1BKHA

Muconate lactonizing enzyme from pseudomonas putida
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
369
structure length
358
Chain Sequence
b'ALIERIDAIIVDLPTIQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUCONATE LACTONIZING ENZYME
molecule tags Muconate cycloisomerase
source organism Pseudomonas putida
publication title Evolution of an enzyme active site: the structure of a new crystal form of muconate lactonizing enzyme compared with mandelate racemase and enolase.
pubmed doi rcsb
total genus 134
structure length 358
sequence length 369
chains with identical sequence B, C
ec nomenclature ec 5.5.1.1: Muconate cycloisomerase.
pdb deposition date 1998-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1bkhA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1bkhA01
2GGEA 1W6TA 3DFHA 2MNRA 4DYEA 3RRAA 5FJUA 1SJDA 3SN1A 3V3WA 4K1WA 5IDZA 3ENLA 3GD6A 3IJIA 3RO6A 3ZVIA 3OPSA 3MUCA 4MMWA 2PTXA 3FCPA 3DG3A 2RDXA 4H2HA 4GIRA 4GMEA 4JN8A 5FJTA 2PP0A 3QLDA 3OZYA 1RVKA 4H83A 1WUFA 3NO1A 4HNCA 2DW7A 3CAWA 3P93A 3P3BA 3GY1A 4KEMA 5ENLA 3UCDA 2P0IA 1KKOA 3B97A 3VC6A 4KPLA 4IZGA 5BOEA 2P3ZA 2XH0A 2OZ3A 2ZADA 3UCCA 3OTRA 4J3ZA 4DN1A 2P8CA 4E8GA 1FHVA 4J1OA 6ENLA 2GSHA 4H1ZA 3RCYA 2PU1A 3ZLFA 3THUA 1SJBA 1MUCA 2PCEA 4K2SA 3U9IA 4YWSA 1R0MA 3RITA 3TOYA 3V5CA 2QJNA 4DWDA 2OO6A 1KKRA 4ENLA 4E4UA 3CT2A 1MRAA 3QTPA 3PWIA 3IJLA 3VDGA 2MUCA 4GGHA 1TKKA 1MNSA 2XGZA 3TWAA 3ZLGA 3UJEA 2GGJA 4F4RA 3TQPA 3JVAA 4Z1YA 2OZ8A 4IL0A 1P43A 3PK7A 4H19A 2OQYA 3H12A 3GO2A 4MGGA 3UJFA 4HCLA 3Q45A 1NU5A 2ZC8A 4GGBA 2I5QA 3T6CA 3SSZA 2GGGA 2OX4A 3SQSA 4A35A 3PWGA 3GC2A 3N4FA 3DERA 2PGEA 2GGIA 1EBGA 2OG9A 2OKTA 2XH4A 3MY9A 3QKEA 4IP4A 4M0XA 3FYYA 3RGTA 1JDFA 1WUEA 2GGHA 1TE6A 2PS2A 3DGBA 3FVDA 2XH7A 2CHRA 4GFIA 3CB3A 1ONEA 5FJPA 3TTEA 4JHMA 3CK5A 7ENLA 3BJSA 3DFYA 2PMQA 3TCSA 2PSNA 3V4BA 2PPGA 1JPDX 3P0WA 5BOFA 3VFCA 2QJJA 4IHCA 2QDDA 1SJCA 2HNEA 1EC8A 2DW6A 3NFUA 3DDMA 4IP5A 1DTNA 1JCTA 1EBHA 3QPEA 1JPMA 3R0UA 1PDYA 2P8BA 3S47A 3UJ2A 3N6JA 2QVHA 1R6WA 3N6HA 3QN3A 4E6MA 4DXKA 3DIPA 3MZNA 3ZVHB 2GDQA 4KWSA 4DHGA 1SJAA 2QDEA 3KUMA 1F9CA 2PTWA 3OW1A 2NQLA 4GYPC 3UXLA 3H7VA 2OLAA 3DG6A 3RR1A 5J04A 3BSMA 4ZA0A 2PGWA 1BKHA 3V5FA 4GISA 3HPFA 4IL2A 3N4EA 2QJMA 1MDRA 3SN0A 1P48A 2QQ6A 4E4FA 1YEYA 3TJIA 3EKGA 4HYRA 5EU9A 2GL5A 3BOXA 3FJ4A 2FKPA 3K1GA 1E9IA 4HPNA 3R11A 2AKZA 3UGVA 2HXTA 3ZLHA 2QGYA 3MSYA 1MDLA 3UXKA 2PU0A 2PODA 3FV9A 4E5TA 1KCZA 3TJ4A 2OPJA 1NELA 3DG7A 3NZGA 3I6EA 3VCCA 4ROPA 3OZMA 4HCDA 3UJSA 3EEZA 3D46A 4GYPA 3ZVHA 4A3RA 3MQTA 1EC9A 3TW9A 3H70A 2FYMA 3VA8A 4KT2A 4JN7A 4M6UA 1OEPA 4G8TA 4HCHA 3R10A 3VCNA 4IT1A 3U4FA 1ECQA 4HNLA 1XS2A 2AKMA 4Z17A 3IJQA 3OP2A 3PFRA 2POZA 3T8QA 4FP1A 3R1ZA 3UJRA 3I4KA 3TWBA 3ES8A 2OVLA 2AL2B 1PDZA 2OFJA 3Q4DA 3DESA 4EWJA 1TZZA 1KD0A 1XPYA 3JZUA 2O56A 4FI4A 3SN4A 4MKSA 3MKCA 2ONEA 2XH2A 2PA6A 4HN8A 5FJRA 2AL2A 3MWCA 4G7FA 2OQHA 3ES7A 4DX3A 3D47A 2PP1A 5FJOA 1ELSA 2PTYA 4A6GA 1IYXA 2HZGA 1L8PA 4X2PA 2OZTA 3CYJA 3STPA 3I6TA 3S5SA 3FXGA 3T9PA 3CXOA 2P88A 3T4WA 2HXUA 1EC7A 3IK4A 3NXLA 3DEQA 3JW7A 3R0KA 2AL1A 2XSXA 1FHUA 2PTZA 3VC5A 3SBFA 4K8GA 3H8AA 1BQGA 2PP3A 3SJNA 3R25A 4ZCWA
chains in the Genus database with same CATH superfamily
1W9BM 1YTDA 3ZT6A 3GUWA 1TYPA 1MZHA 2F6UA 2O0TA 2V9DA 3I7SA 4KERA 3JRKA 3RO6A 4HK5A 3PZ9A 3QW4B 5C9UA 3DK4A 3B9AA 4L61A 3QFAA 1NARA 3A64A 1ZJHA 2VGBA 2Z1VA 1BYDA 1DJQA 2LLEA 3EBVA 3OVQA 1KM5A 4UTUA 4QIUA 4WF7A 3GAYA 2RHGA 2VEFA 4BV6A 4MNJA 3NVYB 3IARA 2Z6IA 4F0MA 2V2HA 4JTSA 1P6WA 4KPLA 3WJWA 1CZ1A 1K77A 2E3ZA 3C0JA 3MP4A 3G1YA 5CPMA 1D8CA 3QY7A 1E1FA 1XISA 2VGFA 4XZLX 2ZWYA 1UCWA 1RXOB 3AUOA 2ICSA 1VFMA 5FEPA 3WBYA 4JTRA 1M7PA 1Q65A 2RAGA 3PB2A 4J2PA 1MUCA 1TSIA 2PZNA 4J57A 2GYIA 2NQ9A 5D9NA 1V6XA 3GBDA 3QW3A 1G01A 1BQCA 2G3NA 4YJ5A 5F2IA 5LXXA 4LBSA 3E9AA 1SQ7A 2C1GA 4UFLA 3TN3A 1LG2A 4IJCA 3W2JA 1WE5A 1JGMA 1VRDA 2UY5A 2CNCA 4WKFA 1EJ7L 2PUZA 3M0XA 2GGJA 2VFGA 4RXGA 3SURA 2OT0A 3ABXA 3R43A 4W4QA 1CW2A 5AHIA 1UWSA 4N4QA 4C6IA 3L7RA 5FF7A 3USZA 4JEQA 1I8JA 4JFVA 3GRIA 2QLYA 1BXNA 3VO0A 1UPMB 1E56A 2GGGA 5F4WA 1UC4A 3H4GA 3RLHA 4LFYA 1ENUA 1U5HA 4C6BA 4HNOA 1AW1A 4XSLA 4CN6A 1X97A 3I4EA 5AY7A 3VZXA 4L4OA 1UR0A 3F03K 3Q65A 1ZAHA 3E0IA 1R38A 1ME8A 2PGRA 4M7TA 4H2CA 2HMCA 4PUUA 4JHMA 5HAOA 2I17A 5EA9A 3BJSA 2QJHA 1BXCA 4WJXA 2GUYA 3TLQA 2ZWZA 3C2YA 5D2WA 1M3UA 3O9NA 5D9PA 2G95A 3FJNA 1KRMA 1PB0A 4GD0A 4AC1X 4X9SA 3JUGA 3URAA 1XD0A 4AXNA 5EMUA 2HTMA 1V51A 4EE9A 4C6FA 3SJ3A 1B3YA 4UR8A 2FGBA 3GBEA 2WVVB 3WQOA 3DC8A 3TZNA 1E9ZB 4E8CA 4MKNA 2DSVA 1J0JA 2RDTA 4XO6A 5EPDA 2V2CA 3IK2A 1RY8A 3VPLA 3QN3A 5M5DA 2E5DA 1Q6OA 5DCBA 3NURA 2RKXA 3VIGA 2NVCA 1CCWB 2QR6A 3AS3A 2VC9A 2ZCGA 2WZIA 4D8AA 1A5LC 3ID7A 1YNYA 1JXJA 3WEMA 2ZRZA 3CPGA 5AZ0A 2BFGA 2W0HA 2W0UA 5G2IA 3P14A 1QJWA 3KOWA 4O10A 2ZDRA 3EPMA 1UBPC 3PN8A 4K3ZA 2OXNA 4ACZB 1NWTA 5BMWA 3E1F1 5F2GA 2A7RA 1US3A 3FJ6A 3ANYA 4MY9A 3N4EA 2FPVA 1UASA 1TV5A 2IKHA 3SN0A 3T42A 4E4FA 3ZJ6A 1DQXA 1T7LA 5I3KA 1HXJA 1RUSA 2WWDA 3OEXA 1KFEA 4W85A 4QBXA 2CXEA 1B54A 3B40A 2I5GA 1REQA 