3OC4A

Crystal structure of a pyridine nucleotide-disulfide family oxidoreductase from the enterococcus faecalis v583
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
442
structure length
422
Chain Sequence
LKIVIIGASFAGISAAIASRKKYPQAEISLIDKQATVGYLSGRYITEEELRRQKIQLLLNREVVAMDVENQLIAWTRKEEQQWYSYDKLILATGASQFSTQIRGSQTEKLLKYKFLSAVPLLENSQTVAVIGAGPIGMEAIDFLVKMKKTVHVFESLENLLPKYFDKEMVAEVQKSLEKQAVIFHFEETVLGIEETANGIVLETSEQEISCDSGIFALNLHPQLAYLDKKIQRNLDQTIAVDAYLQTSVPNVFAIGDCISVMNEPVAETFYAPLVNNAVRTGLVVANNLEEKTHRFIGSLRTMGTKVGDYYLASTGLTETEGLFFPQTLASIIVRQPAPPLQHGTEILGKLIYDKVTQRVLGAQLCSKNNCLEKINTLALSIQTGQTLTDLLQKDYFYQPSLTNIYDITNLMGASAYWREND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxidoreductase, pyridine nucleotide-disulfide family
publication title Crystal Structure of a pyridine nucleotide-disulfide family oxidoreductase from the Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase
total genus 119
structure length 422
sequence length 442
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3oc4A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3oc4A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3oc4A02
3F8DA 4X4JA 3OZ2A 1YY5A 1S3BA 3LZXA 2UZZA 4B68A 1YQ4A 5GRTA 1P2HA 1IJHA 2JB1A 4J36A 1TDEA 1ELIA 3LJPA 2V61A 1VQWA 1NG3A 2XVJA 4H4ZA 1F8SA 3ICSA 5FS6A 4J33A 4OPGA 2QA2A 3CPIG 3DGHA 1GESA 1O5WA 2C65A 1V59A 3C4AA 2J3NA 4OPIA 2BABA 2AR8A 2RGHA 3P1WA 3AEGA 2CULA 3S61A 1E39A 4X9NA 2VVMA 1KDGA 3P4RA 3NT6A 1XANA 4GDEA 4XXGA 2XVEA 3AEAA 4YSXA 4USQA 1N4UA 3D8XA 2TPRA 2WU2A 2X3NA 3UKLA 2WU5A 2ARDA 3I3LA 2E4GA 1NAAA 1CJ4A 1S2YA 4YSZA 4YTNA 3AE1A 2AQJA 2VRMA 3AEDA 3AE7A 3NKSA 2YLRA 2Z5XA 2XCGA 5M0ZA 2GQWA 1CL0A 4EMWA 3P4SA 4JQ9A 2XLTA 4OPUA 1JNRA 4O5QA 3CGEA 4JNQA 1DJNA 3NHOX 2WESA 4Y4NA 3DGZA 4PABA 3NG7X 1NENA 4KX6A 3FIMB 4AP1A 1GV4A 2B7RA 3KU9A 5J60A 2GVCA 4Z25A 2VQ7A 1EL7A 1OJAA 2WOVA 3G5SA 1N4WA 3DJJA 1LTXR 1GRFA 3VRDB 4YKGA 1TDOA 3QJ4A 4D03A 3BHKA 4E0VA 4LIIA 2GR0A 5EBKA 4H4XA 1GTEA 2E5VA 3AEFA 3ZDNA 4NTDA 1TRBA 2RGJA 1GREA 1YQ3A 2YLZA 2XFNA 2WBAA 4B67A 4CY6A 4H4UA 2GAGB 3G5RA 5BULA 2Q0LA 3AB1A 3NK2X 1CJ2A 1PJ7A 1GRBA 5JCIA 1B4VA 2C7GA 3IHMA 3PO7A 5KWFA 4YT0A 4Z2TA 3FMWA 1F8WA 5ER0A 5FS9A 3GMCA 3NK1X 4FDCB 1GETA 1PXBA 1GERA 5FMHA 1N1PA 2WDRA 3AE4A 3ITJA 4Z24A 1PHHA 3UKPA 4U8IA 2C3CA 3SFEA 4A6NA 4YSYA 2BS2A 3NIXA 4USRA 3UKFA 2C67A 2WPFA 1TDKA 5U63A 2R46A 4BJZA 4WX1A 3QVPA 4ZCDA 4CY8A 4U8MA 3CNSA 3ICRA 1ZMCA 4M52A 4EQWA 2GMHA 3LOVA 4EM3A 4TLXA 2EQ6A 1QLBA 3CN8A 3UKQA 4TM3A 2BC0A 1QJDA 2CDUA 4U8LA 3KLJA 1S3EA 3SGLA 3KA7A 4EQRA 1EBDA 1RSGA 3LZWA 3RP6A 4IV9A 1VG0A 2XLPA 1ZKQA 2W0HA 2B9WA 4K22A 1GRTA 4FX9A 1L9DA 3ALJA 3I6DA 3V3NA 2A87A 5U25A 1YKJA 3NLCA 1X31B 5FS7A 2B76A 1H81A 3BNMA 4BJYA 3GD4A 1N4VA 2YM2A 4OPLA 3E1TA 4NTEA 4Y4LA 4BV6A 1GALA 3ALLA 4B65A 3AD7B 3NTDA 1K0JA 2GV8A 3PVCA 3WE0A 5BUKA 2GF3A 3T37A 1VDCA 1K4QA 2WPCA 1JRZA 2YG4A 1PBCA 2BACA 1FECA 5M10A 4BK2A 2OA1A 1H84A 3ADAB 1KF6A 2H88A 2OLNA 3VR9A 2YG5A 2YVJA 2WOWA 2V3BA 3G5QA 4H2RA 1BWCA 3GYIA 3KVEA 2XYOA 4U8PA 4Z2RA 3BHFA 4H2NA 1EL5A 5L46A 2XFQA 4EQSA 2C66A 4I58A 4A65A 2ZBWA 1Q1RA 1GRHA 2HQMA 1MOKA 3AEBA 3QVRA 1CF3A 3VR8A 1VRQB 5HYMA 1CC2A 4UDPA 1S2QA 4H4QA 4LU6A 2R0CA 4C3YA 1IUWA 1L9EA 3IWAA 3ATRA 4ECHA 4B1BA 1DODA 2JB3A 2WP5A 3M0OA 4DGKA 1EL8A 3UTFA 3B3RA 1NG4A 2R4EA 3JSKA 1D4EA 1PDHA 4TM1A 3FG2P 4OPTA 4GRTA 4CCQA 3IHGA 4HA6A 2NVKX 3ABVA 1JOAA 2JAEA 5IPYA 2GR3A 5JCLA 4U2SA 1F6MA 4Z2UA 2QAEA 3CTYA 3AYJA 3NH3X 3FPZA 2WEUA 2C64A 2FJEA 2WDQA 3DJGX 1OJDA 3CIRA 3CNDA 3VRBA 5JCMA 4EIPA 3IF9A 3HZLA 4OPDA 4FK1C 3P9UA 3RNMA 5KRQA 2CVJA 1HYUA 3UTEA 1F3PA 1COYA 1LQUA 1PN0A 2H89A 2B9YA 4RSLA 3L8KA 3UOZA 2BK4A 1BGNA 4YTMA 2BA9A 3UKHA 4C3XA 3QSSA 3KPFA 4Y4MA 1E1MA 3CGDA 3EAOA 2APGA 4APNA 2YAUA 3UTHA 2WPEA 2YM1A 1XPQA 2WS3A 1KSSA 4GF7A 1PBBA 4NZHA 5CQFA 3CNJA 4OCGA 1TYPA 5HHFA 2YLXA 2R45A 2XLSA 5CKUA 3NK0X 2BXSA 3QSMA 3AEEA 1Y56A 5HXIA 2FJDA 3UOVA 5BVAA 3P4QA 2GRTA 2IIDA 2B7SA 3UTGA 1XDIA 3CNTA 2V3AA 2BC1A 2VRLA 2JK6A 3GYJA 2XVHA 2IVDA 1NHPA 1O95A 1PJ5A 1D5TA 4H50A 2DKIA 4JY2A 3AE9A 3CPJG 2BS4A 4J34A 3VQRA 2FBWA 3KD9A 4UP3A 4DSGA 4K2XA 2Y6RA 3EANA 1DOEA 4IA5A 3Q6JA 4EQXA 1E1KA 2BK3A 2JB2A 3URHA 3AE6A 1CJ3A 3NTAA 1BF3A 4RG4A 4DSHA 1GSNA 2C73A 2GAHB 4WCTA 2VVLG 4REKA 4A6NB 4CNJA 2GQFA 3AD8B 4D04A 4C5OA 4A5LA 2PYXA 1ZK7A 2C75A 4IA6A 4CBQA 5C3JA 3GD3A 3QFBA 2R0GA 4HB9A 4X9MA 2ZZ0A 2R9ZA 1ONFA 1FOHA 1IUUA 2QA1A 2Y6QA 4OPCA 4C77A 2X8CA 4EIQA 4AT2A 1YQZA 1FEBA 3FBSA 4OVIA 3AECA 1B5QA 3M13A 3C96A 4PAAA 1NEKA 3BI2A 4O5UA 2I0ZA 3K7TA 2Z5YA 1FL2A 4I59A 2WOIA 4NEWA 1JRYA 4NEVA 3EF6A 4H4PA 5HY5A 1D4DA 1NHSA 2XVIA 1KNRA 3NYEA 1TDFA 3RP7A 4TLZA 3D1CA 3RHAA 5J7XA 4U2LA 3DK9A 4B63A 1LVLA 4EMIA 5LV9A 3GRTA 5KVIA 1NPXA 3DJDA 4UDRA 1LQTA 1Y0PA 2YG3A 3DK4A 2A89A 3V3OA 2YLWA 2C72A 2DKHA 3LB8A 3NN0X 2ACZA 2GR2A 2V6OA 5BRTA 4GDPA 3SM8A 2X8GA 3S5WA 4H2PA 1DJQA 4CCRA 1L9CA 3GDPA 4B64A 1UKVG 2WETA 3DA1A 3CGBA 3UKKA 3K7MX 4H7UA 1GRAA 3NRNA 1D7LA 3UKAA 4N9XA 4YSHA 1PJ6A 2X99A 2ZZBA 1BGJA 2R4JA 4A7AA 5FS8A 1JEHA 2C76A 3KKJA 3DK8A 1MXTA 2O9ZA 4P9SA 1GRGA 1OJTA 2A8XA 1H6VA 1F8RA 4A99A 3AE5A 1VG9A 1GXFA 2YLTA 2EQ9A 2BYBA 4J57A 3NNEA 3GSIA 1REOA 3K7QX 4ICYA 1ZOYA 2EQ8A 5EB4A 4Z43A 3OC4A 4A79A 1JNZA 4U8NA 2AAQA 1BZLA 3UOYA 1CC4A 2E1MA 3II4A 2WDVA 4JY3A 3BI4A 5DBJA 1KSUA 2F5ZA 1Q9IA 3UP4A 3SQPA 4IVMB 2Q7VA 4BK3A 1FEAA 4KPRA 1IUTA 2X8HA 1P2EA 1RYIA 3NN6X 4YTPA 5KOWA 1LV0A 2JBVA 2VQBA 2BS3A 2GR1A 2YWLA 3F8PA 3NGCX 4U8KA 3NYCA 1W4XA 3UCLA 5GSNA 2WQYA 2B9XA 3M12A 1B8SA 2V5ZA 1JRXA 2BXRA 3PS9A 3GWDA 4K5SA 4BURA 3P4PA 1NHQA 1Q1WA 4JNAA 4U8JA 4B69A 1PXAA 3DMEA 4ZN0A 5JCKA 4YKFA 1ZX9A 2Q6UA 4JDRA 4FK1A 2ZZCA 1H7XA 3Q9TA 4H4VA 4ADWA 1CJCA 2XVFA 3AWIA 4GCMA 2PHHA 2XFOA 2YVGA 3RP8A 1ZOVA 2BK5A 3BNUA 5TR3A 1Z6LA 2XFPA 4A9WA 4BK1A 1K0LA 4YXDA 4U2TA 1GT8A 4J31A 5U1OA 3DH9A 5KOXA 3ALMA 3EPTA 3REDA 2GH5A 5JCNA 2YR4A 2WP9A 2XDOA 3COXA 4AP3A 1H83A 4RG3A 4DNAA 1DOCA 1GEUA 1Y56B 3CPHG 5EB5A 4J56A 2XLRA 3BI5A 1KFYA 1PXCA 1TDNA 2C3DA 3O0HA 1PBDA 3B6DA 3QSEA 2V60A 2BCGG 1ZY8A 2YR6A 4H2QA 3AYIA 1GPEA 4YWOA 1IUXA 3DJEA 4MJWA 1NDAA 3AYLA 3C4NA 4H4WA 2OLOA 4XWZA 4Z26A 5KXJA 4K5RA 1DXLA 2OAMA 1CHUA 3R9UA 1D7YA 3GDNA 3AE2A 1L0VA 3GRSA 2YG6A 3AXBA 2GMJA 3K30A 1ZMDA 4U8OA 2JKCA 1IUVA 4GUVA 4CNKA 4GR1A 4K7ZA 1LJ1A 4H4SA 4K8DA 3IC9A 1K0IA 1PBEA 4H4YA 1FCDA 1MO9A 1EL9A 1ZP0A 4Z44A 3SFDA 4AT0A 1B37A 4AOXA 1H86A 2CFYA 5IQ1A 4CRTA 1KNPA 2FJAA 3UP5A 3VRAA 2RGOA 3LXDA 1H82A 2YLSA 4B66A 5KVHA 1IUSA 1O94A 2NPXA 5C2TA 1DNCA 2EQ7A 2VOUA 3GWFA 2RABA 3LADA 2WHDA 4EM4A 4C74A 2GEWA 2VZ2A 4TM4A 1GNDA 5EOWA 3AD9B 4J2WA 2Q0KA 3QFAA 4XWRA 3CNPA 1D4CA 1E6EA 3GMBA 3H8LA 1AOGA 1E7PA 3ICTA 3AE8A 2C70A 1E1NA 2VVLA 1CBOA 2XFUA 3F8RA 4IVOB 1JU2A 2R0PA 2TMDA 4JN9A 4EMJA 1BKWA 1M64A 1OJ9A 3ATQA 1M6IA 3AE3A 1TYTA 3NYFA 1E1LA 3L1RA 1PS9A 4H4TA 1ZDLA 2YVFA 4H4RA 1QO8A 1GTHA 4ZCCA 3ISHA 1CC6A 2YG7A 3V76A 2IVEA 1DOBA 2FJBA 2XLUA 2YR5A 5IQ4A 3ZYXA 2QCUA 2OALA 2X50A 1OJCA 4AOSA 4TM0A 2GB0A 4NTCA 3CGCA 1LPFA 1NHRA 4LA1A 3H8IA 4UDQA 1PBFA 1XHCA 1RP0A 2YQUA 1H7WA 2WP6A 3H4KA 3UOXA 1SEZA 2BCPA 1GOSA
