3V3WA

Crystal structure of an enolase from the soil bacterium cellvibrio japonicus (target efi-502161) with bound mg and glycerol
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
402
structure length
397
Chain Sequence
MKIVDAKVIVTCPGRNFVTLKIVTDQGIYGIGDATLNGREKSVVSYLEDYLIPVLIGRDPQQIEDIWQFFYRGAYWRRGPVGMTALAAIDVALWDIKAKLANMPLYQLLGGKSRERILSYTHANGKDLDSTLEAVRKAKDKGYKAIRVQCGIPGIAKTYGVSYEPADADLPSVEVWSTEKYLNYIPDVFAAVRKEFGPDIHLLHDVHHRLTPIEAARLGKALEPYHLFWMEDAVPAENQESFKLIRQHTTTPLAVGEVFNSIHDCRELIQNQWIDYIRTTIVHAGGISQMRRIADFASLFHVRTGFHGATDLSPVCMGAALHFDYWVPNFGIQEHMAHSEQMNAVFPHAYTFNDGYFTPGEKPGHGVDIDEKLAAQYPYKRACLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an enolase from the soil bacterium Cellvibrio japonicus (TARGET EFI-502161) with bound MG and glycerol
rcsb
source organism Cellvibrio japonicus
molecule tags Lyase
molecule keywords Starvation sensing protein rspA
total genus 143
structure length 397
sequence length 402
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3v3wA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3v3wA01
3V5CA 3ZLHA 4M0XA 3CYJA 1SJDA 3GD6A 4ZA0A 2OQHA 1MUCA 3OTRA 3N6HA 4HPNA 2PU1A 2XH0A 3ZLGA 2ONEA 3TJ4A 3T4WA 3Q4DA 2AL2A 4GFIA 2PP3A 3MWCA 3ZVHB 3NO1A 3JZUA 1EC9A 1JPDX 2PGEA 3S47A 3VCCA 1MDLA 4H2HA 4G8TA 1SJCA 5BOEA 1EC7A 3H70A 2PTYA 3ZLFA 2PCEA 2QQ6A 5FJUA 1TE6A 3N4EA 4FI4A 2XH7A 1ELSA 4GMEA 2QGYA 2GGEA 3H8AA 1JPMA 3VC6A 4JN7A 2OZ8A 1KCZA 2HXTA 3N4FA 4GGHA 1KKOA 1P48A 4IZGA 3OPSA 4HN8A 3VDGA 1ECQA 4DN1A 3UGVA 2PMQA 4KEMA 2GL5A 3U9IA 5FJRA 3SN4A 3JVAA 3EKGA 1P43A 2GDQA 3H7VA 4ENLA 1OEPA 3EEZA 3QLDA 3OZYA 3RITA 2PA6A 3TW9A 2OZTA 3ES8A 4MKSA 4A3RA 1BKHA 3FXGA 3NFUA 4ROPA 3BSMA 5BOFA 3PWGA 3SQSA 2P88A 2GGHA 3MY9A 2RDXA 2OG9A 3VA8A 2MNRA 3P93A 3MSYA 3TWAA 4H19A 3SBFA 1W6TA 4KT2A 3MKCA 3N6JA 4A35A 1JDFA 3DG6A 3CB3A 3R11A 4JN8A 1R0MA 3BJSA 3MUCA 3IJIA 4X2PA 3PFRA 2AL2B 4K1WA 1JCTA 3R0KA 3MQTA 5FJPA 1ONEA 3STPA 3VC5A 1SJAA 2OPJA 1E9IA 1MNSA 2P8CA 4GGBA 3RR1A 2PGWA 1NELA 3UXLA 3ZVIA 3OP2A 3OW1A 3QPEA 3S5SA 3U4FA 2PP1A 3CT2A 4HCHA 1BQGA 3TWBA 2HXUA 2FKPA 4E4FA 3TQPA 2DW6A 4F4RA 3HPFA 1XPYA 1MRAA 1MDRA 3D46A 4HCLA 2POZA 3KUMA 1PDZA 2PSNA 2AL1A 4GISA 4H1ZA 4E6MA 4IHCA 2OKTA 4IP4A 3T8QA 1XS2A 3PWIA 3UJFA 3CAWA 3TJIA 3R0UA 1EBHA 4IP5A 2GGIA 3GY1A 2OVLA 1FHVA 4DXKA 3OZMA 3FVDA 4FP1A 3SSZA 2QJJA 2FYMA 2XH2A 5EU9A 2PTZA 3IJLA 4EWJA 2NQLA 1EC8A 3RRAA 3DGBA 2OZ3A 1KKRA 5IDZA 3DIPA 2PODA 4E8GA 1R6WA 4HNCA 3FYYA 4G7FA 3UJEA 4K2SA 3VFCA 4HNLA 4K8GA 3VCNA 3TOYA 3I6TA 2CHRA 1SJBA 3UXKA 3P0WA 3R10A 4MMWA 2GSHA 3V5FA 3TTEA 3DERA 2QJMA 2QVHA 3H12A 2PTWA 4DWDA 3UCDA 4GYPC 7ENLA 3I4KA 1WUFA 2PU0A 3T9PA 3V3WA 1NU5A 3Q45A 3BOXA 3DDMA 3RO6A 4DYEA 3DEQA 1L8PA 2I5QA 4H83A 1DTNA 2OX4A 2XGZA 1KD0A 3UCCA 3SN1A 4E4UA 2GGGA 3IJQA 2AKZA 3P3BA 2P8BA 2XH4A 3ZVHA 3V4BA 3PK7A 1TZZA 2GGJA 4YWSA 3QTPA 2HNEA 3SN0A 4GIRA 4HCDA 4JHMA 3SJNA 3IK4A 3RGTA 2OLAA 4M6UA 3DG3A 2OFJA 1IYXA 4IL2A 1EBGA 3TCSA 3I6EA 2QDDA 3CK5A 2ZADA 3GO2A 3ES7A 1YEYA 2DW7A 3K1GA 4HYRA 3UJSA 4ZCWA 3DFYA 2PPGA 2O56A 3DG7A 2XSXA 3THUA 2HZGA 4J1OA 5FJTA 3ENLA 3R25A 4KPLA 1RVKA 4DX3A 4Z1YA 1TKKA 4IL0A 1WUEA 4E5TA 2P0IA 1F9CA 2ZC8A 3FV9A 3UJ2A 3D47A 3QKEA 3DESA 1PDYA 3DFHA 2P3ZA 3NXLA 2AKMA 2PTXA 4DHGA 2OO6A 3NZGA 4KWSA 2PP0A 5FJOA 2PS2A 2MUCA 3MZNA 2QDEA 3QN3A 3R1ZA 3T6CA 4GYPA 3JW7A 4IT1A 4Z17A 4J3ZA 3FCPA 6ENLA 5ENLA 3UJRA 4MGGA 1FHUA 3B97A 3CXOA 3RCYA 4A6GA 2QJNA 2OQYA 3FJ4A 5J04A 3GC2A
chains in the Genus database with same CATH superfamily
3SGZA 3CGTA 5EBAA 2D0HA 1R9YA 3KL3A 4H4SA 1O66A 4C6BA 1P0KA 2O4QA 1D2KA 2PWHA 4ZO6A 4ZA0A 3IGUA 5DEZA 3O1NA 3V0TA 5IFPA 3B8WA 4FNPA 1YPFA 3L4XA 2NQZA 3WLRA 3GXIA 4JFWA 4UFKA 1WDQA 1EPVA 4CNPA 2R24A 4G2DA 2ZZ6A 4K39A 1KFEA 3BXWA 1NOWA 2CKSA 3F5LA 5BU9A 3WNOA 2ZBTA 2VTFA 4YHGA 4F9DA 3EWDA 1EO5A 3G0UA 3M47A 2PWFA 1UPPA 5FJUA 3M5XA 2W3ZA 2OWXA 1IEIA 3G1HA 2OQLA 4LT9A 3WUEA 1EP3A 3S1VA 4EOUA 3H8AA 2NQ5A 3ZOAA 4IG2B 1PKNA 3TIMA 2CZVA 3E96A 3F7JA 4K3ZA 3L4TA 3IUIA 2WZMA 1JD7A 1AL8A 1ZBVA 5C7VA 1ECQA 3FJLA 4XK2A 3TSDA 3DN5A 1R3TA 4DUVA 2D73A 3VVGA 1E51A 3G0SA 1GERA 3SRDA 4L9ZA 4HJWA 3R8GA 3AS1A 3C6CA 2CKRA 4MFEA 2GWGA 3O07A 2OZTA 1XCFA 2GQWA 1S5NA 4GNVA 4ZFCA 4FXJA 4O1FA 2YKKA 7REQB 3RCNA 3VKJA 1HXJA 2PLJA 3JS3A 1G94A 3ANUA 2WC7A 5G4WA 3L4UA 4PTNA 3SCQA 2W27A 1HO1A 1GQIA 3BV7A 3GVQA 1XIBA 2GUUA 4OUEA 4PCFA 4JKLA 3SBFA 1F5ZA 1B9ZA 3WK1A 3BLDA 2R1NA 4HPHA 4DBDA 1UKQA 2V2DA 3QPYA 1K4QA 3CEPA 1P6CA 5D2VA 4ZSUA 1DWFM 3A4AA 1UWTA 3DKLA 3MHFA 1S1RA 2YIHA 2XSBA 2IS7A 4J9JA 2AL2B 4XWUA 4YYCA 4B92A 1LRQA 3AALA 1JPKA 3WFLA 4MG4A 3W7EA 3H54A 3ITVA 2E8ZA 4TV6A 2BASA 1EJSC 3VGGA 3W2LA 1GZ1A 1NELA 2GVLA 3A9BA 5LNRA 3LM3A 2DU2A 5CEWA 1P7TA 1P1MA 1S2UA 3OW1A 4W4QA 4S3KA 2GQ9A 3CUHA 1JR1A 4C6CA 1D7YA 3EANA 4QS6A 2H9AB 3U57A 3DKJA 1PTAA 1Q6EA 2Q8XA 2X40A 1MRAA 3PFMA 2V3BA 1GORA 1V3HA 5D8ZA 4UQBA 5EMKA 5I0DA 3CGDA 1ADSA 1ME9A 3NL6A 4K1GA 4LYKA 2BOGX 1W9DM 2QUUA 5KSWA 1E0UA 3PTMA 4QDMA 3GNDA 5C0QA 1UP0A 5KZEA 2V82A 1DXLA 1E6PA 2RH9A 4BF7A 4XIMA 4RPPA 3NCOA 3OZMA 2Q8ZA 4UZUA 5H8UA 1TV4A 2J13A 3LXBA 3VXGA 2QMKA 1Q8JA 5LNUA 