3OZMA

Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
386
structure length
386
Chain Sequence
b'SLKITEVKAHALSTPIPERMRVESGAGLKLNRQMILVEVRTDEGVTGVGSPSGPYDLAVLKRAIEDVIGPQLIGEDPANINYLWHKVFHGEVSRNLGHRSVGIAAMSGVDIALWDLKGRAMNQPIYQLLGGKFHTRGVRAYASSIYWDLTPDQAADELAGWVEQGFTAAKLKVGRAPRKDAANLRAMRQRVGADVEILVDANQSLGRHDALAMLRILDEAGCYWFEEPLSIDDIEGHRILRAQGTPVRIATGENLYTRNAFNDYIRNDAIDVLQADASRAGGITEALAISASAASAHLAWNPHTFNDIITVAANLHLVAASPHPAMFEWDITHNDLMTRLASYDLKLENGLVQPPQGPGLGFEIDWDFVAAHAWKGEPAIGAGHGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative mandelate racemase
publication title Crystal structure of enolase superfamily member from Bordetella bronchiseptica complexed with Mg, m-Xylarate and L-Lyxarate
rcsb
source organism Bordetella bronchiseptica
molecule tags Transferase
total genus 132
structure length 386
sequence length 386
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ozmA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ozmA01
3HPFA 1KCZA 4E6MA 3T4WA 2QJJA 4G8TA 3ZVHA 2OKTA 5BOFA 4GFIA 2P8BA 5BOEA 2AL2B 2PTZA 1FHUA 3S47A 2PCEA 3I6EA 4FI4A 4JN7A 1W6TA 1SJAA 3DFHA 3ZVIA 3ES8A 1EC7A 1MRAA 4IP4A 1E9IA 3MWCA 4DHGA 5FJRA 3GD6A 1R6WA 3H7VA 1TE6A 3VCNA 3PFRA 2ONEA 3TWAA 3PWIA 1WUFA 3DDMA 4KEMA 4X2PA 3UCDA 4A35A 4HNLA 3MKCA 2QJMA 2GGIA 3JVAA 3R0KA 3D47A 2ZC8A 4IL0A 3DG6A 3DFYA 1JCTA 3VC6A 3N6HA 3FV9A 4IL2A 3GY1A 3TOYA 3UGVA 2HZGA 4GMEA 4FP1A 3CT2A 4GISA 1XS2A 4DYEA 3GO2A 3VA8A 3QLDA 1JPMA 3DESA 2PA6A 3B97A 1TKKA 3ZLHA 1R0MA 3EKGA 3RR1A 4GYPC 4HNCA 1ELSA 4G7FA 1EC9A 3CAWA 3SSZA 4K2SA 4GYPA 1PDZA 3N4EA 2XH4A 4KWSA 1P43A 2PU0A 4ENLA 1SJBA 3OZYA 3ZLGA 2AKZA 1YEYA 5J04A 1KD0A 2PMQA 3DG3A 3CYJA 3TWBA 4GIRA 2HNEA 1P48A 2XH7A 2GL5A 2GSHA 4IT1A 2QVHA 3D46A 3MQTA 3CB3A 4GGHA 3TQPA 2PGEA 1EC8A 1NU5A 3IJLA 2P3ZA 3SBFA 2P0IA 3QPEA 1ONEA 4ZA0A 4EWJA 3EEZA 4A6GA 3ZVHB 5FJTA 1OEPA 3STPA 2XH0A 1KKOA 3SN1A 4ROPA 3UXLA 3FJ4A 4H19A 3FXGA 1MUCA 4IZGA 3TCSA 2HXUA 2GGHA 2HXTA 1JDFA 3V4BA 2I5QA 4YWSA 5ENLA 4JN8A 2MUCA 4KT2A 1ECQA 3DIPA 3FCPA 4HCHA 3MUCA 2PP1A 3RO6A 6ENLA 3IK4A 3BJSA 4H1ZA 3UJEA 3V5CA 3V3WA 3PWGA 1SJDA 4M0XA 3IJQA 2OG9A 3TW9A 2GGGA 3P0WA 3H8AA 3TJIA 3SN4A 2POZA 3ES7A 2OPJA 2PTWA 2PGWA 3VCCA 4HCDA 4F4RA 3DG7A 1MDRA 3MZNA 3RITA 4A3RA 1FHVA 3R1ZA 2DW7A 3KUMA 4E5TA 1BQGA 2PP3A 2QGYA 3DEQA 2OQHA 3IJIA 4IP5A 5FJPA 3JW7A 3PK7A 3OPSA 3RGTA 2QJNA 3OTRA 3OW1A 2RDXA 2OZTA 3UJRA 3I6TA 2OVLA 4DX3A 4MMWA 5IDZA 3R10A 4HN8A 2PPGA 1EBHA 1NELA 2AKMA 3NFUA 1EBGA 4Z1YA 3DERA 3JZUA 3T9PA 2OO6A 3FVDA 2P8CA 2QDEA 3MY9A 3S5SA 2ZADA 3NXLA 3SN0A 3VDGA 3BSMA 3UJ2A 2QQ6A 2MNRA 4IHCA 3P3BA 1KKRA 3H12A 2O56A 2PODA 3UJFA 1XPYA 3TTEA 2GDQA 1L8PA 3OZMA 3U9IA 3FYYA 4K1WA 2PU1A 1WUEA 4DN1A 1TZZA 2AL2A 4M6UA 2PSNA 3CK5A 4HCLA 1PDYA 2GGEA 4J1OA 3CXOA 4KPLA 3V5FA 2PP0A 1BKHA 2CHRA 1MDLA 3K1GA 2OQYA 3QKEA 5FJUA 3SQSA 3R11A 4DWDA 3UJSA 4J3ZA 2P88A 3NZGA 3Q45A 2FKPA 2DW6A 1RVKA 3H70A 3RRAA 3UXKA 4MKSA 3U4FA 3THUA 2FYMA 4MGGA 1DTNA 3N6JA 3OP2A 3BOXA 4H83A 3T6CA 2XSXA 3UCCA 4Z17A 4E4FA 2OZ3A 2XH2A 2GGJA 3N4FA 1SJCA 5FJOA 2NQLA 5EU9A 3SJNA 2OLAA 4JHMA 2QDDA 3T8QA 3R25A 3I4KA 3DGBA 3RCYA 3MSYA 1MNSA 4HYRA 4DXKA 3P93A 3Q4DA 3NO1A 2PS2A 1JPDX 1F9CA 3QN3A 4K8GA 2OZ8A 4HPNA 2OX4A 1IYXA 2OFJA 4H2HA 7ENLA 2PTYA 3R0UA 3VFCA 3ENLA 3ZLFA 3TJ4A 2PTXA 3QTPA 2XGZA 4E4UA 2AL1A 4E8GA 4ZCWA 3VC5A 3GC2A 4GGBA
chains in the Genus database with same CATH superfamily
4MWAA 5DX7A 3GYCA 1H0IA 1H7PA 2PDBA 3G2GA 3L8KA 2EJ1A 5TD4A 4ZOHB 3PUOA 3USZA 1GOMA 3HJZA 4NUWA 3HBLA 3NO3A 4RW3A 4GRTA 3EWXA 4PTMA 3ICJA 2QPXA 4RXGA 3WF3A 2QXWA 3GNDA 4ERGA 3MP5A 5JBEA 4ATDA 2X30A 3VMNA 3NPXA 1R6WA 4OBSA 1H61A 2DSZA 4E4PA 1UA3A 1UIOA 1GZJA 1XLAA 1AFSA 1WUFA 2QNEA 4RZ5A 4JTIA 2VEGA 2HDJA 3WLPA 1LROA 4INFA 5FEZA 3L66A 1LTDA 3R89A 1JRCA 2ZICA 2DZWA 1J6OA 2ANUA 3D47A 2ZC8A 1F05A 1XSKA 4AHOA 2Z1VA 3HG4A 3OU8A 2CBVA 1E9LA 3U48A 3GY1A 3NVZB 1N62C 4DJFD 5CC5A 5FD0A 1NFBA 2PRLA 3NPUA 4DWSD 1OFQA 1Q6DA 5CPMA 3NVVB 3LM3A 1EHNA 4O0QA 1UZDA 3NDOA 3SGUA 4IGNA 5FEPA 1K8YA 5CZJA 3L12A 3QQWA 2WJFA 4MJMA 4F3HA 2P76A 3C52A 1BYAA 4PCNA 2WPGA 3UR5A 3DHDA 2VFHA 2NQ5A 1HX0A 3M9YA 2AKZA 2BXZA 3TROA 1XDLA 3ITCA 3W29A 4IXHA 4FLSA 5IFPA 4IPJA 1UKOA 2E9BA 4IT1A 4LS2A 1TQXA 1UWRA 3URAA 3MQTA 4IJCA 3UD6A 2QZRA 4RUBA 4PC8A 4AISA 4AZ5A 1LT7A 3IJLA 3MANA 1B9BA 3LHUA 2B7NA 2XSAA 1XRSA 4PMXA 4HPGA 2J6XA 3B0XA 3F4NA 5BW6A 4A8RA 4AY7A 3QHNA 1FFQA 2BOFX 1BF2A 1O5QA 1E9ZB 4PTWA 4E2DA 1QPOA 4EQRA 3OBEA 3SN1A 4BHYA 2CU0A 1E6PA 1UKTA 3M7WA 4FHAA 3VFLA 3IIVA 3URQA 3M64A 2ZE3A 3BOLA 2OODA 4M19A 1IV8A 4KT2A 4GIYA 3VKDA 4MB1A 2EPKX 4XQ6A 3A3HA 1C8XA 5F7UA 2DT2A 3AMZA 1LF1A 1KXTA 4PMJA 4J28A 3BJSA 5LIWX 3O06A 5GRTA 1MRQA 2C19A 5H8UA 3DJJA 3WELA 4JTLA 1P0EA 1I2PA 1TZ9A 4HNVA 4M29A 4LF1A 2I17A 1IGWA 3ZSTA 3L23A 3IJ9A 1IR1A 1YPFA 4CNNA 1P0KA 4UR8A 4IJRA 3G18A 4CCEA 1E55A 2DDXA 1R2TA 4FK9A 1JPKA 3CGEA 1PKYA 4PZVA 4M52A 3AAMA 2GWGA 4Q8UA 4GUJA 3BLOA 3VDHA 3UZXA 3SCRA 1XANA 1BQGA 3U2EA 3BLDA 3PAOA 5FJPA 1FDZA 2R6OA 4YN5A 4JOMA 4FLRA 3PC0A 1XL9A 4ZGYA 4IIDA 2X40A 3UJRA 4G5DA 2ZZCA 2F7FA 2VL4A 4XAZA 3UP8A 3L4ZA 