3V3WA

Crystal structure of an enolase from the soil bacterium cellvibrio japonicus (target efi-502161) with bound mg and glycerol
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
402
structure length
397
Chain Sequence
b'MKIVDAKVIVTCPGRNFVTLKIVTDQGIYGIGDATLNGREKSVVSYLEDYLIPVLIGRDPQQIEDIWQFFYRGAYWRRGPVGMTALAAIDVALWDIKAKLANMPLYQLLGGKSRERILSYTHANGKDLDSTLEAVRKAKDKGYKAIRVQCGIPGIAKTYGVSYEPADADLPSVEVWSTEKYLNYIPDVFAAVRKEFGPDIHLLHDVHHRLTPIEAARLGKALEPYHLFWMEDAVPAENQESFKLIRQHTTTPLAVGEVFNSIHDCRELIQNQWIDYIRTTIVHAGGISQMRRIADFASLFHVRTGFHGATDLSPVCMGAALHFDYWVPNFGIQEHMAHSEQMNAVFPHAYTFNDGYFTPGEKPGHGVDIDEKLAAQYPYKRACLPVNRLEDGTLWHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Starvation sensing protein rspA
publication title Crystal structure of an enolase from the soil bacterium Cellvibrio japonicus (TARGET EFI-502161) with bound MG and glycerol
rcsb
source organism Cellvibrio japonicus
molecule tags Lyase
total genus 143
structure length 397
sequence length 402
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3v3wA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3v3wA01
2OLAA 2GGEA 3SSZA 3BJSA 3FXGA 1MNSA 4IT1A 2PP3A 3STPA 3UXLA 3MY9A 4GISA 2OKTA 3UJFA 3DESA 3D46A 2P0IA 2XH2A 1P48A 1MDLA 1SJAA 2MUCA 1PDYA 4GYPA 4IL0A 2HZGA 3GO2A 3H70A 3ZLHA 3FV9A 2PTYA 3I6EA 3H7VA 4ROPA 3RGTA 3UJ2A 2PSNA 4FP1A 1L8PA 2QQ6A 3MUCA 2PGWA 3MWCA 2PPGA 4EWJA 3R10A 1P43A 3S47A 3EKGA 3K1GA 3OPSA 1WUEA 2QDEA 3ZVIA 5FJUA 3T8QA 3UJEA 4Z17A 5BOEA 3SQSA 4E4UA 1RVKA 3TCSA 4DWDA 3DIPA 4GIRA 2P88A 3RITA 2P8BA 4JN8A 2FYMA 2QDDA 3RCYA 3V5FA 4A35A 4ENLA 4GMEA 5IDZA 2AKZA 4M6UA 3PWGA 1BQGA 3JVAA 4HCHA 4Z1YA 4KT2A 2P8CA 3P93A 4KEMA 2OQHA 2PTZA 4E4FA 4MKSA 2OX4A 4GGHA 3H12A 2PTXA 3R11A 3IJLA 2XSXA 3GY1A 2PP0A 3CT2A 3V3WA 1DTNA 1EC7A 4HNLA 4JN7A 3UCCA 4GGBA 1XS2A 3QN3A 2QVHA 4K2SA 3Q45A 3ES7A 4HYRA 4K8GA 2OPJA 1JCTA 3TQPA 3CK5A 3V4BA 2GDQA 1TE6A 3UXKA 3PK7A 1YEYA 4HPNA 4A3RA 4E5TA 3CB3A 3DFHA 1R0MA 3IK4A 3VC6A 3DERA 2XH4A 5EU9A 2GGIA 3ZVHA 3RR1A 1TKKA 3FYYA 3SBFA 3VDGA 2XH0A 3PFRA 4DX3A 3B97A 4MGGA 1JPMA 3GD6A 2PTWA 4F4RA 3CXOA 2OZ8A 4A6GA 3QTPA 1EC9A 1JDFA 4E6MA 2GGJA 4H19A 2QJMA 3UCDA 4IP4A 2AKMA 2NQLA 1NELA 2OVLA 3FJ4A 2OFJA 4YWSA 2OZ3A 3TWAA 3IJIA 3ZVHB 3NO1A 3T9PA 1JPDX 1MRAA 3TW9A 3DFYA 3NFUA 1SJCA 2HXUA 4G8TA 3P0WA 3N4FA 3MSYA 2QGYA 1EBHA 3R0KA 4HN8A 2I5QA 3VCNA 2QJJA 1KD0A 4DXKA 3H8AA 5BOFA 1E9IA 4M0XA 2DW6A 2GSHA 2AL2A 4KPLA 3JW7A 4GFIA 3U4FA 1WUFA 3QLDA 1KKRA 3UGVA 3ENLA 2GGGA 1SJDA 2OZTA 2PODA 3TOYA 4IHCA 3BSMA 3N4EA 3D47A 4X2PA 3NZGA 3TJIA 1ECQA 2ONEA 2GL5A 3N6HA 3GC2A 3OP2A 4IZGA 2AL2B 2O56A 4H1ZA 3RRAA 3T4WA 3VFCA 3R25A 3RO6A 4HCDA 3DEQA 4ZA0A 2ZADA 4HNCA 3JZUA 3SJNA 1TZZA 4J1OA 3OZYA 4K1WA 4DHGA 2PMQA 2PS2A 2RDXA 2FKPA 3FCPA 4JHMA 4H83A 4DYEA 1KCZA 1XPYA 3U9IA 2POZA 3TWBA 5FJRA 1MDRA 2HNEA 1OEPA 3KUMA 3MQTA 3I6TA 4H2HA 1EC8A 3R0UA 3Q4DA 2GGHA 2PU1A 1R6WA 4E8GA 4GYPC 2PCEA 3DDMA 5FJTA 3EEZA 3QPEA 2PA6A 3OZMA 2XH7A 3FVDA 5FJOA 2DW7A 1W6TA 3VA8A 3DGBA 1SJBA 3SN0A 4IP5A 1ELSA 5J04A 1EBGA 3THUA 1PDZA 1NU5A 4IL2A 3TJ4A 4KWSA 3OW1A 3CAWA 4MMWA 2PU0A 3NXLA 3S5SA 3UJSA 3I4KA 3PWIA 2AL1A 1ONEA 3ZLFA 4HCLA 3HPFA 2HXTA 3CYJA 3P3BA 4G7FA 3VCCA 5FJPA 2OO6A 2XGZA 3TTEA 3DG7A 3V5CA 1BKHA 2CHRA 1IYXA 2OG9A 2ZC8A 3SN4A 3ZLGA 3MZNA 2PGEA 2MNRA 3BOXA 2OQYA 3IJQA 4FI4A 3DG6A 2PP1A 6ENLA 3T6CA 3QKEA 3DG3A 5ENLA 1MUCA 3UJRA 1KKOA 1FHVA 4DN1A 4ZCWA 7ENLA 3MKCA 3OTRA 1FHUA 2P3ZA 3R1ZA 3SN1A 3N6JA 1F9CA 4J3ZA 3VC5A 2QJNA 3ES8A
chains in the Genus database with same CATH superfamily
3LTYA 3G5EA 5CQ1A 1OHLA 3NQMA 3PBVA 3BMVA 3NL2A 3M43A 4Y6GA 1P6BA 1WZAA 2YR1A 1VBJA 1W9PA 5LNVA 1CGTA 5XINA 1I75A 4NRRA 4MJMA 3TOPA 3QPYA 3B8DA 2QCCA 1LG1A 4HZ8A 1TPFA 3G0SA 5DRCA 1AH4A 2YSWA 2DT1A 3BW3A 3GW0A 2XDFA 3PUGA 1HN1A 1R46A 3R13A 3N2OA 2XG9A 4FEZA 2B31A 3CHCA 4W93A 3AS0A 5KEZA 1RCQA 3UZJA 1W8SA 3VO0A 6CGTA 4L1WA 1J0JA 2O55A 3MKVA 2NT1A 4WJEA 3OPSA 2GOKA 2DDXA 4NKCA 4UMBA 4ZOAA 1S46A 4Q8PA 3E2QA 2VKZG 3RM4A 1H1YA 3SCWA 1E5NA 1TCDA 2BVYA 3CHVA 5A5WA 4BQ4A 2X1RA 3G3DA 2QULA 2W91A 3E74A 2OZ0A 1F3TA 5A6MA 2DZWA 3KCJA 4K36A 2YX0A 4MLJA 5MKGB 3P93A 3WQOA 4WSKA 1MNZA 3MI6A 3EWUA 2VELA 2NQJA 3TNBA 1Y5WA 4IM4A 1XW8A 4GGHA 5I78A 1XQKA 4FOJA 3RX2A 3IGXA 2PDPA 5DELA 3CO8A 1ZX9A 2XHYA 3LHTA 1LQ0A 1FFRA 1DTNA 5CPLA 1EC7A 1SO4A 1JXJA 3RM8A 2E5DA 3BO9A 3WLIA 3AO0A 1BSIA 2HQAA 2JKEA 3FA5A 4N6FA 3ZM8A 3T55A 4A2SA 1L0PA 4EK7A 2BASA 3L4VA 5AHLA 4KEZA 1R38A 3NOEA 1RBOB 1ZHAA 4MDPA 1E6QM 1LLWA 1WBJA 3NEVA 1Q6EA 4Y8EA 2GDQA 4GYFA 1ZS2A 3NL6A 1XRFA 1AW1A 1TR1A 2A3AA 4GH3A 4E2VA 3BZJA 1NHPA 3RYSA 3FSUA 4ZB5A 2QGHA 4HU0A 3NM3A 3A6OA 1PO9A 3ARSA 2P3EA 1Q6RA 3EBVA 3FNDA 4KWWA 1T41A 2F61A 3NGFA 2IKHA 3EZ4A 2PDNA 4FSAA 1D7FA 4CU7A 1U5HA 2VX5A 4K8HA 1OFDA 3R5EA 2GJLA 2J7CA 2F9RA 1RH9A 1EKOA 1QTWA 1V0KA 1R3RA 2NQLA 2OVLA 3FJ4A 5CGQA 3CL8A 3GUWA 4LCSA 3PY2A 2VOTA 2WWCA 2D0FA 2Q3RA 1MRAA 3H54A 1KV5A 5GPRA 1W9UA 1PBGA 4JYFA 3BUVA 3E12A 4MNJA 3WFZA 1EEXA 4WQ6A 3SGGA 4YTUA 2FFCA 3ORWA 2DZBA 2ZKMX 3JU2A 4QEEA 3EUB3 2O9RA 2QJJA 4UTMA 2ZUMA 3KRZA 1JGIA 2EPHA 5CBIA 1GCYA 4TIMA 2XIIA 3DHDA 4EPKA 