3VCCA

Crystal structure of d-galacturonate dehydratase from geobacillus sp. complexed with mg
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
386
structure length
386
Chain Sequence
LNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF D-Galacturonate Dehydratase from GEOBACILLUS SP. complexed with Mg
rcsb
source organism Paenibacillus sp.
molecule tags Metal binding protein
molecule keywords Mandelate racemase/muconate lactonizing protein
total genus 134
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3vccA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3vccA01
4MKSA 1ELSA 2P88A 3TOYA 2PTWA 3CK5A 3T6CA 3UJSA 2PS2A 3DG7A 1KKOA 1SJBA 3VA8A 5EU9A 4DN1A 4IP5A 2P8BA 4JN7A 1WUEA 3GD6A 1DTNA 3IJIA 1EBHA 4FI4A 1TE6A 3I6EA 3DERA 4H1ZA 4HNLA 3UCDA 4DHGA 3GO2A 4H19A 2P0IA 2I5QA 3TQPA 2PU1A 2OPJA 4J3ZA 4M6UA 3VC6A 3BOXA 2HZGA 4GIRA 2XSXA 5FJTA 1KKRA 4GGBA 3OPSA 3RITA 1R6WA 1WUFA 2RDXA 4HCDA 1FHVA 3P93A 2DW6A 4ZCWA 2P8CA 4GMEA 3SQSA 1PDYA 1L8PA 2PGEA 3S47A 3FCPA 3SBFA 3EEZA 4G7FA 4H2HA 2P3ZA 3V5FA 2OZ8A 1EC7A 3FYYA 3GC2A 3MWCA 1KCZA 2FKPA 2QJNA 3RRAA 2GGEA 3PFRA 2QJMA 4IT1A 1MNSA 1E9IA 1PDZA 3UGVA 2OG9A 1SJCA 4ROPA 4E4UA 4KWSA 4A6GA 3N4EA 3ZVIA 4GFIA 3DESA 4Z1YA 4H83A 4KEMA 4GISA 1RVKA 2PTYA 4GYPA 4E6MA 2PGWA 2OLAA 2XH4A 3IJQA 3P0WA 2XH7A 3R0UA 2NQLA 1NU5A 3T4WA 2PA6A 2MUCA 3SN4A 2PP1A 4MGGA 3QPEA 3JVAA 4DX3A 1R0MA 4A3RA 1OEPA 3P3BA 2GGIA 4F4RA 7ENLA 2DW7A 2PSNA 4HCLA 3I4KA 3UXLA 4K8GA 2XH0A 3PWIA 3DIPA 4JN8A 4HCHA 3OZMA 3UJEA 4HPNA 2O56A 3R11A 3TW9A 3VCNA 3N6JA 5FJUA 3DG6A 4GGHA 3V5CA 4J1OA 3Q45A 1ONEA 4ZA0A 3DGBA 4GYPC 4FP1A 2GGHA 3BJSA 2QDDA 1P48A 3DFHA 2PP3A 2GL5A 4KPLA 4K2SA 3PWGA 3TJ4A 3JZUA 2CHRA 4HN8A 1MUCA 4DXKA 3H8AA 4DYEA 3V3WA 3K1GA 3R0KA 3UCCA 3KUMA 3H7VA 3SN1A 4M0XA 3I6TA 3R25A 2OO6A 3UJ2A 3BSMA 5BOEA 5BOFA 4IZGA 3N4FA 2PP0A 3FXGA 3NO1A 2MNRA 2HXUA 2HXTA 3V4BA 3ZLGA 3RO6A 1IYXA 2POZA 3SN0A 3NFUA 1EC8A 1KD0A 3TJIA 3QKEA 3SSZA 1YEYA 1TKKA 3DEQA 4X2PA 2OZTA 3CB3A 3S5SA 1JPDX 1TZZA 3DG3A 3OW1A 3UJRA 1F9CA 3UXKA 4KT2A 4HNCA 3TCSA 2AKZA 4E8GA 3STPA 3CYJA 3R10A 2AKMA 2GDQA 2XGZA 3RR1A 1JPMA 2ZC8A 4DWDA 2PPGA 3THUA 1MDLA 2ZADA 3QN3A 3D46A 3MQTA 4E5TA 2HNEA 4HYRA 2OQHA 4YWSA 2OFJA 3T9PA 2QDEA 5FJPA 3MZNA 3U9IA 1P43A 1ECQA 3VFCA 6ENLA 3Q4DA 2OX4A 3R1ZA 3MKCA 3ZVHB 3IJLA 3ZLFA 4JHMA 2PTZA 3HPFA 4ENLA 1XS2A 3H12A 2OKTA 2QVHA 4K1WA 3MSYA 3TWBA 1EBGA 4IHCA 3DDMA 2GGJA 3VCCA 3ES8A 3MY9A 1NELA 3FV9A 3FJ4A 2GGGA 3VC5A 3VDGA 3B97A 3QTPA 3FVDA 4IL0A 1SJDA 3H70A 5IDZA 2QQ6A 3MUCA 3NZGA 2FYMA 3T8QA 2AL2A 2OQYA 2PCEA 2QJJA 3CXOA 5FJOA 5FJRA 4EWJA 3OTRA 3ZVHA 1EC9A 3PK7A 3CAWA 3TWAA 4G8TA 3D47A 3RCYA 3RGTA 1W6TA 1FHUA 2XH2A 1MRAA 3QLDA 3NXLA 3JW7A 4A35A 3SJNA 1MDRA 3UJFA 2OZ3A 2AL2B 2QGYA 4E4FA 3IK4A 2GSHA 3U4FA 3DFYA 3ENLA 2AL1A 2PTXA 4IL2A 3GY1A 4MMWA 1BQGA 1BKHA 1XPYA 5J04A 4Z17A 2OVLA 3EKGA 3N6HA 1JCTA 3ZLHA 2ONEA 4IP4A 1SJAA 3TTEA 3CT2A 3OZYA 2PODA 5ENLA 2PU0A 2PMQA 3OP2A 3ES7A 1JDFA
chains in the Genus database with same CATH superfamily
4UB9A 1VGAA 1RBLA 1PX4A 5IM51 5FEPA 1IR2A 1W1TA 1HJXA 3IARA 5AC8A 4IQDA 1MO9A 3KTCA 3CHEA 3MO4A 2I17A 4NAEA 3MPGA 1Q66A 4AY1A 1DYSA 1PL9A 1VFMA 2G3IA 4NJKA 2NSXA 3ZR6A 1E6NA 3DI1A 2GVEA 1EZWA 3WD1A 3NJ3A 5A69A 1JL8A 1GT8A 2WSRA 2FMNA 1TPB1 3POHA 3A3HA 3L9CA 3S2MA 3RX2A 5IBXC 2R1NA 5T8GA 5LXXA 1EWEA 1Q6LA 4IH3A 3LXAA 1V3MA 1J79A 3VDAA 2HQMA 1HTIA 2E67A 3PG9A 2D23A 1S3HA 1PX8A 3AXMA 1FXPA 1EIBA 3SUSA 1TMHA 4NEWA 2J8GA 1NFGA 3QLLA 3UXDA 4O12A 3QYQA 1XG3A 5DRIA 4WXZA 2BODX 3NIYA 1VB9A 4GX8A 1S5TA 4HPXA 4F9JA 3TYAA 3AHYA 2FKPA 1HT6A 1NH6A 3LMZA 2G3MA 4XZWA 1QPNA 3W7MA 3N2OA 4F0HA 3ITOA 3UY8A 1DXFA 3L12A 3PZMA 4NX5A 1ZPTA 1SJCA 5HXMA 1UIPA 2UY5A 3BG9A 3R8HA 5BMXA 3CUHA 4JPGA 4Z2KA 3D9XA 1TFVA 2PWGA 3W9ZA 2ACSA 4C6BA 5T26A 1K4QA 2D2GA 2VO5A 4Z2GA 3DC0A 1J93A 1YXCA 3NZRA 4MGGA 4CQ9A 4BHYA 1W1A1 4IJBA 1J10A 3TR9A 4Q7BA 4DYKA 3RIKA 3E3HA 1PKLA 4RZ6A 1Y5XA 2OO0A 1Z6KA 3ZYZA 4TTUA 4H9UA 2OMAA 1KGXA 5LNUA 3EB3A 2QCLA 2VEFA 3I4KA 4M3PA 3S8HA 5FACA 3SCPA 5D9PA 3UXLA 3GXIA 1JEZA 3V0UA 5HR7A 1YTEA 2VZTA 1RCQA 3WX7A 1S39A 4H6KA 4RK8A 4DXVA 3S6DA 2QCDB 3TW9A 2BXYA 2HPIA 3TN5A 2R91A 1OHLA 3PULA 1ONEA 2DPEA 4ZA0A 3OBAA 3PJXA 2FFCA 4XWUA 3S5YA 4ATDA 2RGLA 3F4VA 2ISDA 4DF0A 4PRRA 2XINA 3P80A 3AQUA 1GQLA 1XRFA 1YDOA 2QR6A 3JZUA 1AMKA 1BRLB 2P76A 2V8ZA 2ZCGA 3N11A 1JFXA 1FQ0A 2V2CA 1GEUA 4BI7A 3WNOA 2PDYA 3QY7A 3GC4A 4XAPA 3N13A 3PNZA 5XIMA 1C8VA 2B31A 1LP6A 4MAVA 3UWUA 4R27A 2YIHA 5K7JA 3W7NA 3GG1A 3F4NA 3VPLA 2ACUA 2YKKA 5FJIA 4QM1A 4Z1BA 2PP0A 4J27A 3W2NA 1TV2A 1XIBA 3AUOA 1HJSA 1FKWA 4R85A 2VM8A 3A3WA 2HXTA 2CLEA 3RO6A 5HOSA 2WPCA 3Q37A 1F07A 1B3VA 1A3HA 4C1LA 2A3EA 1ZY9A 3BOLA 1UKQA 2ZUVA 1UZDA 3EX1A 4Q4RA 1I0DA 4M1BA 5D03A 3WQWA 4YCOA 5D09A 5LA1A 5G5HB 1XISA 3VFLA 1E1CA 3G3DA 3FDKA 4G6CA 3M1ZA 3S5SA 3FIGA 2I5IA 4A8LA 1VF8A 4JQ3A 1QOPA 1BWLA 4GUFA 1IGSA 4AIOA 1QI3A 1Q1WA 3MP3A 4BF9A 2GUYA 1BSLA 1WZMA 2ON3A 4MB4A 1FCQA 2VC6A 1WDRA 4ECLA 3OEXA 3PZVA 2JIWA 3LHTA 4JYEA 3NPUA 3W22A 2XIBA 1LBMA 2WC3A 2J6VA 2V5BA 1JCLA 