4FX9A

Structure of the pyrococcus horikoshii coa persulfide/polysulfide reductase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
444
structure length
442
Chain Sequence
MKKKVVIIGGGAAGMSAASRVKRLKPEWDVKVFEATEWVSHAPCGIPYVVEGLSTPDKLMYYPPEVFIKKRGIDLHLNAEVIEVDTGYVRVRGGEKSYEWDYLVFANGASPQVPAIEGVNLKGVFTADLPPDALAIREYMEKYKVENVVIIGGGYIGIEMAEAFAAQGKNVTMIVRGERVLRRSFDKEVTDILEEKLKKHVNLRLQEITMKIEGEERVEKVVTDAGEYKAELVILATGIKPNIELAKQLGVRIGETGAIWTNEKMQTSVENVYAAGDVAETRHVITGRRVWVPLAPAGNKMGYVAGSNIAGKELHFPGVLGTAVTKFMDVEIGKTGLTEMEALKEGYDVRTAFIKASTRPHYYPGGREIWLKGVVDNETNRLLGVQVVGSDILPRIDTAAAMLMAGFTTKDAFFTDLAYAPPFAPVWDPLIVLARVLKFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and substrate specificity of the pyrococcal coenzyme A disulfide reductases/polysulfide reductases (CoADR/Psr): implications for S(0)-based respiration and a sulfur-dependent antioxidant system in Pyrococcus.
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Oxidoreductase
molecule keywords Coenzyme A disulfide reductase
total genus 113
structure length 442
sequence length 444
chains with identical sequence B
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2012-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4fx9A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fx9A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fx9A01
4WCTA 2YAUA 5KVHA 3IHGA 3CGDA 3JSKA 2C64A 1GRTA 1GREA 2YLWA 4NTCA 1O95A 3IWAA 1PN0A 1TDKA 3QSSA 2BXSA 1BZLA 3AXBA 4BJYA 2C3DA 1VDCA 2JKCA 4IA5A 3VR9A 2VRLA 4A7AA 2YLZA 2BS3A 3GYJA 4U8MA 3NH3X 1H86A 2GR2A 4CY8A 4UDQA 1GOSA 1CJ3A 1PS9A 1TDNA 3AYIA 3VRAA 5HHFA 2VRMA 4I59A 3ALLA 4M52A 4ZCCA 3SGLA 2V61A 1GXFA 2TPRA 1TDEA 2YLSA 2YVGA 2WP6A 1CBOA 3UKPA 2YR5A 2C65A 2YVJA 2AQJA 3AEDA 2QA2A 4CCRA 4EQRA 2OLNA 1NEKA 2XLPA 3CNTA 3ICTA 2UZZA 3GMCA 4USRA 3H8IA 2YG3A 1D5TA 4AT2A 1D4EA 3AE2A 2X8CA 3GDPA 1QO8A 3NG7X 1CJ4A 3RHAA 4DSGA 4H4TA 5M0ZA 3QVRA 1JRXA 1IUTA 3URHA 2VZ2A 4K8DA 1H7XA 3UTHA 2GR0A 3V3NA 2GMJA 2B7SA 2CULA 3NHOX 2R9ZA 4RG4A 5FS8A 1CHUA 1B8SA 1KSSA 3CN8A 5EB5A 1IUVA 3QSEA 2WOIA 2R4EA 3AE8A 2BC1A 2BK5A 4H4ZA 2XFNA 3D1CA 2BC0A 3NK2X 4TLZA 2ZZ0A 1PBCA 3CGBA 3AEGA 1JEHA 4NZHA 1PJ7A 2YM2A 4CRTA 1CC2A 3ATQA 1HYUA 1DOEA 2GR3A 1VRQB 3NK1X 3NRNA 3P1WA 4IVMB 2GVCA 2YLTA 4J2WA 3ALJA 1IJHA 2QAEA 2GEWA 3NYEA 1VG0A 3P4RA 3PS9A 4UDRA 1DNCA 1GEUA 4H4UA 5FS7A 2RGJA 1F6MA 1TYPA 2J3NA 3IF9A 2JB1A 2PHHA 5HYMA 1E1LA 3QFAA 2YVFA 4YXDA 1H7WA 1JOAA 2VVMA 3I3LA 4X9MA 1GESA 1CF3A 3NKSA 3Q9TA 4NTDA 4UDPA 2V3BA 1X31B 2C66A 4YSXA 4WX1A 3GD3A 3M12A 3DJDA 2OAMA 1FL2A 4ADWA 1KNPA 5JCNA 1DJNA 4P9SA 4U8PA 3K7TA 3H4KA 1D7LA 3PO7A 2WHDA 4A99A 2FBWA 4EMWA 2GQFA 4DSHA 4H2PA 3CNSA 4NEWA 1OJAA 2GAHB 4E0VA 2XVIA 4OPDA 2AR8A 3BI5A 2CFYA 3QVPA 2WP9A 2C76A 4RSLA 4H4QA 2BYBA 4Z24A 3ZYXA 1F3PA 2NPXA 4TM3A 2ARDA 1OJDA 4HA6A 4KX6A 3P4QA 4REKA 3DK4A 1XHCA 4JY3A 3SFDA 4IV9A 1N4WA 4B1BA 3AEEA 1DJQA 4A5LA 1F8SA 1CL0A 3DJGX 1PBBA 4A65A 4AT0A 4J33A 4Y4LA 2WPEA 1RP0A 2GAGB 1IUXA 4IA6A 1GETA 1PXBA 1E1NA 2A89A 2DKHA 2WEUA 2XVJA 3NNEA 4D03A 4H4SA 1K0LA 2W0HA 3AD8B 1M64A 3G5RA 3UKQA 4BJZA 2YLXA 1JU2A 3NIXA 2WESA 4Z44A 3F8RA 1LVLA 2E4GA 4Z26A 5EBKA 1JRYA 4EIPA 2FJAA 2V60A 3KPFA 1CJCA 2YG5A 2C75A 3HZLA 2XVEA 4ECHA 4KPRA 3ICSA 3UTFA 3AE6A 3RNMA 4U8KA 1GRBA 3KLJA 4JNAA 3UTEA 2YLRA 3EF6A 1ELIA 4JQ9A 3FIMB 3AYJA 4Y4NA 3AE4A 4U2LA 4BURA 1K0JA 1Q1WA 1XANA 4JN9A 4O5UA 2C67A 2C3CA 1BGJA 4CNJA 2QA1A 3UKFA 3AEAA 3IC9A 2B9WA 5EB4A 4JDRA 2BXRA 5JCLA 1Y56B 4U8JA 2BCPA 3LADA 4NEVA 4XXGA 2BK4A 5CQFA 2FJEA 5U63A 2RGHA 2XVFA 5KRQA 2Q6UA 2B7RA 3V3OA 3ABVA 1CC4A 4OCGA 4YSHA 1YY5A 2XVHA 4H2RA 1N4VA 3UKHA 1ZP0A 2EQ7A 2F5ZA 2H88A 3LB8A 1L9DA 4H2NA 2IVDA 3NYCA 3AYLA 5KOXA 5JCIA 4JY2A 4CNKA 2NVKX 2WP5A 1E7PA 5BUKA 3UP4A 3ISHA 2Y6RA 3FBSA 2V5ZA 3L8KA 3E1TA 1EL9A 3K30A 1L0VA 3RP6A 1E1MA 1GRHA 1IUUA 4APNA 1ZMDA 2BABA 4YTMA 4Z2TA 5U25A 1PDHA 4A9WA 1JNRA 3SQPA 3KU9A 2IVEA 3NN6X 4GDPA 5KXJA 1NHRA 1K4QA 4J56A 1EL8A 2WU5A 3BI4A 3LJPA 2GR1A 5IQ1A 2XFPA 1NAAA 3D8XA 2ACZA 2Q7VA 2XFOA 4C77A 3CTYA 4YTPA 4C3YA 4OPTA 1AOGA 3KVEA 4B69A 1N1PA 3CNPA 2EQ9A 2XDOA 2VVLG 4MJWA 4EQSA 3ALMA 3SFEA 4DGKA 2A8XA 3C4NA 1W4XA 1GRGA 3PVCA 1EL5A 3NTAA 2QCUA 4FK1C 2I0ZA 3C4AA 1JNZA 4K22A 3AB1A 1YKJA 3ADAB 3DJEA 1OJ9A 2R0GA 2GRTA 4H4XA 3FMWA 3G5QA 3WE0A 3LZWA 5FS6A 1F8WA 4TLXA 3O0HA 5JCMA 4K5SA 1MOKA 1COYA 2OLOA 3OZ2A 3P4PA 1NDAA 1DOCA 3AWIA 2AAQA 5GRTA 4LIIA 5U1OA 1H82A 1GV4A 1S3BA 2YG4A 1P2EA 2ZBWA 5KOWA 4D04A 3GD4A 2CVJA 4AOSA 1PBDA 1IUWA 2XLSA 1EL7A 4GF7A 4YKGA 2Z5XA 1PBEA 3QSMA 2E1MA 5EOWA 3RP7A 4CBQA 4C74A 2YG7A 4IVOB 1N4UA 3AECA 2BK3A 2C73A 3CPIG 1LQTA 1EBDA 4TM4A 3DMEA 2TMDA 2CDUA 2WBAA 4GUVA 1Y56A 2WOWA 1ZOVA 2JAEA 3AE5A 3QFBA 4OPUA 3GMBA 3CIRA 4A6NB 4BK1A 4LU6A 2Q0KA 3UCLA 4H4RA 4EM4A 3VR8A 2R4JA 2VQ7A 3AD9B 1OJTA 2GB0A 2Q0LA 2OA1A 2WPFA 1RSGA 1BKWA 1DOBA 1GT8A 5ER0A 2FJBA 2XCGA 4EQWA 1E39A 4AP1A 4JNQA 2V3AA 1GALA 3ITJA 1O5WA 4GR1A 1FECA 2VQBA 4OPCA 3SM8A 4A6NA 4EQXA 5C2TA 3S61A 2V6OA 4BK2A 4J34A 4RG3A 1ZOYA 2WQYA 2R46A 1CC6A 3NN0X 3KA7A 1IUSA 1H84A 2R45A 4J36A 4Z2RA 4U8LA 4AP3A 1ZY8A 3AE3A 1GSNA 2YR4A 1ZDLA 4A79A 5BULA 4O5QA 5J60A 2APGA 3DJJA 2X3NA 4GRTA 2BACA 2BS4A 4K7ZA 4EIQA 4I58A 5IQ4A 5KWFA 1F8RA 1Y0PA 4Z25A 1S2QA 5HY5A 4K5RA 4H4YA 4YWOA 3P4SA 1D7YA 3Q6JA 4TM0A 3BI2A 1ZK7A 1PHHA 5L46A 2FJDA 2GH5A 2JB3A 2WOVA 5LV9A 4ICYA 1OJCA 3CNJA 3AD7B 1TYTA 1M6IA 3II4A 1BWCA 1NPXA 3GSIA 4PABA 1GTHA 4EM3A 4OPIA 1DODA 4C5OA 4USQA 5HXIA 4OPLA 1PJ6A 1ZX9A 3R9UA 3GYIA 1BF3A 2PYXA 2R0CA 3DK8A 2XLRA 3AEBA 4ZCDA 4H4WA 2JB2A 3DGHA 4PAAA 2X50A 2ZZCA 1KF6A 3BHKA 3I6DA 3UKLA 3F8DA 3VRBA 2WU2A 3KD9A 3DGZA 3GWFA 2XFQA 1PJ5A 3M0OA 1GRFA 2C72A 3ICRA 3BHFA 2C70A 4B68A 1ZMCA 4H2QA 3NK0X 1XDIA 1H6VA 1D4CA 1PXAA 1S3EA 2C7GA 4X9NA 4YSZA 1LV0A 1RYIA 2DKIA 3LXDA 2Y6QA 4U2SA 1TRBA 4XWZA 3LOVA 1L9CA 1JRZA 3G5SA 5IPYA 2XLTA 1KNRA 4YT0A 4GDEA 2X99A 1FEBA 4H7UA 1XPQA 1NENA 3AEFA 3M13A 5BVAA 1L9EA 1MO9A 4Z2UA 1FOHA 1NHQA 1KDGA 4B66A 4EMJA 3CGCA 5KVIA 2IIDA 1NG3A 3NLCA 4B67A 1Z6LA 2XLUA 3CPJG 5GSNA 2R0PA 5JCKA 2BCGG 3ZDNA 3DA1A 3H8LA 3CPHG 3GRSA 4FDCB 1TDFA 2EQ8A 2GV8A 3NT6A 4HB9A 1MXTA 2WDRA 4C3XA 2ZZBA 2VVLA 3S5WA 1QJDA 1D4DA 3OC4A 1KFYA 1VQWA 4U2TA 1H81A 1YQZA 4DNAA 1K0IA 1NHPA 3LZXA 4N9XA 5J7XA 3NYFA 1VG9A 3VRDB 3GWDA 3AE7A 5M10A 2X8GA 3T37A 1H83A 3KKJA 3L1RA 4YKFA 1DXLA 2B9XA 4Y4MA 2JBVA 4U8OA 4FK1A 2OALA 4CCQA 2EQ6A 1SEZA 3BNUA 1FEAA 1TDOA 3UKAA 1FCDA 1Q9IA 3FPZA 2B9YA 3UOYA 2JK6A 3NTDA 4XWRA 4J31A 2Z5YA 4FX9A 4J57A 4YSYA 3GRTA 3REDA 3B6DA 3GDNA 4OVIA 5CKUA 2RGOA 3ATRA 1GERA 1CJ2A 1REOA 2BS2A 4U8IA 3UOZA 4EMIA 3BNMA 1UKVG 3UTGA 5C3JA 4X4JA 4H50A 1LQUA 2BA9A 3NGCX 3UOVA 5FS9A 1PBFA 2A87A 2WPCA 5TR3A 1B37A 2H89A 2WDVA 4YTNA 1NG4A 1P2HA 3K7MX 3V76A 4ZN0A 4NTEA 2O9ZA 4U8NA 3EAOA 3RP8A 1B5QA 4TM1A 3DK9A 1O94A 3AE1A 3COXA 2E5VA 2GF3A 4OPGA 2YM1A 2XYOA 3C96A 4Z43A 2HQMA 5DBJA 1E6EA 1NHSA 2YR6A 3QJ4A 2WETA 3AE9A 4GCMA 1ONFA 4CY6A 1LPFA 2YG6A 5FMHA 3EANA 1V59A 3UOXA 4B63A 4H4PA 3F8PA 4H4VA 1GRAA 1BGNA 1S2YA 3CNDA 3IHMA 1B4VA 2YWLA 1GNDA 1Q1RA 3K7QX 2X8HA 1GPEA 1YQ4A 2GQWA 5BRTA 4K2XA 4AOXA 2VOUA 4BV6A 3UP5A 4B65A 2B76A 2YQUA 2GMHA 3EPTA 3FG2P 3UKKA 4B64A 1QLBA 3VQRA 3CGEA 4BK3A 3P9UA 1PXCA 1KSUA 1GTEA 3B3RA 1LTXR 2RABA 3DH9A 1LJ1A 1YQ3A 1E1KA 2WS3A 4UP3A 1ZKQA 4LA1A 2WDQA 2XFUA
