3V3WA

Crystal structure of an enolase from the soil bacterium cellvibrio japonicus (target efi-502161) with bound mg and glycerol
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
402
structure length
397
Chain Sequence
MKIVDAKVIVTCPGRNFVTLKIVTDQGIYGIGDATLNGREKSVVSYLEDYLIPVLIGRDPQQIEDIWQFFYRGAYWRRGPVGMTALAAIDVALWDIKAKLANMPLYQLLGGKSRERILSYTHANGKDLDSTLEAVRKAKDKGYKAIRVQCGIPGIAKTYGVSYEPADADLPSVEVWSTEKYLNYIPDVFAAVRKEFGPDIHLLHDVHHRLTPIEAARLGKALEPYHLFWMEDAVPAENQESFKLIRQHTTTPLAVGEVFNSIHDCRELIQNQWIDYIRTTIVHAGGISQMRRIADFASLFHVRTGFHGATDLSPVCMGAALHFDYWVPNFGIQEHMAHSEQMNAVFPHAYTFNDGYFTPGEKPGHGVDIDEKLAAQYPYKRACLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Starvation sensing protein rspA
publication title Crystal structure of an enolase from the soil bacterium Cellvibrio japonicus (TARGET EFI-502161) with bound MG and glycerol
rcsb
source organism Cellvibrio japonicus
molecule tags Lyase
total genus 143
structure length 397
sequence length 402
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3v3wA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3v3wA01
3TWBA 4JN8A 4KEMA 4DN1A 3UCDA 2OLAA 3SBFA 2PODA 3Q45A 3H70A 1TZZA 1R0MA 3P93A 7ENLA 4H2HA 2GDQA 4J3ZA 2GGEA 2QVHA 1EC9A 3UXLA 3DG3A 3K1GA 4JHMA 2DW7A 4H19A 4HYRA 4ZA0A 4MMWA 3UJSA 3ZLGA 2HZGA 3QTPA 3FCPA 3JZUA 2PTWA 3ES7A 4GGHA 3FV9A 2AKMA 5FJRA 3RRAA 4F4RA 2XGZA 4HN8A 2MNRA 3H12A 3QPEA 3DEQA 3ZVIA 2QJJA 2GGJA 3GC2A 1IYXA 1ELSA 2PU0A 3DDMA 3P3BA 4A35A 2OQYA 4KT2A 3UGVA 1BKHA 1L8PA 3VFCA 2GGHA 4JN7A 1RVKA 5EU9A 3UCCA 1XS2A 4DXKA 4K8GA 4GFIA 4K2SA 4IL0A 5BOFA 2NQLA 4E4FA 3CXOA 1JDFA 3CYJA 3SN0A 2RDXA 1KCZA 1JPMA 3KUMA 3ZVHB 1TE6A 3OZYA 3OW1A 3I4KA 2XH0A 4DYEA 3MWCA 3I6TA 4DX3A 1MDRA 1SJCA 1EBHA 3IJQA 3V5FA 4E8GA 3NO1A 4MKSA 3TW9A 3ZLFA 3TJ4A 1F9CA 3UJ2A 4GGBA 3DFHA 3VC5A 4DHGA 3PFRA 2FYMA 4KWSA 2XSXA 3IK4A 1ECQA 2ONEA 1NU5A 2GSHA 3TOYA 2HXTA 3DGBA 3HPFA 4M6UA 2OO6A 3RITA 3V5CA 4G7FA 3T6CA 4Z17A 3N6HA 3CT2A 3TJIA 1SJBA 1XPYA 2P0IA 4HPNA 4GYPA 3D46A 4GIRA 3VA8A 4E4UA 3RGTA 2DW6A 3MY9A 1E9IA 4X2PA 4A6GA 4ROPA 4ENLA 1SJDA 3GY1A 3GD6A 3OPSA 4IL2A 4DWDA 3VDGA 3MUCA 3Q4DA 3VCCA 3CK5A 3MSYA 1SJAA 4HCDA 3R1ZA 1R6WA 3OTRA 1MUCA 1EC8A 2PP3A 3CB3A 5IDZA 2XH4A 3SSZA 3D47A 3JW7A 2P88A 2PP1A 2OKTA 1OEPA 2AL2B 2AL2A 3JVAA 4FP1A 3S47A 1KD0A 3R11A 2P8CA 4HCHA 4FI4A 2XH2A 3RCYA 1FHUA 3IJIA 2QDDA 3MKCA 3B97A 3ZVHA 3DG6A 2FKPA 3T4WA 3FVDA 5J04A 4E5TA 2PPGA 4IT1A 3N4FA 3SQSA 3DERA 4IP4A 3RO6A 5FJPA 1MRAA 3FJ4A 4IZGA 2GGGA 2OFJA 2QQ6A 3UXKA 3R10A 1KKOA 3R25A 3THUA 5FJTA 2POZA 1PDZA 2PCEA 3H8AA 4IHCA 1YEYA 2P8BA 1EBGA 3H7VA 3VCNA 4HNCA 2AKZA 2ZADA 2OG9A 1TKKA 2ZC8A 3ENLA 4E6MA 3MZNA 3DIPA 2OPJA 2GL5A 2MUCA 4M0XA 3UJRA 2QGYA 2PA6A 2QJNA 4HNLA 4A3RA 3QN3A 3QLDA 4HCLA 1W6TA 4J1OA 4KPLA 3UJFA 3NXLA 3DESA 3SN4A 2PTYA 3FYYA 1JCTA 3N4EA 3ZLHA 1DTNA 3IJLA 2GGIA 1NELA 2OX4A 3TWAA 2XH7A 3TCSA 1PDYA 1JPDX 3BJSA 3EEZA 3OZMA 3V3WA 3CAWA 2AL1A 4H83A 3NFUA 4MGGA 3R0UA 2PS2A 4Z1YA 2QJMA 2O56A 5ENLA 4H1ZA 2OVLA 2OZTA 2OZ3A 3U9IA 1BQGA 6ENLA 3RR1A 2OZ8A 2HNEA 3QKEA 4GISA 3MQTA 3VC6A 3TTEA 3SJNA 4YWSA 2I5QA 3DG7A 2PU1A 1KKRA 3NZGA 5FJOA 2OQHA 3V4BA 2PTZA 3N6JA 3SN1A 3U4FA 3T9PA 3I6EA 5BOEA 3FXGA 3GO2A 4GYPC 1WUFA 1WUEA 4GMEA 2PGEA 4G8TA 1EC7A 2HXUA 3ES8A 1ONEA 4K1WA 4ZCWA 2CHRA 2PP0A 3BOXA 3TQPA 3R0KA 3EKGA 1P43A 3PWIA 2PTXA 1MNSA 2PMQA 5FJUA 3P0WA 4EWJA 1MDLA 3PWGA 3DFYA 3BSMA 2PGWA 3T8QA 3OP2A 2QDEA 3UJEA 1FHVA 3STPA 3S5SA 2PSNA 1P48A 4IP5A 3PK7A 2P3ZA
chains in the Genus database with same CATH superfamily
2XGBA 1S2CA 5AECA 2OEJA 2C8NA 1SW3A 3MA8A 2WJZA 1O1HA 2PDKA 3Q45A 2EO7A 1SR9A 4K38A 3WIJA 1S38A 1QO5A 2W3ZA 4GJIA 4C6CA 3RLGA 3FAWA 1CGVA 8TIMA 3NR0A 1FWFC 1EC9A 4NX0A 3DG3A 3GVVA 1T0OA 1U5HA 5CGTA 2FGZA 5DBUA 3LOTA 4QJ3B 3PNUA 4POCA 1A49A 4LPCA 4X9SA 1RM6B 1N63C 4KEZA 4RX0A 1WDRA 4RDYA 4QSFA 4I5RA 4K68A 2VZSA 4DBEA 3UR2A 3WBYA 3MMWA 4LBRA 1T8QA 1E3XA 4FIRA 3B40A 2XIJA 2OQYA 2VFIA 2QUNA 3ITCA 4M8UA 2QDGA 4GNKB 2Y85A 3CWNA 3VD7A 4BHYA 4DXKA 2QXWA 2ZRUA 1H50A 4AMAA 2NQLA 5GJPA 1C9DA 3SN0A 2X7WA 1Z9AA 3H4GA 2FPYA 4H41A 1ZY8A 3HZ3A 1OB0A 4MF4A 1VFFA 3U57A 4JPGA 1DL3A 3IEBA 3EWXA 2XUCA 4L6HA 2FLIA 4DX3A 3TC6A 1PEZA 1KXTA 1ZAIA 1SO5A 2RAGA 3H23A 5AFDA 1XSIA 1XIHA 4XD4A 4EIVA 1ECQA 3NM1A 3WN6A 2AQWA 1EDGA 1R2TA 1NWRA 2X2GA 3DI1A 5KETA 5L6UA 3F7JA 3NEVA 3CMFA 4AVFA 2ZZ5A 3KS5A 2TPSA 1E5JA 3NG3A 3UESA 1L6WA 1O1ZA 4UQBA 4YS1A 4DBSA 1XCWA 4P2VA 2PRLA 8XIAA 5CC3A 3O06A 1EQCA 4GIRA 4EVZA 1UG6A 1XG3A 4ECLA 5K9DA 2DW6A 1BZLA 2JIWA 3KP1A 1LCOA 4OECA 4LAOA 1LLOA 1EEPA 3VIMA 3W7EA 3UF9A 3CU2A 4UR8A 3WNPA 3CJPA 3UVIA 1JF5A 5FACA 5MHBA 4WJEA 2FVKA 3CASA 3R1ZA 5HJXA 4A8NA 1FWIC 3E5BA 3F5LA 2JFEX 3HJZA 4E38A 1SFTA 3PZMA 2VOTA 3TYCA 1YX1A 3WELA 3JUGA 1KFLA 1N5XA 3LS9A 3C61A 4QX4A 4IQEA 4Y6GA 1E4LA 3V0TA 4RZ5A 1U5VA 1TTQA 2QCFA 2GQAA 2H8XA 4NAEA 4OQVA 3IVSA 1R8LA 1VEOA 4W8BA 1G5AA 4YCPA 2Y1HA 2FQIA 1Z8AA 5LSMA 4MYAA 4PGLA 3ANVA 3MYOA 5C70A 5ABHA 5LA2A 3QV8A 4YTRA 5C8BB 1KM6A 3IS4A 4JTTA 4AZIA 4C6KA 5U1OA 3HG3A 4ZQPA 3NL2A 3MYPA 3CUXA 4IX0A 2A3LA 3GU9A 1FCBA 3B8VA 2W3RA 4D72A 5B7YA 4PTMA 1GOIA 4L4LA 