3OZMA

Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
386
structure length
386
Chain Sequence
SLKITEVKAHALSTPIPERMRVESGAGLKLNRQMILVEVRTDEGVTGVGSPSGPYDLAVLKRAIEDVIGPQLIGEDPANINYLWHKVFHGEVSRNLGHRSVGIAAMSGVDIALWDLKGRAMNQPIYQLLGGKFHTRGVRAYASSIYWDLTPDQAADELAGWVEQGFTAAKLKVGRAPRKDAANLRAMRQRVGADVEILVDANQSLGRHDALAMLRILDEAGCYWFEEPLSIDDIEGHRILRAQGTPVRIATGENLYTRNAFNDYIRNDAIDVLQADASRAGGITEALAISASAASAHLAWNPHTFNDIITVAANLHLVAASPHPAMFEWDITHNDLMTRLASYDLKLENGLVQPPQGPGLGFEIDWDFVAAHAWKGEPAIGAGHGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative mandelate racemase
publication title Crystal structure of enolase superfamily member from Bordetella bronchiseptica complexed with Mg, m-Xylarate and L-Lyxarate
rcsb
source organism Bordetella bronchiseptica
molecule tags Transferase
total genus 132
structure length 386
sequence length 386
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ozmA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ozmA01
3D46A 3R0UA 3DERA 4YWSA 1E9IA 1ONEA 2OKTA 2XSXA 3RITA 4A6GA 4A35A 2GGIA 3VFCA 4K2SA 3IJIA 4KEMA 2MNRA 2PA6A 3MKCA 3DG3A 3DESA 3R10A 2FYMA 3PWIA 3OW1A 3UJFA 1FHVA 2PP0A 2PTZA 4GISA 4KWSA 3ES8A 3R11A 3TJIA 4JN7A 3V4BA 1KKRA 2PTYA 4IP5A 3H12A 1NELA 2P8BA 2GGGA 3DEQA 2GSHA 4H2HA 1WUFA 2OLAA 3KUMA 4HNCA 2OX4A 3THUA 2XH4A 3ZVHB 4H83A 1PDZA 3DG7A 3OZYA 2HXTA 3OP2A 4A3RA 1KCZA 5EU9A 3TCSA 1KD0A 2I5QA 2P0IA 3UJ2A 3SN0A 3P3BA 2QGYA 3STPA 3IK4A 5IDZA 2CHRA 3VC6A 4E4FA 1MNSA 3U4FA 1EBGA 3FYYA 2QJNA 4H1ZA 3IJLA 2AKZA 2GGHA 3TWAA 5FJUA 2DW6A 3V3WA 3MUCA 1MDLA 3MSYA 3FXGA 4HCLA 2QJJA 4GMEA 1TE6A 4K8GA 3S5SA 3FCPA 2AL2A 2OZ8A 4IL0A 2PP3A 4JHMA 2OQYA 3U9IA 3S47A 4DWDA 3EKGA 1FHUA 3MWCA 4GIRA 3RGTA 4IT1A 3NZGA 5ENLA 3VCCA 1WUEA 5BOEA 5BOFA 4HYRA 1R0MA 1MRAA 2PODA 3VC5A 4GFIA 3MQTA 3V5CA 3UXKA 1IYXA 2PPGA 2HNEA 3UXLA 4E8GA 1MDRA 3ZLHA 2PS2A 2AKMA 3D47A 3H8AA 1DTNA 3DG6A 2PSNA 4GYPC 2P3ZA 1SJAA 4GGHA 2XH2A 2O56A 3UJEA 3Q45A 3RRAA 4KPLA 2RDXA 3I6TA 3P0WA 2AL2B 3QTPA 2OQHA 4DX3A 3TTEA 2FKPA 1BQGA 4GGBA 4ENLA 2QVHA 2GGJA 3BJSA 3MZNA 5FJOA 4ZCWA 3SQSA 2PTXA 4M6UA 3RCYA 4DYEA 3DIPA 2ZADA 2OPJA 2QQ6A 2AL1A 4IZGA 1SJBA 3SN1A 3TWBA 2OFJA 4IP4A 1R6WA 2PU1A 3R25A 2XGZA 2PCEA 3JZUA 4G7FA 2GGEA 2XH7A 1JPDX 3BSMA 1JPMA 3P93A 3PWGA 1TKKA 3QPEA 2OG9A 4Z1YA 4F4RA 3SBFA 3TW9A 5FJTA 1ELSA 3T4WA 4GYPA 2DW7A 4X2PA 2PGWA 3UJRA 3UCDA 4FP1A 3HPFA 3T9PA 3OPSA 4MKSA 4K1WA 5J04A 4FI4A 3GY1A 3QKEA 2GL5A 3T8QA 2PP1A 4DXKA 2PMQA 1EC8A 2QJMA 2P88A 4ROPA 2OO6A 1KKOA 4J3ZA 2POZA 4KT2A 3SN4A 3I6EA 3T6CA 1L8PA 2P8CA 3ZLFA 4MMWA 4HCDA 3OTRA 3CT2A 1XS2A 3VDGA 3OZMA 2OVLA 4IL2A 2XH0A 3RO6A 3CAWA 3MY9A 7ENLA 1EC7A 4G8TA 1P43A 2OZTA 3BOXA 4DN1A 4HNLA 2ONEA 4H19A 1JCTA 1MUCA 1SJDA 1F9CA 3R1ZA 3B97A 3DFHA 1JDFA 4ZA0A 1NU5A 2PU0A 3H70A 2PGEA 4HN8A 1SJCA 4J1OA 3ES7A 1XPYA 2PTWA 2OZ3A 3I4KA 3ZLGA 3UGVA 4HPNA 1TZZA 3TQPA 3GD6A 4JN8A 3CB3A 3JW7A 3NXLA 2QDDA 1ECQA 3IJQA 3N6HA 4E4UA 3SSZA 4HCHA 3PFRA 3Q4DA 2HZGA 4E6MA 3UJSA 3CXOA 3N6JA 5FJPA 3GO2A 2ZC8A 3ENLA 4IHCA 3EEZA 3V5FA 3DDMA 1PDYA 3VCNA 1OEPA 1P48A 4DHGA 2MUCA 2HXUA 3N4FA 3R0KA 3K1GA 1EBHA 3CK5A 3SJNA 1W6TA 2NQLA 1BKHA 3DFYA 3VA8A 6ENLA 4E5TA 3GC2A 3RR1A 3UCCA 3QN3A 4Z17A 2GDQA 3ZVIA 3PK7A 3N4EA 1RVKA 3DGBA 5FJRA 3FJ4A 3NO1A 3JVAA 1YEYA 3ZVHA 2QDEA 3FV9A 3QLDA 1EC9A 3H7VA 4MGGA 3FVDA 3TJ4A 3CYJA 3NFUA 4M0XA 4EWJA 3TOYA
chains in the Genus database with same CATH superfamily
1DBTA 3N4AA 4HMDA 4CEUC 1W8SA 1XP3A 3U5UA 1GCYA 4LS0A 4W85A 4RCXA 2IKGA 4EXQA 4X63A 4HTYA 2BC1A 2E3TA 1V79A 1QU4A 1O7AA 3NQGA 4CNNA 1OIFA 4K2SA 1E15A 3ZT7A 4HNOA 4YXGA 4GLEA 3FYOA 1U1UA 3AROA 1FWRA 3MDUA 4CNTA 2DSZA 3D3AA 3T2OA 3VAVA 3D3FA 1OFEA 3R10A 1XRTA 5HJXA 3L8KA 3G24A 4L1XA 2GVLA 1CGUA 4GYKA 1FHVA 1K6AA 1VYPX 3LCLA 1S39A 4G2DA 1HZYA 4HIBA 2YL8A 1XIHA 2IPJA 4ML9A 1I2RA 3QZEA 4O17A 1WDQA 3WCZA 3URAA 3W86A 4Z2HA 2QUUA 3O0HA 2D2OA 3NZ1A 4MJMA 2X1UA 1DJGA 3PTKA 5DY2A 1WUFA 3MKKA 4IXHA 5SWUA 3ABZA 2R91A 4JKKA 1C8VA 3W28A 5H91A 1UBPC 2YL9A 5JXQA 1LOQA 4NZCA 1XPGA 1UP3A 1YNQA 3PANA 2QGYA 2WAGA 2NSOA 1OX4A 1LT7A 4DI9A 4XZBA 3EWBX 5EL1A 2V68A 1TTQA 1CZ1A 3KLJA 2DSVA 3CZ8A 3LXBA 3MV11 3WMLA 2J75A 3N9RA 3WELA 4H1ZA 1E1FA 4RE4A 3AIEA 5HMDA 3TWAA 2EPNA 1XBXA 2BXZA 3V3WA 3WNPA 2RGLA 5DEZA 2OXNA 4QLLA 1R87A 5C55A 3UFYA 4FOUA 3UP8A 1V97A 3KVKA 3UEQA 1FKXA 3HGJA 2OZ8A 2PFHA 3TIMA 3ISIX 4Q8QA 2OQYA 4ZSUA 3KCLA 1V08A 3E2QA 2X0SA 3WNMA 2FPVA 5ENLA 4AW7A 1TMQA 2IQDA 1WUEA 5BOEA 3UXIA 4UNLA 3B8TA 4GUFA 4JTKA 4LWWA 1FO4A 1J2WA 4J3WA 2KX9A 4AVNA 5BRPA 4Q4OA 1NVMA 1XLHA 2VZOA 4PSRA 1T40A 3BW2A 4B9YA 2D2GA 2WMKA 2Y88A 5C7HA 4LBUA 1GRFA 4TX9A 2ZRXA 4H4UA 2AKMA 4IP7A 1SFSA 3QV7A 5HPCA 1XYMA 5CQ1A 2CLPA 3TUUA 4J56A 4BQ2A 3CT7A 4C6DA 3I7RA 3LUTA 2XH2A 1NFGA 2PDYA 2FVLA 5K7JA 4JDYA 4GQQA 4H9MA 1ITQA 1H7RA 5H2ZA 1DJIA 1TIWA 4MJ2A 2GR3A 1K9TA 2CLIA 3DAQA 3QY6A 3TR2A 1ALDA 1BFNA 1MW3A 1SQ7A 3GRSA 2EPLX 4UCGA 3BE7A 3S4TA 1B54A 1FQ0A 3SQSA 2J78A 3GM8A 1KRBC 4O53A 3LY0A 3WFZA 4H2CA 1YKWA 3H4KA 1UH3A 4ZQCA 1GKPA 4F9DA 4M6QA 2PZ0A 3DFPA 4N9DA 1XD0A 4ECLA 1GVFA 1V59A 2C8NA 1ENUA 4P7LA 4DIAA 3PZUA 2Z26A 3U7BA 2YAUA 