4FDCB

Crystal structure of the e493v mutant of human apoptosis inducing factor (aif)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
483
structure length
461
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYVAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cowchock syndrome is associated with a mutation in apoptosis-inducing factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis, oxidoreductase
molecule keywords Apoptosis-inducing factor 1, mitochondrial
total genus 135
structure length 461
sequence length 483
ec nomenclature ec 1.-.-.-:
pdb deposition date 2012-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
B PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4fdcB03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fdcB02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fdcB01
1PJ5A 1YKJA 4TLXA 4X9MA 2BK3A 3VQRA 1MO9A 1OJAA 1PJ6A 4IVOB 1O5WA 2YR6A 5JCKA 1VQWA 3DMEA 4FDCB 1BGJA 1H82A 3RHAA 1FCDA 1EL7A 2IVEA 1JRYA 2C75A 1DXLA 2AR8A 1AOGA 1EL8A 3IHGA 2YG4A 2BXRA 1GRBA 3UKLA 1NEKA 4KX6A 4N9XA 1MOKA 1H6VA 3HZLA 2ARDA 5EB5A 2YQUA 3OC4A 4J33A 3K7TA 1NHRA 1CF3A 1H83A 2BK4A 4B69A 2W0HA 2YLZA 1Q1WA 1Y0PA 4ADWA 4GDPA 1TDEA 4C5OA 3LB8A 3NIXA 1KSSA 4IA6A 1PN0A 3CNJA 5GSNA 2RABA 4I59A 2BXSA 1S3EA 1CC4A 3FMWA 2WP6A 3NH3X 3OZ2A 4K22A 1W4XA 3DK8A 1KFYA 1CJ4A 3UKPA 2OLOA 2XFQA 4CNKA 4RSLA 5KVHA 4CCRA 1GT8A 2GH5A 3AD8B 1O95A 1EL9A 2C76A 1GRAA 4A65A 2Q6UA 4BJZA 2FJAA 3GYIA 5KVIA 3UOYA 2IIDA 1L0VA 2YLWA 4PABA 2XLRA 3NGCX 1V59A 3PO7A 1GSNA 4YSHA 2XVHA 2R46A 4XWZA 4AT0A 2WPCA 4B65A 3CPJG 3BHFA 1H86A 3NYFA 4EQSA 1K4QA 1PBBA 2O9ZA 5EBKA 2YAUA 3B6DA 3QFBA 2JKCA 4K5SA 1COYA 3E1TA 1JRZA 3NK2X 3L8KA 4U2SA 3R9UA 2V61A 3NTAA 4Y4LA 3V3NA 2VOUA 4BJYA 3GMCA 3M13A 4OCGA 1PJ7A 1JNZA 1GTEA 4OPUA 1TRBA 3CGEA 1MXTA 4B68A 4OPLA 3EPTA 3II4A 2WDQA 4O5QA 2BS2A 1BWCA 2WPFA 1DJQA 1ZDLA 1F6MA 4NTDA 4OPCA 3FBSA 1H84A 4XWRA 3K7QX 4H4XA 4CRTA 1PDHA 1IJHA 1BKWA 5HXIA 3NN6X 4HB9A 4U8OA 3ADAB 5EOWA 1NDAA 4AOXA 2BK5A 4ECHA 2VZ2A 2V3BA 3PVCA 4H4WA 2I0ZA 2E4GA 1F3PA 3VRAA 3DJGX 4BURA 2XFUA 4YXDA 1CJCA 1XPQA 3ALJA 4WX1A 4EM3A 3AE5A 3AXBA 4GUVA 1K0IA 3CIRA 2R0GA 2EQ6A 3D8XA 1LJ1A 2GMHA 3GWDA 4B63A 1E1NA 2GAGB 5FS7A 4BK1A 2R45A 4HA6A 1GERA 4KPRA 2BA9A 2V5ZA 1ELIA 3AWIA 4U8KA 1PHHA 2GRTA 4FK1C 2GV8A 3UP4A 3BNUA 2YWLA 4ZCCA 1RSGA 4RG3A 4X9NA 1YY5A 4B1BA 4Y4NA 1FL2A 1S3BA 2BACA 3ZYXA 1PBEA 4H4VA 3UCLA 2XLSA 2WDVA 3G5RA 4USRA 5C2TA 5M10A 3RP8A 1NENA 2YVFA 1YQ4A 3KD9A 1TYPA 1KNRA 2C70A 3G5SA 3GDNA 3NLCA 1XHCA 4EM4A 1QLBA 5CQFA 4H4YA 5JCLA 3GMBA 2WP5A 2B9WA 3ISHA 4ZCDA 2GAHB 4NTCA 4MJWA 2WDRA 4YWOA 4J57A 1N4UA 2YG6A 3NG7X 1LV0A 2WP9A 2V6OA 1P2EA 1YQ3A 3FIMB 2GQWA 4EMWA 3AE9A 4OPTA 1NHPA 2BC1A 4K8DA 2C66A 1ZY8A 5IQ4A 1D7YA 1D4DA 3CGDA 1K0JA 2XLUA 3M0OA 2WBAA 4NEWA 2YG5A 4YTPA 4K7ZA 1GV4A 3AE7A 4TLZA 4LIIA 1JU2A 1RYIA 4TM4A 4WCTA 3P1WA 3AE2A 3P9UA 4J31A 4C3XA 1IUWA 3EANA 2XVEA 1BGNA 3T37A 4H2RA 4NEVA 4YKFA 3CGCA 2WOVA 2QCUA 2CDUA 2BCPA 3M12A 1BF3A 1D5TA 2C72A 2XFNA 2ZBWA 4Z43A 4Z2TA 1QO8A 5KOXA 1OJCA 3UOZA 3CPHG 2V60A 4AP3A 3QJ4A 4X4JA 3DK9A 5FS8A 4EQWA 3AEFA 2YLSA 5LV9A 2RGJA 1H7XA 3SGLA 2GR1A 3Q9TA 2TMDA 2WESA 3BNMA 3UKHA 2X8HA 4ICYA 4EMIA 3F8PA 3LZWA 4H2PA 4NTEA 4YTNA 4Z2UA 1LTXR 4C77A 1KF6A 3QSEA 2EQ9A 3CNTA 4A99A 2R0PA 3G5QA 1JOAA 3LZXA 1H7WA 2QA1A 5FMHA 1E1KA 3ICTA 3QVPA 2RGHA 2B7RA 2XVFA 2J3NA 1GALA 4U8PA 1XANA 3UOXA 1CL0A 3GD4A 4C74A 4H50A 5BULA 3AE4A 5IPYA 5CKUA 4GR1A 3RNMA 4B66A 1M6IA 3ATQA 1K0LA 2APGA 2YLRA 2IVDA 4U8IA 1XDIA 3QFAA 4TM1A 4OPGA 2BYBA 3AEEA 5GRTA 3DGHA 1TDNA 2FJEA 3UTHA 4U8JA 3AD9B 1GNDA 2YG7A 2YVJA 3H8IA 3AYIA 4Z2RA 1F8RA 2OA1A 1DJNA 2R9ZA 4OPIA 4J56A 2Y6RA 4A6NB 5DBJA 2QAEA 3FPZA 3DH9A 3AE8A 3NK0X 4GF7A 3UOVA 3AE1A 1GRGA 1TDKA 2A87A 2VVLA 2XLPA 3B3RA 2TPRA 2WQYA 2Q0KA 3FG2P 3VR9A 3LOVA 4DSGA 2ACZA 1OJTA 2B9YA 1BZLA 4H4ZA 5U25A 2Q7VA 1GETA 4I58A 2H89A 2PHHA 2GQFA 2XVJA 1FEAA 3DGZA 1S2YA 5FS6A 3NNEA 4EQXA 1FOHA 1GESA 2B9XA 4OPDA 3AEAA 1GRHA 3SQPA 3C4NA 1TYTA 2X8CA 4H4UA 1Y56A 3K30A 1F8SA 3I6DA 3P4SA 1PBFA 4EIPA 1B37A 3AEDA 3UKQA 1P2HA 1IUXA 3SFEA 4BV6A 3P4PA 1OJ9A 3GYJA 2X3NA 1OJDA 3NHOX 4GDEA 4OVIA 4E0VA 1JNRA 3AE6A 3KPFA 4ZN0A 1LQUA 2C65A 5JCMA 4A9WA 1L9DA 1ZX9A 4IVMB 3AEGA 3EAOA 2JAEA 3QSMA 2GR0A 2FJDA 4AT2A 3IHMA 3QVRA 1DNCA 1REOA 1S2QA 3LJPA 4JY3A 4TM3A 1H81A 4PAAA 4APNA 3GRSA 2Y6QA 3GD3A 3BI2A 3KKJA 2ZZCA 3CN8A 4D03A 1F8WA 3D1CA 3GDPA 1E7PA 3REDA 1E1MA 5M0ZA 3K7MX 4YSZA 1O94A 1N4VA 1ONFA 3AYLA 1DODA 1JRXA 1KSUA 1L9CA 2C7GA 3ITJA 3L1RA 3DK4A 2NVKX 1IUTA 3H4KA 4A79A 3GSIA 1FEBA 2GEWA 2YLXA 2A8XA 2XFPA 2FJBA 3ALMA 1TDFA 2WU5A 2WEUA 3CNSA 4USQA 4XXGA 2UZZA 1HYUA 3UTGA 3BI4A 2R4EA 1NPXA 2CFYA 3UP5A 1B8SA 3IWAA 2BABA 4RG4A 3LXDA 2XDOA 4IV9A 4A5LA 2B7SA 4UP3A 5U63A 4AP1A 1PBDA 4YSYA 3NYEA 1NG4A 2WETA 2ZZ0A 2H88A 1JEHA 2GF3A 4U8LA 2BCGG 4JN9A 3ABVA 2WPEA 1PS9A 2E5VA 1EBDA 2CVJA 3S61A 2WS3A 5KWFA 2A89A 3Q6JA 2JBVA 2QA2A 4BK2A 1D4CA 4LA1A 1KDGA 3C4AA 4BK3A 1PBCA 3DA1A 4CCQA 1GOSA 4JDRA 2FBWA 3KVEA 5FS9A 1LQTA 4REKA 5HY5A 2DKHA 1X31B 2F5ZA 4TM0A 2C64A 1M64A 4B64A 1GXFA 2Z5XA 2YM2A 1CJ2A 3UKAA 2C67A 3I3LA 4YTMA 5BUKA 2NPXA 2B76A 3GRTA 2Z5YA 1ZOYA 2GVCA 4IA5A 1DOCA 2RGOA 2WOIA 2E1MA 4U2TA 1RP0A 4DNAA 1CC2A 2OALA 2V3AA 4YSXA 2GR3A 1GTHA 1ZMDA 5J7XA 3V76A 4EMJA 2XLTA 3UTFA 3ICSA 3F8RA 2XVIA 4DSHA 3IC9A 1CC6A 2PYXA 1DOBA 2X50A 1N4WA 1Z6LA 3IF9A 4GCMA 2YR4A 3P4RA 2VQBA 2R0CA 3P4QA 2JB3A 2XYOA 1GEUA 4UDPA 4H4SA 2JB2A 3AB1A 3CPIG 3NN0X 5BRTA 5J60A 4K2XA 1NHQA 2CULA 4U2LA 5L46A 3VRDB 2OLNA 2EQ7A 1VDCA 1ZP0A 3UKFA 4A6NA 3ICRA 5HYMA 2WU2A 5EB4A 4J34A 5HHFA 3KLJA 3CTYA 3AD7B 4H4TA 4JNAA 4Z25A 1VRQB 4H2NA 2DKIA 3NYCA 2GB0A 2C73A 4H4PA 1GRFA 2EQ8A 1IUSA 3NK1X 1GRTA 1PXAA 2Q0LA 1YQZA 3PS9A 3DJJA 1DOEA 1TDOA 1VG0A 3WE0A 3AE3A 1N1PA 1B5QA 2C3DA 3EF6A 4YT0A 5KRQA 2YVGA 3O0HA 3RP7A 2AAQA 2VVLG 4JQ9A 1QJDA 3H8LA 3JSKA 1ZMCA 1NG3A 3AECA 1LVLA 4AOSA 4J36A 2BS3A 3NKSA 1CHUA 4A7AA 1ZKQA 1IUVA 4O5UA 4Z44A 3UTEA 2VVMA 3S5WA 1PXBA 2GR2A 2WHDA 4CBQA 1PXCA 3DJDA 3V3OA 4H4RA 1GPEA 4FK1A 3URHA 2VRMA 3NT6A 3AEBA 4J2WA 4D04A 2YLTA 4UDRA 4Y4MA 5BVAA 4M52A 3CGBA 1UKVG 3CNPA 4Z24A 4B67A 1GREA 3GWFA 4YKGA 2BS4A 1D7LA 3DJEA 1VG9A 1ZK7A 2OAMA 1Q1RA 5JCIA 2YR5A 2VQ7A 2XCGA 4NZHA 5ER0A 2AQJA 1E39A 1IUUA 5KOWA 2R4JA 3QSSA 2YM1A 4UDQA 4EQRA 1SEZA 5TR3A 3ALLA 4LU6A 1CJ3A 2XFOA 4FX9A 3KA7A 4JNQA 4JY2A 4U8MA 1NHSA 1EL5A 2YG3A 4C3YA 3VRBA 4CY6A 1E6EA 3F8DA 4U8NA 2ZZBA 3C96A 2C3CA 2BC0A 3VR8A 4CY8A 5U1OA 2VRLA 2JK6A 1L9EA 4H2QA 2GMJA 3UKKA 3BI5A 3SFDA 4H7UA 2WOWA 3ZDNA 5C3JA 4K5RA 5KXJA 3NTDA 4Z26A 2X8GA 1CBOA 1D4EA 3LADA 1FECA 1KNPA 3BHKA 1B4VA 3RP6A 3SM8A 3CNDA 4EIQA 1Q9IA 1NAAA 3ATRA 5JCNA 2JB1A 4P9SA 3NRNA 1LPFA 1ZOVA 3KU9A 4H4QA 4DGKA 4GRTA 2HQMA 1E1LA 1Y56B 3COXA 3AYJA 5IQ1A 4CNJA 2X99A
