3VCCA

Crystal structure of d-galacturonate dehydratase from geobacillus sp. complexed with mg
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
386
structure length
386
Chain Sequence
LNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title CRYSTAL STRUCTURE OF D-Galacturonate Dehydratase from GEOBACILLUS SP. complexed with Mg
rcsb
source organism Paenibacillus sp.
total genus 134
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3vccA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3vccA01
4GGHA 3OTRA 1EBGA 2PSNA 1TKKA 3QTPA 4GIRA 3R1ZA 3R0KA 3BJSA 4K1WA 2XSXA 3VCCA 3NO1A 2XH0A 3V5FA 3DG3A 4GMEA 3UCCA 3MKCA 1FHVA 1BQGA 4M6UA 1ELSA 2PODA 3H8AA 3DDMA 3CAWA 3MWCA 3JZUA 1SJAA 3GY1A 2ZC8A 3NZGA 4HCDA 4GYPA 2QDEA 1JDFA 2HXUA 3VC6A 3JW7A 3V4BA 2XH4A 3DIPA 3TWAA 4K8GA 1NU5A 3UJSA 2GGEA 1MUCA 4G8TA 3VFCA 1R6WA 3TQPA 3T8QA 2GDQA 2CHRA 4Z1YA 3IJIA 3SSZA 4DWDA 3KUMA 2DW6A 5FJOA 3VDGA 2MUCA 3U4FA 4A3RA 3R0UA 4KEMA 1WUFA 2P0IA 3PFRA 2OLAA 2PU0A 3UJEA 2P8BA 4HN8A 4MKSA 2AKZA 4JN7A 4H1ZA 3FV9A 5FJPA 1XPYA 3I6EA 3MQTA 1SJDA 3D46A 3UCDA 3DERA 1XS2A 3BOXA 2GGGA 4KT2A 3RITA 4E8GA 3N4EA 1TE6A 2GGHA 2OVLA 2QJNA 3Q4DA 3QLDA 4E6MA 3OP2A 6ENLA 4K2SA 4E4FA 5EU9A 3N4FA 4FI4A 2OZ3A 3RR1A 5BOFA 4HNLA 3MY9A 3GC2A 1EC8A 1MDRA 2XH7A 3QPEA 2QJJA 3D47A 4FP1A 3GO2A 3JVAA 3ES8A 3NFUA 1F9CA 3HPFA 2PS2A 3VC5A 2PP0A 2AL2B 4DXKA 4E4UA 1ECQA 4JHMA 2XGZA 3CYJA 3IJLA 3N6JA 2QDDA 5FJTA 4DYEA 3RO6A 3N6HA 2QGYA 3UJFA 1E9IA 1L8PA 1DTNA 1YEYA 4M0XA 3T9PA 2OZTA 3EKGA 3UXLA 1KKRA 2AL2A 3UXKA 1R0MA 4JN8A 3ZLGA 3CT2A 4ENLA 4GISA 2PPGA 1KCZA 4IHCA 2GSHA 4E5TA 3MZNA 4IT1A 1FHUA 3ZLHA 4HPNA 3THUA 3R11A 2PA6A 4YWSA 3SN4A 1P43A 3S5SA 5J04A 2P3ZA 1SJBA 2PCEA 3PWIA 1EC9A 3H7VA 4A6GA 1BKHA 1KKOA 3B97A 4GYPC 2PTWA 3R25A 3TJ4A 1NELA 2POZA 1W6TA 2OPJA 2PGWA 1TZZA 1SJCA 4A35A 3S47A 5FJRA 3VA8A 2OQYA 2GGIA 3OZMA 4HNCA 2RDXA 2I5QA 3FVDA 4G7FA 3PWGA 1EBHA 3TOYA 3MSYA 3SJNA 3EEZA 3CXOA 2OZ8A 3TW9A 2OFJA 3CK5A 3RGTA 1JPDX 3H12A 2QVHA 4H83A 4EWJA 2MNRA 3P93A 2GGJA 3I6TA 3OW1A 1JCTA 3QKEA 4H19A 4MGGA 2PTYA 3MUCA 1OEPA 3T4WA 4KPLA 1P48A 3BSMA 3UGVA 2HXTA 1RVKA 5ENLA 3ZVIA 4ROPA 4DX3A 4ZCWA 4IZGA 5BOEA 2OG9A 2ONEA 1PDYA 1JPMA 2NQLA 3DG6A 4HCLA 4GFIA 3GD6A 2FYMA 3IJQA 1ONEA 2P88A 4J1OA 2XH2A 4MMWA 3OZYA 3OPSA 3U9IA 3ZVHB 2PTZA 4IP4A 3ES7A 3FCPA 4HCHA 3RRAA 2PGEA 4IP5A 3TCSA 4F4RA 3FJ4A 3P0WA 2FKPA 1MRAA 3QN3A 3RCYA 2GL5A 4IL2A 3DGBA 3ZVHA 2HZGA 3SN1A 1PDZA 1MNSA 2DW7A 3TTEA 3DG7A 2OX4A 3VCNA 4DN1A 4HYRA 3SQSA 3H70A 3DFHA 3SN0A 2OKTA 4ZA0A 3Q45A 4H2HA 3SBFA 3TWBA 2HNEA 3DEQA 3V3WA 1IYXA 3ENLA 2PTXA 3P3BA 4DHGA 3K1GA 1EC7A 4Z17A 2QJMA 3FYYA 5FJUA 7ENLA 2PU1A 3STPA 1KD0A 2PP1A 3NXLA 3TJIA 2P8CA 3CB3A 5IDZA 3V5CA 3PK7A 1MDLA 2OO6A 4KWSA 2PP3A 2QQ6A 3FXGA 3DESA 3IK4A 3ZLFA 3I4KA 3DFYA 3UJRA 2PMQA 4GGBA 1WUEA 2OQHA 3UJ2A 2O56A 2AL1A 2AKMA 4X2PA 3T6CA 4IL0A 3R10A 4J3ZA 2ZADA
chains in the Genus database with same CATH superfamily
3PULA 2W63A 4JHOA 1HQTA 3L0KA 2PZ0A 1TTPA 5G2HA 4XAZA 3M64A 4D8LA 1K8XA 2CLEA 3NL6A 3I65A 4K1WA 3M4HA 1QI4A 1FECA 5BXTA 3NTYA 5E93A 4AD4A 1W3NA 4O54A 3NO1A 3VKJA 3V5FA 2NT1A 3QPZA 1MZHA 2WMJA 1MFUA 5IHRA 4HA1A 5I79A 4M6UA 1ZSXA 2ANUA 1JRBA 1F2JA 2KX9A 3NCOA 3EWDA 4NZ4A 2X0SA 3HGJA 2W66A 4FX8A 4LUTA 3RX2A 1GVOA 5CPQA 1CENA 3VDBA 1T40A 4KMQA 3AHYA 1J0ZA 3QFEA 1BYCA 3KLLA 4PTMA 3FDGA 2WZHA 3UZJA 3WK2A 3P60A 4BFAA 1DNCA 4L1XA 3VNLA 1I2OA 2BOEX 2NV2A 1XLAA 1A3XA 5BYWA 3T0TA 2BBFA 4UWMA 5BRPA 2XVKA 4K8EA 1OF6A 4WOQA 5DEZA 3QFBA 1M3UA 2YX0A 1Z32X 3GYCA 4IQLA 3W00A 4P8WA 4TV6A 3EOEA 3NWRA 2J8FA 4DWDA 1XIJA 4M6PA 4PB4A 3OG3A 2ZIDA 1V7YA 1W3TA 3NOEA 2B4GA 1I75A 5AECA 1A5SA 3L23A 2XIOA 1SM9A 4US5D 4B90A 4DRSA 3N2MA 2PURA 3G1XA 3UZYA 1W2VA 2WB5A 1UD3A 1ME7A 1XH1A 2Q8ZA 1STZA 3FSUA 2AAQA 3WUBA 3Q58A 3IGXA 1OC5A 2QF8A 1IZCA 1ITUA 3M0VA 3E0WA 1O4UA 2QJIA 2Z2AA 1JXJA 5A8OA 3AHZA 1GYMA 3NVYB 4MB3A 3N19B 3HQPA 4GQ0A 4KIRA 4AD5A 3P14A 4AUBA 1Z48A 4DXXA 1E1FA 3EWWA 3VE9A 2GR1A 1EXPA 2HVOA 4F9DA 1QWKA 3CZJA 1PV8A 4HD5A 3NSNA 1MI3A 4LVFA 3QPEA 4DXVA 1HJXA 3RCNA 3H21A 4I6KA 2PWUA 4ZSUA 5HXMA 5CQ1A 3LY0A 3GU1A 4QE4A 4WJ8A 4MB1A 3WG6A 3E2VA 3CGDA 4PN2A 3HURA 1GPFA 4AZCB 1UC4A 1ZAHA 2VFGA 3FA4A 2J25A 3KOXA 3AZSA 2W55A 1WB0A 1BD0A 2EPNA 2PTDA 1EHNA 3A9IA 5DY3A 1J0YA 3CEUA 4LUSB 3T55A 3O06A 4G7EB 4AW7A 2R1MA 5HJYA 2F8QA 1VLWA 3EWZA 4NZFA 4A8RA 3V75A 2QJHA 2E9BA 3CT2A 3MCNA 3ZR6A 4ZSTA 4UOZA 2GZXA 2GJPA 2RGLA 5ABGA 5CAKA 3KX6A 5FS8A 3E0LA 3EYPA 3CZ8A 4LY4A 3UA3A 4LT9A 6XIAA 4TR9A 1UR1A 4UTWA 1KW1A 1XGDA 1ZBKA 2YFNA 4GYPC 3EX2A 3LS9A 3LD5A 4GZ7A 3TSMA 3D9XA 2GQ8A 2QCCA 1ZS2A 4QG8A 4D6HA 3VTRA 3LHWA 4WSHA 1OFOA 2YBVA 3CIXA 3R89A 1VR6A 4DIAA 1W0MA 2ZTJA 1PCWA 2RDXA 1XYCA 3DFTA 3QC3A 3GIQA 2HVMA 3B8TA 3H2CA 3SQMA 2UY3A 4ORIA 4NJIA 5HNNA 1I60A 3TUUA 5TNVA 3UG4A 4B3KA 3G22A 5C70A 4HNTA 3CV7A 2PD5A 5FEWA 4UTWC 2XYLA 2PWHA 1OEPA 3ARRA 4LWWA 3DC0A 3EXSA 6CGTA 1KBBA 1UD8A 1KV8A 1CBGA 4YTUA 3ICJA 4H00A 2DDXA 4DLFA 1SO5A 4MNLA 3H2FA 3DXIA 1W9DM 4KS0A 3EKZA 4NT0A 1MVYA 1JPMA 3ZOAA 4JIRA 5IOBA 3UESA 