2QJHA 3LV6A 2QMJA 2O9PA 4B16A 4IHCA 3BCDA 3BDKA 1J79A 3OHIA 3D47A 2XN2A 3LHYA 4ECLA 3O15A 3O6DA 2Z2BA 3N11A 3B8UA 4PB4A 1YDOA 3RR4A 3S2LA 1LL7A 4AVOA 2DH2A 3N13A 4Q8VA 3AZSA 2QUVA 3LN3A 4MJ2A 2NVDA 1C8YA 1IEIA 2CDUA 3L66A 1JAEA 2PS2A 1MEIA 4CQBA 3EANA 2ZXDA 2QCLA 1P1XA 1CENA 3SCOA 1NIUA 3W82A 8XIAA 1RJRA 4DPPA 1KCZA 1GVYA 4HK7A 3NQ2A 3WMBA 2PWFA 2A85A 3VIIA 3VIHA 4H6QA 3AHTA 1XRVA 1IXPA 2EHHA 3OZPA 3PSVA 3O16A 1QO2A 2Y8KA 1BRLA 1T5AA 2OOFA 4IMCA 3WQ6A 1EXPA 3L5OA 1XLHA 3GR8A 4C91A 2E9BA 2Z2UA 1EF2A 4O0QA 4DPQA 4R3UA 7CGTA 2ZZ0A 1EC8A 2V38A 5E5CA 3P0XA 4AH7A 5CPNA 4EQWA 3WLNA 4K39A 4R33A 2VWTA 5I6SA 4DXXA 2Y24A 3VA8A 3W01A 3WELA 1LM1A 3Q94A 2CLIA 2OKOA 4TOQA 3PTMA 4DF2A 3W6LA 2NV2A 5CKSA 3MV11 4OOUA 4Q8WA 4IL2A 4IIHA 1UW9A 1C8QA 3AS1A 1R47A 4GOAA 4AZBA 2WNNA 2PU0A 2BWGA 3HQOA 1F6PA 4XKMA 3A9IA 4FF7A 3WO8A 4QLLA 2A4AA 4X9SA 3VE9A 3MI2A 1B3XA 1LCOA 1ME9A 2EPLX 5LA1A 4XX6A 4OECA 4XKYA 4HU8A 3TSBA 1R9XA 4QIUA 3QYQA 4Y90A 2CZDA 5SWUA 3W0KA 4K38A 2VHLA 4LVGA 1M1BA 4JTSA 1SW0A 5E0KA 3DG6A 4C6PA 1FDYA 5IM51 1CX9A 3FAXA 3S8HA 4NZ4A 1GZGA 2C13A 3MUXA 1PAMA 1M68A 3E0VA 2GDVA 3NSXA 3PN8A 4JDYA 3OTRA 4FK9A 2MANA 4RZ4A 2P3ZA 3PF3A 4AISA 4AD0A 3MW7A 3DKLA 4MYAA 3VC5A 3O06A 3EX6A 1B0IA 1UOKA 5G4HC 3PB0A 3CQIA 1SB3B 3N12A 4BI6A 3TMLA 2HTMA 5G1MA 3ZWTA 3N1AA 5TNVA 3K8KA 1K8XA 2Z1SA 4C6DA 1VB9A 5D30A 4MUZA 1T3QC 1SFJA 1UKQA 3IIXA 2P0IA 3NZPA 4XBKA 1NFPA 1RD5A 2TODA 3BG3A 3KLJA 1MVYA 4GK8A 3STEA 1X6UA 4DJDC 1P0DA 2QJGA 3EDJA 3OYXA 4QE5A 3AHZA 2BOFX 1MRQA 4GR1A 3WCZA 3Q67A 3P60A 4JYEA 1EJ7L 3M5ZA 2QHAA 1U30A 4HK5A 1W1A1 1KXQA 1E0VA 3HG3A 1FH9A 4NXKA 3VK5A 4NILA 3B0PA 4O11A 1KRAC 5LSMA 3AZTA 2G50A 4UTTC 5FJUA 4NI8A 4JN6A 4IPJA 1GRGA 1V6WA 3SQSA 3R4IA 4FA3A 1ONRA 2EKGA 3R12A 1ZMCA 4GMEA 5KVIA 4M6UA 1GT8A 4MWAA 1OVDA 4D6GA 1C92A 3RAOA 4AAJA 7TAAA 4WVXA 4TMCA 5FA5A 4PTDA 3LGEA 2EPKX 1LL6A 4UC5A 2VEIA 4EAMA 4JFTA 1CIUA 7PTDA 1K9EA 4V27A 4A8LA 4ALDA 3ARRA 1DIDA 3H12A 3UT0A 2O9OA 4QSHA 1GG0A 1ZBWA 2ZZ5A 3PBYA 5AVNA 5I23A 2E3ZA 3GY1A 1FTXA 1SZFA 3NPXA 2VFIA 3AMZA 1KQZA 4C6OA 4S3CA 2J9XA 5I0DA 3I3EA 3CGEA 1E4MM 1WXJA 2XVGA 4F48A 3ZJ6A 3W38A 3QN3A 4K2SA 5AY7A 2QCNA 4QE4A 1EO7A 4IFKA 3IJ7A 1Y7VA 4H00A 2XGIA 3OLIA 3E3HA 4JTLA 4H9ZA 3ARWA 1VQTA 4XUYA 1YEYA 1E9YB 2BX7A 1T0OA 1VPQA 2ZXAA 3E2SA 1FP9A 4Z1AA 4GRTA 3LBCA 3E2RA 2VX6A 4AD5A 3CB3A 4UB9A 1X38A 1SZEA 5EBKA 3LERA 3TYCA 3WJWA 3NPVA 3KS5A 4GXWA 3ZVHA 3WUGA 1XD1A 3TA9A 2VUNA 3GNPA 2X09A 4DWSC 1Q6OA 5H1WA 4F8XA 2EJ1A 3PZNA 1PCWA 4AF0B 1FWNA 3EDDA 5CPMA 3NWRA 1JZ8A 2AKMA 1RJQA 4Q8MA 2QAFA 1EPXA 3FK4A 4POCA 4GBUA 5D8WA 2QPSA 5C9WA 3LM3A 4LBSA 1S38A 2E6YA 1VLWA 5C70A 4WCJA 1FOBA 4MNMA 2YBVA 3URNA 2ZVRA 3TAKA 4I5RA 3TYZA 3KHDA 2WHMA 3NURA 4C1LA 4Y9NA 3QZAA 2AL2A 1VBUA 3UYCA 1TV8A 3PZMA 4EACA 4AWUA 5EBUA 2YCJA 4D72A 4ADUA 2F2KA 3W1NA 2PLCA 1RK5A 2BVWA 3VABA 3W6MA 3WUBA 2P50A 1V6YA 1IZCA 4XIAA 4AEEA 1ECQA 1F76A 2PWUA 3DYPA 3D5HA 4JX6A 4H1ZA 3GU1A 5DQPA 2GQAA 2WZIA 3T4WA 4PEEA 5JBEA 1OG6A 3RO6A 2BP1A 2VFHA 1O68A 1KR1A 4AD2A 5H8UA 3GDKA 1UWSA 1XIJA 3K2GA 5CLWA 1UZDA 5FD0A 2ZA3A 1KM2A 3PG6A 4BR1A 1Z7AA 3KVLA 3RX3A 1EHAA 4FDCB 1RV8A 5G5IA 4GE8A 3QPZA 3UWWA 5C0QA 4QDMA 1VDVA 1EZ2A 1SSDA 3AYVA 4IQDA 1W5PA 4I9TA 4NZFA 1KTCA 1NVMA 3MQTA 1Q5MA 5FI8A 3A5FA 3OQ8A 1IIHA 2PTDA 3SDOA 1R3VA 3CPUA 1GV4A 3WLKX 1ZY9A 2PDFA 4I3GA 4FLQA 2WM0A 4LAMA 3QPEA 2IQ0A 2HEJA 1GOIA 4YWOA 1A47A 1V4YA 1AW2A 3GRSA 4DWSB 1ELSA 1EBGA 1L6FA 2RHGA 3HJEA 2QUUA 1T8QA 2QYGA 4YLWA 3WNOA 5FIPA 1NWRA 5J5DA 4MMWA 1KB3A 3TYUA 3EDEA 3W07A 3GR7A 1RY8A 5HK4A 2EPMX 3M16A 5CSRA 4GNVA 3W1MA 4BEUA 2XGZA 2FMOA 4QJ5B 1V02A 1XL9A 2EF9A 1RCXB 1MXGA 5REQB 3SGUA 3DG7A 4O1CA 5J8LA 1O60A 4FNRA 1FCBA 1O94A 3H55A 2BG5A 4NL1A 4IJBA 1SZRA 4LAZA 5B80A 2WANA 4MLRA 1I8JA 5ENLA 3H2AA 1VGAA 5I02A 3VNIA 2BODX 2Y5EA 3UZWA 2C3DA 1DE5A 3AROA 1FWGC 3OG2A 1XQLA 4B4FA 2J7FA 2NSOA 3SN1A 1GONA 2R94A 4TXEA 5I24A 2ZFAA 3ES8A 2VQUA 1RZMA 1N2VA 4DUOA 4FOKA 5LNSA 3OLEA 1G67A 2NXIA 1Z69A 1TSIA 1WDDA 4Q32A 3KTCA 4O13A 1KBLA 1P0EA 2J74A 3MBFA 4B5UA 4JTEA 1XSJA 1PEZA 4K3ZA 3VD7A 1GVQA 3A24A 4PBFA 3LENA 4F3HA 1W1YA 3GHUA 2D20A 3DAQA 4IG2A 3FAWA 3ZSTA 4R7OA 2PDWA 1C93A 3T8LA 1GZ1A 1MXSA 4WR3A 2C8NA 4KCUA 3N25A 1JDEA 1S5WA 3MWCA 3AC0A 3IC9A 2YXXA 2XWDA 2G3FA 3WQPA 4AVNA 1UC5A 3WQ5A 3S2CA 1BXNA 1TTPA 5AHFA 1ZGDA 2OR2A 5EMJA 3NZQA 3BICA 1OB0A 1NF7A 4H6EA 2J7DA 1EUNA 4U2ZA 3WD3A 1LPFA 4AHQA 3UPBA 3LX9A 4A21A 3FX4A 3PWGA 2P8CA 5I03A 4HZ6A 1SFLA 2ZZ6A 1I1WA 1OIFA 2YJQA 5D9PA 3NGJA 3IRDA 4JNMA 3TX9A 2PDIA 2CZEA 3R11A 4O19A 4UR9A 4G7EB 4U4MA 3AYTA 3LLFA 2VGIA 3AXHA 2E8YA 3STCA 1VFLA 2J27A 3SCUA 5C5YA 1RVGA 4GQRA 3MSRA 2J62A 3T44A 2EG8A 3WY1A 1YQ2A 2X2GA 3V1PA 1E0XA 3QY6A 2ZDRA 4K8GA 5LIKX 4CCCA 4L4MA 4I6KA 3AIQA 1UKSA 3DC0A 1PL9A 2R1MA 2PRLA 4DI9A 1NOWA 5AC6A 3KTXA 4O4WA 3B9OA 3MVIA 3MCOA 4C6BA 5ABEA 2V30A 4UIOA 2HDJA 1KCXA 5EU9A 3BV7A 4RNJA 3AMLA 4RE0A 4F9DA 3GHTA 4JXCA 3GRIA 3F4WA 3RNDA 1RQHA 2INEA 3OLGA 1ISXA 4Z1CA 1B3VA 1A49A 4Q8OA 2GVJA 2YLAA 3SO7A 1QHZA 3T40A 4CN6A 4C7DA 2C7FA 1SU5A 2GDUA 4Z2LA 3NG3A 5DX7A 3DJGX 3BPWA 5EA9A 4XD4A 5CZSA 2HV5A 5T91A 2DEPA 2WNQA 5GRTA 3LXAA 