4FX9A

Structure of the pyrococcus horikoshii coa persulfide/polysulfide reductase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
444
structure length
442
Chain Sequence
MKKKVVIIGGGAAGMSAASRVKRLKPEWDVKVFEATEWVSHAPCGIPYVVEGLSTPDKLMYYPPEVFIKKRGIDLHLNAEVIEVDTGYVRVRGGEKSYEWDYLVFANGASPQVPAIEGVNLKGVFTADLPPDALAIREYMEKYKVENVVIIGGGYIGIEMAEAFAAQGKNVTMIVRGERVLRRSFDKEVTDILEEKLKKHVNLRLQEITMKIEGEERVEKVVTDAGEYKAELVILATGIKPNIELAKQLGVRIGETGAIWTNEKMQTSVENVYAAGDVAETRHVITGRRVWVPLAPAGNKMGYVAGSNIAGKELHFPGVLGTAVTKFMDVEIGKTGLTEMEALKEGYDVRTAFIKASTRPHYYPGGREIWLKGVVDNETNRLLGVQVVGSDILPRIDTAAAMLMAGFTTKDAFFTDLAYAPPFAPVWDPLIVLARVLKFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Coenzyme A disulfide reductase
publication title Structure and substrate specificity of the pyrococcal coenzyme A disulfide reductases/polysulfide reductases (CoADR/Psr): implications for S(0)-based respiration and a sulfur-dependent antioxidant system in Pyrococcus.
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
total genus 113
structure length 442
sequence length 444
chains with identical sequence B
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2012-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4fx9A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fx9A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fx9A01
2WOWA 3DA1A 2BC0A 2V3AA 2BA9A 2XLPA 2ZZCA 1B8SA 4ZCDA 2JB3A 3LZWA 3I3LA 3M13A 4U2SA 2IVEA 1P2EA 4REKA 1IUXA 4AP3A 3ICRA 2F5ZA 2BK5A 5BULA 2YG6A 3H8LA 3DJGX 1JU2A 1OJAA 4ICYA 2WS3A 1TDKA 1HYUA 4Z24A 2A89A 1E6EA 1GV4A 5GSNA 3DJDA 4FX9A 2GEWA 3CNTA 4J34A 3GWDA 4JNAA 3VQRA 2RGOA 1YQZA 2X50A 1NAAA 3QJ4A 2YG4A 4OPTA 2V3BA 3GD4A 2BXSA 2X8GA 3G5SA 3UOYA 3DK8A 2R9ZA 3AYJA 3ADAB 3BHKA 3AD7B 2JK6A 2AAQA 4H4YA 4EQRA 2WDVA 3UKLA 3RP6A 3SFDA 1P2HA 1YY5A 2BS4A 4A5LA 2CFYA 5U25A 1GRFA 2RABA 4J57A 2C67A 5IPYA 3GMBA 3NT6A 1S3BA 5JCIA 2V6OA 3B6DA 1E39A 4HA6A 1GXFA 3AECA 4EQSA 1Y0PA 4X9MA 1KSSA 3NKSA 4B63A 2C7GA 4B68A 4IVOB 3QVRA 2JKCA 3AE9A 1DXLA 4XWRA 3RP7A 1Y56A 4CCRA 3AD9B 3ATRA 3CIRA 3BNMA 1VQWA 4IV9A 4U8JA 4RG3A 2VVLA 1FCDA 1JNRA 1JRXA 3ICTA 4YSHA 3AWIA 2GR1A 2BS2A 1H82A 4Z25A 1GPEA 2ZZ0A 3AEDA 3CN8A 2YVFA 1F6MA 3CNSA 1GERA 3P4QA 2WDRA 5HYMA 2Q6UA 1VG0A 4IA5A 3CTYA 1CJ2A 1Q1RA 3UTGA 4H4QA 4H4RA 4Z2TA 1OJ9A 3NRNA 4UDRA 3REDA 1LQTA 1BZLA 3CGEA 1MOKA 4I58A 4H4ZA 5U1OA 2WHDA 1COYA 4B65A 1M64A 4KPRA 4LA1A 3BI2A 4BJZA 3AE7A 3DK4A 3CNJA 1PBEA 3IHGA 2WP5A 5J60A 4C3YA 1GETA 4OCGA 3URHA 2XFPA 5FS9A 3KLJA 1ZMDA 4U8OA 2B9YA 4M52A 4A6NB 3DK9A 5ER0A 4H2PA 1OJCA 3UCLA 2YG7A 1IJHA 1XHCA 1K0LA 1VRQB 2GH5A 3NK0X 4USRA 5IQ1A 2J3NA 3PO7A 2TPRA 4LIIA 3AE6A 1FEBA 4LU6A 2GB0A 4GF7A 3GDNA 1ZY8A 2WESA 4KX6A 5LV9A 4TM1A 2VQBA 2R4EA 3UKQA 1PJ5A 4IVMB 2BK4A 4FDCB 1LTXR 2C64A 2XFNA 4A99A 3AEFA 3V76A 3GSIA 1GRAA 3P1WA 1SEZA 1KNRA 2C72A 1CC2A 3E1TA 4E0VA 3QSMA 4ZN0A 1H86A 2GQFA 1ZKQA 4N9XA 5HY5A 3V3OA 2RGHA 4K2XA 4B66A 2CDUA 4AOSA 2YG3A 1YQ3A 2YLXA 3VRDB 3C96A 3RP8A 3WE0A 1CBOA 1PXCA 2WETA 5GRTA 2WPEA 4K8DA 3RNMA 1RYIA 4EMWA 3JSKA 4GRTA 2PYXA 1ZP0A 2YM1A 2WPCA 4J31A 3H4KA 1GRGA 2V60A 1NHRA 3UTFA 3FBSA 3G5QA 3P4PA 5FMHA 2Q0KA 1QLBA 3CNPA 3AE3A 3DGZA 5C3JA 1GNDA 5EOWA 3NK1X 3I6DA 1YQ4A 2XVHA 2Y6QA 3VRBA 1O5WA 4YSYA 3K7QX 1Z6LA 4OPLA 1Y56B 3LB8A 4JN9A 1D7LA 1FOHA 1JRZA 1S2YA 4OPGA 2CULA 3AB1A 1RP0A 2ACZA 4APNA 1EBDA 3RHAA 3O0HA 4A79A 2WOIA 1IUTA 2C70A 3R9UA 2BCGG 2OLOA 2E1MA 4C3XA 3VRAA 4EIPA 3K30A 4PAAA 2FJBA 3AE1A 1LVLA 5EBKA 4HB9A 4OPDA 3UKFA 4AT2A 2XVIA 2R0PA 2A8XA 4OPIA 1H84A 4H4UA 1CJCA 1JRYA 3CPIG 1MO9A 2WDQA 3CGCA 3ATQA 3NH3X 4U2LA 1N1PA 3K7TA 4UDPA 5L46A 4U8KA 2VRMA 2BXRA 1GT8A 2XFUA 1EL9A 1Q1WA 4TM3A 3BNUA 1D7YA 3SQPA 3GDPA 2GQWA 1E1MA 4WCTA 1GESA 1PBCA 3HZLA 2VVMA 3OZ2A 1PJ6A 3DMEA 2C3DA 2DKIA 4EM3A 1TRBA 1XANA 2BCPA 3K7MX 4GDEA 1H6VA 4BJYA 2GR3A 1PXAA 1YKJA 2C65A 4TM4A 4GR1A 5J7XA 1VDCA 1GTHA 2XLRA 3NIXA 2VZ2A 5KVHA 3AEEA 2GMJA 3LADA 4A65A 3NTDA 4Y4MA 2GV8A 3PS9A 4UDQA 4U8PA 3ZYXA 4B69A 2BS3A 1BKWA 1X31B 2R0CA 4AOXA 4H4SA 1S3EA 1VG9A 3SGLA 4A9WA 5FS7A 2W0HA 3B3RA 1TDNA 1PBBA 3CGBA 4C74A 4Z26A 3UKPA 4MJWA 5KWFA 3KKJA 4BK1A 4B67A 5JCKA 2GMHA 2GAGB 1EL7A 3BI5A 2WP6A 3BHFA 2PHHA 3IHMA 4J33A 1FEAA 3S5WA 4AT0A 2EQ8A 4EMIA 1KFYA 2RGJA 1GSNA 1ZK7A 4K22A 1S2QA 3QSEA 2X3NA 1GTEA 2E5VA 1DNCA 4BV6A 3P9UA 1QO8A 1JEHA 5CQFA 3DJEA 3CGDA 2YLSA 3P4SA 3UP5A 1GRHA 2YVGA 2FJDA 2XLSA 2EQ6A 3EAOA 2YM2A 4FK1A 4O5QA 3GWFA 3D8XA 2OA1A 1KF6A 3AEGA 1OJDA 2NVKX 4CRTA 1L9CA 3F8DA 4NTDA 1BGJA 2O9ZA 2ZBWA 1LJ1A 2R45A 3EPTA 4BK3A 3GD3A 2XCGA 1CL0A 3ALJA 1LV0A 2A87A 1N4UA 1CC6A 2OALA 1D4EA 1IUVA 2YLWA 4XXGA 3ICSA 3SFEA 3AE2A 3ALLA 3LJPA 3L1RA 2H88A 1JNZA 1PXBA 2YLTA 3PVCA 1KDGA 2WU5A 2ZZBA 1ONFA 5EB5A 3Q6JA 4YT0A 4JQ9A 5BUKA 4TLXA 2X8HA 3LZXA 4OPUA 4Y4NA 4D03A 4TLZA 1PHHA 5M0ZA 2B76A 4B1BA 4CBQA 1ZMCA 1B37A 1PBDA 5HXIA 2EQ7A 4U2TA 2XFOA 4X9NA 3M0OA 2YG5A 4J36A 3GMCA 2WEUA 4BK2A 2XLUA 3COXA 2BACA 3ZDNA 3EANA 1RSGA 3QSSA 1NHSA 1CC4A 3FIMB 5CKUA 1GRBA 4H50A 1EL5A 5FS6A 3NHOX 4EIQA 3GYJA 2QCUA 4GDPA 1E7PA 3AXBA 4NTEA 5EB4A 2OAMA 1Q9IA 3F8PA 5U63A 4H4VA 4FK1C 1GOSA 4CNKA 2C75A 3IC9A 4GUVA 1W4XA 5M10A 4RSLA 1PDHA 3AYLA 1TDFA 4U8NA 2YLZA 2V61A 1BWCA 1NHPA 2Y6RA 3ABVA 5KRQA 4EQWA 3L8KA 1NHQA 3UTHA 3NTAA 2WQYA 2EQ9A 1E1LA 1H83A 2GVCA 3CPHG 4NEWA 4H2RA 4YKFA 1NEKA 2YLRA 4Z44A 4DSHA 2WP9A 1H7WA 4K7ZA 2VOUA 2XYOA 1PJ7A 4TM0A 3UTEA 1CHUA 2QA1A 4Z43A 4H4TA 3KPFA 2IIDA 1D4CA 2UZZA 1ZDLA 2NPXA 2ARDA 1ZOYA 3KD9A 1V59A 5KOXA 4CY8A 4YWOA 1DJQA 1DODA 1GREA 3IF9A 1IUUA 3ITJA 3M12A 4OVIA 3CNDA 1QJDA 2AR8A 1BGNA 2Z5XA 4CNJA 4NEVA 1F8WA 2GF3A 2Q0LA 2XFQA 2JB1A 4JNQA 2OLNA 3DGHA 3QFBA 3KA7A 4H7UA 1DOEA 1K4QA 4JY2A 1PN0A 4IA6A 4AP1A 1L9DA 4H2NA 3DH9A 2YR5A 3LOVA 1F8SA 5HHFA 4DGKA 3SM8A 2C3CA 2X99A 3P4RA 1REOA 1OJTA 3AE4A 3GRTA 3QVPA 1H7XA 4YXDA 2FJAA 4H4XA 2H89A 4K5RA 4U8MA 2B7SA 4Y4LA 2CVJA 5C2TA 1GEUA 2TMDA 5KOWA 3DJJA 2BABA 4YKGA 3OC4A 4Z2RA 2AQJA 3UOXA 4B64A 3FMWA 2DKHA 4BURA 1DOCA 2I0ZA 2JB2A 3T37A 1E1NA 4Z2UA 1PBFA 3D1CA 3KVEA 3FG2P 4D04A 1LPFA 1NENA 3CPJG 4OPCA 3NK2X 2C73A 3NG7X 3LXDA 2C66A 4NTCA 4YTMA 2YVJA 2Q7VA 1E1KA 3AE8A 3H8IA 2WOVA 1N4WA 5IQ4A 2JBVA 3QFAA 2WPFA 1ZX9A 2C76A 3ALMA 3NYCA 1K0JA 1XPQA 2BYBA 1ELIA 3F8RA 3FPZA 4XWZA 1L0VA 4YTPA 3UKAA 1IUSA 1DJNA 3AD8B 1TYPA 4DNAA 4EQXA 1TYTA 4C77A 5JCLA 4JY3A 3UKKA 1O95A 2GR0A 4O5UA 4U8LA 5TR3A 3Q9TA 1KSUA 1L9EA 5DBJA 2R4JA 4H4WA 4USQA 4YSXA 3GRSA 4ZCCA 2BK3A 4H2QA 1O94A 3II4A 1NG4A 2HQMA 1PS9A 4YTNA 5JCMA 3IWAA 2E4GA 4X4JA 1DOBA 2GRTA 1H81A 2XLTA 2XVFA 4CY6A 2WBAA 1CJ3A 4GCMA 3UKHA 3G5RA 4YSZA 4RG4A 3BI4A 2YWLA 5KXJA 4DSGA 2BC1A 1IUWA 2YR4A 1GALA 3NN0X 3NLCA 2GR2A 4ADWA 1BF3A 3NN6X 4P9SA 3UOVA 3KU9A 1TDEA 1TDOA 2APGA 2FJEA 4J56A 2R46A 3VR9A 2Z5YA 1NDAA 2FBWA 1NG3A 1AOGA 3EF6A 3S61A 4NZHA 4H4PA 1EL8A 4EM4A 1LQUA 2VVLG 1GRTA 2XVEA 1NPXA 1F3PA 2R0GA 4U8IA 1UKVG 4I59A 4CCQA 1CF3A 2VQ7A 1XDIA 5JCNA 3V3NA 3VR8A 2B7RA 2QAEA 1M6IA 1N4VA 1K0IA 1B5QA 2V5ZA 3NNEA 4UP3A 2X8CA 1FL2A 1CJ4A 4PABA 2GAHB 2VRLA 3C4AA 1B4VA 1D5TA 2YR6A 1FECA 2IVDA 3NGCX 3UOZA 1KNPA 3NYFA 4C5OA 3AYIA 3NYEA 1ZOVA 3ISHA 4A7AA 4ECHA 2B9XA 5BRTA 2B9WA 4A6NA 3GYIA 4EMJA 4WX1A 3AE5A 2XVJA 1D4DA 2WU2A 2QA2A 4K5SA 2XDOA 4J2WA 2YAUA 5FS8A 1JOAA 4JDRA 2JAEA 5KVIA 1MXTA 3C4NA 3UP4A 2YQUA 3AEBA 1F8RA 3AEAA 5BVAA
