3OZMA

Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
386
structure length
386
Chain Sequence
SLKITEVKAHALSTPIPERMRVESGAGLKLNRQMILVEVRTDEGVTGVGSPSGPYDLAVLKRAIEDVIGPQLIGEDPANINYLWHKVFHGEVSRNLGHRSVGIAAMSGVDIALWDLKGRAMNQPIYQLLGGKFHTRGVRAYASSIYWDLTPDQAADELAGWVEQGFTAAKLKVGRAPRKDAANLRAMRQRVGADVEILVDANQSLGRHDALAMLRILDEAGCYWFEEPLSIDDIEGHRILRAQGTPVRIATGENLYTRNAFNDYIRNDAIDVLQADASRAGGITEALAISASAASAHLAWNPHTFNDIITVAANLHLVAASPHPAMFEWDITHNDLMTRLASYDLKLENGLVQPPQGPGLGFEIDWDFVAAHAWKGEPAIGAGHGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative mandelate racemase
publication title Crystal structure of enolase superfamily member from Bordetella bronchiseptica complexed with Mg, m-Xylarate and L-Lyxarate
rcsb
source organism Bordetella bronchiseptica
total genus 132
structure length 386
sequence length 386
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ozmA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ozmA01
2AKZA 3DDMA 4KWSA 4E4UA 3MQTA 4X2PA 3EEZA 4E6MA 2PTWA 3SN0A 3GC2A 3R10A 2OX4A 2PSNA 3TJIA 1L8PA 3D47A 4GGBA 3SN4A 4HNLA 2XH7A 4HCDA 5FJTA 3FVDA 2OLAA 1EC9A 1EC8A 2GL5A 3CK5A 3OP2A 1DTNA 1ELSA 1MDRA 3N6JA 1XS2A 5BOFA 4IP4A 1YEYA 3JVAA 3THUA 3VCNA 2FYMA 1PDYA 4HCLA 4HNCA 1TKKA 3VCCA 1KCZA 4HN8A 6ENLA 1XPYA 3U9IA 1MRAA 3MSYA 3OPSA 2P8CA 2HXUA 2P88A 3DFHA 2PU0A 3PFRA 4DX3A 3P3BA 4H83A 4K2SA 4GIRA 3DESA 3IJQA 4YWSA 2PTYA 2O56A 3V5CA 2AL1A 3VC5A 3OZMA 4IT1A 3QLDA 2OZ8A 2P0IA 4IL0A 2PP0A 3S47A 2OFJA 3IJIA 3BSMA 4F4RA 3ZVHA 3TWBA 1PDZA 4KEMA 4E5TA 2P3ZA 2QJNA 2OPJA 3H70A 2HXTA 3UCCA 1EC7A 4G8TA 1SJAA 2PP1A 2I5QA 2PTXA 4DXKA 1OEPA 5BOEA 2PP3A 3FXGA 1KKOA 3FCPA 5EU9A 4J3ZA 3V4BA 3DERA 1TE6A 3MZNA 2MUCA 3RO6A 3NFUA 4DWDA 4FP1A 4KT2A 3UGVA 2XSXA 4IZGA 4GFIA 4Z17A 3Q45A 1WUEA 3CT2A 3V3WA 5IDZA 3RCYA 3N4EA 2GGIA 2MNRA 2NQLA 2PTZA 2GDQA 3RITA 2DW6A 3R0UA 2PMQA 3Q4DA 2PPGA 3QKEA 3RRAA 1FHUA 3KUMA 4H19A 3GD6A 3ENLA 3K1GA 4Z1YA 3EKGA 4JN8A 3OZYA 4KPLA 3JW7A 1BKHA 1JPMA 3CXOA 3UJSA 1TZZA 1NU5A 4HPNA 3VFCA 4FI4A 3T9PA 3T6CA 4ZCWA 1JDFA 3MY9A 2PA6A 3CYJA 3ES7A 5FJUA 2AL2B 3DGBA 4MKSA 1ONEA 3CB3A 4DYEA 4M6UA 3SBFA 3DG3A 3NZGA 3U4FA 3DEQA 3R0KA 3R11A 3BOXA 3SQSA 4ENLA 2GGGA 2XGZA 2XH2A 1FHVA 2FKPA 4M0XA 2P8BA 4A35A 1WUFA 2RDXA 1EBHA 3UXLA 4G7FA 4DHGA 2OQYA 1MDLA 4K8GA 2QQ6A 3QTPA 4E4FA 3N6HA 3DFYA 1P43A 3GO2A 2PU1A 2CHRA 2HNEA 1P48A 2QJMA 4JHMA 1R0MA 4K1WA 4E8GA 3STPA 3TCSA 2HZGA 3NXLA 4DN1A 2OG9A 5J04A 3DIPA 3IK4A 3TJ4A 4HYRA 1RVKA 1SJDA 1MUCA 3N4FA 2AKMA 2XH0A 2QJJA 4EWJA 2GGJA 1ECQA 1BQGA 3VDGA 3SSZA 3H7VA 2ZC8A 3FJ4A 3UJFA 3ZLGA 3OTRA 1NELA 3ES8A 4GYPA 3R25A 3TOYA 3TTEA 3UJEA 3VA8A 3JZUA 4A3RA 2OQHA 4ZA0A 2GSHA 3UJRA 4IHCA 3ZLFA 4H1ZA 3UXKA 3UJ2A 2GGEA 2OO6A 4HCHA 3TQPA 3TWAA 4GYPC 7ENLA 4IP5A 1SJCA 3CAWA 1SJBA 3I4KA 1F9CA 2QGYA 3FV9A 3ZLHA 1KD0A 3T8QA 3IJLA 3ZVHB 1JCTA 3P93A 2DW7A 2OKTA 3BJSA 2XH4A 3RR1A 3PK7A 4ROPA 3RGTA 5FJOA 1W6TA 3I6EA 2PODA 2PS2A 4IL2A 2OZ3A 3DG7A 4MGGA 4MMWA 2PGEA 2QVHA 3MKCA 3GY1A 3H12A 4H2HA 4A6GA 1R6WA 2ZADA 2GGHA 4J1OA 3T4WA 3MUCA 3S5SA 2OZTA 2QDDA 3H8AA 3PWIA 4GISA 3QPEA 3MWCA 3SN1A 3FYYA 3P0WA 2OVLA 3R1ZA 3HPFA 4GGHA 3SJNA 5ENLA 5FJPA 3TW9A 3PWGA 1E9IA 1IYXA 3VC6A 4JN7A 3QN3A 1EBGA 3D46A 3B97A 3V5FA 4GMEA 2POZA 2QDEA 2PGWA 1JPDX 1MNSA 1KKRA 3UCDA 3NO1A 3ZVIA 3DG6A 2ONEA 5FJRA 3I6TA 2AL2A 3OW1A 2PCEA
chains in the Genus database with same CATH superfamily
4BWLC 1XIBA 3NVDA 4DUXA 4PMVA 1REQB 5EMMA 4WJEA 1DJXA 2V6OA 3RM4A 2D1ZA 5GNZA 3AM9A 1GHSA 4AD3A 5DMMA 3SCPA 4XAGA 1ICQA 5G2WA 3NDZA 3VOFA 4A2RA 3YPIA 1VJZA 2WPEA 1ZS2A 1O6IA 1XLCA 4OECA 4QBXA 1UUQA 2RDWA 1DJQA 4YTSA 4CNOA 1TFVA 2JIEA 2WVUA 3TYEA 1H2IA 1PX4A 4GR1A 1OZQA 2E0PA 3BW4A 3H2AA 4IIEA 1QCWA 3JRKA 1VFHA 5I77A 3NG3A 5LSMA 3TKFA 1TJPA 1YQZA 2FZMA 4UOJA 4CN6A 2NX3A 4DZAA 3EPNA 2XU2A 2PTYA 3MP5A 4DPQA 1OFOA 1QPOA 1Q7QA 2QCDA 2VX6A 2WW5A 3B0PA 3W74A 5LHEA 5TQLA 4MHBA 4PRTA 4W8AA 2GPTA 2A3BA 2R94A 1G0CA 3G6MA 5I06A 3TMLA 4H4VA 3LGGA 4RKAA 5CPNA 1UKOA 5IHRA 3WNNA 2KX9A 1J93A 3MTWA 4RE0A 1J01A 4HU0A 1XSKA 3RNMA 3TZNA 2VC9A 3HG5A 1GQLA 3EX1A 1ZCCA 4C1NB 2G8ZA 4E3TA 1ZFJA 1J2WA 3E74A 1WAUA 1NWTA 3LCFA 3CGDA 1ISZA 2AMXA 3EOEA 1ITUA 1OEPA 4RNHA 4PR4A 1WXZA 3NWRA 3H22A 4PUDA 4OBRA 3GHRA 1D3CA 4AMAA 5C9WA 3ITCA 3S9YA 1FWCC 4EANA 3G77A 2VD9A 3WLNA 1SZRA 3N6QA 1LDCA 4REQA 3QHNA 2WSRA 4FF5A 1V7AA 3CZKA 1UWIA 1W56A 3TFCA 2FZ9A 4LRSA 3IUIA 4GO8A 2WP6A 3GG0A 1Z6KA 4DEFA 3WJYA 4MNKA 4O14A 2WNZA 4QTGA 2OO0A 2F6XA 3R0UA 2V5JA 4Q4OA 1OG6A 5GNXA 4J7RA 3WLMA 1KFKA 1H1ZA 5D38A 4IH3A 3QQWA 2QIIA 3QY8A 4QE5A 1XCFA 2WOIA 3KW3A 4I6VA 1OGBA 1KTBA 1W31A 3DU0A 3W82A 3WJWA 2IQDA 3DK4A 1OFBA 5G1MA 2PDWA 3B8IA 3PBYA 1LF1A 3MB9A 4HYWA 1I2OA 1MNZA 4LBSA 3AXXA 4WD0A 3T6CA 2X41A 1H5YA 2BNJA 1REQA 1B4KA 2CITA 4L6OA 4TVCA 4JY9A 1J8VA 4AZHA 1BGGA 2PF8A 5I00A 1OC7A 2OOFA 1PKMA 3USBA 3A7AA 1W1YA 5U7SA 4A8LA 3BSHA 1UD5A 4NYYA 1VPQA 2EPLX 2X8RA 1GVRA 1GUVA 3ISIX 3UWEA 3FSTA 3WLRA 1UR8A 3FNDA 5HULA 2WOVA 3WNMA 4LVBA 3FVMA 4MJZA 1JAKA 3J7HA 5PTDA 2C15A 1FO4A 1XI3A 2E09A 4DUWA 1NDZA 2GR0A 5HR7A 4HTYA 4G7FA 1GNXA 1IZCA 2ZVRA 3BZJA 4URIA 1Y0EA 