1SZRA 4UWMA 2DPEA 3ECQA 2OO6A 3I7QA 3KTXA 4JTJA 4ATWA 1OT1A 2Y5SA 2XVLA 5BU6A 3EDFA 3EXSA 4PMZA 4W84A 3UPWA 3SN0A 1UCWA 4JTFA 3OZOA 2H8ZA 3SW6A 5K2ZA 1JRBA 4W85A 4ILSA 5C9XA 4AIEA 1TPVA 1XISA 2DH2A 1E1CB 2X16A 3UJFA 5HINA 5D03A 4MZYA 1YNYA 3DCPA 4NYUA 1NTHA 5A69A 2AL2A 2VQUA 1UG6A 1ZAHA 4PUEA 1WDPA 5JU6A 3DC8A 3L5AA 3VYLA 1GESA 3VKBA 2FMOA 1CI1A 1OCBA 5FA5A 3NL2A 2WLYA 4PUNA 3UY8A 3TSDA 2WVUA 2RKXA 5CZKA 1FKWA 3O16A 3K1GA 2ACSA 3QKEA 1XC4A 4XIAA 5F4XA 1PKMA 3QFWA 2D2JA 1E73M 1JQVA 1MXDA 3PSWA 1RJQA 4AC1X 2A3BA 5CC6A 4NJJA 4XZIA 2GQ9A 2YKKA 4TO8A 3W9ZA 4YU1A 1U30A 3APYA 5IXEA 1Q66A 4W87A 3CMFA 3LPFA 2E5CA 4HA1A 2QF8A 4WUIA 5A6MA 4ZQNA 4Q8TA 1AH3A 4S3EA 4U31A 5PTDA 4IGSA 4YHGA 3HTWA 3N6JA 4PMQA 2CYGA 1RM6B 2PD9A 3OP2A 2FPYA 1YQZA 3ANYA 5JCMA 3P2VA 2J7FA 4LJ3A 4FR1A 1JYWA 1XDIA 1R3RA 3KOYA 2DZBA 3E38A 1JRPA 4AZCB 2Q02A 3V16A 2W62A 3B4YA 1GTHA 1W3LA 4D1JA 2R9RA 2YAUA 3TQVA 1GORA 3EB3A 4HNNA 4RDYA 3VGEA 4S3CA 3R07C 1ITCA 3NGJA 3MT1A 1GREA 2QDHA 3D3FA 4PMRA 3A9IA 4JTCA 3SJ3A 1JDCA 3W73A 1L6WA 4DWSA 4HGXA 1M7JA 4GX8A 5KVIA 1O68A 2ISVA 2CESA 2WMIB 4LALA 4QBXA 3T4WA 3WLOA 2YA1A 4GVFA 5E6YA 3A3WA 4KCVA 2EAWA 5BOEA 1B9ZA 2PDCA 4KMQA 4W9TA 1XBVA 3C2YA 4LU0A 8XIAA 2IS7A 1LLOA 4D8LA 4WDTA 4MVAA 4AWSA 5DMLA 3ZVIA 1GVEA 1GEQA 5K9XA 5FF4A 1GJWA 4NAFB 3LQGA 1VPQA 5F2GA 3MHGA 3PFRA 2Y7EA 1SW7A 2FPVA 2HMCA 2ZVRA 4Y7EA 5H2ZA 3PNUA 2NX1A 2OMAA 2XWDA 2FGLA 4JL1A 3QR3A 3H24A 3ITGA 1OX4A 5C9RA 4HNLA 1OFPA 3PF3A 1W54A 2E3TA 2J74A 4LV4A 2E6AA 3CPRA 4GIEA 3B4UA 3QY7A 5BXSA 4IGMA 1DE5A 2G5WA 1TMLA 3H53A 3FV9A 5CSRA 3W07A 2ZX6A 1J93A 3OLIA 3CT2A 1DHKA 2J7DA 4AH7A 1GW1A 1RV8A 1QHOA 4UQCA 5HJXA 3DESA 4HQVA 2HROA 5CGMA 3B9JB 3CHCA 1SPQA 4JNZA 4LUSA 1HGYA 1TA3B 5I3DA 1KXHA 2X0SA 1JD9A 4MKNA 4GYPC 1N2VA 3T55A 3GDRA 3LOTA 4XD6A 3IACA 4CN6A 4DJED 2NWRA 4H4WA 4RK8A 1OC6A 1B54A 1PDZA 1ONRA 3TTSA 1BGAA 2EG8A 4Z1BA 2VTFA 4XZHA 4L56A 4MYXA 4U28A 4GKTA 5AYIA 4HZ7A 4LAMA 2WOWA 4Y2WA 3M43A 2WPBA 3W1NA 3PZIA 2JBMA 2GUYA 1FP8A 3RU6A 3WJXA 2BASA 3E0WA 2A6LA 3GB6A 1PHQA 3MMDA 1QOQA 1KM4A 3QHMA 4JQ3A 3T0AA 3FDKA 1WYGA 2RAGA 3KOFA 5F2LA 2WBGA 1YE4A 4IM4A 4QEHA 2VI0A 1EJSC 5CAKA 1JCMP 3WL0A 2O92A 3HURA 2W67A 2QCCA 1H09A 1O5RA 3K30A 1W9XA 5ENLA 5G5GB 1GOXA 2MUCA 4LBSA 3MP4A 1D8WA 4GBDA 3VM7A 3C86A 3E5PA 2BSLA 3EXTA 1G5AA 1S5NA 1VCGA 3GVQA 1XLHA 2NUYA 3VM5A 4C90A 1H1NA 2CHOA 5G2IA 3M0JA 3VIMA 2D22A 1UKPA 1MVYA 2WQPA 2OPJA 2PTWA 4F4RA 1OG0A 2BG5A 2RH9A 1BGGA 4JBRA 2OT1A 5E09A 4A3RA 3A21A 3EDDA 1O94A 2EBNA 4PN2A 3QTGA 4RKAA 3N19B 2AAQA 1XSJA 2QGYA 1KGXA 2HPIA 3AOFA 2CZEA 1LLWA 1HXJA 3M0MA 2H9AA 2A3EA 5DQPA 3ABRA 1ZMDA 3WKZA 3W7HA 1Q63A 4WZHA 3OODA 2GR2A 4RE0A 3G8RA 5IDZA 2DZVA 5FJIA 1C29A 3UWZA 1JCLA 2E8YA 3TLLA 2PDJA 1NELA 3LY0A 2WHMA 3AS1A 2HTMA 1DJIA 4WCJA 1MZHA 4GUGA 2FTWA 4KEVA 3WG6A 3LQLA 3WF0A 2YIHA 1CLKA 3L9CA 2ZA1A 3FN9A 3L67A 1FFVC 1M41A 4MY1A 1T41A 4IHCA 1TV7A 1CXKA 4YLWA 3W6LA 2B7OA 3TTEA 3W7KA 3R8HA 3WLSA 2J9XA 3OZMA 3MO7A 4Z0SA 3CIXA 3AS0A 2AQOA 1EDGA 1SVDA 4LY4A 4H7CA 3CK5A 2WJDA 4AWUA 4J56A 3TFXA 5CGTA 4Z2IA 1K3UA 3SM0A 1X6LA 2R14A 1WXJA 3NURA 2YVFA 2Y88A 1PZ3A 3FJ6A 1SFSA 3B0YA 1IEWA 1D7FA 4FF5A 1TMHA 1Q65A 2WHLA 2Y5JA 3V0SA 2XDFA 2ATSA 3HFYA 2PDMA 1VFFA 1F8WA 4PFHA 3IAPA 3H70A 2W92A 4DRSA 3KHJA 2PC8A 6XIAA 4KCTA 1W9BM 3TYUA 1HKKA 4XZWA 4C6BA 2HPMA 4RV3A 2XVNA 4F2TA 4HOZA 3Q37A 1Q5MA 3VDBA 1LT8A 2Y89A 3W23A 1VEMA 2WLZA 1E6NA 4Y9AA 1HL8A 4RNJA 2OGYA 2WZEA 1XXXA 4JD4A 2XIIA 3WBYA 3APTA 2E7FA 1ZQ5A 5LGXA 4WLCA 1KM1A 3RFAA 2E1DA 4D6IA 2CZFA 5AC5A 2WCSA 3FJNA 2VFEA 1W56A 3RCYA 3FAWA 3WQWA 3UBPC 3A4XA 4GA8A 2WAGA 3VCRA 4PB3A 4L9XA 1DORA 4XSMA 2BODX 1DQWA 2AMGA 3NO1A 3CBWA 5DXYA 2YVJA 2E4TA 5M2FX 4DO6A 3VUSA 3U3HA 5C2CA 1OFDA 1KQYA 5JCLA 2ZXDA 2JKPA 1U5JA 5EMMA 3RNDA 3H7UA 4TMBA 5I3JA 3EZ4A 1W17A 2WC4A 5BU9A 3POHA 2BP1A 3OOQA 4DUVA 2O55A 2Y7DA 5FOOA 2EG6A 1GYMA 3HGOA 4DF2A 3HPFA 3D9XA 5G5HB 5LKYA 3WLHA 3S1VA 1TV5A 1ZENA 4G8TA 4PL2A 3W87A 4WF7A 4OWGA 2PTZA 4QS6A 2DSUA 1VRDA 1ZS2A 2IQ0A 1GRTA 1MMFA 1ICSA 4DJEA 3ERPA 4QDPA 4H2CA 2WMGA 1R9YA 5C5YA 4YVPA 3TXZA 1DQUA 3HJEA 4JIEA 3EDEA 1ZB5A 2J4GA 1QPRA 4YIWA 4DHGA 3GFZA 1Q6LA 4J9JA 2WMHA 1FXPA 2HS8A 4QG9A 4JY9A 4PUUA 1NQKA 3CO8A 2AAMA 2YL9A 4GZ7A 1TRDA 3M6DA 4PUWA 4UNLA 4TVYA 4E2BA 1J5TA 1KXVA 3WJYA 5LXEA 1F3EA 3JVAA 3DFYA 2GLKA 3MW7A 3LRLA 5FESA 3Q2DA 3WEMA 7REQB 1X38A 3EOOA 4XISA 1X6UA 4O8RA 3UNTA 2RUSA 5HK4A 3TOYA 3UGVA 2GWNA 1HW6A 3DAQA 5IOBA 1HZYA 3HW2A 3GHTA 1UZ4A 1W91A 2VDGA 3AUOA 3ZLHA 2HEJA 1GK8A 3B8WA 1PSCA 2Z29A 4W93A 4EX4A 3OHIA 2Y1HA 2QCLA 4U3CA 3TLQA 4GKLA 1K6AA 3F1QA 1V3MA 4JIRA 3GM8A 1XGDA 3MZ2A 1R3WA 4IMFA 5K7JA 5DT7A 1B30A 4DJFC 3NQ7A 4HA0A 4B90A 5HMFA 4DWSC 2VHLA 4H8HA 1TELA 5EPDA 1XLEA 1NDVA 4UTTA 2PZNA 1UA7A 1A4LA 2XH7A 3HMCA 4ICNA 2QVHA 3BW2A 3D46A 1F3XA 4GQRA 1XFBA 4H8VA 4RW5A 4OJYA 4O8AA 4U2ZA 4EMJA 2GR0A 4PFMA 4TTGA 4XIMA 2DZXA 1O66A 1C8VA 3OA5A 2XSBA 2C0HA 3NG3A 2QUTA 3ITXA 4JN6A 3VX0A 4ZE5A 4P2VA 1MUCA 3M47A 2PURA 4U4MA 3BGJA 3V4BA 2XN1A 3GUWA 5CPQA 1ECQA 1ZBCA 3HIJA 3SB0A 1JZ5A 1L9WA 2ZFAA 3WQEA 5FCZA 1J01A 2Y6ZA 1ME9A 4X60A 3GNNA 3WF1A 4IQJA 5IFTA 