chains in the Genus database with same CATH superfamily
2ZZCA 4U2SA 2IVEA 2BK5A 5EU9A 2YG6A 4ICYA 1TDKA 1GV4A 4E4UA 3DJDA 3CXOA 3VQRA 3QJ4A 4OPTA 2V3BA 3GD4A 2R9ZA 3ADAB 2AL1A 2JK6A 1P2HA 2CFYA 2QDEA 3ENLA 5IPYA 3GMBA 2XH0A 3HW2A 3U9IA 1WUEA 1E39A 4EQSA 1Y0PA 1KSSA 4G6GA 3RP7A 3AE9A 4K8GA 3D47A 3UJRA 1FCDA 1JNRA 1JRXA 4YSHA 4KWSA 1H82A 4YWSA 3ZLFA 5HYMA 4IA5A 3UTGA 1CJ2A 2HXTA 4H4QA 4Z2TA 1OJ9A 1DTNA 1LQTA 3SN4A 1COYA 3A7UA 3OZMA 3URHA 5FS9A 1JDFA 1ZMDA 3UCLA 2YG7A 1XHCA 4USRA 2J3NA 2GB0A 2WESA 2VQBA 4MGGA 1F9CA 2XFNA 3AEFA 2C72A 3UJSA 1CC2A 5HY5A 2GQFA 3FJ4A 4HPNA 4AOSA 2YG3A 1YQ3A 3EEZA 1RYIA 3JSKA 3TJ4A 4GRTA 2YM1A 2WPCA 4J31A 3MQTA 2V60A 3G5QA 3L5OA 3P3BA 3DGZA 4NNJA 5G5GB 2P88A 2OQYA 3VRBA 4NWZA 1JRZA 1S2YA 4K1WA 2ACZA 1EC9A 4II2A 1FO4A 4C3XA 1LVLA 4HB9A 3A7RA 1H84A 1OEPA 2HXUA 2E3TA 1MO9A 2OZ8A 1S7MA 3K7TA 4E5TA 2VRMA 1GT8A 2XFUA 2PP1A 1EL9A 2QDDA 4TM3A 1D7YA 3GDPA 1KD0A 3N6JA 3HZLA 2VVMA 4MMWA 2C3DA 2FKPA 4GDEA 1VDCA 1L8PA 3OTRA 2W54A 3LADA 3PS9A 4U8PA 3AMZA 1S3EA 2P8CA 1TDNA 4Z26A 5KWFA 4KPLA 3HPFA 1EBHA 2GMHA 2GAGB 1EL7A 3IHMA 3S5WA 3NXLA 3UGVA 2RGJA 3P0WA 4A3RA 2OKTA 3P9UA 1TZZA 1JEHA 5CQFA 2YLSA 1GRHA 2XLSA 3T9PA 3AEGA 3SN1A 3QLDA 1LJ1A 2XCGA 2PA6A 2A87A 2OALA 3STPA 4GIRA 1JNZA 2ZZBA 3R1ZA 3FV9A 5BUKA 4Y4NA 1W6TA 5M0ZA 4B1BA 1PBDA 4U2TA 3GMCA 2PSNA 2WEUA 4BK2A 1NHSA 3FIMB 3NVWB 1PDZA 3OZYA 4GDPA 4GYPA 3AXBA 1FFVC 4CNKA 2V61A 1N62C 3ABVA 4EQWA 2PS2A 4TVYA 3NTAA 2WQYA 2EQ9A 1H83A 4H2RA 4NEWA 1H7WA 4K7ZA 3UTEA 2PMQA 1D4CA 1JCTA 4GFIA 1ZDLA 3KD9A 3M12A 1FHUA 1QJDA 1BGNA 4NEVA 1F8WA 2GF3A 2Q0LA 2OLNA 1KKOA 3QFBA 1DOEA 1K4QA 3A7AA 4IA6A 4H2NA 1F8SA 3D46A 1OJTA 4YXDA 2PU0A 5C2TA 1GEUA 3B9JB 2O56A 2JB2A 3T0KA 4KEMA 4DHGA 4F4RA 1NENA 4NTCA 2Q7VA 3H8IA 2WOVA 2GSHA 2JBVA 1XPQA 3F8RA 4XWZA 1DJNA 4K2SA 5JCLA 5TR3A 5DBJA 3HYVA 4YSXA 3PG6A 2HQMA 4G73A 4YTNA 3UJEA 3CT2A 3SY4A 4GCMA 2YWLA 2BC1A 3T2KA 1IUWA 3FCPA 3UOVA 1TDEA 4J56A 5KMPA 2PPGA 3NVVB 2GDQA 3HYWA 4H4PA 4M0XA 2OFJA 1JPDX 2R0GA 4U8IA 4CCQA 1XDIA 3V3NA 3NS1B 3BJSA 2OZ3A 2YR6A 3SR6B 3NRZB 1FECA 3NGCX 3AYIA 1ZOVA 4A7AA 2OLAA 2B9XA 2B9WA 3Q45A 3T8QA 3UP4A 1MXTA 4RG4A 2YQUA 1F8RA 5KMQA 5BVAA 2WOWA 3TOYA 2BA9A 1B8SA 2JB3A 4REKA 3ICRA 5J04A 4A6GA 5GSNA 3V3WA 3VCCA 4FX9A 4GAPA 2GEWA 3GWDA 7ENLA 2X50A 1NAAA 2BXSA 3G5SA 3UOYA 3B97A 4EQRA 1V97A 6ENLA 1GRFA 3N6HA 5JCIA 1GXFA 4GYPC 4X9MA 3QVRA 1DXLA 3AD9B 3ATRA 3CIRA 3BNMA 4U8JA 4RG3A 4ENLA 3AWIA 2GR1A 2PP0A 3R11A 3CAWA 3AEDA 4HNLA 3CN8A 1GERA 3P4QA 1VG0A 1H2IA 1Q1RA 3EKGA 2PTYA 3NRNA 1BZLA 1MOKA 4I58A 4B65A 1M64A 4KPRA 2ZADA 3AE7A 2DW6A 3CNJA 2PU1A 1PDYA 2WP5A 3TQPA 4C3YA 2XFPA 3KLJA 2B9YA 4M52A 4A6NB 5ER0A 1K0LA 4DWDA 4LU6A 3GDNA 5LV9A 4TM1A 1RVKA 3R0KA 2R4EA 3UKQA 5JRBA 4IVMB 3QTPA 3P1WA 1ZKQA 4N9XA 3V3OA 2P8BA 4B66A 2QJNA 2YLXA 3SZFA 3WE0A 4EMWA 1ZP0A 3H4KA 2Q0KA 3VA8A 3NK1X 3I6DA 1R6WA 2XVHA 1Z6LA 1Y56B 5FJPA 1FOHA 2PP3A 2CULA 3AB1A 3RITA 4APNA 1EBDA 3CYJA 4II3A 2C70A 2BCGG 1T3QC 4EIPA 4PAAA 3SSZA 3DIPA 1TKKA 2PGEA 5EBKA 2XVIA 4OPIA 3SZCA 3SZ0A 4G9KA 1JRYA 5BOEA 3ATQA 4U2LA 3T2ZA 2BXRA 1Q1WA 1GESA 1PBCA 4H1ZA 4EM3A 1XANA 2BCPA 2BRYA 3K7MX 2GR3A 2PCEA 4GR1A 3H12A 5KVHA 3NTDA 1KN0A 2BS3A 1BKWA 3ZLHA 3SGLA 3B3RA 4C74A 4G7FA 4BK1A 3H8AA 3BHFA 2PHHA 1RM6B 2EQ8A 4EMIA 3RGTA 3UCDA 1S2QA 3QSEA 2X3NA 1GTEA 2E5VA 1DNCA 1QO8A 3DJEA 3NVZB 2QJMA 2QGYA 3UP5A 2EQ6A 3GWFA 1OJDA 2NVKX 1EBGA 4CRTA 2ZBWA 2R45A 3SYIA 3GD3A 1CL0A 3VDGA 1LV0A 3CMMA 3SQSA 5BOFA 1D4EA 3ZVHB 4DN1A 3ALLA 3LJPA 3L1RA 4H19A 1PXBA 2YLTA 3Q4DA 5EB5A 1VQZA 4D03A 3JW7A 3PWIA 3T31A 4CBQA 1ZMCA 1IYXA 1JROA 1TE6A 2YG5A 3N4FA 2XLUA 3T2YA 3EANA 1RSGA 3QSSA 5CKUA 3PK7A 1EL5A 3NHOX 2CHRA 1E7PA 5FJOA 3F8PA 4FK1C 1GOSA 3V4BA 2C75A 3IC9A 3AYLA 1TDFA 1BWCA 1ECQA 3DERA 3IJQA 2Y6RA 2YLRA 4DSHA 2XYOA 4IL2A 1PJ7A 1CHUA 2QA1A 2IIDA 2UZZA 2OPJA 1V59A 4CY8A 1GREA 3SBFA 3CNDA 2Z5XA 4CNJA 2XFQA 3DGHA 5IDZA 4JY2A 1L9DA 2YR5A 3LOVA 5HHFA 4HCHA 2C3CA 1REOA 3SN0A 3QVPA 4Y4LA 2TMDA 4YKGA 2BABA 4Z2RA 2AQJA 1DOCA 2I0ZA 1E1NA 3D1CA 3KVEA 3HYXA 4OPCA 2C66A 4YTMA 2YVJA 2MUCA 3AE8A 3H70A 1N4WA 4HN8A 2C76A 3ALMA 1L0VA 4E6MA 1ELIA 4YTPA 3UKAA 1TYPA 2OX4A 4JY3A 4O5UA 3MWCA 4H2QA 1NG4A 3ES8A 3IWAA 2MNRA 5KMSA 4X4JA 2XLTA 2WBAA 4Z17A 4DSGA 3NN0X 4ADWA 3NN6X 4P9SA 3TW9A 2APGA 2PODA 1JPMA 5FJRA 1MRAA 2AKMA 1EL8A 2VVLG 2OVLA 4J3ZA 3QN3A 1BKHA 3VR8A 4GMEA 1K0IA 3NNEA 2X8CA 2GGGA 4PABA 2IVDA 1KNPA 4C5OA 2QQ6A 4A6NA 3GYIA 4EMJA 3AE5A 1D4DA 2WU2A 4K5SA 2XDOA 1JOAA 3HRDC 3C4NA 3KPKA 3SZWA 2XLPA 3LZWA 3M13A 1P2EA 4AP3A 1IUXA 2F5ZA 1OJAA 1HYUA 3V5FA 2GL5A 1E6EA 4FP1A 3CNTA 4J34A 3DG3A 2RGOA 1YQZA 4KT2A 3RCYA 1N5XA 3AD7B 3ES7A 3MY9A 3EUB3 3SFDA 3OP2A 3R25A 4A5LA 5U25A 3TJIA 2RABA 2POZA 3DFYA 4G6HA 3NKSA 4B68A 2JKCA 3RRAA 4XWRA 1Y56A 4CCRA 3VC5A 4IV9A 2VVLA 3ICTA 2BS2A 1GPEA 4JN7A 4JN8A 2YVFA 1F6MA 2Q6UA 3CTYA 4UDRA 3NO1A 4ZCWA 4H4ZA 5U1OA 3BI2A 4BJZA 4G8TA 1PBEA 4H2PA 1EC7A 3NK0X 4IP5A 3PO7A 1VDVA 4IT1A 1STZA 4FDCB 1LTXR 4TVWA 1FHVA 3I4KA 5FJTA 4A99A 3GSIA 3E1TA 4E0VA 3QSMA 4ZN0A 1H86A 4K2XA 4HCLA 2CDUA 4H2HA 3VRDB 4GAVA 1PXCA 2WPEA 4K8DA 1GRGA 1NHRA 3UTFA 3P4PA 3DDMA 3AE3A 5C3JA 1GNDA 1X2GA 2Y6QA 4YSYA 3K7QX 1SJDA 4OPGA 1RP0A 3UXLA 2NQLA 3O0HA 4A79A 3ZVHA 2WOIA 3R9UA 2E1MA 2FJBA 3UKFA 2R0PA 2W55A 3CXBA 1CJCA 1P43A 3NH3X 3DG7A 1N1PA 5L46A 4U8KA 3DGBA 2GQWA 1E1MA 1KKRA 3OZ2A 1PJ6A 3DMEA 3S5SA 1TRBA 4BJYA 1PXAA 1YKJA 2C65A 1GTHA 2XLRA 3NIXA 3FYYA 2GV8A 4UDQA 3I6TA 2R0CA 4AOXA 1VG9A 3BOXA 4A9WA 3CGBA 4MJWA 3RR1A 3BI5A 4AT0A 1ZK7A 4BV6A 2OG9A 3CGDA 3P4SA 2FJDA 4FK1A 3EAOA 5KMRA 2XGZA 1ONEA 2XSXA 3D8XA 4EWJA 1L9CA 3RO6A 1BGJA 2O9ZA 4BK3A 3EPTA 3ALJA 1N4UA 1CC6A 3K1GA 2QVHA 3ICSA 3SFEA 3N4EA 2H88A 1KDGA 1ONFA 3Q6JA 2OO6A 4YT0A 4TLZA 1EC8A 4IHCA 2XFOA 5FJUA 2P3ZA 4DXKA 3COXA 4GISA 3ZDNA 1CC4A 4H50A 5FS6A 4EIQA 2QCUA 3VCNA 4NTEA 4DX3A 2OQHA 2OAMA 4H83A 4H4VA 4GUVA 1W4XA 1PDHA 4U8NA 3L8KA 1NHQA 1E1LA 3CPHG 4YKFA 1NEKA 4Z44A 2VOUA 4ZA0A 4TM0A 4H4TA 3KPFA 2BRAA 3JVAA 2ARDA 1ZOYA 4M6UA 2I5QA 3ITJA 4YWOA 1DJQA 1DODA 3IF9A 3PFRA 4OVIA 3R10A 2AR8A 2JB1A 4JNQA 3GY1A 4H7UA 3KA7A 1PN0A 4AP1A 3DH9A 4J1OA 3SM8A 3P4RA 3GRTA 1H7XA 2FJAA 2H89A 4U8MA 3P93A 2CVJA 3MSYA 4MKSA 3V5CA 3UOXA 3FMWA 4BURA 4Z2UA 2W3SA 1PBFA 1LPFA 3CPJG 1ELSA 2RDXA 2C73A 3LXDA 1WYGA 2C4CA 5IQ4A 3QFAA 3U4FA 3NYCA 