4FX9A

Structure of the pyrococcus horikoshii coa persulfide/polysulfide reductase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
444
structure length
442
Chain Sequence
MKKKVVIIGGGAAGMSAASRVKRLKPEWDVKVFEATEWVSHAPCGIPYVVEGLSTPDKLMYYPPEVFIKKRGIDLHLNAEVIEVDTGYVRVRGGEKSYEWDYLVFANGASPQVPAIEGVNLKGVFTADLPPDALAIREYMEKYKVENVVIIGGGYIGIEMAEAFAAQGKNVTMIVRGERVLRRSFDKEVTDILEEKLKKHVNLRLQEITMKIEGEERVEKVVTDAGEYKAELVILATGIKPNIELAKQLGVRIGETGAIWTNEKMQTSVENVYAAGDVAETRHVITGRRVWVPLAPAGNKMGYVAGSNIAGKELHFPGVLGTAVTKFMDVEIGKTGLTEMEALKEGYDVRTAFIKASTRPHYYPGGREIWLKGVVDNETNRLLGVQVVGSDILPRIDTAAAMLMAGFTTKDAFFTDLAYAPPFAPVWDPLIVLARVLKFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme A disulfide reductase
publication title Structure and substrate specificity of the pyrococcal coenzyme A disulfide reductases/polysulfide reductases (CoADR/Psr): implications for S(0)-based respiration and a sulfur-dependent antioxidant system in Pyrococcus.
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Oxidoreductase
total genus 113
structure length 442
sequence length 444
chains with identical sequence B
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2012-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4fx9A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fx9A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fx9A01
1X31B 5BVAA 1NHPA 4B69A 2B76A 3OC4A 4YWOA 1FL2A 1E39A 1YQ4A 3I3LA 4K22A 3UTGA 1L9CA 3NKSA 4H2RA 4TM3A 2H89A 1UKVG 4H4VA 3D8XA 2BACA 2GVCA 3REDA 1BGJA 2V60A 3GDNA 2H88A 3RNMA 2XLSA 2VQBA 1JOAA 2BK5A 1K0IA 3QSMA 4ICYA 4X4JA 3QSEA 2CFYA 4FDCB 1ZOVA 2FJEA 3BI4A 4EQRA 1DNCA 1IUXA 5DBJA 1RYIA 4OPGA 5CQFA 5EB5A 1S2YA 1FCDA 2IVEA 2VRLA 4B68A 1PJ5A 2Q6UA 1K4QA 4H4PA 1D7LA 4GCMA 4JY3A 1LQTA 2WOWA 3L8KA 1CJ3A 3R9UA 4CBQA 2NPXA 2FJAA 1IJHA 1ZX9A 2GB0A 5TR3A 2GR0A 4UDPA 4TM0A 3V3NA 3NYCA 5BULA 1GREA 3GMBA 4EIPA 4ZN0A 3D1CA 5ER0A 3LXDA 2A89A 1JNRA 3NH3X 4C74A 3UP4A 3CIRA 3RP6A 2XLPA 5M10A 3FPZA 4B65A 5LV9A 2WP6A 2XDOA 1CF3A 3ALLA 2YG3A 3SGLA 3GRSA 1KSSA 3UOVA 3ICSA 5EBKA 5EOWA 1GV4A 2ZZCA 4ZCDA 3AEGA 4B1BA 1PBEA 5J7XA 3EAOA 3BI5A 4Z44A 4YXDA 3AEAA 2XFOA 3CNDA 4JQ9A 1CC2A 1BF3A 2XLUA 4RSLA 3CGBA 4GF7A 3KA7A 4X9NA 4A65A 1NENA 3BHKA 4USQA 2VVLA 4GRTA 1LQUA 1OJCA 2FJBA 1PXBA 3GYJA 1KNPA 3NGCX 3UKQA 3ATRA 2DKIA 2Q7VA 4AP1A 2UZZA 3AE1A 3AE6A 3AE5A 2WOVA 4OPDA 1GRFA 1B8SA 2V3BA 2WP9A 1TDEA 2EQ9A 3CPJG 4IVOB 1XHCA 4H7UA 2WPFA 3V76A 4O5UA 1BZLA 4ZCCA 4WCTA 5C2TA 3SQPA 1F3PA 3EF6A 3AE2A 4IVMB 1F8RA 4Z43A 3UCLA 3NK1X 3UOZA 4IA5A 3OZ2A 2R0CA 3VRDB 3WE0A 4J33A 1OJ9A 4K5RA 1YKJA 2O9ZA 2X8CA 4H4TA 3EANA 3Q6JA 4GR1A 1CJ4A 2XVEA 3BNMA 3GMCA 3I6DA 3CNPA 2PHHA 4Y4NA 3UP5A 1EBDA 1GESA 3F8RA 4U2TA 3VR9A 4AOXA 1PXAA 3UTFA 5L46A 4EQXA 1FOHA 3K7QX 4A5LA 4GDEA 2A8XA 4YSXA 4C77A 3GD4A 3QSSA 1KF6A 3NIXA 4H4WA 4A6NA 1L9EA 4J2WA 4A9WA 4U8PA 4OVIA 1IUUA 4PABA 2C76A 2GQWA 3IWAA 2B7SA 2B9YA 1JNZA 2YR4A 5JCLA 1F8SA 2R4EA 1JRXA 2Z5XA 4BV6A 3CNJA 3P4QA 4LIIA 4O5QA 1EL8A 2R46A 4BJZA 1GPEA 2C73A 3AEEA 4J34A 1AOGA 4C3YA 3UKFA 1F8WA 2OLOA 3IHMA 3KU9A 5BRTA 3BHFA 3L1RA 2R0GA 3P1WA 4H2QA 3DJGX 2YLWA 3CPHG 1O5WA 4Z2UA 3AEFA 1Q1RA 4C5OA 3HZLA 4Y4MA 3ZDNA 3LZWA 1MXTA 1ZOYA 3CPIG 1Y56B 2BXSA 4U8OA 1LTXR 2F5ZA 3UKKA 3CNTA 2E4GA 4Y4LA 3ZYXA 4K5SA 3LB8A 1YQ3A 2ZBWA 4NTDA 4BK1A 3LOVA 4JY2A 2WDRA 4TM4A 4LA1A 3GYIA 1QJDA 3CTYA 2WQYA 4B67A 2AQJA 2E1MA 3GWFA 4U2LA 2NVKX 3C96A 2AAQA 1M6IA 1REOA 2IIDA 2JBVA 4CRTA 4DGKA 1TDNA 3LJPA 3EPTA 2ZZBA 4NTEA 3SFDA 4OPLA 1JRYA 2C64A 2B7RA 5FS6A 3KPFA 4EIQA 2GAHB 2QA1A 3C4AA 3URHA 2WETA 2APGA 2JB2A 2VVMA 2BC0A 2C3DA 4H4XA 5FS7A 2XVHA 2YG4A 4H2NA 1MOKA 3NT6A 5JCMA 2XFPA 4DSHA 1E1MA 2TPRA 2DKHA 2C72A 2Y6QA 1Y0PA 3QFBA 4EQSA 4UP3A 2WPEA 2X50A 3UTEA 4C3XA 2JB1A 4YSZA 4ECHA 1IUSA 3DK8A 4MJWA 4J56A 2BS4A 3GDPA 4H50A 1CJ2A 2BK3A 3KD9A 1K0LA 3II4A 1F6MA 1L9DA 2Q0LA 3CGCA 1HYUA 1D7YA 2YQUA 2R0PA 3VRAA 4BK3A 3Q9TA 2R4JA 4J36A 5JCIA 4EMIA 1P2EA 3K7TA 4NZHA 2BS2A 4CY8A 4TLXA 4CCRA 2CVJA 2C65A 3NLCA 4AT2A 3P9UA 3M12A 2GR3A 2YLZA 4NTCA 3K7MX 1GXFA 3AEBA 2YR6A 1Y56A 2HQMA 1W4XA 2X99A 3P4RA 4U8LA 1RP0A 4USRA 1KFYA 2WP5A 1GNDA 2GAGB 1O94A 4H4SA 1GTHA 1V59A 3DJJA 1O95A 2GR1A 1OJDA 3P4SA 3JSKA 4D03A 3KVEA 4CNJA 3O0HA 2WHDA 4YTMA 4IA6A 2C66A 3ATQA 3FBSA 1FECA 3NNEA 4I58A 2OLNA 1CBOA 2VOUA 1ZDLA 1KDGA 2Q0KA 2WDQA 2YM1A 1NG3A 3ALJA 5EB4A 4XXGA 2OALA 1CL0A 1YY5A 2C70A 4FX9A 3T37A 5U1OA 3AYLA 4EMJA 4KX6A 4H4QA 3QFAA 4B64A 3UKHA 1PDHA 1NPXA 1N4VA 1GALA 4K7ZA 1COYA 2YWLA 2V6OA 3PO7A 1EL5A 3VQRA 4EM3A 1PJ6A 1GRGA 4KPRA 2WPCA 3F8DA 4TM1A 4NEWA 4DSGA 2YVFA 4XWZA 4M52A 2XFUA 3ALMA 1H84A 1FEAA 4Z2TA 1MO9A 1CHUA 1DOCA 1GETA 2R45A 3S5WA 1GRHA 4JNAA 1GRTA 1Q1WA 1K0JA 2RGJA 4U8KA 5KOWA 4OPCA 4JN9A 2X8GA 2EQ7A 4JNQA 1ZY8A 3QJ4A 2BCGG 3NYFA 2YLSA 2WEUA 3UOYA 3DK4A 3DJEA 4YTPA 2GR2A 2I0ZA 3C4NA 3FMWA 4GDPA 1DJNA 1FEBA 3AXBA 3F8PA 4OPUA 1LV0A 1GSNA 1GTEA 3AB1A 2VRMA 5GRTA 2FJDA 5KRQA 2YG7A 3GWDA 3VR8A 5JCKA 2QAEA 3BNUA 3NTAA 1ONFA 3M13A 3PVCA 1DXLA 1QO8A 4U2SA 3SM8A 4H4RA 3NK0X 3AE4A 1BKWA 2GH5A 2WU5A 4PAAA 1PN0A 2RGHA 1S2QA 1PBDA 4YSYA 5IQ4A 2XLTA 2VVLG 3KKJA 5FS8A 5HHFA 4EMWA 3DMEA 1KNRA 1JEHA 2J3NA 1ZMDA 2GMJA 4EQWA 1S3BA 3G5RA 1GRBA 2GEWA 1H82A 1RSGA 5CKUA 1PJ7A 1VDCA 1D4EA 2V61A 3QVPA 2XVIA 2YG6A 1XANA 1NHRA 2ACZA 3CGDA 3AECA 3IF9A 4I59A 3GRTA 3IC9A 4H4ZA 3UOXA 1E7PA 5U63A 1LPFA 2OAMA 4BK2A 1ZK7A 3B3RA 4N9XA 4U8NA 1VRQB 3NHOX 5IQ1A 5KXJA 1NHSA 1PHHA 4CY6A 2C7GA 1XPQA 4OPTA 3LZXA 3NTDA 4GUVA 3UKAA 3GD3A 2EQ8A 4RG3A 1ZP0A 2YVJA 1H7WA 2V5ZA 1N4WA 4OPIA 5KVHA 1P2HA 2BABA 2C67A 4A79A 4Z2RA 4Z25A 4Z26A 1DOEA 4ADWA 1B37A 1CC6A 1PS9A 1BGNA 1PBBA 4A99A 2B9XA 4UDRA 1NEKA 1B5QA 3IHGA 3AD8B 5HXIA 4BJYA 1TDFA 4NEVA 1GEUA 2VZ2A 1CJCA 1CC4A 1DODA 2BC1A 2GQFA 1ELIA 1GERA 2ZZ0A 2CDUA 2QA2A 1L0VA 3AYIA 3KLJA 3AE7A 4EM4A 3AE8A 2W0HA 3NN6X 1IUTA 1PBCA 2BCPA 1VG0A 2B9WA 3DJDA 3H8IA 2YR5A 3GSIA 3P4PA 5FS9A 1EL7A 4A7AA 5BUKA 1YQZA 2EQ6A 4U8MA 3COXA 1NG4A 2A87A 4H2PA 2RGOA 1B4VA 2JKCA 3QVRA 1JRZA 4IV9A 1H7XA 2WBAA 3UKPA 2WDVA 1DOBA 3PS9A 4REKA 4A6NB 4YTNA 2QCUA 3AE9A 5KOXA 3DH9A 4YSHA 3H8LA 2RABA 1Q9IA 4RG4A 2YVGA 3E1TA 4XWRA 2XYOA 4J31A 5FMHA 1NAAA 2WU2A 1IUVA 4WX1A 2ARDA 1N4UA 4UDQA 5GSNA 1H81A 4B63A 2FBWA 4YKGA 2OA1A 2PYXA 2TMDA 1GT8A 2YLTA 4B66A 4JDRA 3G5SA 5J60A 2XFNA 3G5QA 2WESA 1LVLA 2GF3A 3NK2X 2GRTA 2C75A 1PXCA 2VQ7A 1N1PA 4YT0A 2BK4A 1TYPA 2XVFA 3DK9A 2Z5YA 3RP8A 3V3OA 1DJQA 2E5VA 4P9SA 1E1KA 1XDIA 4FK1A 2YLXA 2YAUA 4BURA 1NDAA 3AWIA 5HY5A 4YKFA 1D5TA 1TYTA 1Z6LA 4J57A 4AOSA 1ZMCA 1GRAA 3VRBA 3FIMB 4D04A 3ADAB 1TDOA 1OJAA 2JAEA 4HB9A 2XCGA 4U8IA 2IVDA 4CCQA 3ICRA 3ICTA 1SEZA 3DGZA 2V3AA 1LJ1A 1NHQA 1E1NA 1VQWA 4AT0A 3B6DA 2YM2A 3ISHA 3NRNA 3LADA 2CULA 2Y6RA 3DA1A 1PBFA 3ITJA 1TRBA 2GMHA 1D4CA 1QLBA 2BS3A 1IUWA 2YG5A 4TLZA 5JCNA 4DNAA 2WS3A 2R9ZA 3UTHA 4FK1C 1H86A 2XLRA 5HYMA 1ZKQA 4U8JA 2BYBA 1H83A 1EL9A 3H4KA 5IPYA 4K8DA 2JB3A 1H6VA 2C3CA 3RP7A 2BA9A 1E1LA 3M0OA 4H4YA 1D4DA 3CNSA 3NG7X 2GV8A 1BWCA 4OCGA 2YLRA 3AE3A 1OJTA 1E6EA 4E0VA 4AP3A 2X8HA 3UKLA 1M64A 3CGEA 2XVJA 3AD7B 4X9MA 3SFEA 2JK6A 2AR8A 4APNA 4K2XA 5M0ZA 3BI2A 3AYJA 2X3NA 4LU6A 3FG2P 3CN8A 3AD9B 3S61A 5C3JA 4HA6A 2WOIA 3NYEA 3RHAA 4Z24A 5KWFA 1GOSA 1KSUA 4H4UA 2XFQA 5KVIA 3NN0X 5U25A 3ABVA 3K30A 1VG9A 4CNKA 1JU2A 1TDKA 3AEDA 3DGHA 1S3EA 2BXRA
