4FDCB

Crystal structure of the e493v mutant of human apoptosis inducing factor (aif)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
483
structure length
461
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYVAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Cowchock syndrome is associated with a mutation in apoptosis-inducing factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis, oxidoreductase
total genus 135
structure length 461
sequence length 483
ec nomenclature ec 1.-.-.-:
pdb deposition date 2012-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
B PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4fdcB03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fdcB02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fdcB01
4BURA 1BF3A 2GQFA 4TM4A 3V3OA 4BV6A 4BJYA 1VG9A 4CNKA 1GERA 1P2EA 4XWRA 3CNSA 3AE3A 3K30A 3NG7X 2XDOA 3UTEA 4Z24A 1F8RA 3NTAA 4IA5A 4TM1A 1H86A 2YG7A 4YKFA 1NPXA 2YLZA 1K0JA 2QCUA 3AE6A 1S3EA 4JY2A 4YXDA 2BXSA 3JSKA 1FOHA 4C74A 1JNRA 3AB1A 4J33A 2GAGB 1GTEA 4PAAA 4U2LA 1Y56B 4Y4MA 4H2QA 4ECHA 2YG6A 1XDIA 3NK2X 3P4RA 2X8CA 2BA9A 2XFQA 5EB4A 2WDRA 2YM2A 2DKIA 4UDRA 1QO8A 4LU6A 3URHA 3ADAB 2OLOA 4A79A 3KVEA 4H4WA 4YTMA 2TPRA 4YSZA 3ITJA 4M52A 2VRLA 1ZK7A 2ARDA 3LZWA 2XFPA 2NPXA 3WE0A 2GV8A 4A9WA 1HYUA 5FS7A 4X9NA 1CJCA 3BNMA 3NH3X 1CF3A 4K5SA 4YTPA 2OALA 4ICYA 1CBOA 2GAHB 1OJCA 3AEFA 4Z44A 3UOXA 2XCGA 2A87A 2YVJA 4U8OA 4B63A 2X99A 2FJDA 5JCIA 2E5VA 3AYIA 1TDEA 2C67A 4UDQA 3C4NA 1KSSA 1DODA 2WOWA 1GESA 4EMIA 1D4EA 2YG3A 3ICTA 4AP3A 2YLXA 4YSXA 2JB1A 1MXTA 2BC1A 1ZKQA 4H2NA 1O95A 1JRYA 2WDVA 4CNJA 2R45A 1O94A 1IUWA 3K7TA 1DOEA 4AOXA 5BRTA 1D7LA 3KD9A 1TDKA 4NTDA 4A6NB 3G5RA 3UKPA 4YT0A 2V60A 2YLRA 3GWFA 1CC2A 5U1OA 2B9YA 5J60A 3LADA 1GV4A 2XLRA 2R0GA 2J3NA 2A89A 3UKLA 1PBDA 4EQRA 3AEDA 3D1CA 4UDPA 4CCQA 2WETA 2QA1A 4NTCA 3UKHA 3AE8A 3UKKA 3NTDA 5KRQA 4OPUA 2YLSA 2GEWA 3AWIA 2VQBA 4JN9A 3CPJG 1RSGA 2OAMA 3Q9TA 1MO9A 4U2TA 3S5WA 4AT0A 4TM3A 1P2HA 1EL9A 2C64A 4K7ZA 3IWAA 1N4UA 3PVCA 1RYIA 5U25A 4IVOB 2V3AA 4OPCA 4JQ9A 4EQXA 1ZP0A 4USQA 4NTEA 2WPFA 4H4PA 4Z26A 1ZX9A 5JCLA 3B3RA 1CL0A 1NHRA 1JEHA 3AD9B 4NEWA 5JCMA 3CGEA 3NRNA 2IVEA 3BI4A 1E1NA 1W4XA 4H4UA 1H84A 2JAEA 2Z5YA 3ABVA 3K7QX 2CDUA 1CJ2A 3P4PA 2X8GA 3AD8B 2BS3A 2XFUA 5HHFA 3V76A 1GREA 1V59A 2B7SA 4USRA 1FEBA 4D03A 4BK1A 3G5SA 2AQJA 2Y6RA 2WP6A 4DSGA 3EAOA 2XVJA 1OJAA 1GNDA 1E1MA 2XFNA 2WU5A 4H7UA 3CGBA 1VQWA 1E39A 2XYOA 2BS2A 3NKSA 3AD7B 2GB0A 4KPRA 3EANA 5KVHA 1PBFA 5JCNA 2EQ7A 1LQTA 1OJTA 3II4A 4EMWA 2YG4A 2WPCA 3ALJA 2V5ZA 3ATRA 3K7MX 4RG4A 1Q1WA 1FEAA 3GRTA 3I3LA 3P4QA 1NG3A 2XLSA 1EL8A 4OPLA 1XHCA 2JKCA 4OPDA 5FS6A 2C75A 4XWZA 3AEGA 3S61A 4AT2A 2BABA 5EBKA 2TMDA 2VZ2A 4JY3A 4NZHA 4X9MA 4YWOA 3CNTA 3EPTA 3ISHA 4H50A 3SQPA 2C73A 1JU2A 3DMEA 1F8SA 3BHFA 2O9ZA 1GRTA 1NG4A 3GD4A 1S3BA 3ICSA 3CNJA 4WCTA 1B4VA 1GALA 1TYPA 3AXBA 2WBAA 1B5QA 4ZCDA 3UKQA 4FX9A 2NVKX 2BYBA 3DGHA 2WESA 2JB2A 3QFBA 3AE5A 3ATQA 4Z2UA 3DA1A 4EQWA 4Y4LA 2EQ9A 1TDNA 2BS4A 3AYJA 3CIRA 4K22A 4B65A 4E0VA 3AE2A 1ZDLA 1EL7A 1M64A 4B67A 2ZZCA 1IUSA 3G5QA 2GMHA 3NK0X 3RNMA 5JCKA 2GR0A 4H4RA 4TLZA 1BKWA 2GR2A 4KX6A 2HQMA 4J36A 5KXJA 2WP9A 5L46A 5C2TA 2YR5A 4DNAA 1E1LA 3F8DA 4RG3A 4H4YA 3QVPA 5ER0A 1SEZA 4TLXA 3AE7A 3DK9A 2YQUA 2X3NA 4JNAA 1NHPA 2VVLG 3KPFA 4BJZA 2RGHA 2WOIA 1NHSA 2BACA 1B37A 5BUKA 1N4VA 4YKGA 1Y56A 1KF6A 3NN6X 4YSHA 4FDCB 5FMHA 2JK6A 5IQ4A 1COYA 4X4JA 2FJBA 1YKJA 1E6EA 2B9XA 3SFEA 1LVLA 4Z43A 2VOUA 4HB9A 1KNPA 4B64A 4A5LA 2Q0LA 4YSYA 1L9CA 4OPTA 1LPFA 3DK4A 1S2QA 1DJNA 2XVFA 2BCGG 3C4AA 3COXA 4DGKA 1H81A 3UKAA 2Y6QA 2RGOA 1ZOVA 2C76A 2R9ZA 3GYIA 5KWFA 2BK5A 1O5WA 2GR3A 3AYLA 1L9DA 2XLPA 3L1RA 1DOCA 1FCDA 1L0VA 2GF3A 1H6VA 2XVHA 3GYJA 3UOYA 3UOVA 1IJHA 2OLNA 3GD3A 4U8KA 4H4VA 4LIIA 1N1PA 1NAAA 4H4TA 1YQ3A 4XXGA 3CTYA 5CKUA 2Z5XA 1Q9IA 1TRBA 1E1KA 4EQSA 3Q6JA 2CULA 3NT6A 2VVLA 1K4QA 3FBSA 3GSIA 2WP5A 1M6IA 1BWCA 4Y4NA 2BC0A 2GVCA 3ICRA 5BVAA 1AOGA 3QSMA 3GDPA 2GRTA 2ZBWA 3IC9A 1GPEA 3FIMB 3BI2A 1D7YA 1TDFA 2B76A 3GRSA 2BK4A 2CVJA 2VQ7A 4OPIA 2V61A 4A6NA 3KLJA 4WX1A 4CY6A 2C3CA 3B6DA 2ACZA 1OJDA 1NHQA 2WPEA 1IUVA 2JBVA 2YR4A 3M13A 5LV9A 2BCPA 3CNPA 4H2RA 3OC4A 4J34A 1JRXA 4I58A 3AE9A 3CN8A 2WDQA 3NNEA 4IA6A 2XFOA 2A8XA 5TR3A 1PJ7A 3QVRA 4GUVA 5M10A 2E1MA 2WQYA 1QJDA 1H83A 4K2XA 3HZLA 5HXIA 1CHUA 1RP0A 2YM1A 1EL5A 3RP8A 2DKHA 4Z25A 5HYMA 1GXFA 1ZY8A 2RABA 3I6DA 4GR1A 5FS9A 1UKVG 1L9EA 4CY8A 1X31B 4H4ZA 3D8XA 3KA7A 1CC4A 1KDGA 2ZZ0A 1IUTA 2AR8A 4GCMA 3UTGA 4CRTA 4Z2TA 3ALMA 5EB5A 2BXRA 3H4KA 3UP5A 3UTFA 1Z6LA 4J56A 4U8MA 1JOAA 1ZMCA 5HY5A 2H89A 3PS9A 4U8IA 1F3PA 3DJJA 4EM4A 1LQUA 3E1TA 3F8PA 3ZDNA 4A99A 1NENA 4H2PA 3P9UA 4Z2RA 1B8SA 1GRGA 1PXAA 3H8IA 3CNDA 1IUXA 1S2YA 3KU9A 3L8KA 1PBCA 4O5QA 3DJDA 3VR8A 1YQ4A 5KOWA 1PXBA 1PN0A 5C3JA 1VRQB 2B7RA 4OPGA 4PABA 4U8PA 4AP1A 3DJGX 5J7XA 4D04A 4EIQA 4C3XA 3AEAA 4A65A 1GRHA 2QAEA 2FJAA 3NYEA 3GDNA 4CBQA 3SFDA 3PO7A 3QFAA 2C65A 1GEUA 2I0ZA 3NHOX 3AEBA 2F5ZA 5GRTA 4B69A 2Q7VA 1K0LA 3DGZA 1Y0PA 1REOA 4JNQA 3RHAA 3LOVA 1D5TA 1VDCA 1OJ9A 4EMJA 1FECA 4EM3A 1GRFA 1GTHA 2YWLA 3F8RA 3RP6A 5CQFA 2BK3A 2UZZA 2GR1A 3ALLA 3CGCA 3VRAA 1F6MA 1TYTA 3QSSA 3LB8A 3H8LA 3SGLA 4HA6A 4IVMB 1CJ4A 3FG2P 4C77A 1LTXR 3NIXA 4APNA 3KKJA 4AOSA 1XANA 3DK8A 1QLBA 3QSEA 2V6OA 2EQ8A 2XVEA 3VRBA 1PBEA 1JNZA 3IHGA 3UKFA 4H4XA 1PHHA 5BULA 3CPHG 3NYCA 1BGJA 1ELIA 1K0IA 2OA1A 1LJ1A 4OVIA 4REKA 5KVIA 1N4WA 3R9UA 1GOSA 4YTNA 5IQ1A 2GQWA 1H7WA 2C7GA 3V3NA 3UCLA 4U8LA 1H7XA 1KSUA 3FMWA 3DH9A 1BGNA 4GDPA 2YLWA 4ZN0A 3LJPA 3GMBA 3UTHA 3P1WA 4B68A 4IV9A 1ONFA 3BNUA 4U8NA 4U2SA 4J57A 5IPYA 2YR6A 4J31A 1F8WA 4ADWA 4TM0A 2AAQA 4GDEA 1MOKA 1IUUA 2XVIA 4LA1A 1LV0A 1KNRA 4C3YA 3UP4A 2R4JA 3LZXA 2C3DA 2YAUA 2R4EA 1GRAA 2APGA 3AE1A 5KOXA 4J2WA 2E4GA 2WHDA 4FK1C 2B9WA 4DSHA 3EF6A 2R46A 4U8JA 2IIDA 4K8DA 1PS9A 3NGCX 3VR9A 2PHHA 3C96A 3QJ4A 3ZYXA 1D4CA 2WU2A 4JDRA 5FS8A 4BK3A 2JB3A 1TDOA 4A7AA 4NEVA 1GT8A 1DXLA 1E7PA 2VVMA 3NK1X 3T37A 2CFYA 4RSLA 3M0OA 5M0ZA 1NEKA 2EQ6A 5EOWA 3NLCA 2IVDA 2WOVA 3IHMA 4C5OA 2Q0KA 3BI5A 2C72A 2V3BA 2YLTA 1H82A 2XLUA 2RGJA 1DNCA 4B1BA 1ZOYA 2C66A 1ZMDA 2FBWA 2X8HA 4H4QA 1DJQA 1PJ5A 3UOZA 2R0PA 2YVFA 2ZZBA 4MJWA 4OCGA 1YY5A 4ZCCA 1GSNA 1DOBA 1CC6A 1YQZA 3GWDA 4GRTA 4H4SA 1VG0A 1PBBA 1PXCA 3O0HA 2Q6UA 4GF7A 1XPQA 4I59A 4O5UA 2GMJA 3AEEA 4P9SA 3OZ2A 1GETA 5DBJA 1JRZA 1PDHA 2X50A 3CPIG 1PJ6A 4FK1A 3RP7A 3CGDA 2PYXA 1EBDA 3P4SA 3REDA 3BHKA 3IF9A 4EIPA 2FJEA 4BK2A 1Q1RA 1D4DA 3DJEA 3AECA 4CCRA 2WS3A 2XLTA 2YVGA 3VRDB 2R0CA 4UP3A 5U63A 1FL2A 3NN0X 1KFYA 2VRMA 3GMCA 2H88A 3NYFA 3SM8A 5GSNA 3VQRA 1BZLA 2W0HA 2C70A 2WEUA 2GH5A 1GRBA 4B66A 4N9XA 2QA2A 3FPZA 3AE4A 3M12A 3LXDA 2YG5A 4K5RA 1NDAA 1CJ3A