1F4AA 3OHIA 1GVOA 4C1NA 1N5WC 4FK9A 2WPGA 3POCA 1W3JA 2O7SA 3EDEA 4Z1CA 2HDJA 3KRUA 4GH3A 1RA5A 3VIHA 3WLKX 4PB3A 3BE7A 5FAGA 2VEIA 5KITA 1XRTA 1IZJA 1X8CA 4QRNA 3MP5A 1A5MC 5AOUA 3HG5A 5FJJA 4RDVA 5ABFB 4ZSUA 1O5XA 5I77A 2E8YA 2ZZ1A 4J27A 1FIQB 1SZFA 5AECA 3LV6A 3CPUA 4H50A 3ONBA 2YGYA 3LDVA 4J3SA 4AD5A 1CXHA 3OLDA 1DTUA 4MAZA 4FP1A 4PUWA 4RZ5A 3I4KA 4IPJA 2ZC1A 4F9JA 2Y0FA 4UTWA 1W5PA 1TZZA 2CFFA 3JZUA 3IJ8A 4ZFMA 4MKSA 1FOBA 3O63A 1X6UA 3BJTA 2WNQA 1EQPA 3F2DA 4EKJA 4H4VA 1IEXA 2GJXB 2WNNA 2BB0A 4W9TA 4Q32A 3D47A 1VH7A 1YADA 4DUOA 4NZ5A 3MO4A 2WJZA 2Z7KA 4ERGA 2VENA 3SUSA 2PLCA 3LHTA 5A8NA 1V02A 4X2PA 5ER0A 3C3UA 3S83A 4PTXA 1H1ZA 3NZQA 4PFHA 1TYTA 2GR2A 3N3TA 3UA3A 3MUXA 2Y7EA 2NQZA 1YQZA 5LNWA 4JX4A 3UG3A 3S5SA 3FXGA 4KEVA 3A5FA 1MYRA 3OLIA 3VIIA 3GB6A 1OG0A 4Q6XA 1JAEA 4Y6GA 1KBJA 1CGWA 4FNUA 3R0KA 1U2YA 4FXRA 4GCXA 3T7VA 3DYOA 3O06A 5FEZA 3HQNA 4OVXA 3K4DA 2FZMA 1P0DA 3R25A 3PPFA 3SCPA 1PVNA 3W71A 4AZ6A 4D1IA 3DFHA 4MM1A 1MW3A 4DYEA 3WQ8A 4WGXA 1V3JA 4BZYA 3OPSA 3DGRA 4KEUA 3V36A 1AK5A 4MMWA 4RKAA 3L0GA 3ZYZA 2PBOA 2HK1A 4NX0A 5LIWX 5EBKA 1J18A 1R8LA 1XP3A 5FJTA 2HPMA 3VMPA 1FBAA 3EOOA 2EPMX 3WQ5A 1K6WA 3A7AA 4HNCA 1WUFA 4BF5A 5G1TA 5CAHA 1TTIA 3EA2A 4Z2IA 3E96A 3AOFA 4DWSD 5FCZA 1NWSA 1KLYA 4O8AA 4BQ2A 1SFJA 2G37A 4F0KA 1PKMA 3WDPP 4LBRA 1VEPA 1G4PA 3EDKA 4HQVA 4LVFA 5EB8A 1YDOA 5BOEA 4E2BA 3AHYA 2B7OA 1N62C 2OYKA 2YX0A 1EUAA 3O8AA 1L2UA 4DBDA 4HZ6A 2WBGA 3RCYA 2ZZ4A 4S3JA 3WJZA 4JQ2A 4Q8TA 1WAWA 1EH9A 3KOXA 4WRHA 4NU7A 4K2SA 4MF4A 3TYDA 1TRDA 4PZVA 1F3PA 5CPNA 3IIPA 1K8CA 3WQDA 1GVIA 4H4SA 4IIEA 3H26A 3QTPA 1B3XA 1GJWA 1LUCB 4LYQA 3R8HA 4WY0F 2GSEA 4C6NA 2QCLA 1QWGA 3ZLGA 1NP0A 2PDHA 4AVFA 4YCPA 1O6IA 4J28A 3ICJA 3N2BA 3PR2A 3S1WA 5C2GA 3AXKA 4KRZA 2CLPA 3AS0A 1AZ2A 4XG1A 5A8PA 3UJFA 3QPYA 2C3CA 3HRDC 3NDOA 2FTYA 2ZA1A 4O8RA 5IDIA 3T0AA 3PS7A 1FWEC 1GVYA 3NDYA 3T4CA 1H0GA 3GG8A 3LGDA 2OG9A 4BQ5A 1Q66A 4DB7A 2CBVA 3VDHA 3FYYA 5FD0A 4ZE4A 5ABHA 5HPOA 1ML1A 4QE1A 2XH7A 4UTHA 5KZ6A 4S1FA 2EG8A 4EMIA 3NVDA 1CXFA 3FA5A 3DBNA 3TLLA 4RPPA 2DDXA 2HS6A 3P7YA 3T0TA 4H7VA 1J79A 1ZBVA 3TYBA 1GONA 4NF7A 3TCSA 4I9TA 1WZLA 1B31A 3V75A 4AX7A 3QM3A 4PMUA 2I5IA 1M04A 4HZ8A 2BVDA 1SW0A 3TOPA 4GNKB 2JF7A 1Z7AA 1UMYA 1VBHA 3QZEA 2H90A 3SZ8A 2R1NA 3O07A 3DGHA 1ECEA 3D6NA 1OX4A 3ABQA 1A0EA 1P6CA 3EAOA 1VS1A 4LNCA 1KTCA 4C6EA 1QOQA 1NFBA 5FS8A 2QVNA 2OODA 1MXSA 5CC6A 1PEZA 4GH1A 2A85A 2OR2A 1TJ1A 3WBXA 4MWAA 4UTJA 1A4LA 1S7MA 2YCEA 1HNYA 4H9MA 1O94A 2YXXA 4ILSA 1S3HA 3LK6A 5T26A 3V1HA 1XGEA 1QW9A 2NWSA 5K4XA 1YPXA 3W1UA 4HN4A 2YFOA 4JY8A 4I5XA 3VAVA 5HJLA 1UIPA 5E93A 5FL0A 1ZTVA 1H5YA 4I7VA 1QMLA 3SFKA 3A22A 4DPQA 4JTJA 1UKTA 4D6HA 1FCQA 3K1DA 3P82A 3QQ1A 3H4WA 4QAWA 1Q6EA 3QVQA 1OC5A 3BZGA 5EU9A 5CC5A 3TQKA 1R2TA 4Q8UA 1WKFA 1OY0A 3P5YA 4LB3A 2D2GA 3OZOA 3HOJA 2XUCA 5GNZA 4ZB2A 4UFKA 5EKYA 1FWRA 1WDWA 1ADSA 1Q5MA 1SUXA 3KL5A 1XBVA 2BODX 2C14A 1HG3A 2J7FA 3GDBA 3N2OA 3CMGA 1MFVA 3UJSA 1DHPA 2VR5A 3BZJA 4IQLA 3H24A 2Z2BA 3C2FA 1KN0A 5AHEA 5HMSA 6PTDA 1AJ0A 1BVWA 4ECLA 4PMNA 7TIMA 4RZBA 3F4VA 4GZIA 2PCQA 4IT1A 2ZX6A 2OSWA 5G5HB 4ZVJA 2OZ0A 1N55A 4NSBA 1V3LA 3M9YA 1H4PA 1ODUA 4F48A 4Q7IA 1ADDA 3MMDA 4M8UA 2E6YA 1US2A 2XGBA 1B4KA 3NJ3A 4A8RA 4LGXA 2W79A 3VYLA 1UD4A 4S2BA 3SW6A 1OD0A 5I3JA 2F38A 3WJSA 1E4IA 4EF8A 3FAWA 1CI1A 5DRCA 4LEFA 1P7TA 3WD0A 1IZCA 3EWZA 4XAYA 5A6BD 3CL6A 4L65A 3BLPX 4LYPA 2VZSA 1XSJA 4DX3A 1IGWA 4I90A 4RE4A 3U57A 4L1XA 3RM4A 3OZPA 3WCZA 4S3FA 4NJJA 1H11A 1W1B1 3T2QA 5CPTA 3GAKA 1IYXA 1T8QA 3E3HA 4DLFA 2VC6A 3IANA 2XIMA 4ATDA 3MV01 8A3HA 3W1RA 4D6GA 3VZZA 1OM0A 3WUEA 3NOEA 2XPKA 2WJFA 3KXQA 1YNPA 2QCHA 2A2IA 3GNPA 3WUBA 1L6GA 1DJGA 2HWGA 2PDKA 3QGVA 4YTSA 3VKAA 3LGGA 2H9AB 4GWEA 1VBJA 3KTCA 1JPKA 1S2UA 3QMRA 4XO7A 3CV1A 4LUSA 2E9BA 2Z26A 3W82A 4TX8A 4MWAE 4I8YA 2AOSA 1LYXA 1PJ9A 3GXTA 3SJNA 5A6LA 1W6TA 1XIJA 3PPGA 1P0BA 4Z2JA 3LI1A 3M41A 4U4MA 4EF9A 1GRBA 1ZP3A 3IJDA 1A3WA 4LY8A 4PCNA 3R0DA 2IPJA 2Q3RA 2YA0A 2YIHA 3ZVIA 3N29A 1VC4A 1QI5A 1GW9A 1K8XA 1W2VA 2J9ZA 1KTBA 3E6EA 3W29A 5L6UA 1M6JA 5E5CA 1K9EA 2V3DA 5ENLA 3VOCA 3U7BA 2VFFA 4IWWA 3C56A 3RYSA 4DBWA 4IQDA 3GTXA 1AD1A 4LCSA 4HA1A 2YJQA 4DBUA 1OADA 4HYVA 4XZ9A 5K9DA 2QCDA 3DCPA 5FEWA 1FWAC 4W88A 4XKYA 5EY5A 2AQOA 2VWSA 4O0KA 4EAMA 5U4NA 4XVDA 2XIOA 3N13A 2Y89A 4UB9A 2UWFA 3U2CA 4BWLA 3F5LA 2C1HA 1W5OA 4RUBA 1PBGA 1HN1A 1GTEA 4M19A 1NHPA 2R1MA 5BYWA 5B80A 4H8VA 4DRSA 4ZQMA 2CETA 2DUAA 4MDOA 3W6LA 3KHJA 1OF8A 2F61A 4FLSA 1KXVA 5AYYA 2EPKX 4HOXA 4JYDA 3GC4A 1P0NA 5KZDA 3MBDA 5U25A 1K9TA 3COTA 2QCCA 5I3IA 4AHQA 4AY7A 1OCNA 4AZHA 3U48A 1KC7A 4B2DD 4U28A 1RALA 1H50A 5A1AA 2PDCA 3AFBA 3D3AA 2KAUC 2J6XA 1YNQA 3C52A 3TJLA 5FF3A 1DE6A 4EOUA 1CGVA 1HKVA 1HGWA 1TV8A 3N4FA 2BY1A 1ZP4A 2OKTA 2XH4A 1GVEA 3RLGA 3KBWA 5MKGB 2R9RA 3LB0A 3CLWA 2YBTA 2D1ZA 5FSEC 1HJSA 3M0KA 1ICPA 3P0XA 1VDVA 2YQUA 4DJDA 1AOGA 2ZZ2A 3K13A 2PMQA 2V3GA 1JUBA 3QKZA 4A8IA 2VHLA 3AU6A 1XYMA 3M07A 1XLCA 3NCOA 2B81A 4A8NA 1JPDX 1UH4A 1RLCL 1CGUA 2EQ9A 2X2YA 5AYZA 2QDDA 2HNEA 1V0LA 3PAOA 2DW6A 2WBAA 2Z6JA 1RP9A 3BCDA 3MT1A 4JNYA 4WZHA 1LBFA 