2YAUA 1W5NA 1H5VA 4K8EA 3C61A 1BYDA 2ASHA 1O66A 3DFYA 1TJPA 2QUMA 4AXKA 1LVLA 1W17A 2ISSA 4H4WA 4MUPA 3CTLA 4LV9A 3WQFA 3TDFA 1FHLA 1LDCA 3WFAA 3BLKA 1JRCA 4Q7IA 2ZUWA 4ATLA 4KPLA 3JW7A 1M6JA 4X2RA 1V0MA 3N18A 4DLFA 3CUZA 2CBVA 1NY1A 1E4NA 2Q6ZA 2GPTA 4CN4A 2J88A 1GQIA 3A4AA 1LOQA 4KFNA 4U33A 2ZZ2A 3NQEA 4JTFA 3UG4A 5KITA 3KHJA 3TN3A 3VILA 2WBKA 2Q8ZA 1CXEA 3RPMA 3RM9A 1X1NA 1E6PA 1S2UA 2V2HA 2ZRZA 5D9OA 4AX6A 1A5KC 1ICQA 4M8UA 2GQ3A 3ABSA 8XIMA 3HV8A 1H51A 2CEQA 4EE9A 3KOFA 3OZYA 5FEZA 5A94A 4WUIA 4RPQA 1LWJA 3W28A 3P8JA 4DJFD 2WQPA 2C1IA 1NARA 2WNWA 3GU9A 3ZIZA 5M5DA 2GQWA 3LCFA 4J7RA 4D71A 2WOIA 4OBRA 3VYLA 4HA4A 4URIA 5FJRA 2A2IA 1QFEA 2EXOA 3RLHA 4GD0A 1Q6LA 2V5BA 4FOUA 1IZJA 1FHDA 3O7UA 4UZUA 3QM3A 2FTPA 4LEQA 4P7OA 1QBAA 5DXYA 3VKJA 1X96A 1I1XA 2VVSA 1V6UA 3T08A 3GVRA 2Y7DA 4IQJA 4WY0A 2W79A 3DGRA 1PCKA 4DLMA 1B9ZA 5JCLA 3K4DA 3UPWA 3BGAA 2NUXA 1C7TA 1UR8A 2A3LA 3FOKA 4IGMA 1YMYA 4CLMA 1ISVA 3TJ4A 3WDRA 1OBAA 3REQB 1PTAA 1GRBA 1BGGA 1LOSA 2BBFA 5D37A 3WBYA 3C6CA 1V7YA 1Q7ZA 2Q02A 1ZB5A 1HG3A 2HBVA 3NZ1A 3PZ9A 4FNSA 4KRZA 1SZGA 2Z25A 3WMLA 1K8YA 1JYVA 2X42A 5HUOA 1NM9A 4O1FA 3ITXA 2WKLA 3LCLA 1EH9A 5RUBA 2CETA 1NPXA 3Q37A 4GZ7A 4IFRA 1JULA 1YBQB 1KRMA 3CUGA 4R7WA 5HR7A 1Q3NA 4LUSA 3T09A 1E71M 3VUSA 3HB9A 3PUOA 4CNNA 1PYMA 3BLEA 1CB2A 3QSRA 5LGZA 4KIRA 4JTJA 1IXOA 1MUCA 1E0TA 2ZWYA 1ZALA 1GOOA 4LFYA 3LD5A 1DYSA 3R6IA 4DN1A 3N17A 2GZXA 3MUIA 1I45A 3FVMA 1FHUA 2E7FA 3URBA 1R87A 1CXHA 3RPDA 3IV3A 3OBEA 5MF5A 3N6JA 3NYDA 2POTA 4QGCA 3GU2A 3OBAA 2YQUA 4Y2WA 4MY9A 4EQSA 5FAGA 1QNQA 4O8RA 1BVNP 4XD6A 3W71A 3PG9A 3OVGA 1Z44A 3LADA 3TYDA 1TTIA 4HK6A 5IXEA 2Z28A 4ZQNA 2VCAA 1OYBA 3RUBL 3BQ5A 3WBWA 3P80A 3SIZA 1TPUA 1MDLA 4O28A 3WEZA 1UROA 1EIBA 3UG8A 3CV7A 3A4JA 2PC4A 3UY7A 3ANVA 2G3NA 2WPEA 1S5MA 2C71A 3FHQA 1NJJA 1HVXA 1Q4NX 3OZOA 3S1GA 3VKAA 2O0TA 3VZXA 3FKKA 1QAPA 5IHRA 4MAZA 4G6CA 1SM9A 2XPKA 2QDEA 3E5BA 3BQ6A 4GHRA 4K68A 4PUJA 2E28A 3W1LA 5C54A 1REQA 2C6QA 4C6MA 2CERA 4CEXC 4AC7C 4O10A 2XFFA 3KZSA 3QGVA 2PRHA 5FS9A 1MUWA 2VEGA 4HNOA 1GQKA 2JF7A 2CZFA 2F8QA 4US5D 3N3TA 3H4XA 5C71A 3AWOA 4UBPC 2WVVA 3WQWA 4UQCA 3VTRA 4B2DD 4UTUA 1HO4A 1MQRA 5U1OA 3B9EA 4MB3A 4DUVA 2HWGA 3GLCA 5G4EA 1W5OA 3DUGA 1GKQA 2HE8A 5ABGA 1B5TA 3WL0A 5I7GA 3IJLA 3BOLA 4Q8NA 5LKYA 2YBUA 3AZRA 2Z1BA 2KAUC 1F6KA 1WP6A 1GJPA 5BU6A 4LSBA 1M03A 3UESA 1PTGA 2EBNA 1H7XA 2IKGA 4O4VA 3RHGA 2X8CA 3IS4A 5M2FX 5BXPA 5C8BB 1EJVC 1E1CA 3PK7A 2GK1B 5I77A 4IWWA 4X60A 8RUCA 4HPNA 2XIMA 1XLLA 2W27A 3M4HA 3WH9A 4A8RA 1SO5A 4FF5A 3IK4A 4C1KA 1IXNA 3PZIA 4C5ZA 2EPNA 4QBXA 3LMYA 4C5YA 4X0VA 5FJJA 1KLZA 4DX3A 3MTWA 3ITGA 2FQIA 3WLQA 4DBSA 2HQMA 3GK0A 5CPTA 4GJ1A 3LNPA 4L4PA 5IRPA 5KINA 4RZ5A 5AC7A 1HTIA 1TR9A 4H19A 4JCMA 3LB0A 2P76A 3S9ZA 2PF8A 3CYVA 4N0RA 2OYMA 4PUDA 3GXDA 3PTDA 3NPUA 1DQWA 4US6A 1U33A 3W2JA 4XZMX 4LT9A 3PJXA 4W8LA 3MHGA 3EA2A 3FGCB 3HGSA 3HTWA 5HQMA 3FJLA 1W3IA 2VCBA 1ZP3A 4HPXA 5I00A 2DZPA 2XIQA 4Z2JA 1YXYA 4ONVA 3W26A 3DU0A 5I79A 4F0LA 2J7GA 1ADSA 2R6OA 4NSBA 3TE9A 3B8TA 4H41A 1IIGA 4I5XA 5CJMA 5C9RA 1E9IA 3NVDA 1CGUA 3S1VA 2E6FA 4XSMA 2BHYA 1KKRA 3P5YA 1GEHA 1KV8A 4Z2GA 5JVLA 1U1HA 1VP5A 4UFHA 3UETA 5FACA 1FKWA 1MQPA 2ACQA 1XKJA 4OUIA 1IGSA 3UG5A 3W7QA 1NFGA 2Z27A 5K9XA 3TJIA 4FX9A 1UMLA 3G1DA 4JIEA 2BGQA 3U5UA 3AMCA 1FX6A 4FNQA 1P0NA 4ZENA 3IGHX 1B3ZA 1O5QA 2JIEA 3AUJA 5HBFA 3VFCA 2AMXA 1P1MA 4HCDA 2FVKA 2J9YA 3TN5A 1TWZA 1S2AA 3OA3A 5A6TC 3H53A 2RDXA 3GVVA 4OE7A 1BWKA 1QASA 1M5WA 3WNNA 2JFEX 4YVXA 4RXGA 3T05A 1QMLA 3EA1A 5HJLA 2WHLA 3EMCA 3O2LA 1A0CA 2JEQA 4QM1A 1YX1A 3IK2A 1VJZA 4MZ1A 1K70A 3UBPC 1O95A 3MBDA 3CPGA 3TSDA 1J0YA 2YVFA 3AI0A 3I7QA 1N8WA 3RJXA 1JCXA 2QAPA 5ABFB 3WQ8A 4H2HA 1G4SA 3O3RA 4E8GA 1ZBCA 1PYFA 1VYRA 5AECA 4UNLA 2F6UA 3PJWA 3U3HA 4W7VA 1WDRA 4WDXA 1H50A 1SFSA 3LEPA 2F84A 3EWYA 2O7QA 2XIBA 1VRDA 3MC5A 2ALRA 1YKWA 1GUVA 4FR1A 3EX1A 1P6CA 2J8GA 2PLMA 1DHPA 3K5XA 3OHMB 3KL3A 1NU5A 5B7ZA 5G2HA 3D9XA 1KGWA 4EXAA 4FX8A 4GO8A 1HKWA 5C6MA 2BTMA 1VAHA 2EO7A 4RDYA 3HPFA 1OC7A 3CYJA 4L7ZA 4C1NA 3F5JA 1UKPA 1VKFA 3D3AA 4PRTA 3AXIA 1KFKA 3PS7A 3A3XA 4OVXA 3O07A 4HU3A 4NUWA 1J0KA 3DHFA 3ZLGA 5PTDA 4MPQA 3SRHA 2QT3A 1VR6A 4C6JA 1JCYA 2PI6A 4M7TA 2Y4SA 1OSEA 2WJEA 3I6RA 3QFBA 5CPQA 4KIEA 2OELA 1P7TA 1O5KA 3CWHA 1LRQA 3KP1A 2H3DA 2YDAA 4DBEA 2NV9A 2OJPA 4S2CA 3G1XA 3NVVB 1H7NA 1CLXA 4CUCA 3NO5A 3INPA 1G4EA 4WDUA 1LORA 3H6OA 4NXSA 4LBRA 1UWRA 1V03A 2XVPA 1EJSC 3LV5A 3SSZA 3MV01 5A3HA 1JYXA 2DORA 5FESA 4IT1A 3W27A 1I2RA 3GXFA 3S9YA 3OODA 1TZ7A 3BVJA 2VZUA 3MY9A 2J9ZA 1TPWA 4ZL1A 1SJAA 4ATWA 2W3ZA 3GXTA 2YW3A 2H9AB 3UXIA 2C0HA 5BYWA 1HIZA 4UR8A 2PTYA 3I6EA 3SAZA 4DBWA 3QGAC 1HO1A 3A64A 1XCWA 2QPXA 6REQA 3N2XA 3GVWA 2DZTA 3ZT6A 3TV8A 2A3CA 1EO5A 4PCFA 2VEMA 1SR9A 3H26A 3S42A 2BHZA 1I2OA 1QOQA 1FEAA 4UQ9A 4LC6A 3UYIA 5MKGA 2HCVA 3G0XA 1S39A 1GORA 2YIHA 3T8QA 2VURA 2X8HA 5BOEA 1FWHC 1JYWA 4UTJA 2J79A 4V33A 3BG9A 3MJMA 2G4FA 4GIRA 2ZE0A 1J6OA 4ZQOA 2X50A 4JN8A 9CGTA 2Q8LA 4DWSD 3G1HA 1W3NA 3GXNA 1UWUA 1G5AA 5CGMA 1EDQA 1PIFA 2CZ5A 5LNUA 2J13A 3WDHA 3QC3A 1DIKA 3TYAA 1ZCOA 3WQ4A 1Z41A 3R58A 2YCIX 4UCGA 4XIMA 3W2NA 3HFTA 2WYSA 