4FDCB

Crystal structure of the e493v mutant of human apoptosis inducing factor (aif)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
483
structure length
461
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYVAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis, oxidoreductase
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Cowchock syndrome is associated with a mutation in apoptosis-inducing factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 135
structure length 461
sequence length 483
ec nomenclature ec 1.-.-.-:
pdb deposition date 2012-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
B PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4fdcB03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fdcB02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fdcB01
3GD3A 3AEAA 3CNSA 2R4JA 4EM3A 1NHRA 4WX1A 4USRA 3FPZA 3IHGA 5JCNA 4DSHA 4K5RA 3ICRA 4H4PA 4J31A 3UOXA 3NK0X 1FEBA 3I3LA 3ZDNA 3NN6X 4FDCB 4AOXA 1JU2A 1ZMCA 3BHKA 4JDRA 1S2QA 3VR8A 3C96A 4EQWA 3VRBA 5KVIA 3QJ4A 2R0GA 3AE3A 1L9CA 2YR5A 2I0ZA 4EIPA 4I59A 4O5UA 3NK1X 3V3OA 2YLTA 3ABVA 3H4KA 3UKQA 5KWFA 1O95A 2BCPA 1UKVG 1PJ5A 3S5WA 5KOXA 3NTDA 2R46A 4ZN0A 4EMJA 2X8CA 3CGEA 1CJ2A 1N1PA 4H2QA 3LXDA 3SFEA 3UP5A 2BA9A 3UOYA 3AEBA 2VRMA 3KKJA 4B69A 1L9EA 2WEUA 4IVOB 4NEWA 4AP3A 2FJBA 2Q7VA 3CIRA 2OA1A 1YKJA 1Q9IA 1K4QA 3GD4A 1EL8A 1PBEA 4I58A 4BK3A 2B9YA 2FJEA 3FBSA 4B66A 3PVCA 3NYEA 4D04A 2WPFA 5KXJA 1FOHA 4Z2UA 3II4A 2FBWA 1VG0A 3F8PA 4Z25A 1ONFA 1LVLA 1ZX9A 3L8KA 3G5RA 4YSHA 4FK1A 3AYJA 4H7UA 4JN9A 3UKLA 1LPFA 3Q6JA 4BJYA 4B63A 1Q1RA 1KNRA 3PS9A 4CY6A 4BV6A 4H2PA 3UOZA 2BC1A 3D1CA 4TM4A 3M13A 5C3JA 1D4CA 1OJAA 3HZLA 3M12A 1OJTA 1H6VA 4M52A 1IUXA 2YLRA 3H8IA 3AD8B 3BI4A 3AEDA 4YSYA 4Z26A 2RGJA 3KA7A 1Q1WA 3Q9TA 4U2TA 3I6DA 1GREA 2O9ZA 1KDGA 3KU9A 2XCGA 1F8RA 1GRTA 1GV4A 4Z43A 4TLXA 1S2YA 3LOVA 2WDRA 4GDEA 4J33A 3P4RA 3NYFA 4PABA 1E1LA 1COYA 2ARDA 1CJ3A 1NHQA 1RP0A 3VRDB 1H7XA 1TDEA 1XDIA 5FS8A 5JCKA 1TDNA 2GAGB 2QA1A 2YG5A 3L1RA 1NEKA 2CFYA 2DKHA 5IPYA 1TYPA 1BZLA 3O0HA 5JCLA 2CDUA 4JY2A 2JK6A 2XLUA 3JSKA 3P4SA 2VQ7A 3COXA 5BULA 4NTCA 2QAEA 2WP6A 4H4UA 5FMHA 3LZWA 1Y0PA 3NH3X 2WHDA 4EIQA 1PDHA 4XWZA 3NK2X 1LV0A 3QSSA 4PAAA 4X9MA 2OLNA 4AT2A 3K7QX 3ALMA 2EQ6A 2OALA 2DKIA 3NYCA 2IVEA 4GRTA 2Q0LA 2AQJA 1Z6LA 1GSNA 2XVFA 4Z2RA 2YG4A 5HXIA 1EL7A 4CBQA 2BC0A 1B4VA 1LTXR 4RG3A 1SEZA 1F8WA 3NLCA 3G5QA 3GDPA 4LIIA 1MO9A 3UTGA 1YY5A 1M64A 3AYIA 2VVLG 3CNJA 2XFQA 4AP1A 2GEWA 3FMWA 5L46A 3DGHA 2ZZ0A 4ADWA 2YG7A 4C5OA 2WPCA 2C67A 1PBBA 1TDOA 2C3DA 3EANA 1GRAA 4H4XA 4KPRA 2FJDA 2WU2A 1NPXA 3NTAA 1LJ1A 3BNUA 4IA5A 3AECA 4U2SA 1H86A 5U25A 2BK5A 1BWCA 4REKA 4EMWA 2W0HA 1IJHA 3AYLA 2Q6UA 2XYOA 1H81A 1IUTA 2CULA 2OLOA 2V6OA 3KLJA 2BCGG 2XFOA 2YM2A 1ZY8A 3NIXA 4B67A 1ELIA 4H4ZA 4JNAA 4U8OA 4YTNA 5EB5A 5HHFA 1XANA 3NGCX 3GMCA 3QFAA 2Y6QA 1NHSA 3FG2P 4DGKA 4GF7A 2V61A 4U8NA 1B8SA 3EPTA 4C77A 2R45A 1XHCA 2OAMA 1GEUA 1BGJA 2GB0A 3ZYXA 5KOWA 1NENA 3T37A 4C3XA 2YLWA 4CY8A 2E1MA 1D4EA 2YWLA 4BJZA 3AE5A 4TM1A 2BXSA 3BNMA 4U8MA 1VG9A 4GDPA 4CNKA 2R0CA 1KF6A 2TPRA 2YAUA 3NKSA 1ZDLA 4CNJA 2X8HA 1QJDA 3CNPA 2QCUA 3GRTA 2R4EA 2XLSA 3CGBA 4GR1A 5FS6A 2JB1A 4UP3A 3NT6A 4J34A 1YQ3A 2GVCA 1GERA 4LA1A 1CC2A 4D03A 4NTDA 2X50A 4LU6A 2VZ2A 4O5QA 2GH5A 2B9XA 4HA6A 4B64A 4C74A 2RABA 2WU5A 2ZZBA 2XFPA 4J57A 1CJCA 1KNPA 3ICTA 3NHOX 3NG7X 3ATRA 5U63A 4NEVA 1N4VA 1L9DA 3EF6A 3P4PA 1EL9A 2XVHA 2C76A 4CRTA 2E5VA 1TRBA 2CVJA 1L0VA 2RGHA 1IUVA 2YG3A 1CL0A 1VDCA 1PBDA 4U8LA 3AD7B 5C2TA 2H89A 3D8XA 4OPLA 4X4JA 2Q0KA 3RP8A 4YSXA 1GRFA 4A99A 2UZZA 1IUWA 3ITJA 1P2EA 2C64A 2YLXA 2C75A 2JBVA 4JNQA 5EBKA 4H4RA 1IUSA 3LADA 3SGLA 1DNCA 3RHAA 1DOBA 1DXLA 1PXBA 3GWFA 3VQRA 2FJAA 3UOVA 2BS4A 3AE7A 1NG4A 3G5SA 1NHPA 1PHHA 2WP9A 1GRBA 2Z5YA 3LZXA 4OPIA 4RG4A 1YQ4A 2YLSA 4U8KA 2JB3A 1MXTA 4UDRA 2J3NA 1D4DA 3DK4A 4NZHA 1S3EA 2H88A 2C65A 1HYUA 4YKFA 2WETA 2VOUA 2Z5XA 2C72A 2GR3A 3C4AA 1NAAA 1CF3A 1MOKA 2V5ZA 4EQXA 3P9UA 5CQFA 1F3PA 3UKHA 5KVHA 2BK3A 4U8PA 4H4TA 4OPDA 3NRNA 4TM0A 1GRHA 3GYJA 2YR4A 3NNEA 2VQBA 4Z2TA 1GETA 4J36A 1TDKA 1PBFA 3V3NA 1GXFA 1DOEA 1AOGA 1P2HA 2JAEA 3QSMA 5LV9A 2WOVA 1OJDA 3DA1A 4K2XA 5FS9A 4OPUA 2WP5A 2BABA 2GR2A 1FEAA 4FX9A 1BKWA 1QO8A 1QLBA 2Y6RA 3ADAB 3AE1A 4U8JA 2XLPA 4USQA 3K7TA 1GPEA 1F8SA 3K30A 1E1MA 3WE0A 1GESA 3S61A 4A9WA 3OZ2A 3DJJA 2YVGA 2GQFA 4APNA 3QFBA 2C73A 2WQYA 2VVMA 5M0ZA 2GR1A 2C70A 4YXDA 3P1WA 2XFNA 2EQ9A 1B37A 1Y56A 2IIDA 4X9NA 3FIMB 1H83A 2QA2A 1KSSA 3UTHA 3CNTA 3CPHG 4B65A 1TDFA 3AE8A 2JKCA 3CN8A 4YKGA 3AE4A 2RGOA 1GOSA 4BK1A 1DODA 1NDAA 4OPTA 1ZOVA 1X31B 4H4QA 1BF3A 2NVKX 4A79A 4BK2A 1FECA 4ECHA 3IC9A 1PJ7A 1JOAA 4Y4MA 3UTFA 1PXCA 2V3BA 4IVMB 4K7ZA 2GQWA 2YG6A 4EM4A 3GWDA 1VQWA 4Y4LA 1GT8A 1GTEA 4KX6A 4OCGA 5DBJA 1CC4A 4B68A 5BVAA 5JCIA 1E1KA 1BGNA 4C3YA 2AAQA 4B1BA 1D7LA 1PN0A 4IV9A 5J7XA 2R0PA 3QSEA 3DK9A 2C66A 4GCMA 2E4GA 2XLRA 3H8LA 5GRTA 2B9WA 3ISHA 5EB4A 4NTEA 2WS3A 2R9ZA 3CGDA 4YWOA 1VRQB 1OJ9A 2X8GA 2PHHA 5GSNA 4BURA 4IA6A 2WESA 1F6MA 4ZCCA 3IF9A 5EOWA 1EL5A 3REDA 3SQPA 2B7SA 3B3RA 2A87A 2GAHB 4YTMA 1N4WA 3SM8A 2GV8A 2X3NA 1PJ6A 2A89A 4JQ9A 3F8RA 4TM3A 3BI2A 3CNDA 4H2RA 1ZMDA 4YT0A 2X99A 1CC6A 1DJQA 3F8DA 3GSIA 4UDPA 2WDQA 2VVLA 3DH9A 1K0JA 1Y56B 4A65A 3C4NA 2BS2A 2C7GA 3BHFA 3IWAA 4H4SA 2A8XA 1PS9A 2GR0A 3GRSA 3DK8A 1DJNA 2AR8A 3AE6A 5HY5A 1NG3A 4K5SA 1E39A 4E0VA 2APGA 1PXAA 4Z44A 2F5ZA 3AD9B 5BUKA 4XXGA 4ICYA 2WBAA 3CPJG 3UCLA 4EQRA 1M6IA 3ICSA 1JRZA 3R9UA 4DSGA 2V3AA 1JEHA 4A5LA 5M10A 1KSUA 3UKPA 3AB1A 3KVEA 1CHUA 1GTHA 3AWIA 2WPEA 3E1TA 2ZBWA 2HQMA 2ZZCA 4U8IA 3K7MX 3AEEA 1GNDA 1ZK7A 3CGCA 1ZP0A 3AEFA 5J60A 4A6NA 3LB8A 1H7WA 4YSZA 4WCTA 4H50A 5FS7A 4K8DA 2YVFA 4OPGA 1YQZA 4CCQA 2EQ8A 2VRLA 3DJDA 1H84A 4YTPA 2GMHA 3AXBA 3UP4A 3DGZA 4DNAA 2NPXA 3OC4A 3RP6A 4H4WA 2GRTA 5CKUA 2XFUA 1D7YA 2EQ7A 2XLTA 2GF3A 1DOCA 3ALJA 2C3CA 2V60A 1LQTA 4TLZA 3GMBA 1ZKQA 4HB9A 1D5TA 3UKFA 3CPIG 1CJ4A 4FK1C 2BACA 1E7PA 1B5QA 3DMEA 4J56A 4EQSA 1H82A 3GDNA 1N4UA 4N9XA 1O5WA 2PYXA 2BK4A 1W4XA 2JB2A 4AT0A 4OVIA 4Y4NA 1FCDA 2XVJA 3P4QA 4P9SA 3RP7A 3URHA 2GMJA 2XVIA 2YM1A 3QVRA 4UDQA 3V76A 3DJGX 5JCMA 3CTYA 2B7RA 1E1NA 4GUVA 1S3BA 3B6DA 2YLZA 3KPFA 1PBCA 3UKAA 1K0IA 1CBOA 1FL2A 2BYBA 5IQ1A 4H4YA 1XPQA 5ER0A 4U2LA 2BS3A 3NN0X 4JY3A 3SFDA 1K0LA 1IUUA 1JRXA 2YQUA 3EAOA 4K22A 2WOWA 2WDVA 4OPCA 4A6NB 1OJCA 3UKKA 1RSGA 4ZCDA 1JNZA 3AEGA 3AE9A 2YVJA 3ATQA 4EMIA 1TYTA 1KFYA 1LQUA 4H4VA 3VR9A 4AOSA 5KRQA 3IHMA 1EBDA 1V59A 3LJPA 4CCRA 4J2WA 3AE2A 3UTEA 3RNMA 3M0OA 2ACZA 1E6EA 3VRAA 1REOA 2XDOA 5TR3A 2TMDA 2BXRA 4H2NA 3BI5A 1RYIA 2B76A 2XVEA 5U1OA 1JNRA 2YR6A 4Z24A 3ALLA 3DJEA 1GRGA 5BRTA 2WOIA 4MJWA 5IQ4A 4RSLA 3QVPA 1GALA 1JRYA 1O94A 3KD9A 4XWRA 4A7AA 3PO7A 5HYMA 3GYIA 2IVDA 1ZOYA
