3VCCA

Crystal structure of d-galacturonate dehydratase from geobacillus sp. complexed with mg
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
386
structure length
386
Chain Sequence
b'LNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title CRYSTAL STRUCTURE OF D-Galacturonate Dehydratase from GEOBACILLUS SP. complexed with Mg
rcsb
source organism Paenibacillus sp.
molecule tags Metal binding protein
total genus 134
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3vccA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3vccA01
3PWGA 4G7FA 2P88A 1MUCA 3P3BA 1JCTA 3FV9A 2P8CA 2AKZA 1PDZA 3IJQA 1MDRA 3N4FA 4A6GA 3STPA 3V5FA 4IZGA 3GY1A 1EBGA 3R10A 1FHVA 4HNLA 2RDXA 2PCEA 3SBFA 3VDGA 1P43A 2HXUA 2GL5A 3IK4A 2XH2A 3CAWA 3CK5A 3T9PA 4MGGA 2AL1A 4J3ZA 2OVLA 2XH0A 2PP0A 2OX4A 4IP5A 4JHMA 4DYEA 3DDMA 1YEYA 3VA8A 1FHUA 3MWCA 3RO6A 4ENLA 3KUMA 3R0KA 4HPNA 2XGZA 4A35A 3NO1A 1L8PA 2AKMA 4G8TA 2P0IA 3V3WA 2FYMA 2OPJA 3FVDA 2PGWA 5FJUA 7ENLA 4DWDA 3T8QA 2OZ3A 2XSXA 3IJLA 3B97A 1ONEA 5J04A 2OZ8A 4GIRA 3U9IA 3UCCA 1MRAA 3I6TA 3TW9A 4GYPC 3MKCA 2QVHA 4HN8A 1MDLA 2XH7A 1OEPA 4J1OA 3TJ4A 1ELSA 3U4FA 2PTXA 3P93A 2QJMA 3BOXA 1EC9A 3THUA 1TE6A 2HNEA 3VCNA 4A3RA 3JZUA 2PMQA 3R25A 1R0MA 3CXOA 4GGBA 4F4RA 5BOFA 3SJNA 4H2HA 4K2SA 4H1ZA 3T4WA 1BQGA 1JDFA 4GFIA 3R11A 4DHGA 1SJDA 2PU0A 4MKSA 1XS2A 4Z1YA 2QDDA 4ROPA 3I6EA 4FP1A 1R6WA 3DFYA 3SN4A 2ONEA 5FJPA 4ZA0A 4DX3A 3R1ZA 3GC2A 3DGBA 2PP1A 4K1WA 3FCPA 4K8GA 3N6JA 3JW7A 3K1GA 2GGHA 3OZMA 2I5QA 3DFHA 3QN3A 3JVAA 3TJIA 4FI4A 2AL2B 2PTZA 2DW6A 4H19A 3I4KA 4GGHA 4EWJA 4DXKA 3D47A 3VFCA 4E8GA 3N6HA 2PS2A 2NQLA 3UXKA 3P0WA 3ZVHB 3MSYA 1NELA 3FXGA 3QTPA 3BJSA 2DW7A 2GGEA 1RVKA 3SSZA 5FJOA 1BKHA 2QDEA 3UCDA 2FKPA 4HNCA 4IP4A 2PU1A 2PTYA 1KKRA 3NZGA 3SN1A 3VC6A 3DIPA 4M6UA 3RGTA 4HCLA 3FJ4A 3MQTA 4E5TA 3H8AA 4HCDA 2QJNA 1EC8A 1F9CA 1TZZA 2MUCA 3UJRA 1IYXA 4HYRA 5ENLA 1PDYA 3D46A 2OZTA 2P3ZA 2HXTA 3TQPA 3PWIA 2HZGA 2PSNA 2OFJA 2OG9A 3UJFA 2OQHA 2POZA 4IT1A 3TOYA 3UJSA 3CYJA 3H70A 5FJTA 5IDZA 1KCZA 3OZYA 2GDQA 2PP3A 4HCHA 6ENLA 3ZLGA 1JPMA 4IHCA 2GSHA 2OLAA 3S5SA 2MNRA 4DN1A 2ZC8A 2O56A 3ES7A 3PFRA 3NFUA 1MNSA 1P48A 2PA6A 3CT2A 3OTRA 3DG7A 3NXLA 4IL2A 3SN0A 5BOEA 4Z17A 2PODA 3HPFA 3UJEA 3RITA 3ENLA 4X2PA 4E4UA 1E9IA 3MZNA 3V4BA 4JN7A 3QLDA 2PTWA 2QJJA 2GGJA 3RR1A 3SQSA 1ECQA 3QKEA 3ZVIA 4GISA 3R0UA 1WUFA 2GGGA 3T6CA 3RRAA 3VCCA 1W6TA 3H7VA 3V5CA 3MY9A 2QGYA 3DESA 3DERA 1SJAA 3CB3A 3IJIA 3TWAA 3ZLHA 1XPYA 3DG6A 2AL2A 2QQ6A 2ZADA 3FYYA 3MUCA 3OPSA 3EEZA 2XH4A 2P8BA 3Q4DA 4E4FA 2OKTA 1KKOA 4ZCWA 3N4EA 4KWSA 3UXLA 3TTEA 3DG3A 3QPEA 3ZVHA 4KPLA 3Q45A 4GMEA 4M0XA 1NU5A 3EKGA 1KD0A 4E6MA 3GO2A 4YWSA 3TCSA 3DEQA 3UJ2A 1SJBA 1TKKA 3UGVA 3OP2A 4KT2A 5EU9A 2OO6A 1DTNA 2OQYA 4IL0A 4JN8A 3VC5A 4KEMA 3S47A 3OW1A 3TWBA 1EC7A 1JPDX 4H83A 2CHRA 3H12A 3GD6A 1SJCA 2GGIA 5FJRA 4GYPA 3ZLFA 3BSMA 3RCYA 1EBHA 3PK7A 1WUEA 2PPGA 3ES8A 4MMWA 2PGEA
chains in the Genus database with same CATH superfamily
2QUVA 2GQ3A 4MLJA 2E25A 1GUVA 3BH4A 3T0DA 1C93A 4O1FA 1EIBA 4XZHA 4DWSA 1GOIA 4HVXA 5CC6A 4WOQA 3VD7A 1NDYA 1VCVA 1TZ9A 5J8LA 3BLEA 3KBNA 1N2VA 3TYEA 2X1SA 1L2QA 3AQUA 4EKJA 4DUWA 3LHWA 4IZGA 1MEHA 5C70A 4PMUA 1XSKA 3A22A 2TAAA 4XZWA 4EM4A 1EX5A 3HQNA 4LYRA 4MNMA 4BI7A 1R30A 2B7QA 4O50A 3OZPA 5TD4A 3VX1A 1AOGA 2D3NA 3IGUA 1OY0A 4H7CA 1VFOA 1OK6A 2IPGA 3CIWA 1V8EA 3RF9A 2QPSA 4I8YA 1ZBVA 2FZ9A 1W5OA 3W2NA 3W6LA 1UR1A 1WKFA 2GVLA 1WDSA 3EMQA 3WEZA 4IUOA 1JULA 4W85A 3N2XA 4GPNA 3S46A 4NG3A 1O4UA 3GR4A 5CLTA 1AH4A 3LENA 2YVJA 1NQ6A 4V1YA 1GK8A 2QDHA 2I57A 2VQTA 1KTNA 4DWDA 1EH9A 1C92A 2BGSA 3LUTA 1BYAA 3LX9A 4LUSA 1Q6CA 4QX4A 4PBFA 5GNYA 1ONEA 1E3XA 1J96A 5LNSA 4WRHA 1MRAA 5CSSA 1XIDA 2PDQA 2WOIA 4NYYA 4IGSA 4J3WA 2INFA 4J1OA 2V8ZA 2AQVA 2PZ0A 1R2RA 2IPFA 4QJ4B 1FWSA 4L5ZA 4P8WA 2IUZA 2XGIA 2EG7A 1JCMP 4PH6A 3MUXA 4WZHA 2A3CA 3P5YA 4GGBA 1HKVA 1NFBA 4WSHA 2WQPA 3G6MA 4LVBA 2CDUA 3QC3A 1FWIC 4AWSA 3WDHA 4GFIA 5HNRA 2VUNA 3LZ5A 2O55A 2A4AA 3DZ1A 3F5KA 4LQ1A 4WJEA 2O9PA 2BC0A 5DT7A 3PM6A 4XTIA 1DXFA 1P6WA 4P7OA 2GJXB 5GJNA 5FJPA 3U6WA 4DX3A 3WMBA 4WDXA 3RMEA 3W71A 1CGVA 4M7TA 2VJXA 4RCXA 2GQWA 2PP1A 3NPXA 4LH8A 2D24A 3N6JA 4GJIA 3B4YA 1GHRA 3ERPA 3IV8A 4JQ2A 4B90A 2BDQA 4UTTA 4MUPA 2OO0A 2ZTJA 3C8FA 4PTMA 4MM1A 3NXFA 3IIVA 2GVEA 2FPTA 1G4PA 3N2BA 2RHGA 3LM3A 1SR0A 5LA1A 1CBGA 3CO8A 1X2HA 3U5YA 3N6HA 4LUIA 1TB3A 3TH6A 3WK2A 2R9RA 1XX1A 3FIGA 4GCXA 3UPBA 5D8WA 3QTPA 1QVBA 3UG4A 3O0KA 4XIAA 4DM2A 3CHDA 3VYLA 3OODA 1M41A 1V03A 3S5OA 1ISVA 1EHNA 2JEQA 1SQ7A 5EBUA 1FEBA 4OOZA 4G5DA 3GUGA 3I3BA 3URAA 2GJLA 5EA9A 3NZGA 3GNPA 1SMDA 3G3DA 4H41A 1N8IA 3U2EA 4ZO7A 3WUEA 1HJWA 3A64A 3U48A 3AIVA 4LS2A 2PUZA 2JQXA 1BEUA 4WK9A 4ZQOA 3RM9A 1W3JA 6PTDA 1BPLB 4UOQA 3PBVA 1NEYA 2WZEA 3GVWA 3I4EA 3T09A 4UCGA 4ICCX 3W7HA 2YL9A 4PBEA 4JQ9A 1JZ7A 1E71M 4XUGA 2V3AA 1HKJA 4PE8A 4LRSA 5KINA 3TQKA 2CLEA 1KGWA 1W5QA 4I5RA 4IHCA 3GRSA 4PB3A 3AHZA 3S5SA 3WQPA 1ZS2A 2JKAA 3FKKA 3GW0A 4CEXC 4DLMA 3KE0A 3AMDA 1TPC1 3UWYA 1SSDA 3QM3A 4B5VA 5C7VA 1R86A 4MJ2A 4ZOAA 5C9ZA 