3V3WA

Crystal structure of an enolase from the soil bacterium cellvibrio japonicus (target efi-502161) with bound mg and glycerol
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
402
structure length
397
Chain Sequence
MKIVDAKVIVTCPGRNFVTLKIVTDQGIYGIGDATLNGREKSVVSYLEDYLIPVLIGRDPQQIEDIWQFFYRGAYWRRGPVGMTALAAIDVALWDIKAKLANMPLYQLLGGKSRERILSYTHANGKDLDSTLEAVRKAKDKGYKAIRVQCGIPGIAKTYGVSYEPADADLPSVEVWSTEKYLNYIPDVFAAVRKEFGPDIHLLHDVHHRLTPIEAARLGKALEPYHLFWMEDAVPAENQESFKLIRQHTTTPLAVGEVFNSIHDCRELIQNQWIDYIRTTIVHAGGISQMRRIADFASLFHVRTGFHGATDLSPVCMGAALHFDYWVPNFGIQEHMAHSEQMNAVFPHAYTFNDGYFTPGEKPGHGVDIDEKLAAQYPYKRACLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Starvation sensing protein rspA
publication title Crystal structure of an enolase from the soil bacterium Cellvibrio japonicus (TARGET EFI-502161) with bound MG and glycerol
rcsb
source organism Cellvibrio japonicus
molecule tags Lyase
total genus 143
structure length 397
sequence length 402
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3v3wA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3v3wA01
3U9IA 3S5SA 3VDGA 4E5TA 5J04A 3JW7A 4IZGA 5BOEA 4GIRA 3DDMA 4E6MA 3OPSA 3R10A 2XH0A 3R25A 3SN1A 5FJRA 2QDEA 3KUMA 4IP4A 4KT2A 2PTYA 2CHRA 4KWSA 3RGTA 2OZTA 3SBFA 4K1WA 4F4RA 1BQGA 3GD6A 2OLAA 3NFUA 4GGHA 3RRAA 1P48A 4H1ZA 3R0UA 4E4FA 2FYMA 3N6HA 2AL2B 5IDZA 1TZZA 5FJTA 2ZC8A 2ONEA 3CB3A 3CAWA 3VFCA 2O56A 2AKMA 4IP5A 3ZVHB 1PDYA 4KEMA 1EC8A 3ZVIA 5EU9A 3V3WA 3PK7A 2FKPA 3ZLFA 3TQPA 3BOXA 1RVKA 2MNRA 1SJCA 4J3ZA 2OPJA 3TOYA 2RDXA 4G8TA 3K1GA 2NQLA 1MRAA 3GC2A 1FHUA 2PPGA 3SN0A 3CYJA 1R6WA 3PWGA 3B97A 3OP2A 2I5QA 4H19A 2GSHA 1NELA 1DTNA 2PP3A 2XH2A 2PU1A 4A3RA 4FP1A 4IHCA 3BJSA 3TJ4A 3HPFA 3CT2A 3P3BA 3DG3A 3OTRA 2PP0A 5ENLA 3UXLA 1KD0A 3R0KA 3TCSA 2OZ8A 3I4KA 2OFJA 3VCCA 4X2PA 2PTWA 2QDDA 3FCPA 4GYPC 3OW1A 3CXOA 4ZCWA 4K2SA 2HXUA 3MSYA 2OG9A 2QQ6A 4HN8A 3NO1A 3GO2A 4MKSA 2OO6A 4HCLA 4J1OA 3FJ4A 3IJQA 1KKOA 3FVDA 7ENLA 3DFYA 5FJUA 2DW6A 2HXTA 4GMEA 2OKTA 3I6EA 3UJFA 4ROPA 3H70A 4EWJA 2OQYA 2OX4A 1TE6A 2PP1A 2XH4A 3QKEA 3N6JA 1BKHA 1MUCA 1YEYA 3U4FA 3NXLA 3QN3A 3DIPA 3UXKA 1R0MA 1KKRA 1SJAA 3DERA 2P3ZA 2AL2A 4HNCA 1JPMA 4DN1A 1JPDX 2HNEA 3FYYA 2GGJA 4MMWA 2QGYA 1EBGA 3N4FA 3MKCA 4JN7A 3UCDA 1MNSA 3T6CA 2GDQA 3UCCA 3TW9A 2PGEA 4MGGA 3JVAA 2PTXA 2XGZA 4ZA0A 3VA8A 2GGGA 4HCHA 3TWBA 2GL5A 2PU0A 2XH7A 4IT1A 2OZ3A 3DESA 2PODA 3OZMA 4YWSA 4GYPA 2OVLA 4DWDA 2PCEA 2HZGA 3QTPA 1NU5A 2POZA 4HNLA 2PA6A 3TJIA 3QPEA 2QJNA 3FXGA 3UJRA 3ES8A 3S47A 3BSMA 2QJMA 1WUEA 2P8BA 5FJOA 3P0WA 3FV9A 3MQTA 4DHGA 3IK4A 3ES7A 1EC9A 1SJDA 4DYEA 2OQHA 2PS2A 3PFRA 1EC7A 3I6TA 2DW7A 5FJPA 4DX3A 3RR1A 1XPYA 3QLDA 2QVHA 2GGHA 3TWAA 3V5CA 3MUCA 3T9PA 4E8GA 4H83A 3CK5A 3EKGA 2AKZA 2PGWA 3GY1A 3THUA 1XS2A 3MZNA 3PWIA 3Q45A 1OEPA 3ENLA 3STPA 4ENLA 4Z17A 3UJEA 3H12A 1E9IA 1KCZA 3V5FA 1L8PA 2P0IA 4A35A 3SN4A 4HYRA 3ZLGA 4DXKA 3P93A 2AL1A 3Q4DA 1P43A 3R1ZA 2ZADA 3UGVA 3JZUA 3RCYA 4GGBA 1JCTA 4JN8A 2PMQA 3OZYA 1WUFA 3MWCA 3D46A 3RO6A 1IYXA 3V4BA 4KPLA 3D47A 5BOFA 2GGIA 4HCDA 1ECQA 2PTZA 4IL2A 3ZVHA 4GISA 2QJJA 4FI4A 3VC6A 3VCNA 4Z1YA 1JDFA 2XSXA 6ENLA 4H2HA 3DG7A 3DFHA 4M6UA 1ONEA 2GGEA 1FHVA 1SJBA 4G7FA 4JHMA 3SSZA 4K8GA 3RITA 3ZLHA 4A6GA 3IJIA 3UJSA 3DEQA 3MY9A 1TKKA 4IL0A 3H8AA 3DG6A 1MDLA 3H7VA 3N4EA 2PSNA 3DGBA 1EBHA 4E4UA 3VC5A 1MDRA 1F9CA 4GFIA 2MUCA 4HPNA 3SJNA 3SQSA 3UJ2A 3TTEA 3T8QA 2P8CA 1PDZA 3NZGA 3IJLA 3EEZA 4M0XA 2P88A 3T4WA 1ELSA 1W6TA 3R11A
chains in the Genus database with same CATH superfamily
4YTQA 3U9IA 3U5UA 3N3TA 3LPGA 4E2DA 4YTSA 2R1KA 4AD5A 3LZ3A 2VTFA 1XRSA 4I8DA 2QKFA 1W9PA 2D24A 3W1TA 2O55A 2PF0A 1TTIA 4B5UA 3C86A 3R10A 2EQ7A 3UWZA 1VCFA 3P5ZA 4KT2A 2NQZA 1RK5A 3I7RA 1TV3A 3ETRB 4FA3A 3CZKA 3PY2A 5TF0A 1QK0A 2ZXDA 1GRGA 4X60A 5A6TC 3BO9A 2BV9A 2NWRA 3EWWA 4O18A 2XGIA 1OX5A 4LUTA 5JBFA 1QNQA 2DZVA 3KX6A 1E43A 4GNKB 4DVOA 2QEZA 3N11A 2X7WA 3A7UA 3A24A 5GJNA 2JIWA 4DLMA 4JKKA 3S4TA 4ZBCA 3P60A 2G8ZA 5HMFA 5DY2A 3V3WA 3MSGA 1TTJA 4NJHA 3LA4A 3UPBA 4QROA 4GVFA 1JROA 2ZC1A 1NDWA 1YDNA 4J3ZA 4LNCA 3PZVA 3QSTA 4JFUA 4GBDA 3AMKA 5DELA 5FSDC 2A7NA 4LOCA 1JRPA 3WBEA 1H09A 2Z00A 1IWPA 1UIPA 5JCMA 1LYXA 2X50A 1A50A 4JNZA 1BYAA 4K8DA 3MHUA 1SQ7A 3MW7A 3IS4A 1DQXA 1VHCA 3AZTA 3L68A 3AYVA 3N2MA 2DUZA 2O4QA 4EQXA 1DJXA 2Y89A 1QO2A 3NEVA 1U22A 4IXHA 4GQ0A 4D8AA 4GXPA 2D2GA 4UQEA 3SUSA 3SM0A 3EX1A 3ARVA 4QS5A 4FNPA 1YBQB 1Q4NX 1EJXC 4BA0A 3LNPA 4K7VA 4WXZA 1ZCCA 4FIQA 1V3KA 2GQ9A 4FXSA 3GO2A 3WUGA 5H1WA 5GQBA 1IZCA 4AIBA 2BXZA 1GRBA 3S5YA 3W6MA 3BG5A 4KW2A 5K4XA 1VFLA 4IQEA 1LROA 2JGYA 4OIFA 5AHIA 2YVFA 2HVNA 2NPXA 3USZA 4QP0A 1BWCA 1JF6A 3N4AA 4EWJA 4BF9A 5ECUA 3CAVA 4HK6A 2OQYA 1NOUA 3N6JA 2PDYA 1G0CA 2RDWA 3VOGA 1BPLB 1JAKA 3QTGA 4OV4A 4C91A 5LSMA 2FVLA 3EANA 3WL1A 1MFUA 3W1RA 2C0AA 3F4WA 5CPTA 4MDPA 4PMXA 4BWLC 5FS6A 4FLSA 4BV6A 3RDKA 2C0HA 3OYZA 4UQCA 3T2PA 3TW9A 1E6PA 2XIMA 1FQ0A 9CGTA 1X6NA 1QRQA 4DUOA 4RXGA 4FXRA 4HCHA 3TWBA 3IVSA 3LXDA 1XSIA 1XYMA 2XTKA 1WO2A 1X1ZA 3C2FA 3OZMA 5B7YA 1XYLA 4GYPA 1E9LA 2E68A 2R1LA 3CZJA 5E09A 5F4SA 4HGXA 3WIJA 1FDJA 2GK1A 3AS2A 3OHMB 