1HZYA 3GNPA 1KKRA 3IIPA 1RK6A 1W1A1 3QLLA 4NQ1A 3DIPA 3QOMA 2PODA 3H53A 3NPWA 4Z2JA 2HJPA 3GD4A 2JQXA 3SB0A 3UZJA 3MP3A 5JRBA 4HSNA 4WDXA 1JYWA 1X1OA 3PNUA 4KIEA 3PJXA 1M6IA 2NLYA 5DLCA 5TQLA 5JCLA 1YXDA 2VGIA 1XINA 3I3EA 4W89A 1E40A 1UZ1A 3VNLA 3WMBA 4GYPC 4U3CA 4MNMA 1QI3A 5C8BB 4PCNA 4PN2A 5HWJA 5CPSA 1KM2A 1K9DA 3E0VA 2YYUA 1H7RA 3DEQA 1GRTA 2REQA 4RXFA 3AUOA 2QUNA 5EMJA 3FJ6A 3L7RA 4R5EA 5HAOA 4V2XA 1PZ1A 4CEXC 1CCWB 1V3KA 3DH7A 1G5AA 1J12A 2R94A 2C1GA 4DJEC 3PK7A 1TZZA 1ZB5A 1ISWA 1UH2A 4LUSB 3HGRA 1MXDA 3BSHA 3FSTA 3P6LA 4IL2A 2D23A 2VI0A 1MXGA 2B7PA 3QR0A 4IH3A 5BXRA 4WD0A 4ZENA 2AQVA 2DW7A 2Z1SA 1ZL1A 5I00A 1P0NA 4JQ3A 5A6KA 2EXOA 2WMFA 1G0CA 3MTWA 4AZCA 4J1OA 3C4UA 2ZXBA 1SO4A 5FJTA 2WVVB 2WB5A 3PBYA 1QOXA 2CC0A 2ZWYA 1TVLA 1IQ8A 3W07A 4K7ZA 3PUGA 1A3WA 4JQ9A 4B5NA 2QS8A 3LBCA 1UB3A 3KRUA 4EVZA 2BDQA 1OF8A 4B5SA 3B0PA 1I1WA 4FAMA 3NM1A 1GGOA 2QCDA 4YHEA 3G77A 3OVGA 3RRXA 3DK4A 4HU8A 1X6UA 1VRDA 1E70M 5LXXA 3DYPA 2WYSA 1ZCCA 4RJEA 3LHZA 3I6RA 3FVMA 5FAGA 3H2FA 1GPFA 1LQ2A 5I77A 5EGRA 2IKHA 3PJWA 3V5CA 4ZOHB 2NW0A 1C7SA 3UR2A 3CTLA 1TPEA 4O17A 3GG7A 3KEHA 4XTIA 1TTQA 4LTSA 1FUYA 3DBPA 1FWFC 2WV8A 4O14A 2ZE3A 5CJ5A 1ONWA 5T9CE 1WBJA 2IUZA 1FCBA 1CGXA 4UMBA 4D71A 4Q7NA 3ZIZA 4KWWA 5FCZA 3WMSA 3SI9A 1H5YA 4G56A 1HGYA 1PCWA 4TX6A 2VDGA 3GVWA 1Z32X 3OGVA 1MDLA 3T07A 3TW6A 5U1OA 4N9CA 3M41A 3GH5A 1EC7A 4JD4A 4WX2A 1GVQA 2Y8KA 2XGIA 2CIPA 4EM4A 1UP3A 4HMEA 3TTSA 4XD5A 2Z1BA 3ZMRA 4N42A 3UXDA 4TVDA 1RJRA 1PYFA 4FLSA 5KZDA 3VKCA 1D7FA 4LEFA 1JOAA 1EGMA 2HPIA 1LLZA 1Q85A 5CC6A 4GO9A 3XISA 3SW6A 3W74A 3SURA 2FDSA 1J0IA 3CEUA 3WH6A 1TRIA 1TSIA 1UZ4A 4NZ1A 1A5MC 4BI5A 4ZTXA 3AIEA 4GVIA 4DQWA 2I14A 1P0EA 4GVGA 1SSGA 1ZBKA 3BURA 4Q4PA 2AGKA 5DY2A 1B57A 3QLDA 1VFSA 1ZP3A 1L6SA 1BTCA 1WKFA 1RVGA 2RGMA 2P53A 3B40A 4JTLA 3P7YA 2X05A 1GWJA 2WPGA 3AN1A 3LXCA 1GOIA 1UA3A 1J0HA 1GW9A 1T7LA 1CLKA 2OU4A 2VEFA 4FMVA 3MP4A 4P61A 3O6CA 2A7NA 2QCLA 1XF0A 5HDRA 2VWSA 1PWMA 1QNPA 1KR0A 3GHUA 4UCFA 4MVAA 1E4MM 1LTDA 1VGAA 3ZJ7A 3QSRA 2QCEA 3EX1A 1BGAA 1H09A 3HIJA 4YL2A 5REQA 4KT2A 2PC4A 4LW7A 1RJPA 4IG2A 1KM5A 1XKJA 3O0HA 3SFWA 1VZWA 1PKYA 1UHVA 4H9YA 4HZ7A 1Q63A 1Q3NA 4KEVA 3IJIA 3LG3A 1J0ZA 2GOUA 1LZOA 1OC6A 3BMXA 5AHNA 3UWEA 3NVDA 1XIJA 4DBWA 1XSIA 4O11A 1W32A 3HU7A 1E9IA 2VFIA 4X9SA 2GJXA 1XRVA 4BF9A 1W1ZA 3OEXA 1RCXB 1LWJA 2DT1A 3MANA 1FDJA 4MYXA 5FS9A 2F9RA 2VEPA 2NQJA 4JOMA 3A5FA 2ADAA 3KOXA 2DW6A 1PIIA 4O8RA 2PDCA 4PZVA 1IV8A 3ZWSA 4A8NA 2I57A 5C9XA 4OIFA 4E0CA 2AL1A 2JGYA 4GCAA 4H1ZA 2VENA 5FS8A 3VIJA 2D0GA 4H8UA 3WDHA 3S46A 3GK0A 3T81A 3UJFA 4GA8A 4REQA 1Z7AA 3FSUA 4OGZA 2JKPA 4JTJA 2Z25A 4X0VA 2EQDA 4DJFC 1J6OA 4J3XA 5EU9A 2PTZA 1AH0A 1AZ1A 1M65A 1ZY9A 3APYA 2C15A 4PB5A 4W84A 4GE8A 3B0VC 1FKWA 3ARRA 4NZFA 2EG6A 5IDZA 4J3SA 2V63A 4KESA 1Q6LA 4LH8A 4FLOA 1FA2A 3EX2A 2ZX5A 3W88A 2O9PA 3KTCA 1NHQA 3UBPC 4K2SA 4O50A 3TOYA 2RGLA 4KEZA 1O5XA 1TV8A 4RL3A 2D0FA 4PYSA 1E15A 2YW4A 1F6YA 1J01A 1QTWA 3NDZA 2GSHA 3VKDA 3RLHA 1XLGA 4JTFA 4YVVA 1DJXA 4AWTA 4FALA 4US5D 3HO8A 3W83A 1BF2A 1V6UA 4LCQA 4I90A 1IXNA 4L4PA 1DORA 1QVBA 4ZXLA 3PSWA 2XVNA 3BTNA 3I7QA 5EB8A 4TO8A 4JCLA 4UTTC 1VF8A 1UWRA 2X1RA 5A6MA 2Y2WA 3UXAA 4AAJA 3IJ6A 3MDWA 3OA3A 1SZRA 5BWAA 4QX4A 2E68A 3T0DA 1ZBCA 1HVXA 1F73A 3W7IA 2BX7A 5GNYA 1ISVA 4DNHA 4HCDA 4GABA 4HU0A 2WZIA 2CLPA 2DJLA 1GVSA 4AG0A 1ZKQA 3W86A 1O68A 4NXKA 2DIKA 4QLLA 4ZEPA 3TC7A 1L6FA 4O1CA 2PLKA 3A12A 3LHTA 3VGHA 3TYZA 1ZMDA 3NVTA 4CN6A 3HPSA 1OZQA 2V9DA 3N14A 3B9OA 1F05A 2XIQA 2PURA 2VQUA 1DKWA 1KO0A 1POJA 1UH3A 3OG3A 1S39A 3AUJA 4KPLA 5ABFB 2GJNA 2EQ6A 1BF6A 3UFYA 3L2IA 4NAEB 5AC5A 4QR6A 4YLWA 1EF3A 4IPPA 3VD9A 1CGYA 3AI0A 3FG2P 4V28A 3R2GA 2P0OA 2DH3A 4JTGA 3STCA 4DUWA 3WF3A 3MS8A 2PP0A 3MZNA 1XG3A 4JZ5A 3DK9A 1OC5A 1C8YA 2DH2A 3BAKA 1WA3A 4JTTA 1E73M 4ZBCA 5EBKA 1EJVC 3W85A 4JICA 2FGBA 3M4HA 5BXPA 4HQVA 1MW3A 3SM0A 3D6NA 5BCAA 3WJWA 3GXFA 4P2VA 2V30A 3CYJA 5D9NA 3AZRA 3V35A 1VBGA 3U6WA 4J56A 4WVXA 1JYXA 4IUOA 3KXQA 1YRRA 3UWUA 1CXIA 1I2RA 2PP3A 1I4NA 4GYFA 4Q22A 4ZO9A 4WDUA 5GNXA 2G0WA 3CMJA 4Q8MA 1IXPA 3ZZ1A 3OGRA 4ECLA 2HCVA 3LGDA 4GUHA 5DELA 2H6RA 2QPSA 4LAMA 1Z8AA 4LRSA 1OYBA 4UC5A 3XIMA 3W7QA 4B9YA 2D3NA 3WK2A 5JCNA 1JGMA 1LF1A 3EWWA 1BAGA 1J11A 3LB8A 4V27A 2E40A 2O9TA 2FFIA 5CPLA 4JHZA 3LCXA 1A5LC 3M0JA 1KKOA 2P10A 3MYPA 2ZZ0A 2I5IA 4WOQA 4H9TA 2FFCA 2OLHA 2YZRA 1VLWA 4QNWA 2I5GA 5AC8A 4GYKA 1TCMA 3VZXA 1EP1A 1GPWA 5FJRA 4AVFA 1R46A 4AD3A 2E5CA 5F4SA 5LNVA 3HV9A 3S6DA 3EA3A 3TCEA 3TXVA 1K77A 1JNDA 3AMDA 7REQA 1XLJA 3BAJA 4XO6A 4C1LA 4IGSA 4V1YA 1QNRA 1KQYA 3ALFA 9XIMA 4AZBA 2G8ZA 4ACZB 4BFAA 1S2AA 1I2OA 3H6OA 4LPCA 1GYLA 3DGRA 4FNRA 4J40A 4QNEA 2NV1A 2E1DA 3BWWA 1O94A 1GNXA 3RG6A 3ARSA 1A0EA 3HV8A 1YW1A 4AXKA 3SCWA 4HVXA 1Q2SA 1BWLA 5A6JA 2B81A 1JXKA 2BSLA 1AODA 4HA1A 1CDGA 4NL1A 4LANA 3L8KA 2R1KA 2C7FA 2XVKA 1BFNA 3NGJA 3II1A 1UYQA 3G1RA 3W73A 3CGEA 3EMZA 2NQ9A 1XLMA 4ICMA 4RLIA 3ARXA 3FDKA 4UNKA 4GZEA 3I7RA 2WLYA 3GZAA 4HPJA 4RE2A 3STPA 1U1JA 2FDMA 4CEUC 2WANA 2QXWA 1Q6DA 3IC9A 5LIUX 1QBAA 3R6IA 4L1GA 3USBA 3NEVA 3M0HA 3RR1A 3DGZA 3HMCA 3AIWA 2WSRA 3ZVIA 1TE1A 2V69A 4EQWA 