chains in the Genus database with same CATH superfamily
1YKJA 3VQRA 4TLXA 2YR6A 1DTNA 1H82A 3ES7A 2IVEA 1EL7A 1EL8A 1GRBA 1ZXIC 5EB5A 3K1GA 2YQUA 3K7TA 1Y0PA 4ADWA 4GDPA 1YEYA 3PK7A 1KSSA 3D9XA 1CC4A 3SR6B 4CNKA 2XFQA 4RSLA 1O95A 3CXBA 1GRAA 5KVIA 3UOYA 3L5OA 2IIDA 2BRAA 3PO7A 2ZADA 2XVHA 4XWZA 3CPJG 3BHFA 5BOEA 2YAUA 3QFBA 1COYA 3E1TA 3CT2A 4GAVA 1GTEA 1N5XA 2XH4A 3CGEA 2O56A 2WDQA 4O5QA 1DJQA 2WPFA 1ZDLA 4NTDA 4OPCA 1H84A 4XWRA 3K7QX 1PDHA 1IJHA 4ENLA 2V3BA 3PVCA 4K8GA 2I0ZA 3DJGX 1IYXA 1L8PA 3S5SA 4H2HA 4WX1A 4EM3A 3AXBA 4GUVA 3S47A 2R0GA 3H7VA 1E1NA 1E9IA 3GO2A 2BA9A 1ELIA 1PHHA 2GRTA 3UP4A 3BNUA 4X9NA 1YY5A 1WUEA 3ENLA 1FL2A 1S3BA 2BACA 1PBEA 4ZA0A 5C2TA 4USRA 1NENA 2YVFA 1YQ4A 1KNRA 2C70A 1XHCA 2B9WA 3ISHA 2GAHB 2PPGA 3NG7X 2GGIA 2WP9A 2V6OA 1EBGA 4EMWA 3AE9A 4OPTA 3RCYA 3SXIA 1NHPA 2BC1A 3EEZA 1FIQB 3T31A 5G5GB 4II3A 2WBAA 2OVLA 1JPMA 2YG5A 3DERA 1GV4A 4TLZA 1JU2A 3DG3A 2HZGA 3P1WA 3P9UA 4J31A 1BGNA 4NEVA 3DEQA 2BCPA 3M12A 1BF3A 4Z2TA 1OJCA 3PFRA 3PWIA 4FP1A 5FS8A 2YLSA 4JN7A 2TMDA 2AL2A 4ICYA 3B9JB 4H2PA 4NTEA 5KMSA 4DN1A 2EQ9A 2W3RA 5FMHA 3SX6A 3QVPA 3NVYB 2XVFA 2W54A 1GALA 4U8PA 5BULA 3AE4A 4GR1A 3RNMA 2GDQA 4TM1A 2BYBA 5GRTA 3UTHA 4U8JA 2YVJA 3AYIA 3ZLGA 4OPIA 2P8BA 4MGGA 3UXLA 2BRYA 4GF7A 3UOVA 3AE1A 1TDKA 3B3RA 2TPRA 3I4KA 5BOFA 2WQYA 3LOVA 4DSGA 2B9YA 2Q7VA 2QJJA 2XVJA 1FEAA 3MWCA 1FOHA 1GESA 4GGHA 1TYTA 1JRPA 4G74A 2NQLA 2PTXA 3K30A 4EIPA 4HNLA 1OJ9A 3NHOX 1OJDA 2QGYA 4GDEA 3AE6A 3IJIA 3MY9A 3SN0A 1L9DA 3SZCA 4DXKA 4E4FA 3NS1B 2GR0A 4AT2A 3IHMA 1DNCA 1REOA 1S2QA 3LJPA 4TM3A 4APNA 3GD3A 3QTPA 3KKJA 3SZ0A 4D03A 3D1CA 3UCDA 4MMWA 2AKZA 5M0ZA 2CHRA 3OTRA 4YSZA 1N4VA 1KSUA 2C7GA 3DK4A 4A79A 3T2YA 2POZA 3GSIA 1FEBA 1FHVA 1S7MA 2XFPA 4X2PA 1TDFA 3CYJA 4USQA 4H1ZA 2PU1A 5U63A 2P88A 2WETA 1JEHA 4U8LA 2BCGG 2WPEA 1PS9A 3S61A 5KWFA 4LA1A 1PDYA 5FS9A 1LQTA 4TM0A 1M64A 1GXFA 2YM2A 1CJ2A 2C67A 4YTMA 3GRTA 2I5QA 4U2TA 2E1MA 1RP0A 1CC2A 2V3AA 3I6EA 3V76A 3UTFA 3ICSA 1KCZA 2PYXA 2X50A 1Z6LA 2FKPA 3H12A 2VQBA 2R0CA 3P3BA 1GEUA 2JB2A 3CPIG 4K2XA 2CULA 2GGHA 2OLNA 4A6NA 3ICRA 5HYMA 5KMRA 4G73A 3NXLA 3AD7B 4Z25A 4GYPC 4H4PA 2C73A 1GRFA 1TKKA 1WYGA 1IUSA 3RITA 1YQZA 3PWGA 4E6MA 2OQHA 1N1PA 2C3DA 3EF6A 4YT0A 3O0HA 3JSKA 3KPKA 3ZVIA 1CHUA 3U9IA 4CBQA 3V3OA 3FXGA 1GPEA 2PP1A 1FFVC 4J2WA 4D04A 5BVAA 1GREA 4HN8A 2BS4A 3DDMA 1VG9A 3SN4A 3SJNA 5JCIA 4NZHA 2DW7A 1E39A 3PG6A 2R4JA 3QSSA 1CJ3A 3KA7A 4U8MA 4C3YA 3VRBA 3VR8A 5U1OA 3QKEA 2JK6A 4H2QA 1R0MA 2GMJA 3UKKA 1BQGA 4H7UA 3ZDNA 2OPJA 3NTDA 2PTWA 1CBOA 1D4EA 3LADA 1FECA 2PGEA 1B4VA 1W6TA 3CNDA 1Q9IA 5JCNA 2JB1A 3NRNA 1LPFA 1ZOVA 2HQMA 2MNRA 1E1LA 3R10A 3QN3A 3STPA 1SB3B 1PJ5A 4IHCA 3V4BA 2OFJA 1O5WA 3DMEA 4NWZA 1N62C 2HXTA 1DXLA 2AR8A 4ZCWA 3UKLA 3HZLA 2PA6A 4J33A 3D47A 1V97A 1Q1WA 1TDEA 4C5OA 4IA6A 2P8CA 3CNJA 3HW2A 4GAPA 3NH3X 3HPFA 1SJBA 3OZ2A 4M6UA 3DK8A 4F4RA 1KFYA 1CJ4A 3UKPA 3UXKA 5KVHA 1GT8A 2GH5A 3NVVB 3CB3A 4A65A 2YLWA 4AT0A 4B65A 1KKOA 2O9ZA 4IT1A 5EBKA 1JRZA 2V61A 3NTAA 3V3NA 2VOUA 4BJYA 3UJRA 3GMCA 3I6TA 2QDDA 1X2GA 2QDEA 1TRBA 3FBSA 4H4XA 5HXIA 4U8OA 4AOXA 1NDAA 4ECHA 4NNJA 3V5CA 4H4WA 2E4GA 4BURA 4YXDA 3AE5A 3CIRA 2EQ6A 3D8XA 1LJ1A 2GMHA 4BK1A 2V5ZA 4U8KA 4FK1C 4RG3A 2AL2B 4B1BA 4Y4NA 2XLSA 2XSXA 3G5RA 5M10A 3KD9A 1TYPA 2QJMA 3G5SA 1NU5A 4H4YA 4NTCA 4JN8A 2WDRA 3NVZB 2YG6A 4II2A 1P2EA 1YQ3A 3FIMB 3FV9A 3Q45A 3SQSA 3ZVHB 1ZY8A 2AKMA 3T8QA 2XLUA 4K7ZA 1RYIA 3MUCA 1IUWA 3IK4A 2CDUA 4GGBA 3NFUA 2C72A 2XFNA 5FJOA 3UOZA 3BSMA 3Q4DA 4AP3A 3QJ4A 4EWJA 4X4JA 4EQWA 4TVYA 3Q9TA 3BNMA 2X8HA 4EMIA 3OW1A 2MUCA 4Z2UA 1SJAA 1LTXR 4C77A 3QSEA 4A99A 3G5QA 3LZXA 1H7WA 2QA1A 1E1KA 3ICTA 2RGHA 1OEPA 2J3NA 4DX3A 3GD4A 4G7FA 5IPYA 5ENLA 4B66A 1M6IA 2IVDA 2C4CA 3AEEA 3AD9B 1GNDA 2OA1A 2R9ZA 2Y6RA 4A6NB 3FPZA 3AE8A 1GRGA 2A87A 2VVLA 3T2KA 3FG2P 3VR9A 2PHHA 2GQFA 4EQXA 2B9XA 3SQPA 4HNCA 5KNLA 4H4UA 1Y56A 1PBFA 3UGVA 4H19A 3GYJA 2X3NA 3FJ4A 3ZVHA 3V3WA 1ONEA 4OVIA 4E0VA 4ZN0A 3HRDC 1ZX9A 1H81A 3VCCA 3GDPA 3REDA 4HCDA 1O94A 1ONFA 2QJNA 3AYLA 1JRXA 2A8XA 2WU5A 3CNSA 2UZZA 1HYUA 2R4EA 1NPXA 2CFYA 3IWAA 4AP1A 2GGJA 2B7SA 2PSNA 1XPYA 3B97A 3BJSA 2OG9A 2GF3A 2ZC8A 3D46A 2CVJA 3T14A 2WS3A 2A89A 2QA2A 2JBVA 4BK2A 4HCHA 3C4AA 1PBCA 2FBWA 3KVEA 1N60C 2DKHA 1X31B 4IL2A 4J3ZA 2Z5XA 3I3LA 3VFCA 2NPXA 2B76A 2GVCA 4IA5A 3QLDA 4Z1YA 2OALA 3JZUA 2GL5A 3P93A 4EMJA 3T2ZA 4DSHA 3DGBA 3CMMA 1N4WA 5EU9A 5JRBA 2YR4A 3P4RA 3P4QA 3N4EA 4UDPA 3TTEA 1NHQA 3VC5A 4U2LA 2AL1A 1VDCA 2WU2A 4J34A 3KLJA 4H2NA 3NYCA 4HCLA 2P3ZA 3DJJA 1TDOA 3WE0A 4HYRA 5KRQA 4JQ9A 1SJDA 1ZMCA 4IP5A 4J36A 3JVAA 1IUVA 3VDGA 7ENLA 4Z44A 1KKRA 3S5WA 2GR2A 4FK1A 3URHA 3NT6A 3AEBA 4UDRA 4M52A 3MQTA 3GWFA 2OAMA 2PS2A 2XCGA 2PP0A 2AQJA 4EQRA 4LU6A 3GD6A 4YWSA 2XFOA 3R0KA 4CY6A 3TOYA 4U8NA 2ZZBA 5G5HB 2C3CA 3C96A 2VRLA 3U4FA 2E5AA 3BI5A 4Z26A 1N61C 3BOXA 3RP6A 3SM8A 3BHKA 4G6HA 4EIQA 1NAAA 3ATRA 4P9SA 3KU9A 4H4QA 4GRTA 3DFYA 1T3QC 5IQ1A 2X99A 4X9MA 2BK3A 1MO9A 1OJAA 1JDFA 1PJ6A 5JCKA 1VQWA 4FDCB 1BGJA 1FCDA 2C75A 1P48A 4KX6A 3TJ4A 4N9XA 1MOKA 1H6VA 3OC4A 1NHRA 1CF3A 1H83A 1TE6A 2BK4A 4B69A 2YLZA 4MKSA 2GSHA 5FJUA 2BXSA 3FMWA 1W4XA 3VC6A 5KMPA 3AD8B 1EL9A 2FJAA 4HPNA 2XLRA 1V59A 1GSNA 4YSHA 2R46A 2WPCA 4EQSA 2JKCA 4K5SA 4U2SA 4Y4LA 4OCGA 1PJ7A 1JNZA 4B68A 1ELSA 4Z17A 1F6MA 2PODA 2P0IA 3NN6X 4HB9A 3ADAB 2BK5A 3VRAA 3QPEA 1CJCA 3SBFA 4B63A 2R45A 4HA6A 4KPRA 2PMQA 3AWIA 3RRAA 3ETRB 2YWLA 4ZCCA 1RSGA 3UCLA 2WDVA 3RP8A 3UJ2A 3NLCA 1QLBA 4EM4A 4G8TA 1RVKA 3R0UA 4ZCDA 4MJWA 1N4UA 2GQWA 3SZFA 3R07C 2C66A 5IQ4A 1K0JA 3CGDA 3M0OA 3ES8A 4NEWA 5J04A 4LIIA 4TM4A 3AE2A 3H8AA 4C3XA 3GY1A 3EANA 3N6HA 2XVEA 2QVHA 3T37A 4H2RA 3CGCA 2WOVA 2QCUA 2PP3A 1QO8A 5KOXA 3CPHG 2V60A 1PDZA 3AEFA 2RGJA 1H7XA 2GR1A 3LZWA 1KF6A 1JOAA 3TJIA 3SYIA 3UOXA 1CL0A 4C74A 4H50A 4E5TA 5CKUA 3ATQA 1K0LA 4U8IA 3QFAA 4OPGA 1TDNA 3H8IA 1F8RA 1ECQA 2QAEA 3DH9A 3NK0X 2XLPA 2QQ6A 3THUA 2ACZA 1BZLA 4H4ZA 1GETA 4I58A 3EKGA 2H89A 1EBHA 5FS6A 3NNEA 1GRHA 3C4NA 1F8SA 3I6DA 3P4SA 2XGZA 1P2HA 3TWAA 4TVWA 4GIRA 1P43A 4IVMB 2JAEA 3QSMA 2FJDA 4PAAA 3N6JA 1E7PA 1E1MA 3SY4A 3L1RA 1L9CA 2NVKX 1IUTA 6ENLA 4A35A 5KMQA 2GEWA 2YLXA 2FJBA 3ALMA 1JPDX 1TZZA 1EC9A 4XXGA 3BI4A 3UP5A 3LXDA 1MDRA 3VCNA 4YSYA 1NELA 1NG4A 2H88A 1N63C 4JN9A 1EC8A 2E5VA 4M0XA 3Q6JA 1D4CA 3T9PA 3UJFA 1KDGA 4BK3A 3UCCA 4E8GA 2PTZA 4REKA 5HY5A 1KN0A 4IL0A 2F5ZA 2C64A 3MSYA 3NRZB 5BUKA 2Z5YA 1ZOYA 3FYYA 3TQPA 1GTHA 1ZMDA 4J1OA 1MDLA 3R25A 3F8RA 2XVIA 1DOBA 3IF9A 5BRTA 2XH2A 3VRDB 2EQ7A 5HHFA 3CTYA 1VRQB 2GB0A 2EQ8A 4K2SA 1GRTA 1PXAA 2Q0LA 3PS9A 1VG0A 3AE3A 3SSZA 3V5FA 3SN1A 1LVLA 3NKSA 3P0WA 4A7AA 3UTEA 2VVMA 1PXBA 1PXCA 3GC2A 4KT2A 2VRMA 1MUCA 2YLTA 4Y4MA 