLA 2DJXA 1L6GA 2VJXA 5AVNA 2PLCA 2BX7A 1V02E 1V6UA 2XTKA 2V5BA 1ZZMA 3LQLA 1VZWA 5EMMA 3N3TA 4X0VA 3CQIA 1GOOA 1QJWA 4W8AA 2PDWA 3W75A 1GW1A 2ZX6A 1DIEA 3LXAA 1PV8A 1GEQA 4XD3A 4HPNA 2A8XA 3W2JA 1D8CA 2EXOA 4M52A 1EYWA 4W8BA 1XLBA 2ATSA 1RP9A 2QT3A 4IPNB 5CGQA 4HGXA 2HE8A 3EDJA 5K4XA 2WPEA 4KCTA 1NF0A 2G4FA 3VDHA 4U2YA 3ABZA 3QFEA 1LRTA 2V30A 4GVIA 4KPLA 4S39A 4Y6GA 1US3A 4PYSA 3EWDA 3S8HA 1STZA 4Z2JA 2QV4A 1SFTA 3B9DA 3MKKA 1LYXA 2QJIA 3VKAA 1UC4A 2VCCA 4QRNA 2ZX7A 1DXLA 3W84A 3NOYA 1HW6A 1TTQA 4JL1A 5ABTA 1FFVC 4TVUA 3GH5A 4ACYA 4M81A 3EOOA 1IZCA 2VGFA 1D7KA 1FP8A 4MSSA 5JH1A 4C5ZA 2OTDA 2PDPA 3ZOAA 3LLDA 1ZFJA 4ERIA 3WQPA 1RALA 1QI4A 3KL5A 2JIEA 3NTYA 3C6CA 3ZWSA 3NYDA 4P7OA 4TV6A 5D30A 3P8JA 5JMUA 2E5DA 2PLJA 4ROPA 3S2NA 4PUNA 1T5AA 3S2MA 3UR7A 5J5DA 3EAUA 4DUVA 3WL1A 1W1VA 3WDQA 2BOGX 3FOKA 4UTIA 3CU2A 8XIAA 1HKKA 2D0HA 1XRVA 4JKKA 4FDCB 2XZ9A 3EA1A 3TE9A 4QLKA 3LN3A 4ZO6A 1GNXA 2X40A 1YTEA 5BMXA 2W92A 3POHA 4W5UA 4IP4A 5EBAA 3IC9A 3ITLA 4EAYA 2PTXA 4GISA 1QU4A 4ORIA 3N17A 1TMHA 6A3HA 1UUMA 3BVJA 3HN3A 1GZ1A 3GDLA 2PI6A 2QGYA 4AD1A 1KV8A 2PZ0A 1GW9A 2DSUA 3BL3A 4XO6A 2OWWA 5HJXA 1VCVA 3KBSA 1KBKA 1KBJA 1QBBA 4TMCA 1DTNA 4K68A 4HHPA 2O92A 3ZJ8A 1G69A 4CUCA 2XIIA 1PX4A 2BS9A 2VZUA 1TJ2A 3G1XA 4MHBA 3EKGA 4GY7A 2VRKA 1WA3A 2NV2A 4HNCA 3SCQA 1QPNA 1WZMA 1LPFA 1V93A 1ZKQA 1NF7A 3AOFA 4LYPA 1UWAA 4GX9A 5D2WA 1K1DA 2ALDA 1OFBA 3A4WA 2V5KA 4HK6A 1O5KA 4LIIA 3VGBA 1T41A 3LZ3A 4HZ6A 5C9WA 2P1FA 1V59A 5HMSA 3JR2A 3FFSA 3L5MA 4UOJA 1HTIA 2ZYFA 1F7BA 4B15A 4N6FA 1S3HA 4IUOA 4ALDA 4PMJA 3LY0A 2Y63A 1BWCA 4KEVA 4AVOA 4HNVA 4IGNA 2WBKA 1RCOB 1GOWA 1EBGA 1WOBA 1R46A 4RPPA 4PUEA 4CGTA 2DUXA 3K13A 1E0TA 2OPJA 4GGBA 