chains in the Genus database with same CATH superfamily
2UZZA 1P2HA 3LJPA 3JVAA 3CAWA 2XVJA 4H4ZA 3ICSA 2QA2A 2ONEA 3DGHA 4OPIA 2GGGA 2CULA 4GDEA 4YSXA 1N4UA 2WU2A 2MNRA 1NAAA 1S2YA 4YTNA 3AE1A 3AEDA 2OKTA 3AN1A 2XCGA 3NXLA 1JNRA 4MKSA 4JNQA 4Y4NA 4PABA 3TJIA 2PP3A 2VQ7A 3SYIA 1OJAA 2WOVA 4YKGA 3QJ4A 3RRAA 1YQ3A 3G5RA 6ENLA 3AB1A 1CJ2A 2C7GA 3VA8A 3NRZB 4Z2TA 1W6TA 1F8WA 5EU9A 3NK1X 1N1PA 3AE4A 4J1OA 4E0VA 2RDXA 2GGJA 3ZLHA 4YSYA 4JHMA 3NIXA 4Z17A 2WPFA 4DXKA 3VFCA 3QVPA 4ZCDA 4CY8A 3ICRA 2EQ6A 4NWZA 1EBDA 1RSGA 4H83A 3LZWA 2XH2A 4JN7A 2W0HA 2B9WA 1GRTA 5FS7A 3OTRA 3OZYA 1H81A 4BV6A 3ALLA 4B65A 1K0JA 2GV8A 5BUKA 1K4QA 1JRZA 1PBCA 3DEQA 3ADAB 1KF6A 2YG5A 2V3BA 1V97A 2OFJA 2W55A 4DHGA 1EBHA 2XFQA 3AEBA 3GYXA 1CF3A 2XH4A 4LU6A 1IUWA 3IWAA 3Q4DA 4ECHA 3BOXA 2JB3A 3B3RA 1PDHA 3CT2A 2DW7A 3FG2P 1NU5A 2PTXA 4E6MA 5JCLA 3PK7A 4II2A 3FPZA 2WEUA 1OJDA 4TVWA 2PU0A 2QJJA 1SB3B 3CNDA 2HXTA 5JCMA 3VRBA 3IF9A 5KRQA 1COYA 4RSLA 1LQUA 2P88A 3SY4A 7ENLA 1BGNA 4YTMA 3QSSA 2APGA 2YM1A 3H8AA 1KSSA 3RITA 4NZHA 4YWSA 4KEMA 1N63C 3NK0X 3QSMA 1Y56A 5KMQA 2IIDA 5JRBA 3GYJA 3ZVHA 2XVHA 1FIQB 1D5TA 2DKIA 4JY2A 3KPKA 3RR1A 3VCCA 2BS4A 4DSGA 4RG4A 2OZTA 5KMPA 1BF3A 3S47A 1GSNA 2GAHB 4C5OA 5C3JA 3U9IA 4X9MA 3FCPA 4EIQA 3NVYB 1YQZA 3AECA 4K2SA 4PAAA 1NEKA 3OP2A 3RGTA 5HY5A 4H4PA 1TDFA 3TQPA 4TLZA 3RHAA 1YEYA 5LV9A 2BRAA 3DJDA 1LQTA 1Y0PA 3T2ZA 2YG3A 2XGZA 2C72A 1N62C 3LB8A 2ACZA 5BRTA 3DGBA 4M0XA 3SM8A 3S5WA 2GL5A 4ZCWA 4H2PA 1L9CA 3GDPA 3CGBA 2PSNA 3DG7A 3NRNA 1P48A 2QDDA 1N61C 3V5CA 4YSHA 1PJ6A 3SXIA 1BGJA 3DK8A 2PTYA 3TTEA 2A8XA 1VG9A 2BYBA 3NNEA 3K7QX 4A79A 1JNZA 4U8NA 3UOYA 2E1MA 2WDVA 4JY3A 3EUB3 3BI4A 1KSUA 1FEAA 1RYIA 3MWCA 1LV0A 3NGCX 2W54A 1BKHA 1B8SA 3TCSA 4K5SA 4BURA 1Q1WA 3DMEA 2HZGA 3ES8A 4IP5A 4ROPA 1EC8A 2BK5A 3BNUA 4A9WA 1K0LA 4YXDA 4U2TA 4IL2A 4GGBA 3REDA 5JCNA 2YR4A 4AP3A 3BSMA 4G73A 4DNAA 5G5GB 3CPHG 3NZGA 2XLRA 2YR6A 4H2QA 1TKKA 4MJWA 4Z26A 5KXJA 4XWZA 1E9IA 3GDNA 2YG6A 4ENLA 4K7ZA 3IC9A 3SFDA 1B37A 4AOXA 3PWGA 5IQ1A 3UP5A 1P43A 1O94A 5C2TA 1DNCA 2EQ7A 2VOUA 3GWFA 2RABA 3LADA 2ZADA 1GNDA 3AD9B 4J2WA 3QFAA 3GMBA 3H8LA 1N5WC 2P3ZA 2VVLA 3F8RA 1JU2A 1JRPA 1SJBA 5FJUA 1TYTA 3NYFA 3UGVA 4H4TA 4IP4A 1SJDA 2IVEA 2OALA 1VQZA 4AOSA 4TM0A 4NTCA 4UDQA 1NHRA 4LA1A 3H8IA 4G8TA 3VDGA 2YQUA 1SJCA 3H4KA 3UOXA 4X4JA 3OZ2A 1YY5A 1S3BA 1YQ4A 4HCDA 2DW6A 4A35A 1IJHA 1TDEA 1VQWA 1F8SA 3UJSA 1O5WA 1V59A 2J3NA 2BABA 2AR8A 3AEGA 3S61A 1E39A 3R10A 3UKLA 1S7MA 2WU5A 4YSZA 3FV9A 3NKSA 2AKMA 3MQTA 2MUCA 2GQWA 1CL0A 3P4SA 4OPUA 4O5QA 3NHOX 4G6HA 1NENA 4KX6A 3FIMB 2B7RA 2GVCA 4Z25A 4E4FA 1TE6A 3PG6A 1N4WA 1GRFA 3ENLA 4D03A 4LIIA 2GR0A 5EBKA 4H4XA 2RGJA 4HCLA 3T2YA 2WBAA 3T31A 2GAGB 4F4RA 2Q0LA 3NK2X 3IHMA 3GMCA 5ER0A 1GETA 3UCDA 5FMHA 3SFEA 4HPNA 1STZA 2BS2A 4GAPA 2C67A 4BJZA 2PTWA 3LOVA 3CN8A 3UKQA 4U8LA 3KLJA 3A7AA 3KA7A 1ZKQA 4FX9A 1L9DA 3ALJA 3NLCA 3MKCA 3GD4A 3ZVIA 1N4VA 2YM2A 3E1TA 4Y4LA 2OLAA 4ZA0A 2GF3A 1VDCA 2WPCA 1FECA 3SN1A 1EL5A 3HPFA 5IDZA 3OZMA 2GSHA 2C66A 4I58A 1Q1RA 3QVRA 2AL2A 3SZWA 2R0CA 3R07C 3B97A 3UXKA 1NG4A 1D4EA 3HW2A 4GRTA 3IHGA 4KT2A 4HA6A 2NVKX 1JOAA 2GR3A 4DWDA 1JDFA 1F6MA 2QAEA 3NH3X 4K1WA 2QGYA 4OPDA 3QTPA 3P9UA 1PN0A 2B9YA 3UOZA 3L8KA 2BA9A 3UKHA 3KPFA 1XPQA 1PBBA 3T14A 5HHFA 4EWJA 5HXIA 2XSXA 3UOVA 3P4QA 3CYJA 3BJSA 1XDIA 3CNTA 2BC1A 2VRLA 2IVDA 2NQLA 3CPJG 2FBWA 3P93A 3EANA 1DOEA 4IA5A 3Q6JA 2OVLA 2BK3A 1E1KA 1CJ3A 3NTAA 2C73A 4WCTA 4A6NB 2VVLG 4CNJA 2GQFA 4A5LA 3IJIA 2PYXA 2R0GA 4HB9A 1FOHA 1IUUA 2QA1A 3TJ4A 4C77A 2X8CA 3K1GA 4HNCA 1FEBA 3KUMA 4OVIA 1B5QA 4I59A 1FL2A 2WOIA 4NEWA 3N6JA 3EF6A 1D4DA 2XVIA 1KNRA 3NYEA 4HCHA 3QPEA 4B63A 3TOYA 2QJMA 1R0MA 2A89A 3V3OA 2YLWA 3AM9A 3NN0X 2V6OA 4GDPA 1NELA 2X8GA 4A3RA 1DJQA 3ETRB 3DFHA 1GRAA 2PTZA 2ZZBA 3PFRA 4A7AA 3GC2A 4HNLA 3ES7A 1OJTA 1H6VA 3AE5A 2EQ9A 3GSIA 3FJ4A 1REOA 2EQ8A 3OC4A 3S5SA 1BZLA 1CC4A 2F5ZA 1Q9IA 3SQPA 3H7VA 4BK3A 3NN6X 2X8HA 1P2EA 3GD6A 2VQBA 4U8KA 2YWLA 5GSNA 1JRXA 4U8JA 1PXAA 4ZN0A 4YKFA 1ZX9A 3SX6A 1H7XA 3AWIA 2XFOA 1ZOVA 1Z6LA 4GFIA 1GT8A 4J31A 5G5HB 3TW9A 3DH9A 5KOXA 1JPDX 2WP9A 4RG3A 5EB5A 4J56A 1PBDA 2V60A 4YWOA 1IUXA 3DJEA 1NDAA 3AYLA 2OLOA 1N60C 1D7YA 3STPA 1L0VA 2GMJA 4CNKA 4A65A 1K0IA 4H4YA 1FCDA 4Z44A 4Z1YA 3R0UA 1H86A 4CRTA 2YLSA 1WUEA 4GYPA 4C74A 3OPSA 5EOWA 1EC9A 4IL0A 3CNPA 1E6EA 1E7PA 3T0KA 1FFVC 3AE8A 1E1NA 2I5QA 1BKWA 2XH0A 1M6IA 5FJOA 3MY9A 3L1RA 1PS9A 3P0WA 2YVFA 1GTHA 4ZCCA 3VCNA 3ISHA 1CC6A 3DFYA 2XLUA 2X50A 3CGCA 1RP0A 3GO2A 3F8DA 1BQGA 4E8GA 2OPJA 3LZXA 4B68A 3UXLA 1ELIA 5KMRA 1NG3A 3QN3A 5FS6A 4OPGA 3CPIG 1GESA 2W3SA 3C4AA 2RGHA 4X9NA 2VVMA 1KDGA 4XXGA 3NT6A 1XANA 2XVEA 3AEAA 3D8XA 2TPRA 3IK4A 2X3NA 3JW7A 2QVHA 2E4GA 1CJ4A 3P3BA 5FJTA 2VRMA 3AE7A 2YLRA 2Z5XA 5M0ZA 4EMWA 3U4FA 2XLTA 2P8CA 3CGEA 1FHUA 2WESA 3NG7X 2OQHA 4AP1A 5J60A 3SZ0A 1EL7A 1PDZA 3T4WA 4G74A 1TDOA 3BHKA 1GTEA 3AEFA 4NTDA 2E3TA 2YLZA 2XFNA 1VDVA 4GMEA 4HYRA 4CY6A 3V5FA 1PJ7A 1B4VA 2BRYA 4FDCB 1PXBA 1IYXA 1PHHA 4U8IA 4J3ZA 4USRA 3H70A 2R46A 4WX1A 4IHCA 4U8MA 3CNSA 1H2IA 3I6TA 2PU1A 2HXUA 4H19A 2FYMA 4TM3A 1EBGA 2BC0A 3L5OA 1R6WA 1S3EA 3SGLA 4EQRA 1L8PA 3SZCA 2XLPA 4G7FA 4K22A 3I6DA 3V3NA 2A87A 5U25A 4NNJA 4GGHA 3BNMA 1GALA 3NVVB 3NTDA 3WE0A 3PVCA 3T37A 2YG4A 2BACA 2OA1A 2H88A 3FVDA 2OLNA 2YVJA 3G5QA 1BWCA 3GYIA 3KVEA 2XYOA 4Z2RA 1PDYA 5L46A 3FYYA 3HRDC 2HQMA 1S2QA 4H4QA 5KMSA 3ATRA 1DODA 4DGKA 4TVYA 3D46A 3UTFA 4X2PA 2R4EA 4OPTA 3ABVA 5IPYA 4U2SA 4Z2UA 3AYJA 3CXBA 3DJGX 3CIRA 3HZLA 4A6GA 3RNMA 2CVJA 2H89A 4IZGA 2BK4A 4C3XA 4Y4MA 4APNA 2YAUA 3UTHA 2WPEA 2WS3A 5CQFA 3CNJA 4OCGA 1RVKA 2YLXA 5CKUA 2BXSA 3AEEA 2FJDA 1FFUC 5BVAA 2GRTA 3IJQA 1NHPA 2ZC8A 2PA6A 1O95A 1PJ5A 4H50A 4J34A 2O56A 3KD9A 4UP3A 2JB2A 3AE6A 2GDQA 3URHA 3A7UA 3EKGA 3CK5A 4GYPC 3GD3A 3QFBA 2R9ZA 2PGEA 3HYWA 4OPCA 1ONEA 2XH7A 3A7RA 4AT2A 3FBSA 3C96A 4O5UA 4NEVA 5J7XA 2QJNA 1LVLA 4EMIA 3MZNA 3MUCA 5KVIA 1NPXA 2PODA 2DKHA 2FKPA 4CCRA 4B64A 1UKVG 2WETA 5KNLA 3K7MX 4H7UA 3UKAA 5BOEA 2X99A 3NVZB 2R4JA 2C76A 1WUFA 1F8RA 1GXFA 2YLTA 4J57A 3UCCA 4Z43A 1SJAA 2AAQA 3UJFA 3UP4A 4IVMB 2Q7VA 4KPRA 2BS3A 3F8PA 3NYCA 3UCLA 3M12A 3PS9A 3GWDA 3UJEA 3P4PA 1NHQA 4JNAA 1ELSA 3DIPA 3IJLA 4FK1A 4H1ZA 4II3A 4ADWA 3CXOA 2XVFA 2OX4A 3RP8A 2YVGA 5TR3A 2XFPA 4BK1A 4KWSA 5U1OA 3UJRA 3ALMA 3EPTA 3SQSA 2GH5A 2XDOA 1GEUA 1RM6B 1Y56B 1KFYA 2C3DA 3O0HA 1ZY8A 3AYIA 1GPEA 3ZVHB 4H4WA 4K5RA 2GGHA 3R9UA 3GRSA 3K30A 2JKCA 4GUVA 4H4SA 