1BKHA 3CGBA 4Z24A 1JROA 4YKGA 3A7UA 1D7LA 1ZK7A 1JCTA 2YR5A 2DW6A 2VQ7A 5ER0A 3R1ZA 4UDQA 1SEZA 1STZA 5FJPA 4JY2A 1NHSA 1EL5A 3F8DA 3JW7A 3HYVA 5KXJA 4K5RA 4DGKA 4KWSA 4ROPA 3COXA 3AYJA 4IVOB 3H70A 3RHAA 3IHGA 1JRYA 1AOGA 2YG4A 2BXRA 1NEKA 3DIPA 3DFHA 2ARDA 5FJRA 3NO1A 4DWDA 2W0HA 3LB8A 3NIXA 4GFIA 1PN0A 1R6WA 5GSNA 2RABA 4I59A 1S3EA 2WP6A 4K22A 3AN1A 2W55A 2OLOA 4FI4A 4CCRA 2C76A 2PU0A 4H83A 1VQZA 2Q6UA 4BJZA 3DESA 3GYIA 1L0VA 3MKCA 4PABA 3NGCX 3R11A 2PGWA 1H86A 3NYFA 1K4QA 1PBBA 3B6DA 3DG7A 3SZWA 3NK2X 3L8KA 3R9UA 3M13A 4OPUA 1MXTA 1SJCA 4OPLA 3EPTA 3II4A 2BS2A 1BWCA 3UJEA 4A3RA 4CRTA 1BKWA 5EOWA 2VZ2A 1F3PA 2OKTA 2XFUA 1XPQA 3OZYA 3ALJA 1K0IA 2OLAA 3GWDA 2GAGB 5FS7A 3TW9A 2ONEA 1GERA 4DYEA 1X2HA 1FFUC 2GV8A 2W3SA 2RDXA 3ZYXA 4H4VA 3NZGA 3GDNA 5CQFA 5JCLA 3GMBA 2WP5A 3A7RA 3TWBA 4YWOA 4J57A 1LV0A 4GISA 4K8DA 3CAWA 1D7YA 1D4DA 4YTPA 3AE7A 4WCTA 2FYMA 3N4FA 4YKFA 1D5TA 2ZBWA 4Z43A 4KPLA 1N5WC 3DK9A 5LV9A 3SGLA 1MRAA 2WESA 3UKHA 3F8PA 4YTNA 3CNTA 2R0PA 4GYPA 3RO6A 2B7RA 3FVDA 1XANA 2HXUA 3KUMA 1EC7A 2APGA 2YLRA 1XDIA 1RM6B 2OZ8A 3DGHA 2FJEA 2YG7A 4Z2RA 2XH0A 3RR1A 3IJQA 1DJNA 4J56A 3AMZA 5DBJA 2Q0KA 1OJTA 3T0KA 5U25A 4G6GA 3CXOA 3DGZA 1S2YA 1FO4A 4OPDA 3AEAA 3OZMA 5IDZA 2X8CA 2OQYA 4K1WA 1B37A 3AEDA 3UKQA 1IUXA 3SFEA 4BV6A 3P4PA 3HYWA 3GYXA 1JNRA 3KPFA 1LQUA 2C65A 5JCMA 4A9WA 3AEGA 3EAOA 3VA8A 3OPSA 3QVRA 2OX4A 4JY3A 5FJTA 3GRSA 2Y6QA 3BI2A 2ZZCA 3TCSA 3CN8A 1F8WA 1H2IA 4GMEA 3K7MX 1DODA 3ITJA 3H4KA 2WEUA 3UTGA 1B8SA 2BABA 4RG4A 2XDOA 4DHGA 4IV9A 4UP3A 4A5LA 1PBDA 3NYEA 3FCPA 2ZZ0A 3ABVA 3HYXA 4JHMA 4ZOHB 1EBDA 3RGTA 4CCQA 2GGEA 3DA1A 1GOSA 4JDRA 1WUFA 4B64A 1VDVA 1FHUA 3UKAA 1DOCA 3DG6A 2WOIA 2GGGA 2RGOA 4DNAA 4YSXA 2GR3A 1MNSA 5J7XA 2XLTA 1XS2A 3IC9A 1CC6A 4GCMA 2JB3A 2XYOA 2E3TA 4H4SA 3AB1A 3NN0X 5J60A 2PTYA 5L46A 3A7AA 4KEMA 2HNEA 1ZP0A 3UKFA 5EB4A 4H4TA 4JNAA 3UJSA 3NVWB 2DKIA 3OP2A 2OZ3A 3NK1X 3T6CA 1DOEA 3ZLFA 1B5QA 2YVGA 3RP7A 2AAQA 2VVLG 1QJDA 3H8LA 1NG3A 3AM9A 3AECA 4AOSA 3CK5A 2BS3A 4IP4A 1ZKQA 4A6GA 4O5UA 2WHDA 3DJDA 2OZTA 3MZNA 4H4RA 3IJLA 1UKVG 3CNPA 1KD0A 4B67A 3EUB3 2OO6A 3DJEA 1Q1RA 1IUUA 5KOWA 2YM1A 3ALLA 5TR3A 2XH7A 4FX9A 4JNQA 1F9CA 2YG3A 3T4WA 1E6EA 4IZGA 2BC0A 4CY8A 1L9EA 4E4UA 3SFDA 2WOWA 5C3JA 3ZLHA 4G9KA 2X8GA 1KNPA 2PCEA 1Y56B 4CNJA
chains in the Genus database with same CATH topology
1PJ5A 1YKJA 4TLXA 4X9MA 2BK3A 3VQRA 1MO9A 1OJAA 1PJ6A 4IVOB 1O5WA 2YR6A 5JCKA 1VQWA 3DMEA 4NWZA 4FDCB 1BGJA 1H82A 3RHAA 1FCDA 1EL7A 2IVEA 1JRYA 2C75A 1DXLA 2AR8A 1AOGA 1EL8A 3IHGA 2YG4A 2BXRA 1GRBA 3UKLA 1NEKA 4KX6A 4N9XA 1MOKA 1H6VA 3HZLA 2ARDA 5EB5A 2YQUA 3OC4A 4J33A 3K7TA 1NHRA 1CF3A 1H83A 2BK4A 4B69A 2W0HA 2YLZA 1Q1WA 1Y0PA 4ADWA 4GDPA 1TDEA 4C5OA 3LB8A 3NIXA 1KSSA 4IA6A 1PN0A 3CNJA 5GSNA 2RABA 4I59A 2BXSA 1S3EA 3D9XA 1CC4A 4GAPA 3FMWA 2WP6A 3NH3X 3OZ2A 4K22A 1W4XA 3DK8A 1KFYA 1CJ4A 3UKPA 2OLOA 2XFQA 4CNKA 4RSLA 5KMPA 5KVHA 4CCRA 1GT8A 2GH5A 3AD8B 1O95A 1EL9A 2C76A 1GRAA 4A65A 2Q6UA 4BJZA 2FJAA 3GYIA 5KVIA 3UOYA 3L5OA 2IIDA 1L0VA 2BRAA 2YLWA 4PABA 2XLRA 3NGCX 1V59A 3PO7A 1GSNA 4YSHA 2XVHA 2R46A 4XWZA 4AT0A 2WPCA 4B65A 3CPJG 3BHFA 1H86A 3NYFA 4EQSA 1K4QA 1PBBA 2O9ZA 5EBKA 2YAUA 3B6DA 3QFBA 2JKCA 4K5SA 1COYA 3SZWA 3E1TA 1JRZA 3NK2X 3L8KA 4U2SA 3R9UA 2V61A 3NTAA 4Y4LA 3V3NA 2VOUA 4BJYA 3GMCA 3M13A 4GAVA 1PJ7A 1JNZA 1GTEA 4OCGA 4OPUA 1TRBA 3CGEA 1MXTA 4B68A 4OPLA 3EPTA 3II4A 2WDQA 4O5QA 2BS2A 1BWCA 2WPFA 1DJQA 1ZDLA 1F6MA 4NTDA 4OPCA 3FBSA 1H84A 4XWRA 3K7QX 4H4XA 4CRTA 1PDHA 1IJHA 1BKWA 5HXIA 3NN6X 4HB9A 4U8OA 3ADAB 5EOWA 1NDAA 4AOXA 2BK5A 4ECHA 2VZ2A 4NNJA 2V3BA 3PVCA 4H4WA 2I0ZA 2E4GA 1F3PA 3VRAA 3DJGX 4BURA 2XFUA 4YXDA 1CJCA 1XPQA 3ALJA 4WX1A 4EM3A 3AE5A 3AXBA 4GUVA 1K0IA 3CIRA 2R0GA 2EQ6A 3D8XA 1LJ1A 2GMHA 3GWDA 4B63A 1E1NA 2GAGB 5FS7A 4BK1A 2R45A 4HA6A 1GERA 4KPRA 2BA9A 2V5ZA 1ELIA 3AWIA 4U8KA 1PHHA 2GRTA 4FK1C 2GV8A 3UP4A 3BNUA 2YWLA 4ZCCA 1RSGA 4RG3A 4X9NA 1YY5A 4B1BA 4Y4NA 1FL2A 1S3BA 2BACA 3ZYXA 1PBEA 4H4VA 3UCLA 2XLSA 2WDVA 3G5RA 4USRA 5C2TA 5M10A 3RP8A 1NENA 2YVFA 1YQ4A 3KD9A 1TYPA 1KNRA 2C70A 3G5SA 3GDNA 3NLCA 1XHCA 4EM4A 1QLBA 5CQFA 4H4YA 5JCLA 3GMBA 2WP5A 2B9WA 3ISHA 4ZCDA 2GAHB 4NTCA 4MJWA 2WDRA 4YWOA 4J57A 1N4UA 2YG6A 3NG7X 4II2A 1LV0A 2WP9A 2V6OA 1P2EA 1YQ3A 3FIMB 2GQWA 4EMWA 3AE9A 4OPTA 3SXIA 3SZFA 1NHPA 2BC1A 4K8DA 2C66A 3T31A 1ZY8A 5IQ4A 1D7YA 1D4DA 3CGDA 1K0JA 2XLUA 3M0OA 4II3A 2WBAA 4NEWA 2YG5A 4YTPA 4K7ZA 1GV4A 3AE7A 4TLZA 4LIIA 1JU2A 1RYIA 4TM4A 4WCTA 3P1WA 3AE2A 3P9UA 4J31A 4C3XA 1IUWA 3EANA 2XVEA 1BGNA 3T37A 4H2RA 4NEVA 4YKFA 3CGCA 2WOVA 2QCUA 2CDUA 2BCPA 3M12A 1BF3A 1D5TA 2C72A 2XFNA 2ZBWA 4Z43A 4Z2TA 1QO8A 5KOXA 1OJCA 3UOZA 3CPHG 2V60A 4AP3A 3QJ4A 4X4JA 3DK9A 5FS8A 4EQWA 3AEFA 2YLSA 5LV9A 2RGJA 1H7XA 3SGLA 2GR1A 3Q9TA 2TMDA 2WESA 3BNMA 3UKHA 2X8HA 4ICYA 4EMIA 3F8PA 3LZWA 4H2PA 4NTEA 4YTNA 5KMSA 4Z2UA 1LTXR 4C77A 1KF6A 3QSEA 2EQ9A 3CNTA 4A99A 2R0PA 3G5QA 1JOAA 3LZXA 1H7WA 2QA1A 5FMHA 1E1KA 3SX6A 3ICTA 3QVPA 2RGHA 2B7RA 2XVFA 2J3NA 1GALA 4U8PA 1XANA 3SYIA 3UOXA 1CL0A 3GD4A 4C74A 4H50A 5BULA 3AE4A 5IPYA 5CKUA 4GR1A 3RNMA 4B66A 1M6IA 3ATQA 1K0LA 2APGA 2YLRA 2IVDA 4U8IA 1XDIA 3QFAA 2C4CA 4TM1A 4OPGA 2BYBA 3AEEA 5GRTA 3DGHA 1TDNA 2FJEA 3UTHA 4U8JA 3AD9B 1GNDA 2YG7A 2YVJA 3H8IA 3AYIA 4Z2RA 1F8RA 2OA1A 1DJNA 2R9ZA 4OPIA 4J56A 2Y6RA 4A6NB 2BRYA 2QAEA 3FPZA 3DH9A 3AE8A 3NK0X 5DBJA 4GF7A 3UOVA 3AE1A 1GRGA 1TDKA 2A87A 2VVLA 2XLPA 3B3RA 2TPRA 2WQYA 2Q0KA 3T2KA 3FG2P 3VR9A 3LOVA 4DSGA 2ACZA 1OJTA 2B9YA 1BZLA 4H4ZA 5U25A 2Q7VA 4G6GA 1GETA 4I58A 3T0KA 2H89A 2PHHA 2GQFA 2XVJA 1FEAA 3DGZA 1S2YA 5FS6A 3NNEA 4EQXA 1FOHA 1GESA 2B9XA 4OPDA 3AEAA 1GRHA 3SQPA 3C4NA 1TYTA 5KNLA 4G74A 2X8CA 4H4UA 1Y56A 3K30A 1F8SA 3I6DA 3P4SA 1PBFA 4EIPA 1B37A 3AEDA 3UKQA 1P2HA 1IUXA 3SFEA 4BV6A 3P4PA 3HYWA 1OJ9A 3GYJA 2X3NA 1OJDA 3GYXA 3NHOX 4GDEA 4OVIA 4E0VA 1JNRA 3AE6A 3KPFA 4ZN0A 1LQUA 2C65A 5JCMA 4A9WA 1L9DA 1ZX9A 3SZCA 4IVMB 3AEGA 3EAOA 2JAEA 3QSMA 2GR0A 2FJDA 4AT2A 3IHMA 3QVRA 1DNCA 1REOA 1S2QA 3LJPA 4JY3A 4TM3A 1H81A 4PAAA 4APNA 3GRSA 2Y6QA 3GD3A 3BI2A 3KKJA 2ZZCA 3CN8A 3SZ0A 4D03A 1F8WA 1H2IA 3D1CA 3GDPA 1E7PA 3REDA 1E1MA 5M0ZA 3K7MX 4YSZA 3SY4A 1O94A 1N4VA 1ONFA 3AYLA 1DODA 1JRXA 1KSUA 1L9CA 2C7GA 3ITJA 3L1RA 3DK4A 2NVKX 1IUTA 3H4KA 3T2YA 4A79A 3GSIA 5KMQA 1FEBA 2GEWA 1S7MA 2YLXA 2A8XA 2XFPA 2FJBA 3ALMA 1TDFA 2WU5A 2WEUA 3CNSA 4USQA 4XXGA 2UZZA 1HYUA 3UTGA 3BI4A 2R4EA 1NPXA 2CFYA 3UP5A 1B8SA 3IWAA 2BABA 4RG4A 3LXDA 2XDOA 4IV9A 4A5LA 2B7SA 4UP3A 5U63A 4AP1A 1PBDA 4YSYA 3NYEA 1NG4A 2WETA 2ZZ0A 2H88A 1JEHA 2GF3A 4U8LA 2BCGG 4JN9A 3ABVA 2WPEA 3HYXA 1PS9A 2E5VA 1EBDA 2CVJA 3T14A 3S61A 2WS3A 5KWFA 2A89A 3Q6JA 2JBVA 2QA2A 4BK2A 1D4CA 4LA1A 1KDGA 3C4AA 4BK3A 1PBCA 3DA1A 4CCQA 1GOSA 4JDRA 2FBWA 3KVEA 5FS9A 1LQTA 4REKA 5HY5A 2DKHA 1KN0A 1X31B 2F5ZA 4TM0A 2C64A 1M64A 4B64A 1GXFA 2Z5XA 2YM2A 1CJ2A 3UKAA 2C67A 3I3LA 4YTMA 5BUKA 2NPXA 2B76A 3GRTA 2Z5YA 1ZOYA 2GVCA 4IA5A 1DOCA 2RGOA 2WOIA 2E1MA 4U2TA 1RP0A 4DNAA 1CC2A 2OALA 2V3AA 4YSXA 2GR3A 1GTHA 1ZMDA 5J7XA 3V76A 4EMJA 2XLTA 3UTFA 3ICSA 3F8RA 2XVIA 3T2ZA 4DSHA 3IC9A 1CC6A 2PYXA 3CMMA 1DOBA 2X50A 1N4WA 1Z6LA 3IF9A 4GCMA 5JRBA 2YR4A 3P4RA 2VQBA 2R0CA 3P4QA 2JB3A 2XYOA 1GEUA 4UDPA 4H4SA 2JB2A 3AB1A 3CPIG 3NN0X 5BRTA 5J60A 4K2XA 1NHQA 2CULA 4U2LA 5L46A 3VRDB 2OLNA 2EQ7A 1VDCA 1ZP0A 3UKFA 4A6NA 3ICRA 5HYMA 2WU2A 5EB4A 4J34A 5KMRA 5HHFA 3KLJA 3CTYA 4G73A 3AD7B 4H4TA 4JNAA 4Z25A 1VRQB 4H2NA 2DKIA 3NYCA 2GB0A 2C73A 4H4PA 1GRFA 2EQ8A 1IUSA 3NK1X 1GRTA 1PXAA 2Q0LA 1YQZA 3PS9A 3DJJA 1DOEA 1TDOA 1VG0A 3WE0A 3AE3A 1N1PA 1B5QA 2C3DA 3EF6A 4YT0A 5KRQA 2YVGA 3O0HA 3RP7A 2AAQA 2VVLG 4JQ9A 1QJDA 3H8LA 3JSKA 1ZMCA 1NG3A 3AECA 1LVLA 3KPKA 4J36A 4AOSA 2BS3A 3NKSA 1CHUA 4A7AA 1ZKQA 1IUVA 4O5UA 4Z44A 3UTEA 2VVMA 3S5WA 1PXBA 2GR2A 2WHDA 4CBQA 1PXCA 3DJDA 3V3OA 4H4RA 1GPEA 4FK1A 3URHA 2VRMA 3NT6A 3AEBA 4J2WA 4D04A 2YLTA 4UDRA 4Y4MA 5BVAA 4M52A 3CGBA 1UKVG 3CNPA 4Z24A 4B67A 1GREA 3GWFA 4YKGA 2BS4A 1D7LA 3DJEA 1VG9A 1ZK7A 2OAMA 1Q1RA 5JCIA 2YR5A 2VQ7A 2XCGA 4NZHA 5ER0A 2AQJA 1E39A 1IUUA 5KOWA 3PG6A 2R4JA 3QSSA 2YM1A 4UDQA 4EQRA 1SEZA 5TR3A 3ALLA 4LU6A 1CJ3A 2XFOA 4FX9A 3KA7A 4JNQA 4JY2A 4U8MA 1NHSA 1EL5A 2YG3A 4C3YA 3VRBA 4CY6A 1E6EA 3F8DA 4U8NA 2ZZBA 3C96A 2C3CA 2BC0A 3VR8A 4CY8A 5U1OA 2VRLA 2JK6A 1L9EA 4H2QA 2GMJA 3HYVA 3UKKA 3BI5A 3SFDA 4H7UA 2WOWA 3ZDNA 5C3JA 4K5RA 5KXJA 3NTDA 4G9KA 4Z26A 2X8GA 1CBOA 1D4EA 3LADA 1FECA 1KNPA 3BHKA 1B4VA 3RP6A 3SM8A 3CNDA 4G6HA 4EIQA 1Q9IA 1NAAA 3ATRA 5JCNA 2JB1A 4P9SA 3NRNA 1LPFA 1ZOVA 3KU9A 4H4QA 4DGKA 4GRTA 2HQMA 1E1LA 1Y56B 3COXA 3AYJA 5IQ1A 4CNJA 2X99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PJ5 A;  1YKJ A;  4TLX A;  4X9M A;  2BK3 A;  3VQR A;  1MO9 A;  1OJA A;  1PJ6 A;  4IVO B;  1O5W A;  2YR6 A;  5JCK A;  1VQW A;  3DME A;  4FDC B;  1BGJ A;  1H82 A;  3RHA A;  1FCD A;  1EL7 A;  2IVE A;  1JRY A;  2C75 A;  1DXL A;  2AR8 A;  1AOG A;  1EL8 A;  3IHG A;  2YG4 A;  2BXR A;  1GRB A;  3UKL A;  1NEK A;  4KX6 A;  4N9X A;  1MOK A;  1H6V A;  3HZL A;  2ARD A;  5EB5 A;  2YQU A;  3OC4 A;  4J33 A;  3K7T A;  1NHR A;  1CF3 A;  1H83 A;  2BK4 A;  4B69 A;  2W0H A;  2YLZ A;  1Q1W A;  1Y0P A;  4ADW A;  4GDP A;  1TDE A;  4C5O A;  3LB8 A;  3NIX A;  1KSS A;  4IA6 A;  1PN0 A;  3CNJ A;  5GSN A;  2RAB A;  4I59 A;  2BXS A;  1S3E A;  1CC4 A;  3FMW A;  2WP6 A;  3NH3 X;  3OZ2 A;  4K22 A;  1W4X A;  3DK8 A;  1KFY A;  1CJ4 A;  3UKP A;  2OLO A;  2XFQ A;  4CNK A;  4RSL A;  5KVH A;  4CCR A;  1GT8 A;  2GH5 A;  3AD8 B;  1O95 A;  1EL9 A;  2C76 A;  1GRA A;  4A65 A;  2Q6U A;  4BJZ A;  2FJA A;  3GYI A;  5KVI A;  3UOY A;  2IID A;  1L0V A;  2YLW A;  4PAB A;  2XLR A;  3NGC X;  1V59 A;  3PO7 A;  1GSN A;  4YSH A;  2XVH A;  2R46 A;  4XWZ A;  4AT0 A;  2WPC A;  4B65 A;  3CPJ G;  3BHF A;  1H86 A;  3NYF A;  4EQS A;  1K4Q A;  1PBB A;  2O9Z A;  5EBK A;  2YAU A;  3B6D A;  3QFB A;  2JKC A;  4K5S A;  1COY A;  3E1T A;  1JRZ A;  3NK2 X;  3L8K A;  4U2S A;  3R9U A;  2V61 A;  3NTA A;  4Y4L A;  3V3N A;  2VOU A;  4BJY A;  3GMC A;  3M13 A;  4OCG A;  1PJ7 A;  1JNZ A;  1GTE A;  4OPU A;  1TRB A;  3CGE A;  1MXT A;  4B68 A;  4OPL A;  3EPT A;  3II4 A;  2WDQ A;  4O5Q A;  2BS2 A;  1BWC A;  2WPF A;  1DJQ A;  1ZDL A;  1F6M A;  4NTD A;  4OPC A;  3FBS A;  1H84 A;  4XWR A;  3K7Q X;  4H4X A;  4CRT A;  1PDH A;  1IJH A;  1BKW A;  5HXI A;  3NN6 X;  4HB9 A;  4U8O A;  3ADA B;  5EOW A;  1NDA A;  4AOX A;  2BK5 A;  4ECH A;  2VZ2 A;  2V3B A;  3PVC A;  4H4W A;  2I0Z A;  2E4G A;  1F3P A;  3VRA A;  3DJG X;  4BUR A;  2XFU A;  4YXD A;  1CJC A;  1XPQ A;  3ALJ A;  4WX1 A;  4EM3 A;  3AE5 A;  3AXB A;  4GUV A;  1K0I A;  3CIR A;  2R0G A;  2EQ6 A;  3D8X A;  1LJ1 A;  2GMH A;  3GWD A;  4B63 A;  1E1N A;  2GAG B;  5FS7 A;  4BK1 A;  2R45 A;  4HA6 A;  1GER A;  4KPR A;  2BA9 A;  2V5Z A;  1ELI A;  3AWI A;  4U8K A;  1PHH A;  2GRT A;  4FK1 C;  2GV8 A;  3UP4 A;  3BNU A;  2YWL A;  4ZCC A;  1RSG A;  4RG3 A;  4X9N A;  1YY5 A;  4B1B A;  4Y4N A;  1FL2 A;  1S3B A;  2BAC A;  3ZYX A;  1PBE A;  4H4V A;  3UCL A;  2XLS A;  2WDV A;  3G5R A;  4USR A;  5C2T A;  5M10 A;  3RP8 A;  1NEN A;  2YVF A;  1YQ4 A;  3KD9 A;  1TYP A;  1KNR A;  2C70 A;  3G5S A;  3GDN A;  3NLC A;  1XHC A;  4EM4 A;  1QLB A;  5CQF A;  4H4Y A;  5JCL A;  3GMB A;  2WP5 A;  2B9W A;  3ISH A;  4ZCD A;  2GAH B;  4NTC A;  4MJW A;  2WDR A;  4YWO A;  4J57 A;  1N4U A;  2YG6 A;  3NG7 X;  1LV0 A;  2WP9 A;  2V6O A;  1P2E A;  1YQ3 A;  3FIM B;  2GQW A;  4EMW A;  3AE9 A;  4OPT A;  1NHP A;  2BC1 A;  4K8D A;  2C66 A;  1ZY8 A;  5IQ4 A;  1D7Y A;  1D4D A;  3CGD A;  1K0J A;  2XLU A;  3M0O A;  2WBA A;  4NEW A;  2YG5 A;  4YTP A;  4K7Z A;  1GV4 A;  3AE7 A;  4TLZ A;  4LII A;  1JU2 A;  1RYI A;  4TM4 A;  4WCT A;  3P1W A;  3AE2 A;  3P9U A;  4J31 A;  4C3X A;  1IUW A;  3EAN A;  2XVE A;  1BGN A;  3T37 A;  4H2R A;  4NEV A;  4YKF A;  3CGC A;  2WOV A;  2QCU A;  2CDU A;  2BCP A;  3M12 A;  1BF3 A;  1D5T A;  2C72 A;  2XFN A;  2ZBW A;  4Z43 A;  4Z2T A;  1QO8 A;  5KOX A;  1OJC A;  3UOZ A;  3CPH G;  2V60 A;  4AP3 A;  3QJ4 A;  4X4J A;  3DK9 A;  5FS8 A;  4EQW A;  3AEF A;  2YLS A;  5LV9 A;  2RGJ A;  1H7X A;  3SGL A;  2GR1 A;  3Q9T A;  2TMD A;  2WES A;  3BNM A;  3UKH A;  2X8H A;  4ICY A;  4EMI A;  3F8P A;  3LZW A;  4H2P A;  4NTE A;  4YTN A;  4Z2U A;  1LTX R;  4C77 A;  1KF6 A;  3QSE A;  2EQ9 A;  3CNT A;  4A99 A;  2R0P A;  3G5Q A;  1JOA A;  3LZX A;  1H7W A;  2QA1 A;  5FMH A;  1E1K A;  3ICT A;  3QVP A;  2RGH A;  2B7R A;  2XVF A;  2J3N A;  1GAL A;  4U8P A;  1XAN A;  3UOX A;  1CL0 A;  3GD4 A;  4C74 A;  4H50 A;  5BUL A;  3AE4 A;  5IPY A;  5CKU A;  4GR1 A;  3RNM A;  4B66 A;  1M6I A;  3ATQ A;  1K0L A;  2APG A;  2YLR A;  2IVD A;  4U8I A;  1XDI A;  3QFA A;  4TM1 A;  4OPG A;  2BYB A;  3AEE A;  5GRT A;  3DGH A;  1TDN A;  2FJE A;  3UTH A;  4U8J A;  3AD9 B;  1GND A;  2YG7 A;  2YVJ A;  3H8I A;  3AYI A;  4Z2R A;  1F8R A;  2OA1 A;  1DJN A;  2R9Z A;  4OPI A;  4J56 A;  2Y6R A;  4A6N B;  5DBJ A;  2QAE A;  3FPZ A;  3DH9 A;  3AE8 A;  3NK0 X;  4GF7 A;  3UOV A;  3AE1 A;  1GRG A;  1TDK A;  2A87 A;  2VVL A;  2XLP A;  3B3R A;  2TPR A;  2WQY A;  2Q0K A;  3FG2 P;  3VR9 A;  3LOV A;  4DSG A;  2ACZ A;  1OJT A;  2B9Y A;  1BZL A;  4H4Z A;  5U25 A;  2Q7V A;  1GET A;  4I58 A;  2H89 A;  2PHH A;  2GQF A;  2XVJ A;  1FEA A;  3DGZ A;  1S2Y A;  5FS6 A;  3NNE A;  4EQX A;  1FOH A;  1GES A;  2B9X A;  4OPD A;  3AEA A;  1GRH A;  3SQP A;  3C4N A;  1TYT A;  2X8C A;  4H4U A;  1Y56 A;  3K30 A;  1F8S A;  3I6D A;  3P4S A;  1PBF A;  4EIP A;  1B37 A;  3AED