chains in the Genus database with same CATH superfamily
4A35A 4CNKA 3TWBA 5IDZA 3CNSA 3A7AA 3UJFA 3T31A 3QPEA 3UTEA 4IA5A 2YG7A 4YKFA 2GGJA 4A6GA 2QCUA 4JY2A 1FOHA 3AB1A 3AN1A 3OPSA 2OLOA 3ITJA 4M52A 2ARDA 2OPJA 2XFPA 3TJIA 2GV8A 3RITA 2QJMA 3MY9A 1V97A 4Z1YA 1CBOA 3V5FA 1OJCA 3HW2A 2GAHB 3UOXA 3SR6B 2A87A 4U8OA 4B63A 2P3ZA 5JCIA 1TDEA 1DODA 2WOWA 3SN4A 2YG3A 2YLXA 3AMZA 1KD0A 2PP0A 3S5SA 3K7TA 5BRTA 1D7LA 4NTDA 2YLRA 1CC2A 2XLRA 2J3NA 1PBDA 4DYEA 1FFVC 2OAMA 1P2HA 1VQZA 4OPCA 4EQXA 5FJUA 2WPFA 1NHRA 1JEHA 3CGEA 2GL5A 3BI4A 3NVWB 1W4XA 3K7QX 3AD8B 5HHFA 2B7SA 2CHRA 3NVVB 4D03A 2Y6RA 2WP6A 2ZC8A 3CGBA 1X2HA 5FJRA 3JZUA 2EQ7A 3ALJA 4EMWA 2YG4A 2V5ZA 1Q1WA 2P0IA 1EL8A 1XHCA 2C75A 4XWZA 5EBKA 2VZ2A 1FO4A 1L8PA 4X9MA 3BHFA 1GRTA 3H8AA 3GD4A 1RM6B 3UKQA 3IJQA 4FX9A 2NVKX 3ATQA 3AE5A 4DHGA 3DA1A 2BS4A 3CIRA 3H7VA 3ZLFA 4JN7A 3SZ0A 4G74A 2GR0A 4KX6A 5C2TA 3FYYA 4RG3A 3QVPA 5ER0A 2PCEA 1NHPA 2RGHA 2WOIA 3UJEA 1MNSA 3TW9A 3FJ4A 3PWIA 4YKGA 3NN6X 3DDMA 5FMHA 1COYA 1YKJA 5ENLA 1E6EA 2OLAA 1SJDA 1ZOVA 2C76A 3GYIA 2BK5A 3AYLA 1L9DA 3NO1A 1DOCA 1H6VA 3UOYA 3UOVA 2OLNA 4LIIA 4H4TA 4XXGA 1E1KA 2AL2A 3NT6A 1E9IA 4DX3A 3FBSA 3RR1A 2BC0A 3ICRA 3RO6A 3R0UA 1GPEA 3R25A 1TDFA 3GRSA 2VQ7A 4OPIA 2V61A 4KEMA 3GYXA 2YR4A 3M13A 2BCPA 3CNPA 4J34A 3AE9A 2WDQA 3NXLA 3CK5A 3QTPA 1PJ7A 2O56A 2XH2A 2E1MA 2BRYA 3DESA 1RP0A 2RABA 3I6DA 4GR1A 3VFCA 1X31B 3BOXA 2ZZ0A 1IUTA 3ALMA 1S7MA 4HYRA 3H4KA 3UP5A 3DG6A 4GGBA 4IP5A 1JOAA 4U8MA 5HY5A 3ZDNA 3F8PA 4Z2RA 3L8KA 1PBCA 5FJOA 3VR8A 1XS2A 5KOWA 1PN0A 3OZYA 4OPGA 4AP1A 3DJGX 4EIQA 4KWSA 2QAEA 2FJAA 2PS2A 3KPKA 3QFAA 3PFRA 1GEUA 2C65A 3NHOX 3AEBA 4K1WA 5KMRA 2W54A 1K0LA 3DGZA 3RHAA 3D9XA 1OJ9A 4EM3A 1GRFA 3F8RA 2GR1A 3ZVIA 3EKGA 3QSSA 3H8LA 4HA6A 2AL1A 2GGGA 3MSYA 1CJ4A 1TE6A 3D47A 3FG2P 3NIXA 3KKJA 4AOSA 3DK8A 2XVEA 3IHGA 2PODA 2W3SA 3PG6A 3ZVHA 1ONEA 1EC8A 4J3ZA 2GGEA 2YLWA 1MDLA 1ONFA 3DIPA 4U8NA 1SJCA 5IPYA 6ENLA 4GYPA 1F8WA 4ADWA 4TM0A 3P3BA 3SBFA 4HNCA 5FJTA 3AM9A 1KNRA 2C3DA 2XSXA 3PK7A 1GRAA 4J2WA 2B9WA 4U8JA 2IIDA 2C4CA 2P88A 4NEVA 1GT8A 1X2GA 3NLCA 4GISA 2PP3A 1ECQA 1H82A 2XLUA 4B1BA 1ZOYA 4A3RA 1ZMDA 2FBWA 2XH0A 1DJQA 1PJ5A 4OCGA 4ZCCA 3NVZB 3DERA 1PXCA 3O0HA 4G73A 3AEEA 4P9SA 1GETA 5DBJA 1PDHA 3BJSA 2X50A 1PJ6A 1YEYA 2PYXA 3STPA 1N5XA 4IL2A 3BHKA 3IF9A 4EIPA 3DJEA 3AECA 3SZFA 2ZADA 3VRDB 4ROPA 4FP1A 2R0CA 4UP3A 3NN0X 2VRMA 3GMCA 5GSNA 1BZLA 2WEUA 2QA2A 3AE4A 2CULA 3JVAA 3V3OA 4BJYA 1VG9A 3MKCA 1GERA 1P2EA 1BKHA 4XWRA 4GYPC 4Z24A 1F8RA 1H86A 2OZ3A 1NPXA 2YLZA 1K0JA 3AE6A 1S3EA 4YXDA 4ENLA 1JNRA 2GAGB 1GTEA 4H2QA 4ECHA 2YG6A 3NK2X 2X8CA 2WDRA 4UDRA 1QO8A 4LU6A 3ADAB 4A79A 4YTMA 3MZNA 4YSZA 3TWAA 1ZK7A 3LZWA 2QDDA 1HYUA 5FS7A 4X9NA 3BNMA 3NH3X 4K5SA 2GGIA 4ICYA 3ENLA 2XCGA 2X99A 2FJDA 1KSSA 2AL2B 4AP3A 1MXTA 2BC1A 1ZKQA 3UXKA 1KN0A 1JRYA 3CMMA 2WDVA 4CNJA 1O94A 4AOXA 2PTYA 3KD9A 1TDKA 3ZLHA 3G5RA 3UKPA 4YT0A 2V60A 2B9YA 1PDYA 4HCLA 5J60A 3LADA 3VCCA 2R0GA 4M6UA 2A89A 3D1CA 2QA1A 4NTCA 3UKKA 2PMQA 2GEWA 2QJJA 4TM3A 1EL9A 3IWAA 4NTEA 4Z26A 2OFJA 5JCLA 3FCPA 3AD9B 5JCMA 2IVEA 2PGEA 4H4UA 3T8QA 3P4PA 2X8GA 3IJIA 2XFUA 1V59A 2AQJA 4DSGA 5G5GB 3EAOA 1GNDA 1E1MA 4H7UA 1VQWA 2XYOA 3QKEA 1LQTA 3K7MX 1JPDX 1KKRA 2W3RA 2XLSA 3A7UA 2AKZA 3S61A 1RVKA 4F4RA 3AEGA 3I6TA 2TMDA 4YWOA 3CNTA 2AKMA 1EBHA 2C73A 1EC9A 1ELSA 2O9ZA 2WBAA 3L5OA 2BYBA 2JB2A 3QFBA 4Z2UA 4EQWA 4HCDA 2EQ9A 4B65A 1M64A 1IUSA 3ZVHB 4K8GA 1BKWA 5KXJA 2YR5A 4H4YA 4TLXA 2GDQA 1TZZA 1STZA 4X2PA 4BJZA 3SY4A 5BUKA 2PGWA 3Q4DA 1Y56A 4X4JA 2FJBA 1KKOA 3SFEA 1LVLA 4Z43A 1N62C 4A5LA 3NVYB 2PU0A 3S47A 1W6TA 1LPFA 4H19A 1DJNA 4DGKA 1H81A 3NRZB 3UKAA 1JROA 5KWFA 3TCSA 3L1RA 3DG3A 3GYJA 1IJHA 1YQ3A 5CKUA 2Z5XA 1TRBA 3Q6JA 3HYWA 3H70A 1M6IA 4Y4NA 5BVAA 1AOGA 3GDPA 2GRTA 3V4BA 4A6NA 3MWCA 4WX1A 3B6DA 2ACZA 1OJDA 2QVHA 4I58A 2A8XA 5TR3A 4GUVA 5M10A 2OZTA 4Z25A 4CY8A 3UTFA 5KMPA 4U8IA 4A99A 1R0MA 1NENA 4H2PA 3N6HA 3KU9A 3OP2A 1PXBA 1VRQB 3VC6A 1JRPA 4D04A 3NYEA 3GDNA 4CBQA 2F5ZA 4B69A 4H1ZA 1REOA 3T14A 3FV9A 1FECA 3RP6A 5CQFA 2UZZA 3CB3A 3SZWA 3VRAA 3R0KA 4C77A 1XANA 4IP4A 5BULA 4H4XA 1PHHA 3DFHA 3ETRB 5KVIA 1H7WA 1VDVA 4U8LA 1MUCA 1BGNA 3P1WA 4IV9A 2XGZA 4U2SA 2YR6A 4NWZA 4H2HA 1MOKA 4LA1A 1FFUC 3FVDA 3UP4A 2R4JA 2YAUA 2R4EA 3AE1A 2E4GA 2WHDA 4FI4A 4DSHA 3UJ2A 3C96A 3QJ4A 2WU2A 1E7PA 3T4WA 2EQ6A 5EOWA 3VCNA 2WOVA 3SQSA 1WUFA 1SB3B 2V3BA 2YLTA 1DNCA 2X8HA 2ZZBA 5J04A 3CXBA 1PBBA 3EUB3 1JRZA 4MKSA 3RP7A 7ENLA 3DFYA 2FJEA 1D4DA 3V3WA 4CCRA 2I5QA 3SYIA 1KFYA 2H88A 2HXTA 3VQRA 3ES7A 3FPZA 2YG5A 1NDAA 3GWFA 1CJ3A 4TVWA 2POZA 4BURA 1BF3A 3NS1B 4TM4A 4BV6A 2PTZA 3AE3A 4TVYA 2XDOA 1OEPA 3NTAA 4TM1A 1N61C 2XH4A 3JSKA 4C74A 4J33A 4PAAA 4U2LA 1Y56B 3P4RA 2BA9A 3URHA 4II3A 3B97A 1NELA 2VRLA 3EEZA 2NPXA 4YTPA 1CF3A 2OALA 4Z44A 1SJBA 3AYIA 2C67A 2PPGA 4EMIA 3ICTA 4YSXA 3T9PA 2P8BA 2JB1A 1O95A 2R45A 1IUWA 1DOEA 1WYGA 3UGVA 5JRBA 4A6NB 3RGTA 3I6EA 1GV4A 4EQRA 3AEDA 4CCQA 2WETA 2FYMA 3UKHA 5FJPA 3AE8A 2PA6A 3NTDA 2OG9A 3AWIA 4JN9A 4DXKA 4E4UA 1RSGA 1MO9A 4U2TA 4AT0A 2C64A 4K7ZA 3PVCA 5U25A 3VA8A 2V3AA 4IVOB 4JQ9A 4USQA 1ZP0A 3HPFA 4NEWA 3NRNA 1H84A 2Z5YA 1BQGA 2QDEA 1GREA 2ONEA 4GAVA 3G5SA 2XVJA 1OJAA 4YWSA 2XFNA 2WU5A 2MNRA 1E39A 3NKSA 5EU9A 5KVHA 1PBFA 5JCNA 2W55A 1R6WA 2WPCA 1FEAA 3I3LA 2HZGA 4OPLA 2JKCA 4OPDA 5FS6A 4AT2A 1FHVA 2GGHA 3R10A 3EPTA 4H50A 3RRAA 3SQPA 1JU2A 1NG4A 1S3BA 3P93A 3N6JA 3K1GA 3OZMA 4ZCDA 1B5QA 3DGHA 2WESA 3IK4A 4Y4LA 1TDNA 3AE2A 1ZDLA 1EL7A 5JCKA 4H4RA 4KPLA 3CAWA 5BOEA 4TLZA 2GR2A 4J36A 4HN8A 4DNAA 1E1LA 3VC5A 1SEZA 3DK9A 2X3NA 4JNAA 3KPFA 1NHSA 2BACA 3T0KA 1N4VA 1KF6A 4FDCB 5IQ4A 2B9XA 2DW6A 4ZOHB 2VOUA 1KNPA 4HB9A 4B64A 3THUA 4YSYA 1L9CA 2XVFA 2BCGG 1NU5A 3C4AA 3COXA 2Y6QA 1O5WA 2GR3A 1FCDA 2GF3A 4U8KA 3GD3A 1N1PA 1NAAA 1P43A 3T2ZA 3CTYA 4HPNA 1Q9IA 3SSZA 4EQSA 1TKKA 1K4QA 3QSMA 3FIMB 2BK4A 2CVJA 3T2YA 3KLJA 4NNJA 3U9IA 4GIRA 2OZ8A 2PTWA 3QN3A 4G8TA 2XFOA 3DGBA 4H83A 1QJDA 4K2XA 3HZLA 5HXIA 1CHUA 1EL5A 3RP8A 1ZY8A 3KA7A 1KDGA 4E6MA 5EB5A 2BXRA 1N63C 1Z6LA 4J56A 2H89A 1F3PA 3DJJA 1LQUA 3E1TA 3R07C 1GRGA 2PTXA 3CNDA 4MMWA 3RCYA 3R1ZA 4DN1A 4PABA 4U8PA 4A65A 1GRHA 3SFDA 3PO7A 5GRTA 2Q7VA 1N5WC 1Y0PA 4JNQA 3LOVA 1D5TA 4EMJA 1H2IA 1GTHA 1MRAA 2OVLA 2YWLA 2QQ6A 2BK3A 2HNEA 4GFIA 1F6MA 1TYTA 3LB8A 4E8GA 3SGLA 4IVMB 4APNA 1IYXA 4Z17A 1QLBA 3QSEA 2QGYA 2V6OA 1PBEA 3UKFA 1BGJA 1ELIA 1K0IA 2OA1A 1LJ1A 4OVIA 4KT2A 4REKA 1N4WA 1GOSA 4YTNA 1N60C 2C7GA 4IHCA 3DG7A 3BSMA 1H7XA 1KSUA 3FMWA 4GDPA 4ZN0A 3GMBA 3UTHA 4B68A 4J57A 4G6GA 4J31A 2OQYA 4G7FA 1MDRA 1ZXIC 2AAQA 1IUUA 1LV0A 4C3YA 3LZXA 3HYVA 3ES8A 5KOXA 3KUMA 4FK1C 3EF6A 3NGCX 2PHHA 3ZYXA 4JDRA 5FS8A 2JB3A 1TDOA 3H12A 1DTNA 1DXLA 2VVMA 3NK1X 5M0ZA 3M0OA 3UXLA 2IVDA 1EBGA 