4IZGA

Crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound cis-4oh-d-proline betaine (product)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
369
structure length
369
Chain Sequence
MKIAEIHVYAHDLPVKDGPYTIASSTVWSLQTTLVKIVADSGLAGWGETCPVGPTYAPSHALGARAALAEMAPGLIGANPLQPLVLRRRMDGLLCGHNYAKAAIDIAAYDLMGKHYGVRVADLLGGVAAERVPSYYATGIGQPDEIARIAAEKVAEGFPRLQIKIGGRPVEIDIETVRKVWERIRGTGTRLAVDGNRSLPSRDALRLSRECPEIPFVLEQPCNTLEEIAAIRGRVQHGIYLDESGEDLSTVIRAAGQGLCDGFGMKLTRIGGLQQMAAFRDICEARALPHSCDDAWGGDIIAAACTHIGATVQPRLNEGVWVAQPYIAQPYDEENGIRIAGGHIDLPKGPGLGITPDESLFGPPVASFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Prediction and biochemical demonstration of a catabolic pathway for the osmoprotectant proline betaine.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme, N-terminal d
total genus 126
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 5.1.1.22: 4-hydroxyproline betaine 2-epimerase.
pdb deposition date 2013-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4izgA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4izgA01
3D47A 4A3RA 3NO1A 3H70A 3QTPA 2XH2A 3MY9A 4DHGA 3QLDA 1TE6A 3MUCA 3UXLA 4KT2A 2ONEA 1YEYA 3ZVHB 3FYYA 2QJMA 3DG3A 3OZMA 5IDZA 3N4EA 3QN3A 1L8PA 2PGWA 3JZUA 3UCCA 5FJRA 2P0IA 3DEQA 2XH4A 1PDYA 3ENLA 3UJRA 2PA6A 3K1GA 2XSXA 4GGHA 2XGZA 3T8QA 3OPSA 4JHMA 3ZVIA 2P8CA 1BKHA 3DGBA 4GISA 2QGYA 1MUCA 3PFRA 5FJPA 3H8AA 3CB3A 1SJBA 3DG7A 2PU1A 4K2SA 2PU0A 3OZYA 4E8GA 3R10A 2GGHA 3UJFA 3B97A 4E4FA 4E5TA 2PGEA 1R0MA 3QKEA 3EKGA 2GGEA 1EBGA 4FP1A 1EBHA 2PTYA 4GYPC 2PSNA 2PP1A 3CT2A 2P8BA 3VA8A 3N6JA 3UJEA 3MKCA 2QJNA 3R25A 2HXTA 2POZA 4ROPA 2GDQA 3ZLGA 1SJDA 3FVDA 5FJOA 3SQSA 3S47A 4Z1YA 4ENLA 3FJ4A 3UGVA 3ES8A 3GD6A 3V4BA 4JN7A 5BOFA 4X2PA 2FKPA 3N4FA 4H1ZA 2AKMA 1MDRA 1P48A 1KCZA 3Q4DA 3T6CA 4DN1A 4MGGA 1EC8A 3VDGA 3IK4A 4GIRA 2PTXA 2AL2A 3MWCA 2OZ8A 2OFJA 3RRAA 3SN0A 3FXGA 3VCCA 4GYPA 2O56A 4DXKA 3CYJA 6ENLA 3OW1A 1FHUA 1XPYA 3ZLHA 4HNLA 2HZGA 3SN1A 2MNRA 3V5CA 5J04A 1SJAA 3TWAA 3P93A 4K8GA 2AKZA 4H19A 4IL0A 2PTWA 3STPA 2OX4A 2OQHA 4HNCA 4KEMA 4HN8A 4A6GA 3HPFA 3P0WA 3TQPA 2XH7A 3BJSA 3RGTA 1NELA 2GGGA 3RCYA 4GFIA 3I4KA 3TJIA 1KKRA 4HYRA 2OLAA 3RO6A 2HXUA 4EWJA 3S5SA 4DWDA 4DX3A 1R6WA 1ECQA 3DG6A 4J3ZA 3SBFA 1RVKA 3MZNA 3U4FA 2PMQA 5BOEA 2DW7A 3SSZA 3N6HA 3U9IA 3DESA 3VC6A 2QDEA 2PPGA 2XH0A 1MRAA 4FI4A 3GO2A 3OTRA 4ZA0A 4IZGA 4F4RA 4M6UA 3FCPA 3NXLA 1JDFA 2PP0A 3MQTA 3VFCA 1XS2A 1OEPA 3D46A 2PP3A 3PWGA 4HPNA 1MNSA 5ENLA 2QJJA 4A35A 3R0UA 2ZC8A 2GSHA 2QVHA 2PODA 3OP2A 3H12A 3MSYA 2PCEA 4DYEA 1E9IA 2NQLA 1DTNA 4IL2A 3DFYA 2OG9A 2CHRA 3NFUA 2PS2A 4IP5A 4IT1A 2MUCA 3H7VA 3V5FA 3FV9A 1TKKA 3ZVHA 3R11A 2OQYA 3T9PA 1ELSA 4IP4A 7ENLA 3GC2A 4KWSA 2FYMA 2GGIA 2DW6A 3DDMA 1KKOA 2OO6A 4MMWA 3THUA 1ONEA 3DIPA 4GMEA 4J1OA 3BSMA 1EC9A 3EEZA 2OZTA 3I6EA 2I5QA 3P3BA 1JCTA 2P88A 3KUMA 3TCSA 4G7FA 4HCLA 3R0KA 4M0XA 1BQGA 1NU5A 2OPJA 5EU9A 4H83A 3NZGA 4KPLA 3GY1A 4E6MA 2AL2B 4YWSA 3PK7A 2HNEA 1EC7A 3ZLFA 4HCDA 1IYXA 1WUFA 4H2HA 3TW9A 3UJ2A 3TWBA 3DFHA 2ZADA 3TTEA 3Q45A 3TOYA 4MKSA 3PWIA 4IHCA 3VC5A 3T4WA 2GGJA 3IJQA 3SN4A 1F9CA 3TJ4A 4Z17A 1P43A 2AL1A 4JN8A 3RITA 2PTZA 3RR1A 4E4UA 1MDLA 4GGBA 3BOXA 1JPMA 3IJIA 1JPDX 3IJLA 4K1WA 2P3ZA 2QDDA 1FHVA 3CAWA 5FJUA 3JW7A 3CXOA 1WUEA 3UXKA 3DERA 1W6TA 3V3WA 3SJNA 5FJTA 2RDXA 3UJSA 3R1ZA 2QQ6A 4HCHA 2OKTA 3I6TA 3UCDA 1SJCA 3VCNA 2OZ3A 2OVLA 3JVAA 1TZZA 3CK5A 3ES7A 2GL5A 3QPEA 4G8TA 4ZCWA 1PDZA 1KD0A
chains in the Genus database with same CATH superfamily
1XLGA 2ZXBA 3NO1A 1L8NA 4M7TA 5JUVA 1R3RA 4JQ2A 3W7GA 3MI6A 1LDCA 4ACYA 4PODA 2Y7GA 2TAAA 5BXPA 4RE3A 3W1MA 1E6ZA 2EAWA 5LA1A 1S2CA 4R34A 3EDJA 4AU0A 4MB4A 3TTSA 4Z2LA 2J88A 2J8TA 3LLDA 1SW3A 2QIIA 1IZCA 1OFEA 3F03K 4ZOHB 3TDFA 1GPFA 3SQMA 1HN1A 2D2OA 3WF4A 3HIJA 3B9JB 1RCXB 3VM7A 5F4SA 3AHZA 4KWUA 4WCJA 3UG8A 1Z7AA 2C0HA 1RALA 3MCNA 2FMNA 3DG7A 4QDPA 3EWBX 4GUHA 2V68A 4YCOA 3LNPA 4IFRA 3QQ0A 1UYQA 1LL7A 4MB3A 2OSWA 5K4ZA 5LIWX 4K38A 5E09A 2ZZ5A 5TR3A 3TYBA 1Q8AA 2X8GA 1GVRA 4QIUA 3M1ZA 4D72A 2QJHA 3POHA 1YNPA 1OHLA 4PEKA 5AVNA 2XVKA 4W7UA 1DOSA 5DF0A 1W9PA 1W1ZA 1QPRA 2GDQA 1TVPA 2BFGA 1XIEA 3WQCA 3NZQA 3LXAA 4AIBA 2QV4A 3AIQA 1AZ1A 2WNWA 1ISZA 3EMZA 2YJQA 2QAEA 3D6NA 5IFTA 2GJPA 3I65A 4DIAA 1HVXA 2DSVA 1K9TA 3T78A 3RFAA 1UP2A 3LHYA 4ROQA 2D3NA 3KX6A 1VCGA 4TVUA 3TZNA 4LVDA 3WQ4A 3Q4DA 2QHAA 1H2IA 3FKKA 2CZFA 1TTPA 3IRSA 3NPUA 3L9CA 3VI2A 2E5BA 4UFIA 3M5ZA 1FWCC 2AL2A 3GHUA 3VO0A 5EFFA 3MJYA 3RAOA 3EKZA 4EPDC 4HYWA 3GKFA 2J7FA 3TVAA 1E56A 2YA2A 1GV4A 2W9MA 3CPRA 5HMEA 5EBAA 1JYXA 2ZVIA 3WLIA 3AS2A 4FB7A 5MF5A 3LHWA 2HZGA 3IAQA 1JRBA 1V6VA 4XZIA 2O4MA 1KLZA 3KOFA 4TR9A 3MMDA 1O5QA 3GAKA 2TYSA 1XSIA 4N7QA 1B9ZA 1UR1A 4PB3A 2PF8A 5FJJA 2V82A 2NSXA 3VGGA 4YTTA 5IFPA 4C6OA 4CVWA 1NEYA 3OZPA 1EJWC 1O94A 2QUTA 4D6DA 4L1WA 3RJXA 1EBDA 5E9XA 4KFOA 2BV9A 1CGTA 3VTRA 1WBHA 2WM1A 1I1WA 3RUBL 1OCJA 5I7GA 2VDHA 2E9LA 3NL3A 4E4PA 4HD5A 1XCWA 4LVBA 5TIMA 3SI9A 4LUTA 1ME7A 5FMHA 3SCTA 1O68A 1PYFA 3UCQA 4CNNA 4GNVA 1KNWA 1K7FA 3TW7A 1Q6RA 3ARQA 1AH4A 2A0NA 3VZYA 3OIHA 4JQ9A 4DJED 1FHDA 4V1XA 3GWQA 4QROA 2OEMA 