3CO4A 3S1XA 3C3NA 4H4IA 5MF5A 5A6LA 5CGTA 3CT2A 3L68A 2E3ZA 1NFPA 3AYTA 1FH9A 3LCGA 5DMLA 3LLXA 3OIHA 3D46A 2Y5JA 4LAKA 3W7MA 1UD2A 1A3XA 1X2GA 5J5RA 4XBKA 4H4UA 3HBLA 3GDTA 5JCKA 1JZ8A 5HUOA 4H00A 1JCMP 1ME8A 5B7YA 4UTLA 1K9FA 3FVDA 4IJRA 1GJPA 3LB0A 3NQMA 4OKDA 2PUZA 4CD4A 1BVZA 4Q8TA 1AQHA 4AZ5A 2PWGA 4AUBA 3L65A 3ZSTA 1NDZA 4QAIA 5LGZA 3VNYA 1JEZA 2Y7DA 1KBKA 3NUKA 4ICCX 1W1VA 1MO0A 2EPLX 4TTUA 4JTSA 1OX6A 1RBLA 3WJXA 1R6WA 4EP8C 3KBNA 3KRSA 1C29A 1D9EA 1XFBA 1KFJA 3E12A 2DZPA 1JAEA 1QNSA 3HPAA 3STGA 5AKQA 3P0WA 5BW6A 3L0NA 2BY1A 1HJWA 4H6QA 1IT7A 1ZCOA 4L56A 4FLRA 3T0CA 2CDUA 1RCQA 2J66A 3W81A 4MHBA 3B0UX 1WUFA 3IIVA 1VFOA 1PIGA 4AHOA 4YTSA 4UFMA 3UW6A 4Z1CA 4NVTA 1F3TA 3N25A 1H60A 4H83A 3ARWA 4HTBA 1S7MA 2ISDA 4UTJA 4MYAA 1EA9C 4LS0A 2FZ8A 3MCMA 3PPGA 5G1MA 4WY0A 2NT1A 4S3EA 2BY0A 3PC0A 4H6RA 4UOJA 4NXSA 3PB2A 1EYEA 4QBXA 2ICSA 1B0IA 5CPTA 4BCEA 4TMCA 5KEZA 3W1AA 3C86A 1R86A 4IQEA 5CPQA 5HUPA 1ADDA 4S3BA 1UBSA 3QH2A 1IEVA 4AZ7A 3W7NA 1QHZA 4O4WA 2ZTJA 1EHNA 1FKXA 4CNOA 3R89A 4HYRA 1DJGA 3WLTA 1KBJA 3ERPA 3PZMA 4MAVA 3QXBA 4UFHA 1YE6A 2EO7A 3WYZA 4JFUA 4WEVX 1BTMA 4FF7A 5FKYA 3MCOA 3S2JA 2XTKA 1OFBA 1QMLA 4YCPA 1V4YA 3L5LA 2CBIA 3P62A 3NQGA 3KOZA 3BK0A 3QSTA 2FB2A 3D5HA 3GLCA 1M7JA 1DJZA 3VMOA 4LSBA 4A4AA 3LI1A 2R9RA 3H26A 4JTHA 2WOQA 3DJGX 3FAXA 4R33A 4W8LA 1TMLA 4GH1A 2EKCA 3APGA 1R87A 5DANA 3IVTA 3CIXA 2V5CA 3VNDA 2F2KA 4DZIA 4WXYA 3WH5A 4J3ZA 4LV4A 1C9WA 1KCKA 4IOTA 4OFCA 3RM9A 4ZMGA 3LBMA 2OTDA 1TZ9A 1YLVA 1EA0A 2PWEA 3WY1A 3AMZA 3PSVA 5I7GA 3AHXA 3WQWA 1E5NA 4QRNA 3EOUA 2F38A 1BGGA 4XISA 1NARA 1M04A 3GUGA 5FSDC 1K1DA 1EOKA 2TMDA 3GG0A 1V0MA 4UMCA 3G6LA 3BUVA 1CWYA 4HPNA 4DPPA 2JIWA 1GOOA 5LSMA 3IACA 3NPUA 3BPWA 1TVPA 2Q3RA 3AXKA 1FH8A 4XD4A 3Q4DA 2FLIA 4RDZA 3SIZA 2VC9A 1FP9A 3NSMA 4AC1X 1GW1A 3G8RA 3W6MA 5IM51 3DCPA 3TYDA 4K8EA 1U33A 5E09A 2Y89A 2J25A 3I3DA 5A8MA 3EWYA 5GQBA 1XC6A 3JU2A 3ZLFA 5D2YA 1XLCA 2PCEA 2HVNA 4UTUA 5EBUA 3LCHA 4DPQA 4NI3A 1UIOA 1AVAA 2XH7A 4S38A 1ELSA 3O6DA 1VPQA 3BOFA 3WF2A 3A4JA 3S5OA 1OFRA 3BDKA 3FKRA 3F2DA 3U7BA 2VDHA 3AOFA 1VS1A 4CQDA 4O13A 4HN8A 1GRFA 3DFQA 1YPXA 3WQGA 2QF8A 2Z26A 1XG4A 4JIIX 2PMQA 2YL8A 1UR0A 5A6AA 4ZE4A 3UF9A 2DSKA 3MA8A 2WKLA 2WQPA 3QHOA 5D2XA 3GDLA 1G7UA 3ATYA 3W27A 3N29A 3VIGA 4TUFA 2OWCA 4G7EB 4ROPA 5GVJA 4O4VA 1IZCA 1LUCB 1V59A 1EX1A 1DBTA 3W24A 1TPC1 3VA8A 3NA8A 5CKSA 3N17A 4ZQMA 3AYSA 3K8MA 5M3WA 3CM4A 3QW3A 1DTUA 1W1PA 4DWSA 2FHBA 4X3ZA 1HL9A 1UR8A 4TVUA 3K4WA 1SQ7A 3KZSA 1PJ9A 3GIQA 3P82A 6XIMA 2DVTA 5LIWX 1T6MA 4F48A 2WBAA 3WCZA 2GDVA 5HR6A 1PTGA 1GKPA 4CD6A 8XIAA 3L12A 4F40A 3BLLA 4O53A 1NDAA 4CN4A 3WLNA 4JQAA 2V8ZA 2P1FA 4EANA 1LPFA 4D72A 4O1DA 3R58A 3IJ8A 4PTXA 1XBZA 1E3XA 1OY0A 3LPOA 4A2RA 2XYLA 4DJEA 3LLDA 1CBGA 2Y7EA 4FA3A 4HCHA 5TBOA 3QV9A 3NL5A 1P6BA 3CAQA 5K2ZA 4RNHA 4WIWA 4F4RA 3HPFA 2W63A 3W7GA 1QO2A 2CFYA 3A64A 1MOKA 3KUMA 1H1ZA 4GQGA 4UQDA 3CB8A 3TYCA 3H21A 4EE9A 3DYOA 5EMLA 5C70A 3ARPA 3S8HA 1YIXA 1EBHA 3IANA 4IP5A 1PKLA 3W1RA 3K13A 2VR2A 4DIAA 2G97A 3SSZA 3LRLA 3T42A 5GJMA 4GOAA 3IJLA 2W4XA 3GAYA 3B06A 1OVDA 2L5HA 2E8YA 4TX9A 3WELA 3WNPA 3DGBA 1DWAM 1OGBA 1EOMA 4DNMA 1YQZA 2V5JA 2PLCA 1UUQA 4QJ1A 3RMJA 4O12A 2BMBA 2E7FA 3UETA 4C5ZA 4RDYA 2YA1A 3AHVA 3G6MA 4Y8FA 3W22A 2PDGA 3TZNA 2CHRA 3S3GA 2Z7KA 4UR9A 2DEPA 4DM1A 8TIMA 2O7SA 4QQUA 4AZCB 3A3XA 1LYXA 3H12A 3QQ0A 1GHRA 4KS0A 5CSRA 5GJPA 1JQXA 4BEUA 2YDAA 2JIEA 4ASTA 5ABHA 3I4KA 1CENA 1TPVA 5IDIA 5I03A 3ZJKA 2HE5A 3AYVA 4L9XA 3KDOA 3RO6A 3QY7A 3PZOA 2BY3A 4GY7A 2V5KA 4EACA 4EQXA 3UCCA 1VB9A 1JAKA 5A8NA 5I24A 1QATA 4KH2A 3TSMA 4S1FA 3PF3A 1NVMA 2XINA 1Q4WA 3IARA 4QCFA 1FBAA 4F0HA 2FZMA 1UC5A 4PH6A 2VX7A 4P8UA 3VGFA 3QQ1A 5AC4A 3Q94A 1ZJIA 1ALDA 4H01A 2V6OA 3TTYA 5C5YA 4NKCA 3GXTA 4HNOA 1KA9F 2BGSA 2BXYA 3GO2A 4MWAE 3FXYA 3TW7A 4GRTA 3PG9A 1YEYA 2DZUA 1JD9A 3SJ3A 4MY1A 1TWIA 4C91A 4UNIA 1A5KC 1W54A 1GQKA 3TJXA 4K38A 4C7DA 3DG7A 2E0PA 2C16A 3FGCA 1CT5A 4LALA 3L4YA 5JBEA 4OUIA 2A5HA 3IIXA 1XDJA 1LT7A 5G1TA 4PUJA 4EIVA 1UROA 3SQPA 4U5KA 2R91A 1KNWA 1RVKA 1I2PA 3E5PA 5J5DA 4Z1YA 2IQDA 1QO5A 3W1LA 4J35A 2J78A 1M7PA 2G4FA 3M5VA 4M56A 3RCMA 1H7XA 4PMXA 1Y5XA 4OT7A 4UQAA 2GJLA 3E2QA 4GIAA 4XKYA 4XAGA 1K6AA 2ZE0A 4O28A 4D6FA 3ABOA 1XWYA 2ZUVA 3G0XA 4F2TA 5FJOA 1L6WA 5I3IA 2YDQA 3L23A 3WBXA 3W28A 2NWSA 3A4XA 3VX1A 2C13A 5E5CA 3AMLA 1BD0A 1W1TA 1ENUA 2BXZA 2OYLA 3G2GA 2QJNA 2FVLA 4HHMA 2DPEA 4A05A 3WH7A 3W2MA 2GVYA 3VKKA 2RHGA 4M0XA 4HOWA 2P5NA 1HKKA 1MUCA 1Z42A 1ZAJA 3CNYA 1D3HA 5U7SA 2PU1A 2CLOA 3NQCA 4KWUA 4JTCA 2ZZ3A 1OD0A 1IZJA 2RKXA 3ANVA 4IIDA 1MEHA 4Q8WA 3MMDA 4H9VA 3QYQA 4KKXA 4KCVA 2ZRZA 3E2VA 3OZOA 1JPDX 3A47A 3WQPA 3S47A 4MB4A 4DJDA 1SJCA 3LRMA 4LWWA 3W7KA 3REQB 4HK6A 2QQ6A 1TR1A 3QFEA 2AOSA 1VJZA 4HU3A 2QW5A 3N4EA 2PBOA 2DZVA 4FI4A 5LA2A 1DHKA 5CZSA 1WV2A 4DXXA 4HT3A 1DIEA 2DZAA 3VI2A 5AVNA 1F61A 2V6AA 3QC3A 3N4FA 1I9CB 3LDVA 2ISFA 1XD0A 1DIKA 4LGXA 1XFCA 1IXOA 4JL1A 4L64A 1F3WA 1RA5A 2PDMA 4HMDA 4DN1A 3AXXA 2VCAA 4KETA 4ZOBA 2XFWA 4KGLA 5CGMA 3GS6A 2DVXA 2VJXA 3W37A 3QEZA 5A8GA 1KRMA 1A5AA 1OJXA 3FJNA 1G1YA 4IIFA 1GOMA 4IIGA 4LY8A 2ABBA 5C9WA 4ZVJA 4QEHA 