3OZMA

Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
386
structure length
386
Chain Sequence
SLKITEVKAHALSTPIPERMRVESGAGLKLNRQMILVEVRTDEGVTGVGSPSGPYDLAVLKRAIEDVIGPQLIGEDPANINYLWHKVFHGEVSRNLGHRSVGIAAMSGVDIALWDLKGRAMNQPIYQLLGGKFHTRGVRAYASSIYWDLTPDQAADELAGWVEQGFTAAKLKVGRAPRKDAANLRAMRQRVGADVEILVDANQSLGRHDALAMLRILDEAGCYWFEEPLSIDDIEGHRILRAQGTPVRIATGENLYTRNAFNDYIRNDAIDVLQADASRAGGITEALAISASAASAHLAWNPHTFNDIITVAANLHLVAASPHPAMFEWDITHNDLMTRLASYDLKLENGLVQPPQGPGLGFEIDWDFVAAHAWKGEPAIGAGHGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of enolase superfamily member from Bordetella bronchiseptica complexed with Mg, m-Xylarate and L-Lyxarate
rcsb
source organism Bordetella bronchiseptica
molecule tags Transferase
molecule keywords Putative mandelate racemase
total genus 132
structure length 386
sequence length 386
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ozmA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ozmA01
3MUCA 3CXOA 3MY9A 3VC6A 4HN8A 4DN1A 2PPGA 1XS2A 3CB3A 3R10A 1PDZA 1MDLA 2OPJA 1JCTA 3P0WA 3FCPA 2QQ6A 4MKSA 3IJLA 1IYXA 3UCDA 3IK4A 3TOYA 3MZNA 3DG6A 4KWSA 3QLDA 3UJFA 1YEYA 3GO2A 2PSNA 3FJ4A 2GSHA 3RRAA 3N6HA 3IJQA 4G7FA 2PGEA 3BOXA 2FYMA 3RITA 4E4UA 2QVHA 3VDGA 3H7VA 4ZA0A 3TTEA 3CAWA 4DWDA 3OZYA 4KPLA 3UJSA 3PWGA 3GY1A 2DW6A 1TKKA 3U4FA 5J04A 3UXKA 4FP1A 3N6JA 2OVLA 4YWSA 4E6MA 4MMWA 3H8AA 3R0KA 1MRAA 3R1ZA 4KT2A 3QPEA 4E5TA 3FXGA 2PU0A 4JN8A 4G8TA 4MGGA 3I4KA 3QTPA 2AL1A 2QDEA 1RVKA 3QN3A 2P8BA 1EC8A 3JW7A 3ZVIA 3T9PA 3T4WA 3CT2A 1FHUA 3NXLA 2P0IA 5FJOA 3S5SA 5FJUA 3SN4A 3V5CA 3TW9A 3B97A 3NFUA 5FJTA 1MUCA 4HNLA 5BOEA 2PTYA 3DEQA 1ECQA 1JDFA 4HNCA 3SN1A 4IL0A 4DX3A 4IZGA 1JPMA 2MNRA 4HPNA 3GC2A 4H83A 1R0MA 2P88A 2QJMA 2P3ZA 4GGBA 4IP4A 2OO6A 4GFIA 4GIRA 2XH7A 1ELSA 2HXUA 3UCCA 3R25A 1MNSA 3V3WA 5ENLA 3DFYA 4DYEA 3VC5A 1BQGA 3HPFA 2CHRA 3DG3A 1FHVA 2PMQA 3FVDA 2OQYA 2PTXA 2PP1A 4HCLA 3THUA 2OLAA 4A35A 3U9IA 2O56A 4K8GA 1EC7A 1EBHA 2OX4A 4HCDA 3OW1A 2POZA 2PP3A 7ENLA 3KUMA 3ZLHA 3UJRA 2ONEA 3ENLA 4GMEA 1R6WA 3RO6A 4KEMA 3VCCA 3RGTA 3TQPA 4K2SA 2GGIA 3S47A 3ES7A 4JHMA 1WUFA 3MWCA 2GL5A 3T6CA 4HCHA 2OQHA 3JVAA 2XGZA 4GISA 4M6UA 4IP5A 3PFRA 1NU5A 2NQLA 2XH2A 3SN0A 3Q4DA 3UJ2A 5BOFA 1TE6A 3VA8A 3DDMA 3DGBA 2QDDA 4Z1YA 5EU9A 2GDQA 2AKMA 1SJAA 4GYPC 3N4FA 4IL2A 3VCNA 1KD0A 4DXKA 2PS2A 2QJJA 3K1GA 4E4FA 3DIPA 2QJNA 1W6TA 4ZCWA 3SSZA 3V5FA 2GGEA 2HNEA 3UJEA 2PGWA 4X2PA 2PCEA 2GGGA 4EWJA 2AKZA 3VFCA 2AL2A 3TJ4A 3TWAA 3MQTA 1SJDA 1E9IA 1WUEA 4ENLA 3QKEA 3D47A 2OZ8A 1XPYA 3PK7A 3TWBA 3DESA 3FV9A 3I6TA 3ZVHB 3RR1A 3RCYA 2RDXA 3FYYA 1EC9A 4IHCA 1P43A 3JZUA 4J1OA 4A6GA 3NZGA 4IT1A 3DG7A 1DTNA 2OFJA 2XH0A 3OP2A 3EKGA 4H2HA 3TCSA 3PWIA 3TJIA 2OKTA 4Z17A 2GGHA 1MDRA 3P93A 3Q45A 4HYRA 3ES8A 2I5QA 3UXLA 1PDYA 1SJCA 3P3BA 2PTWA 4F4RA 3EEZA 4FI4A 3I6EA 4H1ZA 1BKHA 1KCZA 3OPSA 3DERA 3R11A 1TZZA 3N4EA 2HXTA 4GGHA 2DW7A 3IJIA 2P8CA 2PP0A 3T8QA 2PU1A 4DHGA 1KKOA 3ZLGA 2AL2B 3SQSA 3SBFA 3CYJA 2OG9A 3GD6A 4J3ZA 2ZC8A 3ZLFA 1NELA 2FKPA 4M0XA 4E8GA 1KKRA 2XSXA 5FJRA 1OEPA 1SJBA 2PA6A 2GGJA 3CK5A 3H12A 4K1WA 3BJSA 4GYPA 6ENLA 2QGYA 3OZMA 3R0UA 5FJPA 2XH4A 3SJNA 3NO1A 2OZ3A 1P48A 2HZGA 3MSYA 1F9CA 2PODA 1JPDX 1L8PA 2PTZA 3MKCA 2OZTA 3DFHA 5IDZA 4A3RA 4ROPA 3STPA 2MUCA 4JN7A 3BSMA 1EBGA 3D46A 3OTRA 1ONEA 3H70A 3UGVA 3ZVHA 4H19A 2ZADA 3V4BA
chains in the Genus database with same CATH superfamily
4OECA 4WXZA 2X7WA 5U25A 4RKAA 2BC1A 3QZAA 4LCQA 1B9BA 1KRAC 4A3QA 4BF5A 4B5XA 1FXQA 3C52A 1TE1A 2YCKX 3BCJA 1W3JA 5D05A 1QW9A 4W7VA 3PUEA 2V63A 2ZE3A 1ECEA 4NI3A 1HJXA 2DP3A 1RCXB 2YW3A 4YMZA 1B2YA 5C9RA 3FJ4A 5JU6A 1B4EA 3PZIA 2JQXA 2WMIA 3AU2A 2C14A 4WY0F 4GD0A 2VEGA 3GHTA 1PO9A 2XHYA 1HTIA 3TVAA 3LMYA 3NYDA 4PUMA 1JRBA 1CGTA 1K9FA 2A85A 3KP1A 5H8UA 1DHPA 1XLFA 2WOWA 4NNCA 4ZZ9A 4DWDA 2YDRA 1LWJA 2XM2A 2CHNA 4AZCB 4IMFA 4Q4OA 3K2GA 4ZENA 4ZL1A 1US3A 1G67A 4J4KA 3UXKA 1IR1A 2YZ5A 1UC4A 1E71M 1ZJAA 4RW3A 3VPLA 4MMWA 3LI1A 5AHNA 1HO4A 5T8GA 1U5HA 4IPLA 3SCQA 2ON3A 3VIKA 4G8TA 1PXGA 3C2EA 4JEJA 3I4KA 1J6PA 1GRFA 3WLPA 1EA9C 1JPHA 1XBVA 3OZOA 3SIMA 4UR8A 4TV5A 3NQ2A 1QK2A 5D37A 3LS9A 1JDAA 2E4TA 5FJUA 4Q4RA 5G4EA 1F2JA 3V5OA 3T1GA 1C7SA 1Q6FA 2GUBA 3IGSA 1A3HA 2PRLA 1AODA 3CV7A 3T7VA 4JHOA 3LX9A 1QOXA 2X09A 4BWLC 3W84A 3OQEA 4TTUA 3CV6A 4UFIA 4NZ5A 5GJNA 4WJ8A 2DJXA 4OKDA 3TC7A 4GUGA 4XX6A 4DM2A 2GSJA 1KRMA 2V3DA 3W9ZA 5F4WA 4YHEA 1OM0A 1F6KA 2P88A 3MWAA 3S2CA 3DK9A 4GGBA 2VGIA 3BMWA 3VABA 4C6MA 2VENA 4AYSA 3UCCA 1MVYA 1FWBC 3CPGA 3Q2DA 4F2BA 2OYKA 3NOEA 3AS3A 4DJEA 2JEPA 4KWUA 5E70A 1YE6A 4J3SA 3VKCA 5JRBA 1Q45A 3NSXA 1QR7A 1TPFA 5BNKA 1EJRC 5AYBA 2C18A 3KHJA 4KESA 3DI1A 3OIHA 4DJDC 3TYCA 5D9NA 1FHLA 4TVDA 3WLQA 3QW4B 4F2UA 1BG9A 1ICSA 3USBA 3UYIA 4IICA 4GBDA 3TLLA 4HPJA 2POZA 3EA2A 1HN1A 4C6FA 4QDWA 1XRTA 1ADDA 2VRJA 3VUPA 3T0AA 4CU7A 1P7TB 1Z41A 4RDWA 3PPHA 4AZBA 2ZUVA 4KWOA 4TVUA 3RPMA 3RLUA 3TJXA 3HGJA 4CD7A 1J0KA 1SFLA 1SYTA 3EZ4A 3WJYA 1HF6A 3Q4DA 2OT0A 4QAIA 2PWFA 1SW0A 2VC9A 2GQWA 4BQ2A 4QX4A 1NWUA 3VKKA 2QUTA 2QPXA 4EP8C 3EPNA 3LXAA 3ARRA 2V5KA 3LZ5A 2QPUA 2WB5A 1S2VA 1UUQA 4CQAA 3VMNA 