A;  3UKQ A;  1P2H A;  1IUX A;  3SFE A;  4BV6 A;  3P4P A;  1OJ9 A;  3GYJ A;  2X3N A;  1OJD A;  3NHO X;  4GDE A;  4OVI A;  4E0V A;  1JNR A;  3AE6 A;  3KPF A;  4ZN0 A;  1LQU A;  2C65 A;  5JCM A;  4A9W A;  1L9D A;  1ZX9 A;  4IVM B;  3AEG A;  3EAO A;  2JAE A;  3QSM A;  2GR0 A;  2FJD A;  4AT2 A;  3IHM A;  3QVR A;  1DNC A;  1REO A;  1S2Q A;  3LJP A;  4JY3 A;  4TM3 A;  1H81 A;  4PAA A;  4APN A;  3GRS A;  2Y6Q A;  3GD3 A;  3BI2 A;  3KKJ A;  2ZZC A;  3CN8 A;  4D03 A;  1F8W A;  3D1C A;  3GDP A;  1E7P A;  3RED A;  1E1M A;  5M0Z A;  3K7M X;  4YSZ A;  1O94 A;  1N4V A;  1ONF A;  3AYL A;  1DOD A;  1JRX A;  1KSU A;  1L9C A;  2C7G A;  3ITJ A;  3L1R A;  3DK4 A;  2NVK X;  1IUT A;  3H4K A;  4A79 A;  3GSI A;  1FEB A;  2GEW A;  2YLX A;  2A8X A;  2XFP A;  2FJB A;  3ALM A;  1TDF A;  2WU5 A;  2WEU A;  3CNS A;  4USQ A;  4XXG A;  2UZZ A;  1HYU A;  3UTG A;  3BI4 A;  2R4E A;  1NPX A;  2CFY A;  3UP5 A;  1B8S A;  3IWA A;  2BAB A;  4RG4 A;  3LXD A;  2XDO A;  4IV9 A;  4A5L A;  2B7S A;  4UP3 A;  5U63 A;  4AP1 A;  1PBD A;  4YSY A;  3NYE A;  1NG4 A;  2WET A;  2ZZ0 A;  2H88 A;  1JEH A;  2GF3 A;  4U8L A;  2BCG G;  4JN9 A;  3ABV A;  2WPE A;  1PS9 A;  2E5V A;  1EBD A;  2CVJ A;  3S61 A;  2WS3 A;  5KWF A;  2A89 A;  3Q6J A;  2JBV A;  2QA2 A;  4BK2 A;  1D4C A;  4LA1 A;  1KDG A;  3C4A A;  4BK3 A;  1PBC A;  3DA1 A;  4CCQ A;  1GOS A;  4JDR A;  2FBW A;  3KVE A;  5FS9 A;  1LQT A;  4REK A;  5HY5 A;  2DKH A;  1X31 B;  2F5Z A;  4TM0 A;  2C64 A;  1M64 A;  4B64 A;  1GXF A;  2Z5X A;  2YM2 A;  1CJ2 A;  3UKA A;  2C67 A;  3I3L A;  4YTM A;  5BUK A;  2NPX A;  2B76 A;  3GRT A;  2Z5Y A;  1ZOY A;  2GVC A;  4IA5 A;  1DOC A;  2RGO A;  2WOI A;  2E1M A;  4U2T A;  1RP0 A;  4DNA A;  1CC2 A;  2OAL A;  2V3A A;  4YSX A;  2GR3 A;  1GTH A;  1ZMD A;  5J7X A;  3V76 A;  4EMJ A;  2XLT A;  3UTF A;  3ICS A;  3F8R A;  2XVI A;  4DSH A;  3IC9 A;  1CC6 A;  2PYX A;  1DOB A;  2X50 A;  1N4W A;  1Z6L A;  3IF9 A;  4GCM A;  2YR4 A;  3P4R A;  2VQB A;  2R0C A;  3P4Q A;  2JB3 A;  2XYO A;  1GEU A;  4UDP A;  4H4S A;  2JB2 A;  3AB1 A;  3CPI G;  3NN0 X;  5BRT A;  5J60 A;  4K2X A;  1NHQ A;  2CUL A;  4U2L A;  5L46 A;  3VRD B;  2OLN A;  2EQ7 A;  1VDC A;  1ZP0 A;  3UKF A;  4A6N A;  3ICR A;  5HYM A;  2WU2 A;  5EB4 A;  4J34 A;  5HHF A;  3KLJ A;  3CTY A;  3AD7 B;  4H4T A;  4JNA A;  4Z25 A;  1VRQ B;  4H2N A;  2DKI A;  3NYC A;  2GB0 A;  2C73 A;  4H4P A;  1GRF A;  2EQ8 A;  1IUS A;  3NK1 X;  1GRT A;  1PXA A;  2Q0L A;  1YQZ A;  3PS9 A;  3DJJ A;  1DOE A;  1TDO A;  1VG0 A;  3WE0 A;  3AE3 A;  1N1P A;  1B5Q A;  2C3D A;  3EF6 A;  4YT0 A;  5KRQ A;  2YVG A;  3O0H A;  3RP7 A;  2AAQ A;  2VVL G;  4JQ9 A;  1QJD A;  3H8L A;  3JSK A;  1ZMC A;  1NG3 A;  3AEC A;  1LVL A;  4AOS A;  4J36 A;  2BS3 A;  3NKS A;  1CHU A;  4A7A A;  1ZKQ A;  1IUV A;  4O5U A;  4Z44 A;  3UTE A;  2VVM A;  3S5W A;  1PXB A;  2GR2 A;  2WHD A;  4CBQ A;  1PXC A;  3DJD A;  3V3O A;  4H4R A;  1GPE A;  4FK1 A;  3URH A;  2VRM A;  3NT6 A;  3AEB A;  4J2W A;  4D04 A;  2YLT A;  4UDR A;  4Y4M A;  5BVA A;  4M52 A;  3CGB A;  1UKV G;  3CNP A;  4Z24 A;  4B67 A;  1GRE A;  3GWF A;  4YKG A;  2BS4 A;  1D7L A;  3DJE A;  1VG9 A;  1ZK7 A;  2OAM A;  1Q1R A;  5JCI A;  2YR5 A;  2VQ7 A;  2XCG A;  4NZH A;  5ER0 A;  2AQJ A;  1E39 A;  1IUU A;  5KOW A;  2R4J A;  3QSS A;  2YM1 A;  4UDQ A;  4EQR A;  1SEZ A;  5TR3 A;  3ALL A;  4LU6 A;  1CJ3 A;  2XFO A;  4FX9 A;  3KA7 A;  4JNQ A;  4JY2 A;  4U8M A;  1NHS A;  1EL5 A;  2YG3 A;  4C3Y A;  3VRB A;  4CY6 A;  1E6E A;  3F8D A;  4U8N A;  2ZZB A;  3C96 A;  2C3C A;  2BC0 A;  3VR8 A;  4CY8 A;  5U1O A;  2VRL A;  2JK6 A;  1L9E A;  4H2Q A;  2GMJ A;  3UKK A;  3BI5 A;  3SFD A;  4H7U A;  2WOW A;  3ZDN A;  5C3J A;  4K5R A;  5KXJ A;  3NTD A;  4Z26 A;  2X8G A;  1CBO A;  1D4E A;  3LAD A;  1FEC A;  1KNP A;  3BHK A;  1B4V A;  3RP6 A;  3SM8 A;  3CND A;  4EIQ A;  1Q9I A;  1NAA A;  3ATR A;  5JCN A;  2JB1 A;  4P9S A;  3NRN A;  1LPF A;  1ZOV A;  3KU9 A;  4H4Q A;  4DGK A;  4GRT A;  2HQM A;  1E1L A;  1Y56 B;  3COX A;  3AYJ A;  5IQ1 A;  4CNJ A;  2X99 A; 
#chains in the Genus database with same CATH topology
 1YKJ A;  3VQR A;  4TLX A;  2YR6 A;  1DTN A;  1H82 A;  3ES7 A;  2IVE A;  1EL7 A;  1EL8 A;  1GRB A;  1ZXI C;  5EB5 A;  3K1G A;  2YQU A;  3K7T A;  1Y0P A;  4ADW A;  4GDP A;  1YEY A;  3PK7 A;  1KSS A;  3D9X A;  1CC4 A;  3SR6 B;  4CNK A;  2XFQ A;  4RSL A;  1O95 A;  3CXB A;  1GRA A;  5KVI A;  3UOY A;  3L5O A;  2IID A;  2BRA A;  3PO7 A;  2ZAD A;  2XVH A;  4XWZ A;  3CPJ G;  3BHF A;  5BOE A;  2YAU A;  3QFB A;  1COY A;  3E1T A;  3CT2 A;  4GAV A;  1GTE A;  1N5X A;  2XH4 A;  3CGE A;  2O56 A;  2WDQ A;  4O5Q A;  1DJQ A;  2WPF A;  1ZDL A;  4NTD A;  4OPC A;  1H84 A;  4XWR A;  3K7Q X;  1PDH A;  1IJH A;  4ENL A;  2V3B A;  3PVC A;  4K8G A;  2I0Z A;  3DJG X;  1IYX A;  1L8P A;  3S5S A;  4H2H A;  4WX1 A;  4EM3 A;  3AXB A;  4GUV A;  3S47 A;  2R0G A;  3H7V A;  1E1N A;  1E9I A;  3GO2 A;  2BA9 A;  1ELI A;  1PHH A;  2GRT A;  3UP4 A;  3BNU A;  4X9N A;  1YY5 A;  1WUE A;  3ENL A;  1FL2 A;  1S3B A;  2BAC A;  1PBE A;  4ZA0 A;  5C2T A;  4USR A;  1NEN A;  2YVF A;  1YQ4 A;  1KNR A;  2C70 A;  1XHC A;  2B9W A;  3ISH A;  2GAH B;  2PPG A;  3NG7 X;  2GGI A;  2WP9 A;  2V6O A;  1EBG A;  4EMW A;  3AE9 A;  4OPT A;  3RCY A;  3SXI A;  1NHP A;  2BC1 A;  3EEZ A;  1FIQ B;  3T31 A;  5G5G B;  4II3 A;  2WBA A;  2OVL A;  1JPM A;  2YG5 A;  3DER A;  1GV4 A;  4TLZ A;  1JU2 A;  3DG3 A;  2HZG A;  3P1W A;  3P9U A;  4J31 A;  1BGN A;  4NEV A;  3DEQ A;  2BCP A;  3M12 A;  1BF3 A;  4Z2T A;  1OJC A;  3PFR A;  3PWI A;  4FP1 A;  5FS8 A;  2YLS A;  4JN7 A;  2TMD A;  2AL2 A;  4ICY A;  3B9J B;  4H2P A;  4NTE A;  5KMS A;  4DN1 A;  2EQ9 A;  2W3R A;  5FMH A;  3SX6 A;  3QVP A;  3NVY B;  2XVF A;  2W54 A;  1GAL A;  4U8P A;  5BUL A;  3AE4 A;  4GR1 A;  3RNM A;  2GDQ A;  4TM1 A;  2BYB A;  5GRT A;  3UTH A;  4U8J A;  2YVJ A;  3AYI A;  3ZLG A;  4OPI A;  2P8B A;  4MGG A;  3UXL A;  2BRY A;  4GF7 A;  3UOV A;  3AE1 A;  1TDK A;  3B3R A;  2TPR A;  3I4K A;  5BOF A;  2WQY A;  3LOV A;  4DSG A;  2B9Y A;  2Q7V A;  2QJJ A;  2XVJ A;  1FEA A;  3MWC A;  1FOH A;  1GES A;  4GGH A;  1TYT A;  1JRP A;  4G74 A;  2NQL A;  2PTX A;  3K30 A;  4EIP A;  4HNL A;  1OJ9 A;  3NHO X;  1OJD A;  2QGY A;  4GDE A;  3AE6 A;  3IJI A;  3MY9 A;  3SN0 A;  1L9D A;  3SZC A;  4DXK A;  4E4F A;  3NS1 B;  2GR0 A;  4AT2 A;  3IHM A;  1DNC A;  1REO A;  1S2Q A;  3LJP A;  4TM3 A;  4APN A;  3GD3 A;  3QTP A;  3KKJ A;  3SZ0 A;  4D03 A;  3D1C A;  3UCD A;  4MMW A;  2AKZ A;  5M0Z A;  2CHR A;  3OTR A;  4YSZ A;  1N4V A;  1KSU A;  2C7G A;  3DK4 A;  4A79 A;  3T2Y A;  2POZ A;  3GSI A;  1FEB A;  1FHV A;  1S7M A;  2XFP A;  4X2P A;  1TDF A;  3CYJ A;  4USQ A;  4H1Z A;  2PU1 A;  5U63 A;  2P88 