3V3WA

Crystal structure of an enolase from the soil bacterium cellvibrio japonicus (target efi-502161) with bound mg and glycerol
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
402
structure length
397
Chain Sequence
MKIVDAKVIVTCPGRNFVTLKIVTDQGIYGIGDATLNGREKSVVSYLEDYLIPVLIGRDPQQIEDIWQFFYRGAYWRRGPVGMTALAAIDVALWDIKAKLANMPLYQLLGGKSRERILSYTHANGKDLDSTLEAVRKAKDKGYKAIRVQCGIPGIAKTYGVSYEPADADLPSVEVWSTEKYLNYIPDVFAAVRKEFGPDIHLLHDVHHRLTPIEAARLGKALEPYHLFWMEDAVPAENQESFKLIRQHTTTPLAVGEVFNSIHDCRELIQNQWIDYIRTTIVHAGGISQMRRIADFASLFHVRTGFHGATDLSPVCMGAALHFDYWVPNFGIQEHMAHSEQMNAVFPHAYTFNDGYFTPGEKPGHGVDIDEKLAAQYPYKRACLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Starvation sensing protein rspA
publication title Crystal structure of an enolase from the soil bacterium Cellvibrio japonicus (TARGET EFI-502161) with bound MG and glycerol
rcsb
source organism Cellvibrio japonicus
total genus 143
structure length 397
sequence length 402
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3v3wA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3v3wA01
5FJUA 3GY1A 3DEQA 3JW7A 1NU5A 3IJQA 2OG9A 4FI4A 3VCCA 3ES7A 3V5CA 1E9IA 3H7VA 3GD6A 3TCSA 1FHVA 2HZGA 2QJJA 3N4EA 1MUCA 2ONEA 4GIRA 4E8GA 2GDQA 2QDEA 2QJMA 4H1ZA 2OQYA 2XSXA 4E6MA 3ES8A 3IJLA 3H70A 5ENLA 2MNRA 3RR1A 1WUEA 3DG6A 3P93A 2FYMA 3DG3A 3IK4A 1ELSA 2QVHA 4ZCWA 4GYPA 4HYRA 4MMWA 3FV9A 3UJFA 3T8QA 3V4BA 1WUFA 3OPSA 2PP0A 3DFHA 3OZMA 5FJTA 2GGJA 2RDXA 3FJ4A 4JN8A 2GGHA 2P0IA 3SBFA 3IJIA 2OZ3A 1TZZA 3H12A 1SJAA 1XPYA 2PTZA 3UCCA 1MDLA 4DX3A 2OVLA 2MUCA 2PS2A 1KKRA 1P48A 3JZUA 4A3RA 2I5QA 3MUCA 2XH4A 2ZADA 1TKKA 3N4FA 3Q45A 4KPLA 3B97A 3ZVIA 3CK5A 3UGVA 4M6UA 4GFIA 2PTWA 3U9IA 3U4FA 3QKEA 4X2PA 3ZLGA 4IZGA 4DYEA 3ENLA 4K8GA 5EU9A 3MSYA 3RITA 4HCLA 4ROPA 4J3ZA 3GO2A 3TTEA 1TE6A 4HPNA 4J1OA 3I4KA 3NZGA 4GGBA 2PP1A 5FJRA 1L8PA 3QPEA 3UCDA 3TOYA 4E5TA 4Z1YA 2AL1A 1RVKA 4IL2A 1R0MA 3OZYA 3DFYA 7ENLA 1R6WA 3D46A 4ENLA 3FYYA 4DHGA 2PTYA 1KCZA 2AL2B 4YWSA 3R0UA 2OFJA 1JDFA 2DW7A 3KUMA 3FCPA 3S47A 3DERA 1IYXA 1NELA 4KEMA 4M0XA 3N6HA 3P3BA 2OO6A 3H8AA 4K2SA 5J04A 3R0KA 5BOFA 2GL5A 1JPMA 2P88A 2ZC8A 3BSMA 3VFCA 3S5SA 1EC9A 3R10A 2GGIA 3R11A 2XGZA 4KT2A 3NFUA 3NXLA 1OEPA 3BOXA 4E4UA 3SN1A 1PDYA 3EKGA 2OKTA 3I6EA 3N6JA 1MRAA 5BOEA 1JPDX 1SJBA 2PP3A 2PMQA 2PODA 3UXKA 3MWCA 4MKSA 1ECQA 4G7FA 1MDRA 2XH0A 3NO1A 3UXLA 5IDZA 2PU0A 1SJDA 2PCEA 3CYJA 2PPGA 3STPA 3DGBA 2OPJA 4JN7A 3TJ4A 3GC2A 1BKHA 1FHUA 4IT1A 3V3WA 3MKCA 4Z17A 3EEZA 3SN4A 3SQSA 3DIPA 3DESA 2XH7A 3ZLHA 3T4WA 3VDGA 3RGTA 3OP2A 4H83A 3R1ZA 2CHRA 4GYPC 4IP5A 2OQHA 3DG7A 1F9CA 4H2HA 4A6GA 1P43A 3R25A 2PGEA 4A35A 3VA8A 1JCTA 3QTPA 3I6TA 1KKOA 3OW1A 2P3ZA 1W6TA 4IL0A 3UJRA 3CXOA 4K1WA 3MY9A 3PFRA 4F4RA 3ZVHA 3SN0A 3BJSA 3TQPA 3QN3A 4ZA0A 3CB3A 2HXTA 4MGGA 2HNEA 3TW9A 4HCDA 3UJSA 3HPFA 2PTXA 3TJIA 2NQLA 3QLDA 4HCHA 2AKMA 2OZTA 3SJNA 3SSZA 2AL2A 4JHMA 3JVAA 2POZA 3RCYA 4GMEA 4IHCA 4GISA 3PK7A 3FXGA 3TWAA 3VCNA 3CAWA 3T9PA 2QQ6A 5FJOA 1XS2A 1BQGA 2OZ8A 2XH2A 3T6CA 3PWIA 1ONEA 3OTRA 1EBHA 4FP1A 4H19A 4HN8A 1MNSA 3UJ2A 2GSHA 3MZNA 6ENLA 1EBGA 3RRAA 2QDDA 4DWDA 3Q4DA 4DXKA 1SJCA 2PSNA 2OX4A 4G8TA 2GGGA 4E4FA 3CT2A 2PGWA 4KWSA 2PA6A 1KD0A 1YEYA 1PDZA 2FKPA 4GGHA 3P0WA 3MQTA 1EC7A 2AKZA 3TWBA 2HXUA 4HNLA 4EWJA 2QGYA 4HNCA 3PWGA 2OLAA 4DN1A 3ZLFA 2GGEA 5FJPA 2P8CA 3VC5A 1EC8A 1DTNA 3V5FA 3D47A 2QJNA 3UJEA 3RO6A 2DW6A 4IP4A 2O56A 3FVDA 3THUA 2PU1A 3DDMA 3K1GA 3VC6A 2P8BA 3ZVHB
chains in the Genus database with same CATH superfamily
1I2OA 3V35A 4NI3A 2YCKX 4O1EA 1CECA 2ZZBA 2G8ZA 4W4QA 1LOLA 1U30A 2BFGA 3TTQA 4FALA 4JQ4A 1EOMA 2FGZA 4O8AA 3VX1A 2VEFA 3VX0A 2G50A 1LWJA 4IIDA 1MMFA 3EXSA 2BVDA 4GI9A 3HV9A 1HVQA 3ES8A 2JGQA 3FN9A 4ADWA 4ZR8A 5TBOA 1XDLA 4TVWA 5E0CA 3WNKA 5EMKA 1US3A 5AY7A 3GHTA 3GXNA 3ZWTA 4C6OA 1HL9A 1A47A 4WKFA 5BXRA 1VBHA 2H6RA 4PCTA 1X6UA 4Z1BA 3OODA 1PZ2A 4WUIA 1UH3A 2G3MA 3LM7A 4HU8A 3SAZA 4AZGA 3XINA 1IZCA 3DFHA 4YLWA 4EM3A 1GOQA 1DL3A 3LADA 3ARRA 1NDVA 4X3ZA 3SBFA 1WBHA 2EJ1A 5I02A 2WZTA 2WOWA 1PX4A 2ZTJA 4EQXA 5LA2A 5A8MA 3SRHA 3P6LA 2SFPA 3AZRA 2G4JA 1VR6A 1NFGA 3C2YA 1JFXA 3H54A 3LDVA 2BV9A 2ZCGA 3MUCA 2XH4A 1CB7B 1MXSA 2OZ0A 3PFMA 1TYGA 4RZBA 2B7QA 3GE7A 3IEBA 3SR7A 4IZGA 2IPJA 1XF0A 3G0SA 4M6PA 4KERA 3EPOA 4WQ6A 3WK0A 3W7RA 2WANA 4MNJA 5ABTA 5AC4A 3W7GA 5CAHA 5FF3A 1F4HA 5B7YA 3CWNA 1H7RA 2WJDA 1MFVA 1ODUA 5HATA 1EWDA 3W88A 4BV6A 1RR2A 2JK6A 3BQ5A 1ZQ5A 2EPLX 3BICA 1N8WA 1ZS2A 2WC4A 4L5ZA 1LRQA 3WX7A 4EMIA 3UY8A 1JUKA 3UWYA 5F7UA 3RMJA 2CWXA 1H1NA 4Z08A 2OSXA 1QPRA 3R0UA 3SI9A 1E73M 4WDTA 2KZHA 4GY0A 3SRFA 1ISXA 4DJEA 1XINA 2BLEA 4PUDA 4ZOBA 3SURA 2YZRA 4LQ1A 1Q13A 1PV8A 4C1KA 1NY1A 2ZTKA 3UVIA 4IJCA 3NPXA 3W9ZA 1GSNA 1W1IE 3VDAA 2Q3OA 4H4YA 5FD0A 4NJGA 4OBRA 1N7KA 2DGAA 3DUGA 4S3JA 2FZ9A 1OF6A 2XGZA 2Y89A 3T2PA 9CGTA 2VX7A 4YCOA 3H4WA 4O1BA 1QATA 3ICJA 3RR4A 1MRQA 5G5IA 1V08A 3WNOA 5A6MA 4CN4A 5E93A 3VU2A 1TCDA 4PTMA 3BC9A 3CAQA 4B3KA 1QNPA 2V3BA 3LS9A 1UJQA 3JZEA 1ZALA 4RNJA 3OA5A 4AFYA 3CIWA 3VNLA 1MOKA 1E6NA 2YPIA 3NURA 3PZMA 4LUSB 2EBNA 4DIAA 3DBNA 1XLEA 4C90A 3NPVA 3XIMA 1YDVA 1REQA 5U7SA 