3AFBA 4IIGA 3FK4A 2PLMA 1WZAA 4FS9A 4JDYA 2ZBTA 3QSRA 1G4PA 2E3ZA 3I4EA 1DIDA 2VC7A 1EJTC 2P53A 5A2CA 3H8AA 5F1VA 1HKJA 3N3TA 2FB2A 1VIWA 3GX9A 4JHOA 3NQGA 4C6OA 1XUZA 3A6OA 3MCMA 1CGYA 1MO0A 3L0KA 2X09A 2X1RA 4L6DA 4LVDA 1YNPA 4Q8VA 1K9EA 4G1KA 3UCQA 1A5MC 5H8PA 1BYBA 3ZXWA 4H4SA 4S3AA 3WLMA 1LQAA 4AAJA 1D3CA 3SZ8A 2WM0A 4QAWA 4HN8A 1RAKA 4UXDA 3SGZA 3NFUA 1UC5A 3S2JA 4S3JA 1GKPA 1ZSXA 1W32A 3QQ1A 2WSYA 4H3DA 4CVUA 4H9XA 1W1TA 3PM6A 1J79A 1Y5VA 4Q4OA 2WKJA 3ALFA 1PTDA 2WOIA 4HSOA 2EEXA 1B3YA 1X96A 3KL0A 3O1NA 3V18A 4JTKA 2PZ0A 2YX0A 3B0UX 3G1SA 4QGCA 2A3AA 3W70A 5I7GA 2IPGA 3O05A 3U7VA 2OOFA 4MADA 3TN4A 4FX6M 5IM51 4MHBA 4IPPA 1VBJA 3MS8A 5DMMA 4ZQOA 3QYSA 4S23A 3QFEA 4DWDA 2W5FA 1MEHA 4XUYA 1JZ6A 3L5LA 1Q6GA 4QE1A 2GOUA 3NZGA 4QTGA 5DBTA 4ML4A 1NF7A 3RCNA 2EKCA 2FKPA 3CZ8A 4OVXA 5FS9A 4Y8FA 2ZXQA 3G3MA 3RRAA 4W8LA 5I79A 3BLPX 3QY8A 2FYMA 2D3NA 3S2NA 1EIBA 1XLDA 3BG5A 3MYOA 4QR6A 3GQYA 4CQ9A 1DTNA 1KRBC 2QJIA 2G95A 3UCCA 3OZPA 3MTWA 4Z17A 2ACQA 1YTKA 1YIXA 5J5RA 2GGJA 7XIMA 3GHSA 1V59A 4E3VA 3SJNA 1A3HA 1HFBA 3THQA 3VZZA 5A6AA 3N25A 3UW6A 3I7SA 3S3GA 3S9ZA 3WDRA 4GWEA 4CQ8A 1A47A 3ZM8A 4EKJA 3T2PA 1GEHA 4KCWA 4K7YA 1H2JA 4CEUC 2PRMA 5FS6A 4REQB 1TV3A 3SY8A 3ZJ7A 3T08A 1Q13A 4L7ZA 4CLMA 4NXSA 4AHPA 2RJHA 4I9TA 3K13A 3H2CA 5TIMA 2XPKA 3GU2A 3CGDA 2DVXA 1L6SA 4I9MA 3MBDA 3LXDA 1FTXA 2PLJA 3DZ1A 2HBXA 3P14A 2HWGA 1VQZA 3SEPA 3I7RA 1VKFA 3F5JA 4MSSA 1AW1A 4ZCWA 4AC7C 4H9VA 3G1VA 4DYKA 4NIRA 4ZMGA 5HPCA 3K1DA 1VCFA 1V0MA 1JOAA 3OBKA 3IUIA 3J7HA 4ES4A 4YTTA 1V3IA 3URBA 3AXHA 1EJVC 8XIMA 3S1WA 4NI3A 3OVRA 3PTQA 3N2CA 4LCRA 3PY2A 4FNPA 4K39A 3VGFA 3AO0A 1PPIA 3WLLA 4EQXA 2A1YA 1XJBA 2E6YA 3ARXA 4IP7A 4TXEA 3K4DA 4K8EA 4PMVA 3L2LA 2W54A 3ZWTA 2CLHA 4UTIA 5FACA 3ARVA 1LCOA 1OGBA 2PDNA 3AYVA 5T8GA 4C60A 1X7IA 3EMZA 2L5HA 3NPVA 1BSLA 1FH8A 2Z6IA 3QY6A 5E0FA 2XIMA 3NGFA 4FB7A 6REQA 4DYJA 4E2OA 4MNJA 1KLZA 5U25A 1US3A 3K5XA 1P7TA 3BE7A 1K77A 3R8GA 3RRXA 5LSMA 4ICMA 2PDIA 3VIKA 3GG0A 4ZOAA 4AZGA 1XS2A 3NL3A 1QXLA 3SCSA 5BMXA 4LNCA 1KBBA 1KQZA 2BVWA 6PTDA 1TKKA 3BV7A 5AKQA 2VELA 3N9KA 2C6QA 4OBTA 3ZJ6A 4GK8A 2FFIA 4NKCA 5AB3A 1U5VA 1ZZMA 1UASA 2O9OA 3H2NA 3SADA 2GH5A 3T40A 3H22A 4G56A 2ZZ5A 4GQQA 5J5DA 4ZOCA 1ZK7A 1DE6A 1WB0A 3QM3A 4TVDA 1Y7VA 2J79A 3QC3A 3W2UA 2E25A 2VURA 2E8ZA 3N34A 3C4UA 1P0BA 3IRSA 4CQCA 5CQ1A 1HUVA 1Q2SA 3PBWA 3TQPA 2JIWA 1WZLA 5K3VA 4MKVA 5G4WA 5HOSA 1W8GA 4DJEC 2P0IA 3PZOA 3NDZA 2X8GA 2EHHA 4HBKA 4WQ6A 5BRQA 4ROPA 3PZNA 2YYTA 1L6GA 4BJHA 4L80A 1TPB1 4IZGA 1ITUA 1JDFA 1QMLA 1T96A 2CLFA 3NQVA 4C6PA 1SZGA 5EMJA 1OCQA 1FDYA 3GVVA 2A4AA 3C3UA 1YX1A 4J5NA 3DHFA 4H4TA 4EIVA 1VAHA 4WRHA 3WH9A 2RHGA 3UERA 3BJTA 4M6PA 3QEZA 4JR5A 2ASHA 2FJUB 1PZ1A 2QCMA 1H2IA 5JIPA 4WSJA 1IXNA 4WHBA 1H5YA 2V3BA 1O1ZA 4L1GA 3PZQA 3S83A 1Q6RA 3FS2A 5LA0A 1FWCC 4HPJA 1F8IA 1NOWA 3E0IA 1XQLA 1Z48A 1FWJC 1XPGA 4WKHA 4US5A 1XSIA 4ZQCA 3B06A 3VCCA 4JHZA 2CITA 2C3DA 1OCNA 1IWAA 2HBVA 1ZY8A 2WB5A 3DI1A 3NVDA 2BC1A 1BQCA 5EY5A 3ONCA 4TQTA 1F4HA 1NPXA 2Q3OA 1VFSA 4F0HA 3W7QA 3BAIA 2C91A 3LM7A 2OCZA 3KOXA 4IP5A 3G0SA 3TJLA 2D23A 1E5JA 2QJNA 2J24A 1JUEA 3LERA 1LOQA 4DLMA 1ME8A 2ODOA 4DX3A 2C71A 3LG3A 4XSLA 5L6UA 3JS3A 1I2RA 4XVEA 1O60A 3AMLA 3W83A 3N73A 2VEFA 5REQA 3O6CA 5AOUA 3DBPA 3ARSA 4R5EA 3N14A 4GZIA 3L7RA 4AHQA 4LUTB 3W7OA 3LNPA 1UP2A 2W6RA 1IT7A 1KKRA 4GG9A 2YGYA 4QEEA 2YZRA 3LMYA 1E6ZA 4S3GA 3UR8A 3MMTA 1RUSA 5DCEA 2PDKA 2PU1A 2E6FA 1DXIA 2CBIA 3VINA 1HKMA 3WD1A 4GXWA 2EPHA 1W3KA 4JKKA 5FS8A 4JXCA 2BWGA 2PBGA 5AVHA 4J4KA 3CQJA 3WSUA 2CHRA 1OZMA 4LEQA 4ROQA 2QHAA 4D9PA 1OGGA 1N61C 5A8OA 1XIMA 2ZZ0A 3SQLA 5G4EA 3CM4A 4XD5A 1GQNA 2C14A 3GD3A 4IMEA 4J3ZA 3TN6A 2CEQA 4KWVA 1F73A 3CT7A 1OZQA 3FEMA 2GDVA 4PYSA 2W3SA 2GQ3A 4D6DA 1S7MA 4TU1A 5AC8A 3T0CA 3G1RA 4V33A 3TYZA 1TTJA 1OBAA 2G97A 2VUNA 2DQWA 1GYLA 1VPXA 3IARA 4L6OA 3MU7A 2INZA 2QV4A 4XKYA 5JQ9A 4I7UA 3R13A 1GOQA 2WWDA 9XIAA 1JIBA 5FJOA 3LLXA 1EOKA 3HGRA 2Y8VA 5I2UA 3MKVA 4QM1A 4CU8A 3EBVA 1VFUA 4JS3A 4OUIA 2VX7A 2Z26A 1MNSA 2FMNA 1FA2A 2CPUA 4AMAA 2ICSA 4GZEA 1XCWA 2PS2A 3KHDA 5LIUX 2OT0A 1PTGA 2CLKA 3QN3A 1PYMA 4JX4A 4TTUA 4EMIA 1F07A 3PUGA 1W8SA 5E9AA 3QR1A 3GBDA 1M9HA 2ZRVA 1L8NA 4QDWA 1XKYA 4GY1A 1LRQA 1QWGA 2YCLB 1IEQA 2Q8LA 1DWJM 3HO8A 4WD0A 5K4ZA 3QH2A 3LADA 1H49A 1KB3A 3YPIA 3E49A 2VVSA 5TBOA 1N8FA 2G8ZA 4LB4A 1Q7ZA 4K6AA 2ALDA 4A22A 4DM2A 3BV4A 3CH9A 2WBKA 2QJJA 1EYWA 2J7BA 2XIJA 2PDXA 4NZCA 3S47A 2V3FA 4LWWA 2BOGX 3UU0A 1JR1A 4FNSA 3DK8A 1YYAA 2X1TA 2EQDA 3RLGA 4IP4A 3KZPA 1E9IA 4AZBA 5FJRA 1XIDA 5SWUA 1HKWA 3S5OA 2Q6ZA 3SUUA 2D0GA 1B3OA 3WQ4A 3NIYA 4FEZA 3EX6A 2NQ9A 5A6JA 1YXDA 2CLMA 3F4VA 3BXWA 1XIGA 5E0CA 5I78A 2V5KA 3KS6A 4B91A 4FNTA 4GBUA 1NFGA 2IKHA 4S3KA 1UWTA 1IGSA 3KBNA 3R0DA 1EEXA 2DIEA 5DXXA 1W1ZA 1Q45A 1FWFC 2BHZA 2PWHA 1S2VA 1JDAA 5EYWA 1P7TB 4TX6A 1BVWA 3LYEA 1C92A 1XIBA 3OIXA 3W81A 4LOCA 2P0OA 4JYEA 2PUZA 3T8LA 1US2A 2O9PA 1UD4A 3WMCA 5BRPA 1VP5A 1KA9F 3TYCA 2FHFA 3GD4A 2IPWA 1PJ9A 2GUBA 4QISA 3T2OA 2OB3A 2V5DA 2JQXA 3IV3A 1H51A 3W7DA 2YDQA 3CZJA 4KWSA 1P43A 4GFSA 3CQIA 2XIOA 3S4TA 1TG7A 3HQPA 3EAOA 3BC9A 1YRRA 1ZXIC 3CYJA 