3OC4A

Crystal structure of a pyridine nucleotide-disulfide family oxidoreductase from the enterococcus faecalis v583
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
442
structure length
422
Chain Sequence
LKIVIIGASFAGISAAIASRKKYPQAEISLIDKQATVGYLSGRYITEEELRRQKIQLLLNREVVAMDVENQLIAWTRKEEQQWYSYDKLILATGASQFSTQIRGSQTEKLLKYKFLSAVPLLENSQTVAVIGAGPIGMEAIDFLVKMKKTVHVFESLENLLPKYFDKEMVAEVQKSLEKQAVIFHFEETVLGIEETANGIVLETSEQEISCDSGIFALNLHPQLAYLDKKIQRNLDQTIAVDAYLQTSVPNVFAIGDCISVMNEPVAETFYAPLVNNAVRTGLVVANNLEEKTHRFIGSLRTMGTKVGDYYLASTGLTETEGLFFPQTLASIIVRQPAPPLQHGTEILGKLIYDKVTQRVLGAQLCSKNNCLEKINTLALSIQTGQTLTDLLQKDYFYQPSLTNIYDITNLMGASAYWREND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxidoreductase, pyridine nucleotide-disulfide family
publication title Crystal Structure of a pyridine nucleotide-disulfide family oxidoreductase from the Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase
total genus 119
structure length 422
sequence length 442
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3oc4A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3oc4A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3oc4A02
1GRFA 2YR4A 3S5WA 1FOHA 2BACA 2WDVA 3NYFA 1JU2A 4FK1A 3VR9A 4EMWA 2WOIA 2Q6UA 3DK9A 3SM8A 1ONFA 3VRDB 1OJ9A 1TRBA 5JCMA 1Y0PA 2XDOA 3NK0X 1YKJA 4NTEA 1GSNA 1D7YA 1IUXA 2C65A 2X8CA 2Q0LA 4ICYA 4XXGA 4UP3A 3P4PA 1D4CA 3AE8A 2C72A 4A6NB 1YQ3A 1IUSA 1M64A 2EQ9A 4D04A 1JNZA 4JQ9A 4TM1A 1Q9IA 2DKIA 2V3BA 1Y56B 3H8LA 1JNRA 1NHRA 2JB3A 3OC4A 1L9DA 3UKKA 2C73A 1F6MA 3EF6A 2YQUA 3K7QX 1TDKA 4ZCCA 1E1MA 1EBDA 3DGZA 4WX1A 4BK1A 4UDPA 4Y4NA 3UTEA 1GETA 1AOGA 2BK5A 3NGCX 2V61A 2C3DA 2C3CA 1GALA 1O95A 2WDQA 4U8MA 4REKA 1CF3A 2YLRA 3FPZA 4U8LA 1DJQA 2BC1A 1QO8A 2GMJA 1RSGA 4GUVA 4TLZA 1GRHA 2WS3A 1ZP0A 3QVRA 4JNAA 3CIRA 3OZ2A 3CNTA 3C96A 4NTDA 2BS2A 2XLRA 4K2XA 3SFDA 3AEEA 3AE3A 3BI5A 3H8IA 4EQRA 4H2QA 1N1PA 3REDA 1GXFA 2XLUA 4IVOB 1KSUA 5FS6A 2VZ2A 3RP7A 3QSSA 3AEDA 2XLPA 1NPXA 1HYUA 5FS7A 4YKFA 4YKGA 2CVJA 4GR1A 2V5ZA 2EQ7A 1H86A 3BNUA 3E1TA 4GDPA 4X9NA 4A5LA 1H81A 3ATRA 4JNQA 3BI4A 4CCRA 4C74A 2GRTA 1XDIA 2JBVA 2RGHA 5U1OA 5KXJA 4FDCB 2OLNA 3NT6A 3LADA 3QVPA 3M13A 1S3BA 4TM3A 1GOSA 1QJDA 4FK1C 1PS9A 3BHFA 4IV9A 3FG2P 3UTHA 5KRQA 4EQXA 1PJ5A 1O5WA 1QLBA 5C3JA 4EIQA 4B69A 2R9ZA 1LTXR 4U2LA 3DH9A 5FMHA 3V76A 4YTPA 2X8GA 2VVMA 3RNMA 4A9WA 4YT0A 4I58A 4U2TA 3M0OA 4Z24A 2XVHA 1S2YA 1PBBA 1TDNA 3CPJG 3NN0X 2YG5A 2ZZCA 1KNRA 4B63A 4UDRA 2HQMA 2C70A 2BABA 1DJNA 1PJ6A 1OJDA 2C75A 3GSIA 5BVAA 5EB4A 2WPFA 3GMCA 4DSHA 1MOKA 3GWDA 5IQ4A 2GR3A 4HA6A 2GEWA 2ZBWA 4U8OA 2AAQA 2XVEA 3AXBA 3VRAA 2GAHB 3NN6X 3AEFA 1F3PA 3CGCA 2B7SA 4XWRA 2X99A 3NYEA 3UOVA 3CNDA 4B64A 1P2HA 5J7XA 2GR2A 4H4SA 2WOVA 4EM3A 3CPIG 4K22A 5GRTA 1KNPA 3UTFA 4K8DA 1DOEA 1EL8A 4TLXA 3PO7A 1CJ3A 3AD7B 2WP9A 3QJ4A 5HY5A 5HYMA 2V3AA 4J36A 4FX9A 2Z5XA 2RABA 3H4KA 1IJHA 5CQFA 4C3YA 3WE0A 2YVGA 4CY8A 1NENA 4OPIA 2XLTA 1LQUA 3G5QA 3LXDA 3CNJA 2VOUA 2YAUA 2VRLA 3ICTA 3ISHA 1MO9A 3AE1A 3CGBA 3DJEA 3VQRA 4USRA 1CJ2A 1E1KA 4KX6A 3KKJA 4A79A 3DK8A 2WDRA 4C77A 3ATQA 3ADAB 3UTGA 4CRTA 4BV6A 4BJZA 1OJCA 3UP5A 2OALA 4CNJA 2A87A 3SGLA 1TYPA 1GEUA 4D03A 3DA1A 1S3EA 2PHHA 4H4QA 5J60A 2H88A 3F8RA 1CL0A 2GV8A 2R0PA 4UDQA 4AT0A 2WHDA 1FCDA 1ZDLA 3NIXA 4CY6A 1LQTA 4X4JA 4C5OA 3BNMA 4RG4A 2YVFA 1GRTA 3IF9A 1L9CA 3KA7A 4H2PA 4U2SA 3IHMA 3D8XA 2TPRA 2PYXA 1PBEA 2YG3A 4BK3A 4Z2UA 1BF3A 4IVMB 3I6DA 3PS9A 1NEKA 2C64A 2RGJA 4DNAA 2BCPA 1JRZA 3NTDA 3GDNA 1H7XA 5KOWA 1P2EA 2C7GA 2C66A 3P4QA 3NHOX 2YVJA 2QCUA 3NNEA 1LV0A 1JRYA 1O94A 2R4JA 5M10A 1B37A 4GRTA 4H2NA 4PAAA 1OJAA 3F8PA 1DODA 1GNDA 2XVFA 1CJCA 1F8SA 4EMJA 4EQWA 2VRMA 2CFYA 1PBCA 3NG7X 2ACZA 4B1BA 2XCGA 4H4WA 2YLZA 3CPHG 4H2RA 2GQWA 4H4XA 1EL5A 3GYIA 4GCMA 4OCGA 4Z43A 1MXTA 1L0VA 3DJDA 3NTAA 1H7WA 5FS9A 2BK4A 1BGJA 2BYBA 2AQJA 4U8KA 2B9YA 2V60A 2IVEA 4K5RA 2BS4A 4GF7A 4NEWA 2B9XA 4Z44A 5BULA 4JN9A 4X9MA 4BJYA 3P9UA 1GESA 2AR8A 3C4AA 3UP4A 1S2QA 4J56A 2WQYA 4PABA 1RP0A 1H84A 2WESA 1LPFA 3JSKA 3LOVA 4LA1A 3O0HA 5TR3A 2XLSA 4Z25A 3AD8B 2TMDA 1NG3A 2BK3A 3IC9A 1H83A 4CBQA 1LJ1A 4A6NA 4B65A 4USQA 2YR6A 1GT8A 4DGKA 2CULA 2WETA 4DSGA 4U8IA 3KPFA 1OJTA 4Z26A 4EIPA 1GRAA 2GF3A 4ADWA 1Q1RA 1KDGA 2JKCA 4WCTA 3AE9A 4H4VA 4A99A 4IA6A 4K7ZA 2Q7VA 4A65A 3CTYA 3R9UA 4CCQA 