chains in the Genus database with same CATH superfamily
2B76A 3SY4A 1UKVG 4H4VA 3RNMA 2XLSA 2VQBA 4X4JA 3QSEA 1S2YA 4F4RA 3NVWB 4CBQA 2NPXA 2GB0A 2AL2A 3GMBA 3LXDA 3MZNA 3UP4A 3RP6A 2XLPA 3FPZA 2XDOA 3BJSA 3GRSA 1KSSA 3ICSA 4Z44A 4YXDA 3CNDA 4RSLA 1MUCA 3KA7A 4X9NA 4ROPA 3UCCA 3BHKA 4GRTA 2FJBA 3NGCX 3ATRA 3TJIA 4DYEA 1GRFA 2V3BA 2WP9A 3GD6A 2HXUA 1TDEA 3CPJG 4H7UA 4ZCCA 4WCTA 3AE2A 4DWDA 3UCLA 3UOZA 3WE0A 2C4CA 2X8CA 3Q6JA 1CJ4A 4Y4NA 3I6DA 2PHHA 3CT2A 3F8RA 1PXAA 3SX6A 3CK5A 2BRYA 3K7QX 2NQLA 4YSXA 4Z17A 4H4WA 4A6NA 4J2WA 4U8PA 2C76A 3IWAA 2B7SA 5JCLA 1H2IA 2R46A 2C73A 1AOGA 1JPMA 3UKFA 3UXLA 2OLOA 3DJGX 2XH0A 4Z2UA 4HNLA 4GFIA 1Q1RA 3VA8A 2XH4A 3LZWA 2PMQA 1LTXR 3ZYXA 1RVKA 4Y4LA 2PS2A 2WQYA 4B67A 3FV9A 2NVKX 3CXBA 2IIDA 3LJPA 5J04A 1JRYA 2C64A 2B7RA 3KPFA 2DW6A 3URHA 2APGA 2PSNA 4H4XA 4K8GA 1MOKA 2TPRA 2DKHA 2W55A 2PTZA 4UP3A 2WPEA 2JB1A 4ENLA 2BS4A 1CJ2A 1L9DA 4HPNA 2Q0LA 3VRAA 1D7YA 2R4JA 1P2EA 4AT2A 3NLCA 1RM6B 2GR3A 1Y56A 1W4XA 2X99A 1FIQB 1GNDA 2GAGB 4H4SA 1GTHA 1O95A 3NS1B 3H8AA 3O0HA 2WHDA 4YTMA 3FBSA 1FECA 2OLNA 3QN3A 4XXGA 1YY5A 3T14A 3NFUA 3QFAA 4B64A 1PDHA 1TE6A 1COYA 2YWLA 4MGGA 3PO7A 1EL5A 3F8DA 4NEWA 2XFUA 1MO9A 1MDRA 2OZ8A 3JZUA 3ZLHA 3SXIA 1K0JA 5KOWA 3QJ4A 3FVDA 2BCGG 3NYFA 2YLSA 3UOYA 3F8PA 1LV0A 3AB1A 5KRQA 3GWDA 3BNUA 3NTAA 4K1WA 3M13A 3T9PA 4GGBA 2PP1A 3DG6A 2QGYA 1PN0A 2RGHA 1PBDA 3VCNA 2J3NA 2PCEA 1H82A 2OZ3A 3AECA 4H4ZA 3ZLFA 3B3RA 4N9XA 5IQ1A 5KXJA 1NHSA 2C7GA 1XPQA 4GUVA 3GD3A 1ZP0A 1H7WA 1N4WA 4Z2RA 4A79A 4G73A 1TDFA 4NEVA 1CC4A 2P3ZA 1GERA 1L0VA 2PP3A 2QVHA 3H8IA 3GSIA 4X2PA 3IK4A 4H2PA 1EBGA 3PS9A 3T4WA 2QCUA 3AE9A 3H8LA 1Q9IA 4RG4A 1DTNA 3E1TA 3GO2A 5FMHA 4WX1A 2XH2A 2ARDA 1N4UA 1H81A 4B63A 2FBWA 4YKGA 5J60A 3RO6A 3TOYA 2GF3A 2GRTA 3UGVA 3DDMA 1PXCA 3V3OA 1MNSA 2YLXA 2YAUA 4BURA 3T8QA 1Z6LA 4D04A 3MKCA 3ADAB 2OO6A 3ICRA 3RRAA 3KPKA 1SEZA 3SN4A 2YM2A 3U4FA 3ITJA 2BS3A 5JCNA 3V3WA 4FK1C 3VC6A 1H86A 3N6JA 4K8DA 2BA9A 3M0OA 3VCCA 3CNSA 3T6CA 3FCPA 1JDFA 4OCGA 2YLRA 3DG7A 3AE3A 1OJTA 1WUEA 1M64A 3AMZA 3AD7B 3UJ2A 1EC8A 3RITA 3BI2A 4LU6A 3CN8A 3AD9B 4II3A 4HA6A 3NYEA 1KSUA 3NN0X 5KVIA 5U25A 3K30A 4CNKA 2DW7A 3OC4A 3I3LA 1E39A 4KPLA 1X2HA 1K0IA 3QSMA 2CFYA 4FDCB 3TJ4A 1ZOVA 2FJEA 4E4FA 3BI4A 1OEPA 1KD0A 1RYIA 4OPGA 5CQFA 5EB5A 2VRLA 1PJ5A 2Q6UA 1D7LA 2QDEA 1LQTA 2WOWA 1CJ3A 3SZ0A 2P88A 1MDLA 4UDPA 5G5HB 5BULA 5JRBA 1GREA 3THUA 5M10A 4B65A 1TZZA 1CF3A 3ALLA 3SGLA 3DGBA 4B1BA 5J7XA 3BI5A 1XS2A 3SR6B 3AEAA 2XFOA 4JQ9A 3D47A 1BF3A 3CGBA 4GF7A 4A65A 1NENA 2QDDA 3T2ZA 1PXBA 4AP1A 2OVLA 3AE5A 2WOVA 3SZFA 4G74A 3EF6A 4Z43A 3ES7A 3NK1X 3CB3A 3I6EA 4J1OA 3UJRA 2R0CA 3OZ2A 4J33A 1SJAA 1OJ9A 2O9ZA 3EANA 3GMCA 2XVEA 4DN1A 3UP5A 1EBDA 3VR9A 4AOXA 3UTFA 5L46A 4C77A 1KKRA 1L9EA 4OVIA 2B9YA 2YR4A 1F8SA 1JRXA 4O5QA 4BJZA 3ZLGA 3AEEA 4J34A 4C3YA 3P0WA 1F8WA 4MMWA 3KU9A 5BRTA 3P1WA 2YLWA 3R25A 4Y4MA 1MXTA 1ZOYA 3CPIG 1Y56B 2I5QA 3CAWA 3LOVA 4K2SA 2WDRA 3HYWA 4LA1A 3CTYA 2GGJA 1T3QC 2AQJA 2GDQA 2ZZBA 4NTEA 3NVZB 5FS6A 4EIQA 3C4AA 2WETA 3BOXA 2VVMA 2C3DA 3UXKA 5FS7A 2XVHA 2YG4A 1N5WC 2XFPA 3QFBA 4HCHA 5KNLA 2O56A 3KD9A 3UJFA 3II4A 1F6MA 2PODA 1HYUA 4BK3A 4E5TA 4CY8A 5JCIA 4NZHA 2BS2A 3DEQA 1GXFA 3AEBA 2HQMA 3P4RA 1RP0A 4USRA 1P48A 1KFYA 1O94A 1BKHA 3DJJA 4IZGA 2XSXA 4CNJA 2C66A 1CBOA 1ZDLA 2Q0KA 2WDQA 3ALJA 5EB4A 4FX9A 4EMJA 4KX6A 3PG6A 1GALA 4K7ZA 2V6OA 5KMPA 4EM3A 1GRGA 2WPCA 4TM1A 1ECQA 4M52A 4GAPA 5FJOA 2PPGA 2OQYA 3PWIA 1CHUA 1DOCA 1GRTA 4U8KA 3MQTA 1ZY8A 3Q45A 4YTPA 2I0ZA 3C4NA 3FMWA 4GDPA 1DJNA 3AXBA 2P0IA 1GTEA 2VRMA 2YG7A 1DXLA 2MUCA 4PAAA 1S2QA 4YSYA 3KKJA 5FS8A 4HNCA 3G5RA 3V5FA 4EQWA 1RSGA 3R07C 3QVPA 4G7FA 2ACZA 2OFJA 3CGDA 3GRTA 3UOXA 1PHHA 3LZXA 3NTDA 2QJNA 2EQ8A 4GGHA 2BABA 2GGEA 4Z26A 3R0KA 1MRAA 3R10A 4UDRA 3NRZB 2OQHA 5FJPA 5HXIA 4BJYA 2AKMA 2VZ2A 1CJCA 2GQFA 2ZZ0A 1N60C 2CDUA 4H2HA 3AE8A 1IYXA 2W0HA 3NN6X 2BCPA 2GSHA 2B9WA 3P4PA 5FS9A 1EL7A 3CYJA 1YQZA 4U8MA 3HYVA 1NG4A 2RGOA 3OZMA 2JKCA 1H7XA 2WBAA 3UKPA 2WDVA 1DOBA 4REKA 4YTNA 3PFRA 1N61C 4XWRA 2XYOA 2P8CA 4J31A 4H1ZA 4UDQA 2OA1A 2PYXA 1GT8A 2YLTA 3G5SA 3N4EA 3DK9A 2Z5YA 3RP8A 1DJQA 2E5VA 4YWSA 3K1GA 1D5TA 4G6HA 3FIMB 1OJAA 4HB9A 3MY9A 5G5GB 3ICTA 1LJ1A 1E1NA 3B6DA 4G8TA 3ZVHB 3TTEA 3LADA 2Y6RA 4FI4A 1PBFA 4GYPC 1D4CA 1QLBA 2YG5A 4TLZA 1SJDA 2R9ZA 3MWCA 2XLRA 1H83A 3H4KA 3OZYA 2JB3A 3TWBA 2XGZA 2OX4A 2AKZA 2P8BA 4TVWA 1D4DA 2GV8A 1BWCA 2HXTA 2X8HA 3UKLA 3I4KA 1VDVA 3AYJA 3S61A 5C3JA 2WOIA 4H4UA 1JU2A 1S3EA 2BXRA 1X31B 1NHPA 4B69A 3ENLA 4YWOA 4K22A 1YQ4A 1L9CA 3GYXA 4TM3A 3D8XA 2GVCA 3REDA 3RR1A 3GDNA 4ICYA 1TKKA 4EQRA 1IUXA 1FCDA 4B68A 4H4PA 1STZA 2PU0A 3RCYA 5TR3A 2GR0A 3QPEA 4TM0A 3NYCA 1WYGA 1XPYA 4EIPA 3HPFA 5ER0A 1X2GA 3NO1A 3B97A 3CXOA 5LV9A 2WP6A 2YG3A 3B9JB 3NXLA 2MNRA 4ZCDA 3AEGA 1PBEA 3H7VA 1VQZA 1CC2A 2XLUA 3S5SA 4Z1YA 2W3SA 2VVLA 1LQUA 3GYJA 5KMQA 2DKIA 2Q7VA 3N4FA 3PK7A 2UZZA 1B8SA 1FFVC 2EQ9A 4O5UA 1BZLA 2W3RA 3SQPA 4IVMB 4IA5A 3VRDB 1YKJA 4GR1A 3CNPA 2GL5A 1GESA 4U2TA 4H83A 4A5LA 1YEYA 2A8XA 4DHGA 1PDYA 3GD4A 3NIXA 3VDGA 4A9WA 1IUUA 4PABA 2OKTA 1JNZA 4LIIA 2PGEA 1GPEA 3BHFA 3L1RA 3EKGA 2R0GA 4H2QA 3CPHG 3P3BA 3T31A 3AEFA 2QJJA 4HCLA 1WUFA 2BXSA 3QLDA 4U8OA 2F5ZA 5FJUA 2E4GA 4NTDA 4BK1A 4JY2A 1QJDA 3GWFA 4U2LA 1JRPA 2AAQA 1M6IA 3OW1A 1FHUA 4NNJA 4CRTA 3FYYA 3ZVHA 1NU5A 4OPLA 1FO4A 3VFCA 3NT6A 5JCMA 4DSHA 1E1MA 2C72A 2Y6QA 1Y0PA 4A6GA 4C3XA 4ECHA 3KUMA 3CMMA 3GDPA 4H50A 3CGCA 3SYIA 2R0PA 3Q9TA 4CCRA 2CVJA 2C65A 2HNEA 3Q4DA 3M12A 4M6UA 2YLZA 3K7MX 2E3TA 2PTWA 1V59A 2QQ6A 1P43A 1OJDA 3P4SA 3KVEA 3NNEA 4I58A 3D46A 2VOUA 1KDGA 2YM1A 3OPSA 2C70A 3T37A 4DX3A 2AL1A 5U1OA 3AYLA 3PWGA 4H4QA 4IT1A 2FYMA 1SJCA 3T0KA 3T2YA 3VQRA 1PJ6A 4KPRA 1ELSA 3DESA 5BOFA 3ALMA 1H84A 1FEAA 3U9IA 1GETA 3S5WA 1GRHA 5FJTA 4KT2A 2RGJA 2EQ7A 4JNQA 4JHMA 3DJEA 2GR2A 4HCDA 1GSNA 3STPA 7ENLA 5GRTA 2FJDA 3VR8A 5JCKA 2QAEA 1ONFA 5KMSA 3PVCA 4U2SA 3AE4A 1BKWA 3DERA 5IQ4A 1ONEA 3UJEA 3ZVIA 3P93A 2VVLG 2XLTA 3DMEA 4IL0A 1ZMDA 4E6MA 2GEWA 5CKUA 2V61A 3TQPA 2XVIA 4FP1A 2YG6A 1ZXIC 3IF9A 4I59A 3IC9A 4JN7A 5U63A 1LPFA 3NHOX 3T2KA 4RG3A 4OPIA 1P2HA 2PGWA 1DOEA 4ADWA 1B37A 3L5OA 3A7AA 1BGNA 1CC6A 1PBBA 1B5QA 3IHGA 1GEUA 1KN0A 2BC1A 4IP5A 1ELIA 3JW7A 3UCDA 2QA2A 3AYIA 3KLJA 1IUTA 1PBCA 3DJDA 4ZOHB 2YR5A 5BUKA 2EQ6A 