4FDCB

Crystal structure of the e493v mutant of human apoptosis inducing factor (aif)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
483
structure length
461
Chain Sequence
b'APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYVAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Cowchock syndrome is associated with a mutation in apoptosis-inducing factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis, oxidoreductase
total genus 135
structure length 461
sequence length 483
ec nomenclature ec 1.-.-.-:
pdb deposition date 2012-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
B PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4fdcB03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fdcB02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fdcB01
1PBFA 2J3NA 3FG2P 1IUXA 2GQWA 3AD9B 3IC9A 4OVIA 5KOXA 2B7RA 5LV9A 4A9WA 1PXBA 4C74A 1L9EA 3BI4A 1FL2A 3NHOX 2BACA 1PBBA 2XLPA 1TDOA 1GT8A 3DGHA 5U25A 2VVMA 1PN0A 2C73A 3DK4A 2Q6UA 1E1KA 3AD8B 3ATQA 3CNJA 3NYFA 3UKAA 1F8WA 1H6VA 1PDHA 1JEHA 2XDOA 1CC2A 2Y6RA 5FS8A 3G5RA 1H81A 2YWLA 4NTEA 3AEEA 1ZK7A 2RABA 4PABA 4H4QA 4LU6A 1MO9A 3AE3A 2UZZA 4ICYA 3P1WA 2WDRA 1ZOVA 3NKSA 2V6OA 3LZXA 1PBEA 4U8PA 4C5OA 3AE1A 3LXDA 5JCIA 5BUKA 3IHGA 1NPXA 5IQ1A 4AOXA 2YG3A 4BJZA 3AECA 2XFUA 1VQWA 1TDEA 1SEZA 4USRA 2X3NA 2XFOA 2WP9A 2GRTA 2WHDA 3IWAA 4B69A 2GH5A 3L1RA 4OPUA 1E1LA 5JCLA 2ZZ0A 3NTDA 3FIMB 4Z43A 3M13A 5FMHA 2GF3A 2Q0LA 2BK4A 3H8IA 4NTCA 4H4YA 2C64A 4YSXA 4YTNA 3F8DA 4H2NA 3V3OA 1H82A 4BK1A 1S2YA 1YQ4A 1CJ2A 2YVFA 4EMIA 3QSMA 1S3EA 2YG4A 2R4JA 1GRFA 3DK8A 2JB3A 3T37A 3VRBA 5HY5A 3M0OA 1OJDA 5BULA 5C2TA 1PJ7A 2BABA 2XVJA 3AEGA 5HHFA 4AOSA 1NHPA 3KLJA 1GERA 4OPIA 1Q9IA 4U8LA 1ZKQA 1CF3A 1Y56B 1IUUA 4C3XA 4CY8A 3R9UA 2FJAA 3NGCX 2CFYA 2X8HA 2WEUA 4N9XA 3AB1A 2YLWA 5FS7A 4H4VA 2EQ6A 3K7TA 3QJ4A 2V61A 4XWRA 2WDVA 4O5UA 4B67A 1JRZA 1XPQA 3H8LA 3QSSA 2YR5A 2XLRA 2OA1A 2RGJA 3UKHA 3DJEA 4OPTA 3AEDA 2ARDA 2V60A 2XVHA 1F3PA 3KU9A 2AR8A 3NK1X 1NENA 4FX9A 5EOWA 4JNQA 2R9ZA 3CNTA 2GAGB 1L0VA 3UOVA 3URHA 2WOWA 4B66A 1E6EA 1DXLA 2JKCA 1CJCA 2Q0KA 4YSYA 4U8NA 2H88A 2V5ZA 4GDPA 3K7MX 3ABVA 4RG3A 4D04A 4Z25A 1E1MA 3GMBA 3ITJA 1VRQB 3NH3X 1Z6LA 4EIPA 3ZYXA 4EQRA 1IUTA 4CY6A 3ALJA 4JNAA 1GTHA 5IPYA 1GRTA 3AE5A 3KKJA 1GRAA 4JY3A 4U8IA 3BHFA 5JCMA 1H7XA 2C65A 3RP6A 4I59A 1JRXA 3VRAA 2F5ZA 1ELIA 2GMHA 5HYMA 4M52A 1DJNA 1PBDA 3P4SA 1RP0A 3D8XA 2GR0A 1MOKA 4H2RA 4WX1A 4GRTA 1EL8A 3NN0X 1IUSA 2R46A 4J2WA 1OJCA 3QVRA 4XXGA 1LV0A 1YY5A 2GAHB 3LOVA 4J36A 3DA1A 3M12A 3NK0X 3KD9A 4Z24A 2E1MA 3O0HA 2GQFA 1V59A 2VVLG 3DMEA 3AXBA 2B76A 1LTXR 4I58A 4H4UA 1KSUA 4APNA 2B9WA 2H89A 2PYXA 2Z5YA 2R0PA 4KX6A 2X99A 4X4JA 3K30A 5DBJA 3UKFA 4ZCDA 1COYA 3UTHA 3ICSA 2QA2A 3AE9A 4IV9A 5U63A 4DGKA 4K5SA 1CHUA 4J34A 1GREA 4Z2TA 1DOBA 3LADA 2BXRA 3JSKA 1ZP0A 1LJ1A 1M64A 2JB2A 3NRNA 4UDPA 4Z44A 4ZN0A 1LVLA 1N1PA 2TMDA 4K8DA 3UTGA 3PO7A 2Y6QA 2RGOA 3ISHA 4YSHA 1K0IA 4YSZA 1IUVA 4C3YA 1Y0PA 1DNCA 4A6NB 5CKUA 3UKLA 3RHAA 3ADAB 4NEVA 1GRGA 3HZLA 4D03A 2BK3A 1ZMCA 1F6MA 2GR3A 3II4A 4YWOA 1CJ4A 1BGJA 3H4KA 2VQBA 5EBKA 1K0JA 1KFYA 3E1TA 3NN6X 4GF7A 4X9MA 1BWCA 1MXTA 3SFDA 4HA6A 4NZHA 3S5WA 1EBDA 4H4TA 4TM1A 5HXIA 3AE8A 3CGEA 2BXSA 4CCRA 1DOEA 2V3AA 3AD7B 4EM3A 4U2LA 2FBWA 1KDGA 3GRTA 1FOHA 1F8RA 3GD3A 1LQTA 2WU5A 3D1CA 2GR1A 3IHMA 4JN9A 2R0GA 2YR4A 1OJTA 1X31B 2YR6A 1OJAA 4AT2A 1CL0A 3UP4A 4B64A 1E39A 3I6DA 1PJ6A 3KA7A 2YLTA 3FMWA 3PS9A 4Z2RA 4A99A 1Y56A 2WOVA 1XHCA 2X50A 2YAUA 2GEWA 4UP3A 4DSGA 3GDPA 3F8PA 3EAOA 2EQ8A 4K2XA 4UDQA 2VVLA 3NK2X 3CPJG 5KRQA 3GSIA 4UDRA 3AYLA 5J7XA 2R4EA 3KPFA 1GTEA 4IVMB 1XANA 3S61A 1TYTA 4MJWA 2WP6A 1D4EA 4B1BA 1GETA 1PXAA 1GEUA 4A79A 1E1NA 3CPIG 2C75A 4J33A 1F8SA 1GPEA 1VDCA 3P4PA 3NYCA 3P9UA 3CPHG 3F8RA 2BC0A 3C4NA 5CQFA 2WOIA 3GD4A 4BK2A 3QFAA 4U8KA 3LZWA 4AP3A 1S2QA 1Q1RA 1H84A 1EL9A 3EPTA 4CNKA 2YQUA 3DH9A 2GMJA 3COXA 3WE0A 4Y4MA 2C67A 1FEBA 2HQMA 1NAAA 2YLRA 3UKQA 3SGLA 2XYOA 4DSHA 3AEAA 4FK1A 4EQXA 2C66A 4H7UA 2XCGA 4ADWA 1PBCA 1PHHA 3BI2A 1PJ5A 3ICTA 2YLXA 1FECA 1GXFA 2C76A 4Z2UA 1O95A 3SFEA 2NPXA 1N4VA 2AQJA 2WPFA 1DJQA 1B5QA 1CC4A 4FK1C 4U8JA 1Q1WA 4H4SA 1CC6A 3IF9A 2XVIA 1EL7A 3B3RA 2DKHA 1B8SA 2C70A 3UOXA 1FEAA 2QAEA 2XVEA 5EB4A 2TPRA 3DJJA 3OC4A 1TDKA 5IQ4A 2YLZA 3OZ2A 3QFBA 5KOWA 4TM4A 2NVKX 5ER0A 2CDUA 3SQPA 1UKVG 2BK5A 1VG0A 4K22A 1AOGA 3CNSA 2EQ9A 1JNZA 1ZDLA 1NG4A 4REKA 3CN8A 3FPZA 3CNPA 5M10A 4CCQA 2VRLA 3DGZA 1D4CA 2YM2A 4YKFA 5M0ZA 4H50A 4H2PA 4YT0A 3EANA 5EB5A 1KNRA 2A89A 2WPEA 1GSNA 5KVHA 4U2TA 1E7PA 1ZX9A 1NEKA 4OCGA 3LB8A 4HB9A 1VG9A 1PS9A 3VR9A 1KSSA 4A65A 2GV8A 3Q9TA 1YQ3A 4DNAA 4GCMA 4RSLA 5GRTA 4BJYA 3ALLA 4H4PA 2WPCA 4JY2A 3QVPA 4A6NA 3I3LA 4H4WA 3V3NA 2FJDA 2FJEA 1P2HA 4EQWA 4WCTA 2VRMA 1CBOA 2ZBWA 2C72A 5FS9A 1TDNA 4EQSA 1O94A 1O5WA 1LQUA 1REOA 4P9SA 3UTEA 4J57A 3GWDA 4YKGA 4J56A 1N4UA 3ALMA 4IVOB 3GYIA 3P4RA 5L46A 2YG7A 1NG3A 4NTDA 4OPCA 3REDA 1GNDA 2W0HA 4KPRA 1NHQA 1TRBA 2E5VA 1BKWA 5TR3A 3GMCA 1KF6A 2WDQA 5GSNA 1H86A 4U2SA 2YVJA 3RNMA 2X8GA 4GR1A 1ONFA 2BCGG 4O5QA 1CJ3A 4A5LA 3Q6JA 4A7AA 1DOCA 4B65A 1D4DA 2BS3A 1GALA 2X8CA 3AE7A 2OLOA 1JU2A 4TLXA 3RP8A 1FCDA 1K4QA 1BGNA 3BNMA 3BNUA 2WBAA 3CIRA 4XWZA 2YLSA 5KVIA 2WP5A 2BC1A 2DKIA 4GUVA 4IA5A 4AP1A 3AE2A 3K7QX 5KWFA 1EL5A 4FDCB 3CGCA 2APGA 4CBQA 2C3CA 2B9XA 3CNDA 1GRBA 2YG5A 3UCLA 3CGDA 2IVEA 3AEFA 4LA1A 2JB1A 1ZOYA 4AT0A 1N4WA 3FBSA 1XDIA 1H7WA 4USQA 2JBVA 4BV6A 2R45A 2WESA 2FJBA 5JCKA 2YM1A 4H4ZA 1TDFA 3VR8A 4Z26A 3GDNA 5BRTA 4OPLA 4TLZA 2A87A 4CNJA 3P4QA 3BI5A 1JNRA 2PHHA 3KVEA 5FS6A 1GV4A 4YTPA 3AE6A 1PXCA 3ICRA 3NT6A 5KXJA 4EMJA 2ZZBA 3GRSA 4EMWA 1QLBA 4H4XA 2WETA 2XLUA 2IIDA 1DODA 3EF6A 1RYIA 1YKJA 4ZCCA 3DJGX 1P2EA 1M6IA 1L9CA 2WQYA 1LPFA 4BK3A 1W4XA 3AWIA 4B63A 1ZY8A 4K7ZA 4CRTA 1TYPA 2BYBA 3RP7A 1H83A 2Q7VA 1ZMDA 3NYEA 2OLNA 2R0CA 2WU2A 3DK9A 3UP5A 3UOZA 4IA6A 3DJDA 1K0LA 2EQ7A 2XFNA 2XLTA 2I0ZA 3ZDNA 1GOSA 4H4RA 2VOUA 3UKPA 2QCUA 4B68A 4E0VA 1GRHA 3AYJA 3NTAA 1YQZA 3UOYA 1QO8A 3CTYA 4X9NA 1HYUA 3UKKA 4EIQA 1KNPA 2YG6A 4TM3A 5BVAA 3CGBA 1RSGA 2GR2A 4JDRA 2BA9A 2YVGA 2XVFA 3NNEA 4NEWA 4OPDA 4ECHA 3UTFA 2C3DA 3V76A 5JCNA 4PAAA 5J60A 4LIIA 4C77A 2GVCA 2AAQA 3NIXA 4J31A 2JAEA 2O9ZA 2WS3A 2RGHA 3G5SA 1L9DA 2OALA 2VZ2A 1BF3A 4K5RA 3B6DA 4RG4A 3NLCA 1B37A 2BS4A 3AYIA 2V3BA 2XFPA 2Z5XA 5C3JA 1BZLA 2CULA 2XLSA 4U8MA 2QA1A 2CVJA 1S3BA 3AE4A 4Y4NA 4TM0A 2BS2A 3VQRA 3L8KA 2JK6A 1JOAA 4U8OA 1OJ9A 4BURA 1NHSA 1D5TA 1IJHA 1GESA 3PVCA 1QJDA 3SM8A 1NHRA 2C7GA 2XFQA 1D7YA 3NG7X 2B9YA 4YTMA 4Y4LA 3ATRA 3C4AA 4EM4A 4YXDA 1IUWA 2OAMA 3VRDB 1B4VA 2A8XA 4JQ9A 3G5QA 4GDEA 1JRYA 2VQ7A 4H2QA 2E4GA 3AEBA 3GWFA 2ACZA 2GB0A 2BCPA 1NDAA 3LJPA 2IVDA 3GYJA 1D7LA 2B7SA 2ZZCA 3BHKA 5U1OA 3C96A 3QSEA 4OPGA
