4FDCB

Crystal structure of the e493v mutant of human apoptosis inducing factor (aif)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
483
structure length
461
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYVAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cowchock syndrome is associated with a mutation in apoptosis-inducing factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis, oxidoreductase
molecule keywords Apoptosis-inducing factor 1, mitochondrial
total genus 135
structure length 461
sequence length 483
ec nomenclature ec 1.-.-.-:
pdb deposition date 2012-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
B PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4fdcB03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fdcB02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fdcB01
3SGLA 1B4VA 1B5QA 3UTGA 3UTFA 3AEBA 5FS9A 4K5SA 3KA7A 2E4GA 3BI5A 3OZ2A 4K8DA 4GCMA 2YLTA 2ARDA 1PN0A 3IF9A 1NHPA 3DH9A 1N4UA 3REDA 2Q6UA 1QJDA 3G5QA 3H8IA 3GDNA 4K5RA 1NG4A 2WOVA 2FBWA 3ISHA 4A99A 1X31B 1JRYA 1CF3A 4C77A 2WQYA 3BI2A 4DSHA 4H2PA 3GDPA 2JKCA 4DSGA 2APGA 4J33A 1TYPA 1LQTA 3UP4A 4B63A 1LQUA 3CNTA 3PVCA 2ZZCA 3V76A 3VR9A 1JEHA 3F8RA 3AE2A 3ATRA 4FDCB 1AOGA 3GYJA 1DOEA 3GWDA 5DBJA 2C3DA 1CBOA 1EL8A 1L9CA 3VQRA 4TLXA 2XVFA 1GRAA 3BNUA 4M52A 4AP1A 2IIDA 4KX6A 4WCTA 1ZDLA 3BNMA 3G5RA 3DJDA 4U2TA 2WDQA 1KSUA 4A6NB 3UOYA 1OJ9A 3NG7X 4H4UA 2JAEA 2QCUA 4FK1A 1H82A 1YKJA 4B65A 3RP7A 1E7PA 3EPTA 3CPIG 2BK4A 4YTPA 3AE9A 4NEVA 3AE4A 3AYJA 1PBFA 4NZHA 3IWAA 2EQ7A 1K0LA 3SM8A 2AQJA 2GB0A 3Q9TA 4LIIA 5JCKA 1NAAA 2X8HA 1BWCA 4X9MA 5GRTA 4CNKA 1E1LA 4ZCDA 1LV0A 3DA1A 1H86A 3GMCA 4TM1A 5JCIA 3KVEA 3NK2X 3UTHA 2CULA 1LVLA 1F6MA 1YQ3A 4U8LA 4B1BA 2YVGA 2WDVA 2WOWA 4K2XA 4KPRA 1IUVA 1W4XA 4NTCA 2ZBWA 1H7WA 1CC4A 1RYIA 1TDKA 2WP6A 3UKQA 4FX9A 4JDRA 3NN6X 3LJPA 4USRA 4GDEA 3SQPA 2C75A 1F8SA 4C3YA 1PHHA 1GEUA 4H4XA 2XVEA 2YLRA 4U2LA 4WX1A 4XXGA 5C3JA 2WESA 4LA1A 1DOBA 1IUTA 1KNRA 3G5SA 1JOAA 2B9YA 3K30A 1CJCA 3DK9A 4AT0A 4CY8A 2QA2A 1EL7A 5BVAA 2YVFA 4UP3A 3BHFA 4J31A 4U8IA 1REOA 2VZ2A 3SFDA 2R45A 3NYFA 4BK2A 3ALJA 2WU5A 3AEFA 1CL0A 2YLZA 1NEKA 4H7UA 1RP0A 3FG2P 4RG3A 4EMJA 2XVJA 2NPXA 2V3AA 2XFPA 3FIMB 2EQ8A 1NHSA 2EQ6A 1VG9A 1GPEA 1FOHA 2XVHA 1DJNA 3R9UA 1FEAA 3V3OA 2GH5A 2GAGB 1PJ6A 1ZMCA 4OPDA 2BC0A 1MXTA 4YTNA 4C74A 3RP8A 1OJAA 1NENA 2WOIA 4J57A 3UKFA 3LZXA 3NHOX 4GF7A 3P4QA 3LXDA 2GVCA 4B69A 1S3EA 4H2NA 4Z2TA 2FJAA 3P4PA 3KPFA 3RP6A 1NHRA 3NH3X 5EOWA 1B8SA 2X99A 2A87A 2Y6QA 3AE1A 4IVMB 1NHQA 1Z6LA 2Q7VA 4FK1C 4OPCA 4A7AA 1ZK7A 4EM3A 2XYOA 5EB5A 4GRTA 1PXBA 3JSKA 4LU6A 4O5QA 5KOWA 1PBCA 3ATQA 5TR3A 3AYLA 2I0ZA 5JCLA 3DJGX 3AE3A 3VRDB 3UKKA 1YQZA 3UKPA 2R0GA 2YG6A 3LB8A 3CGBA 5KVIA 2DKHA 2V3BA 1KSSA 1Y56B 5KOXA 3NNEA 1H83A 3D1CA 1K0JA 4K7ZA 2WEUA 1DNCA 5FS6A 1GREA 4X4JA 2H88A 1TYTA 3EAOA 5J60A 1EBDA 4DNAA 1ZOYA 2X8CA 4NEWA 4OPIA 1MO9A 1ZX9A 4NTDA 2BCPA 3P4RA 1CC2A 4UDPA 3DJJA 4UDRA 2GMHA 2YAUA 4U8OA 2GR2A 2V6OA 3AWIA 1OJCA 3LOVA 2YVJA 1ELIA 4A5LA 3M13A 3GMBA 1O5WA 5C2TA 3NK1X 4EQRA 2C76A 2Y6RA 1E1MA 3DK4A 4J56A 1L9EA 3C4NA 4O5UA 1BKWA 1H81A 1XANA 1SEZA 3AEAA 4H4QA 4OVIA 5M0ZA 5M10A 1BGNA 5J7XA 3EANA 3BHKA 1COYA 2WBAA 4BV6A 4TM3A 1MOKA 5BUKA 3AE7A 2YG3A 4Z2RA 4Z25A 3CTYA 4TM4A 2YLWA 1GETA 1E1KA 2X50A 1CC6A 1IJHA 1D4EA 2YLXA 3DGHA 3S61A 4D04A 5U63A 4H4WA 1DOCA 2YG7A 1CJ3A 1TDNA 3H8LA 4EMIA 1S2YA 3AEDA 2B76A 5KVHA 2V60A 1DJQA 3AEEA 4A9WA 3NK0X 2OLOA 4Z43A 4HB9A 5U25A 3I6DA 2R0CA 2VOUA 2A8XA 2C67A 4H4RA 3M12A 2A89A 3DGZA 3IC9A 3QFAA 1PS9A 2C65A 1KNPA 2OA1A 3PS9A 2RABA 3OC4A 1GOSA 1D7YA 1UKVG 1GRFA 2C3CA 3L1RA 5IQ4A 3CNDA 3AECA 3PO7A 2YWLA 1M6IA 1E39A 1P2EA 3NIXA 1P2HA 2C72A 2XDOA 2XLUA 1K4QA 2YR6A 2IVDA 3RNMA 4B64A 3V3NA 3IHMA 4A6NA 2XFUA 4D03A 2V61A 2GMJA 1GALA 3CGCA 2GRTA 3D8XA 1Y56A 2B9XA 4J2WA 3VRBA 4EM4A 1D5TA 2Q0LA 3Q6JA 4JY2A 2TMDA 4ADWA 2R4EA 3AXBA 1IUUA 2BK3A 5EBKA 1F3PA 5GSNA 2QAEA 2C7GA 2GV8A 5L46A 3T37A 4H2RA 4I59A 4B68A 4H4ZA 3QJ4A 4H50A 1BGJA 2B7RA 4OPGA 1F8WA 2WDRA 4DGKA 4C3XA 3NYCA 4J36A 1LTXR 2GQFA 1JNRA 3WE0A 1OJTA 4BK3A 2AAQA 4YKFA 2YLSA 4EIPA 4JN9A 3KLJA 2W0HA 3GD3A 2B7SA 4IA5A 4YTMA 2X3NA 3AE6A 3C4AA 2WPFA 3F8DA 3NGCX 3AEGA 1Q1WA 4OCGA 2OALA 1Q9IA 4Z24A 4YSHA 2GR1A 3K7MX 2V5ZA 4REKA 1IUWA 4H4YA 3LADA 3E1TA 2HQMA 3DJEA 1GRGA 5HYMA 1H84A 1ZY8A 2WP5A 4RG4A 1GNDA 2R46A 2PYXA 3K7QX 1E6EA 3ZDNA 1TDOA 3AD7B 4P9SA 3QVRA 2R0PA 2FJBA 4EMWA 2JB3A 1JRXA 1S2QA 5CQFA 3AD9B 5CKUA 4APNA 3EF6A 1KDGA 5U1OA 1CHUA 1JRZA 1PBEA 3FPZA 4B66A 3HZLA 4CBQA 2XLPA 1YQ4A 3FBSA 4B67A 3ITJA 4JNQA 2UZZA 2GR0A 3ICTA 2GAHB 2ACZA 1FEBA 1VRQB 3ICRA 4A79A 1GRBA 1VDCA 3RHAA 1B37A 5FS8A 2J3NA 2YM2A 3K7TA 1GRHA 4ECHA 1GSNA 1GRTA 4HA6A 4H4VA 1BF3A 1LPFA 3CNSA 2YM1A 3CPHG 1ZOVA 1PJ5A 4YKGA 4YXDA 3GRTA 4Z2UA 5KRQA 1E1NA 2XLRA 4CCRA 3CIRA 1TDFA 1L9DA 4BURA 1YY5A 2GR3A 1PJ7A 2F5ZA 2VRMA 3UCLA 1PBDA 3P9UA 4OPTA 3GSIA 5FS7A 4C5OA 4JY3A 3UKAA 1NG3A 4OPLA 2VVLA 2WHDA 4Z26A 3NN0X 4AOSA 2BS2A 3AB1A 2TPRA 3I3LA 1K0IA 1FECA 4GDPA 1JNZA 3NKSA 2H89A 4K22A 2XFOA 4ZCCA 2CDUA 3UOXA 4PABA 2JBVA 2RGJA 2XFNA 2Q0KA 4BJYA 1N4VA 4IVOB 2JK6A 2VVLG 4XWRA 2GQWA 2C73A 4U8MA 5LV9A 3ABVA 2FJDA 2JB2A 1XPQA 2NVKX 2BCGG 5BRTA 4YSYA 2C64A 2WS3A 3KU9A 3GWFA 2RGOA 3GRSA 3P4SA 4X9NA 3NLCA 2CVJA 1Y0PA 3ALLA 3ICSA 1N4WA 1XDIA 1EL9A 4U8PA 4YSZA 2C70A 4J34A 3KKJA 4H4PA 3ALMA 2Z5YA 3CN8A 4IV9A 1H6VA 5KWFA 1ONFA 2EQ9A 2WPCA 1Q1RA 5JCMA 2ZZ0A 2R4JA 2VRLA 2ZZBA 3AE8A 3GYIA 3UP5A 5HXIA 2B9WA 2FJEA 2XLSA 1DODA 4NTEA 4GUVA 4I58A 4IA6A 3NTDA 3QSEA 4YT0A 3UKHA 3VR8A 5FMHA 3B3RA 4H4TA 4H4SA 2CFYA 1F8RA 3GD4A 1O95A 3BI4A 4XWZA 3IHGA 3F8PA 2O9ZA 2X8GA 2VQ7A 4U2SA 3SFEA 4Z44A 5IPYA 2YR5A 2BS4A 3AYIA 3UOVA 1ZMDA 1D7LA 3AE5A 4U8NA 4AOXA 1PXCA 4CCQA 3VRAA 3NRNA 2WPEA 3NTAA 1JU2A 2OLNA 1IUSA 1DXLA 4JQ9A 4TLZA 4UDQA 4AT2A 3NT6A 1H7XA 3UTEA 1N1PA 4H2QA 2E5VA 5ER0A 2R9ZA 1BZLA 1KFYA 3LZWA 3QSMA 1GTEA 3QSSA 2GEWA 3P1WA 3O0HA 4GR1A 1TDEA 2AR8A 1LJ1A 1HYUA 4EQWA 3CGEA 2BXRA 1OJDA 2XLTA 4PAAA 1QLBA 4EIQA 3ADAB 1GV4A 2OAMA 2YR4A 1M64A 1ZP0A 4Y4LA 5JCNA 2BACA 4RSLA 1PXAA 4Y4NA 3UOZA 2BS3A 1CJ4A 1ZKQA 1EL5A 1O94A 4YWOA 3M0OA 4CRTA 4EQSA 2VQBA 3DMEA 4ICYA 2BA9A 3CPJG 3NYEA 2VVMA 4U8JA 2WETA 1GTHA 1TRBA 2BK5A 5HY5A 4N9XA 1PDHA 4CNJA 2IVEA 2BYBA 3QFBA 2XFQA 3QVPA 2QA1A 3S5WA 3II4A 4A65A 2YG4A 3H4KA 3L8KA 3UKLA 4YSXA 1FCDA 2Z5XA 1D4CA 3CNPA 4CY6A 4TM0A 1PBBA 1KF6A 3FMWA 1D4DA 5BULA 1L0VA 2E1MA 4BK1A 4AP3A 1VQWA 3COXA 1GT8A 5EB4A 2PHHA 1NDAA 3CNJA 4JNAA 5KXJA 3AD8B 1IUXA 2GF3A 1GERA 3URHA 1QO8A 1S3BA 2JB1A 2BABA 5IQ1A 4U8KA 3B6DA 3DK8A 1V59A 2YQUA 4EQXA 2C66A 2WU2A 2XVIA 4E0VA 2XCGA 4ZN0A 2BXSA 1FL2A 4MJWA 1GXFA 1CJ2A 2DKIA 2WP9A 2RGHA 3C96A 1VG0A 5HHFA 3KD9A 4BJZA 4OPUA 3CGDA 1RSGA 2YG5A 3ZYXA 1NPXA 1GESA 1XHCA 2BC1A 4Y4MA 4USQA