4C5OA 1F9CA 2Q0KA 3BI5A 2C72A 2RGJA 3NFUA 4H4QA 3UOZA 2R0PA 4JN8A 2YVFA 1CC6A 3GWDA 4GRTA 1VG0A 2OKTA 4I59A 1JCTA 2NQLA 3CGDA 1EBDA 3P4SA 4BK2A 1Q1RA 4M0XA 2YVGA 1FL2A 3SM8A 2W0HA 2GH5A 4EWJA 2QJNA 2OX4A 3M12A 3LXDA 3TOYA 2BABA 2GQFA 2MUCA 3GY1A 3K30A 1JPMA 1PDZA 3NG7X 3CXOA 3NZGA 3I4KA 2BXSA 3GD6A 4HNLA 4Y4MA 1XDIA 5EB4A 2XFQA 2YM2A 2DKIA 3KVEA 4H4WA 4J1OA 2TPRA 3SX6A 3WE0A 2DW7A 3CT2A 1T3QC 4A9WA 1CJCA 3AEFA 2YVJA 2E5VA 4UDQA 3C4NA 3A7RA 3DEQA 1GESA 1D4EA 2RDXA 2OQHA 4H2NA 3GO2A 3VDGA 3D46A 5U1OA 4ZCWA 3UKLA 4UDPA 4E5TA 5KRQA 4GGHA 4OPUA 2YLSA 4GAPA 2VQBA 3CPJG 3UJSA 3Q9TA 3S5WA 3SN0A 1N4UA 1RYIA 4H4PA 1ZX9A 3B3RA 1CL0A 4ZA0A 3U4FA 1E1NA 2JAEA 3ABVA 2CDUA 1CJ2A 2BS3A 3V76A 4USRA 1FEBA 4BK1A 2BS2A 3AD7B 2E3TA 2GB0A 1JDFA 4KPRA 3EANA 1OJTA 3II4A 3ATRA 4RG4A 3GRTA 3P4QA 1NG3A 1EC7A 4JY3A 4NZHA 3ISHA 3DMEA 1F8SA 3ICSA 3CNJA 4WCTA 1B4VA 1GALA 1TYPA 3CYJA 3AXBA 3AYJA 4K22A 4E0VA 4B67A 2ZZCA 3G5QA 2GMHA 3NK0X 3RNMA 2HQMA 2WP9A 5L46A 3F8DA 3AE7A 3FXGA 2YQUA 2VVLG 1B37A 3HRDC 4YSHA 2JK6A 1FHUA 5KMQA 2Q0LA 4OPTA 3DK4A 1S2QA 2OO6A 2RGOA 2P8CA 2R9ZA 3UCCA 2XLPA 5G5HB 1L0VA 2XVHA 4H4VA 1XPYA 3N4EA 2VVLA 3GSIA 3Q45A 2WP5A 1BWCA 2GVCA 2ZBWA 3IC9A 3BI2A 1D7YA 2B76A 4CY6A 2C3CA 1NHQA 2WPEA 1IUVA 2JBVA 5LV9A 4H2RA 3OC4A 3TJ4A 1JRXA 3CN8A 3NNEA 4IA6A 3QVRA 1P48A 5BOFA 2WQYA 1H83A 2YM1A 2DKHA 5HYMA 1GXFA 5FS9A 1UKVG 3HYXA 3OTRA 1L9EA 4H4ZA 3D8XA 1CC4A 2FKPA 2AR8A 4GCMA 4Z2TA 3UTGA 4CRTA 3N4FA 1ZMCA 3P0WA 3PS9A 4EM4A 3P9UA 1B8SA 1PXAA 3H8IA 1IUXA 1S2YA 4O5QA 3DJDA 3T6CA 1YQ4A 4IT1A 4G6HA 5C3JA 1WUEA 2B7RA 5J7XA 4C3XA 3AEAA 3SXIA 2I0ZA 3UJRA 2E5AA 4DWDA 1VDCA 2GSHA 4GMEA 4IZGA 3ALLA 3CGCA 1LTXR 3QLDA 3IJLA 5KNLA 2PP1A 2EQ8A 3VRBA 1JNZA 4II2A 3CPHG 3NYCA 3R9UA 4E4FA 5IQ1A 2GQWA 3V3NA 3UCLA 3OW1A 1FIQB 3DH9A 3GC2A 3LJPA 3BNUA 3MQTA 3PWGA 4HCHA 3SZCA 4GDEA 2XVIA 3SN1A 3R11A 2APGA 3SJNA 4G9KA 3JW7A 2R46A 4K8DA 1PS9A 3VR9A 1D4CA 4BK3A 4IL0A 4A7AA 3T37A 2CFYA 4RSLA 3TQPA 1NEKA 2PU1A 3B9JB 3IHMA 3TTEA 2PSNA 1KCZA 3ZLGA 2C66A 2XH7A 4JHMA 4MJWA 1YY5A 1GSNA 1DOBA 4MGGA 1YQZA 4H4SA 3T2KA 2Q6UA 4GF7A 1XPQA 4O5UA 2GMJA 3OZ2A 3CPIG 2HXUA 4FK1A 5KMSA 4K2SA 3REDA 2WS3A 3MUCA 2XLTA 5U63A 1SJAA 3NYFA 2BRAA 3UCDA 2C70A 1GRBA 4B66A 4N9XA 3V5CA 4K5RA
chains in the Genus database with same CATH topology
4BURA 1BF3A 2GQFA 4TM4A 3V3OA 4BV6A 4BJYA 1VG9A 4CNKA 1GERA 1P2EA 4XWRA 3CNSA 3AE3A 3K30A 3T31A 3NG7X 2XDOA 3UTEA 4Z24A 1F8RA 3NTAA 4IA5A 4TM1A 1H86A 2YG7A 4YKFA 1NPXA 2YLZA 1K0JA 2QCUA 3AE6A 1S3EA 4JY2A 4YXDA 2BXSA 3JSKA 1FOHA 4C74A 1JNRA 3AB1A 4J33A 2GAGB 1GTEA 4PAAA 4U2LA 1Y56B 4Y4MA 4H2QA 4ECHA 2YG6A 1XDIA 3NK2X 3P4RA 2X8CA 2BA9A 2XFQA 5EB4A 2WDRA 2YM2A 2DKIA 4UDRA 1QO8A 4LU6A 3URHA 3ADAB 2OLOA 4II3A 4A79A 3KVEA 4H4WA 4YTMA 2TPRA 4YSZA 3ITJA 4M52A 2VRLA 1ZK7A 2ARDA 3LZWA 3SX6A 2XFPA 2NPXA 3WE0A 2GV8A 4A9WA 1HYUA 5FS7A 4X9NA 1CJCA 3BNMA 3NH3X 1CF3A 4K5SA 4YTPA 2OALA 4ICYA 1CBOA 2GAHB 1OJCA 3AEFA 4Z44A 3UOXA 2XCGA 2A87A 2YVJA 4U8OA 4B63A 2X99A 2FJDA 5JCIA 2E5VA 3AYIA 1TDEA 2C67A 4UDQA 3C4NA 1KSSA 1DODA 2WOWA 1GESA 4EMIA 1D4EA 2YG3A 3ICTA 4AP3A 2YLXA 4YSXA 2JB1A 1MXTA 2BC1A 1ZKQA 4H2NA 1O95A 1KN0A 1JRYA 3CMMA 2WDVA 4CNJA 2R45A 1O94A 1IUWA 3K7TA 1DOEA 4AOXA 5BRTA 1D7LA 3KD9A 1TDKA 4NTDA 5JRBA 4A6NB 3G5RA 3UKPA 4YT0A 2V60A 2YLRA 3GWFA 1CC2A 5U1OA 2B9YA 5J60A 3LADA 1GV4A 2XLRA 2R0GA 2J3NA 2A89A 3UKLA 1PBDA 4EQRA 3AEDA 3D1CA 4UDPA 4CCQA 2WETA 2QA1A 4NTCA 3UKHA 3AE8A 3UKKA 3NTDA 5KRQA 4OPUA 2YLSA 4GAPA 2GEWA 3AWIA 2VQBA 4JN9A 3CPJG 1RSGA 2OAMA 3Q9TA 1MO9A 4U2TA 3S5WA 4AT0A 4TM3A 1P2HA 1EL9A 2C64A 4K7ZA 3IWAA 1N4UA 3PVCA 1RYIA 5U25A 4IVOB 2V3AA 4OPCA 4JQ9A 4EQXA 1ZP0A 4USQA 4NTEA 2WPFA 4H4PA 4Z26A 1ZX9A 5JCLA 3B3RA 1CL0A 1NHRA 1JEHA 3AD9B 4NEWA 5JCMA 3CGEA 3NRNA 2IVEA 3BI4A 1E1NA 1W4XA 4H4UA 1H84A 2JAEA 2Z5YA 3ABVA 3K7QX 2CDUA 1CJ2A 3P4PA 2X8GA 3AD8B 2BS3A 2XFUA 5HHFA 3V76A 1GREA 1V59A 2B7SA 4USRA 4GAVA 1FEBA 4D03A 4BK1A 3G5SA 2AQJA 2Y6RA 2WP6A 4DSGA 3EAOA 2XVJA 1OJAA 1GNDA 1E1MA 2XFNA 2WU5A 4H7UA 3CGBA 1VQWA 1E39A 2XYOA 2BS2A 3NKSA 3AD7B 2GB0A 4KPRA 3EANA 5KVHA 1PBFA 5JCNA 2EQ7A 1LQTA 1OJTA 3II4A 4EMWA 2YG4A 2WPCA 3ALJA 2V5ZA 3ATRA 3K7MX 4RG4A 1Q1WA 1FEAA 3GRTA 3I3LA 3P4QA 1NG3A 2XLSA 1EL8A 4OPLA 1XHCA 2JKCA 4OPDA 5FS6A 2C75A 4XWZA 3AEGA 3S61A 4AT2A 2BABA 5EBKA 2TMDA 2VZ2A 4JY3A 4NZHA 4X9MA 4YWOA 3CNTA 3EPTA 3ISHA 4H50A 3SQPA 2C73A 1JU2A 3DMEA 1F8SA 3BHFA 2O9ZA 1GRTA 1NG4A 3GD4A 1S3BA 3ICSA 3CNJA 4WCTA 1B4VA 1GALA 1TYPA 3AXBA 2WBAA 1B5QA 4ZCDA 3UKQA 3L5OA 4FX9A 2NVKX 2BYBA 3DGHA 2WESA 2JB2A 3QFBA 3AE5A 3ATQA 4Z2UA 3DA1A 4EQWA 4Y4LA 2EQ9A 1TDNA 2BS4A 3AYJA 3CIRA 4K22A 4B65A 4E0VA 3AE2A 1ZDLA 1EL7A 1M64A 4B67A 2ZZCA 1IUSA 3G5QA 2GMHA 3SZ0A 3NK0X 3RNMA 5JCKA 2GR0A 4H4RA 4G74A 4TLZA 1BKWA 2GR2A 4KX6A 2HQMA 4J36A 5KXJA 2WP9A 5L46A 5C2TA 2YR5A 4DNAA 1E1LA 3F8DA 4RG3A 4H4YA 3QVPA 5ER0A 1SEZA 4TLXA 3AE7A 3DK9A 2YQUA 2X3NA 4JNAA 1NHPA 2VVLG 3KPFA 4BJZA 2RGHA 3SY4A 2WOIA 1NHSA 2BACA 1B37A 3T0KA 5BUKA 1N4VA 4YKGA 1Y56A 1KF6A 3NN6X 4YSHA 4FDCB 5FMHA 2JK6A 5IQ4A 1COYA 4X4JA 2FJBA 1YKJA 1E6EA 2B9XA 5KMQA 3SFEA 1LVLA 4Z43A 2VOUA 4HB9A 1KNPA 4B64A 4A5LA 2Q0LA 4YSYA 1L9CA 4OPTA 1LPFA 3DK4A 1S2QA 1DJNA 2XVFA 2BCGG 3C4AA 3COXA 4DGKA 1H81A 3UKAA 2Y6QA 2RGOA 1ZOVA 2C76A 2R9ZA 3GYIA 5KWFA 2BK5A 1O5WA 2GR3A 3AYLA 1L9DA 2XLPA 3L1RA 1DOCA 1FCDA 1L0VA 2GF3A 1H6VA 2XVHA 3GYJA 3UOYA 3UOVA 1IJHA 2OLNA 3GD3A 4U8KA 4H4VA 4LIIA 1N1PA 1NAAA 4H4TA 1YQ3A 3T2ZA 4XXGA 3CTYA 5CKUA 2Z5XA 1Q9IA 1TRBA 1E1KA 4EQSA 3Q6JA 2CULA 3HYWA 3NT6A 2VVLA 1K4QA 3FBSA 3GSIA 2WP5A 1M6IA 1BWCA 4Y4NA 2BC0A 2GVCA 3ICRA 5BVAA 1AOGA 3QSMA 3GDPA 2GRTA 2ZBWA 3IC9A 1GPEA 3FIMB 3BI2A 1D7YA 1TDFA 2B76A 3GRSA 2BK4A 2CVJA 2VQ7A 4OPIA 2V61A 3T2YA 4A6NA 3KLJA 4WX1A 4CY6A 2C3CA 3B6DA 2ACZA 4NNJA 1OJDA 1NHQA 2WPEA 1IUVA 2JBVA 3GYXA 2YR4A 3M13A 5LV9A 2BCPA 3CNPA 4H2RA 3OC4A 4J34A 1JRXA 4I58A 3AE9A 3CN8A 2WDQA 3NNEA 4IA6A 2XFOA 2A8XA 5TR3A 1PJ7A 3QVRA 4GUVA 5M10A 2E1MA 2WQYA 1QJDA 1H83A 2BRYA 4K2XA 3HZLA 5HXIA 1CHUA 1RP0A 2YM1A 1EL5A 3RP8A 2DKHA 4Z25A 5HYMA 1GXFA 1ZY8A 2RABA 3I6DA 4GR1A 5FS9A 1UKVG 3HYXA 1L9EA 4CY8A 1X31B 4H4ZA 3D8XA 3KA7A 1CC4A 1KDGA 2ZZ0A 1IUTA 2AR8A 4GCMA 3UTGA 4CRTA 4Z2TA 3ALMA 5EB5A 2BXRA 1S7MA 3H4KA 3UP5A 3UTFA 1Z6LA 4J56A 4U8MA 1JOAA 5KMPA 1ZMCA 5HY5A 2H89A 3PS9A 4U8IA 1F3PA 3DJJA 4EM4A 1LQUA 3E1TA 3F8PA 3ZDNA 4A99A 1NENA 4H2PA 3P9UA 4Z2RA 1B8SA 1GRGA 1PXAA 3H8IA 3CNDA 1IUXA 1S2YA 3KU9A 3L8KA 1PBCA 4O5QA 3DJDA 3VR8A 1YQ4A 4G6HA 5KOWA 1PXBA 1PN0A 5C3JA 1VRQB 2B7RA 4OPGA 4PABA 4U8PA 4AP1A 3DJGX 5J7XA 4D04A 4EIQA 4C3XA 3AEAA 3SXIA 1GRHA 2QAEA 2FJAA 3NYEA 4A65A 3GDNA 3KPKA 4CBQA 3SFDA 3PO7A 3QFAA 2C65A 1GEUA 2I0ZA 3NHOX 3AEBA 2F5ZA 5GRTA 4B69A 2Q7VA 5KMRA 1K0LA 3DGZA 