4DRSA 4DBDA 3L5LA 4LUYA 1FWFC 1CI1A 1B1YA 1P0BA 3Q6JA 2ZQ0A 4M52A 2UY5A 5DF0A 3CAKA 1US3A 3RPTA 3RO8A 2GR0A 1GYNA 3DJJA 2JGQA 2Y62A 1F73A 4GI4A 1VPYA 1M3UA 1AA1B 1KXVA 3G1YA 3AUOA 3RLGA 4BI5A 4IP7A 3O0HA 4PCNA 3PUEA 4C7FA 2OSWA 4X22A 1OGGA 4H4XA 1UR2A 4EPDC 1J2WA 4WZHA 2P10A 4JX4A 4ACYA 5EL1A 4E5TA 1QO5A 1XKYA 3S9IA 2Y85A 4JCLA 1ZKQA 1NWUA 3LY0A 3RLVA 1MOKA 2QDGA 2NX1A 3CAVA 3LPOA 1H0IA 2IPJA 4MY1A 5BRPA 4A6GA 3EA3A 1PIGA 1WYIA 2VEFA 2PDKA 3FYPA 1JOAA 3CU2A 3TSMA 1MWOA 2ZRUA 2RAGA 4TVWA 2D3NA 5HWJA 3RILA 3KVJA 1RBAA 2WLZA 1CXKA 2IKIA 5F7UA 3LCXA 3M0YA 1DJXA 1V3IA 2E9LA 4Y9PA 4OGZA 3TWAA 4HTBA 3GW3A 1NWTA 1XYZA 1XSIA 1BD0A 4PCSA 1BVWA 2FH8A 3I10A 1UYQA 1XG3A 2HVOA 4ZFCA 3M0ZA 3M0XA 3PZVA 2WVTA 3G18A 2Q8XA 4M6PA 3AALA 3QFWA 2BHUA 5LYRA 4BA0A 4GFSA 4DIAA 4LQ1A 2V82A 3QLDA 4I7WA 4H8NA 2BNJA 2OZTA 4JY9A 1NH6A 2PODA 4M3PA 1JVNA 2GUBA 2F7FA 1ZL1A 4WXZA 4V15A 2ZUVA 5GVJA 1H7PA 3ONBA 2YDRA 3MP3A 2QLYA 7TIMA 1A3WA 3GC2A 3MO4A 4NEWA 1VFUA 3CTTA 1JR1A 1DJIA 3U2OA 3IEBA 4E0CA 3QHNA 5E09A 3RRAA 3QBUA 1J12A 1JI1A 2Y88A 4ZA0A 5HANA 2QAEA 2IMRA 1JCNA 4QISA 3THQA 3UR8A 2QDHA 4UUIA 3SJNA 2DZVA 1Q6DA 4EVZA 1EGMA 2Y7GA 3G6LA 5C55A 4J3SA 4FX6M 5AYZA 3W7CA 1I60A 2QCEA 3LTPA 4PTNA 2DP3A 3FFSA 1KWGA 1H6VA 1N62C 1LLOA 4QX4A 3SRFA 1FRBA 4GXPA 1LF1A 3QW4B 4OZOA 1A0DA 1XXXA 3F5KA 3DX5A 1GVOA 3I6TA 3L2LA 3SIMA 3NVTA 1TV2A 4XB3A 4O1DA 2V0TA 5I07A 4Q22A 1JROA 2PCEA 3DDMA 1OC6A 1OX6A 1LT8A 3NTYA 2OSYA 3ARTA 1SQ7A 3SRKA 1DWIM 4AZ5A 1QW9A 2A79A 5KETA 1GEUA 3WNKA 1UD8A 2OEMA 1E6ZA 1WDQA 5TIMA 1ZAJA 1HGWA 2WWDA 4DJED 3NXLA 3WLPA 3Q2DA 1TFVA 1GQNA 3TW7A 2C0AA 4WY0F 1ISYA 1KCLA 3I3BA 3HGJA 3PFMA 4DVOA 1TV7A 1UA3A 4G7FA 3HQPA 1OZMA 1GXFA 3TH6A 4R9XA 2OO6A 1KBJA 3QOKA 2HK1A 2ZZ3A 1RBLA 4IUGA 4UFKA 3W00A 3M0VA 3BXWA 3T7VA 3PULA 2CHRA 1TA3B 1B3WA 2C16A 3CB8A 3DFSA 3DOPA 2PGEA 5KZ6A 3T42A 3LHVA 2G97A 3UNDA 1TPEA 5JCKA 1LBMA 2GOUA 1FCQA 1J96A 1U22A 4H6KA 4DM2A 3S1UA 2CLKA 4MTVA 2IQTA 1E55A 2Y8VA 5E0FA 1DP0A 1H2IA 3KWSA 3V0UA 1EDTA 5HQLA 1D8WA 1XGDA 3AJ7A 3KBVA 3M6DA 3G3MA 3CNYA 3OB8A 1J11A 1WDWA 3APTA 3BGJA 2V5CA 4ORIA 4LIIA 4IISA 3QOMA 3TFCA 1LYXA 4NG3A 3SCTA 4EQRA 3FIGA 2GGEA 1O7AA 1MNSA 4NJJA 3SI9A 2C19A 3TZFA 2YLLA 2A0NA 1LROA 2Z6IA 3C3NA 1KRCC 3QHOA 3QV6A 3LNMA 5A1AA 4KW2A 4YWIA 4ZO7A 3N3MA 4A3YA 4UCFA 3MDUA 3SR6B 3WK2A 4IJCA 5BWAA 3GE7A 3NQCA 4HSNA 5HINA 3DECA 1F8IA 2DU2A 2R91A 4BKNA 2Q09A 3EXTA 4P5UA 4M80A 5AN7A 4FHAA 1L6YA 5A6AA 2DZSA 2OMAA 2P53A 5C7VA 4YCPA 1CDGA 5EY5A 2PPGA 2X0HA 3XINA 4WDTA 5JIPA 1W1ZA 3AISA 3BGGA 3H21A 4N02A 3S47A 3E0LA 1V6TA 4AMAA 2V3GA 5H91A 3KDNA 2C18A 2VD8A 3M64A 4WDWA 1QRQA 1XICA 4MOZA 2O4QA 3SSJA 1B90A 1ZTVA 3F03K 4Q8QA 3W76A 2P88A 4YIWA 3V7PA 3MP5A 2GVGA 3OO2A 3HURA 3VDHA 4NYYA 3PZUA 1VBRA 4FZIA 1EP1A 2B4GA 5CZ0A 4CQ8A 5ABTA 1TUXA 4ZOHB 3VGDA 4Z1YA 5DCDA 3UP8A 3KBWA 3GTXA 2BVTA 4TX8A 4M56A 2OQHA 4LCQA 4M51A 3L0NA 1UHVA 3KRSA 4ACZB 3T1GA 4M19A 3CHEA 3C8NA 1XRSA 1DJNA 2H90A 1FP8A 4H4ZA 2XVKA 3MU7A 2Y8UA 2YBTA 4JN7A 3QQ0A 3HPAA 4B3LA 1FECA 3ZWSA 3W7RA 3CK5A 1X1ZA 4S3JA 4KGLA 2RJGA 3TNOA 1EEPA 2PDLA 5DY2A 4AF0A 3E0WA 4HPHA 1Z6KA 1S5TA 4Y9AA 4JQ3A 3CC1A 3IPWA 3DN5A 2GRTA 3RMJA 3NSNA 3EWZA 1VCGA 4PMXA 4JGDA 4I5UA 1QK2A 4DJDA 3TXZA 1H61A 1T40A 3SBFA 3VDGA 1YADA 2GLKA 3GWQA 2ISDA 4XZIA 4HN4A 1EUAA 3GH4A 3BL3A 1AG1O 3VMOA 3JR2A 1BEUA 2ZXQA 4L9XA 2WB5A 4MFEA 4D6JA 3UU0A 3TC6A 1I4NA 1YNYA 4AC1X 4XZ9A 3R0DA 1EYWA 3EX4A 3LXDA 3V16A 4AIEA 4AUBA 1P4CA 1QOPA 3B06A 3IJIA 5AC8A 3S2NA 1JZ5A 4B3ZA 4MPKA 3TW9A 4A05A 1BG4A 3H2CA 3MDWA 3NFUA 1BG9A 1IWBA 2DSZA 4G8TA 3N4FA 4MHBA 3SUSA 1XUZA 3ICJA 3WSUA 1F07A 3EOUA 4ZQMA 1QHOA 4TU1A 1E4IA 4R53A 1U2YA 1FBAA 4CD8A 3DH9A 2OB3A 3MMTA 3S2JA 1PKLA 1Z32X 1JG9A 4CN1A 3C0QA 1V59A 4J3UA 3KE0A 3RG6A 2I17A 3ARUA 5TAOA 1R3QA 3KZPA 3N4EA 4H01A 4L61A 1EX1A 3CGTA 4CU8A 2TSYA 3H2MA 1XLCA 3B8IA 3OP2A 1KTNA 2CITA 4F9JA 5D2YA 3K8MA 3KLLA 3M5VA 2V3AA 2QF8A 1GK8A 1YDNA 4MZYA 3E49A 3LOTA 4PTVA 4ZR8A 3O0FA 3SUWA 1K3UA 3S46A 1OIMA 1QU4A 2YKKA 4X9YA 2VUYA 1G4PA 4JEJA 5A8NA 3H23A 3VD4A 2CBUA 3HQNA 4ZZ9A 4RDWA 3DFNA 4GUGA 3CZJA 4GUIA 3IVUA 2PB1A 1VIWA 2PAJA 4JHMA 3WQDA 4RE3A 4BK9A 1KO0A 3MUZ1 1BZLA 1UR3M 5AZ0A 3AN1A 5EFFA 1W3HA 3DBPA 3BANA 3T0TA 1PWMA 5A2BA 5I06A 3WH7A 1W54A 3TYEA 2X0YA 4I9AA 3LQLA 1IR2A 4LS1A 1D2KA 4CD7A 1NEYA 4GUJA 3QR3A 1A5MC 3BE7A 1FFQA 1FUYA 4MB4A 3ITCA 2VL4A 4JD4A 2KX9A 5FJOA 5IHSA 1QATA 5D9NA 4GUHA 5REQA 1J8VA 1PDZA 3VFLA 4OWGA 2CHOA 3R8HA 2R8WA 5F2IA 3I68A 3OG3A 1B54A 5EMUA 1K8CA 2EG6A 4GH1A 3BLIA 3RXZA 2BS9A 3A22A 3HPZA 1DTUA 1W9DM 3UPMA 3MMWA 4HCLA 2Y0FA 1QJWA 3S5ZA 4B5TA 2QUNA 1FA2A 1R7AA 1XP3A 5C9XA 1V0NA 4FIRA 1N55A 2OWXA 1W1PA 1X1OA 3W1PA 1X8FA 3KBJA 2ZWZA 3CQ0A 1OINA 3T6CA 3DG3A 2YDSA 4X0NA 3W2LA 3W75A 1JPHA 4BF5A 1THFD 2Z7GA 1FFUC 5JCMA 2ZX7A 3NS1B 4OHQA 3EOSA 2I16A 3ITOA 2WMJA 3VIOA 3VD5A 3PJUA 1K9DA 4H8VA 3G8RA 2WVVB 1TWSA 1VJSA 3N4AA 4EKJA 4O14A 5CG7A 3WQCA 4QG8A 4K7YA 3O6CA 1LG2A 1KXTA 3CH0A 5IBXA 1Q6GA 1LP6A 2F2HA 3LG3A 1ZJIA 4IMGA 2FTYA 3QLLA 1E6NA 3STPA 4S3BA 3BARA 2XTKA 4JL1A 3FS2A 3SB0A 3FY1A 4DUWA 2OODA 3UWEA 4J27A 3B9DA 4M24A 4FLOA 3VNJA 3MHFA 4ROPA 4AY1A 3CUJA 