1BKHA

Muconate lactonizing enzyme from pseudomonas putida
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
369
structure length
358
Chain Sequence
ALIERIDAIIVDLPTIQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Muconate cycloisomerase
molecule keywords MUCONATE LACTONIZING ENZYME
publication title Evolution of an enzyme active site: the structure of a new crystal form of muconate lactonizing enzyme compared with mandelate racemase and enolase.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 134
structure length 358
sequence length 369
chains with identical sequence B, C
ec nomenclature ec 5.5.1.1: Muconate cycloisomerase.
pdb deposition date 1998-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1bkhA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1bkhA01
3UJEA 1NU5A 4E8GA 3R11A 3EKGA 3RGTA 3ZVHA 3ENLA 3I4KA 3H8AA 3BOXA 2FYMA 3P93A 3R10A 4GFIA 4DXKA 1YEYA 3QTPA 2PS2A 2AL1A 1P43A 3OPSA 4ENLA 1XPYA 3FXGA 2PTWA 1EC8A 4ZA0A 2OQYA 2XH4A 3ES8A 2AKZA 4IP5A 2XH0A 4E4UA 4G8TA 3TTEA 2P8BA 3T6CA 1KKOA 2GSHA 3STPA 2XGZA 3QPEA 3NZGA 3CK5A 2OLAA 2HZGA 4Z17A 3DFYA 5J04A 1SJDA 2PSNA 2POZA 3MKCA 6ENLA 3ZVIA 3DERA 2OKTA 1W6TA 2DW6A 2CHRA 3JZUA 4JN8A 4ROPA 4HCLA 5FJTA 1BKHA 3DG6A 3S5SA 2QJNA 4GGBA 2OZTA 1OEPA 2PA6A 3H70A 2QJMA 2AKMA 7ENLA 3IK4A 3R0KA 3VDGA 3Q4DA 5FJPA 1JCTA 3RCYA 4KEMA 3UXKA 1KD0A 3OZMA 3NFUA 2GGGA 3MWCA 3VFCA 2XH2A 5FJUA 4KT2A 1WUEA 4JHMA 3THUA 1EBGA 3BSMA 3V4BA 1WUFA 4J3ZA 4GIRA 3ZVHB 3TJ4A 2PP3A 3TCSA 4E4FA 4GYPA 4Z1YA 3RO6A 3VC5A 3IJQA 2AL2A 4H19A 4KPLA 2GL5A 3JW7A 1FHUA 3BJSA 3FV9A 3KUMA 4DX3A 1DTNA 3N4EA 3S47A 3TW9A 3CT2A 3D47A 2P8CA 3FYYA 4YWSA 3OW1A 3R1ZA 1TKKA 3T9PA 4GGHA 4DYEA 2HXUA 2QDEA 3SN0A 3P0WA 2GGJA 4HNLA 3N6JA 2MUCA 3DGBA 2NQLA 2OQHA 1MUCA 3T4WA 3EEZA 1E9IA 1SJCA 4FP1A 1NELA 3ES7A 3I6TA 3MUCA 2QVHA 4EWJA 2FKPA 3T8QA 3I6EA 4IL2A 2PPGA 3FJ4A 2PCEA 2DW7A 3UJSA 4KWSA 1KCZA 3CAWA 3DIPA 4HNCA 3RITA 3GO2A 4DHGA 3B97A 3ZLHA 2ONEA 4A6GA 2MNRA 4F4RA 1EC9A 3PK7A 5ENLA 1BQGA 3UXLA 3CXOA 2QGYA 3DFHA 4A3RA 1F9CA 4HYRA 3GC2A 4MMWA 2PODA 2XSXA 3SBFA 3MY9A 3H7VA 2QJJA 3V3WA 3QN3A 3PWIA 1TE6A 4GISA 4MKSA 3VC6A 2XH7A 3UGVA 2AL2B 5BOFA 1MNSA 2OZ8A 4H83A 4HCDA 5FJRA 3VCNA 2GGEA 3CYJA 3ZLFA 1JPDX 4MGGA 4DN1A 4E5TA 2OFJA 1IYXA 1P48A 3SSZA 4K8GA 3N4FA 1PDZA 2I5QA 2RDXA 1R0MA 3U9IA 3OTRA 2QQ6A 3SJNA 3K1GA 2PU0A 3FCPA 2O56A 1EBHA 1ONEA 3UCCA 2GGIA 3UJRA 4K2SA 2PTZA 4DWDA 3OZYA 3VCCA 2PTXA 3NO1A 3R0UA 1XS2A 2HNEA 3SQSA 2P88A 4H2HA 4J1OA 3R25A 3ZLGA 2PGEA 2PP0A 4IZGA 3V5CA 4HPNA 4FI4A 3RR1A 5IDZA 2PP1A 3FVDA 2ZADA 4ZCWA 3TJIA 1JPMA 1ECQA 3DESA 3DEQA 1EC7A 4K1WA 1PDYA 2OO6A 3NXLA 4G7FA 5FJOA 3UCDA 1ELSA 3TWBA 3MZNA 4HCHA 3GY1A 2OG9A 3U4FA 1MDLA 2OVLA 3N6HA 4M0XA 3DDMA 2OZ3A 3JVAA 3RRAA 3IJIA 2PMQA 4IHCA 1JDFA 3UJFA 3P3BA 1MRAA 3QKEA 1L8PA 4X2PA 4E6MA 3DG3A 1SJAA 2PGWA 3Q45A 3V5FA 2P3ZA 3DG7A 1KKRA 2ZC8A 3OP2A 2OX4A 2HXTA 3QLDA 4GMEA 3GD6A 4JN7A 2QDDA 3HPFA 2PU1A 1R6WA 4IL0A 2GDQA 2OPJA 3TWAA 3VA8A 5EU9A 2P0IA 4GYPC 3SN1A 3H12A 3TQPA 1FHVA 4IT1A 3SN4A 3UJ2A 4HN8A 3TOYA 4A35A 4M6UA 2GGHA 4IP4A 3MSYA 3CB3A 5BOEA 3D46A 3PWGA 1RVKA 1MDRA 3MQTA 1TZZA 3IJLA 3PFRA 2PTYA 1SJBA 4H1ZA
chains in the Genus database with same CATH superfamily
1OVDA 3W25A 1J5SA 3SGGA 3A5VA 3RAOA 5BXTA 2G41A 4AAJA 5C2CA 1GVSA 1AL8A 3N2OA 1R3QA 3CB8A 1A0DA 2D2HA 1YE4A 4TXEA 1YRRA 4Y96A 1DXIA 1VYSX 4J3XA 3EMQA 1NVMA 1ZCOA 2ZX8A 1DJNA 1HKJA 1J8VA 1E6QM 2E1WA 2PI6A 2WVSA 1TJPA 2GVGA 4AF0B 1EJTC 3FGCA 3S2NA 4OT7A 2XVPA 4MJZA 3G1AA 1DJXA 3SW6A 3WMCA 1WNOA 1EXPA 3LHVA 1CGWA 1FOBA 2YB1A 3WLIA 3P62A 3FS2A 4PTXA 3TTSA 1EYEA 3N15A 2VHLA 3DERA 4D6HA 3NGFA 3EA2A 3W88A 4FR6A 2WP5A 1F3XA 2F61A 2CHRA 4Z1AA 4JN8A 4O8AA 1A5AA 2QKFA 1J12A 1FBAA 5DCEA 2BHUA 2AKMA 2CBUA 3KRUA 1DP0A 4DVOA 3GAYA 3HMJG 1W9UA 2BGNE 4JFTA 2CLHA 4U28A 3PP7A 3C0SA 4XTDA 2JK2A 4XIMA 2GGGA 4C7FA 3S3GA 4OGZA 4YCOA 3KE0A 4OBTA 1JGMA 2X30A 1GTEA 1KXHA 4LVAA 1DJQA 1UWTA 2PP3A 2BOEX 2BC0A 1XANA 4UTWC 1X8FA 2PC8A 5D32A 4XVEA 1YBQB 4DEFA 1I60A 3SSJA 1M7PA 2EPNA 1L6FA 2Y70A 3H53A 4JTGA 3WCZA 2QV4A 3INPA 1KM5A 2D20A 1R2RA 4NZ4A 1W5QA 3QV8A 3QZEA 2D3NA 2BY2A 3DFNA 4BI5A 2EEXA 1V0LA 5B80A 1V97A 1E72M 2V3EA 1FCQA 1TKKA 3MYPA 2VC9A 2JQXA 1UZDA 4N2YA 3T55A 4AB4A 2HVNA 2QDEA 3SN0A 1C29A 3U2CA 3ARWA 1E1CB 4LUJA 2CZFA 2OQHA 1G0CA 1B2YA 2G3IA 4GFSA 1XR2A 1VGAA 1W17A 3WK1A 3B9EA 2G3MA 3H2FA 1VPYA 1JPKA 4GE8A 3R89A 4CD6A 4DNAA 2YBUA 3A23A 3S1XA 4XX6A 4K39A 3W7NA 2DW7A 1XG3A 3U7BA 4QFUA 2BXYA 1XDMA 4ZEPA 4A3YA 1NM9A 3AM9A 4HNCA 3W70A 3KTSA 4CN1A 5LIYX 4EX4A 5D2XA 2MNRA 1X8CA 2W61A 2Y2WA 5HPCA 3WQPA 1V51A 5I03A 1WZLA 3VAVA 1JYNA 1XLGA 3HO8A 1WV2A 1CI1A 1Q85A 1DHPA 4RL3A 1F5ZA 4K8DA 1XW8A 1R87A 4LYPA 2I5GA 1S7MA 4ZE4A 5AVHA 3NSNA 4CU7A 3NNTA 1WAWA 3L21A 2OZ8A 4H83A 3VIJA 3VCNA 4AZCB 4D6EA 4U3CA 4F9JA 2VGBA 1T5AA 1N62C 4OTKA 2RDTA 1ICQA 3GFYA 3NTYA 3CIVA 4MB4A 4PMQA 2RFGA 4H9TA 3W1PA 5LIUX 4XAFA 3WJSA 4JNYA 5AHMA 1U1HA 2X8HA 2PDXA 2D69A 3UZJA 5D02A 1VPXA 4J27A 3MI6A 4ICNA 4IICA 1TPDA 2ALDA 1A5KC 1ESWA 2VEFA 3CXBA 4NVTA 1QBAA 3ABSA 3R12A 1WDPA 