1VFLA 1HO4A 4LY4A 1QNRA 3P62A 2Y88A 2YZ5A 1XLGA 3LUTA 2VQTA 3NVZB 3NGJA 4QJ4B 3RJXA 1I2OA 1FP9A 3ZJKA 1X7IA 2GDQA 4U31A 1ZMDA 3VNYA 1VJSA 3B04A 4F0LA 3C2RA 2PTWA 4QS6A 3AM9A 3G8RA 4ZQPA 3PAJA 3DG6A 3IWPA 1UWRA 4PL1A 2VRQA 3KBSA 1LORA 5I3DA 4Z08A 2I7GA 3S9YA 4XVEA 4B3KA 1EYEA 5CSUA 4GQRA 5D9OA 4ADTA 1TJRA 4A22A 1LLZA 3UD6A 3W26A 3KVKA 4GI4A 3RF9A 4D2JA 3HQOA 3UT0A 2PU0A 3I7QA 3N3MA 4E0CA 1TREA 3WFAA 4WIWA 3KBNA 2VC5A 1LL6A 2VZUA 4ZSTA 3GKFA 4D6FA 1MQRA 4DZ5A 3V5OA 3L8KA 3QHNA 5ABTA 2OYMA 3ITTA 4Q8PA 4V33A 4RV3A 4Y2WA 1JRCA 2G41A 2DPEA 1GEUA 2FYMA 2Q02A 2ZICA 1C7SA 5I09A 1XBYA 4TX9A 3WYZA 3R10A 3CUXA 2OSXA 1V6WA 1XCWA 4P7OA 1ECQA 3KZSA 3QZAA 1RPKA 3TN4A 2X0SA 1GHSA 3LI0A 4KETA 4QSHA 4XWUA 4Q6JA 1XSIA 4JKLA 1QI4A 4ACYA 4G6CA 2JIWA 1XRFA 1PIIA 2ABBA 1UIOA 2UV8G 1QBAA 1VAHA 3TWBA 4QCEA 2QF7A 3WF3A 1H09A 1F7BA 2AL2B 1PDZA 5C2CA 3DESA 2W54A 4M81A 2V8ZA 2CBIA 3SY1A 1VIZA 1JGIA 4FNSA 3B06A 3NL5A 2PA6A 1NOUA 1DXIA 3MWCA 1B3OA 2PF8A 1KBIA 2JE8A 4G7FA 4DVOA 2WPBA 1NWRA 4M24A 2BC1A 5F2LA 1X7FA 2W63A 1Z41A 1UR9A 2JKEA 3B8DA 2R94A 5FJOA 1ELSA 3NO5A 2ALRA 4HSOA 3EX1A 3CZGA 1TPEA 3UZJA 3HN3A 2WP6A 3CV7A 3WLSA 2WHJA 1K9DA 3WDJA 4CNPA 2R8WA 2BWGA 3BCJA 4PE8A 1ISVA 2P88A 2HISA 3T4WA 3L21A 3NQFA 2BDQA 4CNSA 3CJPA 5I06A 1RK5A 3RFAA 2GJRA 3DEQA 1V0NA 4CEUC 2AL1A 3EAUA 3HU7A 2E1DA 2XJ7A 1FXPA 3PUGA 1SO6A 1E55A 5HMDA 3H8AA 2PP3A 1JUKA 4R9OA 4D71A 3O0KA 5HOSA 2PDGA 3CWNA 1Q7QA 3SCRA 3WIJA 3K8MA 1X96A 2JFEX 4U5KA 3ZXWA 2WVTA 4CQCA 1CGYA 3IVSA 4EPKA 4GMEA 3HZ3A 1LP6A 4PGLA 4IMDA 3AROA 3GHUA 3CAWA 1F76A 1AA1B 3W7OA 3QOMA 5A5WA 3C61A 3MMTA 2HE8A 3RNMA 3W88A 3FAXA 4FXSA 1EJWC 4BS0A 2HJPA 1KFBA 3BLKA 2WJEA 3W00A 1OX4B 3UVIA 4IZGA 4UMCA 4S3BA 3SCUA 2AQVA 5CLTA 4O4VA 4DI9A 5KETA 1DQWA 3B8WA 4OV4A 4Z1AA 4DBEA 3OA5A 5CJNA 4XTIA 3SRKA 2CLLA 1Q6QA 3DFQA 1ADOA 3V0SA 5BNKA 3STGA 1GK8A 1JDCA 4LA1A 2OO6A 4B92A 1S38A 1VIWA 1ISXA 3RJYA 3UR2A 5JXQA 4F40A 1DWIM 3BAXA 1UJQA 5FMHA 3Q94A 2WC7A 3PWAA 1WQ5A 4GGHA 5IBXC 1G1YA 3J7HA 5XINA 2Z1XA 5H8MA 4ZOBA 5U1OA 3I3BA 4H41A 2RH9A 1THFD 5AYXA 5XIMA 5KMYA 4LVAA 2EPHA 3DFTA 3PK7A 3AZRA 1GJPA 1MWOA 4IMGA 4UZSA 1SO5A 5EMJA 4HNVA 3KLJA 2PDUA 2ZYFA 3QF0A 3FHAA 1ICSA 1PUDA 1R3QA 2B7NA 1KFKA 3T6CA 1I0BA 1WZAA 5M3WA 1TE1A 3SQSA 3PUDA 2VEKA 2J74A 4ADWA 3PZMA 2PGEA 1W3TA 3MSDA 4GI6A 3K46A 1K3UA 1F07A 2F7FA 2J9YA 4BQ4A 2XM2A 1V08A 1XSKA 3A12A 4M51A 3WK2A 1JZ5A 4NHVA 2YYUA 4J3WA 2WPFA 4BY3A 2BP1A 2X8CA 3CV6A 3CB3A 3A13A 3OYXA 2Z1BA 4HHPA 3O0HA 5KZMA 2QJGA 2V6OA 1TWSA 4Q8MA 4JKMA 3P0WA 1JCNA 1HJQA 2XZ7A 3N34A 2HRWA 3T09A 3BAIA 4HSNA 1F2JA 3WO8A 2NUXA 3I7RA 3ZIZA 5BWFA 3AJXA 3WQEA 5HR7A 4Q3MA 2P8BA 3GDLA 4PYSA 1W1PA 3UJ2A 3CO8A 3WLQA 4DLMA 1TV4A 2VDIA 4E6MA 1E5NA 1XYBA 1IXNA 3L5AA 6TIMA 2F8QA 1DNCA 5D9MA 5GJPA 5DELA 1OFQA 2ZZ5A 3HW2A 2X0HA 1CIUA 4ZE5A 1WXJA 1XDJA 4MYXA 4IFKB 3L2MA 4BKNA 1XDMA 3LADA 4KEZA 3UXLA 1W5NA 1IWAA 1KCLA 1OFDA 3URQA 3F2CA 1G4SA 5J04A 1GG0A 1YPFA 3ZJ7A 2PGWA 2R1KA 2J6VA 1MNZA 4HVXA 2CBUA 1VF8A 3ZZ1A 4XZWA 5A8MA 2J75A 1EDGA 4N9EA 5C71A 1JCLA 3EKLA 4LS2A 5DANA 4AD1A 2X8GA 4NAFA 4MB5A 2EKCA 3DU0A 4O0ZA 3ARXA 5BXRA 3DFPA 2OELA 4L56A 7TAAA 2OWWA 4PTDA 3TC6A 2GVLA 3UGVA 1TUFA 4JD4A 2QUNA 3LPGA 1ITCA 4QTGA 1DIOA 2OQLA 1K9FA 3AXHA 1MDLA 5TNVA 1E3XA 4MADA 3SM0A 2PODA 2BV9A 1KCZA 2E5CA 1U1JA 1NY1A 1TG7A 2C6QA 1KFWA 4PBEA 2V0TA 1MRQA 3VNMA 2A3HA 2VOMA 1R46A 4OBSA 2G97A 1IEWA 3UETA 1XJBA 1VKFA 3VI2A 3W7LA 1V5XA 3U4FA 1K02A 4GPNA 3S2NA 3HGRA 5LSMA 1W0MA 4FNTA 1S2CA 3NEHA 1Q85A 2A7PA 1MUMA 3IJ7A 2QNEA 1U33A 4C7FA 4HNUA 4ADSA 3KX6A 4K39A 1EP1A 3T8QA 4AHOA 3R1ZA 1XG3A 4YVXA 4LF2A 3PZNA 3NA8A 1BFNA 1QPOA 2PDFA 1R3YA 1Z69A 3W75A 2J13A 3IV8A 1XPYA 3G6MA 3C4UA 3SCVA 2UY2A 3MJYA 1JFHA 2GQAA 4G2DA 4AIEA 3UR5A 4NZ1A 4NASA 3MBFA 2YDAA 2NVKX 2BGNE 3PZOA 2VRJA 1HIZA 3HB9A 4C6MA 1Q45A 3MO7A 4LVBA 4EQSA 3H2OA 3IJ6A 4TVUA 5HWMA 3GVGA 2FJKA 1AQFA 3UWQA 1VFSA 3CYJA 3BLFA 4L6OA 2PDLA 2VTFA 4Q4MA 1OC6A 3MA8A 1LUCA 4AZBA 4RDYA 1V6YA 1K4HA 3FDGA 1G0CA 2ZUWA 4PA8A 4EPEC 3S3GA 1IQ8A 5HQLA 3UESA 5CEWA 3NXLA 4IFKA 4FXJA 5HMFA 3HM7A 2PFHA 4JNMA 4QDWA 4W84A 4B5VA 2ZX7A 3HQPA 2ZOXA 4IIHA 4N42A 1X1NA 1W9VA 3AISA 4ZCWA 1BWVA 2YVGA 1UOKA 4MJ2A 4AMCA 4MUZA 3B8VA 2IQDA 2CYGA 2QUMA 2V5BA 3PJWA 1RA0A 4CN4A 4W93A 3GXMA 3R79A 1GYMA 2QAPA 3RN6A 1CWYA 1TIWA 1Q2RA 3TIMA 4XB3A 3WMCA 2ESCA 5AC8A 2J24A 3ARWA 2CWNA 2OWXA 1GXFA 2VEPA 1RVKA 2RFGA 1ZJIA 1BPLB 1NOFA 4K8HA 4EX4A 3P3BA 3GY1A 2QPUA 4C6LA 1NSJA 1XI3A 1Z32X 1X1ZA 5A2CA 3R2GA 3MP3A 4XKYB 3RM9A 2W62A 1Q7ZA 1VFHA 3PBUA 4GUHA 2FPYA 3VNIA 5E6ZA 4S3KA 3KZPA 3M46A 3MMWA 3R13A 2HEJA 3F4WA 4J3ZA 4AF0A 4CUCA 2PBGA 5CPOA 4KQNA 3QMTA 1DJZA 4HZ7A 4DUWA 1O95A 2WLYA 2CLIA 5D37A 3CS2A 3TR9A 2X0YA 3E49A 3AYTA 1XLJA 2ISSA 5REQA 4IPIA 1HVQA 2VELA 3CEUA 1VHCA 4TTUA 3TH6A 3L9CA 2GVGA 4H4PA 3FGCB 3NAVA 2E9MA 2DUXA 4E4UA 3WQWA 3B0UX 4KCTA 4IMFA 1IR1A 1L2QA 1E15A 2AMGA 4C90A 1QNVA 4HK6A 3WH9A 1XLLA 3ZR5A 3W72A 3A21A 3HG2A 5DMYA 4F2BA 3IVUA 3SO7A 2ZX9A 3EB4A 4GZ7A 4ZOCA 4AYGA 1EJXC 4ZOHB 2DZAA 2DU2A 4JCMA 2YL8A 3CTLA 4HCLA 3NQEA 1OFOA 5E9AA 1UZHA 4MUPA 1GKQA 2YDQA 4WD0A 