1TPWA 5IRPA 4FX8A 1RZMA 1D7KA 2DT1A 5M3WA 4WY0B 3CV7A 1XCXA 4J56A 4NXSA 1HFBA 1Q6DA 4R5EA 3OP2A 5JIPA 3LEPA 4JDRA 4IGHA 4GYPC 2GUUA 4IP5A 1J0JA 1A5LC 3DG7A 1M53A 4JBRA 3NOYA 3IJ8A 5G4WA 3KRSA 4GXMA 1FWAC 3WLOA 5KMYA 4GJIA 5JXQA 2VVNA 1WX0A 4NAFB 1MI3A 2OB3A 3OIXA 2HS8A 1B1YA 2RGMA 5C2GA 1KTNA 3SN0A 3BJSA 1SFJA 4WLCA 4N9CA 3DGRA 3WF0A 4A21A 4AC1X 4PMOA 3NSNA 3B8IA 1LVLA 3B3DA 3N13A 4LBSA 4N0RA 1E55A 2I56A 1EZWA 2ZA2A 1UQZA 1W31A 3AJXA 3SY1A 4HCHA 2AKMA 3W22A 5D9PA 2WHJA 4O54A 2H9AB 2PZNA 4H01A 5FIPA 3UXAA 6REQA 4KF1A 1Q7QA 3P5ZA 3LMZA 1CGYA 3QKZA 2JKPA 3VPLA 5MKGA 2VX6A 4XTDA 4EK7A 2CBJA 3TMLA 1OK6A 3EWUA 4A3UA 1MUMA 2QUTA 3QQ1A 3WQFA 1GYLA 1IE7C 2GSHA 3MZNA 4A3HA 4TTGA 2E28A 3RRAA 2IW0A 1M3UA 2JIWA 4CNUA 2EXOA 4GVHA 1AZ1A 4LYPA 3APYA 2GPTA 2GGGA 3FFSA 3CT2A 3AS0A 5JCMA 2XSAA 2PWDA 4DXVA 2XZ7A 3EA2A 1C8VA 1IXQA 2PWFA 3P0WA 1OGSA 4OV4A 2PC8A 2MANA 1NP2A 1US0A 3GLCA 4J2MA 3GW3A 3JU2A 4HA0A 3S3GA 3W7CA 2G41A 5C2XA 3ELFA 3A9BA 1WYIA 1PPIA 4PMJA 4UC5A 3AC0A 4PA8A 3KHDA 1SFTA 4H7CA 2FHBA 4R53A 1DJXA 1ZBKA 3QY8A 4GHRA 4POCA 4ZQNA 3VDBA 3KBJA 2PBGA 1A50A 4J2PA 2G3JA 2Z00A 4AEOA 2FZDA 1EHNA 3KOYA 2V69A 2PE4A 4M1RA 1NFPA 3DDMA 2WCGA 1XD0A 5FJUA 1SO5A 4QDMA 5A6KA 3UZ5A 3MC5A 3GVGA 3OZPA 2DZPA 3SECA 4GINA 1B3WA 1Q6GA 3HTWA 1GREA 1E9IA 2YDAA 4P8UA 1D3GA 4C6NA 3K4DA 4M80A 1MW0A 1MUCA 1R2TA 4H3DA 2Z7GA 1AL7A 4JHOA 4NIRA 1ZP3A 2V81A 4UR9A 2HDJA 3UPWA 1TCMA 2P10A 3M46A 2AGKA 4LAMA 4ZL1A 2V38A 3TKFA 1JPHA 3PZVA 1IZKA 2W4XA 4GYPA 4GYFA 4HYRA 1GESA 3NZRA 2QHAA 2CETA 5HA7A 2E0PA 3AUOA 4B5VA 3PANA 1NPXA 4FX9A 1L2QA 4JCLA 4ZE5A 1XGDA 3GNDA 1Y7VA 1RY8A 1G1YA 1TTPA 2Z28A 2TODA 1SGJA 2WKLA 1EP2A 3CPUA 1A3XA 2ZZ1A 3AJ7A 4LUIA 4YTQA 4CD6A 1SJAA 3APGA 3MP4A 3P5YA 1UKSA 4JFVA 1UBSA 4X60A 1ZX9A 3MDWA 3SGGA 3A7AA 2NVDA 1V6TA 1C8XA 4GI4A 3B97A 4BZYA 4OOUA 3PG9A 1GRHA 2EG6A 1IT8A 1XLGA 1OYCA 3ENLA 1TB3A 3VKJA 1ZFJA 4M19A 3CL8A 4HGXA 2J75A 2ALDA 3CZJA 5RUBA 3CT7A 1V3HA 4PULA 1FTXA 4RK8A 4RXGA 2F2KA 4Z2GA 4N9BA 4XBSA 5DCEA 4KMQA 2RAGA 2YW3A 2H3BA 4O14A 5FJRA 3LHWA 3P81A 1EDQA 5IDIA 1ADOA 1L8PA 3TOYA 4FLRA 3I4EA 3TC6A 2D73A 3B0UX 3VIKA 2VQTA 4Z1YA 1XRFA 2OYMA 1EXBA 4K7VA 1XLLA 3UZZA 3PBMA 1ZHAA 4GQBA 2Z7KA 2OGJA 3O06A 3WL1A 1TJ0A 5G1YA 1G4TA 4ENLA 4FO4A 3R0DA 3HU7A 1A49A 5REQB 1U5VA 1V77A 3SCQA 3IAPA 3O0KA 4GYJA 1FWHC 3FS2A 1AG1O 5D2TA 3M6DA 1JXKA 1B90A 3RCNA 3MBDA 2QPUA 1WXZA 4G7EB 2V82A 4L80A 2XPKA 3W7PA 3S6DA 1UR9A 4AVFA 2D3NA 1JXJA 4CEXC 1G9HA 5CH9A 4EF9A 1VPXA 5J04A 3KP0A 5F4SA 3AZTA 1TV5A 1MYRA 2DSZA 4WKHA 2BOFX 3CZ8A 2H3DA 1XLMA 1FWEC 3U5YA 4JR5A 2DVXA 1XHCA 3Q94A 1GCYA 1LQ0A 2C7FA 3I6EA 2X16A 3LCLA 4XSMA 4EACA 4JY8A 4G7FA 4TIMA 4TUFA 2X0YA 3CO8A 5JH1A 1CENA 3OVRA 3WDQA 3OLEA 2PPGA 3APTA 3QFEA 1WCGA 1OG0A 4R7WA 4QISA 1XIMA 4DUVA 5BXPA 3WLMA 1AZ2A 3BE7A 2XINA 2ZXDA 4NZJA 5E6YA 4IPIA 1GW9A 4OZOA 4UNLA 2OYKA 1PHWA 2O9OA 4O0KA 4EE9A 3PAJA 5CKSA 1W8SA 4AZ6A 3E2RA 2NXIA 4CVUA 5CSSA 3LM3A 1OD8A 2C3ZA 3GXIA 4C91A 4H6RA 4HSHA 2NW0A 2GDUA 3ZIZA 1Q85A 2CESA 3UEQA 2WLZA 2IPGA 5FI8A 3ONBA 5AHMA 1UOZA 1R3RA 2PFHA 4B4HA 2P76A 1SFLA 1UP3A 5HXMA 4WCJA 3NDYA 1TJ2A 4N4PA 3QN3A 1RA0A 5A5WA 5G5HB 2BC1A 2BS9A 3GVWA 1V0MA 3S5NA 2AOSA 2EPHA 4P8XA 1YE6A 3VE9A 4CQBA 1R3SA 2CLEA 4UFHA 3GHSA 1I4NA 1JUBA 5A8QA 3VI2A 1XBVA 2A6NA 3CS2A 3WQVA 4E2DA 3B8SA 3LMYA 4V1YA 1NDAA 2O4MA 4GISA 1LLWA 3HPXA 1J93A 3UETA 1ZAIA 4M8UA 1VFUA 3SCTA 1EF2A 4IP7A 4W7WA 3BGGA 1ZK7A 1ONEA 1Y65A 4C6EA 4RDYA 4GKLA 3WUGA 1PAMA 3WLIA 4JTGA 3WH6A 4XZNX 2JKEA 3KWXA 3G3DA 4H4VA 1LLOA 3HPAA 3BAJA 1TR1A 3ANVA 4DWDA 3AHVA 3CEUA 4DZ5A 4Z0JA 2EQ6A 3SIMA 4Q8OA 3GC5A 4GCAA 4E4FA 3LSCA 5D09A 1SYTA 5I3JA 2EG8A 3GU1A 3NS1B 2Z1SA 1ENUA 4Q8MA 1LF1A 4GGHA 3RJXA 2WVSA 4B4FA 3NVWB 2ZDSA 5C9UA 3FGCB 1EJXC 2E6AA 1TA3A 1YIXA 4QQ3A 5F4WA 2X8CA 3W26A 3GNRA 1UPPA 4BR1A 2A3HA 8RUCA 5BMXA 5KITA 4WY0A 4LALA 1TJRA 3WDPP 1CW2A 1XLAA 4AW7A 2TRSA 4WDXA 3W81A 2IPWA 3E02A 5KSWA 2FPVA 1JVNA 4A8IA 3S42A 5JCNA 1RCQA 2FDSA 1QPQA 1JDCA 3B04A 3KBWA 4IIGA 4DUXA 3PULA 1OX4B 1OGGA 2OJPA 2W63A 4LYQA 3ZVHB 5HPCA 2WMJA 1D3CA 1X98A 4NAFA 1J01A 4NJKA 1V97A 2WZHA 3QHNA 1M65A 2DZWA 1F3EA 2Y5JA 3TW7A 4PCNA 5A6SA 4L7ZA 4F0RA 1XSJA 3TJXA 2DSUA 2OT1A 1JDDA 2AGTA 1EEXA 5GNZA 1Q4NX 4K8HA 2PDIA 1QWGA 2FZ8A 1ONFA 3EA3A 1E43A 3CQIA 2IPFA 3KAOA 3E2QA 1I6NA 5DANA 3WEMA 2QVHA 2ZZ7A 3TYUA 3MI6A 3GXFA 1YQZA 4O11A 2WBGA 3GRIA 4RUBA 1W3JA 2DU2A 1E0XA 2V5DA 4HBKA 3N9SA 1D7YA 4M81A 4GWEA 1O5RA 3NL3A 4BS0A 4BURA 1N82A 3RG6A 3TK7A 2RDXA 2GGHA 4BI7A 1R3YA 3IC9A 3CIVA 4XKYB 3BG9A 4DRSA 1HO4A 2Y63A 4GQRA 3UWEA 1DP0A 3WBEA 2G3NA 1KM2A 3LHTA 3FAXA 3UWVA 4BEQA 2O92A 3EOOA 4MUPA 2ZADA 3RNMA 3ZWSA 3CJPA 1E5JA 4Y9PA 3CK5A 3G22A 4M6UA 2HWGA 2QCHA 4WIWA 3CAVA 1FWDC 1XSIA 2W3SA 5KVHA 1Q1WA 4K8GA 4V28A 2WVTA 1JEZA 3BZGA 1YKWA 1TPFA 2FFIA 1BLIA 5H8PA 4J3ZA 3SY8A 1HJQA 4HHHA 5T9BG 5CJ5A 1UD2A 2X09A 3BAWA 5LKYA 1C9DA 5CBBA 2VC6A 1OG6A 5DT7A 1KFWA 1GJPA 1XYZA 2ZC1A 8A3HA 4XZIA 1L6YA 1G0CA 1E9ZB 2QPXA 1RVKA 5TF0A 4MNMA 2Q02A 3ZR6A 3NTYA 2ZUWA 4ZGYA 1R6WA 4FNUA 1OHLA 4LBRA 4HK5A 4KCUA 1N8IA 2BG5A 4C6FA 1MUWA 1P0DA 4ATDA 2VFDA 4HTYA 2RGLA 3OHIA 4YU1A 1F8MA 3YPIA 