3CEPA 1UWQA 2ZZ4A 1TJ1A 4IT1A 4F48A 3T1GA 1M41A 1YE6A 3TP4A 4IP4A 3CHCA 4YXGA 1I75A 1C92A 3GUWA 1HQTA 1THFD 3WUGA 2EQDA 4FS9A 1HZYA 1H49A 4AD4A 1WB0A 1RJPA 3WF2A 3UY8A 2QJGA 2X42A 3CPRA 2G96A 2WP6A 3QYSA 3UA3A 3B9NA 1GZJA 3WK3A 3OIXA 3TUUA 3E0VA 2HBXA 1B54A 1NDAA 1M53A 4NT0A 3URAA 2ZVIA 4LVGA 4ADSA 2HPMA 4APNA 4JICA 1KM3A 2QJNA 3WNLA 3GXTA 1ONXA 1QU4A 1W6TA 1XUUA 2Z1WA 3NYDA 2O9OA 1FHLA 4M56A 3UZ5A 1PZ0A 2YCLB 3BG9A 3WQ4A 4D6CA 1K8YA 3FYYA 3O9NA 1ME8A 4AWEA 4IJCA 5XIMA 3THDA 3IRDA 3EX6A 4PYSA 1PWLA 3RJYA 1BEUA 2NX9A 1ZY9A 1W1ZA 3CAKA 4NJHA 1C8XA 4TR9A 3ATYA 3NFUA 4EMWA 1J10A 2I9EA 4Q8MA 4RNFA 2YFNA 4ERIA 1T40A 3VGEA 3TXVA 3UERA 1HJWA 2V3FA 2GZXA 1XWYA 4H01A 2HNEA 3CGBA 1ISWA 3QY8A 4GHRA 3W7KA 4HTYA 3CQKA 3UG5A 3FNDA 4YWSA 3OGVA 4LUIA 4RLIA 2X8CA 1NVMA 3MBFA 3TAOA 4AVOA 3N6JA 5BOEA 1DV7A 2E68A 3LERA 5HUOA 1VAHA 3DUGA 3W7PA 3EDEA 2HXUA 4N0RA 5TNVA 3PZVA 4J35A 1N82A 3ES8A 3AS1A 2YR1A 2CW6A 1YXYA 2PLJA 2CBJA 3UQNA 1I0BA 3GR4A 9XIMA 1LLZA 4ZOHB 1HVXA 2BGSA 4DXVA 4B5XA 1P6CA 3R0KA 4H2CA 4A21A 3FS2A 5AYXA 2OOFA 3K8KA 3M5XA 4BF5A 1GOXA 1XP3A 1VYPX 3L68A 1JIBA 3C2RA 4BF7A 3IJDA 4A8RA 3G1XA 1HN1A 4PTVA 3E0FA 4XV0A 3UZJA 3BGGA 2PWGA 2QDEA 1WAWA 5LGZA 3K5XA 2PSNA 3EXRA 4ZO7A 3ZIZA 3CTLA 4IISA 3TQ0A 4AD3A 4REQB 1QOXA 1EOMA 1P0DA 4PZVA 4OZOA 4MWAB 4P8XA 4GNVA 1A4LA 4OBSA 1GSNA 1PZ2A 1NARA 4DWSC 4LAMA 3L4ZA 3FG2P 1DJWA 2QT3A 2A21A 3W26A 2R82A 1PKLA 2HDJA 4GH3A 3HW2A 4ZEPA 1EGMA 3GZAA 3M9YA 5HWNA 1W1VA 3PVFA 3NZ1A 4F2BA 2A8XA 4WLCA 4QJ5B 2G37A 3S9YA 4KFNA 1W0MA 2EBNA 4GPNA 1KN0A 1TSIA 1TJ2A 3KOYA 1F05A 4C7FA 4C6MA 1TIWA 1IEWA 3U3HA 5FEWA 4JQ9A 1J79A 5J8LA 1B3WA 5E93A 5FJRA 2FMNA 9CGTA 3ME3A 3NO5A 3H12A 2BVYA 2OZ0A 3IGXA 3TZNA 4LS0A 3UWQA 4Q8WA 2PU0A 5A95A 3F4DA 3UGVA 1DYSA 3NQAA 3R8GA 3VFCA 2V0TA 2DVUA 2VL4A 3M1ZA 4DZHA 3S5YA 2D2GA 3EA3A 2BSLA 3GAYA 3O0HA 2HRWA 3H2EA 4KQNA 4YWIA 2YL5A 4IL0A 2FH8A 5CPLA 2RDXA 1GQLA 3M5YA 3VGFA 5AHLA 3M0XA 2QUVA 4N02A 1OIFA 4LUYA 4G7EA 1HKVA 3VYLA 2D0GA 1MMFA 1GORA 1OG0A 1PKNA 1RJQA 1BLIA 1W1YA 1I0DA 3MMUA 2A0NA 3W87A 3NZRA 3M6YA 3VINA 1CXLA 1F9CA 4XO6A 3M0HA 5DLCA 3FJLA 2GQ3A 3G24A 3F4VA 2OLSA 3ZXWA 5KVIA 4MKNA 2VC7A 3PS7A 4W7VA 4HTBA 4P8UA 3QHMA 3ANUA 3L65A 3S1VA 2HXTA 5C54A 2Z28A 3DGBA 3WQGA 1PYFA 2GWNA 4KRTA 4ZSUA 4JL2A 1C9WA 3AS3A 3G0SA 4XK2A 2E1WA 4QP0A 3WD4A 1PX8A 5DX7A 4Z1BA 1PZ1A 4P7RA 1OFEA 4JKLA 1ZGDA 4MLJA 2CZEA 2V9DA 4Z2JA 4US6A 4J9JA 4EM3A 3P61A 4QLJA 1WKDA 2WHMA 3H2MA 2ZUVA 4QDPA 2E40A 2PEVA 3CK5A 2FZ8A 1J2WA 3GU1A 5HXMA 4Z0SA 1VB9A 2A1YA 3S9IA 2QNEA 1BQCA 4LV4A 2ZZ3A 2ABBA 3OLDA 4ZGYA 3L5OA 2PP1A 4CGTA 1YTKA 1BSIA 3ALFA 1NOUA 1H11A 4H9XA 2DFAA 2PZNA 3U2EA 3AROA 1AW1A 2RDWA 3MP4A 1CNVA 2BY1A 5A69A 4LIIA 2X0SA 3BARA 3N2BA 3AJXA 3LLFA 1TWSA 3LI1A 1LBLA 3LBOA 3UBPC 2IMRA 2VVNA 4XVDA 3ZR6A 1I45A 3VOIA 4XSMA 3EXSA 4XTDA 2FZBA 2E8YA 3QFAA 1FWNA 3MU7A 2FKPA 3BE7A 4DO4A 3PTDA 2VOMA 1R47A 3WLRA 1WNOA 1TTIA 1E3ZA 2OU4A 2RH9A 2VCCA 3L4UA 2F84A 4Z0JA 4ZVJA 4V1XA 1GERA 4WVXA 1I6NA 4JIQA 1K03A 1A80A 2OWXA 5D9OA 2UWFA 4U10A 1PDZA 5BOOA 1DJYA 1B3ZA 1FCUA 1FTXA 1CGXA 1TKKA 3R07C 4OBRA 3VDAA 6XIAA 2DUZA 1D2KA 3AXKA 2CLFA 3RMJA 4YN5A 3DHDA 5CH9A 2MUCA 4UCGA 4QISA 3W1QA 4GQRA 5CSUA 2FFCA 1XIGA 3N15A 1XHCA 4N4PA 4HNLA 1Q8JA 3S5NA 1GJUA 4PCFA 1WAUA 4KPLA 5E9XA 1KFCA 1W37A 1KWGA 5KZEA 3E02A 3QZEA 4KGLA 3ITXA 3RO8A 4ERGA 4UWMA 4XD3A 2FPVA 2EG6A 4JTAA 3U5UA 1UR8A 1F8WA 2XIBA 3CAQA 2V5BA 1IZJA 2XN2A 2J77A 4FHAA 4B5UA 4ZQRA 4HK6A 3S1XA 1JULA 2A3EA 5LIYX 3A5VA 3GH7A 3N34A 3LTYA 4CEUC 2G0WA 3WUFA 4NRRA 2PLMA 4H9MA 1P4CA 2G50A 2CLOA 3ZYZA 1FWSA 1CGWA 1X2GA 1SZFA 5C7HA 2V3GA 3AWNA 1TWDA 1LP6A 1TVNA 1UMYA 2PBGA 4O57A 1XBYA 3TTSA 4JYEA 4JDYA 2F2HA 4C6PA 3A3WA 2DZWA 4DB7A 4TVUA 2XJ7A 2DUAA 3SFKA 2C3CA 1LOQA 5AHEA 3JZEA 3WD3A 4Q7BA 2D2JA 1FA2A 4K36A 4QNEA 2CHRA 3FDKA 5ER0A 2DU2A 3COTA 4LF1A 2PAJA 3NQ7A 2YXGA 5LNWA 2NT1A 2HQMA 3IAPA 4XTIA 3PBYA 5HJYA 1IT8A 3B9EA 1TX2A 2DZVA 3NURA 2XU2A 2YYUA 3WJSA 5LNVA 3RNMA 3A4AA 2OR2A 2FHBA 3APGA 2GSEA 2V68A 1GT8A 3VTRA 4ATWA 4GI8A 1PVNA 1LROA 3TN4A 3VIKA 4WKAA 3UZZA 1GV4A 2EXOA 1IXOA 1V6XA 1JUEA 5FKYA 4KCUA 1OINA 1FO4A 1LT7A 3PZGA 2P10A 2XN1A 2WPBA 4RE3A 1UJPA 1TZZA 3BAWA 4YVPA 2D20A 4XAYA 2H3BA 4NJJA 2I56A 3TTYA 4QDWA 1UD2A 3TYAA 4JD4A 4OU1A 4G6CA 3K1GA 5ABFA 4LCSA 3Q65A 5AB3A 1ZCCA 2OT1A 5A1AA 3DU0A 3B8IA 2HE5A 3ARSA 3EDKA 4MJZA 2QPUA 1Q2SA 4N4QA 2NSXA 1KA9F 4IJRA 4C5ZA 4O1BA 3A7RA 3PSVA 4AUBA 1JI2A 2AKMA 3W28A 4LGXA 2MNRA 1FH8A 1MZRA 3HQNA 3QR3A 1VFHA 5JRBA 3SFWA 3GTIA 2W9MA 2GJXA 3GNOA 1F3PA 3LD5A 4JTEA 3W7NA 1MEHA 3TAKA 3S3GA 5H2ZA 1L0PA 3LRMA 2VX7A 3W02A 2WMKA 4F9DA 1Q7QA 4V15A 3H4WA 3TONA 1V08A 5CQ1A 3NSMA 2J7CA 4DWSB 1XIEA 3O8AA 2YLLA 2F2KA 3OYXA 3TYBA 3WJXA 3S8HA 4FLRA 5C0QA 3P5ZA 2W27A 1GEUA 2WSRA 3QHOA 4FO4A 3FLUA 4QLLA 4Q8TA 3I4KA 3OODA 4PTXA 3MWCA 1OGSA 2XVGA 2E0PA 3GHSA 3STCA 4H4RA 1H7WA 3CL8A 4AF0A 4CNOA 2E9LA 4DJDA 2Z6IA 4AYSA 4O52A 1FCVA 2XSXA 2WLYA 4GVHA 2BXZA 3SR7A 4FEZA 1VFTA 4U4MA 4JFTA 5BROA 5EBAA 2NVAA 4HOZA 1HO4A 1Q13A 2Q8LA 1OK6A 2V67A 5BMXA 1CIUA 4XZBA 3WF1A 2XG9A 3T09A 4HPNA 3QW3A 4GYPA 4PTDA 1WBHA 2R14A 2H6RA 3LPPA 2QCMA 3P0XA 4NJIA 3W2LA 1BYAA 3P84A 2BHYA 4AEFA 3UR7A 3MSYA 1ISZA 4HKPA 3L23A 2DT1A 1YPIA 3AJ7A 3EX1A 2YCKX 3JW7A 4URIA 4ZO8A 1Q6DA 3MI3A 1IEVA 3T08A 4L56A 3WLNA 1V6VA 3VD9A 4CQBA 1NQKA 3LSCA 1NIUA 4NU7A 3MUAA 2DZUA 3G1YA 3LXDA 1BFNA 3G1FA 5DQPA 3K8MA 3WQOA 1GZ1A 4U5IA 4XKYA 3LTPA 1EQPA 2A6NA 4M80A 2J78A 5CC7A 4W89A 4FIQA 1X8FA 3P8IA 2ZKMX 4M5PA 1XPGA 4FI4A 4BY3A 4QEEA 4UZUA 2XH2A 2EQ6A 3W81A 3ARZA 2WSPA 4PH6A 2PZ0A 2QV5A 3QTGA 4NZJA 1FECA 3O6DA 3N11A 1L2QA 4J28A 1NH6A 1OFQA 2VM8A 1TPFA 4CQ9A 5FF0A 3FJ6A 2W4XA 1E0XA 3LSBA 3SQSA 1XYAA 4TVDA 4NNCA 1IWAA 3RYSA 4JTIA 1W3HA 3E49A 1X1ZA 1N5WC 1H4PA 4XZ9A 3THUA 4OHQA 3H8AA 1I2NA 1NJJA 3I7RA 3SRHA 4GVIA 1H1NA 1L8NA 4E6MA 3QFEA 3KL5A 2YDRA 3WF0A 3HG5A 4I7VA 3GU2A 4M82A 3WSUA 1BG9A 3O7UA 4AD2A 4GZ7A 4LAZA 4RDZA 3VMNA 1H62A 2VWSA 4JZ5A 1FXPA 3SCUA 3QN3A 4LY4A 2W3SA 4NIRA 4JS3A 4IIGA 2OEKA 3N1AA 1Q7ZA 1KQYA 5K7JA 7A3HA 2CXEA 3C6CA 4S3CA 4JY9A 1J0ZA 1T7LA 4XQ6A 4C6BA 2PWVA 3EX3A 4W5UA 2B7PA 3A7UA 3ARTA 3SY5A 4UXDA 1OFAA 4RCXA 5E0FA 2P53A 2ZZ2A 1DIDA 3P14A 3EEZA 2EG7A 3FVMA 2VJXA 1JGIA 5IFPA 1E55A 2HISA 1FKXA 3W2KA 2WPCA 3M0MA 1ECEA 1R5YA 1J0KA 1X38A 1AJ0A 4Q33A 1XW8A 4H4UA 3UT0A 3OBKA 3E38A 3HGJA 1W5MA 3MQTA 4Q8VA 4C91A 3MHUA 4LWWA 4L9YA 4TQTA 1DJIA 3C2YA 4IP7A 1R7OA 3G6LA 3M5VA 3AU2A 3ZJ6A 1TFVA 2I5QA 3EWUA 3M0ZA 4B5WA 1B3XA 3UCQA 1D7FA 4DUOA 1Q6QA 3WJZA 1YNQA 1E56A 3VX0A 1WDSA 1X1NA 2YYTA 4A3UA 4YTUA 5A8QA 2DSWA 4C1NA 5EPDA 5I3JA 5A6BD 3KBNA 1YBQA 3DKLA 1KFBA 1Z32X 3QOMA 4WXYA 2AOSA 4QAWA 4FXRA 1EJRC 3M44A 2DT0A 4BI6A 4UFMA 1F8IA 3LMZA 1K6AA 5DCDA 2XISA 3RM9A 3SW6A 1K7EA 2J24A 2WHJA 2PD9A 4KEVA 1QNOA 2A5HA 4B3KA 3NJ3A 1TA3B 3LBMA 4WGXA 4M51A 4F79A 1CXFA 3Q58A 1XLGA 4GUGA 4O15A 1FP9A 1AW5A 4QXIA 4O10A 4C6OA 4WK9A 2XFWA 3VMPA 3N17A 4MZ1A 4EMJA 2E5DA 4MNMA 1JEZA 2LLEA 1QNQA 5FSDC 1SW7A 2A2IA 3LYEA 4AAJA 4LS2A 2VC9A 3P93A 1ZJHA 1AJZA 2RDTA 5AYBA 3DKJA 1QOQA 5G1YA 1ONWA 4PSRA 1QI4A 1PWMA 5M1TA 3SCRA 3KFTA 1RQBA 1V93A 3NS1B 1VPYA 3T0AA 3KE0A 3LPOA 4GH1A 3OZPA 1HL9A 2PTWA 3ES7A 4UTLA 1E9YB 1QMLA 1BRLB 4S3KA 2VRQA 5E70A 3ZR5A 2WMIB 1DE5A 2ZVRA 1GZGA 3MSDA 4DUWA 2DIKA 1XISA 3SB0A 2JKEA 2PGFA 2PLKA 3DDMA 1KM4A 5FAJA 2WNZA 3BTNA 3BCDA 3K2GA 3MKKA 3AIWA 3UCCA 3PZIA 4QDMA 1H63A 1JXJA 2BOGX 3KZSA 4K2SA 2E3TA 2BFGA 3CXOA 3VI2A 3MUY1 1GXFA 2VXNA 5D9PA 2VEGA 1OG6A 2Y62A 3C0LA 3O05A 2VZUA 3S42A 5A6LA 2JKAA 3HF3A 4I8YA 4O1DA 1GVRA 1UP0A 3GTNA 2W62A 1EBHA 5IRPA 1PX3A 5EFFA 4E8GA 2CLHA 4B5NA 1Y5WA 1TMQA 1OCBA 3TW9A 3JRKA 1EZWA 3W6LA 5HNRA 4LANA 3LG3A 5F4WA 3IAQA 2FYMA 1SUXA 3STGA 2ZA2A 4N9EA 2XIQA 3TMQA 1FFQA 2PWUA 1XF0A 3TFCA 2YBVA 2J8GA 1MFUA 5JXQA 3E12A 3BPWA 1QJWA 1EWEA 3ARQA 2OOGA 3VKCA 4H4PA 1BF6A 3T6CA 4JBRA 3MSRA 3TJIA 4RW5A 4HPJA 4Q8OA 1ZTVA 3D46A 3S6DA 2G97A 3WQ8A 4R5EA 3BCJA 4QFUA 4HU4A 2NQ9A 4QIUA 2ISDA 4MOZA 2DZTA 4CVUA 5I5RA 1EP3A 3IJ6A 2QUTA 4EQXA 3SRKA 3CB3A 2DIJA 4UBPC 3FA5A 4QNWA 1KRMA 3VVGA 4FX9A 1C7SA 3GIQA 2F6UA 4FX6M 2J6VA 2E77A 3G2GA 4JX4A 4PCNA 2YPIA 4DJFA 2QYGA 3VUSA 1NEYA 2ZXBA 4Z2HA 1UIPA 3H2NA 1GRBA 4O1FA 3VPLA 4IFKB 4LH8A 1B9BA 1F6PA 1EF3A 1ADSA 4GUFA 3WH6A 3VDHA 2W92A 3O6YX 5AHMA 3LADA 5JIPA 3EOEA 4D6IA 5EMUA 1UQZA 1F2JA 4TV5A 4XIAA 4GVGA 1VKFA 3C2OA 1R9XA 3EAUA 1VPQA 1XIDA 2FZ9A 4IMEA 4DF2A 1TV3A 3N29A 5H8UA 5I78A 1OK4A 3ZMRA 2FIQA 3GD3A 2PCEA 3G0UA 4QLKA 3T42A 1YEYA 1TV7A 4A22A 5BWAA 2Z24A 3AXIA 1AVAA 2EJAA 4CNUA 1UH2A 5K9XA 1H5YA 2NX1A 1BTMA 1F73A 1RXOB 5HWJA 3HM7A 3PAJA 4I9MA 2X1UA 4GO8A 1IWBA 5AC8A 3L7RA 3R58A 2WSQA 4IF2A 4WGHA 2RKXA 4XG1A 4AD0A 1GHSA 1JCTA 3POCA 4NNBA 1A53A 3PZNA 4MDPA 3IJLA 1M01A 2Z7GA 3R0DA 4AZCB 4IPLA 4B2DD 1CLXA 2BS9A 3W1RA 2ZRZA 3LCLA 2OSWA 3UZXA 5D32A 2ZZBA 1VBJA 3FKKA 1OIMA 2Q71A 1Y65A 1FX6A 3PULA 2PS2A 2O56A 1RBAA 2ZTJA 4BQ2A 5BXPA 2DQXA 3W72A 3S1UA 4LQ1A 3H22A 3ZT5A 4L1WA 3H2AA 3F2CA 4H50A 3G8EA 4IX2A 5A6JA 1L6GA 1TV8A 4IIHA 1UUQA 3TYEA 2EQ9A 2Y8VA 1V8EA 3EOSA 3ZT7A 3CXBA 2PTZA 3WH8A 4GR1A 1W91A 2ZXAA 3XIMA 4HK5A 2PDWA 1XYZA 3NM3A 1JRCA 1EC7A 2PE4A 1VBGA 3LXCA 1ONEA 5FI8A 4ZCWA 2JKPA 3OHIA 2YL9A 3HURA 3BW4A 3VIFA 3AO0A 3QKZA 1GRAA 3LZ3A 1ZJIA 4HA4A 4Z2IA 4E0CA 1S7MA 4JIEA 2Z0IA 3CZKA 4YLWA 2VFFA 2VQTA 3KLLA 3GR8A 3CIXA 4HPXA 2WVSA 4OUEA 1RBOB 4O13A 3CNYA 4DBUA 3T0BA 1KM2A 1QNSA 3ZWTA 2GUYA 3E2SA 4A05A 1FHVA 2R8WA 4MB5A 4PMOA 3KRBA 1GJPA 4XAGA 2UZ9A 3BZGA 5DEZA 2P3ZA 3AHXA 5TAOA 4PMYA 4MADA 5GQBA 2ZOXA 4BZYA 2VDIA 2BG5A 5CJNA 1JCXA 2PODA 3M0JA 3CLWA 2UY2A 3IWPA 4BI7A 2RGLA 2GDQA 4J3ZA 1WZKA 2PDCA 2QR6A 3T0DA 4IMAA 5LHEA 3E1F1 1P7TB 3UXLA 1UC4A 1JDAA 4LU0A 4H19A 5E1QA 2A3AA 1I4NA 4CU6A 2E7FA 3SADA 4QJ4B 5I09A 3NNTA 3WLQA 4R33A 5K9CA 4QITA 4BWLA 2RGMA 3DENA 4EXBA 5CKSA 3W2UA 1JFHA 2WWDA 2PRHA 3PY2A 5T26A 1TVPA 1MUWA 1XSKA 3CGCA 1Z7AA 1DHPA 1QPNA 1ELSA 4YIWA 4LT9A 3GLCA 4ORMA 1MW1A 4GXWA 3QR1A 4AEOA 2CWNA 1YMYA 1XL9A 1WKEA 3SQPA 3LPFA 1RP9A 3UG8A 2J4GA 4NJKA 2ZUTA 1L2UA 4Q7NA 3VGDA 1QVBA 4JKKA 3HN3A 3ABSA 2OJPA 3OZYA 3UG3A 4R3UA 2X41A 1VIWA 3CH9A 1BWCA 3UFYA 4CEXC 2WVVA 4LUTB 2VQUA 3GNDA 3TFXA 2Q01A 4YL2A 3W2NA 1NHPA 3ZLFA 1RUSA 2VEKA 2XPKA 1WDPA 4KWSA 3WLOA 2ONEA 4GKTA 1IIHA 1EWDA 1EO5A 4MUZA 2QJIA 3CUHA 4H8NA 4ZODA 1XC4A 3WDHA 