2ZZ6A 5DT7A 1H51A 5HWNA 4ZFCA 3VOFA 1BWCA 4IP4A 4HSHA 3M6YA 1WUEA 3BPWA 1UH3A 4PULA 4MY1A 4XTDA 3EWYA 1J6PA 1W56A 3VD5A 5G5IA 3D9XA 7ENLA 3PBWA 3QV9A 1VJZA 1BXBA 1WXZA 3FY1A 4FOUA 5A6AA 3LZ3A 2XIBA 9RUBA 2NPXA 2VT0A 4FR1A 5EBUA 2VUYA 2X1SA 3CPRA 5BWAA 1YMYA 3VINA 1ZENA 3RR4A 1Q3NA 5GPRA 3UXDA 3ARPA 3LV5A 3H7RA 3W84A 4BEUA 1NFPA 3CGBA 4NZJA 1TZ7A 3EX3A 1EA9C 1OD8A 4O1CA 3RX2A 5GJMA 2UY4A 3NQ6A 2ZX8A 3BV7A 5JVLA 3GNOA 1GVRA 2I9EA 1E73M 3AHTA 4JN6A 2ACSA 2XWDA 4GC4A 2TAAA 2OGYA 3PZVA 2P50A 4X22A 2P53A 3VFLA 3DGZA 4PTMA 1ZALA 3M1ZA 4GX9A 1DIKA 4GYPC 2GJNA 1IGSA 3GTHA 4GJIA 4CEXC 2YDSA 2QZRA 3BSMA 1Q6CA 2X05A 1LL7A 2YVJA 4EQRA 2HBXA 5EMMA 3EWCA 1H7XA 2QJMA 1F61A 3F7JA 3RU8X 3UU0A 2PLMA 1TPH1 3O6DA 3G3MA 1C3FA 1YEYA 4HYRA 3FJ4A 2CZEA 4GJJA 3NPWA 4FA3A 2HXTA 2X40A 3E12A 4Y9MA 3QPZA 2PE4A 3VMOA 3IRDA 3MSYA 2TODA 3I68A 1F74A 1RJQA 1WPCA 1GYLA 4O52A 5AC6A 4P8UA 4WXYA 1BZLA 5KEZA 4JS3A 4H6KA 1XUUA 4HB7A 3SQPA 2VQUA 4B4FA 1ZB5A 4AFYA 1UZ4A 3VDAA 1W3HA 4F0HA 2F2HA 3ITLA 4GYPA 1R87A 3LCHA 5DCEA 3GM8A 5LNUA 1GKRA 4NNAA 4PB5A 1DORA 1OEPA 1YBQA 2VX4A 3LCXA 3HMJG 1V7YA 3UWUA 2IS7A 4H4ZA 4DF2A 4LSBA 1PE1A 2OT1A 3M5ZA 2VZVA 3E74A 1JI1A 4JIIX 1XLEA 1I2NA 3LHZA 5CBBA 4Q8QA 3VOHA 4H01A 2X50A 2HCVA 1NDZA 3A3HA 1U30A 2E5BA 2FFCA 4REQB 1WV2A 2PI6A 4XIAA 2INZA 3CZ8A 4FHAA 1XPGA 1ZGDA 3Q4DA 3VNKA 2I1OA 1NPXA 2OOFA 1S46A 3GXPA 1MW2A 3I3EA 1NH6A 3NGFA 5CAKA 3W2LA 3G1DA 1BLIA 2E6AA 5T91A 2HBVA 4XBJA 3UG4A 3VUSA 1AH4A 3QGKC 3CASA 1VJIA 2NUWA 3LBMA 3EWXA 4J4KA 3K4WA 3FK4A 1OABA 1J8VA 2FLIA 4LCRA 2GR1A 2V3AA 4L80A 2ZRXA 4ALDA 2E3TA 1UUOA 1XBZA 2FJUB 3GDMA 2W3RA 2VO5A 3WBWA 2W3ZA 5DBTA 2WKGA 4FMVA 4K1GA 1J5TA 4O13A 4XSMA 4NY2A 3LHYA 2CLFA 2V5JA 5D32A 3CGTA 2YBVA 3BAJA 1SZGA 3B8IA 2OYLA 1UA3A 1TQXA 2INFA 4PUJA 3STPA 4ZBCA 1GZGA 4X0NA 3QR0A 4IJBA 1OZQA 3CXOA 3NVVB 4H9XA 1L8NA 4MZ8A 1SGJA 1ITUA 4YIWA 1FWIC 3DYMA 4FLRA 3L5OA 5E0FA 1XX1A 3REQA 1XIHA 4K6AA 1C93A 3ITCA 4DJFD 4O14A 3BQ5A 1XFCA 3PTQA 4RW5A 2VURA 1QK2A 1TWWA 1N5XA 4EWND 3RRXA 1SFTA 4MPQA 1EJRC 4Q8WA 4O1DA 3LHVA 2ODOA 2X30A 1W5QA 2C8NA 2ZE3A 3GH7A 5J5RA 5D2YA 1UKPA 2GQ9A 3DG3A 2Y8VA 3R4IA 1KM3A 4D1JA 5JU6A 4I7UA 3WEZA 1IEVA 4JTKA 1NDWA 5HQMA 5LA0A 2QDGA 3AIQA 1J0KA 4QNEA 2PWVA 4CQ8A 3QV8A 1A47A 4H4UA 3AYRA 2PDYA 4B3ZA 1L0PA 3VIPA 1IT7A 2W27A 1WNOA 3R12A 1B30A 3NL3A 3CWHA 3WLOA 4L7ZA 3WK1A 1C8QA 3UCCA 4DO4A 9XIMA 5HMEA 2F5ZA 4V28A 1LF1A 1OWQA 4Z1BA 2GSHA 3QHMA 2E67A 1FTXA 4IMCA 1TR1A 3MUY1 1CDGA 1DHKA 3BQ6A 1EOMA 2IXUA 3IGSA 2TSYA 3Q6JA 4DEFA 4U3AA 2VXNA 3KBJA 1LROA 1XLIA 5F7UA 1JNEA 2QV4A 3LPPA 4DI8A 1UP2A 3A7UA 2PDBA 1IE7C 3AZTA 3PWIA 3W2UA 1P4CA 4O12A 3W02A 4AIUA 3GR7A 2J47A 5A8GA 2CITA 3KFTA 1BVZA 3FX4A 2OEKA 3BW4A 3TQPA 4I5RA 2OZ8A 4AZ7A 2PLKA 3MMUA 5AHLA 4BCEA 5A6KA 5FL1A 2JKAA 3H12A 5EL1A 4M7SA 1ZRQA 3U5UA 2HNHA 1D7FA 3AMGA 5AC5A 1D7YA 1DXEA 1JDDA 3SSZA 5C55A 1H1YA 3O05A 2BOEX 2VCBA 4DJDC 2YCIX 4GBUA 3ZWSA 1PS9A 2GZXA 1QNSA 4M56A 2CIPA 2GDVA 4BR1A 4AHPA 4MAVA 4H4TA 2WM1A 4IG2B 2ABAA 1O5KA 1HX0A 4AIBA 4HP5A 2FTWA 3TW7A 1GOWA 2GR3A 3AIVA 1OYBA 4FIQA 2X1RA 5D30A 2V68A 3EEGA 4HZMA 5AFDA 3VDBA 5D2VA 2IXVA 3E0LA 2YLLA 3KE0A 1BD0A 4IHCA 2PZ0A 2XDFA 1EC8A 2QCNA 4DO6A 5M2FX 4EQXA 4J7RA 3R8GA 2XYLA 3C2VA 3VGEA 3QY6A 2BZNA 2YFNA 2YCJA 3N6JA 1AJ2A 4NZFA 3N6HA 3PNUA 2ZZCA 3ATZA 1GZJA 1LJYA 3MYPA 1TMQA 4QS5A 2JQXA 4A3YA 5BRBA 2WCSA 3IIVA 1P6BA 4ASTA 4S3GA 1YDVA 2OU4A 3LRMA 3P81A 2ZA3A 3P5ZA 1PWMA 1YHTA 1FRBA 1JCMP 3H7VA 3IGHX 2G50A 3RR1A 4WKAA 4LH8A 2A8XA 1DP0A 3HFTA 2QW5A 3NZ1A 3CZJA 3DJGX 1E43A 2EKGA 2Z7GA 1QNQA 4WY0B 4WEVX 3GXNA 5FESA 4JTUA 2F6XA 3LU2A 5IFPA 1JYXA 4IOTA 4LAUA 2OMAA 3FOKA 2KZHA 2QMKA 4OU1A 4AH7A 4A3QA 2H8XA 1XH0A 1QNOA 1XYCA 4C6JA 2OOGA 2X42A 1VLWA 5LGXA 3FEQA 4GNVA 1ESWA 1OSEA 3G2GA 1I2RA 1M01A 4KMQA 2HVOA 1RJRA 1RBOB 4XBKA 3OZMA 3VGHA 1QR7A 3O3RA 4LCQA 1XLFA 3MQTA 4AD3A 5IBXA 3VD9A 3W7MA 4CKQA 2I9UA 1A53A 5JCLA 1TPVA 5JQ9A 2PRLA 1UB3A 1LDCA 5PTDA 3CUGA 3DH7A 1K4QA 3TYUA 4HYWA 1SSDA 3DFOA 5DQPA 1FDYA 1UZDA 1UWAA 4H00A 5E09A 1MXGA 4PMOA 3UJRA 2EQ8A 1EF3A 1EJSC 5D2TA 2BXYA 2Y7FA 5BROA 4LC6A 1SFLA 4JX5A 2YVFA 2PWHA 1VBGA 3FW6A 3LXBA 5I78A 1ITQA 3W7GA 5JH1A 4E4PA 1CXEA 3S2JA 3M47A 4ATLA 1CGXA 4MJ4A 1E0VA 3CO4A 2IUZA 3SGZA 1NM9A 4L9ZA 4GUJA 2YCKX 3EGJA 7PTDA 4D6IA 4R3UA 1NEYA 3CIWA 4CLMA 4N2YA 1XWYA 2G96A 1UW9A 2Q8ZA 5CKSA 1TTPA 4MY8A 1FFQA 4AVOA 3FIGA 2G3JA 3IIXA 2B0MA 4PBGA 3WH5A 5TAOA 1PCKA 3VNJA 3LSBA 4EM3A 2BGSA 4DXXA 2XM1A 4DJEA 4ZTYA 4Q4RA 4GKLA 1FH9A 3A4WA 1LWHA 3UNDA 3VOIA 2OWCA 1E6XM 3E2VA 4IIDA 3WL0A 4C65A 4AWEA 1E4MM 4CQ9A 1E0WA 4DYKA 2D2OA 3IJ9A 5A3HA 1V6TA 3H2MA 1K6AA 1KFLA 4I9JA 1XH2A 1GOOA 1EZWA 1I4NA 1FHUA 3A47A 5HDRA 1QHZA 3NEVA 3QC0A 2NQJA 3IUDA 1CNVA 3WG6A 4WOQA 3H6OA 5K3VA 4PH6A 4GLEA 5HNNA 3E2SA 4H9VA 2G3FA 1M5WA 2J88A 1J9YA 2QPSA 1A4MA 3T8LA 4GO9A 1R30A 1TYGA 4LUIA 2OKOA 5KVIA 3ZS4A 3MUCA 3PG6A 3G77A 3N1AA 4WGHA 4XX6A 2RDXA 3KEHA 1JRPA 2A7NA 3AICA 4QX4A 3KDNA 1OG6A 3AAMA 1FUYA 3QLDA 2GUUA 1P0EA 4R9XA 4ZTXA 1F8WA 1V77A 4GOAA 3PZUA 4EMJA 1ZU8A 2DW7A 4GYKA 1Y8BA 2ZTJA 2CZVA 4AXKA 2GVEA 3M0ZA 3KL0A 1ZQ5A 