3AWOA 3CUJA 2FVMA 1WXYA 5M2FX 3SCNA 3QMRA 4C6BA 2YQUA 3PHAA 4QNWA 6CGTA 4QQUA 2BGSA 5H6HA 3O1NA 4EQSA 4DO7A 3M1ZA 5CGMA 1O95A 1A4LA 1XH2A 1N55A 1R9ZA 3BSMA 4WHBA 2CEQA 3PZQA 1OX5A 2YGYA 3WD0A 2PBOA 5GVJA 3AU2A 1J96A 4I90A 1ITCA 3LHZA 4D72A 3C56A 1NVMA 3PC0A 1UZDA 4OKDA 1JD9A 1TUXA 1ECQA 1S5NA 1XYLA 1XWYA 4JZ5A 4A29A 1ZJHA 4MKVA 3EOLA 2VMFA 1XBXA 1KV5A 2QXWA 3UXIA 3C3UA 4BQ4A 4AD0A 3TA6A 3A5FA 1TV8A 3B9EA 2ATMA 1V6YA 5T26A 4LVBA 2A5HA 1RJPA 2WMIA 4V15A 2GR1A 4R9XA 1AJ0A 1ONXA 3G1FA 3WZ0E 1WO2A 3O2LA 2J88A 4IT1A 3DOPA 2E25A 4RDVA 3SN4A 3SQSA 3VGFA 1H0GA 2YJQA 2QUVA 2F84A 1AJZA 2BY2A 3HGRA 5D2XA 3OLDA 1ONRA 3RLHA 1I45A 3AISA 3IS4A 4D6HA 3LENA 3W53A 2CZEA 2UWFA 4AD1A 4LCRA 5D9NA 3WQWA 2BY1A 3SZ8A 1OFAA 3NL6A 3W27A 3UESA 4NI8A 2EPNA 2QCMA 1VBRA 2P3ZA 3M0YA 3C2VA 5HJLA 1H60A 5EMLA 5DMLA 1R47A 4YVXA 4HZ7A 2J62A 3EX3A 3SCWA 2ZWZA 2WM0A 3SO7A 2WNQA 3BCFA 3TW9A 1CT5A 3L4YA 1FWGC 1F2JA 3AHTA 3VKKA 5JBFA 1KWGA 4MWAE 3K8KA 5REQA 1AUSL 1XYCA 2Y1HA 5DY2A 3ITYA 5FEXA 2IQ0A 3KFTA 1L2UA 3VOGA 2VEIA 1S2TA 4PUMA 1Q8AA 2VOTA 3G1DA 1GT8A 2PTDA 4AHQA 4G7EA 4YJ5A 1UQYA 1L6GA 1ZXIC 2CFYA 3IARA 4ZO8A 1H7NA 3TXVA 3CUZA 2Y6ZA 1MO0A 4WJXA 3T6CA 1IXNA 3PWIA 1XYFA 4N2YA 3W3OA 1OINA 4CGTA 2INZA 1NWUA 3W1XA 1UC4A 4XZLX 3SADA 5CGTA 1ZZMA 4QGCA 5HNRA 1X38A 2VUNA 2C0HA 3H7RA 2ALRA 3GC4A 3QV6A 3EKLA 3LZ5A 4PTVA 3EAUA 2F5ZA 3MQTA 3IAQA 4CQCA 3Q2DA 5CBJA 1IT7A 2VJXA 1F3XA 3QV8A 4I6VA 1VQTA 4WXZA 4ICCX 5AZ0A 1MEWA 1LL7A 5D9OA 4IQEA 1M41A 2GJRA 3DHUA 1PEZA 3KDOA 2P8CA 3UERA 2QCDB 4MKNA 1F5ZA 1EC8A 4U4MA 1TMLA 2J6VA 1PTGA 2DZSA 3P2VA 4J3VA 1BEUA 1DVJA 4JYFA 3QFBA 3CMFA 1B9BA 1OM0A 3NNTA 1ITQA 3K1GA 4XX6A 1K8YA 1I2NA 1JYVA 5HOSA 4K7YA 1Q65A 3USBA 3K46A 3TCSA 1FHVA 3W1NA 4RDZA 4I7UA 3BAIA 5D30A 5FEZA 3UY7A 4QSHA 3UCQA 4Y9NA 4IJBA 2XFWA 4WOQA 3H70A 1TTQA 5HNUA 4ERAA 4FOJA 3GM8A 2GVEA 2G0WA 4LAZA 1CGTA 2OSYA 4CU8A 3E12A 3O05A 4IMEA 3N14A 1UKTA 1XYAA 4NJIA 2VT0A 3CWOX 1WP6A 3BSHA 2NUWA 1XUUA 4XD4A 5D33A 1GK8A 3HMCA 1JRBA 3KTCA 3LXBA 3A12A 5FJIA 2WNNA 1TYTA 3MKVA 4E8DA 1YX1A 1K9DA 3DBPA 3DFTA 3IIXA 4DF2A 3BL3A 4AVOA 3GRSA 3C8NA 1WDDA 3AS2A 3LHUA 3GNPA 5IBXC 3GK0A 3KCOA 4DVOA 3H2AA 3Q45A 3QYQA 1J2BA 3RX3A 4Q4OA 1PYMA 4K36A 5FAJA 2PTWA 4PB3A 1X97A 2FQIA 4L1WA 1V7YA 4ZSTA 3H53A 1TE1A 4UTJA 4QSFA 4HNOA 3I10A 2ZXAA 2CCRA 3QY7A 2A3LA 1ZY9A 2PI6A 3HJZA 3FGCA 4HNTA 2NQZA 4ZODA 4Q8PA 2P1FA 1DWAM 2GJNA 4DO6A 4JEQA 3LA4A 3KZSA 2ZUMA 4DBEA 4J1OA 4PRRA 1NARA 4GGBA 2WJZA 2VYOA 1FVPA 3T05A 4DNHA 2OODA 2WBKA 3ZQ9A 2CERA 2Q8XA 3W02A 3VD4A 3PPFA 4K3ZA 2TYSA 3IIOA 3N34A 3EWDA 1XLJA 2OEMA 4IMDA 1QHZA 1SFSA 1OX4A 4HU3A 5LIUX 4MY8A 3WJXA 3PZUA 4YTSA 1CX9A 4BCEA 1VCVA 1NOFA 4TV5A 2YVFA 1KGWA 4OWGA 3LCHA 5I3HA 1OFEA 4I6KA 4NSBA 4BF5A 5BOOA 4XO6A 1GJUA 3BXWA 2XISA 1ZUAX 1L8NA 3VKCA 4Q33A 2H90A 3QVQA 4KGJA 4YYFA 5JBEA 4KEMA 4M0XA 1GOKA 2J78A 1W1ZA 3H8AA 3VE7A 3WKZA 1UWSA 4W8BA 2Q3RA 1W5QA 3OVQA 1W9PA 2PLMA 4B9YA 3MHFA 3VOCA 1OFBA 1IQ8A 5I78A 1ZDLA 4DF1A 1OEPA 1LL4A 4W88A 4H9TA 2OO0A 2DUXA 4EQRA 1NOWA 3VIMA 1S2CA 5CG0A 2Z2BA 2ZUSA 1ESWA 1W0MA 5IM51 1RBLA 2GQ9A 5DFAA 1OADA 1GEQA 3UXLA 2I5IA 3G0UA 1VHCA 2NT0A 4RX0A 2ZFAA 2XJ7A 2JF6A 1W1VA 2YA0A 1PTDA 3CGEA 2F6KA 3TN5A 4FXSA 4H7ZA 4AHOA 4JN7A 2EKCA 4Y2WA 1GZ1A 2OWXA 1AD1A 3H24A 3DC0A 3W6LA 4UR8A 2F8QA 2FLIA 3P7YA 2HSAA 1DJYA 2BWGA 9XIMA 4IM4A 2YAUA 1LQ2A 1OK4A 3LLXA 3EWWA 4HJFA 5FOOA 3R1ZA 1KFCA 2CHRA 2VGGA 4LH8A 4PMUA 5I3KA 4PC8A 1DJIA 5HPOA 4KW2A 1OYBA 3G2GA 2FZMA 4H8VA 3NEHA 2J13A 3NQVA 1GG1A 3WBXA 5HUPA 4UTLA 1OZQA 3MY9A 5IBXA 3NQBA 4U2YA 4DJDD 1FRBA 3MDUA 4H7VA 2BY0A 2Y62A 3C2EA 3GTHA 1YNPA 1E5NA 2BB0A 1JPKA 3WMSA 5DELA 2A79A 4DELA 1EOKA 4ES4A 2NV1A 1MW2A 4XKMA 3PTQA 4UTMA 4PBFA 4LRTA 2PDFA 2W91A 3DHPA 3WK1A 5XIAA 4F79A 2QNEA 4GLEA 4XV0A 5K4XA 2OZTA 4PRTA 4L64A 4ONVA 3QZ6A 1F7BA 2WV8A 3RCYA 2NPXA 4R3UA 4ZQRA 4LF1A 2Y85A 2E40A 1UP2A 2WLYA 1TWSA 4CCCA 2OSWA 4JD4A 4UIOA 1VEMA 1K02A 5C8BB 3MHGA 4GH1A 3P60A 2X7VA 1SR0A 3AMZA 5AYXA 4ZFCA 3AUJA 5H8UA 1V93A 1YDNA 1TPC1 3W01A 2I1OA 3ZFHA 4NJHA 2WWDA 2GZXA 1BVNP 3LTPA 3N2OA 1MZRA 3OO2A 1QHOA 3GD4A 1Z41A 1PIFA 4R9OA 5EYWA 2BVWA 3BH4A 3LB8A 4IF2A 3B0PA 1TX2A 2WOQA 4JQAA 4BK9A 3T2QA 2FKPA 3PPHA 1R30A 3CGCA 1Q6FA 3U4AA 1CGUA 2VELA 3TP4A 2WCSA 1TELA 2WVVB 5K7JA 3OLGA 3GB6A 3A24A 5XIMA 2JFEX 4LCQA 3EA1A 2NUYA 4QIUA 4BI6A 2VXNA 4US6A 1HKKA 5TR3A 2Y88A 1GORA 4IPNB 1OC5A 3K13A 3E0LA 4IQLA 2ZX6A 4KS0A 4LS2A 2J6XA 3Q37A 3ARWA 3E96A 1NFBA 2VOMA 2ZA1A 3CV6A 1EX1A 1OCBA 4UNIA 1TYPA 1B4EA 4UOJA 3W00A 4IIBA 4JIQA 3MCNA 2EPMX 2XIQA 4KIRA 1UA3A 3VNJA 3L66A 1Z9AA 1EF3A 3ZS4A 3SJ3A 3GD6A 4XD5A 1G01A 3AI0A 4KRUA 5AVHA 1L0PA 3SIZA 4CQ8A 1K7EA 3UFYA 1EUAA 5HINA 4H1ZA 2W61A 2WVUA 3MSGA 2ZZ2A 3GQYA 4EIVA 1UJPA 3RR1A 1BTCA 3WH5A 5C2CA 4PCFA 1EYEA 1TZ9A 2DJXA 1E1FA 3DCPA 3SFKA 2ATSA 3CGTA 3G24A 3TNBA 3E0IA 3W37A 1DIDA 1ZKQA 1O1ZA 3AHZA 2C1GA 5I3DA 4ZQOA 3UR8A 1VLIA 3IV3A 3GZAA 1DBTA 3TYDA 2YLLA 4CQAA 2DDXA 1JQXA 4RV3A 1AVAA 5HWNA 1CGVA 1FKXA 1XBZA 5CPLA 3BAKA 3UR5A 3B8WA 3JZUA 4ZXOA 1N2VA 3H21A 3VO0A 3CGBA 2DIJA 2NWRA 4S2CA 4URIA 3RM9A 4MJMA 4R34A 1L6FA 1QO2A 1H11A 4WZHA 4K8DA 3GVQA 5LYRA 3WQ8A 