chains in the Genus database with same CATH superfamily
1IUXA 3AD9B 3IC9A 5LV9A 3ES7A 1PBBA 1FIQB 4KT2A 1TDOA 1GT8A 3DGHA 2XLPA 1EBHA 2Q6UA 3CNJA 1E1KA 3NYFA 1PDHA 2XDOA 2RABA 3UXLA 1MO9A 3QTPA 3D46A 2XGZA 2WDRA 3P1WA 2V6OA 3LZXA 4G74A 3SX6A 4U8PA 3SYIA 4FP1A 1NPXA 3CT2A 3AECA 3V3WA 2X3NA 3T2YA 2P8BA 2XH2A 2HXTA 4Z43A 2BK4A 4NTCA 4H4YA 3V3OA 4BK1A 1YQ4A 1CJ2A 2YVFA 4EMIA 3SQSA 3H12A 4G8TA 3T8QA 3VRBA 2GGJA 3PFRA 1PJ7A 3AEGA 5HHFA 2W3SA 1IUUA 2CFYA 4A35A 2YLWA 3DFHA 5FS7A 3K7TA 3QJ4A 1WYGA 2WDVA 1VDVA 4TVWA 3QSSA 3BOXA 2HZGA 2ARDA 4FX9A 2R9ZA 3MKCA 3SZWA 1E6EA 2JKCA 2V5ZA 4D04A 4Z25A 3T2ZA 3GMBA 3ITJA 4EQRA 4CY6A 2MNRA 3T14A 3ALJA 3TTEA 3SJNA 4U8IA 5JCMA 5HYMA 4M52A 1DJNA 3D8XA 4WX1A 3NN0X 4J2WA 1S7MA 1LV0A 3LOVA 3KD9A 1V59A 3AXBA 1LTXR 1KSUA 2B9WA 4X4JA 3K30A 5DBJA 3UKFA 3OTRA 1COYA 4DGKA 4K5SA 3JSKA 2BXRA 1ZP0A 3NRNA 2JB2A 1LVLA 2PGEA 4K8DA 2Y6QA 3Q4DA 3T9PA 3ISHA 1K0IA 4YSZA 4A6NB 3UKLA 3RHAA 1GRGA 1F6MA 1V97A 1BGJA 3H4KA 4ROPA 5EBKA 3RR1A 1BWCA 1MXTA 3SFDA 3PG6A 2BXSA 2V3AA 3AM9A 4EM3A 2FBWA 2WU5A 3UJSA 4AT2A 1CL0A 3I6DA 4KPLA 4Z2RA 4UP3A 3CPJG 5KRQA 2MUCA 5J7XA 3KPFA 3TJ4A 3BSMA 4MJWA 1GETA 1GEUA 1F8SA 1GPEA 1VDCA 3P4PA 3CPHG 4DN1A 3C4NA 3P3BA 4BK2A 3RGTA 3QFAA 4TVYA 1S2QA 3DIPA 2C67A 3SGLA 2XYOA 3VFCA 3SY4A 4G7FA 1FECA 3P93A 2C76A 4HCHA 1O95A 2AQJA 4H83A 3IF9A 2XVIA 3B3RA 2DKHA 3B97A 1B8SA 3UOXA 1FEAA 2XVEA 3K1GA 3OZ2A 5KOWA 4TM4A 2CDUA 3QKEA 2BK5A 1VG0A 2EQ9A 3THUA 1JNZA 4CCQA 4YT0A 3I4KA 2FKPA 3TCSA 5KVHA 3DESA 1NEKA 3LB8A 4A3RA 4HB9A 1KSSA 3NS1B 4DNAA 4GGBA 1XPYA 2POZA 3QVPA 4A6NA 3V3NA 4H4WA 3UCDA 4DWDA 2ZBWA 1TDNA 1O94A 4J57A 1EC7A 3ALMA 2YG7A 3CB3A 2E5VA 4E4FA 3GMCA 3V5CA 5GSNA 4U2SA 2YVJA 2X8GA 3FV9A 4GR1A 5FJRA 4X2PA 3NVWB 3DG3A 4A7AA 2GGGA 3Q6JA 1DOCA 4B65A 4K8GA 3MY9A 1KKOA 3RP8A 2BC1A 2C4CA 4IA5A 3K7QX 5KWFA 1EL5A 4CBQA 3CGDA 3V4BA 1ZOYA 4AT0A 2OFJA 3FBSA 4USQA 1TZZA 2R45A 2FJBA 4GMEA 4E5TA 1N62C 4HCDA 2PHHA 3KVEA 1GV4A 3AE6A 1PXCA 5KXJA 4EMJA 4EMWA 2WETA 1DODA 3EF6A 4ZCCA 3DJGX 3OZMA 1L9CA 3AWIA 4B63A 1ZY8A 1SB3B 2Q7VA 2WU2A 3QLDA 3DK9A 3UP5A 3DJDA 2EQ7A 4IP4A 4H4RA 1ZXIC 4E0VA 3GC2A 1GRHA 1YQZA 3UOYA 4IHCA 5BVAA 1RSGA 4Z1YA 3T4WA 3NNEA 2P3ZA 4GFIA 3NIXA 5KMPA 2JAEA 2O9ZA 1JPDX 2OALA 1BF3A 3B6DA 1RVKA 1JCTA 1KN0A 2XFPA 2Z5XA 1BZLA 2CVJA 3AE4A 3VQRA 1PDYA 1OJ9A 1D5TA 1QJDA 1NHRA 2C7GA 4YTMA 2B9YA 3H7VA 4Y4LA 1KCZA 1N5XA 2E4GA 3LJPA 3BHKA 4OPGA 3T31A 2J3NA 5KOXA 2B7RA 3FJ4A 3NHOX 2BACA 5U25A 2VVMA 3GD6A 3AD8B 3ATQA 1F8WA 1H81A 1X2GA 3OZYA 4H4QA 4LU6A 4ICYA 1ZOVA 3TJIA 1PBEA 4NWZA 3NFUA 5JCIA 3IHGA 4AOXA 2OQHA 2XFOA 2WP9A 2WHDA 4OPUA 1E1LA 3NTDA 2ZZ0A 3M13A 1XS2A 1S2YA 3NVYB 2YG4A 2R4JA 1GRFA 3DK8A 3SBFA 3T37A 5HY5A 3M0OA 1KKRA 1OJDA 5BULA 5C2TA 2XVJA 4AOSA 1GERA 4OPIA 1ZKQA 1Y56B 1FO4A 3NGCX 2ONEA 2WEUA 3AB1A 4H4VA 2V61A 2XLRA 2OA1A 3UKHA 3DJEA 2XVHA 3NK1X 1NENA 5EOWA 4JNQA 3CNTA 2GAGB 1L0VA 3UOVA 3URHA 3U9IA 3ZLFA 2Q0KA 4YSYA 4U8NA 3K7MX 3ZVHB 4RG3A 1E1MA 2PTXA 3S5SA 2AKZA 1VRQB 3NH3X 1Z6LA 3N4EA 3ZYXA 3EEZA 1IUTA 1GTHA 4A6GA 3KKJA 3AE5A 1GRAA 3N6HA 4I59A 3VRAA 3VC6A 5IDZA 1RP0A 4H2RA 1EL8A 2GGEA 2GAHB 1FHUA 3NK0X 1SJDA 4FI4A 3DMEA 2GQFA 3CXOA 2OZ8A 2H89A 4GAVA 2X99A 3VCNA 4GYPC 3UTHA 2QA2A 4IV9A 1CHUA 4JN7A 1DOBA 1N1PA 3A7RA 3QN3A 3TQPA 4MKSA 3GY1A 3PO7A 1SJCA 1DNCA 5CKUA 1EC9A 3HZLA 2OQYA 1ZMCA 3ETRB 1KFYA 4GF7A 1KD0A 1EBDA 4H4TA 4TM1A 3UGVA 2PA6A 2BRYA 4GAPA 1DOEA 3AD7B 4U2LA 3N6JA 2HXUA 3GD3A 3SN0A 2OVLA 3FMWA 3PS9A 1Y56A 2WOVA 1XHCA 2YAUA 2GEWA 3GDPA 2VVLA 5KNLA 3NK2X 3SN4A 1BKHA 4IVMB 3S61A 4B1BA 4IP5A 4A79A 2C75A 3NYCA 2BC0A 3GD4A 4H19A 5J04A 6ENLA 1Q1RA 3EPTA 4CNKA 3COXA 3UJFA 3WE0A 2YLRA 1FEBA 3ZVHA 3SZFA 2C66A 1R0MA 1PBCA 1PJ5A 2OKTA 4Z2UA 3SFEA 4U8JA 1CC6A 1EL7A 2C70A 3NVZB 2QAEA 5EB4A 3DJJA 3QFBA 5ER0A 3SQPA 1UKVG 5FJOA 3KUMA 4HCLA 3B9JB 5M0ZA 4H50A 3MUCA 2P88A 2PU1A 2DW7A 5EB5A 2WPEA 3DG7A 4U2TA 1ZX9A 1FFVC 1PS9A 3VR9A 3ZLGA 4HNCA 4A65A 2ZC8A 3GO2A 4GCMA 4RSLA 4BJYA 3ALLA 4YWSA 3I3LA 2FJEA 1P2HA 4WCTA 1ECQA 2OO6A 2C72A 1O5WA 1LQUA 3DDMA 3JW7A 3UTEA 4YKGA 3N4FA 1TE6A 4M0XA 4OPCA 3REDA 5TR3A 1KF6A 1H86A 3RNMA 2BCGG 4O5QA 1CJ3A 2CHRA 1N60C 1N5WC 2X8CA 3AE7A 1FCDA 3R0KA 3CIRA 2WBAA 4XWZA 1MNSA 2WP5A 4K1WA 3AE2A 4FDCB 3CGCA 1JDFA 2B9XA 4MMWA 2IVEA 4LA1A 3D47A 4J1OA 1N4WA 4G6GA 3P4QA 3HYWA 4YTPA 3ICRA 2XLUA 3HYVA 1YKJA 4BK3A 4K7ZA 4JN8A 2OLNA 1GOSA 2VOUA 3UKPA 3AYJA 3T6CA 3NTAA 4X9NA 2I5QA 2YG6A 2AL1A 2BA9A 4NEWA 3UTFA 2C3DA 3V76A 4KWSA 4LIIA 2GVCA 3DGBA 2AAQA 1YEYA 4J31A 1E9IA 2WS3A 2VZ2A 3NLCA 1B37A 2BS4A 2W3RA 3AYIA 2V3BA 3ZLHA 5C3JA 2QJNA 4U8MA 2QA1A 4Y4NA 4TM0A 1NHSA 1GESA 3PVCA 3NG7X 2A8XA 4JQ9A 3UJRA 2VQ7A 4H2QA 2IVDA 4E6MA 2OPJA 5FJPA 4C74A 3PWGA 1L9EA 3BI4A 3JZUA 4HYRA 4H1ZA 1H6VA 3PK7A 1JEHA 5FS8A 1OEPA 2YWLA 1ZK7A 3FXGA 4DHGA 1X2HA 3AE3A 2UZZA 3NKSA 3DFYA 2QDDA 2NQLA 2YG3A 4E8GA 2XFUA 1TDEA 4USRA 2GSHA 3IWAA 4B69A 5KMRA 2GH5A 3KPKA 2OX4A 3L1RA 3UJEA 1JROA 2GF3A 2QJJA 3H8IA 3I6TA 4H2NA 4H2HA 4F4RA 3QPEA 3HRDC 3R10A 2P0IA 3VDGA 2BABA 1NHPA 3KLJA 5KMQA 1Q9IA 4G9KA 1CF3A 4C3XA 4CY8A 2X8HA 4N9XA 2EQ6A 3P0WA 4O5UA 1XPQA 3H8LA 2RGJA 3FCPA 4E4UA 3KU9A 3JVAA 2WOWA 4B66A 1CJCA 4GDPA 1VQZA 3ABVA 3BJSA 4M6UA 3ENLA 3AMZA 5FJUA 1GRTA 3TOYA 3RITA 1JRXA 2GMHA 5BOEA 3VC5A 1MOKA 4GRTA 2R46A 3QVRA 4IL2A 1YY5A 4J36A 3DA1A 1MDRA 3IK4A 4Z24A 3RO6A 4H4UA 2PS2A 2Z5YA 1IYXA 2PYXA 1SJBA 2R0PA 2PTYA 3SZ0A 5U63A 4Z2TA 1GREA 3TW9A 1LJ1A 4ZN0A 4UDPA 1R6WA 3UTGA 3R07C 1DTNA 2BK3A 3OPSA 2GR3A 3CXBA 3II4A 4YWOA 2PMQA 2VQBA 1K0JA 3NN6X 4NZHA 3S5WA 3NXLA 3SN1A 3AE8A 5HXIA 1FOHA 1F8RA 1LQTA 3D1CA 3MQTA 4JN9A 3UKQA 2YR4A 1OJTA 1OJAA 1E39A 1PJ6A 2YLTA 4DSGA 3F8PA 4UDQA 4II2A 3PWIA 4IZGA 1GTEA 1XANA 4KEMA 1E1NA 3CPIG 4J33A 3CYJA 3F8RA 5CQFA 2WOIA 3LZWA 4AP3A 1EL9A 2GL5A 3DH9A 2GMJA 4Y4MA 4GGHA 3A7AA 3VCCA 4G6HA 4DSHA 3AEAA 4FK1A 1FFUC 4ADWA 1JRPA 1PHHA 3BI2A 1H2IA 3ICTA 1GXFA 2NPXA 1N4VA 1DJQA 4FK1C 1L8PA 1TDKA 2NVKX 3CN8A 3FPZA 3CNPA 1D4CA 2YM2A 4H2PA 3EANA 1KNRA 3IJIA 4GYPA 3EKGA 1VG9A 2XSXA 2GV8A 3UCCA 2WPCA 1P43A 2FJDA 4EQWA 2PPGA 2VRMA 1CBOA 3MSYA 4GISA 2PP0A 5FS9A 4EQSA 3CMMA 2XH7A 2OZTA 1REOA 4P9SA 3U4FA 1N4UA 4IVOB 4ZOHB 1NG3A 3R0UA 4J3ZA 1GNDA 1NHQA 1TRBA 2AKMA 2WDQA 3MZNA 3EUB3 4A5LA 1STZA 1D4DA 1GALA 2OLOA 1JU2A 4TLXA 1K4QA 1BGNA 2P8CA 3SR6B 2YLSA 5KVIA 4GUVA 4AP1A 3FYYA 2APGA 2C3CA 3AEFA 2JB1A 1MDLA 3OW1A 2JBVA 2WESA 2YM1A 4H4ZA 4DX3A 1TDFA 4OPLA 4CNJA 1JNRA 5FS6A 3NT6A 1QLBA 4H4XA 2IIDA 2E5AA 1LPFA 1W4XA 3STPA 3RP7A 1H83A 1ZMDA 2R0CA 3VA8A 2XFNA 3SXIA 2XLTA 3ZDNA 4B68A 2QCUA 2QDEA 1BQGA 1QO8A 2OG9A 3UKKA 1KNPA 3CGBA 1ELSA 4JDRA 4OPDA 2YVGA 7ENLA 5JCNA 4PAAA 5J60A 2QQ6A 4MGGA 3G5SA 4K5RA 2AL2B 5JRBA 2DW6A 5BOFA 2CULA 2QVHA 3Q45A 4IL0A 4BURA 1IJHA 