3OC4A

Crystal structure of a pyridine nucleotide-disulfide family oxidoreductase from the enterococcus faecalis v583
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
442
structure length
422
Chain Sequence
LKIVIIGASFAGISAAIASRKKYPQAEISLIDKQATVGYLSGRYITEEELRRQKIQLLLNREVVAMDVENQLIAWTRKEEQQWYSYDKLILATGASQFSTQIRGSQTEKLLKYKFLSAVPLLENSQTVAVIGAGPIGMEAIDFLVKMKKTVHVFESLENLLPKYFDKEMVAEVQKSLEKQAVIFHFEETVLGIEETANGIVLETSEQEISCDSGIFALNLHPQLAYLDKKIQRNLDQTIAVDAYLQTSVPNVFAIGDCISVMNEPVAETFYAPLVNNAVRTGLVVANNLEEKTHRFIGSLRTMGTKVGDYYLASTGLTETEGLFFPQTLASIIVRQPAPPLQHGTEILGKLIYDKVTQRVLGAQLCSKNNCLEKINTLALSIQTGQTLTDLLQKDYFYQPSLTNIYDITNLMGASAYWREND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a pyridine nucleotide-disulfide family oxidoreductase from the Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase
molecule keywords Oxidoreductase, pyridine nucleotide-disulfide family
total genus 119
structure length 422
sequence length 442
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3oc4A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3oc4A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3oc4A02
1TYPA 1MXTA 2RGOA 1NHSA 4H4PA 4Y4LA 1F3PA 3LXDA 3QSSA 3NK1X 2TMDA 1LQTA 4A65A 2JBVA 3ADAB 2BC1A 4FDCB 2GAHB 4EIPA 1QLBA 1E1NA 4B65A 3QJ4A 5M10A 2JAEA 2FBWA 2WP6A 1N1PA 2FJDA 4A5LA 4LU6A 1F8SA 2C65A 5CKUA 5KXJA 1O5WA 1OJTA 2B76A 4OPTA 1GNDA 3UTEA 1JU2A 5KWFA 2VQ7A 2NVKX 1MOKA 2E1MA 1IUUA 3GD3A 3DA1A 3UKLA 2BACA 4X4JA 1IJHA 1OJ9A 1PBDA 5FS6A 1F8RA 3AE6A 3OC4A 1PJ7A 1ZMDA 4OCGA 1OJDA 4JY3A 4H4SA 2B9XA 1PBCA 3VRBA 2X99A 4HB9A 3NYFA 3VRAA 1OJAA 5EB5A 1B4VA 4J36A 2YLZA 3AE4A 4J33A 4UP3A 1O94A 3GYJA 3V76A 4Z44A 3UTHA 1H7XA 2GV8A 1DOCA 3AB1A 3ALJA 1TDOA 3DK9A 3AYJA 3BI4A 4A6NB 4Z43A 1S3EA 1IUTA 5ER0A 3G5QA 3I3LA 4EIQA 1M64A 4I59A 2PYXA 2O9ZA 4C5OA 2DKIA 2GQWA 2YVJA 2IVDA 3UKHA 4BK1A 4Z2RA 1XANA 3AXBA 1PBEA 3UP5A 1NEKA 5HY5A 3CGEA 3BNMA 4M52A 4Z2UA 4U8NA 1IUVA 1VQWA 3WE0A 4JNQA 1PJ6A 3UOYA 2XLPA 4H4ZA 1PN0A 1GOSA 2I0ZA 3UKAA 3ZYXA 4H4QA 1JRXA 2XFNA 3CIRA 4GCMA 1GTEA 5LV9A 1CJ4A 1N4VA 3NLCA 3SFEA 2OLNA 1FCDA 4YT0A 4CBQA 5HXIA 1V59A 3FIMB 2ZBWA 3RP7A 2WBAA 1H82A 3C96A 4X9NA 4IVMB 4YKGA 4YSZA 2XVFA 3SGLA 1FECA 4EQXA 2Q0KA 2XLTA 4CCQA 4USRA 3H8LA 4JN9A 1TDFA 3GRSA 2APGA 3BHKA 1GXFA 1GT8A 1Q1RA 2OALA 1PJ5A 2XCGA 4K5SA 1CJ3A 3RP8A 2YG7A 2XLSA 3P4QA 1Y0PA 3BI5A 4NTEA 2WEUA 2BS4A 1Y56A 4JY2A 4DSHA 4BK2A 2J3NA 2QA1A 1IUSA 1YKJA 4ZCCA 4LA1A 1CC6A 2AQJA 2BXRA 2AAQA 1D4CA 2FJEA 3GRTA 3KD9A 4U8MA 1DNCA 3AYIA 4OVIA 4WCTA 4OPIA 1ONFA 1UKVG 1GETA 3FMWA 1CHUA 4D03A 3UKPA 4APNA 1JRYA 4DGKA 2C73A 1EL8A 2GR2A 2WOIA 3QSMA 4RG4A 2WDVA 3G5RA 3M13A 5C3JA 2CVJA 4EMIA 3IF9A 1IUXA 1PHHA 3NRNA 3PS9A 4C74A 1NENA 3DGZA 4H4YA 1NDAA 5JCIA 1N4WA 3RP6A 2X8HA 2XLUA 2BK3A 2YLWA 2WPEA 2BK5A 4H2PA 3CNTA 1LVLA 2WQYA 2NPXA 3BI2A 3PVCA 2X8GA 3GYIA 5KRQA 1ZOYA 2AR8A 2XLRA 3K7MX 1E1KA 4CY8A 5JCMA 2Y6RA 1FL2A 1LV0A 3IHMA 3CNPA 4BJYA 4PABA 2CFYA 2R45A 2OLOA 2XFQA 2R4JA 4TM3A 2YQUA 3NIXA 1NHRA 2PHHA 4H50A 2DKHA 3UOZA 4YXDA 5U25A 1GRFA 1YQZA 1P2HA 2VVMA 3NG7X 3ZDNA 3CTYA 1ZMCA 1KF6A 4DNAA 4UDRA 3CGDA 1K0JA 1L9EA 3NYEA 1B37A 1PS9A 2C67A 2E5VA 3DH9A 2JB2A 2YG5A 3AEEA 4AOXA 1BGJA 3UTGA 2R0GA 3Q9TA 1TRBA 1D4EA 4YTPA 2YVFA 3EANA 1ZX9A 1L9DA 2V3BA 1TDEA 2WESA 5IQ1A 5DBJA 1HYUA 2YLRA 1EL5A 2VVLG 1MO9A 4C77A 3CNDA 1EBDA 1W4XA 2FJAA 2R0CA 3QFBA 4BURA 4ECHA 1FEBA 3EPTA 4H4VA 3AE9A 2WP5A 1PDHA 5C2TA 2WPCA 2YVGA 4IA6A 3FG2P 4E0VA 3SQPA 3CGBA 4A9WA 3D8XA 1Y56B 3QSEA 1P2EA 4B1BA 1GPEA 4ZN0A 1KNRA 1NAAA 5BVAA 1K0LA 1D4DA 1E7PA 1LPFA 2BXSA 2RGJA 4JNAA 3NK0X 4AT2A 2GR3A 5EOWA 1H86A 1CF3A 1GERA 2GF3A 4YKFA 5IQ4A 1H84A 3AECA 3AD7B 3GDPA 1YY5A 4FK1A 1H81A 4GDEA 1KNPA 3UCLA 5KVIA 5EB4A 3GSIA 4Z26A 2YWLA 3AEBA 3EAOA 3AEGA 4U2SA 1BKWA 4USQA 2WETA 3D1CA 4J31A 2WPFA 1S2QA 5BULA 4TM4A 2BYBA 1LQUA 2WP9A 4UDPA 2C3DA 1GRHA 4BV6A 1B5QA 1CJ2A 5JCKA 1S2YA 2TPRA 4FX9A 3KU9A 1VRQB 3LADA 1GEUA 3P4PA 3L1RA 4P9SA 1Q9IA 2XVIA 3P4SA 2H88A 3II4A 1GREA 2ZZBA 2EQ6A 4CY6A 2JK6A 4OPDA 3T37A 4HA6A 2GR1A 3L8KA 3IC9A 1B8SA 2YR5A 4U8KA 5BUKA 4CNJA 2C7GA 1VG9A 1YQ4A 2UZZA 2XYOA 3AD9B 2GMJA 4U8OA 1E39A 4K22A 2C75A 2BA9A 2B9YA 3KA7A 3SM8A 4YSHA 1GV4A 3B3RA 3RNMA 4ICYA 1CC2A 1YQ3A 1XPQA 4OPCA 4B66A 5JCNA 1CL0A 5M0ZA 3UOVA 1D7YA 3F8PA 2Q6UA 3ALMA 4LIIA 1ZDLA 5BRTA 3NK2X 4IV9A 4KX6A 2GEWA 2B7SA 1KFYA 2CDUA 3ATQA 2W0HA 2EQ9A 3LB8A 1ZK7A 2JB3A 3M0OA 1OJCA 3CPIG 3JSKA 3UKKA 1BGNA 4U8LA 3DK8A 1ZOVA 4JQ9A 2JB1A 2XVJA 3B6DA 3KPFA 3GMCA 3KKJA 1KSUA 2R0PA 1GRGA 2YG4A 2B7RA 4B69A 1D7LA 3AEDA 1PXCA 1JRZA 3DJDA 4ZCDA 4OPUA 2V3AA 2F5ZA 4TM1A 2C64A 2WHDA 1GRAA 4J57A 3IWAA 5U1OA 4CNKA 1JNRA 1H83A 2Q0LA 3NTAA 4U2TA 4GF7A 4A6NA 4OPLA 3V3OA 2C70A 2JKCA 2R46A 3GMBA 4J2WA 3GD4A 1GALA 1Z6LA 2V61A 1CC4A 3C4AA 4K5RA 4B64A 2BC0A 1E1MA 1ZP0A 2WOWA 3NNEA 4YTNA 3F8RA 2WU5A 3ABVA 3GWFA 3K7TA 4Y4MA 3FPZA 2BCGG 1GTHA 2BABA 2BS2A 2XFPA 1XHCA 4CCRA 1F6MA 4EMWA 1H6VA 5L46A 1L0VA 3AE7A 2A87A 4AOSA 3ICTA 1S3BA 5FS7A 5HYMA 1EL9A 4A99A 3H8IA 4BK3A 3NKSA 2YG3A 2GH5A 3NGCX 3GDNA 2YAUA 4H4TA 1PBFA 1NPXA 3DJEA 3LJPA 4PAAA 3OZ2A 2V60A 3CNJA 3Q6JA 1LTXR 3O0HA 3S5WA 4H2RA 4NTCA 5J60A 4EM3A 1X31B 3QVRA 4NZHA 4O5UA 1AOGA 4NEWA 3R9UA 4K7ZA 2C72A 3UTFA 4H4UA 3NHOX 4EQRA 2WS3A 3DGHA 4H7UA 4FK1C 3GWDA 2GR0A 4JDRA 5CQFA 1KDGA 1FOHA 4OPGA 2EQ8A 1E1LA 1F8WA 1CBOA 3ICSA 3NT6A 3LZXA 5GRTA 2A89A 1VG0A 1N4UA 4H2NA 3VRDB 3AE5A 2VVLA 3AE2A 1Q1WA 2WDQA 2IIDA 4A79A 4AP1A 2A8XA 4A7AA 3K30A 2XFUA 3CN8A 1JEHA 1ELIA 4GDPA 3LZWA 1FEAA 4C3XA 2XDOA 4ADWA 4Y4NA 1PBBA 1IUWA 4EMJA 2BCPA 1NG3A 2R9ZA 1RYIA 5TR3A 2V5ZA 4H2QA 1O95A 2GAGB 3IHGA 4AT0A 2QCUA 3NYCA 1DODA 2Z5YA 2ACZA 2WDRA 2C66A 1CJCA 3C4NA 1GESA 2WOVA 2GVCA 5EBKA 3AYLA 3V3NA 2GRTA 3DJJA 2C76A 3ALLA 1NHPA 2VRLA 5FMHA 1GSNA 3PO7A 2WU2A 3AEFA 4MJWA 3BNUA 4XXGA 5GSNA 3UKFA 3KLJA 2IVEA 3NTDA 1E6EA 1LJ1A 4H4XA 2BK4A 3ATRA 3CPHG 3F8DA 3LOVA 4B68A 4YWOA 2X3NA 1BF3A 5FS9A 2RGHA 4Z25A 4NEVA 2X50A 2ZZCA 2E4GA 4XWZA 1EL7A 3UP4A 1VDCA 3EF6A 2YLXA 3AE8A 3NN6X 1TDNA 4GRTA 3K7QX 1L9CA 3UKQA 1DXLA 1NG4A 3SFDA 4TLXA 1COYA 4U8PA 1D5TA 1DJNA 3CNSA 4K2XA 4BJZA 3VR8A 5KOXA 3COXA 2QAEA 1JNZA 4Z2TA 1KSSA 2R4EA 2H89A 2EQ7A 3QVPA 2X8CA 2YM2A 4EQWA 3REDA 2C3CA 5J7XA 3UOXA 2YLTA 3ITJA 5JCLA 4GR1A 1GRBA 2ZZ0A 2VRMA 2ARDA 2HQMA 3ISHA 1ZKQA 5FS8A 3KVEA 4C3YA 3AWIA 4K8DA 3P1WA 4N9XA 4GUVA 4U8JA 3AEAA 3S61A 5KVHA 4CRTA 5U63A 2XVEA 4REKA 4YSYA 3CPJG 3P9UA 3URHA 2YM1A 3G5SA 3CGCA 3H4KA 2GB0A 4RSLA 2VQBA 4RG3A 2YR6A 2XVHA 1QJDA 4YTMA 5IPYA 2VZ2A 3NH3X 4D04A 2V6OA 2OAMA 1PXAA 4I58A 4U8IA 3DMEA 1NHQA 5HHFA 1M6IA 1JOAA 2Q7VA 4J34A 3ICRA 2B9WA 1TYTA 3E1TA 3AE1A 4H4RA 1K0IA 1ZY8A 3DK4A 4UDQA 4EQSA 3I6DA 4TLZA 1RP0A 4O5QA 2YG6A 2VOUA 4XWRA 1DJQA 3VQRA 4YSXA 2BS3A 1XDIA 3AD8B 3NN0X 4B67A 3M12A 2YLSA 4Z24A 3DJGX 4J56A 3VR9A 1GRTA 4WX1A 3FBSA 4U2LA 5KOWA 4AP3A 3AE3A 2YR4A 1BZLA 3QFAA 3HZLA 4IA5A 1REOA 4H4WA 2GMHA 4TM0A 3RHAA 1SEZA 1TDKA 4B63A 4NTDA 2XFOA 4EM4A 2Y6QA 1DOBA 2GQFA 1DOEA 2Z5XA 2CULA 1BWCA 4IVOB 2RABA 2OA1A 1PXBA 3P4RA 2QA2A 2FJBA 4X9MA 1K4QA 1QO8A 4KPRA 4DSGA 3BHFA 1RSGA 1H7WA
