3VCCA

Crystal structure of d-galacturonate dehydratase from geobacillus sp. complexed with mg
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
386
structure length
386
Chain Sequence
LNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title CRYSTAL STRUCTURE OF D-Galacturonate Dehydratase from GEOBACILLUS SP. complexed with Mg
rcsb
source organism Paenibacillus sp.
molecule tags Metal binding protein
total genus 134
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3vccA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3vccA01
3JVAA 2AL2A 3VA8A 4HN8A 4E5TA 3S5SA 2ZADA 2PSNA 2NQLA 4E8GA 3CB3A 3R25A 2P88A 2HZGA 1KKOA 3NXLA 3ZVIA 1R6WA 1MUCA 3CAWA 4H19A 3TJ4A 3PFRA 5J04A 3QPEA 3N4FA 2OZ8A 1P43A 3TCSA 2QJMA 3ES7A 2OX4A 2XH2A 2OLAA 3V3WA 1JPDX 2QJNA 3UJEA 1MNSA 2HXUA 3DFYA 2DW6A 3V5CA 3I4KA 3THUA 3DDMA 4MKSA 4FP1A 3MKCA 3GC2A 4DXKA 4IP4A 2PGEA 1TE6A 2OKTA 3PK7A 1E9IA 3SN1A 4HYRA 3P93A 3B97A 4ZCWA 4GIRA 1JDFA 3R11A 3SBFA 3Q4DA 3QN3A 2PP0A 4JHMA 3OZYA 4IL2A 4IZGA 2GGEA 3OTRA 4GGBA 4H1ZA 3TTEA 3T4WA 4ROPA 2XH7A 3IJIA 3TWAA 5FJRA 2QJJA 5FJTA 3GD6A 3H70A 1EBGA 1EBHA 5ENLA 3QKEA 4JN8A 2GL5A 1KCZA 3OP2A 4HPNA 4E4FA 3CK5A 2GGGA 4GMEA 3GY1A 3TW9A 3TJIA 1EC9A 2QVHA 3UXKA 4HCLA 2OQYA 3N6JA 5BOEA 1P48A 3VCCA 3ZLHA 3MUCA 3FCPA 3DFHA 1JCTA 4KEMA 3FVDA 2P3ZA 2RDXA 4JN7A 1EC7A 3Q45A 4YWSA 2PU0A 2HXTA 4IP5A 4G8TA 1ECQA 5EU9A 3OW1A 1KKRA 3RO6A 4M0XA 3OZMA 2OFJA 2P0IA 4GYPA 1PDZA 2HNEA 1WUEA 3NO1A 6ENLA 3MZNA 3QLDA 2PP3A 3H12A 7ENLA 2P8BA 3DESA 3N6HA 1R0MA 2GGJA 4A6GA 3ES8A 3IJQA 1MDRA 2POZA 3BOXA 3BSMA 3D46A 3VDGA 2OPJA 4DN1A 2PTZA 3JZUA 2PTXA 3MY9A 5FJPA 3DG6A 3VCNA 4J3ZA 5IDZA 4ENLA 3T9PA 5FJOA 4KPLA 1DTNA 3RR1A 4Z17A 4IT1A 3DEQA 2ZC8A 3PWGA 4HCDA 4HNLA 3PWIA 4K1WA 2I5QA 3R0UA 2QGYA 3T6CA 4DWDA 1SJBA 3BJSA 3TQPA 1XPYA 2GDQA 4DYEA 4Z1YA 2OG9A 2AL1A 4EWJA 3N4EA 3FJ4A 2OQHA 3MWCA 3FXGA 3SSZA 3SN0A 3SQSA 1SJDA 3S47A 4HNCA 1F9CA 2GSHA 5BOFA 2QDDA 3DGBA 2PS2A 2CHRA 4MGGA 3UXLA 3T8QA 3DERA 3STPA 3UJRA 1OEPA 3VC5A 2QDEA 2PPGA 1PDYA 2MNRA 1SJAA 1FHUA 3U9IA 2FKPA 2XSXA 3UJSA 1TZZA 4E4UA 2P8CA 3MQTA 3UCCA 2OZTA 4GGHA 4ZA0A 3RGTA 2PTYA 3MSYA 3P0WA 4KT2A 1RVKA 1WUFA 3VC6A 3TWBA 3H7VA 1NELA 2PP1A 4A35A 1L8PA 4X2PA 3K1GA 4MMWA 4A3RA 4GISA 3DG7A 3ZVHB 2PGWA 3CT2A 1MRAA 3JW7A 1BQGA 3EEZA 3FYYA 2XGZA 3RCYA 3CYJA 3V5FA 3IK4A 3RRAA 3P3BA 1XS2A 4IHCA 2OVLA 4KWSA 3ZVHA 2FYMA 3I6TA 1BKHA 4G7FA 2QQ6A 4F4RA 2AKMA 4GYPC 1SJCA 3DIPA 3CXOA 4FI4A 2PCEA 4DX3A 3NFUA 1ELSA 4GFIA 2MUCA 4DHGA 1NU5A 3R1ZA 3D47A 4M6UA 2PTWA 2PMQA 3I6EA 3GO2A 3KUMA 3VFCA 4J1OA 4K8GA 4K2SA 1KD0A 1FHVA 1ONEA 4E6MA 3UJ2A 4H83A 4H2HA 1MDLA 3UJFA 3TOYA 3UCDA 3SJNA 3ENLA 2GGIA 2XH0A 3EKGA 2XH4A 1TKKA 2PODA 3V4BA 2O56A 3ZLGA 2GGHA 3IJLA 3U4FA 3OPSA 3HPFA 2PA6A 3DG3A 5FJUA 1EC8A 2OZ3A 3UGVA 3R0KA 3FV9A 3H8AA 3SN4A 3QTPA 2AL2B 4HCHA 2OO6A 3ZLFA 2DW7A 2PU1A 4IL0A 3RITA 1IYXA 1YEYA 1W6TA 2ONEA 3R10A 3NZGA 1JPMA 2AKZA
chains in the Genus database with same CATH superfamily
2WMJA 1A5SA 5TD4A 3GWQA 3FVMA 4G56A 3UA4A 1PTGA 1T41A 4B2DD 4ADWA 2W66A 3TJXA 4JGDA 4QP0A 3B05A 3EOSA 3PJXA 2KZHA 3A4XA 4IH3A 2XWDA 3C2FA 5D33A 3THAA 1P43A 1RQHA 4HJWA 4S3KA 2FGZA 2OX4A 1HKMA 2HE5A 3N9RA 1JUBA 4AD0A 7ODCA 2HXUA 2X2GA 4J5NA 5F4WA 2FVLA 4JTCA 3AOFA 2Z1SA 1FH8A 4HNTA 1JR1A 5J8LA 3N11A 1U5VA 1MI3A 1A80A 5AYXA 4AWUA 2WOVA 1FVPA 2BGQA 4RLIA 2WSRA 2PLMA 4QISA 1TE6A 1I75A 4QAWA 3WF0A 2W3RA 3SN1A 4FPSA 4FDCB 4GYKA 4M81A 1KRMA 3QMTA 3W82A 4NRRA 4PBGA 4MY8A 2QMJA 3MJYA 4RPQA 4JHMA 4HA0A 4QDWA 4FNPA 3E0WA 1ZRQA 1JRCA 4GGBA 3PJUA 3SI9A 2HVMA 1SZFA 2VUYA 3DYMA 3M0IA 5M3WA 1F07A 3BCFA 1OJXA 1U22A 3SW6A 2FTYA 3S6TA 2NX9A 3MUZ1 2A3CA 2Q8LA 1XD0A 2I9EA 4K7VA 4LVBA 4MSSA 4AY8A 1J12A 1DJHA 3SCUA 2B0MA 3PBGA 1G7UA 1ONWA 3WX7A 3VZZA 1A49A 4I6KA 2BLEA 1HGWA 3FSUA 3LHUA 1MOKA 3JU2A 2WCGA 3WLQA 4GJJA 4L4MA 1QR7A 1N7KA 1AA1B 4LGXA 2E6DA 1QBAA 1P1XA 4A8IA 4UTWA 3UT0A 3AMKA 3FVDA 2H3BA 4W8AA 2ZRVA 1DHKA 2ZUMA 3QPYA 2HXTA 1VFUA 4P7LA 4CNPA 3QZ6A 1IE7C 1GORA 3NRZB 3FS2A 1OVDA 1YTDA 1TWWA 2OELA 3HIJA 1M7PA 3T0CA 4WZHA 2ZOXA 3RO6A 3TXZA 1OG0A 5CBIA 2QJIA 1PDZA 4W5UA 1GVQA 1KV8A 4IIEA 4YLWA 3SCSA 3UZ5A 4KEVA 4F40A 2E6FA 1LYXA 1GZJA 1EGVA 3DESA 4DF0A 1KFWA 2ACQA 1VENA 3UY8A 1ONXA 2Y88A 4FXSA 4KCUA 1FWAC 3OQEA 2LLEA 2PTXA 1EIXA 3GBDA 1GKPA 5HK4A 4DF1A 3VOFA 1EA9C 3M5XA 3THDA 1KTCA 1DJNA 1D9EA 2ZC1A 4BI6A 3QQ0A 3POHA 4FLSA 3M0LA 4PMZA 4UR7A 1JCMP 3AXHA 1E6QM 3MSGA 1WAUA 4Z1YA 5A6SA 3H21A 3N3MA 4FX7A 1W9UA 3GDRA 3P14A 4QBXA 3N2OA 3FEMA 1YNYA 4C90A 4HNCA 4GK8A 3K5XA 2QDDA 2Q6ZA 3VIMA 1VFFA 4FOUA 2HISA 2FFIA 2YCLB 4V28A 4C6DA 4GQ0A 3CYVA 3AXKA 3V0TA 1S2CA 3TTQA 3QSRA 1XF0A 1E15A 2E9LA 1BYCA 3W71A 3L4YA 1C7SA 1O6IA 5G1TA 5A6BD 3BK0A 3W23A 3LI0A 3CHEA 4TVDA 4OGZA 3VXGA 1HG3A 4CVUA 1XIGA 2Y8VA 3ATYA 4IFRA 4TTGA 2PWVA 4A3HA 4C1NB 5D30A 3BG5A 4JKLA 3BANA 4WKFA 3TMQA 2WNQA 1KM5A 1EYWA 2OYLA 3UW6A 4ZB0A 4ADSA 1GQLA 5I3DA 3W1NA 1LBMA 1O5XA 3P84A 1BQGA 3FYYA 1O7AA 4OUEA 2R82A 1W56A 4XZIA 5DCDA 3WNOA 1E1CA 1XLGA 4LAOA 4IHCA 4XUYA 2J9ZA 4O53A 3W7OA 4NX5A 5FCZA 