1NP0A 2OWWA 1W8GA 3PM6A 3ITLA 4BZYA 5A8NA 4D1IA 3SY8A 4D6JA 5C9RA 2DUXA 4P8VA 3SCVA 1NWUA 1G01A 1H61A 4KCVA 1PE1A 2YXOA 3RX3A 4I9AA 4HSHA 2X41A 5E70A 4EE9A 4DELA 1YDYA 3VNMA 2JBMA 4JX4A 4GZIA 3W7PA 4S3DA 2GSHA 2V5LA 3PBUA 3S9ZA 1JQVA 4MAZA 3DN5A 1DIEA 4JTJA 5LHFA 4NEWA 4WSKA 4JNMA 1ZJHA 1ZDLA 4XAPA 3HPAA 3REQB 1AUSL 2XN1A 3WJYA 3QZEA 4Q4SA 1W56A 4I3GA 2FDMA 3CUFA 5I24A 2BXVA 3MBFA 4FPSA 2MUCA 4WK9A 1N5XA 4QHRA 2UY5A 1FFQA 1KBBA 4KWSA 2E09A 3V0SA 2DW6A 1PWMA 1XPGA 3GS6A 4TO8A 3W76A 1A5NC 4FIQA 2CZ5A 3VIJA 3K8MA 2ACSA 5B7ZA 2RJHA 2QCFA 3OHIA 3W9ZA 3WEMA 2F38A 4YWOA 1TV3A 3GXDA 4NXSA 1XLFA 5A8QA 1D3HA 1PS9A 4ZQNA 4A05A 3M0IA 2WCSA 4IJCA 4DXVA 2XWDA 4CCZA 2ZUVA 1JOAA 1A5UA 3CXBA 4XZMX 3BCFA 5CGTA 1EC7A 1R85A 3ZLFA 2P76A 1Q7ZA 3UFYA 4BEUA 4CNPA 3LPOA 5AYIA 1P0EA 4PZVA 2Z2AA 1MQPA 3PSWA 2ODOA 3MMWA 4Q32A 2VC5A 1JDEA 4Z2JA 5A69A 3I7RA 2GUBA 2QCEA 2XINA 1P0NA 3JW7A 5FF3A 1PUDA 1OADA 2GDVA 1VR6A 4P7LA 3IJ6A 3SJ3A 4Z2GA 3ZJKA 3GX9A 2OKTA 4DO5A 2FZBA 1VFFA 5U25A 5KSWA 4I9JA 4WSJA 2OOFA 3H2NA 3TXVA 2QCMA 3V36A 3PG8A 3R12A 4X22A 3LTSA 3CV7A 3NYZA 1IEVA 3N2BA 3SR6B 1JXJA 3FYYA 1VLIA 4QLKA 4B9ZA 1A3HA 4NILA 1LOSA 2X40A 4A8NA 4GK8A 1V3KA 2V6AA 3LD5A 1H1ZA 3LGDA 4WXYA 4RLIA 5AC8A 2PDYA 1NPXA 3QFEA 3KS5A 5LNRA 3LUTA 3PZTA 3QZ6A 2BVTA 2H9AA 3ZIZA 4AZGA 4DNAA 2VR2A 4EK7A 4JHMA 3ICJA 3ITXA 1KXTA 3EXSA 2TPRA 2B0MA 4DJEA 4OHQA 1JCMP 3CB3A 3LA4A 2VDIA 5BXRA 4LY4A 1CCWB 4K2SA 1SPQA 3UZXA 1A0CA 4PCPA 4LBUA 4AWTA 4JY8A 3GIPA 3T08A 1BXBA 3II4A 2XPKA 1KCXA 1G67A 4O0KA 1HXJA 1R0MA 5HWJA 3VILA 1GGOA 2RFGA 3M07A 4F40A 2CETA 3PULA 4DEFA 3UJEA 3MKCA 1E70M 2QCCA 1H3GA 3E96A 1JYWA 2OX1A 4B90A 1UWSA 3P6LA 4ATLA 3F4CA 3I7QA 2DGAA 4LC8A 2ZRXA 3EWDA 3PZUA 4LUSA 1POKA 2YL6A 1E6XM 3WYZA 1A3XA 1DYSA 2XJ7A 3R0DA 1EQPA 2QULA 4TIMA 2ISDA 1UZ1A 4PTDA 2ZYFA 5A6KA 4H8NA 3KCJA 4Q8VA 1MRQA 1EF3A 3PBVA 1UD3A 4BURA 3DFTA 3IK4A 3NL6A 3O9NA 3EYPA 4LY8A 4PTXA 4Q3MA 2BVWA 2OFJA 3BH4A 2CU0A 3ITGA 1Q6DA 4HPGA 1IT7A 5I3HA 4J56A 3QY6A 3AN1A 1IXNA 1MWOA 1FHUA 3K30A 4KRUA 3VD3A 1KTBA 3E1F1 2BHUA 3W7KA 4GRTA 5F2LA 2VFGA 2DY3A 2ZUNA 4HK7A 2W27A 4KGLA 1UR4A 1UR2A 4OBSA 3STPA 4LALA 5AFDA 5DY3A 2RAGA 5JBFA 1FWAC 4FR1A 3DBPA 3WD4A 3LHZA 1WE5A 1SW7A 2VC9A 4ADUA 4B9YA 3RGTA 3U7VA 3LQGA 1T7LA 1EJ7L 2GGGA 4I90A 2WZHA 3TU9A 4JDRA 1ZX9A 3GK0A 4PR4A 4JQ4A 4ZFCA 1W1A1 4DX3A 3T09A 3LB8A 1OIFA 5AYYA 1VKFA 1E72M 1XKJA 4TTGA 2XTKA 3K46A 2AGKA 3A24A 4MZYA 3QRHA 3U4FA 3N17A 4K3ZA 2O4QA 3UGRA 3KE0A 3TOPA 3DESA 2XZ7A 4PL1A 4PUEA 2ACUA 1MZHA 3DI0A 4R3UA 4KWVA 4CLMA 2X0SA 1IT0A 2Q3OA 4Y90A 3WG6A 3TONA 1GT8A 1SB3B 4HYVA 3XINA 1QCWA 2ZA3A 4YXGA 3UD6A 3KTXA 2J3NA 2EO7A 5CBIA 1H1YA 2IXVA 5JCNA 2PWDA 3LXBA 1UKPA 3KOZA 5HINA 2CERA 2PP3A 3T0AA 1IEQA 2QUVA 1U22A 1GYNA 1BF2A 5FS7A 4S3EA 2PD9A 5J5RA 4PUKA 1CGWA 5C9WA 4M52A 3R58A 2NVDA 2XN0A 1QNOA 1EYEA 3TAKA 3TYZA 3EX2A 4GUFA 1BHGA 1W17A 3CH9A 1Y0EA 4UTIA 2E28A 5BWFA 1XLIA 3AMKA 2OQLA 3VNZA 3FA5A 4RW5A 5DBUA 3GUWA 5CAHA 1HKVA 1LQ0A 3DHDA 4AIOA 1EJRC 2WMIA 3GHSA 3R6IA 1NHRA 2EPKX 3G6MA 3PZIA 1E5JA 4ONVA 1FWRA 1GOKA 4S3KA 4AB4A 1EHAA 3PANA 2W79A 3KBWA 2OSYA 1XSKA 3BVJA 2FVLA 2VX7A 2VOTA 2XUCA 2BS9A 4RX0A 5MKGB 3BL3A 4QAWA 5LYRA 2AAMA 4S39A 2W0UA 3P0XA 1VBRA 3CHFA 3LTPA 2PC4A 2G3IA 4L6OA 4GZ7A 3PR2A 1J5TA 2OZTA 5M5DA 4U5IA 1OFOA 1EFZA 1GVOA 4W4QA 4WDWA 3NDYA 4HHHA 1XHGA 3K4WA 3G1AA 3NQ8A 4GKLA 1EWDA 3TA6A 1LRQA 2EEXA 3KLJA 1UZ4A 3KEHA 3VM5A 5CC7A 2V30A 3SFWA 2ZA1A 4AC1X 4B3LA 4FOUA 3TWBA 3WJXA 4TV6A 1R86A 3PWIA 4ZMGA 1RV8A 1DTUA 4HHMA 4MWAD 3IVTA 5LXEA 1MDLA 1H41A 3BOXA 2X1UA 1JZ4A 3N9KA 4C6QA 1B3WA 4KH2A 1UR8A 1WKYA 1VFOA 1VIZA 4M6PA 2WLZA 2DIKA 3VMPA 4GJ1A 3ITYA 3VGEA 3AS0A 2EKGA 1WCGA 2WVUA 2YFNA 5FL0A 3WNMA 2PDWA 3BLIA 4QJ4B 2D0HA 4RV8A 1MW1A 1ITQA 4W5ZA 1FXQA 4TMBA 5K9XA 4C91A 2KAUC 1XC4A 1OSEA 3CHVA 3OBKA 4WD0A 1FEBA 4GVFA 3D47A 1TWWA 1EB3A 4YTUA 3ARZA 5EMKA 1KR1A 2ZWYA 1UP3A 3VKAA 1PJ9A 5C9XA 1YBQA 1YTEA 4PRWA 1AJ0A 3TXZA 3VDAA 3AC0A 4KT2A 3EPNA 1ADOA 3TC6A 2VWTA 1DVJA 1ODUA 3HO8A 4IFOA 3FXYA 2PGWA 4PBFA 5FF2A 4RV3A 1LRTA 2VX5A 4L6HA 5D05A 1Q45A 2QPUA 3P62A 2JK2A 2DUAA 5CXPA 5EMUA 1GHSA 5JMUA 4LX4A 3RPDA 3EA3A 1WA3A 4CUCA 1FCQA 3GHRA 3UG3A 1NF7A 3CQIA 5RUBA 3SCUA 3SAZA 1IIHA 4IIEA 4DQWA 3T42A 1NWTA 2NV9A 1I1XA 1F4HA 3WLJA 1F61A 2QGYA 1L6YA 1KRCC 2Z1VA 2JF6A 5CZSA 2CDUA 3W85A 2Y5JA 4HT3A 4YTQA 4OBRA 5EMJA 3IWPA 5CSYA 1QWGA 3DECA 3G2GA 2OT1A 5CPNA 3GLCA 1NF0A 2I5IA 1TTIA 1YPIA 2Z4GA 3E38A 3EKGA 4QS6A 5DCDA 1HNYA 4X9SA 1Q85A 2F84A 4IPPA 4M80A 3UYCA 2ZTJA 3E49A 4Y6GA 4IIHA 2Z25A 3S2JA 4A21A 1GEUA 2JIWA 5AVHA 2ZDRA 4JKMA 3SQSA 3E2QA 1UD5A 3KZSA 3B9DA 3ONCA 2PDJA 4ENLA 4M3PA 4M8UA 3LSBA 4BWLC 3NQ6A 4S3GA 2OYKA 3RN6A 4JTRA 2FZ8A 4BF9A 2J7GA 4F0LA 1FWHC 4ECLA 4X3ZA 3MPGA 1B54A 1A50A 2HK1A 1ZP4A 2WPBA 1QK0A 2HJPA 2AOSA 1KFCA 1HL8A 3WBAA 2JF7A 3VAVA 4NQ1A 1YE6A 3OYZA 4C6PA 4HKPA 4WSHA 4ZO6A 1VFMA 2NV1A 3GNRA 4D6IA 1Q1RA 1XR2A 3NZ1A 3UP8A 3P93A 3O0KA 4WJXA 5E0KA 3E5PA 4Z08A 3B06A 4R7JA 1EA0A 4ICCX 5BMWA 2V2HA 3HF3A 3I3EA 3HQOA 4JFTA 4IGSA 5L6UA 2Y89A 3TQPA 5DCBA 1OWQA 3HGSA 4RPPA 3QOKA 1IZJA 2YQUA 5GJPA 4PFMA 1LROA 2CBJA 5D32A 3W26A 