3VVGA 4AB4A 3MSDA 3WFZA 4G1NA 3BTNA 4ROPA 4MVAA 4H4ZA 3KRZA 5C5YA 1TE6A 3VNZA 1ZJIA 4W89A 4MG4A 1SUXA 3HGJA 4AIEA 4HYWA 1RP8A 4NT0A 4PGLA 2ZWYA 5G4HC 2ODOA 2PDBA 1E15A 4ORMA 2VRJA 1MNZA 1R0MA 1BF6A 5HJXA 4Y8FA 1V02A 1KA9F 4H4TA 5GRTA 2V6AA 5M5DA 1JCJA 1SSDA 3O07A 5BRQA 1SPQA 4GQQA 3EPMA 3VUSA 3KM8A 2CW6A 2FVKA 3SUWA 4N6EA 4NX5A 1ZAHA 2PWHA 1UP0A 1SZFA 3N6HA 3VD9A 3QHOA 3HG3A 2WSRA 3CV2A 1IT0A 1IWPA 3H55A 2ZZCA 1BYBA 3CQHA 4PB4A 4EANA 3DH9A 2GSJA 1WOBA 3F4WA 3WJYA 3R10A 3NSMA 5A2AA 3NXLA 3CPRA 3FIGA 3LTSA 4LYKA 4YXGA 1F05A 3IWPA 5CZSA 4AZIA 3UGRA 1JEHA 1HF6A 1C92A 3M9YA 4JTTA 1TX0A 4GNKB 3NA8A 3M0VA 3WDHA 3PPGA 2HK0A 1FWJC 3GFXA 4HZ8A 5J5DA 2C18A 4W93A 2Q8ZA 5KINA 3ERPA 1DOSA 1HW6A 1TWWA 4PCSA 4NEWA 5JCLA 1QAPA 3BG3A 3QV7A 1UWAA 3UWQA 1F3WA 2OPJA 3A4WA 1H5VA 4JTCA 3W1QA 1M7XA 2B0MA 3M5XA 2Y2WA 1XLCA 1I1WA 4ZENA 5HNNA 1BSLA 4O53A 1ISVA 1T8XA 3MUAA 3NZQA 4WX2A 2W55A 1YQ2A 3BAXA 3GIYA 1W3TA 1MQRA 3OOQA 4KCWA 3BPWA 2A3BA 4TMCA 4PUKA 3WDIA 1F9CA 1X6NA 4H2HA 4A3QA 1P43A 3TROA 1A5BA 1LZOA 1DJGA 3URAA 5A6BD 3TC3A 3A22A 1V6WA 1G6CA 5DF0A 4GR1A 5FESA 4F4RA 4E8CA 1KRBC 3FA3A 4RNHA 3DJJA 1E6RA 2JE8A 3UJSA 4IUGA 5E5CA 4AY8A 4F66A 3RU6A 3PY2A 4L1XA 4RW3A 4GVFA 4HA1A 1US2A 3KBNA 4I7WA 4EPBC 3NQMA 4JHMA 4FSAA 3ONCA 2R1KA 3BANA 1PHQA 3DN5A 3WF2A 5C71A 4JQ3A 4LXFA 1QNOA 2CHOA 4YL2A 2UV8G 1QW7A 3VNKA 1XS2A 4J7RA 5FF0A 1E3XA 5IFPA 5M03A 1BQGA 1H51A 5LIKX 3KXQA 2B81A 4KPRA 3CQKA 2XVGA 1G4EA 4CCEA 2CYGA 3W38A 3W7MA 1DORA 4P8VA 1DNCA 1Q3NA 2VRQA 4MWAD 2PB1A 3PF3A 4UXDA 1U1JA 1MZHA 3DFNA 1LRTA 1H3GA 3VAVA 2J9XA 2WSQA 1MXDA 2OX4A 4E3TA 1XIIA 4HA4A 3MMTA 4P7NA 2CITA 2WXDM 2Z1KA 1Q2RA 1ALDA 3LSBA 2DIEA 3GDBA 4EX4A 4ZO9A 4MZ8A 1UBPC 4WRHA 2J24A 1OX6A 2Y7DA 1EHAA 1MEHA 4N4QA 1EO7A 4EWJA 3S2LA 2XG9A 2PLJA 1FH9A 1GOMA 1DJHA 4N42A 2XGIA 2GGEA 1XC6A 2QCNA 4OJYA 3VKDA 1LT8A 4P8WA 3RPDA 3NM1A 2RKXA 3FK4A 4LB3A 1TPB1 4S3CA 4IQDA 1DWJM 3D47A 4ALDA 4E2VA 2DZXA 1EIXA 3CL6A 4AQLA 3RO6A 1EJVC 3MI2A 2VGIA 3THUA 2A0NA 2W92A 4MJ4A 4GG9A 4HTBA 3FA5A 2XTKA 4KBXA 4A8RA 2NLIA 1LTDA 2GSEA 1NH6A 1GEHA 4QR6A 3T08A 4AXNA 1BFNA 1GQJA 2Z1XA 2VZUA 4D6CA 4KGLA 1PIGA 5I09A 1T99A 4DBUA 4AYGA 3GRTA 3CTLA 2A3AA 1CI1A 5EMYA 1EQPA 3IJLA 1RD5A 2BDQA 2DEPA 4NQ1A 1RPKA 1WA3A 1B57A 3L9CA 1XANA 3W24A 4OVXA 5AVNA 5C6MA 3EPNA 3UJFA 5K2ZA 4FDCB 2Q6ZA 4JTFA 3V4BA 1XBYA 5LNSA 3JUGA 1GHRA 1PSCA 3WY1A 4RE3A 1G67A 2AQWA 1BSIA 4DPPA 1J5TA 3MS8A 4RE4A 1Y8BA 4MZ1A 4RZ6A 3OGSA 3PNZA 3K30A 3E74A 1U5JA 4O1DA 2P0IA 4O52A 3BO9A 4W8AA 3NGJA 4TX8A 2YCEA 1M6IA 2IQDA 3NUKA 2PTZA 2ZZ0A 3N29A 1UWIA 5G2IA 4ZXLA 4QTGA 1WZKA 1OFPA 4Y90A 4CCZA 2RABA 2BXZA 3G1YA 1E4IA 3LCFA 4FS9A 1P6CA 4EPEC 5E6ZA 2OLHA 4QDPA 4LSBA 1JPIA 2WSKA 1VGAA 3STFA 1YE4A 4UZSA 3M47A 3ZZ1A 2O7QA 2H8XA 5K9DA 4FXRA 4NILA 3OBAA 2WVVA 3PB2A 3VGHA 2CBIA 3AIUA 3AIQA 1N61C 1HG3A 4D1JA 3B0YA 1WKDA 1Y0EA 2F6UA 3VGBA 3C61A 4B16A 3T55A 2E4TA 1M1BA 3UBPC 3VGGA 1AL8A 4HOZA 2W0UA 5I6SA 1NF7A 2WHMA 3VZZA 3SDOA 2R82A 3IJDA 3VMNA 4LWWA 3WJZA 3KVLA 1K1DA 5J8LA 1FWWA 1HL2A 4Y7EA 3OC4A 1PKMA 2VFFA 4MJZA 5H1WA 1S5TA 1BD0A 3CZGA 3T0BA 1JRPA 1GQIA 2PDGA 2DQXA 4L56A 1XRVA 3MYOA 5A1AA 5AB3A 3CUFA 2E3ZA 2VZTA 4O13A 4OQVA 1YHTA 2QUUA 1PIIA 3NM3A 1UKPA 3KWSA 1XGZA 5CG7A 1D9EA 4XD6A 3DERA 1LUCB 2YXXA 1NELA 3I3DA 3MO7A 3QBUA 3R0KA 5AHEA 4IGSA 5DBUA 1FA2A 1TVPA 3WLQA 4FHAA 1ISYA 4NG3A 5C9RA 2DIKA 3C2FA 3VKBA 3ABSA 3M0JA 2J7HA 4YTTA 3VUPA 2NVAA 4M3PA 3VD3A 5AECA 1SJBA 2HMCA 4E3VA 4EPKA 3A4AA 2Y7GA 5LHFA 3WJSA 2VGFA 1SJDA 4DPQA 2C0AA 1R3WA 2PLCA 1T8QA 3GXMA 5AHFA 1W5MA 3BARA 5LA1A 5FS6A 3PNUA 5D9MA 1HTIA 3LXAA 4NZFA 3WLRA 3WLLA 1J4EA 3HV8A 5F2LA 1A80A 2C16A 4AX7A 1TIMA 3V3WA 1LORA 3DXIA 1LG2A 2HJPA 4BKNA 3MO4A 1EZ2A 2BSLA 2GOUA 4UQ9A 1TO3A 2X8RA 3LQLA 4JTLA 5SWUA 5FF7A 1OSEA 2ACUA 2HPIA 1ADSA 1F6YA 2AQVA 4LS1A 2VCBA 3WQDA 5G4EA 4R33A 4GABA 1O6IA 1CB2A 4C7FA 2E7FA 1XLDA 1JCNA 3W7EA 1RQBA 2PWUA 3LHYA 5CC7A 1FIQB 1FCVA 4Q4MA 3QEZA 4NYUA 3TYEA 4WK9A 3SSZA 2D0HA 1J9YA 2TMDA 5DLCA 3WH9A 2GWGA 3BMVA 3AQUA 5I3GA 4APNA 3ZT6A 3SCRA 2IQTA 1TRIA 2BBFA 5D37A 4TVYA 5D38A 4LCSA 3CWHA 2KAUC 3F1QA 3TR9A 4U3CA 4QAIA 1QI3A 3H22A 2POTA 3CAWA 2A4AA 3AMGA 4OOZA 3MYPA 4B3ZA 1QI5A 3T42A 4AVNA 3T0CA 5BRBA 2FGLA 4XTIA 1R7OA 4UQDA 1XLHA 3OTRA 2HROA 1VQZA 3WQ6A 4J3SA 3SW6A 2WW5A 4ADUA 1TV2A 3KOFA 3EWXA 3GU2A 4DJDC 2WJFA 1CIUA 3LLDA 5HBFA 1GKPA 2R14A 2VZSA 1VC4A 1ZJAA 5BROA 2CLLA 1R9YA 2OMAA 5IOBA 1W1A1 4HMCA 4WJEA 1VCGA 3QY6A 4GUJA 2WYSA 4FB7A 4NAEB 5CLWA 2YZ5A 1E6SM 1V6UA 4AIUA 1EC7A 3MHUA 4KWUA 1KGXA 4GZJA 4HNLA 3GYEA 3C5QA 3FNDA 5JVLA 3R58A 3H2OA 3GBDA 2WZEA 4GH3A 2E3TA 1BVWA 4FNRA 4QBXA 4GCXA 1OFQA 3U5UA 4JNZA 3VZYA 4LEQA 1ZB5A 4E2OA 2ISFA 3TSBA 5C70A 2GLKA 2BCPA 1XIGA 2AQOA 4P61A 3L0GA 1TZZA 2OZ3A 4GX8A 3AXHA 1B2YA 6PTDA 4WF7A 3VIIA 1OZMA 1NF0A 5EY5A 4PFHA 1F3TA 2CXEA 1WQ5A 1XLFA 1ZBCA 4U3AA 3LCGA 1KCLA 1E0UA 5L6UA 3GYCA 2TAAA 4L9ZA 1XC4A 3QV9A 1EX5A 2ADAA 1POJA 1A5UA 2MNRA 3LCWA 3DG6A 3MJMA 2V5CA 3C8FA 3HBLA 3P8JA 1DWIM 4EOUA 7ODCA 1SW7A 3IK4A 1BGAA 3NAVA 4MWAB 4M6VA 5KTLA 1MFUA 2J66A 2GYIA 3O6YX 2VR5A 3V5OA 3TC7A 3OPSA 2ZRVA 1KXQA 4MOZA 2Y7FA 3PTDA 1E6QM 3TONA 