1LJ1A 1MO9A 1EL9A 4M6UA 3SZFA 4JN8A 2CFYA 2PGWA 2PPGA 1KNPA 1XPYA 3DERA 4B66A 1IUSA 2NPXA 2WHDA 2CHRA 3ZLGA 3SSZA 2GEWA 4TM4A 3NVWB 4XWRA 1N5XA 3R11A 1CBOA 2XFUA 4IVOB 2TMDA 4EMJA 3ATQA 3AE3A 1E1LA 1ZDLA 1QO8A 5J04A 2YG7A 1KKRA 3V76A 2FJBA 2YR5A 3T9PA 5IQ4A 1ECQA 2QCUA 2OZ8A 2GB0A 1PBFA 1XHCA 4E4UA 2WP6A 2POZA 1SEZA 3RO6A 2BCPA 4KPLA 1JCTA 5GRTA 2JB1A 4J36A 2V61A 3T2KA 4J33A 2OO6A 2C65A 3P1WA 4GIRA 3P4RA 4FP1A 4USQA 2PMQA 2ARDA 3I3LA 2AQJA 4JQ9A 4GAVA 1DJNA 3DGZA 1EC7A 1GV4A 3KU9A 2P8BA 3NFUA 3G5SA 3VC6A 4HN8A 4E5TA 3DJJA 1LTXR 3VRDB 2HNEA 2E5VA 3ZDNA 1F9CA 1TRBA 3TWAA 1JROA 3UJ2A 2OZ3A 1GREA 3CMMA 4B67A 5BULA 4H4UA 2OQYA 2AKZA 1GRBA 5JCIA 3OW1A 3Q45A 3I4KA 3PO7A 5KWFA 4YT0A 3FMWA 5FS9A 1GERA 2WDRA 3UKPA 4Z24A 3ITJA 4A6NA 2C3CA 3UKFA 1TDKA 5U63A 2QQ6A 4IT1A 1ZMCA 4M52A 4EQWA 2E5AA 2GMHA 4EM3A 1TZZA 4TLXA 1QLBA 1QJDA 2CDUA 3RP6A 4IV9A 1VG0A 3SN4A 1KKOA 1FO4A 1YKJA 4DN1A 1X31B 3DESA 4MGGA 2B76A 4BJYA 4OPLA 4FI4A 4NTEA 3V3WA 3AD7B 3I6EA 5M10A 4BK2A 1H84A 3VR9A 2WOWA 4H2RA 4U8PA 3BHFA 4H2NA 3R1ZA 4EQSA 2ZBWA 1GRHA 1MOKA 4K8GA 2PP0A 3VR8A 3V4BA 1VRQB 1CC2A 4UDPA 5HYMA 4C3YA 1L9EA 4B1BA 2WP5A 3M0OA 5FJPA 1EL8A 3JSKA 4TM1A 4CCQA 2JAEA 4H2HA 3CTYA 3R0KA 2C64A 2FJEA 2WDQA 3DDMA 1KD0A 4EIPA 4DYEA 4FK1C 1WYGA 3UTEA 1HYUA 1F3PA 3SJNA 3CGDA 3EAOA 1E1MA 3DG6A 4GF7A 1TYPA 2R45A 2XLSA 3N6HA 1MDRA 3UTGA 2B7SA 2V3AA 2JK6A 3AE9A 3VQRA 4K2XA 2Y6RA 1OEPA 3SN0A 2GGIA 4EQXA 4DSHA 5BOFA 4REKA 4D04A 3AD8B 1X2GA 1ZK7A 2C75A 4IA6A 4CBQA 3HYVA 2ZZ0A 3HYXA 1ONFA 2Y6QA 3M13A 3BI2A 3NO1A 2I0ZA 1FHVA 2Z5YA 3K7TA 2QDEA 1JRYA 2PS2A 1NHSA 3RP7A 3PWIA 3AMZA 3D1CA 4U2LA 3DK9A 2AL1A 3GRTA 4UDRA 1ZXIC 3DK4A 3QLDA 1MDLA 3TWBA 1KCZA 2GR2A 2PCEA 5ENLA 3DG3A 3CB3A 2W3RA 3DA1A 3UKKA 1D7LA 4N9XA 5FS8A 1JEHA 3KKJA 1MXTA 4P9SA 2O9ZA 3N4EA 3GY1A 1GRGA 2AL2B 4A99A 3SR6B 3R25A 4ICYA 1ZOYA 5EB4A 1MNSA 1X2HA 3II4A 5DBJA 3H12A 2C4CA 3SBFA 1IUTA 4YTPA 5KOWA 3EEZA 3D9XA 4G9KA 2JBVA 2GR1A 1W4XA 1XS2A 2WQYA 2B9XA 2V5ZA 2BXRA 4B69A 5JCKA 3QKEA 2Q6UA 4JDRA 2ZZCA 3Q9TA 4H4VA 1CJCA 4GCMA 2PHHA 2P0IA 1KN0A 3COXA 1H83A 3VC5A 1DOCA 1T3QC 3RCYA 3BI5A 1PXCA 1TDNA 3B6DA 3QSEA 2BCGG 3C4NA 1DXLA 3T8QA 2OAMA 3ZLFA 1CHUA 2GGEA 3AE2A 3AXBA 1ZMDA 4U8OA 1IUVA 4GR1A 4K8DA 1PBEA 1ZP0A 4AT0A 2FJAA 3VRAA 2RGOA 1DTNA 3LXDA 1H82A 3JZUA 1MRAA 3B9JB 5KVHA 3NS1B 3D47A 3THUA 4EM4A 2VZ2A 2Q0KA 4DX3A 1D4CA 1AOGA 3T6CA 3ICTA 2PP1A 4GISA 4G6GA 2C70A 2R0PA 4JN9A 1M64A 1OJ9A 3MSYA 3FXGA 5FJRA 4H4RA 4ZOHB 2OG9A 1MUCA 1DOBA 3N4FA 3ZYXA 4MMWA 1OJCA 1JPMA 1LPFA 1H7WA 1GOSA
chains in the Genus database with same CATH topology
3F8DA 4X4JA 3OZ2A 1YY5A 1S3BA 3LZXA 2UZZA 4B68A 1YQ4A 5GRTA 1P2HA 1IJHA 2JB1A 4J36A 1TDEA 1ELIA 3LJPA 2V61A 5KMRA 1VQWA 1NG3A 2XVJA 4H4ZA 1F8SA 3ICSA 5FS6A 4J33A 3T2KA 4OPGA 2QA2A 3CPIG 3DGHA 1GESA 1O5WA 2C65A 1V59A 3C4AA 2J3NA 4OPIA 2BABA 2AR8A 2RGHA 3P1WA 3AEGA 2CULA 3S61A 1E39A 4X9NA 2VVMA 1KDGA 3P4RA 3NT6A 1XANA 4GDEA 4XXGA 2XVEA 3AEAA 4YSXA 4USQA 1N4UA 3D8XA 2TPRA 2WU2A 2X3NA 3UKLA 1S7MA 2ARDA 2WU5A 2E4GA 3I3LA 1NAAA 1CJ4A 1S2YA 4YSZA 4YTNA 3AE1A 2AQJA 2VRMA 3AEDA 3AE7A 3NKSA 2YLRA 2Z5XA 2XCGA 5M0ZA 2GQWA 1CL0A 4EMWA 3P4SA 4JQ9A 2XLTA 4OPUA 1JNRA 4GAVA 4O5QA 3CGEA 4JNQA 1DJNA 3NHOX 2WESA 4Y4NA 3DGZA 4PABA 4G6HA 3NG7X 1NENA 4KX6A 3FIMB 4AP1A 1GV4A 2B7RA 3KU9A 5J60A 2GVCA 3SZ0A 4Z25A 2VQ7A 1EL7A 3SYIA 1OJAA 2WOVA 3G5SA 3PG6A 1N4WA 3DJJA 1LTXR 1GRFA 3VRDB 4YKGA 4G74A 1TDOA 3QJ4A 4D03A 3BHKA 4E0VA 4LIIA 2GR0A 5EBKA 4H4XA 1GTEA 2E5VA 3AEFA 3ZDNA 4NTDA 1TRBA 2RGJA 3CMMA 1GREA 3T2YA 1YQ3A 2YLZA 2XFNA 2WBAA 3T31A 4B67A 4H4UA 2GAGB 3G5RA 4CY6A 2Q0LA 5BULA 3AB1A 3NK2X 1CJ2A 1PJ7A 1GRBA 5JCIA 1B4VA 2C7GA 3IHMA 3PO7A 2BRYA 5KWFA 4YT0A 4Z2TA 3FMWA 1F8WA 5ER0A 5FS9A 3GMCA 3NK1X 4FDCB 1GETA 1PXBA 1GERA 5FMHA 1N1PA 2WDRA 3AE4A 3ITJA 4Z24A 1PHHA 3UKPA 4U8IA 2C3CA 3SFEA 4A6NA 4YSYA 2BS2A 3NIXA 4USRA 3UKFA 4GAPA 2C67A 2WPFA 1TDKA 5U63A 2R46A 4BJZA 4WX1A 3QVPA 4ZCDA 4CY8A 4U8MA 3CNSA 1H2IA 1ZMCA 3ICRA 4M52A 4EQWA 2GMHA 3LOVA 4EM3A 4TLXA 2EQ6A 1QLBA 3CN8A 3UKQA 4TM3A 2BC0A 3L5OA 1QJDA 4NWZA 2CDUA 4U8LA 3KLJA 1S3EA 3SGLA 3KA7A 4EQRA 1EBDA 1RSGA 3LZWA 3RP6A 4IV9A 1VG0A 3SZCA 2XLPA 1ZKQA 2W0HA 2B9WA 4K22A 1GRTA 4FX9A 1L9DA 3ALJA 3I6DA 3V3NA 2A87A 5U25A 4NNJA 1YKJA 3NLCA 1X31B 5FS7A 2B76A 1H81A 3BNMA 4BJYA 3GD4A 1N4VA 2YM2A 4OPLA 3E1TA 4NTEA 4Y4LA 4BV6A 1GALA 3ALLA 4B65A 3AD7B 3NTDA 1K0JA 2GV8A 3PVCA 3WE0A 5BUKA 2GF3A 3T37A 1VDCA 1K4QA 2WPCA 1JRZA 2YG4A 1PBCA 2BACA 1FECA 5M10A 4BK2A 2OA1A 1H84A 3ADAB 1KF6A 2H88A 2OLNA 3VR9A 2YG5A 2YVJA 2V3BA 2WOWA 3G5QA 4H2RA 1BWCA 3GYIA 3KVEA 2XYOA 4U8PA 4Z2RA 3BHFA 4H2NA 1EL5A 5L46A 2XFQA 4EQSA 2C66A 4I58A 4A65A 2ZBWA 1Q1RA 1GRHA 2HQMA 1MOKA 3AEBA 3QVRA 3GYXA 1CF3A 3VR8A 1VRQB 5HYMA 1CC2A 4UDPA 1S2QA 4H4QA 3SZWA 4LU6A 2R0CA 4C3YA 5KMSA 1IUWA 1L9EA 3IWAA 3ATRA 4ECHA 4B1BA 1DODA 2JB3A 2WP5A 3M0OA 4DGKA 1EL8A 3UTFA 3B3RA 1NG4A 2R4EA 3JSKA 1D4EA 1PDHA 4TM1A 3FG2P 4OPTA 4GRTA 4CCQA 3IHGA 4HA6A 2NVKX 3ABVA 1JOAA 2JAEA 5IPYA 2GR3A 5JCLA 4II2A 1F6MA 4U2SA 4Z2UA 2QAEA 3CTYA 3AYJA 3NH3X 3FPZA 2WEUA 2C64A 2FJEA 2WDQA 3DJGX 1OJDA 3CIRA 3CNDA 3VRBA 5JCMA 4EIPA 3IF9A 3HZLA 4OPDA 4FK1C 3P9UA 3RNMA 5KRQA 2CVJA 1HYUA 3UTEA 1F3PA 1COYA 1LQUA 1PN0A 2H89A 2B9YA 4RSLA 3L8KA 3SY4A 3UOZA 2BK4A 1BGNA 4YTMA 2BA9A 3UKHA 4C3XA 3QSSA 3KPFA 4Y4MA 1E1MA 3CGDA 3EAOA 2APGA 4APNA 2YAUA 3UTHA 2WPEA 2YM1A 1XPQA 2WS3A 1KSSA 4GF7A 1PBBA 4NZHA 5CQFA 3CNJA 4OCGA 1TYPA 3T14A 5HHFA 2YLXA 2R45A 2XLSA 5CKUA 3NK0X 2BXSA 3QSMA 3AEEA 1Y56A 5KMQA 5HXIA 2FJDA 3UOVA 5BVAA 3P4QA 2GRTA 2IIDA 2B7SA 3UTGA 1XDIA 5JRBA 3CNTA 2V3AA 2BC1A 2VRLA 2JK6A 3GYJA 2XVHA 2IVDA 1NHPA 1O95A 1PJ5A 1D5TA 4H50A 2DKIA 3KPKA 4JY2A 3AE9A 3CPJG 2BS4A 4J34A 3VQRA 2FBWA 3KD9A 4UP3A 4DSGA 4K2XA 2Y6RA 3EANA 1DOEA 4IA5A 3Q6JA 4EQXA 1E1KA 2BK3A 2JB2A 3URHA 3AE6A 1CJ3A 3NTAA 1BF3A 4RG4A 4DSHA 5KMPA 1GSNA 2C73A 2GAHB 4WCTA 2VVLG 4REKA 4A6NB 4CNJA 2GQFA 3AD8B 4D04A 4C5OA 4A5LA 2PYXA 1ZK7A 2C75A 4IA6A 4CBQA 5C3JA 3GD3A 3QFBA 2R0GA 3HYVA 4HB9A 4X9MA 2ZZ0A 2R9ZA 3HYXA 1ONFA 1FOHA 1IUUA 2QA1A 2Y6QA 3HYWA 4OPCA 4C77A 2X8CA 4EIQA 4AT2A 1YQZA 1FEBA 3FBSA 4OVIA 3AECA 1B5QA 3M13A 3C96A 4PAAA 1NEKA 3BI2A 4O5UA 2I0ZA 3K7TA 2Z5YA 1FL2A 4I59A 2WOIA 4NEWA 1JRYA 4NEVA 3EF6A 4H4PA 5HY5A 1D4DA 1NHSA 2XVIA 1KNRA 3NYEA 1TDFA 3RP7A 4TLZA 3D1CA 3RHAA 5J7XA 4U2LA 3DK9A 4B63A 1LVLA 4EMIA 5LV9A 3GRTA 2BRAA 5KVIA 1NPXA 3DJDA 4UDRA 1LQTA 1Y0PA 3T2ZA 2YG3A 3DK4A 2A89A 3V3OA 2YLWA 2C72A 2DKHA 3LB8A 3NN0X 2ACZA 2GR2A 2V6OA 5BRTA 4GDPA 3SM8A 2X8GA 3S5WA 4H2PA 1DJQA 4CCRA 1L9CA 3GDPA 4B64A 1UKVG 2WETA 3DA1A 5KNLA 3CGBA 3UKKA 3K7MX 4H7UA 1GRAA 3NRNA 1D7LA 3UKAA 4N9XA 4YSHA 1PJ6A 3SXIA 2X99A 2ZZBA 1BGJA 2R4JA 4A7AA 5FS8A 1JEHA 2C76A 3KKJA 3DK8A 1MXTA 2O9ZA 4P9SA 1GRGA 1OJTA 2A8XA 1H6VA 