4IZGA

Crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound cis-4oh-d-proline betaine (product)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
369
structure length
369
Chain Sequence
MKIAEIHVYAHDLPVKDGPYTIASSTVWSLQTTLVKIVADSGLAGWGETCPVGPTYAPSHALGARAALAEMAPGLIGANPLQPLVLRRRMDGLLCGHNYAKAAIDIAAYDLMGKHYGVRVADLLGGVAAERVPSYYATGIGQPDEIARIAAEKVAEGFPRLQIKIGGRPVEIDIETVRKVWERIRGTGTRLAVDGNRSLPSRDALRLSRECPEIPFVLEQPCNTLEEIAAIRGRVQHGIYLDESGEDLSTVIRAAGQGLCDGFGMKLTRIGGLQQMAAFRDICEARALPHSCDDAWGGDIIAAACTHIGATVQPRLNEGVWVAQPYIAQPYDEENGIRIAGGHIDLPKGPGLGITPDESLFGPPVASFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme, N-terminal d
publication title Prediction and biochemical demonstration of a catabolic pathway for the osmoprotectant proline betaine.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 126
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 5.1.1.22: 4-hydroxyproline betaine 2-epimerase.
pdb deposition date 2013-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4izgA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4izgA01
3SN1A 2HNEA 3TW9A 4HCHA 3I4KA 1W6TA 1EBHA 4FI4A 4EWJA 3UJEA 4MGGA 4ENLA 3ZLHA 4ROPA 4ZCWA 3DG6A 3T9PA 3SN4A 3UCCA 3U4FA 3UXLA 3H7VA 2ZADA 3RITA 3N4FA 4HNCA 3S47A 4K2SA 1F9CA 3NZGA 4IP5A 4KWSA 3VFCA 3V5CA 3TOYA 3IK4A 2PPGA 3DGBA 1ONEA 1BQGA 2O56A 3NO1A 2PMQA 3P3BA 3N6HA 2HXTA 3FJ4A 4GGHA 4GYPC 4H83A 2QJNA 3VCNA 3P93A 3K1GA 3RR1A 3ZVIA 2PGWA 3FVDA 3MY9A 1JPDX 3H12A 2PA6A 4J1OA 3DIPA 2GGGA 3ES8A 1NU5A 2QVHA 3UCDA 5FJUA 2GGJA 4K8GA 3THUA 2ONEA 1P43A 1EBGA 3SN0A 3TJ4A 2PP1A 1FHVA 3GD6A 4DYEA 2P0IA 3MWCA 2QDEA 5J04A 2NQLA 3RGTA 5FJPA 2QJJA 2DW7A 3D46A 4KEMA 4J3ZA 3RCYA 4IHCA 3VDGA 4A35A 3QN3A 1EC9A 1JPMA 1KD0A 2GGHA 4E8GA 4M0XA 1MNSA 4H1ZA 3MKCA 5IDZA 2PODA 3GY1A 3R10A 3V5FA 2OFJA 3OZMA 3PWIA 2I5QA 3UJ2A 3TJIA 3T8QA 4G8TA 4DXKA 3S5SA 2OQYA 2P88A 4HCLA 1PDZA 3OP2A 1L8PA 3PWGA 4GIRA 4HNLA 2XH4A 4M6UA 4IL0A 3Q45A 2AL2A 1XPYA 3UJFA 3NXLA 4JN8A 3QTPA 3R0KA 3T6CA 3SJNA 4IZGA 2PGEA 1SJDA 4H19A 3UJRA 3ZLFA 2P3ZA 1BKHA 4A3RA 3D47A 1MUCA 3IJIA 3QLDA 3OZYA 3BJSA 3CT2A 4MKSA 5BOFA 1SJAA 2PP0A 4H2HA 5FJTA 2OPJA 3VC6A 3OW1A 2XH7A 3BOXA 3DEQA 4FP1A 3JVAA 3TWAA 4JN7A 3I6TA 2QQ6A 3V3WA 2QJMA 2POZA 1OEPA 4DWDA 1JDFA 3FYYA 3SSZA 3KUMA 2PTWA 1IYXA 3H70A 2OX4A 1WUFA 2OQHA 2OZ3A 2OLAA 4F4RA 3JZUA 3VCCA 3N4EA 4ZA0A 2OVLA 3HPFA 3RRAA 2PP3A 2PTZA 3GO2A 3DFYA 3ZVHB 1JCTA 2GGIA 2PU1A 3DERA 5ENLA 4DHGA 2P8CA 1KKRA 3OTRA 4A6GA 2AKMA 6ENLA 4IL2A 3DESA 2OKTA 2XSXA 1MDLA 3CYJA 3GC2A 3MZNA 4Z17A 2HXUA 1EC8A 4E5TA 1ECQA 3Q4DA 3MQTA 3CAWA 3OPSA 4X2PA 4E4UA 4IP4A 3BSMA 1MRAA 3DG3A 2XH2A 4K1WA 3PK7A 2OZTA 2GDQA 3U9IA 4Z1YA 2PU0A 3PFRA 4GISA 4YWSA 4GFIA 3ZLGA 3ZVHA 1TKKA 2OO6A 4MMWA 2XH0A 5BOEA 3UJSA 3IJLA 3JW7A 3DG7A 5FJRA 3TQPA 3R25A 4E4FA 5EU9A 3ENLA 2HZGA 1YEYA 2PTXA 2P8BA 4HN8A 3SBFA 2MNRA 3TTEA 2GGEA 3N6JA 3V4BA 2OG9A 4E6MA 1DTNA 2PCEA 4IT1A 2AL1A 3FXGA 3I6EA 3DFHA 3H8AA 2MUCA 7ENLA 3EKGA 1EC7A 1P48A 3TCSA 3CXOA 3T4WA 3VC5A 3FCPA 4DN1A 2OZ8A 3EEZA 1SJCA 2AKZA 3B97A 2PSNA 3DDMA 4GGBA 1MDRA 3R0UA 3MUCA 1WUEA 1PDYA 3IJQA 3SQSA 3CK5A 1TZZA 4GMEA 3QKEA 5FJOA 4JHMA 4HYRA 2GL5A 3FV9A 3CB3A 1R0MA 4DX3A 3P0WA 3STPA 2QGYA 4GYPA 3UXKA 1RVKA 3UGVA 3NFUA 4KT2A 2CHRA 3R11A 1KCZA 2XGZA 2GSHA 1R6WA 4G7FA 2RDXA 2AL2B 2DW6A 2FKPA 2QDDA 4HPNA 3R1ZA 4HCDA 1TE6A 1KKOA 2FYMA 4KPLA 3VA8A 2ZC8A 3ES7A 2PTYA 1NELA 2PS2A 1SJBA 1E9IA 3TWBA 1ELSA 1FHUA 1XS2A 3RO6A 3QPEA 3MSYA
chains in the Genus database with same CATH superfamily
3HJZA 5M1TA 3HG4A 1W5PA 2WM1A 4FK9A 5A95A 1XLMA 1VBHA 2DSZA 3GRSA 4GA8A 3UESA 3MI2A 3WO8A 1YXYA 3DECA 4MGGA 3CBWA 4WSHA 4ENLA 3ORWA 3NXFA 1KN0A 1W3JA 2FGBA 2QS8A 1DVJA 3M1ZA 1JPHA 4RKAA 3A7UA 3CGEA 1NTHA 4JTEA 4S3GA 4YHGA 2A3EA 1ZGDA 4I9AA 4Q4RA 3O0FA 5A3HA 3VIGA 1JI1A 5DXYA 4XIAA 4IP5A 4IIHA 4HK5A 2XN0A 3G2GA 1N82A 5DO8A 2X16A 1BQGA 3KBJA 4PEKA 4WJEA 4AY8A 3N17A 5CSRA 2ZX7A 4DXVA 3LBMA 3W1QA 3TKFA 1M6JA 3GXTA 3FA3A 3PZQA 9XIAA 2W55A 2J77A 5EMKA 4MVAA 5FL0A 3FGCB 1H1NA 4J1OA 1GNXA 4H4UA 1WV2A 4E8CA 3DIPA 2P53A 1VB9A 2ZRWA 1LP6A 1HKVA 1VIZA 1MSSA 1RBOB 1H6VA 3GXPA 3SCUA 4BQ2A 3TJ4A 4D6GA 1VRDA 4ZOEA 2BZNA 1QBBA 4X61A 2CZEA 3RM4A 1S38A 2PRHA 3NVWB 3S1VA 1OCBA 1VPXA 5MHBA 1TZ7A 3CAVA 4W93A 1S2CA 1AG1O 3V1HA 3TH6A 5C8BB 1RXOB 3AM9A 4H8HA 3M64A 3RCYA 2IQ0A 2W61A 3H21A 1TRDA 3VDGA 1TREA 3GTNA 2YL8A 4ACYA 1QNRA 3FLUA 4FOKA 2A7RA 4JBRA 1KD0A 1WCGA 2QF7A 3QHMA 1FVPA 4LRTA 3NQCA 3WMLA 4K38A 2NQ9A 2GJXA 3BZJA 5BXSA 1CNVA 3S2JA 5A2AA 4NXKA 1ALDA 2W0UA 3GVRA 1LCOA 2TAAA 4G8TA 1E4MM 4NAFA 3TTQA 1CX9A 2EHHA 2V6AA 4NZ1A 2C3ZA 3J7HA 1GYNA 4WKFA 3D9XA 4XTDA 3O1NA 1XISA 4W84A 1YTDA 3VGDA 3MJMA 4XZ9A 3UXDA 1OJXA 1XRFA 4DWSB 2XH4A 1ONRA 4M6UA 1V6WA 5LA0A 3PNUA 3BLKA 4JTRA 4KEVA 3GVQA 3WNLA 4N4PA 5CAKA 1W1YA 2HMCA 3QXBA 1JDCA 3M0YA 4TOQA 1JDEA 1XBXA 1CGWA 2ZA3A 3W71A 4LUTB 3URBA 5K9DA 4IFRA 1P6CA 2E25A 3D47A 4GC3A 4XUYA 3RILA 4MKSA 2VM8A 3WKZA 1TSIA 3W88A 1E0WA 4H2HA 1MWOA 1EX1A 4IG2B 1HP5A 2EQDA 1FCQA 4UMCA 3KDOA 2W67A 2PDUA 3V3WA 3HV8A 4XTIA 3NTYA 4E3TA 1GUVA 1DEDA 2DQWA 2Z6IA 1VJIA 4AYSA 4F9DA 2EBNA 2FLIA 