3LXDA 2WLZA 2PDMA 1U1HA 4HU4A 3EKZA 4NZJA 5AYZA 3RR4A 1JEHA 4W93A 1XIGA 4E4FA 1MO9A 4AG0A 3SGUA 3V7PA 1WXJA 2CLLA 1ZALA 1L6GA 4UXDA 4ILSA 3NOYA 1FUYA 1SZNA 4Q4KA 4TVYA 2GWGA 1E1CB 3RPTA 2VP8A 1CT5A 1I4NA 2PDUA 1TRDA 4ENLA 4LVAA 3QC3A 3GD3A 3VE9A 3SUTA 2WPCA 5M5DA 5AYXA 2HSAA 1W2PA 1N55A 2BVYA 3RR1A 4GI9A 4LUTA 1LL7A 2VC6A 2OU4A 4IHCA 2W0HA 1XDJA 1PKMA 2C6QA 3TFCA 1KRCC 3WF1A 1JRPA 4EACA 4POCA 1E6SM 3KRSA 5FS8A 4ZB0A 5FF2A 1XQKA 4Z1AA 5FF7A 1LQ2A 1PAMA 5AB3A 2XZ7A 1D7KA 5CPMA 4AD2A 1GVQA 3RMEA 5GJMA 3MMUA 3LV5A 4GVFA 1GERA 1PCWA 1EYEA 9XIAA 1TPEA 4NRSA 3W88A 7A3HA 5GNZA 4O53A 1HQTA 3MHFA 3DENA 2XJ7A 3NZ1A 3M6YA 1B0IA 2TSYA 2G97A 3KCLA 2HXTA 4ATDA 2PEVA 1IEQA 2XYLA 3AS1A 3HG3A 1CXIA 4FNRA 1A5AA 2OLHA 1M01A 2VGFA 3BJTA 4XVDA 1Y5WA 1UQZA 4RNJA 3SADA 1BG4A 4NZ1A 7ODCA 2QDGA 4HHLA 3WMBA 4LVGA 3H12A 1A0DA 2CITA 2X8CA 3H2OA 3NO1A 1FFVC 1WKDA 5HQEA 4D9PA 2ZWYA 1DXFA 3PZOA 4P8XA 1JPDX 3WK3A 1SFJA 4N0RA 3WQ5A 2FPYA 1HKVA 5K7JA 4Q8QA 1IGSA 2XVPA 3IJ8A 3STPA 3QGKC 3I10A 3FIGA 3P7YA 2J7FA 4NJIA 1VCGA 2Z1SA 1RP9A 1LP6A 5D02A 3R43A 3GXTA 2CLIA 4K39A 1JXJA 3HGSA 1HL8A 4ZR8A 4DXXA 1VEMA 3NA8A 1LLWA 5LSMA 4H2CA 2DY3A 3K8KA 1XUUA 2DT3A 4PR4A 1UKSA 4YTTA 2F61A 2BHYA 2DIEA 5L6UA 2R9ZA 4ZOHB 1IXQA 2JFEX 3KOFA 1SW3A 4C6KA 4JQ1A 3RO8A 3KTXA 1ZAIA 2D20A 3TR2A 1NF7A 2O4MA 3W7RA 3V18A 4N7QA 1FWTA 1JCMP 1WXZA 1JZ6A 4JDYA 4ZQOA 2R6OA 1LLZA 3VM5A 4CKQA 4JTLA 4ZO6A 1ISYA 4QM1A 1KW1A 5K9DA 3WQPA 1CDGA 1KO0A 1AK5A 2E1DA 3K13A 1ZCCA 2Y24A 2TODA 3CZJA 1FEBA 3BOXA 5A2AA 1VBRA 4E4UA 3CNYA 4QBXA 4NZ4A 4PMDA 5C0QA 3HOJA 1QJWA 1SMAA 4QJ3B 4K8EA 1K70A 3N13A 4MTVA 5C9UA 4QQUA 3BG5A 5KVIA 5CEWA 2NWRA 1YNPA 4GVHA 2ZX6A 4JTUA 5I77A 2ZUSA 4LVBA 1TKKA 4LUIA 1Q1WA 1S2TA 4UQ9A 1E9YB 2EQDA 5JCMA 1R2TA 4PMVA 4UFJA 3ABSA 3LQGA 3SEPA 1SFSA 2DZTA 1U30A 3PFMA 2WBKA 4CD5A 2E68A 1OC5A 3FXGA 3S6DA 1W9BM 4CNUA 4TOQA 3G6LA 3EWBX 5LXXA 2ZRYA 2J7GA 4FMVA 1J96A 1IGWA 4MGGA 1SZGA 3L5LA 3EDJA 1V7AA 2AQWA 4WK9A 3WEMA 1XD0A 4GUIA 1H62A 3QPYA 4MZYA 1N8FA 3KWSA 1SZRA 4U3AA 4HOZA 4IIHA 1IEWA 3QFAA 1TPUA 4DJDA 4GQGA 2EPLX 5FOOA 2H8ZA 3NPWA 1BXNA 2CLEA 1EJUC 3PC0A 3TYUA 3VAVA 1R2RA 2FQIA 3GIYA 2YB4A 4OBTA 1VQZA 3T40A 3BARA 4H4UA 3ATYA 1DP0A 3CWNA 4PB4A 1NDVA 4H01A 3WMCA 2GOKA 1DJNA 5CBJA 3ECQA 3N2OA 3NJ3A 3A64A 3CL8A 3M0LA 2BS9A 4IP4A 3V36A 2IQ0A 2PRHA 2HXUA 3KBVA 3F7JA 3N29A 6REQB 4KKXA 4HNTA 3N11A 1Q4NX 1VBHA 3DFYA 4OE7A 4ROQA 4ZMGA 3CU2A 3HIJA 3DG3A 4ZB2A 2REQB 1W8SA 3MA8A 3F2BA 4M1RA 3GBEA 3SRDA 1XRFA 3LTPA 3FGCB 3VDCA 3KL5A 1EBHA 2GVJA 5K9XA 2OX1A 1TPWA 1OFOA 1IT0A 1LT7A 3GVGA 5FS7A 1TO3A 3NDZA 3KUMA 2NVCA 3ZLHA 5ABTA 1R3RA 3MS8A 1XV8A 5M03A 4MM1A 4GMEA 3W72A 3RO6A 1WPCA 2YAUA 3GWQA 4LYQA 3VILA 1WUFA 4C6EA 3LCLA 3W7LA 3RILA 3MHUA 1IZJA 1TCDA 3KOZA 4GY0A 1KM5A 4HU8A 3EYPA 2ACRA 4ORIA 5BMXA 4JS3A 2A2IA 3BQ6A 4S3GA 4X0VA 4QFUA 1GHRA 2FFIA 1BXBA 4QNWA 1L9WA 1YTEA 3GZAA 1W3NA 4W5UA 1B3OA 3KRBA 4HA4A 2F38A 2REQA 1PUDA 2PLCA 3HQ1A 1J0HA 3GU2A 2DH3A 1K4QA 3WD2A 4B5WA 5AC8A 5E1QA 2PS2A 3WLHA 3BG9A 5AZ0A 2GGEA 4MB3A 3ABZA 2DH2A 1Q4WA 1YNQA 3TN4A 1H61A 3W53A 1RK6A 3KM8A 2EG8A 3DU0A 2YSWA 3Q58A 4DY1A 2IKJA 3TWBA 4O10A 1HKMA 3I6TA 1SPQA 3SM0A 4Y9OA 2NT1A 1EXBA 3L12A 4LBSA 5A8MA 4C7DA 1GQNA 1K1DA 3LEPA 4OTKA 2FTPA 1Q7QA 2CU0A 3TSMA 1NVMA 4KWWA 1DE5A 1J10A 3QYSA 1C8YA 3NL3A 1AJZA 5EY5A 1GOWA 3EPMA 1EHAA 4YPJA 2OYMA 2ISDA 5HWJA 4YJ5A 1R7AA 3P5YA 1FY6A 1UOZA 4X9SA 2RGLA 2BASA 1OBAA 4I9MA 3QQWA 1KCKA 4ZXOA 4UNLA 4NEWA 2WPGA 4Y2WA 2P53A 4AZCA 3EWUA 1H60A 2CLMA 4GGHA 3HMJG 3IJIA 1R3QA 2P8CA 2PWHA 4MLRA 5D9OA 3II1A 4AHOA 3EWCA 1TPVA 4Z1BA 3EXSA 2CNCA 4Y7EA 2QUUA 1KCXA 2FZMA 1VRDA 4D8ZA 2DV0A 1UJQA 2QULA 3WIJA 2OMAA 3M41A 1CGVA 4J7RA 2ZXBA 3KHDA 4K8DA 4MJMA 2UY5A 1B3VA 1M41A 2OELA 4PCFA 3LLXA 4W84A 1EYWA 1TPH1 1RBOB 5A6SA 3W7IA 4JFWA 3HQOA 3USZA 5XIAA 3G1XA 1J79A 3ALFA 2A1YA 2J7HA 2EQ7A 5JBFA 1V6WA 4B16A 3PWAA 1E6XM 4OBRA 5CZTA 3OG2A 1XG4A 4CNTA 4DNMA 3BMVA 3GS6A 3V0SA 1FDJA 2NQHA 2NXGA 3V4BA 3MUCA 3SJ3A 3DC0A 3IIOA 1YKWA 2RJGA 3R8RA 1I6NA 1WBJA 4FS9A 1K6AA 2GH5A 4YU1A 1A5BA 4DZ5A 2NW0A 1M6JA 4GG9A 4GACA 4GY1A 5M1TA 3N6QA 4Q8OA 1QUMA 1H1YA 2J75A 1B54A 3QEZA 4GI4A 5DRCA 1XM3A 1G5AA 4IP7A 4GOAA 4QRNA 1E4IA 4GR1A 3T0DA 1ZS2A 3GO2A 1SO3A 2DGAA 4Z2KA 2VEIA 1V02E 3BJFA 4O13A 3AQUA 2GSHA 1OD8A 4EPBC 4IJRA 4KW2A 4RE0A 3GC5A 4JY9A 4G7FA 3BAYA 3F4WA 3RITA 4QXIA 2UY3A 3RLVA 2DUXA 1GVIA 3EA3A 1L6YA 3O0FA 5CSYA 5A8GA 5EL1A 3TC6A 1RH9A 2YDQA 1XIIA 4OHQA 5A95A 1EIBA 2WCAA 4NYUA 1V59A 1JZ3A 1G9HA 1E4NA 1GVOA 3P81A 4QROA 3W1XA 1P6BA 3K46A 1JDDA 3VOGA 1ICPA 4N9CA 2QXWA 1CPUA 3SR6B 3AJXA 2D23A 1QOQA 3MZ2A 3HRDC 1KN0A 1RCQA 2R82A 4E6MA 1Y5XA 2BGNE 2GJNA 2I5GA 1YTDA 3S2LA 1CXKA 1L2UA 1L6WA 2X41A 1AH4A 1BWCA 2RDWA 1KFCA 5AYYA 2QGHA 2FJKA 2CLOA 1IWAA 5E6YA 3CB8A 2YA0A 3QTPA 1Z8AA 2XM1A 1ZKQA 4IFKA 4BHYA 2ZUUA 5L9FA 4IGHA 1KBKA 3CPUA 3W76A 1XW8A 3N2BA 5DBUA 1D2KA 3SDOA 1UWSA 1GW1A 3THQA 3K5XA 3WH8A 3LXCA 4MZ8A 3NCOA 2EAWA 4WX2A 5IHRA 1PB0A 3H53A 1V93A 4KERA 2OT1A 2XN2A 2V6OA 4D71A 5A8QA 2BWGA 3OEXA 4LF2A 1DXLA 1J2WA 4REQA 3MBFA 3HB9A 1NQ6A 2Q8XA 1EOMA 3F4CA 3UR7A 2MNRA 1BSIA 2PDFA 