chains in the Genus database with same CATH superfamily
2YLWA 1O95A 3EKGA 4BJYA 2JKCA 2ZADA 2BS3A 3GYJA 1CJ3A 3AYIA 3ALLA 1GXFA 3AEDA 4DXKA 2OLNA 2XLPA 3ICTA 3GMCA 1D5TA 1QO8A 3VDGA 3PWGA 2W55A 1IUTA 1SJDA 1B8SA 1KSSA 5EB5A 1IUVA 2BC0A 2W3RA 3T6CA 3VC5A 2ZZ0A 1JEHA 3ZVHB 1PJ7A 1HYUA 1VRQB 3NRNA 3P1WA 4IVMB 2GVCA 2YLTA 1F9CA 3PS9A 3UXLA 1F6MA 1TYPA 3IF9A 2JB1A 1H7WA 3NKSA 3Q9TA 3VCCA 2C66A 4YSXA 3GD3A 5KNLA 4P9SA 3PO7A 4A99A 3CNSA 1OJAA 3SN0A 4OPDA 2AR8A 2CFYA 2C76A 4H4QA 5IDZA 3T2ZA 2RDXA 3FVDA 3MY9A 3DK4A 4JY3A 3SFDA 3TWBA 3DJGX 4J33A 4Y4LA 1RP0A 2GAGB 1IUXA 4IA6A 1PXBA 1E1NA 2WEUA 1K0LA 1R0MA 1X2HA 3NIXA 3R07C 2FKPA 2FJAA 1CJCA 4ECHA 2QDDA 3V5FA 2GGEA 3EF6A 4JQ9A 3FIMB 3AYJA 1K0JA 4JN9A 3UJEA 2C3CA 4CNJA 3VCNA 4H1ZA 3MZNA 3T8QA 1BQGA 2RGHA 2XVFA 2B7RA 1CC4A 5BOEA 3LB8A 2IVDA 5KOXA 5JCIA 1E7PA 4APNA 2PODA 5U25A 1JNRA 3SQPA 3NN6X 4KT2A 2WU5A 2XFPA 3D8XA 4C77A 2OPJA 3SZCA 3KVEA 3CMMA 1IYXA 4MJWA 4DGKA 2A8XA 1W4XA 2XH2A 3NVYB 3T2YA 2QCUA 2PTWA 3AB1A 1OJ9A 2R0GA 2GRTA 3FMWA 3WE0A 3RGTA 3LZWA 3O0HA 5JCMA 2P8CA 3DFHA 3AWIA 1DOCA 5U1OA 2YG4A 1P2EA 4D04A 1H2IA 2CVJA 1IUWA 4GF7A 2Z5XA 4ZCWA 3CXBA 2YG7A 4IVOB 1N4UA 3AECA 4TM4A 3DMEA 1WYGA 2WBAA 4GUVA 2JAEA 4BK1A 3GMBA 4ROPA 2PU0A 1ONEA 3VR8A 3OZYA 2VQ7A 2GB0A 2WPFA 1DOBA 1GT8A 4G9KA 3MSYA 3ITJA 4GR1A 1JDFA 4EQXA 3S61A 4BK2A 3VA8A 3IJQA 2PPGA 2R46A 1CC6A 1JRPA 4J36A 3AE3A 2YR4A 4O5QA 5J60A 3EEZA 1V97A 2BS4A 3N6JA 4EIQA 4I58A 5IQ4A 1F8RA 4Z25A 4H4YA 3STPA 3P4SA 2OLAA 2JB3A 2GH5A 3FXGA 1M6IA 1MDRA 1DODA 4USQA 4OPLA 1ZX9A 3UCDA 4PAAA 3F8DA 2XFQA 2C70A 2C7GA 1KCZA 2BRAA 2PGWA 3OW1A 4G6GA 4YT0A 5BVAA 1L9EA 1MO9A 1NHQA 4B66A 1PDYA 3NLCA 5GSNA 3CPJG 1SJCA 5JCKA 2PA6A 2GV8A 2AKZA 3H12A 2VVLA 3DG7A 4A3RA 3OC4A 1FO4A 1D4DA 3QKEA 1VQWA 1H81A 4II2A 1YQZA 3LZXA 4N9XA 1VG9A 4FP1A 4E4UA 2X8GA 1ZXIC 1H83A 3KKJA 3K1GA 1FCDA 3UOYA 4XWRA 4FX9A 1P43A 3Q45A 5G5HB 3REDA 4YSYA 3B6DA 1KD0A 3ATRA 3SQSA 1GERA 1CJ2A 3NXLA 5C3JA 4H50A 3UJRA 3NGCX 5TR3A 2WDVA 4YTNA 1P2HA 3SR6B 3RP8A 1B5QA 1O94A 2OZTA 4OPGA 2C4CA 3P3BA 2YR6A 3QJ4A 2P88A 2WETA 3AE9A 4H4PA 1JCTA 3FJ4A 1ELSA 3CNDA 1B4VA 1GNDA 3K7QX 5J04A 2AL2A 4AOXA 4B65A 3PG6A 3FG2P 3VQRA 3R1ZA 1YQ3A 3HYWA 1E1KA 5KVHA 1EC9A 3CGDA 3DERA 3IWAA 2BXSA 1BZLA 3PK7A 3AXBA 2C3DA 3VR9A 4A7AA 2E3TA 3NH3X 3HRDC 1PS9A 1TDNA 3VRAA 4I59A 3SGLA 4M52A 4DWDA 3BJSA 2CHRA 1TDEA 2YVGA 2WP6A 3UKPA 2YVJA 4G8TA 4CCRA 1NEKA 4FI4A 3ES7A 3NG7X 1FHVA 3RHAA 5M0ZA 3QVRA 3ZVIA 4K1WA 3URHA 2VZ2A 4K8DA 1H7XA 4X2PA 3SZWA 3UTHA 2PMQA 3NHOX 2R9ZA 5FS8A 3CN8A 2WOIA 3AE8A 3NVWB 3D1CA 1FHUA 3I6TA 2YM2A 3SYIA 1DOEA 2GR3A 1R6WA 1MDLA 4GAPA 3NYEA 4UDRA 1GEUA 2RGJA 5FS7A 3NS1B 2HZGA 2VVMA 4NTDA 2AL2B 4UDPA 4WX1A 3M12A 3DJDA 4ADWA 1DJNA 3H4KA 1D7LA 4EMWA 2GQFA 4DSHA 3U4FA 4H19A 4NEWA 2XVIA 3BI5A 3R0UA 4RSLA 3D9XA 3ZYXA 4G74A 1F3PA 1N62C 4IV9A 4AT0A 4A35A 6ENLA 2WPEA 1EBHA 5ENLA 2DKHA 2OVLA 2QGYA 4D03A 2W0HA 3AD8B 3UKQA 2YLXA 1JU2A 4Z44A 4EIPA 3T14A 2V60A 3HW2A 2C75A 3HZLA 2XVEA 4KPRA 3ICSA 3RNMA 1GRBA 4JNAA 1ELIA 4DHGA 4Y4NA 4BURA 1XANA 5FJTA 1BGJA 3CT2A 2QA1A 3UKFA 4K8GA 5EB4A 4JDRA 2BXRA 4NEVA 2BK4A 3I4KA 1YY5A 3UKHA 4H2NA 3NYCA 3AYLA 4JY2A 2PU1A 4CNKA 4IL0A 3DIPA 2Y6RA 1TKKA 2V5ZA 3L8KA 3RP6A 1EL9A 3K30A 2MNRA 1GRHA 1ZMDA 2BABA 1EC7A 4A9WA 3KU9A 4GDPA 1NHRA 1K4QA 3BI4A 5IQ1A 2Q7VA 2XFOA 4OPTA 4B69A 1WUFA 2XDOA 2VVLG 3SFEA 4EQSA 3ALMA 4HCLA 4IP4A 3MUCA 3VFCA 2OKTA 3G5QA 3NVZB 3THUA 1F8WA 2POZA 1COYA 3OZ2A 2AAQA 4LIIA 1S3BA 5KOWA 3GO2A 2XLSA 1EL7A 4C74A 1PBEA 5EOWA 2E1MA 3TWAA 4CBQA 1FFVC 2W54A 2QJNA 1Y56A 1ZOVA 3QFBA 3CIRA 3JW7A 3L5OA 2OA1A 2XH4A 1BKWA 3FCPA 5ER0A 2XCGA 3SJNA 1STZA 2V3AA 1GALA 1O5WA 2VQBA 1FECA 4OPCA 5C2TA 4RG3A 3KA7A 2R45A 4U8LA 4AP3A 1GSNA 3KUMA 4MKSA 3I6EA 4ZA0A 5JRBA 4E8GA 2XH7A 5KWFA 5HY5A 3Q6JA 1ZK7A 3R25A 4JHMA 5LV9A 4ICYA 4II3A 3II4A 1VDVA 4PABA 1GTHA 4EM3A 4OPIA 4C5OA 1PJ6A 3GYIA 2R0CA 4H4WA 2JB2A 1KF6A 3I6DA 3MQTA 3DGZA 5FJPA 1GRFA 2C72A 4GGHA 4H2QA 3NK0X 1PXAA 1H6VA 1S3EA 3LOVA 1KNRA 2X99A 3NVVB 4H7UA 1XPQA 1FOHA 3OPSA 4EMJA 2IIDA 2XLUA 2R0PA 3RCYA 3CPHG 4HB9A 3NT6A 4C3XA 3S5WA 2BRYA 3VRDB 5M10A 3T37A 4YKFA 2B9XA 2JBVA 4FK1A 4NWZA 3AMZA 3QLDA 2EQ6A 2Z5YA 3GDNA 1W6TA 5CKUA 3UOZA 3QN3A 4HNLA 4EMIA 3A7UA 4J3ZA 3UOVA 2H89A 3R11A 1B37A 3JZUA 1NG4A 3V76A 3K7MX 4ZN0A 4GISA 4U8NA 3NO1A 3BSMA 3RR1A 4Z43A 2PP3A 4GCMA 1ONFA 1LPFA 3UOXA 4B63A 1KKRA 3DDMA 4H4VA 1BGNA 2OQHA 3IHMA 1MNSA 2X8HA 2GGHA 3S47A 2OZ8A 4K2XA 2VOUA 4BV6A 1N60C 2YQUA 3P0WA 2GMHA 3UKKA 2XGZA 4B64A 3CGEA 4BK3A 4HN8A 3RRAA 1GTEA 2WS3A 1ZKQA 3SN4A 2XFUA 1TE6A 2GDQA 3IHGA 1GRTA 4NTCA 3T2KA 3FV9A 1TDKA 3QSSA 3DEQA 2DW6A 3DFYA 1H86A 1OEPA 4UDQA 1GOSA 2VRMA 4ZCCA 2V61A 2TPRA 2YLSA 1SB3B 1CBOA 1N5XA 2YR5A 2C65A 2AQJA 2QA2A 4USRA 3H8IA 4AT2A 3AE2A 2X8CA 2GGGA 3NRZB 4TVWA 4H4TA 2QVHA 2OFJA 2GR0A 2GMJA 2CULA 4RG4A 3QTPA 3B97A 4H83A 3AM9A 2BC1A 2BK5A 4H4ZA 3NK2X 2GSHA 3CGBA 4NZHA 3TJIA 1N63C 3EUB3 3NFUA 3ALJA 3P4RA 2OZ3A 1DNCA 2PHHA 1E1LA 3QFAA 4YXDA 2OX4A 1JOAA 4X9MA 1GESA 3P93A 1KN0A 3FYYA 1KNPA 3K7TA 1ECQA 2WHDA 3UJ2A 4H2PA 2P3ZA 4E0VA 4GYPC 2BYBA 2NPXA 1JPMA 2ARDA 1OJDA 4HA6A 3P4QA 4REKA 4HNCA 4A5LA 1F8SA 1CL0A 1N61C 3SX6A 1PBBA 4A65A 3DGBA 2HNEA 4IHCA 1GETA 2A89A 5FJUA 3UJFA 1M64A 3G5RA 4BJZA 3U9IA 2E4GA 3MWCA 4Z26A 1JRYA 1EC8A 2PS2A 3AE6A 4U8KA 2PTZA 3KLJA 3V4BA 3UTEA 2YLRA 1Q1WA 3OP2A 2C67A 2XSXA 4Z1YA 2B9WA 3SY4A 5CQFA 5JCLA 1Y56B 3LADA 4XXGA 5U63A 4E4FA 5KRQA 4DN1A 3V3OA 2E5AA 3ABVA 4DYEA 2XVHA 4H2RA 1ZP0A 2EQ7A 2F5ZA 2H88A 2NVKX 5BUKA 3UP4A 1L0VA 1E1MA 2PGEA 1IUUA 4Z2TA 4YTMA 1PDHA 1EL8A 4J56A 3LJPA 1MRAA 3PFRA 1NAAA 2ACZA 3CTYA 3T9PA 3UXKA 1AOGA 2EQ9A 4GIRA 3C4NA 1SJBA 3PVCA 4E5TA 2I0ZA 3C4AA 1JNZA 4K22A 1YKJA 3DJEA 4H4XA 5FS6A 4TLXA 1MOKA 1NDAA 3GD6A 3TCSA 1GV4A 3RP7A 2C73A 1EBDA 3HPFA 2TMDA 2CDUA 2WOWA 3AE5A 4A6NB 4ZOHB 4GFIA 2Q0KA 3UCLA 4H4RA 3D46A 2R4JA 3AD9B 2FYMA 1RSGA 7ENLA 2OO6A 1RVKA 1FFUC 4E6MA 1E39A 4AP1A 3ETRB 3N4FA 2V6OA 4J34A 3NN0X 2MUCA 1IUSA 4Z2RA 1ZY8A 4A79A 3QPEA 4G73A 5BULA 2APGA 3OZMA 4GRTA 2BACA 4IP5A 1Y0PA 1S2QA 4YWOA 2HXUA 1D7YA 4TM0A 4HCDA 3A7RA 2WOVA 4TVYA 1OJCA 1TYTA 1BWCA 1NPXA 4Z17A 1FIQB 5HXIA 1BF3A 2PYXA 3DK8A 3AEBA 3V3NA 2HXTA 3UKLA 3BHKA 3VRBA 2PSNA 2WU2A 3M0OA 2NQLA 3GWFA 3BHFA 4B68A 1XDIA 1D4CA 4X9NA 2DKIA 2Y6QA 5FJRA 1L9CA 