1Y0PA 1REOA 4JNQA 3T14A 3RHAA 3LOVA 3D9XA 1D5TA 1VDCA 1OJ9A 4EMJA 1FECA 1H2IA 4EM3A 1GRFA 1GTHA 2YWLA 3F8RA 3RP6A 5CQFA 2BK3A 2UZZA 2GR1A 3ALLA 3SZWA 3CGCA 3VRAA 1F6MA 1TYTA 3QSSA 3LB8A 3H8LA 3SGLA 4HA6A 4IVMB 1CJ4A 3FG2P 4C77A 1LTXR 3NIXA 4APNA 3KKJA 4AOSA 5KNLA 1XANA 3DK8A 1QLBA 3QSEA 2V6OA 2EQ8A 2XVEA 3VRBA 1PBEA 1JNZA 3IHGA 3UKFA 4H4XA 1PHHA 5BULA 4II2A 3CPHG 3NYCA 1BGJA 1ELIA 1K0IA 2OA1A 1LJ1A 4OVIA 4REKA 5KVIA 1N4WA 3R9UA 1GOSA 3PG6A 4YTNA 5IQ1A 2GQWA 1H7WA 2C7GA 3V3NA 3UCLA 4U8LA 1H7XA 1KSUA 3FMWA 3DH9A 1BGNA 4GDPA 2YLWA 4ZN0A 3LJPA 3GMBA 3UTHA 3P1WA 4B68A 4IV9A 1ONFA 3BNUA 4U8NA 4U2SA 4J57A 4G6GA 2YR6A 4J31A 1F8WA 4NWZA 5IPYA 4ADWA 4TM0A 2AAQA 3SZCA 4GDEA 1MOKA 1IUUA 2XVIA 4LA1A 1LV0A 1KNRA 4C3YA 3UP4A 2R4JA 3LZXA 2C3DA 2YAUA 2R4EA 3HYVA 1GRAA 2APGA 3AE1A 5KOXA 4J2WA 4G9KA 2E4GA 2WHDA 4FK1C 2B9WA 4DSHA 3EF6A 2R46A 4U8JA 2IIDA 4K8DA 1PS9A 3NGCX 3VR9A 2PHHA 3C96A 2C4CA 3QJ4A 1D4CA 3ZYXA 2WU2A 4JDRA 5FS8A 4BK3A 2JB3A 1TDOA 4A7AA 4NEVA 1GT8A 1DXLA 1E7PA 2VVMA 3NK1X 3T37A 2CFYA 4RSLA 3M0OA 5M0ZA 1NEKA 2EQ6A 5EOWA 3NLCA 2IVDA 2WOVA 3IHMA 4C5OA 2Q0KA 3BI5A 2C72A 2V3BA 2YLTA 1H82A 2XLUA 2RGJA 1DNCA 4B1BA 1ZOYA 2C66A 1ZMDA 2FBWA 2X8HA 4H4QA 1DJQA 1PJ5A 3UOZA 2R0PA 2YVFA 2ZZBA 4MJWA 4OCGA 1YY5A 4ZCCA 1GSNA 1DOBA 1CC6A 1YQZA 3GWDA 4GRTA 4H4SA 1VG0A 1PBBA 1PXCA 3O0HA 4G73A 2Q6UA 3T2KA 4GF7A 1XPQA 4I59A 4O5UA 2GMJA 3AEEA 4P9SA 3OZ2A 1GETA 5DBJA 1JRZA 1PDHA 2X50A 3CPIG 1PJ6A 4FK1A 5KMSA 3RP7A 3CGDA 2PYXA 1EBDA 3P4SA 3REDA 3BHKA 3IF9A 4EIPA 2FJEA 4BK2A 1Q1RA 1D4DA 3DJEA 3AECA 4CCRA 3SZFA 2WS3A 2XLTA 2YVGA 3VRDB 2R0CA 4UP3A 5U63A 1FL2A 3SYIA 3NN0X 1KFYA 2VRMA 3GMCA 2H88A 3NYFA 3SM8A 5GSNA 2BRAA 3VQRA 1BZLA 2W0HA 2C70A 2WEUA 2GH5A 1GRBA 4B66A 4N9XA 2QA2A 3FPZA 3AE4A 3M12A 3LXDA 2YG5A 4K5RA 1NDAA 1CJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BUR A;  1BF3 A;  2GQF A;  4TM4 A;  3V3O A;  4BV6 A;  4BJY A;  1VG9 A;  4CNK A;  1GER A;  1P2E A;  4XWR A;  3CNS A;  3AE3 A;  3K30 A;  3NG7 X;  2XDO A;  3UTE A;  4Z24 A;  1F8R A;  3NTA A;  4IA5 A;  4TM1 A;  1H86 A;  2YG7 A;  4YKF A;  1NPX A;  2YLZ A;  1K0J A;  2QCU A;  3AE6 A;  1S3E A;  4JY2 A;  4YXD A;  2BXS A;  3JSK A;  1FOH A;  4C74 A;  1JNR A;  3AB1 A;  4J33 A;  2GAG B;  1GTE A;  4PAA A;  4U2L A;  1Y56 B;  4Y4M A;  4H2Q A;  4ECH A;  2YG6 A;  1XDI A;  3NK2 X;  3P4R A;  2X8C A;  2BA9 A;  2XFQ A;  5EB4 A;  2WDR A;  2YM2 A;  2DKI A;  4UDR A;  1QO8 A;  4LU6 A;  3URH A;  3ADA B;  2OLO A;  4A79 A;  3KVE A;  4H4W A;  4YTM A;  2TPR A;  4YSZ A;  3ITJ A;  4M52 A;  2VRL A;  1ZK7 A;  2ARD A;  3LZW A;  2XFP A;  2NPX A;  3WE0 A;  2GV8 A;  4A9W A;  1HYU A;  5FS7 A;  4X9N A;  1CJC A;  3BNM A;  3NH3 X;  1CF3 A;  4K5S A;  4YTP A;  2OAL A;  4ICY A;  1CBO A;  2GAH B;  1OJC A;  3AEF A;  4Z44 A;  3UOX A;  2XCG A;  2A87 A;  2YVJ A;  4U8O A;  4B63 A;  2X99 A;  2FJD A;  5JCI A;  2E5V A;  3AYI A;  1TDE A;  2C67 A;  4UDQ A;  3C4N A;  1KSS A;  1DOD A;  2WOW A;  1GES A;  4EMI A;  1D4E A;  2YG3 A;  3ICT A;  4AP3 A;  2YLX A;  4YSX A;  2JB1 A;  1MXT A;  2BC1 A;  1ZKQ A;  4H2N A;  1O95 A;  1JRY A;  2WDV A;  4CNJ A;  2R45 A;  1O94 A;  1IUW A;  3K7T A;  1DOE A;  4AOX A;  5BRT A;  1D7L A;  3KD9 A;  1TDK A;  4NTD A;  4A6N B;  3G5R A;  3UKP A;  4YT0 A;  2V60 A;  2YLR A;  3GWF A;  1CC2 A;  5U1O A;  2B9Y A;  5J60 A;  3LAD A;  1GV4 A;  2XLR A;  2R0G A;  2J3N A;  2A89 A;  3UKL A;  1PBD A;  4EQR A;  3AED A;  3D1C A;  4UDP A;  4CCQ A;  2WET A;  2QA1 A;  4NTC A;  3UKH A;  3AE8 A;  3UKK A;  3NTD A;  5KRQ A;  4OPU A;  2YLS A;  2GEW A;  3AWI A;  2VQB A;  4JN9 A;  3CPJ G;  1RSG A;  2OAM A;  3Q9T A;  1MO9 A;  4U2T A;  3S5W A;  4AT0 A;  4TM3 A;  1P2H A;  1EL9 A;  2C64 A;  4K7Z A;  3IWA A;  1N4U A;  3PVC A;  1RYI A;  5U25 A;  4IVO B;  2V3A A;  4OPC A;  4JQ9 A;  4EQX A;  1ZP0 A;  4USQ A;  4NTE A;  2WPF A;  4H4P A;  4Z26 A;  1ZX9 A;  5JCL A;  3B3R A;  1CL0 A;  1NHR A;  1JEH A;  3AD9 B;  4NEW A;  5JCM A;  3CGE A;  3NRN A;  2IVE A;  3BI4 A;  1E1N A;  1W4X A;  4H4U A;  1H84 A;  2JAE A;  2Z5Y A;  3ABV A;  3K7Q X;  2CDU A;  1CJ2 A;  3P4P A;  2X8G A;  3AD8 B;  2BS3 A;  2XFU A;  5HHF A;  3V76 A;  1GRE A;  1V59 A;  2B7S A;  4USR A;  1FEB A;  4D03 A;  4BK1 A;  3G5S A;  2AQJ A;  2Y6R A;  2WP6 A;  4DSG A;  3EAO A;  2XVJ A;  1OJA A;  1GND A;  1E1M A;  2XFN A;  2WU5 A;  4H7U A;  3CGB A;  1VQW A;  1E39 A;  2XYO A;  2BS2 A;  3NKS A;  3AD7 B;  2GB0 A;  4KPR A;  3EAN A;  5KVH A;  1PBF A;  5JCN A;  2EQ7 A;  1LQT A;  1OJT A;  3II4 A;  4EMW A;  2YG4 A;  2WPC A;  3ALJ A;  2V5Z A;  3ATR A;  3K7M X;  4RG4 A;  1Q1W A;  1FEA A;  3GRT A;  3I3L A;  3P4Q A;  1NG3 A;  2XLS A;  1EL8 A;  4OPL A;  1XHC A;  2JKC A;  4OPD A;  5FS6 A;  2C75 A;  4XWZ A;  3AEG A;  3S61 A;  4AT2 A;  2BAB A;  5EBK A;  2TMD A;  2VZ2 A;  4JY3 A;  4NZH A;  4X9M A;  4YWO A;  3CNT A;  3EPT A;  3ISH A;  4H50 A;  3SQP A;  2C73 A;  1JU2 A;  3DME A;  1F8S A;  3BHF A;  2O9Z A;  1GRT A;  1NG4 A;  3GD4 A;  1S3B A;  3ICS A;  3CNJ A;  4WCT A;  1B4V A;  1GAL A;  1TYP A;  3AXB A;  2WBA A;  1B5Q A;  4ZCD A;  3UKQ A;  4FX9 A;  2NVK X;  2BYB A;  3DGH A;  2WES A;  2JB2 A;  3QFB A;  3AE5 A;  3ATQ A;  4Z2U A;  3DA1 A;  4EQW A;  4Y4L A;  2EQ9 A;  1TDN A;  2BS4 A;  3AYJ A;  3CIR A;  4K22 A;  4B65 A;  4E0V A;  3AE2 A;  1ZDL A;  1EL7 A;  1M64 A;  4B67 A;  2ZZC A;  1IUS A;  3G5Q A;  2GMH A;  3NK0 X;  3RNM A;  5JCK A;  2GR0 A;  4H4R A;  4TLZ A;  1BKW A;  2GR2 A;  4KX6 A;  2HQM A;  4J36 A;  5KXJ A;  2WP9 A;  5L46 A;  5C2T A;  2YR5 A;  4DNA A;  1E1L A;  3F8D A;  4RG3 A;  4H4Y A;  3QVP A;  5ER0 A;  1SEZ A;  4TLX A;  3AE7 A;  3DK9 A;  2YQU A;  2X3N A;  4JNA A;  1NHP A;  2VVL G;  3KPF A;  4BJZ A;  2RGH A;  2WOI A;  1NHS A;  2BAC A;  1B37 A;  5BUK A;  1N4V A;  4YKG A;  1Y56 A;  1KF6 A;  3NN6 X;  4YSH A;  4FDC B;  5FMH A;  2JK6 A;  5IQ4 A;  1COY A;  4X4J A;  2FJB A;  1YKJ A;  1E6E A;  2B9X A;  3SFE A;  1LVL A;  4Z43 A;  2VOU A;  4HB9 A;  1KNP A;  4B64 A;  4A5L A;  2Q0L A;  4YSY A;  1L9C A;  4OPT A;  1LPF A;  3DK4 A;  1S2Q A;  1DJN A;  2XVF A;  2BCG G;  3C4A A;  3COX A;  4DGK A;  1H81 A;  3UKA A;  2Y6Q A;  2RGO A;  1ZOV A;  2C76 A;  2R9Z A;  3GYI A;  5KWF A;  2BK5 A;  1O5W A;  2GR3 A;  3AYL A;  1L9D A;  2XLP A;  3L1R A;  1DOC A;  1FCD A;  1L0V A;  2GF3 A;  1H6V A;  2XVH A;  3GYJ A;  3UOY A;  3UOV A;  1IJH A;  2OLN A;  3GD3 A;  4U8K A;  4H4V A;  4LII A;  1N1P A;  1NAA A;  4H4T A;  1YQ3 A;  4XXG A;  3CTY A;  5CKU A;  2Z5X A;  1Q9I A;  1TRB A;  1E1K A;  4EQS A;  3Q6J A;  2CUL A;  3NT6 A;  2VVL A;  1K4Q A;  3FBS A;  3GSI A;  2WP5 A;  1M6I A;  1BWC A;  4Y4N A;  2BC0 A;  2GVC A;  3ICR A;  5BVA A;  1AOG A;  3QSM A;  3GDP A;  2GRT A;  2ZBW A;  3IC9 A;  1GPE A;  3FIM B;  3BI2 A;  1D7Y A;  