chains in the Genus database with same CATH superfamily
1MXTA 2PCEA 1X2GA 4Y4LA 1WYGA 3NRZB 3IJIA 4A65A 4FDCB 5M10A 3RITA 4LU6A 5CKUA 1MOKA 3UKLA 3GD3A 4EWJA 1PBDA 3ZVIA 1PJ7A 4OCGA 4JY3A 4H4SA 1PBCA 2X99A 3VRAA 1OJAA 2PODA 4MKSA 3ETRB 4J33A 2PU1A 3V76A 3MSYA 2PSNA 4E5TA 3ALJA 4A6NB 2ZC8A 2DKIA 2YVJA 4KWSA 2AL2A 1PBEA 3DIPA 1NEKA 3NVZB 5EU9A 4ZA0A 3WE0A 3BJSA 1JPDX 5G5HB 1GOSA 3ZYXA 4GCMA 1CJ4A 1N4VA 4CBQA 3HYWA 4YKGA 2GGEA 4EQXA 2Q0KA 3H8LA 2APGA 1GT8A 1PJ5A 4K5SA 3RP8A 3MKCA 1D4CA 3KD9A 3UJEA 4U8MA 3FMWA 3RO6A 1JRYA 2C73A 3A7UA 2GR2A 2WDVA 3M13A 1PHHA 3NRNA 3PS9A 1NENA 1MRAA 3ZLFA 1N4WA 4H2PA 2WQYA 3GYIA 5KRQA 3TW9A 5BOFA 2QDEA 3IJQA 2OLOA 1TKKA 4TM3A 2DKHA 4H83A 1YQZA 3CTYA 1ZMCA 3CGDA 4IT1A 3FCPA 3EANA 1ZX9A 2VVLG 1MO9A 3CNDA 2FJAA 3EPTA 3A7RA 3AE9A 2WPCA 2YVGA 3SQPA 3V5CA 1Y56B 3D9XA 5BVAA 3H7VA 3CB3A 2O56A 1LPFA 3DERA 4AT2A 3CK5A 5EOWA 3AD7B 1N62C 3GDPA 1YY5A 3UJRA 3UCLA 5EB4A 3CT2A 3DESA 2WETA 1S2QA 4MGGA 5BULA 2BYBA 1GRHA 3VC6A 3L1RA 1MDRA 1TZZA 2E5AA 3PG6A 3T6CA 2JK6A 4ENLA 1B8SA 3R07C 5BUKA 4CNJA 2OFJA 1V97A 4II3A 2UZZA 3AD9B 2XYOA 2GMJA 1E39A 5KMPA 4YSHA 1GV4A 4ICYA 4LIIA 4IV9A 2B7SA 1KFYA 3ATQA 1MDLA 3JSKA 3UKKA 2R0PA 1KCZA 2QVHA 1JPMA 2QDDA 1EC7A 2C64A 2WHDA 5U1OA 1JNRA 1H83A 4U2TA 4NNJA 2Q0LA 4OPLA 1VQZA 3V3OA 3FYYA 3GMBA 4J2WA 3GD4A 1Z6LA 1CC4A 1ZP0A 4YTNA 4Y4MA 3FPZA 2XFPA 1N5XA 1H6VA 4EMWA 3AE7A 1S3BA 5FS7A 1EL9A 4BK3A 3DJEA 2OQHA 2PTWA 2V60A 3CNJA 3Q6JA 4NWZA 4H2RA 4GYPA 4ZOHB 4H7UA 2GR0A 4JDRA 1KDGA 1FOHA 3ES7A 2XSXA 3ICSA 3NT6A 2XH7A 2A89A 4H2NA 3SJNA 2AKMA 3AE5A 2PTZA 3TQPA 1JEHA 4E4UA 3LZWA 3T14A 2XDOA 4Y4NA 4EMJA 4J1OA 2V5ZA 3UCCA 1N5WC 4AT0A 3NYCA 3V3NA 3C4NA 3P3BA 3TJIA 3A7AA 3DEQA 1GSNA 3PO7A 2WU2A 4XXGA 2OO6A 3ENLA 1LJ1A 2PA6A 4H4XA 3LOVA 2FKPA 4YWOA 4GMEA 2ZZCA 3Q45A 4HPNA 1VDCA 2YLXA 1TDNA 4GRTA 2ONEA 3DFYA 3UKQA 1MNSA 3KPKA 1X2HA 1DXLA 1COYA 1E9IA 1DJNA 3CNSA 4BJZA 2H89A 1JRPA 2YM2A 3UOXA 2C3CA 1PDZA 5JCLA 4HCDA 2ARDA 2HQMA 5FS8A 4K8DA 3AEAA 1WUFA 3K1GA 3R0KA 2CHRA 1JROA 3T9PA 4RG3A 2GB0A 2YR6A 1QJDA 4TVYA 5IPYA 3JZUA 2V6OA 3TWAA 2W55A 2Q7VA 2B9WA 3OTRA 1RP0A 2QQ6A 4O5QA 2W3SA 2YG6A 2VOUA 4YSXA 4JN8A 3MWCA 3DGBA 4Z24A 1W6TA 1BQGA 5KOWA 2YR4A 3QFAA 4IA5A 2OKTA 4H4WA 4TM0A 3VCCA 2XFOA 5FJOA 1BWCA 4HNCA 3T31A 5KMQA 2PP1A 3PWIA 3EKGA 3FVDA 3V4BA 1NU5A 1F3PA 3LXDA 3UXKA 3NK1X 3ADAB 2BC1A 1QLBA 2JAEA 3FJ4A 4HCLA 2NVKX 2E1MA 1IUUA 3SN1A 2BACA 1IJHA 1F8RA 3OC4A 1ZMDA 2RDXA 5ENLA 1T3QC 3R10A 4G7FA 2B9XA 3VRBA 4ZCWA 3NYFA 3Q4DA 3AE4A 5IDZA 3UTHA 3DK9A 3BI4A 4Z43A 5ER0A 3G5QA 1M64A 2PYXA 4A3RA 4Z2RA 4BK1A 2IVDA 3UKHA 2PTYA 3P0WA 4M52A 5JRBA 1IUVA 1PJ6A 3UOYA 2XH4A 1PN0A 3UKAA 3GC2A 1JRXA 4GIRA 5LV9A 3SFEA 4F4RA 1V59A 1H82A 4YSZA 2XVFA 1RVKA 4CCQA 5KNLA 4USRA 4JN9A 4DXKA 3GRSA 1GXFA 2GGHA 2XCGA 1CJ3A 2YG7A 1Y0PA 4NTEA 3D46A 2BS4A 4BK2A 2J3NA 1IUSA 4ZCCA 3UXLA 2AAQA 3VCNA 1PDYA 4WCTA 1GETA 3SZCA 3UKPA 4APNA 1EL8A 2WOIA 3SSZA 5C3JA 2QGYA 3DGZA 4H4YA 2X8HA 2WPEA 2BK5A 2NPXA 2X8GA 1ZOYA 1EBGA 5JCMA 1FL2A 3IHMA 2R45A 2R4JA 4M0XA 2YQUA 4H50A 4JN7A 2P3ZA 4DNAA 1K0JA 3N6JA 2C67A 2E5VA 3DH9A 3UTGA 3CAWA 2R0GA 3Q9TA 1TRBA 4YTPA 2YVFA 1L9DA 3VC5A 2ZADA 4C77A 2PPGA 1EBDA 5FJPA 3QFBA 4BURA 4G73A 3QKEA 1F9CA 3OP2A 4IA6A 3FV9A 4A9WA 1P2EA 1GPEA 4ZN0A 1K0LA 1D4DA 4A35A 1E7PA 2RGJA 3NVYB 4DHGA 1GERA 4YKFA 3OZYA 1H81A 4GDEA 4G9KA 2YWLA 3EAOA 3H70A 4A6GA 4HCHA 4J31A 4UDPA 4BV6A 1CJ2A 1S7MA 3NZGA 4P9SA 4OPDA 2DW6A 3KUMA 2C7GA 4U8OA 1YQ4A 2BA9A 3SM8A 1YQ3A 4B66A 3UOVA 4H1ZA 1FFUC 1DTNA 3F8PA 4GYPC 4KX6A 2CDUA 1SJAA 3QN3A 2EQ9A 3LB8A 1ZK7A 1OJCA 3CPIG 4U8LA 4JQ9A 3B6DA 3GMCA 3T0KA 4HN8A 1PXCA 3CXOA 3IWAA 4A6NA 3RR1A 2C70A 2OVLA 2V61A 4B64A 3C4AA 4K1WA 3NNEA 3ABVA 3K7TA 4E6MA 4CCRA 5L46A 4AOSA 4A99A 1KKOA 3GDNA 1PBFA 3OZ2A 4GGHA 3R9UA 3UTFA 4H4UA 1RM6B 2P0IA 5CQFA 1CBOA 3PWGA 3RCYA 3SZFA 3U9IA 3K30A 2XFUA 4MMWA 1FEAA 1SJDA 4C3XA 3AMZA 4ADWA 1IUWA 1NG3A 3UJ2A 4DN1A 5TR3A 4H2QA 2QCUA 3OZMA 4H19A 2WDRA 2C66A 1CJCA 1GESA 2WOVA 3AYLA 5EBKA 2GRTA 2C76A 1IYXA 1BKHA 3UKFA 3AEFA 3I4KA 3SX6A 3CPHG 3UCDA 1JDFA 5BOEA 1BF3A 2I5QA 4Z25A 3ZVHA 4NEVA 2GGIA 6ENLA 4XWZA 2XH2A 3EF6A 2OZ3A 2PGEA 3SFDA 2HZGA 3MZNA 3VR8A 1JNZA 4Z2TA 2R4EA 3QVPA 3REDA 4G8TA 2VRMA 4C3YA 3P1WA 4GUVA 2C4CA 3S61A 3MUCA 4YSYA 3P9UA 3URHA 3G5SA 4E8GA 1EBHA 1PXAA 5HHFA 1M6IA 1JOAA 1TYTA 3E1TA 3AE1A 4GGBA 3EUB3 1ZXIC 2PMQA 3VQRA 3GD6A 2BS3A 3AD8B 4B67A 2YLSA 3DJGX 4J56A 1GRTA 4U2LA 3HZLA 3B9JB 3H12A 1DOBA 2CULA 2RABA 4X9MA 2QA2A 2FJBA 3BHFA 2RGOA 2PP0A 3QSSA 1LQTA 2JBVA 1E1NA 4B65A 2FJDA 4A5LA 1XS2A 1YEYA 2C65A 1O5WA 1OJTA 4IL2A 4OPTA 1GNDA 3UTEA 5KWFA 2VQ7A 1OJ9A 5FS6A 2BRYA 3VDGA 4HB9A 3UJSA 4J36A 2YLZA 4UP3A 1O94A 1H7XA 1TDOA 3AYJA 1S3EA 2MUCA 4JHMA 4EIQA 2O9ZA 1XANA 3AXBA 4U8NA 3QLDA 2GL5A 2XLPA 4H4ZA 4HYRA 2I0ZA 2XFNA 3NLCA 4YT0A 3FIMB 2ZBWA 3RP7A 2WBAA 3ES8A 3QPEA 1R0MA 5FJRA 3BHKA 2OALA 3BI5A 3BSMA 2WEUA 4DSHA 1CC6A 2AQJA 2FJEA 3GRTA 3DG7A 1DNCA 3AYIA 1ONFA 1UKVG 2XGZA 2HNEA 4D03A 2POZA 3QSMA 4Z17A 3H8AA 3IF9A 1IUXA 5G5GB 3OPSA 5JCIA 3RP6A 3SBFA 2YLWA 2AKZA 3CNTA 1LVLA 3PVCA 3VFCA 3K7MX 1E1KA 4CY8A 2Y6RA 2CFYA 2XFQA 3V3WA 3NIXA 5U25A 1GRFA 3PK7A 1P2HA 3NG7X 3I6EA 3ZDNA 3DFHA 3QTPA 4UDRA 3MY9A 2YG5A 2JB2A 1BGJA 1D4EA 5IQ1A 1TDEA 1HYUA 1FFVC 4DX3A 1FEBA 2OZ8A 4H4VA 5C2TA 1NAAA 3N4EA 2BXSA 5FJUA 4JNAA 3NK0X 2OQYA 2PS2A 1H86A 1CF3A 3U4FA 5IQ4A 3R0UA 4FK1A 1KNPA 5KVIA 3AEBA 4U2SA 1BKWA 3R1ZA 1ECQA 4GAPA 3D1CA 2WPFA 3HRDC 2C3DA 1S2YA 1B5QA 4G74A 4FX9A 3NXLA 3KU9A 1EC9A 1NELA 1GEUA 3P4SA 2ZZBA 3T2YA 2EQ6A 4CY6A 4HA6A 3NFUA 3IC9A 3MQTA 3ZVHB 4U8KA 1VG9A 4IHCA 2C75A 2B9YA 1ELSA 1KN0A 2MNRA 3B3RA 5JCNA 3SXIA 1CL0A 5M0ZA 2Q6UA 3ALMA 5BRTA 2W0HA 2JB3A 3M0OA 4ROPA 1BGNA 3R25A 3KPFA 1ZOVA 2JB1A 2XVJA 3KKJA 1KSUA 4FP1A 2B7RA 1D7LA 3IK4A 3T2ZA 1JRZA 3DJDA 4ZCDA 2V3AA 1GRAA 4J57A 3P93A 3STPA 4IL0A 3NVWB 1GALA 1TE6A 3GYXA 4Z1YA 4IZGA 3F8RA 2WU5A 3GWFA 3THUA 3EEZA 2BS2A 3ICTA 5HYMA 1KKRA 4KT2A 3NKSA 3R11A 2YG3A 2GH5A 2PP3A 2YAUA 4H4TA 4PAAA 4FI4A 1LTXR 3O0HA 4NTCA 4O5UA 4NEWA 3SZWA 3TJ4A 4EQRA 2WS3A 3DGHA 4FK1C 3GWDA 4K8GA 4OPGA 4HNLA 2P8BA 1VG0A 1N4UA 4K2SA 3VRDB 1VDVA 1SB3B 3AE2A 1Q1WA 2IIDA 4A79A 4AP1A 2A8XA 3T8QA 4A7AA 2HXTA 1WUEA 3CN8A 4GDPA 1ELIA 1PBBA 2BCPA 5FJTA 2R9ZA 1RYIA 1O95A 2GAGB 3IHGA 2Z5YA 2ACZA 2GVCA 5FMHA 1MUCA 3KLJA 4B68A 3F8DA 2BK4A 3L5OA 2X3NA 1N61C 2RGHA 2X50A 2E4GA 1EL7A 3UP4A 2OG9A 3AE8A 3NN6X 3K7QX 1L9CA 2OLAA 4TLXA 4U8PA 1D5TA 5KOXA 3COXA 2QAEA 1KSSA 