1SZEA 5XIMA 3BSGA 1LDCA 5BOFA 2YL9A 4UTWC 1L6YA 2FPVA 2GGHA 3FHQA 3M9YA 3MMTA 1AK5A 4W85A 3M6DA 1JPHA 1KBIA 1XCWA 2JF7A 3KM8A 4IXXA 3V36A 4IGNA 1S2CA 2J7EA 5TIMA 1F74A 1DHPA 1FQ0A 1YKWA 2EKGA 4XTDA 2HQAA 3O7UA 5LXEA 1VBHA 2V68A 5RUBA 4A35A 4REQB 3SY5A 4GO8A 4NYUA 7XIMA 1OINA 1CGUA 3WD2A 6REQB 2V67A 1MRQA 2XVGA 3MMUA 3D3AA 5M1TA 1E6XM 3IUHA 1YXCA 5FOOA 1XYAA 1X1ZA 4QG8A 3CS2A 3CZLA 2XPKA 3VOJA 3IGXA 4ZB5A 3PS7A 3E6EA 4U4MA 1N62C 1E9ZB 3N4AA 3RIKA 4NZ3A 5MHBA 3H2NA 4JAWA 3ONBA 3C0QA 3IWPA 7A3HA 1FEAA 1V02A 5HWMA 3IVUA 4R9OA 2DQXA 1O4UA 2UY5A 2UV8G 4XSMA 2DZXA 1ZJAA 3WUBA 1KBBA 1BYAA 4PMOA 4M80A 4FPSA 2BGQA 4JTIA 1TJ2A 1JUKA 1NQKA 4A8RA 4O18A 2ZUMA 5SWUA 4GUIA 3R0UA 1Q45A 2GGIA 3WNNA 3GY1A 4NJKA 4W7VA 3F2BA 2C14A 4YWIA 1PZ2A 5AYZA 4A3HA 1YPIA 3KS5A 1K8ZA 2QDGA 5AECA 1TWWA 1YDOA 1VAHA 2NV9A 3BOLA 3O16A 3AAMA 4JKMA 3UG8A 4YTUA 1AA1B 4XBJA 5FA5A 3DHFA 1E3ZA 4HK5A 3W7CA 4HNCA 5BXSA 4GVHA 1V51A 2H8ZA 3BCJA 5IHRA 4M1RA 1BHGA 1XANA 4EM3A 2ZZ5A 2WP6A 1QPNA 1VENA 1P4CA 3DXIA 3NQFA 5EMYA 5HJXA 3OHMB 3WH8A 1H7NA 3CQ0A 3S1GA 3SUSA 3UT0A 4RNIA 3GFXA 4D6HA 1XSJA 2XM2A 3ZS4A 1F8IA 4E3TA 4H4ZA 4DYEA 2QHAA 1L8PA 4HKPA 4K8DA 3CC1A 3BG3A 1IWPA 3V16A 1DJQA 4LB4A 4CCEA 3WN6A 4JQ4A 2X0YA 2PDBA 1LBLA 1HF6A 2ALRA 1NOFA 1GCYA 4L6HA 4JCMA 3DC0A 2NX3A 4I5UA 4JHMA 2POTA 2OLAA 1XM3A 1E1EA 2REQB 1BSLA 1XUZA 4DF0A 2D22A 3SQMA 5BMWA 1XCXA 4BQ2A 3DFOA 3PZTA 3R8RA 2ZADA 1RCOB 1MMFA 2F6KA 1A0DA 4GKTA 1D7KA 3GTXA 4TV5A 2FZDA 2W79A 4O19A 3TDFA 5JQ9A 2P3EA 4L4LA 1M68A 4AX7A 4XZLX 4OOUA 1QJWA 2OODA 3GR4A 2D2OA 4DY1A 5DFAA 3NDYA 3V5OA 1QWGA 4HYWA 2C71A 2CITA 4AH7A 5K9XA 3DESA 3EAUA 3C0LA 2BHZA 4BURA 5EKYA 4DHGA 3A7AA 2XG9A 5GNZA 3NZ1A 1IR2A 2EPHA 3HA1A 4PB4A 1ZBWA 2OYKA 2EGZA 1KLYA 4R7OA 2YA2A 5DY3A 4P5UA 1Q6GA 4IT1A 3L2LA 4MKVA 5C2GA 4IMCA 1CXKA 4XD6A 1W0MA 5I3JA 2VVNA 1AG1O 3CXOA 3VIIA 4JTUA 1P0DA 5HNUA 2QMJA 3HGJA 2DV0A 4LEQA 3NXFA 5I06A 3DK8A 1U1HA 4PR4A 1NM9A 1SJDA 2A4AA 5ECVA 3UP8A 3MHGA 1VEOA 2G3FA 1MFUA 4LYQA 1R7OA 2VFHA 4BY3A 4NX0A 4PBGA 1WYGA 2ABAA 4AHQA 1YBQB 2DUAA 2YLLA 4Y8EA 1KM3A 2GUYA 1QI2A 2YCLB 1LQAA 3BLOA 3FN9A 3BLFA 5LA0A 1TWDA 3PN8A 4YN5A 2XZ9A 4GBDA 4R34A 3EMCA 3AIUA 4HSHA 4HOZA 1I2QA 4FX8A 4J3TA 4CQ8A 4DO6A 3AWNA 5BNKA 4ZQNA 4LUJA 1BKSA 4K68A 3BAYA 1PB0A 3N2MA 3O06A 5EA9A 1C90A 2Z1KA 2G50A 5HA7A 5BU6A 3OVPA 4LY4A 2XFFA 4CQBA 1E1CB 4IMGA 2NX1A 1TMQA 2ACUA 1X2HA 3YPIA 2C3ZA 1JRCA 2JGQA 4I5XA 3WJZA 3MUXA 3N04A 4U3AA 2VRJA 3UWVA 2YDRA 4XZIA 3AYRA 3VE7A 2BLEA 4L6OA 3H7VA 4L1WA 5AHLA 1YX1A 3NJ3A 4CD5A 5I09A 4D9PA 3GRTA 2FGZA 2ZWZA 3M0KA 3W0KA 1W8SA 4PGLA 1BQCA 3KS6A 5C54A 1NHPA 1VFFA 1VLIA 1B5TA 3MV01 4K8HA 4GRSA 1U5JA 1V7AA 3P5ZA 4D8LA 2WJEA 4KFNA 3GX9A 4IQJA 3SQSA 2P88A 4CU6A 3AWOA 3KLJA 4L6DA 5HATA 4F79A 3KTSA 1DVJA 3MSYA 2PF0A 4LJ3A 2Y62A 1VFLA 3AFBA 3UZYA 2XIJA 1FWNA 2KAUC 2VDIA 2R1PA 5EMUA 3TVAA 1E6QM 3HZ3A 1BVNP 1US2A 3LCFA 3TUUA 3UZWA 3OIXA 3TFCA 2JF6A 1ML1A 2OEMA 1TMHA 3CHEA 1UD5A 3N6JA 1Q6QA 2J62A 2JE8A 4D6EA 2WM0A 4W88A 1VH7A 1E72M 1EBDA 2ATSA 4EKJA 2CBUA 2C6QA 5HQLA 3QV6A 1RD5A 2BXVA 1W3NA 3R0KA 5F4XA 1EGVA 2C8NA 1C91A 5F1VA 3SGUA 1SJAA 4W93A 2OPJA 4JYFA 4RE0A 1ZENA 3AMKA 1JCLA 3QHMA 3UXLA 3W1TA 3NAVA 3F03K 1I0BA 1W2VA 5FSEC 4GZJA 3H7UA 5JBFA 1JROA 2EQ8A 4JN6A 1EJUC 2E25A 1FFRA 3S1WA 1BQGA 3NIYA 4DI9A 2BVYA 3W7HA 1M5WA 2CBJA 3CWNA 5E0KA 1SSDA 4QDWA 3CHFA 1B2YA 1XPYA 1A5UA 1F3EA 2EQ9A 3CAKA 2BS9A 1N5XA 1KFWA 3U2ZA 1BYDA 2POZA 3BAXA 1W3IA 3CWHA 5ECUA 2WPFA 3PBUA 3HN3A 4H4YA 2W9MA 1ITQA 2W92A 3LHUA 1Q13A 5IHSA 2FMNA 3MUIA 1TTPA 4WOZA 1I2NA 2OKTA 2PDQA 3PBMA 4Q8VA 3VABA 4J3VA 3HFYA 2G3MA 4IFRA 4H8VA 3T40A 1XLIA 3P14A 4ICNA 4HHPA 4FP1A 4KCWA 3EBVA 3PZQA 2XH2A 2R6OA 4K36A 3F2CA 5I23A 3FX4A 3LNPA 5LYRA 3LSBA 3GM8A 4H04A 4TX8A 1UD3A 4PUWA 1NAL1 2EPNA 4BI6A 1PAMA 2DT3A 3O15A 2HK1A 4AZGA 3ARYA 2ZZ7A 2DDXA 2BHYA 2A6LA 4UIOA 2GJRA 2JKEA 2GSEA 3BGAA 4KFPA 1RUSA 3E2RA 1DIDA 2BB0A 1PEZA 3MB9A 3WQCA 1Z3NA 3GZ3A 1OG0A 1VCVA 3TN3A 2OX1A 1YNYA 4H50A 1GRBA 4LCSA 3U4AA 3DDMA 2JKAA 3SFKA 3U2OA 2E6FA 2X1TA 2J6XA 3D0CA 3IUDA 4GY0A 1A3HA 3I7SA 5FF3A 3GHTA 4GH3A 1B1YA 2D2HA 2P8BA 2O9RA 1DXIA 3ITOA 4C6MA 3TX9A 1GVIA 1MYRA 4KW2A 3KOWA 3LADA 4JYEA 1FHLA 3QTPA 1TYPA 4A2SA 4I9JA 3WEMA 4XVDA 1W91A 3ZT7A 2GJXB 3EZ4A 6XIAA 3R43A 5T8GA 3PNZA 1NDVA 4IJBA 1S2VA 1H3GA 3NOYA 3RNMA 3WQ6A 2EQ7A 5FACA 3ID7A 3EA1A 5H8PA 3W2JA 1E0XA 2X42A 4QP0A 2YB4A 3KRZA 3C0SA 4DLFA 1DQXA 3K1GA 3AQUA 3AHTA 1SUXA 1VFHA 3UYIA 1YE4A 1RBAA 4IPIA 1ODUA 2D69A 1KN0A 1EUAA 4NT0A 3HPZA 3UG3A 3QFAA 3LY0A 3FEQA 2WHKA 4MB1A 5A6BD 4GZ7A 4IFOA 4IM4A 4ADUA 4AIEA 3HTWA 4QM1A 2ZKMX 3GU1A 2B7NA 3R5EA 4FNSA 3NG3A 3G1XA 4O57A 1V77A 4FXSA 4PULA 3FA3A 3DFPA 1OT1A 2R1LA 3QZ6A 3NQVA 4LIIA 1OIFA 4C6OA 4F2UA 2GR3A 3T6CA 3U3HA 2SFPA 2XISA 3PWAA 1LQ0A 3GAKA 3VIKA 1RY0A 1N61C 4UUIA 3NNTA 3STFA 3V1HA 2WM1A 2LLEA 3WH9A 3RPTA 2EPMX 4A3QA 1AW1A 2HDJA 3PR2A 2J47A 2HQMA 1TR9A 2HISA 3IJDA 4M5PA 2J7BA 4DYKA 1UJPA 2VX4A 1Q6CA 1YDVA 2QJIA 1A5OC 4CQAA 2ZA1A 4WLCA 3A7UA 2J3NA 1TPB1 1E4IA 1U30A 3W26A 5GJNA 4MFDA 3QVQA 3W00A 1GESA 1X39A 1FWRA 3VNJA 3H4KA 1CNVA 4NSBA 3BJTA 6A3HA 1F4AA 4EQRA 2F61A 5FIPA 