1SO3A 4MFDA 4JOMA 1VAHA 3GHRA 1XLAA 1NAL1 1RJPA 4JFUA 2ZOXA 3W1MA 1VS1A 5K4XA 3BZJA 1B3XA 2BY1A 1IIHA 3TROA 5KITA 4ZXLA 2OJPA 2DW7A 4GNKB 4FR1A 1F3XA 3PZTA 3WIJA 4OJYA 2ESCA 4NZ4A 2Y1HA 1VLWA 6A3HA 3R13A 4Z2GA 4QFUA 1Q2RA 1HJUA 2XIBA 4IGSA 4GYFA 2ZICA 1LRNA 4KT2A 3U2EA 4O4WA 1L6GA 4HNTA 1GERA 5D02A 1U22A 1N5XA 1AD1A 2ZDRA 3UXAA 3MO4A 2CLFA 2QJIA 1RALA 1YADA 4IL2A 4MZ8A 4ROQA 4L9YA 4FSAA 4H6KA 4BFAA 3UZZA 1OYCA 3IS4A 1OB0A 4KCVA 3EDFA 4AWEA 4C6IA 4NAFA 3AYRA 5KETA 1TPB1 3LPOA 3P6LA 1H11A 4H19A 1WZKA 1OC5A 1JCTA 3CAKA 3PC0A 1GHRA 4PA8A 1F9CA 4N9CA 3JS3A 3J7HA 4QX4A 4OFCA 4QDMA 3EKLA 3TJLA 4IFRA 4WCJA 1SJCA 3SRFA 4F0KA 5KEZA 4LF1A 3VIJA 2ADAA 2CIPA 2WOVA 2PB1A 1VJZA 3WL0A 4JYDA 1WCGA 3H24A 1EXPA 3TU9A 1XLFA 3S2MA 3QR3A 2YGYA 4X0VA 4V27A 3SSZA 2X0YA 4JBRA 4D8LA 3T2PA 1QHOA 2ZRZA 1XANA 3CL7A 1JDAA 3WBWA 2HZGA 1P6CA 3WBEA 1T7LA 3GG8A 1WNOA 4DB7A 3WQEA 3VNYA 4JZ5A 1GVRA 2XYLA 2WVVB 4I8YA 4FS9A 4F0MA 2PWVA 3T7VA 3VIIA 1A5NC 3URHA 2GWNA 1JZ8A 3DFYA 4LGXA 1XLMA 3VNLA 3W1UA 1B3ZA 4R88A 4Q7IA 1GVIA 4E2DA 4CKQA 2ABBA 3M6YA 1RJRA 1QI4A 1BSLA 4EACA 4JTFA 3K4AA 2QCLA 1GOWA 1FWTA 3M5ZA 3W02A 2DZPA 3RM9A 3VINA 3FV9A 4UFHA 1JGIA 1YYAA 1H7OA 5TQLA 4A21A 4GCXA 5G1MA 4Q33A 3N6QA 1ZY9A 3G0XA 1A4MA 1IWPA 4K8HA 4PMVA 3GZAA 2QULA 5DELA 1AJ0A 1TJ2A 3H21A 2CERA 2FZBA 3NO5A 4G6CA 3TJXA 5MKGA 2WKLA 1ONEA 3T40A 5AHFA 3NEVA 3QC0A 1K7FA 1J5TA 2VI0A 1RQEA 1IEIA 4MB3A 1XWYA 4KQNA 3KP1A 4LB4A 2Z6JA 3AI0A 1TQXA 1TELA 2BG5A 4GBDA 3T1GA 3W22A 3QR0A 2YFNA 3N9KA 2XGBA 1Y5WA 3DESA 1E5JA 3PBMA 3ETRB 1ZAHA 3LZ5A 5FF4A 5HQEA 2PTZA 2WVTA 4RLIA 3LLDA 1VBRA 3R11A 4JN7A 2WMFA 2XSAA 3ECQA 3QZAA 4EIVA 4PC8A 2VEIA 4H6QA 5HATA 1I6NA 2GGGA 2DVUA 2VUNA 3VPLA 3THAA 3C2OA 4X9YA 1J9YA 3UVIA 2GWGA 3KOFA 1YIXA 2BHZA 3V35A 3DG7A 2BY0A 4MNKA 4GQRA 1WKEA 2DUZA 2ZDSA 3UJ2A 1F4AA 4MJZA 3SN0A 1FTXA 2IMRA 2FZNA 5C9ZA 4UBPC 2YX0A 5I3IA 1M68A 4W93A 1VB9A 4PFHA 3TZNA 4WKAA 1E1CA 3E2VA 3GXDA 1WZMA 2Q3RA 4C65A 3B8DA 1PUDA 4H9YA 3F4CA 2L5HA 4TV6A 4NEWA 1ZAJA 1D8CA 2XIMA 1OCNA 1JEZA 3LERA 4MY1A 4TV5A 4W7VA 4PR4A 1UQYA 2R14A 4FOJA 3HO8A 2FB3A 1EP3A 2EBNA 3A5VA 1V3JA 3EKGA 3ZJ7A 1FHUA 1BYDA 1OHLA 4NKCA 3Q6JA 1GUVA 3FA5A 1H5VA 4E8DA 1DJHA 4KWWA 1HO1A 2DZWA 1GOKA 1BWVA 3MCNA 4RR4A 3L4WA 1RY0A 4XO7A 1IXPA 3GUWA 1PAMA 2EJAA 3UXKA 4GUHA 2DUXA 1N60C 1J6OA 2PLJA 3FA3A 3W87A 2OELA 1HG3A 3N25A 3D9XA 4MJ4A 1CLVA 2HCVA 3OG2A 2OSWA 2PF8A 4OECA 1WV2A 1KM6A 3H8AA 1HKIA 2HPMA 3KZSA 4JX4A 3MHGA 2OT1A 3E02A 1GOMA 3VOIA 1UOZA 4QLJA 1CTNA 4UFIA 1DPMA 4QE1A 1VP5A 1WDWA 2X0HA 1ZDLA 2P0OA 1FEAA 2BLEA 2AL2B 1X6NA 4PSPA 4Q8NA 3P8JA 4FR6A 3U6WA 2DORA 3M0HA 1JI2A 2ZXAA 1JZ4A 4UQCA 4RK8A 4UTWC 4P8XA 3MV01 4EQXA 1B0IA 1Q6CA 5A8MA 5EYWA 1E9LA 3CGCA 4NJKA 2VENA 2GOUA 4N42A 4JNMA 1NARA 4IQEA 4H41A 3WH8A 2QS8A 4HN4A 1R6WA 1H0IA 1VJIA 3M7WA 4GABA 1W2VA 2B7QA 2W66A 2ON3A 3TXVA 1XYZA 2ZWYA 4YL2A 2EPMX 1N62C 4KRUA 5AOUA 2E5BA 2PDLA 3ID7A 3IJDA 2BVYA 1XXXA 1FWGC 4Y7EA 2BNJA 3DJGX 1MEHA 3H4XA 1TPUA 1KBLA 4L80A 4L65A 4HHPA 4PCNA 2XWDA 3CPUA 2ZRYA 4GJIA 3GY1A 4HPJA 2QW5A 3AM9A 1JXJA 3GDLA 1TWIA 4DAFA 2Y8VA 4HPGA 4PL2A 1RBAA 1KKOA 5LSMA 1S1RA 2J7GA 3BJFA 1V02E 2CDUA 3MPGA 4U2ZA 2E09A 2HSAA 5F2GA 4HCDA 3PG9A 4ZMGA 3W29A 5GQBA 1ISZA 3MY9A 1UD5A 1EJ7L 2GSJA 1S2UA 4OIFA 3HPSA 1KFEA 3W53A 3EMZA 5BXSA 2AQVA 3E0IA 4EPDC 2HK0A 4GG9A 4GBUA 1V3HA 3ITYA 2CHNA 2DIKA 5BWAA 1Q6QA 1RLDA 4QLKA 1UWQA 4DO5A 2Z2UA 4WSHA 1VFLA 2C7FA 1S1PA 4AF0B 3NPVA 3W7OA 3BXWA 2IPWA 3EOUA 3KZPA 2VP8A 1BXBA 5LNSA 3NVDA 1D9EA 3AUOA 4H8VA 4LCQA 4MTVA 3SO7A 2AGKA 2C3DA 5FD0A 2NV9A 1Z9AA 3K1DA 4DZHA 1Q5MA 3M6DA 2VZSA 3CHDA 2E4TA 2ZC8A 2AQOA 3W2NA 5A8PA 5I3DA 1PDYA 3TNBA 1A4LA 3W1TA 2MUCA 4RNHA 2HXUA 1B5TA 2PDJA 4NJJA 5FAGA 1E4NA 3CK5A 1TO3A 1GRAA 5CZSA 2VEFA 3W1PA 3K8KA 3LHWA 4HNUA 1IWAA 1BKHA 4LEFA 2YXXA 1K8CA 5G1YA 1GRBA 1DJQA 1WXJA 3IV8A 3JZEA 1TX2A 3DK9A 4C1NA 1ZJHA 4JQAA 1C93A 3WZ0E 1KRAC 3BTNA 1VCGA 3SY5A 4TUFA 4A29A 1K4GA 5LNUA 1UH2A 2A2IA 2D69A 4O18A 1W1ZA 3SCRA 2XJ7A 5HQMA 3O6DA 8XIMA 1HW6A 1QR7A 3P5ZA 1M5WA 1CCWB 3W1NA 3KCOA 5GJPA 3AYSA 1ICQA 4E3TA 4WGHA 3EWZA 1Z42A 4GVFA 3SRKA 5ER0A 5A95A 4GO9A 2WSPA 4AMCA 4XAYA 3LBCA 1SFTA 2BTMA 2BV9A 1L9WA 1YLVA 1VBJA 3SGGA 3LB0A 2DQXA 3CIWA 3SGUA 2CW6A 1YTDA 4MPKA 4A2SA 3H12A 1EF3A 4D6DA 3CTTA 1VH7A 1T8QA 2QGHA 2ANUA 3EWXA 4QRNA 1V3LA 2ALDA 5AHIA 4DBEA 1PDZA 5HMSA 3E0FA 1KC7A 3EWCA 3MI2A 4RE0A 4I7VA 4NAEA 4A3RA 5EU9A 4BQ5A 1P0EA 2V8ZA 1CB7B 3DH9A 2PLCA 4K7VA 3T0AA 1TYPA 3C56A 1R3VA 1W32A 2J79A 2H8ZA 1UR8A 1L2QA 3DJJA 1OIMA 4EM4A 4UFKA 4JDRA 1U1HA 3N29A 4WXYA 1FCUA 5D33A 1V3IA 5FS9A 4RL3A 3AS2A 1XGEA 4Q3MA 1I1WA 1JDDA 3B3DA 1I0DA 2WPFA 2PP3A 4JTGA 4JHMA 5BRBA 5CZJA 2C1GA 1A5LC 4PMQA 3RGTA 1TV2A 2C79A 1LP6A 4IIBA 3EA1A 3C3NA 1SZRA 1WAWA 2YZ5A 5BOFA 5EPDA 4XISA 3EX3A 4HU3A 2V9DA 1L6WA 4YCOA 1PTAA 1P7TB 3EOOA 4YTUA 1GTHA 1ML1A 4AZ5A 1BTMA 1MDRA 2Q6ZA 3R6IA 3LADA 1ZXIC 3KP0A 3FAXA 1OFOA 4S3GA 1NTHA 1UD6A 5G5IA 2VOMA 2V69A 1R30A 2QT3A 4YLWA 1Y5XA 2PDNA 4LVFA 2XVKA 2I5IA 1LYXA 4OE7A 4A8IA 2G3JA 3V16A 2P3ZA 1SJAA 3P84A 4GGHA 3ARRA 1TREA 3GD4A 2C18A 1OYAA 4C7FA 3LU2A 4IMCA 2Z1SA 1XBVA 3AYVA 