1S5TA 3M5YA 3S5NA 1UIPA 1ISXA 1QOXA 2D24A 3RNMA 4CN1A 2WQPA 1WZMA 4KPRA 3OB8A 1ZAHA 2G3NA 3GTNA 5HAOA 3VIMA 4LYQA 1GREA 1XIMA 3ZQ9A 2DZBA 2BC1A 2RJGA 3A4AA 3M5VA 2Z1XA 2BZNA 2VX6A 3KOYA 2X1TA 4NEVA 2NXGA 1JRPA 4W89A 3EF6A 9XIAA 3P82A 1BAGA 3IIPA 1MRAA 4DO6A 1ZL1A 4FA3A 3G1XA 4IZGA 1JF6A 1XIFA 1E40A 3NQAA 1MEHA 2VL4A 3T55A 3SR7A 1UPMB 3GQYA 3GH7A 2Q8ZA 3TUUA 2X1RA 1VHNA 1HFBA 5AN7A 4F66A 3TEVA 2VC7A 1M68A 2GR2A 3VXGA 4CD7A 1JZ8A 4EWND 4H9XA 1M41A 1CB7B 1KA9F 1VENA 4ZO7A 5HK4A 4C6EA 1WPCA 4C7GA 2B7OA 5CC5A 1GRTA 2PDLA 3GBEA 2ZZ3A 4B5XA 5C71A 1RJPA 3KCLA 3LB0A 2PDBA 3KVMA 3T40A 5D2WA 1JQXA 1W5PA 3HMCA 1EPVA 3SUUA 4IMDA 1R3VA 2C79A 1HKKA 3PBYA 4CD4A 1ZXIC 2R94A 3K1DA 2QJGA 1TIMA 2OO6A 1P7TA 1T96A 4H8HA 2HQMA 3W1RA 1QPOA 4G7EA 4RNJA 2G41A 4AYGA 1PSCA 2PWVA 1V3MA 1XD1A 2I5QA 3BW4A 3CTLA 1PIGA 5HMDA 4AYSA 3BGAA 4O1EA 3BGGA 3GC4A 2QEZA 4WY0A 4JTDA 5CPQA 1S2WA 4IWWA 4OOZA 3GNXA 1UCWA 1J0JA 1E4IA 4CNOA 3K4AA 1R2SA 4NNAA 3B9EA 3PTKA 4DWSD 1ICSA 3LMYA 2A8XA 3YPIA 2E7FA 1LT7A 1GXFA 1Y5XA 1NP2A 3IGXA 3M41A 4WKFA 3MYOA 3P5YA 3AROA 4IUGA 4IHCA 2XFWA 4AIUA 4I6VA 3LBMA 3T0BA 1J0KA 2GGJA 2G4JA 3JS3A 2I57A 4JTQA 4DUVA 1W1VA 2YAUA 1MZRA 1EHNA 5M17A 3II1A 4HU0A 1IXPA 1JL8A 4EKJA 3MBDA 2QUMA 3CXOA 4HU3A 4GI8A 1I45A 4NYYA 3WLTA 3NQ2A 3BWWA 1UKSA 1V3LA 3R1ZA 4HP5A 1R7AA 4HCHA 1UHVA 3BMWA 5CJMA 5I3IA 4K8EA 2ZRYA 1X2GA 3SB0A 5C2GA 4MAVA 5F4XA 1G5AA 4AD2A 2EG8A 4UOJA 3O2LA 3W6MA 2PRHA 2GL5A 1MUMA 1P0DA 4YTSA 7REQA 1MEWA 2YA0A 3FK4A 2E0PA 3PTQA 3THDA 3EXRA 5HWMA 1C3FA 5KZDA 2WPCA 3DENA 5HPCA 1E6NA 1J0IA 3WQPA 1JZ5A 3HGOA 3L5AA 4MIMA 1FFVC 2V6OA 2CPUA 2J78A 4C6FA 4QGCA 3LBOA 4W86A 3I10A 4XBJA 1IXQA 4O17A 1W3TA 2NQJA 3V16A 2UZ9A 1EOKA 3O6DA 4BV6A 1Z6KA 1LBMA 4WR3A 2V81A 1XC6A 2XH4A 3N34A 2ZWZA 1GVYA 3MVTA 3SCSA 4NI8A 3BAXA 3PZMA 4BI5A 3CUXA 1E4MM 2XGZA 1AW2A 4CU8A 3CUGA 4GY1A 1PZ3A 1UR9A 4DUXA 3O3RA 2QCDA 4GISA 1R3YA 3RK8A 5BOOA 4JTAA 5I06A 5A2BA 4ZBCA 3SW6A 3B9AA 1SGJA 4XBKA 1UWQA 1D2KA 1UBPC 1PL9A 4YVXA 4NJIA 4DPQA 4X0VA 3WNOA 1EIXA 1U30A 2GGHA 3CHCA 2I16A 4PMNA 1GOXA 3TNOA 3B3DA 3CMGA 3GAYA 4PCFA 3NTYA 2QPSA 3CV6A 3CGBA 5B80A 2WAGA 4YIWA 4HMNA 3GC5A 1POJA 2WYSA 3Q94A 3UZJA 1YKWA 3QW3A 1FVPA 1QHZA 4XQ6A 1C93A 3S47A 2VO5A 4OFCA 3VX1A 3UWZA 1NTHA 2VUNA 5BYWA 4LXFA 3PUGA 4GIYA 4C6MA 4EQWA 5I07A 1VZWA 4YMZA 4LYPA 1UH2A 1YYAA 1X2HA 3CTTA 2W5FA 1HP4A 1QOQA 3VGHA 1Z42A 2FVKA 3LS9A 1V02E 4GIAA 3VDGA 1Y8BA 4NF7A 4JIRA 3MWCA 1X38A 1UD2A 1DQWA 1JG9A 4AD1A 2X1IA 4H6QA 1LJYA 2CKRA 3CIVA 3E0WA 3TN6A 3FX4A 1F6YA 4REQA 2Z24A 3RG6A 3Q65A 1RBOB 2OEKA 1D7FA 2O56A 4DAIA 3HGRA 3ZLHA 5G1TA 3NM3A 5F4WA 3A3XA 3W01A 1P6WA 3QR0A 4IL0A 2WZEA 4JQ1A 3OHMB 4HA0A 2X7WA 4H01A 4QEHA 3DC0A 4AX6A 3KLKA 1L6GA 3GNDA 5FSDC 4ZE4A 2Z2BA 1FQ0A 3BJSA 1SZRA 4DF0A 1UQYA 1AQMA 1H51A 3EEGA 4EM3A 3FIGA 1BG4A 1JPHA 3GTXA 1OT1A 4BJHA 3DYOA 2R24A 3HQ1A 1GEQA 1OFBA 2PEVA 3CWNA 3UY7A 2I56A 1Q63A 2I17A 5E6YA 1STZA 2FJKA 1ADSA 1C8VA 3DG6A 3UWVA 2A7NA 2WOQA 3ABSA 5JCMA 1NDYA 4CCCA 1RBLA 2WPEA 1MO0A 1UA7A 3KL3A 5CZKA 4B5SA 1MXGA 4AZCB 1RQBA 3LPFA 1T99A 2PPGA 1XLKA 4MNLA 3DK9A 1EWEA 1TJRA 3W1XA 3OTRA 2TRSA 1XBVA 3MW7A 2WSPA 3FLUA 3LY0A 2VRQA 1HKJA 3K4DA 2RKXA 3B4YA 2ESCA 2OO0A 4PRTA 3UZ5A 1CNVA 5L9FA 4CGTA 3DKLA 1MNSA 1XV8A 2ZZBA 3WBYA 3UT0A 3Q58A 3KVJA 1R3TA 1R46A 2ALDA 4W7VA 3A23A 2FB3A 3KXQA 4NRSA 2PCEA 2FHCA 3BLPX 3FYPA 2EKCA 3RU8X 5CPOA 3PJXA 3PZOA 1KM5A 5B7YA 1C29A 3NVVB 4WOQA 2C3ZA 2Q71A 2CHRA 4EXAA 2J8GA 2PS2A 2QCLA 2XFYA 1H50A 2JQXA 2WVVA 4R7OA 3Q2DA 2C6QA 5EMMA 1TREA 1T8QA 1W1YA 1U2YA 1GESA 1TX0A 4RUBA 3ZT5A 3UWEA 3UR7A 1R30A 1ZGDA 3RIKA 3SM0A 1VS1A 2OU4A 1X96A 2OLHA 3LXCA 1DJGA 1N60C 4IPLA 3EB2A 1GVFA 4P8UA 4C7DA 2BHZA 3DDMA 1KKOA 2QZRA 4Z1BA 2GVEA 1XL9A 2J77A 4KWOA 4IJBA 3APTA 3RMEA 1M03A 4NZCA 3SURA 3CLMA 3TQKA 3PFMA 4PBEA 1W5MA 4PCSA 5C0QA 1Z69A 2X05A 2OYLA 3T7VA 5JIPA 4OJYA 4PSRA 1CXFA 3IC9A 3VINA 1WKDA 2RDTA 3U8GA 2AL2B 3KBMA 4KIRA 5AZ1A 2H3BA 3PK7A 1TQXA 1BWLA 3UJ2A 4K7YA 3DFHA 1PIIA 1A5KC 4W85A 4GQBA 3JUGA 1UH4A 4JL2A 1U1HA 2AQWA 4A8LA 1N55A 1VJZA 4Q7NA 3S1WA 2ZDSA 3WLNA 4Q7IA 1NHQA 1HF6A 4IIGA 1E1EA 1BVWA 3I68A 2C18A 5AC7A 4IQLA 4FO4A 1NWSA 4INFA 3IIXA 3W1NA 2BGSA 1WUEA 3T0TA 2QNEA 1BRLB 2R82A 3H4KA 1EDGA 5FAGA 4QLJA 5T91A 3U6WA 1DJNA 3WJWA 1CDGA 1XG4A 2HRWA 2XVPA 2ANUA 4J3TA 1XBXA 1XG3A 1DJZA 4HNVA 4HMEA 2V3EA 1OJXA 2Y7DA 3O15A 1L9WA 1LRNA 2PFHA 1IWBA 3CHDA 4G5DA 1ZHAA 4IGMA 4W88A 3UWWA 4RNFA 3N13A 4XAFA 3W81A 4EAMA 4QJ3B 4FOKA 3RPMA 3AHVA 1QW9A 1XUZA 2O9OA 2PURA 1XBZA 2EJAA 3N4EA 3L67A 4JTGA 2IXUA 3EKLA 4GJIA 1SYTA 2P0IA 2VHLA 1JFHA 4MUPA 1W3IA 4RR4A 5FEXA 3AMDA 3GDRA 2BVYA 4D6EA 3ENLA 2BOGX 3UJRA 2XSXA 4R27A 3GYEA 4LNYA 5J5DA 3BUVA 2XWEA 1QW7A 1F3EA 4OWGA 5LGZA 1G1YA 5C6MA 1DJHA 1I2NA 3CMFA 1SVDA 4XBSA 4PUUA 1MUCA 3CPGA 3M0ZA 4TVWA 4X61A 3P8IA 4P7RA 3ARXA 4TX6A 1KXQA 4XVDA 2CCRA 3W24A 2A3EA 3LMZA 4AW7A 3GW0A 4BS0A 3LU2A 2W66A 2FLIA 5AOUA 1Z8AA 1FDZA 3TSDA 4RJEA 3LX9A 4E5TA 5GQBA 2PGEA 5CKSA 3CB8A 1RCQA 2QUUA 1EBGA 4FP1A 4E2BA 4I9MA 4Z0SA 2PSNA 2PP1A 3CT2A 3VA8A 2VZSA 1EZWA 1BF6A 2AAAA 5DXXA 2WMFA 2E3ZA 3BSGA 3HMJG 3ITCA 3W28A 2VDGA 4OV4A 4IJRA 