1TDF A;  2B76 A;  3GRS A;  2BK4 A;  2CVJ A;  2VQ7 A;  4OPI A;  2V61 A;  4A6N A;  3KLJ A;  4WX1 A;  4CY6 A;  2C3C A;  3B6D A;  2ACZ A;  1OJD A;  1NHQ A;  2WPE A;  1IUV A;  2JBV A;  2YR4 A;  3M13 A;  5LV9 A;  2BCP A;  3CNP A;  4H2R A;  3OC4 A;  4J34 A;  1JRX A;  4I58 A;  3AE9 A;  3CN8 A;  2WDQ A;  3NNE A;  4IA6 A;  2XFO A;  2A8X A;  5TR3 A;  1PJ7 A;  3QVR A;  4GUV A;  5M10 A;  2E1M A;  2WQY A;  1QJD A;  1H83 A;  4K2X A;  3HZL A;  5HXI A;  1CHU A;  1RP0 A;  2YM1 A;  1EL5 A;  3RP8 A;  2DKH A;  4Z25 A;  5HYM A;  1GXF A;  1ZY8 A;  2RAB A;  3I6D A;  4GR1 A;  5FS9 A;  1UKV G;  1L9E A;  4CY8 A;  1X31 B;  4H4Z A;  3D8X A;  3KA7 A;  1CC4 A;  1KDG A;  2ZZ0 A;  1IUT A;  2AR8 A;  4GCM A;  3UTG A;  4CRT A;  4Z2T A;  3ALM A;  5EB5 A;  2BXR A;  3H4K A;  3UP5 A;  3UTF A;  1Z6L A;  4J56 A;  4U8M A;  1JOA A;  1ZMC A;  5HY5 A;  2H89 A;  3PS9 A;  4U8I A;  1F3P A;  3DJJ A;  4EM4 A;  1LQU A;  3E1T A;  3F8P A;  3ZDN A;  4A99 A;  1NEN A;  4H2P A;  3P9U A;  4Z2R A;  1B8S A;  1GRG A;  1PXA A;  3H8I A;  3CND A;  1IUX A;  1S2Y A;  3KU9 A;  3L8K A;  1PBC A;  4O5Q A;  3DJD A;  3VR8 A;  1YQ4 A;  5KOW A;  1PXB A;  1PN0 A;  5C3J A;  1VRQ B;  2B7R A;  4OPG A;  4PAB A;  4U8P A;  4AP1 A;  3DJG X;  5J7X A;  4D04 A;  4EIQ A;  4C3X A;  3AEA A;  4A65 A;  1GRH A;  2QAE A;  2FJA A;  3NYE A;  3GDN A;  4CBQ A;  3SFD A;  3PO7 A;  3QFA A;  2C65 A;  1GEU A;  2I0Z A;  3NHO X;  3AEB A;  2F5Z A;  5GRT A;  4B69 A;  2Q7V A;  1K0L A;  3DGZ A;  1Y0P A;  1REO A;  4JNQ A;  3RHA A;  3LOV A;  1D5T A;  1VDC A;  1OJ9 A;  4EMJ A;  1FEC A;  4EM3 A;  1GRF A;  1GTH A;  2YWL A;  3F8R A;  3RP6 A;  5CQF A;  2BK3 A;  2UZZ A;  2GR1 A;  3ALL A;  3CGC A;  3VRA A;  1F6M A;  1TYT A;  3QSS A;  3LB8 A;  3H8L A;  3SGL A;  4HA6 A;  4IVM B;  1CJ4 A;  3FG2 P;  4C77 A;  1LTX R;  3NIX A;  4APN A;  3KKJ A;  4AOS A;  1XAN A;  3DK8 A;  1QLB A;  3QSE A;  2V6O A;  2EQ8 A;  2XVE A;  3VRB A;  1PBE A;  1JNZ A;  3IHG A;  3UKF A;  4H4X A;  1PHH A;  5BUL A;  3CPH G;  3NYC A;  1BGJ A;  1ELI A;  1K0I A;  2OA1 A;  1LJ1 A;  4OVI A;  4REK A;  5KVI A;  1N4W A;  3R9U A;  1GOS A;  4YTN A;  5IQ1 A;  2GQW A;  1H7W A;  2C7G A;  3V3N A;  3UCL A;  4U8L A;  1H7X A;  1KSU A;  3FMW A;  3DH9 A;  1BGN A;  4GDP A;  2YLW A;  4ZN0 A;  3LJP A;  3GMB A;  3UTH A;  3P1W A;  4B68 A;  4IV9 A;  1ONF A;  3BNU A;  4U8N A;  4U2S A;  4J57 A;  5IPY A;  2YR6 A;  4J31 A;  1F8W A;  4ADW A;  4TM0 A;  2AAQ A;  4GDE A;  1MOK A;  1IUU A;  2XVI A;  4LA1 A;  1LV0 A;  1KNR A;  4C3Y A;  3UP4 A;  2R4J A;  3LZX A;  2C3D A;  2YAU A;  2R4E A;  1GRA A;  2APG A;  3AE1 A;  5KOX A;  4J2W A;  2E4G A;  2WHD A;  4FK1 C;  2B9W A;  4DSH A;  3EF6 A;  2R46 A;  4U8J A;  2IID A;  4K8D A;  1PS9 A;  3NGC X;  3VR9 A;  2PHH A;  3C96 A;  3QJ4 A;  3ZYX A;  1D4C A;  2WU2 A;  4JDR A;  5FS8 A;  4BK3 A;  2JB3 A;  1TDO A;  4A7A A;  4NEV A;  1GT8 A;  1DXL A;  1E7P A;  2VVM A;  3NK1 X;  3T37 A;  2CFY A;  4RSL A;  3M0O A;  5M0Z A;  1NEK A;  2EQ6 A;  5EOW A;  3NLC A;  2IVD A;  2WOV A;  3IHM A;  4C5O A;  2Q0K A;  3BI5 A;  2C72 A;  2V3B A;  2YLT A;  1H82 A;  2XLU A;  2RGJ A;  1DNC A;  4B1B A;  1ZOY A;  2C66 A;  1ZMD A;  2FBW A;  2X8H A;  4H4Q A;  1DJQ A;  1PJ5 A;  3UOZ A;  2R0P A;  2YVF A;  2ZZB A;  4MJW A;  4OCG A;  1YY5 A;  4ZCC A;  1GSN A;  1DOB A;  1CC6 A;  1YQZ A;  3GWD A;  4GRT A;  4H4S A;  1VG0 A;  1PBB A;  1PXC A;  3O0H A;  2Q6U A;  4GF7 A;  1XPQ A;  4I59 A;  4O5U A;  2GMJ A;  3AEE A;  4P9S A;  3OZ2 A;  1GET A;  5DBJ A;  1JRZ A;  1PDH A;  2X50 A;  3CPI G;  1PJ6 A;  4FK1 A;  3RP7 A;  3CGD A;  2PYX A;  1EBD A;  3P4S A;  3RED A;  3BHK A;  3IF9 A;  4EIP A;  2FJE A;  4BK2 A;  1Q1R A;  1D4D A;  3DJE A;  3AEC A;  4CCR A;  2WS3 A;  2XLT A;  2YVG A;  3VRD B;  2R0C A;  4UP3 A;  5U63 A;  1FL2 A;  3NN0 X;  1KFY A;  2VRM A;  3GMC A;  2H88 A;  3NYF A;  3SM8 A;  5GSN A;  3VQR A;  1BZL A;  2W0H A;  2C70 A;  2WEU A;  2GH5 A;  1GRB A;  4B66 A;  4N9X A;  2QA2 A;  3FPZ A;  3AE4 A;  3M12 A;  3LXD A;  2YG5 A;  4K5R A;  1NDA A;  1CJ3 A; 
#chains in the Genus database with same CATH topology
 4A35 A;  4CNK A;  3TWB A;  5IDZ A;  3CNS A;  3A7A A;  3UJF A;  3T31 A;  3QPE A;  3UTE A;  4IA5 A;  2YG7 A;  4YKF A;  2GGJ A;  4A6G A;  2QCU A;  4JY2 A;  1FOH A;  3AB1 A;  3AN1 A;  3OPS A;  2OLO A;  3ITJ A;  4M52 A;  2ARD A;  2OPJ A;  2XFP A;  3TJI A;  2GV8 A;  3RIT A;  2QJM A;  3MY9 A;  1V97 A;  4Z1Y A;  1CBO A;  3V5F A;  1OJC A;  3HW2 A;  2GAH B;  3UOX A;  3SR6 B;  2A87 A;  4U8O A;  4B63 A;  2P3Z A;  5JCI A;  1TDE A;  1DOD A;  2WOW A;  3SN4 A;  2YG3 A;  2YLX A;  3AMZ A;  1KD0 A;  2PP0 A;  3S5S A;  3K7T A;  5BRT A;  1D7L A;  4NTD A;  2YLR A;  1CC2 A;  2XLR A;  2J3N A;  1PBD A;  4DYE A;  1FFV C;  2OAM A;  1P2H A;  1VQZ A;  4OPC A;  4EQX A;  5FJU A;  2WPF A;  1NHR A;  1JEH A;  3CGE A;  2GL5 A;  3BI4 A;  3NVW B;  1W4X A;  3K7Q X;  3AD8 B;  5HHF A;  2B7S A;  2CHR A;  3NVV B;  4D03 A;  2Y6R A;  2WP6 A;  2ZC8 A;  3CGB A;  1X2H A;  5FJR A;  3JZU A;  2EQ7 A;  3ALJ A;  4EMW A;  2YG4 A;  2V5Z A;  1Q1W A;  2P0I A;  1EL8 A;  1XHC A;  2C75 A;  4XWZ A;  5EBK A;  2VZ2 A;  1FO4 A;  1L8P A;  4X9M A;  3BHF A;  1GRT A;  3H8A A;  3GD4 A;  1RM6 B;  3UKQ A;  3IJQ A;  4FX9 A;  2NVK X;  3ATQ A;  3AE5 A;  4DHG A;  3DA1 A;  2BS4 A;  3CIR A;  3H7V A;  3ZLF A;  4JN7 A;  3SZ0 A;  4G74 A;  2GR0 A;  4KX6 A;  5C2T A;  3FYY A;  4RG3 A;  3QVP A;  5ER0 A;  2PCE A;  1NHP A;  2RGH A;  2WOI A;  3UJE A;  1MNS A;  3TW9 A;  3FJ4 A;  3PWI A;  4YKG A;  3NN6 X;  3DDM A;  5FMH A;  1COY A;  1YKJ A;  5ENL A;  1E6E A;  2OLA A;  1SJD A;  1ZOV A;  2C76 A;  3GYI A;  2BK5 A;  3AYL A;  1L9D A;  3NO1 A;  1DOC A;  1H6V A;  3UOY A;  3UOV A;  2OLN A;  4LII A;  4H4T A;  4XXG A;  1E1K A;  2AL2 A;  3NT6 A;  1E9I A;  4DX3 A;  3FBS A;  3RR1 A;  2BC0 A;  3ICR A;  3RO6 A;  3R0U A;  1GPE A;  3R25 A;  1TDF A;  3GRS A;  2VQ7 A;  4OPI A;  2V61 A;  4KEM A;  3GYX A;  2YR4 A;  3M13 A;  2BCP A;  3CNP A;  4J34 A;  3AE9 A;  2WDQ A;  3NXL A;  3CK5 A;  3QTP A;  1PJ7 A;  2O56 A;  2XH2 A;  2E1M A;  2BRY A;  3DES A;  1RP0 A;  2RAB A;  3I6D A;  4GR1 A;  3VFC A;  1X31 B;  3BOX A;  2ZZ0 A;  1IUT A;  3ALM A;  1S7M A;  4HYR A;  3H4K A;  3UP5 A;  3DG6 A;  4GGB A;  4IP5 A;  1JOA A;  4U8M A;  5HY5 A;  3ZDN A;  3F8P A;  4Z2R A;  3L8K A;  1PBC A;  5FJO A;  3VR8 A;  1XS2 A;  5KOW A;  1PN0 A;  3OZY A;  4OPG A;  4AP1 A;  3DJG X;  4EIQ A;  4KWS A;  2QAE A;  2FJA A;  2PS2 A;  3KPK A;  3QFA A;  3PFR A;  1GEU A;  2C65 A;  3NHO X;  3AEB A;  4K1W A;  5KMR A;  2W54 A;  1K0L A;  3DGZ A;  3RHA A;  3D9X A;  1OJ9 A;  4EM3 A;  1GRF A;  3F8R A;  2GR1 A;  3ZVI A;  3EKG A;  3QSS A;  3H8L A;  4HA6 A;  2AL1 A;  2GGG A;  3MSY A;  1CJ4 A;  1TE6 A;  3D47 A;  3FG2 P;  3NIX A;  3KKJ A;  4AOS A;  3DK8 A;  2XVE A;  3IHG A;  2POD A;  2W3S A;  3PG6 A;  3ZVH A;  1ONE A;  1EC8 A;  4J3Z A;  2GGE A;  2YLW A;  1MDL A;  1ONF A;  3DIP A;  4U8N A;  1SJC A;  5IPY A;  6ENL A;  4GYP A;  1F8W A;  4ADW A;  4TM0 A;  3P3B A;  3SBF A;  4HNC A;  5FJT A;  3AM9 A;  1KNR A;  2C3D A;  2XSX A;  3PK7 A;  1GRA A;  4J2W A;  2B9W A;  4U8J A;  2IID A;  2C4C A;  2P88 A;  4NEV A;  1GT8 A;  1X2G A;  3NLC A;  4GIS A;  2PP3 A;  1ECQ A;  1H82 A;  2XLU A;  4B1B A;  1ZOY A;  4A3R A;  1ZMD A;  2FBW A;  2XH0 A;  1DJQ A;  1PJ5 A;  4OCG A;  4ZCC A;  3NVZ B;  3DER A;  1PXC A;  3O0H A;  4G73 A;  3AEE A;  4P9S A;  1GET A;  5DBJ A;  1PDH A;  3BJS A;  2X50 A;  1PJ6 A;  1YEY A;  2PYX A;  3STP A;  1N5X A;  4IL2 A;  3BHK A;  3IF9 A;  4EIP A;  3DJE A;  3AEC A;  3SZF A;  2ZAD A;  3VRD B;  4ROP A;  4FP1 A;  2R0C A;  4UP3 A;  3NN0 X;  2VRM A;  3GMC A;  5GSN A;  1BZL A;  2WEU A;  2QA2 A;  3AE4 A;  2CUL A;  3JVA A;  3V3O A;  4BJY A;  1VG9 A;  3MKC A;  1GER A;  1P2E A;  1BKH A;  4XWR A;  4GYP C;  4Z24 A;  1F8R A;  1H86 A;  2OZ3 A;  1NPX A;  2YLZ A;  1K0J A;  3AE6 A;  1S3E A;  4YXD A;  4ENL A;  1JNR A;  2GAG B;  1GTE A;  4H2Q A;  4ECH A;  2YG6 A;  3NK2 X;  2X8C A;  2WDR A;  4UDR A;  1QO8 A;  4LU6 A;  3ADA B;  4A79 A;  4YTM A;  3MZN A;  4YSZ A;  3TWA A;  1ZK7 A;  3LZW A;  2QDD A;  1HYU A;  5FS7 A;  4X9N A;  3BNM A;  3NH3 X;  4K5S A;  2GGI A;  4ICY A;  3ENL A;  2XCG A;  2X99 A;  2FJD A;  1KSS A;  2AL2 B;  4AP3 A;  1MXT A;  2BC1 A;  1ZKQ A;  3UXK A;  1KN0 A;  1JRY A;  3CMM A;  2WDV A;  4CNJ A;  1O94 A;  4AOX A;  2PTY A;  3KD9 A;  1TDK A;  3ZLH A;  3G5R A;  3UKP A;  4YT0 A;  2V60 A;  2B9Y A;  1PDY A;  4HCL A;  5J60 A;  3LAD A;  3VCC A;  2R0G A;  4M6U A;  2A89 A;  3D1C A;  2QA1 A;  4NTC A;  3UKK A;  2PMQ A;  2GEW A;  2QJJ A;  4TM3 A;  1EL9 A;  3IWA A;  4NTE A;  4Z26 A;  2OFJ A;  5JCL A;  3FCP A;  3AD9 B;  5JCM A;  2IVE A;  2PGE A;  4H4U A;  3T8Q A;  3P4P A;  2X8G A;  3IJI A;  2XFU A;  1V59 A;  2AQJ A;  4DSG A;  5G5G B;  3EAO A;  1GND A;  1E1M A;  4H7U A;  1VQW A;  2XYO A;  3QKE A;  1LQT A;  3K7M X;  1JPD X;  1KKR A;  2W3R A;  2XLS A;  3A7U A;  2AKZ A;  3S61 A;  1RVK A;  4F4R A;  3AEG A;  3I6T A;  2TMD A;  4YWO A;  3CNT A;  2AKM A;  1EBH A;  2C73 A;  1EC9 A;  1ELS A;  2O9Z A;  2WBA A;  3L5O A;  2BYB A;  2JB2 A;  3QFB A;  4Z2U A;  4EQW A;  4HCD A;  2EQ9 A;  4B65 A;  1M64 A;  1IUS A;  3ZVH B;  4K8G A;  1BKW A;  5KXJ A;  2YR5 A;  4H4Y A;  4TLX A;  2GDQ A;  1TZZ A;  1STZ A;  4X2P A;  4BJZ A;  3SY4 A;  5BUK A;  2PGW A;  3Q4D A;  1Y56 A;  4X4J A;  2FJB A;  1KKO A;  3SFE A;  1LVL A;  4Z43 A;  1N62 C;  4A5L A;  3NVY B;  2PU0 A;  3S47 A;  1W6T A;  1LPF A;  4H19 A;  1DJN A;  4DGK A;  1H81 A;  3NRZ B;  3UKA A;  1JRO A;  5KWF A;  3TCS A;  3L1R A;  3DG3 A;  3GYJ A;  1IJH A;  1YQ3 A;  5CKU A;  2Z5X A;  1TRB A;  3Q6J A;  3HYW A;  3H70 A;  1M6I A;  4Y4N A;  5BVA A;  1AOG A;  3GDP A;  2GRT A;  3V4B A;  4A6N A;  3MWC A;  4WX1 A;  3B6D A;  2ACZ A;  1OJD A;  2QVH A;  4I58 A;  2A8X A;  5TR3 A;  4GUV A;  5M10 A;  2OZT A;  4Z25 A;  4CY8 A;  3UTF A;  5KMP A;  4U8I A;  4A99 A;  1R0M A;  1NEN A;  4H2P A;  3N6H A;  3KU9 A;  3OP2 A;  1PXB A;  1VRQ B;  3VC6 A;  1JRP A;  4D04 A;  3NYE A;  3GDN A;  4CBQ A;  2F5Z A;  4B69 A;  4H1Z A;  1REO A;  3T14 A;  3FV9 A;  1FEC A;  3RP6 A;  5CQF A;  2UZZ A;  3CB3 A;  3SZW A;  3VRA A;  3R0K A;  4C77 A;  1XAN A;  4IP4 A;  5BUL A;  4H4X A;  1PHH A;  3DFH A;  3ETR B;  5KVI A;  1H7W A;  1VDV A;  4U8L A;  1MUC A;  1BGN A;  3P1W A;  4IV9 A;  2XGZ A;  4U2S A;  2YR6 A;  4NWZ A;  4H2H A;  1MOK A;  4LA1 A;  1FFU C;  3FVD A;  3UP4 A;  2R4J A;  2YAU A;  2R4E A;  3AE1 A;  2E4G A;  2WHD A;  4FI4 A;  4DSH A;  3UJ2 A;  3C96 A;  3QJ4 A;  2WU2 A;  1E7P A;  3T4W A;  2EQ6 A;  5EOW A;  3VCN A;  2WOV A;  3SQS A;  1WUF A;  1SB3 B;  2V3B A;  2YLT A;  1DNC A;  2X8H A;  2ZZB A;  5J04 A;  3CXB A;  1PBB A;  3EUB 3;  1JRZ A;  4MKS A;  3RP7 A;  7ENL A;  3DFY A;  2FJE A;  1D4D A;  3V3W A;  4CCR A;  2I5Q A;  3SYI A;  1KFY A;  2H88 A;  2HXT A;  3VQR A;  3ES7 A;  3FPZ A;  2YG5 A;  1NDA A;  3GWF A;  1CJ3 A;  4TVW A;  2POZ A;  4BUR A;  1BF3 A;  3NS1 B;  4TM4 A;  4BV6 A;  2PTZ A;  3AE3 A;  4TVY A;  2XDO A;  1OEP A;  3NTA A;  4TM1 A;  1N61 C;  2XH4 A;  3JSK A;  4C74 A;  4J33 A;  4PAA A;  4U2L A;  1Y56 B;  3P4R A;  2BA9 A;  3URH A;  4II3 A;  3B97 A;  1NEL A;  2VRL A;  3EEZ A;  2NPX A;  4YTP A;  1CF3 A;  2OAL A;  4Z44 A;  1SJB A;  3AYI A;  2C67 A;  2PPG A;  4EMI A;  3ICT A;  4YSX A;  3T9P A;  2P8B A;  2JB1 A;  1O95 A;  2R45 A;  1IUW A;  1DOE A;  1WYG A;  3UGV A;  5JRB A;  4A6N B;  3RGT A;  3I6E A;  1GV4 A;  4EQR A;  3AED A;  4CCQ A;  2WET A;  2FYM A;  3UKH A;  5FJP A;  3AE8 A;  2PA6 A;  3NTD A;  2OG9 A;  3AWI A;  4JN9 A;  4DXK A;  4E4U A;  1RSG A;  1MO9 A;  4U2T A;  4AT0 A;  2C64 A;  4K7Z A;  3PVC A;  5U25 A;  3VA8 A;  2V3A A;  4IVO B;  4JQ9 A;  4USQ A;  1ZP0 A;  3HPF A;  4NEW A;  3NRN A;  1H84 A;  2Z5Y A;  1BQG A;  2QDE A;  1GRE A;  2ONE A;  4GAV A;  3G5S A;  2XVJ A;  1OJA A;  4YWS A;  2XFN A;  2WU5 A;  2MNR A;  1E39 A;  3NKS A;  5EU9 A;  5KVH A;  1PBF A;  5JCN A;  2W55 A;  1R6W A;  2WPC A;  1FEA A;  3I3L A;  2HZG A;  4OPL A;  2JKC A;  4OPD A;  5FS6 A;  4AT2 A;  1FHV A;  2GGH A;  3R10 A;  3EPT A;  4H50 A;  3RRA A;  3SQP A;  1JU2 A;  1NG4 A;  1S3B A;  3P93 A;  3N6J A;  3K1G A;  3OZM A;  4ZCD A;  1B5Q A;  3DGH A;  2WES A;  3IK4 A;  4Y4L A;  1TDN A;  3AE2 A;  1ZDL A;  1EL7 A;  5JCK A;  4H4R A;  4KPL A;  3CAW A;  5BOE A;  4TLZ A;  2GR2 A;  4J36 A;  4HN8 A;  4DNA A;  1E1L A;  3VC5 A;  1SEZ A;  3DK9 A;  2X3N A;  4JNA A;  3KPF A;  1NHS A;  2BAC A;  3T0K A;  1N4V A;  1KF6 A;  4FDC B;  5IQ4 A;  2B9X A;  2DW6 A;  4ZOH B;  2VOU A;  1KNP A;  4HB9 A;  4B64 A;  3THU A;  4YSY A;  1L9C A;  2XVF A;  2BCG G;  1NU5 A;  3C4A A;  3COX A;  2Y6Q A;  1O5W A;  2GR3 A;  1FCD A;  2GF3 A;  4U8K A;  3GD3 A;  1N1P A;  1NAA A;  1P43 A;  3T2Z A;  3CTY A;  4HPN A;  1Q9I A;  3SSZ A;  4EQS A;  1TKK A;  1K4Q A;  3QSM A;  3FIM B;  2BK4 A;  2CVJ A;  3T2Y A;  3KLJ A;  4NNJ A;  3U9I A;  4GIR A;  2OZ8 A;  2PTW A;  3QN3 A;  4G8T A;  2XFO A;  3DGB A;  4H83 A;  1QJD A;  4K2X A;  3HZL A;  5HXI A;  1CHU A;  1EL5 A;  3RP8 A;  1ZY8 A;  3KA7 A;  1KDG A;  4E6M A;  5EB5 A;  2BXR A;  1N63 C;  1Z6L A;  4J56 A;  2H89 A;  1F3P A;  3DJJ A;  1LQU A;  3E1T A;  3R07 C;  1GRG A;  2PTX A;  3CND A;  4MMW A;  3RCY A;  3R1Z A;  4DN1 A;  4PAB A;  4U8P A;  4A65 A;  1GRH A;  3SFD A;  3PO7 A;  5GRT A;  2Q7V A;  1N5W C;  1Y0P A;  4JNQ A;  3LOV A;  1D5T A;  4EMJ A;  1H2I A;  1GTH A;  1MRA A;  2OVL A;  2YWL A;  2QQ6 A;  2BK3 A;  2HNE A;  4GFI A;  1F6M A;  1TYT A;  3LB8 A;  4E8G A;  3SGL A;  4IVM B;  4APN A;  1IYX