2BRAA 2XFQA 1D7YA 3ATRA 4YXDA 4EM4A 2QJMA 2OAMA 3VRDB 1B4VA 3G5QA 3AEBA 3GWFA 3NO1A 3GYJA 1D7LA 3C96A 2ZZCA 3QSEA 1PBFA 3FG2P 4OVIA 2GQWA 4A9WA 1PXBA 1FL2A 4DXKA 1PN0A 4GIRA 2C73A 3DK4A 3UKAA 2Y6RA 3G5RA 1CC2A 4NTEA 3HYXA 3AEEA 4PABA 3DG6A 3UXKA 4C5OA 3AE1A 3HPFA 3LXDA 5BUKA 4IT1A 5IQ1A 3D9XA 3A7UA 1F9CA 4BJZA 1VQWA 2GGHA 1SEZA 1FHVA 2GRTA 5KMSA 1MUCA 5JCLA 3FIMB 3FVDA 3NRZB 1NU5A 5FMHA 2Q0LA 2C64A 4YSXA 4YTNA 3F8DA 1H82A 3QSMA 1S3EA 2PP3A 2XH4A 2JB3A 2PTWA 4U8LA 1EBGA 3R9UA 2FJAA 3CK5A 4XWRA 3DERA 4HPNA 4B67A 1JRZA 2YR5A 3T2KA 4OPTA 3AEDA 2V60A 1F3PA 2AR8A 2W55A 2AL2A 1DXLA 1WUEA 3NVVB 2H88A 2E3TA 2OLAA 1SJAA 3NZGA 5EU9A 4JNAA 5IPYA 4K2SA 4JY3A 3BHFA 1H7XA 2C65A 3RP6A 3OP2A 2F5ZA 1ELIA 3V5FA 1PBDA 3P4SA 2GR0A 1IUSA 1OJCA 4XXGA 3M12A 2PTZA 2E1MA 3O0HA 2VVLG 4EWJA 2B76A 4I58A 1EC8A 4APNA 4KX6A 4ZA0A 2ZADA 4ZCDA 3ICSA 3AE9A 4J34A 4EIPA 3LADA 4Z44A 1M64A 2PCEA 2OZ3A 2TMDA 2RGOA 5G5HB 4YSHA 1IUVA 2XH0A 4C3YA 1Y0PA 3ADAB 4NEVA 4D03A 4II3A 1CJ4A 2HNEA 3S47A 3E1TA 4X9MA 4HA6A 2PGWA 3CGEA 4CCRA 1KDGA 3GRTA 3IHMA 2GR1A 3L5OA 2R0GA 1X31B 2YR6A 4B64A 3UP4A 3ES8A 1W6TA 3H8AA 3KA7A 4ZCWA 2GGIA 4A99A 2X50A 3EAOA 4Z17A 2EQ8A 4K2XA 3GSIA 4UDRA 3AYLA 2R4EA 1TYTA 2WP6A 1D4EA 1ONEA 1PXAA 3R11A 3TWBA 3P9UA 4ENLA 3RRAA 4U8KA 1H84A 2YQUA 3R25A 2HQMA 1NAAA 4EQXA 2GDQA 4H7UA 2XCGA 2YLXA 3AN1A 2WPFA 4HNLA 1B5QA 1CC4A 3SZCA 1Q1WA 4H4SA 2O56A 2TPRA 3OC4A 5IQ4A 2YLZA 3UJ2A 3HW2A 4K22A 1AOGA 3CNSA 1ZDLA 1NG4A 4REKA 1MRAA 5M10A 2VRLA 3DGZA 4YKFA 2QGYA 2A89A 1GSNA 2PU0A 1E7PA 4NNJA 4OCGA 3IJLA 3Q9TA 1YQ3A 2PSNA 1N63C 5GRTA 2PP1A 4H4PA 4JY2A 3ZVIA 1N61C 1P48A 5ENLA 3GWDA 3R1ZA 4J56A 2RDXA 3GYIA 5G5GB 3P4RA 5L46A 4NTDA 3T0KA 2W0HA 4KPRA 3H70A 3GYXA 1BKWA 3SSZA 2FYMA 1ONFA 2BS3A 3BNMA 3BNUA 2DKIA 4DYEA 5FJTA 3IJQA 3MWCA 3CNDA 1GRBA 3TWAA 2YG5A 3UCLA 1XDIA 1H7WA 4BV6A 5JCKA 3RCYA 3VR8A 4Z26A 3GDNA 5BRTA 4JHMA 4TLZA 2A87A 3BI5A 3DEQA 3CAWA 2ZZBA 3GRSA 4G73A 1TKKA 1RYIA 1P2EA 1M6IA 2WQYA 2PODA 4CRTA 1TYPA 2BYBA 3NYEA 3UOZA 4IA6A 1K0LA 4HN8A 2I0ZA 1WUFA 3CTYA 1HYUA 4EIQA 1PDZA 4TM3A 1JPMA 2GR2A 2XVFA 4ECHA 4C77A 1T3QC 2RGHA 1L9DA 4RG4A 1NELA 2XLSA 1S3BA 2BS2A 3L8KA 2JK6A 1JOAA 4U8OA 1RM6B 3SM8A 3I6EA 3C4AA 1IUWA 4GDEA 1JRYA 2W54A 2ACZA 2GB0A 2BCPA 1NDAA 2B7SA 5U1OA
chains in the Genus database with same CATH topology
1PBFA 2J3NA 3FG2P 1IUXA 2GQWA 3AD9B 3IC9A 4OVIA 5KOXA 2B7RA 5LV9A 4A9WA 1PXBA 4C74A 1L9EA 3BI4A 1FL2A 3NHOX 2BACA 1PBBA 2XLPA 1TDOA 1GT8A 3DGHA 5U25A 2VVMA 1PN0A 2C73A 3DK4A 2Q6UA 1E1KA 3AD8B 3ATQA 3CNJA 3NYFA 3UKAA 1F8WA 1H6VA 1PDHA 1JEHA 2XDOA 1CC2A 2Y6RA 5FS8A 3G5RA 1H81A 2YWLA 4NTEA 3HYXA 3AEEA 1ZK7A 2RABA 4PABA 4H4QA 4LU6A 1MO9A 3AE3A 2UZZA 4ICYA 3P1WA 2WDRA 1ZOVA 3NKSA 2V6OA 3LZXA 4G74A 3SX6A 1PBEA 4U8PA 4C5OA 3AE1A 4NWZA 3SYIA 3LXDA 5JCIA 5BUKA 3IHGA 1NPXA 5IQ1A 3D9XA 4AOXA 2YG3A 4BJZA 3AECA 2XFUA 1VQWA 1TDEA 4AT2A 1SEZA 4USRA 2X3NA 2XFOA 2WP9A 2GRTA 2WHDA 3IWAA 4B69A 5KMRA 2GH5A 3KPKA 5KMSA 3T2YA 3L1RA 4OPUA 1E1LA 5JCLA 2ZZ0A 3NTDA 3FIMB 4Z43A 3M13A 5FMHA 2GF3A 2Q0LA 2BK4A 3H8IA 4NTCA 4H4YA 2C64A 4YSXA 4YTNA 3F8DA 4H2NA 3V3OA 1H82A 4BK1A 1S2YA 1YQ4A 1CJ2A 2YVFA 4EMIA 3QSMA 1S3EA 2YG4A 2R4JA 1GRFA 3DK8A 2JB3A 3T37A 3VRBA 5HY5A 3M0OA 1OJDA 5BULA 5C2TA 1PJ7A 2BABA 2XVJA 3AEGA 5HHFA 4AOSA 1NHPA 3KLJA 5KMQA 1GERA 4OPIA 1Q9IA 4G9KA 4U8LA 1ZKQA 1CF3A 1Y56B 1IUUA 4C3XA 4CY8A 3R9UA 2FJAA 3NGCX 2CFYA 2X8HA 2WEUA 4N9XA 3AB1A 2YLWA 5FS7A 4H4VA 2EQ6A 3K7TA 3QJ4A 2V61A 4XWRA 2WDVA 4O5UA 4B67A 1JRZA 1XPQA 3H8LA 3QSSA 2YR5A 3T2KA 2XLRA 2OA1A 2RGJA 3UKHA 3DJEA 4OPTA 3AEDA 2ARDA 2V60A 2XVHA 1F3PA 3KU9A 2AR8A 3NK1X 1NENA 4FX9A 5EOWA 4JNQA 2R9ZA 3CNTA 2GAGB 1L0VA 3SZWA 3UOVA 3URHA 2WOWA 4B66A 1E6EA 1DXLA 2JKCA 1CJCA 2Q0KA 4YSYA 4U8NA 2H88A 2V5ZA 4GDPA 3K7MX 3ABVA 4RG3A 4D04A 4Z25A 3T2ZA 1E1MA 3GMBA 3ITJA 1VRQB 3NH3X 1Z6LA 4EIPA 3ZYXA 4EQRA 1IUTA 4CY6A 3T14A 3ALJA 4JNAA 1GTHA 5IPYA 1GRTA 3AE5A 3KKJA 1GRAA 4JY3A 4U8IA 3BHFA 5JCMA 1H7XA 2C65A 3RP6A 4I59A 1JRXA 3VRAA 2F5ZA 1ELIA 2GMHA 5HYMA 4M52A 1DJNA 1PBDA 3P4SA 1RP0A 3D8XA 2GR0A 1MOKA 4H2RA 4WX1A 4GRTA 1EL8A 3NN0X 1IUSA 2R46A 4J2WA 1OJCA 1S7MA 3QVRA 4XXGA 1LV0A 1YY5A 2GAHB 3LOVA 4J36A 3DA1A 3M12A 3NK0X 3KD9A 4Z24A 2E1MA 3O0HA 2GQFA 1V59A 2VVLG 3DMEA 3AXBA 2B76A 1LTXR 4I58A 4H4UA 3SZCA 1KSUA 4APNA 2B9WA 2H89A 2PYXA 2Z5YA 2R0PA 4GAVA 2X99A 4KX6A 4X4JA 3K30A 5DBJA 3UKFA 4ZCDA 1COYA 3UTHA 3ICSA 2QA2A 3SZ0A 3AE9A 4IV9A 5U63A 4DGKA 4K5SA 1CHUA 4J34A 1GREA 4Z2TA 1DOBA 3LADA 2BXRA 3JSKA 1ZP0A 1LJ1A 1M64A 2JB2A 3NRNA 4UDPA 4Z44A 4ZN0A 1LVLA 1N1PA 2TMDA 4K8DA 3UTGA 3PO7A 2Y6QA 2RGOA 3ISHA 4YSHA 1K0IA 4YSZA 1IUVA 4C3YA 1Y0PA 1DNCA 4A6NB 5CKUA 3UKLA 3RHAA 3ADAB 4NEVA 1GRGA 3HZLA 4D03A 4II3A 2BK3A 1ZMCA 1F6MA 2GR3A 3II4A 4YWOA 1CJ4A 1BGJA 3H4KA 2VQBA 5EBKA 1K0JA 1KFYA 3E1TA 3NN6X 4GF7A 4X9MA 1BWCA 1MXTA 3SFDA 4HA6A 4NZHA 3PG6A 3S5WA 1EBDA 4H4TA 4TM1A 5HXIA 3AE8A 3CGEA 2BRYA 2BXSA 4GAPA 1DOEA 2V3AA 3AD7B 4EM3A 4U2LA 2FBWA 1KDGA 4CCRA 3GRTA 1FOHA 1F8RA 3GD3A 1LQTA 2WU5A 3D1CA 2GR1A 3IHMA 4JN9A 3L5OA 2R0GA 1OJTA 1X31B 2YR6A 1OJAA 2YR4A 1CL0A 3UP4A 4B64A 1E39A 3I6DA 1PJ6A 3KA7A 2YLTA 3FMWA 3PS9A 4Z2RA 4A99A 1Y56A 2WOVA 1XHCA 2X50A 2YAUA 2GEWA 4UP3A 4DSGA 3GDPA 3F8PA 3EAOA 2EQ8A 4K2XA 4UDQA 2VVLA 5KNLA 3NK2X 4II2A 3CPJG 5KRQA 3GSIA 4UDRA 3AYLA 5J7XA 2R4EA 3KPFA 1GTEA 4IVMB 1XANA 3S61A 1TYTA 4MJWA 2WP6A 1D4EA 4B1BA 1GETA 1PXAA 1GEUA 4A79A 1E1NA 3CPIG 2C75A 4J33A 1F8SA 1GPEA 1VDCA 3P4PA 3NYCA 3P9UA 3CPHG 3F8RA 2BC0A 3C4NA 5CQFA 2WOIA 3GD4A 4BK2A 3QFAA 4U8KA 3LZWA 4AP3A 1S2QA 1Q1RA 1H84A 1EL9A 3EPTA 4CNKA 2YQUA 3DH9A 2GMJA 3COXA 3WE0A 4Y4MA 2C67A 1FEBA 2HQMA 1NAAA 2YLRA 4G6HA 3UKQA 3SGLA 2XYOA 4DSHA 3AEAA 4FK1A 3SZFA 4EQXA 3SY4A 2C66A 4H7UA 2XCGA 4ADWA 1PBCA 1PHHA 3BI2A 1H2IA 1PJ5A 3ICTA 2YLXA 1FECA 1GXFA 2C76A 4Z2UA 1O95A 3SFEA 2NPXA 1N4VA 2AQJA 2WPFA 1DJQA 1B5QA 1CC4A 4FK1C 4U8JA 1Q1WA 4H4SA 1CC6A 3IF9A 2XVIA 1EL7A 3B3RA 2DKHA 1B8SA 2C70A 3UOXA 1FEAA 2QAEA 2XVEA 5EB4A 2TPRA 3DJJA 3OC4A 1TDKA 5IQ4A 2YLZA 3OZ2A 3QFBA 5KOWA 4TM4A 2NVKX 5ER0A 2CDUA 3SQPA 1UKVG 2BK5A 1VG0A 4K22A 1AOGA 3CNSA 2EQ9A 1JNZA 1ZDLA 1NG4A 4REKA 3CN8A 3FPZA 3CNPA 5M10A 4CCQA 2VRLA 3DGZA 1D4CA 2YM2A 4YKFA 5M0ZA 4H50A 4H2PA 4YT0A 3EANA 5EB5A 1KNRA 2A89A 2WPEA 1GSNA 5KVHA 4U2TA 1E7PA 1ZX9A 1NEKA 4OCGA 4NNJA 3LB8A 4HB9A 1VG9A 1PS9A 3VR9A 1KSSA 4A65A 2GV8A 3Q9TA 1YQ3A 4DNAA 4GCMA 4RSLA 5GRTA 4BJYA 3ALLA 4H4PA 2WPCA 4JY2A 3QVPA 4A6NA 3I3LA 4H4WA 3V3NA 2FJDA 2FJEA 1P2HA 4EQWA 4WCTA 2VRMA 1CBOA 2ZBWA 2C72A 5FS9A 1TDNA 4EQSA 3CMMA 1O94A 1O5WA 1LQUA 1REOA 4P9SA 3UTEA 4J57A 3GWDA 4YKGA 4J56A 1N4UA 3ALMA 4IVOB 3GYIA 3P4RA 5L46A 2YG7A 1NG3A 4NTDA 4OPCA 3T0KA 3REDA 1GNDA 2W0HA 4KPRA 1NHQA 1TRBA 2E5VA 3GYXA 1BKWA 5TR3A 3GMCA 1KF6A 