1GVEA 2XIOA 1RK5A 2HPMA 3ZJ7A 4QQUA 3RAOA 1UR1A 2QDEA 3L2IA 1HKJA 4ML9A 3DFPA 4HGXA 2XJ7A 3AROA 7CGTA 2PRLA 2I9UA 3BW2A 3ZVHB 3LK6A 2VEIA 4Y8FA 4ENLA 4MF4A 2B0MA 3IEBA 4L4PA 3DH9A 5FESA 4DO5A 3VILA 1FX6A 3D3FA 1EKOA 2GGGA 2VCBA 2WMIA 3RNMA 4MZ8A 2FZBA 3ORWA 4C1KA 5KINA 1PTDA 3USBA 3WNPA 4AD2A 3OLGA 4C7DA 4GXPA 1GETA 3PPHA 1JD7A 1YLVA 3ITCA 3NEHA 4YTQA 3N34A 4JQ9A 1EC9A 1KBBA 3F4DA 3QR3A 1EUAA 4HQVA 3I7QA 3TLQA 1AA1B 4R9XA 4HYVA 2ZTJA 5BXSA 4GX9A 4PCNA 2X8RA 4X61A 1SSGA 3WH7A 4HBKA 4N2YA 2QMJA 3UETA 4GH1A 3VUSA 3SJNA 4IGMA 3NSNA 1RM6B 1BGGA 3DFYA 4HHHA 4C91A 1KO0A 4FAMA 2VGBA 1FCVA 4F0RA 1BKHA 3H4GA 1M7OA 1E9YB 1VLIA 3O6CA 4B4HA 1P4CA 3TP4A 1C3FA 3A7RA 3CZLA 3QHNA 3II4A 4EMIA 2P53A 4X3ZA 2PU0A 3M0LA 3CMGA 3ES7A 3G1XA 4AZ5A 3REQA 3GIYA 4Y9NA 4XZ9A 2YX0A 3CJPA 3IVSA 4WIWA 4RKAA 4DJED 2EHHA 4ORIA 2QAPA 1K9DA 2X09A 3VA8A 3GS6A 4AFYA 2QF7A 5AOUA 3KBSA 1QPOA 1DTNA 2PBGA 1KBLA 1GPWA 2J7HA 3EX2A 1TJRA 1WZAA 4HA3A 1VEOA 3LQGA 4NNBA 4W93A 1W9VA 2OODA 1L0PA 3GO2A 2RKXA 4R7JA 3O16A 1IXPA 3CZJA 1DXIA 4DUXA 5C9UA 2B7PA 2BBFA 2PE4A 3P7YA 3M7SA 5H91A 4MG4A 2DVXA 3DKLA 4DO4A 1WDSA 2WSYA 4YJ5A 1KC7A 4D9PA 3DN5A 1UCWA 4KFNA 1VHNA 5SWUA 3MKKA 1GQJA 4PMRA 2GSEA 4M52A 4CCCA 4GG9A 2FJKA 5FI8A 4YTTA 3HV8A 4XAGA 2ANUA 3HW2A 3MJYA 4G9PA 5M3WA 5DXXA 1VRDA 4UTMA 3CZGA 2Z2AA 3II1A 2OR2A 4L6HA 3AMGA 5JQ9A 2IXUA 2X7WA 1JOAA 2VX4A 2Y85A 1THFD 1EJ7L 3KXQA 3LCLA 4AHPA 4TIMA 4H6RA 4CEXC 3UA4A 3DENA 4L5ZA 1L6FA 4AC7C 2CBIA 1B54A 2DQWA 4DPPA 5BWFA 3T40A 4EXAA 3SRHA 1TYTA 2HJPA 3MYPA 3KCLA 3ELFA 3RU8X 1EJTC 2J47A 2ISVA 3KLLA 1ZALA 2Z24A 1RVKA 2WOQA 2ASHA 1B4KA 2WHLA 5EKYA 4C6NA 5I3FA 1XPGA 4PCPA 3IC9A 2NQLA 2NXIA 1WXZA 1TTJA 5F4SA 3PHAA 4QG6A 1JZ2A 1BXBA 3PBWA 2Z1SA 3ZFHA 2FTPA 3W86A 2I57A 3WLNA 1GTEA 4PMQA 3B0UX 4JX6A 3H22A 2C3CA 3W1QA 3L4YA 4E8DA 1EYWA 3QH2A 2DW7A 3TR2A 3CB8A 4ICMA 5BW6A 3ZSTA 3QV6A 3PJUA 4L6DA 3CASA 4ICNA 3EPOA 2EG8A 1X6UA 3LCXA 1OB0A 1AL8A 3T44A 5EMUA 4L4LA 1OSEA 4LF2A 1YDNA 3M5YA 2RHGA 2G50A 2Z7GA 3TTYA 4E2OA 4HHMA 3BJSA 2PTDA 1ZFJA 4MNKA 1I4NA 2GL5A 4RXGA 1BAGA 4W5ZA 4YYCA 1ZMCA 3GZ3A 1MW2A 1V02A 4Z0SA 3UESA 4B9ZA 1VFOA 1I9CB 1O1HA 2W4XA 4Q6JA 1IR1A 4FR6A 3WLOA 4L1XA 5EB8A 3CIWA 5LXEA 2NUYA 3GTNA 5E9AA 3S9YA 4IQLA 4OT7A 1FWSA 1OK6A 5BOEA 4HK6A 2E09A 5CC3A 1X96A 4BJHA 1IQ8A 2CITA 3TXZA 5A6KA 4L56A 3B8UA 4DUVA 3CQKA 1WPCA 5FF2A 3TZNA 3W37A 4YTRA 1X8CA 1W1PA 4ZVJA 4MWAD 4PEEA 3ITXA 1Q1RA 3R8GA 4O1FA 4GO8A 4YIWA 3TJIA 1K8XA 5M2FX 5CXPA 3QKEA 2OWWA 1WKDA 5HAOA 3LPOA 3SCQA 3G24A 2OZTA 3BWWA 1VAHA 4PBFA 2E8YA 3SZ8A 1M7PA 2AGKA 3QTGA 1ZKQA 3W6MA 3GLCA 4S3FA 3STPA 4GVIA 4QXIA 1QASA 1L2QA 3R10A 4Z1DA 5DN1A 1WYIA 4BQ2A 3GFZA 1J9YA 4DJFD 1YDVA 1LZOA 4JFWA 3KVMA 7TIMA 2ZDSA 4FALA 3TV8A 2DU2A 3ZO9A 1KCKA 5JVLA 3W83A 4GIEA 3F5JA 2QHAA 4M7TA 2WV8A 3BW4A 2CLMA 1P43A 3T2OA 2NLIA 1W3IA 6A3HA 3EWDA 1F4AA 4UTWA 5DCDA 1Y65A 1Y0EA 4A05A 3EGJA 4IHCA 4GABA 3SQMA 2WOVA 5I0DA 2ZRWA 4R33A 4EOUA 1FFUC 5CGQA 3QTPA 4DNMA 4G5DA 1Q7MA 1Q6DA 4IMAA 4IQJA 2ZX9A 5LA2A 2QQ6A 1LQ2A 3WF2A 5IFPA 3O0KA 1SFTA 3EWYA 3W00A 3ITLA 1IIGA 4WHBA 4JNMA 4TV6A 4ES4A 3NQ8A 1TPH1 3THCA 4TVDA 3CHFA 2HK0A 2YBTA 1VJZA 3B4UA 2TPRA 3CAWA 3GVRA 4TX9A 4DM2A 5CPNA 1JGIA 2J8TA 3PZ9A 2A1YA 3OHIA 2CXGA 3IVTA 2XH2A 1ZMDA 1CXLA 3IANA 1ICPA 5A6BA 1SU5A 1UA3A 4HZ7A 8XIAA 5FS9A 5I2UA 3TYBA 1POJA 3W2MA 3H54A 1BHGA 3H2FA 5ABTA 4IQEA 1KN0A 1CTNA 1XBXA 2DZAA 1Z32X 1FWJC 1UMLA 1VH7A 1N61C 1ZJBA 3URNA 2KZHA 3H2MA 4PGLA 1I60A 1V08A 1H7RA 3VKBA 2XDFA 3UPWA 1KLYA 3TH6A 3NPVA 3S4TA 2NZLA 3D0CA 3IGUA 4RW3A 3LDVA 4HA4A 4RE0A 1N62C 5LIWX 5KETA 3ETRB 6REQA 5L6UA 1JRPA 5CKSA 3W7IA 2J8FA 1DKWA 4IMCA 4IFKB 3HG4A 1UP2A 1XDIA 3BSHA 4DELA 2V3AA 3QM3A 2F2HA 3CUJA 1AW1A 3QMSA 4K7ZA 4G7EB 3N2MA 2R1PA 4H1ZA 2QKFA 1CEOA 1XIFA 4E8CA 4A3UA 4H19A 3N4AA 4F48A 5GPRA 4C6FA 1TSIA 1ZX9A 3CUZA 4J3TA 3DXIA 1BVWA 2XSXA 4W87A 3AHZA 4L9YA 1FH7A 2YLLA 4CCDA 1OGSA 4DBUA 3LCHA 1GK8A 3TCEA 1KA9F 2GYIA 4GMEA 1K4GA 2QCHA 1W8GA 1R7AA 4PODA 5A94A 4C6PA 3EEZA 4O10A 4A21A 2EQ7A 2XG9A 1OT1A 4EPKA 4ZBCA 4XD5A 2J7FA 5E0FA 4AZIA 3SCTA 1GJUA 1G0CA 4LA1A 1E5NA 3JUGA 3L23A 4ILSA 5CPOA 4GISA 4EQRA 1VHCA 3A4WA 5AC4A 1JPKA 2PGWA 2OLAA 4AWUA 2PLKA 4W8LA 3T4WA 3S1UA 4CQDA 4E0CA 2O4MA 3SURA 1JYWA 4FR1A 3VX0A 5TD4A 1SVDA 3QPZA 2C13A 1UR4A 2OQLA 3FYOA 4CQCA 4DNHA 4M19A 4HPJA 1TUFA 2ZX6A 3CWHA 1GWJA 5EFFA 1CW2A 4UR8A 3E38A 1UR2A 4I6VA 5AYYA 3T55A 4JTTA 3RYSA 1J6PA 4ZSTA 2Y2WA 1ZUAX 1X2GA 3GG7A 4D8LA 1EPVA 3PUGA 3CTLA 2IKGA 2GQWA 1HUVA 3TOPA 1R85A 2XIQA 5CZ0A 4H9XA 5I3DA 2ZXAA 3B9OA 3NNTA 3THDA 4RNIA 4O18A 4KMQA 4PCFA 4QAWA 4QSHA 5KMYA 2HBXA 4WY0F 1UWQA 4EXBA 3PWGA 2EPNA 9RUBA 1MXDA 3H8AA 4RUBA 1EPXA 1VJIA 1CGVA 3K1GA 2CLFA 1A53A 3UCCA 4QNWA 4PUDA 3SN1A 4AU0A 2OU4A 5BRBA 1VBUA 3VO0A 3UQNA 4S3EA 4LYRA 2D22A 2NV9A 4IM4A 4K8DA 1TPC1 1R46A 3QR1A 5BOFA 4APNA 3HGOA 3G1AA 4I5UA 4DJDD 4O50A 2A5HA 3SSJA 3L0GA 2NQJA 4H4RA 1NY1A 1TCMA 2DGAA 2HXUA 4MNMA 5CQ1A 4MYAA 4TOQA 4JIPA 4GYFA 1F6YA 2INEA 3ZT7A 1K7EA 3WFZA 3NFUA 3ANVA 3OYXA 2CHOA 3OA5A 5MF5A 3M6YA 5HJXA 2XM1A 1TWDA 5GNXA 4FF5A 5FD0A 2Q8XA 