4J3ZA 3COXA 1FHVA 3QVRA 4YSHA 3DIPA 2YVGA 6ENLA 4G9KA 4NWZA 1FFUC 2GGHA 5IDZA 5GSNA 4B66A 4JDRA 2XFNA 5FJRA 2VQ7A 3DFYA 4YT0A 2BK4A 1TYPA 1XDIA 4FK1A 4A3RA 3S47A 3AWIA 1NDAA 1TYTA 4J57A 1ZMCA 1GRAA 2ONEA 3VRBA 3FXGA 4H19A 3DFHA 2JAEA 4CCQA 3SQSA 3DGZA 4GAVA 1VQWA 4AT0A 3ISHA 3NRNA 2CULA 3DA1A 1IUWA 2WS3A 5HYMA 1ZKQA 4U8JA 2BYBA 2C3CA 1E1LA 4A35A 1R0MA 4AP3A 2PA6A 3CGEA 2XVJA 4X9MA 3SFEA 2AR8A 4K2XA 2X3NA 3RHAA 4Z24A 5EU9A 1VG9A 2A89A 5BVAA 1FL2A 3EEZA 3UTGA 3NKSA 4H2RA 2H89A 2BACA 4IL2A 1BGJA 2V60A 2H88A 2ZC8A 4HYRA 1JOAA 2BK5A 2OLAA 1EC9A 1DNCA 5DBJA 2IVEA 3OTRA 1K4QA 4GCMA 4JY3A 3L8KA 3R9UA 2FJAA 1IJHA 1ZX9A 3V3NA 4ZN0A 3D1CA 1JNRA 3NH3X 4C74A 3A7UA 3CIRA 2CHRA 3AN1A 5KMRA 2QJMA 3UOVA 3AM9A 5EBKA 5EOWA 1GV4A 2ZZCA 2POZA 3EAOA 3DG3A 4EWJA 4USQA 1SB3B 1OJCA 1KNPA 3UKQA 3AE1A 3AE6A 4OPDA 4IVOB 1XHCA 2WPFA 5C2TA 1F3PA 3QTPA 1F8RA 3I6TA 4K5RA 4H4TA 3V76A 3BNMA 4II2A 4EQXA 1FOHA 4GDEA 3ETRB 2PTXA 3QSSA 2E5AA 1KF6A 1V97A 2GQWA 2R4EA 2Z5XA 4BV6A 3CNJA 3P4QA 1EL8A 1JPDX 3IJQA 3IJLA 3SZWA 3IHMA 1O5WA 3GY1A 1JCTA 4C5OA 3HZLA 3ZDNA 1KKOA 3BSMA 1BQGA 3UKKA 3CNTA 4K5SA 3LB8A 1YQ3A 2ZBWA 4TM4A 3GYIA 3HRDC 4TVYA 2E1MA 3SN1A 3C96A 1REOA 4MKSA 2JBVA 2OG9A 4DGKA 1TDNA 1PDZA 3EPTA 3SJNA 3SFDA 2GAHB 2QA1A 1EC7A 4KEMA 2JB2A 4HN8A 2BC0A 4H2NA 2RDXA 3VC5A 3MSYA 4EQSA 2X50A 3UTEA 4YSZA 4M0XA 1IUSA 3DK8A 4MJWA 2HZGA 4J56A 2BK3A 1K0LA 2YQUA 4J36A 3K7TA 4EMIA 2PP0A 4TLXA 3P9UA 4NTCA 3FJ4A 2YR6A 1EBHA 3IJIA 4U8LA 4IHCA 2WP5A 2OZTA 1E9IA 2GR1A 4D03A 3JSKA 4IP4A 4IA6A 3ATQA 4ZA0A 1NG3A 3UJSA 2OALA 1CL0A 3UKHA 3ES8A 1NPXA 1N4VA 2ZADA 1F9CA 3R0UA 4DSGA 3SBFA 2YVFA 4XWZA 4G6GA 4Z2TA 4GIRA 2R45A 1L8PA 4JNAA 1Q1WA 4OPCA 3TCSA 2X8GA 4JN9A 4JN8A 2WEUA 3DK4A 1FEBA 2FKPA 4OPUA 3EUB3 2AL2B 1N62C 3H12A 1QO8A 2GGIA 3SM8A 4H4RA 3NK0X 2WU5A 2GH5A 3MUCA 5HHFA 2W54A 4EMWA 3QKEA 2BRAA 1KNRA 1JEHA 2GMJA 1S3BA 1N5XA 1GRBA 4GISA 1PJ7A 1VDCA 1D4EA 1XANA 1NHRA 1E7PA 2OAMA 4BK2A 1ZK7A 3R1ZA 4U8NA 2OPJA 1VRQB 1KCZA 4CY6A 4OPTA 3UKAA 2YVJA 2V5ZA 5KVHA 2C67A 4Z25A 1PS9A 1W6TA 4A99A 2B9XA 1NEKA 3GC2A 3AD8B 1JROA 3V4BA 1DODA 4E4UA 3AE7A 4EM4A 1VG0A 4A7AA 2A87A 1B4VA 3V5CA 1JRZA 4IV9A 4A6NB 5KOXA 3DH9A 2RABA 5ENLA 4E8GA 1NAAA 2WU2A 1IUVA 3N6HA 4ZCWA 3NVYB 3HW2A 2TMDA 3G5QA 2WESA 3NVVB 1LVLA 3NK2X 2C75A 1N1PA 4DXKA 3JVAA 2XVFA 4GYPA 4P9SA 1R6WA 1E1KA 4GMEA 5HY5A 4YKFA 1SJBA 4AOSA 3SZCA 1TDOA 3RGTA 2XCGA 3D9XA 4U8IA 2PU1A 2IVDA 3SN0A 3TWAA 2V3AA 1NHQA 1S7MA 3OP2A 1N63C 3HYXA 1TRBA 2GMHA 4DNAA 3R11A 3UTHA 1EL9A 5IPYA 3NZGA 3RP7A 1H6VA 5BOEA 2PTYA 2GGGA 4H4YA 3NG7X 3SSZA 1E6EA 4E0VA 3TW9A 4KWSA 2JK6A 1NELA 2XH7A 3H70A 4APNA 5M0ZA 3FG2P 5KWFA 1GOSA 2XFQA 3A7RA 3ABVA 1TDKA 3AEDA 3DGHA
chains in the Genus database with same CATH topology
1X31B 5BVAA 1NHPA 4B69A 2B76A 3OC4A 4YWOA 1FL2A 1E39A 1YQ4A 3I3LA 4K22A 3UTGA 1L9CA 3GYXA 3NKSA 4H2RA 4TM3A 2H89A 3SY4A 1UKVG 4H4VA 3D8XA 2BACA 2GVCA 3REDA 1BGJA 2V60A 3GDNA 2H88A 3RNMA 2XLSA 2VQBA 1JOAA 2BK5A 1K0IA 3QSMA 4ICYA 4X4JA 3QSEA 2CFYA 4FDCB 1ZOVA 2FJEA 3BI4A 4EQRA 1DNCA 1IUXA 5DBJA 1RYIA 4OPGA 5CQFA 5EB5A 1S2YA 1FCDA 2IVEA 2VRLA 4B68A 1PJ5A 2Q6UA 1K4QA 4H4PA 1D7LA 4GCMA 4JY3A 1LQTA 2WOWA 3L8KA 1CJ3A 3R9UA 4CBQA 2NPXA 3SZ0A 2FJAA 1IJHA 1ZX9A 2GB0A 5TR3A 2GR0A 4UDPA 4TM0A 3V3NA 3NYCA 5BULA 5JRBA 1GREA 3GMBA 4EIPA 4ZN0A 3D1CA 5ER0A 3LXDA 2A89A 1JNRA 3NH3X 4C74A 3UP4A 3CIRA 3RP6A 2XLPA 5KMRA 5M10A 3FPZA 4B65A 5LV9A 2WP6A 2XDOA 1CF3A 3ALLA 2YG3A 3SGLA 3GRSA 1KSSA 3UOVA 3ICSA 5EBKA 5EOWA 1GV4A 2ZZCA 4ZCDA 3AEGA 4B1BA 1PBEA 5J7XA 3EAOA 3BI5A 4Z44A 4YXDA 3AEAA 2XFOA 3CNDA 4JQ9A 1CC2A 1BF3A 2XLUA 4RSLA 3CGBA 4GF7A 3KA7A 4X9NA 4A65A 1NENA 3BHKA 4USQA 2VVLA 4GRTA 1LQUA 3T2ZA 1OJCA 2FJBA 1PXBA 3GYJA 1KNPA 3NGCX 5KMQA 3ATRA 2DKIA 3UKQA 2Q7VA 4AP1A 2UZZA 3AE1A 3AE6A 3AE5A 2WOVA 4OPDA 1GRFA 1B8SA 2V3BA 2WP9A 1TDEA 2EQ9A 3CPJG 4IVOB 1XHCA 3SZFA 4H7UA 2WPFA 3V76A 4O5UA 1BZLA 4ZCCA 4WCTA 4G74A 5C2TA 3SQPA 1F3PA 3EF6A 3AE2A 4IVMB 1F8RA 4Z43A 3UCLA 3NK1X 3UOZA 4IA5A 3OZ2A 2R0CA 3VRDB 3WE0A 4J33A 2C4CA 1OJ9A 4K5RA 1YKJA 2O9ZA 2X8CA 4H4TA 3EANA 3Q6JA 4GR1A 1CJ4A 2XVEA 3BNMA 3GMCA 3I6DA 3CNPA 2PHHA 4Y4NA 3UP5A 1EBDA 1GESA 3F8RA 4U2TA 3VR9A 4AOXA 1PXAA 3UTFA 3SX6A 4II2A 5L46A 4EQXA 1FOHA 2BRYA 3K7QX 4A5LA 4GDEA 2A8XA 4YSXA 4C77A 3GD4A 3QSSA 1KF6A 3NIXA 4H4WA 4A6NA 1L9EA 4J2WA 4A9WA 4U8PA 4OVIA 1IUUA 4PABA 2C76A 2GQWA 3IWAA 2B7SA 2B9YA 1JNZA 2YR4A 5JCLA 1F8SA 2R4EA 1JRXA 2Z5XA 1H2IA 4BV6A 3CNJA 3P4QA 4LIIA 4O5QA 1EL8A 2R46A 4BJZA 1GPEA 2C73A 3AEEA 4J34A 1AOGA 4C3YA 3UKFA 1F8WA 2OLOA 3SZWA 3IHMA 3KU9A 5BRTA 3BHFA 3L1RA 2R0GA 3P1WA 4H2QA 3DJGX 2YLWA 3CPHG 1O5WA 4Z2UA 3T31A 3AEFA 1Q1RA 4C5OA 3HZLA 4Y4MA 3ZDNA 3LZWA 1MXTA 1ZOYA 3CPIG 1Y56B 2BXSA 4U8OA 1LTXR 2F5ZA 3UKKA 3CNTA 2E4GA 4Y4LA 3ZYXA 4K5SA 3LB8A 1YQ3A 2ZBWA 4NTDA 4BK1A 3LOVA 4JY2A 2WDRA 3HYWA 4LA1A 4TM4A 3GYIA 1QJDA 3CTYA 2WQYA 4B67A 2AQJA 2E1MA 3GWFA 4U2LA 2NVKX 3C96A 2AAQA 1M6IA 1REOA 2IIDA 2JBVA 4NNJA 4CRTA 4DGKA 1TDNA 3LJPA 3EPTA 2ZZBA 4NTEA 3SFDA 4OPLA 1JRYA 2C64A 2B7RA 5FS6A 3KPFA 4EIQA 2GAHB 2QA1A 3C4AA 3URHA 2WETA 2APGA 2JB2A 2VVMA 2BC0A 2C3DA 4H4XA 5FS7A 2XVHA 2YG4A 4H2NA 1MOKA 3NT6A 5JCMA 2XFPA 4DSHA 1E1MA 2TPRA 2DKHA 2C72A 2Y6QA 1Y0PA 3QFBA 4EQSA 4UP3A 2WPEA 2X50A 3UTEA 4C3XA 2JB1A 4YSZA 4ECHA 1IUSA 3DK8A 4MJWA 5KNLA 4J56A 3CMMA 2BS4A 3GDPA 4H50A 1CJ2A 2BK3A 3KD9A 1K0LA 3II4A 1F6MA 1L9DA 2Q0LA 3CGCA 1HYUA 1D7YA 2YQUA 2R0PA 3SYIA 3VRAA 4BK3A 3Q9TA 2R4JA 4J36A 5JCIA 4EMIA 1P2EA 3K7TA 4NZHA 2BS2A 4CY8A 4TLXA 4CCRA 2CVJA 2C65A 3NLCA 4AT2A 3P9UA 3M12A 2GR3A 2YLZA 4NTCA 3K7MX 1GXFA 3AEBA 2YR6A 1Y56A 2HQMA 1W4XA 2X99A 3P4RA 4U8LA 1RP0A 4USRA 1KFYA 2WP5A 1GNDA 2GAGB 1O94A 4H4SA 1GTHA 1V59A 3DJJA 1O95A 2GR1A 1OJDA 3P4SA 3JSKA 4D03A 3KVEA 4CNJA 3O0HA 2WHDA 4YTMA 4IA6A 2C66A 3ATQA 3FBSA 1FECA 3NNEA 4I58A 2OLNA 1CBOA 2VOUA 1ZDLA 1KDGA 2Q0KA 2WDQA 2YM1A 1NG3A 3ALJA 5EB4A 4XXGA 2OALA 1CL0A 1YY5A 2C70A 4FX9A 3T37A 5U1OA 3AYLA 4EMJA 4KX6A 3PG6A 4H4QA 3T14A 3QFAA 4B64A 3UKHA 1PDHA 1NPXA 1N4VA 3T0KA 1GALA 4K7ZA 1COYA 2YWLA 3T2YA 2V6OA 3PO7A 1EL5A 3VQRA 5KMPA 4EM3A 1PJ6A 1GRGA 4KPRA 2WPCA 3F8DA 4TM1A 4NEWA 4DSGA 2YVFA 4XWZA 4M52A 2XFUA 3ALMA 4G6GA 1H84A 1FEAA 4GAPA 4Z2TA 1MO9A 1CHUA 1DOCA 1GETA 2R45A 3S5WA 1GRHA 4JNAA 1GRTA 1Q1WA 3SXIA 1K0JA 2RGJA 4U8KA 5KOWA 4OPCA 4JN9A 2X8GA 2EQ7A 4JNQA 1ZY8A 3QJ4A 2BCGG 3NYFA 2YLSA 2WEUA 3UOYA 3DK4A 3DJEA 4YTPA 2GR2A 2I0ZA 3C4NA 3FMWA 4GDPA 1DJNA 1FEBA 3AXBA 3F8PA 4OPUA 1LV0A 1GSNA 1GTEA 3AB1A 2VRMA 5GRTA 2FJDA 5KRQA 2YG7A 3GWDA 3VR8A 5JCKA 2QAEA 3BNUA 3NTAA 1ONFA 5KMSA 3M13A 3PVCA 1DXLA 1QO8A 4U2SA 3SM8A 4H4RA 3NK0X 3AE4A 1BKWA 2GH5A 2WU5A 4PAAA 1PN0A 2RGHA 1S2QA 1PBDA 4YSYA 5IQ4A 2XLTA 2VVLG 3KKJA 5FS8A 5HHFA 4EMWA 3DMEA 2BRAA 1KNRA 1JEHA 2J3NA 1ZMDA 2GMJA 4EQWA 1S3BA 3G5RA 1GRBA 2GEWA 1H82A 1RSGA 