4EQWA 3ITJA 3JW7A 2GDQA 1GRBA 1ZKQA 2OX4A 3KVEA 3AWIA 4CRTA 5KVHA 5U63A 2YM1A 4RSLA 2VQBA 2VZ2A 3NH3X 4D04A 2OAMA 4I58A 3DMEA 1NHQA 3AM9A 3ICRA 4H4RA 3RGTA 1K0IA 1ZY8A 4UDQA 4EQSA 4TLZA 3DG6A 3NN0X 3M12A 2HXUA 4H2HA 3HYVA 3SZ0A 4WX1A 3FBSA 3AE3A 4GISA 1BZLA 3OW1A 3RHAA 1TDKA 2Z5XA 4IVOB 2PTXA 2OA1A 1K4QA 1QO8A 4KPRA 1RSGA 1TYPA 1NHSA 4G6GA 1STZA 4H4PA 2TMDA 4EIPA 2GAHB 3QJ4A 2FBWA 2WP6A 1N1PA 2NQLA 1F8SA 5KXJA 2B76A 1JU2A 2GSHA 3DA1A 3HPFA 4X4JA 3DDMA 3AE6A 1OJDA 5EB5A 1B4VA 3GYJA 4Z44A 2GV8A 3AB1A 1DOCA 1IUTA 2QJNA 3I3LA 4I59A 4C5OA 2GQWA 3UP5A 7ENLA 5HY5A 3CGEA 3BNMA 1H2IA 4Z2UA 2OPJA 1VQWA 4JNQA 4H4QA 3CIRA 1GTEA 2OLNA 3AN1A 1FCDA 5HXIA 1SJBA 3NO1A 3C96A 4X9NA 4IVMB 3NS1B 3UJFA 3SGLA 1FECA 2XLTA 3NVVB 3GO2A 2XH0A 1TDFA 3CXBA 1L8PA 1Q1RA 2XLSA 3P4QA 1OEPA 2DW7A 4KPLA 1Y56A 2BRAA 4JY2A 2QA1A 4X2PA 1YKJA 4LA1A 2E3TA 2BXRA 3CMMA 4OVIA 4OPIA 1CHUA 3TCSA 3PFRA 4DGKA 1SJCA 1N63C 4RG4A 3G5RA 2CVJA 4EMIA 3UGVA 4C74A 3FXGA 3SY4A 1NDAA 2OZTA 2XLUA 2BK3A 3BI2A 2AR8A 2XLRA 4GAVA 1LV0A 3CNPA 4BJYA 3V5FA 4PABA 2P8CA 3UOZA 1NHRA 2PHHA 4YXDA 3BOXA 4IP5A 2VVMA 1KF6A 1L9EA 3NYEA 1B37A 3VA8A 3D47A 1PS9A 3AEEA 3SQSA 4AOXA 3IJLA 2V3BA 2WESA 5DBJA 2YLRA 1EL5A 1W4XA 3RRAA 2R0CA 2W3RA 3JVAA 1KD0A 4ECHA 1FIQB 2WP5A 1PDHA 3FG2P 4E0VA 3CGBA 3D8XA 3QSEA 4B1BA 1KNRA 2GR3A 2GF3A 1H84A 3AECA 2PU0A 3GSIA 4Z26A 2QJJA 3AEGA 4USQA 4G6HA 3SN4A 5KMRA 4TM4A 1LQUA 2WP9A 5JCKA 2TPRA 1VRQB 3LADA 3P4PA 3CYJA 4E4FA 1Q9IA 2XVIA 2H88A 3II4A 1GREA 4J3ZA 3T37A 2AL2B 2GR1A 3L8KA 2YR5A 4K22A 3ZLHA 3KA7A 3RNMA 1CC2A 1XPQA 4OPCA 1D7YA 1EC8A 2PGWA 1ZDLA 3NK2X 2GEWA 3DK8A 2YG4A 1GRGA 3SN0A 4B69A 3AEDA 1JCTA 5KMSA 4OPUA 2FYMA 2F5ZA 4TM1A 4DWDA 4CNKA 4YWSA 3NTAA 1FHVA 4GF7A 1ONEA 2AL1A 2JKCA 2R46A 4K5RA 2BC0A 1E1MA 2WOWA 2BCGG 1GTHA 1XPYA 2BABA 1XHCA 3T4WA 1FO4A 1F6MA 1L0VA 2A87A 3TTEA 3H8IA 4DYEA 3NGCX 3LJPA 1NPXA 3S5WA 3ZLGA 3TOYA 5J60A 4EM3A 1X31B 3QVRA 4NZHA 1AOGA 4K7ZA 2C72A 3NHOX 3I6TA 2EQ8A 1E1LA 1F8WA 4TVWA 1R6WA 3LZXA 5GRTA 3N6HA 2VVLA 2WDQA 3HYXA 1P43A 5J04A 3GY1A 2GGGA 1DODA 1P48A 3DJJA 3SR6B 3ALLA 1NHPA 3S5SA 2VRLA 5GSNA 4MJWA 3BNUA 3N4FA 2IVEA 3NTDA 1E6EA 3ATRA 1FHUA 4GFIA 5FS9A 3TWBA 4IP4A 4M6UA 3DG3A 1NG4A 2GGJA 4K2XA 3HW2A 2EQ7A 2X8CA 5J7XA 2YLTA 4GR1A 2ZZ0A 3T2KA 4KEMA 3ISHA 4N9XA 4U8JA 2XVEA 4REKA 3B97A 3CPJG 1N60C 3CGCA 3H4KA 2XVHA 4YTMA 2W54A 4U8IA 4J34A 3DK4A 3I6DA 4XWRA 2QJMA 1DJQA 1XDIA 3VR9A 3SYIA 4AP3A 2P88A 1REOA 2GMHA 1SEZA 4B63A 4NTDA 4EM4A 2Y6QA 2GQFA 1DOEA 3S47A 1PXBA 3P4RA 4DSGA 1H7WA 4II2A
chains in the Genus database with same CATH topology
1TYPA 1MXTA 2RGOA 1NHSA 4G6GA 4H4PA 4Y4LA 1F3PA 3LXDA 3QSSA 3NK1X 2TMDA 1LQTA 4A65A 2JBVA 3ADAB 2BC1A 4FDCB 2GAHB 4EIPA 1QLBA 1E1NA 4B65A 3QJ4A 5M10A 2JAEA 2FBWA 2WP6A 1N1PA 2FJDA 4A5LA 4LU6A 1F8SA 2C65A 5CKUA 5KXJA 1O5WA 1OJTA 2B76A 4OPTA 1GNDA 3UTEA 1JU2A 5KWFA 2VQ7A 2NVKX 1MOKA 2E1MA 1IUUA 3GD3A 3DA1A 3UKLA 2BACA 4X4JA 1IJHA 1OJ9A 1PBDA 5FS6A 2BRYA 1F8RA 3AE6A 3OC4A 1PJ7A 1ZMDA 4OCGA 1OJDA 4JY3A 4H4SA 2B9XA 1PBCA 3VRBA 2X99A 4HB9A 3NYFA 3VRAA 1OJAA 5EB5A 1B4VA 4J36A 2YLZA 3AE4A 4J33A 4UP3A 1O94A 3GYJA 3V76A 4Z44A 3UTHA 1H7XA 2GV8A 1DOCA 3AB1A 3ALJA 1TDOA 3DK9A 3AYJA 3BI4A 4A6NB 4Z43A 1S3EA 1IUTA 5ER0A 3G5QA 3I3LA 4EIQA 1M64A 4I59A 2PYXA 2O9ZA 4C5OA 2DKIA 2GQWA 2YVJA 2IVDA 3UKHA 4BK1A 4Z2RA 1XANA 3AXBA 1PBEA 3UP5A 1NEKA 5HY5A 3CGEA 3BNMA 4M52A 1H2IA 4Z2UA 4U8NA 5JRBA 1IUVA 1VQWA 3WE0A 4JNQA 1PJ6A 3UOYA 2XLPA 4H4ZA 1PN0A 1GOSA 2I0ZA 3UKAA 3ZYXA 4H4QA 1JRXA 2XFNA 3CIRA 4GCMA 1GTEA 5LV9A 1CJ4A 1N4VA 3NLCA 3SFEA 2OLNA 1FCDA 4YT0A 4CBQA 5HXIA 1V59A 3FIMB 2ZBWA 3RP7A 2WBAA 1H82A 3C96A 4X9NA 3HYWA 4IVMB 4YKGA 4YSZA 2XVFA 3SGLA 1FECA 4EQXA 2Q0KA 2XLTA 4CCQA 5KNLA 4USRA 3H8LA 4JN9A 1TDFA 3GRSA 2APGA 3BHKA 1GXFA 1GT8A 1Q1RA 2OALA 1PJ5A 2XCGA 4K5SA 1CJ3A 3RP8A 2YG7A 2XLSA 3P4QA 1Y0PA 3BI5A 4NTEA 2WEUA 2BS4A 1Y56A 2BRAA 4JY2A 4DSHA 4BK2A 2J3NA 2QA1A 1IUSA 1YKJA 4ZCCA 4LA1A 1CC6A 2AQJA 2BXRA 2AAQA 1D4CA 2FJEA 3GRTA 3CMMA 3KD9A 4U8MA 1DNCA 3AYIA 4OVIA 4WCTA 4OPIA 1ONFA 1UKVG 1GETA 3FMWA 3SZCA 1CHUA 4D03A 3UKPA 4APNA 1JRYA 4DGKA 2C73A 1EL8A 2GR2A 2WOIA 3QSMA 4RG4A 2WDVA 3G5RA 3M13A 5C3JA 2CVJA 4EMIA 3IF9A 1IUXA 1PHHA 3NRNA 3PS9A 4C74A 1NENA 3DGZA 4H4YA 1NDAA 3SY4A 5JCIA 1N4WA 3RP6A 2X8HA 2XLUA 2BK3A 2YLWA 2WPEA 2BK5A 4H2PA 3CNTA 1LVLA 2WQYA 2NPXA 3BI2A 3PVCA 2X8GA 3GYIA 5KRQA 1ZOYA 2AR8A 2XLRA 4GAVA 3K7MX 1E1KA 4CY8A 5JCMA 2Y6RA 1FL2A 1LV0A 3IHMA 3CNPA 4BJYA 4PABA 2CFYA 2R45A 2OLOA 2XFQA 2R4JA 4TM3A 2YQUA 3NIXA 1NHRA 2PHHA 4H50A 2DKHA 3UOZA 4YXDA 5U25A 1GRFA 1YQZA 1P2HA 2VVMA 3NG7X 3ZDNA 3CTYA 1ZMCA 1KF6A 4DNAA 4UDRA 3CGDA 1K0JA 1L9EA 3NYEA 1B37A 1PS9A 2C67A 2E5VA 3DH9A 2JB2A 2YG5A 3AEEA 4AOXA 1BGJA 3UTGA 2R0GA 3Q9TA 1TRBA 1D4EA 4YTPA 2YVFA 3EANA 1ZX9A 2V3BA 1L9DA 1TDEA 2WESA 5IQ1A 5DBJA 1HYUA 2YLRA 1EL5A 2VVLG 1MO9A 4C77A 3CNDA 1EBDA 1W4XA 2FJAA 2R0CA 3QFBA 4BURA 4ECHA 1FEBA 3EPTA 4G73A 4H4VA 3AE9A 2WP5A 1PDHA 5C2TA 2WPCA 2YVGA 4IA6A 3FG2P 4E0VA 3SQPA 3CGBA 4A9WA 3D8XA 1Y56B 3D9XA 1P2EA 3QSEA 1GPEA 4B1BA 1KNRA 1NAAA 4ZN0A 1K0LA 5BVAA 1D4DA 1E7PA 1LPFA 2BXSA 2RGJA 4JNAA 3NK0X 4AT2A 2GR3A 5EOWA 1H86A 1CF3A 1GERA 2GF3A 4YKFA 5IQ4A 1H84A 3AECA 3AD7B 3GDPA 1YY5A 4FK1A 1H81A 4GDEA 1KNPA 4G9KA 3UCLA 5KVIA 5EB4A 3GSIA 4Z26A 2YWLA 3AEBA 3EAOA 3AEGA 4U2SA 1BKWA 4GAPA 4USQA 2WETA 4G6HA 3D1CA 4J31A 2WPFA 1S2QA 5KMRA 5BULA 4TM4A 2BYBA 1LQUA 2WP9A 4UDPA 2C3DA 1GRHA 4BV6A 1B5QA 1CJ2A 5JCKA 1S2YA 2TPRA 4FX9A 3KU9A 4G74A 1VRQB 1S7MA 3LADA 1GEUA 3P4PA 3L1RA 4P9SA 1Q9IA 2XVIA 3P4SA 2H88A 3II4A 1GREA 2ZZBA 3T2YA 2EQ6A 4CY6A 3PG6A 2JK6A 4OPDA 3T37A 4HA6A 2GR1A 3L8KA 3IC9A 1B8SA 2YR5A 4U8KA 5BUKA 4CNJA 2C7GA 1VG9A 1YQ4A 2UZZA 2XYOA 3AD9B 2GMJA 4II3A 4U8OA 1E39A 4K22A 2C75A 2BA9A 2B9YA 3KA7A 5KMPA 3SM8A 4YSHA 1GV4A 1KN0A 3B3RA 3RNMA 4ICYA 1CC2A 1YQ3A 1XPQA 4OPCA 4B66A 5JCNA 3SXIA 1CL0A 5M0ZA 3UOVA 1D7YA 3F8PA 2Q6UA 3ALMA 4LIIA 1ZDLA 5BRTA 3NK2X 4IV9A 4KX6A 2GEWA 2B7SA 1KFYA 2CDUA 3ATQA 2W0HA 2EQ9A 3LB8A 1ZK7A 2JB3A 3M0OA 1OJCA 3CPIG 3JSKA 3UKKA 1BGNA 4U8LA 3DK8A 1ZOVA 4JQ9A 2JB1A 2XVJA 3B6DA 3KPFA 3GMCA 3KKJA 1KSUA 2R0PA 1GRGA 2YG4A 2B7RA 3T0KA 4B69A 1D7LA 3AEDA 3T2ZA 1PXCA 1JRZA 3DJDA 4ZCDA 4OPUA 2V3AA 5KMSA 2F5ZA 4TM1A 2C64A 2WHDA 1GRAA 4J57A 3IWAA 5U1OA 4CNKA 1JNRA 1H83A 2Q0LA 3NTAA 4NNJA 4GF7A 4U2TA 4OPLA 4A6NA 3V3OA 2C70A 2JKCA 2R46A 3GMBA 4J2WA 3GD4A 1GALA 1Z6LA 2V61A 1CC4A 3C4AA 4K5RA 4B64A 3GYXA 1E1MA 2BC0A 1ZP0A 2WOWA 3NNEA 4YTNA 3F8RA 2WU5A 3ABVA 3GWFA 3K7TA 4Y4MA 3FPZA 2BCGG 1GTHA 2BABA 2BS2A 2XFPA 1XHCA 4CCRA 1F6MA 4EMWA 1H6VA 5L46A 1L0VA 3AE7A 2A87A 4AOSA 3ICTA 1S3BA 5FS7A 5HYMA 1EL9A 4A99A 3H8IA 4BK3A 3NKSA 2YG3A 2GH5A 3NGCX 3GDNA 2YAUA 4H4TA 1PBFA 1NPXA 3DJEA 3LJPA 4PAAA 3OZ2A 2V60A 3CNJA 3Q6JA 1LTXR 3O0HA 4NWZA 3S5WA 