4H4VA 1ZALA 4PCNA 1BGGA 3DK4A 4HA1A 4KFNA 2PCEA 2YSWA 3IV3A 4GO9A 2G3JA 4XBKA 1NHQA 1O94A 5D9MA 1F3TA 4D9PA 2MUCA 3E74A 3C8FA 2Y6ZA 4EPBC 2G50A 4MZ1A 4E2OA 2FPTA 4P8XA 4E38A 3HBLA 1J5TA 4DZ5A 4AZ6A 2PTDA 2Y62A 2PMQA 2P50A 1KBKA 4TVCA 2C15A 3HPZA 1NARA 3H24A 3VFCA 4Q6XA 2YFNA 4N9CA 2ZTJA 3WJYA 2CCRA 5AC7A 3C4UA 1KCLA 2J77A 4IX2A 3AS0A 3AYRA 4HN4A 1XLBA 4HBKA 2QAPA 3E02A 4RZ6A 3G1DA 3ITTA 1PJ9A 4W7WA 5LZLA 2FQIA 1C8VA 3AIVA 3NVDA 1W91A 5F4XA 3ARRA 2ZBTA 3KVKA 1UWSA 1XYFA 1L6YA 3TCEA 4O50A 4JIEA 3S5YA 1XANA 1IXNA 1VEOA 3PZIA 1I2RA 2A1YA 4IIGA 3VIGA 4NAFB 4W8LA 4OZOA 2BVTA 4F2BA 3WQ4A 1XC4A 5A8GA 4HYVA 2C16A 5DX7A 3SN4A 3W22A 3ZJ6A 2EQ7A 3F4VA 1PKNA 3AMCA 4AZBA 2I56A 2GUYA 4LUIA 2GSJA 2W0HA 3A9IA 1DTUA 3G1FA 1AD4A 3WQEA 1W8GA 3AHZA 3KL3A 3ZXWA 5HMEA 3B0UX 1ONRA 2OCZA 2BY1A 2E68A 1TX0A 5KZ6A 2FHBA 1D8WA 1J9YA 3UR7A 5EBUA 4BQ5A 1P0DA 3MS8A 5EA9A 3W2KA 3LCLA 1Z42A 3S5SA 4UTHA 2P88A 3ZWSA 3PBYA 3BZGA 2QLYA 1ZENA 1I2PA 3QBUA 4PMDA 1X39A 1JPHA 2QJHA 3VMOA 4QEEA 2JALA 3W28A 4HHPA 3T55A 1V93A 3QPEA 1H09A 1XLIA 3B04A 3II4A 4UQCA 1MFUA 3BXWA 5HJXA 3USBA 3V5CA 4XVDA 5DY3A 5BROA 3N2MA 1S1RA 3N12A 4WEVX 2WLYA 1W9DM 2DSWA 5REQA 5M03A 1UWQA 4MF4A 3AYVA 3SFWA 1OK6A 1UP3A 2A0NA 4RW5A 4RZ5A 5C71A 2VVNA 3ONBA 2XDFA 2YOCA 3WDQA 3L2LA 4XG1A 4GKTA 4PGLA 1K70A 4V27A 1HF6A 2DH3A 2EKGA 4Q8QA 5I77A 3IUIA 4IGNA 1H1ZA 3BW3A 4FSAA 5K9DA 3N15A 3EPOA 1CB2A 3LCWA 5D02A 4YN5A 4TMBA 3G0XA 3ME3A 1QOQA 2EPHA 3QGKC 5T91A 3TV8A 3UESA 3C86A 1EDQA 3R0DA 1FEBA 1THFD 5A6KA 2E5BA 3IJ9A 4OJYA 1XYCA 4DPPA 3C2RA 5HNRA 3RPTA 5DXYA 4LF1A 3N34A 4ZBCA 2PCQA 3GUGA 4QE1A 1WCGA 3VKKA 4I9TA 1Q6RA 3W7QA 2WNNA 4ZOEA 4DWSA 3TJIA 3WQ8A 4QX4A 4JXCA 1KFJA 3QR3A 4RE4A 1H11A 2V5CA 5TNVA 1DJWA 1OY0A 1C8XA 3T0BA 2GJLA 3W2JA 4UFIA 7A3HA 4N2YA 5FL0A 4YVXA 2J27A 2GK1A 2IMRA 3K4DA 3K2GA 2XFYA 2J66A 1B3YA 2QPXA 3O9NA 1E5NA 2WVVA 1F3PA 1GTEA 4L1XA 3N2BA 4KFOA 1PIGA 2WKGA 1MXSA 4YTUA 4N02A 3GH7A 2FTWA 4J56A 1TTQA 2QCCA 3VK5A 4EWND 3T0DA 4H6QA 4KETA 3TYEA 3TIMA 1MDRA 3WG6A 3L7RA 4JX4A 1HO4A 5H1WA 3W83A 1X1ZA 2YBUA 1GSNA 2W9MA 3NDOA 5A1AA 1MW2A 3LTPA 1HUVA 4DJEA 5LIXX 5LXEA 1WO2A 3LPPA 3SFKA 3W7NA 3M0JA 3W9ZA 5FS7A 1E9LA 2BMBA 3MUAA 4AIOA 4LUYA 3PUDA 4IT1A 4RZ4A 1A5BA 2BSLA 4TO8A 3PWIA 1LP6A 3MV11 3VD9A 1JEZA 3L0NA 4C7FA 3L2MA 3S4TA 2WLZA 3S2MA 1K4HA 3OLDA 4J9JA 5HQMA 2V3DA 3G2GA 5LIWX 5IOBA 4GE8A 2W5FA 2J47A 4CU8A 3M7SA 2XWEA 3NVVB 1W1TA 2WBAA 1NFGA 4APNA 3S47A 1OSEA 3QHOA 1AODA 2XFRA 1QWKA 5CZKA 3H54A 2RHGA 3N4AA 2ANUA 3NQEA 3BLDA 3IAPA 4PUMA 4FEZA 3UXLA 4DZIA 3R89A 4Z2GA 4DNAA 2EO7A 2WBKA 2WC3A 1UROA 1E3ZA 4O15A 5AKQA 4LH8A 2FMOA 2HVOA 3CEUA 2PDFA 3BMVA 2H8ZA 2BG5A 4H6EA 3MUIA 4B5UA 3E49A 1LPFA 4RDWA 4B92A 2CHNA 4GYFA 4ZE5A 1RK6A 2GUUA 4H4IA 1KWGA 2OZTA 2Z4GA 3W85A 1K6WA 4K7ZA 3WLLA 2QS8A 1E51A 5LA2A 2GYIA 4QITA 2VOTA 3BDKA 2V8ZA 3GW3A 5K4XA 2A2IA 2Z2BA 1TSIA 2ZCGA 1JPKA 1U33A 1OG6A 3HG3A 3RMEA 3QHNA 3DYOA 1QI0A 2EKCA 2WHKA 3L68A 4GISA 2EG8A 2PGWA 3VNLA 3VOJA 3FGCA 4YJ5A 5AFDA 4GG9A 4EQSA 4FF7A 2I7GA 2V5JA 2FZDA 4JDBA 4MB3A 3P3BA 4A3YA 1W1B1 4PFMA 3OVPA 4DUOA 5JH1A 2X2YA 2FYMA 4AVNA 3CASA 1BKHA 2PGRA 4H4YA 1DORA 2CIPA 1KQYA 2EAWA 4OFCA 1RCQA 4KQNA 4EACA 5LGXA 3GNDA 1CXFA 3RHGA 1GJWA 2D3NA 2O92A 5ABTA 4AW7A 4S2CA 3PBWA 1OJTA 2FDSA 1A0CA 3KM8A 1JQXA 3TUUA 4S38A 4Z2LA 1XR2A 4JTLA 3CBWA 1XHGA 3VDAA 3OGRA 3VE9A 2EQDA 4CNSA 3GU9A 2WOIA 3I65A 4ICMA 5EMJA 3E12A 3OVRA 4OBRA 5DELA 1NDZA 4PB4A 4IGMA 3OHIA 2GQ9A 3CWOX 5I23A 1JNEA 5CH9A 3KBVA 3GSMA 1BAGA 1TZ9A 4FF5A 3VYLA 3AJ7A 2UBPC 3OB8A 4AF0A 3U3HA 4A4AA 4FMVA 3T42A 4IMCA 1ZXIC 1TIMA 3GW0A 3QFAA 3ITCA 2NWSA 3CU2A 3WQPA 1PO9A 5DCEA 4C6LA 3FIGA 1NPXA 3GE7A 5HJLA 1Q6DA 2DSKA 3MCNA 4XWUA 2BC1A 1OFPA 3HQNA 3E5BA 3VD4A 3V35A 1UWAA 1YE6A 2DV0A 2D73A 4WDTA 1DXFA 2A7NA 4H7CA 3CB3A 4DJED 4G7EA 2VZVA 3QQ1A 1LWJA 5BRQA 2PDBA 3T44A 1EGZA 1YX1A 2X0HA 3RLVA 4EIVA 3DFPA 4HMCA 1V3LA 4BWLA 3QV9A 4LRSA 5CPQA 2XH2A 2X99A 1NOUA 2QJNA 1JFXA 3UJEA 3L4VA 3DAQA 4CCZA 5FS9A 3WDRA 4WDUA 4PTMA 1HP4A 3G6LA 4WUIA 1W54A 2V5DA 3SUTA 4ECLA 3FYPA 1RVGA 3CZEA 1IEVA 2I17A 2OLSA 1H51A 3ZR4A 2BBFA 2CXGA 2J13A 4K7YA 5CJNA 4L9ZA 4HHHA 1F61A 2J79A 1KXHA 1NFPA 3ISIX 2NXIA 1XDIA 1I9CB 1VYPX 3EWWA 3QN3A 1JULA 1HP5A 2HE8A 3IPWA 3Q94A 3MV01 4G5DA 5HNUA 3TDFA 3IGUA 3G1VA 4NEVA 2BVWA 4MAZA 3ERPA 2PDNA 4MB1A 1KBIA 1XUUA 1X2GA 5JBDA 4NZJA 1TPVA 1A53A 5FSEC 3WBYA 2PWEA 4MZYA 4Q4OA 5F2GA 1B2YA 5FEPA 3BZJA 3P0XA 4Z2JA 4LU0A 3W7MA 4E2BA 4NG3A 1V3IA 2R91A 3O3RA 3A24A 4JYEA 2CW6A 4EXQA 3CLMA 2WBGA 4LBRA 3WZ0E 4HK5A 1VQZA 4HZ6A 5I03A 3GU2A 3WEZA 3PY2A 3GVVA 4QCEA 1OYAA 4ERIA 4O12A 4P8VA 1K8YA 3LBCA 1JEHA 4DUXA 1QHOA 4YWSA 4IUOA 3E38A 1KB3A 3FOKA 3H22A 1UJQA 4XO7A 3LCFA 3ORWA 3OIHA 4AAJA 2WK2A 1TV3A 3OHMB 3WLIA 1K03A 1AJZA 1IWAA 4M1RA 5B80A 2WJZA 2FDMA 2GQAA 4JX6A 2NUXA 1XLDA 2IQTA 5JIPA 1NH6A 1CXKA 1ZQ5A 3SZ8A 5B7YA 5IFPA 3VX1A 1DKWA 4GY1A 1DNCA 4K8EA 3GXTA 1UBSA 3CAKA 1KFEA 3WENA 1LF1A 1ZJHA 4EXBA 1EOKA 1FTXA 4O52A 3WJSA 4K37A 5A8NA 4V1XA 4UTJA 5A6LA 3QFBA 4IOTA 5IDZA 4ZXOA 2OWWA 4M19A 1TYPA 2DPEA 2XZ7A 2ZZ6A 4U2YA 