chains in the Genus database with same CATH superfamily
2PMQA 3UTGA 3UTFA 4K8DA 3R1ZA 1PN0A 3REDA 3DH9A 1QJDA 3GDNA 4K5RA 1NG4A 2WOVA 3NFUA 3MSYA 4DSHA 3DERA 4J33A 1LQUA 3CNTA 3AE2A 3ATRA 1DOEA 3RO6A 3VQRA 4M52A 4GMEA 2AL2B 1ZDLA 3DJDA 2WDQA 1OJ9A 3NVVB 4H4UA 3H8AA 2GGJA 2DW6A 4B65A 3EPTA 2BK4A 4NEVA 3U9IA 1PBFA 4NZHA 2GB0A 4LIIA 3BJSA 1NAAA 1E1LA 4ZCDA 3GMCA 4TM1A 1LVLA 1YQ3A 2YVGA 3UJRA 1N60C 3UXLA 4NTCA 1H7WA 1KCZA 1TDKA 2PTWA 4JDRA 4USRA 3NN6X 4C3YA 1GEUA 4U2LA 4G73A 4WX1A 4XXGA 5C3JA 4LA1A 1JOAA 2B9YA 3K30A 2ONEA 4CY8A 3CYJA 5KMQA 4UP3A 2PTZA 2VZ2A 4BK2A 3NYFA 1N5XA 2YLZA 3U4FA 1NEKA 4H7UA 3VA8A 4RG3A 2XVJA 2XFPA 2EQ6A 3ENLA 4NWZA 3R9UA 1FEAA 2GAGB 1PJ6A 4YTNA 3NXLA 1OJAA 3UKFA 4J57A 3P4QA 4B69A 1S3EA 4H2NA 4Z2TA 2FJAA 3P4PA 3KPFA 3RP6A 3NH3X 3CB3A 4GGBA 1NHQA 4A7AA 1ZK7A 2XYOA 3N4FA 4G6GA 2PGWA 2DW7A 3AE3A 1YQZA 4GGHA 3CGBA 1KSSA 3NNEA 3OW1A 5FS6A 3EAOA 1ZOYA 2X8CA 4G6HA 4G74A 3VDGA 1EC8A 1CC2A 4UDRA 2PTYA 3SXIA 5FJOA 3R0KA 3SJNA 3HYVA 1OJCA 4EQRA 2C76A 2E5AA 2P3ZA 3R25A 1L9EA 4O5UA 3Q45A 3AEAA 5M0ZA 1COYA 4BV6A 1WUFA 2PGEA 3CTYA 5J04A 2W3RA 2YLWA 1GETA 2W55A 1CC6A 2YG7A 2GGEA 2B76A 2V60A 3AEEA 1N61C 2A8XA 2A89A 3DGZA 3IC9A 2OA1A 1KNPA 3L1RA 3AECA 1E39A 3RITA 4DXKA 3NVYB 2XLUA 1K4QA 3T2ZA 3SZ0A 3V3NA 4HCHA 3IJIA 3STPA 4TVYA 2GRTA 1Y56A 2B9XA 3VRBA 3IJLA 2TMDA 2R4EA 5EBKA 2C7GA 2GV8A 5L46A 3T37A 4H2RA 4B68A 4H50A 4J36A 4F4RA 1JNRA 4BK3A 4YKFA 4EIPA 4JN9A 3KLJA 4YTMA 2X3NA 3HPFA 2WPFA 3NGCX 2OALA 4Z24A 3NZGA 4HYRA 7ENLA 1GRGA 1ZY8A 2R46A 3QVRA 6ENLA 5G5GB 4EMWA 1JRXA 4APNA 5FJPA 5U1OA 1JRZA 1STZA 4CBQA 4HNLA 2GAHB 5FS8A 4DN1A 4ECHA 3CPHG 1E1NA 3TWBA 3CIRA 1TDFA 4E5TA 4DHGA 1PJ7A 3P9UA 3UKAA 1SJBA 1NG3A 2PU0A 2BS2A 2TPRA 4K22A 2XGZA 3GD6A 2CDUA 2RGJA 3R0UA 1N4VA 1KKOA 1P43A 2VVLG 3RRAA 4G7FA 4MMWA 1XPQA 2NVKX 2WS3A 4GFIA 4HN8A 2CVJA 3GYXA 1XS2A 5FJUA 4U8PA 2PS2A 1EL9A 3T2KA 4J34A 3SR6B 1Q1RA 3UKHA 5FMHA 3B3RA 4H4TA 4MKSA 2PU1A 1O95A 3BI4A 3IHGA 2X8GA 4E4UA 4U2SA 5IPYA 2BS4A 3AE5A 3VRAA 5KNLA 3N6HA 4JQ9A 4UDQA 5FJRA 3QSMA 2R9ZA 1GTEA 3QSSA 4M6UA 4GR1A 3V3WA 1TDEA 2AR8A 5G5HB 1LJ1A 4PAAA 3A7UA 4EIQA 4II2A 2BACA 2QJMA 1EL5A 1O94A 4CRTA 2XH4A 4ICYA 1FHUA 1XPYA 3T0KA 1N5WC 2WETA 1GTHA 2BK5A 4CNJA 3T6CA 2BYBA 2XFQA 3II4A 2OO6A 3H4KA 3UKLA 1FCDA 3CNPA 1D4DA 3CAWA 3AN1A 1S3BA 2JB1A 5IQ1A 2MNRA 4U8KA 3B6DA 3DK8A 2PODA 3MZNA 2WP9A 5HHFA 2RGHA 3KD9A 4IHCA 3CGDA 1FFVC 1NPXA 1GESA 4USQA 1B5QA 3AEBA 5FS9A 3BI5A 4GCMA 2OFJA 1N4UA 1EC9A 3HYWA 4A99A 2WQYA 3GDPA 3DEQA 2JKCA 2W3SA 4B63A 1MNSA 3ZVHA 3V76A 3VR9A 3F8RA 3GYJA 4TLXA 3BNUA 4AP1A 2IIDA 4KX6A 2W54A 3BNMA 4A6NB 3NG7X 3IK4A 4ZCWA 4FK1A 3RP7A 3AE4A 3ZLHA 3KUMA 4GAPA 3GY1A 1L8PA 2X8HA 4X9MA 2HNEA 3DA1A 3NK2X 2CULA 3D46A 4KPRA 1CC4A 2XVEA 4HNCA 1KNRA 3UCDA 3DK9A 1CJCA 1EBHA 3SY4A 2QA2A 1TZZA 3AEFA 3R10A 3FIMB 2C4CA 2BC0A 4C74A 3RP8A 3NHOX 4GF7A 3LXDA 4GIRA 3N4EA 4II3A 1NHRA 1B8SA 3DDMA 2Y6QA 4OPCA 4FK1C 3T9PA 5EB5A 4GRTA 3ATQA 3AYLA 2I0ZA 3DJGX 4IL0A 2DKHA 5KOXA 3I4KA 3V5FA 4K7ZA 1K0JA 1GREA 1IYXA 1EBDA 4NEWA 4OPIA 2BCPA 3P93A 3P4RA 4UDPA 3DJJA 2GMHA 2V6OA 2YVJA 1ELIA 3M13A 3GMBA 2Y6RA 3DK4A 3C4NA 1BKWA 3V5CA 1SEZA 1X2HA 4OVIA 5M10A 3EANA 2WBAA 2XH2A 3AE7A 4EWJA 4Z25A 3CT2A 3DGHA 3N6JA 4D04A 5U63A 4H4WA 3SYIA 5KMSA 1CJ3A 5KVHA 3NK0X 4Z43A 3H7VA 3I6DA 2VOUA 4H4RA 3QFAA 3PS9A 1GOSA 5IQ4A 2YWLA 4YWSA 1EBGA 3SZCA 2XDOA 3RNMA 3MUCA 3IHMA 2XFUA 3H70A 1GALA 3CGCA 4EM4A 1D5TA 3Q6JA 3AXBA 2BK3A 1F3PA 2OZ3A 4I59A 1BGJA 2B7RA 4OPGA 1F8WA 4K2SA 3NYCA 1LTXR 4ROPA 2GQFA 3K1GA 3NS1B 2W0HA 4IA5A 3UJFA 3UXKA 1PDYA 4YSHA 1IUWA 3LADA 1ELSA 2WP5A 1E6EA 4P9SA 3AD7B 3OZMA 2FJBA 1F9CA 1S2QA 4DWDA 4B66A 1JDFA 3P3BA 3FBSA 3Q4DA 4B67A 3CMMA 3ICTA 2ACZA 1FEBA 4A79A 1GRBA 1B37A 1H2IA 2YM2A 1GSNA 4HA6A 3HYXA 1MUCA 2YM1A 1ZOVA 3I6EA 1L9DA 4BURA 5BOEA 5FS7A 3ZLGA 4OPLA 2VVLA 4Z26A 3EKGA 1K0IA 1OEPA 4E8GA 4H2HA 3UJ2A 1MDRA 4IVOB 4IP4A 4XWRA 5LV9A 2JB2A 2P8BA 2RGOA 1VDVA 4X9NA 1Y0PA 2OZTA 4Z17A 3ICSA 4YSZA 2C70A 3AMZA 2Z5YA 4JHMA 1H6VA 2EQ9A 2VRLA 5HXIA 3UP5A 2XLSA 1DODA 4GUVA 5BRTA 4IA6A 3QSEA 4YT0A 1F8RA 3GD4A 3SFEA 1E9IA 2AL1A 5KMPA 4AOXA 3FJ4A 1PXCA 4CCQA 1JU2A 1IUSA 2QQ6A 4TLZA 4AT2A 1FHVA 3NT6A 1N62C 5ER0A 1KFYA 3P1WA 3O0HA 1HYUA 4EQWA 2BXRA 2ZADA 2OAMA 4Y4LA 3DG7A 1PXAA 2OPJA 3UOZA 2AL2A 1CJ4A 1FIQB 2GGGA 3M0OA 3VC5A 3HRDC 2BA9A 3T2YA 4U8JA 4N9XA 2GSHA 2IVEA 3QVPA 2QA1A 5IDZA 3L8KA 4KT2A 1T3QC 3FMWA 1WYGA 1NDAA 5KXJA 1IUXA 1GERA 4IP5A 3P0WA 3PK7A 2BABA 2ZC8A 4EQXA 4ZN0A 5KMRA 1FL2A 1GXFA 1SJCA 2DKIA 3C96A 4BJZA 1XHCA 1B4VA 3NVWB 2QDDA 2E4GA 3OZ2A 2CHRA 2YLTA 2ARDA 2Q6UA 3H8IA 4KWSA 3ISHA 1JRYA 1CF3A 4C77A 3BI2A 3MY9A 4A3RA 4DSGA 3UP4A 3PVCA 2ZZCA 4JN7A 1FO4A 1DTNA 4FDCB 1AOGA 2C3DA 1CBOA 1L9CA 4FP1A 4DYEA 1GRAA 2NQLA 3G5RA 4U2TA 3ZLFA 2QCUA 1JCTA 1YKJA 1W6TA 5BOFA 3CPIG 4ENLA 1NELA 4J1OA 3IWAA 2EQ7A 2P8CA 3Q9TA 5JCKA 1BWCA 5GRTA 5JCIA 3UTHA 4U8LA 3SN0A 1W4XA 1EC7A 3FV9A 2WP6A 3UKQA 3LJPA 3SQPA 2C75A 1F8SA 1PHHA 4H4XA 2WESA 3G5SA 4FI4A 4AT0A 3L5OA 1EL7A 3TTEA 2OVLA 1ONEA 3BHFA 4J31A 3PFRA 2RDXA 1REOA 2R45A 2WU5A 1RVKA 1CL0A 3V4BA 4EMJA 1JRPA 3CXOA 2V3AA 1NHSA 1VG9A 1FOHA 1MDLA 2GH5A 1ZMCA 4OPDA 1TE6A 1NENA 2WOIA 3JVAA 1RM6B 4M0XA 5EOWA 2X99A 2Q7VA 1S7MA 1PXBA 4LU6A 3FCPA 3I6TA 5KOWA 5JCLA 3VRDB 3FYYA 3UKPA 2R0GA 2V3BA 3LB8A 5KVIA 1Y56B 1H83A 3D1CA 2WEUA 1DNCA 4X4JA 2H88A 4DNAA 4IZGA 1KN0A 1ZX9A 4NTDA 4GYPC 2YAUA 3AWIA 2O56A 4A5LA 1O5WA 3NK1X 3UJEA 1E1MA 4H1ZA 2OG9A 1H81A 3AM9A 4H4QA 5J7XA 4TM3A 1MOKA 4Z1YA 4Z2RA 3TJIA 3S5SA 1BQGA 1E1KA 2X50A 2OLAA 1IJHA 1D4EA 2YLXA 1TDNA 4EMIA 1S2YA 3D47A 1DJQA 4A9WA 4HB9A 5U25A 3M12A 2RABA 3TJ4A 1UKVG 3CNDA 3PO7A 1VQZA 3NIXA 2C72A 3OPSA 4GISA 2IVDA 4A6NA 3QPEA 4D03A 2Q0LA 1R0MA 5GSNA 2QAEA 3QJ4A 2WDRA 4HPNA 3WE0A 1OJTA 2AAQA 4TVWA 4GYPA 3SBFA 2YLSA 3GD3A 2B7SA 5FJTA 3AE6A 4MGGA 4OCGA 3SN1A 4REKA 4H4YA 1FFUC 1GNDA 4IT1A 3ZDNA 2R0PA 2GDQA 5CQFA 5CKUA 2BRAA 1R6WA 3EF6A 1KDGA 1PBEA 3HZLA 2XLPA 2QDEA 2GL5A 2UZZA 1VDCA 3OP2A 3K7TA 3VC6A 3ZVIA 1GRTA 4YXDA 4Z2UA 3GRTA 4CCRA 2VRMA 1PBDA 4C5OA 4AOSA 3NKSA 2XFOA 1JPDX 2BRYA 3UOXA 2Q0KA 3TQPA 1WUEA 2XH7A 2C73A 4A35A 2FJDA 2BCGG 4YSYA 3KU9A 3GWFA 3NLCA 3OZYA 3ALLA 1XDIA 2FKPA 4H4PA 3ALMA 1ONFA 2R4JA 2ZZ0A 3GYIA 3AE8A 2FJEA 4NTEA 4I58A 3NTDA 2CFYA 3RGTA 2PPGA 3F8PA 2O9ZA 3NO1A 2VQ7A 4Z44A 4KEMA 2YR5A 3AYIA 1ZMDA 4U8NA 1YEYA 3NTAA 2OLNA 1N63C 1H7XA 1N1PA 4H2QA 2E5VA 4H83A 2HZGA 2GEWA 3ZVHB 3QN3A 1ZXIC 2XLTA 3ADAB 2AKMA 3JZUA 2YR4A 1M64A 1ZP0A 4RSLA 4Y4NA 2BS3A 4EQSA 3H12A 2VQBA 2XH0A 2GGIA 2VVMA 1TRBA 5HY5A 3SZWA 1PDHA 3QFBA 4A65A 3S5WA 3PG6A 2YG4A 3T4WA 1D4CA 5EU9A 4CY6A 4TM0A 1V97A 1L0VA 2E1MA 4BK1A 1VQWA 1GT8A 3BSMA 2HXUA 3AD8B 2GF3A 1SB3B 