5IPYA 3G5SA 4GMEA 3DG3A 2GL5A 2XH0A 1FEBA 1NENA 3M13A 4Z2UA 5KMPA 1KDGA 3CGCA 5KVIA 4IZGA 3T31A 1Z6LA 4M0XA 2BCGG 3H8LA 3GRSA 4FDCB 5G5GB 2EQ8A 1TDFA 1MXTA 2WDRA 4YWSA 2QJMA 1K0IA 5J7XA 3GWDA 3AE7A 3CAWA 1DXLA 4U8OA 2OALA 3SBFA 4CCQA 2ZC8A 1SEZA 1Q9IA 3TQPA 3FPZA 4J31A 4J57A 3GRTA 3TW9A 4IL2A 4OVIA 2RGOA 4K2SA 4U8IA 3BNMA 3UTGA 3IK4A 1LQUA 3HYVA 5FS9A 2A87A 2WPCA 4NTEA 3EAOA 4TM1A 3AE1A 2XYOA 3C96A 5DBJA 1E6EA 3MKCA 1NHSA 3NZGA 1XPYA 5FMHA 3EANA 3F8PA 4G7FA 4HCHA 1GRAA 2YWLA 1N5WC 1GPEA 3UCCA 4MGGA 5BRTA 1L8PA 3UP5A 3T4WA 3CXOA 3EPTA 4KPLA 3P9UA 1PXCA 1KSUA 3B3RA 1LJ1A 3V3WA 3SZFA 2GGJA 2PP0A 1PDZA 4JN7A 4WCTA 1NELA 2YAUA 4M6UA 3JSKA 2C64A 1GREA 1PN0A 4KEMA 1VDCA 4IA5A 2VRLA 1XS2A 2P0IA 2YLZA 4U8MA 2GR2A 2QDEA 4CY8A 3ES8A 5HHFA 3ZVHA 4EQRA 3CNTA 2UZZA 2YG3A 4DX3A 1D4EA 3GDPA 1TZZA 3CK5A 4KWSA 3IJIA 1CJ4A 4DSGA 3H8AA 1JRXA 3TJ4A 2QQ6A 2OG9A 2B7SA 1CHUA 3QSEA 2R4EA 2XFNA 4JN8A 4TLZA 1PBCA 3AEGA 1KKOA 4CRTA 1CC2A 3ATQA 3NK1X 3GY1A 4J2WA 1X2GA 1IJHA 2QAEA 2GEWA 1VG0A 3JVAA 4H4UA 2J3NA 5HYMA 2YVFA 4G6HA 3I3LA 1CF3A 2V3BA 1X31B 2OAMA 1FL2A 1JROA 5JCNA 4HPNA 3ZLFA 4U8PA 1EBGA 2FBWA 3ZLHA 3RITA 2GAHB 3SN1A 3QVPA 3BOXA 2WP9A 4Z24A 3T0KA 4TM3A 4KX6A 3GYXA 1XHCA 3PWIA 1N4WA 2PCEA 4B1BA 3AEEA 1DJQA 1WUEA 4H2HA 2XVJA 3NNEA 4H4SA 2WESA 3F8RA 1LVLA 5EBKA 2QJJA 3KPFA 2YG5A 2PTYA 3UTFA 3D47A 4ENLA 3AE4A 3AN1A 4U2LA 3TTEA 4J1OA 4O5UA 3B9JB 3SZ0A 5KMQA 3AEAA 3IC9A 4U8JA 2BCPA 2FJEA 2Q6UA 4OCGA 4YSHA 1N4VA 1L9DA 3UGVA 3SSZA 1NU5A 2WP5A 3ISHA 3FBSA 1T3QC 3E1TA 3R10A 4NNJA 2IVEA 5KXJA 1RM6B 2GR1A 5FJOA 3H70A 4YTPA 4MMWA 4C3YA 1N1PA 3CNPA 5KMRA 1GRGA 1EL5A 3NTAA 4FK1C 3ENLA 2PTXA 3ADAB 1VQZA 4F4RA 4K5SA 2OLOA 3P4PA 5GRTA 1H82A 2ZBWA 3GD4A 2ONEA 4AOSA 1PBDA 4YKGA 3QSMA 3SXIA 5EU9A 2BK3A 3CPIG 3R0KA 1LQTA 3Q4DA 3RO6A 4OPUA 4LU6A 1YEYA 4EM4A 1OJTA 2Q0LA 3V5CA 2OQYA 2FJBA 4EQWA 2DW7A 4JNQA 3SM8A 1DTNA 3CYJA 4A6NA 1ZOYA 2WQYA 4GGBA 1H84A 3GC2A 1ZDLA 1S7MA 1BKHA 3DJJA 2X3NA 4K7ZA 1JPDX 4K5RA 3N6HA 3BI2A 1P48A 1PHHA 5L46A 2FJDA 4GAVA 3CNJA 3AD7B 3GSIA 3R9UA 2XLRA 3CB3A 4ZCDA 3DGHA 2X50A 1MUCA 2I5QA 2ZZCA 3KD9A 1PJ5A 3ICRA 1ZMCA 4YSZA 3UJSA 1LV0A 1RYIA 3LXDA 4U2SA 1TRBA 4XWZA 1JRZA 2XLTA 4GDEA 3AEFA 2AL1A 1NG3A 4B67A 3ZDNA 3DA1A 2W3SA 4A6GA 2ZZBA 1QJDA 4U2TA 1KFYA 3IJLA 4DNAA 1NHPA 1E9IA 3NYFA 2P8BA 3L1RA 4Y4MA 3DG6A 2AKMA 3BNUA 1FEAA 1TDOA 3UKAA 2B9YA 2JK6A 3NTDA 2PP1A 3S5SA 4IT1A 5BOFA 2BS2A 1REOA 3N4EA 2O56A 3ZLGA 1UKVG 3OTRA 4X4JA 2BA9A 1PBFA 3A7AA 2O9ZA 3DK9A 3COXA 2E5VA 2GF3A 2YM1A 2HQMA 3VC6A 2GGIA 4CY6A 2YG6A 3DESA 1V59A 1S2YA 3H7VA 3KPKA 1Q1RA 4GYPA 1YQ4A 2GQWA 5KMSA 1SJAA 4EWJA 2B76A 1QLBA 1LTXR 2RABA 3DH9A 3TOYA 3HYXA 4UP3A 4LA1A 2WDQA 4HYRA
chains in the Genus database with same CATH topology
4WCTA 2YAUA 5KVHA 3IHGA 3CGDA 3JSKA 2C64A 1GRTA 1GREA 2YLWA 4NTCA 1O95A 3T2KA 3IWAA 1PN0A 1TDKA 3QSSA 2BXSA 1BZLA 3AXBA 4BJYA 2C3DA 1VDCA 2JKCA 4IA5A 3VR9A 2VRLA 4A7AA 2YLZA 2BS3A 3GYJA 4U8MA 3NH3X 1H86A 2GR2A 4CY8A 4UDQA 1GOSA 1CJ3A 1PS9A 1TDNA 3AYIA 3VRAA 5HHFA 2VRMA 4I59A 3ALLA 4M52A 4ZCCA 3SGLA 2V61A 1GXFA 2TPRA 1TDEA 2YLSA 2YVGA 2WP6A 1CBOA 3UKPA 2YR5A 2C65A 2YVJA 2AQJA 3AEDA 2QA2A 4CCRA 4EQRA 2OLNA 1NEKA 2XLPA 3CNTA 3ICTA 2UZZA 3GMCA 4USRA 3H8IA 2YG3A 1D5TA 4AT2A 1D4EA 3AE2A 2X8CA 3GDPA 1QO8A 3NG7X 1CJ4A 3RHAA 4DSGA 4H4TA 5M0ZA 3QVRA 1JRXA 1IUTA 3URHA 2VZ2A 4K8DA 1H7XA 3UTHA 3SZWA 2GR0A 3V3NA 2GMJA 2B7SA 2CULA 3NHOX 2R9ZA 4RG4A 5FS8A 1CHUA 1B8SA 1KSSA 3CN8A 5EB5A 1IUVA 3QSEA 2WOIA 2R4EA 3AE8A 2BC1A 2BK5A 4H4ZA 2XFNA 3D1CA 2BC0A 3NK2X 4TLZA 2ZZ0A 1PBCA 3CGBA 3AEGA 1JEHA 4NZHA 1PJ7A 2YM2A 3SYIA 4CRTA 1CC2A 3ATQA 1HYUA 1DOEA 2GR3A 1VRQB 3NK1X 3NRNA 3P1WA 4IVMB 2GVCA 2YLTA 4J2WA 3ALJA 1IJHA 2QAEA 2GEWA 4GAPA 3NYEA 1VG0A 3P4RA 3PS9A 4UDRA 1DNCA 1GEUA 4H4UA 5FS7A 2RGJA 1F6MA 1TYPA 2J3NA 3IF9A 2JB1A 2PHHA 5HYMA 1E1LA 3QFAA 2YVFA 4G6HA 1H7WA 4YXDA 1JOAA 2VVMA 3I3LA 4X9MA 1GESA 1CF3A 3NKSA 3Q9TA 4NTDA 4UDPA 2V3BA 1X31B 2C66A 1KN0A 4YSXA 4WX1A 3GD3A 3M12A 3DJDA 2OAMA 1FL2A 4ADWA 1KNPA 5JCNA 1DJNA 4P9SA 5KNLA 4U8PA 3K7TA 3H4KA 1D7LA 3PO7A 2WHDA 4A99A 2FBWA 4EMWA 2GQFA 4DSHA 4H2PA 3CNSA 4NEWA 1OJAA 2GAHB 4E0VA 2XVIA 4OPDA 2AR8A 3BI5A 2CFYA 3QVPA 2WP9A 2C76A 4RSLA 4H4QA 3D9XA 2BYBA 4Z24A 4G74A 3ZYXA 3T2ZA 3T0KA 1F3PA 2NPXA 4TM3A 2ARDA 1OJDA 4HA6A 4KX6A 3GYXA 3P4QA 4REKA 3DK4A 1XHCA 4JY3A 3SFDA 4IV9A 1N4WA 4B1BA 3AEEA 1DJQA 4A5LA 1F8SA 1CL0A 3DJGX 1PBBA 3SX6A 4A65A 4J33A 4AT0A 4Y4LA 2WPEA 1RP0A 2GAGB 1IUXA 4IA6A 1GETA 1PXBA 1E1NA 2A89A 2DKHA 2WEUA 2XVJA 3NNEA 4D03A 4H4SA 1K0LA 2W0HA 3AD8B 1M64A 3G5RA 3UKQA 4BJZA 2YLXA 1JU2A 3NIXA 2WESA 4Z44A 3F8RA 1LVLA 2E4GA 4Z26A 5EBKA 1JRYA 4EIPA 2FJAA 3T14A 2V60A 3KPFA 1CJCA 2YG5A 2C75A 3HZLA 2XVEA 4ECHA 4KPRA 3ICSA 3UTFA 3AE6A 3RNMA 4U8KA 1GRBA 3KLJA 4JNAA 3UTEA 2YLRA 3EF6A 1ELIA 4JQ9A 3FIMB 3AYJA 4Y4NA 3AE4A 4U2LA 4BURA 1K0JA 1Q1WA 1XANA 4JN9A 4O5UA 2C67A 2C3CA 1BGJA 3SZ0A 4CNJA 2QA1A 3UKFA 5KMQA 3AEAA 3IC9A 2B9WA 5EB4A 3SY4A 4JDRA 2BXRA 5JCLA 1Y56B 4U8JA 2BCPA 3LADA 4NEVA 4XXGA 2BK4A 5CQFA 2FJEA 5U63A 2RGHA 2XVFA 5KRQA 2Q6UA 2B7RA 3V3OA 3ABVA 1CC4A 4OCGA 4YSHA 1YY5A 2XVHA 4H2RA 1N4VA 3UKHA 1ZP0A 2EQ7A 2F5ZA 2H88A 3LB8A 1L9DA 4H2NA 2IVDA 3NYCA 3AYLA 5KOXA 5JCIA 4JY2A 4CNKA 2NVKX 2WP5A 1E7PA 5BUKA 3UP4A 3ISHA 2Y6RA 3FBSA 2V5ZA 3L8KA 3E1TA 1EL9A 3K30A 1L0VA 3RP6A 1E1MA 1GRHA 1IUUA 4APNA 4NNJA 1ZMDA 2BABA 4YTMA 4Z2TA 5U25A 1PDHA 4A9WA 1JNRA 3SQPA 3KU9A 2IVEA 3NN6X 4GDPA 5KXJA 1NHRA 1K4QA 4J56A 1EL8A 2WU5A 3BI4A 3LJPA 2GR1A 5IQ1A 2XFPA 1NAAA 3D8XA 2ACZA 2Q7VA 2XFOA 4C77A 3CTYA 4YTPA 4C3YA 3SZCA 4OPTA 1AOGA 3KVEA 3CMMA 1N1PA 3CNPA 4B69A 2EQ9A 2XDOA 2VVLG 4MJWA 4EQSA 3ALMA 3SFEA 4DGKA 5KMRA 2A8XA 3C4NA 1W4XA 1GRGA 3T2YA 3PVCA 1EL5A 3NTAA 2QCUA 4FK1C 2I0ZA 3C4AA 1JNZA 4K22A 3AB1A 1YKJA 3ADAB 3DJEA 1OJ9A 2R0GA 2GRTA 4H4XA 3FMWA 3G5QA 3WE0A 3LZWA 5FS6A 1F8WA 4TLXA 3O0HA 5JCMA 4K5SA 1MOKA 1COYA 2OLOA 3OZ2A 3P4PA 1NDAA 1DOCA 3AWIA 2AAQA 5GRTA 4LIIA 5U1OA 1H82A 1GV4A 1S3BA 2YG4A 1P2EA 2ZBWA 5KOWA 4D04A 1H2IA 3GD4A 2CVJA 4AOSA 1PBDA 1IUWA 2XLSA 1EL7A 4GF7A 4YKGA 2Z5XA 1PBEA 3QSMA 2E1MA 5EOWA 3RP7A 3SXIA 4CBQA 4C74A 2YG7A 4IVOB 1N4UA 3AECA 2BK3A 2C73A 3CPIG 1LQTA 1EBDA 4TM4A 3DMEA 2TMDA 2CDUA 2WBAA 4GUVA 1Y56A 2WOWA 1ZOVA 2JAEA 3AE5A 3QFBA 4OPUA 3GMBA 3CIRA 4A6NB 4BK1A 4LU6A 2Q0KA 3UCLA 4H4RA 4EM4A 3VR8A 2R4JA 3L5OA 2VQ7A 3AD9B 1OJTA 2GB0A 2Q0LA 2OA1A 2WPFA 1RSGA 1BKWA 1DOBA 1GT8A 5ER0A 2FJBA 2XCGA 4G9KA 4EQWA 1E39A 4AP1A 4JNQA 2V3AA 1GALA 3ITJA 1O5WA 4GR1A 1FECA 2VQBA 4OPCA 3SM8A 4A6NA 4EQXA 5C2TA 3S61A 2V6OA 4BK2A 4J34A 4RG3A 1ZOYA 2WQYA 2R46A 1CC6A 3NN0X 3KA7A 1IUSA 1H84A 2R45A 4J36A 4Z2RA 4U8LA 4AP3A 1ZY8A 3AE3A 1GSNA 2YR4A 1ZDLA 4A79A 4G73A 5BULA 1S7MA 4O5QA 5J60A 2APGA 3DJJA 2X3NA 4GRTA 2BACA 5JRBA 2BS4A 4K7ZA 4EIQA 4I58A 5IQ4A 5KWFA 1F8RA 1Y0PA 4Z25A 