5CKUA 1PJ7A 1VDCA 1D4EA 2V61A 3QVPA 2XVIA 2YG6A 1XANA 1NHRA 2ACZA 3CGDA 3AECA 3IF9A 4I59A 3GRTA 3IC9A 4H4ZA 3UOXA 1E7PA 5U63A 1LPFA 2OAMA 4BK2A 1ZK7A 3B3RA 4N9XA 4U8NA 1VRQB 3NHOX 5IQ1A 5KXJA 1NHSA 1PHHA 4CY6A 2C7GA 3T2KA 1XPQA 4OPTA 3LZXA 3NTDA 4GUVA 3UKAA 3GD3A 2EQ8A 4RG3A 1ZP0A 2YVJA 1H7WA 2V5ZA 1N4WA 4OPIA 5KVHA 1P2HA 2BABA 2C67A 4A79A 4Z2RA 4Z25A 4Z26A 1DOEA 4ADWA 1B37A 3L5OA 1CC6A 1BGNA 1PS9A 1PBBA 4A99A 2B9XA 4UDRA 1NEKA 1B5QA 3IHGA 3AD8B 5HXIA 4G73A 4BJYA 1TDFA 4NEVA 1GEUA 1KN0A 2VZ2A 1CJCA 1CC4A 1DODA 2BC1A 2GQFA 1ELIA 1GERA 2ZZ0A 2CDUA 2QA2A 1L0VA 3AYIA 3KLJA 3AE7A 4EM4A 3AE8A 2W0HA 3NN6X 1IUTA 1PBCA 2BCPA 1VG0A 2B9WA 3DJDA 3H8IA 2YR5A 3GSIA 3P4PA 5FS9A 1EL7A 4A7AA 5BUKA 1YQZA 2EQ6A 4U8MA 3HYVA 3COXA 1NG4A 2A87A 4H2PA 2RGOA 1B4VA 2JKCA 3QVRA 1JRZA 4IV9A 1H7XA 2WBAA 3UKPA 2WDVA 1DOBA 3PS9A 4REKA 4A6NB 4YTNA 2QCUA 3AE9A 5KOXA 3DH9A 4YSHA 3H8LA 2RABA 1Q9IA 4RG4A 2YVGA 3E1TA 4XWRA 2XYOA 4G9KA 5FMHA 4J31A 1NAAA 4NWZA 2WU2A 1IUVA 4WX1A 2ARDA 1N4UA 4UDQA 5GSNA 1H81A 4B63A 2FBWA 4YKGA 2OA1A 2PYXA 2TMDA 1GT8A 2YLTA 4B66A 4JDRA 3G5SA 5J60A 2XFNA 3G5QA 2WESA 1LVLA 2GF3A 3NK2X 2GRTA 2C75A 1PXCA 2VQ7A 1N1PA 4YT0A 2BK4A 1TYPA 2XVFA 3DK9A 2Z5YA 3RP8A 3V3OA 1DJQA 2E5VA 4P9SA 1E1KA 1XDIA 4FK1A 2YLXA 2YAUA 4BURA 1NDAA 3AWIA 5HY5A 4YKFA 4G6HA 1D5TA 1TYTA 1Z6LA 4J57A 4AOSA 1ZMCA 3SZCA 1GRAA 3VRBA 3FIMB 4D04A 3ADAB 1TDOA 1OJAA 2JAEA 4HB9A 2XCGA 3D9XA 4U8IA 2IVDA 4CCQA 3ICRA 3ICTA 3KPKA 1SEZA 3DGZA 4GAVA 2V3AA 1LJ1A 1NHQA 1E1NA 1VQWA 4AT0A 1S7MA 3B6DA 2YM2A 3ISHA 3NRNA 3LADA 3HYXA 2CULA 2Y6RA 3DA1A 1PBFA 3ITJA 1TRBA 2GMHA 1D4CA 1QLBA 2BS3A 1IUWA 2YG5A 4TLZA 5JCNA 4DNAA 2WS3A 2R9ZA 3UTHA 4FK1C 1H86A 2XLRA 5HYMA 1ZKQA 4U8JA 2BYBA 1H83A 1EL9A 3H4KA 5IPYA 4K8DA 2JB3A 1H6VA 2C3CA 3RP7A 2BA9A 1E1LA 3M0OA 4H4YA 1D4DA 3CNSA 3NG7X 2GV8A 1BWCA 4OCGA 2YLRA 3AE3A 1OJTA 1E6EA 4E0VA 4AP3A 2X8HA 3UKLA 1M64A 3CGEA 2XVJA 3AD7B 4X9MA 3SFEA 2JK6A 2AR8A 4APNA 4K2XA 5M0ZA 3BI2A 3AYJA 2X3NA 4LU6A 3FG2P 3CN8A 3AD9B 3S61A 4II3A 4HA6A 5C3JA 2WOIA 3NYEA 3RHAA 4Z24A 5KWFA 1GOSA 1KSUA 4H4UA 2XFQA 5KVIA 3NN0X 5U25A 3ABVA 3K30A 1VG9A 4CNKA 1JU2A 1TDKA 3AEDA 3DGHA 1S3EA 2BXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X31 B;  5BVA A;  1NHP A;  4B69 A;  2B76 A;  3OC4 A;  4YWO A;  1FL2 A;  1E39 A;  1YQ4 A;  3I3L A;  4K22 A;  3UTG A;  1L9C A;  3NKS A;  4H2R A;  4TM3 A;  2H89 A;  1UKV G;  4H4V A;  3D8X A;  2BAC A;  2GVC A;  3RED A;  1BGJ A;  2V60 A;  3GDN A;  2H88 A;  3RNM A;  2XLS A;  2VQB A;  1JOA A;  2BK5 A;  1K0I A;  3QSM A;  4ICY A;  4X4J A;  3QSE A;  2CFY A;  4FDC B;  1ZOV A;  2FJE A;  3BI4 A;  4EQR A;  1DNC A;  1IUX A;  5DBJ A;  1RYI A;  4OPG A;  5CQF A;  5EB5 A;  1S2Y A;  1FCD A;  2IVE A;  2VRL A;  4B68 A;  1PJ5 A;  2Q6U A;  1K4Q A;  4H4P A;  1D7L A;  4GCM A;  4JY3 A;  1LQT A;  2WOW A;  3L8K A;  1CJ3 A;  3R9U A;  4CBQ A;  2NPX A;  2FJA A;  1IJH A;  1ZX9 A;  2GB0 A;  5TR3 A;  2GR0 A;  4UDP A;  4TM0 A;  3V3N A;  3NYC A;  5BUL A;  1GRE A;  3GMB A;  4EIP A;  4ZN0 A;  3D1C A;  5ER0 A;  3LXD A;  2A89 A;  1JNR A;  3NH3 X;  4C74 A;  3UP4 A;  3CIR A;  3RP6 A;  2XLP A;  5M10 A;  3FPZ A;  4B65 A;  5LV9 A;  2WP6 A;  2XDO A;  1CF3 A;  3ALL A;  2YG3 A;  3SGL A;  3GRS A;  1KSS A;  3UOV A;  3ICS A;  5EBK A;  5EOW A;  1GV4 A;  2ZZC A;  4ZCD A;  3AEG A;  4B1B A;  1PBE A;  5J7X A;  3EAO A;  3BI5 A;  4Z44 A;  4YXD A;  3AEA A;  2XFO A;  3CND A;  4JQ9 A;  1CC2 A;  1BF3 A;  2XLU A;  4RSL A;  3CGB A;  4GF7 A;  3KA7 A;  4X9N A;  4A65 A;  1NEN A;  3BHK A;  4USQ A;  2VVL A;  4GRT A;  1LQU A;  1OJC A;  2FJB A;  1PXB A;  3GYJ A;  1KNP A;  3NGC X;  3UKQ A;  3ATR A;  2DKI A;  2Q7V A;  4AP1 A;  2UZZ A;  3AE1 A;  3AE6 A;  3AE5 A;  2WOV A;  4OPD A;  1GRF A;  1B8S A;  2V3B A;  2WP9 A;  1TDE A;  2EQ9 A;  3CPJ G;  4IVO B;  1XHC A;  4H7U A;  2WPF A;  3V76 A;  4O5U A;  1BZL A;  4ZCC A;  4WCT A;  5C2T A;  3SQP A;  1F3P A;  3EF6 A;  3AE2 A;  4IVM B;  1F8R A;  4Z43 A;  3UCL A;  3NK1 X;  3UOZ A;  4IA5 A;  3OZ2 A;  2R0C A;  3VRD B;  3WE0 A;  4J33 A;  1OJ9 A;  4K5R A;  1YKJ A;  2O9Z A;  2X8C A;  4H4T A;  3EAN A;  3Q6J A;  4GR1 A;  1CJ4 A;  2XVE A;  3BNM A;  3GMC A;  3I6D A;  3CNP A;  2PHH A;  4Y4N A;  3UP5 A;  1EBD A;  1GES A;  3F8R A;  4U2T A;  3VR9 A;  4AOX A;  1PXA A;  3UTF A;  5L46 A;  4EQX A;  1FOH A;  3K7Q X;  4A5L A;  4GDE A;  2A8X A;  4YSX A;  4C77 A;  3GD4 A;  3QSS A;  1KF6 A;  3NIX A;  4H4W A;  4A6N A;  1L9E A;  4J2W A;  4A9W A;  4U8P A;  4OVI A;  1IUU A;  4PAB A;  2C76 A;  2GQW A;  3IWA A;  2B7S A;  2B9Y A;  1JNZ A;  2YR4 A;  5JCL A;  1F8S A;  2R4E A;  1JRX A;  2Z5X A;  4BV6 A;  3CNJ A;  3P4Q A;  4LII A;  4O5Q A;  1EL8 A;  2R46 A;  4BJZ A;  1GPE A;  2C73 A;  3AEE A;  4J34 A;  1AOG A;  4C3Y A;  3UKF A;  1F8W A;  2OLO A;  3IHM A;  3KU9 A;  5BRT A;  3BHF A;  3L1R A;  2R0G A;  3P1W A;  4H2Q A;  3DJG X;  2YLW A;  3CPH G;  1O5W A;  4Z2U A;  3AEF A;  1Q1R A;  4C5O A;  3HZL A;  4Y4M A;  3ZDN A;  3LZW A;  1MXT A;  1ZOY A;  3CPI G;  1Y56 B;  2BXS A;  4U8O A;  1LTX R;  2F5Z A;  3UKK A;  3CNT A;  2E4G A;  4Y4L A;  3ZYX A;  4K5S A;  3LB8 A;  1YQ3 A;  2ZBW A;  4NTD A;  4BK1 A;  3LOV A;  4JY2 A;  2WDR A;  4TM4 A;  4LA1 A;  3GYI A;  1QJD A;  3CTY A;  2WQY A;  4B67 A;  2AQJ A;  2E1M A;  3GWF A;  4U2L A;  2NVK X;  3C96 A;  2AAQ A;  1M6I A;  1REO A;  2IID A;  2JBV A;  4CRT A;  4DGK A;  1TDN A;  3LJP A;  3EPT A;  2ZZB A;  4NTE A;  3SFD A;  4OPL A;  1JRY A;  2C64 A;  2B7R A;  5FS6 A;  3KPF A;  4EIQ A;  2GAH B;  2QA1 A;  3C4A A;  3URH A;  2WET A;  2APG A;  2JB2 A;  2VVM A;  2BC0 A;  2C3D A;  4H4X A;  5FS7 A;  2XVH A;  2YG4 A;  4H2N A;  1MOK A;  3NT6 A;  5JCM A;  2XFP A;  4DSH A;  1E1M A;  2TPR A;  2DKH A;  2C72 A;  2Y6Q A;  1Y0P A;  3QFB A;  4EQS A;  4UP3 A;  2WPE A;  2X50 A;  3UTE A;  4C3X A;  2JB1 A;  4YSZ A;  4ECH A;  1IUS A;  3DK8 A;  4MJW A;  4J56 A;  2BS4 A;  3GDP A;  4H50 A;  1CJ2 A;  2BK3 A;  3KD9 A;  1K0L A;  3II4 A;  1F6M A;  1L9D A;  2Q0L A;  3CGC A;  1HYU A;  1D7Y A;  2YQU A;  2R0P A;  3VRA A;  4BK3 A;  3Q9T A;  2R4J A;  4J36 A;  5JCI A;  4EMI A;  1P2E A;  3K7T A;  4NZH A;  2BS2 A;  4CY8 A;  4TLX A;  4CCR A;  2CVJ A;  2C65 A;  3NLC A;  4AT2 A;  3P9U A;  3M12 A;  2GR3 A;  2YLZ A;  4NTC A;  3K7M X;  1GXF A;  3AEB A;  2YR6 A;  1Y56 A;  2HQM A;  1W4X A;  2X99 A;  3P4R A;  4U8L A;  1RP0 A;  4USR A;  1KFY A;  2WP5 A;  1GND A;  2GAG B;  1O94 A;  4H4S A;  1GTH A;  1V59 A;  3DJJ A;  1O95 A;  2GR1 A;  1OJD A;  3P4S A;  3JSK A;  4D03 A;  3KVE A;  4CNJ A;  3O0H A;  2WHD A;  4YTM A;  4IA6 A;  2C66 A;  3ATQ A;  3FBS A;  1FEC A;  3NNE A;  4I58 A;  2OLN A;  1CBO A;  2VOU A;  1ZDL A;  1KDG A;  2Q0K A;  2WDQ A;  2YM1 A;  1NG3 A;  3ALJ A;  5EB4 A;  4XXG A;  2OAL A;  1CL0 A;  1YY5 A;  2C70 A;  4FX9 A;  3T37 A;  5U1O A;  3AYL A;  4EMJ A;  