2NV9A 1F4AA 1X8FA 4IISA 3RXZA 4ZE5A 5F4XA 2Z1XA 1FVPA 4HQVA 3VD5A 3QZAA 3RAOA 4O1EA 4JYEA 1WBHA 3U2CA 5TBOA 4LA1A 4IP5A 1XW8A 3IPWA 1XDMA 3CV1A 2VM8A 2YJQA 3AXHA 4F0LA 4UZSA 4RNJA 3AIRA 3FAWA 5HJXA 1EJRC 1PDZA 3ISIX 2DW7A 4CCZA 2E5CA 2JKAA 1F6PA 3SQSA 2BCPA 2DZTA 1ISYA 1S2AA 5K4XA 1AQHA 3LK6A 3VX1A 4ZA0A 2ZUTA 3MANA 4H7ZA 5BZAA 1VFOA 1ZP4A 1KB3A 3AHTA 4JY8A 3ENLA 3LYEA 2VYOA 4H7VA 2AQOA 1NOFA 1F76A 4CQDA 5JCMA 4QHRA 3SECA 4RR4A 5EY5A 3WX7A 1V0KA 4FX7A 2I57A 1Y5WA 1GETA 3SEPA 1HJWA 3P62A 3JS3A 1MDLA 4NIRA 3T0CA 3DESA 2NWSA 2XZ7A 1LORA 2DSWA 3UJRA 5KITA 5I24A 4GGBA 1FWSA 3VM5A 1LG1A 1O94A 2Z4GA 5LKYA 1UKPA 2LLEA 4QR6A 4HK6A 4PB5A 3N1AA 2B7QA 1EFZA 4J3WA 2GK1A 4DY1A 3T6CA 1OD8A 1JPHA 4UTJA 3G1RA 3A64A 1BTCA 1B90A 2GJRA 4HBKA 4HOZA 1R38A 3WCZA 2AMXA 1GQNA 1CGUA 4H9VA 4GZEA 3STFA 2YXGA 2V81A 5LIKX 2Y6ZA 4ML4A 3DAQA 1GEQA 4KPRA 1PPIA 3GBEA 2A3EA 1W54A 4Q4RA 2CLMA 3NQAA 1ZCCA 3O0FA 5IRPA 3KWSA 4ERIA 1WZLA 2F7FA 3QM3A 3SRFA 4GUIA 4EX4A 8XIAA 4GA8A 5D9NA 2ZX7A 4W88A 3DGHA 4Y8FA 2X2YA 3IJ7A 5E9AA 4PUJA 3BLOA 3L5AA 5HMSA 4AZIA 4AX7A 1SJAA 3NQVA 4RE3A 1DJHA 2DY3A 2Q01A 3N29A 3GU2A 3WFAA 4FNQA 3EXTA 1S2WA 4IQEA 2EXOA 4YWOA 1XUUA 4DJFD 3D0CA 5A6AA 1BG9A 2WCAA 3RNDA 3M6YA 3AM9A 2Z1VA 3V36A 1HJVA 3W1MA 2EHHA 4Y9AA 3KAOA 4RLIA 4LGXA 4LUJA 2ADAA 5JUVA 4MDPA 4IPJA 3F4VA 2YCLA 2EPOA 2QT3A 3IAPA 3GXIA 1GT8A 3M5XA 4EPEC 3A7AA 2PF8A 1JCXA 3S5NA 4GYJA 2TODA 5MKGA 1SGJA 3PC0A 3QMSA 4S3KA 3BAIA 3WDHA 4H1ZA 4EAMA 4FIRA 4GO8A 2TSYA 1DWGM 1XPYA 4MJZA 1GYNA 4JQ3A 3AHXA 3LXCA 2JK6A 4PUEA 3DERA 2PLJA 1AMKA 4XO7A 1KFBA 1WKDA 2OR2A 2Q8XA 4F2UA 3ZSTA 1DXIA 4N2YA 1C8YA 4I8DA 3ZJ8A 8CGTA 2W6RA 3WYZA 2WSYA 4AISA 1V7AA 4H9ZA 1W9BM 4GR1A 3EDDA 1B0IA 3QR1A 5DCBA 4PSPA 3CNYA 3UY8A 4HZ8A 4FP1A 3AZRA 1MW1A 3JVAA 1BYDA 2CNCA 1X38A 4ZTYA 3VMNA 4CCEA 5A6TC 1GVQA 3URAA 1QHPA 3HPFA 4QE5A 1V02E 1OQFA 2Q8LA 1U1JA 4DBWA 4KBXA 3WSUA 4E4UA 4IQJA 5G2WA 2PGRA 3BCDA 4K37A 5LIXX 2WHMA 3DHUA 4KRZA 3TIMA 1JJKA 2CBVA 4PMUA 2RJHA 1UA7A 2DVXA 5U1OA 1XLJA 3UJFA 4HNOA 1E3ZA 1Q8AA 1KKRA 3NVWB 2YZRA 1QW9A 1A53A 4IMGA 1BLIA 1WXYA 2VWSA 3U48A 2ZRUA 3W82A 4KETA 4BI6A 2E9MA 2YDRA 5FEXA 1D8WA 3DH9A 2FMOA 2FZ8A 1KXTA 3MUIA 1IWAA 5MHBA 1KFJA 3GNNA 3ITXA 4PBEA 5JIWA 1XYAA 4CCDA 4C60A 1GZGA 1U1UA 3THAA 3PUEA 1LL6A 4D8ZA 1GXFA 3YPIA 4DEFA 2X05A 3VI2A 1DJYA 5FF3A 2ZBTA 2I5QA 1FIQB 3NM3A 2PGFA 2WZMA 1L6FA 3U7BA 5D04C 3UCQA 1ZAJA 3FSTA 2D0FA 1MQRA 4O4WA 4ZOEA 3ZT5A 2VEMA 4G5DA 1ISZA 4EWJA 2POTA 4GJ1A 4CCCA 3CHFA 1QI0A 3OW1A 2BY0A 1FEAA 1EQPA 2JK2A 3QKEA 3BOLA 4A05A 3OBAA 1E6PA 1V59A 2B7PA 2EPLX 3N14A 1GVYA 2D2OA 2V68A 1WOAA 2CXEA 3GIPA 4BY3A 1F8MA 2PZNA 5JBDA 3AN1A 3IJ6A 4LC6A 4E8CA 1AJ2A 4L6HA 3WMLA 2W54A 5DX7A 3DK8A 2B0MA 1P0DA 4AZ5A 2J77A 2Y62A 3B40A 3ITCA 2W0UA 2Y0FA 4KFOA 4C6CA 1ML1A 2D3LA 4QAWA 4LF2A 1XISA 3FY1A 3AUOA 4DJFC 1PO9A 2EG8A 2WWCA 1BYAA 2NZLA 5CPMA 3SM0A 5T26A 2NUXA 4Y7EA 2PDLA 4A8LA 3WK0A 3R7MA 2OT1A 3UXIA 3DGBA 1G94A 1TWIA 2D69A 3C61A 3NRZB 1MNSA 4KQNA 3EB4A 4OWGA 1YXCA 5REQB 1TWSA 2I9UA 2G37A 1EZ2A 2CBJA 4X61A 2WZEA 1KFEA 3S6OA 2DUAA 4GKLA 2V6AA 4IPNB 1Q6QA 2A0NA 3MHGA 4AEFA 1H7WA 3QR3A 4QJ5B 1EDGA 2CKSA 1JDEA 3S0CA 2VELA 1X2GA 3B8UA 5D32A 2ZRWA 2QJMA 3T42A 1EJXC 5HDRA 3B0YA 2IMRA 4H8VA 1XLEA 2E4TA 2PWGA 3CQ0A 4UNKA 1KBLA 3QGAC 1PEZA 4WDTA 3HG4A 3GAKA 5HR6A 4XUGA 2GSJA 5CEWA 5CCZA 3IACA 4JTQA 4V33A 3DFYA 2V5KA 2PMQA 2R94A 3L68A 5KEZA 2ICSA 1WNOA 1WUEA 2PBOA 3RR4A 3CUGA 1A0CA 2G8ZA 4GI8A 1F07A 4DUOA 2ZADA 3RX3A 3B06A 3GVGA 1TKKA 4O18A 5CSSA 3F5JA 3FS2A 3PZTA 5LNSA 3QQWA 4HIBA 1RD5A 4YTQA 1OX5A 3B0PA 4O16A 3N12A 3ERPA 5JVLA 3LHVA 3AMGA 4ICCX 3MMWA 4LUIA 3WH9A 3MKCA 4ZBCA 4AC7C 1ADDA 3GRIA 4P7NA 3V1PA 5CKSA 4Y8EA 2PODA 2ZXQA 4C6BA 4LU0A 3RHGA 2UZ9A 3JZUA 2DJLA 5AFDA 3PTQA 1EF3A 3L5MA 3QQ0A 2ZC8A 4XBKA 3GE7A 3NZGA 1JCMP 3O63A 1V6VA 2BHUA 5FI8A 1D7KA 5C7VA 4MJMA 2GQ9A 2DVTA 1PSCA 3PBVA 5H1WA 2J66A 2ZX8A 3PWAA 2PDIA 1VJIA 4FO4A 3OGVA 3M6DA 1G4SA 3E96A 3WENA 5HBFA 4GX9A 3O0HA 3NL5A 2F6UA 3V0UA 3LERA 4JIHA 3WQ4A 3EDFA 3VIFA 4KRTA 2BODX 5CZ0A 3KP1A 4L6DA 3MW7A 1V0NA 3GG8A 1JCJA 4GUJA 3WUEA 3ZM8A 5LIYX 3MDWA 4A3RA 1SUXA 1GOMA 3AZTA 5CZKA 2EQ9A 4LAOA 4D6IA 1RK6A 1TZ9A 4DELA 5FL1A 2WM0A 4XZBA 4LIIA 2VT0A 3E2SA 3ITYA 2P8BA 1FUYA 4Y9PA 3JR2A 1N5XA 1BF6A 2FQIA 4CKQA 1XF0A 4E3TA 4PYSA 3UFYA 1DJQA 3M0IA 3LI0A 1OCJA 4NL1A 4OE7A 4FOKA 1WZMA 2VDGA 3I3DA 1NP0A 4TMBA 1H49A 3QY6A 3R43A 3ID7A 3GDMA 3AXXA 4MNKA 3WH7A 5D9MA 4N6FA 3O9NA 5TIMA 3CWNA 4MF4A 1Q6LA 3Q4DA 4HHHA 2C79A 2J7CA 1E4MM 1UWAA 4Y9MA 1M6IA 1ZBCA 4C6JA 5EU9A 5BOFA 3JZEA 1GOWA 1NFBA 3RLHA 1G01A 3RJYA 3USBA 4HPGA 3O6DA 4H41A 5KZDA 2BGQA 3A23A 4UOQA 5DFAA 3OIXA 4RNFA 1W32A 1YQZA 3EGJA 3M47A 1YIXA 1UBPC 4EQRA 1Z7AA 3K8LA 1EWEA 2HPIA 2DH3A 4FDCB 1ECQA 3URHA 1AZ1A 4NAFB 3IJLA 2QDDA 3C3NA 4Q22A 1QWGA 3N6HA 3KHDA 3DHFA 3OBEA 2WJEA 1H0IA 3NQFA 1MUWA 4OJYA 5CBJA 2OKOA 2OZTA 1WOBA 5E6ZA 3HF3A 3OHMB 2WSPA 1J0JA 1Z69A 3TNBA 3AFBA 4AWTA 4GVHA 1XIBA 1B3OA 3L2MA 2A4AA 4N6EA 4A2SA 4UQCA 1BWLA 2WNZA 3PPHA 4FLSA 3TZFA 1KXVA 2OB3A 3IUHA 1N55A 1Q2RA 2P3ZA 1FTXA 