3C8NA 4QROA 3OG2A 5E9AA 1XYZA 4IGHA 3GWQA 1QWKA 2V5DA 1XI3A 3R7MA 3N9RA 1E1FA 1TWZA 5HJYA 1CLVA 4L4OA 1LJYA 1T3QC 5T26A 1TE6A 5DF0A 3R79A 3HURA 3EPNA 1GRHA 5E93A 3C3UA 2GGEA 1O5QA 1YDNA 3F4WA 2OYMA 2WNZA 2C19A 3B8SA 4B5TA 5JMUA 4YCOA 3UCQA 3MCNA 4P7QA 5A6TC 5TF0A 4DRSA 1EHAA 3E1F1 4ALDA 4DO5A 3BVJA 5HBFA 1W5PA 2VFFA 2NSOA 4H8HA 3U9IA 2GH5A 1AW5A 4WUIA 4FF5A 2BFGA 1K9TA 2WBGA 1Q8AA 2ANUA 3OZYA 4Y9MA 4WQ6A 3PB0A 4MDPA 3GYCA 4GQ0A 3CPUA 2QAPA 4GX8A 3WO8A 5LHFA 4E2BA 4CKQA 4DBEA 4PMZA 1BKHA 3IVSA 4O52A 3TNBA 4QG9A 5CLWA 2CFFA 2NX9A 4YVPA 4AWSA 1FWAC 3ZQ9A 2CLLA 2ZZ2A 4H6EA 1YNPA 2MNRA 5M2FX 4RW5A 1BWKA 3HQPA 4AD2A 3U8GA 1PHQA 1HG3A 1XH1A 1ZFJA 3UPWA 4PBFA 1UD4A 1W3KA 4OQVA 1FWEC 4B3LA 3NS1B 1W6TA 1HX0A 3KW3A 2O7QA 3IJ9A 4CNTA 5AHEA 3ORWA 1RK5A 3NYZA 3BH4A 1JDFA 3RHGA 1KXVA 4YS1A 4M52A 3WDIA 1RPXA 1W1YA 1WDPA 1VPXA 2EJ1A 2VGGA 3QFBA 2W0HA 1LROA 3W1XA 4QITA 3VOCA 3N73A 3OQEA 3M16A 4JEJA 1US0A 1J2BA 2BC0A 4XAYA 1W31A 4BKNA 5C71A 1FTXA 1XJBA 3OP2A 5LIKX 3T4CA 2GYIA 1K02A 4BV6A 4DI8A 1WDWA 4C6KA 3TN4A 4ZO8A 1WB0A 4PUMA 4OV9A 5D2WA 2YXOA 1RY8A 4NEVA 1DWGM 1PDZA 1V3MA 3LCLA 5LA1A 5KVHA 1GYMA 3W2UA 4LVDA 2YR1A 3T8QA 4JFTA 3TR2A 3K2GA 2A7PA 2IPFA 3N2OA 1I8JA 2BP1A 3TQ0A 3OLDA 2XDFA 4HGXA 1E6ZA 2DSUA 3BE7A 4EWJA 3WD4A 3ZM8A 2PDFA 1GVOA 3FA5A 2A7RA 3RRAA 1H62A 1G69A 1QXLA 2R1MA 3VKBA 2Z1XA 3TQKA 1S46A 1FFUC 2DIEA 3DU0A 2F6XA 1PYMA 1NTHA 1OCNA 2HSAA 3ITCA 3LENA 4ZB2A 4MF4A 3LI0A 3VTRA 4O15A 4IX0A 5H1WA 3LHVA 4LNYA 4DF1A 3PBGA 2ZX8A 1ICPA 4FDCB 3KHDA 2XN1A 2ZZ4A 3M6YA 1N8WA 2QF7A 3Q2DA 2X2YA 3DERA 5CJMA 1EH9A 3S5ZA 2QVHA 2G95A 1R2SA 1W1IE 4FOKA 5EL1A 4MJZA 2HK0A 2TAAA 3M1ZA 2QCNA 4JNMA 2PU0A 3CU2A 3A3WA 3WLPA 3DHDA 3SAZA 2E4TA 3N12A 3UZ5A 1J8VA 3BOXA 3CJPA 1HL8A 1R3WA 4JEQA 4DJDD 1CIUA 1ME7A 4YMZA 1QR7A 3W4RA 5CBIA 1VDVA 4GHRA 1GVEA 3SN1A 1ZALA 4UTIA 3E74A 3W25A 3EOEA 5FS6A 3QMSA 3RPDA 3TROA 5PTDA 3ABRA 2GVGA 5G2IA 3HMJG 1XLAA 1PE1A 2X0SA 3ITLA 3UA3A 1JI2A 3G1AA 4OBTA 2ZUWA 4M6UA 3DG3A 3RUBL 3THQA 4A21A 3OBKA 1NWTA 4M8UA 4PUKA 4LFYA 1UWQA 2PDKA 3ES7A 1IEWA 2WBKA 1DIOA 2C91A 1GOXA 4PFHA 3TC6A 1RA0A 1TQJA 2W3RA 4F66A 3THUA 3EMQA 3S9YA 3O3RA 1VBRA 2HZGA 5JCIA 3BANA 1AJ0A 2ISWA 3NQ8A 3LU2A 3GTNA 3V0UA 3GC5A 3UGRA 2GK1B 4JGDA 2NWRA 3CZJA 3NQEA 4NJGA 3N19B 3WLIA 4U10A 1K7EA 2KX9A 5H91A 1UMYA 2IMRA 3LNMA 3G24A 1VQZA 2GFTA 3L9CA 4HD5A 4JL2A 4B4FA 1OJTA 2VYOA 1V6WA 4NAEA 1KR1A 3AS2A 1TJ0A 2PS2A 3ELFA 4R7WA 3W1QA 3C52A 4DO7A 2X0HA 1N2VA 2QV4A 2QJGA 2PWDA 5JH2A 3VDBA 2ZIDA 1MWOA 2OGJA 3FCPA 1E43A 3AMGA 4MGGA 2YL6A 5CQ1A 3RCYA 3WQEA 4WXZA 3SCPA 1JRPA 3CPGA 1OX4A 5AHFA 4GIEA 2QVNA 4U31A 1PIFA 4IP7A 1UWIA 3GD6A 3RNDA 3UWQA 1IEXA 2HV5A 5FMHA 1U83A 1XRSA 3R07C 1E55A 4ZL1A 1SZGA 4N6EA 3ZLGA 3A23A 3GD3A 3T4WA 1KM1A 4I9TA 1QDSA 1V7YA 5HMDA 1JZ2A 2NQHA 4TQTA 2ZZCA 4H4TA 2P76A 3ZT6A 1A5SA 5D9PA 2PGEA 1LORA 2BCPA 2JFEX 2PCQA 2EG8A 4NILA 4HNVA 3L0GA 2CLMA 4AY1A 3BL3A 4FOUA 3QTGA 1ZRQA 1EFZA 4QE4A 4FIRA 1ITUA 3ITYA 2ZYFA 3QY8A 4S39A 1KCZA 2JALA 1ZJHA 4UTHA 2WLZA 3ITTA 3CL6A 2FJUB 5BRBA 1H1NA 1JDDA 4IXHA 4MY8A 1UPMB 4PMJA 3O6AA 3EWUA 2YVJA 2IPGA 4WJXA 1Q2RA 4ZR8A 5I3HA 5CZTA 4CCCA 1EJWC 3CZ8A 3GH4A 3SADA 4CGTA 3O05A 5CPNA 2ZUSA 3T7VA 4WZHA 2ZUNA 3GNRA 4C5YA 3AO0A 3GRIA 3W7PA 4ATLA 3C61A 4AZHA 3TW9A 1KLZA 1DNCA 1NFBA 3T78A 3NQBA 2Z6JA 1QAPA 4ADWA 4Q33A 2WPBA 4EPKA 3BQ5A 1OT2A 1NF0A 2D1ZA 4XKYB 4PL2A 1MQRA 3PWGA 5LGXA 3NSNA 2RDXA 1GEQA 1HKMA 2OG9A 1JF6A 1MZRA 2OSWA 1NWSA 4NZJA 3TA9A 1LBFA 3M0XA 1P5BA 4ZSTA 3OBEA 2E67A 2G3NA 2RDUA 4FXRA 3CHVA 1EJXC 1GETA 1W5QA 4EXQA 1QFEA 5CJNA 4LCRA 3T08A 4DVOA 4V15A 1EQCA 4UXDA 5D30A 1G4EA 4GUFA 2P50A 3BJFA 3KZPA 2XM1A 3CIWA 1R0MA 1JXJA 3WG6A 3W9ZA 1JCTA 3N9KA 4JHOA 4DZ5A 3M5YA 4J2PA 1V3JA 4JY9A 4B16A 2E09A 1MNSA 2J24A 2UY3A 3SGGA 2P8CA 1NDYA 1X97A 2BY2A 2VC6A 2X7VA 1SFTA 3QPEA 1XGZA 3LUTA 2PP1A 1S38A 3NPXA 3OBAA 4P8VA 2G5WA 2ZRWA 1B3YA 4LUTA 2HXUA 4WKFA 1QOPA 3ARZA 5D8WA 5H8MA 6CGTA 5U4NA 3FFSA 1HN1A 3GHSA 3VPLA 3CLMA 2QR6A 3PPFA 3RN6A 3WLMA 4P7RA 2JEPA 2GQ3A 2TPSA 4JY8A 4M7TA 4ACYA 3RK8A 1XLKA 1EF2A 1U5VA 2RDTA 5FEZA 1XDIA 3WD3A 3CAWA 3LHYA 3TJIA 3S9IA 3I65A 1TQXA 2HE8A 4C7GA 1KWGA 4XZ9A 1ZGDA 4CU7A 1VBJA 1F3PA 1ONXA 3T55A 2CWNA 3M44A 5AYBA 4I8YA 2ZQ0A 4JNYA 4OECA 1F3XA 3ME3A 3EXRA 3GU2A 2BG5A 3L66A 4M6QA 2VO5A 3VGBA 3NZPA 3WLQA 3CXBA 1EXPA 2XJ7A 2QIIA 1EWEA 4NRSA 4ZOEA 1K9EA 1HGWA 2OOFA 4QLJA 3NQ7A 2WSYA 3B03A 4IUGA 2FZ9A 3OVQA 4R88A 1A5BA 2C0HA 2DZBA 3QYSA 5AHMA 3I6TA 1E5JA 5I6SA 5D04C 4I7UA 3BV4A 3GXDA 3DENA 1EDTA 3AC0A 4TMBA 4PE8A 2HVMA 4AWEA 3O0KA 2PTWA 1J18A 4LV9A 4LVAA 3UD6A 4YWOA 1ESWA 4UFJA 1G01A 2G4JA 1YDYA 4GG9A 4R27A 2XIMA 4BQ5A 1R9XA 1V79A 4AISA 3WD1A 3IJQA 3WX7A 1VFUA 4HNUA 1YBQA 4JTDA 3GXMA 3GDBA 3L4WA 3ZVHA 5JIWA 3MP5A 4HB7A 2YVGA 4BA0A 4D1JA 4I3GA 5HINA 1V6TA 1ZXIC 3EDFA 3WDRA 3SCUA 3LSCA 3TCSA 3T2PA 4FNTA 4GVFA 5FEPA 1QUMA 4UTMA 3KCOA 4GKLA 4B5VA 5TD4A 4FSAA 4EMWA 1CTNA 1RPKA 3UR5A 4KF1A 3QKZA 3B04A 4H41A 3THAA 4LVFA 3NVYB 2WAGA 2J9YA 5CSUA 3WNLA 3T0BA 5E6YA 1IR1A 3S83A 4RDWA 2XVLA 1WOBA 1MUWA 1MW2A 2OCZA 3WDQA 1G67A 5A8QA 3B9DA 3QZEA 1TPWA 4J57A 4E5TA 3KP0A 3VMNA 3UJ2A 3VKAA 1D8CA 