1HKWA 5D33A 1BVNP 2PDMA 4PUEA 4JIPA 3KM8A 4HHPA 1M6IA 3LHZA 3OGRA 4UTMA 1KR1A 1L9WA 1XH0A 4JCLA 1D7KA 3GHUA 2FPTA 3WJWA 5L9FA 2WOWA 3ORWA 5I0DA 1MW0A 3I65A 4TTUA 3CIWA 3W7JA 2D69A 4NXKA 1S5VA 1K6WA 4FLSA 2AGKA 1A5UA 3DK8A 4ENLA 1C3FA 1SJDA 3OQ8A 4H4SA 5DBTA 1XIJA 4MB1A 2X7VA 4OV4A 4GC4A 1FQ0A 4CN1A 1R3WA 1OVDA 1SJAA 2CYGA 3GXPA 3KBWA 5C9ZA 4DLFA 3I10A 3D47A 3LXBA 3MDWA 1HJXA 1EXPA 1UA7A 3BANA 4YWOA 3LBCA 5A5WA 1YTEA 2DJLA 1R2SA 4X0VA 4P8VA 2ZE3A 2QW5A 1YDYA 1NWSA 4CCZA 1HKMA 4KERA 1UIOA 4GXPA 4KEUA 1XH1A 3VD4A 4QRNA 2X2YA 3T07A 2V3BA 4IPPA 1HO1A 4PMDA 1X7FA 4IFKA 4NEWA 4Y9OA 4ZL1A 1TWZA 1IEXA 3BH4A 4A3QA 1LPFA 3M0YA 4XD6A 3QGAC 1YHTA 1VLIA 1LYXA 1NPXA 2O92A 3SY8A 4K8DA 3QGKC 2QHAA 2HTMA 2BX7A 2VD9A 1M7OA 3GFYA 5BXRA 1G67A 3PJUA 2JK6A 3EWZA 8CGTA 3BXWA 1VDVA 3GC5A 3DGRA 1WPCA 1K8CA 1XINA 1JPKA 1P5BA 3QSRA 3WBEA 3G1AA 2POZA 4K1GA 4GABA 2X0YA 2DZXA 3F2DA 3QY7A 3LCFA 3I3DA 1VENA 1K8ZA 3IPWA 3VGGA 3GDKA 2Z1SA 3ETRB 3L4YA 2DJXA 1UCWA 5K4XA 3CIVA 1C8QA 3TTOA 2B0MA 4AIEA 1GPFA 1XDIA 3W6MA 1QNRA 1RY8A 2DSVA 2WOIA 3RG6A 4IG2A 2V3AA 5EB8A 2PWHA 1GQJA 1B4KA 5T9CE 4TIMA 3ONCA 4ICCX 1PYMA 4IGMA 1VFLA 4LNYA 3ANYA 2VENA 4GUHA 3HPZA 4BR1A 1GOMA 1WE5A 1E51A 1JF6A 3TCSA 4CD7A 4UNKA 3CV1A 4B3ZA 2YXXA 3U2ZA 4L61A 2ESCA 2AL1A 3T55A 3R8HA 3NVWB 1M65A 1Q4NX 1WOAA 3KS6A 1RA0A 1H7XA 1EJUC 1PAMA 1N61C 4QG6A 1UHVA 4BURA 3FGCB 5BW6A 3M0IA 3SGGA 1JRPA 2DSKA 5G4EA 3L4VA 1K7XA 3TR9A 1CGYA 1TELA 4L4PA 3K4WA 1TPDA 5D2VA 1E40A 2YOCA 3R43A 1DXLA 2VCBA 3C0SA 3GO2A 3PJTA 1WUFA 1YQZA 1Q6LA 4R9OA 1B57A 2P5NA 2YB4A 2VO5A 6ALDA 3GG0A 1LUCB 3GDLA 3TN6A 1RHCA 3AMCA 1FOBA 1E15A 1HW6A 1KLYA 3CHEA 2YCIX 3DFPA 1QR7A 2J7BA 1S2WA 1GG1A 4RV3A 3OO2A 1V4YA 2FZMA 1GOKA 4Z1DA 3F03K 3FSUA 4JR5A 2VELA 5D03A 2D23A 4C65A 1XLCA 4J4KA 6CGTA 4LUSB 1J4EA 1CT5A 3TLQA 4I5XA 1R87A 1AODA 2YDQA 3M47A 2B7OA 3Q6JA 2YZ5A 3OBEA 2OLAA 3SIZA 1UP2A 3WZ0E 1A3WA 2JGYA 1B31A 4PBGA 5FF7A 3A12A 1W3LA 4LEQA 2PDPA 4OT7A 2GGEA 4CNNA 4Y9NA 4N6EA 1H1ZA 1KNWA 2E5AA 4PB3A 1BXNA 4A3HA 4MDOA 4ZXOA 2RJGA 3UU0A 1DWHM 3BG5A 4EPKA 2BY3A 1A5CA 3QQ0A 1X6LA 1DNCA 3L0KA 5EMMA 3WD2A 4DF0A 2MANA 2WSKA 2W79A 3WQWA 1I2PA 3F2BA 2WC4A 4JIIX 4YYFA 2KX9A 3M7SA 5FS6A 4H4WA 2IW0A 1V0NA 2YB1A 4GBDA 2HCVA 3GNPA 1C90A 7ODCA 4WY0F 2VMFA 1FWAC 3AHTA 4GY1A 4NI8A 4UTUA 1L8PA 5JCKA 4I7UA 4ONVA 4JN7A 3ECQA 3BZJA 1ADDA 3RHGA 3BOFA 2QPXA 4V33A 5EFDA 4Z1CA 1LWJA 1FWJC 1UMLA 2F38A 4US5D 5HNNA 4ZENA 1CX9A 3OA5A 6REQB 1JZ6A 2FJKA 3EB2A 3VMOA 3POHA 3V36A 1E1CA 3EEGA 3BL3A 2BC1A 1TE6A 2ABAA 1US3A 3E3HA 4EF8A 3D6NA 1LL7A 2GFTA 3W85A 4PFHA 1R9YA 3BJTA 1U2YA 1JFXA 2ZWYA 3R2GA 5F2LA 3GKFA 4R53A 2VRJA 3AI0A 2CKSA 3GFXA 3IJQA 1PCWA 1VCGA 2VGBA 3VAVA 4KCTA 4PMRA 4CCCA 1EF2A 1KBKA 1ZQ5A 4MY9A 3IK4A 4LSBA 3CZJA 4PULA 3KBMA 4KGJA 5MF5A 3B8WA 5CAKA 1R3VA 2GOKA 2IPJA 3P2VA 4C6FA 3WEMA 2WQPA 2Y7DA 1R86A 4UB9A 4KMQA 1OCJA 5DY2A 5U4NA 4S23A 4ZQOA 4NZ1A 4TX8A 1O5KA 3UWVA 3IK2A 4XBSA 3DN5A 3S2MA 1JD9A 2GPTA 3M0VA 2V38A 3DI0A 5REQA 1W5OA 2QULA 2XVPA 3C3NA 3OPSA 2WKLA 3EDJA 3C8NA 5H6HA 2CFFA 1CXEA 2CNCA 3R8RA 4HCDA 3OHMB 3TTQA 3AALA 1P0NA 4L1GA 4CN4A 5DRIA 3SI9A 4RE4A 2NWRA 1XLFA 2Z1VA 4HOXA 3BGAA 2BTMA 1HXJA 4UQDA 4AB4A 3MANA 5I07A 4H4IA 1EPXA 3H55A 1HGYA 3WFLA 1SR0A 3ZFHA 1QCWA 4GUJA 4AW7A 3RMEA 1OYBA 5C9XA 2YIHA 3VZYA 2CHOA 3U7VA 1IF2A 3BURA 3LENA 1S5TA 1ICPA 2FJUB 1IT7A 3APYA 4XAFA 5AYYA 1ZK7A 1GOQA 1TE1A 9XIAA 1KWKA 1Q6OA 3O15A 4QHRA 1UOZA 1K8XA 4NX5A 5E0CA 2BWGA 4Z08A 3RDKA 3BWWA 2V82A 1P6BA 1Z48A 1TREA 3LCIA 5DXYA 3LHYA 4WOZA 3D5HA 3WQDA 3HA1A 4ACZB 2QCEA 1KGUA 4TU1A 1KQZA 1XI3A 2JF6A 2WVUA 4HB7A 4DBDA 2DORA 1NFPA 3KW3A 2YX0A 3PZQA 1P0KA 1I1WA 4DEFA 5G4WA 4WKFA 3VCNA 1XYFA 4HNCA 3G18A 1UD6A 1V3JA 5AZ0A 1XBZA 2OXNA 1W9XA 3W74A 3B9JB 5DO8A 4UTFA 3P74A 3SECA 5GNYA 2QAFA 5CJ5A 3WQEA 4G2DA 1CW2A 4XZNX 1WDQA 4OBTA 4A2SA 3PPGA 3C4UA 1EPVA 3B4YA 4JN6A 1A0EA 2CKRA 3EZ4A 3DHUA 4UNIA 4EMIA 3PM6A 2OX1A 1VPXA 1TX0A 1XYBA 3N4EA 2JEPA 1RCXB 4OIFA 4FX7A 1KV5A 1T96A 2H9AB 2PDLA 3NXFA 1JYVA 3UGRA 3AUOA 4H6KA 2J25A 1CCWB 3QBUA 3FXYA 1BGAA 3ABQA 1O94A 2GVEA 3WQ5A 2QJMA 2Y24A 3ABOA 1I2RA 4H4TA 2QGHA 2OZ3A 4LOCA 4WJXA 3AXXA 2WPGA 3N3MA 4RE0A 5AHIA 5A8GA 3WQVA 2Y89A 4HU3A 5E0KA 1ZLPA 5KMYA 4WSJA 4TV6A 3W27A 3W4RA 3NZGA 3R4IA 2WMFA 3N18A 1GOWA 3T9PA 1TPUA 1NDYA 1PKMA 2FMOA 4ZOEA 2DSZA 4HZMA 1WUEA 2PGEA 4IIFA 2OKOA 2JBMA 4RUBA 4WEVX 3QQ1A 3UETA 1OYCA 2WYSA 3C86A 5EBKA 3CM4A 4B5TA 1V3KA 3BDKA 4FNPA 2FHFA 4MZ8A 4GA8A 3BQ5A 4FF5A 4A3YA 1FWTA 3N2XA 2V6OA 2CFYA 4L80A 1DEDA 1QBBA 1TCDA 3FYPA 3P0WA 4EWJA 1LQ0A 1MDLA 3MW7A 5HMSA 3I6RA 3PWGA 4O28A 5FA5A 1UZ4A 1XLJA 3TA6A 1G01A 4HA3A 2YA1A 1O60A 5IHRA 1KM1A 3N12A 3EPOA 3B9AA 2NPXA 2B7NA 3BLLA 5HR7A 3U8GA 3HRDC 3UCDA 3V0UA 1OD0A 1PO9A 2J7HA 1JD7A 3H70A 1XLEA 4N42A 1VBHA 3AYRA 4N7QA 1QUMA 1U5JA 2OLHA 1F76A 1X1OA 1V51A 3UR8A 5E5CA 2GVYA 1NY1A 2BVDA 5FESA 2Z1XA 3DFQA 1F07A 3GZ3A 3JZUA 1GVOA 4J3UA 3BLEA 2AMGA 1V79A 4ZB2A 4TMCA 3TN5A 3VZXA 1DPMA 1G4SA 1LRQA 1H7NA 1R85A 4D71A 1IR1A 1KR0A 3L9CA 1F74A 1PV8A 2CDUA 5F4XA 1M1BA 3STFA 3Q37A 1QI0A 2QJJA 3W71A 4CNSA 1QPKA 3GC2A 5K4ZA 2JF7A 5A2CA 5CZKA 3T78A 3GXIA 3EWWA 1PCKA 