3ZYXA 2WP5A 1FECA 1PJ7A 1GTEA 1F8WA 1GERA 2O9ZA 2R0GA 2WEUA 4XWZA 3SQPA 3K7MX 4OPLA 3UKPA 3CNSA 3AYJA 3UKAA 1W4XA 5L46A 1ZMCA 4EM4A 2YM2A 5KWFA 4APNA 1CJ4A 1XPQA 4KPRA 3T37A 2WOWA 4H7UA 1YQ4A 4Z2TA 4ECHA 1PBDA 4IA5A 4J33A 1TDFA 1E1LA 3AD9B 2EQ8A 1E39A 1EL7A 3DGHA 3VRBA 2Q0KA 3AEGA 4ZCDA 3GMBA 4AT2A 3LB8A 1BGNA 2E5VA 3UKLA 4A7AA 2GR0A 2IIDA 3CN8A 3G5RA 4YWOA 1TDOA 3RP6A 3UKHA 2WBAA 2XFUA 4OPGA 2GAGB 3UOZA 4Z2RA 1D4DA 2QAEA 2OLOA 1GREA 4YTMA 4I59A 4YSHA 3V3OA 3RHAA 5KOXA 2YG6A 1VG9A 4B67A 5EB5A 3QFAA 1BWCA 2GR1A 1KF6A 1UKVG 2YLWA 4TM4A 3KLJA 3FBSA 2CDUA 3NH3X 1K4QA 2OA1A 4U8NA 4O5UA 1RYIA 2JK6A 2R45A 2BC0A 1CBOA 4YTNA 1ZK7A 1E6EA 4TM0A 1GTHA 3GD4A 2VQ7A 2X3NA 2A8XA 4OPDA 2JAEA 1V59A 1Z6LA 2C76A 4GDEA 3ICRA 2FJDA 3K30A 4H4YA 3GRTA 2VQBA 2BXSA 4OPCA 2FJAA 5U63A 4AOXA 3AWIA 3AE5A 1BZLA 2YLXA 2GB0A 2YLSA 2WP6A 2QA2A 3DJGX 3DK4A 1N4UA 2GMHA 2JB1A 3V3NA 4CNKA 1GRBA 2EQ6A 2WU5A 2E4GA 1L9EA 3AEBA 3KVEA 4B66A 2QA1A 2GQFA 4U8PA 1B5QA 1CC4A 3UKFA 1PBFA 4YSXA 1DOCA 1N4WA 4OVIA 3L8KA 2WU2A 3EPTA 3ZDNA 3BHKA 2NPXA 1GRGA 2I0ZA 1M6IA 1NG4A 2FJBA 3NYCA 3QSMA 4J2WA 4U8JA 3IWAA 4H4TA 3VR8A 1CHUA 5BUKA 5BRTA 1IUWA 3KD9A 4J57A 3AB1A 1D7LA 4NTCA 2APGA 3AYIA 1IUTA 1GPEA 3K7TA 4H4PA 1IUUA 2YR5A 2X50A 1PXAA 2R4EA 4BURA 5GSNA 4NEVA 1D5TA 1X31B 2B9WA 3AE2A 4AP3A 1NHQA 5JCLA 1K0IA 1DXLA 5M0ZA 1NHPA 1IUVA 1F8RA 3M12A 4JY3A 3KU9A 2XYOA 1ZOYA 4J31A 3UKQA 4EMIA 2OAMA 2FBWA 1ZKQA 2W0HA 3Q6JA 3PVCA 1XHCA 2GVCA 2ZZ0A 5ER0A 2BXRA 1ZOVA 3ABVA 1Y56A 1K0LA 4YSYA 2F5ZA 4LIIA 1XANA 3AE7A 3DJJA 3NK2X 3II4A 1CC6A 3RP8A 4M52A 2C67A 2R46A 5KVHA 2BS3A 2XFQA 3ITJA 3S61A 3IHGA 1REOA 3AE6A 3P1WA 1ZMDA 3D1CA 4MJWA 3URHA 1KFYA 4LU6A 3HZLA 4E0VA 3GYJA 4H4UA 3FIMB 2NVKX 2GH5A 3AEAA 3LJPA 3SFEA 4OPTA 4HB9A 5C2TA 4P9SA 2Y6QA 2V6OA 4H50A 1ELIA 4H4RA 1FEAA 5JCKA 1E1NA 1PHHA 2DKHA 2XFPA 1NDAA 5JCNA 1BKWA 3B6DA 1GV4A 1VG0A 3ALLA 3EAOA 3NLCA 4Y4LA 3P4RA 1B4VA 1VRQB 3CGEA 3ALMA 2YWLA 1COYA 3AE4A 2WPEA 1ZY8A 5U25A 2YG7A 1KSSA 1JRXA 3L1RA 4O5QA 1H82A 4K5SA 3AYLA 1CC2A 2RGOA 3UOYA 3BI2A 2X8HA 5EBKA 3QSEA 4C3XA 1FEBA 3GD3A 1NAAA 2J3NA 1DOBA 1VDCA 2ZZBA 2BCGG 3P4SA 1FL2A 2YG4A 3FMWA 3Q9TA 4NZHA 1PN0A 5JCIA 2BA9A 2B76A 2WPCA 4AOSA 2FJEA 3AECA 1ZX9A 3COXA 1YY5A 2R0CA 3GDPA 4OPUA 3CNPA 1N4VA 1PXBA 1PDHA 1SEZA 1Q1WA 4JY2A 5DBJA 5HHFA 1DNCA 4H4ZA 1H6VA 1K0JA 3ICSA 4RG3A 1VQWA 3GWFA 5CKUA 1E7PA 2ARDA 3B3RA 1TYTA 2YLTA 2IVDA 2B7RA 1LVLA 5KVIA 2XVIA 3I3LA 3UCLA 5IQ1A 3F8DA 4BK2A 3UOXA 1NHSA 2UZZA 1D4EA 3LZWA 3QFBA 4AP1A 3NRNA 2XFOA 3ALJA 2Z5YA 4B68A 1JOAA 2JB2A 5EOWA 1TDEA 2XVJA 2Y6RA 4RSLA 4ZN0A 2E1MA 3LZXA 1YQZA 3CGDA 4JDRA 4EQSA 5FS8A 1B8SA 3EANA 2XFNA 3DMEA 4YXDA 3NK1X 1PXCA 2VVLG 5HXIA 5IPYA 4J34A 2YM1A 4N9XA 3NKSA 4Y4MA 1JEHA 4YSZA 3G5SA 1EL9A 2A89A 2VVLA 2H89A 3GRSA 5LV9A 3C4NA
chains in the Genus database with same CATH superfamily
2YR4A 2HXUA 4FK1A 3IJIA 1ONFA 3R0KA 2XDOA 1GSNA 1D7YA 2C72A 4ZOHB 1PDZA 1JNZA 2GGIA 3H8LA 2PGWA 1JNRA 1NHRA 3AN1A 2YQUA 1EBDA 3ETRB 4WX1A 3UTEA 1GETA 3D9XA 2V61A 2C3DA 3UJ2A 1O95A 2BRYA 3FPZA 2GMJA 4GUVA 3CYJA 4TLZA 3CXOA 4DHGA 3CIRA 3C96A 3AEEA 3VC6A 4H2QA 4IVOB 2XLPA 1R0MA 1NPXA 4YKFA 3KPKA 2CVJA 2V5ZA 2EQ7A 3E1TA 4CCRA 3UCDA 4C74A 2JBVA 4FDCB 2OLNA 3LADA 1GOSA 1QJDA 3IJQA 2E5AA 5KRQA 4GMEA 1O5WA 3V4BA 4YTPA 5FMHA 3RNMA 4I58A 3PWIA 2HZGA 1TDNA 4NWZA 2YG5A 4E4FA 1X2GA 4UDRA 1DJNA 5BVAA 2WPFA 3GMCA 4KWSA 2XVEA 2GAHB 3AEFA 1EC8A 1P2HA 5GRTA 1KNPA 3UTFA 1S7MA 1TE6A 3RR1A 5HY5A 5HYMA 2V3AA 2Z5XA 4C3YA 2YVGA 1TZZA 4OPIA 1LQUA 3SY4A 2VRLA 4H19A 2OVLA 4A79A 4C77A 3ADAB 4BV6A 3DFHA 3Q4DA 1GEUA 1S3EA 2PU1A 4G6GA 3D47A 1EC7A 1TKKA 3NIXA 4X4JA 4C5OA 2ZADA 4ENLA 3NVWB 4J1OA 3IHMA 3CT2A 4Z2UA 4BK3A 2C64A 4DNAA 3GDNA 1H7XA 3NHOX 2QCUA 2PTYA 3F8PA 2GGJA 1F8SA 2VRMA 1PBCA 4B1BA 4H2RA 1EL5A 3GYIA 3VFCA 1L0VA 1H7WA 5FS9A 2BK4A 2BYBA 2B9YA 4HN8A 4NEWA 7ENLA 4DN1A 3NO1A 4BJYA 2AR8A 4TVYA 2WQYA 1RP0A 5TR3A 2XLSA 3AD8B 4II3A 2TMDA 1NG3A 2AKZA 3R0UA 1MUCA 3IC9A 4K8GA 4A6NA 4X2PA 1WUEA 3KPFA 3FVDA 2GF3A 4WCTA 5KMRA 3ENLA 1FECA 2O9ZA 1GERA 3DEQA 4HCHA 4XWZA 3CNSA 5L46A 1ZMCA 5KNLA 3SN1A 1XPQA 4KPRA 4H7UA 2QJJA 4E4UA 4ECHA 4J33A 1TDFA 2CHRA 3GD6A 3DGHA 2Q0KA 3AEGA 4AT2A 4HCLA 2E5VA 3RO6A 3UKLA 4A7AA 2XSXA 5ENLA 4NNJA 1D4DA 4YTMA 4I59A 3V3OA 5KOXA 1BWCA 3FBSA 2CDUA 3SZWA 1K4QA 3H70A 4HNCA 4U8NA 3FCPA 