1E55A 4XZNX 3UGVA 4HNTA 3V4BA 1OF8A 4CQBA 5CSUA 1V0LA 5DFAA 5HQLA 5HR6A 1TR1A 2ALRA 3VNIA 3NEHA 5DMNA 4QCEA 1KN0A 2ZE3A 2V5CA 2GFTA 4DJDA 5AC4A 3W7HA 3L4XA 1AH3A 1TWSA 2X50A 3IV3A 3C2FA 1OYAA 4D6CA 4PB4A 2BY1A 1NWRA 3V35A 3O6AA 1PB0A 5H8UA 4K7ZA 1PIFA 3PAJA 1HKWA 3BPWA 3M0YA 2MNRA 1TV7A 2FH6A 2Z26A 3TWAA 4AD3A 2BASA 3EDEA 3VU2A 1M04A 4A29A 2EQ7A 1JCYA 3O8AA 3LCLA 1QOPA 4ML9A 3CIXA 2YDRA 3K13A 3PZVA 3W2MA 5DMYA 1ONFA 3D0CA 4HN8A 3F5LA 1BVNP 3NSMA 3COTA 1YNYA 1FH7A 3AYRA 4UQEA 3ANYA 5CSSA 2J9ZA 4LRTA 3UA3A 1UB3A 4NL1A 1E5NA 3GTIA 4YU1A 5E6ZA 3LOTA 4J35A 4WKHA 1XDJA 4WX2A 4TVYA 4H41A 3P7YA 3QMSA 3VZXA 2OLAA 2BWGA 3RO6A 4EWJA 4B5WA 4N0RA 3L0NA 2QIWA 4DAFA 2XIJA 1DQXA 3WX7A 5I0DA 1A49A 4PMRA 2J7BA 1C92A 3T2QA 4H6RA 4H00A 4IG2B 2PMQA 1TJPA 1H2JA 3NGFA 1V0KA 3SSZA 4WJEA 1J9YA 4JTUA 3VPLA 3HB9A 4IMAA 3GXPA 4XUGA 7XIMA 5E5CA 4F4RA 2Y7FA 1D7KA 1NAL1 3CGCA 3VKCA 3K2GA 3W7CA 4Q8OA 4XIAA 3LG3A 1NOWA 1RP9A 2BMBA 3S1UA 2VD9A 1X97A 2A3AA 5HUOA 2WBAA 1JUEA 3TKFA 2HNHA 3BAIA 1W32A 2QVHA 2Y5EA 4DO4A 2ZVRA 3N25A 3PB2A 3IPWA 3OP2A 3IS4A 2YBVA 3IJ9A 5CGMA 3TK7A 4B5UA 3IVSA 1E9IA 2BP1A 4JYFA 5A6MA 1ICPA 1K4QA 2FZDA 3LBCA 3CIWA 3NA8A 5IRPA 2WWDA 1YXYA 1I2OA 4BCEA 3CLWA 2A3CA 4F8XA 1Q7MA 4TX9A 4DZIA 4JNYA 2JGYA 3BOLA 2DT0A 2QAPA 2W67A 4WXZA 1TO3A 4HBKA 2D0FA 1EJVC 1H7OA 3THUA 1ONEA 4LUSB 3TYCA 4IPNB 1IEWA 1GRBA 3EEZA 3CBWA 3KUMA 2VUYA 3B8VA 1DP0A 2DT1A 5FD0A 1BQGA 3EOEA 1F6PA 1S7MA 3NZGA 3CM4A 3HFYA 4O4WA 1X7FA 3GVGA 2QV5A 1P0BA 3NL5A 1F7BA 1PTDA 2OWXA 1OG0A 3WF3A 3PAOA 2QDHA 3BCJA 2V38A 1VJIA 4HSNA 3VC5A 3KL0A 4H9YA 4HK6A 4I7UA 5A3HA 4H4UA 2F9RA 3NQBA 4DVOA 4GGBA 1JPMA 3H24A 4C90A 1Q6QA 3P80A 3ELFA 2B4GA 4HA3A 4D1JA 2QDDA 3GKAA 3NVTA 3AIEA 1SFLA 2W0HA 1CB2A 1YHTA 3H7UA 2WZMA 4WJ8A 2CLIA 1SQ7A 4JEQA 4NG3A 3BLKA 3R8GA 4L80A 3G22A 2D2GA 1M53A 2VGBA 1I2RA 3M0JA 2QQ6A 3FEMA 3AXIA 1G0CA 1CXIA 4R9OA 4M24A 2O7QA 5C9ZA 6TIMA 1PVNA 4LNCA 1XGDA 1ZBVA 4QNWA 4DI8A 1MXDA 1YDNA 1HKIA 2WMHA 1ZJBA 1ADDA 2NPXA 4S38A 2GOUA 1XYAA 2PI6A 5DXYA 5A2CA 1OX5A 2VTFA 3FGCA 4NZ4A 1YX1A 5M2FX 3S2NA 1O7AA 2WSYA 4Y9OA 3H2AA 4NNCA 4OECA 4ZTXA 5KTLA 4H4VA 1DWGM 3GG1A 2WJDA 4N2YA 1KV8A 3V0UA 4X60A 3EMCA 1AQFA 3HZ3A 3WQEA 3W88A 2GDUA 1EUNA 1CECA 2VR4A 1XIGA 2QCHA 2PB1A 3MT1A 5GJNA 3GM8A 2AAQA 1B9BA 3W75A 9CGTA 3K1GA 3H22A 2GUUA 1DWHM 3OLGA 2Y63A 3VMOA 1UOKA 2BX7A 2VP8A 3ZVIA 5AHMA 3DHFA 4GQGA 3G1VA 4ADSA 3UPMA 4PTVA 3NSXA 2PDXA 3NVWB 1NM9A 3D3FA 2XGBA 2G5WA 3QYSA 3ZR5A 4FHAA 4CN4A 4EF8A 2AQVA 3WK2A 2EPLX 5DLCA 3PNZA 4LAMA 3NDOA 5BU6A 3DXIA 4KGJA 1LUCA 4BQ5A 3B97A 4MZ1A 1X6NA 1QNQA 1GTEA 1QNVA 3T07A 1TRDA 4MPQA 3CZEA 4YLWA 3RHGA 1EBHA 1IXOA 4GYPC 4MYXA 1NQKA 3NQDA 5HMSA 4EMIA 4YVVA 4JIHA 1W9VA 3WK0A 1L0PA 2POZA 4LFYA 3QF0A 5C8BB 3D3AA 2VEIA 2H90A 4FNQA 2BOEX 3O63A 5K3VA 1J96A 3A9BA 3CGTA 4AF0A 1SFSA 2PGRA 3FJ6A 2I9UA 3W7JA 3M0MA 1OINA 4FLSA 3WFAA 6CGTA 4JR5A 4CU6A 2FFCA 1GJPA 2C1IA 4O12A 1AW5A 3TYUA 5HJLA 2VOMA 3ZT6A 4Q6JA 3VD5A 1W31A 2DZAA 4GZJA 3GG7A 1S1RA 3VIOA 1UASA 2O7SA 5GNYA 4U3CA 3GFXA 5ABFA 1LBLA 4O15A 3W2NA 3GRIA 2QAFA 1XLMA 4UZSA 3GDKA 3QHOA 4XISA 3WELA 4M82A 4AZHA 4XK2A 2V3BA 1AK5A 3SN0A 4CD6A 4DF1A 1S39A 1JD7A 3QY7A 3SN1A 4AISA 1SZGA 1FWNA 4UFKA 1ZLPA 4YVPA 3GVRA 1F6KA 3N2MA 1HKMA 2CYGA 1LM1A 3I3BA 2KZHA 3URHA 1QT1A 4JOMA 3F2DA 4O1DA 4E2DA 4ZXOA 4FNRA 4DXXA 4ZSUA 1TPH1 5KITA 1GZJA 1R3WA 3AYSA 5K9CA 1ME8A 2WBGA 4M81A 3NL2A 1AJZA 3SCNA 2L5HA 1KKRA 3TJIA 2VURA 1ESWA 4AAJA 1QTWA 1TB3A 1XQLA 3L23A 2QCNA 2PWFA 1ECQA 1VJSA 3DCPA 1TSIA 1CT5A 5EYWA 1QO2A 4UIOA 4KS0A 1A5SA 1RM6B 4GXPA 3N6QA 3UWUA 2G97A 1FHLA 1H7PA 2YCEA 4S3AA 3QOMA 4V27A 1NDWA 3A3WA 3VKJA 1S5VA 3MANA 3SCRA 3LPGA 2VZTA 3VFLA 4IF2A 4FR6A 5TQLA 2IKIA 5GRTA 3KRZA 8XIMA 4A3UA 2GH5A 3HPXA 3GG8A 2F2KA 1XH0A 3P81A 2WM0A 5DBTA 3R2GA 5EB8A 4JIPA 4DJFA 1QI5A 1XM3A 3WIJA 2VCAA 3BZJA 3R0UA 3HQNA 1OK4A 1ONRA 4ORIA 1BPLB 4CN6A 1UR0A 4QG8A 2PODA 4UTMA 3EB4A 2YL9A 5A6TC 2W6RA 4DYEA 2ISFA 4BY3A 1K8CA 4KWWA 1WYGA 4DBEA 3BICA 4Y9NA 3CZ8A 2XG9A 1XYCA 1M01A 2W62A 3O1NA 4UXDA 3M16A 3KDNA 1C7TA 3THAA 5A6BA 3V5FA 1WZKA 1OABA 2YYUA 2BGQA 4IG2A 1EL3A 4IFKA 4LCRA 4B5TA 3GC2A 3PPCA 4LS1A 1XYMA 4TOQA 4QAIA 3W07A 2VM8A 3FY1A 4LU0A 5I09A 2P10A 4FLOA 4ZVJA 1EC9A 2BC0A 1DWAM 3LGGA 1QHOA 4H9ZA 1E9YB 4GFSA 3ARPA 1EXBA 4FEZA 1X6UA 2POTA 3S42A 4HHLA 4AEFA 2ZRZA 1WB0A 1EX1A 3CZGA 1NU5A 1A5CA 1GTHA 2Y2WA 1ZJAA 3NQVA 3TLQA 2HMCA 1ZKQA 4UFHA 1Y7VA 5KZEA 2GLKA 2R1PA 3PPHA 4B2DA 2XVLA 2FPYA 2BBFA 2BXYA 3AS1A 3WSUA 2NX3A 3G0XA 3W1UA 2WNQA 2JGQA 1E43A 4MKSA 2CFYA 5KZMA 1B0IA 4PFHA 3T4WA 1AZ2A 4K68A 4P8WA 3RR1A 4DJDD 3O6CA 1V6XA 3I3DA 1WKEA 4JDYA 1SSGA 2BDQA 4LF1A 1JYVA 1FHVA 5F1VA 3LZ3A 1L2UA 1ZS2A 5JCLA 2VEPA 1JNDA 4O1FA 3F2BA 3G8EA 4H8VA 3IANA 1AQHA 2OGJA 3PTDA 2RDXA 3E0LA 3C86A 3T2OA 4O16A 4IPJA 1SO3A 2FMOA 4DRSA 1OBAA 1UOZA 1HO1A 1OYCA 2ZRWA 2OZ3A 3E2RA 3C0LA 2WJZA 3QM3A 3L4UA 4GXWA 3CEUA 4UNKA 4YYCA 4G8TA 1D3GA 1JRCA 1MYRA 4M1BA 3KM8A 5TF0A 3NQEA 1LL6A 3RYSA 4YCPA 1J8VA 3L21A 4J3WA 4H7ZA 1TE6A 3M0KA 3GRSA 3A6OA 2B31A 1BWCA 2I5GA 2X8RA 2VMFA 5IDZA 1ZENA 1CPUA 3M7SA 3ZYZA 4K1GA 5CEWA 4HJWA 1LF1A 3WEZA 4HZ8A 4RXGA 1CGVA 