4U2ZA 2YCEA 1OADA 1DJIA 1LTDA 1P5BA 4ONVA 1FCUA 5BRQA 1Q2RA 4AFYA 3PB0A 1QNOA 1I8JA 2WMHA 1E9IA 4LBSA 3PJXA 2WSPA 3JR2A 5GRTA 2QJJA 3E9AA 3WBYA 3ZVIA 3ZJ8A 2WK2A 3F1QA 1HL2A 3WBAA 2A3AA 1LG2A 2J7DA 4RXGA 4UUIA 5HMDA 1U83A 3T0BA 1EEPA 4JYFA 1I2NA 5REQB 3BQ5A 2ALRA 3I3DA 2CW6A 1E1FA 1E73M 3G8EA 1IEQA 3SAZA 1I2QA 2X8CA 1F3EA 2EG8A 3UXLA 3S6DA 4JX4A 3OJGA 2IW0A 2G0WA 3Q45A 2XN2A 5AVHA 1NOUA 1I1XA 4HBKA 1GORA 3UJ2A 3WDQA 4NZ1A 1V3HA 4CD7A 3EGJA 5AYXA 1D8WA 3OP2A 2V3BA 1YXYA 4GXWA 4BURA 1Q8JA 3W37A 1RM6B 4KEMA 1DE5A 4TVDA 4W5UA 1H7RA 3TWBA 1ZAJA 4Q8PA 5D04C 4AY1A 3WF4A 1PZ0A 1WKEA 4DPPA 3G0XA 1KFEA 4I9JA 1XIFA 4G2DA 3P61A 1WUEA 5IBXA 1XPGA 1D3CA 1FCQA 3RMJA 3QW4B 3PP7A 4HMCA 3QEZA 4ZOCA 5CAHA 3CYVA 4ATDA 3VD4A 2ZTKA 2IKJA 3NQ8A 1GTHA 3L4YA 2DPEA 3UETA 1XW8A 4JY9A 3CGDA 4F48A 3NRZB 1LM1A 3DBPA 3V5FA 1E6ZA 3THAA 1E4NA 1JL8A 2VHLA 2I5IA 3WNLA 1FH9A 5KVHA 3K8MA 2FZNA 2HISA 4ZQRA 1B54A 1QPQA 1PKLA 3LCIA 2BG5A 1P7TB 1HL9A 4GO8A 4NYUA 3K5XA 1FDYA 3NQ7A 1UPPA 4NZFA 4H4TA 3PPHA 3IK2A 2PP0A 3B8UA 1R2SA 4TVYA 3ZJ7A 2WJFA 4BFAA 1FHUA 2G41A 4PEKA 3S1XA 4RJEA 3VILA 3NO1A 3HV8A 2PDBA 3RLHA 3PJUA 1PV8A 1JQVA 1CXLA 3NQVA 1RCQA 4W5ZA 4FOUA 5REQA 3SY8A 4BWLC 4WSJA 3DKJA 1SGJA 4RL3A 2XFYA 3MI2A 4EF9A 1QDSA 1MXGA 3B40A 2HWGA 3M0MA 3QV9A 1E51A 4O1AA 1ZMDA 5LA2A 3P62A 4LC8A 4L4OA 2RKXA 5LNWA 4QM1A 4C6MA 4JTHA 4GBUA 5PTDA 2VENA 2PDXA 1M6JA 1I45A 2ZX9A 4H1ZA 5I78A 6XIMA 3DOPA 1B3VA 1JCJA 1E9ZB 1TPUA 3TMQA 4DHGA 1L6WA 2NX9A 2PU0A 5HUOA 3R2GA 4PMZA 5FF4A 3BARA 4QXIA 4GC3A 2CZEA 3ZR5A 1R6WA 1W91A 3MBDA 3CHFA 1JOAA 4DZ5A 3A5FA 4U5KA 1TJ1A 3L66A 4UFJA 3VPLA 4JIHA 1RQHA 3U8GA 2XPKA 1SO6A 3C0LA 4Z08A 4WXZA 3QSTA 3K1GA 4NU7A 4EPBC 4M1BA 3VFLA 3VNLA 3VDHA 1R9YA 2CXEA 5D09A 4HP5A 3L0KA 1GG1A 1HL8A 2D2GA 3JVAA 3M41A 3SRHA 1ZP4A 2PDIA 1V59A 2A85A 1WCGA 4GZJA 5I3DA 3W7KA 1XV8A 3V75A 1P0BA 1CB2A 3W87A 4MDPA 4Y8EA 4I7UA 2W5FA 1R3QA 4MVAA 5JIPA 1W1TA 1P7TA 1VRXA 4R27A 3UXKA 3EX6A 1L6YA 3HG5A 3ARSA 7TIMA 1I75A 2NSXA 3AFBA 1NDVA 4JNZA 4EMWA 4HU3A 2Y89A 2J24A 3BG3A 3QR0A 1VLIA 3COTA 3WJZA 2R1MA 1VYSX 3PUDA 4PB4A 1XINA 1LBFA 1LL4A 4BEQA 5C9UA 4W7UA 1Q7QA 4IH3A 3ABRA 4Z2JA 3ARYA 3TE9A 3URNA 2CFYA 2VEMA 2DUZA 3FJ4A 3MQTA 5BU6A 2QNEA 1NSJA 1TCMA 2ISWA 1DJXA 4HJWA 3AYTA 3HB9A 3WDPP 3GG1A 1GERA 1MEIA 4GKTA 2EEXA 4O4VA 4QSHA 1RUSA 5B80A 3TQPA 3DI1A 3TCEA 4PYSA 3ATYA 1GYMA 1KR0A 5FEXA 1KWKA 4IT1A 4V33A 5LIYX 1ME8A 4HQVA 3PBMA 3CU2A 1UR4A 1NF0A 2GDQA 4S2CA 2BSLA 4WSKA 4BEUA 6ENLA 4JYDA 1QXLA 3W83A 3PUEA 4OT7A 2V6OA 5A8PA 4ILSA 1C7TA 1V0KA 1RA0A 5TR3A 1R5YA 3UWVA 4FR1A 4NAFA 3PFRA 1DJNA 3OTRA 1KNWA 1SZNA 3FYOA 4I5UA 2R1LA 1E6RA 4FNTA 3SN0A 5CPNA 3E02A 1UYQA 3QBUA 3XISA 2O92A 3UJEA 4ICNA 4E4UA 4DJDA 1EP3A 4GNKB 4QRNA 5CC5A 1B2YA 3TV8A 3KRSA 3OA3A 7PTDA 3UA3A 4JEJA 4JCLA 4G7EB 4KCVA 3MW7A 3NPUA 3TAKA 2E67A 3QHNA 5ABTA 3MUZ1 3SY5A 3QFAA 1TYGA 2F9RA 1JCYA 2FVKA 5A8OA 3AOFA 4XZNX 4LVDA 2VWTA 3W82A 4Y2WA 3BJTA 3GTXA 1NP2A 4PMVA 2WPFA 1XPYA 1H11A 3PZOA 4O18A 4DO4A 1K9EA 3OG2A 1ZKQA 1DHPA 5LIKX 1YNYA 3F7JA 3RG6A 4KWSA 4BY3A 1UKOA 4S3EA 2Z29A 1TV3A 3RR4A 2GWGA 2PDHA 4M0XA 2EKCA 3QXBA 4CEUC 3W70A 4C6JA 3H26A 2YB4A 4R34A 3S0CA 2FHBA 3P2VA 1UJQA 4KFPA 1HGWA 4H4WA 4DBDA 2OSXA 4IPNB 1W3HA 3VNKA 1EJUC 4DF1A 4AY8A 1OYAA 2Z0IA 2NUWA 1ISZA 5A6TC 2OU4A 3NVWB 4GYPA 3WLNA 3RHGA 2JIEA 1UKQA 5A6SA 1K8XA 2A7NA 2XIQA 4YTSA 2Z28A 4DUXA 5D05A 1W37A 1YKWA 2E5DA 1QI4A 1PB0A 2X30A 4XVDA 4FAMA 4ZFCA 1TRDA 3B8SA 2C1IA 4XD6A 2WPCA 3KS5A 1I2RA 4W88A 2ZWYA 4ZEPA 2OEMA 2Q09A 3CGCA 4FF5A 2BB0A 2VDGA 1TYTA 3E49A 4OIFA 3W85A 3IJQA 3WNKA 3GRTA 3RUBL 3VU2A 2P3EA 3CXBA 3TONA 3H2CA 4HSNA 4V28A 1KBIA 4B9ZA 3VABA 3A23A 3FDKA 3BMVA 2YXGA 1IEIA 1KB3A 3NZRA 5C8BB 1F4AA 3R6IA 4O19A 2VOTA 4J7RA 4QG6A 3WH9A 5HQEA 3A7AA 2VR5A 2WVVA 4Y9OA 3VOCA 2BXYA 1VGAA 5BXTA 1UUMA 2DIKA 3EWZA 3NVVB 2JK2A 3VTRA 2AGKA 2TMDA 3LLFA 3VKDA 5JCMA 4G1KA 3DDMA 3LB0A 3G1DA 3VA8A 1XYAA 1Q1WA 3QV6A 5A8QA 3VKBA 4A35A 5C2GA 1ZSXA 4G7EA 5HJYA 3GXFA 4GWEA 1NWTA 3D0CA 2E6FA 1J0YA 2PWGA 3W23A 2DQXA 3OGVA 3FK4A 3DFSA 3WLRA 2PD9A 2W62A 2V3FA 3EAOA 2D23A 1GZ1A 4H3DA 4WIWA 4WR3A 1F3XA 1V08A 3BLLA 3M0JA 4LW7A 3P14A 3KP1A 1FECA 1TE1A 2DUAA 3W07A 1B31A 1OEPA 2YL6A 2ZUUA 5C7HA 5BRBA 1KC7A 1K7EA 1QFEA 4GNJA 2YCIX 4L9XA 3TXZA 3T2QA 4D6GA 4HSHA 1IXQA 1R0MA 4K2SA 4N9CA 3LN3A 1TCDA 1KCXA 4Q4MA 2WWDA 4WEVX 1J0KA 3APTA 1HGYA 5E0KA 3TFCA 4IQLA 1XIIA 1XQKA 1F3PA 1F8MA 2BWGA 2Z2UA 1VJIA 1XLJA 3DKLA 4Z0JA 2PLKA 1E3ZA 2WC7A 1OGSA 1WXJA 1D3GA 5RUBA 3P81A 1VFMA 1YLVA 3USBA 1VYPX 3BGJA 1QR7A 1KGXA 4AC1X 2WMKA 4C1LA 4QP0A 1FHLA 3IC9A 1VZWA 2GRTA 2W4XA 4GI8A 3R1ZA 2C0AA 1UMLA 4GUFA 1KBJA 1S2VA 4I3GA 1SVDA 2E6YA 3DC8A 2TPRA 3VM7A 3P80A 3F2BA 2XGBA 3OZMA 3EOSA 2DVXA 5EYWA 3QOMA 5L6UA 2QKFA 5HNTA 4J3UA 4FXRA 4KQNA 3WH5A 1WBJA 2CITA 2I14A 3LPGA 3MPGA 1R3RA 2OLHA 3DU0A 4NRRA 3H24A 1RBOB 3M64A 4EWJA 1NWRA 3THQA 1GREA 3AICA 1O95A 3WH6A 2XDFA 4QAIA 3WMCA 2YOCA 1IZKA 3P67A 3RPDA 3U0HA 1LBLA 4HOZA 5DY2A 5FJOA 4BZYA 3O63A 1JZ4A 5HWNA 1ONFA 1EDGA 4YIWA 3H6OA 1IT7A 4LCRA 5LA0A 4LV9A 1W31A 2E9BA 4MJMA 4Q3MA 