2Q8XA 1RK6A 1FA2A 1KKOA 1K1DA 4GINA 3Q37A 1DIEA 2Y85A 5CG0A 4GACA 3XIMA 3ABSA 4NXKA 2XVPA 1ZCCA 4YYCA 1EO7A 4HHMA 4I3GA 6ENLA 2WBKA 4RDZA 1TELA 2ISWA 1AJZA 5JIWA 3DXIA 2PCEA 1QT1A 3KL3A 3MW7A 1R0MA 4C5YA 2VYOA 1EUNA 3MVIA 5I3FA 3W1AA 4Z2GA 2R9ZA 1WCGA 2C79A 3TNOA 4L4LA 1OCBA 1WKEA 2ZQ0A 1W1ZA 2W91A 4JTAA 2DZBA 3KOFA 3TWAA 1FWHC 4B5WA 2Y8KA 5BXSA 5FJIA 5AHNA 4CCZA 2I16A 1LOSA 4CU6A 4Z2LA 3UPWA 1E0TA 3VVGA 3VIFA 3H4XA 3RNDA 2BASA 1OYCA 4O16A 3RX3A 3UCQA 3UWVA 4CNUA 3GZAA 1I60A 2GQ8A 1JRBA 4NAFB 3UG8A 1SPQA 3CHFA 3BDKA 4J5NA 3WNOA 4ZQOA 2FPTA 3L68A 5LHFA 1FDZA 5TF0A 4Q8OA 2VZOA 3BGAA 3DFNA 4O50A 3ZM8A 3T40A 1FP8A 4B5UA 3UW6A 4DNMA 3S1XA 1TCMA 5FKYA 3TQ0A 2V81A 3VGGA 1MI3A 1XYAA 2G3MA 3WDQA 4QG9A 2BXZA 4ADUA 4G1NA 2QUVA 5CLWA 4XAZA 1GT8A 4GQQA 1DKWA 1U1UA 3T55A 4H4XA 4XV0A 5BOFA 3MKKA 2ZXBA 3QGAC 3M0VA 1KM6A 3EDDA 1UKQA 1PIGA 3NFUA 4NRRA 1HL8A 2QUTA 4XUGA 2CU0A 4W86A 4NI3A 4W8LA 3F1QA 3P2VA 3VTRA 1FWDC 2XINA 2FZDA 4F2UA 2RUSA 4JQAA 1J12A 1OFRA 2DSZA 5CZTA 1RAKA 1LWIA 3WEOA 1JROA 4KCVA 3URNA 3DIPA 4NJHA 1F8IA 2J7GA 4GI8A 4OTKA 4NZ4A 1C8YA 4ERIA 3DUGA 1TUXA 3OW1A 3WMLA 1IR2A 1S5TA 3PUEA 5IHRA 2B7QA 1GZ1A 2BBFA 3W7NA 4L6HA 4N9DA 4HJWA 2WMIB 1LL4A 4ZA0A 4O4WA 4JDBA 1J2WA 1GEQA 3LS9A 2A6NA 3W7RA 3OYZA 2BCPA 3CL7A 5K4ZA 1K4GA 4W5ZA 2TPRA 3BTNA 4CVUA 3QR3A 2DY3A 4DF0A 1V03A 4JEJA 4YS1A 4LRTA 1YE4A 1G67A 3EKGA 3SCTA 3MV11 1QO2A 4ACZA 1OFBA 3WNMA 4WOZA 3V7PA 3K1GA 2IPGA 3QRHA 3PM6A 4ZODA 8TIMA 4D6EA 5M03A 2QGYA 3FGCA 4LU0A 5ECUA 2ATMA 4MJZA 4TO8A 5TR3A 2ACQA 3KP0A 5LNSA 3VUPA 3THQA 3FV9A 3H54A 5FF2A 1S39A 3UEQA 3ARQA 5CQ1A 3KVMA 1NF7A 1CXIA 3AZSA 1NELA 1QPRA 3IGUA 3DG7A 3AIWA 2YZRA 3IUIA 1CB7B 4B15A 4G56A 3GD4A 5CC7A 4UTTA 1F4HA 2Z0IA 2XSAA 3HPAA 4GRTA 2A6LA 4QQUA 4LV4A 4JQ4A 3VD7A 3PBVA 5CBIA 4HCHA 1BG4A 1BKSA 3FSTA 2PF0A 4BI7A 2IQTA 2E77A 3HJZA 1W8GA 3O15A 4J35A 1JULA 4U3CA 1GCYA 4N9CA 4HA0A 4S38A 1EXBA 3PFRA 4KFOA 3TMQA 4AZCB 1RSCA 2H9AA 3WQFA 2XVNA 4W7UA 3C8FA 2PDQA 2Q09A 3QHOA 4V27A 3MS8A 3VIOA 3B05A 2E68A 4JTIA 4RCXA 3EUB3 2WSQA 3ZWTA 2ZFAA 4PN2A 1IF2A 2V63A 2Z1WA 3GDRA 4C6OA 1Z6KA 4Q4KA 4Z2HA 4RLIA 2H3DA 3OIHA 1JFXA 3OVGA 5E70A 3KS5A 1JDAA 2WZMA 4EACA 1TCDA 1NOWA 2P0OA 2Z25A 2R82A 1J0IA 2V69A 1RV8A 4W8BA 4YTUA 4MLJA 3G5EA 4AW7A 1E4LA 2UBPC 5AB3A 5T9BG 4RDWA 1A3XA 2GQWA 4LAMA 1KR0A 4ZR8A 1UD6A 4V1YA 2XN1A 4JX6A 2CZDA 2X8RA 3QFBA 3GU9A 3I6TA 4DO5A 2ZX5A 1GRFA 3TC3A 1ITXA 3GH4A 4RNIA 1A0CA 5I5RA 3GLCA 4OOZA 4HU3A 3LZ5A 1X1OA 4UQEA 3JW7A 3WLMA 3WSUA 5J8LA 4X63A 3T0DA 3SBFA 2HPIA 1FH8A 4J2MA 2A0NA 5AN7A 1E4NA 3GHRA 4GABA 1E0XA 4IG2A 1OYAA 1GRHA 1HJVA 3QEZA 2NV9A 1PTDA 3F4DA 4K7YA 2VR4A 3M16A 3NVTA 1TV7A 2ZBTA 2NSOA 3SUVA 1SVDA 4JN8A 2YB4A 4Q22A 1Z8AA 3EX2A 1QHPA 3W2KA 3L0NA 1V3KA 4H83A 4GUFA 2PRMA 1C90A 4QGCA 2FH6A 3KRZA 1IZKA 3LCFA 4DPPA 1SM9A 2B31A 5BXPA 3DECA 4QHRA 2DSWA 3CC1A 4QE4A 1PCWA 2BY3A 2OB3A 4N7QA 5EFFA 1EFZA 4OOUA 5JBFA 5HPCA 1FHVA 4MSSA 2FDSA 1QWKA 1XW8A 3LCWA 4I9AA 4W5UA 5F2MA 3AQUA 3B9EA 5ABGA 3WLTA 3ARSA 4NJKA 1N60C 4YWSA 4K8DA 1D8WA 2OX1A 5LIUX 4NIRA 1U83A 4HPXA 3TOYA 4A2SA 3B0XA 2AAAA 2JK2A 3WJYA 4FX9A 1OJXA 4OZOA 4B5NA 1PX8A 4XD5A 4FLQA 6ALDA 3CQIA 2V6AA 1ZHAA 1G69A 4TMBA 4DM2A 2B4GA 4IGMA 4IL0A 1P43A 4L5ZA 1VBRA 2ATSA 5MHBA 3AMLA 4AWSA 3N15A 4AYSA 3GO2A 2QULA 3U6WA 2V5DA 1TX2A 1G6CA 4YU1A 3OJGA 3H2NA 1FWBC 3BV4A 7REQB 3OB8A 3LLFA 9XIAA 4JR5A 4EPBC 3GNRA 1EBGA 2V2DA 4LRSA 1AW5A 4MJMA 5LNVA 3BL3A 2WQDA 1FCUA 3EPOA 1R3SA 4A2RA 1IIHA 2TYSA 3B3DA 4HK7A 4JCLA 2WVSA 3ABZA 3URBA 5FAJA 1FWTA 3VABA 8XIAA 1XQLA 2DQWA 3FVMA 4WDUA 1NVMA 1VRXA 3BW3A 2J3NA 4B3LA 3EWBX 1OIMA 5HK4A 1QOXA 1H7NA 1NWUA 3WH8A 2CFYA 4E3VA 4C6CA 3BANA 4CCCA 1ALDA 3M44A 2GLKA 4AC7C 3GG1A 3A7RA 3UERA 4EPDC 3K30A 2J7EA 2R91A 4NP7A 4PUNA 1V6UA 4MKVA 4PL2A 4H9UA 3NRZB 2VGGA 2W6RA 3BGJA 3DHUA 4DHGA 2YA2A 3WFLA 2QCGA 1QI0A 1HTIA 4UOQA 4FX7A 3TROA 1XYZA 1EKOA 3BLIA 3NSNA 1DOSA 3G0UA 2GJPA 1CTNA 3BAYA 4WSKA 3KCOA 2ZA2A 4FNQA 2BLEA 3U5YA 1HVXA 3OQEA 4D8LA 5HJYA 2Q3OA 2V67A 1Q6DA 2QEZA 2VZTA 3TFCA 2YW4A 5DMLA 1SZEA 3S6OA 2GL5A 3GSMA 1E9IA 1K7FA 4JIHA 4DM1A 1WDDA 4FF5A 3OBKA 4UQCA 1OCJA 3H55A 1EPXA 2FTPA 5MKGA 3CAVA 4PUMA 1SMDA 5I3GA 3UXKA 2QPXA 3A6OA 3INPA 4WQ6A 2NW0A 3IRSA 3ITOA 3E0WA 4Y9AA 3TCEA 4JQ3A 4UTLA 1V6VA 2Z27A 3I6EA 3RMEA 1W54A 4HU4A 1ONWA 2D0GA 1I2PA 3LNMA 2VVNA 1TVNA 4WKHA 4ZMGA 1OGBA 5JCNA 1H3GA 2C3ZA 1EGMA 3SECA 3OG2A 1UQZA 3TW9A 1EOKA 4KT2A 5BMXA 1Q8AA 3U3HA 4NILA 4LBUA 1TB3A 2QCDB 3S0CA 3I65A 1H61A 1N82A 2GJLA 4J40A 3W7EA 3CWOX 3IJQA 3VM7A 2AAQA 1EJVC 3SUUA 1B4EA 1Y0EA 2POZA 3BLLA 2WZTA 3C2EA 2Q6ZA 1DYSA 1MMFA 1TJ0A 5E6YA 1C8XA 3HFYA 3ABRA 3SB0A 5JCMA 3KBVA 2BVWA 1NDAA 3C0LA 2Y7GA 1R2SA 3WDIA 3IIZA 3ALGA 5TBOA 3VIJA 4FB7A 3MJMA 2R6OA 4IIGA 3SGUA 2G3IA 5GQBA 4KWOA 4S3EA 4ORIA 4LANA 5FJRA 3E2QA 2CPUA 3KVLA 3S2LA 3UFYA 1D3CA 3OBEA 5U7SA 4KW2A 2OJPA 4Y90A 3P74A 4AEOA 2PWUA 1DJIA 3WQGA 5A2BA 3NZPA 1GNXA 4CVWA 2YPIA 1J6OA 4IXXA 2HZGA 4OT7A 1L8PA 1MZRA 5A95A 4YN5A 3G24A 2JALA 2Y2WA 3PBGA 4QEEA 4UTFA 1DPMA 5I79A 3EZ4A 1GOXA 3S1VA 4B5XA 5CH9A 2W61A 5FA5A 1PXGA 1R3RA 1D2KA 3MCOA 1U5JA 