3EUB3 3DG6A 2C66A 3VCNA 4E0VA 2XCGA 2BXSA 1P48A 4MJWA 1VG0A 2PA6A 4OPUA 2YG5A 4X2PA 3SGLA 3B9JB 2OZ8A 4K5SA 3KA7A 3UGVA 3SX6A 3IF9A 1NHPA 2PP1A 3G5QA 5JRBA 3TCSA 2FBWA 1X31B 4H2PA 1KD0A 2APGA 1TYPA 1LQTA 1JEHA 3DESA 3GWDA 5DBJA 1EL8A 4E4FA 2XVFA 4WCTA 4ZOHB 1KSUA 3UOYA 3MKCA 2JAEA 1H82A 2PCEA 1E7PA 3DFHA 1TKKA 4YTPA 3AE9A 2GGHA 3AYJA 3VFCA 1K0LA 3SM8A 2AQJA 4G9KA 4CNKA 3FXGA 1LV0A 1H86A 3KVEA 1F6MA 4B1BA 2WDVA 2WOWA 1IUVA 2ZBWA 3NRZB 1RYIA 2OX4A 4FX9A 4GDEA 2YLRA 3GO2A 3D9XA 4HCDA 1DOBA 1IUTA 2OQHA 3R07C 5BVAA 2YVFA 2QJJA 4JN8A 4U8IA 3SFDA 3ALJA 2MUCA 1RP0A 3FG2P 3DG3A 2NPXA 4K1WA 2EQ8A 1GPEA 2XVHA 3SSZA 1DJNA 3EEZA 3QLDA 3V3OA 4E6MA 2XSXA 1MXTA 3LZXA 2GVCA 3RR1A 3SZFA 4IVMB 2A87A 3AE1A 1Z6LA 4EM3A 3CK5A 3JSKA 4O5QA 3DFYA 1PBCA 5TR3A 3UKKA 2YG6A 5J60A 1TYTA 4G8TA 1MO9A 3UJSA 4HCLA 3PWGA 3T8QA 4U8OA 2GR2A 2PP3A 3LOVA 3BOXA 5C2TA 2POZA 4J56A 1XANA 1ECQA 3SN4A 1BGNA 3BHKA 5BUKA 2YG3A 1MRAA 4TM4A 2QVHA 3RCYA 3DGBA 3S61A 4DX3A 4H19A 1DOCA 3H8LA 3AEDA 1KKRA 2OLOA 4ZA0A 2R0CA 2C67A 4K2XA 2C65A 1PS9A 3OC4A 1D7YA 1GRFA 2C3CA 3ES8A 1M6IA 3DIPA 3FVDA 1P2EA 3MWCA 1P2HA 4A6GA 3A7AA 2YR6A 1JPMA 4B64A 2QJNA 2QGYA 2V61A 2GMJA 3D8XA 3KPKA 4J2WA 4JY2A 1SJDA 4ADWA 1IUUA 4H4ZA 4DGKA 4C3XA 3IJQA 2I5QA 3C4AA 3JW7A 3TW9A 3F8DA 2HXTA 3AEGA 1Q1WA 1Q9IA 2GR1A 3K7MX 2V5ZA 3QKEA 2OKTA 3E1TA 2HQMA 3DJEA 2OQYA 5HYMA 3TOYA 1PDZA 1H84A 4RG4A 2PYXA 3K7QX 1TDOA 2JB3A 2P0IA 3ETRB 3AD9B 1CHUA 2AKZA 3FPZA 1YQ4A 3ITJA 4JNQA 3HW2A 4NNJA 2GR0A 3A7RA 1VRQB 3ICRA 3RHAA 2J3NA 1GRHA 4H4VA 1BF3A 1LPFA 3CNSA 5KRQA 1PJ5A 4YKGA 2XLRA 4J3ZA 1YY5A 4GAVA 2GR3A 2F5ZA 3UCLA 3CXBA 4OPTA 3GSIA 4JY3A 2P88A 2WHDA 3NN0X 3AB1A 3I3LA 3S47A 4GDPA 1FECA 1JNZA 3T14A 2H89A 1SJAA 4ZCCA 4PABA 2JBVA 2XFNA 4BJYA 4IL2A 2JK6A 2GQWA 4U8MA 3ABVA 3QTPA 2C64A 3MQTA 3GRSA 3P4SA 1N4WA 3KKJA 3CN8A 4IV9A 5KWFA 2WPCA 5JCMA 4K8GA 2ZZBA 2B9WA 3VR8A 4H4SA 4XWZA 3NVZB 3UOVA 3PWIA 1D7LA 3TWAA 3VCCA 3R11A 3NRNA 3THUA 2WPEA 1DXLA 3UTEA 3T31A 3LZWA 1BZLA 2FYMA 3SQSA 3OTRA 3CGEA 1OJDA 1JROA 1QLBA 1GV4A 3GC2A 5JCNA 1ZKQA 4YWOA 3DMEA 3UCCA 2E3TA 3NYEA 3CPJG 2PSNA 1BKHA 4YSXA 2Z5XA 1PBBA 1KF6A 5BULA 4AP3A 3COXA 5EB4A 2PHHA 2PTXA 3CNJA 4JNAA 1X2GA 4KPLA 3URHA 1QO8A 3ES7A 1V59A 2YQUA 2WU2A 2XVIA 3B97A 1NU5A 2PP0A 1CJ2A 1RSGA 3ZYXA 5ENLA 2BC1A 4Y4MA
chains in the Genus database with same CATH topology
3SGLA 1B4VA 1B5QA 3UTGA 3UTFA 3AEBA 5FS9A 4K5SA 3KA7A 2E4GA 3BI5A 3OZ2A 4K8DA 4GCMA 2YLTA 2ARDA 3SX6A 1PN0A 3IF9A 1NHPA 3DH9A 1N4UA 3REDA 2Q6UA 1QJDA 3G5QA 3H8IA 3GDNA 5JRBA 3HYWA 4K5RA 1NG4A 2WOVA 2FBWA 3ISHA 4A99A 1X31B 1JRYA 1CF3A 4C77A 2WQYA 3BI2A 4DSHA 4H2PA 3GDPA 2JKCA 4DSGA 2APGA 4J33A 1TYPA 1LQTA 3UP4A 4B63A 1LQUA 3CNTA 3PVCA 2ZZCA 3V76A 3VR9A 1JEHA 3F8RA 3AE2A 3ATRA 4FDCB 1AOGA 3GYJA 1DOEA 3GWDA 5DBJA 2C3DA 1CBOA 1EL8A 1L9CA 3VQRA 4TLXA 2XVFA 1GRAA 3BNUA 4M52A 4AP1A 2IIDA 4KX6A 4WCTA 1ZDLA 3BNMA 3G5RA 3DJDA 4U2TA 2WDQA 1KSUA 4A6NB 3UOYA 1OJ9A 3NG7X 4H4UA 2JAEA 2QCUA 4FK1A 1H82A 1YKJA 4B65A 3RP7A 1E7PA 3EPTA 3CPIG 2BK4A 4YTPA 3AE9A 4NEVA 3AE4A 3AYJA 1PBFA 4GAPA 4NZHA 3IWAA 2EQ7A 1K0LA 3SM8A 2AQJA 2GB0A 3Q9TA 4LIIA 4G9KA 5JCKA 1NAAA 2X8HA 1BWCA 4X9MA 5GRTA 4CNKA 1E1LA 4ZCDA 1LV0A 3DA1A 1H86A 3GMCA 4TM1A 5JCIA 3KVEA 3NK2X 3UTHA 2CULA 1LVLA 1F6MA 1YQ3A 4U8LA 4B1BA 2YVGA 2WDVA 2WOWA 4K2XA 4KPRA 1IUVA 1W4XA 4NTCA 2ZBWA 1H7WA 1CC4A 1RYIA 1TDKA 2WP6A 3UKQA 4FX9A 4JDRA 3NN6X 3LJPA 4USRA 4GDEA 3SQPA 2C75A 1F8SA 4C3YA 1PHHA 1GEUA 4H4XA 2XVEA 2YLRA 3D9XA 4U2LA 4G73A 4WX1A 4XXGA 2WESA 5C3JA 4LA1A 1DOBA 1IUTA 1KNRA 3G5SA 1JOAA 2B9YA 3K30A 1CJCA 3DK9A 3SY4A 4AT0A 4CY8A 3L5OA 2QA2A 5KMQA 1EL7A 5BVAA 2YVFA 4UP3A 3BHFA 4J31A 4U8IA 1REOA 2VZ2A 3SFDA 2R45A 3NYFA 4BK2A 3ALJA 2WU5A 3AEFA 1CL0A 2YLZA 1NEKA 4H7UA 1RP0A 3FG2P 4RG3A 4EMJA 2XVJA 2NPXA 2V3AA 2XFPA 3FIMB 2EQ8A 1NHSA 2EQ6A 1VG9A 1GPEA 1FOHA 2XVHA 2C4CA 4NWZA 1DJNA 3R9UA 1FEAA 3V3OA 2GH5A 2GAGB 1PJ6A 1ZMCA 4OPDA 2BC0A 1MXTA 4YTNA 4C74A 3RP8A 1OJAA 1NENA 2WOIA 4J57A 3UKFA 3LZXA 3NHOX 4GF7A 3P4QA 3LXDA 2GVCA 4B69A 1S3EA 4H2NA 4II3A 4Z2TA 2FJAA 3P4PA 3KPFA 3RP6A 1NHRA 3NH3X 3SZFA 5EOWA 1B8SA 2X99A 2A87A 2Y6QA 3AE1A 4IVMB 1NHQA 1Z6LA 2Q7VA 4FK1C 4OPCA 1S7MA 1ZK7A 4A7AA 4EM3A 2XYOA 5EB5A 4GRTA 1PXBA 3JSKA 4LU6A 4O5QA 4G6GA 5KOWA 1PBCA 3ATQA 5TR3A 3AYLA 2I0ZA 5JCLA 3DJGX 3AE3A 3VRDB 3UKKA 1YQZA 3UKPA 2R0GA 2YG6A 2V3BA 3CGBA 3LB8A 5KVIA 2DKHA 1KSSA 1Y56B 5KOXA 3NNEA 1H83A 3D1CA 1K0JA 4K7ZA 2WEUA 1DNCA 5FS6A 1GREA 4X4JA 2H88A 1TYTA 3EAOA 5J60A 1EBDA 4DNAA 1ZOYA 2X8CA 4G6HA 4NEWA 4G74A 4OPIA 1MO9A 1KN0A 1ZX9A 4NTDA 2BCPA 3P4RA 1CC2A 4UDPA 3DJJA 4UDRA 3SXIA 2GMHA 2YAUA 4U8OA 2GR2A 2V6OA 3AWIA 3HYVA 1OJCA 3LOVA 2YVJA 1ELIA 4A5LA 3M13A 3GMBA 1O5WA 5C2TA 3NK1X 4EQRA 2C76A 2Y6RA 1E1MA 3DK4A 4J56A 1L9EA 3C4NA 4O5UA 1BKWA 1H81A 1XANA 1SEZA 3AEAA 4H4QA 4OVIA 5M0ZA 5M10A 1BGNA 5J7XA 3EANA 3BHKA 1COYA 2WBAA 4BV6A 4TM3A 1MOKA 5BUKA 3AE7A 2YG3A 4Z2RA 4Z25A 3CTYA 4TM4A 2YLWA 1GETA 1E1KA 2X50A 1CC6A 1IJHA 1D4EA 2YLXA 3DGHA 3S61A 4D04A 5U63A 4H4WA 3SYIA 5KMSA 1DOCA 2YG7A 1CJ3A 1TDNA 3H8LA 4EMIA 1S2YA 3AEDA 2B76A 5KVHA 2V60A 1DJQA 3AEEA 4A9WA 3NK0X 2OLOA 4Z43A 4HB9A 5U25A 3I6DA 2R0CA 2VOUA 2A8XA 2C67A 4H4RA 3M12A 2A89A 3DGZA 3IC9A 3QFAA 1PS9A 2C65A 1KNPA 2OA1A 3PS9A 2RABA 3OC4A 1GOSA 1D7YA 1UKVG 1GRFA 2C3CA 3L1RA 5IQ4A 3CNDA 3AECA 3PO7A 2YWLA 1M6IA 1E39A 1P2EA 3NIXA 1P2HA 2C72A 3SZCA 2XDOA 2XLUA 1K4QA 3T2ZA 2YR6A 3SZ0A 2IVDA 3RNMA 4B64A 3V3NA 3IHMA 4A6NA 2XFUA 4D03A 2V61A 2GMJA 1GALA 3CGCA 2GRTA 3D8XA 3KPKA 1Y56A 2B9XA 4J2WA 3VRBA 4EM4A 1D5TA 2Q0LA 3Q6JA 4JY2A 2TMDA 4ADWA 2R4EA 3AXBA 1IUUA 2BK3A 5EBKA 1F3PA 5GSNA 2QAEA 2C7GA 2GV8A 5L46A 3T37A 4H2RA 4I59A 4B68A 4H4ZA 3QJ4A 4H50A 1BGJA 2B7RA 4OPGA 1F8WA 2WDRA 4DGKA 4C3XA 3NYCA 4J36A 1LTXR 2GQFA 1JNRA 3WE0A 1OJTA 4BK3A 2AAQA 4YKFA 2YLSA 4EIPA 4JN9A 3KLJA 2W0HA 3GD3A 2B7SA 4IA5A 4YTMA 2X3NA 3AE6A 3C4AA 2WPFA 3F8DA 3NGCX 3AEGA 1Q1WA 4OCGA 2OALA 1Q9IA 4Z24A 4YSHA 2GR1A 3K7MX 2V5ZA 4REKA 1IUWA 4H4YA 3LADA 3E1TA 2HQMA 3DJEA 1GRGA 5HYMA 1H84A 1ZY8A 2WP5A 4RG4A 1GNDA 2R46A 2PYXA 3K7QX 1E6EA 3ZDNA 1TDOA 3AD7B 4P9SA 3QVRA 2R0PA 2FJBA 4EMWA 2JB3A 1JRXA 1S2QA 5CQFA 3AD9B 5CKUA 2BRAA 4APNA 3EF6A 1KDGA 5U1OA 1CHUA 1JRZA 1PBEA 3FPZA 4B66A 3HZLA 4CBQA 2XLPA 1YQ4A 3FBSA 4B67A 3CMMA 3ITJA 4JNQA 4NNJA 2UZZA 2GR0A 3ICTA 2GAHB 2ACZA 1FEBA 1VRQB 3ICRA 4A79A 1GRBA 1VDCA 3RHAA 1B37A 1H2IA 5FS8A 2J3NA 2YM2A 3K7TA 1GRHA 4ECHA 1GSNA 1GRTA 4HA6A 4H4VA 1BF3A 3HYXA 1LPFA 3CNSA 2YM1A 3CPHG 1ZOVA 1PJ5A 4YKGA 4YXDA 3GRTA 4Z2UA 5KRQA 1E1NA 2XLRA 4CCRA 3CIRA 1TDFA 1L9DA 4BURA 1YY5A 2GR3A 4GAVA 1PJ7A 2F5ZA 2VRMA 3UCLA 1PBDA 3P9UA 4OPTA 3GSIA 5FS7A 4C5OA 4JY3A 3UKAA 1NG3A 4OPLA 2VVLA 2WHDA 4Z26A 3NN0X 4AOSA 2BS2A 3AB1A 2TPRA 3I3LA 1K0IA 1FECA 