1W8GA 1FP8A 4F3HA 2ZUTA 4G9PA 3A21A 1I8JA 3QR3A 5EBAA 2QKFA 3D6NA 1GXFA 3L12A 5DY3A 2HBXA 1ZGDA 4Q8NA 2EKGA 4RE2A 2VR2A 3UCCA 2WP5A 2OT0A 4H9MA 2ZBTA 3E2SA 3R79A 4K7ZA 1K7FA 4YWIA 2QJIA 4KPLA 1R3QA 2BNJA 2XWDA 1R5YA 1C8YA 3P62A 2XIOA 4H8HA 4MB3A 4MPQA 2WQDA 1R8LA 4EWND 1TSIA 3CV1A 1CPUA 3E3HA 3W1TA 4C60A 2DSKA 3LOTA 4KFOA 3M64A 1H7OA 3U57A 3VOFA 4IWWA 3FKRA 1E6PA 2R1MA 3A47A 3I4KA 3U7VA 2ISDA 5HMDA 2E5AA 3G6LA 1R9XA 1QUMA 1J6PA 3IIZA 2VUYA 2QV5A 1YW1A 2HE8A 5JUVA 2YL6A 2GRTA 4DJDA 4GUIA 1KB3A 3G3MA 4DYJA 3VMOA 5E0FA 1KRMA 3GH5A 4JFWA 4PYSA 3VZXA 5CAKA 3D46A 1JCMP 2R1LA 3DYPA 3WBAA 3N2TA 3WMLA 1BRLB 1ZENA 3S4TA 1Z8AA 3K8MA 4Q6XA 3DK4A 2W3RA 1R3VA 3RUBL 4Z2JA 2VFHA 4QE1A 2V3DA 3KUMA 4H9VA 2QJGA 3VDHA 5CZKA 5EGRA 1NWSA 3EMCA 4B5XA 4QROA 4K8EA 3FVMA 4WGXA 1H09A 1V79A 7TAAA 4HK6A 3FEMA 4Q8QA 5MHBA 3WUEA 4IMFA 2NVKX 3BLLA 2EQDA 5D04C 2ABBA 4QJ1A 2ZX9A 5HMSA 5CSYA 4JIHA 2NV9A 3WQCA 4UTTC 3TZNA 1I2RA 4LA1A 5A69A 4GXWA 4ERGA 1Q66A 4C6PA 4E4UA 2EO7A 3PZOA 4XIMA 1GWJA 5CPQA 2XIMA 2QCFA 1UIPA 1Q6RA 1OCQA 4HP5A 4O4VA 5H91A 5BOEA 2PMQA 3HMJG 1GETA 5HAOA 2OKOA 2Y5EA 1GTHA 4QG8A 1BQCA 3NO3A 3B40A 5HANA 4ZMGA 4EVZA 1QOPA 2FVLA 2B4GA 1JYNA 1K9TA 3MUY1 1XIJA 3AICA 2WKGA 3TSMA 2NX9A 4IOTA 2A1YA 2VWSA 1XP3A 2V2CA 3GC2A 2X0SA 2ZXQA 4Q8VA 2ZVIA 1UROA 3M41A 3OVGA 3BVJA 4C6JA 4H6QA 4XZMX 4PMRA 1Q6EA 1R46A 1UR4A 4L9YA 3I3EA 4LFYA 1W9DM 3EGJA 4AD5A 1KFJA 4QRNA 4YMZA 2GDVA 3PN8A 3N18A 1KC7A 1UD3A 2I7GA 2ZKMX 5FS9A 3TQ0A 1HL8A 4Z2LA 2ZZ6A 4HMEA 4MDOA 3UJRA 1HIZA 3N3TA 1LRNA 3II1A 3H2FA 3WF4A 3TOPA 2G97A 3VGEA 1VLWA 1O5QA 2P0OA 3WDJA 4O50A 3S9YA 3EX2A 3OJGA 1POKA 3CB3A 2VO5A 2WPEA 1TWZA 2WO5A 4ICMA 3L5OA 2ON3A 2A6LA 1WYGA 3QLDA 3LERA 1RLDA 3P74A 4CQ9A 2YCIX 2F2HA 1YADA 1XQKA 2E9BA 3I65A 5PTDA 1AA1B 3ZM8A 4HOXA 5LNWA 4NVTA 4LW7A 4H8NA 5DXXA 1JAKA 1OABA 3FXGA 1LUCA 3KRBA 4NYYA 1GRBA 5HUOA 3NDOA 4NZ1A 1JF5A 4UR7A 3R8HA 2C8NA 3NSXA 2OZ8A 2XVKA 1RV8A 1OCNA 3OHMB 3ITCA 3HZ3A 3ATZA 4RZ5A 2V5KA 2ZUNA 3GKAA 2X7WA 7CGTA 2Q71A 5ABGA 2CLPA 4PMXA 1EBGA 3HW2A 2YA1A 3A6OA 4GC4A 4I9MA 4JCMA 4LC6A 1SQ7A 1KN0A 5D05A 4UQAA 2VHLA 3LXCA 2RHGA 1DQXA 5XINA 3V1PA 1PDZA 3CIXA 3LNMA 2R91A 4HZMA 1DXEA 4CN6A 1TIWA 1Q5MA 3V1HA 5F1VA 5JCIA 4LVDA 4AWUA 2HXUA 8TIMA 1YBQA 3TA9A 1JYWA 3N9KA 1PKYA 1K8ZA 1PO9A 1HJSA 3S5ZA 4EAMA 2OOFA 3O63A 2CZFA 1M68A 3BLOA 4IXHA 3M0IA 2YBTA 3RLUA 2QAPA 4UTTA 3LRKA 2J4GA 3AS3A 5AYIA 3WK3A 5JRBA 4IX2A 4JOMA 4XAZA 3N17A 2GR0A 1FUYA 1OC6A 3CASA 3AHXA 4MWAC 5FACA 4YS1A 1QNSA 1OC7A 2PC4A 3HN3A 4FIRA 2ZICA 4M7TA 2VTFA 3GFYA 3K1DA 3GY1A 1UYQA 3AROA 3BLKA 3L23A 3BV7A 2TSYA 3QZEA 2PDMA 3NDZA 3MMUA 2HZGA 4JTJA 2QDEA 3RXZA 2XU2A 1YXCA 5I2UA 3W74A 2FJUB 3HRDC 3MUIA 4PUWA 5DQPA 5I0DA 2D20A 3GTNA 1GVIA 3PBGA 1XLIA 2X8HA 4Y9AA 3WLTA 4G56A 2GH5A 4OTKA 2E09A 3W2LA 3M0HA 1S2VA 3T7VA 3IGXA 3INPA 1KBBA 2J9ZA 1JDAA 3LV5A 5E70A 3E5PA 3WJWA 1Y5XA 2OYLA 1WNOA 5EL1A 3HQOA 1B3YA 5CJMA 4TOQA 1A5AA 3EAOA 3IJIA 4BI5A 2WMFA 4DNAA 4DQWA 1FHLA 1JI1A 2XZ9A 4DX3A 1VJSA 4FK9A 3NPUA 5IXEA 1C8QA 2HRWA 4FX6M 4HPHA 3T0DA 2DZTA 3GSMA 3H2MA 2QAEA 3N4FA 3I3BA 3NQ6A 1TRDA 4LOCA 1FEBA 1DWGM 4GFIA 1FWNA 3U9IA 2CDUA 1O1HA 1TA3B 4GXPA 1U33A 2J7EA 1O60A 1J2WA 3DFPA 1IWBA 3U2CA 3MA8A 4CNSA 3EWBX 4NAEA 2Z6IA 1I2QA 4H4PA 1F61A 3M0LA 4QFUA 1WDRA 6TAAA 1GVRA 1GZGA 3T0AA 1XKYA 4LUYA 4J3XA 1W2VA 2ZRWA 4PMDA 5EB8A 3EDFA 2PP1A 5A6BA 1EP1A 3GR4A 3AYVA 2Y8UA 4NEVA 4E5TA 1XFBA 2ZXBA 1OY0A 3EB2A 4F0HA 1VD6A 1FBAA 2WZMA 1M5WA 4KEZA 3NWRA 1RUSA 1VH7A 3KX6A 1M7JA 3QMTA 4EPDC 4C5YA 1J8VA 3GS6A 5LNUA 5HQEA 4OT7A 2QMKA 4XAFA 4NNBA 3WG6A 1O7AA 4FNSA 1VS1A 1LG1A 1XYMA 4DY1A 3EUB3 4JKKA 1JCXA 2YLAA 4L4OA 1GW1A 1TR9A 3FCPA 4K68A 3C3NA 5A8GA 3KRUA 1M04A 4NZ4A 4HHPA 1T7LA 3CMJA 4YTUA 4JHZA 3WMBA 3JR2A 4UNKA 2QF8A 3AIEA 4AEFA 4QLLA 3QFAA 3S5SA 4KWOA 4UTUA 1A53A 2A21A 3B4UA 4EM4A 4DZAA 1HT6A 3TV8A 3H2CA 4MWAA 3SN1A 1PDYA 1J0HA 3OB8A 1HGYA 3PBWA 2W67A 3EKGA 5A2CA 2CIPA 3GAKA 3PUGA 3EB3A 4MLJA 4AY7A 1X39A 1FDZA 2EQ9A 1GQLA 3ABZA 3NOEA 1WV2A 1W17A 2R9RA 5C9ZA 3UD6A 5CXPA 2PCEA 1UWQA 3ZO9A 1VENA 2P3EA 1R87A 3DGBA 1PYFA 4Y8EA 3UWWA 4PH6A 1R2SA 2O0TA 4REQB 2VNCA 2DORA 2P5NA 2B7NA 2QF7A 1KCXA 4GJ1A 4IMAA 2ACQA 1RBOB 1HKVA 4O10A 4JIIX 3SCSA 3PZTA 1J5SA 2QYGA 1KM4A 3ARUA 3W85A 1KCKA 3B05A 1WXJA 3F7JA 4Q6JA 4FIQA 4M24A 3SCPA 1S1RA 1KR0A 3EB4A 1R38A 1JCTA 5TIMA 5ECVA 4O8RA 4AY1A 3HB9A 4K1GA 1EUNA 3BURA 1VRDA 2HCVA 3K8LA 1UUQA 1V6XA 1DQWA 5AFDA 3KLJA 3RN6A 4OE7A 4ML4A 5HQLA 3WQPA 4PB5A 4D8LA 2HNEA 2DT3A 4C6DA 1G4PA 3GXDA 3EWCA 2G3IA 1HKJA 2Z29A 1BRLA 3O6CA 2X1IA 2D0GA 1WKYA 2F61A 3CQJA 3H4KA 2HQAA 3QXBA 3LN3A 5C7VA 4PTXA 3G1XA 3WF3A 1ML1A 2GUYA 2GVGA 5CLTA 4UQEA 2V2DA 3W2MA 1QVBA 4L4PA 3PK7A 4ROQA 2Y70A 1M6JA 1XCWA 5CJNA 3BG5A 1XCFA 4UB9A 1UC5A 4RZ4A 3CTTA 4IQJA 4Q7IA 1VKFA 1SZEA 3W84A 1BAGA 3NRZB 3I6RA 5IFTA 4YIWA 5DX7A 2ACSA 1HX0A 2NX1A 3H2NA 5E9AA 3L2LA 4C7GA 3W1RA 4MLRA 1SJCA 4QS6A 4F2TA 1QASA 4W9TA 3ZXWA 2JF7A 2QJHA 2WMIB 1KFKA 1Z32X 2QIIA 5CSUA 5U1OA 3E0FA 1YEYA 1FY6A 3MVIA 3WH8A 2VDHA 2WC3A 3VILA 1STZA 5HK4A 3QPZA 3QPYA 1BXBA 3WBYA 3FYOA 3RF9A 2R1PA 1UKOA 4LVGA 3EX1A 3ATYA 4P7RA 3GW0A 5G2WA 2CXGA 4EXBA 