4H2RA 4NTCA 5J60A 4EM3A 1X31B 3QVRA 4NZHA 4O5UA 1AOGA 4NEWA 3R9UA 3SZWA 4K7ZA 2C72A 3UTFA 4H4UA 3NHOX 4EQRA 2WS3A 3DGHA 4H7UA 4FK1C 3GWDA 2GR0A 4JDRA 5CQFA 1KDGA 1FOHA 4OPGA 2EQ8A 1E1LA 1F8WA 1CBOA 3ICSA 3NT6A 3LZXA 5GRTA 2A89A 1VG0A 1N4UA 4H2NA 3VRDB 3SZFA 3AE5A 2VVLA 3AE2A 1Q1WA 2WDQA 2IIDA 4A79A 3HYXA 4AP1A 2A8XA 4A7AA 3K30A 2XFUA 3CN8A 1JEHA 1ELIA 4GDPA 3LZWA 1FEAA 4C3XA 3T14A 2XDOA 4ADWA 4Y4NA 1PBBA 1IUWA 4EMJA 2BCPA 1NG3A 2R9ZA 1RYIA 5TR3A 2V5ZA 4H2QA 1O95A 2GAGB 3IHGA 4AT0A 2QCUA 3NYCA 1DODA 2Z5YA 2ACZA 2WDRA 2C66A 1CJCA 3C4NA 1GESA 2WOVA 2GVCA 5EBKA 3AYLA 3V3NA 2GRTA 3DJJA 2C76A 3ALLA 1NHPA 2VRLA 5FMHA 1GSNA 3PO7A 2WU2A 3AEFA 4MJWA 3BNUA 4XXGA 5GSNA 3UKFA 3KLJA 2IVEA 3NTDA 3SX6A 1E6EA 1LJ1A 4H4XA 2BK4A 3ATRA 3CPHG 3L5OA 3F8DA 3LOVA 4B68A 4YWOA 2X3NA 1BF3A 5FS9A 2RGHA 4Z25A 4NEVA 2X50A 2ZZCA 2E4GA 4XWZA 1EL7A 3UP4A 1VDCA 3EF6A 2YLXA 3AE8A 3NN6X 1TDNA 4GRTA 3K7QX 1L9CA 3UKQA 3KPKA 1DXLA 1NG4A 3SFDA 4TLXA 1COYA 4U8PA 1D5TA 1DJNA 3CNSA 4K2XA 4BJZA 3VR8A 5KOXA 3COXA 2QAEA 1JNZA 4Z2TA 1KSSA 2R4EA 2H89A 2EQ7A 3QVPA 2X8CA 2YM2A 4EQWA 3REDA 2C3CA 5J7XA 3UOXA 2YLTA 3ITJA 5JCLA 4GR1A 1GRBA 2ZZ0A 2VRMA 2ARDA 3T2KA 2HQMA 3ISHA 1ZKQA 5FS8A 3KVEA 4C3YA 3AWIA 4K8DA 3P1WA 4N9XA 4GUVA 4U8JA 2C4CA 3AEAA 3S61A 5KVHA 4CRTA 5U63A 2XVEA 4REKA 4YSYA 3CPJG 3P9UA 3URHA 2YM1A 3G5SA 3CGCA 3H4KA 2GB0A 4RSLA 2VQBA 4RG3A 2YR6A 2XVHA 1QJDA 4YTMA 5IPYA 2VZ2A 3NH3X 4D04A 2V6OA 2OAMA 1PXAA 4I58A 4U8IA 3DMEA 1NHQA 5HHFA 1M6IA 1JOAA 2Q7VA 4J34A 3ICRA 2B9WA 1TYTA 3E1TA 3AE1A 4H4RA 1K0IA 1ZY8A 3DK4A 4UDQA 4EQSA 3I6DA 4TLZA 1RP0A 4O5QA 2YG6A 2VOUA 4XWRA 1DJQA 3VQRA 4YSXA 2BS3A 1XDIA 3AD8B 3NN0X 4B67A 3M12A 2YLSA 4Z24A 3DJGX 4J56A 3HYVA 3SZ0A 3VR9A 1GRTA 4WX1A 3SYIA 3FBSA 4U2LA 5KOWA 4AP3A 3AE3A 2YR4A 1BZLA 3QFAA 3HZLA 4IA5A 1REOA 4H4WA 2GMHA 4TM0A 3RHAA 1SEZA 1TDKA 4B63A 4NTDA 2XFOA 4EM4A 2Y6QA 1DOBA 2GQFA 1DOEA 2Z5XA 2CULA 1BWCA 4IVOB 2RABA 3T31A 5KMQA 2OA1A 1PXBA 3P4RA 2QA2A 2FJBA 4X9MA 1K4QA 1QO8A 4KPRA 4DSGA 3BHFA 1RSGA 1H7WA 4II2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TYP A;  1MXT A;  2RGO A;  1NHS A;  4H4P A;  4Y4L A;  1F3P A;  3LXD A;  3QSS A;  3NK1 X;  2TMD A;  1LQT A;  4A65 A;  2JBV A;  3ADA B;  2BC1 A;  4FDC B;  2GAH B;  4EIP A;  1QLB A;  1E1N A;  4B65 A;  3QJ4 A;  5M10 A;  2JAE A;  2FBW A;  2WP6 A;  1N1P A;  2FJD A;  4A5L A;  4LU6 A;  1F8S A;  2C65 A;  5CKU A;  5KXJ A;  1O5W A;  1OJT A;  2B76 A;  4OPT A;  1GND A;  3UTE A;  1JU2 A;  5KWF A;  2VQ7 A;  2NVK X;  1MOK A;  2E1M A;  1IUU A;  3GD3 A;  3DA1 A;  3UKL A;  2BAC A;  4X4J A;  1IJH A;  1OJ9 A;  1PBD A;  5FS6 A;  1F8R A;  3AE6 A;  3OC4 A;  1PJ7 A;  1ZMD A;  4OCG A;  1OJD A;  4JY3 A;  4H4S A;  2B9X A;  1PBC A;  3VRB A;  2X99 A;  4HB9 A;  3NYF A;  3VRA A;  1OJA A;  5EB5 A;  1B4V A;  4J36 A;  2YLZ A;  3AE4 A;  4J33 A;  4UP3 A;  1O94 A;  3GYJ A;  3V76 A;  4Z44 A;  3UTH A;  1H7X A;  2GV8 A;  1DOC A;  3AB1 A;  3ALJ A;  1TDO A;  3DK9 A;  3AYJ A;  3BI4 A;  4A6N B;  4Z43 A;  1S3E A;  1IUT A;  5ER0 A;  3G5Q A;  3I3L A;  4EIQ A;  1M64 A;  4I59 A;  2PYX A;  2O9Z A;  4C5O A;  2DKI A;  2GQW A;  2YVJ A;  2IVD A;  3UKH A;  4BK1 A;  4Z2R A;  1XAN A;  3AXB A;  1PBE A;  3UP5 A;  1NEK A;  5HY5 A;  3CGE A;  3BNM A;  4M52 A;  4Z2U A;  4U8N A;  1IUV A;  1VQW A;  3WE0 A;  4JNQ A;  1PJ6 A;  3UOY A;  2XLP A;  4H4Z A;  1PN0 A;  1GOS A;  2I0Z A;  3UKA A;  3ZYX A;  4H4Q A;  1JRX A;  2XFN A;  3CIR A;  4GCM A;  1GTE A;  5LV9 A;  1CJ4 A;  1N4V A;  3NLC A;  3SFE A;  2OLN A;  1FCD A;  4YT0 A;  4CBQ A;  5HXI A;  1V59 A;  3FIM B;  2ZBW A;  3RP7 A;  2WBA A;  1H82 A;  3C96 A;  4X9N A;  4IVM B;  4YKG A;  4YSZ A;  2XVF A;  3SGL A;  1FEC A;  4EQX A;  2Q0K A;  2XLT A;  4CCQ A;  4USR A;  3H8L A;  4JN9 A;  1TDF A;  3GRS A;  2APG A;  3BHK A;  1GXF A;  1GT8 A;  1Q1R A;  2OAL A;  1PJ5 A;  2XCG A;  4K5S A;  1CJ3 A;  3RP8 A;  2YG7 A;  2XLS A;  3P4Q A;  1Y0P A;  3BI5 A;  4NTE A;  2WEU A;  2BS4 A;  1Y56 A;  4JY2 A;  4DSH A;  4BK2 A;  2J3N A;  2QA1 A;  1IUS A;  1YKJ A;  4ZCC A;  4LA1 A;  1CC6 A;  2AQJ A;  2BXR A;  2AAQ A;  1D4C A;  2FJE A;  3GRT A;  3KD9 A;  4U8M A;  1DNC A;  3AYI A;  4OVI A;  4WCT A;  4OPI A;  1ONF A;  1UKV G;  1GET A;  3FMW A;  1CHU A;  4D03 A;  3UKP A;  4APN A;  1JRY A;  4DGK A;  2C73 A;  1EL8 A;  2GR2 A;  2WOI A;  3QSM A;  4RG4 A;  2WDV A;  3G5R A;  3M13 A;  5C3J A;  2CVJ A;  4EMI A;  3IF9 A;  1IUX A;  1PHH A;  3NRN A;  3PS9 A;  4C74 A;  1NEN A;  3DGZ A;  4H4Y A;  1NDA A;  5JCI A;  1N4W A;  3RP6 A;  2X8H A;  2XLU A;  2BK3 A;  2YLW A;  2WPE A;  2BK5 A;  4H2P A;  3CNT A;  1LVL A;  2WQY A;  2NPX A;  3BI2 A;  3PVC A;  2X8G A;  3GYI A;  5KRQ A;  1ZOY A;  2AR8 A;  2XLR A;  3K7M X;  1E1K A;  4CY8 A;  5JCM A;  2Y6R A;  1FL2 A;  1LV0 A;  3IHM A;  3CNP A;  4BJY A;  4PAB A;  2CFY A;  2R45 A;  2OLO A;  2XFQ A;  2R4J A;  4TM3 A;  2YQU A;  3NIX A;  1NHR A;  2PHH A;  4H50 A;  2DKH A;  3UOZ A;  4YXD A;  5U25 A;  1GRF A;  1YQZ A;  1P2H A;  2VVM A;  3NG7 X;  3ZDN A;  3CTY A;  1ZMC A;  1KF6 A;  4DNA A;  4UDR A;  3CGD A;  1K0J A;  1L9E A;  3NYE A;  1B37 A;  1PS9 A;  2C67 A;  2E5V A;  3DH9 A;  2JB2 A;  2YG5 A;  3AEE A;  4AOX A;  1BGJ A;  3UTG A;  2R0G A;  3Q9T A;  1TRB A;  1D4E A;  4YTP A;  2YVF A;  3EAN A;  1ZX9 A;  1L9D A;  2V3B A;  1TDE A;  2WES A;  5IQ1 A;  5DBJ A;  1HYU A;  2YLR A;  1EL5 A;  2VVL G;  1MO9 A;  4C77 A;  3CND A;  1EBD A;  1W4X A;  2FJA A;  2R0C A;  3QFB A;  4BUR A;  4ECH A;  1FEB A;  3EPT A;  4H4V A;  3AE9 A;  2WP5 A;  1PDH A;  5C2T A;  2WPC A;  2YVG A;  4IA6 A;  3FG2 P;  4E0V A;  3SQP A;  3CGB A;  4A9W A;  3D8X A;  1Y56 B;  3QSE A;  1P2E A;  4B1B A;  1GPE A;  4ZN0 A;  1KNR A;  1NAA A;  5BVA A;  1K0L A;  1D4D A;  1E7P A;  1LPF A;  2BXS A;  2RGJ A;  4JNA A;  3NK0 X;  4AT2 A;  2GR3 A;  5EOW A;  1H86 A;  1CF3 A;  1GER A;  2GF3 A;  4YKF A;  5IQ4 A;  1H84 A;  3AEC A;  3AD7 B;  3GDP A;  1YY5 A;  4FK1 A;  1H81 A;  4GDE A;  1KNP A;  3UCL A;  5KVI A;  5EB4 A;  3GSI A;  4Z26 A;  2YWL A;  3AEB A;  3EAO A;  3AEG A;  4U2S A;  1BKW A;  4USQ A;  2WET A;  3D1C A;  4J31 A;  2WPF A;  1S2Q A;  5BUL A;  4TM4 A;  2BYB A;  1LQU A;  2WP9 A;  4UDP A;  2C3D A;  1GRH A;  4BV6 A;  1B5Q A;  1CJ2 A;  5JCK A;  1S2Y A;  2TPR A;  4FX9 A;  3KU9 A;  1VRQ B;  3LAD A;  1GEU A;  3P4P A;  3L1R A;  4P9S A;  1Q9I A;  2XVI A;  3P4S A;  2H88 A;  3II4 A;  1GRE A;  2ZZB A;  2EQ6 A;  4CY6 A;  2JK6 A;  4OPD A;  3T37 A;  4HA6 A;  2GR1 A;  3L8K A;  3IC9 A;  1B8S A;  2YR5 A;  4U8K A;  5BUK A;  4CNJ A;  2C7G A;  1VG9 A;  1YQ4 A;  2UZZ A;  2XYO A;  3AD9 B;  2GMJ A;  4U8O A;  1E39 A;  4K22 A;  2C75 A;  2BA9 A;  2B9Y A;  3KA7 A;  3SM8 A;  4YSH A;  1GV4 A;  3B3R A;  3RNM A;  4ICY A;  1CC2 A;  1YQ3 A;  1XPQ A;  4OPC A;  4B66 A;  5JCN A;  1CL0 A;  5M0Z A;  3UOV