1F8RA 4A99A 3AE5A 1VG9A 1GXFA 2YLTA 2EQ9A 2BYBA 4J57A 3NNEA 3GSIA 1REOA 3K7QX 4ICYA 1ZOYA 2EQ8A 5EB4A 4Z43A 3OC4A 4A79A 1JNZA 4U8NA 2AAQA 1BZLA 3UOYA 1CC4A 2E1MA 3II4A 2WDVA 4JY3A 3BI4A 5DBJA 1KSUA 2C4CA 2F5ZA 1Q9IA 3UP4A 3SQPA 4IVMB 2Q7VA 4BK3A 1FEAA 4KPRA 1IUTA 2X8HA 1P2EA 1RYIA 3NN6X 4YTPA 5KOWA 1LV0A 3D9XA 4G9KA 2JBVA 2VQBA 2BS3A 2GR1A 2YWLA 3F8PA 3NGCX 4U8KA 3NYCA 1W4XA 3UCLA 5GSNA 2WQYA 2B9XA 3M12A 1B8SA 2V5ZA 1JRXA 2BXRA 3PS9A 3GWDA 4K5SA 4BURA 3P4PA 1NHQA 1Q1WA 4JNAA 4U8JA 4B69A 1PXAA 3DMEA 4ZN0A 5JCKA 4YKFA 1ZX9A 2Q6UA 3SX6A 4JDRA 4FK1A 2ZZCA 1H7XA 3Q9TA 4H4VA 4II3A 4ADWA 1CJCA 2XVFA 3AWIA 4GCMA 2PHHA 2XFOA 2YVGA 3RP8A 1ZOVA 2BK5A 3BNUA 5TR3A 1Z6LA 2XFPA 4A9WA 4BK1A 1K0LA 4YXDA 4U2TA 1GT8A 4J31A 5U1OA 3DH9A 5KOXA 1KN0A 3ALMA 3EPTA 3REDA 2GH5A 5JCNA 2YR4A 2WP9A 2XDOA 3COXA 4AP3A 1H83A 4G73A 4DNAA 4RG3A 1DOCA 1GEUA 1Y56B 3CPHG 5EB5A 4J56A 2XLRA 3BI5A 1KFYA 1PXCA 1TDNA 2C3DA 3O0HA 1PBDA 3B6DA 3QSEA 2V60A 2BCGG 1ZY8A 2YR6A 4H2QA 3AYIA 1GPEA 4YWOA 1IUXA 3DJEA 4MJWA 1NDAA 3AYLA 3C4NA 4H4WA 2OLOA 4XWZA 4Z26A 5KXJA 4K5RA 1DXLA 2OAMA 1CHUA 3R9UA 1D7YA 3GDNA 3AE2A 1L0VA 3GRSA 2YG6A 3AXBA 2GMJA 3K30A 1ZMDA 4U8OA 2JKCA 1IUVA 4GUVA 4CNKA 4GR1A 4K7ZA 4H4SA 4K8DA 3IC9A 1K0IA 1LJ1A 1PBEA 4H4YA 1FCDA 1MO9A 1EL9A 1ZP0A 4Z44A 3SFDA 4AT0A 1B37A 3SZFA 4AOXA 1H86A 2CFYA 5IQ1A 4CRTA 1KNPA 2FJAA 3UP5A 3VRAA 2RGOA 3LXDA 1H82A 2YLSA 4B66A 5KVHA 1IUSA 1O94A 2NPXA 5C2TA 1DNCA 2EQ7A 2VOUA 3GWFA 2RABA 3LADA 2WHDA 4EM4A 4C74A 2GEWA 2VZ2A 4TM4A 1GNDA 5EOWA 3AD9B 4J2WA 2Q0KA 3QFAA 4XWRA 3CNPA 1D4CA 1E6EA 3GMBA 3H8LA 1AOGA 1E7PA 3ICTA 3T0KA 4G6GA 3AE8A 2C70A 1E1NA 2VVLA 1CBOA 2XFUA 3F8RA 4IVOB 1JU2A 2R0PA 2TMDA 4JN9A 4EMJA 1BKWA 1M64A 1OJ9A 3ATQA 1M6IA 3AE3A 1TYTA 3NYFA 1E1LA 3L1RA 1PS9A 4H4TA 1ZDLA 2YVFA 4H4RA 1QO8A 1GTHA 4ZCCA 3ISHA 1CC6A 2YG7A 3V76A 2IVEA 1DOBA 2FJBA 2XLUA 2YR5A 5IQ4A 3ZYXA 2QCUA 2OALA 2X50A 1OJCA 4AOSA 4TM0A 2GB0A 4NTCA 3CGCA 1LPFA 1NHRA 4LA1A 3H8IA 4UDQA 1PBFA 1XHCA 1RP0A 2YQUA 1H7WA 2WP6A 3H4KA 3UOXA 1SEZA 2BCPA 1GOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8D A;  4X4J A;  3OZ2 A;  1YY5 A;  1S3B A;  3LZX A;  2UZZ A;  4B68 A;  1YQ4 A;  5GRT A;  1P2H A;  1IJH A;  2JB1 A;  4J36 A;  1TDE A;  1ELI A;  3LJP A;  2V61 A;  1VQW A;  1NG3 A;  2XVJ A;  4H4Z A;  1F8S A;  3ICS A;  5FS6 A;  4J33 A;  4OPG A;  2QA2 A;  3CPI G;  3DGH A;  1GES A;  1O5W A;  2C65 A;  1V59 A;  3C4A A;  2J3N A;  4OPI A;  2BAB A;  2AR8 A;  2RGH A;  3P1W A;  3AEG A;  2CUL A;  3S61 A;  1E39 A;  4X9N A;  2VVM A;  1KDG A;  3P4R A;  3NT6 A;  1XAN A;  4GDE A;  4XXG A;  2XVE A;  3AEA A;  4YSX A;  4USQ A;  1N4U A;  3D8X A;  2TPR A;  2WU2 A;  2X3N A;  3UKL A;  2WU5 A;  2ARD A;  3I3L A;  2E4G A;  1NAA A;  1CJ4 A;  1S2Y A;  4YSZ A;  4YTN A;  3AE1 A;  2AQJ A;  2VRM A;  3AED A;  3AE7 A;  3NKS A;  2YLR A;  2Z5X A;  2XCG A;  5M0Z A;  2GQW A;  1CL0 A;  4EMW A;  3P4S A;  4JQ9 A;  2XLT A;  4OPU A;  1JNR A;  4O5Q A;  3CGE A;  4JNQ A;  1DJN A;  3NHO X;  2WES A;  4Y4N A;  3DGZ A;  4PAB A;  3NG7 X;  1NEN A;  4KX6 A;  3FIM B;  4AP1 A;  1GV4 A;  2B7R A;  3KU9 A;  5J60 A;  2GVC A;  4Z25 A;  2VQ7 A;  1EL7 A;  1OJA A;  2WOV A;  3G5S A;  1N4W A;  3DJJ A;  1LTX R;  1GRF A;  3VRD B;  4YKG A;  1TDO A;  3QJ4 A;  4D03 A;  3BHK A;  4E0V A;  4LII A;  2GR0 A;  5EBK A;  4H4X A;  1GTE A;  2E5V A;  3AEF A;  3ZDN A;  4NTD A;  1TRB A;  2RGJ A;  1GRE A;  1YQ3 A;  2YLZ A;  2XFN A;  2WBA A;  4B67 A;  4CY6 A;  4H4U A;  2GAG B;  3G5R A;  5BUL A;  2Q0L A;  3AB1 A;  3NK2 X;  1CJ2 A;  1PJ7 A;  1GRB A;  5JCI A;  1B4V A;  2C7G A;  3IHM A;  3PO7 A;  5KWF A;  4YT0 A;  4Z2T A;  3FMW A;  1F8W A;  5ER0 A;  5FS9 A;  3GMC A;  3NK1 X;  4FDC B;  1GET A;  1PXB A;  1GER A;  5FMH A;  1N1P A;  2WDR A;  3AE4 A;  3ITJ A;  4Z24 A;  1PHH A;  3UKP A;  4U8I A;  2C3C A;  3SFE A;  4A6N A;  4YSY A;  2BS2 A;  3NIX A;  4USR A;  3UKF A;  2C67 A;  2WPF A;  1TDK A;  5U63 A;  2R46 A;  4BJZ A;  4WX1 A;  3QVP A;  4ZCD A;  4CY8 A;  4U8M A;  3CNS A;  3ICR A;  1ZMC A;  4M52 A;  4EQW A;  2GMH A;  3LOV A;  4EM3 A;  4TLX A;  2EQ6 A;  1QLB A;  3CN8 A;  3UKQ A;  4TM3 A;  2BC0 A;  1QJD A;  2CDU A;  4U8L A;  3KLJ A;  1S3E A;  3SGL A;  3KA7 A;  4EQR A;  1EBD A;  1RSG A;  3LZW A;  3RP6 A;  4IV9 A;  1VG0 A;  2XLP A;  1ZKQ A;  2W0H A;  2B9W A;  4K22 A;  1GRT A;  4FX9 A;  1L9D A;  3ALJ A;  3I6D A;  3V3N A;  2A87 A;  5U25 A;  1YKJ A;  3NLC A;  1X31 B;  5FS7 A;  2B76 A;  1H81 A;  3BNM A;  4BJY A;  3GD4 A;  1N4V A;  2YM2 A;  4OPL A;  3E1T A;  4NTE A;  4Y4L A;  4BV6 A;  1GAL A;  3ALL A;  4B65 A;  3AD7 B;  3NTD A;  1K0J A;  2GV8 A;  3PVC A;  3WE0 A;  5BUK A;  2GF3 A;  3T37 A;  1VDC A;  1K4Q A;  2WPC A;  1JRZ A;  2YG4 A;  1PBC A;  2BAC A;  1FEC A;  5M10 A;  4BK2 A;  2OA1 A;  1H84 A;  3ADA B;  1KF6 A;  2H88 A;  2OLN A;  3VR9 A;  2YG5 A;  2YVJ A;  2WOW A;  2V3B A;  3G5Q A;  4H2R A;  1BWC A;  3GYI A;  3KVE A;  2XYO A;  4U8P A;  4Z2R A;  3BHF A;  4H2N A;  1EL5 A;  5L46 A;  2XFQ A;  4EQS A;  2C66 A;  4I58 A;  4A65 A;  2ZBW A;  1Q1R A;  1GRH A;  2HQM A;  1MOK A;  3AEB A;  3QVR A;  1CF3 A;  3VR8 A;  1VRQ B;  5HYM A;  1CC2 A;  4UDP A;  1S2Q A;  4H4Q A;  4LU6 A;  2R0C A;  4C3Y A;  1IUW A;  1L9E A;  3IWA A;  3ATR A;  4ECH A;  4B1B A;  1DOD A;  2JB3 A;  2WP5 A;  3M0O A;  4DGK A;  1EL8 A;  3UTF A;  3B3R A;  1NG4 A;  2R4E A;  3JSK A;  1D4E A;  1PDH A;  4TM1 A;  3FG2 P;  4OPT A;  4GRT A;  4CCQ A;  3IHG A;  4HA6 A;  2NVK X;  3ABV A;  1JOA A;  2JAE A;  5IPY A;  2GR3 A;  5JCL A;  4U2S A;  1F6M A;  4Z2U A;  2QAE A;  3CTY A;  3AYJ A;  3NH3 X;  3FPZ A;  2WEU A;  2C64 A;  2FJE A;  2WDQ A;  3DJG X;  1OJD A;  3CIR A;  3CND A;  3VRB A;  5JCM A;  4EIP A;  3IF9 A;  3HZL A;  4OPD A;  4FK1 C;  3P9U A;  3RNM A;  5KRQ A;  2CVJ A;  1HYU A;  3UTE A;  1F3P A;  1COY A;  1LQU A;  1PN0 A;  2H89 A;  2B9Y A;  4RSL A;  3L8K A;  3UOZ A;  2BK4 A;  1BGN A;  4YTM A;  2BA9 A;  3UKH A;  4C3X A;  3QSS A;  3KPF A;  4Y4M A;  1E1M A;  3CGD A;  3EAO A;  2APG A;  4APN A;  2YAU A;  3UTH A;  2WPE A;  2YM1 A;  1XPQ A;  2WS3 A;  1KSS A;  4GF7 A;  1PBB A;  4NZH A;  5CQF A;  3CNJ A;  4OCG A;  1TYP A;  5HHF A;  2YLX A;  2R45 A;  2XLS A;  5CKU A;  3NK0 X;  2BXS A;  3QSM A;  3AEE A;  1Y56 A;  5HXI A;  2FJD A;  3UOV A;  5BVA A;  3P4Q A;  2GRT A;  2IID A;  2B7S A;  3UTG A;  1XDI A;  3CNT A;  2V3A A;  2BC1 A;  2VRL A;  2JK6 A;  3GYJ A;  2XVH A;  2IVD A;  1NHP A;  1O95 A;  1PJ5 A;  1D5T A;  4H50 A;  2DKI A;  4JY2 A;  3AE9 A;  3CPJ G;  2BS4 A;  4J34 A;  3VQR A;  2FBW A;  3KD9 A;  4UP3 A;  4DSG A;  4K2X A;  2Y6R A;  3EAN A;  1DOE A;  4IA5 A;  3Q6J A;  4EQX A;  1E1K A;  2BK3 A;  2JB2 A;  3URH A;  3AE6 A;  1CJ3 A;  3NTA A;  1BF3 A;  4RG4 A;  4DSH A;  1GSN A;  2C73 A;  2GAH B;  4WCT A;  2VVL G;  4REK A;  4A6N B;  4CNJ A;  2GQF A;  3AD8 B;  4D04 A;  4C5O A;  4A5L A;  2PYX A;  1ZK7 A;  2C75 A;  4IA6 A;  4CBQ A;  5C3J A;  3GD3 A;  3QFB A;  2R0G A;  4HB9 A;  4X9M A;  2ZZ0 A;  2R9Z A;  1ONF A;  1FOH A;  1IUU A;  2QA1 A;  2Y6Q A;  4OPC A;  4C77 A;  2X8C A;  4EIQ A;  4AT2 A;  1YQZ A;  1FEB A;  3FBS A;  4OVI A;  3AEC A;  1B5Q A;  3M13 A;  3C96 A;  4PAA A;  1NEK A;  3BI2 A;  4O5U A;  2I0Z A;  3K7T A;  2Z5Y A;  1FL2 A;  4I59 A;  2WOI A;  4NEW A;  1JRY A;  4NEV A;  3EF6 A;  4H4P A;  5HY5 A;  1D4D A;  1NHS A;  2XVI A;  1KNR A;  3NYE A;  1TDF A;  3RP7 A;  4TLZ A;  3D1C A;  3RHA A;  5J7X A;  4U2L A;  3DK9 A;  4B63 A;  1LVL A;  4EMI A;  5LV9 A;  3GRT A;  5KVI A;  1NPX A;  3DJD A;  4UDR A;  1LQT A;  1Y0P A;  2YG3 A;  3DK4 A;  2A89 A;  3V3O A;  2YLW A;  2C72 A;  2DKH A;  3LB8 A;  3NN0 X;  2ACZ A;  2GR2 A;  2V6O A;  5BRT A;  4GDP A;  3SM8 A;  2X8G A;  3S5W A;  4H2P A;  1DJQ A;  4CCR A;  1L9C A;  3GDP A;  4B64 A;  1UKV G;  2WET A;  3DA1 A;  3CGB A;  3UKK A;  3K7M X;  4H7U A;  1GRA A;  3NRN A;  1D7L A;  3UKA A;  4N9X A;  4YSH A;  1PJ6 A;  2X99 A;  2ZZB A;  1BGJ A;  2R4J A;  4A7A A;  5FS8 A;  1JEH A;  2C76 A;  3KKJ A;  3DK8 A;  1MXT A;  2O9Z A;  4P9S A;  1GRG A;  1OJT A;  2A8X A;  1H6V A;  1F8R A;  4A99 A;  3AE5 A;  1VG9 A;  1GXF A;  2YLT A;  2EQ9 A;  2BYB A;  4J57 A;  3NNE A;  3GSI A;  1REO A;  3K7Q X;  4ICY A;  1ZOY A;  2EQ8 A;  5EB4 A;  4Z43 A;  3OC4 A;  4A79 A;  1JNZ A;  4U8N A;  2AAQ A;  1BZL A;  3UOY A;  1CC4 A;  2E1M A;  3II4 A;  2WDV A;  4JY3 A;  3BI4 A;  5DBJ A;  1KSU A;  2F5Z A;  1Q9I A;  3UP4 A;  3SQP A;  4IVM B;  2Q7V A;  4BK3 A;  1FEA A;  4KPR A;  1IUT A;  2X8H A;  1P2E A;  1RYI A;  3NN6 X;  4YTP A;  5KOW A;  1LV0 A;  2JBV A;  2VQB A;  2BS3 A;  2GR1 A;  2YWL A;  3F8P A;  3NGC X;  4U8K A;  3NYC A;  1W4X A;  3UCL A;  5GSN A;  2WQY A;  2B9X A;  3M12 A;  1B8S A;  2V5Z A;  1JRX A;  2BXR A;  3PS9 A;  3GWD A;  4K5S A;  4BUR A;  3P4P A;  1NHQ A;  1Q1W A;  4JNA A;  4U8J A;  4B69 A;  1PXA A;  3DME A;  4ZN0 A;  5JCK A;  4YKF A;  1ZX9 A;  2Q6U A;  4JDR A;  4FK1 A;  2ZZC A;  1H7X A;  3Q9T A;  4H4V A;  4ADW A;  1CJC A;  2XVF A;  3AWI A;  4GCM A;  2PHH A;  2XFO A;  2YVG A;  3RP8 A;  1ZOV A;  2BK5 A;  3BNU A;  5TR3 A;  1Z6L A;  2XFP A;  4A9W A;  4BK1 A;  1K0L A;  4YXD A;  4U2T A;  1GT8 A;  4J31 A;  5U1O A;  3DH9 A;  5KOX A;  3ALM A;  3EPT A;  3RED A;  2GH5 A;  5JCN A;  2YR4 A;  2WP9 A;  2XDO A;  3COX A;  4AP3 A;  1H83 A;  4RG3 A;  4DNA A;  1DOC A;  1GEU A;  1Y56 B;  3CPH G;  5EB5 A;  4J56 A;  2XLR A;  3BI5 A;  1KFY A;  1PXC A;  1TDN A;  2C3D A;  3O0H A;  1PBD A;  3B6D A;  3QSE A;  2V60 A;  2BCG G;  1ZY8 A;  2YR6 A;  4H2Q A;  3AYI A;  1GPE A;  4YWO A;  1IUX A;  3DJE A;  4MJW A;  1NDA A;  3AYL A;  3C4N A;  4H4W A;  2OLO A;  4XWZ A;  4Z26 A;  5KXJ A;  4K5R A;  1DXL A;  2OAM A;  1CHU A;  3R9U A;  1D7Y A;  3GDN A;  3AE2 A;  1L0V A;  3GRS A;  2YG6 A;  3AXB A;  2GMJ A;  3K30 A;  1ZMD A;  4U8O A;  2JKC A;  1IUV A;  4GUV A;  4CNK A;  4GR1 A;  4K7Z A;  1LJ1 A;  4H4S A;  4K8D A;  3IC9 A;  1K0I A;  1PBE A;  4H4Y A;  1FCD A;  1MO9 A;  1EL9 A;  1ZP0 A;  4Z44 A;  3SFD A;  4AT0 A;  1B37 A;  4AOX A;  1H86 A;  2CFY A;  5IQ1 A;  4CRT A;  1KNP A;  2FJA A;  3UP5 A;  3VRA A;  2RGO A;  3LXD A;  1H82 A;  2YLS A;  4B66 A;  5KVH A;  1IUS A;  1O94 A;  2NPX A;  5C2T A;  1DNC A;  2EQ7 A;  2VOU A;  3GWF A;  2RAB A;  3LAD A;  2WHD A;  4EM4 A;  4C74 A;  2GEW A;  2VZ2 A;  4TM4 A;  1GND A;  5EOW A;  3AD9 B;  4J2W A;  2Q0K A;  3QFA A;  4XWR A;  3CNP A;  1D4C A;  1E6E A;  3GMB A;  3H8L A;  1AOG A;  1E7P A;  3ICT A;  3AE8 A;  2C70 A;  1E1N A;  2VVL A;  1CBO A;  2XFU A;  3F8R A;  4IVO B;  1JU2 A;  2R0P A;  2TMD A;  4JN9 A;  4EMJ A;  1BKW A;  1M64 A;  1OJ9 A;  3ATQ A;  1M6I A;  3AE3 A;  1TYT A;  3NYF A;  1E1L A;  3L1R A;  1PS9 A;  4H4T A;  1ZDL A;  2YVF A;  4H4R A;  1QO8 A;  1GTH A;  4ZCC A;  3ISH A;  1CC6 A;  2YG7 A;  3V76 A;  2IVE A;  1DOB A;  2FJB A;  2XLU A;  2YR5 A;  5IQ4 A;  3ZYX A;  2QCU A;  2OAL A;  2X50 A;  1OJC A;  4AOS A;  4TM0 A;  2GB0 A;  4NTC A;  3CGC A;  1LPF A;  1NHR A;  4LA1 A;  3H8I A;  4UDQ A;  1PBF A;  1XHC A;  1RP0 A;  2YQU A;  1H7W A;  2WP6 A;  3H4K A;  3UOX A;  1SEZ A;  2BCP A;  1GOS A; 
#chains in the Genus database with same CATH topology
 2UZZ A;  1P2H A;  3LJP A;  3JVA A;  3CAW A;  2XVJ A;  4H4Z A;  3ICS A;  2QA2 A;  2ONE A;  3DGH A;  4OPI A;  2GGG A;  2CUL A;  4GDE A;  4YSX A;  1N4U A;  2WU2 A;  2MNR A;  1NAA A;  1S2Y A;  4YTN A;  3AE1 A;  3AED A;  2OKT A;  3AN1 A;  2XCG A;  3NXL A;  1JNR A;  4MKS A;  4JNQ A;  4Y4N A;  4PAB A;  3TJI A;  2PP3 A;  2VQ7 A;  3SYI A;  1OJA A;  2WOV A;  4YKG A;  3QJ4 A;  3RRA A;  1YQ3 A;  3G5R A;  6ENL A;  3AB1 A;  1CJ2 A;  2C7G A;  3VA8 A;  3NRZ B;  4Z2T A;  1W6T A;  1F8W A;  5EU9 A;  3NK1 X;  1N1P A;  3AE4 A;  4J1O A;  4E0V A;  2RDX A;  2GGJ A;  3ZLH A;  4YSY A;  4JHM A;  3NIX A;  4Z17 A;  2WPF A;  4DXK A;  3VFC A;  3QVP A;  4ZCD A;  4CY8 A;  3ICR A;  2EQ6 A;  4NWZ A;  1EBD A;  1RSG A;  4H83 A;  3LZW A;  2XH2 A;  4JN7 A;  2W0H A;  2B9W A;  1GRT A;  5FS7 A;  3OTR A;  3OZY A;  1H81 A;  4BV6 A;  3ALL A;  4B65 A;  1K0J A;  2GV8 A;  5BUK A;  1K4Q A;  1JRZ A;  1PBC A;  3DEQ A;  3ADA B;  1KF6 A;  2YG5 A;  2V3B A;  1V97 A;  2OFJ A;  2W55 A;  4DHG A;  1EBH A;  2XFQ A;  3AEB A;  3GYX A;  1CF3 A;  2XH4 A;  4LU6 A;  1IUW A;  3IWA A;  3Q4D A;  4ECH A;  3BOX A;  2JB3 A;  3B3R A;  1PDH A;  3CT2 A;  2DW7 A;  3FG2 P;  1NU5 A;  2PTX A;  4E6M A;  5JCL A;  3PK7 A;  4II2 A;  3FPZ A;  2WEU A;  1OJD A;  4TVW A;  2PU0 A;  2QJJ A;  1SB3 B;  3CND A;  2HXT A;  5JCM A;  3VRB A;  3IF9 A;  5KRQ A;  1COY A;  4RSL A;  1LQU A;  2P88 A;  3SY4 A;  7ENL A;  1BGN A;  4YTM A;  3QSS A;  2APG A;  2YM1 A;  3H8A A;  1KSS A;  3RIT A;  4NZH A;  4YWS A;  4KEM A;  1N63 C;  3NK0 X;  3QSM A;  1Y56 A;  5KMQ A;  2IID A;  5JRB A;  3GYJ A;  3ZVH A;  2XVH A;  1FIQ B;  1D5T A;  2DKI A;  4JY2 A;  3KPK A;  3RR1 A;  3VCC A;  2BS4 A;  4DSG A;  4RG4 A;  2OZT A;  5KMP A;  1BF3 A;  3S47 A;  1GSN A;  2GAH B;  4C5O A;  5C3J A;  3U9I A;  4X9M A;  3FCP A;  4EIQ A;  3NVY B;  1YQZ A;  3AEC A;  4K2S A;  4PAA A;  1NEK A;  3OP2 A;  3RGT A;  5HY5 A;  4H4P A;  1TDF A;  3TQP A;  4TLZ A;  3RHA A;  1YEY A;  5LV9 A;  2BRA A;  3DJD A;  1LQT A;  1Y0P A;  3T2Z A;  2YG3 A;  2XGZ A;  2C72 A;  1N62 C;  3LB8 A;  2ACZ A;  5BRT A;  3DGB A;  4M0X A;  3SM8 A;  3S5W A;  2GL5 A;  4ZCW A;  4H2P A;  1L9C A;  3GDP A;  3CGB A;  2PSN A;  3DG7 A;  3NRN A;  1P48 A;  2QDD A;  1N61 C;  3V5C A;  4YSH A;  1PJ6 A;  3SXI A;  1BGJ A;  3DK8 A;  2PTY A;  3TTE A;  2A8X A;  1VG9 A;  2BYB A;  3NNE A;  3K7Q X;  4A79 A;  1JNZ A;  4U8N A;  3UOY A;  2E1M A;  2WDV A;  4JY3 A;  3EUB 3;  3BI4 A;  1KSU A;  1FEA A;  1RYI A;  3MWC A;  1LV0 A;  3NGC X;  