4GDPA 1JNZA 3T14A 3NKSA 2H89A 4K22A 2XFOA 4ZCCA 2CDUA 2BRYA 3UOXA 4PABA 2JBVA 2RGJA 2XFNA 2Q0KA 4BJYA 1N4VA 4IVOB 2JK6A 2VVLG 4XWRA 2GQWA 2C73A 4U8MA 5LV9A 3ABVA 2FJDA 2JB2A 1XPQA 2NVKX 2BCGG 5BRTA 4YSYA 2C64A 2WS3A 3KU9A 3GWFA 2RGOA 3GRSA 3P4SA 4X9NA 3NLCA 2CVJA 3GYXA 1Y0PA 3ALLA 3ICSA 1N4WA 1XDIA 1EL9A 4U8PA 4YSZA 3T2KA 2C70A 4J34A 3KKJA 4H4PA 3ALMA 2Z5YA 3CN8A 4IV9A 1H6VA 5KWFA 1ONFA 2EQ9A 2WPCA 1Q1RA 5JCMA 2ZZ0A 2R4JA 2VRLA 2ZZBA 3AE8A 3GYIA 3UP5A 5HXIA 2B9WA 2FJEA 2XLSA 1DODA 4NTEA 4GUVA 4I58A 4IA6A 3NTDA 3QSEA 4YT0A 3UKHA 3VR8A 5FMHA 3B3RA 4H4TA 4H4SA 2CFYA 1F8RA 3GD4A 1O95A 3BI4A 4XWZA 3IHGA 3F8PA 2O9ZA 2X8GA 2VQ7A 4U2SA 3SFEA 4Z44A 5IPYA 2YR5A 2BS4A 3AYIA 3UOVA 1ZMDA 1D7LA 3AE5A 5KMPA 4U8NA 4AOXA 1PXCA 4CCQA 3VRAA 5KNLA 3NRNA 2WPEA 3NTAA 1JU2A 2OLNA 1IUSA 1DXLA 4JQ9A 4TLZA 4UDQA 4AT2A 3NT6A 1H7XA 3UTEA 1N1PA 4H2QA 3T31A 2E5VA 1KFYA 5ER0A 2R9ZA 1BZLA 3LZWA 3QSMA 1GTEA 3QSSA 2GEWA 3P1WA 3O0HA 4GR1A 1TDEA 2AR8A 1LJ1A 1HYUA 4EQWA 3CGEA 2BXRA 1OJDA 2XLTA 4PAAA 1QLBA 4EIQA 3ADAB 4II2A 1GV4A 2OAMA 2YR4A 1M64A 1ZP0A 4Y4LA 5JCNA 2BACA 4RSLA 1PXAA 4Y4NA 3UOZA 2BS3A 1CJ4A 1ZKQA 1EL5A 1O94A 4YWOA 3M0OA 4CRTA 4EQSA 2VQBA 3DMEA 4ICYA 2BA9A 3CPJG 3NYEA 3T2YA 2VVMA 4U8JA 3T0KA 2WETA 1GTHA 1TRBA 2BK5A 3SZWA 4N9XA 5HY5A 1PDHA 4CNJA 2IVEA 2BYBA 3QFBA 2XFQA 3QVPA 2QA1A 3S5WA 3II4A 4A65A 3PG6A 2YG4A 3H4KA 3L8KA 3UKLA 4YSXA 1FCDA 2Z5XA 1D4CA 3CNPA 4CY6A 4TM0A 1PBBA 1KF6A 3FMWA 1D4DA 5BULA 1L0VA 2E1MA 4BK1A 4AP3A 1VQWA 3COXA 1GT8A 5EB4A 2PHHA 1NDAA 3CNJA 4JNAA 5KXJA 3AD8B 1IUXA 2GF3A 1GERA 3URHA 1QO8A 1S3BA 2JB1A 2BABA 5IQ1A 4U8KA 3B6DA 3DK8A 1V59A 2YQUA 4EQXA 2C66A 2WU2A 2XVIA 4E0VA 2XCGA 4ZN0A 5KMRA 2BXSA 1FL2A 4MJWA 1GXFA 1CJ2A 2DKIA 2WP9A 2RGHA 3C96A 1VG0A 5HHFA 3KD9A 4BJZA 4OPUA 3CGDA 1RSGA 2YG5A 3ZYXA 1NPXA 1GESA 1XHCA 2BC1A 4Y4MA 4USQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SGL A;  1B4V A;  1B5Q A;  3UTG A;  3UTF A;  3AEB A;  5FS9 A;  4K5S A;  3KA7 A;  2E4G A;  3BI5 A;  3OZ2 A;  4K8D A;  4GCM A;  2YLT A;  2ARD A;  1PN0 A;  3IF9 A;  1NHP A;  3DH9 A;  1N4U A;  3RED A;  2Q6U A;  1QJD A;  3G5Q A;  3H8I A;  3GDN A;  4K5R A;  1NG4 A;  2WOV A;  2FBW A;  3ISH A;  4A99 A;  1X31 B;  1JRY A;  1CF3 A;  4C77 A;  2WQY A;  3BI2 A;  4DSH A;  4H2P A;  3GDP A;  2JKC A;  4DSG A;  2APG A;  4J33 A;  1TYP A;  1LQT A;  3UP4 A;  4B63 A;  1LQU A;  3CNT A;  3PVC A;  2ZZC A;  3V76 A;  3VR9 A;  1JEH A;  3F8R A;  3AE2 A;  3ATR A;  4FDC B;  1AOG A;  3GYJ A;  1DOE A;  3GWD A;  5DBJ A;  2C3D A;  1CBO A;  1EL8 A;  1L9C A;  3VQR A;  4TLX A;  2XVF A;  1GRA A;  3BNU A;  4M52 A;  4AP1 A;  2IID A;  4KX6 A;  4WCT A;  1ZDL A;  3BNM A;  3G5R A;  3DJD A;  4U2T A;  2WDQ A;  1KSU A;  4A6N B;  3UOY A;  1OJ9 A;  3NG7 X;  4H4U A;  2JAE A;  2QCU A;  4FK1 A;  1H82 A;  1YKJ A;  4B65 A;  3RP7 A;  1E7P A;  3EPT A;  3CPI G;  2BK4 A;  4YTP A;  3AE9 A;  4NEV A;  3AE4 A;  3AYJ A;  1PBF A;  4NZH A;  3IWA A;  2EQ7 A;  1K0L A;  3SM8 A;  2AQJ A;  2GB0 A;  3Q9T A;  4LII A;  5JCK A;  1NAA A;  2X8H A;  1BWC A;  4X9M A;  5GRT A;  4CNK A;  1E1L A;  4ZCD A;  1LV0 A;  3DA1 A;  1H86 A;  3GMC A;  4TM1 A;  5JCI A;  3KVE A;  3NK2 X;  3UTH A;  2CUL A;  1LVL A;  1F6M A;  1YQ3 A;  4U8L A;  4B1B A;  2YVG A;  2WDV A;  2WOW A;  4K2X A;  4KPR A;  1IUV A;  1W4X A;  4NTC A;  2ZBW A;  1H7W A;  1CC4 A;  1RYI A;  1TDK A;  2WP6 A;  3UKQ A;  4FX9 A;  4JDR A;  3NN6 X;  3LJP A;  4USR A;  4GDE A;  3SQP A;  2C75 A;  1F8S A;  4C3Y A;  1PHH A;  1GEU A;  4H4X A;  2XVE A;  2YLR A;  4U2L A;  4WX1 A;  4XXG A;  5C3J A;  2WES A;  4LA1 A;  1DOB A;  1IUT A;  1KNR A;  3G5S A;  1JOA A;  2B9Y A;  3K30 A;  1CJC A;  3DK9 A;  4AT0 A;  4CY8 A;  2QA2 A;  1EL7 A;  5BVA A;  2YVF A;  4UP3 A;  3BHF A;  4J31 A;  4U8I A;  1REO A;  2VZ2 A;  3SFD A;  2R45 A;  3NYF A;  4BK2 A;  3ALJ A;  2WU5 A;  3AEF A;  1CL0 A;  2YLZ A;  1NEK A;  4H7U A;  1RP0 A;  3FG2 P;  4RG3 A;  4EMJ A;  2XVJ A;  2NPX A;  2V3A A;  2XFP A;  3FIM B;  2EQ8 A;  1NHS A;  2EQ6 A;  1VG9 A;  1GPE A;  1FOH A;  2XVH A;  1DJN A;  3R9U A;  1FEA A;  3V3O A;  2GH5 A;  2GAG B;  1PJ6 A;  1ZMC A;  4OPD A;  2BC0 A;  1MXT A;  4YTN A;  4C74 A;  3RP8 A;  1OJA A;  1NEN A;  2WOI A;  4J57 A;  3UKF A;  3LZX A;  3NHO X;  4GF7 A;  3P4Q A;  3LXD A;  2GVC A;  4B69 A;  1S3E A;  4H2N A;  4Z2T A;  2FJA A;  3P4P A;  3KPF A;  3RP6 A;  1NHR A;  3NH3 X;  5EOW A;  1B8S A;  2X99 A;  2A87 A;  2Y6Q A;  3AE1 A;  4IVM B;  1NHQ A;  1Z6L A;  2Q7V A;  4FK1 C;  4OPC A;  4A7A A;  1ZK7 A;  4EM3 A;  2XYO A;  5EB5 A;  4GRT A;  1PXB A;  3JSK A;  4LU6 A;  4O5Q A;  5KOW A;  1PBC A;  3ATQ A;  5TR3 A;  3AYL A;  2I0Z A;  5JCL A;  3DJG X;  3AE3 A;  3VRD B;  3UKK A;  1YQZ A;  3UKP A;  2R0G A;  2YG6 A;  3LB8 A;  3CGB A;  5KVI A;  2DKH A;  2V3B A;  1KSS A;  1Y56 B;  5KOX A;  3NNE A;  1H83 A;  3D1C A;  1K0J A;  4K7Z A;  2WEU A;  1DNC A;  5FS6 A;  1GRE A;  4X4J A;  2H88 A;  1TYT A;  3EAO A;  5J60 A;  1EBD A;  4DNA A;  1ZOY A;  2X8C A;  4NEW A;  4OPI A;  1MO9 A;  1ZX9 A;  4NTD A;  2BCP A;  3P4R A;  1CC2 A;  4UDP A;  3DJJ A;  4UDR A;  2GMH A;  2YAU A;  4U8O A;  2GR2 A;  2V6O A;  3AWI A;  1OJC A;  3LOV A;  2YVJ A;  1ELI A;  4A5L A;  3M13 A;  3GMB A;  1O5W A;  5C2T A;  3NK1 X;  4EQR A;  2C76 A;  2Y6R A;  1E1M A;  3DK4 A;  4J56 A;  1L9E A;  3C4N A;  4O5U A;  1BKW A;  1H81 A;  1XAN A;  1SEZ A;  3AEA A;  4H4Q A;  4OVI A;  5M0Z A;  5M10 A;  1BGN A;  5J7X A;  3EAN A;  3BHK A;  1COY A;  2WBA A;  4BV6 A;  4TM3 A;  1MOK A;  5BUK A;  3AE7 A;  2YG3 A;  4Z2R A;  4Z25 A;  3CTY A;  4TM4 A;  2YLW A;  1GET A;  1E1K A;  2X50 A;  1CC6 A;  1IJH A;  1D4E A;  2YLX A;  3DGH A;  3S61 A;  4D04 A;  5U63 A;  4H4W A;  1DOC A;  2YG7 A;  1CJ3 A;  1TDN A;  3H8L A;  4EMI A;  1S2Y A;  3AED A;  2B76 A;  5KVH A;  2V60 A;  1DJQ A;  3AEE A;  4A9W A;  3NK0 X;  2OLO A;  4Z43 A;  4HB9 A;  5U25 A;  3I6D A;  2R0C A;  2VOU A;  2A8X A;  2C67 A;  4H4R A;  3M12 A;  2A89 A;  3DGZ A;  3IC9 A;  3QFA A;  1PS9 A;  2C65 A;  1KNP A;  2OA1 A;  3PS9 A;  2RAB A;  3OC4 A;  1GOS A;  1D7Y A;  1UKV G;  1GRF A;  2C3C A;  3L1R A;  5IQ4 A;  3CND A;  3AEC A;  3PO7 A;  2YWL A;  1M6I A;  1E39 A;  1P2E A;  3NIX A;  1P2H A;  2C72 A;  2XDO A;  2XLU A;  1K4Q A;  2YR6 A;  2IVD A;  3RNM A;  4B64 A;  3V3N A;  3IHM A;  4A6N A;  2XFU A;  4D03 A;  2V61 A;  2GMJ A;  1GAL A;  3CGC A;  2GRT A;  3D8X A;  1Y56 A;  2B9X A;  4J2W A;  3VRB A;  4EM4 A;  1D5T A;  2Q0L A;  3Q6J A;  4JY2 A;  2TMD A;  4ADW A;  2R4E A;  3AXB A;  1IUU A;  2BK3 A;  5EBK A;  1F3P A;  5GSN A;  2QAE A;  2C7G A;  2GV8 A;  5L46 A;  3T37 A;  4H2R A;  4I59 A;  4B68 A;  4H4Z A;  3QJ4 A;  4H50 A;  1BGJ A;  2B7R A;  4OPG A;  1F8W A;  2WDR A;  4DGK A;  4C3X A;  3NYC A;  4J36 A;  1LTX R;  2GQF A;  1JNR