1P1XA 4NAEB 1BKHA 4RZ4A 4OKDA 4PMQA 2DVXA 3LY0A 5EU9A 5E09A 2EPLX 4MNKA 3LB0A 3GE7A 1H2JA 2XYLA 1TJPA 3T8LA 4UQCA 5CCZA 2GH5A 2VP8A 3II1A 1FWEC 1Q7MA 2D24A 4YNGA 2WJFA 4S3JA 2B31A 4U28A 3WLKX 3H4KA 4MUPA 3PZOA 1QDSA 1EHNA 1EJSC 2ALDA 1DIOA 3N19B 1F3EA 3DFHA 1VJIA 1KV8A 2VFHA 2QUUA 1OZMA 4MZYA 5HDRA 1F61A 4R7WA 2ZBTA 3EYPA 5G1TA 4UTWC 2CERA 1XFCA 3F4CA 3ALGA 4Y9AA 2ZIDA 4M6UA 3WNOA 4FDCB 1XICA 2XZ7A 3UPWA 1AD1A 3VO0A 1V03A 2E9BA 3QV6A 2XZ9A 3H6OA 2ZQ0A 4PE8A 3HG4A 2GK1B 5D9MA 1VEPA 4HGXA 3VA8A 3MJMA 4HU0A 4JTFA 1TZ9A 4H9ZA 4CNTA 4KRUA 4KIEA 3FA4A 1EP1A 5A6SA 1EJWC 4GFSA 3AYSA 3GSMA 4HIBA 3NUKA 3HQ1A 3W7IA 2BLEA 2ANUA 4FR1A 3N4AA 2CLLA 2PF0A 3AICA 3L4TA 5BWFA 3B0UX 4RV8A 3WDRA 3VE7A 1IEIA 2L5HA 1WX0A 5D37A 1E9LA 3OQEA 2ACUA 1H5VA 1DJZA 1KD0A 2ATMA 5FJIA 1UR1A 2VGIA 3M43A 4IJBA 1JVNA 2IPGA 4F40A 1DQUA 3D3FA 3FX4A 1O4UA 2FGLA 1GESA 3A47A 4MIMA 4MWAC 3HG2A 1ZXIC 3W82A 2J3NA 4GOAA 3W7LA 3HPAA 1JYXA 2VUYA 1UWIA 2FFIA 2CZ5A 3ARWA 1VJSA 2J7DA 1Z69A 4FOJA 1AQ0A 1UASA 4HZ8A 1UWUA 4IZGA 2WHKA 1IE7C 3PN8A 4DZAA 5LZLA 2GVGA 4MB3A 1OFPA 4JYFA 4A4AA 1ODZA 3CO8A 1OC6A 1YDOA 1UP3A 2AKZA 3SCVA 4XKMA 1BGGA 2ZC8A 4MPQA 1V6WA 2AQVA 3MZNA 2YVGA 1UR9A 1O5QA 3MUIA 1OT2A 1QNVA 4PL2A 4B15A 5AYZA 3TN3A 3PNZA 3GW0A 3AFBA 2PRMA 1UD3A 2PUZA 1Q2RA 2V6AA 2GVLA 4JQ1A 2DZAA 3G1RA 4HJWA 3ABRA 3NXLA 1HJUA 1OGGA 1LWHA 2W67A 3L4WA 3WDPP 4M52A 3DESA 2P1FA 5HNTA 2QPSA 1XG4A 1FUYA 3ZLHA 4GC3A 5CJMA 4CUCA 5BRQA 3C56A 3K13A 1E6PA 2CIPA 1KM0A 4NILA 1VRXA 2H9AA 1PDYA 1QI5A 1JPIA 1JR1A 3OZMA 3DK9A 4B5VA 4H83A 1EYWA 3QGVA 2NXHA 4DO7A 3EX2A 5C55A 1EFZA 2OVLA 5G2IA 2GR0A 3TMLA 3PBWA 6ENLA 1VYRA 3TTEA 1BVZA 3C3UA 3ZJKA 1JXKA 5AOUA 4ZFMA 1ZL1A 1ZMDA 4H8HA 3IIXA 3VGHA 4LVFA 4U31A 1IXQA 1HKIA 1VBUA 2VWTA 4AXKA 1AG1O 3ICJA 1OHLA 4XWUA 2C14A 4F2UA 2DV0A 1N55A 1CB2A 2PD5A 3FJNA 4GYPC 1SO3A 2WSYA 1EJ7L 4NJGA 4BCEA 2VEMA 3EKZA 2PDQA 2XIMA 1RV8A 5LXXA 4G7EB 5AC4A 3EAOA 3I4EA 4TMBA 5DMNA 2ZUUA 1V59A 3VM5A 3EBVA 2GLKA 1OCNA 3WUBA 1AQMA 3CTTA 4DZ5A 2QCGA 2O0TA 4C6LA 3LHTA 5M03A 3BMVA 4UOQA 2BP1A 4AZBA 1P0BA 4XB3A 1Q6CA 1N8FA 2I1OA 1FWCC 4E3VA 5K3VA 3MMTA 3INPA 3FW6A 7PTDA 4LBUA 2HROA 3BGJA 3PK7A 1A5OC 1HT6A 4ZSTA 5A6BA 1X2HA 3ZSTA 5IOBA 3W1LA 5MKGA 2QZRA 3KTCA 4QAIA 2VX6A 2VURA 3KHJA 3VD5A 3GDMA 2EF9A 2OODA 1OY0A 2EGZA 1YRRA 4K7VA 4HNTA 3NVDA 3MSGA 1K4QA 4FLOA 2ON3A 3TX9A 5EMJA 3NGJA 3AYTA 1US0A 4I5UA 5HQEA 3GDBA 3UG4A 5JCNA 1FVPA 1RD5A 3UJSA 3MDUA 4KESA 2HZGA 3FCPA 3OGSA 4UR9A 5AY7A 1YQ2A 4GI4A 1M7PA 4B92A 1KBLA 4GX9A 4I9JA 4KFPA 1OC5A 3G3DA 2VNCA 3RRAA 1NFGA 3RFAA 1LT8A 3W1TA 1K77A 4XZLX 2OGYA 4D8AA 3P82A 1GK8A 4NNAA 5CEWA 4AC1X 3MT1A 1UUMA 1STZA 2ZZ7A 3PUGA 1E73M 3VIGA 4W93A 1PKYA 1W9DM 4MVAA 1Y5XA 3ARVA 2WCGA 1A4MA 2GSJA 4ZZ9A 3DYPA 3FSTA 4WDWA 4F3HA 2WZHA 7XIMA 4X2RA 3V1PA 4HOWA 1YE4A 3IIOA 1X96A 1XS2A 3WLTA 4X60A 4JTKA 2JGQA 1HKKA 4YVXA 3YPIA 4E4FA 4PUUA 3HOJA 3KTXA 1LRTA 1Z41A 1BVWA 3MVIA 4MB4A 4AWUA 4O4WA 1RAKA 2V3EA 2XM2A 4HMCA 4W86A 3FOKA 5HULA 2YW3A 3OW1A 4MWAD 2ZDSA 3NDZA 3L12A 2P50A 3CYVA 4I6VA 2HVMA 4H9YA 1GCYA 3NO1A 2GOUA 4NY2A 2QMJA 4KWVA 5BCAA 4DHGA 4LXFA 3W73A 4H8VA 1OX4A 1SO4A 2WHLA 4JTHA 3WLHA 1MXGA 1RLCL 4LVDA 2WOQA 3TOYA 2XSBA 4WD0A 4H00A 1W5PA 2ZUWA 1GJWA 3W70A 3E0WA 1LL4A 4X61A 4HNNA 2H8ZA 4TOQA 4FB7A 3AIBA 3CUJA 4TX9A 1XSJA 4H4ZA 2GK1A 4HMDA 1TV4A 3G3MA 4FOKA 3GD4A 2FGBA 4IWWA 3BLPX 4HPGA 3CZLA 4IICA 3GY1A 1Y7VA 4O19A 5BRBA 3ZOAA 3GRSA 1HJSA 1EDTA 1VQTA 3OTRA 1N8WA 1VFMA 4JQ2A 1AD4A 3SSZA 3TXZA 3SR6B 4FF7A 2HNHA 4F0SA 3SGZA 3RPMA 4S2BA 2PDNA 2IKHA 4UMCA 4JTLA 2XWEA 3MV01 3VE9A 2SFPA 1E6ZA 1MRQA 5J5DA 3SCPA 1DWJM 1RQEA 5H8PA 1A5LC 1LF1A 4IM4A 3PF3A 4J57A 3RILA 4D8LA 4WQ6A 1UWTA 3VU2A 2VDGA 3HTWA 1IXPA 4IOTA 5I3IA 3N2TA 2BODX 4RZ6A 1D7YA 3GXFA 1WZMA 1Z6KA 4P5UA 1OFBA 4V28A 1FWWA 1R2RA 4Z1AA 3WLSA 3RK8A 4TX6A 4QEHA 2QIIA 2RHGA 4Y8FA 3BK0A 3CHDA 2OELA 3RPTA 2BASA 5J04A 3NGFA 1EA9C 4K7YA 3W53A 4D6FA 4DELA 2D3NA 1U1UA 1WV2A 3SY1A 1DJQA 1MRAA 2A7PA 3GXNA 4EXAA 5BRPA 4PUNA 4HK7A 1VLWA 3R25A 1EEXA 5T8GA 2ZZ0A 4ILSA 1XLIA 3GVRA 3IVUA 1FEAA 3QRHA 4AZ6A 1JUKA 1VD6A 1HGWA 1Q8AA 4HZ6A 5HA7A 3LXAA 3ENLA 3GVGA 4UMAA 1EH9A 3V0SA 3CMJA 4JY8A 4UR7A 3MUXA 2A3HA 4P7LA 3USBA 3EOLA 1N8IA 3UWZA 1UKOA 2D0HA 1QWGA 3CO4A 5LIXX 1PL9A 2E5CA 4AXNA 4JTJA 3LPGA 1FHDA 5K2ZA 3WQFA 4A3RA 3QLDA 2GJLA 1QK2A 4GZJA 1HJQA 1Y8BA 3M41A 1QASA 3WD0A 4O0KA 3LTSA 2HE8A 1UD4A 3GC4A 4FOUA 4HMEA 5ABFB 2E8ZA 1JZ3A 3LCHA 3A3HA 1R3SA 5G4HC 4NKCA 2ZZ6A 4HYVA 3NQGA 5BU6A 1HG3A 2ZFAA 4NP7A 3XINA 1MYRA 2YW4A 1XCFA 3B8SA 2ZUMA 4Q8QA 4X63A 2R9ZA 2NVKX 2ZYFA 4XZMX 5E6YA 4H1ZA 3BVJA 1S5NA 3NQDA 1F8MA 3MCNA 3KDOA 3NQBA 2WJEA 5SWUA 4GQBA 3PZUA 1ISVA 2O7SA 4IGHA 2XIIA 2DZBA 2V81A 1OADA 2GJXB 4CVWA 4Y96A 3DX5A 2VZVA 4LYQA 3SCNA 3RUBL 1TO3A 5FJOA 4B2DA 1QI2A 1NM9A 1EDQA 1HL8A 3QH2A 2OSXA 3I6EA 1X98A 3URQA 3M0KA 3TSMA 1FP8A 1JGMA 1B4EA 2BY0A 2AMXA 2WM0A 4HA1A 2DUXA 1S2TA 4O0QA 3EB3A 3JS3A 1ITCA 3W83A 1GGOA 3W76A 2BHZA 3AMLA 4GG9A 3OLEA 5DY3A 1W5NA 2ZE0A 4XISA 3TJXA 1AFSA 4RNIA 5D2XA 2BXVA 3TSBA 3UW6A 5D04C 4NRSA 4IIEA 5I06A 5CAHA 3TA9A 2WMGA 3HBLA 1SW0A 3II4A 2E67A 1ZX9A 2WCAA 4AF0B 1VEMA 