4FDCB

Crystal structure of the e493v mutant of human apoptosis inducing factor (aif)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
483
structure length
461
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYVAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Cowchock syndrome is associated with a mutation in apoptosis-inducing factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis, oxidoreductase
total genus 135
structure length 461
sequence length 483
ec nomenclature ec 1.-.-.-:
pdb deposition date 2012-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
B PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4fdcB03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fdcB02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fdcB01
2VVMA 3UOXA 2Q7VA 3PO7A 3URHA 3SFDA 5M10A 4A6NB 1B37A 3VQRA 3CNJA 4Z43A 4CCQA 4Y4MA 5GRTA 4X9NA 1FEBA 1TDNA 3H8IA 4YSXA 3NYFA 3K30A 3B6DA 2GMHA 2VOUA 3I6DA 3AE3A 2XFOA 3UTHA 2WESA 2C65A 3CPHG 4U8KA 3VRBA 4BK1A 1GOSA 2ZZ0A 1LQTA 1YQ4A 3CPIG 2GAGB 3D8XA 3NK0X 1UKVG 4Z26A 2CFYA 2C67A 1COYA 2HQMA 1BZLA 3IC9A 3EF6A 1E7PA 5U25A 4EQRA 3AE8A 3BNMA 3BI5A 3R9UA 3DGHA 4UDRA 4TM0A 2XFQA 4UDPA 4ZCDA 1QJDA 2VVLG 1NG4A 5J7XA 1QO8A 3P4PA 2RGHA 1TYTA 2AR8A 3M0OA 2JK6A 2WQYA 1D4DA 1M64A 3DJEA 3RP6A 3P9UA 3K7TA 4H4PA 2X50A 2YLWA 3M13A 3LXDA 4B63A 4DSGA 3AEDA 2XLTA 1QLBA 1GEUA 3DJGX 1GRHA 2BCGG 1ZOVA 3EANA 1JOAA 2GR2A 3E1TA 1GERA 1H6VA 4B68A 2YR6A 4A9WA 1EL5A 3UP4A 3F8PA 2WPCA 4IVOB 3UTEA 4BK2A 2YLRA 2XFUA 4AT0A 5HXIA 2X8CA 2C7GA 3NGCX 3AE7A 1GALA 1IUTA 2YLSA 2YLXA 4J31A 2GR3A 4H4XA 4EQSA 1TDOA 2XFNA 1GRFA 4X4JA 5KRQA 1D7YA 1O95A 1YQZA 1CJ3A 2BYBA 1PHHA 4J57A 4AOSA 4D03A 2BC0A 1H84A 2XVHA 3K7QX 2B76A 2YAUA 4JY2A 3NHOX 4C74A 5KVHA 4Z24A 1D4EA 4H4ZA 4XWZA 3GWDA 3H8LA 3V76A 2XFPA 1CJ4A 4J34A 5JCLA 1OJAA 4GDPA 2YG3A 1GETA 2AAQA 3DMEA 1GSNA 4TLXA 4ADWA 4JQ9A 4U2TA 4CY8A 5IQ1A 1FCDA 2DKHA 2W0HA 2X3NA 1K0JA 4U8MA 2BS3A 2E5VA 2R4EA 3UOZA 3RP7A 2EQ7A 4OCGA 4B64A 2ZZBA 1XPQA 3AECA 4YT0A 4K5SA 2GV8A 2TMDA 4DGKA 3CGCA 1CF3A 1DNCA 4H4YA 3UKFA 4X9MA 1GRAA 3EAOA 2YVFA 3NKSA 4YKGA 3C4NA 3UKHA 2Y6RA 3ALLA 2EQ8A 5JCMA 4DNAA 5KOXA 1JU2A 2FJBA 1K4QA 2Q0KA 3GSIA 2A89A 2VRMA 3ALMA 4AT2A 1K0IA 1TYPA 2XDOA 3AE9A 2R46A 3GD3A 1PJ7A 2TPRA 3NLCA 4IA5A 2EQ9A 2WOWA 2WU2A 2VVLA 3DJDA 3ITJA 1PXBA 3IWAA 3Q9TA 3VRDB 1L9CA 4NTCA 4MJWA 2WU5A 2IIDA 1N4VA 3AE4A 1N4UA 2DKIA 3ATQA 4APNA 2FJDA 3CTYA 3G5RA 4K22A 4KX6A 4TLZA 3SM8A 1PDHA 5KXJA 1GRTA 1TDEA 3AE1A 3GMBA 5KVIA 3T37A 4C3XA 5FS9A 3IHGA 4EQXA 1E6EA 1E1LA 2IVDA 3EPTA 4IV9A 2I0ZA 5BUKA 3DGZA 3FPZA 1PJ6A 3S5WA 1JEHA 2GH5A 3WE0A 1DOEA 1ZMDA 4H4WA 1DOBA 2GR0A 1F8SA 2GB0A 3CGDA 2V3BA 4J56A 1K0LA 2WP5A 1H86A 4OVIA 3KPFA 2JB2A 4H4RA 2YG7A 3NRNA 1PJ5A 2WBAA 2V60A 2XLUA 1ZX9A 2OALA 4FX9A 4U8IA 2JKCA 1NG3A 2XVIA 4LA1A 2C76A 4C77A 1BKWA 1CC2A 1CJ2A 4BK3A 2GR1A 1P2EA 5BRTA 1PS9A 2VQBA 1XANA 2YG6A 2C66A 4OPGA 4OPTA 3RNMA 4ZCCA 4H4TA 3ADAB 1GNDA 3BI4A 1VQWA 1VRQB 1ZKQA 3DK4A 1JRXA 3AEFA 4WCTA 3OC4A 2Z5YA 2APGA 4TM4A 1F6MA 2PYXA 3NIXA 1L9DA 1KFYA 1EL9A 1OJ9A 2YLTA 4E0VA 3CNPA 3QFBA 5EOWA 1PBDA 5TR3A 1GREA 2CVJA 2R0CA 1RYIA 1NPXA 2Q6UA 2OAMA 4I59A 2FJEA 2H89A 1S3EA 1DJNA 3C96A 3UOYA 4YTPA 3LOVA 3QSMA 3KD9A 1LPFA 1GTEA 3AEEA 3LB8A 3NNEA 4NTEA 4EM3A 3GYIA 3QVPA 2QAEA 1KNPA 1DODA 3G5QA 1KDGA 2XVEA 3QSEA 4ECHA 3PVCA 4EQWA 1RSGA 1TRBA 2RGOA 3FIMB 3CGBA 4CRTA 4O5QA 2A8XA 3NK1X 2C75A 2R4JA 4EMIA 4K8DA 1CC6A 1S2QA 3GDPA 5DBJA 2C3DA 1F8WA 3BHFA 2PHHA 2QA2A 2XLSA 3ICRA 3FG2P 3GYJA 3VR8A 4GRTA 3AE2A 2GEWA 1ZK7A 1E1MA 3K7MX 3NYEA 4I58A 3IF9A 1ONFA 3DK8A 4BURA 5CKUA 4YSHA 2GRTA 2BS4A 3AYLA 2XVJA 1NHRA 3AE5A 3REDA 2V3AA 2H88A 1Z6LA 2R0PA 1O94A 3ABVA 2RGJA 1NHQA 1Q1RA 1N1PA 5FS6A 1H82A 3AXBA 5FMHA 3BNUA 1FECA 3LZWA 5U63A 3S61A 5IPYA 2GAHB 4Y4LA 1FEAA 2BACA 4JNQA 4CBQA 3OZ2A 4PAAA 2BS2A 2VRLA 2BXRA 1XHCA 2R45A 3SGLA 5ER0A 2BA9A 4YKFA 4OPIA 5HYMA 1OJCA 2B7RA 3P1WA 2BK3A 4USRA 2WOVA 5JCKA 3M12A 2C73A 5IQ4A 4A5LA 1XDIA 1ZP0A 3KLJA 2GVCA 3AWIA 3DJJA 1NAAA 4K5RA 1CJCA 2ARDA 1GRGA 1HYUA 1VG9A 1NEKA 1CHUA 4RSLA 2GQFA 3JSKA 4RG4A 4HA6A 4AP3A 1IUSA 2B9WA 1D5TA 3UTFA 3AEAA 4U8PA 5CQFA 3ICTA 4J2WA 2BABA 2EQ6A 1GXFA 3AD7B 4PABA 4H4QA 5BVAA 3NN0X 1CBOA 2GF3A 1W4XA 4RG3A 3ATRA 4BJYA 4K2XA 4Z2UA 4XXGA 1GPEA 3NH3X 1IUWA 4IVMB 4Y4NA 2WP9A 5FS8A 1IUVA 2JAEA 1VDCA 4P9SA 3LADA 2OA1A 5U1OA 3ALJA 1BWCA 2BXSA 3LJPA 4B66A 3PS9A 3VR9A 3UKPA 2XVFA 4UP3A 2JB1A 3L8KA 4AP1A 1S3BA 1F8RA 1BGJA 2WDVA 3P4QA 4U8OA 3QFAA 2BC1A 5EB5A 1GV4A 3VRAA 2WPFA 3G5SA 3NTAA 3COXA 4U2LA 1L0VA 1PN0A 4H2QA 1MXTA 2E1MA 2JB3A 5JCNA 4TM3A 4H4UA 4EM4A 2ZBWA 1D4CA 1YQ3A 4J33A 3ZYXA 4CCRA 1Q9IA 2WPEA 3RHAA 2V61A 1H81A 2YLZA 3RP8A 2NVKX 4REKA 3P4RA 4ICYA 2GQWA 2WP6A 2Q0LA 2OLOA 4CNJA 2Y6QA 1NHPA 3AYIA 3D1CA 1PBBA 1B4VA 3FBSA 1H7WA 5JCIA 4GUVA 4U8NA 2C70A 4BJZA 4C5OA 2AQJA 4CY6A 1EL8A 1E39A 3GDNA 1CC4A 2WS3A 4OPCA 2YVJA 1GTHA 2IVEA 1LQUA 1PBEA 3ISHA 4GCMA 4U8JA 4C3YA 1NENA 4YTNA 2VQ7A 2UZZA 1Y56A 3BHKA 3LZXA 4JN9A 4GR1A 2CULA 1VG0A 4A7AA 4B67A 1GT8A 1OJDA 3GRTA 3H4KA 3GRSA 3DA1A 3QVRA 1Y56B 1LJ1A 4NEVA 2WDRA 4JY3A 1H83A 4LU6A 1YKJA 3CGEA 2V5ZA 5HY5A 4NZHA 3GMCA 4DSHA 2X8HA 4CNKA 5C3JA 3GD4A 4A79A 1IJHA 3UKQA 3V3NA 4TM1A 2YVGA 1BGNA 3UKAA 1ZOYA 1MOKA 2A87A 1EBDA 1KNRA 2YG4A 1KSUA 1V59A 3DK9A 1E1NA 2WHDA 2XLRA 4H50A 3I3LA 1JNZA 3UKLA 5KOWA 4YWOA 3DH9A 4FK1A 4B65A 1M6IA 4OPUA 3AD8B 3C4AA 2X8GA 4Z2TA 2R0GA 3KVEA 3NYCA 1ZY8A 1S2YA 4B1BA 2XYOA 4YTMA 3NTDA 1X31B 3CIRA 1OJTA 2C3CA 4USQA 3QSSA 4NTDA 1NHSA 2NPXA 4YXDA 3P4SA 2B7SA 4LIIA 4FDCB 1H7XA 3CPJG 2YR5A 1CL0A 1SEZA 1IUUA 4GF7A 1ZDLA 2Z5XA 2BCPA 1FOHA 3UOVA 2J3NA 1B8SA 3UCLA 5LV9A 3V3OA 2YG5A 4U8LA 3QJ4A 4H2PA 3AEGA 3SQPA 1N4WA 2O9ZA 3UKKA 5BULA 3UTGA 2ACZA 4NEWA 1B5QA 5KWFA 4GDEA 1JNRA 3HZLA 1PXCA 4OPLA 4Z2RA 1YY5A 4HB9A 3B3RA 1IUXA 2E4GA 3NG7X 1F3PA 3ICSA 4H4SA 1LTXR 3AD9B 2X99A 1DXLA 1KF6A 3II4A 1PBCA 2JBVA 4Z25A 2B9XA 5HHFA 2ZZCA 2YM1A 1LVLA 2FBWA 3CNSA 3CN8A 2V6OA 4A99A 5EBKA 1KSSA 1MO9A 4ZN0A 1LV0A 2FJAA 3BI2A 3KKJA 1RP0A 1DJQA 3AB1A 4U2SA 5C2TA 2RABA 3F8DA 3CNDA 2XCGA 1D7LA 4J36A 2YR4A 4FK1C 2YM2A 4AOXA 1JRZA 2CDUA 4BV6A 3NN6X 2BK4A 3NT6A 3O0HA 4IA6A 1ZMCA 1NDAA 2R9ZA 3L1RA 4A65A 4KPRA 4EMWA 4EMJA 3IHMA 1E1KA 4JNAA 1O5WA 5EB4A 3UP5A 3F8RA 4JDRA 1TDFA 2B9YA 2WOIA 4N9XA 1FL2A 4XWRA 3AYJA 4D04A 2WEUA 3Q6JA 1GESA 1AOGA 2XLPA 4EIQA 1DOCA 1BF3A 2QA1A 4M52A 4H7UA 2OLNA 2QCUA 3AEBA 3ZDNA 3FMWA 5L46A 2BK5A 3KA7A 2C64A 2WDQA 1GRBA 1EL7A 5GSNA 4OPDA 2VZ2A 5M0ZA 1ELIA 4O5UA 4WX1A 2YQUA 3GWFA 4K7ZA 5FS7A 1L9EA 2WETA 4YSZA 4Z44A 5J60A 1Y0PA 2YWLA 1TDKA 4EIPA 4H4VA 1Q1WA 3NK2X 1PXAA 3KU9A 3SFEA 4B69A 4H2RA 4A6NA 1REOA 4YSYA 1P2HA 3AE6A 4H2NA 1JRYA 2F5ZA 4UDQA 3CNTA 1PBFA 2GMJA 2C72A