3SQPA 3MZ2A 4C6KA 1EC9A 4N9EA 2Y7DA 3GXPA 3CH0A 3E74A 2E9LA 4C7DA 5FS6A 4R9XA 5HULA 2PTWA 1A49A 2POZA 3P2VA 1QT1A 4J56A 4J2MA 4EXAA 5FESA 5AHLA 2XM2A 3T0BA 2B7NA 1BYBA 1K70A 3D3FA 4KF1A 3GTXA 5D05A 2AGKA 3DJGX 2INEA 2GK1B 4QNWA 2XJ7A 3IIVA 1JPDX 4O11A 2PWDA 1PZ0A 4KESA 2IQ0A 4BF5A 5HNUA 3AMCA 2BV9A 5FL0A 1GK8A 1LRTA 1F3XA 3I6TA 1XCWA 4D6CA 1S5TA 4MZ1A 3RO8A 1EPXA 4JPGA 2ZKMX 3WUFA 3LV6A 1VP5A 1V8EA 2PRMA 1UQYA 4D6EA 3M7SA 1XI3A 1OYBA 1TSIA 1ITQA 3W7JA 4J5NA 4IJRA 1U1HA 4WDXA 4E3VA 3LRMA 1WDPA 4ROPA 5CG7A 4ZCWA 3CQJA 2YCIX 4PMJA 3PG6A 4ASTA 1K3UA 1SMDA 4H6RA 4GNJA 5CSRA 4WOZA 5CGTA 2IUZA 3KEHA 3OC4A 3PJXA 1AQMA 4GNKB 3U9IA 1EPVA 3DUGA 3FEMA 1J18A 4AY7A 4AXKA 2WPGA 4QBXA 1NJJA 4ZZ9A 1BAGA 2VEFA 3VD3A 2ZUMA 1XYLA 3IJDA 2OSWA 3CEPA 3UXAA 4Q8VA 3QN3A 2F84A 3W7PA 3WQ6A 3G24A 1XYZA 3QBUA 3L2LA 3FJLA 3ARQA 1XINA 1VPQA 3LRLA 4JTGA 4N4QA 1TA3B 4GZJA 3WJXA 1KM2A 4Q4SA 3NZ1A 1JRPA 1PX8A 4C6QA 3TQVA 4DZ5A 4CVWA 1O95A 3V3WA 3S9ZA 2Y61A 1M7JA 4N0RA 2D22A 5DLCA 3A5VA 4JAWA 1XIGA 5LA2A 2HSAA 3DX5A 1F7BA 3GZ3A 2EPMX 4YVPA 1RQEA 1UUOA 2Z1BA 4YTSA 3EUB3 2ZX6A 3FGCA 6A3HA 4KWSA 1WDWA 3LHTA 4WXZA 4OZOA 1O6IA 2RDTA 2J7DA 1A5LC 3LDVA 2AL1A 3WQOA 4D1JA 1UP3A 3T0DA 3W53A 1KXQA 4IIGA 3WBEA 1BWKA 3SCWA 4H4PA 1GHRA 4IIBA 1EGVA 2DFAA 1D9EA 3IRDA 2PC4A 1C8VA 3T2QA 1HUVA 2V3GA 3H26A 3NOYA 2VC6A 1ZCOA 3NO5A 2VZVA 4BQ3A 1M1BA 5T8GA 1YADA 1EP1A 4AVNA 4EE9A 3WFLA 2FHFA 2ZCGA 4R27A 3S2NA 1US3A 1H6VA 1NHSA 3TE9A 1CGVA 4ECLA 2C13A 2QUTA 1G7VA 3PR2A 4AZ7A 1XLFA 2EG7A 3VNYA 4JN6A 1DJNA 3W1XA 5B7ZA 3KTSA 1GYLA 1JDFA 1YE4A 2VX4A 3EB3A 1WKEA 3VC6A 2B81A 4H9MA 3D5HA 1SO3A 2EPKX 3PSVA 3K30A 3W75A 2PB1A 4YVVA 4M3PA 2GGEA 2WBGA 4WEVX 5LYRA 3NQ8A 1NHPA 3R4IA 3MDUA 2EQDA 1UC5A 4MTVA 5EBAA 1OYAA 1EUNA 3BZJA 3FHQA 2C0HA 3IGSA 1IR1A 2JBMA 2O9TA 4AX6A 1DJZA 1BHGA 1AODA 3T2PA 3HA1A 1TX2A 2REQA 3BOFA 2EO7A 4C65A 3A6OA 2GDVA 1ZNNA 4J57A 2W0HA 3WQVA 1QNOA 4QGCA 3EOUA 1KBIA 4JGDA 5AYYA 3RM8A 3UY7A 2ZZ7A 2I5GA 3TSDA 5EBKA 1KGXA 1FWBC 4ICMA 2DJXA 2E25A 2YBUA 3A4WA 4KEZA 1KTCA 1ME8A 2HDJA 2INFA 4EQXA 3BOXA 2GGGA 2PCQA 4LAZA 5EL1A 1DOSA 5D8WA 1G6CA 4FOUA 3NZRA 1AFSA 2YL6A 3N2CA 3KWXA 2WYSA 4E6MA 1TMLA 2OELA 4WKAA 4P8XA 2WC3A 4GBUA 3ABSA 4UTFA 2W61A 3W4RA 2CYGA 2ZYFA 3S2CA 4E2BA 1RM6B 2CETA 4GCAA 3CPRA 3LUTA 3W0KA 2PLKA 4KKXA 4BQ2A 1I1XA 2R1PA 5CSUA 1FWWA 3VKKA 1XANA 4L7ZA 5PTDA 4PCNA 5GVJA 1UWQA 3ES8A 1CXKA 4JIEA 1TVLA 4R34A 1DBTA 3LCHA 1GVIA 1TO3A 3GDTA 1FCVA 1SVDA 3ARVA 4JBRA 3AI0A 4CU8A 1GOXA 4JQ4A 4O15A 2QGYA 1GKPA 4RNIA 1DTNA 1FWFC 2D3NA 4XAPA 3CGEA 1JZ2A 3KHJA 1DKWA 2FTWA 3GYEA 2ZX9A 3HIJA 3TKFA 3U8GA 4IHCA 2QULA 5D02A 9XIMA 1C3FA 3QGKC 1NTHA 4ROQA 4PFMA 2SFPA 5I7GA 1FHUA 4NJGA 3W2NA 3THUA 3HB9A 4JR5A 1ITXA 1U5JA 2VZTA 1PIIA 3NURA 4EMIA 3S5ZA 1K7XA 5TD4A 4H7CA 5BW6A 3BSHA 5JH1A 2PDQA 2OPJA 3U2EA 4NG3A 3AUJA 4IGSA 3K4AA 1MEWA 4UFHA 4Z0SA 4AAJA 1PAMA 3S47A 1HVXA 2FPTA 2GGIA 1BXCA 4J3SA 2BP1A 1SZFA 3N2BA 4HNCA 4Q8NA 4H4YA 4LV9A 1KRAC 3A4AA 3EWXA 5LA0A 1HTIA 2CBIA 1JCLA 3EA3A 2CXGA 3VM7A 5FIPA 1JROA 4LFYA 3W37A 2NW0A 3W7LA 2JIWA 4GHRA 3UPWA 1AD1A 2ZUWA 2A79A 2BSLA 5AHMA 1JCTA 1CYGA 3LLDA 4JEJA 4ZODA 3QW3A 1H62A 3LU2A 3FJNA 2HXTA 4Q32A 2XIBA 1YX1A 1N8IA 1GQKA 4RPQA 2Z2UA 3NQMA 4X9SA 4QTGA 4IZGA 4L4OA 4CU6A 2G3FA 4K7VA 2OG9A 3F4CA 1JFXA 4JTDA 5CGQA 5FF0A 1QI2A 2JQXA 1R85A 2OQLA 3GM8A 3ONCA 2YVFA 3LTPA 3B9DA 3SRKA 2V8ZA 3CL7A 2QCMA 3U3HA 4JYFA 2OMAA 4UFJA 3VOJA 5M3WA 3TLQA 3BV7A 1L6SA 1JPIA 2XPKA 2YDAA 3DHPA 3XISA 4M82A 2D2HA 3BV4A 3P61A 2P1FA 2OO0A 3HBLA 4H2HA 3DEQA 4MUZA 1T8QA 1OBAA 4JDRA 5FS7A 4GIEA 1ZQ5A 2VDIA 2OYKA 4GINA 1UR8A 2PDHA 1MW3A 1MQQA 4PRTA 4YYFA 3GC5A 4AYSA 2W3ZA 3W23A 3W1TA 2J7GA 5AHEA 1CIUA 2V3BA 4MOZA 1AH0A 2FGLA 2HROA 3QY8A 1NHRA 2DORA 1QW8A 1OG6A 5AYXA 4MJ4A 3RLVA 4C6DA 3SCSA 4EQWA 4ZQPA 1UJPA 4G1NA 4C5ZA 3FHAA 3HPZA 1N7KA 3M07A 3BJFA 1SSDA 4BF9A 5K9DA 4S1FA 3D6NA 1EGZA 2ZUSA 1UD5A 2WHJA 1GKQA 4GGHA 2CZFA 4P7RA 1AUSL 4LUYA 2Y7EA 3VGHA 1G1YA 1CNVA 2F61A 4X0VA 2VGBA 3VE7A 3KBVA 1W5NA 1W3LA 3TZNA 4C1KA 5HWNA 3K8KA 4B16A 5A2AA 4FXFA 4O0ZA 3AXKA 2C7FA 2CEQA 3VOGA 1PTAA 4KCVA 1HN1A 3UG8A 3BAJA 2HE5A 4E8DA 2AAAA 2ABBA 1HO1A 4YU1A 5FF4A 3MWCA 3LZ3A 2Q3OA 3M0ZA 4NNCA 3GTHA 2QAPA 2WV8A 4H6EA 3GHUA 2JFEX 1VBGA 1DEDA 4FA3A 1JZ3A 1QPNA 3ANUA 2VOTA 4EM4A 1E6SM 1RCQA 3MSRA 4UZUA 1Q4NX 1TV7A 1GESA 7ODCA 5DF0A 3M16A 3NZPA 1AD4A 1KM6A 3MC5A 5A8QA 2BGNE 3C6CA 3F1QA 1OSEA 5CPOA 3NSMA 1UWTA 5LGZA 2VGFA 4W84A 2NQ5A 4Q8TA 4Z1YA 1YDVA 5H8PA 4I3GA 4TVDA 3WNLA 1GW1A 2VDHA 2P3EA 3A3WA 6ALDA 3RF9A 4QJ1A 4YYCA 3P8JA 1TPWA 4QCFA 4ATLA 5K3VA 1K4HA 3ZYZA 1GVSA 4V1YA 3UETA 5ABFB 2VC9A 4JX5A 3OQEA 2BC0A 3KZPA 4XV0A 2WSQA 1ZTVA 4HN8A 4UTTC 4R7OA 1KM4A 3NPVA 5FJPA 1XBYA 4TXEA 4FLQA 1JOAA 2VR5A 2V6OA 1V5XA 3P8IA 3B4UA 3AS0A 4ADUA 4GUHA 5I78A 5E0CA 3W1RA 3BLIA 1OF8A 2WMFA 2YKKA 5TQLA 1I8JA 4J7RA 4IGMA 1EWDA 3HJEA 3UBPC 1EP2A 3B04A 4NXKA 3O8AA 4XVEA 2BXZA 1B3VA 3TU9A 4PEEA 3NEHA 3SADA 5LNWA 1YPXA 3EF6A 4CEUC 3VIOA 2Y5EA 2WLYA 4ZOAA 4B4FA 4IH3A 4HNNA 4ACZA 3BZGA 1Z8AA 3DK9A 5DMLA 2AGTA 1EGMA 2BY1A 4A21A 1F5ZA 