1S2QA 5HY5A 4K5RA 4H4YA 4YWOA 3P4SA 1D7YA 3Q6JA 4TM0A 3BI2A 1ZK7A 1PHHA 5L46A 2FJDA 2GH5A 2JB3A 2WOVA 4GAVA 5LV9A 4ICYA 1OJCA 3CNJA 3AD7B 1TYTA 1M6IA 4II3A 3II4A 1BWCA 1NPXA 3GSIA 4PABA 1GTHA 4EM3A 4OPIA 1DODA 4C5OA 4USQA 5HXIA 4OPLA 1PJ6A 1ZX9A 3R9UA 3GYIA 1BF3A 2PYXA 2R0CA 3DK8A 2XLRA 3AEBA 4ZCDA 4H4WA 2JB2A 3DGHA 4PAAA 2X50A 2ZZCA 1KF6A 3BHKA 3I6DA 3UKLA 3F8DA 3VRBA 2WU2A 3KD9A 3DGZA 3GWFA 2XFQA 1PJ5A 3M0OA 1GRFA 2C72A 3ICRA 3BHFA 2C70A 4B68A 1ZMCA 4H2QA 3NK0X 1XDIA 1H6VA 1D4CA 1PXAA 1S3EA 2C7GA 4X9NA 4YSZA 1LV0A 1RYIA 2DKIA 2BRAA 3LXDA 2Y6QA 4U2SA 1TRBA 4XWZA 3LOVA 1L9CA 1JRZA 3G5SA 4G6GA 5IPYA 2XLTA 1KNRA 4YT0A 4GDEA 2X99A 1FEBA 4H7UA 1XPQA 1NENA 3AEFA 3M13A 5BVAA 1L9EA 1MO9A 4Z2UA 5KMPA 1FOHA 1NHQA 1KDGA 4B66A 4EMJA 3CGCA 5KVIA 2IIDA 1NG3A 3NLCA 3T31A 1Z6LA 2XLUA 3CPJG 5GSNA 4B67A 2R0PA 5JCKA 2BCGG 3ZDNA 3DA1A 3H8LA 3CPHG 3GRSA 4FDCB 1TDFA 2EQ8A 2GV8A 3NT6A 4HB9A 1MXTA 2WDRA 4C3XA 2ZZBA 2VVLA 3S5WA 1QJDA 1D4DA 3OC4A 1KFYA 1VQWA 4U2TA 1H81A 4II2A 1YQZA 4DNAA 1K0IA 1NHPA 3LZXA 4N9XA 5J7XA 3NYFA 1VG9A 2BRYA 3VRDB 3GWDA 3AE7A 5M10A 2X8GA 3T37A 1H83A 3KKJA 3L1RA 4YKFA 1DXLA 2B9XA 4Y4MA 2JBVA 4U8OA 4FK1A 4NWZA 2OALA 4CCQA 2EQ6A 1SEZA 3BNUA 1FEAA 1TDOA 3UKAA 1FCDA 1Q9IA 3FPZA 2B9YA 3UOYA 2JK6A 3NTDA 4XWRA 4J31A 2Z5YA 4FX9A 4J57A 4YSYA 3GRTA 3REDA 3B6DA 3GDNA 4OVIA 5CKUA 2RGOA 3ATRA 1GERA 1CJ2A 1REOA 2BS2A 4U8IA 3UOZA 4EMIA 3BNMA 1UKVG 3UTGA 5C3JA 4X4JA 4H50A 1LQUA 2BA9A 3HYVA 3NGCX 3UOVA 5FS9A 1PBFA 2A87A 2WPCA 5TR3A 1B37A 2H89A 2WDVA 4YTNA 1NG4A 1P2HA 3K7MX 3V76A 4ZN0A 4NTEA 2O9ZA 4U8NA 3EAOA 3RP8A 1B5QA 4TM1A 3DK9A 1O94A 3AE1A 3COXA 2E5VA 2GF3A 4OPGA 2C4CA 2YM1A 2XYOA 3C96A 4Z43A 2HQMA 5DBJA 1E6EA 1NHSA 2YR6A 3QJ4A 2WETA 3AE9A 4GCMA 1ONFA 4CY6A 1LPFA 2YG6A 5FMHA 3EANA 1V59A 3UOXA 4B63A 4H4PA 3F8PA 4H4VA 1GRAA 1BGNA 1S2YA 3CNDA 3IHMA 1B4VA 2YWLA 1GNDA 3KPKA 1Q1RA 3K7QX 2X8HA 1GPEA 1YQ4A 2GQWA 5KMSA 5BRTA 4K2XA 4AOXA 2VOUA 4BV6A 3UP5A 4B65A 3PG6A 2B76A 2YQUA 2GMHA 3EPTA 3FG2P 3UKKA 4B64A 1QLBA 3VQRA 3CGEA 4BK3A 3P9UA 1PXCA 1KSUA 1GTEA 3B3RA 1LTXR 2RABA 3DH9A 1LJ1A 1YQ3A 3HYWA 3SZFA 1E1KA 2WS3A 3HYXA 4UP3A 1ZKQA 4LA1A 2WDQA 2XFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCT A;  2YAU A;  5KVH A;  3IHG A;  3CGD A;  3JSK A;  2C64 A;  1GRT A;  1GRE A;  2YLW A;  4NTC A;  1O95 A;  3IWA A;  1PN0 A;  1TDK A;  3QSS A;  2BXS A;  1BZL A;  3AXB A;  4BJY A;  2C3D A;  1VDC A;  2JKC A;  4IA5 A;  3VR9 A;  2VRL A;  4A7A A;  2YLZ A;  2BS3 A;  3GYJ A;  4U8M A;  3NH3 X;  1H86 A;  2GR2 A;  4CY8 A;  4UDQ A;  1GOS A;  1CJ3 A;  1PS9 A;  1TDN A;  3AYI A;  3VRA A;  5HHF A;  2VRM A;  4I59 A;  3ALL A;  4M52 A;  4ZCC A;  3SGL A;  2V61 A;  1GXF A;  2TPR A;  1TDE A;  2YLS A;  2YVG A;  2WP6 A;  1CBO A;  3UKP A;  2YR5 A;  2C65 A;  2YVJ A;  2AQJ A;  3AED A;  2QA2 A;  4CCR A;  4EQR A;  2OLN A;  1NEK A;  2XLP A;  3CNT A;  3ICT A;  2UZZ A;  3GMC A;  4USR A;  3H8I A;  2YG3 A;  1D5T A;  4AT2 A;  1D4E A;  3AE2 A;  2X8C A;  3GDP A;  1QO8 A;  3NG7 X;  1CJ4 A;  3RHA A;  4DSG A;  4H4T A;  5M0Z A;  3QVR A;  1JRX A;  1IUT A;  3URH A;  2VZ2 A;  4K8D A;  1H7X A;  3UTH A;  2GR0 A;  3V3N A;  2GMJ A;  2B7S A;  2CUL A;  3NHO X;  2R9Z A;  4RG4 A;  5FS8 A;  1CHU A;  1B8S A;  1KSS A;  3CN8 A;  5EB5 A;  1IUV A;  3QSE A;  2WOI A;  2R4E A;  3AE8 A;  2BC1 A;  2BK5 A;  4H4Z A;  2XFN A;  3D1C A;  2BC0 A;  3NK2 X;  4TLZ A;  2ZZ0 A;  1PBC A;  3CGB A;  3AEG A;  1JEH A;  4NZH A;  1PJ7 A;  2YM2 A;  4CRT A;  1CC2 A;  3ATQ A;  1HYU A;  1DOE A;  2GR3 A;  1VRQ B;  3NK1 X;  3NRN A;  3P1W A;  4IVM B;  2GVC A;  2YLT A;  4J2W A;  3ALJ A;  1IJH A;  2QAE A;  2GEW A;  3NYE A;  1VG0 A;  3P4R A;  3PS9 A;  4UDR A;  1DNC A;  1GEU A;  4H4U A;  5FS7 A;  2RGJ A;  1F6M A;  1TYP A;  2J3N A;  3IF9 A;  2JB1 A;  2PHH A;  5HYM A;  1E1L A;  3QFA A;  2YVF A;  4YXD A;  1H7W A;  1JOA A;  2VVM A;  3I3L A;  4X9M A;  1GES A;  1CF3 A;  3NKS A;  3Q9T A;  4NTD A;  4UDP A;  2V3B A;  1X31 B;  2C66 A;  4YSX A;  4WX1 A;  3GD3 A;  3M12 A;  3DJD A;  2OAM A;  1FL2 A;  4ADW A;  1KNP A;  5JCN A;  1DJN A;  4P9S A;  4U8P A;  3K7T A;  3H4K A;  1D7L A;  3PO7 A;  2WHD A;  4A99 A;  2FBW A;  4EMW A;  2GQF A;  4DSH A;  4H2P A;  3CNS A;  4NEW A;  1OJA A;  2GAH B;  4E0V A;  2XVI A;  4OPD A;  2AR8 A;  3BI5 A;  2CFY A;  3QVP A;  2WP9 A;  2C76 A;  4RSL A;  4H4Q A;  2BYB A;  4Z24 A;  3ZYX A;  1F3P A;  2NPX A;  4TM3 A;  2ARD A;  1OJD A;  4HA6 A;  4KX6 A;  3P4Q A;  4REK A;  3DK4 A;  1XHC A;  4JY3 A;  3SFD A;  4IV9 A;  1N4W A;  4B1B A;  3AEE A;  1DJQ A;  4A5L A;  1F8S A;  1CL0 A;  3DJG X;  1PBB A;  4A65 A;  4AT0 A;  4J33 A;  4Y4L A;  2WPE A;  1RP0 A;  2GAG B;  1IUX A;  4IA6 A;  1GET A;  1PXB A;  1E1N A;  2A89 A;  2DKH A;  2WEU A;  2XVJ A;  3NNE A;  4D03 A;  4H4S A;  1K0L A;  2W0H A;  3AD8 B;  1M64 A;  3G5R A;  3UKQ A;  4BJZ A;  2YLX A;  1JU2 A;  3NIX A;  2WES A;  4Z44 A;  3F8R A;  1LVL A;  2E4G A;  4Z26 A;  5EBK A;  1JRY A;  4EIP A;  2FJA A;  2V60 A;  3KPF A;  1CJC A;  2YG5 A;  2C75 A;  3HZL A;  2XVE A;  4ECH A;  4KPR A;  3ICS A;  3UTF A;  3AE6 A;  3RNM A;  4U8K A;  1GRB A;  3KLJ A;  4JNA A;  3UTE A;  2YLR A;  3EF6 A;  1ELI A;  4JQ9 A;  3FIM B;  3AYJ A;  4Y4N A;  3AE4 A;  4U2L A;  4BUR A;  1K0J A;  1Q1W A;  1XAN A;  4JN9 A;  4O5U A;  2C67 A;  2C3C A;  1BGJ A;  4CNJ A;  2QA1 A;  3UKF A;  3AEA A;  3IC9 A;  2B9W A;  5EB4 A;  4JDR A;  2BXR A;  5JCL A;  1Y56 B;  4U8J A;  2BCP A;  3LAD A;  4NEV A;  4XXG A;  2BK4 A;  5CQF A;  2FJE A;  5U63 A;  2RGH A;  2XVF A;  5KRQ A;  2Q6U A;  2B7R A;  3V3O A;  3ABV A;  1CC4 A;  4OCG A;  4YSH A;  1YY5 A;  2XVH A;  4H2R A;  1N4V A;  3UKH A;  1ZP0 A;  2EQ7 A;  2F5Z A;  2H88 A;  3LB8 A;  1L9D A;  4H2N A;  2IVD A;  3NYC A;  3AYL A;  5KOX A;  5JCI A;  4JY2 A;  4CNK A;  2NVK X;  2WP5 A;  1E7P A;  5BUK A;  3UP4 A;  3ISH A;  2Y6R A;  3FBS A;  2V5Z A;  3L8K A;  3E1T A;  1EL9 A;  3K30 A;  1L0V A;  3RP6 A;  1E1M A;  1GRH A;  1IUU A;  4APN A;  1ZMD A;  2BAB A;  4YTM A;  4Z2T A;  5U25 A;  1PDH A;  4A9W A;  1JNR A;  3SQP A;  3KU9 A;  2IVE A;  3NN6 X;  4GDP A;  5KXJ A;  1NHR A;  1K4Q A;  4J56 A;  1EL8 A;  2WU5 A;  3BI4 A;  3LJP A;  2GR1 A;  5IQ1 A;  2XFP A;  1NAA A;  3D8X A;  2ACZ A;  2Q7V A;  2XFO A;  4C77 A;  3CTY A;  4YTP A;  4C3Y A;  4OPT A;  1AOG A;  3KVE A;  4B69 A;  1N1P A;  3CNP A;  2EQ9 A;  2XDO A;  2VVL G;  4MJW A;  4EQS A;  3ALM A;  3SFE A;  4DGK A;  2A8X A;  3C4N A;  1W4X A;  1GRG A;  3PVC A;  1EL5 A;  3NTA A;  2QCU A;  4FK1 C;  2I0Z A;  3C4A A;  1JNZ A;  4K22 A;  3AB1 A;  1YKJ A;  3ADA B;  3DJE A;  1OJ9 A;  2R0G A;  2GRT A;  4H4X A;  3FMW A;  3G5Q A;  3WE0 A;  3LZW A;  5FS6 A;  1F8W A;  4TLX A;  3O0H A;  5JCM A;  4K5S A;  1MOK A;  1COY A;  2OLO A;  3OZ2 A;  3P4P A;  1NDA A;  1DOC A;  3AWI A;  2AAQ A;  5GRT A;  4LII A;  5U1O A;  1H82 