1UZ1A 1GKRA 2QUNA 2HV5A 1CXFA 3DX5A 3FDGA 1P4CA 4XUYA 3P14A 2CLHA 1DJNA 4X2RA 1UR0A 1EJ7L 4HVXA 2XFFA 3VXGA 4KIEA 1YTEA 5FJJA 2WBAA 1GZJA 2CU0A 5A6AA 5JH2A 3PM6A 4F2BA 1KFEA 3MMWA 3VCCA 1BTMA 1B54A 4RL3A 1CNVA 3GZ3A 1K9EA 4HNVA 4NNCA 1H1YA 3WH7A 4PCPA 2CKSA 1K8CA 4M29A 3Q65A 1CXHA 5D8ZA 3ITVA 2A7PA 1LT7A 1UR2A 2CZ5A 1XW8A 1ZP4A 4GBUA 1S46A 2C15A 2B7PA 4ZB2A 3G5EA 4IUOA 4JTHA 1AQFA 4IIHA 4B2DD 2WPBA 1BYAA 1BWVA 3BMWA 4LRSA 4WEVX 1YTKA 3VIGA 1DWFM 1P7TB 4AZCB 4A3YA 1IXOA 3CL7A 1BYDA 4ATWA 3LNPA 4CNNA 1L9WA 1ZBVA 1AQ0A 5U4NA 2A2IA 2V2HA 2X40A 4KFNA 4KWWA 3M0XA 4NZ3A 4M6QA 4XB3A 1GVOA 3Q67A 2HS6A 1MDLA 4YVPA 4Q8TA 4J28A 2PS2A 3RDKA 4PUJA 3PUOA 3WLPA 4MF4A 2NSOA 2IKIA 3PUDA 3CUGA 1DTUA 3U4FA 4X2PA 2CZVA 3T8LA 1VP5A 3IIPA 3VKAA 3V18A 4Q7BA 3EWYA 3TR2A 2EJAA 3N2CA 2DSVA 4RLIA 5C9WA 1FWTA 4KWVA 3SUTA 3NEVA 1R86A 5CZJA 1PZ0A 3AS1A 2EGZA 3QPEA 4CU7A 2PWGA 4A8NA 2AAAA 3LXDA 1GVSA 2WMGA 4OHQA 4X9YA 4KRTA 4YYCA 2J3NA 2AL1A 2YR1A 1F8WA 4JIPA 4AF0B 1J0YA 1N8FA 4YNGA 4U33A 1PVNA 3PJUA 3GDKA 5DCBA 4WOZA 1CGWA 3GH7A 2X1TA 1QNQA 2TPRA 4HT3A 2O9RA 3VD5A 2BASA 4D71A 3MV01 4R88A 3MTWA 1DXIA 3G1RA 2YX0A 4TVUA 1D2KA 4DNMA 3UVAA 2GJPA 2GL5A 4LY4A 5AOUA 3F4NA 1LBLA 3ARYA 1HJUA 1EC9A 1NJJA 3KVMA 4KT2A 3BW2A 1T96A 4NJJA 2NQ5A 5EBKA 1QXLA 2PDXA 3WUFA 4AZ5A 3TLQA 1UD8A 1CZ1A 3AFBA 1K77A 5LA0A 3O3RA 4D1IA 1MDRA 2Z26A 3L4ZA 2YOCA 3NO1A 2ZRZA 4A2SA 4XQ6A 3UW6A 5HWJA 5G5GB 3STPA 1O4UA 1S2UA 2DJLA 1FWFC 3NVVB 2QMJA 1RSCA 1JL8A 2WNZA 2Z1BA 3RM8A 4YVVA 3PS7A 3FDKA 8CGTA 3B8TA 4ADSA 1HQTA 1FDJA 4L6OA 1OWQA 3LLFA 3H26A 2VR4A 4UTKA 2GQAA 2C13A 1P0BA 3M5YA 3SR6B 4ATLA 4H83A 3A7UA 1BXNA 2EF9A 3LZ3A 4A4AA 5FL0A 3A3WA 3UNTA 4WDUA 1LM1A 4JQ1A 3HG2A 3NVTA 4TMBA 3VA8A 4W8LA 3I6TA 1DIEA 2ZX7A 4AAJA 3GD3A 4RNIA 4P2VA 3PFRA 1B0IA 1ZJBA 4WXYA 5GJPA 4HNUA 1Z69A 2VC5A 2WMHA 4QG9A 1OFOA 1E72M 3WK2A 1X96A 5DN1A 1R3TA 3KL0A 1PKLA 2RFGA 3NVZB 1TMHA 1B30A 2R6OA 1F4AA 4F8XA 2NQLA 1KFBA 4HU0A 3AXIA 4UTFA 2ISSA 3SJNA 4O28A 1XRTA 1X2GA 1PCKA 1Q63A 4PUEA 1AQHA 4D6GA 1V7AA 1O66A 2NX3A 4EP8C 1YLVA 4X61A 1KO0A 1RM6B 4V27A 3SUVA 1RJRA 1BYCA 1S2WA 5AYZA 3HPSA 2GVLA 2INEA 2QCLA 4AD3A 1THFD 1KBLA 5U25A 1DEDA 3M4HA 2XIBA 1TJ1A 4UFIA 5FL1A 1GPFA 3G77A 4H19A 4LNCA 2V63A 1SO4A 2G3FA 2C3DA 4XWUA 1PB0A 1LCOA 4B5NA 3GKFA 2INFA 2F9RA 3LCXA 1TMQA 4S3BA 3VOJA 4XG1A 1W2PA 3UZYA 1E9YB 4GE8A 1SW0A 3NXFA 2YCLB 3BDKA 1Z44A 4AMAA 2J9YA 3W1AA 4GQGA 4DB7A 8XIMA 2W0HA 1E9LA 2ABAA 4MM1A 1AH4A 3B9DA 4GUFA 2A3EA 2OX1A 1ZAJA 4XZBA 1A0CA 3GTFA 7A3HA 2V5JA 5JCKA 4AXKA 4PODA 1FFUC 4REQA 2L5HA 2UY3A 1RQHA 3T09A 5FJPA 3LBCA 2QV4A 3VC5A 3IUHA 1EJUC 1ZPTA 1FCQA 3SQLA 1IF2A 1V3LA 4K37A 4IFRA 3RFAA 4IP4A 2PDYA 1T41A 2PU1A 3I68A 3TYBA 2V68A 3QLLA 4CNTA 4ERIA 2ZX8A 3ARQA 4M5PA 1CYGA 4YN5A 2JGYA 2ZE3A 4AIBA 5HULA 2YL9A 1XX1A 4EXAA 3TN4A 1I2PA 3CBWA 1RPXA 3COTA 3L67A 2CC0A 3ZR5A 3E2VA 1XHGA 1VFMA 4H4UA 2V30A 4XSLA 3DYOA 3SUUA 1ICSA 1WUEA 2ZIDA 1AH0A 3C0JA 3N04A 3G18A 1OVDA 3WNNA 4ZCWA 3QH2A 4JTIA 3AIVA 3AM9A 3HM7A 1LPFA 5FS7A 3LB0A 3WELA 3ZJ6A 2FZNA 1B3ZA 1TV4A 2BMBA 3M0MA 1FXPA 4GIYA 3GG7A 2X99A 1W3HA 4MAZA 4QLKA 1ZRQA 3WDRA 5EKYA 4LNYA 4PSRA 2XM1A 3CHVA 2QCGA 1TQJA 3WF1A 3VDCA 3QTGA 4Q3MA 3CUXA 2FDMA 3GG1A 4LB4A 1IIHA 4OU1A 3TSDA 2OVLA 3M6YA 1P48A 4L65A 4RJEA 3NVYB 3ITLA 3UGVA 1WZMA 2XFYA 3WD2A 4LJ3A 2DY3A 2KX9A 2OEJA 4US5D 1KNWA 3E0VA 4HK7A 3WENA 2PAJA 2ZUVA 1HN1A 3KOZA 5EU9A 3OG3A 3BGAA 1UR3M 2WHLA 3A3HA 2OOGA 3QSRA 3VK5A 3ZMRA 3FX4A 4ZE4A 5FF4A 4M56A 3OA3A 3GWQA 3TNOA 1NOUA 3R12A 2VEKA 3B0VC 3Q6JA 1XR2A 2ZDRA 1IEIA 4ZOHB 4LAKA 3WEZA 3MUZ1 3CXBA 4H6KA 3CPGA 1ECEA 4FZIA 3RIKA 3UG5A 2XHYA 2C14A 3BMXA 1JD7A 5FMHA 4IL2A 1EBDA 2PDUA 4JNYA 1DJWA 3IVUA 1FWCC 4GACA 1JZ3A 4FR1A 1XGEA 7REQB 4TVCA 1EDGA 5L9FA 3NQFA 3S5YA 3QFWA 2Z25A 4Z0SA 2DH2A 3PWAA 1EO5A 3THAA 3IRDA 1NQ6A 3J7HA 1V0NA 2FTPA 1QHPA 1D8CA 2X8GA 1SR9A 1JPMA 1VFOA 1JR1A 4RE0A 1OJXA 4TX6A 4FR6A 2QPSA 3VIFA 2G96A 2OQLA 2XN0A 1K70A 1ME8A 2J8GA 5A6TC 3P8IA 5FS8A 3WLNA 3AXKA 1QI0A 1EQCA 3PBVA 1MRAA 1P7TA 4XK2A 3IACA 4AZCA 5LGZA 4CUCA 1P1MA 1PE1A 3V16A 1U2YA 3DGZA 3KDNA 3CQ0A 3R8RA 1PUDA 4N7QA 4LC8A 1U5HA 3GXPA 1UUMA 2YA2A 1XYBA 2WAGA 3EOSA 2XFRA 3EF6A 2XIIA 5G2HA 2V67A 1LOQA 3RNDA 1LDCA 1JYXA 4H6EA 1T3QC 4HPXA 4P7OA 4O16A 1M9HA 3VDGA 1QPNA 3DAQA 1W3IA 3OYXA 2IXVA 4G1KA 1GYMA 3TN3A 5BU6A 3WFAA 4XAYA 1A5NC 2BZNA 1EP3A 3TW6A 3UA4A 4HNNA 4Z42C 3KW3A 1TWIA 1KKOA 3CC1A 2Z2UA 3VABA 4DZIA 3WNLA 3FOKA 2QAFA 1QFEA 2XN1A 2NV2A 3HFTA 1P1XA 3N2MA 3WD1A 2J8TA 3RX4A 3K2GA 1FECA 3TQPA 3RHGA 1A3HA 2VX4A 3NVDA 5LGXA 4JXCA 4AF0A 3RO8A 3HPFA 5E0KA 1Z42A 3LV6A 1FXQA 1F6KA 1Y5WA 3ZJ7A 4BY3A 4GRSA 4D6FA 1OQFA 4Y96A 1QPKA 4QE5A 3GH4A 3JVAA 2FPTA 1S2AA 3WCZA 3N2BA 1JOAA 3P61A 1AW2A 1CDGA 3W2KA 2YXOA 4X63A 3AALA 5CPMA 2CNCA 1FFQA 4I7VA 1SW3A 4O1AA 4B92A 4S3FA 1WKEA 4BJHA 1EBHA 4S3EA 1TFVA 4ZQPA 3D3AA 3VMPA 1Q6QA 4J4KA 1XIEA 3DC8A 3G1SA 4CD7A 5DXYA 3W2JA 1DJZA 7PTDA 3S0CA 4IMCA 4FNTA 2YVJA 2DZUA 6XIMA 4G8TA 3VNMA 2CBUA 2PGWA 3GHUA 1PS9A 1VB9A 3IUIA 2JKAA 3V0UA 2ZUUA 1E40A 4QCEA 4ZZ9A 1XDIA 1J0ZA 3STGA 1CWYA 4C6QA 4DM2A 2OLAA 2JQXA 2VKZG 4DN1A 4S3AA 1W9XA 4FEZA 4W5ZA 