4O52A 4XWUA 1KGUA 4WUIA 2J74A 2I9EA 3QZ6A 2ATMA 1YNYA 2DGAA 2EKCA 2PS2A 3WQDA 2P5NA 1CDGA 1NIUA 1MZRA 3N13A 3T1GA 1FRBA 1ICPA 4JHMA 5DCEA 4DM2A 1V3KA 3FEQA 1T96A 1K8CA 4H4XA 3SCQA 3LADA 1E9IA 5HPOA 4ALDA 4M0XA 3LOTA 4HU0A 4BJHA 2ABAA 2ZA1A 3CHEA 4NYYA 3LPOA 1W9UA 4M7SA 4BWLC 1OM0A 4JIPA 4WZHA 4MKVA 3I68A 4RPPA 2CCRA 3WY1A 2VUYA 4MAVA 2YAUA 4HA3A 1XH2A 2Q71A 1SB3B 1TMQA 3U5UA 3S5SA 1PTDA 4L9XA 2ZRVA 3GNXA 1VHCA 3EDEA 3AU6A 2I7GA 3FVMA 4WGXA 2WOWA 4EMWA 4A35A 3SUSA 1R5YA 3RPTA 1EJWC 5C9XA 4OVXA 1F8WA 4JIIX 1ENUA 5T91A 3FVDA 2F6KA 1JZ5A 3IGHX 4FIQA 3H4XA 3EEZA 4PRRA 1PBGA 4DNMA 1HVQA 2YCJA 2G97A 4R53A 3LLXA 1XIIA 1HX0A 2NQ9A 4MFEA 2MNRA 3P93A 1GOIA 1EXBA 1XM3A 1L6GA 3CYVA 1CPUA 4H8NA 3CIVA 2D1ZA 4PTDA 4MGGA 1Q7ZA 4LVBA 2OZ0A 2PTYA 2A85A 3L12A 4LS2A 1RVKA 3CAQA 3PTMA 2H6RA 1ICQA 4ZFCA 1F61A 2FDSA 4EWND 1A5OC 3W1PA 2X30A 3ARTA 1M7XA 4G56A 1F05A 4UTIA 2DIJA 3EPNA 1GG1A 2OEJA 1ONEA 1DHKA 2P88A 5BWAA 9RUBA 4JYDA 2WZIA 2X41A 3G8RA 3R0DA 4IP4A 1LUCA 3FA3A 4Q8MA 3FCPA 4A3UA 4DO6A 1EA9C 1BZLA 4XD6A 4HNVA 5FKYA 2J8GA 4KEUA 2KZHA 1M03A 2QPUA 1QOXA 2R9ZA 4AIUA 4UR9A 3C0JA 1HGYA 3TTQA 1V77A 3TTEA 1YTKA 4MYXA 3AYVA 1YDYA 3HQOA 4DJDD 4HYRA 3LM7A 4MFDA 1SR0A 1GRGA 1LOSA 4LEQA 2HNEA 1UZ4A 4LJ3A 5FOOA 5DANA 2REQB 2DIKA 4J27A 2HCVA 4N7QA 3WD2A 2Z27A 3APTA 5D33A 3K4DA 1B9BA 4L9YA 1SFSA 1KD0A 3VIGA 4AXNA 2PP1A 4PMDA 1OJXA 3AS1A 5GNXA 1PZ2A 4CN6A 4C6LA 2GOKA 3MMTA 1O60A 2DZSA 2QV4A 1MEHA 3HU7A 3M0HA 3I4KA 5I3FA 3ZIZA 4GXPA 4K3ZA 3T4CA 3K2GA 5DELA 4B5UA 3UJ2A 4K68A 2A3AA 1C8XA 3F4DA 4UIOA 4ADSA 4XISA 3K8MA 3R10A 1H09A 1VKFA 1BF2A 3AOFA 5KVIA 2UWFA 2PSNA 3CQKA 3IEBA 3ELFA 3AWNA 2CLFA 1ZDLA 4ZQRA 3AISA 3RPMA 1O5QA 1QPOA 5CJMA 4FNRA 3PUDA 3NR0A 2W91A 2A5HA 4AMCA 1J4EA 3W29A 2VOMA 1XFCA 4O17A 3LCLA 4WD0A 4GMEA 1L6YA 4H8UA 1F3EA 3O05A 2O7QA 3D3AA 4F66A 5M2FX 1ZFJA 1J12A 4RNHA 2V67A 4IMEA 4WGHA 4WRHA 5JMUA 4C6FA 1TTIA 4XD3A 4F48A 4DPQA 2CFFA 2VC5A 2WQPA 4KGLA 3UT0A 3T8LA 1TV5A 1XCFA 4O1FA 5EFDA 4V2XA 2HPMA 4U5KA 1BRLA 1J93A 1LLZA 1R87A 3VU2A 4QDWA 5XIAA 1NU5A 1CCWB 1OD0A 3W7IA 1DWFM 3PZQA 2XFWA 1Q4WA 3DFOA 3PSWA 1U2YA 3LG3A 4LXFA 3UR7A 2RAGA 2O4QA 6XIMA 3H4KA 5EMYA 3B9OA 3SJ3A 4GY1A 1OX4B 3I7QA 4HZMA 2CHRA 3M0MA 3TN5A 1XLCA 1DVJA 2GR2A 1CB2A 2VP8A 4GQGA 1HL8A 1POKA 4ZB0A 1DE5A 3R0UA 3W74A 1FWHC 2KAUC 2C6QA 4ONVA 3SFWA 8XIMA 1FDZA 2PDUA 4HA4A 3UJEA 1ESWA 2AKZA 4S3GA 1TJ0A 3LM3A 4KIEA 2DU2A 2BX7A 2ZZ6A 1CW2A 3B03A 1TPEA 5HQLA 1B3XA 4B5VA 4LTSA 4ZO7A 2ACUA 4JFSA 3KL0A 3NQCA 1GNXA 1ALDA 2GDUA 2NVKX 1Q3NA 3N4EA 1QK0A 2GGHA 2ZZCA 1XG4A 4QE1A 4PUDA 3KL3A 1X7IA 4D6FA 6ENLA 5KMYA 1KTNA 2D20A 3N25A 7TIMA 2NVDA 4FSAA 4NX0A 3SUUA 3DENA 4LPCA 2CESA 2DQWA 1K8YA 4NU7A 1VCFA 1MDRA 1VRXA 1B1YA 2NV1A 3D47A 1GRTA 3RLGA 4L6OA 2V0TA 4MZ8A 3W83A 3GG7A 9XIAA 1R30A 3M44A 4HSOA 3KE0A 5I3IA 3VC5A 1ECEA 3HV8A 4H6QA 2X7WA 4OHQA 1I6NA 2AL2B 4DXKA 2HK0A 1ADSA 1LL7A 5A69A 4TOQA 4MLRA 3N6JA 3WLKX 5F1UA 2O9OA 1RSCA 3RO6A 5ABHA 1VYPX 4Q4QA 5AYBA 4DJDC 4Z2KA 3UXKA 3BG3A 3PPFA 2PDFA 2Z1SA 4Q4MA 4AZCA 3FA5A 4JD4A 1REQB 3G1FA 3VAVA 3RMJA 2XDFA 4UFKA 1VCGA 4AIBA 4DJED 3W87A 4AHQA 1EHAA 3E5PA 4HPNA 1JZ8A 4JDYA 3I4EA 4YWSA 1BGAA 2XFYA 1FFRA 3II1A 4NAEB 1FDJA 3GX9A 5J04A 3R6IA 1EL3A 4FXSA 3A47A 2FZMA 3W7MA 3CMGA 3CQIA 4PMVA 4W7WA 4KGJA 5H2ZA 4QSFA 3P80A 3QSRA 1QO5A 3TJ4A 1JNDA 3DZ1A 5FJIA 1D3HA 4I7UA 1FKWA 1F3PA 3E38A 3EAOA 5I5RA 3KM8A 1UWSA 3POHA 1X1ZA 4EXQA 1POJA 4OGZA 3H2MA 5AYIA 4MWAD 3W84A 5K7JA 1KTBA 1S5WA 3BURA 3CMFA 3TOYA 4IGNA 3MSYA 2J9YA 3UG3A 2OZ8A 4AF0B 5D37A 1UJQA 4IIFA 4KCUA 5C9RA 3UQNA 3CPGA 3F2CA 3GU9A 2XVPA 3W1QA 4H19A 4AWSA 4O28A 4XBJA 5G4HC 2C3DA 3ARZA 2WANA 3VNMA 3EZ4A 2WJFA 5CZSA 4UQBA 3NQEA 3ZVIA 4P8VA 4PA8A 4BQ4A 3B9NA 1UB3A 3C2YA 1VS1A 5I6SA 5F2MA 1OT2A 1PDYA 2RH9A 3TP4A 3AIVA 2WAGA 4FNSA 1YMYA 5CZJA 4PODA 1HJSA 3WK1A 4HCLA 2GVGA 4IPPA 3T07A 5F1VA 5HNTA 4QG9A 4W89A 4EKJA 2P76A 1HGWA 1A0EA 3TN3A 4WKFA 1YTEA 1FOBA 1W8GA 4K38A 1HZYA 2BVDA 3N04A 3WNNA 1S5MA 3UA4A 1IEVA 1SU5A 4B92A 2GL5A 2FHBA 4I5UA 4DN1A 3CQHA 3TYUA 1ZBVA 4UFIA 5FCZA 4PC8A 2FPVA 4Z0JA 4APNA 5RUBA 3URBA 2OOFA 1DE6A 5K4ZA 2PRLA 4FALA 2XN0A 1VEMA 3WNKA 4FK9A 3CHCA 2VURA 4KERA 4Z17A 3VDCA 2H8ZA 1J01A 3L2IA 1B9ZA 1FFUC 5EMJA 4M29A 2BY2A 1HKVA 3MVIA 4C7GA 3W26A 1UKQA 3VGGA 2TPSA 2DQXA 3BLLA 4I9MA 5IDZA 1VFSA 3Q94A 4NASA 2JE8A 2VQTA 1XG3A 3SDOA 2G3IA 3NQGA 3UZZA 4F3HA 5SWUA 3NA8A 1DL3A 4UXDA 1H11A 1PHQA 4IG2A 2ZZ2A 4X2PA 3PBGA 5DY2A 4LAKA 3C52A 4WR3A 4PTXA 3T05A 3PZIA 4QROA 4GXMA 1W3JA 4GACA 2ZA2A 4O8RA 2H3DA 3WH8A 1NWRA 2WOIA 2GVJA 4ACZB 4NEWA 3R8GA 3DN5A 1EIXA 1MXGA 2WHKA 4HK5A 3MI2A 4BQ5A 1W91A 3RLUA 4NZCA 4K39A 4F0HA 3P5YA 1OFEA 1ADOA 4WDWA 4ES4A 1MWOA 2WKGA 3T81A 4GNVA 1SZRA 4OBSA 8A3HA 1VFUA 2V5JA 3AXIA 1JULA 3WELA 3KS5A 1VAHA 4PRWA 3NQ6A 1R3TA 3CAWA 4AD0A 1YTDA 1TIWA 3VMOA 3LMZA 2QR6A 1JDDA 3PB0A 1US2A 5D2XA 4W86A 2VX6A 3F03K 3W7HA 1CWYA 4DJEC 1UR3M 5AC7A 3PNUA 4ZE4A 3TH6A 5LNRA 1M01A 1OK4A 1WYIA 2XH4A 4TIMA 5CAHA 1TQJA 3OLEA 4EM3A 1XRTA 2PDBA 1TIMA 5C9WA 2OJPA 5A6BD 2FTYA 5DMMA 4U5IA 3WDRA 4GVIA 4D6GA 3IJIA 