1UW9A 3IUIA 3MSDA 4WIWA 1TJ0A 1H1YA 3C2OA 5A2AA 1PKMA 4EOUA 1UIOA 3SGUA 4GNKB 2WOQA 4I9AA 1JULA 5JUVA 1G4TA 3PPCA 4FXSA 2WPCA 2AQWA 2E6YA 2OO6A 5D33A 3MC5A 5FEPA 2Z1KA 3TTQA 3D3AA 1SGJA 3TWBA 1WPCA 5AFDA 1OX5A 1OFRA 1D3HA 3U4FA 3F5JA 2HWGA 1I8JA 3TH6A 2J7CA 1IR2A 2VD9A 1BWKA 2GK1B 4AZIA 4C6DA 1K70A 5TD4A 2F7FA 3D5HA 3OC4A 3FA5A 1S2WA 3DC8A 3RYSA 1QNQA 1CGYA 2GOKA 4PUMA 4GZIA 2H6RA 4WOQA 3EANA 1CGUA 2HQAA 5CZSA 1R38A 4Q4KA 2ZKMX 3GDLA 3HQ1A 1LF1A 1M7OA 1V0NA 4KWVA 2PLCA 2J7GA 2CLFA 2YB4A 2CW6A 3H2AA 3CT7A 2QCEA 1P0EA 2BSLA 4A21A 3SECA 2WPEA 3H12A 4NXSA 1O1ZA 1BZLA 4M24A 4KCVA 3CGDA 1ZTVA 4H8HA 3GYCA 5BOEA 4CQ8A 4PCNA 1NPXA 2FVLA 4IQEA 5M17A 3W37A 1S3HA 3KL0A 3S9YA 4QCEA 3HURA 1TUFA 2X99A 2B7NA 3N25A 3AFBA 3LSCA 2UWFA 3GG8A 2J78A 4GX8A 3CMGA 1V6UA 4EQWA 3RGTA 2ZE0A 1X1ZA 5C71A 3O07A 1J0JA 3PZ9A 4HPXA 3MKVA 1PTDA 2QCDB 4KWOA 1EP2A 3WNMA 3THDA 2AL1A 1ICPA 2GLKA 1XPYA 1LPFA 1UWQA 2OQYA 5I7GA 1GK8A 1LQ0A 4Z08A 1P0KA 5AHIA 4O1DA 5AHNA 4D9PA 3QPYA 4W7UA 1QW7A 2FPVA 4O4VA 3GXFA 3WNLA 2DSVA 1M6JA 4ZTYA 1E4IA 3NAVA 3JR2A 1FCVA 4QE1A 1TO3A 4H6RA 5F4SA 3UWUA 4LWWA 2AOSA 4HZ7A 3NR0A 2PSNA 2C1GA 2POZA 2WB5A 2ZOXA 1HJQA 1S1RA 4S3FA 4KCUA 4CCEA 4UB9A 2DT3A 1EJWC 5AECA 3CQHA 4QE4A 5A6KA 3QPZA 1SUXA 4JIQA 4NP7A 2PLMA 1KNWA 2DIEA 1GEHA 5FI8A 1EJSC 3BMWA 3EX3A 3GDBA 3URHA 1FXQA 4ROPA 1FDJA 4O1FA 3UWZA 4MYAA 5DN1A 3HFYA 3B0XA 1XM3A 3WIJA 3N2TA 3RLUA 1O5RA 1EA0A 1SSGA 4UTTC 3H70A 4PMJA 2FB2A 1Q6QA 3KBMA 3OJGA 3PBYA 4S2BA 3I3DA 4J3TA 5KINA 1LLZA 3WL0A 3VCRA 5K9DA 1W0MA 3VTRA 4AWTA 5DO8A 1A5CA 4DXVA 3TSBA 2VRJA 3PBMA 4QJ4B 2X50A 1GPFA 2G50A 3I65A 2PWDA 2XH2A 3TW6A 3H2MA 1EBGA 4G7EA 3BSMA 3G0UA 3AMDA 1ZUAX 3ZFHA 1PYFA 1AODA 2WM0A 4E4FA 5BZAA 1E3XA 1PX3A 1DIEA 3IJQA 3UP8A 2PGFA 3PBGA 3S4TA 4NAEB 1E73M 1F2JA 1KGWA 3LB0A 4DLMA 5ABFB 2F5ZA 3EOOA 3KUMA 4DWSD 2WOVA 4NZCA 2QULA 4GG9A 4LYQA 3AXHA 7TAAA 4AEEA 3W2MA 4BZYA 2F6KA 2BB0A 3QXBA 5GRTA 1R2SA 1QOPA 3M4HA 4EM3A 3O05A 1W2PA 1EHAA 3WD4A 4JFVA 1Z44A 3DI1A 4XB3A 1TSIA 2YFOA 4Q8UA 1LOQA 1QI0A 3M1ZA 4I90A 3PTMA 1Q6OA 3OO2A 1P0BA 3M7SA 5IOBA 1V6YA 3R8RA 3VKKA 5FEZA 1CEOA 4NJHA 2YVFA 1XRSA 1RCQA 3WFLA 5LHEA 5JBDA 2BXZA 4J3WA 4PSRA 1HO4A 5AYYA 4S38A 4H6QA 4L64A 4ML4A 5CGMA 3TR9A 1PHWA 4O50A 4EE9A 2DIJA 1W54A 1MO9A 2FGZA 3L12A 1OYCA 3GR4A 2E77A 2EXOA 3CXOA 3BG5A 3QRHA 3U48A 1QNOA 1NJJA 2ZX7A 1F9CA 1VIZA 3URAA 4BQ4A 3W86A 1VCFA 3PANA 1JQXA 1RVGA 2HEJA 3CBWA 2PWGA 2C1IA 3BANA 4JEQA 1OADA 3PWIA 5CBBA 1F73A 3RX3A 3Q67A 3GKAA 4YVVA 4IMCA 3ZLFA 3MV01 1RK6A 1QHOA 4C60A 3URNA 5JH1A 1AK5A 2YLLA 4JTRA 1GYLA 5EBAA 4GUHA 2Z27A 1E6XM 2Y89A 3CHCA 2PF8A 3UZXA 4NEWA 4TMCA 5AOUA 8A3HA 1ZPTA 4D6DA 4DO4A 3G1FA 4YWOA 2VQTA 4XVDA 4HZMA 3ZSSA 2V3AA 3RM8A 2ZDSA 4O0QA 2WAGA 3NO1A 3HJZA 4WVXA 3ZR4A 1ZX9A 3VD9A 1K4HA 3CUHA 1E15A 3VIGA 1H1NA 3KHDA 1G5AA 1V0KA 2E1DA 2Q3OA 1Q4NX 2PDYA 1XIJA 3GXNA 3WDQA 4HT3A 1GOIA 5JIPA 2ZX9A 4EIVA 3BARA 1KA9F 5JCIA 4J40A 4IM4A 5B7YA 3PFMA 3HQNA 5A8GA 1TUXA 4M80A 4NAFA 4D1JA 3EDKA 2GDVA 3NXLA 3SZ8A 2ZUMA 3CWHA 3WFAA 1GZ1A 4JXCA 1TV4A 2PDKA 3HV9A 4PMZA 1FWNA 4UTMA 1B0IA 2E8YA 3VNMA 1PL9A 1Y7VA 3NL6A 5GNXA 3U2OA 3DOPA 1MQQA 4P7OA 4I6VA 1E0VA 4WKHA 2PMQA 1KM2A 3P3BA 3T0CA 3VGHA 1G4PA 4DJEC 3TYCA 5LYRA 4IISA 3GRSA 4GBUA 1K6AA 1JZ6A 4PUWA 2VEPA 5L9FA 4Y9AA 1NWSA 3DFOA 1O68A 4PB5A 1VLWA 4R3UA 3I7SA 3LA4A 4Q22A 3POHA 3HPFA 2E67A 3ICJA 3N9RA 1Z3NA 2NUWA 1FCUA 2CHNA 1A50A 4O4WA 1J6OA 3B8WA 3IAPA 2GJPA 4JFUA 5HINA 3CLWA 2V6AA 4LUIA 1JCNA 4B5NA 3BSGA 2CZVA 1LUCA 1NHSA 1XP3A 2HS8A 2VC7A 4H9YA 1KXQA 3TK7A 4HNNA 4QAIA 4FB7A 3UPMA 3OG2A 1F05A 4PBEA 1UZHA 3RUBL 3UFYA 1TZZA 4B3LA 3AYTA 1WYIA 3HQOA 1YDNA 5FA5A 2OSWA 3LERA 5G4EA 4PMOA 5E9AA 5D05A 3NVTA 4JTCA 2QGHA 3LPOA 2VWSA 1H62A 3ARRA 2X0YA 1XLIA 1CENA 4FHAA 1EQPA 3VZZA 2XIOA 1FHDA 3C5QA 3S2LA 5CBIA 3A3WA 4AX6A 3L4VA 1L6WA 4BI6A 2REQB 4KKXA 2WM1A 1WO2A 2FTYA 3UG3A 3RNDA 3PUEA 2BODX 1SVDA 3LCFA 5HQEA 3U6WA 3T07A 5A6AA 1HJWA 2WBKA 2YBTA 4PMUA 3AYSA 1YXDA 3FEMA 3H6OA 3W6MA 1UR1A 3AUOA 1JUEA 4CVWA 4DJFD 3UCQA 2WQPA 1BXBA 2HZGA 1S5MA 1IEXA 1YPIA 4A3QA 4MWAD 2V67A 2DIKA 4JIIX 1SJDA 2V3BA 1DWHM 4Y2WA 4XZWA 1R46A 1BG9A 1VCVA 5G2WA 5H2ZA 1W6TA 1XJBA 1EXBA 2Z6JA 4LEFA 4P7QA 1H2JA 3RMEA 3LYEA 3LPGA 3BLLA 3DKLA 3VUPA 2ABBA 2QJNA 4BA0A 2VT0A 5AHEA 5J5DA 2WSYA 3VFLA 5CQ1A 5A6TC 1LWHA 1ICSA 1EB3A 4CNTA 4DJEA 4XZBA 1I1WA 4HA3A 1O5QA 3PZOA 3EWUA 3TE9A 1UH3A 3QZAA 2J4GA 3EDJA 3VFCA 2QUTA 3CLMA 3C0LA 4Q8PA 5A2BA 5I3GA 4Q8WA 1OX4A 1KFEA 3WMBA 2Q6ZA 3ZT7A 1Q65A 3HQPA 4Q4SA 3QGKC 2EG8A 1T0OA 1U5JA 1HKMA 4MPKA 8CGTA 5JH2A 3P5ZA 1JQVA 4Z1YA 4GI4A 4ADWA 2CCRA 2O7SA 4QITA 1GQLA 3BTNA 2J3NA 4AYGA 1GOXA 3BJSA 1CLVA 3SJ3A 3IIXA 4LBUA 2BX7A 4I7WA 3TZFA 4P7RA 4DB7A 1BD0A 3WQWA 3ZT6A 1RUSA 1GJPA 3U3HA 3VGGA 2P8CA 3VIMA 1ZHAA 3T2QA 1BF2A 2YL9A 2V5JA 3KOFA 1JCLA 3NPVA 4UQDA 3URQA 3IARA 2V8ZA 3TUUA 1FFUC 1TCDA 4W88A 4ADSA 2NQLA 2V81A 4K7VA 3EAUA 4GQBA 5BCAA 5DMLA 3TVAA 2GDUA 1FFRA 3ECQA 5F4XA 5G1YA 4FP1A 5HJLA 2WPFA 3HFTA 4JTUA 4K38A 3WK0A 4CNSA 3TIMA 3UWYA 2CKRA 1JFXA 4LUSA 2PLKA 2C71A 4AEOA 3BLEA 1MQRA 3BOLA 3UQNA 2CLPA 2WZHA 2JE8A 