4KX6 A;  4H4Q A;  3QFA A;  4B64 A;  3UKH A;  1PDH A;  1NPX A;  1N4V A;  1GAL A;  4K7Z A;  1COY A;  2YWL A;  2V6O A;  3PO7 A;  1EL5 A;  3VQR A;  4EM3 A;  1PJ6 A;  1GRG A;  4KPR A;  2WPC A;  3F8D A;  4TM1 A;  4NEW A;  4DSG A;  2YVF A;  4XWZ A;  4M52 A;  2XFU A;  3ALM A;  1H84 A;  1FEA A;  4Z2T A;  1MO9 A;  1CHU A;  1DOC A;  1GET A;  2R45 A;  3S5W A;  1GRH A;  4JNA A;  1GRT A;  1Q1W A;  1K0J A;  2RGJ A;  4U8K A;  5KOW A;  4OPC A;  4JN9 A;  2X8G A;  2EQ7 A;  4JNQ A;  1ZY8 A;  3QJ4 A;  2BCG G;  3NYF A;  2YLS A;  2WEU A;  3UOY A;  3DK4 A;  3DJE A;  4YTP A;  2GR2 A;  2I0Z A;  3C4N A;  3FMW A;  4GDP A;  1DJN A;  1FEB A;  3AXB A;  3F8P A;  4OPU A;  1LV0 A;  1GSN A;  1GTE A;  3AB1 A;  2VRM A;  5GRT A;  2FJD A;  5KRQ A;  2YG7 A;  3GWD A;  3VR8 A;  5JCK A;  2QAE A;  3BNU A;  3NTA A;  1ONF A;  3M13 A;  3PVC A;  1DXL A;  1QO8 A;  4U2S A;  3SM8 A;  4H4R A;  3NK0 X;  3AE4 A;  1BKW A;  2GH5 A;  2WU5 A;  4PAA A;  1PN0 A;  2RGH A;  1S2Q A;  1PBD A;  4YSY A;  5IQ4 A;  2XLT A;  2VVL G;  3KKJ A;  5FS8 A;  5HHF A;  4EMW A;  3DME A;  1KNR A;  1JEH A;  2J3N A;  1ZMD A;  2GMJ A;  4EQW A;  1S3B A;  3G5R A;  1GRB A;  2GEW A;  1H82 A;  1RSG A;  5CKU A;  1PJ7 A;  1VDC A;  1D4E A;  2V61 A;  3QVP A;  2XVI A;  2YG6 A;  1XAN A;  1NHR A;  2ACZ A;  3CGD A;  3AEC A;  3IF9 A;  4I59 A;  3GRT A;  3IC9 A;  4H4Z A;  3UOX A;  1E7P A;  5U63 A;  1LPF A;  2OAM A;  4BK2 A;  1ZK7 A;  3B3R A;  4N9X A;  4U8N A;  1VRQ B;  3NHO X;  5IQ1 A;  5KXJ A;  1NHS A;  1PHH A;  4CY6 A;  2C7G A;  1XPQ A;  4OPT A;  3LZX A;  3NTD A;  4GUV A;  3UKA A;  3GD3 A;  2EQ8 A;  4RG3 A;  1ZP0 A;  2YVJ A;  1H7W A;  2V5Z A;  1N4W A;  4OPI A;  5KVH A;  1P2H A;  2BAB A;  2C67 A;  4A79 A;  4Z2R A;  4Z25 A;  4Z26 A;  1DOE A;  4ADW A;  1B37 A;  1CC6 A;  1PS9 A;  1BGN A;  1PBB A;  4A99 A;  2B9X A;  4UDR A;  1NEK A;  1B5Q A;  3IHG A;  3AD8 B;  5HXI A;  4BJY A;  1TDF A;  4NEV A;  1GEU A;  2VZ2 A;  1CJC A;  1CC4 A;  1DOD A;  2BC1 A;  2GQF A;  1ELI A;  1GER A;  2ZZ0 A;  2CDU A;  2QA2 A;  1L0V A;  3AYI A;  3KLJ A;  3AE7 A;  4EM4 A;  3AE8 A;  2W0H A;  3NN6 X;  1IUT A;  1PBC A;  2BCP A;  1VG0 A;  2B9W A;  3DJD A;  3H8I A;  2YR5 A;  3GSI A;  3P4P A;  5FS9 A;  1EL7 A;  4A7A A;  5BUK A;  1YQZ A;  2EQ6 A;  4U8M A;  3COX A;  1NG4 A;  2A87 A;  4H2P A;  2RGO A;  1B4V A;  2JKC A;  3QVR A;  1JRZ A;  4IV9 A;  1H7X A;  2WBA A;  3UKP A;  2WDV A;  1DOB A;  3PS9 A;  4REK A;  4A6N B;  4YTN A;  2QCU A;  3AE9 A;  5KOX A;  3DH9 A;  4YSH A;  3H8L A;  2RAB A;  1Q9I A;  4RG4 A;  2YVG A;  3E1T A;  4XWR A;  2XYO A;  4J31 A;  5FMH A;  1NAA A;  2WU2 A;  1IUV A;  4WX1 A;  2ARD A;  1N4U A;  4UDQ A;  5GSN A;  1H81 A;  4B63 A;  2FBW A;  4YKG A;  2OA1 A;  2PYX A;  2TMD A;  1GT8 A;  2YLT A;  4B66 A;  4JDR A;  3G5S A;  5J60 A;  2XFN A;  3G5Q A;  2WES A;  1LVL A;  2GF3 A;  3NK2 X;  2GRT A;  2C75 A;  1PXC A;  2VQ7 A;  1N1P A;  4YT0 A;  2BK4 A;  1TYP A;  2XVF A;  3DK9 A;  2Z5Y A;  3RP8 A;  3V3O A;  1DJQ A;  2E5V A;  4P9S A;  1E1K A;  1XDI A;  4FK1 A;  2YLX A;  2YAU A;  4BUR A;  1NDA A;  3AWI A;  5HY5 A;  4YKF A;  1D5T A;  1TYT A;  1Z6L A;  4J57 A;  4AOS A;  1ZMC A;  1GRA A;  3VRB A;  3FIM B;  4D04 A;  3ADA B;  1TDO A;  1OJA A;  2JAE A;  4HB9 A;  2XCG A;  4U8I A;  2IVD A;  4CCQ A;  3ICR A;  3ICT A;  1SEZ A;  3DGZ A;  2V3A A;  1LJ1 A;  1NHQ A;  1E1N A;  1VQW A;  4AT0 A;  3B6D A;  2YM2 A;  3ISH A;  3NRN A;  3LAD A;  2CUL A;  2Y6R A;  3DA1 A;  1PBF A;  3ITJ A;  1TRB A;  2GMH A;  1D4C A;  1QLB A;  2BS3 A;  1IUW A;  2YG5 A;  4TLZ A;  5JCN A;  4DNA A;  2WS3 A;  2R9Z A;  3UTH A;  4FK1 C;  1H86 A;  2XLR A;  5HYM A;  1ZKQ A;  4U8J A;  2BYB A;  1H83 A;  1EL9 A;  3H4K A;  5IPY A;  4K8D A;  2JB3 A;  1H6V A;  2C3C A;  3RP7 A;  2BA9 A;  1E1L A;  3M0O A;  4H4Y A;  1D4D A;  3CNS A;  3NG7 X;  2GV8 A;  1BWC A;  4OCG A;  2YLR A;  3AE3 A;  1OJT A;  1E6E A;  4E0V A;  4AP3 A;  2X8H A;  3UKL A;  1M64 A;  3CGE A;  2XVJ A;  3AD7 B;  4X9M A;  3SFE A;  2JK6 A;  2AR8 A;  4APN A;  4K2X A;  5M0Z A;  3BI2 A;  3AYJ A;  2X3N A;  4LU6 A;  3FG2 P;  3CN8 A;  3AD9 B;  3S61 A;  5C3J A;  4HA6 A;  2WOI A;  3NYE A;  3RHA A;  4Z24 A;  5KWF A;  1GOS A;  1KSU A;  4H4U A;  2XFQ A;  5KVI A;  3NN0 X;  5U25 A;  3ABV A;  3K30 A;  1VG9 A;  4CNK A;  1JU2 A;  1TDK A;  3AED A;  3DGH A;  1S3E A;  2BXR A; 
#chains in the Genus database with same CATH topology
 2B76 A;  3SY4 A;  1UKV G;  4H4V A;  3RNM A;  2XLS A;  2VQB A;  4X4J A;  3QSE A;  1S2Y A;  4F4R A;  3NVW B;  4CBQ A;  2NPX A;  2GB0 A;  2AL2 A;  3GMB A;  3LXD A;  3MZN A;  3UP4 A;  3RP6 A;  2XLP A;  3FPZ A;  2XDO A;  3BJS A;  3GRS A;  1KSS A;  3ICS A;  4Z44 A;  4YXD A;  3CND A;  4RSL A;  1MUC A;  3KA7 A;  4X9N A;  4ROP A;  3UCC A;  3BHK A;  4GRT A;  2FJB A;  3NGC X;  3ATR A;  3TJI A;  4DYE A;  1GRF A;  2V3B A;  2WP9 A;  3GD6 A;  2HXU A;  1TDE A;  3CPJ G;  4H7U A;  4ZCC A;  4WCT A;  3AE2 A;  4DWD A;  3UCL A;  3UOZ A;  3WE0 A;  2C4C A;  2X8C A;  3Q6J A;  1CJ4 A;  4Y4N A;  3I6D A;  2PHH A;  3CT2 A;  3F8R A;  1PXA A;  3SX6 A;  3CK5 A;  2BRY A;  3K7Q X;  2NQL A;  4YSX A;  4Z17 A;  4H4W A;  4A6N A;  4J2W A;  4U8P A;  2C76 A;  3IWA A;  2B7S A;  5JCL A;  1H2I A;  2R46 A;  2C73 A;  1AOG A;  1JPM A;  3UKF A;  3UXL A;  2OLO A;  3DJG X;  2XH0 A;  4Z2U A;  4HNL A;  4GFI A;  1Q1R A;  3VA8 A;  2XH4 A;  3LZW A;  2PMQ A;  1LTX R;  3ZYX A;  1RVK A;  4Y4L A;  2PS2 A;  2WQY A;  4B67 A;  3FV9 A;  2NVK X;  3CXB A;  2IID A;  3LJP A;  5J04 A;  1JRY A;  2C64 A;  2B7R A;  3KPF A;  2DW6 A;  3URH A;  2APG A;  2PSN A;  4H4X A;  4K8G A;  1MOK A;  2TPR A;  2DKH A;  2W55 A;  2PTZ A;  4UP3 A;  2WPE A;  2JB1 A;  4ENL A;  2BS4 A;  1CJ2 A;  1L9D A;  4HPN A;  2Q0L A;  3VRA A;  1D7Y A;  2R4J A;  1P2E A;  4AT2 A;  3NLC A;  1RM6 B;  2GR3 A;  1Y56 A;  1W4X A;  2X99 A;  1FIQ B;  1GND A;  2GAG B;  4H4S A;  1GTH A;  1O95 A;  3NS1 B;  3H8A A;  3O0H A;  2WHD A;  4YTM A;  3FBS A;  1FEC A;  2OLN A;  3QN3 A;  4XXG A;  1YY5 A;  3T14 A;  3NFU A;  3QFA A;  4B64 A;  1PDH A;  1TE6 A;  1COY A;  2YWL A;  4MGG A;  3PO7 A;  1EL5 A;  3F8D A;  4NEW A;  2XFU A;  1MO9 A;  1MDR A;  2OZ8 A;  3JZU A;  3ZLH A;  3SXI A;  1K0J A;  5KOW A;  3QJ4 A;  3FVD A;  2BCG G;  3NYF A;  2YLS A;  3UOY A;  3F8P A;  1LV0 A;  3AB1 A;  5KRQ A;  3GWD A;  3BNU A;  3NTA A;  4K1W A;  3M13 A;  3T9P A;  4GGB A;  2PP1 A;  3DG6 A;  2QGY A;  1PN0 A;  2RGH A;  1PBD A;  3VCN A;  2J3N A;  2PCE A;  1H82 A;  2OZ3 A;  3AEC A;  4H4Z A;  3ZLF A;  3B3R A;  4N9X A;  5IQ1 A;  5KXJ A;  1NHS A;  2C7G A;  1XPQ A;  4GUV A;  3GD3 A;  1ZP0 A;  1H7W A;  1N4W A;  4Z2R A;  4A79 A;  4G73 A;  1TDF A;  4NEV A;  1CC4 A;  2P3Z A;  1GER A;  1L0V A;  2PP3 A;  2QVH A;  3H8I A;  3GSI A;  4X2P A;  3IK4 A;  4H2P A;  1EBG A;  3PS9 A;  3T4W A;  2QCU A;  3AE9 A;  3H8L A;  1Q9I A;  4RG4 A;  