chains in the Genus database with same CATH superfamily
3GD3A 4USRA 2OFJA 4H4PA 4J31A 3T6CA 5KVIA 2BRAA 4EIPA 4O5UA 3NK1X 2AL1A 2YLTA 4JHMA 1UKVG 4II3A 4IZGA 1JROA 2X8CA 3LXDA 3AEBA 2VRMA 3KKJA 2P3ZA 3RCYA 2Q7VA 3CIRA 1YKJA 4KPLA 1ECQA 1EL8A 4B66A 2PPGA 3NYEA 3PVCA 1FOHA 3II4A 3TOYA 3GYXA 2FBWA 4Z25A 1ZX9A 4GGBA 3QKEA 4BJYA 4CY6A 2BC1A 4TVWA 1H6VA 2YLRA 3ES7A 2PTWA 4Z26A 3DG7A 1EC7A 3I6DA 1MRAA 2O9ZA 1F8RA 3IJQA 4FI4A 3UCCA 2WDRA 4GAPA 2P88A 1P48A 1CJ3A 4GYPC 5FS8A 1TDNA 2PP3A 3IJLA 3DIPA 2W3RA 3COXA 2PU0A 3TJIA 3NK2X 3QSSA 2OLNA 2OALA 2DKIA 3NYCA 1RVKA 1Z6LA 1GSNA 1V97A 5HXIA 1F9CA 3TTEA 2XH4A 3THUA 3UTGA 3AN1A 1M64A 3AYIA 3CNJA 1NELA 2C67A 1KCZA 4KPRA 1NPXA 3NTAA 4ZA0A 1LJ1A 5U25A 1IJHA 3AYLA 4G9KA 1H81A 1IUTA 2CULA 2XFOA 1R0MA 1WYGA 3ZLFA 4C77A 3ES8A 1GEUA 3ZYXA 4C3XA 3AE5A 2BXSA 4U8MA 1VG9A 2YAUA 4CNJA 5FJRA 1QJDA 4F4RA 3ZLHA 3BJSA 3CGBA 4GR1A 2JB1A 3NT6A 4J34A 3UJ2A 4NTDA 4HA6A 2ZZBA 2XFPA 3NHOX 1CJCA 3B97A 1L9DA 3EF6A 4HPNA 2C76A 1TRBA 1L0VA 1IUVA 1VDCA 4J1OA 2PA6A 3H7VA 3D8XA 4ENLA 3D9XA 3Q45A 4NWZA 3SGLA 3GWFA 2QVHA 3UOVA 1NG4A 1PHHA 2WP9A 2Z5YA 2P8BA 2QQ6A 2JB3A 2J3NA 4NZHA 2C65A 1HYUA 1MOKA 4EQXA 3P9UA 1T3QC 1F3PA 3UKHA 2BK3A 4U8PA 4H4TA 4K8GA 3NNEA 4Z2TA 2ZC8A 2PSNA 1OJDA 3DA1A 1QLBA 3T37A 2Y6RA 4U8JA 3K7TA 3K30A 3SY4A 4TVYA 3OZ2A 3QFBA 2WQYA 3TJ4A 1JCTA 2C70A 2XFNA 1Y56A 2IIDA 2QA2A 3UTHA 4B65A 4YKGA 2RGOA 4M6UA 4BK1A 1NDAA 4OPTA 2AL2A 1ZOVA 3TW9A 1JOAA 3UTFA 1MNSA 2V3BA 4IVMB 4K7ZA 4Y4LA 4B68A 5DBJA 1BGNA 5J7XA 2R0PA 3DK9A 4GCMA 3BOXA 1E9IA 3H8LA 5GRTA 1N61C 2B9WA 5KMPA 2R9ZA 3CGDA 2X8GA 5GSNA 3CT2A 1F6MA 3REDA 2GAHB 2HXUA 2X3NA 2A89A 3F8RA 1ZMDA 5KNLA 3PFRA 4FP1A 1CC6A 2HNEA 3F8DA 4DHGA 3DH9A 1K0JA 2VVLA 3C4NA 2A8XA 3GRSA 4K5SA 1E39A 1JRZA 3R9UA 3NVVB 4A5LA 1KSUA 3AB1A 3KVEA 4U8IA 2ZBWA 3UGVA 3CMMA 2ONEA 3CYJA 5G5HB 2HZGA 2YVFA 4OPGA 4CCQA 2EQ8A 2GSHA 3DJDA 3UP4A 5CKUA 1D7YA 2XLTA 1LQTA 4HB9A 3UKFA 4FK1C 2BACA 1E7PA 4EQSA 1N4UA 1O5WA 2PYXA 2BK4A 4AT0A 4OVIA 3RP7A 5FJOA 3R10A 3R25A 2XVIA 2YM1A 3DJGX 1S3BA 5FJTA 1JRPA 3SN4A 1CBOA 1FL2A 5IQ1A 4DX3A 4G6HA 4JY3A 3VFCA 1K0LA 1JRXA 4HCHA 2PP1A 1KKOA 3EUB3 3UJEA 3AE9A 1TYTA 3SR6B 3IHMA 3UTEA 2QGYA 2BXRA 4IL2A 5U1OA 2YR6A 3ALLA 4GFIA 4MJWA 1O94A 1ZOYA 2OLAA 4ZCWA 1NHRA 4WX1A 3IHGA 3ZVIA 5JCNA 3NVYB 4DSHA 1FEBA 4GISA 2OX4A 4FDCB 1S2QA 3OPSA 1P43A 3C96A 3VRBA 3AE3A 2YR5A 3ETRB 3T8QA 3UKQA 3RO6A 5KOXA 3NTDA 3NS1B 4EMJA 4G74A 3VCCA 1CJ2A 3UP5A 1L9EA 2XH0A 4NEWA 1Q9IA 1PBEA 2FJEA 2GL5A 2WPFA 1MUCA 3SZWA 4Z2UA 3UJRA 1VG0A 3F8PA 3S47A 3UKLA 1LPFA 1Q1RA 3U4FA 1KN0A 3UOZA 3D1CA 2QDEA 4TM4A 3M13A 3M12A 3H8IA 2FKPA 3AD8B 4Z17A 3DG3A 1GREA 3KU9A 2XCGA 4Z43A 4TLXA 4GDEA 3P4RA 1COYA 3T9PA 2ARDA 3R0KA 1XDIA 2GGHA 2YG5A 2GAGB 2CFYA 5IPYA 1BZLA 5JCLA 4JY2A 2CDUA 3P4SA 2VQ7A 2QAEA 1N62C 2WP6A 4H4UA 3LZWA 3RITA 1Y0PA 3NH3X 1PDHA 1LV0A 4PAAA 4X9MA 2EQ6A 2IVEA 4GRTA 2AQJA 2ZADA 2XVFA 2YG4A 3RR1A 4A35A 2PTXA 3KPKA 3H8AA 3FCPA 1F8WA 2XH2A 5KMQA 3GDPA 4LIIA 1MO9A 3FMWA 3DGHA 2ZZ0A 4ADWA 2WPCA 1TDOA 3EANA 1SJAA 4IA5A 3OTRA 3V5CA 1H86A 2BK5A 4REKA 2Q6UA 4HCLA 7ENLA 3KLJA 4YTNA 5HHFA 3H70A 4HCDA 3SXIA 3DERA 2GB0A 1NENA 4CY8A 2E1MA 4TM1A 5KMRA 1KF6A 1ZDLA 3AM9A 2E3TA 1XS2A 2GVCA 2X50A 4LU6A 2VZ2A 4B64A 2B9XA 3DG6A 2RABA 3ATRA 3DDMA 4NEVA 1EL9A 2XVHA 3T2ZA 3JZUA 1H2IA 2PTZA 3I4KA 2E5VA 4YWSA 1PBDA 3AD7B 5C2TA 3RP8A 4A99A 2OO6A 2UZZA 4JN7A 4DWDA 3HYVA 1IUSA 1DNCA 2FJAA 4OPIA 3R07C 1YQ4A 2YLSA 1D4DA 4MGGA 1S3EA 2Z5XA 2C72A 1NAAA 1TKKA 2V5ZA 3V4BA 3QPEA 4TM0A 3GYJA 2VQBA 4J36A 1TDKA 3CXBA 1GXFA 2WOVA 5FS9A 1FEAA 3N4EA 4C5OA 3WE0A 1GPEA 4A9WA 1E1MA 1GESA 3UXKA 2GQFA 3FIMB 3CNTA 1TDFA 3HW2A 3AMZA 3AE4A 1GOSA 4H4QA 1FECA 3IC9A 2PMQA 2GQWA 4MMWA 4EM4A 4HN8A 4OCGA 5JCIA 1SJBA 2PCEA 2PS2A 1X2HA 3QSEA 2E4GA 3SN0A 4H19A 4YWOA 3SX6A 2W54A 3IF9A 5EOWA 3B3RA 1N4WA 4IT1A 3ZLGA 1YEYA 2QJJA 2BS2A 3IWAA 2APGA 1PXAA 3SQSA 2F5ZA 3AD9B 4XXGA 3UCLA 4EQRA 1M6IA 3ICSA 5M10A 4UP3A 3E1TA 2WPEA 4HNLA 2ZZCA 3AEEA 1ZP0A 3CGCA 5J60A 3LB8A 1H7WA 4WCTA 5FS7A 2DW7A 3VC6A 4X2PA 4DNAA 4H4WA 3NRZB 1D5TA 3CB3A 3GDNA 2XGZA 4Y4NA 3QN3A 2XVJA 4UDQA 3T2YA 2B7RA 2OQYA 3B6DA 4IHCA 3UKAA 1K0IA 2BYBA 5ER0A 3EAOA 4E4FA 4A6NB 4HYRA 3AEGA 3JVAA 5KMSA 1FO4A 2YVJA 1LQUA 4AOSA 4H4VA 5KRQA 3EKGA 1V59A 1SJDA 4J3ZA 4J2WA 2ACZA 1E6EA 2OPJA 3BI5A 1RYIA 2B76A 2XVEA 5BRTA 2PTYA 1OEPA 1JRYA 4XWRA 3KD9A 3PO7A 3DEQA 4IP5A 2R4JA 3FPZA 3RRAA 3PWIA 3UOXA 3NK0X 3I3LA 3ZDNA 3NN6X 4AOXA 1JU2A 1ZMCA 3BHKA 1L8PA 4JDRA 2R0GA 3V3OA 3UJSA 2OZ8A 1O95A 3SBFA 3CGEA 3GD6A 3SN1A 3UOYA 4IVOB 5IDZA 2OA1A 1K4QA 3GD4A 3FBSA 3NVZB 4D04A 5KXJA 3FJ4A 1ONFA 3G5RA 4G73A 4YSHA 3AYJA 4H7UA 5BOFA 4B63A 4GGHA 1KNRA 2C4CA 1OJAA 3P3BA 1ONEA 3QTPA 3AEDA 1Q1WA 3Q9TA 1GV4A 4HNCA 1S2YA 1NHQA 1RP0A 5JCKA 2QA1A 3L1RA 2DKHA 3OW1A 1BKHA 3JSKA 5BULA 4NTCA 3VA8A 3T31A 3MUCA 4EIQA 4XWZA 3K7QX 3SSZA 2Q0LA 4Z2RA 2HXTA 1EL7A 4G6GA 4A6GA 2NQLA 3NLCA 3SJNA 3R1ZA 2VVLG 2GEWA 3D47A 3PG6A 1PBBA 2C3DA 1GRAA 4H4XA 2WU2A 3BNUA 3AECA 1VQZA 4H1ZA 3ZVHB 1FFUC 4EMWA 3VDGA 2XYOA 3ENLA 2OLOA 3PWGA 1W6TA 2YM2A 1ZY8A 1ELIA 4JNAA 2XH7A 3NGCX 3GMCA 2Y6QA 1S7MA 3FG2P 4DGKA 2V61A 1B8SA 3EPTA 3TWAA 2R45A 2OAMA 3SZCA 2YLWA 5JRBA 3V5FA 2R0CA 3T14A 2TPRA 3GC2A 4K2SA 2QCUA 3GRTA 2R4EA 2XLSA 3P93A 2W3SA 1EC8A 4LA1A 3FXGA 1CC2A 3A7RA 4O5QA 2GH5A 3T2KA 2GGGA 4AP1A 2WU5A 3ICTA 4J57A 3NG7X 1N4VA 4E6MA 4GYPA 3D46A 4CRTA 2CVJA 3A7UA 2OG9A 3MSYA 2RGHA 2YG3A 3CK5A 3TWBA 4U8LA 2H89A 3MY9A 4OPLA 2Q0KA 4YSXA 3GY1A 1MDRA 5J04A 1IUWA 2C64A 2YLXA 2OZ3A 2C75A 1ELSA 2JBVA 5EBKA 4H4RA 3LADA 4ZOHB 4E5TA 1DOBA 1DXLA 3VQRA 3N6HA 3DGBA 3G5SA 1NHPA 4RG4A 5FJUA 4U8KA 1WUEA 1MDLA 2I5QA 1WUFA 2H88A 1CF3A 3OP2A 3NRNA 4MKSA 2YR4A 3GO2A 1EC9A 1GETA 1PBFA 3TCSA 1R6WA 1AOGA 1DOEA 1P2HA 2JAEA 3SZ0A 4ROPA 3Q4DA 2WP5A 2BABA 1BKWA 4FX9A 1QO8A 4USQA 3JW7A 1F8SA 3NVWB 3DJJA 3KUMA 2YVGA 6ENLA 2AKMA 5M0ZA 4YXDA 3P1WA 4KT2A 4X9NA 1H83A 3CPHG 3AE8A 3CN8A 1DODA 2NVKX 4A79A 4BK2A 4ECHA 1PJ7A 4Y4MA 1PXCA 1FHUA 3GWDA 1GT8A 1GTEA 4KX6A 1CC4A 1E1KA 4C3YA 2AAQA 4B1BA 1D7LA 1PN0A 2XLRA 3H12A 5EB4A 4NTEA 1VRQB 2PHHA 4IA6A 1STZA 2QDDA 4ZCCA 3SQPA 2W55A 2A87A 4YTMA 1TZZA 2GV8A 4NNJA 4JQ9A 3BI2A 3CNDA 4H2RA 4YT0A 1DJQA 1KD0A 1Y56B 1PS9A 3DK8A 1DJNA 2AR8A 2AL2B 3HPFA 4E0VA 3IK4A 4ICYA 2WBAA 3UXLA 4DSGA 2V3AA 3UKPA 2HQMA 3MKCA 3K7MX 1GNDA 3CAWA 4YSZA 4H50A 4K8DA 3TQPA 3PK7A 1FHVA 1H84A 4YTPA 1BQGA 3HRDC 2GMHA 3DGZA 3RP6A 2GRTA 2XFUA 2EQ7A 3ALJA 5ENLA 4TLZA 1ZKQA 3CPIG 3MQTA 4J56A 1H82A 4N9XA 1W4XA 3I6EA 4P9SA 3ZVHA 3QVRA 1RM6B 2OKTA 4GUVA 2CHRA 2YLZA 1PBCA 2OQHA 2QJNA 4H4YA 3NN0X 1IUUA 2YQUA 3UCDA 3UJFA 2WDVA 4OPCA 1OJCA 2GGJA 1RSGA 3OZMA 3ATQA 4EMIA 1EBDA 4CCRA 3AE2A 3RNMA 3M0OA 3VRAA 1REOA 