4PMNA 2D2JA 3L67A 4GE8A 3KVMA 3P82A 5K4XA 3H22A 2Y7GA 3F03K 1W2PA 2FFCA 3W7PA 4P7LA 4A3QA 4MFDA 4LBSA 4UZSA 4ZZ9A 3ABXA 3TLQA 3P61A 2XM2A 2F84A 3DERA 2BHUA 1UWTA 3LX9A 3WD2A 3CMFA 1TJRA 3L21A 1QCWA 3UG8A 2XIQA 1XKJA 1WXYA 2C0AA 1S5VA 3TCEA 3WMSA 2ZIDA 2VEFA 1KM4A 4BK9A 3PZUA 1YNPA 4X2PA 3BSMA 1YHTA 4GRTA 3R94A 4ZOCA 4M8UA 4DO4A 3AMLA 3L0KA 2J9ZA 4A2RA 3RX3A 3HZ3A 2GK1B 4D2JA 5DX7A 3QZAA 1UP3A 4AX6A 1OADA 4RUBA 1EWEA 2C3DA 3EB2A 1ZP3A 5DMMA 3LHTA 3VKDA 4M1RA 8RUCA 2W6RA 3LM7A 4IGSA 3UY7A 3CL8A 3T09A 4C6OA 4JL2A 3ENLA 5C70A 3EEGA 4C6DA 3W2MA 5BNKA 2VEKA 2WOQA 2WC7A 4HN8A 4R34A 3KCLA 1QNQA 4B91A 3TTEA 3C3NA 2X41A 1RALA 3HMJG 4S2BA 4KBXA 1V03A 3WQVA 4IIEA 4JD4A 3BLFA 1IXPA 1XG4A 3VNIA 4Z1CA 2RUSA 3TNBA 2NUYA 4L61A 2OZ8A 5C5YA 1BZLA 1YQ2A 3MV01 4WCJA 2TODA 3HG2A 2AKZA 2OR2A 2E1DA 5JUVA 3EMZA 5I23A 1HX0A 3ZR4A 4GUHA 1NAL1 3N25A 1BTMA 3EB4A 2CKSA 1JAKA 3CH0A 5JBDA 4C7DA 4GMEA 4H6QA 4MB1A 5G5GB 1BRLA 4HA3A 4MAVA 3WLIA 1AK5A 3RRXA 5LSMA 3HQ1A 1J5TA 1DTUA 4ZQNA 1J79A 5DCBA 4DNHA 2V3BA 3CB3A 1PAMA 4UNLA 3PZGA 1GVFA 3T1GA 1I1WA 3C5QA 2QCGA 2VEIA 1DXFA 2NVKX 4I9TA 3RF9A 2IPGA 4NZCA 4OE7A 1E6ZA 4HCDA 3NM3A 1LBLA 1TA3A 2Q8LA 2H8XA 2Y4SA 1X6UA 1R3VA 3QW4B 4C6EA 1ZBCA 1VHCA 1H41A 2R94A 4H9UA 2HROA 3SN1A 1BEUA 3TIMA 1UA7A 1QW9A 1IR1A 5FSEC 1G01A 5CZTA 3XISA 3GDTA 2XVLA 4AWEA 2HQMA 2J8FA 7A3HA 3E2QA 3PTMA 4LANA 1UWUA 1WZMA 1UKOA 1LOLA 1HGWA 1R9YA 2ZOXA 3P8JA 5H2ZA 2JKEA 4UOQA 3O07A 5JU6A 4MYXA 4F40A 1DE5A 1DQWA 2XISA 4KF1A 1K3UA 3GD3A 3A9BA 1ZBVA 4TR9A 2C6QA 4HZ6A 4Z0JA 2E6YA 4H4TA 2QDGA 3LENA 3W81A 3PP7A 3BGJA 1XIGA 1O7AA 3RCMA 2DH3A 3SFWA 3DU0A 3QW3A 2E8YA 3NO1A 3OZOA 4WY0B 3AIVA 3K4DA 3M41A 4PR4A 4D8AA 4BS0A 4NILA 1EGVA 3MP4A 3P93A 3OIXA 3B9NA 3B4UA 4LVBA 1JZ7A 5FEXA 4GJJA 4TVUA 3DK9A 4MF4A 1JUBA 3A3XA 3M0KA 1V93A 1NP2A 1Q4WA 1OINA 3TK7A 3WH6A 1LBFA 3NO5A 3BLDA 2WLYA 3NWRA 4JFVA 5GNYA 5K3VA 2PEVA 1P43A 3KLJA 2OKOA 3NDYA 2ISDA 4XAFA 2RHGA 3EGJA 3N2OA 2OGJA 4LUJA 3WIJA 1Q8JA 1OFAA 2IQDA 1OYCA 5EMMA 5FAGA 2VRQA 5AY7A 4QLLA 1HL9A 4L65A 1T7LA 3C2OA 4KEMA 1JD9A 4UNKA 3WLHA 4HGXA 5ABFB 3Q37A 4H4XA 3P62A 4J3WA 4LEFA 5HR6A 1RJPA 3PBMA 3QVQA 1NWTA 6TAAA 2PRMA 4MUPA 2DP3A 2GJRA 3SIMA 2DUZA 4FXRA 3UWVA 5IDZA 1GXFA 3KWXA 2JEQA 3W70A 3F2CA 3URHA 5LIXX 3G0SA 3W4RA 1W3HA 3L4VA 4ZXLA 1LBMA 4FAMA 4DXKA 3QYQA 1Y7VA 1BVZA 4Q33A 3C2VA 2AMGA 5I09A 3P74A 1MNZA 2YCLB 5FSDC 3FYOA 1EUNA 3BLLA 5I06A 1X8CA 1AQ0A 4MWAB 4W9TA 1UOKA 1IEQA 5GNZA 1LF1A 3I7QA 1W32A 3W73A 5H6HA 3VUSA 1GZJA 5BWFA 1FCBA 4RDZA 1XSKA 1XC6A 4K68A 1MUCA 3SEPA 1KCXA 4GHRA 4QEHA 1QHOA 3OC4A 3IGUA 4HPXA 3T0BA 2NVDA 4DJDA 1NWUA 5AYZA 2QGHA 1AD1A 4O0ZA 3SQMA 3LTYA 1CI1A 3MP5A 1R9XA 5FA5A 1EH9A 1C8YA 2ICSA 4JN7A 1RBAA 1QWGA 3ZJ8A 3SW6A 1WOAA 1XH2A 2C0HA 5U25A 3LQGA 4DPPA 4H4IA 1E55A 2DVUA 1E73M 3W7RA 4LB3A 3ZWSA 1BWKA 1GQKA 1VYRA 1X1NA 2PBGA 1ME7A 2ZUMA 4QSFA 1IYXA 5XINA 2OQHA 3HJEA 1AMYA 1OX4B 1XANA 4BF7A 4M29A 1X7FA 2VCCA 3T44A 5HMEA 1PX3A 5HQMA 2ZDSA 5EBAA 1CLXA 3ZT6A 4FLRA 3E5BA 1UYQA 5J5RA 1DJQA 4PFHA 4UTTA 1VQTA 3HQNA 3PSVA 3CPGA 3KL3A 3SUTA 1PXGA 2WBAA 4WJXA 2DT1A 1UWRA 5EKYA 4CQ9A 5JCLA 4UTJA 1ZAHA 3TXZA 1FBAA 1Z89A 1XSJA 4N9EA 2A3LA 4XISA 2BCPA 3BH4A 2HTMA 3BARA 5FD0A 4AHQA 4IIFA 4WKHA 4CNTA 3B9EA 1EDTA 4DVOA 3PPHA 3V7PA 3TYZA 1ZMCA 3G1RA 4PRWA 1WXZA 4QM1A 3B8DA 3QFAA 1TPH1 4NSBA 1XRSA 5AHIA 5D04C 3WQGA 2QCDA 3DG7A 2JGQA 1Q6GA 3O06A 1EJXC 4EF8A 3CIXA 2WBGA 3CZJA 3W1UA 4MDOA 2WKJA 2P8BA 1UMYA 1VHNA 3ZMRA 4NHVA 3V4BA 1C93A 2WPGA 5A2BA 3F5KA 2NQHA 1KM0A 5G2IA 3AJXA 2Q02A 4M24A 3W7OA 1B2YA 4LV4A 4HHPA 1YDOA 1Z69A 3QZEA 3O16A 4YCPA 2Y89A 3NURA 2XIJA 1S1PA 4LEQA 2WCAA 1H2JA 1H5VA 4C6LA 2PLJA 2NLIA 3NR0A 4H04A 2VVNA 3ATZA 1GRBA 3S0CA 3T0CA 8XIAA 4MHBA 4NNAA 5CC3A 2RGMA 3EKLA 4O52A 4AZCB 4DJFA 1Y5WA 4C90A 3NZRA 3NVTA 3N2TA 1OFQA 2GQ3A 2YA1A 1TWZA 4G1NA 4HU0A 3KL5A 4MB3A 2G37A 1ZJBA 1ZY8A 5KZ6A 4F8XA 4RE4A 4JHMA 5E0KA 4YMZA 4NYUA 2BP1A 4ADSA 4X9SA 1W54A 4GIEA 3II1A 4GQRA 5JVLA 2ISSA 3EOLA 2AGKA 3UXKA 2GRTA 2IPWA 4WDWA 3E6EA 3ZM8A 3H2OA 4K37A 3GXFA 2WPEA 1WZKA 2E3TA 4DBSA 2FH8A 2RDXA 1J18A 1KQZA 2QCFA 5E0FA 3AMDA 3M7WA 4LGXA 3A5VA 3CHEA 4TX6A 3HURA 1FHUA 4BR1A 3GS6A 1MI3A 3MBDA 4HJWA 3F4NA 4DUOA 2DEPA 3TW9A 2OYMA 1L0PA 1T8XA 3NQ6A 4EMJA 2Z6JA 4DWSC 4LC6A 1V0NA 3L4TA 4IPIA 2VP8A 1UZ4A 1V6YA 4XAPA 3UG3A 4YNGA 5IM51 1H4PA 3RITA 4BKNA 2BXYA 2O9RA 2WVVA 3AO0A 1A5BA 3TR9A 3LCXA 3S5NA 4WOZA 1B1YA 3A9IA 1HF6A 3GTFA 4ALDA 2IMRA 3VXGA 4O16A 3VX0A 1TJ2A 4H01A 5A2CA 2HNHA 3LCGA 2PMQA 5DEZA 1JROA 4EXQA 4GD0A 2PB1A 4B92A 1RJQA 3JS3A 5LA2A 3ZVIA 2DT3A 3WZ0E 4HZMA 2QXWA 4IGHA 4JL1A 3OODA 4W8AA 3BAJA 3PZVA 3NOYA 5CLWA 4G56A 1NIUA 1E5NA 1UP0A 1P0KA 2WANA 4B5TA 4OFCA 5F2IA 3UCDA 3VE9A 2OELA 1FWBC 2CHNA 3TZFA 5CCZA 3PZIA 2F7FA 4FA3A 4OUEA 1SZEA 2REQA 4BZYA 1FWCC 3BC9A 4XAZA 1TTPA 4YTRA 4JIEA 3WLLA 4AY1A 4DAIA 3URQA 4W7WA 3D46A 1E4NA 1O5QA 1UP2A 3E49A 3R13A 5AVHA 4J3ZA 1ZY9A 2IKHA 1I9CB 1T99A 4CEUC 1NP0A 2WPFA 1Z48A 3ALFA 3QN3A 1M9HA 3ABRA 4ERAA 1W9UA 2CESA 5I3DA 2VELA 2XVKA 4M0XA 3IEBA 3UCQA 3MS8A 5H1WA 4ICCX 3PUDA 3ARRA 1E9LA 2ZA2A 2UZ9A 3TJIA 2JGYA 4RR4A 3C8FA 1GEHA 3T8QA 2YDAA 