1LL7A 1EGZA 1W3LA 2BGSA 1CTNA 3W7KA 3TYUA 4GINA 3LRMA 1H50A 5EFDA 1G7UA 4W4QA 3CTLA 5KZMA 1HKKA 4L7ZA 5CAHA 2CWNA 1B30A 3EA3A 3FS2A 3MVTA 4DYKA 1J96A 4Q4PA 3T0AA 3IC9A 2ISFA 1O94A 2J7EA 3RUBL 2ZZBA 3IVUA 3PTDA 3NPWA 3V1HA 4TQTA 1UC5A 4E8GA 4XTIA 1F05A 3NWRA 1US3A 3P5YA 3THUA 1DQUA 1W2VA 3OBAA 3ENLA 3QEZA 4L65A 1ML1A 1KCZA 1Y5WA 4JY8A 2E4TA 3NGFA 5CSUA 1TPVA 3SN4A 3AMZA 1F73A 1WB0A 4NRRA 4AHOA 4UTTA 4YNGA 4AVOA 3EF6A 1E56A 1DEDA 1T96A 4R9XA 2R9ZA 1TJ1A 4ZXLA 1JZ8A 1XIFA 3NOEA 1FX6A 5DN1A 3D46A 4PBFA 3V4BA 5BOFA 2PRLA 4W7WA 3POCA 2J8GA 4BEQA 2YCLA 3NM3A 2C16A 2ZWZA 3UWEA 1GONA 1X39A 2WBAA 1Q5MA 1GQIA 3VXGA 5EMJA 1RCOB 3S9ZA 2LLEA 3EX4A 5CGMA 5GNZA 3DG7A 2CKSA 1QCWA 3G1VA 1H7PA 1DVJA 4J9JA 2PI6A 2V38A 2VP8A 4MB5A 3BARA 4Y96A 3UNDA 1BEUA 1FWHC 5AB3A 4JHMA 2W63A 2WQPA 4XZ9A 1Z44A 5EMLA 2ZDRA 4MNLA 3BG9A 3WD2A 4ML9A 1CXKA 1S39A 1HNYA 1MDLA 2WP5A 3WLHA 4C60A 1XG3A 3UXDA 1IIHA 5HNNA 2YLLA 5LIYX 4V1YA 3TX9A 1HVQA 4A3UA 4GJJA 1KTCA 1Q6CA 5T91A 2DVUA 4CU8A 1PTGA 1ZAJA 5C5YA 4WHBA 4J57A 4DWSD 2OEKA 4RL3A 5I24A 4RDZA 4D1JA 3L0GA 4JX6A 3SRFA 1XLDA 2ALDA 4B9YA 2WNZA 2B7OA 3VMPA 5HBFA 5IFPA 3HPSA 5CJMA 3PPCA 2WMHA 1XGZA 3NO3A 1FWIC 3GS6A 4DZHA 2QDHA 1VYSX 3IVTA 3NR0A 3CYVA 4XX6A 2QPXA 4XV0A 2XH0A 3GVQA 1H62A 3WLNA 1N55A 1S1PA 2EQ9A 1ZU8A 3WH6A 2C7FA 2PTYA 3F1QA 2FZNA 2FQIA 2FMNA 1W5PA 5I3HA 2ZUUA 3NFUA 1G4SA 3NGJA 2DEPA 2E5BA 4ZODA 5HA7A 1GOIA 9XIMA 4RE4A 4UR7A 2XVLA 3NURA 3L12A 4Y2WA 1EJVC 1GVEA 3RU6A 1VB9A 4L4OA 3VFCA 4PUJA 2O7SA 4J56A 2AKMA 5BWFA 1UHVA 2G97A 3PG9A 4NT0A 1NDZA 1XBVA 5G5GB 1T5AA 3ZLFA 1WKDA 1QWGA 3WLKX 3A9IA 2GR0A 4GWEA 1XISA 2ZUTA 3CZEA 3VD5A 4LVGA 1J6PA 4FEZA 3SGZA 1ZFJA 3CMGA 3E02A 1FEBA 1O6IA 1IXQA 2JBMA 2GSHA 4CU7A 4ZTYA 1Q2SA 2VEKA 4H6KA 4N4QA 4Z2GA 4NL1A 4KCUA 3MV01 2CBVA 1UMLA 4E3TA 1XDLA 4PMDA 3HTWA 4AZ5A 5I5RA 1H2JA 1H5YA 2NUWA 4D6DA 1H60A 2Z1BA 4DYJA 1NP2A 4H04A 4LV4A 3GVGA 3VGFA 1V6VA 3CMFA 2HNHA 1V51A 2CWXA 3K2GA 3CXOA 2OGJA 2OT0A 2EQ6A 3MUXA 3L0NA 3AIVA 5D9NA 1H1YA 4O50A 3WF4A 1NM9A 3DHPA 4XIAA 4HMCA 4AH7A 2VFHA 5DCEA 2O4MA 2W79A 1OINA 5A6AA 3LX9A 5FJUA 1V6XA 2R94A 2HXTA 4EF9A 3ORWA 1SZGA 4KF1A 3H21A 3C52A 2OKOA 2EPNA 1P6WA 2GZXA 1SMDA 4CCEA 5HWJA 1HKMA 2HWGA 4IG2A 2R24A 3OQEA 4IUOA 1UG6A 2IXUA 3KLJA 2C18A 4CN4A 1BHGA 5MF5A 2GFTA 4MMWA 1S5VA 1NDVA 3W1XA 5TR3A 3EX3A 5GNYA 3PULA 2R8WA 4I7UA 2VFEA 4JN7A 1T40A 1QXLA 5H8MA 1WKEA 3F2BA 4F3HA 1J9YA 4HSNA 3KDNA 3L4ZA 3DC0A 1S7MA 1XCFA 4NI3A 4ZOCA 1FECA 2WVSA 4JQ4A 1HG3A 5EMYA 3AZSA 1Z89A 4YWSA 3IIZA 3A9BA 3QV6A 4NASA 3SW6A 4YHEA 1QNVA 3QTPA 4HA3A 3N29A 3TJIA 3ZJ7A 5DRCA 2ADAA 3WH7A 3VU2A 1P1MA 1RHCA 4FIRA 1N7KA 2NX9A 4IMCA 4H4TA 3A22A 4BI7A 3APTA 1TPB1 2E0PA 4XZLX 1NP0A 2ZQ0A 4BQ4A 1UD8A 3GNNA 3OG2A 5CH9A 3K8MA 3PFRA 4Z2HA 2ZTKA 1DWGM 4H7VA 1EJTC 1XIEA 4C6FA 4EANA 3RLHA 2PRHA 1MEIA 4IMDA 3LBOA 2C14A 1D7YA 1VPQA 4DBEA 1A5SA 2QVHA 1LWIA 5I3KA 1W56A 3TWAA 3GIQA 4L6OA 3EWXA 4H83A 4HNUA 1PX4A 2E77A 4US5D 1OC7A 2FFIA 2W66A 2EEXA 9XIAA 1OIFA 4KEZA 4H2CA 5LA2A 3LDVA 2GDVA 3V5FA 3F03K 4Q3MA 1I2NA 1XR2A 3WQEA 3SQLA 1YHTA 3P93A 2WPFA 2OYMA 5FL1A 2WWDA 3N13A 3STCA 1GHRA 2NQHA 4Q4RA 2NWSA 4PMNA 2XN2A 3TFCA 1OZQA 2CZDA 3KHJA 2A7RA 5HPCA 2IKGA 1XP3A 4KPLA 1CPUA 5LYRA 1P1XA 4Q6JA 8XIMA 3SDOA 3EAOA 2VDHA 3FHAA 4M7TA 5FAGA 2JE8A 1H6VA 3WK0A 3AIEA 1GGOA 1MOKA 1OZMA 4H2HA 1O1HA 1EDQA 3GFXA 3NQ6A 4J3XA 4CEXC 1QPNA 2GGEA 1UA7A 5CZJA 2YQUA 5LXEA 4HZ6A 3L65A 4S3GA 2H90A 4Q7NA 1Q45A 4KWOA 4NEVA 4ZFMA 4A2SA 4FNSA 3ZT6A 3MY9A 1K7EA 4YCOA 4FSAA 3E2SA 2BZNA 1J2BA 1K4HA 4WUIA 4PC8A 3DGHA 3RLGA 2BOEX 4GC3A 4HTBA 1XIHA 4PB4A 1UWQA 1LUCA 3KAOA 5I06A 1HQTA 4J27A 2A4AA 3AYTA 3E0FA 3EB2A 1AL7A 3WFAA 5BYWA 3W29A 3OLGA 4KCVA 2C1HA 5D03A 3OIHA 7A3HA 1SZFA 3AS1A 2GJXA 4ALDA 3EEZA 4FOKA 2GLKA 3THCA 2OO0A 4KH2A 5F4XA 4GRSA 3SUWA 4JDRA 4EMJA 5I02A 4DM1A 2QT3A 1TJ0A 4NZCA 1C8XA 2WNQA 2I9UA 2OTDA 3VDGA 1V97A 4IISA 3ZIZA 1I2QA 1KV5A 4ZB2A 1TQJA 1LBLA 2J6XA 3BANA 1MNZA 1RPKA 3NZRA 4EMIA 2DV0A 1GORA 1C90A 4FLOA 3AISA 4O19A 2A0NA 3CHVA 1P7TA 4HMNA 3WK1A 1QI5A 2EPMX 3B0PA 4FF7A 4DZIA 3PR2A 1JIBA 1A5CA 3CGBA 3VGBA 4QE1A 2PAJA 4AVNA 2J88A 3D3AA 3K1DA 3SCRA 1V0NA 2FYMA 4JBRA 3N6HA 5A6LA 3H7RA 3RCMA 4FR1A 4F48A 1VLIA 3BWWA 3HQ1A 3PPGA 1PKNA 1GG1A 3UA3A 1X8CA 2IPGA 2J7CA 1H2IA 3CQHA 1Q6LA 1R2SA 5A6MA 3W00A 3BCFA 2NV1A 1OFOA 3PK7A 2FKPA 1OFQA 4Y9MA 3CL6A 1CXFA 4A05A 4OECA 4LF2A 5T8GA 5A3HA 3DYPA 3UZ5A 1HJQA 2JKAA 3LCGA 5C2XA 3K1GA 2DSZA 3E2RA 4FOJA 2VD8A 1EPXA 3FGCB 3ITYA 2WCGA 3POHA 1W8SA 4RZ6A 3WBXA 4DZ5A 3A21A 1BYBA 8CGTA 5D38A 3VD3A 1V3IA 4IIGA 6CGTA 3E5BA 5AYXA 4D6FA 4JTUA 1ADSA 4MAVA 3FDGA 1G7VA 4A3RA 4IHCA 4NU7A 3WK3A 3IRDA 1JOAA 1PTAA 4M6VA 4Q8VA 2HPMA 1W1VA 3CUZA 1QPRA 4LB3A 3NPUA 3W7RA 2UY5A 4LRTA 4O0KA 3PZTA 3ERPA 4MWAA 1GWJA 2PTWA 2YFNA 1ZUAX 4D6CA 3K13A 2V68A 5JXQA 4JN6A 1CT5A 2BB0A 2QQ6A 3P67A 6REQA 4HP5A 1LBFA 1BFNA 1PSCA 4C6EA 1XCXA 4QLLA 2DT1A 1WX0A 3AROA 3PBMA 3FVDA 4XUYA 4DWSB 1CGVA 1G1YA 3M0ZA 4EM4A 1NF0A 3DUGA 3UP8A 5CPOA 4H9YA 2XJ7A 2VURA 1OHLA 4H8HA 1L6GA 4NIRA 2BXVA 2ZX9A 3W1AA 4PTMA 2WOVA 5KZDA 1V7YA 5TIMA 4GC4A 1DNCA 2XH4A 3T05A 5XIAA 2REQA 3U4FA 3JR2A 1I2RA 4LBUA 