2WDQA 5GSNA 1H86A 4U2SA 2YVJA 3RNMA 2X8GA 4GR1A 1ONFA 2BCGG 4O5QA 1CJ3A 4A5LA 3Q6JA 4A7AA 1DOCA 4B65A 1D4DA 2BS3A 1GALA 2X8CA 3AE7A 2OLOA 1JU2A 4TLXA 3RP8A 1FCDA 1K4QA 1BGNA 3BNMA 3BNUA 2WBAA 3CIRA 4XWZA 2YLSA 5KVIA 2WP5A 2BC1A 2DKIA 2C4CA 4GUVA 4IA5A 4AP1A 3AE2A 3K7QX 5KWFA 1EL5A 4FDCB 3CGCA 2APGA 4CBQA 2C3CA 2B9XA 3CNDA 1GRBA 2YG5A 3UCLA 3CGDA 2IVEA 3AEFA 4LA1A 2JB1A 1ZOYA 4AT0A 1N4WA 3FBSA 1XDIA 1H7WA 4USQA 2JBVA 4BV6A 2R45A 2WESA 2FJBA 5JCKA 2YM1A 4H4ZA 1TDFA 3VR8A 4Z26A 3GDNA 4G6GA 5BRTA 4OPLA 4TLZA 2A87A 4CNJA 3P4QA 3BI5A 3HYWA 1JNRA 2PHHA 3KVEA 5FS6A 1GV4A 4YTPA 3AE6A 1PXCA 3ICRA 3NT6A 5KXJA 4EMJA 2ZZBA 3GRSA 4EMWA 1QLBA 4H4XA 2WETA 2XLUA 2IIDA 4G73A 1DODA 3HYVA 3EF6A 1RYIA 1YKJA 4ZCCA 3DJGX 1P2EA 1M6IA 1L9CA 2WQYA 1LPFA 4BK3A 1W4XA 3AWIA 4B63A 1ZY8A 4K7ZA 4CRTA 1TYPA 2BYBA 3RP7A 1H83A 2Q7VA 1ZMDA 3NYEA 2OLNA 2R0CA 2WU2A 3DK9A 3UP5A 3UOZA 4IA6A 3DJDA 1K0LA 2EQ7A 2XFNA 3SXIA 2XLTA 2I0ZA 3ZDNA 1GOSA 4H4RA 2VOUA 3UKPA 2QCUA 4B68A 4E0VA 1GRHA 3AYJA 3NTAA 1YQZA 3UOYA 1QO8A 3CTYA 4X9NA 1HYUA 3UKKA 4EIQA 1KNPA 2YG6A 4TM3A 5BVAA 3CGBA 1RSGA 2GR2A 4JDRA 2BA9A 2YVGA 2XVFA 3NNEA 4NEWA 4OPDA 4ECHA 3UTFA 2C3DA 3V76A 5JCNA 4PAAA 5J60A 4LIIA 4C77A 2GVCA 2AAQA 3NIXA 5KMPA 4J31A 2JAEA 2O9ZA 2WS3A 2RGHA 3G5SA 1L9DA 2OALA 2VZ2A 1BF3A 4K5RA 3B6DA 4RG4A 3NLCA 1B37A 2BS4A 5JRBA 3AYIA 1KN0A 2V3BA 2XFPA 2Z5XA 5C3JA 1BZLA 2CULA 2XLSA 4U8MA 2QA1A 2CVJA 1S3BA 3AE4A 4Y4NA 4TM0A 2BS2A 3VQRA 3L8KA 2JK6A 1JOAA 4U8OA 1OJ9A 4BURA 1NHSA 1D5TA 1IJHA 1GESA 3PVCA 1QJDA 3SM8A 1NHRA 2BRAA 2C7GA 1D7YA 2XFQA 2B9YA 3NG7X 4Y4LA 4YTMA 3ATRA 3C4AA 4EM4A 4YXDA 1IUWA 2OAMA 3VRDB 1B4VA 2A8XA 4JQ9A 3G5QA 4GDEA 1JRYA 2VQ7A 4H2QA 2E4GA 3AEBA 3GWFA 2ACZA 2GB0A 2BCPA 1NDAA 3LJPA 2IVDA 3GYJA 1D7LA 2B7SA 2ZZCA 3BHKA 5U1OA 3C96A 3QSEA 4OPGA 3T31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PBF A;  2J3N A;  3FG2 P;  1IUX A;  2GQW A;  3AD9 B;  3IC9 A;  4OVI A;  5KOX A;  2B7R A;  5LV9 A;  4A9W A;  1PXB A;  4C74 A;  1L9E A;  3BI4 A;  1FL2 A;  3NHO X;  2BAC A;  1PBB A;  2XLP A;  1TDO A;  1GT8 A;  3DGH A;  5U25 A;  2VVM A;  1PN0 A;  2C73 A;  3DK4 A;  2Q6U A;  1E1K A;  3AD8 B;  3ATQ A;  3CNJ A;  3NYF A;  3UKA A;  1F8W A;  1H6V A;  1PDH A;  1JEH A;  2XDO A;  1CC2 A;  2Y6R A;  5FS8 A;  3G5R A;  1H81 A;  2YWL A;  4NTE A;  3AEE A;  1ZK7 A;  2RAB A;  4PAB A;  4H4Q A;  4LU6 A;  1MO9 A;  3AE3 A;  2UZZ A;  4ICY A;  3P1W A;  2WDR A;  1ZOV A;  3NKS A;  2V6O A;  3LZX A;  1PBE A;  4U8P A;  4C5O A;  3AE1 A;  3LXD A;  5JCI A;  5BUK A;  3IHG A;  1NPX A;  5IQ1 A;  4AOX A;  2YG3 A;  4BJZ A;  3AEC A;  2XFU A;  1VQW A;  1TDE A;  1SEZ A;  4USR A;  2X3N A;  2XFO A;  2WP9 A;  2GRT A;  2WHD A;  3IWA A;  4B69 A;  2GH5 A;  3L1R A;  4OPU A;  1E1L A;  5JCL A;  2ZZ0 A;  3NTD A;  3FIM B;  4Z43 A;  3M13 A;  5FMH A;  2GF3 A;  2Q0L A;  2BK4 A;  3H8I A;  4NTC A;  4H4Y A;  2C64 A;  4YSX A;  4YTN A;  3F8D A;  4H2N A;  3V3O A;  1H82 A;  4BK1 A;  1S2Y A;  1YQ4 A;  1CJ2 A;  2YVF A;  4EMI A;  3QSM A;  1S3E A;  2YG4 A;  2R4J A;  1GRF A;  3DK8 A;  2JB3 A;  3T37 A;  3VRB A;  5HY5 A;  3M0O A;  1OJD A;  5BUL A;  5C2T A;  1PJ7 A;  2BAB A;  2XVJ A;  3AEG A;  5HHF A;  4AOS A;  1NHP A;  3KLJ A;  1GER A;  4OPI A;  1Q9I A;  4U8L A;  1ZKQ A;  1CF3 A;  1Y56 B;  1IUU A;  4C3X A;  4CY8 A;  3R9U A;  2FJA A;  3NGC X;  2CFY A;  2X8H A;  2WEU A;  4N9X A;  3AB1 A;  2YLW A;  5FS7 A;  4H4V A;  2EQ6 A;  3K7T A;  3QJ4 A;  2V61 A;  4XWR A;  2WDV A;  4O5U A;  4B67 A;  1JRZ A;  1XPQ A;  3H8L A;  3QSS A;  2YR5 A;  2XLR A;  2OA1 A;  2RGJ A;  3UKH A;  3DJE A;  4OPT A;  3AED A;  2ARD A;  2V60 A;  2XVH A;  1F3P A;  3KU9 A;  2AR8 A;  3NK1 X;  1NEN A;  4FX9 A;  5EOW A;  4JNQ A;  2R9Z A;  3CNT A;  2GAG B;  1L0V A;  3UOV A;  3URH A;  2WOW A;  4B66 A;  1E6E A;  1DXL A;  2JKC A;  1CJC A;  2Q0K A;  4YSY A;  4U8N A;  2H88 A;  2V5Z A;  4GDP A;  3K7M X;  3ABV A;  4RG3 A;  4D04 A;  4Z25 A;  1E1M A;  3GMB A;  3ITJ A;  1VRQ B;  3NH3 X;  1Z6L A;  4EIP A;  3ZYX A;  4EQR A;  1IUT A;  4CY6 A;  3ALJ A;  4JNA A;  1GTH A;  5IPY A;  1GRT A;  3AE5 A;  3KKJ A;  1GRA A;  4JY3 A;  4U8I A;  3BHF A;  5JCM A;  1H7X A;  2C65 A;  3RP6 A;  4I59 A;  1JRX A;  3VRA A;  2F5Z A;  1ELI A;  2GMH A;  5HYM A;  4M52 A;  1DJN A;  1PBD A;  3P4S A;  1RP0 A;  3D8X A;  2GR0 A;  1MOK A;  4H2R A;  4WX1 A;  4GRT A;  1EL8 A;  3NN0 X;  1IUS A;  2R46 A;  4J2W A;  1OJC A;  3QVR A;  4XXG A;  1LV0 A;  1YY5 A;  2GAH B;  3LOV A;  4J36 A;  3DA1 A;  3M12 A;  3NK0 X;  3KD9 A;  4Z24 A;  2E1M A;  3O0H A;  2GQF A;  1V59 A;  2VVL G;  3DME A;  3AXB A;  2B76 A;  1LTX R;  4I58 A;  4H4U A;  1KSU A;  4APN A;  2B9W A;  2H89 A;  2PYX A;  2Z5Y A;  2R0P A;  4KX6 A;  2X99 A;  4X4J A;  3K30 A;  5DBJ A;  3UKF A;  4ZCD A;  1COY A;  3UTH A;  3ICS A;  2QA2 A;  3AE9 A;  4IV9 A;  5U63 A;  4DGK A;  4K5S A;  1CHU A;  4J34 A;  1GRE A;  4Z2T A;  1DOB A;  3LAD A;  2BXR A;  3JSK A;  1ZP0 A;  1LJ1 A;  1M64 A;  2JB2 A;  3NRN A;  4UDP A;  4Z44 A;  4ZN0 A;  1LVL A;  1N1P A;  2TMD A;  4K8D A;  3UTG A;  3PO7 A;  2Y6Q A;  2RGO A;  3ISH A;  4YSH A;  1K0I A;  4YSZ A;  1IUV A;  4C3Y A;  1Y0P A;  1DNC A;  4A6N B;  5CKU A;  3UKL A;  3RHA A;  3ADA B;  4NEV A;  1GRG A;  3HZL A;  4D03 A;  2BK3 A;  1ZMC A;  1F6M A;  2GR3 A;  3II4 A;  4YWO A;  1CJ4 A;  1BGJ A;  3H4K A;  2VQB A;  5EBK A;  1K0J A;  1KFY A;  3E1T A;  3NN6 X;  4GF7 A;  4X9M A;  1BWC A;  1MXT A;  3SFD A;  4HA6 A;  4NZH A;  3S5W A;  1EBD A;  4H4T A;  4TM1 A;  5HXI A;  3AE8 A;  3CGE A;  2BXS A;  4CCR A;  1DOE A;  2V3A A;  3AD7 B;  4EM3 A;  4U2L A;  2FBW A;  1KDG A;  3GRT A;  1FOH A;  1F8R A;  3GD3 A;  1LQT A;  2WU5 A;  3D1C A;  2GR1 A;  3IHM A;  4JN9 A;  2R0G A;  2YR4 A;  1OJT A;  1X31 B;  2YR6 A;  1OJA A;  4AT2 A;  1CL0 A;  3UP4 A;  4B64 A;  1E39 A;  3I6D A;  1PJ6 A;  3KA7 A;  2YLT A;  3FMW A;  3PS9 A;  4Z2R A;  4A99 A;  1Y56 A;  2WOV A;  1XHC A;  2X50 A;  2YAU A;  2GEW A;  4UP3 A;  4DSG A;  3GDP A;  3F8P A;  3EAO A;  2EQ8 A;  4K2X A;  4UDQ A;  2VVL A;  3NK2 X;  3CPJ G;  5KRQ A;  3GSI A;  4UDR A;  3AYL A;  5J7X A;  2R4E A;  3KPF A;  1GTE A;  4IVM B;  1XAN A;  3S61 A;  1TYT A;  4MJW A;  2WP6 A;  1D4E A;  4B1B A;  1GET A;  1PXA A;  1GEU A;  4A79 A;  1E1N A;  3CPI G;  2C75 A;  4J33 A;  1F8S A;  1GPE A;  1VDC A;  3P4P A;  3NYC A;  3P9U A;  3CPH G;  3F8R A;  2BC0 A;  3C4N A;  5CQF A;  2WOI A;  3GD4 A;  4BK2 A;  3QFA A;  4U8K A;  3LZW A;  4AP3 A;  1S2Q A;  1Q1R A;  1H84 A;  1EL9 A;  3EPT A;  4CNK A;  2YQU A;  3DH9 A;  2GMJ A;  3COX A;  3WE0 A;  4Y4M A;  2C67 A;  1FEB A;  2HQM A;  1NAA A;  2YLR A;  3UKQ A;  3SGL A;  2XYO A;  4DSH A;  3AEA A;  4FK1 A;  4EQX A;  2C66 A;  4H7U A;  2XCG A;  4ADW A;  1PBC A;  1PHH A;  3BI2 A;  1PJ5 A;  3ICT A;  