3VCCA

Crystal structure of d-galacturonate dehydratase from geobacillus sp. complexed with mg
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
386
structure length
386
Chain Sequence
LNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF D-Galacturonate Dehydratase from GEOBACILLUS SP. complexed with Mg
rcsb
source organism Paenibacillus sp.
molecule tags Metal binding protein
molecule keywords Mandelate racemase/muconate lactonizing protein
total genus 134
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3vccA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3vccA01
1FHUA 3SN0A 1OEPA 3RO6A 3ZVHA 1P43A 3MSYA 1TE6A 3PWIA 4MGGA 4FP1A 2HXUA 3P93A 3THUA 3SSZA 4HCLA 2OZTA 3ES7A 3VFCA 3DGBA 1F9CA 2XH7A 3RCYA 4E6MA 4DYEA 3VC5A 3GO2A 3V5CA 3IK4A 3BJSA 3R0UA 4G8TA 2ONEA 4HNLA 2XGZA 1RVKA 4DX3A 1WUFA 4EWJA 3UXLA 2POZA 5FJRA 4IT1A 1SJCA 3FJ4A 3TTEA 3RITA 3UCCA 3SN4A 5FJTA 4KPLA 3EKGA 3NXLA 3H12A 4A3RA 3R1ZA 4IL2A 3GY1A 3QTPA 2P8BA 4GGHA 3FYYA 3TWAA 2AL1A 3UJEA 4E5TA 3IJLA 5BOEA 4H83A 1JCTA 2OKTA 2XSXA 3ES8A 5FJPA 3ZLGA 5J04A 2PA6A 3FXGA 3DIPA 4ZCWA 4DHGA 3T8QA 3R25A 4X2PA 2AKMA 4Z1YA 1YEYA 2HXTA 1ONEA 2PTWA 1BKHA 3ZLHA 3MZNA 4M6UA 3NZGA 4JN7A 4KEMA 3TJIA 4K1WA 1EC8A 3IJIA 4MMWA 3U4FA 3TOYA 3TWBA 2HZGA 3H70A 2MNRA 4IL0A 1XPYA 2GL5A 2P8CA 1NU5A 2OO6A 3ZVIA 3DG3A 3T9PA 3N6HA 2HNEA 4HCDA 3UJRA 2PP3A 3DFYA 4IZGA 3TJ4A 4J1OA 2QJJA 3QKEA 3RR1A 4GMEA 3SQSA 2QJMA 2QDDA 2GGJA 2QVHA 3QLDA 4JHMA 2ZC8A 1EBHA 3I4KA 2OVLA 3Q45A 3N4EA 1L8PA 3BSMA 2PMQA 2OPJA 4ZA0A 2GGHA 3SN1A 3CYJA 2OFJA 1SJDA 3N4FA 1JDFA 3NFUA 4K8GA 2GGIA 1KD0A 1MDRA 2PU1A 3UJ2A 3PWGA 4DXKA 1XS2A 3OPSA 3DG6A 2QGYA 3RGTA 4GFIA 1FHVA 4MKSA 4IP4A 3BOXA 5FJOA 1PDYA 3R11A 1MRAA 3PFRA 2QJNA 2GGEA 4E4UA 3K1GA 4HPNA 2PP0A 3MKCA 4GISA 3VCCA 3MY9A 1KKOA 3DEQA 2PTXA 2PTZA 3RRAA 4J3ZA 3V5FA 4FI4A 4GGBA 3CAWA 2OZ8A 1R6WA 4YWSA 3EEZA 4Z17A 4HYRA 3UJSA 1P48A 3JZUA 2OX4A 3P0WA 3CT2A 5EU9A 3H7VA 4HN8A 3UGVA 3DESA 1NELA 3FVDA 4H2HA 1KKRA 2XH4A 4KT2A 4E8GA 1WUEA 1ECQA 2PSNA 3OTRA 3V4BA 1EC7A 3P3BA 2XH0A 4GYPA 3IJQA 3QPEA 2GGGA 3DFHA 3Q4DA 3R0KA 4IHCA 3T4WA 3QN3A 2OZ3A 4HCHA 3VC6A 4H1ZA 3TQPA 2P0IA 2AL2B 2XH2A 3DG7A 2P88A 4M0XA 3I6TA 3VDGA 4DWDA 2OQYA 3VA8A 2PGWA 3SJNA 3GD6A 2QDEA 3MWCA 3GC2A 3JVAA 2PU0A 2PP1A 2OLAA 2FKPA 2ZADA 2FYMA 2AL2A 3VCNA 4DN1A 3CXOA 2PODA 7ENLA 3NO1A 2DW7A 2DW6A 3OP2A 3UCDA 2RDXA 1IYXA 2OG9A 2PPGA 1JPDX 3OW1A 2AKZA 4KWSA 3T6CA 3V3WA 3ENLA 4G7FA 2NQLA 2P3ZA 2QQ6A 1BQGA 3TW9A 1PDZA 6ENLA 3U9IA 3STPA 3DDMA 1TZZA 1W6TA 3PK7A 4K2SA 3UJFA 5ENLA 2PS2A 3MUCA 4E4FA 1EC9A 3KUMA 3D46A 4H19A 1MDLA 1JPMA 1KCZA 4HNCA 3OZMA 1EBGA 3FV9A 2GSHA 4GIRA 3B97A 4ENLA 3JW7A 2CHRA 1MNSA 3OZYA 3SBFA 4IP5A 3H8AA 4A35A 2PTYA 5BOFA 3TCSA 1R0MA 2GDQA 3ZVHB 2I5QA 3CK5A 1ELSA 3MQTA 3CB3A 1E9IA 3HPFA 2O56A 1TKKA 2MUCA 5IDZA 3FCPA 3UXKA 1DTNA 1MUCA 3I6EA 3DERA 4GYPC 3D47A 3N6JA 1SJBA 3R10A 3ZLFA 2PCEA 4ROPA 4JN8A 2OQHA 1SJAA 3S5SA 4A6GA 4F4RA 3S47A 5FJUA 2PGEA
chains in the Genus database with same CATH superfamily
5FCZA 3C6CA 4DXVA 4XQ6A 1NFGA 3W83A 5REQB 2ZA2A 2BC1A 3OVPA 3W6YA 1ZP4A 3NOYA 5DFAA 4ZSTA 4FX9A 4CVWA 5KVHA 3V0TA 4L65A 2AQOA 1IXNA 1QO5A 4AD2A 3IARA 1US2A 1EO5A 1CPUA 4RL3A 4QSHA 2X09A 4CD4A 4Y9MA 1W3JA 3QQ1A 4L4PA 4YCOA 4KMQA 4NG3A 4S3BA 3H7UA 1K7XA 3RXZA 3T4CA 2JF7A 1WV2A 5HJXA 2DY3A 3HQOA 4GWEA 3P8IA 4OJYA 3TN5A 1Q2SA 4UMBA 3STFA 4IT1A 4ZB2A 1QNPA 1YTDA 2QDHA 5FD0A 3J7HA 1UD8A 5K2ZA 2XVGA 3VGFA 3CS2A 5CBBA 3T1GA 2YIHA 2JEPA 3CC1A 3NM3A 3K8KA 4WX2A 3EKZA 4Q8TA 4UFHA 4E5TA 5BOEA 4BV6A 2TPRA 3WFAA 3N6QA 2F38A 1JQXA 5LIXX 3EPMA 3C0SA 2G3NA 2CDUA 3DBNA 1VFSA 3DIPA 3MJYA 3CO4A 1RA0A 2XN1A 4J3UA 1PKMA 4FLQA 1LORA 3LY0A 2E1DA 1W9VA 1GQKA 2PTWA 1KM1A 3LCLA 3SRFA 3TR9A 1EX5A 3QC3A 3NDYA 1ODUA 2GJXA 3TJIA 1JGMA 5EBAA 3H2NA 2AAAA 3DI1A 3N15A 2GVGA 3WD2A 1DXIA 4IL0A 4N7QA 3BLOA 4DB7A 3ABZA 4UMAA 2BY2A 1XFCA 1UHVA 2HWGA 4M5PA 1KCKA 3GLCA 4JIHA 1W5PA 1HN1A 2ZA3A 3B9JB 5FACA 5CC7A 5KZDA 1G4SA 1RVGA 4RK8A 4L61A 4A8RA 3D6NA 1LT7A 1XIBA 3QLDA 4CN1A 2Y61A 4DNAA 4L7ZA 3QSTA 5M1TA 1EOKA 1GYMA 2I9EA 5EKYA 2ZX7A 3T42A 3WH9A 4QDPA 3WQ8A 1J0HA 1EF3A 1GG1A 3WLTA 1SW0A 5LSMA 1C92A 3S1GA 1JZ3A 1IIHA 4K8GA 4RDZA 1OC6A 2XSBA 3CQIA 5A8OA 3L67A 2YW4A 3R12A 3NXFA 1LTDA 1KLZA 1YE6A 3BMWA 2FFCA 3LB8A 1B4KA 1UKTA 1XUZA 4MWAC 4WOQA 4IMFA 1YW1A 4HNNA 1QI5A 5BMXA 3EWXA 4MKSA 3QEZA 1NF7A 1E5JA 3M1ZA 1AZ2A 2QR6A 4ZQRA 3UEQA 1Y5XA 4C1NB 3QJAA 1GK8A 5G5GB 4LUSA 2QIIA 1RM6B 3FKRA 1EDGA 4S3FA 4W89A 1ZY8A 1SMDA 4QR6A 3PJTA 1WKDA 4EIVA 3KOYA 1O5QA 4HPNA 2W0HA 2E1WA 2E9BA 1CLKA 3TYDA 2DIEA 1H7OA 4ERAA 2J7BA 2FVKA 5AYBA 2X1UA 4AIUA 3S9IA 3U3HA 4JD4A 4IOTA 4HOZA 4RCXA 1P0EA 2Y5EA 3M5ZA 3EEZA 3WF4A 2Y5SA 2ZBTA 2J75A 1NHSA 4HYRA 3L4WA 2DVXA 1US3A 3H7VA 4JTDA 3UG4A 2Z4GA 5C2XA 3AISA 1QNRA 3E02A 1XLDA 3M6YA 1V02E 3DFNA 3A4AA 2B81A 1LP6A 2PWUA 1V0MA 4UC5A 3W7QA 4AD4A 3HGSA 1YXDA 2FHBA 2DVUA 3WD1A 3V0UA 4A2SA 3WLOA 5CLTA 5EGRA 4H1ZA 1W1TA 1T8XA 4PTMA 2P0IA 2ZKMX 1BF2A 8XIMA 3AU2A 1NWSA 3DG7A 4UWMA 1W8SA 1YNYA 2ZUUA 1NWRA 3RM8A 2RABA 2OQYA 1T8QA 