2WHKA 4H9VA 2X1UA 4S3JA 3GO2A 4DHGA 2J13A 2V5LA 3B05A 3RLGA 4A6GA 4J28A 1XF0A 2NUYA 4O17A 1L6YA 2NZLA 5C2GA 2BGSA 2QV5A 4D1IA 3PTDA 2NX3A 4B5WA 3UETA 4N42A 2Q09A 4YTTA 3QVQA 3DH7A 1NFPA 1TPEA 2D22A 2NXGA 1TTPA 4UOZA 3G1SA 1PZ3A 3BAIA 3OVGA 3LCIA 3DU0A 3CASA 4MKSA 2A7NA 2NV9A 5GJNA 3VVGA 3R5EA 5HJYA 2VX7A 5FJRA 4JYEA 5JXQA 3W53A 2QJHA 3BLIA 2DSWA 2W0UA 4Q7IA 2X1TA 1IXNA 1WP6A 4PB3A 3VD4A 2GUUA 1BVZA 1KRBC 3VNYA 3CAQA 3GVQA 4Q8NA 2WMIA 1AJ2A 4P61A 3MDWA 3SJNA 1ZENA 3ABRA 4H4RA 1ZRQA 1TCMA 3QH2A 5FS6A 4AWSA 3UF9A 2PTXA 4D8AA 3EGJA 5EMJA 2H3DA 3A22A 1T40A 2FH6A 4J1OA 1VR6A 3I68A 3VNLA 1TYTA 1OBAA 4WY0A 4D71A 3C0QA 3OLEA 4YN5A 3WF1A 3R94A 2C19A 5DBUA 1GERA 4ZB5A 4LTSA 3QQ1A 5DQPA 4RLIA 1OGSA 4EXBA 3NL3A 5HR6A 2QDGA 4H7ZA 2OLHA 1LRQA 4D2JA 3H2OA 4CD5A 3KBWA 1VEOA 2YCLB 4J56A 1RALA 5I0DA 2GUYA 2V3GA 2QW5A 3NQ2A 4DO7A 4G7FA 3B9NA 1EDTA 1OM0A 1FWJC 4HA4A 3EXTA 2ZUNA 5A5WA 1FDYA 2BP1A 3ZMRA 3CGEA 1H5YA 4GYFA 4FSAA 1S3TC 1QI3A 3H26A 4J2MA 3QMTA 1XBZA 4C6NA 3WUFA 3QM3A 4MNLA 3OBAA 4GR1A 1E9LA 2X05A 1VPQA 2JBMA 3M0HA 1K8ZA 1Z41A 3BZGA 1FWIC 3WQGA 3RPDA 2X1SA 1TPWA 3EF6A 3G22A 4J3VA 1S5WA 4GMEA 1YTKA 1TR1A 1DWIM 1QPRA 3IIZA 2XIQA 3ARZA 4P7NA 3CPUA 4F40A 5AC6A 5D9MA 5C5YA 3SN4A 1H4PA 1XH0A 3TOYA 3RMJA 1Q6LA 3DI0A 1DE6A 4W86A 4NUWA 4BF5A 1J79A 2IPFA 1V93A 3W7LA 1I2RA 2GUBA 5CSRA 1UD8A 4GRSA 4MM1A 1QI2A 2Q8LA 1TMHA 2E5AA 1HL8A 3UG5A 1LLOA 3SUTA 2G5WA 4H1ZA 4GI6A 3H4XA 3B9OA 5FCZA 1KM6A 5EL1A 3ZR5A 1V03A 2JKPA 1E5NA 4DBDA 4IH3A 1ZBKA 2QXWA 4PMDA 4IPJA 1FH7A 1JUBA 1TWSA 4JIEA 2PS2A 3GSMA 1BYDA 1OYAA 4YNGA 3KRZA 4MTVA 2ADAA 1JDAA 3O7UA 2PTWA 4MFEA 1GTHA 4ZQPA 3HM7A 3V0SA 1AW2A 6PTDA 4E0CA 2QUNA 3IV8A 3W72A 2XIJA 4S23A 1NDWA 4XSMA 1UZ1A 2QVNA 4C6CA 2GSHA 3KL3A 4LC8A 2Y7GA 2R82A 4B3KA 3EDEA 4ZOBA 1PB0A 4OOZA 1DL3A 1SR0A 2BTMA 2C79A 1JL8A 4K7ZA 1TJ1A 2YBVA 3WDRA 3IV3A 1TPUA 2JIWA 3RO8A 6ENLA 2VDGA 4H50A 1NP0A 1R30A 2ATMA 4QNWA 4FXRA 3PS7A 5F2IA 2BVDA 3WK3A 1N8WA 4C6FA 1RLDA 1GRAA 1Q7ZA 2RAGA 3ARXA 2FZMA 2Z1VA 4TV5A 1ZKQA 4PCSA 3JU2A 1ODUA 5G1TA 4LF1A 3ITYA 3RCYA 1ZALA 4DBSA 1AQMA 2RUSA 2A7PA 1QT1A 2WQDA 3KVJA 4NJJA 4AU0A 1QCWA 5XINA 5E70A 2BY1A 1LG2A 1PWLA 5DMMA 1BWCA 4UR9A 3PPHA 2F9RA 2WC3A 4KRZA 3WLTA 3UZYA 2WLYA 1X38A 2FMNA 4I3GA 3A12A 1XH2A 4H9ZA 3RHGA 1VDVA 3UY8A 2V5CA 1QXLA 3C2YA 4KETA 3VX0A 1QI5A 1EJ7L 1LRNA 3DAQA 4HIBA 5DLCA 1TYPA 1G67A 5GVJA 4QG9A 4W4QA 2DVXA 3OOQA 3IIVA 1US3A 2W92A 5AYZA 5JCLA 3M5YA 3MJYA 3NQMA 1W1TA 5HWMA 4HPGA 1UQYA 3LNMA 2C1HA 4ACZA 4YIWA 5G4HC 3R1ZA 3FGCB 1EPVA 3N29A 5EPDA 3IACA 3KBSA 3NPUA 5DCDA 3Q94A 4NYUA 4IIGA 1EBDA 2NWSA 1TMLA 3NVZB 1LBFA 2NSXA 1GVQA 4JNZA 5HNRA 5FSDC 2SFPA 2BHYA 1KGUA 4IUOA 5EGRA 2IXVA 3AHZA 3VKCA 4AY1A 1A47A 3IJ8A 2Y8UA 1YTEA 4D6JA 3B3DA 3LK6A 1LP6A 2V0TA 3AJXA 4GUFA 5EMLA 3CAWA 4XZIA 3G1VA 4R53A 2W63A 2X16A 2DV0A 2Q8XA 2ONEA 3N2MA 1MI3A 3WQ4A 4IGHA 5LA0A 5KMYA 4O16A 3AISA 2J62A 4ICMA 2EPMX 4HHLA 2W66A 4UIOA 1TPH1 5CSUA 4MNJA 3WY1A 7A3HA 3ME3A 4UNKA 3E6EA 3F4WA 4JOMA 1O94A 4G6CA 3TDFA 2G95A 1W1VA 3BGJA 4AMCA 3REQA 1P4CA 2EKCA 3H2EA 1OGBA 3VC6A 1K9DA 3W6LA 5M5DA 4GACA 4QEEA 1UMYA 4HSOA 1KLYA 3AXKA 4D72A 8RUCA 3C2EA 3GDRA 2VURA 1SU5A 3T0AA 3FNDA 3POCA 4TV6A 4JIHA 2VFGA 4LFYA 1QHPA 2VCBA 1JF5A 4PUEA 1E0WA 1EIXA 5FF3A 3WYZA 3HTWA 3EZ4A 3K1GA 5FD0A 4F0MA 1HGWA 4I9JA 1ONEA 4OE7A 1Q6GA 3GZ3A 1UKQA 3CUJA 1H7OA 2PTZA 4M7SA 5TAOA 3C3NA 4O0KA 2INFA 3V1HA 4JTLA 4KF1A 1ITXA 4LAOA 4OUIA 1IXQA 4OV9A 2W27A 2ZWYA 2VRQA 1XYFA 1FWBC 2H9AA 5BXRA 4FI4A 1M41A 1JR1A 1ME9A 2YA0A 1ADOA 4W8LA 3KWSA 4NZFA 1UASA 4JY8A 3UXAA 4P8XA 3RIKA 1EC7A 4JNMA 4H4XA 1KFLA 1DWFM 4LV9A 2JALA 1VYPX 3P80A 4WR3A 2A6LA 4RDZA 1EJRC 1R9YA 3H21A 1N8FA 2KZHA 1S46A 2CKSA 4GH1A 4H41A 1F4HA 1NOUA 4J9JA 3CO4A 3N6HA 1Q1WA 5A6BA 4PCTA 1F6YA 2YX0A 4IHCA 3EWBX 2A3CA 3I3BA 1H61A 1AQ0A 2XGIA 2E5CA 3DG3A 4E6MA 3PZVA 3VIKA 4C6PA 2PGWA 4I9MA 2YCEA 2NX9A 2P3ZA 1RD6A 1VYRA 2Y6ZA 1P0DA 3WD2A 3C2FA 1RJRA 3LI1A 3P5YA 4ZGYA 1OGGA 3QLDA 3N6QA 2XFRA 1QK2A 4IL0A 2OPJA 1JOAA 2VGFA 5DELA 3OYZA 3UWVA 4XAGA 3PZUA 2NT1A 1J6PA 1BTMA 3M41A 3G77A 3GIPA 4KEZA 5A8NA 3UG4A 1OINA 2ZX5A 1OABA 4Q3MA 4M6UA 5F2MA 2VD8A 2HE5A 2WSPA 3FHQA 1X6LA 5CPMA 5F7UA 4J7RA 2G96A 4UTFA 1LM1A 2VEKA 1F74A 1VF8A 3NQEA 5KZMA 4UOQA 4XUGA 5FAGA 3TJXA 4TTGA 3TTYA 5BW6A 2X7VA 3NZPA 4G1NA 1DXLA 2DY3A 2WCAA 4GZ7A 3KRBA 3W75A 3R11A 5C9RA 3TFCA 1MOKA 1MFUA 3CEUA 2CEQA 3NVWB 3N2XA 5FJJA 1UG6A 4YVPA 3ENLA 4Z2GA 1N61C 4K8EA 2KX9A 3R10A 4GD0A 4RDYA 4HNOA 4H8VA 3L0KA 1HKIA 2BVTA 3M64A 4BHYA 1FH9A 1M03A 3MCNA 1RPXA 4IP5A 4C6KA 2ODOA 2V2CA 4I5UA 1EUNA 5LNVA 1I45A 4Q6JA 1DJGA 1XIMA 1Q45A 1ZP3A 4YL2A 1C7SA 2OR2A 3FYPA 2GVLA 1DJWA 1JZ3A 4OECA 5D09A 1DJZA 4CVUA 3GS6A 1T6MA 1W91A 3DFYA 2DUZA 4PFMA 3VILA 2ZVIA 3VKDA 4UTHA 1F6PA 2OKOA 5FF7A 3LBOA 2WJFA 4FLOA 1W3IA 1GKRA 4PBFA 3NPWA 1A49A 3SFKA 4RK8A 3LPFA 6TIMA 5U1OA 3APTA 3BQ5A 3GK0A 3ZT5A 2X40A 1DJIA 4B92A 2AQVA 1V7AA 3PJTA 4QR6A 4GO8A 1DBTA 5HUOA 5D2TA 1RHCA 2TPSA 1WQ5A 3BOFA 2FQIA 1SQ7A 3W38A 3O6CA 3GRIA 1KV8A 3OQ8A 4K6AA 4DBWA 3W7MA 1WB0A 3DGHA 1HP5A 5JCKA 4CNOA 3NFUA 3TU9A 2E28A 2F6UA 2H3BA 