2YLX A;  1FEC A;  1GXF A;  2C76 A;  4Z2U A;  1O95 A;  3SFE A;  2NPX A;  1N4V A;  2AQJ A;  2WPF A;  1DJQ A;  1B5Q A;  1CC4 A;  4FK1 C;  4U8J A;  1Q1W A;  4H4S A;  1CC6 A;  3IF9 A;  2XVI A;  1EL7 A;  3B3R A;  2DKH A;  1B8S A;  2C70 A;  3UOX A;  1FEA A;  2QAE A;  2XVE A;  5EB4 A;  2TPR A;  3DJJ A;  3OC4 A;  1TDK A;  5IQ4 A;  2YLZ A;  3OZ2 A;  3QFB A;  5KOW A;  4TM4 A;  2NVK X;  5ER0 A;  2CDU A;  3SQP A;  1UKV G;  2BK5 A;  1VG0 A;  4K22 A;  1AOG A;  3CNS A;  2EQ9 A;  1JNZ A;  1ZDL A;  1NG4 A;  4REK A;  3CN8 A;  3FPZ A;  3CNP A;  5M10 A;  4CCQ A;  2VRL A;  3DGZ A;  1D4C A;  2YM2 A;  4YKF A;  5M0Z A;  4H50 A;  4H2P A;  4YT0 A;  3EAN A;  5EB5 A;  1KNR A;  2A89 A;  2WPE A;  1GSN A;  5KVH A;  4U2T A;  1E7P A;  1ZX9 A;  1NEK A;  4OCG A;  3LB8 A;  4HB9 A;  1VG9 A;  1PS9 A;  3VR9 A;  1KSS A;  4A65 A;  2GV8 A;  3Q9T A;  1YQ3 A;  4DNA A;  4GCM A;  4RSL A;  5GRT A;  4BJY A;  3ALL A;  4H4P A;  2WPC A;  4JY2 A;  3QVP A;  4A6N A;  3I3L A;  4H4W A;  3V3N A;  2FJD A;  2FJE A;  1P2H A;  4EQW A;  4WCT A;  2VRM A;  1CBO A;  2ZBW A;  2C72 A;  5FS9 A;  1TDN A;  4EQS A;  1O94 A;  1O5W A;  1LQU A;  1REO A;  4P9S A;  3UTE A;  4J57 A;  3GWD A;  4YKG A;  4J56 A;  1N4U A;  3ALM A;  4IVO B;  3GYI A;  3P4R A;  5L46 A;  2YG7 A;  1NG3 A;  4NTD A;  4OPC A;  3RED A;  1GND A;  2W0H A;  4KPR A;  1NHQ A;  1TRB A;  2E5V A;  1BKW A;  5TR3 A;  3GMC A;  1KF6 A;  2WDQ A;  5GSN A;  1H86 A;  4U2S A;  2YVJ A;  3RNM A;  2X8G A;  4GR1 A;  1ONF A;  2BCG G;  4O5Q A;  1CJ3 A;  4A5L A;  3Q6J A;  4A7A A;  1DOC A;  4B65 A;  1D4D A;  2BS3 A;  1GAL A;  2X8C A;  3AE7 A;  2OLO A;  1JU2 A;  4TLX A;  3RP8 A;  1FCD A;  1K4Q A;  1BGN A;  3BNM A;  3BNU A;  2WBA A;  3CIR A;  4XWZ A;  2YLS A;  5KVI A;  2WP5 A;  2BC1 A;  2DKI A;  4GUV A;  4IA5 A;  4AP1 A;  3AE2 A;  3K7Q X;  5KWF A;  1EL5 A;  4FDC B;  3CGC A;  2APG A;  4CBQ A;  2C3C A;  2B9X A;  3CND A;  1GRB A;  2YG5 A;  3UCL A;  3CGD A;  2IVE A;  3AEF A;  4LA1 A;  2JB1 A;  1ZOY A;  4AT0 A;  1N4W A;  3FBS A;  1XDI A;  1H7W A;  4USQ A;  2JBV A;  4BV6 A;  2R45 A;  2WES A;  2FJB A;  5JCK A;  2YM1 A;  4H4Z A;  1TDF A;  3VR8 A;  4Z26 A;  3GDN A;  5BRT A;  4OPL A;  4TLZ A;  2A87 A;  4CNJ A;  3P4Q A;  3BI5 A;  1JNR A;  2PHH A;  3KVE A;  5FS6 A;  1GV4 A;  4YTP A;  3AE6 A;  1PXC A;  3ICR A;  3NT6 A;  5KXJ A;  4EMJ A;  2ZZB A;  3GRS A;  4EMW A;  1QLB A;  4H4X A;  2WET A;  2XLU A;  2IID A;  1DOD A;  3EF6 A;  1RYI A;  1YKJ A;  4ZCC A;  3DJG X;  1P2E A;  1M6I A;  1L9C A;  2WQY A;  1LPF A;  4BK3 A;  1W4X A;  3AWI A;  4B63 A;  1ZY8 A;  4K7Z A;  4CRT A;  1TYP A;  2BYB A;  3RP7 A;  1H83 A;  2Q7V A;  1ZMD A;  3NYE A;  2OLN A;  2R0C A;  2WU2 A;  3DK9 A;  3UP5 A;  3UOZ A;  4IA6 A;  3DJD A;  1K0L A;  2EQ7 A;  2XFN A;  2XLT A;  2I0Z A;  3ZDN A;  1GOS A;  4H4R A;  2VOU A;  3UKP A;  2QCU A;  4B68 A;  4E0V A;  1GRH A;  3AYJ A;  3NTA A;  1YQZ A;  3UOY A;  1QO8 A;  3CTY A;  4X9N A;  1HYU A;  3UKK A;  4EIQ A;  1KNP A;  2YG6 A;  4TM3 A;  5BVA A;  3CGB A;  1RSG A;  2GR2 A;  4JDR A;  2BA9 A;  2YVG A;  2XVF A;  3NNE A;  4NEW A;  4OPD A;  4ECH A;  3UTF A;  2C3D A;  3V76 A;  5JCN A;  4PAA A;  5J60 A;  4LII A;  4C77 A;  2GVC A;  2AAQ A;  3NIX A;  4J31 A;  2JAE A;  2O9Z A;  2WS3 A;  2RGH A;  3G5S A;  1L9D A;  2OAL A;  2VZ2 A;  1BF3 A;  4K5R A;  3B6D A;  4RG4 A;  3NLC A;  1B37 A;  2BS4 A;  3AYI A;  2V3B A;  2XFP A;  2Z5X A;  5C3J A;  1BZL A;  2CUL A;  2XLS A;  4U8M A;  2QA1 A;  2CVJ A;  1S3B A;  3AE4 A;  4Y4N A;  4TM0 A;  2BS2 A;  3VQR A;  3L8K A;  2JK6 A;  1JOA A;  4U8O A;  1OJ9 A;  4BUR A;  1NHS A;  1D5T A;  1IJH A;  1GES A;  3PVC A;  1QJD A;  3SM8 A;  1NHR A;  2C7G A;  2XFQ A;  1D7Y A;  3NG7 X;  2B9Y A;  4YTM A;  4Y4L A;  3ATR A;  3C4A A;  4EM4 A;  4YXD A;  1IUW A;  2OAM A;  3VRD B;  1B4V A;  2A8X A;  4JQ9 A;  3G5Q A;  4GDE A;  1JRY A;  2VQ7 A;  4H2Q A;  2E4G A;  3AEB A;  3GWF A;  2ACZ A;  2GB0 A;  2BCP A;  1NDA A;  3LJP A;  2IVD A;  3GYJ A;  1D7L A;  2B7S A;  2ZZC A;  3BHK A;  5U1O A;  3C96 A;  3QSE A;  4OPG A; 
#chains in the Genus database with same CATH topology
 1IUX A;  3AD9 B;  3IC9 A;  5LV9 A;  3ES7 A;  1PBB A;  1FIQ B;  4KT2 A;  1TDO A;  1GT8 A;  3DGH A;  2XLP A;  1EBH A;  2Q6U A;  3CNJ A;  1E1K A;  3NYF A;  1PDH A;  2XDO A;  2RAB A;  3UXL A;  1MO9 A;  3QTP A;  3D46 A;  2XGZ A;  2WDR A;  3P1W A;  2V6O A;  3LZX A;  4G74 A;  3SX6 A;  4U8P A;  3SYI A;  4FP1 A;  1NPX A;  3CT2 A;  3AEC A;  3V3W A;  2X3N A;  3T2Y A;  2P8B A;  2XH2 A;  2HXT A;  4Z43 A;  2BK4 A;  4NTC A;  4H4Y A;  3V3O A;  4BK1 A;  1YQ4 A;  1CJ2 A;  2YVF A;  4EMI A;  3SQS A;  3H12 A;  4G8T A;  3T8Q A;  3VRB A;  2GGJ A;  3PFR A;  1PJ7 A;  3AEG A;  5HHF A;  2W3S A;  1IUU A;  2CFY A;  4A35 A;  2YLW A;  3DFH A;  5FS7 A;  3K7T A;  3QJ4 A;  1WYG A;  2WDV A;  1VDV A;  4TVW A;  3QSS A;  3BOX A;  2HZG A;  2ARD A;  4FX9 A;  2R9Z A;  3MKC A;  3SZW A;  1E6E A;  2JKC A;  2V5Z A;  4D04 A;  4Z25 A;  3T2Z A;  3GMB A;  3ITJ A;  4EQR A;  4CY6 A;  2MNR A;  3T14 A;  3ALJ A;  3TTE A;  3SJN A;  4U8I A;  5JCM A;  5HYM A;  4M52 A;  1DJN A;  3D8X A;  4WX1 A;  3NN0 X;  4J2W A;  1S7M A;  1LV0 A;  3LOV A;  3KD9 A;  1V59 A;  3AXB A;  1LTX R;  1KSU A;  2B9W A;  4X4J A;  3K30 A;  5DBJ A;  3UKF A;  3OTR A;  1COY A;  4DGK A;  4K5S A;  3JSK A;  2BXR A;  1ZP0 A;  3NRN A;  2JB2 A;  1LVL A;  2PGE A;  4K8D A;  2Y6Q A;  3Q4D A;  3T9P A;  3ISH A;  1K0I A;  4YSZ A;  4A6N B;  3UKL A;  3RHA A;  1GRG A;  1F6M A;  1V97 A;  1BGJ A;  3H4K A;  4ROP A;  5EBK A;  3RR1 A;  1BWC A;  1MXT A;  3SFD A;  3PG6 A;  2BXS A;  2V3A A;  3AM9 A;  4EM3 A;  2FBW A;  2WU5 A;  3UJS A;  4AT2 A;  1CL0 A;  3I6D A;  4KPL A;  4Z2R A;  4UP3 A;  3CPJ G;  5KRQ A;  2MUC A;  5J7X A;  3KPF A;  3TJ4 A;  3BSM A;  4MJW A;  1GET A;  1GEU A;  1F8S A;  1GPE A;  1VDC A;  3P4P A;  3CPH G;  4DN1 A;  3C4N A;  3P3B A;  4BK2 A;  3RGT A;  3QFA A;  4TVY A;  1S2Q A;  3DIP A;  2C67 A;  3SGL A;  2XYO A;  3VFC A;  3SY4 A;  4G7F A;  1FEC A;  3P93 A;  2C76 A;  4HCH A;  1O95 A;  2AQJ A;  4H83 A;  3IF9 A;  2XVI A;  3B3R A;  2DKH A;  3B97 A;  1B8S A;  3UOX A;  1FEA A;  2XVE A;  3K1G A;  3OZ2 A;  5KOW A;  4TM4 A;  2CDU A;  3QKE A;  2BK5 A;  1VG0 A;  2EQ9 A;  3THU A;  1JNZ A;  4CCQ A;  4YT0 A;  3I4K A;  2FKP A;  3TCS A;  5KVH A;  3DES A;  1NEK A;  3LB8 A;  4A3R A;  4HB9 A;  1KSS A;  3NS1 B;  4DNA A;  4GGB A;  1XPY A;  2POZ A;  3QVP A;  4A6N A;  3V3N A;  4H4W A;  3UCD A;  4DWD A;  2ZBW A;  1TDN A;  1O94 A;  4J57 A;  1EC7 A;  3ALM A;  2YG7 A;  3CB3 A;  2E5V A;  4E4F A;  3GMC A;  3V5C A;  5GSN A;  4U2S A;  2YVJ A;  2X8G A;  3FV9 A;  4GR1 A;  5FJR A;  4X2P A;  3NVW B;  3DG3 A;  4A7A A;  2GGG A;  3Q6J A;  1DOC A;  4B65 A;  4K8G A;  3MY9 A;  1KKO A;  3RP8 A;  2BC1 