4JTRA 4M6PA 3GWQA 2CESA 2R1PA 2GGJA 3LM3A 1KWGA 1V6WA 1SU5A 4J4KA 1FTXA 2D3NA 3BE7A 1ISYA 4LUTB 3GHSA 4MB3A 1CXHA 3GUGA 1N8WA 4GUGA 2VOMA 3IPWA 1Z3NA 2JIEA 3CQJA 4ZTXA 3WQWA 2VO5A 3ZR4A 2V3DA 1TMHA 4OJYA 1UUQA 3P84A 2Z28A 4N4PA 3GVRA 4B5WA 3STEA 3BOFA 2EO7A 5C7VA 1XDIA 3EPMA 4XUGA 3L2LA 4GH3A 2YZ5A 4F2BA 1REQA 2BX7A 3B06A 1C8QA 1OCBA 3WMCA 1OVDA 4KKXA 3KVKA 4ZB5A 2Y4SA 4P8VA 3IJ9A 2J27A 3EMZA 1AQMA 4HHLA 4GQBA 4V15A 3G5EA 1GVRA 3BSMA 4YJ5A 4CNSA 1J5SA 1FWCC 1HGYA 2DVTA 3IIXA 4B9ZA 4EF8A 1AD1A 1TWSA 1DIOA 1M68A 3RU8X 3A12A 5F2MA 2J9XA 5AHMA 4JTEA 1M41A 1KCXA 3ONCA 2WO5A 3W53A 1XPYA 2DJXA 4MFEA 4BI5A 1DJZA 4RDWA 1Q65A 5AHFA 2OSWA 2AAMA 3QOMA 1QI0A 2SFPA 3Q94A 3SAZA 4PTDA 3RILA 1VEMA 3DK8A 3GTIA 3G1SA 1NFGA 3RX2A 3PWIA 1ADDA 3IJ8A 3S9IA 1WDDA 3F7JA 1YPIA 3SY8A 1GEQA 1YX1A 3E49A 4EPEC 4HOXA 2Z27A 4C1KA 1BAGA 1MZRA 3GDRA 4KEVA 2NV9A 3AUJA 3BJFA 2VVNA 3R12A 4MOZA 1UA3A 3UGVA 4ZL1A 4DJEA 3A4JA 1XWYA 2H3DA 3G8RA 1H1ZA 5E0CA 1UQYA 2FLIA 3N2TA 2AQVA 2AAQA 4N6EA 1L9WA 3DHUA 1UP2A 3IJDA 2BASA 2VC9A 3ECQA 3KOFA 1RQBA 3IRSA 4N9EA 3W22A 4GQRA 5C71A 4YCPA 2DT3A 1IV8A 4A29A 3P62A 3VKJA 1Z7AA 1QT1A 1XL9A 4DXVA 2F38A 1U83A 1V93A 3DFHA 3OGVA 1LDCA 1O1ZA 1GUVA 1SJBA 1E9YB 4HA0A 3W6YA 3GHTA 2EF9A 3RAOA 1TYPA 1B9ZA 2A6LA 3TCEA 1GYMA 2WJDA 3ARWA 3KCOA 2CEQA 4CGTA 4DJFC 4PCTA 3YPIA 2X1SA 1EGMA 1H7WA 2XVNA 3W7LA 1VJIA 5I3JA 2E28A 3GTFA 3GBDA 1WPCA 4WKAA 2KZHA 3QLLA 4AX7A 1EJRC 3H2AA 3WDIA 5AC5A 3CWHA 3A4WA 5CSSA 4UZUA 5DT7A 1V03A 3DH9A 1ISVA 1F2JA 3FVMA 4ERAA 1EPVA 4IX0A 1P0NA 4TVDA 2YSWA 1D8CA 2Z6JA 2ISVA 3DFSA 3GW3A 1XW8A 2XFFA 5LGXA 3WF3A 5DT5A 2GPTA 1R9XA 3UZYA 2WLYA 2FGLA 3V75A 3ZYZA 1TWIA 1OBAA 4PFMA 4A4AA 2XZ9A 2JK2A 3SGGA 3DYOA 3FN9A 4FX9A 4LY4A 1PZ3A 3WBYA 4KGJA 5U4NA 4L61A 3QY6A 3QR3A 1UP0A 3UNTA 2XUCA 4YYCA 3KVMA 4Y9OA 1FH9A 2J4GA 1QK2A 3W25A 6PTDA 5FIPA 1AVAA 4W7UA 4YN5A 2FGBA 2YCKX 4NILA 2XYLA 3W24A 1FCVA 4KFOA 2I57A 4IMEA 1RJRA 3UF9A 3SRKA 8TIMA 3MO4A 3PBVA 4C6IA 4H01A 5KINA 2O56A 2HMCA 3CT7A 3OBKA 1NEYA 3E1F1 1L2UA 4JS3A 3ZVIA 1KFCA 3EXTA 5D9PA 3N2BA 3H24A 1Z42A 2E1DA 1JZ4A 3Q37A 3SRDA 3E12A 4E4PA 3VCRA 2DY3A 3KWSA 4LAZA 3CV7A 1ZJAA 1UASA 5BU6A 1W5NA 1F4HA 1FWNA 4H19A 1R7OA 3H2CA 3AFBA 2QCHA 3EBVA 1OD8A 1OT2A 1PZ2A 1OCNA 1OGSA 2ICSA 3NL5A 5E0FA 1ESWA 1QW7A 2GR3A 3PTKA 4XAPA 1ZRQA 4DF1A 1W1YA 4JIPA 1X38A 2ZXBA 1ZP4A 1C29A 3UD6A 5HQMA 4C6KA 2HISA 1XLJA 3BH4A 4TVUA 2W62A 3IGUA 1M03A 4IFOA 1KBIA 1OY0A 1JG9A 4HPGA 1JAEA 1XYAA 1YE4A 3TK7A 3OW1A 5IHSA 1FEAA 2ZA2A 4D6HA 4MKVA 3FAXA 1BXCA 4ZCWA 2DQWA 1GRHA 3MSYA 1QHOA 3SR6B 1N2VA 3G1HA 3W1UA 4E8CA 1I1XA 2X0YA 1TMLA 1X97A 3RO8A 1V3MA 1X8FA 2ATSA 3S1GA 4PZVA 4W86A 2W91A 3NUKA 3MA8A 4IQLA 3WMLA 2FTYA 5H8UA 5CJ5A 4JTGA 4UFLA 1XANA 1K8YA 3LBMA 4MPQA 4N42A 1YMYA 4PSPA 4QJ1A 3Q2DA 3UJFA 5BROA 1VBHA 1ZDLA 4PTWA 1E4IA 1VBRA 1KV8A 2PBGA 3GC5A 4H41A 2JFEX 2AL2A 2Q09A 5HUOA 4E2OA 1Q63A 3IEBA 1UKQA 2YGYA 5FJIA 3DGRA 2BOFX 1FHLA 3MUIA 1AW1A 2FPTA 4PR4A 3TE9A 3W7HA 3PVFA 3O15A 4B5XA 1OG0A 3PJWA 4RW5A 1BYCA 4BQ3A 2YL6A 3CUIA 4MB1A 1LL4A 1K8ZA 1BTCA 1VKFA 3F5LA 1QVBA 2D0GA 1N63C 1EF3A 2CCRA 2HE8A 2YDAA 4K38A 2X1RA 3RN6A 4HNLA 4M24A 1YTKA 5LA0A 3BDKA 4PCFA 1GPWA 2QJNA 3GU1A 3K46A 4HU8A 1MZHA 1WUEA 3KW3A 1UYQA 4D6GA 2PC8A 3LTSA 4GA8A 3FV9A 3S9YA 2VC7A 3WEOA 3RF9A 1AJ2A 3TZFA 4UZSA 1C9DA 4LS1A 4AZCB 3GDLA 4DO6A 4GIAA 4Q4SA 1S5NA 1AMYA 2E9BA 4MJ2A 4CCZA 5HNRA 2G3JA 3WJYA 4OOZA 3WQ4A 2J66A 4OOUA 1OABA 2Y8VA 1S3HA 1IEIA 5LXXA 1VR6A 3V36A 2O92A 4B3LA 1NHRA 1TV5A 2DSUA 1SO5A 4LH8A 1XYFA 4IFKA 1NFPA 1LVLA 4MNJA 3CK5A 3RNDA 1OC6A 2V3GA 3EKGA 4JTHA 5FF0A 3TSBA 3HOJA 3W2JA 4JNYA 2G3MA 2J9ZA 3R43A 1A5MC 4K6AA 4LANA 3TQVA 1L8PA 1EJ7L 1PBGA 1EHAA 3NVVB 3KBJA 4HTYA 4XK2A 4RKAA 2ZRZA 1ZLPA 1D3CA 3FJNA 3MB9A 3P8IA 2J24A 1A0EA 3GD4A 5F2IA 1RA5A 1IQ8A 2WCAA 3RO6A 5M1TA 4C5ZA 3G0UA 2PTZA 1IHIA 4JX4A 3H4WA 2GYIA 4EPKA 3WDQA 3OOQA 3W1NA 1TPWA 3PG6A 3R2GA 2DT0A 4M5PA 1UR9A 1QNOA 1HP4A 3GG8A 3GXIA 4U2ZA 2VC6A 4FNUA 3VDCA 2PWHA 4MHBA 3CLMA 3DAQA 1CB2A 2V3AA 4BR1A 4G7FA 3KTCA 2I5IA 3AXKA 4EOUA 4AHQA 1L6WA 4PRTA 1KM3A 3PZIA 3W28A 2J77A 5AYYA 1TA3B 1WDRA 3BSHA 2IUZA 1JEZA 3FFSA 4I5UA 1JDCA 1JEHA 3A4AA 1MDRA 2E40A 4LPCA 2NZLA 4KWVA 1CLXA 3QV8A 1KR0A 4NYYA 4QSHA 2XHYA 1POJA 5JCLA 2FH8A 1R85A 4XAZA 3WUBA 1ZMDA 1XBXA 1U5JA 3MPGA 2QV5A 1KFKA 1UWRA 5GRTA 4UR9A 3VAVA 4FZIA 1V6UA 1UH4A 1JYVA 4JYFA 2CIPA 3CQ0A 3C2YA 2FZBA 1WZLA 4J35A 4XSLA 1U30A 4ZQOA 1I0BA 1Q13A 3CZLA 1MQRA 1UQZA 1OF6A 2HE5A 1NHSA 3TXZA 3RXZA 3UY7A 4IMGA 3SADA 3CUGA 2NVDA 5EB8A 4I9MA 4CQ8A 2Z1KA 4S3KA 3GIYA 4M81A 1UUMA 3GDMA 3P80A 1UC4A 3W23A 4NEWA 2WWCA 5K4ZA 2OYLA 2FJKA 4HD5A 2AOSA 1T6MA 3UG4A 4EIVA 4IJRA 1R7AA 4LB4A 2FZMA 5FKYA 1S5MA 3G77A 3VIKA 5LNVA 3U48A 2Z29A 1GRAA 4KPRA 1FWBC 2RUSA 5C8BB 1UR1A 4JTCA 1CXEA 5HOSA 4S3CA 4B4HA 5A2BA 2WPBA 6ALDA 3A47A 1H11A 7TAAA 1NH6A 1EC8A 3PB0A 4JTAA 5CZTA 5D09A 5EU9A 4A8NA 3M9YA 2V8ZA 3LHVA 1VBJA 2EKCA 1F3WA 4XKMA 3W4RA 1O12A 4R88A 1W3IA 4JYDA 1E6ZA 3NL6A 1W9DM 3NQAA 1MRAA 4OGZA 1CECA 2Q8XA 4WJXA 3APGA 3C0SA 3NYZA 4ERIA 3T07A 2E5DA 4GUIA 3KRZA 1LQ2A 3EX2A 3KBWA 4Z0SA 2DIJA 1DTNA 5C9WA 1VJZA 2NQ5A 3FA5A 