1YXCA 3UPMA 4QJ5B 1ZAIA 3BJSA 1O95A 3MSDA 2QUTA 3BL3A 2C19A 4DYEA 3F4WA 4YTSA 3IJ6A 3HMJG 4OIFA 3OBEA 5C9RA 1GEUA 1N8FA 6ALDA 3LCGA 4H41A 4R53A 2VRKA 4IIBA 4KH2A 1IWPA 4H6KA 4D6JA 2VDGA 1PE1A 2YL5A 5G5HB 4MGGA 4NJGA 4C6MA 3MMDA 1Q5MA 1ZCCA 5LHEA 1SJAA 1RQEA 4MB4A 1LG2A 3VUPA 1FHUA 2V3EA 2X7WA 1RV8A 3INPA 2QCDB 2V30A 4PUKA 4CCDA 3VFLA 3F5KA 1BKSA 4NNAA 1OX4B 3W7RA 1X1OA 2YA1A 2HWGA 3F2CA 3II1A 3EX4A 3ICJA 4W85A 3AYSA 4DJDC 3WH9A 3OYXA 1DIKA 1G0CA 3T40A 4ONVA 3WDJA 1FWEC 2IPFA 3VC6A 7CGTA 2C8NA 1EWEA 3E0VA 2DT0A 2ZZ1A 4J57A 4RKAA 2PP1A 2PDHA 1F8MA 2W55A 3BICA 3BG3A 1HT6A 5FAGA 1FWBC 1UD6A 4HA3A 1L6WA 4H4ZA 1MO0A 3E5PA 1JF5A 3QTGA 3VPLA 2XN2A 3NXFA 3EB4A 2DUZA 3EDKA 1GYLA 3EEZA 4PMJA 3V5FA 4GI8A 4LRTA 1AW5A 2J8FA 4YIWA 4OBTA 4B4FA 3GDKA 3AHXA 3OG3A 1JQVA 1EUNA 1OT2A 4S3GA 2CLOA 2ZXQA 2Y2WA 3AI0A 2FJUB 2OSXA 2P5NA 1QHPA 4XB3A 1NP2A 1ZS2A 5DCBA 1XRSA 5A6TC 4HMEA 2D2JA 3ZS4A 4NNBA 4AEOA 4GFIA 1A5NC 3SECA 3NQMA 3RLGA 2VP8A 1QPNA 4DHGA 1WKEA 2OOGA 2WM1A 3O05A 1REQA 4O0ZA 1B30A 2PTWA 1I2QA 1JUEA 5A3HA 1SO4A 2CLKA 1OT1A 4LANA 1YDNA 4S2BA 2GJNA 5FA5A 3LM7A 1FECA 7PTDA 4I7WA 2VVSA 3LTSA 1Y0EA 1QPQA 4E2VA 3HW2A 3CQ0A 1SW7A 2QR6A 1XRVA 1TA3A 1Z89A 3RFAA 3K4AA 1US0A 1EH9A 2XGIA 3ENLA 1CGWA 3ZSSA 1YPFA 1PXGA 2XU2A 4GKLA 1XQLA 1LT8A 2BP1A 3D0CA 3OG2A 1GOKA 4W5ZA 4LNYA 4INFA 3HRDC 5AYZA 4NASA 1AZ2A 3S1WA 2ZRYA 4KFPA 3NA8A 1RR2A 3IRDA 4DLFA 3GBEA 3HG4A 1GWJA 1Q4NX 1NQ6A 2PGFA 3H2EA 5KZEA 3TXVA 2VCBA 3AU2A 2PWUA 1E71M 3AIRA 4YU1A 1HL2A 4CEUC 4XX6A 1RLCL 4O11A 4HZ8A 4F0MA 5D04C 3VZYA 4AD1A 1B1YA 5GQBA 3NQFA 4Y9OA 5FF4A 2ICSA 3LNMA 4Y9MA 3VU2A 2WJDA 2ZFAA 4OECA 3PFRA 4IJBA 3APYA 4QS6A 1ZU8A 3EA1A 2C71A 1JZ2A 2QJMA 4V1YA 1GRGA 1JDAA 1XXXA 1EHAA 1K8CA 2FZ9A 3UVAA 1MNSA 3PM6A 3I68A 1CXEA 1AUSL 1DE6A 4KMQA 1SB3B 1GERA 1OYCA 3DX5A 1AQFA 1OHLA 1F3EA 3TP4A 1MSSA 2INZA 1L2UA 4A29A 4YNGA 2J75A 4KGJA 2OSWA 4EANA 3NURA 2OKTA 5D2XA 2RJHA 4EAYA 3CIXA 4D2JA 1TPH1 2IKJA 4DO7A 3EXTA 2Q3RA 1DIEA 6A3HA 5HXMA 3LHZA 4M82A 4ROPA 1TMHA 1B3ZA 3IIPA 4FNRA 2VGIA 5HATA 2VFHA 1YMYA 4JQ2A 5DN1A 4PUWA 2Y5SA 1PBGA 4MNLA 1F4HA 3RX3A 4Y8FA 3GTNA 3KCJA 3GG8A 2E1WA 4HPNA 1JCYA 3I10A 3I3DA 3LYEA 3S2LA 2EEXA 3GHRA 1ODZA 4LNCA 2EPLX 5D32A 4HCLA 1RBAA 4BFAA 5HNTA 3E0LA 3NVZB 3BMWA 5E9AA 2W92A 3GTHA 4LPCA 5JCMA 4S1FA 4D1JA 5I09A 2VFFA 1NSJA 4FHAA 1A47A 3G6MA 4UTKA 1H7PA 3CQJA 4DXXA 2EXOA 3BJTA 3TNBA 1E1FA 1W3LA 1MUMA 4UFLA 4LAUA 1VB9A 3AC0A 4CU6A 1LRNA 5AHFA 1FCUA 2GR1A 2QMKA 4JFVA 1JCJA 3H12A 4PMXA 3RK8A 1DVJA 1R0MA 2POZA 4GR1A 4JD4A 2GDVA 4JOMA 2OPJA 1SSGA 2PTZA 3JZUA 4DJFC 1WBHA 3DJJA 4O1EA 4US6A 2CFYA 1CT5A 4GZ7A 3TSBA 1EJRC 5FJPA 4J3ZA 1N5XA 3NL3A 4D72A 2GVLA 3N6QA 3O8AA 3USZA 1BYAA 1XYLA 4NXKA 3NZRA 4HCDA 6TAAA 3M0YA 4GACA 3UERA 3QKZA 2CWXA 3H53A 1BXCA 3GU1A 3WNPA 3TAOA 3EWCA 1B3VA 2AQWA 4I5UA 4JKKA 1OM0A 4I5XA 2EPNA 3LLFA 3MWAA 3TMLA 1LTDA 3VKAA 2X42A 1WZMA 4LVDA 1CGTA 1TR9A 4I90A 3IIOA 1WA3A 1QT1A 4GQRA 3DYPA 4ACZB 1XWYA 4GXWA 3CO4A 1UG6A 2JIEA 2WCAA 1DJIA 5FF0A 3RIKA 5CJMA 4FXJA 3C0JA 5FI8A 1J0JA 3S5OA 4Z1DA 1W5QA 4AXKA 2WQPA 3EDDA 4ADTA 2BWGA 3WNNA 2ZWZA 2GSEA 1V51A 3F1QA 4E8DA 1QI2A 4JAWA 2QKFA 1BRLB 1SSDA 2FKPA 1U5JA 4JEQA 3ZR5A 5D4YA 5DEZA 5KMYA 2X7VA 3C3NA 4JTKA 4D8AA 4L6DA 3G0UA 4QM1A 1CGYA 3PJTA 3UWWA 3TN3A 4B3KA 4ZA0A 3LRKA 3RLUA 4UFKA 2QDGA 2WHMA 1LOQA 3MSYA 4BI5A 3GXIA 3ZOAA 1WKDA 3PTMA 1FWRA 3WJXA 3KWXA 4MJMA 4CNNA 2I1OA 3URBA 2F7FA 4YS1A 4JNZA 2GZXA 3WLKX 4K8DA 3MUXA 2WM0A 3PNUA 3F2DA 4EMIA 1UKOA 1XC6A 5I06A 4XISA 4MMWA 4FOJA 1TVPA 4DI9A 4MNKA 5AB3A 3CYJA 3TZFA 1GKQA 1TB3A 2H9AB 3CH0A 1W3JA 3R8HA 1HJXA 1GVEA 2J78A 4XKYA 1W5OA 3FKRA 1ML1A 4E3TA 4DZHA 3U7BA 2Z1XA 1YXDA 1X2HA 4R7OA 5HMFA 5CAHA 1IXQA 3OGSA 2ZVRA 2JQXA 4NJKA 1P6CA 4S3JA 1GW9A 2WO5A 4AISA 3S1VA 1ZLPA 3UNTA 1VFOA 1I0BA 3O0HA 2ACUA 2J7DA 3TSDA 5CXPA 3RJXA 4HHLA 1EJTC 1B3XA 5LNUA 4MIMA 3BLOA 1QW8A 1SYTA 3ABZA 3VI2A 4LF2A 4UQAA 2HEJA 1BTMA 3UCDA 4R9OA 3GTFA 1EP3A 5A8MA 1AW2A 4D8ZA 3PBMA 2PODA 1FWHC 1GREA 2YCLA 1K7XA 3I4EA 4HB7A 5ECUA 4IF2A 3PANA 1TCDA 4GFSA 1EC8A 1Z7AA 3EMQA 4IMAA 5K3VA 4AWSA 3DHDA 2VT0A 3KS6A 4DELA 4H8UA 1AH0A 2VD8A 4JICA 3CJPA 3NL2A 4G2DA 2PU1A 1YEYA 3EWZA 4DBSA 1JL8A 3WMLA 4H8HA 2PDMA 1JPMA 3ALGA 2CKSA 3CL6A 1XIDA 1C91A 3MMUA 4NIRA 4C1NA 4C91A 3VA8A 4Z0JA 3M44A 2PSNA 1P5BA 4JL2A 4PCPA 1FFVC 2QHAA 1QBBA 1TPWA 2VEPA 4B16A 3MZ2A 2A5HA 3N9KA 1H63A 3M7WA 1A5CA 1A5UA 1MXDA 3IIVA 3GIQA 3BC9A 5D2TA 1ZBWA 3UXDA 3C61A 3DFYA 3TLLA 2B7PA 2Y5EA 4JHOA 3QXBA 3ARQA 3MB9A 1VEMA 3JR2A 3QC3A 5H91A 1ECEA 4ES4A 2RABA 3AIQA 3L65A 5J5RA 4AZ5A 2O0TA 4DXKA 2DSZA 4IP4A 4AG0A 3LHWA 1BLIA 2ON3A 1LLWA 1VS1A 3W2LA 2TODA 3SO7A 1N62C 4H4TA 4C6KA 3GTIA 3RNDA 3QGVA 5H6HA 3PHAA 1UP2A 3RR4A 3W1AA 3KBNA 1QUMA 1OCQA 3K30A 4IZGA 1V03A 2X0YA 3NZPA 5AHEA 2CZEA 2P3EA 4ZOAA 5EMLA 3LV6A 2WKLA 3ARTA 1EXBA 2QJJA 4XD6A 3VKCA 1L0PA 4CCCA 4LY4A 3LHVA 5BWFA 1XX1A 2ATSA 1VPXA 4DJDA 1WDQA 3UY7A 2GH5A 1XYZA 1XISA 3QY6A 3UWQA 1VCVA 2ZDRA 1POKA 3TW9A 1W1ZA 2QVHA 5HMSA 4D1IA 2R9ZA 3GHTA 1WXZA 3KBJA 2DP3A 5I07A 1EPXA 2WP5A 4PN2A 4DNMA 5DFAA 5K7JA 