4Z2KA 1J10A 1PDYA 3S5YA 3PUOA 1A4LA 4JTAA 4AY7A 1C8XA 3RJXA 6ALDA 4GI9A 3W7JA 4WDTA 4AF0B 4KWSA 3V7PA 2PDUA 4QQ3A 1JUEA 3CYVA 3O9NA 3SUTA 5D9OA 3HGSA 5AYXA 1CLXA 2W91A 6ENLA 4KCTA 5E6ZA 2KZHA 3FHAA 2VZSA 1GZJA 4FO4A 2XUCA 2Z24A 2OQYA 4J5NA 3V75A 1IT0A 3PANA 1PZ3A 1BWVA 4UQ9A 2I7GA 1GRAA 5CXPA 4HZ8A 2XH0A 2Z6IA 3CH9A 3GG1A 4UTKA 3RU6A 4EXBA 4JKKA 3U2CA 1Q6FA 4AYSA 1MQPA 1B3OA 3NO1A 4XZNX 3FNDA 2EG7A 4M1BA 4D1IA 1YTDA 3B0XA 5FEXA 1CX9A 1FECA 2ZRVA 1GVFA 3P8JA 3REQA 3H24A 4IPLA 1RHCA 3GNXA 2WK2A 3MZ2A 2INFA 2F8QA 3LV6A 3B05A 4FIQA 3QJAA 2ESCA 3T1GA 5F2LA 4RW3A 3COTA 3B8VA 3DZ1A 2OZ8A 4N9DA 4NJIA 2HXTA 5H6HA 5BMXA 2QKFA 2XWEA 2OKOA 4AIUA 3WQVA 1VEPA 1GOQA 4ZE5A 2O0TA 3CV2A 2VOMA 1KFBA 1E9YB 3EWXA 4AVNA 3M46A 3EPMA 2PE4A 3L5MA 2ZRUA 3UGVA 2FQIA 4HZMA 4QJ3B 3N11A 2X8HA 4XBSA 5HMFA 5DQPA 3VCRA 3VINA 1OYCA 2Q09A 4RZ4A 2XFRA 3W02A 2DSVA 1AH4A 3C5QA 2QT3A 3WQ8A 2FPTA 4XB3A 1I0DA 1W37A 3JZEA 4CU8A 4WGHA 3L5AA 1KM0A 2IPWA 4MKSA 5D37A 1OFQA 1Q7MA 5FESA 3GKFA 3VK5A 4O1EA 3EXTA 4LXFA 4DYJA 4M6VA 2E5BA 2W5FA 3TMQA 1XBXA 3H2EA 1HJXA 2DQWA 3WLKX 2GK1A 1H49A 3WQDA 4CCZA 3LEPA 2JBMA 3RLVA 4OHQA 2IXUA 3TMLA 3RR4A 1S5WA 2X50A 2AQOA 1XYCA 5FF2A 4H9UA 3HG2A 2H9AA 4N0RA 4LUSA 2A3LA 2GOKA 3W76A 4GQQA 7PTDA 4QJ4B 4GBUA 1EDQA 2O9OA 4C7FA 1YMYA 3GYEA 1TA3A 3VDCA 1BRLA 1QK0A 1AH3A 4OBRA 4ORMA 4ILSA 4OV4A 3BQ6A 3S0CA 4Z2HA 4K6AA 3PAJA 3WEOA 3LQGA 3S5SA 3U4FA 4QSHA 4GYJA 3GR8A 4MNLA 2GQAA 3EKLA 1VJSA 4DB7A 3A22A 4QISA 3CUIA 2WNNA 1PO9A 5HNNA 1XYMA 2OT0A 1IT8A 2GJPA 3LV5A 3QQWA 3UERA 4CNNA 3M0MA 4R3UA 1FO4A 4IHCA 1TFVA 3RU8X 3AMCA 4F0LA 3IK2A 3PWIA 2DVUA 1G7VA 1PV8A 3HQNA 1XKYA 3EDDA 2FPYA 1LUCA 2YCEA 4A3UA 4B2DA 5REQB 4RDVA 2OXNA 2PI6A 3NL3A 3WMCA 1MI3A 4ZZ9A 4RCXA 3CASA 2ALDA 5H2ZA 1H41A 1Q6OA 4HA4A 2VEKA 4JBRA 3EB3A 4GQBA 4G5DA 1W5MA 1XLBA 2VL4A 2OZ3A 1NSJA 2YXXA 1N60C 3N9SA 1GK8A 4E2VA 4L4MA 1FWTA 2TPRA 3AXHA 4FB7A 3LERA 4MADA 2OSXA 1K7XA 3VCNA 2A3BA 2XHYA 4LS2A 2HPMA 5ABEA 4PEKA 3R10A 1M01A 3QMTA 3TZFA 3TYBA 1O1ZA 3RLUA 3URBA 3GDRA 3QW4B 4JX6A 3MO4A 2CBVA 3WUGA 2QJMA 2NVDA 5I3FA 2BOFX 3W2KA 1B3ZA 2Z1VA 4QHRA 2VZVA 1MEWA 1UQZA 1KRCC 3PULA 2PWUA 3NVVB 3QR3A 3EUB3 2ZRYA 1K4HA 1E1CA 1Y5VA 4IGMA 3SUUA 3QGAC 1JZ4A 2OX4A 4LB3A 2TYSA 4PTWA 4MAZA 4BQ4A 1QHOA 2CCRA 3WJSA 3THDA 4XZBA 2GGGA 1TA3B 2FMOA 1ZDLA 2R8WA 3BMWA 4MB5A 6REQA 2CWXA 1IGSA 3IIOA 2NT0A 4AC7C 4PMDA 1U5HA 1K8YA 1LOSA 2HMCA 3QY6A 1E4NA 3EGJA 4EQSA 4YWSA 3RILA 4H3DA 1EJ7L 4O54A 3SN0A 2YCJA 1XBVA 1NIUA 2BNJA 1ZMCA 2OFJA 3KE0A 4JDRA 1JIBA 3NQDA 2NUXA 3SY1A 3A9IA 5E70A 5JBDA 3AICA 2NUWA 2WNWA 3A3HA 2E6DA 3DYMA 3CGCA 3LTYA 3CQHA 4ZCWA 4R53A 3UVIA 2O56A 3NWRA 4B2DD 2BTMA 1E71M 1XIEA 3WFAA 4URIA 1EIBA 1OWQA 4H8NA 4OU1A 4LAOA 3M0VA 2CHOA 4DBUA 4LYRA 3VOIA 5B7ZA 4X2RA 3R13A 3S6TA 1E6RA 1M1BA 3QC0A 3SCSA 4IL0A 4N9BA 4Q4OA 2P0IA 5ABTA 4N4PA 4GJJA 3BZJA 2P3ZA 2AKMA 1DWJM 4HMNA 1KRBC 3EF6A 4M3PA 2PC8A 4MWAC 2Z1WA 1QASA 1JF5A 3R1ZA 1MO9A 2YJQA 4BZYA 4H9ZA 3PBVA 1RQHA 2WSQA 1QI5A 5ENLA 1W3TA 2GR1A 3LA4A 3RMEA 1Z41A 3B97A 3VYLA 1MNZA 3QR1A 1UMLA 4CCDA 1GG0A 3CH0A 1L2UA 1R7AA 1OCBA 3LOTA 3TAOA 4B5WA 4N9EA 4B5XA 1HKIA 3VIHA 3OYXA 3GTIA 1ZZMA 3N6HA 4IJCA 3T0TA 2V3FA 3H4WA 1JL8A 1ISXA 3V18A 3CHCA 1A4MA 3MUAA 3PPCA 4NP7A 4GFIA 1XLDA 2VZTA 2DUZA 5FL0A 4P7OA 4NY2A 3SSJA 4H2HA 3GDMA 4X9YA 2YBVA 3VFLA 1AD4A 4DJED 1GEUA 5CAHA 1OSEA 3VD4A 3LXDA 1QPQA 2Y0FA 3WF0A 4XZWA 3NURA 3EOLA 4GNKB 2ZVRA 1TWSA 3BCDA 4UB9A 3HW2A 4R9XA 1DWHM 1F8MA 7TAAA 1LWIA 3OVRA 1MFVA 5M5DA 2CEQA 1D8WA 3U5UA 1NY1A 3BLKA 3BAIA 1VKFA 3RX2A 3AIBA 4HP5A 4UQEA 3G1DA 1LL7A 3RLGA 3C2EA 3S2MA 1KXQA 4NJHA 1T40A 3VDGA 1UUOA 3RPMA 2FHCA 3GC4A 1C7TA 4GWEA 5CC7A 2EEXA 4K7YA 2G41A 3AS3A 3W38A 5I3DA 2V2HA 2ZRXA 5F2GA 4ENLA 1DJYA 2BWGA 1DEDA 4PBEA 1G4TA 3MSDA 3IV8A 5G5GB 3F5KA 2WZTA 4A3RA 2F6UA 1SO5A 4V1XA 5KETA 1VPYA 2PDNA 4RV3A 5CAKA 3BSMA 4UTTA 2YFNA 2W54A 1UWSA 2YYTA 2A21A 3DECA 1OFPA 1SR0A 5CG7A 3C2FA 5HNTA 5A69A 5DXYA 2BVDA 4C90A 1J6PA 4FX7A 3WQ4A 4F3HA 3ARVA 4KRUA 3MKVA 4TTGA 3MKCA 4B90A 1VHNA 4AWUA 5HULA 1HT6A 1OB0A 1T5AA 5JIPA 2QAFA 4RV8A 3KRBA 3N6QA 4PMVA 3PFRA 5CZ0A 2PDWA 4PMRA 5FJPA 1LOLA 1ONEA 2CLHA 1TIMA 4POCA 1P6WA 2XN0A 3WLSA 2CHNA 1X8FA 3EX4A 4G9PA 5DT5A 1XIGA 2PGWA 3BLPX 1TG7A 1C3FA 2O4MA 1FX6A 2ZOXA 1BYBA 1M03A 1KM6A 1XDLA 2WW5A 2XIIA 4MM1A 2I17A 3CUZA 1HKVA 5CBJA 4RNFA 2E9BA 3KOYA 3W87A 4ZQOA 1UR3M 3V1PA 2E9LA 2NVCA 4TR9A 1WDSA 4QCEA 2AMXA 1R3YA 5KITA 5D33A 1OM0A 3E2SA 4HCLA 3S1UA 4B4HA 1R3QA 4AU0A 4E6MA 3IAQA 1UWUA 1U2YA 3KFTA 2J7DA 2Z2AA 4XAPA 4KERA 1YXYA 1U1UA 1SFLA 3K1DA 4QLKA 1IXQA 1NEYA 4S3JA 4TVWA 4O0KA 4S3FA 1XDMA 1LCOA 3G1SA 1FHVA 1M7XA 1I75A 4DXKA 4M19A 4MB3A 1B4EA 1X6LA 4AF0A 3NQ2A 4EPDC 3MKKA 5HOSA 1F2JA 2E1WA 5M03A 4ZOAA 1HW6A 1E6SM 4YJ5A 2VVSA 3OB8A 1TTJA 5HK4A 4IMEA 1N8FA 2J77A 1MSSA 4G7FA 4FNUA 3H55A 3KCJA 3ITXA 4G6CA 2A1YA 4H9XA 1KFLA 4EX4A 1HP5A 4RK8A 4MMWA 2WMGA 1M53A 4Z08A 3CZKA 3V5FA 1JDAA 3WL1A 4O16A 4E38A 3WD0A 1P0BA 2PTDA 4GNJA 4DWDA 2J4GA 3UCDA 2Y85A 4H9MA 3MJMA 5LIYX 3Q45A 3SCOA 4J7RA 2VFDA 3KBJA 1Q7QA 2PZ0A 2QULA 2Z00A 3WBWA 2TODA 2I5QA 4Z1DA 4FXFA 3S6OA 2B0MA 1WXYA 4AEEA 4H7VA 3GVVA 