1IXNA 5EMMA 5FSEC 5SWUA 4X61A 1HL2A 1S2VA 3TYEA 1D3GA 2CLLA 3WQVA 3RRXA 4U4MA 2F6XA 5CLTA 3KVLA 3CL7A 4RE0A 5DANA 3UR7A 1AG1O 2DDXA 4CVWA 3FKRA 3TYAA 3CH9A 4U3CA 3LLXA 3NSMA 3UZZA 3RLUA 7CGTA 4KIRA 2J7HA 2Y62A 1NJJA 5MKGB 5TNVA 4DB7A 4ATDA 4L6DA 1KKOA 1DE5A 3NRZB 1SR9A 1ZY9A 2XVPA 1JQXA 4HU0A 1UR3M 3HGSA 3MZ2A 2FIQA 3WNKA 5B80A 2XISA 4ACYA 3VOFA 1PX3A 4NZ1A 3GVVA 2QW5A 2PP1A 5CG0A 1G69A 1P7TB 3KRBA 1W9XA 3KFTA 1Q6EA 5BMXA 1R0MA 3DFQA 4L1WA 3RPMA 3VZYA 3Q6JA 3HPZA 3G3DA 3AI0A 4HNTA 4YVVA 3VE7A 2DIEA 1JPDX 2HNEA 4W84A 1IWBA 1XIBA 2XINA 1GVFA 4UBPC 1XLIA 4HNOA 3W1LA 4JQAA 5I3GA 1MNSA 2XWEA 3V18A 3AWOA 3TYZA 1VEOA 1F8MA 2Z2UA 4WLCA 2VFIA 3QBUA 2VVSA 1A3XA 2PB1A 1AZ2A 3OHIA 5XIMA 2D1ZA 2GL5A 3W71A 4JL1A 4AD4A 4IT1A 4LWWA 4DY1A 2FTPA 1BVNP 1KCLA 3CGDA 4QAIA 5EBKA 2A3AA 2Y63A 2X99A 2Z2AA 2XIOA 4RXFA 5G2WA 2DPEA 3U7BA 2WV8A 1TB3A 3O0FA 3MWAA 1FWTA 1VQTA 4P8UA 2QUMA 4CNTA 3K4DA 3SCWA 1MUWA 2DZWA 1UZDA 1DYSA 3ES8A 1ZMCA 3W74A 1CGWA 3EWCA 2VZVA 4ZB0A 5FJOA 1TVPA 5FEWA 3MQTA 2X30A 3VI2A 4LU0A 1EC9A 3PS7A 5CBJA 4UCGA 5FJPA 5CZ0A 1UWTA 1YBQA 4Z1AA 1MVYA 3GYCA 1QO5A 4JL2A 5EKYA 1EBDA 3EXSA 1HX0A 2BXYA 4K39A 2TMDA 4CNOA 5F2GA 4L5ZA 3V0UA 1F5ZA 3O16A 1QOXA 3PUOA 2GSJA 3LTPA 4AMCA 1XICA 3A3WA 3PSVA 6REQB 1CGXA 3N14A 4I90A 5M5DA 3DHFA 1NIUA 3UJEA 2PDFA 4BF5A 2C3CA 2GWGA 1EOMA 4QG8A 1PZ1A 2E7FA 3QMTA 4KGLA 5CQ1A 5TBOA 3VM5A 3GTXA 3MMUA 1OYCA 3NAVA 3U2OA 1GKPA 4RR4A 4S3EA 4B4FA 5H91A 4YWOA 3UZXA 1T8QA 3M0VA 1FP8A 1TV8A 5C7HA 2OOGA 3CPGA 2REQB 4TMCA 4PE8A 1RBOB 4GACA 4FALA 3WD4A 5LGZA 3T7VA 2A2IA 5CLWA 5E70A 2G41A 2W3RA 1EOKA 1HKWA 2ZOXA 5I7GA 3KRSA 4UFHA 3TZNA 2C13A 3LCLA 2BVWA 1PO9A 4FLRA 4AVFA 2WC7A 4DAFA 3E0IA 1ZGDA 1SB3B 5C2GA 4GYFA 2E3ZA 2HJPA 3L4WA 3CS2A 2CBIA 4AY7A 4AIOA 2YDRA 2ZUNA 2JKPA 1FCQA 2PZNA 4P61A 4E8DA 4WF7A 4AQLA 1LWJA 3EZ4A 3ALFA 1L0PA 4AD0A 3PG8A 1CGUA 2A3HA 2NVKX 2ZA1A 3O0KA 1EUAA 1JZ3A 3W9ZA 2IPFA 4N02A 5HMSA 2YLAA 4RV3A 2D73A 3HGRA 1HW6A 3WNNA 1FBAA 3T8QA 4AHPA 3NZGA 4IIEA 3Q58A 2INEA 2ZWYA 4IGHA 3MS8A 4W87A 3NQ2A 3TTYA 1AOGA 4IFRA 3VOHA 1CGYA 1US0A 3NIYA 4MYAA 4J3WA 3CUHA 4E5TA 5G1MA 4X9SA 2PDJA 3WO8A 4P7OA 4CCDA 4AZ7A 1G9HA 1RZMA 4XAYA 2VRQA 6TAAA 3R25A 3GR4A 1KXHA 3S1WA 2HEJA 4AFYA 4HPJA 3S5NA 2ZTJA 2RH9A 4JTDA 3NZPA 3H4XA 3BLDA 5DMYA 3CBWA 2J7DA 5HR7A 3MYPA 4ONVA 3SBFA 4W85A 5HJXA 4GGHA 5D04C 3WQ8A 1N62C 2WKGA 2Y7DA 1AZ1A 3EDJA 3WQGA 1PKLA 3AOFA 4TU1A 1WE5A 1JULA 3NQ8A 4Q8NA 2B7PA 5IBXA 3M0HA 4O8AA 3ZO9A 3C2VA 4DJDA 2ACUA 3ARQA 2RFGA 2PDBA 2VEIA 3TIMA 4TVYA 4U28A 4H9ZA 4QG6A 2FZDA 4R85A 1ICSA 3HQNA 3P14A 2AAAA 1NELA 3M7WA 4D1IA 1K7XA 4JTKA 1VJSA 3NDYA 3QV7A 3OG3A 3VMNA 3BQ5A 4HPXA 2QJHA 2IPJA 2X0HA 4ZOAA 4LUIA 5IOBA 3BCJA 4XBSA 5C55A 4KBXA 3LCXA 3ITTA 3G1DA 4LCQA 2PDUA 3L5AA 3PNUA 3VD4A 3WMSA 5K9XA 4OBTA 5JH1A 3WMBA 4DNAA 2DZBA 2ZX6A 4QIUA 5I3IA 1K8CA 5BWAA 3A4XA 1ECEA 4MZYA 4MKSA 1HTIA 4EE9A 4HCLA 2C1GA 4EPDC 2VXNA 1A0CA 1JCMP 4JQ3A 1E4LA 4DM2A 2WMFA 4AWUA 2PURA 4E38A 4U5IA 4GMEA 2PDPA 3TYBA 4EQSA 3ALGA 4KQNA 1JL8A 3O6YX 3TAOA 4HBKA 1GOWA 1JNDA 3THQA 3SCNA 5K3VA 3FK4A 1BGGA 5CJNA 3RX4A 4UFJA 3UXAA 4QEHA 4TX8A 4JOMA 3ANUA 2E9LA 4GHRA 4C90A 1DPMA 3AJ7A 4MY9A 2HS6A 5GNXA 4UQAA 1XM3A 3W37A 4IH3A 3TROA 3R94A 4F9DA 4M8UA 3O9NA 1KC7A 3BZGA 4Q8UA 1KM2A 3KZSA 1NTHA 3S2CA 1EWDA 3GAYA 2X41A 3ITXA 5G1TA 4R53A 1KA9F 2TSYA 1EZ2A 2PODA 3G1AA 2FTWA 4CN1A 1VLWA 5EBUA 4DRSA 4DWDA 2IKIA 4XKYB 4EPBC 4H4RA 1E6RA 4A8IA 2VELA 2TPSA 2EHHA 2YPIA 1W5MA 1EZWA 1J5TA 3FXGA 2BBFA 2ZICA 4X0NA 5ABEA 1K77A 4QE5A 3LSCA 3MUAA 1KW1A 1V0MA 3S47A 3G6LA 5J5RA 2A3BA 5TAOA 2Y5EA 4GQGA 5AC8A 1M65A 3C2OA 2F8QA 1DWAM 2C1IA 1CXLA 1FRBA 1JXJA 2PS2A 5G4HC 4F8XA 2WSQA 1EYWA 5AZ0A 4Z08A 3IUHA 3CU2A 1XRFA 2GGHA 3VGGA 3VVGA 5I77A 3QGVA 4WEVX 2HDJA 1BG4A 4S3JA 1GOMA 2BS9A 4O15A 3W75A 4F66A 1DQWA 3R7MA 2VENA 3AC0A 3LG3A 4UTFA 3QPYA 1OT1A 3VD9A 1T8XA 1M9HA 1JCXA 3LGDA 3RNMA 3NSNA 1KFEA 1M6JA 2GOUA 2B7NA 4YMZA 1NWSA 1PYMA 1ME9A 1NOWA 3E2QA 1BF6A 3SJ3A 1FWAC 2G96A 3CHFA 4HYRA 1ZALA 3NZ1A 2QHAA 5D33A 4S39A 1WAWA 3TC3A 2QULA 4XZIA 4LA1A 4O52A 5L9FA 2X8HA 1JCTA 4M82A 3R8GA 1WNOA 4F0LA 4MYXA 1I2PA 2XVKA 5EFFA 1KRAC 2BC0A 3CO8A 4TVWA 3W7GA 3CPUA 4D72A 3D47A 2CHOA 4R9OA 1Q6FA 1WQ5A 1MW2A 1WZAA 1RCQA 5AZ1A 1MEHA 4PRRA 1GNXA 2XSXA 4HU3A 1IXOA 1ZQ5A 4GO8A 3A3HA 3MU7A 3DI0A 2OELA 4NXKA 2QCMA 1JUBA 1AL8A 1GVQA 2A3EA 3W7QA 4HMEA 4LCRA 2F6UA 3M4HA 5BRBA 3BAYA 2WANA 1PZ0A 2AMGA 3THDA 1JD9A 1JDAA 4JDBA 4UFIA 3AXIA 3IUDA 3QR0A 2EPOA 1W9UA 3VIOA 1IT7A 2CXGA 4DAIA 2Q8LA 3EMCA 2GQ8A 3QZ6A 2OWCA 3VNLA 1LP6A 3A7RA 3W87A 4IPPA 4OKDA 5E1QA 4K7ZA 5IXEA 5LNUA 2CBJA 5JBEA 1S2AA 2J79A 4AEOA 1ISZA 2YJQA 3JRKA 3QXBA 2P8CA 2EJAA 4X3ZA 4MNKA 1NF7A 1KGUA 4KETA 3E0VA 3WLMA 3MSDA 2OODA 1JJKA 1XDJA 3W1MA 3R11A 2FDMA 4LF1A 3B40A 3QQWA 4R33A 2PDLA 3T81A 3NVZB 2Z26A 4I3GA 4PEKA 4H4SA 3B0UX 3NXFA 2GUUA 4J5NA 2WSKA 3LXBA 2YXOA 3RR4A 2NSOA 1O4UA 2VFDA 1A49A 4PTNA 2H6RA 3I3EA 2W9MA 1XH0A 1QI3A 5CKSA 1IT8A 1FCBA 4A3HA 1VS1A 1QPOA 1PHWA 4KERA 4LVAA 1BTMA 4ZVJA 3ZXWA 4C6OA 2OLSA 2DFAA 1WV2A 1M1BA 3AALA 1TPDA 3BLFA 3NA8A 3GNDA 3QMRA 4DEFA 5CZSA 4F4RA 2PBOA 3WLRA 5F4WA 4YL2A 1ITCA 2CETA 