3CQHA 4FLOA 3GIPA 4AD0A 2FTPA 2WWCA 1L2QA 3GH5A 1G9HA 4PODA 4BA0A 4LVFA 4DUWA 2VR2A 5AYYA 2AGKA 2EJAA 3P67A 4PMYA 1EYEA 5BZAA 1EQCA 4XKMA 3PPCA 3PBYA 1QBBA 3L68A 3QPEA 3GDMA 3WH7A 4I8DA 1IXOA 2Y4SA 3ZVHB 1QI2A 4A8NA 4PTXA 1XR2A 1L6YA 4IFRA 4JTSA 1HVXA 5T91A 4F48A 1V0KA 1Z42A 1I4NA 4KGJA 1ZJIA 1U1UA 1S1RA 4F0KA 1UBPC 5HATA 4IF2A 1WDDA 1OC7A 3E96A 4WY0B 4FALA 4IMAA 2E09A 1W9PA 3VNLA 1BZLA 4XWUA 3MUCA 3OGSA 3P84A 3M0XA 2ZX7A 1ITQA 3NDYA 4HK7A 1XH2A 1PE1A 2GQAA 2J8FA 1JGIA 2VO5A 4XTDA 2GOKA 1I45A 3WLRA 1MW1A 5AHFA 1UH2A 4GUFA 5D05A 3V3WA 1RCXB 4EXQA 2ZKMX 1ICPA 3TW9A 2DV0A 1VD6A 1RZMA 2HRWA 1JDDA 2REQB 1DIKA 1GWJA 2XU2A 4LYKA 1EFZA 4V1XA 1XIEA 5A6BA 1XBZA 3BQ6A 5GJMA 1J0ZA 3OLGA 4TX8A 5EGRA 4KCUA 3SRFA 5ECVA 1EPVA 2WP5A 4B5SA 3T0TA 4IQDA 3PS7A 3BW3A 1VDVA 3PK7A 3LBOA 5D2YA 1PS9A 1PKNA 3KTCA 3FLUA 4K3ZA 3W53A 3WZ0E 3CGBA 1FVPA 1VJSA 1K8CA 3FGCA 3HRDC 2Y8KA 5KEZA 2VEPA 2ZOXA 1NFPA 4I5XA 2Q71A 3UG5A 4NJIA 3UVAA 1DXEA 3NQ2A 5G2HA 4F9JA 2DJXA 4ZVJA 2QQ6A 4Z42C 4G6CA 1KXQA 4Z08A 3SCNA 1EA9C 3E3HA 2UWFA 1I75A 2J9YA 3DXIA 3IVSA 1FWGC 5U7SA 1H11A 3AIEA 1WZKA 2QKFA 4M6UA 1Z8AA 2CBJA 4LW7A 1GKRA 4H4ZA 2NQJA 3GVGA 3W24A 3ATZA 2X1UA 1BKHA 1EIXA 4JFTA 1AQ0A 2AMXA 1DJWA 3SQSA 1E0XA 1HF6A 4LS1A 3LHYA 1CLVA 5DELA 4V27A 2I1OA 3H4WA 1W0MA 4U2YA 2ZWYA 3OO2A 1E6XM 1YXCA 3MUIA 4H00A 2DW6A 4WSKA 4LYPA 3UXKA 3SURA 2WSRA 1Z9AA 4F0LA 2J78A 3OHMB 4J35A 1RALA 2FIQA 1FWTA 1YBQA 3W88A 1O1HA 3GDLA 1OABA 1ZBVA 1W3HA 1QI5A 4UUIA 1SSDA 2OZ3A 3NQMA 4EF8A 4US6A 2FHCA 1CGVA 2B4GA 3DGRA 3T8QA 3DOPA 2G3FA 3M0YA 2WJEA 4PCSA 3NQFA 4GYFA 1H7NA 4WKAA 3GNRA 1RJRA 1T99A 1JPDX 3MDUA 2QCNA 5AYXA 1I2QA 3QPZA 3BLEA 4PMDA 4WR3A 4DAFA 3VFCA 1GZ1A 4M1RA 4C6IA 1D7KA 4DBUA 3AMCA 3ZJKA 3B9AA 2CKRA 3B9NA 5C9WA 3DKJA 2I57A 1A0CA 5A6SA 4KH2A 2IXUA 5C9UA 5HANA 2X50A 1KTBA 2D1ZA 4WGXA 5A3HA 1Y5XA 3C6CA 3GG7A 5A8QA 1K02A 1K1DA 5AC4A 3TYDA 1T40A 1KGUA 3HN3A 1C7SA 3DYMA 3O6YX 3ZFHA 5DBUA 3TTOA 1EDTA 3DC0A 1ZY9A 3AYRA 4NZ4A 1UROA 1TPH1 2WZIA 2FZNA 1TWWA 1XRVA 1W5QA 2F2HA 4GC3A 4C1KA 4Z1CA 3VCNA 1H62A 3WQCA 3GXIA 3SUSA 1FCUA 2C13A 4D71A 5I09A 1HL9A 2VMFA 4NJKA 4C6LA 3LK6A 3UCDA 3GXNA 1E4LA 4A35A 1LLZA 1CT5A 2NLIA 2D24A 2NUXA 1T0OA 4FNRA 2VX6A 1W9DM 5E93A 5KSWA 2POTA 4GZJA 3OGRA 4TVWA 2G4FA 2FDMA 1W9VA 3IGXA 1FX6A 2QUMA 1L6FA 1KRCC 3W1MA 4JTDA 1NWSA 4YMZA 1TPDA 2CERA 1XICA 1ZALA 4RJEA 4CQBA 4F2UA 3V36A 2BV9A 3B8VA 1HO1A 1EUNA 3NQ6A 2DZAA 1BD0A 1F61A 3UWEA 1V3LA 2A79A 2W9MA 4GYKA 2CIPA 5JCKA 1X39A 1QBAA 4J7RA 4TMCA 2PU0A 3WQ6A 3W25A 2QCDB 1R85A 3EXRA 4JICA 3RJXA 4HSNA 1VBHA 2X2YA 1DJQA 3VX1A 4GIRA 2NUWA 1BTMA 4EE9A 1JCYA 4EXAA 7A3HA 5ABGA 1QJWA 2XM2A 3M0VA 1CGXA 3NVYB 3OYXA 3BSGA 4FPSA 4TUFA 1XV8A 1EHAA 3NM1A 3WCZA 4O18A 3CO4A 1QK0A 1RBOB 1JZ3A 1K70A 4M80A 3STFA 4A6GA 4LVBA 1NVMA 2W0UA 4H9YA 2BDQA 4CNTA 4B2DD 2XH0A 3L5MA 5HNTA 1PIIA 2B81A 3WY1A 2YVGA 3PSVA 5LNSA 1V6YA 2EXOA 2CWXA 3WMSA 3C8NA 1Z41A 2I5QA 2EO7A 5DMNA 1WNOA 5AFDA 1GG1A 1DXLA 3GU9A 4Q6XA 3LHTA 4DELA 4F9DA 5D38A 3GXPA 3TNOA 1GVIA 4HU3A 4K8HA 1R7OA 1YMYA 2HK1A 3U5YA 4QJ1A 4GNKB 4IIBA 3TFCA 3AU6A 4LQ1A 3AU2A 3GAKA 1CDGA 2GSEA 5GNXA 3AZTA 3B0PA 3IRDA 3T1GA 3ALGA 4G9PA 1RQEA 4XZ9A 4AYGA 4L1XA 5ER0A 4ZB2A 1JG9A 4R7OA 1PCKA 3TJXA 4PE8A 1W5MA 2YA2A 1S38A 4YYFA 1D3HA 3BCFA 1XD0A 2G50A 4H4IA 3W37A 3VZXA 1WKFA 2F9RA 5I03A 2HVNA 2FLIA 2QMKA 4WIWA 3LTYA 5DCBA 4JFUA 4ERAA 3VD7A 1ISYA 2WHJA 5JRBA 1NARA 3EMCA 3KTSA 4A2RA 4JY8A 2XVPA 4WDWA 2OVLA 4MMWA 4R88A 4XZNX 1VH7A 5J8LA 1J0IA 5HULA 1WX0A 1EBHA 2EQ7A 3FDGA 4H6RA 2AKMA 4R53A 1UPMB 4DF1A 2BLEA 3FGCB 3ATYA 3CAVA 4DPQA 2X1IA 4AZIA 3OBAA 3VDGA 4AD1A 3UJ2A 1E56A 4O53A 2IKJA 4DBWA 4BQ5A 4EOUA 5JCNA 4H01A 1WKEA 4WKFA 3QFBA 4UMAA 1UP3A 2QGHA 5CSSA 1PKLA 1KN0A 1PEZA 2Z28A 2GJRA 2JFEX 3WUFA 4ZEPA 1JPHA 3WO8A 5KINA 3LBCA 4EM4A 4J1OA 4K68A 3ARZA 5AHIA 5F2IA 1KO0A 1Y65A 1VF8A 2HCVA 4R9OA 5CPLA 3R2GA 3E2QA 2OQYA 1DIEA 4XVDA 3N29A 3UXDA 2XYLA 4MB3A 3UPBA 4H4PA 3VTRA 4QNEA 1ZAJA 4DB7A 1GRAA 3DH9A 1HJWA 4OOZA 3IAQA 3PG8A 1FECA 3H26A 2F6UA 5CGQA 4TVUA 2ZX9A 2NT0A 5HQLA 4JFWA 1TB3A 5D9PA 5LNVA 3K8KA 4UZUA 1XLCA 3NM3A 4HIBA 5B80A 3LLFA 3FKRA 3R43A 3FKKA 1PX3A 5EU9A 4GXMA 3BO9A 1E3ZA 2GUUA 3N9SA 2WYSA 2ZWZA 3ZT7A 5I3IA 4PTDA 1DWIM 2UY4A 4MWAD 2V6OA 2H3BA 2EQ9A 1CYGA 3PBMA 4GI4A 4ML9A 4YCPA 3WYZA 1B3ZA 1EOMA 1PIFA 3SFWA 2Y2WA 4KKXA 2XZ9A 2EPNA 2WZHA 3A5VA 3KZSA 4NF7A 2Z25A 4GI6A 4X61A 4AF0B 4C91A 1KWGA 4HPHA 4U5IA 1A80A 4RZBA 5FF3A 1KFCA 4ACZA 2IPFA 1V4YA 3IV8A 1KFKA 1TTIA 3LEPA 5KTLA 1GETA 4K37A 4PTVA 2X7VA 5KZEA 1US0A 2CHNA 3NSMA 2PDWA 3RLUA 1WCGA 3NEVA 2WK2A 3QLLA 4EF9A 2RDTA 2Z1WA 4JNYA 4D6GA 4E0CA 1ZU8A 3QJAA 4AIOA 3FYOA 3BOFA 2J6VA 2P8BA 3LHZA 4IJBA 3FAXA 2Y24A 2VJXA 3PPGA 3GFXA 1HP4A 1E71M 1EC7A 1EF2A 2VZOA 3WLNA 5AC6A 1JROA 3MP3A 4MDPA 1XI3A 1DYSA 4CCDA 4CKQA 1UC4A 2WMJA 3N2OA 1UKSA 3UYCA 3AUJA 2J77A 4MLRA 1JL8A 3W76A 1FKXA 2OEMA 2ZTKA 3LLDA 4JTHA 3P61A 4OE7A 3R0KA 2ACUA 3WDPP 4Q8QA 3VC6A 4HOWA 4KF1A 3MB9A 3UG3A 1KFWA 3O63A 1JVNA 2NVCA 3TR2A 4RPQA 1M5WA 1TPFA 1KFJA 1V03A 3S46A 3GHUA 2GJLA 1RLCL 5LYRA 3B97A 2XGIA 4YTQA 3UY7A 4J27A 3EKGA 4LGXA 2RABA 1MW2A 4DO7A 