4OFCA 4O1BA 1JJKA 1RALA 5HNRA 1UIPA 4JIPA 3HQPA 1OFDA 1CXFA 1V79A 3Q94A 3EX1A 4KEUA 2J9XA 2E7FA 1MFVA 3PG8A 1B3ZA 3FAWA 1HZYA 3MVIA 2A7RA 1BLIA 3SEPA 3L2MA 5F2LA 1IT7A 3XINA 4WVXA 3JRKA 4AWSA 3CGDA 2PPGA 2BTMA 4C7FA 5I07A 3OW1A 1VJSA 4PTVA 2VZUA 5LIYX 1J2WA 4QG8A 2BX7A 1PIIA 3GE7A 1RQEA 1SGJA 4GI9A 3STPA 4PUDA 3E5PA 2X2GA 2AAQA 1LQ2A 5CAHA 3ARUA 2A7PA 4IXXA 1HTIA 2Y7FA 3GBDA 5I03A 1Q6FA 3APTA 4V15A 3TP4A 1JPIA 4D1IA 1RH9A 4UCFA 5CAKA 4ENLA 3FEQA 1OABA 1W9BM 2IKHA 1G5AA 2GDQA 2IPJA 1IF2A 3LNPA 3CB3A 1EJ7L 4IMGA 1TKKA 3OOQA 2EKGA 3KRZA 3W70A 2ZZ4A 1GJPA 3C86A 3M5XA 4JHZA 2VJXA 1EGVA 3W88A 3AIWA 5CPSA 5I0DA 3M0JA 4H6QA 4IUGA 3UG5A 1K7FA 3QR3A 1NF0A 3HPZA 1E55A 1VFFA 3RX4A 1KFWA 4MYXA 1EH9A 2G37A 3U7VA 2NUWA 4PEKA 1TE6A 3M47A 2OSXA 4EM4A 1FHDA 1PS9A 3OVQA 4AZ5A 2INFA 4UTUA 3Q67A 1E4LA 1IEWA 3TV8A 2F6XA 2NX9A 1MW3A 3EANA 4CUCA 4C1KA 3DGBA 3GIQA 3TFXA 1XD1A 1J2BA 3LGDA 3GNRA 3V18A 2EO7A 2ZRYA 4LH8A 3DECA 3IV8A 5F2GA 4HNLA 3VOCA 4TQTA 4J5NA 1BTCA 3TH6A 1C7SA 3AUOA 3WQPA 3IJ9A 2E4TA 3GHRA 3AU6A 4ALDA 4UR7A 1FWNA 1VBUA 4IMEA 1R86A 2B0MA 5DQPA 4GNVA 3HGOA 1V8EA 1UOZA 4A3YA 4UQDA 4JOMA 1A5OC 4GGHA 4H4TA 4O1EA 3VIMA 3FYYA 4J28A 3TWAA 2O9TA 1LLWA 3TTQA 2CLMA 3IJLA 1B0IA 2R9RA 3MUXA 2PWVA 1OIFA 3NS1B 1VRDA 1W9DM 5HWJA 5KTLA 3N04A 4AEEA 1FX6A 4N0RA 3WSUA 4WY0B 1J93A 3OQ8A 1P0BA 4X2PA 2WKLA 4ILSA 4Z1YA 4BQ3A 5F2MA 1W9UA 3M4HA 3AHTA 1PZ3A 2UWFA 2VURA 2E09A 5DY2A 3MPGA 4E2OA 1XIMA 5FF7A 1J0JA 2NWSA 2Y88A 3LG3A 1R2TA 2UY2A 3DFPA 1BQCA 1UUOA 3CGBA 1W3TA 4HSOA 2Z00A 5CPOA 4JQAA 3N6HA 3ZWTA 3CUZA 3UCQA 5AC5A 2PDQA 1K4QA 3E0VA 1WKFA 1E0UA 1UD5A 4DO4A 1UMYA 1HKVA 2XJ7A 4GXMA 4HU4A 3RR1A 4DBUA 3EA1A 1A49A 1POJA 1UQYA 1XF0A 2QVHA 2D2OA 5IBXC 2WHMA 3NVZB 3FVMA 2WNZA 2EEXA 3E6EA 4OQVA 5HATA 2ZRWA 1RLCL 1RJPA 2YSWA 2Q3RA 5FEZA 4Q7IA 3AO0A 2C3DA 2ISWA 4EVZA 3T0AA 3PWGA 1DWJM 1IE7C 1XHCA 1H41A 5CSRA 1ZCOA 4CNPA 2CHOA 4HTBA 3B9OA 4QNWA 5CZJA 1ADSA 2O4QA 1NDWA 3M41A 3TYCA 4REQB 4R27A 3GIYA 3BPWA 2GGEA 2D0HA 5D4YA 1F3WA 3GXNA 3TLQA 3HOJA 4XAPA 1SO5A 3AMCA 1OCQA 1XLCA 3BLKA 3OBEA 2YZRA 2W27A 5AHFA 1CZ1A 5XIMA 3RRAA 1E6XM 1PX3A 3KHDA 3KEHA 4MUPA 1NDYA 5D2WA 4LUTA 3NQMA 3BW3A 1GW1A 3U6WA 4XBJA 1RJRA 1P48A 3R0DA 3MA8A 4FNRA 3TN3A 1KQYA 4JNZA 1AQFA 4PUNA 4JZ5A 4GVHA 1RSCA 2DUZA 3HQNA 4PR4A 1E0TA 1JI1A 4U3AA 3VNIA 3HZ3A 1G69A 3W82A 1NEYA 4KS0A 3D5HA 3QYSA 3JR2A 2GGGA 3DFHA 5JBFA 4YHEA 4H4RA 2DSWA 4R9XA 1TWIA 1S3HA 1WDRA 4IQJA 2O9RA 5CH9A 1Y0EA 2IPWA 3NPUA 5BYWA 5F1VA 4O1AA 3QRHA 3NPWA 4Q4QA 3DHDA 4X0VA 3VILA 2O9OA 2VFIA 3MP5A 3MMTA 2ZX8A 2C1IA 1VFTA 3N2CA 3FHAA 3ITVA 1FO4A 3UZXA 4E0CA 3QKZA 4P8WA 1UD3A 3W2NA 2XWEA 3SR6B 2PP1A 5JIWA 1QNSA 3D0CA 4HU8A 3E0LA 5JRBA 3EXRA 2TODA 3LZ5A 2QW5A 1WXZA 2GUYA 1XDJA 1FWHC 1XDLA 4O8AA 3I6RA 1TELA 3B8VA 1WCGA 2GR3A 5EMYA 3ARPA 4J3XA 5FSDC 4MFEA 1XBZA 4DJDC 2FTWA 3JUGA 2JQXA 2V2DA 3FEMA 4PBEA 1C8VA 4NILA 3V3WA 3M46A 1KM6A 1QNOA 1H62A 2W54A 3HU7A 4XAGA 3AUJA 4F8XA 1TRDA 2X1IA 3EPOA 4KF1A 4LNYA 4MJMA 2V5LA 3FGCB 4EACA 1ADDA 2W6RA 2V8ZA 4IM4A 3GXDA 1BVZA 9XIMA 2YCKX 4FPSA 1MNZA 1T3QC 2WNQA 3D3AA 1D7YA 1YTKA 5EYWA 1UWSA 4MWAA 2EPNA 2FMOA 2VQTA 1G67A 2Y5JA 1ISZA 1QVBA 2FZNA 4QCEA 4AXKA 4O8RA 3LBOA 3D47A 3KDOA 3LOTA 4HSHA 3WDIA 4E8CA 3BAYA 1J6OA 1V93A 5A94A 3BAIA 3PSWA 4KGJA 3WDQA 1EP3A 3WQEA 3DC8A 4ROPA 1E6PA 1XSKA 3GUWA 3SSJA 3IUIA 3NL5A 3IVUA 1DQXA 4MLJA 3T08A 1CDGA 1FKWA 4PSPA 3H4XA 3SUSA 1FHUA 4LNCA 1QWGA 3WBAA 1R30A 5CBJA 1TPC1 4H7ZA 4HVXA 3CUHA 5KEZA 2F8QA 5LKYA 2GVJA 2XVPA 1J0KA 3SB0A 3H55A 2P10A 4TU1A 1UASA 4XAYA 4UQBA 3IWPA 1LRQA 1H63A 2OZTA 2JIWA 2PGRA 1GTEA 4JTFA 3TC3A 5ABFB 2R82A 1N2VA 3SCSA 2X99A 2VO5A 2R14A 1JCJA 3V5CA 2CKSA 1OFEA 1H1YA 3FGCA 1WZMA 1W54A 2YYTA 3LV6A 3S4TA 2YJQA 4B5UA 5FS7A 1YKWA 1KNWA 4R33A 3CXBA 3WEZA 4S23A 3MO7A 3EX4A 2BDQA 2DT0A 2G3MA 3VTRA 5CG0A 4D9PA 1JQVA 3QR0A 4IL2A 1ZBCA 4OBSA 3GDKA 1JCMP 1XLBA 3EX6A 2Q71A 4C6DA 2P1FA 1A0CA 3WH7A 3UF9A 2YCLA 4IMDA 1MWOA 3HPAA 4MJZA 4AG0A 2V30A 2FLIA 2GDVA 2Z25A 1D9EA 1S7MA 1TWZA 3ATZA 3MTWA 4LJ3A 3P80A 2OU4A 1U5HA 2XN2A 3TU9A 3OODA 1PX4A 4CN6A 2X1SA 1UD4A 4M6UA 2QCHA 4FR1A 3W07A 4KFOA 2NPXA 1O12A 1OYAA 3PFMA 1JPHA 4U2ZA 4B9ZA 4C60A 5F4XA 3TWBA 1KGUA 2HZGA 1XYFA 3H70A 3S8HA 1MFUA 2QCFA 2E28A 3WQOA 2OO6A 3CIWA 5BRQA 3QZ6A 5DBUA 1AH4A 5CC3A 1X8CA 3IAQA 2PRLA 4KFNA 4XISA 4CD5A 5A2BA 2QCDA 4GFSA 3A22A 2ZZ6A 2VL4A 3UZJA 1QBBA 4IZGA 1A80A 2GR0A 1R7OA 3C3UA 3VFLA 2NV1A 4C65A 2RGMA 3JS3A 2R9ZA 3B06A 1LM1A 2RH9A 3N4EA 4HMDA 1LL4A 3BSMA 3GKAA 1ISXA 4AWTA 2ACSA 2FVMA 4BWLA 3EMQA 4O17A 4FEZA 3WLKX 4MNKA 3N73A 4ZFMA 1XLLA 4G9PA 3WQFA 1E15A 4AVNA 4YIWA 3KBJA 5LYRA 4DBDA 4WY0F 3WFZA 2ISVA 4D72A 3U2EA 3F1QA 2VKZG 2J27A 1CECA 3W9ZA 2JFEX 1G1YA 2RJHA 3K30A 2X0SA 4JR5A 2WPCA 3N4AA 4AEFA 1TFVA 1M7JA 1CXEA 3UD6A 1TTJA 2IPGA 2VZVA 4B3LA 1GVQA 3A13A 4JCLA 4JGDA 2QCDB 2VRKA 2WCSA 1WDDA 1X1ZA 4I6VA 3ATYA 3USBA 1XFBA 1UR3M 3T8LA 1UPPA 2OGJA 4UNIA 3JZUA 4PTNA 3TNBA 2E5CA 4LOCA 3WK3A 2PURA 3BAXA 4JS3A 3P0WA 1XUUA 3AYSA 2HRWA 2NT0A 3AIQA 5C55A 4JKKA 1NOUA 1D8CA 4BK9A 1FP8A 1DVJA 3FLUA 4UTIA 1A5UA 1IEQA 