A;  2C4C A;  4IA5 A;  3K7Q X;  5KWF A;  1EL5 A;  4CBQ A;  3CGD A;  3V4B A;  1ZOY A;  4AT0 A;  2OFJ A;  3FBS A;  4USQ A;  1TZZ A;  2R45 A;  2FJB A;  4GME A;  4E5T A;  1N62 C;  4HCD A;  2PHH A;  3KVE A;  1GV4 A;  3AE6 A;  1PXC A;  5KXJ A;  4EMJ A;  4EMW A;  2WET A;  1DOD A;  3EF6 A;  4ZCC A;  3DJG X;  3OZM A;  1L9C A;  3AWI A;  4B63 A;  1ZY8 A;  1SB3 B;  2Q7V A;  2WU2 A;  3QLD A;  3DK9 A;  3UP5 A;  3DJD A;  2EQ7 A;  4IP4 A;  4H4R A;  1ZXI C;  4E0V A;  3GC2 A;  1GRH A;  1YQZ A;  3UOY A;  4IHC A;  5BVA A;  1RSG A;  4Z1Y A;  3T4W A;  3NNE A;  2P3Z A;  4GFI A;  3NIX A;  5KMP A;  2JAE A;  2O9Z A;  1JPD X;  2OAL A;  1BF3 A;  3B6D A;  1RVK A;  1JCT A;  1KN0 A;  2XFP A;  2Z5X A;  1BZL A;  2CVJ A;  3AE4 A;  3VQR A;  1PDY A;  1OJ9 A;  1D5T A;  1QJD A;  1NHR A;  2C7G A;  4YTM A;  2B9Y A;  3H7V A;  4Y4L A;  1KCZ A;  1N5X A;  2E4G A;  3LJP A;  3BHK A;  4OPG A;  3T31 A;  2J3N A;  5KOX A;  2B7R A;  3FJ4 A;  3NHO X;  2BAC A;  5U25 A;  2VVM A;  3GD6 A;  3AD8 B;  3ATQ A;  1F8W A;  1H81 A;  1X2G A;  3OZY A;  4H4Q A;  4LU6 A;  4ICY A;  1ZOV A;  3TJI A;  1PBE A;  4NWZ A;  3NFU A;  5JCI A;  3IHG A;  4AOX A;  2OQH A;  2XFO A;  2WP9 A;  2WHD A;  4OPU A;  1E1L A;  3NTD A;  2ZZ0 A;  3M13 A;  1XS2 A;  1S2Y A;  3NVY B;  2YG4 A;  2R4J A;  1GRF A;  3DK8 A;  3SBF A;  3T37 A;  5HY5 A;  3M0O A;  1KKR A;  1OJD A;  5BUL A;  5C2T A;  2XVJ A;  4AOS A;  1GER A;  4OPI A;  1ZKQ A;  1Y56 B;  1FO4 A;  3NGC X;  2ONE A;  2WEU A;  3AB1 A;  4H4V A;  2V61 A;  2XLR A;  2OA1 A;  3UKH A;  3DJE A;  2XVH A;  3NK1 X;  1NEN A;  5EOW A;  4JNQ A;  3CNT A;  2GAG B;  1L0V A;  3UOV A;  3URH A;  3U9I A;  3ZLF A;  2Q0K A;  4YSY A;  4U8N A;  3K7M X;  3ZVH B;  4RG3 A;  1E1M A;  2PTX A;  3S5S A;  2AKZ A;  1VRQ B;  3NH3 X;  1Z6L A;  3N4E A;  3ZYX A;  3EEZ A;  1IUT A;  1GTH A;  4A6G A;  3KKJ A;  3AE5 A;  1GRA A;  3N6H A;  4I59 A;  3VRA A;  3VC6 A;  5IDZ A;  1RP0 A;  4H2R A;  1EL8 A;  2GGE A;  2GAH B;  1FHU A;  3NK0 X;  1SJD A;  4FI4 A;  3DME A;  2GQF A;  3CXO A;  2OZ8 A;  2H89 A;  4GAV A;  2X99 A;  3VCN A;  4GYP C;  3UTH A;  2QA2 A;  4IV9 A;  1CHU A;  4JN7 A;  1DOB A;  1N1P A;  3A7R A;  3QN3 A;  3TQP A;  4MKS A;  3GY1 A;  3PO7 A;  1SJC A;  1DNC A;  5CKU A;  1EC9 A;  3HZL A;  2OQY A;  1ZMC A;  3ETR B;  1KFY A;  4GF7 A;  1KD0 A;  1EBD A;  4H4T A;  4TM1 A;  3UGV A;  2PA6 A;  2BRY A;  4GAP A;  1DOE A;  3AD7 B;  4U2L A;  3N6J A;  2HXU A;  3GD3 A;  3SN0 A;  2OVL A;  3FMW A;  3PS9 A;  1Y56 A;  2WOV A;  1XHC A;  2YAU A;  2GEW A;  3GDP A;  2VVL A;  5KNL A;  3NK2 X;  3SN4 A;  1BKH A;  4IVM B;  3S61 A;  4B1B A;  4IP5 A;  4A79 A;  2C75 A;  3NYC A;  2BC0 A;  3GD4 A;  4H19 A;  5J04 A;  6ENL A;  1Q1R A;  3EPT A;  4CNK A;  3COX A;  3UJF A;  3WE0 A;  2YLR A;  1FEB A;  3ZVH A;  3SZF A;  2C66 A;  1R0M A;  1PBC A;  1PJ5 A;  2OKT A;  4Z2U A;  3SFE A;  4U8J A;  1CC6 A;  1EL7 A;  2C70 A;  3NVZ B;  2QAE A;  5EB4 A;  3DJJ A;  3QFB A;  5ER0 A;  3SQP A;  1UKV G;  5FJO A;  3KUM A;  4HCL A;  3B9J B;  5M0Z A;  4H50 A;  3MUC A;  2P88 A;  2PU1 A;  2DW7 A;  5EB5 A;  2WPE A;  3DG7 A;  4U2T A;  1ZX9 A;  1FFV C;  1PS9 A;  3VR9 A;  3ZLG A;  4HNC A;  4A65 A;  2ZC8 A;  3GO2 A;  4GCM A;  4RSL A;  4BJY A;  3ALL A;  4YWS A;  3I3L A;  2FJE A;  1P2H A;  4WCT A;  1ECQ A;  2OO6 A;  2C72 A;  1O5W A;  1LQU A;  3DDM A;  3JW7 A;  3UTE A;  4YKG A;  3N4F A;  1TE6 A;  4M0X A;  4OPC A;  3RED A;  5TR3 A;  1KF6 A;  1H86 A;  3RNM A;  2BCG G;  4O5Q A;  1CJ3 A;  2CHR A;  1N60 C;  1N5W C;  2X8C A;  3AE7 A;  1FCD A;  3R0K A;  3CIR A;  2WBA A;  4XWZ A;  1MNS A;  2WP5 A;  4K1W A;  3AE2 A;  4FDC B;  3CGC A;  1JDF A;  2B9X A;  4MMW A;  2IVE A;  4LA1 A;  3D47 A;  4J1O A;  1N4W A;  4G6G A;  3P4Q A;  3HYW A;  4YTP A;  3ICR A;  2XLU A;  3HYV A;  1YKJ A;  4BK3 A;  4K7Z A;  4JN8 A;  2OLN A;  1GOS A;  2VOU A;  3UKP A;  3AYJ A;  3T6C A;  3NTA A;  4X9N A;  2I5Q A;  2YG6 A;  2AL1 A;  2BA9 A;  4NEW A;  3UTF A;  2C3D A;  3V76 A;  4KWS A;  4LII A;  2GVC A;  3DGB A;  2AAQ A;  1YEY A;  4J31 A;  1E9I A;  2WS3 A;  2VZ2 A;  3NLC A;  1B37 A;  2BS4 A;  2W3R A;  3AYI A;  2V3B A;  3ZLH A;  5C3J A;  2QJN A;  4U8M A;  2QA1 A;  4Y4N A;  4TM0 A;  1NHS A;  1GES A;  3PVC A;  3NG7 X;  2A8X A;  4JQ9 A;  3UJR A;  2VQ7 A;  4H2Q A;  2IVD A;  4E6M A;  2OPJ A;  5FJP A;  4C74 A;  3PWG A;  1L9E A;  3BI4 A;  3JZU A;  4HYR A;  4H1Z A;  1H6V A;  3PK7 A;  1JEH A;  5FS8 A;  1OEP A;  2YWL A;  1ZK7 A;  3FXG A;  4DHG A;  1X2H A;  3AE3 A;  2UZZ A;  3NKS A;  3DFY A;  2QDD A;  2NQL A;  2YG3 A;  4E8G A;  2XFU A;  1TDE A;  4USR A;  2GSH A;  3IWA A;  4B69 A;  5KMR A;  2GH5 A;  3KPK A;  2OX4 A;  3L1R A;  3UJE A;  1JRO A;  2GF3 A;  2QJJ A;  3H8I A;  3I6T A;  4H2N A;  4H2H A;  4F4R A;  3QPE A;  3HRD C;  3R10 A;  2P0I A;  3VDG A;  2BAB A;  1NHP A;  3KLJ A;  5KMQ A;  1Q9I A;  4G9K A;  1CF3 A;  4C3X A;  4CY8 A;  2X8H A;  4N9X A;  2EQ6 A;  3P0W A;  4O5U A;  1XPQ A;  3H8L A;  2RGJ A;  3FCP A;  4E4U A;  3KU9 A;  3JVA A;  2WOW A;  4B66 A;  1CJC A;  4GDP A;  1VQZ A;  3ABV A;  3BJS A;  4M6U A;  3ENL A;  3AMZ A;  5FJU A;  1GRT A;  3TOY A;  3RIT A;  1JRX A;  2GMH A;  5BOE A;  3VC5 A;  1MOK A;  4GRT A;  2R46 A;  3QVR A;  4IL2 A;  1YY5 A;  4J36 A;  3DA1 A;  1MDR A;  3IK4 A;  4Z24 A;  3RO6 A;  4H4U A;  2PS2 A;  2Z5Y A;  1IYX A;  2PYX A;  1SJB A;  2R0P A;  2PTY A;  3SZ0 A;  5U63 A;  4Z2T A;  1GRE A;  3TW9 A;  1LJ1 A;  4ZN0 A;  4UDP A;  1R6W A;  3UTG A;  3R07 C;  1DTN A;  2BK3 A;  3OPS A;  2GR3 A;  3CXB A;  3II4 A;  4YWO A;  2PMQ A;  2VQB A;  1K0J A;  3NN6 X;  4NZH A;  3S5W A;  3NXL A;  3SN1 A;  3AE8 A;  5HXI A;  1FOH A;  1F8R A;  1LQT A;  3D1C A;  3MQT A;  4JN9 A;  3UKQ A;  2YR4 A;  1OJT A;  1OJA A;  1E39 A;  1PJ6 A;  2YLT A;  4DSG A;  3F8P A;  4UDQ A;  4II2 A;  3PWI A;  4IZG A;  1GTE A;  1XAN A;  4KEM A;  1E1N A;  3CPI G;  4J33 A;  3CYJ A;  3F8R A;  5CQF A;  2WOI A;  3LZW A;  4AP3 A;  1EL9 A;  2GL5 A;  3DH9 A;  2GMJ A;  4Y4M A;  4GGH A;  3A7A A;  3VCC A;  4G6H A;  4DSH A;  3AEA A;  4FK1 A;  1FFU C;  4ADW A;  1JRP A;  1PHH A;  3BI2 A;  1H2I A;  3ICT A;  1GXF A;  2NPX A;  1N4V A;  1DJQ A;  4FK1 C;  1L8P A;  1TDK A;  2NVK X;  3CN8 A;  3FPZ A;  3CNP A;  1D4C A;  2YM2 A;  4H2P A;  3EAN A;  1KNR A;  3IJI A;  4GYP A;  3EKG A;  1VG9 A;  2XSX A;  2GV8 A;  3UCC A;  2WPC A;  1P43 A;  2FJD A;  4EQW A;  2PPG A;  2VRM A;  1CBO A;  3MSY A;  4GIS A;  2PP0 A;  5FS9 A;  4EQS A;  3CMM A;  2XH7 A;  2OZT A;  1REO A;  4P9S A;  3U4F A;  1N4U A;  4IVO B;  4ZOH B;  1NG3 A;  3R0U A;  4J3Z A;  1GND A;  1NHQ A;  1TRB A;  2AKM A;  2WDQ A;  3MZN A;  3EUB 3;  4A5L A;  1STZ A;  1D4D A;  1GAL A;  2OLO A;  1JU2 A;  4TLX A;  1K4Q A;  1BGN A;  2P8C A;  3SR6 B;  2YLS A;  5KVI A;  4GUV A;  4AP1 A;  3FYY A;  