2EPOA 3G8RA 2DJXA 1WP6A 2X40A 5IFTA 2DQXA 1TZZA 3FW6A 1WA3A 3MVTA 4OBSA 3MI3A 3TONA 1XH2A 4S39A 2VUYA 1FDJA 3NTYA 3ZWTA 3VIMA 3OVPA 3AZSA 2XN1A 2XSBA 3BLPX 1WXYA 4EMJA 1IV8A 5LGXA 1JZ3A 3R5EA 4U5IA 4QCFA 3BXWA 2PDNA 4JY8A 1LLWA 1YNQA 3THUA 2UV8G 2WZMA 3TTOA 2HS8A 3S5NA 4MSSA 2BASA 2CXEA 1E56A 4LYQA 4C65A 1LF1A 2WJFA 3C2OA 4Y90A 5G4EA 1DWGM 5E09A 4MTVA 1L6YA 5FL1A 3BLOA 1E4MM 1N63C 4H6QA 4FX9A 3HPXA 5A3HA 3H53A 1XICA 4GUJA 5CSRA 3PPGA 2Q8ZA 1N2VA 4JR5A 2YFNA 4H41A 3QFAA 4W88A 3ES8A 1FFQA 1GOOA 2ISSA 3PAJA 2PD5A 2Y7GA 2WPFA 3EAUA 1Z9AA 3C2VA 3QSTA 1QNRA 2A7NA 1OJXA 2GLKA 1QBBA 3RCMA 3KLJA 4Z1CA 2DSVA 3W2KA 1QWKA 4POCA 3T09A 5BU9A 3W7OA 4UTUA 1G67A 3AZTA 1XLCA 3HTWA 3KHDA 4X2RA 3LD5A 3NDYA 3WMLA 2WHJA 1B57A 1QHPA 1XLFA 4GJIA 2RFGA 2R9ZA 1MW0A 4U28A 4W4QA 2BXVA 5B7YA 3AJ7A 3LI0A 2PF0A 4XZBA 3M4HA 2Y62A 4DBWA 1DQWA 1AUSL 1MRAA 4L80A 1FA2A 3RDKA 2IS7A 3UJFA 4PE8A 3UG4A 2A4AA 2Y24A 2QGYA 1KXTA 1XKJA 5HMSA 3ARTA 3U4FA 2CESA 4KRUA 4CGTA 5CPLA 4B5TA 2ZUWA 5E70A 1KRBC 3ARUA 2VTFA 1Y5WA 4PMJA 4LNYA 1E0VA 3EKGA 3N6HA 1H50A 1SJAA 1LUCB 1GW9A 3W28A 5A95A 3LSBA 3NPXA 3P6LA 3KRUA 3CUFA 2PMQA 3LHVA 3IJ7A 1DNCA 4JFTA 4D1JA 1OZQA 4NHVA 4LXFA 3WQEA 1KKOA 3SUVA 1KXHA 1TPEA 1N55A 4JNZA 4JKMA 1JYNA 4PR4A 4RLIA 4EE9A 1DORA 1SR0A 2AQVA 3HGSA 3G1SA 3G1VA 1F6KA 2F7FA 4K37A 3C3NA 4LT9A 3TYUA 4O1EA 2DV0A 5FIPA 5LNRA 3P2VA 5KITA 4JY9A 4GIRA 1Q8AA 3OU8A 2VWTA 4LAKA 4XO6A 3MI6A 4ERAA 4TTGA 2C3DA 3P93A 2DW6A 5BRPA 2ZUSA 3HFYA 2G4FA 1FH9A 2XGBA 4AVNA 3H4KA 1VKFA 4LF1A 3WH9A 1XCXA 1Q2SA 3SBFA 5EPDA 4G7FA 2ZXBA 2UY4A 3O6YX 3W7LA 2WKJA 4L64A 1OGGA 1CXKA 3EMQA 2VVSA 3VD3A 1KFKA 2QJMA 2PDMA 5CSYA 1V0MA 4TVCA 2VDIA 1GPFA 4H83A 4CN6A 3BV4A 2PGRA 1DJWA 3EDJA 5EBKA 4XKMA 1MEWA 3TA6A 1LOQA 2X99A 1U1UA 3KBMA 3P62A 2MUCA 3PZTA 2PP1A 4LYPA 3VIFA 4TX6A 3TSDA 3EMZA 2HNHA 3LLDA 4J3VA 1YIXA 5E6YA 2ACQA 2VDHA 3OOQA 2O9OA 1ZZMA 3LBOA 3P3BA 1QI0A 3G8EA 1A5AA 2A21A 1AG1O 1V0LA 1EGZA 1X2HA 3ANYA 3UG3A 4ZQOA 3T05A 2DZWA 3WDJA 2YDRA 1LLOA 3KTXA 2GJRA 2VFIA 3UR5A 5XIAA 2A3CA 1GRHA 1PCKA 1OFAA 6XIMA 1A0CA 1P6CA 3DI0A 6CGTA 1GORA 3CTTA 4CQBA 1ISWA 3LRKA 5JU6A 1VCVA 4H9TA 3QGVA 5FKYA 5AHMA 1XLJA 5G5IA 1D2KA 4PBGA 1MWOA 4UFHA 1C9WA 4FDCB 4B2DA 4MWAB 4NF7A 2DZSA 1UD2A 3K8MA 2W54A 4LC6A 1TV3A 2PP3A 4MY9A 1LOLA 4GY0A 3UWVA 1GKRA 3VU2A 1G4TA 1BSIA 4KPLA 5D33A 2BY0A 2W6RA 3B8TA 1TMLA 4O17A 3LUTA 4JBRA 1S2UA 2ZXQA 2FB3A 4JTDA 2E9MA 1PX3A 1VC4A 3WH8A 3KUMA 1A0DA 3BK0A 3H7VA 3OLIA 1E0UA 2YQUA 4J57A 2A79A 3V75A 4D6HA 3NO3A 3S1VA 4WQ6A 3WKZA 1DJXA 3W1TA 1Z8AA 5CH9A 1ZP4A 4LPCA 5DFAA 1A5KC 3QY6A 4GKTA 4UNIA 3HMCA 1DJNA 3OGVA 2F84A 4O0KA 1OX4A 2E9BA 4GPNA 3WQPA 2X1SA 2Z6JA 3C56A 1W3HA 2ZQ0A 1E4LA 1NARA 1OGBA 2QCCA 1C8XA 4KETA 4IPPA 3WJZA 3LLXA 1CLKA 3S3GA 4O8RA 3W7CA 2A7RA 3LCWA 1M7JA 1GRFA 2TAAA 2BVWA 1X1ZA 2ZDRA 2OKOA 1XX1A 3LYEA 1M65A 3NVTA 2L5HA 1ESWA 3CB3A 4CNSA 2XFYA 3QKZA 4GOAA 3F2BA 4LY4A 4NKCA 3CGBA 4C6DA 3SFWA 3ARYA 3CS2A 2ABAA 1SM9A 1PYFA 4HP5A 3OGSA 3MWAA 3NGFA 4B5UA 4U2YA 3AAMA 3URHA 1M03A 1W0MA 2AKMA 2ESCA 2YXGA 1GEQA 2GOUA 1XQLA 1Q4NX 3IAQA 2UWFA 4Y96A 3W75A 2TSYA 2DZPA 1EGMA 2E1DA 4ZXOA 3PR2A 3PTKA 2D3LA 3GTHA 1CENA 4GQGA 1XINA 1G94A 2O0TA 4REQA 1B4EA 3NRZB 3NZPA 1YADA 2D0FA 5LKYA 1IT8A 1O7AA 5TQLA 1GHRA 5A5WA 4WDXA 3S0CA 3FJ6A 4Z2LA 4D8AA 3EMCA 5E1QA 5U1OA 2WMHA 2ZIDA 1XS2A 1R38A 3S5OA 1N5WC 1EBGA 4NXSA 4EQWA 1SFLA 3WJXA 1YTDA 1JF5A 4OGZA 3POCA 3CQ0A 3G1RA 2QNEA 1DWHM 4WK9A 4P8XA 2Z6IA 1QPRA 3VM5A 2WVVB 1W9BM 1VBGA 3MKVA 4QE4A 3I3DA 2X42A 5G5GB 4ZE4A 4AZCB 2IW0A 4BZYA 4OVXA 4H4UA 1L9WA 2PCEA 6REQB 4O57A 1KTBA 4WF7A 1Z41A 4A8IA 4QBXA 1QVBA 4X9YA 3ONCA 5DXYA 1WZLA 2I14A 1KBKA 3W7GA 4Q32A 4XIAA 1NWSA 3GC5A 4P8VA 3HG3A 1BYBA 3ITGA 4H2CA 3USZA 3LS9A 5U25A 2IQTA 1HP4A 3LERA 4NJGA 5FJJA 3PBUA 4RX0A 2NT0A 1PAMA 2OYLA 3DGZA 1F6PA 4KGLA 4JKLA 2JFEX 4PMDA 4ALDA 4XVEA 1CLVA 4FMVA 4NASA 2CZEA 2Z25A 4UFMA 5DBUA 5A8GA 5ABFB 2X7VA 5EFDA 4GFSA 1OVDA 3D6NA 1TWZA 1QR7A 4ZOHB 2FQIA 4LV4A 4QR6A 3WJSA 4JTFA 2X1TA 4IJRA 3T2QA 3GXNA 2J25A 4E2DA 2ACRA 4PSPA 2VFGA 1A5OC 3QV7A 5LA0A 4QE5A 2J88A 3E2QA 1G6CA 1SJBA 4F3HA 2D0GA 4NSBA 4MM1A 1WUEA 3VNKA 3K1DA 1MQQA 2WKGA 4S23A 1V59A 4JTJA 3UWYA 4LUTB 1V6WA 8TIMA 1X8FA 3ATYA 3VZYA 4FXRA 1XYBA 2V0TA 3QZ6A 3AXXA 1P0DA 4N0RA 4M29A 3SY8A 3ZT6A 1JCNA 2OEJA 3TQPA 2PU1A 3ONBA 1GKPA 1EUNA 4I7UA 4JICA 1W56A 5C54A 3P67A 4WGXA 2VHLA 3WQ8A 4GZEA 2OOFA 1TIWA 1B30A 3EX3A 5CAHA 1V6UA 1OFOA 1L8PA 4HT3A 2E9LA 2HMCA 2W79A 1R86A 1E6SM 2FH8A 2W62A 2PCQA 4LVAA 1E6ZA 5AHLA 4ZFCA 5D4YA 1FWWA 2QUNA 3OO2A 2A0NA 1TJPA 4C6IA 4HJWA 2XVPA 1PIGA 2YCKX 2I1OA 1J4EA 3MS8A 1FHDA 4F2UA 3GHRA 4US6A 4DZAA 5IDIA 3I7SA 4UIOA 1V6XA 3KAOA 4Q4QA 3VIJA 4I7VA 4A6GA 1IXNA 2C19A 1P0KA 3DESA 2WWDA 2GH5A 1W91A 1J6OA 4XIMA 4LVFA 4KWOA 4GYPA 3RPTA 3WK1A 3N9SA 4AX6A 3P0WA 4HNTA 2V6OA 3A4JA 1B90A 2B7QA 1XDLA 4F0LA 4J9JA 5D2WA 1OIMA 1T99A 3MSRA 1KFEA 5JIPA 5HNTA 1A3XA 1O5XA 4S3KA 2E28A 1L2UA 4IG2B 1OFQA 1AH3A 5FA5A 3EPNA 5D04C 1JIBA 1VBJA 4LUIA 2GUBA 1PS9A 1KCLA 3MB9A 3BPWA 4B5XA 3CWOX 4ZEPA 3W1MA 3QY8A 1H3GA 2VFEA 3WJWA 