1V77A 3E2SA 1EC7A 3UU0A 2DGAA 3CU2A 4CQAA 2VM8A 2W62A 5D8WA 1SU5A 5D05A 2CNCA 2V3EA 3P6LA 1DWHM 4B5TA 4FNTA 1VKFA 4GY0A 4HP5A 4ZO8A 5LXEA 4AHPA 3KOXA 3SGUA 4ZFCA 1V6VA 3SQMA 4RE4A 4ZO6A 3U2OA 4PMUA 4EK7A 2ZQ0A 2BLEA 4M7SA 7REQB 1VB9A 3SJNA 4KCTA 4MYAA 1W2PA 4K7YA 3SFKA 1JRPA 2CLLA 1CXKA 1V02A 4DPPA 4GC3A 2PU0A 3GDRA 3TQVA 2J6XA 4JIIX 4R7OA 4EWND 1F7BA 2E9LA 1MXDA 1V4YA 3QV7A 3PAJA 4GRSA 3ABQA 1QR7A 3RMJA 4BI6A 5JIPA 5C9RA 2TPSA 3CAVA 1NTHA 4IICA 1XW8A 3ZZ1A 2Q01A 1T99A 1R47A 2V3AA 4PUKA 2I16A 5D02A 1BVNP 1V7YA 4DQWA 2PLJA 5M3WA 1YPIA 2HQMA 1XRSA 3L5AA 4MJ2A 5D2XA 1HVQA 3C2YA 5LA1A 1GRGA 1FWRA 1FWGC 2NXIA 4UNLA 4QEEA 3U9IA 3ITTA 3WNLA 3B8DA 1VP5A 4PFHA 1JI2A 1KRAC 1RPXA 1XIHA 3PBYA 1J0YA 1OK6A 2Z24A 3BG9A 3EWZA 3UXAA 1TV3A 3WQVA 1EC9A 5I3KA 1ITXA 1H61A 1QU4A 4MZ8A 1JPMA 3MO4A 4PN2A 1HL8A 3RJXA 1KQZA 3MI6A 2XISA 1BWKA 2ZUTA 1G4PA 2XVKA 3WLHA 1QOQA 2BASA 3TCSA 2XGIA 4LGXA 3QTGA 4FR6A 5JMUA 5E0FA 3HPFA 4DWSC 1GOKA 1R3VA 4Q8MA 3OA3A 1NAL1 1FXQA 1RCOB 1CGUA 4FNQA 4ZODA 2WCAA 4I7WA 1TPVA 4W84A 5DANA 4JTGA 4JTAA 4GNKB 1KXQA 2QHAA 2A5HA 2I17A 3E0WA 3LPOA 1TPUA 3TC7A 5AYIA 3RAOA 1PIFA 4L1WA 2E9MA 4GQGA 4GY1A 4XZWA 4UFJA 3SN0A 1XCFA 1OEPA 3K8MA 3VABA 1AVAA 3PWIA 5BXTA 4C7DA 1E6QM 2QAEA 1UJPA 1XIFA 4OIFA 3WBYA 3UG3A 3ES7A 1VFUA 4GH1A 3O9NA 3TYBA 4HOXA 3IIXA 4EQSA 1CGTA 1FKXA 1HL9A 3GU2A 3S2MA 1DKWA 1J0IA 3IK4A 5CPTA 4G8TA 1MUWA 4P7OA 5LIKX 1RVKA 3A12A 3GTIA 2J3NA 5TIMA 3WO8A 3W2LA 3GHUA 4ZTXA 3IIPA 5FMHA 1AL7A 1S5WA 4KPLA 1C9WA 3NXLA 1E43A 1EO7A 1EA0A 4QRNA 3FG2P 4LEQA 1I2RA 3THCA 4K7ZA 1RK5A 2A3LA 4ORIA 4GC4A 2F6UA 5A2AA 2Q8XA 1ME8A 2ZRVA 1JROA 4OWGA 7TIMA 1AJZA 5J04A 5DT7A 2F6KA 4LB4A 1UZ4A 2REQB 3EOSA 3DKJA 1Q66A 4DHGA 4C6FA 3PM6A 4MB4A 5EFDA 4A4AA 1EBDA 1ONEA 1QATA 2J13A 3SADA 4AIEA 1IEXA 4JN7A 3MT1A 5D8ZA 3WLNA 1PZ1A 2B7QA 2GPTA 4KEVA 4WDWA 1BXBA 2MNRA 4XVDA 1L6YA 3ARWA 2P8CA 1NU5A 3ZT7A 3MDUA 5CBIA 2W3SA 4B2DA 2RGLA 3C8NA 3CHCA 4HCDA 3FA5A 2VX7A 1O1HA 1T40A 4RKAA 1UH4A 3WUGA 3AMGA 5C2GA 3DGRA 2CZDA 3UZ5A 4DNMA 2IMRA 1HFBA 2QCEA 1GRTA 1TPFA 1S5MA 5A95A 4CQCA 3I4KA 1T0OA 5H8PA 1HUVA 3OIHA 1BG9A 2VP8A 4JIQA 4JIRA 4L80A 4W9TA 4QCFA 3SZ8A 5K9XA 3K5XA 2CWXA 1KV8A 1E0VA 5AFDA 4M29A 3WLLA 3HRDC 1I45A 3HPXA 1I6NA 3RLHA 1AW1A 3L5OA 3ARQA 1CGYA 4RX0A 4DLMA 1Z44A 1XP3A 4NT0A 4O0QA 3NQEA 1TPH1 2QJNA 3EXTA 4NAEB 3RRXA 2Q02A 3CZGA 1QDSA 3IGSA 4GBDA 4PMNA 5BOOA 4LALA 1L6SA 3EDEA 1V59A 2PTXA 4PL2A 1ZRQA 4QG6A 2Z1WA 4BF5A 5A6MA 4IPLA 2Z1KA 3BVJA 3AMZA 2GOKA 3PZGA 1TR9A 1QI3A 1RP8A 4Z0SA 4FX7A 3SCWA 2E68A 1HKMA 2PDCA 1VF8A 4V27A 4NASA 2J7HA 5CJMA 1XKYA 3GRSA 3LDVA 2VD8A 1M7OA 2VC6A 4HZ7A 2A7NA 2H8ZA 5JVLA 3IVSA 2HK0A 3GC4A 4O10A 4PCPA 3LCXA 4WLCA 2XH0A 3KVJA 4CKQA 2P0OA 4GKTA 1J79A 1L0PA 2VR2A 1BXCA 3OLEA 4GACA 3EZ4A 3C56A 4ERIA 2D73A 4PMQA 4PODA 1VBRA 3QGAC 3PAOA 2D1ZA 5FAGA 2CHNA 4GQQA 1F4HA 3ZIZA 3B03A 1RD5A 3C8FA 2Z2UA 4QE1A 3KS6A 1KC7A 2G3IA 1V51A 1Q7QA 4PULA 3ZR4A 5ABGA 1YMYA 1OFBA 3WLIA 2OLAA 1B3VA 1UWRA 1KWKA 1A5KC 1A0EA 3VCNA 3M9YA 3VD7A 4DN1A 2CU0A 1HL2A 3B0VC 1GKRA 1TTQA 3P61A 2QKFA 4GK8A 3BZGA 2BZNA 2BS9A 3MU7A 4FDCB 4W7VA 4M82A 1M5WA 4ZQMA 5B80A 4F79A 3W29A 4OE7A 3W7LA 2DSZA 3L9CA 2C19A 4O15A 1WX0A 4YWIA 2ALRA 3WD3A 3OVGA 1I2NA 2XIIA 4HA0A 1U5JA 3MVTA 5EBUA 1M3UA 4XV0A 3P0XA 1ZMDA 3UGRA 1E6SM 4NJKA 2C91A 5PTDA 4MKVA 1GERA 3UJFA 3S5OA 1E6ZA 3SY1A 2YDRA 2D0GA 1UD6A 4HNCA 3S6TA 3WNPA 4BKNA 2GSHA 3DN5A 1SZGA 2XFRA 3NQ6A 5G5IA 3MS8A 3LQLA 1TO3A 3OZYA 1I2OA 3ZM8A 4OZOA 4A35A 4GBUA 3KOWA 1QCWA 1GYLA 1AFSA 3N25A 3EDDA 2WOQA 4Q22A 3S1WA 3G77A 4EQRA 4G1NA 4UNKA 3WMLA 4LANA 4Y8FA 2HS8A 4GYPC 4HPJA 4ZQOA 2OODA 3ITLA 3QZAA 2FIQA 1HKWA 2G0WA 4C7GA 5FEPA 1G9HA 2FZ9A 4YTSA 3AXXA 4HNUA 2F5ZA 3MV01 5KMYA 4M1RA 3BMVA 1YDOA 3ZYZA 1W3IA 3WL1A 1E3ZA 3S6DA 2NT1A 3QF0A 4RDVA 3WK1A 2WQDA 4LRTA 3LGGA 4ML9A 3RPMA 2DU2A 5H8MA 1DJGA 3W37A 4H4IA 3W23A 4PTXA 4AW7A 1P43A 4RE2A 1V97A 1BZLA 4DUXA 1YQ2A 3BJTA 1W9PA 3ISIX 2A8XA 2YBVA 4ATWA 4ZB5A 3L8KA 2EGZA 1S2UA 1KTCA 3W7RA 3TK7A 2I5GA 1DV7A 1A47A 4IF2A 1XL9A 2DORA 3PB2A 4XD5A 1EJSC 2FH8A 4H6EA 4DYEA 1OB0A 3GO2A 2CPUA 1ITCA 4IXHA 3BJSA 3LXCA 4DAIA 5HQMA 2BVDA 2ADAA 2XGZA 2VRQA 4DX3A 3B8IA 4GG9A 3NL6A 3W87A 3GR7A 1VQTA 2YVGA 1M01A 3PZTA 2HE5A 1P6BA 4FZIA 2W4XA 4NYYA 3H24A 5I3FA 1QOXA 1H4PA 1JXJA 3H12A 3A7UA 3SJ3A 3W25A 1C8XA 4MY8A 2PCQA 4E38A 3BG5A 4ZMGA 1ZX9A 1JUEA 2GQ3A 1D8WA 3KZPA 4RXGA 2KZHA 3TVAA 2PBGA 1LOQA 1UBPC 1JR1A 3RO8A 2B4GA 3VKKA 4C91A 4K6AA 3EX3A 3FXGA 1WOBA 2Q09A 1OT1A 3TFCA 1HJSA 3W1XA 4IGMA 1LLZA 3APGA 3EWBX 3TQKA 3TSMA 2NQJA 4LV4A 4A29A 2AMGA 4S3KA 2QMJA 4W7WA 1U22A 1FECA 3ZLHA 1ZL1A 3CLMA 2WAGA 5C9ZA 2WNWA 3VGGA 2WBKA 2YDQA 4K1WA 3GVGA 2PGFA 1N55A 4TV5A 4NZ4A 5FF4A 3G1YA 1JYWA 4H9MA 1JDDA 4Z2JA 4H9ZA 2R91A 1TV4A 1NPXA 3DG3A 3GX9A 5MKGA 4RV8A 2EQ8A 4ZO9A 1ZQ5A 2VC5A 2WHKA 3OZOA 3ANYA 1K4GA 4PMRA 4MJ4A 4ZOEA 3WUFA 1JZ4A 2CESA 3BDKA 3CYVA 5G4WA 1W17A 1P7TB 2KX9A 4LPCA 3PZOA 2CIPA 2I9UA 4EMJA 4XIAA 3EBVA 5DRCA 4C5ZA 2PC8A 4BQ2A 2J7GA 2F84A 3BMXA 3WQGA 4EAYA 2V5JA 5JH2A 3L2LA 3UJ2A 3UR8A 1H09A 1H7XA 4M81A 2NQ5A 