2APG A;  2C3C A;  3AEF A;  2JB1 A;  1MDL A;  3OW1 A;  2JBV A;  2WES A;  2YM1 A;  4H4Z A;  4DX3 A;  1TDF A;  4OPL A;  4CNJ A;  1JNR A;  5FS6 A;  3NT6 A;  1QLB A;  4H4X A;  2IID A;  2E5A A;  1LPF A;  1W4X A;  3STP A;  3RP7 A;  1H83 A;  1ZMD A;  2R0C A;  3VA8 A;  2XFN A;  3SXI A;  2XLT A;  3ZDN A;  4B68 A;  2QCU A;  2QDE A;  1BQG A;  1QO8 A;  2OG9 A;  3UKK A;  1KNP A;  3CGB A;  1ELS A;  4JDR A;  4OPD A;  2YVG A;  7ENL A;  5JCN A;  4PAA A;  5J60 A;  2QQ6 A;  4MGG A;  3G5S A;  4K5R A;  2AL2 B;  5JRB A;  2DW6 A;  5BOF A;  2CUL A;  2QVH A;  3Q45 A;  4IL0 A;  4BUR A;  1IJH A;  2BRA A;  2XFQ A;  1D7Y A;  3ATR A;  4YXD A;  4EM4 A;  2QJM A;  2OAM A;  3VRD B;  1B4V A;  3G5Q A;  3AEB A;  3GWF A;  3NO1 A;  3GYJ A;  1D7L A;  3C96 A;  2ZZC A;  3QSE A;  1PBF A;  3FG2 P;  4OVI A;  2GQW A;  4A9W A;  1PXB A;  1FL2 A;  4DXK A;  1PN0 A;  4GIR A;  2C73 A;  3DK4 A;  3UKA A;  2Y6R A;  3G5R A;  1CC2 A;  4NTE A;  3HYX A;  3AEE A;  4PAB A;  3DG6 A;  3UXK A;  4C5O A;  3AE1 A;  3HPF A;  3LXD A;  5BUK A;  4IT1 A;  5IQ1 A;  3D9X A;  3A7U A;  1F9C A;  4BJZ A;  1VQW A;  2GGH A;  1SEZ A;  1FHV A;  2GRT A;  5KMS A;  1MUC A;  5JCL A;  3FIM B;  3FVD A;  3NRZ B;  1NU5 A;  5FMH A;  2Q0L A;  2C64 A;  4YSX A;  4YTN A;  3F8D A;  1H82 A;  3QSM A;  1S3E A;  2PP3 A;  2XH4 A;  2JB3 A;  2PTW A;  4U8L A;  1EBG A;  3R9U A;  2FJA A;  3CK5 A;  4XWR A;  3DER A;  4HPN A;  4B67 A;  1JRZ A;  2YR5 A;  3T2K A;  4OPT A;  3AED A;  2V60 A;  1F3P A;  2AR8 A;  2W55 A;  2AL2 A;  1DXL A;  1WUE A;  3NVV B;  2H88 A;  2E3T A;  2OLA A;  1SJA A;  3NZG A;  5EU9 A;  4JNA A;  5IPY A;  4K2S A;  4JY3 A;  3BHF A;  1H7X A;  2C65 A;  3RP6 A;  3OP2 A;  2F5Z A;  1ELI A;  3V5F A;  1PBD A;  3P4S A;  2GR0 A;  1IUS A;  1OJC A;  4XXG A;  3M12 A;  2PTZ A;  2E1M A;  3O0H A;  2VVL G;  4EWJ A;  2B76 A;  4I58 A;  1EC8 A;  4APN A;  4KX6 A;  4ZA0 A;  2ZAD A;  4ZCD A;  3ICS A;  3AE9 A;  4J34 A;  4EIP A;  3LAD A;  4Z44 A;  1M64 A;  2PCE A;  2OZ3 A;  2TMD A;  2RGO A;  5G5H B;  4YSH A;  1IUV A;  2XH0 A;  4C3Y A;  1Y0P A;  3ADA B;  4NEV A;  4D03 A;  4II3 A;  1CJ4 A;  2HNE A;  3S47 A;  3E1T A;  4X9M A;  4HA6 A;  2PGW A;  3CGE A;  4CCR A;  1KDG A;  3GRT A;  3IHM A;  2GR1 A;  3L5O A;  2R0G A;  1X31 B;  2YR6 A;  4B64 A;  3UP4 A;  3ES8 A;  1W6T A;  3H8A A;  3KA7 A;  4ZCW A;  2GGI A;  4A99 A;  2X50 A;  3EAO A;  4Z17 A;  2EQ8 A;  4K2X A;  3GSI A;  4UDR A;  3AYL A;  2R4E A;  1TYT A;  2WP6 A;  1D4E A;  1ONE A;  1PXA A;  3R11 A;  3TWB A;  3P9U A;  4ENL A;  3RRA A;  4U8K A;  1H84 A;  2YQU A;  3R25 A;  2HQM A;  1NAA A;  4EQX A;  2GDQ A;  4H7U A;  2XCG A;  2YLX A;  3AN1 A;  2WPF A;  4HNL A;  1B5Q A;  1CC4 A;  3SZC A;  1Q1W A;  4H4S A;  2O56 A;  2TPR A;  3OC4 A;  5IQ4 A;  2YLZ A;  3UJ2 A;  3HW2 A;  4K22 A;  1AOG A;  3CNS A;  1ZDL A;  1NG4 A;  4REK A;  1MRA A;  5M10 A;  2VRL A;  3DGZ A;  4YKF A;  2QGY A;  2A89 A;  1GSN A;  2PU0 A;  1E7P A;  4NNJ A;  4OCG A;  3IJL A;  3Q9T A;  1YQ3 A;  2PSN A;  1N63 C;  5GRT A;  2PP1 A;  4H4P A;  4JY2 A;  3ZVI A;  1N61 C;  1P48 A;  5ENL A;  3GWD A;  3R1Z A;  4J56 A;  2RDX A;  3GYI A;  5G5G B;  3P4R A;  5L46 A;  4NTD A;  3T0K A;  2W0H A;  4KPR A;  3H70 A;  3GYX A;  1BKW A;  3SSZ A;  2FYM A;  1ONF A;  2BS3 A;  3BNM A;  3BNU A;  2DKI A;  4DYE A;  5FJT A;  3IJQ A;  3MWC A;  3CND A;  1GRB A;  3TWA A;  2YG5 A;  3UCL A;  1XDI A;  1H7W A;  4BV6 A;  5JCK A;  3RCY A;  3VR8 A;  4Z26 A;  3GDN A;  5BRT A;  4JHM A;  4TLZ A;  2A87 A;  3BI5 A;  3DEQ A;  3CAW A;  2ZZB A;  3GRS A;  4G73 A;  1TKK A;  1RYI A;  1P2E A;  1M6I A;  2WQY A;  2POD A;  4CRT A;  1TYP A;  2BYB A;  3NYE A;  3UOZ A;  4IA6 A;  1K0L A;  4HN8 A;  2I0Z A;  1WUF A;  3CTY A;  1HYU A;  4EIQ A;  1PDZ A;  4TM3 A;  1JPM A;  2GR2 A;  2XVF A;  4ECH A;  4C77 A;  1T3Q C;  2RGH A;  1L9D A;  4RG4 A;  1NEL A;  2XLS A;  1S3B A;  2BS2 A;  3L8K A;  2JK6 A;  1JOA A;  4U8O A;  1RM6 B;  3SM8 A;  3I6E A;  3C4A A;  1IUW A;  4GDE A;  1JRY A;  2W54 A;  2ACZ A;  2GB0 A;  2BCP A;  1NDA A;  2B7S A;  5U1O A; 
#chains in the Genus database with same CATH homology
 1PBF A;  2J3N A;  3FG2 P;  1IUX A;  2GQW A;  3AD9 B;  3IC9 A;  4OVI A;  5KOX A;  2B7R A;  5LV9 A;  4A9W A;  1PXB A;  4C74 A;  1L9E A;  3BI4 A;  1FL2 A;  3NHO X;  2BAC A;  1PBB A;  2XLP A;  1TDO A;  1GT8 A;  3DGH A;  5U25 A;  2VVM A;  1PN0 A;  2C73 A;  3DK4 A;  2Q6U A;  1E1K A;  3AD8 B;  3ATQ A;  3CNJ A;  3NYF A;  3UKA A;  1F8W A;  1H6V A;  1PDH A;  1JEH A;  2XDO A;  1CC2 A;  2Y6R A;  5FS8 A;  3G5R A;  1H81 A;  2YWL A;  4NTE A;  3HYX A;  3AEE A;  1ZK7 A;  2RAB A;  4PAB A;  4H4Q A;  4LU6 A;  1MO9 A;  3AE3 A;  2UZZ A;  4ICY A;  3P1W A;  2WDR A;  1ZOV A;  3NKS A;  2V6O A;  3LZX A;  4G74 A;  3SX6 A;  1PBE A;  4U8P A;  4C5O A;  3AE1 A;  4NWZ A;  3SYI A;  3LXD A;  5JCI A;  5BUK A;  3IHG A;  1NPX A;  5IQ1 A;  3D9X A;  4AOX A;  2YG3 A;  4BJZ A;  3AEC A;  2XFU A;  1VQW A;  1TDE A;  4AT2 A;  1SEZ A;  4USR A;  2X3N A;  2XFO A;  2WP9 A;  2GRT A;  2WHD A;  3IWA A;  4B69 A;  5KMR A;  2GH5 A;  3KPK A;  5KMS A;  3T2Y A;  3L1R A;  4OPU A;  1E1L A;  5JCL A;  2ZZ0 A;  3NTD A;  3FIM B;  4Z43 A;  3M13 A;  5FMH A;  2GF3 A;  2Q0L A;  2BK4 A;  3H8I A;  4NTC A;  4H4Y A;  2C64 A;  4YSX A;  4YTN A;  3F8D A;  4H2N A;  3V3O A;  1H82 A;  4BK1 A;  1S2Y A;  1YQ4 A;  1CJ2 A;  2YVF A;  4EMI A;  3QSM A;  1S3E A;  2YG4 A;  2R4J A;  1GRF A;  3DK8 A;  2JB3 A;  3T37 A;  3VRB A;  5HY5 A;  3M0O A;  1OJD A;  5BUL A;  5C2T A;  1PJ7 A;  2BAB A;  2XVJ A;  3AEG A;  5HHF A;  4AOS A;  1NHP A;  3KLJ A;  5KMQ A;  1GER A;  4OPI A;  1Q9I A;  4G9K A;  4U8L A;  1ZKQ A;  1CF3 A;  1Y56 B;  1IUU A;  4C3X A;  4CY8 A;  3R9U A;  2FJA A;  3NGC X;  2CFY A;  2X8H A;  2WEU A;  4N9X A;  3AB1 A;  2YLW A;  5FS7 A;  4H4V A;  2EQ6 A;  3K7T A;  3QJ4 A;  2V61 A;  4XWR A;  2WDV A;  4O5U A;  4B67 A;  1JRZ A;  1XPQ A;  3H8L A;  3QSS A;  2YR5 A;  3T2K A;  2XLR A;  2OA1 A;  2RGJ A;  3UKH A;  3DJE A;  4OPT A;  3AED A;  2ARD A;  2V60 A;  2XVH A;  1F3P A;  3KU9 A;  2AR8 A;  3NK1 X;  1NEN A;  4FX9 A;  5EOW A;  4JNQ A;  2R9Z A;  3CNT A;  2GAG B;  1L0V A;  3SZW A;  3UOV A;  3URH A;  2WOW A;  4B66 A;  1E6E A;  1DXL A;  2JKC A;  1CJC A;  2Q0K A;  4YSY A;  4U8N A;  2H88 A;  2V5Z A;  4GDP A;  3K7M X;  3ABV A;  4RG3 A;  4D04 A;  4Z25 A;  3T2Z A;  1E1M A;  3GMB A;  3ITJ A;  1VRQ B;  3NH3 X;  1Z6L A;  4EIP A;  3ZYX A;  4EQR A;  1IUT A;  4CY6 A;  3T14 A;  3ALJ A;  4JNA A;  1GTH A;  5IPY A;  1GRT A;  3AE5 A;  3KKJ A;  1GRA A;  4JY3 A;  4U8I A;  3BHF A;  5JCM A;  1H7X A;  2C65 A;  3RP6 A;  4I59 A;  1JRX A;  3VRA A;  2F5Z A;  1ELI A;  2GMH A;  5HYM A;  4M52 A;  1DJN A;  1PBD A;  3P4S A;  1RP0 A;  3D8X A;  2GR0 A;  1MOK A;  4H2R A;  4WX1 A;  4GRT A;  1EL8 A;  3NN0 X;  