3WLPA 3P6LA 4MNJA 4O18A 4RNFA 3MPGA 4BQ5A 3EAOA 2FH8A 1POJA 1OT2A 4IGSA 1ZXIC 5GPRA 4Y9NA 3H6OA 2BFGA 4DN1A 3GXFA 4Q6JA 4S39A 1GOWA 3TYCA 2JALA 1RQHA 4MNLA 4I9MA 3OVGA 1YDYA 3MVTA 1U33A 2A7RA 1PTGA 3AROA 4FLOA 3OTRA 4H4RA 5D9MA 8XIAA 2RDTA 5CGMA 2DIEA 3VKAA 3WQ6A 2YFOA 4UC5A 3Q37A 1GESA 2YX0A 3HG2A 4D9PA 5IBXC 4FO4A 7ENLA 2EAWA 4LAKA 3QXBA 1XM3A 2GUBA 1EIXA 3GDBA 3WH5A 5BZAA 3CUGA 3LUTA 4C1NA 2YR1A 4AIUA 1DQXA 3GU1A 3UPBA 1H63A 3W2UA 4FOJA 4X61A 2OU4A 1FA2A 1JEHA 1KNWA 1PKNA 3NVYB 3AHZA 4L4PA 3T8QA 3KCJA 2QV4A 3H2MA 3ZVHB 1JCTA 3TNOA 3ID7A 2RUSA 3BSGA 5KTLA 3NEVA 1Q4NX 3FK4A 4PTMA 1SUXA 3M0XA 3ZZ1A 1MFUA 4LAMA 2E7FA 3XIMA 4H9XA 2VZSA 2QZRA 1J18A 3HG3A 3UXDA 1L6SA 3MHUA 1ZHAA 3W1MA 1C8QA 2V8ZA 4LYQA 5F1UA 3MUY1 3UG4A 4XZWA 1QNPA 3H55A 1OVDA 2C1HA 3GVQA 1OCQA 2FTWA 1I1WA 3LNMA 3L66A 3R8RA 4CQAA 4CQ9A 3AMDA 4K8EA 1UIPA 2C71A 1LRTA 3UG3A 2VC6A 3HG4A 3ZXWA 1M6IA 3F1QA 3FYYA 4Z2LA 4QAWA 3GXNA 3HGOA 3M0LA 3KLKA 3C3UA 3RNDA 1R3RA 3OBEA 5EMJA 3EB3A 3V5OA 1IYXA 3AIEA 3MT1A 4EWND 4ADUA 3EDDA 3HRDC 1W5NA 3V5FA 4JTRA 4GJJA 1ZALA 1DV7A 2J66A 3IK2A 1KKRA 1VYPX 2PDPA 1TV7A 1OYAA 4W7WA 4TUFA 4IQDA 5C7VA 1RK6A 4FNTA 1CLXA 2PDXA 1D3GA 2DDXA 3HGRA 1XHGA 3NZQA 5IBXA 1K1DA 2P76A 2DSKA 1M7JA 3MKKA 3KX6A 4YWIA 1XG3A 3PSVA 4JQ9A 1A5SA 4CEUC 4LBUA 4LS0A 4GABA 2C0HA 4YL2A 4CNUA 1C8VA 4E2OA 2Z7GA 2QXWA 5CQ1A 3FAXA 4P8VA 2E6FA 3AHTA 5F4SA 2E6YA 3PNZA 3BW3A 4YHGA 3VOIA 3BC9A 4IIBA 1S5MA 1H09A 2GUYA 2CNCA 1MQQA 4UTTC 3PZTA 1EL3A 4LAOA 1JZ5A 1V6XA 4FHAA 5JQ9A 3FKRA 3IIVA 1WV2A 2EXOA 4NZ5A 3GFZA 1R9ZA 3RCMA 3OLEA 4ASTA 4D2JA 4ZO9A 3A12A 3SR7A 4JQ2A 3MV11 2PD9A 4V33A 4N9CA 4CUCA 1FECA 1LWIA 4JTSA 1LTDA 3MCOA 2Y89A 4YVXA 5HMDA 3WY1A 2EQ7A 4WY0B 2ZRUA 2OZ8A 4GA8A 5ECUA 4GLEA 4A3YA 1V6TA 1OSEA 4ZTYA 3ZVHA 2X30A 4O10A 3L5OA 1O68A 4C6MA 3PG6A 2VT0A 2P3ZA 2F61A 3SZ8A 4ZO7A 3WBWA 1OFQA 3P5ZA 4QISA 3T2PA 1DJNA 1FWAC 1W9XA 2ICSA 1O60A 1ZU8A 5JH1A 5KVHA 1D8CA 5CKSA 3NZ1A 1NARA 3GHUA 2A3LA 4QNWA 2YZRA 1T7LA 5D9PA 3WQGA 3SDOA 3S0CA 5K9XA 4J3UA 1QBAA 6A3HA 4HJWA 1UMYA 4NX5A 1MW1A 1VBHA 1KCXA 1FWEC 2P53A 3LX9A 3WLOA 3L7RA 3UWQA 1XDIA 3LQGA 3M7WA 2ALDA 2H3DA 4IWWA 4AD2A 3GNDA 3VO0A 4EXQA 3WLLA 2J77A 1DTUA 3ITLA 3C0SA 1B2YA 4TXEA 1RY8A 1Q7MA 1PYMA 3GD6A 4UTTA 2ISWA 1NHRA 4Z1YA 2GQ9A 3GHTA 3NL6A 4JYFA 1TVLA 1XDMA 3W23A 3MV01 1NDYA 4DQWA 1DXIA 4UFLA 1NU5A 1TQJA 3DN5A 1JNEA 4UOQA 4AW7A 3U7VA 2OSYA 3LXBA 2G95A 1CTNA 2V5CA 2ATSA 4GRTA 4CCDA 1VKFA 1W91A 1DJWA 1IF2A 1UUMA 6REQB 4FR1A 4RPQA 1W1B1 5FJUA 1E56A 5AZ1A 3DGBA 3LHVA 3CB3A 1V0LA 3HJZA 1JYWA 1V6YA 1BPLB 1LBLA 3BLIA 1LBFA 1S5WA 2FMOA 2YXXA 4PUWA 3BOXA 5CLWA 4JKLA 1LG1A 2PZNA 1SQ7A 2X0SA 3W2JA 3I10A 2J7DA 3OVPA 4MJ2A 2B81A 2NVDA 1BF2A 3B0UX 5JCMA 3VCRA 3VDAA 3GBDA 2PDLA 3N2XA 5EMUA 4L65A 1JRBA 2PRMA 3VD3A 1HL8A 2WMKA 3MKVA 4C7GA 1UWSA 5E6YA 1TG7A 4ORIA 4XQ6A 5AECA 4S38A 2HSAA 5J04A 1V6VA 4B5VA 1DJZA 3DOPA 4HYRA 1H3GA 1Q4WA 4Q6XA 1VHNA 3DJGX 4LS1A 2BDQA 4ERIA 1OCBA 3QQ1A 4WY0A 3EMZA 3MHFA 3C3NA 4GRSA 2CWXA 1IIGA 2P50A 4FX8A 4K38A 2OWWA 4UZSA 5A2AA 5DT5A 3JZUA 1B3OA 3UNDA 4D72A 4IPJA 4PTNA 3VXGA 2ZZ1A 1ZMCA 4HNTA 3ZSTA 3H2FA 3ZFHA 3CQ0A 4C6BA 4C5YA 4DRSA 4LVDA 2PLCA 2TAAA 4CD5A 1EP2A 1OFPA 4IF2A 3VM7A 2WLZA 4F0KA 3EA2A 1F2JA 2GJNA 4JXCA 2UY3A 4WDXA 3WENA 2GDVA 1Z32X 4MJMA 3ZOAA 4B5WA 4LUJA 3RGTA 3FG2P 3HGSA 2PODA 2PS2A 5HAOA 1T41A 3DKJA 1DJIA 4GG9A 2FVMA 3K4DA 2BG5A 1TMLA 2QHAA 3ZJKA 3POHA 4LYRA 5DO8A 1KLZA 4EMJA 4V2XA 3OGRA 3ZM8A 3L4WA 3W7CA 1U5JA 5AYIA 1SW3A 1BF6A 3S2JA 3OVRA 2BMBA 3W1NA 4BCEA 2WV8A 2CERA 3LSBA 3P8JA 2NLIA 4H4IA 4O12A 3SSJA 5FJPA 1UZ1A 2A7PA 3PWGA 1E9IA 3AHYA 3GR8A 3B8WA 3QBUA 1M53A 4NIRA 2D0GA 2CKSA 4ZQCA 1KR1A 2CLFA 2ZDSA 5I3FA 3NQEA 4BHYA 5CPOA 1N82A 2VM8A 6REQA 4HN4A 4ZOHB 1OFRA 1UC4A 3PY2A 3PJXA 1QNOA 3DDMA 4IJBA 2E6DA 4E2BA 4ZEPA 1DXEA 5C5YA 1Q6OA 4N6FA 2V6AA 2PTWA 3SN0A 1TR9A 3TJIA 3BMXA 2DFAA 3B8SA 4GY7A 2Q8ZA 3B9NA 3QVQA 3G3MA 1WZAA 2E1WA 2XGIA 3NGFA 4W87A 2PD5A 1WBHA 1RV8A 4XBJA 2WC7A 3SGUA 3VGEA 4HCDA 4JNYA 1G4EA 5FJTA 1PUDA 1S39A 3GHSA 4K39A 3SRKA 1US2A 3CIVA 4DF1A 2X8CA 1EO7A 3R89A 1OFEA 1RH9A 2CHNA 4ALDA 3TAOA 3S6OA 1I1XA 4MKVA 1BXBA 1EO5A 2WP5A 5AC5A 5DF0A 4A2SA 5XIAA 4HOXA 4C1KA 2CLMA 1F07A 2V2CA 3W7OA 3TC7A 3PF3A 4LEQA 3W7EA 4ZVJA 3CLWA 4FR6A 5D4YA 4JAWA 3K8MA 1DORA 1OG0A 2XGBA 3GBEA 2PU0A 4GZ7A 3DXIA 4O1FA 3P3BA 3QR1A 1TV3A 1XL9A 1A5LC 2BVYA 3TXVA 3WO8A 1QNRA 5A6JA 4D8LA 4LV4A 3V75A 3CIXA 3SCNA 1V4YA 3GAKA 1YNQA 4IT1A 4JFWA 3C56A 3QLDA 1CNVA 2VEPA 4M6VA 3D5HA 3LBOA 2CETA 3B9DA 2D3NA 3S47A 2OFJA 2QV5A 3NM1A 3WK0A 1FEAA 4M6PA 4IJRA 1YADA 4FEZA 3W2NA 2WJEA 3NZRA 4Y9PA 4KEMA 4FXSA 1N8IA 4CQDA 5LNRA 4KRUA 2VD8A 4TX8A 4XAPA 3C2FA 3IGUA 1NDAA 2HE5A 4JX6A 5BOEA 3M6YA 4DJEA 1KKOA 2GJPA 2ZUTA 1BD0A 1EGMA 1QW8A 2HBVA 2E6AA 2WQPA 2PLJA 1B0IA 3RO6A 2Z27A 1FUYA 4DPPA 4O11A 2QUMA 3LTPA 3FDKA 3BLFA 4BI5A 5KMYA 2XIOA 3M0YA 1KBKA 1N60C 1OADA 2O92A 1Y5XA 3DHUA 3RCYA 3HQNA 1AQMA 5FS8A 2BGNE 2EG6A 2PMQA 3Q4DA 3U5YA 1RY0A 2HQMA 2EHHA 2V63A 3C2EA 4GY0A 1IT8A 5AVHA 2OLHA 2X7VA 3O15A 4HZ7A 3N34A 1M03A 1Z3NA 3GNOA 4O1CA 1HZYA 1BKHA 2CZVA 3KTCA 3LRKA 1NQKA 1XW8A 8A3HA 