1DTN A;  3E1T A;  3GO2 A;  5FMH A;  4WX1 A;  2XH2 A;  2ARD A;  1N4U A;  1H81 A;  4B63 A;  2FBW A;  4YKG A;  5J60 A;  3RO6 A;  3TOY A;  2GF3 A;  2GRT A;  3UGV A;  3DDM A;  1PXC A;  3V3O A;  1MNS A;  2YLX A;  2YAU A;  4BUR A;  3T8Q A;  1Z6L A;  4D04 A;  3MKC A;  3ADA B;  2OO6 A;  3ICR A;  3RRA A;  3KPK A;  1SEZ A;  3SN4 A;  2YM2 A;  3U4F A;  3ITJ A;  2BS3 A;  5JCN A;  3V3W A;  4FK1 C;  3VC6 A;  1H86 A;  3N6J A;  4K8D A;  2BA9 A;  3M0O A;  3VCC A;  3CNS A;  3T6C A;  3FCP A;  1JDF A;  4OCG A;  2YLR A;  3DG7 A;  3AE3 A;  1OJT A;  1WUE A;  1M64 A;  3AMZ A;  3AD7 B;  3UJ2 A;  1EC8 A;  3RIT A;  3BI2 A;  4LU6 A;  3CN8 A;  3AD9 B;  4II3 A;  4HA6 A;  3NYE A;  1KSU A;  3NN0 X;  5KVI A;  5U25 A;  3K30 A;  4CNK A;  2DW7 A;  3OC4 A;  3I3L A;  1E39 A;  4KPL A;  1X2H A;  1K0I A;  3QSM A;  2CFY A;  4FDC B;  3TJ4 A;  1ZOV A;  2FJE A;  4E4F A;  3BI4 A;  1OEP A;  1KD0 A;  1RYI A;  4OPG A;  5CQF A;  5EB5 A;  2VRL A;  1PJ5 A;  2Q6U A;  1D7L A;  2QDE A;  1LQT A;  2WOW A;  1CJ3 A;  3SZ0 A;  2P88 A;  1MDL A;  4UDP A;  5G5H B;  5BUL A;  5JRB A;  1GRE A;  3THU A;  5M10 A;  4B65 A;  1TZZ A;  1CF3 A;  3ALL A;  3SGL A;  3DGB A;  4B1B A;  5J7X A;  3BI5 A;  1XS2 A;  3SR6 B;  3AEA A;  2XFO A;  4JQ9 A;  3D47 A;  1BF3 A;  3CGB A;  4GF7 A;  4A65 A;  1NEN A;  2QDD A;  3T2Z A;  1PXB A;  4AP1 A;  2OVL A;  3AE5 A;  2WOV A;  3SZF A;  4G74 A;  3EF6 A;  4Z43 A;  3ES7 A;  3NK1 X;  3CB3 A;  3I6E A;  4J1O A;  3UJR A;  2R0C A;  3OZ2 A;  4J33 A;  1SJA A;  1OJ9 A;  2O9Z A;  3EAN A;  3GMC A;  2XVE A;  4DN1 A;  3UP5 A;  1EBD A;  3VR9 A;  4AOX A;  3UTF A;  5L46 A;  4C77 A;  1KKR A;  1L9E A;  4OVI A;  2B9Y A;  2YR4 A;  1F8S A;  1JRX A;  4O5Q A;  4BJZ A;  3ZLG A;  3AEE A;  4J34 A;  4C3Y A;  3P0W A;  1F8W A;  4MMW A;  3KU9 A;  5BRT A;  3P1W A;  2YLW A;  3R25 A;  4Y4M A;  1MXT A;  1ZOY A;  3CPI G;  1Y56 B;  2I5Q A;  3CAW A;  3LOV A;  4K2S A;  2WDR A;  3HYW A;  4LA1 A;  3CTY A;  2GGJ A;  1T3Q C;  2AQJ A;  2GDQ A;  2ZZB A;  4NTE A;  3NVZ B;  5FS6 A;  4EIQ A;  3C4A A;  2WET A;  3BOX A;  2VVM A;  2C3D A;  3UXK A;  5FS7 A;  2XVH A;  2YG4 A;  1N5W C;  2XFP A;  3QFB A;  4HCH A;  5KNL A;  2O56 A;  3KD9 A;  3UJF A;  3II4 A;  1F6M A;  2POD A;  1HYU A;  4BK3 A;  4E5T A;  4CY8 A;  5JCI A;  4NZH A;  2BS2 A;  3DEQ A;  1GXF A;  3AEB A;  2HQM A;  3P4R A;  1RP0 A;  4USR A;  1P48 A;  1KFY A;  1O94 A;  1BKH A;  3DJJ A;  4IZG A;  2XSX A;  4CNJ A;  2C66 A;  1CBO A;  1ZDL A;  2Q0K A;  2WDQ A;  3ALJ A;  5EB4 A;  4FX9 A;  4EMJ A;  4KX6 A;  3PG6 A;  1GAL A;  4K7Z A;  2V6O A;  5KMP A;  4EM3 A;  1GRG A;  2WPC A;  4TM1 A;  1ECQ A;  4M52 A;  4GAP A;  5FJO A;  2PPG A;  2OQY A;  3PWI A;  1CHU A;  1DOC A;  1GRT A;  4U8K A;  3MQT A;  1ZY8 A;  3Q45 A;  4YTP A;  2I0Z A;  3C4N A;  3FMW A;  4GDP A;  1DJN A;  3AXB A;  2P0I A;  1GTE A;  2VRM A;  2YG7 A;  1DXL A;  2MUC A;  4PAA A;  1S2Q A;  4YSY A;  3KKJ A;  5FS8 A;  4HNC A;  3G5R A;  3V5F A;  4EQW A;  1RSG A;  3R07 C;  3QVP A;  4G7F A;  2ACZ A;  2OFJ A;  3CGD A;  3GRT A;  3UOX A;  1PHH A;  3LZX A;  3NTD A;  2QJN A;  2EQ8 A;  4GGH A;  2BAB A;  2GGE A;  4Z26 A;  3R0K A;  1MRA A;  3R10 A;  4UDR A;  3NRZ B;  2OQH A;  5FJP A;  5HXI A;  4BJY A;  2AKM A;  2VZ2 A;  1CJC A;  2GQF A;  2ZZ0 A;  1N60 C;  2CDU A;  4H2H A;  3AE8 A;  1IYX A;  2W0H A;  3NN6 X;  2BCP A;  2GSH A;  2B9W A;  3P4P A;  5FS9 A;  1EL7 A;  3CYJ A;  1YQZ A;  4U8M A;  3HYV A;  1NG4 A;  2RGO A;  3OZM A;  2JKC A;  1H7X A;  2WBA A;  3UKP A;  2WDV A;  1DOB A;  4REK A;  4YTN A;  3PFR A;  1N61 C;  4XWR A;  2XYO A;  2P8C A;  4J31 A;  4H1Z A;  4UDQ A;  2OA1 A;  2PYX A;  1GT8 A;  2YLT A;  3G5S A;  3N4E A;  3DK9 A;  2Z5Y A;  3RP8 A;  1DJQ A;  2E5V A;  4YWS A;  3K1G A;  1D5T A;  4G6H A;  3FIM B;  1OJA A;  4HB9 A;  3MY9 A;  5G5G B;  3ICT A;  1LJ1 A;  1E1N A;  3B6D A;  4G8T A;  3ZVH B;  3TTE A;  3LAD A;  2Y6R A;  4FI4 A;  1PBF A;  4GYP C;  1D4C A;  1QLB A;  2YG5 A;  4TLZ A;  1SJD A;  2R9Z A;  3MWC A;  2XLR A;  1H83 A;  3H4K A;  3OZY A;  2JB3 A;  3TWB A;  2XGZ A;  2OX4 A;  2AKZ A;  2P8B A;  4TVW A;  1D4D A;  2GV8 A;  1BWC A;  2HXT A;  2X8H A;  3UKL A;  3I4K A;  1VDV A;  3AYJ A;  3S61 A;  5C3J A;  2WOI A;  4H4U A;  1JU2 A;  1S3E A;  2BXR A;  1X31 B;  1NHP A;  4B69 A;  3ENL A;  4YWO A;  4K22 A;  1YQ4 A;  1L9C A;  3GYX A;  4TM3 A;  3D8X A;  2GVC A;  3RED A;  3RR1 A;  3GDN A;  4ICY A;  1TKK A;  4EQR A;  1IUX A;  1FCD A;  4B68 A;  4H4P A;  1STZ A;  2PU0 A;  3RCY A;  5TR3 A;  2GR0 A;  3QPE A;  4TM0 A;  3NYC A;  1WYG A;  1XPY A;  4EIP A;  3HPF A;  5ER0 A;  1X2G A;  3NO1 A;  3B97 A;  3CXO A;  5LV9 A;  2WP6 A;  2YG3 A;  3B9J B;  3NXL A;  2MNR A;  4ZCD A;  3AEG A;  1PBE A;  3H7V A;  1VQZ A;  1CC2 A;  2XLU A;  3S5S A;  4Z1Y A;  2W3S A;  2VVL A;  1LQU A;  3GYJ A;  5KMQ A;  2DKI A;  2Q7V A;  3N4F A;  3PK7 A;  2UZZ A;  1B8S A;  1FFV C;  2EQ9 A;  4O5U A;  1BZL A;  2W3R A;  3SQP A;  4IVM B;  4IA5 A;  3VRD B;  1YKJ A;  4GR1 A;  3CNP A;  2GL5 A;  1GES A;  4U2T A;  4H83 A;  4A5L A;  1YEY A;  2A8X A;  4DHG A;  1PDY A;  3GD4 A;  3NIX A;  3VDG A;  4A9W A;  1IUU A;  4PAB A;  2OKT A;  1JNZ A;  4LII A;  2PGE A;  1GPE A;  3BHF A;  3L1R A;  3EKG A;  2R0G A;  4H2Q A;  3CPH G;  3P3B A;  3T31 A;  3AEF A;  2QJJ A;  4HCL A;  1WUF A;  2BXS A;  3QLD A;  4U8O A;  2F5Z A;  5FJU A;  2E4G A;  4NTD A;  4BK1 A;  4JY2 A;  1QJD A;  3GWF A;  4U2L A;  1JRP A;  2AAQ A;  1M6I A;  3OW1 A;  1FHU A;  4NNJ A;  4CRT A;  3FYY A;  3ZVH A;  1NU5 A;  4OPL A;  1FO4 A;  3VFC A;  3NT6 A;  5JCM A;  4DSH A;  1E1M A;  2C72 A;  2Y6Q A;  1Y0P A;  4A6G A;  4C3X A;  4ECH A;  3KUM A;  3CMM A;  3GDP A;  4H50 A;  3CGC A;  3SYI A;  2R0P A;  3Q9T A;  4CCR A;  2CVJ A;  2C65 A;  2HNE A;  3Q4D A;  3M12 A;  4M6U A;  2YLZ A;  3K7M X;  2E3T A;  2PTW A;  1V59 A;  2QQ6 A;  1P43 A;  1OJD A;  3P4S A;  3KVE A;  3NNE A;  4I58 A;  3D46 A;  2VOU A;  1KDG A;  2YM1 A;  3OPS A;  2C70 A;  3T37 A;  4DX3 A;  2AL1 A;  5U1O A;  3AYL A;  3PWG A;  4H4Q A;  4IT1 A;  2FYM A;  1SJC A;  3T0K A;  3T2Y A;  3VQR A;  1PJ6 A;  4KPR A;  1ELS A;  3DES A;  5BOF A;  3ALM A;  1H84 A;  1FEA A;  3U9I A;  1GET A;  3S5W A;  1GRH A;  5FJT A;  4KT2 A;  2RGJ A;  2EQ7 A;  4JNQ A;  4JHM A;  3DJE A;  2GR2 A;  4HCD A;  1GSN A;  3STP A;  7ENL A;  5GRT A;  2FJD A;  3VR8 A;  5JCK A;  2QAE A;  1ONF A;  5KMS A;  3PVC A;  4U2S A;  3AE4 A;  1BKW A;  3DER A;  5IQ4 A;  1ONE A;  3UJE A;  3ZVI A;  3P93 A;  2VVL G;  2XLT A;  3DME A;  4IL0 A;  1ZMD A;  4E6M A;  2GEW A;  5CKU A;  2V61 A;  3TQP A;  2XVI A;  4FP1 A;  2YG6 A;  1ZXI C;  3IF9 A;  4I59 A;  3IC9 A;  4JN7 A;  5U63 A;  1LPF A;  3NHO X;  3T2K A;  4RG3 A;  4OPI A;  1P2H A;  2PGW A;  1DOE A;  4ADW A;  1B37 A;  3L5O A;  3A7A A;  1BGN A;  1CC6 A;  1PBB A;  1B5Q A;  3IHG A;  1GEU A;  1KN0 A;  2BC1 A;  4IP5 A;  1ELI A;  3JW7 