3GE7A 2ZZ2A 4BS0A 1QAPA 2QPSA 4CU6A 4D8ZA 4UUIA 4MM1A 4IIBA 1XLKA 5DXYA 1JYNA 1RLCL 4IIFA 1DJGA 2V6OA 4KWWA 3W1PA 5D02A 1PDYA 1U5VA 3LRKA 3OU8A 2V30A 3IARA 4HHMA 1EA0A 4YPJA 4Q7IA 1TZ9A 4RZ4A 1H61A 5KZEA 3NS1B 1IEWA 3GM8A 1G4EA 3BV7A 3HBLA 3QR1A 1YE6A 2VX5A 4HOZA 4LVBA 4JEJA 4RNJA 3V35A 2E3TA 1EKOA 4H4ZA 3M41A 3URAA 4KRTA 3UG5A 4HVXA 4AEFA 3QZAA 4LYPA 1ODZA 3OZPA 2INZA 2YAUA 2XH2A 4JTIA 1GVSA 2W61A 4FP1A 2O9PA 4HIBA 1A4LA 4S2BA 1FIQB 1KFWA 3EOEA 4IWWA 4O1AA 1W3TA 2OZ8A 5D8ZA 2A8XA 1TX0A 4GYKA 3UR8A 4MPKA 4PL2A 4CVUA 3T08A 1XI3A 2YCEA 2PD9A 3VIMA 5GPRA 3VZXA 3WJXA 4WX2A 5CEWA 8RUCA 4WQ6A 3UT0A 4C6NA 3EAUA 2C3DA 1I60A 1ZZMA 2CBUA 1RA0A 5G2IA 4LC8A 2OU4A 4DJFD 4W5UA 3W83A 1D8WA 4FHAA 3EUB3 1B31A 1NWUA 4GO9A 1PHQA 5LZLA 1R9YA 1GZGA 2VD9A 3GQYA 1L6YA 2YR1A 2NXGA 3SCSA 2J8TA 3W2NA 3MDUA 1FWWA 3DYMA 4M51A 1YDOA 3OVPA 2GQ3A 2QCEA 2YBVA 1B1YA 3DGZA 2HK0A 2PGRA 5JRBA 4GI4A 4F0RA 3GXNA 4C6BA 4MY1A 4HNCA 4XAFA 1P0KA 3GZ3A 2W55A 2DZAA 3EXRA 2QJGA 3N4FA 4NSBA 2CFFA 3FYOA 2WSRA 3BLPX 3PAOA 2ABAA 4G7EA 2GDQA 1TELA 4QAWA 1YNYA 3B9OA 1TUFA 1R3VA 4PCNA 1FO4A 3MANA 3W27A 4S2CA 2B7QA 4AD3A 2XSBA 4LFYA 3ABZA 4JFVA 4UTJA 1TTQA 3FGCA 4YIWA 5AVHA 1MFVA 2HZGA 2Z1WA 4LEFA 4AD1A 3OVGA 4Q8TA 2NX3A 3R89A 4GJIA 2A7PA 5CPLA 3RJYA 3BLOA 3LI0A 1ITUA 4EMWA 3QPEA 1QWKA 4CNUA 4WVXA 3EOOA 1OFDA 4ZENA 2P8BA 1WDQA 3L7RA 1TV7A 4MUPA 3XINA 7ODCA 5AYBA 1C92A 4AW7A 3WH9A 2ISDA 1LOLA 2QS8A 1GQJA 5E6ZA 4JR5A 2YL5A 1H41A 1JRCA 4A8RA 4DO4A 1SUXA 2OXNA 3QY7A 2QUNA 3WG6A 3U8GA 3SQMA 1S2CA 2PDMA 4D6JA 4XVDA 3CQKA 1I1WA 3NTYA 2DP3A 4K3ZA 4EVZA 3MUCA 5I0DA 2V5CA 3ATYA 3T44A 3AHZA 2X0SA 3MZNA 2F2KA 3VKBA 1SFSA 1K3UA 4ZQPA 3LSBA 1VRDA 4DWSA 2VRKA 1LG1A 2DGAA 5AHEA 3GH7A 4HK7A 2D0FA 3OA3A 1X98A 3B4UA 3KL5A 5CCZA 1P43A 3ID7A 3H6OA 1HZYA 4JX5A 3PUEA 1OFEA 4XWUA 3OZYA 3T0DA 3EA2A 3V0TA 2PLJA 4MJ4A 4DBSA 1BF2A 3B04A 3BJTA 2DUXA 3R79A 1FFRA 2QJJA 3N9SA 1O68A 4R7JA 2VGGA 5E93A 5M3WA 2QCDB 2VFFA 5JCNA 3KP1A 3DI1A 4M6UA 3OBEA 1JQVA 5F1UA 1EEPA 4I5RA 2FMOA 3BK0A 3RM9A 4IQDA 2QPUA 3ARPA 1Q7QA 2HPIA 2C15A 1LZOA 1X6UA 2ACRA 3T78A 3TONA 2E9MA 1LL6A 4JCLA 1GYLA 1R2TA 1TKKA 4UFMA 1GV4A 1QOPA 3NEHA 4FR6A 2PSNA 2R9RA 3MJYA 1GHSA 4Q6XA 2RJGA 4APNA 2JEPA 4BHYA 4GD0A 2Z25A 1KWKA 1SSDA 2MUCA 3GHRA 3B9JB 5A8OA 3E2VA 4BQ5A 2O9OA 5DQPA 3TTEA 4B15A 1DXEA 4MB4A 3A5FA 1UBPC 1BZLA 1ZJBA 4EKJA 1OJTA 3M16A 2PWEA 3VK5A 2JK6A 1NY1A 1V6YA 1HJUA 1PUDA 4L4LA 1CLVA 2WBGA 3FNDA 1VF8A 1J0JA 3GC4A 3H4KA 3PHAA 1VPXA 4DNMA 2WHLA 3CPRA 5DCBA 3B8WA 4M29A 4OU1A 2E67A 1RD5A 1TIWA 2WQDA 2G37A 5HJLA 2ZZ6A 3L5LA 4E6MA 3MHGA 3B0VC 3UGRA 3OPSA 4AZ6A 4BY3A 2JF6A 4Q8OA 3ITVA 2VGBA 3QZEA 1ZB5A 2ALRA 3DN5A 1KTBA 2GVGA 4ZOEA 3AXXA 3TLQA 1FWFC 4H4IA 4OTKA 3I68A 3PBGA 1STZA 4QFUA 1FFUC 3R8RA 5IDZA 3AN1A 4XZBA 2QF7A 3L23A 1XX1A 1R9ZA 4ECLA 3F4CA 4XAGA 5U1OA 3DKLA 3DECA 3WELA 3I10A 2P53A 4QJ3B 3WJSA 5ABFB 3ABSA 3MBFA 3B8TA 1A5UA 2ZX5A 2ZZCA 3TC7A 3HU7A 1A5NC 4C6MA 5M2FX 3CWOX 3R13A 4YWIA 1FHUA 2E5AA 3C5QA 4JPGA 2VGFA 5A95A 4E2VA 1GREA 3BXWA 4A21A 2P3EA 5C9ZA 1JI1A 1H7NA 3P0XA 1B9BA 4RV8A 3SUUA 2WMGA 2OSXA 1W9BM 4AZGA 4EXAA 3PAJA 3ITLA 1YRRA 2WJFA 3UZWA 3VD7A 3GSMA 2J25A 1Q8AA 1YKWA 2V2CA 2FFCA 5GJPA 1ZAHA 5HUPA 1UKSA 3UXLA 3TCSA 3WQOA 4YTRA 4V27A 3WLQA 4GYPC 2RDUA 1Q6QA 4N9CA 3C8FA 3AUOA 1GW9A 1SM9A 1U33A 4LVFA 3NO1A 3M47A 4CNPA 2D23A 1DJHA 1DOSA 3W7MA 3UESA 4J3SA 2WZMA 1EWEA 2WPGA 2CKRA 3N2XA 1W9VA 3A23A 4R3UA 2V3BA 1WA3A 1UZ1A 2HK1A 3KVJA 3II1A 2OKTA 3AXMA 4N7QA 3T55A 1N61C 1O95A 2ZZ1A 2QF8A 1S2WA 1CDGA 3KOWA 1PXGA 1XCWA 3L4UA 2INFA 2Y85A 3NCOA 4US5A 5E9AA 3K4AA 3LPOA 2P0OA 2YW4A 1PTDA 4OBSA 4IPLA 5LIWX 5FCZA 3UY8A 3G3MA 5E9XA 1HF6A 4NKCA 4AF0B 3T6CA 5C9XA 2WZIA 3NPXA 4LBRA 1EX1A 1WXYA 4HZ7A 1MYRA 5HDRA 1QW9A 4F40A 4DELA 3BLEA 1BGAA 2PTXA 3MCNA 2CLEA 1A0DA 3WQFA 2G0WA 4Y7EA 2YL9A 2E6DA 4UFKA 3O1NA 1U1UA 3W81A 3XISA 4LAUA 3TN4A 2RDTA 5HMDA 5HR6A 5K2ZA 3N12A 5FF7A 4IQJA 2QNEA 3KBMA 4JDYA 3DHDA 3UJRA 4NZ5A 1C93A 2C8NA 3PBWA 1E55A 4JKMA 3M64A 2OYKA 2AGTA 3M07A 1K4GA 1SJDA 3TR2A 5G1YA 2PGFA 1OK6A 2DW7A 4B90A 4DX3A 3TA9A 5DBTA 2Y5SA 5CBBA 4ILSA 1MXGA 4XG1A 3QKZA 1F6PA 3AIBA 4I6KA 1PAMA 4H9VA 4W8LA 2DZPA 4WKFA 1J12A 3T9PA 4JCMA 2UBPC 3BAWA 1R3WA 1V59A 1TR1A 5A6BD 3DFNA 1G4TA 1UPPA 2Z1SA 1KM5A 2WPEA 4WR3A 2P0IA 3WQCA 1G94A 4F9JA 3TU9A 4PUUA 3AMDA 2KAUC 3PZUA 4OUIA 1AW5A 3NQDA 4W9TA 1F6YA 4TMBA 4GVIA 4O4VA 3IV8A 3MTWA 3DJGX 3HA1A 1E15A 3IAPA 1EP3A 2ZX7A 5G4EA 3QF0A 2OWWA 5D9MA 1Y5VA 2VC5A 1Q4WA 2GGIA 2E25A 1KRCC 2JALA 1R3QA 1UZHA 3CHCA 2XFYA 3B9EA 2HTMA 3PANA 5BXRA 3GXFA 3TW7A 5KTLA 3SIMA 1V5XA 1YLVA 2FB3A 4TX9A 3FHQA 2VX4A 3C0QA 4G5DA 4AYSA 1UR2A 2XIIA 3O3RA 3O6AA 3AHXA 1BRLA 1V3HA 2DSWA 1THFD 3N34A 4A6GA 1J0HA 1XUZA 3CL8A 4S3FA 1LG2A 4ZQCA 4A22A 3GXMA 8XIAA 1FH8A 1EA9C 2A6NA 4GRTA 2A3LA 4J3TA 3TXVA 1OFBA 4E4UA 2UZ9A 5DF0A 4O0QA 2ZXAA 1PE1A 1F9CA 1R87A 2Y2WA 3WDJA 4EQWA 1IR2A 3WZ0E 1QNSA 3MC5A 4LYQA 2YOCA 1OJXA 3TV8A 1XLLA 4QRNA 3PZGA 2VEGA 4AZCA 2EAWA 3MJMA 5FI8A 2FVKA 1ICQA 1NQKA 3ISIX 4TX6A 3UR5A 4FXJA 2FB2A 1S2TA 1LJYA 4PMUA 3QFBA 3M7SA 1YQ2A 2VDGA 2WAGA 1OX4A 1CWYA 1KFBA 3S5SA 4JFSA 4R34A 3QJAA 1WYGA 