3E12A 4PUEA 4Y9MA 1N5WC 3VNKA 2TMDA 4UIOA 3SZ8A 1YDYA 4HN4A 1ME8A 1V0NA 3EMCA 4DM1A 3OGVA 4NAFA 4Q4SA 2R24A 1I2OA 4NYYA 3RXZA 3V3WA 5JCLA 5D32A 2ZA1A 3GAYA 1FWIC 3VC5A 4CD6A 3W7HA 2GRTA 3BAJA 3EA1A 1UH4A 4XTDA 1CWYA 3TDFA 3ABXA 3M9YA 4O15A 8RUCA 2VOTA 3GDLA 3HJEA 1F6YA 1ZHAA 4Z1CA 4D6EA 1BXCA 3ARYA 2O56A 5C2CA 1TTPA 4WSHA 1CXLA 1T6MA 4E3VA 4MOZA 3S9ZA 1FWFC 3O6AA 4O0ZA 3RCNA 1HXJA 5JH2A 2PC4A 2PP3A 2A3LA 1PWMA 2CBIA 1R46A 2VTFA 4KEUA 4XD5A 2OWWA 1F8MA 3RCMA 3B8SA 4H8HA 3EGJA 1LQ0A 1XGZA 2PDWA 1UZ1A 4MUPA 3AO0A 1V6XA 3URHA 3M7WA 4IIDA 1DWGM 5GNXA 3R94A 3PJTA 4PMOA 2XFRA 3THCA 3M0MA 3QV6A 4ORMA 2GDQA 2ZZ0A 1E0TA 3QFWA 4MPKA 5FA5A 1LBLA 4K7VA 4U4MA 5A6KA 2NXIA 3LRLA 3ZO9A 3PJXA 5J5RA 3CZEA 3PZUA 4X60A 1J9YA 1GEQA 1HKKA 3QXBA 3CBWA 3UWVA 1W3LA 2PCEA 1XLDA 3P0XA 4O54A 4UMCA 3VOJA 3IANA 3MUY1 4PTDA 3WJZA 5JIWA 5F2IA 3IEBA 2YYTA 5HULA 5HUPA 2X1UA 1OGSA 1B3ZA 2GFTA 4F48A 2TYSA 4AFYA 5FKYA 5H8MA 1LL4A 3TK7A 3SFKA 4TMCA 1O95A 3G8EA 1IIGA 1J0JA 1JIBA 5HDRA 1YNYA 1HNYA 3MV11 2EPMX 4B15A 5JCKA 5M17A 4MKNA 3TCSA 3EANA 1E0XA 3BG3A 4Z17A 4MDPA 5IBXA 4UQDA 3AMKA 4LYRA 5C54A 1HJWA 3L7RA 2PTWA 1LRQA 3MI6A 2NXHA 3ZYZA 3VGBA 1PJ9A 4GABA 3WF3A 5CSRA 1MQRA 5G2WA 2P10A 3OPSA 3UWZA 3CPRA 1Q63A 4CU8A 1OABA 3BVJA 3FFSA 2CPUA 4HKPA 3T0BA 4LEQA 1A53A 3R58A 3U5UA 1CGYA 5D2YA 2NX1A 2IKGA 4EQXA 1LLOA 1THFD 3MCOA 1W31A 3CYJA 4JNZA 4GNVA 4FIQA 1NELA 3T09A 1T41A 1SJBA 5LNRA 1ITCA 3N2TA 1TRIA 2Q8LA 3HPAA 1VJSA 3ITTA 2XH4A 5HBFA 4GINA 1EJXC 4K36A 3DFQA 3O07A 3AROA 5AECA 3IRDA 1D3CA 4DO5A 2I5IA 4Z2JA 4HTYA 1NP2A 4KCWA 5DY2A 1ENUA 2MUCA 3NQDA 3SB0A 2GQAA 3PZTA 5BXPA 2PLJA 5GRTA 1RQEA 3TA6A 4GH3A 4RE4A 4DUXA 4C1NA 3P6LA 2WWCA 2ZUMA 2NPXA 4KF1A 3VD3A 1VP5A 1JXKA 3G1RA 2V69A 1MDLA 2ASHA 3P0WA 3WH9A 1YW1A 4ZQPA 1HX0A 3CZ8A 4X63A 5KSWA 1ZL1A 5HNUA 2C1HA 1C91A 3IK4A 4O1FA 3I4EA 4I7WA 4LY8A 3DG6A 5CAHA 3A21A 4HP5A 4GIEA 2GJRA 4JIEA 2X2YA 3MP4A 1GYNA 2HBXA 4RL3A 5T26A 3B0VC 4QAWA 2PDXA 4XTIA 4A3YA 2ZVRA 2D2HA 2VVSA 1N60C 4RPPA 1BGGA 1TMQA 3I6RA 5I3FA 4FB7A 1KM6A 5IHSA 2IKHA 4N9EA 4CN4A 4UBPC 4DWSA 3SRKA 5I07A 2DIJA 4UWMA 3NVVB 1K9DA 4KQNA 5HNRA 4O28A 2H3BA 2PI6A 4M6PA 3RX4A 1KBBA 5M3WA 3HBLA 3I3EA 1SSGA 3M5YA 4FHAA 3HV8A 1YLVA 3G3DA 3NYZA 3W0KA 4JN6A 3UERA 2FGBA 1OCQA 1JDEA 2ZXQA 5JUVA 3CT7A 3H8AA 1W5MA 3CH0A 4LW7A 2J6XA 1WCGA 4O12A 3P84A 5CGTA 2QT3A 1DJGA 5EYWA 1EWEA 2GK1A 4GQ0A 4US6A 4HA1A 4LT9A 3A3HA 2GVYA 1G0CA 3FS2A 4ACYA 1EC8A 1YPXA 1U1UA 3S0CA 3QR0A 4AHPA 3S5SA 1NEYA 2ZZ4A 2WMGA 3SN4A 3C0SA 3QM3A 3H24A 2VFEA 4G5DA 4IFKB 3NFUA 4EQWA 3W1PA 4QE4A 3UXAA 2XGBA 4L5ZA 3KOXA 4YS1A 1D8WA 3VIMA 3KCOA 1VFFA 2WSKA 1JDFA 2HJPA 3QR3A 4C1KA 3ITLA 3MVIA 1H41A 3B8WA 4PC8A 5HR6A 1V3JA 4KWVA 5I06A 2R1LA 2WWDA 3BL3A 1DORA 2QYGA 4H9ZA 2ZUNA 1XD1A 3GH4A 4CNNA 3WUFA 3ITXA 4YIWA 1XLIA 5CG0A 1PYMA 3L4WA 3TQ0A 4J27A 5D2XA 3MYOA 4C6CA 5DRIA 5A6LA 3BC9A 1A4MA 2EG6A 1C8XA 4P8UA 2CHRA 4B5NA 2EPKX 2BCPA 2DORA 2OQYA 2PTXA 2V2HA 1IWPA 3LBMA 1I2NA 3E2VA 1XIEA 2WOIA 5HNTA 2ZVIA 2C15A 2WZHA 3ID7A 1C3FA 4UZSA 1YADA 2OSWA 1YTKA 5HPCA 2X40A 3EF6A 4QJ5B 1OY0A 3DKJA 3A7RA 2RFGA 2XTKA 3B8UA 2FVLA 3LOTA 3PBMA 4E2OA 3RGTA 4YWIA 1AJ0A 1TZ7A 5HPOA 3L4YA 4O50A 4H8NA 1PIIA 1JGMA 4WEVX 4M6UA 1ONWA 3KP0A 1NHSA 2VOMA 1NDYA 4V1YA 4LBUA 5BOFA 1PCKA 2J62A 3AHTA 5LZLA 3AYSA 1WOAA 1PV8A 1BTMA 2WHKA 3GG7A 2PZNA 1MQQA 4JPGA 4P7LA 4CCDA 3F5KA 1G69A 1HFBA 3C61A 2ZZBA 3N4FA 3R8GA 2CKSA 5EPDA 1UIOA 3WELA 4Z08A 2QJGA 1W5OA 4IG2B 3ZJKA 2DSVA 3W2MA 3WLSA 3DIPA 4HT3A 2QJNA 4S3CA 2E7FA 4EMIA 1QVBA 1SU5A 3S3GA 1OX4B 1WZKA 3PPGA 1W56A 1A50A 4HYVA 2YB1A 2G41A 3HGOA 1LF1A 2VRKA 4FLSA 3I68A 1XCFA 1ZTVA 2D69A 2QVNA 1T40A 3KTSA 4Q8MA 3FYOA 3L2IA 1D3GA 3CGDA 3LDVA 3DFNA 1N82A 3KW3A 3NVTA 2X30A 3WQWA 3KBWA 1BLIA 1JCYA 3UESA 2WK2A 4FX6M 3FAXA 1V03A 3KVKA 5CZSA 3SUUA 4O52A 3WQ8A 4BQ4A 1VDVA 2WQDA 4IQLA 1V6YA 3ES8A 4WSJA 4LALA 5AVHA 5PTDA 4XB3A 3UXLA 3EB2A 3PB2A 4XZIA 5M2FX 3A4WA 1CXEA 3GHRA 2YCEA 3NURA 1E6QM 3RFAA 4MVAA 5D2VA 1XBZA 2V5CA 3T05A 3R11A 3GTHA 3T2QA 2XIJA 4EF9A 2VURA 3KX6A 1IEIA 2IXVA 3DK4A 4HNUA 2CWXA 2XIMA 4PCPA 3WDPP 2PU1A 2W27A 1WDPA 1Z3NA 3W86A 4MY1A 3TXVA 3WH6A 6CGTA 1PPIA 1N2VA 2H9AA 2ZC8A 4O8AA 3CIVA 4TTGA 1YXYA 1PHQA 2EEXA 3CUHA 2Q02A 5FJRA 4ZQRA 1XH0A 3B8IA 1NSJA 4A8LA 3G18A 3WF4A 1AQ0A 3MSYA 5EBKA 4BQ3A 1OG0A 4DZAA 4S3JA 1GG0A 4QR6A 2OZTA 3XISA 4MSSA 1FFQA 4TUFA 2WM0A 3NG3A 1KFBA 1FWGC 4W88A 5F1UA 4CVUA 3VD9A 3TYDA 1GUVA 3DFSA 3GNRA 1AMKA 1SM9A 1YQ2A 4MJ4A 2DSUA 3GM8A 2BY1A 2E9MA 1O1ZA 1TREA 1V0MA 4M3PA 1TV4A 4NJJA 4FOJA 4M6QA 3WLNA 2I7GA 2WC4A 4DN1A 2GVEA 4UFHA 1TWDA 3L4VA 4LPCA 4K38A 3WLKX 2NQZA 3TNOA 2I14A 3V16A 2XWEA 4ES4A 1CGXA 2PBOA 3C0JA 1GVSA 4RNHA 3ZS4A 2WV8A 5A6BA 4PULA 2HK0A 1TX2A 4DBSA 4C6QA 3VE7A 1ZB5A 2XIOA 3NGJA 4UTHA 2NVKX 3W7OA 3N6HA 2QKFA 4S3FA 3B05A 5CG7A 3PNZA 4PEEA 2ZFAA 3W7QA 3SRFA 3A7AA 4Q4MA 6ALDA 2FHFA 1K8XA 1UBSA 4AWSA 1KXQA 3VDGA 2JEQA 4OT7A 3VNMA 2VR2A 3W7EA 3DGHA 1IE7C 4CN6A 4LUSB 1F4AA 4QLJA 5FS6A 1ODUA 2Z25A 2JGYA 3IUHA 3C2OA 5D2WA 3EDDA 2OEJA 4WLCA 1IXOA 3T0TA 2PWDA 1JFHA 3K8LA 4JTSA 3RAOA 3IGHX 4CCCA 4IMDA 2Z1XA 4GYKA 4NVTA 4IMAA 3R0KA 