5HUPA 4AD5A 1EDGA 3G6MA 1LUCA 2QDGA 4MB3A 1REQA 5HNUA 2BOFX 4LCRA 4REQB 3DJGX 1S5MA 4GGHA 2FDSA 5I7GA 1UJPA 1XHGA 4Q4KA 2Y70A 3BGAA 5BOOA 3N2CA 2E40A 1GOIA 2HDJA 1BVZA 4OQVA 3UZWA 4NEVA 3NPWA 4QDMA 1B9ZA 3I10A 2PDLA 4QS5A 4GI4A 2JF6A 5DMMA 1X1NA 4IWWA 1P6WA 4XVDA 3ZJ8A 5FS7A 4XAFA 2XVGA 1Q6QA 2J77A 5CJNA 1ZS2A 3FHQA 2DSZA 5AFDA 4A22A 2YZRA 5A6JA 4FS9A 3UZYA 1SFSA 2Z00A 4W86A 4R7OA 3I6TA 1JDDA 4PC8A 4FNPA 3WDRA 3NDZA 5HR6A 4ORMA 1B3XA 5K4XA 1BYCA 3V5OA 1DWAM 3EWZA 3WFAA 4AC1X 4LW7A 4Q7IA 4LANA 1VFHA 2YYTA 1XL9A 2DIJA 3CPGA 4PCSA 4O1BA 3VOJA 3GE7A 1TZ7A 3M43A 2ZX7A 3PUOA 4AWEA 3GK0A 4V1YA 3C52A 1LL4A 1B3ZA 1J96A 4JQ1A 4GA8A 4W7WA 2UBPC 4JXCA 3N3MA 5JH2A 4ZSUA 3KS5A 3DEQA 4X0NA 4DWSC 5FSEC 2EJAA 1D7FA 3EKLA 4OTKA 3FLUA 5DBTA 4H00A 4F66A 1TQJA 1U22A 2DT3A 5D2TA 3LPGA 3STEA 4MY1A 1XD0A 2WZIA 3AS3A 1A5NC 1F3WA 2AKZA 5A6TC 2IKIA 4Q4OA 3AU6A 3SUUA 4GRTA 1PIFA 4GWEA 4OE7A 3WLIA 3LM7A 1UUQA 1FEAA 3ZZ1A 1B3YA 4DWDA 4XZNX 3OC4A 4DBDA 3W76A 1E3XA 5I06A 4MWAA 2FHBA 1H5VA 5KZ6A 1YX1A 3HG2A 1HJQA 4NVTA 3W1RA 2OQHA 4X60A 3QC3A 1FWNA 5I78A 1QHZA 4P7RA 3N9KA 6ENLA 3MUZ1 3R1ZA 4BY3A 3OB8A 5BXRA 1D9EA 4LAOA 3IJLA 4HK7A 3N1AA 2OEMA 4D6CA 3UZJA 2RDWA 3KWSA 3V0TA 1UKPA 3CU2A 4XSMA 4HTYA 1CGYA 3QFEA 2OWXA 2X0YA 1ZB5A 3G1YA 1UYQA 3KVJA 1XKYA 2J75A 1WQ5A 1BRLA 1SZNA 3ZT5A 2HS6A 1F8MA 3WUEA 2AOSA 5U4NA 4BURA 2FYMA 1G4PA 3S9IA 2BFGA 1OD0A 1UC4A 2QJJA 4YLWA 4ZB2A 1JZ6A 1OT2A 5T91A 3TN4A 3KBJA 5C9WA 5HWMA 3M5VA 1MVYA 3R8RA 3RG6A 2YXOA 1W17A 1AJZA 2RABA 2QULA 3A21A 3U57A 4U33A 1B0IA 5A6MA 1MMFA 3BTNA 2XFFA 3V7PA 3GVGA 4EF9A 2VFFA 2V5LA 1UOZA 3WLRA 4H4VA 2BVYA 3KW3A 1QT1A 3C8FA 5BXPA 4N9DA 1ZAHA 4DAFA 4TMCA 2DDXA 4AXNA 3PTDA 2I7GA 4MHBA 1H49A 2ZUNA 3O0HA 1E51A 4B92A 1WCGA 4IL2A 5FCZA 3GQYA 3YPIA 4H4WA 3QYSA 4Z17A 3QOMA 2VX7A 2REQA 3W27A 2QMKA 2J78A 2WPEA 4LUSB 2PDXA 4AAJA 2GQAA 1UMYA 1JXKA 5F4XA 3F2CA 4D71A 4MWAE 1JDFA 3NQFA 1DV7A 3MHFA 1AK5A 3P8IA 3RILA 1QTWA 2PTWA 3WJYA 3W23A 2D24A 5A6BD 2PS2A 3M0IA 4EX4A 4ZOBA 1H61A 1V6YA 3C2RA 1OG0A 3RUBL 3BCFA 1R2SA 4PYSA 1PWMA 3HQPA 5XINA 4Z1AA 5PTDA 4LY8A 4LALA 3EXSA 4CU8A 1XG4A 3EAOA 3RLGA 4PFMA 3SRKA 2J24A 3CEPA 1SO6A 3WQGA 3CHCA 2CIPA 2Y7DA 4JHZA 3AHVA 2IXVA 3FYPA 3KZSA 4H3DA 4ZR8A 2YVGA 1TV4A 1ECEA 4FNRA 4QJ5B 2GJPA 3PB2A 2ZWYA 1OYBA 4IIGA 3TMLA 1UIOA 4ZCWA 3ZQ9A 3L5MA 4LU0A 2Q3RA 1GJWA 2I56A 5KSWA 2PGEA 4H4QA 4CD5A 4DO6A 3P84A 4A3QA 1CGTA 1NDWA 3SRDA 2WC7A 2FVMA 1K8CA 5I00A 3V18A 4NAEB 2X8HA 4FOUA 4YN5A 3NAVA 1R3TA 1EX1A 4HJFA 3ZR5A 3PJTA 3CL7A 1B31A 4UCFA 1PDZA 3W1XA 3WQFA 1KM0A 4UTFA 4E4UA 1JCXA 4QLLA 1PO9A 4LAMA 1KFJA 1JUKA 1QCWA 3WDHA 3T2PA 1T3QC 3A13A 4FXJA 1O5RA 2WVSA 3WQ6A 2ADAA 5I23A 4NX0A 5C71A 2YLAA 1XGDA 4B3ZA 4O11A 1H51A 1R0MA 5HANA 4GCAA 4ZTXA 2GUUA 4HSHA 3TK7A 1CB7B 2BZNA 1GG1A 5BCAA 3TAKA 5BXTA 3HIJA 3B9AA 3GRSA 3NVDA 3QFBA 1UHVA 4FZIA 1A47A 3FG2P 3QMRA 1XGEA 2C0AA 3PB0A 1EGVA 3GBDA 3A5FA 2Q71A 4HPNA 4JGDA 4ATWA 3NXFA 4H50A 2HVMA 1E1CB 1GONA 1SZGA 2I9EA 4FP1A 5C70A 2IQ0A 4AMAA 4GY7A 3VKKA 1WZKA 3FA5A 1S46A 3W1NA 3ISIX 2BHZA 3KRSA 3DFHA 3AMKA 1O12A 3OA3A 4MDOA 3LGDA 4XAZA 4EK7A 5HK4A 3IGSA 3G18A 2BY3A 4WJ8A 3OLDA 3CC1A 3VX1A 4O1CA 1ZHAA 1LBLA 3DYPA 4LOCA 2XYLA 1XWYA 1GRGA 3LCGA 3B8IA 4MVAA 1F3TA 5I24A 3EUB3 3CGCA 4M0XA 3SW6A 3S5ZA 4GIYA 1Z44A 2G8ZA 5IBXA 4EANA 4FX8A 3BCDA 4ZO9A 1XANA 3DK4A 3N4FA 3NVVB 1YBQB 4IMDA 1OC5A 2NX1A 3W1PA 4A3HA 3GTFA 2E68A 4KWWA 4L61A 3TDFA 4KKXA 1KM1A 3V1HA 2AAAA 2H9AB 1FXQA 2GQ8A 3IS4A 2WNNA 1KLZA 4DLFA 5G4HC 4GVFA 1XBVA 2YB4A 3SIMA 4QX4A 4WY0B 3APTA 2WMGA 1UWIA 1GVQA 2CWXA 2XN2A 2GZXA 1ZL1A 4X2PA 4WKAA 4J4KA 1ITQA 5LIXX 4QG8A 4O4WA 5CGTA 3AYVA 4HNCA 1NP0A 1ME9A 3QEZA 5AHFA 3QOKA 3KBWA 3H2NA 1X97A 2Z1KA 3SQPA 3GX9A 2V69A 4H04A 1F61A 1YDYA 1H1ZA 1JPMA 2G41A 3R43A 5C55A 1JI2A 2ZUUA 1FWCC 4BK9A 2ZADA 3QN3A 4C7FA 2YR1A 2RDUA 3ABZA 3ZSSA 1NSJA 4CU7A 4ZFMA 5JCKA 3TTQA 2QPUA 4XZIA 2CBUA 4UQCA 2BY2A 3IUIA 1UBSA 1K7FA 4E3TA 4P7LA 2FGLA 3MZNA 3U9IA 2C71A 1K3UA 4KBXA 1R7OA 3AS0A 3NR0A 1SSDA 2DT1A 4S3CA 4PBEA 3H7UA 2X41A 3BAKA 3B3DA 3H12A 1R30A 4PMXA 1WAUA 4PTNA 2REQB 1NELA 3BZGA 2XUCA 1D3HA 4AIBA 1OFPA 3U3HA 3IRSA 1LOSA 2BOEX 1SO4A 2H9AA 3B8DA 3U7BA 4C1NA 3INPA 3NO5A 3GAYA 3H2AA 3AUJA 1H1YA 2Y1HA 4H7CA 4H4TA 1EA0A 2E6AA 1G4SA 2DIEA 1OF8A 1VDVA 4C6OA 4Y8EA 1BVNP 3SGZA 2VZSA 4ZQMA 3RGTA 1FHUA 4Q8PA 2OSYA 1DVJA 1F2JA 4MB1A 3PAOA 1EEXA 1UR8A 1ITUA 4LVBA 3Q94A 3P82A 1XH1A 2DUZA 3RHGA 2XIIA 2CHNA 1Z89A 4BS0A 3U8GA 4MJMA 4UTHA 5B80A 3QQWA 4IGSA 3GY1A 5DY2A 2AMXA 3N2TA 1TO3A 2PRHA 3L4XA 2CWNA 1ONFA 1JFHA 1YBQA 3DU0A 9XIMA 3FS2A 3E02A 5IOBA 1P6BA 1FOBA 4D6DA 2UZ9A 5CPTA 1PE1A 1PVNA 4PUWA 2VQTA 2DP3A 2JIEA 3LNPA 3TOYA 3BDKA 2TRSA 4C6KA 4GI8A 3UJSA 1VQTA 4QP0A 2W63A 3VZXA 5C7VA 1DP0A 4G56A 1JDCA 1GERA 1LYXA 2FLIA 4IP5A 3WBYA 1OYCA 3DKJA 3SUTA 3GD6A 5JUVA 1XP3A 2ZRUA 4AF0B 4UQEA 3SDOA 3FAXA 2WMFA 4YWOA 3E2VA 1YQZA 4OOUA 3DERA 1TV8A 3ZR4A 1XC6A 4D1IA 3WF1A 1OCBA 3CV7A 1XCFA 1YPFA 1G1YA 2Q02A 5AYZA 5AYBA 4HMCA 3FJNA 2C1GA 4H8VA 4LS2A 3A23A 5FJTA 1KKRA 4FK9A 3OPSA 3EEGA 2R94A 2Y89A 4NQ1A 4QNEA 1IEIA 2J27A 