A;  1D7Y A;  3F8P A;  2Q6U A;  3ALM A;  4LII A;  1ZDL A;  5BRT A;  3NK2 X;  4IV9 A;  4KX6 A;  2GEW A;  2B7S A;  1KFY A;  2CDU A;  3ATQ A;  2W0H A;  2EQ9 A;  3LB8 A;  1ZK7 A;  2JB3 A;  3M0O A;  1OJC A;  3CPI G;  3JSK A;  3UKK A;  1BGN A;  4U8L A;  3DK8 A;  1ZOV A;  4JQ9 A;  2JB1 A;  2XVJ A;  3B6D A;  3KPF A;  3GMC A;  3KKJ A;  1KSU A;  2R0P A;  1GRG A;  2YG4 A;  2B7R A;  4B69 A;  1D7L A;  3AED A;  1PXC A;  1JRZ A;  3DJD A;  4ZCD A;  4OPU A;  2V3A A;  2F5Z A;  4TM1 A;  2C64 A;  2WHD A;  1GRA A;  4J57 A;  3IWA A;  5U1O A;  4CNK A;  1JNR A;  1H83 A;  2Q0L A;  3NTA A;  4U2T A;  4GF7 A;  4A6N A;  4OPL A;  3V3O A;  2C70 A;  2JKC A;  2R46 A;  3GMB A;  4J2W A;  3GD4 A;  1GAL A;  1Z6L A;  2V61 A;  1CC4 A;  3C4A A;  4K5R A;  4B64 A;  2BC0 A;  1E1M A;  1ZP0 A;  2WOW A;  3NNE A;  4YTN A;  3F8R A;  2WU5 A;  3ABV A;  3GWF A;  3K7T A;  4Y4M A;  3FPZ A;  2BCG G;  1GTH A;  2BAB A;  2BS2 A;  2XFP A;  1XHC A;  4CCR A;  1F6M A;  4EMW A;  1H6V A;  5L46 A;  1L0V A;  3AE7 A;  2A87 A;  4AOS A;  3ICT A;  1S3B A;  5FS7 A;  5HYM A;  1EL9 A;  4A99 A;  3H8I A;  4BK3 A;  3NKS A;  2YG3 A;  2GH5 A;  3NGC X;  3GDN A;  2YAU A;  4H4T A;  1PBF A;  1NPX A;  3DJE A;  3LJP A;  4PAA A;  3OZ2 A;  2V60 A;  3CNJ A;  3Q6J A;  1LTX R;  3O0H A;  3S5W A;  4H2R A;  4NTC A;  5J60 A;  4EM3 A;  1X31 B;  3QVR A;  4NZH A;  4O5U A;  1AOG A;  4NEW A;  3R9U A;  4K7Z A;  2C72 A;  3UTF A;  4H4U A;  3NHO X;  4EQR A;  2WS3 A;  3DGH A;  4H7U A;  4FK1 C;  3GWD A;  2GR0 A;  4JDR A;  5CQF A;  1KDG A;  1FOH A;  4OPG A;  2EQ8 A;  1E1L A;  1F8W A;  1CBO A;  3ICS A;  3NT6 A;  3LZX A;  5GRT A;  2A89 A;  1VG0 A;  1N4U A;  4H2N A;  3VRD B;  3AE5 A;  2VVL A;  3AE2 A;  1Q1W A;  2WDQ A;  2IID A;  4A79 A;  4AP1 A;  2A8X A;  4A7A A;  3K30 A;  2XFU A;  3CN8 A;  1JEH A;  1ELI A;  4GDP A;  3LZW A;  1FEA A;  4C3X A;  2XDO A;  4ADW A;  4Y4N A;  1PBB A;  1IUW A;  4EMJ A;  2BCP A;  1NG3 A;  2R9Z A;  1RYI A;  5TR3 A;  2V5Z A;  4H2Q A;  1O95 A;  2GAG B;  3IHG A;  4AT0 A;  2QCU A;  3NYC A;  1DOD A;  2Z5Y A;  2ACZ A;  2WDR A;  2C66 A;  1CJC A;  3C4N A;  1GES A;  2WOV A;  2GVC A;  5EBK A;  3AYL A;  3V3N A;  2GRT A;  3DJJ A;  2C76 A;  3ALL A;  1NHP A;  2VRL A;  5FMH A;  1GSN A;  3PO7 A;  2WU2 A;  3AEF A;  4MJW A;  3BNU A;  4XXG A;  5GSN A;  3UKF A;  3KLJ A;  2IVE A;  3NTD A;  1E6E A;  1LJ1 A;  4H4X A;  2BK4 A;  3ATR A;  3CPH G;  3F8D A;  3LOV A;  4B68 A;  4YWO A;  2X3N A;  1BF3 A;  5FS9 A;  2RGH A;  4Z25 A;  4NEV A;  2X50 A;  2ZZC A;  2E4G A;  4XWZ A;  1EL7 A;  3UP4 A;  1VDC A;  3EF6 A;  2YLX A;  3AE8 A;  3NN6 X;  1TDN A;  4GRT A;  3K7Q X;  1L9C A;  3UKQ A;  1DXL A;  1NG4 A;  3SFD A;  4TLX A;  1COY A;  4U8P A;  1D5T A;  1DJN A;  3CNS A;  4K2X A;  4BJZ A;  3VR8 A;  5KOX A;  3COX A;  2QAE A;  1JNZ A;  4Z2T A;  1KSS A;  2R4E A;  2H89 A;  2EQ7 A;  3QVP A;  2X8C A;  2YM2 A;  4EQW A;  3RED A;  2C3C A;  5J7X A;  3UOX A;  2YLT A;  3ITJ A;  5JCL A;  4GR1 A;  1GRB A;  2ZZ0 A;  2VRM A;  2ARD A;  2HQM A;  3ISH A;  1ZKQ A;  5FS8 A;  3KVE A;  4C3Y A;  3AWI A;  4K8D A;  3P1W A;  4N9X A;  4GUV A;  4U8J A;  3AEA A;  3S61 A;  5KVH A;  4CRT A;  5U63 A;  2XVE A;  4REK A;  4YSY A;  3CPJ G;  3P9U A;  3URH A;  2YM1 A;  3G5S A;  3CGC A;  3H4K A;  2GB0 A;  4RSL A;  2VQB A;  4RG3 A;  2YR6 A;  2XVH A;  1QJD A;  4YTM A;  5IPY A;  2VZ2 A;  3NH3 X;  4D04 A;  2V6O A;  2OAM A;  1PXA A;  4I58 A;  4U8I A;  3DME A;  1NHQ A;  5HHF A;  1M6I A;  1JOA A;  2Q7V A;  4J34 A;  3ICR A;  2B9W A;  1TYT A;  3E1T A;  3AE1 A;  4H4R A;  1K0I A;  1ZY8 A;  3DK4 A;  4UDQ A;  4EQS A;  3I6D A;  4TLZ A;  1RP0 A;  4O5Q A;  2YG6 A;  2VOU A;  4XWR A;  1DJQ A;  3VQR A;  4YSX A;  2BS3 A;  1XDI A;  3AD8 B;  3NN0 X;  4B67 A;  3M12 A;  2YLS A;  4Z24 A;  3DJG X;  4J56 A;  3VR9 A;  1GRT A;  4WX1 A;  3FBS A;  4U2L A;  5KOW A;  4AP3 A;  3AE3 A;  2YR4 A;  1BZL A;  3QFA A;  3HZL A;  4IA5 A;  1REO A;  4H4W A;  2GMH A;  4TM0 A;  3RHA A;  1SEZ A;  1TDK A;  4B63 A;  4NTD A;  2XFO A;  4EM4 A;  2Y6Q A;  1DOB A;  2GQF A;  1DOE A;  2Z5X A;  2CUL A;  1BWC A;  4IVO B;  2RAB A;  2OA1 A;  1PXB A;  3P4R A;  2QA2 A;  2FJB A;  4X9M A;  1K4Q A;  1QO8 A;  4KPR A;  4DSG A;  3BHF A;  1RSG A;  1H7W A; 
#chains in the Genus database with same CATH topology
 1MXT A;  2PCE A;  1X2G A;  4Y4L A;  1WYG A;  3NRZ B;  3IJI A;  4A65 A;  4FDC B;  5M10 A;  3RIT A;  4LU6 A;  5CKU A;  1MOK A;  3UKL A;  3GD3 A;  4EWJ A;  1PBD A;  3ZVI A;  1PJ7 A;  4OCG A;  4JY3 A;  4H4S A;  1PBC A;  2X99 A;  3VRA A;  1OJA A;  2POD A;  4MKS A;  3ETR B;  4J33 A;  2PU1 A;  3V76 A;  3MSY A;  2PSN A;  4E5T A;  3ALJ A;  4A6N B;  2ZC8 A;  2DKI A;  2YVJ A;  4KWS A;  2AL2 A;  1PBE A;  3DIP A;  1NEK A;  3NVZ B;  5EU9 A;  4ZA0 A;  3WE0 A;  3BJS A;  1JPD X;  5G5H B;  1GOS A;  3ZYX A;  4GCM A;  1CJ4 A;  1N4V A;  4CBQ A;  3HYW A;  4YKG A;  2GGE A;  4EQX A;  2Q0K A;  3H8L A;  2APG A;  1GT8 A;  1PJ5 A;  4K5S A;  3RP8 A;  3MKC A;  1D4C A;  3KD9 A;  3UJE A;  4U8M A;  3FMW A;  3RO6 A;  1JRY A;  2C73 A;  3A7U A;  2GR2 A;  2WDV A;  3M13 A;  1PHH A;  3NRN A;  3PS9 A;  1NEN A;  1MRA A;  3ZLF A;  1N4W A;  4H2P A;  2WQY A;  3GYI A;  5KRQ A;  3TW9 A;  5BOF A;  2QDE A;  3IJQ A;  2OLO A;  1TKK A;  4TM3 A;  2DKH A;  4H83 A;  1YQZ A;  3CTY A;  1ZMC A;  3CGD A;  4IT1 A;  3FCP A;  3EAN A;  1ZX9 A;  2VVL G;  1MO9 A;  3CND A;  2FJA A;  3EPT A;  3A7R A;  3AE9 A;  2WPC A;  2YVG A;  3SQP A;  3V5C A;  1Y56 B;  3D9X A;  5BVA A;  3H7V A;  3CB3 A;  2O56 A;  1LPF A;  3DER A;  4AT2 A;  3CK5 A;  5EOW A;  3AD7 B;  1N62 C;  3GDP A;  1YY5 A;  3UJR A;  3UCL A;  5EB4 A;  3CT2 A;  3DES A;  2WET A;  1S2Q A;  4MGG A;  5BUL A;  2BYB A;  1GRH A;  3VC6 A;  3L1R A;  1MDR A;  1TZZ A;  2E5A A;  3PG6 A;  3T6C A;  2JK6 A;  4ENL A;  1B8S A;  3R07 C;  5BUK A;  4CNJ A;  2OFJ A;  1V97 A;  4II3 A;  2UZZ A;  3AD9 B;  2XYO A;  2GMJ A;  1E39 A;  5KMP A;  4YSH A;  1GV4 A;  4ICY A;  4LII A;  4IV9 A;  2B7S A;  1KFY A;  3ATQ A;  1MDL A;  3JSK A;  3UKK A;  2R0P A;  1KCZ A;  2QVH A;  1JPM A;  2QDD A;  1EC7 A;  2C64 A;  2WHD A;  5U1O A;  1JNR A;  1H83 A;  4U2T A;  4NNJ A;  2Q0L A;  4OPL A;  1VQZ A;  3V3O A;  3FYY A;  3GMB A;  4J2W A;  3GD4 A;  1Z6L A;  1CC4 A;  1ZP0 A;  4YTN A;  4Y4M A;  3FPZ A;  2XFP A;  1N5X A;  1H6V A;  4EMW A;  3AE7 A;  1S3B A;  5FS7 A;  1EL9 A;  4BK3 A;  3DJE A;  2OQH A;  2PTW A;  2V60 A;  3CNJ A;  3Q6J A;  4NWZ A;  4H2R A;  4GYP A;  4ZOH B;  4H7U A;  2GR0 A;  4JDR A;  1KDG A;  1FOH A;  3ES7 A;  2XSX A;  3ICS A;  3NT6 A;  2XH7 A;  2A89 A;  4H2N A;  3SJN A;  2AKM A;  3AE5 A;  2PTZ A;  3TQP A;  1JEH A;  4E4U A;  3LZW A;  3T14 A;  2XDO A;  4Y4N A;  4EMJ A;  4J1O A;  2V5Z A;  3UCC A;  1N5W C;  4AT0 A;  3NYC A;  3V3N A;  3C4N A;  3P3B A;  3TJI A;  3A7A A;  3DEQ A;  1GSN A;  3PO7 A;  