5I07A 3ARRA 4BS0A 3W76A 5E0CA 2ZRWA 3GDRA 4W9TA 1H11A 2XUCA 3FW6A 2F6KA 5F2MA 2WMIB 3EDJA 2XIIA 4FK9A 4ZQPA 4PEKA 4I3GA 1KM0A 1EEXA 1H7RA 3GNNA 1DJHA 5I3KA 3O6DA 4UCGA 1XYCA 2GVGA 4QM1A 3URHA 3ABRA 1VBGA 3P0XA 3BLLA 1KGWA 3O0FA 4JTDA 1LZOA 1JDDA 3VILA 2VVNA 2E1DA 3WQEA 1JCMP 2FPTA 5I3JA 5JIWA 3M0ZA 2F38A 3WF4A 1JUEA 1W8GA 3GW3A 4LWWA 1UZHA 2PDGA 4DAFA 5ABHA 2FTPA 3N3TA 1J0ZA 3WQVA 4HOZA 4NQ1A 1MDLA 1FX6A 2DT2A 3QTPA 4HGXA 5E6ZA 3ZQ9A 3CM4A 3DFYA 3CMGA 2EO7A 5CPQA 4A3QA 1P43A 1TZ7A 3WQ5A 7TAAA 3NCOA 3QGKC 4KBXA 2YDSA 3TCSA 1W8SA 3NXLA 3SUUA 2ZZ5A 3O1NA 5CCZA 2DUAA 4YTRA 2D3LA 3IK4A 1A5UA 3A3WA 1DWFM 3I65A 5AYZA 4U2YA 4ZQNA 4NP7A 2G96A 3P61A 4APNA 5EPDA 3LERA 5KZ6A 4H4TA 1XV8A 3FJ4A 1FWGC 1UROA 1S7MA 4NZCA 4PMZA 3AXMA 3MYPA 4OV4A 3TONA 3WD0A 4A3RA 3KOXA 1KM5A 2YOCA 3SECA 3I3EA 3TWAA 5E09A 4UBPC 4GYPC 3W84A 4BJHA 1CEOA 3EXSA 4RDZA 3DX5A 3CIWA 1HXJA 2WLYA 1F6PA 3PBVA 4AF0B 4AZ6A 4HA4A 2Y24A 1H41A 1V3MA 4J3VA 1KD0A 1E4MM 3S1UA 3V36A 1EXPA 1S5NA 4IG2A 9XIMA 2OKTA 1F3EA 3B03A 1QXLA 3NOEA 2G3IA 1K9FA 5L9FA 1DE6A 4E2VA 2CBIA 4NG3A 1N7KA 1Q7ZA 1E72M 3WBAA 1R7OA 4MGGA 3WL1A 3BPWA 1W9DM 2NT0A 3P84A 2DY3A 1XXXA 2ZYFA 1WKFA 1AD4A 3G1AA 3NDOA 1K7XA 4WK9A 3E96A 1H51A 1LRQA 3A22A 2DZBA 4HMNA 2RHGA 1UD8A 1EQPA 4N7QA 1M6JA 2B7PA 3H8AA 4WF7A 1EJSC 1JPHA 1O5RA 2E28A 3VOCA 2FPYA 3EX2A 2Z1XA 5JBFA 4L6HA 4M5PA 1PIGA 3KL5A 4FXRA 1F61A 1K8YA 3LQLA 2G3FA 3PUDA 2F6UA 2HWGA 4TIMA 3G1DA 2WMIA 5EFDA 5LZLA 1B3WA 3SFWA 3IV3A 4Q22A 3VI2A 3E0IA 1TX0A 3FIGA 1JYNA 3PC0A 5FF3A 3NEHA 2PDCA 4KWSA 1UKSA 3BJTA 1MW3A 4UNIA 4LNYA 4ZOEA 4YWOA 3GC2A 4OWGA 4EOUA 3BARA 1LBMA 4G5DA 3CPRA 4KGLA 3GNPA 4ACZB 1JJKA 5IOBA 4JS3A 1WQ5A 4IM4A 2J8GA 3CEUA 2XSBA 4CD4A 1KCLA 3E5PA 2WZEA 5U4NA 1EC8A 2D2JA 2FMNA 1WOBA 2ZOXA 3FYPA 1D7FA 5BU9A 5GJNA 3N6JA 1B4EA 1KFEA 1XIGA 3IUHA 1K4HA 3GXMA 4LJ3A 1TKKA 3TN4A 2AAAA 3W6LA 1JL8A 1MRAA 1D9EA 1QU4A 1IWPA 4GIAA 2HMCA 4GI9A 3DFHA 3HPAA 1IEXA 2DT0A 3VIKA 5CJMA 1OFDA 1N5XA 4QROA 4W7UA 1R2RA 5C0QA 1UW9A 3E0FA 4NZFA 4CGTA 1TRDA 3EBVA 2JQXA 4KRTA 3WDHA 1DJYA 4P7QA 2BODX 3AU2A 1EXBA 3DGHA 2CDUA 3TV8A 2WJFA 1QHZA 4AF0A 5HMEA 5C9RA 1WNOA 4MZYA 3FKKA 4S2BA 3VKDA 4DO7A 2BOFX 1X38A 1VEPA 2WWDA 4PSRA 2QCGA 4PMRA 1THFD 3N3MA 3QGVA 1JVNA 4P5UA 1FFUC 1MMFA 1VDVA 4HHHA 4Q8UA 3GXTA 2V30A 1BVNP 1FQ0A 4J5NA 3BLDA 2QVNA 1QO5A 1BKSA 3F4CA 2CLHA 2PP1A 4S3BA 4UIOA 2NUYA 3EX3A 3B4UA 5EU9A 4B2DA 4J3ZA 4NI8A 3V1PA 4CNSA 4CN4A 5KITA 4HA1A 3WH8A 1KWKA 5A6BA 3UT0A 2HROA 4LCSA 1TV5A 1GEHA 2BVWA 4D8ZA 4UFIA 2JFEX 3SM0A 2ZX8A 2QPUA 3CUIA 4DO6A 4KT2A 4B16A 2FZBA 3UGVA 2FTYA 3QHMA 4IZGA 2Y8UA 3AHVA 1LORA 1ODZA 1M5WA 2YSWA 3OJGA 3F4NA 3U5UA 3LHYA 4RV3A 4UFHA 1Z42A 1TPB1 2MNRA 4AAJA 5F1VA 4TV6A 4PCSA 1CXFA 3OYXA 3EWDA 4U2ZA 3DFPA 3AMLA 5FKYA 2ACSA 1J2BA 2DVTA 2J47A 4H2CA 1PVNA 1TWIA 2HK1A 1Y5VA 4WDTA 5C9UA 4TX9A 4NX0A 4L80A 4JTLA 1NOWA 1W3HA 3WF2A 4F2BA 3CTTA 1JFXA 1LJYA 1R3TA 4FNUA 3CMFA 1QOXA 1GKQA 1A50A 3ZR5A 2YJQA 2PRLA 2Y7GA 3AS1A 3NL3A 3SCOA 2DH3A 4GC4A 7XIMA 1JG9A 3DBNA 5ABGA 4NXKA 3IWPA 3TX9A 3SGZA 2PA6A 2V82A 1W1IE 3II4A 4L9XA 4I5RA 1EKOA 1UR4A 3PZQA 2W61A 4NAEB 1UR2A 4N9EA 1YDVA 7ODCA 2FZNA 2OEMA 4J40A 1DIOA 2F7FA 3C2OA 1PPIA 3VU2A 4K7ZA 1M7XA 2IPWA 2JF7A 1RR2A 2XGZA 3SCVA 4M6QA 2WMJA 1SZFA 1FHVA 3VNIA 3E0VA 4K6AA 3MA8A 4H7ZA 3AOFA 4B15A 4E4FA 1C8YA 1CXIA 3VIPA 2JBMA 2HV5A 3GRSA 1GVFA 1QK0A 2X2GA 3LI0A 1XIIA 1T96A 4AXNA 4PCNA 1F73A 4L1WA 3MU7A 3DIPA 1GG0A 3G1VA 2BXZA 2CIPA 2VRJA 5LNWA 3E3HA 4O13A 3L0GA 4EWJA 4NJJA 3EA3A 1W17A 1T40A 3W9ZA 4IGHA 2D0FA 4D1IA 4D6HA 3R25A 3R2GA 4GX8A 2ZZ3A 1W3JA 5JCKA 1QI3A 5CZ0A 2CCRA 3L4XA 3N04A 4B3KA 4DNHA 2OSXA 5HJYA 1AOGA 2CXEA 1GOQA 3STCA 4BI6A 4M7SA 4YPJA 1XD0A 4Q8PA 2YB4A 2I1OA 3QZ6A 1JFHA 1LVLA 1NP0A 2OWXA 1W5OA 4PBFA 2DW7A 5M2FX 1K9EA 2BHUA 4UTHA 3FAWA 1JZ2A 1O12A 3R6IA 4MAZA 5A95A 2JEQA 4JTGA 3WQFA 5EMYA 4ZL1A 2QAEA 4J3WA 2J7HA 3W3OA 1TPC1 2SFPA 3BZGA 3VAVA 1LLOA 4HPHA 1ECEA 4PYSA 4RZ4A 3DFQA 1V3JA 3O0KA 1UG6A 2E5DA 1WAWA 1BYBA 4B92A 3IIZA 1MRQA 4PODA 4C5ZA 1SW0A 2YL5A 2NVAA 2BOGX 5CSRA 2ISFA 4JFVA 1F6KA 3JS3A 2EG8A 3EX4A 4ZQMA 3L2IA 3GTHA 2RGLA 4DLMA 1RZMA 5D8ZA 4AEEA 1YNPA 2NXHA 2VI0A 4HZ8A 1E71M 3TP4A 2XN1A 3DC8A 3U2OA 2PI6A 1KTCA 2CFFA 1VENA 4Z2KA 4XUGA 1MQPA 3GNRA 3VFLA 4J4KA 4Q4RA 5J5DA 1M04A 3OHIA 2ISVA 4IUGA 3DI0A 3GWQA 1UWTA 1OYBA 3W70A 4JY8A 4X9YA 3D0CA 1RCQA 1XSIA 4NAEA 1OQFA 3SRFA 1E51A 2DUZA 3MQTA 3EEZA 3R10A 1DHPA 2ZC1A 4MY8A 1V59A 5BNKA 4DM2A 3RU6A 4AYSA 4HNLA 4HU8A 4O0KA 1VZWA 1A5NC 1X8FA 4XO6A 4Z1BA 3E02A 1WDQA 1XH2A 3H4KA 1ZCOA 1B31A 3ZIZA 3M9YA 3LMYA 2IKJA 3NDYA 3C2VA 1VAHA 2OX1A 3VIGA 2VFIA 4MB1A 3GG1A 4JTQA 2AGTA 4GNJA 1L6GA 4TMCA 4KIRA 1GVOA 1XSJA 4Y96A 4RX0A 1MXGA 2HXUA 4MUPA 3SY1A 3T0TA 5D05A 1KXVA 3BXWA 3M07A 1G67A 1WB0A 1NVMA 3QHOA 3QFEA 4LF2A 1GOOA 4GIRA 4AIEA 3DESA 2WNQA 2VFDA 3A3XA 1TJRA 2AL1A 3P5YA 3VOGA 3W6YA 1EJWC 3WD1A 1FWFC 1CXHA 1NJJA 4O16A 1J96A 3WYZA 1I4NA 3K4AA 3ARYA 1JEZA 3E0WA 3L9CA 3LN3A 4GIEA 4C6OA 1H0GA 3MSGA 1H50A 2FIQA 3C8FA 3WNKA 1SR9A 1BTCA 1FXPA 3EYPA 1J12A 9XIAA 2YL8A 3E49A 1EC7A 4G8TA 1X1ZA 1YDOA 4MIMA 3VX1A 4OUIA 4LEFA 4IMAA 