5H1WA 3HFYA 2HQAA 2QGYA 4QTGA 4QE4A 2D20A 4GUHA 4QJ4B 3GAYA 4MKNA 2IQTA 4XD3A 3W6MA 1DE6A 2YAUA 4KESA 5K4XA 3QGKC 4YMZA 2OSYA 4H01A 1N8FA 4JFWA 3PFRA 3CMJA 3S3GA 4IPIA 1E4IA 3SCVA 1XLEA 3VDCA 5I00A 3PVFA 3GXPA 1EJTC 1FHLA 1KFLA 3MKCA 4Z2KA 1KM0A 1UUQA 2IS7A 5E6ZA 1PKYA 4JX4A 3HV8A 4A3UA 3O6YX 2CITA 3G18A 1KKOA 2PTZA 1UWUA 1XQKA 1OK4A 1IIGA 4JPGA 4N6FA 4ZQCA 3F7JA 2RDTA 2WJDA 3TCEA 1RV8A 4WD0A 2CLKA 2VCBA 3STCA 4Z17A 2VFHA 5D04C 1UZ1A 3UWYA 4H4SA 4JL2A 5KZ6A 1SQ7A 1ZJBA 4H2HA 2J7EA 2PWHA 4RZBA 3UBPC 1M04A 2QF7A 2Z26A 2E8ZA 1QNVA 1S46A 1WUEA 1NP2A 3K8LA 2O9PA 1CWYA 4AZGA 3UWZA 1PYFA 2ZUVA 3IJQA 5EY5A 1ZJHA 2CETA 2X0YA 5DMMA 1LG1A 4ZOAA 2HBXA 4TO8A 1I2PA 5LNVA 2CZVA 2VEKA 4PSRA 1J5TA 3T7VA 2EG7A 4NRRA 3F5JA 3K4AA 4AF0B 3E9AA 2QGHA 2IUZA 3VA8A 3HV9A 1SUXA 1ICSA 2A2IA 3S5NA 2OYMA 2OEMA 4ATLA 5CKSA 3KRUA 1X6LA 3T55A 4MB1A 2XPKA 1VYSX 4CQ8A 5HMFA 2PDUA 4Z08A 4WIWA 2DW7A 1FQ0A 2NZLA 5EB8A 3QM3A 2FDMA 3BQ5A 4RNIA 2QUNA 2FTYA 4LTSA 5BNKA 3VMNA 3B8TA 4D6CA 1MW2A 4H9VA 3VNYA 4KWSA 1VS1A 2YX0A 3AIRA 1BF6A 3T6CA 5JCMA 4E2DA 1A53A 4HB7A 4DJED 3DXIA 4O11A 2JALA 1EZ2A 3AWOA 1WB0A 4N02A 6ENLA 4ECLA 2Y63A 1REQB 3WK2A 4DEFA 2VHLA 1VFOA 4N6EA 2BGNE 4L6HA 4Y9PA 5C7VA 1A5MC 2DZPA 1VQZA 1OCNA 3VIOA 1D3HA 3AYTA 3MDWA 2B7NA 3CM4A 1TZ7A 1F8IA 4HPGA 4B3ZA 3FKKA 2J78A 3F4WA 3DFTA 4GA8A 3SIMA 1UH3A 2HK1A 3MP4A 4J9JA 3PWAA 4QBXA 5BOFA 3L23A 4FIQA 2YA0A 3AROA 1UD2A 2IXUA 1JYXA 1XIIA 3MQTA 3QYQA 1J9YA 2NVCA 2C1GA 4RE3A 4LBUA 3BO9A 4AISA 1YHTA 1EFZA 2GSEA 4WSHA 4V33A 3CZLA 2DSUA 1F07A 3I7SA 2PCEA 1F3XA 3C5QA 1H6VA 1E0WA 3TOPA 4L56A 4J3SA 4PB3A 3ZFHA 3ARVA 1W2VA 4IMCA 4H9TA 2ZIDA 3AXIA 4A6GA 2R1PA 4HIBA 4IJCA 1K9DA 3CJPA 4QLKA 1YYAA 1XSIA 1I0BA 2DV0A 1GVEA 5AHIA 4MLRA 1WQ5A 3K2GA 3W72A 5E5CA 4LCSA 4MWAD 4ASTA 4LUYA 2F2HA 3QPYA 5CGQA 5TBOA 2DFAA 5A8QA 3R2GA 3CWHA 5E9AA 1OZMA 4C90A 3THUA 3GC5A 1BWVA 3M0VA 3VE9A 2CLIA 4FXRA 2QS8A 4OHQA 3L0NA 1XC4A 3W71A 3BICA 5ABTA 2VCAA 2EAWA 5M2FX 1GZ1A 1ZFJA 1UB3A 1HO1A 5BZAA 4LVDA 2ZYFA 3IIZA 4UB9A 3TX9A 3TYUA 2VFDA 4TOQA 4IFKB 3TMLA 2HJPA 5T8GA 2GH5A 3FJ4A 1XG4A 1I60A 2BOEX 3W28A 4M6QA 3E2VA 4NXKA 4AX7A 1CGXA 1K7EA 1W5NA 2V3GA 4GI6A 1TJ0A 4US6A 2J25A 2YA2A 4Q8PA 3MUY1 1H60A 1B30A 3L65A 5T91A 1X6NA 2PA6A 2XFWA 3MCNA 3ETRB 2WOVA 1B31A 1UKPA 1W8GA 4Q8VA 3URNA 2BODX 2L5HA 5K4ZA 2Y85A 4LVAA 2YPIA 2PWEA 4H4ZA 3PR2A 3DFQA 3T0BA 1S1RA 3WELA 1JZ7A 3CV1A 3CGEA 3AJXA 3PUGA 4FS9A 3L4TA 1K8CA 1ZAIA 3IJIA 2WK2A 2BNJA 1XLIA 1XQLA 2WSKA 3WX7A 3KAOA 1W5QA 3W7IA 1GVIA 1N82A 4OUIA 5MHBA 4TIMA 1XSJA 1DJYA 4UQ9A 2PTDA 4EF9A 4JTKA 5EPDA 1P0NA 2BFGA 4HYWA 4LF2A 5HR6A 5CQ1A 3FSTA 1WAUA 1NDZA 1KBIA 1ZJIA 4V1XA 2BWGA 3EMZA 1SM9A 4QLLA 3W86A 2A3BA 4IX2A 4JQ3A 4UUIA 4C6PA 2WHJA 3QXBA 1XYZA 4V2XA 4Z2HA 3TTSA 4UR9A 2OFJA 3BLFA 1RPKA 5BU6A 4C1NA 4AZCA 5D37A 4ACZA 4O16A 2CZEA 3CTLA 3F4DA 2ISSA 1FWDC 2Y8UA 3VXGA 4IFKA 2NV2A 4UXDA 4W88A 1XS2A 3OPSA 3DG6A 2V82A 1GV4A 4YYCA 4E4PA 3F4CA 4IP4A 2OT1A 5U1OA 1HKIA 3R11A 3O7UA 4WKFA 1I75A 2JGQA 1N60C 2VEFA 1HGYA 1ZY9A 1PBGA 2ODOA 3K4WA 2V68A 4HU3A 1UWIA 5EL1A 3BQ6A 1GQLA 3O63A 2Y24A 1M6IA 4WSJA 2OB3A 3GNPA 1SMAA 4YL2A 3GNNA 7TAAA 3E1F1 1GRAA 1D3GA 2F61A 4CU6A 2YXGA 4GGBA 3W1QA 1BD0A 2YLLA 1XISA 4U5IA 3VE7A 4TR9A 3PG6A 4W8BA 3NVYB 5B7ZA 4JDYA 3QH2A 3IJ7A 3II4A 2NLYA 1VCGA 1ZDLA 3R8GA 3IS4A 5HNTA 3WBEA 1EP1A 4LAMA 4EQXA 2A6NA 3ERPA 3AXKA 2INEA 3G8RA 5AY7A 3LHVA 3OTRA 3N1AA 1XJBA 3HG3A 4GXWA 5HUPA 3FJ6A 1NM9A 2D24A 3TTOA 1KCXA 1UW9A 5G4HC 3WDJA 1NOFA 4OBTA 2PZNA 3LCGA 3SFWA 4D2JA 3CL6A 1FCBA 4HK7A 4FX8A 4BFAA 4X9YA 3O07A 3FXYA 3LU2A 1UR2A 1J8VA 1ECEA 1BSIA 1RJQA 3V75A 3VOGA 3A5VA 4Y8EA 4IQEA 1S2CA 4QDWA 3L0GA 4XB3A 2WVSA 1TWWA 2GYIA 2CBVA 1QMLA 3K46A 2C3ZA 5KITA 5BRPA 5I79A 1SR0A 1QASA 4F0RA 3MMDA 4WGXA 2WC3A 4Z1AA 4Q4PA 1EIXA 4WKAA 1EPXA 3A3HA 1M68A 7ENLA 1PCWA 3H23A 1SO4A 4TVUA 2NVDA 2RKXA 1IYXA 2CC0A 1AG1O 1B4EA 2NQHA 4B4HA 1TVNA 3A4XA 1IQ8A 3OGSA 1R9YA 4PB5A 1TUFA 4JN6A 1GEQA 2DUAA 3AS0A 1V3IA 2ZZ2A 3NCOA 2XSAA 1SZRA 1TMLA 4BWLC 2BVTA 1T6MA 3NRZB 3U8GA 1YRRA 5ENLA 2ABAA 3HBLA 2DJLA 4GLEA 3BZJA 1QW8A 2PD5A 1B57A 3NQBA 5BROA 3F4VA 4HPXA 3SGZA 1BG4A 2OQLA 2PUZA 4UFKA 2HVMA 4B3KA 5KETA 3JW7A 4Q6JA 4AF0A 3LRKA 3FAXA 4Q4OA 3WENA 5REQA 3TYAA 2WM1A 1ZNNA 3LHTA 3ITCA 1V03A 8RUCA 2CKRA 1Q4NX 1DTNA 5L6UA 2PAJA 2ZZCA 4Z2LA 1Y7VA 4J2PA 5AC8A 3C0QA 3ZLFA 5HA7A 3VD4A 5HQLA 4UQAA 8CGTA 1VBHA 5C7HA 3WMSA 3QFWA 4APNA 5LA2A 4OGZA 4MFDA 4R53A 4FOUA 1AUSL 3I7QA 3IUDA 1VPQA 4TV6A 4IJRA 4EXBA 3HA1A 1RY0A 2PDYA 4L6OA 4CNTA 3PPCA 2VI0A 2OWCA 2DVTA 3VUSA 2JKPA 3W74A 5F1UA 3LI0A 3BW2A 4XUGA 3UWQA 4GUFA 1SZFA 4IUOA 4FNSA 1KFBA 1SFJA 2ZZ3A 1X1NA 1F8MA 3SSZA 3NNTA 1RCQA 3BWWA 2XIQA 2QCNA 4MTVA 1XC6A 1PEZA 3RCYA 4E6MA 1AQ0A 3AMDA 1B3XA 1JF6A 3VC5A 3IJ8A 1QO2A 4W5UA 1R2RA 3L21A 4AXNA 3VIIA 3R0UA 2DDXA 2Q3OA 2OR2A 4JTIA 1F2JA 1OX6A 1ADOA 3OG2A 3IJDA 4GYFA 2DT2A 1VIZA 2CXGA 3PULA 2ZZ5A 3VZYA 3UCCA 2PEVA 1D7KA 4IQDA 3QZEA 1E6RA 2NUXA 4NI3A 1W5OA 1ZPTA 4OOZA 1SR9A 3ZQ9A 1UPMB 1W1A1 3LI1A 1ONWA 3CBWA 3E96A 3STEA 3NWRA 1FY6A 1QHPA 3LPFA 1X2GA 1TPWA 3IIVA 4DLFA 