5FSEC 2WZTA 2VC7A 3H22A 2J79A 4TQTA 1NFBA 2P5NA 4JX6A 4P7QA 6REQA 3W7CA 4UMBA 1HKWA 3EOSA 1H51A 1LL6A 1P4CA 1PBGA 5CH9A 2WHJA 4B4FA 4NNBA 2O92A 1X8FA 4BQ5A 1GT8A 1FP8A 4M8UA 1U5VA 5MHBA 5D9MA 3V5CA 1TELA 1UP3A 3FGCA 3U2OA 4Q8WA 3BLKA 3JRKA 3GSMA 3ABOA 5DT5A 3ZFHA 3ARXA 1AZ2A 4AWEA 1GYLA 2CBVA 2NWSA 4JQ4A 1GTEA 1EPXA 2XSBA 1RK5A 4JX4A 5KMYA 1O1HA 2QV4A 4OOUA 3TONA 3U6WA 3LHYA 4XBSA 4AC1X 3I3DA 3WENA 1FCUA 4TR9A 4M81A 3D9XA 2NV9A 2XH7A 1ELSA 2OXNA 4LA1A 3UG8A 3MBDA 3VIJA 1VJZA 3UBPC 4I9JA 4N2YA 4APNA 1PX3A 1ESWA 2VZSA 4A3HA 1TA3A 1E6NA 7TIMA 1XIBA 1EGMA 3HPFA 1KA9F 2JKAA 1T96A 2WCGA 1SZFA 3GFXA 4URIA 1YE4A 2EJ1A 4GX9A 1P0BA 2YCJA 2J13A 3PBVA 3IUDA 1XJBA 2PTDA 1AVAA 1E6RA 4WKFA 3DCPA 4HCDA 5I3GA 5IRPA 3MI3A 4WSKA 3UNDA 3D3AA 4JTKA 4FX8A 4PSPA 3CYVA 3FOKA 1H3GA 4FNTA 2PRMA 1NHQA 3GYEA 4L4PA 4HZ6A 4L1XA 4L64A 2GGIA 2DT2A 3CEUA 1ZGDA 5LIWX 2PWGA 4HQVA 2O7SA 1VPQA 4JQ2A 3TN6A 2WMKA 2XH2A 4YCPA 4EM3A 1JDCA 4F79A 4RR4A 4XZMX 1PZ1A 3NM3A 3S46A 4DBWA 4NX0A 3ATZA 4ZE4A 2FPTA 4AQLA 3O0KA 3KVMA 4Z1YA 5BYWA 4MY9A 4DAFA 3SUSA 5EU9A 1FKWA 4G1NA 1WXYA 4PTNA 4GYPC 3S8HA 1OGBA 1X6UA 3ANUA 2YCIX 5HUOA 3IJ7A 3O9NA 1T0OA 4LVDA 1VQTA 1FOBA 2VI0A 3MC5A 1IT8A 1H2IA 2XVKA 1VFHA 1DIKA 3U2EA 3CGEA 3U8GA 4CQDA 4GA8A 3VNIA 3VNLA 3PJUA 1O60A 3GYCA 2OB3A 4OV9A 3VKDA 3WLRA 4E8DA 5C2XA 1E9IA 1BWKA 4US5A 1HJSA 1WUEA 4R33A 3W85A 1JZ2A 5F2LA 4N6FA 3WO8A 3SO7A 3QW3A 5A6MA 3CHDA 4L1WA 4ML9A 3WFLA 1HT6A 3A23A 1T99A 3UD6A 1O66A 3IGUA 3UGRA 4HPXA 3VZZA 4A6GA 1ZBWA 1HP4A 1CB7B 4JIQA 4AD4A 1EUNA 3OZPA 2HS8A 1VCFA 1P6WA 1XRSA 3EKGA 1CX9A 3F2DA 9RUBA 1XGEA 3NDYA 4HK7A 3PTDA 1XDIA 1OIMA 4X9YA 9XIMA 3MI2A 3G1YA 4RJEA 3JS3A 1I0BA 5I3DA 3UZYA 4IX0A 2W4XA 1JYNA 4C7GA 1FIQB 4NIRA 2DW7A 2PP0A 3QJAA 4KGJA 4NXKA 2FJUB 6TAAA 2GVLA 1X39A 4ASTA 3LM3A 3NNTA 1CBGA 4AF0A 2E6YA 2PDNA 1EF3A 3APYA 4IOTA 1W1B1 2ZXDA 3LPGA 3MW7A 2VCBA 3DX5A 4MNKA 2Y6ZA 4CQCA 3BV4A 4EPKA 5A6JA 3FN9A 4GQQA 3BLIA 2OZ3A 1P48A 3TYEA 3RDKA 1TPC1 1VPYA 1NOWA 4CVWA 3GXDA 1AD1A 1UWQA 4W85A 1QWGA 5F2MA 4JIHA 3BAKA 2J25A 1X96A 1E70M 3WH7A 5BWAA 8XIAA 4PCNA 1VYPX 4GVGA 2W3RA 4O1EA 1NWSA 1W1IE 5CZ0A 2J78A 4WY0A 1EUAA 3FJ6A 1W3KA 1ONEA 1SR0A 5CPOA 1R47A 3DYOA 4C65A 4FOKA 1W2VA 3LHVA 2PLKA 2W9MA 3VDAA 4K68A 2YCLB 4FOUA 2NV1A 1EEPA 3QSTA 4AISA 4H9UA 7PTDA 2OOFA 2QQ6A 5HNNA 4JEQA 4GZ7A 4F2TA 3PAOA 1WOBA 5RUBA 1Q8AA 2EQ8A 2J9YA 5HK4A 2I9UA 2DFAA 2NUXA 3VVGA 2YIHA 3QY7A 1CTNA 4NU7A 2GUUA 3E5PA 2Y85A 1HL9A 4DI9A 7XIMA 1KR0A 1BSLA 3GR7A 1R3YA 2DZWA 2QVHA 4DRSA 2A7PA 4S23A 2Y8UA 1KWGA 4PGLA 1XSJA 4WOQA 3EWDA 4H4PA 1WDDA 3WBYA 3RYSA 1XP3A 1QPOA 3KE0A 3W75A 2QJHA 5TF0A 1EHNA 3V75A 3N6JA 3P5ZA 1NDZA 1RLCL 4IGSA 3DFPA 3KBMA 1RVGA 2ADAA 4XG1A 4H4XA 1E5NA 1B3WA 4H9TA 5KINA 3NQGA 4WKAA 3NVWB 3RRXA 3AC0A 1AL8A 1YX1A 1X7IA 3V0TA 2NX9A 4YYCA 4XZNX 3FSTA 3UCQA 5E0FA 1IXNA 3CT2A 3NXLA 3HFTA 1EA0A 1QCWA 4CEXC 3WUEA 4XK2A 4JZ5A 5AYIA 3AXKA 1TJPA 4HHHA 5FAGA 4F0RA 2XINA 1RBLA 1XLHA 3APGA 3R5EA 2Q3RA 4NAFB 4ATLA 1XINA 4B3KA 3H2FA 2YQUA 1TUXA 2W79A 3ZJ6A 4RZ6A 3SCRA 3AIVA 3LY0A 4HNCA 4HSNA 2QUVA 2BGSA 3B03A 3QBUA 1X1OA 4AMAA 1UR1A 3N19B 3LYEA 1S2UA 4FNPA 2PURA 1N8WA 4M6VA 2XFFA 2NSOA 2QJMA 4GFIA 1FRBA 5TQLA 1EOKA 2IUZA 4OOZA 1V97A 5I24A 2V30A 5AFDA 3PZGA 4K7ZA 1XC4A 2AMGA 1XRVA 4H9VA 1STZA 3UETA 3VIHA 3LPPA 3DBNA 1RBAA 3TSDA 1ZDLA 1UA3A 2PCQA 1BQGA 2F9RA 1WZMA 2F8QA 3QQ1A 3LENA 4EXBA 4F9JA 1FFUC 4N4QA 4YN5A 3LMZA 1RQHA 3W25A 4HCLA 4QITA 4AD1A 1ZU8A 1XCWA 3FYPA 3LCXA 1UKOA 4FR1A 3GU1A 3T42A 5ABEA 3QF0A 4GIAA 3G8RA 3N25A 4JNYA 1VFTA 2EBNA 4IH3A 1KTNA 1UA7A 2ZUWA 3WD3A 2PDBA 3GW3A 2V6AA 3FLUA 2Y5EA 3NL5A 4KRTA 3GDKA 1UH3A 2IKIA 3DN5A 3NTYA 3AIRA 1KM2A 2BV9A 3MMTA 1O5KA 1W9XA 3MWCA 1Q7MA 1XIJA 3LXBA 3C2YA 2WBGA 1H7OA 1LG1A 2NQLA 1NPXA 3GXNA 3UFYA 1Q1RA 2IS7A 1TQJA 1UWAA 1TE6A 3W29A 3DDMA 1ZY8A 4MWAB 4DNAA 3PR2A 5K3VA 4QDMA 3TLQA 4AXKA 1FQ0A 3EWYA 4ZEPA 1HO1A 2ABBA 1EBDA 1H5YA 2OEMA 4DXKA 3CUFA 4JX5A 4RCXA 1Q13A 1YXCA 3G0XA 5DMYA 3DKLA 1TTIA 3C0LA 2D1ZA 3PPFA 4ZXLA 1TYPA 3L4UA 2GVGA 3RM4A 3VFCA 4IJCA 3A7UA 5G5IA 1W1PA 3QKEA 4HJWA 3TTOA 2WAGA 4E2VA 3W37A 1GQLA 2CZEA 1EJWC 2JK2A 4H04A 4UB9A 3W1NA 1PHWA 3JZUA 4ADTA 4MG4A 4D6DA 3MTWA 3ZR4A 3HQNA 1SR9A 2QNEA 2BC0A 2C3DA 2XZ9A 1MRQA 3UR2A 3C2VA 3AHYA 5DN1A 4IPJA 1I45A 1M7OA 2BY0A 1XG3A 1HW6A 5BU6A 2DEPA 4PUWA 3EOOA 4W8AA 1UG6A 3CQIA 5IBXC 2Z2BA 1TB3A 3E96A 1K7XA 3EEZA 1QTWA 3CUIA 1JF5A 2Z7KA 1UP0A 4GO8A 5DANA 5CJMA 2DU2A 3U7BA 4YLWA 1DJIA 1UUOA 2W61A 4GIYA 4MZ1A 2QCNA 3B8VA 4Q8UA 4I90A 2V3AA 1GQKA 3AOFA 2YR1A 1JR1A 2FTYA 4FK9A 4AZ6A 3LZ3A 3IJDA 3LNMA 3VKJA 1S38A 2AQOA 1XIMA 4PRWA 3SBFA 1UZ4A 4MNJA 2PFHA 1R3VA 1EP3A 2FB3A 4XIAA 3L65A 3SGZA 3UWWA 1NAL1 1C7TA 2XDFA 1TIWA 4GYPA 1PTAA 1W9UA 3A9BA 2QW5A 5CBIA 3L0NA 1XYZA 3SAZA 1V3KA 4WD0A 5CSUA 3C8NA 4H9YA 1REQB 4ADUA 1BTCA 3K4AA 2Q3OA 2HBVA 2F84A 2C8NA 4AD3A 3UXDA 2C79A 3A12A 4P2VA 2VFGA 3BAIA 5D8ZA 2ZADA 1MMFA 1V51A 3TROA 3S1VA 3TYBA 3VC6A 2Y0FA 4ZQCA 3MDWA 3R10A 3M46A 3WDIA 4JCMA 1GJPA 1TPDA 2X0HA 4GJJA 3B04A 4V28A 3G24A 3VNJA 2QCLA 2XFYA 2OSYA 1UR4A 1IIHA 3S9YA 1KM0A 3OQ8A 1KBIA 3G1HA 1XLEA 3N18A 2QCGA 3GAKA 