A;  3WE0 A;  1OJT A;  4BK3 A;  2AAQ A;  4YKF A;  2YLS A;  4EIP A;  4JN9 A;  3KLJ A;  2W0H A;  3GD3 A;  2B7S A;  4IA5 A;  4YTM A;  2X3N A;  3AE6 A;  3C4A A;  2WPF A;  3F8D A;  3NGC X;  3AEG A;  1Q1W A;  4OCG A;  2OAL A;  1Q9I A;  4Z24 A;  4YSH A;  2GR1 A;  3K7M X;  2V5Z A;  4REK A;  1IUW A;  4H4Y A;  3LAD A;  3E1T A;  2HQM A;  3DJE A;  1GRG A;  5HYM A;  1H84 A;  1ZY8 A;  2WP5 A;  4RG4 A;  1GND A;  2R46 A;  2PYX A;  3K7Q X;  1E6E A;  3ZDN A;  1TDO A;  3AD7 B;  4P9S A;  3QVR A;  2R0P A;  2FJB A;  4EMW A;  2JB3 A;  1JRX A;  1S2Q A;  5CQF A;  3AD9 B;  5CKU A;  4APN A;  3EF6 A;  1KDG A;  5U1O A;  1CHU A;  1JRZ A;  1PBE A;  3FPZ A;  4B66 A;  3HZL A;  4CBQ A;  2XLP A;  1YQ4 A;  3FBS A;  4B67 A;  3ITJ A;  4JNQ A;  2UZZ A;  2GR0 A;  3ICT A;  2GAH B;  2ACZ A;  1FEB A;  1VRQ B;  3ICR A;  4A79 A;  1GRB A;  1VDC A;  3RHA A;  1B37 A;  5FS8 A;  2J3N A;  2YM2 A;  3K7T A;  1GRH A;  4ECH A;  1GSN A;  1GRT A;  4HA6 A;  4H4V A;  1BF3 A;  1LPF A;  3CNS A;  2YM1 A;  3CPH G;  1ZOV A;  1PJ5 A;  4YKG A;  4YXD A;  3GRT A;  4Z2U A;  5KRQ A;  1E1N A;  2XLR A;  4CCR A;  3CIR A;  1TDF A;  1L9D A;  4BUR A;  1YY5 A;  2GR3 A;  1PJ7 A;  2F5Z A;  2VRM A;  3UCL A;  1PBD A;  3P9U A;  4OPT A;  3GSI A;  5FS7 A;  4C5O A;  4JY3 A;  3UKA A;  1NG3 A;  4OPL A;  2VVL A;  2WHD A;  4Z26 A;  3NN0 X;  4AOS A;  2BS2 A;  3AB1 A;  2TPR A;  3I3L A;  1K0I A;  1FEC A;  4GDP A;  1JNZ A;  3NKS A;  2H89 A;  4K22 A;  2XFO A;  4ZCC A;  2CDU A;  3UOX A;  4PAB A;  2JBV A;  2RGJ A;  2XFN A;  2Q0K A;  4BJY A;  1N4V A;  4IVO B;  2JK6 A;  2VVL G;  4XWR A;  2GQW A;  2C73 A;  4U8M A;  5LV9 A;  3ABV A;  2FJD A;  2JB2 A;  1XPQ A;  2NVK X;  2BCG G;  5BRT A;  4YSY A;  2C64 A;  2WS3 A;  3KU9 A;  3GWF A;  2RGO A;  3GRS A;  3P4S A;  4X9N A;  3NLC A;  2CVJ A;  1Y0P A;  3ALL A;  3ICS A;  1N4W A;  1XDI A;  1EL9 A;  4U8P A;  4YSZ A;  2C70 A;  4J34 A;  3KKJ A;  4H4P A;  3ALM A;  2Z5Y A;  3CN8 A;  4IV9 A;  1H6V A;  5KWF A;  1ONF A;  2EQ9 A;  2WPC A;  1Q1R A;  5JCM A;  2ZZ0 A;  2R4J A;  2VRL A;  2ZZB A;  3AE8 A;  3GYI A;  3UP5 A;  5HXI A;  2B9W A;  2FJE A;  2XLS A;  1DOD A;  4NTE A;  4GUV A;  4I58 A;  4IA6 A;  3NTD A;  3QSE A;  4YT0 A;  3UKH A;  3VR8 A;  5FMH A;  3B3R A;  4H4T A;  4H4S A;  2CFY A;  1F8R A;  3GD4 A;  1O95 A;  3BI4 A;  4XWZ A;  3IHG A;  3F8P A;  2O9Z A;  2X8G A;  2VQ7 A;  4U2S A;  3SFE A;  4Z44 A;  5IPY A;  2YR5 A;  2BS4 A;  3AYI A;  3UOV A;  1ZMD A;  1D7L A;  3AE5 A;  4U8N A;  4AOX A;  1PXC A;  4CCQ A;  3VRA A;  3NRN A;  2WPE A;  3NTA A;  1JU2 A;  2OLN A;  1IUS A;  1DXL A;  4JQ9 A;  4TLZ A;  4UDQ A;  4AT2 A;  3NT6 A;  1H7X A;  3UTE A;  1N1P A;  4H2Q A;  2E5V A;  5ER0 A;  2R9Z A;  1BZL A;  1KFY A;  3LZW A;  3QSM A;  1GTE A;  3QSS A;  2GEW A;  3P1W A;  3O0H A;  4GR1 A;  1TDE A;  2AR8 A;  1LJ1 A;  1HYU A;  4EQW A;  3CGE A;  2BXR A;  1OJD A;  2XLT A;  4PAA A;  1QLB A;  4EIQ A;  3ADA B;  1GV4 A;  2OAM A;  2YR4 A;  1M64 A;  1ZP0 A;  4Y4L A;  5JCN A;  2BAC A;  4RSL A;  1PXA A;  4Y4N A;  3UOZ A;  2BS3 A;  1CJ4 A;  1ZKQ A;  1EL5 A;  1O94 A;  4YWO A;  3M0O A;  4CRT A;  4EQS A;  2VQB A;  3DME A;  4ICY A;  2BA9 A;  3CPJ G;  3NYE A;  2VVM A;  4U8J A;  2WET A;  1GTH A;  1TRB A;  2BK5 A;  5HY5 A;  4N9X A;  1PDH A;  4CNJ A;  2IVE A;  2BYB A;  3QFB A;  2XFQ A;  3QVP A;  2QA1 A;  3S5W A;  3II4 A;  4A65 A;  2YG4 A;  3H4K A;  3L8K A;  3UKL A;  4YSX A;  1FCD A;  2Z5X A;  1D4C A;  3CNP A;  4CY6 A;  4TM0 A;  1PBB A;  1KF6 A;  3FMW A;  1D4D A;  5BUL A;  1L0V A;  2E1M A;  4BK1 A;  4AP3 A;  1VQW A;  3COX A;  1GT8 A;  5EB4 A;  2PHH A;  1NDA A;  3CNJ A;  4JNA A;  5KXJ A;  3AD8 B;  1IUX A;  2GF3 A;  1GER A;  3URH A;  1QO8 A;  1S3B A;  2JB1 A;  2BAB A;  5IQ1 A;  4U8K A;  3B6D A;  3DK8 A;  1V59 A;  2YQU A;  4EQX A;  2C66 A;  2WU2 A;  2XVI A;  4E0V A;  2XCG A;  4ZN0 A;  2BXS A;  1FL2 A;  4MJW A;  1GXF A;  1CJ2 A;  2DKI A;  2WP9 A;  2RGH A;  3C96 A;  1VG0 A;  5HHF A;  3KD9 A;  4BJZ A;  4OPU A;  3CGD A;  1RSG A;  2YG5 A;  3ZYX A;  1NPX A;  1GES A;  1XHC A;  2BC1 A;  4Y4M A;  4USQ A; 
#chains in the Genus database with same CATH topology
 2PMQ A;  3UTG A;  3UTF A;  4K8D A;  3R1Z A;  1PN0 A;  3RED A;  3DH9 A;  1QJD A;  3GDN A;  4K5R A;  1NG4 A;  2WOV A;  3NFU A;  3MSY A;  4DSH A;  3DER A;  4J33 A;  1LQU A;  3CNT A;  3AE2 A;  3ATR A;  1DOE A;  3RO6 A;  3VQR A;  4M52 A;  4GME A;  2AL2 B;  1ZDL A;  3DJD A;  2WDQ A;  1OJ9 A;  3NVV B;  4H4U A;  3H8A A;  2GGJ A;  2DW6 A;  4B65 A;  3EPT A;  2BK4 A;  4NEV A;  3U9I A;  1PBF A;  4NZH A;  2GB0 A;  4LII A;  3BJS A;  1NAA A;  1E1L A;  4ZCD A;  3GMC A;  4TM1 A;  1LVL A;  1YQ3 A;  2YVG A;  3UJR A;  1N60 C;  3UXL A;  4NTC A;  1H7W A;  1KCZ A;  1TDK A;  2PTW A;  4JDR A;  4USR A;  3NN6 X;  4C3Y A;  1GEU A;  4U2L A;  4G73 A;  4WX1 A;  4XXG A;  5C3J A;  4LA1 A;  1JOA A;  2B9Y A;  3K30 A;  2ONE A;  4CY8 A;  3CYJ A;  5KMQ A;  4UP3 A;  2PTZ A;  2VZ2 A;  4BK2 A;  3NYF A;  1N5X A;  2YLZ A;  3U4F A;  1NEK A;  4H7U A;  3VA8 A;  4RG3 A;  2XVJ A;  2XFP A;  2EQ6 A;  3ENL A;  4NWZ A;  3R9U A;  1FEA A;  2GAG B;  1PJ6 A;  4YTN A;  3NXL A;  1OJA A;  3UKF A;  4J57 A;  3P4Q A;  4B69 A;  1S3E A;  4H2N A;  4Z2T A;  2FJA A;  3P4P A;  3KPF A;  3RP6 A;  3NH3 X;  3CB3 A;  4GGB A;  1NHQ A;  4A7A A;  1ZK7 A;  2XYO A;  3N4F A;  4G6G A;  2PGW A;  2DW7 A;  3AE3 A;  1YQZ A;  4GGH A;  3CGB A;  1KSS A;  3NNE A;  3OW1 A;  5FS6 A;  3EAO A;  1ZOY A;  2X8C A;  4G6H A;  4G74 A;  3VDG A;  1EC8 A;  1CC2 A;  4UDR A;  2PTY A;  3SXI A;  5FJO A;  3R0K A;  3SJN A;  3HYV A;  1OJC A;  4EQR A;  2C76 A;  2E5A A;  2P3Z A;  3R25 A;  1L9E A;  4O5U A;  3Q45 A;  3AEA A;  5M0Z A;  1COY A;  4BV6 A;  1WUF A;  2PGE A;  3CTY A;  5J04 A;  2W3R A;  2YLW A;  1GET A;  2W55 A;  1CC6 A;  2YG7 A;  2GGE A;  2B76 A;  2V60 A;  3AEE A;  1N61 C;  2A8X A;  2A89 A;  3DGZ A;  3IC9 A;  2OA1 A;  1KNP A;  3L1R A;  3AEC A;  1E39 A;  3RIT A;  4DXK A;  3NVY B;  2XLU A;  1K4Q A;  3T2Z A;  3SZ0 A;  3V3N A;  4HCH A;  3IJI A;  3STP A;  4TVY A;  2GRT A;  1Y56 A;  2B9X A;  3VRB A;  3IJL A;  2TMD A;  2R4E A;  5EBK A;  2C7G A;  2GV8 A;  5L46 A;  3T37 A;  4H2R A;  4B68 A;  4H50 A;  4J36 A;  4F4R A;  1JNR A;  4BK3 A;  4YKF A;  4EIP A;  4JN9 A;  3KLJ A;  4YTM A;  2X3N A;  3HPF A;  2WPF A;  3NGC X;  2OAL A;  4Z24 A;  3NZG A;  4HYR A;  7ENL A;  1GRG A;  1ZY8 A;  2R46 A;  3QVR A;  6ENL A;  5G5G B;  4EMW A;  1JRX A;  4APN A;  5FJP A;  5U1O A;  1JRZ A;  1STZ A;  4CBQ A;  4HNL A;  2GAH B;  5FS8 A;  4DN1 A;  4ECH A;  3CPH G;  1E1N A;  3TWB A;  3CIR A;  1TDF A;  4E5T A;  4DHG A;  1PJ7 A;  3P9U A;  3UKA A;  1SJB A;  1NG3 A;  2PU0 A;  2BS2 A;  2TPR A;  4K22 A;  2XGZ A;  3GD6 A;  2CDU A;  2RGJ A;  3R0U A;  1N4V A;  1KKO A;  1P43 A;  2VVL G;  3RRA