A;  1GV4 A;  1S3B A;  2YG4 A;  1P2E A;  2ZBW A;  5KOW A;  4D04 A;  3GD4 A;  2CVJ A;  4AOS A;  1PBD A;  1IUW A;  2XLS A;  1EL7 A;  4GF7 A;  4YKG A;  2Z5X A;  1PBE A;  3QSM A;  2E1M A;  5EOW A;  3RP7 A;  4CBQ A;  4C74 A;  2YG7 A;  4IVO B;  1N4U A;  3AEC A;  2BK3 A;  2C73 A;  3CPI G;  1LQT A;  1EBD A;  4TM4 A;  3DME A;  2TMD A;  2CDU A;  2WBA A;  4GUV A;  1Y56 A;  2WOW A;  1ZOV A;  2JAE A;  3AE5 A;  3QFB A;  4OPU A;  3GMB A;  3CIR A;  4A6N B;  4BK1 A;  4LU6 A;  2Q0K A;  3UCL A;  4H4R A;  4EM4 A;  3VR8 A;  2R4J A;  2VQ7 A;  3AD9 B;  1OJT A;  2GB0 A;  2Q0L A;  2OA1 A;  2WPF A;  1RSG A;  1BKW A;  1DOB A;  1GT8 A;  5ER0 A;  2FJB A;  2XCG A;  4EQW A;  1E39 A;  4AP1 A;  4JNQ A;  2V3A A;  1GAL A;  3ITJ A;  1O5W A;  4GR1 A;  1FEC A;  2VQB A;  4OPC A;  3SM8 A;  4A6N A;  4EQX A;  5C2T A;  3S61 A;  2V6O A;  4BK2 A;  4J34 A;  4RG3 A;  1ZOY A;  2WQY A;  2R46 A;  1CC6 A;  3NN0 X;  3KA7 A;  1IUS A;  1H84 A;  2R45 A;  4J36 A;  4Z2R A;  4U8L A;  4AP3 A;  1ZY8 A;  3AE3 A;  1GSN A;  2YR4 A;  1ZDL A;  4A79 A;  5BUL A;  4O5Q A;  5J60 A;  2APG A;  3DJJ A;  2X3N A;  4GRT A;  2BAC A;  2BS4 A;  4K7Z A;  4EIQ A;  4I58 A;  5IQ4 A;  5KWF A;  1F8R A;  1Y0P A;  4Z25 A;  1S2Q A;  5HY5 A;  4K5R A;  4H4Y A;  4YWO A;  3P4S A;  1D7Y A;  3Q6J A;  4TM0 A;  3BI2 A;  1ZK7 A;  1PHH A;  5L46 A;  2FJD A;  2GH5 A;  2JB3 A;  2WOV A;  5LV9 A;  4ICY A;  1OJC A;  3CNJ A;  3AD7 B;  1TYT A;  1M6I A;  3II4 A;  1BWC A;  1NPX A;  3GSI A;  4PAB A;  1GTH A;  4EM3 A;  4OPI A;  1DOD A;  4C5O A;  4USQ A;  5HXI A;  4OPL A;  1PJ6 A;  1ZX9 A;  3R9U A;  3GYI A;  1BF3 A;  2PYX A;  2R0C A;  3DK8 A;  2XLR A;  3AEB A;  4ZCD A;  4H4W A;  2JB2 A;  3DGH A;  4PAA A;  2X50 A;  2ZZC A;  1KF6 A;  3BHK A;  3I6D A;  3UKL A;  3F8D A;  3VRB A;  2WU2 A;  3KD9 A;  3DGZ A;  3GWF A;  2XFQ A;  1PJ5 A;  3M0O A;  1GRF A;  2C72 A;  3ICR A;  3BHF A;  2C70 A;  4B68 A;  1ZMC A;  4H2Q A;  3NK0 X;  1XDI A;  1H6V A;  1D4C A;  1PXA A;  1S3E A;  2C7G A;  4X9N A;  4YSZ A;  1LV0 A;  1RYI A;  2DKI A;  3LXD A;  2Y6Q A;  4U2S A;  1TRB A;  4XWZ A;  3LOV A;  1L9C A;  1JRZ A;  3G5S A;  5IPY A;  2XLT A;  1KNR A;  4YT0 A;  4GDE A;  2X99 A;  1FEB A;  4H7U A;  1XPQ A;  1NEN A;  3AEF A;  3M13 A;  5BVA A;  1L9E A;  1MO9 A;  4Z2U A;  1FOH A;  1NHQ A;  1KDG A;  4B66 A;  4EMJ A;  3CGC A;  5KVI A;  2IID A;  1NG3 A;  3NLC A;  4B67 A;  1Z6L A;  2XLU A;  3CPJ G;  5GSN A;  2R0P A;  5JCK A;  2BCG G;  3ZDN A;  3DA1 A;  3H8L A;  3CPH G;  3GRS A;  4FDC B;  1TDF A;  2EQ8 A;  2GV8 A;  3NT6 A;  4HB9 A;  1MXT A;  2WDR A;  4C3X A;  2ZZB A;  2VVL A;  3S5W A;  1QJD A;  1D4D A;  3OC4 A;  1KFY A;  1VQW A;  4U2T A;  1H81 A;  1YQZ A;  4DNA A;  1K0I A;  1NHP A;  3LZX A;  4N9X A;  5J7X A;  3NYF A;  1VG9 A;  3VRD B;  3GWD A;  3AE7 A;  5M10 A;  2X8G A;  3T37 A;  1H83 A;  3KKJ A;  3L1R A;  4YKF A;  1DXL A;  2B9X A;  4Y4M A;  2JBV A;  4U8O A;  4FK1 A;  2OAL A;  4CCQ A;  2EQ6 A;  1SEZ A;  3BNU A;  1FEA A;  1TDO A;  3UKA A;  1FCD A;  1Q9I A;  3FPZ A;  2B9Y A;  3UOY A;  2JK6 A;  3NTD A;  4XWR A;  4J31 A;  2Z5Y A;  4FX9 A;  4J57 A;  4YSY A;  3GRT A;  3RED A;  3B6D A;  3GDN A;  4OVI A;  5CKU A;  2RGO A;  3ATR A;  1GER A;  1CJ2 A;  1REO A;  2BS2 A;  4U8I A;  3UOZ A;  4EMI A;  3BNM A;  1UKV G;  3UTG A;  5C3J A;  4X4J A;  4H50 A;  1LQU A;  2BA9 A;  3NGC X;  3UOV A;  5FS9 A;  1PBF A;  2A87 A;  2WPC A;  5TR3 A;  1B37 A;  2H89 A;  2WDV A;  4YTN A;  1NG4 A;  1P2H A;  3K7M X;  3V76 A;  4ZN0 A;  4NTE A;  2O9Z A;  4U8N A;  3EAO A;  3RP8 A;  1B5Q A;  4TM1 A;  3DK9 A;  1O94 A;  3AE1 A;  3COX A;  2E5V A;  2GF3 A;  4OPG A;  2YM1 A;  2XYO A;  3C96 A;  4Z43 A;  2HQM A;  5DBJ A;  1E6E A;  1NHS A;  2YR6 A;  3QJ4 A;  2WET A;  3AE9 A;  4GCM A;  1ONF A;  4CY6 A;  1LPF A;  2YG6 A;  5FMH A;  3EAN A;  1V59 A;  3UOX A;  4B63 A;  4H4P A;  3F8P A;  4H4V A;  1GRA A;  1BGN A;  1S2Y A;  3CND A;  3IHM A;  1B4V A;  2YWL A;  1GND A;  1Q1R A;  3K7Q X;  2X8H A;  1GPE A;  1YQ4 A;  2GQW A;  5BRT A;  4K2X A;  4AOX A;  2VOU A;  4BV6 A;  3UP5 A;  4B65 A;  2B76 A;  2YQU A;  2GMH A;  3EPT A;  3FG2 P;  3UKK A;  4B64 A;  1QLB A;  3VQR A;  3CGE A;  4BK3 A;  3P9U A;  1PXC A;  1KSU A;  1GTE A;  3B3R A;  1LTX R;  2RAB A;  3DH9 A;  1LJ1 A;  1YQ3 A;  1E1K A;  2WS3 A;  4UP3 A;  1ZKQ A;  4LA1 A;  2WDQ A;  2XFU A; 
#chains in the Genus database with same CATH topology
 2YLW A;  1O95 A;  3EKG A;  4BJY A;  2JKC A;  2ZAD A;  2BS3 A;  3GYJ A;  1CJ3 A;  3AYI A;  3ALL A;  1GXF A;  3AED A;  4DXK A;  2OLN A;  2XLP A;  3ICT A;  3GMC A;  1D5T A;  1QO8 A;  3VDG A;  3PWG A;  2W55 A;  1IUT A;  1SJD A;  1B8S A;  1KSS A;  5EB5 A;  1IUV A;  2BC0 A;  2W3R A;  3T6C A;  3VC5 A;  2ZZ0 A;  1JEH A;  3ZVH B;  1PJ7 A;  1HYU A;  1VRQ B;  3NRN A;  3P1W A;  4IVM B;  2GVC A;  2YLT A;  1F9C A;  3PS9 A;  3UXL A;  1F6M A;  1TYP A;  3IF9 A;  2JB1 A;  1H7W A;  3NKS A;  3Q9T A;  3VCC A;  2C66 A;  4YSX A;  3GD3 A;  5KNL A;  4P9S A;  3PO7 A;  4A99 A;  3CNS A;  1OJA A;  3SN0 A;  4OPD A;  2AR8 A;  2CFY A;  2C76 A;  4H4Q A;  5IDZ A;  3T2Z A;  2RDX A;  3FVD A;  3MY9 A;  3DK4 A;  4JY3 A;  3SFD A;  3TWB A;  3DJG X;  4J33 A;  4Y4L A;  1RP0 A;  2GAG B;  1IUX A;  4IA6 A;  1PXB A;  1E1N A;  2WEU A;  1K0L A;  1R0M A;  1X2H A;  3NIX A;  3R07 C;  2FKP A;  2FJA A;  1CJC A;  4ECH A;  2QDD A;  3V5F A;  2GGE A;  3EF6 A;  4JQ9 A;  3FIM B;  3AYJ A;  1K0J A;  4JN9 A;  3UJE A;  2C3C A;  4CNJ A;  3VCN A;  4H1Z A;  3MZN A;  3T8Q A;  1BQG A;  2RGH A;  2XVF A;  2B7R A;  1CC4 A;  5BOE A;  3LB8 A;  2IVD A;  5KOX A;  5JCI A;  1E7P A;  4APN A;  2POD A;  5U25 A;  1JNR A;  3SQP A;  3NN6 X;  4KT2 A;  2WU5 A;  2XFP A;  3D8X A;  4C77 A;  2OPJ A;  3SZC A;  3KVE A;  3CMM A;  1IYX A;  4MJW A;  4DGK A;  2A8X A;  1W4X A;  2XH2 A;  3NVY B;  3T2Y A;  2QCU A;  2PTW A;  3AB1 A;  1OJ9 A;  2R0G A;  2GRT A;  3FMW A;  3WE0 A;  3RGT A;  3LZW A;  3O0H A;  5JCM A;  2P8C A;  3DFH A;  3AWI A;  1DOC A;  5U1O A;  2YG4 A;  1P2E A;  4D04 A;  1H2I A;  2CVJ A;  1IUW A;  4GF7 A;  2Z5X A;  4ZCW A;  3CXB A;  2YG7 A;  4IVO B;  1N4U A;  3AEC A;  4TM4 A;  3DME A;  1WYG A;  2WBA A;  4GUV A;  2JAE A;  4BK1 A;  3GMB A;  4ROP A;  2PU0 A;  1ONE A;  3VR8 A;  3OZY A;  2VQ7 A;  2GB0 A;  2WPF A;  1DOB A;  1GT8 A;  4G9K A;  3MSY A;  3ITJ A;  4GR1 A;  1JDF A;  4EQX A;  3S61 A;  4BK2 A;  3VA8 A;  3IJQ A;  2PPG A;  2R46 A;  1CC6 A;  1JRP A;  4J36 A;  3AE3 A;  2YR4 A;  4O5Q A;  5J60 A;  3EEZ A;  1V97 A;  2BS4 A;  3N6J A;  4EIQ A;  4I58 A;  5IQ4 A;  1F8R A;  4Z25 A;  4H4Y A;  3STP A;  3P4S A;  2OLA A;  2JB3 A;  2GH5 A;  3FXG A;  1M6I A;  1MDR A;  1DOD A;  4USQ A;  4OPL A;  1ZX9 A;  3UCD A;  4PAA A;  3F8D A;  2XFQ A;  2C70 A;  2C7G A;  1KCZ A;  2BRA A;  2PGW A;  3OW1 A;  4G6G A;  4YT0 A;  5BVA A;  1L9E A;  1MO9 A;  1NHQ A;  4B66 A;  1PDY A;  3NLC