2VDIA 2QPXA 4EF9A 4F0SA 3UERA 3HJEA 3THUA 3KOXA 1RA5A 2PURA 4XZNX 3B0PA 1SW0A 4L6OA 4NU7A 3GC5A 4MUZA 4DZIA 4MLRA 1Q13A 3CHEA 5K9XA 2UBPC 1PIGA 3WQCA 3BAXA 3AS1A 4H19A 4G5DA 2VR5A 2NVAA 4HK5A 2P53A 1TZ7A 4Y9OA 2VOTA 4P5UA 1A5NC 1KFKA 3V5OA 1E0TA 3N4EA 1L6GA 2X0SA 1RD5A 4CD8A 4FZIA 3WNKA 3BCDA 1B3VA 4F0RA 1BYCA 3UZZA 3OGVA 5EBKA 5KVHA 1RK5A 3IVTA 2MUCA 3M5ZA 4A2SA 4JDBA 1JVNA 4XTIA 3EWCA 1R2TA 1XIDA 5EFFA 3LRLA 3WLJA 4YYFA 1W9PA 3MO4A 4X9YA 3WDIA 5F4WA 1EGVA 2BG5A 3S1VA 2DZBA 1W9VA 1GW1A 1X97A 2IS7A 3NZ1A 3FJ4A 1A3HA 3SCNA 1GUVA 2EBNA 3UU0A 5JCMA 3J7HA 1W1PA 3LM7A 1R9ZA 3ITXA 3SM0A 4GIEA 1S1PA 3ZLHA 1WKDA 1HT6A 1EC9A 3S1UA 1X7FA 1OIFA 5A8OA 4Z2IA 3DFHA 3KS5A 4NXKA 3H23A 5CAKA 4ZOEA 3S9ZA 4JD4A 1MRQA 4LEQA 1LL6A 1ZJAA 2VZUA 4EVZA 4WHBA 1FWWA 4RKAA 1YDOA 1G7UA 4G7EB 3W74A 4JEJA 1NARA 3OHIA 1N55A 4GVIA 4HU8A 3OB8A 3K2GA 3QHMA 1A4MA 4AC1X 5SWUA 3GD3A 3V35A 2PB1A 1V7YA 2YDQA 4RE2A 1PWMA 2B7OA 2VENA 4BQ3A 2HJPA 1E6PA 2XIIA 4B2DA 1UHVA 1TWZA 3OZPA 1C9DA 1Q6DA 4XZ9A 2JKEA 3ZJ7A 2VYOA 2HTMA 1AMYA 2OJPA 3P61A 2PU0A 1Z6KA 4I6KA 3MVIA 4GVFA 5I5RA 3W1AA 4Q8OA 4INFA 2P5NA 3CL8A 1Q1RA 1ZNNA 3VCCA 1U22A 1H1ZA 3TW7A 3R0UA 3M07A 3W4RA 3AAMA 2OEJA 3RRXA 3WBAA 3GFZA 1BFNA 4JTDA 3U8GA 4DJDA 4HPNA 2D1ZA 1QFEA 1EJUC 4FNSA 3NM3A 5LNWA 3AC0A 2I9EA 5H8UA 1FP9A 1N60C 4QG8A 3A7AA 2TAAA 1ZXIC 3E3HA 4LYKA 3NL2A 2FVKA 1Z7AA 5B7ZA 5GNZA 2ZADA 3P60A 3E5BA 4ZCWA 5JCNA 4LAMA 2ZX6A 4LUTA 2V68A 2BZNA 2QCHA 4AD5A 2HQMA 2EKGA 2WNWA 5TF0A 5IFPA 1V08A 3JS3A 1M1BA 1TA3A 2HVMA 3XISA 3HBLA 4Y8FA 4P8VA 1BAGA 2VFIA 3NWRA 5ER0A 1U30A 2YPIA 3KBJA 1FFVC 2C3ZA 4D6FA 1MDLA 1SMDA 4M0XA 4Q8MA 3NDOA 1DYSA 1I0DA 1QOXA 4PTDA 4W89A 4QAWA 4KCTA 1L8PA 4RDWA 4X2PA 1PZ2A 3Q65A 2XWEA 3VKBA 1AH4A 1C92A 3VDBA 2QUMA 2X0HA 1E56A 4Y7EA 2QNEA 1KFWA 3LDVA 3TMLA 4PMYA 1BPLB 4N4QA 5FL0A 3GXIA 2IUZA 2YQUA 2RJGA 4GYPC 1R3YA 3C61A 3TQPA 2XINA 3PNZA 2X1IA 1MSSA 3VKJA 4V2XA 3W23A 5HUPA 3TC7A 2GFTA 1FDZA 3JRKA 3TN5A 1D3GA 2NQJA 4JTEA 2BVYA 3U2ZA 1FWSA 1VZWA 4MB1A 3NVYB 3DX5A 3WJWA 4N6EA 2PAJA 3ATYA 5LXXA 4WGHA 4H4ZA 1G94A 4JQ4A 1W5OA 2FHFA 2ON3A 3FK4A 4POCA 2E9MA 2NW0A 2LLEA 1REQB 3ZVHA 3DC0A 3EWYA 1GEUA 3DBPA 3B8VA 5DRCA 1GQKA 1GEQA 8TIMA 3NIYA 4Y6GA 3I7RA 1P43A 1IEQA 3W7JA 3CHFA 4HNUA 4NAFB 3L8KA 2FDMA 2BWGA 4MF4A 4XZMX 2WC7A 4JHOA 4A8IA 1ISZA 5GPRA 1XGEA 4KQNA 3SRDA 5BOOA 3W7OA 2D0GA 1BQCA 1HVQA 3PZGA 2VC5A 1OB0A 3NZGA 3KVMA 2YXXA 1E1FA 2FFCA 5T9CE 2ZUVA 1WKYA 4I8YA 4HD5A 5A1AA 1XFCA 3T05A 4S39A 4EPBC 4DZHA 2O9PA 2OKTA 2TRSA 1SZGA 5K9CA 3PZIA 3PJWA 3W29A 1F8WA 5AYBA 4LNCA 2CHOA 1PTAA 2YZRA 2FJUB 1UR0A 4GH3A 3EYPA 2ZZ5A 1OC6A 2OZTA 1MEIA 1E1EA 1OEPA 1XIBA 2DUAA 3A5FA 4M52A 1VRXA 3DHUA 5PTDA 5I02A 4N02A 3GQYA 1LUCB 2OYMA 4Q32A 4LW7A 3WF4A 1EQCA 4JTAA 4FOKA 4UTUA 2VNCA 3FSTA 5EMMA 1ISXA 3CQ0A 2X09A 2BVWA 3PTQA 4O52A 3DXIA 3KWXA 2GR2A 2EQDA 4GWEA 2NVCA 3F1QA 2ACQA 3LU2A 2DH3A 4JQ1A 2ZCGA 4WX2A 3S6TA 3AZRA 3QMRA 1GVRA 4GQGA 4GIRA 2WCSA 2EQ9A 3N04A 4PEEA 4GYPA 1WCGA 4K8HA 3QGAC 4C65A 2WC4A 2Y8KA 1OK6A 1RBOB 1W5MA 3DUGA 1WKFA 3A3XA 2WNNA 3EWXA 4LS1A 4WK9A 3CM4A 4Q8VA 2VEIA 3A4AA 3G0SA 3DFQA 3S47A 4AVNA 2DZSA 1OFPA 5AB3A 4ACYA 5G2IA 4BCEA 2CLOA 1G9HA 4M8UA 3E2RA 2CPUA 3DHDA 2XN1A 3G3MA 4IWWA 3LZ5A 3QSTA 1AUSL 1GOMA 1I4NA 4H4PA 4M82A 3ZIZA 2CC0A 4WDWA 3VE7A 2V5KA 4B16A 3MP4A 3N3MA 4NYYA 1TV5A 4CQAA 1IXPA 3GNRA 3I6TA 1JZ4A 4OVXA 5JBFA 3BGAA 3DFPA 2GPTA 1QWKA 1OIMA 4UQ9A 3NM1A 3SIZA 5EMYA 4YTSA 1UQZA 4IXHA 4P8WA 2CXGA 1EWEA 4KWSA 2NV1A 2VI0A 3GVRA 3DIPA 1QDSA 3CQIA 3AMKA 3UD6A 1ZBVA 3BAWA 4MJMA 4MJ4A 2PDUA 1BQGA 1NY1A 3OU8A 1ZFJA 3N13A 3GDTA 4MMWA 1KCLA 3G3DA 2CERA 1OX4B 3LI0A 5L6UA 1CDGA 2NXHA 2W3RA 3MY9A 5G4WA 3UWWA 5CJMA 3WEZA 4BEUA 4AW7A 4QP0A 4MKNA 4H4IA 2CLKA 4GOAA 2A3EA 2WSKA 4F48A 2J66A 3M44A 3NQ7A 3G6MA 4OBRA 2R14A 4YTRA 1DWJM 5TNVA 3SSZA 4C6MA 1S5TA 2NQZA 3OA5A 1X6NA 2E9LA 4UFKA 3N4FA 1VP5A 4GNVA 1TV3A 2OU4A 3OTRA 4RDVA 3B9JB 2QQ6A 1O66A 3K8MA 3F7JA 3GHSA 1O12A 2WNQA 5HNUA 4LGXA 1X2GA 3GG1A 2NLIA 1V3IA 5CZKA 1NH6A 5I23A 3BMXA 4JN6A 1XS2A 4YTQA 3GU1A 4CD4A 3HV8A 4FOJA 1MMFA 2PGEA 4IZGA 3BCFA 2UY2A 2E4TA 3WH5A 4MAVA 3AUJA 3ITOA 2J7HA 2VXNA 1M68A 4HSNA 4V27A 4FIQA 2P0OA 2ZUTA 5C54A 1F3PA 5CPSA 4QM1A 3QMSA 3N14A 4GIAA 3CUIA 2J7DA 1S5VA 1K7EA 3ITTA 3BDKA 1ONFA 4HBKA 4DAIA 4BF7A 4ORIA 1FKXA 4JKLA 1HNYA 3UCDA 3C0JA 1HZYA 1ELSA 3HOJA 1ME8A 4KMQA 3KTCA 1M7XA 1ALDA 5H91A 4A8RA 3LMYA 6XIAA 4C1NA 1R86A 3RRAA 2BBFA 4D8ZA 4HPHA 1JDFA 4ZMGA 3KEHA 4R7OA 4TTUA 3CUZA 4XBKA 4J4KA 1CYGA 1CXLA 3UXIA 2ZC8A 2PDPA 2PDWA 4GJJA 3KTXA 3PHAA 3HU7A 3UR5A 3KM8A 1I2OA 3GD6A 3PUDA 2JK6A 2UY3A 9XIMA 1R6WA 4QHRA 2ZUUA 4IMDA 1JF6A 3T8LA 2GQ9A 1WBHA 1TREA 4J57A 4CNPA 3NS1B 2PC4A 2WMIB 3BV7A 3GW0A 1GOOA 4QJ3B 2ZRXA 4FNRA 3EX6A 1VH7A 5E5CA 4EQRA 4E4PA 1J01A 3Q58A 1EO5A 3K4DA 5FKYA 2FZNA 1A0EA 4HOWA 3TNBA 5MHBA 1MDRA 3SY1A 1KRAC 2WKLA 4GZJA 1ZP4A 1AW1A 1PKYA 4WY0B 2PTYA 1GVEA 2QCFA 5AHLA 1VFLA 2QCGA 3L66A 3VUSA 1BF6A 5DCBA 3WMSA 5DANA 2Z0IA 1XICA 3V0UA 5CEWA 5CC7A 5DF0A 2YVJA 3W01A 5AZ0A 3H8AA 5TR3A 3BOXA 2ZXAA 4MWAE 1TV7A 1VJZA 1E3ZA 2B4GA 4QJ1A 5ABGA 4YXGA 3KZSA 