2WU2 A;  4XXG A;  2OO6 A;  3ENL A;  1LJ1 A;  2PA6 A;  4H4X A;  3LOV A;  2FKP A;  4YWO A;  4GME A;  2ZZC A;  3Q45 A;  4HPN A;  1VDC A;  2YLX A;  1TDN A;  4GRT A;  2ONE A;  3DFY A;  3UKQ A;  1MNS A;  3KPK A;  1X2H A;  1DXL A;  1COY A;  1E9I A;  1DJN A;  3CNS A;  4BJZ A;  2H89 A;  1JRP A;  2YM2 A;  3UOX A;  2C3C A;  1PDZ A;  5JCL A;  4HCD A;  2ARD A;  2HQM A;  5FS8 A;  4K8D A;  3AEA A;  1WUF A;  3K1G A;  3R0K A;  2CHR A;  1JRO A;  3T9P A;  4RG3 A;  2GB0 A;  2YR6 A;  1QJD A;  4TVY A;  5IPY A;  3JZU A;  2V6O A;  3TWA A;  2W55 A;  2Q7V A;  2B9W A;  3OTR A;  1RP0 A;  2QQ6 A;  4O5Q A;  2W3S A;  2YG6 A;  2VOU A;  4YSX A;  4JN8 A;  3MWC A;  3DGB A;  4Z24 A;  1W6T A;  1BQG A;  5KOW A;  2YR4 A;  3QFA A;  4IA5 A;  2OKT A;  4H4W A;  4TM0 A;  3VCC A;  2XFO A;  5FJO A;  1BWC A;  4HNC A;  3T31 A;  5KMQ A;  2PP1 A;  3PWI A;  3EKG A;  3FVD A;  3V4B A;  1NU5 A;  1F3P A;  3LXD A;  3UXK A;  3NK1 X;  3ADA B;  2BC1 A;  1QLB A;  2JAE A;  3FJ4 A;  4HCL A;  2NVK X;  2E1M A;  1IUU A;  3SN1 A;  2BAC A;  1IJH A;  1F8R A;  3OC4 A;  1ZMD A;  2RDX A;  5ENL A;  1T3Q C;  3R10 A;  4G7F A;  2B9X A;  3VRB A;  4ZCW A;  3NYF A;  3Q4D A;  3AE4 A;  5IDZ A;  3UTH A;  3DK9 A;  3BI4 A;  4Z43 A;  5ER0 A;  3G5Q A;  1M64 A;  2PYX A;  4A3R A;  4Z2R A;  4BK1 A;  2IVD A;  3UKH A;  2PTY A;  3P0W A;  4M52 A;  5JRB A;  1IUV A;  1PJ6 A;  3UOY A;  2XH4 A;  1PN0 A;  3UKA A;  3GC2 A;  1JRX A;  4GIR A;  5LV9 A;  3SFE A;  4F4R A;  1V59 A;  1H82 A;  4YSZ A;  2XVF A;  1RVK A;  4CCQ A;  5KNL A;  4USR A;  4JN9 A;  4DXK A;  3GRS A;  1GXF A;  2GGH A;  2XCG A;  1CJ3 A;  2YG7 A;  1Y0P A;  4NTE A;  3D46 A;  2BS4 A;  4BK2 A;  2J3N A;  1IUS A;  4ZCC A;  3UXL A;  2AAQ A;  3VCN A;  1PDY A;  4WCT A;  1GET A;  3SZC A;  3UKP A;  4APN A;  1EL8 A;  2WOI A;  3SSZ A;  5C3J A;  2QGY A;  3DGZ A;  4H4Y A;  2X8H A;  2WPE A;  2BK5 A;  2NPX A;  2X8G A;  1ZOY A;  1EBG A;  5JCM A;  1FL2 A;  3IHM A;  2R45 A;  2R4J A;  4M0X A;  2YQU A;  4H50 A;  4JN7 A;  2P3Z A;  4DNA A;  1K0J A;  3N6J A;  2C67 A;  2E5V A;  3DH9 A;  3UTG A;  3CAW A;  2R0G A;  3Q9T A;  1TRB A;  4YTP A;  2YVF A;  1L9D A;  3VC5 A;  2ZAD A;  4C77 A;  2PPG A;  1EBD A;  5FJP A;  3QFB A;  4BUR A;  4G73 A;  3QKE A;  1F9C A;  3OP2 A;  4IA6 A;  3FV9 A;  4A9W A;  1P2E A;  1GPE A;  4ZN0 A;  1K0L A;  1D4D A;  4A35 A;  1E7P A;  2RGJ A;  3NVY B;  4DHG A;  1GER A;  4YKF A;  3OZY A;  1H81 A;  4GDE A;  4G9K A;  2YWL A;  3EAO A;  3H70 A;  4A6G A;  4HCH A;  4J31 A;  4UDP A;  4BV6 A;  1CJ2 A;  1S7M A;  3NZG A;  4P9S A;  4OPD A;  2DW6 A;  3KUM A;  2C7G A;  4U8O A;  1YQ4 A;  2BA9 A;  3SM8 A;  1YQ3 A;  4B66 A;  3UOV A;  4H1Z A;  1FFU C;  1DTN A;  3F8P A;  4GYP C;  4KX6 A;  2CDU A;  1SJA A;  3QN3 A;  2EQ9 A;  3LB8 A;  1ZK7 A;  1OJC A;  3CPI G;  4U8L A;  4JQ9 A;  3B6D A;  3GMC A;  3T0K A;  4HN8 A;  1PXC A;  3CXO A;  3IWA A;  4A6N A;  3RR1 A;  2C70 A;  2OVL A;  2V61 A;  4B64 A;  3C4A A;  4K1W A;  3NNE A;  3ABV A;  3K7T A;  4E6M A;  4CCR A;  5L46 A;  4AOS A;  4A99 A;  1KKO A;  3GDN A;  1PBF A;  3OZ2 A;  4GGH A;  3R9U A;  3UTF A;  4H4U A;  1RM6 B;  2P0I A;  5CQF A;  1CBO A;  3PWG A;  3RCY A;  3SZF A;  3U9I A;  3K30 A;  2XFU A;  4MMW A;  1FEA A;  1SJD A;  4C3X A;  3AMZ A;  4ADW A;  1IUW A;  1NG3 A;  3UJ2 A;  4DN1 A;  5TR3 A;  4H2Q A;  2QCU A;  3OZM A;  4H19 A;  2WDR A;  2C66 A;  1CJC A;  1GES A;  2WOV A;  3AYL A;  5EBK A;  2GRT A;  2C76 A;  1IYX A;  1BKH A;  3UKF A;  3AEF A;  3I4K A;  3SX6 A;  3CPH G;  3UCD A;  1JDF A;  5BOE A;  1BF3 A;  2I5Q A;  4Z25 A;  3ZVH A;  4NEV A;  2GGI A;  6ENL A;  4XWZ A;  2XH2 A;  3EF6 A;  2OZ3 A;  2PGE A;  3SFD A;  2HZG A;  3MZN A;  3VR8 A;  1JNZ A;  4Z2T A;  2R4E A;  3QVP A;  3RED A;  4G8T A;  2VRM A;  4C3Y A;  3P1W A;  4GUV A;  2C4C A;  3S61 A;  3MUC A;  4YSY A;  3P9U A;  3URH A;  3G5S A;  4E8G A;  1EBH A;  1PXA A;  5HHF A;  1M6I A;  1JOA A;  1TYT A;  3E1T A;  3AE1 A;  4GGB A;  3EUB 3;  1ZXI C;  2PMQ A;  3VQR A;  3GD6 A;  2BS3 A;  3AD8 B;  4B67 A;  2YLS A;  3DJG X;  4J56 A;  1GRT A;  4U2L A;  3HZL A;  3B9J B;  3H12 A;  1DOB A;  2CUL A;  2RAB A;  4X9M A;  2QA2 A;  2FJB A;  3BHF A;  2RGO A;  2PP0 A;  3QSS A;  1LQT A;  2JBV A;  1E1N A;  4B65 A;  2FJD A;  4A5L A;  1XS2 A;  1YEY A;  2C65 A;  1O5W A;  1OJT A;  4IL2 A;  4OPT A;  1GND A;  3UTE A;  5KWF A;  2VQ7 A;  1OJ9 A;  5FS6 A;  2BRY A;  3VDG A;  4HB9 A;  3UJS A;  4J36 A;  2YLZ A;  4UP3 A;  1O94 A;  1H7X A;  1TDO A;  3AYJ A;  1S3E A;  2MUC A;  4JHM A;  4EIQ A;  2O9Z A;  1XAN A;  3AXB A;  4U8N A;  3QLD A;  2GL5 A;  2XLP A;  4H4Z A;  4HYR A;  2I0Z A;  2XFN A;  3NLC A;  4YT0 A;  3FIM B;  2ZBW A;  3RP7 A;  2WBA A;  3ES8 A;  3QPE A;  1R0M A;  5FJR A;  3BHK A;  2OAL A;  3BI5 A;  3BSM A;  2WEU A;  4DSH A;  1CC6 A;  2AQJ A;  2FJE A;  3GRT A;  3DG7 A;  1DNC A;  3AYI A;  1ONF A;  1UKV G;  2XGZ A;  2HNE A;  4D03 A;  2POZ A;  3QSM A;  4Z17 A;  3H8A A;  3IF9 A;  1IUX A;  5G5G B;  3OPS A;  5JCI A;  3RP6 A;  3SBF A;  2YLW A;  2AKZ A;  3CNT A;  1LVL A;  3PVC A;  3VFC A;  3K7M X;  1E1K A;  4CY8 A;  2Y6R A;  2CFY A;  2XFQ A;  3V3W A;  3NIX A;  5U25 A;  1GRF A;  3PK7 A;  1P2H A;  3NG7 X;  3I6E A;  3ZDN A;  3DFH A;  3QTP A;  4UDR A;  3MY9 A;  2YG5 A;  2JB2 A;  1BGJ A;  1D4E A;  5IQ1 A;  1TDE A;  1HYU A;  1FFV C;  4DX3 A;  1FEB A;  2OZ8 A;  4H4V A;  5C2T A;  1NAA A;  3N4E A;  2BXS A;  5FJU A;  4JNA A;  3NK0 X;  2OQY A;  2PS2 A;  1H86 A;  1CF3 A;  3U4F A;  5IQ4 A;  3R0U A;  4FK1 A;  1KNP A;  5KVI A;  3AEB A;  4U2S A;  1BKW A;  3R1Z A;  1ECQ A;  4GAP A;  3D1C A;  2WPF A;  3HRD C;  2C3D A;  1S2Y A;  1B5Q A;  4G74 A;  4FX9 A;  3NXL A;  3KU9 A;  1EC9 A;  1NEL A;  1GEU A;  3P4S A;  2ZZB A;  3T2Y A;  2EQ6 A;  4CY6 A;  4HA6 A;  3NFU A;  3IC9 A;  3MQT A;  3ZVH B;  4U8K A;  1VG9 A;  4IHC A;  2C75 A;  2B9Y A;  1ELS A;  1KN0 A;  2MNR A;  3B3R A;  5JCN A;  3SXI A;  1CL0 A;  5M0Z A;  2Q6U A;  3ALM A;  5BRT A;  2W0H A;  2JB3 A;  3M0O A;  4ROP A;  1BGN A;  3R25 A;  3KPF A;  1ZOV A;  2JB1 A;  2XVJ A;  3KKJ A;  1KSU A;  4FP1 A;  2B7R A;  1D7L A;  3IK4 A;  3T2Z A;  1JRZ A;  3DJD A;  4ZCD A;  2V3A A;  1GRA A;  4J57 A;  3P93 A;  3STP A;  4IL0 A;  3NVW B;  1GAL A;  1TE6 A;  3GYX A;  4Z1Y A;  4IZG A;  3F8R A;  2WU5 A;  3GWF A;  3THU A;  3EEZ A;  2BS2 A;  3ICT A;  5HYM A;  1KKR A;  4KT2 A;  3NKS A;  3R11 A;  2YG3 A;  2GH5 A;  2PP3 A;  2YAU A;  4H4T A;  4PAA A;  4FI4 A;  1LTX R;  3O0H A;  4NTC A;  4O5U A;  4NEW A;  3SZW A;  3TJ4 A;  4EQR A;  2WS3 A;  3DGH A;  4FK1 C;  3GWD A;  4K8G A;  4OPG A;  4HNL A;  2P8B A;  1VG0 A;  1N4U A;  4K2S A;  3VRD B;  1VDV A;  1SB3 B;  3AE2 A;  1Q1W A;  2IID A;  4A79 A;  4AP1 A;  2A8X A;  3T8Q A;  4A7A A;  2HXT A;  1WUE A;  3CN8 A;  4GDP A;  1ELI A;  1PBB A;  2BCP A;  5FJT A;  2R9Z A;  1RYI A;  1O95 A;  