2JK6A 3A7UA 2AL2B 2C76A 3ICRA 3UJFA 4H4YA 3NZGA 2BXSA 4OPCA 4GYPC 5U63A 4AOXA 3AWIA 2PSNA 2WP6A 1F9CA 3V3NA 3DJGX 1N4UA 2GMHA 2E4GA 4U8PA 2W55A 3UKFA 2WU2A 1ECQA 3ZDNA 4IP4A 2NPXA 1GRGA 1NG4A 4MGGA 3QSMA 4J2WA 1WUFA 3VR8A 1CHUA 1PXAA 2R4EA 2B9WA 1W6TA 1IUVA 1ZOYA 3UJSA 3VC5A 2GSHA 5EU9A 2AKMA 3RP8A 1P48A 2C67A 2R46A 5KVHA 3R11A 3IHGA 1P43A 3P1WA 3URHA 3V5FA 2PU0A 4JHMA 2QJNA 4H4UA 2NVKX 4OPTA 4HB9A 4P9SA 3DFYA 1ELIA 1SJDA 2XFPA 5JCNA 4Y4LA 2QJMA 1VRQB 4Z17A 1COYA 4G7FA 1JRPA 2YG7A 5U25A 1KSSA 1JRXA 4GISA 4ROPA 1V97A 2BCGG 3NVZB 3Q9TA 1PN0A 2OFJA 1ZX9A 5FJTA 3OP2A 1PXBA 1PDHA 1SEZA 1DNCA 1K0JA 1H6VA 4RG3A 3GWFA 1E7PA 3B3RA 2IVDA 2B7RA 5KVIA 5JRBA 2XVIA 3UCLA 5IQ1A 1NHSA 2UZZA 2Z5YA 2XVJA 4RSLA 4EQSA 1SJBA 1YQZA 3CGDA 4MMWA 1B8SA 4YXDA 1NU5A 5IPYA 1JEHA 1EL9A 2A89A 3C4NA 4HNLA 3P0WA 4EMWA 2WOIA 3VRDB 1IUXA 4UP3A 3P4PA 1D4CA 3AE8A 1ELSA 4TM1A 2V3BA 1Y56B 3SSZA 1L9DA 3UKKA 3GO2A 3EF6A 3K7QX 1R6WA 4Y4NA 3NGCX 1GALA 4REKA 4FI4A 1QO8A 3QVRA 4JNAA 4K2XA 3AE3A 3H8IA 3BI5A 2OPJA 1GXFA 3RP7A 3QSSA 1KCZA 5FS7A 4YKGA 2QDDA 4CY6A 3BNUA 4GDPA 3KUMA 2GRTA 1FHVA 3N4EA 1JCTA 1S3BA 4TM3A 1PS9A 3UTHA 3N6JA 3FYYA 3GC2A 1QLBA 5C3JA 4EIQA 2R9ZA 1IYXA 1LTXR 3V76A 2X8GA 3MWCA 2VVMA 4A9WA 1S2YA 1PBBA 2DW7A 3NN0X 1KNRA 3ES7A 4B63A 3S47A 1FFVC 1OJDA 5EB4A 1MOKA 2PTXA 2GEWA 2ZBWA 2AAQA 3VRAA 3NN6X 1F3PA 2ONEA 2B7SA 3CNDA 5J7XA 2GR2A 4EM3A 3AD7B 2WP9A 3QJ4A 3QTPA 1KD0A 4J36A 4DSHA 3H4KA 3I6TA 1IJHA 2P8CA 3WE0A 3G5QA 3T2ZA 3V3WA 2YAUA 4DXKA 4KX6A 2XH7A 4IL2A 4CRTA 1XPYA 1OJCA 3UP5A 4CNJA 2A87A 3SGLA 4H4QA 5KMQA 2GV8A 4UDQA 1LQTA 2C4CA 3VCCA 3BNMA 1MNSA 4RG4A 3IF9A 3UJEA 2PMQA 2PYXA 2YG3A 3HYWA 2PA6A 3SQSA 1BF3A 2AL2A 2BCPA 3NTDA 2C66A 3TQPA 3NNEA 2YVJA 1LV0A 1JRYA 4H1ZA 2DW6A 4A3RA 4KEMA 5M10A 3ZLFA 1B37A 1CJCA 4EMJA 3NG7X 2XCGA 4H4WA 2YLZA 4OCGA 3RGTA 2GL5A 3HYVA 4U8KA 1H2IA 3D46A 4X9MA 3UP4A 1LPFA 3Q45A 1JROA 1N63C 3FJ4A 4H2HA 1H83A 1LJ1A 2YR6A 4DGKA 3DIPA 2WETA 4DSGA 1OJTA 4Z26A 1GRAA 1KKRA 4ADWA 1Q1RA 2JKCA 5IDZA 4A65A 3CTYA 4A35A 4CCQA 4K1WA 1F8WA 4IZGA 1FO4A 3K7MX 2PP0A 3UKAA 4APNA 4Z2TA 1E1LA 4JN7A 3TW9A 3HW2A 1TDOA 2XFUA 3UOZA 1GREA 3DG7A 3NVVB 3SZ0A 3KLJA 3ZVHB 3DESA 1RYIA 2R45A 1CBOA 1ZK7A 4G9KA 1GTHA 2VQ7A 3GRTA 1RM6B 3PFRA 3AE5A 1VQZA 2GB0A 2YLSA 2O56A 2EQ6A 3AEBA 3KVEA 4B66A 2QA1A 3CK5A 4DYEA 4YSXA 3RRAA 5FJOA 3L8KA 1M6IA 3KD9A 3AB1A 1D7LA 1GPEA 3K7TA 5GSNA 4NEVA 1D5TA 1K0IA 5M0ZA 3M12A 1F8RA 3T2YA 5FJUA 3DG6A 2XYOA 2OAMA 3ES8A 3T6CA 2FBWA 2W0HA 1XHCA 2ZZ0A 2BXRA 2QQ6A 1ZOVA 3ABVA 1Y56A 4YSYA 4LIIA 3DJJA 3II4A 4M52A 3OW1A 3IJLA 3SX6A 1REOA 3AE6A 1ZMDA 3HZLA 4E0VA 3T31A 3QLDA 3FIMB 2GH5A 2PS2A 2E3TA 3R25A 3HYXA 2Y6QA 4JN8A 1FEAA 2P3ZA 3MZNA 2DKHA 3R10A 1B4VA 3CGEA 3ALMA 2POZA 4HPNA 3TCSA 3AE4A 4O5QA 1H82A 3BI2A 2GGHA 2X8HA 1FEBA 3GD3A 1DOBA 3SXIA 2ZZBA 2YG4A 2BA9A 2B76A 2WPCA 4AOSA 1YY5A 2R0CA 3CNPA 4H4ZA 4DWDA 3SBFA 3OPSA 4K2SA 1TYTA 4G73A 3UCCA 3B9JB 3F8DA 4H83A 3LZWA 3QFBA 3H8AA 4AP1A 3CB3A 2JB2A 3ZLHA 2OQYA 2Y6RA 3LZXA 4GAVA 3NK1X 1STZA 1PXCA 2YM1A 3G5SA 5LV9A 1GRFA 2GDQA 3S5WA 2PGEA 3UXLA 3NYFA 1JU2A 3DK9A 3SM8A 5KMPA 1OJ9A 1TRBA 5JCMA 1Y0PA 3NK0X 2X8CA 2Q0LA 4IP5A 1DTNA 1YQ3A 1IUSA 3VCNA 2EQ9A 4JQ9A 1Q9IA 1NELA 3NXLA 3SN4A 2C73A 1E1MA 3DG3A 2BK5A 4U8MA 4U8LA 2BC1A 1RSGA 2WS3A 1ZP0A 2W54A 3TJIA 4NTDA 2BS2A 4GGHA 1SB3B 1N1PA 3U4FA 3REDA 3UJRA 1HYUA 1X2HA 1H86A 4X9NA 3NVYB 3L5OA 1H81A 1XDIA 2RGHA 5U1OA 5KXJA 3QVPA 3M13A 4FK1C 4IV9A 3BHFA 3FG2P 1PJ5A 1KN0A 4YT0A 1WYGA 3M0OA 1FIQB 2ZZCA 3T9PA 2HQMA 2BABA 1PJ6A 3GSIA 1N61C 3GWDA 2GR3A 4HA6A 3AXBA 4E6MA 4XWRA 4B64A 4K22A 3CPIG 3QN3A 4K8DA 1DOEA 3T2KA 2RABA 3LXDA 3CNJA 1EBGA 3ISHA 3AE1A 4USRA 1CJ2A 1YEYA 2WDRA 2XGZA 3SZFA 3UTGA 3SJNA 2OALA 2OZ8A 1TYPA 2MUCA 2H88A 3F8RA 1RVKA 1KKOA 5G5GB 2R0PA 4AT0A 2WHDA 1FCDA 6ENLA 3ZVHA 1L9CA 3KA7A 4H2PA 3D8XA 1PBEA 1NEKA 2RGJA 1P2EA 3P4QA 2R4JA 3K1GA 4H2NA 1DODA 1GNDA 2XVFA 4EQWA 2CFYA 4GIRA 3V5CA 3CPHG 2GQWA 4H4XA 4Z43A 4GCMA 3BJSA 1BQGA 3NTAA 3GYXA 4Z1YA 1BGJA 2AQJA 4Z44A 4K5RA 2IVEA 5BULA 2BS4A 2B9XA 4JN9A 3P9UA 1GESA 3C4AA 1S2QA 4PABA 1H84A 3JSKA 2BK3A 4B65A 1GT8A 2CULA 4DX3A 2QVHA 2HNEA 4EIPA 1KDGA 3AE9A 4A99A 4IA6A 2Q7VA 4GYPA 4GGBA 4GFIA 3R9UA 3ZYXA 2WP5A 4MKSA 1PJ7A 2R0GA 1W4XA 2YM2A 3N6HA 2WOWA 1E9IA 1PBDA 3AD9B 1E39A 1EL7A 3VRBA 4ZCDA 3GMBA 1BGNA 2GR0A 2IIDA 