A;  5GSN A;  3CPJ G;  1SJC A;  5JCK A;  2PA6 A;  2GV8 A;  2AKZ A;  3H12 A;  2VVL A;  3DG7 A;  4A3R A;  3OC4 A;  1FO4 A;  1D4D A;  3QKE A;  1VQW A;  1H81 A;  4II2 A;  1YQZ A;  3LZX A;  4N9X A;  1VG9 A;  4FP1 A;  4E4U A;  2X8G A;  1ZXI C;  1H83 A;  3KKJ A;  3K1G A;  1FCD A;  3UOY A;  4XWR A;  4FX9 A;  1P43 A;  3Q45 A;  5G5H B;  3RED A;  4YSY A;  3B6D A;  1KD0 A;  3ATR A;  3SQS A;  1GER A;  1CJ2 A;  3NXL A;  5C3J A;  4H50 A;  3UJR A;  3NGC X;  5TR3 A;  2WDV A;  4YTN A;  1P2H A;  3SR6 B;  3RP8 A;  1B5Q A;  1O94 A;  2OZT A;  4OPG A;  2C4C A;  3P3B A;  2YR6 A;  3QJ4 A;  2P88 A;  2WET A;  3AE9 A;  4H4P A;  1JCT A;  3FJ4 A;  1ELS A;  3CND A;  1B4V A;  1GND A;  3K7Q X;  5J04 A;  2AL2 A;  4AOX A;  4B65 A;  3PG6 A;  3FG2 P;  3VQR A;  3R1Z A;  1YQ3 A;  3HYW A;  1E1K A;  5KVH A;  1EC9 A;  3CGD A;  3DER A;  3IWA A;  2BXS A;  1BZL A;  3PK7 A;  3AXB A;  2C3D A;  3VR9 A;  4A7A A;  2E3T A;  3NH3 X;  3HRD C;  1PS9 A;  1TDN A;  3VRA A;  4I59 A;  3SGL A;  4M52 A;  4DWD A;  3BJS A;  2CHR A;  1TDE A;  2YVG A;  2WP6 A;  3UKP A;  2YVJ A;  4G8T A;  4CCR A;  1NEK A;  4FI4 A;  3ES7 A;  3NG7 X;  1FHV A;  3RHA A;  5M0Z A;  3QVR A;  3ZVI A;  4K1W A;  3URH A;  2VZ2 A;  4K8D A;  1H7X A;  4X2P A;  3SZW A;  3UTH A;  2PMQ A;  3NHO X;  2R9Z A;  5FS8 A;  3CN8 A;  2WOI A;  3AE8 A;  3NVW B;  3D1C A;  1FHU A;  3I6T A;  2YM2 A;  3SYI A;  1DOE A;  2GR3 A;  1R6W A;  1MDL A;  4GAP A;  3NYE A;  4UDR A;  1GEU A;  2RGJ A;  5FS7 A;  3NS1 B;  2HZG A;  2VVM A;  4NTD A;  2AL2 B;  4UDP A;  4WX1 A;  3M12 A;  3DJD A;  4ADW A;  1DJN A;  3H4K A;  1D7L A;  4EMW A;  2GQF A;  4DSH A;  3U4F A;  4H19 A;  4NEW A;  2XVI A;  3BI5 A;  3R0U A;  4RSL A;  3D9X A;  3ZYX A;  4G74 A;  1F3P A;  1N62 C;  4IV9 A;  4AT0 A;  4A35 A;  6ENL A;  2WPE A;  1EBH A;  5ENL A;  2DKH A;  2OVL A;  2QGY A;  4D03 A;  2W0H A;  3AD8 B;  3UKQ A;  2YLX A;  1JU2 A;  4Z44 A;  4EIP A;  3T14 A;  2V60 A;  3HW2 A;  2C75 A;  3HZL A;  2XVE A;  4KPR A;  3ICS A;  3RNM A;  1GRB A;  4JNA A;  1ELI A;  4DHG A;  4Y4N A;  4BUR A;  1XAN A;  5FJT A;  1BGJ A;  3CT2 A;  2QA1 A;  3UKF A;  4K8G A;  5EB4 A;  4JDR A;  2BXR A;  4NEV A;  2BK4 A;  3I4K A;  1YY5 A;  3UKH A;  4H2N A;  3NYC A;  3AYL A;  4JY2 A;  2PU1 A;  4CNK A;  4IL0 A;  3DIP A;  2Y6R A;  1TKK A;  2V5Z A;  3L8K A;  3RP6 A;  1EL9 A;  3K30 A;  2MNR A;  1GRH A;  1ZMD A;  2BAB A;  1EC7 A;  4A9W A;  3KU9 A;  4GDP A;  1NHR A;  1K4Q A;  3BI4 A;  5IQ1 A;  2Q7V A;  2XFO A;  4OPT A;  4B69 A;  1WUF A;  2XDO A;  2VVL G;  3SFE A;  4EQS A;  3ALM A;  4HCL A;  4IP4 A;  3MUC A;  3VFC A;  2OKT A;  3G5Q A;  3NVZ B;  3THU A;  1F8W A;  2POZ A;  1COY A;  3OZ2 A;  2AAQ A;  4LII A;  1S3B A;  5KOW A;  3GO2 A;  2XLS A;  1EL7 A;  4C74 A;  1PBE A;  5EOW A;  2E1M A;  3TWA A;  4CBQ A;  1FFV C;  2W54 A;  2QJN A;  1Y56 A;  1ZOV A;  3QFB A;  3CIR A;  3JW7 A;  3L5O A;  2OA1 A;  2XH4 A;  1BKW A;  3FCP A;  5ER0 A;  2XCG A;  3SJN A;  1STZ A;  2V3A A;  1GAL A;  1O5W A;  2VQB A;  1FEC A;  4OPC A;  5C2T A;  4RG3 A;  3KA7 A;  2R45 A;  4U8L A;  4AP3 A;  1GSN A;  3KUM A;  4MKS A;  3I6E A;  4ZA0 A;  5JRB A;  4E8G A;  2XH7 A;  5KWF A;  5HY5 A;  3Q6J A;  1ZK7 A;  3R25 A;  4JHM A;  5LV9 A;  4ICY A;  4II3 A;  3II4 A;  1VDV A;  4PAB A;  1GTH A;  4EM3 A;  4OPI A;  4C5O A;  1PJ6 A;  3GYI A;  2R0C A;  4H4W A;  2JB2 A;  1KF6 A;  3I6D A;  3MQT A;  3DGZ A;  5FJP A;  1GRF A;  2C72 A;  4GGH A;  4H2Q A;  3NK0 X;  1PXA A;  1H6V A;  1S3E A;  3LOV A;  1KNR A;  2X99 A;  3NVV B;  4H7U A;  1XPQ A;  1FOH A;  3OPS A;  4EMJ A;  2IID A;  2XLU A;  2R0P A;  3RCY A;  3CPH G;  4HB9 A;  3NT6 A;  4C3X A;  3S5W A;  2BRY A;  3VRD B;  5M10 A;  3T37 A;  4YKF A;  2B9X A;  2JBV A;  4FK1 A;  4NWZ A;  3AMZ A;  3QLD A;  2EQ6 A;  2Z5Y A;  3GDN A;  1W6T A;  5CKU A;  3UOZ A;  3QN3 A;  4HNL A;  4EMI A;  3A7U A;  4J3Z A;  3UOV A;  2H89 A;  3R11 A;  1B37 A;  3JZU A;  1NG4 A;  3V76 A;  3K7M X;  4ZN0 A;  4GIS A;  4U8N A;  3NO1 A;  3BSM A;  3RR1 A;  4Z43 A;  2PP3 A;  4GCM A;  1ONF A;  1LPF A;  3UOX A;  4B63 A;  1KKR A;  3DDM A;  4H4V A;  1BGN A;  2OQH A;  3IHM A;  1MNS A;  2X8H A;  2GGH A;  3S47 A;  2OZ8 A;  4K2X A;  2VOU A;  4BV6 A;  1N60 C;  2YQU A;  3P0W A;  2GMH A;  3UKK A;  2XGZ A;  4B64 A;  3CGE A;  4BK3 A;  4HN8 A;  3RRA A;  1GTE A;  2WS3 A;  1ZKQ A;  3SN4 A;  2XFU A;  1TE6 A;  2GDQ A;  3IHG A;  1GRT A;  4NTC A;  3T2K A;  3FV9 A;  1TDK A;  3QSS A;  3DEQ A;  2DW6 A;  3DFY A;  1H86 A;  1OEP A;  4UDQ A;  1GOS A;  2VRM A;  4ZCC A;  2V61 A;  2TPR A;  2YLS A;  1SB3 B;  1CBO A;  1N5X A;  2YR5 A;  2C65 A;  2AQJ A;  2QA2 A;  4USR A;  3H8I A;  4AT2 A;  3AE2 A;  2X8C A;  2GGG A;  3NRZ B;  4TVW A;  4H4T A;  2QVH A;  2OFJ A;  2GR0 A;  2GMJ A;  2CUL A;  4RG4 A;  3QTP A;  3B97 A;  4H83 A;  3AM9 A;  2BC1 A;  2BK5 A;  4H4Z A;  3NK2 X;  2GSH A;  3CGB A;  4NZH A;  3TJI A;  1N63 C;  3EUB 3;  3NFU A;  3ALJ A;  3P4R A;  2OZ3 A;  1DNC A;  2PHH A;  1E1L A;  3QFA A;  4YXD A;  2OX4 A;  1JOA A;  4X9M A;  1GES A;  3P93 A;  1KN0 A;  3FYY A;  1KNP A;  3K7T A;  1ECQ A;  2WHD A;  3UJ2 A;  4H2P A;  2P3Z A;  4E0V A;  4GYP C;  2BYB A;  2NPX A;  1JPM A;  2ARD A;  1OJD A;  4HA6 A;  3P4Q A;  4REK A;  4HNC A;  4A5L A;  1F8S A;  1CL0 A;  1N61 C;  3SX6 A;  1PBB A;  4A65 A;  3DGB A;  2HNE A;  4IHC A;  1GET A;  2A89 A;  5FJU A;  3UJF A;  1M64 A;  3G5R A;  4BJZ A;  3U9I A;  2E4G A;  3MWC A;  4Z26 A;  1JRY A;  1EC8 A;  2PS2 A;  3AE6 A;  4U8K A;  2PTZ A;  3KLJ A;  3V4B A;  3UTE A;  2YLR A;  1Q1W A;  3OP2 A;  2C67 A;  2XSX A;  4Z1Y A;  2B9W A;  3SY4 A;  5CQF A;  5JCL A;  1Y56 B;  3LAD A;  4XXG A;  5U63 A;  4E4F A;  5KRQ A;  4DN1 A;  3V3O A;  2E5A A;  3ABV A;  4DYE A;  2XVH A;  4H2R A;  1ZP0 A;  2EQ7 A;  2F5Z A;  2H88 A;  2NVK X;  5BUK A;  3UP4 A;  1L0V A;  1E1M A;  2PGE A;  1IUU A;  4Z2T A;  4YTM A;  1PDH A;  1EL8 A;  4J56 A;  3LJP A;  1MRA A;  3PFR A;  1NAA A;  2ACZ A;  3CTY A;  3T9P A;  3UXK A;  1AOG A;  2EQ9 A;  4GIR A;  3C4N A;  1SJB A;  3PVC A;  4E5T A;  2I0Z A;  3C4A A;  1JNZ A;  4K22 A;  1YKJ A;  3DJE A;  4H4X A;  5FS6 A;  4TLX A;  1MOK A;  1NDA A;  3GD6 A;  3TCS A;  1GV4 A;  3RP7 A;  2C73 A;  1EBD A;  3HPF A;  2TMD A;  2CDU A;  2WOW A;  3AE5 A;  4A6N B;  4ZOH B;  4GFI A;  2Q0K A;  3UCL A;  4H4R A;  3D46 A;  2R4J A;  3AD9 B;  2FYM A;  1RSG A;  7ENL A;  2OO6 A;  1RVK A;  1FFU C;  4E6M A;  1E39 A;  4AP1 A;  3ETR B;  3N4F A;  2V6O A;  4J34 A;  3NN0 X;  2MUC A;  1IUS A;  4Z2R A;  1ZY8 A;  4A79 A;  3QPE A;  4G73 A;  5BUL A;  2APG A;  3OZM A;  4GRT A;  2BAC A;  4IP5 A;  1Y0P A;  1S2Q A;  4YWO A;  2HXU A;  1D7Y A;  4TM0 A;  4HCD A;  3A7R A;  2WOV A;  4TVY A;  1OJC A;  1TYT A;  1BWC A;  1NPX A;  4Z17 A;  1FIQ B;  5HXI A;  1BF3 A;  2PYX A;  3DK8 A;  3AEB A;  3V3N A;  2HXT A;  3UKL A;  3BHK A;  3VRB A;  2PSN A;  2WU2 A;  3M0O