A;  4G7F A;  4MMW A;  1XPQ A;  2NVK X;  2WS3 A;  4GFI A;  4HN8 A;  2CVJ A;  3GYX A;  1XS2 A;  5FJU A;  4U8P A;  2PS2 A;  1EL9 A;  3T2K A;  4J34 A;  3SR6 B;  1Q1R A;  3UKH A;  5FMH A;  3B3R A;  4H4T A;  4MKS A;  2PU1 A;  1O95 A;  3BI4 A;  3IHG A;  2X8G A;  4E4U A;  4U2S A;  5IPY A;  2BS4 A;  3AE5 A;  3VRA A;  5KNL A;  3N6H A;  4JQ9 A;  4UDQ A;  5FJR A;  3QSM A;  2R9Z A;  1GTE A;  3QSS A;  4M6U A;  4GR1 A;  3V3W A;  1TDE A;  2AR8 A;  5G5H B;  1LJ1 A;  4PAA A;  3A7U A;  4EIQ A;  4II2 A;  2BAC A;  2QJM A;  1EL5 A;  1O94 A;  4CRT A;  2XH4 A;  4ICY A;  1FHU A;  1XPY A;  3T0K A;  1N5W C;  2WET A;  1GTH A;  2BK5 A;  4CNJ A;  3T6C A;  2BYB A;  2XFQ A;  3II4 A;  2OO6 A;  3H4K A;  3UKL A;  1FCD A;  3CNP A;  1D4D A;  3CAW A;  3AN1 A;  1S3B A;  2JB1 A;  5IQ1 A;  2MNR A;  4U8K A;  3B6D A;  3DK8 A;  2POD A;  3MZN A;  2WP9 A;  5HHF A;  2RGH A;  3KD9 A;  4IHC A;  3CGD A;  1FFV C;  1NPX A;  1GES A;  4USQ A;  1B5Q A;  3AEB A;  5FS9 A;  3BI5 A;  4GCM A;  2OFJ A;  1N4U A;  1EC9 A;  3HYW A;  4A99 A;  2WQY A;  3GDP A;  3DEQ A;  2JKC A;  2W3S A;  4B63 A;  1MNS A;  3ZVH A;  3V76 A;  3VR9 A;  3F8R A;  3GYJ A;  4TLX A;  3BNU A;  4AP1 A;  2IID A;  4KX6 A;  2W54 A;  3BNM A;  4A6N B;  3NG7 X;  3IK4 A;  4ZCW A;  4FK1 A;  3RP7 A;  3AE4 A;  3ZLH A;  3KUM A;  4GAP A;  3GY1 A;  1L8P A;  2X8H A;  4X9M A;  2HNE A;  3DA1 A;  3NK2 X;  2CUL A;  3D46 A;  4KPR A;  1CC4 A;  2XVE A;  4HNC A;  1KNR A;  3UCD A;  3DK9 A;  1CJC A;  1EBH A;  3SY4 A;  2QA2 A;  1TZZ A;  3AEF A;  3R10 A;  3FIM B;  2C4C A;  2BC0 A;  4C74 A;  3RP8 A;  3NHO X;  4GF7 A;  3LXD A;  4GIR A;  3N4E A;  4II3 A;  1NHR A;  1B8S A;  3DDM A;  2Y6Q A;  4OPC A;  4FK1 C;  3T9P A;  5EB5 A;  4GRT A;  3ATQ A;  3AYL A;  2I0Z A;  3DJG X;  4IL0 A;  2DKH A;  5KOX A;  3I4K A;  3V5F A;  4K7Z A;  1K0J A;  1GRE A;  1IYX A;  1EBD A;  4NEW A;  4OPI A;  2BCP A;  3P93 A;  3P4R A;  4UDP A;  3DJJ A;  2GMH A;  2V6O A;  2YVJ A;  1ELI A;  3M13 A;  3GMB A;  2Y6R A;  3DK4 A;  3C4N A;  1BKW A;  3V5C A;  1SEZ A;  1X2H A;  4OVI A;  5M10 A;  3EAN A;  2WBA A;  2XH2 A;  3AE7 A;  4EWJ A;  4Z25 A;  3CT2 A;  3DGH A;  3N6J A;  4D04 A;  5U63 A;  4H4W A;  3SYI A;  5KMS A;  1CJ3 A;  5KVH A;  3NK0 X;  4Z43 A;  3H7V A;  3I6D A;  2VOU A;  4H4R A;  3QFA A;  3PS9 A;  1GOS A;  5IQ4 A;  2YWL A;  4YWS A;  1EBG A;  3SZC A;  2XDO A;  3RNM A;  3MUC A;  3IHM A;  2XFU A;  3H70 A;  1GAL A;  3CGC A;  4EM4 A;  1D5T A;  3Q6J A;  3AXB A;  2BK3 A;  1F3P A;  2OZ3 A;  4I59 A;  1BGJ A;  2B7R A;  4OPG A;  1F8W A;  4K2S A;  3NYC A;  1LTX R;  4ROP A;  2GQF A;  3K1G A;  3NS1 B;  2W0H A;  4IA5 A;  3UJF A;  3UXK A;  1PDY A;  4YSH A;  1IUW A;  3LAD A;  1ELS A;  2WP5 A;  1E6E A;  4P9S A;  3AD7 B;  3OZM A;  2FJB A;  1F9C A;  1S2Q A;  4DWD A;  4B66 A;  1JDF A;  3P3B A;  3FBS A;  3Q4D A;  4B67 A;  3CMM A;  3ICT A;  2ACZ A;  1FEB A;  4A79 A;  1GRB A;  1B37 A;  1H2I A;  2YM2 A;  1GSN A;  4HA6 A;  3HYX A;  1MUC A;  2YM1 A;  1ZOV A;  3I6E A;  1L9D A;  4BUR A;  5BOE A;  5FS7 A;  3ZLG A;  4OPL A;  2VVL A;  4Z26 A;  3EKG A;  1K0I A;  1OEP A;  4E8G A;  4H2H A;  3UJ2 A;  1MDR A;  4IVO B;  4IP4 A;  4XWR A;  5LV9 A;  2JB2 A;  2P8B A;  2RGO A;  1VDV A;  4X9N A;  1Y0P A;  2OZT A;  4Z17 A;  3ICS A;  4YSZ A;  2C70 A;  3AMZ A;  2Z5Y A;  4JHM A;  1H6V A;  2EQ9 A;  2VRL A;  5HXI A;  3UP5 A;  2XLS A;  1DOD A;  4GUV A;  5BRT A;  4IA6 A;  3QSE A;  4YT0 A;  1F8R A;  3GD4 A;  3SFE A;  1E9I A;  2AL1 A;  5KMP A;  4AOX A;  3FJ4 A;  1PXC A;  4CCQ A;  1JU2 A;  1IUS A;  2QQ6 A;  4TLZ A;  4AT2 A;  1FHV A;  3NT6 A;  1N62 C;  5ER0 A;  1KFY A;  3P1W A;  3O0H A;  1HYU A;  4EQW A;  2BXR A;  2ZAD A;  2OAM A;  4Y4L A;  3DG7 A;  1PXA A;  2OPJ A;  3UOZ A;  2AL2 A;  1CJ4 A;  1FIQ B;  2GGG A;  3M0O A;  3VC5 A;  3HRD C;  2BA9 A;  3T2Y A;  4U8J A;  4N9X A;  2GSH A;  2IVE A;  3QVP A;  2QA1 A;  5IDZ A;  3L8K A;  4KT2 A;  1T3Q C;  3FMW A;  1WYG A;  1NDA A;  5KXJ A;  1IUX A;  1GER A;  4IP5 A;  3P0W A;  3PK7 A;  2BAB A;  2ZC8 A;  4EQX A;  4ZN0 A;  5KMR A;  1FL2 A;  1GXF A;  1SJC A;  2DKI A;  3C96 A;  4BJZ A;  1XHC A;  1B4V A;  3NVW B;  2QDD A;  2E4G A;  3OZ2 A;  2CHR A;  2YLT A;  2ARD A;  2Q6U A;  3H8I A;  4KWS A;  3ISH A;  1JRY A;  1CF3 A;  4C77 A;  3BI2 A;  3MY9 A;  4A3R A;  4DSG A;  3UP4 A;  3PVC A;  2ZZC A;  4JN7 A;  1FO4 A;  1DTN A;  4FDC B;  1AOG A;  2C3D A;  1CBO A;  1L9C A;  4FP1 A;  4DYE A;  1GRA A;  2NQL A;  3G5R A;  4U2T A;  3ZLF A;  2QCU A;  1JCT A;  1YKJ A;  1W6T A;  5BOF A;  3CPI G;  4ENL A;  1NEL A;  4J1O A;  3IWA A;  2EQ7 A;  2P8C A;  3Q9T A;  5JCK A;  1BWC A;  5GRT A;  5JCI A;  3UTH A;  4U8L A;  3SN0 A;  1W4X A;  1EC7 A;  3FV9 A;  2WP6 A;  3UKQ A;  3LJP A;  3SQP A;  2C75 A;  1F8S A;  1PHH A;  4H4X A;  2WES A;  3G5S A;  4FI4 A;  4AT0 A;  3L5O A;  1EL7 A;  3TTE A;  2OVL A;  1ONE A;  3BHF A;  4J31 A;  3PFR A;  2RDX A;  1REO A;  2R45 A;  2WU5 A;  1RVK A;  1CL0 A;  3V4B A;  4EMJ A;  1JRP A;  3CXO A;  2V3A A;  1NHS A;  1VG9 A;  1FOH A;  1MDL A;  2GH5 A;  1ZMC A;  4OPD A;  1TE6 A;  1NEN A;  2WOI A;  3JVA A;  1RM6 B;  4M0X A;  5EOW A;  2X99 A;  2Q7V A;  1S7M A;  1PXB A;  4LU6 A;  3FCP A;  3I6T A;  5KOW A;  5JCL A;  3VRD B;  3FYY A;  3UKP A;  2R0G A;  2V3B A;  3LB8 A;  5KVI A;  1Y56 B;  1H83 A;  3D1C A;  2WEU A;  1DNC A;  4X4J A;  2H88 A;  4DNA A;  4IZG A;  1KN0 A;  1ZX9 A;  4NTD A;  4GYP C;  2YAU A;  3AWI A;  2O56 A;  4A5L A;  1O5W A;  3NK1 X;  3UJE A;  1E1M A;  4H1Z A;  2OG9 A;  1H81 A;  3AM9 A;  4H4Q A;  5J7X A;  4TM3 A;  1MOK A;  4Z1Y A;  4Z2R A;  3TJI A;  3S5S A;  1BQG A;  1E1K A;  2X50 A;  2OLA A;  1IJH A;  1D4E A;  2YLX A;  1TDN A;  4EMI A;  1S2Y A;  3D47 A;  1DJQ A;  4A9W A;  4HB9 A;  5U25 A;  3M12 A;  2RAB A;  3TJ4 A;  1UKV G;  3CND A;  3PO7 A;  1VQZ A;  3NIX A;  2C72 A;  3OPS A;  4GIS A;  2IVD A;  4A6N A;  3QPE A;  4D03 A;  2Q0L A;  1R0M A;  5GSN A;  2QAE A;  3QJ4 A;  2WDR A;  4HPN A;  3WE0 A;  1OJT A;  2AAQ A;  4TVW A;  4GYP A;  3SBF A;  2YLS A;  3GD3 A;  2B7S A;  5FJT A;  3AE6 A;  4MGG A;  4OCG A;  3SN1 A;  4REK A;  4H4Y A;  1FFU C;  1GND A;  4IT1 A;  3ZDN A;  2R0P A;  2GDQ A;  5CQF A;  5CKU A;  2BRA A;  1R6W A;  3EF6 A;  1KDG A;  1PBE A;  3HZL A;  2XLP A;  2QDE A;  2GL5 A;  2UZZ A;  1VDC A;  3OP2 A;  3K7T A;  3VC6 A;  3ZVI A;  1GRT A;  4YXD A;  4Z2U A;  3GRT A;  4CCR A;  2VRM A;  1PBD A;  4C5O A;  4AOS A;  3NKS A;  2XFO A;  1JPD X;  2BRY A;  3UOX A;  2Q0K A;  3TQP A;  1WUE A;  2XH7 A;  2C73 A;  4A35 A;  2FJD A;  2BCG G;  4YSY A;  3KU9 A;  3GWF A;  3NLC A;  3OZY A;  3ALL A;  1XDI A;  2FKP A;  4H4P A;  3ALM A;  1ONF A;  2R4J A;  2ZZ0 A;  3GYI A;  3AE8 A;  2FJE A;  4NTE A;  4I58 A;  3NTD A;  2CFY A;  3RGT A;  2PPG A;  3F8P A;  2O9Z A;  3NO1 A;  2VQ7 A;  4Z44 A;  