chains in the Genus database with same CATH superfamily
2VVMA 1MDRA 1TKKA 2XGZA 4X9NA 1TDNA 3K30A 3B6DA 2GMHA 3K1GA 2BRYA 3I6DA 2XFOA 2WESA 4E6MA 1F9CA 3UJRA 1LQTA 3T0KA 2C67A 1COYA 3IC9A 3EF6A 2P8BA 3MUCA 5U25A 3AMZA 3L5OA 2I5QA 2HZGA 4UDPA 3HRDC 1QJDA 3M0OA 2JK6A 2ONEA 3DJEA 3P9UA 3K7TA 1QLBA 2BCGG 1GRHA 3JW7A 2QJJA 2GR2A 1GERA 2C4CA 4BK2A 1SJBA 5HXIA 2C7GA 3AE7A 3FVDA 4G7FA 4X4JA 1O95A 2BC0A 1H84A 2XVHA 2B76A 3ETRB 5KVHA 3V76A 4J34A 1CJ4A 1OJAA 4GDPA 4GISA 1GSNA 4TLXA 3BOXA 5IQ1A 1FCDA 2X3NA 4U8MA 2E5VA 4KEMA 3RP7A 4YT0A 4K5SA 2GV8A 4DGKA 3CGCA 4H4YA 3RGTA 3UKFA 3NKSA 5KOXA 1JU2A 4II2A 3TW9A 2Q0KA 1TZZA 2VRMA 1K0IA 1TYPA 2TPRA 2EQ9A 3MKCA 2WOWA 1PXBA 2WU5A 2QJMA 4DXKA 4K22A 3ATQA 2FJDA 3SM8A 5KXJA 1TDEA 3T37A 2PU0A 3U4FA 1E6EA 3A7UA 2I0ZA 1DOEA 4H4WA 2GR0A 3KPFA 4H4RA 3NRNA 2WBAA 1TE6A 3TOYA 4U8IA 4LA1A 4IL2A 4C77A 4H83A 1W6TA 1CJ2A 5BRTA 1XANA 2YG6A 3DGBA 2CHRA 3BI4A 1VQWA 1VRQB 4WCTA 1EL9A 4E0VA 2OZ3A 3CNPA 5EOWA 4ENLA 4GFIA 4GIRA 2Q6UA 2H89A 3C96A 3QSMA 3OZYA 1XPYA 2QGYA 4ROPA 2QAEA 3BJSA 4EQWA 3A7AA 3CGBA 4CRTA 4O5QA 2A8XA 3QPEA 3RR1A 1F8WA 4GGBA 2QA2A 3AE2A 4ZOHB 2P8CA 1ONFA 4BURA 5CKUA 2HNEA 3HYXA 3AE5A 3REDA 1P48A 1ECQA 3ABVA 3OZMA 3MSYA 1FECA 3R1ZA 3S61A 2GAHB 4Y4LA 1FEAA 3GYXA 1WUEA 4JNQA 4CBQA 4PAAA 4E4UA 2W54A 1XHCA 3SGLA 3T6CA 5HYMA 2FKPA 2BK3A 4USRA 4G74A 4A5LA 1XDIA 3T4WA 3DJJA 1GRGA 4A3RA 2AL2A 4RG4A 2PCEA 4U8PA 5CQFA 5FJUA 3AD7B 5BVAA 3UJSA 1CBOA 1W4XA 4BJYA 3NH3X 3CXOA 2JAEA 1BWCA 3PS9A 3VR9A 3UKPA 4AP1A 1S3BA 5KNLA 3N4EA 5BOEA 3P4QA 4HCLA 4U8OA 2BC1A 3IJLA 2WPFA 3NTAA 1JDFA 3COXA 1L0VA 1PN0A 3SZCA 3MWCA 4EM4A 3GC2A 4CCRA 2WPEA 3RHAA 3RP8A 2YLZA 4ICYA 2GQWA 4CNJA 2OVLA 1NHPA 3AYIA 4U8NA 4CY6A 2MUCA 1EL8A 3FV9A 4KPLA 1NENA 3DG6A 5J04A 3LZXA 4JN9A 4GR1A 1X2GA 4A7AA 1GT8A 1OJDA 3H4KA 1Y56B 4NEVA 4JY3A 3H7VA 3GMCA 4CNKA 3R07C 3GD4A 3UKQA 4TM1A 5FJTA 3UKAA 3DK9A 4H50A 3I3LA 2OO6A 3UKLA 5KOWA 4B65A 3TQPA 3DFHA 3AD8B 4OPUA 1L8PA 2GSHA 4B1BA 3GD6A 4YTMA 1X31B 1OJTA 3NO1A 4G73A 4IP5A 2DW6A 2Z5XA 3UOVA 2J3NA 1WUFA 5FJPA 6ENLA 3AEGA 3P3BA 2E5AA 4NEWA 1B5QA 5KWFA 1JNRA 3HZLA 3B3RA 3ZVHA 3CXBA 3EUB3 3ICSA 1LTXR 1DXLA 1KF6A 2YM1A 3CNSA 2V6OA 2QQ6A 4E8GA 2RABA 3F8DA 2XCGA 4HYRA 3FYYA 2YR4A 2CDUA 4BV6A 3PG6A 3O0HA 2R9ZA 1NDAA 3L1RA 3IHMA 1JROA 5EB4A 3JZUA 4JDRA 2BRAA 4N9XA 1N60C 3SSZA 3Q6JA 4M52A 2OLNA 3N6JA 3AEBA 3ZDNA 5L46A 2WDQA 1EL7A 5M0ZA 3GWFA 3SR6B 3CK5A 4HCHA 3NK2X 1PXAA 3AE6A 2F5ZA 2DW7A 3URHA 5M10A 3SZWA 1B37A 3D46A 4CCQA 3H8IA 4GGHA 3NYFA 2MNRA 2VOUA 4GAVA 4IL0A 2ZZ0A 1YQ4A 2PP3A 1UKVG 4Z26A 2CFYA 2HQMA 1BZLA 3BNMA 1BQGA 3CT2A 3ZLHA 4TM0A 1NG4A 1D4DA 4X2PA 4H4PA 3M13A 1KCZA 4DSGA 2XLTA 1GEUA 3DJGX 3EANA 1H6VA 2YR6A 4FP1A 3UP4A 2WPCA 2XFUA 5G5GB 2X8CA 2YLXA 4EQSA 2XFNA 1GRFA 5KRQA 1D7YA 1CJ3A 2BYBA 4AOSA 2YAUA 4Z24A 4XWZA 1FHVA 1GETA 4U2TA 4K2SA 3HYVA 2DKHA 3R11A 1K0JA 2EQ7A 1XPQA 2TMDA 4F4RA 1DNCA 2XH0A 3ALLA 5JCMA 2A89A 4AT2A 3AE9A 1PJ7A 4K8GA 3DJDA 3ITJA 3IWAA 2E3TA 4MJWA 2IIDA 3CTYA 1N4UA 2DKIA 4TLZA 4KX6A 1ONEA 3MZNA 3GMBA 3IHGA 4EQXA 1E1LA 3EPTA 4IV9A 3FPZA 3S5WA 1ZMDA 1F8SA 3UKHA 2V3BA 2WP5A 1E9IA 1R0MA 2JB2A 1PJ5A 2V60A 1ZX9A 2OALA 1NG3A 2XVIA 2C76A 2OPJA 2OLAA 1CC2A 3D47A 1P2EA 2VQBA 2C66A 4ZCCA 3ADAB 1GNDA 2PTXA 2OQHA 2QDEA 1JRXA 5FJOA 4TM4A 2XH2A 3NIXA 1L9DA 1KFYA 3SXIA 1MDLA 2CVJA 4HCDA 2R0CA 4M6UA 1S3EA 3KD9A 2OKTA 3AEEA 3LB8A 4EM3A 3GYIA 3QVPA 1KNPA 1DODA 3QSEA 1TRBA 3FIMB 4DN1A 4EMIA 1CC6A 3VR8A 1ZK7A 1T3QC 1E1MA 3K7MX 3TTEA 3IF9A 4IZGA 1NHRA 1Z6LA 1MRAA 2RGJA 1NHQA 4DYEA 3AXBA 3LZWA 4NNJA 3OZ2A 2BS2A 3T2ZA 2GGHA 2R45A 4OPIA 3P1WA 5FJRA 1VQZA 1HYUA 1VG9A 1NEKA 1CHUA 4RSLA 2GQFA 3JSKA 1IUSA 1NELA 2B9WA 3GO2A 4TVYA 2ZADA 2BABA 2W3SA 1GXFA 4PABA 3AN1A 3NN0X 3ATRA 4K2XA 4XXGA 3BSMA 1IUWA 2OFJA 3QKEA 5ENLA 1VDCA 4P9SA 3LJPA 4TVWA 4YWSA 2XVFA 1F8RA 4IHCA 4M0XA 3QFAA 5EB5A 1GV4A 3S5SA 3G5SA 1MXTA 4H4UA 2ZBWA 1N5WC 1H81A 1V97A 2Y6QA 4C5OA 3GDNA 3ZVIA 4A6GA 2WS3A 1GTHA 2IVEA 4GCMA 4YTNA 2VQ7A 1Y56A 3BHKA 2GGJA 3SY4A 4B67A 3DA1A 2GGEA 5HY5A 5C3JA 2ZC8A 1IYXA 1EBDA 1KSUA 1V59A 1E1NA 2WHDA 2XLRA 3T31A 3CMMA 4Z2TA 2R0GA 3KVEA 3NYCA 3NTDA 2C3CA 4NTDA 2NPXA 4YXDA 2YR5A 1CL0A 4E4FA 2PP0A 1S7MA 2BCPA 3S47A 1B8SA 4U8LA 3QJ4A 2O9ZA 2ACZA 3Q4DA 1YY5A 2E4GA 3D9XA 2X99A 3PWGA 3UGVA 3MY9A 3RO6A 3SZFA 2B9XA 2FBWA 4A99A 3Q45A 1RP0A 2PS2A 3AB1A 2XH4A 3I6TA 2XSXA 4FK1C 2YM2A 4AOXA 1JRZA 3SN4A 1ZMCA 3NVVB 3VCNA 1E1KA 4JNAA 4G8TA 4HNLA 1TDFA 2B9YA 4JN8A 5KMRA 1DOCA 2QA1A 4H7UA 1EC7A 4Z17A 2QCUA 2C64A 1GRBA 5GSNA 2GL5A 3T8QA 4Z44A 5J60A 4A35A 5KMPA 1Q1WA 3KU9A 4B69A 3TJ4A 1FFUC 3NVZB 3CNTA 1PBFA 2Q7VA 3PO7A 3SFDA 4A6NB 3VQRA 1FO4A 3CNJA 4Z43A 2PA6A 4Y4MA 2PODA 1FEBA 4YSXA 1FFVC 3UTHA 4KT2A 3CPHG 1GOSA 3CPIG 1EC9A 1BKHA 3R9UA 4EQRA 3BI5A 4H19A 4ZCDA 3P0WA 3KPKA 5J7XA 3P4PA 2RGHA 2AR8A 3OTRA 1M64A 3RP6A 2X50A 2YLWA 3LXDA 3TWAA 1FHUA 4B68A 4A9WA 1EL5A 3UTEA 3OPSA 3VC5A 3NGCX 1IUTA 2YLSA 4H4XA 1TDOA 1YQZA 4D03A 4JY2A 1VDVA 1D4EA 4H4ZA 3T9PA 2XFPA 2YG3A 3OW1A 2PTZA 2BS3A 2R4EA 3UOZA 4OCGA 2ZZBA 1CF3A 1N61C 4YKGA 4X9MA 2NQLA 2YVFA 2EQ8A 3TWBA 4FI4A 7ENLA 3H12A 2XDOA 2AKZA 3TJIA 4IA5A 2WU2A 3SN0A 3A7RA 2VVLA 3Q9TA 3VRDB 1L9CA 3AE4A 4DHGA 4JN7A 1PDHA 4HN8A 1GRTA 3HW2A 4H1ZA 5KVIA 5FS9A 2IVDA 5BUKA 3DGZA 1PJ6A 2GH5A 3WE0A 4K1WA 2GB0A 4J56A 1H86A 3UXLA 3V5CA 2YG7A 3GY1A 4FX9A 2JKCA 3T14A 4BK3A 2GR1A 1SJCA 1PS9A 4OPGA 3QN3A 1FIQB 4G6GA 3PK7A 1MUCA 3EEZA 1ZKQA 3OC4A 3IK4A 2Z5YA 3N4FA 2PYXA 1OJ9A 2YLTA 4JHMA 3QFBA 1GREA 3UJ2A 1RYIA 1NPXA 2FJEA 3DESA 1DJNA 1LPFA 1GTEA 4NTEA 4J3ZA 2PGWA 1KDGA 4ECHA 3PVCA 1RSGA 2RGOA 2QVHA 3NK1X 2P0IA 2C75A 2R4JA 3KUMA 1S2QA 2C3DA 3BHFA 2PHHA 1JCTA 2XLSA 3ICRA 3FG2P 2PPGA 3GYJA 2GEWA 3NYEA 4I58A 3VCCA 1OEPA 3DK8A 3B97A 4YSHA 2GRTA 2XVJA 3NFUA 1N62C 2XH7A 2V3AA 2H88A 2R0PA 1H2IA 1Q1RA 1N1PA 1H82A 5FMHA 3BNUA 1STZA 5U63A 3JVAA 5IPYA 2PU1A 2VRLA 2BXRA 5ER0A 2BA9A 1NU5A 5JCKA 3M12A 2C73A 1ZP0A 3AWIA 3KLJA 2GVCA 4K5RA 5G5HB 1CJCA 2ARDA 2HXUA 1R6WA 4AP3A 4HA6A 3SX6A 3UTFA 4J2WA 4GYPC 2O56A 4H4QA 3U9IA 2GF3A 1RM6B 4RG3A 4Z2UA 2W3RA 4Y4NA 3NVYB 2OZTA 2WP9A 5FS8A 3LADA 2OA1A 5U1OA 2BXSA 4B66A 3VDGA 3L8KA 3DEQA 2WDVA 2AL1A 4U2LA 2E1MA 4TM3A 5JCNA 1YQ3A 4J33A 3ZYXA 1Q9IA 5IQ4A 3T2KA 2NVKX 2WP6A 2Q0LA 2OLOA 1PBBA 5JCIA 4GUVA 2AQJA 4OPCA 3HPFA 4E5TA 4C3YA 4U8JA 2UZZA 1LJ1A 2WDRA 4LU6A 3CGEA 4NZHA 2X8HA 1IJHA 3V3NA 1MOKA 1KNRA 5IDZA 4NWZA 4G9KA 4ZCWA 3DH9A 1SJDA 4FK1A 1M6IA 3QTPA 3C4AA 1S2YA 2XYOA 3P4SA 2B7SA 1H7XA 1SEZA 4GF7A 1ZDLA 3ES8A 3UCDA 4DX3A 3UCLA 5LV9A 3V3OA 2YG5A 1N4WA 3UKKA 3QLDA 1YEYA 3THUA 4HB9A 1IUXA 3NG7X 3T2YA 1F3PA 3AD9B 1PBCA 2JBVA 1ZXIC 1LVLA 4ZN0A 1MO9A 1PDYA 2FJAA 3BI2A 2P88A 1DJQA 1KN0A 1DTNA 2P3ZA 1PDZA 1D7LA 4J36A 2QJNA 2BK4A 3NT6A 4KPRA 4EMWA 