4V2XA 4A3UA 4C6PA 1XLFA 3W1XA 2D2OA 3A5VA 3ITLA 3U2OA 3E38A 3Q58A 3WLOA 3ARXA 1H60A 4QDPA 3EA3A 1CGWA 4A8NA 2CNCA 3N2MA 4UTMA 2DZUA 1OZQA 4IF2A 2Q8XA 5A6BD 3UERA 2XYLA 4FNQA 4L6DA 3L8KA 1I1WA 4H50A 1O1ZA 2QV5A 3UR7A 2VUYA 4F2TA 4UFHA 1LUCB 1X7FA 2QJIA 3NG3A 1YHTA 3LXDA 4B3ZA 4TMCA 1JZ6A 1ZAIA 2GR0A 3G6LA 4JN6A 3NPVA 2Z25A 4F0SA 4Y96A 3KHDA 1KW1A 1NHSA 2C16A 4FSAA 2QUUA 9RUBA 2FVLA 4B5UA 3V0SA 4Q7BA 3SW6A 1ZY9A 2NWSA 1XISA 3QRHA 2VKZG 1YE6A 3QV8A 3WLMA 1VENA 1MWOA 3PF3A 4GH1A 3DGZA 4K7ZA 1JPHA 4Z2GA 4MY9A 1B3WA 2E3ZA 3CAKA 1QWGA 1T40A 3ENLA 1D7KA 2VNCA 3W1LA 5EBKA 2FJUB 4JTQA 3GZ3A 4IIDA 1MZRA 3CPGA 3NA8A 4HU0A 2PLJA 2WWCA 2FZBA 5I3IA 1KCKA 1PXGA 2ZVRA 2E5CA 2ZDSA 2EKGA 3CV1A 1KFJA 3PJTA 3OPSA 1AW1A 3EEZA 5CCZA 4LALA 4Z0SA 3WLQA 1VFLA 5H8MA 5KZEA 2DZTA 1AQMA 2NUXA 4NEVA 3FFSA 3M5ZA 2A2IA 3PB2A 5D2WA 2YGYA 3TR2A 1XRSA 3VZZA 2YA2A 2QDGA 1GRTA 4YNGA 2J88A 2F6UA 4QGCA 4QG8A 2B7NA 4LYPA 3FKRA 3SGZA 2CETA 4HZMA 5C6MA 5T8GA 1GPFA 1MYRA 2OQLA 1JG9A 2QIIA 1GZJA 3ZYZA 4DIAA 2WKLA 4F2BA 1JPDX 3QQWA 3ZWTA 1SJCA 2DZXA 3CASA 3QTGA 3P5ZA 3BGGA 1E70M 3NVDA 3EOOA 5SWUA 3CS2A 4J40A 5DX7A 1L2UA 1XLMA 4QLKA 2WPBA 1GCYA 5HNUA 2ZZBA 7A3HA 3AIWA 4LU0A 1JJKA 4X60A 1EJVC 3AU6A 5GQBA 3VKAA 2W54A 5E5CA 3LQLA 4B2DA 4L56A 1ZJBA 1Q63A 2FZ8A 4G6CA 3KOWA 2CLIA 4H2CA 3AMCA 3H2MA 3V35A 4PUMA 4FNSA 3E3HA 3WYZA 2VTFA 4MNKA 3ABZA 1F6YA 3CIXA 5AYYA 4RPQA 3GFZA 2UV8G 3S2NA 4LAOA 3GBEA 4WKAA 3OBKA 3B8DA 4CNSA 4F9JA 1K9TA 4MB3A 2UY3A 4Z1AA 3TKFA 1TPWA 1BAGA 2XH2A 4W4QA 2FLIA 5FAJA 3K4DA 4ZE5A 3SQMA 2ZZ0A 4J3VA 4GVFA 2WBKA 2C1HA 3F2CA 4L4LA 3WNNA 1O60A 1GQJA 3N11A 3VOJA 4EP8C 4GQQA 3MWCA 2VR4A 4QS6A 1GOOA 3LRKA 3IAPA 3ARPA 2PGWA 4FLQA 4Z2LA 5EMMA 4RE4A 3SJ3A 4D71A 2GOUA 4XZMX 5HA7A 5CGTA 2DT0A 4NIRA 3DK9A 3E5PA 1ZJAA 1JFHA 5FJJA 1I9CB 1SFSA 3OGSA 5AYZA 4M80A 2FZDA 2GJRA 3LCLA 3BLFA 5JXQA 4PTVA 3U7BA 1JDCA 2CPUA 1REQB 1RJRA 2Y2WA 1UIPA 4N02A 4RE2A 3N9SA 4H9YA 1S5TA 3GG7A 3VCNA 1RY0A 3JZUA 2AOSA 3CXOA 5HJXA 3EF6A 1E4IA 4AF0B 2IKGA 2XFRA 4MFEA 3EOLA 5BXPA 3KTSA 3EB4A 1H5VA 3TTYA 2XINA 3S2MA 4DJED 1SO5A 1HTIA 4NJKA 4C7DA 4PCPA 2EF9A 4H9VA 1X7IA 4JL2A 1EXBA 2G3MA 3BMXA 4TOQA 5AY7A 4NL1A 3W2UA 4P7QA 5CG7A 1OC7A 1S7MA 3SR7A 1TPVA 3AM9A 4FLOA 4CU8A 3SM0A 1WDDA 3HF3A 4HTBA 4K8GA 4A29A 1FKWA 1VFFA 1UW9A 2DORA 2I7GA 3OVGA 3ZQ9A 3G1AA 3ZS4A 2Z1BA 3FY1A 1MEWA 2HJPA 4QJ3B 5KSWA 5LGXA 4HGXA 4L4MA 2X8RA 1SUXA 3DGHA 3M0LA 3UPWA 4F79A 2F5ZA 2ZX6A 3I4KA 2G4JA 4D6DA 1IV8A 3PHAA 2YW4A 4AD2A 4QTGA 4M8UA 5IDIA 3UXDA 1JYVA 1BD0A 3SSZA 3N19B 1EDTA 4ERGA 5AHIA 1FEAA 2EQ8A 4ML4A 1RLDA 2FH8A 2QCFA 2VXNA 3VMNA 5A6LA 1XIMA 1J01A 4UTWA 4GQBA 1W5MA 4JNMA 1X1OA 3SN1A 5DF0A 2FVMA 2ZBTA 3POCA 3V0TA 4M6UA 1WXYA 4Q4KA 3KBSA 1JAEA 1EC8A 1K7XA 4LBRA 2IQDA 3VKCA 3GKFA 1MW3A 3INPA 3UJRA 1RQEA 1G4SA 3TSMA 3TYAA 1W1PA 4GKLA 4RNFA 2G3JA 3E2VA 4JTRA 2GLKA 4WKFA 4YL2A 3M47A 3VE9A 1WNOA 2POZA 4HMNA 4NI8A 1REQA 3GXNA 2J9YA 4M6PA 3GHRA 4B5WA 3NQBA 5CKSA 3WQVA 3SI9A 2GQAA 3GDLA 2WW5A 1EUNA 2YX0A 4JAWA 3EA1A 4DEFA 3Q37A 3C2FA 3KBMA 1UD3A 3GXTA 4AF0A 1HW6A 4K3ZA 3R8GA 2CU0A 1IEVA 4LS0A 3UYIA 3WJXA 1GV4A 3G1RA 1GW9A 3NQCA 2J78A 1CW2A 5JBEA 3DJJA 3BAJA 4UCFA 4D8AA 3CGBA 3MCMA 1N5WC 1WX0A 3VOFA 3BUVA 3L2LA 5T9CE 4IGMA 2E9LA 1SYTA 2W6RA 1P0DA 1ZK7A 4QE5A 1MQQA 1H41A 3RM8A 2J79A 3DERA 1SJAA 1SW0A 1W9PA 2Y63A 4GK8A 1D7YA 1XYFA 4IIBA 3EXTA 1LRQA 5FEWA 4ZB2A 1VS1A 3CUFA 4FXSA 3W24A 2UY2A 1F6PA 4I6KA 3O15A 5CC3A 3TTEA 5AVNA 4GUIA 2OODA 2QCGA 3E74A 3P8JA 4NHVA 4UQ9A 3ARTA 2BGQA 3RILA 4YYFA 2C3CA 3GO2A 3MKVA 2PZNA 1TKKA 3VAVA 1DVJA 3UGVA 1PHWA 5E0CA 3CH0A 1OHLA 3NQDA 2H8XA 1UWSA 2GR3A 1E9YB 1XHGA 3TSDA 1O5RA 3JZEA 1G4TA 4E2VA 5AKQA 2WO5A 5CGMA 1MFUA 2V30A 3AS0A 4LVGA 1W3LA 3FXYA 1ENUA 1W5PA 4BF5A 2BY0A 4TX6A 1JEZA 2W91A 3A6OA 2QCHA 3URQA 1B3XA 1KFKA 3DAQA 4O54A 2I1OA 4Y9PA 3PK7A 4V1XA 3ZM8A 2BV9A 5DFAA 2PPGA 3AALA 3LHTA 2EG6A 1JI2A 2BXVA 3N29A 1X39A 2Z6JA 3WEMA 1TZ7A 2NZLA 3S4TA 4MYXA 1HKMA 4G7FA 9XIMA 1AODA 1JCTA 2BCPA 3NJ3A 4W8LA 2BOGX 3B9AA 3NDOA 4NASA 3VI2A 3HU7A 3ZT7A 3EAUA 1A3WA 3AWNA 5GJPA 2XVGA 2HRWA 3W7DA 4R5EA 3M46A 1ZDLA 4D72A 1ONRA 1OFPA 1DOSA 4RX0A 3G18A 1UJPA 1EJSC 4AWEA 3QR3A 3VXGA 3R58A 3NGFA 5FL1A 3GK0A 3KP0A 3WUGA 3CHVA 4UOJA 4TTGA 4S1FA 1KM5A 2BHUA 1VHCA 3LLDA 3M0XA 2WM1A 5K9CA 2GFTA 1AUSL 1J93A 1LOSA 1H7NA 1VIZA 1R3SA 1XLBA 1OX6A 3PWAA 4JQ1A 4EF8A 3M5XA 1H7OA 4J5NA 3LEPA 3VD3A 1TJ0A 2JKEA 2XHYA 3ZFHA 1XLDA 4RZ6A 2NV2A 3T8QA 1G7VA 2PBGA 3GD3A 4EVZA 1YQ2A 1UWTA 1Q6LA 2DT2A 3OB8A 1UUQA 2DVUA 3WDRA 5HNNA 3TW9A 1A5OC 1B1YA 1Q13A 1H4PA 2YBUA 1ITUA 5A5WA 1DWJM 1H2IA 3O06A 1UQYA 3OQ8A 5HPCA 4GVHA 4Y8FA 3U4FA 4WDUA 2XUCA 3QSRA 4S3BA 2C91A 2PWFA 5F1VA 2WV8A 2YA0A 5I06A 2GSEA 4AZ7A 1WPCA 2BY1A 4RZ4A 1KFLA 3AJXA 1V6TA 3AXMA 4MB5A 2WSRA 3ZJKA 1GVFA 3HQOA 2WPEA 1L6GA 3NQEA 3M16A 4OBTA 4F0LA 3ZSSA 1UBSA 5JCNA 1JF5A 2R9ZA 1SJDA 5A69A 2YAUA 3IAQA 4XAFA 1OT1A 2WNQA 3DHDA 1UKTA 4AAJA 3DBNA 2BY3A 4FP1A 4K6AA 4RKAA 3QC0A 1GYLA 2XIBA 3ITOA 1T99A 3MSRA 3T08A 2H9AB 3IVSA 3MVIA 4LUTB 2BGNE 2ONEA 3A4JA 1GOMA 2C13A 2OWCA 3GC2A 4I5XA 4ZSUA 