3K4WA 3EOEA 3TFCA 2QZRA 1E51A 3QGAC 4FF7A 5LSMA 1VPYA 5MF5A 3ORWA 1MWOA 3B8VA 3F2BA 3S1WA 1PX8A 2O56A 1WPCA 1P6BA 3R6IA 4V2XA 4Y9OA 4BEUA 4EF8A 1OYAA 2V8ZA 2IKHA 2HNHA 3CO4A 1A3WA 4ACYA 3O7UA 3CLWA 3LPGA 2P50A 3DEQA 4P7LA 4GIEA 3JW7A 1TVNA 1I0BA 3IJQA 1UHVA 2OG9A 4ZOAA 3BLIA 2JALA 4RPQA 1QJWA 1H41A 3N4EA 2GDQA 3W7JA 3TAKA 2VFIA 2OU4A 4H00A 4YHEA 3ETRB 1E4LA 3XISA 1B3VA 3QF0A 1DV7A 4HKPA 1RAKA 3L0KA 2VEMA 4S39A 1E4NA 2G37A 4XZ9A 2YCJA 2ZZ3A 3DZ1A 2RDUA 3HO8A 4W7UA 1E56A 4F48A 2OTDA 3WBWA 2I17A 3C0SA 1S3HA 3G8EA 3PVFA 4U2ZA 4S3GA 3S2MA 4CQDA 3W2UA 3GG0A 2Q8LA 1WUFA 1BPLB 4H4SA 3OZMA 6TIMA 1IZJA 5EMMA 3G8RA 4QG6A 2NXGA 5D2WA 1NDWA 1Z48A 3R89A 3MCOA 2EPOA 2IMRA 3TYCA 1RH9A 2QEZA 1FP9A 2HVMA 3PZNA 3KTSA 3MU7A 2OEKA 4B9ZA 1S7MA 3AYTA 3IGHX 1TZ7A 3T81A 4J40A 1TKKA 4WKAA 3ZR4A 5LHEA 4EMJA 3GDMA 4TU1A 2YCLA 3IPWA 4U10A 3MANA 1EYWA 1SVDA 3QGVA 4UFLA 1NEYA 3W7IA 1MW3A 4JL2A 3MSYA 4RNFA 3W7OA 5KZDA 2Q01A 1VHNA 4W87A 4BQ2A 2BC0A 3B9JB 2RJHA 3S1XA 2HVNA 4AZHA 4CD5A 1Q45A 3EDJA 2ZQ0A 2QIWA 3S2JA 2XYLA 1Q6OA 3P84A 3R5EA 2E6YA 3M0KA 1CCWB 1GVEA 3MVTA 3M44A 2QLYA 3NQEA 5DRCA 1TTJA 2VDGA 1EXPA 4G5DA 4QCFA 3UR7A 1A5MC 4O1FA 3FYYA 4DHGA 3GU9A 4PTNA 2W5FA 4PN2A 4PMVA 4L1GA 4GJJA 2PD5A 3LPOA 1G94A 2FMNA 1WBJA 1KM0A 2ZYFA 3N4AA 3KP1A 3W1PA 3IK2A 3KS5A 4XZWA 1Y5VA 1AJ2A 1JGMA 2IXUA 1QR7A 3ZJ8A 2E67A 2GVYA 2J7BA 4MHBA 3T40A 2BGNE 3UP8A 4GK8A 3HQ1A 1ZCOA 3K5XA 3W76A 3GXTA 4W7VA 4HIBA 3S9IA 4JAWA 2VC9A 3NIYA 1HP4A 4L6DA 3NQGA 3AMLA 5C54A 2BX7A 3M5VA 3LUTA 1YRRA 3S2CA 1NDYA 1UUOA 5T9CE 4JDYA 1M03A 1UKQA 1E1CB 2GJXB 3A3XA 3EZ4A 3LPFA 4C1LA 5I23A 2JIEA 5T8GA 1CXKA 2QVNA 4NKCA 3D0CA 2EEXA 2DH3A 1XIFA 5T91A 2RDTA 1HGWA 4UQBA 2PU0A 2X1RA 3CYJA 3W7NA 1IR1A 4TVDA 3TTOA 3FJNA 4B91A 1E0VA 4H50A 1K4QA 1JZ2A 1PJ9A 1W32A 5DBTA 2BXVA 3I7QA 5FEPA 3SFWA 3F2CA 1R7AA 2IUZA 3LTYA 1FH8A 5ABHA 2QCEA 3HURA 3UWUA 3RGTA 1EA0A 3AAMA 4AISA 2ZX5A 3PSVA 1U1HA 2J7GA 5GPRA 1JRCA 3PBUA 3E38A 4A2RA 3O6DA 3W23A 1BG9A 4PTWA 3RPMA 3OYZA 4U5IA 1W6TA 4B90A 4AG0A 5I00A 3W75A 2V9DA 4J57A 4MYXA 3IVTA 4WSKA 4XBKA 2ANUA 1W9BM 3H7UA 3MB9A 4ZA0A 4M1BA 2O4QA 4F0LA 1XV8A 4H8UA 3TE9A 4UOZA 2WM1A 1U83A 1TTIA 1G7UA 4BF9A 2WPGA 2VVSA 3CZKA 4LS0A 2DP3A 1KQZA 1DE6A 4I3GA 7REQA 5DMYA 3TX9A 3W7QA 3L0NA 3W25A 3RX2A 4DWSD 5D03A 2I9EA 3NG3A 1JIBA 4B2DA 1T5AA 2NXHA 4AD2A 5HNTA 1PL9A 2D2JA 4UMAA 1EKOA 4LPCA 4MDPA 1OBAA 4UTWC 5CZ0A 1RBAA 4JX4A 4I5UA 2BGQA 2HE5A 4ZOCA 1EDTA 3GIQA 2XH2A 1IEXA 3A5VA 4PFMA 1PXGA 1V0KA 1KBIA 1MNSA 1NWTA 1GEUA 5AC5A 1SMDA 2HTMA 4IPPA 2O7SA 2WK2A 1W9VA 4E4PA 1KQYA 2RJGA 2VENA 4GVGA 4E2BA 3SSJA 2YXGA 1NAL1 3AIWA 2WQPA 4S3DA 3ZSSA 1LP6A 5EPDA 3UQNA 2QCCA 2CFFA 3WFLA 4UOQA 3BOLA 2R1NA 1RXOB 1RP9A 3IRSA 1XLBA 3HA1A 3B8UA 4JFTA 1T6MA 2E8ZA 4KRZA 1XG3A 3A4XA 1NIUA 1QTWA 4WSHA 1UZHA 4AHPA 2D24A 3N1AA 4TTUA 5H2ZA 3ITGA 3DGHA 4FPSA 3VYLA 3UZJA 1TV7A 1XPGA 1J6OA 3GNNA 2J77A 2OCZA 5JQ9A 1EGMA 4QP0A 4MSSA 4HZ6A 1RD6A 4Z1AA 5A8NA 1QI2A 4HPJA 1NU5A 3C4UA 4TX9A 3ES7A 4TXEA 3H7VA 1DIKA 1X8FA 5FSEC 3S83A 4ZO6A 1HO1A 2DV0A 1EIBA 1KRCC 2XSXA 4C6MA 4JKMA 4Q8WA 1NHRA 2EHHA 1WAWA 4LAUA 4ORIA 4XISA 5LNVA 2VEPA 3FJ6A 2OWWA 4O57A 1M7OA 1OF8A 5C55A 2DVUA 1S3TC 4H04A 2WOVA 1IEWA 4GZIA 2E5BA 3WO8A 2DPEA 3P80A 3AIBA 1JI2A 4MMWA 4NXKA 3BUVA 3TH6A 4JTQA 1XIBA 3F4VA 3EX4A 4GFSA 2PP0A 4UFJA 1L6SA 4L4MA 2PZ0A 3HQNA 1V3KA 2E1DA 5FJTA 3S2NA 1Q1RA 4HYVA 2FTYA 4HB7A 3ZOAA 3MKKA 1MVYA 4GI8A 4KFPA 5TNVA 2DVTA 3HJEA 2F6XA 3THCA 2I5QA 3E1F1 4CCDA 5GJMA 4DBDA 1GNXA 4LV9A 4MADA 3ZVIA 5BZAA 4LUSA 3VM5A 3GDLA 3AMCA 3T2OA 2I5GA 2ZZ4A 4CD8A 2E6FA 3VTRA 1C90A 3N6QA 4FNQA 2R94A 1FWSA 5FF2A 1KM6A 4OBSA 4JICA 2Z2AA 4GI6A 1PBGA 3MW7A 4DBSA 1XG4A 4S3KA 4U28A 4UTWA 1LBFA 1W5PA 4AC7C 4F0KA 1A5CA 3B4YA 1E6ZA 4QNEA 5FAGA 5LIYX 2XVLA 3TIMA 5BRPA 1ODZA 5AC7A 2O9PA 2WSYA 3OEXA 3ZYZA 4GRTA 2XVPA 1SZRA 1JQVA 3RK8A 3BK0A 4PSPA 1TG7A 2NUXA 3FSUA 1W56A 7ENLA 3DFQA 1GHSA 5G1TA 1QK0A 4HHMA 4QX4A 3WLHA 3ARTA 4N9EA 4LY8A 1QBBA 3SM0A 3UPBA 2YDRA 3PAOA 4GYKA 3GIPA 4X9SA 3W83A 1UW9A 4ILSA 3ECQA 3TEVA 3UZXA 4Q4KA 1RCOB 1UR8A 5CZTA 4UQCA 4OIFA 4LTSA 3WQ5A 3IIVA 3SCOA 2H9AA 5EFFA 3QC3A 1UG6A 4C5ZA 3WN6A 4IJRA 2E8YA 3URHA 3EXTA 4FXFA 1Z6KA 1CEOA 1LQAA 2P88A 1JNDA 3MP5A 3HPZA 3N73A 1VCFA 1JGIA 3CGDA 1W3NA 2DFAA 3O0HA 3ZSTA 4D9PA 2I14A 3BJTA 5AHIA 2VCCA 2OKTA 1S5WA 4GNVA 2QW5A 3UXKA 5D02A 1GJWA 3S1VA 4GPNA 3O8AA 2XH0A 3TZFA 3KTXA 1FFVC 3LRLA 3KE0A 1GOOA 2AAQA 5J5RA 2ZRYA 5EMJA 4H9UA 4ZQMA 3UR2A 1DQUA 2B31A 2NWSA 3EOUA 3JRKA 3IGSA 3VIJA 2ISWA 2OELA 4Q4RA 5DMNA 1ZLPA 2VL4A 5I03A 3IJ7A 3KCJA 3N9RA 3B8DA 2QULA 1E71M 2W3ZA 4Z17A 2YB1A 4HJWA 3NR0A 4KEVA 1S38A 3ABXA 5I07A 3EDEA 3W1MA 2PRHA 2JK2A 3W2NA 1UMYA 4GOAA 1A4MA 1KV8A 3S9ZA 4PZVA 1ME9A 1UASA 5ABFB 2D69A 3DYMA 1EJSC 3QTPA 4DUWA 5CEWA 3BQ6A 5DCDA 1N5XA 4PBGA 4PE8A 5GNXA 2C19A 4S1FA 3ARPA 4IICA 1NQKA 1W1B1 1XH0A 3HFYA 3QRHA 3I7SA 4ML9A 3URBA 3F2DA 3CH9A 4LUTB 4MGGA 4MY9A 5LIXX 1J0IA 2D1ZA 3GR7A 1ZNNA 3TQVA 4H4XA 5IHRA 2O9TA 3DJGX 4JNMA 1C7SA 1SO6A 3TUUA 1YPIA 2X1SA 2UBPC 4YPJA 1VJZA 2FMOA 1SZNA 2NVCA 5D4YA 1FFRA 1HKIA 3RJYA 1O5KA 2POZA 4IISA 4GMEA 3R2GA 1BZLA 1WAUA 4MB1A 2Y8VA 