5TR3A 4IL0A 4H2NA 3BSMA 4Z24A 1JNRA 1DTNA 1GRGA 3T0KA 2WOIA 3A7AA 3QVPA 4A7AA 5HYMA 3P0WA 3AEAA 3NXLA 3CNSA 2DW6A 3SYIA 4EM3A 4K5RA 3ICRA 3DESA 5BOEA 3VR8A 4EQWA 3QJ4A 4Z1YA 3B9JB 1L9CA 2I0ZA 4I59A 3ABVA 3H4KA 5KWFA 2BCPA 1PJ5A 3S5WA 2OZTA 2R46A 4ZN0A 1PDYA 3R11A 1N1PA 4H2QA 3SFEA 2BA9A 1EBGA 4B69A 2WEUA 2XSXA 3STPA 4AP3A 2FJBA 3IJIA 4I58A 4BK3A 2B9YA 2FYMA 3DFYA 3FV9A 3L8KA 1LVLA 4FK1A 1KKRA 4JN9A 3Q6JA 3PS9A 4BV6A 4H2PA 5C3JA 1D4CA 3HZLA 1OJTA 4M52A 1IUXA 4GMEA 3BI4A 4YSYA 2PGEA 4E8GA 2RGJA 3KA7A 4U2TA 1SJCA 1KDGA 3S5SA 1GRTA 3LOVA 4J33A 2E5AA 3RGTA 3NYFA 4PABA 1E1LA 1JPMA 3VRDB 1H7XA 1TDEA 1N60C 3NO1A 1NEKA 1TYPA 2PODA 3O0HA 2JK6A 2XLUA 4GIRA 5FMHA 2WHDA 4K1WA 2MUCA 4AT2A 3ALMA 1N5XA 1NU5A 4A3RA 4CBQA 2BC0A 1N5WC 4DN1A 4G7FA 1B4VA 1LTXR 4RG3A 1SEZA 3G5QA 1YY5A 2XFQA 5EU9A 5L46A 2YG7A 3MWCA 2FJDA 3V3WA 4U2SA 4H83A 4JN8A 4E4UA 1BWCA 3VC5A 2W0HA 3DFHA 2V6OA 2BCGG 3NIXA 1N63C 2QJMA 4B67A 4H4ZA 4U8OA 5EB5A 1XANA 4KWSA 1JPDX 3QFAA 1NHSA 4GF7A 4U8NA 1XHCA 4M0XA 1BGJA 5KOWA 1ZXIC 3NZGA 1D4EA 2YWLA 4BJZA 3BNMA 4CNKA 4GDPA 3NKSA 2BRYA 2X8HA 4IP4A 3CNPA 5FS6A 1YQ3A 1GERA 4D03A 4C74A 5U63A 1KNPA 3P4PA 1CL0A 4X4JA 1GRFA 3N6JA 1XPYA 3ITJA 1P2EA 5FJPA 3QLDA 4JNQA 3RHAA 1PXBA 2BS4A 3AE7A 1IYXA 1EBHA 1GRBA 3LZXA 3SZFA 1MXTA 4UDRA 3DK4A 1X2GA 4YKFA 2WETA 2VOUA 2GR3A 3C4AA 3HYXA 5CQFA 5KVHA 4OPDA 1GRHA 2AKZA 3HYWA 3V3NA 3QSMA 5LV9A 4K2XA 4OPUA 3I6TA 2GR2A 3ADAB 3AE1A 2XLPA 3T4WA 3S61A 5G5GB 3FVDA 4APNA 2C73A 2OVLA 2VVMA 4H2HA 2GR1A 2EQ9A 1B37A 1KSSA 2JKCA 1TE6A 1X31B 1BF3A 3K1GA 2YG6A 1VQWA 5BVAA 3EEZA 4G8TA 4IV9A 4GAVA 2C66A 3ISHA 2WS3A 1OJ9A 4BURA 3MZNA 2PP0A 2MNRA 2WESA 4EWJA 2RDXA 3FYYA 1EL5A 2B7SA 2PU1A 3SM8A 4DXKA 1PJ6A 3N4FA 4TM3A 2X99A 3GSIA 4UDPA 2WDQA 4A65A 2C7GA 3BHFA 4H4SA 4DYEA 2GR0A 5HY5A 3AE6A 1NG3A 4Z44A 5BUKA 3VCNA 3CPJG 3U9IA 1JEHA 2GDQA 1CHUA 1GTHA 3AWIA 3CXOA 1ZK7A 3AEFA 4A6NA 1SB3B 4II2A 1YQZA 2VRLA 1PDZA 3AXBA 2NPXA 3OC4A 3NFUA 1JDFA 2GF3A 1DOCA 2C3CA 2V60A 3GMBA 1CJ4A 1B5QA 3DMEA 2POZA 2JB2A 1FCDA 3P4QA 1FFVC 3URHA 2GMJA 3R0UA 3V76A 5JCMA 3CTYA 1E1NA 2GGIA 1VDVA 3KPFA 1FIQB 2GGEA 1XPQA 4U2LA 2BS3A 3SFDA 2P0IA 4K22A 2WOWA 3L5OA 3UKKA 2O56A 4ZCDA 1JNZA 2P8CA 3VR9A 1KFYA 3LJPA 3OZYA 2XDOA 2TMDA 2PGWA 3DJEA 4KEMA 5IQ4A 4RSLA 1GALA 3GYIA 2IVDA
chains in the Genus database with same CATH topology
3GD3A 3AEAA 3CNSA 2R4JA 3SYIA 4EM3A 1NHRA 4WX1A 4USRA 3FPZA 3IHGA 5JCNA 4DSHA 4K5RA 3ICRA 4H4PA 4J31A 3UOXA 3NK0X 1FEBA 3I3LA 3ZDNA 3NN6X 4FDCB 4AOXA 1JU2A 1ZMCA 3BHKA 4JDRA 1S2QA 3VR8A 3C96A 4EQWA 3VRBA 5KVIA 3QJ4A 2R0GA 2BRAA 3AE3A 1L9CA 2YR5A 2I0ZA 4EIPA 4I59A 4O5UA 3NK1X 3V3OA 2YLTA 3ABVA 3H4KA 3WE0A 3UKQA 5KWFA 1O95A 2BCPA 1UKVG 1PJ5A 4II3A 3S5WA 5KOXA 3NTDA 2R46A 4ZN0A 4EMJA 4G74A 2X8CA 3CGEA 1CJ2A 1N1PA 4H2QA 3LXDA 3SFEA 3UP5A 2BA9A 3UOYA 3AEBA 2VRMA 3KKJA 4B69A 1L9EA 2WEUA 4IVOB 4NEWA 4AP3A 2FJBA 2Q7VA 3CIRA 2OA1A 1YKJA 1Q9IA 1K4QA 3GD4A 1EL8A 1PBEA 4I58A 4BK3A 2B9YA 2FJEA 3FBSA 4B66A 3PVCA 3NYEA 4D04A 2WPFA 5KXJA 1FOHA 3SZWA 4Z2UA 3II4A 3GYXA 2FBWA 1VG0A 3F8PA 4Z25A 1ONFA 1LVLA 1ZX9A 3L8KA 3G5RA 4G73A 4FK1A 3AYJA 4H7UA 4JN9A 3UKLA 4YSHA 1LPFA 3Q6JA 4BJYA 4B63A 1Q1RA 1KNRA 3PS9A 4CY6A 4BV6A 1KN0A 4H2PA 3UOZA 2BC1A 3D1CA 4TM4A 3M13A 2C4CA 1D4CA 1OJAA 5C3JA 3HZLA 3M12A 1OJTA 1H6VA 4M52A 1IUXA 2YLRA 3H8IA 3AD8B 3BI4A 3AEDA 4YSYA 4Z26A 2RGJA 3KA7A 1Q1WA 3Q9TA 4U2TA 3I6DA 1GREA 2O9ZA 1KDGA 3KU9A 2XCGA 1F8RA 1GRTA 1GV4A 4Z43A 4TLXA 1S2YA 3LOVA 2WDRA 4GDEA 4J33A 4GAPA 3P4RA 3NYFA 4PABA 1E1LA 1COYA 2ARDA 1CJ3A 1NHQA 1RP0A 3VRDB 1H7XA 1TDEA 1XDIA 5FS8A 5JCKA 1TDNA 2GAGB 2QA1A 2YG5A 3L1RA 1NEKA 2CFYA 2DKHA 5IPYA 1TYPA 1BZLA 3O0HA 5JCLA 2CDUA 4JY2A 2JK6A 2XLUA 3JSKA 3P4SA 2VQ7A 3COXA 5BULA 4NTCA 2QAEA 2WP6A 3T31A 4H4UA 5FMHA 3LZWA 1Y0PA 3NH3X 2WHDA 4EIQA 1PDHA 4XWZA 3NK2X 1LV0A 3QSSA 4PAAA 4X9MA 2OLNA 4AT2A 3K7QX 3ALMA 2EQ6A 2OALA 2DKIA 3NYCA 2IVEA 4GRTA 2Q0LA 2AQJA 1Z6LA 1GSNA 2XVFA 4Z2RA 2YG4A 5HXIA 1EL7A 4CBQA 2BC0A 3KPKA 1B4VA 4G6GA 1LTXR 4RG3A 1SEZA 1F8WA 3NLCA 3G5QA 3GDPA 4LIIA 1MO9A 5KMQA 3UTGA 1YY5A 1M64A 3AYIA 2VVLG 3CNJA 2XFQA 4AP1A 2GEWA 3FMWA 5L46A 3DGHA 2ZZ0A 4ADWA 2YG7A 4C5OA 2WPCA 3PG6A 2C67A 1PBBA 1TDOA 2C3DA 3EANA 1GRAA 4H4XA 4KPRA 2FJDA 2WU2A 1NPXA 3NTAA 1LJ1A 3BNUA 4IA5A 3AECA 4U2SA 1H86A 5U25A 2BK5A 1BWCA 4REKA 4EMWA 2W0HA 1IJHA 3AYLA 2Q6UA 2XYOA 4G9KA 1H81A 1IUTA 2CULA 2OLOA 2V6OA 3KLJA 2BCGG 2XFOA 2YM2A 1ZY8A 3NIXA 4B67A 1ELIA 4H4ZA 4JNAA 4U8OA 4YTNA 5EB5A 5HHFA 1XANA 3NGCX 3GMCA 3QFAA 2Y6QA 3SXIA 1S7MA 1NHSA 3FG2P 4DGKA 4GF7A 2V61A 4U8NA 1B8SA 3EPTA 4C77A 2R45A 1XHCA 2OAMA 1GEUA 1BGJA 2GB0A 3ZYXA 5KOWA 1NENA 3SZCA 3T37A 4C3XA 2YLWA 5JRBA 4CY8A 2E1MA 1D4EA 2YWLA 4BJZA 3AE5A 4TM1A 2BXSA 3BNMA 4U8MA 1VG9A 4GDPA 4CNKA 2R0CA 3T14A 5KMRA 1KF6A 2TPRA 2YAUA 3NKSA 1ZDLA 4CNJA 2BRYA 2X8HA 1QJDA 3CNPA 2QCUA 3GRTA 2R4EA 2XLSA 3CGBA 4GR1A 5FS6A 2JB1A 4UP3A 3NT6A 4J34A 1YQ3A 2GVCA 1GERA 4LA1A 1CC2A 4D03A 4NTDA 2X50A 4LU6A 2VZ2A 4O5QA 2GH5A 2B9XA 4HA6A 3T2KA 4B64A 4C74A 2RABA 2WU5A 2ZZBA 2XFPA 4J57A 1CJCA 1KNPA 3ICTA 3NHOX 3NG7X 3ATRA 5U63A 4NEVA 1N4VA 1L9DA 3EF6A 3P4PA 1EL9A 2XVHA 3T2ZA 2C76A 1H2IA 4CRTA 2E5VA 1TRBA 2CVJA 1L0VA 2RGHA 1IUVA 2YG3A 1CL0A 1VDCA 1PBDA 4U8LA 3AD7B 5C2TA 2H89A 3D8XA 4OPLA 4X4JA 2Q0KA 3RP8A 4YSXA 1GRFA 4A99A 2UZZA 1IUWA 3ITJA 1P2EA 2C64A 2YLXA 3D9XA 2C75A 2JBVA 3HYVA 4JNQA 5EBKA 4H4RA 1IUSA 3LADA 4NWZA 3SGLA 1DNCA 3RHAA 1DOBA 1DXLA 1PXBA 3GWFA 3VQRA 2FJAA 3UOVA 2BS4A 3AE7A 1NG4A 3G5SA 1NHPA 1PHHA 2WP9A 1GRBA 2Z5YA 3LZXA 4OPIA 4RG4A 1YQ4A 2YLSA 4U8KA 2JB3A 1MXTA 3SZFA 4UDRA 2J3NA 1D4DA 3DK4A 4NZHA 1S3EA 2H88A 2C65A 1HYUA 4YKFA 2WETA 2VOUA 2Z5XA 2C72A 2GR3A 3C4AA 3HYXA 1NAAA 1CF3A 1MOKA 2V5ZA 4EQXA 3P9UA 5CQFA 1F3PA 3UKHA 5KVHA 2BK3A 4U8PA 4H4TA 4OPDA 3NRNA 4TM0A 1GRHA 3GYJA 2YR4A 3NNEA 2VQBA 4Z2TA 1GETA 3HYWA 4J36A 1TDKA 1PBFA 3V3NA 1GXFA 1DOEA 1AOGA 1P2HA 2JAEA 3SZ0A 3QSMA 5LV9A 2WOVA 1OJDA 3DA1A 4K2XA 5FS9A 4OPUA 2WP5A 2BABA 2GR2A 1FEAA 4FX9A 1BKWA 1QO8A 1QLBA 2Y6RA 3ADAB 3AE1A 4U8JA 2XLPA 4USQA 3K7TA 1GPEA 1F8SA 3K30A 1E1MA 3SY4A 1GESA 3S61A 4A9WA 3OZ2A 3DJJA 2YVGA 2GQFA 4APNA 3QFBA 2C73A 2WQYA 2VVMA 5M0ZA 2GR1A 2C70A 4YXDA 3P1WA 2XFNA 2EQ9A 1B37A 1Y56A 2IIDA 4X9NA 3FIMB 1H83A 2QA2A 1KSSA 3UTHA 3CNTA 3CPHG 4B65A 1TDFA 3AE8A 2JKCA 3CN8A 4YKGA 3AE4A 2RGOA 1GOSA 4BK1A 1DODA 1NDAA 4OPTA 1ZOVA 1X31B 4H4QA 1BF3A 2NVKX 4A79A 4BK2A 1FECA 4ECHA 3IC9A 1PJ7A 1JOAA 4Y4MA 3UTFA 1PXCA 2V3BA 4IVMB 4K7ZA 2GQWA 2YG6A 4EM4A 3GWDA 1VQWA 4Y4LA 1GT8A 1GTEA 4KX6A 4OCGA 5DBJA 1CC4A 4B68A 5BVAA 5JCIA 1E1KA 1BGNA 4C3YA 2AAQA 4B1BA 1D7LA 1PN0A 4IV9A 5J7XA 2R0PA 3QSEA 4GAVA 3DK9A 2C66A 4GCMA 2E4GA 2XLRA 3H8LA 5GRTA 2B9WA 3ISHA 5KMPA 5EB4A 4NTEA 2WS3A 2R9ZA 3CGDA 4YWOA 1VRQB 1OJ9A 