3T0KA 3G5RA 3RP6A 1MRAA 4OPGA 2GAGB 1OEPA 2QAEA 4YSHA 3PG6A 2YG6A 1VG9A 4B67A 1N60C 5EB5A 3UGVA 3QFAA 2GR1A 1KF6A 4TM4A 3NH3X 2OA1A 4O5UA 3DDMA 2BC0A 1E6EA 4TM0A 2X3NA 2A8XA 4OPDA 1V59A 1Z6LA 4GDEA 3K30A 2VQBA 3QKEA 1SJAA 2PODA 3OZYA 2YLXA 4CNKA 1GRBA 2WU5A 3T4WA 4OVIA 3A7AA 3EPTA 2FJBA 3NYCA 4U8JA 5BRTA 1IUWA 4J57A 3CAWA 2APGA 2YR5A 1IUUA 1X31B 4J3ZA 1NHQA 2XH0A 3FXGA 4J31A 3AMZA 3UXKA 1ZKQA 3Q6JA 4G6HA 2OO6A 3BOXA 2F5ZA 3AE7A 3NK2X 1CC6A 2BS3A 2XFQA 3ITJA 2W3SA 4HYRA 4MJWA 4LU6A 3LJPA 3SFEA 4H50A 4H4RA 3I4KA 3B6DA 3EAOA 1VDVA 2WPEA 4M6UA 4TVWA 3T14A 4K5SA 1CC2A 2RGOA 3UOYA 1SJCA 3SYIA 4IT1A 3QSEA 4C3XA 4IHCA 1NAAA 2J3NA 2MNRA 1VDCA 3P4SA 1FL2A 2XH4A 4NZHA 5KMSA 3ZLGA 2QGYA 3AECA 3GDPA 3COXA 1JDFA 1N4VA 3U9IA 3ICSA 1VQWA 5CKUA 2ARDA 1FFUC 4D04A 3VDGA 4A6GA 2XFOA 3ALJA 3NRNA 5EOWA 3IK4A 4YWSA 4JDRA 2GGEA 2PCEA 4M0XA 3THUA 3EANA 3STPA 3DMEA 2VVLG 5HXIA 3DERA 4N9XA 3NKSA 3GRSA 4BK1A 3BSMA 1FOHA 2BACA 2ZC8A 2WDVA 3SR6B 3VR9A 2Q6UA 3TWAA 1YKJA 4NTEA 2C65A 4ICYA 3PK7A 4XXGA 1M64A 2P88A 2PPGA 1L8PA 2DKIA 2JB3A 3OC4A 1F6MA 1TDKA 4ZCCA 3DGZA 4UDPA 3AM9A 1AOGA 2C3CA 2WDQA 1CF3A 2YLRA 1DJQA 1GRHA 3MSYA 3OZ2A 3MKCA 3P93A 3CNTA 3SFDA 2XLRA 3CMMA 4EQRA 2XLUA 2OKTA 5J04A 1KSUA 5FS6A 2VZ2A 1EC9A 3AEDA 4GR1A 4A5LA 3ATRA 4JNQA 3BI4A 3MUCA 2HXTA 3NT6A 2OQHA 3ZVIA 4EQXA 2OZ3A 4B69A 4U2LA 3DH9A 3DGBA 2OG9A 4U2TA 4Z24A 2XVHA 4FP1A 3CPJG 1ONEA 2C70A 2C75A 5IQ4A 5BOEA 4U8OA 5G5HB 3OZMA 4GAPA 3CGCA 3UOVA 2X99A 3NYEA 4H4SA 2WOVA 1EL8A 4TLXA 3PO7A 1CJ3A 5CQFA 4FX9A 4CY8A 1NENA 2XLTA 2FKPA 2VOUA 3ICTA 1MO9A 3CGBA 3DJEA 3VQRA 1E1KA 4KPLA 3KKJA 3DK8A 1JPDX 3ATQA 2XH2A 4BJZA 4D03A 2P8BA 3DA1A 3MY9A 3RCYA 3SZCA 2PHHA 5J60A 2PTZA 1CL0A 1ZDLA 3B97A 1FHUA 1N62C 2YVFA 1GRTA 4U2SA 2TPRA 4IVMB 3I6DA 3PS9A 1JRZA 5KOWA 3MQTA 3JVAA 2C7GA 1O94A 1BKHA 2NQLA 4HCDA 2PTWA 3R1ZA 4GRTA 4PAAA 1OJAA 3RITA 2ACZA 3EKGA 3H7VA 3SN0A 1MXTA 3DJDA 3EUB3 4II2A 4G74A 3R07C 2PP3A 2V60A 4ZA0A 4GF7A 2BRAA 4G8TA 4J56A 2WESA 3HRDC 3LOVA 4LA1A 3O0HA 2QDEA 4Z25A 4CBQA 4USQA 4U8IA 4H4VA 3NS1B 4EWJA 3JW7A 2PP1A 4K7ZA 4E8GA 2OZTA 5FJPA 1GTEA 2WEUA 2P0IA 3SQPA 4OPLA 3UKPA 3AYJA 4EM4A 3TWBA 5KWFA 1CJ4A 3T37A 3TOYA 1YQ4A 5FJRA 4IA5A 3FV9A 3T8QA 2EQ8A 3N4FA 3LB8A 4E5TA 3CN8A 4YWOA 3UKHA 2WBAA 1T3QC 4Z2RA 3OTRA 2OLOA 2W3RA 3RHAA 2YLWA 1UKVG 2FYMA 4F4RA 4YTNA 3GD4A 2AL1A 2JAEA 2FJDA 2FJAA 1BZLA 2QA2A 3DK4A 2JB1A 1L9EA 2GQFA 1B5QA 1CC4A 4IL0A 4ZCWA 5BOFA 1PBFA 1DOCA 1N4WA 3BHKA 2OLAA 2I0ZA 3IWAA 4H4TA 5BUKA 2OX4A 3S5SA 4NTCA 3AYIA 1IUTA 1EBHA 4H4PA 4A6NB 2X50A 4BURA 3CXBA 3AE2A 4AP3A 5JCLA 1DXLA 1NHPA 4JY3A 3H12A 3KU9A 3UKQA 4EMIA 3PVCA 1XS2A 2GVCA 3NFUA 5ER0A 1K0LA 1PDYA 1XANA 3TJ4A 3S61A 3D1CA 4KT2A 3I6EA 1KFYA 3GYJA 3AEAA 5C2TA 2V6OA 2GGGA 5JCKA 3JZUA 1N5WC 1E1NA 2I5QA 1PHHA 1NDAA 1BKWA 1GV4A 1VG0A 3ALLA 3NLCA 3P4RA 2YWLA 1ZY8A 3L1RA 3AYLA 3A7RA 3PWGA 3EEZA 3GY1A 5EBKA 3QPEA 3FMWA 1JPMA 5JCIA 1N5XA 1ZXIC 2FJEA 4OPUA 1Q1WA 4JY2A 5DBJA 5HHFA 3HPFA 1MDLA 2YLTA 3VA8A 1LVLA 3I3LA 4BK2A 3P3BA 3UOXA 1D4EA 4B68A 1JOAA 1TDEA 3NRZB 1MDRA 4ZN0A 2E1MA 5FS8A 3TTEA 2XFNA 4J34A 4Y4MA 4YSZA 2VVLA 2H89A 2RDXA
chains in the Genus database with same CATH topology
1GRFA 2YR4A 3S5WA 1FOHA 2BACA 2WDVA 3NYFA 1JU2A 4FK1A 3VR9A 4EMWA 2WOIA 2Q6UA 3DK9A 3SM8A 1ONFA 3VRDB 5KMPA 1OJ9A 1TRBA 5JCMA 1Y0PA 2XDOA 3NK0X 1YKJA 4NTEA 1GSNA 1D7YA 1IUXA 2C65A 2X8CA 2Q0LA 4ICYA 4XXGA 4UP3A 3P4PA 1D4CA 3AE8A 2C72A 4A6NB 1YQ3A 1IUSA 1M64A 2EQ9A 4D04A 1JNZA 4JQ9A 4TM1A 1Q9IA 2V3BA 2DKIA 1Y56B 3H8LA 1JNRA 1NHRA 2JB3A 3OC4A 1L9DA 3UKKA 2C73A 1F6MA 3EF6A 2YQUA 3K7QX 1TDKA 4ZCCA 1E1MA 1EBDA 3DGZA 4WX1A 4BK1A 4UDPA 4Y4NA 3UTEA 1GETA 3D9XA 1AOGA 2BK5A 3NGCX 2V61A 2C3DA 2C3CA 1GALA 1O95A 2WDQA 4U8MA 4REKA 1CF3A 2BRYA 2YLRA 3FPZA 4U8LA 1DJQA 2BC1A 1QO8A 2GMJA 1RSGA 4GUVA 4TLZA 1GRHA 2WS3A 1ZP0A 3QVRA 4JNAA 3CIRA 3OZ2A 3CNTA 3C96A 4NTDA 2BS2A 2XLRA 3CMMA 4K2XA 3SFDA 3AEEA 3AE3A 3BI5A 3H8IA 4EQRA 4H2QA 1N1PA 3REDA 1GXFA 2XLUA 4IVOB 1KSUA 5FS6A 2VZ2A 3RP7A 3QSSA 3AEDA 2XLPA 1NPXA 1HYUA 5FS7A 4YKFA 3KPKA 4YKGA 2CVJA 4GR1A 2V5ZA 2EQ7A 1H86A 3BNUA 3E1TA 4GDPA 3L5OA 4X9NA 1H81A 3ATRA 4JNQA 3BI4A 4CCRA 4C74A 2GRTA 1XDIA 2JBVA 2RGHA 5U1OA 5KXJA 4FDCB 2OLNA 3NT6A 3LADA 3QVPA 3M13A 1S3BA 4TM3A 1GOSA 1QJDA 4FK1C 1PS9A 3BHFA 4IV9A 3FG2P 3UTHA 5KRQA 4EQXA 1PJ5A 1O5WA 