4C6EA 2ATSA 3WLHA 2ZXAA 1H1ZA 4GD0A 2QPSA 1G4PA 4MWAC 3EX1A 1N2VA 1NF7A 4AZ6A 1ZENA 3PFRA 3BGGA 3CGCA 3IK2A 1H60A 4MKSA 3VPLA 4JN7A 1QNRA 1CT5A 2ISDA 1P4CA 1RZMA 3MPGA 3P67A 4B5NA 2D0GA 4ZOCA 1IIHA 2RGMA 3W28A 1SMAA 4HYVA 3NJ3A 1N5WC 1EP3A 5FD0A 4A2RA 3U57A 2YOCA 3CHVA 3RITA 1UD6A 3OB8A 2WXDM 2A6LA 1LM1A 2XIJA 1QNSA 2CLLA 1UH3A 2UY4A 3O6AA 4S3FA 1XP3A 4Z2IA 3WD1A 1WKFA 3LQLA 3DECA 3VVGA 1PVNA 1JYWA 4K2SA 4MYAA 2X99A 6REQB 3WN6A 1JD7A 3VILA 2GWNA 3VOCA 1TYGA 4RDWA 3MY9A 3CTLA 1EQCA 2CERA 4YHGA 4MADA 2J47A 1E6XM 4B4HA 2WCSA 3BXWA 4PMRA 1O66A 3FDKA 3L5LA 4R5EA 3WF1A 1EA0A 1ZMDA 2ZZ4A 1DJXA 4LC8A 1KFLA 3CL8A 1LUCB 4LRTA 3WJYA 1XQLA 2NX1A 1QI5A 3NDZA 2QCGA 1TMHA 3WF0A 2PDKA 4LANA 2Z6JA 4DAFA 1GQJA 3KVJA 5AZ1A 4EMJA 2VFDA 2W79A 3IRSA 4H01A 1RK5A 5B80A 4XAGA 3VABA 1DWJM 3VNZA 3R79A 4A29A 4L64A 2P50A 1R9ZA 4XZNX 5BROA 4ENLA 1KCZA 4XZMX 2GSHA 5M1TA 4E5TA 1XLLA 4IF2A 1OFBA 3UWQA 3GAYA 3CT7A 3W7DA 1XYBA 2PC8A 4M81A 2Y2WA 1TX0A 4EQSA 4AD1A 3HTWA 3I7RA 5IBXC 1FQ0A 5CPNA 3W9ZA 2QMKA 2VENA 1QNVA 2GR3A 2XFRA 1P6BA 3B97A 3ARSA 1EKOA 5DT7A 3I3BA 3AMLA 1TTQA 1TVNA 1S1PA 1Y65A 2GJXA 1DIDA 3PZVA 5AOUA 5EB8A 2OEMA 3ARXA 1SJCA 3EANA 3JU2A 4FNTA 3S2JA 2E5AA 3A4XA 3OZMA 1WXJA 2AMGA 1B4KA 4EOUA 3CGBA 3LBMA 1XRVA 1S7MA 4W4QA 3VINA 4AHOA 3TW9A 3CASA 3NQ2A 3TC6A 3WJZA 5F4SA 4X22A 1EYWA 4POCA 3QVQA 1OG0A 3BC9A 2C14A 3LI1A 3P0XA 4M8UA 5FEPA 4AZGA 3GB6A 3NM1A 3UP8A 1P0EA 3MT1A 4Q8UA 1VHNA 2ZA3A 3UGVA 3MWAA 2A7NA 3WLJA 4EF9A 3LBOA 3DK4A 4P7LA 5A6BA 7REQA 4P5UA 4O1AA 2WSRA 1OFRA 4MLJA 4CQCA 3WLTA 2FH8A 2NWRA 3L4ZA 2WMGA 3UWYA 1FFVC 1RP9A 3DG6A 1XR2A 1ZXIC 2EJAA 2Y7FA 3CPUA 2E8ZA 1E56A 5EMUA 3TLLA 1DJGA 1XIEA 5TR3A 3AROA 3LB8A 1BRLB 3ZVHB 1E5NA 3CV6A 3SR7A 3HV9A 1C8QA 2BFGA 2OTDA 1UROA 4EP8C 5HUPA 4MDOA 1JF6A 5HATA 1VLIA 1P0KA 1KBKA 3E2QA 1SQ7A 3FKKA 2IPFA 4B2DD 2NQZA 4JL1A 1CGYA 3TROA 3N2OA 1UWRA 3JRKA 2G50A 4U2ZA 3DFHA 3SN0A 2E1DA 4RE2A 1TVPA 2FTPA 2ACRA 3L4VA 1YQ2A 3TWBA 3TFCA 4W8LA 2XWEA 1GRBA 3S3GA 2ZUVA 2GJLA 1C29A 3MSDA 3WDJA 5REQA 4HVXA 3MB9A 1NSJA 3BMVA 3DFNA 1XGZA 3NPXA 4IXHA 5DBTA 1ZX9A 2P53A 2JKEA 2X7VA 4UTHA 3DYOA 3NXLA 1R7AA 2BG5A 4EF8A 3IC9A 1B5TA 1NOUA 4PCSA 3TSBA 2PDYA 1B54A 1XHCA 3KLJA 2YDQA 3KOZA 3MP3A 3APGA 4S38A 4GQRA 2OQHA 1OWQA 1UKTA 1Q5MA 5DMNA 1G69A 2XU2A 4IX0A 1YPIA 2J7BA 1EB3A 3W7CA 1VBUA 2CWNA 5I2UA 1R86A 4W7VA 1AA1B 2X1IA 3C56A 1J6PA 2YSWA 3FG2P 3P81A 1H61A 2NT0A 4LVGA 4XD4A 4KFPA 3IVSA 4XIMA 1A5UA 2O55A 4MM1A 4U33A 1H1YA 1JAEA 1JUEA 1RHCA 3LZ5A 2E67A 4D2JA 3CTTA 2A8XA 1VFTA 3W2MA 1V02A 4GE8A 5FF7A 4AMAA 1ELSA 3HQ1A 1RPKA 3UWUA 1D8CA 3DDMA 2I16A 3GUWA 1EJUC 4M1RA 3HM7A 4IIEA 1FWCC 2WPCA 4AWUA 3G1VA 3TN4A 4BI7A 2YFOA 3EDJA 4GYPA 2QDEA 3RNMA 1RD6A 2HBVA 3JW7A 2PWFA 4MWAE 1SO4A 5U7SA 5XINA 1V03A 4E2VA 3TWAA 4M24A 1VIWA 3UJSA 4DNHA 1JCYA 4RXFA 4DO5A 5LHEA 1MUCA 4F40A 4G8TA 4DWSD 4H04A 4CUCA 1VQTA 4S3EA 4H4ZA 1TRDA 4Y90A 1WV2A 2FVKA 3QEZA 1UH4A 2VGGA 3HOJA 3N34A 2ACQA 3S6DA 5K9XA 1EJVC 3NAVA 3L21A 4KEMA 5CPTA 1JNEA 4GQQA 1A5MC 1CXHA 3FV9A 3O1NA 4GYFA 5C8BB 3TMQA 2VO5A 3CZLA 3A12A 5I3HA 3T78A 4L5ZA 4E8GA 1PYMA 1LRNA 3BJTA 3BDKA 4ATDA 3VIPA 1XC4A 2O4MA 1YNQA 3OLIA 4PTNA 1VBHA 3GFYA 4BI5A 3WF3A 1M7OA 4QQ3A 4QDMA 4EXBA 2V69A 3G6LA 2J13A 4L4LA 1VZWA 1XIDA 3C8NA 2CLKA 3EA1A 3N2XA 5BXRA 2NX3A 2A2IA 2X1RA 2G95A 4Z2HA 3ALGA 2HS8A 5A6SA 3KL5A 4RDZA 4FZIA 3WUGA 4H9YA 3G3DA 4DO4A 3PJTA 1UA3A 2EG6A 2A21A 1IR2A 3TAOA 1PUDA 2XGZA 4WX2A 5T9CE 2PAJA 3WEOA 4AB4A 3P5ZA 4US5A 1YEYA 2RFGA 4YCPA 3UXLA 3TAKA 1FWAC 3BK0A 2YLLA 1H7PA 4IPLA 4NAFA 5CBIA 3KFTA 3TYBA 1KFKA 4HNUA 1MO0A 3MKKA 2VWTA 2X42A 1RP8A 2FHCA 3GTIA 2D73A 5DRCA 4OOUA 1MW0A 4A4AA 1SJBA 2E77A 1TJ2A 3S1UA 2DVUA 2XSAA 1E15A 4ZOHB 1A5AA 4I9AA 3MU7A 4DNAA 2BMBA 4FX6M 2QYGA 4CQ8A 4E4PA 2Z1KA 1W6TA 1PHWA 2OLHA 1HNYA 3MBFA 1W9PA 2QCNA 1W31A 4NJKA 4NI8A 4HPXA 3OOQA 1V6UA 4N02A 1MNZA 4J2PA 4LB4A 4LRSA 3VFLA 4AWEA 2J24A 2WLZA 1N82A 4IG2B 3KP0A 3LGGA 3K13A 2O92A 1Z42A 4H3DA 1OIMA 3RGTA 2R8WA 2O9RA 3WZ0E 4H83A 3UD6A 3W71A 1XLDA 3WH5A 5JBFA 1Q85A 1EOKA 1PKYA 4LVDA 2MANA 3Q67A 3ABOA 5HMEA 2VCCA 3T4WA 2WKJA 3V7PA 1W5PA 3GVVA 4H4WA 1E72M 1UR9A 3LSBA 3HN3A 4QSHA 2WW5A 3T2OA 1OABA 3ZQ9A 3W7KA 4JKMA 3GD3A 2YZ5A 2ZC1A 4UQ9A 2QUMA 3ETRB 2FFIA 4DF2A 3BLEA 5KTLA 2CZEA 4O13A 1L6WA 1PYFA 2TMDA 4Z1AA 1E1EA 4MMWA 4H2CA 3NXFA 1JR1A 1CLVA 2C3ZA 4QNEA 3MMUA 4GVGA 5BRBA 1RA5A 5HWJA 3CWHA 2O9PA 2FGBA 3KVKA 1Z6KA 3OYZA 4AH7A 1KNWA 1HL9A 1XLKA 4MJ2A 2C1IA 4W87A 3S1XA 1TPVA 3BH4A 1FWNA 3E2RA 4DWSC 3U2OA 4F2BA 3WBYA 3DG7A 3EOOA 3U6WA 3NIYA 3UWVA 3WDPP 1O5RA 3GK0A 4JTLA 3DU0A 4GG9A 3Q45A 3MHUA 3PN8A 3BL3A 4D9PA 4P7OA 5A8NA 5LIUX 3HG3A 3AICA 3EWBX 2WJDA 1WBJA 1QPQA 1TA3A 2FH6A 3IVTA 4NXSA 2PDCA 3GDRA 4L61A 1LT8A 1AH3A 4NZ5A 3FK4A 2PU1A 1ZJIA 2NQJA 1A80A 3H2OA 4P61A 1VH7A 4TX8A 5DXXA 3TJIA 1UUMA 2VCBA 3IK4A 1U83A 3OA5A 4O14A 3MUZ1 2GPTA 1B3YA 4MB4A 1FEBA 2VZUA 3MP5A 4LAMA 2XIIA 4DBDA 2IQDA 3NL2A 1VFLA 3GDKA 3SY8A 1C91A 2TPRA 4U31A 4M56A 3M9YA 3ABZA 3WF4A 4HP5A 4NY2A 4Q4PA 2GUUA 2YCEA 2JGYA 5KINA 3TR9A 2NX9A 1B57A 4XZWA 4UTKA 1EO7A 