2BYBA 1NELA 1IUSA 3AD8B 1TYTA 4C77A 3UKKA 1O95A 1SJAA 1X2HA 3Q9TA 1KSUA 1L9EA 2R4JA 4H4WA 4ZCCA 2BK3A 4HCDA 5JCMA 2HNEA 2GRTA 2XVFA 4CY6A 3UKHA 3G5RA 4YSZA 5KXJA 2GGHA 1GALA 3NLCA 2GR2A 1TDOA 2R46A 2Z5YA 1NDAA 3IJIA 3S61A 3EF6A 4EM4A 1N5WC 1LQUA 1SJCA 2XVEA 1ZXIC 1UKVG 4I59A 1P48A 2PGWA 1M6IA 2PTZA 1N4VA 4UP3A 1B5QA 2V5ZA 2DW7A 2OZTA 1FL2A 2GAHB 2VRLA 3C4AA 1B4VA 1D5TA 3UOZA 3ZVIA 3NYFA 1MDLA 4GGHA 4ECHA 5BRTA 4WX1A 3TWBA 3MUCA 2QA2A 4GGBA 2YAUA 5FS8A 4JDRA 2JAEA 1YQ4A 3AEAA 2XH2A 3DA1A 2BC0A 2V3AA 3H7VA 4ZCDA 4IL0A 3I3LA 3SJNA 3S47A 5BULA 3H8LA 3DJGX 1JU2A 2WS3A 3CB3A 4Z24A 2A89A 4JNAA 2P0IA 4DYEA 2YG4A 2X8GA 3DK8A 3AYJA 3BHKA 4HNCA 2AAQA 4H4YA 3GO2A 2WDVA 3UKLA 3RP6A 2BS4A 1YY5A 3DESA 2C67A 4J57A 4X2PA 3NT6A 1S3BA 2V6OA 3B6DA 4HA6A 3AECA 4B63A 2C7GA 4IVOB 1VQWA 4Z25A 2ZZ0A 3IJLA 4IZGA 3CNSA 2GGJA 2WDRA 3MKCA 2ONEA 4H4RA 3NVYB 3REDA 2PTWA 3CGEA 2WHDA 4LA1A 3DK4A 3IHGA 5J60A 3VFCA 1GETA 4OCGA 4U8OA 3DK9A 1OJCA 1IJHA 3DG6A 1VRQB 2GH5A 1XS2A 5IQ1A 2TPRA 4LIIA 3AE6A 1FEBA 2AL2B 4FI4A 4GF7A 1ZY8A 4KX6A 3T14A 3UXKA 1PJ5A 2BK4A 2C64A 3V76A 1GRAA 1SEZA 1KNRA 2RGHA 1KCZA 3C96A 3RP8A 1CBOA 2WETA 5GRTA 3TWAA 3RNMA 2PYXA 3FBSA 3PWGA 3MZNA 5FMHA 4HYRA 1QLBA 1FIQB 3R0UA 3CNPA 5EOWA 1JRPA 1O5WA 4OPLA 3LB8A 4JN9A 3UCCA 1D7LA 1XPYA 2XH4A 1N63C 3T6CA 3RHAA 1IUTA 2OLOA 3VRAA 3K30A 3AE1A 4OPDA 4AT2A 3T4WA 2A8XA 4H4UA 3CPIG 2WDQA 3CGCA 4UDPA 1YEYA 3AN1A 3BNUA 3SQPA 1SB3B 3TCSA 4WCTA 4G74A 1N60C 2XH7A 2DKIA 4ZOHB 1H6VA 4TM4A 5J7XA 5G5HB 4A35A 3VC6A 3I6EA 2VZ2A 3AEEA 2GMJA 4A65A 4Y4MA 3ZYXA 4B69A 4E4FA 1X31B 4H4SA 5FS7A 2W0HA 1PBBA 3UKPA 2PTXA 3KKJA 4B67A 5JCKA 2WP6A 4J33A 1FEAA 1KFYA 1SJBA 1GSNA 3DEQA 4K22A 2YVGA 2YM2A 4O5QA 2OA1A 1KF6A 3UJFA 3QPEA 3F8DA 4NTDA 4JHMA 3QKEA 1IUVA 2YLWA 4XXGA 3SXIA 3AE2A 3PVCA 4IP4A 2WU5A 3THUA 3GYXA 3ETRB 4JQ9A 4TLXA 2X8HA 2ZC8A 3LZXA 4OPUA 1PHHA 2B76A 1B37A 5HXIA 2EQ7A 3FXGA 4X9NA 1FFUC 3M0OA 4J36A 1MUCA 2BACA 3BSMA 1GRBA 3TTEA 3GYJA 5EB4A 3KUMA 1Q9IA 5U63A 4Z1YA 5M10A 2GGEA 4RSLA 2YLZA 1NHPA 5KRQA 3UTHA 2GVCA 3OW1A 2WP9A 3AM9A 4Z43A 4E8GA 2NPXA 3FVDA 5KOXA 1IUUA 2AKZA 3DFHA 5ENLA 1N61C 2W3RA 4DGKA 2X99A 3AE4A 2GGIA 4H4XA 4K5RA 2B7SA 5KOWA 3DJJA 3D9XA 3OC4A 4B64A 2DKHA 3T37A 1NU5A 3FG2P 4D04A 1MDRA 3NK2X 3SX6A 3NFUA 3NG7X 3JZUA 1E1KA 2WPFA 1ZX9A 1K0JA 5KNLA 3GC2A 3FPZA 3UJ2A 4DNAA 4EQXA 2GR0A 3CK5A 4U8LA 4USQA 3GRSA 1O94A 3II4A 1PS9A 3R07C 2E4GA 1BQGA 1DOBA 1H81A 1MNSA 1CJ3A 3BI4A 2YR4A 1BF3A 3KU9A 2FJEA 3VR9A 3NZGA 3ZLGA 2FBWA 1NG3A 1AOGA 4NZHA 2HZGA 4ROPA 1GRTA 1NPXA 1F3PA 1CF3A 2VQ7A 3GD6A 5JCNA 2B7RA 2QAEA 3OPSA 2FYMA 2QJJA 1CJ4A 2E5AA 3IK4A 1WUFA 3NYEA 3ISHA 1R0MA 2XVJA 1E9IA 4J2WA 5KVIA 2AL2A 3AEBA
chains in the Genus database with same CATH topology
2WOWA 3DA1A 2BC0A 2V3AA 2BA9A 2XLPA 2ZZCA 1B8SA 4ZCDA 2JB3A 3LZWA 3I3LA 3M13A 4U2SA 2IVEA 1P2EA 4REKA 1IUXA 4AP3A 3ICRA 2F5ZA 2BK5A 5BULA 2YG6A 3H8LA 3DJGX 1JU2A 1OJAA 4ICYA 2WS3A 1TDKA 1HYUA 4Z24A 2A89A 1E6EA 1GV4A 5GSNA 3DJDA 4FX9A 4GAPA 2GEWA 3CNTA 4J34A 3GWDA 4JNAA 3VQRA 2RGOA 1YQZA 2X50A 1NAAA 3QJ4A 2YG4A 4OPTA 2V3BA 3GD4A 2BXSA 2X8GA 3G5SA 3UOYA 3DK8A 2R9ZA 3AYJA 3ADAB 3BHKA 3AD7B 2JK6A 2AAQA 4H4YA 4EQRA 2WDVA 3UKLA 3RP6A 3SFDA 1P2HA 1YY5A 2BS4A 4A5LA 2CFYA 5U25A 1GRFA 2RABA 4J57A 2C67A 5IPYA 3GMBA 3NT6A 1S3BA 5JCIA 2V6OA 3B6DA 1E39A 4G6HA 1GXFA 3AECA 4HA6A 4EQSA 1Y0PA 4X9MA 1KSSA 3NKSA 4B63A 2C7GA 4B68A 4IVOB 3QVRA 4G6GA 2JKCA 3AE9A 1DXLA 4XWRA 3RP7A 1Y56A 4CCRA 3AD9B 3ATRA 3CIRA 3BNMA 1VQWA 4IV9A 4U8JA 4RG3A 2VVLA 1FCDA 1JNRA 1JRXA 3ICTA 4YSHA 3AWIA 2GR1A 2BS2A 1H82A 4Z25A 1GPEA 2ZZ0A 3AEDA 3CN8A 2YVFA 1F6MA 3CNSA 1GERA 3P4QA 2WDRA 5HYMA 2Q6UA 1VG0A 4IA5A 1H2IA 1CJ2A 1Q1RA 3CTYA 4H4QA 3UTGA 4H4RA 4Z2TA 1OJ9A 3NRNA 4UDRA 3REDA 1LQTA 1BZLA 3CGEA 1MOKA 4I58A 4H4ZA 5U1OA 2WHDA 1COYA 4B65A 1M64A 4KPRA 4LA1A 3BI2A 4BJZA 3AE7A 3DK4A 3CNJA 1PBEA 3IHGA 2WP5A 5J60A 4C3YA 1GETA 4OCGA 3URHA 2XFPA 5FS9A 3KLJA 1ZMDA 4U8OA 2B9YA 4M52A 4A6NB 3DK9A 5ER0A 4H2PA 1OJCA 3UCLA 2YG7A 1IJHA 1XHCA 1K0LA 1VRQB 2GH5A 3NK0X 4USRA 5IQ1A 2J3NA 3PO7A 2TPRA 4LIIA 3AE6A 1FEBA 4LU6A 2GB0A 4GF7A 3GDNA 1ZY8A 2WESA 4KX6A 5LV9A 4TM1A 2VQBA 2R4EA 3T14A 3UKQA 5JRBA 1PJ5A 4IVMB 2BK4A 4FDCB 1LTXR 2C64A 2XFNA 4A99A 3AEFA 3V76A 3GSIA 1GRAA 3P1WA 1SEZA 1KNRA 2C72A 1CC2A 3E1TA 4E0VA 3QSMA 4ZN0A 1H86A 2GQFA 1ZKQA 4N9XA 5HY5A 3V3OA 2RGHA 4K2XA 4B66A 2CDUA 4AOSA 2YG3A 1YQ3A 2YLXA 3VRDB 3C96A 4GAVA 3RP8A 3SZFA 3WE0A 1CBOA 1PXCA 2WETA 5GRTA 2WPEA 4K8DA 3RNMA 1RYIA 4EMWA 3JSKA 4GRTA 2PYXA 1ZP0A 2YM1A 2WPCA 4J31A 3H4KA 1GRGA 2V60A 1NHRA 3UTFA 3FBSA 3G5QA 3P4PA 3L5OA 5FMHA 2Q0KA 1QLBA 3CNPA 3AE3A 3DGZA 5C3JA 1GNDA 4NNJA 5EOWA 3NK1X 3I6DA 1YQ4A 2XVHA 2Y6QA 3VRBA 1O5WA 4YSYA 3K7QX 1Z6LA 4NWZA 4OPLA 1Y56B 3LB8A 4JN9A 1D7LA 1FOHA 1JRZA 1S2YA 4OPGA 2CULA 3AB1A 1RP0A 2ACZA 4APNA 1EBDA 3RHAA 3O0HA 4A79A 4II3A 2WOIA 1IUTA 2C70A 4II2A 2BCGG 3R9UA 2OLOA 2E1MA 4C3XA 3VRAA 4EIPA 3K30A 4PAAA 2FJBA 3AE1A 1LVLA 5EBKA 4HB9A 4OPDA 3UKFA 4AT2A 2XVIA 2R0PA 2A8XA 4OPIA 3SZCA 1H84A 3SZ0A 4H4UA 4G9KA 1CJCA 1JRYA 3CPIG 5KMQA 1MO9A 2WDQA 3CGCA 1S7MA 3ATQA 3NH3X 1N1PA 3K7TA 4U2LA 4UDPA 5L46A 4U8KA 2VRMA 3T2ZA 2BXRA 1GT8A 2XFUA 1EL9A 1Q1WA 4TM3A 3BNUA 1D7YA 3SQPA 3GDPA 2GQWA 1E1MA 4WCTA 1GESA 1PBCA 3HZLA 2VVMA 3OZ2A 1PJ6A 4G74A 3DMEA 2C3DA 2DKIA 4EM3A 1TRBA 1XANA 2BCPA 2BRYA 3K7MX 4GDEA 1H6VA 4BJYA 2GR3A 1PXAA 1YKJA 2C65A 4TM4A 4GR1A 5J7XA 1VDCA 1GTHA 2XLRA 3NIXA 2VZ2A 5KVHA 3AEEA 2GMJA 3LADA 4A65A 3NTDA 4Y4MA 2GV8A 3PS9A 1KN0A 4U8PA 4UDQA 3ZYXA 4B69A 2BS3A 1BKWA 1X31B 2R0CA 4AOXA 4H4SA 1S3EA 1VG9A 3SGLA 4A9WA 5FS7A 2W0HA 3B3RA 1TDNA 1PBBA 3CGBA 4C74A 4Z26A 3UKPA 4MJWA 5KWFA 3KKJA 4BK1A 4B67A 5JCKA 2GMHA 2GAGB 1EL7A 3BI5A 2WP6A 3BHFA 2PHHA 3IHMA 4J33A 1FEAA 3S5WA 4AT0A 2EQ8A 4EMIA 1KFYA 2RGJA 1GSNA 1ZK7A 4K22A 1S2QA 3QSEA 2X3NA 1GTEA 2E5VA 1DNCA 4BV6A 3P9UA 1QO8A 1JEHA 5CQFA 3DJEA 3CGDA 2YLSA 3P4SA 3UP5A 1GRHA 2YVGA 2FJDA 2XLSA 2EQ6A 3EAOA 2YM2A 4FK1A 4O5QA 5KMRA 3GWFA 3D8XA 2OA1A 1KF6A 3AEGA 1OJDA 2NVKX 4CRTA 1L9CA 3F8DA 4NTDA 1BGJA 2O9ZA 2ZBWA 1LJ1A 2R45A 3EPTA 3SYIA 4BK3A 3GD3A 2XCGA 1CL0A 3ALJA 3CMMA 1LV0A 2A87A 1N4UA 1CC6A 2OALA 1D4EA 1IUVA 2YLWA 4XXGA 3ICSA 3SXIA 3SFEA 3AE2A 3ALLA 3LJPA 3L1RA 2H88A 1JNZA 1PXBA 2YLTA 3PVCA 1KDGA 2WU5A 2ZZBA 1ONFA 5EB5A 3GYXA 3Q6JA 4YT0A 4JQ9A 5BUKA 4TLXA 2X8HA 3LZXA 4OPUA 4Y4NA 4D03A 4TLZA 1PHHA 5M0ZA 2B76A 3T31A 4B1BA 4CBQA 1ZMCA 1B37A 1PBDA 5HXIA 2EQ7A 4U2TA 2XFOA 4X9NA 3M0OA 2YG5A 4J36A 3GMCA 2WEUA 4BK2A 2XLUA 3COXA 2BACA 3T2YA 3ZDNA 3EANA 1RSGA 3QSSA 1NHSA 1CC4A 3FIMB 5CKUA 1GRBA 4H50A 1EL5A 5FS6A 3NHOX 4EIQA 3GYJA 2QCUA 4GDPA 1E7PA 3AXBA 4NTEA 5EB4A 2OAMA 1Q9IA 3F8PA 5U63A 4H4VA 4FK1C 1GOSA 4CNKA 2C75A 3IC9A 4GUVA 1W4XA 5M10A 4RSLA 1PDHA 3AYLA 1TDFA 4U8NA 2YLZA 2V61A 1BWCA 1NHPA 2Y6RA 3ABVA 5KRQA 4EQWA 