1QLBA 5C3JA 4EIQA 4B69A 2R9ZA 1LTXR 4U2LA 3DH9A 1KN0A 5FMHA 3V76A 4YTPA 2X8GA 2VVMA 3RNMA 4A9WA 4YT0A 4I58A 4U2TA 3M0OA 4Z24A 2XVHA 1S2YA 1PBBA 1TDNA 3CPJG 3NN0X 2YG5A 4NWZA 2ZZCA 1KNRA 4B63A 4UDRA 2HQMA 2C70A 2BABA 1DJNA 1PJ6A 1OJDA 2C75A 3GSIA 5BVAA 5EB4A 2WPFA 3GMCA 4DSHA 1MOKA 3GWDA 5IQ4A 2GR3A 4HA6A 2GEWA 2ZBWA 4U8OA 2AAQA 2XVEA 3AXBA 3VRAA 2GAHB 3NN6X 3AEFA 1F3PA 3CGCA 2B7SA 4GAPA 2X99A 3NYEA 4XWRA 3CNDA 3UOVA 4B64A 1P2HA 5J7XA 2GR2A 4H4SA 2WOVA 4EM3A 3CPIG 4K22A 5GRTA 1KNPA 3UTFA 4K8DA 1S7MA 1DOEA 1EL8A 4TLXA 3PO7A 1CJ3A 3AD7B 2WP9A 3QJ4A 3T2KA 5HY5A 5HYMA 2V3AA 4J36A 4FX9A 2Z5XA 2RABA 3H4KA 1IJHA 5CQFA 4C3YA 3WE0A 2YVGA 4CY8A 1NENA 4OPIA 2XLTA 1LQUA 3G5QA 3LXDA 3SY4A 3CNJA 3T2ZA 2VOUA 2YAUA 2VRLA 3ICTA 3ISHA 1MO9A 3AE1A 3CGBA 3DJEA 3VQRA 4USRA 1CJ2A 1E1KA 4KX6A 3KKJA 4A79A 3DK8A 2WDRA 4C77A 3ATQA 3ADAB 3SZFA 3UTGA 4BV6A 4CRTA 4BJZA 1OJCA 3UP5A 2OALA 4CNJA 2A87A 3SGLA 1TYPA 1GEUA 4D03A 3DA1A 1S3EA 3SZCA 2PHHA 4H4QA 5KMQA 5J60A 2H88A 3F8RA 1CL0A 2GV8A 4G6GA 2R0PA 4UDQA 4AT0A 2WHDA 1FCDA 1ZDLA 3NIXA 4CY6A 1LQTA 4X4JA 2C4CA 4C5OA 3BNMA 4RG4A 2YVFA 1GRTA 3IF9A 1L9CA 3KA7A 4H2PA 4U2SA 3IHMA 3D8XA 2TPRA 2PYXA 1PBEA 2YG3A 3HYWA 4BK3A 4Z2UA 1BF3A 4IVMB 3I6DA 3PS9A 1NEKA 2C64A 2RGJA 4DNAA 2BCPA 1JRZA 3NTDA 3GDNA 1H7XA 5KOWA 1P2EA 2C7GA 2C66A 3P4QA 3NHOX 2YVJA 2QCUA 3NNEA 1LV0A 1JRYA 1O94A 2R4JA 5M10A 1B37A 4GRTA 4H2NA 4PAAA 1OJAA 3F8PA 1DODA 1GNDA 2XVFA 1CJCA 1F8SA 4EMJA 4EQWA 2VRMA 2CFYA 1PBCA 3NG7X 2ACZA 4B1BA 2XCGA 4H4WA 2YLZA 3CPHG 4H2RA 2GQWA 4H4XA 1EL5A 3GYIA 4GCMA 4OCGA 4Z43A 1MXTA 1L0VA 3DJDA 3HYVA 3NTAA 3GYXA 1H7WA 5FS9A 2BK4A 4II2A 1BGJA 4G74A 2BYBA 2AQJA 4U8KA 2B9YA 2V60A 2IVEA 4K5RA 2BS4A 4GF7A 4NEWA 2B9XA 4Z44A 5BULA 1H2IA 2BRAA 4JN9A 4X9MA 4BJYA 3P9UA 1GESA 2AR8A 3C4AA 3UP4A 1S2QA 4J56A 2WQYA 4PABA 1RP0A 1H84A 2WESA 1LPFA 3JSKA 3LOVA 4LA1A 3O0HA 5TR3A 2XLSA 4Z25A 3AD8B 4II3A 2TMDA 1NG3A 2BK3A 3IC9A 1H83A 4CBQA 1LJ1A 4A6NA 4B65A 4USQA 2YR6A 1GT8A 4DGKA 2CULA 2WETA 4DSGA 4U8IA 3KPFA 1OJTA 4Z26A 4EIPA 1GRAA 2GF3A 4ADWA 1Q1RA 1KDGA 2JKCA 4WCTA 3AE9A 5KMRA 4H4VA 4A99A 4IA6A 4K7ZA 2Q7VA 4A65A 3CTYA 3R9UA 4CCQA 3ZYXA 2WP5A 1FECA 1PJ7A 1GTEA 1F8WA 1GERA 2O9ZA 2R0GA 2WEUA 4XWZA 3SQPA 3K7MX 4OPLA 3UKPA 3CNSA 3AYJA 3UKAA 1W4XA 5L46A 1ZMCA 4EM4A 5KNLA 2YM2A 5KWFA 4APNA 1CJ4A 1XPQA 4KPRA 3T37A 2WOWA 4H7UA 1YQ4A 4Z2TA 4ECHA 1PBDA 4IA5A 4J33A 1TDFA 1E1LA 3AD9B 2EQ8A 4A5LA 1E39A 1EL7A 3DGHA 3VRBA 2Q0KA 3AEGA 4ZCDA 3GMBA 4AT2A 3LB8A 1BGNA 2E5VA 3UKLA 4A7AA 2GR0A 2IIDA 3CN8A 3T0KA 3G5RA 4NNJA 4YWOA 1TDOA 3RP6A 3UKHA 2WBAA 2XFUA 4OPGA 4BK2A 2GAGB 3UOZA 4Z2RA 1D4DA 2QAEA 2OLOA 1GREA 4YTMA 4I59A 4YSHA 3PG6A 3V3OA 3RHAA 5KOXA 2YG6A 1VG9A 4B67A 5EB5A 3SZ0A 3QFAA 1BWCA 2GR1A 1KF6A 1UKVG 2YLWA 4TM4A 3KLJA 3FBSA 2CDUA 3NH3X 3SZWA 1K4QA 2OA1A 4U8NA 4O5UA 1RYIA 2JK6A 2R45A 2BC0A 1CBOA 4YTNA 1ZK7A 1E6EA 4G9KA 1GTHA 3GD4A 2VQ7A 2X3NA 4TM0A 2A8XA 4OPDA 2JAEA 1V59A 1Z6LA 2C76A 4GDEA 3ICRA 2FJDA 3K30A 4H4YA 3GRTA 2VQBA 2BXSA 4OPCA 2FJAA 5U63A 4AOXA 3AWIA 3AE5A 1BZLA 2YLXA 2GB0A 2YLSA 2WP6A 2QA2A 3DJGX 3DK4A 1N4UA 2GMHA 2JB1A 3V3NA 4CNKA 1GRBA 2EQ6A 2WU5A 2E4GA 1L9EA 3AEBA 3KVEA 4B66A 2QA1A 2GQFA 4U8PA 1B5QA 1CC4A 3UKFA 1PBFA 4YSXA 1DOCA 1N4WA 4OVIA 3L8KA 2WU2A 3EPTA 3ZDNA 3BHKA 2NPXA 1GRGA 2I0ZA 1M6IA 1NG4A 2FJBA 3NYCA 3QSMA 4J2WA 4U8JA 3IWAA 4H4TA 3VR8A 1CHUA 5BUKA 5BRTA 1IUWA 3KD9A 4J57A 3AB1A 1D7LA 4NTCA 2APGA 3AYIA 1IUTA 1GPEA 3K7TA 4H4PA 1IUUA 2YR5A 2X50A 1PXAA 2R4EA 4BURA 5GSNA 4NEVA 1D5TA 1X31B 2B9WA 3AE2A 4AP3A 1NHQA 5JCLA 1K0IA 1DXLA 5M0ZA 1NHPA 1IUVA 1F8RA 3M12A 4JY3A 3KU9A 3T2YA 2XYOA 1ZOYA 4J31A 3UKQA 4EMIA 2OAMA 2FBWA 1ZKQA 2W0HA 3Q6JA 3PVCA 1XHCA 2GVCA 4G6HA 2ZZ0A 5ER0A 2BXRA 1ZOVA 3ABVA 1Y56A 1K0LA 4YSYA 2F5ZA 4LIIA 1XANA 3AE7A 3DJJA 3NK2X 3II4A 1CC6A 3RP8A 4M52A 2C67A 2R46A 5KVHA 2BS3A 2XFQA 3ITJA 3S61A 3SX6A 3IHGA 1REOA 3AE6A 3P1WA 1ZMDA 3D1CA 4MJWA 3URHA 1KFYA 4LU6A 3HZLA 4E0VA 3T31A 3GYJA 4H4UA 3FIMB 2NVKX 2GH5A 3AEAA 3LJPA 3SFEA 4OPTA 4HB9A 5C2TA 4P9SA 3HYXA 2Y6QA 2V6OA 4H50A 1ELIA 4H4RA 1FEAA 5JCKA 1E1NA 1PHHA 2DKHA 2XFPA 1NDAA 5JCNA 1BKWA 3B6DA 1GV4A 1VG0A 3ALLA 3EAOA 3NLCA 4Y4LA 3P4RA 1B4VA 1VRQB 3CGEA 3ALMA 2YWLA 1COYA 3AE4A 2WPEA 1ZY8A 5U25A 2YG7A 1KSSA 1JRXA 3L1RA 4O5QA 1H82A 3T14A 4K5SA 3AYLA 1CC2A 2RGOA 3UOYA 3BI2A 2X8HA 3SYIA 