3UP5A 3PWIA 3F8RA 1KD0A 1GESA 3FMWA 3KA7A 4OPDA 2VZ2A 4WX1A 2HXTA 4YSZA 1Y0PA 2YWLA 5KMSA 3SJNA 2OQYA 3SFEA 4H2RA 4A6NA 3SQSA 3UJFA 4YSYA 1P2HA 1JRYA 4UDQA 2C72A 3UOXA 5GRTA 2PTWA 4GMEA 3AE3A 2C65A 4U8KA 3VRBA 4BK1A 4HPNA 2GAGB 3D8XA 3NK0X 4MKSA 3I4KA 1E7PA 3AE8A 3DGHA 4UDRA 3ZLGA 2XFQA 2VVLG 1QO8A 1XS2A 3FXGA 1TYTA 2WQYA 4MGGA 3R25A 4HNCA 4B63A 3AEDA 3SBFA 1ZOVA 1JOAA 3E1TA 3F8PA 4IVOB 2YLRA 1JRPA 3PFRA 4AT0A 3R10A 1EC8A 1GALA 4J31A 2GR3A 3R0KA 3I6EA 3STPA 1PHHA 4J57A 3V4BA 3K7QX 3NHOX 4C74A 3DG7A 3GWDA 3H8LA 3ZLFA 5JCLA 2POZA 2AAQA 5JRBA 3DMEA 4ADWA 4JQ9A 4CY8A 2W0HA 4J1OA 2PMQA 4B64A 3AECA 3NS1B 1GRAA 3EAOA 3C4NA 2Y6RA 4DNAA 2FJBA 2OZ8A 1K4QA 3GSIA 1SJAA 3ALMA 2R46A 3SZ0A 3GD3A 3NLCA 4DWDA 3UJEA 2PTYA 4NTCA 1N4VA 3G5RA 4APNA 3AE1A 5BOFA 4C3XA 3DFYA 1JEHA 1DOBA 3CGDA 1K0LA 4OVIA 3UCCA 1P43A 2XLUA 3CAWA 1BKWA 2OG9A 3NRZB 4OPTA 3UXKA 3RNMA 4H4TA 2AKMA 3DK4A 3AEFA 1SB3B 5EU9A 2APGA 1F6MA 2PP1A 1PBDA 3IJIA 5TR3A 5KMQA 2OAMA 4I59A 2FYMA 3UOYA 4IP4A 4YTPA 1KKOA 3LOVA 3NNEA 3CB3A 3G5QA 2RDXA 1KKRA 2XVEA 3RCYA 4GYPA 4K8DA 3GDPA 5DBJA 4GRTA 3AYLA 2BS4A 1O94A 1EBHA 3VFCA 3DG3A 5FS6A 3V5FA 4KWSA 2BACA 1N5XA 3IJQA 4II3A 2PGEA 4YKFA 1OJCA 2B7RA 3VC6A 3V3WA 2WOVA 1NAAA 3FCPA 1D5TA 3AEAA 3ICTA 2EQ6A 2W55A 2AL2B 4MMWA 1GPEA 4IVMB 1IUVA 3FJ4A 3ALJA 4UP3A 2JB1A 3DERA 1BGJA 3N6HA 1ELSA 3HYWA 3RRAA 4H2QA 2JB3A 1D4CA 2V61A 4REKA 3P4RA 1JPMA 3D1CA 1B4VA 3FBSA 1H7WA 2C70A 4BJZA 1E39A 3ES7A 4ZA0A 1CC4A 3DIPA 2YVJA 3ENLA 1LQUA 1PBEA 3ISHA 3H8AA 2OX4A 2CULA 3P93A 1VG0A 3CYJA 1X2HA 3GRTA 3GRSA 3QVRA 2PSNA 3OP2A 4IT1A 1H83A 1YKJA 2V5ZA 4DSHA 4H2HA 4A79A 1MNSA 2YVGA 1BGNA 1ZOYA 2A87A 2YG4A 2QDDA 1JNZA 4YWOA 1JPDX 2X8GA 1ZY8A 3CIRA 2GDQA 1WYGA 3QSSA 4USQA 4G6HA 1NHSA 4LIIA 4FDCB 3CPJG 1IUUA 1FOHA 4H2PA 3SQPA 5BULA 3UTGA 3DDMA 4GDEA 3TCSA 1PXCA 4OPLA 4Z2RA 4H4SA 3B9JB 3II4A 4Z25A 3ZVHB 5HHFA 2ZZCA 3CN8A 5EBKA 1KSSA 1LV0A 3KKJA 1RVKA 4U2SA 5C2TA 4EWJA 3R0UA 3NN6X 4GAPA 4IA6A 1EBGA 4A65A 4EMJA 1O5WA 3NVWB 2GGIA 3NZGA 2WOIA 4XWRA 1N63C 1FL2A 3AYJA 4D04A 2WEUA 1AOGA 3MQTA 2XLPA 4EIQA 1BF3A 3NXLA 3SYIA 3RITA 2BK5A 3H70A 3VA8A 1ELIA 4O5UA 2YQUA 4K7ZA 5FS7A 1L9EA 3SN1A 2WETA 3EKGA 1TDKA 4EIPA 4H4VA 1REOA 3AM9A 4H2NA 2GGGA 4Z1YA 3VRAA 2GMJA 3CNDA
chains in the Genus database with same CATH topology
2VVMA 3UOXA 2Q7VA 3PO7A 3URHA 3SFDA 5M10A 3SZWA 1B37A 4A6NB 3VQRA 3CNJA 4Z43A 4CCQA 4Y4MA 5GRTA 4X9NA 1FEBA 1TDNA 3H8IA 4YSXA 3NYFA 3K30A 3B6DA 2GMHA 2VOUA 3I6DA 2BRYA 3AE3A 2XFOA 3UTHA 2WESA 2C65A 4GAVA 3CPHG 4U8KA 3VRBA 4BK1A 1GOSA 2ZZ0A 1LQTA 1YQ4A 3CPIG 2GAGB 3T0KA 3D8XA 3NK0X 1UKVG 4Z26A 2CFYA 2C67A 1COYA 2HQMA 1BZLA 3IC9A 3EF6A 1E7PA 5U25A 4EQRA 3AE8A 3BNMA 3BI5A 3R9UA 3L5OA 3DGHA 4UDRA 4TM0A 2XFQA 4UDPA 4ZCDA 1QJDA 2VVLG 3KPKA 1NG4A 5J7XA 1QO8A 3P4PA 2RGHA 1TYTA 2AR8A 3M0OA 2JK6A 2WQYA 1D4DA 1M64A 3DJEA 3RP6A 3P9UA 3K7TA 4H4PA 2X50A 2YLWA 3M13A 3LXDA 4B63A 4DSGA 3AEDA 2XLTA 1QLBA 1GEUA 3DJGX 1GRHA 2BCGG 1ZOVA 3EANA 1JOAA 2GR2A 3E1TA 1GERA 1H6VA 4B68A 2YR6A 4A9WA 1EL5A 2C4CA 3UP4A 3F8PA 2WPCA 4IVOB 3UTEA 4BK2A 2YLRA 2XFUA 4AT0A 5HXIA 2X8CA 2C7GA 3NGCX 3AE7A 1GALA 1IUTA 2YLSA 2YLXA 4J31A 2GR3A 4H4XA 4EQSA 1TDOA 2XFNA 1GRFA 4X4JA 5KRQA 1D7YA 1O95A 1YQZA 1CJ3A 2BYBA 1PHHA 4J57A 4AOSA 4D03A 2BC0A 1H84A 2XVHA 3K7QX 2B76A 2YAUA 4JY2A 3NHOX 4C74A 5KVHA 4Z24A 1D4EA 4H4ZA 4XWZA 3GWDA 3H8LA 3V76A 2XFPA 1CJ4A 4J34A 5JCLA 1OJAA 4GDPA 2YG3A 1GETA 2AAQA 5JRBA 3DMEA 1GSNA 4TLXA 4ADWA 4JQ9A 4U2TA 4CY8A 5IQ1A 3HYVA 1FCDA 2DKHA 2W0HA 2X3NA 1K0JA 4U8MA 2BS3A 2E5VA 2R4EA 3UOZA 3RP7A 2EQ7A 4OCGA 4B64A 2ZZBA 1XPQA 3AECA 4YT0A 4K5SA 2GV8A 2TMDA 4DGKA 3CGCA 1CF3A 1DNCA 4H4YA 3UKFA 4X9MA 1GRAA 3EAOA 2YVFA 3NKSA 4YKGA 3C4NA 3UKHA 2Y6RA 3ALLA 2EQ8A 5JCMA 4DNAA 5KOXA 1JU2A 2FJBA 4II2A 1K4QA 2Q0KA 3GSIA 2A89A 2VRMA 3ALMA 4AT2A 1K0IA 1TYPA 2XDOA 3AE9A 2R46A 3SZ0A 3GD3A 1PJ7A 2TPRA 3NLCA 4IA5A 2EQ9A 2WOWA 2WU2A 2VVLA 3DJDA 3ITJA 1PXBA 3IWAA 3Q9TA 3VRDB 1L9CA 4NTCA 4MJWA 2WU5A 2IIDA 1N4VA 3AE4A 1N4UA 2DKIA 3ATQA 4APNA 2FJDA 3CTYA 3G5RA 4K22A 4KX6A 4TLZA 3SM8A 1PDHA 5KXJA 1GRTA 1TDEA 3AE1A 3GMBA 5KVIA 3T37A 4C3XA 5FS9A 3IHGA 4EQXA 1E6EA 1E1LA 2IVDA 3EPTA 4IV9A 2I0ZA 5BUKA 3DGZA 3FPZA 1PJ6A 3S5WA 1JEHA 2GH5A 3WE0A 1DOEA 1ZMDA 4H4WA 1DOBA 2GR0A 2V3BA 1F8SA 3CGDA 2GB0A 4J56A 1K0LA 2WP5A 1H86A 4OVIA 3KPFA 2JB2A 4H4RA 2YG7A 3NRNA 1PJ5A 2WBAA 2V60A 2XLUA 1ZX9A 2OALA 4FX9A 4U8IA 2JKCA 1NG3A 2XVIA 4LA1A 2C76A 4C77A 1BKWA 3T14A 1CC2A 1CJ2A 4BK3A 2GR1A 1P2EA 5BRTA 1PS9A 2VQBA 1XANA 2YG6A 2C66A 4OPGA 4OPTA 3RNMA 4ZCCA 4G6GA 4H4TA 3ADAB 1GNDA 3BI4A 1VQWA 1VRQB 1ZKQA 3DK4A 1JRXA 3AEFA 4WCTA 3OC4A 2Z5YA 2APGA 4TM4A 1F6MA 2PYXA 3NIXA 1L9DA 1KFYA 1EL9A 1OJ9A 3SXIA 2YLTA 4E0VA 3CNPA 3QFBA 5EOWA 1PBDA 5TR3A 1GREA 2CVJA 2R0CA 1RYIA 1NPXA 2Q6UA 5KMQA 2OAMA 4I59A 2FJEA 2H89A 1S3EA 1DJNA 3C96A 3UOYA 4YTPA 3LOVA 3QSMA 3KD9A 1LPFA 1GTEA 3AEEA 3LB8A 3NNEA 4NTEA 4EM3A 3GYIA 3QVPA 2QAEA 1KNPA 1DODA 3G5QA 1KDGA 2XVEA 3QSEA 4ECHA 3PVCA 4EQWA 1RSGA 1TRBA 2RGOA 3FIMB 3CGBA 4CRTA 4O5QA 2A8XA 3NK1X 2C75A 2R4JA 4EMIA 4K8DA 1CC6A 1S2QA 3GDPA 5DBJA 2C3DA 1F8WA 3BHFA 2PHHA 2QA2A 2XLSA 3ICRA 3FG2P 3GYJA 3VR8A 4GRTA 3AE2A 2GEWA 1ZK7A 1E1MA 3K7MX 3NYEA 4I58A 3IF9A 1ONFA 3DK8A 4BURA 5CKUA 4YSHA 3HYXA 2GRTA 2BS4A 3AYLA 2XVJA 1NHRA 3AE5A 3REDA 2V3AA 2H88A 1Z6LA 2R0PA 1O94A 3ABVA 2RGJA 1NHQA 1H2IA 1Q1RA 1N1PA 5FS6A 1H82A 3AXBA 5FMHA 3BNUA 1FECA 3LZWA 5U63A 3S61A 5IPYA 2GAHB 4Y4LA 1FEAA 3GYXA 2BACA 4NNJA 4JNQA 4CBQA 3OZ2A 4PAAA 2BS2A 3T2ZA 2VRLA 2BXRA 1XHCA 2R45A 4II3A 3SGLA 5ER0A 2BA9A 4YKFA 4OPIA 5HYMA 1OJCA 2B7RA 3P1WA 2BK3A 4USRA 2WOVA 5JCKA 3M12A 4G74A 2C73A 5IQ4A 3T2KA 4A5LA 1XDIA 1ZP0A 3KLJA 2GVCA 3AWIA 3DJJA 1NAAA 4K5RA 1CJCA 2ARDA 1GRGA 1HYUA 1VG9A 1NEKA 1CHUA 4RSLA 2GQFA 3JSKA 4RG4A 4HA6A 4AP3A 1IUSA 2B9WA 1D5TA 3SX6A 3AEAA 4U8PA 5CQFA 3ICTA 3UTFA 4J2WA 2BABA 2EQ6A 1GXFA 3AD7B 4PABA 4H4QA 5BVAA 3NN0X 1CBOA 2GF3A 1W4XA 4RG3A 3ATRA 4BJYA 4K2XA 4Z2UA 4XXGA 1GPEA 3NH3X 1IUWA 4IVMB 4Y4NA 2WP9A 5FS8A 1IUVA 2JAEA 1VDCA 4P9SA 3LADA 2OA1A 5U1OA 3ALJA 1BWCA 2BXSA 3LJPA 4B66A 3PS9A 3VR9A 3UKPA 2XVFA 4UP3A 2JB1A 3L8KA 4AP1A 1S3BA 1F8RA 1BGJA 2WDVA 5KNLA 3P4QA 4U8OA 3QFAA 2BC1A 5EB5A 1GV4A 3VRAA 2WPFA 3G5SA 3HYWA 3NTAA 3COXA 4U2LA 1L0VA 1PN0A 4H2QA 3SZCA 1MXTA 2E1MA 2JB3A 5JCNA 4TM3A 4H4UA 4EM4A 2ZBWA 1D4CA 1YQ3A 4J33A 3ZYXA 4CCRA 1Q9IA 2WPEA 3RHAA 2V61A 1H81A 2YLZA 3RP8A 2NVKX 4REKA 3P4RA 4ICYA 2GQWA 2WP6A 2Q0LA 2OLOA 4CNJA 2Y6QA 1NHPA 3AYIA 3D1CA 1PBBA 1B4VA 3FBSA 1H7WA 5JCIA 4GUVA 4U8NA 2C70A 4BJZA 4C5OA 2AQJA 4CY6A 1EL8A 1E39A 3GDNA 1CC4A 2WS3A 4OPCA 2YVJA 1GTHA 2IVEA 1LQUA 1PBEA 3ISHA 4GCMA 4U8JA 4C3YA 1NENA 4YTNA 2VQ7A 2UZZA 1Y56A 3BHKA 3LZXA 4JN9A 4GR1A 2CULA 1VG0A 3SY4A 4A7AA 4B67A 1GT8A 1OJDA 3GRTA 3H4KA 3GRSA 3DA1A 3QVRA 1Y56B 1LJ1A 4NEVA 2WDRA 4JY3A 1H83A 4LU6A 1YKJA 3CGEA 2V5ZA 5HY5A 4NZHA 3GMCA 4DSHA 2X8HA 4CNKA 5C3JA 3GD4A 4A79A 1IJHA 3UKQA 3V3NA 4TM1A 2YVGA 1BGNA 3UKAA 1ZOYA 1MOKA 2A87A 1EBDA 1KNRA 2YG4A 1KSUA 1V59A 3DK9A 1E1NA 2WHDA 2XLRA 4NWZA 4H50A 3I3LA 1JNZA 3UKLA 5KOWA 4YWOA 4G9KA 3DH9A 3T31A 4FK1A 4B65A 1M6IA 3CMMA 4OPUA 3AD8B 3C4AA 2X8GA 4Z2TA 2R0GA 3KVEA 3NYCA 1ZY8A 1S2YA 4B1BA 2XYOA 4YTMA 3NTDA 1X31B 3CIRA 1OJTA 2C3CA 4G73A 3QSSA 4NTDA 4G6HA 1NHSA 2NPXA 4USQA 3P4SA 4YXDA 2B7SA 4LIIA 4FDCB 1H7XA 3CPJG 2YR5A 1CL0A 1SEZA 1IUUA 4GF7A 1ZDLA 2Z5XA 1S7MA 2BCPA 1FOHA 3UOVA 2J3NA 1B8SA 3UCLA 5LV9A 3V3OA 2YG5A 4U8LA 3QJ4A 4H2PA 3AEGA 3SQPA 1N4WA 2O9ZA 3UKKA 5BULA 3UTGA 2ACZA 4NEWA 1B5QA 5KWFA 4GDEA 1JNRA 3HZLA 1PXCA 4OPLA 4Z2RA 1YY5A 4HB9A 3B3RA 1IUXA 2E4GA 3NG7X 3D9XA 3T2YA 1F3PA 3ICSA 4H4SA 1LTXR 3AD9B 2X99A 1DXLA 1KF6A 3II4A 1PBCA 2JBVA 4Z25A 3SZFA 2B9XA 5HHFA 2ZZCA 2YM1A 1LVLA 2FBWA 3CNSA 3CN8A 2V6OA 4A99A 5EBKA 1KSSA 1MO9A 4ZN0A 1LV0A 2FJAA 3BI2A 3KKJA 1RP0A 1DJQA 1KN0A 3AB1A 4U2SA 5C2TA 2RABA 3F8DA 3CNDA 2XCGA 1D7LA 4J36A 2YR4A 4FK1C 2YM2A 4AOXA 1JRZA 2CDUA 4BV6A 3NN6X 2BK4A 4GAPA 3PG6A 3NT6A 3O0HA 4IA6A 1ZMCA 1NDAA 2R9ZA 3L1RA 4A65A 4KPRA 4EMWA 4EMJA 3IHMA 1E1KA 4JNAA 1O5WA 5EB4A 3UP5A 3F8RA 4JDRA 1TDFA 2B9YA 2WOIA 2BRAA 1FL2A 4N9XA 4XWRA 5KMRA 3AYJA 4D04A 2WEUA 3Q6JA 1GESA 1AOGA 2XLPA 4EIQA 1DOCA 1BF3A 2QA1A 4M52A 3SYIA 4H7UA 2OLNA 2QCUA 3AEBA 3ZDNA 3FMWA 5L46A 2BK5A 3KA7A 2C64A 2WDQA 1GRBA 1EL7A 5GSNA 4OPDA 2VZ2A 5M0ZA 1ELIA 4O5UA 4WX1A 2YQUA 3GWFA 4K7ZA 5FS7A 1L9EA 2WETA 4YSZA 4Z44A 5J60A 1Y0PA 2YWLA 5KMSA 1TDKA 4EIPA 5KMPA 4H4VA 1Q1WA 3NK2X 1PXAA 3KU9A 3SFEA 4B69A 4H2RA 4A6NA 1REOA 4YSYA 1P2HA 3AE6A 4H2NA 1JRYA 2F5ZA 4UDQA 3CNTA 1PBFA 2GMJA 2C72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VVM A;  3UOX A;  2Q7V A;  3PO7 A;  3URH A;  3SFD A;  5M10 A;  4A6N B;  1B37 A;  3VQR A;  3CNJ A;  4Z43 A;  4CCQ A;  4Y4M A;  5GRT A;  4X9N A;  1FEB A;  1TDN A;  3H8I A;  4YSX A;  3NYF A;  3K30 A;  3B6D A;  2GMH A;  2VOU A;  3I6D A;  3AE3 A;  2XFO A;  3UTH A;  2WES A;  2C65 A;  3CPH G;  4U8K A;  3VRB A;  4BK1 A;  1GOS A;  2ZZ0 A;  1LQT A;  1YQ4 A;  3CPI G;  2GAG B;  3D8X A;  3NK0 X;  1UKV G;  4Z26 A;  2CFY A;  2C67 A;  1COY A;  2HQM A;  1BZL A;  3IC9 A;  3EF6 A;  1E7P A;  5U25 A;  4EQR A;  3AE8 A;  3BNM A;  3BI5 A;  3R9U A;  3DGH A;  4UDR A;  4TM0 A;  2XFQ A;  4UDP A;  4ZCD A;  1QJD A;  2VVL G;  1NG4 A;  5J7X A;  1QO8 A;  3P4P A;  2RGH A;  1TYT A;  2AR8 A;  3M0O A;  2JK6 A;  2WQY A;  1D4D A;  1M64 A;  3DJE A;  3RP6 A;  3P9U A;  3K7T A;  4H4P A;  2X50 A;  2YLW A;  3M13 A;  3LXD A;  4B63 A;  4DSG A;  3AED A;  2XLT A;  1QLB A;  1GEU A;  3DJG X;  1GRH A;  2BCG G;  1ZOV A;  3EAN A;  1JOA A;  2GR2 A;  3E1T A;  1GER A;  1H6V A;  4B68 A;  2YR6 A;  4A9W A;  1EL5 A;  3UP4 A;  3F8P A;  2WPC A;  4IVO B;  3UTE A;  4BK2 A;  2YLR A;  2XFU A;  4AT0 A;  5HXI A;  2X8C A;  2C7G A;  3NGC X;  3AE7 A;  1GAL A;  1IUT A;  2YLS A;  2YLX A;  4J31 A;  2GR3 A;  4H4X A;  4EQS A;  1TDO A;  2XFN A;  1GRF A;  4X4J A;  5KRQ A;  1D7Y A;  1O95 A;  1YQZ A;  1CJ3 A;  2BYB A;  1PHH A;  4J57 A;  4AOS A;  4D03 A;  2BC0 A;  1H84 A;  2XVH A;  3K7Q X;  2B76 A;  2YAU A;  4JY2 A;  3NHO X;  4C74 A;  5KVH A;  4Z24 A;  1D4E A;  4H4Z A;  4XWZ A;  3GWD A;  3H8L A;  3V76 A;  2XFP A;  1CJ4 A;  4J34 A;  5JCL A;  1OJA A;  4GDP A;  2YG3 A;  1GET A;  2AAQ A;  3DME A;  1GSN A;  4TLX A;  4ADW A;  4JQ9 A;  4U2T A;  4CY8 A;  5IQ1 A;  1FCD A;  2DKH A;  2W0H A;  2X3N A;  1K0J A;  4U8M A;  2BS3 A;  2E5V A;  2R4E A;  3UOZ A;  3RP7 A;  2EQ7 A;  4OCG A;  4B64 A;  2ZZB A;  1XPQ A;  3AEC A;  4YT0 A;  4K5S A;  2GV8 A;  2TMD A;  4DGK A;  3CGC A;  1CF3 A;  1DNC A;  4H4Y A;  3UKF A;  4X9M A;  1GRA A;  3EAO A;  2YVF A;  3NKS A;  4YKG A;  3C4N A;  3UKH A;  2Y6R A;  3ALL A;  2EQ8 A;  5JCM A;  4DNA A;  5KOX A;  1JU2 A;  2FJB A;  1K4Q A;  2Q0K A;  3GSI A;  2A89 A;  2VRM A;  3ALM A;  4AT2 A;  1K0I A;  1TYP A;  2XDO A;  3AE9 A;  2R46 A;  3GD3 A;  1PJ7 A;  2TPR A;  3NLC A;  4IA5 A;  2EQ9 A;  2WOW A;  2WU2 A;  2VVL A;  3DJD A;  3ITJ A;  1PXB A;  3IWA A;  3Q9T A;  3VRD B;  1L9C A;  4NTC A;  4MJW A;  2WU5 A;  2IID A;  1N4V A;  3AE4 A;  1N4U A;  2DKI A;  3ATQ A;  4APN A;  2FJD A;  3CTY A;  3G5R A;  4K22 A;  4KX6 A;  4TLZ A;  3SM8 A;  1PDH A;  5KXJ A;  1GRT A;  1TDE A;  3AE1 A;  3GMB A;  5KVI A;  3T37 A;  4C3X A;  5FS9 A;  3IHG A;  4EQX A;  1E6E A;  1E1L A;  2IVD A;  3EPT A;  4IV9 A;  2I0Z A;  5BUK A;  3DGZ A;  3FPZ A;  1PJ6 A;  3S5W A;  1JEH A;  2GH5 A;  3WE0 A;  1DOE A;  1ZMD A;  4H4W A;  1DOB A;  2GR0 A;  1F8S A;  2GB0 A;  3CGD A;  2V3B A;  4J56 A;  1K0L A;  2WP5 A;  1H86 A;  4OVI A;  3KPF A;  2JB2 A;  4H4R A;  2YG7 A;  3NRN A;  1PJ5 A;  2WBA A;  2V60 A;  2XLU A;  1ZX9 A;  2OAL A;  4FX9 A;  4U8I A;  2JKC A;  1NG3 A;  2XVI A;  4LA1 A;  2C76 A;  4C77 A;  1BKW A;  1CC2 A;  1CJ2 A;  4BK3 A;  2GR1 A;  1P2E A;  5BRT A;  1PS9 A;  2VQB A;  1XAN A;  2YG6 A;  2C66 A;  4OPG A;  4OPT A;  3RNM A;  4ZCC A;  4H4T A;  3ADA B;  1GND A;  3BI4 A;  1VQW A;  1VRQ B;  1ZKQ A;  3DK4 A;  1JRX A;  3AEF A;  4WCT A;  3OC4 A;  2Z5Y A;  2APG A;  4TM4 A;  1F6M A;  2PYX A;  3NIX A;  1L9D A;  1KFY A;  1EL9 A;  1OJ9 A;  2YLT A;  4E0V A;  3CNP A;  3QFB A;  5EOW A;  1PBD A;  5TR3 A;  1GRE A;  2CVJ A;  2R0C A;  1RYI A;  1NPX A;  2Q6U A;  2OAM A;  4I59 A;  2FJE A;  2H89 A;  1S3E A;  1DJN A;  3C96 A;  3UOY A;  4YTP A;  3LOV A;  3QSM A;  3KD9 A;  1LPF A;  1GTE A;  3AEE A;  3LB8 A;  3NNE A;  4NTE A;  4EM3 A;  3GYI A;  3QVP A;  2QAE A;  1KNP A;  1DOD A;  3G5Q A;  1KDG A;  2XVE A;  3QSE A;  4ECH A;  3PVC A;  4EQW A;  1RSG A;  1TRB A;  2RGO A;  3FIM B;  3CGB A;  4CRT A;  4O5Q A;  2A8X A;  3NK1 X;  2C75 A;  2R4J A;  4EMI A;  4K8D A;  1CC6 A;  1S2Q A;  3GDP A;  5DBJ A;  2C3D A;  1F8W A;  3BHF A;  2PHH A;  2QA2 A;  2XLS A;  3ICR A;  3FG2 P;  3GYJ A;  3VR8 A;  4GRT A;  3AE2 A;  2GEW A;  1ZK7 A;  1E1M A;  3K7M X;  3NYE A;  4I58 A;  3IF9 A;  1ONF A;  3DK8 A;  4BUR A;  5CKU A;  4YSH A;  2GRT A;  2BS4 A;  3AYL A;  2XVJ A;  1NHR A;  3AE5 A;  3RED A;  2V3A A;  2H88 A;  1Z6L A;  2R0P A;  1O94 A;  3ABV A;  2RGJ A;  1NHQ A;  1Q1R A;  1N1P A;  5FS6 A;  1H82 A;  3AXB A;  5FMH A;  3BNU A;  1FEC A;  3LZW A;  5U63 A;  3S61 A;  5IPY A;  2GAH B;  4Y4L A;  1FEA A;  2BAC A;  4JNQ A;  4CBQ A;  3OZ2 A;  4PAA A;  2BS2 A;  2VRL A;  2BXR A;  1XHC A;  2R45 A;  3SGL A;  5ER0 A;  2BA9 A;  4YKF A;  4OPI A;  5HYM A;  1OJC A;  2B7R A;  3P1W A;  2BK3 A;  4USR A;  2WOV A;  5JCK A;  3M12 A;  2C73 A;  5IQ4 A;  4A5L A;  1XDI A;  1ZP0 A;  3KLJ A;  2GVC A;  3AWI A;  3DJJ A;  1NAA A;  4K5R A;  1CJC A;  