2E5CA 4IPJA 4Y9PA 4RNIA 3PJUA 4JKLA 2PWVA 3DDMA 4TOQA 3GK0A 2BY0A 2X1UA 4TV6A 4TTGA 3EB3A 1NSJA 1M3UA 2IXVA 3HF3A 2VEPA 2QDEA 1B2YA 1FA2A 3LGGA 1Z32X 1UR4A 4M19A 3HURA 1JDEA 5A6KA 4PL1A 1JPKA 3DKJA 7XIMA 2ZX8A 1JUEA 4NNAA 2PDIA 4Z1DA 4DXXA 3MCMA 1IT0A 2BGNE 1E71M 3TSMA 3O0HA 4QDPA 1Z48A 4BI6A 3R0UA 4E4FA 3VNKA 3MI3A 3NVDA 4GK8A 3NQBA 1AQFA 3O07A 4GX9A 1K4QA 4J3VA 4V33A 1C7SA 4GR1A 3KL0A 4KFPA 2FHBA 4UMBA 3WQDA 4FK9A 2BOGX 4PMRA 1N8FA 1GZJA 1E5NA 3T0TA 4XTDA 4PMZA 4Q32A 1E0VA 2V81A 2RAGA 4FXFA 4LXFA 3FSTA 1QHZA 4GLEA 4NP7A 3SN0A 1XYZA 4GVGA 1TA3A 3LI1A 1TV2A 2J74A 3OP2A 3SO7A 2F6KA 2FHFA 2DVXA 1EQPA 3RFAA 5K9CA 1UOKA 4JEQA 3LY0A 3TAKA 2WW5A 2BHUA 4JZ5A 3K5XA 5DLCA 4DBDA 2Q8ZA 2Z1VA 4FO4A 1FHDA 2I7GA 3RM8A 3VM7A 3URQA 2HXUA 2F9RA 3PPFA 5EYWA 4WCJA 4PMVA 3UBPC 1ISWA 3H7UA 3S6OA 3KP0A 1ME8A 1XSJA 1EB3A 1SW3A 4AY1A 4IMFA 4H9XA 3CUFA 5H6HA 2DW6A 1YYAA 4QLJA 1L6FA 4MKNA 3LPFA 3HPAA 1OFAA 4EAMA 2TRSA 1YNPA 2VM8A 1JFHA 1RD6A 3M5ZA 1A5OC 2Y8KA 1A5LC 3FY1A 3E3HA 3T0CA 2HCVA 3I4EA 1TE6A 2DZXA 1OF8A 1K9DA 3KDOA 5AC6A 1V08A 5BMWA 2GH5A 3TH6A 3NL2A 3CAKA 4LT9A 4YVPA 3VIHA 3INPA 3W86A 2Q71A 2QCFA 1VYRA 4D6EA 2WSPA 3L67A 3TC6A 3BAJA 3BMXA 3ZS4A 1RBAA 3MUY1 5LHEA 3QW3A 3EKLA 3OYXA 3HN3A 3ZR6A 3JVAA 2VWTA 3AYRA 3BGGA 1TX2A 2GWNA 3C3UA 4XD3A 4RJEA 2Y7EA 3DESA 5CPSA 1QATA 4ZO6A 3ZJ8A 2D3LA 1GVIA 3E96A 2PCEA 2YYUA 4O13A 1UR0A 1ZCOA 1EP1A 4U31A 2E8YA 2L5HA 1AK5A 2PA6A 1SFJA 1TPFA 1I2OA 1XYCA 3PBYA 4ZOHB 3VKCA 2VUYA 1F3XA 2C79A 3VIFA 1F76A 2GVEA 4GNVA 1ZBWA 4I5XA 3TLLA 4GJ1A 2G4FA 2QAFA 1S46A 2G5WA 4C1NB 4ZEPA 4O17A 3KBSA 3DFTA 1UD3A 4CUCA 1GOQA 5CPNA 1YQZA 2WMIB 1IF2A 3O63A 4WKHA 1HP5A 3M6YA 4MJZA 1GQKA 1JR1A 4FNTA 1KBKA 3CUXA 3RR1A 3BL3A 3N15A 4UNLA 2XGBA 1HL9A 1W17A 3IWPA 1WYIA 3W7IA 4NZFA 2AKZA 2PGWA 3PZNA 1XH2A 2QLYA 5MKGA 3B9DA 2B0MA 3B8IA 1LOQA 3STPA 3C8NA 5H2ZA 2CZFA 2A79A 2QYGA 3H12A 1IGWA 2YB1A 4Z2IA 4RNHA 5KETA 3K8LA 4UXDA 1KM0A 1G01A 1TR9A 2XIQA 2UY4A 1KRBC 4C7DA 3LMZA 3ZJKA 3HMCA 4QR6A 3T40A 4FLQA 1UBSA 1EF2A 3L2MA 4F0HA 4LAKA 4CQDA 3DFPA 4ZGYA 5HPOA 1UPMB 4K37A 1GOKA 3PB2A 1W1IE 3NQGA 4IL2A 4O1CA 3VDBA 1I9CB 1QR7A 4GISA 3NQFA 1O5XA 4GNJA 4N9DA 3O05A 3WFZA 5CC3A 5DX7A 1BWVA 3GG0A 4ZE5A 1E1CB 4G7EB 2PD5A 3GDBA 1FP9A 5I3FA 5RUBA 1UMYA 2X16A 3MI2A 4H3DA 1BKSA 2E8ZA 4LCSA 2QCLA 4G6CA 3KCLA 3B8DA 4YHGA 2J7FA 2W54A 5AECA 1QBAA 4V2XA 1VFOA 3ICJA 5LHFA 4R27A 1XHGA 3CHEA 2WVTA 5TD4A 2Q01A 3IGSA 1GKQA 4W5ZA 2YCJA 4E0CA 1FWJC 1GJWA 3LMYA 5DXXA 1PCKA 3WKZA 3AIWA 1A5AA 4GQQA 3VGEA 2W3ZA 3U2ZA 2X09A 2ZE0A 3LB8A 1H51A 2J7GA 4P7QA 2VNCA 4OHQA 1EP2A 3FW6A 5AYZA 4I8YA 4LYKA 3VOIA 2NQJA 2WP6A 2G3FA 1DV7A 4HYWA 4O1EA 5A2AA 4WY0B 3HG3A 1MO0A 2PTDA 4IZGA 2DU2A 4HA1A 1CX9A 4HZMA 4LAOA 1P6BA 4H4XA 2VOTA 1QASA 4NZ3A 4H4WA 3OO2A 5A1AA 1KXTA 1Q1WA 4IMAA 3GXDA 3L8KA 1K8XA 2IQ0A 3CEUA 1W3NA 1FWSA 1MI3A 1VGAA 3GLCA 5A94A 1G5AA 4H7ZA 4ICCX 4M56A 1W5QA 4MWAC 2J3NA 1XDMA 3ZR5A 1GQLA 1QFEA 4QJ4B 5BRPA 4UTWC 4WSHA 3EPOA 3MP4A 4C7FA 1GRFA 1JCYA 4DUXA 1YXDA 1I4NA 4WK9A 3MKVA 2IQDA 2IMRA 1TZZA 3VIGA 1AQ0A 1BWLA 3SEPA 1E1EA 5LA1A 3EDFA 3CAWA 1HJXA 5AVNA 3SB0A 2EQDA 5JH2A 4AWSA 1JZ5A 1TPC1 2PDQA 4G2DA 1E40A 1Y65A 4Q8QA 8A3HA 4PRWA 4H50A 3EPNA 2NVAA 4AZHA 1MUMA 4TIMA 2CFYA 4W8AA 1X6LA 4XZMX 2YVGA 2PPGA 6A3HA 2NV2A 2O9RA 1HVXA 3W07A 1FY6A 1E73M 5C54A 2J9YA 4FPSA 1NVMA 1N5XA 2RGMA 3W82A 1I8JA 4QTGA 2CZ5A 2X8CA 5JBDA 3UWVA 1X96A 2DT2A 3HV8A 1GTHA 2UY3A 4PMQA 2ZRYA 3SECA 1KBJA 3V7PA 3FSUA 3G8EA 4Z42C 3VCCA 4EACA 3F4DA 4QGCA 3S2JA 1Q85A 3M0MA 2VYOA 2VJXA 3LOTA 3C56A 3H2NA 1S3TC 3N17A 1TVLA 1XIGA 3B0YA 4H6RA 5M17A 1Q1RA 4GCAA 3DFYA 4NUWA 2VL4A 4HB7A 4H4YA 2TODA 2ZRUA 2WPCA 2GJNA 3UWWA 3GTHA 1EDTA 3DCPA 3I6EA 1ZJHA 1H1NA 3OZOA 3VABA 1VHNA 1XV8A 1N5WC 3QRHA 4JQ9A 3CMJA 3KZPA 3S8HA 1F74A 1RALA 2DUAA 4J3UA 3TA6A 1SJAA 4LALA 5GJMA 1LRNA 4NAFB 1UWSA 4B16A 3LHUA 4FOUA 4DN1A 3GFYA 3EOSA 1R38A 3P81A 2ZRXA 1KO0A 3N19B 1EBGA 4AX6A 4KCTA 4OQVA 3UCDA 3HPXA 1LOSA 4BQ2A 3H54A 3DXIA 1HKVA 5I09A 4Q4OA 1X1NA 4DLFA 3ARSA 3LU2A 4DO5A 4P7NA 5G5IA 2PWFA 3QW4B 3B8VA 4V28A 1Y7VA 2OQLA 4CN6A 2OX1A 3GRIA 4PTXA 2OZ3A 2VCBA 1XGDA 3S6TA 4DJEC 3BAKA 1AH0A 1E0UA 1MQQA 3LV6A 2YXXA 1F3PA 1QMLA 4IP7A 4DQWA 3T09A 4LW7A 5IDIA 1VFFA 1PPIA 5BRQA 4HNVA 3PUGA 2EQ8A 1KGXA 1U2YA 4XBKA 5LIKX 1NDYA 2UV8G 3XIMA 3CH0A 2C19A 5ABHA 3LB0A 1CIUA 2AQOA 2QGHA 4LTSA 2DH2A 3SY1A 2ISWA 2WYSA 1ZX9A 3AZRA 2B31A 1H7XA 1HXJA 3I6TA 2JGQA 1EQCA 1V02E 1PS9A 4ZE4A 1KXVA 3CB8A 3SCQA 3CHDA 2IW0A 2Z6IA 1TFVA 2BLEA 3UG3A 7REQA 1Q66A 1RY8A 3UU0A 5PTDA 1ADOA 1WXZA 4TV5A 5FA5A 5AC7A 3IIOA 3UCQA 3DC8A 4BWLA 4FAMA 1AJ0A 3SCVA 5BCAA 2C3ZA 3R8HA 4JFWA 1G4PA 1PWLA 5DFAA 3S2NA 3ZLGA 4DXKA 1Y5XA 3M44A 4MVAA 5G2HA 2TAAA 1ZNNA 3P61A 1S2UA 3BPWA 4NJGA 4LQ1A 3PTQA 4D6IA 1QPKA 3R0DA 2VMFA 1RQEA 2HQAA 3BURA 5XINA 3TW6A 1E0XA 3UA4A 4EWND 4IIHA 3F5JA 4H9TA 4RX0A 2Z4GA 2XM1A 2WVVB 3VKAA 4DBWA 1W3JA 3K8KA 3WJWA 4UTLA 2BNJA 1UKOA 4PFHA 4L1GA 4K36A 1A47A 3ELFA 2IKJA 4BJHA 1XGEA 3QQ1A 4EQRA 1R2RA 3IJIA 3UJSA 1DP0A 4XKYA 4F0KA 2I17A 4KCWA 1CXIA 3OLIA 3N18A 1UD5A 1XIIA 3EKZA 2C71A 3RX3A 1UJQA 4L9ZA 3BV4A 3OB8A 2OJPA 5D8WA 1Q7ZA 3UW6A 3A6OA 