A;  2NQL A;  3GWF A;  3BHF A;  4B68 A;  1XDI A;  1D4C A;  4X9N A;  2DKI A;  2Y6Q A;  5FJR A;  1L9C A;  5IPY A;  3G5S A;  4GME A;  3DG3 A;  2GL5 A;  2XH0 A;  1FEB A;  1NEN A;  3M13 A;  4Z2U A;  5KMP A;  1KDG A;  3CGC A;  5KVI A;  4IZG A;  3T31 A;  1Z6L A;  4M0X A;  2BCG G;  3H8L A;  3GRS A;  4FDC B;  5G5G B;  2EQ8 A;  1TDF A;  1MXT A;  2WDR A;  4YWS A;  2QJM A;  1K0I A;  5J7X A;  3GWD A;  3AE7 A;  3CAW A;  1DXL A;  4U8O A;  2OAL A;  3SBF A;  4CCQ A;  2ZC8 A;  1SEZ A;  1Q9I A;  3TQP A;  3FPZ A;  4J31 A;  4J57 A;  3GRT A;  3TW9 A;  4IL2 A;  4OVI A;  2RGO A;  4K2S A;  4U8I A;  3BNM A;  3UTG A;  3IK4 A;  1LQU A;  3HYV A;  5FS9 A;  2A87 A;  2WPC A;  4NTE A;  3EAO A;  4TM1 A;  3AE1 A;  2XYO A;  3C96 A;  5DBJ A;  1E6E A;  3MKC A;  1NHS A;  3NZG A;  1XPY A;  5FMH A;  3EAN A;  3F8P A;  4G7F A;  4HCH A;  1GRA A;  2YWL A;  1N5W C;  1GPE A;  3UCC A;  4MGG A;  5BRT A;  1L8P A;  3UP5 A;  3T4W A;  3CXO A;  3EPT A;  4KPL A;  3P9U A;  1PXC A;  1KSU A;  3B3R A;  1LJ1 A;  3V3W A;  3SZF A;  2GGJ A;  2PP0 A;  1PDZ A;  4JN7 A;  4WCT A;  1NEL A;  2YAU A;  4M6U A;  3JSK A;  2C64 A;  1GRE A;  1PN0 A;  4KEM A;  1VDC A;  4IA5 A;  2VRL A;  1XS2 A;  2P0I A;  2YLZ A;  4U8M A;  2GR2 A;  2QDE A;  4CY8 A;  3ES8 A;  5HHF A;  3ZVH A;  4EQR A;  3CNT A;  2UZZ A;  2YG3 A;  4DX3 A;  1D4E A;  3GDP A;  1TZZ A;  3CK5 A;  4KWS A;  3IJI A;  1CJ4 A;  4DSG A;  3H8A A;  1JRX A;  3TJ4 A;  2QQ6 A;  2OG9 A;  2B7S A;  1CHU A;  3QSE A;  2R4E A;  2XFN A;  4JN8 A;  4TLZ A;  1PBC A;  3AEG A;  1KKO A;  4CRT A;  1CC2 A;  3ATQ A;  3NK1 X;  3GY1 A;  4J2W A;  1X2G A;  1IJH A;  2QAE A;  2GEW A;  1VG0 A;  3JVA A;  4H4U A;  2J3N A;  5HYM A;  2YVF A;  4G6H A;  3I3L A;  1CF3 A;  2V3B A;  1X31 B;  2OAM A;  1FL2 A;  1JRO A;  5JCN A;  4HPN A;  3ZLF A;  4U8P A;  1EBG A;  2FBW A;  3ZLH A;  3RIT A;  2GAH B;  3SN1 A;  3QVP A;  3BOX A;  2WP9 A;  4Z24 A;  3T0K A;  4TM3 A;  4KX6 A;  3GYX A;  1XHC A;  3PWI A;  1N4W A;  2PCE A;  4B1B A;  3AEE A;  1DJQ A;  1WUE A;  4H2H A;  2XVJ A;  3NNE A;  4H4S A;  2WES A;  3F8R A;  1LVL A;  5EBK A;  2QJJ A;  3KPF A;  2YG5 A;  2PTY A;  3UTF A;  3D47 A;  4ENL A;  3AE4 A;  3AN1 A;  4U2L A;  3TTE A;  4J1O A;  4O5U A;  3B9J B;  3SZ0 A;  5KMQ A;  3AEA A;  3IC9 A;  4U8J A;  2BCP A;  2FJE A;  2Q6U A;  4OCG A;  4YSH A;  1N4V A;  1L9D A;  3UGV A;  3SSZ A;  1NU5 A;  2WP5 A;  3ISH A;  3FBS A;  1T3Q C;  3E1T A;  3R10 A;  4NNJ A;  2IVE A;  5KXJ A;  1RM6 B;  2GR1 A;  5FJO A;  3H70 A;  4YTP A;  4MMW A;  4C3Y A;  1N1P A;  3CNP A;  5KMR A;  1GRG A;  1EL5 A;  3NTA A;  4FK1 C;  3ENL A;  2PTX A;  3ADA B;  1VQZ A;  4F4R A;  4K5S A;  2OLO A;  3P4P A;  5GRT A;  1H82 A;  2ZBW A;  3GD4 A;  2ONE A;  4AOS A;  1PBD A;  4YKG A;  3QSM A;  3SXI A;  5EU9 A;  2BK3 A;  3CPI G;  3R0K A;  1LQT A;  3Q4D A;  3RO6 A;  4OPU A;  4LU6 A;  1YEY A;  4EM4 A;  1OJT A;  2Q0L A;  3V5C A;  2OQY A;  2FJB A;  4EQW A;  2DW7 A;  4JNQ A;  3SM8 A;  1DTN A;  3CYJ A;  4A6N A;  1ZOY A;  2WQY A;  4GGB A;  1H84 A;  3GC2 A;  1ZDL A;  1S7M A;  1BKH A;  3DJJ A;  2X3N A;  4K7Z A;  1JPD X;  4K5R A;  3N6H A;  3BI2 A;  1P48 A;  1PHH A;  5L46 A;  2FJD A;  4GAV A;  3CNJ A;  3AD7 B;  3GSI A;  3R9U A;  2XLR A;  3CB3 A;  4ZCD A;  3DGH A;  2X50 A;  1MUC A;  2I5Q A;  2ZZC A;  3KD9 A;  1PJ5 A;  3ICR A;  1ZMC A;  4YSZ A;  3UJS A;  1LV0 A;  1RYI A;  3LXD A;  4U2S A;  1TRB A;  4XWZ A;  1JRZ A;  2XLT A;  4GDE A;  3AEF A;  2AL1 A;  1NG3 A;  4B67 A;  3ZDN A;  3DA1 A;  2W3S A;  4A6G A;  2ZZB A;  1QJD A;  4U2T A;  1KFY A;  3IJL A;  4DNA A;  1NHP A;  1E9I A;  3NYF A;  2P8B A;  3L1R A;  4Y4M A;  3DG6 A;  2AKM A;  3BNU A;  1FEA A;  1TDO A;  3UKA A;  2B9Y A;  2JK6 A;  3NTD A;  2PP1 A;  3S5S A;  4IT1 A;  5BOF A;  2BS2 A;  1REO A;  3N4E A;  2O56 A;  3ZLG A;  1UKV G;  3OTR A;  4X4J A;  2BA9 A;  1PBF A;  3A7A A;  2O9Z A;  3DK9 A;  3COX A;  2E5V A;  2GF3 A;  2YM1 A;  2HQM A;  3VC6 A;  2GGI A;  4CY6 A;  2YG6 A;  3DES A;  1V59 A;  1S2Y A;  3H7V A;  3KPK A;  1Q1R A;  4GYP A;  1YQ4 A;  2GQW A;  5KMS A;  1SJA A;  4EWJ A;  2B76 A;  1QLB A;  1LTX R;  2RAB A;  3DH9 A;  3TOY A;  3HYX A;  4UP3 A;  4LA1 A;  2WDQ A;  4HYR A; 
#chains in the Genus database with same CATH homology
 4WCT A;  2YAU A;  5KVH A;  3IHG A;  3CGD A;  3JSK A;  2C64 A;  1GRT A;  1GRE A;  2YLW A;  4NTC A;  1O95 A;  3T2K A;  3IWA A;  1PN0 A;  1TDK A;  3QSS A;  2BXS A;  1BZL A;  3AXB A;  4BJY A;  2C3D A;  1VDC A;  2JKC A;  4IA5 A;  3VR9 A;  2VRL A;  4A7A A;  2YLZ A;  2BS3 A;  3GYJ A;  4U8M A;  3NH3 X;  1H86 A;  2GR2 A;  4CY8 A;  4UDQ A;  1GOS A;  1CJ3 A;  1PS9 A;  1TDN A;  3AYI A;  3VRA A;  5HHF A;  2VRM A;  4I59 A;  3ALL A;  4M52 A;  4ZCC A;  3SGL A;  2V61 A;  1GXF A;  2TPR A;  1TDE A;  2YLS A;  2YVG A;  2WP6 A;  1CBO A;  3UKP A;  2YR5 A;  2C65 A;  2YVJ A;  2AQJ A;  3AED A;  2QA2 A;  4CCR A;  4EQR A;  2OLN A;  1NEK A;  2XLP A;  3CNT A;  3ICT A;  2UZZ A;  3GMC A;  4USR A;  3H8I A;  2YG3 A;  1D5T A;  4AT2 A;  1D4E A;  3AE2 A;  2X8C A;  3GDP A;  1QO8 A;  3NG7 X;  1CJ4 A;  3RHA A;  4DSG A;  4H4T A;  5M0Z A;  3QVR A;  1JRX A;  1IUT A;  3URH A;  2VZ2 A;  4K8D A;  1H7X A;  3UTH A;  3SZW A;  2GR0 A;  3V3N A;  2GMJ A;  2B7S A;  2CUL A;  3NHO X;  2R9Z A;  4RG4 A;  5FS8 A;  1CHU A;  1B8S A;  1KSS A;  3CN8 A;  5EB5 A;  1IUV A;  3QSE A;  2WOI A;  2R4E A;  3AE8 A;  2BC1 A;  2BK5 A;  4H4Z A;  2XFN A;  3D1C A;  2BC0 A;  3NK2 X;  4TLZ A;  2ZZ0 A;  1PBC A;  3CGB A;  3AEG A;  1JEH A;  4NZH A;  1PJ7 A;  2YM2 A;  3SYI A;  4CRT A;  1CC2 A;  3ATQ A;  1HYU A;  1DOE A;  2GR3 A;  1VRQ B;  3NK1 X;  3NRN A;  3P1W A;  4IVM B;  2GVC A;  2YLT A;  4J2W A;  3ALJ A;  1IJH A;  2QAE A;  2GEW A;  4GAP A;  3NYE A;  1VG0 A;  3P4R A;  3PS9 A;  4UDR A;  1DNC A;  1GEU A;  4H4U A;  5FS7 A;  2RGJ A;  1F6M A;  1TYP A;  2J3N A;  3IF9 A;  2JB1 A;  2PHH A;  5HYM A;  1E1L A;  3QFA A;  2YVF A;  4G6H A;  1H7W A;  4YXD A;  1JOA A;  2VVM A;  3I3L A;  4X9M A;  1GES A;  1CF3 A;  3NKS A;  3Q9T A;  4NTD A;  4UDP A;  2V3B A;  1X31 B;  2C66 A;  1KN0 A;  4YSX A;  4WX1 A;  3GD3 A;  3M12 A;  3DJD A;  2OAM A;  1FL2 A;  4ADW A;  1KNP A;  5JCN A;  1DJN A;  4P9S A;  5KNL A;  4U8P A;  3K7T A;  3H4K A;  1D7L A;  3PO7 A;  2WHD A;  4A99 A;  2FBW A;  4EMW A;  2GQF A;  4DSH A;  4H2P A;  3CNS A;  4NEW A;  1OJA A;  2GAH B;  4E0V A;  2XVI A;  4OPD A;  2AR8 A;  3BI5 A;  2CFY A;  3QVP A;  2WP9 A;  2C76 A;  4RSL A;  4H4Q A;  3D9X A;  2BYB A;  4Z24 A;  4G74 A;  3ZYX A;  3T2Z A;  3T0K A;  1F3P A;  2NPX A;  4TM3 A;  2ARD A;  1OJD A;  4HA6 A;  4KX6 A;  3GYX A;  3P4Q A;  4REK A;  3DK4 A;  1XHC A;  4JY3 A;  3SFD A;  4IV9 A;  1N4W A;  4B1B A;  3AEE A;  1DJQ A;  4A5L A;  1F8S A;  1CL0 A;  3DJG X;  1PBB A;  3SX6 A;  4A65 A;  4J33 A;  4AT0 A;  4Y4L A;  2WPE A;  1RP0 A;  2GAG B;  1IUX A;  4IA6 A;  1GET