4CNOA 4AZCB 4KEMA 2PDLA 2X1RA 3W0KA 4A8NA 1HJVA 3B4YA 3SY5A 2V2HA 2G4FA 2FGBA 1MYRA 3N29A 1GQJA 4WRHA 1RBOB 3L66A 2DZVA 2Z24A 3ZJ7A 2Z7GA 4O4VA 1UWUA 5CBBA 3PFMA 5AZ1A 1WYIA 1EDGA 1PZ1A 2PP3A 1JD9A 3MVIA 4Q8NA 3DI1A 4O1AA 3VNDA 4BCEA 1MEWA 4FALA 5AHNA 1TIWA 1G4PA 3QFWA 3KP0A 3HPXA 5KEZA 2Y61A 4C6PA 3T78A 4NP7A 1J18A 3A5FA 3SRFA 1UD5A 3GYCA 2PWFA 2DVTA 1B57A 5F2MA 4J35A 1W1IE 2VRJA 4WF7A 3WDPP 1E5JA 1PX8A 3VNKA 2A3BA 3HJZA 1UIPA 5I3FA 3UG5A 2D69A 2V68A 4RDZA 1A0EA 4H9XA 4UFHA 5G1MA 9RUBA 1Z41A 3WF3A 3WNKA 1KBBA 3I3BA 1VLIA 4LV4A 4JR5A 1K7FA 5G5GB 3RUBL 1F76A 4X0VA 4H4UA 4LYRA 1P6BA 3BQ6A 2ZRZA 1Z8AA 2PS2A 2BZNA 1M53A 1WV2A 5D9PA 3REQB 2X8HA 1PSCA 2YBTA 3VIOA 3KL5A 3TN4A 4WIWA 1I4NA 4PTWA 2QDEA 4ZQMA 4IPPA 1C3FA 1VFLA 4J2PA 2C79A 2QDHA 1IT7A 5HA7A 3VIIA 1R9ZA 4IQJA 4DO6A 1LWHA 4JY9A 1TZZA 3GDLA 4KWUA 3O07A 3WMSA 3E0IA 3TJLA 1CYGA 2QUMA 3GH5A 3BW4A 3WD2A 2ESCA 1TCMA 1XH0A 1RVKA 4HPXA 2BV9A 1WAWA 1V6TA 3OVQA 1Q13A 2OWCA 1TZ7A 3G8RA 2TPRA 4TMCA 2E6YA 4C6JA 3MP4A 3GVQA 1H1NA 1AZ1A 3VIHA 1OGBA 4Q33A 2XGZA 2YX0A 3VOGA 4H01A 1V59A 1ADSA 3RG6A 2OKOA 4EE9A 1DE5A 1W17A 1AH4A 4ACYA 1BWVA 3H7RA 1M68A 2OU4A 3SGZA 5CC6A 1OFRA 4LEQA 4A22A 1MEHA 2UY3A 3LMYA 3A7UA 2J8GA 3WH8A 3G1RA 3W7HA 1KFBA 4I8YA 4XAFA 3KW3A 3AO0A 1NU5A 2R1MA 2OT0A 3KRUA 4UQEA 3DOPA 1V6VA 1K77A 3UWUA 1SGJA 1MZRA 5IBXC 5I00A 4IG2A 2PC4A 1CTNA 4LX4A 3CZKA 4P5UA 4ZQPA 5JU6A 5SWUA 3H4XA 3MMTA 4K2SA 1X98A 2AGTA 3JRKA 4DJDD 1W3IA 5IM51 4LAZA 4ROQA 3PBVA 3L5MA 4JTSA 3AQUA 4HJFA 2RKXA 1PZ0A 3W72A 3ARSA 4JY8A 3N2TA 1RHCA 2CNCA 3HURA 4MWAE 1C92A 2QCMA 5C55A 4NZCA 3M5ZA 3LHYA 3IEBA 4EMJA 4PBEA 4D6EA 5HAOA 1LQ0A 4XBSA 4CKQA 1GOIA 4K39A 2YL6A 2G95A 4M24A 4M6QA 1V3JA 2E4TA 4BI7A 2P0OA 3A4JA 3R8RA 4MKNA 1RXOB 4HZMA 1YBQB 3WIJA 3M5VA 3S2CA 1S5WA 2Z1KA 1Y5WA 2BNJA 5LNRA 1M7XA 3SQMA 1XIFA 4GZEA 4RDYA 2DJLA 4ATLA 2QAFA 2Z7KA 2GLKA 4LUSA 1V7YA 5GVJA 4L4OA 3L4XA 1WDPA 3EF6A 4YYFA 2AKZA 1UZHA 4A05A 5DRIA 1GRAA 4B3LA 4M7SA 2VJXA 1HQTA 3WQ6A 3R5EA 4LS1A 3J7HA 4AVFA 3SAZA 3HZ3A 4ICCX 2ACSA 3WJWA 4H7VA 4TX8A 3PWAA 2GVYA 1VPYA 2NQ9A 2XG9A 2V2DA 3P74A 3N73A 5I3HA 3I4KA 3SUSA 3THUA 5C7VA 4C7GA 4ZOHB 1S7MA 3ZR6A 5LIYX 1IZKA 3KL0A 5LYRA 5PTDA 3KOWA 4NQ1A 3CQIA 1NM9A 1V6UA 2DIKA 2PGEA 2YZ5A 3V1PA 1QASA 3ZMRA 4B5XA 3R8GA 3MTWA 3KRBA 1JPIA 3CGEA 2PP0A 3O6DA 1CW2A 4L80A 4LJ3A 1NJJA 4Q7IA 4IL2A 3I7RA 3HGOA 3OTRA 4KIEA 4MLRA 1W0MA 3EX2A 4CNUA 1HFBA 4CLMA 3BOLA 1G4TA 4PE8A 1UQZA 3EA3A 1UZ4A 3TEVA 1S2AA 2D0HA 3WQOA 4JTGA 3FYOA 1V02A 4I6VA 1ISVA 4F2TA 4W89A 1JAKA 1DBTA 3FDGA 4OBSA 3PF3A 2DIEA 1D7FA 4UCGA 3NUKA 1F4AA 2YXGA 1V0LA 4ZQOA 2BGSA 4NHVA 1PTAA 2VD9A 3L23A 4O8RA 1H4PA 1S5VA 3B8WA 5BOEA 2R24A 3MUCA 1YHTA 2ZZ3A 2CZFA 1TWIA 3T05A 2AAMA 4FLQA 5F1VA 3GR7A 2WVUA 1OFEA 1SFJA 1JRPA 2XM2A 2FH6A 3SUWA 5KVIA 3A5VA 1E0TA 4W7VA 2G97A 3OU8A 1Q63A 5JBFA 4AWTA 5LSMA 1IR1A 3FJNA 5JCKA 1B31A 1FWDC 4RV3A 3AN1A 3E2QA 2YDQA 4CQCA 1K8XA 5D38A 4UTWC 2ZE3A 1DXIA 5U4NA 2JEPA 1PKLA 2QV5A 4MLJA 3VDGA 2A8XA 3PUOA 1T40A 1Y8BA 2I14A 1US2A 3VNIA 7TAAA 1CXHA 4GIEA 4MWAA 4GLEA 3HQOA 3NVWB 5D2VA 2Y8KA 5DRCA 1YXYA 1EKOA 2QXWA 2ZC8A 1HJUA 2E77A 2RAGA 4H4XA 2D0FA 3TQVA 1U5HA 1LZOA 4K1WA 1JZ3A 3N9SA 4PA8A 1RCOB 1E43A 4LVAA 3R0UA 3D3AA 2ZXBA 3LM3A 4BURA 3HV8A 2JEQA 1PL9A 2WZIA 4QROA 1XLCA 1EX1A 1EL3A 5I3KA 1F73A 3WMBA 1FY6A 3T07A 3PTKA 3PVFA 1XIHA 5EFDA 3NQVA 1IV8A 1SJDA 2VL4A 3WBEA 2GSHA 3V1HA 2OMAA 1UC4A 1IZCA 4RJEA 1CZ1A 3PAOA 1S38A 5DANA 4YXGA 3BAIA 3QYQA 4BEUA 3W87A 3PB2A 2NZLA 1H41A 3WLOA 4HU3A 5EB8A 3N1AA 1CCWB 2YGYA 2NX1A 9CGTA 2WMIB 2QJGA 2QV4A 1YE4A 2NV2A 1LJYA 4ML9A 4DJFD 1AK5A 3EEGA 2PD9A 3DU0A 3GDTA 2OYMA 2YLAA 2YCEA 3L9CA 4QS5A 4WXZA 4RXGA 1GYNA 4LW7A 2VURA 1ZP3A 4AMAA 3W37A 1FWNA 3EPNA 1QU4A 5HUOA 4D6FA 1SZEA 1W9PA 3FJLA 4JQ1A 1UR4A 3JS3A 1O68A 3DFSA 4MHBA 2NVKX 3TWBA 4EM4A 4A2RA 5JQ9A 5M5DA 1XLKA 1XGZA 2A21A 4LUTB 1LCOA 4GO8A 1OFDA 3GXDA 1MEIA 3WD4A 3GC4A 2J62A 3RCYA 4FZIA 3VGFA 1TTPA 3QMRA 3LUTA 1C7TA 3EMCA 2JK6A 4CN6A 5D03A 4Z1AA 3B0PA 6TIMA 3KTCA 1UCWA 4M8UA 3GFXA 1KXTA 5I2UA 2GJXB 1IWBA 4ZQNA 3UR5A 4YCOA 1J01A 5HINA 1F05A 2OOFA 2FZBA 5HWMA 4BQ2A 4AUBA 1ELSA 4NJIA 3WO8A 4KEUA 1MZHA 3IACA 4H50A 4TX6A 4W8BA 4CD7A 4OVXA 3OO2A 1GEHA 4QR6A 1GVSA 3G1AA 1P7TA 5CLWA 3OA3A 3G22A 3A23A 4M56A 4J1OA 4UWMA 2QUVA 4H9UA 4EQXA 3LD5A 4WDXA 3W1UA 3R94A 5CC7A 2G3IA 2ZUSA 2OEKA 3NGFA 4YL2A 4H2HA 4LYKA 5G2HA 3BAJA 1GVRA 2WPFA 2ZRUA 3PTQA 2PZ0A 3IAQA 4RE2A 1LDCA 1EQCA 1VAHA 4QE5A 1C93A 1J11A 1E56A 3FAWA 3VNZA 1OX6A 2QPUA 2VC7A 1HKWA 3SUVA 3FEQA 3ZLGA 2VDHA 3WLRA 3KRZA 2XVPA 3KOZA 2D23A 2NWRA 5BXPA 3ZIZA 1OD8A 1UA7A 2CLHA 4MKVA 1XDMA 2FZMA 3O63A 3VD5A 5KZMA 1WKFA 3F4DA 2DVXA 3VTRA 2G3NA 4A2SA 2PRLA 3LOTA 2XIQA 2QIIA 4O1BA 3QTPA 1JYWA 1S3HA 3KTXA 5AOUA 2V67A 4RZBA 1P0NA 4DI8A 4UTTA 1OX4A 3TW7A 3MJMA 3RITA 1T6MA 3S9YA 1ITQA 2GDUA 3T2OA 1A0DA 3IVUA 2ZQ0A 4LS0A 4Y2WA 3NZGA 3P81A 1FP9A 3NQ7A 4HNUA 3DHUA 2F84A 3JVAA 4K1GA 1XLEA 2PDIA 2CDUA 3TFCA 2FB2A 3G3MA 2NQLA 1UKTA 1F6PA 1R87A 2J4GA 5AC5A 2HZGA 2G8ZA 4PEEA 4NRSA 1F3XA 3MYOA 4U10A 1OYBA 3P8IA 1R6WA 4CCEA 