A;  4Z17 A;  1QLB A;  3QSE A;  2QGY A;  2V6O A;  1PBE A;  3UKF A;  1BGJ A;  1ELI A;  1K0I A;  2OA1 A;  1LJ1 A;  4OVI A;  4KT2 A;  4REK A;  1N4W A;  1GOS A;  4YTN A;  1N60 C;  2C7G A;  4IHC A;  3DG7 A;  3BSM A;  1H7X A;  1KSU A;  3FMW A;  4GDP A;  4ZN0 A;  3GMB A;  3UTH A;  4B68 A;  4J57 A;  4G6G A;  4J31 A;  2OQY A;  4G7F A;  1MDR A;  1ZXI C;  2AAQ A;  1IUU A;  1LV0 A;  4C3Y A;  3LZX A;  3HYV A;  3ES8 A;  5KOX A;  3KUM A;  4FK1 C;  3EF6 A;  3NGC X;  2PHH A;  3ZYX A;  4JDR A;  5FS8 A;  2JB3 A;  1TDO A;  3H12 A;  1DTN A;  1DXL A;  2VVM A;  3NK1 X;  5M0Z A;  3M0O A;  3UXL A;  2IVD A;  1EBG A;  4C5O A;  1F9C A;  2Q0K A;  3BI5 A;  2C72 A;  2RGJ A;  3NFU A;  4H4Q A;  3UOZ A;  2R0P A;  4JN8 A;  2YVF A;  1CC6 A;  3GWD A;  4GRT A;  1VG0 A;  2OKT A;  4I59 A;  1JCT A;  2NQL A;  3CGD A;  1EBD A;  3P4S A;  4BK2 A;  1Q1R A;  4M0X A;  2YVG A;  1FL2 A;  3SM8 A;  2W0H A;  2GH5 A;  4EWJ A;  2QJN A;  2OX4 A;  3M12 A;  3LXD A;  3TOY A;  2BAB A;  2GQF A;  2MUC A;  3GY1 A;  3K30 A;  1JPM A;  1PDZ A;  3NG7 X;  3CXO A;  3NZG A;  3I4K A;  2BXS A;  3GD6 A;  4HNL A;  4Y4M A;  1XDI A;  5EB4 A;  2XFQ A;  2YM2 A;  2DKI A;  3KVE A;  4H4W A;  4J1O A;  2TPR A;  3SX6 A;  3WE0 A;  2DW7 A;  3CT2 A;  1T3Q C;  4A9W A;  1CJC A;  3AEF A;  2YVJ A;  2E5V A;  4UDQ A;  3C4N A;  3A7R A;  3DEQ A;  1GES A;  1D4E A;  2RDX A;  2OQH A;  4H2N A;  3GO2 A;  3VDG A;  3D46 A;  5U1O A;  4ZCW A;  3UKL A;  4UDP A;  4E5T A;  5KRQ A;  4GGH A;  4OPU A;  2YLS A;  4GAP A;  2VQB A;  3CPJ G;  3UJS A;  3Q9T A;  3S5W A;  3SN0 A;  1N4U A;  1RYI A;  4H4P A;  1ZX9 A;  3B3R A;  1CL0 A;  4ZA0 A;  3U4F A;  1E1N A;  2JAE A;  3ABV A;  2CDU A;  1CJ2 A;  2BS3 A;  3V76 A;  4USR A;  1FEB A;  4BK1 A;  2BS2 A;  3AD7 B;  2E3T A;  2GB0 A;  1JDF A;  4KPR A;  3EAN A;  1OJT A;  3II4 A;  3ATR A;  4RG4 A;  3GRT A;  3P4Q A;  1NG3 A;  1EC7 A;  4JY3 A;  4NZH A;  3ISH A;  3DME A;  1F8S A;  3ICS A;  3CNJ A;  4WCT A;  1B4V A;  1GAL A;  1TYP A;  3CYJ A;  3AXB A;  3AYJ A;  4K22 A;  4E0V A;  4B67 A;  2ZZC A;  3G5Q A;  2GMH A;  3NK0 X;  3RNM A;  2HQM A;  2WP9 A;  5L46 A;  3F8D A;  3AE7 A;  3FXG A;  2YQU A;  2VVL G;  1B37 A;  3HRD C;  4YSH A;  2JK6 A;  1FHU A;  5KMQ A;  2Q0L A;  4OPT A;  3DK4 A;  1S2Q A;  2OO6 A;  2RGO A;  2P8C A;  2R9Z A;  3UCC A;  2XLP A;  5G5H B;  1L0V A;  2XVH A;  4H4V A;  1XPY A;  3N4E A;  2VVL A;  3GSI A;  3Q45 A;  2WP5 A;  1BWC A;  2GVC A;  2ZBW A;  3IC9 A;  3BI2 A;  1D7Y A;  2B76 A;  4CY6 A;  2C3C A;  1NHQ A;  2WPE A;  1IUV A;  2JBV A;  5LV9 A;  4H2R A;  3OC4 A;  3TJ4 A;  1JRX A;  3CN8 A;  3NNE A;  4IA6 A;  3QVR A;  1P48 A;  5BOF A;  2WQY A;  1H83 A;  2YM1 A;  2DKH A;  5HYM A;  1GXF A;  5FS9 A;  1UKV G;  3HYX A;  3OTR A;  1L9E A;  4H4Z A;  3D8X A;  1CC4 A;  2FKP A;  2AR8 A;  4GCM A;  4Z2T A;  3UTG A;  4CRT A;  3N4F A;  1ZMC A;  3P0W A;  3PS9 A;  4EM4 A;  3P9U A;  1B8S A;  1PXA A;  3H8I A;  1IUX A;  1S2Y A;  4O5Q A;  3DJD A;  3T6C A;  1YQ4 A;  4IT1 A;  4G6H A;  5C3J A;  1WUE A;  2B7R A;  5J7X A;  4C3X A;  3AEA A;  3SXI A;  2I0Z A;  3UJR A;  2E5A A;  4DWD A;  1VDC A;  2GSH A;  4GME A;  4IZG A;  3ALL A;  3CGC A;  1LTX R;  3QLD A;  3IJL A;  5KNL A;  2PP1 A;  2EQ8 A;  3VRB A;  1JNZ A;  4II2 A;  3CPH G;  3NYC A;  3R9U A;  4E4F A;  5IQ1 A;  2GQW A;  3V3N A;  3UCL A;  3OW1 A;  1FIQ B;  3DH9 A;  3GC2 A;  3LJP A;  3BNU A;  3MQT A;  3PWG A;  4HCH A;  3SZC A;  4GDE A;  2XVI A;  3SN1 A;  3R11 A;  2APG A;  3SJN A;  4G9K A;  3JW7 A;  2R46 A;  4K8D A;  1PS9 A;  3VR9 A;  1D4C A;  4BK3 A;  4IL0 A;  4A7A A;  3T37 A;  2CFY A;  4RSL A;  3TQP A;  1NEK A;  2PU1 A;  3B9J B;  3IHM A;  3TTE A;  2PSN A;  1KCZ A;  3ZLG A;  2C66 A;  2XH7 A;  4JHM A;  4MJW A;  1YY5 A;  1GSN A;  1DOB A;  4MGG A;  1YQZ A;  4H4S A;  3T2K A;  2Q6U A;  4GF7 A;  1XPQ A;  4O5U A;  2GMJ A;  3OZ2 A;  3CPI G;  2HXU A;  4FK1 A;  5KMS A;  4K2S A;  3RED A;  2WS3 A;  3MUC A;  2XLT A;  5U63 A;  1SJA A;  3NYF A;  2BRA A;  3UCD A;  2C70 A;  1GRB A;  4B66 A;  4N9X A;  3V5C A;  4K5R A; 
#chains in the Genus database with same CATH homology
 4BUR A;  1BF3 A;  2GQF A;  4TM4 A;  3V3O A;  4BV6 A;  4BJY A;  1VG9 A;  4CNK A;  1GER A;  1P2E A;  4XWR A;  3CNS A;  3AE3 A;  3K30 A;  3T31 A;  3NG7 X;  2XDO A;  3UTE A;  4Z24 A;  1F8R A;  3NTA A;  4IA5 A;  4TM1 A;  1H86 A;  2YG7 A;  4YKF A;  1NPX A;  2YLZ A;  1K0J A;  2QCU A;  3AE6 A;  1S3E A;  4JY2 A;  4YXD A;  2BXS A;  3JSK A;  1FOH A;  4C74 A;  1JNR A;  3AB1 A;  4J33 A;  2GAG B;  1GTE A;  4PAA A;  4U2L A;  1Y56 B;  4Y4M A;  4H2Q A;  4ECH A;  2YG6 A;  1XDI A;  3NK2 X;  3P4R A;  2X8C A;  2BA9 A;  2XFQ A;  5EB4 A;  2WDR A;  2YM2 A;  2DKI A;  4UDR A;  1QO8 A;  4LU6 A;  3URH A;  3ADA B;  2OLO A;  4II3 A;  4A79 A;  3KVE A;  4H4W A;  4YTM A;  2TPR A;  4YSZ A;  3ITJ A;  4M52 A;  2VRL A;  1ZK7 A;  2ARD A;  3LZW A;  3SX6 A;  2XFP A;  2NPX A;  3WE0 A;  2GV8 A;  4A9W A;  1HYU A;  5FS7 A;  4X9N A;  1CJC A;  3BNM A;  3NH3 X;  1CF3 A;  4K5S A;  4YTP A;  2OAL A;  4ICY A;  1CBO A;  2GAH B;  1OJC A;  3AEF A;  4Z44 A;  3UOX A;  2XCG A;  2A87 A;  2YVJ A;  4U8O A;  4B63 A;  2X99 A;  2FJD A;  5JCI A;  2E5V A;  3AYI A;  1TDE A;  2C67 A;  4UDQ A;  3C4N A;  1KSS A;  1DOD A;  2WOW A;  1GES A;  4EMI A;  1D4E A;  2YG3 A;  3ICT A;  4AP3 A;  2YLX A;  4YSX A;  2JB1 A;  1MXT A;  2BC1 A;  1ZKQ A;  4H2N A;  1O95 A;  1KN0 A;  1JRY A;  3CMM A;  2WDV A;  4CNJ A;  2R45 A;  1O94 A;  1IUW A;  3K7T A;  1DOE A;  4AOX A;  5BRT A;  1D7L A;  3KD9 A;  1TDK A;  4NTD A;  5JRB A;  4A6N B;  3G5R A;  3UKP A;  4YT0 A;  2V60 A;  2YLR A;  3GWF A;  1CC2 A;  5U1O A;  2B9Y A;  5J60 A;  3LAD A;  1GV4 A;  2XLR A;  2R0G A;  2J3N A;  2A89 A;  3UKL A;  1PBD A;  4EQR A;  3AED A;  3D1C A;  4UDP A;  4CCQ A;  2WET A;  2QA1 A;  4NTC A;  3UKH A;  3AE8 A;  3UKK A;  3NTD A;  5KRQ A;  4OPU A;  2YLS A;  4GAP A;  2GEW A;  3AWI A;  2VQB A;  4JN9 A;  3CPJ G;  1RSG A;  2OAM A;  3Q9T A;  1MO9 A;  4U2T A;  3S5W A;  4AT0 A;  4TM3 A;  1P2H A;  1EL9 A;  2C64 A;  4K7Z A;  3IWA A;  1N4U A;  3PVC A;  1RYI A;  5U25 A;  4IVO B;  2V3A A;  4OPC A;  4JQ9 A;  4EQX A;  1ZP0 A;  4USQ A;  4NTE A;  2WPF A;  4H4P A;  4Z26 A;  1ZX9 A;  5JCL A;  3B3R A;  1CL0 A;  1NHR A;  1JEH A;  3AD9 B;  4NEW A;  5JCM A;  3CGE A;  3NRN A;  2IVE A;  3BI4 A;  1E1N A;  1W4X A;  4H4U A;  1H84 A;  2JAE A;  2Z5Y A;  3ABV A;  3K7Q X;  2CDU A;  1CJ2 A;  3P4P A;  2X8G A;  3AD8 B;  2BS3 A;  2XFU A;  5HHF A;  3V76 A;  1GRE A;  1V59 A;  2B7S A;  4USR A;  4GAV A;  1FEB A;  4D03 A;  4BK1 A;  3G5S A;  2AQJ A;  2Y6R A;  2WP6 A;  4DSG A;  3EAO A;  2XVJ A;  1OJA A;  1GND A;  1E1M A;  2XFN A;  2WU5 A;  4H7U A;  3CGB A;  1VQW A;  1E39 A;  2XYO A;  2BS2 A;  3NKS A;  3AD7 B;  2GB0 A;  4KPR A;  3EAN A;  