3QY8A 4HQVA 4W7UA 3LZ5A 5D9MA 4PEKA 1E1CB 3QF0A 1RPKA 2VFDA 3W7KA 4JTRA 2PGWA 2VEKA 5FF0A 4HNVA 4BF9A 2W9MA 4DELA 3W1TA 1CLKA 3EKGA 4JBRA 3U48A 4CU6A 1S3TC 2JKPA 4GNJA 4PSPA 5E9XA 5KSWA 4KFPA 3BSGA 2BY3A 3N29A 1JZ7A 1HW6A 4E4UA 3FXYA 3G1VA 1O1HA 2IQDA 3CV6A 3HN3A 1JPKA 3P62A 4NP7A 3FKRA 3GG1A 3O6AA 3FDGA 4BQ5A 1OYAA 3V5FA 5D09A 3RMEA 4FLRA 3B4YA 2WBGA 3CHDA 1KFCA 3OC4A 4MG4A 3JVAA 4H8HA 4N4QA 3TTSA 1UJQA 4GJIA 4FAMA 4GG9A 7ODCA 5K4XA 2X41A 3GB6A 1BGAA 1H7RA 4AY8A 4UTKA 3B05A 1J6PA 4ZQCA 3M7SA 4UQAA 4J56A 1WO2A 4JFVA 2BSLA 1Y5XA 1L6SA 1HP5A 4Q3MA 4GYJA 4LXFA 3GBEA 5F4SA 3QRHA 4WJXA 2ZA2A 1WQ5A 1UD5A 3PTKA 1WZLA 1AJ2A 3NSMA 4EOUA 3L4YA 4UMCA 3IV8A 5BRQA 9RUBA 4MJZA 1JD7A 1TMHA 4REQA 2REQB 3R07C 4P8XA 1F6YA 1S3HA 1TCMA 2ZDSA 3V4BA 4FNTA 3WUEA 2VDIA 1PV8A 3OGVA 3IIZA 4GVHA 5F2LA 4IPLA 5G2IA 5F2GA 4LVDA 4PUMA 1N7KA 5U4NA 3WK1A 2ZRVA 4MWAD 5DMYA 2GGIA 1V3HA 1TPC1 3FYYA 3GC4A 5DCEA 3WEMA 5GJMA 3F2DA 2AQOA 3NL5A 4JIIX 1NSJA 4E6MA 2GGJA 1XF0A 1L6GA 4TVUA 3G24A 3MI3A 1VHCA 5BXTA 4YPJA 4CEUC 1N61C 3VKDA 9XIAA 3TP4A 3K1DA 4GUFA 4WHBA 1CB7B 1KN0A 4QNWA 4QQ3A 3MMUA 3P0WA 1WOAA 2NT0A 4XZWA 5CSSA 3W9ZA 3VOIA 1GKRA 3DKJA 3R79A 1D9EA 1K6AA 3CZLA 1GZJA 4EPEC 2I5QA 2FHCA 3NL3A 2WC4A 1DPMA 3M9YA 5A2AA 2AQVA 1C90A 4LVBA 1KWKA 3VOHA 5LXEA 4ZQRA 1XV8A 2QV4A 3MP4A 1K4HA 1TVLA 3AIBA 1G7VA 2HS6A 5I3HA 2CESA 4FB7A 2BVDA 3L0KA 2XYLA 2FZMA 5JMUA 4PMZA 4A8IA 3G2GA 2GL5A 4IF2A 3UA3A 4CD4A 4ERAA 3WLLA 1IT8A 4WSHA 4QCFA 1A53A 4C1NB 1HJVA 2O56A 5CEWA 2Q01A 3W6YA 1D3GA 2OGJA 3AYRA 3GTHA 4R85A 3B0UX 2ZX9A 4UNKA 4WGHA 3DEQA 3N9RA 1M41A 2VZVA 3MO7A 4H6RA 1Q4WA 3WBAA 1JL8A 1H7WA 4K7ZA 2E8ZA 5GNZA 4F79A 4PUKA 1KTBA 3W87A 2H8XA 1VQZA 2UZ9A 3CEUA 3IRSA 1HKMA 4NHVA 2V63A 2POZA 1SGJA 2PC8A 3B9AA 1P7TB 4Z0SA 1ITXA 5EMMA 3RX4A 3RN6A 5D2TA 3MZ2A 4F0RA 2ZZBA 3REQA 1JRPA 3WX7A 3KFTA 1DL3A 2DQWA 1F4HA 1H0GA 1IEXA 4CD5A 2YA2A 3GIQA 4ADSA 2DIJA 2D22A 1NF0A 1F3XA 5H2ZA 3UWQA 2PDJA 4GC4A 3SGZA 3WUFA 4XAFA 4E3TA 4LB3A 5G5GB 1YBQA 3W1XA 1KFWA 5D2VA 3SADA 5KZDA 1TG7A 1HQTA 5HATA 3CAWA 1DIOA 4YYFA 4TV5A 4DO4A 1GPFA 2HJPA 3F4NA 1M7XA 3QKZA 4CKQA 3L4WA 5AHMA 4L6OA 3WENA 2VFGA 5CC6A 1VD6A 1QPRA 5CH9A 3IVSA 3GD4A 2DUZA 6REQB 5LNWA 2BOEX 5FJPA 3GYCA 4AZ7A 3TTEA 4HHLA 4ILSA 3SN4A 5HMEA 1VEMA 2VR5A 4NNBA 1WPCA 1JI2A 1E3XA 3S4TA 5I3DA 5FAJA 2KZHA 3E0IA 4IQLA 1UMYA 1QPQA 1UG6A 4U31A 1Y0EA 2CKRA 1Q2RA 5EKYA 3C2RA 4A3HA 1Q85A 7ENLA 4H9YA 2ZICA 4J40A 4HGXA 1FWAC 4F0KA 3LRLA 4H3DA 3THDA 2Z29A 3GZAA 5GQBA 4DF0A 5C2XA 4YS1A 1OFBA 1CCWB 3B4UA 3O8AA 5DLCA 4NRSA 1ECEA 3EMZA 2FPVA 2IW0A 4S2BA 1PX8A 2ACRA 1UH2A 4LS2A 3IJ6A 1GW9A 4MNKA 1ZCCA 4XVEA 5I09A 4D6IA 1ONXA 4HU4A 1QNVA 3W4RA 4Q4PA 3BSHA 5KMYA 4ATDA 1A3XA 1OJTA 3WQGA 3D46A 4IPNB 1IEWA 4YVPA 2BY2A 2HZGA 3GO2A 4HYVA 2QV5A 1OCNA 1FWIC 3SRDA 4JDRA 4HPJA 3TQKA 4U10A 1NHQA 3LXBA 1ZBKA 3UNTA 4D1IA 1QUMA 1US0A 3TLQA 3EPMA 4F0HA 3IAPA 2XZ7A 3VDCA 1R9YA 5AYYA 2WW5A 4EWJA 1GVSA 1YDVA 1IWPA 4XBSA 2ZRWA 3ZO9A 1PKNA 3O6YX 3A3WA 4H50A 2VGFA 1R9ZA 5CXPA 3NUKA 4PB5A 3PBMA 4ZB0A 4AQLA 2A7NA 5DT5A 3QJAA 2GJNA 1WKFA 1XM3A 4NY2A 4Z0JA 4Q8TA 3U2EA 3SCNA 4AYSA 1D7KA 1V51A 4MF4A 4PRWA 1NTHA 4EQXA 1HJSA 3AOFA 3GDTA 3LPGA 3MKKA 4NJHA 3SM0A 1DORA 5D4YA 2X8RA 2DQXA 3KCOA 3MHUA 3AJXA 3MVTA 3VNDA 2DT2A 4UQBA 1R3WA 4ORMA 2Y63A 3NAVA 1MFUA 2GK1A 3PVFA 1GRHA 3NQFA 2HBXA 3VGFA 3QFAA 2HRWA 4M1BA 3IIVA 5ER0A 3WLSA 5K9CA 4B92A 2GH5A 4GPNA 1BQCA 1G4TA 1XIEA 3UR5A 1O12A 3HRDC 1R2SA 3LHWA 3GFXA 4QS5A 4Z08A 3TQPA 4S3AA 3UXKA 5E9AA 1UD4A 3V0SA 2FVMA 1WOBA 3GUGA 1EF3A 2W0HA 4LTSA 2QIWA 5HNUA 4DAFA 1DQXA 4MDOA 2J47A 2YL6A 1BYAA 1S2WA 3GTFA 3CHFA 3USBA 2E68A 4GABA 1FQ0A 2G3IA 5LA0A 1BPLB 3FHAA 3FGCA 2XH0A 2NX9A 2VJXA 3QYSA 2PTWA 1KCKA 3DENA 1H2JA 1KFLA 2D2OA 3RU6A 3SCPA 1QI4A 4XISA 1JDFA 4PMOA 1UJPA 3TXVA 3K8LA 3CZGA 2CCRA 1EJWC 4S1FA 3URAA 3EAOA 1E6SM 3GD3A 4DYJA 1GOKA 2QS8A 5A6KA 4QXIA 2E77A 1JEHA 3QC0A 3D0CA 1ZY8A 4Y9OA 2WC3A 1AUSL 3J7HA 2FLIA 5AHEA 2CLPA 5LHFA 1Q6QA 1CTNA 1POJA 5JUVA 3PWAA 2HXUA 1R5YA 3CGDA 3LCIA 2E25A 3AFBA 2HVMA 4ICCX 1PSCA 4DAIA 1TJRA 4F0SA 5CSYA 4QROA 4YMZA 1S2CA 2J24A 3N2TA 3TCEA 1KD0A 1PKMA 3ATYA 3GZ3A 3C2EA 2ZTKA 4Z42C 4G56A 3N2CA 1STZA 2NSXA 1SJDA 3V0TA 3G1RA 3ZOAA 4O1BA 3UXDA 3LI0A 5CZTA 3VOJA 2V3BA 3KP0A 1NFBA 1E70M 1RR2A 2VGBA 3ZFHA 1R3TA 2ACUA 2YZ5A 5K2ZA 5FL0A 4BF7A 3BK0A 3NQ7A 3N6HA 3HA1A 2WVSA 4HMNA 8TIMA 3UZYA 4DYKA 3SQPA 6XIMA 4GZJA 3WLMA 4CCZA 4NZCA 3USZA 2VRQA 3E2VA 4HTYA 3SUUA 3DHPA 3R43A 2EQ7A 3N9KA 5E6YA 5ABFA 1E15A 1L9WA 8CGTA 3SUVA 5FOOA 1VF8A 1KBBA 5ABHA 2X7WA 1GNXA 4JQ2A 1XYAA 4GJJA 4APNA 1UZ4A 3V75A 3CMFA 1DJYA 3B9JB 3QV7A 1GQLA 4Z1DA 4BWLC 5HJYA 3FA3A 2VFEA 1UB3A 2QR6A 4ZO6A 2B7QA 2J7BA 1GPWA 1WAUA 1EFZA 4MYXA 3DFPA 1XIFA 5CC3A 4GYPC 4MSSA 1PXGA 5DANA 2D0HA 5HWNA 3FVDA 1TWWA 5AC4A 1T96A 4L4OA 4J35A 1I0BA 3VOCA 4WLCA 2YVJA 3GM8A 4JQ9A 1TV4A 1M7PA 2WSPA 3I3DA 4R34A 1WDPA 1DJHA 3W23A 2VWSA 4KWVA 1A50A 3THAA 4OBSA 4B5SA 1YXCA 2CLEA 2ICSA 1J18A 1IT7A 3L4TA 1TMLA 3L4XA 1XD0A 3S0CA 3KOYA 2AL1A 3PWIA 1K6WA 4N9CA 2Z00A 1PTDA 1E6RA 5HDRA 1OX5A 4YYCA 1JZ4A 4IICA 1A80A 2F38A 1TUFA 3OU8A 4P61A 5LIUX 2PRMA 1ADDA 3VIMA 