1N8WA 2DJXA 4US5D 4BEUA 3L4ZA 1LL4A 4HCLA 2KAUC 1JRCA 3AMZA 3KHJA 1W1B1 3UFYA 3MTWA 3M5VA 4Y8FA 3TYCA 1JZ4A 4P61A 3KBNA 1BYDA 2UY3A 1F6YA 2QMJA 3Q45A 1AW1A 3W7KA 4ZE5A 4ZSUA 4J5NA 3MVTA 4EMWA 4QXIA 3GKFA 3CS2A 2YQUA 1IQ8A 1CXHA 2CEQA 3LPOA 4CCZA 4H19A 3MMTA 3GNRA 1US0A 3BICA 5HULA 3MMUA 3V1PA 5I03A 4ONVA 3M6DA 3OHMB 2CDUA 5A8MA 2YOCA 4KS0A 1BPLB 2OTDA 1SR9A 3VGBA 2Z26A 4B9YA 1J0JA 2V69A 1JPIA 4HNOA 1FEBA 1A5KC 3PJWA 2ISWA 1CXFA 1ZRQA 2Y7DA 2PTDA 3EWYA 4DLMA 1C9DA 4Q6JA 4LTSA 2Z4GA 5CZJA 1PJ9A 4ATWA 2NWSA 4AY7A 2OODA 2QYGA 2Z1XA 1OHLA 3L2LA 1AZ1A 3CHCA 5BMXA 3A4JA 3AS3A 5KSWA 4K8EA 2FTYA 3MPGA 2PTZA 2ZDRA 5FEZA 1WZLA 1JL8A 3AHXA 4JYDA 4WF7A 2PDYA 3LLXA 1XYFA 3WNPA 1CW2A 1VBGA 1YPXA 1GGOA 1JYWA 1NM9A 1OT1A 2G3MA 3WDPP 4QAIA 3LN3A 1SO6A 3TTYA 1RJRA 4IF2A 5C2XA 1PZ3A 2NVAA 2V3AA 1C92A 5DELA 1Q6LA 3WK2A 4UTFA 1JQVA 4HIBA 1EKOA 1QR7A 1C3FA 2XYLA 1MRAA 2F8QA 4U5IA 1OZMA 1J2BA 3PK7A 2OZTA 2GDQA 3NVZB 1NF0A 1VJZA 5H8MA 4H4WA 3HN3A 2O92A 2EG8A 5BROA 2WB5A 3ZLGA 5IXEA 2E5AA 3T42A 3G18A 1QI5A 3TTSA 1RPKA 5E70A 3O0HA 2VR4A 1YTEA 4AD4A 1YE6A 2B7NA 5FJRA 1KM6A 1RBLA 2B7OA 4O28A 3U2ZA 4EF9A 4ES4A 1S2VA 4MY9A 1R9ZA 2PTXA 5FF0A 2INFA 1LWIA 1G4PA 1X2GA 3RN6A 2QUNA 4PB4A 5HPOA 1OY0A 1M7PA 4IUGA 3JU2A 5M5DA 3EKGA 3UWZA 3PANA 2VMFA 1W1VA 3N15A 3WEZA 4TMBA 3B06A 1E43A 1BSLA 3CXOA 2CBUA 2DZAA 3VC5A 1SW0A 3APGA 3CL7A 3KZPA 3R8HA 2V2DA 4XG1A 2WC4A 3DDMA 3NZPA 5F2MA 4A8LA 3UG5A 3R0UA 4RL3A 3IJQA 1E6PA 1CXLA 1JYVA 1H5YA 4MZ8A 1QNPA 5KINA 2GJXB 3BXWA 3NPUA 3USZA 5KZMA 1N60C 1PCWA 3TXVA 4EM4A 1B3WA 2GL5A 3P0WA 4W7VA 2ZZ5A 2VC6A 4ZQPA 3R11A 4PN2A 1UWSA 4UC5A 2OXNA 4URIA 2E0PA 1QNSA 3N11A 4L9ZA 4ZBCA 4XZLX 3E12A 2CLIA 3GAYA 3IANA 2BVWA 4W88A 2BGNE 1HVQA 2YBTA 3REQA 1SJBA 1OG6A 1BGAA 4IIDA 3W3OA 3KZSA 1J11A 1XFBA 1XW8A 1TYPA 5HNRA 2IKIA 4GYJA 3BL3A 1MXGA 1EJTC 5U7SA 2WOIA 2GDUA 3BGGA 1RY8A 4YXGA 2O9OA 4U10A 2WJEA 4CQBA 4MWAC 2CXGA 1P6BA 5AN7A 4HNCA 3R58A 2J66A 2TYSA 2X1RA 1L6WA 2Z2UA 4CN1A 1VFUA 2QEZA 4H9XA 5HWNA 1H11A 3QQ0A 3CIVA 4PTNA 3EX2A 2D22A 3TNOA 4EQSA 4B2DD 1KR1A 4R7OA 1O6IA 1VPYA 2TMDA 2C1GA 4JDYA 4A8IA 2EPOA 3HQOA 3GK0A 4X63A 3W76A 1HO1A 3UA4A 1XIHA 2QJNA 3E2SA 2YIHA 3RR1A 2C3CA 3PJUA 4I90A 2JKAA 3MY9A 3F2BA 1JRBA 4JTUA 4IX0A 3WLTA 4NJHA 1JI2A 1V6VA 3N6QA 1NU5A 4QDMA 2Z1KA 2W9MA 5FJUA 4QISA 2OZ0A 4ASTA 3SQLA 1GVOA 5A6KA 3R8RA 4DM1A 3CQ0A 1D3CA 3KBVA 5REQA 3FOKA 3N13A 4PL1A 4XVDA 1VBRA 5J04A 4Q4PA 3V36A 4L4OA 5BZAA 2D69A 2NQLA 2DSKA 5AHEA 3LTPA 1JYNA 4ZVJA 3OBEA 3L68A 1J4EA 4U5KA 5D9OA 3WX7A 4YS1A 4MUZA 4RLIA 1TPWA 4LA1A 4ZQRA 1V02E 4RPPA 1VFLA 5I3IA 4CU6A 3DHPA 1AUSL 2E3ZA 3S2CA 2PI6A 1WAUA 1K9TA 4I8YA 5A6AA 4JTGA 2BY1A 1O68A 1CXIA 4ADUA 2PODA 1PX4A 4AIBA 4ZQCA 2PDLA 3OZMA 4GXMA 2XGIA 2YL9A 2X2GA 1OGSA 3S2LA 4M51A 4UQAA 1QFEA 4JIIX 3OB8A 2DJLA 2QT3A 3SSJA 4XZWA 3LZ5A 1XSIA 1IGSA 4D9PA 4DQWA 5HQLA 2DZWA 1GQIA 2ZZ0A 1Q8AA 5EA9A 1PTGA 1LVLA 2AL2A 4DWSD 3GNNA 4D6CA 3CV2A 5BOOA 2VUNA 1JFXA 2Z25A 4AZHA 1EQCA 4ACZA 5D2TA 2QAFA 3DJJA 1Q63A 2CC0A 1JNEA 3IJIA 1KV5A 4I5XA 4J57A 3FA5A 1YYAA 4IFKB 1GJWA 3B3DA 3BOFA 3HO8A 5CG0A 4IIBA 1GG0A 3VZYA 1UZ1A 4S3JA 3UETA 3QMSA 4LY4A 3GNPA 4H3DA 2YFOA 4B5NA 2I9UA 4DY1A 3H6OA 4LW7A 1EJWC 4S3AA 2ZUNA 3OLIA 1FH8A 3VIOA 4O15A 1AODA 3PR2A 1TJ1A 3CV7A 3BLPX 1B4EA 3L23A 4AZ7A 1OX6A 1Q1RA 3NDOA 3ARXA 3VNZA 6CGTA 4KWVA 3UW6A 4ZA0A 4UTLA 3W7GA 2PP3A 2J75A 1UR2A 4UFLA 4APNA 3COTA 1A5SA 1E9ZB 1XDLA 2ZX5A 3PSWA 3WJYA 3AMKA 3MCNA 3IUIA 2PC4A 1VFSA 5AC8A 4A6GA 4B16A 1VPQA 4PUUA 3T0TA 2EPHA 1CECA 1K9EA 1U5VA 3GC4A 3PPFA 4JS3A 1K9FA 1EC8A 2XDFA 3L5LA 1LM1A 3FSUA 4RNJA 4DYKA 3SY1A 3HW2A 4JQAA 1BFNA 3F4WA 3QMTA 4GVHA 4K1WA 5IFPA 1BHGA 1QPKA 2D3NA 4P8WA 2HE8A 3PUGA 3S46A 1P0DA 4GISA 1VEOA 2OO6A 2XH0A 4WY0F 4PUMA 4MKNA 2H90A 4WQ6A 4WD0A 2VZVA 3D3FA 3QGAC 4J28A 3AUOA 1A3XA 1DE6A 1YEYA 1BLIA 4MPQA 4ROQA 3W1XA 3VNJA 3DH9A 3WQ4A 3MMWA 2OEMA 3AS0A 3T40A 2DH2A 2ZZ3A 3CPRA 5DN1A 3PF3A 2HRWA 3NQDA 4NAEA 4C6QA 1SM9A 1VEMA 3MHUA 2J7BA 1STZA 3MUY1 4R88A 1I0BA 4F0KA 2GVJA 3FCPA 2FGZA 5HNNA 3VOHA 1OFBA 1V97A 4AFYA 1ICPA 3STEA 1MRQA 1HL2A 3FA4A 4ECLA 3MKKA 2F6KA 3SQSA 4JDRA 4DB7A 5T9BG 2VQTA 1Q66A 1ZCCA 3C2EA 2G8ZA 1E4IA 1EO7A 2ZZ2A 3W1TA 2G96A 4U2ZA 1C91A 4LSBA 3TMLA 1O1HA 1RZMA 1H7NA 3WJWA 3CUZA 3GDBA 3UGVA 1U1HA 3N3TA 2VGBA 4MWAE 3ARZA 2CFFA 3VKCA 2W3SA 3EOOA 1FCVA 1DIEA 4GO8A 1IIGA 4JQ9A 3VMNA 1B5TA 4AD2A 1QPQA 2FMNA 2I1OA 4XSLA 1POKA 4W7UA 2GVYA 2IKGA 2EEXA 4QG9A 4LXFA 2TRSA 3BURA 2V2CA 5IBXC 4PUDA 4FX7A 4S2CA 3UGRA 4KETA 5IHSA 2EAWA 6ALDA 2XIBA 3R0DA 2XFFA 3DGRA 3N9SA 4L64A 1UJQA 2W66A 1AQHA 2FQIA 1DIDA 1ZENA 3AHZA 4QCEA 2CERA 1H7XA 4PMXA 5IDIA 3TA6A 1KRCC 3B04A 3WQPA 3NG3A 4Y9NA 3T2QA 4EM3A 4N9DA 3P5YA 2Y88A 3W2NA 1RCOB 4KWSA 1ZZMA 4FNTA 2BXVA 2PDQA 4O11A 2FTWA 3CUGA 3N73A 4ZO8A 1KWKA 2ACSA 3M0IA 2BBFA 2O56A 4K39A 2WMGA 2DZBA 5IRPA 1GK8A 4H6RA 4B4HA 4IQLA 3CASA 3NVYB 2HDJA 2PGWA 1KGWA 3KOXA 4W89A 4G7EA 4B5UA 1IHIA 1RK5A 3MMDA 4XO6A 3TYDA 3LXCA 3EMQA 1BWCA 1Q6CA 3AUJA 5I3JA 3OYZA 1W91A 3P8IA 4YPJA 2A7PA 2QVHA 1HIZA 1SO3A 1J0ZA 3THAA 4GJ1A 4D1IA 2NSXA 5BXRA 4LAMA 5EFFA 2JE8A 2XU2A 2QCHA 3H4WA 1OC6A 1E1CA 2YPIA 