3L8KA 1NHQA 3UTHA 3NTAA 2WQYA 2EQ9A 1E1LA 1H83A 2GVCA 3CPHG 4NEWA 4H2RA 4YKFA 1NEKA 2YLRA 4Z44A 4DSHA 2WP9A 1H7WA 4K7ZA 2VOUA 2XYOA 1PJ7A 4TM0A 3UTEA 1CHUA 2QA1A 4Z43A 4H4TA 3KPFA 2BRAA 2IIDA 1D4CA 2UZZA 1ZDLA 2NPXA 2ARDA 1ZOYA 3KD9A 1V59A 5KOXA 4CY8A 4YWOA 1DJQA 1DODA 1GREA 3IF9A 1IUUA 3ITJA 3M12A 4OVIA 3CNDA 1QJDA 2AR8A 1BGNA 2Z5XA 4CNJA 4NEVA 1F8WA 2GF3A 2Q0LA 2XFQA 2JB1A 4JNQA 2OLNA 3DGHA 3QFBA 3KA7A 4H7UA 1DOEA 1K4QA 4JY2A 1PN0A 4IA6A 4AP1A 1L9DA 4H2NA 3DH9A 2YR5A 3LOVA 1F8SA 5HHFA 4DGKA 3SM8A 2C3CA 2X99A 3P4RA 1REOA 1OJTA 3AE4A 3GRTA 3QVPA 1H7XA 4YXDA 2FJAA 4H4XA 2H89A 4K5RA 4U8MA 2B7SA 4Y4LA 2CVJA 5C2TA 1GEUA 2TMDA 5KOWA 3DJJA 3D9XA 2BABA 4YKGA 3OC4A 4Z2RA 2AQJA 3UOXA 4B64A 3FMWA 2DKHA 4BURA 1DOCA 2I0ZA 2JB2A 3T37A 3T0KA 1E1NA 4Z2UA 1PBFA 3D1CA 3KVEA 3FG2P 4D04A 1LPFA 3HYXA 1NENA 3CPJG 4OPCA 3NK2X 3SX6A 2C73A 3NG7X 3LXDA 2C66A 4NTCA 4YTMA 2YVJA 2Q7VA 1E1KA 3AE8A 3H8IA 2WOVA 2C4CA 1N4WA 5IQ4A 2JBVA 3QFAA 2WPFA 1ZX9A 2C76A 3ALMA 3NYCA 1K0JA 1XPQA 2BYBA 1ELIA 3F8RA 3FPZA 4XWZA 1L0VA 4YTPA 5KNLA 3UKAA 1IUSA 1DJNA 3AD8B 1TYPA 4DNAA 4EQXA 1TYTA 4C77A 5JCLA 4JY3A 3UKKA 1O95A 2GR0A 4O5UA 4U8LA 5TR3A 3Q9TA 1KSUA 1L9EA 5DBJA 2R4JA 4H4WA 3HYVA 4USQA 4YSXA 3GRSA 4ZCCA 2BK3A 4H2QA 1O94A 3PG6A 3II4A 1NG4A 2HQMA 4G73A 1PS9A 4YTNA 5JCMA 3IWAA 2E4GA 4X4JA 5KMSA 1DOBA 2GRTA 1H81A 2XLTA 2XVFA 3SY4A 4CY6A 2WBAA 1CJ3A 4GCMA 3UKHA 3G5RA 4YSZA 4RG4A 3BI4A 2YWLA 5KXJA 4DSGA 2BC1A 3T2KA 1IUWA 2YR4A 1GALA 3NN0X 3NLCA 2GR2A 4ADWA 1BF3A 3NN6X 4P9SA 3UOVA 3KU9A 1TDEA 1TDOA 2APGA 2FJEA 4J56A 2R46A 3VR9A 5KMPA 2Z5YA 1NDAA 3HYWA 2FBWA 1NG3A 1AOGA 3EF6A 3S61A 4NZHA 4H4PA 1EL8A 4EM4A 1LQUA 2VVLG 1GRTA 2XVEA 1NPXA 1F3PA 2R0GA 4U8IA 1UKVG 4I59A 4CCQA 1CF3A 2VQ7A 1XDIA 5JCNA 3V3NA 3VR8A 2B7RA 2QAEA 1M6IA 1N4VA 1K0IA 1B5QA 2V5ZA 3NNEA 4UP3A 2X8CA 1FL2A 1CJ4A 4PABA 2GAHB 2VRLA 3C4AA 1B4VA 1D5TA 2YR6A 1FECA 2IVDA 3NGCX 3UOZA 1KNPA 3NYFA 4C5OA 3AYIA 3NYEA 1ZOVA 3ISHA 4A7AA 4ECHA 2B9XA 5BRTA 2B9WA 4A6NA 3GYIA 4EMJA 4WX1A 3AE5A 2XVJA 1D4DA 2WU2A 2QA2A 4K5SA 2XDOA 4J2WA 2YAUA 5FS8A 1JOAA 4JDRA 2JAEA 5KVIA 1MXTA 3C4NA 3UP4A 2YQUA 3KPKA 3AEBA 1F8RA 3AEAA 5BVAA 3SZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WOW A;  3DA1 A;  2BC0 A;  2V3A A;  2BA9 A;  2XLP A;  2ZZC A;  1B8S A;  4ZCD A;  2JB3 A;  3LZW A;  3I3L A;  3M13 A;  4U2S A;  2IVE A;  1P2E A;  4REK A;  1IUX A;  4AP3 A;  3ICR A;  2F5Z A;  2BK5 A;  5BUL A;  2YG6 A;  3H8L A;  3DJG X;  1JU2 A;  1OJA A;  4ICY A;  2WS3 A;  1TDK A;  1HYU A;  4Z24 A;  2A89 A;  1E6E A;  1GV4 A;  5GSN A;  3DJD A;  4FX9 A;  2GEW A;  3CNT A;  4J34 A;  3GWD A;  4JNA A;  3VQR A;  2RGO A;  1YQZ A;  2X50 A;  1NAA A;  3QJ4 A;  2YG4 A;  4OPT A;  2V3B A;  3GD4 A;  2BXS A;  2X8G A;  3G5S A;  3UOY A;  3DK8 A;  2R9Z A;  3AYJ A;  3ADA B;  3BHK A;  3AD7 B;  2JK6 A;  2AAQ A;  4H4Y A;  4EQR A;  2WDV A;  3UKL A;  3RP6 A;  3SFD A;  1P2H A;  1YY5 A;  2BS4 A;  4A5L A;  2CFY A;  5U25 A;  1GRF A;  2RAB A;  4J57 A;  2C67 A;  5IPY A;  3GMB A;  3NT6 A;  1S3B A;  5JCI A;  2V6O A;  3B6D A;  1E39 A;  4HA6 A;  1GXF A;  3AEC A;  4EQS A;  1Y0P A;  4X9M A;  1KSS A;  3NKS A;  4B63 A;  2C7G A;  4B68 A;  4IVO B;  3QVR A;  2JKC A;  3AE9 A;  1DXL A;  4XWR A;  3RP7 A;  1Y56 A;  4CCR A;  3AD9 B;  3ATR A;  3CIR A;  3BNM A;  1VQW A;  4IV9 A;  4U8J A;  4RG3 A;  2VVL A;  1FCD A;  1JNR A;  1JRX A;  3ICT A;  4YSH A;  3AWI A;  2GR1 A;  2BS2 A;  1H82 A;  4Z25 A;  1GPE A;  2ZZ0 A;  3AED A;  3CN8 A;  2YVF A;  1F6M A;  3CNS A;  1GER A;  3P4Q A;  2WDR A;  5HYM A;  2Q6U A;  1VG0 A;  4IA5 A;  3CTY A;  1CJ2 A;  1Q1R A;  3UTG A;  4H4Q A;  4H4R A;  4Z2T A;  1OJ9 A;  3NRN A;  4UDR A;  3RED A;  1LQT A;  1BZL A;  3CGE A;  1MOK A;  4I58 A;  4H4Z A;  5U1O A;  2WHD A;  1COY A;  4B65 A;  1M64 A;  4KPR A;  4LA1 A;  3BI2 A;  4BJZ A;  3AE7 A;  3DK4 A;  3CNJ A;  1PBE A;  3IHG A;  2WP5 A;  5J60 A;  4C3Y A;  1GET A;  4OCG A;  3URH A;  2XFP A;  5FS9 A;  3KLJ A;  1ZMD A;  4U8O A;  2B9Y A;  4M52 A;  4A6N B;  3DK9 A;  5ER0 A;  4H2P A;  1OJC A;  3UCL A;  2YG7 A;  1IJH A;  1XHC A;  1K0L A;  1VRQ B;  2GH5 A;  3NK0 X;  4USR A;  5IQ1 A;  2J3N A;  3PO7 A;  2TPR A;  4LII A;  3AE6 A;  1FEB A;  4LU6 A;  2GB0 A;  4GF7 A;  3GDN A;  1ZY8 A;  2WES A;  4KX6 A;  5LV9 A;  4TM1 A;  2VQB A;  2R4E A;  3UKQ A;  1PJ5 A;  4IVM B;  2BK4 A;  4FDC B;  1LTX R;  2C64 A;  2XFN A;  4A99 A;  3AEF A;  3V76 A;  3GSI A;  1GRA A;  3P1W A;  1SEZ A;  1KNR A;  2C72 A;  1CC2 A;  3E1T A;  4E0V A;  3QSM A;  4ZN0 A;  1H86 A;  2GQF A;  1ZKQ A;  4N9X A;  5HY5 A;  3V3O A;  2RGH A;  4K2X A;  4B66 A;  2CDU A;  4AOS A;  2YG3 A;  1YQ3 A;  2YLX A;  3VRD B;  3C96 A;  3RP8 A;  3WE0 A;  1CBO A;  1PXC A;  2WET A;  5GRT A;  2WPE A;  4K8D A;  3RNM A;  1RYI A;  4EMW A;  3JSK A;  4GRT A;  2PYX A;  1ZP0 A;  2YM1 A;  2WPC A;  4J31 A;  3H4K A;  1GRG A;  2V60 A;  1NHR A;  3UTF A;  3FBS A;  3G5Q A;  3P4P A;  5FMH A;  2Q0K A;  1QLB A;  3CNP A;  3AE3 A;  3DGZ A;  5C3J A;  1GND A;  5EOW A;  3NK1 X;  3I6D A;  1YQ4 A;  2XVH A;  2Y6Q A;  3VRB A;  1O5W A;  4YSY A;  3K7Q X;  1Z6L A;  4OPL A;  1Y56 B;  3LB8 A;  4JN9 A;  1D7L A;  1FOH A;  1JRZ A;  1S2Y A;  4OPG A;  2CUL A;  3AB1 A;  1RP0 A;  2ACZ A;  4APN A;  1EBD A;  3RHA A;  3O0H A;  4A79 A;  2WOI A;  1IUT A;  2C70 A;  3R9U A;  2BCG G;  2OLO A;  2E1M A;  4C3X A;  3VRA A;  4EIP A;  3K30 A;  4PAA A;  2FJB A;  3AE1 A;  1LVL A;  5EBK A;  4HB9 A;  4OPD A;  3UKF A;  4AT2 A;  2XVI A;  2R0P A;  2A8X A;  4OPI A;  1H84 A;  4H4U A;  1CJC A;  1JRY A;  3CPI G;  1MO9 A;  2WDQ A;  3CGC A;  3ATQ A;  3NH3 X;  4U2L A;  1N1P A;  3K7T A;  4UDP A;  5L46 A;  4U8K A;  2VRM A;  2BXR A;  1GT8 A;  2XFU A;  1EL9 A;  1Q1W A;  4TM3 A;  3BNU A;  1D7Y A;  3SQP A;  3GDP A;  2GQW A;  1E1M A;  4WCT A;  1GES A;  1PBC A;  3HZL A;  2VVM A;  3OZ2 A;  1PJ6 A;  3DME A;  2C3D A;  2DKI A;  4EM3 A;  1TRB A;  1XAN A;  2BCP A;  3K7M X;  4GDE A;  1H6V A;  4BJY A;  2GR3 A;  1PXA A;  1YKJ A;  2C65 A;  4TM4 A;  4GR1 A;  5J7X A;  1VDC A;  1GTH A;  2XLR A;  3NIX A;  2VZ2 A;  5KVH A;  3AEE A;  2GMJ A;  3LAD A;  4A65 A;  3NTD A;  4Y4M A;  2GV8 A;  3PS9 A;  4UDQ A;  4U8P A;  3ZYX A;  4B69 A;  2BS3 A;  1BKW A;  1X31 B;  2R0C A;  4AOX A;  4H4S A;  1S3E A;  1VG9 A;  3SGL A;  4A9W A;  5FS7 A;  2W0H A;  3B3R A;  1TDN A;  1PBB A;  3CGB A;  4C74 A;  4Z26 A;  3UKP A;  4MJW A;  5KWF A;  3KKJ A;  4BK1 A;  4B67 A;  5JCK A;  2GMH A;  2GAG B;  1EL7 A;  3BI5 A;  2WP6 A;  3BHF A;  2PHH A;  3IHM A;  4J33 A;  1FEA A;  3S5W A;  4AT0 A;  2EQ8 A;  4EMI A;  1KFY A;  2RGJ A;  1GSN A;  1ZK7 A;  4K22 A;  1S2Q A;  3QSE A;  2X3N A;  1GTE A;  2E5V A;  1DNC A;  4BV6 A;  3P9U A;  1QO8 A;  1JEH A;  5CQF A;  3DJE A;  3CGD A;  2YLS A;  3P4S A;  3UP5 A;  1GRH A;  2YVG A;  2FJD A;  2XLS A;  2EQ6 A;  3EAO A;  2YM2 A;  4FK1 