2RDXA 3OC4A 3W72A 2D0GA 3UETA 2OQHA 5KVIA 2O0TA 4GZIA 1M6JA 4ACZA 4AD2A 3ANVA 1BZLA 3BDKA 1OFRA 2YXGA 4YTTA 5BROA 2RHGA 3MI6A 1XQLA 1IF2A 4ZB5A 3W37A 3QHNA 3HZ3A 3IWPA 3AIBA 3LTPA 4ZOHB 4NUWA 1SO6A 3ZQ9A 5CH9A 4AG0A 3TWBA 1M04A 5CC5A 3HGOA 1QO5A 3QHOA 2NUWA 2HQMA 4LIIA 3GU9A 1Q1RA 3B05A 1BQCA 2Y8KA 3IIVA 1L6SA 5A8GA 4ADUA 1LJYA 2VR2A 1OFQA 2DIEA 1V0LA 3O6YX 1Y0EA 5JH1A 3UCDA 2QCFA 4WHBA 1GKQA 3NWRA 2P1FA 2Q01A 1MSSA 1ITUA 5DXXA 1MMFA 3FEQA 5C7VA 4ATDA 3LCFA 4R7OA 1K7EA 1CWYA 1K9EA 1CW2A 1O66A 4P8VA 2HROA 2PWHA 2H3BA 2WXDM 5A6BD 3GR8A 1SW3A 5D05A 4C1KA 3O7UA 1W54A 1HKMA 5K2ZA 5MHBA 3RJYA 4UTWA 4D6HA 1XS2A 3PN8A 2E8ZA 1FRBA 2OWWA 2EG7A 3GW0A 1AH0A 3V18A 1F61A 7ENLA 3B9AA 4HQVA 2GR0A 3FDKA 2BHYA 2VRQA 3A47A 2ZZCA 3M41A 3UA4A 3GXNA 3VOFA 3K8MA 4UTJA 5DMYA 1TUXA 1TFVA 1VKFA 3N14A 1KTNA 2HTMA 2PDUA 4JTHA 1YX1A 2WJZA 4B5NA 2XIQA 2PAJA 3PR2A 4H9TA 4ZA0A 3PBWA 2WWCA 3TAKA 1XIEA 1Y8BA 4EAYA 2QJHA 2OT0A 4EWND 3TN5A 1W9XA 1JYVA 2AMXA 2PTDA 2PTWA 3I4KA 2HK1A 1QHZA 1NOUA 3JUGA 3NXLA 3KAOA 4ILSA 3W7EA 4XZ9A 3ARQA 2G0WA 2DVXA 3GD3A 4XAPA 5BW6A 4OUEA 4IIEA 4DUVA 2BVTA 4MZ1A 4AXNA 3H2EA 4LRSA 1UR0A 8TIMA 3LA4A 3WJWA 3GO2A 1MQPA 2A79A 1HTIA 4IG2B 2GYIA 2Z25A 3BMVA 2Z7GA 1CEOA 3N4FA 4PULA 2Z24A 2FZ9A 3VDHA 1P0NA 1HO4A 2NQLA 2WC4A 1JG9A 4OBSA 2ZBTA 2PEVA 3HF3A 1BG9A 4WDWA 4FNPA 3A21A 1EPXA 4PCSA 2HRWA 4OGZA 3O07A 3N3MA 2OO0A 3VGBA 3LHZA 4GVGA 3W82A 4M56A 3OHIA 3TA6A 4MLJA 5EMKA 1NWSA 2FH8A 2PLKA 2QDEA 2AAMA 1UB3A 2E6YA 3CUZA 3QLDA 2CXGA 4FNQA 3KS6A 3BG9A 4M1BA 2VZUA 4HPXA 3TJ4A 3CZLA 1RLCL 3LPFA 4AHQA 5L9FA 4D6IA 1HJXA 3EYPA 1LLOA 1RZMA 3BAWA 3R0UA 1QI2A 4Z2LA 3BLEA 1KXVA 2PC4A 2P76A 1B3OA 1S5MA 2XFRA 1AQMA 3UPWA 4A35A 3S9IA 4UNKA 3VGHA 1LLWA 3W84A 3IIXA 4V28A 1X6UA 1UC4A 4QDWA 2V5DA 4S3JA 4JIEA 1M7XA 1Q7MA 3LTSA 1ZGDA 1D3GA 1JCMP 4CN1A 3CUFA 4YVPA 2DT2A 4W8LA 9RUBA 4PUEA 4YVXA 1XCWA 5GNXA 2WKGA 1VBGA 1SU5A 4ZOBA 1MWOA 1G4EA 2J4GA 1K02A 4WY0A 2D0FA 3W1RA 5HDRA 4J57A 2HBXA 4UTUA 4MDOA 4ZFCA 4HT3A 5PTDA 4XBKA 1P1MA 4YTSA 3OP2A 1RP8A 1KD0A 1X98A 4LAMA 1HGWA 2PGFA 3VGFA 3S1WA 3NOEA 1H2JA 4J9JA 2VDIA 4UMBA 3QMRA 1OABA 3CZGA 1LG2A 1FWAC 3PZVA 3HU7A 3CV2A 3N04A 4CQDA 3TDFA 3SADA 1E0WA 4OKDA 2BS9A 2GGHA 4R33A 3IJ8A 3OLIA 4LY4A 4ZQPA 1VFFA 2Y2WA 2E25A 4O11A 3WY1A 2O9RA 2TYSA 3WF1A 3C2FA 2O9TA 3UPBA 4NSBA 1W1A1 3UBPC 3E2RA 1FWJC 3JRKA 1GOOA 2A7NA 3OU8A 3PUDA 5FS6A 4EQSA 1E9ZB 2GK1A 3IVUA 4H9UA 5FKYA 1FH9A 3Q65A 6XIAA 1H1ZA 2ICSA 5C9WA 3LOTA 5FOOA 4JL2A 2VWTA 3UYIA 4Q4SA 3VCCA 2REQB 4XK2A 5CSUA 3QM3A 4Q8OA 4F2TA 4HSOA 4HZ6A 1VHCA 4DXVA 3AXMA 1TQJA 1E0XA 1WDSA 4P2VA 3E96A 1NHQA 3RAOA 4O57A 4JQ2A 3C2RA 3N2MA 1UJQA 1V6XA 4O1EA 1E3XA 2HNEA 2QHAA 3RLVA 4W5ZA 4PRWA 5T9CE 3VTRA 1QW7A 5CSRA 2VGFA 1W31A 3NPUA 1YDNA 1U30A 2NVKX 1PKLA 2H90A 1GOQA 3QPYA 4B4HA 4MG4A 2WB5A 1TVNA 3CV7A 2G37A 1DTNA 3PUOA 4HZ7A 1G4PA 2Y70A 3NQFA 4PFMA 1EQCA 1T96A 1XKYA 4PMRA 4DF1A 2WSRA 3ITCA 2BB0A 2GUBA 3TVAA 2VCAA 4Q8UA 4D72A 1GG0A 4GJJA 1UCWA 3W25A 3FLUA 3PF3A 3C8FA 3S5OA 1Q13A 1L2UA 2BVWA 2G3IA 3CUIA 3QMTA 4GGBA 5U25A 1LBLA 3STFA 3OQ8A 4XQ6A 4NJHA 1CXLA 3BJSA 1GWJA 3A6OA 3KRBA 3QOMA 3AS1A 4XVDA 1J93A 2Y85A 1CIUA 1Y5VA 2A5HA 2J74A 4P7NA 3B9OA 1J8VA 1MQQA 1S46A 4G1KA 2J8GA 3W70A 4I8DA 3PULA 4X60A 3R25A 1E6SM 1JZ5A 2PCEA 2V82A 2Z00A 4XTIA 3JZUA 3BGGA 2OYMA 3IANA 4LBSA 5D2TA 1Z89A 2Q09A 4E38A 2HISA 4F0LA 2ZUNA 4GXWA 5AB3A 4S3CA 5E0FA 5FSEC 1XHGA 3G3MA 1MNZA 4S1FA 4MLRA 4BQ3A 3IVTA 3W7PA 5LNWA 3GXPA 4AEOA 1J0HA 3STCA 4D1IA 3UWWA 1PZ2A 2NXIA 4QQUA 4GINA 4IIFA 2JKAA 2V81A 4UIOA 3DYMA 4JTUA 4JL1A 2IW0A 3LB8A 3I65A 5JBDA 3A22A 2A3CA 2A3HA 2P8CA 3MI3A 1GQIA 2GJLA 3GR7A 2VEGA 3A4WA 2VC9A 4JNZA 3ZM8A 4P7QA 1JROA 2FVKA 1RD5A 2PD5A 2VFEA 1LL6A 3P62A 3UNTA 1JRPA 3LXAA 1UH4A 1EC7A 1PKMA 3GH4A 5CJMA 3WLRA 4ZB2A 3WQ8A 5A1AA 4QNEA 2WOQA 3QSTA 2GLKA 3DFHA 4BS0A 1ODUA 2VD9A 3T42A 3CZKA 3VKKA 1GVQA 4BEUA 4HSHA 4AWSA 1YDVA 3NQ2A 1U5JA 2XN0A 4IMEA 4ZVJA 1NF7A 3CQ0A 1GEUA 2FZDA 2FGZA 1GVEA 3TK7A 5D30A 1QPOA 5DY3A 4R5EA 1CI1A 2I14A 2VXNA 3KFTA 1U5HA 3G18A 4UQEA 3W1AA 2WVUA 5FF3A 4JY8A 3N2OA 4TXEA 4DWSD 3BAYA 2W54A 1JEHA 1TV8A 3U2CA 1AZ2A 3C0LA 3OA3A 3V5FA 3LK6A 1DIKA 4HA4A 3KRSA 4FNTA 1SSGA 2NX1A 1NHSA 4GC4A 4F40A 1V02A 1X6LA 2R8WA 1DHPA 3UY8A 3U4AA 3KL3A 3KOYA 4PTDA 1E51A 4TVYA 6ENLA 1LUCA 4LUIA 2GQ8A 1TB3A 4XZHA 2DZAA 3ZVIA 3RR4A 3GAKA 3UZJA 5C9UA 2QV4A 3MJYA 3CU2A 4EMWA 1W3KA 2W91A 4HHMA 4RUBA 1DWGM 2ZTKA 4LAZA 1PTGA 4GNJA 5AZ1A 5I7GA 1EDTA 3M0YA 1PYFA 1UA7A 5A6MA 4PMZA 2B7PA 4BY3A 2E9BA 2WNWA 3AJ7A 1S5WA 4C1LA 2QMKA 1XSIA 1F73A 1LVLA 2A4AA 3D46A 1DWFM 5TR3A 4N0RA 3DERA 3TYBA 4QISA 3RO8A 3LZ3A 1DWHM 5K3VA 2WMIB 4KRTA 1XYAA 3WENA 4ES4A 1LWJA 5TAOA 2GGIA 4IQLA 3VFCA 4AMAA 2I9EA 4QJ5B 4LPCA 2HQAA 3F2CA 1VBUA 3MP5A 2CESA 1TJPA 3CB8A 3OJGA 1Z7AA 4KFOA 4MB4A 1OVDA 3WMSA 3ES8A 3MMDA 3IV3A 4XKMA 1MXGA 3F03K 1KKRA 1VC4A 4X9SA 3PP7A 5KVHA 1LG1A 1RAKA 2GSHA 2QUNA 4H2HA 4UQDA 2WHLA 2OLAA 5T9BG 4J3XA 3M0LA 3ZVHB 4PBFA 3T0DA 5FEWA 4ICCX 3G2GA 3NZQA 3NL6A 4GUIA 4LF2A 4PMJA 3GUGA 1EX5A 3HJZA 6REQB 5D09A 2XHYA 2VDHA 2ZQ0A 4US5D 1Q2SA 1XC4A 4HU4A 3AMLA 1UOKA 2JALA 5A6KA 