A;  2WET A;  1JEH A;  4U8L A;  2BCG G;  2WPE A;  1PS9 A;  3S61 A;  5KWF A;  4LA1 A;  1PDY A;  5FS9 A;  1LQT A;  4TM0 A;  1M64 A;  1GXF A;  2YM2 A;  1CJ2 A;  2C67 A;  4YTM A;  3GRT A;  2I5Q A;  4U2T A;  2E1M A;  1RP0 A;  1CC2 A;  2V3A A;  3I6E A;  3V76 A;  3UTF A;  3ICS A;  1KCZ A;  2PYX A;  2X50 A;  1Z6L A;  2FKP A;  3H12 A;  2VQB A;  2R0C A;  3P3B A;  1GEU A;  2JB2 A;  3CPI G;  4K2X A;  2CUL A;  2GGH A;  2OLN A;  4A6N A;  3ICR A;  5HYM A;  5KMR A;  4G73 A;  3NXL A;  3AD7 B;  4Z25 A;  4GYP C;  4H4P A;  2C73 A;  1GRF A;  1TKK A;  1WYG A;  1IUS A;  3RIT A;  1YQZ A;  3PWG A;  4E6M A;  2OQH A;  1N1P A;  2C3D A;  3EF6 A;  4YT0 A;  3O0H A;  3JSK A;  3KPK A;  3ZVI A;  1CHU A;  3U9I A;  4CBQ A;  3V3O A;  3FXG A;  1GPE A;  2PP1 A;  1FFV C;  4J2W A;  4D04 A;  5BVA A;  1GRE A;  4HN8 A;  2BS4 A;  3DDM A;  1VG9 A;  3SN4 A;  3SJN A;  5JCI A;  4NZH A;  2DW7 A;  1E39 A;  3PG6 A;  2R4J A;  3QSS A;  1CJ3 A;  3KA7 A;  4U8M A;  4C3Y A;  3VRB A;  3VR8 A;  5U1O A;  3QKE A;  2JK6 A;  4H2Q A;  1R0M A;  2GMJ A;  3UKK A;  1BQG A;  4H7U A;  3ZDN A;  2OPJ A;  3NTD A;  2PTW A;  1CBO A;  1D4E A;  3LAD A;  1FEC A;  2PGE A;  1B4V A;  1W6T A;  3CND A;  1Q9I A;  5JCN A;  2JB1 A;  3NRN A;  1LPF A;  1ZOV A;  2HQM A;  2MNR A;  1E1L A;  3R10 A;  3QN3 A;  3STP A;  1SB3 B;  1PJ5 A;  4IHC A;  3V4B A;  2OFJ A;  1O5W A;  3DME A;  4NWZ A;  1N62 C;  2HXT A;  1DXL A;  2AR8 A;  4ZCW A;  3UKL A;  3HZL A;  2PA6 A;  4J33 A;  3D47 A;  1V97 A;  1Q1W A;  1TDE A;  4C5O A;  4IA6 A;  2P8C A;  3CNJ A;  3HW2 A;  4GAP A;  3NH3 X;  3HPF A;  1SJB A;  3OZ2 A;  4M6U A;  3DK8 A;  4F4R A;  1KFY A;  1CJ4 A;  3UKP A;  3UXK A;  5KVH A;  1GT8 A;  2GH5 A;  3NVV B;  3CB3 A;  4A65 A;  2YLW A;  4AT0 A;  4B65 A;  1KKO A;  2O9Z A;  4IT1 A;  5EBK A;  1JRZ A;  2V61 A;  3NTA A;  3V3N A;  2VOU A;  4BJY A;  3UJR A;  3GMC A;  3I6T A;  2QDD A;  1X2G A;  2QDE A;  1TRB A;  3FBS A;  4H4X A;  5HXI A;  4U8O A;  4AOX A;  1NDA A;  4ECH A;  4NNJ A;  3V5C A;  4H4W A;  2E4G A;  4BUR A;  4YXD A;  3AE5 A;  3CIR A;  2EQ6 A;  3D8X A;  1LJ1 A;  2GMH A;  4BK1 A;  2V5Z A;  4U8K A;  4FK1 C;  4RG3 A;  2AL2 B;  4B1B A;  4Y4N A;  2XLS A;  2XSX A;  3G5R A;  5M10 A;  3KD9 A;  1TYP A;  2QJM A;  3G5S A;  1NU5 A;  4H4Y A;  4NTC A;  4JN8 A;  2WDR A;  3NVZ B;  2YG6 A;  4II2 A;  1P2E A;  1YQ3 A;  3FIM B;  3FV9 A;  3Q45 A;  3SQS A;  3ZVH B;  1ZY8 A;  2AKM A;  3T8Q A;  2XLU A;  4K7Z A;  1RYI A;  3MUC A;  1IUW A;  3IK4 A;  2CDU A;  4GGB A;  3NFU A;  2C72 A;  2XFN A;  5FJO A;  3UOZ A;  3BSM A;  3Q4D A;  4AP3 A;  3QJ4 A;  4EWJ A;  4X4J A;  4EQW A;  4TVY A;  3Q9T A;  3BNM A;  2X8H A;  4EMI A;  3OW1 A;  2MUC A;  4Z2U A;  1SJA A;  1LTX R;  4C77 A;  3QSE A;  4A99 A;  3G5Q A;  3LZX A;  1H7W A;  2QA1 A;  1E1K A;  3ICT A;  2RGH A;  1OEP A;  2J3N A;  4DX3 A;  3GD4 A;  4G7F A;  5IPY A;  5ENL A;  4B66 A;  1M6I A;  2IVD A;  2C4C A;  3AEE A;  3AD9 B;  1GND A;  2OA1 A;  2R9Z A;  2Y6R A;  4A6N B;  3FPZ A;  3AE8 A;  1GRG A;  2A87 A;  2VVL A;  3T2K A;  3FG2 P;  3VR9 A;  2PHH A;  2GQF A;  4EQX A;  2B9X A;  3SQP A;  4HNC A;  5KNL A;  4H4U A;  1Y56 A;  1PBF A;  3UGV A;  4H19 A;  3GYJ A;  2X3N A;  3FJ4 A;  3ZVH A;  3V3W A;  1ONE A;  4OVI A;  4E0V A;  4ZN0 A;  3HRD C;  1ZX9 A;  1H81 A;  3VCC A;  3GDP A;  3RED A;  4HCD A;  1O94 A;  1ONF A;  2QJN A;  3AYL A;  1JRX A;  2A8X A;  2WU5 A;  3CNS A;  2UZZ A;  1HYU A;  2R4E A;  1NPX A;  2CFY A;  3IWA A;  4AP1 A;  2GGJ A;  2B7S A;  2PSN A;  1XPY A;  3B97 A;  3BJS A;  2OG9 A;  2GF3 A;  2ZC8 A;  3D46 A;  2CVJ A;  3T14 A;  2WS3 A;  2A89 A;  2QA2 A;  2JBV A;  4BK2 A;  4HCH A;  3C4A A;  1PBC A;  2FBW A;  3KVE A;  1N60 C;  2DKH A;  1X31 B;  4IL2 A;  4J3Z A;  2Z5X A;  3I3L A;  3VFC A;  2NPX A;  2B76 A;  2GVC A;  4IA5 A;  3QLD A;  4Z1Y A;  2OAL A;  3JZU A;  2GL5 A;  3P93 A;  4EMJ A;  3T2Z A;  4DSH A;  3DGB A;  3CMM A;  1N4W A;  5EU9 A;  5JRB A;  2YR4 A;  3P4R A;  3P4Q A;  3N4E A;  4UDP A;  3TTE A;  1NHQ A;  3VC5 A;  4U2L A;  2AL1 A;  1VDC A;  2WU2 A;  4J34 A;  3KLJ A;  4H2N A;  3NYC A;  4HCL A;  2P3Z A;  3DJJ A;  1TDO A;  3WE0 A;  4HYR A;  5KRQ A;  4JQ9 A;  1SJD A;  1ZMC A;  4IP5 A;  4J36 A;  3JVA A;  1IUV A;  3VDG A;  7ENL A;  4Z44 A;  1KKR A;  3S5W A;  2GR2 A;  4FK1 A;  3URH A;  3NT6 A;  3AEB A;  4UDR A;  4M52 A;  3MQT A;  3GWF A;  2OAM A;  2PS2 A;  2XCG A;  2PP0 A;  2AQJ A;  4EQR A;  4LU6 A;  3GD6 A;  4YWS A;  2XFO A;  3R0K A;  4CY6 A;  3TOY A;  4U8N A;  2ZZB A;  5G5H B;  2C3C A;  3C96 A;  2VRL A;  3U4F A;  2E5A A;  3BI5 A;  4Z26 A;  1N61 C;  3BOX A;  3RP6 A;  3SM8 A;  3BHK A;  4G6H A;  4EIQ A;  1NAA A;  3ATR A;  4P9S A;  3KU9 A;  4H4Q A;  4GRT A;  3DFY A;  1T3Q C;  5IQ1 A;  2X99 A;  4X9M A;  2BK3 A;  1MO9 A;  1OJA A;  1JDF A;  1PJ6 A;  5JCK A;  1VQW A;  4FDC B;  1BGJ A;  1FCD A;  2C75 A;  1P48 A;  4KX6 A;  3TJ4 A;  4N9X A;  1MOK A;  1H6V A;  3OC4 A;  1NHR A;  1CF3 A;  1H83 A;  1TE6 A;  2BK4 A;  4B69 A;  2YLZ A;  4MKS A;  2GSH A;  5FJU A;  2BXS A;  3FMW A;  1W4X A;  3VC6 A;  5KMP A;  3AD8 B;  1EL9 A;  2FJA A;  4HPN A;  2XLR A;  1V59 A;  1GSN A;  4YSH A;  2R46 A;  2WPC A;  4EQS A;  2JKC A;  4K5S A;  4U2S A;  4Y4L A;  4OCG A;  1PJ7 A;  1JNZ A;  4B68 A;  1ELS A;  4Z17 A;  1F6M A;  2POD A;  2P0I A;  3NN6 X;  4HB9 A;  3ADA B;  2BK5 A;  3VRA A;  3QPE A;  1CJC A;  3SBF A;  4B63 A;  2R45 A;  4HA6 A;  4KPR A;  2PMQ A;  3AWI A;  3RRA A;  3ETR B;  2YWL A;  4ZCC A;  1RSG A;  3UCL A;  2WDV A;  3RP8 A;  3UJ2 A;  3NLC A;  1QLB A;  4EM4 A;  4G8T A;  1RVK A;  3R0U A;  4ZCD A;  4MJW A;  1N4U A;  2GQW A;  3SZF A;  3R07 C;  2C66 A;  5IQ4 A;  1K0J A;  3CGD A;  3M0O A;  3ES8 A;  4NEW A;  5J04 A;  4LII A;  4TM4 A;  3AE2 A;  3H8A A;  4C3X A;  3GY1 A;  3EAN A;  3N6H A;  2XVE A;  2QVH A;  3T37 A;  4H2R A;  3CGC A;  2WOV A;  2QCU A;  2PP3 A;  1QO8 A;  5KOX A;  3CPH G;  2V60 A;  1PDZ A;  3AEF A;  2RGJ A;  1H7X A;  2GR1 A;  3LZW A;  1KF6 A;  1JOA A;  3TJI A;  3SYI A;  3UOX A;  1CL0 A;  4C74 A;  4H50 A;  4E5T A;  5CKU A;  3ATQ A;  1K0L A;  4U8I A;  3QFA A;  4OPG A;  1TDN A;  3H8I A;  1F8R A;  1ECQ A;  2QAE A;  3DH9 A;  3NK0 X;  2XLP A;  2QQ6 A;  3THU A;  2ACZ A;  1BZL A;  4H4Z A;  1GET A;  4I58 A;  3EKG A;  2H89 A;  1EBH A;  5FS6 A;  3NNE A;  1GRH A;  3C4N A;  1F8S A;  3I6D A;  3P4S A;  2XGZ A;  1P2H A;  3TWA A;  4TVW A;  4GIR A;  1P43 A;  4IVM B;  2JAE A;  3QSM A;  2FJD A;  4PAA A;  3N6J A;  1E7P A;  1E1M A;  3SY4 A;  3L1R A;  1L9C A;  2NVK X;  1IUT A;  6ENL A;  4A35 A;  5KMQ A;  2GEW A;  2YLX A;  2FJB A;  3ALM A;  1JPD X;  1TZZ A;  1EC9 A;  4XXG A;  3BI4 A;  3UP5 A;  3LXD A;  1MDR A;  3VCN A;  4YSY A;  1NEL A;  1NG4 A;  2H88 A;  1N63 C;  4JN9 A;  1EC8 A;  2E5V A;  4M0X A;  3Q6J A;  1D4C A;  3T9P A;  3UJF A;  