4KEM A;  2YR5 A;  3AYI A;  1ZMD A;  4U8N A;  1YEY A;  3NTA A;  2OLN A;  1N63 C;  1H7X A;  1N1P A;  4H2Q A;  2E5V A;  4H83 A;  2HZG A;  2GEW A;  3ZVH B;  3QN3 A;  1ZXI C;  2XLT A;  3ADA B;  2AKM A;  3JZU A;  2YR4 A;  1M64 A;  1ZP0 A;  4RSL A;  4Y4N A;  2BS3 A;  4EQS A;  3H12 A;  2VQB A;  2XH0 A;  2GGI A;  2VVM A;  1TRB A;  5HY5 A;  3SZW A;  1PDH A;  3QFB A;  4A65 A;  3S5W A;  3PG6 A;  2YG4 A;  3T4W A;  1D4C A;  5EU9 A;  4CY6 A;  4TM0 A;  1V97 A;  1L0V A;  2E1M A;  4BK1 A;  1VQW A;  1GT8 A;  3BSM A;  2HXU A;  3AD8 B;  2GF3 A;  1SB3 B;  3EUB 3;  3DG6 A;  2C66 A;  3VCN A;  4E0V A;  2XCG A;  2BXS A;  1P48 A;  4MJW A;  1VG0 A;  2PA6 A;  4OPU A;  2YG5 A;  4X2P A;  3SGL A;  3B9J B;  2OZ8 A;  4K5S A;  3KA7 A;  3UGV A;  3SX6 A;  3IF9 A;  1NHP A;  2PP1 A;  3G5Q A;  5JRB A;  3TCS A;  2FBW A;  1X31 B;  4H2P A;  1KD0 A;  2APG A;  1TYP A;  1LQT A;  1JEH A;  3DES A;  3GWD A;  5DBJ A;  1EL8 A;  4E4F A;  2XVF A;  4WCT A;  4ZOH B;  1KSU A;  3UOY A;  3MKC A;  2JAE A;  1H82 A;  2PCE A;  1E7P A;  3DFH A;  1TKK A;  4YTP A;  3AE9 A;  2GGH A;  3AYJ A;  3VFC A;  1K0L A;  3SM8 A;  2AQJ A;  4G9K A;  4CNK A;  3FXG A;  1LV0 A;  1H86 A;  3KVE A;  1F6M A;  4B1B A;  2WDV A;  2WOW A;  1IUV A;  2ZBW A;  3NRZ B;  1RYI A;  2OX4 A;  4FX9 A;  4GDE A;  2YLR A;  3GO2 A;  3D9X A;  4HCD A;  1DOB A;  1IUT A;  2OQH A;  3R07 C;  5BVA A;  2YVF A;  2QJJ A;  4JN8 A;  4U8I A;  3SFD A;  3ALJ A;  2MUC A;  1RP0 A;  3FG2 P;  3DG3 A;  2NPX A;  4K1W A;  2EQ8 A;  1GPE A;  2XVH A;  3SSZ A;  1DJN A;  3EEZ A;  3QLD A;  3V3O A;  4E6M A;  2XSX A;  1MXT A;  3LZX A;  2GVC A;  3RR1 A;  3SZF A;  4IVM B;  2A87 A;  3AE1 A;  1Z6L A;  4EM3 A;  3CK5 A;  3JSK A;  4O5Q A;  3DFY A;  1PBC A;  5TR3 A;  3UKK A;  2YG6 A;  5J60 A;  1TYT A;  4G8T A;  1MO9 A;  3UJS A;  4HCL A;  3PWG A;  3T8Q A;  4U8O A;  2GR2 A;  2PP3 A;  3LOV A;  3BOX A;  5C2T A;  2POZ A;  4J56 A;  1XAN A;  1ECQ A;  3SN4 A;  1BGN A;  3BHK A;  5BUK A;  2YG3 A;  1MRA A;  4TM4 A;  2QVH A;  3RCY A;  3DGB A;  3S61 A;  4DX3 A;  4H19 A;  1DOC A;  3H8L A;  3AED A;  1KKR A;  2OLO A;  4ZA0 A;  2R0C A;  2C67 A;  4K2X A;  2C65 A;  1PS9 A;  3OC4 A;  1D7Y A;  1GRF A;  2C3C A;  3ES8 A;  1M6I A;  3DIP A;  3FVD A;  1P2E A;  3MWC A;  1P2H A;  4A6G A;  3A7A A;  2YR6 A;  1JPM A;  4B64 A;  2QJN A;  2QGY A;  2V61 A;  2GMJ A;  3D8X A;  3KPK A;  4J2W A;  4JY2 A;  1SJD A;  4ADW A;  1IUU A;  4H4Z A;  4DGK A;  4C3X A;  3IJQ A;  2I5Q A;  3C4A A;  3JW7 A;  3TW9 A;  3F8D A;  2HXT A;  3AEG A;  1Q1W A;  1Q9I A;  2GR1 A;  3K7M X;  2V5Z A;  3QKE A;  2OKT A;  3E1T A;  2HQM A;  3DJE A;  2OQY A;  5HYM A;  3TOY A;  1PDZ A;  1H84 A;  4RG4 A;  2PYX A;  3K7Q X;  1TDO A;  2JB3 A;  2P0I A;  3ETR B;  3AD9 B;  1CHU A;  2AKZ A;  3FPZ A;  1YQ4 A;  3ITJ A;  4JNQ A;  3HW2 A;  4NNJ A;  2GR0 A;  3A7R A;  1VRQ B;  3ICR A;  3RHA A;  2J3N A;  1GRH A;  4H4V A;  1BF3 A;  1LPF A;  3CNS A;  5KRQ A;  1PJ5 A;  4YKG A;  2XLR A;  4J3Z A;  1YY5 A;  4GAV A;  2GR3 A;  2F5Z A;  3UCL A;  3CXB A;  4OPT A;  3GSI A;  4JY3 A;  2P88 A;  2WHD A;  3NN0 X;  3AB1 A;  3I3L A;  3S47 A;  4GDP A;  1FEC A;  1JNZ A;  3T14 A;  2H89 A;  1SJA A;  4ZCC A;  4PAB A;  2JBV A;  2XFN A;  4BJY A;  4IL2 A;  2JK6 A;  2GQW A;  4U8M A;  3ABV A;  3QTP A;  2C64 A;  3MQT A;  3GRS A;  3P4S A;  1N4W A;  3KKJ A;  3CN8 A;  4IV9 A;  5KWF A;  2WPC A;  5JCM A;  4K8G A;  2ZZB A;  2B9W A;  3VR8 A;  4H4S A;  4XWZ A;  3NVZ B;  3UOV A;  3PWI A;  1D7L A;  3TWA A;  3VCC A;  3R11 A;  3NRN A;  3THU A;  2WPE A;  1DXL A;  3UTE A;  3T31 A;  3LZW A;  1BZL A;  2FYM A;  3SQS A;  3OTR A;  3CGE A;  1OJD A;  1JRO A;  1QLB A;  1GV4 A;  3GC2 A;  5JCN A;  1ZKQ A;  4YWO A;  3DME A;  3UCC A;  2E3T A;  3NYE A;  3CPJ G;  2PSN A;  1BKH A;  4YSX A;  2Z5X A;  1PBB A;  1KF6 A;  5BUL A;  4AP3 A;  3COX A;  5EB4 A;  2PHH A;  2PTX A;  3CNJ A;  4JNA A;  1X2G A;  4KPL A;  3URH A;  1QO8 A;  3ES7 A;  1V59 A;  2YQU A;  2WU2 A;  2XVI A;  3B97 A;  1NU5 A;  2PP0 A;  1CJ2 A;  1RSG A;  3ZYX A;  5ENL A;  2BC1 A;  4Y4M A; 
#chains in the Genus database with same CATH homology
 3SGL A;  1B4V A;  1B5Q A;  3UTG A;  3UTF A;  3AEB A;  5FS9 A;  4K5S A;  3KA7 A;  2E4G A;  3BI5 A;  3OZ2 A;  4K8D A;  4GCM A;  2YLT A;  2ARD A;  3SX6 A;  1PN0 A;  3IF9 A;  1NHP A;  3DH9 A;  1N4U A;  3RED A;  2Q6U A;  1QJD A;  3G5Q A;  3H8I A;  3GDN A;  5JRB A;  3HYW A;  4K5R A;  1NG4 A;  2WOV A;  2FBW A;  3ISH A;  4A99 A;  1X31 B;  1JRY A;  1CF3 A;  4C77 A;  2WQY A;  3BI2 A;  4DSH A;  4H2P A;  3GDP A;  2JKC A;  4DSG A;  2APG A;  4J33 A;  1TYP A;  1LQT A;  3UP4 A;  4B63 A;  1LQU A;  3CNT A;  3PVC A;  2ZZC A;  3V76 A;  3VR9 A;  1JEH A;  3F8R A;  3AE2 A;  3ATR A;  4FDC B;  1AOG A;  3GYJ A;  1DOE A;  3GWD A;  5DBJ A;  2C3D A;  1CBO A;  1EL8 A;  1L9C A;  3VQR A;  4TLX A;  2XVF A;  1GRA A;  3BNU A;  4M52 A;  4AP1 A;  2IID A;  4KX6 A;  4WCT A;  1ZDL A;  3BNM A;  3G5R A;  3DJD A;  4U2T A;  2WDQ A;  1KSU A;  4A6N B;  3UOY A;  1OJ9 A;  3NG7 X;  4H4U A;  2JAE A;  2QCU A;  4FK1 A;  1H82 A;  1YKJ A;  4B65 A;  3RP7 A;  1E7P A;  3EPT A;  3CPI G;  2BK4 A;  4YTP A;  3AE9 A;  4NEV A;  3AE4 A;  3AYJ A;  1PBF A;  4GAP A;  4NZH A;  3IWA A;  2EQ7 A;  1K0L A;  3SM8 A;  2AQJ A;  2GB0 A;  3Q9T A;  4LII A;  4G9K A;  5JCK A;  1NAA A;  2X8H A;  1BWC A;  4X9M A;  5GRT A;  4CNK A;  1E1L A;  4ZCD A;  1LV0 A;  3DA1 A;  1H86 A;  3GMC A;  4TM1 A;  5JCI A;  3KVE A;  3NK2 X;  3UTH A;  2CUL A;  1LVL A;  1F6M A;  1YQ3 A;  4U8L A;  4B1B A;  2YVG A;  2WDV A;  2WOW A;  4K2X A;  4KPR A;  1IUV A;  1W4X A;  4NTC A;  2ZBW A;  1H7W A;  1CC4 A;  1RYI A;  1TDK A;  2WP6 A;  3UKQ A;  4FX9 A;  4JDR A;  3NN6 X;  3LJP A;  4USR A;  4GDE A;  3SQP A;  2C75 A;  1F8S A;  4C3Y A;  1PHH A;  1GEU A;  4H4X A;  2XVE A;  2YLR A;  3D9X A;  4U2L A;  4G73 A;  4WX1 A;  4XXG A;  2WES A;  5C3J A;  4LA1 A;  1DOB A;  1IUT A;  1KNR A;  3G5S A;  1JOA A;  2B9Y A;  3K30 A;  1CJC A;  3DK9 A;  3SY4 A;  4AT0 A;  4CY8 A;  3L5O A;  2QA2 A;  5KMQ A;  1EL7 A;  5BVA A;  2YVF A;  4UP3 A;  3BHF A;  4J31 A;  4U8I A;  1REO A;  2VZ2 A;  3SFD A;  2R45 A;  3NYF A;  4BK2 A;  3ALJ A;  2WU5 A;  3AEF A;  1CL0 A;  2YLZ A;  1NEK A;  4H7U A;  1RP0 A;  3FG2 P;  4RG3 A;  4EMJ A;  2XVJ A;  2NPX A;  2V3A A;  2XFP A;  3FIM B;  2EQ8 A;  1NHS A;  2EQ6 A;  1VG9 A;  1GPE A;  1FOH A;  2XVH A;  2C4C A;  4NWZ A;  1DJN A;  3R9U A;  1FEA A;  3V3O A;  2GH5 A;  2GAG B;  1PJ6 A;  1ZMC A;  4OPD A;  2BC0 A;  1MXT A;  4YTN A;  4C74 A;  3RP8 A;  1OJA A;  1NEN A;  2WOI A;  4J57 A;  3UKF A;  3LZX A;  3NHO X;  4GF7 A;  3P4Q A;  3LXD A;  2GVC A;  4B69 A;  1S3E A;  4H2N A;  4II3 A;  4Z2T A;  2FJA A;  3P4P A;  3KPF A;  3RP6 A;  1NHR A;  3NH3 X;  3SZF A;  5EOW A;  1B8S A;  2X99 A;  2A87 A;  2Y6Q