1DJYA 4G7FA 1NWUA 5HUPA 4BCEA 3I3EA 3SSZA 3EWDA 2DIJA 3WJWA 3W2JA 2C7FA 3C2OA 2KZHA 2OELA 5BYWA 1F3WA 3UNDA 3N2BA 4IG2B 1T7LA 3TW7A 2FVKA 3WBEA 3RMEA 4NASA 4AXNA 4DM1A 5EBKA 1M6JA 2QCFA 3QXBA 1VS1A 1SW3A 3SCQA 3W85A 5TQLA 1E1CA 1UD3A 1EXPA 5D02A 4ZA0A 1ZMCA 4EANA 2BX7A 5C7VA 2C15A 2BS9A 2QMJA 3NVTA 2W63A 4MDOA 4ATLA 1WO2A 3PZGA 5H91A 4JKLA 5I77A 3DFTA 1SFJA 1WQ5A 3R58A 2OO0A 3GE7A 4BFAA 5FS7A 3EX3A 1XGEA 2BCPA 5D8ZA 1L2UA 3OLEA 1UQYA 1MEIA 2VDHA 1BWLA 4HCHA 1MUWA 1CXHA 4GQGA 3GTNA 5EFDA 1GQLA 5EBAA 2DU2A 4Q7NA 3CUZA 3IK4A 3GC5A 1ENUA 2VEKA 2EQ8A 3CIWA 1Q3NA 3WF2A 1ZJBA 2HJPA 2JF7A 1OD0A 2V82A 4O54A 4ZFMA 4J40A 4MAVA 3VNKA 2HK0A 2GK1B 1MXSA 1P0DA 3WQDA 2RJGA 1WBHA 1HT6A 3RLVA 3UEQA 1QU4A 2CZDA 1IWPA 1XHGA 3G6LA 2GR1A 2ZZBA 1MDRA 4O4WA 1R3YA 4GH3A 3APGA 3OQEA 5AN7A 1DKWA 3B8UA 3XISA 3UWQA 4Q4PA 4AZCA 5H8MA 3SR6B 2PGRA 3T09A 3R5EA 3FHQA 3OPSA 4WEVX 2ZE0A 4YTSA 1JJKA 1XLIA 2FTYA 2PF0A 5FI8A 2IPJA 1LP6A 4DXXA 1Q6EA 3NPWA 2D20A 4LEFA 2WJZA 1XIJA 3MCOA 1EX1A 1LJYA 2PWUA 1UQZA 1EGMA 2OYMA 3JZUA 4LUYA 4AYSA 4IPLA 3T9PA 1JUBA 3FVDA 1OT2A 3CEPA 3THCA 3WBAA 2YCIX 3BTNA 3FW6A 4D8AA 1WAUA 2YQUA 3EPMA 5CPNA 5I0DA 2ADAA 4X22A 5HMSA 2PB1A 3L4XA 4NXKA 3PBUA 3WQVA 4AD2A 3CV2A 4IMCA 1TJ0A 3II1A 4PEEA 1QNVA 3DX5A 3P3BA 2O7QA 2WMFA 3KCOA 4PBFA 2PODA 5K9DA 1XX1A 2WMIA 3AMGA 2YFNA 3V1HA 4OBRA 2VC6A 3R7MA 1P1MA 3WLJA 3W7MA 1IXPA 3T81A 2VFDA 2BXYA 4MPKA 3VIFA 1B3XA 3CQ0A 4NAFA 4GACA 3P7YA 3BPWA 1VJZA 1WP6A 3K8LA 3P62A 1MDLA 4FZIA 1NP0A 1PWLA 2C79A 4V15A 3B40A 3ANVA 3W7CA 1F7BA 3IUHA 1TR1A 4W5UA 1VIZA 3SRHA 4A4AA 4RZ4A 3B8TA 4YPJA 4QSHA 4CCZA 2VT0A 5E6ZA 1RVKA 2X8RA 3B8IA 3WD0A 2QPSA 1Q6CA 2XFRA 3QZEA 4AVNA 2XFYA 2PWVA 1W1A1 3W6MA 1NOUA 3BDKA 5LHEA 1AA1B 1F5ZA 3CWOX 2X7WA 3W2NA 2E1WA 4FNQA 3A3XA 3SSJA 1AMYA 2XSXA 4MAZA 1JCJA 2DZPA 3ARWA 1VBUA 2BTMA 1HVQA 4CU7A 1SJCA 3VILA 3BVJA 1CLXA 4XV0A 2ZTJA 5HQEA 1TA3A 5DEZA 2FZ8A 1NHPA 3N9RA 3CNYA 3WMBA 4UTWC 3P93A 2WVVB 3CHFA 1KM2A 2GQWA 3M0KA 2D73A 4IQLA 5FSDC 2IQTA 5GNYA 4HHLA 2ZXBA 2FDSA 3UG8A 3LPOA 3OG2A 2X0YA 1JXKA 4D6EA 3BZJA 3U2ZA 3P8IA 3FIGA 4H9ZA 4ACZB 1ONXA 4AEFA 1IEIA 1EJUC 3LB8A 1XYCA 2VOTA 3VIPA 5GPRA 3EWWA 2FZMA 3U8GA 2DSKA 3BZGA 3RPTA 1H5VA 4HNTA 4B92A 4O14A 3AN1A 3TUUA 3M4HA 2J7EA 1S5VA 4RDVA 5IBXA 3SR7A 3W6YA 4DAIA 4GI8A 2FH6A 1GJPA 3MUY1 1VRXA 3KBJA 4W7WA 1FP9A 2I7GA 1RY0A 4PUDA 3ZO9A 1MRAA 1JEZA 4YWIA 3GD6A 3DH7A 4IISA 5ABFA 4FR6A 1IT0A 1XWYA 5LNRA 1KTCA 4MB5A 4A2SA 4K36A 3VDAA 2X8HA 3UF9A 4PUMA 2FJKA 3EOSA 1QVBA 2I5GA 1I6NA 3KDOA 4I9AA 4ZODA 1XYZA 3KBWA 5JH1A 1P6BA 4BEUA 1E4MM 1XYFA 1FWRA 4AXKA 3P5ZA 1QO2A 1Q4WA 4HA3A 1MQPA 4IUGA 4P8WA 1TQJA 4HOXA 3CU2A 3M44A 2F84A 3S2MA 4RV8A 1JPIA 4YCOA 4UFHA 3OGVA 3G22A 1J4EA 1S2AA 4GPNA 5CXPA 3W1PA 5DY2A 3A22A 2PBOA 4RNFA 4UB9A 1QT1A 2Y7GA 4W7VA 5CBBA 2FGZA 2XFFA 4WX2A 2OWXA 1UWIA 4HP5A 1HJSA 3WJZA 1EA0A 4ZQMA 3IJ6A 3UWVA 5I23A 4YVXA 3S6TA 1Z7AA 3VE7A 1VGAA 1ZPTA 3LCFA 1VEOA 2SFPA 2GRTA 3WF4A 3IUDA 1TWZA 4ENLA 5I07A 1SJBA 4F0RA 3ZLGA 3BLIA 4HK5A 2WZMA 1CBGA 1YEYA 1KD0A 1QNPA 1OK6A 1CXLA 1JYXA 4O1EA 3ZR6A 2QR6A 3RM4A 3WENA 1SR9A 3SRKA 4HYWA 4JIHA 1NU5A 4GVGA 4KRZA 4O16A 2JE8A 4J57A 2CETA 4HU4A 1Q6OA 1TRIA 4WGHA 3TSBA 3EDJA 5AY7A 4GLEA 4GUIA 2CLOA 1AJ2A 2G3JA 3A4JA 1AH4A 3EPOA 1YKWA 2H3DA 4I5UA 4PBEA 5FMHA 1TJ2A 1V8EA 3VO0A 4DY1A 1V0LA 3SUVA 3UXLA 3TCSA 3TC3A 2C3CA 3C2RA 5JBFA 3ZR4A 4YWSA 8CGTA 1E6QM 1STZA 2A21A 3ZZ1A 4UQBA 2BFGA 3VIGA 4HU8A 1K4HA 1O5XA 3EEGA 3G24A 1SO5A 2WM1A 3U57A 4GHRA 1E0VA 3B04A 3BMWA 4HT3A 3W22A 1TYPA 4GNVA 1XGZA 1XW8A 2Y7FA 2JALA 3E2SA 2NXHA 1OYCA 4UFLA 4Y96A 1Q2RA 3JU2A 1TVLA 4C6MA 1HIZA 3GRIA 2VZVA 3A24A 3E6EA 4E8CA 3KS5A 3IJ8A 1XBXA 3K2GA 2J25A 2FH8A 4C6EA 1F6YA 3CPUA 1EDQA 4RDWA 1WA3A 1A5UA 4UNIA 1H0GA 1OSEA 3DEQA 3IJIA 5F2MA 3KE0A 1SSGA 4EPEC 3RYSA 1WDQA 3WLIA 1GKQA 4JTRA 3D5HA 1I2NA 4FX7A 1FWEC 4OV9A 3ABQA 1UR4A 1EPXA 3SY1A 4AQLA 3AHYA 4O4VA 1I9CB 1I1WA 3CUXA 3G1YA 1DHPA 3W4RA 3LS9A 2RFGA 3D6NA 4YHEA 1GOIA 3M0ZA 3TZFA 3HU7A 1GONA 3DU0A 3NTYA 2FZDA 2ZZ7A 3VNYA 4ZOBA 1PL9A 2W91A 2TPRA 1BRLB 1FQ0A 4LAUA 1P6WA 2DT0A 2TSYA 2XWEA 3QZ6A 3AWOA 1SO4A 3A7RA 3EF6A 3NYZA 2O56A 3CPGA 1TSIA 1ISZA 3CXBA 4AZ6A 3RN6A 3HPXA 4DN1A 3P74A 4AY8A 1TWSA 3FSTA 2P1FA 2A7NA 3EWCA 3RM9A 2E67A 1Q1WA 2UZ9A 4B5NA 7CGTA 1ZBKA 3NZQA 4ORMA 5DY3A 1C8QA 2VVNA 3CXOA 4S2CA 4B5XA 4ZO6A 5EMLA 2BVYA 4RX0A 1IZJA 1M65A 2YPIA 1CGTA 1YLVA 2QDGA 5A94A 4LSBA 3MMWA 1KBJA 3FEQA 3WK3A 3N11A 4NEVA 3ZJ8A 4YS1A 2CXEA 2QUUA 1YHTA 5T9BG 2ON3A 5CC3A 2F61A 4R3UA 1GRBA 1GHSA 3Q6JA 2EG7A 1UHVA 2DSVA 4H9MA 2R94A 1BYDA 4FOJA 1F3TA 7REQA 3BCDA 2HQMA 1M04A 4DI8A 2GPTA 3AYTA 3E1F1 1PBGA 3WQ8A 2ZUUA 3BOXA 4H83A 1ISXA 1EWDA 1UOKA 1WOBA 1EP1A 3D3AA 2NX3A 2INFA 4HJWA 3G8EA 1QI4A 3KVJA 4FDCB 2OEJA 5C2XA 1THFD 3UR2A 1RPKA 4UBPC 4NG3A 1YTDA 1I0DA 2V9DA 4J3WA 1KNWA 4RE4A 2MANA 4LXFA 3W1LA 2OQLA 1ADDA 4JQ1A 2VP8A 4S3FA 3LTPA 4M24A 2DUAA 3RM8A 1JZ8A 1A4MA 3Q4DA 3VGGA 4PGLA 1JNEA 2C18A 4ZBCA 3W1UA 4ZQRA 7ENLA 3GRSA 3R0UA 4HN4A 3AXIA 4ONVA 4CD8A 3PUEA 8RUCA 5F4SA 2C0AA 4ZTYA 1KBLA 4HNUA 2PTXA 3QTPA 4ADSA 3DHUA 5JMUA 3REQB 4MWAC 3W26A 4ERIA 4M7SA 3NZ1A 