4N42A 3TSMA 4XTIA 3TJ4A 1KA9F 3QVQA 4N9BA 4NU7A 3N4FA 4AC7C 1BWKA 1S2VA 3TCSA 2NSOA 1EJUC 1EF3A 3MC5A 3DC8A 1LLZA 5GJMA 2I16A 1G94A 2CC0A 3PBUA 4Q7NA 1EQPA 5BCAA 2V3FA 4UFMA 4PB3A 1KGUA 1V8EA 2X30A 3UBPC 1IIGA 3EANA 2C3ZA 2V82A 3PK7A 4RK8A 4O18A 2XVLA 4KIRA 4UNLA 4RV8A 1QOPA 2HCVA 5AY7A 2NVAA 3CV6A 1JZ4A 3UR2A 1Q6GA 2F5ZA 4PL1A 2WVTA 3CMJA 4GVHA 3TH6A 4KBXA 1A5LC 2VWTA 3G1HA 2XIOA 5CQ1A 2I57A 4UZUA 2WW5A 3WLPA 3AZRA 3GD6A 3B06A 3H70A 5AECA 4BJHA 4RL3A 4QCFA 2NLIA 4FLOA 2Z2UA 1TMLA 2BXZA 1KCXA 4NZ5A 4BQ4A 4H4RA 2OZ0A 1JUKA 4KPRA 1H3GA 2PEVA 3PG8A 3S5NA 4YHGA 4WVXA 2CITA 1OCJA 3RILA 3W01A 2GGGA 1FWFC 4IIDA 1RPKA 1W8SA 1P0KA 5DMNA 2J8TA 2REQA 2OQYA 2CLLA 5M1TA 3T08A 1AJ2A 5AC4A 2V38A 3TR2A 2C3DA 3PZOA 4JQAA 3H7UA 1DP0A 2VEGA 5CPSA 3Q45A 1A4LA 3M07A 4OU1A 4GVFA 3WF4A 2C18A 1KC7A 1K9DA 3VCRA 4HOXA 3KX6A 4DPQA 4REQB 2ISDA 1GJUA 3UR8A 3G3DA 3A47A 4KCTA 4DWSC 4L7ZA 5BRPA 3QR1A 2OT1A 3THCA 3B0XA 4AIBA 3RYSA 2FZNA 4YVPA 1GQKA 1KN0A 2KX9A 3PZTA 4GQQA 1SMAA 5ER0A 2GGJA 3IJQA 3CUJA 4TVWA 3BGAA 1L8NA 3CV1A 4ZE4A 3PZ9A 3CGCA 1U1HA 3BE7A 1NAL1 4HQVA 1YLVA 2RUSA 2ZVIA 1K9EA 4B9YA 3WFLA 2Y8UA 3W7PA 1VRXA 2P76A 1LL6A 4PZVA 4LCRA 9XIAA 3ZQ9A 4Q22A 1H62A 3M0XA 4O14A 4XD5A 3VGGA 1VJZA 3C0SA 2XGBA 1Y5XA 2WNZA 4DJEC 3S9ZA 1VFTA 1NWUA 1IQ8A 4F0LA 2YB4A 3DECA 4HGXA 3CIVA 3QQWA 1EEPA 2J3NA 3QY7A 1H7OA 3DGBA 5CKSA 1D8CA 5I0DA 1Z69A 3CGDA 2CHRA 3M6YA 1HNYA 1RCXB 4HK7A 3STEA 4MTVA 5GNZA 3DERA 1UKQA 5CAKA 1QNOA 1I1XA 3P67A 4ZO8A 4FIQA 2PDPA 3LU2A 2EQ9A 2DH2A 2PF0A 4O1CA 3VKBA 1NVMA 3LQGA 2Y1HA 4QLLA 1VBHA 2A4AA 3CPRA 2QVNA 3W6MA 3S1UA 3VD3A 4FIRA 4L1GA 1B90A 4KERA 2PURA 3MO7A 2XM1A 5L9FA 1FH9A 3CGTA 3QV8A 5HJYA 4GVGA 4S39A 1TRIA 1SU5A 3LX9A 1OFOA 4IGHA 3MHFA 2WC7A 3VE7A 4JZ5A 4J4KA 4YWIA 4WY0F 1SPQA 5JXQA 1J0HA 4W88A 1ZTVA 1EOMA 3KBWA 5CSYA 3VGEA 1NWSA 4QTGA 3WQVA 3FX4A 4AZIA 2VO5A 3ZVHA 4KKXA 2VGBA 3AXMA 4GXPA 3AS2A 1EIBA 4JCLA 4HNNA 4PCFA 1W1YA 3VIJA 5E6ZA 4DRSA 4ZMGA 1WE5A 5C9XA 1KO0A 3UG4A 4P2VA 4ATDA 3MKKA 1M7JA 1BF2A 1AD1A 1O5QA 1EJSC 2OGYA 3BCJA 1H7NA 2VENA 4JFSA 3RPDA 5A8QA 4GCXA 2PAJA 4I7UA 3C56A 4K8GA 4CGTA 3RLHA 3NL6A 2PLKA 4UTUA 3JZEA 3NOYA 2G0WA 3KZSA 3M1ZA 1UR2A 4XIMA 1ZAJA 5EYWA 1TPB1 1E1EA 3UJFA 3UA3A 3W7IA 2XVKA 1TV5A 3SJNA 1A3XA 3GLCA 4GY0A 1VYSX 1R3YA 3WD0A 3KBMA 1UWTA 1W9XA 1QVBA 1SFSA 3WFAA 1UR1A 1YRRA 1FCQA 1Y7VA 2IS7A 3L5OA 1OF8A 3UGVA 1JROA 1HJSA 1UWIA 1J93A 3GRSA 3OODA 1P6WA 1E0UA 5H8PA 4YMZA 4WY0A 3OYZA 4HCHA 4AFYA 1EJVC 2OX1A 1U1UA 4IISA 4DO4A 3S0CA 4TVYA 2RH9A 4X9YA 2ONEA 4K6AA 4PMOA 1GESA 5I3JA 1HKJA 4Z08A 3OC4A 1NF7A 3A21A 2AL2A 3N18A 3WEOA 3HJEA 2A7RA 4UNKA 2E8ZA 3E2SA 3N2CA 3DC0A 1WDDA 3W6LA 4I5RA 1EUAA 1NFBA 2PDQA 3BLKA 3SEPA 3U6WA 1EJ7L 4JIIX 3RXZA 1DXEA 2H9AA 4FOKA 5AZ0A 1ZFJA 1DWHM 2QEZA 1LRQA 4MKSA 1QNQA 2ZZCA 4N0RA 2QUUA 5A95A 1J0KA 1JDDA 1R2SA 4F0KA 3MI6A 3LPFA 3DH9A 1E4MM 3VDCA 5RUBA 1VC4A 4AHPA 2XIJA 3I3EA 4JFTA 1UH3A 4OV9A 4GWEA 3LXDA 2W91A 2PDUA 4HTYA 4BWLC 3C2OA 1OBAA 3IRSA 2OLHA 3Q4DA 4K38A 3QM3A 4CQAA 4IJRA 3CUFA 1XD1A 3ID7A 4EF8A 3IJIA 3W7EA 3VIFA 3WD1A 1TVNA 4U28A 3ITVA 4UC5A 2GJPA 4DXVA 4DWSB 4KRTA 1O5KA 4N6EA 2TAAA 4MAVA 1T8XA 2ZWYA 1UD3A 3W4RA 5DT5A 3OEXA 3FN9A 1DWGM 1XI3A 4H7ZA 5FD0A 3N6JA 4CU7A 1MUWA 3GIPA 1UPPA 2GJRA 2W27A 3FHQA 5JCLA 1E6SM 2WVVB 3CGBA 4NXSA 1XCFA 3AS1A 4PUDA 5FS6A 1M04A 4JN7A 4HSNA 1Q65A 3QOKA 3UXIA 2NV9A 3WNLA 1TUFA 1S2UA 1ECQA 1I2OA 2RDTA 1MXGA 1HXJA 1X7FA 4R88A 1L9WA 3NNTA 3OZMA 2P0IA 2HNEA 1W9VA 3LB0A 2PRHA 2QIWA 3KVJA 5K4ZA 1JXJA 2PDWA 3R4IA 2YL8A 2OO0A 1TELA 3WLJA 1R2TA 3M64A 4U5KA 1UZDA 4AMCA 3BOXA 1R47A 1ME8A 3QW4B 4UFJA 1LBLA 3MY9A 1UYQA 4NKCA 3FW6A 1GQNA 4O57A 3IVSA 1XUZA 1JZ8A 2VR4A 1E6ZA 5DF0A 1FO4A 3VVGA 3TU9A 1F7BA 4DBWA 2PLCA 2VEFA 4AVOA 4CQDA 3BCDA 3CS2A 4LB4A 4Q4SA 2Y7EA 3ECQA 5H8UA 1X6NA 4EPDC 3AIWA 4C1LA 4B5TA 5CBJA 1ZJIA 5JBEA 2XHYA 3KLJA 3H4KA 2PLJA 3BH4A 1SFLA 2YBVA 1BYBA 3TK7A 2PDGA 4LB3A 2QAEA 2JGQA 4MPKA 4H4PA 1LLOA 4L9XA 5CZSA 1AG1O 3W1XA 2HPMA 3MO4A 1O1HA 3MVTA 4C6QA 1YTEA 2HQAA 4GZJA 4AHQA 4TIMA 3PS7A 4RE0A 1HL8A 3PZQA 3MI3A 1HX0A 1ZNNA 3A4AA 3UJSA 1X8CA 2NT1A 2P8CA 1DEDA 1HJWA 1TPFA 2VZSA 1J96A 2Q8ZA 2ZXAA 1KRAC 4TX9A 4D6IA 1W5NA 4X2RA 4GBDA 4O54A 2WSYA 3L5LA 1CIUA 4TQTA 1FWSA 2QCNA 4ZFCA 3FGCB 3O6YX 4IGSA 5TAOA 1JNDA 1AMKA 1UMLA 2VI0A 1GW1A 4ZZ9A 1QPOA 3GFZA 4E8CA 1E6RA 4ZVJA 3JW7A 3FDKA 2BCPA 4KWVA 1EA0A 1VFSA 1WOAA 1QAPA 3BV7A 2HMCA 2ZIDA 3HFYA 3NQ8A 2G5WA 4LUJA 2WOWA 8RUCA 3URHA 1V97A 3ZZ1A 4WCJA 3SR7A 1U2YA 2DUAA 2GVGA 4GUGA 4GYPC 2CLPA 4UBPC 4S3CA 4J27A 3KRSA 1V6WA 2RJGA 5MKGA 4EAMA 1OB0A 1P1MA 2XFFA 1MQQA 3MBFA 4M6UA 5FESA 1FWJC 4XAPA 3KUMA 4W4QA 2H8XA 1AH3A 3RO8A 4XTDA 1NDYA 5EPDA 2X1UA 3HG5A 1AQHA 1IT8A 4JHZA 3Q2DA 2J88A 5C0QA 4YTTA 4S3BA 5U25A 3KVLA 1KR0A 3T09A 4ORIA 2YQUA 4R3UA 4BR1A 1WPCA 4AF0B 3V4BA 5T9BG 1SO6A 4H9TA 4JIHA 1QJWA 1FP8A 3C6CA 3E2RA 2VWSA 4KWOA 3K8KA 2RDWA 4JDYA 2XUCA 2IKIA 2VZUA 5DO8A 4QDPA 4QLKA 1V3KA 1D3GA 2CLMA 3CO8A 1YW1A 1H7WA 3CWHA 3SSJA 4H4QA 1Z3NA 1TUXA 1FKWA 3BAKA 1S5TA 1DQUA 2WOQA 3ANVA 4H3DA 1A5KC 1JF6A 4OKDA 1TV8A 