1F7BA 2TYSA 3JU2A 4DY1A 2WNWA 4WKHA 3S5SA 5C9WA 1ZNNA 3QMRA 1ONRA 3PUEA 3WD1A 3SGUA 2HMCA 3BLOA 2PURA 3TWBA 4D6EA 1CPUA 1FY6A 1VRDA 1T99A 1OGBA 2YZRA 2ZZCA 4AY8A 3G5EA 2BGQA 1JAKA 4IIDA 2Q8ZA 4NYYA 4CD5A 2VT0A 1CYGA 1V02A 4HNOA 4MY1A 3WNMA 4R9XA 3NL3A 1EX5A 1HFBA 4U2YA 1T6MA 3T2PA 1QPOA 1GPWA 3GFZA 3L21A 3IJ7A 3KXQA 4AHPA 3CUIA 2C0AA 4AEEA 3KZPA 1OFOA 3AZRA 3NVZB 1H2IA 1F5ZA 2FZNA 2INFA 1FIQB 4E8DA 1K1DA 3NOEA 1O66A 3RCNA 1H60A 3A3XA 2PF8A 2IPFA 4XKYB 4C6QA 1HX0A 2PFHA 1G0CA 2BC0A 4EE9A 2PC4A 3T0TA 3QY6A 1D8WA 5KTLA 2VUNA 4PL1A 5HPCA 5FIPA 3RU6A 1PE1A 1XCXA 4PRWA 4H4VA 4HPHA 2WK2A 3TOPA 9RUBA 3VK5A 3VNIA 1REQA 4LS1A 1VGAA 5BU9A 3IUIA 1TJ0A 3IJ9A 3APTA 1E5NA 2GUUA 1H09A 1XV8A 2YVFA 1Q6EA 1SPQA 1WYGA 1P6WA 2PWDA 1NWTA 3NSNA 3UWEA 1AZ2A 2HK0A 4CKQA 4CU8A 3OEXA 3GK0A 4GGBA 3RX4A 3QW4B 3VC5A 4BQ4A 3PFRA 5D09A 1EB3A 4NAFB 1S2VA 1OCQA 1W3IA 3A13A 1QPRA 2OSYA 2VVSA 3SUVA 2IS7A 3FEQA 3REQA 3O3RA 3KRSA 4Q8PA 2OO6A 4NXSA 3GM8A 1B5TA 4HQVA 3PFMA 4LFYA 5CG0A 5ECUA 2CITA 4XAZA 4C7DA 3FYOA 2OQLA 1M7JA 2D22A 4A8LA 1XC6A 2P0IA 4IPIA 1A50A 1M68A 2Y7FA 3VDBA 4B90A 4AZGA 3N13A 3RGTA 4J3XA 4J27A 3PAOA 3G0XA 4DO6A 2EJ1A 3P67A 3QYQA 3F5KA 3CWHA 3HFTA 4H7VA 1MSSA 1W2VA 1WO2A 3IV8A 5CPMA 4HMNA 2PDFA 4LTSA 4IL2A 1TWIA 2FTPA 2WP5A 3GXMA 3OVPA 3Q4DA 4DWSD 3M64A 4RK8A 4QCEA 4S1FA 4WZHA 1R6WA 2XH4A 3AHVA 1G69A 1ESWA 2GJNA 3ZWSA 1HF6A 3N25A 3QJAA 3QM3A 4IQJA 3PJXA 1XDMA 3PUDA 5FS8A 1ZZMA 1TB3A 3GVQA 4QR6A 1CB7B 2WBKA 4UZSA 4LW7A 3S47A 4C7GA 4K6AA 3WF4A 3RCMA 4MY8A 1JI1A 5KZDA 1W1B1 5E9AA 1XIMA 3RCYA 1FHUA 3LNMA 4DPQA 3MBDA 3PG8A 4NYUA 1PBGA 3NVTA 3ITTA 5HQLA 1U83A 1NHQA 3MKCA 1WXJA 4J3WA 4KWUA 4W87A 4Y9MA 1C29A 4DJEA 3CC1A 3ZVHA 3VKKA 2CBIA 2AGTA 3QXBA 2X05A 1W9BM 1EZ2A 1H7OA 3QV7A 4C1NB 1GVFA 5TR3A 5JH1A 3Q2DA 2P0OA 3MC5A 1YBQB 2GQWA 4QQUA 2IQ0A 2ZRXA 4GZEA 2IKIA 4FZIA 4ZO6A 3PB2A 4TTGA 4EQRA 3RU8X 2WWCA 4DM1A 1K4GA 4GIEA 4B16A 2C15A 2J8FA 3E0LA 5HWMA 3H7VA 2WNNA 4L4OA 4LB3A 1UBSA 1A3HA 4OJYA 4PR4A 1WXZA 1TUXA 1PTAA 4IFRA 4GCXA 1C93A 3AS2A 2OPJA 1J6OA 1KCLA 2BGNE 1LM1A 4UFKA 3VNKA 5HATA 1WP6A 1SFJA 3WH7A 4M0XA 4Q4QA 3RLVA 3AIQA 5FF3A 1RALA 4CD4A 4F0KA 3SO7A 3VOCA 1YNPA 3F1QA 1S1RA 3WF3A 5FJJA 5D02A 3IC9A 4OV9A 2Y88A 3PG9A 4IXHA 1XGDA 3VIPA 4CQAA 2I5GA 1CECA 3E2VA 4AHOA 1FWBC 2OX4A 3DFTA 3EWYA 2DVTA 3EMZA 2XH7A 1UA3A 1RCQA 3MMDA 2GR3A 1H61A 4JAWA 3D3AA 1TIMA 3N2MA 1RPXA 5AVHA 2ZRYA 4Z1YA 1FWRA 1L6FA 3AXMA 3CGDA 1O7AA 4Z2KA 4DNAA 4GD0A 3MVTA 1ZCOA 2EPMX 5KSWA 3SCTA 3B9OA 3TU9A 1UKSA 4FMVA 3DGZA 5M17A 4LAUA 2J9XA 3KL0A 3PPFA 5EMKA 1ICQA 3FK4A 3ZS4A 4PEKA 3B4UA 4IH3A 2Q02A 4M29A 1E4NA 1FFRA 3D9XA 4QJ1A 4DM2A 5A2AA 5D30A 4F0HA 5B7ZA 3B0YA 2CLKA 4P7NA 3KVKA 7REQA 3TYUA 3GNRA 2W0UA 1Q1RA 4K1WA 5M2FX 4J7RA 5DANA 5DMMA 4J3TA 4Q4OA 3EKGA 3UPBA 1P43A 3HGRA 4GJ1A 1I2OA 2XHYA 2A79A 3PZ9A 4OOUA 4QQ3A 1B90A 2FB2A 3W7HA 4E3TA 2YL6A 3GHTA 1J12A 2O9RA 4FXJA 1BAGA 1E0UA 2PDGA 3QMSA 3UY7A 3T8QA 1TQJA 3R5EA 3DXIA 3O07A 3STPA 1ZMCA 1PUDA 4H8UA 5IDIA 3L0NA 1SZNA 2QCCA 2XN0A 4S3DA 3UA4A 1UB3A 3DAQA 1OABA 3WBAA 3GYCA 1LVLA 3AN1A 5T91A 1NOWA 3T2QA 3TEVA 2OYMA 1E71M 1X6UA 2IKGA 4FNSA 1Q65A 2YLAA 4E4PA 4S3GA 4Z42C 5F1VA 1XBXA 3EMQA 4D2JA 1TWWA 3TSDA 1S39A 2Z00A 4XZWA 1WDWA 4G9PA 2E3ZA 4OE7A 4O1EA 3ZLGA 3W07A 1AH0A 1YNYA 5I77A 4J40A 1H0GA 1KFJA 2X1IA 4MPKA 3FV9A 3WX7A 4M1BA 4MFEA 1W54A 5I03A 1DIEA 3KLKA 2Q3RA 2Y8KA 2PB1A 4A2RA 3NYZA 4LNCA 4Q4PA 1QW7A 3VOGA 1W31A 1EJVC 2EPNA 1UD8A 2XTKA 1V02E 4ORIA 5DT7A 1XHGA 4BQ3A 3O63A 3R13A 3CWOX 4LC8A 4JX5A 1DHKA 2R6OA 3QFWA 2W91A 4E2OA 1I1XA 3ZR4A 4QROA 3SUWA 2Z7KA 4GBUA 1G7UA 1WKYA 2JEQA 1DIKA 2C1IA 1H0IA 4DI9A 5EY5A 1TMLA 5AYIA 2XFYA 2Z4GA 3KBSA 4HA0A 5DMYA 3I6TA 1JOAA 1XRSA 4Y9PA 1AJ2A 3NO3A 1JEHA 3PWAA 3ARYA 1ZRQA 5AKQA 2E4TA 5HPOA 4WXZA 2QIWA 1DJXA 1TMHA 1EIXA 4FLQA 4BA0A 3L5LA 1TV2A 4BJHA 5FD0A 3QPYA 5JVLA 3NA8A 3AQUA 4NAFA 2UV8G 3W1UA 4US5A 2V5CA 3VKAA 4AIBA 4GLEA 4K3ZA 3VOHA 2J6XA 3P80A 4H7ZA 5C5YA 4EQWA 3SJ3A 3V5CA 2ADAA 4PC8A 3QSTA 1YKWA 3SZ8A 1KRAC 4ZQCA 1X6NA 1TV5A 5D2TA 1XDLA 5JBEA 1NF7A 2Z1BA 4QS5A 4ZMGA 5LIWX 3PBUA 3W25A 1UQYA 3DYOA 3MS8A 4XZIA 3VABA 4A6GA 1JCYA 1KLZA 3WO8A 5H8MA 2H3DA 4M6PA 4AQLA 4JFSA 4KIRA 3DGHA 2AAAA 3AAMA 4PCPA 1MUCA 3WDIA 1ZS2A 4JIRA 2WJDA 4QE4A 4HHMA 2ZXQA 4C6DA 1JDCA 5BXSA 3JVAA 1QWKA 2NQJA 1T5AA 4E8CA 3N04A 4H04A 1FCQA 4KCVA 4AX7A 4JOMA 4LF2A 2DT2A 5GJMA 1Z89A 3GUGA 2P8CA 1ME7A 3QZ6A 1DQWA 3KRZA 1J9YA 1LBFA 2Y5JA 3LM3A 1XH2A 2QDDA 4LRTA 1QHZA 2QUMA 4UTJA 4Q4SA 4HD5A 3DK4A 3FY1A 1XXXA 4E2VA 3O2LA 4R7OA 3LGGA 4IXXA 4JFWA 2TPRA 3ITOA 4D9PA 1GTEA 2HQAA 3EA1A 1J6PA 5TBOA 3TQKA 3GWQA 3MV11 2V63A 4UFLA 2XVKA 2BY2A 4Q4MA 2OWCA 1SZRA 3WDJA 2WPEA 1GNXA 3N4FA 1JCLA 2R1MA 1AOGA 2CETA 3OLGA 5FJPA 5CXPA 2E28A 5JQ9A 3BMWA 3OU8A 5AHNA 2R24A 2C13A 2G41A 5LIUX 1VF8A 1KTBA 3HO8A 1B0IA 3ITYA 3GH5A 1CXHA 1BYBA 3MJYA 3EDDA 3L0GA 4X3ZA 2QLYA 2GL5A 5I3GA 2C71A 4JTQA 7CGTA 2V5LA 2WOVA 3KCLA 3VNJA 6TIMA 1Q66A 1F6YA 4YTQA 3MHFA 2Y63A 4FR6A 1ODUA 5EMLA 2V3DA 3SN4A 4FNQA 2J75A 2PDHA 3QQWA 2VX5A 5GRTA 1AQHA 4M24A 2O55A 3FFSA 3AIRA 1R30A 3KP0A 1V3HA 3ARXA 3K8LA 1A0CA 4MGGA 4DLMA 3GX9A 1HJVA 2EQ7A 2A85A 