4FOJA 3ZXWA 2QKFA 3G3MA 4BQ5A 3MSRA 4M5PA 4O13A 3MBFA 3QYSA 2ZRYA 4AEEA 3DK8A 2AGTA 3SADA 2QCDB 3VU2A 3GD4A 3WH8A 1E70M 3BVJA 4WDUA 5HR7A 1UPPA 4AZGA 4GXWA 2DPEA 3G1SA 2XZ9A 5D30A 3L8KA 4MZYA 4P8UA 5I02A 5KITA 5F1UA 1WAWA 5HINA 4E2OA 3UWUA 4KRZA 4PCPA 2PWDA 1XPYA 5D2VA 1EX5A 2WHLA 2BV9A 2PDMA 3UZXA 1H7OA 5AECA 2X50A 1FO4A 4M80A 4UTUA 4KCVA 4HYVA 1D7FA 4Q6XA 4IISA 1SZFA 1UUOA 2YLLA 5CJMA 4FLSA 5DMYA 4IWWA 2CLFA 5LKYA 1GPWA 4Z2GA 3E0VA 1CXEA 3QLDA 1CGXA 1DL3A 5GQBA 5LNVA 5CPLA 2ANUA 4RNFA 3TEVA 1O95A 3G1XA 3HIJA 3LHWA 2WOVA 3DFQA 1EOMA 1VS1A 2YXOA 4JX6A 2JIEA 2POZA 4B3KA 5I00A 4Y9MA 3WQWA 1ITQA 1LUCA 2VFEA 1XIDA 4W5ZA 4L1XA 1G4EA 4ZSTA 3UQNA 2QCCA 1XUUA 2X1IA 5HNUA 2FHFA 1JYXA 5CQ1A 3HPFA 1OFDA 3CTLA 5TQLA 3W7DA 3W02A 1HL8A 2CLMA 4M6PA 2J27A 4HJFA 3LXBA 1CXKA 2ON3A 2G3IA 2E9LA 4RX0A 5C7VA 3W26A 2WVVB 3VCRA 4MLRA 1MYRA 3CAKA 2Y61A 4XAGA 5HJXA 3PG8A 1Q85A 4L5ZA 3AN1A 3BK0A 3CYJA 2V67A 3JZEA 3WNMA 2XSAA 5XIMA 4RXGA 1OFEA 1SSDA 3GG7A 3LRMA 3MWAA 3A7AA 3NJ3A 1Q6OA 3AIWA 4YWSA 8A3HA 4BEQA 4F9JA 1C9WA 3BPWA 5JBFA 4WHBA 3SCPA 2A4AA 2ZX6A 4JIQA 5CJ5A 3QHOA 3UWYA 3PBVA 3UVIA 3QKZA 2XSBA 4PUKA 3EYPA 3S9IA 1OD8A 1XL9A 3GNXA 1PVNA 2MNRA 2DDXA 1V3JA 3EMCA 1H1ZA 2REQB 3A3WA 2ZE0A 4IT1A 4PA8A 4POCA 4DNMA 3FXGA 2WWDA 1ZJHA 5DY2A 3PAJA 2A5HA 3LCHA 3FNDA 3S3GA 3FEQA 2R1KA 2GK1A 1R38A 1SB3B 3TCSA 1YDVA 3UZJA 2R8WA 3KOWA 5EL1A 3EEZA 3UZWA 3S9YA 2WO5A 3MUIA 1EZ2A 1A4MA 2YX0A 4JNYA 3KVKA 4HMEA 5D03A 1XIEA 2B7PA 3TC7A 3SR7A 3S6TA 3LEPA 2Y24A 1VR6A 4KCWA 2ZZ4A 4YN5A 4JTAA 2YB1A 4MDPA 3WD3A 2WZMA 3O6DA 3UR7A 1T41A 3KTCA 2SFPA 2QCEA 3EDFA 3BLIA 3OVQA 1M65A 3IUHA 1R6WA 2C1HA 4GI6A 1XICA 3E9AA 4ZOHB 4F0HA 2X1UA 1N61C 1VFMA 3OIHA 3PB2A 2VI0A 4PBGA 4ZTYA 2ZRXA 5KEZA 1TWIA 3TZNA 4TVYA 2TPRA 1AL8A 4L9YA 4RDVA 4HPJA 3DN5A 4L6OA 1XC4A 1ADOA 5L6UA 3TW6A 1ONFA 1PTDA 2ZVRA 3UU0A 3IUDA 2G4JA 1OFPA 4UBPC 3UJEA 1E0VA 4ICNA 3MKVA 1FDJA 1KBIA 4HHMA 3PBWA 1EJUC 2DVTA 2A3HA 1UH4A 4NX5A 5JIPA 3GZ3A 3EA1A 4H4PA 3A47A 4LCQA 2A21A 2IQTA 2WSPA 5AHLA 3D5HA 1KFEA 3H7VA 2HPIA 1LORA 3H2MA 1V51A 3DCPA 1MQRA 4Q8QA 4HA0A 3HBLA 1JNDA 2YCIX 3ARSA 1T0OA 4HMCA 4ZQOA 2WP6A 1F74A 1WBHA 2YVGA 3O15A 1CCWB 3DFSA 3EAUA 4YWIA 4F2UA 1XRVA 2YSWA 4FF5A 5EY5A 4AWSA 4IUOA 2Z0IA 3DGBA 2W92A 3VUPA 2PDPA 2NT0A 3T78A 3FJ4A 3QRHA 3RCNA 4GGHA 3CHVA 5DMNA 4IPLA 1NVMA 1UKPA 4GK8A 2QNEA 4NG3A 4H83A 3KCJA 3AU6A 5LNRA 3FX4A 1Z3NA 2RKXA 3S2NA 2ZRUA 3SR6B 2Z29A 1XG3A 3PZTA 3WJZA 1K6WA 2QAEA 2ZC1A 1IXQA 3R79A 5ER0A 4J40A 1TG7A 3W7IA 3NSNA 1LL6A 3AICA 2DV0A 3HTWA 1PKNA 1MO0A 1QBAA 4X3ZA 1JZ2A 5BU6A 3GUGA 4HYWA 1IZKA 3SN0A 2XJ7A 3EXTA 3HQPA 3JUGA 1LT8A 1W3KA 3SUVA 2HK0A 1KBJA 3RLVA 1XR2A 3QY6A 3W74A 1FRBA 1HKJA 1ZS2A 3PM6A 3MT1A 1UUMA 3BSHA 1MZRA 1TRIA 1Q6DA 4D6HA 3G6MA 3ISIX 3H4GA 5FIPA 1FWGC 1G7VA 4JTLA 1E6XM 1TPDA 1SPQA 3WQEA 2GUYA 4AW7A 2J3NA 4GI8A 4YVPA 2E6FA 4TXEA 1FIQB 3BCJA 1A5AA 1XBZA 3IPWA 3K4AA 1V6UA 1GHSA 2A3BA 5AYYA 3PY2A 5DRCA 2GSEA 3GE7A 3M7SA 1VF8A 1RVGA 3EDJA 3IV8A 1XF0A 3KRBA 4LT9A 4WDXA 2OQYA 5D2YA 1HGYA 3UYIA 4KPRA 1O12A 3O7UA 4EX4A 1S5WA 1OCNA 4AYGA 3OP2A 4EAYA 4DO7A 3MUAA 4GVGA 1EOKA 5A6SA 1ZPTA 2X05A 7ODCA 1E6QM 4J7RA 1ML1A 1DWFM 4Z2IA 1SZGA 3QTPA 3EWWA 5J8LA 1SQ7A 2DIJA 5D9MA 3ZWTA 5BRBA 1LLZA 1BF2A 1RK6A 1HKKA 3OEXA 4AMAA 4M52A 4BURA 4ZOAA 2DZXA 1XH0A 3G0XA 1TQJA 3GXIA 2YKKA 4JTHA 3PZ9A 4I6VA 4PSPA 1PKLA 4ZOBA 3LA4A 2NX3A 3NQGA 4XZIA 2WMIA 5EBKA 3BOXA 5JH1A 1AW5A 1ZJIA 4WR3A 3AHVA 4DO6A 3CWHA 1WDQA 1B3YA 4PRRA 2B7QA 4PTDA 4GYKA 3CUHA 2PZ0A 4EKJA 1L6FA 4MWAA 4C6BA 3V35A 3Q94A 1CB7B 1Z7AA 1IWBA 5D05A 2OZ3A 3POHA 1O66A 1JPKA 3DZ1A 3REQB 3VCCA 4GOAA 3QOMA 4NJJA 3GLCA 1HKIA 2YLAA 1DYSA 4UFJA 3LI0A 2OVLA 1YPFA 2OGYA 5E6ZA 2EQ7A 3RLGA 3T2PA 3MHFA 1R2TA 4XD5A 1TCDA 2MANA 4EOUA 1UD5A 4XAYA 3EF6A 4J3UA 1K8ZA 3WNOA 4AC7C 1XRTA 1FA2A 4J4KA 3NQBA 1GOXA 2HBVA 3HA1A 1GG1A 1UJPA 1V0KA 3LBCA 3EXRA 3QR0A 3GIYA 1BSIA 4XK2A 3Q4DA 4IGMA 1LPFA 1OX4A 4XBJA 3THDA 2P5NA 4D1JA 4N02A 1BGGA 3VIMA 4DJDC 5CSYA 4CD5A 3AIEA 3UZ5A 4FZIA 4HU8A 4LCSA 1WQ5A 2YL6A 2PU0A 1H7WA 4DBWA 1EDGA 4G5DA 4GKLA 3DXIA 3E2RA 3VABA 3UR5A 4WZHA 3W2JA 2YCEA 4I5RA 1UW9A 3AXKA 1KGXA 4ZR8A 2J8GA 3RLUA 4UOZA 1B54A 3IIVA 4TTUA 4NJGA 1LWJA 2HZGA 3H53A 2QUMA 2E40A 1DIOA 2EG6A 4FXFA 2XGBA 3A5FA 2VT0A 4NI8A 3BE7A 4YHEA 4YL2A 2PUZA 1GVEA 5REQB 4B15A 3EWDA 1L6SA 1LRTA 1K8CA 3GRIA 1PV8A 2YCJA 3W7QA 3CL6A 4UTTC 7ENLA 2OO0A 3WD4A 4KRTA 3S83A 2G0WA 1YMYA 3GHUA 3CO4A 4IMDA 2ZRVA 1FTXA 4OOZA 1YNYA 3M47A 4DN1A 1QATA 5CBIA 5FI8A 4JX5A 3HB9A 1GOQA 2R1LA 4HZ7A 2GVGA 4A8NA 3DYOA 5DBUA 3W1NA 1MQQA 1OGGA 1KFWA 1TZZA 3ZOAA 1A5UA 4L80A 1VC4A 1S5TA 3G1AA 4IGNA 1HNYA 4P7OA 1OQFA 3QTGA 4Z0SA 4UFIA 3WFLA 3W7CA 4NF7A 3GKAA 3SRFA 1YX1A 2J7DA 3RX2A 4MAZA 4ZFCA 4NY2A 4H7VA 3WLMA 4F0SA 2XM1A 3L5OA 3LSCA 2GSHA 2V9DA 4IX2A 1NDVA 4KESA 2WMKA 2AL2B 4TV5A 2GUUA 1QOQA 2QIIA 1DKWA 3S2MA 4O10A 1VP5A 1ISXA 1GKRA 5LNWA 3SCWA 4ACZB 1THFD 2VURA 1BD0A 3SAZA 4PULA 3I4KA 2D0FA 5CPQA 2EJ1A 3CMJA 4ICMA 2Y5SA 1C7TA 1JG9A 2Q71A 2P1FA 3VO0A 2WCGA 1REQA 3K8KA 5LXEA 1XYMA 4ROPA 3TAKA 5AHNA 7CGTA 1QK2A 4DI9A 4C1LA 4A2SA 3W75A 1I1XA 1EF2A 4Q7BA 2V5LA 4IMEA 