1X38A 4DJDD 3PZ9A 2ZZ2A 3U4FA 4AZ6A 3WK0A 2BMBA 4PZVA 4DBDA 3RUBL 1VQZA 1TVPA 1PHWA 3VUPA 2ZX9A 3SCVA 3PB2A 2TRSA 4GVHA 4UTHA 1B2YA 1M7JA 3AMGA 2EG8A 4U5KA 1UKOA 1OJXA 4AF0A 1VFHA 2QDGA 4MWAB 1J0YA 5JIWA 3CUJA 1N82A 4LS1A 3ORWA 1ADOA 3BLLA 2WW5A 3LNPA 1GRHA 1UD3A 1R85A 5M17A 4S2BA 5GRTA 2EG6A 3O06A 2PODA 1MRAA 3MWAA 3IGSA 3LI0A 2CLOA 5DCBA 3W3OA 4CUCA 3L23A 5FJJA 3EZ4A 3K5XA 3SDOA 3QQWA 3UXLA 4E8GA 3VMOA 1VLIA 1UQZA 1WKFA 3B04A 3E5BA 5G5HB 1QOPA 4Z2JA 2PS2A 1TV5A 1OX4B 1XYCA 4ZQOA 3SRHA 2CHOA 1U1JA 1N7KA 1OD0A 1CXHA 1VIWA 1F3PA 3B4UA 4IXXA 4B5SA 3W75A 5I2UA 4EOUA 1KM0A 1F3EA 3G5EA 3F4NA 4QHRA 4BV6A 3N1AA 4PTWA 3W26A 1V4YA 3ABQA 2DT0A 3B06A 4AYSA 4FF5A 1GESA 3RRAA 2PDCA 3LQGA 1TVLA 2QCDB 4REQA 2IXVA 2Q3OA 3WUFA 3NQCA 3ZR4A 2WOWA 4XG1A 5JCIA 3P5YA 3SM0A 3DECA 3UR7A 4FMVA 3W7LA 2QVHA 1R3RA 2YR1A 2DZVA 3BV4A 1UBSA 4ZCWA 1HL8A 3FKKA 3SGZA 3WDQA 3RCYA 1IT7A 1D7YA 4ZZ9A 3L65A 4PTVA 5I3HA 4FXRA 3KVMA 3CQJA 2C16A 4MWAE 1GVSA 3QZ6A 3ARZA 4IGNA 4Y90A 3NCOA 1YNPA 3E38A 3SUSA 4ICMA 1Q3NA 1WZAA 3TAOA 5DCEA 1FHLA 4GI6A 2OTDA 3CHVA 1KA9F 3VI2A 3QPEA 4JNYA 2NZLA 3QC3A 3M4HA 4PB4A 2WZMA 4CU8A 1CECA 2B7NA 4DJFD 2W3ZA 3TN3A 3SUWA 1H61A 4K1WA 3OLEA 4IMDA 4O54A 3C0JA 2QAPA 3EXTA 4L6HA 4PEKA 2PP1A 2DH3A 3VIPA 4MM1A 5HMFA 4TVUA 2BDQA 2QJMA 1DXLA 1MQRA 4AHOA 3LYEA 4J2MA 4HA0A 4KH2A 5KMYA 5C6MA 1KWKA 1S2VA 1L8PA 3BAJA 3BL3A 3IIOA 5EFFA 1C8QA 3ZLFA 3CT2A 4LBRA 3WLLA 3HRDC 3G1XA 3OZMA 1HUVA 4UOZA 3V75A 4E8CA 5A8NA 4LUSB 3LEPA 3CMJA 1FA2A 3SUVA 3RMEA 1EHNA 4WKFA 5JUVA 4LYQA 1IZJA 5AC8A 2J27A 1FOBA 1ZTVA 3E6EA 2E6DA 5A3HA 3W74A 1NU5A 5LXEA 2EQ6A 2YOCA 1Q85A 1CNVA 3URBA 3MUY1 4WDTA 5ABHA 1E4MM 2G5WA 2ZVRA 3DH7A 4PUMA 3YPIA 1M53A 4ONVA 1X8FA 3P8IA 2YIHA 3LV5A 3RK8A 4GXPA 3NA8A 4HPNA 5A2BA 3WLPA 1XLLA 1W3LA 1YTKA 1US3A 2Y8UA 1GSNA 4KGLA 3POCA 1UR3M 3C4UA 2QF7A 2X42A 3UNDA 4H4ZA 3AIWA 2P5NA 1EOMA 4H6RA 2CBVA 3RNMA 1E4LA 2R9ZA 2OGYA 4H4XA 2ZUMA 3MUXA 4TIMA 1VFOA 3FGCB 3N6JA 1P0BA 3G8RA 1H1YA 5KSWA 4J3UA 5DXYA 5E09A 3EEZA 1IEQA 1J0IA 4GIYA 4QJ1A 3QQ0A 1NP2A 1FUYA 4AZ7A 2H8XA 3K1GA 4KCWA 4H3DA 3F5KA 3WF4A 1JD9A 4CLMA 2ZUVA 1JJKA 2WHKA 4NAFB 5CGQA 2QAEA 4JPGA 3O1NA 4M80A 4FLSA 1UPMB 3NO3A 3N4EA 4AD4A 1MXDA 7TAAA 4Y8EA 1JPKA 5BOOA 4S23A 4LVGA 2XFWA 1X97A 1OADA 1BAGA 4JTRA 3GNRA 4QG8A 3EAOA 3TR9A 3L67A 1QMLA 1FWFC 1E71M 1XYBA 2RGMA 3CQIA 4FA3A 4EWJA 5L6UA 4MSSA 3WF2A 2Z28A 5D9MA 3GYEA 2QUMA 3TOPA 3L2MA 2ZIDA 3EOEA 1QNRA 3PZNA 1P6BA 3BLOA 3CZEA 2ACSA 1B30A 2FMNA 3EAUA 2V67A 5FA5A 1EP2A 5A6TC 1B4KA 4MUPA 5TNVA 1EWEA 1AJ2A 1FWDC 1JNEA 1GYMA 1ECEA 2R6OA 3OVGA 3SUUA 1QOXA 4E0CA 4O15A 3ATZA 2P8BA 4O52A 2XG9A 4TR9A 5FF0A 2W92A 4UMCA 5HXMA 4CD6A 2TAAA 4LAUA 3PSVA 3ARPA 4NYYA 2OX4A 4BK9A 1O5QA 5LGXA 2WZHA 4QTGA 1SZGA 1M65A 2EO7A 3AFBA 2P0IA 2I5QA 4C91A 2W61A 3P3BA 5LA1A 3W00A 4XWUA 3STPA 2B81A 3GDBA 1LQ2A 3EDDA 3URQA 4B9ZA 1EJWC 3VIHA 4QQ3A 1Q65A 3KEHA 3LS9A 4HOZA 2BHUA 4PCPA 2WM0A 2CPUA 4EPKA 1QI0A 1HN1A 4Y9PA 4WSKA 1W5QA 2PBOA 2JGQA 3ITLA 4URIA 3VYLA 4WKHA 3FNDA 2WBGA 3RG6A 1A5SA 2WZTA 3S2LA 4CQ8A 2PDPA 3I68A 2DIJA 3VO0A 1EJTC 2G96A 3AIQA 4Q4PA 2D2HA 1P0DA 4JTDA 3CHEA 4PL1A 4RNJA 3G1VA 3CHFA 4KPRA 3UVAA 2PRHA 3S6TA 4XAZA 4W87A 4GI9A 2NLIA 3ZLHA 3HMCA 4TTGA 1LBMA 1JPHA 3CQKA 5I07A 5BYWA 2OZ0A 2X8RA 3EXSA 4FXFA 3ARVA 4S3DA 4XBSA 4BR1A 2EQ9A 1E1CB 4CNUA 3I3BA 4E4PA 2RDWA 3PY2A 3DG6A 3QJAA 4DEFA 1FWNA 1W5PA 3ICJA 4FO4A 3LRKA 4CCCA 3HW2A 2XU2A 1XH0A 3Q45A 1TV7A 1ZJAA 1XBZA 3WQWA 4LJ3A 3QSRA 1OZMA 3QV9A 1RBLA 1EF2A 4Y96A 3H54A 4YPJA 2CLHA 4HU8A 1E4IA 3P61A 4XIMA 2YBTA 3TTEA 4H4YA 1LWHA 4ADTA 5XIAA 5HINA 4GY7A 2UY2A 2DV0A 4IFKA 3MUZ1 3EOLA 2OEKA 4XO6A 2QF8A 1B9BA 1OZQA 1E40A 4F66A 4IZGA 4JIPA 4CCZA 2DSKA 2A8XA 3UA3A 2EKGA 5HWNA 2E77A 4O1BA 4JTQA 7TIMA 3NS1B 2A6LA 2W0UA 2VFFA 4P7OA 4OQVA 1REQA 1KLZA 4MWAC 5G4EA 5E6YA 4AEEA 1X1OA 3KRZA 1HJSA 1TG7A 2OOGA 3W0KA 4MVAA 3VIGA 2UBPC 3XIMA 4J3VA 4Z1YA 4CN6A 4J3SA 1MI3A 3W6YA 4JEJA 5BCAA 2EF9A 4GZJA 1SGJA 4EF8A 3HPFA 3DBPA 2YVGA 2C19A 4ZB0A 4NF7A 1KQZA 3UWEA 3MC5A 4QP0A 2B31A 2FZMA 3GHSA 4YTQA 2XINA 4BJHA 4WOZA 3N11A 3TC6A 3L12A 3BWWA 3OTRA 1AW2A 1TYGA 3VDGA 4KMQA 1JIBA 4DYJA 2HPIA 3VNMA 4I9MA 3G3DA 4LFYA 2JEQA 3M5VA 3KBSA 2PWGA 3VD9A 3VD5A 3ME3A 4NP7A 4QEEA 1SSDA 1QFEA 1WX0A 2DZUA 4IMGA 1N8FA 2W3RA 4GOAA 2EPOA 3OLGA 2ZKMX 1UA3A 3AAMA 2G50A 1JDFA 1DE6A 1EOKA 3VOCA 1GPFA 4JIIX 3GTFA 4GIAA 4QGCA 1K3UA 2O4MA 3WNNA 1XPYA 3EUB3 3CHCA 1E0UA 3QPZA 3BCJA 4E3VA 2ZZ4A 4HSNA 2A3LA 4L9XA 3GXIA 4H4SA 3NNTA 3U3HA 3FN9A 4JFVA 2UWFA 3SY1A 1OC7A 4O0QA 3O8AA 4QJ4B 1QWKA 4XUGA 4K6AA 4QDPA 3KCJA 5CBBA 4WF7A 4FB7A 4P5UA 1FXPA 2VX6A 5E0KA 2CBJA 5HJYA 1VHNA 3SEPA 2ALRA 4LVDA 4JHZA 1W6TA 3IAQA 4PTMA 3M0MA 3DU0A 4HA3A 4U3AA 4LC8A 2BGQA 5AC4A 1EWDA 4JGDA 2DZSA 1QK0A 5DANA 1YBQA 1SFLA 1A3XA 2VX7A 3R8GA 4LQ1A 1I75A 4WJ8A 3VIFA 1OGGA 3TSMA 1QPQA 2EQ7A 1K1DA 1KFKA 4AX6A 3CWOX 2GR2A 5FJIA 1D2KA 4QROA 3R07C 3WD1A 3A5FA 1C92A 3ZFHA 3STGA 3QHMA 2ZRWA 3MSGA 3WK3A 1EX1A 2NQ5A 5C5YA 3PBYA 1GTEA 1F5ZA 1QOQA 4GXMA 3GRIA 2D23A 2OEJA 3L21A 3OEXA 4NRSA 1W91A 2CETA 3NYZA 3S2CA 2WWDA 3H2FA 3NZPA 2E9MA 1UD2A 4A22A 4UTTC 3NZRA 3NTYA 