1KDG A;  4BK3 A;  3UCC A;  4E8G A;  2PTZ A;  4REK A;  5HY5 A;  1KN0 A;  4IL0 A;  2F5Z A;  2C64 A;  3MSY A;  3NRZ B;  5BUK A;  2Z5Y A;  1ZOY A;  3FYY A;  3TQP A;  1GTH A;  1ZMD A;  4J1O A;  1MDL A;  3R25 A;  3F8R A;  2XVI A;  1DOB A;  3IF9 A;  5BRT A;  2XH2 A;  3VRD B;  2EQ7 A;  5HHF A;  3CTY A;  1VRQ B;  2GB0 A;  2EQ8 A;  4K2S A;  1GRT A;  1PXA A;  2Q0L A;  3PS9 A;  1VG0 A;  3AE3 A;  3SSZ A;  3V5F A;  3SN1 A;  1LVL A;  3NKS A;  3P0W A;  4A7A A;  3UTE A;  2VVM A;  1PXB A;  1PXC A;  3GC2 A;  4KT2 A;  2VRM A;  1MUC A;  2YLT A;  4Y4M A;  1BKH A;  3CGB A;  4Z24 A;  1JRO A;  4YKG A;  3A7U A;  1D7L A;  1ZK7 A;  1JCT A;  2YR5 A;  2DW6 A;  2VQ7 A;  5ER0 A;  3R1Z A;  4UDQ A;  1SEZ A;  1STZ A;  5FJP A;  4JY2 A;  1NHS A;  1EL5 A;  3F8D A;  3JW7 A;  3HYV A;  5KXJ A;  4K5R A;  4DGK A;  4KWS A;  4ROP A;  3COX A;  3AYJ A;  4IVO B;  3H70 A;  3RHA A;  3IHG A;  1JRY A;  1AOG A;  2YG4 A;  2BXR A;  1NEK A;  3DIP A;  3DFH A;  2ARD A;  5FJR A;  3NO1 A;  4DWD A;  2W0H A;  3LB8 A;  3NIX A;  4GFI A;  1PN0 A;  1R6W A;  5GSN A;  2RAB A;  4I59 A;  1S3E A;  2WP6 A;  4K22 A;  3AN1 A;  2W55 A;  2OLO A;  4FI4 A;  4CCR A;  2C76 A;  2PU0 A;  4H83 A;  1VQZ A;  2Q6U A;  4BJZ A;  3DES A;  3GYI A;  1L0V A;  3MKC A;  4PAB A;  3NGC X;  3R11 A;  2PGW A;  1H86 A;  3NYF A;  1K4Q A;  1PBB A;  3B6D A;  3DG7 A;  3SZW A;  3NK2 X;  3L8K A;  3R9U A;  3M13 A;  4OPU A;  1MXT A;  1SJC A;  4OPL A;  3EPT A;  3II4 A;  2BS2 A;  1BWC A;  3UJE A;  4A3R A;  4CRT A;  1BKW A;  5EOW A;  2VZ2 A;  1F3P A;  2OKT A;  2XFU A;  1XPQ A;  3OZY A;  3ALJ A;  1K0I A;  2OLA A;  3GWD A;  2GAG B;  5FS7 A;  3TW9 A;  2ONE A;  1GER A;  4DYE A;  1X2H A;  1FFU C;  2GV8 A;  2W3S A;  2RDX A;  3ZYX A;  4H4V A;  3NZG A;  3GDN A;  5CQF A;  5JCL A;  3GMB A;  2WP5 A;  3A7R A;  3TWB A;  4YWO A;  4J57 A;  1LV0 A;  4GIS A;  4K8D A;  3CAW A;  1D7Y A;  1D4D A;  4YTP A;  3AE7 A;  4WCT A;  2FYM A;  3N4F A;  4YKF A;  1D5T A;  2ZBW A;  4Z43 A;  4KPL A;  1N5W C;  3DK9 A;  5LV9 A;  3SGL A;  1MRA A;  2WES A;  3UKH A;  3F8P A;  4YTN A;  3CNT A;  2R0P A;  4GYP A;  3RO6 A;  2B7R A;  3FVD A;  1XAN A;  2HXU A;  3KUM A;  1EC7 A;  2APG A;  2YLR A;  1XDI A;  1RM6 B;  2OZ8 A;  3DGH A;  2FJE A;  2YG7 A;  4Z2R A;  2XH0 A;  3RR1 A;  3IJQ A;  1DJN A;  4J56 A;  3AMZ A;  5DBJ A;  2Q0K A;  1OJT A;  3T0K A;  5U25 A;  4G6G A;  3CXO A;  3DGZ A;  1S2Y A;  1FO4 A;  4OPD A;  3AEA A;  3OZM A;  5IDZ A;  2X8C A;  2OQY A;  4K1W A;  1B37 A;  3AED A;  3UKQ A;  1IUX A;  3SFE A;  4BV6 A;  3P4P A;  3HYW A;  3GYX A;  1JNR A;  3KPF A;  1LQU A;  2C65 A;  5JCM A;  4A9W A;  3AEG A;  3EAO A;  3VA8 A;  3OPS A;  3QVR A;  2OX4 A;  4JY3 A;  5FJT A;  3GRS A;  2Y6Q A;  3BI2 A;  2ZZC A;  3TCS A;  3CN8 A;  1F8W A;  1H2I A;  4GME A;  3K7M X;  1DOD A;  3ITJ A;  3H4K A;  2WEU A;  3UTG A;  1B8S A;  2BAB A;  4RG4 A;  2XDO A;  4DHG A;  4IV9 A;  4UP3 A;  4A5L A;  1PBD A;  3NYE A;  3FCP A;  2ZZ0 A;  3ABV A;  3HYX A;  4JHM A;  4ZOH B;  1EBD A;  3RGT A;  4CCQ A;  2GGE A;  3DA1 A;  1GOS A;  4JDR A;  1WUF A;  4B64 A;  1VDV A;  1FHU A;  3UKA A;  1DOC A;  3DG6 A;  2WOI A;  2GGG A;  2RGO A;  4DNA A;  4YSX A;  2GR3 A;  1MNS A;  5J7X A;  2XLT A;  1XS2 A;  3IC9 A;  1CC6 A;  4GCM A;  2JB3 A;  2XYO A;  2E3T A;  4H4S A;  3AB1 A;  3NN0 X;  5J60 A;  2PTY A;  5L46 A;  3A7A A;  4KEM A;  2HNE A;  1ZP0 A;  3UKF A;  5EB4 A;  4H4T A;  4JNA A;  3UJS A;  3NVW B;  2DKI A;  3OP2 A;  2OZ3 A;  3NK1 X;  3T6C A;  1DOE A;  3ZLF A;  1B5Q A;  2YVG A;  3RP7 A;  2AAQ A;  2VVL G;  1QJD A;  3H8L A;  1NG3 A;  3AM9 A;  3AEC A;  4AOS A;  3CK5 A;  2BS3 A;  4IP4 A;  1ZKQ A;  4A6G A;  4O5U A;  2WHD A;  3DJD A;  2OZT A;  3MZN A;  4H4R A;  3IJL A;  1UKV G;  3CNP A;  1KD0 A;  4B67 A;  3EUB 3;  2OO6 A;  3DJE A;  1Q1R A;  1IUU A;  5KOW A;  2YM1 A;  3ALL A;  5TR3 A;  2XH7 A;  4FX9 A;  4JNQ A;  1F9C A;  2YG3 A;  3T4W A;  1E6E A;  4IZG A;  2BC0 A;  4CY8 A;  1L9E A;  4E4U A;  3SFD A;  2WOW A;  5C3J A;  3ZLH A;  4G9K A;  2X8G A;  1KNP A;  2PCE A;  1Y56 B;  4CNJ A; 
#chains in the Genus database with same CATH homology
 1PJ5 A;  1YKJ A;  4TLX A;  4X9M A;  2BK3 A;  3VQR A;  1MO9 A;  1OJA A;  1PJ6 A;  4IVO B;  1O5W A;  2YR6 A;  5JCK A;  1VQW A;  3DME A;  4NWZ A;  4FDC B;  1BGJ A;  1H82 A;  3RHA A;  1FCD A;  1EL7 A;  2IVE A;  1JRY A;  2C75 A;  1DXL A;  2AR8 A;  1AOG A;  1EL8 A;  3IHG A;  2YG4 A;  2BXR A;  1GRB A;  3UKL A;  1NEK A;  4KX6 A;  4N9X A;  1MOK A;  1H6V A;  3HZL A;  2ARD A;  5EB5 A;  2YQU A;  3OC4 A;  4J33 A;  3K7T A;  1NHR A;  1CF3 A;  1H83 A;  2BK4 A;  4B69 A;  2W0H A;  2YLZ A;  1Q1W A;  1Y0P A;  4ADW A;  4GDP A;  1TDE A;  4C5O A;  3LB8 A;  3NIX A;  1KSS A;  4IA6 A;  1PN0 A;  3CNJ A;  5GSN A;  2RAB A;  4I59 A;  2BXS A;  1S3E A;  3D9X A;  1CC4 A;  4GAP A;  3FMW A;  2WP6 A;  3NH3 X;  3OZ2 A;  4K22 A;  1W4X A;  3DK8 A;  1KFY A;  1CJ4 A;  3UKP A;  2OLO A;  2XFQ A;  4CNK A;  4RSL A;  5KMP A;  5KVH A;  4CCR A;  1GT8 A;  2GH5 A;  3AD8 B;  1O95 A;  1EL9 A;  2C76 A;  1GRA A;  4A65 A;  2Q6U A;  4BJZ A;  2FJA A;  3GYI A;  5KVI A;  3UOY A;  3L5O A;  2IID A;  1L0V A;  2BRA A;  2YLW A;  4PAB A;  2XLR A;  3NGC X;  1V59 A;  3PO7 A;  1GSN A;  4YSH A;  2XVH A;  2R46 A;  4XWZ A;  4AT0 A;  2WPC A;  4B65 A;  3CPJ G;  3BHF A;  1H86 A;  3NYF A;  4EQS A;  1K4Q A;  1PBB A;  2O9Z A;  5EBK A;  2YAU A;  3B6D A;  3QFB A;  2JKC A;  4K5S A;  1COY A;  3SZW A;  3E1T A;  1JRZ A;  3NK2 X;  3L8K A;  4U2S A;  3R9U A;  2V61 A;  3NTA A;  4Y4L A;  3V3N A;  2VOU A;  4BJY A;  3GMC A;  3M13 A;  4GAV A;  1PJ7 A;  1JNZ A;  1GTE A;  4OCG A;  4OPU A;  1TRB A;  3CGE A;  1MXT A;  4B68 A;  4OPL A;  3EPT A;  3II4 A;  2WDQ A;  4O5Q A;  2BS2 A;  1BWC A;  2WPF A;  1DJQ A;  1ZDL A;  1F6M A;  4NTD A;  4OPC A;  3FBS A;  1H84 A;  4XWR A;  3K7Q X;  4H4X A;  4CRT A;  1PDH A;  1IJH A;  1BKW A;  5HXI A;  3NN6 X;  4HB9 A;  4U8O A;  3ADA B;  5EOW A;  1NDA A;  4AOX A;  2BK5 A;  4ECH A;  2VZ2 A;  4NNJ A;  2V3B A;  3PVC A;  4H4W A;  2I0Z A;  2E4G A;  1F3P A;  3VRA A;  3DJG X;  4BUR A;  2XFU A;  4YXD A;  1CJC A;  1XPQ A;  3ALJ A;  4WX1 A;  4EM3 A;  3AE5 A;  3AXB A;  4GUV A;  1K0I A;  3CIR A;  2R0G A;  2EQ6 A;  3D8X A;  1LJ1 A;  2GMH A;  3GWD A;  4B63 A;  1E1N A;  2GAG B;  5FS7 A;  4BK1 A;  2R45 A;  4HA6 A;  1GER A;  4KPR A;  2BA9 A;  2V5Z A;  1ELI A;  3AWI A;  4U8K A;  1PHH A;  2GRT A;  4FK1 C;  2GV8 A;  3UP4 A;  3BNU A;  2YWL A;  4ZCC A;  1RSG A;  4RG3 A;  4X9N A;  1YY5 A;  4B1B A;  4Y4N A;  1FL2 A;  1S3B A;  2BAC A;  3ZYX A;  1PBE A;  4H4V A;  3UCL A;  2XLS A;  2WDV A;  3G5R A;  4USR A;  5C2T A;  5M10 A;  3RP8 A;  1NEN A;  2YVF A;  1YQ4 A;  3KD9 A;  1TYP A;  1KNR A;  2C70 A;  3G5S A;  3GDN A;  3NLC A;  1XHC A;  4EM4 A;  1QLB A;  5CQF A;  4H4Y