4LYQA 3WK0A 3W38A 1WZKA 5B80A 4YU1A 4GH3A 1XDIA 2PURA 4AISA 2YL8A 5ER0A 3NPVA 3K4AA 3MMDA 5CZTA 2GQWA 4S1FA 1FBAA 1UMYA 4ZXLA 4YWIA 3GTIA 1XYMA 4DPQA 4O1DA 4Y9MA 3AFBA 4HQVA 4FAMA 3WL0A 4YVVA 1IGWA 5FOOA 5DT5A 4QROA 1E9YB 3INPA 1Q4WA 4OOZA 1XIIA 1Q6QA 3HPAA 4TOQA 4LV4A 2JBMA 1W8SA 1EOMA 1ZLPA 3B97A 3H2AA 2PDXA 3BAJA 2P3ZA 1B9BA 1PIGA 5L6UA 1UMLA 1IEVA 4D6IA 3WQVA 4CU6A 4Q6XA 1JAEA 1LQ0A 2POZA 2R94A 1OBAA 1UWTA 3G2GA 5E6ZA 2NXHA 2XSBA 1C9WA 4D6CA 5HUPA 4O4VA 2J7GA 4W88A 1W1IE 4OOUA 5E6YA 4XZ9A 4Z1DA 1VB9A 1NTHA 1TPDA 4YTQA 1L8PA 1XD0A 3E5BA 4D72A 4HJFA 3W2LA 3QOKA 2ZCGA 3O3RA 3S5OA 1PTAA 3N9KA 1UD3A 1LRQA 1VBGA 3UGRA 2F9RA 2FMNA 3FA5A 4JHZA 1BVNP 4MWAE 1EJRC 4QJ3B 3F2DA 4QE5A 4XSLA 2ZRYA 4Q4KA 3CZEA 3GVVA 1DTUA 3NG3A 1KLYA 2V3DA 4RE3A 4DUWA 2CBVA 1YPXA 2GQAA 3TSMA 1JNEA 4G56A 4Z1AA 1VFHA 1QHOA 5A8OA 2Z1KA 3LADA 3VUSA 4AEOA 2NLYA 3ITTA 3SUTA 1RM6B 2R1KA 1I8JA 1KNWA 1DHPA 1EO5A 3T7VA 4WSJA 3B05A 3MSGA 1JZ5A 1JDAA 1QI2A 1W1ZA 4WXZA 4K7VA 2BNJA 5G4EA 3WF2A 2QAFA 1BF6A 1MQQA 2I57A 3F4NA 2Z2UA 4QEEA 5KEZA 3KP1A 4EQXA 3ICJA 4J3WA 3G24A 4XUGA 3E0IA 4XZHA 1XKYA 4P7NA 4PODA 4H4WA 4B5NA 3WLJA 1E0VA 3EWYA 4WKAA 4GVGA 1EC9A 4DNAA 3W07A 4H8VA 2WNNA 5MKGB 4ASTA 3TTOA 4AU0A 4MWAB 3P6LA 2D2OA 3A12A 3T0DA 4LNYA 1W37A 5AHNA 2WP6A 4CNNA 2X1RA 2QR6A 4Q8QA 5LSMA 3PPFA 2J3NA 1GRGA 3SY8A 1FFUC 3KW3A 1XDMA 1IZKA 1XLCA 4PB4A 4H9MA 1B31A 4NZ5A 4ECLA 1MRQA 3C4UA 3BJSA 1LM1A 2C1HA 3L21A 3RJYA 4JD4A 3SFKA 3CUFA 1K9FA 4Q6JA 3DFSA 1O94A 1R9XA 1P43A 2QV5A 2AQVA 5EBKA 4KGLA 4MLJA 2WSQA 3TC6A 1LBFA 5MKGA 4AQLA 3LPPA 1WBJA 4DUXA 3PPCA 4QCEA 3W29A 1LBMA 1KKRA 4MWAA 1VPYA 4HZMA 1VFLA 5GVJA 4QTGA 1O5RA 1WKYA 4E4PA 4XBJA 1M7XA 2PDQA 2BXZA