3DK8A 2DSKA 4BFAA 5AYBA 4DNMA 1L6FA 1X8FA 1YMYA 1KRAC 1DKWA 4CQ8A 3V5OA 4U10A 1WDPA 3CV1A 1CLVA 3WMSA 4NZJA 1VBHA 5FJPA 3OU8A 3GXNA 4Q7BA 2VELA 3DUGA 3FHAA 3UR8A 3NPXA 3RLVA 1V79A 4M51A 3BDKA 4L1XA 3AM9A 3K5XA 3FKRA 3R10A 1UWUA 1P6BA 2R1NA 3UJFA 4E4FA 2Q3RA 2INZA 1ZJIA 2OCZA 2P53A 1GOIA 1JF5A 4FLRA 3B40A 3NOEA 5JH1A 3PSVA 2X0YA 3U2EA 2P8BA 3IK2A 1Q6EA 3TA9A 3S5OA 1A53A 4L9YA 4ADWA 5F7UA 3WCZA 3SQPA 1N61C 1ZY9A 3MCOA 1SJDA 2J62A 2J7HA 1ZSXA 5CPMA 4PYSA 2DVUA 2PDIA 2GZXA 3WN6A 3FOKA 5U7SA 1R38A 1HGWA 2QMKA 2PF0A 1OVDA 1M6JA 7A3HA 5BOFA 3B8SA 4ZO8A 3SRHA 3OODA 3CZLA 1W2PA 2ASHA 1XIHA 3LLXA 4QTGA 4MJMA 1RD5A 2E8YA 2WMJA 1B3XA 4LJ3A 3EOUA 4DN1A 1B30A 4GIRA 3BLFA 1ZUAX 2H8XA 1KM1A 1O1HA 3VGBA 1V02A 1IR2A 2DT2A 5I3DA 8TIMA 5JVLA 2CZDA 3M5XA 8CGTA 2ACRA 2YBTA 3OQ8A 3B0YA 2Y70A 3CQHA 4B5VA 3F4VA 5LZLA 2HPMA 3CAKA 2YIHA 1TWIA 2E25A 1KFWA 1QMLA 1UJPA 3LERA 4IQJA 1WV2A 3NZRA 5A6SA 4IM4A 1H5VA 4H19A 2Z28A 4NXKA 3CQ0A 2PTWA 2ZXDA 5ABEA 3KVLA 3S5YA 1VFSA 3ONBA 1HP5A 5JXQA 3TNBA 2WC4A 1OX6A 4JTSA 1FWJC 1VQTA 4WGHA 3ZO9A 2DJLA 4PUDA 2V2CA 3W00A 4UTWC 2YDSA 2QMJA 4XV0A 1Q6LA 2GR1A 4J9JA 4GFIA 1I75A 2EQDA 1QBAA 1GNXA 4O28A 2HXUA 4OUEA 5DMMA 3VOCA 1XRTA 3DAQA 3WK1A 4DZHA 2X42A 1LCOA 5TAOA 1ITUA 1YE4A 3F5JA 5FEZA 1RVKA 3K8LA 2ATMA 1HG3A 3A13A 1GSNA 1H7WA 4AEEA 2NLIA 1PTAA 4D8LA 2NX1A 4JXCA 1M65A 2SFPA 1UUMA 1J6PA 1TG7A 4MHBA 1A5AA 5LGXA 1GEHA 4CNSA 2CC0A 3WD1A 2YVJA 5HOSA 5BXTA 1YRRA 4CNTA 3KL5A 4HGXA 1IQ8A 1KQYA 2PP0A 1UG6A 4AMAA 4Y8EA 3D46A 3PWGA 3UVIA 1WNOA 4IXXA 5D8WA 3IJ8A 3OGSA 3KRSA 2EHHA 1AG1O 4H4SA 1CLKA 4LV4A 3C2EA 4U4MA 3UERA 2DVXA 4NIRA 3MSYA 1I8JA 1Q7QA 5IM51 1V6WA 4AHOA 4IL2A 4BI7A 4NRRA 2FH8A 4H7VA 2V5KA 1UWAA 4OE7A 3AOFA 4LPCA 1XCFA 4PH6A 2YB4A 2WNZA 2E9MA 2NQ9A 2VNCA 2GVYA 5A2AA 1LPFA 4IP4A 4BQ4A 5BZAA 3EANA 2IQDA 5ABGA 1WP6A 3C0SA 1EX5A 3DIPA 3PY2A 4JFSA 4AWSA 3S6OA 4ZXLA 1PZ0A 4J1OA 4JTTA 2E5CA 1JCTA 1ISYA 3N29A 1EA9C 2E1WA 4K39A 4LVAA 1ZP3A 2EGZA 3EX1A 2WB5A 1KGUA 5CPSA 4FX6M 1MEIA 5FIPA 3NJ3A 4J2MA 4E6MA 4G1NA 4QJ5B 3UXIA 4LT9A 1RA0A 1TA3B 3VIGA 1ZAIA 3WQWA 4C6NA 2R9ZA 2F6KA 1FH8A 2G50A 2IMRA 3IJ7A 1HJQA 2VJXA 5FS8A 3CAVA 1E0XA 3SN4A 1TYPA 3PVFA 2C71A 2FZ9A 1BYCA 3EX4A 1XYLA 1BZLA 4UTKA 1C8YA 2BTMA 1T6MA 3VD7A 3TSMA 1LOQA 4E0CA 1QRQA 1XLLA 4AD4A 4XSLA 2EQ9A 1UJQA 1TUXA 5FJUA 2CZEA 4ZQOA 2Z1WA 1I6NA 3DERA 3SIZA 3ANUA 3V3WA 1GKQA 1J2BA 4TTUA 1HL2A 4KIEA 5I78A 4H4YA 3BMVA 1NDVA 2YBUA 4KETA 2OVLA 4L65A 3KS6A 4WY0B 4N9BA 2PCQA 1J0HA 3WLKX 4ZCWA 4EAYA 4WZHA 4UCFA 4W5UA 4NX0A 1QU4A 4NSBA 2E6FA 5CLTA 3C2RA 2J9XA 1TV8A 3ARYA 4DHGA 5HNTA 4AXNA 1C8XA 1LORA 1XLBA 3MUCA 3W84A 1B3VA 3BAJA 3KRBA 4JEJA 2NVAA 4JTIA 1ZZMA 3H55A 1P5BA 4M56A 4B4FA 3B9OA 2ZXQA 4LGXA 1UMYA 1HIZA 1EDQA 2FDSA 1PX8A 1US0A 4US5D 5KINA 4WDTA 1D8CA 3HOJA 4I8YA 1QDSA 4DWSB 3BLEA 4EX4A 1SO4A 3DX5A 3EOSA 3RILA 4GNJA 4DPPA 3BG3A 3EA1A 3CL8A 4JY9A 2ICSA 3EOOA 4AZ6A 2YCLA 4KMQA 1FUYA 3AUJA 2CLOA 2Q09A 4O57A 3MMTA 1DHKA 3LPPA 4H9UA 4KEUA 4Z2IA 2DH3A 1JCNA 1R3SA 5GVJA 2BODX 3P67A 3UWQA 3VOHA 1TMHA 2J6XA 3M6DA 3TR9A 3TMQA 1LG2A 1YXCA 1E15A 4X63A 2YL8A 1REQA 4NASA 3FA3A 4P5UA 1N82A 4U5KA 1O5RA 2YW3A 3PUEA 4AZ5A 1LWIA 4C7FA 1FH9A 1QO5A 1MOKA 1FKXA 1OC5A 3U0HA 4DLFA 1PCWA 4GVGA 5AECA 1DJYA 3WO8A 3MUZ1 4XZHA 4R5EA 3HG5A 1DJIA 2FTPA 3NIYA 5CZTA 4C1LA 4PMUA 4H3DA 1V97A 2FGZA 1W9XA 1F3PA 4R85A 4KFPA 1KV5A 5H8MA 2WJEA 5J8LA 2ISVA 3MSGA 3LNMA 4YPJA 2JKEA 3KTSA 1FWDC 4MGGA 3UR2A 1EJXC 4J57A 3DYPA 4HTYA 1S1PA 1LZOA 1HZYA 2QCDB 4C6IA 5A1AA 4MADA 4IISA 2ZUSA 3BW2A 3MHFA 1ZY8A 4N42A 5HQMA 3DGZA 3RM4A 1LG1A 2DIJA 3EX3A 4DXKA 2GJLA 5DMLA 4RDZA 4I7VA 3WDIA 1XPYA 3LHUA 3VIIA 3V5CA 4YNGA 4P61A 3A21A 1M6IA 2OLSA 1CW2A 1RPKA 1GQLA 2Z27A 3TCEA 1XFBA 3URQA 1A5LC 4HNCA 1H4PA 1UP0A 3UZYA 3UG5A 2P1FA 3W37A 3KBNA 2WHMA 4MWAE 1E0UA 1LTDA 4US6A 3L4WA 4LQ1A 1IWPA 2Y24A 4NJHA 4DYJA 2J7DA 3BJTA 4ZODA 1FTXA 4JTKA 5HJXA 1JEZA 2Q01A 2W61A 2BHYA 3V0TA 1C9DA 5DQPA 2DJXA 2LLEA 4EQRA 1BD0A 4OOUA 1QASA 3HA1A 1FP9A 1XANA 3PBGA 3UPWA 2INEA 2VEKA 5G2HA 1O5KA 1JUBA 1CXHA 4HU4A 1L2QA 2XH0A 3GNOA 4A8RA 4D9PA 3WLPA 4N4PA 3TX9A 3LQLA 3PZNA 3H23A 1PAMA 3L7RA 5T9CE 4E3VA 3NVDA 4GCAA 1M9HA 3SRFA 2NZLA 3UBPC 4GZEA 1OX4A 1A4MA 4UUIA 5E1QA 3QGKC 3MQTA 3LSCA 4GH3A 3SUTA 4LF2A 4LUTB 5ENLA 4APNA 3LYEA 5EFDA 2R1MA 1HO4A 1K70A 2IPJA 1WAWA 1IWAA 4WQ6A 2KX9A 4YJ5A 4Z1AA 4DJFC 5LHEA 1R2RA 1KFLA 1GERA 2QR6A 2GOKA 4QFUA 2OODA 4R7WA 4C6BA 2Y8KA 4KQNA 1K9DA 1KTNA 3BCDA 3LHTA 3SCQA 2IQ0A 1ZBCA 3QSTA 1YTKA 3PJWA 4A4AA 1K77A 4MSSA 2YZ5A 3ISIX 3R11A 1ELSA 3VNLA 1ZAJA 4DJFD 1H5YA 3RCNA 1B3OA 1RD6A 4DF2A 3BJFA 1LWJA 1K02A 3MUY1 4QNEA 4F0KA 3I6EA 4PUJA 3H2MA 1S3TC 2OZ0A 1N63C 3E3HA 1SW0A 3QC3A 1R9XA 4M0XA 3A4XA 5EU9A 1I60A 2V5DA 4RL3A 4FIRA 3ECQA 3TQVA 2PDGA 2PGFA 2V8ZA 2HNEA 4QDWA 3T4CA 4AY8A 4UMAA 2DVTA 4Q8TA 1TTQA 3M46A 1W5NA 1WAUA 1VPQA 3ZJ6A 3PUDA 4JCLA 4OVXA 2WQDA 4XKMA 5CQ1A 3W7LA 1GVIA 1OX4B 1F2JA 1TYGA 2P5NA 3TJXA 2DZXA 4D2JA 3R8HA 2ZXAA 3B03A 2F8QA 3RU6A 1GRFA 4PB5A 3LCXA 1J5SA 1VF8A 4YTRA 3TAOA 2Q02A 6XIMA 1DXLA 3SGGA 3OVRA 5FJTA 2DSWA 3L2LA 5IHRA 3NO5A 1ALDA 4FNSA 3UJSA 1WDSA 4BEQA 4ZOEA 1G7UA 