2X8GA 2PHHA 5GSNA 3SX6A 4BURA 4IA6A 2WESA 1F6MA 4ZCCA 3IF9A 5EOWA 1EL5A 3REDA 3SQPA 2B7SA 3B3RA 2A87A 2GAHB 4YTMA 1N4WA 3SM8A 2GV8A 2X3NA 4NNJA 1PJ6A 2A89A 4JQ9A 3F8RA 4TM3A 3BI2A 3CNDA 4H2RA 1ZMDA 5KNLA 4YT0A 2X99A 1CC6A 1DJQA 3F8DA 3GSIA 4UDPA 2WDQA 2VVLA 3DH9A 1K0JA 1Y56B 4A65A 3C4NA 2BS2A 2C7GA 3BHFA 3IWAA 4H4SA 2A8XA 1PS9A 2GR0A 3GRSA 3DK8A 1DJNA 2AR8A 3AE6A 5HY5A 1NG3A 4K5SA 1E39A 4E0VA 2APGA 1PXAA 4Z44A 2F5ZA 3AD9B 5BUKA 4XXGA 4ICYA 2WBAA 3CPJG 3UCLA 4EQRA 1M6IA 3ICSA 1JRZA 3R9UA 4DSGA 2V3AA 1JEHA 4A5LA 5M10A 1KSUA 3UKPA 3AB1A 3KVEA 1CHUA 1GTHA 3AWIA 2WPEA 3E1TA 2ZBWA 2HQMA 2ZZCA 4U8IA 3CMMA 3K7MX 3AEEA 1GNDA 1ZK7A 3CGCA 1ZP0A 3AEFA 5J60A 4A6NA 3LB8A 1H7WA 4YSZA 4WCTA 4H50A 5FS7A 4K8DA 4II2A 2YVFA 4OPGA 1YQZA 4CCQA 2EQ8A 2VRLA 3DJDA 1H84A 4YTPA 2GMHA 3AXBA 3UP4A 3DGZA 4DNAA 2NPXA 3OC4A 3RP6A 4H4WA 2GRTA 5CKUA 2XFUA 1D7YA 2EQ7A 2XLTA 2GF3A 1DOCA 3ALJA 2C3CA 2V60A 1LQTA 4TLZA 3GMBA 1ZKQA 4HB9A 1D5TA 3UKFA 3CPIG 1CJ4A 4FK1C 2BACA 1E7PA 1B5QA 3DMEA 4J56A 4EQSA 1H82A 3GDNA 1N4UA 4N9XA 1O5WA 2PYXA 2BK4A 1W4XA 2JB2A 4AT0A 4OVIA 4Y4NA 1FCDA 2XVJA 3P4QA 4P9SA 3RP7A 3URHA 2GMJA 2XVIA 2YM1A 3QVRA 4UDQA 3V76A 3T2YA 3DJGX 5JCMA 3CTYA 2B7RA 1E1NA 4GUVA 1S3BA 3B6DA 2YLZA 3KPFA 1PBCA 3UKAA 1K0IA 1CBOA 1FL2A 2BYBA 5IQ1A 4H4YA 1XPQA 5ER0A 4G6HA 2BS3A 3NN0X 4JY3A 4U2LA 3SFDA 1K0LA 1IUUA 1JRXA 2YQUA 3EAOA 4K22A 2WOWA 2WDVA 4OPCA 4A6NB 3L5OA 1OJCA 3UKKA 1RSGA 4ZCDA 1JNZA 3AEGA 3AE9A 5KMSA 2YVJA 3ATQA 4EMIA 1TYTA 1KFYA 1LQUA 4H4VA 3VR9A 4AOSA 5KRQA 3IHMA 1EBDA 1V59A 3LJPA 4CCRA 4J2WA 3AE2A 3UTEA 3RNMA 3M0OA 2ACZA 1E6EA 3VRAA 1REOA 2XDOA 5TR3A 2TMDA 2BXRA 4H2NA 3BI5A 1RYIA 2B76A 2XVEA 5U1OA 1JNRA 2YR6A 4Z24A 3ALLA 3DJEA 1GRGA 3T0KA 5BRTA 2WOIA 4MJWA 5IQ4A 4RSLA 3QVPA 1GALA 1JRYA 1O94A 3KD9A 4XWRA 4A7AA 3PO7A 5HYMA 3GYIA 2IVDA 1ZOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GD3 A;  3AEA A;  3CNS A;  2R4J A;  4EM3 A;  1NHR A;  4WX1 A;  4USR A;  3FPZ A;  3IHG A;  5JCN A;  4DSH A;  4K5R A;  3ICR A;  4H4P A;  4J31 A;  3UOX A;  3NK0 X;  1FEB A;  3I3L A;  3ZDN A;  3NN6 X;  4FDC B;  4AOX A;  1JU2 A;  1ZMC A;  3BHK A;  4JDR A;  1S2Q A;  3VR8 A;  3C96 A;  4EQW A;  3VRB A;  5KVI A;  3QJ4 A;  2R0G A;  3AE3 A;  1L9C A;  2YR5 A;  2I0Z A;  4EIP A;  4I59 A;  4O5U A;  3NK1 X;  3V3O A;  2YLT A;  3ABV A;  3H4K A;  3UKQ A;  5KWF A;  1O95 A;  2BCP A;  1UKV G;  1PJ5 A;  3S5W A;  5KOX A;  3NTD A;  2R46 A;  4ZN0 A;  4EMJ A;  2X8C A;  3CGE A;  1CJ2 A;  1N1P A;  4H2Q A;  3LXD A;  3SFE A;  3UP5 A;  2BA9 A;  3UOY A;  3AEB A;  2VRM A;  3KKJ A;  4B69 A;  1L9E A;  2WEU A;  4IVO B;  4NEW A;  4AP3 A;  2FJB A;  2Q7V A;  3CIR A;  2OA1 A;  1YKJ A;  1Q9I A;  1K4Q A;  3GD4 A;  1EL8 A;  1PBE A;  4I58 A;  4BK3 A;  2B9Y A;  2FJE A;  3FBS A;  4B66 A;  3PVC A;  3NYE A;  4D04 A;  2WPF A;  5KXJ A;  1FOH A;  4Z2U A;  3II4 A;  2FBW A;  1VG0 A;  3F8P A;  4Z25 A;  1ONF A;  1LVL A;  1ZX9 A;  3L8K A;  3G5R A;  4YSH A;  4FK1 A;  3AYJ A;  4H7U A;  4JN9 A;  3UKL A;  1LPF A;  3Q6J A;  4BJY A;  4B63 A;  1Q1R A;  1KNR A;  3PS9 A;  4CY6 A;  4BV6 A;  4H2P A;  3UOZ A;  2BC1 A;  3D1C A;  4TM4 A;  3M13 A;  5C3J A;  1D4C A;  1OJA A;  3HZL A;  3M12 A;  1OJT A;  1H6V A;  4M52 A;  1IUX A;  2YLR A;  3H8I A;  3AD8 B;  3BI4 A;  3AED A;  4YSY A;  4Z26 A;  2RGJ A;  3KA7 A;  1Q1W A;  3Q9T A;  4U2T A;  3I6D A;  1GRE A;  2O9Z A;  1KDG A;  3KU9 A;  2XCG A;  1F8R A;  1GRT A;  1GV4 A;  4Z43 A;  4TLX A;  1S2Y A;  3LOV A;  2WDR A;  4GDE A;  4J33 A;  3P4R A;  3NYF A;  4PAB A;  1E1L A;  1COY A;  2ARD A;  1CJ3 A;  1NHQ A;  1RP0 A;  3VRD B;  1H7X A;  1TDE A;  1XDI A;  5FS8 A;  5JCK A;  1TDN A;  2GAG B;  2QA1 A;  2YG5 A;  3L1R A;  1NEK A;  2CFY A;  2DKH A;  5IPY A;  1TYP A;  1BZL A;  3O0H A;  5JCL A;  2CDU A;  4JY2 A;  2JK6 A;  2XLU A;  3JSK A;  3P4S A;  2VQ7 A;  3COX A;  5BUL A;  4NTC A;  2QAE A;  2WP6 A;  4H4U A;  5FMH A;  3LZW A;  1Y0P A;  3NH3 X;  2WHD A;  4EIQ A;  1PDH A;  4XWZ A;  3NK2 X;  1LV0 A;  3QSS A;  4PAA A;  4X9M A;  2OLN A;  4AT2 A;  3K7Q X;  3ALM A;  2EQ6 A;  2OAL A;  2DKI A;  3NYC A;  2IVE A;  4GRT A;  2Q0L A;  2AQJ A;  1Z6L A;  1GSN A;  2XVF A;  4Z2R A;  2YG4 A;  5HXI A;  1EL7 A;  4CBQ A;  2BC0 A;  1B4V A;  1LTX R;  4RG3 A;  1SEZ A;  1F8W A;  3NLC A;  3G5Q A;  3GDP A;  4LII A;  1MO9 A;  3UTG A;  1YY5 A;  1M64 A;  3AYI A;  2VVL G;  3CNJ A;  2XFQ A;  4AP1 A;  2GEW A;  3FMW A;  5L46 A;  3DGH A;  2ZZ0 A;  4ADW A;  2YG7 A;  4C5O A;  2WPC A;  2C67 A;  1PBB A;  1TDO A;  2C3D A;  3EAN A;  1GRA A;  4H4X A;  4KPR A;  2FJD A;  2WU2 A;  1NPX A;  3NTA A;  1LJ1 A;  3BNU A;  4IA5 A;  3AEC A;  4U2S A;  1H86 A;  5U25 A;  2BK5 A;  1BWC A;  4REK A;  4EMW A;  2W0H A;  1IJH A;  3AYL A;  2Q6U A;  2XYO A;  1H81 A;  1IUT A;  2CUL A;  2OLO A;  2V6O A;  3KLJ A;  2BCG G;  2XFO A;  2YM2 A;  1ZY8 A;  3NIX A;  4B67 A;  1ELI A;  4H4Z A;  4JNA A;  4U8O A;  4YTN A;  5EB5 A;  5HHF A;  1XAN A;  3NGC X;  3GMC A;  3QFA A;  2Y6Q A;  1NHS A;  3FG2 P;  4DGK A;  4GF7 A;  2V61 A;  4U8N A;  1B8S A;  3EPT A;  4C77 A;  2R45 A;  1XHC A;  2OAM A;  1GEU A;  1BGJ A;  2GB0 A;  3ZYX A;  5KOW A;  1NEN A;  3T37 A;  4C3X A;  2YLW A;  4CY8 A;  2E1M A;  1D4E A;  2YWL A;  4BJZ A;  3AE5 A;  4TM1 A;  2BXS A;  3BNM A;  4U8M A;  1VG9 A;  4GDP A;  4CNK A;  2R0C A;  1KF6 A;  2TPR A;  2YAU A;  3NKS A;  1ZDL A;  4CNJ A;  2X8H A;  1QJD A;  3CNP A;  2QCU A;  3GRT A;  2R4E A;  2XLS A;  3CGB A;  4GR1 A;  5FS6 A;  2JB1 A;  4UP3 A;  3NT6 A;  4J34 A;  1YQ3 A;  2GVC A;  1GER A;  4LA1 A;  1CC2 A;  4D03 A;  4NTD A;  2X50 A;  4LU6 A;  2VZ2 A;  4O5Q A;  2GH5 A;  2B9X A;  4HA6 A;  4B64 A;  4C74 A;  2RAB A;  2WU5 A;  2ZZB A;  2XFP A;  4J57 A;  1CJC A;  1KNP A;  3ICT A;  3NHO X;  3NG7 X;  3ATR A;  5U63 A;  4NEV A;  1N4V A;  1L9D A;  3EF6 A;  3P4P A;  1EL9 A;  2XVH A;  2C76 A;  4CRT A;  2E5V A;  1TRB A;  2CVJ A;  1L0V A;  2RGH A;  1IUV A;  2YG3 A;  1CL0 A;  1VDC A;  1PBD A;  4U8L A;  3AD7 B;  5C2T A;  2H89 A;  3D8X A;  4OPL A;  4X4J A;  2Q0K A;  3RP8 A;  4YSX A;  1GRF A;  4A99 A;  2UZZ A;  1IUW A;  3ITJ A;  1P2E A;  2C64 A;  2YLX A;  2C75 A;  2JBV A;  4JNQ A;  5EBK A;  4H4R A;  1IUS A;  3LAD A;  3SGL A;  1DNC A;  3RHA A;  1DOB A;  1DXL A;  1PXB A;  3GWF A;  3VQR A;  2FJA A;  3UOV A;  2BS4 A;  3AE7 A;  1NG4 A;  3G5S A;  1NHP A;  1PHH A;  2WP9 A;  1GRB A;  2Z5Y A;  3LZX A;  4OPI A;  4RG4 A;  1YQ4 A;  2YLS A;  4U8K A;  2JB3 A;  1MXT A;  4UDR A;  2J3N A;  1D4D A;  3DK4 A;  4NZH A;  1S3E A;  2H88 A;  2C65 A;  1HYU A;  4YKF A;  2WET A;  2VOU A;  2Z5X A;  2C72 A;  2GR3 A;  3C4A A;  1NAA A;  1CF3 A;  1MOK A;  2V5Z A;  4EQX A;  3P9U A;  5CQF A;  1F3P A;  3UKH A;  5KVH A;  2BK3 A;  4U8P A;  4H4T A;  4OPD A;  3NRN A;  4TM0 A;  1GRH A;  3GYJ A;  2YR4 A;  3NNE A;  2VQB A;  4Z2T A;  1GET A;  4J36 A;  1TDK A;  1PBF A;  3V3N A;  1GXF A;  1DOE A;  1AOG A;  1P2H A;  2JAE A;  3QSM A;  5LV9 A;  2WOV A;  1OJD A;  3DA1 A;  4K2X A;  5FS9 A;  4OPU A;  2WP5 A;  2BAB A;  2GR2 A;  1FEA A;  4FX9 A;  1BKW A;  1QO8 A;  1QLB A;  2Y6R A;  3ADA B;  3AE1 A;  4U8J A;  2XLP A;  4USQ A;  3K7T A;  1GPE A;  1F8S A;  3K30 A;  1E1M A;  3WE0 A;  1GES A;  3S61 A;  4A9W A;  3OZ2 A;  3DJJ A;  2YVG A;  2GQF A;  4APN A;  3QFB A;  2C73 A;  2WQY A;  2VVM A;  5M0Z A;  2GR1 A;  2C70 A;  4YXD A;  3P1W A;  2XFN A;  2EQ9 A;  1B37 A;  1Y56 A;  2IID A;  4X9N A;  3FIM B;  1H83 A;  2QA2 A;  1KSS A;  3UTH A;  3CNT A;  3CPH G;  4B65 A;  1TDF A;  3AE8 A;  2JKC A;  3CN8 A;  4YKG A;  3AE4 A;  2RGO A;  1GOS A;  4BK1 A;  1DOD A;  1NDA A;  4OPT A;  1ZOV A;  1X31 B;  4H4Q A;  1BF3 A;  2NVK X;  4A79 A;  4BK2 A;  1FEC A;  4ECH A;  3IC9 A;  1PJ7 A;  1JOA A;  4Y4M A;  3UTF A;  1PXC A;  2V3B A;  4IVM B;  4K7Z A;  2GQW A;  2YG6 A;  4EM4 A;  3GWD A;  1VQW A;  4Y4L A;  1GT8 A;  1GTE A;  4KX6 A;  4OCG A;  5DBJ A;  1CC4 A;  4B68 A;  5BVA A;  5JCI A;  1E1K A;  1BGN A;  4C3Y A;  2AAQ A;  4B1B A;  1D7L A;  1PN0 A;  4IV9 A;  5J7X A;  2R0P A;  3QSE A;  3DK9 A;  2C66 A;  4GCM A;  2E4G A;  2XLR A;  3H8L A;  5GRT A;  2B9W A;  3ISH A;  5EB4 A;  4NTE A;  2WS3 A;  2R9Z A;  3CGD A;  4YWO A;  1VRQ B;  1OJ9 A;  2X8G A;  2PHH A;  5GSN A;  4BUR A;  4IA6 A;  2WES A;  1F6M A;  4ZCC A;  3IF9 A;  5EOW A;  1EL5 A;  3RED A;  3SQP A;  2B7S A;  3B3R A;  2A87 A;  2GAH B;  4YTM A;  1N4W A;  3SM8 A;  2GV8 A;  2X3N A;  1PJ6 A;  2A89 A;  4JQ9 A;  3F8R A;  4TM3 A;  3BI2 A;  3CND A;  4H2R A;  1ZMD A;  4YT0 A;  2X99 A;  1CC6 A;  1DJQ A;  3F8D A;  3GSI A;  4UDP A;  2WDQ A;  2VVL A;  3DH9 A;  1K0J A;  1Y56 B;  4A65 A;  3C4N A;  2BS2 A;  2C7G A;  3BHF A;  3IWA A;  4H4S A;  2A8X A;  1PS9 A;  2GR0 A;  3GRS A;  3DK8 A;  1DJN A;  2AR8 A;  3AE6 A;  5HY5 A;  1NG3 A;  4K5S A;  1E39 A;  4E0V A;  2APG A;  1PXA A;  4Z44 A;  2F5Z A;  3AD9 B;  5BUK A;  4XXG A;  4ICY A;  2WBA A;  3CPJ G;  3UCL A;  4EQR A;  1M6I A;  3ICS A;  1JRZ A;  3R9U A;  4DSG A;  2V3A A;  1JEH A;  4A5L A;  5M10 A;  1KSU A;  3UKP A;  3AB1 A;  3KVE A;  1CHU A;  1GTH A;  3AWI A;  2WPE A;  3E1T A;  2ZBW A;  2HQM A;  2ZZC A;  4U8I A;  3K7M X;  3AEE A;  1GND A;  1ZK7 A;  3CGC A;  1ZP0 A;  3AEF A;  5J60 A;  4A6N A;  3LB8 A;  1H7W A;  4YSZ A;  4WCT A;  4H50 A;  5FS7 A;  4K8D A;  2YVF A;  4OPG A;  1YQZ A;  4CCQ A;  2EQ8 A;  2VRL A;  3DJD A;  1H84 A;  4YTP A;  2GMH A;  3AXB A;  3UP4 A;  3DGZ A;  4DNA A;  2NPX A;  3OC4 A;  3RP6 A;  4H4W A;  2GRT A;  5CKU A;  2XFU A;  1D7Y A;  2EQ7 A;  2XLT A;  2GF3 A;  1DOC A;  3ALJ A;  2C3C A;  2V60 A;  1LQT A;  4TLZ A;  3GMB A;  1ZKQ A;  4HB9 A;  1D5T A;  3UKF A;  3CPI G;  1CJ4 A;  4FK1 C;  2BAC A;  1E7P A;  1B5Q A;  3DME A;  4J56 A;  4EQS A;  1H82 A;  3GDN A;  1N4U A;  4N9X A;  1O5W A;  2PYX A;  2BK4 A;  1W4X A;  2JB2 A;  4AT0 A;  4OVI A;  4Y4N A;  1FCD A;  2XVJ A;  3P4Q A;  4P9S A;  3RP7 A;  3URH A;  2GMJ A;  2XVI A;  2YM1 A;  3QVR A;  4UDQ A;  3V76 A;  3DJG X;  5JCM A;  3CTY A;  2B7R A;  1E1N A;  4GUV A;  1S3B A;  3B6D A;  2YLZ A;  3KPF A;  1PBC A;  3UKA A;  1K0I A;  1CBO A;  1FL2 A;  2BYB A;  5IQ1 A;  4H4Y A;  1XPQ A;  5ER0 A;  4U2L A;  2BS3 A;  3NN0 X;  4JY3 A;  3SFD A;  1K0L A;  1IUU A;  1JRX A;  2YQU A;  3EAO A;  4K22 A;  2WOW A;  2WDV A;  4OPC A;  4A6N B;  1OJC A;  3UKK A;  1RSG A;  4ZCD A;  1JNZ A;  3AEG A;  3AE9 A;  2YVJ A;  3ATQ A;  4EMI A;  1TYT A;  1KFY A;  1LQU A;  4H4V A;  3VR9 A;  4AOS A;  5KRQ A;  3IHM A;  1EBD A;  1V59 A;  3LJP A;  4CCR A;  4J2W A;  3AE2 A;  3UTE A;  3RNM A;  3M0O A;  2ACZ A;  1E6E A;  3VRA A;  1REO A;  2XDO A;  5TR3 A;  2TMD A;  2BXR A;  4H2N A;  3BI5 A;  1RYI A;  2B76 A;  2XVE A;  5U1O A;  1JNR A;  2YR6 A;  4Z24 A;  3ALL A;  3DJE A;  1GRG A;  5BRT A;  2WOI A;  4MJW A;  5IQ4 A;  4RSL A;  3QVP A;  1GAL A;  1JRY A;  1O94 A;  3KD9 A;  4XWR A;  4A7A A;  3PO7 A;  5HYM A;  3GYI A;  2IVD A;  1ZOY A; 
#chains in the Genus database with same CATH topology
 3GD3 A;  4USR A;  2OFJ A;  4H4P A;  4J31 A;  3T6C A;  5KVI A;  2BRA A;  4EIP A;  4O5U A;  3NK1 X;  2AL1 A;  2YLT A;  4JHM A;  1UKV G;  4II3 A;  4IZG A;  1JRO A;  2X8C A;  3LXD A;  3AEB A;  2VRM A;  3KKJ A;  2P3Z A;  3RCY A;  2Q7V A;  3CIR A;  1YKJ A;  4KPL A;  1ECQ A;  1EL8 A;  4B66 A;  2PPG A;  3NYE A;  3PVC A;  1FOH A;  3II4 A;  3TOY A;  3GYX A;  2FBW A;  4Z25 A;  1ZX9 A;  4GGB A;  3QKE A;  4BJY A;  4CY6 A;  2BC1 A;  4TVW A;  1H6V A;  2YLR A;  3ES7 A;  2PTW A;  4Z26 A;  3DG7 A;  1EC7 A;  3I6D A;  1MRA A;  2O9Z A;  1F8R A;  3IJQ A;  4FI4 A;  3UCC A;  2WDR A;  4GAP A;  2P88 A;  1P48 A;  1CJ3 A;  4GYP C;  5FS8 A;  1TDN A;  2PP3 A;  3IJL A;  3DIP A;  2W3R A;  3COX A;  2PU0 A;  3TJI A;  3NK2 X;  3QSS A;  2OLN A;  2OAL A;  2DKI A;  3NYC A;  1RVK A;  1Z6L A;  1GSN A;  1V97 A;  5HXI A;  1F9C A;  3TTE A;  2XH4 A;  3THU A;  3UTG A;  3AN1 A;  1M64 A;  3AYI A;  3CNJ A;  1NEL A;  2C67 A;  1KCZ A;  4KPR A;  1NPX A;  3NTA A;  4ZA0 A;  1LJ1 A;  5U25 A;  1IJH A;  3AYL A;  4G9K A;  1H81 A;  1IUT A;  2CUL A;  2XFO A;  1R0M A;  1WYG A;  3ZLF A;  4C77 A;  3ES8 A;  1GEU A;  3ZYX A;  4C3X A;  3AE5 A;  2BXS A;  4U8M A;  1VG9 A;  2YAU A;  4CNJ A;  5FJR A;  1QJD A;  4F4R A;  3ZLH A;  3BJS A;  3CGB A;  4GR1 A;  2JB1 A;  3NT6 A;  4J34 A;  3UJ2 A;  4NTD A;  4HA6 A;  2ZZB A;  2XFP A;  3NHO X;  1CJC A;  3B97 A;  1L9D A;  3EF6 A;  4HPN A;  2C76 A;  1TRB A;  1L0V A;  1IUV A;  1VDC A;  4J1O A;  2PA6 A;  3H7V A;  3D8X A;  4ENL A;  3D9X A;  3Q45 A;  4NWZ A;  3SGL A;  3GWF A;  2QVH A;  3UOV A;  1NG4 A;  1PHH A;  2WP9 A;  2Z5Y A;  2P8B A;  2QQ6 A;  2JB3 A;  2J3N A;  4NZH A;  2C65 A;  1HYU A;  1MOK A;  4EQX A;  3P9U A;  1T3Q C;  1F3P A;  3UKH A;  2BK3 A;  4U8P A;  4H4T A;  4K8G A;  3NNE A;  4Z2T A;  2ZC8 A;  2PSN A;  1OJD A;  3DA1 A;  1QLB A;  3T37 A;  2Y6R A;  4U8J A;  3K7T A;  3K30 A;  3SY4 A;  4TVY A;  3OZ2 A;  3QFB A;  2WQY A;  3TJ4 A;  1JCT A;  2C70 A;  2XFN A;  1Y56 A;  2IID A;  2QA2 A;  3UTH A;  4B65 A;  4YKG A;  2RGO A;  4M6U A;  4BK1 A;  1NDA A;  4OPT A;  2AL2 A;  1ZOV A;  3TW9 A;  1JOA A;  3UTF A;  1MNS A;  2V3B A;  4IVM B;  4K7Z A;  4Y4L A;  4B68 A;  5DBJ A;  1BGN A;  5J7X A;  2R0P A;  3DK9 A;  4GCM A;  3BOX A;  1E9I A;  3H8L A;  5GRT A;  1N61 C;  2B9W A;  5KMP A;  2R9Z A;  3CGD A;  2X8G A;  5GSN A;  3CT2 A;  1F6M A;  3RED A;  2GAH B;  2HXU A;  2X3N A;  2A89 A;  3F8R A;  1ZMD A;  5KNL A;  3PFR A;  4FP1 A;  1CC6 A;  2HNE A;  3F8D A;  4DHG A;  3DH9 A;  1K0J A;  2VVL A;  3C4N A;  2A8X A;  3GRS A;  4K5S A;  1E39 A;  1JRZ A;  3R9U A;  3NVV B;  4A5L A;  1KSU A;  3AB1 A;  3KVE A;  4U8I