2PDYA 4HZ6A 3CQKA 3KEHA 1KRAC 5KZ6A 4M81A 1YPIA 4AEOA 1UKQA 3FA5A 3WIJA 3HGSA 3PJWA 5MF5A 1C9WA 4P7NA 2PRHA 3GIYA 2YW3A 1FDJA 4H9UA 2YLAA 4EP8C 3KX6A 4JN7A 4QNWA 4BWLA 4IX2A 4XD4A 3AZRA 4RPPA 4L5ZA 3R8RA 3MWCA 1EF3A 4KFOA 1A0DA 1E4IA 2A6NA 2E5BA 4F0SA 1N82A 2D2OA 1TE6A 3KP0A 4ADWA 1XHCA 1O12A 4Q8PA 4PTNA 4KFNA 1OWQA 1FOBA 5ABFB 3DFNA 1A3WA 4Q4RA 3AXMA 1PVNA 2XVKA 3M5VA 4KETA 3A64A 1QRQA 3GXMA 3LCLA 4MF4A 3NUKA 2W66A 2I9EA 4AZ7A 4A29A 4RCXA 3DYPA 2GGIA 4MUPA 2CZVA 4S2BA 1FWIC 4JPGA 1U1JA 4H8NA 2V63A 1GG0A 3TVAA 3SCUA 1JCTA 1CENA 3LHVA 2R1NA 2C16A 5D2VA 5LIYX 1BYCA 3M5YA 3AROA 2ALRA 5EFFA 3VABA 1TV8A 4W88A 3VA8A 3W02A 1LG1A 3CMJA 3BAXA 4UNKA 5DN1A 3DECA 3FXYA 2H6RA 3DK9A 5KVHA 2D0FA 3QMTA 3W27A 1R47A 1GZGA 4F2BA 4KIRA 4J3VA 3ZSSA 2PWEA 1UD6A 3BAWA 1S2WA 2O7SA 4S1FA 4ZO8A 1PB0A 2PDHA 4MIMA 5DRCA 5BXTA 4I7VA 5A8GA 4B3LA 3SQPA 4NRRA 3KL5A 3VKKA 1JF5A 3NQAA 2PEVA 3VXGA 4IUOA 4JYFA 1XG3A 2R9ZA 2PGEA 2BGSA 4AMCA 3QRHA 5IBXC 3P60A 3V75A 4AD3A 3TEVA 4NP7A 4HHPA 1GGOA 1V08A 2ZRZA 1XDJA 3PWAA 3HQOA 5JH2A 5A2AA 2NQHA 5G4HC 1NF0A 3W7LA 1YNQA 3DI0A 4DPPA 4OU1A 1ADOA 8TIMA 4K7VA 4Q32A 2BHUA 1RJPA 4H19A 3QYQA 4JYDA 1X8FA 4EPDC 1OB0A 4MM1A 1XLGA 3AC0A 1G01A 4AIUA 4C6QA 4BI5A 5D37A 2PWGA 4BZYA 3FYPA 3HF3A 2W79A 1AVAA 2XINA 3S2LA 1CXEA 4XZBA 4Y6GA 5F4WA 4RNHA 3UPMA 5I24A 1E15A 1WZMA 1NQ6A 4M8UA 4LC8A 3CUHA 5DLCA 3RCMA 1YDYA 2BY1A 2Q01A 2Z1SA 2F8QA 4G7EB 4GIAA 1W1PA 4QSFA 3GR7A 2XM1A 3M0IA 4XAYA 3CJPA 3BICA 3L65A 1FCVA 2A3LA 1K7XA 3W1AA 4B9ZA 2ZX8A 3H21A 3TTQA 4DZAA 3CH0A 4IGHA 3SAZA 2DW7A 4NT0A 3H2EA 4N0RA 4Q3MA 1RD5A 2TMDA 4LANA 2H90A 3LI1A 5EL1A 1PZ2A 1DJNA 3AXXA 3OTRA 3V0TA 6CGTA 2NT1A 2YCEA 3BANA 1Z3NA 1VFOA 1NHQA 2V68A 3T4CA 3IGSA 4REQA 3W1XA 4P8VA 1XM3A 1TTQA 1H7XA 4X2RA 4QJ4B 4L4OA 3MSDA 1POJA 2V67A 1WV2A 2Y62A 3EWBX 2PAJA 4M3PA 2F5ZA 2ZX5A 1TTPA 2ZCGA 4N4PA 4QE5A 1E70M 3QBUA 3TX9A 5EA9A 1DNCA 1NDYA 3NAVA 3PAJA 3L2MA 2GJXB 4E38A 3N1AA 4O12A 1E0UA 3HG5A 4DBEA 1RP9A 1Q8AA 1F2JA 3O6DA 3GXDA 3CTTA 2DZUA 1TZZA 1NDAA 4IIFA 3EDKA 1V7AA 3GIQA 3WL1A 3TAOA 1F76A 4M82A 5AECA 2GGEA 4H9TA 3GDBA 4FA3A 1W3NA 5IRPA 1R2SA 2D69A 4B15A 3F5KA 3EUB3 1GVSA 1QW8A 4O1DA 2IMRA 2NSOA 4ZZ9A 3NQ8A 3UG4A 1AMKA 3DFQA 3ITLA 2FZBA 4JIPA 1UWSA 3UJSA 1N7KA 1VLWA 3Q45A 3FVMA 1DJZA 3OLDA 3GFYA 3AMKA 3PNZA 3VDCA 1AQFA 1EGZA 4KRTA 1R2RA 5XIAA 1F6PA 1LL6A 3V7PA 2YCKX 1EEPA 4IPNB 2QPUA 3WNLA 2V2CA 1TV4A 1JYVA 3BSHA 2NQZA 4HMCA 2TYSA 3F2CA 2Q8XA 2YFOA 4AW7A 3IIOA 2WNWA 2YSWA 2NSXA 3I3DA 3CUFA 1R3QA 3GXFA 4XTIA 5A8PA 1TIWA 4KEZA 3N2MA 4JHMA 5AHNA 3WH8A 3R25A 1YTEA 1T8QA 1KTNA 1Z32X 3EKLA 3PPFA 4QXIA 4E3TA 3KOWA 3VOHA 1S2CA 1HN1A 1QOPA 1RY8A 4HTBA 4LC6A 1H3GA 1N8WA 3WNOA 1EJRC 1ZFJA 4P7OA 2Z2UA 4DI9A 1R3SA 3A47A 3AHXA 4QJ5B 3WQFA 4PMOA 4H2HA 4CD7A 4XB3A 3GW3A 3G1HA 4GINA 1A5LC 3ITYA 4HHHA 3LCHA 1LUCB 1GV4A 3PJTA 4O10A 2OLSA 1LBLA 4HPXA 3OQ8A 3ME3A 3ZR5A 4BF9A 1U2YA 4FXSA 2WKGA 5AYBA 1DTUA 4YWOA 3VC5A 3GLCA 4EPBC 4RL3A 4E6MA 1KCZA 5CG7A 2FFCA 1POKA 1BVNP 1RP8A 5M1TA 3ZIZA 3WK1A 1EL3A 3F2BA 1WXZA 4OT7A 1E6SM 1RR2A 4JTAA 4FI4A 1BF6A 1SFLA 4J3SA 1OD8A 5A8NA 4Q22A 3B8SA 4RDZA 4QDMA 2OJPA 1V6WA 2QVNA 1F74A 1QW7A 4IOTA 4R33A 1WOAA 4UQEA 1U22A 1F8MA 3MVIA 1OCJA 2F6XA 4ZOEA 1XYLA 3CV7A 3STGA 3WD4A 1E72M 3LNMA 3E12A 1EWEA 2WQDA 4U3AA 1UYQA 2NV2A 2G3IA 4QLJA 2A8XA 4ZSUA 3LPGA 3E9AA 3MI3A 1XD1A 3TNBA 3UA3A 2D2HA 3M46A 1RCOB 2X05A 3VUPA 3B9EA 5JUVA 2A3HA 1S5MA 2HZGA 4GMEA 1A3XA 3F4CA 1MQRA 1K8XA 2XJ7A 3GR8A 4DJDA 2DY3A 3H2AA 1XYAA 1LWIA 3WN6A 4CQAA 1R0MA 3QSTA 5FF0A 2J7HA 4D8ZA 4CEXC 2PTDA 1MWOA 5CSYA 5D2XA 4MJ2A 4GYPA 1KW1A 2VGFA 4Z2GA 3P6LA 3BAKA 2OWCA 3WBXA 5D4YA 4O28A 1H50A 4JTQA 3DG3A 4C7GA 5D8WA 3NQDA 1P48A 3E5BA 3OB8A 3U4AA 2WVTA 3SIMA 4LUTA 9RUBA 4NAEA 5FSEC 2PFHA 4GVIA 1CZ1A 4UOZA 4LV9A 3A7UA 1UD8A 1S2TA 1ML1A 2YB1A 4NJGA 2INEA 4B3KA 4PMNA 4BWLC 1PX8A 3UETA 4B3ZA 4BQ3A 5RUBA 3NYDA 3PG6A 1OC5A 5CJNA 4JTTA 1EUAA 2I14A 1H1YA 2W0HA 1DWAM 3FJ4A 3IIPA 3OC4A 1GYNA 4US5D 2GGHA 4X0NA 1PX4A 4KBXA 1AUSL 3IANA 2VD9A 3K46A 3GKFA 5M03A 3M07A 2VZUA 2YXOA 4IPIA 2V5BA 3VAVA 4P7LA 5JIWA 2V3GA 2J7CA 4KESA 4Z2KA 2BY3A 4DVOA 3QKZA 1GRGA 1T3QC 3V5CA 1W1B1 3EWZA 1G94A 3GTFA 4Q8MA 1XIHA 2QIWA 2OX1A 1AQMA 3UGRA 2POZA 4BQ2A 1GRFA 4Z2JA 2BHYA 1A53A 4D2JA 2OR2A 1ZBWA 3VGBA 1C90A 4ZR8A 4DBSA 4I9JA 1TYGA 2V5CA 2VUYA 2NXGA 1YQ2A 2PP3A 4JNMA 3C2FA 2O9RA 3MMUA 1IEXA 4LYQA 3TYBA 1NJJA 1WDRA 4IFKB 4NU7A 4PUJA 3RR4A 5M3WA 3CMGA 4QITA 1K4QA 2VC5A 2BVTA 3WJSA 1TZ7A 4IFOA 1U83A 4A05A 4PEKA 3UVIA 1IZCA 3CUIA 1XF0A 4XX6A 3NZPA 1UR3M 3S1XA 3HFTA 3W86A 1EBGA 3DYOA 1A5CA 7ODCA 3PTDA 3VVGA 2YCLA 3CL8A 4YTUA 4Q4MA 3NXLA 1K03A 2BGNE 4LVGA 3A13A 4XD3A 2ZZ6A 4Q8WA 2P50A 3SIZA 3I3BA 3VNJA 3M7SA 4HB7A 3DFOA 2Z6JA 7TAAA 2GDQA 3B0VC 2YXXA 5EMKA 1WKDA 4OKDA 3UXAA 3P8JA 4YXGA 5KZDA 1UMYA 2UBPC 4HCLA 3NA8A 3ABZA 1PCWA 1CCWB 1MI3A 3CAKA 4KPLA 1Q4NX 3V5FA 2BGQA 3S6OA 3K4AA 2J7GA 2CWNA 5K9CA 1HJVA 5LNUA 2WVSA 1CXFA 1FWWA 1SQ7A 4XO7A 4FO4A 4H4QA 3KW3A 3VGDA 4ACYA 4X9YA 3MJMA 1MYRA 4QCFA 2DJLA 3THUA 5FJJA 4EAMA 1S3HA 4KPRA 5CZSA 2R8WA 3KL3A 1H7RA 3TAKA 1M03A 3LXAA 2ZYFA 2EPLX 2W27A 2GFTA 1FH7A 