3S6DA 1AVAA 1XIFA 4MNLA 4C60A 3V0UA 4OBRA 4RE2A 4H04A 1G5AA 1M68A 4AZCA 2D24A 4R27A 4HT3A 4K37A 3EB2A 1T96A 1YTKA 2A3CA 5DEZA 1HKKA 3MDUA 3IEBA 1UWTA 2Y1HA 3RRAA 1QTWA 1K70A 2JGYA 3W1LA 4ZO7A 1XIBA 2Z1SA 4HNTA 1PWLA 4CN1A 5BXTA 3CMFA 3ALFA 1Q6FA 1YPIA 3NS1B 3ZO9A 4JTHA 3RIKA 1S2VA 3GYEA 4JTTA 3VD4A 3WD2A 2G5WA 3FA3A 4Q33A 5LIXX 4NNBA 2PP0A 4UNLA 1NJJA 2C3DA 3POHA 3NO1A 1R5YA 3N9KA 5KVHA 4ZO9A 1OFPA 4MFEA 3UCDA 4GBDA 3B97A 2VKZG 4XZBA 3G3DA 3WUFA 1GETA 4NEVA 2ZADA 1RHCA 2L5HA 3F5KA 4IPPA 3AUJA 1OK4A 1AH0A 1S2TA 3W1QA 3N2CA 4KPRA 1JOAA 3SFWA 1MW0A 2C19A 3PPHA 1SR0A 5C9XA 1UWIA 1HT6A 2V3FA 3CHDA 4WSHA 4UTMA 1VR6A 4RPQA 2FH8A 3NQDA 2DH2A 3ORWA 3PPCA 5G1MA 5H91A 4IMEA 3C6CA 5DMMA 1ME7A 4IMAA 1MRAA 2V3BA 3E5BA 3DYPA 1CT5A 1BHGA 3WDRA 1KWGA 2DZUA 3QY8A 4JICA 1LWJA 3QQ0A 3S6TA 4M6QA 4WXZA 2QDHA 3FLUA 1EEPA 4LAZA 4H19A 1HGYA 1NHQA 4QR6A 3E5PA 1VLIA 1NU5A 3R7MA 1F73A 1O5QA 2D73A 1OCQA 2CDUA 3WQ6A 2WMHA 5I2UA 2VFDA 3TTSA 3P8JA 2CC0A 2Y24A 3G1VA 4F2TA 1V0KA 1MQQA 1JDFA 3DGBA 4UWMA 2C1IA 2RJGA 3LCGA 4JYFA 5JIPA 3DFSA 2P5NA 3AIRA 1N8IA 1XKJA 2NQHA 1JF5A 3ELFA 1GHRA 4FIRA 4H8NA 2JK6A 5LIYX 3S8HA 2V5LA 2PC8A 1CXKA 4KWUA 2J77A 3G1RA 1PL9A 4UFHA 2NV2A 2NUYA 4GY1A 3TN5A 1SJCA 3NPUA 1TV3A 5AC7A 1S3TC 2XFWA 1YW1A 3WQCA 3QPEA 5CPSA 1JPMA 3CM4A 4QQ3A 1R47A 4OFCA 3HG4A 2Z2AA 3GFZA 4FOKA 1XLMA 3AIEA 3AHVA 2NV1A 1HW6A 4IH3A 4JFSA 3UZXA 3ZT7A 1YE6A 4H4WA 2Z00A 3B9NA 4YXGA 4IUOA 5GJNA 4M6PA 4PRWA 3UYIA 3G1HA 3W7CA 4M80A 1RCQA 1F9CA 1V02E 5D4YA 3QYQA 3IAQA 2A3LA 3Q58A 5FIPA 4YVVA 3SY5A 2ZRUA 3QZ6A 3G1AA 1LCOA 5K2ZA 3C2OA 2HQAA 4P8XA 4F8XA 1JYWA 3QV6A 3VCRA 1XCXA 3GYCA 2A5HA 1H63A 4TTGA 1FEBA 4I7WA 5A6JA 1JL8A 4EXBA 1QDSA 2D3LA 1WKDA 3E0VA 4XAPA 3FJLA 2BY2A 1ZNNA 2FKPA 4W87A 3N25A 2PAJA 3ZLHA 3C8NA 3GHSA 3EPNA 2Y8UA 1W2PA 3IVTA 4KGLA 4KGJA 3N11A 2C91A 3TJ4A 3E38A 1MFUA 4NYUA 2VI0A 4K7ZA 4S3AA 4JPGA 3WELA 5C6MA 2JBMA 1H0IA 2VEMA 1XDLA 4HTYA 4ONVA 1EC9A 4OKDA 2W4XA 5CZSA 4PUDA 4GVFA 2WNWA 3SCWA 4S3DA 4HGXA 3FFSA 2Y5JA 2CHOA 3ECQA 3W23A 5H1WA 3LTYA 4RR4A 2GVYA 3STCA 4WY0A 2WPEA 3OGSA 1BG9A 3ZFHA 2XIQA 4R88A 4H7CA 1PKYA 1UD5A 3NR0A 4PSRA 2YL9A 4CQBA 2HS8A 1F3EA 3N6QA 4NL1A 1S5WA 3W76A 4W7VA 3KLLA 3A23A 3CAQA 3S5ZA 4M1RA 3NNTA 4G5DA 3PSVA 2PD5A 4HBKA 2AGTA 4PMRA 2AL2A 1UC5A 1R86A 3B9JB 1UR3M 3M0MA 1F6KA 1DXFA 4KBXA 3UPBA 3FYOA 5TD4A 4GRSA 3BMXA 4TV6A 2WVVA 3H53A 2Z4GA 4FZIA 1GESA 3G1XA 1XL9A 3W4RA 3CUJA 4LF1A 2DJLA 2YXGA 1B9BA 3QSRA 2BS9A 4UTIA 3NXFA 4KWWA 5CGQA 2E7FA 5HNUA 1RCOB 3TONA 2J62A 4ICCX 4H6QA 4AWUA 3AIBA 1Q1RA 3MCNA 4AY8A 3RK8A 5HBFA 3WDHA 1EC7A 1FHLA 2A3AA 1GVFA 2FMOA 3RHGA 1NF0A 2JGQA 4DYJA 5IXEA 2OCZA 1UOZA 4PMJA 4LEQA 2CESA 1RBLA 3BCFA 1ZAJA 5E0KA 1MSSA 3IV3A 1TRIA 3LENA 2DZWA 2Q71A 3BO9A 4JTEA 2NX1A 2FHFA 4IFOA 1GPWA 1GORA 5A6MA 2FFIA 4HPGA 3IACA 4HA4A 4PB4A 3ENLA 3S5YA 4BQ3A 2YXOA 3VKBA 1VYRA 2GWGA 4HOWA 3N73A 1AZ1A 4E8DA 5A94A 2XVKA 3VZYA 3UWWA 2QCMA 3GWQA 3P93A 3ARRA 4KS0A 5A69A 5EGRA 3W7HA 3CUIA 1YTEA 1A5KC 4UMAA 1ISYA 2WKJA 4I8DA 4P2VA 1F05A 3UG5A 5EMLA 1OK6A 1DJHA 4EAYA 3JS3A 4R7WA 4Y9OA 4H8UA 4AY1A 1TPWA 4L9XA 3IAPA 2PU1A 3ARVA 3DHPA 4E3TA 4OUIA 1HKWA 1DEDA 3RMJA 4DXVA 1S5MA 1XINA 2YW3A 3RITA 3CQHA 2NX9A 3VU2A 3HQ1A 3WD1A 3NUKA 1FQ0A 4PTNA 3NPXA 1O4UA 2W3SA 1N63C 3EWWA 4NZCA 3LB8A 3IJLA 4DJFA 4TX6A 8XIMA 1TKKA 3NL6A 3YPIA 4ZQNA 3MCMA 2FVKA 2O9RA 3AIUA 1KBKA 4JQ1A 4F4RA 3BW2A 1KA9F 2HK0A 1B90A 1KBBA 1MEHA 2R14A 4EANA 2HVMA 2QJIA 2D0FA 2BVTA 3O6AA 1J0HA 1Q6GA 1UZ1A 1NHRA 5CG7A 1FFRA 2P76A 3EX6A 5C54A 4OE7A 2YYTA 1VEOA 3A5VA 4U2YA 2CLKA 1HL9A 3L5MA 2UZ9A 4GQGA 3VM5A 4JDYA 3CHEA 5C0QA 4M0XA 1VCGA 3RGTA 2WMFA 1J11A 3NQBA 5IFTA 5CJ5A 1FKXA 3PZTA 2GOKA 3W7QA 1R3TA 1XFBA 3Q67A 2ISFA 1UKSA 3GIPA 1NIUA 2FIQA 3EDJA 4C7DA 4ZB0A 2QXWA 2XU2A 3KCLA 4YCOA 5C5YA 2YOCA 4YTTA 1GUVA 3LXAA 1YXYA 5FS9A 1E6PA 4PMXA 3VFCA 2REQB 4ZXLA 2GVJA 3H2FA 1GQKA 2QMJA 2A21A 1DTNA 1JCTA 4GQ0A 4IFRA 1EBHA 4X3ZA 1SU5A 3EOEA 3L4XA 2Y5EA 1GOMA 3R0UA 1PTAA 1PDYA 4UBPC 3S47A 1ZXIC 4PBFA 4ZQRA 1VFOA 2XG9A 3W1PA 4WJ8A 4E2DA 1EP3A 4GQBA 3ERPA 4NAEB 2W66A 4R85A 3LHWA 4YHEA 5HUPA 3PSWA 2VD9A 2XWEA 3ZR4A 1IXOA 2E5AA 1PZ0A 5CBJA 5DO8A 1ZFJA 3GW3A 5HULA 1GPFA 2OLAA 4JTDA 2DORA 3HURA 1GKPA 3BOFA 3KTSA 3CQKA 1ZX9A 2Y63A 1DWGM 3H22A 2VNCA 3GVVA 3VMNA 2QQ6A 1TWZA 1HP5A 3AXMA 4DJDD 4PCTA 2WMJA 4HPNA 5XIAA 3C0SA 3RCNA 1JZ8A 1MUWA 1XIMA 3S2MA 4TOQA 3C3NA 5H8PA 4DUXA 2ZUSA 4LW7A 5B7ZA 3LERA 3LYEA 3CH9A 2V5KA 3BK0A 3I10A 2O9PA 2ISDA 3WF1A 1BF6A 4EXAA 4CD8A 1ZJBA 3BSHA 1TO3A 4HCDA 1KLZA 2ZRVA 3F4NA 4GZJA 4JY9A 2CZ5A 2ZRWA 3LN3A 3OVPA 3VILA 3O1NA 2BMBA 3S5OA 4TVYA 4QLKA 4M6UA 6A3HA 1TJ2A 4JIRA 4GXPA 1DWFM 4BFAA 2EG6A 3S2CA 3W70A 1W32A 2DT2A 4MNKA 3L4TA 3AYSA 2XHYA 1BAGA 3W1XA 1QRQA 1UG6A 1CECA 4GIEA 4GVHA 1JZ7A 1XV8A 4P7LA 1W9XA 4OIFA 3W7JA 4Z17A 3ANVA 5GNXA 4DUVA 1C9WA 3GG7A 4AQLA 1Q63A 1LTDA 1FWFC 4TMCA 5AKQA 4IICA 1XKYA 4UQBA 2EF9A 5GVJA 1KD0A 3IGXA 1TZ9A 2O56A 1XDIA 2VFIA 1P1MA 1XUZA 1ZMCA 1XQKA 3QXBA 1F5ZA 3UZYA 1T40A 4O1BA 1EQCA 2NXGA 4L9YA 1ZBCA 3AALA 2X99A 3MYOA 3NM1A 4XZHA 1SZRA 3CMJA 3DAQA 1I1WA 1Z42A 1FWNA 2QV5A 3TZFA 