A;  2ZBW A;  3UGV A;  3CMM A;  2ONE A;  3CYJ A;  5G5H B;  2HZG A;  2YVF A;  4OPG A;  4CCQ A;  2EQ8 A;  2GSH A;  3DJD A;  3UP4 A;  5CKU A;  1D7Y A;  2XLT A;  1LQT A;  4HB9 A;  3UKF A;  4FK1 C;  2BAC A;  1E7P A;  4EQS A;  1N4U A;  1O5W A;  2PYX A;  2BK4 A;  4AT0 A;  4OVI A;  3RP7 A;  5FJO A;  3R10 A;  3R25 A;  2XVI A;  2YM1 A;  3DJG X;  1S3B A;  5FJT A;  1JRP A;  3SN4 A;  1CBO A;  1FL2 A;  5IQ1 A;  4DX3 A;  4G6H A;  4JY3 A;  3VFC A;  1K0L A;  1JRX A;  4HCH A;  2PP1 A;  1KKO A;  3EUB 3;  3UJE A;  3AE9 A;  1TYT A;  3SR6 B;  3IHM A;  3UTE A;  2QGY A;  2BXR A;  4IL2 A;  5U1O A;  2YR6 A;  3ALL A;  4GFI A;  4MJW A;  1O94 A;  1ZOY A;  2OLA A;  4ZCW A;  1NHR A;  4WX1 A;  3IHG A;  3ZVI A;  5JCN A;  3NVY B;  4DSH A;  1FEB A;  4GIS A;  2OX4 A;  4FDC B;  1S2Q A;  3OPS A;  1P43 A;  3C96 A;  3VRB A;  3AE3 A;  2YR5 A;  3ETR B;  3T8Q A;  3UKQ A;  3RO6 A;  5KOX A;  3NTD A;  3NS1 B;  4EMJ A;  4G74 A;  3VCC A;  1CJ2 A;  3UP5 A;  1L9E A;  2XH0 A;  4NEW A;  1Q9I A;  1PBE A;  2FJE A;  2GL5 A;  2WPF A;  1MUC A;  3SZW A;  4Z2U A;  3UJR A;  1VG0 A;  3F8P A;  3S47 A;  3UKL A;  1LPF A;  1Q1R A;  3U4F A;  1KN0 A;  3UOZ A;  3D1C A;  2QDE A;  4TM4 A;  3M13 A;  3M12 A;  3H8I A;  2FKP A;  3AD8 B;  4Z17 A;  3DG3 A;  1GRE A;  3KU9 A;  2XCG A;  4Z43 A;  4TLX A;  4GDE A;  3P4R A;  1COY A;  3T9P A;  2ARD A;  3R0K A;  1XDI A;  2GGH A;  2YG5 A;  2GAG B;  2CFY A;  5IPY A;  1BZL A;  5JCL A;  4JY2 A;  2CDU A;  3P4S A;  2VQ7 A;  2QAE A;  1N62 C;  2WP6 A;  4H4U A;  3LZW A;  3RIT A;  1Y0P A;  3NH3 X;  1PDH A;  1LV0 A;  4PAA A;  4X9M A;  2EQ6 A;  2IVE A;  4GRT A;  2AQJ A;  2ZAD A;  2XVF A;  2YG4 A;  3RR1 A;  4A35 A;  2PTX A;  3KPK A;  3H8A A;  3FCP A;  1F8W A;  2XH2 A;  5KMQ A;  3GDP A;  4LII A;  1MO9 A;  3FMW A;  3DGH A;  2ZZ0 A;  4ADW A;  2WPC A;  1TDO A;  3EAN A;  1SJA A;  4IA5 A;  3OTR A;  3V5C A;  1H86 A;  2BK5 A;  4REK A;  2Q6U A;  4HCL A;  7ENL A;  3KLJ A;  4YTN A;  5HHF A;  3H70 A;  4HCD A;  3SXI A;  3DER A;  2GB0 A;  1NEN A;  4CY8 A;  2E1M A;  4TM1 A;  5KMR A;  1KF6 A;  1ZDL A;  3AM9 A;  2E3T A;  1XS2 A;  2GVC A;  2X50 A;  4LU6 A;  2VZ2 A;  4B64 A;  2B9X A;  3DG6 A;  2RAB A;  3ATR A;  3DDM A;  4NEV A;  1EL9 A;  2XVH A;  3T2Z A;  3JZU A;  1H2I A;  2PTZ A;  3I4K A;  2E5V A;  4YWS A;  1PBD A;  3AD7 B;  5C2T A;  3RP8 A;  4A99 A;  2OO6 A;  2UZZ A;  4JN7 A;  4DWD A;  3HYV A;  1IUS A;  1DNC A;  2FJA A;  4OPI A;  3R07 C;  1YQ4 A;  2YLS A;  1D4D A;  4MGG A;  1S3E A;  2Z5X A;  2C72 A;  1NAA A;  1TKK A;  2V5Z A;  3V4B A;  3QPE A;  4TM0 A;  3GYJ A;  2VQB A;  4J36 A;  1TDK A;  3CXB A;  1GXF A;  2WOV A;  5FS9 A;  1FEA A;  3N4E A;  4C5O A;  3WE0 A;  1GPE A;  4A9W A;  1E1M A;  1GES A;  3UXK A;  2GQF A;  3FIM B;  3CNT A;  1TDF A;  3HW2 A;  3AMZ A;  3AE4 A;  1GOS A;  4H4Q A;  1FEC A;  3IC9 A;  2PMQ A;  2GQW A;  4MMW A;  4EM4 A;  4HN8 A;  4OCG A;  5JCI A;  1SJB A;  2PCE A;  2PS2 A;  1X2H A;  3QSE A;  2E4G A;  3SN0 A;  4H19 A;  4YWO A;  3SX6 A;  2W54 A;  3IF9 A;  5EOW A;  3B3R A;  1N4W A;  4IT1 A;  3ZLG A;  1YEY A;  2QJJ A;  2BS2 A;  3IWA A;  2APG A;  1PXA A;  3SQS A;  2F5Z A;  3AD9 B;  4XXG A;  3UCL A;  4EQR A;  1M6I A;  3ICS A;  5M10 A;  4UP3 A;  3E1T A;  2WPE A;  4HNL A;  2ZZC A;  3AEE A;  1ZP0 A;  3CGC A;  5J60 A;  3LB8 A;  1H7W A;  4WCT A;  5FS7 A;  2DW7 A;  3VC6 A;  4X2P A;  4DNA A;  4H4W A;  3NRZ B;  1D5T A;  3CB3 A;  3GDN A;  2XGZ A;  4Y4N A;  3QN3 A;  2XVJ A;  4UDQ A;  3T2Y A;  2B7R A;  2OQY A;  3B6D A;  4IHC A;  3UKA A;  1K0I A;  2BYB A;  5ER0 A;  3EAO A;  4E4F A;  4A6N B;  4HYR A;  3AEG A;  3JVA A;  5KMS A;  1FO4 A;  2YVJ A;  1LQU A;  4AOS A;  4H4V A;  5KRQ A;  3EKG A;  1V59 A;  1SJD A;  4J3Z A;  4J2W A;  2ACZ A;  1E6E A;  2OPJ A;  3BI5 A;  1RYI A;  2B76 A;  2XVE A;  5BRT A;  2PTY A;  1OEP A;  1JRY A;  4XWR A;  3KD9 A;  3PO7 A;  3DEQ A;  4IP5 A;  2R4J A;  3FPZ A;  3RRA A;  3PWI A;  3UOX A;  3NK0 X;  3I3L A;  3ZDN A;  3NN6 X;  4AOX A;  1JU2 A;  1ZMC A;  3BHK A;  1L8P A;  4JDR A;  2R0G A;  3V3O A;  3UJS A;  2OZ8 A;  1O95 A;  3SBF A;  3CGE A;  3GD6 A;  3SN1 A;  3UOY A;  4IVO B;  5IDZ A;  2OA1 A;  1K4Q A;  3GD4 A;  3FBS A;  3NVZ B;  4D04 A;  5KXJ A;  3FJ4 A;  1ONF A;  3G5R A;  4G73 A;  4YSH A;  3AYJ A;  4H7U A;  5BOF A;  4B63 A;  4GGH A;  1KNR A;  2C4C A;  1OJA A;  3P3B A;  1ONE A;  3QTP A;  3AED A;  1Q1W A;  3Q9T A;  1GV4 A;  4HNC A;  1S2Y A;  1NHQ A;  1RP0 A;  5JCK A;  2QA1 A;  3L1R A;  2DKH A;  3OW1 A;  1BKH A;  3JSK A;  5BUL A;  4NTC A;  3VA8 A;  3T31 A;  3MUC A;  4EIQ A;  4XWZ A;  3K7Q X;  3SSZ A;  2Q0L A;  4Z2R A;  2HXT A;  1EL7 A;  4G6G A;  4A6G A;  2NQL A;  3NLC A;  3SJN A;  3R1Z A;  2VVL G;  2GEW A;  3D47 A;  3PG6 A;  1PBB A;  2C3D A;  1GRA A;  4H4X A;  2WU2 A;  3BNU A;  3AEC A;  1VQZ A;  4H1Z A;  3ZVH B;  1FFU C;  4EMW A;  3VDG A;  2XYO A;  3ENL A;  2OLO A;  3PWG A;  1W6T A;  2YM2 A;  1ZY8 A;  1ELI A;  4JNA A;  2XH7 A;  3NGC X;  3GMC A;  2Y6Q A;  1S7M A;  3FG2 P;  4DGK A;  2V61 A;  1B8S A;  3EPT A;  3TWA A;  2R45 A;  2OAM A;  3SZC A;  2YLW A;  5JRB A;  3V5F A;  2R0C A;  3T14 A;  2TPR A;  3GC2 A;  4K2S A;  2QCU A;  3GRT A;  2R4E A;  2XLS A;  3P93 A;  2W3S A;  1EC8 A;  4LA1 A;  3FXG A;  1CC2 A;  3A7R A;  4O5Q A;  2GH5 A;  3T2K A;  2GGG A;  4AP1 A;  2WU5 A;  3ICT A;  4J57 A;  3NG7 X;  1N4V A;  4E6M A;  4GYP A;  3D46 A;  4CRT A;  2CVJ A;  3A7U A;  2OG9 A;  3MSY A;  2RGH A;  2YG3 A;  3CK5 A;  3TWB A;  4U8L A;  2H89 A;  3MY9 A;  4OPL A;  2Q0K A;  4YSX A;  3GY1 A;  1MDR A;  5J04 A;  1IUW A;  2C64 A;  2YLX A;  2OZ3 A;  2C75 A;  1ELS A;  2JBV A;  5EBK A;  4H4R A;  3LAD A;  4ZOH B;  4E5T A;  1DOB A;  1DXL A;  3VQR A;  3N6H A;  3DGB A;  3G5S A;  1NHP A;  4RG4 A;  5FJU A;  4U8K A;  1WUE A;  1MDL A;  2I5Q A;  1WUF A;  2H88 A;  1CF3 A;  3OP2 A;  3NRN A;  4MKS A;  2YR4 A;  3GO2 A;  1EC9 A;  1GET A;  1PBF A;  3TCS A;  1R6W A;  1AOG A;  1DOE A;  1P2H A;  2JAE A;  3SZ0 A;  4ROP A;  3Q4D A;  2WP5 A;  2BAB A;  1BKW A;  4FX9 A;  1QO8 A;  4USQ A;  3JW7 A;  1F8S A;  3NVW B;  3DJJ A;  3KUM A;  2YVG A;  6ENL A;  2AKM A;  5M0Z A;  4YXD A;  3P1W A;  4KT2 A;  4X9N A;  1H83 A;  3CPH G;  3AE8 A;  3CN8 A;  1DOD A;  2NVK X;  4A79 A;  4BK2 A;  4ECH A;  1PJ7 A;  4Y4M A;  1PXC A;  1FHU A;  3GWD A;  1GT8 A;  1GTE A;  4KX6 A;  1CC4 A;  1E1K A;  4C3Y A;  2AAQ A;  4B1B A;  1D7L A;  1PN0 A;  2XLR A;  3H12 A;  5EB4 A;  4NTE A;  1VRQ B;  2PHH A;  4IA6 A;  1STZ A;  2QDD A;  4ZCC A;  3SQP A;  2W55 A;  2A87 A;  4YTM A;  1TZZ A;  2GV8 A;  4NNJ A;  4JQ9 A;  3BI2 A;  3CND A;  4H2R A;  4YT0 A;  1DJQ A;  1KD0 A;  1Y56 B;  1PS9 A;  3DK8 A;  1DJN A;  2AR8 A;  2AL2 B;  3HPF A;  4E0V A;  3IK4 A;  4ICY A;  2WBA A;  3UXL A;  4DSG A;  2V3A A;  3UKP A;  2HQM A;  3MKC A;  3K7M