2ISFA 4WDUA 4LVAA 2YBTA 3CZKA 5IM51 1SZNA 2DSVA 1J2WA 1K9EA 3FIGA 3QHMA 3HPXA 1VJSA 1OC6A 5KVHA 2GVEA 3BJSA 4B9ZA 1PCKA 4F8XA 1TJRA 2H3BA 3AQUA 4GY7A 5C54A 3XIMA 4YMZA 3PBMA 2QS8A 1GTEA 3T0AA 1GW9A 1JYVA 3B0XA 4JTRA 3B8SA 1ZP3A 4UFMA 1EJTC 2NSOA 2EEXA 1R2RA 2H9AB 3H8AA 3HMCA 1QBBA 1ZALA 1A5KC 1XLBA 5IFPA 3ITTA 2EPHA 1LQ0A 2D24A 2EBNA 3SSJA 4RJEA 2J3NA 4WY0A 1XDLA 3BLPX 3C2EA 4K8DA 4FX9A 4WIWA 1VFMA 1BSIA 4X63A 1HKIA 2C71A 5LNUA 3S83A 4AZBA 4IM4A 5C0QA 1SFLA 1RY8A 1E71M 4RUBA 3GRTA 5ABTA 4KW2A 4B3LA 1CXEA 2Y5SA 3UR5A 3HPSA 3W6LA 1F74A 3MTWA 5C5YA 4MY9A 3TQPA 4AFYA 3AMKA 1RCXB 3MI3A 1RJRA 3T8QA 1Q1WA 3K46A 1NDWA 1J0IA 1YDOA 2GJXB 3PS7A 3N2TA 5B7YA 2VRJA 3M5VA 3KUMA 4GABA 5FJOA 3W1AA 2WK2A 4X60A 3MUY1 3W81A 2P0IA 4MHBA 1S1RA 4N9CA 3PZ9A 4NRRA 5BMXA 5G5HB 4JFWA 2BOFX 1E55A 4EVZA 2VR2A 4NRSA 3KBNA 5LGXA 1MMFA 4QJ4B 3LTYA 4BKNA 4S3BA 3BPWA 1W1A1 1IHIA 1R8LA 5KZEA 1KRCC 1CXIA 4QRNA 3KRZA 2UY5A 5U25A 1ZJAA 1TR1A 4BEUA 1LOLA 4PR4A 1JAKA 2GVYA 3PJWA 4JTEA 4B91A 1CX9A 7REQB 2VKZG 2IKJA 1E1CB 4DJFA 1KC7A 1W3KA 4RL3A 1W56A 3WLNA 2HWGA 2QAEA 1XICA 1NOWA 2J8TA 1X8CA 2EQ6A 3RMEA 2A6NA 2VZOA 1AJ0A 1MSSA 2BB0A 2JEQA 4J4KA 3DI1A 3QC0A 5JQ9A 7CGTA 1GOOA 3VGDA 4A3YA 1YBQB 1L2UA 5M17A 2GQWA 3SUWA 2VUNA 1JDAA 3EB2A 1L8PA 3LPFA 4J40A 1UZDA 3WLQA 1QVBA 2ALRA 3OQ8A 4JZ5A 3M41A 1QK2A 5I02A 1LG2A 1QNPA 3TXZA 4C6IA 4QLLA 4Q4KA 3LCIA 4GISA 1UPPA 2ZUUA 3MKVA 3SURA 1J0KA 1GONA 2VL4A 2XN1A 1DXLA 5A5WA 4FEZA 3PVFA 2RDWA 5GJMA 1FWJC 3S4TA 5J5DA 1BGGA 4UTUA 2DZBA 2WQDA 3QQ1A 1OC7A 3H2NA 4NSBA 3KW3A 2FDMA 4LX4A 4Z08A 4PGLA 1FH8A 4IXXA 3NVTA 4B3ZA 3SR6B 2EF9A 2V30A 3U0HA 1H4PA 5HR7A 4E0CA 3C0SA 2J88A 3LB0A 4FLOA 1E4IA 3NGJA 4G7FA 3LPPA 1W5MA 1H5YA 1EBHA 4YLWA 3SJNA 4Y9OA 1JYNA 4KWVA 4IMCA 1VYSX 4LV4A 4H9TA 3BCJA 2WOQA 1X7FA 1KWGA 5G2IA 3LA4A 3N9RA 3SB0A 1S3TC 3G1YA 1FCQA 2Z1WA 4O8AA 1SW0A 1XDJA 1TV8A 3MV11 4H4RA 3M43A 2J7FA 3MMDA 3UPMA 3HGRA 1LWJA 1VPYA 3ZJ6A 2VR4A 4JIQA 3U7VA 1C93A 3NQDA 1X98A 2GUYA 3SCVA 4DX3A 2RKXA 2WO5A 1F6YA 1UASA 3HGSA 1X6NA 3NZQA 4Y9NA 1K9FA 4ZR8A 3U5YA 3OJGA 4EANA 3CO4A 4PL2A 4O0KA 3IJ8A 1GTHA 2XH2A 3OZYA 2X1UA 1DIEA 1I0BA 4GBDA 2XM1A 4QS5A 5AKQA 5C71A 1O12A 1K4GA 4AQLA 3CGTA 3E1F1 2YYUA 3PAOA 2Y1HA 4A3HA 3C2OA 3CJPA 3BG5A 3GBDA 3THDA 3FJ4A 1TV2A 3AIEA 1LP6A 4QDPA 3MI6A 2V2HA 1XYMA 4GVFA 1TUFA 2E0PA 1E43A 2QJGA 2V5DA 4L4MA 3UU0A 3H70A 1R9YA 5JIPA 3UXDA 1TPDA 4PMYA 1W9VA 1EX1A 4LW7A 3GNPA 5BNKA 5D2YA 2NVAA 2R24A 5CH9A 5JBEA 1PX4A 4AD2A 1YYAA 1FCBA 3BQ6A 3DI0A 3N6QA 4L1GA 3BMWA 1VEPA 5GPRA 5DBUA 1CZ1A 5E6YA 1DQWA 3MJMA 1DTUA 4ZO6A 1S2UA 4FNPA 1A47A 1X96A 4HMEA 3V5CA 5A6LA 3TJLA 2PP3A 4IOTA 1YHTA 5D8ZA 3WLIA 1UW9A 4QISA 5CPLA 5I3KA 3LXBA 2JKPA 1XBZA 4Q7BA 1CTNA 3B8IA 3UNTA 3GSMA 1LVLA 3GW0A 3AIUA 2VFHA 3KTCA 3ZZ1A 4FLRA 4D1IA 2V5CA 1NDVA 1M41A 1K9DA 1V0LA 1TPC1 4INFA 4UCGA 4AIEA 1OCQA 4JCMA 1K6WA 1DWHM 5D09A 4EACA 2D2JA 3IWPA 4IGHA 3TEVA 1MXSA 2DZAA 4M1BA 3N4AA 5CBBA 3IARA 4Q7IA 5EGRA 1QU4A 1U5VA 3OLDA 5AC6A 2DUXA 1D7FA 4XK2A 5GQBA 2ALDA 2G3NA 3F4WA 1W1B1 2E40A 5AVNA 4GI4A 5KZ6A 3E3HA 1LCOA 3N18A 1AQFA 3WQ8A 4GIAA 3E02A 3BG9A 3TXVA 3O3RA 2X40A 3C5QA 3DYPA 3O16A 3U2ZA 3A22A 2XVNA 1UWIA 1XRFA 4GO9A 2VTFA 2IPJA 1F3WA 1I2RA 4DBEA 4V1XA 2XWDA 1JUBA 5K2ZA 2E5DA 2ZQ0A 4DUWA 3DIPA 3QRHA 3SCNA 1JRCA 1WP6A 4I90A 2XGBA 4DLMA 3INPA 1NFPA 3GXNA 1CLXA 5I0DA 1K1DA 1YLVA 4RZBA 1XLIA 3H2EA 5A8MA 5CXPA 1Q7QA 1D7YA 1WAUA 4YWIA 4M6QA 4LB3A 1TWZA 4MVAA 4JTSA 2DW6A 4HMDA 4V15A 1W3IA 4BV6A 2ZZ3A 5C6MA 1DXFA 3MO7A 4NQ1A 2PDXA 1DWIM 1WUFA 3VCRA 3SIMA 4WF7A 3GTFA 2QCLA 1N8FA 4JCLA 4M5PA 3C2RA 4REQA 2ZRZA 2WHLA 2FJUB 4OECA 4UOJA 3TYAA 5A2CA 1MRQA 3NVVB 4JQ9A 2X0YA 3L0NA 1H63A 1LLOA 4NI3A 5ABFA 4D6JA 1KFCA 3MYOA 5EA9A 1T3QC 3E9AA 3KOYA 1GGOA 4I8YA 1ONRA 4UBPC 2OVLA 3EX4A 1H7XA 3NPWA 4MPKA 1HP4A 1OYCA 3AYSA 4FXJA 3N3MA 3VOHA 1E51A 4C1NA 3OP2A 3MP4A 2XIMA 3N3TA 3HGOA 3WBAA 4DWSB 4TVYA 3R8HA 3E49A 1XYFA 1I0DA 3I3EA 5HINA 3W70A 2PI6A 1ZY8A 2X8GA 1BVNP 4H4VA 1LL4A 2R14A 4P8UA 3GO2A 4RW5A 2VC7A 3B0VC 4G1KA 3IIOA 2E7FA 1PIGA 3EXRA 1E6QM 3NFUA 4H9XA 1KM1A 1Z9AA 3LCFA 5D9PA 3RUBL 4MB5A 4PUMA 2ODOA 3TTYA 2WVSA 4DI8A 3A21A 2HK1A 4HZ7A 4CN4A 1AQ0A 4IQDA 4E2OA 2X50A 4YIWA 1QO2A 1SFTA 3WQFA 4XSMA 1E9ZB 4OQVA 3PNZA 3EKGA 1XWYA 4AEEA 5LHFA 3CAKA 2D0HA 2A1YA 2HQAA 1JI1A 3TYEA 2EQ7A 1ZGDA 1MQPA 5CC6A 1ZMCA 1F4HA 3RU6A 4XSLA 2V63A 3DFPA 3CHDA 3ITGA 1H51A 4Q8QA 3I6RA 3TR2A 1FHLA 3H6OA 3QOMA 1VPXA 2PDPA 1PB0A 1IEIA 1SFJA 3AMZA 3IV8A 3OZPA 3VUSA 2V2CA 2ZDSA 3O07A 5H8UA 3RDKA 1Q6DA 8RUCA 3LGDA 2ZTKA 3B8DA 4MNMA 3ORWA 3ABQA 1FXPA 1DJWA 2QHAA 3FFSA 1GJWA 2O0TA 2BWGA 1SZGA 2L5HA 1HJQA 1Z41A 2GOUA 1RAKA 2ZZBA 2WVVB 4QLKA 1W9XA 4GZIA 2NXHA 3WEZA 1UBSA 1IZKA 1KLZA 1LBFA 5I06A 4WK9A 2F2KA 3G3MA 3GTNA 2ISWA 3KCLA 1TPH1 1GSNA 3AALA 5A3HA 2Q09A 3UR8A 3BVJA 4JTAA 4FHAA 4WHBA 1LQAA 2PFHA 1CECA 4NEVA 1FP8A 1TPUA 4LS0A 5BOEA 2PD9A 1NQ6A 1DXEA 3U4AA 1H2IA 4Y6GA 4A8IA 3KRSA 3TX9A 1MFVA 2J78A 3W1UA 3UGRA 3LMYA 3NQ7A 3IJQA 1EYEA 1CGTA 2BVTA 3B9AA 3OBKA 3OPSA 1KCLA 4WY0B 1JEHA 1A3WA 4GH3A 4RZ4A 3WD4A 3MHFA 