4UTLA 1IV8A 1BLIA 1W3KA 1F8MA 1WXZA 3MSDA 2OX1A 1A5UA 3MZNA 4XAGA 2NXHA 3BOXA 1SR0A 3SEPA 2GSEA 3K30A 2ON3A 2YB1A 4PBGA 2VO5A 2HSAA 1T99A 5A6JA 4AMCA 3ARXA 5CC7A 5HA7A 2OO0A 3CV2A 5FS7A 1G69A 2XVNA 1TB3A 1FWEC 2GVYA 1R2RA 2W4XA 2H9AA 3AS3A 5CGTA 2QVNA 1NQ6A 2XSAA 3PM6A 3LBOA 1AVAA 4C90A 3BOFA 1W1IE 1H49A 2W67A 2WSKA 2ZUSA 4IIBA 2BXZA 2PWEA 1YXDA 3CJPA 1FFVC 2DSWA 2QCDB 1MZHA 1HKJA 4IIDA 1VFTA 2OKTA 3ANUA 4IIFA 4D9PA 2OQLA 2UV8G 1QNOA 4CD6A 2YYTA 1PDYA 4RNIA 4C6EA 5BMWA 3FV9A 4JQAA 4E2BA 3OQEA 3W7IA 5I3KA 3RGTA 1BFNA 1K9FA 1EXBA 3W1RA 1K77A 2GUUA 5CLTA 1SZNA 1ME8A 1V77A 2EQ8A 3WEOA 3CL7A 3G22A 1R8LA 5CC5A 4QG6A 3GG0A 2BC1A 4CQCA 3VKBA 1XLJA 3OYZA 3R10A 4ML9A 2ISWA 4M82A 1M7JA 1WUEA 3LCHA 5EB8A 2YA1A 4MKNA 3MA8A 3M0LA 3SECA 5JIWA 2RABA 4UMAA 4JIPA 3WNMA 2VM8A 2JBMA 1POKA 3W7DA 4KKXA 3LLXA 3AMDA 4LV4A 3PPGA 1IZKA 1GVFA 1XYMA 3EB4A 4PCPA 3QSTA 4MM1A 1HX0A 4I7VA 3RCNA 4M6QA 3MB9A 3E9AA 3MSGA 4RV3A 4UOQA 1OF8A 2HK0A 2XSXA 3FLUA 2G95A 2ISVA 4WJ8A 1GTHA 2OTDA 4MWAE 2YW4A 4E2DA 1TE1A 4ZMGA 4ES4A 1G6CA 1QI0A 4NJGA 3UR2A 2R1PA 1VH7A 2A1YA 2CW6A 2DVXA 4EIVA 1ZXIC 5A8PA 1JCTA 2INFA 2X1UA 4W89A 5G5HB 1J01A 2OT1A 2GSJA 4DM1A 2GVLA 5BZAA 3WJYA 3LZ3A 4D6CA 4HVXA 4XWUA 2QNEA 2CC0A 4GY1A 4G5DA 1YPXA 3NJ3A 5U7SA 4IXXA 4LEFA 3ZQ9A 4E8CA 3C86A 4QG9A 5IBXC 2I5IA 4L1XA 2BFGA 3UERA 1VRXA 3BAYA 1GOQA 1Z9AA 1OFOA 4X63A 4F0MA 4KQNA 3HV9A 3TC3A 1EC9A 2BXVA 4RZ6A 4J3XA 3LCGA 1B30A 3V18A 1I6NA 3ZS4A 4FX7A 2RFGA 1KM3A 1QWGA 3BTNA 4Z2IA 3AU2A 3WG6A 4KWUA 2NQZA 2OFJA 3E0FA 3WD0A 4YTTA 2NVAA 2P5NA 1J0IA 5TF0A 3TZNA 1V3MA 5E93A 3GFYA 3GNDA 3NQDA 4RE4A 2WZEA 2DVTA 2ZRXA 2O4MA 2GSHA 1J5TA 1TJ1A 2INZA 3LHUA 3L8KA 2GR2A 1XIDA 3IUDA 4ZOBA 3NVYB 4YTQA 1KBKA 3KLKA 4XQ6A 2NXGA 4O18A 2XWEA 4YN5A 3W53A 1X39A 5LXXA 1H1NA 2YPIA 3W29A 3TC7A 1Q2SA 4HOZA 2PDXA 1G94A 1YW1A 1AQ0A 2VRKA 4RDVA 4PBEA 3HPXA 2EGZA 4G9PA 1FKXA 2XU2A 5JXQA 3PBWA 5IOBA 3ZJ7A 1WX0A 1D8CA 3AAMA 2OYLA 1FVPA 1CXLA 3WD2A 1QPKA 4J1OA 1VFHA 4ZE4A 4DHGA 2X05A 1J5SA 2HE5A 3CUHA 1XHCA 2CFYA 2ZTJA 3IJ8A 3W81A 4I6VA 3WJXA 4DUXA 5KZMA 2O92A 4AZCB 3LA4A 1Z8AA 1Q13A 1UD6A 4B15A 1EHNA 4GIAA 1MDRA 1PZ1A 5A6SA 4MJ4A 4NNAA 2ZUNA 3KX6A 1NDVA 4P8VA 4INFA 4HMDA 1B9BA 4EPBC 1TMQA 3S1WA 1UR0A 1GQJA 1KR0A 1J93A 2I14A 2FJKA 4AHOA 2VTFA 2A3HA 3HF3A 1PHQA 3WN6A 1WYGA 4D6HA 1O5XA 3OZMA 3C2FA 1B4EA 1PE1A 1JIBA 4KBXA 1HL9A 3GTIA 4NVTA 3EOLA 4XAYA 1TO3A 4AY7A 3V35A 4IPIA 1TA3A 4NT0A 3W2UA 5GJPA 1TTQA 2VCCA 1QPNA 3WDJA 2CHNA 2WOQA 1HL2A 3HPSA 2FMNA 5FL1A 3MUY1 5F4XA 5G1YA 5TR3A 4Q7NA 3EKZA 4AEOA 5LIWX 2PD5A 4OBTA 1AQFA 3TQ0A 3NEHA 1WCGA 4ICMA 1AH0A 1Q65A 4KRTA 3UCQA 3STGA 1A0EA 1A5CA 3LLDA 3GDMA 1UUQA 3IANA 2CBIA 2DUXA 1MMFA 1XUUA 2OGYA 3CIVA 3QGKC 2A3EA 4DO5A 1HNYA 1YE6A 4H7VA 4XZHA 1WXYA 4UTIA 2PDQA 1OCQA 1UIOA 1UD3A 4OJYA 2PWVA 4QFUA 1YNPA 1QI5A 4HZMA 2L5HA 4WKAA 3PAJA 3RIKA 1KKOA 1NP0A 4P7NA 3HMCA 4IFOA 1RD6A 1IEVA 1ZRQA 5AKQA 3YPIA 1H4PA 2GFTA 1E51A 4PE8A 4JTHA 1UZHA 5T8GA 5A6BA 2QUTA 3A5VA 3S6TA 3AIRA 4G1NA 2BOGX 3CGBA 1GW1A 2R82A 2OLSA 1Q7MA 1JXKA 1KXHA 2OLAA 3EPOA 4I8YA 1H1ZA 4MAVA 1IR1A 1XBVA 2XGBA 4Y9MA 2A7RA 1VPXA 4NF7A 2BY1A 3B8SA 2YOCA 3F1QA 2O9TA 1TQJA 3DESA 1JQXA 3ARVA 1P48A 2WQDA 2MUCA 2PE4A 3CQKA 5D2WA 4C60A 4REQB 3VZZA 1ICSA 3L4ZA 4DO7A 2EQDA 2G37A 4MVAA 4GQBA 2YFOA 2DV0A 3W1UA 3QW3A 3QH2A 1OC5A 3IIPA 1D3HA 4JTUA 4DZAA 4WF7A 3W85A 4BCEA 4HHPA 4LVAA 3VGEA 3K46A 5CCZA 1ZFJA 3UJEA 3PC0A 1JFHA 1JZ6A 4AD3A 3FN9A 4ACZA 3CL6A 4P7RA 1KW1A 1QCWA 4YTRA 2J4GA 3M1ZA 2FYMA 2QDDA 1KNWA 4A35A 1M6IA 1EB3A 1AFSA 1TPH1 5IDZA 2VD9A 3NCOA 4B5XA 4DJFC 3UWUA 1BQGA 2JF6A 4QP0A 2W62A 2EPOA 4KT2A 3TW6A 3KWXA 1W9VA 1OQFA 3LGDA 4L6DA 4PTXA 1Q7QA 3ME3A 3OBKA 2PTZA 4HMEA 4IOTA 3STFA 4QDWA 3QV8A 3RK8A 2HROA 1DXLA 1ISZA 1AODA 4F66A 3TR9A 5G2WA 3UY8A 4S3GA 2TPSA 3A13A 4U5IA 1AW5A 2JE8A 3FJNA 5FF7A 3MS8A 1XHGA 3H4GA 4AVFA 2ZOXA 1E3ZA 3DK4A 1XH2A 5EMYA 4XV0A 4LGXA 1WKEA 1HL8A 1GTEA 1XS2A 4M81A 2QCHA 3M0MA 3KBMA 2RUSA 3GRTA 3P7YA 4JTGA 3QHMA 4NASA 2QCMA 4MZ8A 1YE4A 1DHKA 1GOMA 1L6WA 2E1DA 2NW0A 2FH6A 2XVLA 1VYSX 4W85A 2WCAA 1HF6A 1ZZMA 3GNXA 2Y6ZA 1HJWA 1RM6B 4BEQA 3W84A 4R27A 7REQB 3M6YA 1DNCA 1E0WA 3VOFA 3SW6A 1K1DA 4GA8A 5DBTA 2AQWA 3W2MA 1GRAA 3HW2A 2OWWA 7XIMA 2XZ9A 3CMGA 4IMEA 4JKMA 1XLKA 4UTHA 4RK8A 5HWMA 1EJTC 1QVBA 1SPQA 3NQGA 1W1B1 1TIWA 2CNCA 4NAFB 4A3UA 3DXIA 3GSMA 1OT1A 2V69A 4EMWA 4W86A 1LBLA 4IP4A 1BHGA 4PZVA 1XCXA 2PLKA 5LIYX 1OK6A 4E8DA 1LZOA 1VBGA 4JIHA 1GRFA 1Q66A 1YTDA 1OABA 2FPYA 1U5JA 2CXEA 2CXGA 1JPDX 4M29A 2WMIA 3CAQA 1MUMA 4ZOCA 3W83A 1SYTA 1ZUAX 3C0SA 2B7OA 4HNTA 2G96A 4M5PA 2DH3A 5A6LA 4K1GA 3DK9A 5DXXA 4JQ1A 4I8DA 3UZ5A 1XYCA 2WZTA 1YLVA 4JTDA 2PDUA 3TTQA 3U4AA 4P7QA 1ZDLA 4L64A 3WDPP 2V2DA 1XDLA 3APYA 1T7LA 1KC7A 4B90A 2Z1XA 3H4WA 1UZ1A 2ONEA 5AYBA 4UWMA 3UQNA 3CIWA 3HO8A 1DEDA 3SCQA 1RXOB 1RK6A 4FS9A 3R25A 2A7PA 2ZA1A 3ID7A 3MYPA 5BROA 1YRRA 3FEMA 3APGA 1TZZA 1DXEA 3LQGA 1JD9A 4RDZA 1W2VA 1KM0A 3OOQA 2FTWA 2TRSA 2PBOA 1XDMA 1E56A 5L9FA 2V68A 4JFUA 2F6KA 4EANA 2PZNA 4OIFA 1W1VA 2TAAA 4GC3A 3P81A 4KFOA 3BCFA 1ML1A 4JZ5A 2XINA 4D2JA 3LGGA 3TR2A 1OEPA 2R1KA 2D1ZA 4NZ1A 3VCRA 3FA4A 3IJ9A 5EBAA 