2Q71A 4MOZA 3BSGA 4TVCA 3VIOA 1KBBA 1RPKA 3VO0A 4DNAA 4UQEA 3AO0A 3H4KA 3UU0A 4U3CA 2BX7A 3W76A 3CHEA 3VIFA 3C86A 3CLMA 1OINA 4C65A 1OFAA 4RW3A 1W8GA 3P0WA 1M03A 5KZ6A 2ZRWA 2J3NA 2XVKA 3BJSA 3BLKA 4M52A 2RGMA 1E4LA 4DELA 3RIKA 1KTCA 2F7FA 1VBUA 1UZ4A 4XD4A 4S3GA 2ZX5A 4HPGA 3T8LA 3RCNA 4JIQA 1J5SA 4FNUA 5G1YA 1A50A 2A3EA 1VIWA 2PTYA 3PTQA 3FSTA 5IFTA 1CIUA 2IPJA 1DWAM 1SO4A 2ZRZA 4DY1A 3QOKA 4PMNA 1JIBA 1VRDA 4XKYA 4HCDA 3F4NA 3SUWA 2ZZ7A 4A2SA 3O6DA 1IYXA 2HBVA 4PBGA 2HVOA 4AH7A 2VX7A 1ZBCA 2ZRYA 4YHGA 3U2CA 3SO7A 3PVFA 3GG8A 4DWSC 4NZJA 6TIMA 1Q66A 1CT5A 1T41A 2QMKA 1ICSA 1QASA 4I9AA 4GZEA 2VP8A 3D9XA 3OZYA 1FWNA 1Q6GA 4NNBA 4PEEA 1XRFA 1TWZA 2B4GA 2QCMA 4L64A 3MMUA 4RLIA 3D6NA 1RQBA 4AZIA 1JRBA 5CPOA 4MNLA 3N34A 1X6NA 2DZAA 1XC4A 1KQZA 3NURA 2E6AA 1RJPA 4XBJA 4HNUA 1XG3A 1BFNA 4H7ZA 4IL2A 3BAIA 5BOOA 3PBWA 1VBHA 4LAKA 4AEEA 2GR2A 3BZJA 2QGHA 4HOXA 1KV5A 4K8HA 4K36A 1PTGA 5DCDA 3KRUA 2H9AA 4LUTA 4EQSA 3RR1A 1IT0A 3GW3A 1AMKA 1BTMA 1U22A 1KFBA 1QHPA 3LMZA 4FX7A 5LXXA 4TVWA 2Y6ZA 5I07A 5D30A 1DIEA 1RBLA 4AVFA 3D5HA 5BCAA 5FSEC 2CXGA 4HKPA 3W7RA 2NSOA 1QPKA 1LLWA 2BASA 2REQA 3NVZB 3ATZA 4BQ4A 1OBAA 4GMEA 3PZMA 5KZMA 4QR6A 4ZTYA 4E6MA 1RSCA 1DHKA 1QCWA 1EGMA 1LROA 5D2YA 1Y5WA 1FXPA 1PPIA 4WQ6A 3WNOA 1S2CA 3VC5A 1VPYA 2EHHA 3EMZA 1QRQA 3RX4A 1DJHA 3VINA 3NS1B 4XZIA 3W27A 5IFPA 3OEXA 3GM8A 1FCVA 4IMGA 4R9OA 2PDUA 2ZICA 3IGSA 1WE5A 3LXBA 4JS3A 4ZODA 1W56A 4MPQA 3FHQA 1A5LC 3GIPA 2WJEA 1YX1A 3G1YA 4CD5A 1C8XA 1XLKA 5FF0A 3SRKA 4YTUA 3BCDA 4PL2A 3A7UA 3DI0A 1CNVA 4OKDA 2VZTA 3KX6A 4UTTC 3HN3A 1MUCA 2IMRA 4CN4A 4G1NA 2C79A 4LEQA 4C7FA 4MWAE 2Y5JA 3WJSA 1DORA 1ALDA 1H51A 4ZZ9A 5I02A 3ORWA 1KM4A 3AXIA 4OV4A 4IMDA 2P8CA 5FAGA 2WP6A 4AQLA 4P8XA 3N4FA 3N1AA 3TQVA 4R53A 1EBGA 3RPMA 1AQFA 3PG9A 1EQPA 5AHMA 3QGKC 4HNLA 4YMZA 3VNZA 4S3JA 3GHUA 3VDGA 2Z00A 1EEXA 2VFDA 1T0OA 3O1NA 4PTXA 1FKXA 2GL5A 3AYVA 1KRAC 4MWAD 2J25A 4IUGA 6ALDA 1OIFA 3T9PA 2Z7GA 3PAJA 1IWAA 4WVXA 1WDRA 3CT7A 4LAUA 2WMFA 7XIMA 1TA3B 3DFNA 2VO5A 1ISWA 1ZENA 1H50A 1CI1A 3WK0A 1VFUA 1XP3A 2GJPA 4HJFA 3K4AA 3BTNA 1POKA 2AKMA 5C5YA 2NQ9A 4HIBA 3DUGA 3QMSA 4GVIA 5FS8A 4DO6A 3AROA 2Y61A 1W1YA 1OK4A 3B8VA 5DQPA 4FLRA 2AGTA 3Q6JA 2OZ8A 1EF2A 1FO4A 2OKOA 1B9ZA 4BF7A 3T1GA 1M7PA 4W7VA 3AMLA 2XH7A 4M24A 1BZLA 3N25A 2R14A 1SFLA 3TJ4A 5I09A 2FH6A 1ELSA 3M07A 4KWWA 1Z48A 4DJFD 3BOXA 2R91A 4NUWA 3H22A 2EJAA 1YPIA 1OG6A 3FYPA 2PDCA 1AL7A 3C56A 4ZB0A 4F4RA 1OX5A 4NI3A 2OSWA 1XH2A 4JOMA 4XAZA 2J7BA 2CCRA 1R3WA 2QCLA 1A53A 2PDLA 3BE7A 1WAWA 3VGFA 2OX1A 1ZJIA 1B5TA 5G2IA 4KPRA 3FW6A 2PDMA 2QDDA 1M53A 1Q6QA 3QQ0A 2E8ZA 3CGEA 1AD4A 2DVTA 2O9RA 1QHOA 1GQLA 4F0RA 4IPJA 4NXKA 1DJQA 1X8FA 2HE5A 3S1GA 3TYZA 3U5UA 5EFDA 2E9MA 3EOUA 1W1B1 5I3GA 1A4LA 2ZZ2A 3OGRA 4KETA 2ZDRA 2GGHA 1WYIA 1Z69A 3CTLA 3A3WA 5HWMA 1UG6A 5T26A 1TV5A 1Q4WA 1MQRA 3VMPA 4R33A 2OSYA 1EXPA 4NJGA 3T0AA 1HP5A 2V0TA 2A79A 1WOAA 1WZMA 2PE4A 3RK8A 5F4XA 1NELA 3FXGA 3A4XA 1B3OA 2ABAA 4ZFMA 5K2ZA 3KLLA 3WUFA 2H3DA 2HSAA 2EBNA 3GH5A 3CAQA 3SEPA 1VEOA 2OT0A 1UR2A 2QDEA 1NM9A 1TA3A 3E0LA 3PAOA 2CZFA 2F2HA 4TV6A 4IP4A 1AQ0A 2PU1A 1UWAA 3VM5A 3HMJG 2WNNA 2ZZ5A 3DIPA 3EX2A 1XIBA 4FO4A 5IBXC 2DIJA 1F2JA 4J28A 2Q01A 3L67A 1VJZA 4KIEA 1PDYA 2PEVA 1NDAA 4Z1BA 4B5SA 1U5JA 4IQEA 1GETA 1P4CA 4ZOEA 2BVWA 4MPKA 4RR4A 2OOFA 3TROA 3LTSA 1GOKA 4W87A 3TOYA 5ABEA 1BQCA 4RDZA 1CECA 4QAWA 1OFRA 1W54A 3BURA 5D9PA 1IXNA 2BHYA 1B4KA 1OD8A 4XTDA 5CZTA 3G1VA 1TMQA 4JDRA 4QS5A 2X7WA 1VD6A 1XJBA 1AW5A 3HJEA 2PD5A 1EDQA 4M1RA 1U1JA 3NQ2A 1YBQA 3TC6A 4KGLA 2V3GA 4LF1A 1GVRA 2J74A 3LXAA 5JBDA 3JU2A 1OT2A 5LHFA 3PZVA 3URBA 3GXIA 3B9NA 4IMEA 3STFA 5C54A 3P82A 3S8HA 4D2JA 4PSRA 2ACQA 4ATLA 3V4BA 1NARA 3R7MA 4LY8A 4FR6A 1UUOA 1VYRA 2XVPA 3WN6A 5CC7A 4APNA 3AIEA 3M4HA 2A7PA 1F3WA 3T07A 3B8WA 3HPAA 1IHIA 1E55A 4GUHA 1YDNA 5XIAA 3UNDA 1BSLA 1V0LA 4AD1A 1PTDA 4HA0A 4Q8WA 3FEQA 2V5DA 5B7YA 3AWOA 3TK7A 1PX3A 3QPYA 4GC4A 1RP8A 3GE7A 5JCKA 2XH4A 4KWUA 2WZHA 3BZGA 3N73A 2X1UA 4JFWA 4C6KA 1AVAA 4JCMA 5ABFB 2Y1HA 4XSMA 3GTIA 4TVUA 5XIMA 4YWSA 1KBKA 4UTIA 3Q2DA 4EACA 1SJBA 4QBXA 5HPOA 3W9ZA 2AMGA 1ZX9A 1AJ2A 4M51A 3ABSA 3GH4A 5GPRA 5BRPA 1ZQ5A 1H7XA 3S83A 4DBUA 2BHZA 1TR1A 2H90A 1MQPA 5DCEA 5A6BA 5HINA 3B4UA 3AIBA 2DSKA 5IRPA 3LQGA 1ZALA 4L61A 3KM8A 1LP6A 5FJRA 4R7WA 4FZIA 2XN0A 5G4EA 4U28A 1UP3A 4ADWA 3WIJA 3RYSA 1JXJA 2PGEA 5J5DA 2JK6A 1F76A 3ONCA 3Q65A 2V68A 3S9YA 2BVDA 5CJNA 2P88A 3EBVA 1QAPA 2XFFA 3TAOA 3IIOA 1HVQA 1AZ1A 1P0KA 4Y6GA 2JFEX 4WKHA 1UKSA 2AKZA 1PDZA 2IKIA 5A1AA 2ZE0A 2O7QA 5C9XA 3IIPA 3AUOA 2V6AA 2AAMA 3BDKA 3EDDA 3LXCA 5E09A 2CESA 2A8XA 4ATWA 4EWND 1EGVA 1XIJA 4PMXA 2CBIA 3GHSA 1US0A 1CTNA 2V69A 4NRSA 4LC6A 4QLJA 3B04A 2PGFA 3C2VA 3BOLA 3CK5A 1XIGA 3C2OA 4C1NB 1XLEA 2XH0A 1W5NA 3SZ8A 1WZAA 3LG3A 1OIMA 4H6EA 4INFA 1HFBA 5CZSA 4OFCA 1RP9A 4PFHA 3HG4A 2WQDA 1FY6A 3TR9A 2HEJA 3V36A 3A12A 3BPWA 4S3AA 2GH5A 3DFTA 7ENLA 1O5KA 2XSXA 4AB4A 1X1ZA 1W9UA 3R8HA 1V7AA 2NXHA 4GIRA 3ANYA 3EXRA 3KZPA 3LZ3A 3UCCA 4KWVA 5EMKA 3PUGA 2Y0FA 1M7JA 2DH3A 3HTWA 4HN8A 3DFPA 1POJA 2ZOXA 