2ARD A;  1GRG A;  1HYU A;  1VG9 A;  1NEK A;  1CHU A;  4RSL A;  2GQF A;  3JSK A;  4RG4 A;  4HA6 A;  4AP3 A;  1IUS A;  2B9W A;  1D5T A;  3UTF A;  3AEA A;  4U8P A;  5CQF A;  3ICT A;  4J2W A;  2BAB A;  2EQ6 A;  1GXF A;  3AD7 B;  4PAB A;  4H4Q A;  5BVA A;  3NN0 X;  1CBO A;  2GF3 A;  1W4X A;  4RG3 A;  3ATR A;  4BJY A;  4K2X A;  4Z2U A;  4XXG A;  1GPE A;  3NH3 X;  1IUW A;  4IVM B;  4Y4N A;  2WP9 A;  5FS8 A;  1IUV A;  2JAE A;  1VDC A;  4P9S A;  3LAD A;  2OA1 A;  5U1O A;  3ALJ A;  1BWC A;  2BXS A;  3LJP A;  4B66 A;  3PS9 A;  3VR9 A;  3UKP A;  2XVF A;  4UP3 A;  2JB1 A;  3L8K A;  4AP1 A;  1S3B A;  1F8R A;  1BGJ A;  2WDV A;  3P4Q A;  4U8O A;  3QFA A;  2BC1 A;  5EB5 A;  1GV4 A;  3VRA A;  2WPF A;  3G5S A;  3NTA A;  3COX A;  4U2L A;  1L0V A;  1PN0 A;  4H2Q A;  1MXT A;  2E1M A;  2JB3 A;  5JCN A;  4TM3 A;  4H4U A;  4EM4 A;  2ZBW A;  1D4C A;  1YQ3 A;  4J33 A;  3ZYX A;  4CCR A;  1Q9I A;  2WPE A;  3RHA A;  2V61 A;  1H81 A;  2YLZ A;  3RP8 A;  2NVK X;  4REK A;  3P4R A;  4ICY A;  2GQW A;  2WP6 A;  2Q0L A;  2OLO A;  4CNJ A;  2Y6Q A;  1NHP A;  3AYI A;  3D1C A;  1PBB A;  1B4V A;  3FBS A;  1H7W A;  5JCI A;  4GUV A;  4U8N A;  2C70 A;  4BJZ A;  4C5O A;  2AQJ A;  4CY6 A;  1EL8 A;  1E39 A;  3GDN A;  1CC4 A;  2WS3 A;  4OPC A;  2YVJ A;  1GTH A;  2IVE A;  1LQU A;  1PBE A;  3ISH A;  4GCM A;  4U8J A;  4C3Y A;  1NEN A;  4YTN A;  2VQ7 A;  2UZZ A;  1Y56 A;  3BHK A;  3LZX A;  4JN9 A;  4GR1 A;  2CUL A;  1VG0 A;  4A7A A;  4B67 A;  1GT8 A;  1OJD A;  3GRT A;  3H4K A;  3GRS A;  3DA1 A;  3QVR A;  1Y56 B;  1LJ1 A;  4NEV A;  2WDR A;  4JY3 A;  1H83 A;  4LU6 A;  1YKJ A;  3CGE A;  2V5Z A;  5HY5 A;  4NZH A;  3GMC A;  4DSH A;  2X8H A;  4CNK A;  5C3J A;  3GD4 A;  4A79 A;  1IJH A;  3UKQ A;  3V3N A;  4TM1 A;  2YVG A;  1BGN A;  3UKA A;  1ZOY A;  1MOK A;  2A87 A;  1EBD A;  1KNR A;  2YG4 A;  1KSU A;  1V59 A;  3DK9 A;  1E1N A;  2WHD A;  2XLR A;  4H50 A;  3I3L A;  1JNZ A;  3UKL A;  5KOW A;  4YWO A;  3DH9 A;  4FK1 A;  4B65 A;  1M6I A;  4OPU A;  3AD8 B;  3C4A A;  2X8G A;  4Z2T A;  2R0G A;  3KVE A;  3NYC A;  1ZY8 A;  1S2Y A;  4B1B A;  2XYO A;  4YTM A;  3NTD A;  1X31 B;  3CIR A;  1OJT A;  2C3C A;  4USQ A;  3QSS A;  4NTD A;  1NHS A;  2NPX A;  4YXD A;  3P4S A;  2B7S A;  4LII A;  4FDC B;  1H7X A;  3CPJ G;  2YR5 A;  1CL0 A;  1SEZ A;  1IUU A;  4GF7 A;  1ZDL A;  2Z5X A;  2BCP A;  1FOH A;  3UOV A;  2J3N A;  1B8S A;  3UCL A;  5LV9 A;  3V3O A;  2YG5 A;  4U8L A;  3QJ4 A;  4H2P A;  3AEG A;  3SQP A;  1N4W A;  2O9Z A;  3UKK A;  5BUL A;  3UTG A;  2ACZ A;  4NEW A;  1B5Q A;  5KWF A;  4GDE A;  1JNR A;  3HZL A;  1PXC A;  4OPL A;  4Z2R A;  1YY5 A;  4HB9 A;  3B3R A;  1IUX A;  2E4G A;  3NG7 X;  1F3P A;  3ICS A;  4H4S A;  1LTX R;  3AD9 B;  2X99 A;  1DXL A;  1KF6 A;  3II4 A;  1PBC A;  2JBV A;  4Z25 A;  2B9X A;  5HHF A;  2ZZC A;  2YM1 A;  1LVL A;  2FBW A;  3CNS A;  3CN8 A;  2V6O A;  4A99 A;  5EBK A;  1KSS A;  1MO9 A;  4ZN0 A;  1LV0 A;  2FJA A;  3BI2 A;  3KKJ A;  1RP0 A;  1DJQ A;  3AB1 A;  4U2S A;  5C2T A;  2RAB A;  3F8D A;  3CND A;  2XCG A;  1D7L A;  4J36 A;  2YR4 A;  4FK1 C;  2YM2 A;  4AOX A;  1JRZ A;  2CDU A;  4BV6 A;  3NN6 X;  2BK4 A;  3NT6 A;  3O0H A;  4IA6 A;  1ZMC A;  1NDA A;  2R9Z A;  3L1R A;  4A65 A;  4KPR A;  4EMW A;  4EMJ A;  3IHM A;  1E1K A;  4JNA A;  1O5W A;  5EB4 A;  3UP5 A;  3F8R A;  4JDR A;  1TDF A;  2B9Y A;  2WOI A;  4N9X A;  1FL2 A;  4XWR A;  3AYJ A;  4D04 A;  2WEU A;  3Q6J A;  1GES A;  1AOG A;  2XLP A;  4EIQ A;  1DOC A;  1BF3 A;  2QA1 A;  4M52 A;  4H7U A;  2OLN A;  2QCU A;  3AEB A;  3ZDN A;  3FMW A;  5L46 A;  2BK5 A;  3KA7 A;  2C64 A;  2WDQ A;  1GRB A;  1EL7 A;  5GSN A;  4OPD A;  2VZ2 A;  5M0Z A;  1ELI A;  4O5U A;  4WX1 A;  2YQU A;  3GWF A;  4K7Z A;  5FS7 A;  1L9E A;  2WET A;  4YSZ A;  4Z44 A;  5J60 A;  1Y0P A;  2YWL A;  1TDK A;  4EIP A;  4H4V A;  1Q1W A;  3NK2 X;  1PXA A;  3KU9 A;  3SFE A;  4B69 A;  4H2R A;  4A6N A;  1REO A;  4YSY A;  1P2H A;  3AE6 A;  4H2N A;  1JRY A;  2F5Z A;  4UDQ A;  3CNT A;  1PBF A;  2GMJ A;  2C72 A; 
#chains in the Genus database with same CATH topology
 2VVM A;  1MDR A;  1TKK A;  2XGZ A;  4X9N A;  1TDN A;  3K30 A;  3B6D A;  2GMH A;  3K1G A;  2BRY A;  3I6D A;  2XFO A;  2WES A;  4E6M A;  1F9C A;  3UJR A;  1LQT A;  3T0K A;  2C67 A;  1COY A;  3IC9 A;  3EF6 A;  2P8B A;  3MUC A;  5U25 A;  3AMZ A;  3L5O A;  2I5Q A;  2HZG A;  4UDP A;  3HRD C;  1QJD A;  3M0O A;  2JK6 A;  2ONE A;  3DJE A;  3P9U A;  3K7T A;  1QLB A;  2BCG G;  1GRH A;  3JW7 A;  2QJJ A;  2GR2 A;  1GER A;  2C4C A;  4BK2 A;  1SJB A;  5HXI A;  2C7G A;  3AE7 A;  3FVD A;  4G7F A;  4X4J A;  1O95 A;  2BC0 A;  1H84 A;  2XVH A;  2B76 A;  3ETR B;  5KVH A;  3V76 A;  4J34 A;  1CJ4 A;  1OJA A;  4GDP A;  4GIS A;  1GSN A;  4TLX A;  3BOX A;  5IQ1 A;  1FCD A;  2X3N A;  4U8M A;  2E5V A;  4KEM A;  3RP7 A;  4YT0 A;  4K5S A;  2GV8 A;  4DGK A;  3CGC A;  4H4Y A;  3RGT A;  3UKF A;  3NKS A;  5KOX A;  1JU2 A;  4II2 A;  3TW9 A;  2Q0K A;  1TZZ A;  2VRM A;  1K0I A;  1TYP A;  2TPR A;  2EQ9 A;  3MKC A;  2WOW A;  1PXB A;  2WU5 A;  2QJM A;  4DXK A;  4K22 A;  3ATQ A;  2FJD A;  3SM8 A;  5KXJ A;  1TDE A;  3T37 A;  2PU0 A;  3U4F A;  1E6E A;  3A7U A;  2I0Z A;  1DOE A;  4H4W A;  2GR0 A;  3KPF A;  4H4R A;  3NRN A;  2WBA A;  1TE6 A;  3TOY A;  4U8I A;  4LA1 A;  4IL2 A;  4C77 A;  4H83 A;  1W6T A;  1CJ2 A;  5BRT A;  1XAN A;  2YG6 A;  3DGB A;  2CHR A;  3BI4 A;  1VQW A;  1VRQ B;  4WCT A;  1EL9 A;  4E0V A;  2OZ3 A;  3CNP A;  5EOW A;  4ENL A;  4GFI A;  4GIR A;  2Q6U A;  2H89 A;  3C96 A;  3QSM A;  3OZY A;  1XPY A;  2QGY A;  4ROP A;  2QAE A;  3BJS A;  4EQW A;  3A7A A;  3CGB A;  4CRT A;  4O5Q A;  2A8X A;  3QPE A;  3RR1 A;  1F8W A;  4GGB A;  2QA2 A;  3AE2 A;  4ZOH B;  2P8C A;  1ONF A;  4BUR A;  5CKU A;  2HNE A;  3HYX A;  3AE5 A;  3RED A;  1P48 A;  1ECQ A;  3ABV A;  3OZM A;  3MSY A;  1FEC A;  3R1Z A;  3S61 A;  2GAH B;  4Y4L A;  1FEA A;  3GYX A;  1WUE A;  4JNQ A;  4CBQ A;  4PAA A;  4E4U A;  2W54 A;  1XHC A;  3SGL A;  3T6C A;  5HYM A;  2FKP A;  2BK3 A;  4USR A;  4G74 A;  4A5L A;  1XDI A;  3T4W A;  3DJJ A;  1GRG A;  4A3R A;  2AL2 A;  4RG4 A;  2PCE A;  4U8P A;  5CQF A;  5FJU A;  3AD7 B;  5BVA A;  3UJS A;  1CBO A;  1W4X A;  4BJY A;  3NH3 X;  3CXO A;  2JAE A;  1BWC A;  3PS9 A;  3VR9 A;  3UKP A;  4AP1 A;  1S3B A;  5KNL A;  3N4E A;  5BOE A;  3P4Q A;  4HCL A;  4U8O A;  2BC1 A;  3IJL A;  2WPF A;  3NTA A;  1JDF A;  3COX A;  1L0V A;  1PN0 A;  3SZC A;  3MWC A;  4EM4 A;  3GC2 A;  4CCR A;  2WPE A;  3RHA A;  3RP8 A;  2YLZ A;  4ICY A;  2GQW A;  4CNJ A;  2OVL A;  1NHP A;  3AYI A;  4U8N A;  4CY6 A;  2MUC A;  1EL8 A;  3FV9 A;  4KPL A;  1NEN A;  3DG6 A;  5J04 A;  3LZX A;  4JN9 A;  4GR1 A;  1X2G A;  4A7A A;  1GT8 A;  1OJD A;  3H4K A;  1Y56 