A;  5JCL A;  3GMB A;  2WP5 A;  2B9W A;  3ISH A;  4ZCD A;  2GAH B;  4NTC A;  4MJW A;  2WDR A;  4YWO A;  4J57 A;  1N4U A;  2YG6 A;  3NG7 X;  4II2 A;  1LV0 A;  2WP9 A;  2V6O A;  1P2E A;  1YQ3 A;  3FIM B;  2GQW A;  4EMW A;  3AE9 A;  4OPT A;  3SXI A;  3SZF A;  1NHP A;  2BC1 A;  4K8D A;  2C66 A;  3T31 A;  1ZY8 A;  5IQ4 A;  1D7Y A;  1D4D A;  3CGD A;  1K0J A;  2XLU A;  3M0O A;  4II3 A;  2WBA A;  4NEW A;  2YG5 A;  4YTP A;  4K7Z A;  1GV4 A;  3AE7 A;  4TLZ A;  4LII A;  1JU2 A;  1RYI A;  4TM4 A;  4WCT A;  3P1W A;  3AE2 A;  3P9U A;  4J31 A;  4C3X A;  1IUW A;  3EAN A;  2XVE A;  1BGN A;  3T37 A;  4H2R A;  4NEV A;  4YKF A;  3CGC A;  2WOV A;  2QCU A;  2CDU A;  2BCP A;  3M12 A;  1BF3 A;  1D5T A;  2C72 A;  2XFN A;  2ZBW A;  4Z43 A;  4Z2T A;  1QO8 A;  5KOX A;  1OJC A;  3UOZ A;  3CPH G;  2V60 A;  4AP3 A;  3QJ4 A;  4X4J A;  3DK9 A;  5FS8 A;  4EQW A;  3AEF A;  2YLS A;  5LV9 A;  2RGJ A;  1H7X A;  3SGL A;  2GR1 A;  3Q9T A;  2TMD A;  2WES A;  3BNM A;  3UKH A;  2X8H A;  4ICY A;  4EMI A;  3F8P A;  3LZW A;  4H2P A;  4NTE A;  4YTN A;  5KMS A;  4Z2U A;  1LTX R;  4C77 A;  1KF6 A;  3QSE A;  2EQ9 A;  3CNT A;  4A99 A;  2R0P A;  3G5Q A;  1JOA A;  3LZX A;  1H7W A;  2QA1 A;  5FMH A;  1E1K A;  3SX6 A;  3ICT A;  3QVP A;  2RGH A;  2B7R A;  2XVF A;  2J3N A;  1GAL A;  4U8P A;  1XAN A;  3SYI A;  3UOX A;  1CL0 A;  3GD4 A;  4C74 A;  4H50 A;  5BUL A;  3AE4 A;  5IPY A;  5CKU A;  4GR1 A;  3RNM A;  4B66 A;  1M6I A;  3ATQ A;  1K0L A;  2APG A;  2YLR A;  2IVD A;  4U8I A;  1XDI A;  3QFA A;  2C4C A;  4TM1 A;  4OPG A;  2BYB A;  3AEE A;  5GRT A;  3DGH A;  1TDN A;  2FJE A;  3UTH A;  4U8J A;  3AD9 B;  1GND A;  2YG7 A;  2YVJ A;  3H8I A;  3AYI A;  4Z2R A;  1F8R A;  2OA1 A;  1DJN A;  2R9Z A;  4OPI A;  4J56 A;  2Y6R A;  4A6N B;  2BRY A;  2QAE A;  3FPZ A;  3DH9 A;  3AE8 A;  3NK0 X;  5DBJ A;  4GF7 A;  3UOV A;  3AE1 A;  1GRG A;  1TDK A;  2A87 A;  2VVL A;  2XLP A;  3B3R A;  2TPR A;  2WQY A;  2Q0K A;  3T2K A;  3FG2 P;  3VR9 A;  3LOV A;  4DSG A;  2ACZ A;  1OJT A;  2B9Y A;  1BZL A;  4H4Z A;  5U25 A;  2Q7V A;  4G6G A;  1GET A;  4I58 A;  3T0K A;  2H89 A;  2PHH A;  2GQF A;  2XVJ A;  1FEA A;  3DGZ A;  1S2Y A;  5FS6 A;  3NNE A;  4EQX A;  1FOH A;  1GES A;  2B9X A;  4OPD A;  3AEA A;  1GRH A;  3SQP A;  3C4N A;  1TYT A;  5KNL A;  4G74 A;  2X8C A;  4H4U A;  1Y56 A;  3K30 A;  1F8S A;  3I6D A;  3P4S A;  1PBF A;  4EIP A;  1B37 A;  3AED A;  3UKQ A;  1P2H A;  1IUX A;  3SFE A;  4BV6 A;  3P4P A;  3HYW A;  1OJ9 A;  3GYJ A;  2X3N A;  1OJD A;  3GYX A;  3NHO X;  4GDE A;  4OVI A;  4E0V A;  1JNR A;  3AE6 A;  3KPF A;  4ZN0 A;  1LQU A;  2C65 A;  5JCM A;  4A9W A;  1L9D A;  1ZX9 A;  3SZC A;  4IVM B;  3AEG A;  3EAO A;  2JAE A;  3QSM A;  2GR0 A;  2FJD A;  4AT2 A;  3IHM A;  3QVR A;  1DNC A;  1REO A;  1S2Q A;  3LJP A;  4JY3 A;  4TM3 A;  1H81 A;  4PAA A;  4APN A;  3GRS A;  2Y6Q A;  3GD3 A;  3BI2 A;  3KKJ A;  2ZZC A;  3CN8 A;  3SZ0 A;  4D03 A;  1F8W A;  1H2I A;  3D1C A;  3GDP A;  1E7P A;  3RED A;  1E1M A;  5M0Z A;  3K7M X;  4YSZ A;  3SY4 A;  1O94 A;  1N4V A;  1ONF A;  3AYL A;  1DOD A;  1JRX A;  1KSU A;  1L9C A;  2C7G A;  3ITJ A;  3L1R A;  3DK4 A;  2NVK X;  1IUT A;  3H4K A;  3T2Y A;  4A79 A;  3GSI A;  5KMQ A;  1FEB A;  2GEW A;  1S7M A;  2YLX A;  2A8X A;  2XFP A;  2FJB A;  3ALM A;  1TDF A;  2WU5 A;  2WEU A;  3CNS A;  4USQ A;  4XXG A;  2UZZ A;  1HYU A;  3UTG A;  3BI4 A;  2R4E A;  1NPX A;  2CFY A;  3UP5 A;  1B8S A;  3IWA A;  2BAB A;  4RG4 A;  3LXD A;  2XDO A;  4IV9 A;  4A5L A;  2B7S A;  4UP3 A;  5U63 A;  4AP1 A;  1PBD A;  4YSY A;  3NYE A;  1NG4 A;  2WET A;  2ZZ0 A;  2H88 A;  1JEH A;  2GF3 A;  4U8L A;  2BCG G;  4JN9 A;  3ABV A;  2WPE A;  3HYX A;  1PS9 A;  2E5V A;  1EBD A;  2CVJ A;  3T14 A;  3S61 A;  2WS3 A;  5KWF A;  2A89 A;  3Q6J A;  2JBV A;  2QA2 A;  4BK2 A;  1D4C A;  4LA1 A;  1KDG A;  3C4A A;  4BK3 A;  1PBC A;  3DA1 A;  4CCQ A;  1GOS A;  4JDR A;  2FBW A;  3KVE A;  5FS9 A;  1LQT A;  4REK A;  5HY5 A;  2DKH A;  1KN0 A;  1X31 B;  2F5Z A;  4TM0 A;  2C64 A;  1M64 A;  4B64 A;  1GXF A;  2Z5X A;  2YM2 A;  1CJ2 A;  3UKA A;  2C67 A;  3I3L A;  4YTM A;  5BUK A;  2NPX A;  2B76 A;  3GRT A;  2Z5Y A;  1ZOY A;  2GVC A;  4IA5 A;  1DOC A;  2RGO A;  2WOI A;  2E1M A;  4U2T A;  1RP0 A;  4DNA A;  1CC2 A;  2OAL A;  2V3A A;  4YSX A;  2GR3 A;  1GTH A;  1ZMD A;  5J7X A;  3V76 A;  4EMJ A;  2XLT A;  3UTF A;  3ICS A;  3F8R A;  2XVI A;  3T2Z A;  4DSH A;  3IC9 A;  1CC6 A;  2PYX A;  3CMM A;  1DOB A;  2X50 A;  1N4W A;  1Z6L A;  3IF9 A;  4GCM A;  5JRB A;  2YR4 A;  3P4R A;  2VQB A;  2R0C A;  3P4Q A;  2JB3 A;  2XYO A;  1GEU A;  4UDP A;  4H4S A;  2JB2 A;  3AB1 A;  3CPI G;  3NN0 X;  5BRT A;  5J60 A;  4K2X A;  1NHQ A;  2CUL A;  4U2L A;  5L46 A;  3VRD B;  2OLN A;  2EQ7 A;  1VDC A;  1ZP0 A;  3UKF A;  4A6N A;  3ICR A;  5HYM A;  2WU2 A;  5EB4 A;  4J34 A;  5KMR A;  5HHF A;  3KLJ A;  3CTY A;  4G73 A;  3AD7 B;  4H4T A;  4JNA A;  4Z25 A;  1VRQ B;  4H2N A;  2DKI A;  3NYC A;  2GB0 A;  2C73 A;  4H4P A;  1GRF A;  2EQ8 A;  1IUS A;  3NK1 X;  1GRT A;  1PXA A;  2Q0L A;  1YQZ A;  3PS9 A;  3DJJ A;  1DOE A;  1TDO A;  1VG0 A;  3WE0 A;  3AE3 A;  1N1P A;  1B5Q A;  2C3D A;  3EF6 A;  4YT0 A;  5KRQ A;  2YVG A;  3O0H A;  3RP7 A;  2AAQ A;  2VVL G;  4JQ9 A;  1QJD A;  3H8L A;  3JSK A;  1ZMC A;  1NG3 A;  3AEC A;  1LVL A;  3KPK A;  4J36 A;  4AOS A;  2BS3 A;  3NKS A;  1CHU A;  4A7A A;  1ZKQ A;  1IUV A;  4O5U A;  4Z44 A;  3UTE A;  2VVM A;  3S5W A;  1PXB A;  2GR2 A;  2WHD A;  4CBQ A;  1PXC A;  3DJD A;  3V3O A;  4H4R A;  1GPE A;  4FK1 A;  3URH A;  2VRM A;  3NT6 A;  3AEB A;  4J2W A;  4D04 A;  2YLT A;  4UDR A;  4Y4M A;  5BVA A;  4M52 A;  3CGB A;  1UKV G;  3CNP A;  4Z24 A;  4B67 A;  1GRE A;  3GWF A;  4YKG A;  2BS4 A;  1D7L A;  3DJE A;  1VG9 A;  1ZK7 A;  2OAM A;  1Q1R A;  5JCI A;  2YR5 A;  2VQ7 A;  2XCG A;  4NZH A;  5ER0 A;  2AQJ A;  1E39 A;  1IUU A;  5KOW A;  3PG6 A;  2R4J A;  3QSS A;  2YM1 A;  4UDQ A;  4EQR A;  1SEZ A;  5TR3 A;  3ALL A;  4LU6 A;  1CJ3 A;  2XFO A;  4FX9 A;  3KA7 A;  4JNQ A;  4JY2 A;  4U8M A;  1NHS A;  1EL5 A;  2YG3 A;  4C3Y A;  3VRB A;  4CY6 A;  1E6E A;  3F8D A;  4U8N A;  2ZZB A;  3C96 A;  2C3C A;  2BC0 A;  3VR8 A;  4CY8 A;  5U1O A;  2VRL A;  2JK6 A;  1L9E A;  4H2Q A;  2GMJ A;  3HYV A;  3UKK A;  3BI5 A;  3SFD A;  4H7U A;  2WOW A;  3ZDN A;  5C3J A;  4K5R A;  5KXJ A;  3NTD A;  4G9K A;  4Z26 A;  2X8G A;  1CBO A;  1D4E A;  3LAD A;  1FEC A;  1KNP A;  3BHK A;  1B4V A;  3RP6 A;  3SM8 A;  3CND A;  4G6H A;  4EIQ A;  1Q9I A;  1NAA A;  3ATR A;  5JCN A;  2JB1 A;  4P9S A;  3NRN A;  1LPF A;  1ZOV A;  3KU9 A;  4H4Q A;  4DGK A;  4GRT A;  2HQM A;  1E1L A;  1Y56 B;  3COX A;  3AYJ A;  5IQ1 A;  4CNJ A;  2X99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...