4D6HA 2PCQA 3LBCA 4HK6A 2E1WA 5A2AA 4CQAA 5MKGB 3WENA 3OYXA 1TE6A 4ZTXA 4A3HA 1E0VA 4A3RA 5FS9A 5EKYA 1VB9A 5BOFA 3HO8A 1OX4A 4H2HA 5D33A 4EQWA 1I2PA 4GXMA 2F6XA 1PZ3A 3TUUA 3CQHA 3FAXA 5CSYA 4E3TA 4DJDC 1XS2A 4WGHA 1DYSA 2HDJA 4DBSA 1K8YA 3NQMA 4I9TA 3LGDA 1PJ9A 2DZSA 3QJAA 5B7ZA 4AXNA 3UW6A 2RUSA 2ISDA 4IMFA 4Y9NA 3N3MA 4UTHA 1OJTA 5LYRA 4LV4A 4E2OA 4TUFA 4ZA0A 4CN1A 2ZUVA 2V82A 4HSOA 4O8AA 3A13A 3DGBA 3L0NA 1VKFA 5TF0A 4EAYA 5DLCA 1EKOA 5A2BA 5BMXA 1XLLA 2A21A 2I5QA 2YYTA 3QN3A 3ABQA 2ZZ3A 4GJJA 3KHJA 3VCRA 4WY0F 4I8DA 2PTZA 3HBLA 1UOKA 5LIXX 3IEBA 2QEZA 2QCDB 4YJ5A 3W2KA 2VX6A 1TR9A 1J6OA 2NQLA 3KEHA 1FHDA 5FS6A 4CCEA 3IJ9A 5EMLA 3CWHA 2J27A 3LCHA 5DMYA 5CPQA 4B15A 3OIHA 4C1NA 3WMSA 3HRDC 1JF6A 4HPJA 3ME3A 2DZVA 4UTFA 5I3KA 3B0VC 3T40A 4Z2HA 1IZJA 3NDYA 4HT3A 5C0QA 3WDIA 3W1UA 5E6ZA 3URHA 3S1WA 3SFKA 3MWAA 3B0XA 3CZ8A 4Q8QA 4QDWA 1RBAA 3UZYA 3DC0A 4AVOA 1VHNA 4AYGA 3SRFA 3GC4A 1EQCA 3OA5A 4NT0A 4OUEA 5DELA 5E9AA 3UR2A 1ME9A 2OXNA 3OQEA 1JPIA 2GDUA 3TW6A 3IIZA 1US3A 4OQVA 1CXIA 3TJXA 3K30A 1H3GA 1S3TC 5CSUA 3PBUA 1GOXA 4KRTA 3LPFA 3GDBA 4Q4RA 4AW7A 3WQ6A 2R6OA 3CUGA 1RR2A 1BWCA 1WAUA 2XIMA 4CD8A 1A5MC 4GFSA 4DJEA 4FIRA 4X0VA 5HAOA 4HYVA 4H6RA 5CEWA 1V3JA 2BTMA 1QI3A 3PY2A 1NP0A 4AHPA 3DG7A 1T5AA 2Z1SA 3GAKA 4IPLA 4GIYA 1L8NA 3NYDA 4AD0A 3AIRA 1YPXA 4CD4A 2VL4A 5E70A 3KBWA 2VOMA 2XIJA 3T7VA 4NNCA 4MIMA 3UD6A 3OU8A 1CXFA 1UB3A 2O7SA 1IWPA 1ECQA 4GISA 3VD9A 1WUFA 1QNSA 2YZ5A 3TQ0A 1C29A 2GGGA 3VCCA 1KRMA 2PRLA 1GSNA 4JX5A 3ABXA 1XUUA 3W1QA 3IJIA 1M5WA 1VJSA 3DG6A 3NEVA 4CCDA 5C9WA 2QUNA 3G1HA 2OKTA 1CLXA 2AAQA 3V5OA 1G5AA 2QCDA 3N4EA 2EO7A 3C0SA 4YHEA 3G1SA 5K7JA 4JXCA 3EKGA 5C2XA 3VD5A 1JD7A 1X96A 2XZ9A 3MUAA 1C7SA 1J10A 4ZBCA 3G1XA 3PANA 1YQZA 1EO5A 1JQXA 3KCJA 1PTAA 1IGSA 2OO6A 3R79A 1DTNA 3NSXA 1FP8A 1MSSA 1XANA 4UTJA 1OCNA 1QBAA 1EC7A 2WSYA 1TJ2A 5DBUA 2Z7KA 3IJ6A 3BL3A 3HV9A 4DYKA 3EPNA 2J7HA 4C6NA 4K39A 3R5EA 1UZDA 4GINA 4MAZA 4DAIA 2F84A 1DL3A 1J0HA 3FGCB 4PA8A 4GRTA 5EL1A 2X8HA 1NTHA 2A7RA 4LJ3A 3WZ0E 1WXZA 3UG3A 3B9JB 2G50A 4YTRA 2O4QA 1ISXA 2J6XA 3A9IA 3WQ4A 2YZRA 5K9DA 4LVFA 2IXUA 5JVLA 1LG1A 2XVNA 4RXFA 1OM0A 3L4TA 4OU1A 4TO8A 1TV8A 1XXXA 4KF1A 4U4MA 2FFIA 3JUGA 3SCTA 3FVMA 4O11A 4JPGA 3GY1A 2V81A 3TZFA 3LOTA 2YCKX 4XWUA 3KVMA 1DJZA 3NQGA 4D1JA 5D2VA 1GJPA 1TPFA 4JFSA 1UQZA 4L6HA 3WSUA 1FWFC 3KFTA 5G1MA 3L5LA 3CZJA 2RDWA 2Z6IA 1N61C 1SPQA 6TAAA 3A4AA 1UR3M 1JPKA 4J3ZA 4H4XA 4AU0A 2Z1WA 1F74A 2TYSA 4IFRA 2PLMA 5XINA 3CPRA 1KRCC 1ITQA 1IIHA 3NOEA 5A6KA 3L4VA 3ZT6A 1UWRA 3W7CA 5HOSA 3BANA 4HK7A 2V63A 4PUWA 4GRSA 1ZAHA 1E5JA 2FQIA 1PSCA 2BFGA 2YCJA 5H1WA 2WOVA 4UWMA 3W74A 2PWHA 3PR2A 2DIEA 3WD4A 4QJ5B 1GTEA 1EP1A 2WVSA 1TELA 3DGRA 1J0IA 3N6QA 4H4PA 4GNVA 4IFKA 2BNJA 3ARRA 2WKGA 3MCNA 2RABA 2X0HA 3P74A 2ZX7A 2NVAA 1S5NA 2VGBA 1PCWA 3P93A 3I68A 3OC4A 2Y24A 3PN8A 1EC9A 1AH0A 4LTSA 4UQBA 1KV8A 1J11A 4Q4QA 4H4RA 3R25A 3F5JA 1DWHM 4LA1A 3PFMA 4H4VA 4FX8A 4LT9A 5CH9A 1QPOA 1J6PA 4KCUA 4QNWA 4WF7A 3KCLA 1F73A 3UR5A 4B4HA 1R47A 2X16A 2PDNA 3SURA 3W26A 3BW2A 4XIMA 5FESA 3CUZA 3DFOA 3FGCA 1ODUA 1H1YA 2CLMA 2TRSA 4BI6A 2QCNA 2WCSA 1A0DA 3LPOA 2ZX8A 3GDTA 3WJYA 3HGJA 5K4ZA 5ECUA 3VNMA 1X6LA 3AXKA 1BSIA 3GNXA 1DJWA 1IT8A 4GO9A 1ODZA 2CLKA 4QE4A 1DWGM 1MO9A 3LTPA 2GUBA 1PL9A 1X38A 2W9MA 1UASA 4EOUA 1X1NA 5F2GA 5HDRA 1JRPA 3HFTA 1B90A 3EX4A 2NVKX 3OLEA 3KOXA 4P8UA 2Z4GA 1GJWA 2NXIA 1OWQA 4FX9A 4NKCA 3GTNA 4AZ6A 4CNNA 5DMLA 4ZQMA 2YDRA 1TPH1 4JQ3A 4PRTA 1IR2A 1VH7A 5GNZA 3NGJA 3CHCA 4N7QA 4LAMA 1B30A 1F7BA 1PKNA 2YXXA 1KTBA 5DMNA 3H8AA 1U1UA 1F9CA 3K4WA 3PZGA 4WLCA 1V0MA 5FF2A 4BS0A 4HNTA 1S2UA 5KTLA 2VGIA 2YB1A 3LS9A 4O57A 3OYZA 3WQGA 3PPGA 3SECA 3IGXA 1BG4A 3GNDA 2Y5EA 2XVLA 1MZHA 3REQB 4A3YA 2HZGA 2GR1A 1ZRQA 4R85A 2PWDA 1A80A 3LD5A 2J8GA 4CCZA 1M9HA 3OHMB 2WJDA 4N0RA 3G77A 3ZR4A 1GW1A 1VF8A 3GQYA 4TIMA 3M44A 1LQ2A 2VZSA 5IHRA 1LDCA 3TMLA 3TYDA 1XDIA 2ZE3A 1P6BA 3B9EA 4IJRA 1C9WA 1FWTA 3G1FA 1FWAC 1O94A 4FA3A 3L2IA 3S3GA 1BVWA 2VMFA 5JBFA 1GXFA 5FACA 1DJGA 4DJDD 3C4UA 1W1IE 3QFWA 1V93A 3QY6A 2WLZA 2ABBA 2ZC1A 4FIQA 2XM1A 2E8YA 2BS9A 2J9ZA 1XRVA 1BHGA 2PTWA 1J12A 2C15A 3QKEA 1OFBA 3IJ7A 1ONWA 1MMFA 1Z41A 1KQYA 3WD2A 2VQUA 1HNYA 2DEPA 1OABA 1A0CA 3FEMA 1KRBC 1UD5A 2QPUA 5D03A 3WBEA 1ADDA 4GXPA 2QQ6A 2ZADA 2ZZ1A 3MUCA 4DPQA 1UR9A 3Q4DA 3LCXA 4H4ZA 5F4WA 2OLSA 7REQB 3CBWA 3W1AA 4WDWA 3EWBX 1YTKA 2EGZA 3DG3A 3G22A 3K2GA 3PZIA 1RALA 4TQTA 4OECA 5E0FA 3VVGA 2G37A 3PSVA 4QDMA 4FDCB 1AQHA 3TCSA 1JDAA 5U1OA 1G0CA 4GUJA 2OWWA 4AZCB 4O1EA 2WHMA 3DJGX 1E6SM 1OC6A 3SCSA 1XH0A 3M9YA 2E7FA 4EE9A 1QI5A 3MUIA 4F9DA 4MTVA 1A47A 2AAAA 4K8DA 2HK1A 3EKZA 3H12A 3N2CA 1LF1A 2YCLB 3N9RA 4HA4A 1S39A 5AZ0A 1TVPA 4F2UA 4C6DA 1HJQA 4GZ7A 3ICJA 4ORIA 3MV11 1EA9C 2JF6A 2XWEA 4LXFA 2I16A 3I7SA 3O3RA 3H54A 4NAFB 4PSPA 4O12A 4IGNA 1ME7A 2ACRA 4QISA 3REQA 2BP1A 1KXHA 4P8VA 3H4GA 1FWWA 3KOZA 3G0UA 2YIHA 4MWAB 4UBPC 5I3FA 3M43A 3RO8A 1O1HA 4UFIA 3NAVA 2R8WA 3LB8A 4YCPA 4IISA 2YDSA 5I5RA 1K6AA 2ACUA 3R0DA 2PF0A 2CWXA 5JCLA 4XBKA 2VI0A 1E9LA 1XH1A 4U33A 4OGZA 4MGGA 4Z2KA 