X;  1GND A;  3CAW A;  4YSZ A;  4H50 A;  4K8D A;  3TQP A;  3PK7 A;  1FHV A;  1H84 A;  4YTP A;  1BQG A;  3HRD C;  2GMH A;  3DGZ A;  3RP6 A;  2GRT A;  2XFU A;  2EQ7 A;  3ALJ A;  5ENL A;  4TLZ A;  1ZKQ A;  3CPI G;  3MQT A;  4J56 A;  1H82 A;  4N9X A;  1W4X A;  3I6E A;  4P9S A;  3ZVH A;  3QVR A;  1RM6 B;  2OKT A;  4GUV A;  2CHR A;  2YLZ A;  1PBC A;  2OQH A;  2QJN A;  4H4Y A;  3NN0 X;  1IUU A;  2YQU A;  3UCD A;  3UJF A;  2WDV A;  4OPC A;  1OJC A;  2GGJ A;  1RSG A;  3OZM A;  3ATQ A;  4EMI A;  1EBD A;  4CCR A;  3AE2 A;  3RNM A;  3M0O A;  3VRA A;  1REO A;  5TR3 A;  4IL0 A;  4H2N A;  3BSM A;  4Z24 A;  1JNR A;  1DTN A;  1GRG A;  3T0K A;  2WOI A;  3A7A A;  3QVP A;  4A7A A;  5HYM A;  3P0W A;  3AEA A;  3NXL A;  3CNS A;  2DW6 A;  3SYI A;  4EM3 A;  4K5R A;  3ICR A;  3DES A;  5BOE A;  3VR8 A;  4EQW A;  3QJ4 A;  4Z1Y A;  3B9J B;  1L9C A;  2I0Z A;  4I59 A;  3ABV A;  3H4K A;  5KWF A;  2BCP A;  1PJ5 A;  3S5W A;  2OZT A;  2R46 A;  4ZN0 A;  1PDY A;  3R11 A;  1N1P A;  4H2Q A;  3SFE A;  2BA9 A;  1EBG A;  4B69 A;  2WEU A;  2XSX A;  3STP A;  4AP3 A;  2FJB A;  3IJI A;  4I58 A;  4BK3 A;  2B9Y A;  2FYM A;  3DFY A;  3FV9 A;  3L8K A;  1LVL A;  4FK1 A;  1KKR A;  4JN9 A;  3Q6J A;  3PS9 A;  4BV6 A;  4H2P A;  5C3J A;  1D4C A;  3HZL A;  1OJT A;  4M52 A;  1IUX A;  4GME A;  3BI4 A;  4YSY A;  2PGE A;  4E8G A;  2RGJ A;  3KA7 A;  4U2T A;  1SJC A;  1KDG A;  3S5S A;  1GRT A;  3LOV A;  4J33 A;  2E5A A;  3RGT A;  3NYF A;  4PAB A;  1E1L A;  1JPM A;  3VRD B;  1H7X A;  1TDE A;  1N60 C;  3NO1 A;  1NEK A;  1TYP A;  2POD A;  3O0H A;  2JK6 A;  2XLU A;  4GIR A;  5FMH A;  2WHD A;  4K1W A;  2MUC A;  4AT2 A;  3ALM A;  1N5X A;  1NU5 A;  4A3R A;  4CBQ A;  2BC0 A;  1N5W C;  4DN1 A;  4G7F A;  1B4V A;  1LTX R;  4RG3 A;  1SEZ A;  3G5Q A;  1YY5 A;  2XFQ A;  5EU9 A;  5L46 A;  2YG7 A;  3MWC A;  2FJD A;  3V3W A;  4U2S A;  4H83 A;  4JN8 A;  4E4U A;  1BWC A;  3VC5 A;  2W0H A;  3DFH A;  2V6O A;  2BCG G;  3NIX A;  1N63 C;  2QJM A;  4B67 A;  4H4Z A;  4U8O A;  5EB5 A;  1XAN A;  4KWS A;  1JPD X;  3QFA A;  1NHS A;  4GF7 A;  4U8N A;  1XHC A;  4M0X A;  1BGJ A;  5KOW A;  1ZXI C;  3NZG A;  1D4E A;  2YWL A;  4BJZ A;  3BNM A;  4CNK A;  4GDP A;  3NKS A;  2BRY A;  2X8H A;  4IP4 A;  3CNP A;  5FS6 A;  1YQ3 A;  1GER A;  4D03 A;  4C74 A;  5U63 A;  1KNP A;  3P4P A;  1CL0 A;  4X4J A;  1GRF A;  3N6J A;  1XPY A;  3ITJ A;  1P2E A;  5FJP A;  3QLD A;  4JNQ A;  3RHA A;  1PXB A;  2BS4 A;  3AE7 A;  1IYX A;  1EBH A;  1GRB A;  3LZX A;  3SZF A;  1MXT A;  4UDR A;  3DK4 A;  1X2G A;  4YKF A;  2WET A;  2VOU A;  2GR3 A;  3C4A A;  3HYX A;  5CQF A;  5KVH A;  4OPD A;  1GRH A;  2AKZ A;  3HYW A;  3V3N A;  3QSM A;  5LV9 A;  4K2X A;  4OPU A;  3I6T A;  2GR2 A;  3ADA B;  3AE1 A;  2XLP A;  3T4W A;  3S61 A;  5G5G B;  3FVD A;  4APN A;  2C73 A;  2OVL A;  2VVM A;  4H2H A;  2GR1 A;  2EQ9 A;  1B37 A;  1KSS A;  2JKC A;  1TE6 A;  1X31 B;  1BF3 A;  3K1G A;  2YG6 A;  1VQW A;  5BVA A;  3EEZ A;  4G8T A;  4IV9 A;  4GAV A;  2C66 A;  3ISH A;  2WS3 A;  1OJ9 A;  4BUR A;  3MZN A;  2PP0 A;  2MNR A;  2WES A;  4EWJ A;  2RDX A;  3FYY A;  1EL5 A;  2B7S A;  2PU1 A;  3SM8 A;  4DXK A;  1PJ6 A;  3N4F A;  4TM3 A;  2X99 A;  3GSI A;  4UDP A;  2WDQ A;  4A65 A;  2C7G A;  3BHF A;  4H4S A;  4DYE A;  2GR0 A;  5HY5 A;  3AE6 A;  1NG3 A;  4Z44 A;  5BUK A;  3VCN A;  3CPJ G;  3U9I A;  1JEH A;  2GDQ A;  1CHU A;  1GTH A;  3AWI A;  3CXO A;  1ZK7 A;  3AEF A;  4A6N A;  1SB3 B;  4II2 A;  1YQZ A;  2VRL A;  1PDZ A;  3AXB A;  2NPX A;  3OC4 A;  3NFU A;  1JDF A;  2GF3 A;  1DOC A;  2C3C A;  2V60 A;  3GMB A;  1CJ4 A;  1B5Q A;  3DME A;  2POZ A;  2JB2 A;  1FCD A;  3P4Q A;  1FFV C;  3URH A;  2GMJ A;  3R0U A;  3V76 A;  5JCM A;  3CTY A;  1E1N A;  2GGI A;  1VDV A;  3KPF A;  1FIQ B;  2GGE A;  1XPQ A;  4U2L A;  2BS3 A;  3SFD A;  2P0I A;  4K22 A;  2WOW A;  3L5O A;  3UKK A;  2O56 A;  4ZCD A;  1JNZ A;  2P8C A;  3VR9 A;  1KFY A;  3LJP A;  3OZY A;  2XDO A;  2TMD A;  2PGW A;  3DJE A;  4KEM A;  5IQ4 A;  4RSL A;  1GAL A;  3GYI A;  2IVD A; 
#chains in the Genus database with same CATH homology
 3GD3 A;  3AEA A;  3CNS A;  2R4J A;  3SYI A;  4EM3 A;  1NHR A;  4WX1 A;  4USR A;  3FPZ A;  3IHG A;  5JCN A;  4DSH A;  4K5R A;  3ICR A;  4H4P A;  4J31 A;  3UOX A;  3NK0 X;  1FEB A;  3I3L A;  3ZDN A;  3NN6 X;  4FDC B;  4AOX A;  1JU2 A;  1ZMC A;  3BHK A;  4JDR A;  1S2Q A;  3VR8 A;  3C96 A;  4EQW A;  3VRB A;  5KVI A;  3QJ4 A;  2R0G A;  2BRA A;  3AE3 A;  1L9C A;  2YR5 A;  2I0Z A;  4EIP A;  4I59 A;  4O5U A;  3NK1 X;  3V3O A;  2YLT A;  3ABV A;  3H4K A;  3WE0 A;  3UKQ A;  5KWF A;  1O95 A;  2BCP A;  1UKV G;  1PJ5 A;  4II3 A;  3S5W A;  5KOX A;  3NTD A;  2R46 A;  4ZN0 A;  4EMJ A;  4G74 A;  2X8C A;  3CGE A;  1CJ2 A;  1N1P A;  4H2Q A;  3LXD A;  3SFE A;  3UP5 A;  2BA9 A;  3UOY A;  3AEB A;  2VRM A;  3KKJ A;  4B69 A;  1L9E A;  2WEU A;  4IVO B;  4NEW A;  4AP3 A;  2FJB A;  2Q7V A;  3CIR A;  2OA1 A;  1YKJ A;  1Q9I A;  1K4Q A;  3GD4 A;  1EL8 A;  1PBE A;  4I58 A;  4BK3 A;  2B9Y A;  2FJE A;  3FBS A;  4B66 A;  3PVC A;  3NYE A;  4D04 A;  2WPF A;  5KXJ A;  1FOH A;  3SZW A;  4Z2U A;  3II4 A;  3GYX A;  2FBW A;  1VG0 A;  3F8P A;  4Z25 A;  1ONF A;  1LVL A;  1ZX9 A;  3L8K A;  3G5R A;  4G73 A;  4FK1 A;  3AYJ A;  4H7U A;  4JN9 A;  3UKL A;  4YSH A;  1LPF A;  3Q6J A;  4BJY A;  4B63 A;  1Q1R A;  1KNR A;  3PS9 A;  4CY6 A;  4BV6 A;  1KN0 A;  4H2P A;  3UOZ A;  2BC1 A;  3D1C A;  4TM4 A;  3M13 A;  2C4C A;  1D4C A;  1OJA A;  5C3J A;  3HZL A;  3M12 A;  1OJT A;  1H6V A;  4M52 A;  1IUX A;  2YLR A;  3H8I A;  3AD8 B;  3BI4 A;  3AED A;  4YSY A;  4Z26 A;  2RGJ A;  3KA7 A;  1Q1W A;  3Q9T A;  4U2T A;  3I6D A;  1GRE A;  2O9Z A;  1KDG A;  3KU9 A;  2XCG A;  1F8R A;  1GRT A;  1GV4 A;  4Z43 A;  4TLX A;  1S2Y A;  3LOV A;  2WDR A;  4GDE A;  4J33 A;  4GAP A;  3P4R A;  3NYF A;  4PAB A;  1E1L A;  1COY A;  2ARD A;  1CJ3 A;  1NHQ A;  1RP0 A;  3VRD B;  1H7X A;  1TDE A;  1XDI A;  5FS8 A;  5JCK A;  1TDN A;  2GAG B;  2QA1 A;  2YG5 A;  3L1R A;  1NEK A;  2CFY A;  2DKH A;  5IPY A;  1TYP A;  1BZL A;  3O0H A;  5JCL A;  2CDU A;  4JY2 A;  2JK6 A;  2XLU A;  3JSK A;  3P4S A;  2VQ7 A;  3COX A;  5BUL A;  4NTC A;  2QAE A;  2WP6 A;  3T31 A;  4H4U A;  5FMH A;  3LZW A;  1Y0P A;  3NH3 X;  2WHD A;  4EIQ A;  1PDH A;  4XWZ A;  3NK2 X;  1LV0 A;  3QSS A;  4PAA A;  4X9M A;  2OLN A;  4AT2 A;  3K7Q X;  3ALM A;  2EQ6 A;  2OAL A;  2DKI A;  3NYC A;  2IVE A;  4GRT A;  2Q0L A;  2AQJ A;  1Z6L A;  1GSN A;  2XVF A;  4Z2R A;  2YG4 A;  5HXI A;  1EL7 A;  4CBQ A;  2BC0 A;  3KPK A;  1B4V A;  4G6G A;  1LTX R;  4RG3 A;  1SEZ A;  1F8W A;  3NLC A;  3G5Q A;  3GDP A;  4LII A;  1MO9 A;  5KMQ A;  3UTG A;  1YY5 A;  1M64 A;  3AYI A;  2VVL G;  3CNJ A;  2XFQ A;  4AP1 A;  2GEW A;  3FMW