4UTFA 3AXHA 3G1SA 1Z89A 3VK5A 4M8UA 3WQDA 3NQDA 3W1UA 4AD5A 3K5XA 4B9ZA 3TSBA 1KC7A 1PB0A 1S5VA 5D9OA 1W32A 4FP1A 4I90A 4FS9A 4FLRA 1XISA 4W5ZA 4GFIA 5G2HA 4D1JA 1JZ8A 4FNQA 3L2MA 1G4SA 5K9DA 4D6DA 3L0KA 1R38A 4OFCA 3DFSA 1P0EA 2VRQA 5U1OA 2PPGA 3AISA 3M46A 5XINA 1RA5A 3KAOA 2X1TA 1RA0A 5FF0A 3FY1A 1XR2A 3II1A 4DWSC 4ZXOA 1J0YA 1HIZA 2Z6IA 1E4NA 3CPGA 2F9RA 2X40A 4IX0A 3WG6A 2XINA 2O4MA 3CXOA 4NU7A 1JUKA 2ZZ0A 1W9VA 4Q8WA 1M3UA 4ZQOA 4OBSA 3LU2A 1J0JA 1S2VA 5IRPA 3G1HA 2VCBA 1JZ7A 3HN3A 4ATWA 4AD0A 5ABEA 1V93A 1GRGA 4ZFMA 2XSAA 5AKQA 5AFDA 2E67A 1KBJA 4HMCA 1KGUA 3KZSA 1S5TA 3OA3A 5D2YA 2DZXA 1C9DA 3MCMA 3HA1A 1E6NA 4H9MA 1B5TA 1DXLA 4F0RA 1L8NA 5CZTA 5DEZA 4PB4A 3GM8A 3AS3A 3WK2A 4NJKA 4C6JA 1L2UA 3IJDA 4AIOA 2CHOA 4M0XA 4QDMA 3UYIA 1QJWA 3HV9A 2QCNA 4WSJA 2WBKA 3CQIA 1YPFA 3CTLA 3A64A 2J8TA 3GG8A 4NJIA 3M64A 3GFXA 1JQXA 4XTDA 3KRSA 2WWCA 2NV2A 4LCRA 4IXHA 4UQAA 4OE7A 1HGWA 2VFFA 1J10A 1U1UA 2CHRA 3E12A 2VR5A 4BQ3A 2OKOA 1FWJC 1UD4A 3BDKA 1K6WA 3STPA 3VIMA 4KWOA 4I6KA 3TN5A 3WMSA 4F66A 1AH3A 4FDCB 2PAJA 3VD4A 4KETA 1CZ1A 1FVPA 2AKMA 4XK2A 2R9ZA 1HKVA 4A8RA 3CO4A 1ZUAX 1UA3A 1UOKA 1TUFA 3CHEA 4XVEA 1XCWA 2EQ6A 1NF0A 2PE4A 1T8XA 3OZOA 4CU7A 4WR3A 2EG7A 4K7YA 3B9AA 4C65A 2VUNA 4MNMA 3RHGA 3B8VA 2ADAA 3L4ZA 4LY4A 2FGLA 1F4HA 2D24A 3TXZA 1PE1A 4EX4A 1UWRA 4R5EA 5A8MA 3QW3A 5IFTA 3A3HA 3RDKA 3TSDA 2XZ9A 3BAIA 1TV8A 1XLMA 4AEFA 3IIOA 2QUUA 4EIVA 1G7VA 4XKYB 1ONWA 1A49A 4Y7EA 4XX6A 3UG5A 3LSCA 5FJOA 2ZFAA 3N15A 3OG3A 1FWBC 2F2KA 3TYZA 5EBAA 3MJMA 1Q2SA 2NVKX 1E0VA 3W1XA 3MUAA 2Z1BA 1GERA 1PIIA 1U5VA 4IPLA 1GOXA 1OY0A 1SM9A 2WZHA 3MP3A 4FX7A 4JTKA 1X96A 1E4IA 4V15A 1OHLA 1V7YA 2Z6JA 3F7JA 3QPEA 3N73A 4GC3A 4R85A 3L5LA 4O0ZA 1N61C 1ENUA 1CXKA 3HPFA 1IEWA 5DRIA 1F3WA 2PB1A 2W6RA 3EB2A 4JDRA 3MC5A 5DQPA 1GKPA 2HJPA 3L65A 1PIFA 3LCIA 4UB9A 2YBTA 3WLKX 5DMNA 4AYGA 4GVHA 3UCDA 6XIAA 4IQJA 1FCBA 2ESCA 2J88A 5I2UA 3OW1A 3W83A 2QAFA 1W3KA 1R3YA 4M29A 4M80A 2OX4A 4ML4A 1C90A 3VGBA 3H54A 3WDJA 3NURA 3K8LA 2YCLB 1LCOA 1KM1A 2FPVA 3TE9A 4O17A 1S2TA 2WHLA 1F3XA 3WEMA 3QJAA 3W7PA 2INFA 1LL4A 1E9LA 3FHAA 3N9SA 4IPNB 3C6CA 3OP2A 1L6WA 2WKGA 2ZXDA 4S2CA 1AMKA 4NUWA 4PL2A 2A1YA 3NQ6A 3VCNA 2FGZA 1C8XA 3UQNA 3L0NA 4O15A 4JIQA 4O4WA 2DORA 4XD4A 1K6AA 4RUBA 4C6QA 1GETA 2IW0A 4BZYA 5HMFA 4GHRA 1FKWA 1QWKA 3R07C 5DXXA 3QV9A 4GUFA 2CLEA 3CL6A 1SSDA 4W4QA 2B31A 1KV8A 4DZ5A 3D9XA 1XLFA 4YVVA 1SSGA 4PMYA 4IFOA 2GJXB 1XQKA 3KP0A 3NUKA 2PUZA 1XYZA 4NI3A 3WFLA 3WJSA 2GK1B 4E3VA 3GU2A 1G5AA 3PZMA 3ZT7A 2ZA3A 1G4TA 2P0OA 2VYOA 4XKYA 1A4LA 4K1GA 3SIMA 4OHQA 4EE9A 3TQVA 5KZMA 2HCVA 2G50A 4GUGA 4OT7A 2HXTA 4IIFA 3LEPA 1KCKA 1F7BA 4O1EA 2Q8XA 5A6MA 3STFA 5A6LA 2GOKA 1EHNA 3IJ6A 1W1VA 5G5HB 1LROA 3KWXA 1KBIA 3GQYA 2WPFA 1L9WA 4LBRA 1ESWA 2PDJA 1N55A 1NAL1 3QY6A 4CNPA 2Z24A 5LXXA 3V3WA 3AYTA 5LGZA 3L21A 3MO4A 2CBVA 3OC4A 4AVNA 2V5LA 1A4MA 3AU6A 5LIWX 1W3NA 3RLHA 1R85A 3WFZA 3Q67A 2NVCA 3KUMA 3PAOA 1FH7A 4N9DA 5C2XA 2J4GA 1EDGA 4H9UA 4PB5A 4ZOBA 1LOQA 4I7UA 3GTFA 3GKFA 4DJFA 3O8AA 4RXGA 1RBLA 1TQXA 1MXSA 4DF2A 3CGTA 4R9OA 2GZXA 1CDGA 3N2TA 3N4AA 3M47A 1ITQA 1PWLA 1TIWA 1W1A1 3M5YA 4QG6A 3PR2A 2R1PA 3UJSA 2BHZA 4S23A 2LLEA 4AC1X 4LC8A 5AHMA 4JL2A 4AX6A 1M7PA 1BWLA 1ZJIA 4ZCWA 2FHCA 2PDNA 2ZCGA 2J6VA 1O7AA 2OZ0A 3SCSA 4NJHA 2YCLA 3APYA 2CLIA 2DGAA 2Y5JA 4U33A 1UR0A 1BVWA 4MADA 4MKSA 4DYEA 4M6UA 1GJUA 1BFNA 2VX4A 2UWFA 3A5VA 4ZGYA 4C6IA 3ABZA 5C71A 2PFHA 1E0TA 3VIIA 4UTLA 4QIUA 4G1NA 5LXEA 1TJ1A 1W0MA 1I2NA 2J75A 4P7RA 3C0QA 1HO4A 4AVOA 5DXYA 4DVOA 3GD4A 3LMZA 3CPUA 2NT1A 1PX3A 1OWQA 3S5ZA 4YXGA 4D6GA 2ZRXA 5B80A 4L9ZA 4C6FA 1RK5A 3DUGA 3H2CA 1I6NA 3CC1A 5TBOA 4K1WA 2A5HA 5I78A 5LIUX 2OCZA 3FEMA 3KWSA 1FXQA 3PTQA 4DNMA 2JGQA 5HMSA 2ZBTA 2RFGA 3TJ4A 1RVKA 2VUYA 2ODOA 4EMWA 2GJXA 2QPXA 3N4FA 2ACRA 5EY5A 4F9JA 2ZC8A 2ZXBA 1H5VA 2GK1A 1CCWB 2CZEA 2IMRA 3VDHA 3RM9A 1GORA 3EWXA 2EPMX 2Z2BA 1GEUA 1HO1A 4I8YA 5FAJA 3MI6A 5HNRA 4NEWA 5KSWA 1GWJA 5DCBA 1GRBA 1XLKA 4XSMA 3UU0A 3ZWTA 3ANUA 5FI8A 4C60A 1C7TA 1NDVA 3PJUA 4TMBA 4H9YA 5BWAA 4M52A 1IR1A 4UR8A 2QGYA 4HHPA 2I57A 4GPNA 1ALDA 3UWUA 2VDHA 3CZGA 4M7TA 1J79A 3T7VA 4UTIA 2PGRA 2OTDA 3W86A 1QATA 2X09A 2PWFA 1F3PA 4DUOA 4IL2A 3SUVA 3K2GA 2I5IA 2ZUMA 1B9BA 1OCJA 3QEZA 4U5KA 1XBXA 4QLLA 3NPVA 3HMJG 4ZOCA 1V02E 3KVJA 1YLVA 3NOYA 4UFKA 1VFOA 1XICA 3H12A 1FP8A 4PCPA 2Y8KA 4CNNA 3O6CA 3P2VA 3B06A 4GI4A 1ITCA 4XAFA 5I02A 1GVIA 1VCGA 1K7FA 4GUIA 4AWTA 3MWCA 4H6RA 2WK2A 4MB3A 2IKHA 1DWAM 1OCNA 2AQOA 5TD4A 3KRBA 1U5HA 1TZ9A 1E40A 4HP5A 3NJ3A 3HBLA 3SAZA 5ENLA 3RX2A 3QMRA 1F8IA 3GR4A 1K8XA 1DBTA 1E1CB 3B97A 1H7NA 3TUUA 2PZ0A 2NXGA 1IZKA 2XFRA 5HANA 1EWEA 5SWUA 4M24A 2PWHA 4H4PA 4ACYA 1NWSA 1ICPA 2Y62A 4DJED 2AKZA 1MVYA 5C7HA 4XIMA 4ZENA 3NVZB 3CV6A 4ZO8A 2IS7A 1K03A 3ARVA 3GDLA 1TTIA 2Y63A 1C29A 1CBGA 1N8FA 1XUZA 4DJDA 2Z29A 1DXFA 3CT7A 1J0KA 4NZ1A 8CGTA 5MHBA 5BXSA 1BVZA 2DZUA 3VMPA 3LS9A 1Q13A 2DVUA 4WJXA 3UXIA 3L67A 2D73A 1EC9A 3XINA 4WZHA 5F4XA 4R3UA 4B3LA 1KM3A 1B3ZA 1ZY9A 3A13A 3I68A 2NV9A 3AMZA 4HK5A 1FY6A 1C92A 3JVAA 5BROA 3ETRB 3URQA 2XPKA 1GYNA 3S2CA 1UPPA 4HK6A 1TB3A 4IPPA 3N29A 