2W54 A;  1BKH A;  1B8S A;  3TCS A;  4K5S A;  4BUR A;  1Q1W A;  3DME A;  2HZG A;  3ES8 A;  4IP5 A;  4ROP A;  1EC8 A;  2BK5 A;  3BNU A;  4A9W A;  1K0L A;  4YXD A;  4U2T A;  4IL2 A;  4GGB A;  3RED A;  5JCN A;  2YR4 A;  4AP3 A;  3BSM A;  4G73 A;  4DNA A;  5G5G B;  3CPH G;  3NZG A;  2XLR A;  2YR6 A;  4H2Q A;  1TKK A;  4MJW A;  4Z26 A;  5KXJ A;  4XWZ A;  1E9I A;  3GDN A;  2YG6 A;  4ENL A;  4K7Z A;  3IC9 A;  3SFD A;  1B37 A;  4AOX A;  3PWG A;  5IQ1 A;  3UP5 A;  1P43 A;  1O94 A;  5C2T A;  1DNC A;  2EQ7 A;  2VOU A;  3GWF A;  2RAB A;  3LAD A;  2ZAD A;  1GND A;  3AD9 B;  4J2W A;  3QFA A;  3GMB A;  3H8L A;  1N5W C;  2P3Z A;  2VVL A;  3F8R A;  1JU2 A;  1JRP A;  1SJB A;  5FJU A;  1TYT A;  3NYF A;  3UGV A;  4H4T A;  4IP4 A;  1SJD A;  2IVE A;  2OAL A;  1VQZ A;  4AOS A;  4TM0 A;  4NTC A;  4UDQ A;  1NHR A;  4LA1 A;  3H8I A;  4G8T A;  3VDG A;  2YQU A;  1SJC A;  3H4K A;  3UOX A;  4X4J A;  3OZ2 A;  1YY5 A;  1S3B A;  1YQ4 A;  4HCD A;  2DW6 A;  4A35 A;  1IJH A;  1TDE A;  1VQW A;  1F8S A;  3UJS A;  1O5W A;  1V59 A;  2J3N A;  2BAB A;  2AR8 A;  3AEG A;  3S61 A;  1E39 A;  3R10 A;  3UKL A;  1S7M A;  2WU5 A;  4YSZ A;  3FV9 A;  3NKS A;  2AKM A;  3MQT A;  2MUC A;  2GQW A;  1CL0 A;  3P4S A;  4OPU A;  4O5Q A;  3NHO X;  4G6H A;  1NEN A;  4KX6 A;  3FIM B;  2B7R A;  2GVC A;  4Z25 A;  4E4F A;  1TE6 A;  3PG6 A;  1N4W A;  1GRF A;  3ENL A;  4D03 A;  4LII A;  2GR0 A;  5EBK A;  4H4X A;  2RGJ A;  4HCL A;  3T2Y A;  2WBA A;  3T31 A;  2GAG B;  4F4R A;  2Q0L A;  3NK2 X;  3IHM A;  3GMC A;  5ER0 A;  1GET A;  3UCD A;  5FMH A;  3SFE A;  4HPN A;  1STZ A;  2BS2 A;  4GAP A;  2C67 A;  4BJZ A;  2PTW A;  3LOV A;  3CN8 A;  3UKQ A;  4U8L A;  3KLJ A;  3A7A A;  3KA7 A;  1ZKQ A;  4FX9 A;  1L9D A;  3ALJ A;  3NLC A;  3MKC A;  3GD4 A;  3ZVI A;  1N4V A;  2YM2 A;  3E1T A;  4Y4L A;  2OLA A;  4ZA0 A;  2GF3 A;  1VDC A;  2WPC A;  1FEC A;  3SN1 A;  1EL5 A;  3HPF A;  5IDZ A;  3OZM A;  2GSH A;  2C66 A;  4I58 A;  1Q1R A;  3QVR A;  2AL2 A;  3SZW A;  2R0C A;  3R07 C;  3B97 A;  3UXK A;  1NG4 A;  1D4E A;  3HW2 A;  4GRT A;  3IHG A;  4KT2 A;  4HA6 A;  2NVK X;  1JOA A;  2GR3 A;  4DWD A;  1JDF A;  1F6M A;  2QAE A;  3NH3 X;  4K1W A;  2QGY A;  4OPD A;  3QTP A;  3P9U A;  1PN0 A;  2B9Y A;  3UOZ A;  3L8K A;  2BA9 A;  3UKH A;  3KPF A;  1XPQ A;  1PBB A;  3T14 A;  5HHF A;  4EWJ A;  5HXI A;  2XSX A;  3UOV A;  3P4Q A;  3CYJ A;  3BJS A;  1XDI A;  3CNT A;  2BC1 A;  2VRL A;  2IVD A;  2NQL A;  3CPJ G;  2FBW A;  3P93 A;  3EAN A;  1DOE A;  4IA5 A;  3Q6J A;  2OVL A;  2BK3 A;  1E1K A;  1CJ3 A;  3NTA A;  2C73 A;  4WCT A;  4A6N B;  2VVL G;  4CNJ A;  2GQF A;  4A5L A;  3IJI A;  2PYX A;  2R0G A;  4HB9 A;  1FOH A;  1IUU A;  2QA1 A;  3TJ4 A;  4C77 A;  2X8C A;  3K1G A;  4HNC A;  1FEB A;  3KUM A;  4OVI A;  1B5Q A;  4I59 A;  1FL2 A;  2WOI A;  4NEW A;  3N6J A;  3EF6 A;  1D4D A;  2XVI A;  1KNR A;  3NYE A;  4HCH A;  3QPE A;  4B63 A;  3TOY A;  2QJM A;  1R0M A;  2A89 A;  3V3O A;  2YLW A;  3AM9 A;  3NN0 X;  2V6O A;  4GDP A;  1NEL A;  2X8G A;  4A3R A;  1DJQ A;  3ETR B;  3DFH A;  1GRA A;  2PTZ A;  2ZZB A;  3PFR A;  4A7A A;  3GC2 A;  4HNL A;  3ES7 A;  1OJT A;  1H6V A;  3AE5 A;  2EQ9 A;  3GSI A;  3FJ4 A;  1REO A;  2EQ8 A;  3OC4 A;  3S5S A;  1BZL A;  1CC4 A;  2F5Z A;  1Q9I A;  3SQP A;  3H7V A;  4BK3 A;  3NN6 X;  2X8H A;  1P2E A;  3GD6 A;  2VQB A;  4U8K A;  2YWL A;  5GSN A;  1JRX A;  4U8J A;  1PXA A;  4ZN0 A;  4YKF A;  1ZX9 A;  3SX6 A;  1H7X A;  3AWI A;  2XFO A;  1ZOV A;  1Z6L A;  4GFI A;  1GT8 A;  4J31 A;  5G5H B;  3TW9 A;  3DH9 A;  5KOX A;  1JPD X;  2WP9 A;  4RG3 A;  5EB5 A;  4J56 A;  1PBD A;  2V60 A;  4YWO A;  1IUX A;  3DJE A;  1NDA A;  3AYL A;  2OLO A;  1N60 C;  1D7Y A;  3STP A;  1L0V A;  2GMJ A;  4CNK A;  4A65 A;  1K0I A;  4H4Y A;  1FCD A;  4Z44 A;  4Z1Y A;  3R0U A;  1H86 A;  4CRT A;  2YLS A;  1WUE A;  4GYP A;  4C74 A;  3OPS A;  5EOW A;  1EC9 A;  4IL0 A;  3CNP A;  1E6E A;  1E7P A;  3T0K A;  1FFV C;  3AE8 A;  1E1N A;  2I5Q A;  1BKW A;  2XH0 A;  1M6I A;  5FJO A;  3MY9 A;  3L1R A;  1PS9 A;  3P0W A;  2YVF A;  1GTH A;  4ZCC A;  3VCN A;  3ISH A;  1CC6 A;  3DFY A;  2XLU A;  2X50 A;  3CGC A;  1RP0 A;  3GO2 A;  3F8D A;  1BQG A;  4E8G A;  2OPJ A;  3LZX A;  4B68 A;  3UXL A;  1ELI A;  5KMR A;  1NG3 A;  3QN3 A;  5FS6 A;  4OPG A;  3CPI G;  1GES A;  2W3S A;  3C4A A;  2RGH A;  4X9N A;  2VVM A;  1KDG A;  4XXG A;  3NT6 A;  1XAN A;  2XVE A;  3AEA A;  3D8X A;  2TPR A;  3IK4 A;  2X3N A;  3JW7 A;  2QVH A;  2E4G A;  1CJ4 A;  3P3B A;  5FJT A;  2VRM A;  3AE7 A;  2YLR A;  2Z5X A;  5M0Z A;  4EMW A;  3U4F A;  2XLT A;  2P8C A;  3CGE A;  1FHU A;  2WES A;  3NG7 X;  2OQH A;  4AP1 A;  5J60 A;  3SZ0 A;  1EL7 A;  1PDZ A;  3T4W A;  4G74 A;  1TDO A;  3BHK A;  1GTE A;  3AEF A;  4NTD A;  2E3T A;  2YLZ A;  2XFN A;  1VDV A;  4GME A;  4HYR A;  4CY6 A;  3V5F A;  1PJ7 A;  1B4V A;  2BRY A;  4FDC B;  1PXB A;  1IYX A;  1PHH A;  4U8I A;  4J3Z A;  4USR A;  3H70 A;  2R46 A;  4WX1 A;  4IHC A;  4U8M A;  3CNS A;  1H2I A;  3I6T A;  2PU1 A;  2HXU A;  4H19 A;  2FYM A;  4TM3 A;  1EBG A;  2BC0 A;  3L5O A;  1R6W A;  1S3E A;  3SGL A;  4EQR A;  1L8P A;  3SZC A;  2XLP A;  4G7F A;  4K22 A;  3I6D A;  3V3N A;  2A87 A;  5U25 A;  4NNJ A;  4GGH A;  3BNM A;  1GAL A;  3NVV B;  3NTD A;  3WE0 A;  3PVC A;  3T37 A;  2YG4 A;  2BAC A;  2OA1 A;  2H88 A;  3FVD A;  2OLN A;  2YVJ A;  3G5Q A;  1BWC A;  3GYI A;  3KVE A;  2XYO A;  4Z2R A;  1PDY A;  5L46 A;  3FYY A;  3HRD C;  2HQM A;  1S2Q A;  4H4Q A;  5KMS A;  3ATR A;  1DOD A;  4DGK A;  4TVY A;  3D46 A;  3UTF A;  4X2P A;  2R4E A;  4OPT A;  3ABV A;  5IPY A;  4U2S A;  4Z2U A;  3AYJ A;  3CXB A;  3DJG X;  3CIR A;  3HZL A;  4A6G A;  3RNM A;  2CVJ A;  2H89 A;  4IZG A;  2BK4 A;  4C3X A;  4Y4M A;  4APN A;  2YAU A;  3UTH A;  2WPE A;  2WS3 A;  5CQF A;  3CNJ A;  4OCG A;  1RVK A;  2YLX A;  5CKU A;  2BXS A;  3AEE A;  2FJD A;  1FFU C;  5BVA A;  2GRT A;  3IJQ A;  1NHP A;  2ZC8 A;  2PA6 A;  1O95 A;  1PJ5 A;  4H50 A;  4J34 A;  2O56 A;  3KD9 A;  4UP3 A;  2JB2 A;  3AE6 A;  2GDQ A;  3URH A;  3A7U A;  3EKG A;  3CK5 A;  4GYP C;  3GD3 A;  3QFB A;  2R9Z A;  2PGE A;  3HYW A;  4OPC A;  1ONE A;  2XH7 A;  3A7R A;  4AT2 A;  3FBS A;  3C96 A;  4O5U A;  4NEV A;  5J7X A;  2QJN A;  1LVL A;  4EMI A;  3MZN A;  3MUC A;  5KVI A;  1NPX A;  2POD A;  2DKH A;  2FKP A;  4CCR A;  4B64 A;  1UKV G;  2WET A;  5KNL A;  3K7M X;  4H7U A;  3UKA A;  5BOE A;  2X99 A;  3NVZ B;  2R4J A;  2C76 A;  1WUF A;  1F8R A;  1GXF A;  2YLT A;  4J57 A;  3UCC A;  4Z43 A;  1SJA A;  2AAQ A;  3UJF A;  3UP4 A;  4IVM B;  2Q7V A;  4KPR A;  2BS3 A;  3F8P A;  3NYC A;  3UCL A;  3M12 A;  3PS9 A;  3GWD A;  3UJE A;  3P4P A;  1NHQ A;  4JNA A;  1ELS A;  3DIP A;  3IJL A;  4FK1 A;  4H1Z A;  4II3 A;  4ADW A;  3CXO A;  2XVF A;  2OX4 A;  3RP8 A;  2YVG