3SSJA 2CEQA 4PODA 2OGYA 4UTWC 1SMAA 5A6AA 1D2KA 2J8FA 1JUBA 3CQ0A 1R8LA 3CC1A 4HPNA 5D9NA 4N6EA 3BICA 1L8PA 4EX4A 1K4HA 4G8TA 3E2QA 1CB7B 3LGEA 4ASTA 2WPGA 2CZDA 4IXHA 3FVDA 4XSLA 5EMUA 2DSUA 2O9TA 3T05A 4IP7A 2FPVA 5JQ9A 1XSIA 5J04A 1KXVA 2CYGA 3HGRA 5HWJA 4XAYA 5F2IA 4NF7A 5G2HA 3SFWA 2NV9A 2J6VA 3I6TA 5MHBA 1G69A 1J18A 2WCAA 4XO6A 1C8YA 1MUMA 2GQ9A 7REQA 2J7EA 1UWUA 2QCEA 5FI8A 2J66A 1JUEA 3KWXA 2SFPA 3AS3A 2VWSA 4S3CA 1F8WA 5F2LA 2NUYA 4X3ZA 1BTCA 3H2NA 3UFYA 2VDHA 3CMGA 4AZCA 4A05A 3N2OA 4ERAA 4FHAA 1EJWC 1TPDA 1O5QA 3O6CA 1JR1A 3GDKA 3T4WA 2BY2A 5LKYA 3GXPA 3BW3A 2YCLA 3MO7A 4C6CA 3K46A 1Q2SA 3BVJA 1Q6OA 4QQUA 4AY7A 3FAWA 3BO9A 1E72M 4V15A 4QE1A 4JL1A 3IJDA 1Z9AA 3M5VA 1R85A 4UR7A 2V2CA 3L65A 2ZXBA 3OLDA 8XIAA 3RPTA 4MG4A 3S1VA 2OZ0A 2WVVB 1KLZA 5D32A 3AMZA 2HVMA 1TJRA 5E1QA 2PBOA 8TIMA 1W3KA 3T2PA 1AA1B 4FMVA 1WQ5A 4FS9A 5FF3A 2GK1A 2VFEA 4UQAA 4B5TA 1LWHA 4MWAA 1CGUA 1GEHA 1NOFA 4LS1A 5LIWX 4AIEA 2VRKA 3QVQA 1U5HA 2DW6A 4GY0A 3D3FA 2YLAA 4XBSA 1LZOA 4H8NA 2VC9A 1H7PA 3H55A 4ZQNA 1J0JA 3O07A 4XAPA 3KVKA 1K7FA 5D37A 9CGTA 3DH9A 4UR8A 3RM4A 3ITYA 4KIRA 3SDOA 3WF1A 3CPUA 2POTA 4A22A 3N04A 2WBAA 3KXQA 3M0IA 1CYGA 2P50A 4TX9A 4AC7C 3W75A 1H63A 3TTQA 2G4FA 5AHEA 2WJZA 3LHYA 5EGRA 5CG0A 1X98A 1K02A 1OCBA 4YLWA 2VR2A 3AYSA 3WQ5A 2FGBA 3BK0A 1WKDA 1JCNA 3QHMA 1AG1O 4MZYA 3RNMA 1F5ZA 4DNHA 1TZZA 4JFUA 5IM51 3RJXA 2J47A 3D46A 4FLSA 1YDOA 3RLUA 3MP4A 4OE7A 3IANA 3BQ6A 2JGYA 4LY4A 3GDRA 5CJMA 4K8EA 4DJFA 1GRHA 1QW9A 4KRUA 4ORMA 2WNWA 3M0ZA 1IXPA 5FKYA 5E93A 6REQB 4H4UA 1GRFA 1SW7A 2J8TA 2QT3A 3M7SA 5AC6A 3MP5A 4YS1A 3WLPA 5IDZA 3VGGA 1QK0A 4GQGA 1W1VA 1YDVA 4F66A 3MDWA 2L5HA 4HCHA 1HN1A 4H6QA 3SCQA 2QCCA 1DQUA 2MNRA 4PUEA 2QF8A 1CX9A 2ZRVA 3BCJA 2WSKA 2WOWA 2ZC8A 3ES7A 1P48A 1UPMB 1TFVA 3NL5A 5LSMA 4M6QA 3BLOA 1ZCOA 4F0MA 5LGZA 3EUB3 1QK2A 3P84A 3A24A 5I23A 3HA1A 1DE6A 3PS7A 5HULA 4XISA 1GRGA 1FWCC 4EANA 5BMWA 3VNDA 4A2RA 4OZOA 3T6CA 3MDUA 3AMGA 4W84A 3PG8A 2VFHA 3P60A 1RHCA 2NQHA 2Q3OA 1EX1A 3WLHA 1HT6A 5AC5A 2HBXA 4N9EA 3W2LA 2P76A 4UNIA 5FEZA 4G9PA 1T96A 3OVPA 3DHUA 3N14A 2XSBA 3M1ZA 2KX9A 3OVRA 4PUDA 4Y9AA 1NQKA 3QZ6A 4K68A 2P5NA 4PN2A 4XX6A 1XGEA 2ODOA 1YXDA 1OC5A 3TP4A 1NU5A 2CERA 4US6A 1HO4A 1VBRA 3DEQA 3SCUA 2UBPC 1JGIA 3IUDA 3FA3A 1R7AA 3QZAA 1FTXA 2DZBA 3WBWA 1V79A 3KOYA 2CBUA 3O16A 3OO2A 2D3LA 5K9XA 1TV7A 1N82A 3BLPX 1YXCA 4HZ6A 1OG0A 2EQ9A 5M17A 2OELA 2VFGA 5AYBA 2GVYA 4M6VA 1UWQA 4O52A 3ZWSA 2Q6ZA 1SSGA 4AD5A 2CWNA 3WLSA 3ZLFA 1N8FA 4WHBA 3ETRB 3CZKA 2DQWA 2V9DA 3KAOA 3MHUA 2ZRUA 3LSCA 4FNPA 2GYIA 4EMIA 3EXSA 5BNKA 4X63A 2ICSA 3O0HA 3O2LA 4CQBA 3R89A 4PCTA 3WF2A 6REQA 3P3BA 3LPPA 1AMYA 3GFYA 1OVDA 1TIWA 3N9KA 3TLLA 2NT1A 3WQCA 1ITXA 2E5BA 5DY3A 3M6YA 1LPFA 8A3HA 1R9ZA 2DZPA 3KLKA 4HPHA 3P7YA 1THFD 3R10A 3S6TA 1GEUA 2PGRA 1UOZA 2FHFA 4PRRA 4P5UA 4DO5A 1P1MA 4UFMA 2ZYFA 1O7AA 1H0GA 1EO7A 4XD5A 1R87A 1JNEA 4Q4SA 1OGGA 2X50A 3KL3A 1BWKA 3W2MA 3NL3A 3BV7A 4H8VA 1DV7A 1A5BA 1WO2A 1K77A 2WAGA 1W3IA 3E0WA 3C61A 4XO7A 4DRSA 3W72A 2BLEA 4BJHA 3GSMA 1JZ2A 4M19A 4MLRA 2F8QA 2XGZA 3AI0A 4J3TA 2I9EA 3VNIA 3L4ZA 1KR1A 4OTKA 2UZ9A 3UA4A 1D3HA 2FDSA 4ZR8A 2QUTA 2X7VA 1ZJHA 2O4MA 3ABOA 3MMWA 4B5NA 4JKMA 2QPXA 4JTJA 1P6CA 2ADAA 3TXVA 1TIMA 2OEKA 4XV0A 3XIMA 5A6JA 4KRZA 3GVGA 4U31A 4CU6A 2DU2A 1MDLA 1N55A 4ZL1A 1GG0A 1UC5A 3IVUA 5HMFA 5JRBA 3UVIA 1WBHA 3FSUA 3RU6A 3SQPA 3LRMA 1PS9A 4LYQA 3STGA 4Q8NA 3NPWA 3PNUA 2VC5A 5F1UA 4ADUA 2QAFA 1JEHA 1FIQB 5BXSA 3NIYA 1LQ0A 3AYRA 4E8DA 2V38A 4CQDA 4HNNA 1BQGA 1G6CA 1W8SA 3QYSA 4BKNA 1FWRA 2IKHA 5F7UA 3W22A 3GNOA 1H61A 1GVSA 2F6KA 1V3MA 4J9JA 4HA3A 5DMMA 3DFYA 3N12A 3AXXA 5A94A 1ZXIC 1D7FA 2VVNA 4H9UA 2D2JA 4IMCA 2H8ZA 1EJ7L 1HKWA 3GR8A 2E28A 4ALDA 1YNQA 4K7YA 3UZ5A 3VUSA 1XM3A 3I65A 3CL7A 1Q8AA 1VEPA 3O6AA 4JEQA 4O14A 2VZUA 1EL3A 1VBGA 2DSVA 3LHZA 2RAGA 4ZQCA 1E40A 3KCOA 3UR8A 4Q4OA 3TW7A 1CGXA 4ZGYA 3UZZA 5GJMA 3KDNA 5G4HC 3BJFA 2B7OA 1SFTA 4QIUA 2F61A 1M6IA 1RV8A 1D9EA 1Q7MA 4BK9A 3ZVHB 2O0TA 2GWNA 3IJ8A 3V18A 3C3UA 3SCWA 7TAAA 2OMAA 1JDEA 4NP7A 2WOQA 2DW7A 1O12A 4YN5A 3KLJA 3ARZA 3UY8A 1I4NA 2ZUMA 3TYCA 4M81A 3UXIA 3MSGA 1AW2A 3O05A 1W9BM 5IOBA 2RH9A 3R43A 3W3OA 1W2VA 4LUJA 3GH7A 4ZOHB 4JDYA 4C7GA 3KVLA 3VC6A 4GJ1A 3WEOA 3Q94A 4GQ0A 3T0CA 1ONXA 3H23A 3W88A 1FXQA 4NJJA 2YVFA 1TRIA 5A8NA 2ZXAA 4IIGA 3WMLA 5DN1A 3K13A 2P1FA 3HIJA 4RZBA 2BMBA 3WQFA 1YE4A 4ICMA 5G5IA 4UFKA 2OZTA 4JX6A 1TPB1 1WV2A 2YW3A 5DBTA 2CC0A 2OQHA 3FOKA 4C60A 3A21A 3LBOA 5FJTA 1UHVA 2GDVA 1WZKA 3PG6A 3LNPA 1QUMA 1IEWA 3VOHA 3B0UX 1BGGA 3GNRA 2X40A 1PKMA 4S38A 2CLHA 2E68A 3GVRA 3AMKA 1MNSA 2J62A 1QO5A 1L6SA 1TUXA 2HQMA 3V1PA 2XU2A 4EPDC 2PDGA 1QHZA 4B4FA 3AHYA 3LV5A 2QLYA 1PX8A 4ZO8A 3G2GA 2FTYA 1R3VA 3WFAA 3ZR6A 1KXQA 4HNVA 3L2MA 1AD1A 1BYBA 3T55A 4PZVA 3V16A 3GIYA 4H9TA 2A3HA 4WX2A 4E38A 1ZMCA 2WXDM 1F6KA 2X2YA 3R0UA 3EB2A 2NLIA 1X2GA 1R38A 4EK7A 3W1RA 1W6TA 3H7VA 4RNJA 3MY9A 2QGYA 3DESA 1KLYA 1GONA 5AC8A 1O6IA 1RY8A 4YYCA 3STEA 3ZLHA 2NQJA 3VZYA 3ZXWA 3NM1A 4MADA 2ON3A 2Y62A 2WYSA 2NX1A 1I2OA 4FK9A 3PPCA 5G5GB 3OLGA 4AZ5A 3ZVHA 