4NI8A 2O9PA 4L4MA 4AY7A 2X16A 1H7OA 3U2EA 5MHBA 2P8CA 5TR3A 3QMTA 4AQLA 1PTGA 3BVJA 4GZIA 3VGFA 1ISXA 1PV8A 1GVSA 3ARXA 5KEZA 3BAYA 1ISYA 3V5FA 4AZCA 4ZL1A 1KQZA 4B5WA 4WDWA 2PWEA 3MA8A 1XIMA 2QJNA 2VC5A 1B2YA 4QAIA 1MSSA 3CHVA 1RUSA 3L5OA 2QCNA 4KWSA 1UASA 3G2GA 2ZZBA 2E6YA 4FLRA 3CMFA 3PY2A 2CERA 4YS1A 3S83A 1FWDC 1DL3A 5C9ZA 2PLJA 4UFLA 1NOUA 4UBPC 2VC9A 2VGGA 2C15A 3MUAA 1L6SA 1E6PA 3O07A 4U4MA 1PHWA 3CH0A 4KS0A 1UWAA 2BVTA 5AC5A 1Y5VA 3HPSA 2B7OA 2Z1BA 1JCMP 1X6NA 2HCVA 5CJ5A 3M9YA 1CB2A 4HNVA 3KP1A 1RK6A 2POTA 4K8HA 1GYMA 5GJMA 4BWLA 4H4XA 3LSCA 2GQ9A 3URQA 2WJDA 3KLKA 3KRBA 4GK8A 1EBDA 4PB4A 3W71A 3SCSA 3XIMA 4X22A 1ZBKA 3GNDA 4PL1A 2YA1A 4PH6A 1XDJA 4IMGA 1KXVA 3WNKA 1OYAA 3L66A 1EFZA 4RPQA 1A5SA 1TVNA 1QNPA 3S42A 1BPLB 4NZ1A 5G2WA 3EZ4A 2C1IA 3E0WA 3CGEA 4BA0A 2INZA 3G5EA 4S3DA 3W70A 2FFIA 3FGCA 4KGJA 4RJEA 3WUGA 5LNWA 3N9RA 3KOXA 2VR2A 1PTAA 2CHRA 2E7FA 5I6SA 1RA5A 3LCFA 5C2GA 5I09A 1FEBA 1XV8A 3BAXA 3W88A 1C9DA 1PKMA 3HGRA 1P1MA 1XLKA 2DH2A 2EQ9A 4F79A 1V7YA 2ZYFA 4OHQA 4M51A 1GVOA 2GQ3A 3CXBA 1KFCA 3CO4A 3EWUA 3E12A 1QNOA 5ABEA 1PXGA 2SFPA 4GE8A 2QVNA 1EHAA 4JTAA 5EBAA 1K9EA 3VYLA 2VDGA 2PURA 4HHPA 3O2LA 1QNSA 4FIQA 5IHRA 3A7AA 4XB3A 3SUWA 2POZA 1VIWA 3FSUA 1VPYA 4EIVA 4IP7A 2GK1B 1Q6CA 3OYZA 4PMVA 4HIBA 4GUHA 1K9TA 1TKKA 3L67A 5A8PA 4E2VA 3WLQA 3TNOA 3G0XA 1RCXB 3UJRA 3W7EA 1IGWA 2H3DA 2PZNA 1T41A 4O15A 3V35A 5FOOA 1XLLA 3PBYA 3TFCA 3DGHA 2OGJA 3QRHA 1IWPA 3BE7A 4TU1A 5LGZA 1KB3A 4EKJA 2WJZA 3N3TA 2FPVA 5DT7A 3O3RA 2HBVA 3FSTA 4JTIA 2JKAA 2DZVA 8CGTA 3DH7A 1UKTA 4H4SA 4K6AA 3CO8A 3S1GA 4DM1A 1P1XA 2GK1A 3C3UA 2XISA 3G1FA 4J56A 3UA3A 2GFTA 1F76A 4GJJA 1DQUA 1EHNA 1F3PA 4UOJA 3C4UA 1CX9A 2WKLA 1UWTA 4M82A 4H9MA 1S2AA 2DUAA 1CNVA 3CUXA 3W1AA 3APYA 4AEEA 4JYDA 4MAZA 5FJPA 2XZ9A 5EY5A 2X8CA 1W5MA 1VCGA 1TX2A 2YCIX 7PTDA 3GHTA 3ZLFA 1TVLA 4Z08A 4AYSA 2PZ0A 5DMLA 4D6FA 2QVHA 2X1IA 4R7WA 3AIBA 3QC0A 1TA3A 4ZO8A 4Z2HA 3LMYA 4Y9OA 3B0VC 4V1XA 1W5NA 2C8NA 2FH6A 3NQGA 3NQ2A 1VFSA 2EF9A 4IMEA 4UZSA 2FZNA 3WL0A 4ACZB 1EP3A 4IL0A 1H7XA 1RAKA 1DIEA 4U10A 3CV6A 1EZ2A 2EG7A 1MXSA 1V79A 5GRTA 2NVDA 1GV4A 1BTMA 4WR3A 3T81A 4DY1A 4WSKA 2PDWA 1M5WA 5FAJA 1GOWA 1HG3A 3ALGA 1S1PA 1XIGA 4JIIX 1HFBA 3FEMA 5C9RA 3RCYA 1I6NA 4K39A 1T7LA 3VDCA 3P14A 4HNOA 5CZSA 1OC7A 1VFFA 1DXLA 4A35A 4KESA 1JQVA 4JOMA 1UD3A 1D8CA 2NWSA 2Y4SA 5KZDA 5DANA 2EPHA 4IX0A 3LZ3A 2AL1A 4O54A 3CUGA 3EOUA 1X7IA 1DHPA 2PAJA 4I5XA 1DIOA 3ZXWA 4XO7A 2WHKA 1FBAA 1BFNA 1XIIA 3VNMA 3BMWA 1MW1A 5HMDA 3ITVA 3OBKA 2CLLA 1EP1A 2QPXA 5ENLA 1XUUA 3FN9A 2WZTA 3GXPA 4ZTYA 1MRQA 2Z0IA 4QE1A 5ECVA 2JQXA 2BY1A 3RLUA 3DOPA 3HGJA 1PYMA 3ABRA 1RQEA 4X9SA 2YL8A 4MDPA 1MFVA 4NZFA 3HFTA 4LYKA 3WLJA 1FVPA 4NILA 1BG4A 1C93A 4FLSA 2QS8A 4WOZA 3KL0A 3W73A 3RX4A 1HKIA 2EQ8A 3UWWA 4AXKA 4NI3A 4BWLC 4FX6M 3F4CA 4R9OA 2OZ0A 3LB0A 3O06A 3GM8A 1GZJA 3REQB 4D6EA 4O19A 4DJEA 4H9VA 1WUFA 4PMYA 1OD8A 4HCDA 4NNCA 5EA9A 1KGUA 1SYTA 4C5YA 3NL2A 4NUWA 5DY3A 1W5PA 3HPZA 3PZNA 4DUOA 4EVZA 4EM4A 1VZWA 4H2HA 3UWQA 4KF1A 1E5JA 3VTRA 3BO9A 4CNOA 2YDSA 5HULA 1DE5A 3NQDA 3M46A 3RRAA 4KERA 1EJWC 4XKYB 2GJLA 1R2RA 1BQCA 1OX4B 1E55A 1IWBA 2BG5A 2Z2UA 3HF3A 3W3OA 2OG9A 5JRBA 3EOLA 4GBDA 3M0JA 1DHKA 3J7HA 3ZVIA 3GRTA 4Z1YA 2W55A 1BG9A 1JPHA 1CGXA 3C2EA 3C0SA 1F4HA 3BOFA 2QUUA 1KM5A 4J3XA 4N6EA 3VIKA 1LTDA 2XH7A 4EM3A 3EX4A 2PRMA 3ABSA 5KVHA 3RMJA 1HP5A 3QPEA 5JMUA 2ZWZA 4NIRA 3S2JA 3N6QA 1M7XA 3WCZA 3WEZA 1S5WA 3OHMB 4J2PA 3MCOA 2PF8A 2PC4A 2XVNA 3W85A 3VGGA 3FK4A 1H41A 4HZMA 1HX0A 2PSNA 1JUBA 2AMGA 2VRJA 3GYEA 2HSAA 4PMOA 4EQSA 3K4AA 3DIPA 4AWTA 1C8QA 1BWVA 1VCFA 3MMWA 1XGZA 3RU6A 1UD5A 3LV6A 1ONRA 1WKEA 3PANA 4W7VA 3FDGA 3CZEA 1OBAA 1H0IA 2VEGA 4CQ8A 2GGHA 2B4GA 3QW3A 1P48A 3CLMA 4JFVA 5K2ZA 5E6ZA 1PCWA 1WX0A 4XV0A 4JAWA 4NZCA 1V77A 3IUDA 3IVUA 4DF1A 3RM8A 5MKGA 2ZRZA 4JQ4A 1Z69A 4J3WA 3A4AA 3P5YA 2XVLA 2F6KA 1Q65A 1E71M 3AYSA 1FUYA 3AI0A 1ZQ5A 2J4GA 1N8IA 1N5XA 3W02A 1EXPA 1N60C 4XBKA 5JCIA 3WEOA 1MEHA 5M5DA 3QHMA 1WDPA 2WLZA 1CI1A 2F2KA 3FXGA 2VR4A 1KWKA 5G1MA 4WLCA 4JIQA 4A8NA 5G2IA 3SN0A 5REQB 1V93A 3K8KA 3UR8A 1P0NA 1DQXA 1YQ2A 1WYGA 1HN1A 5HQMA 4YXGA 1AZ1A 4FSAA 1VD6A 4OUEA 4N6FA 2Z4GA 1V51A 1HQTA 4FNTA 2NX3A 1XFCA 2E1WA 2DZBA 4M5PA 2QAEA 4Q8TA 1W2VA 1TRIA 2GR2A 1KRAC 2ICSA 4C6QA 4V28A 5G4WA 3DG3A 2NUWA 1FWRA 4LVGA 3VOFA 4HHLA 2GJXA 4GIAA 1LCOA 1W8SA 3CWNA 4LS0A 3EYPA 2HROA 2WCAA 1VPQA 3T1GA 3F4WA 1AQ0A 3DUGA 2WZHA 2GOKA 3GVQA 3IJ8A 2NVAA 2HQAA 2PPGA 2BGSA 4CEUC 1BWCA 3FEQA 3WK2A 3CLWA 2NQHA 1E73M 1Q6GA 1QK0A 1JD9A 1V7AA 3G3MA 3M64A 1X1OA 2OFJA 5HBFA 1D3CA 2CFFA 2GR3A 1R47A 4QROA 2NPXA 3UYIA 2OLSA 2YAUA 2GR1A 3U2ZA 4J5NA 3U4AA 1KWGA 3GDLA 1V97A 1U33A 3MV11 2VJXA 1ZP3A 5JCNA 1U2YA 4DWSB 3DDMA 3MUXA 3DYMA 1C91A 3ID7A 4TO8A 2VT0A 5U7SA 1VYRA 4Q8NA 3DAQA 4S2CA 3VDGA 4W9TA 8A3HA 1F74A 3G6LA 2OWCA 5IDZA 2FGBA 3BG3A 3Q58A 3WK3A 1CDGA 2WPGA 4H6EA 1NM9A 2P5NA 1BKSA 1UPMB 3DHFA 3T8QA 3CNYA 2B7NA 2ALDA 4ONVA 4XSLA 3JU2A 1TPFA 3IIPA 3W4RA 1V5XA 4EWJA 3WNNA 3PK7A 3W81A 4GUIA 5DEZA 5JH1A 3W87A 3KFTA 2WYSA 1JI1A 3TYCA 3CM4A 3GXFA 4LC8A 