4DI9A 3QC3A 3NNTA 4D2JA 3D9XA 2H9AB 3J7HA 4EXQA 4GZ7A 4NAEB 3IIVA 1PDZA 2CYGA 3IJLA 4HJWA 3D6NA 4M0XA 5D2XA 1E0WA 2PDWA 3FX4A 3VKKA 1ONRA 5CGQA 4TTUA 1WDWA 1HT6A 3B3DA 2EJ1A 4O54A 3QGKC 1ZHAA 2QMKA 2QAPA 2EG6A 2D2OA 1LLWA 4GZJA 4S3AA 1XF0A 3TFXA 4XD5A 3M0YA 3C61A 3EWDA 1TREA 2F84A 2QMJA 2OR2A 5BU9A 2YVJA 4LJ3A 4JXCA 2Q3RA 4IP4A 2BODX 4MG4A 3WBWA 5I6SA 1J18A 2V2HA 4AWTA 1W37A 3V1PA 3RRAA 3SZ8A 3GG1A 4MNMA 4H1ZA 4XZNX 2YFOA 3UWYA 2QDGA 3ZSSA 3B03A 4P7RA 2ZC8A 4ZR8A 2ZZ7A 5C9RA 3W1QA 1KRMA 3SQPA 1KM1A 2CC0A 3OJGA 3KE0A 4UOZA 2YA1A 3G1XA 3A5VA 5LNRA 3L21A 4O28A 4JQ1A 2J75A 3QV9A 3W73A 2YYTA 3BOXA 2QR6A 3ARUA 1F6KA 1SJCA 2EGZA 3TN5A 3CZGA 1ME7A 4HMDA 1MO9A 1C91A 2Z1XA 4ZMGA 4TUFA 2XN1A 1S5WA 1BRLB 3K30A 2YL8A 1AFSA 3PWGA 3VX1A 5E6YA 1FWDC 2I5QA 3QGAC 4QDWA 3VGHA 2O7QA 1OQFA 4BURA 2XIBA 2BVYA 3TVAA 4R7OA 4QM1A 1UKPA 4UCFA 3H2EA 4ZZ9A 3GKAA 4QSFA 1LRQA 2PDNA 2Z2BA 3B0XA 3TJ4A 2GJRA 5KEZA 4LAMA 1NQ6A 1JYXA 2P50A 4O16A 3R0KA 4TVCA 4CCCA 3H2OA 4X2PA 2QDDA 4IICA 1XIJA 1VRXA 3UR2A 1OYAA 5BNKA 3RHGA 1WP6A 4BEUA 1OFPA 3DZ1A 4ORIA 4FNQA 5JU6A 2CZVA 2A3CA 6XIMA 4Q4MA 1DL3A 3UFYA 1XLAA 1OX4B 4M1BA 4XO6A 3N9RA 3FIGA 4R5EA 3CAQA 2NLYA 4NHVA 3N1AA 1CYGA 5AHLA 4MZ8A 4D9PA 1XLMA 3HFYA 4B91A 1ZBVA 3KTXA 3OODA 1O5QA 1VENA 4JY9A 4LUSB 1PKYA 1IE7C 4PMOA 3GRTA 5D2TA 3VKDA 3V0SA 5CGTA 3NXLA 3WLIA 2JEQA 2NQ9A 3MI6A 3WX7A 1KKRA 1GXFA 5ABGA 1GJUA 1B3YA 2Y1HA 3FYYA 1S5TA 2RABA 1POKA 2QAEA 2WM0A 3U5YA 4CD4A 4H4PA 5L6UA 3I65A 4OVXA 4UTIA 3IUIA 3G0SA 4A3QA 1RPXA 4O14A 3WH8A 5I78A 3HB9A 2V3FA 1PWMA 2WNWA 3LD5A 1CI1A 3UYIA 4WD0A 1UWAA 2VUNA 2PCQA 4GZEA 3KM8A 4RZBA 4XD6A 1ONWA 1E4MM 3P8JA 1Q6GA 3NQEA 3SFWA 4H6QA 1K03A 3FA4A 1V0LA 3UXIA 3N9KA 3N2CA 4CKQA 5HNUA 3ZSTA 4RPQA 3VE9A 5A8NA 4I7VA 4Q4QA 3WDRA 1JPIA 2W4XA 4I6VA 4B2DA 4PSRA 4JTJA 3NOYA 2RHGA 3KXQA 1EJWC 1I45A 1GW1A 1UD4A 5HXMA 1GQNA 3IGHX 4QJ5B 1J8VA 4Z2JA 4O0ZA 4EK7A 2QCCA 3IK4A 2ZCGA 7TIMA 1ZXIC 3C4UA 3WNPA 1CENA 2OOFA 3DBPA 1DXLA 4ZQMA 4NNCA 3UG8A 1ZTVA 2I5GA 2DIKA 3WSUA 3ZWTA 2VCAA 5JIPA 5E5CA 3SI9A 2CLHA 1K1DA 5ECVA 3MT1A 2W92A 1M7XA 5KVIA 2X2YA 4D8LA 1E9IA 2OEJA 2ZE3A 5HQLA 1UR8A 3S46A 3VNIA 4MJMA 3GKFA 5D30A 3EOLA 3R1ZA 4ICMA 1AUSL 3I7QA 1UP3A 5JUVA 2W3SA 2W6RA 5A69A 1G6CA 2Y5JA 4HKPA 3ZJ6A 5DMMA 4BFAA 4LVDA 3LBCA 2EKGA 4C6JA 1ECQA 3RPTA 1M7OA 3BAIA 3ZVHA 1V0KA 2WHKA 3ZQ9A 3VCNA 3W0KA 2RJHA 4W93A 1KXQA 1JDFA 4HZ8A 4FX6M 3S2MA 5A6SA 1K6WA 5AN7A 2QUVA 3KS5A 1ONEA 1HUVA 4GVHA 3T8LA 3NO5A 4JHOA 3BGJA 2I14A 1UD2A 3VO0A 1E51A 3QHOA 5FF4A 5JVLA 1CBGA 4JICA 4KIEA 4L9XA 3TQKA 3PNZA 4C7GA 3VNJA 5LIXX 1ZY8A 3CGCA 3B4YA 4O4WA 4PEEA 1YNQA 3AQUA 1P6CA 3CASA 3DEQA 1WZMA 1FCUA 4IL0A 3VZZA 3WNLA 3N4EA 3DGBA 4JTFA 1J4EA 3GU9A 4PYSA 2ASHA 4DZAA 1ZS2A 5BXSA 3PWAA 1SYTA 1EDGA 1DWJM 1EEXA 4W7VA 3SJNA 2KX9A 2QIIA 1FWRA 4BKNA 4P8XA 1X7FA 4ZSTA 4CQ9A 5M03A 2P88A 1XD0A 3AS0A 3HJEA 3GXPA 1TYTA 1V77A 3S0CA 3DFOA 3GYEA 2AGKA 2WHJA 3TTQA 1PV8A 1YADA 4ORMA 3DJJA 1DIEA 4YTUA 1SZRA 5CAKA 3TNBA 1DHKA 1Z8AA 4GIYA 2VKZG 3C6CA 3B9NA 3H26A 1QOQA 1SZNA 2VR2A 5D4YA 1VC4A 1K9EA 1KR1A 3B8UA 1CZ1A 2Z7GA 1OWQA 1YDYA 2XWDA 3ITGA 4D71A 2J7BA 3L4TA 3PP7A 3CV1A 5DO8A 2YA2A 3WF2A 4REQA 2HV5A 4OUEA 5H8PA 1NHQA 4ATWA 2BDQA 4GX8A 4JHZA 1KM6A 4W89A 4PUEA 4DUWA 5CG7A 1RVGA 1UB3A 2FPYA 2DZTA 4L56A 3TYDA 1HKJA 4IXXA 2ONEA 2NXHA 4B3KA 3GHUA 3PPHA 3U4AA 1V8EA 4L6HA 2QCDA 4KEMA 1PB0A 4Z1CA 1OB0A 3E38A 4W88A 4K68A 2R6OA 4AWEA 3M0JA 3ARXA 1W8GA 5ER0A 5A8QA 3T1GA 1JYWA 4DPQA 3BW4A 1HJSA 3D5HA 3CV2A 1GPFA 1LT7A 4G8TA 3JZEA 4O1DA 4GABA 1TTPA 1P4CA 2NUXA 3UETA 3G0XA 1R6WA 2ON3A 3KCJA 3WD3A 3OGRA 1P0BA 5J5DA 1W1ZA 4GUHA 3W88A 5T26A 3AHTA 2P76A 4IIDA 3CTTA 4GZIA 3MCOA 2BFGA 4YTTA 3P82A 2V5LA 3WK2A 5I79A 1AODA 1NOFA 3RK8A 2YBTA 2PRMA 4GPNA 5CZKA 3P3BA 5C2CA 1LWHA 4H9UA 2X05A 2AMXA 3HQOA 1I6NA 1NAL1 5I07A 4M80A 1XLHA 2F7FA 5FS9A 4UB9A 3UPWA 4QNWA 1H49A 2V82A 3UZJA 2BC1A 1KQYA 4MF4A 4HN8A 1GZ1A 3HG5A 4J2MA 3EYPA 1W1TA 2QIWA 2Q6ZA 1NHPA 1DBTA 4J1OA 3BZJA 2FZ8A 1H3GA 2PDHA 3OQ8A 1OX6A 4H6EA 3BLLA 1JZ6A 2F2HA 1ONXA 4KMQA 4ZO9A 3JU2A 5U25A 1Z69A 1OGGA 2BGQA 1TV4A 2UY2A 2BVTA 2VEMA 1YEYA 4B3ZA 2Z24A 3UXKA 1PVNA 2DORA 1ITQA 3W3OA 2X42A 4ACZB 4JIRA 3HO8A 1R8LA 3QFEA 4F0SA 2J13A 1T0OA 1GEUA 3BC9A 4PBGA 4WY0F 3SRHA 3GU2A 3GX9A 1VPYA 3HW2A 4A3YA 5ABFA 3MSRA 3TEVA 1TCMA 1HFBA 4O1FA 3EWYA 2ZUSA 4ZFCA 3MP5A 3L0KA 4LYRA 4RZ5A 2XGZA 2GGGA 5DEZA 4Q7BA 2NVCA 2Z7KA 4QHRA 3TTOA 2PZ0A 4B2DD 4MAZA 3KLLA 3W76A 3WUEA 5FF2A 3T42A 4POCA 4QS6A 1E72M 2DH3A 1SO6A 1ZBCA 4AZBA 3MMWA 1NU5A 4DF0A 3ATZA 4Q22A 1E9ZB 3WD1A 4GI6A 1NPXA 1W32A 3REQB 3NJ3A 3URBA 4K8EA 1GRTA 1O7AA 4DHGA 3S5OA 1DJWA 2EBNA 1B3VA 5E0KA 2OQHA 2POTA 4WDTA 2WJZA 4BK9A 4UTWA 5FEZA 3HMJG 1W2PA 4Z2LA 2D0HA 2PWUA 1UOZA 2DZSA 1TVNA 5EMKA 5A2CA 3DK4A 1QBBA 3VUSA 2WCSA 2IPWA 4FX7A 5REQA 1XS2A 2CZEA 3NG3A 2YB4A 1SR0A 1XH1A 1L6SA 4NJKA 5AOUA 2ATMA 2XG9A 4PBEA 3AO0A 4QE4A 4N2YA 1E5JA 1EIXA 3QVQA 1QNRA 3H2MA 3UQNA 4JNMA 3Q4DA 4LEQA 2ZADA 2FDSA 1YPFA 4PMYA 3LCWA 4H7CA 1JF5A 3LCFA 1FH7A 2O0TA 2CLOA 1XQKA 3QH2A 3GNRA 3QC0A 2WNNA 3W7DA 3STGA 4H4QA 4ES4A 2V9DA 2EG7A 3W7NA 3ME3A 4QQUA 2CU0A 1B5TA 5DMNA 2HQMA 