A;  3UCD A;  2QA2 A;  3AYI A;  3KLJ A;  1IUT A;  1PBC A;  3DJD A;  4ZOH B;  2YR5 A;  5BUK A;  2EQ6 A;  4J3Z A;  3COX A;  1FHV A;  3QVR A;  4YSH A;  3DIP A;  2YVG A;  6ENL A;  4G9K A;  4NWZ A;  1FFU C;  2GGH A;  5IDZ A;  5GSN A;  4B66 A;  4JDR A;  2XFN A;  5FJR A;  2VQ7 A;  3DFY A;  4YT0 A;  2BK4 A;  1TYP A;  1XDI A;  4FK1 A;  4A3R A;  3S47 A;  3AWI A;  1NDA A;  1TYT A;  4J57 A;  1ZMC A;  1GRA A;  2ONE A;  3VRB A;  3FXG A;  4H19 A;  3DFH A;  2JAE A;  4CCQ A;  3SQS A;  3DGZ A;  4GAV A;  1VQW A;  4AT0 A;  3ISH A;  3NRN A;  2CUL A;  3DA1 A;  1IUW A;  2WS3 A;  5HYM A;  1ZKQ A;  4U8J A;  2BYB A;  2C3C A;  1E1L A;  4A35 A;  1R0M A;  4AP3 A;  2PA6 A;  3CGE A;  2XVJ A;  4X9M A;  3SFE A;  2AR8 A;  4K2X A;  2X3N A;  3RHA A;  4Z24 A;  5EU9 A;  1VG9 A;  2A89 A;  5BVA A;  1FL2 A;  3EEZ A;  3UTG A;  3NKS A;  4H2R A;  2H89 A;  2BAC A;  4IL2 A;  1BGJ A;  2V60 A;  2H88 A;  2ZC8 A;  4HYR A;  1JOA A;  2BK5 A;  2OLA A;  1EC9 A;  1DNC A;  5DBJ A;  2IVE A;  3OTR A;  1K4Q A;  4GCM A;  4JY3 A;  3L8K A;  3R9U A;  2FJA A;  1IJH A;  1ZX9 A;  3V3N A;  4ZN0 A;  3D1C A;  1JNR A;  3NH3 X;  4C74 A;  3A7U A;  3CIR A;  2CHR A;  3AN1 A;  5KMR A;  2QJM A;  3UOV A;  3AM9 A;  5EBK A;  5EOW A;  1GV4 A;  2ZZC A;  2POZ A;  3EAO A;  3DG3 A;  4EWJ A;  4USQ A;  1SB3 B;  1OJC A;  1KNP A;  3UKQ A;  3AE1 A;  3AE6 A;  4OPD A;  4IVO B;  1XHC A;  2WPF A;  5C2T A;  1F3P A;  3QTP A;  1F8R A;  3I6T A;  4K5R A;  4H4T A;  3V76 A;  3BNM A;  4II2 A;  4EQX A;  1FOH A;  4GDE A;  3ETR B;  2PTX A;  3QSS A;  2E5A A;  1KF6 A;  1V97 A;  2GQW A;  2R4E A;  2Z5X A;  4BV6 A;  3CNJ A;  3P4Q A;  1EL8 A;  1JPD X;  3IJQ A;  3IJL A;  3SZW A;  3IHM A;  1O5W A;  3GY1 A;  1JCT A;  4C5O A;  3HZL A;  3ZDN A;  1KKO A;  3BSM A;  1BQG A;  3UKK A;  3CNT A;  4K5S A;  3LB8 A;  1YQ3 A;  2ZBW A;  4TM4 A;  3GYI A;  3HRD C;  4TVY A;  2E1M A;  3SN1 A;  3C96 A;  1REO A;  4MKS A;  2JBV A;  2OG9 A;  4DGK A;  1TDN A;  1PDZ A;  3EPT A;  3SJN A;  3SFD A;  2GAH B;  2QA1 A;  1EC7 A;  4KEM A;  2JB2 A;  4HN8 A;  2BC0 A;  4H2N A;  2RDX A;  3VC5 A;  3MSY A;  4EQS A;  2X50 A;  3UTE A;  4YSZ A;  4M0X A;  1IUS A;  3DK8 A;  4MJW A;  2HZG A;  4J56 A;  2BK3 A;  1K0L A;  2YQU A;  4J36 A;  3K7T A;  4EMI A;  2PP0 A;  4TLX A;  3P9U A;  4NTC A;  3FJ4 A;  2YR6 A;  1EBH A;  3IJI A;  4U8L A;  4IHC A;  2WP5 A;  2OZT A;  1E9I A;  2GR1 A;  4D03 A;  3JSK A;  4IP4 A;  4IA6 A;  3ATQ A;  4ZA0 A;  1NG3 A;  3UJS A;  2OAL A;  1CL0 A;  3UKH A;  3ES8 A;  1NPX A;  1N4V A;  2ZAD A;  1F9C A;  3R0U A;  4DSG A;  3SBF A;  2YVF A;  4XWZ A;  4G6G A;  4Z2T A;  4GIR A;  2R45 A;  1L8P A;  4JNA A;  1Q1W A;  4OPC A;  3TCS A;  2X8G A;  4JN9 A;  4JN8 A;  2WEU A;  3DK4 A;  1FEB A;  2FKP A;  4OPU A;  3EUB 3;  2AL2 B;  1N62 C;  3H12 A;  1QO8 A;  2GGI A;  3SM8 A;  4H4R A;  3NK0 X;  2WU5 A;  2GH5 A;  3MUC A;  5HHF A;  2W54 A;  4EMW A;  3QKE A;  2BRA A;  1KNR A;  1JEH A;  2GMJ A;  1S3B A;  1N5X A;  1GRB A;  4GIS A;  1PJ7 A;  1VDC A;  1D4E A;  1XAN A;  1NHR A;  1E7P A;  2OAM A;  4BK2 A;  1ZK7 A;  3R1Z A;  4U8N A;  2OPJ A;  1VRQ B;  1KCZ A;  4CY6 A;  4OPT A;  3UKA A;  2YVJ A;  2V5Z A;  5KVH A;  2C67 A;  4Z25 A;  1PS9 A;  1W6T A;  4A99 A;  2B9X A;  1NEK A;  3GC2 A;  3AD8 B;  1JRO A;  3V4B A;  1DOD A;  4E4U A;  3AE7 A;  4EM4 A;  1VG0 A;  4A7A A;  2A87 A;  1B4V A;  3V5C A;  1JRZ A;  4IV9 A;  4A6N B;  5KOX A;  3DH9 A;  2RAB A;  5ENL A;  4E8G A;  1NAA A;  2WU2 A;  1IUV A;  3N6H A;  4ZCW A;  3NVY B;  3HW2 A;  2TMD A;  3G5Q A;  2WES A;  3NVV B;  1LVL A;  3NK2 X;  2C75 A;  1N1P A;  4DXK A;  3JVA A;  2XVF A;  4GYP A;  4P9S A;  1R6W A;  1E1K A;  4GME A;  5HY5 A;  4YKF A;  1SJB A;  4AOS A;  3SZC A;  1TDO A;  3RGT A;  2XCG A;  3D9X A;  4U8I A;  2PU1 A;  2IVD A;  3SN0 A;  3TWA A;  2V3A A;  1NHQ A;  1S7M A;  3OP2 A;  1N63 C;  3HYX A;  1TRB A;  2GMH A;  4DNA A;  3R11 A;  3UTH A;  1EL9 A;  5IPY A;  3NZG A;  3RP7 A;  1H6V A;  5BOE A;  2PTY A;  2GGG A;  4H4Y A;  3NG7 X;  3SSZ A;  1E6E A;  4E0V A;  3TW9 A;  4KWS A;  2JK6 A;  1NEL A;  2XH7 A;  3H70 A;  4APN A;  5M0Z A;  3FG2 P;  5KWF A;  1GOS A;  2XFQ A;  3A7R A;  3ABV A;  1TDK A;  3AED A;  3DGH A; 
#chains in the Genus database with same CATH homology
 1X31 B;  5BVA A;  1NHP A;  4B69 A;  2B76 A;  3OC4 A;  4YWO A;  1FL2 A;  1E39 A;  1YQ4 A;  3I3L A;  4K22 A;  3UTG A;  1L9C A;  3GYX A;  3NKS A;  4H2R A;  4TM3 A;  2H89 A;  3SY4 A;  1UKV G;  4H4V A;  3D8X A;  2BAC A;  2GVC A;  3RED A;  1BGJ A;  2V60 A;  3GDN A;  2H88 A;  3RNM A;  2XLS A;  2VQB A;  1JOA A;  2BK5 A;  1K0I A;  3QSM A;  4ICY A;  4X4J A;  3QSE A;  2CFY A;  4FDC B;  1ZOV A;  2FJE A;  3BI4 A;  4EQR A;  1DNC A;  1IUX A;  5DBJ A;  1RYI A;  4OPG A;  5CQF A;  5EB5 A;  1S2Y A;  1FCD A;  2IVE A;  2VRL A;  4B68 A;  1PJ5 A;  2Q6U A;  1K4Q A;  4H4P A;  1D7L A;  4GCM A;  4JY3 A;  1LQT A;  2WOW A;  3L8K A;  1CJ3 A;  3R9U A;  4CBQ A;  2NPX A;  3SZ0 A;  2FJA A;  1IJH A;  1ZX9 A;  2GB0 A;  5TR3 A;  2GR0 A;  4UDP A;  4TM0 A;  3V3N A;  3NYC A;  5BUL A;  5JRB A;  1GRE A;  3GMB A;  4EIP A;  4ZN0 A;  3D1C A;  5ER0 A;  3LXD A;  2A89 A;  1JNR A;  3NH3 X;  4C74 A;  3UP4 A;  3CIR A;  3RP6 A;  2XLP A;  5KMR A;  5M10 A;  3FPZ A;  4B65 A;  5LV9 A;  2WP6 A;  2XDO A;  1CF3 A;  3ALL A;  2YG3 A;  3SGL A;  3GRS A;  1KSS A;  3UOV A;  3ICS A;  5EBK A;  5EOW A;  1GV4 A;  2ZZC A;  4ZCD A;  3AEG A;  4B1B A;  1PBE A;  5J7X A;  3EAO A;  3BI5 A;  4Z44 A;  4YXD A;  3AEA A;  2XFO A;  3CND A;  4JQ9 A;  1CC2 A;  1BF3 A;  2XLU A;  4RSL A;  3CGB A;  4GF7 A;  3KA7 A;  4X9N A;  4A65 A;  1NEN A;  3BHK A;  4USQ A;  2VVL A;  4GRT A;  1LQU A;  3T2Z A;  1OJC A;  2FJB A;  1PXB A;  3GYJ A;  1KNP A;  3NGC X;  5KMQ A;  3ATR A;  2DKI A;  3UKQ A;  2Q7V A;  4AP1 A;  2UZZ A;  3AE1 A;  3AE6 A;  3AE5 A;  2WOV A;  4OPD A;  1GRF A;  1B8S A;  2V3B A;  2WP9 A;  1TDE A;  2EQ9 A;  3CPJ G;  4IVO B;  1XHC A;  3SZF A;  4H7U A;  2WPF A;  3V76 A;  4O5U A;  1BZL A;  4ZCC A;  4WCT A;  4G74 A;  5C2T A;  3SQP A;  1F3P A;  3EF6 A;  3AE2 A;  4IVM B;  1F8R A;  4Z43 A;  3UCL A;  3NK1 X;  3UOZ A;  4IA5 A;  3OZ2 A;  2R0C A;  3VRD B;  3WE0 A;  4J33 A;  2C4C A;  1OJ9 A;  4K5R A;  1YKJ A;  2O9Z A;  2X8C A;  4H4T A;  3EAN A;  3Q6J A;  4GR1 A;  1CJ4 A;  2XVE A;  3BNM A;  3GMC A;  3I6D A;  3CNP A;  2PHH A;  4Y4N A;  3UP5 A;  1EBD A;  1GES A;  3F8R A;  4U2T A;  3VR9 A;  4AOX A;  1PXA A;  3UTF A;  3SX6 A;  4II2 A;  5L46 A;  4EQX A;  1FOH A;  2BRY A;  3K7Q X;  4A5L A;  4GDE A;  2A8X A;  4YSX A;  4C77 A;  3GD4 A;  3QSS A;  1KF6 A;  3NIX A;  4H4W A;  4A6N A;  1L9E A;  4J2W A;  4A9W A;  4U8P A;  4OVI A;  1IUU A;  4PAB A;  2C76 A;  2GQW A;  3IWA A;  2B7S A;  2B9Y A;  1JNZ A;  2YR4 A;  5JCL A;  1F8S A;  2R4E A;  1JRX A;  2Z5X A;  1H2I A;  4BV6 A;  3CNJ A;  3P4Q A;  4LII A;  4O5Q A;  1EL8 A;  2R46 