4PB3A 3QLDA 3NXLA 3S1WA 5JCMA 1MDRA 2YL5A 1OX5A 1YXDA 2DIKA 5CBBA 4YL2A 1AH4A 2NV1A 2G37A 4OZOA 3CAQA 1JEHA 3NQCA 2RJHA 3FOKA 5KZMA 2WVTA 1LT8A 4QLJA 1ZRQA 3W7HA 4ROQA 3DK8A 3B03A 2XPKA 5GVJA 1OWQA 2AQWA 1TPWA 3LN3A 4AISA 3WNLA 1AZ2A 4HMNA 5CJMA 3PJWA 4V27A 3PP7A 1H2JA 1IHIA 3WDIA 4M6QA 1ELSA 4MPQA 4L65A 1UZ1A 3UGRA 2GDUA 1VS1A 2Z1VA 4MUPA 4GD0A 2WNWA 3CPRA 1WAWA 4FI4A 4LQ1A 4LNCA 4J3UA 3IJ9A 4DEFA 1FRBA 3IV3A 2OYKA 2ZX8A 4BI5A 1FHLA 5D2YA 3UEQA 4C7GA 2QUTA 4A8RA 4H9ZA 2P0IA 3ARSA 3BV7A 3M0HA 4MJZA 3DX5A 1DXEA 3RCNA 3GD3A 2ZZ4A 4IGHA 1E40A 4UMAA 2A6NA 1GW1A 1E15A 1XSJA 3JRKA 2XGIA 1MUMA 4D8ZA 3QBUA 4GQBA 2P3ZA 4TVWA 5CPQA 1EC7A 1K8YA 1E4NA 2C79A 3WK0A 1G01A 4AEFA 3E6EA 3QZEA 5A1AA 3EANA 4YU1A 4GINA 1PJ9A 3MYOA 1UWRA 5I3IA 4URIA 3C0QA 4DLMA 1QHOA 5DT5A 1OM0A 4ROPA 2EEXA 4V33A 5E0KA 4KEMA 1NDYA 3WLSA 1V02E 1ADOA 1UR9A 3AICA 5HQEA 4S3JA 1I2QA 4CD8A 1QOQA 3N29A 3SN4A 1SO5A 4WY0A 4XG1A 3CGDA 1W5QA 5HDRA 3W7JA 5BRQA 4F0KA 2V3FA 1SW7A 2OEKA 1UR0A 2VCCA 2XIMA 4DX3A 1Q45A 1I8JA 2W91A 3SJ3A 5GQBA 2DT0A 2A8XA 3AU2A 1K7XA 1US0A 2EQDA 1MNZA 3COTA 3SAZA 1T40A 4DJFC 1Q6OA 3LU2A 3M0MA 1GRTA 1JZ7A 4RDWA 4D6IA 3QJAA 4C6MA 4JN8A 2WANA 2CLKA 6TAAA 3QGKC 5DLCA 1Y8BA 5DELA 3B9DA 3R11A 4JEJA 1R3QA 3D3AA 3IJ6A 4FNQA 1XIJA 1QDSA 3THQA 1GVFA 3W6LA 3WF4A 4GQQA 5A6AA 1WKFA 4Y9MA 2FB2A 2WM0A 1D7YA 3DHPA 3SCUA 5LSMA 1NFPA 4US5D 3STFA 3CUIA 3NQAA 3ECQA 4PUEA 4H8HA 3TZFA 3K4WA 2W66A 1PUDA 1YE6A 3VUPA 1NOFA 4O1AA 5BROA 3V1PA 4IZGA 1XLEA 4GACA 4HU8A 2YBUA 4PN2A 1V6TA 4EF8A 5DO8A 3M0ZA 2QF8A 1E6QM 2QXWA 1XC4A 1IYXA 4ZO6A 4OFCA 4C6JA 3T8LA 5AHEA 1EYEA 3S6TA 2ZZ2A 1XDMA 2PDHA 1IIHA 3D5HA 4MFEA 1P7TB 1OG6A 3FKKA 3F5KA 3TSMA 1Y7VA 1TJ2A 3HN3A 4IF2A 1ME7A 4LFYA 3OW1A 4HD5A 4AEOA 1HGYA 5JIWA 1OCNA 1LBFA 4CQAA 3RNDA 2X30A 4Q4MA 3BUVA 2W5FA 3TVAA 4QCEA 2YZ5A 3CYJA 4CUCA 3MSGA 4GYKA 3W38A 2Q01A 4UC5A 3WH6A 1J0HA 1JXJA 2NVCA 5IHSA 4RZ4A 1IE7C 2W3RA 1Q6RA 2V81A 2WBAA 1P0BA 3PNUA 4HVXA 4RR4A 3NDOA 3VIPA 1GZ1A 2ABBA 4YWSA 4TQTA 5D05A 1H1NA 2JK6A 2Q8LA 2CETA 3EDFA 4R53A 4DPQA 2JEQA 3W72A 1XIHA 2H3BA 4RDYA 8RUCA 1AQFA 1QOXA 2Y8KA 2CLOA 1IXQA 4JHMA 4MUZA 4G2DA 2VEKA 3W1UA 2CFYA 1HO4A 2P50A 1EEPA 3PPCA 1PZ3A 3L68A 1RXOB 4CKQA 1WDWA 3K4DA 3MY9A 3GNNA 3PVFA 2VZVA 2E4TA 1A0EA 2YCLA 1LRTA 1E70M 1W32A 4U3CA 2ZA2A 1EDQA 3L2MA 1RA0A 4AUBA 4HMEA 2D2JA 2UY2A 1BWKA 4WX2A 1DWFM 4JFUA 1XXXA 5BZAA 3TWAA 1FO4A 1PB0A 1A5CA 3D47A 6XIAA 4NAFA 1W6TA 2CBJA 1ZBCA 3AIUA 3VM7A 1TWIA 3LXCA 1IEWA 3VNYA 3KBNA 3JW7A 4BEQA 3EOEA 1TZ9A 1FWFC 2G3NA 4E4FA 2WZEA 3AIWA 3KVLA 4JQ2A 1KM4A 1EXBA 1HIZA 2FPYA 1POKA 5AYIA 4DWSD 3TEVA 4JFSA 3SGUA 3FGCB 4Q8OA 4B5VA 3LCIA 4BKNA 2BV9A 1VRXA 2VUNA 1MI3A 2PDFA 4RDVA 3R89A 4QDPA 5F7UA 5I07A 5AVHA 2VWSA 1T8XA 3UG8A 4XZMX 4GJ1A 3ARZA 4GXMA 4K1GA 2E5CA 3U0HA 1UZHA 3JS3A 3PG6A 5B7ZA 4XD6A 3GDRA 2DZTA 4E4PA 2DEPA 3V36A 3CK5A 3E2SA 3HA1A 1GTHA 1QK2A 3HV9A 3LA4A 2JGYA 4GKLA 4CD4A 2P8BA 3HQNA 2WBKA 1DJIA 1ZNNA 4HA1A 1Q8JA 2YW4A 3TW7A 3AALA 1FIQB 2IUZA 3K8LA 1QNQA 4G1NA 3C5QA 1TPUA 3WELA 3CZKA 3AXHA 4QSFA 4I5RA 4J3ZA 2GJNA 3TQVA 4H4YA 4IJCA 1EP2A 2AAMA 5F1UA 3UR2A 2XFRA 4AD1A 1RPKA 2YYUA 1OQFA 3OG3A 3VGDA 1DJGA 1PDYA 3ANUA 1J8VA 4HN4A 3S1XA 3M6DA 5F2MA 1EO5A 1T96A 4WZHA 1B3OA 1BYDA 3P60A 4WOQA 4IOTA 4O1DA 2WQPA 3CEUA 3OVQA 5FEWA 3W84A 1XLGA 1C90A 5CPMA 3A24A 1X38A 3P8JA 5JBDA 3OBEA 4LCQA 4FB7A 4DIAA 1S2CA 1EB3A 1PKNA 1TREA 1M04A 3SCVA 3VK5A 2X2YA 3AMZA 4GFIA 5AZ0A 4BQ4A 5AY7A 1XIDA 2PTYA 1R8LA 1GQNA 2PEVA 1X7FA 4J7RA 2H8XA 1P7TA 1U1HA 2J7GA 1G5AA 2VX6A 2X0SA 1V3LA 2PA6A 3LG3A 3LRMA 2EBNA 2DORA 2WSKA 1NHQA 1LWHA 4IXXA 4GBUA 1NF0A 1E1EA 3L4TA 3KWXA 3IK2A 3EA3A 3F5LA 1TX0A 3OLEA 3WLHA 1I1XA 2J9XA 3B05A 1RBAA 4U3AA 7ENLA 4O0ZA 3V16A 4DYJA 1I75A 2EKGA 1R3SA 3BCJA 3HZ3A 2E6DA 3E5PA 3HURA 5A6LA 4K8GA 4C90A 3A5VA 5EMJA 1E0WA 3O9NA 3TMQA 1EOMA 2O56A 3ZS4A 3OG2A 2RAGA 3SR7A 3NWRA 3DG6A 1EDTA 4FXSA 2VKZG 3U2OA 3UW6A 3T0TA 3OJGA 1CZ1A 1MXGA 2CU0A 4EACA 2E77A 1SUXA 2WSPA 2PFHA 1QU4A 1JVNA 3TYEA 2PDGA 3CH9A 3L8KA 2B81A 7REQA 3WY1A 1J5TA 4P7NA 5E93A 1RV8A 4IIFA 1F3XA 1KV5A 1UQYA 4JTQA 2X2GA 1JGMA 4ZQRA 3B0YA 2CZ5A 3AIQA 3GFXA 5HMEA 4QRNA 4I90A 1EF3A 4ADTA 1TVPA 3CAKA 3E0FA 1EQCA 2WLYA 3GAKA 3A3XA 3UJ2A 5FEZA 4B2DD 4KWUA 2YA0A 3WDQA 1TV7A 4F2TA 3NO1A 4NU7A 1OX6A 3VGBA 1OF6A 4EXQA 1CWYA 1V3JA 5EL1A 1A4LA 4XZHA 1GOKA 3R0DA 4K3ZA 4JTKA 4UR9A 4GC3A 4K38A 4CNNA 4Z2JA 3IRDA 4I8YA 2XU2A 1DJQA 4UTTC 2ZKMX 2QEZA 3KZPA 2P1FA 5K9XA 4X63A 4AH7A 2FZ9A 1J0JA 1A3WA 1VLWA 1SW3A 4D6GA 3GVWA 2X05A 1JDEA 1WDDA 3PC0A 1QW7A 2Z2BA 3EDDA 4CNPA 4UMBA 4Q8WA 4E8GA 2WW5A 4NZ5A 4CN4A 5LYRA 2PDCA 3CAVA 3UF9A 3VE9A 2ZX5A 1LM1A 4LAUA 5JCLA 1TG7A 3KOYA 4C6EA 4UR7A 4ZGYA 2WP5A 1XW8A 1FFRA 2XN0A 4CVUA 1UG6A 2C1HA 4MJ2A 1RHCA 5D9NA 2VENA 5AHNA 3MQTA 3VXGA 4HMDA 3QVQA 3O63A 4JIRA 4AD4A 2V82A 1GRAA 3WLPA 3U48A 2R8WA 4RNFA 2WPBA 5G2HA 1RR2A 1RZMA 2DJLA 1ZJHA 1CGWA 1Q2RA 4AYGA 2ZE0A 1W31A 2VGIA 5CAKA 1RVGA 1AW5A 4TR9A 1ODZA 1UR3M 3WMSA 1UH4A 4WRHA 1DOSA 1JPIA 3VDHA 3VC5A 3EXTA 5C2CA 4HKPA 2VR5A 3DK9A 3T0BA 1B1YA 1MO0A 3WUFA 2CBVA 3W29A 