5EBKA 3QSEA 4C3XA 1FEBA 3GD3A 1NAAA 2J3NA 1DOBA 1VDCA 3SXIA 2ZZBA 2BCGG 3P4SA 1FL2A 2YG4A 3FMWA 3Q9TA 4NZHA 1PN0A 5JCIA 2BA9A 5KMSA 2B76A 2WPCA 4AOSA 2FJEA 3AECA 1ZX9A 3COXA 1YY5A 2R0CA 3GDPA 4OPUA 3CNPA 1N4VA 1PXBA 1PDHA 1SEZA 1Q1WA 4JY2A 5DBJA 5HHFA 1K0JA 1DNCA 1H6VA 4H4ZA 3ICSA 4RG3A 1VQWA 3GWFA 5CKUA 1E7PA 2ARDA 3B3RA 1TYTA 2YLTA 2IVDA 4G73A 2B7RA 1LVLA 5KVIA 5JRBA 2XVIA 3I3LA 5IQ1A 3F8DA 3UCLA 3UOXA 1NHSA 2UZZA 1D4EA 3LZWA 3QFBA 4AP1A 3NRNA 2XFOA 3ALJA 2Z5YA 4B68A 1JOAA 2JB2A 5EOWA 1TDEA 2XVJA 2Y6RA 4RSLA 4ZN0A 2E1MA 3LZXA 1YQZA 3CGDA 4JDRA 4EQSA 4GAVA 5FS8A 1B8SA 3EANA 2XFNA 3DMEA 4YXDA 3NK1X 1PXCA 2VVLG 5HXIA 5IPYA 4J34A 2YM1A 4N9XA 3NKSA 4Y4MA 1JEHA 4YSZA 3G5SA 1EL9A 2A89A 2VVLA 2H89A 3GRSA 5LV9A 3C4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GRF A;  2YR4 A;  3S5W A;  1FOH A;  2BAC A;  2WDV A;  3NYF A;  1JU2 A;  4FK1 A;  3VR9 A;  4EMW A;  2WOI A;  2Q6U A;  3DK9 A;  3SM8 A;  1ONF A;  3VRD B;  1OJ9 A;  1TRB A;  5JCM A;  1Y0P A;  2XDO A;  3NK0 X;  1YKJ A;  4NTE A;  1GSN A;  1D7Y A;  1IUX A;  2C65 A;  2X8C A;  2Q0L A;  4ICY A;  4XXG A;  4UP3 A;  3P4P A;  1D4C A;  3AE8 A;  2C72 A;  4A6N B;  1YQ3 A;  1IUS A;  1M64 A;  2EQ9 A;  4D04 A;  1JNZ A;  4JQ9 A;  4TM1 A;  1Q9I A;  2DKI A;  2V3B A;  1Y56 B;  3H8L A;  1JNR A;  1NHR A;  2JB3 A;  3OC4 A;  1L9D A;  3UKK A;  2C73 A;  1F6M A;  3EF6 A;  2YQU A;  3K7Q X;  1TDK A;  4ZCC A;  1E1M A;  1EBD A;  3DGZ A;  4WX1 A;  4BK1 A;  4UDP A;  4Y4N A;  3UTE A;  1GET A;  1AOG A;  2BK5 A;  3NGC X;  2V61 A;  2C3D A;  2C3C A;  1GAL A;  1O95 A;  2WDQ A;  4U8M A;  4REK A;  1CF3 A;  2YLR A;  3FPZ A;  4U8L A;  1DJQ A;  2BC1 A;  1QO8 A;  2GMJ A;  1RSG A;  4GUV A;  4TLZ A;  1GRH A;  2WS3 A;  1ZP0 A;  3QVR A;  4JNA A;  3CIR A;  3OZ2 A;  3CNT A;  3C96 A;  4NTD A;  2BS2 A;  2XLR A;  4K2X A;  3SFD A;  3AEE A;  3AE3 A;  3BI5 A;  3H8I A;  4EQR A;  4H2Q A;  1N1P A;  3RED A;  1GXF A;  2XLU A;  4IVO B;  1KSU A;  5FS6 A;  2VZ2 A;  3RP7 A;  3QSS A;  3AED A;  2XLP A;  1NPX A;  1HYU A;  5FS7 A;  4YKF A;  4YKG A;  2CVJ A;  4GR1 A;  2V5Z A;  2EQ7 A;  1H86 A;  3BNU A;  3E1T A;  4GDP A;  4X9N A;  4A5L A;  1H81 A;  3ATR A;  4JNQ A;  3BI4 A;  4CCR A;  4C74 A;  2GRT A;  1XDI A;  2JBV A;  2RGH A;  5U1O A;  5KXJ A;  4FDC B;  2OLN A;  3NT6 A;  3LAD A;  3QVP A;  3M13 A;  1S3B A;  4TM3 A;  1GOS A;  1QJD A;  4FK1 C;  1PS9 A;  3BHF A;  4IV9 A;  3FG2 P;  3UTH A;  5KRQ A;  4EQX A;  1PJ5 A;  1O5W A;  1QLB A;  5C3J A;  4EIQ A;  4B69 A;  2R9Z A;  1LTX R;  4U2L A;  3DH9 A;  5FMH A;  3V76 A;  4YTP A;  2X8G A;  2VVM A;  3RNM A;  4A9W A;  4YT0 A;  4I58 A;  4U2T A;  3M0O A;  4Z24 A;  2XVH A;  1S2Y A;  1PBB A;  1TDN A;  3CPJ G;  3NN0 X;  2YG5 A;  2ZZC A;  1KNR A;  4B63 A;  4UDR A;  2HQM A;  2C70 A;  2BAB A;  1DJN A;  1PJ6 A;  1OJD A;  2C75 A;  3GSI A;  5BVA A;  5EB4 A;  2WPF A;  3GMC A;  4DSH A;  1MOK A;  3GWD A;  5IQ4 A;  2GR3 A;  4HA6 A;  2GEW A;  2ZBW A;  4U8O A;  2AAQ A;  2XVE A;  3AXB A;  3VRA A;  2GAH B;  3NN6 X;  3AEF A;  1F3P A;  3CGC A;  2B7S A;  4XWR A;  2X99 A;  3NYE A;  3UOV A;  3CND A;  4B64 A;  1P2H A;  5J7X A;  2GR2 A;  4H4S A;  2WOV A;  4EM3 A;  3CPI G;  4K22 A;  5GRT A;  1KNP A;  3UTF A;  4K8D A;  1DOE A;  1EL8 A;  4TLX A;  3PO7 A;  1CJ3 A;  3AD7 B;  2WP9 A;  3QJ4 A;  5HY5 A;  5HYM A;  2V3A A;  4J36 A;  4FX9 A;  2Z5X A;  2RAB A;  3H4K A;  1IJH A;  5CQF A;  4C3Y A;  3WE0 A;  2YVG A;  4CY8 A;  1NEN A;  4OPI A;  2XLT A;  1LQU A;  3G5Q A;  3LXD A;  3CNJ A;  2VOU A;  2YAU A;  2VRL A;  3ICT A;  3ISH A;  1MO9 A;  3AE1 A;  3CGB A;  3DJE A;  3VQR A;  4USR A;  1CJ2 A;  1E1K A;  4KX6 A;  3KKJ A;  4A79 A;  3DK8 A;  2WDR A;  4C77 A;  3ATQ A;  3ADA B;  3UTG A;  4CRT A;  4BV6 A;  4BJZ A;  1OJC A;  3UP5 A;  2OAL A;  4CNJ A;  2A87 A;  3SGL A;  1TYP A;  1GEU A;  4D03 A;  3DA1 A;  1S3E A;  2PHH A;  4H4Q A;  5J60 A;  2H88 A;  3F8R A;  1CL0 A;  2GV8 A;  2R0P A;  4UDQ A;  4AT0 A;  2WHD A;  1FCD A;  1ZDL A;  3NIX A;  4CY6 A;  1LQT A;  4X4J A;  4C5O A;  3BNM A;  4RG4 A;  2YVF A;  1GRT A;  3IF9 A;  1L9C A;  3KA7 A;  4H2P A;  4U2S A;  3IHM A;  3D8X A;  2TPR A;  2PYX A;  1PBE A;  2YG3 A;  4BK3 A;  4Z2U A;  1BF3 A;  4IVM B;  3I6D A;  3PS9 A;  1NEK A;  2C64 A;  2RGJ A;  4DNA A;  2BCP A;  1JRZ A;  3NTD A;  3GDN A;  1H7X A;  5KOW A;  1P2E A;  2C7G A;  