B;  4NEV A;  4JY3 A;  3H7V A;  3GMC A;  4CNK A;  3R07 C;  3GD4 A;  3UKQ A;  4TM1 A;  5FJT A;  3UKA A;  3DK9 A;  4H50 A;  3I3L A;  2OO6 A;  3UKL A;  5KOW A;  4B65 A;  3TQP A;  3DFH A;  3AD8 B;  4OPU A;  1L8P A;  2GSH A;  4B1B A;  3GD6 A;  4YTM A;  1X31 B;  1OJT A;  3NO1 A;  4G73 A;  4IP5 A;  2DW6 A;  2Z5X A;  3UOV A;  2J3N A;  1WUF A;  5FJP A;  6ENL A;  3AEG A;  3P3B A;  2E5A A;  4NEW A;  1B5Q A;  5KWF A;  1JNR A;  3HZL A;  3B3R A;  3ZVH A;  3CXB A;  3EUB 3;  3ICS A;  1LTX R;  1DXL A;  1KF6 A;  2YM1 A;  3CNS A;  2V6O A;  2QQ6 A;  4E8G A;  2RAB A;  3F8D A;  2XCG A;  4HYR A;  3FYY A;  2YR4 A;  2CDU A;  4BV6 A;  3PG6 A;  3O0H A;  2R9Z A;  1NDA A;  3L1R A;  3IHM A;  1JRO A;  5EB4 A;  3JZU A;  4JDR A;  2BRA A;  4N9X A;  1N60 C;  3SSZ A;  3Q6J A;  4M52 A;  2OLN A;  3N6J A;  3AEB A;  3ZDN A;  5L46 A;  2WDQ A;  1EL7 A;  5M0Z A;  3GWF A;  3SR6 B;  3CK5 A;  4HCH A;  3NK2 X;  1PXA A;  3AE6 A;  2F5Z A;  2DW7 A;  3URH A;  5M10 A;  3SZW A;  1B37 A;  3D46 A;  4CCQ A;  3H8I A;  4GGH A;  3NYF A;  2MNR A;  2VOU A;  4GAV A;  4IL0 A;  2ZZ0 A;  1YQ4 A;  2PP3 A;  1UKV G;  4Z26 A;  2CFY A;  2HQM A;  1BZL A;  3BNM A;  1BQG A;  3CT2 A;  3ZLH A;  4TM0 A;  1NG4 A;  1D4D A;  4X2P A;  4H4P A;  3M13 A;  1KCZ A;  4DSG A;  2XLT A;  1GEU A;  3DJG X;  3EAN A;  1H6V A;  2YR6 A;  4FP1 A;  3UP4 A;  2WPC A;  2XFU A;  5G5G B;  2X8C A;  2YLX A;  4EQS A;  2XFN A;  1GRF A;  5KRQ A;  1D7Y A;  1CJ3 A;  2BYB A;  4AOS A;  2YAU A;  4Z24 A;  4XWZ A;  1FHV A;  1GET A;  4U2T A;  4K2S A;  3HYV A;  2DKH A;  3R11 A;  1K0J A;  2EQ7 A;  1XPQ A;  2TMD A;  4F4R A;  1DNC A;  2XH0 A;  3ALL A;  5JCM A;  2A89 A;  4AT2 A;  3AE9 A;  1PJ7 A;  4K8G A;  3DJD A;  3ITJ A;  3IWA A;  2E3T A;  4MJW A;  2IID A;  3CTY A;  1N4U A;  2DKI A;  4TLZ A;  4KX6 A;  1ONE A;  3MZN A;  3GMB A;  3IHG A;  4EQX A;  1E1L A;  3EPT A;  4IV9 A;  3FPZ A;  3S5W A;  1ZMD A;  1F8S A;  3UKH A;  2V3B A;  2WP5 A;  1E9I A;  1R0M A;  2JB2 A;  1PJ5 A;  2V60 A;  1ZX9 A;  2OAL A;  1NG3 A;  2XVI A;  2C76 A;  2OPJ A;  2OLA A;  1CC2 A;  3D47 A;  1P2E A;  2VQB A;  2C66 A;  4ZCC A;  3ADA B;  1GND A;  2PTX A;  2OQH A;  2QDE A;  1JRX A;  5FJO A;  4TM4 A;  2XH2 A;  3NIX A;  1L9D A;  1KFY A;  3SXI A;  1MDL A;  2CVJ A;  4HCD A;  2R0C A;  4M6U A;  1S3E A;  3KD9 A;  2OKT A;  3AEE A;  3LB8 A;  4EM3 A;  3GYI A;  3QVP A;  1KNP A;  1DOD A;  3QSE A;  1TRB A;  3FIM B;  4DN1 A;  4EMI A;  1CC6 A;  3VR8 A;  1ZK7 A;  1T3Q C;  1E1M A;  3K7M X;  3TTE A;  3IF9 A;  4IZG A;  1NHR A;  1Z6L A;  1MRA A;  2RGJ A;  1NHQ A;  4DYE A;  3AXB A;  3LZW A;  4NNJ A;  3OZ2 A;  2BS2 A;  3T2Z A;  2GGH A;  2R45 A;  4OPI A;  3P1W A;  5FJR A;  1VQZ A;  1HYU A;  1VG9 A;  1NEK A;  1CHU A;  4RSL A;  2GQF A;  3JSK A;  1IUS A;  1NEL A;  2B9W A;  3GO2 A;  4TVY A;  2ZAD A;  2BAB A;  2W3S A;  1GXF A;  4PAB A;  3AN1 A;  3NN0 X;  3ATR A;  4K2X A;  4XXG A;  3BSM A;  1IUW A;  2OFJ A;  3QKE A;  5ENL A;  1VDC A;  4P9S A;  3LJP A;  4TVW A;  4YWS A;  2XVF A;  1F8R A;  4IHC A;  4M0X A;  3QFA A;  5EB5 A;  1GV4 A;  3S5S A;  3G5S A;  1MXT A;  4H4U A;  2ZBW A;  1N5W C;  1H81 A;  1V97 A;  2Y6Q A;  4C5O A;  3GDN A;  3ZVI A;  4A6G A;  2WS3 A;  1GTH A;  2IVE A;  4GCM A;  4YTN A;  2VQ7 A;  1Y56 A;  3BHK A;  2GGJ A;  3SY4 A;  4B67 A;  3DA1 A;  2GGE A;  5HY5 A;  5C3J A;  2ZC8 A;  1IYX A;  1EBD A;  1KSU A;  1V59 A;  1E1N A;  2WHD A;  2XLR A;  3T31 A;  3CMM A;  4Z2T A;  2R0G A;  3KVE A;  3NYC A;  3NTD A;  2C3C A;  4NTD A;  2NPX A;  4YXD A;  2YR5 A;  1CL0 A;  4E4F A;  2PP0 A;  1S7M A;  2BCP A;  3S47 A;  1B8S A;  4U8L A;  3QJ4 A;  2O9Z A;  2ACZ A;  3Q4D A;  1YY5 A;  2E4G A;  3D9X A;  2X99 A;  3PWG A;  3UGV A;  3MY9 A;  3RO6 A;  3SZF A;  2B9X A;  2FBW A;  4A99 A;  3Q45 A;  1RP0 A;  2PS2 A;  3AB1 A;  2XH4 A;  3I6T A;  2XSX A;  4FK1 C;  2YM2 A;  4AOX A;  1JRZ A;  3SN4 A;  1ZMC A;  3NVV B;  3VCN A;  1E1K A;  4JNA A;  4G8T A;  4HNL A;  1TDF A;  2B9Y A;  4JN8 A;  5KMR A;  1DOC A;  2QA1 A;  4H7U A;  1EC7 A;  4Z17 A;  2QCU A;  2C64 A;  1GRB A;  5GSN A;  2GL5 A;  3T8Q A;  4Z44 A;  5J60 A;  4A35 A;  5KMP A;  1Q1W A;  3KU9 A;  4B69 A;  3TJ4 A;  1FFU C;  3NVZ B;  3CNT A;  1PBF A;  2Q7V A;  3PO7 A;  3SFD A;  4A6N B;  3VQR A;  1FO4 A;  3CNJ A;  4Z43 A;  2PA6 A;  4Y4M A;  2POD A;  1FEB A;  4YSX A;  1FFV C;  3UTH A;  4KT2 A;  3CPH G;  1GOS A;  3CPI G;  1EC9 A;  1BKH A;  3R9U A;  4EQR A;  3BI5 A;  4H19 A;  4ZCD A;  3P0W A;  3KPK A;  5J7X A;  3P4P A;  2RGH A;  2AR8 A;  3OTR A;  1M64 A;  3RP6 A;  2X50 A;  2YLW A;  3LXD A;  3TWA A;  1FHU A;  4B68 A;  4A9W A;  1EL5 A;  3UTE A;  3OPS A;  3VC5 A;  3NGC X;  1IUT A;  2YLS A;  4H4X A;  1TDO A;  1YQZ A;  4D03 A;  4JY2 A;  1VDV A;  1D4E A;  4H4Z A;  3T9P A;  2XFP A;  2YG3 A;  3OW1 A;  2PTZ A;  2BS3 A;  2R4E A;  3UOZ A;  4OCG A;  2ZZB A;  1CF3 A;  1N61 C;  4YKG A;  4X9M A;  2NQL A;  2YVF A;  2EQ8 A;  3TWB A;  4FI4 A;  7ENL A;  3H12 A;  2XDO A;  2AKZ A;  3TJI A;  4IA5 A;  2WU2 A;  3SN0 A;  3A7R A;  2VVL A;  3Q9T A;  3VRD B;  1L9C A;  3AE4 A;  4DHG A;  4JN7 A;  1PDH A;  4HN8 A;  1GRT A;  3HW2 A;  4H1Z A;  5KVI A;  5FS9 A;  2IVD A;  5BUK A;  3DGZ A;  1PJ6 A;  2GH5 A;  3WE0 A;  4K1W A;  2GB0 A;  4J56 A;  1H86 A;  3UXL A;  3V5C A;  2YG7 A;  3GY1 A;  4FX9 A;  2JKC A;  3T14 A;  4BK3 A;  2GR1 A;  1SJC A;  1PS9 A;  4OPG A;  3QN3 A;  1FIQ B;  4G6G A;  3PK7 A;  1MUC A;  3EEZ A;  1ZKQ A;  3OC4 A;  3IK4 A;  2Z5Y A;  3N4F A;  2PYX A;  1OJ9 A;  2YLT A;  4JHM A;  3QFB A;  1GRE A;  3UJ2 A;  1RYI A;  1NPX A;  2FJE A;  3DES A;  1DJN A;  1LPF A;  1GTE A;  4NTE A;  4J3Z A;  2PGW A;  1KDG A;  4ECH A;  3PVC A;  1RSG A;  2RGO A;  2QVH A;  3NK1 X;  2P0I A;  2C75 A;  2R4J A;  3KUM A;  1S2Q A;  2C3D A;  3BHF A;  2PHH A;  1JCT A;  2XLS A;  3ICR A;  3FG2 P;  2PPG A;  3GYJ A;  2GEW A;  3NYE A;  4I58 A;  3VCC A;  1OEP A;  3DK8 A;  3B97 A;  4YSH A;  2GRT A;  2XVJ A;  3NFU A;  1N62 C;  2XH7 A;  2V3A A;  2H88 A;  2R0P A;  1H2I A;  1Q1R A;  1N1P A;  1H82 A;  5FMH A;  3BNU A;  1STZ A;  5U63 A;  3JVA A;  5IPY A;  2PU1 A;  2VRL A;  2BXR A;  5ER0 A;  2BA9 A;  1NU5 A;  5JCK A;  3M12 A;  2C73 A;  1ZP0 A;  3AWI A;  3KLJ A;  2GVC A;  4K5R A;  5G5H B;  1CJC A;  2ARD A;  2HXU A;  1R6W A;  4AP3 A;  4HA6 A;  3SX6 A;  3UTF A;  4J2W A;  4GYP C;  2O56 A;  4H4Q A;  3U9I A;  2GF3 A;  1RM6 B;  4RG3 A;  4Z2U A;  2W3R A;  4Y4N A;  3NVY B;  2OZT A;  2WP9 A;  5FS8 A;  3LAD A;  2OA1 A;  5U1O A;  2BXS A;  4B66 A;  3VDG A;  3L8K A;  3DEQ A;  2WDV A;  2AL1 A;  4U2L A;  2E1M A;  4TM3 A;  5JCN A;  1YQ3 A;  4J33 A;  3ZYX A;  1Q9I A;  5IQ4 A;  3T2K A;  2NVK X;  2WP6 A;  2Q0L A;  2OLO A;  1PBB A;  5JCI A;  4GUV A;  2AQJ A;  4OPC A;  3HPF A;  4E5T A;  4C3Y A;  4U8J A;  2UZZ A;  1LJ1 A;  2WDR A;  