3DGRA 2NPXA 5C9UA 3G1SA 4RXGA 3E0VA 1BVWA 3LCWA 1M7PA 2DZVA 1DIOA 3R2GA 1XGEA 4XKYA 4TO8A 1G9HA 2BZNA 3BLFA 4NNBA 2P10A 2QCDB 5EKYA 4R7JA 4DF0A 5JCKA 3WQGA 3PUGA 2QVNA 4EK7A 1A5NC 1L8NA 1UG6A 5BRQA 3A9BA 5D2VA 2C1HA 5K9CA 1NWSA 1W1ZA 1KO0A 2WPFA 1S5VA 2AAMA 1AW1A 3KTXA 1JVNA 3TC3A 3LRKA 2GYIA 4OTKA 3N9KA 5D4YA 3H55A 1F6KA 2R9RA 2F6XA 4ILSA 4QIUA 3PG9A 1QATA 1GQLA 3NDOA 4GY0A 3DC8A 3CB3A 2YCKX 3PP7A 2ZRXA 3CUXA 2J6XA 4CQBA 3TMLA 1E73M 3P7YA 3AO0A 4LS1A 1S38A 2CZ5A 1VEOA 2AKMA 2E6AA 3TFXA 1FBAA 1FWRA 1VC4A 1DIKA 3ZT7A 2I5IA 1J5TA 3N9SA 3QPYA 1XRSA 2R1KA 4OV4A 4J3ZA 1GREA 2Z26A 2HEJA 2QUVA 4GIRA 1LZOA 4PUUA 3GDLA 3VKDA 4XZIA 3KBWA 2DSZA 3R1ZA 2WWDA 2W3SA 3A3XA 2QV5A 2IKHA 3R0KA 4HMCA 1EEPA 4XBSA 4LQ1A 4PTWA 5TF0A 3W07A 1ITCA 3RJXA 4ERAA 4NHVA 1BQGA 3GUGA 7PTDA 1L2QA 2X1SA 2E3ZA 1DPMA 4J3UA 1E0VA 3Q37A 1JZ7A 4R7WA 2BNJA 3ME3A 3EOLA 3EWUA 4J3TA 1EH9A 1W1TA 2NSXA 2DV0A 5H6HA 4JDBA 1EJ7L 5BOOA 1ISXA 2J9XA 1NH6A 3W2LA 1LF1A 3W2UA 5FMHA 1M9HA 4TX9A 1K8ZA 3EKLA 2OEKA 3SUVA 4AZHA 1B4EA 1Y0EA 4MNJA 3UWEA 1FXQA 3KRUA 4ZENA 4OFCA 1PWMA 1I1WA 1OFPA 4DUVA 4RKAA 4BHYA 2DSUA 4IJBA 3LHUA 3GXFA 4TTUA 3AIBA 2GJNA 3TYCA 3PM6A 3DYMA 3QFAA 1E0UA 5IDIA 2G96A 1OX4A 1HKKA 3WFZA 2Z24A 5FS9A 3HQNA 1ZY9A 4UCFA 3SCUA 3GH7A 2XSBA 1GVRA 4RV3A 3S42A 3NPUA 1IXNA 3WQ5A 3UCDA 1WQ5A 3AIQA 4UTLA 4I5XA 3IJ9A 3IIZA 3ZR4A 1A0DA 1LROA 4RCXA 3PF3A 1GVFA 2QJNA 4NF7A 3WEMA 2IKIA 1M5WA 2OX1A 3VKBA 4UQEA 1GQIA 1PXGA 1RLCL 3NGFA 2WNQA 4E4FA 1BFNA 3P84A 4F2TA 3N4FA 1H7NA 5ABEA 2Y5JA 4JHZA 3WNOA 2QIIA 4MSSA 4BCEA 1U22A 2ZOXA 2WP5A 4KWUA 1IXQA 1Y7VA 3AMDA 4JTHA 3GH5A 1LWHA 4GJIA 3TVAA 4UFLA 3WJSA 3QMRA 5AB3A 2W5FA 4IIDA 3WQCA 3WD3A 3RPDA 4QITA 2YGYA 2V3EA 1VBJA 1P0BA 5G1TA 1J11A 1PZ3A 3SGZA 3HO8A 1P1XA 4ZQOA 3W2KA 1V3IA 2AL2A 4TU1A 3STEA 3THCA 3LHZA 3EWCA 3LEPA 4DO7A 1C90A 1TCDA 1JDCA 1OADA 5BWFA 4DPPA 4QFUA 1FWIC 1LRQA 4B5TA 1IT8A 5KZMA 3G0SA 4R9OA 1JXKA 3VOFA 4H4SA 1HXJA 2X8HA 1REQA 2UBPC 1DHPA 3PWIA 2FB3A 3WQWA 3IS4A 2J6VA 4WCJA 3W7RA 1KKOA 1TZ7A 3G18A 3GRSA 3B05A 4XZ9A 4NAEA 1HKWA 1R3RA 5CPSA 4LNYA 3LV5A 1I2PA 1VENA 2YLAA 1FWEC 1XPGA 2J27A 3SGUA 2BDQA 4IX2A 2CBUA 2WOVA 1I45A 1UP0A 2ZX5A 3CK5A 5CC5A 3HFTA 5I3GA 2PDWA 1DYSA 4NJJA 4YVXA 2C8NA 1EOMA 1S3HA 1QI3A 2GGJA 2WVTA 1PKLA 1TPFA 4CQAA 2GRTA 1T6MA 3W25A 3G5EA 3GVRA 3STGA 4ORMA 2OSXA 1KRBC 1QMLA 5EMKA 4BF7A 4KPLA 3KS6A 4YHEA 4AF0A 3W1LA 2VRKA 2WC7A 2JEPA 2BOGX 1NARA 4IFOA 3Q65A 1Q2SA 3SQLA 2ONEA 2BS9A 1DP0A 2VD9A 1EIBA 2QNEA 2YW3A 3WQEA 3KLKA 1PX3A 3ATYA 3S2LA 3TYZA 3RFAA 2J4GA 4PB3A 5L9FA 4S3CA 3OYXA 3QW4B 3GDBA 3N15A 2NLIA 3W72A 4PCFA 3OG2A 4TVCA 4LBUA 3H22A 2DT3A 4JX6A 4QS6A 4BK9A 1IF2A 2E68A 5I23A 1NDAA 1RR2A 4HJWA 4LYPA 4GUGA 3QV9A 3W38A 2VFIA 2F2HA 1LYXA 2PGEA 4LY8A 2Z2BA 2DZWA 1XSKA 2OOGA 1C7TA 4WKHA 2E1WA 1MRAA 4B5SA 2PWEA 3IV3A 1LPFA 2GQ3A 2F38A 1G5AA 1QW7A 1VQZA 3RILA 5HA7A 2VQUA 4UTTA 1I9CB 4MY1A 2QCHA 3QFWA 1OX6A 4HSHA 3L7RA 1UR4A 3MV01 4YCOA 3QJAA 3IIXA 2OKTA 1TELA 4JTUA 4NUWA 3XINA 1GORA 3PPGA 2YA0A 2OWCA 1XBVA 4DM1A 5IFTA 1XKYA 4REQB 1TPB1 3KCJA 3JUGA 5FF2A 1TWDA 2C0AA 1X1OA 3BARA 4QEEA 1I2NA 4YTRA 5C9ZA 2BTMA 3O6YX 4XX6A 1TYPA 2X2GA 3GFXA 3PK7A 1X97A 5A6JA 2X09A 2AOSA 1IV8A 1NM9A 2O7SA 3P6LA 3UZWA 1P7TA 3HG2A 1V79A 4C1NB 5ECVA 2XIQA 3KCOA 1N8WA 1TTJA 3BW3A 1G7UA 3G1DA 5IXEA 5F4WA 3UWZA 4DB7A 4AIOA 2GWGA 3QXBA 3SCPA 3FAXA 2E5BA 3QH2A 4PE8A 7A3HA 1H3GA 1R3SA 1ZKQA 3O2LA 2QDGA 2HISA 3EWYA 5A8PA 4X2RA 4S3AA 4HSNA 2Y70A 4ICNA 2XSXA 3VCCA 4HOXA 1A5CA 1TQXA 5DRIA 3GXTA 4BWLA 3WMBA 4PMZA 1Q7MA 4LUTB 3F2BA 2H8XA 1FHVA 5E09A 2Z7KA 5HANA 1BSLA 3RK8A 2ASHA 1BXBA 1SW7A 3W2JA 4OU1A 4TVUA 1LDCA 4FF5A 3K5XA 4HPJA 4NILA 3IUDA 1OIFA 4HCDA 3BQ5A 3TOPA 4M19A 1SSGA 4URIA 2HXUA 5I09A 3TCEA 4M7TA 3K4WA 1FP9A 4FPSA 3WH6A 1J0HA 4FXRA 4PFHA 5A8GA 1NFGA 3PZGA 3M46A 3RX4A 3V35A 1R6WA 1NPXA 4UMBA 1JFHA 4AD3A 1UH2A 2R91A 1FWTA 4L56A 1WDRA 4JTCA 4QAIA 1US0A 1ISVA 3LLFA 3BE7A 4KRUA 4L4PA 3AAMA 3U4FA 3NYDA 2CITA 3WK3A 1E6RA 4F0KA 3W7EA 4HYWA 1V3HA 2OWXA 1UR0A 3NNTA 3EX6A 1A50A 1BVZA 1KBJA 3FX4A 2PDNA 3HRDC 2YYTA 4UQAA 3PPCA 1Q6EA 2X16A 1ISWA 2WMKA 2Z29A 4LALA 3I6EA 2YL5A 5JU6A 3MQTA 3BLDA 4CVUA 1XS2A 4HZ6A 4PUNA 3EBVA 3J7HA 3IANA 4CD8A 3BTNA 4RK8A 4ACYA 1GZJA 2TAAA 1ZU8A 3RRXA 3ZJ7A 5A95A 4Z2GA 4PUKA 3VD7A 2NXGA 1HL2A 4M80A 1JQXA 3TJXA 4CQ9A 1L0PA 1D3GA 2I56A 1H5VA 4HNLA 2VEPA 4O10A 3GC2A 4WLCA 4GYKA 2QJJA 4JQAA 4AHPA 3VUPA 1XHGA 3GWQA 3KBSA 3VKCA 2F9RA 1F9CA 6REQA 3MJYA 3GD4A 1W1VA 5EYWA 1IEWA 3OZOA 2C1GA 1E6NA 3KXQA 4XTDA 4HU3A 1Q13A 3ARPA 1VBRA 4XKYB 5DT5A 4ZXLA 1XH0A 1TV4A 3GXDA 1J79A 3R07C 4LCSA 4U28A 3EEGA 3OVRA 1I4NA 1WXZA 4C6PA 1QR7A 1QHOA 2XVLA 4PSRA 4H4UA 2VEIA 4QXIA 3Q6JA 2J75A 2QF7A 3TDFA 2CLPA 2YL9A 3MZNA 4QX4A 4GQBA 1OY0A 2DT1A 2IS7A 3RIKA 4S2CA 3SGGA 1W3HA 2HE8A 1QCWA 3SN4A 4DZAA 4JFUA 4XAYA 4CD5A 2DIEA 4GRSA 4S23A 1EDTA 3USZA 2CDUA 3Q2DA 1W1IE 1F73A 2BXVA 3ZFHA 3HG5A 2BLEA 2CZDA 3S9YA 5A1AA 4UC5A 4PULA 3R25A 1O5XA 2XISA 2HNHA 2PGWA 2XGIA 1TZZA 4UMAA 2G0WA 2VGIA 2OYMA 1KRMA 2WBAA 3PZUA 3MUXA 3W27A 2Z7GA 2PRHA 1JZ6A 3II4A 