2JK2A 3FHQA 3LBCA 1ZY8A 5F2GA 4ZQRA 3ARQA 1D8WA 3NAVA 4WRHA 3NGJA 1CYGA 5BMWA 3HQOA 1KW1A 2B0MA 2VCCA 4N6EA 2O56A 4U4MA 4H04A 4QX4A 5DCDA 2W3SA 4AHOA 5BMXA 3SUWA 3LB8A 3VDCA 5LNSA 3FN9A 4HNVA 3T0DA 3NVWB 3IJIA 1WBJA 4K8DA 1XIMA 3USZA 5CG0A 2WM1A 2YGYA 3MJYA 3L23A 4E5TA 2E68A 4JICA 5CC6A 2VC5A 3KM8A 2ZE3A 2FB2A 3RMJA 4JOMA 3AUJA 2VFGA 1HP5A 4KS0A 2GFTA 3FSUA 3WMBA 4XSLA 1RQEA 3BO9A 4ZOAA 2E9LA 3R5EA 2BV9A 4Q4KA 3CUXA 3GVGA 5HINA 3L5MA 4IIGA 1IR2A 5EGRA 3S2NA 1O1HA 3KXQA 1YXDA 4DWDA 3BICA 4PUKA 1CGWA 3TTOA 3AIQA 3FA4A 1JULA 4IJCA 1J6OA 1F3TA 2XN0A 1GJWA 3PTDA 3Q45A 4PMNA 4P8WA 1FWDC 2GGIA 3U2ZA 4S3CA 3MANA 3G0SA 3RITA 2FZDA 3AALA 1T5AA 5CGTA 1TWSA 1FWIC 1TWZA 3RRAA 2PDHA 2X99A 2A79A 3CJPA 4WXYA 3UWZA 1E1CA 1PCKA 5D03A 3VABA 3DGZA 2EPOA 4PMOA 3ARZA 2AAMA 2NWSA 2Z28A 1IV8A 2EKCA 1K9TA 4AY1A 4JIIX 3PBWA 3G0XA 3OZYA 1QK2A 1X98A 2VENA 4JFUA 1TX2A 1W54A 3PHAA 4KFOA 3CXBA 4I8DA 3MMTA 3EZ4A 1G1YA 3NPUA 4WEVX 2GH5A 3QH2A 5H8MA 3WUGA 5HOSA 4G6CA 4FOUA 3T4CA 3O16A 3QFBA 2Z0IA 4YYCA 1QW9A 2W67A 1BWVA 3MY9A 5BWFA 5A2CA 1TE1A 4RCXA 1RCOB 5E70A 9CGTA 2C3DA 1UQZA 2BGQA 3CMJA 1ZP4A 4MUZA 3U3HA 4CQ8A 3KCOA 3WIJA 4KEVA 3HQ1A 3CHCA 2HS6A 3ONBA 2QJHA 3KOWA 4TTUA 3GAYA 5I0DA 3VGDA 4D8AA 5CC3A 2P8BA 5T26A 3THAA 5I09A 1RP9A 2DIJA 4ILSA 4YTQA 4EKJA 3PB2A 4IGNA 4ZB0A 2X0HA 1UKQA 2QCLA 2WSYA 4IP7A 1EHAA 1NP2A 3VX0A 3ITTA 2PU1A 1WOAA 3ZJ8A 1P48A 4RE2A 2DZTA 3NQVA 3R13A 4QG9A 3TFXA 2YQUA 5FSEC 3O63A 4IQEA 2YW4A 4LYPA 3LTSA 1ZSXA 2XH0A 2QT3A 4J2MA 3AJXA 3F5KA 3WZ0E 4G1KA 3BQ6A 1EJ7L 3VDGA 1T99A 3H7VA 4O28A 3O0HA 1W3LA 3ZLGA 2HPIA 3ES8A 2EKGA 4LAZA 3WFAA 2G4JA 2H6RA 3PP7A 3UJEA 5JU6A 3M44A 5M03A 2GSHA 4IHCA 1K4GA 2GGEA 4HCHA 4LT9A 1QUMA 3C2RA 4XAYA 5TIMA 3C86A 4I9TA 3Q65A 3AMKA 4MJ4A 4PCTA 5HXMA 4QE4A 2WOQA 2YDQA 5JBEA 2HS8A 3W72A 4XZMX 3D3FA 2VDIA 3PM6A 4HNUA 2WMHA 1F9CA 1DQWA 2V3BA 3LD5A 1TPVA 4NKCA 3ZJ7A 4JZ5A 3PPFA 5T91A 3P93A 4GQGA 3T2QA 3P81A 1JGMA 2NQ5A 3O6YX 5CLTA 5F2LA 1OABA 4CD7A 2WHJA 1UBSA 3C61A 4ICNA 1JXJA 1Q6EA 1FCQA 5FS6A 2PCQA 3Q94A 4GD0A 2YYUA 1VFTA 2OB3A 1WDSA 2BP1A 3IIPA 1ONRA 2D69A 1VPXA 1V3KA 4HSHA 4U31A 3IACA 1TO3A 3H26A 1R6WA 2V5DA 1XJBA 4E4PA 4M19A 1UZDA 2G41A 5D37A 1GOIA 3LHUA 3AI0A 1XYMA 1EZWA 2VGGA 4ES4A 3TR2A 3GG7A 4QE1A 4NVTA 3DK9A 4JIRA 3CZLA 1AZ1A 1K8CA 3DK8A 2OVLA 1IXNA 4IMEA 1GRHA 4FPSA 3OBKA 3KE0A 5CXPA 3EOLA 5DANA 4JBRA 1K8ZA 1AZ2A 2A85A 2WMGA 1UD2A 3B0VC 4J2PA 1OFAA 4BWLA 3CGEA 1TREA 1XIDA 3M0IA 4QEEA 1EFZA 2EF9A 3K30A 3E2SA 3LPOA 2I5GA 4OJYA 1Q5MA 2DSUA 1S3TC 4QRNA 3CU2A 4B2DD 2KZHA 2NPXA 1V8EA 2HVNA 1AJ0A 3ARXA 1CGXA 2VMFA 3RFAA 3BAJA 5A6BD 1XLBA 3TDFA 2A3AA 3N14A 4ZTXA 1B3XA 2GJRA 1ZBKA 5EFFA 4O19A 2Y7FA 3UF9A 3LI1A 2XIJA 2GQAA 1JAEA 3DH7A 3W7LA 1GRFA 1BEUA 5DN1A 4D6IA 1L6YA 1ONXA 1JRPA 3O06A 5JCLA 4Z1AA 1JGIA 2PBGA 1XS2A 2ACQA 3O2LA 2Y85A 2CLOA 2CPUA 5I3GA 3DFNA 3FX4A 3HFTA 1ME7A 3F03K 5DFAA 3VD7A 1F8MA 3JU2A 2GJLA 1OBAA 3BGAA 1XPYA 3MSYA 2W55A 3ZWSA 3TSMA 4JTIA 1Z9AA 4FZIA 1V6UA 1R2TA 3B05A 1UKTA 2WSQA 2C0AA 2BB0A 4LQ1A 3WH6A 1P0DA 3MMDA 3QMTA 1OIFA 3IJQA 4KFPA 3AYRA 1YBQA 1XWYA 5B7YA 1V02A 4A21A 4ZB2A 4LUSB 1IE7C 3NQAA 3LENA 2QUNA 4ICCX 2RABA 2H9AB 3WEZA 4DXVA 2V69A 3CL8A 5AVNA 3HGJA 1TWWA 4GE8A 3TA9A 2QULA 1P6CA 2WCAA 1S2UA 3TWBA 2G3JA 1ZJHA 3RMEA 1ZGDA 4QLJA 5LHFA 5FA5A 4RE3A 4FA3A 1OT1A 1SVDA 4PL1A 1TCDA 5LNVA 3DGRA 1XLEA 1Z48A 2QF7A 3SEPA 1IIHA 3S9IA 2HQAA 5HQEA 4GFSA 3RPMA 4C6PA 5KEZA 4PSPA 3DERA 6ALDA 3MZNA 1Z44A 3MS8A 2VX7A 2PDKA 1DWIM 1HGYA 4JYEA 3NM3A 3W7JA 3GS6A 2ZXQA 1IXOA 2XWDA 3F4WA 4B5XA 3RPTA 5IM51 3TNBA 4Z17A 2WSKA 4ERAA 5F2IA 1WUEA 3CT2A 2PWDA 1TWDA 2C14A 2J8FA 2NQLA 4KWWA 3M16A 4B9YA 3W1QA 2BXYA 3TMQA 3ZT5A 4TO8A 4NT0A 3WNLA 1KFBA 2QKFA 1YE6A 1HKJA 1N8WA 4LA1A 3WELA 4JTEA 4BF9A 1TRIA 4GYKA 5HUPA 1GSNA 1LOSA 3W73A 1B30A 4KEUA 4Y9OA 4FNSA 4C7FA 4R88A 2A6LA 1EF3A 2Y1HA 1GRTA 5BRBA 4IOTA 3M0KA 4HPNA 3UA3A 4LUYA 4F0MA 4CVUA 2Q71A 1FCUA 4YJ5A 2BVDA 4AISA 5L6UA 1ADSA 5A8QA 4X63A 3DI1A 3QSRA 1XIFA 1TUXA 5I6SA 2VGIA 5G2IA 4XZNX 1RP8A 4JCLA 4OTKA 2D20A 3VIOA 2PGFA 1XH1A 5HUOA 4WIWA 5H1WA 3N12A 4ML9A 4NHVA 1MXDA 1Z8AA 4W85A 1KA9F 5HNTA 5JCNA 1SO4A 3WF3A 5CZJA 2XH2A 3NQ8A 1XFCA 3WD2A 3UR8A 1YW1A 3BW2A 1VEMA 3V18A 4KCTA 3H4WA 1CLKA 3NL2A 4MKNA 4PMDA 4JPGA 1KFJA 1E5NA 4JQ4A 3NR0A 3TIMA 5I3DA 4MTVA 1KLYA 1XLGA 3HV8A 5M5DA 3HIJA 1C93A 3IAQA 3RG6A 1JD9A 5D2VA 1W1ZA 1XYLA 3V35A 1NPXA 1VHCA 1H1NA 3BV4A 3R8HA 3FFSA 4LUSA 3UWVA 2CWNA 4C6KA 5GJPA 1BQGA 3KHDA 2WZIA 3KTSA 2H9AA 4PTVA 1QOPA 4FX9A 3K8KA 4LVAA 4NILA 4WDWA 4LAUA 3UJ2A 2IPGA 3KBWA 1QO2A 1OF8A 4ORMA 1D7YA 2OGYA 7CGTA 2VEIA 3PWAA 2YXOA 2ZDRA 2DSWA 4YTUA 4AZ5A 1CECA 5LA2A 2VC7A 4AZCB 5FCZA 3BOLA 1Z7AA 1FKXA 3M41A 4AWEA 2DU2A 2ASHA 4L4MA 2Q8LA 3W7HA 2UY4A 4MM1A 3C0LA 4RE4A 1CLVA 2FLIA 3PK7A 4Z08A 1Q6CA 1UCWA 5FS7A 4L1GA 1RLCL 1XH0A 3CBWA 4YIWA 2YYTA 3QM3A 3EKLA 1VRXA 1GJPA 1PCWA 4WKFA 1G01A 4MWAE 1M65A 4M1RA 3W07A 4H2HA 9RUBA 5JXQA 2VFHA 1KFWA 2ZADA 4O1DA 5K2ZA 4PTDA 5HA7A 1WP6A 5E0KA 2OZTA 2QDDA 1P5BA 1JDCA 3NYZA 4P2VA 2NSXA 3HQPA 3THQA 3WN6A 4AH7A 3EXTA 4JNMA 4CN1A 4GUHA 4MY9A 2VWTA 2YA1A 4GGHA 4WCJA 4DLFA 3TW9A 