8CGTA 4KWOA 4PMRA 1FRBA 2A6NA 2PC4A 4GYKA 2V3DA 4KT2A 3WQDA 4JICA 3SIZA 4OOUA 2CKRA 3WX7A 1QNRA 1FWGC 5C2CA 1H1NA 4US5D 3A4WA 3WL0A 2KAUC 3SY1A 4Z2IA 1QBBA 2VEIA 3II4A 3AS1A 5IXEA 2Z24A 1V3IA 1P0EA 4F40A 1OCQA 4ZOBA 2D22A 1G01A 1GPWA 1UR0A 4LF2A 4O15A 1Q1RA 1DIKA 4O53A 3ARVA 4PB5A 4JBRA 4FOKA 1Z7AA 2W61A 3UVAA 4H7VA 4EM3A 3D3AA 2YVGA 2X0YA 5LNRA 2VFFA 3FV9A 1XD1A 3QF0A 3RJYA 2XSAA 2PF8A 6CGTA 3MJYA 4GIAA 3QY7A 1LWJA 4IJCA 4NZ3A 2J75A 4X61A 1AJZA 1Z42A 4H4IA 4ROQA 3EPOA 4QFUA 4KMQA 1SR9A 4AEFA 1GWJA 2PI6A 1NJJA 1ZGDA 2GJXA 2JF7A 3EB3A 1E4MM 1P43A 1A0EA 1XBVA 4URIA 4YVPA 3RAOA 3L5MA 3JRKA 4KW2A 5AYIA 3L5OA 2YQUA 2FB3A 2AL1A 3WLKX 1J0ZA 3IIXA 4LFYA 1T7LA 3FA4A 1RCOB 4C5YA 3TN6A 1NFPA 2ZXDA 4IP5A 3THCA 4JHMA 1HX0A 1QJWA 4DYEA 2W27A 3HQ1A 4GG9A 3WQEA 4ENLA 1U1HA 3NZ1A 4MHBA 2FHCA 4AUBA 1M65A 3H4WA 3ZSTA 2FYMA 3PULA 3WQOA 4REQB 2VEKA 2OZ3A 1E0WA 4LSBA 5LNUA 1JGMA 2ZUNA 2FFCA 1ICPA 4JTKA 3TDFA 2JGQA 4QITA 3CWNA 3MCOA 4HHMA 1OCJA 4PCSA 3MKCA 4JIIX 3R07C 3H7RA 2QS8A 4S3DA 4PCNA 3LSBA 5LHEA 1QI2A 1S2WA 3LCFA 3K8KA 1CWYA 1S5VA 3T0TA 5J5RA 1EZ2A 3CZEA 3W29A 2UWFA 1WP6A 2WP5A 2HNEA 4JR5A 2V5LA 2VZOA 3AN1A 4J2PA 3LY0A 5FA5A 2FTPA 4O0KA 1G1YA 2VD9A 4RDYA 3R11A 5TQLA 3N13A 4Z1YA 4FX6M 2C7FA 2X1IA 1X8CA 2CLOA 2VYOA 2CBJA 1ZU8A 3AZSA 2VCCA 4MDOA 2OB3A 1UZ1A 2VGFA 4DZAA 1IR1A 3ITCA 4JHZA 2VGGA 3LI0A 1TTJA 4GX9A 3CV6A 3JW7A 5KZDA 4F3HA 1H62A 4H04A 1IF2A 4C1KA 5HK4A 1HJVA 4GZIA 2I56A 4J35A 4H9XA 4FI4A 2AL2B 2PWVA 3MANA 2G3FA 3EWYA 2ACSA 4MFDA 4N9BA 4C6FA 5ER0A 1AZ2A 1XDLA 4JQ4A 3MB9A 4HHPA 3VIMA 3EX3A 2J13A 4XG1A 1B0IA 1MXSA 3O0FA 1E1CB 1GKPA 1OGBA 4TXEA 3G24A 5K3VA 8XIMA 1UD8A 4IFOA 1Q4NX 4OWGA 3CUJA 4IIFA 3UG5A 3FDGA 5TNVA 4JKLA 4PL1A 4HCLA 5DXYA 1E0XA 2J4GA 3ITTA 1LL6A 3I10A 4REQA 3EDEA 3CUHA 1QNQA 4O28A 5HQLA 2OT1A 3EWXA 4BQ2A 3DYOA 1GHSA 2P3ZA 4E2BA 4F8XA 1JFXA 3BV4A 5I3HA 5I03A 2CZVA 4LCSA 1OJXA 1K4QA 3UJFA 4J3SA 2DH2A 5E6YA 1BYDA 2G97A 3WD3A 1Q45A 1TX2A 4FNRA 4WD0A 2FB2A 2CLLA 4DI8A 4H8HA 3CWOX 3LADA 3LHVA 1GOQA 3UWQA 3LM7A 2J7GA 1S1PA 1ZL1A 4K37A 3C2RA 4H00A 1N60C 1UA3A 3L5AA 4ZSTA 4UZSA 5JU6A 4MZ1A 4GOAA 1U2YA 1HUVA 5HR7A 4AWUA 4O0ZA 3LHUA 4J56A 2NV1A 3WELA 1S46A 3CV2A 3F4DA 1HO1A 2VX5A 5I6SA 1Q3NA 1HJXA 4F0HA 5T9BG 3QW3A 3WK1A 1ICQA 3MZNA 3MHGA 4PULA 1KM6A 4LB3A 1QPNA 3QLDA 4H01A 1FFRA 1RK5A 4RZ5A 1XYMA 2IXVA 2W92A 4NZ4A 3OOQA 2Q8LA 4H4YA 2EPKX 2DZWA 3FLUA 1VBJA 3GVQA 2GZXA 2X8GA 5LXEA 1Z3NA 1LRNA 2AL2A 1Y5XA 4QSFA 5CLWA 4AIOA 4ZCWA 4FOJA 3P8IA 5A95A 1V5XA 3M0KA 3IUHA 4XKYB 5AC4A 3WL1A 1VQTA 1HKKA 1PX4A 1VFHA 4YU1A 5EMJA 1FVPA 3W7NA 3L12A 3NM3A 5BYWA 2ZA2A 1E1CA 3FS2A 3UT0A 2RGLA 4QJ1A 4HPXA 3TJLA 4D6EA 2ZUWA 2JBMA 1TMLA 1VDVA 3OW1A 3S1UA 3SGGA 2WBGA 1FX6A 4AD3A 1TVNA 4H83A 2XZ7A 1VR6A 3ITVA 5C9RA 4C6BA 4XD3A 1HJUA 5A3HA 3NVYB 3S6OA 4D8ZA 2J7CA 1JCLA 1H7WA 1XBZA 2TODA 1RA5A 4LOCA 2ZWZA 3EDKA 2ZIDA 3HG2A 4ZO6A 4E4PA 1ZZMA 3GU1A 3WK3A 1EBHA 3DHPA 3DCPA 1PO9A 2WVTA 1F07A 2PRHA 4AMAA 2X09A 3W7EA 1FOBA 5C71A 1EOMA 3BAWA 1Z8AA 1HJSA 5M5DA 1RCXB 3PBYA 1M04A 1DXLA 4D6IA 4L1GA 1EGZA 3GBDA 1K9DA 4NJHA 3R12A 1VPXA 2ESCA 3U4AA 2GVGA 1KO0A 1DNCA 2W55A 1GQNA 1VC4A 2VM8A 3WUBA 1KFCA 3CJPA 2VRJA 2AMXA 4TR9A 4A6GA 4JDBA 1WA3A 4DXXA 4FXFA 5BW6A 4J4KA 3CIVA 3N17A 1KM1A 4M82A 2Q02A 4R3UA 1QNPA 1B9BA 5D9MA 4OBRA 2RDXA 3UZXA 4W89A 2PCEA 2VEFA 3HZ3A 3SBFA 3B06A 1JI1A 3F2DA 1BLIA 3THDA 1ZY8A 2X99A 3H21A 3CAWA 1BF2A 4DO7A 3W81A 4PMQA 1GRAA 2A3BA 4UC5A 3O8AA 1S5WA 2PDFA 1LVLA 3AJ7A 2I17A 1K6WA 1YEYA 4PMDA 2XISA 2REQB 3W7OA 3M6DA 1W1ZA 3SADA 1LCOA 5CPSA 3LDVA 2VVSA 1Y8BA 5HANA 5CPMA 2P0IA 1JDDA 2O9OA 2JALA 4E3VA 2Q8ZA 1Q6FA 4LBUA 4W9TA 2JIWA 1MW1A 2CBVA 3E96A 2OEJA 3EKLA 3NTYA 4MZ8A 5D38A 4IQJA 1HXJA 2FDMA 2DSZA 5HJLA 4Y90A 4GE8A 4XK2A 4BCEA 1DBTA 1DWFM 5EFFA 1TPEA 4J3XA 2I5GA 2EJ1A 2OOGA 2YPIA 3KOFA 4ML9A 1V0NA 3AIQA 4DJEC 2YFNA 4FPSA 4DNMA 3UBPC 3FJNA 4KFOA 1EJXC 3HURA 4AIUA 4MNJA 2ZVIA 4O1CA 3VDCA 4MF4A 3ONBA 2D69A 1J9YA 1YNPA 3E6EA 1TREA 4DB7A 1H1ZA 1JZ8A 3DECA 2WVUA 1OFDA 2P10A 3H7UA 3GC5A 4Z1CA 5F4SA 1W9DM 1Q6EA 4HU8A 1G9HA 2B81A 1EUAA 1OSEA 1VAHA 3HG3A 1X6UA 3W7GA 1UP0A 1CDGA 2W0HA 1SZEA 4H6KA 4ADSA 2LLEA 4PTDA 1V6YA 5DEZA 2QUMA 4X2RA 3F5LA 4F0KA 3WJWA 4QQ3A 3ZJ6A 4S3FA 3AZRA 1CLVA 4UFLA 3FCPA 3VK5A 2V2HA 4ES4A 1GVYA 3PSWA 3NZPA 3CLWA 1A5UA 5TBOA 1QO2A 3RLGA 5FOOA 3C52A 4WJXA 4TTUA 5AZ1A 4TU1A 5A8MA 4D1IA 3TU9A 2G5WA 2PDWA 4W8BA 1EYWA 3VIGA 1V02E 4PRWA 3TTSA 1XCWA 2A3LA 3WLJA 1NAL1 4NNAA 2XG9A 3W6MA 2PLCA 1M7OA 3E12A 2INEA 4DI9A 2PS2A 3CB8A 3KZSA 3W01A 3V7PA 2OYLA 2RJGA 4D6FA 3TC3A 1V6UA 2NPXA 1F4HA 3EEGA 2BOEX 3HW2A 2PDPA 5KETA 1B4EA 3ANUA 4HNCA 1HG3A 1SB3B 3GD4A 3FJ6A 3MYOA 5HQMA 1RZMA 1ML1A 3L21A 2F38A 3QPZA 1ADSA 3W4RA 1GGOA 3CAVA 4QCEA 4Z42C 1PIGA 4LPCA 1F3TA 3BWWA 1FWJC 4OJYA 2QW5A 5FCZA 3E0VA 1RH9A 2D2HA 3GTHA 4J57A 3BAYA 1FQ0A 4XB3A 2ATSA 4XUYA 1LT8A 5ECVA 1SU5A 3M0HA 2EPHA 3PTKA 4UQDA 3LRLA 4AEOA 4Q7NA 3SB0A 2G8ZA 2OFJA 2V67A 3K8LA 2Z2AA 4ZXOA 4E0CA 3L23A 4LVAA 3CYJA 3WG6A 2P0OA 4A8LA 1G67A 3RNDA 1KFWA 3QFEA 2PP3A 4YCOA 2VELA 3ZLGA 4MJZA 4XZBA 1DIDA 