2DPEA 4NVTA 4HBKA 4JFWA 4FHAA 3HV8A 4KIEA 2J8FA 3DBNA 3P60A 3GDRA 2YCKX 3VKCA 5AFDA 1O60A 4IF2A 1YQZA 3B9JB 3FSTA 2E0PA 2VVSA 4LXFA 1K4QA 2PZNA 5EY5A 3W73A 3H4GA 1R8LA 4KCTA 3PPHA 5K9XA 4R34A 4RDZA 2DGAA 3DEQA 3R2GA 3PPFA 3E0LA 3G1HA 4OZOA 2F61A 3G77A 5ECUA 3ZXWA 2ZUUA 1QDSA 1N2VA 1DYSA 4WK9A 3ZSSA 4YJ5A 3OZYA 3MJMA 3QBUA 1KCZA 1AQFA 3OO2A 4K3ZA 4KWUA 1F2JA 1V03A 1S2TA 3TW6A 3NUKA 2XVGA 4IMFA 2FTYA 1CXKA 4JTSA 4G5DA 5CG0A 4PEEA 2VCBA 1EBGA 5A8QA 4HMEA 4MY9A 2QJNA 3FYPA 4B2DA 1JAKA 1MVYA 2F7FA 1OBAA 3H2AA 4HB7A 2OYKA 2J77A 3APYA 4EE9A 3VKDA 3ITGA 5HANA 3KBJA 2PC8A 3WQGA 4GVIA 1R86A 1ZUAX 2YCLB 1THFD 4QJ3B 1RV8A 2E6FA 2J9ZA 3HQNA 5A5WA 3VX1A 4JAWA 3B40A 2YDQA 3MWCA 3NQMA 2POTA 2Q8ZA 3HURA 1A3WA 4J40A 3W76A 2WANA 4N7QA 4MKVA 2WZEA 4LAKA 2W6RA 3CNYA 4DO7A 4UTFA 1AMYA 1CPUA 3V5CA 4NI8A 5LZLA 3WDHA 4HYWA 5LHEA 1IYXA 1G01A 3F7JA 2JK6A 4MPQA 3AUJA 4AUBA 2WMJA 2QV5A 4O4VA 4L4LA 2ZXQA 3WD4A 4NAEB 3PBVA 4QAWA 1LOLA 3CLWA 3UCQA 3LXDA 4AC1X 1G69A 4B92A 2D24A 1KW1A 5DMMA 3VGGA 1FWEC 2E8YA 2INZA 4HMCA 2X50A 1Q63A 4YIWA 4KERA 1BVWA 3MCOA 4FX6M 3D5HA 4FNSA 5E6ZA 3S1GA 3EWWA 4IPLA 4TX8A 2C71A 3ZO9A 3NSMA 2TPSA 1OFBA 3IEBA 4ZO8A 4RXFA 2QXWA 1PXGA 2FPYA 3R43A 1CLXA 5BU9A 1TZ7A 3ZMRA 3HG5A 1ZCCA 3V36A 4INFA 5F2MA 1H5YA 3D0CA 2PI6A 4WZHA 1UWSA 1A0DA 3WK2A 2V30A 3NQDA 1W5NA 3GRTA 3U2OA 3PZMA 4WJEA 9XIMA 1T99A 1X39A 4PUJA 3KDNA 1JYWA 1TRDA 1S38A 4C7GA 3HGSA 3SN1A 2E5AA 2XN1A 3LPGA 3KOXA 2CEQA 5CJ5A 4JX6A 2D3LA 2VC6A 3BH4A 1K9DA 3KE0A 3GK0A 2VYOA 3THDA 1W56A 2V5KA 5FS8A 2NX3A 4Y6GA 4L7ZA 1I2NA 3AWNA 1ICPA 5AYZA 4L4OA 2VRKA 3OODA 3ZSTA 1GVYA 3SBFA 1Z44A 1W8GA 2PWFA 2OWCA 1TWSA 3CGTA 3LBMA 6XIMA 5C9RA 3NGJA 3UYCA 3IIPA 1JULA 1ISVA 3CM4A 3BGAA 4MB5A 3FK4A 2VM8A 1JAEA 1KXTA 3B0XA 1DVJA 3Q2DA 3I10A 1G1YA 1VFUA 3UD6A 2WMGA 3L2LA 1KTBA 3SJ3A 6REQA 1OQFA 1S7MA 3MCMA 1DIDA 1ZB5A 1OX6A 4CQAA 1CB2A 3LD5A 3R5EA 3I3EA 4XBJA 5EB8A 4EK7A 3ONBA 1TA3A 4GCAA 1TYTA 1KFBA 1Q1WA 4EXAA 1IGWA 4TVDA 3B9DA 4ORMA 1VF8A 2JF6A 2OZTA 4RJEA 3SCOA 1XUUA 5FMHA 2UZ9A 5CZ0A 2H9AB 2A7RA 3OBKA 5LIUX 5XINA 1G7UA 3EX1A 1R3WA 1BTCA 4MWAA 1EEPA 1ZALA 1WYGA 2V3GA 3SI9A 8XIAA 1NIUA 2IKIA 4JIHA 3KDOA 1EQPA 4W84A 1CX9A 3SCSA 1PIFA 2WO5A 4A8LA 2V0TA 2I17A 3HG3A 3GKAA 1ECQA 2X2YA 4OBRA 4A8RA 3GSMA 3R0DA 2XIIA 2YPIA 4AH7A 3E0WA 1TTJA 1UKSA 1XGZA 4PYSA 3T0TA 4R7WA 1W9BM 5JCLA 3GFXA 4LYKA 2H3DA 1TWWA 2Z1BA 1W9DM 3W7QA 2EAWA 3ELFA 1DEDA 4KIRA 3L4VA 3BQ5A 2ZRUA 3CUHA 5I77A 2X1TA 1VPXA 1O68A 3PJWA 2E6AA 3PHAA 3BC9A 2VJXA 1AA1B 2F8QA 1TPVA 4BCEA 4FX7A 3PK7A 4QE5A 1IT8A 1V7AA 2QCDA 3DGBA 4K1GA 2WYSA 4Z1CA 3QYQA 3WQ6A 1JDEA 1X7IA 2V5LA 4OWGA 4KCUA 4MUZA 5H8UA 3TQ0A 4OVXA 2J7CA 1S3TC 4FIQA 2ZZ3A 4IJCA 4YTRA 3LRMA 4D2JA 2FHCA 4Z42C 2YLLA 1UR4A 3BQ6A 3GDTA 4AD5A 2NXHA 2EPHA 3UWZA 3FEMA 3FXYA 5CLTA 4US6A 2VC5A 1V0KA 3ZT6A 3M43A 1YPFA 2E68A 4HOXA 2Z29A 1KCLA 4V1XA 1FWBC 4XD3A 5D2WA 2OLHA 1UIOA 3SFKA 1AL8A 4DBSA 5KZDA 1AVAA 5FS7A 2Z2BA 1WP6A 4MF4A 4DUWA 4A3HA 1R2RA 2P10A 3VXGA 3WQDA 4PN2A 1I60A 4JKLA 4YMZA 3R89A 4YS1A 3IGHX 1GV4A 1JZ3A 1YMYA 5F4WA 2PRMA 1BF6A 1GVOA 5FESA 1SYTA 2Y0FA 1BEUA 2E5DA 1B90A 3DFSA 4N6EA 3M16A 4PMOA 1DJWA 5BZAA 1QBBA 4ACYA 4NX5A 1H7NA 3KVJA 1R7AA 3QXBA 1TJRA 6TIMA 5IDZA 3W6MA 3KS5A 4E4FA 4LUSA 1QPKA 1R3YA 3VZXA 2WHMA 3BCFA 4IX0A 3IJLA 1T8XA 1Q6EA 5FJUA 1XUZA 2C91A 2R1NA 2X2GA 1FCBA 1E0TA 4UTTA 3AMDA 3FXGA 1PWMA 3C3UA 1H7PA 2ZCGA 3LGEA 3LGGA 2X8HA 4GQGA 5DF0A 2OCZA 2XGIA 3NAVA 1TWDA 2R82A 3PWAA 3LHYA 3PJXA 4PUUA 1E56A 3WBAA 1DE5A 4DQWA 3VU2A 3WQ5A 1XRFA 5REQA 3EDKA 4P8WA 4DBUA 4HYRA 1R0MA 3VC5A 4WY0B 1R2SA 4HD5A 5D8WA 1ONWA 2Y5SA 4WDUA 4GX8A 4N6FA 1UWRA 3FGCA 1VCVA 3P0XA 1VEOA 1JXKA 3LGDA 3W1QA 4N9EA 4Q4RA 1SZFA 4GRSA 2QCCA 4EXBA 1W5MA 3N2TA 3TYZA 3NVZB 2Z1KA 3H55A 3EB2A 3DKLA 3WLQA 5I00A 2I57A 5T8GA 1VFTA 2A6NA 4XUYA 4NZ3A 2NQZA 3LCGA 1KV8A 1PO9A 7CGTA 2Y62A 5F7UA 3GHUA 1WBJA 4XZNX 1ADSA 4O28A 4AISA 4FX9A 4ZO7A 5U1OA 2X7WA 3DYPA 3TA9A 2GJXB 4K7ZA 2V6AA 3P74A 5JU6A 1T41A 4M52A 4NYUA 2GK1B 3B8VA 4J28A 1EDQA 4ENLA 1WQ5A 3II4A 5DBTA 2Y4SA 5LHFA 4AZHA 4GIEA 1KGUA 2AAAA 4BI6A 2PTXA 4DBWA 4ZQMA 4HPHA 3SURA 2J88A 4W9TA 1SJBA 2CYGA 1QT1A 4PMNA 4LT9A 4M19A 1XICA 4ZO6A 2PU1A 1LCOA 1UMLA 5M5DA 2GSEA 4AB4A 1TJ0A 2ZA2A 4XKYA 5CGTA 3ALGA 3OZOA 3NL2A 1K03A 1GXFA 2XFFA 4PTXA 2F5ZA 4DNAA 2GFTA 3NL5A 1PIIA 3N2BA 2ZX6A 3WQCA 3RPTA 2PDWA 2D2JA 5A8OA 5IFTA 3AIRA 1LF1A 1G9HA 1K8ZA 5JVLA 3B03A 1LZOA 2ZZ6A 3SQMA 3OIXA 4DXKA 4F3HA 2OSXA 3APTA 3EGJA 3IGUA 3EA2A 4LC6A 1GEHA 1KM1A 4OU1A 2BGSA 1QHPA 4DI8A 2B4GA 3FFSA 3UR2A 4U5IA 1MO9A 2OB3A 2VCCA 4G1NA 1JCXA 3AS0A 4CCEA 4L6OA 4Q32A 3T81A 4UTKA 1DIEA 1TTIA 1CXIA 4TO8A 3WFAA 3QTGA 2VHLA 3BW4A 3N3TA 4NXSA 3LM3A 4GX9A 3C8NA 4G56A 1SR0A 4DWSC 2OWXA 2NQHA 3DX5A 1HT6A 5IDIA 3ARXA 5A6BA 3WJSA 2ASHA 2GH5A 4I5RA 3A13A 3LMYA 3LXCA 5AY7A 3O6CA 1JF6A 4HZ8A 3TYDA 3HPAA 4I5UA 5EMJA 3A9IA 3W7JA 1NSJA 3HB9A 1LQ0A 4FK9A 4ZOEA 1PEZA 2HDJA 1V6UA 2E1WA 1UKTA 2JKEA 3EX2A 3G1YA 3CV1A 3GR4A 4GYJA 1UD4A 3MBFA 3IJQA 4E4UA 1XLEA 3TNOA 4QSHA 1QCWA 3NDOA 5ECVA 4JKMA 4E6MA 1W3NA 1GGOA 3ZR6A 4AWTA 3QW3A 3P7YA 1W1PA 3QW4B 4UQ9A 2ZZ1A 1XC6A 2JFEX 