4RPPA 1E6PA 1MFVA 1KFLA 3EOUA 4C6EA 1UD6A 1M68A 4HZMA 2OOGA 1QPQA 2V3AA 1LLZA 4CU8A 4OOZA 2PWGA 3NO1A 3T81A 3VNJA 4WY0F 1UD3A 3SO7A 3U48A 1NH6A 2ONEA 4PFMA 3KTXA 1GW1A 3LCGA 4QNEA 4L9YA 1OX5A 3KVMA 4IQLA 5C2CA 4GVIA 3VIHA 1IEVA 2WZTA 2O9TA 4X2PA 4RNIA 1QI5A 2J74A 2JKEA 4RDYA 2CZDA 4A05A 4PC8A 5I79A 4PGLA 3S83A 4FAMA 4RZ5A 4H50A 3F4DA 3GK0A 3RM8A 5GQBA 1Q3NA 3FVDA 2Y7EA 4QLKA 3OYZA 1VS1A 5A94A 4Z0JA 1E0XA 1XLAA 2FFCA 3LCHA 3RPDA 4I7VA 1W3TA 2E5CA 4WSHA 3AXIA 3WEOA 1IWBA 4INFA 3WNPA 4FXJA 4H6EA 2R91A 2QAPA 3U9IA 2VOMA 3SCWA 1Q2RA 4HB7A 4F9DA 1O94A 2Q01A 1NWRA 1S46A 2PDQA 3K1DA 2IUZA 1EPVA 3BUVA 3G0UA 3PG8A 5DT7A 3UA4A 3W1RA 1R3QA 4UOZA 3G6LA 3LRLA 1HT6A 4PFHA 4TVYA 4B4HA 5CZSA 3TA6A 1GHRA 2DH2A 3M7SA 1QRQA 3KFTA 1IZJA 1QTWA 4XD3A 4EQWA 3JR2A 2TPSA 3G1XA 1KQZA 4NRSA 2HTMA 2WQDA 4AZCA 2WVTA 3C4UA 3W7MA 5HPOA 3T08A 2WKLA 1AW1A 1GKRA 4K68A 4YS1A 3MP4A 3IGSA 4YTTA 2YAUA 4WKHA 5LIKX 5FAGA 2Y8VA 3ITYA 4W89A 3GDTA 4KWUA 5TAOA 4EF9A 5BXPA 1GV4A 2V5BA 3TYUA 4OKDA 4F48A 4UUIA 1XD1A 3BLOA 1ZTVA 1TSIA 3SGGA 3PSWA 3POCA 3FCPA 2YA2A 4A8IA 3VKJA 2AOSA 4G56A 1X1OA 2MUCA 3NVTA 3HB9A 2AGKA 3SQMA 1EX1A 2RGMA 2DIKA 5B7ZA 2BGSA 1LP6A 4K3ZA 1XLDA 5CZKA 3CASA 2XSXA 2Z00A 1GYMA 4MFEA 4PULA 4W84A 1IHIA 3F2BA 1PV8A 4DBDA 1K3UA 1LT8A 3DAQA 2BTMA 2ZE0A 4XUYA 1AH4A 1E73M 4AQLA 3UYCA 3KL0A 4G2DA 4GZJA 4L61A 1QW7A 4MPQA 3PTKA 1S2AA 2Y7DA 3VOJA 3A24A 5AYXA 3A7UA 2IPJA 1JCXA 3P82A 4AY8A 3T05A 3L2LA 4LV9A 3W01A 2QS8A 3B0YA 2A6NA 1SYTA 3E2RA 3N11A 1E9YB 4Z2HA 2NUWA 5DELA 2WCGA 3S5NA 4RDVA 2Y6ZA 3RLVA 1FWNA 4XD6A 3WK1A 3L4UA 4RW3A 4PBEA 1MO9A 4NY2A 3C2YA 4Z2JA 1DWGM 2PWVA 3AS0A 5LYRA 3P7YA 3SBFA 3IIXA 2AAQA 5RUBA 3ELFA 3DEQA 3TJLA 3WLQA 2QUTA 4ENLA 2GGGA 1CWYA 4J9JA 4HNNA 1PX8A 2C79A 1HJSA 3PG9A 4A35A 2GOUA 4CKQA 3U0HA 3G18A 3W1PA 1HJXA 4C6CA 2OQYA 4MVAA 4Q33A 5EBUA 2Y0FA 3ZYZA 3HFYA 4JQ3A 3AC0A 4IGMA 3U2CA 1L6FA 3GRIA 2QJMA 4MPKA 4Q3MA 4BURA 1R0MA 8TIMA 5DCEA 1UYQA 1T8QA 2A3CA 2DZVA 4IPIA 2OWCA 2BC1A 4XVDA 4DAIA 3LHWA 1XPGA 2GR2A 1X8CA 1UP3A 1H1YA 1U2YA 3IC9A 5DY3A 1BHGA 3ZJ6A 4Y2WA 3S5OA 3WUBA 1IQ8A 2NX1A 3VA8A 3GKAA 3UJRA 4H1ZA 4U5IA 2REQA 4ZZ9A 4O50A 1A3WA 3BAXA 4QS6A 3Q58A 4AC7C 1UC5A 5T9CE 3QTGA 5HQLA 4LH8A 3ANVA 4DUVA 4MWAB 4KMQA 4PUJA 1E1EA 2G3NA 3G22A 5H6HA 3I4KA 1RAKA 2CEQA 3P80A 4L6DA 2CKRA 4ZE5A 4WOQA 1G9HA 1DNCA 1VCFA 3KZPA 5AHLA 1YHTA 4F3HA 4UNLA 2D2GA 2WSPA 4MFDA 2X1IA 5C8BB 1VD6A 4MY1A 3RR1A 3WNOA 3WCZA 5C70A 4JIHA 1CX9A 4GYFA 1EDQA 3TW6A 4HYVA 1MQRA 4EPBC 2INEA 1CB2A 3DG7A 4EMIA 4MMWA 4NJGA 3A7RA 3NS1B 3AWOA 3CV2A 1S3HA 4S3DA 3NQGA 2OGJA 1TPDA 2WYSA 4H6KA 1YTKA 1RLDA 1ISXA 2BY1A 3LBMA 4XZHA 1DE5A 1EUAA 3T2OA 4CCZA 4J1OA 3MUCA 3S5SA 3B40A 4A3UA 3HU7A 2H3BA 3DYPA 3KVLA 4DF0A 1A53A 3UZJA 5JVLA 1ZJAA 4C6DA 4O1BA 2X8GA 1HJUA 1V79A 1YTEA 1SR0A 3W1AA 4JQ1A 2OODA 1T3QC 4MWAC 3W29A 3NQCA 5LA1A 1TVNA 2Q09A 5AC6A 1JDAA 5C55A 4IXXA 5CAHA 3GD3A 4YLWA 1MNSA 1S2CA 1XIEA 5I7GA 2J3NA 4AY7A 3ZVIA 3DG6A 3UZYA 1O5XA 1PYFA 1WZLA 1FWHC 3B9JB 5A1AA 4IG2B 4JTTA 4N02A 2QLYA 4QITA 4GXMA 3A4WA 3TN3A 4E6MA 1R30A 1H4PA 4JX4A 2PSNA 2TSYA 1RVGA 4IIHA 3LZ5A 2BVTA 1MSSA 1ADOA 2J79A 3WQOA 4ADSA 2X50A 1W1TA 4FIQA 4HOWA 3TC6A 4NZJA 2GWNA 1E1FA 2OLAA 4F0SA 4FLQA 1BYAA 1I0BA 4HHLA 1HL2A 1LM1A 1LT7A 3IVUA 1GTHA 4HHMA 1DTNA 3H2NA 1BRLB 5F7UA 2Z1VA 1UOZA 1HVXA 2OQLA 3BGJA 4H4QA 4MZ1A 1TV4A 3U7BA 3GNXA 1YPIA 2H8ZA 4NNCA 1FCVA 2V38A 2QEZA 3OLGA 3CV1A 5HWMA 4DJFD 3LV6A 4H8NA 4GNKB 1P1MA 3CWHA 2PWEA 2ZA2A 1LRNA 3KBJA 2HNHA 3SY8A 1SB3B 3R0DA 3RRXA 1B54A 3V0UA 3QYSA 4JIEA 3WKZA 3SW6A 1X1NA 3PUGA 3W25A 2ISSA 3HPXA 3LXCA 3GTXA 1SMAA 1UHVA 4MYXA 4JTFA 1OINA 2PDYA 2GLKA 4TVUA 1VFUA 4MWAA 1XUUA 2DP3A 2P0IA 3APGA 3CGCA 1XGEA 4W7VA 1ME8A 3A4XA 2I14A 4F4RA 1E0UA 1FHLA 3QC3A 2I56A 1PDZA 3PJTA 4H3DA 2EJAA 2VVSA 3NSNA 3BG3A 5K4XA 5D8WA 3SB0A 1YDNA 4EXAA 1PBGA 3N1AA 3BANA 3UCCA 4L5ZA 3K4WA 2WC4A 2PTXA 4H9ZA 4AB4A 2PP3A 1ISWA 1CGVA 3QPZA 3VIJA 1US3A 3S1VA 3FYOA 2ZRYA 1HJQA 3QRHA 3UY8A 1PZ3A 2DSVA 5CH9A 2J7CA 1E43A 1GYLA 1GVEA 3EKZA 3BCFA 3WLSA 3MMUA 4TQTA 3Q6JA 2YXGA 4YCOA 2IXUA 1ZAJA 4WXZA 3LNPA 1ZZMA 3QW4B 3QY7A 5IDZA 3UNTA 1JZ4A 2DW6A 4MF4A 3TAKA 4F8XA 4GH3A 3IPWA 3EPOA 4BEUA 3W24A 3MHGA 1V0MA 4LGXA 1GEQA 2PDUA 2IKGA 1B57A 2J9YA 3CUHA 4CQBA 1H7XA 3VMOA 2P10A 2ISDA 4B5NA 1PHQA 3VUSA 1WXYA 1SO5A 2GQWA 2ZIDA 4EQSA 2W92A 1LQ2A 1KM6A 4LUIA 1MUMA 2C3ZA 2BWGA 1JCYA 3W0KA 4C7DA 1CIUA 5I03A 4XG1A 5E93A 5BW6A 3SUTA 4DBWA 2Z2AA 3S4TA 4GUJA 3ES7A 4YN5A 1JCNA 2B7OA 2VR2A 4C91A 4WOZA 4QQ3A 5DLCA 3L4TA 3SQSA 3W7IA 4Q7NA 2EPHA 3TW7A 2XFWA 1BRLA 3BGGA 1JZ3A 3BLEA 2FKPA 2NX9A 1QI4A 2YKKA 3UXLA 3GXDA 2Z1KA 1EOKA 5D33A 3CWNA 4UTJA 1RBAA 1UJQA 1FIQB 1ZL1A 3TOPA 4BR1A 3LPFA 1EJVC 1A5AA 1B90A 2Y88A 1XBZA 2NQZA 5CSYA 3OGSA 4UQ9A 4MAVA 3T55A 3TYDA 3W71A 2QGHA 3W37A 2X0YA 2VQUA 4V28A 4CCEA 2VR4A 2GGJA 1XRSA 2Z7KA 2TYSA 3OOQA 3G3DA 4BI7A 5HNNA 5CPTA 4GYPA 4PE8A 4R7JA 3EAUA 3B3DA 1ZB5A 3PZUA 2UV8G 4ZA0A 2Z1SA 3ZLFA 3MZ2A 4D6CA 2ANUA 4JDBA 3AICA 4BA0A 1CPUA 4MOZA 3OU8A 6PTDA 4DJDD 4NXSA 1SJCA 4NZ4A 5KINA 4M81A 1T0OA 3CAWA 3URAA 3IANA 5GJMA 3W02A 1UH4A 4GBDA 1J0IA 1KXQA 4B5TA 