A;  4O5Q A;  3GWF A;  3D8X A;  2OA1 A;  1KF6 A;  3AEG A;  1OJD A;  2NVK X;  4CRT A;  1L9C A;  3F8D A;  4NTD A;  1BGJ A;  2O9Z A;  2ZBW A;  1LJ1 A;  2R45 A;  3EPT A;  4BK3 A;  3GD3 A;  2XCG A;  1CL0 A;  3ALJ A;  1LV0 A;  2A87 A;  1N4U A;  1CC6 A;  2OAL A;  1D4E A;  1IUV A;  2YLW A;  4XXG A;  3ICS A;  3SFE A;  3AE2 A;  3ALL A;  3LJP A;  3L1R A;  2H88 A;  1JNZ A;  1PXB A;  2YLT A;  3PVC A;  1KDG A;  2WU5 A;  2ZZB A;  1ONF A;  5EB5 A;  3Q6J A;  4YT0 A;  4JQ9 A;  5BUK A;  4TLX A;  2X8H A;  3LZX A;  4OPU A;  4Y4N A;  4D03 A;  4TLZ A;  1PHH A;  5M0Z A;  2B76 A;  4B1B A;  4CBQ A;  1ZMC A;  1B37 A;  1PBD A;  5HXI A;  2EQ7 A;  4U2T A;  2XFO A;  4X9N A;  3M0O A;  2YG5 A;  4J36 A;  3GMC A;  2WEU A;  4BK2 A;  2XLU A;  3COX A;  2BAC A;  3ZDN A;  3EAN A;  1RSG A;  3QSS A;  1NHS A;  1CC4 A;  3FIM B;  5CKU A;  1GRB A;  4H50 A;  1EL5 A;  5FS6 A;  3NHO X;  4EIQ A;  3GYJ A;  2QCU A;  4GDP A;  1E7P A;  3AXB A;  4NTE A;  5EB4 A;  2OAM A;  1Q9I A;  3F8P A;  5U63 A;  4H4V A;  4FK1 C;  1GOS A;  4CNK A;  2C75 A;  3IC9 A;  4GUV A;  1W4X A;  5M10 A;  4RSL A;  1PDH A;  3AYL A;  1TDF A;  4U8N A;  2YLZ A;  2V61 A;  1BWC A;  1NHP A;  2Y6R A;  3ABV A;  5KRQ A;  4EQW A;  3L8K A;  1NHQ A;  3UTH A;  3NTA A;  2WQY A;  2EQ9 A;  1E1L A;  1H83 A;  2GVC A;  3CPH G;  4NEW A;  4H2R A;  4YKF A;  1NEK A;  2YLR A;  4Z44 A;  4DSH A;  2WP9 A;  1H7W A;  4K7Z A;  2VOU A;  2XYO A;  1PJ7 A;  4TM0 A;  3UTE A;  1CHU A;  2QA1 A;  4Z43 A;  4H4T A;  3KPF A;  2IID A;  1D4C A;  2UZZ A;  1ZDL A;  2NPX A;  2ARD A;  1ZOY A;  3KD9 A;  1V59 A;  5KOX A;  4CY8 A;  4YWO A;  1DJQ A;  1DOD A;  1GRE A;  3IF9 A;  1IUU A;  3ITJ A;  3M12 A;  4OVI A;  3CND A;  1QJD A;  2AR8 A;  1BGN A;  2Z5X A;  4CNJ A;  4NEV A;  1F8W A;  2GF3 A;  2Q0L A;  2XFQ A;  2JB1 A;  4JNQ A;  2OLN A;  3DGH A;  3QFB A;  3KA7 A;  4H7U A;  1DOE A;  1K4Q A;  4JY2 A;  1PN0 A;  4IA6 A;  4AP1 A;  1L9D A;  4H2N A;  3DH9 A;  2YR5 A;  3LOV A;  1F8S A;  5HHF A;  4DGK A;  3SM8 A;  2C3C A;  2X99 A;  3P4R A;  1REO A;  1OJT A;  3AE4 A;  3GRT A;  3QVP A;  1H7X A;  4YXD A;  2FJA A;  4H4X A;  2H89 A;  4K5R A;  4U8M A;  2B7S A;  4Y4L A;  2CVJ A;  5C2T A;  1GEU A;  2TMD A;  5KOW A;  3DJJ A;  2BAB A;  4YKG A;  3OC4 A;  4Z2R A;  2AQJ A;  3UOX A;  4B64 A;  3FMW A;  2DKH A;  4BUR A;  1DOC A;  2I0Z A;  2JB2 A;  3T37 A;  1E1N A;  4Z2U A;  1PBF A;  3D1C A;  3KVE A;  3FG2 P;  4D04 A;  1LPF A;  1NEN A;  3CPJ G;  4OPC A;  3NK2 X;  2C73 A;  3NG7 X;  3LXD A;  2C66 A;  4NTC A;  4YTM A;  2YVJ A;  2Q7V A;  1E1K A;  3AE8 A;  3H8I A;  2WOV A;  1N4W A;  5IQ4 A;  2JBV A;  3QFA A;  2WPF A;  1ZX9 A;  2C76 A;  3ALM A;  3NYC A;  1K0J A;  1XPQ A;  2BYB A;  1ELI A;  3F8R A;  3FPZ A;  4XWZ A;  1L0V A;  4YTP A;  3UKA A;  1IUS A;  1DJN A;  3AD8 B;  1TYP A;  4DNA A;  4EQX A;  1TYT A;  4C77 A;  5JCL A;  4JY3 A;  3UKK A;  1O95 A;  2GR0 A;  4O5U A;  4U8L A;  5TR3 A;  3Q9T A;  1KSU A;  1L9E A;  5DBJ A;  2R4J A;  4H4W A;  4USQ A;  4YSX A;  3GRS A;  4ZCC A;  2BK3 A;  4H2Q A;  1O94 A;  3II4 A;  1NG4 A;  2HQM A;  1PS9 A;  4YTN A;  5JCM A;  3IWA A;  2E4G A;  4X4J A;  1DOB A;  2GRT A;  1H81 A;  2XLT A;  2XVF A;  4CY6 A;  2WBA A;  1CJ3 A;  4GCM A;  3UKH A;  3G5R A;  4YSZ A;  4RG4 A;  3BI4 A;  2YWL A;  5KXJ A;  4DSG A;  2BC1 A;  1IUW A;  2YR4 A;  1GAL A;  3NN0 X;  3NLC A;  2GR2 A;  4ADW A;  1BF3 A;  3NN6 X;  4P9S A;  3UOV A;  3KU9 A;  1TDE A;  1TDO A;  2APG A;  2FJE A;  4J56 A;  2R46 A;  3VR9 A;  2Z5Y A;  1NDA A;  2FBW A;  1NG3 A;  1AOG A;  3EF6 A;  3S61 A;  4NZH A;  4H4P A;  1EL8 A;  4EM4 A;  1LQU A;  2VVL G;  1GRT A;  2XVE A;  1NPX A;  1F3P A;  2R0G A;  4U8I A;  1UKV G;  4I59 A;  4CCQ A;  1CF3 A;  2VQ7 A;  1XDI A;  5JCN A;  3V3N A;  3VR8 A;  2B7R A;  2QAE A;  1M6I A;  1N4V A;  1K0I A;  1B5Q A;  2V5Z A;  3NNE A;  4UP3 A;  2X8C A;  1FL2 A;  1CJ4 A;  4PAB A;  2GAH B;  2VRL A;  3C4A A;  1B4V A;  1D5T A;  2YR6 A;  1FEC A;  2IVD A;  3NGC X;  3UOZ A;  1KNP A;  3NYF A;  4C5O A;  3AYI A;  3NYE A;  1ZOV A;  3ISH A;  4A7A A;  4ECH A;  2B9X A;  5BRT A;  2B9W A;  4A6N A;  3GYI A;  4EMJ A;  4WX1 A;  3AE5 A;  2XVJ A;  1D4D A;  2WU2 A;  2QA2 A;  4K5S A;  2XDO A;  4J2W A;  2YAU A;  5FS8 A;  1JOA A;  4JDR A;  2JAE A;  5KVI A;  1MXT A;  3C4N A;  3UP4 A;  2YQU A;  3AEB A;  1F8R A;  3AEA A;  5BVA A; 
#chains in the Genus database with same CATH topology
 2ZZC A;  4U2S A;  2IVE A;  2BK5 A;  5EU9 A;  2YG6 A;  4ICY A;  1TDK A;  1GV4 A;  4E4U A;  3DJD A;  3CXO A;  3VQR A;  3QJ4 A;  4OPT A;  2V3B A;  3GD4 A;  2R9Z A;  3ADA B;  2AL1 A;  2JK6 A;  1P2H A;  2CFY A;  2QDE A;  3ENL A;  5IPY A;  3GMB A;  2XH0 A;  3HW2 A;  3U9I A;  1WUE A;  1E39 A;  4EQS A;  1Y0P A;  1KSS A;  4G6G A;  3RP7 A;  3AE9 A;  4K8G A;  3D47 A;  3UJR A;  1FCD A;  1JNR A;  1JRX A;  4YSH A;  4KWS A;  1H82 A;  4YWS A;  3ZLF A;  5HYM A;  4IA5 A;  3UTG A;  1CJ2 A;  2HXT A;  4H4Q A;  4Z2T A;  1OJ9 A;  1DTN A;  1LQT A;  3SN4 A;  1COY A;  3A7U A;  3OZM A;  3URH A;  5FS9 A;  1JDF A;  1ZMD A;  3UCL A;  2YG7 A;  1XHC A;  4USR A;  2J3N A;  2GB0 A;  2WES A;  2VQB A;  4MGG A;  1F9C A;  2XFN A;  3AEF A;  2C72 A;  3UJS A;  1CC2 A;  5HY5 A;  2GQF A;  3FJ4 A;  4HPN A;  4AOS A;  2YG3 A;  1YQ3 A;  3EEZ A;  1RYI A;  3JSK A;  3TJ4 A;  4GRT A;  2YM1 A;  2WPC A;  4J31 A;  3MQT A;  2V60 A;  3G5Q A;  3L5O A;  3P3B A;  3DGZ A;  4NNJ A;  5G5G B;  2P88 A;  2OQY A;  3VRB A;  4NWZ A;  1JRZ A;  1S2Y A;  4K1W A;  2ACZ A;  1EC9 A;  4II2 A;  1FO4 A;  4C3X A;  1LVL A;  4HB9 A;  3A7R A;  1H84 A;  1OEP A;  2HXU A;  2E3T A;  1MO9 A;  2OZ8 A;  1S7M A;  3K7T A;  4E5T A;  2VRM A;  1GT8 A;  2XFU A;  2PP1 A;  1EL9 A;  2QDD A;  4TM3 A;  1D7Y A;  3GDP A;  1KD0 A;  3N6J A;  3HZL A;  2VVM A;  4MMW A;  2C3D A;  2FKP A;  4GDE A;  1VDC A;  1L8P A;  3OTR A;  2W54 A;  3LAD A;  3PS9 A;  4U8P A;  3AMZ A;  1S3E A;  2P8C A;  1TDN A;  4Z26 A;  5KWF A;  4KPL A;  3HPF A;  1EBH A;  2GMH A;  2GAG B;  1EL7 A;  3IHM A;  3S5W A;  3NXL A;  3UGV A;  2RGJ A;  3P0W A;  4A3R A;  2OKT A;  3P9U A;  1TZZ A;  1JEH A;  5CQF A;  2YLS A;  1GRH A;  2XLS A;  3T9P A;  3AEG A;  3SN1 A;  3QLD A;  1LJ1 A;  2XCG A;  2PA6 A;  2A87 A;  2OAL A;  3STP A;  4GIR A;  1JNZ A;  2ZZB A;  3R1Z A;  3FV9 A;  5BUK A;  4Y4N A;  1W6T A;  5M0Z A;  4B1B A;  1PBD A;  4U2T A;  3GMC A;  2PSN A;  2WEU A;  4BK2 A;  1NHS A;  3FIM B;  3NVW B;  1PDZ A;  3OZY A;  4GDP A;  4GYP A;  3AXB A;  1FFV C;  4CNK A;  2V61 A;  1N62 C;  3ABV A;  4EQW A;  2PS2 A;  4TVY A;  3NTA A;  2WQY A;  2EQ9 A;  1H83 A;  4H2R A;  4NEW A;  1H7W A;  4K7Z A;  3UTE A;  2PMQ A;  1D4C A;  1JCT A;  4GFI A;  1ZDL A;  3KD9 A;  3M12 A;  1FHU A;  1QJD A;  1BGN A;  4NEV A;  1F8W A;  2GF3 A;  2Q0L A;  2OLN A;  1KKO A;  3QFB A;  1DOE A;  1K4Q A;  3A7A A;  4IA6 A;  4H2N A;  1F8S A;  3D46 A;  1OJT A;  4YXD