5I23A 3L65A 3UCDA 1VB9A 4CD8A 4XAZA 2MANA 2HVNA 1OM0A 4KRTA 1TZZA 2BVDA 3BLLA 4QG6A 1F3XA 5ABTA 1KD0A 4ES4A 1EZ2A 2XM2A 3H70A 3MSRA 3W7EA 4LUIA 5T26A 1TVLA 4DB7A 1XD0A 3UXDA 4U31A 1OD8A 1TA3A 3AXHA 1XKYA 3IACA 4H04A 3B0PA 2IS7A 2TPSA 3CS2A 2QXWA 3UESA 3ETRB 4FNTA 3LRMA 1NQ6A 5M1TA 5FJRA 4RCXA 3FDKA 1TX2A 1XDIA 2DIEA 2QPXA 1M3UA 1TCDA 4M29A 4PN2A 4WLCA 1PTGA 2PA6A 4GJJA 1PWLA 3DFQA 4H4PA 3H53A 5K9DA 4ERGA 3U2CA 3L2IA 4ICNA 4FS9A 2A5HA 3EWWA 1WZAA 2D20A 1BRLA 5BRQA 1J79A 1N8WA 1BYDA 2REQA 1PHQA 2PU1A 4DZ5A 3QY8A 5I6SA 1DXIA 1XQKA 1MW0A 3PJUA 3ZSSA 4QP0A 5JCIA 2C13A 1TWZA 3OZOA 3B8TA 2BCPA 2AMXA 2CITA 2GGEA 1PKLA 3WBWA 3XISA 1KM2A 1WOBA 8RUCA 2V63A 3GYCA 2PWGA 1OF6A 2E6YA 3BLDA 2DDXA 4FF5A 2Y62A 4DYKA 4DM1A 2BY0A 1GK8A 3FVDA 5G5HB 4RZ6A 5C9UA 3UR5A 4HMDA 7TIMA 1VEPA 4AHQA 2G8ZA 2OB3A 4Z1YA 3FJ4A 2OMAA 4FAMA 2EPMX 1CZ1A 1BSLA 4L6DA 5GNXA 3OLEA 2O55A 1RZMA 4IXHA 2XHYA 4WVXA 3CUHA 1EJSC 2ZE0A 5U1OA 3A47A 4MWAA 1UUQA 2NWRA 3E12A 1BWKA 3MCMA 4EP8C 3IUHA 3TP4A 1R3QA 3AISA 1LBFA 3SY5A 3AIVA 4GHRA 1XLHA 3DBNA 3NZPA 4J27A 4JL1A 1AH0A 1PX4A 3FXGA 1V0MA 3VCCA 2F61A 3WQFA 1NDZA 1LQAA 1YPXA 3KFTA 1V8EA 2ZFAA 4QJ1A 4L1GA 1AMYA 4C6LA 4XZBA 1KQZA 4ZENA 2W3SA 2NV2A 3TN4A 1DL3A 1NOUA 1Y65A 3M0VA 1VYPX 2PD5A 5G5GB 3GHTA 5M03A 3E0IA 3DU0A 1MFUA 1RXOB 1Q65A 2X8HA 3AJXA 1E4LA 1F73A 2CLMA 2EG6A 1QATA 3MTWA 3P8JA 1NELA 1H0GA 3FSUA 4FX8A 1A0DA 4HZ6A 2RDWA 3TR2A 1FWGC 4DBWA 2OKOA 1JGIA 2PAJA 4W7WA 4Z2KA 3WJZA 4LW7A 1QAPA 3EWZA 5I77A 5KZ6A 2DQWA 2DT3A 4PMZA 1QJWA 3SBFA 3MZNA 4U2YA 1D8WA 5BOEA 2PWHA 2DZVA 4JZ5A 2GJNA 3U2ZA 3EUB3 3U9IA 4MOZA 3VK5A 4XZLX 5CPLA 3RLUA 4D6FA 2WW5A 2NQZA 3FW6A 2DP3A 1GZGA 4JFWA 4NVTA 1AL8A 4O10A 4J3XA 3TZFA 2NT1A 2CLLA 3U5YA 4GCXA 2WCGA 1GOOA 3NXLA 4MFDA 3ITOA 1OCQA 2OR2A 2PDQA 4L4PA 1JDFA 1UH3A 2CXEA 3OOQA 3VFCA 3W7DA 3G8RA 4RE0A 4HPNA 1W3NA 1HGYA 3LCWA 4ZB2A 1W1PA 3WEOA 1U1UA 1F74A 1KM3A 1YLVA 5KMYA 3L68A 4O53A 3TV8A 4UOZA 1Q6GA 3M47A 4YWIA 4S3JA 2BGNE 1XYFA 2UBPC 3BSHA 2GJRA 3EDKA 4K8DA 5HUPA 1VD6A 3NFUA 1RK6A 2BNJA 2WMGA 4ZFMA 1OCNA 3OG3A 5DN1A 1TPB1 3WLOA 1VP5A 5JH2A 2J24A 3W38A 2NUYA 1K4HA 4GI6A 4DLMA 2W3ZA 3TJLA 1TQJA 3ZVHA 3PP7A 3CYVA 3MDUA 5H2ZA 3QXBA 3AXXA 1A5BA 5BNKA 1XFCA 1JZ3A 3WNNA 1YDVA 4A2SA 3G1DA 3R7MA 3VDHA 1JZ6A 3BSMA 2YR1A 4K8HA 3LI0A 3KOXA 3BK0A 3R0KA 2B7PA 3UPBA 4X2RA 1AVAA 4AEOA 1NARA 1S5MA 2JE8A 2Y8UA 3VKBA 2OPJA 3WDRA 2HV5A 2F6UA 4KPLA 3GY1A 1DIKA 5HPOA 3M4HA 3CT7A 2P0OA 4CU7A 1B57A 1KGXA 3W29A 1QI4A 5FACA 3ZS4A 5AHFA 1LQ2A 4GC4A 3A9IA 3SIMA 5MKGA 2YDAA 5XIAA 1X1ZA 1K3UA 4FDCB 1TV5A 2JEPA 5F2GA 1ZRQA 4R9XA 1I4NA 3TFXA 1NHSA 2VVSA 4P7QA 2G4FA 3OBEA 1BTCA 1IT8A 5CH9A 1WXJA 2ABAA 3V75A 2EPNA 3AIRA 2WO5A 4QG9A 4GY0A 4WDUA 2D3LA 4H6EA 2WHKA 3O06A 3LLFA 3UXKA 3NQCA 2YCJA 3OG2A 1G4SA 2WKGA 2HEJA 1CXLA 2C1GA 2A1YA 3VUSA 4AX7A 3B0VC 2EJ1A 1A47A 3W83A 1KCKA 3MI2A 4JS3A 4A3HA 1ODZA 2ZBTA 2ZZ4A 1R8LA 1YNQA 1PKYA 2YA1A 2PUZA 1D7YA 2UWFA 3LM3A 3DH9A 1C8QA 1PX3A 3MU7A 3BV4A 3MY9A 4BR1A 3GB6A 4N6FA 2GSEA 3SUWA 4V1YA 3DC8A 3RXZA 1GPWA 4JYEA 2VGIA 1TUFA 4M6QA 1TZ7A 5LNVA 1FECA 5EPDA 2UY4A 2A7RA 1AW1A 3WUBA 1H11A 3GTFA 2P3EA 1KRMA 5C2CA 3DEQA 4LWWA 2VRKA 1W91A 3SDOA 4IX2A 4XAYA 3IUIA 2PRLA 3S0CA 3AYVA 1RH9A 4GBUA 5FESA 4E2OA 5HR7A 1XHCA 1GVEA 2WHJA 3OPSA 1EQCA 4Z1DA 2GQ8A 3PB0A 3OYXA 4UNLA 4C6KA 1ZPTA 4N4QA 3AUOA 3J7HA 4XSMA 1S46A 2E4TA 3FG2P 1YQ2A 3TSBA 2GPTA 1FWSA 4FXJA 4OKDA 1GVSA 3TC3A 5D2XA 2PTYA 5DRCA 1GW1A 4HVXA 1EGMA 3UYIA 2WKJA 1QPQA 5LKYA 4LH8A 4IIFA 1H7RA 1NDAA 5FJOA 3G3MA 2GR3A 1IEXA 3AMLA 5JQ9A 4FF7A 2NUXA 2V0TA 1QI3A 4CQAA 3SADA 1F8MA 3VX0A 3BQ6A 2WSRA 3GG0A 5JIWA 4LAZA 1E4NA 1Z89A 2O92A 4JTHA 2J25A 3ID7A 3VNDA 4G1KA 3PZ9A 2H9AB 3AS3A 3WDQA 3TTQA 4GR1A 2C7FA 2V67A 4PMQA 3USBA 4IMFA 3WQ5A 3CO8A 4MF4A 4DBUA 3VZZA 3N1AA 3URAA 1XBYA 3CH0A 3E74A 4L64A 1SUXA 3JR2A 3U48A 4JPGA 1V08A 3VIKA 5C54A 3GZ3A 1WO2A 2VZVA 4QE5A 4HPJA 2X16A 3B04A 4GYPA 3GFZA 1TZ9A 1OIMA 1NY1A 3MUXA 1KM0A 5DANA 3L4VA 4EQSA 3RMJA 1UKTA 1ZU8A 4GABA 4XG1A 2IPFA 4UR8A 1VDVA 3WH9A 1BGAA 1F3WA 4GINA 1YW1A 5AZ0A 1AD1A 2VFHA 4AF0B 1ONWA 4F0RA 2BB0A 3QVQA 2FZNA 2DFAA 2C3DA 2PZNA 1E6QM 3GW3A 4HYRA 2E40A 5CJ5A 5C5YA 1J4EA 4F3HA 4GD0A 3U57A 4XWUA 3T2PA 4D8AA 3ORWA 2ZKMX 5LNUA 1IR1A 4QS5A 3AJ7A 3FHQA 2I7GA 5XINA 2PDCA 3G1SA 3OA3A 4S2BA 3C2VA 3MDWA 3WJSA 1CYGA 1A80A 3N9SA 3HURA 3FAXA 1B1YA 4FI4A 3SCPA 4PCNA 3W3OA 1PBGA 3T05A 3W7QA 3AICA 2VFIA 1OGSA 1TTJA 5LSMA 4RPQA 1GG1A 4LS0A 1UZHA 3QTGA 1LWHA 5TBOA 4NZ3A 3M9YA 3QEZA 2YYTA 3UNDA 1GORA 4ZL1A 3ME3A 3S3GA 4QXIA 1W1B1 3A64A 4UTFA 1JPIA 2HS6A 1W37A 4OUIA 1FWBC 3RNDA 5CPTA 1VGAA 3DFSA 1G4PA 3F4NA 4A2RA 1W3HA 1OFPA 3QC0A 3MYPA 2PDFA 4Q8QA 4GYJA 3AZRA 3W2LA 1JROA 1XIIA 3WH5A 4MNJA 4QEEA 4PTNA 3DFYA 1J0ZA 5CBBA 1FFUC 1M1BA 3WMBA 1ITCA 2H6RA 3ARSA 3QGVA 2YXXA 1KR0A 1ENUA 4UTTC 1JD9A 3EB3A 4NJJA 3H7VA 3S1GA 4UMBA 2VI0A 3GXTA 3AU2A 3ITVA 1XGEA 3T9PA 3RX2A 3HG4A 1EP2A 4GE8A 5CCZA 1UWTA 1W1IE 3RLGA 4JNZA 4MMWA 3KP1A 3NVYB 3PG6A 3G18A 2EPHA 5EA9A 4GX8A 1SZEA 2Y1HA 1UQZA 3DFPA 3MHUA 1DXEA 4LBSA 4HCLA 1AL7A 4GH1A 2E5AA 1TPDA 3CQKA 4PMOA 3N9RA 1CXEA 4ZOBA 2UY2A 1RY8A 2VZUA 3SCOA 