4LU6 A;  3CGE A;  4NZH A;  2X8H A;  1IJH A;  3V3N A;  1MOK A;  1KNR A;  5IDZ A;  4NWZ A;  4G9K A;  4ZCW A;  3DH9 A;  1SJD A;  4FK1 A;  1M6I A;  3QTP A;  3C4A A;  1S2Y A;  2XYO A;  3P4S A;  2B7S A;  1H7X A;  1SEZ A;  4GF7 A;  1ZDL A;  3ES8 A;  3UCD A;  4DX3 A;  3UCL A;  5LV9 A;  3V3O A;  2YG5 A;  1N4W A;  3UKK A;  3QLD A;  1YEY A;  3THU A;  4HB9 A;  1IUX A;  3NG7 X;  3T2Y A;  1F3P A;  3AD9 B;  1PBC A;  2JBV A;  1ZXI C;  1LVL A;  4ZN0 A;  1MO9 A;  1PDY A;  2FJA A;  3BI2 A;  2P88 A;  1DJQ A;  1KN0 A;  1DTN A;  2P3Z A;  1PDZ A;  1D7L A;  4J36 A;  2QJN A;  2BK4 A;  3NT6 A;  4KPR A;  4EMW A;  3UP5 A;  3PWI A;  3F8R A;  1KD0 A;  1GES A;  3FMW A;  3KA7 A;  4OPD A;  2VZ2 A;  4WX1 A;  2HXT A;  4YSZ A;  1Y0P A;  2YWL A;  5KMS A;  3SJN A;  2OQY A;  3SFE A;  4H2R A;  4A6N A;  3SQS A;  3UJF A;  4YSY A;  1P2H A;  1JRY A;  4UDQ A;  2C72 A;  3UOX A;  5GRT A;  2PTW A;  4GME A;  3AE3 A;  2C65 A;  4U8K A;  3VRB A;  4BK1 A;  4HPN A;  2GAG B;  3D8X A;  3NK0 X;  4MKS A;  3I4K A;  1E7P A;  3AE8 A;  3DGH A;  4UDR A;  3ZLG A;  2XFQ A;  2VVL G;  1QO8 A;  1XS2 A;  3FXG A;  1TYT A;  2WQY A;  4MGG A;  3R25 A;  4HNC A;  4B63 A;  3AED A;  3SBF A;  1ZOV A;  1JOA A;  3E1T A;  3F8P A;  4IVO B;  2YLR A;  1JRP A;  3PFR A;  4AT0 A;  3R10 A;  1EC8 A;  1GAL A;  4J31 A;  2GR3 A;  3R0K A;  3I6E A;  3STP A;  1PHH A;  4J57 A;  3V4B A;  3K7Q X;  3NHO X;  4C74 A;  3DG7 A;  3GWD A;  3H8L A;  3ZLF A;  5JCL A;  2POZ A;  2AAQ A;  5JRB A;  3DME A;  4ADW A;  4JQ9 A;  4CY8 A;  2W0H A;  4J1O A;  2PMQ A;  4B64 A;  3AEC A;  3NS1 B;  1GRA A;  3EAO A;  3C4N A;  2Y6R A;  4DNA A;  2FJB A;  2OZ8 A;  1K4Q A;  3GSI A;  1SJA A;  3ALM A;  2R46 A;  3SZ0 A;  3GD3 A;  3NLC A;  4DWD A;  3UJE A;  2PTY A;  4NTC A;  1N4V A;  3G5R A;  4APN A;  3AE1 A;  5BOF A;  4C3X A;  3DFY A;  1JEH A;  1DOB A;  3CGD A;  1K0L A;  4OVI A;  3UCC A;  1P43 A;  2XLU A;  3CAW A;  1BKW A;  2OG9 A;  3NRZ B;  4OPT A;  3UXK A;  3RNM A;  4H4T A;  2AKM A;  3DK4 A;  3AEF A;  1SB3 B;  5EU9 A;  2APG A;  1F6M A;  2PP1 A;  1PBD A;  3IJI A;  5TR3 A;  5KMQ A;  2OAM A;  4I59 A;  2FYM A;  3UOY A;  4IP4 A;  4YTP A;  1KKO A;  3LOV A;  3NNE A;  3CB3 A;  3G5Q A;  2RDX A;  1KKR A;  2XVE A;  3RCY A;  4GYP A;  4K8D A;  3GDP A;  5DBJ A;  4GRT A;  3AYL A;  2BS4 A;  1O94 A;  1EBH A;  3VFC A;  3DG3 A;  5FS6 A;  3V5F A;  4KWS A;  2BAC A;  1N5X A;  3IJQ A;  4II3 A;  2PGE A;  4YKF A;  1OJC A;  2B7R A;  3VC6 A;  3V3W A;  2WOV A;  1NAA A;  3FCP A;  1D5T A;  3AEA A;  3ICT A;  2EQ6 A;  2W55 A;  2AL2 B;  4MMW A;  1GPE A;  4IVM B;  1IUV A;  3FJ4 A;  3ALJ A;  4UP3 A;  2JB1 A;  3DER A;  1BGJ A;  3N6H A;  1ELS A;  3HYW A;  3RRA A;  4H2Q A;  2JB3 A;  1D4C A;  2V61 A;  4REK A;  3P4R A;  1JPM A;  3D1C A;  1B4V A;  3FBS A;  1H7W A;  2C70 A;  4BJZ A;  1E39 A;  3ES7 A;  4ZA0 A;  1CC4 A;  3DIP A;  2YVJ A;  3ENL A;  1LQU A;  1PBE A;  3ISH A;  3H8A A;  2OX4 A;  2CUL A;  3P93 A;  1VG0 A;  3CYJ A;  1X2H A;  3GRT A;  3GRS A;  3QVR A;  2PSN A;  3OP2 A;  4IT1 A;  1H83 A;  1YKJ A;  2V5Z A;  4DSH A;  4H2H A;  4A79 A;  1MNS A;  2YVG A;  1BGN A;  1ZOY A;  2A87 A;  2YG4 A;  2QDD A;  1JNZ A;  4YWO A;  1JPD X;  2X8G A;  1ZY8 A;  3CIR A;  2GDQ A;  1WYG A;  3QSS A;  4USQ A;  4G6H A;  1NHS A;  4LII A;  4FDC B;  3CPJ G;  1IUU A;  1FOH A;  4H2P A;  3SQP A;  5BUL A;  3UTG A;  3DDM A;  4GDE A;  3TCS A;  1PXC A;  4OPL A;  4Z2R A;  4H4S A;  3B9J B;  3II4 A;  4Z25 A;  3ZVH B;  5HHF A;  2ZZC A;  3CN8 A;  5EBK A;  1KSS A;  1LV0 A;  3KKJ A;  1RVK A;  4U2S A;  5C2T A;  4EWJ A;  3R0U A;  3NN6 X;  4GAP A;  4IA6 A;  1EBG A;  4A65 A;  4EMJ A;  1O5W A;  3NVW B;  2GGI A;  3NZG A;  2WOI A;  4XWR A;  1N63 C;  1FL2 A;  3AYJ A;  4D04 A;  2WEU A;  1AOG A;  3MQT A;  2XLP A;  4EIQ A;  1BF3 A;  3NXL A;  3SYI A;  3RIT A;  2BK5 A;  3H70 A;  3VA8 A;  1ELI A;  4O5U A;  2YQU A;  4K7Z A;  5FS7 A;  1L9E A;  3SN1 A;  2WET A;  3EKG A;  1TDK A;  4EIP A;  4H4V A;  1REO A;  3AM9 A;  4H2N A;  2GGG A;  4Z1Y A;  3VRA A;  2GMJ A;  3CND A; 
#chains in the Genus database with same CATH homology
 2VVM A;  3UOX A;  2Q7V A;  3PO7 A;  3URH A;  3SFD A;  5M10 A;  3SZW A;  1B37 A;  4A6N B;  3VQR A;  3CNJ A;  4Z43 A;  4CCQ A;  4Y4M A;  5GRT A;  4X9N A;  1FEB A;  1TDN A;  3H8I A;  4YSX A;  3NYF A;  3K30 A;  3B6D A;  2GMH A;  2VOU A;  3I6D A;  2BRY A;  3AE3 A;  2XFO A;  3UTH A;  2WES A;  2C65 A;  4GAV A;  3CPH G;  4U8K A;  3VRB A;  4BK1 A;  1GOS A;  2ZZ0 A;  1LQT A;  1YQ4 A;  3CPI G;  2GAG B;  3T0K A;  3D8X A;  3NK0 X;  1UKV G;  4Z26 A;  2CFY A;  2C67 A;  1COY A;  2HQM A;  1BZL A;  3IC9 A;  3EF6 A;  1E7P A;  5U25 A;  4EQR A;  3AE8 A;  3BNM A;  3BI5 A;  3R9U A;  3L5O A;  3DGH A;  4UDR A;  4TM0 A;  2XFQ A;  4UDP A;  4ZCD A;  1QJD A;  2VVL G;  3KPK A;  1NG4 A;  5J7X A;  1QO8 A;  3P4P A;  2RGH A;  1TYT A;  2AR8 A;  3M0O A;  2JK6 A;  2WQY A;  1D4D A;  1M64 A;  3DJE A;  3RP6 A;  3P9U A;  3K7T A;  4H4P A;  2X50 A;  2YLW A;  3M13 A;  3LXD A;  4B63 A;  4DSG A;  3AED A;  2XLT A;  1QLB A;  1GEU A;  3DJG X;  1GRH A;  2BCG G;  1ZOV A;  3EAN A;  1JOA A;  2GR2 A;  3E1T A;  1GER A;  1H6V A;  4B68 A;  2YR6 A;  4A9W A;  1EL5 A;  2C4C A;  3UP4 A;  3F8P A;  2WPC A;  4IVO B;  3UTE A;  4BK2 A;  2YLR A;  2XFU A;  4AT0 A;  5HXI A;  2X8C A;  2C7G A;  3NGC X;  3AE7 A;  1GAL A;  1IUT A;  2YLS A;  2YLX A;  4J31 A;  2GR3 A;  4H4X A;  4EQS A;  1TDO A;  2XFN A;  1GRF A;  4X4J A;  5KRQ A;  1D7Y A;  1O95 A;  1YQZ A;  1CJ3 A;  2BYB A;  1PHH A;  4J57 A;  4AOS A;  4D03 A;  2BC0 A;  1H84 A;  2XVH A;  3K7Q X;  2B76 A;  2YAU A;  4JY2 A;  3NHO X;  4C74 A;  5KVH A;  4Z24 A;  1D4E A;  4H4Z A;  4XWZ A;  3GWD A;  3H8L A;  3V76 A;  2XFP A;  1CJ4 A;  4J34 A;  5JCL A;  1OJA A;  4GDP A;  2YG3 A;  1GET A;  2AAQ A;  5JRB A;  3DME A;  1GSN A;  4TLX A;  4ADW A;  4JQ9 A;  4U2T A;  4CY8 A;  5IQ1 A;  3HYV A;  1FCD A;  2DKH A;  2W0H A;  2X3N A;  1K0J A;  4U8M A;  2BS3 A;  2E5V A;  2R4E A;  3UOZ A;  3RP7 A;  2EQ7 A;  4OCG A;  4B64 A;  2ZZB A;  1XPQ A;  3AEC A;  4YT0 A;  4K5S A;  2GV8 A;  2TMD A;  4DGK A;  3CGC A;  1CF3 A;  1DNC A;  4H4Y A;  3UKF A;  4X9M A;  1GRA A;  3EAO A;  2YVF A;  3NKS A;  4YKG A;  3C4N A;  3UKH A;  2Y6R A;  3ALL A;  2EQ8 A;  5JCM A;  4DNA A;  5KOX A;  1JU2 A;  2FJB A;  4II2 A;  1K4Q A;  2Q0K A;  3GSI A;  2A89 A;  2VRM A;  3ALM A;  4AT2 A;  1K0I A;  1TYP A;  2XDO A;  3AE9 A;  2R46 A;  3SZ0 A;  3GD3 A;  1PJ7 A;  2TPR A;  3NLC A;  4IA5 A;  2EQ9 A;  2WOW A;  2WU2 A;  2VVL A;  3DJD A;  3ITJ A;  1PXB A;  3IWA A;  3Q9T A;  3VRD B;  1L9C A;  4NTC A;  4MJW A;  2WU5 A;  2IID A;  1N4V A;  3AE4 A;  1N4U A;  2DKI A;  3ATQ A;  4APN A;  2FJD A;  3CTY A;  3G5R A;  4K22 A;  4KX6 A;  4TLZ A;  3SM8 A;  1PDH A;  5KXJ A;  1GRT A;  