4LIIA 3BLFA 1EC8A 5BU9A 2RGLA 4H00A 3WD3A 2B7PA 2IPGA 2XN2A 2AMGA 1TTJA 4NSBA 2O92A 1QPOA 1KKOA 3GTNA 3GXDA 2WP6A 1EGZA 1M01A 1K77A 1XKJA 2O55A 2XGZA 3QPEA 3GH4A 2XWDA 1KWKA 3GYEA 3F2CA 3LTSA 1ONRA 3AIEA 1XSJA 2G3FA 2FZ8A 3P67A 4QDWA 4I5RA 3G5EA 4MY1A 4ZE5A 1XQKA 1RP8A 2QF8A 2C6QA 1VFHA 1KBLA 3HGJA 5M2FX 1H7XA 3DG6A 3CGCA 1E6RA 5IHRA 2HS6A 3GLCA 3NOYA 2PA6A 2R1LA 3W1RA 3O3RA 4HNTA 3FOKA 3PSVA 2WMJA 2ZTJA 1W2VA 2GRTA 2DQXA 1JROA 3Q2DA 3SB0A 1AVAA 2D2OA 3OBEA 1KC7A 1UIPA 1O4UA 4AXNA 3GU2A 3EOUA 1PJ9A 3GUGA 3BW3A 4WLCA 5FJUA 3W1TA 4W7WA 3AIWA 3L4TA 1AQFA 1B5TA 1YPXA 1BRLA 2XFFA 2WMHA 1EIBA 3BJFA 3WDPP 4QRNA 3TJ4A 1U5VA 1S2VA 1VBUA 5EFDA 5LHFA 1B1YA 1ENUA 2NXIA 5DX7A 3RILA 3QFAA 3VGEA 1UP2A 1JNDA 5K7JA 1XLCA 5J5RA 1XSIA 1XYMA 4C6JA 3P7YA 1GONA 4GQ0A 3S2CA 1O5KA 2Y24A 3A9IA 5KITA 4DXXA 5ECUA 4JL1A 2A85A 1A5BA 1UR3M 1RAKA 2VDHA 1US0A 1IF2A 3H4GA 4GI8A 2GGJA 3EX4A 2YA2A 3EA1A 1E0UA 1PIIA 3T4WA 1E6ZA 5T26A 4MAZA 4W7VA 1CLKA 4XISA 3CAKA 4EANA 5EKYA 4Z1BA 5I6SA 3DBNA 2C91A 4JQ3A 3WLNA 2GWGA 2PPGA 1YNQA 2ALRA 3AHTA 2PDGA 3NO3A 2WBAA 4H4UA 1KCZA 4GUJA 2OQLA 2QZRA 3STGA 2QS8A 5FJIA 1V6WA 2FGBA 3B97A 5C0QA 4KIEA 5C70A 2J8TA 4KFOA 1FTXA 1FX6A 1UKPA 4PFHA 3W24A 1R9XA 2QGYA 3S2MA 3DH9A 1U83A 1XLBA 1LYXA 3E5PA 5A3HA 3UVIA 2QR6A 3PBWA 3ABOA 3LRKA 1R47A 2J27A 3TQKA 4IQJA 4Q8QA 1RY0A 3EKLA 4V1YA 2XDFA 4GZEA 2D2GA 3FVMA 3LCLA 2YLAA 2WZTA 1M3UA 2C18A 3L2MA 2DDXA 5AY7A 4IPLA 5T8GA 4UNLA 3QHNA 1BSIA 1XINA 2ZZCA 1EJVC 3VMPA 2PZ0A 3AMZA 1SFTA 2BY3A 4F66A 3RJXA 1O1HA 5BMXA 4BQ5A 3ZSTA 1VENA 4XKMA 1FWCC 3SRHA 1MUMA 1OHLA 3W7HA 3EB3A 3P84A 4ACZB 3S46A 4M3PA 4HU3A 3GBEA 4HZ6A 2Z26A 1BG4A 1IIHA 3W7IA 4EXAA 2JGYA 1GYNA 2GJXA 4M6VA 4F2UA 5DMNA 4PH6A 2EAWA 4BJHA 3EWDA 3NXFA 3LV5A 1Q6RA 5F1VA 1EPXA 3UWEA 2P50A 3OGRA 3DK8A 2Y8VA 2DU2A 3V75A 2V2HA 1W56A 4RR4A 3PG8A 1MO0A 4GABA 4RXGA 4PTVA 3P8JA 4FS9A 4ZO6A 3LXDA 4DZ5A 1QPNA 1WDWA 4N9EA 3ZJKA 7XIMA 3HGSA 5FL1A 1E6NA 3DN5A 4FEZA 4O1AA 3IIOA 1T8QA 2OCZA 3SCTA 2PWFA 1W5PA 3XIMA 1QJWA 1KXVA 1Y0EA 1HP4A 2HE8A 2OZ3A 3WD1A 3H7UA 3IJIA 3O9NA 3REQB 2YZ5A 4UWMA 3KP1A 4DIAA 2ZDRA 1NTHA 2G4JA 2ZA1A 1UA7A 2GVEA 3EEGA 3GAKA 5I09A 3BH4A 3IIPA 2GR1A 1CGTA 2WVVA 2QHAA 4IX0A 2PWHA 3W1UA 3QFEA 5CG7A 4O28A 4HP5A 2G97A 2CBIA 1WDDA 3GTHA 3VKAA 1GPWA 1Q4WA 2P0IA 4GO9A 3SN1A 4DUXA 4PA8A 4KIRA 3CAVA 2DP3A 1M6IA 2GSEA 2ZTKA 3MSYA 1IXOA 3WQ6A 2HV5A 2WSQA 3BPWA 5BROA 2CDUA 4KH2A 2Y4SA 1CGVA 4ADUA 1CIUA 3CZKA 3PFRA 1MW3A 3B8SA 2D0FA 1OQFA 1W32A 1NU5A 2H9AB 3WDJA 1Y5WA 3MSGA 1E40A 4L1WA 2OSXA 3P93A 3H2CA 1YEYA 2FGLA 3SY8A 3AWNA 3R58A 3P82A 2FFIA 3M9YA 3FA3A 4QDPA 2YFNA 1NDVA 4O11A 4HK7A 1KW1A 3W7RA 2FIQA 2QCDA 3A21A 2PDLA 1JI1A 2XH0A 2Z1XA 2HNHA 3PC0A 2VWTA 1IWAA 3RX2A 4A05A 3E9AA 2FJKA 1ISVA 3M0ZA 3W85A 1LT7A 1DQXA 4WGXA 2C0AA 5HBFA 1W8GA 1DQUA 1IGSA 2RH9A 4WDUA 3WNOA 1SW3A 4JYFA 1J9YA 3FXYA 6CGTA 4PUKA 2DT1A 2DW6A 3UWQA 2HCVA 4K7YA 4K3ZA 5HANA 3PF3A 4W8BA 4MKVA 1PZ1A 1XCWA 1YXYA 3R8HA 4K68A 2DGAA 2D0HA 1KBIA 3AI0A 4N6FA 4LANA 5HJXA 2VOMA 1KQZA 2QAEA 3Q4DA 2QCLA 1LQ2A 1KTBA 5A6JA 4JS3A 4W87A 4PMRA 4O1EA 2X8CA 5DT7A 1AMKA 4QLJA 4Z42C 4ZQCA 4M7TA 4CCZA 4M5PA 4R88A 3ZWSA 3EPNA 3STEA 4ZVJA 3WLLA 2WVUA 4J3ZA 3VZYA 2A3HA 4E8CA 2WZEA 4U10A 3CPGA 1K03A 5FMHA 5C7HA 3RDKA 3THCA 1XPGA 1U1JA 3HPSA 1VCGA 5HPOA 1FHUA 5FEWA 2XFWA 2OOGA 4RPQA 3GU9A 3DJJA 4AY7A 2WPBA 1EH9A 1BWVA 4TO8A 4M1RA 1K9FA 3E0LA 3EOSA 4IFRA 3TW9A 1YDYA 1WXJA 3H22A 3NRZB 4NAEA 3G6LA 7ODCA 5D03A 4JQAA 4PCPA 4UR7A 1UKSA 4DWSC 1CLXA 1HUVA 4EQSA 2VP8A 5CSSA 4RXFA 4OJYA 3LCXA 3P0WA 3HRDC 1HKVA 3WQDA 3AU6A 4LAUA 4X61A 5JBEA 3HZ3A 3NZRA 3PBUA 1Z8AA 3SCQA 1MW1A 1BYBA 1SFLA 4JKMA 4L9YA 4Q4RA 3WBEA 1OK4A 3VD7A 5HOSA 1Z42A 1NELA 4O10A 4DUWA 4NRRA 1W1YA 4KGJA 4LS2A 1GWJA 3FW6A 3SRKA 4ERGA 4IL2A 2WBGA 5D2WA 1JRCA 1KRCC 3R13A 4W5UA 4QX4A 3DGZA 3LXBA 5DMYA 3RITA 4H4TA 3RNMA 5JQ9A 3MHUA 4H7CA 1R7AA 2H90A 2WOWA 1TTQA 1EX5A 1J0HA 1VIWA 3XINA 1ISYA 1GETA 1HF6A 1MYRA 4DZAA 3RU6A 3S1GA 4ZOAA 3SR6B 3E0FA 3VABA 4AZGA 4WCJA 3TYEA 3DYMA 3DJGX 4BQ2A 2CETA 3N2CA 3PSWA 3SCSA 3SGZA 1RBAA 2A1YA 5F2LA 3V3WA 4K36A 4ZXOA 1A5LC 3OEXA 2JF6A 4QE5A 4C6LA 1HXJA 3E0IA 4JICA 4RZ4A 1MFVA 3UVAA 5D30A 3CYJA 5LIXX 3IC9A 3VPLA 4A22A 1E51A 2Q8ZA 1XLJA 1NIUA 1P48A 3VD3A 3PG6A 1TIWA 2V2DA 5GJPA 4UFIA 1E4LA 4UTJA 2RDXA 3U9IA 3D0CA 3LXCA 4AH7A 3AYRA 3PTKA 3I6RA 1EBHA 4GJIA 3IJ9A 4Z2HA 1VFTA 2PZNA 4IIDA 4CD7A 2GGIA 2WJEA 5BRBA 4DWDA 3SEPA 1FQ0A 1FP8A 1WDRA 3NQ8A 2WCGA 4RNJA 1KN0A 4B4HA 2GQ3A 5CH9A 3M0XA 3NQBA 2D2JA 3R25A 3BL3A 1XDJA 4HHMA 3QR3A 3C2VA 4LY8A 2BOFX 1RXOB 3B4UA 4YWIA 3FY1A 1JXKA 1P5BA 4IF2A 3RF9A 1K3UA 4C7GA 2DZPA 1DIKA 1ZJBA 2WMGA 1NDAA 3CZLA 1VBRA 4DWSA 1H7RA 4QLLA 4QCFA 1LBLA 5FF2A 3W02A 4CNUA 1Q2RA 3L4WA 2PDQA 3KAOA 1N5XA 4RUBA 3ERPA 4IMGA 3AWOA 3VNJA 3NQDA 4CQCA 1FWFC 1WZAA 2OB3A 2OVLA 2OXNA 3PPFA 4RE3A 2QT3A 1TVNA 2PDBA 5CPQA 4C91A 1HL2A 1GV4A 1NP2A 1YADA 3W2LA 4MOZA 4NL1A 2Y85A 3Q45A 4IQLA 3V5FA 1XLFA 1KKRA 1A5UA 1IEWA 3OP2A 1OCJA 2HXTA 3F4VA 1LG1A 3V36A 3OG3A 3TCEA 4GKTA 2GDQA 4AUBA 3CZGA 1ZB5A 4ECLA 1J18A 3L0NA 4QSFA 3NPXA 3KOWA 3LQLA 3GC4A 