1DIEA 3VIGA 1J4EA 2WZMA 4WCJA 2VOMA 5IM51 3S9YA 3BH4A 1Y5VA 3PUDA 1JEHA 7ODCA 5EA9A 3FDKA 1TRIA 3R25A 3KP0A 1BYDA 1H51A 1OSEA 1KXTA 1WZLA 1TA3B 3QR1A 3KS5A 5A5WA 4EANA 2J24A 3B8UA 3EDJA 3U5YA 5I23A 3B0XA 3N2BA 3EA3A 1VR6A 5TQLA 1WOAA 3RU8X 3U4FA 3GS6A 2XIJA 3T78A 1MEIA 3PUOA 4A8LA 1GEHA 4H9XA 3TN6A 1XPYA 2BV9A 4I9AA 3VNKA 5AECA 3WDPP 1Q6RA 1IZKA 1LOSA 3QW3A 2VELA 3L4XA 3M0ZA 1OFPA 4JTQA 1Q4WA 4ML4A 3D9XA 1P6WA 4NEWA 2VT0A 5JU6A 4O0KA 5LIUX 4UZUA 2QDDA 6A3HA 1OM0A 4JHMA 2C15A 1YTEA 3WCZA 3L0KA 2WSRA 1UR0A 5I06A 2V67A 1JDFA 4L4OA 4MNJA 4AZBA 3EOEA 2CLEA 2J47A 2IKGA 1XDMA 1MDRA 5FJJA 3CZEA 5TAOA 3IRDA 4R88A 3LTSA 1VHCA 4MDOA 1Q6OA 3QY8A 2I7GA 5JBDA 4Q6XA 1GYNA 4LS1A 3RGTA 1OINA 2NQZA 3T0TA 2ZA1A 2A6LA 3NO3A 3VO0A 1BEUA 5ECUA 2Z29A 2NXGA 4NZ1A 5FJOA 5E9XA 2I56A 2PDPA 1IWAA 3CHVA 3HG2A 1ZJAA 4KBXA 3UG8A 1KM4A 4WQ6A 3EUB3 1K4HA 3VGEA 5GNXA 4N9CA 1PO9A 1HT6A 1TJPA 4DJFC 1R3QA 1Q6GA 1CGWA 1QK2A 3OGVA 1ESWA 4OBRA 5CPMA 4H9YA 1KB3A 1R5YA 4FHAA 1Q6LA 2OKOA 1V0NA 4B91A 1POKA 1EB3A 1XGEA 2OX4A 5MKGB 3KTXA 3Q37A 3K1DA 2JIEA 5CEWA 4Q4MA 4Z2GA 4AZ7A 4WOZA 4JAWA 1FWFC 1GKPA 1JCXA 4PBFA 3BK0A 1XLGA 2BMBA 4WGHA 3KZSA 4NZFA 2ZWYA 3AWNA 1CGVA 3OBAA 1M53A 2DJXA 4WDUA 2R94A 2WMHA 4KCUA 4X2RA 3QN3A 3ZJKA 2NW0A 5CSUA 3U2CA 1UR1A 2VGFA 3L4VA 1HKKA 4GR1A 5F7UA 3UZZA 3HGRA 4YN5A 3G0UA 3DJGX 4LVGA 3CMFA 4PA8A 3PZIA 3VOFA 1R87A 1FH9A 3QY6A 5CZTA 2YA1A 3VZXA 1QI4A 1Y8BA 2PDIA 2EHHA 3W01A 3FNDA 1MXGA 4MDPA 4D6HA 3WDHA 1SFLA 3GG0A 1MZRA 2RFGA 3QFBA 2RHGA 1DJQA 1UJQA 1AZ1A 2PLKA 3GDTA 1BYAA 1KV5A 1L6FA 4UOZA 3W1LA 3W6LA 5C9WA 4W8AA 4Z1BA 3G1SA 4AC7C 4G7FA 4S3CA 2X41A 4RNHA 3R79A 4NJHA 3O0FA 4DO5A 4XZLX 4JY9A 1TZZA 2BY3A 4GX8A 4D8LA 1K70A 3BOLA 1B9ZA 1GHSA 4E4FA 1UYQA 1BKSA 1DTUA 2G5WA 4FALA 1HW6A 1LYXA 4LVFA 1DQUA 4H8NA 1PAMA 4AYGA 3IACA 1BYBA 3TYEA 2VZOA 3CQKA 5A6LA 1JRCA 2PTYA 1TYPA 3TSDA 4ZGYA 3QOKA 3O1NA 2O56A 3AC0A 5HPOA 2I57A 4W87A 3JU2A 4HNVA 3DERA 4LUIA 4MZ1A 4UQEA 2SFPA 2A3CA 4E2BA 1VD6A 4LFYA 1O1ZA 3AZRA 1VJIA 3NQ7A 1W3KA 4HHPA 3WY1A 3PZ9A 2CEQA 3LMYA 1KTBA 3DK9A 3G1DA 4EXQA 4RUBA 5E0KA 4HN4A 1M1BA 4AUBA 1EQPA 4GHRA 5JCLA 2HVOA 1VEPA 4R3UA 4XX6A 1X7FA 2BGSA 2YLAA 2VUNA 2B7PA 3B04A 3AMKA 1NWUA 3ABRA 3G1XA 3KFTA 4RJEA 1KRMA 1EQCA 2RDUA 4NZ3A 2FHFA 2Y89A 4GXPA 2HE8A 4X3ZA 3WJWA 4KFPA 2J62A 4CNNA 1X7IA 4ONVA 3BSGA 3N12A 1TQJA 2YB4A 1YX1A 3EMCA 1JZ5A 3QMTA 4RDYA 4DJDA 4OU1A 1BAGA 3W84A 3BANA 2Z6IA 2NX1A 4LS2A 5FJRA 2VVNA 3FSUA 2DH2A 1CNVA 1KLYA 4GZEA 2OMAA 3TR2A 6REQA 3PJUA 3OG3A 3RCMA 4ZSUA 4H2CA 5BW6A 1RXOB 1UQZA 4LW7A 4L64A 3WLJA 3OBKA 2C8NA 3LTYA 3I68A 2EQDA 1FXPA 3IGUA 4I5RA 5HINA 3VIFA 4Z0JA 3UPBA 4H83A 1RCXB 1VEMA 3HN3A 4ICMA 3DHUA 5CGTA 2XSXA 2ZC1A 1N7KA 1UBSA 3FHQA 1V0KA 5FOOA 4KWWA 3UFYA 4B2DD 3GFZA 5FL1A 3NPXA 2VQUA 4IPJA 4QDMA 3SCUA 3M0XA 1FDZA 1VCVA 1ZB5A 3ZR6A 3MKVA 2Y7EA 1Q1RA 1PPIA 2WO5A 1XYAA 3P5ZA 1JF5A 3PJWA 3H4WA 4R34A 2DZSA 3PS7A 2AGKA 2V5KA 1QRQA 2HPMA 3GTXA 1XRFA 3AXMA 3GB6A 4F9DA 1HJWA 3MW7A 1A5CA 1DXLA 2POTA 2A79A 2JEQA 2QJMA 4K39A 3TXZA 1KO0A 2WP6A 1ICPA 4F48A 1H49A 3SR7A 8TIMA 2OVLA 3Q45A 4Y9AA 3SUTA 1XGZA 3RHGA 1KXVA 4EPEC 2F7FA 3E49A 1S5VA 1NHPA 2G50A 2YDSA 4G6CA 4QSFA 4WEVX 3WD4A 1UKOA 1AL8A 2OWXA 1G7UA 5LIWX 4PE8A 3B3DA 4TVCA 3RPTA 1E6NA 1H0IA 3C2RA 1MUMA 1G6CA 4IISA 1OYBA 1YDNA 1OBAA 1FHVA 3VOIA 2HCVA 4K8HA 1PKLA 4LSBA 1L6WA 2R1MA 2P3EA 3NEHA 5I6SA 4XVEA 5CZKA 4XAFA 4IMAA 3FA4A 1TR1A 1JFHA 2C6QA 5CLWA 2Z2BA 1TIMA 2ZVIA 4PTWA 4DBWA 2ZE3A 1ZENA 1T41A 2BY0A 3H26A 4GO8A 4S2BA 3EDFA 4GH3A 3RLUA 1BXNA 4HZ6A 1LT8A 4N9BA 2ACRA 1R6WA 3LCHA 4Q8UA 5CJ5A 4WUIA 1S38A 1Z3NA 2PDXA 1LJYA 3ZSSA 1KA9F 3RPDA 2E5AA 3GHSA 1ALDA 3N17A 1KBLA 1NHQA 4Z1DA 3NYDA 3NUKA 2FH6A 1PZ2A 3SCTA 3T0CA 1NQKA 2G41A 3SGGA 4QP0A 4E8GA 4FA3A 4AMCA 1ECQA 1TG7A 2BP1A 3GYEA 4LAKA 1KTNA 2W3RA 1X98A 1REQA 4ZEPA 3AOFA 4KQNA 4AWUA 3VDAA 4PL1A 2OZ3A 3TQPA 3B0YA 5HWMA 4JEQA 3M43A 1FUYA 2RDWA 1J11A 3H4GA 1GVRA 3VDGA 2H3DA 3O6AA 4DWDA 1DBTA 2XFYA 1M03A 4GIAA 3WYZA 4NX0A 1AODA 1CCWB 4JXCA 3B9EA 5HJYA 1VAHA 3MP3A 3LBMA 5I3DA 3TZNA 1E9LA 1W1ZA 4X0NA 5HR7A 3AIUA 4BCEA 3WNNA 4C1LA 5DMLA 2ZCGA 4XZHA 2V63A 2ZADA 3PB0A 1MZHA 2OLHA 4F0HA 2PODA 4I7VA 3H2OA 1F6KA 1V7AA 4H4WA 2W91A 2E3TA 3N9KA 1J18A 4D71A 2QCMA 3CPUA 1MI3A 2IXVA 1JXKA 3E0FA 4R9OA 4M6PA 4IIEA 2QXWA 3O0HA 3ZS4A 1R3TA 4U33A 2R1NA 2XM1A 2O0TA 1K03A 3DC0A 3WUEA 3SUUA 2WMIA 1O5RA 4JFUA 4K2SA 4HHMA 2NVAA 2HNHA 4REQA 3VVGA 4P2VA 3W85A 5LNSA 1W56A 1GESA 2GWGA 2X8HA 2WANA 2GLKA 2D3NA 2RJGA 1LF1A 3N11A 3FV9A 5DMYA 2NVKX 3W81A 3WNKA 2V3BA 4PMVA 5J5RA 1RA5A 3NAVA 5CGMA 1E4NA 3O6CA 4GE8A 3H21A 4E2VA 1E9IA 2TRSA 3FW6A 5CSYA 3P81A 1PWLA 1MUCA 4H8VA 1SZEA 3GYCA 4AIBA 4M19A 1AJ2A 5HULA 2V9DA 4PMDA 3NOEA 2AAMA 3W7NA 1FWBC 5A6AA 4GIYA 2NV9A 3MWAA 4CD6A 3CV6A 4GOAA 3UP8A 1RBAA 1FTXA 1ZBWA 3O2LA 1XHGA 3TA6A 4U2YA 3RYSA 1FOBA 2YFOA 3GH4A 2WPEA 3IV3A 2JKAA 3MSYA 3CB8A 5AYYA 4C6LA 4J3TA 1JUKA 2EQ9A 3CPRA 2WZIA 5D38A 3GTFA 4HCLA 2QNEA 2ACQA 5FS6A 4GX9A 5ER0A 4JTTA 1LRTA 2UY5A 3G3DA 2YDAA 4PCNA 3TLLA 3VD9A 4LUJA 5I7GA 3N2TA 2OLSA 3O0KA 3AI0A 5GQBA 4I8DA 