1TDE A;  3AE1 A;  3GMB A;  5KVI A;  3T37 A;  4C3X A;  5FS9 A;  3IHG A;  4EQX A;  1E6E A;  1E1L A;  2IVD A;  3EPT A;  4IV9 A;  2I0Z A;  5BUK A;  3DGZ A;  3FPZ A;  1PJ6 A;  3S5W A;  1JEH A;  2GH5 A;  3WE0 A;  1DOE A;  1ZMD A;  4H4W A;  1DOB A;  2GR0 A;  2V3B A;  1F8S A;  3CGD A;  2GB0 A;  4J56 A;  1K0L A;  2WP5 A;  1H86 A;  4OVI A;  3KPF A;  2JB2 A;  4H4R A;  2YG7 A;  3NRN A;  1PJ5 A;  2WBA A;  2V60 A;  2XLU A;  1ZX9 A;  2OAL A;  4FX9 A;  4U8I A;  2JKC A;  1NG3 A;  2XVI A;  4LA1 A;  2C76 A;  4C77 A;  1BKW A;  3T14 A;  1CC2 A;  1CJ2 A;  4BK3 A;  2GR1 A;  1P2E A;  5BRT A;  1PS9 A;  2VQB A;  1XAN A;  2YG6 A;  2C66 A;  4OPG A;  4OPT A;  3RNM A;  4ZCC A;  4G6G A;  4H4T A;  3ADA B;  1GND A;  3BI4 A;  1VQW A;  1VRQ B;  1ZKQ A;  3DK4 A;  1JRX A;  3AEF A;  4WCT A;  3OC4 A;  2Z5Y A;  2APG A;  4TM4 A;  1F6M A;  2PYX A;  3NIX A;  1L9D A;  1KFY A;  1EL9 A;  1OJ9 A;  3SXI A;  2YLT A;  4E0V A;  3CNP A;  3QFB A;  5EOW A;  1PBD A;  5TR3 A;  1GRE A;  2CVJ A;  2R0C A;  1RYI A;  1NPX A;  2Q6U A;  5KMQ A;  2OAM A;  4I59 A;  2FJE A;  2H89 A;  1S3E A;  1DJN A;  3C96 A;  3UOY A;  4YTP A;  3LOV A;  3QSM A;  3KD9 A;  1LPF A;  1GTE A;  3AEE A;  3LB8 A;  3NNE A;  4NTE A;  4EM3 A;  3GYI A;  3QVP A;  2QAE A;  1KNP A;  1DOD A;  3G5Q A;  1KDG A;  2XVE A;  3QSE A;  4ECH A;  3PVC A;  4EQW A;  1RSG A;  1TRB A;  2RGO A;  3FIM B;  3CGB A;  4CRT A;  4O5Q A;  2A8X A;  3NK1 X;  2C75 A;  2R4J A;  4EMI A;  4K8D A;  1CC6 A;  1S2Q A;  3GDP A;  5DBJ A;  2C3D A;  1F8W A;  3BHF A;  2PHH A;  2QA2 A;  2XLS A;  3ICR A;  3FG2 P;  3GYJ A;  3VR8 A;  4GRT A;  3AE2 A;  2GEW A;  1ZK7 A;  1E1M A;  3K7M X;  3NYE A;  4I58 A;  3IF9 A;  1ONF A;  3DK8 A;  4BUR A;  5CKU A;  4YSH A;  3HYX A;  2GRT A;  2BS4 A;  3AYL A;  2XVJ A;  1NHR A;  3AE5 A;  3RED A;  2V3A A;  2H88 A;  1Z6L A;  2R0P A;  1O94 A;  3ABV A;  2RGJ A;  1NHQ A;  1H2I A;  1Q1R A;  1N1P A;  5FS6 A;  1H82 A;  3AXB A;  5FMH A;  3BNU A;  1FEC A;  3LZW A;  5U63 A;  3S61 A;  5IPY A;  2GAH B;  4Y4L A;  1FEA A;  3GYX A;  2BAC A;  4NNJ A;  4JNQ A;  4CBQ A;  3OZ2 A;  4PAA A;  2BS2 A;  3T2Z A;  2VRL A;  2BXR A;  1XHC A;  2R45 A;  4II3 A;  3SGL A;  5ER0 A;  2BA9 A;  4YKF A;  4OPI A;  5HYM A;  1OJC A;  2B7R A;  3P1W A;  2BK3 A;  4USR A;  2WOV A;  5JCK A;  3M12 A;  4G74 A;  2C73 A;  5IQ4 A;  3T2K A;  4A5L A;  1XDI A;  1ZP0 A;  3KLJ A;  2GVC A;  3AWI A;  3DJJ A;  1NAA A;  4K5R A;  1CJC A;  2ARD A;  1GRG A;  1HYU A;  1VG9 A;  1NEK A;  1CHU A;  4RSL A;  2GQF A;  3JSK A;  4RG4 A;  4HA6 A;  4AP3 A;  1IUS A;  2B9W A;  1D5T A;  3SX6 A;  3AEA A;  4U8P A;  5CQF A;  3ICT A;  3UTF A;  4J2W A;  2BAB A;  2EQ6 A;  1GXF A;  3AD7 B;  4PAB A;  4H4Q A;  5BVA A;  3NN0 X;  1CBO A;  2GF3 A;  1W4X A;  4RG3 A;  3ATR A;  4BJY A;  4K2X A;  4Z2U A;  4XXG A;  1GPE A;  3NH3 X;  1IUW A;  4IVM B;  4Y4N A;  2WP9 A;  5FS8 A;  1IUV A;  2JAE A;  1VDC A;  4P9S A;  3LAD A;  2OA1 A;  5U1O A;  3ALJ A;  1BWC A;  2BXS A;  3LJP A;  4B66 A;  3PS9 A;  3VR9 A;  3UKP A;  2XVF A;  4UP3 A;  2JB1 A;  3L8K A;  4AP1 A;  1S3B A;  1F8R A;  1BGJ A;  2WDV A;  5KNL A;  3P4Q A;  4U8O A;  3QFA A;  2BC1 A;  5EB5 A;  1GV4 A;  3VRA A;  2WPF A;  3G5S A;  3HYW A;  3NTA A;  3COX A;  4U2L A;  1L0V A;  1PN0 A;  4H2Q A;  3SZC A;  1MXT A;  2E1M A;  2JB3 A;  5JCN A;  4TM3 A;  4H4U A;  4EM4 A;  2ZBW A;  1D4C A;  1YQ3 A;  4J33 A;  3ZYX A;  4CCR A;  1Q9I A;  2WPE A;  3RHA A;  2V61 A;  1H81 A;  2YLZ A;  3RP8 A;  2NVK X;  4REK A;  3P4R A;  4ICY A;  2GQW A;  2WP6 A;  2Q0L A;  2OLO A;  4CNJ A;  2Y6Q A;  1NHP A;  3AYI A;  3D1C A;  1PBB A;  1B4V A;  3FBS A;  1H7W A;  5JCI A;  4GUV A;  4U8N A;  2C70 A;  4BJZ A;  4C5O A;  2AQJ A;  4CY6 A;  1EL8 A;  1E39 A;  3GDN A;  1CC4 A;  2WS3 A;  4OPC A;  2YVJ A;  1GTH A;  2IVE A;  1LQU A;  1PBE A;  3ISH A;  4GCM A;  4U8J A;  4C3Y A;  1NEN A;  4YTN A;  2VQ7 A;  2UZZ A;  1Y56 A;  3BHK A;  3LZX A;  4JN9 A;  4GR1 A;  2CUL A;  1VG0 A;  3SY4 A;  4A7A A;  4B67 A;  1GT8 A;  1OJD A;  3GRT A;  3H4K A;  3GRS A;  3DA1 A;  3QVR A;  1Y56 B;  1LJ1 A;  4NEV A;  2WDR A;  4JY3 A;  1H83 A;  4LU6 A;  1YKJ A;  3CGE A;  2V5Z A;  5HY5 A;  4NZH A;  3GMC A;  4DSH A;  2X8H A;  4CNK A;  5C3J A;  3GD4 A;  4A79 A;  1IJH A;  3UKQ A;  3V3N A;  4TM1 A;  2YVG A;  1BGN A;  3UKA A;  1ZOY A;  1MOK A;  2A87 A;  1EBD A;  1KNR A;  2YG4 A;  1KSU A;  1V59 A;  3DK9 A;  1E1N A;  2WHD A;  2XLR A;  4NWZ A;  4H50 A;  3I3L A;  1JNZ A;  3UKL A;  5KOW A;  4YWO A;  4G9K A;  3DH9 A;  3T31 A;  4FK1 A;  4B65 A;  1M6I A;  3CMM A;  4OPU A;  3AD8 B;  3C4A A;  2X8G A;  4Z2T A;  2R0G A;  3KVE A;  3NYC A;  1ZY8 A;  1S2Y A;  4B1B A;  2XYO A;  4YTM A;  3NTD A;  1X31 B;  3CIR A;  1OJT A;  2C3C A;  4G73 A;  3QSS A;  4NTD A;  4G6H A;  1NHS A;  2NPX A;  4USQ A;  3P4S A;  4YXD A;  2B7S A;  4LII A;  4FDC B;  1H7X A;  3CPJ G;  2YR5 A;  1CL0 A;  1SEZ A;  1IUU A;  4GF7 A;  1ZDL A;  2Z5X A;  1S7M A;  2BCP A;  1FOH A;  3UOV A;  2J3N A;  1B8S A;  3UCL A;  5LV9 A;  3V3O A;  2YG5 A;  4U8L A;  3QJ4 A;  4H2P A;  3AEG A;  3SQP A;  1N4W A;  2O9Z A;  3UKK A;  5BUL A;  3UTG A;  2ACZ A;  4NEW A;  1B5Q A;  5KWF A;  4GDE A;  1JNR A;  3HZL A;  1PXC A;  4OPL A;  4Z2R A;  1YY5 A;  4HB9 A;  3B3R A;  1IUX A;  2E4G A;  3NG7 X;  3D9X A;  3T2Y A;  1F3P A;  3ICS A;  4H4S A;  1LTX R;  3AD9 B;  2X99 A;  1DXL A;  1KF6 A;  3II4 A;  1PBC A;  2JBV A;  4Z25 A;  3SZF A;  2B9X A;  5HHF A;  2ZZC A;  2YM1 A;  1LVL A;  2FBW A;  3CNS A;  3CN8 A;  2V6O A;  4A99 A;  5EBK A;  1KSS A;  1MO9 A;  4ZN0 A;  1LV0 A;  2FJA A;  3BI2 A;  3KKJ A;  1RP0 A;  1DJQ A;  1KN0 A;  3AB1 A;  4U2S A;  5C2T A;  2RAB A;  3F8D A;  3CND A;  2XCG A;  1D7L A;  4J36 A;  2YR4 A;  4FK1 C;  2YM2 A;  4AOX A;  1JRZ A;  2CDU A;  4BV6 A;  3NN6 X;  2BK4 A;  4GAP A;  3PG6 A;  3NT6 A;  3O0H A;  4IA6 A;  1ZMC A;  1NDA A;  2R9Z A;  3L1R A;  4A65 A;  4KPR A;  4EMW A;  4EMJ A;  3IHM A;  1E1K A;  4JNA A;  1O5W A;  5EB4 A;  3UP5 A;  3F8R A;  4JDR A;  1TDF A;  2B9Y A;  2WOI A;  2BRA A;  1FL2 A;  4N9X A;  4XWR A;  5KMR A;  3AYJ A;  4D04 A;  2WEU A;  3Q6J A;  1GES A;  1AOG A;  2XLP A;  4EIQ A;  1DOC A;  1BF3 A;  2QA1 A;  4M52 A;  3SYI A;  4H7U A;  2OLN A;  2QCU A;  3AEB A;  3ZDN A;  3FMW A;  5L46 A;  2BK5 A;  3KA7 A;  2C64 A;  2WDQ A;  1GRB A;  1EL7 A;  5GSN A;  4OPD A;  2VZ2 A;  5M0Z A;  1ELI A;  4O5U A;  4WX1 A;  2YQU A;  3GWF A;  4K7Z A;  5FS7 A;  1L9E A;  2WET A;  4YSZ A;  4Z44 A;  5J60 A;  1Y0P A;  2YWL A;  5KMS A;  1TDK A;  4EIP A;  5KMP A;  4H4V A;  1Q1W A;  3NK2 X;  1PXA A;  3KU9 A;  3SFE A;  4B69 A;  4H2R A;  4A6N A;  1REO A;  4YSY A;  1P2H A;  3AE6 A;  4H2N A;  1JRY A;  2F5Z A;  4UDQ A;  3CNT A;  1PBF A;  2GMJ A;  2C72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...