1EP3A 3HV9A 4H83A 3R8RA 2W91A 4BF5A 4DUOA 4YWSA 1W9BM 3C3NA 5G2WA 3PS7A 3DGRA 3A22A 2QKFA 3WBEA 4Y9PA 1SSDA 2ZADA 3ERPA 4XVEA 1E6SM 3S46A 4KF1A 4WIWA 1SO5A 2Y61A 3EXTA 4ZGYA 4HZ7A 1KM4A 5CZ0A 4NX5A 5G4WA 1GZ1A 4JN8A 1Q8JA 4E4UA 3ZSTA 1S5WA 4H4ZA 5LNSA 5I3GA 2YLLA 4FNPA 1ZBWA 3KOWA 1K9FA 1O12A 3W7RA 2DZSA 5IDIA 1FWEC 3GH5A 2DZTA 1Q2RA 4FNUA 3RPTA 5CAKA 1UC5A 2XISA 2YZRA 4JIQA 3ARVA 1TIWA 2DSZA 4W87A 1XLCA 2GJXA 5BWAA 3GBDA 3W6LA 5DCEA 4QBXA 1IHIA 3I6TA 2E6AA 5D2TA 3N2TA 3VCNA 4DJDC 1F8IA 2TMDA 1BEUA 3VABA 3ES7A 1AD4A 5EBKA 4GUGA 3ALGA 2WVVB 2W55A 2HVMA 5I00A 1OFDA 4O50A 2XH2A 5T9BG 3NURA 4PCTA 1Q4NX 1SFJA 2E3TA 3TMLA 3LXDA 2J7EA 4ZSTA 5A94A 5BRBA 1IEIA 5CC6A 5I5RA 3INPA 3NCOA 3CU2A 3L0GA 1LP6A 3QW4B 2RDUA 1UBSA 1KFBA 2YCKX 5A6AA 1FIQB 1V6UA 1E9ZB 3UCCA 1XIBA 4KERA 3VKDA 4MUZA 1KXVA 4PUMA 2NSOA 1ICQA 4E2VA 1O6IA 1KFEA 4L5ZA 1HJXA 3IUDA 4FMVA 3FJLA 2Z7GA 5LA0A 2IKGA 3R89A 3VNKA 3CC1A 2QW5A 1XRSA 3S2LA 2W4XA 2OOGA 2VCCA 3BZGA 4UTJA 4JFVA 1QNRA 2PU0A 3N11A 1E3ZA 5I2UA 1H62A 1YIXA 9XIMA 1H6VA 1RJRA 2D2JA 4BI6A 3C5QA 2QDGA 5FOOA 2RUSA 2VZOA 5KVHA 3NQMA 1Q6OA 3HRDC 1V3HA 5D9PA 2VT0A 3VD9A 3HPZA 3PTMA 2H8ZA 5AHIA 1J01A 1MW3A 3EWUA 4QE4A 4RZ5A 3QMTA 1Z32X 1SFTA 4MZ8A 1EDTA 3ARTA 3ES8A 1RQHA 3BURA 4HK5A 2FKPA 1JGMA 2FJUB 2WSQA 1TPC1 2D1ZA 2E68A 1J0YA 4F0HA 3ANVA 2AKMA 3D5HA 3TQ0A 1MDRA 4NZ1A 1V03A 1GYMA 5E0FA 1JI2A 3HW2A 1THFD 2IQTA 5F2IA 3MO4A 4ACZA 2VFEA 2Y6ZA 4UOQA 1B4EA 4FXFA 1Y5WA 4Y9MA 1US3A 3LADA 1RQEA 4GI4A 4MNKA 5KETA 4AIEA 2Z6IA 3BOFA 3XIMA 3KW3A 4HSOA 4P8XA 1LLOA 1TPWA 1VBGA 4RZBA 3QPYA 1U1JA 2WOVA 3W74A 2AKZA 1CLXA 3DOPA 3PBWA 2B81A 3E0VA 5EY5A 5I3FA 3S1VA 2WCAA 4PC8A 2CFFA 1R47A 1TJ1A 2CBVA 2OX4A 1JVNA 1RP8A 4XZWA 3NOYA 5BRPA 2VX4A 4MFEA 3NQGA 2PLMA 2A6LA 3M43A 3BGJA 2X2YA 2NUWA 2GYIA 1M7XA 1X1NA 5CC3A 3A5VA 1TPVA 4D6GA 4RE2A 3O05A 4I5UA 2NT0A 1K6WA 3IGUA 4TV5A 3VD4A 3TC7A 2Y7EA 2ZRVA 3W72A 2WC7A 1DWJM 1XJBA 2J74A 4GQRA 4XD3A 4L9XA 1OJTA 3L12A 4XO6A 2EQ6A 3KHDA 3VNJA 4HN4A 2X7VA 1VFLA 3WLQA 4WEVX 1BQCA 1FEAA 1QK2A 2QDEA 2Y5SA 3L4YA 4ZE5A 3GO2A 2HE5A 4ZOCA 5CG7A 2QS8A 3W2JA 3Q6JA 1MQRA 4G7EB 1I9CB 3EZ4A 3RCMA 3FCPA 1YTDA 3TYEA 3G3DA 5AYZA 5DELA 4B92A 3VMNA 3EGJA 2JFEX 3GDTA 1OEPA 2VFFA 1HJSA 3B8UA 4AUBA 3CL6A 1DIOA 2HCVA 3GDLA 4N02A 2VD8A 4PTMA 1MXSA 4BA0A 2ZC8A 2GWNA 1JIBA 2PDUA 1G4EA 2DV0A 2DEPA 4XUYA 3WQOA 3EA2A 4IOTA 2WNNA 3MI3A 1TV4A 4GWEA 5HBFA 1RY0A 1KBIA 3I7SA 3APGA 3W53A 1A5OC 1MVYA 1CGXA 2GK1A 1W3LA 1F8WA 2A3LA 3GU1A 3V1HA 4WGXA 2GQWA 3EAOA 6REQA 3ZJ8A 4H9MA 4ICMA 4JKLA 2C15A 4OZOA 2IW0A 1E6RA 3W7OA 1AQ0A 4I6KA 2ZTKA 1OD0A 1ML1A 3NGJA 4NJKA 2PDMA 1BYBA 3OJGA 4GPNA 1P1MA 1ZMDA 4REQB 4JYDA 1LL4A 3CJPA 3N3TA 2FYMA 2GGIA 3A7UA 3OVGA 1XH1A 1BTMA 4KCTA 1J11A 1EOMA 3G5EA 4EF9A 5HATA 3CUJA 1V51A 2FGBA 3P3BA 3F4WA 1PCKA 2NVCA 4QQUA 3VDCA 2WZTA 4TVDA 3MZ2A 4L4OA 4H50A 4W84A 2DORA 2HISA 2Q8LA 2IKHA 2VCBA 1GCYA 5JBEA 2CLHA 1OZQA 1DPMA 3N18A 2WPFA 2NQ5A 3FN9A 3HJEA 1FKWA 1J6OA 3GD4A 3L66A 4FALA 2D23A 3QV6A 3GSMA 4GX9A 4LA1A 4H9VA 4ZO9A 4W8BA 1WYIA 1WUFA 3R79A 4UTLA 5JRBA 4Q4PA 1OFRA 2OTDA 4RZ4A 1LLZA 4TU1A 3W2KA 1WZLA 3KDOA 1GETA 3QYQA 1MI3A 3TOYA 5BMXA 1B2YA 4TUFA 3QFAA 3SY1A 1NH6A 1UPPA 4NAFA 2HBVA 1UIOA 3IJQA 2WP5A 1FOBA 4FZIA 3SCWA 1UKOA 1XICA 3G6LA 2PWUA 3IJLA 3WLRA 3P61A 4MYAA 5HNNA 3B8WA 1KBJA 4AY7A 2VYOA 4DNHA 5BCAA 2ZUUA 2PLJA 3G1RA 5HULA 1FA2A 1T40A 2Y4SA 1LYXA 4EIVA 2R1KA 1XXXA 1YPFA 1OC6A 2W3RA 1K9EA 2GK1B 3PPFA 4O54A 1A5MC 5HNUA 2V9DA 5T8GA 3IIZA 1CIUA 1GJUA 3SGUA 3LCHA 5A8MA 3P84A 1W9DM 2Y8VA 5H1WA 3WF1A 3WUGA 3PG9A 3STCA 4A3RA 5F1UA 2XSBA 2XVNA 1DIDA 3MSDA 3BG9A 3GFYA 3PNUA 5FCZA 3LEPA 4BHYA 2ZQ0A 1SM9A 1QNSA 4MJZA 5BW6A 4Q8MA 3SZ8A 4OBTA 4O0QA 3DG3A 4FLQA 1CWYA 2GVLA 2PLCA 4JHZA 1L8PA 2Z7KA 3JZUA 5FAJA 4F0MA 1WDWA 1P4CA 1U5VA 3N19B 2X99A 5K4XA 1N8IA 4AC7C 4L9ZA 5JU6A 3HU7A 5G5IA 1WOAA 4DWSC 1SO6A 2VEMA 3H54A 4B15A 4J3VA 3WUFA 1TE1A 4XTIA 5A6LA 1C90A 3ITTA 1IF2A 4BQ2A 4I5RA 3PFRA 3L5OA 4UR7A 1SJBA 1EXPA 1OCBA 2J13A 5ECVA 4K6AA 2C3CA 4BQ3A 7REQB 3EWYA 1PEZA 4KESA 5DY2A 1X6LA 3QR3A 1O95A 3AMCA 1H63A 1GJWA 1M7PA 3R43A 1PKMA 4N6EA 3NS1B 2GUYA 1XRFA 2EF9A 4UCGA 1VEMA 5DT7A 1DJXA 3ZLGA 1OQFA 1RPXA 1MUWA 4Y8FA 5D03A 1EO7A 4IGHA 3HTWA 3NPVA 3S8HA 5AKQA 3N14A 3GD6A 2G96A 2OSXA 1VHCA 1VBJA 3M64A 3USZA 1DE5A 1TRIA 3LHVA 4L56A 1D3CA 5DEZA 1E1FA 3TYDA 5EMLA 2F7FA 4AHPA 1S38A 3T6CA 4PEEA 3VYLA 3NVZB 4UTHA 3OGRA 4YHEA 2WPGA 2V3GA 4W8LA 2OZ8A 2XIBA 4FX9A 4Q8UA 1GWJA 1MQQA 4GNKB 1BSIA 1EUAA 4AVFA 3KWXA 4JKKA 1FWTA 1QI0A 4JTCA 2CBIA 3RX4A 4G9PA 3GRTA 2RH9A 1OFQA 3R07C 4MB5A 1SJAA 3ABRA 4EPEC 2JALA 4L7ZA 3VE9A 3BO9A 1DWFM 3VOGA 1VFTA 3KBVA 4XD6A 4JTFA 3UZWA 3GR8A 4XB3A 4OQVA 2OYMA 3F7JA 1XISA 1Q4WA 4A6GA 3WDJA 1OGBA 4V33A 3MHGA 3BG5A 3NM1A 2XZ9A 2WBKA 4MVAA 5FSEC 1NVMA 2O9TA 1OT2A 3VIPA 3GR4A 6TAAA 3T81A 3FVMA 5LIKX 2C16A 1K03A 3I4KA 1LOLA 3SO7A 3NQFA 1W5OA 2D0GA 2NXIA 3GD3A 3A5FA 4NZ5A 4MNMA 2OXNA 3QR1A 4O18A 4HOWA 3QPZA 1WXYA 2VR5A 5LIXX 3WMCA 2HK0A 3G1HA 2PZ0A 1X7IA 2V3FA 3CAQA 4XD5A 3WQGA 1WDDA 1K6AA 3ARWA 3ARRA 4EOUA 1XCXA 3N15A 1JAKA 1VAHA 1ZCCA 3SUVA 4C5YA 2HPIA 1U33A 1KWKA 1W54A 1V5XA 