1LM1A 1G4EA 3W7DA 1VFMA 1A5OC 5DX7A 2YPIA 2KAUC 4Y8FA 1DJHA 3LHTA 4GWEA 5REQB 2Z27A 5I0DA 3NPXA 5LKYA 4DYJA 1FH8A 1XIFA 4JCLA 2PDJA 1VFLA 4PMYA 5EBAA 4H6KA 2RDUA 4DPQA 1UR9A 2GR0A 4H41A 4O17A 1B30A 1GVEA 1GZGA 1DQWA 3L68A 4C7FA 3GLCA 4J3VA 4QLLA 4ACZB 1QPRA 1OT2A 5BROA 4R5EA 3A6OA 5E09A 4XZHA 3THDA 3N3MA 4QTGA 1Q6OA 4H4SA 3BWWA 2Z00A 1H63A 3RK8A 1Q6CA 1MRAA 1R86A 5FF3A 2AGTA 3T4CA 3W1LA 1JQVA 4PRTA 1UJPA 2VJXA 2VHLA 1RJPA 1ALDA 1ZBVA 2Z2UA 3KLKA 1O68A 2I57A 4H7VA 1GESA 4DIAA 1QNPA 2AL1A 1OF6A 2PD5A 2RHGA 3EBVA 3U2CA 2YL9A 4XO7A 2GYIA 5AVNA 2O9TA 3NXFA 5IFTA 3PPCA 4EK7A 2YW4A 1YYAA 1E56A 1Q66A 5DY3A 1JFXA 2VFFA 4PTWA 5G5HB 4PL2A 2XGIA 3W01A 1GOQA 3O8AA 1OVDA 3NQ7A 1ZNNA 3W7NA 1XDLA 4FALA 5I3IA 4FX9A 4S3KA 1AA1B 4GYFA 1GOXA 1CYGA 3F4DA 3H4GA 3QVQA 4RE3A 3FHAA 2E28A 1KTCA 4H4RA 1ZP3A 3K4DA 5I5RA 2RKXA 2DZPA 6PTDA 1GREA 2WKLA 3QH2A 4PSRA 1ZJHA 1R8LA 2GLKA 4W86A 1U83A 3ANYA 3GKFA 4FO4A 4MNMA 3OVRA 3TA9A 1TJ0A 2I16A 2OQLA 3JZEA 3FVDA 8CGTA 4YVXA 1F61A 4JTIA 3W1QA 4CUCA 4O14A 3EX1A 1W54A 3THUA 4K7YA 4AVFA 2EKCA 4K8GA 5A8NA 1EKOA 1SVDA 2Z4GA 3MB9A 5JMUA 1UASA 1QO2A 4TXEA 1UD3A 3B4YA 3LGGA 4ZO8A 3P82A 1E1EA 3WN6A 4UUIA 3PSVA 2YL8A 3A5VA 3ENLA 1KM3A 3WH5A 3AIWA 3S47A 5D9PA 2BY3A 3H6OA 3GHUA 7REQA 3GNPA 3GR8A 2V3FA 1V4YA 2YDAA 3D0CA 3WLLA 3BLPX 4E2BA 1OWQA 3HFYA 2J4GA 2JKPA 5CPQA 3DGBA 3ORWA 4J56A 3NEVA 3PTMA 2E6AA 1GONA 2YYUA 2EKGA 3C8FA 3HG4A 3FKRA 2C1IA 3S42A 1EL3A 2WPBA 4H4VA 2EHHA 1M53A 1U5JA 1EH9A 2ZX5A 2G96A 4CNOA 3M0IA 4XUGA 4F66A 3C4UA 4ZCWA 5TBOA 4XBKA 3WQ6A 4FR6A 3LHZA 4A05A 4X2PA 5U7SA 5GPRA 3WUGA 1EJTC 4BFAA 1VFOA 3CAVA 3LCFA 4PEKA 1KLYA 4JYDA 2AL2A 3TJLA 1J0ZA 1FXPA 3W7GA 4A2RA 2OZ8A 1UCWA 1XISA 4WJEA 3DGRA 3OLEA 4M24A 3CMFA 5FS9A 3NQ8A 2HVMA 1XR2A 2V81A 3NVDA 2WSQA 5C9WA 4UOJA 3UNTA 1GEUA 4DF0A 4WZHA 4J1OA 1AQMA 4M7TA 1PVNA 3WJWA 1F8IA 4UTKA 4ZFCA 2VX7A 3PUDA 4REQB 4C6OA 3NQAA 4Q8TA 3OP2A 1CW2A 4CD8A 4Y8EA 2PUZA 2Y89A 3QHMA 2YL6A 3WLMA 1V3LA 1GKQA 3J7HA 4JHZA 3TX9A 4PODA 4AX7A 4JTFA 1ONXA 4OU1A 3VIOA 3B40A 1D8CA 1V8EA 3AXXA 4O16A 3UZZA 3DYPA 4QE1A 1X2GA 5EMUA 3RJYA 1US2A 1VD6A 1BF2A 2BFGA 4GXPA 4AIUA 2DZAA 2HE5A 2Y1HA 2J9ZA 3A3WA 3LLFA 4ONVA 1W1YA 3COTA 3M43A 4LV4A 4AIBA 2VQTA 3W73A 5LXEA 1G4PA 2A7NA 4Q8NA 1V6UA 4W9TA 2Y61A 4HOWA 4UTTC 3URNA 4JY8A 2ALDA 3N2MA 3KCJA 1ML1A 1JYWA 3UR8A 1EJVC 2XN0A 4XISA 4H4WA 2WQPA 4U10A 2GUYA 3ZLFA 3CHFA 1FCBA 2FKPA 2WHLA 3AMZA 2KX9A 3S9IA 1KFEA 3ZWTA 1W3IA 4N9DA 1LJYA 1FWDC 3PP7A 1VS1A 3N9SA 4CCZA 4K1GA 3CV1A 3MDUA 2VDIA 4Z0JA 4LGXA 4AEEA 2J7BA 3HO8A 3PBGA 1LCOA 2YFNA 1L6FA 4UC5A 4JKLA 1G4TA 2VKZG 5JXQA 4LEFA 2WSYA 3AHVA 1EBGA 5EB8A 2IXUA 3VKBA 4U31A 4GXWA 3QMSA 4LBRA 2WZIA 3KXQA 1EP2A 1DYSA 4FF7A 1PDZA 4HSOA 5FF4A 4J5NA 4OBSA 3EUB3 4Q22A 3FCPA 2QCHA 1P0NA 1IZKA 3CWOX 1E0VA 2RDTA 1CLKA 2QPSA 2CDUA 3MZNA 2G3MA 3F5LA 2BVWA 3II4A 3OIXA 4MKVA 2SFPA 4IMEA 1KXHA 2WM1A 3NEHA 4HMCA 2VEKA 4PBEA 5CPSA 2WZMA 4XV0A 2WKGA 1PIGA 3TAOA 1MZHA 3RU8X 2VR4A 3U7VA 3BK0A 4BF9A 2J88A 1GZ1A 3B0YA 3LLDA 5HR7A 3TOPA 3BZGA 1IWBA 1G4SA 3C6CA 3SW6A 4EXAA 2DZSA 4BF7A 4F0MA 3O15A 1GKPA 3VD5A 4GXMA 4PUKA 4DF2A 2HVOA 4UZUA 1Q8JA 1DXEA 1H7RA 4UTJA 2WCSA 1JRCA 3WX7A 2DT0A 3GK0A 2I56A 3QV8A 2E5DA 3GNNA 4TO8A 2CZDA 1WAUA 3BLEA 3TUUA 3NQFA 3T8LA 4UOZA 2O9PA 1P1XA 2WJFA 3M0JA 1FCQA 3WK2A 4Y9PA 2XISA 2VXNA 1Y65A 3GVVA 2OO0A 4HVXA 3PZMA 4BV6A 2CCRA 3M64A 3GZ3A 3AYVA 4LOCA 4DVOA 4RV8A 1OJTA 4RXFA 2OR2A 4IQEA 2TRSA 1KNWA 2AAMA 4R85A 3WQFA 2W3ZA 4M29A 1V3HA 3M16A 1XCXA 2Z2AA 4ZO7A 1E73M 4KH2A 1A5MC 1P0EA 1FTXA 1QI3A 3R79A 1BPLB 4FXJA 2IW0A 2FHBA 3FY1A 3BANA 2CLHA 3QMTA 5IXEA 1ITUA 3IV8A 3H2MA 5BCAA 3HPSA 1LUCB 3W1RA 3HURA 4B5TA 1X98A 1GPWA 3BLDA 3VIGA 1M1BA 2CLFA 2ZXAA 1Z44A 2FFCA 3ARWA 4PTMA 4N02A 2VCCA 5IDIA 5FL1A 4S3BA 1YPFA 1OX6A 5ECVA 4DYEA 2OTDA 3SUWA 4XQ6A 2PMQA 4QEHA 1RA5A 1MNZA 4XAPA 1JPIA 3V35A 2DSKA 5CPLA 1TV7A 2YA1A 1BEUA 5HOSA 1J0IA 1RUSA 4TX9A 3ZM8A 4ACZA 4WDWA 4HPGA 4JQ3A 1GJUA 2VD9A 4KEMA 3NL6A 3L67A 3O1NA 3NPUA 3UY7A 4K2SA 2QF7A 3WQVA 4JHMA 1I2QA 2H8XA 2XGZA 1R3SA 3TEVA 3AMGA 1A5KC 3M47A 2G4FA 1AW2A 4MPQA 1FWSA 3A4JA 4HIBA 2QDDA 2PDLA 1NY1A 1PX8A 3LCGA 4LY4A 1R5YA 1ZQ5A 3HF3A 2GJLA 2JF6A 3NQMA 1UUMA 3VK5A 4UQBA 2Z7GA 1UKPA 2V5JA 1ISVA 3ABQA 4R9OA 2W3SA 1I1WA 1ZENA 3DI0A 2ZZ7A 1NDWA 1AG1O 4IF2A 3BLOA 1WA3A 1DL3A 4JBRA 3QTGA 1CNVA 3C5QA 2WC7A 2VUYA 5HATA 1EF2A 2AOSA 2ZYFA 1X2HA 4NY2A 4PUDA 1RA0A 1QDSA 5I3JA 2Q6ZA 2O7QA 3QZ6A 5CKSA 3UYCA 2Y70A 3M0YA 4HJFA 2VGBA 1X8CA 3EB3A 4XAGA 3SCUA 5KZDA 3H2CA 4UQEA 2E77A 1TV8A 1RY8A 4Q7NA 5E93A 1DJXA 1IF2A 1GRBA 3DFTA 1FA2A 4ZVJA 1DTNA 4GC3A 4O57A 1W0MA 2E3ZA 3H2NA 4H2HA 2I17A 4S38A 2E6DA 1QPQA 4I5UA 4Q4QA 3A47A 1SB3B 1GRHA 3AWOA 3S5YA 5H8PA 1EFZA 3W1UA 3EPOA 1XICA 2DZUA 4F0HA 3FX4A 4LB4A 3KVLA 5HQLA 4EQRA 1BGAA 3VCRA 4BEUA 4EM4A 4AD0A 2KZHA 3M0ZA 1WAWA 4UTTA 1NP0A 3E2QA 4S2CA 4NJGA 3LB8A 1PYFA 1DJWA 4D6FA 2YZRA 3DERA 1DKWA 4FPSA 1JD9A 4JFTA 2A79A 3AS0A 1AH0A 4EKJA 2CFFA 2Q09A 3M0VA 2JKEA 5LIKX 3N17A 4NILA 1WKFA 2OLSA 4WVXA 4U5IA 5XINA 5G4HC 3VO0A 1MW2A 3CTTA 1JI1A 3SI9A 3UQNA 2O4QA 5JVLA 2A8XA 1WE5A 3OODA 4D6GA 1SZEA 4H4IA 