1X7IA 3O0KA 1QVBA 1U33A 3N11A 4BF9A 3L5OA 2XFYA 1S2UA 1W1B1 2W55A 3VGFA 1UD6A 1P7TA 3EKZA 3VOGA 4MPQA 1H7WA 3MANA 4XV0A 1EFZA 2Y63A 7REQA 1VLIA 3WQVA 2YSWA 4XQ6A 2Q01A 5AZ1A 4PEKA 2V30A 3CV2A 1E9ZB 1JDCA 4OQVA 4C7DA 4DXKA 4V28A 4LQ1A 2QAFA 1J0KA 1ZLPA 4R34A 3FX4A 4LUTB 1NF7A 2E9BA 1UWUA 3A7RA 4UCFA 4IG2A 4EWND 1W5NA 1GT8A 2Z28A 1TA3B 2QIWA 1IHIA 1A5MC 1WOAA 4E38A 4PB4A 3WELA 2AKZA 4NQ1A 4UQAA 2FZDA 2P8BA 3D6NA 3NQCA 3WUBA 4UOJA 1BVNP 4U31A 1F76A 3STPA 3QKZA 4FX7A 3FKKA 4ZFMA 4H4QA 1DHKA 3KVKA 1LTDA 4ZQMA 3EUB3 1W31A 1J0YA 4OWGA 3KOZA 4YLWA 3IS4A 3L68A 4DBEA 4S3DA 1YYAA 3AIUA 1H50A 1PE1A 4EP8C 4YCPA 4MWAC 4B5UA 3B8TA 1CCWB 1VEPA 3NYZA 4XIAA 4TVYA 1D8CA 2ICSA 3HMCA 4EMJA 4RW5A 1IIGA 1BLIA 3A7UA 2Q02A 3V18A 3AXXA 4MJ2A 5C6MA 3MP3A 4UR8A 1GG0A 4JTQA 4AFYA 3OLIA 5E09A 4YMZA 5ABTA 3FFSA 4ALDA 2CNCA 1F8MA 4C1LA 2IKHA 2W3SA 4AIEA 3H4KA 1JEZA 1GOQA 1KR1A 4HA0A 1IEIA 2P1FA 4NI8A 2DZTA 1W9DM 4EK7A 3ZVHB 3NO5A 1OD8A 3GH5A 4FNPA 3QYSA 3W22A 4ZZ9A 2ZRUA 4TVCA 3II4A 4EPKA 4L61A 4NNAA 4D8LA 3FAXA 5IDIA 3ANYA 4NZJA 3MKKA 3LY0A 3FYYA 4LB3A 3LHTA 2DSUA 4WY0F 4EKJA 2DPEA 3ITGA 1EUAA 3WLOA 3PULA 2VFHA 4PUDA 4AD0A 4HNLA 4MSSA 1DV7A 2XYLA 1GGOA 1C7TA 1MXSA 1XUUA 3DGBA 1IT0A 2DFAA 4FNQA 2E5BA 3TMQA 3DENA 3GTIA 4AWUA 3EEZA 3GDKA 4H6KA 4KESA 1SJCA 1J2WA 3TEVA 1VBJA 3MUCA 1TZ9A 2ISFA 2O0TA 3CNYA 2BY0A 1LVLA 4YS1A 2FKPA 3T8QA 1K9TA 3ZJ6A 1QAPA 5AYIA 1EJXC 1W9BM 4HMEA 3RPMA 4E3TA 4MVAA 3JUGA 3S8HA 4BURA 3GVVA 4A3RA 4DJFA 3GC2A 2MANA 4NZ3A 4MWAA 2E5DA 2V82A 3UNTA 1A3XA 4L4PA 4Y9MA 2QJJA 6ALDA 3SO7A 4GISA 3L65A 2WOIA 4HKPA 1IZCA 1JPDX 2I5IA 1AOGA 3BC9A 1X2HA 3RJYA 1ZGDA 1XRVA 4XKYA 3PBVA 4REQA 1SO3A 1XX1A 3R6IA 4FLSA 1B3YA 3W07A 2F8QA 2NSOA 1YLVA 1V3KA 2ZRZA 2BGQA 1GJUA 2AAMA 4GXWA 3HIJA 4H9MA 1P0NA 1UOKA 4PTMA 1SO6A 7TIMA 1G4SA 5BXSA 2J7FA 1N8IA 2ZQ0A 4H4WA 4IGMA 3LHYA 1GJWA 4MNMA 2WKJA 4U2ZA 3PM6A 4Y90A 3KVLA 2OX1A 5CZ0A 5HWJA 1GRFA 2PP0A 4US5D 3OVRA 4W85A 1W1A1 2Z6IA 1UC4A 3IJDA 1F7BA 4Q7BA 1VFFA 2PDFA 5REQA 4CEUC 1IT7A 1F3EA 4V33A 4UFHA 2NPXA 5TQLA 3DEQA 4CGTA 4IPIA 3T7VA 4OIFA 1OFBA 2G8ZA 4KBXA 1UWIA 3E74A 5F1UA 3GRTA 1KFBA 3S5OA 3OIHA 1V59A 1WBJA 4KCWA 5G5HB 4F0LA 1X98A 3MZNA 4GVHA 2YVGA 5AHFA 2DZXA 1SZFA 3L4UA 1Q6CA 1XYBA 1PPIA 2EPKX 5AC4A 4HPJA 4RPPA 4AHPA 1MRAA 3ID7A 4DPPA 4IJBA 3GR7A 1AH0A 1DXEA 1SJAA 2BS9A 3E49A 3AALA 2CBVA 4IMEA 3EMCA 4RV8A 1YKWA 5CG0A 1WYGA 3USBA 4ZR8A 2A0NA 3WLPA 1RPKA 2OX4A 3ALGA 1V5XA 4OU1A 3IRSA 4AXKA 4GLEA 5E0FA 3IK2A 1EOMA 3NOEA 1V02A 3ZYZA 4EAYA 2PDCA 3DCPA 1W3TA 4S3KA 1J11A 1VRDA 3DZ1A 2Z1SA 4JDYA 1QU4A 3QSRA 4HMCA 3W7KA 4KRUA 5H1WA 2G3JA 3AXIA 4NJGA 3PWGA 4E8DA 1FY6A 3BCJA 4TU1A 1UROA 5A8QA 1X1OA 1B3XA 1SJBA 4DI9A 1LL4A 2EF9A 3UJEA 3O6DA 1JPIA 1UB3A 4DI8A 3VMOA 1E9YB 4G1KA 1ZAIA 3NCOA 4LU0A 3HB9A 4GFIA 2P76A 3QTPA 3B0VC 2Z1WA 2VGGA 1JZ2A 3MWAA 1VAHA 2R91A 3OPSA 3VIFA 1KTNA 1P6BA 2WKGA 3IRDA 4AYSA 2Y1HA 5A6SA 1QRQA 2DZUA 5CPOA 1JRBA 3ARYA 4O13A 1DJHA 4UTKA 2VCCA 2HPMA 1WXZA 4IJRA 3SI9A 4EACA 3KX6A 1VFSA 4M56A 3LADA 4C1NB 3U5UA 1B3ZA 2V9DA 3CK5A 4WSHA 2HROA 4IPNB 1ECEA 3PZNA 3T2PA 3CGTA 1W37A 5BMWA 3DGRA 3MKCA 5DT5A 5GJMA 1M04A 3RX4A 1KWGA 4PRTA 4LCSA 2QCNA 1QO2A 3LS9A 1NWTA 1D2KA 1KO0A 1JZ7A 4IMAA 4HCLA 4CN4A 5HMFA 4UBPC 2W79A 3QY6A 3VMNA 4I7UA 4H2CA 4L7ZA 4ZB0A 2GQ8A 2ZZ3A 1XDLA 2J75A 4LCRA 4O12A 5EMKA 7ENLA 3VDGA 4DAFA 2Y61A 2INEA 4BS0A 5LIWX 3RLHA 3C6CA 3MI2A 4JTFA 2BFGA 1NQ6A 4Q33A 3WNNA 3TYDA 3TC3A 5IM51 2RDWA 4PRRA 3S9IA 1WUFA 2E6FA 4AHQA 2VO5A 3F4NA 1A3WA 1KXTA 4DBUA 1FXPA 1PUDA 4N7QA 3NA8A 3E2QA 3KOYA 2XTKA 3GX9A 2GL5A 2WZMA 4ZODA 4X2RA 1VEMA 2FPTA 4XSLA 3U4AA 3BMVA 4FK9A 2Y5SA 2PEVA 4JPGA 2F6XA 4DX3A 4B5XA 7CGTA 2FVMA 5TBOA 1AW5A 3C8FA 3IANA 3CS2A 3GW3A 3TTOA 4B9ZA 4A8LA 5KTLA 2R24A 5E0CA 2X7WA 2UV8G 2GWNA 5H8PA 1YNYA 4EXQA 3PWAA 4QQ3A 3W2NA 5HWNA 1I0BA 3S6DA 3BZJA 4HJWA 4UUIA 3W7EA 1GQIA 1MUCA 4BWLC 1XIGA 4ML9A 5FACA 4YTUA 1OX6A 1DWAM 1BTCA 2O9TA 4ATLA 2A3LA 1XCFA 2WHLA 3WNPA 4IX2A 4IIEA 1XGDA 4H9XA 5FIPA 3BO9A 4A4AA 5GNYA 3E1F1 4FLQA 3LENA 1XIIA 4HSHA 4Q4OA 1IGWA 1JRPA 4HN4A 7PTDA 3UR8A 1ISWA 2VX6A 1MEHA 1A5SA 3VO0A 2ZWZA 1I2QA 3KLJA 4NI3A 4WDTA 3NSMA 3T09A 4FF5A 5A6LA 1UUOA 3PY2A 3AXMA 4LUYA 1A80A 2VJXA 4KERA 5KVIA 1AJZA 3EB4A 4MHBA 2C7FA 1BRLB 4TX6A 3H7VA 3CL7A 2W54A 1EKOA 3EPMA 1LWIA 3C52A 3P2VA 1YDVA 2A7RA 1NHPA 1JEHA 2I14A 5LZLA 4HCDA 1FO4A 4PYSA 1QW8A 3ARPA 1X39A 4PUUA 4GCXA 4HYWA 4C5YA 1SSDA 1OC5A 3B8IA 3H7RA 4FA3A 1H51A 1XLHA 1KTCA 5KEZA 4K8GA 1C8YA 2DSKA 3LNPA 3SCRA 3V0TA 1UPPA 1JNEA 1XLEA 3ISIX 3WDHA 3B03A 1CECA 3A4XA 1ZDLA 1VKFA 3FCPA 2OYKA 2I16A 3QY7A 3A47A 1YX1A 3IVUA 4K2SA 4QQUA 3W2KA 4KEUA 2V3FA 5I3HA 1DTUA 1DOSA 2Z00A 4H6EA 2C3CA 3TROA 3MHGA 1KB3A 2QPUA 3UR7A 2WNZA 3BAKA 3VDAA 1QASA 4K1GA 4RX0A 2VZTA 2CLEA 3VIIA 2NQ5A 4AWEA 1K7FA 2NVKX 2O9RA 1WXYA 4AMAA 1C8QA 1JPMA 1XISA 1JYXA 3TNOA 5CSYA 2WYSA 4Y9NA 1GQNA 3BURA 3RPTA 2NX1A 1Q6EA 4BWLA 4GHRA 3QHOA 4YYCA 1PDYA 5C9WA 5FJOA 1V6VA 1B3OA 3NSXA 1TWWA 3MUZ1 4GI9A 4HCHA 3E38A 3UZWA 2GR3A 4GNJA 2X8GA 4IIFA 2PRLA 3FSUA 4ORMA 2AQOA 3GG7A 1NOWA 2CLLA 1QO5A 4XD5A 2DSZA 3OZOA 4ICCX 