3EPNA 5K9XA 3G1FA 2HEJA 4GFSA 1S1RA 3TN3A 2P3EA 3H2NA 3F5JA 2X8CA 3HGSA 1OCJA 4R85A 3MSDA 1NOWA 1ODZA 4OHQA 3M0ZA 4UR8A 4DJFC 4A3HA 3VFCA 1EHNA 4FX8A 1FWEC 3B8WA 1KXHA 3VNKA 1LRQA 3UNTA 4XIMA 3CGCA 3CZEA 1UD3A 2FJKA 4FDCB 4AC1X 1HJQA 4U2YA 1NARA 1XP3A 3B9JB 1JCMP 1NQKA 2GR2A 3KP1A 1TZ9A 4RZ5A 4TVWA 3VDBA 3LZ3A 4XUGA 2D73A 4Y9AA 2GGGA 4C7GA 4CQAA 2F2KA 5EMJA 4FX9A 1KFLA 1W5QA 1PCKA 3W7HA 3U2OA 2PURA 2E5DA 4JIRA 2GGJA 2A3CA 2WSRA 3DKJA 2QUVA 2C7FA 4PGLA 2ZUVA 5CGQA 1W8SA 2PP1A 4UTHA 3ABSA 4I7WA 3UT0A 4PMJA 3AFBA 2QPSA 3I68A 5AC4A 3UZZA 3GQYA 4R7JA 2GJNA 2OOFA 3KBMA 5D9NA 5B80A 1MQPA 1XIFA 4UXDA 2QJJA 2X42A 2G5WA 3CB8A 1TX2A 2VD9A 2R82A 3S8HA 1ISZA 3CUIA 1P6WA 3DI1A 2E4TA 3W38A 3OBAA 4NXSA 1TMLA 1UD6A 3AHTA 4UTWC 4IHCA 1DNCA 4A35A 1QOPA 2DIEA 4EANA 2WP5A 4FXJA 1GVYA 2FVMA 1XLIA 1TUFA 2FHBA 3GG0A 3FDGA 4DJEA 3WFZA 2GGHA 4PUWA 4JQ2A 2ACQA 4QJ4B 2WBKA 2X40A 1CYGA 1TVNA 3GY1A 1XLCA 5EBUA 4OBSA 1NWRA 4GX9A 3PWIA 2IXVA 3PBYA 3QLLA 3P6LA 2X0SA 4IQDA 1ZU8A 1UROA 3QGVA 3EWZA 1KA9F 3HV9A 4M7TA 4WGHA 4Y8EA 4ZTXA 1FWHC 5A8NA 2JK6A 4NAEB 1PHQA 3OHIA 1JXKA 3W29A 1GKQA 3BWWA 1F7BA 5D02A 3WBWA 1IIHA 4KRUA 1PIFA 3KTXA 5DANA 2NSOA 1QI0A 4C6CA 3B8VA 4BQ3A 3R0KA 1S3TC 2PFHA 1M01A 3WBXA 5AOUA 3LDVA 3TDFA 3VZXA 1NPXA 1KLYA 2V3DA 3KOZA 1C7SA 4M82A 3ZLFA 3SY5A 1M03A 1TYTA 4XV0A 2QHAA 3C0QA 4JHZA 5M17A 1KM1A 1F3WA 5JBEA 3KTSA 3AXIA 4JEJA 3L5AA 1TIWA 1TR9A 1OG0A 1KFKA 3OW1A 3RM8A 4EPDC 2BTMA 4PMDA 5LIWX 1WKFA 3N2BA 1JQXA 1TPEA 2OX1A 2J47A 3BG9A 4QTGA 4PCFA 3K30A 2POTA 3H55A 4M19A 1WUFA 3SGZA 2PDKA 4S1FA 3HPSA 2PGFA 3GNOA 3R2GA 1UH3A 1FFVC 1RR2A 2H6RA 3HOJA 2J24A 4GIYA 3GO2A 3DFYA 3ZVHB 6TIMA 2VC5A 4O53A 2NVCA 1EJ7L 2YR1A 4NNBA 2FGLA 1MOKA 1G69A 1NHQA 2GGIA 2CBIA 2G4FA 3KFTA 1I6NA 4JY8A 2W3ZA 1M41A 4IPPA 1AD4A 2R14A 5LIKX 3G8EA 1LZOA 2HJPA 4H8NA 4JDBA 4M81A 1FH9A 1UKQA 2OWWA 5K9CA 3NQ7A 3L2MA 1ECQA 2GVLA 2AQVA 3INPA 3DC0A 3CZLA 1HUVA 2BDQA 3U9IA 5JCNA 3OLEA 3EDEA 3W1LA 1KBBA 4JYEA 1B0IA 5KZEA 1DHPA 2OEJA 3V75A 2C8NA 4G7EB 1QO2A 1J01A 3M5ZA 3T05A 3AIUA 2YXXA 1TPB1 4PMRA 1DJHA 3AIRA 1UD2A 1LLWA 4XVEA 3TQPA 5E0CA 3M6YA 3WDJA 2Y70A 2YBVA 1XXXA 4FEZA 3WJSA 4HBKA 2VEGA 1GRTA 1TWDA 1CLVA 1PIGA 3GZAA 4E2VA 3UA3A 3STCA 1DBTA 1TVLA 4KMQA 1F3PA 2VR5A 4O8RA 1P48A 2VXNA 4E38A 3URAA 1E1CB 4Q7IA 4G1KA 3AJ7A 4J27A 9XIMA 1OFRA 2H9AA 2QR6A 3BLEA 1QUMA 1HJSA 3PTDA 3NPXA 1C90A 4FLOA 4CKQA 3VIKA 3IIPA 3WDHA 2V82A 3RR4A 1VENA 4IH3A 5DBTA 4DF2A 2X0YA 5AC7A 3M44A 4PTVA 1X97A 5HMSA 1JF6A 3M9YA 2V3GA 1S2UA 1LDCA 3CZKA 3ZS4A 4X9YA 4YU1A 1D9EA 5TR3A 2JK2A 4BI5A 4JX4A 1B3VA 2Y7FA 4LC8A 3N2XA 1EA9C 1NWSA 4KT2A 1QHZA 4V2XA 4C60A 4LPCA 1KCZA 5LIYX 3FKKA 4DZHA 3FJNA 5CZKA 2RAGA 4XB3A 1Q7ZA 5CBBA 4HPNA 1NFPA 2X8RA 3N2CA 1RLCL 1P4CA 3GFZA 4F0LA 3I4EA 1EGZA 3PFMA 3AALA 5AKQA 1AZ2A 1K7EA 1GYMA 4IXXA 1E72M 3MSYA 4IMAA 4G2DA 1NDWA 2VX7A 1K03A 3MO7A 3AYTA 1I2PA 2FVLA 4JTFA 1E3ZA 2J88A 1WP6A 4EPEC 5JIWA 5M03A 1GREA 4LUYA 1B9BA 1WYGA 4AQLA 4DJDD 2Y1HA 3GH5A 4Q4SA 1JEHA 3W1MA 1TPUA 4FNUA 4TU1A 3SN4A 3U4FA 3VNDA 2ATMA 3E02A 1P1MA 2WZHA 2VZTA 1OC5A 3GIQA 1LUCB 1JAEA 4NZ5A 3TAOA 5A6BD 4FS9A 3A13A 3NZGA 4RV3A 2XFWA 1M68A 2E9BA 1DJYA 5D37A 4DM2A 4IQJA 2WZTA 2XIMA 1DHKA 3M0XA 1JDDA 5KETA 2VX6A 1MXSA 1Y5VA 4K3ZA 3BDKA 2D0GA 4ERGA 3S1XA 3F4DA 3RG6A 1NDYA 2CZDA 2BG5A 3TR2A 3H12A 1VJSA 1TCMA 2EO7A 3LNMA 3IK2A 1BXBA 3QFBA 2ATSA 3BV4A 1ISVA 1FXQA 3THUA 3VZZA 3HM7A 5HWMA 1JZ3A 2V6OA 3MP3A 2Y0FA 3M0HA 1VD6A 1KXVA 4Q8VA 2J74A 4W8LA 3VM5A 1LQAA 1TV7A 2QUTA 2DW7A 1UHVA 5HUOA 4RK8A 1K7XA 1U5JA 1TV4A 1TPFA 3CYVA 3KM8A 2VZUA 3E38A 4MADA 3RPMA 4N0RA 1FCUA 2ZZ7A 1TPC1 1VEPA 2BC0A 3R10A 1U5HA 5F4WA 1W5MA 2D2GA 3STFA 2Z7KA 4MJ2A 3M07A 3W86A 4L4LA 1ZHAA 3N3MA 3RK8A 1MUWA 2P10A 2VDIA 4EWND 3OJGA 3EANA 4JQ4A 4NI3A 4RJEA 1U83A 4KQNA 4GJIA 3W6YA 2IPFA 3NYZA 3PWGA 2GVEA 4GIRA 3ZQ9A 1A5CA 3S4TA 4IQEA 1NFBA 3NXLA 3LQLA 2RJGA 1HJWA 4QQ3A 1T5AA 4FX6M 4C6IA 3B9DA 4PE8A 2VC9A 2P3ZA 3PBGA 4TX9A 4LYKA 4AUBA 1N5XA 3UR8A 1WDPA 1JCXA 2G3JA 2VKZG 3VMPA 2Q6ZA 4DJFD 1NDZA 3BG5A 3CT2A 4BF5A 3SCSA 2NX9A 1XIBA 3ITLA 2I5GA 1FWIC 3IGXA 1Z9AA 5DCDA 4L6HA 2EQ8A 3I6TA 3BGAA 2HVMA 3GDRA 2PDWA 1VCGA 2E5BA 3AISA 3NQAA 2OSYA 1OEPA 3ARVA 5I78A 1OFOA 5C2GA 4JAWA 3HPXA 1JCNA 2HS6A 2FB3A 2PTWA 1U33A 1K1DA 3VE7A 1DJNA 3LY0A 5HOSA 1X7IA 5EMLA 1XBYA 2FMOA 3BMWA 3NQ8A 3K13A 4PBFA 2QVNA 2WW5A 3E96A 2VGIA 3NVDA 4GQBA 4IFKA 3K8MA 4TIMA 4GCXA 6XIAA 3VYLA 4MJMA 1R30A 1SZRA 1ZKQA 1IWPA 3UD6A 3MB9A 2WC3A 1TX0A 1XDMA 5AB3A 4OBTA 1B31A 3KAOA 3PN8A 1YLVA 1KO0A 1UR9A 1XI3A 1XUZA 2FIQA 6ENLA 4FR1A 3M5YA 3W9ZA 2CYGA 5TF0A 3TJXA 4IOTA 4PB3A 1I2QA 3VK5A 5FS7A 4OT7A 5I77A 2I16A 3OPSA 1V3MA 3A3HA 1UWAA 3GVWA 4Z1BA 4EP8C 1M7XA 3OLGA 3SUUA 3HPAA 4V27A 3SO7A 2UY5A 5JCIA 3SGGA 5CJNA 4MMWA 1F61A 2O0TA 3DOPA 4GYFA 3JW7A 4LUIA 4IMFA 4E4FA 1H1YA 1ICQA 3CTTA 1FDYA 1OX5A 2ZWZA 3RMEA 1CIUA 1O60A 1S2TA 5I79A 4O14A 3WQ5A 2GZXA 1HP4A 1SR0A 4B5SA 2UWFA 2YL5A 2EG7A 2VFDA 3M0VA 3T4CA 3WDQA 3TJLA 3CWOX 1F8MA 1O1ZA 4QIUA 3ITOA 5C71A 1Q7QA 2XN1A 5G4HC 3E0WA 1EDQA 2GFTA 4GLEA 1VZWA 4DZAA 5HA7A 1HXJA 1PWLA 3U7VA 1G9HA 5HAOA 2BS9A 4N6EA 3VPLA 3G1YA 1KFBA 