3P84A 5DN1A 3CL7A 2X1SA 2AKZA 3P3BA 4W8AA 3OHIA 1TV3A 2VR5A 4UOQA 5JVLA 5AZ1A 4KBXA 1AQ0A 3RAOA 5I2UA 3GSMA 2RABA 2GWNA 3U5YA 3UA4A 4DXVA 2QJHA 5KZMA 1XXXA 3CK5A 1DJHA 2J7HA 2YSWA 2INZA 1I60A 2J7FA 4V33A 1KGUA 2GSJA 2H8XA 1JNEA 1KGWA 3W53A 2RAGA 2DT2A 2OEJA 3LMYA 3MWAA 3VOFA 1AOGA 3HQOA 3BICA 1G6CA 1A47A 2XSXA 1W2PA 1FVPA 3S5NA 5A2BA 5XIAA 3VE9A 2CU0A 3E49A 3PY2A 1UW9A 2A6NA 2BVWA 3POCA 4O8AA 4NAFA 2X1UA 1IIGA 4WSJA 1WUEA 2ZC8A 3FV9A 1OK6A 3E3HA 4AD1A 2W3SA 1NPXA 2ZDRA 1KBLA 4GUGA 1N5WC 3FYPA 4QJ5B 4WR3A 3B9EA 4GC3A 3E9AA 3J7HA 1J9YA 2PD5A 3WK3A 3TYAA 4Y90A 2MUCA 1UOKA 2H3BA 3QN3A 2YZ5A 4BF5A 4H6KA 3W1UA 3OJGA 4UOZA 3POHA 1XQKA 2X41A 3KLKA 1ZPTA 4W87A 1XLFA 5DMNA 2W55A 4A6GA 3M64A 2D20A 3S2CA 1R3RA 1XR2A 4AYGA 4M24A 1K6WA 2GVJA 1JUBA 4A8IA 4A22A 2WZEA 1OFOA 3WIJA 3T2QA 5C2CA 1YTEA 1N7KA 1OQFA 3PJTA 3ZR4A 2CLKA 3WENA 3O6YX 4PC8A 1OGSA 3TJ4A 4Q8NA 4YNGA 4KRZA 3DH9A 3P5YA 1YTKA 3KVKA 5A6BA 3G8EA 3ISIX 5LHEA 1Q6RA 2Y70A 1ZNNA 4L61A 1CB2A 4M6PA 4G8TA 1GYNA 1T8QA 1A5NC 2PTYA 5HPCA 4KEUA 4XO7A 2C18A 1UKTA 2PLMA 3AHZA 3IAPA 4Y96A 3B8DA 2WO5A 3MI6A 3PZGA 4HZ6A 3ZT5A 2J7CA 3PAOA 2VGBA 4O1AA 3DFTA 4QAWA 3GXNA 4WRHA 3CIVA 3SRKA 4NASA 4JN7A 1AMKA 1FWHC 1K7FA 1A5CA 4C1NA 2HEJA 2FTYA 2ZDSA 3N3TA 3VOGA 1R2RA 1EWDA 1H2JA 1LL6A 4MNJA 2FH8A 3W7DA 1FWGC 4IZGA 3AZSA 4AW7A 2Y8VA 1WP6A 5DCBA 5LIXX 2AGTA 3KAOA 1JCYA 1QPRA 1WDDA 2W66A 1BYCA 2WMIA 3LK6A 1UZHA 2VFGA 2YW3A 4L5ZA 1FWIC 5D02A 1ZHAA 3ABQA 1PS9A 4MY9A 1SMDA 1H4PA 2X8GA 1WPCA 1XICA 4OOZA 1FWWA 1KCXA 2IPJA 5GPRA 1JULA 4MWAB 1NP0A 2G3IA 5C55A 2G37A 4ZQCA 4E2OA 3UU0A 1GSNA 2I9UA 3M0IA 4HBKA 3WEZA 4GI6A 1R2TA 3A21A 3ANYA 1I1XA 3W7LA 1ZUAX 1VJIA 1E4LA 3MI2A 3QPZA 5G5IA 3GHRA 3TKFA 5A8PA 1M41A 4ES4A 4HA0A 3DHPA 3AISA 4C6EA 2WVVA 3M0YA 5HR7A 3TONA 3MI3A 1F8WA 3ALGA 4Z2LA 3R4IA 3BARA 2GPTA 1JRBA 4LVGA 1QBBA 3SUVA 3R11A 4AIBA 3OGSA 1T99A 4HPXA 3VIPA 1EP2A 3W6YA 1RH9A 2AAMA 2FVMA 1S5TA 2WVSA 4PCPA 3B4YA 3F4DA 3NL2A 3O0FA 4S3CA 5DBTA 1V3IA 4LOCA 4XZHA 2YGYA 1DPMA 4HHHA 3TR9A 1CYGA 3W01A 2W61A 1Y8BA 2ASHA 3MDUA 1SGJA 3KOFA 3N2XA 3CBWA 3MYOA 4D6DA 1H50A 1CPUA 3DI1A 3UG5A 1H0IA 4MUZA 4FEZA 5U25A 4X0NA 6PTDA 3TC3A 1V97A 1UG6A 3GFYA 2X99A 1LRTA 5EYWA 3TQPA 2J74A 1WDRA 2VRKA 2NZLA 2QV5A 4DLMA 1UA7A 4HIBA 4O10A 1IEQA 3NQ6A 4IP4A 1XS2A 3EB2A 3H2OA 4F8XA 4IFKA 2FB3A 2WJDA 4GXMA 4IICA 3ZR6A 1S3HA 1FDZA 1KXTA 3W71A 2GR0A 2VT0A 2WPCA 3KL5A 4I8DA 3EOOA 1B3VA 2QPUA 2IKGA 4B9ZA 1MEIA 3KHJA 3EDJA 1CGWA 1GJWA 3HJEA 4QGCA 1TO3A 2CLFA 2FZBA 2UY2A 4ROQA 4QE5A 1GRGA 1HFBA 3EWCA 1FP8A 4DJDC 2V3GA 3AJ7A 2OJPA 2C3CA 3VFCA 5AZ0A 2W67A 5JCMA 1VIWA 2VELA 2XN2A 3SZ8A 1XV8A 1EX5A 1H61A 5JUVA 1QI0A 4FOJA 2I9EA 3EWBX 4RUBA 4X60A 1VR6A 2GR2A 4LS1A 1UKSA 1SFSA 1A49A 4DELA 5C6MA 1VFTA 3ZJ6A 3T9PA 3V3WA 3LQLA 1US3A 4FK9A 4TOQA 4ATDA 4HHLA 4RR4A 2MANA 4KGJA 4QTGA 4FX9A 1OX5A 3UQNA 1ISZA 1TYTA 4CN1A 4JXCA 1I45A 3PM6A 4LA1A 1PX4A 4J28A 3AM9A 4XVEA 3T2OA 3F1QA 1W3LA 3TOPA 1Z69A 1XIMA 1KGXA 1OBAA 4YXGA 4XAFA 4FNQA 4I7VA 2PDXA 3VNIA 4JX4A 5FJJA 2A85A 5D32A 5L9FA 4P7LA 2PD9A 2WCSA 2PDPA 1HJQA 2VC7A 3LLFA 3AIQA 4IIEA 4LVBA 1QNOA 2XSAA 2CXGA 1OHLA 2Z7GA 1VFMA 2Y61A 4A8LA 4HOXA 5A8OA 1TVNA 2A3AA 1OFDA 3P74A 3WF4A 1HP4A 2QLYA 1XIDA 2R14A 1KFCA 4PEEA 1TUFA 1HUVA 4YVXA 2HS6A 4RNJA 5LNWA 1BG4A 3C2VA 4PTVA 2A8XA 1WX0A 3CQKA 1OC7A 2YAUA 5HANA 2OO6A 2XFYA 2WMIB 4F9JA 2Y5EA 5AYIA 2IKIA 3NZGA 4P8WA 2NLIA 1DOSA 4JIHA 4PTMA 2ZCGA 1NOUA 3B9AA 2QNEA 3W2NA 1E0VA 2FIQA 5F1UA 5CZJA 2WP5A 1X96A 1YADA 3UJRA 5FJIA 4LYPA 3GC2A 4EAMA 1DL3A 4W7UA 4DF2A 3B9NA 1IE7C 5DMYA 3TA6A 1O95A 2XWDA 1BZLA 3OTRA 2YX0A 3HG4A 1RP9A 3AHYA 1W9BM 1UH4A 4B3ZA 2C79A 3LN3A 4OTKA 3VO0A 2Q71A 4OE7A 3B9JB 1FWDC 2PDHA 3BAWA 1Y5WA 4U5IA 1REQB 2ZUUA 1UKOA 5F2MA 1O60A 2OGYA 3ECQA 1V6XA 2V81A 2QIWA 4HNTA 1MVYA 1W17A 1JCXA 3LS9A 1A53A 4DAIA 5CC5A 3ETRB 1LRNA 2HNHA 4H4VA 4GMEA 4MPQA 1EEPA 2QGYA 1GZGA 4RZ5A 3K8KA 1LG1A 2FVKA 2PWVA 5DCDA 4NHVA 3AJXA 1LBMA 5HMSA 5FEWA 2VUYA 2A2IA 2B7QA 5CPMA 1DYSA 3CPRA 2Y5SA 2CPUA 2D2JA 1R5YA 2J6VA 1R3SA 3AS0A 2VCCA 3WBEA 1FCUA 4BK9A 1TV2A 2GL5A 1V0NA 2W6RA 3GFZA 1M6JA 1GUVA 1WCGA 2YLAA 2VWTA 3KVLA 1R47A 2VX5A 2J27A 3IV3A 2HROA 1QU4A 4Y6GA 5AHIA 1XUUA 3C56A 2GUBA 5FL1A 1HJUA 4PUEA 4OZOA 1QOQA 1ZSXA 3VOHA 4F0SA 4FHAA 1DXFA 3ES8A 4YTRA 2CW6A 3IGSA 4W7WA 2NVAA 4AZ6A 4EF9A 2ATMA 3MY9A 4OBSA 3A4WA 1STZA 3UZZA 2PAJA 1LLOA 1EIXA 4HSOA 3VNZA 1TV7A 3LTPA 1JFHA 5FAJA 3KX6A 3G1FA 4WKHA 4GCXA 2BODX 3PTKA 4Q6XA 5E0CA 2R9ZA 3LD5A 2ZXAA 4N2YA 4WY0B 1V03A 2AQWA 3B8UA 1JFXA 4X2PA 2YPIA 1RM6B 1B54A 4K1WA 1LM1A 1RQEA 5DXXA 1P7TB 3EA2A 1TPDA 3H23A 2OELA 4QSFA 2ZUTA 3VC5A 4BEQA 3WDJA 2GLKA 2WHLA 4GGBA 4X61A 3IRSA 4P7NA 3MJYA 1IIHA 1THFD 4S3GA 3KP1A 1DWIM 2OT1A 4PL1A 4IPJA 4BQ3A 2FGLA 4PSPA 1HO4A 4XZMX 1RD6A 1RV8A 2TSYA 3BW4A 4EXAA 4KRTA 2QGHA 3B4UA 4JIRA 1RBOB 2OO0A 3ZR5A 1R30A 2QCFA 2PRMA 4WJ8A 1XHGA 3W23A 2QCGA 3ABXA 2A3HA 3KDNA 2Q02A 4IQDA 2WWDA 4EK7A 1D3GA 3GTFA 5DRIA 2ZZ1A 4G7EA 3AROA 3L2MA 2GRTA 5EFDA 3Q65A 3EOSA 5CH9A 4MWAD 1MQQA 3HRDC 4H4XA 1NF7A 2E5AA 2OB3A 3GVRA 1AJ2A 1W9UA 1QHPA 1MUMA 2WSPA 1NDWA 4CLMA 2NUYA 2YCIX 4I9AA 4PSRA 4INFA 3NO3A 