1BLIA 3BAWA 3IJ8A 5A6TC 2C7FA 1UB3A 3UETA 5K9CA 4PEEA 2CC0A 3MW7A 3BAYA 4B90A 4GCAA 1GZ1A 3D6NA 4EM3A 2J13A 2VHLA 2GSEA 4R34A 1E6QM 3MO7A 3O6AA 2UY2A 4DBSA 4UNKA 3GDKA 1EIBA 4UQBA 3R43A 1XLJA 3PVFA 1U22A 4HQVA 2ZWZA 1XDJA 3MKCA 4CNTA 4PCFA 3EEGA 1QOQA 3RJXA 2GGHA 3L8KA 1R3WA 3FOKA 4AUBA 4WUIA 3THCA 5EMKA 5M17A 2DUXA 4W8BA 3EOSA 1M9HA 3GTNA 3BJFA 2OT1A 1M1BA 4AD1A 3COTA 3VUPA 1GOKA 4IICA 5D2TA 4W5UA 5HR6A 1EEPA 3VM5A 4EAMA 5EMLA 2OT0A 4LW7A 1SZNA 1ZBCA 2ZWYA 4GQRA 1MEHA 3BL3A 1DQUA 2FFIA 4O53A 2Y2WA 2XN2A 4LU0A 4TVDA 1VRDA 1SFLA 1EA0A 3T0AA 3N2OA 3OEXA 2PLMA 1W3IA 5J8LA 1ZP3A 1U1HA 3UR2A 2YPIA 2RDUA 3KCLA 3VNLA 4EVZA 2R1KA 3U6WA 5G1YA 3P67A 3ZR6A 3RO8A 4K37A 5AC8A 3OO2A 1JUBA 2E5BA 3LG3A 5AOUA 1PSCA 3ITVA 2VZVA 3XISA 3CH9A 5C6MA 2Q3RA 3UG8A 3VNKA 1YEYA 3VKBA 1WDDA 4HNCA 2C13A 3U2EA 1DWHM 1H60A 3ATZA 3B9OA 6ENLA 3ANYA 4QG8A 1N5WC 2JKPA 2YLAA 1Q65A 2W63A 2H8XA 2W5FA 1RSCA 3PFRA 2V3EA 1IT7A 4HSNA 3EWUA 3AMGA 3GVRA 4JEQA 3N2BA 2D23A 2HBXA 4K2SA 3LM3A 1N63C 4A29A 3TQKA 3R8GA 3V5CA 3SCUA 3FJLA 3ATYA 1ZK7A 3U4AA 4Z1DA 2W27A 1J5SA 1KM4A 1RJRA 1HN1A 1WDWA 4L7ZA 1F6YA 1R9XA 1HNYA 4ZB5A 1AQHA 2RJHA 3FJ6A 3CB8A 4JTJA 1VGAA 4QEHA 4LRTA 4KCWA 4O1AA 5FEPA 1XYAA 3GTIA 1V0NA 3GIPA 1NEYA 1Y7VA 3MWAA 3LADA 3UBPC 4A22A 4ERGA 1SZGA 3W38A 2C19A 3H70A 4LX4A 4KRZA 3WJXA 3PBGA 4F2TA 1Q8AA 2R1LA 2VWSA 2I5QA 2FHFA 3AYSA 4XBSA 4WSKA 3F5JA 3EPMA 2HK0A 2QR6A 2XIMA 3B0XA 3M0JA 3WK3A 4Z2IA 5CEWA 3PZGA 3G2GA 1BXCA 3NFUA 2W0UA 2BY2A 3WUFA 5MKGB 3LYEA 1RJPA 2DZAA 4R7WA 2EQ9A 4JEJA 1UP2A 4GQQA 2WVVB 4U3AA 2WCSA 1PZ1A 3WDQA 4XZBA 1EJUC 1LOLA 4UCFA 4QSHA 4YU1A 1H6VA 1IGSA 3U57A 4CCCA 4HTBA 3CHFA 4AZBA 1LWHA 2GVJA 5FACA 3VNYA 3KOZA 4XZ9A 1E6XM 3UXAA 4KH2A 3TZFA 3AZSA 1L2QA 1FHUA 2DQWA 1MOKA 1UIOA 3B04A 1I75A 3NVVB 3ENLA 3KLLA 3K1GA 3ME3A 3QYQA 3TU9A 2R82A 2QCEA 3CQJA 4S3FA 4DO5A 2ZRZA 2VCAA 4XD5A 4F79A 4KKXA 3GB6A 1JPMA 3EDFA 3ORWA 4OOUA 1C91A 3B9EA 5HK4A 4Z42C 3WL0A 5G4EA 5H2ZA 3VFCA 3T9PA 1J9YA 5KETA 1Q6GA 2ZTKA 2W0HA 1NQ6A 4GOAA 4Q8VA 1R5YA 3WD4A 3ABQA 1UWUA 4HA3A 1QMLA 3M0MA 1R87A 1SZEA 1LUCB 3GC5A 4QDPA 2O7QA 2QDGA 3EMCA 1A47A 3LCXA 3MBDA 3PS7A 4B5SA 4F0LA 1GCYA 3T44A 2TRSA 4LCQA 2FH6A 3A4AA 1U83A 2FDMA 5AHIA 1KGXA 3NZPA 4GI6A 1OJXA 1WUFA 2EQ8A 1EBHA 1TJ2A 2XVGA 3VINA 2NWRA 2QCMA 4K8GA 4I7WA 3G1RA 3PFMA 3TTQA 4UTMA 4AHPA 2V0TA 3EDKA 1QASA 1HJWA 1NHPA 3E2VA 2QMKA 5XIMA 5K3VA 3KP1A 1WPCA 3BLKA 1AL7A 3V0SA 3MDUA 2OG9A 5LIYX 3RX3A 1A5KC 4US5A 4JCMA 3CLMA 2BC0A 1GZJA 2Q02A 3LZ3A 3K13A 2A4AA 1M7OA 5EBKA 4X3ZA 1IT0A 1ZJBA 1WE5A 2KAUC 3TVAA 1ADDA 4PRWA 2CESA 3PPGA 2PRHA 1TVPA 1TMHA 4IFRA 1FDZA 2NQ9A 1Q66A 2OEKA 4OGZA 1FP9A 3V7PA 3SFKA 4RZ6A 3MI3A 1SJBA 1DOSA 3VGGA 4GIYA 3DYOA 3W00A 4QJ4B 4GQ0A 3EWZA 4Q4QA 4QGCA 4U10A 2Z2UA 2XH4A 1PZ2A 4LUTB 3O05A 5JIPA 1K70A 1SFSA 5MKGA 3CUJA 1W6TA 4MB5A 1GOMA 1HW6A 3WLIA 1LL7A 4CU6A 2WVVA 1WKYA 2D2HA 4E0CA 3QQ0A 3M5VA 2DJXA 5C9ZA 4US6A 3NXFA 4Q7IA 4XZIA 3PNUA 1H62A 1CGUA 3KBVA 4FF7A 2X1RA 2VFEA 1VQZA 3CQHA 4LXFA 3GY1A 1FDJA 4A4AA 3W1LA 2FVKA 4A6GA 2YVGA 3ARTA 3HPSA 5JMUA 5D9NA 1RD6A 1TYGA 4HA0A 4WLCA 4O0QA 4Q8QA 3CH0A 4EM4A 3P0WA 4J3SA 3T0CA 1RQBA 1O1ZA 5T8GA 2FJUB 4YVPA 1O5QA 1K9DA 3G5EA 4DWSB 1OC5A 3BK0A 1I2QA 1UMLA 1W5PA 1XYFA 4ZO6A 1R3VA 2GDUA 1J6PA 2WNWA 1XIHA 2V9DA 3C52A 3LV5A 3GE7A 3VPLA 4RK8A 4S3KA 5HJXA 1PO9A 1LUCA 2VEKA 4HD5A 4L64A 1EUNA 5FJRA 1P6WA 3I6TA 3DENA 4PUMA 1GT8A 3RLUA 3A9IA 4C90A 3WQ8A 1FTXA 1HKWA 2G37A 1X39A 2QCCA 1ZBVA 4BFAA 2IXVA 2Z1WA 3C0JA 3NSMA 5DBTA 3BCJA 3A23A 4DELA 4GQBA 4U3CA 1CGTA 1EJRC 1MYRA 5D2WA 1Y65A 3WMLA 3ZS4A 2VX5A 4M3PA 3H7UA 1QPKA 2WPGA 4R7OA 3ARPA 4X0NA 4X2RA 3ZR4A 3BLPX 1EX5A 1V08A 1VLIA 2E9BA 4OU1A 2C1IA 1X6LA 1MDRA 2JKAA 4FSAA 3CUZA 5EB8A 3TLQA 4JYDA 4DYKA 3QLLA 2J7GA 5HATA 1XKYA 1PDYA 4HCLA 4B3ZA 3PBMA 1POKA 5CPSA 5ABFB 2J7EA 4NSBA 1B3YA 2VURA 1DYSA 4BEQA 3KBSA 3E2QA 3UP8A 2VOTA 2WJZA 3W27A 3AQUA 1JOAA 4BQ2A 2ZICA 3OBAA 3DJJA 4JIPA 1CB7B 5CBBA 4Q8MA 4YWSA 2A3HA 1GREA 3VC5A 2OYKA 4IIDA 4UTUA 5H8PA 1SPQA 1GG1A 2G4FA 4BK9A 4DO4A 3VGFA 3CUFA 3BSMA 2D2OA 1HP4A 4WJ8A 4LUTA 4KCVA 4FXFA 3E6EA 5EA9A 3UZXA 2GRTA 3IVSA 3E38A 1PXGA 5IHSA 4AXKA 5HPCA 3GUGA 3IRDA 2V68A 4S1FA 1CXEA 1TTQA 2EJ1A 4M51A 4QS5A 4X22A 3QZEA 2E9MA 3LM7A 5HBFA 4DJEC 3EWYA 4DB7A 1H61A 1NFPA 2VTFA 1B1YA 1SO3A 5TNVA 2GVLA 4KIEA 1FWRA 1VCVA 3NTYA 2J7BA 5AN7A 4I9AA 5ER0A 1EJXC 2QNEA 2ABAA 1UP0A 3SJ3A 3RX4A 3WX7A 3N2MA 3VIFA 4UMAA 5CG7A 3QKEA 4KW2A 3VZYA 4J28A 3NQ2A 4DWSA 4MLJA 3DHPA 4QSFA 4KFNA 3T8LA 4MDPA 4HPJA 5AHEA 4RL3A 4TTGA 1A5MC 3HPZA 4RXFA 5K4ZA 2G5WA 3AUOA 3GW0A 4OQVA 1EB3A 3OODA 1U30A 1NY1A 1VJIA 3LXAA 4AZIA 1VFMA 1W1PA 2WB5A 5TF0A 1W9PA 2YCKX 1N62C 1MO0A 1RXOB 4N9BA 3UR7A 4PUEA 2PURA 4PBGA 3WBXA 2DQXA 1W9BM 5J5RA 2C3CA 5A6AA 3QOKA 1QHPA 2YDAA 1TMQA 3UPMA 1GK8A 3R0KA 1E6ZA 1JYVA 3BURA 1AJ2A 3IARA 4LB4A 3CZJA 2RDXA 3OGVA 3QR3A 2QQ6A 3WDIA 2WZMA 3TJXA 5ABFA 2PBOA 4LVFA 3N6HA 1GQNA 3LK6A 1VBUA 3UCQA 4JHOA 2ZKMX 4YYFA 2WPCA 5JBDA 2GUUA 3WLHA 3BTNA 3O7UA 5HNUA 2Q6ZA 4Y6GA 1BTMA 4UFMA 1MW2A 3OVQA 3GZAA 2NQJA 3G1FA 3AIBA 2YL9A 3LCWA 4QJ1A 1I0DA 1M01A 1XANA 3NA8A 5A8GA 4Q8TA 