5KVH A;  1PBF A;  5JCN A;  2EQ7 A;  1LQT A;  1OJT A;  3II4 A;  4EMW A;  2YG4 A;  2WPC A;  3ALJ A;  2V5Z A;  3ATR A;  3K7M X;  4RG4 A;  1Q1W A;  1FEA A;  3GRT A;  3I3L A;  3P4Q A;  1NG3 A;  2XLS A;  1EL8 A;  4OPL A;  1XHC A;  2JKC A;  4OPD A;  5FS6 A;  2C75 A;  4XWZ A;  3AEG A;  3S61 A;  4AT2 A;  2BAB A;  5EBK A;  2TMD A;  2VZ2 A;  4JY3 A;  4NZH A;  4X9M A;  4YWO A;  3CNT A;  3EPT A;  3ISH A;  4H50 A;  3SQP A;  2C73 A;  1JU2 A;  3DME A;  1F8S A;  3BHF A;  2O9Z A;  1GRT A;  1NG4 A;  3GD4 A;  1S3B A;  3ICS A;  3CNJ A;  4WCT A;  1B4V A;  1GAL A;  1TYP A;  3AXB A;  2WBA A;  1B5Q A;  4ZCD A;  3UKQ A;  3L5O A;  4FX9 A;  2NVK X;  2BYB A;  3DGH A;  2WES A;  2JB2 A;  3QFB A;  3AE5 A;  3ATQ A;  4Z2U A;  3DA1 A;  4EQW A;  4Y4L A;  2EQ9 A;  1TDN A;  2BS4 A;  3AYJ A;  3CIR A;  4K22 A;  4B65 A;  4E0V A;  3AE2 A;  1ZDL A;  1EL7 A;  1M64 A;  4B67 A;  2ZZC A;  1IUS A;  3G5Q A;  2GMH A;  3SZ0 A;  3NK0 X;  3RNM A;  5JCK A;  2GR0 A;  4H4R A;  4G74 A;  4TLZ A;  1BKW A;  2GR2 A;  4KX6 A;  2HQM A;  4J36 A;  5KXJ A;  2WP9 A;  5L46 A;  5C2T A;  2YR5 A;  4DNA A;  1E1L A;  3F8D A;  4RG3 A;  4H4Y A;  3QVP A;  5ER0 A;  1SEZ A;  4TLX A;  3AE7 A;  3DK9 A;  2YQU A;  2X3N A;  4JNA A;  1NHP A;  2VVL G;  3KPF A;  4BJZ A;  2RGH A;  3SY4 A;  2WOI A;  1NHS A;  2BAC A;  1B37 A;  3T0K A;  5BUK A;  1N4V A;  4YKG A;  1Y56 A;  1KF6 A;  3NN6 X;  4YSH A;  4FDC B;  5FMH A;  2JK6 A;  5IQ4 A;  1COY A;  4X4J A;  2FJB A;  1YKJ A;  1E6E A;  2B9X A;  5KMQ A;  3SFE A;  1LVL A;  4Z43 A;  2VOU A;  4HB9 A;  1KNP A;  4B64 A;  4A5L A;  2Q0L A;  4YSY A;  1L9C A;  4OPT A;  1LPF A;  3DK4 A;  1S2Q A;  1DJN A;  2XVF A;  2BCG G;  3C4A A;  3COX A;  4DGK A;  1H81 A;  3UKA A;  2Y6Q A;  2RGO A;  1ZOV A;  2C76 A;  2R9Z A;  3GYI A;  5KWF A;  2BK5 A;  1O5W A;  2GR3 A;  3AYL A;  1L9D A;  2XLP A;  3L1R A;  1DOC A;  1FCD A;  1L0V A;  2GF3 A;  1H6V A;  2XVH A;  3GYJ A;  3UOY A;  3UOV A;  1IJH A;  2OLN A;  3GD3 A;  4U8K A;  4H4V A;  4LII A;  1N1P A;  1NAA A;  4H4T A;  1YQ3 A;  3T2Z A;  4XXG A;  3CTY A;  5CKU A;  2Z5X A;  1Q9I A;  1TRB A;  1E1K A;  4EQS A;  3Q6J A;  2CUL A;  3HYW A;  3NT6 A;  2VVL A;  1K4Q A;  3FBS A;  3GSI A;  2WP5 A;  1M6I A;  1BWC A;  4Y4N A;  2BC0 A;  2GVC A;  3ICR A;  5BVA A;  1AOG A;  3QSM A;  3GDP A;  2GRT A;  2ZBW A;  3IC9 A;  1GPE A;  3FIM B;  3BI2 A;  1D7Y A;  1TDF A;  2B76 A;  3GRS A;  2BK4 A;  2CVJ A;  2VQ7 A;  4OPI A;  2V61 A;  3T2Y A;  4A6N A;  3KLJ A;  4WX1 A;  4CY6 A;  2C3C A;  3B6D A;  2ACZ A;  4NNJ A;  1OJD A;  1NHQ A;  2WPE A;  1IUV A;  2JBV A;  3GYX A;  2YR4 A;  3M13 A;  5LV9 A;  2BCP A;  3CNP A;  4H2R A;  3OC4 A;  4J34 A;  1JRX A;  4I58 A;  3AE9 A;  3CN8 A;  2WDQ A;  3NNE A;  4IA6 A;  2XFO A;  2A8X A;  5TR3 A;  1PJ7 A;  3QVR A;  4GUV A;  5M10 A;  2E1M A;  2WQY A;  1QJD A;  1H83 A;  2BRY A;  4K2X A;  3HZL A;  5HXI A;  1CHU A;  1RP0 A;  2YM1 A;  1EL5 A;  3RP8 A;  2DKH A;  4Z25 A;  5HYM A;  1GXF A;  1ZY8 A;  2RAB A;  3I6D A;  4GR1 A;  5FS9 A;  1UKV G;  3HYX A;  1L9E A;  4CY8 A;  1X31 B;  4H4Z A;  3D8X A;  3KA7 A;  1CC4 A;  1KDG A;  2ZZ0 A;  1IUT A;  2AR8 A;  4GCM A;  3UTG A;  4CRT A;  4Z2T A;  3ALM A;  5EB5 A;  2BXR A;  1S7M A;  3H4K A;  3UP5 A;  3UTF A;  1Z6L A;  4J56 A;  4U8M A;  1JOA A;  5KMP A;  1ZMC A;  5HY5 A;  2H89 A;  3PS9 A;  4U8I A;  1F3P A;  3DJJ A;  4EM4 A;  1LQU A;  3E1T A;  3F8P A;  3ZDN A;  4A99 A;  1NEN A;  4H2P A;  3P9U A;  4Z2R A;  1B8S A;  1GRG A;  1PXA A;  3H8I A;  3CND A;  1IUX A;  1S2Y A;  3KU9 A;  3L8K A;  1PBC A;  4O5Q A;  3DJD A;  3VR8 A;  1YQ4 A;  4G6H A;  5KOW A;  1PXB A;  1PN0 A;  5C3J A;  1VRQ B;  2B7R A;  4OPG A;  4PAB A;  4U8P A;  4AP1 A;  3DJG X;  5J7X A;  4D04 A;  4EIQ A;  4C3X A;  3AEA A;  3SXI A;  1GRH A;  2QAE A;  2FJA A;  3NYE A;  4A65 A;  3GDN A;  3KPK A;  4CBQ A;  3SFD A;  3PO7 A;  3QFA A;  2C65 A;  1GEU A;  2I0Z A;  3NHO X;  3AEB A;  2F5Z A;  5GRT A;  4B69 A;  2Q7V A;  5KMR A;  1K0L A;  3DGZ A;  1Y0P A;  1REO A;  4JNQ A;  3T14 A;  3RHA A;  3LOV A;  3D9X A;  1D5T A;  1VDC A;  1OJ9 A;  4EMJ A;  1FEC A;  1H2I A;  4EM3 A;  1GRF A;  1GTH A;  2YWL A;  3F8R A;  3RP6 A;  5CQF A;  2BK3 A;  2UZZ A;  2GR1 A;  3ALL A;  3SZW A;  3CGC A;  3VRA A;  1F6M A;  1TYT A;  3QSS A;  3LB8 A;  3H8L A;  3SGL A;  4HA6 A;  4IVM B;  1CJ4 A;  3FG2 P;  4C77 A;  1LTX R;  3NIX A;  4APN A;  3KKJ A;  4AOS A;  5KNL A;  1XAN A;  3DK8 A;  1QLB A;  3QSE A;  2V6O A;  2EQ8 A;  2XVE A;  3VRB A;  1PBE A;  1JNZ A;  3IHG A;  3UKF A;  4H4X A;  1PHH A;  5BUL A;  4II2 A;  3CPH G;  3NYC A;  1BGJ A;  1ELI A;  1K0I A;  2OA1 A;  1LJ1 A;  4OVI A;  4REK A;  5KVI A;  1N4W A;  3R9U A;  1GOS A;  3PG6 A;  4YTN A;  5IQ1 A;  2GQW A;  1H7W A;  2C7G A;  3V3N A;  3UCL A;  4U8L A;  1H7X A;  1KSU A;  3FMW A;  3DH9 A;  1BGN A;  4GDP A;  2YLW A;  4ZN0 A;  3LJP A;  3GMB A;  3UTH A;  3P1W A;  4B68 A;  4IV9 A;  1ONF A;  3BNU A;  4U8N A;  4U2S A;  4J57 A;  4G6G A;  2YR6 A;  4J31 A;  1F8W A;  4NWZ A;  5IPY A;  4ADW A;  4TM0 A;  2AAQ A;  3SZC A;  4GDE A;  1MOK A;  1IUU A;  2XVI A;  4LA1 A;  1LV0 A;  1KNR A;  4C3Y A;  3UP4 A;  2R4J A;  3LZX A;  2C3D A;  2YAU A;  2R4E A;  3HYV A;  1GRA A;  2APG A;  3AE1 A;  5KOX A;  4J2W A;  4G9K A;  2E4G A;  2WHD A;  4FK1 C;  2B9W A;  4DSH A;  3EF6 A;  2R46 A;  4U8J A;  2IID A;  4K8D A;  1PS9 A;  3NGC X;  3VR9 A;  2PHH A;  3C96 A;  2C4C A;  3QJ4 A;  1D4C A;  3ZYX A;  2WU2 A;  4JDR A;  5FS8 A;  4BK3 A;  2JB3 A;  1TDO A;  4A7A A;  4NEV A;  1GT8 A;  1DXL A;  1E7P A;  2VVM A;  3NK1 X;  3T37 A;  2CFY A;  4RSL A;  3M0O A;  5M0Z A;  1NEK A;  2EQ6 A;  5EOW A;  3NLC A;  2IVD A;  2WOV A;  3IHM A;  4C5O A;  2Q0K A;  3BI5 A;  2C72 A;  2V3B A;  2YLT A;  1H82 A;  2XLU A;  2RGJ A;  1DNC A;  4B1B A;  1ZOY A;  2C66 A;  1ZMD A;  2FBW A;  2X8H A;  4H4Q A;  1DJQ A;  1PJ5 A;  3UOZ A;  2R0P A;  2YVF A;  2ZZB A;  4MJW A;  4OCG A;  1YY5 A;  4ZCC A;  1GSN A;  1DOB A;  1CC6 A;  1YQZ A;  3GWD A;  4GRT A;  4H4S A;  1VG0 A;  1PBB A;  1PXC A;  3O0H A;  4G73 A;  2Q6U A;  3T2K A;  4GF7 A;  1XPQ A;  4I59 A;  4O5U A;  2GMJ A;  3AEE A;  4P9S A;  3OZ2 A;  1GET A;  5DBJ A;  1JRZ A;  1PDH A;  2X50 A;  3CPI G;  1PJ6 A;  4FK1 A;  5KMS A;  3RP7 A;  3CGD A;  2PYX A;  1EBD A;  3P4S A;  3RED A;  3BHK A;  3IF9 A;  4EIP A;  2FJE A;  4BK2 A;  1Q1R A;  1D4D A;  3DJE A;  3AEC A;  4CCR A;  3SZF A;  2WS3 A;  2XLT A;  2YVG A;  3VRD B;  2R0C A;  4UP3 A;  5U63 A;  1FL2 A;  3SYI A;  3NN0 X;  1KFY A;  2VRM A;  3GMC A;  2H88 A;  3NYF A;  3SM8 A;  5GSN A;  2BRA A;  3VQR A;  1BZL A;  2W0H A;  2C70 A;  2WEU A;  2GH5 A;  1GRB A;  4B66 A;  4N9X A;  2QA2 A;  3FPZ A;  3AE4 A;  3M12 A;  3LXD A;  2YG5 A;  4K5R A;  1NDA A;  1CJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...