A;  2PU0 A;  5C2T A;  1GEU A;  3B9J B;  2O56 A;  2JB2 A;  3T0K A;  4KEM A;  4DHG A;  4F4R A;  1NEN A;  4NTC A;  2Q7V A;  3H8I A;  2WOV A;  2GSH A;  2JBV A;  1XPQ A;  3F8R A;  4XWZ A;  1DJN A;  4K2S A;  5JCL A;  5TR3 A;  5DBJ A;  3HYV A;  4YSX A;  3PG6 A;  2HQM A;  4G73 A;  4YTN A;  3UJE A;  3CT2 A;  3SY4 A;  4GCM A;  2YWL A;  2BC1 A;  3T2K A;  1IUW A;  3FCP A;  3UOV A;  1TDE A;  4J56 A;  5KMP A;  2PPG A;  3NVV B;  2GDQ A;  3HYW A;  4H4P A;  4M0X A;  2OFJ A;  1JPD X;  2R0G A;  4U8I A;  4CCQ A;  1XDI A;  3V3N A;  3NS1 B;  3BJS A;  2OZ3 A;  2YR6 A;  3SR6 B;  3NRZ B;  1FEC A;  3NGC X;  3AYI A;  1ZOV A;  4A7A A;  2OLA A;  2B9X A;  2B9W A;  3Q45 A;  3T8Q A;  3UP4 A;  1MXT A;  4RG4 A;  2YQU A;  1F8R A;  5KMQ A;  5BVA A;  2WOW A;  3TOY A;  2BA9 A;  1B8S A;  2JB3 A;  4REK A;  3ICR A;  5J04 A;  4A6G A;  5GSN A;  3V3W A;  3VCC A;  4FX9 A;  4GAP A;  2GEW A;  3GWD A;  7ENL A;  2X50 A;  1NAA A;  2BXS A;  3G5S A;  3UOY A;  3B97 A;  4EQR A;  1V97 A;  6ENL A;  1GRF A;  3N6H A;  5JCI A;  1GXF A;  4GYP C;  4X9M A;  3QVR A;  1DXL A;  3AD9 B;  3ATR A;  3CIR A;  3BNM A;  4U8J A;  4RG3 A;  4ENL A;  3AWI A;  2GR1 A;  2PP0 A;  3R11 A;  3CAW A;  3AED A;  4HNL A;  3CN8 A;  1GER A;  3P4Q A;  1VG0 A;  1H2I A;  1Q1R A;  3EKG A;  2PTY A;  3NRN A;  1BZL A;  1MOK A;  4I58 A;  4B65 A;  1M64 A;  4KPR A;  2ZAD A;  3AE7 A;  2DW6 A;  3CNJ A;  2PU1 A;  1PDY A;  2WP5 A;  3TQP A;  4C3Y A;  2XFP A;  3KLJ A;  2B9Y A;  4M52 A;  4A6N B;  5ER0 A;  1K0L A;  4DWD A;  4LU6 A;  3GDN A;  5LV9 A;  4TM1 A;  1RVK A;  3R0K A;  2R4E A;  3UKQ A;  5JRB A;  4IVM B;  3QTP A;  3P1W A;  1ZKQ A;  4N9X A;  3V3O A;  2P8B A;  4B66 A;  2QJN A;  2YLX A;  3SZF A;  3WE0 A;  4EMW A;  1ZP0 A;  3H4K A;  2Q0K A;  3VA8 A;  3NK1 X;  3I6D A;  1R6W A;  2XVH A;  1Z6L A;  1Y56 B;  5FJP A;  1FOH A;  2PP3 A;  2CUL A;  3AB1 A;  3RIT A;  4APN A;  1EBD A;  3CYJ A;  4II3 A;  2C70 A;  2BCG G;  1T3Q C;  4EIP A;  4PAA A;  3SSZ A;  3DIP A;  1TKK A;  2PGE A;  5EBK A;  2XVI A;  4OPI A;  3SZC A;  3SZ0 A;  4G9K A;  1JRY A;  5BOE A;  3ATQ A;  4U2L A;  3T2Z A;  2BXR A;  1Q1W A;  1GES A;  1PBC A;  4H1Z A;  4EM3 A;  1XAN A;  2BCP A;  2BRY A;  3K7M X;  2GR3 A;  2PCE A;  4GR1 A;  3H12 A;  5KVH A;  3NTD A;  1KN0 A;  2BS3 A;  1BKW A;  3ZLH A;  3SGL A;  3B3R A;  4C74 A;  4G7F A;  4BK1 A;  3H8A A;  3BHF A;  2PHH A;  1RM6 B;  2EQ8 A;  4EMI A;  3RGT A;  3UCD A;  1S2Q A;  3QSE A;  2X3N A;  1GTE A;  2E5V A;  1DNC A;  1QO8 A;  3DJE A;  3NVZ B;  2QJM A;  2QGY A;  3UP5 A;  2EQ6 A;  3GWF A;  1OJD A;  2NVK X;  1EBG A;  4CRT A;  2ZBW A;  2R45 A;  3SYI A;  3GD3 A;  1CL0 A;  3VDG A;  1LV0 A;  3CMM A;  3SQS A;  5BOF A;  1D4E A;  3ZVH B;  4DN1 A;  3ALL A;  3LJP A;  3L1R A;  4H19 A;  1PXB A;  2YLT A;  3Q4D A;  5EB5 A;  1VQZ A;  4D03 A;  3JW7 A;  3PWI A;  3T31 A;  4CBQ A;  1ZMC A;  1IYX A;  1JRO A;  1TE6 A;  2YG5 A;  3N4F A;  2XLU A;  3T2Y A;  3EAN A;  1RSG A;  3QSS A;  5CKU A;  3PK7 A;  1EL5 A;  3NHO X;  2CHR A;  1E7P A;  5FJO A;  3F8P A;  4FK1 C;  1GOS A;  3V4B A;  2C75 A;  3IC9 A;  3AYL A;  1TDF A;  1BWC A;  1ECQ A;  3DER A;  3IJQ A;  2Y6R A;  2YLR A;  4DSH A;  2XYO A;  4IL2 A;  1PJ7 A;  1CHU A;  2QA1 A;  2IID A;  2UZZ A;  2OPJ A;  1V59 A;  4CY8 A;  1GRE A;  3SBF A;  3CND A;  2Z5X A;  4CNJ A;  2XFQ A;  3DGH A;  5IDZ A;  4JY2 A;  1L9D A;  2YR5 A;  3LOV A;  5HHF A;  4HCH A;  2C3C A;  1REO A;  3SN0 A;  3QVP A;  4Y4L A;  2TMD A;  4YKG A;  2BAB A;  4Z2R A;  2AQJ A;  1DOC A;  2I0Z A;  1E1N A;  3D1C A;  3KVE A;  3HYX A;  4OPC A;  2C66 A;  4YTM A;  2YVJ A;  2MUC A;  3AE8 A;  3H70 A;  1N4W A;  4HN8 A;  2C76 A;  3ALM A;  1L0V A;  4E6M A;  1ELI A;  4YTP A;  3UKA A;  1TYP A;  2OX4 A;  4JY3 A;  4O5U A;  3MWC A;  4H2Q A;  1NG4 A;  3ES8 A;  3IWA A;  2MNR A;  5KMS A;  4X4J A;  2XLT A;  2WBA A;  4Z17 A;  4DSG A;  3NN0 X;  4ADW A;  3NN6 X;  4P9S A;  3TW9 A;  2APG A;  2POD A;  1JPM A;  5FJR A;  1MRA A;  2AKM A;  1EL8 A;  2VVL G;  2OVL A;  4J3Z A;  3QN3 A;  1BKH A;  3VR8 A;  4GME A;  1K0I A;  3NNE A;  2X8C A;  2GGG A;  4PAB A;  2IVD A;  1KNP A;  4C5O A;  2QQ6 A;  4A6N A;  3GYI A;  4EMJ A;  3AE5 A;  1D4D A;  2WU2 A;  4K5S A;  2XDO A;  1JOA A;  3HRD C;  3C4N A;  3KPK A;  3SZW A;  2XLP A;  3LZW A;  3M13 A;  1P2E A;  4AP3 A;  1IUX A;  2F5Z A;  1OJA A;  1HYU A;  3V5F A;  2GL5 A;  1E6E A;  4FP1 A;  3CNT A;  4J34 A;  3DG3 A;  2RGO A;  1YQZ A;  4KT2 A;  3RCY A;  1N5X A;  3AD7 B;  3ES7 A;  3MY9 A;  3EUB 3;  3SFD A;  3OP2 A;  3R25 A;  4A5L A;  5U25 A;  3TJI A;  2RAB A;  2POZ A;  3DFY A;  4G6H A;  3NKS A;  4B68 A;  2JKC A;  3RRA A;  4XWR A;  1Y56 A;  4CCR A;  3VC5 A;  4IV9 A;  2VVL A;  3ICT A;  2BS2 A;  1GPE A;  4JN7 A;  4JN8 A;  2YVF A;  1F6M A;  2Q6U A;  3CTY A;  4UDR A;  3NO1 A;  4ZCW A;  4H4Z A;  5U1O A;  3BI2 A;  4BJZ A;  4G8T A;  1PBE A;  4H2P A;  1EC7 A;  3NK0 X;  4IP5 A;  3PO7 A;  1VDV A;  4IT1 A;  1STZ A;  4FDC B;  1LTX R;  4TVW A;  1FHV A;  3I4K A;  5FJT A;  4A99 A;  3GSI A;  3E1T A;  4E0V A;  3QSM A;  4ZN0 A;  1H86 A;  4K2X A;  4HCL A;  2CDU A;  4H2H A;  3VRD B;  4GAV A;  1PXC A;  2WPE A;  4K8D A;  1GRG A;  1NHR A;  3UTF A;  3P4P A;  3DDM A;  3AE3 A;  5C3J A;  1GND A;  1X2G A;  2Y6Q A;  4YSY A;  3K7Q X;  1SJD A;  4OPG A;  1RP0 A;  3UXL A;  2NQL A;  3O0H A;  4A79 A;  3ZVH A;  2WOI A;  3R9U A;  2E1M A;  2FJB A;  3UKF A;  2R0P A;  2W55 A;  3CXB A;  1CJC A;  1P43 A;  3NH3 X;  3DG7 A;  1N1P A;  5L46 A;  4U8K A;  3DGB A;  2GQW A;  1E1M A;  1KKR A;  3OZ2 A;  1PJ6 A;  3DME A;  3S5S A;  1TRB A;  4BJY A;  1PXA A;  1YKJ A;  2C65 A;  1GTH A;  2XLR A;  3NIX A;  3FYY A;  2GV8 A;  4UDQ A;  3I6T A;  2R0C A;  4AOX A;  1VG9 A;  3BOX A;  4A9W A;  3CGB A;  4MJW A;  3RR1 A;  3BI5 A;  4AT0 A;  1ZK7 A;  4BV6 A;  2OG9 A;  3CGD A;  3P4S A;  2FJD A;  4FK1 A;  3EAO A;  5KMR A;  2XGZ A;  1ONE A;  2XSX A;  3D8X A;  4EWJ A;  1L9C A;  3RO6 A;  1BGJ A;  2O9Z A;  4BK3 A;  3EPT A;  3ALJ A;  1N4U A;  1CC6 A;  3K1G A;  2QVH A;  3ICS A;  3SFE A;  3N4E A;  2H88 A;  1KDG A;  1ONF A;  3Q6J A;  2OO6 A;  4YT0 A;  4TLZ A;  1EC8 A;  4IHC A;  2XFO A;  5FJU A;  2P3Z A;  4DXK A;  3COX A;  4GIS A;  3ZDN A;  1CC4 A;  4H50 A;  5FS6 A;  4EIQ A;  2QCU A;  3VCN A;  4NTE A;  4DX3 A;  2OQH A;  2OAM A;  4H83 A;  4H4V A;  4GUV A;  1W4X A;  1PDH A;  4U8N A;  3L8K A;  1NHQ A;  1E1L A;  3CPH G;  4YKF A;  1NEK A;  4Z44 A;  2VOU A;  4ZA0 A;  4TM0 A;  4H4T A;  3KPF A;  2BRA A;  3JVA A;  2ARD A;  1ZOY A;  4M6U A;  2I5Q A;  3ITJ A;  4YWO A;  1DJQ A;  1DOD A;  3IF9 A;  3PFR A;  4OVI A;  3R10 A;  2AR8 A;  2JB1 A;  4JNQ A;  3GY1 A;  4H7U A;  3KA7 A;  1PN0 A;  4AP1 A;  3DH9 A;  4J1O A;  3SM8 A;  3P4R A;  3GRT A;  1H7X A;  2FJA A;  2H89 A;  4U8M A;  3P93 A;  2CVJ A;  3MSY A;  4MKS A;  3V5C A;  3UOX A;  3FMW A;  4BUR A;  4Z2U A;  2W3S A;  1PBF