4IL0A 1GT8A 1TWZA 1D3CA 4JTFA 4XAZA 1E70M 1G1YA 3B9OA 4G7EB 3UFYA 3DKJA 4TTUA 3SDOA 3LRMA 4GQGA 2JFEX 5DMYA 3M0ZA 3MANA 4EPKA 5HOSA 3CUXA 4GI6A 7REQA 1BWLA 2F38A 3A9BA 3MSRA 5HQEA 2YA0A 1XM3A 5KTLA 3PUEA 1W9BM 1QRQA 2CETA 3LK6A 2W54A 1BSLA 4IICA 3EKLA 4W9TA 3Q58A 1SR0A 3FSTA 3GVGA 5KVHA 1JYXA 1YQ2A 3QV6A 1XFCA 1FHLA 3P62A 3WQ5A 2VC6A 5FL1A 2XJ7A 2YDRA 1E72M 4P8UA 4MNJA 2JK2A 1WB0A 4DBUA 1F74A 5D9OA 1ZY9A 1LM1A 2YW4A 3ZT6A 1CGXA 4I8DA 1B9ZA 3MYPA 1ISZA 2UV8G 5D8WA 3NPWA 1XGDA 3TNOA 3LXAA 2CEQA 3ZT5A 4BQ3A 4P7RA 4BF7A 3OZOA 3PR2A 4HYRA 2HBXA 2A3EA 3AMLA 3B97A 3WH6A 1SZNA 1JDFA 2AAAA 4A21A 1VF8A 4GA8A 4H8VA 3MA8A 1YADA 2WSKA 4ZQRA 2X40A 5LGZA 4JX5A 5EL1A 3S1XA 3MT1A 3GDMA 2WZTA 2I5IA 3F2BA 1N8WA 1WZKA 5ABHA 2Q02A 3VGDA 5JIWA 3WBWA 2YZRA 2YKKA 1CGVA 3G24A 3CAQA 5A5WA 1D7YA 3NPVA 4K3ZA 1Z44A 3QKEA 4ZEPA 1NQKA 2C1IA 1X6UA 3WK0A 1F6KA 3FKKA 3GX9A 4UQDA 3CK5A 4IPIA 5CZ0A 2XSAA 2ZRWA 4PBFA 5CCZA 1FWGC 3NYDA 4MM1A 4X9SA 5CSRA 2FLIA 2HSAA 3VCCA 3I6RA 1N82A 5F2IA 3EWDA 4AU0A 2VCCA 1JCTA 2DU2A 3H4WA 5G2WA 3GHSA 5I79A 1ITCA 3QF0A 1R46A 4G8TA 1IT0A 4IFKB 4PRRA 3CQKA 3S2NA 4ICNA 5TR3A 8CGTA 1KKRA 3S46A 2XFWA 3TW6A 4M0XA 2X8RA 1YPXA 3NZ1A 1DWFM 1WUEA 3IVTA 2A6NA 1XCWA 3H2CA 3UWZA 4LBSA 3B8IA 3CXBA 1RP9A 2WHJA 3LGEA 2P8BA 1MW3A 4H9MA 3U5UA 3D46A 4QXIA 1PYMA 4NUWA 1EDTA 2ZX9A 4PEKA 5EBAA 4BK9A 3RM8A 3DK9A 3NEVA 1GHRA 4JTEA 6PTDA 2E67A 3VCNA 4US5A 1QNPA 1VFMA 5FF2A 1NIUA 3DHPA 3EWBX 2BY0A 5FS8A 5KZDA 2J9XA 2XN1A 1F8WA 1Q3NA 4Q8VA 3DBPA 1H7XA 3WK1A 2RDUA 3CZJA 4DEFA 2DSUA 3ARYA 2DZUA 3S9IA 1JJKA 3A64A 3TQPA 3U2CA 1EGMA 4OTKA 2I5GA 4URIA 2ABAA 1XIBA 2J7FA 2UWFA 3WUGA 2V9DA 1HJQA 1QCWA 2X05A 2FMNA 3NQGA 3VNYA 3S5ZA 1OINA 4PMNA 1HN1A 1PEZA 4BS0A 4GUJA 1F9CA 1EEXA 2BS9A 3KFTA 3B40A 3NPXA 3LY0A 2C13A 2NXGA 1VRDA 4DWSD 1BXBA 4HYWA 3KZPA 3VAVA 4P8WA 1A5OC 1O66A 1UHVA 1BZLA 1J0IA 4DUVA 3GXPA 4YPJA 2DJXA 4FS9A 1AMYA 2PTYA 1VIZA 3TC6A 3LG3A 4R7JA 1WYGA 3DGZA 3UZJA 1ZBVA 1DYSA 1GPWA 1SM9A 1R5YA 2W63A 3HF3A 2QCGA 1QATA 3S83A 1I2NA 1H0IA 5K2ZA 1J5SA 5DQPA 1JFHA 5D2YA 3T2PA 1D3HA 3O16A 3VABA 1FXQA 1MRAA 2X16A 1CGUA 1SW3A 2V63A 3M0VA 3QV7A 2GVJA 2E1DA 3SRDA 3OIXA 3B9AA 5I5RA 1EHNA 1BFNA 1KM1A 5G4WA 3BJFA 1QO5A 1DOSA 3LPGA 5BW6A 1LOLA 3W70A 1CNVA 2YW3A 2Y7FA 1UH4A 3VGHA 1UC5A 1V3HA 2BB0A 1CLXA 5CPMA 3OLGA 5C6MA 3WFZA 1W3KA 3MUY1 1TA3B 3P6LA 1QO2A 3ETRB 4UUIA 4PMRA 2IQDA 3G77A 3KOXA 1OQFA 3I7QA 2CZ5A 1EXPA 4O16A 1KRBC 1Q2SA 3BAXA 5LA0A 3UJ2A 2WCSA 4GNVA 1XG3A 3NSNA 1OZQA 2POTA 4Z0SA 4ZO9A 2NVCA 4BF9A 2E5CA 2J74A 3U48A 3WL0A 2O9OA 4LVGA 4WJXA 5ABFA 4LAMA 4NF7A 4AZ7A 2XH4A 2WMFA 2F6KA 3KLLA 3SCTA 1CWYA 1XDJA 4JYDA 1C9DA 4FR1A 3VILA 2D0GA 2G96A 2Z29A 2VKZG 3JUGA 4NAEA 2CFFA 2IKHA 4F66A 4WD0A 3W1PA 2BOEX 3HFTA 4XUGA 2WMIA 3VIKA 3SQLA 3TTSA 4L1WA 1GVFA 1TQXA 1VJSA 1DPMA 2OO6A 2DW7A 5JCNA 3NQAA 1QPKA 4RNFA 1FBAA 4H8NA 4L6HA 4X63A 3GZ3A 1ZGDA 4AIUA 4JDRA 1Q7ZA 1OGSA 1KV5A 1NDVA 1U30A 4IQEA 3WUEA 2HBVA 1TPC1 5DMMA 2VELA 2G41A 4NEWA 3SRKA 4J2MA 1MUCA 1SO3A 4US5D 2HTMA 1DV7A 3D9XA 3U7VA 3UD6A 3U2EA 3BLPX 5CZTA 1UJPA 1VBGA 2BGNE 1E4IA 1WOBA 2XINA 4XK2A 5D9NA 3PZMA 2ZTKA 1G01A 2CLFA 1TX2A 5BXSA 5FF3A 1SUXA 3ITOA 8XIAA 1FX6A 3AUOA 2BHYA 4GZIA 5I7GA 1YTKA 4MJZA 4S23A 2CBIA 4W7UA 4C1KA 3C52A 4KF1A 3HGJA 2Y7DA 1XYMA 4QEHA 4AZHA 4S3AA 4IXHA 3LCIA 3KOYA 3NM1A 3GQYA 2YCKX 3PPFA 3NJ3A 4Q4PA 4QG8A 4GH3A 4WX2A 3WQFA 4B5SA 4LOCA 2VEIA 4ZOCA 3RAOA 3W7KA 1FOBA 3EB2A 4OE7A 3SADA 3WSUA 1GONA 3GAYA 3TROA 4AX6A 3V75A 3R6IA 1BQCA 2VFDA 3KCLA 2BVDA 4BY3A 1EBHA 4CD5A 5E0KA 1V6XA 4TUFA 2DIJA 2X0SA 3GK0A 3QPZA 2VX5A 3CH9A 3URNA 3WF2A 3GUWA 3UXKA 2G3MA 4GQBA 1UA3A 3QZAA 5FEWA 1M9HA 3LSBA 3E0FA 1VDVA 4PTXA 2RDXA 3ANYA 4WXYA 4ZODA 2WZMA 3G1SA 5LNSA 2PU0A 5JRBA 3SIZA 4WKAA 3BSHA 3W1TA 4CNTA 3APGA 4JBRA 1GHSA 5DT7A 1YKWA 1XFBA 1EYEA 3ITLA 4AY1A 1TWSA 4CD4A 4GYPA 5FJIA 1KFCA 4WR3A 4OQVA 4DM2A 3ARUA 2V0TA 2O55A 4N6FA 4PODA 2CKRA 2D1ZA 1I45A 1ZCOA 1D2KA 5BMXA 4CD6A 2R94A 1E9YB 3L12A 4RNIA 3U0HA 3GAKA 1QFEA 4U3AA 3W27A 1OABA 4JQ9A 1LUCB 7XIMA 3U4AA 2NT0A 4Q8OA 3PWGA 2B7NA 1WXJA 2O7SA 2C14A 3B9EA 1YNQA 4HOZA 3UYCA 4R34A 1UIOA 3U5YA 5C70A 1WNOA 3DCPA 1UD4A 4JL1A 5DY2A 4ASTA 1PCKA 4KRUA 3MWCA 3SSZA 5JCIA 3U2OA 1HO1A 1XKYA 2J7HA 2BDQA 1I8JA 2F6XA 5CGMA 1XHCA 1PPIA 1F6YA 2DGAA 1UR0A 1FFRA 4Y9PA 3M47A 3QR0A 3UJRA 3LMZA 4AC1X 2FFCA 1MRQA 3VC5A 2NQZA 2PPGA 1JCLA 5HR6A 2PDCA 4L65A 4L9YA 5FJJA 3AISA 4GC4A 1J79A 3G1YA 5HWJA 1GRBA 3GHUA 4JKMA 5B7ZA 3KHDA 3ZJ8A 1ALDA 1EJXC 1PVNA 3NM3A 3NGJA 1ONFA 5CZJA 1O4UA 1VBRA 3RGTA 6REQB 1JIBA 2Q09A 5MHBA 3ZT7A 4KT2A 1WBJA 2WQDA 5E5CA 4AZGA 1TREA 2X50A 2ABBA 4EF9A 1NDWA 3VDBA 1J6PA 1IR2A 4UZSA 1VH7A 4HNOA 4UNIA 3EZ4A 1BG4A 2ASHA 5T8GA 1XINA 4IUGA 3K1GA 4XKYB 3EA2A 4REQA 3CT2A 3WN6A 4EXAA 4BHYA 2Y24A 1PIFA 4QQUA 4XZWA 3BMXA 1M5WA 1GOMA 1XSJA 3B8VA 1WZLA 5G4EA 4ZL1A 1E0XA 5CPTA 4LC6A 5TBOA 3VM7A 3RF9A 4A3QA 5A2AA 1B0IA 4R7WA 2QQ6A 4IWWA 4WJ8A 4UB9A 3DIPA 2VTFA 1ADOA 1WDWA 3O2LA 2WMHA 3GVRA 4DX3A 6CGTA 4QE4A 3EWUA 4JTRA 4Y9AA 3PUGA 1MMFA 4UR8A 1ITXA 1YQZA 3D47A 1AJ0A 3DXIA 1H2JA 3QFEA 