3O16A 2OLSA 4FLOA 1CXFA 2ZX5A 5AHNA 4APNA 3KHDA 2J7BA 1WOAA 4CQ9A 1R46A 4O50A 3DOPA 4IX2A 3T4CA 2V5JA 2PWDA 1NFPA 3IJ6A 4RPPA 5AYBA 4GY0A 3UERA 1AQHA 2Z7KA 4AXKA 2BY2A 3OGSA 4GWEA 1TPC1 1CT5A 3QLLA 5ABFA 3IRSA 4J4KA 2VC7A 3JVAA 1KBJA 5HUOA 4Q8PA 1ME9A 1K4HA 4QS6A 5T26A 1JFXA 3NG3A 4AD0A 4NL1A 4YYFA 5BXPA 4LY8A 4H4VA 5LIXX 4NU7A 2WJEA 1H63A 4YWSA 1OC6A 4XAFA 5A6SA 1YXYA 2E1DA 2JK2A 3VMPA 3WLTA 5TF0A 4KEMA 2P3EA 3HFTA 2MNRA 1QPRA 3MKCA 1NM9A 3S1UA 3WEZA 3WNKA 1WE5A 4JYFA 2FYMA 1E70M 4IQJA 4CEXC 3UJFA 3AHXA 4ERIA 4Z2IA 5M03A 5RUBA 1LUCB 1K8YA 4H8HA 5HK4A 1UWTA 3HPXA 3BLFA 2E3ZA 1R3TA 5CSSA 1RSCA 1M03A 3NQAA 1VYRA 4H83A 4HJWA 3SCTA 3WBYA 5LA0A 5EKYA 4H4PA 2EHHA 3GAYA 2BC0A 2QLYA 1I9CB 3IK4A 1V77A 4IPNB 4AZCA 4ASTA 4H9ZA 3MUIA 1ZZMA 3W71A 1C8XA 3BMWA 4H9VA 2WSQA 2VO5A 3F4WA 2ODOA 5GNYA 1YRRA 4ZOAA 2DW6A 1J2BA 3MUCA 3C2YA 3TW7A 4BWLC 4QBXA 1IT0A 1UZ4A 2FJKA 1U2YA 5D9PA 3BARA 2YKKA 3KX6A 3EOSA 1O95A 2V5CA 1N55A 1DL3A 1NEYA 4K68A 4X2RA 3K4WA 3RDKA 3P67A 3INPA 4DPQA 3K30A 1GQNA 2X8CA 2V3AA 3EWYA 3DCPA 5JH2A 4BF5A 2NVCA 3RX3A 2XM1A 4W5UA 1UR2A 5IXEA 1NH6A 3VOGA 1SO4A 3NQ8A 5CC3A 3W81A 3SR7A 3FX4A 4KRZA 1GT8A 1J96A 1KFJA 2XN2A 5CG7A 1ZKQA 4C6JA 2CBUA 4X3ZA 1KXQA 4UR9A 2YYTA 4JFTA 3WDIA 3MYPA 5LGZA 3F2BA 7REQA 4TU1A 2GDUA 2QIWA 3RM8A 1KFCA 1TCMA 1ZBVA 1TPDA 4PB3A 1N63C 1EO5A 1KCKA 1J18A 3TTSA 1KCXA 1IE7C 1G4TA 4JR5A 1HKKA 5T91A 4U2YA 3VM5A 3HM7A 4KPLA 3QQ1A 4B5VA 1GZJA 1A5AA 3CL6A 2HVNA 3TQKA 1W3IA 3H7RA 4Q8MA 3BZGA 3QGVA 4RV8A 3NQVA 1C9DA 2FHBA 5U4NA 4YWIA 3UWYA 4K8DA 2TSYA 2J47A 1XKJA 2WQDA 1F3TA 2YCIX 2WCSA 4S39A 4JCLA 4EPEC 3LRLA 3PSWA 2OPJA 2SFPA 3S1VA 1I2OA 2GVJA 4O14A 4ZXOA 3VILA 3G0UA 5I02A 1QUMA 2DT3A 5CPTA 2YVFA 1SW7A 1EYEA 3UWUA 1W3TA 5FL0A 1W3HA 2ZUWA 1F6PA 1JPDX 3HIJA 3VK5A 1TE1A 2J6XA 3PWGA 3WG6A 4CVUA 4PMXA 1POKA 4ML4A 4HVXA 2OODA 1EJRC 5CZKA 3MHUA 5FJTA 5I79A 3NDZA 3LMZA 3APGA 3UJRA 3W7DA 2WPBA 3OOQA 2RJGA 2INFA 3IVSA 3QKEA 1GYLA 1KM5A 3BOLA 4REQB 2HVOA 4TVCA 2A3EA 3MVIA 1BVZA 3RNDA 5CBIA 2NQ9A 5CXPA 3NR0A 1DQUA 1V6YA 3A4XA 1ADDA 1GETA 4NEVA 1K70A 2V63A 3HQOA 4NNBA 2YDRA 3EB4A 2J7DA 1R9ZA 4NZ1A 4X61A 3E9AA 2OVLA 4E2VA 1H41A 1BPLB 1KN0A 4UFMA 3RO6A 3W7IA 3OVRA 4I9JA 4C6OA 1UP0A 2OOFA 4Y9AA 4D8ZA 3CWNA 2E7FA 1K7XA 1YE4A 2Z4GA 2E28A 1ZPTA 2C1HA 3T8LA 2VGIA 1STZA 1F6YA 1XDMA 1SVDA 2NUYA 2YCLA 3AHVA 2J9YA 2BXVA 1W1B1 2GQAA 4ADSA 4CCDA 1ZMCA 4K38A 1WKYA 3GVQA 3PUEA 3AZSA 3B8IA 3DGRA 2OYLA 4MHBA 2YQUA 1OINA 1E1EA 1NQ6A 1UWAA 3KOWA 3PZOA 4L4MA 1FDZA 1FECA 2C13A 2BSLA 3PFMA 3TQPA 1GORA 3TMQA 3GDMA 2VGBA 3KBWA 4NI3A 4RXGA 3USZA 5FJPA 2CZVA 3MMWA 5CAHA 3SW6A 1G7VA 1UUOA 2NV2A 4I90A 4S3FA 4HZMA 5I3JA 4TMCA 3AJXA 2QKFA 3WN6A 1WO2A 3QGKC 2CLMA 4B4FA 1EIBA 4CQCA 5KZEA 3SQPA 1FH7A 1OGBA 1PZ0A 4H8UA 2DZBA 2WK2A 3TN6A 1B3WA 3SCNA 3ARSA 3UCCA 2GQ3A 4DWSA 3RLGA 1F05A 3R79A 5C8BB 1KTCA 3EEGA 5I3KA 3COTA 5FJRA 1TV3A 5E9XA 4DF2A 2FIQA 4S3KA 3S83A 2F6KA 5HUPA 3H7VA 4CD7A 3ZR5A 2YA2A 3AU2A 3II1A 4PUDA 2UV8G 3WLNA 3F4DA 1QASA 1XIBA 4DZAA 3FVDA 1W37A 1CGXA 2FDSA 1PIGA 2WNZA 1QNPA 3A3HA 2WOIA 1IEVA 2F6XA 2VQTA 5AN7A 2OKTA 5CSYA 4L1WA 3VD4A 2FVMA 2W4XA 3LHTA 4RE2A 3SCPA 4HU0A 4XB3A 5DQPA 1DOSA 1XLBA 4KS0A 2YBUA 3D6NA 4H6EA 5JCNA 1VPQA 1R38A 4JD4A 5BXRA 3N19B 3GZ3A 1S2CA 3E0VA 5C2XA 5JIPA 3MZ2A 2GUUA 5CLWA 1QW9A 3O9NA 2O92A 3W07A 3HOJA 3L5LA 3RF9A 4S3BA 1BHGA 1NELA 2DY3A 3LPPA 4XSMA 3UQNA 3S6OA 4Y2WA 2CU0A 4YCPA 4Z0JA 1EUAA 3O6AA 3TZFA 2W0HA 1MUMA 2V3DA 4S2CA 1FHDA 1NDWA 1RHCA 3QEZA 5C2GA 2TODA 3E74A 3WSUA 4QR6A 3ALFA 4IIHA 2J7HA 3VX0A 4MAZA 3F1QA 3W7MA 5KTLA 2OU4A 3Q94A 3CPRA 5EBAA 3VNIA 1QAPA 3GVGA 1MNSA 3L4TA 4V33A 3GYCA 3CH0A 2O9OA 1XL9A 5FCZA 2ZUTA 1IHIA 4IGHA 1R5YA 4YNGA 2D22A 2HMCA 2H9AA 1AODA 2G97A 3A23A 4HK5A 4OV9A 1IQ8A 1UASA 1Q8AA 3S5SA 3UR8A 2I5GA 1X8CA 1G4SA 1F74A 1ODZA 4ZQRA 4US5A 3CGEA 3VGEA 3W4RA 1S5NA 2XSBA 3BMXA 1ZNNA 4GIRA 4E2OA 4Q22A 2D20A 4IT1A 3NRZB 4NX0A 3BAKA 3TC7A 3VD7A 1F3WA 1UZHA 4XTDA 2CZEA 4BHYA 4GFIA 5DT5A 1JFHA 4OT7A 2V3EA 3AXKA 4NHVA 4NNAA 5FF2A 1HX0A 1J6PA 1Z32X 3BURA 3GX9A 4LANA 1R3QA 2XWEA 2C14A 4LV9A 5H6HA 4GRTA 3K13A 5AHMA 1P1XA 4FDCB 1NWTA 1XDJA 4QCEA 2Y7GA 2I1OA 1CGWA 3D47A 3AU6A 2ZWZA 4UOJA 3UT0A 1W1YA 3F2DA 1XJBA 2ISSA 1H49A 1BWKA 3L66A 3B0VC 1V7YA 4GC3A 3HA1A 1MUWA 1JF5A 1JYNA 4R9XA 3G1RA 1EL3A 3EBVA 4BWLA 2W67A 1CBGA 3VABA 1F7BA 3I6TA 2HBVA 2A7PA 4C6NA 3M07A 3TSDA 1ZP4A 1BD0A 1UC5A 3H23A 1V6TA 3CUXA 2BBFA 2XIOA 3ITVA 3WF3A 4DVOA 2GGJA 1P5BA 1ITCA 4LAOA 2X41A 3OHMB 4XZMX 3HTWA 1KRMA 3DIPA 4I5XA 1WDPA 1F8MA 4M24A 3LHUA 4A3QA 3VIOA 3VKBA 4U10A 3A4JA 2VKZG 1SZNA 4NT0A 2CKSA 5HPOA 5J5RA 3V5OA 3W88A 4Q7NA 3B8SA 2PLMA 1UIPA 2G3FA 4IPIA 3M1ZA 4K8EA 2HS8A 1A5UA 4EANA 4MFEA 4B5TA 1OK6A 5EBUA 5IHSA 2EQDA 1NDYA 3P93A 3TONA 3GQYA 1A0EA 1V6VA 4MY8A 2W3SA 5DRIA 4JTJA 5JRBA 1M7OA 1ELSA 2PF0A 3ITOA 2EPKX 4C90A 4L5ZA 1EO7A 1EB3A 3GNOA 1S2AA 4UZSA 5AHEA 2XVNA 1GZGA 3GG0A 3SCWA 3PB0A 1YXDA 3AWOA 3AICA 4FXJA 2QIIA 2W27A 4B3KA 3RFAA 1XYFA 2P88A 5FI8A 4NRRA 3UW6A 3KTXA 1PTDA 2FFCA 3RX2A 5AHLA 4L9ZA 1OCQA 1SB3B 3A24A 3DHFA 4RZ4A 3MHFA 5D9NA 3KBVA 3ZWSA 4IFKB 1ITXA 3EA3A 2CZ5A 3C0SA 