4PBFA 1S1RA 4QG6A 3UG4A 3MVTA 1J12A 1AMYA 1XI3A 3MKCA 2FH8A 1X6NA 1XSIA 4P7NA 2DVUA 2V9DA 4UNKA 4C1NB 2NVDA 1J18A 3WBXA 3NPVA 2DJLA 4DJFD 3BSMA 3D46A 1CGWA 4N4PA 2IMRA 1V79A 2OSXA 1KFWA 1FWWA 4LNCA 4M51A 3O63A 3E0VA 3CXBA 5AC5A 4CNSA 1CLVA 4I3GA 3AMLA 3CB3A 1XS2A 3IIPA 3FA3A 1LROA 1AZ1A 4JYFA 5GJPA 3T81A 3UY8A 4JGDA 1J0YA 5BOOA 3IJLA 5BU9A 1RXOB 1RALA 3OA3A 1QBBA 1K7FA 4Z2LA 4MAZA 3HG5A 3AIUA 3CQ0A 3MO7A 2HTMA 3VOCA 1A5SA 1FVPA 1MUMA 3FXYA 4OFCA 1W9DM 3FK4A 1S3TC 3IJQA 1Z42A 4U33A 5AC4A 4O18A 4TMBA 1BYBA 1GNXA 2GZXA 2INFA 3WFZA 5EBUA 5AHFA 4BURA 2WC3A 2UBPC 1OK4A 1ICQA 2ZRXA 3DHDA 4BK9A 2Z6JA 4DJEC 1F3EA 1TJ2A 1ZSXA 3GY1A 3W3OA 2CIPA 3CUZA 4O19A 5KZ6A 3H26A 4D2JA 1FDZA 2INEA 4PMQA 2H6RA 4Q4PA 3A9IA 3LBOA 2WVUA 5AHIA 3OC4A 3N14A 3RPDA 3M5XA 4LUYA 2WJZA 2XN1A 1Y7VA 2BDQA 4JTTA 3UZWA 3QPZA 1OD0A 3W23A 1CXFA 4UFLA 4AEFA 4WJXA 5I00A 3AZTA 1BWLA 4A29A 1NDAA 1PIFA 3N9RA 5K4ZA 5IFPA 3BOFA 5I23A 5A2BA 3AZRA 1LG2A 3L5MA 4XUYA 3ALGA 4I5RA 3T4WA 3N34A 1QPNA 1LDCA 1H49A 2GR3A 1W3HA 3NQVA 2J7EA 2Z1KA 1ODZA 2VNCA 3GD4A 3B0UX 3L5AA 1XX1A 2J3NA 3KOYA 4W89A 3CLWA 5AOUA 5REQA 2ZX9A 2QLYA 3OLDA 3ZXWA 3DEQA 2FH6A 4EVZA 3S4TA 4W5ZA 1Z89A 2CBJA 3UA4A 2ZBTA 2G5WA 2WKJA 1UC5A 1I60A 4A22A 4ICCX 1OFRA 2HPIA 1TV3A 2OO6A 2ZE0A 1A0CA 2W54A 5JBEA 3C86A 3G6MA 1XLGA 1MEHA 3IWPA 3BDKA 4GBUA 4INFA 4PMXA 1F74A 1GVRA 3A5FA 1OYCA 1UR0A 1K7EA 1WB0A 2W63A 1MNSA 2ZIDA 4TU1A 2BXYA 3V1PA 1JZ5A 2HEJA 5G1MA 3G77A 3GXMA 3WNMA 3UVAA 4DLFA 3SCWA 5FIPA 3FDKA 3VNYA 5FSDC 4YTRA 1UKQA 3CV2A 1QU4A 5E0KA 5E6ZA 1LYXA 4J2PA 3BGAA 2E8YA 1GZJA 3TZNA 4L4MA 3O2LA 3T2OA 3M4HA 3VNDA 3HPZA 4LYPA 2QV5A 1R6WA 3W71A 1LPFA 3CHVA 4UNIA 2PDYA 2PC8A 3FSUA 4HCHA 1OYAA 2OQHA 1W1VA 1XFCA 4GISA 1ISWA 3PFRA 1UWIA 1H11A 2NUYA 3PANA 2ZTJA 1AW1A 3NVYB 1M9HA 3W6YA 3CIXA 3RLGA 1DWAM 1WZLA 4ZOEA 4HMEA 1OFPA 3PVFA 1KBLA 4U3CA 4JFUA 3B06A 2DQWA 3S5ZA 4AAJA 2OYLA 2G4JA 2XFWA 4LTSA 3BUVA 1UPPA 1JVNA 1BQCA 3VU2A 4QDPA 2PZ0A 2BVDA 3S6TA 1RPKA 3VIIA 3WNLA 1VLIA 2GJXA 3M7SA 4GFSA 5B7ZA 1D3HA 2W91A 4Q7IA 5FEPA 2BBFA 4IQDA 4NXSA 3F1QA 4AY8A 5XIMA 1GYMA 1SJDA 1YDNA 3TWAA 3SURA 3IIVA 3HPXA 4RZ4A 2QIIA 2B0MA 2FVKA 4L65A 2P50A 1QI5A 4LS2A 3BGJA 3RIKA 3W24A 1UR8A 1AQFA 1ZJIA 4L7ZA 4IWWA 4JNMA 2C91A 3WNNA 2RDXA 2ODOA 4JR5A 4V27A 1P43A 2QCCA 1EXPA 3PUGA 1RY0A 3VIFA 4A8NA 1UROA 4KPRA 1OB0A 2ZOXA 3UW6A 3R13A 4FAMA 3WDQA 4IT1A 2PDCA 5FJJA 2VFHA 3R2GA 2OFJA 4AZGA 4I9AA 3NAVA 3EKLA 3E5BA 4AVOA 1M7XA 4JTHA 5B7YA 3EEGA 3I3BA 3HGRA 3B9DA 4F8XA 2FTWA 3P3BA 2YJQA 4M56A 4W87A 4EPDC 2ZUTA 3EX2A 5I02A 5IM51 1S2AA 4H1ZA 3E0LA 2E09A 2I9EA 3TNBA 1KTBA 3GQYA 2HNHA 4O1CA 2NLIA 3UZXA 4LSBA 4C6LA 3L4XA 2ZTKA 1MFVA 1V02A 4V1XA 2AAQA 3CC1A 4GE8A 2WVVB 2WJEA 1F76A 1E3ZA 4QSFA 4G6CA 3R0DA 1BZLA 2ZZ1A 3H7RA 2V5DA 4RW5A 4RLIA 4MHBA 4E8GA 1GK8A 3AIEA 4C6BA 3CMJA 4JQAA 4K1WA 4D6CA 1BVZA 3AXMA 1OC6A 1OFBA 4JTRA 3BW4A 3NO3A 3VX0A 1E4MM 1RD6A 3OG3A 1L8PA 1E51A 3BLFA 3WLOA 4O1BA 1QNRA 1ZAJA 3PZ9A 4J28A 3VOFA 1O5XA 1EO7A 4RXGA 1F8WA 7TAAA 3M44A 4UTWA 1GWJA 4XZBA 1RP8A 1KV8A 5A6TC 4ZODA 3FDGA 3KZPA 3SQLA 1S2WA 1MZRA 4NUWA 1H7NA 3FKKA 2WVVA 2W6RA 2ZA3A 5JBDA 1DVJA 2R14A 1YBQA 5BXTA 1G7UA 1C8QA 4MKSA 1IYXA 1US0A 4L1GA 4DWSB 2GJPA 5DCBA 5DT7A 5BWFA 2WBAA 4DZHA 3RX2A 1E9ZB 2WOVA 2NUWA 2VGGA 3QLDA 1DIOA 1E4LA 3PTKA 3W4RA 4NHVA 3AZSA 1DQXA 3MUAA 1E72M 1KV5A 3LUTA 1YPIA 3TMQA 1GOKA 3QRHA 3AM9A 1HUVA 3ONBA 2E40A 3POCA 3BSGA 2QAPA 2ALRA 5D33A 3ARZA 3TXZA 3CAWA 1VCVA 5CAKA 3KVJA 4GYJA 1OK6A 2RGMA 2F6XA 1O5QA 3DJJA 1PKNA 3W26A 3HM7A 3LCWA 2VZVA 1QMLA 4EF8A 4N9BA 3W7KA 3WD4A 3SQMA 2XVLA 1J6OA 1EWDA 4CNPA 2A3AA 3U4AA 2ZKMX 3STEA 4TVWA 2EF9A 2DT1A 2WLYA 3DGZA 2BLEA 1ZRQA 1X38A 3M07A 2NQJA 1SO4A 3MMDA 1RZMA 5DMLA 2Y8VA 3LCIA 1I2RA 4PMUA 2EO7A 1MW0A 4M80A 4J35A 4H4TA 2HS6A 3WDJA 1OIFA 3DK8A 4IQJA 1PL9A 5EFDA 3GR4A 1R3WA 2VEFA 3PBWA 1N7KA 3H2EA 2GDVA 1SMDA 2WMIB 4Y9NA 5HXMA 3GKAA 1FKXA 2D0FA 1MUCA 1ZX9A 4JIIX 1Y8BA 3IACA 1D9EA 1XYCA 3WNOA 3GG0A 2X1RA 4MWAC 3WG6A 1DNCA 1XIDA 4S3DA 2WHMA 2YXGA 1UHVA 3MMWA 1JPMA 4IZGA 2BXVA 1DQUA 1LWHA 2QIWA 1E6PA 2Y88A 4H83A 5K2ZA 3R89A 4W8BA 3RM8A 4RNFA 4WUIA 5DF0A 4MF4A 3REQB 3MSDA 5CC7A 3HA1A 3TE9A 3VOHA 3TCEA 1NOFA 1ZBCA 1DV7A 7CGTA 3NO5A 2UWFA 1V0LA 3G22A 5ENLA 1XFBA 1EDTA 5J8LA 2ATSA 2R1KA 5HJLA 3LNPA 4GI8A 3T2PA 3TN3A 5LYRA 1IEXA 2I1OA 2YLAA 4KEVA 4UR9A 2O55A 2WW5A 2P0OA 2Y63A 3UG5A 1VC4A 2PP1A 1OHLA 2OLAA 4PUUA 3NSNA 3GC4A 3U9IA 1EC7A 3E3HA 1OCBA 2ACSA 1HIZA 3IS4A 8XIMA 3RNMA 3EWZA 2OX4A 4X2RA 4S1FA 1ONRA 3OOQA 4PA8A 4PUJA 1UMLA 1GV4A 1R38A 1YBQB 3MT1A 4LAZA 4H8UA 3PBYA 2CZ5A 1CI1A 2PDIA 4YL2A 3TQPA 1ZZMA 2JF7A 3EWXA 3TTQA 4IP5A 3MO4A 3AICA 4HD5A 1TV2A 4D1JA 4KGLA 4US5D 3Q65A 4DO7A 2J8GA 1SFTA 1TVLA 1GGOA 3W22A 3W82A 4IXHA 1BHGA 2VWTA 1F3TA 1RLDA 2QR6A 2ZQ0A 3CAKA 1XKJA 2X16A 3VZXA 3B9JB 4NI8A 4DZIA 1O12A 1EX1A 2BZNA 3VCNA 1I0DA 4RV3A 3SQPA 4M7SA 2GQ3A 1NHRA 1QAPA 3K1GA 1UB3A 1JOAA 4HMNA 3V5FA 1JEZA 2PBGA 4H6RA 5U4NA 4HK5A 4MWAD 1YIXA 4G56A 4D6HA 3BLLA 4S3EA 4J57A 5U1OA 1UIPA 3OBEA 1QI2A 3MYPA 4FF5A 3TH6A 3CGBA 2UY4A 4G9PA 3MQTA 1K4GA 3D47A 3IARA 4X22A 2QCMA 2Y62A 3DECA 1VENA 3T78A 