3UZZA 3B8SA 3BAYA 3HN3A 3DHFA 3BPWA 1IEIA 2BODX 3AZSA 3OVGA 2YA2A 5BRBA 4HK6A 5A8OA 5CPLA 3WCZA 3T0TA 1AQMA 1O60A 2DQWA 4HZ7A 4UTMA 1OADA 2ISVA 3WDIA 5H8MA 2W0UA 1XYAA 3PPHA 3K8LA 3VNMA 4HPJA 1STZA 1ZSXA 2FPVA 2Z1VA 4MYAA 1DHPA 1KM3A 3HGSA 1FKXA 1B4EA 5HQLA 4KESA 3LLXA 2DY3A 1E73M 4XBJA 4HKPA 4IMGA 5LXXA 1RY0A 5I3GA 2Y7GA 2OGJA 3FA3A 2NX3A 2DQXA 5HDRA 4GI9A 3P80A 3CLWA 1ODUA 3EPMA 4WOQA 4JN6A 3O6CA 4CVWA 2QCHA 3PULA 3B8TA 3TTYA 1SO5A 3LEPA 3OJGA 3DFQA 3VIPA 3VMNA 2PDYA 3B0VC 4PRWA 1AL8A 4DB7A 1KKOA 2IW0A 1BF6A 3CAWA 4ZB2A 3SR6B 3M0MA 4NT0A 4AD3A 1LBFA 1YIXA 2INEA 3NPUA 1NY1A 2EG6A 2X09A 4GD0A 2OZ8A 4MUPA 3GNOA 1GV4A 3ES7A 3V3WA 4PUEA 1PHQA 1BSIA 3PTDA 4LFYA 3KAOA 5XIMA 4GIYA 4O17A 3GB6A 2GQWA 4MFEA 4H9VA 5AC8A 4AD4A 1I6NA 4FP1A 5E09A 1CX9A 3IUHA 2EBNA 1FCBA 4ZB5A 2VOMA 3RU6A 4ZGYA 2HVNA 5FAJA 3P93A 2PRMA 3XINA 1BPLB 3P5ZA 3AMDA 5U7SA 2DZXA 1OCNA 3TZNA 3CL8A 2C1HA 1N60C 5C9WA 4PSPA 1XBVA 1H6VA 2GGEA 2AQOA 4YHEA 4PTVA 3ZFHA 5EGRA 3IGHX 3TWAA 5FJTA 5E9XA 3LN3A 4ZFMA 1R86A 1LROA 4IMDA 4BKNA 1S5MA 3AU6A 3EYPA 4GC3A 2VZTA 1S1PA 4HU0A 1XLHA 3DENA 5ENLA 4OOUA 1WXYA 4JN8A 2ISWA 4LCQA 3VZXA 4PB5A 3EOOA 3NZQA 2W61A 4GUIA 1R30A 3FAXA 2WPGA 3M41A 3W76A 3LXBA 3CTLA 3PG9A 3DUGA 1XIMA 3V5OA 1M41A 1RD6A 2O7QA 4D71A 4AIEA 3T7VA 2ATMA 1DQXA 2QT3A 2A85A 2OR2A 4ZXLA 3B3DA 4LV9A 2YVJA 1BXNA 1AOGA 2P3ZA 2YVGA 2PD5A 5I3IA 2Y63A 3RCMA 1XIJA 1N8IA 2X1SA 5EU9A 3W7CA 3BUVA 3KXQA 4BV6A 2ZICA 4E2DA 4DYJA 2H90A 4J40A 5IDIA 1NDAA 4Z1CA 3OLEA 2TYSA 3AMGA 4ZO7A 3H2MA 2EJ1A 3AM9A 1X8FA 4A6GA 3ES8A 3NOEA 2Q8XA 5CGQA 3TN6A 2JIWA 3BSMA 3KS5A 1KXQA 4GYJA 1JZ5A 3ABRA 3A3HA 3UGRA 4W84A 1TO3A 3T2QA 1B4KA 2NQ5A 4EPEC 5LIKX 3IV8A 3POCA 3Q67A 4M80A 1GYMA 1E55A 4AB4A 4Y96A 2WJFA 4DQWA 1OIFA 3UU0A 3NDYA 3PP7A 1XH2A 1OK4A 1Q45A 4QQ3A 1RQBA 1KNWA 1OCBA 3TA6A 3NL5A 1KBLA 4NZ1A 4QLJA 2VEKA 4B3ZA 1NHSA 1F2JA 1FUYA 2O9PA 4MWAC 3NQ6A 3SN0A 4LS2A 1Q7MA 2Y4SA 3TYBA 3LA4A 2OODA 1OC6A 2CXEA 2XZ9A 5HULA 4C5ZA 1UD8A 4XKMA 3SM0A 3S3GA 3LQLA 3CHFA 2EQ8A 2HNHA 3STPA 3ITYA 4QNWA 4UXDA 3THQA 4HIBA 3EB3A 3V7PA 2ZA2A 3CEPA 1Q4WA 2AMGA 3M43A 3DGRA 4Q8WA 2TRSA 2C0HA 1DJYA 1KM0A 3V36A 3TQ0A 3MHGA 3NQ2A 4E4UA 3AJXA 3L0GA 4D8LA 4FNQA 2DUXA 3LBOA 1WUFA 2HS8A 2WAGA 5M17A 3L0KA 4ALDA 3IWPA 3XIMA 1W31A 2MANA 4NJJA 2HROA 2WYSA 5AHIA 3CV7A 3PSVA 1WX0A 4EQWA 2WZHA 4X2PA 3SCWA 3SQPA 4LYQA 2ZUNA 4C5YA 2BTMA 2GR3A 4Q3MA 4A3RA 1WDRA 4PCSA 4JYFA 1CDGA 3R13A 5K9CA 3GD3A 2PWGA 1B3OA 4QSFA 4ATWA 4J3SA 1EWDA 1W1A1 2IPJA 1BVZA 1DXLA 3IK4A 3UNDA 3E3HA 2CBJA 4GUFA 1TJRA 5MF5A 2R8WA 4UTIA 4YCPA 3SRHA 4CN4A 2IXVA 2QULA 1QXLA 4NI3A 3UWEA 3GC5A 2TPSA 3HTWA 3O15A 3AUJA 1M65A 5L6UA 3CXOA 2PBGA 2D3LA 4IG2B 1MNZA 3BO9A 3P5YA 2C7FA 1HL9A 3VKDA 5FEZA 2UY2A 3TKFA 5HR7A 1V6YA 3VOHA 3D5HA 3BVJA 1V0KA 1HKVA 2B4GA 4ZSTA 2A3AA 3SCRA 3BGJA 2DFAA 1IGSA 2DVUA 2JF6A 3W1RA 4NZFA 4GINA 2XIIA 5FF7A 1TVLA 4NL1A 2NLYA 1OFAA 3NSXA 1NWTA 2V5BA 4WSHA 1MDLA 3GIYA 4ZENA 2BVYA 4ZTYA 4PYSA 4A8LA 3M16A 3EKGA 1EO7A 4Y8EA 2Y5JA 5HMDA 5BZAA 3IJLA 5A2BA 2WSPA 2EQ6A 2QPSA 3CNYA 3NVTA 3WH5A 2VM8A 3FY1A 3OPSA 2YL9A 3DG3A 2ZZBA 3TOPA 1Q6LA 2J9YA 4LUSB 5GPRA 3FV9A 4FR6A 1TV4A 4QNEA 2W62A 3IUDA 3B8UA 3QY8A 2ZUWA 4R33A 3KBSA 4J7RA 2PWDA 4IIHA 3TA9A 4NAFA 1UR9A 2E3ZA 1FA2A 4DUWA 1E6NA 1W6TA 4Q4KA 3SGUA 4UOZA 1AL7A 4GI4A 4N7QA 3KE0A 5E6YA 2V2CA 4F48A 1BVWA 3WK2A 4LC8A 4E5TA 3R43A 3C2EA 3HB9A 2FZ8A 2BFGA 3NXLA 1ESWA 1TTIA 1Q8AA 5BYWA 1QK2A 1J0ZA 5A2CA 1TYTA 2G3FA 3CMGA 4UTTC 1M7OA 4S3FA 5A8PA 4Z2KA 4IP7A 1H5VA 3MDUA 3HGRA 1NOFA 3QZEA 1JI1A 4Y90A 3UF9A 3ABSA 3UXAA 3GVWA 3EBVA 1OIMA 3AIUA 1PIIA 3G18A 3T8LA 4RXFA 1TG7A 4Y6GA 2WZEA 1C90A 5FSDC 2JBMA 4CD8A 1ZK7A 1SZRA 1Q6EA 4Q32A 4LT9A 3QOMA 2NW0A 1K6AA 4OT7A 3URQA 3GKAA 4LQ1A 2WNWA 4PTDA 1KFKA 2CLEA 2GOKA 4O8AA 1R2RA 4D6GA 4H1ZA 3TTEA 1J2BA 3NIYA 2ZZ5A 4Z2HA 2L5HA 1ME7A 3ARVA 2Q01A 2Y0FA 4U5IA 4UR9A 1GVIA 1ICSA 5A69A 3WQWA 2IQ0A 4XVEA 4QJ4B 3HV9A 4HNVA 1VEPA 3MPGA 1XICA 2J24A 5CJ5A 2HQMA 2GFTA 3NTYA 3DK8A 4GMEA 4KCWA 1DWIM 3CZGA 3RX4A 4P61A 3QMSA 3EXRA 3TC7A 1ZZMA 3B4UA 3HA1A 4B4HA 1SR9A 2QW5A 4EM3A 3AROA 1UB3A 2VX6A 8A3HA 3UETA 1PUDA 5BOOA 4P7QA 4G1KA 1ZAHA 1JZ6A 2YVFA 3A3XA 5IXEA 2X1IA 3VGBA 3DFNA 5IRPA 3R7MA 5E0FA 3UP8A 1K02A 2ZX8A 1GGOA 5ABEA 4PUUA 4CUCA 3QJAA 4M29A 4ILSA 3NAVA 1BTCA 4ADUA 1LORA 2Y85A 2P10A 1G69A 3BLLA 4UOJA 4MWAB 1VP5A 3AXXA 2O9TA 2ZX7A 3HMCA 5AHLA 1T3QC 3ABOA 3AWOA 3MU7A 5AYYA 4UMBA 3GNNA 1VKFA 2FJKA 2QGHA 4MJ2A 3GR4A 4IIFA 3R2GA 3STGA 2E9MA 1GOOA 4CN1A 3DG6A 4HVXA 1G9HA 4GX9A 5CSUA 3LPOA 4U3CA 4GY7A 4JTAA 5A94A 1K4QA 2TSYA 4XZBA 1NP0A 1KRCC 4C60A 5A6MA 1XIEA 3AHVA 1CECA 3GS6A 1KM6A 1TTJA 4IXXA 3IIXA 4EP8C 1SJBA 2O9RA 4XV0A 3LZ5A 1R3QA 4EWJA 1R8LA 2ZRXA 4XAYA 3HQ1A 3IANA 4NVTA 3FHAA 4ERAA 4UQ9A 1RA0A 4RX0A 3FXGA 1VCGA 4MY9A 1GZ1A 1I60A 4M5PA 3O1NA 1VBUA 1GG1A 1HTIA 3WL1A 4YTRA 3MCMA 3R07C 1OFBA 4QRNA 1KGXA 3GKFA 3T8QA 1PKYA 3LI1A 4LXFA 1W5MA 3BOFA 2ZKMX 1FWIC 2V81A 3L4TA 1FFQA 4Q8UA 2YB1A 2MNRA 2OJPA 4M51A 1FEAA 1CEOA 2RGMA 1P0EA 2WC4A 1E0VA 4WGHA 1E3XA 3U9IA 1QPRA 4PMYA 1RD5A 1KFLA 4GVIA 1M1BA 