2QUUA 4G9PA 4GCXA 1SYTA 7XIMA 4FOJA 3CUIA 4AG0A 5AC5A 5LSMA 3VNIA 4LBSA 1EDQA 3W86A 3OVPA 2FJKA 5EFFA 5T9BG 4US6A 5LA1A 3CL6A 2X1TA 3SY1A 3MSGA 1RQHA 1MW2A 4B5XA 1FKXA 1J8VA 4PUWA 3WLOA 3I7SA 1KA9F 1E5JA 5G4WA 1Q66A 3C3UA 1JEZA 1C92A 4ZFMA 2YQUA 3OU8A 4EAYA 1TFVA 3VKAA 4IICA 2DSKA 3B9JB 3PBUA 1CXLA 2XVGA 3HFYA 2ACSA 3QV8A 2IPGA 4XZLX 4XAFA 4IMAA 5GNZA 1GPWA 1ZZMA 5AHIA 3PHAA 1NY1A 2FZ9A 3R8RA 2YPIA 2A7PA 3GC4A 1S2TA 2ZXDA 1E0XA 1V6YA 4C90A 1AMYA 2W4XA 1YW1A 2V5LA 3RCMA 1D2KA 3NVDA 1K4QA 1RLDA 3E12A 1EO5A 2XHYA 1Y8BA 1BXNA 5FAJA 1XIMA 3ZVHA 2V5BA 3CH9A 4OBRA 2Y89A 4ZVJA 3T09A 1YKWA 3VCNA 1VB9A 3IUIA 3UNDA 1FH9A 1GV4A 1XLGA 3VMPA 4O19A 2EQ8A 2QMJA 4Y2WA 1JI2A 2W9MA 4O4VA 3C8FA 3A4JA 1KCKA 1NVMA 3UW6A 3CS2A 3K1GA 2Z0IA 5C2GA 2OLSA 2WNNA 1NF0A 3UZXA 5D03A 4R3UA 3SW6A 2DZUA 2OT0A 1UP2A 3COTA 1LOQA 5FJUA 3SZ8A 1LWIA 1E0WA 2J62A 3STPA 5J5RA 1QBAA 1AG1O 4FR6A 3W02A 4CU7A 1R9XA 3SO7A 4UNIA 2QKFA 3KDOA 4GKTA 6PTDA 2B31A 4IFKA 3UR2A 1JZ4A 1GG0A 1HKMA 5BU6A 2A3HA 4U3CA 4DBSA 3TTOA 2OXNA 5FA5A 5FSEC 1PE1A 2E8YA 4W5ZA 3AS2A 3RN6A 2GH5A 2XINA 1KM5A 1CEOA 3OTRA 5C2XA 2W3RA 1V0MA 3WLPA 3GKFA 4OBTA 4O1BA 5JRBA 4R88A 2DP3A 3FKRA 4DJDA 4C6NA 4HJFA 1G4TA 4Q4OA 3B8WA 1RXOB 3MO4A 1O1ZA 2ZE0A 4HU8A 1GKRA 3BW2A 2XH0A 4Q7NA 1BWVA 2XZ9A 5CLTA 5A6KA 5G1MA 1M53A 1VFFA 5F7UA 3W88A 2OGJA 3WNMA 3ITVA 1Z44A 2CC0A 5FACA 1U33A 1RV8A 2FLIA 3OIHA 1E4NA 1RJPA 3NYZA 4WQ6A 1M68A 2OU4A 4MZYA 3NG3A 5DQPA 4LCRA 3WL0A 1LLWA 4ATWA 3GY1A 2ZUNA 2YA1A 1W17A 3BAXA 3EAUA 4QG6A 2PDMA 5CLWA 4LSBA 4BEQA 4IIHA 1XC6A 1TJPA 1KM0A 3V4BA 3EMZA 4YS1A 2YCLB 5U4NA 4O50A 1WPCA 2R1LA 4MG4A 3ARYA 3W22A 2PUZA 3VFCA 2WPEA 3R94A 5MKGB 3NDYA 2VNCA 4WJEA 4D71A 1E0TA 3WMCA 3ZJKA 5HK4A 1V51A 3CAVA 4NYUA 2MUCA 3GFZA 1NWUA 2PU0A 4RE0A 3IAQA 4HU4A 5F2IA 3BWWA 1ZB5A 3KVMA 4UUIA 1FY6A 2HMCA 1FX6A 3S1WA 4I7VA 1ODZA 3QZEA 4QCEA 2F5ZA 1F8IA 3ABXA 1ZRQA 2DEPA 5I77A 4H6KA 4PMOA 2E09A 1TE6A 4CGTA 4A3QA 3VIJA 2C3CA 1TUXA 4F0RA 3HZ3A 2CIPA 5A2BA 3G2GA 3S46A 3LGEA 3MUAA 1YXYA 1XBXA 3M0KA 3BLKA 1R47A 4V27A 1TREA 2G41A 3RR1A 4BURA 5DO8A 3VOIA 5G1YA 3F7JA 3O15A 3OVGA 2YB4A 4XQ6A 1RJQA 2Q6ZA 4TX6A 1OINA 3VXGA 1V6XA 3HJZA 3CLWA 2YL8A 4TVWA 2A3CA 2WNWA 3AWOA 1RA0A 1J9YA 3CUJA 3FOKA 3NQBA 3G1HA 3W24A 2G3MA 2QIWA 4Z1CA 1C9DA 3V18A 4D6DA 3FYOA 2XN2A 1V3MA 3M0XA 3VZXA 2XTKA 3AJXA 5G4EA 4H50A 4N42A 3T9PA 2VX7A 3C86A 3T7VA 2VFFA 3PAJA 3BSGA 1ZAIA 1K6AA 1T5AA 2Y7GA 4IT1A 1K9TA 3S1VA 4I5RA 1AK5A 5FSDC 1DQUA 3CWOX 3CBWA 4CD7A 2YXOA 3B8VA 4AEOA 2CHOA 2G4FA 3L4TA 2FVLA 1OJTA 3MBDA 2AQWA 1PZ1A 3GHRA 1SO6A 4CN1A 4UQDA 4ZQCA 2UY2A 3ZXWA 2NUWA 1AH4A 1FA2A 1UOZA 2CZVA 3LSCA 3KDNA 4EPBC 4PMXA 3GR7A 3G1AA 5EMMA 1WE5A 1W37A 1P7TB 5HAOA 3ZT6A 4JKKA 5I00A 1O68A 4GC4A 2Y24A 3ABRA 1Z89A 3WKZA 4ZMGA 1WKYA 1LBLA 1FCUA 1E3XA 2V3DA 3SFKA 4XUYA 1IXOA 4XTIA 4J3VA 4BS0A 1H41A 2GFTA 1W8SA 4JFTA 1V3JA 5JCLA 3MUCA 1HT6A 3HMJG 1PTGA 1Y5VA 1H0GA 5ENLA 2VRQA 4NZ3A 2ZZ5A 1Y5XA 3DBNA 4DJEA 1R3VA 4HTBA 3FXYA 2RDUA 3BANA 3H7RA 3GNOA 1GOKA 5C2CA 4NJHA 1X6UA 2YVGA 4ZB2A 1LT7A 2HS6A 3L5OA 2E28A 2YDSA 3W7QA 5C7HA 1QOPA 3PZNA 3BAWA 1XD0A 3GW3A 1EX5A 1VYRA 5EBUA 4YN5A 1YNPA 4Q8WA 4RX0A 3EOSA 3QHNA 1W5QA 2P0OA 3AJ7A 4C91A 1PL9A 1UD2A 3VD4A 4AU0A 3LXDA 3WDQA 4MWAA 4F4RA 2FKPA 4L9ZA 3RCYA 1GEUA 2QDHA 3QKZA 1DV7A 2WBKA 2BHZA 5EPDA 4LCQA 1WZAA 2C15A 3VYLA 4QLJA 3TA6A 1OB0A 4JEQA 1PS9A 4D72A 3LNPA 4OUIA 1PJ9A 1OVDA 1AZ2A 1CXFA 4PEKA 3LENA 5C55A 2WCGA 1RPXA 3CUFA 2FFCA 1IT7A 2PTXA 3BUVA 3PTKA 3VIIA 1GRHA 3W73A 3RYSA 1R3WA 3R13A 3GZAA 1OGGA 4KWOA 1FFQA 5EMLA 2D23A 3AIWA 1TJ1A 4LAUA 5AC8A 1HG3A 3KBJA 4NX5A 3UF9A 3WD0A 1J2BA 4M51A 3TV8A 5ER0A 4C1LA 2WMIA 2VFEA 3BGJA 3VIKA 1P6WA 1Q8JA 1H50A 5AC4A 2VD8A 3GNRA 4IUOA 1A4MA 3BW4A 3UZ5A 1TG7A 3H24A 3N17A 3C2FA 3CZEA 5F2LA 1M65A 2PLCA 3AC0A 5D2WA 2Q3RA 4PCPA 1QOQA 3GLCA 1EBGA 5GNYA 1LBMA 4AVOA 4PL1A 3LNMA 1T99A 3SI9A 2NVCA 4LNCA 2B7OA 5HJLA 1G67A 3CV2A 4GPNA 6TAAA 3M5YA 2Z28A 3WLMA 1JF5A 2VCAA 1R2TA 3DG3A 1V6TA 2IXUA 3REQA 5E70A 3UCCA 3W76A 3A7UA 3AHVA 4CD4A 1YXDA 3GR4A 3PTDA 1OFAA 4CNPA 1S2CA 3EPMA 5IBXA 3S5YA 2QUNA 3W7NA 4PBFA 3O0KA 1BKSA 3L66A 5XIMA 4DQWA 1UR2A 3TQKA 4L1WA 2H9AA 3L4XA 4G2DA 3F5LA 1B3ZA 1SR9A 3GVWA 3S1GA 4DBUA 4IMFA 1KR0A 5FEZA 1KV5A 4HGXA 2BHYA 3VNJA 4K8GA 4ZEPA 1WX0A 2XUCA 1E9YB 1TV3A 3W7GA 1IQ8A 2ESCA 5AHNA 4J9JA 5BCAA 1KFWA 4GRTA 2JALA 1UOKA 4ADTA 5FAGA 2I1OA 4ZOBA 2ZWYA 3I10A 4W8BA 3B4YA 3VGEA 3SSZA 4HOWA 4X0NA 3W1NA 3EPOA 5HMFA 3VDGA 4PTVA 1CLKA 3ARWA 5BMWA 1G0CA 1UIPA 2V82A 2OLAA 1KWKA 1BQCA 2XFFA 4XIAA 1FWGC 1IZJA 1KM3A 5LZLA 1SJDA 4OV9A 3LCXA 1XV8A 2HBXA 4HMNA 3QGVA 4KT2A 5HQEA 3DFSA 4WSJA 5M03A 4FF7A 2CLOA 3PG8A 1W5OA 3QLDA 3F5KA 3C2VA 3THQA 2VEKA 1H2JA 1YDNA 2J7HA 5IHSA 1N63C 2CWXA 5CZTA 2OZ3A 1QTWA 4ZXOA 1EC8A 3EX3A 4HTYA 4KCWA 2FB2A 3OGSA 1E1CA 1WZKA 3NS1B 3SRHA 4TMCA 1AOGA 3GIYA 3UERA 1J10A 3OODA 3M0JA 5D2TA 1GERA 4NVTA 3CYJA 3DJJA 3GG0A 3UVIA 4ZO8A 1EEXA 2X8RA 3LXAA 1KR1A 4TV5A 3T40A 1IIGA 1UZ1A 1YBQA 3ZS4A 4J28A 3H4WA 1TR9A 4JN8A 4F0MA 3DH7A 2C91A 3SRDA 2DT0A 1ONFA 1V4YA 4IFRA 1TWWA 1Q6FA