2GAG B;  3IHG A;  2Z5Y A;  2ACZ A;  2GVC A;  5FMH A;  1MUC A;  3KLJ A;  4B68 A;  3F8D A;  2BK4 A;  3L5O A;  2X3N A;  1N61 C;  2RGH A;  2X50 A;  2E4G A;  1EL7 A;  3UP4 A;  2OG9 A;  3AE8 A;  3NN6 X;  3K7Q X;  1L9C A;  2OLA A;  4TLX A;  4U8P A;  1D5T A;  5KOX A;  3COX A;  2QAE A;  1KSS A;  4EQW A;  3ITJ A;  3JW7 A;  2GDQ A;  1GRB A;  1ZKQ A;  2OX4 A;  3KVE A;  3AWI A;  4CRT A;  5KVH A;  5U63 A;  2YM1 A;  4RSL A;  2VQB A;  2VZ2 A;  3NH3 X;  4D04 A;  2OAM A;  4I58 A;  3DME A;  1NHQ A;  3AM9 A;  3ICR A;  4H4R A;  3RGT A;  1K0I A;  1ZY8 A;  4UDQ A;  4EQS A;  4TLZ A;  3DG6 A;  3NN0 X;  3M12 A;  2HXU A;  4H2H A;  3HYV A;  3SZ0 A;  4WX1 A;  3FBS A;  3AE3 A;  4GIS A;  1BZL A;  3OW1 A;  3RHA A;  1TDK A;  2Z5X A;  4IVO B;  2PTX A;  2OA1 A;  1K4Q A;  1QO8 A;  4KPR A;  1RSG A;  1TYP A;  1NHS A;  4G6G A;  1STZ A;  4H4P A;  2TMD A;  4EIP A;  2GAH B;  3QJ4 A;  2FBW A;  2WP6 A;  1N1P A;  2NQL A;  1F8S A;  5KXJ A;  2B76 A;  1JU2 A;  2GSH A;  3DA1 A;  3HPF A;  4X4J A;  3DDM A;  3AE6 A;  1OJD A;  5EB5 A;  1B4V A;  3GYJ A;  4Z44 A;  2GV8 A;  3AB1 A;  1DOC A;  1IUT A;  2QJN A;  3I3L A;  4I59 A;  4C5O A;  2GQW A;  3UP5 A;  7ENL A;  5HY5 A;  3CGE A;  3BNM A;  1H2I A;  4Z2U A;  2OPJ A;  1VQW A;  4JNQ A;  4H4Q A;  3CIR A;  1GTE A;  2OLN A;  3AN1 A;  1FCD A;  5HXI A;  1SJB A;  3NO1 A;  3C96 A;  4X9N A;  4IVM B;  3NS1 B;  3UJF A;  3SGL A;  1FEC A;  2XLT A;  3NVV B;  3GO2 A;  2XH0 A;  1TDF A;  3CXB A;  1L8P A;  1Q1R A;  2XLS A;  3P4Q A;  1OEP A;  2DW7 A;  4KPL A;  1Y56 A;  2BRA A;  4JY2 A;  2QA1 A;  4X2P A;  1YKJ A;  4LA1 A;  2E3T A;  2BXR A;  3CMM A;  4OVI A;  4OPI A;  1CHU A;  3TCS A;  3PFR A;  4DGK A;  1SJC A;  1N63 C;  4RG4 A;  3G5R A;  2CVJ A;  4EMI A;  3UGV A;  4C74 A;  3FXG A;  3SY4 A;  1NDA A;  2OZT A;  2XLU A;  2BK3 A;  3BI2 A;  2AR8 A;  2XLR A;  4GAV A;  1LV0 A;  3CNP A;  4BJY A;  3V5F A;  4PAB A;  2P8C A;  3UOZ A;  1NHR A;  2PHH A;  4YXD A;  3BOX A;  4IP5 A;  2VVM A;  1KF6 A;  1L9E A;  3NYE A;  1B37 A;  3VA8 A;  3D47 A;  1PS9 A;  3AEE A;  3SQS A;  4AOX A;  3IJL A;  2V3B A;  2WES A;  5DBJ A;  2YLR A;  1EL5 A;  1W4X A;  3RRA A;  2R0C A;  2W3R A;  3JVA A;  1KD0 A;  4ECH A;  1FIQ B;  2WP5 A;  1PDH A;  3FG2 P;  4E0V A;  3CGB A;  3D8X A;  3QSE A;  4B1B A;  1KNR A;  2GR3 A;  2GF3 A;  1H84 A;  3AEC A;  2PU0 A;  3GSI A;  4Z26 A;  2QJJ A;  3AEG A;  4USQ A;  4G6H A;  3SN4 A;  5KMR A;  4TM4 A;  1LQU A;  2WP9 A;  5JCK A;  2TPR A;  1VRQ B;  3LAD A;  3P4P A;  3CYJ A;  4E4F A;  1Q9I A;  2XVI A;  2H88 A;  3II4 A;  1GRE A;  4J3Z A;  3T37 A;  2AL2 B;  2GR1 A;  3L8K A;  2YR5 A;  4K22 A;  3ZLH A;  3KA7 A;  3RNM A;  1CC2 A;  1XPQ A;  4OPC A;  1D7Y A;  1EC8 A;  2PGW A;  1ZDL A;  3NK2 X;  2GEW A;  3DK8 A;  2YG4 A;  1GRG A;  3SN0 A;  4B69 A;  3AED A;  1JCT A;  5KMS A;  4OPU A;  2FYM A;  2F5Z A;  4TM1 A;  4DWD A;  4CNK A;  4YWS A;  3NTA A;  1FHV A;  4GF7 A;  1ONE A;  2AL1 A;  2JKC A;  2R46 A;  4K5R A;  2BC0 A;  1E1M A;  2WOW A;  2BCG G;  1GTH A;  1XPY A;  2BAB A;  1XHC A;  3T4W A;  1FO4 A;  1F6M A;  1L0V A;  2A87 A;  3TTE A;  3H8I A;  4DYE A;  3NGC X;  3LJP A;  1NPX A;  3S5W A;  3ZLG A;  3TOY A;  5J60 A;  4EM3 A;  1X31 B;  3QVR A;  4NZH A;  1AOG A;  4K7Z A;  2C72 A;  3NHO X;  3I6T A;  2EQ8 A;  1E1L A;  1F8W A;  4TVW A;  1R6W A;  3LZX A;  5GRT A;  3N6H A;  2VVL A;  2WDQ A;  3HYX A;  1P43 A;  5J04 A;  3GY1 A;  2GGG A;  1DOD A;  1P48 A;  3DJJ A;  3SR6 B;  3ALL A;  1NHP A;  3S5S A;  2VRL A;  5GSN A;  4MJW A;  3BNU A;  3N4F A;  2IVE A;  3NTD A;  1E6E A;  3ATR A;  1FHU A;  4GFI A;  5FS9 A;  3TWB A;  4IP4 A;  4M6U A;  3DG3 A;  1NG4 A;  2GGJ A;  4K2X A;  3HW2 A;  2EQ7 A;  2X8C A;  5J7X A;  2YLT A;  4GR1 A;  2ZZ0 A;  3T2K A;  4KEM A;  3ISH A;  4N9X A;  4U8J A;  2XVE A;  4REK A;  3B97 A;  3CPJ G;  1N60 C;  3CGC A;  3H4K A;  2XVH A;  4YTM A;  2W54 A;  4U8I A;  4J34 A;  3DK4 A;  3I6D A;  4XWR A;  2QJM A;  1DJQ A;  1XDI A;  3VR9 A;  3SYI A;  4AP3 A;  2P88 A;  1REO A;  2GMH A;  1SEZ A;  4B63 A;  4NTD A;  4EM4 A;  2Y6Q A;  2GQF A;  1DOE A;  3S47 A;  1PXB A;  3P4R A;  4DSG A;  1H7W A;  4II2 A; 
#chains in the Genus database with same CATH homology
 1TYP A;  1MXT A;  2RGO A;  1NHS A;  4G6G A;  4H4P A;  4Y4L A;  1F3P A;  3LXD A;  3QSS A;  3NK1 X;  2TMD A;  1LQT A;  4A65 A;  2JBV A;  3ADA B;  2BC1 A;  4FDC B;  2GAH B;  4EIP A;  1QLB A;  1E1N A;  4B65 A;  3QJ4 A;  5M10 A;  2JAE A;  2FBW A;  2WP6 A;  1N1P A;  2FJD A;  4A5L A;  4LU6 A;  1F8S A;  2C65 A;  5CKU A;  5KXJ A;  1O5W A;  1OJT A;  2B76 A;  4OPT A;  1GND A;  3UTE A;  1JU2 A;  5KWF A;  2VQ7 A;  2NVK X;  1MOK A;  2E1M A;  1IUU A;  3GD3 A;  3DA1 A;  3UKL A;  2BAC A;  4X4J A;  1IJH A;  1OJ9 A;  1PBD A;  5FS6 A;  2BRY A;  1F8R A;  3AE6 A;  3OC4 A;  1PJ7 A;  1ZMD A;  4OCG A;  1OJD A;  4JY3 A;  4H4S A;  2B9X A;  1PBC A;  3VRB A;  2X99 A;  4HB9 A;  3NYF A;  3VRA A;  1OJA A;  5EB5 A;  1B4V A;  4J36 A;  2YLZ A;  3AE4 A;  4J33 A;  4UP3 A;  1O94 A;  3GYJ A;  3V76 A;  4Z44 A;  3UTH A;  1H7X A;  2GV8 A;  1DOC A;  3AB1 A;  3ALJ A;  1TDO A;  3DK9 A;  3AYJ A;  3BI4 A;  4A6N B;  4Z43 A;  1S3E A;  1IUT A;  5ER0 A;  3G5Q A;  3I3L A;  4EIQ A;  1M64 A;  4I59 A;  2PYX A;  2O9Z A;  4C5O A;  2DKI A;  2GQW A;  2YVJ A;  2IVD A;  3UKH A;  4BK1 A;  4Z2R A;  1XAN A;  3AXB A;  1PBE A;  3UP5 A;  1NEK A;  5HY5 A;  3CGE A;  3BNM A;  4M52 A;  1H2I A;  4Z2U A;  4U8N A;  5JRB A;  1IUV A;  1VQW A;  3WE0 A;  4JNQ A;  1PJ6 A;  3UOY A;  2XLP A;  4H4Z A;  1PN0 A;  1GOS A;  2I0Z A;  3UKA A;  3ZYX A;  4H4Q A;  1JRX A;  2XFN A;  3CIR A;  4GCM A;  1GTE A;  5LV9 A;  1CJ4 A;  1N4V A;  3NLC A;  3SFE A;  2OLN A;  1FCD A;  4YT0 A;  4CBQ A;  5HXI A;  1V59 A;  3FIM B;  2ZBW A;  3RP7 A;  2WBA A;  1H82 A;  3C96 A;  4X9N A;  3HYW A;  4IVM B;  4YKG A;  4YSZ A;  2XVF A;  3SGL A;  1FEC A;  4EQX A;  2Q0K A;  2XLT A;  4CCQ A;  5KNL A;  4USR A;  3H8L A;  4JN9 A;  1TDF A;  3GRS A;  2APG A;  3BHK A;  1GXF A;  1GT8 A;  1Q1R A;  2OAL A;  1PJ5 A;  2XCG A;  4K5S A;  1CJ3 A;  3RP8 A;  2YG7 A;  2XLS A;  3P4Q A;  1Y0P A;  3BI5 A;  4NTE A;  2WEU A;  2BS4 A;  1Y56 A;  2BRA A;  4JY2 A;  4DSH A;  4BK2 A;  2J3N A;  2QA1 A;  1IUS A;  1YKJ A;  4ZCC A;  4LA1 A;  1CC6 A;  2AQJ A;  2BXR A;  2AAQ A;  1D4C A;  2FJE A;  3GRT A;  3CMM A;  3KD9 A;  4U8M A;  1DNC A;  3AYI A;  4OVI A;  4WCT A;  4OPI A;  1ONF A;  1UKV G;  1GET A;  3FMW A;  3SZC A;  1CHU A;  4D03 A;  3UKP A;  4APN A;  1JRY A;  4DGK A;  2C73 A;  1EL8 A;  2GR2 A;  2WOI A;  3QSM A;  4RG4 A;  2WDV A;  3G5R A;  3M13 A;  5C3J A;  2CVJ A;  4EMI A;  3IF9 A;  1IUX A;  1PHH A;  3NRN A;  3PS9 A;  4C74 A;  1NEN A;  3DGZ A;  4H4Y A;  1NDA A;  3SY4 A;  5JCI A;  1N4W A;  3RP6 A;  2X8H A;  2XLU A;  2BK3 A;  2YLW A;  2WPE A;  2BK5 A;  4H2P A;  3CNT A;  1LVL A;  2WQY