4L1XA 2O9OA 1W1IE 3L2LA 4MG4A 1V3MA 1EX1A 3NQAA 1P6CA 3M0IA 4NIRA 5HULA 1ZAJA 1GOWA 4NX0A 1DIOA 2A3AA 4HYVA 2OGJA 3OVQA 1PV8A 2OEKA 4H01A 2C13A 4RJEA 3R79A 3BWWA 2CFFA 4A35A 3IUDA 4X3ZA 2WXDM 4JX6A 2GJXB 2Y5JA 3MQTA 4LH8A 3WLMA 3EDFA 1Q7QA 4KRTA 3PAJA 4NNBA 4UTWA 1WX0A 2R6OA 4K37A 4U3AA 1KM0A 2XIMA 5FESA 4Q4PA 3EKGA 3HG3A 3K8KA 4JTSA 3I4KA 1FWAC 1MUWA 3EB2A 4AG0A 5TIMA 1ITQA 3QEZA 2UY4A 1OYBA 4LVBA 1TPB1 3HF3A 3OQEA 4ENLA 4MZ8A 2YOCA 3M6DA 1IT8A 3K4AA 3O6AA 3G2GA 4N4PA 4ILSA 4S1FA 3NDZA 4L56A 3ZOAA 4NY2A 3ARTA 2UY5A 3TTEA 4AVOA 1BVWA 4OOUA 5AC8A 1ONXA 4PN2A 1Q8JA 4CCDA 3P8IA 1KCXA 4GX9A 5M1TA 4RNFA 2BHZA 4JX5A 3PZMA 4MADA 2CZ5A 3MZ2A 4OZOA 3A4JA 4LALA 4UTIA 3ZR6A 4MIMA 4UQCA 1VHCA 4H04A 5HK4A 3SUSA 3KHJA 2WVVB 3IAQA 3UYIA 1CXIA 4KS0A 6A3HA 4FIRA 4QXIA 5FJTA 2YR1A 2CXEA 3B4YA 3S5SA 3WENA 4PC8A 1F8IA 3N17A 4MDOA 1IWBA 1XYLA 2QJMA 4X0VA 1JG9A 3VDHA 1QPQA 3WBYA 4AD2A 1P6WA 2PDMA 3VOIA 3FA4A 1V6XA 4ZO9A 1VQTA 4EF8A 5D38A 1U5HA 5G5GB 3AIVA 3SY5A 2CIPA 4G9PA 1ADSA 2IKJA 3TSMA 2P3EA 2QMKA 2FH8A 1RLCL 2R1KA 3OODA 2BXVA 2OOFA 4EPDC 3CU2A 3W84A 3VI2A 1HG3A 2YDRA 2Y5EA 4AEFA 3IWPA 2E25A 3E2VA 3QC3A 3LTYA 2DZAA 4US6A 4RCXA 1N82A 3W73A 3ONCA 1I2NA 2W6RA 3E0WA 2PWUA 4QGCA 4UC5A 2ZRWA 3ZM8A 1Y5VA 4CN6A 1EL3A 4UTLA 1UPMB 3ARVA 3GHRA 4B4FA 4DYEA 2HXUA 3IGHX 3KDOA 3N6JA 2VR4A 1E6SM 1PCWA 1E71M 1UKOA 1GSNA 4OKDA 3THQA 2HBXA 5LGXA 1ZBWA 4MB5A 4F2TA 3T42A 2WO5A 4QS5A 2YJQA 4PTWA 4GY1A 1SFJA 1UR8A 2E68A 3VNKA 3TQVA 1M9HA 2Z29A 1HN1A 4B3ZA 3ARQA 1G6CA 4R5EA 4ROQA 2FLIA 2J25A 4EMIA 4W8AA 3WLHA 2FDSA 4WD0A 1UR9A 3UZ5A 4HU4A 3WX7A 3F2BA 4TVWA 2Z2AA 4ZO8A 2D3LA 5HXMA 1T8XA 1FCBA 2QEZA 2V5BA 1TRDA 4F4RA 3U5YA 3T44A 1XLDA 4O15A 1MZHA 3ORWA 3TA9A 1Q2SA 1K8XA 1XYCA 4PL2A 3AS0A 3MO7A 2VZSA 1M5WA 3TA6A 2CITA 1XIHA 3GNXA 4H4YA 4H4SA 1O60A 4L6DA 3ABZA 3LUTA 4B5VA 4F8XA 4GC4A 4M19A 1TE6A 3UY7A 3VXGA 4BR1A 1H7NA 1MNSA 2X2YA 5I2UA 3HA1A 4X0NA 3AYVA 5JVLA 2OFJA 2CZEA 2PDNA 3T78A 3O63A 2XN0A 1V3JA 1QNPA 2VGIA 1MXDA 4ZTXA 4H8UA 3BW2A 1ZU8A 5BWAA 3DYOA 4JTHA 1K1DA 1LRTA 1TB3A 2XG9A 4TR9A 4GY0A 2GVYA 5CZTA 2QYGA 1N63C 1OG6A 3KZPA 1X1NA 3TYAA 4HZ8A 3T0DA 4EAMA 3SRFA 4GC3A 1M7JA 3NQVA 1MNZA 4GA8A 3K46A 4QNEA 3E0VA 5LNUA 5RUBA 1R3VA 4HJFA 1F3WA 5IDZA 5IXEA 4O57A 2CFYA 1S38A 4GCAA 2EPLX 4JDRA 4HTBA 4E2OA 1ECQA 3AZTA 1NEYA 1OJXA 5LNSA 3S1WA 2BLEA 2RKXA 4I5XA 3SQLA 3B40A 2F2KA 5FS9A 1RQBA 3STCA 4FNUA 1H49A 3GNDA 4E2BA 3K4WA 5I3IA 1PX4A 5AKQA 3NEVA 1R3WA 1BKSA 3H54A 3GY1A 2VVNA 1U2YA 3ELFA 3ZQ9A 3QFBA 1CXKA 2AMXA 4DYJA 2G0WA 5FS8A 4U5IA 1GKPA 3GKFA 2CZDA 3K13A 3QKEA 2J9ZA 5D8ZA 3GVGA 2VCAA 1HJSA 1OF8A 6XIMA 5HNTA 1BYAA 5LKYA 1GKQA 2GYIA 1QPKA 5I06A 4UTTA 2XM2A 1J10A 3P81A 4LYRA 2WV8A 1F6KA 4JN7A 2QDDA 3PNUA 1B3WA 4FAMA 1HW6A 4YHEA 1FEBA 3BV4A 4NX5A 1XCXA 2IQTA 3GD4A 1TVLA 3N9KA 2W3ZA 3LM3A 4WKAA 4WJXA 1WDQA 1WA3A 3VU2A 3NDYA 1G1YA 1KRMA 4E2VA 3LCGA 3JZEA 2QLYA 1GZJA 3QTGA 1MQPA 1RVKA 4LVFA 5I77A 2CWNA 1CB7B 4JTTA 2VTFA 3CL6A 4H4VA 3A6OA 5XIAA 3ZJ8A 2V6OA 3HPXA 3E2SA 1D7YA 1CBGA 2X8RA 1UA3A 1B4EA 1SZEA 4DJDC 4DWSB 5DXYA 3ABQA 4NNCA 3MU7A 1KFCA 4IXXA 4LS0A 4NKCA 1REQA 2CU0A 4KW2A 4AHOA 1KM1A 5I24A 2XH4A 3RM9A 2OZ0A 1H3GA 4GUGA 1NSJA 1K7XA 2EHHA 1C8XA 3DFTA 3PUOA 2QJIA 2IXUA 5A69A 4XWUA 1PZ0A 3DHFA 1VS1A 3B9AA 1GESA 3HPAA 2WVTA 1XUZA 2E40A 3AICA 4JGDA 3PJXA 3F03K 3PB2A 1XBYA 4GJ1A 1TJRA 3O06A 3GBDA 5I00A 3UEQA 4LV4A 3ZVIA 2Q3RA 3SCPA 1S39A 3W3OA 4M81A 3GXMA 2B81A 2A8XA 1GZGA 4URIA 4LA1A 4AIOA 5BNKA 5H6HA 4JQ2A 2IKGA 1D9EA 1G69A 1XRFA 1QNVA 1BKHA 3CTLA 2A2IA 3OIXA 2JKAA 1Q5MA 1C3FA 4FX8A 5JIWA 1EF2A 3SCVA 2E6AA 4PODA 2FZ9A 4UFMA 1OY0A 3S6OA 2W5FA 1XIFA 1X6UA 4FPSA 5LXEA 1UWRA 1QR7A 5DEZA 1P7TB 1OD0A 1KD0A 1KBBA 1W9XA 4FXFA 3MDUA 3TSDA 2PWVA 2FTWA 1XKYA 4UQBA 3GXTA 1PYMA 7REQB 1KBJA 3CJPA 1IEVA 3QQ0A 1DORA 5ABHA 2TPRA 3H4WA 4LAZA 3HGOA 3CZEA 2NV2A 3VOHA 3WQ8A 2ZXQA 4LT9A 2W67A 3WH6A 3M0VA 1SO4A 2AL2A 5C9XA 4KPLA 1YQZA 3SIMA 4IG2B 2PE4A 1JIBA 1HJVA 1O5XA 3P74A 2XSBA 3TLLA 3GTFA 3CT2A 3IGXA 3I7QA 1QTWA 2QAPA 3GHTA 1CNVA 3F5KA 3QV6A 3CZJA 5EYWA 3UT0A 1RH9A 2XISA 3I3EA 4QSHA 2ISSA 1XLKA 3Q6JA 2IPWA 2R94A 3QOKA 3WQEA 4JCMA 2BC1A 2I17A 3G1RA 2AGTA 1CXFA 1V77A 1WAUA 4JKKA 5CC6A 3T81A 2OWCA 1XLLA 4L9ZA 3MYOA 3CH0A 3G8RA 1BGAA 2YA1A 4LPCA 4IFOA 3GVWA 1D8WA 3DECA 3I6EA 5DBTA 3L9CA 2YDSA 5LSMA 3WMLA 3UJSA 3GWQA 4UMAA 4ATWA 3THAA 3K5XA 1N7KA 1AG1O 3FEQA 4WJ8A 3MUY1 2XHYA 2HPIA 3PR2A 3APGA 3WLSA 4A3UA 2RGMA 2QPSA 1PIFA 3AO0A 3OYXA 2ZZBA 4LY4A 5F2GA 1TG7A 2IKIA 1XHCA 2OYLA 4BI7A 2PODA 1O7AA 2XSXA 3BG9A 3SBFA 3WBWA 2IQDA 1ZSXA 3BVJA 4I8DA 2ZICA 3IVSA 4CU8A 4ERAA 3ALFA 4U2YA 4ZFCA 3KDNA 1NFBA 4CCCA 5I3FA 3A64A 4JHZA 4Y8EA 1H0IA 1XC6A 3TYBA 3CGBA 3PG9A 2E3TA 1CTNA 1P1XA 4HMDA 2NQHA 3T08A 2ZZ2A 3DFSA 1AL7A 4NASA 3TAOA 3QFWA 5CLTA 5U25A 1UZ4A 2A6NA 1GNXA 3NVDA 1RSCA 1LOSA 5FSEC 2ZZ1A 1T7LA 3VZXA 2WW5A 1NFGA 4QTGA 1H60A 2V63A 3NGJA 2VEGA 3W9ZA 1GXFA 3ZLGA 1MXGA 1LT8A 3V5CA 2RABA 1RA0A 2D24A 2PDIA 2E8ZA 1D7FA 4TIMA 3RCMA 4LVGA 5M03A 1XLMA 2YDAA 4EM4A 1HL9A 1FFQA 1FIQB 3MBDA 3M0MA 1SMAA 3EDDA 4BFAA 5K3VA 2ACRA 2A4AA 2YYUA 4M51A 