3T81A 3KRBA 3W7GA 1WPCA 4DUOA 3BOFA 4H7VA 1HXJA 1EX1A 1GVSA 4TX9A 2ZZ0A 5FS8A 3IGHX 5G2HA 3H2EA 4TXEA 3T0DA 3LHZA 1ZALA 1X2HA 1SPQA 1KGXA 3AXHA 1P5BA 3VPLA 1QNQA 5I3IA 3T40A 3LERA 3KLKA 2H6RA 3IRSA 1JCTA 2E67A 5DXYA 3W38A 4PYSA 2C14A 1M9HA 3ZLGA 3LB0A 5GJPA 3H54A 4RR4A 3CAKA 3APYA 3W7CA 4FB7A 4N9DA 3GM8A 3W1UA 1R3SA 2ASHA 4QJ5B 3P60A 1NHRA 1BKHA 4ZZ9A 3MZNA 4JX6A 4IIHA 5DXXA 3QW4B 5E1QA 1MQQA 3D3FA 1WE5A 5G1TA 5T9BG 3AM9A 4H00A 5BXSA 2H8XA 3CLWA 5MF5A 3UQNA 4JYFA 3CPGA 3LPPA 3WH8A 2C16A 1B3YA 4O4VA 3U2ZA 1ISVA 5IRPA 5IDIA 5AHNA 5A69A 4PUUA 2V5BA 4HSNA 3TJXA 4WDXA 4Q4SA 5LNWA 3RN6A 3BL3A 3GG7A 2XG9A 3SQSA 1LQAA 3M0KA 2CFYA 1KFJA 5JUVA 3R7MA 1MQPA 1O5XA 4YU1A 3SCQA 3F2DA 1LQ0A 1GJUA 2O92A 4LYKA 3VKAA 3KVKA 4UTTA 2YW3A 1SJDA 3M0IA 4RPPA 2GGIA 2WMIB 2IKJA 2ZX6A 1DXEA 1YIXA 2EJAA 1XLKA 2VDGA 3H2MA 5FEXA 3L12A 4F0LA 3BLLA 2WWCA 1VJZA 4AVFA 2DZVA 4L1XA 1GKQA 2GR2A 2X16A 2D69A 5ABFA 5E09A 1XYCA 3P84A 4U4MA 4CVUA 1DJNA 5GVJA 4PUMA 4UTHA 4KIRA 1G7VA 4ADTA 4BY3A 3PPFA 3LK6A 2Y7DA 4TUFA 3KWSA 3M0MA 4HHLA 1YBQA 3ZJ7A 3I4EA 2W67A 1AMYA 3CZKA 3C2VA 1MO0A 2DIJA 2PWFA 2FGBA 2X8CA 3W7PA 3UWWA 3AQUA 2JBMA 3NGJA 3URHA 1ZZMA 2JK2A 4YWSA 4GQBA 4LU0A 5E6YA 3GBEA 3ARYA 1A3XA 3UESA 4BA0A 1L2UA 2QUVA 4CU8A 1OJXA 1XLFA 1YPFA 2PDFA 3FVDA 2X05A 2BXZA 3AHVA 3CTTA 1PHWA 1XCWA 3LM7A 1ZK7A 4ZENA 1R85A 3CV2A 1GCYA 3S6OA 2PWDA 3QMRA 4ZOHB 4AFYA 4RZ6A 4Y7EA 5FAJA 4KW2A 4S3AA 3NQAA 3G1AA 3G2GA 4D6GA 1EJUC 3KBNA 4OT7A 3DJJA 2F2KA 4HCHA 1IZJA 1ENUA 4LT9A 4B5XA 3GSMA 4H4VA 4PCFA 4NJJA 4U31A 1GG0A 3W0KA 1IEVA 3KE0A 4YLWA 1PE1A 4D8ZA 4O52A 6XIAA 4MY1A 1IHIA 1LUCA 2ATSA 4NAFB 1MW1A 1TV8A 1WXYA 4Q7NA 4DIAA 4DWSB 1O5KA 2FKPA 3S2NA 3SIZA 4DZIA 1ZMCA 3H2FA 1YBQB 4HNTA 3G22A 1KFCA 2DW6A 3QOMA 4ZOCA 5KZMA 1GREA 2RDXA 3NZRA 3VM5A 3N2MA 1GQJA 3TW6A 4A2RA 1W3HA 1JPDX 1Q6EA 3WLSA 4U5KA 3WDRA 3ZWSA 4AVOA 4MHBA 1A0DA 1EUNA 4GQRA 1CENA 1DIDA 2NQLA 1BQGA 3OIXA 3T07A 4M51A 4JFTA 3A47A 2Y2WA 4PH6A 1KBBA 2QUMA 1KXHA 1S2AA 4LS0A 2WXDM 1GEUA 3OHMB 4DZAA 2FQIA 3D46A 3WNOA 1MDLA 4J3VA 3PTDA 5IOBA 4XK2A 5D32A 5A3HA 1VBJA 5GJNA 3KL3A 4V28A 3NYZA 1O7AA 5DBTA 4QLJA 3HQ1A 3S0CA 4LYPA 2VVSA 4K8EA 2ZRZA 1F3PA 4MSSA 1MQRA 2PRMA 3T09A 1TJ1A 2BHUA 5D30A 4EPBC 3SCPA 3FCPA 4D6IA 4CLMA 1E4MM 2FFIA 1JL8A 1YNPA 4A8NA 2WCGA 2A3EA 1LDCA 3BAJA 3GK0A 4HMEA 1UG6A 3DYOA 3N3TA 3BXWA 3Q65A 1QTWA 3K13A 4QXIA 3NGFA 1E9ZB 4HK5A 3RM4A 3WIJA 5A6BD 4MPKA 3KVMA 3LCIA 4EM3A 1W1YA 1EEXA 4CEXC 3AYVA 3VK5A 4LYRA 3BCDA 4H9UA 4IJBA 5C6MA 4N4PA 4XD4A 4DF1A 1Z48A 1IT0A 1WAWA 3WN6A 2GSJA 2G96A 2E6AA 4BF7A 5AC6A 2PDGA 3M07A 2G8ZA 2E0PA 7PTDA 5I78A 1EGZA 4PFMA 2PI6A 4CGTA 3P14A 3T44A 1CT5A 3O05A 4K1GA 4X60A 2WNNA 1Q85A 2QAFA 3TJLA 4M80A 3USZA 1ZBKA 3CHEA 1A5BA 5BCAA 2O4MA 3ONCA 3FS2A 2CW6A 3BG3A 4CN4A 1HGWA 4AZCB 3GG8A 4YVXA 3OYXA 2QPXA 4ICCX 4O50A 2YGYA 4ES4A 4W4QA 2ZOXA 2DH3A 1P0DA 3S46A 4EKJA 2ZXQA 1OGSA 2BVYA 6TAAA 3S9ZA 2E6YA 4LBSA 2AQVA 4ZCWA 4GD0A 1KM5A 2YQUA 2CZFA 3REQA 3W02A 2ZX5A 1Q7ZA 3T8QA 4CU7A 4FSAA 1XKJA 1Z32X 1F74A 1Q45A 5U7SA 1AK5A 2X40A 2Z7GA 3DBPA 3PC0A 1Z8AA 3IEBA 1TWSA 2FTPA 4R7WA 4QJ3B 3LXAA 1EC8A 5LHFA 3M0HA 4ADSA 2EPKX 2HBVA 4MWAB 4UTKA 4B16A 1O95A 3ZXWA 3EGJA 5HDRA 5AHEA 3CUJA 1XICA 4UTFA 3CZ8A 3GVRA 3NQFA 3AHYA 2JGYA 3E74A 1R2SA 4KRZA 3LN3A 5DN1A 3A9BA 3UR7A 2PP3A 3TJ4A 3GVQA 2YBTA 2XM2A 4F2BA 1DEDA 3GXMA 1MVYA 4XKMA 5C9UA 2ZZBA 4C6QA 3WJSA 2J8FA 2ZC8A 4NAEA 1IGSA 5FS9A 3P62A 3SCRA 4OV9A 1L2QA 2VC9A 2BOGX 3S5ZA 4GIEA 1X96A 5DO8A 3AIEA 3QV6A 4L1GA 1F4AA 1KD0A 3G3MA 3VKJA 1FIQB 3PNZA 1B3WA 1N8WA 1B54A 2TMDA 4K68A 1GOMA 4AD0A 5C5YA 4P7RA 2PLMA 4PBGA 1X39A 4IIFA 3VX1A 4H50A 2Z1SA 1SO6A 5I2UA 3LHYA 2OO0A 3EB2A 2VFGA 4C6NA 2BSLA 3HMCA 4H6RA 1WP6A 3LLFA 1FFVC 1FWEC 4V1YA 2VXNA 2ATMA 5IHRA 5A8NA 4P61A 3E0IA 4LYQA 4FI4A 2Q6ZA 1TB3A 1ME7A 2CBIA 2E5DA 4XSMA 1W5MA 2NQ9A 1WKYA 4YPJA 4Y96A 3DGHA 1GZGA 2WSQA 2DZBA 2GUUA 4LAOA 1FCVA 4JNMA 1QK0A 4INFA 2WOWA 1E40A 2WB5A 1VENA 4OKDA 4EMWA 1FBAA 4H8UA 3AIBA 1W9XA 3MBDA 4HYVA 4O14A 3A3WA 1O68A 5LGZA 3RILA 2X7VA 3UZWA 3DH9A 3T4WA 1QPQA 4I90A 5DELA 1EJVC 1UCWA 4GY7A 5HBFA 2GK1A 1LZOA 2E6DA 1ONXA 3PBUA 5DY3A 4MVAA 4LF1A 4H4UA 1M7XA 3NR0A 4R85A 4ZB0A 3KTCA 1JAKA 3NQ8A 1CLVA 1I1XA 2ALDA 3GD6A 1UZDA 3SUWA 3GC2A 2Q8LA 2YOCA 3SQPA 5EBKA 3CT7A 1RHCA 4P7LA 4H4XA 1XI3A 4XIMA 4TVYA 2ZUSA 2QULA 2OCZA 4GJJA 3OP2A 2WVTA 3IANA 4LQ1A 1VGAA 4DF0A 3PBVA 1V3LA 1JULA 2J7FA 2CXEA 1EGMA 3AJ7A 3M16A 1KR1A 3U0HA 3LPGA 1GVFA 1MOKA 3ZT5A 3G0SA 3CV7A 4JTJA 1XH1A 1SSDA 2J7DA 3BGGA 3M0LA 4YTRA 4P8XA 3WUBA 4XSLA 1OGBA 3R6IA 4C6JA 4MWAE 4IGSA 2EQ6A 1BPLB 3E38A 3YPIA 3VINA 1FWWA 1C90A 4TX8A 3TEVA 5FESA 1B2YA 1H50A 1LBMA 5FL0A 2E3ZA 4WZHA 1UWQA 4JFVA 3T2PA 5H91A 2ZX9A 4XKYA 5FSEC 2VWSA 3TC6A 1KW1A 5AN7A 5AVNA 3SRHA 5CG7A 1V3MA 3URBA 2C3CA 4FLOA 1TIWA 1XIEA 2CLOA 1OGGA 1NOWA 2FGZA 1QUMA 4J57A 2D0FA 3WF0A 1SFSA 4DJFA 3A23A 3QSRA 3M5YA 4K36A 2GK1B 2J66A 1P7TA 4LX4A 3H7RA 3QHNA 3U5UA 1R9XA 1K1DA 4RW5A 2QUTA 3UWUA 1A5LC 5T9CE 4O28A 1TX0A 3GIPA 3BV4A 4W5ZA 1EHAA 4JL1A 2VWTA 2V81A 3SO7A 3LCFA 3TDFA 1J10A 4PRTA 5G1YA 