A;  2NPX A;  3BI2 A;  3PVC A;  2X8G A;  3GYI A;  5KRQ A;  1ZOY A;  2AR8 A;  2XLR A;  4GAV A;  3K7M X;  1E1K A;  4CY8 A;  5JCM A;  2Y6R A;  1FL2 A;  1LV0 A;  3IHM A;  3CNP A;  4BJY A;  4PAB A;  2CFY A;  2R45 A;  2OLO A;  2XFQ A;  2R4J A;  4TM3 A;  2YQU A;  3NIX A;  1NHR A;  2PHH A;  4H50 A;  2DKH A;  3UOZ A;  4YXD A;  5U25 A;  1GRF A;  1YQZ A;  1P2H A;  2VVM A;  3NG7 X;  3ZDN A;  3CTY A;  1ZMC A;  1KF6 A;  4DNA A;  4UDR A;  3CGD A;  1K0J A;  1L9E A;  3NYE A;  1B37 A;  1PS9 A;  2C67 A;  2E5V A;  3DH9 A;  2JB2 A;  2YG5 A;  3AEE A;  4AOX A;  1BGJ A;  3UTG A;  2R0G A;  3Q9T A;  1TRB A;  1D4E A;  4YTP A;  2YVF A;  3EAN A;  1ZX9 A;  2V3B A;  1L9D A;  1TDE A;  2WES A;  5IQ1 A;  5DBJ A;  1HYU A;  2YLR A;  1EL5 A;  2VVL G;  1MO9 A;  4C77 A;  3CND A;  1EBD A;  1W4X A;  2FJA A;  2R0C A;  3QFB A;  4BUR A;  4ECH A;  1FEB A;  3EPT A;  4G73 A;  4H4V A;  3AE9 A;  2WP5 A;  1PDH A;  5C2T A;  2WPC A;  2YVG A;  4IA6 A;  3FG2 P;  4E0V A;  3SQP A;  3CGB A;  4A9W A;  3D8X A;  1Y56 B;  3D9X A;  1P2E A;  3QSE A;  1GPE A;  4B1B A;  1KNR A;  1NAA A;  4ZN0 A;  1K0L A;  5BVA A;  1D4D A;  1E7P A;  1LPF A;  2BXS A;  2RGJ A;  4JNA A;  3NK0 X;  4AT2 A;  2GR3 A;  5EOW A;  1H86 A;  1CF3 A;  1GER A;  2GF3 A;  4YKF A;  5IQ4 A;  1H84 A;  3AEC A;  3AD7 B;  3GDP A;  1YY5 A;  4FK1 A;  1H81 A;  4GDE A;  1KNP A;  4G9K A;  3UCL A;  5KVI A;  5EB4 A;  3GSI A;  4Z26 A;  2YWL A;  3AEB A;  3EAO A;  3AEG A;  4U2S A;  1BKW A;  4GAP A;  4USQ A;  2WET A;  4G6H A;  3D1C A;  4J31 A;  2WPF A;  1S2Q A;  5KMR A;  5BUL A;  4TM4 A;  2BYB A;  1LQU A;  2WP9 A;  4UDP A;  2C3D A;  1GRH A;  4BV6 A;  1B5Q A;  1CJ2 A;  5JCK A;  1S2Y A;  2TPR A;  4FX9 A;  3KU9 A;  4G74 A;  1VRQ B;  1S7M A;  3LAD A;  1GEU A;  3P4P A;  3L1R A;  4P9S A;  1Q9I A;  2XVI A;  3P4S A;  2H88 A;  3II4 A;  1GRE A;  2ZZB A;  3T2Y A;  2EQ6 A;  4CY6 A;  3PG6 A;  2JK6 A;  4OPD A;  3T37 A;  4HA6 A;  2GR1 A;  3L8K A;  3IC9 A;  1B8S A;  2YR5 A;  4U8K A;  5BUK A;  4CNJ A;  2C7G A;  1VG9 A;  1YQ4 A;  2UZZ A;  2XYO A;  3AD9 B;  2GMJ A;  4II3 A;  4U8O A;  1E39 A;  4K22 A;  2C75 A;  2BA9 A;  2B9Y A;  3KA7 A;  5KMP A;  3SM8 A;  4YSH A;  1GV4 A;  1KN0 A;  3B3R A;  3RNM A;  4ICY A;  1CC2 A;  1YQ3 A;  1XPQ A;  4OPC A;  4B66 A;  5JCN A;  3SXI A;  1CL0 A;  5M0Z A;  3UOV A;  1D7Y A;  3F8P A;  2Q6U A;  3ALM A;  4LII A;  1ZDL A;  5BRT A;  3NK2 X;  4IV9 A;  4KX6 A;  2GEW A;  2B7S A;  1KFY A;  2CDU A;  3ATQ A;  2W0H A;  2EQ9 A;  3LB8 A;  1ZK7 A;  2JB3 A;  3M0O A;  1OJC A;  3CPI G;  3JSK A;  3UKK A;  1BGN A;  4U8L A;  3DK8 A;  1ZOV A;  4JQ9 A;  2JB1 A;  2XVJ A;  3B6D A;  3KPF A;  3GMC A;  3KKJ A;  1KSU A;  2R0P A;  1GRG A;  2YG4 A;  2B7R A;  3T0K A;  4B69 A;  1D7L A;  3AED A;  3T2Z A;  1PXC A;  1JRZ A;  3DJD A;  4ZCD A;  4OPU A;  2V3A A;  5KMS A;  2F5Z A;  4TM1 A;  2C64 A;  2WHD A;  1GRA A;  4J57 A;  3IWA A;  5U1O A;  4CNK A;  1JNR A;  1H83 A;  2Q0L A;  3NTA A;  4NNJ A;  4GF7 A;  4U2T A;  4OPL A;  4A6N A;  3V3O A;  2C70 A;  2JKC A;  2R46 A;  3GMB A;  4J2W A;  3GD4 A;  1GAL A;  1Z6L A;  2V61 A;  1CC4 A;  3C4A A;  4K5R A;  4B64 A;  3GYX A;  1E1M A;  2BC0 A;  1ZP0 A;  2WOW A;  3NNE A;  4YTN A;  3F8R A;  2WU5 A;  3ABV A;  3GWF A;  3K7T A;  4Y4M A;  3FPZ A;  2BCG G;  1GTH A;  2BAB A;  2BS2 A;  2XFP A;  1XHC A;  4CCR A;  1F6M A;  4EMW A;  1H6V A;  5L46 A;  1L0V A;  3AE7 A;  2A87 A;  4AOS A;  3ICT A;  1S3B A;  5FS7 A;  5HYM A;  1EL9 A;  4A99 A;  3H8I A;  4BK3 A;  3NKS A;  2YG3 A;  2GH5 A;  3NGC X;  3GDN A;  2YAU A;  4H4T A;  1PBF A;  1NPX A;  3DJE A;  3LJP A;  4PAA A;  3OZ2 A;  2V60 A;  3CNJ A;  3Q6J A;  1LTX R;  3O0H A;  4NWZ A;  3S5W A;  4H2R A;  4NTC A;  5J60 A;  4EM3 A;  1X31 B;  3QVR A;  4NZH A;  4O5U A;  1AOG A;  4NEW A;  3R9U A;  3SZW A;  4K7Z A;  2C72 A;  3UTF A;  4H4U A;  3NHO X;  4EQR A;  2WS3 A;  3DGH A;  4H7U A;  4FK1 C;  3GWD A;  2GR0 A;  4JDR A;  5CQF A;  1KDG A;  1FOH A;  4OPG A;  2EQ8 A;  1E1L A;  1F8W A;  1CBO A;  3ICS A;  3NT6 A;  3LZX A;  5GRT A;  2A89 A;  1VG0 A;  1N4U A;  4H2N A;  3VRD B;  3SZF A;  3AE5 A;  2VVL A;  3AE2 A;  1Q1W A;  2WDQ A;  2IID A;  4A79 A;  3HYX A;  4AP1 A;  2A8X A;  4A7A A;  3K30 A;  2XFU A;  3CN8 A;  1JEH A;  1ELI A;  4GDP A;  3LZW A;  1FEA A;  4C3X A;  3T14 A;  2XDO A;  4ADW A;  4Y4N A;  1PBB A;  1IUW A;  4EMJ A;  2BCP A;  1NG3 A;  2R9Z A;  1RYI A;  5TR3 A;  2V5Z A;  4H2Q A;  1O95 A;  2GAG B;  3IHG A;  4AT0 A;  2QCU A;  3NYC A;  1DOD A;  2Z5Y A;  2ACZ A;  2WDR A;  2C66 A;  1CJC A;  3C4N A;  1GES A;  2WOV A;  2GVC A;  5EBK A;  3AYL A;  3V3N A;  2GRT A;  3DJJ A;  2C76 A;  3ALL A;  1NHP A;  2VRL A;  5FMH A;  1GSN A;  3PO7 A;  2WU2 A;  3AEF A;  4MJW A;  3BNU A;  4XXG A;  5GSN A;  3UKF A;  3KLJ A;  2IVE A;  3NTD A;  3SX6 A;  1E6E A;  1LJ1 A;  4H4X A;  2BK4 A;  3ATR A;  3CPH G;  3L5O A;  3F8D A;  3LOV A;  4B68 A;  4YWO A;  2X3N A;  1BF3 A;  5FS9 A;  2RGH A;  4Z25 A;  4NEV A;  2X50 A;  2ZZC A;  2E4G A;  4XWZ A;  1EL7 A;  3UP4 A;  1VDC A;  3EF6 A;  2YLX A;  3AE8 A;  3NN6 X;  1TDN A;  4GRT A;  3K7Q X;  1L9C A;  3UKQ A;  3KPK A;  1DXL A;  1NG4 A;  3SFD A;  4TLX A;  1COY A;  4U8P A;  1D5T A;  1DJN A;  3CNS A;  4K2X A;  4BJZ A;  3VR8 A;  5KOX A;  3COX A;  2QAE A;  1JNZ A;  4Z2T A;  1KSS A;  2R4E A;  2H89 A;  2EQ7 A;  3QVP A;  2X8C A;  2YM2 A;  4EQW A;  3RED A;  2C3C A;  5J7X A;  3UOX A;  2YLT A;  3ITJ A;  5JCL A;  4GR1 A;  1GRB A;  2ZZ0 A;  2VRM A;  2ARD A;  3T2K A;  2HQM A;  3ISH A;  1ZKQ A;  5FS8 A;  3KVE A;  4C3Y A;  3AWI A;  4K8D A;  3P1W A;  4N9X A;  4GUV A;  4U8J A;  2C4C A;  3AEA A;  3S61 A;  5KVH A;  4CRT A;  5U63 A;  2XVE A;  4REK A;  4YSY A;  3CPJ G;  3P9U A;  3URH A;  2YM1 A;  3G5S A;  3CGC A;  3H4K A;  2GB0 A;  4RSL A;  2VQB A;  4RG3 A;  2YR6 A;  2XVH A;  1QJD A;  4YTM A;  5IPY A;  2VZ2 A;  3NH3 X;  4D04 A;  2V6O A;  2OAM A;  1PXA A;  4I58 A;  4U8I A;  3DME A;  1NHQ A;  5HHF A;  1M6I A;  1JOA A;  2Q7V A;  4J34 A;  3ICR A;  2B9W A;  1TYT A;  3E1T A;  3AE1 A;  4H4R A;  1K0I A;  1ZY8 A;  3DK4 A;  4UDQ A;  4EQS A;  3I6D A;  4TLZ A;  1RP0 A;  4O5Q A;  2YG6 A;  2VOU A;  4XWR A;  1DJQ A;  3VQR A;  4YSX A;  2BS3 A;  1XDI A;  3AD8 B;  3NN0 X;  4B67 A;  3M12 A;  2YLS A;  4Z24 A;  3DJG X;  4J56 A;  3HYV A;  3SZ0 A;  3VR9 A;  1GRT A;  4WX1 A;  3SYI A;  3FBS A;  4U2L A;  5KOW A;  4AP3 A;  3AE3 A;  2YR4 A;  1BZL A;  3QFA A;  3HZL A;  4IA5 A;  1REO A;  4H4W A;  2GMH A;  4TM0 A;  3RHA A;  1SEZ A;  1TDK A;  4B63 A;  4NTD A;  2XFO A;  4EM4 A;  2Y6Q A;  1DOB A;  2GQF A;  1DOE A;  2Z5X A;  2CUL A;  1BWC A;  4IVO B;  2RAB A;  3T31 A;  5KMQ A;  2OA1 A;  1PXB A;  3P4R A;  2QA2 A;  2FJB A;  4X9M A;  1K4Q A;  1QO8 A;  4KPR A;  4DSG A;  3BHF A;  1RSG A;  1H7W A;  4II2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...