2D2HA 1Y65A 1TV2A 3HGSA 4A6GA 4LX4A 5I23A 1FKWA 4WDWA 3DBPA 1HUVA 4PR4A 4CNTA 4DZAA 3CH0A 4H4IA 1I9CB 2C18A 1EDTA 4NUWA 5F4XA 3WLJA 1RD5A 3NZRA 3MI6A 2HQMA 1GRAA 1Z48A 2PWGA 5IHSA 1JJKA 3ATYA 5JH2A 4N4PA 2IKGA 4ZGYA 3UPMA 3W7IA 1HJXA 2IKJA 3CT7A 4US6A 2J66A 1O7AA 3A4XA 1QAPA 5T9CE 1KB3A 2GGEA 1LRQA 4HIBA 1KO0A 4M1BA 1HJUA 1JG9A 2J78A 2P1FA 4XKMA 3IJIA 4IISA 4N02A 3F4CA 1CLXA 4X9YA 4JL1A 5EMKA 3M5XA 2WC3A 1L6SA 1GVSA 4H2HA 5BZAA 2QF8A 4GIRA 2W55A 3MHFA 3WD3A 3OZYA 2ISVA 3E02A 3WF0A 3SQLA 4INFA 5FEXA 3CV2A 1L9WA 1LOLA 1OX6A 4CU7A 1CXLA 3U4AA 4EIVA 3N2XA 1E9LA 3LD5A 5D8ZA 1FFUC 1B2YA 2C15A 1UD2A 1G4EA 2QKFA 3DK9A 1XBXA 3UWEA 4DF1A 3L2LA 2FQIA 4GY7A 1MVYA 2I57A 3HPXA 4J1OA 4C1LA 4M6VA 4WDTA 6XIAA 3GX9A 3P84A 4ES4A 1R9YA 2QIIA 2V5CA 3DC0A 1WKYA 5FACA 4PMQA 4HMEA 3V5CA 2GK1B 1AH3A 3EDFA 3BJFA 1QK0A 2JEPA 3WBAA 1RR2A 3STEA 1NHSA 1NDYA 1KM4A 2YDRA 2Y4SA 2V3EA 1VB9A 4DZHA 5H2ZA 5REQB 4Z1YA 4IGHA 3TC7A 3GC5A 4F0RA 3W27A 1W1TA 3B4UA 4J3XA 3QYSA 2J8TA 2J7HA 4JHZA 4PUEA 1E70M 3W38A 1EA0A 3EX4A 1UP0A 2W67A 2HVNA 1JPIA 1EX5A 2FZ8A 2VDGA 3EOUA 3AO0A 4IUGA 4N9BA 1LM1A 1Q13A 3DERA 4LS1A 5BRPA 1DBTA 3KM8A 3VE9A 1BRLA 2EGZA 2GGHA 1POKA 3W37A 3LBOA 1LBLA 1ONEA 1NP2A 4K38A 3S1UA 3TU9A 2O4MA 3BLDA 4F66A 4LYRA 4MB1A 4D6JA 2PD9A 1CEOA 2HE5A 1TA3B 1RH9A 2DZXA 1WOBA 3A9IA 3UBPC 1CYGA 3V4BA 2AMXA 2DGAA 1PIFA 2FVLA 1VPYA 3MB9A 3CU2A 3PJUA 1KW1A 3TYCA 3GTNA 3W83A 4AZIA 4ZB5A 1NAL1 3SIZA 1WBHA 3N2TA 4R33A 4AD0A 1QATA 3DDMA 1H2IA 1V3IA 1LVLA 4NNCA 1R7OA 1VBUA 3EA3A 3BICA 1O12A 5CC3A 5LKYA 4XD3A 3U7VA 2OEJA 4GYJA 4DY1A 4P7RA 3GIQA 4AD2A 4PTVA 3RPTA 1LG1A 1OZMA 2WMIA 3VNZA 3UVAA 4DAIA 1TTQA 4KRTA 4O1EA 3MZNA 2G0WA 1EB3A 5GNYA 2MANA 3MC5A 2ZUUA 2DZTA 1SO4A 4X2RA 1Q4WA 5CJMA 1JZ2A 4C91A 2OLSA 3W1TA 4B16A 1QUMA 1GSNA 4LVDA 2UY3A 3AWNA 3NYDA 4FOJA 3PB0A 3W2NA 1UR2A 2NLYA 1OB0A 4MNMA 4IPLA 1X39A 3WBEA 4JGDA 2C71A 3QBUA 4YWOA 1KWKA 4UQDA 5ECVA 1N8WA 3TSMA 1XM3A 3PHAA 4W8AA 3TTQA 3M0HA 4WR3A 1I0DA 3L67A 3TJIA 3KOYA 3PFMA 1IWBA 4JTFA 4B9YA 1KXHA 1LT7A 5DX7A 2XVGA 1H2JA 5MF5A 1A5UA 1X6NA 1H60A 1X8FA 4X60A 1G4TA 3W7PA 4H6EA 3UQNA 2EO7A 1P0KA 4LWWA 3PY2A 3OC4A 4BURA 4FR6A 3EKZA 3A3XA 2E40A 3W74A 3BVJA 1OT1A 3D0CA 3EEZA 3WNNA 4A3RA 2BG5A 4MOZA 4AB4A 3TW6A 4JN7A 5KINA 1HZYA 1EEXA 2ADAA 4GE8A 2X2GA 1R2RA 3KP1A 2J8GA 2IPWA 1GQIA 1V0MA 3LXCA 3S1GA 1ZY9A 1CGTA 3UNTA 3BLOA 4XISA 4NZ3A 2E0PA 4A05A 5T8GA 4N6FA 1K7EA 1ZY8A 1XCFA 1FWSA 4JFTA 4ZO8A 3ARTA 1X6LA 2QIWA 4O15A 1XLBA 4RNJA 3QC3A 3LCIA 3HPSA 2WYSA 1QU4A 1JVNA 3M0JA 1XLHA 1ZAIA 3AMDA 4LJ3A 3HF3A 3SCQA 1VFUA 2YBUA 2XH2A 2VCAA 3T0CA 3K2GA 3L12A 3KVJA 1OX5A 2A3EA 5BU9A 2NLIA 3FEMA 2X09A 3RILA 2PP1A 4L64A 4IGSA 2CLEA 1BEUA 1E72M 4HPHA 2F6KA 4E2VA 3G22A 1F3TA 1TJPA 1FCBA 3PJXA 2OZTA 3LHUA 4Z1DA 2VVSA 4IIBA 2D3NA 4XBSA 2WCGA 3KCJA 4GYFA 2ZRYA 3SQMA 3R6IA 2WO5A 3TFXA 2X7WA 1FWWA 3W24A 2HXUA 2Z1KA 3O0FA 3HO8A 3BC9A 5JCIA 1JZ4A 4CD6A 4PODA 4DNHA 3MUAA 4NKCA 4PCFA 3T44A 4MG4A 8CGTA 4FF7A 1UKOA 3VX1A 4K8GA 3JZEA 4RE0A 1Z89A 1LQAA 2DT1A 1E3ZA 4L1GA 2YL5A 3QOKA 2GSJA 2WQPA 3W85A 1R3VA 3REQB 3FA4A 1F8MA 3TXZA 2GQ3A 2EHHA 3S5NA 2DV0A 4POCA 3FKKA 5LA1A 2NT1A 4J9JA 1ZLPA 1T8XA 3RO8A 3WENA 3W86A 1DQUA 4G9PA 1G7VA 4KEMA 4PEKA 3THDA 3IPWA 3KOZA 3PZQA 1PKNA 1HO1A 3URHA 3GFXA 3A24A 2DZSA 3HG3A 4UUIA 5D02A 1FHDA 3H23A 5FSDC 4AIOA 2P3ZA 3R58A 2EJ1A 2OZ3A 3GTFA 4KESA 4KKXA 2NXIA 1DJNA 3OTRA 4LIIA 1W91A 4KWVA 4FALA 4AWTA 3WQVA 2X41A 4H3DA 1MO9A 2J25A 4XK2A 3BMWA 1D9EA 2DZVA 4V1XA 1UWUA 5E1QA 1AQ0A 4BWLC 1GOQA 1SJBA 4LUSB 4XZIA 4UQ9A 4V15A 2P10A 5H8UA 1IEIA 4Y9PA 2HROA 4UFMA 3HPZA 5JMUA 4FS9A 1KKRA 1LPFA 2WXDM 4D8ZA 1TTJA 3M0YA 3GXIA 4O19A 2WOVA 2GFTA 2VFEA 7REQA 1MNSA 1H7WA 4QDMA 4O18A 4QITA 4UFIA 1VPQA 1QNPA 1IWPA 3BOLA 2WOWA 1UR8A 2NWRA 3EXTA 1WA3A 1SSGA 3SUWA 1T6MA 2ZXAA 2OX4A 4F3HA 1FEAA 4CD5A 1GYNA 1E1CA 5HR6A 2YCLA 4I9MA 1B3VA 1EWDA 3ARZA 4W89A 2X8HA 3H4KA 2XFFA 1LRNA 2ON3A 3PNZA 5DFAA 2DUZA 3EF6A 3JR2A 1EO5A 3NTYA 4WK9A 1ZKQA 1QW8A 1HL2A 1TR9A 4GFIA 4GJ1A 4MZ1A 4MTVA 4NXSA 1XC4A 5FJPA 3TTEA 5C9RA 2DVXA 1F3WA 1SW7A 2H3BA 1X38A 3KAOA 2FB3A 1Q1WA 6TAAA 2PSNA 3TX9A 1W1YA 4L1WA 1UYQA 2XFRA 1ZK7A 1FH7A 4M29A 3EYPA 3ZSTA 2VL4A 2WC4A 3UZWA 5DLCA 1Y7VA 1U22A 3BG9A 2GUBA 3IUHA 1YYAA 2OLHA 3U2OA 4O28A 2EPLX 1WDSA 4ZENA 3EWDA 4KFPA 3EB3A 3II1A 1W3LA 2VR2A 3C86A 1B9ZA 1HKMA 1KXQA 3L23A 1LLOA 2ALDA 3UP8A 4KH2A 4OGZA 3W7DA 2ZUMA 4YYFA 3MHGA 4U33A 3VOJA 4FLOA 1HQTA 3MZ2A 3RAOA 2CBJA 3GU1A 2WW5A 2J7DA 4M82A 3EMQA 3W28A 1ZJAA 4KWSA 3RDKA 3S4TA 4N6EA 4LUTA 5C9ZA 2X1UA 3KUMA 4A29A 1RQHA 4YWIA 4FX8A 3QSTA 3L4UA 1P1XA 2GJXA 1TPC1 2X16A 4JTLA 5G5GB 2ZIDA 5ABEA 3R07C 4QAIA 1XIGA 3BAKA 1EPVA 4HMDA 4ZO6A 3N2MA 4RNHA 2ZZ3A 3GR4A 4GHRA 2PB1A 1MDRA 5CZ0A 3CGCA 2NXHA 1WOAA 1P48A 4S2CA 3AC0A 4H8HA 5CGMA 3BOXA 5F1VA 4UQAA 2YAUA 3MUZ1 4P7QA 3KRBA 3ARUA 1WZKA 1PZ1A 4JIQA 1TWIA 4QE5A 3WJXA 3WF4A 1XLKA 2GRTA 4HMNA 1UD3A 1D3GA 3N9RA 4E5TA 3R5EA 1JCXA 3W7KA 4MDPA 1UR1A 2R1LA 3VD3A 4GG9A 2GPTA 2EPNA 1BSIA 3DHFA 3LXDA 3NZGA 3ZQ9A 4DJED 1R9XA 4IXHA 4ROPA 3UA4A 2SFPA 3FNDA 1R9ZA 1CX9A 4KRUA 2DP3A 4PRTA 7ODCA 