A;  5TR3 A;  2XFP A;  4BK1 A;  4KWS A;  5U1O A;  3UJR A;  3ALM A;  3EPT A;  3SQS A;  2GH5 A;  2XDO A;  1GEU A;  1RM6 B;  1Y56 B;  1KFY A;  2C3D A;  3O0H A;  1ZY8 A;  3AYI A;  1GPE A;  3ZVH B;  4H4W A;  4K5R A;  2GGH A;  3R9U A;  3GRS A;  3K30 A;  2JKC A;  4GUV A;  4H4S A;  1LJ1 A;  1MO9 A;  1EL9 A;  4M6U A;  3SZF A;  4JN8 A;  2CFY A;  2PGW A;  2PPG A;  1KNP A;  1XPY A;  3DER A;  4B66 A;  1IUS A;  2NPX A;  2WHD A;  2CHR A;  3ZLG A;  3SSZ A;  2GEW A;  4TM4 A;  3NVW B;  4XWR A;  1N5X A;  3R11 A;  1CBO A;  2XFU A;  4IVO B;  2TMD A;  4EMJ A;  3ATQ A;  3AE3 A;  1E1L A;  1ZDL A;  1QO8 A;  5J04 A;  2YG7 A;  1KKR A;  3V76 A;  2FJB A;  2YR5 A;  3T9P A;  5IQ4 A;  1ECQ A;  2QCU A;  2OZ8 A;  2GB0 A;  1PBF A;  1XHC A;  4E4U A;  2WP6 A;  2POZ A;  1SEZ A;  3RO6 A;  2BCP A;  4KPL A;  1JCT A;  5GRT A;  2JB1 A;  4J36 A;  2V61 A;  3T2K A;  4J33 A;  2OO6 A;  2C65 A;  3P1W A;  4GIR A;  3P4R A;  4FP1 A;  4USQ A;  2PMQ A;  2ARD A;  3I3L A;  2AQJ A;  4JQ9 A;  4GAV A;  1DJN A;  3DGZ A;  1EC7 A;  1GV4 A;  3KU9 A;  2P8B A;  3NFU A;  3G5S A;  3VC6 A;  4HN8 A;  4E5T A;  3DJJ A;  1LTX R;  3VRD B;  2HNE A;  2E5V A;  3ZDN A;  1F9C A;  1TRB A;  3TWA A;  1JRO A;  3UJ2 A;  2OZ3 A;  1GRE A;  3CMM A;  4B67 A;  5BUL A;  4H4U A;  2OQY A;  2AKZ A;  1GRB A;  5JCI A;  3OW1 A;  3Q45 A;  3I4K A;  3PO7 A;  5KWF A;  4YT0 A;  3FMW A;  5FS9 A;  1GER A;  2WDR A;  3UKP A;  4Z24 A;  3ITJ A;  4A6N A;  2C3C A;  3UKF A;  1TDK A;  5U63 A;  2QQ6 A;  4IT1 A;  1ZMC A;  4M52 A;  4EQW A;  2E5A A;  2GMH A;  4EM3 A;  1TZZ A;  4TLX A;  1QLB A;  1QJD A;  2CDU A;  3RP6 A;  4IV9 A;  1VG0 A;  3SN4 A;  1KKO A;  1FO4 A;  1YKJ A;  4DN1 A;  1X31 B;  3DES A;  4MGG A;  2B76 A;  4BJY A;  4OPL A;  4FI4 A;  4NTE A;  3V3W A;  3AD7 B;  3I6E A;  5M10 A;  4BK2 A;  1H84 A;  3VR9 A;  2WOW A;  4H2R A;  4U8P A;  3BHF A;  4H2N A;  3R1Z A;  4EQS A;  2ZBW A;  1GRH A;  1MOK A;  4K8G A;  2PP0 A;  3VR8 A;  3V4B A;  1VRQ B;  1CC2 A;  4UDP A;  5HYM A;  4C3Y A;  1L9E A;  4B1B A;  2WP5 A;  3M0O A;  5FJP A;  1EL8 A;  3JSK A;  4TM1 A;  4CCQ A;  2JAE A;  4H2H A;  3CTY A;  3R0K A;  2C64 A;  2FJE A;  2WDQ A;  3DDM A;  1KD0 A;  4EIP A;  4DYE A;  4FK1 C;  1WYG A;  3UTE A;  1HYU A;  1F3P A;  3SJN A;  3CGD A;  3EAO A;  1E1M A;  3DG6 A;  4GF7 A;  1TYP A;  2R45 A;  2XLS A;  3N6H A;  1MDR A;  3UTG A;  2B7S A;  2V3A A;  2JK6 A;  3AE9 A;  3VQR A;  4K2X A;  2Y6R A;  1OEP A;  3SN0 A;  2GGI A;  4EQX A;  4DSH A;  5BOF A;  4REK A;  4D04 A;  3AD8 B;  1X2G A;  1ZK7 A;  2C75 A;  4IA6 A;  4CBQ A;  3HYV A;  2ZZ0 A;  3HYX A;  1ONF A;  2Y6Q A;  3M13 A;  3BI2 A;  3NO1 A;  2I0Z A;  1FHV A;  2Z5Y A;  3K7T A;  2QDE A;  1JRY A;  2PS2 A;  1NHS A;  3RP7 A;  3PWI A;  3AMZ A;  3D1C A;  4U2L A;  3DK9 A;  2AL1 A;  3GRT A;  4UDR A;  1ZXI C;  3DK4 A;  3QLD A;  1MDL A;  3TWB A;  1KCZ A;  2GR2 A;  2PCE A;  5ENL A;  3DG3 A;  3CB3 A;  2W3R A;  3DA1 A;  3UKK A;  1D7L A;  4N9X A;  5FS8 A;  1JEH A;  3KKJ A;  1MXT A;  4P9S A;  2O9Z A;  3N4E A;  3GY1 A;  1GRG A;  2AL2 B;  4A99 A;  3SR6 B;  3R25 A;  4ICY A;  1ZOY A;  5EB4 A;  1MNS A;  1X2H A;  3II4 A;  5DBJ A;  3H12 A;  2C4C A;  3SBF A;  1IUT A;  4YTP A;  5KOW A;  3EEZ A;  3D9X A;  4G9K A;  2JBV A;  2GR1 A;  1W4X A;  1XS2 A;  2WQY A;  2B9X A;  2V5Z A;  2BXR A;  4B69 A;  5JCK A;  3QKE A;  2Q6U A;  4JDR A;  2ZZC A;  3Q9T A;  4H4V A;  1CJC A;  4GCM A;  2PHH A;  2P0I A;  1KN0 A;  3COX A;  1H83 A;  3VC5 A;  1DOC A;  1T3Q C;  3RCY A;  3BI5 A;  1PXC A;  1TDN A;  3B6D A;  3QSE A;  2BCG G;  3C4N A;  1DXL A;  3T8Q A;  2OAM A;  3ZLF A;  1CHU A;  2GGE A;  3AE2 A;  3AXB A;  1ZMD A;  4U8O A;  1IUV A;  4GR1 A;  4K8D A;  1PBE A;  1ZP0 A;  4AT0 A;  2FJA A;  3VRA A;  2RGO A;  1DTN A;  3LXD A;  1H82 A;  3JZU A;  1MRA A;  3B9J B;  5KVH A;  3NS1 B;  3D47 A;  3THU A;  4EM4 A;  2VZ2 A;  2Q0K A;  4DX3 A;  1D4C A;  1AOG A;  3T6C A;  3ICT A;  2PP1 A;  4GIS A;  4G6G A;  2C70 A;  2R0P A;  4JN9 A;  1M64 A;  1OJ9 A;  3MSY A;  3FXG A;  5FJR A;  4H4R A;  4ZOH B;  2OG9 A;  1MUC A;  1DOB A;  3N4F A;  3ZYX A;  4MMW A;  1OJC A;  1JPM A;  1LPF A;  1H7W A;  1GOS A; 
#chains in the Genus database with same CATH homology
 3F8D A;  4X4J A;  3OZ2 A;  1YY5 A;  1S3B A;  3LZX A;  2UZZ A;  4B68 A;  1YQ4 A;  5GRT A;  1P2H A;  1IJH A;  2JB1 A;  4J36 A;  1TDE A;  1ELI A;  3LJP A;  2V61 A;  5KMR A;  1VQW A;  1NG3 A;  2XVJ A;  4H4Z A;  1F8S A;  3ICS A;  5FS6 A;  4J33 A;  3T2K A;  4OPG A;  2QA2 A;  3CPI G;  3DGH A;  1GES A;  1O5W A;  2C65 A;  1V59 A;  3C4A A;  2J3N A;  4OPI A;  2BAB A;  2AR8 A;  2RGH A;  3P1W A;  3AEG A;  2CUL A;  3S61 A;  1E39 A;  4X9N A;  2VVM A;  1KDG A;  3P4R A;  3NT6 A;  1XAN A;  4GDE A;  4XXG A;  2XVE A;  3AEA A;  4YSX A;  4USQ A;  1N4U A;  3D8X A;  2TPR A;  2WU2 A;  2X3N A;  3UKL A;  1S7M A;  2ARD A;  2WU5 A;  2E4G A;  3I3L A;  1NAA A;  1CJ4 A;  1S2Y A;  4YSZ A;  4YTN A;  3AE1 A;  2AQJ A;  2VRM A;  3AED A;  3AE7 A;  3NKS A;  2YLR A;  2Z5X A;  2XCG A;  5M0Z A;  2GQW A;  1CL0 A;  4EMW A;  3P4S A;  4JQ9 A;  2XLT A;  4OPU A;  1JNR A;  4GAV A;  4O5Q A;  3CGE A;  4JNQ A;  1DJN A;  3NHO X;  2WES A;  4Y4N A;  3DGZ A;  4PAB A;  4G6H A;  3NG7 X;  1NEN A;  4KX6 A;  3FIM B;  4AP1 A;  1GV4 A;  2B7R A;  3KU9 A;  5J60 A;  2GVC A;  3SZ0 A;  4Z25 A;  2VQ7 A;  1EL7 A;  3SYI A;  1OJA A;  2WOV A;  3G5S A;  3PG6 A;  1N4W A;  3DJJ A;  1LTX R;  1GRF A;  3VRD B;  4YKG A;  4G74 A;  1TDO A;  3QJ4 A;  4D03 A;  3BHK A;  4E0V A;  4LII A;  2GR0 A;  5EBK A;  4H4X A;  1GTE A;  2E5V A;  3AEF A;  3ZDN A;  4NTD A;  1TRB A;  2RGJ A;  3CMM A;  1GRE A;  3T2Y A;  1YQ3 A;  2YLZ A;  2XFN A;  2WBA A;  3T31 A;  4B67 A;  4H4U A;  2GAG B;  3G5R A;  4CY6 A;  2Q0L A;  5BUL A;  3AB1 A;  3NK2 X;  1CJ2 A;  1PJ7 A;  1GRB A;  5JCI A;  1B4V A;  2C7G A;  3IHM A;  3PO7 A;  2BRY A;  5KWF A;  4YT0 A;  4Z2T A;  3FMW A;  1F8W A;  5ER0 A;  5FS9 A;  3GMC A;  3NK1 X;  4FDC B;  1GET A;  1PXB A;  1GER A;  5FMH A;  1N1P A;  2WDR A;  3AE4 A;  3ITJ A;  4Z24 A;  1PHH A;  3UKP A;  4U8I A;  2C3C A;  3SFE A;  4A6N A;  4YSY A;  2BS2 A;  3NIX A;  4USR A;  3UKF A;  4GAP A;  2C67 A;  2WPF A;  1TDK A;  5U63 A;  2R46 A;  4BJZ A;  4WX1 A;  3QVP A;  4ZCD A;  4CY8 A;  4U8M A;  3CNS A;  1H2I A;  1ZMC A;  3ICR A;  4M52 A;  4EQW A;  2GMH A;  3LOV A;  4EM3 A;  4TLX A;  2EQ6 A;  1QLB A;  3CN8 A;  3UKQ A;  4TM3 A;  2BC0 A;  3L5O A;  1QJD A;  4NWZ A;  2CDU A;  4U8L A;  3KLJ A;  1S3E A;  3SGL A;  3KA7 A;  4EQR A;  1EBD A;  1RSG A;  3LZW A;  3RP6 A;  4IV9 A;  1VG0 A;  3SZC A;  2XLP A;  1ZKQ A;  2W0H A;  2B9W A;  4K22 A;  1GRT A;  4FX9 A;  1L9D A;  3ALJ A;  3I6D A;  3V3N A;  2A87 A;  5U25 A;  4NNJ A;  1YKJ A;  3NLC A;  1X31 B;  5FS7 A;  2B76 A;  1H81 A;  3BNM A;  4BJY A;  3GD4 A;  1N4V A;  2YM2 A;  4OPL A;  3E1T A;  4NTE A;  