3QKEA 3EDKA 5F4XA 5G5IA 3ZSTA 1AH4A 3CUFA 2FDMA 1J0YA 1G1YA 2Z7GA 2OSXA 1JUEA 2W91A 3ZYZA 2B81A 1GV4A 3NFUA 3G1DA 1PZ2A 2J8TA 5BCAA 2W27A 2QMKA 3PJXA 4C6MA 2EGZA 1UWQA 1ONXA 4RPQA 5FKYA 2V68A 1J10A 3R1ZA 2E68A 1MFUA 5BYWA 2FYMA 3BMVA 3T0DA 1KFJA 1UQYA 3W1PA 3GR7A 5H91A 2VZOA 4QE5A 1U1JA 4US6A 3TWBA 4AVNA 3QV7A 3RO6A 4BCEA 4F79A 4B5XA 4GH1A 5DXXA 2J79A 3L0GA 2WMIB 5G4EA 4PMQA 4ZCWA 3TN6A 3T0AA 3ITVA 4QDPA 3KP0A 4M56A 3NSXA 5HJYA 5CH9A 3H2FA 3VDAA 3W87A 3WG6A 3ARPA 4J2MA 2FPVA 1AA1B 3QC3A 3L5MA 2Z00A 2NV1A 5FCZA 2WHKA 3LPPA 4GKTA 1AH3A 3TOYA 3UBPC 3O8AA 3A64A 2CZ5A 4LV9A 3BQ6A 1K77A 1FHDA 1FWFC 4Y2WA 1RQHA 3S5ZA 5TNVA 4CEXC 4F0RA 1ZLPA 4AIEA 3S1WA 1SZNA 3LTSA 3WUGA 3G77A 5A6BA 1WX0A 2GQAA 1V08A 1A0EA 3HU7A 2FZ8A 3THQA 4DYEA 1DXLA 2D0HA 4FNQA 1NQ6A 3CM4A 3F4CA 5I3HA 3R8GA 2Y8KA 3B0PA 4L4PA 2UBPC 1GEUA 3RGTA 3CUXA 4UQEA 3IGHX 1JULA 2H8ZA 1XIIA 3UXAA 4A29A 1FWNA 4LRSA 4MG4A 1VLIA 4AH7A 4WSKA 3NYDA 4JXCA 3LXDA 1UKTA 2Q3RA 3FXYA 2E5CA 2J6VA 1Q6QA 1OF8A 3CGDA 1DOSA 1OGBA 1K4GA 3U57A 5I3FA 1W3IA 4Y90A 4W4QA 1OIFA 2DSVA 1TTJA 4PTWA 1V8EA 2PLMA 3S5SA 3UYCA 3ZIZA 1N55A 3NO3A 1GTHA 3EZ4A 1PHWA 4JFWA 2BHYA 3AI0A 3WBEA 2BVYA 3VIIA 3H26A 1ZX9A 2Z2AA 3G8RA 3MO4A 3WQDA 2GR3A 3L4YA 4PUNA 1MEHA 1J8VA 3IVTA 3OGSA 4BF9A 3BJFA 2PGEA 1T96A 4HTYA 4JFUA 4QG8A 1UG6A 1SJDA 3UJRA 3VNLA 3DUGA 4ADWA 4H4SA 2HSAA 3GVVA 1NFGA 1JGIA 1M5WA 2HVOA 1EA0A 4AEOA 1XLJA 4CGTA 3WH5A 4W87A 3TC3A 1SJAA 1W5OA 2OPJA 2V5JA 1R85A 2QCLA 2WOWA 3OGRA 2G50A 3EX6A 1YXCA 3B05A 3MJYA 3ICJA 4MJZA 1Q2RA 2E77A 4EIVA 2VO5A 2DQXA 4DWDA 1JDFA 2NWRA 1GW9A 1UR1A 1QOXA 4K8DA 2EKCA 1OC7A 3W00A 1MO9A 3PPCA 2DFAA 1XHGA 1CEOA 2BY3A 2CCRA 4P8VA 4K6AA 3WLOA 3GH4A 3G1HA 1GOWA 2FTPA 3SCQA 1UMLA 1DP0A 3SB0A 2DGAA 2OU4A 2V5DA 4GI9A 3F5LA 3IAQA 2QV5A 3RRAA 4FNRA 4A21A 4MJ4A 3CHFA 4V28A 1SUXA 2OWCA 1REQB 3LPFA 4I9JA 2ZKMX 3HGOA 4KEUA 1XGDA 5AC6A 2CLKA 2RDWA 2R1MA 1RQBA 5C2CA 1TE1A 3RU6A 4GQGA 3WL0A 2YFNA 1KB3A 3DGZA 3ABOA 3QSTA 4UCFA 3QQ1A 3CAWA 1PWMA 2INZA 3CZ8A 4LAZA 1A47A 3PB0A 3LCFA 1X6LA 1UD4A 2BGQA 3NUKA 2Y2WA 3QFEA 4KFPA 4GVFA 4QE1A 1B3OA 1TFVA 4UZUA 3ZJ6A 4PZVA 2PDXA 4PUEA 4U28A 4QR6A 5E1QA 1ZMDA 3VKAA 1JGMA 5C55A 5K4ZA 3DH7A 4UTWA 3C0SA 1EIBA 3LB0A 4LF1A 5LA1A 3IJ9A 2YW4A 3OA5A 3L4WA 3N6JA 4INFA 3VILA 1HTIA 4GX8A 3ECQA 3VDCA 5G5HB 2DUXA 2C14A 5AZ1A 1Q6EA 1SMAA 4Z42C 4LVGA 5JMUA 3LPGA 3GAKA 3O63A 2W0HA 4HSOA 5CAHA 4PBEA 1UR0A 2J7FA 3WDRA 3L66A 3RUBL 3GU9A 4RNHA 1GVRA 2PSNA 4LJ3A 2WPBA 2QUUA 5J5DA 3QV6A 3AZRA 3HGJA 1XLBA 2HV5A 4QEEA 4AHOA 3BAYA 1CENA 4JIHA 3TROA 4QRNA 3B8UA 2V5BA 3O3RA 4ZENA 4S3BA 4NZFA 3A4WA 1V4YA 3NQVA 2GQWA 3VIFA 3LHUA 3ZSSA 1W1TA 4LF2A 3MC5A 3SZ8A 1ZP4A 1QW8A 1Q3NA 3GTHA 3WFAA 4DF0A 4LAOA 1ZB5A 3FEMA 1LLOA 5A6JA 3MCOA 2OYKA 3TU9A 3NOEA 4JTQA 1GETA 1EJRC 5SWUA 2RH9A 2VFIA 2I56A 1UOZA 1NELA 3L4UA 2VL4A 1L2QA 1HKWA 1WZAA 1OB0A 3VGHA 4YVXA 1HN1A 2HNEA 3GTIA 1A3HA 1P1XA 4RZ4A 4DXXA 4FIQA 4Y96A 1W6TA 4UCGA 4OWGA 5ABTA 2VWSA 1RV8A 4FI4A 3SI9A 4EMIA 2YXGA 3N29A 4U3CA 2W62A 1GEQA 4KERA 3VGFA 1GPFA 4EK7A 1O5RA 1GT8A 3Q58A 5CZ0A 4FOUA 4ATDA 1M3UA 2ZADA 1ECEA 4XZHA 1TV8A 4OBRA 3W84A 1D8CA 2G97A 3VIPA 1F9CA 3P14A 3TMQA 5HMFA 3N2MA 2YA0A 4D6IA 1AOGA 4TQTA 5JXQA 2G3FA 2PGRA 1XM3A 3DYMA 4GACA 3TX9A 1F4AA 3AS1A 2R1NA 3WNKA 2XIIA 4F2BA 4AVOA 5EYWA 3CV6A 4QX4A 4CU8A 1PPIA 1RHCA 4Q4OA 2YAUA 1WDSA 5IHRA 2OLHA 3CLMA 1EEXA 3ANYA 3E3HA 3G1VA 3CGBA 1KRBC 4LYRA 5I7GA 4C65A 1OM0A 2I17A 3YPIA 1JEZA 4M6QA 1E9YB 1VCFA 3VNYA 1I2RA 5I07A 3CZGA 5U1OA 4WX2A 4Y6GA 1V3KA 4AWUA 3B0UX 4UNIA 2QAPA 3ELFA 2BVTA 2A7NA 2EPKX 2V30A 3GD6A 4P7RA 5CPNA 1K02A 2XG9A 1TUXA 3EAOA 4NNCA 4J2PA 5DQPA 4WVXA 1CBGA 1EFZA 1VAHA 3KOYA 3PBUA 5C7HA 1UUQA 3SFKA 4B4FA 3QFWA 3H4KA 2YDRA 1BYCA 1ODUA 4NJIA 1EO5A 3IC9A 2R6OA 3L65A 2V3FA 4QAWA 4BI6A 1WKEA 3ZJ7A 1E5JA 1OJTA 2HPMA 1EPXA 5BRQA 1JCYA 3SUWA 1PSCA 1YW1A 4FMVA 4O4VA 3ARWA 3EOEA 5T9CE 4C6NA 2Z1WA 1IE7C 2ZZ6A 1A5LC 4IM4A 4OV4A 2GWNA 1PO9A 1BG4A 4CNOA 1V5XA 3A21A 4C7FA 1BYBA 1B90A 1UR3M 3D6NA 5T91A 3TQKA 5GJMA 5DT7A 4XZBA 4J35A 3W82A 1EP2A 3I10A 4HNLA 1XX1A 2RDUA 2PDFA 5BRPA 4RDWA 2H9AB 4UR9A 3RDKA 4JNMA 5C9XA 1IXOA 2Q3OA 1EHAA 4QS6A 3AQUA 3PAOA 2YJQA 3FVMA 4NZ3A 2EJAA 2CLHA 4WKAA 3FJLA 4V1YA 5EFDA 3ITGA 4RDYA 3BAKA 3ZFHA 2A8XA 3EDDA 3C6CA 4CNNA 2RGLA 1D7KA 3NL5A 5BXPA 4AISA 2HE5A 1MW3A 2E09A 3QGKC 4IICA 2QJHA 1D3GA 4E2BA 1XYLA 1YDNA 4RNIA 1FFQA 3V16A 2QQ6A 2ALDA 3JR2A 1DQXA 2QJMA 1CTNA 1IGWA 1BWVA 4HVXA 2NUWA 3IJ6A 2GJPA 2H3BA 3GWQA 4QJ5B 5G2HA 1V7AA 2TPSA 1IEVA 2NZLA 3ARTA 3KUMA 2GDVA 2WVSA 3UP8A 1V3HA 3FY1A 2OLAA 3NRZB 3H2EA 1Q6RA 1XYBA 5CGTA 3P5ZA 5LGZA 3H7UA 3GXNA 4CCCA 4PTXA 3GBDA 3W2KA 3LM3A 4OV9A 4OZOA 4HHHA 2BSLA 2O4QA 1CT5A 4OIFA 3FHAA 4CNUA 4HZ8A 4FB7A 2O9PA 4JR5A 3APTA 3EA2A 4AZIA 4DLFA 4R53A 1XGEA 3B8TA 1XFCA 4QFUA 4UTKA 2P8CA 4UMAA 4H41A 2VFFA 1WBJA 1XYAA 1SVDA 5I2UA 3WELA 5DLCA 2WNQA 1PB0A 3MA8A 3SCOA 4QROA 3RYSA 1YDYA 4S3DA 1N63C 2GLKA 4GNVA 3AOFA 4KKXA 1ITUA 3WH9A 1S5MA 1WDRA 3WLJA 3M0LA 3KBSA 5D38A 4FF7A 5KVHA 1X98A 3PFRA 3PJTA 4NJKA 4YTUA 5IFTA 4OOUA 4XZMX 4HOXA 2DZUA 1BAGA 1RQEA 2Z1SA 3KRUA 1NOUA 1U30A 1JF5A 2D24A 4UFMA 5CSSA 