1V4YA 3UQNA 3NNTA 4BWLA 4F2BA 3NR0A 3DK4A 1O60A 1P0KA 3S1XA 1CEOA 1Q2SA 3M0LA 2ZCGA 5IOBA 4C5ZA 1EJTC 1XLJA 5FF7A 4N9EA 1PO9A 3GVVA 2XU2A 2Z2UA 3FYOA 3H26A 3L0KA 1GRGA 4GI9A 1VC4A 4M1RA 3CZKA 3MJMA 2NW0A 2CLFA 3WKZA 2QJJA 3GVQA 4A35A 5FI8A 3I6RA 3UZZA 2WMKA 3N2XA 5IBXC 5IHSA 4AD5A 1UD6A 1DORA 7TAAA 2OG9A 2GVGA 5E93A 4C1KA 1ZK7A 1UD8A 5FF4A 2NLYA 1E6PA 4TQTA 1RLDA 3LZ5A 4U28A 4A3YA 3ZJ7A 5A6JA 1GW9A 1VYRA 2OQYA 2HROA 4UTTA 3NEVA 2OWCA 5EKYA 3ZFHA 4QX4A 3V7PA 3ZM8A 3WUEA 3F4DA 1QFEA 4GMEA 4PA8A 4NKCA 3H2CA 3AMZA 4FSAA 2CLKA 3TCSA 1VPXA 3THQA 4PMXA 1ZNNA 1DV7A 3WH8A 1GVQA 1EJUC 2QCGA 2E9BA 1TR9A 4J3SA 3H2FA 3RRXA 2Q6ZA 3PZGA 5A6BD 3NO3A 4NY2A 2E67A 3RDKA 5FS6A 3WDPP 4HCDA 3LCGA 3QV9A 4ZOAA 2CHOA 1DBTA 5DO8A 3P60A 4G6CA 4EMWA 3ZMRA 1V0NA 2NQHA 3RLHA 1GKPA 3VE7A 3CWOX 1BKSA 1XW8A 1ISVA 1PHWA 3AWOA 5FA5A 3F2CA 4TVCA 1CGUA 3RITA 5FEWA 1O1ZA 3C3UA 3RF9A 1NFPA 1R9YA 3WLLA 1JPDX 3CNYA 4K1WA 4GIEA 4DUWA 3N2OA 2A6NA 1IZKA 1XIDA 5HQEA 3VIFA 3CAWA 2GR0A 1KTCA 1HJUA 4Q8NA 1G69A 1WX0A 3MMUA 1KWGA 4Q4RA 3C2OA 1KRBC 2PE4A 1XI3A 4KEVA 4ADTA 3L8KA 3W87A 1UWRA 3R13A 2G95A 3JVAA 2QUNA 3W71A 2WHLA 4R33A 4OU1A 3CEPA 4LV9A 2V2DA 3KBSA 1QXLA 4HA4A 3AMGA 3CO4A 1TFVA 3SSJA 4O11A 4RXFA 3UEQA 1YEYA 1CTNA 3ZVHB 2QJMA 3HM7A 3OZMA 4L61A 3UETA 1TVNA 1WQ5A 1O66A 1UROA 9RUBA 3H4XA 3MUAA 2Z1SA 4RDVA 5CLWA 2XVGA 1J12A 3TROA 4POCA 2B7NA 3O0HA 1I2PA 3W23A 1ZQ5A 4AWEA 2NXHA 1UC4A 3FSTA 2A3BA 5I3KA 1WDRA 2ISWA 3DKJA 1KW1A 3IEBA 5HXMA 2NX9A 4IMCA 5LXXA 4AVOA 3A7RA 4AZCA 1TMLA 4MKNA 1XLDA 4C1NB 5K7JA 1V7YA 3C52A 4E8GA 4KBXA 1QVBA 3KP0A 5FJIA 1O5XA 3IARA 2FVMA 4FXRA 2DUZA 5REQB 1TJ2A 2TODA 3N6JA 4HZMA 1RSCA 3R25A 4ROPA 2PWEA 1NSJA 3M6YA 1E51A 2ZC1A 1WDQA 4DO7A 1JUKA 4AFYA 3OBAA 3NWRA 4OGZA 4UQ9A 4ATWA 3N04A 1N62C 1DQUA 4H1ZA 2FQIA 1DXFA 1YADA 3RO8A 1V59A 5TD4A 1W2VA 5D9OA 1P48A 1XYZA 3FFSA 5G1YA 1J2WA 4DM2A 3ABOA 1SMAA 4H4XA 1EEPA 1RUSA 4J4KA 1GONA 3WF0A 1RLCL 1WKFA 2REQB 3GDMA 5TNVA 3GH4A 4LCQA 1FWWA 1ZCOA 4QRNA 2J8FA 1W0MA 1F76A 1VPYA 1NIUA 4EANA 3BLOA 1S2VA 2OJPA 3GNPA 1DJQA 2A3HA 4URIA 4HB7A 1HT6A 3UXAA 1BFNA 1HUVA 1JXKA 3CL7A 1DJWA 4QLLA 4AVNA 4U33A 4MB1A 2C8NA 3HPFA 2DH2A 2CBUA 2Y88A 3URNA 5ABFB 2CIPA 2FPVA 2YDQA 3VOFA 5FS9A 2WKLA 3ZWSA 4O52A 4MM1A 4C1NA 1XDLA 1K4GA 1RR2A 2DPEA 3P14A 4OV9A 3G0UA 3ATZA 4Q22A 1MSSA 3DFOA 3BW3A 3OQEA 4GC3A 1XYBA 2J27A 1AMKA 1F05A 3C6CA 4J3ZA 3CUZA 3W2UA 2I14A 4HMCA 3W25A 3EPMA 4NZFA 1JCLA 4B3KA 3S6DA 3WD3A 3MO7A 3N6HA 3KLLA 3KBJA 1XP3A 4M5PA 4UC5A 4MKVA 2GSJA 3FDGA 2BSLA 1NJJA 4Q8PA 2XGIA 3KAOA 4NT0A 3UY8A 3PBMA 2YX0A 4M6UA 3WD0A 4WDXA 4O1AA 1KLYA 5C7VA 2YL5A 1K7XA 1Q1WA 4LYKA 4B5NA 1KCLA 3S2MA 3E9AA 4PMDA 3U7BA 4ZTYA 3GIQA 3EAUA 3BQ5A 5HMFA 1GQKA 5I03A 1ITXA 4ERIA 4JX6A 1UMLA 4GOAA 3VVGA 3VIHA 4M19A 2QF7A 4HPXA 1E1CA 3KWSA 3TTOA 4K7VA 3FAWA 3AWNA 3E2VA 4O1BA 3HJZA 3M7WA 4J2PA 4HOZA 2BY3A 3STEA 5KVIA 2FTYA 4UNIA 5FL1A 1BYAA 4Q33A 3GDBA 2O9PA 3S6TA 3GE7A 2ZX8A 3QQWA 4IT1A 3LI1A 2AGTA 1V93A 4DWSA 4F9JA 1TPEA 3QKZA 4YYFA 4IICA 3S5ZA 1TV2A 3FV9A 1TKKA 2C19A 2I9EA 2IUZA 3SQLA 3H6OA 2R91A 3E2SA 3QFBA 3KZPA 1VRXA 1L6SA 4IIDA 1FP8A 3DHUA 5D2VA 4LRSA 3DI1A 3CUIA 3WNKA 3QLLA 4QITA 1ZBKA 1B3YA 1Q66A 3EWCA 4Q4OA 3ABZA 2RHGA 4E8CA 4HA1A 4PMYA 1R2TA 1HL9A 4UBPC 1CENA 4K37A 2P50A 2A21A 1CGYA 4JAWA 3MUIA 4I9TA 2J66A 3W02A 2W54A 1TMQA 2FTWA 3MWAA 2G0WA 4B91A 1WBJA 1Q6CA 3FNDA 4ZQMA 3UA4A 3CGDA 2J4GA 3VDBA 1QW8A 5AYXA 1RAKA 4GO8A 4IGNA 4RDWA 4E38A 3Q45A 4GVHA 4EQXA 2PRMA 3C2YA 1RCOB 3S9YA 2D73A 3WY1A 4Y9AA 4CCDA 4HQVA 4C65A 1JULA 2PDNA 1Q5MA 5D30A 2YSWA 5EMYA 3S4TA 1UD4A 1O4UA 2WSKA 3OGVA 3AXKA 3BTNA 4S1FA 4ZQPA 1HW6A 3VGDA 3QGAC 2F2HA 4IMEA 2V3AA 3SFKA 4AH7A 1W6TA 5DT5A 2YCIX 2HDJA 3IIOA 4AQLA 4E3TA 3AFBA 5DX7A 1G94A 4A22A 1UA3A 1SJCA 2VEFA 3F1QA 4M6VA 1H49A 3MVIA 5BROA 3TLLA 4MY1A 3AI0A 4RKAA 4DJEC 4UB9A 1FO4A 1JPKA 1RHCA 1BXCA 1KM6A 4HIBA 4Z2HA 3N12A 2UY3A 1FY6A 1XRVA 4JCMA 4W9TA 4DY1A 1TPFA 4NNBA 3LDVA 7PTDA 2FFIA 3KTCA 3WQDA 3N2CA 1ME9A 2ONEA 3NAVA 4O1CA 3BAKA 1XWYA 3U3HA 4QM1A 3L5MA 1W3JA 4CQ9A 1KBKA 3WNPA 4JD4A 1JI1A 2ZZ7A 3AALA 2AQOA 3POCA 3QHMA 4LVGA 2WANA 4XX6A 1M7JA 3B4UA 4E8DA 4GGHA 3VOJA 1Q6FA 2BOFX 3WQ8A 1KGWA 1XGZA 3GXIA 4IUOA 2P8CA 1P7TB 1TCMA 1MFVA 2HWGA 3M44A 4BK9A 1BKHA 4FXSA 4H4WA 1BWVA 2EQ8A 4PGLA 5G4HC 6XIAA 3IGSA 3H8AA 2Z0IA 3V1PA 5HJYA 3CZJA 3PHAA 4U2ZA 2ZZ0A 1Y5VA 5D02A 1KO0A 2ZA2A 2QYGA 3E02A 2ZZ6A 2BXZA 4JQAA 2YFOA 4FOJA 3VOIA 5AHNA 2Z00A 2D69A 3DFNA 4D71A 3VNYA 4H7CA 1YBQB 1ZALA 4AZBA 3GXFA 2QJNA 2PBOA 4JN6A 1V6YA 3IVUA 1YXDA 2TSYA 1GYLA 3V18A 1M5WA 2VC6A 3LN3A 4OT7A 2CW6A 4TXEA 1MMFA 1EPXA 3IJDA 1Q3NA 3W1TA 1UKQA 4NAEA 4UFLA 3PJTA 2GJXB 2ZX6A 4CQCA 4NI3A 4A8IA 2YW4A 4NYUA 3QMRA 1QWKA 1T8XA 1U5HA 4LEQA 3T1GA 5D9MA 3WH7A 1EF2A 1JNEA 1JJKA 5GNZA 4H4QA 5D33A 2HTMA 3UNTA 5DRIA 4RK8A 5C7HA 4EXQA 2Z1BA 3REQA 1TELA 3DH7A 2CEQA 4UQCA 2R9RA 1VCFA 1CXKA 2X2GA 4LEFA 2ZZCA 3LK6A 4IQEA 4HNLA 3W22A 2PDKA 3AO0A 2XSAA 3PZQA 2INFA 1X8CA 3U5UA 4K8GA 4DZAA 1YQZA 4EVZA 1IGSA 4TX8A 4DBSA 1BG9A 1JDCA 3TTYA 5K2ZA 4DI9A 3W0KA 4KEMA 1JZ7A 1JCJA 3GU9A 5AY7A 3STFA 1G7VA 1QHPA 1PKNA 1EIBA 1GHRA 4LB3A 2JKAA