3SR6B 4JFSA 1VYSX 3PANA 1UH2A 1MUWA 5CSSA 1X2GA 2OQHA 2O9PA 3I7SA 3L4YA 4GH1A 1FFQA 4TVWA 5AYYA 2D22A 1B9ZA 1NSJA 2J25A 1PTAA 1S38A 3LLDA 1F74A 2CFYA 1YXCA 1C3FA 3GVWA 1ICSA 4XISA 5DY2A 3QR0A 3VYLA 4WX2A 4NASA 4PMXA 1HX0A 5H8UA 4XAZA 2A3EA 2ZZ6A 4PMQA 4Y9MA 3EWCA 1Q6FA 1R8LA 1WYGA 1R2SA 3S2LA 2R8WA 2X7WA 1OM0A 5G5GB 2WPBA 3I3DA 1YPXA 2VQTA 3LPGA 1WZMA 2QF8A 4NNAA 5A6KA 1BWCA 3ARWA 4AX7A 2F5ZA 1EYWA 2DT1A 2PGEA 4J3TA 4H9TA 1XBYA 3OIHA 2VZUA 1DL3A 3IS4A 2QDHA 3SRDA 1EP1A 1VFFA 2ON3A 4HJFA 4JDYA 5FEXA 4DI9A 2XIBA 3T4WA 3WQ4A 2AQVA 2J9ZA 2XM1A 3WLJA 4EK7A 3LB0A 1ZQ5A 2ZX7A 3LCLA 1VLWA 2E3ZA 2W66A 3L5AA 4DY1A 1RBOB 4N4QA 1LWJA 2J9XA 1WXJA 4B91A 2FDSA 3PN8A 3ALFA 4N2YA 3WF0A 2XVPA 3D46A 3EGJA 4PN2A 2QDEA 2PGWA 1PJ9A 2XDFA 2R14A 1AK5A 2QPSA 2R6OA 3NIYA 3N2CA 1MZRA 3G8RA 3ECQA 4XIAA 5TR3A 1OGGA 3W7DA 5EL1A 1W5MA 2ZXAA 1PZ0A 1VYRA 2NV1A 3W4RA 1BSLA 4I5XA 1TPFA 4MDOA 2E5AA 5E9AA 4UQCA 4ZXLA 1Q6LA 5E5CA 4AZ7A 1AJZA 2XZ7A 2V2HA 1VBJA 1O5KA 1JRCA 3D47A 1OF6A 1WX0A 5FMHA 5FEWA 1J5TA 4XZLX 3HW2A 1V51A 1GXFA 4Q4PA 1FFVC 2NXIA 1PL9A 3PZOA 4FIRA 2C16A 3QF0A 1A0DA 1AL8A 1WZKA 4G9PA 5BOFA 2XFYA 1GTEA 2FYMA 1HJVA 3H2OA 2J6XA 1CXLA 2D0HA 4EQRA 4ZR8A 5ECVA 4KGJA 4E8CA 4IUOA 2CXGA 2VKZG 4QR6A 5FIPA 2O0TA 4IX2A 1R7AA 4J35A 1KXHA 3BMWA 2H90A 5LNUA 1IGWA 1X6UA 3T42A 1DP0A 1HF6A 2BY0A 4E2DA 4IL0A 3L68A 4UTWC 3KS5A 3VNZA 2W62A 4QFUA 5BOOA 2ZUNA 2XVKA 1VH7A 4GKLA 4D6FA 2BXVA 3SCRA 3DHDA 4CVWA 2P1FA 6XIMA 3W75A 2HVOA 3AIVA 1P0KA 3GYCA 1ZRQA 2BY3A 4DXKA 3UD6A 3DECA 1EPXA 3C8NA 3TN6A 2FQIA 4M1BA 3W7RA 4IMCA 2JE8A 4NAFB 2VNCA 3QKZA 1ZBWA 3RIKA 3S3GA 3EOOA 3MUIA 1Z41A 2I7GA 5CPLA 2P3EA 1TYPA 3N4EA 3HM7A 3VNMA 5FOOA 2GDQA 2HPMA 2FGBA 4S3AA 1EWDA 4N42A 4JFTA 2YIHA 4TV5A 4TU1A 1MI3A 1AUSL 3RLGA 3VZXA 4W93A 3S42A 1NOFA 2PDIA 1BGAA 3OA5A 4GXWA 2GVEA 3HJEA 3PUEA 1XFBA 2BS9A 2XISA 3N9KA 1AVAA 1UZ4A 4UTKA 3FLUA 3HF3A 3ARSA 3ITXA 3WH9A 4MG4A 3QSTA 2AMGA 2O9OA 3R12A 2ZX6A 1OK6A 3LLXA 4NYUA 3WDPP 4HPXA 5I23A 1JDFA 1NM9A 4UTWA 7TIMA 3URNA 3I4EA 2CYGA 2NUXA 2OYMA 1XINA 4K36A 3HURA 2JK6A 1Q6RA 2R1NA 1HQTA 3W2KA 5CPMA 3FDGA 3S46A 1P0BA 1OD0A 2OJPA 2CLKA 2YBUA 1V6WA 1UASA 3CO8A 3P8IA 3W7GA 1VIZA 5DMYA 2BLEA 3CAKA 1VIWA 4H9VA 5AY7A 2BOEX 2R9RA 5JCIA 2E8YA 6CGTA 4O52A 2E25A 4HU3A 1AW2A 3L12A 5A8NA 4PUUA 3OLIA 2HNEA 4Y8FA 1J0HA 3E9AA 1GVSA 3GFYA 4M56A 4RNJA 2FB3A 1SJDA 3KVKA 1LQAA 1KRAC 3VD5A 4L1XA 2CBUA 4Q4SA 2OELA 5FJJA 5FL1A 3OQ8A 5MF5A 3IJ9A 1NELA 3CEPA 4EPDC 4B4FA 1XBVA 3TTEA 3W7KA 3R79A 3V1HA 1OYCA 5IXEA 2DPEA 4L4LA 1ZX9A 3FGCB 1US0A 4XKMA 3CV7A 4IP5A 1TR1A 3M4HA 1RM6B 4W8LA 3A6OA 1E3ZA 3A5FA 5H91A 4GVGA 5AZ0A 1Y8BA 3HTWA 3AJ7A 4F2UA 1VJSA 3UERA 1TTJA 4WHBA 2ZRVA 4H4WA 2HE8A 1H7WA 1JXKA 2A7NA 5A8OA 5HJLA 1E70M 3BJSA 3CQKA 3EB4A 1D7KA 3SY5A 4J27A 1XGDA 4NAFA 4GACA 2OSWA 1F4AA 4J3XA 1UR9A 2YDRA 2OZ3A 1GPWA 4ACZA 1VQTA 2X1SA 3NO3A 5E1QA 2B7NA 3PTMA 4P7OA 3UY7A 1GQJA 5C2GA 1NFGA 1WO2A 4H7CA 1E15A 1XRVA 2XVNA 2GQ8A 1SFJA 3MBFA 4GISA 3A47A 1O95A 3UPWA 4MWAD 3ABSA 4QCEA 3VTRA 3OHMB 3H24A 4PA8A 1TELA 1E3XA 4H4XA 4QXIA 3CAVA 1KTNA 3P60A 1RJQA 2CLLA 4UR7A 1JZ6A 1KQYA 3W2MA 2QUVA 4O8RA 1JPDX 2PDMA 4N4PA 1GGOA 1I2RA 3LOTA 1A3XA 3QPYA 2J78A 1GONA 2G0WA 2DT3A 1RUSA 2UZ9A 4K7VA 4FALA 4TOQA 1YQ2A 3A4JA 1H0IA 3NQBA 4H4ZA 4PTWA 4XO7A 1XLIA 3RJYA 2JF6A 4Z2GA 1KBLA 4KF1A 1ITXA 4EAYA 2XHYA 1K7EA 1I8JA 1XKJA 3FJNA 1I2PA 4ZE4A 1WKEA 1YE4A 2V67A 2POTA 3N13A 1L8PA 4QAIA 1NWUA 1XLLA 1UA7A 3EWBX 1TV2A 2WBAA 3BCDA 1A5OC 1BXNA 1NF7A 1XC4A 3QOMA 1QNVA 3IGHX 2VEGA 3TQ0A 2ZUUA 4A3HA 2WVSA 1UJPA 3W22A 4OZOA 4HU4A 3RUBL 3GRTA 1XC6A 1OZMA 5A69A 4GYJA 2GL5A 4IISA 4XBKA 5IFPA 5GRTA 1RPKA 3CAQA 2BCPA 3TTSA 4IP4A 1BSIA 3WMCA 3GH4A 1O66A 1TCMA 4R53A 3VCCA 1ZAHA 1EA9C 5A8PA 1F5ZA 4HN8A 2OLSA 3OPSA 4FNPA 2V3DA 2P8CA 3IGXA 5KVIA 4NNBA 3T0BA 2L5HA 2FHBA 2YA0A 4Q32A 4QHRA 5LIXX 5CBJA 4UMCA 5DMLA 3KDNA 2V3FA 1F05A 4WDUA 1AW5A 1EYEA 2QIWA 4PRRA 3IUDA 4JHZA 3ZO9A 3FGCA 3ABOA 1ZDLA 5FSDC 3QV7A 4P8UA 1WDRA 5AHFA 4J57A 1H2JA 3OZMA 2PEVA 1JYXA 3K46A 1XP3A 2GR1A 5BRPA 1C9WA 2OMAA 1P7TB 1S1PA 1Q1RA 2WJDA 3IV8A 1QPRA 1H7OA 1HL9A 4AU0A 3M0HA 3TYBA 5HDRA 1UWAA 3PZVA 1QR7A 1VFLA 1P6BA 1KWGA 4TX6A 2C6QA 5C9XA 3AZRA 2F2HA 3FEQA 4LFYA 5G4WA 1XX1A 2OPJA 2YB1A 5D2XA 5M1TA 4LOCA 2VEFA 4KWVA 3BV7A 1R9YA 2QYGA 3A21A 1G4PA 3M0VA 1KRMA 3CNYA 1TE6A 1SFTA 3FA3A 3QV6A 3C5QA 1KB3A 3REQB 2FVLA 4MLRA 4DIAA 3JZEA 4FB7A 3JUGA 3SIZA 4JD4A 1K02A 4S3EA 1UPMB 4AVFA 3VNDA 1ZNNA 4H4YA 4Z0SA 5CBIA 2Y4SA 3AIWA 5FS9A 2ACUA 3W85A 4L56A 1R47A 1RPXA 5AC4A 1I60A 4HMEA 2O7SA 1JI2A 3EA1A 1JNDA 2CW6A 4BF5A 2WOWA 3B4YA 1OB0A 3HOJA 4YCPA 1YBQB 4S3GA 1LL6A 2RAGA 4Y9AA 1DIKA 2XYLA 3RILA 4JN6A 4UR9A 3QFAA 5AC7A 3E1F1 1Q45A 2EPNA 3ARUA 3Q2DA 1CI1A 4GJ1A 3EKGA 3TLLA 1AD1A 5FJIA 1W2PA 4JN8A 1TPWA 4RDWA 5REQB 4KPLA 3JW7A 2VGFA 1AA1B 3L4VA 3WLTA 5BXRA 1P4CA 2YFNA 2BZNA 2V2DA 4Q7BA 3LDVA 3W7NA 1EZ2A 1UBPC 2XFFA 4FI4A 1L0PA 4Q4MA 4S3JA 1EJTC 3GVVA 3ABXA 3SI9A 3DYMA 1Q8JA 1I45A 3H21A 5D32A 2W9MA 1R3SA 2R24A 3GIYA 1EOMA 1FH9A 3CYJA 4CQCA 2AQWA 2E77A 1PKYA 1XLHA 1LLWA 4OUEA 7REQB 2WMFA 3DG3A 1MW0A 2ZX5A 3U4FA 4KERA 3W87A 3I3BA