2CZFA 4NP7A 5A6AA 5B80A 2ACQA 1F4HA 1E5JA 3VM7A 3FYYA 3EX4A 3TSBA 3QQ0A 5D04C 1REQA 4LC8A 4WXYA 4HNVA 2FB2A 1QPKA 2GQ9A 3DG7A 3AXHA 3TAKA 1DEDA 1K9EA 2OKOA 3A3XA 2OGJA 3CJPA 4P61A 1K8ZA 4HZMA 3GX9A 1TJRA 2B81A 1KGXA 3S1XA 2RAGA 2BG5A 1HKIA 3WDRA 4EXQA 1ZPTA 4O4WA 3U3HA 1FO4A 4TX6A 5CGQA 1F07A 1JULA 1W17A 3VXGA 3CGTA 2CERA 3QOMA 3STGA 1BRLB 3URBA 2C3ZA 3NQCA 1XYMA 3SR7A 3S1WA 5J5DA 1A49A 1W5QA 5MKGB 4ADWA 4LS1A 1JNDA 1I1XA 3WK0A 3ABRA 1QHOA 4P8WA 1Q6QA 5A8OA 3KBSA 2HMCA 2VX6A 4LIIA 4FIRA 2W66A 3ELFA 2GR2A 5KTLA 3SQSA 3LM7A 1EDGA 1S39A 3TR9A 2G3NA 4YTSA 2OJPA 3BPWA 4D72A 5C9ZA 3LCHA 1MQPA 1O7AA 3CK5A 3AN1A 1F7BA 1LVLA 1K3UA 3ITYA 1OFEA 5DFAA 2HZGA 1BVNP 1A47A 4LAMA 2C13A 2D0GA 3WYZA 4MB4A 3W6MA 4AZIA 3CASA 3U5YA 4OJYA 2G37A 2JIWA 4QGCA 3A4XA 3IIXA 4F0LA 3L4ZA 1UZDA 2E0PA 4ZTYA 3NL2A 4HHMA 2AQVA 3OTRA 2JALA 3NS1B 3UGVA 4YTUA 1V7YA 1TVPA 4BI6A 2V0TA 1QASA 5E0CA 3CM4A 3RUBL 3W2LA 2GSEA 2R8WA 2VQUA 4DJFA 1GKRA 3LBCA 3NZQA 4PCTA 1OYBA 4H8VA 3UF9A 2QAFA 3HN3A 4FLQA 2ZRZA 1PTDA 1JCTA 2BX7A 5C55A 4PB5A 1A5NC 1QI4A 1TTJA 1WDRA 3EOUA 4EQSA 3ZJ8A 4KFOA 2CW6A 2VD8A 3GNOA 1OZMA 1JF6A 4KWSA 2WJDA 2X50A 4R7WA 1WZAA 1POJA 2G0WA 3E74A 3U0HA 1ZK7A 3C2RA 2J7DA 4XVEA 4IM4A 3IVSA 2V2DA 3LRMA 4LRTA 3F5JA 3KEHA 3DYMA 8A3HA 3CO4A 3OJGA 1UD4A 4PN2A 3H7VA 1CCWB 4ZA0A 2DSZA 5F1VA 3DH7A 2Y7GA 3PG9A 1DXIA 1DPMA 1V6TA 1YRRA 4LX4A 4B3ZA 1NH6A 3I65A 3VTRA 4ZE5A 1VKFA 3UR5A 3S1GA 4L80A 1YQZA 3V1HA 5CC6A 1P1MA 1SQ7A 2YX0A 5BZAA 2GQ8A 1EEXA 4H7CA 1B5TA 3T55A 3O6CA 3E02A 4JN8A 3VZYA 2P8BA 2C71A 3WF2A 4PTXA 1FWAC 2E5AA 4UQCA 3JU2A 1H5VA 4MIMA 3E9AA 4OV4A 1QK0A 3LV6A 3SSJA 3JR2A 2CESA 3MKKA 3OYXA 3CQHA 3W2UA 3NZRA 2D2GA 2QCDB 2EG7A 1VPXA 4JIPA 4JKMA 2F2HA 4WGHA 1EJSC 1H7XA 4HZ8A 2PTYA 3VYLA 1ZY9A 4L6OA 3NVZB 3O05A 3WJSA 4K37A 1VBUA 2X8HA 1U1JA 5F4SA 4UCGA 3S1UA 5LNUA 1G6CA 3SY5A 1GOIA 4FZIA 4RDZA 1Z48A 3ZSTA 1OJXA 3NQEA 4AEOA 4B5UA 2DZVA 5HQMA 1R0MA 1PE1A 1M68A 5FESA 2ZX8A 2OWCA 2YBTA 3BAWA 2A3EA 4I7VA 1A0EA 4PMZA 2Z1BA 3R25A 4B91A 3LGEA 3UVIA 3N12A 3TTSA 1AL7A 1E0WA 1OFDA 1XYBA 3VNZA 3CEPA 4V33A 5I03A 3AAMA 1B31A 1BFNA 2DVTA 1PZ0A 1I2PA 3MCMA 5CZKA 5TIMA 3LADA 4LQ1A 4UTLA 2DQXA 3AUOA 3BGGA 1M3UA 4BWLA 4Z1DA 5ABFB 2G3JA 3TYZA 2W0UA 1EJ7L 4RDVA 2XU2A 2VX5A 1M04A 2FGZA 4DUWA 1H4PA 1JYVA 3WDHA 2ONEA 4Q33A 3FA5A 1UR3M 3AS2A 5CSSA 4XSMA 3FJNA 2EPNA 3QKZA 1RV8A 2EXOA 3BO9A 3LERA 3QOKA 1XGDA 1KGUA 1NU5A 3SN0A 2BODX 3W1MA 4AXNA 2RH9A 1KM1A 5A69A 4NG3A 2WOQA 2PAJA 3WQGA 1C93A 2C7FA 2VX4A 3GW0A 1OX5A 5I6SA 1Q6GA 1GOOA 1F3WA 2CZVA 4IFOA 1N62C 2ZDRA 2D0HA 4C91A 3BCDA 3E2RA 4IGMA 3HU7A 4S39A 1QI0A 1A4LA 1QHPA 1T8XA 2OODA 3QR1A 1XBYA 2X1TA 5CXPA 3MSGA 4RDYA 3CQJA 3TKFA 2D24A 2PGWA 1HGYA 2GK1B 3PZNA 4WDTA 4XAYA 1J11A 3NZPA 4ICNA 3WSUA 1W3TA 5GVJA 1Q6LA 5LA2A 4NT0A 1L0PA 4HNOA 4ADSA 5LA1A 1VR6A 3PSWA 3CO8A 1HJQA 1VYSX 3CHCA 3ZVHB 1GG1A 3NR0A 1X7FA 4X3ZA 2X1SA 3OGRA 4IJBA 4TIMA 2DSWA 4L6HA 4J2MA 1F5ZA 3KRZA 1O94A 1VLWA 4JXCA 1GJWA 4UTIA 4NX5A 3W83A 4HHPA 3KS5A 1B4KA 2BOGX 2BGQA 3M6DA 2V8ZA 1JUKA 4I6VA 1ME7A 3CGCA 2YA2A 3UZ5A 3T44A 3K8MA 1TZ9A 4ZQNA 2G3FA 1TZZA 1M7JA 5H1WA 3QHNA 3UT0A 2CETA 4DEFA 1EQPA 4IMGA 3C56A 1TMHA 2QEZA 5D03A 1SW7A 1FECA 1LBFA 2BMBA 3A4AA 1E3XA 4AIOA 2OG9A 2Z24A 2YXXA 1IQ8A 1MYRA 1D7YA 3GUGA 2F7FA 2Q01A 1O4UA 1WKYA 1GTHA 1DBTA 4O8RA 3H54A 4ERIA 4Z2IA 4BS0A 3KLLA 1UKTA 3VGGA 3MUZ1 4ZQMA 4FDCB 4QP0A 1P0KA 4GNJA 2W67A 3UWYA 3R12A 4M82A 1LORA 3DFHA 1IZCA 2GPTA 1T8QA 1LRTA 2UV8G 3MUIA 5HMSA 4D1IA 1Q7ZA 2EPOA 1MXGA 3CL6A 3M1ZA 1VAHA 3RHGA 4H19A 1JAKA 2D3NA 4PH6A 2W62A 3OO2A 1V3MA 3OGSA 3LSCA 2A3HA 4GKTA 3DHPA 2PPGA 3ICJA 2VEPA 3GTXA 2X0YA 3AMDA 4CN1A 3WK1A 4LAOA 3GIQA 3CAQA 2JGQA 4W7UA 4QSHA 3TOYA 3SCSA 3W70A 1OX4A 1SO6A 2D22A 2FZNA 1OINA 3S2NA 2EJAA 3L21A 2BTMA 1UP2A 4Y90A 1V3IA 2VT0A 2ZZ6A 1W32A 5D2TA 1EX5A 3C2FA 3ZT5A 3W02A 5G5GB 3WLIA 1ZMDA 3EB4A 1R7OA 2INZA 2WP6A 3O6YX 3TTEA 2CLPA 3OYZA 1EGVA 2WNQA 2J27A 1M7PA 3MANA 4GPNA 4CU6A 3QHOA 4E38A 1PTGA 3MJMA 5J04A 5HMEA 1RM6B 3IJ9A 1M5WA 2BHUA 5I3HA 4U2ZA 1V08A 3ARVA 2Y8KA 1VRXA 3LQLA 4E5TA 2ZRUA 4EMWA 1W1TA 3WMSA 2QHAA 4L61A 5HWNA 1MOKA 1DWIM 4XZ9A 3QZEA 5DBTA 1R87A 3PUOA 3WCZA 1DWJM 4DI8A 2V3BA 3LI0A 3W81A 1XDMA 1VEPA 3M0XA 3L5OA 2P0IA 2FDSA 3TU9A 3TZFA 5FAJA 2PDQA 2CWNA 4AH7A 4PMRA 4MY8A 3BICA 2F6UA 3XINA 2OCZA 5FJTA 5FCZA 4IIEA 1TVNA 3IC9A 2QF8A 4LF1A 1ECQA 3MJYA 1JCJA 1AOGA 2CLKA 3P67A 1BD0A 3TV8A 4A8IA 1XBXA 4GO9A 2ESCA 4JDBA 4DX3A 1OFAA 2ZRWA 4CEUC 2CC0A 4LH8A 4F0SA 1GRTA 4WIWA 3LSBA 4UCFA 2D73A 5BMWA 2Z29A 4O0QA 4X0NA 5LIXX 4V15A 2D2JA 5JQ9A 4KMQA 5DELA 3SIZA 3B9OA 3WQEA 3AIBA 2A6NA 2BHZA 3AMCA 2A3BA 3W1TA 1K03A 5F4XA 3TQKA 2C1GA 1WDQA 4GQBA 4PCSA 1PS9A 2D3LA 1H1ZA 1ZCOA 5E9AA 2G3IA 1XLJA 4B92A 3LG3A 1TWIA 5EMLA 1C90A 4UTMA 1EDQA 4HBKA 3PAJA 1W1A1 4A8RA 2IPGA 4GZEA 4C6IA 1FCVA 3UEQA 4B9YA 1RAKA 3TW6A 5LNVA 2VM8A 2R94A 3WD1A 2UY2A 5ABGA 2J47A 1OFQA 5G1YA 2VCAA 4J40A 3K30A 3POHA 1HGWA 4DUOA 3W2KA 1RPXA 3T6CA 1Q85A 3F03K 4H9XA 2VRQA 2DZXA 3ZQ9A 1XF0A 3ZT6A 1KQYA 3VA8A 4XD3A 1ME9A 4B90A 4ECLA 1F3XA 1J8VA 1T7LA 2VFIA 4NZFA 2BSLA 2FZBA 1Y5VA 1B90A 1LQAA 1XH1A 