1QDSA 1O5XA 2G4FA 1ICPA 1OGBA 1P6WA 4W85A 2A85A 1BVZA 1DIOA 4L9XA 3W82A 3ID7A 2W9MA 2BP1A 4PTDA 1F3PA 4I9JA 1R2RA 2PDQA 1NM9A 3M43A 4E38A 3L4WA 2UZ9A 3POCA 1AODA 4UZUA 2UY4A 3F03K 3AN1A 4JY9A 1UH2A 2BVTA 2E77A 4XO7A 2Y61A 1Q7MA 5BW6A 1E1CA 2GJXA 1I75A 1GVYA 4H9ZA 1V4YA 1FO4A 3OBEA 2D23A 4US5A 3ZT7A 4JKLA 4CU6A 3WQOA 4QAWA 3FG2P 3PPCA 1AFSA 3AMDA 4O18A 1B3XA 5AKQA 2X30A 1V3MA 3C86A 4ZTYA 3TWBA 4Z2KA 1J79A 1X6LA 3FAWA 1V03A 4PR4A 3DKJA 3FEQA 3MBFA 3TLLA 4J9JA 2C3CA 4HNCA 1H1ZA 3WUBA 3ZLFA 4ZVJA 2F7FA 3V0TA 4QJ4B 1BG4A 4UCGA 5BMWA 3LQGA 2NLYA 3V5FA 1VFLA 3WSUA 2OR2A 2Y4SA 4IH3A 3CUIA 3VGDA 1VBGA 3EBVA 5GQBA 2HPMA 4JL1A 4XAGA 1VZWA 4KQNA 3OG2A 7XIMA 3FVDA 1ITUA 5TQLA 4DEFA 9XIAA 2OWCA 3NL2A 1C3FA 3KLKA 3CNYA 2BTMA 3A9IA 3VNIA 1QU4A 3PP7A 4C6KA 4K39A 3ABRA 2X1UA 4DWSB 4C6CA 3QSTA 4IPJA 1RJQA 2ONEA 4S38A 1W1PA 3QW3A 4LX4A 5F4XA 1KBJA 3WLJA 2I16A 3LY0A 3B0XA 1BWKA 1YDYA 4YTRA 5BXSA 4LIIA 5BWAA 1BXCA 5F2GA 1K3UA 5E1QA 1XQLA 4JQ2A 3CU2A 1H62A 3BLDA 4NL1A 2WPFA 1YNYA 2J7DA 2GVJA 3FV9A 4I8YA 3RM4A 5TAOA 4YHGA 5I24A 2HK1A 1F07A 5E09A 3ALGA 4DJFD 3GFZA 4PMNA 1JUEA 4F40A 2FIQA 3KL3A 5B7ZA 1UD5A 2ZA3A 1Q6CA 5ECUA 4OFCA 3H23A 1HVXA 3H12A 1QT1A 3LHVA 3QJAA 3B9OA 4HMDA 1TREA 1CLKA 4B15A 4C1NB 4A3RA 5AHNA 2J7CA 3OU8A 1SM9A 5C9XA 4Q32A 2R9ZA 2PWEA 5CCZA 2PDCA 1TPEA 5A6JA 1J0KA 2XM2A 2Z1WA 3AYSA 1Z89A 3ZT5A 4H9YA 4AYSA 3WMCA 4MPKA 1H4PA 1F6PA 3U8GA 1YBQB 2PD9A 3PTMA 3GNXA 3SRDA 3RITA 3WD3A 3KVJA 5M1TA 1Q8JA 3NQDA 2J25A 5A94A 3FW6A 4Y6GA 4ACZB 1VYRA 1EFZA 3TTEA 1QO5A 1WZLA 4F9DA 1H7WA 2JEQA 2QR6A 3UCDA 1IIGA 1X2HA 1E6XM 4L6HA 4XAPA 1MEIA 3URQA 1EB3A 3F4DA 4PBEA 4RR4A 4H4RA 1X1NA 1EH9A 3NQ7A 1QMLA 2V0TA 3OZYA 2CLIA 3LCIA 5BXTA 1W91A 1VFFA 3VD7A 4A05A 3H4GA 1E1EA 3D9XA 3NCOA 3LG3A 2NZLA 3MCMA 1RVGA 3USZA 1KCZA 1X1ZA 4IFKB 4JN6A 8XIAA 5D8WA 3MV11 1TUFA 4W86A 2NQJA 3U6WA 4BA0A 2OFJA 4DLMA 1UWUA 4GZEA 2DW7A 4B5WA 3EX6A 2GFTA 1I9CB 3IJ6A 1H7PA 1YDOA 1IYXA 3MUXA 1D7FA 1YXYA 3ARZA 1ZMDA 1V59A 5LNRA 2NQHA 1FH7A 3LYEA 3BCDA 5ER0A 1XXXA 2XDFA 2GGIA 3QR1A 3NYZA 3NFUA 1VFTA 1ZBWA 1N63C 4LANA 1B3OA 1MW1A 1GOIA 3ITOA 2PURA 5E9XA 1MQPA 3A13A 3EMZA 4ZFMA 3N6JA 2YL5A 1RK5A 2PP3A 3PZIA 1N62C 1KXVA 3M7WA 5DRIA 4ZO7A 4JYEA 5FCZA 4XD3A 4LGXA 5JIWA 3BLPX 5IDZA 1U1UA 1ZSXA 2IKJA 2WPCA 3CUHA 1LL6A 1HKMA 2FB2A 4JS3A 3VIHA 4KKXA 3W70A 1JZ8A 4R7OA 3IANA 4QDWA 4GY7A 4NF7A 1JZ6A 1QRQA 3HIJA 3NZ1A 3U2EA 4HU4A 3M7SA 3MKCA 2EPKX 3R94A 5AC6A 3EEZA 1I1XA 1B9ZA 4GNJA 2Y5SA 4AD4A 4XVEA 3HG4A 1LOSA 3MJYA 2GQ8A 2A8XA 3N2XA 3O15A 5D2YA 2YVGA 4Q7NA 3W73A 5CC3A 1VEOA 3GTIA 1RALA 1VF8A 3EKZA 4RPPA 3IUDA 3N3MA 1OT2A 1XRSA 2PGFA 2DUAA 2YYTA 3E5BA 3OW1A 2VM8A 4PL1A 1OB0A 1X7IA 4LEFA 3QOMA 3PJWA 4GC3A 1KXHA 3ZVHA 1V6VA 1J11A 1PX3A 4Z1DA 4NRRA 3W7HA 1GV4A 1KM3A 1Z7AA 1KM1A 3V0SA 3CB8A 1DKWA 1OIFA 4NUWA 4JIRA 5DO8A 3L4TA 4JTEA 3ISIX 5C7HA 3QR0A 5BU9A 5M17A 4V33A 1SO3A 1C9WA 4AH7A 1JROA 2R8WA 4IHCA 2REQB 4GVIA 1E4MM 3VCRA 3TWAA 4D2JA 4XVDA 1EL3A 2WZIA 1C7TA 4HOWA 2VC7A 3U7BA 2V5BA 2OXNA 5CC6A 3N11A 4NZ5A 3GUWA 1UD6A 3WEOA 5HR7A 2UY2A 2CHNA 3B9AA 2XWEA 4XKYA 2VZOA 3CZEA 4P5UA 4H2CA 4ZB0A 1QW8A 3T4CA 2QDDA 2G95A 1IV8A 4DXKA 1XDJA 2EG7A 2HEJA 3RU8X 2C6QA 4H4QA 1JJKA 1SZGA 1W5NA 3T78A 1P5BA 1GQKA 1IEVA 3OGRA 4DWSC 5KETA 1JZ4A 1DHKA 3BW4A 3DU0A 1H50A 1A0EA 3KHJA 4ZQCA 5HR6A 2J27A 3O9NA 3P0XA 4E0CA 1AH3A 3TCEA 1TPDA 2CLKA 3NQ8A 3RLVA 5FEWA 1PWLA 2C1IA 3UNDA 1PZ1A 3E49A 2QS8A 1TVLA 2J7FA 4FLSA 3BSGA 2F38A 3IV8A 4DAIA 3GTXA 2E6DA 3KL5A 2Y7EA 4ZSUA 4QJ5B 2GR3A 1WE5A 4QE4A 3SGUA 1ZMCA 1H6VA 5ABFA 4MFEA 1LWHA 4PUUA 2VZVA 5I79A 3L4VA 2YDQA 4XZHA 1ONWA 3NPWA 4JQ9A 4B5TA 5CSRA 4AUBA 4JTDA 3V5CA 4PMYA 1EPVA 4XUGA 2YB4A 3ABOA 2QJJA 4UFKA 1WOAA 3REQB 4E8GA 2VP8A 2D2OA 2Z4GA 5H8MA 4LUTA 1FOBA 4EQWA 1FCBA 2V3EA 5HWMA 3GUGA 4NHVA 3QW4B 4L4LA 1NHPA 1VIWA 4I5RA 1C29A 3NO5A 2VGBA 3T8QA 3G1VA 3C0QA 1V51A 1QCWA 3OGVA 2W79A 2PF8A 3OLIA 2EQ8A 3SEPA 3KCLA 4KETA 5KZMA 3U48A 2W66A 4JN8A 2C71A 3I7RA 2A3CA 2ZOXA 2PDKA 1N60C 3DKLA 1JNEA 3M0ZA 2WJEA 4UTHA 4MIMA 2PDLA 3W87A 1PWMA 4LAOA 3POHA 4G2DA 3C0LA 3ITXA 5EBUA 5B80A 2QUMA 2X2GA 4GUHA 2PGRA 4EMWA 3BWWA 3UF9A 5GJNA 1XD1A 2Z0IA 4R7JA 3ANUA 1H61A 3SY5A 1NHSA 3ZLGA 2RUSA 3DK9A 5A8PA 1O68A 4DYEA 2DZVA 3L21A 2YIHA 2J79A 4CNPA 4AWSA 3LX9A 3BGJA 3F5LA 4ZB5A 4QEEA 1KBKA 1XL9A 1XSKA 3EEGA 2WMKA 3L2IA 3MSRA 2DZAA 1GERA 1FQ0A 1OFRA 2VFEA 1QNVA 3MWAA 2CPUA 3BW3A 4DUOA 3NZGA 1K6AA 2FFCA 4FLOA 2GK1B 2PEVA 3L65A 1T40A 3AWNA 1JFHA 1GG0A 2E9LA 4A22A 5K9CA 1BF2A 1GRGA 1W9UA 1ZL1A 5A3HA 1GTEA 4O1CA 3AMKA 3RLGA 2PDNA 4QHRA 1VYPX 2YBVA 3BCJA 3THQA 1GQNA 1GVQA 1VFSA 3ME3A 1TWDA 2PTYA 3C2RA 4PEKA 2ZZ5A 5AN7A 4DWSA 4ECLA 3PG8A 5CPTA 3WYZA 4HSNA 3E6EA 3LBOA 3UPMA 1KFLA 4D8AA 5A2BA 3EANA 3UA3A 3URNA 1WZAA 3LGEA 3S47A 1YXDA 4MZYA 3LRMA 3TDFA 3S5OA 4ADTA 1TJPA 3P3BA 3F5KA 4H4WA 4BF7A 3BAYA 3V36A 4MFDA 3L5LA 2IKGA 5CQ1A 3LPPA 4FNPA 4EAYA 2WOIA 1DHPA 2VEGA 2GQ3A 3WIJA 1QW9A 1AQMA 5I3FA 1YPFA 1BWLA 4FLQA 2YW4A 1YMYA 4U31A 2JEPA 3WLSA 1JPDX 2R24A 2XSBA 1J10A 3MWCA 2VD8A 3LGDA 3QZAA 4H4IA 2CLMA 3C2OA 3OZOA 4G6CA 5D32A 1M7PA 4PRWA 4IFOA 1A5KC 1MQQA 5HDRA 4GIAA 1XKJA 3CLMA