2DSWA 1V6VA 4CCCA 2X41A 3VIIA 4GABA 5GNXA 3L0GA 1KA9F 3SCRA 3W73A 4IWWA 1VP5A 3NYZA 3NFUA 2WHJA 3MU7A 1I0DA 3R4IA 1GZGA 3CM4A 3UQNA 5CZKA 4B91A 4Z17A 3T42A 4XAGA 1IQ8A 4L1WA 2CLFA 2V5JA 3A47A 2E5AA 1PAMA 1PIFA 4QHRA 3RRXA 5JIWA 3B9OA 3W1TA 2X42A 4L80A 1G7UA 1QI0A 1LRTA 3C2YA 1GQIA 3P6LA 3RRAA 3RDKA 4C6QA 3CEUA 4NX0A 3WFZA 5LIUX 3W7MA 3S2LA 3UEQA 3HMCA 4DUVA 3AS2A 3NQ6A 1UIOA 4Q8OA 2EPLX 3AC0A 3FYYA 2P8BA 3NEHA 4RUBA 1KKOA 3NCOA 3S5ZA 1WOBA 2VCAA 1JAKA 3ITGA 3QKZA 3MJMA 2R94A 1QATA 1EP2A 1A5AA 1NDWA 3APGA 1RPXA 4UR9A 4GY1A 3W7LA 3PZNA 2XJ7A 1RAKA 2QR6A 5EU9A 4QG9A 1FFVC 1KM3A 3USZA 5U7SA 4JN8A 4GYJA 4PTNA 1BG9A 1LT7A 3DYPA 4KERA 4QLLA 4K38A 3SGUA 2HPMA 5CAKA 1R7OA 4C6IA 4B92A 2BZNA 3ITXA 3GYCA 1HP4A 1LWIA 4N4QA 2WZTA 2HQAA 4NY2A 3RCYA 4XZ9A 1FH7A 4Q7IA 4MMWA 1TTPA 1YIXA 1EA0A 3PWGA 4Y9MA 1YBQB 3VOIA 3B05A 4O0QA 4PC8A 1TJPA 4MUZA 3DK8A 1NHPA 4MB4A 4A8IA 4H8UA 3NQFA 1SZRA 2ZRXA 1W1A1 2WCGA 2W3ZA 2VT0A 4LANA 4PGLA 3SUUA 3RCMA 3PBGA 1MDRA 2QXWA 3POHA 3A3HA 3MO4A 2HK0A 3CUIA 2OGJA 5FSDC 2CFFA 1UZHA 2Y8VA 3GLCA 2PRMA 4XVEA 4X0NA 4A4AA 1TTQA 1WDPA 2C8NA 1E6PA 3OLIA 2QYGA 1XKYA 2QJHA 1QOXA 2V3EA 4Q22A 2QHAA 1TWDA 1ECEA 3ARUA 4GHRA 1BYCA 4MAVA 3UCQA 1YTEA 4C91A 2WM0A 4CUCA 3H2EA 1PWMA 4BV6A 1I0BA 1BXBA 4AISA 5D2TA 3GWQA 2NQZA 5H8UA 2DFAA 1ZUAX 3KBJA 2AQOA 2CHOA 2EXOA 1SZFA 3I6RA 3UZJA 1N7KA 2G3IA 2WMGA 4HB7A 4N42A 4POCA 3TEVA 2WB5A 4Q6JA 4ZENA 3GHTA 3IPWA 1OF8A 4GBDA 1FDJA 4S2BA 4UTKA 1V97A 3ISIX 1PUDA 5CSRA 3GG0A 4UTLA 3LNMA 4C6OA 1NWUA 4AXKA 4YPJA 3S2CA 3CZLA 3CQIA 4O4WA 4JFTA 1BVZA 1E43A 2PC8A 2Y70A 5U4NA 2ZKMX 2Z26A 5DXXA 2YR1A 1AH3A 1BXNA 3W6YA 2C0HA 1CEOA 5TIMA 5HBFA 1NWSA 1J5TA 4CGTA 4NILA 2W79A 1OF6A 2PMQA 1V4YA 4QNEA 4LEFA 4QEEA 3A9BA 3SJNA 3H2AA 4GI9A 3I3EA 2YKKA 3PTMA 2J9XA 4YXGA 3QR1A 3CMFA 4RPPA 1S3HA 1WZLA 3UWUA 1KGUA 1LUCA 2P53A 3CQKA 4MYAA 1GRBA 1NHRA 5H91A 3APYA 4R9XA 1XICA 4G56A 1GVIA 3QLLA 2XN1A 3IUIA 3M0YA 3AHXA 3CL6A 1QMLA 4D9PA 2R1NA 4WJ8A 1A3XA 1JNDA 1XF0A 1TTIA 4UNKA 1ZLPA 1M7XA 4EXQA 3EZ4A 2WANA 1BXCA 2X1TA 2DT1A 3TN4A 1GVOA 4CNOA 3W84A 2HMCA 1TWWA 3IV3A 4O1DA 4QROA 3BSHA 2FMOA 2ISFA 4IG2B 5KITA 5FMHA 4GGHA 1BKSA 3I7RA 4J2MA 1UR8A 4U2YA 4E8GA 4AIBA 1Y65A 1A3HA 1SO3A 1FFUC 1NY1A 1FBAA 3SQLA 1E56A 3AISA 3EWWA 1VPQA 4OHQA 4MB1A 3B8IA 3N2TA 1PEZA 1TV2A 5AN7A 5JUVA 3AUJA 2W66A 2NXGA 1EIXA 4E5TA 4QEHA 4GACA 3LTYA 2MUCA 3BAKA 3BOFA 5CQ1A 2OCZA 1TWIA 1WB0A 1OX4B 1ZP3A 3UWEA 5DRIA 3DFQA 4RW5A 2INZA 4L1XA 3WCZA 3PZUA 2HXTA 2B7PA 3WLIA 1N63C 4BQ3A 1A49A 5CJ5A 4BWLA 3DXIA 3QGVA 3G3MA 1GKQA 5D02A 2OG9A 3MZ2A 4C90A 1OZMA 2WSQA 5M1TA 3QGAC 5BWAA 5TAOA 4Z1DA 3CMJA 3MUY1 1TQJA 1UCWA 3WNMA 1VCFA 2QMJA 1P0NA 3CGTA 1JPMA 1DEDA 2GSHA 1AK5A 4DLFA 5AC7A 4DN1A 1M68A 4DWSD 1UC4A 2C6QA 3PNZA 1TG7A 4EQXA 3VZXA 3OVQA 1KCLA 2TSYA 1K8CA 4R7JA 4PUKA 2ZA1A 3TZNA 2PAJA 2VD8A 5FJIA 4XQ6A 1WDWA 1UWIA 2Y7EA 3UYCA 2WZMA 1SM9A 5CBIA 5FF7A 9XIAA 1H2JA 5D4YA 2HS6A 4BA0A 3IARA 1DKWA 1LBMA 2ZUTA 3ZOAA 3NSMA 2W0UA 3MVTA 4P7NA 2XFWA 2ZZCA 1HKIA 1TX0A 2VC7A 4I7VA 5FD0A 4JGDA 4H4QA 1SZGA 1XLHA 3U57A 5I24A 3F03K 3W7IA 2DP3A 1Z89A 4LCQA 3HJZA 2YLLA 1JROA 1J8VA 4AD4A 3TWAA 1ITCA 3KTCA 2Z1VA 5I7GA 1YRRA 1M01A 4JIRA 4JTEA 3VGHA 2NT0A 3GR7A 1XLAA 4HZ7A 4IG2A 2OJPA 4RV3A 4UB9A 1DQWA 2J7FA 1V77A 3L7RA 3NO3A 2V5KA 4PCFA 3W86A 1Q7ZA 4KPLA 5CZJA 1KD0A 1XIEA 1JRCA 2BOFX 1XCFA 4WXYA 4B9YA 2OR2A 1O5XA 2ZZ4A 1QW7A 2F2KA 1ISYA 5AFDA 4FXJA 3GB6A 3E2RA 1B3ZA 2OQYA 4IL0A 5D8ZA 4KESA 3HPSA 2Y8UA 4WUIA 4H9ZA 3EANA 2A1YA 2NQ5A 3E1F1 1IEXA 1STZA 1TUFA 5AOUA 2FJKA 2IQ0A 4C6LA 3L4WA 1N8WA 2V2DA 4TMBA 4MKVA 3OBAA 1RD5A 1HQTA 1TV4A 3C0QA 1V7YA 3PJWA 1XIHA 3TA6A 4AX6A 3WF3A 1E6NA 4S3KA 2BVTA 4W7WA 2E77A 3QV7A 1YADA 4MWAC 3OG3A 3W1NA 1MRQA 5U25A 1S5MA 1LLOA 3PTDA 1PHQA 5I79A 1Z44A 3STPA 2VZVA 2PDJA 2BODX 1JVNA 4GX8A 2B31A 4W93A 3ARWA 1M3UA 4Q6XA 2EPNA 1M1BA 4DBWA 5JH2A 1JZ3A 2W3SA 4Q33A 3MSDA 2HXUA 3S9ZA 5JMUA 2YL8A 4LX4A 3V1HA 4QCFA 1W3TA 1ZCCA 3ELFA 1DTUA 1LL7A 1CXKA 1VQZA 4X9YA 2E0PA 4FEZA 3SIMA 3PZ9A 3GIQA 1NOWA 3LK6A 3XINA 1I60A 4BF9A 5H8PA 3HM7A 1CENA 1HZYA 1YDYA 3PPFA 4LWWA 1I6NA 3WD0A 4OBSA 3ZIZA 1R3YA 3PZTA 2XTKA 1K70A 3AAMA 4DJFC 2BXZA 1NDZA 2C1GA 4W8AA 1V6WA 3MYPA 3MMTA 1FP9A 4BR1A 1OFEA 2JE8A 3MS8A 4BQ5A 3WBXA 1NH6A 5FS7A 4GYPC 2UY5A 5KVIA 4NZCA 4GLEA 5CBJA 1JXKA 4AG0A 3LI1A 3NZQA 1F05A 3P0XA 1DWIM 4RDWA 4CQ9A 2ZA3A 2EPOA 5BZAA 3RN6A 1V3LA 4AWTA 3B0PA 1FUYA 1C90A 4O8RA 4US5A 3QQ1A 1EB3A 4DZIA 3N4AA 1N62C 1U30A 2ZZ6A 1AFSA 3UWZA 1UH3A 3N15A 1F61A 2Z27A 4DUOA 3W2JA 1PZ2A 1B57A 1MNZA 2IS7A 1TVLA 2Y7DA 1JDFA 1UA7A 4AX7A 4RV8A 4CNTA 2E1DA 3O7UA 2C18A 3I6EA 4WCJA 2QVNA 3SN4A 4KEVA 1L6FA 4HTYA 4HMDA 2C14A 4ADTA 4NEWA 2GJNA 3RX2A 3F4VA 2X1RA 2NX3A 2Y7GA 4BI5A 3VKJA 3CH9A 2B0MA 2EQ6A 1NFGA 2D0HA 3KS6A 1X97A 3DFHA 5EBAA 2CIPA 3TJIA 2WMIB 4KEUA 3RX3A 4PR4A 2Y4SA 1BWLA 1TWSA 2WLYA 1LLZA 3D47A 2VFIA 4YVVA 4JTUA 2E3TA 3RXZA 1DXIA 3ZMRA 3MC5A 3C5QA 3MSYA 2DGAA 3S5NA 1RVKA 4KCTA 1E15A 5EPDA 4M29A 1MW0A 4L9ZA 4MJ4A 3QZEA 4IFKB 4P2VA 1CZ1A 1GYNA 5G5HB 3VX0A 2D73A 4JD4A 3VUPA 1Y0EA 1XRTA 3GNNA