A;  1LPF A;  3CPJ G;  1ELS A;  2RDX A;  2C73 A;  3LXD A;  1WYG A;  2C4C A;  5IQ4 A;  3QFA A;  3U4F A;  3NYC A;  2BYB A;  1NEL A;  1IUS A;  3AD8 B;  1TYT A;  4C77 A;  3UKK A;  1O95 A;  1SJA A;  1X2H A;  3Q9T A;  1KSU A;  1L9E A;  2R4J A;  4H4W A;  4ZCC A;  2BK3 A;  4HCD A;  5JCM A;  2HNE A;  2GRT A;  2XVF A;  4CY6 A;  3UKH A;  3G5R A;  4YSZ A;  5KXJ A;  2GGH A;  1GAL A;  3NLC A;  2GR2 A;  1TDO A;  2R46 A;  2Z5Y A;  1NDA A;  3IJI A;  3S61 A;  3EF6 A;  4EM4 A;  1N5W C;  1LQU A;  1SJC A;  2XVE A;  1ZXI C;  1UKV G;  4I59 A;  1P48 A;  2PGW A;  1M6I A;  2PTZ A;  1N4V A;  4UP3 A;  1B5Q A;  2V5Z A;  2DW7 A;  2OZT A;  1FL2 A;  2GAH B;  2VRL A;  3C4A A;  1B4V A;  1D5T A;  3UOZ A;  3ZVI A;  3NYF A;  1MDL A;  4GGH A;  4ECH A;  5BRT A;  4WX1 A;  3TWB A;  3MUC A;  2QA2 A;  4GGB A;  2YAU A;  5FS8 A;  4JDR A;  2JAE A;  1YQ4 A;  3AEA A;  2XH2 A;  3DA1 A;  2BC0 A;  2V3A A;  3H7V A;  4ZCD A;  4IL0 A;  3I3L A;  3SJN A;  3S47 A;  5BUL A;  3H8L A;  3DJG X;  1JU2 A;  2WS3 A;  3CB3 A;  4Z24 A;  2A89 A;  4JNA A;  2P0I A;  4DYE A;  2YG4 A;  2X8G A;  3DK8 A;  3AYJ A;  3BHK A;  4HNC A;  2AAQ A;  4H4Y A;  3GO2 A;  2WDV A;  3UKL A;  3RP6 A;  2BS4 A;  1YY5 A;  3DES A;  2C67 A;  4J57 A;  4X2P A;  3NT6 A;  1S3B A;  2V6O A;  3B6D A;  4HA6 A;  3AEC A;  4B63 A;  2C7G A;  4IVO B;  1VQW A;  4Z25 A;  2ZZ0 A;  3IJL A;  4IZG A;  3CNS A;  2GGJ A;  2WDR A;  3MKC A;  2ONE A;  4H4R A;  3NVY B;  3RED A;  2PTW A;  3CGE A;  2WHD A;  4LA1 A;  3DK4 A;  3IHG A;  5J60 A;  3VFC A;  1GET A;  4OCG A;  4U8O A;  3DK9 A;  1OJC A;  1IJH A;  3DG6 A;  1VRQ B;  2GH5 A;  1XS2 A;  5IQ1 A;  2TPR A;  4LII A;  3AE6 A;  1FEB A;  2AL2 B;  4FI4 A;  4GF7 A;  1ZY8 A;  4KX6 A;  3T14 A;  3UXK A;  1PJ5 A;  2BK4 A;  2C64 A;  3V76 A;  1GRA A;  1SEZ A;  1KNR A;  2RGH A;  1KCZ A;  3C96 A;  3RP8 A;  1CBO A;  2WET A;  5GRT A;  3TWA A;  3RNM A;  2PYX A;  3FBS A;  3PWG A;  3MZN A;  5FMH A;  4HYR A;  1QLB A;  1FIQ B;  3R0U A;  3CNP A;  5EOW A;  1JRP A;  1O5W A;  4OPL A;  3LB8 A;  4JN9 A;  3UCC A;  1D7L A;  1XPY A;  2XH4 A;  1N63 C;  3T6C A;  3RHA A;  1IUT A;  2OLO A;  3VRA A;  3K30 A;  3AE1 A;  4OPD A;  4AT2 A;  3T4W A;  2A8X A;  4H4U A;  3CPI G;  2WDQ A;  3CGC A;  4UDP A;  1YEY A;  3AN1 A;  3BNU A;  3SQP A;  1SB3 B;  3TCS A;  4WCT A;  4G74 A;  1N60 C;  2XH7 A;  2DKI A;  4ZOH B;  1H6V A;  4TM4 A;  5J7X A;  5G5H B;  4A35 A;  3VC6 A;  3I6E A;  2VZ2 A;  3AEE A;  2GMJ A;  4A65 A;  4Y4M A;  3ZYX A;  4B69 A;  4E4F A;  1X31 B;  4H4S A;  5FS7 A;  2W0H A;  1PBB A;  3UKP A;  2PTX A;  3KKJ A;  4B67 A;  5JCK A;  2WP6 A;  4J33 A;  1FEA A;  1KFY A;  1SJB A;  1GSN A;  3DEQ A;  4K22 A;  2YVG A;  2YM2 A;  4O5Q A;  2OA1 A;  1KF6 A;  3UJF A;  3QPE A;  3F8D A;  4NTD A;  4JHM A;  3QKE A;  1IUV A;  2YLW A;  4XXG A;  3SXI A;  3AE2 A;  3PVC A;  4IP4 A;  2WU5 A;  3THU A;  3GYX A;  3ETR B;  4JQ9 A;  4TLX A;  2X8H A;  2ZC8 A;  3LZX A;  4OPU A;  1PHH A;  2B76 A;  1B37 A;  5HXI A;  2EQ7 A;  3FXG A;  4X9N A;  1FFU C;  3M0O A;  4J36 A;  1MUC A;  2BAC A;  3BSM A;  1GRB A;  3TTE A;  3GYJ A;  5EB4 A;  3KUM A;  1Q9I A;  5U63 A;  4Z1Y A;  5M10 A;  2GGE A;  4RSL A;  2YLZ A;  1NHP A;  5KRQ A;  3UTH A;  2GVC A;  3OW1 A;  2WP9 A;  3AM9 A;  4Z43 A;  4E8G A;  2NPX A;  3FVD A;  5KOX A;  1IUU A;  2AKZ A;  3DFH A;  5ENL A;  1N61 C;  2W3R A;  4DGK A;  2X99 A;  3AE4 A;  2GGI A;  4H4X A;  4K5R A;  2B7S A;  5KOW A;  3DJJ A;  3D9X A;  3OC4 A;  4B64 A;  2DKH A;  3T37 A;  1NU5 A;  3FG2 P;  4D04 A;  1MDR A;  3NK2 X;  3SX6 A;  3NFU A;  3NG7 X;  3JZU A;  1E1K A;  2WPF A;  1ZX9 A;  1K0J A;  5KNL A;  3GC2 A;  3FPZ A;  3UJ2 A;  4DNA A;  4EQX A;  2GR0 A;  3CK5 A;  4U8L A;  4USQ A;  3GRS A;  1O94 A;  3II4 A;  1PS9 A;  3R07 C;  2E4G A;  1BQG A;  1DOB A;  1H81 A;  1MNS A;  1CJ3 A;  3BI4 A;  2YR4 A;  1BF3 A;  3KU9 A;  2FJE A;  3VR9 A;  3NZG A;  3ZLG A;  2FBW A;  1NG3 A;  1AOG A;  4NZH A;  2HZG A;  4ROP A;  1GRT A;  1NPX A;  1F3P A;  1CF3 A;  2VQ7 A;  3GD6 A;  5JCN A;  2B7R A;  2QAE A;  3OPS A;  2FYM A;  2QJJ A;  1CJ4 A;  2E5A A;  3IK4 A;  1WUF A;  3NYE A;  3ISH A;  1R0M A;  2XVJ A;  1E9I A;  4J2W A;  5KVI A;  2AL2 A;  3AEB A; 
#chains in the Genus database with same CATH homology
 2WOW A;  3DA1 A;  2BC0 A;  2V3A A;  2BA9 A;  2XLP A;  2ZZC A;  1B8S A;  4ZCD A;  2JB3 A;  3LZW A;  3I3L A;  3M13 A;  4U2S A;  2IVE A;  1P2E A;  4REK A;  1IUX A;  4AP3 A;  3ICR A;  2F5Z A;  2BK5 A;  5BUL A;  2YG6 A;  3H8L A;  3DJG X;  1JU2 A;  1OJA A;  4ICY A;  2WS3 A;  1TDK A;  1HYU A;  4Z24 A;  2A89 A;  1E6E A;  1GV4 A;  5GSN A;  3DJD A;  4FX9 A;  4GAP A;  2GEW A;  3CNT A;  4J34 A;  3GWD A;  4JNA A;  3VQR A;  2RGO A;  1YQZ A;  2X50 A;  1NAA A;  3QJ4 A;  2YG4 A;  4OPT A;  2V3B A;  3GD4 A;  2BXS A;  2X8G A;  3G5S A;  3UOY A;  3DK8 A;  2R9Z A;  3AYJ A;  3ADA B;  3BHK A;  3AD7 B;  2JK6 A;  2AAQ A;  4H4Y A;  4EQR A;  2WDV A;  3UKL A;  3RP6 A;  3SFD A;  1P2H A;  1YY5 A;  2BS4 A;  4A5L A;  2CFY A;  5U25 A;  1GRF A;  2RAB A;  4J57 A;  2C67 A;  5IPY A;  3GMB A;  3NT6 A;  1S3B A;  5JCI A;  2V6O A;  3B6D A;  1E39 A;  4G6H A;  1GXF A;  3AEC A;  4HA6 A;  4EQS A;  1Y0P A;  4X9M A;  1KSS A;  3NKS A;  4B63 A;  2C7G A;  4B68 A;  4IVO B;  3QVR A;  4G6G A;  2JKC A;  3AE9 A;  1DXL A;  4XWR A;  3RP7 A;  1Y56 A;  4CCR A;  3AD9 B;  3ATR A;  3CIR A;  3BNM A;  1VQW A;  4IV9 A;  4U8J A;  4RG3 A;  2VVL A;  1FCD A;  1JNR A;  1JRX A;  3ICT A;  4YSH A;  3AWI A;  2GR1 A;  2BS2 A;  1H82 A;  4Z25 A;  1GPE A;  2ZZ0 A;  3AED A;  3CN8 A;  2YVF A;  1F6M A;  3CNS A;  1GER A;  3P4Q A;  2WDR A;  5HYM A;  2Q6U A;  1VG0 A;  4IA5 A;  1H2I A;  1CJ2 A;  1Q1R A;  3CTY A;  4H4Q A;  3UTG A;  4H4R A;  4Z2T A;  1OJ9 A;  3NRN A;  4UDR A;  3RED A;  1LQT A;  1BZL A;  3CGE A;  1MOK A;  4I58 A;  4H4Z A;  5U1O A;  2WHD A;  1COY A;  4B65 A;  1M64 A;  4KPR A;  4LA1 A;  3BI2 A;  4BJZ A;  3AE7 A;  3DK4 A;  3CNJ A;  1PBE A;  3IHG A;  2WP5 A;  5J60 A;  4C3Y A;  1GET A;  4OCG A;  3URH A;  2XFP A;  5FS9 A;  3KLJ A;  1ZMD A;  4U8O A;  2B9Y A;  4M52 A;  4A6N B;  3DK9 A;  5ER0 A;  4H2P A;  1OJC A;  3UCL A;  2YG7 A;  1IJH A;  1XHC A;  1K0L A;  1VRQ B;  2GH5 A;  3NK0 X;  4USR A;  5IQ1 A;  2J3N A;  3PO7 A;  2TPR A;  4LII A;  3AE6 A;  1FEB A;  4LU6 A;  2GB0 A;  4GF7 A;  3GDN A;  1ZY8 A;  2WES A;  4KX6 A;  5LV9 A;  4TM1 A;  2VQB A;  2R4E A;  3T14 A;  3UKQ A;  5JRB A;  1PJ5 A;  4IVM B;  2BK4 A;  4FDC B;  1LTX R;  2C64 A;  2XFN A;  4A99 A;  3AEF A;  3V76 A;  3GSI A;  1GRA A;  3P1W A;  1SEZ A;  1KNR A;  2C72 A;  1CC2 A;  3E1T A;  4E0V A;  3QSM A;  4ZN0 A;  1H86 A;  2GQF A;  1ZKQ A;  4N9X A;  5HY5 A;  3V3O A;  2RGH A;  4K2X A;  4B66 A;  2CDU A;  4AOS A;  2YG3 A;  1YQ3 A;  2YLX A;  3VRD B;  3C96 A;  4GAV A;  3RP8 A;  3SZF A;  3WE0 A;  1CBO A;  1PXC A;  2WET A;  5GRT A;  2WPE A;  4K8D