2PC8A 1GK8A 3Q6JA 5EY5A 1GRTA 2VGFA 3E1F1 2YLLA 5AVNA 3GZAA 7TIMA 2ALRA 4GBUA 2IUZA 2HDJA 3W3OA 1QTWA 1OGGA 1CLVA 2NXHA 1ZMCA 1OWQA 3V0UA 4QFUA 2QCEA 4A35A 4QGCA 1KTNA 4J28A 4AX7A 1E6XM 3PZVA 4IFKA 2QCLA 3IJ7A 2CPUA 3C2YA 2FTPA 2HS6A 3KEHA 3UVIA 4L4PA 1FWTA 3WDHA 4RCXA 3CM4A 4U2ZA 4XSMA 5G4HC 1KM2A 2BXVA 1EP1A 1UPMB 4IQLA 1XSKA 4G7FA 2AKMA 4HMNA 1NHRA 1SJCA 3CHDA 3W2UA 1BEUA 1P7TB 1SW0A 4GX8A 5XIAA 3W7DA 3NFUA 4AYSA 1UW9A 1J10A 4GH1A 4RR4A 4UQBA 5FIPA 1ISXA 2TMDA 3M0KA 4HU8A 4M1BA 1R85A 4O1FA 4POCA 3K1DA 1T96A 4HU4A 9XIMA 2W3SA 5BXRA 4KCVA 4G6CA 4Y7EA 4S3EA 1DIOA 1ZP4A 2V6AA 4GUHA 2Z00A 1KWKA 3TYUA 5BWAA 1EZWA 5AN7A 1GNXA 3OGVA 2IPWA 2WSQA 2ODOA 3B03A 2GGIA 4LEFA 3QYSA 5AC6A 2E25A 3KWSA 1GVOA 4H4SA 1J4EA 4KW2A 3RNMA 2YJQA 2V3BA 3ZM8A 5C2GA 3CB8A 2R9RA 2PA6A 5FJUA 2NQHA 1UUMA 1N55A 5G5IA 3ZJKA 2BOGX 4TR9A 1R3VA 1XDLA 3ATZA 2VX7A 1UKSA 1B5TA 1J8VA 2YYUA 1QOXA 1MW0A 1Q7QA 2ZX5A 4GPNA 2E40A 2XIMA 2UZ9A 3KP1A 3CUIA 3IARA 4X60A 3LXCA 3HPAA 1WQ5A 4DBEA 5AYBA 5HNNA 4P7NA 5ABGA 1MQPA 1X1NA 1GZGA 2D2OA 4N9DA 3WLSA 4E8GA 3R25A 2AOSA 3ZVIA 5FMHA 3R12A 2XPKA 4W87A 2WMGA 3FJ6A 1DWAM 3A13A 5J04A 1RSCA 1RM6B 4JIRA 4OUIA 2J25A 4HSOA 1LRTA 3WLTA 2DSVA 5JH2A 3AHYA 1JPDX 4Q8TA 5I6SA 4NY2A 1ZHAA 1GQIA 2DW6A 4PTNA 2CHOA 1E6PA 1K7EA 3AMZA 2PDJA 3DDMA 3WYZA 4UMAA 2IKGA 3IJDA 1J6OA 3MKCA 4I3GA 3C8NA 2DZSA 5D09A 1PV8A 3IGXA 4K36A 3EOLA 1GOQA 3WBXA 2A3HA 1S3TC 1TJPA 3AXIA 4HP5A 1EF2A 1XBXA 2WB5A 2EF9A 1XV8A 3SBFA 1TPUA 5K9XA 2Z28A 1R3SA 2VNCA 1X96A 3OZYA 1FWWA 3LERA 4XQ6A 5F2LA 3BARA 3DJGX 1XCXA 1J0YA 2EGZA 3W6YA 2VFGA 1JI2A 5FJRA 4UTFA 4I9AA 1V7AA 4M6PA 3GNRA 2REQB 4C6EA 3TAKA 3B9JB 4TU1A 4XZHA 1JG9A 4E4FA 3S8HA 2W4XA 1S46A 1QWGA 1ZDLA 1DJZA 2O4MA 1GVYA 1Q66A 1LL4A 2B81A 1R3TA 2ALDA 2R1PA 3GXMA 3FCPA 3T1GA 4HT3A 3EDFA 5CLTA 3W1LA 2J7CA 3KOFA 2OEJA 1ZY8A 1NEYA 2W6RA 3L4WA 3SJ3A 2F2HA 2UY5A 3N19B 2F61A 2XIBA 1E0WA 1XBZA 3GNXA 1EBDA 3NO3A 3SB0A 4RUBA 4EVZA 2G4JA 3W00A 1F3WA 1PX3A 4O0QA 3K13A 4FNUA 2KAUC 4XZ9A 4XIAA 5CSSA 5GNYA 4GRTA 4R5EA 3PB0A 2WPCA 4F2UA 3ZSTA 1NOWA 4V15A 5F4SA 2CBVA 4ENLA 3T9PA 1AFSA 5T26A 4MUZA 3ARPA 3RMJA 1PB0A 1Q8JA 3RR1A 4Z17A 1DWJM 1TFVA 3EMZA 3SIMA 3DEQA 3SURA 4NI8A 3M6DA 4B91A 3BLFA 1GEQA 1X38A 4NJHA 1UH2A 3EX1A 1K9TA 2QGYA 2E0PA 1W1VA 2F2KA 2GOUA 1N61C 1UZ1A 4XAGA 1VPQA 1IHIA 4EOUA 3N4EA 3GRTA 3GRIA 3FJ4A 3COTA 4I9JA 1MO9A 4D6DA 3W38A 3W1MA 1F8IA 2QNEA 1KCKA 2PUZA 1TQJA 1ZPTA 3VD7A 1W3NA 1I0DA 1PWLA 4KEZA 2E7FA 3L4UA 1OEPA 4ZQCA 5GJNA 1O5RA 3FFSA 4QDMA 1MQRA 3M5YA 4MVAA 1UR3M 4JIQA 1F5ZA 2GWGA 3TFXA 3KDOA 1JZ7A 1ICPA 4F8XA 4RW3A 2XSXA 2VXNA 2B7OA 4S3DA 2X1TA 1GCYA 4FO4A 2NUWA 1UD2A 4IPLA 4HPGA 1ZJBA 3S6OA 3UCQA 5EBKA 2E09A 1K8ZA 4MB5A 3UCCA 1V4YA 4HOWA 1BYDA 5D2WA 1DJXA 3MP3A 2QCDA 1VIWA 5CC5A 3UEQA 5EMYA 5BU9A 4O13A 2GUBA 3ABQA 3TONA 3TTOA 2WP6A 2R1KA 2QCFA 3AHTA 2VC5A 1G5AA 3L67A 1PZ2A 4C7DA 3M4HA 1S5NA 2V3AA 4LAKA 1OF6A 3CUHA 3ZVHB 4PFHA 4GXMA 4Q4RA 4L61A 3O7UA 3N3TA 4JS3A 1V08A 3SCNA 4MWAD 3RRAA 3CHVA 4RDVA 3D6NA 3MI2A 1XS2A 3GXFA 3O06A 4BZYA 4EKJA 2OVLA 1T0OA 4LY8A 3WMCA 3BLIA 3IIZA 4F4RA 3KVMA 2FVMA 2VUNA 3RPMA 3C3UA 4FI4A 1KBJA 2FPYA 4IPJA 1EB3A 1R38A 2YAUA 4A3UA 1XBYA 1MFVA 5E1QA 4HA4A 1LUCA 1XLAA 4WGXA 3QH2A 1H5YA 1H7RA 2P53A 2PZNA 3L21A 5IHSA 1TJ2A 3GO2A 1LL7A 2OTDA 4NILA 3L8KA 2NV1A 3F7JA 1XLMA 1OFQA 3NQBA 4MDOA 1FHVA 3DKLA 1VFHA 2W67A 1Z48A 3AIBA 4FLRA 3P2VA 1M01A 4IFOA 4GNJA 3W7LA 2V69A 1IXPA 3LADA 1RUSA 2ISFA 4O1DA 3STFA 3TE9A 1V5XA 2JE8A 3UZXA 1Q85A 2B31A 3MDWA 3H6OA 4LWWA 1FWCC 4N4PA 4Y9NA 4WSJA 2YFOA 4O4WA 2WWCA 4WY0B 4TVUA 4KGLA 3N25A 4M6VA 1SMDA 1PKMA 3PN8A 3UG3A 3T4CA 1CPUA 2DEPA 4X61A 2E28A 1FH7A 3F5JA 2PFHA 1CENA 1QMLA 2AL2B 2ZZ0A 4QHRA 4F3HA 3CUZA 3ZLFA 4F0SA 1V77A 4EQRA 6REQA 3IS4A 3W25A 3UG8A 3BG9A 4XSLA 2AQVA 1KGWA 3CT7A 3DZ1A 3QC0A 1SFTA 3V18A 2GRTA 2A6LA 3WLMA 2F9RA 4QIUA 4HN8A 1RY8A 1PCWA 3PNZA 1QHZA 2F6UA 1HGYA 2ZADA 4FX8A 2VGGA 3PZUA 2E5AA 2Z25A 1XW8A 1QW7A 1R7OA 2EHHA 1UP0A 4BF5A 3HPSA 1A3WA 1LG1A 1Q1WA 1TYGA 2VEMA 1YYAA 3OQ8A 2ZZ2A 3LV5A 1XRFA 4C6BA 3TLQA 1IXOA 4B9ZA 2E6AA 5D37A 3SUUA 2INFA 4F9DA 3DFTA 5IHRA 4HMDA 2GQ3A 4RPPA 1P4CA 4F0HA 2VHLA 4K8HA 1W3TA 3PJWA 2OEMA 3ARZA 5LA1A 2DZAA 4PH6A 1E9IA 3GTXA 4XD3A 1WKYA 3OZPA 5M2FX 2ZYFA 2ZE0A 3R11A 3NCOA 3CZ8A 5U1OA 3RJYA 1AQ0A 4QAIA 3BSGA 1UASA 1WDSA 3T4WA 1V3MA 5LIUX 1MWOA 4F0RA 1UUOA 3SGGA 1H1YA 5IFTA 1XH1A 1LQAA 3W29A 4DBDA 2YPIA 3IJ8A 4TV6A 3SCPA 2D24A 4WLCA 2J7GA 3SY1A 4FX9A 2VZOA 3NS1B 3NWRA 1EPVA 5DMLA 2EPOA 4NYYA 4DVOA 4LVFA 2VCAA 3RN6A 1L6SA 2GL5A 3W2NA 1UUQA 1GETA 1KCZA 2WKJA 3TC3A 1ZB5A 4JTHA 3SCOA 1H50A 2XN0A 4RE3A 5CGTA 1UBPC 4N9EA 3PG6A 3CIWA 1Y5VA 1N63C 1D7KA 4H4WA 1KLYA 2BHUA 4C6IA 1W2VA 1IIHA 4GRSA 5GRTA 3GD4A 3DFHA 2VYOA 3B0YA 4TXEA 3RU8X 2J7EA 1G67A 5AVHA 1EC7A 5HPOA 3ONCA 4EX4A 3W24A 1T7LA 3QW3A 3E9AA 4PMVA 3LB8A 1U83A 3N2XA 3OW1A 4FNSA 4YTQA 2YIHA 4LTSA 3EOUA 1E1CB 1IEQA 4FAMA 2D20A 5C2XA 5CPOA 3EDEA 2NSXA 4AH7A 3FXYA 1VQTA 4Q6JA 2OYKA 7ENLA 1XIIA 4WDWA 3P7YA 3LRLA 3QHMA 3WELA 4JIPA 5C9ZA 1UWRA 1RALA 1FDZA 2DT3A 2EJAA 2DORA 3G1XA