4Z1YA 4AF0A 4Y90A 3LEPA 2E6FA 1R3SA 1MW1A 1Q3NA 1KBBA 5JMUA 3VPLA 3W7JA 3V5OA 1Q6DA 1TZ7A 1KFLA 3S1XA 1XG4A 1BXBA 5A8GA 3FAWA 1MWOA 4WSKA 3ARTA 4AC1X 4K7YA 5CC6A 5AYIA 1SVDA 3GH5A 3W2MA 4L64A 4J2PA 3GNXA 3EWUA 1V4YA 3F4NA 5CPMA 4O11A 3U2EA 1LTDA 3SR7A 5FOOA 3W38A 1Q6RA 3BG3A 5D2WA 3CO4A 2ESCA 1JCLA 1SPQA 5IBXC 4O12A 1F61A 3T2OA 1SFLA 1JXKA 3DU0A 4HPNA 3ABXA 4DJDC 2FGZA 2NXIA 3UJ2A 1TJPA 3BLIA 3HFTA 3UPMA 1XIMA 3TOPA 1PYFA 2Y6ZA 3T4WA 2PWDA 3KS6A 1TMQA 3VX0A 3E9AA 2D2JA 1ISXA 1KLZA 1BSIA 1OC5A 3NPVA 3GFZA 4X9YA 1NARA 1UD6A 7REQB 4L9YA 4MFDA 4B5NA 1RSCA 2V5JA 2EG8A 4AB4A 3JW7A 1PIGA 3QYSA 1DJQA 4GIRA 3E0WA 2J47A 4ZO7A 3CM4A 5C0QA 2ZVRA 1GSNA 1ALDA 5FJRA 3KUMA 1DWFM 2XM2A 3WBAA 1X1OA 1WKYA 2OZTA 2TPRA 4K1WA 2XSAA 3CZ8A 1E1FA 2QJIA 1BQGA 3G1FA 4S1FA 1KLYA 1P48A 1N60C 1BVZA 1WAUA 4DNHA 4ADSA 3GXTA 5CC7A 1T41A 4DJFA 1QDSA 4L80A 4P7LA 3WQPA 1AD4A 3CB3A 3AU2A 1M04A 2BP1A 3W7OA 3LENA 5F7UA 1W1A1 4HPHA 3BVJA 4I9JA 1DTUA 1TPUA 4GBUA 4HHPA 3TQPA 3BSGA 2A1YA 2WMJA 3TOYA 3UERA 3H55A 3WJZA 4AUBA 1XXXA 3S1VA 3GC2A 1BWKA 1C9WA 5AY7A 4FB7A 2GK1B 3M1ZA 3AICA 4AIEA 2VGIA 4ADUA 2HBVA 1KB3A 4G1NA 5A6JA 1CB7B 3IJ6A 4GI9A 1FWEC 5HK4A 3STFA 4C6QA 1F3EA 1E4NA 4GE8A 2X2GA 3HPFA 4KFNA 2PP0A 3AYSA 4JD4A 4UR8A 2VZOA 3LHZA 1KD0A 3LTYA 5AFDA 3PC0A 1HGWA 3FCPA 3U6WA 1B3OA 4JFTA 2G4JA 3WLTA 1J6OA 4DPPA 3TKFA 3G18A 3LQLA 2OG9A 4NG3A 1KQZA 1JD7A 4GUFA 3B8SA 5FS8A 1EX5A 4M7SA 3CWNA 3GTNA 6XIAA 2R82A 1TQXA 1LLOA 2D2HA 4XVEA 5C6MA 3RMEA 4LSBA 2BHZA 3G6MA 4X2RA 3TJLA 7ENLA 4X0VA 1XQLA 4JTTA 4LIIA 2CW6A 4X63A 4ROPA 4RW3A 2B4GA 1H0IA 3NVTA 2NUYA 4CQCA 5DRIA 1XLEA 1TYGA 3QKEA 3AWNA 4EAYA 2DJLA 5IHRA 4Q8WA 5BXPA 3WEMA 1B3WA 1DIKA 3RCNA 1TRIA 1JPMA 3AAMA 3KOYA 1WDPA 4IUGA 2ABBA 1FUYA 2YCLB 2QGYA 3Q67A 3KOZA 2VCCA 3N04A 5F2LA 2OWXA 1EHNA 1TWZA 3E6EA 1PKMA 4MGGA 4S38A 3M6DA 4RK8A 3B9AA 4BZYA 3LLDA 3QM3A 1JZ7A 3WY1A 1SW0A 3FLUA 5HMEA 1IZKA 1TPEA 2OVLA 1FKWA 1OG6A 4AXKA 4MY8A 4MWAD 1UWUA 4TR9A 4XSMA 1K70A 2I16A 1V3JA 1KTNA 3NQCA 1C8VA 5KSWA 4FX8A 1R30A 3I6RA 4RCXA 5DBUA 4FF5A 3F4VA 4B5SA 3S6DA 1YTDA 2PEVA 2VX7A 3ITCA 1UJPA 2FZ9A 4V1XA 2A5HA 4KESA 4DYEA 2Y8UA 4KS0A 1E6SM 4P5UA 3PJTA 2G3IA 5DY3A 3HGOA 2ZUMA 4CQBA 3LADA 3AHYA 4FMVA 4U10A 3N3MA 2CLMA 3GD3A 3MMDA 3P74A 2BTMA 2YX0A 4QDMA 1OM0A 3GY1A 3QFAA 1FVPA 4JIIX 4CQAA 4R7WA 3EOUA 5JCKA 5DMLA 4NZJA 4Z17A 3W7EA 5D2VA 1ZPTA 3N6QA 1LLZA 4QG9A 1Z41A 3FJ6A 4JIHA 1W0MA 3M0XA 4HT3A 4QQ3A 3W01A 4F2TA 3BW2A 4F2UA 3VINA 5FEXA 3RCYA 1OYBA 2CPUA 3DOPA 2J8FA 3L9CA 4H8NA 3R4IA 1IEXA 2GVYA 1FXQA 1W3KA 1A3HA 2QUTA 2WHMA 4HCDA 4KWUA 2VHLA 3AJXA 3APYA 4CLMA 1RP9A 5I03A 3MDWA 2W0UA 1G67A 1UIOA 2C6QA 1IGSA 4IPIA 1JNEA 1UW9A 3EA1A 1D3HA 2JKEA 2PF8A 2Y7GA 3C2RA 4WJEA 3WDPP 3WD0A 2YW3A 2RGLA 3COTA 1YIXA 3HG2A 3SCOA 3CJPA 3WUFA 3WNOA 3LK6A 4UQBA 3D3FA 4K8GA 3RITA 3ZM8A 5T9BG 4XQ6A 4PUNA 1X7IA 2X1IA 3KWXA 4LS2A 1RCXB 4WGXA 2CLIA 1KCKA 3DG6A 3M5VA 2OSYA 4AY8A 3PSWA 2H8ZA 1L8NA 5KITA 3R5EA 4GFIA 3BGAA 2ZUVA 4C1NA 4MADA 1XBYA 4XBJA 3BOLA 3SQSA 4HOWA 2X8RA 2WMIA 1Y8BA 4JGDA 1J10A 4JAWA 2QXWA 3F2CA 1CEOA 2GVJA 5HJYA 3FA3A 1IEQA 3TP4A 1VYPX 2V5KA 3RLVA 3VMOA 3VILA 3VIIA 1C7TA 3L2IA 5JCIA 3HG4A 2EPLX 4DJED 2EPHA 2GQWA 2ZA3A 3UWUA 3LYEA 4JYEA 4DI8A 1F3TA 1B4KA 2HROA 1DJNA 1FOBA 1TG7A 1RUSA 5A8PA 4A8LA 2B81A 1LQ0A 4PB5A 3QQ0A 5CPQA 1VFMA 5G4WA 2VR4A 1QPQA 4QX4A 4XB3A 3MO7A 1I0DA 3HM7A 3RGTA 1QW8A 2O9TA 2J78A 3M0LA 3ZFHA 1UH2A 3RIKA 4O53A 3GR7A 4DUVA 2TYSA 4QXIA 4IG2B 1V79A 3M46A 2HBXA 1VEPA 3BMVA 4OE7A 1BVWA 2BMBA 3I3BA 4WJ8A 2W5FA 1TWWA 1OGBA 2V3EA 3ANVA 2RKXA 5MHBA 5IM51 3W7PA 1XLBA 3EWBX 3LV5A 4PCSA 3UWQA 3L66A 1W3HA 3ZVHB 3L4XA 1H4PA 2GUBA 4N0RA 1VCGA 1S1RA 3FDKA 3CEPA 4C6CA 5FS7A 1E1CA 3CQIA 3QFWA 4RNFA 2P1FA 4B5TA 4M52A 4B5VA 3AIUA 4NYUA 2OZ0A 4LBSA 5FMHA 2MNRA 1EIBA 1TRDA 1KM4A 2ZRVA 3M0KA 1XKYA 1JI2A 2OPJA 2GVLA 5T9CE 1QJWA 2YBUA 4AXNA 2NQLA 3EMQA 3CYJA 4MLRA 3WFLA 3B97A 2WMKA 3AS3A 1DXIA 4H4UA 1VDVA 3PJXA 2JF7A 2DSVA 4Q33A 3KHDA 3KRUA 5ABTA 3SSJA 4YS1A 4Z2KA 3BJSA 3H2FA 2FPVA 4UWMA 4GY0A 2HVMA 1HKIA 3VOJA 4E2BA 1W54A 1XD1A 5ENLA 1CNVA 5HWMA 3CUJA 3L5OA 3KBNA 4O57A 1VQZA 1F7BA 1JFXA 1PCWA 2XVGA 4UTKA 2HVOA 2WC3A 4PA8A 1W1PA 1LBMA 3H23A 3BMWA 1HO1A 2G3NA 5FAJA 1CW2A 4WY0A 4CD5A 1JRBA 2YKKA 3M5YA 4ERGA 2OO6A 2PE4A 3TDFA 5A8MA 3W2LA 3DK9A 1R3YA 1AQHA 4GG9A 2PFHA 1D2KA 4X22A 4GY1A 3A64A 1RJPA 3SY5A 1JCJA 4ZO8A 1RQHA 4H8VA 5KVHA 1HN1A 1BXNA 3USBA 1J0IA 1BSLA 4PN2A 2ZZ0A 1PJ9A 2XDFA 1UROA 2G50A 2CHNA 1BKHA 1PL9A 1H7OA 5BOOA 1XLFA 1H0GA 4QBXA 2IS7A 4REQB 4RUBA 3FEMA 1W5OA 2QVNA 2V69A 4CNNA 3CIXA 3IIPA 2BY2A 3M43A 3BUVA 4PUKA 5A6BA 1KNWA 4MWAE 4WDWA 4WOQA 3WLOA 1RH9A 1A5BA 3WENA 3MKCA 3NQVA 4DWSC 3JS3A 2Y7FA 4IX2A 1ZL1A 3ONBA 2PGEA 3O2LA 4HU4A 4AG0A 2D22A 2GR2A 1V6TA 4LY8A 4RLIA 5KZ6A 4ZA0A 3E74A 4L4MA 1NWTA 1T99A 4O1BA 4PTVA 2GJLA 1R3RA 4HNNA 1A3WA 3G1YA 1F8IA 4PODA 5CXPA 4QNEA 1K9TA 4NJIA 1ONFA 4YVXA 4Y8FA 3PTMA 2NT1A 4HSOA 3W85A 1Y0EA 4YU1A 5LIUX 4P2VA 4C6DA 5IFTA 3EDDA 4QITA 2PWGA 4GOAA 1MEWA 1XC6A 1LUCB 3I3DA 1RP8A 1B0IA 4NI8A 4Q8MA 5I23A 4O8RA 1RR2A 1DWHM 2OLHA 1WBHA 3EWZA 1WZKA 4LRSA 3O7UA 1IWAA 1GERA 1E3ZA 1EC7A 1YDVA