1W1ZA 1C9DA 1EO5A 4GUHA 3U2ZA 4IL2A 2EQ6A 1C29A 1W9VA 5AY7A 1ADOA 1KD0A 1UOKA 3G1AA 1LZOA 1XYFA 3TC3A 1WYGA 4Q7BA 2WPFA 2HNEA 3FEQA 4IPPA 4B4HA 5F2GA 4H50A 4RZ5A 4AX6A 2YXOA 2GGGA 4AY7A 4W7WA 3L9CA 4DBDA 1XH2A 1GQIA 5FL0A 4LCSA 5AC7A 3VINA 3SCVA 4J3WA 1BWVA 4XZLX 1W37A 2BY2A 2IPWA 1ZFJA 2X1IA 3CLMA 3PK7A 3DESA 3Q94A 3CIWA 4KIEA 3VMOA 4Q6XA 3U48A 4NL1A 3GG8A 1YHTA 1UD5A 1FH9A 1IHIA 3HTWA 3LA4A 2WNNA 4OQVA 1NF0A 2QMKA 3NIYA 3BQ5A 4AHQA 3UWEA 3IK2A 3NZGA 1UD6A 1WV2A 1R9YA 1NHPA 1VZWA 2YBUA 3PG8A 3OLIA 4WY0B 2NX3A 3GFZA 4AZ5A 1F3PA 1KLZA 4GJIA 4JAWA 2YOCA 1MDRA 1C9WA 4R88A 5CGMA 4ZO9A 4GCAA 1PDYA 1S2CA 5SWUA 4F4RA 1NQKA 3K1DA 4FI4A 1BAGA 5CPNA 3NQ6A 3NWRA 1UWTA 1TG7A 2EPHA 4U2YA 3E0FA 5C70A 4DXVA 1M6IA 3THAA 5D38A 4JIRA 1TUFA 3T8QA 4DUVA 3RLHA 3A22A 4DHGA 1Z32X 3G5EA 4DO6A 2VDGA 2POTA 5LGZA 2WNZA 2J74A 3K4WA 4CCEA 4NNAA 2ZZ3A 4M0XA 1KKRA 4GK8A 5HINA 4S2BA 2IPJA 3WJXA 3BJSA 3AWNA 3LGDA 4H4ZA 1XLBA 4RPQA 4HMDA 4PRRA 3G1SA 4DJDD 4DBUA 2PODA 2PTZA 1N63C 5CJNA 3V0UA 5C7VA 2XPKA 5IDZA 1HL2A 3SCOA 1DIDA 3IVTA 3WNKA 1VB9A 3ZR5A 2LLEA 4LAUA 4NJKA 2O9OA 2BOFX 4JTQA 4R7JA 4Z2HA 1KC7A 3WEOA 5BW6A 3PTQA 1FWEC 5EA9A 1Z69A 1IR2A 1E1CA 2TPRA 3HZ3A 3ARPA 2C19A 1TJ1A 3BMXA 1SSDA 4C6PA 4HN8A 2R1NA 2VWSA 3H21A 3KAOA 4PFMA 4IGNA 4I8DA 4RZBA 4FXFA 3C3NA 4IISA 3GVQA 2QUNA 5G4WA 3W07A 2GR1A 3UA3A 5KZEA 3DHFA 2YVGA 2X7VA 2FIQA 1D7FA 3UJFA 3CTLA 3M0KA 1UD2A 4GUJA 5HJXA 3ONCA 2AAAA 3QFBA 3DOPA 1LRNA 3LRKA 4L4LA 3OVQA 4R7OA 5JH1A 2W92A 1JUEA 2YCLA 4Q32A 4GRTA 2G95A 2FYMA 4LANA 3PB0A 2OWXA 3A13A 1UW9A 3ARQA 2BXZA 3RU6A 4NAEA 5FMHA 3P60A 4FA3A 2E1WA 4UR7A 4LAKA 1RHCA 4WDUA 1PEZA 1ITXA 3CWHA 2NV2A 1F73A 2R1MA 5LNWA 3ZSSA 1S5WA 4KPLA 3SCNA 2Z6IA 3W2NA 1FHDA 2C3CA 4UMAA 4HA3A 3UWQA 4WF7A 3DJGX 2MANA 3L23A 1FWNA 4FXRA 3BAXA 2OVLA 3LPFA 1GSNA 4DF1A 3W74A 4PZVA 2DUAA 1R3TA 1W9PA 2FZDA 4WGXA 1TSIA 3L66A 5TNVA 4A2SA 1UWRA 2OZ0A 3O6DA 3QPEA 5EMKA 4PE8A 1G1YA 5LHEA 1BF6A 1J93A 1C92A 3O3RA 3ISIX 4S3AA 1R2SA 3NRZB 5TR3A 3APTA 1MEIA 2QCDA 4BKNA 4I6KA 3I7QA 1Q6RA 1SO5A 3AI0A 5LGXA 3WZ0E 2YDSA 3NDOA 2QZRA 3GTFA 4OUEA 2V5LA 4ERAA 3AJ7A 4AF0B 4XWUA 3MUXA 1JD7A 4H3DA 3TW9A 3CUXA 3REQA 2DIKA 3E38A 4N6EA 1S5VA 2IQTA 3WKZA 4QG8A 3O0HA 4RK8A 5BOEA 2C0AA 4UTFA 1LOQA 2Y7EA 3N04A 2RJHA 4L4OA 2J8TA 5JCNA 4M52A 1GW9A 2ZA2A 1RSCA 2WMFA 5I7GA 1FH7A 1JL8A 5AN7A 2PGFA 1TCMA 4OWGA 3GDMA 2RUSA 1P6CA 1LWIA 1QXLA 1T5AA 1XYAA 1TA3B 3TFXA 4MJZA 3S2JA 2ZZ2A 2J9XA 2Y7FA 1VH7A 3JUGA 2XVGA 1AJ2A 2FPVA 2J24A 2A6LA 3ME3A 4TX8A 2QCEA 5CC3A 4CQ8A 2VFDA 4FNUA 4QNEA 2E6FA 4O0KA 4WCJA 2BNJA 1OSEA 4BCEA 2ACUA 2PWUA 1VFUA 2XWDA 4ERGA 2E9LA 1X1ZA 2GOUA 2TAAA 1FFRA 5H2ZA 2HRWA 4NJHA 4P8VA 4QQ3A 7ENLA 5A8PA 2BVTA 4QISA 3ARSA 5FEXA 1MW3A 1GETA 4ICMA 4HU3A 2QUMA 4DQWA 2WSPA 1H0IA 4LXFA 2ZCGA 1WNOA 2B31A 3WQOA 2X8GA 3R07C 1MI3A 3LU2A 5ER0A 3OHIA 5LA0A 1LOSA 4E2DA 5A5WA 3PZVA 3ZWSA 3N73A 1E6ZA 2X42A 4JTCA 1Z7AA 2QDHA 3VOIA 4LUTB 4AC7C 4QLKA 4HNNA 4EANA 1KWKA 1YMYA 4A3UA 4AZ7A 1VEOA 1NARA 1XLCA 4MNLA 1MXSA 3GDTA 1WKEA 4LU0A 2J7CA 2Q8ZA 3TN5A 1K4HA 1XPGA 4EWJA 3B9NA 2AKZA 1MO0A 4YNGA 4ZBCA 3BZJA 5BXSA 4XIMA 5DXYA 1CXHA 5D09A 5HJYA 3W6LA 4MADA 1XYLA 1UQYA 1W8GA 3KLJA 3TP4A 5FEWA 4QEEA 3IAPA 4EPEC 3WQ4A 2PWEA 4GHRA 4ZTXA 3D6NA 3F4VA 2E9BA 2ZDSA 2JE8A 4IFRA 2E67A 4JL2A 2GJXB 2HCVA 3GTIA 3G0UA 4Y9AA 1IEVA 2R1PA 3GRIA 3TW7A 4Q8VA 4H6EA 4W4QA 1PWLA 3GB6A 3URAA 1KQZA 2XH0A 4NQ1A 2R9RA 3TYAA 3AXIA 5FF0A 1N61C 2XVNA 4DNHA 3UXIA 1QATA 3P93A 3Q45A 3OVGA 5TAOA 1KFJA 2I5QA 4XSLA 1CIUA 3RJXA 3XIMA 3OVPA 1W5NA 5D8WA 1JJKA 1K9TA 2W5FA 4ZGYA 2ZRVA 3P61A 1HP5A 2FHCA 2XG9A 2HROA 5T91A 2O0TA 3KBJA 1OT1A 4EWND 1AFSA 4HSHA 4QCFA 1R30A 5DCDA 1K8YA 3PULA 4Q8PA 3B8TA 4IMCA 4FX7A 4KFPA 2HQMA 3P80A 4IX2A 4AB4A 5FJPA 2Z28A 3SJNA 1RQBA 5C5YA 4KCUA 1H0GA 4EIVA 3VDHA 3ZZ1A 2VO5A 4JL1A 4UTWC 1SUXA 3L4TA 4ML4A 1R9ZA 4R9XA 3MV01 3H4WA 3WMLA 4JQ9A 5G1TA 3UU0A 3EAUA 2PB1A 4PL1A 4ROPA 4IIGA 4YHGA 4NASA 2ZX7A 2NSXA 1Q65A 3ZVHA 3UP8A 3S83A 3CXOA 5DMNA 4XAZA 4GUFA 1T3QC 3VMPA 5MF5A 2XIQA 4AUBA 3VIPA 4JD4A 1XHCA 3NUKA 2FZ9A 4D8AA 3M5ZA 5KEZA 2OPJA 1Q2RA 3VUSA 1CENA 3CH9A 2V5BA 3UCDA 3VGFA 4LUSA 3ITCA 1YEYA 7REQB 4GI6A 1DE6A 2NQ5A 4EAMA 4YCOA 2J66A 2YBVA 4OIFA 9CGTA 4ALDA 2Y5JA 4J3UA 4PTVA 1TYGA 4BJHA 2AGKA 5C71A 1I8JA 4XD4A 4IUGA 4X61A 4A21A 3AIQA 3EMZA 3OZYA 3UPBA 3GU9A 3PWGA 3P2VA 1KFLA 4O1AA 4JTGA 3G0SA 3GFYA 3L2LA 1Q2SA 1XC6A 3D3FA 3GG1A 1GRGA 1FX6A 1IXPA 4FP1A 3WL0A 2E25A 1EIXA 4MYXA 1XIHA 4H7ZA 3T07A 4KT2A 5HA7A 5EMYA 5EGRA 2PU0A 2WZEA 4Q3MA 4F9DA 2JBMA 4CQ9A 4HOXA 1RVKA 3INPA 1QHZA 3JW7A 2J6VA 1FWHC 1L6SA 1FHUA 4GZIA 3IJ6A 2XSAA 3RF9A 3H4KA 2QCFA 3R6IA 4H4YA 3MCNA 5LIYX 2ZWZA 3VDBA 3B97A 1UBPC 2H3DA 3WFAA 3BTNA 4KETA 1NFPA 1Q6DA 1NTHA 1S1PA 3WY1A 1Z6KA 2G50A 4LB3A 4PMNA 2DDXA 1BVWA 2P1FA 4BI7A 4DB7A 3GC2A 1E1FA 1Q6EA 1AQHA 1OADA 1MXDA 3T08A 3GNDA 2P3ZA 1GORA 5T9CE 1RJRA 3G1VA 4XKMA 3ZOAA 1RR2A 3OA5A 4UOQA 5C8BB 3O16A 1UZHA 4H4QA 4YVPA 3BXWA 5CZJA 4OUIA 3B3DA 3MHGA 2ZC1A 4U28A 4FLRA 5C2GA 3EWWA 3BOLA 5AKQA 4C5ZA 1TIMA 2Y2WA 4O4VA 3EXRA 4R27A 1EZWA 4I9TA 1TV5A 3N4AA 4QE5A 3T0CA 2HVNA 2YL5A 1DIEA 2V67A