1TV7A 3P93A 1FWTA 3NVVB 1NQ6A 2PF0A 4KEZA 3HJEA 4LEFA 5HJLA 2FPYA 1OCJA 3TONA 2FVLA 4XTDA 3P7YA 1TWDA 4QGCA 3HMJG 4MAVA 4A3QA 1G4EA 7REQA 5E93A 4IWWA 3LADA 3EOOA 2HROA 1AW5A 4YVVA 4S2CA 1BTMA 3CQHA 1V6UA 1BYCA 1GJWA 4YNGA 3SN4A 4MG4A 1CTNA 3WKZA 6TIMA 1GQIA 4LCRA 1YLVA 4KGLA 5TF0A 1XLMA 3SQLA 3F5LA 4JTLA 2EPOA 1GPFA 2VR4A 3UJEA 3W7HA 2XN0A 3N34A 4IPPA 1F73A 2IPFA 1W32A 3QC0A 4FAMA 4JKMA 2QIWA 3ES8A 4NEVA 4H4QA 2ACUA 1I8JA 3LENA 3MI3A 1GTHA 1PTGA 3AS1A 4CNSA 4M52A 1XIGA 4UTWA 5D09A 5M17A 4B5NA 3URQA 1QHZA 2BVWA 3SRKA 4HHHA 1OX4B 2J7CA 4DRSA 2QJIA 3MCOA 4WRHA 2W9MA 1JFXA 4HA3A 4UIOA 3UY8A 1BGAA 1H2IA 3KVLA 1CW2A 1UMLA 1OJTA 1O4UA 2YCIX 4EF8A 2IQDA 1IR1A 3RNMA 5FIPA 3ALFA 3UW6A 2WBGA 2WJFA 3AAMA 3WMCA 2WMJA 4FNUA 1JNDA 5HANA 1LL6A 2LLEA 1H2JA 3UYIA 5LGXA 3OYZA 2V6OA 5HOSA 1Q6DA 4BURA 5H2ZA 3KHJA 3M44A 4QM1A 3FX4A 5TNVA 3GQYA 4J1OA 1ZAHA 4WHBA 4GMEA 1J6PA 2WP5A 3B05A 4PUJA 4DF2A 4KH2A 4KETA 1J5SA 1EBHA 1KGWA 2VUYA 3C2EA 4NU7A 3E2QA 1TV5A 3SN1A 1OC5A 3CL7A 3HG4A 4KCWA 5HMSA 4PMYA 4GCAA 4BR1A 3ZSTA 3DHPA 2WJEA 1F6YA 3DI0A 4ORMA 1HG3A 4DXKA 5BWFA 2CYGA 5J5DA 2QAPA 3GTNA 3KP1A 1F61A 1DJXA 2WPFA 1Z69A 1RK6A 2Y7GA 2O7SA 3THDA 5D2YA 1O94A 2XTKA 2PB1A 3TSBA 3WQDA 3ME3A 1XRTA 1JD9A 3KBSA 1PHQA 2VC7A 5FA5A 4EPKA 1NY1A 1XIJA 4AMAA 2PP0A 1STZA 1PTAA 3UYCA 2PC4A 4RE0A 4QAIA 3MANA 3MY9A 3W76A 5D9OA 4YTUA 4I5UA 6REQB 4Z1CA 3I10A 4J3ZA 3V5FA 4MY9A 1CBGA 2D22A 4QAWA 3UNTA 4BF9A 5D2VA 1WYGA 3N13A 3EA2A 4DZ5A 2G3JA 5A8PA 3PBMA 2YL8A 1RBLA 3BLPX 1PJ9A 3A7RA 2R6OA 1NELA 3VD5A 9XIAA 4YS1A 3P2VA 2AMXA 4ZE4A 3R43A 3GW3A 1GPWA 1BWCA 3OU8A 1S5NA 3WQWA 2WC4A 3NM1A 1AD4A 1WBJA 1UP2A 2ISFA 4IHCA 1ONFA 3P8JA 3QV9A 1NARA 1LLOA 2DEPA 4AZHA 4WSKA 1UR8A 3WQ4A 3OLGA 4LV9A 3OGRA 2D23A 1AH3A 4JKLA 4B15A 5DCDA 4G5DA 3VYLA 3MI2A 3W7DA 2EG8A 1JCNA 3W4RA 2OYKA 3PPGA 1TVPA 3EWDA 2PGWA 3OQEA 1IZCA 2KAUC 4HPHA 2WVUA 1YXCA 3PY2A 1XRVA 3C2OA 4K37A 4FF5A 3HJZA 1T5AA 2I1OA 1W1PA 1ONRA 2I14A 4D6DA 5DX7A 1PIGA 1ZSXA 4EMIA 1EL3A 4QEHA 5FF0A 4HK6A 4F2TA 3T2QA 1QT1A 4JDRA 1QPNA 4NNBA 4H4YA 3B9NA 3GNXA 4HTYA 1A3HA 5HNUA 2AKZA 8XIAA 4FOJA 1Z6KA 1DNCA 1V08A 4NUWA 3H2AA 3C0JA 5H6HA 5CCZA 5AOUA 1DWAM 3TKFA 2DUXA 3VKCA 2GJLA 4NZCA 4CD8A 3GZ3A 2FPTA 5BXRA 2FJKA 3FYOA 1VH7A 1E70M 3LM3A 3VNZA 2HS6A 2V38A 3LRMA 2Y1HA 2HPIA 3MHGA 3ZMRA 1M6JA 4LUSB 4A05A 4RDWA 3V0SA 2GQ8A 1O6IA 2VDHA 1OYCA 1F8WA 2Z1VA 3ICJA 4PUWA 4GIRA 4JQ2A 4NVTA 5HAOA 5AC4A 3VGDA 3PBGA 9CGTA 3SBFA 4IP5A 2W66A 5GJMA 3GZAA 4GVIA 1IWBA 1KM2A 4CQBA 1QBAA 2VR5A 1WBHA 1L6GA 3FOKA 4S3EA 5IHSA 5JCIA 1EYWA 2E40A 1MW0A 4DJEC 5LA0A 2VFEA 3PTMA 4XZNX 5DF0A 2QV5A 4MNMA 4HT3A 4UR8A 3B0PA 2Y8KA 3W7MA 4UQCA 3CGCA 4JN8A 4QS6A 1SJAA 1JPKA 1A5SA 3R5EA 4PCTA 1QPKA 1VPYA 5FJUA 2W3ZA 2PGEA 3AZTA 1UWTA 1GOWA 2BB0A 2DQXA 4FX6M 4S38A 3MZ2A 3QHOA 2V3DA 3P74A 4HD5A 5CPLA 1EJRC 1QW9A 3ITYA 1FFRA 4W8LA 4FP1A 1OF8A 1XYMA 4P8UA 1J12A 5GPRA 4LY4A 2XVLA 4QITA 5HWNA 4I9TA 1YXYA 2XH7A 4GUIA 4XZBA 1IGWA 5E0CA 4DVOA 4JCMA 1JNEA 3FN9A 3A5FA 4BJHA 2QV4A 2GVYA 4F0KA 3G1VA 3BW4A 2OOFA 2C0AA 3UXLA 2QUUA 4ZVJA 2I5IA 5IXEA 3S2LA 1RUSA 4DXXA 3ARZA 1H3GA 4KKXA 3ITOA 4WJEA 5FJTA 3WNMA 5TR3A 1MEWA 3WJZA 5XIAA 4GABA 3CHFA 3R1ZA 4A3HA 2BXVA 2WYSA 3GFYA 1GT8A 3GXTA 3QTPA 3N2XA 3R8HA 5ABEA 2WSPA 5AB3A 3W2JA 1VLIA 2DPEA 1WYIA 5AZ1A 3CL8A 4W7UA 5GNZA 5FF2A 4HOWA 3RR4A 3V36A 1GOOA 4AD3A 4DPQA 2WPGA 3SCNA 1QJWA 3B40A 1Q8JA 4QS5A 3WLRA 8A3HA 3SM0A 1XG3A 1TMQA 2AKMA 3LBCA 3DU0A 4X63A 5U4NA 3ZT6A 4ACYA 1AD1A 3NZGA 2X8GA 4J56A 3LEPA 3MBFA 4P5UA 1JCYA 4H7CA 1CI1A 3S83A 4QFUA 3OC4A 5ECVA 3BV7A 5CJNA 3HURA 1AA1B 4YTQA 3T05A 4BEQA 4CNUA 2HNEA 3PG9A 1E1FA 3UJRA 1R38A 2CWNA 2G97A 1E73M 3SURA 3UZYA 3GUGA 5EFFA 3QKEA 3GDMA 1EZWA 4PRWA 1W31A 3L66A 2QCLA 4GJ1A 4GNJA 1JIBA 2GGJA 5XINA 1JDAA 1XANA 2YCEA 4Q3MA 1OC7A 2GGHA 1ZS2A 3MUIA 2CBUA 5HXMA 5SWUA 3NVDA 2PU1A 2HSAA 4PMJA 4NRSA 3DOPA 7XIMA 4POCA 1FWAC 1EXPA 2C13A 3BTNA 2J9ZA 2ZUMA 1VFHA 4Y9NA 3T2OA 4YCPA 2W55A 3EWYA 4QQUA 1EEPA 1PDYA 1FH7A 1A5AA 2YB1A 1MRAA 4Q4RA 3VD3A 3LMZA 5HPCA 2DSVA 4UMCA 1GONA 1JZ6A 4N2YA 1ODZA 2WV8A 1H5VA 3K1GA 1B3OA 3AZSA 4GISA 4AYSA 4XO6A 4Y9OA 1V3HA 2CLPA 4A21A 4JFSA 1NIUA 3CWNA 3DEQA 5DT5A 3W7OA 2WKJA 4US5D 1FDYA 3BE7A 3QY7A 4NY2A 3GKFA 4F66A 4Q32A 4UZSA 2GJRA 4KWVA 2UY3A 1MMFA 2VX6A 4FNPA 3B9DA 3PZUA 2X42A 2J74A 2QMKA 1M41A 3TZFA 3G1RA 1I0DA 1E71M 4CQ9A 4IQLA 4J3WA 4F40A 1O66A 3DESA 2NWRA 2FHCA 5K9DA 3BCFA 3LXBA 1JVNA 2UY4A 1QI0A 4GI8A 1FRBA 4GUJA 1ZAJA 4XO7A 3RF9A 1TTIA 3S1UA 2PFHA 1GRBA 2ZXAA 2J4GA 3HB9A 1WDWA 3R13A 4U3CA 5I5RA 3R0KA 3KLJA 2UBPC 2OELA 3W2MA 2V69A 3UR5A 3WQ6A 4XKYB 1V6XA 1BHGA 1W1B1 4DJDD 1XBXA 1EWDA 1JUBA 4GKLA 2YFNA 5A6SA 4TTUA 1S2WA 4DUWA 3MHUA 1T7LA 3PSVA 4PGLA 1W0MA 1EYEA 3A6OA 4AU0A 3MWCA 1V0LA 3FY1A 1P1XA 3F5KA 4EOUA 2H90A 3EAUA 1RD6A 2PD9A 1UC5A 3VNLA 3CXOA 4FIRA 2IQ0A 1CYGA 3PN8A 3B0UX 3GD3A 3TTYA 2YCLB 3TAOA 4B92A 3I3BA 3LYEA 3WZ0E 5JQ9A 3AMLA 2OG9A 1WDPA 1Y65A 1OFAA 1U1JA 2QDGA 1KWGA 3ALGA 3DUGA 3W26A 4N42A 1R8LA 2XU2A 3COTA 3INPA 3NJ3A 1FWSA 6ALDA 3AS3A 2AGTA 4GZJA 1U2YA 3LTPA 3EWUA 4GQ0A 1LPFA 