2DSUA 1AQMA 2E28A 3U4AA 3VOIA 4WDTA 3S9ZA 4HNVA 2PRLA 1CB2A 4Q22A 3VFLA 1W37A 1R46A 4ORMA 5A5WA 5MF5A 3CEPA 2WCSA 2OG9A 2B4GA 1XYZA 2V81A 1GOOA 2AL1A 4B5VA 3NSMA 2O4MA 3DFHA 3H8AA 3LLDA 5EGRA 1EC7A 4YYCA 3KLLA 3PNZA 1Z44A 3PC0A 3LMZA 1A5OC 3U5UA 1NJJA 2H3DA 4PODA 3VNMA 4U31A 2ZZ1A 4H4RA 4Q8WA 1K70A 3LCLA 4KH2A 3BANA 4GGBA 3OG2A 2YYTA 3KS6A 2VEMA 4J3SA 4IJRA 4JOMA 5LIUX 4LY8A 2BVDA 3BSGA 4HSNA 1XQLA 2ESCA 3ANUA 2PBOA 4PC8A 5MKGA 4J9JA 1T3QC 2QV4A 2C13A 3ITXA 3W25A 1AH0A 3PTKA 4AAJA 2A1YA 1I2NA 4UMBA 5FS9A 1OK4A 2WQPA 2R24A 2DT2A 3AXHA 1NOFA 4Q4MA 1NH6A 3R4IA 4NEVA 2QDDA 4H6KA 1KKOA 3SM0A 4H9VA 4XX6A 3MZ2A 4HMDA 2ZC8A 2VGGA 2Y6ZA 3DKLA 4GCAA 5FAJA 4YTSA 1LWHA 3C56A 1ELSA 3EKZA 2VDHA 3E0LA 1Q6FA 1C29A 1F05A 1WXJA 2VGFA 4LALA 2BY2A 3RXZA 2Y7EA 2D1ZA 1EPVA 4D6FA 2EXOA 3VINA 3Q2DA 1YKWA 4Q8TA 1Q5MA 1DPMA 1EL3A 1QJWA 4MYAA 3WL1A 3ITTA 3G6LA 1EUAA 3CQIA 3IACA 3C0JA 4R7WA 4LAKA 2E6DA 2DZTA 4R9OA 1IWAA 1XLLA 2X09A 3VX1A 4TX8A 1E1EA 1IEXA 1DXEA 3SY8A 1X38A 5A8PA 3IARA 3SGUA 5E9AA 3GXDA 3B4YA 4AIUA 1XBVA 1LOSA 4KCUA 1VIWA 1KFCA 2GOUA 3PZNA 5GJPA 1R8LA 3R7MA 3FKRA 4DO5A 4DZIA 3TYAA 1SW3A 1A5NC 4HU4A 2FPTA 2WMJA 3IV3A 5CPOA 1OYAA 4F48A 3DJGX 1NF7A 1EXBA 4AX7A 3APYA 1A0DA 1UB3A 4K1GA 4A8RA 2YYUA 4BHYA 2OT1A 1FDZA 2J9YA 1R47A 2ONEA 2BOGX 4H00A 1KV8A 1SFJA 1TJ0A 2ODOA 2ASHA 3LRKA 4S3CA 3RO8A 4A05A 1S3HA 4CD7A 2QDEA 2C1IA 3SCTA 4MTVA 2WPCA 1ZBKA 4D8ZA 2ZX9A 3ANVA 5FJPA 4K7ZA 2NLYA 2R9RA 3S5YA 3TTOA 3LUTA 4REQB 2OB3A 1RCQA 3OO2A 4IFOA 3LGEA 4U3AA 1P7TA 3IJ7A 1XCWA 3AXXA 4HKPA 1KXTA 3U2CA 1JZ8A 4LVFA 1IR2A 3FJ6A 3AWOA 3FK4A 1I4NA 5CC6A 3EUB3 2XUCA 1MNSA 3BZGA 4D6DA 1L6YA 2I5QA 3P80A 3OA3A 3BOLA 1RH9A 4OJYA 4F2TA 1FECA 4O1AA 4PMVA 1GRAA 4GUJA 2XINA 4WUIA 5FEWA 4OGZA 4GABA 4OTKA 1M1BA 1YIXA 1R87A 2A0NA 3SQPA 4DBUA 4E8DA 4X60A 2V2HA 4QHRA 2L5HA 1XINA 4CVUA 1D7YA 1T8QA 4JN8A 3DFOA 1UASA 1XHCA 1AQFA 2WHJA 3B0XA 1K8YA 3LADA 2WNNA 4ZMGA 1ADSA 1EYWA 4B90A 2YCKX 1B30A 1XYCA 2VTFA 4AIOA 1OWQA 3E1F1 2NPXA 2PP0A 1A53A 3A7RA 1OD0A 3DEQA 4E4PA 4O19A 3TWAA 2ZTKA 3VD9A 3F7JA 1J12A 1Y5XA 3V5OA 2XTKA 4I3GA 1QASA 1A4LA 4DJEC 1V59A 4EQWA 3EBVA 5DT5A 1SMDA 1HZYA 2OCZA 1HO4A 3FDKA 1QU4A 2ZE3A 3L12A 4JCMA 4KCTA 5B7YA 5FJIA 2W5FA 4RV8A 4YTQA 4LH8A 2ZA1A 4EXAA 4IP7A 2IXUA 4WIWA 2V5CA 2XWDA 4Z1DA 3H2AA 2X0HA 1JCTA 1KC7A 2VX5A 3EXSA 2HCVA 2I7GA 1FY6A 1Q4NX 1XGZA 3CWNA 1EBDA 3RLHA 2WAGA 2NQJA 3S6OA 4JZ5A 3VM7A 1JZ5A 4P2VA 4IL2A 2PF8A 5AZ0A 3OVGA 2ZZBA 4YIWA 2HXUA 2X7WA 4E5TA 4R27A 4ATLA 2VRKA 1QW7A 1KM3A 4E0CA 4EQRA 3GM8A 3TSDA 3PG9A 3ONBA 3H23A 2OYLA 8TIMA 1GCYA 4M6VA 2WJFA 3R5EA 5FF4A 2CIPA 3GBEA 3WLQA 1F6KA 3ZVHA 5BOEA 3UJSA 5H8PA 1PE1A 4C6PA 1I8JA 2UY2A 3ATYA 1K9DA 1R3RA 4Y9OA 4FO4A 1DORA 4P7QA 7TAAA 1MUMA 1KCLA 1R7OA 3WYZA 1HT6A 1I2OA 5EB8A 2X30A 3NL6A 4Q4QA 5FACA 1WDWA 5HNTA 7TIMA 2KZHA 4E6MA 4GNJA 3AMGA 5LZLA 4HPHA 3EOSA 3VKJA 5L9FA 3AIBA 2OSWA 3FIGA 2WZIA 3WQ8A 1ZNNA 1WOBA 2VENA 3D0CA 4QNWA 1W1IE 3K4WA 3C2RA 1XLDA 4QE4A 2PAJA 3LXAA 4O1BA 4YTTA 3PULA 3RM9A 1PDYA 1CGVA 1BKSA 1H7PA 3UR2A 1F8IA 1HJUA 4W85A 1Z32X 3U0HA 2IKJA 3NM1A 3VKKA 1V0LA 3B03A 2PDBA 1LJYA 5A6LA 1VFOA 3NGFA 2Y85A 3W01A 1W56A 4BJHA 3QPZA 4GYPA 4HN4A 4H6EA 5D8ZA 2OOGA 2W79A 2WXDM 2HK1A 3IJ8A 3P67A 4Q8UA 2PLKA 4LYPA 2XVPA 3FG2P 4FIRA 3L0NA 1TYGA 4M7SA 4O57A 3BW4A 1Z8AA 1AW2A 4KPLA 2QPXA 3GG8A 2D23A 3HRDC 1S2AA 3ES7A 5FESA 4O50A 1JFHA 4NZJA 1POJA 1HJVA 2B0MA 4OQVA 4Z2KA 1FWAC 4GXPA 2CWNA 4MZ1A 3ARUA 3P2VA 5C9RA 3E0IA 3GFXA 4ZODA 4EWJA 2I57A 1JRPA 3PTQA 2QJGA 3ZLHA 2Z1BA 2BMBA 3KBWA 4L56A 6REQA 4JTCA 2PWGA 3W07A 2X2YA 5HATA 4PL2A 4LQ1A 5AFDA 1GVQA 2EPMX 3UXLA 2J7HA 1LG2A 2JBMA 2J7EA 1KBLA 1R7AA 4O17A 4QJ3B 1GW1A 3A23A 3JRKA 3QY8A 3QR1A 2Z1VA 3ID7A 4DBEA 3C3UA 3IJDA 3L4XA 4OUIA 1TWWA 4RZ6A 1RA5A 1IT7A 3K1DA 5CC7A 4RZBA 2CZVA 4MWAD 2PPGA 4O12A 3FS2A 4MNMA 1OABA 1LT7A 5D9PA 2FZ9A 1BTCA 2CWXA 3VD3A 1W1PA 4MNKA 3GW0A 3U6WA 4HHLA 4XQ6A 5CXPA 1SO4A 1NEYA 4A22A 5JCMA 1JPDX 1N62C 5T8GA 3A4XA 5C9WA 2DZPA 4XKYA 4C1NA 3TSMA 4U33A 3GH7A 4J3VA 9RUBA 3RIKA 1X96A 1V79A 1FKWA 4Y7EA 2WVTA 4EPKA 3WD1A 1ZJAA 3BAXA 1V77A 2FZDA 3NCOA 2P0IA 1DWAM 4EACA 4ZEPA 1S5NA 5D09A 1KWGA 2ZXDA 3GU1A 3I6RA 1DV7A 3WEMA 3KW3A 2WM0A 1CLKA 2BHZA 4PH6A 3E2VA 3DYPA 2BX7A 4A3YA 5HANA 4AD5A 1UBSA 3E74A 4YYFA 3URNA 2CBJA 1QPRA 2FJUB 3PUEA 4PMUA 2IPJA 4JN6A 1CGYA 5A8GA 3EX4A 1XDIA 1JPMA 2VYOA 4ILSA 3GR4A 5G2WA 3MKCA 3HPZA 4JIPA 4F66A 2TSYA 4M3PA 1QAPA 3QEZA 1C8VA 3UWQA 4QITA 1I60A 1TMHA 2KX9A 4PMOA 1E4LA 3K46A 4O1EA 1P0BA 5A1AA 4UWMA 4OKDA 5BW6A 3TW7A 5I5RA 2VVSA 4N4QA 4NZ4A 4XD4A 1OCQA 3UXIA 4IPNB 4O4WA 1U1UA 1E6RA 3QV8A 1D8WA 1H2IA 5H8UA 1VBJA 1FXPA 4GZJA 1JVNA 1XLHA 4KGJA 3TSBA 6PTDA 1QHPA 1XD0A 3RU8X 2BB0A 2VR2A 4UQDA 3ONCA 1BKHA 1UWIA 4LBRA 4K8HA 3N04A 5BOFA 2JALA 3II4A 4AXKA 3N12A 3VGEA 5E93A 1WE5A 4JICA 4DIAA 1R3YA 1CGUA 1ZAJA 4GH3A 5D33A 5I24A 3NEHA 3JVAA 1XCFA 2QJIA 2O9TA 5EMUA 1NDAA 3MU7A 1I75A 2F61A 3GHTA 1RP8A 3EPOA 1YBQA 3QV9A 2G3NA 3C61A 5TAOA 4ML4A 3HFYA 3PZMA 1GORA 3JZUA 2ABAA 5DRIA 1WB0A 3WSUA 4KIRA 3QC0A 3RMJA 4S3FA 4A3UA 4NL1A 2CHOA 4RW5A 2W54A 4PFMA 5CKSA 2J6XA 1TTIA 3QBUA 4A4AA 2QPUA 