4XG1A 1OF6A 3LXAA 1L8NA 2PF0A 2RJHA 1T96A 1WE5A 4GINA 5KZEA 3W81A 4A3HA 4DF2A 5I3KA 4DJED 1H6VA 4MWAB 4N9BA 4HU0A 4U33A 4ASTA 4B15A 1DWGM 1XG4A 2CYGA 4XZHA 4ES4A 1POKA 3W71A 3IUHA 4AD3A 4KPRA 1V79A 3T2OA 2DUXA 2HBVA 4TVDA 5A2CA 2DEPA 4BV6A 3CO8A 4O18A 3AQUA 1H63A 2J8FA 2Y0FA 2ISWA 2V3DA 4XKYB 2VRKA 4ZBCA 5CC5A 2BCPA 4REQB 5D8WA 1KFJA 4LJ3A 1CX9A 5C8BB 5DY3A 1KBKA 2XVNA 4DPQA 5EU9A 3ETRB 3CWNA 3CHDA 4I9TA 1FHVA 1QWGA 3UJ2A 5HA7A 3O0HA 1THFD 2DH2A 1C91A 1BXNA 1UBPC 5EY5A 4Z2JA 2VVSA 4JTIA 3MS8A 1ZMCA 4M1BA 5A95A 2IPJA 5D9OA 3O8AA 3B9DA 5G2HA 4J35A 1S2AA 3Q37A 4FLRA 1F4AA 2C8NA 4DELA 2Z7GA 1EZ2A 2B31A 3USZA 2FYMA 5REQB 2YW3A 3RXZA 3R0DA 4B5TA 4F2BA 3G1YA 3AHVA 3A3HA 2B0MA 3EXRA 3SR7A 1T3QC 2PDHA 4AISA 1EEXA 4E2DA 2ZZ7A 1SM9A 1OCNA 1L0PA 1U1UA 2J9XA 4RW3A 4E4UA 3QV7A 1XH1A 3S2JA 3FJNA 3T6CA 5GQBA 5E0KA 1YMYA 3UPWA 1UD4A 1L2QA 1XYAA 3EXSA 3L4XA 3MW7A 4HB7A 3VOCA 3WJYA 3RU8X 3ATZA 1UBSA 3N18A 3UW6A 4IFKA 3W2UA 5FAJA 1DVJA 1RJQA 8XIMA 2YGYA 4I7VA 4QLKA 3JZUA 5EMUA 1CWYA 3GG0A 3HG5A 1OCBA 1TQJA 3LLDA 2Z1BA 3F4CA 1ZK7A 2ZYFA 3EBVA 3OHMB 3WEOA 4GGBA 1I6NA 3KFTA 3L2IA 1RCXB 2EG6A 2ZUSA 2CLMA 4JIPA 3P14A 4QS6A 4PCFA 4MLJA 3U7VA 2W0HA 2O7QA 1OCQA 3TJLA 2A21A 4ZENA 2VR2A 1B90A 4WRHA 1OFOA 3ITVA 3OZMA 2XJ7A 3TXZA 3BG3A 3MWCA 4NF7A 4UNIA 5U7SA 1PSCA 2WLZA 3D3FA 4OBSA 4M29A 3V4BA 3T40A 3G1XA 3GE7A 3P6LA 3TN3A 1JD9A 4IIBA 1PAMA 2VZOA 1OZQA 5D2YA 4ATDA 3VIPA 4ERIA 1BWLA 1CPUA 4MY8A 2WHMA 3GH7A 3GDMA 2QF7A 2E3ZA 2X42A 4NHVA 1Q6FA 2JFEX 3QY8A 5D4YA 3I4EA 3GTXA 4D6GA 3OW1A 2W91A 4QJ5B 4XK2A 1PXGA 2WPGA 1LORA 1XI3A 5HMSA 4Z1DA 4O53A 1DPMA 5D9NA 2J24A 3EX2A 2YIHA 4AC7C 1E9IA 1OFAA 1VHNA 4LUSB 4L4LA 1FHLA 3PUGA 1W1ZA 3KXQA 4C1KA 4FX6M 4XBJA 1G7VA 1HGYA 1TJ2A 3KBNA 6REQA 5BRQA 3R8GA 2C3DA 2EPHA 1W3HA 2V69A 3K30A 1K4GA 1MVYA 2Y62A 3MPGA 2I9UA 3VIOA 3S83A 1QBBA 1B54A 3A24A 3T0BA 2AAQA 2ZFAA 1IWPA 1NDZA 1PS9A 1IZJA 3IJ6A 3UR2A 3PK7A 3M0KA 3UXLA 1HFBA 2VZVA 1P1MA 2ZBTA 3SADA 3HN3A 1XD0A 4ZSTA 5MKGA 4X22A 3UGRA 1JGIA 3WN6A 2J74A 4FR1A 4WZHA 2YKKA 3H2NA 1PVNA 3LLFA 1SR9A 3AMGA 4IJCA 1BHGA 3BE7A 1B9ZA 3MUAA 1TR9A 4Q7NA 1CZ1A 6TAAA 1KM4A 3UG8A 2DQWA 1SZRA 4PMNA 3UA3A 2R8WA 4LVDA 2GGEA 3QLLA 1MW2A 1RCOB 4DLFA 1T99A 4MGGA 2YCKX 3LLXA 4R7JA 3FJ6A 3FAWA 4DN1A 4E5TA 1HO1A 1K6WA 5A6MA 2CWXA 1DJYA 4GVGA 5U4NA 1JCMP 1O6IA 3R2GA 1Z32X 3SUUA 4QROA 1FVPA 3VM7A 4GK8A 2PBOA 3O1NA 2J7EA 3N9SA 1ML1A 3VOJA 1TWIA 3L5AA 2FPYA 1RQHA 1R0MA 3WZ0E 1TPVA 2XZ7A 4G2DA 1ME7A 4N9CA 2QIIA 2J77A 4P7LA 1RZMA 3M5XA 3UJRA 4FALA 4RZ6A 2CLIA 4FOUA 3V16A 3L67A 4AZBA 3KS6A 5CJNA 3LZ3A 2ACUA 4H2HA 4GXPA 5CAHA 4PSPA 4NG3A 2PGRA 2GSJA 2OMAA 3T0TA 1QI4A 3N1AA 2FHCA 2Z7KA 3I10A 2ZRYA 3CHVA 5FS7A 2FHBA 2A79A 1STZA 3N12A 5AN7A 3NG3A 3L5MA 3RR1A 2FMOA 4IUGA 4JR5A 3MMDA 1DEDA 3W1QA 2GQAA 1EGMA 1EDGA 4WJEA 3T4CA 1QW9A 3O6YX 3B04A 4K1WA 4N0RA 3VDCA 1J96A 1IR1A 1J93A 5I78A 4MYXA 4UFLA 3MVTA 1F07A 1TPC1 4WKFA 2YXOA 3W7CA 2WMFA 3L4YA 5C55A 1IV8A 1AD4A 4AF0A 3DDMA 3A9BA 3LV6A 2OT1A 2VQUA 4RE0A 4G56A 5HQMA 3CYVA 3WJXA 3BJTA 2GH5A 2VFEA 1C93A 2ISVA 2XVLA 3DG7A 1ZAHA 3K8LA 3RFAA 3IGSA 1B4KA 3LD5A 4BEQA 4XD3A 1Q8AA 3RCNA 4DUOA 1NDYA 4AVFA 1AZ1A 3PJUA 2F38A 3MBFA 4JFWA 3E96A 3U57A 3SCWA 2Q71A 1JAKA 1FWTA 2XSAA 3VYLA 1UD2A 2QUUA 3TYZA 3GNNA 1DXFA 4PR4A 3TN6A 5CPTA 1QHZA 4KWUA 1O95A 1VFOA 1VD6A 1G01A 3LSBA 4HK6A 2CBJA 1RV8A 2GGHA 4IP4A 4U4MA 2VL4A 4XD6A 3CB3A 1YW1A 4DQWA 2VKZG 2ZZ0A 1JD7A 1WDSA 3BLDA 1UP3A 1EO7A 2L5HA 1V0MA 1K02A 3LCWA 1JFHA 1EZWA 2DORA 3BW4A 3LQGA 4ZXLA 3LBCA 1GVOA 5E6YA 3GIYA 1OJTA 3QF0A 4WXYA 3WO8A 3N19B 3W28A 3GIQA 1RBLA 1NHQA 2VC6A 1ZZMA 1YBQA 1OZMA 4GXMA 4W5ZA 3DHPA 1ITCA 1UWAA 4XD4A 4CQ9A 5LNRA 2BNJA 1YIXA 4WF7A 2PLJA 4NEVA 4JFSA 4W84A 3F4DA 3DK4A 2NT0A 1V02E 5K2ZA 5C9ZA 4XO6A 3N34A 1E4MM 3CV1A 5C7VA 1ZS2A 4L65A 4RZ5A 1CW2A 3SURA 5FF4A 4APNA 3QYQA 4S3CA 4DY1A 1IZKA 2HSAA 3LHUA 5JRBA 3BICA 1E1CA 1TX0A 4BK9A 1DQWA 3CQKA 5CZJA 3TP4A 4S3GA 2VFFA 4ZB2A 3LN3A 3CEPA 1TMQA 3PZQA 3BGGA 1VQZA 1R8LA 1WZMA 2EQ7A 2VX5A 3U0HA 3NZQA 3OGSA 1S2CA 5E9XA 3ABXA 1XGZA 1K9EA 2YXGA 1XDIA 4PE8A 3MV11 4NZ1A 1LOLA 4JIRA 3VNIA 1M53A 1ADDA 5DRIA 1TELA 1J0ZA 3NQFA 4C6OA 4HA1A 4HHHA 2YW4A 1Z48A 4WSJA 3CUFA 2J6VA 2QDHA 3GXPA 2CESA 5CXPA 3UXKA 2B7QA 3QJAA 1R3SA 1VJIA 4LC6A 2EJ1A 3L23A 1SW7A 5CLWA 1CB2A 1H09A 3O0FA 2ZVRA 1SFSA 1WUEA 4JHMA 4PMVA 4FXJA 4S2CA 1A53A 2HRWA 4GRTA 3C56A 5LGZA 2FB3A 2D23A 4QDMA 4ZOHB 2IMRA 5I79A 1E43A 3TCSA 1J5TA 3PB0A 4LRSA 3RO6A 3AMLA 2GJLA 3WQFA 3WD0A 3HG4A 4RE4A 4AZCA 3NL5A 3QQWA 1N2VA 1L9WA 5CGTA 3KL5A 4N9DA 4GKLA 2NUXA 3YPIA 3QZ6A 1DTNA 3TV8A 4C6BA 4ZQRA 3KBVA 4J2PA 4R85A 2I56A 4LBSA 3WJZA 1B9BA 1D3CA 4PRWA 3D47A 3L0GA 1QMLA 1S5NA 2YL5A 9XIAA 3KW3A 5FOOA 2DZVA 3C86A 3UNDA 3MT1A 1UUMA 3C8NA 4WEVX 1LCOA 5A6BD 5A8MA 2QMJA 1PO9A 3M7WA 1SYTA 2PFHA 5LA2A 1XV8A 4L6HA 1GVIA 1UH4A 3ES7A 1AFSA 2PUZA 2JIEA 4F3HA 3MB9A 5I3DA 2X2GA 3AIBA 2QVHA 1GREA 4EWJA 1QUMA 2ASHA 3TKFA 3RG6A 4F0HA 3CH9A 2XPKA 1ZY9A 2EO7A 4LCQA 5D37A 2Z2UA 1D7KA 5JU6A 1Q7MA 2IW0A 1FWDC 1T41A 3QR1A 1JDEA 3II1A 3B0UX 1OG0A 5H8MA 5EB8A 5HNNA 4DNMA 3CIWA 2PCQA 4O1CA