1KFJA 1QBBA 1GOIA 3B0VC 1BYBA 4O1FA 3ZSSA 2CWXA 2WNZA 5CZKA 3NQ8A 3TQVA 2RDWA 3M7SA 3T08A 1WYGA 2EQ6A 1EGVA 4V2XA 2AAMA 5D38A 3LBCA 5M1TA 3BGGA 2O9TA 1RJPA 1B57A 2OGJA 4AZ5A 3OP2A 2Y6ZA 1A80A 2ZZBA 1U1HA 3UWZA 1RP8A 3OG3A 2OVLA 3S9IA 4D72A 4OECA 4DQWA 3PVFA 1GQLA 1Y5XA 1K03A 3AMZA 1FECA 4XZNX 4K7VA 1OF6A 2CEQA 1V3HA 2JKPA 3MKCA 3CXBA 4J3UA 1EHNA 3U8GA 2C0HA 4IJRA 4B5SA 2VP8A 1W37A 4HN8A 4UR9A 1ONXA 2W5FA 3PTDA 3TP4A 3VNDA 2CCRA 4BF7A 3LA4A 4JQ9A 1XGZA 3RG6A 1YDNA 3UZZA 1J2BA 1ZBKA 2J7BA 2GK1A 2PTYA 4R34A 1GVQA 4YVPA 2WSRA 1JI2A 3CNYA 1X2GA 1J10A 5G2HA 4Y96A 5I6SA 2DIKA 3GDKA 2D69A 3MI3A 2XN0A 1KRBC 3APYA 3ETRB 4FXFA 1KCXA 1F3XA 1XXXA 1UUMA 5A8QA 3T05A 2DT3A 3LRLA 2WHKA 1KGWA 2TRSA 1VD6A 1VFFA 4LUTB 4QROA 1JQVA 1RPXA 3NDZA 2EQ7A 2DVUA 3M7WA 2XSXA 1QFEA 1MEWA 4PCSA 1AL7A 2ZVIA 3SEPA 4BJHA 4KFNA 1UP3A 3WLPA 1E5JA 5A6TC 4QDPA 3XISA 3EOSA 1VHNA 2P3EA 2WPCA 5C2XA 4LPCA 4IPNB 1SJDA 3O6CA 2IPFA 1XANA 3V3WA 4WVXA 5IDZA 3GS6A 4YTRA 4LYKA 1TFVA 4S3CA 4DBSA 2I14A 4QSFA 2FDMA 3E2RA 3PG9A 1UMLA 4JXCA 3WQPA 3H2AA 1EZ2A 1KFCA 4CNNA 2ACUA 3V0TA 3QQWA 1X98A 1R85A 4DELA 3L4YA 5FI8A 1DJWA 1GGOA 4Q8VA 2CKSA 5DN1A 1LZOA 4PMVA 3GRSA 1KV8A 5IRPA 3TXVA 1KGXA 3DJJA 2WSYA 1TPB1 4KCUA 4XD6A 1JD9A 1JEZA 3FN9A 3M0LA 2P8CA 4YTQA 5HA7A 1YX1A 4A4AA 3B03A 1KM0A 2DZPA 2ZXQA 4UR7A 4E38A 1JYNA 2GDUA 5CZJA 1H7PA 2EPOA 5G4EA 1N2VA 2CERA 4CNOA 1XHCA 1TMLA 2TPSA 3AHXA 3DH9A 4YLWA 3WNLA 2QJNA 3WK0A 4UC5A 2BVYA 1A5BA 4ENLA 3GVWA 4F0SA 4CCDA 3VDGA 1JD7A 2WJDA 1A5CA 2YR1A 4PMYA 4LV9A 1V93A 1J0YA 4GFSA 3V35A 3KTXA 1H7RA 3NM3A 4GCAA 1ISZA 1H49A 4R5EA 2A4AA 4TUFA 1A50A 1KM1A 2FZBA 2J27A 4QJ3B 1BRLB 1BVNP 1KM2A 5DXXA 5I00A 3PZGA 2ZC8A 4GGBA 3L0KA 3PULA 2X1TA 3AI0A 5CPQA 2IQ0A 3W22A 3ANUA 4A35A 4GI9A 3PWGA 4C6KA 3GC2A 1OFAA 2DVTA 1Q2SA 4WLCA 3K5XA 3M4HA 3OU8A 3HGOA 1QXLA 3QKEA 1UPPA 4AMAA 1RQEA 2VX6A 2C0AA 1TE6A 2O9OA 4AISA 2VX7A 1RM6B 3DKLA 3GE7A 4PCPA 2ZZ7A 1H5VA 4GIAA 2GOUA 2XVLA 1PAMA 3NSMA 1E6RA 1YXCA 2ZUVA 7CGTA 1HJWA 1BGAA 3NQCA 1EIBA 1JCYA 3NIYA 3APGA 1MQPA 2POTA 2CLMA 3VXGA 5K9XA 3BUVA 4QEHA 1A5NC 4NJGA 1C91A 3N14A 2DSUA 3QTGA 3GUGA 1ZL1A 4QLJA 5JBEA 4RZ4A 3LTPA 1KCKA 5A6BA 5LA2A 3WNPA 1DJXA 4LAOA 1Q4NX 1DIDA 3BXWA 5DBUA 4OUEA 4EK7A 1L6FA 1XYFA 4AUBA 4URIA 2RJHA 3PZIA 4ORMA 4AEEA 5F1UA 3RXZA 1PZ3A 1E1CB 1CENA 1AFSA 3GH5A 1KV5A 3DKJA 1A5OC 2J4GA 1JDEA 5HQEA 1RCXB 1DJYA 2CHNA 1WO2A 4U10A 5HJXA 2ZUTA 1BKHA 1DWJM 2R24A 1Q6LA 3W6YA 1XGDA 5K9CA 3CAKA 1EIXA 4UTKA 5C7HA 2WP5A 3T0BA 3MPGA 3P8IA 3SCSA 3TV8A 4Z42C 4HU8A 4N0RA 1M6IA 1WB0A 4FNRA 3SRHA 1PX4A 4J3VA 1JR1A 1S1PA 2CLOA 3NQ7A 3W1MA 1NQKA 1WP6A 1X2HA 1XIDA 4Y9NA 2OPJA 2VJXA 4CGTA 1O5RA 1AODA 1WAUA 2D23A 1FWCC 1O66A 3NG3A 4Y7EA 4GVGA 3VCCA 4LS0A 2O92A 2EAWA 2WMGA 5C9WA 1US0A 5FS7A 4HHHA 4CQDA 1HF6A 1CBGA 4GUGA 3FXYA 3II4A 5JRBA 3SIMA 1TIMA 4O57A 4GC3A 4NEWA 1LQ0A 3SRDA 3SRFA 3T78A 1XS2A 4H4QA 1NQ6A 1EHAA 2RABA 3B0YA 3AXIA 1LLWA 2BX7A 2EXOA 1M1BA 1YIXA 4NJIA 1E9YB 3ES8A 4LAKA 4BI6A 3GNXA 1FWJC 3M5VA 3BMVA 3HJEA 3W01A 3R89A 4DWSC 5AYIA 4K68A 2DT0A 2BC0A 3LPFA 1UH2A 3OO2A 2FHBA 1FXQA 1POJA 2FMNA 3W9ZA 4LNYA 2ZDSA 1PV8A 3WZ0E 1AQHA 1WDQA 4C6QA 3DZ1A 1VQZA 4EP8C 2ASHA 2GH5A 3THCA 5KSWA 3CIXA 3EMCA 2ZXDA 2WOIA 1W3KA 3ZOAA 2J7CA 1BYAA 5DCDA 7XIMA 1P5BA 3GKAA 1RVGA 4Q4QA 2J9XA 4DIAA 1I1XA 2YB1A 3ZT5A 1EP2A 4M3PA 2AGKA 3DI1A 4PMZA 2TMDA 3BH4A 5D05A 4RL3A 1EX1A 1IT0A 1TX0A 4HKPA 5A8OA 2Z29A 3H2EA 1S2WA 2IW0A 2XN2A 4MHBA 4AEFA 1F6PA 4GX8A 1VGAA 1G7UA 4H4RA 2PDNA 4J3TA 4JL2A 3HIJA 1GRTA 3AWOA 2NVDA 3IK4A 3KDOA 3WX7A 4UMBA 1XRVA 4HD5A 4JKKA 2BNJA 1GTHA 5LYRA 3LLDA 1P7TB 1JQXA 5J5DA 3TDFA 2FB2A 2D22A 3P60A 3SN1A 3T81A 5AC4A 2BHYA 2OSYA 1RY0A 3GD6A 1UA7A 4EMWA 1K8YA 3P67A 4M5PA 3G6LA 3T2OA 3VIMA 1UD8A 1XICA 3F5JA 1OQFA 1Y5VA 2WB5A 2VUNA 1SW3A 3M6DA 4QJ5B 3TSDA 1S5VA 4UNKA 5AHFA 3WMSA 4D6CA 2PTDA 2JF6A 2JIEA 3WMBA 2NX3A 1XR2A 3LNPA 3M43A 4GUIA 1GWJA 4JYEA 3TA6A 1OFEA 2FZNA 1OVDA 1H6VA 1UJPA 4IP7A 4JFWA 2D0HA 2E09A 1PKLA 1W31A 1DE5A 5AVHA 5LNRA 5LXEA 1KNWA 5LGZA 2WVUA 2VD8A 1PHWA 5HUOA 4DAFA 3T07A 4ICNA 2XZ9A 3UF9A 4BF9A 1O1HA 3WN6A 3P80A 3BARA 1WDRA 2DFAA 1JZ6A 3A4AA 3THUA 2DEPA 5D2XA 2VM8A 4NG3A 4Z0JA 4DWDA 3R8RA 3WD4A 3N12A 3UR7A 2WANA 4P7NA 6REQB 1CB2A 1JCJA 1U5VA 4PFMA 1WBJA 2MUCA 4QISA 2XGZA 2WK2A 5AYBA 4WCJA 1XC6A 3BLEA 3SCOA 1SR9A 3JVAA 3WY1A 1BWLA 3KWXA 3JU2A 2PDMA 1JNDA 3PUOA 1EL3A 5I02A 4ZEPA 2OQYA 3QFEA 4R7JA 2A3BA 3TSBA 3P6LA 3Q45A 5FF4A 1JUEA 2BHUA 2X1IA 4QLLA 2R1PA 2IKIA 4QJ1A 2XTKA 3LX9A 3W25A 3W1NA 1VCVA 1VENA 3CUHA 3A3WA 2GGIA 4UCGA 2XFYA 2VWTA 3MY9A 5HNTA 4C6DA 2H8ZA 4DWSA 2REQA 1Z44A 3LG3A 1W9DM 2AQWA 4C5ZA 1FVPA 2NT0A 3CK5A 3V18A 3BG5A 4UTTC 5BW6A 4MLRA 1EGZA 3B4YA 4DJEC 4QCFA 1E6QM 1YDYA 3WK3A 1OBAA 4JIPA 1GQNA 2PURA 4GXMA 4AG0A 4I6KA 1DL3A 1LOQA 4GA8A 3GTIA 3NQAA 3CYVA 5LZLA 5GRTA 3AS1A 3PG8A 2OEMA 1C9DA 5L9FA 4F79A 1XH1A 3BURA 4JTQA 3MI2A 1V79A 1KXTA 4HHLA 1ONRA 3WLLA 3M64A 3NQGA 2G4FA 1RBAA 3LMYA 5C8BB 3GXDA 2QVHA 2XIJA 1R6WA 1TQJA 3WKZA 2VX5A 4QXIA 2ZKMX 1PZ2A 3UY8A 3ARYA 2D20A 3ABOA 4CCEA 3ZVHB 4US5D 4FDCB 1JYVA 1N61C 4B90A 4BI5A 4NYYA