2QJGA 1TR1A 1U83A 1A5MC 3FX4A 1Q7ZA 4W8AA 2GVJA 4PRTA 4JTCA 4Q8MA 4QLKA 1ZAIA 1RLDA 1EO7A 1L6WA 3G77A 2QIIA 2ZZ1A 3CHDA 5FF3A 1JR1A 2OLHA 3QQ1A 5ECUA 3ZVHA 3LRLA 3FFSA 4H4IA 4QEHA 1DBTA 3SO7A 1NFBA 1WO2A 3RO8A 1LRQA 5K3VA 4DZIA 1V3KA 1F05A 1KTCA 2FGZA 5D37A 4AZ6A 1C8YA 3MI2A 1SZEA 2VEMA 3O0FA 3GR7A 2GPTA 3I3EA 3E0VA 1M68A 4UTIA 4P8WA 3L4VA 3KCOA 4XUGA 4X0VA 2Y0FA 2HV5A 1F73A 1V3HA 4S38A 7TAAA 5J04A 4LVDA 1Q63A 1XLBA 3WF3A 5I3KA 2J9YA 2F61A 3EA2A 2ONEA 3P5ZA 3KBVA 1O1ZA 5TAOA 3TTEA 2EPKX 3ABOA 4ZMGA 3BLLA 5HNRA 5CZTA 2V5CA 2FPTA 3MDWA 4K68A 1EJVC 3WLTA 1FCUA 3TC3A 5CGMA 3BC9A 4HPGA 3VD5A 4W8BA 4PSRA 3GIQA 3O6DA 3RJXA 1YW1A 1UWUA 3KL3A 2D69A 3M5XA 3FY1A 3T6CA 1R3YA 3EKZA 4ZQPA 3SECA 3IUHA 2CW6A 4M8UA 2J7BA 2XZ7A 4HSOA 3QPYA 4GZJA 3L2LA 3PSVA 4YCPA 4WJXA 1R9ZA 2QV4A 3G0UA 4I7WA 1XYAA 2C14A 3Q65A 4HNLA 2OB3A 2E0PA 2FTYA 4DHGA 1GEHA 3TIMA 1AOGA 2VURA 1MEIA 2C6QA 5T9BG 4D2JA 4I9MA 4M6UA 4J35A 3VC6A 2R1MA 3RR4A 5C6MA 4GGBA 4TXEA 1FWTA 2RDXA 1TYPA 4LIIA 4PULA 1I2RA 3AMCA 1XLAA 3VKCA 3WYZA 1QO2A 2J7DA 5DMYA 3SQSA 4CNUA 3S47A 5BWAA 3CL6A 3TXVA 2P10A 4LEQA 2Y61A 1VYPX 1XLIA 4PRWA 3VOHA 4ADWA 2BS9A 3BLFA 2W3SA 1NOWA 3FYYA 4EQXA 1TPDA 2OOGA 3KOZA 3EWBX 3QHOA 2J62A 1JRCA 1MNSA 3A12A 3W0KA 1A4MA 1VEPA 3N12A 3WQ4A 2QCMA 3IAPA 4IUGA 3ZJKA 1CIUA 5H8PA 3RRXA 1N8FA 2XH4A 4ZB0A 4FF7A 1VFLA 4DB7A 5D8WA 4Z42C 1EWDA 4UWMA 4J28A 1K02A 3TUUA 4V2XA 1JZ8A 2HRWA 4WEVX 3GSMA 1UQZA 4GRSA 2DZXA 2EAWA 3L7RA 2V38A 2CKSA 3W26A 3SR6B 3SGGA 4P7OA 1FTXA 5DCEA 3VMPA 3T78A 4AVOA 4QIUA 4R34A 3SEPA 1GG0A 2CDUA 1GOMA 1PIIA 4IUOA 4U2ZA 3H2CA 4UFJA 3FVMA 1R87A 6ALDA 1RJRA 1ALDA 1WNOA 1UBPC 1QNVA 1H7WA 1E9ZB 1REQB 3GNPA 3WDPP 3W7RA 3AYTA 3UJEA 3LY0A 4US5A 3UP8A 3VCNA 5FJUA 1FDZA 1JUEA 2XSAA 2WP6A 2C18A 5HMFA 3V5CA 1E6RA 4G1KA 1HL2A 3GVVA 3I68A 3NVYB 2ZZ5A 3DCPA 4YVPA 3C2YA 3AN1A 2J6XA 4RZ5A 5HPCA 1YE4A 1RQHA 1F7BA 3T7VA 4F9DA 4TX8A 5G1TA 2EPLX 3TJLA 4M24A 4ZB5A 4MKVA 1QXLA 2V68A 3VMNA 1TA3B 1UPPA 4NJHA 3R0KA 1AJ0A 3A4XA 3IACA 4QJ4B 2GR0A 4IPNB 3UU0A 2IPWA 3QV9A 3N15A 3AFBA 1UP0A 5FS6A 4OECA 1V03A 5CPSA 4UTKA 3K13A 3BLEA 4GNJA 1U5VA 1Q4WA 2BLEA 1V6VA 1AFSA 3IIZA 3ZMRA 1QBAA 2A3LA 5MKGB 3H21A 5F1VA 3MVIA 4C6LA 3V4BA 3TQ0A 4Q33A 4R5EA 3EXRA 1VEMA 3GU2A 2VNCA 4MZ1A 3N25A 1ZENA 2RGMA 2IPFA 3NZQA 4DZ5A 1LQ0A 4AHOA 3K30A 1NQ6A 3WBXA 3UZZA 4Q4PA 5HJYA 2WWCA 2WNQA 2YL6A 4A29A 4F8XA 3PZGA 4DI9A 5GNYA 3P74A 2D2HA 1A80A 3PFMA 5C7HA 4K7YA 1EA9C 1RQBA 1XF0A 3AISA 4WSHA 3B9JB 5C8BB 4DUWA 2FHFA 4B15A 5I02A 2XWEA 1KR1A 4F2BA 3W24A 4GNVA 1ZJAA 8XIMA 3RR1A 3VKJA 5CSUA 1QMLA 3AHTA 4JS3A 2J3NA 1LG2A 3WD2A 5D38A 2BVDA 4LBRA 1LVLA 3B9EA 7XIMA 2WO5A 3NL3A 1LORA 3RPMA 3PTMA 4LRTA 5AN7A 3R13A 1Z42A 2E8ZA 1UZ4A 3VFCA 3Q4DA 4DI8A 5HJLA 4DBEA 1US2A 4E2BA 3LB8A 5A8QA 3MU7A 2J7EA 1B3WA 4YHGA 3PZIA 2PTZA 3BMVA 3MSYA 2J79A 1OY0A 3PWAA 4PFHA 4JDRA 1J11A 3GG0A 4B91A 2PWDA 3IJDA 1JF6A 2VP8A 4H7VA 4GUGA 1Q7QA 1NAL1 2I16A 1GQIA 2J9ZA 1JAKA 2XFWA 1QUMA 3S2LA 3N04A 4KRZA 3N14A 3MUCA 1OJTA 1LRNA 5D9MA 3A7UA 2QW5A 5EYWA 1VIZA 1UP3A 2V2DA 3C0JA 3LHUA 4ASTA 3A47A 5KZEA 4DWSA 2BOGX 1QI5A 1QATA 3CXOA 1RJQA 4L9XA 5FJOA 2Z29A 4AG0A 3RLHA 3WSUA 1LT7A 2QV5A 3E0LA 4JIHA 2G3JA 5AHIA 2HWGA 4CU6A 1XRVA 2R9RA 2ZZ7A 1WXJA 2Y5SA 1PPIA 4KRTA 4PUKA 1I0BA 1K9FA 1GYNA 5GNZA 1E72M 4LBUA 4ML4A 1J0ZA 4I8DA 2PWVA 3ENLA 1LL7A 2MANA 2ZTKA 1S5VA 2QGHA 2OXNA 4I6KA 1RP8A 4JQAA 1DWIM 3IGXA 4RV3A 4F0SA 4NNAA 5CLTA 4QJ1A 2ZZCA 2NUXA 1I45A 2JALA 3N73A 5C2XA 2BDQA 4CLMA 1R2TA 7A3HA 4JCLA 2PDPA 1HF6A 3OP2A 4MIMA 3MMTA 3GKFA 3L5AA 2NQZA 4NYUA 4DN1A 4JN7A 4JZ5A 1HGWA 1R9XA 3NQBA 1GOQA 4HU4A 4EWND 3VGHA 3VABA 4A3YA 1O95A 3LV5A 2FHCA 2X1RA 3NQ6A 2EG6A 5ER0A 3NSXA 3NYDA 1SZFA 1EX5A 1EJUC 1ADDA 2YXXA 4IGNA 1R6WA 3GUWA 2D20A 3ARWA 1O4UA 1E1FA 3W25A 1TJ1A 3WQVA 1ITXA 1QPQA 3AS2A 1LJYA 4BF5A 4YTUA 1LQAA 4L1GA 2OT1A 1TRDA 1DEDA 2OTDA 1UJQA 3RN6A 2F6XA 4M1RA 4Q3MA 4N42A 1J12A 2OZ8A 3OIHA 1BD0A 3QW4B 3G0SA 4LS1A 1WBJA 4ACZA 3RMEA 4AF0A 3C8NA 3CPUA 5D2VA 3AWOA 2NQ5A 1X6LA 3URAA 1SO3A 5I3GA 4A4AA 2A6LA 3BQ5A 3DFQA 2Y8UA 1PBGA 3V0SA 3UGVA 2ZICA 3NYZA 4IFRA 1IZKA 1HKKA 2WXDM 1CYGA 1JDAA 4JEQA 1GZGA 2W27A 3BGGA 2YCEA 3WBAA 1J0KA 1EIXA 1EJRC 4ATLA 3H23A 3IJQA 3W2JA 3GNRA 2W3ZA 1UUOA 3WD3A 2BNJA 5RUBA 4PMNA 4KCWA 4WCJA 2CZVA 5L9FA 3OIXA 1KBJA 1CLXA 3MCMA 4UNLA 2YCLB 2HK1A 4ERGA 3RFAA 5CG0A 3MANA 2ZC1A 3BJTA 4RNHA 2JK2A 3ZJ6A 3AHXA 4F4RA 1OCJA 4CCZA 2A7PA 4AY8A 3WLKX 2VFHA 4RE4A 3AYRA 4WDTA 1BXNA 4I9JA 4HCHA 3LXBA 3OZMA 4NP7A 1W2PA 3BL3A 4GXWA 1SR9A 4LRSA 1WOAA 3S2NA 3Q45A 5JBEA 4FOKA 4GYPC 1SMDA 3EDEA 4B5SA 1MFUA 3LOTA 1JYXA 1W9XA 1W3NA 5E5CA 1JZ4A 2IKHA 5LIKX 4O13A 4FNUA 1TR9A 4P2VA 4LV9A 3TJ4A 1GUVA 1C29A 1MUCA 4ERIA 3LLFA 1GXFA 1NVMA 4XTIA 1M9HA 1FWAC 1YTKA 3MBFA 3NSMA 4JTEA 1OIFA 1V0KA 3LENA 2D2OA 3RM9A 3KCJA 3R25A 1T8QA 3LEPA 2OO6A 3W53A 1MQPA 1YPIA 1S5NA 3H4XA 1A5LC 2YA2A 4HOZA 2YW3A 1KR0A 4H4ZA 3NVZB 4H01A 2WQDA 1BLIA 3L65A 2BC1A 5I5RA 1H0GA 3GWQA 4LWWA 4N4PA 4MNLA 4QFUA 1JRBA 4XISA 1YEYA 3BW3A 5EMLA 1PZ0A 3B40A 3WENA 2C3ZA 3MHGA 2GVLA 3A22A 2IPGA 3OZOA 1O60A 3LBMA 