1XKJA 4LBRA 3T42A 1EO5A 4LUJA 2NQLA 4BK9A 2OLAA 2YBVA 3EX4A 1RK6A 4LF2A 4XZLX 3T0DA 1CECA 2CCRA 2TAAA 3I4KA 3NL6A 1H63A 2WANA 1XRFA 3U2OA 3C2EA 2E77A 2AOSA 4NX0A 3MSYA 5DO8A 7TIMA 3W82A 1J12A 1AL8A 1KCLA 3SQMA 1D8CA 4PRRA 1VEPA 3NOEA 4IWWA 4HPNA 1EJ7L 3GH4A 4H4UA 5CCZA 1UMLA 3SY5A 1ZHAA 4L64A 1NOFA 4L4PA 2B7QA 3BGGA 3SCPA 1ALDA 3NVWB 1QDSA 3ZLFA 3GYEA 2GVEA 5CPSA 3KRZA 3S5NA 3G1AA 3G3DA 1TJRA 2GVYA 1RBLA 4ZL1A 2QAPA 4CD5A 3ARPA 3ZVHA 2OOGA 1GOKA 1V79A 4Q33A 1XLKA 3AMDA 1CIUA 1REQB 4FMVA 3PG9A 3OVPA 3F2DA 3E74A 4LAOA 2WKLA 3N12A 1MW3A 3BWWA 1M7XA 4N02A 4GQBA 4JEQA 4OZOA 3S1GA 5H6HA 3WLQA 1LOLA 3W1RA 4WY0A 2X2GA 1SR0A 1NWTA 4DO5A 2FZ9A 4XAFA 3TYEA 4LRTA 1CTNA 1GTEA 1GSNA 4LVAA 5AHEA 2BXVA 2ACRA 3DDMA 5HR7A 3U2CA 3MUXA 3PBVA 4QE4A 3CUGA 2J3NA 4DO4A 3MVTA 3F7JA 1HG3A 1IHIA 1FWHC 4UCGA 4TX9A 1W5NA 3MKCA 5LNWA 1BFNA 4UQDA 3DG6A 3LSCA 3LD5A 4GD0A 1HJUA 2ISSA 2PCQA 2QUVA 2OTDA 3KCJA 2REQA 5M17A 3NJ3A 2ZXAA 3I10A 4V2XA 5HXMA 1TV2A 2Z0IA 3GTIA 1NIUA 4W8BA 3W84A 4JFSA 1QR7A 5CEWA 4BS0A 1MNZA 4QHRA 2VCBA 4GR1A 1CX9A 4JX6A 4MJZA 3SDOA 4ZO7A 4H50A 1M53A 1OX6A 1RD6A 3MO4A 3VD4A 4LCSA 4DXVA 1QAPA 4UC5A 1JGMA 1AODA 2VYOA 3VIOA 4KQNA 4LS0A 4O17A 3VIHA 5GJNA 1FY6A 5BRBA 4ORIA 4C1LA 4UTTC 3LZ3A 3C0JA 3E2RA 5B7YA 5I5RA 1GERA 4H6EA 4DJFA 5C70A 3VOIA 4YJ5A 3R4IA 1P0NA 2GL5A 3CL6A 1EJWC 5LA2A 3SCTA 4UTJA 1D2KA 5KMYA 3C61A 1Q6FA 4LT9A 3AZSA 1EQPA 3N13A 4NAEB 4NYYA 4MWAB 2OYLA 4NY2A 4EWJA 3FA4A 3VMPA 3P81A 1SM9A 4KWUA 1EB3A 1MUMA 4Y9MA 4AD4A 4QLKA 2VWSA 1F4AA 3FXGA 3VI2A 1LWHA 1KBIA 1R87A 5HWJA 2ZVIA 5A6BD 2ZRUA 5KETA 1UR8A 2QJGA 1S5WA 5A95A 4DBDA 3AHVA 1VFLA 4E2VA 3KFTA 1FHLA 3T07A 1DJGA 3HV9A 4C6JA 4D72A 1W1YA 2YCJA 2DUZA 2O4MA 4GUHA 2V5JA 5LA1A 3BLLA 1XBYA 5AYZA 4C1NA 2P5NA 2QAFA 3C0QA 1UR1A 2CBUA 3PBGA 4AX7A 2YBUA 1H41A 1UR0A 5JVLA 1QWKA 3HM7A 2R82A 3SCWA 3EA2A 1ADSA 4M0XA 3QV9A 3GXTA 5LGZA 1HQTA 2GGGA 1S1PA 4DJDC 2ABBA 2PWDA 1KR1A 3AICA 4J3TA 3LMZA 1YXYA 1RA5A 2ZDSA 1J9YA 3ABSA 3TN5A 4AVOA 4OGZA 4LUIA 3AYSA 4MB4A 2NVAA 3N2XA 4TV5A 4E5TA 2WO5A 4B5UA 3EAUA 4JGDA 2QW5A 1NAL1 3HOJA 4DEFA 1UJQA 1HNYA 3I6TA 3U6WA 1QI0A 1N5XA 2J8GA 2WNNA 3GZAA 3S8HA 1GVQA 1NHRA 5KZMA 2G37A 1ODUA 2ZUSA 1E40A 3MA8A 2QT3A 3F5LA 2C1HA 2VFIA 3GH7A 3CZLA 1ESWA 2P8CA 2ESCA 3I68A 4WJ8A 3UWYA 1EP3A 5D9OA 4RNIA 2PF8A 1KCXA 1E0TA 1SZEA 2HSAA 2CKSA 4NZ3A 4POCA 3VIIA 3H12A 4C6NA 2OZ0A 3UA4A 4ICCX 1GRHA 3T7VA 3BMXA 2VOMA 1FWDC 3CASA 3HQNA 2E9MA 4QX4A 1B3WA 4NNCA 2BVDA 1PDYA 1HKVA 3V5OA 4PCTA 3XIMA 5AHMA 1UB3A 1V7YA 4K8DA 3UZ5A 3USBA 1R9XA 2VKZG 1TX0A 3MDWA 1EBDA 4JZ5A 1BWVA 4JTUA 4UIOA 3QR0A 1HL2A 3QOKA 3PANA 4CD4A 3WEOA 2BMBA 2FVMA 1V77A 3MI6A 3CGTA 1J2BA 4JKMA 1V02E 1ZCOA 3LU2A 3R94A 2BY2A 1MFVA 4N9BA 2HQAA 1G6CA 3U4FA 2NPXA 1FWSA 1BG4A 4HD5A 3TE9A 1XG4A 1XLJA 2PDQA 3PN8A 4Q4KA 1W2PA 2BNJA 2EKGA 3AHTA 2V69A 3QMSA 1FO4A 4M6QA 2WP6A 3L4VA 4EAYA 3EOLA 1E43A 1E5NA 1FIQB 1UD5A 3GDTA 3LV5A 3HG2A 3BG9A 3SFKA 3QV7A 4O11A 1AOGA 1UIPA 4JEJA 3RIKA 5BNKA 2ZA2A 1XFCA 1VYRA 4R85A 4GQ0A 4G1NA 1QPKA 2OX4A 2QCDA 1PUDA 4J2MA 1BSIA 2DT3A 5A2BA 3F4DA 2E68A 3PZVA 3NL5A 3VZYA 4AWEA 2ZUNA 2J62A 4ADUA 2AQVA 4OQVA 3EB2A 5E0KA 4E4UA 2PD5A 3W7JA 2RGMA 4HKPA 1W3IA 1A5KC 3WLKX 1YPXA 1AZ2A 1XLMA 4DZHA 1KFLA 2OWWA 3RPDA 5CLTA 1L0PA 5GNZA 1QW9A 2VX4A 1XLFA 2AL2B 4K1GA 1FHUA 3AIBA 1D9EA 3I6EA 1MEWA 3ITOA 1M7OA 2NXIA 5ABEA 1R38A 3HG3A 1B4EA 2DEPA 5C55A 1QATA 1Y8BA 1QTWA 2VR5A 4KEUA 3H54A 3GW0A 1T6MA 3O9NA 3STCA 2VWTA 1D3GA 3WQOA 1SO3A 3PWIA 1BPLB 3W7RA 1DP0A 1I60A 3VU2A 3AWNA 3KVKA 1LZOA 2R1MA 4LAKA 4RLIA 1X97A 2A0NA 3V1PA 4UFIA 4O50A 3MHUA 5BMWA 2I9UA 3C3NA 1MFUA 2OEKA 1E9YB 3CWHA 5ABHA 2JIEA 4FOKA 4A3YA 2YL5A 4NZJA 4BEQA 3PJUA 1KWKA 1N60C 2A85A 4BY3A 1XP3A 1OYAA 3B9DA 1FH9A 5I3KA 4GISA 5FF2A 3VD9A 1N8IA 4ZB0A 3B03A 4KWOA 2VGGA 1JPMA 4KRUA 3RK8A 5FKYA 2F38A 4OFCA 4L65A 5EMYA 3LCXA 3C2VA 4QFUA 1TVNA 3OJGA 2QS8A 4Z2LA 2CLEA 2JKAA 3QV6A 1ZP4A 2EPMX 1ELSA 1KM5A 3OVQA 1SO6A 2Y85A 3CHEA 2JEQA 4K2SA 1S39A 4AFYA 4W8AA 1XH1A 3LUTA 2Z2BA 3LXCA 1CB7B 4WVXA 2PMQA 4GY0A 4BQ4A 4NHVA 3CEUA 3TWBA 2J27A 3GTHA 4XAGA 2HNEA 1YDVA 3NXFA 4Y9PA 1LRTA 2QIIA 1WE5A 2WSQA 2D2GA 2X8CA 4BR1A 4DWSB 2AAAA 1UWUA 1Q85A 4M5PA 4E8DA 5CAHA 3BG3A 3RDKA 3SBFA 5CBIA 1NEYA 3IVUA 4NNBA 2V3EA 1DWFM 1ICQA 2E5DA 3TK7A 3EEZA 4QS5A 6A3HA 4LYRA 3STPA 1PIGA 2XIBA 1SGJA 1YDNA 3NQCA 5CPOA 1G67A 3EX2A 4BKNA 2XN0A 2FVLA 4JCMA 2XZ7A 3E0VA 1EKOA 1R7AA 5LZLA 4D6JA 3QHOA 4MJ4A 1PWMA 4JQAA 1NDZA 4O19A 1LVLA 2LLEA 4S38A 5G1MA 2PWFA 1HGWA 1B90A 4JIIX 1J0KA 1VHNA 1J2WA 4GVHA 3ARUA 3URHA 2WHKA 2TODA 4GX9A 2Z1XA 2OXNA 3A12A 3TH6A 3MV11 3RO6A 2DSWA 4UQ9A 1PV8A 3D0CA 3WDQA 3ABOA 1B0IA 3HPAA 1OX4B 4QP0A 1OFRA 3IJ7A 3NS1B 3W2KA 4C1NB 3ITVA 5CG0A 2WSPA 4V1YA 3M5ZA 1OX5A 4P8UA 2OG9A 6XIMA 2D0HA 2V2DA 3M1ZA 1WPCA 1UOZA 3P0WA 3QGVA 3THDA 1AW2A 1S3TC 4L9ZA 2RDWA 3DG7A 3AI0A 4C65A 1XLLA 4C7FA 2C3ZA 4H4XA 1NHSA 2XVGA 2W55A 3G1XA 5U1OA 4EWND 3RG6A 4LUSB 1TVPA 2FHBA 1JCXA 3LN3A 2O0TA 4JQ9A 1UZ1A 4OHQA 1VBRA 3VD3A 3R10A 4GYJA 2PPGA 4H6KA 3M0LA 2J13A 2UY3A 4H8UA 3PTMA 3U0HA 1K4GA 1OM0A 3AXKA 5C71A 4AF0A 1RH9A 4HMDA 2XFWA 1PHWA 2WPFA 2Z1BA 