1XG4A 4L80A 4L6HA 2YL9A 3U2CA 2A6LA 4F40A 5JCNA 1V7AA 1UWIA 3VKKA 1W6TA 3S5OA 4FO4A 1ONWA 3B0VC 1ODUA 2C3CA 3URHA 3P6LA 1PZ0A 4G2DA 2DUAA 4OV9A 4J3VA 1ADOA 3VUPA 3GHSA 5A8GA 1XLFA 1KA9F 2XFRA 4P8WA 1KFBA 1UP0A 1F3PA 3GXPA 1ONEA 4XG1A 1I2QA 1B3YA 2R1LA 2O7SA 1G1YA 2AAAA 2AMGA 1WBHA 1MFVA 2ESCA 1AJ0A 5G4WA 1W5MA 4XD3A 2C79A 4CNTA 3OJGA 3LUTA 2C1GA 4ROQA 4ERGA 1TV5A 3SCSA 3V5CA 5H6HA 1XI3A 3KDOA 1IYXA 2ZC8A 5HNNA 2Y7EA 3DGHA 1YPFA 2W54A 3U7BA 4D1JA 4K8DA 3AHVA 2ZXBA 2QEZA 1JPIA 1TRDA 1M7OA 3I7RA 1O1ZA 5TD4A 4CCDA 5A95A 2W3SA 2H6RA 3R2GA 3QKEA 3E1F1 2PFHA 3HG4A 4RLIA 3UJRA 5J5RA 2WSQA 1E73M 4ZSTA 1U1JA 1XLEA 1MYRA 3AIVA 3ZR4A 4QR6A 4WOQA 4GINA 1CXFA 1FH7A 4QAIA 1UKOA 4GWEA 5HUPA 5XIAA 1LBFA 2QIIA 2X1TA 4I90A 1M53A 1GHRA 3VNKA 5HNRA 1HVQA 1B3OA 1UKTA 4NX5A 3BJSA 2PWGA 3BAJA 2F5ZA 1OCJA 2PP3A 4HJFA 2Y5JA 3ZT5A 4H9XA 3B03A 4DNHA 4GISA 4V1YA 5K9DA 3GAYA 2E6AA 4HSOA 1FCUA 2V5DA 4LYPA 1CWYA 3G1SA 1XANA 5HQEA 3U7VA 3ZLHA 3FSTA 1W5QA 2OCZA 1AD4A 3FDKA 4KEVA 3UF9A 1FDZA 4N42A 1ITQA 4YHGA 2GWNA 2EAWA 3IGSA 1VBHA 3PANA 4WKFA 1LQ2A 4Z2KA 4RJEA 1P43A 4S38A 3L5AA 4FR6A 4AD1A 3GBDA 3HGOA 4H4IA 2DPEA 1M9HA 3GIPA 4Q4SA 3VE7A 1S1PA 1FWDC 3CEPA 1NHSA 1RVKA 1VHNA 1EBDA 2YCEA 4DWDA 2EQ6A 1XYFA 4TQTA 1ALDA 3DIPA 3WKZA 4D6EA 3VDAA 1W0MA 4JEQA 2TPRA 1DXFA 3WLTA 2YDQA 5BNKA 5I5RA 4B5VA 3W72A 5DO8A 1QNSA 1SMDA 4YVVA 4AWSA 4JNYA 3WQVA 4PC8A 3DFTA 3WZ0E 3EWXA 3A4WA 4U3CA 4U28A 4YNGA 1LJYA 3V36A 2NWRA 2X0SA 3DCPA 2Y2WA 2D73A 2REQA 2JKAA 2X30A 4ZFMA 1J0ZA 3WF3A 3AIUA 4LBUA 1OGSA 4HJWA 2PTXA 4JY8A 3PZTA 4XAZA 5IDIA 4GVGA 2WKGA 1MEWA 4PUWA 4YXGA 3UA4A 1PJ9A 3UWYA 1KM5A 1YQZA 3P67A 4HHMA 3DK8A 2QVHA 4Y8FA 5DN1A 4HP5A 1BWVA 2PLJA 2FZ9A 2OXNA 1J2BA 4PA8A 1TE6A 4S3DA 4XZBA 4DEFA 1S2VA 3VU2A 2FVLA 2J78A 4CCEA 2CIPA 4BI7A 2V5JA 2JEPA 4LNYA 4W88A 4AB4A 4HNNA 4ZEPA 3C2VA 1TKKA 2YXGA 3B97A 1ZENA 4GLEA 1FWJC 3RDKA 1PPIA 4LY8A 1PX3A 4X61A 3BW4A 3ABRA 3WYZA 1JGMA 5JBDA 5LNRA 3PBGA 4CVWA 3COTA 4WIWA 3S2MA 4EAYA 3T0AA 3SCVA 1EGZA 4HSHA 5TQLA 2OZ3A 1I0DA 3A47A 2I9EA 3AXKA 2WOVA 2HMCA 3SJ3A 4C6IA 1TYGA 1OGBA 1SJCA 2WM1A 4GCAA 3A7AA 1MSSA 3G77A 3T0BA 1RHCA 3TJLA 3M0KA 1NHRA 3R0KA 3VCNA 3LS9A 1BYCA 2C15A 3QMSA 1BAGA 4GIYA 4M0XA 2ZE3A 2ALDA 1BTMA 2V5LA 4W87A 4DJDD 2ZBTA 1CYGA 1EA0A 5LA2A 4TVDA 4GKLA 2GGGA 2GQ9A 3PZQA 1W56A 5HULA 1CEOA 2TYSA 1VIZA 4M6VA 3VMPA 1V0LA 4N2YA 2FZNA 3SZ8A 1NP2A 1XLAA 1QR7A 3LSBA 1HXJA 1GERA 2WSYA 3SR7A 3N34A 2WMFA 4JL2A 1A3HA 4UFLA 3PB2A 1NDWA 1VYPX 1R85A 4PR4A 5F1UA 5GJNA 1J0HA 2DT0A 2ZADA 4KEUA 3JZUA 3EDFA 1DWHM 2WJDA 3L21A 1X7IA 1DOSA 4EF9A 4NQ1A 3V5OA 5CSUA 3UEQA 4GO9A 3GKAA 4G1KA 3AM9A 3WBEA 2FGLA 3MCMA 2J66A 2VEPA 1C7SA 1CLVA 5EMKA 4TTUA 3VVGA 2HNEA 2HS8A 4LAUA 1SVDA 4NI3A 2GWGA 1XIHA 3AMKA 1T6MA 2D2HA 2GGHA 5LZLA 3VX0A 1IE7C 1R6WA 1UC4A 4HBKA 3M0IA 3RF9A 2PCQA 3C3UA 2E0PA 2B7NA 1CGXA 4BY3A 3AS2A 3W25A 1J4EA 3SN0A 3WH5A 1JF5A 3ITYA 1K02A 5BMXA 2XSBA 4LCRA 3H7UA 4AD4A 4LUTA 3BH4A 3NVZB 1JDCA 3KTSA 3U5YA 3GNNA 4MKVA 3C52A 2VDGA 1LUCB 3CPRA 3VIJA 6A3HA 4GI8A 4WKHA 2HXTA 2CYGA 3W7OA 3DFQA 1RA0A 1OWQA 2Y5SA 1AH3A 4PMUA 3PJTA 2ZUTA 4J3TA 3T81A 5AC5A 2ZYFA 3F4CA 1KBIA 1KGXA 1OYCA 5DMNA 3AYSA 1XFBA 2QMKA 3E38A 1MO0A 5D8ZA 2PEVA 4JDBA 4H7CA 4I7UA 2ABBA 2WMGA 4F2BA 2F6XA 4LC8A 1C3FA 3TIMA 3S6DA 4JTTA 1FHVA 2FDSA 4GIEA 3QMTA 3S1XA 1JFXA 1H62A 3LPPA 2UWFA 1CXIA 5BW6A 1WV2A 2W3RA 4C7GA 1FCVA 2QJNA 4LANA 1K03A 2JGYA 3ITTA 4MB1A 1EWEA 2WJFA 1PB0A 3ALFA 4TX6A 3FG2P 2FGBA 2RKXA 5T26A 1H3GA 3H2EA 3UXLA 2ZIDA 4ZE5A 2E3TA 2NQ9A 1UH4A 4IH3A 5KZEA 2TMDA 2JQXA 1XBYA 5E1QA 4TUFA 1FWTA 2X1IA 4XUGA 2PGFA 4MNLA 3H7VA 1BTCA 3PHAA 3UJ2A 2PSNA 2WBAA 4RW5A 1JEZA 4JKLA 2B0MA 2V67A 2YB4A 5AZ1A 3WK0A 2X8GA 2R9ZA 1TJ0A 2JIWA 4AU0A 2WK2A 1N8FA 2V6OA 2ATMA 3GC5A 4HNUA 4LRTA 3TFXA 3WD1A 3KCLA 1OX4A 4JFSA 4FXJA 1TV3A 4Z1BA 4ASTA 1EOMA 3BLDA 2FHFA 2E1WA 4C65A 3T0DA 1RPXA 1EZWA 3CQHA 1H63A 2ZVIA 2OEJA 2Z1WA 3RCYA 1E6XM 1UPPA 2X7VA 3PG8A 3UR7A 5DMMA 4ENLA 4UOJA 3C2YA 1WZKA 2GVEA 2AKZA 1TX2A 3PSWA 2JK2A 3WLOA 3BAXA 3GH7A 1DV7A 1AD1A 2V8ZA 4LYRA 1E9LA 1C9WA 2E9MA 2IPFA 4LAKA 5LGXA 3URQA 3IAQA 3G8EA 1E1FA 1XIIA 2FHBA 3L65A 1NAL1 4PGLA 1IHIA 4J4KA 4LX4A 4AW7A 3W2KA 2WHKA 4K37A 4PL1A 3P2VA 4LALA 4NAEB 6TAAA 2RJHA 2G0WA 4H4PA 2BMBA 3L23A 1EIXA 4HYRA 3MCNA 4OQVA 4AZIA 1R30A 4UTWC 5E6ZA 2ZX8A 3GDRA 1F74A 1XC4A 3G1AA 4HT3A 1IGWA 3KL0A 4DJEC 1NOUA 1WZMA 4QQUA 2DY3A 3UGRA 4FXFA 2FDMA 3DFHA 1R0MA 3BLPX 1W9BM 1XISA 4S23A 3DERA 2FZDA 1O6IA 3BCJA 1XJBA 4QCEA 1R2TA 3TONA 3JS3A 4ZGYA 2W66A 5HOSA 3EOEA 3EKLA 4MGGA 1JPMA 2QCFA 3GD6A 1V8EA 4WK9A 4F4RA 2WKJA 4J5NA 1JUBA 4UQEA 5FF3A 3VNYA 3H22A 2ZRYA 2DIEA 1OD8A 3CT7A 4L9ZA 1AJZA 2RDWA 4GXMA 3L5MA 2VR2A 1R3SA 3T9PA 4KETA 3SY8A 1JNEA 3BAIA 4LNCA 3ARYA 4O16A 1W32A 4LYKA 4LUJA 1H7OA 3WH8A 4AIOA 2WPCA 3HOJA 2XIJA 2RDTA 1H09A 3VNZA 2UBPC 3H8AA 5BOFA 4RNHA 4XO6A 3BV4A 2Z0IA 4FALA 4PL2A 3U4FA 3N73A 2YFNA 1RQBA 5I3IA 3U2ZA 2V9DA 3F2BA 4JAWA 4R5EA 1XYLA 3GXMA 3DFOA 1XIGA 1RLDA 4B9YA 1MO9A 3BSMA 5K7JA 3CM4A 4IGNA 4KMQA 1XBXA 1YYAA 4JNZA 1FXQA 3R89A 3K4WA 4C6CA 5DMLA 4TR9A 3NZGA 1TQXA 6PTDA 1XLMA 4NJKA 2PWDA 3PTQA 1UR1A 2J7HA 3G0UA 1VCFA 