1BTCA 2PC8A 2YFOA 4S3GA 3GHSA 4RNJA 1DJZA 2PWUA 3TCSA 1E4IA 1XSIA 1F3EA 2HTMA 2W9MA 1H11A 3W7DA 5LHEA 2YVFA 4M6VA 2XGZA 2E6FA 4WSJA 4O0QA 3GH4A 3W01A 2FZ8A 2TYSA 1TCDA 4BI6A 3RLVA 4H8UA 3BICA 1U5HA 3D46A 3DZ1A 1I2PA 2EXOA 4HYRA 1A5UA 3BURA 1E9LA 5CC7A 1HJUA 4B9YA 4EAYA 1AODA 1PHQA 3OGRA 3NEVA 3SY1A 4H8NA 3G22A 3EB2A 5AC7A 2KX9A 5HQLA 1EJSC 3GH5A 3NZ1A 3B04A 3AM9A 1L8NA 1EOKA 4GYJA 3BQ6A 4IG2A 3GW0A 3VCCA 4G7EA 2NVKX 3FJ4A 4DZHA 3GZAA 1PKYA 5REQA 3TROA 1GGOA 3FVDA 1GKQA 3UZ5A 1L6GA 1H60A 4BF7A 5FF4A 2QLYA 3W7QA 1GYLA 1XYZA 2C0HA 4CCEA 4JX5A 1G69A 2YOCA 2G96A 1AH0A 3DYOA 2WK2A 5FJRA 2R24A 3GNXA 2EKCA 3HG5A 4LAZA 3VVGA 2ZOXA 1O68A 4GQRA 4MJ4A 4UTLA 4MADA 4K7VA 4PUMA 1H2IA 1KBIA 3AZRA 4GO9A 2IQDA 3BAJA 4Y6GA 3A6OA 3ARPA 3UXIA 4S3AA 2ZUTA 3GHUA 4UZUA 3K5XA 4JIEA 3KP0A 3R12A 3LHYA 1RY8A 1Q6FA 1XPYA 4IFKA 5CZJA 3Q2DA 2OCZA 3QV8A 1Q5MA 1MYRA 4N02A 2VMFA 4WVXA 5CEWA 4M7SA 1CPUA 4L7ZA 2ZRYA 3F2DA 3JZEA 1SGJA 1LL6A 1W9PA 1D3GA 3H4WA 5F2GA 4S2BA 1BXCA 2V6AA 4HTBA 1GVIA 4W85A 1HVQA 2R1KA 2WCGA 1M6JA 2P88A 1U5JA 5CC6A 4Q8VA 2WOWA 5KTLA 2PDUA 1XBZA 3GDKA 1YNYA 3TKFA 1H62A 2WVUA 1EBHA 2YDQA 2IPJA 3QZAA 4D6JA 2YBVA 5DF0A 3TQKA 1RH9A 1FP8A 1NTHA 1WE5A 2A3BA 2I5QA 1H4PA 5A2AA 1XSKA 3SCOA 5H6HA 3RITA 3HJEA 4B3LA 1N8WA 4TVYA 2JKPA 4DQWA 3FJLA 1C7TA 1OCQA 3MDUA 1MQRA 1UD6A 4D72A 4TV5A 1XHCA 2PI6A 3FCPA 4XKYA 3ERPA 3TA9A 2EGZA 4AWSA 1SB3B 3WN6A 4QJ3B 3UD6A 1RY0A 1ICQA 4B16A 3B8VA 3GC2A 3LTYA 3CMJA 2GGEA 4XD3A 3T4CA 4CVWA 2V30A 4IT1A 3PG8A 4IIDA 1MW3A 5FSDC 2Q3OA 1AQHA 2Y5JA 5IXEA 3IV8A 3ZWSA 4LUYA 1R3VA 1XRSA 4N9CA 4Y2WA 3R0UA 1NU5A 3AMDA 3CQIA 4IISA 1FH8A 4LB3A 3W6YA 4O28A 4JN6A 4YVXA 3ZM8A 3R58A 1XYCA 3LX9A 2JF7A 3IWPA 3WZ0E 2V9DA 1ONWA 4EPEC 3JVAA 4FPSA 4FA3A 3PUEA 3GXMA 5I03A 5D9OA 4QHRA 3GDBA 3BLIA 5J5DA 3WD0A 4UQAA 2A85A 1VENA 4HZ8A 4OBTA 3FA4A 4B4FA 3AWNA 4ZXLA 3RXZA 3NQ7A 2XTKA 3EOOA 1QAPA 3RF9A 3RK8A 3N17A 4TMBA 2XH0A 3PWIA 3BZJA 3CZ8A 4YNGA 3VAVA 3TLLA 3HOJA 4AX7A 4HSNA 5DCBA 1YMYA 1RPXA 3BLDA 2PDJA 3ITYA 1W3LA 3HBLA 4J1OA 5CBIA 5BMWA 1S2TA 4FLOA 4B90A 5FL0A 3DFSA 3IIXA 3AIRA 2QDDA 4XX6A 4XD4A 2EJ1A 2VELA 3GB6A 2XVKA 3M41A 2EPMX 5D2XA 3A9IA 2Q09A 1K6WA 3E9AA 2ZBTA 3W2UA 3OQEA 4DXKA 1VQZA 1CXEA 4AIUA 1X39A 4DYEA 4JTRA 2QPSA 2ZZ0A 3ATZA 2GJXB 2Z27A 5K4ZA 2EQ6A 2J7CA 2JGQA 9XIAA 4WUIA 4DJDC 3DFNA 2PDQA 2A2IA 4NZ3A 2QCEA 4ZQNA 3BSMA 3L0NA 4KPRA 4JDBA 1AW2A 1UW9A 4JCMA 1K4HA 1W1VA 1R5YA 4EP8C 2MNRA 1PZ1A 2QZRA 1JNEA 3MMDA 3T0DA 4YHEA 3ZLGA 1HZYA 5HNNA 4HPHA 2YB1A 1BYAA 2O7SA 4O4VA 3IGHX 3P81A 4Z0JA 2OELA 3MSDA 3HQOA 2DSKA 1LWIA 3UVAA 4CN1A 4XAYA 1ML1A 3MCNA 2F8QA 1C7SA 4WGHA 4IPJA 1W1YA 4FIRA 3VD9A 1F9CA 4FHAA 2F5ZA 3TAOA 3CV2A 3QR0A 3VNJA 5G1YA 3IIVA 3RPDA 5A8NA 1TQXA 1HO1A 3H55A 1QJWA 1MOKA 4ACYA 3EX6A 1OINA 1NEYA 4NY2A 4R88A 1TPVA 3TX9A 2G4JA 4OJYA 2ZC8A 4UXDA 1YNPA 4MZYA 2WSQA 1VFUA 2G97A 4N4QA 4Y7EA 4Q8QA 1KTNA 3SY5A 3NQEA 2BHUA 4E5TA 2J74A 1OABA 4PTVA 2QJHA 1XD1A 4RE3A 3LGEA 5J8LA 1ECQA 4DJFA 2OX4A 1UD8A 1DIKA 3MKCA 3DJJA 4LH8A 4KEZA 4H4PA 2GVYA 1YKWA 3E1F1 4EPDC 3PSWA 5A8MA 4HNUA 2QCGA 4K1WA 5H8UA 3E0IA 4MWAC 5T9CE 4M6PA 4IPLA 2BMBA 4HOWA 3PM6A 4ZE5A 5C0QA 2NX9A 1QPKA 3LXDA 3ARVA 3BARA 3B97A 3S46A 3UT0A 1GHSA 2GWNA 3OZPA 3H70A 4GC4A 5EMMA 4Q7NA 1XR2A 1ODUA 3EBVA 3LGGA 3VGEA 3H2EA 1KGWA 1KNWA 2PDIA 3HO8A 5ABHA 3SM0A 2JE8A 3WIJA 5A2BA 1BZLA 2AL2A 1XBYA 2E5AA 3UZXA 3U5YA 1SZRA 2DH3A 2ZUMA 3PS7A 3GH7A 3KE0A 3MV01 2O92A 4O53A 3WMCA 4UCGA 4DVOA 1WBHA 1KRMA 1UKSA 3RJYA 3TYZA 2WMJA 2YJQA 5J5RA 1OFDA 5C9XA 2NV2A 2V63A 3HB9A 4WD0A 3DC8A 1OC6A 3N19B 3WQCA 3KS6A 3IK4A 2GSHA 3GIPA 4C1NB 4HOXA 4TVUA 4IICA 4KCUA 4OOZA 2YCJA 2E3ZA 3SQLA 1J2WA 3S6OA 3FAWA 4ZOCA 1LLZA 3ME3A 3B06A 4EAMA 2ZVRA 1M01A 3WQOA 1N82A 3U7VA 3CQJA 2RJGA 2VRKA 1ZTVA 3M07A 3MBDA 1XYFA 1US3A 1YRRA 1OADA 2GDVA 2ZRXA 5A8OA 3VOGA 3EWWA 1JQXA 4ADUA 4MKSA 4LUSA 2Q6ZA 4O14A 4OIFA 1S7MA 2D0HA 3CBWA 3AMLA 4WXYA 3VOIA 4FX7A 3WNMA 1F8IA 3HRDC 2DVTA 4N9BA 3M0XA 1HVXA 2E5BA 3IJIA 3EWXA 3O05A 1ONXA 2WMIB 4JYFA 4ZQCA 4AMCA 1HJWA 4FNSA 2P3EA 1IEQA 2FZMA 1NDZA 3UCDA 3NG3A 4P61A 3AC0A 2QT3A 1NWRA 1NWTA 1Q85A 5TIMA 1PZ2A 2BHYA 3NGJA 4AZHA 5FEXA 3PZOA 4INFA 2CLHA 3T07A 2ZRVA 4HU0A 1UA7A 3LADA 2W0UA 9CGTA 3M47A 1Q13A 1VJSA 5M17A 1AL7A 3KOWA 3UY7A 3M44A 3UNTA 3WQDA 5D02A 2FMOA 1GRBA 3TN3A 4LUTA 3R94A 3LPPA 3HQ1A 3Q6JA 2F38A 1KCZA 5HINA 3MC5A 4XTDA 2Y7FA 2KAUC 4JTSA 2YSWA 2WCSA 3B8SA 1J2BA 5CCZA 3N4EA 1LDCA 4S1FA 2HVOA 4DF2A 4M81A 4YYFA 3WFLA 3XINA 5I77A 1KM2A 4UFIA 4PTMA 3STGA 3FHAA 4AW7A 5A6SA 4AZGA 3CV1A 1V0NA 1M41A 4LBSA 2Y6ZA 3SI9A 5ABFA 1B9BA 1XQKA 2Z28A 3M0KA 4PMZA 5HATA 3NUKA 3GNOA 7REQB 4BCEA 1R3RA 1ISZA 3I4EA 4LUJA 3U6WA 1KXQA 2ISFA 1GREA 3DHUA 1OEPA 1N7KA 2CCRA 3A9BA 4L1WA 3THAA 2GGIA 4RE2A 5JBFA 4YTSA 3T08A 1XLHA 1H63A 4WKHA 4L6OA 4HCLA 3TC6A 2HISA 1K8ZA 3NM1A 4NT0A 1W3TA 4MYXA 4XZLX 1LPFA 4GI9A 3MZ2A 1NHRA 5TBOA 3VKAA 2QYGA 4UMCA 4EMWA 3N6JA 3KHJA 1ZCCA 3GTIA 4XQ6A 4DXXA 3R07C 2LLEA 3AOFA 2JEPA 2BX7A 1AQMA 1EL3A 3O15A 4J2MA 4XBJA 4K2SA 2WNZA 5HPOA 1IF2A 4ADSA 1SPQA 3I7RA 3RM4A 2ZXDA 4HN8A 3SFKA 4UTWC