3SR7A 2WNQA 3XINA 3FYYA 1JDEA 3LGGA 5CLTA 3RDKA 6TAAA 1B3WA 2WXDM 5LKYA 3EB4A 4OVXA 1YYAA 1OCQA 1H5VA 4CVWA 3IJ7A 4I9MA 4O1BA 4BHYA 1H63A 2PRHA 3CUXA 5TR3A 3SUWA 3L5OA 2JEQA 3VUSA 2C3DA 1D3CA 3P0XA 4XSLA 4H7CA 3HOJA 2DGAA 3C2OA 3D9XA 1NHSA 2Z29A 3FDGA 4D6IA 1S2TA 1GKQA 3P67A 1VEMA 1POKA 3CLWA 2A79A 1JGIA 2DP3A 1XLHA 3OZPA 5A6SA 1JZ7A 1J4EA 4O0QA 4B15A 4LBUA 3O8AA 1TPH1 4I6VA 1WQ5A 1XLLA 5D4YA 1F76A 1FXQA 3E0LA 3RGTA 1VP5A 4YIWA 2DY3A 1PX8A 3P80A 3NVZB 4IISA 2Z2BA 4M7SA 3URNA 3I3BA 2VURA 4Q6JA 4R7JA 3L21A 3W6LA 4Q32A 1ONFA 1E0TA 1T41A 5IOBA 1DE6A 4AXNA 3LPGA 4RZBA 2ZA2A 1ICSA 3RXZA 3GIPA 3ZJ8A 4MPKA 1NFGA 1XX1A 4AD5A 5DT7A 1A80A 4GJIA 1CXFA 4CD7A 3HB9A 3OYZA 1C8VA 1P1XA 3W3OA 4X22A 2BZNA 3CGBA 3MUY1 2QAEA 4EAYA 4DX3A 4YPJA 4MWAA 1ONRA 2QCDB 3N2CA 3RM4A 3SR6B 3NPVA 3EKZA 2V5BA 3SCVA 5KZ6A 2X7WA 4C6LA 3INPA 2ACSA 2C1IA 5JU6A 2QZRA 1BVWA 1V3LA 3CO8A 3U0HA 3VZYA 2J88A 3EYPA 3MBFA 2QDEA 1ICQA 1OABA 3EDKA 3JW7A 4AFYA 1FWCC 3G3MA 3GVGA 2OMAA 2BV9A 3S42A 3F5JA 4QEEA 1Q65A 3Q58A 4CVUA 1WXZA 2VD8A 3TE9A 1FCQA 4GQRA 1G4PA 5AYYA 3PZUA 2WWCA 4QG6A 1GEHA 2OQHA 1M9HA 1AW2A 3LRKA 1CXEA 5JH1A 3HQ1A 1FIQB 1HKWA 2ONEA 3TN6A 4ERGA 5FF7A 1M7OA 3USZA 1PVNA 4IMFA 1EC9A 1F4HA 2NXGA 2J8GA 4I5RA 3DX5A 2X09A 1W3HA 4Q3MA 3H70A 1BEUA 4IWWA 1VRXA 5HQMA 1GTHA 1GV4A 3UY7A 1UIPA 1EL3A 4KMQA 4U28A 5C9UA 1OG6A 2DZWA 3DFNA 2CYGA 3ZSSA 4D8ZA 4N4QA 3QFWA 2Z2UA 1PKMA 1V0LA 3W84A 1K4GA 1T96A 4JTRA 4JQ2A 2OZ0A 2R82A 3OQ8A 3WZ0E 1K8CA 4WY0F 2Q6ZA 3QBUA 4K7VA 1CI1A 4MZ1A 1X7FA 4AQLA 2WCAA 5AVHA 3R94A 2AAQA 1J93A 3ZO9A 4ERIA 5K4XA 4MJ2A 3OLEA 1Y7VA 1WKDA 3BCFA 1V5XA 4WJEA 1CXLA 3NEHA 1ITCA 1PZ0A 3SCNA 5KMYA 1Q4NX 5F7UA 2WSKA 1DJWA 4G1NA 4PMNA 4EPBC 2WQDA 3GE7A 1UD8A 4PFMA 4LNCA 2F5ZA 2J9XA 3PVFA 4AZIA 1NHRA 3CV1A 1T0OA 1W9VA 3PG8A 2IQ0A 5G2HA 3OU8A 1XLEA 2ZC1A 1BSIA 4E8CA 2ZICA 4QXIA 4MOZA 3F4CA 4RE4A 2ZX9A 1RR2A 4M81A 5CZKA 2ISSA 1LLWA 2E28A 1XIHA 3RYSA 1GONA 1FWBC 5DMMA 2E9MA 2J7GA 1Z48A 2RFGA 1J0KA 3SIMA 2HS8A 3QGKC 1TCDA 3GRSA 3MQTA 3UR7A 1EGZA 1W1B1 2V2CA 5XINA 3DHUA 4DZHA 4PMYA 5CGQA 2WHMA 3M07A 3GUWA 4D2JA 4D6CA 3CZGA 5HJLA 5D9MA 2WPEA 4UMAA 3KBSA 4NZ4A 4NZ5A 5G4HC 3TQVA 5I02A 1ZLPA 1ZAHA 4C65A 5IRPA 1J5TA 1LT8A 4XKMA 1RLDA 3QRHA 1GG1A 1LP6A 3QZAA 2QCCA 3TWBA 4XQ6A 1SZNA 1JZ3A 3WUFA 3VNKA 3R12A 5C7HA 3WBYA 5D09A 3TLQA 4Z2GA 4RPQA 1N63C 3N3MA 3IS4A 1VCFA 1NP2A 4JTEA 1MZHA 4NJJA 4NU7A 2WMJA 2Z0IA 4C6DA 4GIYA 5E1QA 3G22A 2VHLA 4BWLA 1MW1A 4PMUA 3M0ZA 2VEMA 2XGBA 2QPXA 4IPNB 4JDBA 3UYCA 1GT8A 3WNMA 1UD6A 4UTWA 2FZNA 3GG8A 3DI0A 3BG5A 4WCJA 3QMRA 1XRTA 1H7OA 2OR2A 4UTFA 3C8FA 3BLEA 4XV0A 4JR5A 5CSYA 1EO7A 5LNSA 2WMKA 1FOBA 4IIBA 1EC8A 3H7RA 3U48A 1KV5A 1FXPA 3FGCB 1AMYA 3UNDA 2PBGA 1O7AA 3E0IA 3H4XA 2ZXQA 1XYLA 3TN5A 3OLGA 2BBFA 2C1HA 1E9LA 4RZ6A 1TRDA 3TP4A 4RXGA 3UJEA 5TNVA 1SJBA 4C6NA 3ABSA 3LBOA 4XUGA 1WO2A 1W5NA 1GOKA 4DM2A 5I78A 1ZQ5A 3B8TA 4WF7A 2D3LA 3W7OA 3BC9A 2BHUA 3LTSA 2VGFA 3GTHA 2PDYA 1NU5A 1NWRA 4NYYA 1UR4A 1XD1A 3FA4A 5FF0A 4ML9A 3CQJA 3UNTA 1WXJA 4H4QA 1J96A 3MO7A 4UFIA 1RZMA 3KTXA 4PRRA 2PEVA 3UVAA 4E4PA 3TTOA 1LWHA 1O6IA 3N13A 4Q4RA 1K03A 3GDKA 3I4EA 4EF8A 1BWCA 1CXHA 4KWVA 1B30A 3V4BA 1SM9A 5TAOA 1XIIA 1DV7A 2GGJA 5GRTA 1ZY8A 3GBDA 3L67A 4HYVA 2HNEA 4XG1A 1WKEA 3CQIA 1S3TC 3A7RA 4A29A 2J8TA 1C93A 3OO2A 1IYXA 4E3VA 3CUJA 1EB3A 4GX9A 2D24A 4DWSC 2YCLA 3SO7A 1OFAA 1Q66A 4L7ZA 4ERAA 3ZWTA 4PUDA 3CHDA 1S2WA 4MDOA 3UJSA 1ODZA 2PPGA 3ARTA 1QNQA 1J0YA 2W62A 3RM8A 5K4ZA 1B9BA 2NPXA 4Z0JA 1TYGA 2A3CA 4H4RA 3K4DA 1H2IA 1UZDA 4RE3A 3LXAA 4OWGA 4Y9NA 1F9CA 3STEA 5BRPA 1BXNA 1QW8A 2FTWA 2DIJA 3VDHA 8XIMA 4UQCA 3NXLA 4NX5A 5JXQA 3UPMA 5F2IA 4GPNA 5E9XA 3KBMA 4AD0A 1UJQA 1VYSX 3ONCA 4TVCA 1KTCA 1WZAA 1X7IA 4GYPA 1FEBA 4C60A 4EPEC 3S4TA 6TIMA 1V8EA 3UESA 4S2BA 3GNOA 2BC1A 2E5DA 2Y1HA 3PZIA 1OF6A 2WKGA 3FKKA 1E0WA 3ZLHA 3P2VA 1RJQA 1OGGA 1VCGA 1T8XA 4DUOA 4H2CA 2PDLA 2RDWA 1TB3A 5BZAA 2EJAA 1FWJC 4Q7IA 1XGEA 1FFQA 3DBNA 1SYTA 5FD0A 3M43A 1EZWA 3SECA 4RX0A 3IPWA 1PHWA 1OFEA 2IKJA 2VEGA 3S9ZA 4FZIA 5HMEA 4Y9AA 3W72A 4ZODA 4YTQA 4FS9A 4XD3A 3H22A 1TUXA 4UR7A 4Z1BA 4UBPC 2EPOA 2VNCA 4ZB0A 3KWSA 4IF2A 2X30A 3G18A 3M7SA 3NO5A 3THCA 3NDOA 1SO3A 4UR8A 3PZ9A 2PDJA 2PGFA 1OADA 2XU2A 5DBUA 4NI8A 4WDWA 4TU1A 2QUTA 2X8CA 5K3VA 3SDOA 3HGOA 1CB7B 4HTYA 4J2MA 1Q1RA 1JCNA 3OPSA 2QYGA 5HWNA 5EPDA 2NVKX 3PP7A 3MW7A 3URQA 4XUYA 3SN4A 1XH0A 4O0ZA 1NQ6A 4IQLA 2UY4A 4FLQA 1OEPA 3EEZA 1TX0A 3WQ5A 1FWSA 3TYEA 3R0DA 2I16A 1X38A 1WZKA 4PRTA 4GUJA 1ZS2A 2PA6A 3H2CA 5G1YA 2DZTA 1E6NA 1BXCA 2XIOA 2VXNA 4CQCA 3VAVA 3FXGA 1SZFA 1PTDA 3NFUA 1WZMA 3O63A 4PMQA 1MW0A 4MJMA 4C6PA 1JCJA 4CNUA 1YQ2A 1ZP4A 4L9YA 3GNNA 1H1YA 2VZOA 1XH2A 4BS0A 3CUFA 4H19A 5HPOA 1KV8A 3CWOX 2WOIA 3EX6A 4JIEA 4UNLA 2DSWA 3EWZA 3MMWA 3CMGA 2BVTA 3P81A 3CUGA 3N18A 4MJ4A 1O5KA 3CB3A 3WBAA 3WLOA 1WZLA 2Y4SA 3W82A 1JVNA 8CGTA 4JX5A 2VC5A 1PCKA 4N6FA 1V02E 3CL8A 3CTTA 2AMGA 4LQ1A 4DBSA 1W8GA 1KXHA 1FH7A 5G4EA 2QDHA 3QHNA 1RQBA 2Y6ZA 4HJFA 3UEQA 1OX4B 3N15A 1R85A 2Z28A 3LX9A 1OCJA 2FH6A 4LX4A 5M17A 3KBVA 1KB3A 2UWFA 2H3DA 4AMAA 4AX6A 3QOKA 1ZAIA 2Y7FA 2E3TA 1XP3A 2EF9A 1G4SA 2VRQA 4N02A 4S3DA