A;  4BJZ A;  1GPE A;  2C73 A;  3AEE A;  4J34 A;  1AOG A;  4C3Y A;  3UKF A;  1F8W A;  2OLO A;  3SZW A;  3IHM A;  3KU9 A;  5BRT A;  3BHF A;  3L1R A;  2R0G A;  3P1W A;  4H2Q A;  3DJG X;  2YLW A;  3CPH G;  1O5W A;  4Z2U A;  3T31 A;  3AEF A;  1Q1R A;  4C5O A;  3HZL A;  4Y4M A;  3ZDN A;  3LZW A;  1MXT A;  1ZOY A;  3CPI G;  1Y56 B;  2BXS A;  4U8O A;  1LTX R;  2F5Z A;  3UKK A;  3CNT A;  2E4G A;  4Y4L A;  3ZYX A;  4K5S A;  3LB8 A;  1YQ3 A;  2ZBW A;  4NTD A;  4BK1 A;  3LOV A;  4JY2 A;  2WDR A;  3HYW A;  4LA1 A;  4TM4 A;  3GYI A;  1QJD A;  3CTY A;  2WQY A;  4B67 A;  2AQJ A;  2E1M A;  3GWF A;  4U2L A;  2NVK X;  3C96 A;  2AAQ A;  1M6I A;  1REO A;  2IID A;  2JBV A;  4NNJ A;  4CRT A;  4DGK A;  1TDN A;  3LJP A;  3EPT A;  2ZZB A;  4NTE A;  3SFD A;  4OPL A;  1JRY A;  2C64 A;  2B7R A;  5FS6 A;  3KPF A;  4EIQ A;  2GAH B;  2QA1 A;  3C4A A;  3URH A;  2WET A;  2APG A;  2JB2 A;  2VVM A;  2BC0 A;  2C3D A;  4H4X A;  5FS7 A;  2XVH A;  2YG4 A;  4H2N A;  1MOK A;  3NT6 A;  5JCM A;  2XFP A;  4DSH A;  1E1M A;  2TPR A;  2DKH A;  2C72 A;  2Y6Q A;  1Y0P A;  3QFB A;  4EQS A;  4UP3 A;  2WPE A;  2X50 A;  3UTE A;  4C3X A;  2JB1 A;  4YSZ A;  4ECH A;  1IUS A;  3DK8 A;  4MJW A;  5KNL A;  4J56 A;  3CMM A;  2BS4 A;  3GDP A;  4H50 A;  1CJ2 A;  2BK3 A;  3KD9 A;  1K0L A;  3II4 A;  1F6M A;  1L9D A;  2Q0L A;  3CGC A;  1HYU A;  1D7Y A;  2YQU A;  2R0P A;  3SYI A;  3VRA A;  4BK3 A;  3Q9T A;  2R4J A;  4J36 A;  5JCI A;  4EMI A;  1P2E A;  3K7T A;  4NZH A;  2BS2 A;  4CY8 A;  4TLX A;  4CCR A;  2CVJ A;  2C65 A;  3NLC A;  4AT2 A;  3P9U A;  3M12 A;  2GR3 A;  2YLZ A;  4NTC A;  3K7M X;  1GXF A;  3AEB A;  2YR6 A;  1Y56 A;  2HQM A;  1W4X A;  2X99 A;  3P4R A;  4U8L A;  1RP0 A;  4USR A;  1KFY A;  2WP5 A;  1GND A;  2GAG B;  1O94 A;  4H4S A;  1GTH A;  1V59 A;  3DJJ A;  1O95 A;  2GR1 A;  1OJD A;  3P4S A;  3JSK A;  4D03 A;  3KVE A;  4CNJ A;  3O0H A;  2WHD A;  4YTM A;  4IA6 A;  2C66 A;  3ATQ A;  3FBS A;  1FEC A;  3NNE A;  4I58 A;  2OLN A;  1CBO A;  2VOU A;  1ZDL A;  1KDG A;  2Q0K A;  2WDQ A;  2YM1 A;  1NG3 A;  3ALJ A;  5EB4 A;  4XXG A;  2OAL A;  1CL0 A;  1YY5 A;  2C70 A;  4FX9 A;  3T37 A;  5U1O A;  3AYL A;  4EMJ A;  4KX6 A;  3PG6 A;  4H4Q A;  3T14 A;  3QFA A;  4B64 A;  3UKH A;  1PDH A;  1NPX A;  1N4V A;  3T0K A;  1GAL A;  4K7Z A;  1COY A;  2YWL A;  3T2Y A;  2V6O A;  3PO7 A;  1EL5 A;  3VQR A;  5KMP A;  4EM3 A;  1PJ6 A;  1GRG A;  4KPR A;  2WPC A;  3F8D A;  4TM1 A;  4NEW A;  4DSG A;  2YVF A;  4XWZ A;  4M52 A;  2XFU A;  3ALM A;  4G6G A;  1H84 A;  1FEA A;  4GAP A;  4Z2T A;  1MO9 A;  1CHU A;  1DOC A;  1GET A;  2R45 A;  3S5W A;  1GRH A;  4JNA A;  1GRT A;  1Q1W A;  3SXI A;  1K0J A;  2RGJ A;  4U8K A;  5KOW A;  4OPC A;  4JN9 A;  2X8G A;  2EQ7 A;  4JNQ A;  1ZY8 A;  3QJ4 A;  2BCG G;  3NYF A;  2YLS A;  2WEU A;  3UOY A;  3DK4 A;  3DJE A;  4YTP A;  2GR2 A;  2I0Z A;  3C4N A;  3FMW A;  4GDP A;  1DJN A;  1FEB A;  3AXB A;  3F8P A;  4OPU A;  1LV0 A;  1GSN A;  1GTE A;  3AB1 A;  2VRM A;  5GRT A;  2FJD A;  5KRQ A;  2YG7 A;  3GWD A;  3VR8 A;  5JCK A;  2QAE A;  3BNU A;  3NTA A;  1ONF A;  5KMS A;  3M13 A;  3PVC A;  1DXL A;  1QO8 A;  4U2S A;  3SM8 A;  4H4R A;  3NK0 X;  3AE4 A;  1BKW A;  2GH5 A;  2WU5 A;  4PAA A;  1PN0 A;  2RGH A;  1S2Q A;  1PBD A;  4YSY A;  5IQ4 A;  2XLT A;  2VVL G;  3KKJ A;  5FS8 A;  5HHF A;  4EMW A;  3DME A;  2BRA A;  1KNR A;  1JEH A;  2J3N A;  1ZMD A;  2GMJ A;  4EQW A;  1S3B A;  3G5R A;  1GRB A;  2GEW A;  1H82 A;  1RSG A;  5CKU A;  1PJ7 A;  1VDC A;  1D4E A;  2V61 A;  3QVP A;  2XVI A;  2YG6 A;  1XAN A;  1NHR A;  2ACZ A;  3CGD A;  3AEC A;  3IF9 A;  4I59 A;  3GRT A;  3IC9 A;  4H4Z A;  3UOX A;  1E7P A;  5U63 A;  1LPF A;  2OAM A;  4BK2 A;  1ZK7 A;  3B3R A;  4N9X A;  4U8N A;  1VRQ B;  3NHO X;  5IQ1 A;  5KXJ A;  1NHS A;  1PHH A;  4CY6 A;  2C7G A;  3T2K A;  1XPQ A;  4OPT A;  3LZX A;  3NTD A;  4GUV A;  3UKA A;  3GD3 A;  2EQ8 A;  4RG3 A;  1ZP0 A;  2YVJ A;  1H7W A;  2V5Z A;  1N4W A;  4OPI A;  5KVH A;  1P2H A;  2BAB A;  2C67 A;  4A79 A;  4Z2R A;  4Z25 A;  4Z26 A;  1DOE A;  4ADW A;  1B37 A;  3L5O A;  1CC6 A;  1BGN A;  1PS9 A;  1PBB A;  4A99 A;  2B9X A;  4UDR A;  1NEK A;  1B5Q A;  3IHG A;  3AD8 B;  5HXI A;  4G73 A;  4BJY A;  1TDF A;  4NEV A;  1GEU A;  1KN0 A;  2VZ2 A;  1CJC A;  1CC4 A;  1DOD A;  2BC1 A;  2GQF A;  1ELI A;  1GER A;  2ZZ0 A;  2CDU A;  2QA2 A;  1L0V A;  3AYI A;  3KLJ A;  3AE7 A;  4EM4 A;  3AE8 A;  2W0H A;  3NN6 X;  1IUT A;  1PBC A;  2BCP A;  1VG0 A;  2B9W A;  3DJD A;  3H8I A;  2YR5 A;  3GSI A;  3P4P A;  5FS9 A;  1EL7 A;  4A7A A;  5BUK A;  1YQZ A;  2EQ6 A;  4U8M A;  3HYV A;  3COX A;  1NG4 A;  2A87 A;  4H2P A;  2RGO A;  1B4V A;  2JKC A;  3QVR A;  1JRZ A;  4IV9 A;  1H7X A;  2WBA A;  3UKP A;  2WDV A;  1DOB A;  3PS9 A;  4REK A;  4A6N B;  4YTN A;  2QCU A;  3AE9 A;  5KOX A;  3DH9 A;  4YSH A;  3H8L A;  2RAB A;  1Q9I A;  4RG4 A;  2YVG A;  3E1T A;  4XWR A;  2XYO A;  4G9K A;  5FMH A;  4J31 A;  1NAA A;  4NWZ A;  2WU2 A;  1IUV A;  4WX1 A;  2ARD A;  1N4U A;  4UDQ A;  5GSN A;  1H81 A;  4B63 A;  2FBW A;  4YKG A;  2OA1 A;  2PYX A;  2TMD A;  1GT8 A;  2YLT A;  4B66 A;  4JDR A;  3G5S A;  5J60 A;  2XFN A;  3G5Q A;  2WES A;  1LVL A;  2GF3 A;  3NK2 X;  2GRT A;  2C75 A;  1PXC A;  2VQ7 A;  1N1P A;  4YT0 A;  2BK4 A;  1TYP A;  2XVF A;  3DK9 A;  2Z5Y A;  3RP8 A;  3V3O A;  1DJQ A;  2E5V A;  4P9S A;  1E1K A;  1XDI A;  4FK1 A;  2YLX A;  2YAU A;  4BUR A;  1NDA A;  3AWI A;  5HY5 A;  4YKF A;  4G6H A;  1D5T A;  1TYT A;  1Z6L A;  4J57 A;  4AOS A;  1ZMC A;  3SZC A;  1GRA A;  3VRB A;  3FIM B;  4D04 A;  3ADA B;  1TDO A;  1OJA A;  2JAE A;  4HB9 A;  2XCG A;  3D9X A;  4U8I A;  2IVD A;  4CCQ A;  3ICR A;  3ICT A;  3KPK A;  1SEZ A;  3DGZ A;  4GAV A;  2V3A A;  1LJ1 A;  1NHQ A;  1E1N A;  1VQW A;  4AT0 A;  1S7M A;  3B6D A;  2YM2 A;  3ISH A;  3NRN A;  3LAD A;  3HYX A;  2CUL A;  2Y6R A;  3DA1 A;  1PBF A;  3ITJ A;  1TRB A;  2GMH A;  1D4C A;  1QLB A;  2BS3 A;  1IUW A;  2YG5 A;  4TLZ A;  5JCN A;  4DNA A;  2WS3 A;  2R9Z A;  3UTH A;  4FK1 C;  1H86 A;  2XLR A;  5HYM A;  1ZKQ A;  4U8J A;  2BYB A;  1H83 A;  1EL9 A;  3H4K A;  5IPY A;  4K8D A;  2JB3 A;  1H6V A;  2C3C A;  3RP7 A;  2BA9 A;  1E1L A;  3M0O A;  4H4Y A;  1D4D A;  3CNS A;  3NG7 X;  2GV8 A;  1BWC A;  4OCG A;  2YLR A;  3AE3 A;  1OJT A;  1E6E A;  4E0V A;  4AP3 A;  2X8H A;  3UKL A;  1M64 A;  3CGE A;  2XVJ A;  3AD7 B;  4X9M A;  3SFE A;  2JK6 A;  2AR8 A;  4APN A;  4K2X A;  5M0Z A;  3BI2 A;  3AYJ A;  2X3N A;  4LU6 A;  3FG2 P;  3CN8 A;  3AD9 B;  3S61 A;  4II3 A;  4HA6 A;  5C3J A;  2WOI A;  3NYE A;  3RHA A;  4Z24 A;  5KWF A;  1GOS A;  1KSU A;  4H4U A;  2XFQ A;  5KVI A;  3NN0 X;  5U25 A;  3ABV A;  3K30 A;  1VG9 A;  4CNK A;  1JU2 A;  1TDK A;  3AED A;  3DGH A;  1S3E A;  2BXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...