2C66 A;  3P4Q A;  3NHO X;  2YVJ A;  2QCU A;  3NNE A;  1LV0 A;  1JRY A;  1O94 A;  2R4J A;  5M10 A;  1B37 A;  4GRT A;  4H2N A;  4PAA A;  1OJA A;  3F8P A;  1DOD A;  1GND A;  2XVF A;  1CJC A;  1F8S A;  4EMJ A;  4EQW A;  2VRM A;  2CFY A;  1PBC A;  3NG7 X;  2ACZ A;  4B1B A;  2XCG A;  4H4W A;  2YLZ A;  3CPH G;  4H2R A;  2GQW A;  4H4X A;  1EL5 A;  3GYI A;  4GCM A;  4OCG A;  4Z43 A;  1MXT A;  1L0V A;  3DJD A;  3NTA A;  1H7W A;  5FS9 A;  2BK4 A;  1BGJ A;  2BYB A;  2AQJ A;  4U8K A;  2B9Y A;  2V60 A;  2IVE A;  4K5R A;  2BS4 A;  4GF7 A;  4NEW A;  2B9X A;  4Z44 A;  5BUL A;  4JN9 A;  4X9M A;  4BJY A;  3P9U A;  1GES A;  2AR8 A;  3C4A A;  3UP4 A;  1S2Q A;  4J56 A;  2WQY A;  4PAB A;  1RP0 A;  1H84 A;  2WES A;  1LPF A;  3JSK A;  3LOV A;  4LA1 A;  3O0H A;  5TR3 A;  2XLS A;  4Z25 A;  3AD8 B;  2TMD A;  1NG3 A;  2BK3 A;  3IC9 A;  1H83 A;  4CBQ A;  1LJ1 A;  4A6N A;  4B65 A;  4USQ A;  2YR6 A;  1GT8 A;  4DGK A;  2CUL A;  2WET A;  4DSG A;  4U8I A;  3KPF A;  1OJT A;  4Z26 A;  4EIP A;  1GRA A;  2GF3 A;  4ADW A;  1Q1R A;  1KDG A;  2JKC A;  4WCT A;  3AE9 A;  4H4V A;  4A99 A;  4IA6 A;  4K7Z A;  2Q7V A;  4A65 A;  3CTY A;  3R9U A;  4CCQ A;  3ZYX A;  2WP5 A;  1FEC A;  1PJ7 A;  1GTE A;  1F8W A;  1GER A;  2O9Z A;  2R0G A;  2WEU A;  4XWZ A;  3SQP A;  3K7M X;  4OPL A;  3UKP A;  3CNS A;  3AYJ A;  3UKA A;  1W4X A;  5L46 A;  1ZMC A;  4EM4 A;  2YM2 A;  5KWF A;  4APN A;  1CJ4 A;  1XPQ A;  4KPR A;  3T37 A;  2WOW A;  4H7U A;  1YQ4 A;  4Z2T A;  4ECH A;  1PBD A;  4IA5 A;  4J33 A;  1TDF A;  1E1L A;  3AD9 B;  2EQ8 A;  1E39 A;  1EL7 A;  3DGH A;  3VRB A;  2Q0K A;  3AEG A;  4ZCD A;  3GMB A;  4AT2 A;  3LB8 A;  1BGN A;  2E5V A;  3UKL A;  4A7A A;  2GR0 A;  2IID A;  3CN8 A;  3G5R A;  4YWO A;  1TDO A;  3RP6 A;  3UKH A;  2WBA A;  2XFU A;  4OPG A;  2GAG B;  3UOZ A;  4Z2R A;  1D4D A;  2QAE A;  2OLO A;  1GRE A;  4YTM A;  4I59 A;  4YSH A;  3V3O A;  3RHA A;  5KOX A;  2YG6 A;  1VG9 A;  4B67 A;  5EB5 A;  3QFA A;  1BWC A;  2GR1 A;  1KF6 A;  1UKV G;  2YLW A;  4TM4 A;  3KLJ A;  3FBS A;  2CDU A;  3NH3 X;  1K4Q A;  2OA1 A;  4U8N A;  4O5U A;  1RYI A;  2JK6 A;  2R45 A;  2BC0 A;  1CBO A;  4YTN A;  1ZK7 A;  1E6E A;  4TM0 A;  1GTH A;  3GD4 A;  2VQ7 A;  2X3N A;  2A8X A;  4OPD A;  2JAE A;  1V59 A;  1Z6L A;  2C76 A;  4GDE A;  3ICR A;  2FJD A;  3K30 A;  4H4Y A;  3GRT A;  2VQB A;  2BXS A;  4OPC A;  2FJA A;  5U63 A;  4AOX A;  3AWI A;  3AE5 A;  1BZL A;  2YLX A;  2GB0 A;  2YLS A;  2WP6 A;  2QA2 A;  3DJG X;  3DK4 A;  1N4U A;  2GMH A;  2JB1 A;  3V3N A;  4CNK A;  1GRB A;  2EQ6 A;  2WU5 A;  2E4G A;  1L9E A;  3AEB A;  3KVE A;  4B66 A;  2QA1 A;  2GQF A;  4U8P A;  1B5Q A;  1CC4 A;  3UKF A;  1PBF A;  4YSX A;  1DOC A;  1N4W A;  4OVI A;  3L8K A;  2WU2 A;  3EPT A;  3ZDN A;  3BHK A;  2NPX A;  1GRG A;  2I0Z A;  1M6I A;  1NG4 A;  2FJB A;  3NYC A;  3QSM A;  4J2W A;  4U8J A;  3IWA A;  4H4T A;  3VR8 A;  1CHU A;  5BUK A;  5BRT A;  1IUW A;  3KD9 A;  4J57 A;  3AB1 A;  1D7L A;  4NTC A;  2APG A;  3AYI A;  1IUT A;  1GPE A;  3K7T A;  4H4P A;  1IUU A;  2YR5 A;  2X50 A;  1PXA A;  2R4E A;  4BUR A;  5GSN A;  4NEV A;  1D5T A;  1X31 B;  2B9W A;  3AE2 A;  4AP3 A;  1NHQ A;  5JCL A;  1K0I A;  1DXL A;  5M0Z A;  1NHP A;  1IUV A;  1F8R A;  3M12 A;  4JY3 A;  3KU9 A;  2XYO A;  1ZOY A;  4J31 A;  3UKQ A;  4EMI A;  2OAM A;  2FBW A;  1ZKQ A;  2W0H A;  3Q6J A;  3PVC A;  1XHC A;  2GVC A;  2ZZ0 A;  5ER0 A;  2BXR A;  1ZOV A;  3ABV A;  1Y56 A;  1K0L A;  4YSY A;  2F5Z A;  4LII A;  1XAN A;  3AE7 A;  3DJJ A;  3NK2 X;  3II4 A;  1CC6 A;  3RP8 A;  4M52 A;  2C67 A;  2R46 A;  5KVH A;  2BS3 A;  2XFQ A;  3ITJ A;  3S61 A;  3IHG A;  1REO A;  3AE6 A;  3P1W A;  1ZMD A;  3D1C A;  4MJW A;  3URH A;  1KFY A;  4LU6 A;  3HZL A;  4E0V A;  3GYJ A;  4H4U A;  3FIM B;  2NVK X;  2GH5 A;  3AEA A;  3LJP A;  3SFE A;  4OPT A;  4HB9 A;  5C2T A;  4P9S A;  2Y6Q A;  2V6O A;  4H50 A;  1ELI A;  4H4R A;  1FEA A;  5JCK A;  1E1N A;  1PHH A;  2DKH A;  2XFP A;  1NDA A;  5JCN A;  1BKW A;  3B6D A;  1GV4 A;  1VG0 A;  3ALL A;  3EAO A;  3NLC A;  4Y4L A;  3P4R A;  1B4V A;  1VRQ B;  3CGE A;  3ALM A;  2YWL A;  1COY A;  3AE4 A;  2WPE A;  1ZY8 A;  5U25 A;  2YG7 A;  1KSS A;  1JRX A;  3L1R A;  4O5Q A;  1H82 A;  4K5S A;  3AYL A;  1CC2 A;  2RGO A;  3UOY A;  3BI2 A;  2X8H A;  5EBK A;  3QSE A;  4C3X A;  1FEB A;  3GD3 A;  