1GVOA 5TD4A 3TUUA 2EG6A 3C3NA 4QE5A 3GAKA 3DFOA 1HKJA 3ZR5A 2PS2A 4IH3A 1AMKA 1V6TA 2PF8A 3QQWA 2ZTJA 1QW7A 4Q8NA 4DI9A 1NP0A 1VCFA 1R3WA 1ZTVA 4Z2IA 1VC4A 3GRIA 3UXIA 1XX1A 3AHXA 1MNSA 3KW3A 1NFPA 1P1MA 3H8AA 1HJQA 4FMVA 4O0ZA 2BCPA 2GQWA 1GORA 1F76A 5I09A 5I02A 1LOLA 3URAA 3WG6A 4KIEA 1E1CA 3WQCA 3DFSA 3UXKA 1Z9AA 9RUBA 3G6MA 3SY5A 3UA3A 4G7EB 3N6JA 2VTFA 1SJBA 4TVWA 3CZJA 2XHYA 7A3HA 1RQHA 1SW7A 1CB7B 2FZDA 3WJXA 1HJUA 2GR1A 2VGBA 4AB4A 4M8UA 1O60A 4F4RA 4DUVA 3S47A 2H9AB 4WKHA 1PTDA 4LRSA 3VIJA 1TPEA 2FB3A 3VIHA 3CUXA 5BWAA 3V7PA 4RV3A 4AX6A 2CLHA 4GPNA 2X0HA 4LY8A 1C7TA 5H8UA 3QPZA 3L2IA 2XVNA 4PB4A 3W75A 1PYMA 5RUBA 3WEMA 1FH8A 1HJXA 1XLHA 3N3MA 2ZZ1A 5E70A 3KBMA 4HJWA 3SY8A 3ABOA 1OD8A 2FB2A 2Z28A 4A22A 4BS0A 3VFCA 2GJXB 3W53A 4H8HA 4ZQNA 1BRLA 1JYNA 1OIMA 3WJYA 3RNDA 2JE8A 4ZBCA 1I1WA 3I3EA 2REQA 2HTMA 3ITGA 3FJLA 2V2CA 3POCA 3A64A 4EWJA 3VUPA 2C7FA 5C8BB 2B7OA 2GQ9A 2AOSA 5EMLA 2C1HA 1VRXA 1TYTA 1C29A 3RJYA 1H7PA 2GJNA 3IIOA 4A3RA 1IXQA 5A1AA 2HMCA 2XIBA 4PMZA 1K8XA 1BVWA 5BMWA 2C71A 2P8BA 1V6YA 2E8YA 2YR1A 3PTQA 4ROQA 2OKTA 4WJ8A 3LSCA 1L9WA 2OX1A 3ARSA 4H41A 1Z41A 4L9XA 3IGXA 1H11A 4URIA 4Y2WA 1U33A 6CGTA 2FPVA 3PNUA 3WBXA 1N8IA 3SCOA 2E6FA 3C0LA 3E2RA 1TX2A 4JTHA 1XLJA 3THAA 4D6EA 3QGVA 1E0XA 5JCKA 3TAKA 2QZRA 4DM2A 3TOYA 1OCBA 2X30A 1YDVA 3WLMA 3GRTA 3DYMA 1IEIA 4PUEA 2A3AA 1PUDA 1E1EA 2D2GA 5A6KA 5D03A 4FLSA 1US0A 3R07C 2XGBA 2JK6A 1LRNA 1V3KA 2WW5A 1RBOB 3ZJ8A 1QI2A 4EXAA 3OB8A 6PTDA 3O06A 3BGJA 1I2QA 1OY0A 1JCLA 4GVFA 1MSSA 1H7RA 1SSGA 2PMQA 1N61C 4ZA0A 1G94A 2VX4A 3KDNA 2XUCA 4QG9A 3CYJA 4YYFA 2P5NA 3R94A 4DJEA 3NFUA 1WZKA 4RZ4A 1CIUA 4N9EA 3C61A 1TTPA 2BHZA 3DZ1A 4UTLA 4TX6A 4W85A 4B5SA 2DP3A 1H7WA 3CEPA 1R3YA 1DJHA 2ISDA 2PDMA 4LAZA 1DYSA 4XAZA 4LVBA 2YCJA 4RPQA 4D8AA 3Q6JA 1VYRA 1RY8A 1D3CA 6XIMA 1EJWC 2TSYA 4E4UA 1JEZA 1EKOA 1D2KA 2FZ8A 2XWDA 4MAZA 4D6JA 5CPNA 4DNHA 1EIBA 1TCMA 4DO6A 3LQGA 1B9BA 2X8RA 3S42A 3VNJA 1KCLA 2ZWZA 2R24A 5DLCA 4HA1A 3W7EA 3VGBA 2TAAA 2ANUA 3NIYA 1PSCA 3VCRA 2V6AA 3AS2A 3C2FA 3QFAA 2UZ9A 2QF8A 1VFMA 2A21A 1HIZA 3W22A 3IK2A 4WK9A 4NZ5A 3SUVA 4YWOA 1DE5A 4HN8A 5LXXA 1TSIA 1GGOA 3FA3A 5C9XA 3LRLA 2JKEA 4C6KA 1C8QA 3MSGA 5A6TC 3H6OA 3U7BA 2X2YA 2J6VA 4AC1X 3V4BA 1KR0A 3DKLA 3SRDA 3KBVA 4DJFD 4K7VA 4JHOA 1WZAA 2XZ7A 4KWUA 1H0GA 3W7JA 3PP7A 3LV5A 5FJIA 3GG1A 3F4NA 2G95A 4O4WA 3GDBA 1HP5A 4IG2A 4MM1A 3AHZA 3CHDA 3LS9A 2P88A 2EF9A 3QV8A 5EMJA 3PZQA 1XPGA 1MEHA 4JEJA 3TIMA 1NWTA 1HO4A 4I9MA 1G01A 1QAPA 3NSMA 5CZ0A 2QDEA 5L9FA 4AH7A 4FXJA 1KBKA 4RXFA 1VZWA 5LZLA 3V35A 4IGHA 3LX9A 2QJGA 2B31A 3MYOA 4GVGA 4OOUA 1BGGA 1TYGA 3VIPA 5B7YA 2DZAA 2X50A 3CO8A 2W63A 5DEZA 3GVVA 5JH1A 2DZWA 4PCSA 4UOJA 5HNNA 2XIOA 1FCUA 2PE4A 1OF6A 4PC8A 4QQ3A 1B1YA 2J8GA 1DJZA 2HEJA 3BAWA 3G1HA 5C70A 1NH6A 4HGXA 3L5MA 3MSRA 4NZJA 1IXOA 4O18A 5G5HB 2VD9A 4M7TA 2VOTA 2QPUA 1Q8AA 3B4UA 5U25A 1IWPA 1XR2A 1UKSA 3QLLA 2YXOA 1R3RA 4DWSD 4R5EA 1BWLA 1WKEA 2DQWA 2R1KA 3UETA 3MUCA 5I3GA 1JDEA 3A21A 5AYXA 1DWIM 4H19A 4KPRA 1Q63A 1CB2A 3MMWA 3DHFA 3MYPA 3S1XA 4ADUA 2CHRA 3OHIA 4XBKA 3G5EA 3H2CA 2VEMA 3GU1A 1R0MA 3V1PA 5I77A 3W1PA 4WDTA 1R9ZA 2VGIA 1KFEA 1UKQA 4MUZA 1Z42A 3LSBA 1W3LA 4RW3A 5G1MA 3W00A 3NPVA 2PZ0A 4NSBA 3KM8A 2ZTKA 3OLIA 1OX4A 3R10A 3RMEA 3ITXA 4GJIA 5IFTA 5AC7A 2A85A 4UBPC 1ML1A 1S39A 3WD0A 4I8YA 4BQ5A 4HNOA 2WMGA 1GW9A 3QMSA 5D2TA 3W2UA 2W92A 4X61A 2GRTA 3WMBA 2ZVRA 4B5WA 1LBFA 3EWCA 1W91A 4XZ9A 3BARA 4CQDA 2WQPA 1EJXC 4HA4A 1FA2A 3R58A 4L5ZA 4AHQA 3N9RA 1TA3A 3WQ5A 2YL5A 1H7NA 1GRHA 2WJZA 3RK8A 1ZKQA 3KXQA 1JDCA 3RO6A 3ZVHA 4NQ1A 3CAQA 3HTWA 4J27A 2PDBA 2XINA 2ZDRA 1PWMA 2E77A 4C6MA 2Z1XA 4MF4A 3NZ1A 2D3LA 3BSHA 2HDJA 5CSSA 4JTRA 3H22A 3PZMA 4CCDA 4E8DA 4JTEA 1S1PA 1VFLA 4EX4A 5FEWA 3CH9A 1E72M 2YL9A 3TNOA 4PTDA 1LWJA 3BAKA 4DAFA 2CCRA 4AD1A 3W24A 1H1NA 3WH5A 1Q2RA 2GVLA 3NO5A 4J2MA 2YZ5A 4LB3A 5DCEA 2YYUA 3UPMA 3PZVA 1UROA 1N5WC 1PV8A 1QPRA 3L5LA 1DPMA 2XZ9A 1YNQA 2R8WA 3A4WA 5HK4A 3TTEA 4NYUA 4H6KA 3NURA 1QFEA 1RZMA 3N19B 5AZ0A 4NNAA 2PLCA 1F3TA 2OJPA 1VYPX 3EOUA 4UFIA 2VEIA 4FLRA 4Q4KA 4TMCA 1GXFA 5C0QA 4QJ1A 1XGDA 2AL1A 5EMUA 3ECQA 2CBJA 2OEJA 1DOSA 3EB4A 2DT1A 5HMEA 5LNRA 1X38A 1SO3A 5FJPA 4IGNA 2WMKA 4XD6A 2VCCA 2VEGA 4E3VA 3VNDA 1Q6QA 5LNUA 1MO9A 1EOMA 5D33A 4AIOA 4WR3A 4AY1A 4LUTB 1P0KA 4B9YA 1ICQA 2OXNA 1OFRA 4LCQA 4ATDA 1N63C 1OT2A 2O7QA 4KEMA 1JZ8A 1U1HA 2BC0A 2VX5A 4KERA 5C54A 1P4CA 1XINA 3RIKA 2ICSA 1E51A 3BURA 2GL5A 3HF3A 2WVVB 2ZRUA 1GSNA 2PDLA 1NSJA 3S1VA 3TN4A 2V0TA 2W61A 1FEAA 3ZOAA 5DRIA 1UA3A 2QVNA 1JZ2A 2OTDA 4I5XA 3AFBA 4L4LA 4QROA 7CGTA 1K8YA 3DAQA 1LBLA 3EOLA 3MJMA 4CNOA 3UT0A 2ZUNA 3EYPA 4BZYA 5AVHA 4YVPA 2MANA 1F6PA 2WLYA 1UIOA 1I4NA 3CMGA 4Y6GA 1GETA 3WH6A 4HJFA 1OD0A 3N4FA 1TV2A 1KBJA 3Q58A 3EF6A 1RR2A 3ANVA 1ZU8A 4X22A 4I3GA 1LG2A 2VMFA 3NQVA 3IUHA 1NVMA 1Q3NA 3G8EA 2W0UA 3ONBA 2BG5A 2OGYA 4Q8OA 2Z1BA 1OADA 3Q2DA 4IIGA 4S3GA 4UOQA 4MB5A 2W5FA 3AN1A 1CX9A 3PBWA 2A0NA 4NJIA 2WPBA 2WSYA 4U10A 4XBSA 3VX0A 4J40A 2ZZ7A 4GYKA 3TMQA 1LWIA 3NA8A 4ACZB 4ZTYA 4Y90A 2HV5A 5T26A 2GWNA 1VIWA 4O1FA 4ZO7A