4JEQA 4Z2LA 3W75A 2Q09A 2XINA 4KFOA 3L2MA 3L5AA 1W9VA 1BQGA 4LRSA 8RUCA 4R88A 2G4JA 1M9HA 3NL6A 1AUSL 1ML1A 3QKEA 1MQQA 5CZJA 3OG3A 4JTUA 4FNUA 2QJHA 3K4DA 2XGIA 1I2QA 4V1YA 2PCQA 3L2LA 3V7PA 3DG7A 1LRNA 3OOQA 1KKRA 3ZZ1A 5XIAA 1QK0A 3AHYA 3TR2A 4N9CA 4WHBA 4OTKA 1C8VA 3CGEA 1ONFA 2DDXA 3VIOA 5FS9A 3W1PA 4WDXA 2G95A 3GR7A 1A0DA 3UZYA 5AHFA 1PB0A 3M0LA 4DBWA 2VCAA 1T41A 1J8VA 4ADTA 2DPEA 2G5WA 3BAYA 2VI0A 4KPRA 4AZHA 1Q85A 3LV6A 1AA1B 1DXEA 5LNSA 2PTXA 3NDYA 1EP2A 2PMQA 1XRFA 5JMUA 2WVVB 1HP4A 4MJ4A 2YJQA 1ZJBA 3WMBA 2ZC1A 2NVCA 1DJGA 4ZOCA 2PGWA 1SMAA 1JPHA 1J0IA 1HIZA 3AIUA 4G56A 1R38A 2WZTA 4HBKA 1XYLA 1GUVA 1CXIA 4GRTA 3UNTA 4FSAA 4A8IA 2D3LA 2EEXA 2PLCA 5KZ6A 2F6KA 4JDRA 1X8CA 1IZCA 2QF7A 3SCOA 4JN8A 4KEMA 2OCZA 3S9ZA 5U25A 1WOBA 4B9ZA 3U2CA 2EG8A 3M5ZA 3W23A 3P81A 4WF7A 3LRKA 4PTNA 1QXLA 4L1XA 1ISXA 4H2HA 4H4XA 1IT0A 2C1HA 3T2OA 4IMDA 4NHVA 5I23A 2WC7A 1IEQA 2QVHA 4TXEA 2YCJA 4R85A 3LMYA 1VQZA 4ZA0A 1KO0A 5GVJA 3TNBA 1LLWA 4GNJA 3TC7A 1UUOA 3U6WA 3OC4A 5C2XA 4YVVA 4P7OA 2UY4A 2Z2AA 1JROA 2JE8A 3GKAA 3QHNA 3VDCA 3CPGA 1AL7A 1LG1A 4E2DA 3THAA 1CTNA 1GVEA 3TYDA 2YQUA 3WMCA 3TDFA 4OVXA 1X7IA 2POTA 2WKGA 3VOFA 2HBVA 1U30A 1OX5A 2ISFA 2PDUA 4D1JA 4A35A 2R91A 2W0HA 2CC0A 4I6KA 4PUJA 1Q6GA 4EACA 4B4HA 2AQOA 6TAAA 3PZTA 1UR3M 3DOPA 1RVKA 1PTGA 1QNPA 5CG7A 3RJXA 1UWSA 1EO7A 4GFIA 4HN4A 3A24A 3USZA 1GVIA 5TIMA 1LL6A 5I2UA 4D6HA 3WUEA 4D6JA 4DAFA 1NDVA 4WSKA 1KCZA 1JPMA 3KUMA 4BQ5A 1WYIA 3S83A 5C7VA 1G94A 2ZA3A 1FDJA 1MDRA 1VYSX 4JIHA 2VKZG 1RVGA 2QCDA 5AC7A 2OT0A 2BMBA 4YCOA 3UJ2A 4MAZA 2C16A 1EUNA 4G1NA 5A2BA 4FAMA 4GVFA 4LB4A 2HVOA 5BNKA 1A5NC 3AU6A 2DSUA 5I6SA 3V16A 1QI3A 1FKWA 4F0MA 1W1TA 2VX4A 3MO7A 2CLMA 2VR5A 4YTTA 3UWYA 1B9ZA 1OZQA 3C2EA 1EKOA 3C2VA 3TK7A 4PUWA 4DQWA 3H21A 4LJ3A 3TYZA 1TTPA 2NLYA 4AD5A 5G5HB 1P1MA 1D8CA 1E6QM 1DBTA 2REQB 2YA2A 1VH7A 3ITLA 1BYDA 4IG2B 5HUPA 1E9IA 3KOXA 2J27A 2X50A 1YIXA 1RR2A 3PHAA 3TV8A 1N60C 4FX8A 3E96A 2J7GA 1ZDLA 3NEHA 1ALDA 1QATA 1EC8A 2PP3A 4QGCA 5HMDA 1SZGA 3TH6A 4UTKA 3A7AA 4TUFA 2C3ZA 1J5SA 3W1NA 1C91A 2P88A 3EWCA 3QLLA 1UKTA 1JZ5A 3MHGA 4NL1A 3S5OA 3I3EA 1GHRA 3NPUA 2DZPA 3CQIA 2QVNA 3ONBA 1X97A 1JDDA 2X40A 2FVMA 4NUWA 1ZALA 3UVAA 1XIIA 4CNPA 3IUHA 4RZBA 3DYMA 1LOLA 2FZDA 3EX4A 4BFAA 1V0KA 4CN6A 2WO5A 3W2MA 1WBJA 4TO8A 2I17A 3PBGA 5A8NA 4JTSA 3SSJA 3G77A 3WEZA 5AZ1A 5CLWA 4IUOA 4A29A 4DUXA 2PC8A 4G5DA 2C1GA 3FVDA 3C5QA 3HFYA 4KWOA 4UQ9A 3UNDA 4ZXLA 1A5SA 1ITQA 2PDJA 3CV2A 2GDUA 2GJPA 3RO6A 4EF9A 3AS0A 3LK6A 2C79A 1XRTA 3UXKA 1KKOA 1N62C 4WIWA 5BYWA 1E72M 1XLLA 1P0EA 1RSCA 1CXKA 2GDVA 2ZCGA 2QF8A 3T44A 3B03A 4CD6A 2ZADA 3B8DA 1F3WA 4UFHA 1Q63A 2CLIA 3DIPA 2ZX7A 2A4AA 2V5JA 1ZUAX 4P8WA 1LQAA 5CZ0A 1VIZA 2QGYA 3GBEA 3OLIA 3VOJA 3O6AA 5KZMA 1IWPA 3DJGX 4HSOA 5JCMA 5EYWA 1NWUA 2DH3A 4WUIA 5I3HA 5I79A 4RDWA 1NP2A 1KBIA 1O12A 2YVJA 4MJ2A 1ZBVA 1ZU8A 2F7FA 4R27A 1TYTA 1EL3A 3S6TA 3BLDA 1XUZA 4GO9A 5HK4A 1MEWA 5CBJA 3GG1A 3BAXA 3BJSA 4P61A 3GQYA 1EIBA 1DE6A 4IUGA 3W7DA 4BS0A 3EANA 2J47A 1R46A 2DH2A 5DT5A 5M3WA 1BWLA 4XIMA 5A8OA 3ABZA 3CUZA 1B3YA 3RNDA 4HYWA 2CZFA 3HPXA 2XWDA 5ABGA 2HK1A 1JNEA 4Q6JA 4IQDA 1PS9A 5ABTA 2Y61A 4GRSA 3CZEA 4JNYA 4IMCA 5BMWA 2JK2A 4EPEC 1WQ5A 1S3HA 4O1AA 3N3TA 1E0TA 1O5XA 1YYAA 2G3FA 3GNNA 3UXAA 3LCGA 1GEHA 1OC7A 1JAEA 4D1IA 1UWRA 3R79A 1JRBA 3STEA 4Y90A 1AMKA 3LLXA 1E1CB 3FDGA 4L9ZA 1RJRA 1DXIA 2J66A 3ELFA 1DORA 2Z27A 3BOXA 3MWAA 1KRBC 2OEMA 5HOSA 2G3JA 1TTJA 4FXFA 5FOOA 2XDFA 4Q7IA 4J2MA 1DTUA 4PRRA 5EBUA 2DP3A 3WENA 1GKQA 3AYVA 3K46A 3RLUA 1OQFA 4YYCA 1Z44A 1J5TA 3PPHA 1JNDA 4N9DA 1W8SA 3S0CA 1WCGA 3CQJA 6PTDA 3PPCA 3GS6A 1Z3NA 3HV8A 3GXDA 3VFLA 2YCLA 4ZE5A 1JYNA 3H2OA 4GIAA 7ENLA 1DXFA 1MXSA 2OGJA 1DWGM 2X8RA 2NWSA 4Y8EA 2IQTA 5REQB 1K7FA 2DW7A 1RK5A 3QTPA 5BXTA 3LLDA 4O18A 3WNKA 3GNXA 4XX6A 1QBAA 1TR1A 3IIPA 3K1DA 4UTWA 4PEEA 5FEZA 1C7TA 3KRUA 2O7QA 4Q8UA 5IHSA 1ZHAA 4MNLA 2R1PA 1JQXA 2J79A 4JTRA 2YBUA 1GYNA 4LCRA 1MEIA 2NQ5A 4RPPA 4EXQA 4Q6XA 2CWXA 3P3BA 2ODOA 3EB4A 4KT2A 2Y7GA 5IBXC 2GGHA 3MPGA 5GJNA 2BVWA 4MYXA 2EPKX 3ARUA 4YPJA 3VZZA 4QS6A 2W63A 4QBXA 4L6OA 4AC7C 1ZBWA 2F61A 4NZ5A 3IGUA 1Y5VA 1U22A 2D73A 1UH4A 4CCEA 4NASA 3L66A 3RN6A 1WDDA 1VR6A 4WY0B 4O8AA 4BKNA 1OFDA 1SVDA 3D0CA 1A5KC 1E6SM 1K9FA 1CDGA 2DT3A 3N2OA 4B3LA 4EKJA 4Y7EA 4K37A 1L6YA 2QAEA 3LN3A 4MSSA 3M4HA 1NU5A 1PTDA 1H7PA 1X39A 2TSYA 2ZUSA 3B06A 4AIUA 1E1EA 2VC6A 1V3IA 2VFDA 1IQ8A 4JYDA 4GINA 4REQA 3PP7A 3BUVA 4JNZA 1S46A 4MWAA 3WH5A 4AZ7A 4JQ3A 1NDWA 5JUVA 1KB3A 1SJBA 3T05A 4RNHA 1B3VA 5XINA 3BAKA 2VC5A 2BVTA 2P76A 2ICSA 2REQA 2JQXA 1KXVA 2CZVA 1JCMP 3GRIA 1DJHA 2BXYA 2KZHA 4YTSA 2E6AA 1UR2A 2E6FA 5EL1A 3LM7A 1ZAHA 1YLVA 4DWDA 3EUB3 4GXMA 3V75A 1J2BA 1J0JA 2IKJA 3CV7A 1AZ1A 2FDSA 1YDNA 3PANA 5G1MA 2NSOA 1I60A 2CZDA 3GB6A 3ERPA 1PSCA 3FIGA 3F4NA 4UTTA 4EWND 1UBPC 2J9YA 2PDBA 1S3TC 3PBVA 2HWGA 4PCSA 4NZCA 1GYMA 2IPWA 3EXTA 3AWOA 5B80A 1R3YA 3LB8A 1CI1A 1IGSA 4WDUA 4RKAA 4C6NA 4N6FA 4HCHA 6A3HA 3BCFA 2RABA 3WDQA 4FALA 1CENA 1DWFM 5A94A 3MTWA 1B1YA 3A4JA 2DQWA 5G5GB 3GHRA 4JFUA 4C5YA 1V6YA 4X0NA 4AU0A 1EGVA 4G1KA 2J8TA 4KWWA 3LGDA 1GTHA 5F2IA 4QE5A 5FAGA 