1IUS A;  2R46 A;  4J2W A;  1OJC A;  1S7M A;  3QVR A;  4XXG A;  1LV0 A;  1YY5 A;  2GAH B;  3LOV A;  4J36 A;  3DA1 A;  3M12 A;  3NK0 X;  3KD9 A;  4Z24 A;  2E1M A;  3O0H A;  2GQF A;  1V59 A;  2VVL G;  3DME A;  3AXB A;  2B76 A;  1LTX R;  4I58 A;  4H4U A;  3SZC A;  1KSU A;  4APN A;  2B9W A;  2H89 A;  2PYX A;  2Z5Y A;  2R0P A;  4GAV A;  2X99 A;  4KX6 A;  4X4J A;  3K30 A;  5DBJ A;  3UKF A;  4ZCD A;  1COY A;  3UTH A;  3ICS A;  2QA2 A;  3SZ0 A;  3AE9 A;  4IV9 A;  5U63 A;  4DGK A;  4K5S A;  1CHU A;  4J34 A;  1GRE A;  4Z2T A;  1DOB A;  3LAD A;  2BXR A;  3JSK A;  1ZP0 A;  1LJ1 A;  1M64 A;  2JB2 A;  3NRN A;  4UDP A;  4Z44 A;  4ZN0 A;  1LVL A;  1N1P A;  2TMD A;  4K8D A;  3UTG A;  3PO7 A;  2Y6Q A;  2RGO A;  3ISH A;  4YSH A;  1K0I A;  4YSZ A;  1IUV A;  4C3Y A;  1Y0P A;  1DNC A;  4A6N B;  5CKU A;  3UKL A;  3RHA A;  3ADA B;  4NEV A;  1GRG A;  3HZL A;  4D03 A;  4II3 A;  2BK3 A;  1ZMC A;  1F6M A;  2GR3 A;  3II4 A;  4YWO A;  1CJ4 A;  1BGJ A;  3H4K A;  2VQB A;  5EBK A;  1K0J A;  1KFY A;  3E1T A;  3NN6 X;  4GF7 A;  4X9M A;  1BWC A;  1MXT A;  3SFD A;  4HA6 A;  4NZH A;  3PG6 A;  3S5W A;  1EBD A;  4H4T A;  4TM1 A;  5HXI A;  3AE8 A;  3CGE A;  2BRY A;  2BXS A;  4GAP A;  1DOE A;  2V3A A;  3AD7 B;  4EM3 A;  4U2L A;  2FBW A;  1KDG A;  4CCR A;  3GRT A;  1FOH A;  1F8R A;  3GD3 A;  1LQT A;  2WU5 A;  3D1C A;  2GR1 A;  3IHM A;  4JN9 A;  3L5O A;  2R0G A;  1OJT A;  1X31 B;  2YR6 A;  1OJA A;  2YR4 A;  1CL0 A;  3UP4 A;  4B64 A;  1E39 A;  3I6D A;  1PJ6 A;  3KA7 A;  2YLT A;  3FMW A;  3PS9 A;  4Z2R A;  4A99 A;  1Y56 A;  2WOV A;  1XHC A;  2X50 A;  2YAU A;  2GEW A;  4UP3 A;  4DSG A;  3GDP A;  3F8P A;  3EAO A;  2EQ8 A;  4K2X A;  4UDQ A;  2VVL A;  5KNL A;  3NK2 X;  4II2 A;  3CPJ G;  5KRQ A;  3GSI A;  4UDR A;  3AYL A;  5J7X A;  2R4E A;  3KPF A;  1GTE A;  4IVM B;  1XAN A;  3S61 A;  1TYT A;  4MJW A;  2WP6 A;  1D4E A;  4B1B A;  1GET A;  1PXA A;  1GEU A;  4A79 A;  1E1N A;  3CPI G;  2C75 A;  4J33 A;  1F8S A;  1GPE A;  1VDC A;  3P4P A;  3NYC A;  3P9U A;  3CPH G;  3F8R A;  2BC0 A;  3C4N A;  5CQF A;  2WOI A;  3GD4 A;  4BK2 A;  3QFA A;  4U8K A;  3LZW A;  4AP3 A;  1S2Q A;  1Q1R A;  1H84 A;  1EL9 A;  3EPT A;  4CNK A;  2YQU A;  3DH9 A;  2GMJ A;  3COX A;  3WE0 A;  4Y4M A;  2C67 A;  1FEB A;  2HQM A;  1NAA A;  2YLR A;  4G6H A;  3UKQ A;  3SGL A;  2XYO A;  4DSH A;  3AEA A;  4FK1 A;  3SZF A;  4EQX A;  3SY4 A;  2C66 A;  4H7U A;  2XCG A;  4ADW A;  1PBC A;  1PHH A;  3BI2 A;  1H2I A;  1PJ5 A;  3ICT A;  2YLX A;  1FEC A;  1GXF A;  2C76 A;  4Z2U A;  1O95 A;  3SFE A;  2NPX A;  1N4V A;  2AQJ A;  2WPF A;  1DJQ A;  1B5Q A;  1CC4 A;  4FK1 C;  4U8J A;  1Q1W A;  4H4S A;  1CC6 A;  3IF9 A;  2XVI A;  1EL7 A;  3B3R A;  2DKH A;  1B8S A;  2C70 A;  3UOX A;  1FEA A;  2QAE A;  2XVE A;  5EB4 A;  2TPR A;  3DJJ A;  3OC4 A;  1TDK A;  5IQ4 A;  2YLZ A;  3OZ2 A;  3QFB A;  5KOW A;  4TM4 A;  2NVK X;  5ER0 A;  2CDU A;  3SQP A;  1UKV G;  2BK5 A;  1VG0 A;  4K22 A;  1AOG A;  3CNS A;  2EQ9 A;  1JNZ A;  1ZDL A;  1NG4 A;  4REK A;  3CN8 A;  3FPZ A;  3CNP A;  5M10 A;  4CCQ A;  2VRL A;  3DGZ A;  1D4C A;  2YM2 A;  4YKF A;  5M0Z A;  4H50 A;  4H2P A;  4YT0 A;  3EAN A;  5EB5 A;  1KNR A;  2A89 A;  2WPE A;  1GSN A;  5KVH A;  4U2T A;  1E7P A;  1ZX9 A;  1NEK A;  4OCG A;  4NNJ A;  3LB8 A;  4HB9 A;  1VG9 A;  1PS9 A;  3VR9 A;  1KSS A;  4A65 A;  2GV8 A;  3Q9T A;  1YQ3 A;  4DNA A;  4GCM A;  4RSL A;  5GRT A;  4BJY A;  3ALL A;  4H4P A;  2WPC A;  4JY2 A;  3QVP A;  4A6N A;  3I3L A;  4H4W A;  3V3N A;  2FJD A;  2FJE A;  1P2H A;  4EQW A;  4WCT A;  2VRM A;  1CBO A;  2ZBW A;  2C72 A;  5FS9 A;  1TDN A;  4EQS A;  3CMM A;  1O94 A;  1O5W A;  1LQU A;  1REO A;  4P9S A;  3UTE A;  4J57 A;  3GWD A;  4YKG A;  4J56 A;  1N4U A;  3ALM A;  4IVO B;  3GYI A;  3P4R A;  5L46 A;  2YG7 A;  1NG3 A;  4NTD A;  4OPC A;  3T0K A;  3RED A;  1GND A;  2W0H A;  4KPR A;  1NHQ A;  1TRB A;  2E5V A;  3GYX A;  1BKW A;  5TR3 A;  3GMC A;  1KF6 A;  2WDQ A;  5GSN A;  1H86 A;  4U2S A;  2YVJ A;  3RNM A;  2X8G A;  4GR1 A;  1ONF A;  2BCG G;  4O5Q A;  1CJ3 A;  4A5L A;  3Q6J A;  4A7A A;  1DOC A;  4B65 A;  1D4D A;  2BS3 A;  1GAL A;  2X8C A;  3AE7 A;  2OLO A;  1JU2 A;  4TLX A;  3RP8 A;  1FCD A;  1K4Q A;  1BGN A;  3BNM A;  3BNU A;  2WBA A;  3CIR A;  4XWZ A;  2YLS A;  5KVI A;  2WP5 A;  2BC1 A;  2DKI A;  2C4C A;  4GUV A;  4IA5 A;  4AP1 A;  3AE2 A;  3K7Q X;  5KWF A;  1EL5 A;  4FDC B;  3CGC A;  2APG A;  4CBQ A;  2C3C A;  2B9X A;  3CND A;  1GRB A;  2YG5 A;  3UCL A;  3CGD A;  2IVE A;  3AEF A;  4LA1 A;  2JB1 A;  1ZOY A;  4AT0 A;  1N4W A;  3FBS A;  1XDI A;  1H7W A;  4USQ A;  2JBV A;  4BV6 A;  2R45 A;  2WES A;  2FJB A;  5JCK A;  2YM1 A;  4H4Z A;  1TDF A;  3VR8 A;  4Z26 A;  3GDN A;  4G6G A;  5BRT A;  4OPL A;  4TLZ A;  2A87 A;  4CNJ A;  3P4Q A;  3BI5 A;  3HYW A;  1JNR A;  2PHH A;  3KVE A;  5FS6 A;  1GV4 A;  4YTP A;  3AE6 A;  1PXC A;  3ICR A;  3NT6 A;  5KXJ A;  4EMJ A;  2ZZB A;  3GRS A;  4EMW A;  1QLB A;  4H4X A;  2WET A;  2XLU A;  2IID A;  4G73 A;  1DOD A;  3HYV A;  3EF6 A;  1RYI A;  1YKJ A;  4ZCC A;  3DJG X;  1P2E A;  1M6I A;  1L9C A;  2WQY A;  1LPF A;  4BK3 A;  1W4X A;  3AWI A;  4B63 A;  1ZY8 A;  4K7Z A;  4CRT A;  1TYP A;  2BYB A;  3RP7 A;  1H83 A;  2Q7V A;  1ZMD A;  3NYE A;  2OLN A;  2R0C A;  2WU2 A;  3DK9 A;  3UP5 A;  3UOZ A;  4IA6 A;  3DJD A;  1K0L A;  2EQ7 A;  2XFN A;  3SXI A;  2XLT A;  2I0Z A;  3ZDN A;  1GOS A;  4H4R A;  2VOU A;  3UKP A;  2QCU A;  4B68 A;  4E0V A;  1GRH A;  3AYJ A;  3NTA A;  1YQZ A;  3UOY A;  1QO8 A;  3CTY A;  4X9N A;  1HYU A;  3UKK A;  4EIQ A;  1KNP A;  2YG6 A;  4TM3 A;  5BVA A;  3CGB A;  1RSG A;  2GR2 A;  4JDR A;  2BA9 A;  2YVG A;  2XVF A;  3NNE A;  4NEW A;  4OPD A;  4ECH A;  3UTF A;  2C3D A;  3V76 A;  5JCN A;  4PAA A;  5J60 A;  4LII A;  4C77 A;  2GVC A;  2AAQ A;  3NIX A;  5KMP A;  4J31 A;  2JAE A;  2O9Z A;  2WS3 A;  2RGH A;  3G5S A;  1L9D A;  2OAL A;  2VZ2 A;  1BF3 A;  4K5R A;  3B6D A;  4RG4 A;  3NLC A;  1B37 A;  2BS4 A;  5JRB A;  3AYI A;  1KN0 A;  2V3B A;  2XFP A;  2Z5X A;  5C3J A;  1BZL A;  2CUL A;  2XLS A;  4U8M A;  2QA1 A;  2CVJ A;  1S3B A;  3AE4 A;  4Y4N A;  4TM0 A;  2BS2 A;  3VQR A;  3L8K A;  2JK6 A;  1JOA A;  4U8O A;  1OJ9 A;  4BUR A;  1NHS A;  1D5T A;  1IJH A;  1GES A;  3PVC A;  1QJD A;  3SM8 A;  1NHR A;  2BRA A;  2C7G A;  1D7Y A;  2XFQ A;  2B9Y A;  3NG7 X;  4Y4L A;  4YTM A;  3ATR A;  3C4A A;  4EM4 A;  4YXD A;  1IUW A;  2OAM A;  3VRD B;  1B4V A;  2A8X A;  4JQ9 A;  3G5Q A;  4GDE A;  1JRY A;  2VQ7 A;  4H2Q A;  2E4G A;  3AEB A;  3GWF A;  2ACZ A;  2GB0 A;  2BCP A;  1NDA A;  3LJP A;  2IVD A;  3GYJ A;  1D7L A;  2B7S A;  2ZZC A;  3BHK A;  5U1O A;  3C96 A;  3QSE A;  4OPG A;  3T31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...