3R7MA 4FNUA 4DJFA 4W8BA 3ZYZA 4A2RA 4J5NA 1IZCA 2OSYA 1KO0A 5EFDA 2D0HA 3PBUA 4KKXA 1AQ0A 3RMJA 1UUQA 2NUXA 4HNLA 1NP0A 1WA3A 1J4EA 2ONEA 3MUAA 5M2FX 2I7GA 3DHUA 4QSFA 1ZK7A 5I24A 2QPUA 1AOGA 1Q4WA 1REQB 3KTCA 2PU0A 1XFCA 1YQ2A 2FGBA 1CXEA 1WZLA 3ONCA 1G6CA 4J1OA 3WF0A 2OZ3A 2FTPA 3TCEA 4AY7A 3W01A 3L4UA 3JW7A 1TZ9A 3GE7A 1NWRA 4LNYA 3FJNA 2ZXBA 4AZGA 1YNYA 3ABRA 1UMYA 3E2SA 3QV8A 4IISA 4O10A 3UR5A 3GTNA 4DHGA 2EXOA 1FWIC 1BXNA 4FALA 2GR1A 1SFJA 1PZ3A 3WNLA 3BICA 3S3GA 3GIYA 2YSWA 5AVHA 4QITA 2GJXA 3KBNA 4A3UA 1PX3A 3FJ4A 3BOFA 1Q4NX 3GXFA 4XX6A 2CITA 4NNCA 1XLKA 4J3TA 3H26A 4XIAA 2QAFA 4PMUA 3M44A 4JIQA 4HA1A 3O3RA 1Q6RA 3TTOA 4G7EB 1IV8A 4KWOA 4DJEC 3N2CA 3UG8A 3SAZA 5A2AA 3SUTA 4UQBA 4DF0A 4L6DA 3BSGA 4AHPA 4Q4QA 3VDBA 2PDGA 4M0XA 3TOYA 2VQUA 2R1PA 1PB0A 1ZJBA 5LA2A 1JZ2A 2ZYFA 1Z41A 4XZWA 1GJWA 4WGXA 1EIXA 3RITA 2CWNA 4F0RA 4QM1A 3EXRA 1B31A 1V8EA 4AD3A 1E6XM 1G5AA 2WLZA 4PMDA 3M0VA 3W6LA 3NPWA 2ZFAA 1I4NA 3S9YA 1HVXA 7ODCA 3PWIA 2DSWA 2IQ0A 3EMCA 4F0HA 5HAOA 4ERGA 5HULA 1VDVA 3PJTA 1XH1A 1PPIA 2PTYA 2O7SA 3RXZA 1FVPA 4EPBC 2AGTA 1BRLA 1YBQB 5JCKA 5HNNA 3DENA 3N9SA 1X7FA 1XQKA 3SSJA 2DUAA 3UZYA 4HOWA 3VNZA 2GQ9A 3IC9A 2PWUA 4C6PA 1KGXA 2HXTA 1DXFA 3DUGA 2QCGA 4Q6XA 5I09A 5G2IA 1PHQA 4UFJA 1KR1A 4MYXA 2YA1A 4XZLX 4JX5A 2YYUA 4M7SA 3CPGA 4NXKA 4ZTYA 2ISWA 3BAIA 3AZTA 3E49A 1RM6B 3SZ8A 1O6IA 2A21A 3CUGA 3QFBA 2A3BA 3IPWA 4RZBA 1E6RA 2PURA 2YDSA 1QBAA 2W5FA 4UMAA 2PDQA 3QGAC 5AZ0A 3AHZA 4EAMA 4EQWA 4AVFA 4GMEA 2HE5A 4NZFA 2FDMA 1JUKA 2XZ9A 3FCPA 4KF1A 4LU0A 2C0AA 1FKWA 5D8ZA 1GQKA 2OEMA 3OIHA 3VFLA 3KLLA 5HOSA 3DFQA 1FEBA 4IUOA 3WX7A 5C54A 4A3YA 2FB2A 4DM2A 4E2BA 2FGLA 2X05A 5F2IA 3MQTA 1NF0A 4LOCA 3CXBA 3B8UA 2VVNA 3QR1A 1OFDA 3PNZA 1W1IE 1VJSA 3DI0A 4Z1BA 4NIRA 3OYZA 1QI5A 2IPFA 2FPTA 1PS9A 4Y9OA 2Y63A 3BLIA 5FEXA 1WPCA 2BXYA 1DJXA 5DN1A 2HS6A 3CS2A 2PSNA 2Q02A 3DK4A 2DQWA 3UESA 4PE8A 1UUMA 5HNTA 4H50A 1M9HA 3PM6A 3L0GA 3W7KA 5GVJA 2R1LA 1FWSA 5D2XA 4B2DD 3E5PA 3REQA 2H6RA 4BI5A 3P0WA 1A5CA 3I7SA 2NPXA 1IXNA 3L68A 2RDUA 3FDGA 4TVWA 2Y24A 4X22A 3TFXA 2TMDA 3ARUA 3GW3A 1WBHA 3RX4A 4B5WA 3NQ6A 2FH6A 3VIMA 4BQ4A 3RYSA 3DKJA 5FJOA 1U33A 2PGRA 4M6UA 3BUVA 2EQ8A 3LI1A 3DYOA 5EGRA 2B7OA 3QVQA 2W79A 2GVGA 3IARA 2V3FA 1PWLA 5I5RA 3HFYA 4DPPA 4GY1A 1EA0A 4JTLA 2F2KA 7PTDA 1N5WC 5H8MA 4W88A 2J13A 3WDJA 5K9DA 4LVBA 1DHKA 4QAIA 4AC7C 1JPMA 3KXQA 2NW0A 4JY9A 3H7UA 4B90A 3AHTA 1EA9C 4NQ1A 3OGVA 4RDVA 1RK6A 4O1AA 3C0QA 5B7YA 1DQXA 2DZTA 2RDTA 1EC8A 1LQAA 5CPOA 1JD7A 2QCHA 2Z1XA 4ROPA 1MW2A 1RA0A 2UY3A 3SN4A 2E40A 3T78A 2O9PA 5CKSA 1FP8A 1OD8A 3H2CA 4BURA 5K9CA 3WLIA 1V0NA 4O1DA 3W1LA 5I6SA 4ADWA 4IFOA 4H4TA 4FLRA 1IIGA 1XH2A 1XRSA 2HNHA 1JOAA 2XH0A 1GW1A 3QYSA 2ZA1A 2GJPA 2PDFA 5HA7A 1POJA 1LPFA 2A1YA 2F84A 5CPQA 1GRTA 2WSYA 2XFYA 1RCQA 4NY2A 1XRVA 5A2CA 4WIWA 2QCEA 1GEQA 2EKCA 4PH6A 1SJDA 5I03A 1R3SA 3WKZA 4MOZA 1CGVA 5H1WA 4ZE4A 2PUZA 5JCMA 3VVGA 1J12A 3ZLGA 3UY7A 1A47A 1EJSC 1H6VA 4ZSTA 1AFSA 2GJRA 1FBAA 5LNVA 1XSKA 2G95A 1JCJA 5DLCA 3PNUA 4AU0A 3SB0A 3HG2A 1TCDA 3CXOA 4DO6A 1TMLA 1XINA 4IHCA 3CH9A 5E9AA 3W83A 4OV4A 1H0GA 4C6QA 3AMZA 1TA3B 1BYAA 4UNIA 2VZVA 3M47A 1VBHA 3NEHA 3WEOA 3SJNA 1LOSA 3T2QA 3FY1A 4UR8A 3G1FA 4BF7A 1KLYA 3GC2A 4RE3A 1NFBA 4XD6A 2VFDA 3ITTA 4R85A 1FWHC 1J0ZA 1RVKA 1RA5A 3NOYA 4FEZA 2V2CA 3L5MA 5M3WA 1VR6A 3ZWTA 5E1QA 3UF9A 1BXCA 4WXZA 1MW1A 4IJRA 1PE1A 4PCTA 1EC9A 1OF8A 3ERPA 3TC3A 4PB5A 1A50A 2J3NA 3H22A 1ZFJA 4KEUA 5BU6A 4H4QA 4QS5A 1E3ZA 4MWAD 3UG4A 3NJ3A 4B91A 4UZUA 3WL1A 2NVAA 2ZZ0A 1X96A 4UTIA 2BWGA 1UW9A 2YL6A 4KFPA 4UWMA 1XI3A 4LUTB 4QEHA 1E9IA 3EANA 3HGRA 3TYAA 5CC6A 2QUTA 3RILA 2C0HA 2PE4A 4A6GA 1OGSA 2VFHA 3TLLA 3AN1A 3VNKA 3ANUA 3IJIA 3FSUA 3TP4A 3OLDA 2QR6A 3S5NA 4AY8A 1FFVC 4K39A 3N13A 1US2A 3I4EA 1OG0A 1C3FA 1BYBA 2DEPA 4H4IA 3TTYA 4GO8A 4C6LA 3NIYA 4GISA 5G2WA 3NVYB 4AWUA 1Q6LA 2Y6ZA 4UC5A 4U28A 4M6VA 2G3MA 3VMNA 4RNFA 2RFGA 1Z6KA 3KUMA 1XCFA 3IUDA 4HNCA 3K46A 4ZL1A 1BWLA 2UY5A 4YYCA 3CV6A 3L9CA 4FOKA 1O5KA 5ABGA 1XLJA 1TUFA 2VRJA 4B5XA 1XR2A 2A0NA 4I9TA 2ABAA 1Q7ZA 3EMQA 3U57A 1SM9A 4DJEA 3QH2A 2J66A 4FAMA 3LTYA 1SUXA 4UFLA 2PDKA 2VEPA 3LCIA 1E43A 1XLCA 1NHPA 3SY8A 3VM7A 4R3UA 1BLIA 1Z3NA 1VFMA 3DK8A 2VNCA 1E6PA 2X1SA 3M7SA 2O7QA 4HCLA 3WMBA 1L6FA 2Z1WA 3S5ZA 4OOUA 3A7UA 1WDRA 6CGTA 3MTWA 3U9IA 3URNA 3S47A 3NYDA 5EMLA 2WCAA 1HNYA 3B9EA 4O1FA 4V2XA 5J8LA 3A7RA 4GACA 4GD0A 2DDXA 2VTFA 1PCKA 1A49A 4M7TA 4ORIA 5LIWX 2ATSA 1XDIA 1C29A 4JQ1A 1ME8A 1H09A 1QNQA 1ZHAA 1EJXC 4GH3A 4LTSA 3WLJA 1R9YA 4LB3A 4KEVA 1RPXA 3W9ZA 2ATMA 3TYUA 3WQPA 1Q6DA 1BSIA 2YW4A 5HNUA 1CYGA 3WLSA 3GVVA 3EKZA 3I3DA 3TKFA 1UP2A 3DHPA 4H4WA 5A6JA 4LYPA 4GH1A 1ZAIA 5HR7A 1G0CA 1Y7VA 3H2MA 4AY1A 4EP8C 1JUBA 1E72M 1GPWA 4J35A 3EF6A 4OBTA 4L4PA 2VEMA 3DN5A 4K37A 4U33A 3WDRA 5E5CA 3GNPA 4CNSA 3NM1A 2ZRVA 4FLQA 4AAJA 1C91A 2BOFX 1D3CA 5J5DA 2WPCA 1WAUA 5HWMA 2QNEA 3E3HA 1HJVA 4HNVA 1E0VA 3VOHA 1N8IA 2FKPA 2BODX 5IBXC 4RV3A 1ZY8A 3AIVA 4LW7A 4O0ZA 1UPPA 2Y7DA 5REQB 4AIOA 4PUKA 2AL1A 3WQOA 2GVYA 1ZENA 1GONA 3N17A 1BKSA 1J5SA 1KM3A 3FHQA 1KXHA 3GTXA 4N4PA 2ZZ7A 1TX0A 1YW1A 4UB9A 4EKJA 1XF0A 