A;  1PXB A;  1E1N A;  2A89 A;  2DKH A;  2WEU A;  2XVJ A;  3NNE A;  4D03 A;  4H4S A;  1K0L A;  2W0H A;  3AD8 B;  1M64 A;  3G5R A;  3UKQ A;  4BJZ A;  2YLX A;  1JU2 A;  3NIX A;  2WES A;  4Z44 A;  3F8R A;  1LVL A;  2E4G A;  4Z26 A;  5EBK A;  1JRY A;  4EIP A;  2FJA A;  3T14 A;  2V60 A;  3KPF A;  1CJC A;  2YG5 A;  2C75 A;  3HZL A;  2XVE A;  4ECH A;  4KPR A;  3ICS A;  3UTF A;  3AE6 A;  3RNM A;  4U8K A;  1GRB A;  3KLJ A;  4JNA A;  3UTE A;  2YLR A;  3EF6 A;  1ELI A;  4JQ9 A;  3FIM B;  3AYJ A;  4Y4N A;  3AE4 A;  4U2L A;  4BUR A;  1K0J A;  1Q1W A;  1XAN A;  4JN9 A;  4O5U A;  2C67 A;  2C3C A;  1BGJ A;  3SZ0 A;  4CNJ A;  2QA1 A;  3UKF A;  5KMQ A;  3AEA A;  3IC9 A;  2B9W A;  5EB4 A;  3SY4 A;  4JDR A;  2BXR A;  5JCL A;  1Y56 B;  4U8J A;  2BCP A;  3LAD A;  4NEV A;  4XXG A;  2BK4 A;  5CQF A;  2FJE A;  5U63 A;  2RGH A;  2XVF A;  5KRQ A;  2Q6U A;  2B7R A;  3V3O A;  3ABV A;  1CC4 A;  4OCG A;  4YSH A;  1YY5 A;  2XVH A;  4H2R A;  1N4V A;  3UKH A;  1ZP0 A;  2EQ7 A;  2F5Z A;  2H88 A;  3LB8 A;  1L9D A;  4H2N A;  2IVD A;  3NYC A;  3AYL A;  5KOX A;  5JCI A;  4JY2 A;  4CNK A;  2NVK X;  2WP5 A;  1E7P A;  5BUK A;  3UP4 A;  3ISH A;  2Y6R A;  3FBS A;  2V5Z A;  3L8K A;  3E1T A;  1EL9 A;  3K30 A;  1L0V A;  3RP6 A;  1E1M A;  1GRH A;  1IUU A;  4APN A;  4NNJ A;  1ZMD A;  2BAB A;  4YTM A;  4Z2T A;  5U25 A;  1PDH A;  4A9W A;  1JNR A;  3SQP A;  3KU9 A;  2IVE A;  3NN6 X;  4GDP A;  5KXJ A;  1NHR A;  1K4Q A;  4J56 A;  1EL8 A;  2WU5 A;  3BI4 A;  3LJP A;  2GR1 A;  5IQ1 A;  2XFP A;  1NAA A;  3D8X A;  2ACZ A;  2Q7V A;  2XFO A;  4C77 A;  3CTY A;  4YTP A;  4C3Y A;  3SZC A;  4OPT A;  1AOG A;  3KVE A;  3CMM A;  1N1P A;  3CNP A;  4B69 A;  2EQ9 A;  2XDO A;  2VVL G;  4MJW A;  4EQS A;  3ALM A;  3SFE A;  4DGK A;  5KMR A;  2A8X A;  3C4N A;  1W4X A;  1GRG A;  3T2Y A;  3PVC A;  1EL5 A;  3NTA A;  2QCU A;  4FK1 C;  2I0Z A;  3C4A A;  1JNZ A;  4K22 A;  3AB1 A;  1YKJ A;  3ADA B;  3DJE A;  1OJ9 A;  2R0G A;  2GRT A;  4H4X A;  3FMW A;  3G5Q A;  3WE0 A;  3LZW A;  5FS6 A;  1F8W A;  4TLX A;  3O0H A;  5JCM A;  4K5S A;  1MOK A;  1COY A;  2OLO A;  3OZ2 A;  3P4P A;  1NDA A;  1DOC A;  3AWI A;  2AAQ A;  5GRT A;  4LII A;  5U1O A;  1H82 A;  1GV4 A;  1S3B A;  2YG4 A;  1P2E A;  2ZBW A;  5KOW A;  4D04 A;  1H2I A;  3GD4 A;  2CVJ A;  4AOS A;  1PBD A;  1IUW A;  2XLS A;  1EL7 A;  4GF7 A;  4YKG A;  2Z5X A;  1PBE A;  3QSM A;  2E1M A;  5EOW A;  3RP7 A;  3SXI A;  4CBQ A;  4C74 A;  2YG7 A;  4IVO B;  1N4U A;  3AEC A;  2BK3 A;  2C73 A;  3CPI G;  1LQT A;  1EBD A;  4TM4 A;  3DME A;  2TMD A;  2CDU A;  2WBA A;  4GUV A;  1Y56 A;  2WOW A;  1ZOV A;  2JAE A;  3AE5 A;  3QFB A;  4OPU A;  3GMB A;  3CIR A;  4A6N B;  4BK1 A;  4LU6 A;  2Q0K A;  3UCL A;  4H4R A;  4EM4 A;  3VR8 A;  2R4J A;  3L5O A;  2VQ7 A;  3AD9 B;  1OJT A;  2GB0 A;  2Q0L A;  2OA1 A;  2WPF A;  1RSG A;  1BKW A;  1DOB A;  1GT8 A;  5ER0 A;  2FJB A;  2XCG A;  4G9K A;  4EQW A;  1E39 A;  4AP1 A;  4JNQ A;  2V3A A;  1GAL A;  3ITJ A;  1O5W A;  4GR1 A;  1FEC A;  2VQB A;  4OPC A;  3SM8 A;  4A6N A;  4EQX A;  5C2T A;  3S61 A;  2V6O A;  4BK2 A;  4J34 A;  4RG3 A;  1ZOY A;  2WQY A;  2R46 A;  1CC6 A;  3NN0 X;  3KA7 A;  1IUS A;  1H84 A;  2R45 A;  4J36 A;  4Z2R A;  4U8L A;  4AP3 A;  1ZY8 A;  3AE3 A;  1GSN A;  2YR4 A;  1ZDL A;  4A79 A;  4G73 A;  5BUL A;  1S7M A;  4O5Q A;  5J60 A;  2APG A;  3DJJ A;  2X3N A;  4GRT A;  2BAC A;  5JRB A;  2BS4 A;  4K7Z A;  4EIQ A;  4I58 A;  5IQ4 A;  5KWF A;  1F8R A;  1Y0P A;  4Z25 A;  1S2Q A;  5HY5 A;  4K5R A;  4H4Y A;  4YWO A;  3P4S A;  1D7Y A;  3Q6J A;  4TM0 A;  3BI2 A;  1ZK7 A;  1PHH A;  5L46 A;  2FJD A;  2GH5 A;  2JB3 A;  2WOV A;  4GAV A;  5LV9 A;  4ICY A;  1OJC A;  3CNJ A;  3AD7 B;  1TYT A;  1M6I A;  4II3 A;  3II4 A;  1BWC A;  1NPX A;  3GSI A;  4PAB A;  1GTH A;  4EM3 A;  4OPI A;  1DOD A;  4C5O A;  4USQ A;  5HXI A;  4OPL A;  1PJ6 A;  1ZX9 A;  3R9U A;  3GYI A;  1BF3 A;  2PYX A;  2R0C A;  3DK8 A;  2XLR A;  3AEB A;  4ZCD A;  4H4W A;  2JB2 A;  3DGH A;  4PAA A;  2X50 A;  2ZZC A;  1KF6 A;  3BHK A;  3I6D A;  3UKL A;  3F8D A;  3VRB A;  2WU2 A;  3KD9 A;  3DGZ A;  3GWF A;  2XFQ A;  1PJ5 A;  3M0O A;  1GRF A;  2C72 A;  3ICR A;  3BHF A;  2C70 A;  4B68 A;  1ZMC A;  4H2Q A;  3NK0 X;  1XDI A;  1H6V A;  1D4C A;  1PXA A;  1S3E A;  2C7G A;  4X9N A;  4YSZ A;  1LV0 A;  1RYI A;  2DKI A;  2BRA A;  3LXD A;  2Y6Q A;  4U2S A;  1TRB A;  4XWZ A;  3LOV A;  1L9C A;  1JRZ A;  3G5S A;  4G6G A;  5IPY A;  2XLT A;  1KNR A;  4YT0 A;  4GDE A;  2X99 A;  1FEB A;  4H7U A;  1XPQ A;  1NEN A;  3AEF A;  3M13 A;  5BVA A;  1L9E A;  1MO9 A;  4Z2U A;  5KMP A;  1FOH A;  1NHQ A;  1KDG A;  4B66 A;  4EMJ A;  3CGC A;  5KVI A;  2IID A;  1NG3 A;  3NLC A;  3T31 A;  1Z6L A;  2XLU A;  3CPJ G;  5GSN A;  4B67 A;  2R0P A;  5JCK A;  2BCG G;  3ZDN A;  3DA1 A;  3H8L A;  3CPH G;  3GRS A;  4FDC B;  1TDF A;  2EQ8 A;  2GV8 A;  3NT6 A;  4HB9 A;  1MXT A;  2WDR A;  4C3X A;  2ZZB A;  2VVL A;  3S5W A;  1QJD A;  1D4D A;  3OC4 A;  1KFY A;  1VQW A;  4U2T A;  1H81 A;  4II2 A;  1YQZ A;  4DNA A;  1K0I A;  1NHP A;  3LZX A;  4N9X A;  5J7X A;  3NYF A;  1VG9 A;  2BRY A;  3VRD B;  3GWD A;  3AE7 A;  5M10 A;  2X8G A;  3T37 A;  1H83 A;  3KKJ A;  3L1R A;  4YKF A;  1DXL A;  2B9X A;  4Y4M A;  2JBV A;  4U8O A;  4FK1 A;  4NWZ A;  2OAL A;  4CCQ A;  2EQ6 A;  1SEZ A;  3BNU A;  1FEA A;  1TDO A;  3UKA A;  1FCD A;  1Q9I A;  3FPZ A;  2B9Y A;  3UOY A;  2JK6 A;  3NTD A;  4XWR A;  4J31 A;  2Z5Y A;  4FX9 A;  4J57 A;  4YSY A;  3GRT A;  3RED A;  3B6D A;  3GDN A;  4OVI A;  5CKU A;  2RGO A;  3ATR A;  1GER A;  1CJ2 A;  1REO A;  2BS2 A;  4U8I A;  3UOZ A;  4EMI A;  3BNM A;  1UKV G;  3UTG A;  5C3J A;  4X4J A;  4H50 A;  1LQU A;  2BA9 A;  3HYV A;  3NGC X;  3UOV A;  5FS9 A;  1PBF A;  2A87 A;  2WPC A;  5TR3 A;  1B37 A;  2H89 A;  2WDV A;  4YTN A;  1NG4 A;  1P2H A;  3K7M X;  3V76 A;  4ZN0 A;  4NTE A;  2O9Z A;  4U8N A;  3EAO A;  3RP8 A;  1B5Q A;  4TM1 A;  3DK9 A;  1O94 A;  3AE1 A;  3COX A;  2E5V A;  2GF3 A;  4OPG A;  2C4C A;  2YM1 A;  2XYO A;  3C96 A;  4Z43 A;  2HQM A;  5DBJ A;  1E6E A;  1NHS A;  2YR6 A;  3QJ4 A;  2WET A;  3AE9 A;  4GCM A;  1ONF A;  4CY6 A;  1LPF A;  2YG6 A;  5FMH A;  3EAN A;  1V59 A;  3UOX A;  4B63 A;  4H4P A;  3F8P A;  4H4V A;  1GRA A;  1BGN A;  1S2Y A;  3CND A;  3IHM A;  1B4V A;  2YWL A;  1GND A;  3KPK A;  1Q1R A;  3K7Q X;  2X8H A;  1GPE A;  1YQ4 A;  2GQW A;  5KMS A;  5BRT A;  4K2X A;  4AOX A;  2VOU A;  4BV6 A;  3UP5 A;  4B65 A;  3PG6 A;  2B76 A;  2YQU A;  2GMH A;  3EPT A;  3FG2 P;  3UKK A;  4B64 A;  1QLB A;  3VQR A;  3CGE A;  4BK3 A;  3P9U A;  1PXC A;  1KSU A;  1GTE A;  3B3R A;  1LTX R;  2RAB A;  3DH9 A;  1LJ1 A;  1YQ3 A;  3HYW A;  3SZF A;  1E1K A;  2WS3 A;  3HYX A;  4UP3 A;  1ZKQ A;  4LA1 A;  2WDQ A;  2XFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...