A;  5L46 A;  3DGH A;  2ZZ0 A;  4ADW A;  2YG7 A;  4C5O A;  2WPC A;  3PG6 A;  2C67 A;  1PBB A;  1TDO A;  2C3D A;  3EAN A;  1GRA A;  4H4X A;  4KPR A;  2FJD A;  2WU2 A;  1NPX A;  3NTA A;  1LJ1 A;  3BNU A;  4IA5 A;  3AEC A;  4U2S A;  1H86 A;  5U25 A;  2BK5 A;  1BWC A;  4REK A;  4EMW A;  2W0H A;  1IJH A;  3AYL A;  2Q6U A;  2XYO A;  4G9K A;  1H81 A;  1IUT A;  2CUL A;  2OLO A;  2V6O A;  3KLJ A;  2BCG G;  2XFO A;  2YM2 A;  1ZY8 A;  3NIX A;  4B67 A;  1ELI A;  4H4Z A;  4JNA A;  4U8O A;  4YTN A;  5EB5 A;  5HHF A;  1XAN A;  3NGC X;  3GMC A;  3QFA A;  2Y6Q A;  3SXI A;  1S7M A;  1NHS A;  3FG2 P;  4DGK A;  4GF7 A;  2V61 A;  4U8N A;  1B8S A;  3EPT A;  4C77 A;  2R45 A;  1XHC A;  2OAM A;  1GEU A;  1BGJ A;  2GB0 A;  3ZYX A;  5KOW A;  1NEN A;  3SZC A;  3T37 A;  4C3X A;  2YLW A;  5JRB A;  4CY8 A;  2E1M A;  1D4E A;  2YWL A;  4BJZ A;  3AE5 A;  4TM1 A;  2BXS A;  3BNM A;  4U8M A;  1VG9 A;  4GDP A;  4CNK A;  2R0C A;  3T14 A;  5KMR A;  1KF6 A;  2TPR A;  2YAU A;  3NKS A;  1ZDL A;  4CNJ A;  2BRY A;  2X8H A;  1QJD A;  3CNP A;  2QCU A;  3GRT A;  2R4E A;  2XLS A;  3CGB A;  4GR1 A;  5FS6 A;  2JB1 A;  4UP3 A;  3NT6 A;  4J34 A;  1YQ3 A;  2GVC A;  1GER A;  4LA1 A;  1CC2 A;  4D03 A;  4NTD A;  2X50 A;  4LU6 A;  2VZ2 A;  4O5Q A;  2GH5 A;  2B9X A;  4HA6 A;  3T2K A;  4B64 A;  4C74 A;  2RAB A;  2WU5 A;  2ZZB A;  2XFP A;  4J57 A;  1CJC A;  1KNP A;  3ICT A;  3NHO X;  3NG7 X;  3ATR A;  5U63 A;  4NEV A;  1N4V A;  1L9D A;  3EF6 A;  3P4P A;  1EL9 A;  2XVH A;  3T2Z A;  2C76 A;  1H2I A;  4CRT A;  2E5V A;  1TRB A;  2CVJ A;  1L0V A;  2RGH A;  1IUV A;  2YG3 A;  1CL0 A;  1VDC A;  1PBD A;  4U8L A;  3AD7 B;  5C2T A;  2H89 A;  3D8X A;  4OPL A;  4X4J A;  2Q0K A;  3RP8 A;  4YSX A;  1GRF A;  4A99 A;  2UZZ A;  1IUW A;  3ITJ A;  1P2E A;  2C64 A;  2YLX A;  3D9X A;  2C75 A;  2JBV A;  3HYV A;  4JNQ A;  5EBK A;  4H4R A;  1IUS A;  3LAD A;  4NWZ A;  3SGL A;  1DNC A;  3RHA A;  1DOB A;  1DXL A;  1PXB A;  3GWF A;  3VQR A;  2FJA A;  3UOV A;  2BS4 A;  3AE7 A;  1NG4 A;  3G5S A;  1NHP A;  1PHH A;  2WP9 A;  1GRB A;  2Z5Y A;  3LZX A;  4OPI A;  4RG4 A;  1YQ4 A;  2YLS A;  4U8K A;  2JB3 A;  1MXT A;  3SZF A;  4UDR A;  2J3N A;  1D4D A;  3DK4 A;  4NZH A;  1S3E A;  2H88 A;  2C65 A;  1HYU A;  4YKF A;  2WET A;  2VOU A;  2Z5X A;  2C72 A;  2GR3 A;  3C4A A;  3HYX A;  1NAA A;  1CF3 A;  1MOK A;  2V5Z A;  4EQX A;  3P9U A;  5CQF A;  1F3P A;  3UKH A;  5KVH A;  2BK3 A;  4U8P A;  4H4T A;  4OPD A;  3NRN A;  4TM0 A;  1GRH A;  3GYJ A;  2YR4 A;  3NNE A;  2VQB A;  4Z2T A;  1GET A;  3HYW A;  4J36 A;  1TDK A;  1PBF A;  3V3N A;  1GXF A;  1DOE A;  1AOG A;  1P2H A;  2JAE A;  3SZ0 A;  3QSM A;  5LV9 A;  2WOV A;  1OJD A;  3DA1 A;  4K2X A;  5FS9 A;  4OPU A;  2WP5 A;  2BAB A;  2GR2 A;  1FEA A;  4FX9 A;  1BKW A;  1QO8 A;  1QLB A;  2Y6R A;  3ADA B;  3AE1 A;  4U8J A;  2XLP A;  4USQ A;  3K7T A;  1GPE A;  1F8S A;  3K30 A;  1E1M A;  3SY4 A;  1GES A;  3S61 A;  4A9W A;  3OZ2 A;  3DJJ A;  2YVG A;  2GQF A;  4APN A;  3QFB A;  2C73 A;  2WQY A;  2VVM A;  5M0Z A;  2GR1 A;  2C70 A;  4YXD A;  3P1W A;  2XFN A;  2EQ9 A;  1B37 A;  1Y56 A;  2IID A;  4X9N A;  3FIM B;  1H83 A;  2QA2 A;  1KSS A;  3UTH A;  3CNT A;  3CPH G;  4B65 A;  1TDF A;  3AE8 A;  2JKC A;  3CN8 A;  4YKG A;  3AE4 A;  2RGO A;  1GOS A;  4BK1 A;  1DOD A;  1NDA A;  4OPT A;  1ZOV A;  1X31 B;  4H4Q A;  1BF3 A;  2NVK X;  4A79 A;  4BK2 A;  1FEC A;  4ECH A;  3IC9 A;  1PJ7 A;  1JOA A;  4Y4M A;  3UTF A;  1PXC A;  2V3B A;  4IVM B;  4K7Z A;  2GQW A;  2YG6 A;  4EM4 A;  3GWD A;  1VQW A;  4Y4L A;  1GT8 A;  1GTE A;  4KX6 A;  4OCG A;  5DBJ A;  1CC4 A;  4B68 A;  5BVA A;  5JCI A;  1E1K A;  1BGN A;  4C3Y A;  2AAQ A;  4B1B A;  1D7L A;  1PN0 A;  4IV9 A;  5J7X A;  2R0P A;  3QSE A;  4GAV A;  3DK9 A;  2C66 A;  4GCM A;  2E4G A;  2XLR A;  3H8L A;  5GRT A;  2B9W A;  3ISH A;  5KMP A;  5EB4 A;  4NTE A;  2WS3 A;  2R9Z A;  3CGD A;  4YWO A;  1VRQ B;  1OJ9 A;  2X8G A;  2PHH A;  5GSN A;  3SX6 A;  4BUR A;  4IA6 A;  2WES A;  1F6M A;  4ZCC A;  3IF9 A;  5EOW A;  1EL5 A;  3RED A;  3SQP A;  2B7S A;  3B3R A;  2A87 A;  2GAH B;  4YTM A;  1N4W A;  3SM8 A;  2GV8 A;  2X3N A;  4NNJ A;  1PJ6 A;  2A89 A;  4JQ9 A;  3F8R A;  4TM3 A;  3BI2 A;  3CND A;  4H2R A;  1ZMD A;  5KNL A;  4YT0 A;  2X99 A;  1CC6 A;  1DJQ A;  3F8D A;  3GSI A;  4UDP A;  2WDQ A;  2VVL A;  3DH9 A;  1K0J A;  1Y56 B;  4A65 A;  3C4N A;  2BS2 A;  2C7G A;  3BHF A;  3IWA A;  4H4S A;  2A8X A;  1PS9 A;  2GR0 A;  3GRS A;  3DK8 A;  1DJN A;  2AR8 A;  3AE6 A;  5HY5 A;  1NG3 A;  4K5S A;  1E39 A;  4E0V A;  2APG A;  1PXA A;  4Z44 A;  2F5Z A;  3AD9 B;  5BUK A;  4XXG A;  4ICY A;  2WBA A;  3CPJ G;  3UCL A;  4EQR A;  1M6I A;  3ICS A;  1JRZ A;  3R9U A;  4DSG A;  2V3A A;  1JEH A;  4A5L A;  5M10 A;  1KSU A;  3UKP A;  3AB1 A;  3KVE A;  1CHU A;  1GTH A;  3AWI A;  2WPE A;  3E1T A;  2ZBW A;  2HQM A;  2ZZC A;  4U8I A;  3CMM A;  3K7M X;  3AEE A;  1GND A;  1ZK7 A;  3CGC A;  1ZP0 A;  3AEF A;  5J60 A;  4A6N A;  3LB8 A;  1H7W A;  4YSZ A;  4WCT A;  4H50 A;  5FS7 A;  4K8D A;  4II2 A;  2YVF A;  4OPG A;  1YQZ A;  4CCQ A;  2EQ8 A;  2VRL A;  3DJD A;  1H84 A;  4YTP A;  2GMH A;  3AXB A;  3UP4 A;  3DGZ A;  4DNA A;  2NPX A;  3OC4 A;  3RP6 A;  4H4W A;  2GRT A;  5CKU A;  2XFU A;  1D7Y A;  2EQ7 A;  2XLT A;  2GF3 A;  1DOC A;  3ALJ A;  2C3C A;  2V60 A;  1LQT A;  4TLZ A;  3GMB A;  1ZKQ A;  4HB9 A;  1D5T A;  3UKF A;  3CPI G;  1CJ4 A;  4FK1 C;  2BAC A;  1E7P A;  1B5Q A;  3DME A;  4J56 A;  4EQS A;  1H82 A;  3GDN A;  1N4U A;  4N9X A;  1O5W A;  2PYX A;  2BK4 A;  1W4X A;  2JB2 A;  4AT0 A;  4OVI A;  4Y4N A;  1FCD A;  2XVJ A;  3P4Q A;  4P9S A;  3RP7 A;  3URH A;  2GMJ A;  2XVI A;  2YM1 A;  3QVR A;  4UDQ A;  3V76 A;  3T2Y A;  3DJG X;  5JCM A;  3CTY A;  2B7R A;  1E1N A;  4GUV A;  1S3B A;  3B6D A;  2YLZ A;  3KPF A;  1PBC A;  3UKA A;  1K0I A;  1CBO A;  1FL2 A;  2BYB A;  5IQ1 A;  4H4Y A;  1XPQ A;  5ER0 A;  4G6H A;  2BS3 A;  3NN0 X;  4JY3 A;  4U2L A;  3SFD A;  1K0L A;  1IUU A;  1JRX A;  2YQU A;  3EAO A;  4K22 A;  2WOW A;  2WDV A;  4OPC A;  4A6N B;  3L5O A;  1OJC A;  3UKK A;  1RSG A;  4ZCD A;  1JNZ A;  3AEG A;  3AE9 A;  5KMS A;  2YVJ A;  3ATQ A;  4EMI A;  1TYT A;  1KFY A;  1LQU A;  4H4V A;  3VR9 A;  4AOS A;  5KRQ A;  3IHM A;  1EBD A;  1V59 A;  3LJP A;  4CCR A;  4J2W A;  3AE2 A;  3UTE A;  3RNM A;  3M0O A;  2ACZ A;  1E6E A;  3VRA A;  1REO A;  2XDO A;  5TR3 A;  2TMD A;  2BXR A;  4H2N A;  3BI5 A;  1RYI A;  2B76 A;  2XVE A;  5U1O A;  1JNR A;  2YR6 A;  4Z24 A;  3ALL A;  3DJE A;  1GRG A;  3T0K A;  5BRT A;  2WOI A;  4MJW A;  5IQ4 A;  4RSL A;  3QVP A;  1GAL A;  1JRY A;  1O94 A;  3KD9 A;  4XWR A;  4A7A A;  3PO7 A;  5HYM A;  3GYI A;  2IVD A;  1ZOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...