4Y4L A;  4BV6 A;  1GAL A;  3ALL A;  4B65 A;  3AD7 B;  3NTD A;  1K0J A;  2GV8 A;  3PVC A;  3WE0 A;  5BUK A;  2GF3 A;  3T37 A;  1VDC A;  1K4Q A;  2WPC A;  1JRZ A;  2YG4 A;  1PBC A;  2BAC A;  1FEC A;  5M10 A;  4BK2 A;  2OA1 A;  1H84 A;  3ADA B;  1KF6 A;  2H88 A;  2OLN A;  3VR9 A;  2YG5 A;  2YVJ A;  2V3B A;  2WOW A;  3G5Q A;  4H2R A;  1BWC A;  3GYI A;  3KVE A;  2XYO A;  4U8P A;  4Z2R A;  3BHF A;  4H2N A;  1EL5 A;  5L46 A;  2XFQ A;  4EQS A;  2C66 A;  4I58 A;  4A65 A;  2ZBW A;  1Q1R A;  1GRH A;  2HQM A;  1MOK A;  3AEB A;  3QVR A;  3GYX A;  1CF3 A;  3VR8 A;  1VRQ B;  5HYM A;  1CC2 A;  4UDP A;  1S2Q A;  4H4Q A;  3SZW A;  4LU6 A;  2R0C A;  4C3Y A;  5KMS A;  1IUW A;  1L9E A;  3IWA A;  3ATR A;  4ECH A;  4B1B A;  1DOD A;  2JB3 A;  2WP5 A;  3M0O A;  4DGK A;  1EL8 A;  3UTF A;  3B3R A;  1NG4 A;  2R4E A;  3JSK A;  1D4E A;  1PDH A;  4TM1 A;  3FG2 P;  4OPT A;  4GRT A;  4CCQ A;  3IHG A;  4HA6 A;  2NVK X;  3ABV A;  1JOA A;  2JAE A;  5IPY A;  2GR3 A;  5JCL A;  4II2 A;  1F6M A;  4U2S A;  4Z2U A;  2QAE A;  3CTY A;  3AYJ A;  3NH3 X;  3FPZ A;  2WEU A;  2C64 A;  2FJE A;  2WDQ A;  3DJG X;  1OJD A;  3CIR A;  3CND A;  3VRB A;  5JCM A;  4EIP A;  3IF9 A;  3HZL A;  4OPD A;  4FK1 C;  3P9U A;  3RNM A;  5KRQ A;  2CVJ A;  1HYU A;  3UTE A;  1F3P A;  1COY A;  1LQU A;  1PN0 A;  2H89 A;  2B9Y A;  4RSL A;  3L8K A;  3SY4 A;  3UOZ A;  2BK4 A;  1BGN A;  4YTM A;  2BA9 A;  3UKH A;  4C3X A;  3QSS A;  3KPF A;  4Y4M A;  1E1M A;  3CGD A;  3EAO A;  2APG A;  4APN A;  2YAU A;  3UTH A;  2WPE A;  2YM1 A;  1XPQ A;  2WS3 A;  1KSS A;  4GF7 A;  1PBB A;  4NZH A;  5CQF A;  3CNJ A;  4OCG A;  1TYP A;  3T14 A;  5HHF A;  2YLX A;  2R45 A;  2XLS A;  5CKU A;  3NK0 X;  2BXS A;  3QSM A;  3AEE A;  1Y56 A;  5KMQ A;  5HXI A;  2FJD A;  3UOV A;  5BVA A;  3P4Q A;  2GRT A;  2IID A;  2B7S A;  3UTG A;  1XDI A;  5JRB A;  3CNT A;  2V3A A;  2BC1 A;  2VRL A;  2JK6 A;  3GYJ A;  2XVH A;  2IVD A;  1NHP A;  1O95 A;  1PJ5 A;  1D5T A;  4H50 A;  2DKI A;  3KPK A;  4JY2 A;  3AE9 A;  3CPJ G;  2BS4 A;  4J34 A;  3VQR A;  2FBW A;  3KD9 A;  4UP3 A;  4DSG A;  4K2X A;  2Y6R A;  3EAN A;  1DOE A;  4IA5 A;  3Q6J A;  4EQX A;  1E1K A;  2BK3 A;  2JB2 A;  3URH A;  3AE6 A;  1CJ3 A;  3NTA A;  1BF3 A;  4RG4 A;  4DSH A;  5KMP A;  1GSN A;  2C73 A;  2GAH B;  4WCT A;  2VVL G;  4REK A;  4A6N B;  4CNJ A;  2GQF A;  3AD8 B;  4D04 A;  4C5O A;  4A5L A;  2PYX A;  1ZK7 A;  2C75 A;  4IA6 A;  4CBQ A;  5C3J A;  3GD3 A;  3QFB A;  2R0G A;  3HYV A;  4HB9 A;  4X9M A;  2ZZ0 A;  2R9Z A;  3HYX A;  1ONF A;  1FOH A;  1IUU A;  2QA1 A;  2Y6Q A;  3HYW A;  4OPC A;  4C77 A;  2X8C A;  4EIQ A;  4AT2 A;  1YQZ A;  1FEB A;  3FBS A;  4OVI A;  3AEC A;  1B5Q A;  3M13 A;  3C96 A;  4PAA A;  1NEK A;  3BI2 A;  4O5U A;  2I0Z A;  3K7T A;  2Z5Y A;  1FL2 A;  4I59 A;  2WOI A;  4NEW A;  1JRY A;  4NEV A;  3EF6 A;  4H4P A;  5HY5 A;  1D4D A;  1NHS A;  2XVI A;  1KNR A;  3NYE A;  1TDF A;  3RP7 A;  4TLZ A;  3D1C A;  3RHA A;  5J7X A;  4U2L A;  3DK9 A;  4B63 A;  1LVL A;  4EMI A;  5LV9 A;  3GRT A;  2BRA A;  5KVI A;  1NPX A;  3DJD A;  4UDR A;  1LQT A;  1Y0P A;  3T2Z A;  2YG3 A;  3DK4 A;  2A89 A;  3V3O A;  2YLW A;  2C72 A;  2DKH A;  3LB8 A;  3NN0 X;  2ACZ A;  2GR2 A;  2V6O A;  5BRT A;  4GDP A;  3SM8 A;  2X8G A;  3S5W A;  4H2P A;  1DJQ A;  4CCR A;  1L9C A;  3GDP A;  4B64 A;  1UKV G;  2WET A;  3DA1 A;  5KNL A;  3CGB A;  3UKK A;  3K7M X;  4H7U A;  1GRA A;  3NRN A;  1D7L A;  3UKA A;  4N9X A;  4YSH A;  1PJ6 A;  3SXI A;  2X99 A;  2ZZB A;  1BGJ A;  2R4J A;  4A7A A;  5FS8 A;  1JEH A;  2C76 A;  3KKJ A;  3DK8 A;  1MXT A;  2O9Z A;  4P9S A;  1GRG A;  1OJT A;  2A8X A;  1H6V A;  1F8R A;  4A99 A;  3AE5 A;  1VG9 A;  1GXF A;  2YLT A;  2EQ9 A;  2BYB A;  4J57 A;  3NNE A;  3GSI A;  1REO A;  3K7Q X;  4ICY A;  1ZOY A;  2EQ8 A;  5EB4 A;  4Z43 A;  3OC4 A;  4A79 A;  1JNZ A;  4U8N A;  2AAQ A;  1BZL A;  3UOY A;  1CC4 A;  2E1M A;  3II4 A;  2WDV A;  4JY3 A;  3BI4 A;  5DBJ A;  1KSU A;  2C4C A;  2F5Z A;  1Q9I A;  3UP4 A;  3SQP A;  4IVM B;  2Q7V A;  4BK3 A;  1FEA A;  4KPR A;  1IUT A;  2X8H A;  1P2E A;  1RYI A;  3NN6 X;  4YTP A;  5KOW A;  1LV0 A;  3D9X A;  4G9K A;  2JBV A;  2VQB A;  2BS3 A;  2GR1 A;  2YWL A;  3F8P A;  3NGC X;  4U8K A;  3NYC A;  1W4X A;  3UCL A;  5GSN A;  2WQY A;  2B9X A;  3M12 A;  1B8S A;  2V5Z A;  1JRX A;  2BXR A;  3PS9 A;  3GWD A;  4K5S A;  4BUR A;  3P4P A;  1NHQ A;  1Q1W A;  4JNA A;  4U8J A;  4B69 A;  1PXA A;  3DME A;  4ZN0 A;  5JCK A;  4YKF A;  1ZX9 A;  2Q6U A;  3SX6 A;  4JDR A;  4FK1 A;  2ZZC A;  1H7X A;  3Q9T A;  4H4V A;  4II3 A;  4ADW A;  1CJC A;  2XVF A;  3AWI A;  4GCM A;  2PHH A;  2XFO A;  2YVG A;  3RP8 A;  1ZOV A;  2BK5 A;  3BNU A;  5TR3 A;  1Z6L A;  2XFP A;  4A9W A;  4BK1 A;  1K0L A;  4YXD A;  4U2T A;  1GT8 A;  4J31 A;  5U1O A;  3DH9 A;  5KOX A;  1KN0 A;  3ALM A;  3EPT A;  3RED A;  2GH5 A;  5JCN A;  2YR4 A;  2WP9 A;  2XDO A;  3COX A;  4AP3 A;  1H83 A;  4G73 A;  4DNA A;  4RG3 A;  1DOC A;  1GEU A;  1Y56 B;  3CPH G;  5EB5 A;  4J56 A;  2XLR A;  3BI5 A;  1KFY A;  1PXC A;  1TDN A;  2C3D A;  3O0H A;  1PBD A;  3B6D A;  3QSE A;  2V60 A;  2BCG G;  1ZY8 A;  2YR6 A;  4H2Q A;  3AYI A;  1GPE A;  4YWO A;  1IUX A;  3DJE A;  4MJW A;  1NDA A;  3AYL A;  3C4N A;  4H4W A;  2OLO A;  4XWZ A;  4Z26 A;  5KXJ A;  4K5R A;  1DXL A;  2OAM A;  1CHU A;  3R9U A;  1D7Y A;  3GDN A;  3AE2 A;  1L0V A;  3GRS A;  2YG6 A;  3AXB A;  2GMJ A;  3K30 A;  1ZMD A;  4U8O A;  2JKC A;  1IUV A;  4GUV A;  4CNK A;  4GR1 A;  4K7Z A;  4H4S A;  4K8D A;  3IC9 A;  1K0I A;  1LJ1 A;  1PBE A;  4H4Y A;  1FCD A;  1MO9 A;  1EL9 A;  1ZP0 A;  4Z44 A;  3SFD A;  4AT0 A;  1B37 A;  3SZF A;  4AOX A;  1H86 A;  2CFY A;  5IQ1 A;  4CRT A;  1KNP A;  2FJA A;  3UP5 A;  3VRA A;  2RGO A;  3LXD A;  1H82 A;  2YLS A;  4B66 A;  5KVH A;  1IUS A;  1O94 A;  2NPX A;  5C2T A;  1DNC A;  2EQ7 A;  2VOU A;  3GWF A;  2RAB A;  3LAD A;  2WHD A;  4EM4 A;  4C74 A;  2GEW A;  2VZ2 A;  4TM4 A;  1GND A;  5EOW A;  3AD9 B;  4J2W A;  2Q0K A;  3QFA A;  4XWR A;  3CNP A;  1D4C A;  1E6E A;  3GMB A;  3H8L A;  1AOG A;  1E7P A;  3ICT A;  3T0K A;  4G6G A;  3AE8 A;  2C70 A;  1E1N A;  2VVL A;  1CBO A;  2XFU A;  3F8R A;  4IVO B;  1JU2 A;  2R0P A;  2TMD A;  4JN9 A;  4EMJ A;  1BKW A;  1M64 A;  1OJ9 A;  3ATQ A;  1M6I A;  3AE3 A;  1TYT A;  3NYF A;  1E1L A;  3L1R A;  1PS9 A;  4H4T A;  1ZDL A;  2YVF A;  4H4R A;  1QO8 A;  1GTH A;  4ZCC A;  3ISH A;  1CC6 A;  2YG7 A;  3V76 A;  2IVE A;  1DOB A;  2FJB A;  2XLU A;  2YR5 A;  5IQ4 A;  3ZYX A;  2QCU A;  2OAL A;  2X50 A;  1OJC A;  4AOS A;  4TM0 A;  2GB0 A;  4NTC A;  3CGC A;  1LPF A;  1NHR A;  4LA1 A;  3H8I A;  4UDQ A;  1PBF A;  1XHC A;  1RP0 A;  2YQU A;  1H7W A;  2WP6 A;  3H4K A;  3UOX A;  1SEZ A;  2BCP A;  1GOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...