3AHXA 1A5SA 4R7JA 4F2TA 5AYXA 2VGGA 3GAKA 2FGZA 1ZBVA 3CS2A 4ZOEA 1C29A 3HJZA 3SCRA 3LBMA 1VFMA 5CBJA 3WMCA 3ALGA 3TMQA 4YJ5A 1TWIA 4GX9A 2CLLA 3QEZA 4QDPA 3ZZ1A 2VC5A 5HPCA 1B31A 5F2MA 4GNKB 2PMQA 3O05A 2FFIA 2WCGA 3TKFA 3OVRA 1J10A 4HYWA 1F2JA 4BQ3A 1HKKA 3ATZA 3VAVA 1K4GA 1YHTA 1EDGA 2OT0A 5JH2A 3U9IA 3UWZA 2Z26A 2YGYA 2QF7A 4PMJA 2WMKA 2XM2A 4B91A 1K7FA 3E5PA 3EXRA 4O57A 4EMJA 3K4AA 2CLHA 4X3ZA 2GJXA 4PTMA 2PU1A 4LY4A 4FLSA 1XBZA 3AWNA 4JTAA 1V6VA 4EXQA 2WMHA 1DWAM 2RH9A 2YA0A 4W84A 3DGBA 1SJBA 4PUUA 1AL8A 4IUOA 1F05A 3DHUA 1TYPA 4DY1A 4ADWA 2XISA 1RUSA 3S6OA 2GQ8A 5J04A 3QVQA 3II4A 1OCBA 2HVNA 4RUBA 1S5NA 2PGRA 3CWNA 2UY4A 3S5SA 3UJSA 3RFAA 1GRTA 3L2IA 3VXGA 1KM6A 1Q8AA 4H9VA 1JDAA 4RL3A 1L2QA 3P5ZA 1XPGA 4H4SA 2QKFA 3LPFA 4RXFA 4M7SA 3MYOA 2RGLA 2P0OA 1ZLPA 1A5OC 1EL3A 3GYEA 1L8NA 3LU2A 1V6XA 5T9BG 3NDZA 4BZYA 2CZVA 1H60A 2E67A 4PUEA 2P1FA 2IXUA 3GXIA 3A9BA 4ZQPA 3CZEA 4AFYA 1EPVA 3LI1A 2VT0A 1XDIA 2QCDA 3NA8A 3W1QA 1WAWA 4XTIA 4CQ9A 4IXHA 4AIBA 5M03A 3AIEA 2X16A 2WV8A 5XIMA 3M46A 4QLKA 4ZBCA 4EP8C 1OJXA 5CAKA 4LA1A 4P8UA 4BWLA 4ZSUA 4HMCA 3NM1A 4NEVA 2DZUA 4HD5A 3M44A 1VZWA 2NUWA 3WF1A 2YXOA 4FIQA 1ZNNA 3TROA 1Q8JA 3SQMA 3ANYA 1TREA 4NZ5A 4QHRA 5JBFA 2B7PA 4TTGA 4GYPA 4WX2A 4NIRA 3XIMA 3I4EA 3H70A 2W5FA 1K7XA 4RZBA 2ZZ4A 1RP9A 2PDYA 1RCOB 1M04A 3ERPA 1L8PA 4O1AA 2VQTA 3MUCA 4HZ7A 4LRSA 4ZB2A 3VX1A 3PZOA 4RCXA 5FEXA 4C6QA 1HT6A 1SSGA 4TV6A 1E40A 2XN1A 4MADA 4IGSA 2E5BA 4CVUA 5JCIA 2Z1VA 4JTQA 1UWQA 1ENUA 1AOGA 2DJLA 4J28A 2IUZA 1GEQA 4V2XA 3HGRA 3TCSA 2ZCGA 2C3ZA 1HKIA 4AZGA 2DIKA 3IIOA 2HPMA 4D6DA 2WO5A 1EGVA 2GUYA 2G4JA 4TVCA 1ZJAA 3WFLA 4HCHA 4YTSA 3JUGA 3TAOA 3EWBX 1HZYA 1K8ZA 3R94A 2WPBA 1DJGA 3E96A 2OX4A 4A29A 2WMIB 2FJUB 5FMHA 2UY2A 4JICA 3THCA 3QQ1A 2ZUUA 5T9CE 3QR0A 1OFAA 3V3WA 4HIBA 3CMJA 4WEVX 2PD9A 3EB2A 1Q1RA 3EXSA 5DFAA 1V3JA 3UVIA 1CZ1A 5JRBA 4GGBA 1Q6FA 4V1XA 4BS0A 3GG7A 1R3YA 3MWAA 3VD3A 1FWRA 5HNTA 1TELA 5C7HA 3CLWA 4PMDA 4H04A 3BWWA 4DI8A 3K13A 4PMNA 3PAOA 2VX7A 2XFYA 1PKYA 3B8WA 3PNZA 4DQWA 1X8CA 4BJHA 5A8QA 1HJUA 1I9CB 3MPGA 3KBSA 1GVRA 2VC7A 4D8AA 4A3RA 4S39A 3FEQA 4GVFA 4HA3A 4EM3A 2W63A 4XVDA 1EJXC 2GR3A 1DKWA 1CPUA 3TUUA 1RY0A 1TPVA 2I1OA 1I2PA 3RR1A 3T2PA 4JIQA 3H7RA 3P74A 3U6WA 4PB3A 4XTDA 3VMNA 2OZ8A 3ITVA 3QTPA 1LOLA 1OT2A 5FEPA 1ZPTA 2WNZA 2QJIA 2IKJA 4IIEA 3GHRA 1ZJBA 3II1A 3UCDA 3W7NA 1OY0A 4AG0A 5FSDC 4L5ZA 4DO6A 2GYIA 3JRKA 1M65A 5BRBA 1TIMA 4XSLA 5HR6A 6XIAA 4H2CA 4A2RA 1H5YA 5M1TA 4E38A 4ZO9A 1JZ3A 3TYBA 5D2XA 4UFIA 3VI2A 2Z2AA 3EGJA 2QGYA 1P5BA 1JDDA 1EBHA 5C9UA 4H9UA 2X1SA 4HN8A 4GCXA 2HNHA 3IUIA 4IIGA 1GETA 3B3DA 5CAHA 1AQHA 4GQQA 2D2GA 2WZHA 4CGTA 4KF1A 5BXRA 1DWFM 1WUFA 1R7OA 3WNPA 1GG1A 5D32A 3R8GA 3TLLA 5D04C 3ABZA 1XFCA 1QWKA 4Q6XA 4QE1A 5M3WA 2BV9A 3OEXA 5EPDA 3WDQA 1Z3NA 4L4LA 4EXBA 1Q63A 3NYZA 4KH2A 2BLEA 2D24A 4N4PA 2Z7KA 4HA0A 3N2MA 1DJQA 1Q6CA 4AZCA 1WA3A 1VC4A 3VPLA 1JRBA 3TU9A 5DT7A 1VCVA 2PWHA 2BGNE 1UP2A 3FJ6A 3F7JA 5M17A 4OV4A 2ACSA 3W7HA 4O12A 3A3HA 3WLRA 2WXDM 2FKPA 3F4DA 2Y1HA 4H83A 2Z24A 2X2YA 1FWCC 2VMFA 3L67A 3B9NA 5IFPA 3L68A 1XGEA 2DSUA 4D6FA 4QJ3B 3GDLA 4U2YA 1CGYA 1C9DA 1ESWA 3KUMA 2YCLA 1VFFA 1RLCL 4RE2A 1C8XA 4PUNA 5D03A 3R0UA 4LYQA 4LF1A 1IEQA 3KBNA 2J77A 3BLFA 5FKYA 3EEZA 3TEVA 5LHEA 2G3JA 2PA6A 3L12A 2FPTA 2XH7A 1W9XA 3PPFA 1XC6A 5AYIA 4IP5A 3G6MA 4S3EA 1BRLB 1KLYA 2EQ9A 3KRUA 1N60C 2DSVA 1IWAA 5JH1A 4DZ5A 3HU7A 1I2NA 1MW3A 2JALA 3NQVA 4JQ4A 2BGSA 1G7UA 2V3EA 4O54A 3QTGA 3HQ1A 4AX7A 3EB3A 4OKDA 5FEWA 4ZO8A 4R88A 1BKHA 3F4VA 4ZXLA 2OG9A 4XZLX 5D38A 4H4YA 4MWAC 3PBUA 3FW6A 3CASA 2X99A 3FYOA 3IJQA 2CKSA 3LDVA 4TMBA 4FI4A 3VGGA 5F1VA 3EDKA 1ICPA 4WD0A 1DJWA 4C6LA 1GJUA 3PPHA 4LU0A 4C6FA 5C9ZA 4NYUA 1V3KA 4DBUA 4DF1A 3ARZA 4XKYB 2J8FA 4ZCWA 1W2PA 4Y96A 1QI2A 1PS9A 4UXDA 4CNPA 5HMFA 4MY8A 2Y61A 5L6UA 3IGUA 1OZQA 3ZR6A 2VZSA 5CJNA 2PDMA 3TVAA 1H11A 4HA1A 4L65A 2QPUA 3N9SA 4GY0A 1UASA 4PRRA 1X7FA 1RA5A 3VKCA 4CNSA 4KS0A 1KRBC 3CZ8A 3PR2A 3CXBA 4FNUA 4PMVA 1B2YA 4HB7A 4H4RA 1XLBA 4PN2A 3C4UA 3AHYA 1E4LA 4JR5A 3DYOA 5CPSA 2B81A 3KVMA 2EEXA 4FP1A 3VZYA 3NQ8A 1GHSA 3DH7A 4XZNX 2QQ6A 3RJYA 4IMDA 1XGZA 4PMYA 5A69A 4JTCA 6TIMA 2C91A 1AL7A 1V97A 3K1GA 2RGMA 2R1NA 1SW7A 1JUEA 2VFFA 1QT1A 2W61A 1F3WA 4H7ZA 1XR2A 1YTKA 3WLJA 2CWNA 2HISA 1UUOA 4JHZA 3U0HA 5MHBA 4FPSA 1SO6A 1BVZA 2XM1A 3QMRA 4QSFA 2CBJA 4M1RA 3OVQA 1T8XA 2W6RA 3RITA 4UFMA 1CBGA 4AYGA 2PDHA 1TZ9A 1UH3A 4AHPA 2VZOA 2WHJA 1ITCA 4AZHA 1NDAA 3N2BA 1QNPA 4O0ZA 1IXQA 1F8WA 3RU8X 3W24A 3IVTA 3WQEA 1ZK7A 3DYMA 3LYEA 1W3LA 4P7LA 4E4FA 1OFEA 2D0GA 2R24A 3P14A 5FJIA 4I9JA 4CNUA 1J9YA 3W86A 4UTFA 4FNPA 1PIIA 1TYTA 4Q6JA 2A5HA 3DI0A 7REQA 2DJXA 3LCWA 2NQHA 2E6DA 2EJAA 4P2VA 3UCCA 4MWAB 1TTJA 3KM8A 4RNFA 3SUTA 2CLMA 4PODA 5C2GA 5AHIA 4PMRA 5I3JA 1EYEA 1BSLA 5G1TA 4B5WA 2FIQA 1KM4A 4WGXA 3W70A 2FZ8A 2OPJA 3WJZA 3NNTA 2IPGA 1DBTA 1US2A 3AU6A 1QW8A 4LOCA 1UCWA 1PX4A 3UFYA 4NAFA 3BW2A 4LAOA 3DGZA 1HP4A 1V93A 2VXNA 4KCWA 4D8LA 5FCZA 3BJFA 3SQLA 1OG0A 4KESA 4BFAA 2AGTA 1RALA 4IFKB 2DVUA 3DZ1A 3PFRA 4E4PA 3WMSA 2D3LA 1FH8A 3BJTA 5B7YA 2VP8A 1OM0A 4EMIA 4JYDA 1ZMDA 4KERA 2V5KA 1PZ3A 2QJMA 1GYLA