4H50A 3P7YA 4D6EA 3ME3A 3TOPA 1G5AA 1FWSA 4NRSA 3SDOA 3M43A 1HVXA 3O6YX 3ETRB 2XSXA 4H9YA 3O6CA 3AC0A 4GRSA 3MZNA 3RAOA 3CXBA 2XIOA 3Q6JA 1QTWA 5E09A 3NZQA 4Z1YA 3UPBA 3RPTA 2X8HA 4TMCA 4O18A 4BI7A 3AYRA 1E1FA 2OQLA 2EPLX 4CU7A 1UA3A 4TVDA 4C91A 1ICSA 2ZXAA 1DJZA 4YCOA 4CNSA 4Z2LA 4JTJA 1UIOA 3BW3A 4L1WA 4HB7A 1J5SA 4HK7A 3EX1A 2E6AA 3W53A 3KOFA 3SBFA 1DIKA 3I7SA 1M53A 3NQ2A 3QY7A 4HOWA 1BF6A 2PDIA 5C9UA 4YVVA 2PCEA 1VBUA 3U8GA 5ECVA 3W22A 4DYJA 3EB3A 1Y65A 3W28A 3USBA 4UQBA 3OQ8A 4DRSA 4PYSA 3ERPA 1XJBA 5FS6A 3R07C 3LS9A 5C6MA 1EP3A 3C2YA 4V1XA 2VD8A 2Y62A 4DJED 3I3BA 1K4HA 1QI2A 5E5CA 1UBPC 2CLEA 1A3WA 4QGCA 3EX3A 1R2SA 3ZJKA 3LMYA 3HF3A 4HNTA 4J3TA 4KEZA 1XDJA 3QZ6A 4HPGA 4QG6A 4H2CA 4P5UA 1L9WA 4DX3A 1F3XA 1GOMA 2ISVA 4JY9A 1XD1A 3T7VA 3PVFA 5KMYA 2XGZA 2EQ6A 1MZHA 5G1YA 3D3AA 1K7FA 4HK6A 3V0UA 2G41A 4RE3A 3GDLA 2EQ9A 1TE6A 4H8UA 1ZBWA 4GY0A 3T55A 5A94A 2GR0A 1E40A 2CNCA 1UR4A 1CZ1A 1NHRA 1E9IA 4ZXOA 2DZVA 3MDWA 3C2FA 1R3TA 3A12A 2CLPA 2PD9A 4O0QA 4LX4A 3WF3A 3NQEA 1Z42A 4PUJA 5FMHA 3GDKA 4BWLC 3VMOA 4F3HA 1QRQA 3BUVA 3HMCA 1A5MC 1QDSA 1FWWA 3BO9A 3DG6A 1CGTA 3O2LA 4J56A 3B8SA 3VD5A 3GHSA 4GY7A 3N4FA 5T26A 2J9XA 4YJ5A 4TTGA 2VHLA 1FFUC 1CWYA 1V3IA 4JTSA 3TA9A 5FOOA 2GOKA 4NEWA 1X8FA 1JUKA 2FZMA 4JTKA 2GQ8A 3DHFA 5FF2A 2Q8XA 1EB3A 3THCA 2Z27A 1EWDA 3VIHA 2HXTA 1KQYA 2J7GA 3AMCA 3I65A 3FHQA 2F5ZA 4N6FA 5D8WA 4O1CA 2BC1A 3BW2A 1IZJA 3UPMA 1K6AA 2PA6A 1IEWA 4LUSA 5D32A 1GQNA 1LTDA 3VDHA 1B4KA 1TMQA 1O5XA 1IV8A 5HXMA 1XIMA 4JQ1A 2E9MA 3A6OA 3ZR6A 1YADA 3WF2A 3L9CA 3NEVA 1EIXA 3O6AA 1GRGA 1QXLA 3QMRA 4H9TA 4K8GA 1N5WC 2J13A 1JR1A 4JTDA 1EBGA 1W8GA 4IPJA 3GVGA 3ZO9A 2XPKA 1BQCA 3I7RA 4NAFB 4PTMA 2BFGA 2R91A 4N7QA 1VYPX 4IMGA 1F73A 1Y0EA 2NXIA 2XWEA 4N42A 1GRHA 1J0HA 5GPRA 1N8IA 1T6MA 1D2KA 4V15A 3TUUA 4H4QA 3S1UA 4L4MA 3QPYA 3Q67A 1X1ZA 1AVAA 3A4AA 1EC9A 3B0VC 1I0DA 4B3LA 1ZUAX 3W7EA 3B9AA 4QLJA 1B3XA 3CLWA 1GZ1A 3IIXA 3KXQA 1VDVA 4LIIA 3AXMA 2DY3A 3KEHA 2V63A 4RXFA 4L7ZA 4XKMA 3RJXA 3B9OA 1IT8A 3MHGA 3MW7A 3OZPA 1FH7A 3NVVB 3AZSA 2PLCA 3B40A 8XIMA 3P60A 1EP1A 2P88A 2UY4A 3L2IA 2BWGA 2WVUA 3W2LA 2JIWA 4MB4A 4O8AA 1J0KA 1L8PA 5A6MA 2DZSA 3GYCA 1KM2A 3UJFA 1QI3A 3WK1A 3EPMA 1ZQ5A 1WPCA 3T6CA 1OZQA 5IOBA 4IZGA 1RD5A 4XD3A 4R9XA 1E15A 3VTRA 3TFCA 4DZ5A 3CH9A 4A3RA 3GUWA 3OZYA 4I5UA 4R3UA 1VGAA 5CG7A 3BV7A 5FJTA 1F3EA 2VCBA 5MKGB 3VC6A 3TYBA 3LCIA 1DJWA 3M0JA 3GXMA 4LFYA 1GRFA 4FP1A 3DAQA 3WLPA 4C6FA 4CD4A 3K2GA 2C71A 1UZDA 1IZCA 4IMCA 1E71M 3CGTA 4WXZA 1TO3A 3NPWA 1KCKA 4F4RA 4AEFA 1JZ6A 2X1TA 4JGDA 2FB2A 1G7UA 1L6GA 4ZO6A 2DIKA 3WH7A 2WSKA 3WLRA 3BCFA 3QH2A 3G5EA 2NQZA 3CC1A 4WXYA 4JTTA 3LI1A 1D3HA 2CXEA 2FDSA 2YGYA 3RFAA 2HQAA 3OU8A 1FX6A 1GOIA 1VCVA 1XKYA 2HS8A 5C0QA 2PWVA 4HNNA 1W1A1 4NT0A 1TTQA 4W8BA 3WEOA 1KKRA 2GR1A 4UQ9A 3VOGA 2CETA 3UPWA 2F2HA 3W2UA 4AZ5A 3WLSA 4KW2A 4CUCA 1WNOA 1E56A 1W9DM 1ADDA 2I9EA 2CPUA 1MVYA 3O9NA 2O7SA 2FVKA 5A69A 5CPMA 1IXNA 1V6XA 3KX6A 2ABBA 1YPIA 7REQA 3FAWA 5I3GA 1TV3A 2XH2A 2NT1A 1J96A 3WMBA 4O54A 1QVBA 2WHMA 3IIOA 1E6SM 4JCLA 1W5NA 2ZX8A 2YVJA 5AYIA 4ZE4A 2ZUUA 3KRSA 3H2CA 2GQ9A 1W9BM 3IJLA 3CIWA 4AD1A 3DBPA 2V8ZA 1DWHM 2JKPA 4QDWA 1ME9A 4WGXA 4WRHA 5BU9A 1QNOA 1PL9A 2PZNA 4O1FA 1BRLB 3O05A 3B8IA 3KRZA 5ECUA 4JKLA 3LERA 4US5A 3W72A 3W85A 4Q8PA 1WDDA 1PYMA 2OLSA 3TE9A 4K36A 3I6EA 1MW1A 3N9RA 4KFNA 1HQTA 1JIBA 4CQCA 1DWIM 1H61A 3RNMA 2Y8VA 2AQWA 2R9ZA 2XN2A 2IW0A 1VKFA 5I3KA 1XPGA 1NHPA 1P7TB 1DJXA 4PCTA 4TO8A 5CZSA 3TYEA 4IJCA 4Z2HA 3GIPA 5CC5A 1TA3B 5XIAA 5BWAA 1CDGA 3B97A 1KM5A 5G1TA 1N8FA 1S2WA 1KTBA 1Z41A 4R33A 4QS5A 5GNXA 2F6UA 3QR3A 2FZBA 5EMYA 4TUFA 3NAVA 4MOZA 2QULA 4TVCA 2PE4A 2Y63A 3RPDA 4K7YA 1R0MA 2ZQ0A 2X8GA 3SCVA 4AZ6A 3GW3A 1W3NA 1SFSA 1HW6A 2RFGA 1DJIA 3KWSA 1BVNP 1FP8A 1GWJA 1WKDA 5HDRA 2Q8ZA 4G7FA 3GG1A 2NX1A 3UVAA 1KR0A 1V6TA 5G4WA 3VA8A 3WMCA 2FFIA 4I8DA 5FS8A 3RX4A 4GUFA 1ISYA 2HISA 5HWJA 4KWWA 1K8XA 4HOZA 2NV2A 5ABGA 3POCA 4HCHA 5HMDA 2YB4A 4JPGA 2QDHA 2CFYA 3LHZA 3BTNA 1GQJA 4LS0A 4AG0A 3TC6A 3U5YA 1H0IA 2WK2A 3IIZA 3SRDA 4GNKB 5GRTA 3AYVA 4D8LA 2W63A 1ZL1A 2PDNA 2WMHA 1RA0A 1LG1A 2XFYA 2WKLA 4K2SA 2I14A 3XIMA 3O0KA 5ABEA 3AHYA 3T81A 3W7NA 1BXNA 3WJXA 1GESA 1WKYA 3V5CA 4AHPA 2NW0A 1UD8A 4GINA 5TBOA 1ONEA 4W86A 3ALGA 2XHYA 3LCWA 1UKSA 1UZHA 1PKYA 3IVSA 1EJVC 1LYXA 1TB3A 2YZRA 1JCJA 3TONA 2D2HA 3G0UA 4AF0A 3OVRA 3UZYA 3WQOA 5HK4A 4ML9A 1EGMA 4XWUA 1NHSA 4PEEA 2P50A 3DI0A 4C5YA 1F07A 6XIMA 3NL2A 3KCOA 4CN4A 2PDCA 2ZXQA 3R43A 3DFTA 3KS5A 1TV2A 4GUGA 4F0MA 1JJKA 1QMLA 3I3EA 1FHVA 4Z2JA 3LGGA 1FOBA 3GU2A 1KTCA 3MWCA 2PWFA 2Z24A 5JCKA 4X0NA 1G0CA 1N7KA 4OVXA 2PF0A 5HUPA 3CMGA 4UQCA 4AU0A 3WF4A 3MYPA 4H8VA 4HU3A 3RJYA 4NQ1A 3K5XA 4NKCA 3BJTA 5LGXA 4PCSA 3NA8A 4BV6A 1C8QA 3P0XA 1X2HA 3WK3A 1ZSXA 3ITCA 1DWGM 4QLKA 1G94A 1ZTVA 4DEFA 1IEIA 1NSJA 5TD4A 3TFXA 1RD6A 5F1VA 1FKXA 4ZB5A 1X6NA 3NS1B 3UJ2A 3RNDA 2QF8A 2JFEX 1H7RA 2PWHA 1E0UA 1ZK7A 1FEAA 4LYQA 2FH6A 3IRDA 5DFAA 4LAUA 3HG5A 3N1AA 2XVNA 3ZT5A 2J7CA 4PSRA 2PD5A 4Q8OA 1GONA 1TJPA 1E6NA 3P84A 2BOEX 1H0GA 1AMKA 3W6LA 4CD6A 3DX5A 2GWGA 1TELA 2CITA 3TQVA 3ARQA 3NNTA 1MFVA 1FWRA 3C4UA 2GH5A 1W9PA