A;  3RNM A;  1RYI A;  4EMW A;  3JSK A;  4GRT A;  2PYX A;  1ZP0 A;  2YM1 A;  2WPC A;  4J31 A;  3H4K A;  1GRG A;  2V60 A;  1NHR A;  3UTF A;  3FBS A;  3G5Q A;  3P4P A;  3L5O A;  5FMH A;  2Q0K A;  1QLB A;  3CNP A;  3AE3 A;  3DGZ A;  5C3J A;  1GND A;  4NNJ A;  5EOW A;  3NK1 X;  3I6D A;  1YQ4 A;  2XVH A;  2Y6Q A;  3VRB A;  1O5W A;  4YSY A;  3K7Q X;  1Z6L A;  4NWZ A;  4OPL A;  1Y56 B;  3LB8 A;  4JN9 A;  1D7L A;  1FOH A;  1JRZ A;  1S2Y A;  4OPG A;  2CUL A;  3AB1 A;  1RP0 A;  2ACZ A;  4APN A;  1EBD A;  3RHA A;  3O0H A;  4A79 A;  4II3 A;  2WOI A;  1IUT A;  2C70 A;  4II2 A;  2BCG G;  3R9U A;  2OLO A;  2E1M A;  4C3X A;  3VRA A;  4EIP A;  3K30 A;  4PAA A;  2FJB A;  3AE1 A;  1LVL A;  5EBK A;  4HB9 A;  4OPD A;  3UKF A;  4AT2 A;  2XVI A;  2R0P A;  2A8X A;  4OPI A;  3SZC A;  1H84 A;  3SZ0 A;  4H4U A;  4G9K A;  1CJC A;  1JRY A;  3CPI G;  5KMQ A;  1MO9 A;  2WDQ A;  3CGC A;  1S7M A;  3ATQ A;  3NH3 X;  1N1P A;  3K7T A;  4U2L A;  4UDP A;  5L46 A;  4U8K A;  2VRM A;  3T2Z A;  2BXR A;  1GT8 A;  2XFU A;  1EL9 A;  1Q1W A;  4TM3 A;  3BNU A;  1D7Y A;  3SQP A;  3GDP A;  2GQW A;  1E1M A;  4WCT A;  1GES A;  1PBC A;  3HZL A;  2VVM A;  3OZ2 A;  1PJ6 A;  4G74 A;  3DME A;  2C3D A;  2DKI A;  4EM3 A;  1TRB A;  1XAN A;  2BCP A;  2BRY A;  3K7M X;  4GDE A;  1H6V A;  4BJY A;  2GR3 A;  1PXA A;  1YKJ A;  2C65 A;  4TM4 A;  4GR1 A;  5J7X A;  1VDC A;  1GTH A;  2XLR A;  3NIX A;  2VZ2 A;  5KVH A;  3AEE A;  2GMJ A;  3LAD A;  4A65 A;  3NTD A;  4Y4M A;  2GV8 A;  3PS9 A;  1KN0 A;  4U8P A;  4UDQ A;  3ZYX A;  4B69 A;  2BS3 A;  1BKW A;  1X31 B;  2R0C A;  4AOX A;  4H4S A;  1S3E A;  1VG9 A;  3SGL A;  4A9W A;  5FS7 A;  2W0H A;  3B3R A;  1TDN A;  1PBB A;  3CGB A;  4C74 A;  4Z26 A;  3UKP A;  4MJW A;  5KWF A;  3KKJ A;  4BK1 A;  4B67 A;  5JCK A;  2GMH A;  2GAG B;  1EL7 A;  3BI5 A;  2WP6 A;  3BHF A;  2PHH A;  3IHM A;  4J33 A;  1FEA A;  3S5W A;  4AT0 A;  2EQ8 A;  4EMI A;  1KFY A;  2RGJ A;  1GSN A;  1ZK7 A;  4K22 A;  1S2Q A;  3QSE A;  2X3N A;  1GTE A;  2E5V A;  1DNC A;  4BV6 A;  3P9U A;  1QO8 A;  1JEH A;  5CQF A;  3DJE A;  3CGD A;  2YLS A;  3P4S A;  3UP5 A;  1GRH A;  2YVG A;  2FJD A;  2XLS A;  2EQ6 A;  3EAO A;  2YM2 A;  4FK1 A;  4O5Q A;  5KMR A;  3GWF A;  3D8X A;  2OA1 A;  1KF6 A;  3AEG A;  1OJD A;  2NVK X;  4CRT A;  1L9C A;  3F8D A;  4NTD A;  1BGJ A;  2O9Z A;  2ZBW A;  1LJ1 A;  2R45 A;  3EPT A;  3SYI A;  4BK3 A;  3GD3 A;  2XCG A;  1CL0 A;  3ALJ A;  3CMM A;  1LV0 A;  2A87 A;  1N4U A;  1CC6 A;  2OAL A;  1D4E A;  1IUV A;  2YLW A;  4XXG A;  3ICS A;  3SXI A;  3SFE A;  3AE2 A;  3ALL A;  3LJP A;  3L1R A;  2H88 A;  1JNZ A;  1PXB A;  2YLT A;  3PVC A;  1KDG A;  2WU5 A;  2ZZB A;  1ONF A;  5EB5 A;  3GYX A;  3Q6J A;  4YT0 A;  4JQ9 A;  5BUK A;  4TLX A;  2X8H A;  3LZX A;  4OPU A;  4Y4N A;  4D03 A;  4TLZ A;  1PHH A;  5M0Z A;  2B76 A;  3T31 A;  4B1B A;  4CBQ A;  1ZMC A;  1B37 A;  1PBD A;  5HXI A;  2EQ7 A;  4U2T A;  2XFO A;  4X9N A;  3M0O A;  2YG5 A;  4J36 A;  3GMC A;  2WEU A;  4BK2 A;  2XLU A;  3COX A;  2BAC A;  3T2Y A;  3ZDN A;  3EAN A;  1RSG A;  3QSS A;  1NHS A;  1CC4 A;  3FIM B;  5CKU A;  1GRB A;  4H50 A;  1EL5 A;  5FS6 A;  3NHO X;  4EIQ A;  3GYJ A;  2QCU A;  4GDP A;  1E7P A;  3AXB A;  4NTE A;  5EB4 A;  2OAM A;  1Q9I A;  3F8P A;  5U63 A;  4H4V A;  4FK1 C;  1GOS A;  4CNK A;  2C75 A;  3IC9 A;  4GUV A;  1W4X A;  5M10 A;  4RSL A;  1PDH A;  3AYL A;  1TDF A;  4U8N A;  2YLZ A;  2V61 A;  1BWC A;  1NHP A;  2Y6R A;  3ABV A;  5KRQ A;  4EQW A;  3L8K A;  1NHQ A;  3UTH A;  3NTA A;  2WQY A;  2EQ9 A;  1E1L A;  1H83 A;  2GVC A;  3CPH G;  4NEW A;  4H2R A;  4YKF A;  1NEK A;  2YLR A;  4Z44 A;  4DSH A;  2WP9 A;  1H7W A;  4K7Z A;  2VOU A;  2XYO A;  1PJ7 A;  4TM0 A;  3UTE A;  1CHU A;  2QA1 A;  4Z43 A;  4H4T A;  3KPF A;  2BRA A;  2IID A;  1D4C A;  2UZZ A;  1ZDL A;  2NPX A;  2ARD A;  1ZOY A;  3KD9 A;  1V59 A;  5KOX A;  4CY8 A;  4YWO A;  1DJQ A;  1DOD A;  1GRE A;  3IF9 A;  1IUU A;  3ITJ A;  3M12 A;  4OVI A;  3CND A;  1QJD A;  2AR8 A;  1BGN A;  2Z5X A;  4CNJ A;  4NEV A;  1F8W A;  2GF3 A;  2Q0L A;  2XFQ A;  2JB1 A;  4JNQ A;  2OLN A;  3DGH A;  3QFB A;  3KA7 A;  4H7U A;  1DOE A;  1K4Q A;  4JY2 A;  1PN0 A;  4IA6 A;  4AP1 A;  1L9D A;  4H2N A;  3DH9 A;  2YR5 A;  3LOV A;  1F8S A;  5HHF A;  4DGK A;  3SM8 A;  2C3C A;  2X99 A;  3P4R A;  1REO A;  1OJT A;  3AE4 A;  3GRT A;  3QVP A;  1H7X A;  4YXD A;  2FJA A;  4H4X A;  2H89 A;  4K5R A;  4U8M A;  2B7S A;  4Y4L A;  2CVJ A;  5C2T A;  1GEU A;  2TMD A;  5KOW A;  3DJJ A;  3D9X A;  2BAB A;  4YKG A;  3OC4 A;  4Z2R A;  2AQJ A;  3UOX A;  4B64 A;  3FMW A;  2DKH A;  4BUR A;  1DOC A;  2I0Z A;  2JB2 A;  3T37 A;  3T0K A;  1E1N A;  4Z2U A;  1PBF A;  3D1C A;  3KVE A;  3FG2 P;  4D04 A;  1LPF A;  3HYX A;  1NEN A;  3CPJ G;  4OPC A;  3NK2 X;  3SX6 A;  2C73 A;  3NG7 X;  3LXD A;  2C66 A;  4NTC A;  4YTM A;  2YVJ A;  2Q7V A;  1E1K A;  3AE8 A;  3H8I A;  2WOV A;  2C4C A;  1N4W A;  5IQ4 A;  2JBV A;  3QFA A;  2WPF A;  1ZX9 A;  2C76 A;  3ALM A;  3NYC A;  1K0J A;  1XPQ A;  2BYB A;  1ELI A;  3F8R A;  3FPZ A;  4XWZ A;  1L0V A;  4YTP A;  5KNL A;  3UKA A;  1IUS A;  1DJN A;  3AD8 B;  1TYP A;  4DNA A;  4EQX A;  1TYT A;  4C77 A;  5JCL A;  4JY3 A;  3UKK A;  1O95 A;  2GR0 A;  4O5U A;  4U8L A;  5TR3 A;  3Q9T A;  1KSU A;  1L9E A;  5DBJ A;  2R4J A;  4H4W A;  3HYV A;  4USQ A;  4YSX A;  3GRS A;  4ZCC A;  2BK3 A;  4H2Q A;  1O94 A;  3PG6 A;  3II4 A;  1NG4 A;  2HQM A;  4G73 A;  1PS9 A;  4YTN A;  5JCM A;  3IWA A;  2E4G A;  4X4J A;  5KMS A;  1DOB A;  2GRT A;  1H81 A;  2XLT A;  2XVF A;  3SY4 A;  4CY6 A;  2WBA A;  1CJ3 A;  4GCM A;  3UKH A;  3G5R A;  4YSZ A;  4RG4 A;  3BI4 A;  2YWL A;  5KXJ A;  4DSG A;  2BC1 A;  3T2K A;  1IUW A;  2YR4 A;  1GAL A;  3NN0 X;  3NLC A;  2GR2 A;  4ADW A;  1BF3 A;  3NN6 X;  4P9S A;  3UOV A;  3KU9 A;  1TDE A;  1TDO A;  2APG A;  2FJE A;  4J56 A;  2R46 A;  3VR9 A;  5KMP A;  2Z5Y A;  1NDA A;  3HYW A;  2FBW A;  1NG3 A;  1AOG A;  3EF6 A;  3S61 A;  4NZH A;  4H4P A;  1EL8 A;  4EM4 A;  1LQU A;  2VVL G;  1GRT A;  2XVE A;  1NPX A;  1F3P A;  2R0G A;  4U8I A;  1UKV G;  4I59 A;  4CCQ A;  1CF3 A;  2VQ7 A;  1XDI A;  5JCN A;  3V3N A;  3VR8 A;  2B7R A;  2QAE A;  1M6I A;  1N4V A;  1K0I A;  1B5Q A;  2V5Z A;  3NNE A;  4UP3 A;  2X8C A;  1FL2 A;  1CJ4 A;  4PAB A;  2GAH B;  2VRL A;  3C4A A;  1B4V A;  1D5T A;  2YR6 A;  1FEC A;  2IVD A;  3NGC X;  3UOZ A;  1KNP A;  3NYF A;  4C5O A;  3AYI A;  3NYE A;  1ZOV A;  3ISH A;  4A7A A;  4ECH A;  2B9X A;  5BRT A;  2B9W A;  4A6N A;  3GYI A;  4EMJ A;  4WX1 A;  3AE5 A;  2XVJ A;  1D4D A;  2WU2 A;  2QA2 A;  4K5S A;  2XDO A;  4J2W A;  2YAU A;  5FS8 A;  1JOA A;  4JDR A;  2JAE A;  5KVI A;  1MXT A;  3C4N A;  3UP4 A;  2YQU A;  3KPK A;  3AEB A;  1F8R A;  3AEA A;  5BVA A;  3SZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...