A;  3AE1 A;  4IVM B;  1NHQ A;  1Z6L A;  2Q7V A;  4FK1 C;  4OPC A;  1S7M A;  1ZK7 A;  4A7A A;  4EM3 A;  2XYO A;  5EB5 A;  4GRT A;  1PXB A;  3JSK A;  4LU6 A;  4O5Q A;  4G6G A;  5KOW A;  1PBC A;  3ATQ A;  5TR3 A;  3AYL A;  2I0Z A;  5JCL A;  3DJG X;  3AE3 A;  3VRD B;  3UKK A;  1YQZ A;  3UKP A;  2R0G A;  2YG6 A;  2V3B A;  3CGB A;  3LB8 A;  5KVI A;  2DKH A;  1KSS A;  1Y56 B;  5KOX A;  3NNE A;  1H83 A;  3D1C A;  1K0J A;  4K7Z A;  2WEU A;  1DNC A;  5FS6 A;  1GRE A;  4X4J A;  2H88 A;  1TYT A;  3EAO A;  5J60 A;  1EBD A;  4DNA A;  1ZOY A;  2X8C A;  4G6H A;  4NEW A;  4G74 A;  4OPI A;  1MO9 A;  1KN0 A;  1ZX9 A;  4NTD A;  2BCP A;  3P4R A;  1CC2 A;  4UDP A;  3DJJ A;  4UDR A;  3SXI A;  2GMH A;  2YAU A;  4U8O A;  2GR2 A;  2V6O A;  3AWI A;  3HYV A;  1OJC A;  3LOV A;  2YVJ A;  1ELI A;  4A5L A;  3M13 A;  3GMB A;  1O5W A;  5C2T A;  3NK1 X;  4EQR A;  2C76 A;  2Y6R A;  1E1M A;  3DK4 A;  4J56 A;  1L9E A;  3C4N A;  4O5U A;  1BKW A;  1H81 A;  1XAN A;  1SEZ A;  3AEA A;  4H4Q A;  4OVI A;  5M0Z A;  5M10 A;  1BGN A;  5J7X A;  3EAN A;  3BHK A;  1COY A;  2WBA A;  4BV6 A;  4TM3 A;  1MOK A;  5BUK A;  3AE7 A;  2YG3 A;  4Z2R A;  4Z25 A;  3CTY A;  4TM4 A;  2YLW A;  1GET A;  1E1K A;  2X50 A;  1CC6 A;  1IJH A;  1D4E A;  2YLX A;  3DGH A;  3S61 A;  4D04 A;  5U63 A;  4H4W A;  3SYI A;  5KMS A;  1DOC A;  2YG7 A;  1CJ3 A;  1TDN A;  3H8L A;  4EMI A;  1S2Y A;  3AED A;  2B76 A;  5KVH A;  2V60 A;  1DJQ A;  3AEE A;  4A9W A;  3NK0 X;  2OLO A;  4Z43 A;  4HB9 A;  5U25 A;  3I6D A;  2R0C A;  2VOU A;  2A8X A;  2C67 A;  4H4R A;  3M12 A;  2A89 A;  3DGZ A;  3IC9 A;  3QFA A;  1PS9 A;  2C65 A;  1KNP A;  2OA1 A;  3PS9 A;  2RAB A;  3OC4 A;  1GOS A;  1D7Y A;  1UKV G;  1GRF A;  2C3C A;  3L1R A;  5IQ4 A;  3CND A;  3AEC A;  3PO7 A;  2YWL A;  1M6I A;  1E39 A;  1P2E A;  3NIX A;  1P2H A;  2C72 A;  3SZC A;  2XDO A;  2XLU A;  1K4Q A;  3T2Z A;  2YR6 A;  3SZ0 A;  2IVD A;  3RNM A;  4B64 A;  3V3N A;  3IHM A;  4A6N A;  2XFU A;  4D03 A;  2V61 A;  2GMJ A;  1GAL A;  3CGC A;  2GRT A;  3D8X A;  3KPK A;  1Y56 A;  2B9X A;  4J2W A;  3VRB A;  4EM4 A;  1D5T A;  2Q0L A;  3Q6J A;  4JY2 A;  2TMD A;  4ADW A;  2R4E A;  3AXB A;  1IUU A;  2BK3 A;  5EBK A;  1F3P A;  5GSN A;  2QAE A;  2C7G A;  2GV8 A;  5L46 A;  3T37 A;  4H2R A;  4I59 A;  4B68 A;  4H4Z A;  3QJ4 A;  4H50 A;  1BGJ A;  2B7R A;  4OPG A;  1F8W A;  2WDR A;  4DGK A;  4C3X A;  3NYC A;  4J36 A;  1LTX R;  2GQF A;  1JNR A;  3WE0 A;  1OJT A;  4BK3 A;  2AAQ A;  4YKF A;  2YLS A;  4EIP A;  4JN9 A;  3KLJ A;  2W0H A;  3GD3 A;  2B7S A;  4IA5 A;  4YTM A;  2X3N A;  3AE6 A;  3C4A A;  2WPF A;  3F8D A;  3NGC X;  3AEG A;  1Q1W A;  4OCG A;  2OAL A;  1Q9I A;  4Z24 A;  4YSH A;  2GR1 A;  3K7M X;  2V5Z A;  4REK A;  1IUW A;  4H4Y A;  3LAD A;  3E1T A;  2HQM A;  3DJE A;  1GRG A;  5HYM A;  1H84 A;  1ZY8 A;  2WP5 A;  4RG4 A;  1GND A;  2R46 A;  2PYX A;  3K7Q X;  1E6E A;  3ZDN A;  1TDO A;  3AD7 B;  4P9S A;  3QVR A;  2R0P A;  2FJB A;  4EMW A;  2JB3 A;  1JRX A;  1S2Q A;  5CQF A;  3AD9 B;  5CKU A;  2BRA A;  4APN A;  3EF6 A;  1KDG A;  5U1O A;  1CHU A;  1JRZ A;  1PBE A;  3FPZ A;  4B66 A;  3HZL A;  4CBQ A;  2XLP A;  1YQ4 A;  3FBS A;  4B67 A;  3CMM A;  3ITJ A;  4JNQ A;  4NNJ A;  2UZZ A;  2GR0 A;  3ICT A;  2GAH B;  2ACZ A;  1FEB A;  1VRQ B;  3ICR A;  4A79 A;  1GRB A;  1VDC A;  3RHA A;  1B37 A;  1H2I A;  5FS8 A;  2J3N A;  2YM2 A;  3K7T A;  1GRH A;  4ECH A;  1GSN A;  1GRT A;  4HA6 A;  4H4V A;  1BF3 A;  3HYX A;  1LPF A;  3CNS A;  2YM1 A;  3CPH G;  1ZOV A;  1PJ5 A;  4YKG A;  4YXD A;  3GRT A;  4Z2U A;  5KRQ A;  1E1N A;  2XLR A;  4CCR A;  3CIR A;  1TDF A;  1L9D A;  4BUR A;  1YY5 A;  2GR3 A;  4GAV A;  1PJ7 A;  2F5Z A;  2VRM A;  3UCL A;  1PBD A;  3P9U A;  4OPT A;  3GSI A;  5FS7 A;  4C5O A;  4JY3 A;  3UKA A;  1NG3 A;  4OPL A;  2VVL A;  2WHD A;  4Z26 A;  3NN0 X;  4AOS A;  2BS2 A;  3AB1 A;  2TPR A;  3I3L A;  1K0I A;  1FEC A;  4GDP A;  1JNZ A;  3T14 A;  3NKS A;  2H89 A;  4K22 A;  2XFO A;  4ZCC A;  2CDU A;  2BRY A;  3UOX A;  4PAB A;  2JBV A;  2RGJ A;  2XFN A;  2Q0K A;  4BJY A;  1N4V A;  4IVO B;  2JK6 A;  2VVL G;  4XWR A;  2GQW A;  2C73 A;  4U8M A;  5LV9 A;  3ABV A;  2FJD A;  2JB2 A;  1XPQ A;  2NVK X;  2BCG G;  5BRT A;  4YSY A;  2C64 A;  2WS3 A;  3KU9 A;  3GWF A;  2RGO A;  3GRS A;  3P4S A;  4X9N A;  3NLC A;  2CVJ A;  3GYX A;  1Y0P A;  3ALL A;  3ICS A;  1N4W A;  1XDI A;  1EL9 A;  4U8P A;  4YSZ A;  3T2K A;  2C70 A;  4J34 A;  3KKJ A;  4H4P A;  3ALM A;  2Z5Y A;  3CN8 A;  4IV9 A;  1H6V A;  5KWF A;  1ONF A;  2EQ9 A;  2WPC A;  1Q1R A;  5JCM A;  2ZZ0 A;  2R4J A;  2VRL A;  2ZZB A;  3AE8 A;  3GYI A;  3UP5 A;  5HXI A;  2B9W A;  2FJE A;  2XLS A;  1DOD A;  4NTE A;  4GUV A;  4I58 A;  4IA6 A;  3NTD A;  3QSE A;  4YT0 A;  3UKH A;  3VR8 A;  5FMH A;  3B3R A;  4H4T A;  4H4S A;  2CFY A;  1F8R A;  3GD4 A;  1O95 A;  3BI4 A;  4XWZ A;  3IHG A;  3F8P A;  2O9Z A;  2X8G A;  2VQ7 A;  4U2S A;  3SFE A;  4Z44 A;  5IPY A;  2YR5 A;  2BS4 A;  3AYI A;  3UOV A;  1ZMD A;  1D7L A;  3AE5 A;  5KMP A;  4U8N A;  4AOX A;  1PXC A;  4CCQ A;  3VRA A;  5KNL A;  3NRN A;  2WPE A;  3NTA A;  1JU2 A;  2OLN A;  1IUS A;  1DXL A;  4JQ9 A;  4TLZ A;  4UDQ A;  4AT2 A;  3NT6 A;  1H7X A;  3UTE A;  1N1P A;  4H2Q A;  3T31 A;  2E5V A;  1KFY A;  5ER0 A;  2R9Z A;  1BZL A;  3LZW A;  3QSM A;  1GTE A;  3QSS A;  2GEW A;  3P1W A;  3O0H A;  4GR1 A;  1TDE A;  2AR8 A;  1LJ1 A;  1HYU A;  4EQW A;  3CGE A;  2BXR A;  1OJD A;  2XLT A;  4PAA A;  1QLB A;  4EIQ A;  3ADA B;  4II2 A;  1GV4 A;  2OAM A;  2YR4 A;  1M64 A;  1ZP0 A;  4Y4L A;  5JCN A;  2BAC A;  4RSL A;  1PXA A;  4Y4N A;  3UOZ A;  2BS3 A;  1CJ4 A;  1ZKQ A;  1EL5 A;  1O94 A;  4YWO A;  3M0O A;  4CRT A;  4EQS A;  2VQB A;  3DME A;  4ICY A;  2BA9 A;  3CPJ G;  3NYE A;  3T2Y A;  2VVM A;  4U8J A;  3T0K A;  2WET A;  1GTH A;  1TRB A;  2BK5 A;  3SZW A;  4N9X A;  5HY5 A;  1PDH A;  4CNJ A;  2IVE A;  2BYB A;  3QFB A;  2XFQ A;  3QVP A;  2QA1 A;  3S5W A;  3II4 A;  4A65 A;  3PG6 A;  2YG4 A;  3H4K A;  3L8K A;  3UKL A;  4YSX A;  1FCD A;  2Z5X A;  1D4C A;  3CNP A;  4CY6 A;  4TM0 A;  1PBB A;  1KF6 A;  3FMW A;  1D4D A;  5BUL A;  1L0V A;  2E1M A;  4BK1 A;  4AP3 A;  1VQW A;  3COX A;  1GT8 A;  5EB4 A;  2PHH A;  1NDA A;  3CNJ A;  4JNA A;  5KXJ A;  3AD8 B;  1IUX A;  2GF3 A;  1GER A;  3URH A;  1QO8 A;  1S3B A;  2JB1 A;  2BAB A;  5IQ1 A;  4U8K A;  3B6D A;  3DK8 A;  1V59 A;  2YQU A;  4EQX A;  2C66 A;  2WU2 A;  2XVI A;  4E0V A;  2XCG A;  4ZN0 A;  5KMR A;  2BXS A;  1FL2 A;  4MJW A;  1GXF A;  1CJ2 A;  2DKI A;  2WP9 A;  2RGH A;  3C96 A;  1VG0 A;  5HHF A;  3KD9 A;  4BJZ A;  4OPU A;  3CGD A;  1RSG A;  2YG5 A;  3ZYX A;  1NPX A;  1GES A;  1XHC A;  2BC1 A;  4Y4M A;  4USQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...