4G7FA 5DMNA 4JHOA 4KBXA 3HN3A 3PG6A 1LL7A 3G0SA 4MB1A 1FDJA 3WMCA 2WMHA 4GZ7A 4MNJA 4F4RA 4H01A 1EKOA 2ZZBA 4O0KA 2V2DA 2PGWA 3T44A 1O5XA 3WUEA 5D9OA 1VEPA 3IGXA 2XDFA 3T0BA 3DC8A 4MKSA 3PZQA 4HK7A 1WB0A 4GK8A 4B3ZA 4DO4A 1Q45A 3W7GA 5EMMA 3S5YA 1ZJIA 3UPMA 1DORA 3QFEA 3I6EA 3T6CA 2XVLA 3O0FA 3O2LA 3EDEA 4GQBA 4BEQA 3VGDA 1H50A 3OBAA 4MMWA 2ZTJA 1W3JA 1H1NA 1ONXA 5C70A 5CGMA 1D7KA 5G5GB 3PZIA 5LKYA 3OG3A 1EBDA 1EGMA 2PBGA 1QVBA 1GOIA 1B4EA 3CAWA 2BVDA 4BI7A 3M0XA 1ZX9A 1AD4A 1DV7A 3KRUA 1QXLA 1YPXA 4XKYB 4LCRA 3AC0A 3QMSA 4MIMA 3HBLA 1A5BA 3KTSA 4CGTA 3VUSA 2CZDA 1F76A 1ISWA 1MW0A 3WYZA 3V1PA 3MT1A 1XLDA 3PTMA 1V6WA 4CN4A 3BAXA 4EQRA 2VWSA 1OCBA 2CXEA 5D37A 3A4AA 3N6HA 4PTNA 1DP0A 4IPPA 1T3QC 1SMAA 1EJUC 3BPWA 2YBVA 2ACRA 3ZS4A 5KINA 2HV5A 3Q4DA 3UJSA 4YWOA 2G3NA 1VPYA 3DGZA 5A69A 4A4AA 3N12A 3DDMA 3B0PA 1BG4A 4CU6A 2BOGX 3WQFA 3WDPP 4HGXA 5E0CA 2Y61A 1YHTA 1I2QA 2P50A 3U8GA 4OTKA 1TPH1 2GOKA 1HQTA 3QY7A 3ARYA 4J27A 2AOSA 3U5YA 1B3VA 1Z48A 1TMHA 2WJDA 1FIQB 2VL4A 3M46A 4IMAA 5I06A 4CVWA 2UY4A 3N15A 2C15A 2FQIA 3PZGA 4IH3A 4I9AA 2A3AA 1AG1O 5BNKA 5HQLA 2XUCA 2FMOA 1OT2A 3P80A 4IM4A 6ALDA 4AVOA 4D6CA 4Q6JA 1N8WA 3QV6A 4ZFMA 2IKHA 3BO9A 2J8TA 1CGYA 1MO0A 4F8XA 4RZ5A 5U7SA 5K4ZA 3S9ZA 2PWEA 1GKRA 3KL0A 1F8IA 3R12A 1R9XA 3P82A 4H9XA 3SIMA 4B3LA 1XM3A 1I45A 3NL3A 3W7CA 2F2HA 2YA0A 2TPRA 5CCZA 4JTTA 1ME7A 3AS3A 4DZ5A 4RKAA 3HG4A 1IR2A 2PA6A 1OJTA 4UR7A 1BVNP 5B80A 3LENA 1XG3A 1CDGA 1VRXA 4JTAA 3H4WA 4S38A 1M6IA 3QFWA 3OW1A 4DM1A 2PP0A 3SRDA 1WXYA 3WJZA 3RRXA 2PD9A 4X0NA 3ZOAA 3S0CA 3KW3A 5I0DA 3GLCA 4F2BA 2BGNE 2GQWA 4O8AA 4ALDA 1FCVA 3T55A 1DTUA 4DAIA 1D8WA 3G6MA 4M6PA 3PTQA 3GHTA 3DFNA 3T08A 3L4XA 3W7NA 5ABFB 4LA1A 1XIJA 4PODA 3IIZA 1DJYA 3TCSA 3TV8A 1F4HA 3LQLA 2WP6A 3VC6A 1M01A 2WBKA 3C5QA 5EMUA 3RIKA 5C9XA 2F38A 2GDVA 4C6FA 1X1NA 4WD0A 1EFZA 3V7PA 3CLMA 6TAAA 2WLYA 4WX2A 1RPKA 5XIMA 3ZT5A 2QJJA 1TE6A 4K8GA 1BF2A 1QPNA 3TFCA 1ICSA 4M51A 3G8EA 3GC5A 3GXTA 4DWDA 3B8WA 3TTQA 1PJ9A 4K7YA 1IXOA 2VURA 2KZHA 3WLHA 1EJVC 4HNNA 1QJWA 5F4SA 3T05A 1HL9A 3CGDA 3MANA 5KZ6A 5FACA 1GK8A 4GJ1A 4GI4A 1JZ6A 4D71A 1KNWA 2D1ZA 4LVAA 2DH2A 4EMJA 1BYCA 1JR1A 1Q6FA 1QW8A 3NM3A 3RHGA 4QIUA 3OA5A 3MS8A 1NOFA 1EDGA 4JDBA 1XGDA 2CZFA 5D4YA 3GTHA 3ANYA 2OX1A 2HE8A 2QDHA 4AZCB 1H3GA 2FJUB 4TQTA 1NDZA 2CFFA 1S3HA 3CZJA 4DUOA 8A3HA 2YB1A 2QEZA 1UR9A 3CMFA 4GYPC 2QMJA 3GNDA 4GKTA 4H8NA 1RP9A 4H7ZA 2BFGA 2ACUA 2CBIA 4JQ3A 2XPKA 1JRBA 2IPGA 1H51A 4ATWA 3QKZA 4JS3A 2HWGA 1EUNA 2G4JA 4DNHA 3AOFA 3GDKA 3QF0A 2ZUSA 3EB3A 4G7EA 1XLIA 3A3XA 1O94A 4QCFA 5GNZA 1EP1A 3M5YA 3HPZA 1CENA 1HKJA 2CLEA 1FWWA 4RW3A 2YCJA 1C8YA 1V5XA 3W27A 3NVVB 3MP3A 2J25A 2QZRA 4H7VA 3MYOA 4ZQNA 1DIOA 2WC7A 4XZIA 3LSBA 4O1CA 5JBFA 3AIUA 4LUJA 4BZYA 1EZWA 1DWIM 3SIZA 1F8WA 3QFAA 1PKNA 4QXIA 2EJ1A 3OBEA 2GGEA 2XH7A 3VZYA 3W7HA 1LM1A 3BSMA 5AECA 1HL2A 3L0NA 3LHVA 7REQB 1GQLA 3FHAA 4I7WA 1SZEA 1OSEA 3NQBA 3BGJA 1RJQA 5H8PA 4YVVA 2E9LA 3THCA 3MA8A 1XYLA 1RBOB 4F9JA 1OG6A 3T9PA 3H2OA 4LALA 5J04A 3MP4A 4FI4A 5CZTA 3G6LA 1B57A 1AJZA 3WLKX 2J7FA 3SCQA 4CNOA 2PMQA 4KGJA 4H4RA 1KQYA 3V1HA 3W1XA 3HQ1A 4Y8FA 2QPSA 3H6OA 5IBXA 4FF7A 4MNLA 1JQVA 2WVVA 4Y9MA 4DYKA 2ISFA 4HKPA 3OZPA 1NY1A 2YL5A 1I2PA 4G8TA 4V15A 3W2UA 1VZWA 3B9NA 2J62A 4IOTA 5F1UA 2IKJA 4Z2KA 3UWVA 1QNVA 4HYVA 3KBMA 1ZQ5A 2FFIA 4GFSA 3A3WA 3UG3A 2CLKA 3R1ZA 3B97A 4L1GA 3CL8A 1ZBWA 1TTPA 3U48A 1F07A 4KFNA 3LM7A 2C6QA 2QCMA 3B0UX 4OUIA 3UGVA 3CBWA 2J6VA 2OQLA 1HIZA 1VQTA 1WDDA 3BLPX 3U2ZA 3N34A 3CQHA 1HXJA 3ZJ8A 4HCHA 5GPRA 4D6JA 3UU0A 1LLZA 3WLOA 4NILA 4XSLA 2WV8A 2BASA 1XW8A 1UG6A 4M3PA 1V0MA 3HQPA 3XISA 1S5TA 3USBA 1ZSXA 2DU2A 5D32A 2V6OA 3LCWA 3VE9A 3PPCA 1TPWA 1OEPA 3DFTA 1XHCA 2WPGA 3S6DA 2WVSA 4C7DA 3R0KA 5CEWA 2YZRA 1UWIA 3RPMA 4EVZA 1P4CA 9XIAA 4IGMA 1YE6A 2R94A 1US0A 3OB8A 1WOBA 5LIYX 3MO7A 3QN3A 2GDQA 1HJQA 4LS2A 3GFYA 4MADA 4J7RA 2Q8XA 3WH7A 4GKLA 1RUSA 4MAVA 5DMLA 3GC4A 1O5RA 3R4IA 1P6WA 4R27A 2CCRA 4MGGA 2CC0A 3TXZA 1YDYA 5AC7A 5BMXA 2Z6IA 2JBMA 5CPSA 2PDMA 1JL8A 8RUCA 1TPFA 4AEFA 3OYXA 1U83A 5EA9A 5A6AA 3PPGA 3GG7A 4DNMA 3GU2A 4GA8A 3TMLA 2XSXA 5HMEA 3BLKA 1LORA 3CC1A 5FF7A 2PDHA 1XX1A 1UYQA 3VNDA 4FNRA 1QATA 1V3MA 4DUXA 4RDWA 1W9UA 3AALA 1HJWA 7XIMA 5LIKX 4V1YA 3P14A 1DXEA 3VE7A 2WSKA 2X30A 3HJEA 4JTIA 3WJYA 1G67A 4DWSB 2XVPA 4PBGA 1HFBA 1DWJM 3NVWB 4UTMA 3NVTA 1J01A 3THUA 2VUYA 3GTIA 4R9OA 4NJGA 4I6KA 1D3HA 1E6NA 1QTWA 4R53A 3CTLA 1Q6OA 5M1TA 1MZHA 8CGTA 2YB4A 5G1TA 5EMYA 1H62A 3GVRA 3NPXA 2ISVA 4GHRA 2X1IA 4F0SA 1ZMDA 1WKDA 4JQ4A 1DJNA 1HKWA 1I0BA 2LLEA 1ZCOA 1PYMA 1DXIA 4NG3A 3BV7A 1NHRA 3MVTA 1ZP3A 4PCFA 1L0PA 2Y89A 2AL2A 3L4YA 2FZ8A 1FH8A 3JR2A 1EEXA 3BJTA 4QE4A 1PVNA 1X2HA 1M7PA 2BCPA 2J7EA 3CO4A 2X1RA 3NZGA 1OY0A 3ZZ1A 3MSRA 1OX5A 3M0KA 1RR2A 3S1XA 3GS6A 1XG4A 3SCUA 3TYEA 1KBBA 4DZIA 1JI1A 2PPGA 2ZXDA 3EDJA 2V5BA 3SQLA 1JDCA 2BY3A 1OT1A 1NOWA 5BMWA 2FHFA 2VDGA 3PBGA 1OYBA 3AISA 4JFSA 3R8HA 3F5JA 1TWZA 4GR1A 1D7FA 4S3AA 2MANA 4ZODA 1W9VA 2VD8A 3WBXA 4M29A 5I23A 2XIJA 1W0MA 3TN4A 4LV4A 1BWCA 4P61A 4I3GA 2YFOA 1XSJA 4JN6A 1H60A 2B0MA 1B3YA 4GZEA 1E9YB 3WO8A 1TR9A 3LX9A 2DZXA