2VRJA 1BAGA 4WJEA 1KFEA 6TAAA 4PR4A 3WQGA 1XINA 2E9LA 5AVNA 4B5VA 5HQMA 3UZZA 1H6VA 4EM3A 4L6HA 4B5WA 3S1UA 3R6IA 3IPWA 3WFAA 1TPEA 2I56A 4PBGA 2NLYA 1PAMA 1IIHA 1JD7A 4O13A 1XPYA 2QAEA 4F79A 3GAYA 1A50A 4F40A 4NILA 3WNNA 4K1WA 3LXBA 1ZAIA 3O3RA 2J88A 4MG4A 3FOKA 1V51A 1RBAA 3RX2A 3KCLA 4WOZA 1IWBA 3VKCA 5F1UA 2PSNA 5IHRA 2QUNA 3UESA 4UOJA 2PC4A 1V6XA 2ZZ2A 4GCAA 2IKIA 4DZ5A 2DVTA 1OIMA 4H04A 3MV01 1W31A 2VEMA 4C5YA 4N2YA 1GCYA 1IIGA 1V6TA 4I6VA 5XIMA 1NP2A 1PXGA 3V0UA 3ZYZA 3R11A 3DHPA 1YW1A 2H8XA 5CSUA 1KCKA 1EZ2A 3PPHA 5HJLA 1AH0A 1UR9A 1HKIA 3GWQA 3MBFA 3SO7A 1C9DA 5HWNA 3VPLA 1K8ZA 2W3RA 4O57A 3DUGA 2J8TA 1R8LA 5EKYA 4AD5A 5BWFA 4XAPA 5HMDA 3H4XA 3TYAA 3GG8A 5BWAA 3GNPA 2XUCA 1TPUA 2AQWA 3T6CA 1QNSA 2DORA 3TDFA 5DCDA 2ISDA 2BB0A 4ZSTA 1TX2A 1U33A 1V3KA 4N42A 3IK2A 3TMQA 3VKJA 3GR4A 3SUTA 4UFJA 4GABA 2XG9A 3BAJA 2QDDA 4XK2A 5I06A 2FQIA 4LCQA 2H9AB 3HZ3A 4AEEA 2DVUA 4MNLA 1P4CA 2F2KA 2XGBA 2G96A 1QK2A 1VJIA 1DVJA 2X1SA 4HYRA 3HA1A 1DBTA 2J75A 1RSCA 4D6HA 1CW2A 2JGQA 1KR0A 2ZC1A 2EQ6A 3AS2A 5U4NA 1FRBA 2O4QA 1TREA 1GPWA 1HTIA 3L4UA 4UR9A 4HU0A 2HE5A 3GDKA 2ZIDA 4ZXOA 1VQTA 5G1YA 1MXGA 3IIZA 4R7JA 4IG2A 4AUBA 2HVMA 2QYGA 1QI3A 4DNMA 1GNXA 1TUFA 2XTKA 3Q67A 2V8ZA 1F6KA 4GFIA 4I5RA 1RQBA 1R46A 5IHSA 4GO8A 2IW0A 1V97A 3VMOA 3K8MA 3AIQA 3U7BA 3BL3A 4HMNA 1V0NA 3KLJA 3QQ0A 5DFAA 3DFHA 1JZ2A 3ID7A 1O4UA 4S3BA 3TU9A 3CLWA 2HISA 5D9MA 1YE6A 1X2HA 5CH9A 4RXFA 3EA1A 4KW2A 3EGJA 4MTVA 4EK7A 1LDCA 5DMYA 1M01A 3M16A 1GQKA 1B1YA 1GVRA 2Z7GA 1KBKA 3KM8A 1Z89A 4NX5A 2CNCA 3LZ5A 3E02A 1K7FA 4MNKA 1JI1A 4DNAA 4F8XA 4AG0A 3N4AA 4X2PA 2NVKX 3TCEA 1JUKA 3GHRA 3TC7A 4IL0A 3W7PA 3T2QA 4PCFA 1DEDA 3II4A 4H6QA 3AJXA 1PTAA 2GK1A 5H1WA 2A5HA 5I6SA 3C0SA 8A3HA 4IL2A 3GNXA 1Z44A 1O95A 3IGHX 1OQFA 2CFFA 4DNHA 3QC0A 2V30A 4TR9A 3VGHA 3GO2A 4Z1DA 5D32A 3MSRA 1BHGA 3G0XA 1SU5A 3TOPA 3IS4A 2VFFA 1JFXA 4B9YA 4CD6A 1T8XA 4FLQA 1V5XA 4NZ5A 4ZQPA 3EKZA 1EC9A 1VYPX 3WX7A 1H60A 4IH3A 3JR2A 7PTDA 2CFYA 3C0LA 1E6RA 2XH4A 4HA4A 3QW4B 2WZTA 2YL8A 3CUJA 4M6VA 4ZTXA 3OZYA 3GS6A 5DANA 4NRSA 1MSSA 3HB9A 1HJXA 2GVLA 5AZ0A 1XH0A 3EX1A 4S39A 3RX4A 4O1AA 4V28A 4MZ1A 2YZ5A 3DGHA 2CXGA 5AHLA 2V6AA 1G0CA 2P3ZA 1E0WA 5BOOA 2OGJA 3PJXA 4PB5A 3W1TA 4B4HA 2ATMA 1QOXA 5BXPA 1BEUA 1ODZA 4PRWA 4PUKA 2VCCA 4IX0A 1LL4A 4UFMA 3GUGA 1ZGDA 1CB2A 4W7UA 3W2MA 1FBAA 1DQXA 3FJLA 3JRKA 3RX3A 2BC0A 5AC7A 4J2PA 1VYSX 1KV8A 1ZJHA 1X7FA 4FXRA 3FCPA 3GTXA 1SW0A 1WDWA 3NO5A 3TC6A 5D04C 4WXYA 4GJIA 4CQDA 4TV6A 3EB4A 1OHLA 4I3GA 1JQXA 3RU8X 5HNRA 5GVJA 1DJXA 1E3XA 3ZT6A 3LGEA 3IGUA 2WPCA 1WYIA 4FF7A 4H1ZA 2NW0A 2ZQ0A 1LBFA 1G7UA 1DV7A 4GI9A 4HTYA 2CZ5A 4U10A 2C8NA 4PA8A 3M5XA 4LNYA 3C56A 4XZMX 1AD1A 2YOCA 3UZYA 2OSXA 3FSUA 2BBFA 3HGJA 4MY8A 1X1ZA 3ZMRA 3TXVA 2WCGA 1TYTA 3KOZA 4S3DA 1FHVA 1VZWA 3VOFA 4CGTA 1I8JA 3KUMA 1IXQA 5D2WA 1X98A 4PH6A 3NR0A 4R34A 4LX4A 4DZIA 3OW1A 3L4TA 3KVLA 1R9ZA 1I1XA 4FAMA 5T9CE 4RE3A 3PZMA 1A5BA 2GJPA 1ZX9A 2WVVA 1C93A 1QFEA 1K7EA 3W28A 2CLIA 1JXJA 4Z1YA 3CIVA 5I3HA 4FNUA 3WMLA 3BQ5A 4UOQA 5CKSA 3TP4A 3H4GA 4MPQA 3OYZA 1LOSA 1FWNA 2QDEA 3N6QA 1CXIA 3O8AA 1VFTA 3NRZB 3BSMA 4KWWA 1LWJA 4I7WA 1MOKA 1NWRA 3S0CA 5LIKX 3LBMA 3XINA 5HMEA 3GNOA 1AG1O 3BAYA 3QOMA 3WUGA 1Q1RA 1XIFA 3A4WA 5I3FA 1GOWA 2JEPA 3MCNA 1KFBA 5DF0A 4QQ3A 1BXBA 4ZO9A 3W00A 1G4SA 3LV6A 4HYVA 1CPUA 3LRKA 4I90A 5K4XA 1KM3A 3CB8A 4P5UA 2NX9A 1GJUA 1XYBA 2ZZ1A 1FFRA 3IC9A 2TRSA 1GVYA 3UWWA 2JKEA 4AU0A 3SCOA 1M68A 5HR6A 2WNZA 1QNOA 4PMUA 4QQUA 1WAWA 4QLLA 1J0YA 3VNMA 3MWAA 4JQ2A 1RXOB 4B5TA 3H6OA 1T5AA 4N6EA 1VCVA 3RILA 4YTRA 3GC4A 1A5SA 1BG9A 1EP2A 4K38A 1J0JA 4C6KA 4P8XA 3ITTA 3ELFA 1RLDA 2VZSA 3W3OA 4D6CA 1OVDA 4HNOA 1M1BA 2P10A 1J96A 1TWDA 2HV5A 3B05A 3NSNA 3I6RA 2WC3A 5T26A 1A5NC 1K9FA 3CTLA 4GH1A 1CWYA 4Y8EA 3BK0A 1E1FA 2YDRA 3BUVA 2QEZA 1H1ZA 2XH2A 3CWNA 2R1LA 4A3HA 1E1EA 1HP5A 4J3XA 3TZNA 3BH4A 5D2TA 3RPMA 1J5SA 1W3JA 4EACA 3L2IA 3H2OA 5C54A 2W3ZA 5EB8A 2B7PA 4C7DA 1J6PA 1W1IE 5E1QA 1IZKA 3GVWA 1OINA 1XYMA 1IYXA 3TTYA 3VNIA 2X41A 3VNZA 3WDJA 4O1FA 1DJHA 3M6YA 4CNUA 3RUBL 3PULA 3QMRA 3AIRA 3C8FA 4GXPA 3NQBA 2YDAA 2AL1A 4E8GA 2VZTA 4EVZA 1N55A 3ARRA 4QROA 3B8DA 4GCXA 1ONFA 4N7QA 1MQQA 3G1DA 3C5QA 3DJGX 3AIUA 1M7PA 3CS2A 2YB4A 5BOFA 3STEA 2E40A 3DFPA 1FFUC 2WW5A 3QGAC 3UQNA 3CHDA 2PCEA 3H55A 5HNNA 4HSHA 4I8YA 2NV1A 1W6TA 1V3HA 1ZDLA 3JZEA 4ZE4A 3W75A 3WNPA 4N4QA 4DUOA 4NZFA 4IQEA 3QVQA 3QPYA 2GJNA 1R5YA 3HPZA 4Z1AA 5I00A 5MKGA 1GQIA 2ONEA 2B0MA 3FX4A 4N9CA 2BZNA 5D09A 4KEMA 4CN1A 1XDMA 3W2LA 1BXNA 1U1HA 3WD3A 5C0QA 1FWAC 1UR2A 2P3EA 3S5ZA 5CZTA 3UFYA 4YNGA 3S2CA 1IT8A 1ZLPA 1VR6A 4L4MA 5FF7A 4JIQA 1C8YA 4H41A 3LGDA 1TWIA 3KP1A 1LBMA 5FEWA 3WH5A 3WFZA 4FXJA 2PA6A 3UXIA 3W38A 2V81A 3SUWA 4MLJA 1ZKQA 1AL7A 3KBMA 4C5ZA 5I3GA 1YDOA 2Q8ZA 1BTCA 2VC9A 1LQ0A 3O0FA 1ZUAX 4NI8A 2ZZ3A 2QJHA 3A9BA 3TQ0A 1OFBA 2ZUWA 4Q8NA 4A8LA 3N17A 5TF0A 4NVTA 1EZWA 3BLFA 1SMDA 3WUEA 1SUXA 3MUAA 1Q7MA 4XBKA 4BF5A 3CB3A 4UQAA 1BRLA 2V3DA 3NSXA 3O0HA 3LA4A 3DBNA 3NZRA 5A6TC 4UTUA 4UZSA 1FCQA 4Q4QA 1W2VA 4MWAE 4FIRA 4IMGA 1OJXA 2ZUMA 4PCPA 1MZRA 1EJXC 4WSHA 3EWYA 1I0BA 2WSKA 1UP0A 2WOQA 3L5OA