1NSJA 1UWAA 1ZKQA 5DMLA 1UROA 2PDIA 3GTXA 2EQ8A 3DERA 3GDTA 5H91A 5C9RA 1POKA 2F6XA 3SM0A 3FJ4A 5GNXA 2ASHA 3NVYB 2GGGA 4ACYA 4UFJA 1RZMA 3R10A 2WVTA 3BSGA 2YSWA 1JL8A 2FTYA 4IHCA 1EBGA 3WMSA 1TYPA 2AAQA 2P3EA 2CEQA 1AW2A 3OVGA 1MI3A 4XUGA 3FAXA 5CSSA 2VEPA 1BG4A 2EPOA 3EOOA 3RR4A 2X09A 1KCXA 4PTWA 4EPDC 5KITA 2ZTKA 3WK1A 2PA6A 4JQAA 1FH7A 4LYRA 4UTIA 5HAOA 4BV6A 3PJWA 5FL1A 2WPFA 1SSDA 1TG7A 3SRFA 1QW8A 4WDTA 1W32A 1XRVA 3EWBX 2INZA 3UJFA 3SQLA 3O0FA 3W01A 4I7WA 2NZLA 1OBAA 3HGSA 4S39A 2PTYA 1VHCA 3L4XA 1FFUC 1ZBKA 5ECVA 1E0VA 2Y2WA 4DVOA 1ZENA 1AL8A 3CAWA 3H53A 4LEFA 1OJXA 2OTDA 3RM4A 1KFEA 3DFOA 2Z26A 3NZPA 3NPVA 1G4PA 4ML9A 4PUKA 2BOEX 2B81A 2OZ8A 2X30A 3ITGA 3AHZA 2Y5EA 3CV6A 2EKCA 3WBWA 1RLDA 1KTNA 3DFSA 1I9CB 4KS0A 5CZTA 5F7UA 4LBSA 2CXGA 1MNZA 2A3CA 1KTCA 4JEJA 2JIEA 1CWYA 4D8ZA 3SN1A 2ACQA 4EPBC 3SUUA 1CLKA 1MW3A 3BLIA 4PB4A 4AH7A 4GI9A 1EX1A 1TVLA 1UYQA 1QW9A 4G8TA 3E2RA 4LYPA 4EAMA 3CQHA 3O16A 2PWEA 1ZP4A 3OZOA 2J13A 1GYLA 1K02A 4HJFA 3WG6A 3AMKA 3KVJA 1W1PA 4EX4A 1RY0A 3MZ2A 3L5MA 4D6DA 4F8XA 2INEA 4WOQA 2Z29A 1JZ2A 2ZX5A 5FF2A 1G1YA 3DFYA 2O9TA 3B0XA 4I9AA 1V0LA 3BSMA 1W8GA 3OP2A 1HL2A 1B3OA 3UJEA 1NHRA 1LORA 1JQVA 4GYFA 4IP5A 3H7UA 3R94A 3PTMA 1IHIA 1SFSA 3EOUA 1V6UA 1NQ6A 3KLJA 1ZP3A 4JDBA 1FWDC 1KFWA 2CESA 4CCDA 3MCOA 1PZ3A 4N2YA 4GZIA 4LVAA 3IRSA 1TR9A 4W7WA 3T81A 1R0MA 5LNRA 4O54A 3LQLA 3GIYA 1AK5A 2V5KA 3K30A 1LWIA 3W7OA 4HNVA 4FA3A 4F0LA 1D3GA 1D9EA 1J93A 1KW1A 2A6LA 5F4SA 4DXXA 4GGHA 2ATSA 4L64A 5A6MA 1XLHA 1QHPA 3CHVA 3LV5A 4S3FA 5F2GA 1XANA 3OB8A 2WB5A 3DHPA 3VCRA 4U5KA 1YPFA 3W00A 4F4RA 4J3VA 4MG4A 4AWSA 2ZXDA 3ZVIA 3WYZA 1XD1A 1J0HA 1HVQA 5HINA 3BW2A 3CB8A 3NQ8A 3DHFA 1HUVA 3WBXA 3ITVA 1LOSA 3LGEA 2BDQA 2WBAA 2ZUNA 4GIYA 2Z2BA 5JU6A 4PMUA 5BOFA 4Y2WA 2O9PA 4RR4A 4BK9A 3LRLA 3ID7A 2WANA 2XVLA 3AMDA 3QF0A 3CLMA 3UYCA 3H24A 2WW5A 4WY0A 4WSHA 2UY5A 1GG0A 1H7RA 1SJCA 3QVQA 1LTDA 3W7RA 2I14A 3V5FA 4MKSA 3KWSA 5LA1A 3VXGA 3W37A 3VGBA 2V2CA 3L8KA 1DP0A 3CPUA 3W86A 4M19A 3TQVA 4GKLA 3G22A 4UOJA 5CBBA 4UTHA 2CCRA 3GW3A 3KEHA 5LXEA 1GW1A 4YHGA 3BG3A 4GQGA 3PUOA 5C9UA 1V3LA 4H6QA 1VHNA 2QAPA 3ISIX 4AISA 2Y8UA 3SQMA 1XPYA 4HP5A 3KOFA 3CAVA 5DRCA 4E4UA 3BOLA 3URBA 4OOZA 2WMJA 1AQFA 3B9DA 4RE2A 2BNJA 1TPEA 3KX6A 2HVNA 1SSGA 3KAOA 1YXDA 1ZPTA 3WLPA 2BV9A 8A3HA 1NAL1 3VCCA 4HNUA 4JGDA 2X1RA 4V27A 3W7QA 4J56A 3BO9A 3E2QA 7TIMA 3AM9A 1BXCA 3W3OA 4MWAE 1VFUA 3BQ6A 2E5BA 2WZEA 3R7MA 4ROQA 1S1PA 1JZ8A 4O8RA 2GR2A 3VNZA 2HS8A 1XQKA 5JH2A 2B7QA 2HV5A 4I90A 3KOWA 4WX2A 1NHSA 3EWDA 2VR4A 1E70M 1B30A 1EA0A 4YU1A 3EMCA 3BV4A 4DWSA 1OF6A 5EKYA 1UKQA 2BOFX 3S46A 4PSPA 2C19A 3GIPA 4WCJA 3IARA 1XGEA 4PODA 3FA3A 1S2AA 4W4QA 4AWTA 1ISYA 3THQA 2X1SA 1W3NA 3DG6A 3MI6A 4JTCA 4BEUA 5I00A 5I3KA 4DIAA 4PUDA 4C1KA 4LCQA 5G2WA 2PTDA 5CGMA 2QS8A 4PMVA 1TPVA 2NX3A 1NP0A 5I24A 2W5FA 1E1FA 1FWHC 4KETA 4H7CA 4ZFCA 2OFJA 5PTDA 2XFFA 4B91A 3QEZA 1OFRA 1O68A 5KVHA 1YADA 4Q4KA 3B3DA 5D8ZA 4P7QA 1W1IE 5LKYA 1DQXA 4FXSA 3SCWA 3NAVA 4GWEA 2OG9A 1GRHA 3B05A 3W84A 1M5WA 1C8YA 3LX9A 4XBJA 5RUBA 3QOKA 3DH7A 3IGSA 1XYMA 2X8HA 1POJA 5F2MA 5MKGB 3BW3A 4XD5A 1VC4A 1KC7A 4LUJA 5HR6A 3TROA 3URNA 1QAPA 3CZGA 4CU7A 4DF1A 1VBRA 3TZFA 4J5NA 2GGIA 3H7RA 3W22A 3S2LA 1JPDX 3VNYA 1JZ4A 3URHA 3NSXA 4LVBA 2EAWA 5A8MA 1G7VA 1W9PA 3EA2A 3MKVA 3G1SA 5DN1A 2OZTA 2WBGA 2BHUA 3E6EA 1BXBA 4R7JA 3RR1A 1GVQA 1NTHA 1RK6A 2TAAA 4GISA 3AISA 4X22A 3T4CA 3WEOA 1MFVA 1J01A 5IXEA 1PIGA 2Q8XA 3SJNA 2TODA 2ZX6A 4R34A 3XISA 1E6NA 4DYJA 5CBIA 2GJRA 3EF6A 4H4YA 3V4BA 1V7AA 4M81A 3SURA 1LDCA 4IGSA 4ZB0A 5JBFA 4QSHA 5EGRA 4UCFA 1AMYA 3V1HA 4H9TA 3LHUA 3V18A 3NTYA 4CQCA 4NZFA 3LEPA 1NF0A 3QR0A 3CS2A 5AC6A 2PP0A 2I7GA 3ZJ7A 3HMCA 4Q3MA 1V5XA 3E0IA 5A6AA 3DFNA 1MZHA 4GI6A 1XR2A 2G3MA 1GKPA 1MNSA 5FF4A 5D2WA 5FJUA 2FB3A 2D1ZA 3IV3A 3P62A 3B0VC 2Z1KA 1V3MA 3IANA 3TVAA 1UOKA 1LJYA 3T7VA 4AG0A 1VZWA 1OX4B 4DO5A 1GVSA 4CQDA 3W1XA 4JCMA 5C2CA 3GVWA 1P48A 3W29A 3WNNA 4B9YA 3N9KA 2GVJA 4AX6A 3UR5A 1J11A 3M07A 1KBJA 3CMGA 4S3AA 2GQ9A 1XLMA 5I3DA 3VD3A 3DJJA 1HNYA 3NZQA 3GRTA 2HEJA 4HZ7A 4GY0A 2YDAA 5E6ZA 5D4YA 4INFA 1XIBA 4DJEC 3W9ZA 1SO6A 3CH0A 1CBGA 4K39A 1BSLA 3RM8A 1DWAM 4OGZA 4CQ8A 1FRBA 1FWGC 4EOUA 1EBDA 3RAOA 1UD5A 1XLAA 1MUMA 1VCVA 5TF0A 6XIMA 4M1RA 3MP5A 4OUIA 4EM4A 3ABXA 3UYIA 4C60A 3WK0A 1W3KA 4KBXA 3KVMA 4JQ4A 1N7KA 3S6OA 4HN8A 2YL8A 3PBMA 1KXHA 4NZ4A 1IIGA 3J7HA 1K9EA 3C0QA 2NVDA 3RX3A 3O6CA 4XO7A 1SFLA 1FEBA 3A9BA 3VIHA 3NQCA 3G1DA 3UZWA 2J74A 2C0HA 1OD8A 2J7EA 3WFZA 2IXUA 4K8GA 1RPKA 3ZJ8A 2VDHA 3S1GA 3TJLA 1TYGA 1TPB1 1K70A 1UPMB 2G4FA 1FDZA 2R1NA 2NQZA 3BSHA 4MKVA 3VX1A 3BLFA 1ICSA 4AHQA 1K9TA 2GUBA 1GETA 3CZ8A 4DYEA 2NUYA 3S2JA 1J0YA 2G3IA 1QOPA 1L6SA 4JNMA 3BC9A 2Z2UA 4KKXA 3TJ4A 4DI8A 3O0KA 4U3CA 3UWUA 1TA3A 1PXGA 4EK7A 3M6DA 4PFMA 3QZAA 1WXYA 3WQCA 5D2YA 3VNMA 1TZ7A 2QCLA 3A6OA 4O16A 2GSHA 1F4AA 3P8JA 3WL1A 4Q8NA 3HPFA 2VZOA 3CBWA 3MCMA 4RW3A 3RITA 4NEVA 3VKBA 1SYTA 1OM0A 3ZM8A 3SCQA 3TE9A 2GQ8A 2V2DA 3CT7A 4RDVA 3WH9A 4Z17A 4RNJA 2AAMA 1XGZA 3BLKA 3LZ5A 3ZSSA 1VCFA 3P7YA 1XM3A 2E6YA 3K4AA 3NQFA 2ACSA 4UQEA 2Y4SA 2NV9A 1W3TA 3R12A 3MY9A 3WK2A 3H26A 2OYKA