1NAA A;  2J3N A;  1DOB A;  1VDC A;  2ZZB A;  2BCG G;  3P4S A;  1FL2 A;  2YG4 A;  3FMW A;  3Q9T A;  4NZH A;  1PN0 A;  5JCI A;  2BA9 A;  2B76 A;  2WPC A;  4AOS A;  2FJE A;  3AEC A;  1ZX9 A;  3COX A;  1YY5 A;  2R0C A;  3GDP A;  4OPU A;  3CNP A;  1N4V A;  1PXB A;  1PDH A;  1SEZ A;  1Q1W A;  4JY2 A;  5DBJ A;  5HHF A;  1DNC A;  4H4Z A;  1H6V A;  1K0J A;  3ICS A;  4RG3 A;  1VQW A;  3GWF A;  5CKU A;  1E7P A;  2ARD A;  3B3R A;  1TYT A;  2YLT A;  2IVD A;  2B7R A;  1LVL A;  5KVI A;  2XVI A;  3I3L A;  3UCL A;  5IQ1 A;  3F8D A;  4BK2 A;  3UOX A;  1NHS A;  2UZZ A;  1D4E A;  3LZW A;  3QFB A;  4AP1 A;  3NRN A;  2XFO A;  3ALJ A;  2Z5Y A;  4B68 A;  1JOA A;  2JB2 A;  5EOW A;  1TDE A;  2XVJ A;  2Y6R A;  4RSL A;  4ZN0 A;  2E1M A;  3LZX A;  1YQZ A;  3CGD A;  4JDR A;  4EQS A;  5FS8 A;  1B8S A;  3EAN A;  2XFN A;  3DME A;  4YXD A;  3NK1 X;  1PXC A;  2VVL G;  5HXI A;  5IPY A;  4J34 A;  2YM1 A;  4N9X A;  3NKS A;  4Y4M A;  1JEH A;  4YSZ A;  3G5S A;  1EL9 A;  2A89 A;  2VVL A;  2H89 A;  3GRS A;  5LV9 A;  3C4N A; 
#chains in the Genus database with same CATH topology
 2YR4 A;  2HXU A;  4FK1 A;  3IJI A;  1ONF A;  3R0K A;  2XDO A;  1GSN A;  1D7Y A;  2C72 A;  4ZOH B;  1PDZ A;  1JNZ A;  2GGI A;  3H8L A;  2PGW A;  1JNR A;  1NHR A;  3AN1 A;  2YQU A;  1EBD A;  3ETR B;  4WX1 A;  3UTE A;  1GET A;  3D9X A;  2V61 A;  2C3D A;  3UJ2 A;  1O95 A;  2BRY A;  3FPZ A;  2GMJ A;  4GUV A;  3CYJ A;  4TLZ A;  3CXO A;  4DHG A;  3CIR A;  3C96 A;  3AEE A;  3VC6 A;  4H2Q A;  4IVO B;  2XLP A;  1R0M A;  1NPX A;  4YKF A;  3KPK A;  2CVJ A;  2V5Z A;  2EQ7 A;  3E1T A;  4CCR A;  3UCD A;  4C74 A;  2JBV A;  4FDC B;  2OLN A;  3LAD A;  1GOS A;  1QJD A;  3IJQ A;  2E5A A;  5KRQ A;  4GME A;  1O5W A;  3V4B A;  4YTP A;  5FMH A;  3RNM A;  4I58 A;  3PWI A;  2HZG A;  1TDN A;  4NWZ A;  2YG5 A;  4E4F A;  1X2G A;  4UDR A;  1DJN A;  5BVA A;  2WPF A;  3GMC A;  4KWS A;  2XVE A;  2GAH B;  3AEF A;  1EC8 A;  1P2H A;  5GRT A;  1KNP A;  3UTF A;  1S7M A;  1TE6 A;  3RR1 A;  5HY5 A;  5HYM A;  2V3A A;  2Z5X A;  4C3Y A;  2YVG A;  1TZZ A;  4OPI A;  1LQU A;  3SY4 A;  2VRL A;  4H19 A;  2OVL A;  4A79 A;  4C77 A;  3ADA B;  4BV6 A;  3DFH A;  3Q4D A;  1GEU A;  1S3E A;  2PU1 A;  4G6G A;  3D47 A;  1EC7 A;  1TKK A;  3NIX A;  4X4J A;  4C5O A;  2ZAD A;  4ENL A;  3NVW B;  4J1O A;  3IHM A;  3CT2 A;  4Z2U A;  4BK3 A;  2C64 A;  4DNA A;  3GDN A;  1H7X A;  3NHO X;  2QCU A;  2PTY A;  3F8P A;  2GGJ A;  1F8S A;  2VRM A;  1PBC A;  4B1B A;  4H2R A;  1EL5 A;  3GYI A;  3VFC A;  1L0V A;  1H7W A;  5FS9 A;  2BK4 A;  2BYB A;  2B9Y A;  4HN8 A;  4NEW A;  7ENL A;  4DN1 A;  3NO1 A;  4BJY A;  2AR8 A;  4TVY A;  2WQY A;  1RP0 A;  5TR3 A;  2XLS A;  3AD8 B;  4II3 A;  2TMD A;  1NG3 A;  2AKZ A;  3R0U A;  1MUC A;  3IC9 A;  4K8G A;  4A6N A;  4X2P A;  1WUE A;  3KPF A;  3FVD A;  2GF3 A;  4WCT A;  5KMR A;  3ENL A;  1FEC A;  2O9Z A;  1GER A;  3DEQ A;  4HCH A;  4XWZ A;  3CNS A;  5L46 A;  1ZMC A;  5KNL A;  3SN1 A;  1XPQ A;  4KPR A;  4H7U A;  2QJJ A;  4E4U A;  4ECH A;  4J33 A;  1TDF A;  2CHR A;  3GD6 A;  3DGH A;  2Q0K A;  3AEG A;  4AT2 A;  4HCL A;  2E5V A;  3RO6 A;  3UKL A;  4A7A A;  2XSX A;  5ENL A;  4NNJ A;  1D4D A;  4YTM A;  4I59 A;  3V3O A;  5KOX A;  1BWC A;  3FBS A;  2CDU A;  3SZW A;  1K4Q A;  3H70 A;  4HNC A;  4U8N A;  3FCP A;  2JK6 A;  3A7U A;  2AL2 B;  2C76 A;  3ICR A;  3UJF A;  4H4Y A;  3NZG A;  2BXS A;  4OPC A;  4GYP C;  5U63 A;  4AOX A;  3AWI A;  2PSN A;  2WP6 A;  1F9C A;  3V3N A;  3DJG X;  1N4U A;  2GMH A;  2E4G A;  4U8P A;  2W55 A;  3UKF A;  2WU2 A;  1ECQ A;  3ZDN A;  4IP4 A;  2NPX A;  1GRG A;  1NG4 A;  4MGG A;  3QSM A;  4J2W A;  1WUF A;  3VR8 A;  1CHU A;  1PXA A;  2R4E A;  2B9W A;  1W6T A;  1IUV A;  1ZOY A;  3UJS A;  3VC5 A;  2GSH A;  5EU9 A;  2AKM A;  3RP8 A;  1P48 A;  2C67 A;  2R46 A;  5KVH A;  3R11 A;  3IHG A;  1P43 A;  3P1W A;  3URH A;  3V5F A;  2PU0 A;  4JHM A;  2QJN A;  4H4U A;  2NVK X;  4OPT A;  4HB9 A;  4P9S A;  3DFY A;  1ELI A;  1SJD A;  2XFP A;  5JCN A;  4Y4L A;  2QJM A;  1VRQ B;  4Z17 A;  1COY A;  4G7F A;  1JRP A;  2YG7 A;  5U25 A;  1KSS A;  1JRX A;  4GIS A;  4ROP A;  1V97 A;  2BCG G;  3NVZ B;  3Q9T A;  1PN0 A;  2OFJ A;  1ZX9 A;  5FJT A;  3OP2 A;  1PXB A;  1PDH A;  1SEZ A;  1DNC A;  1K0J A;  1H6V A;  4RG3 A;  3GWF A;  1E7P A;  3B3R A;  2IVD A;  2B7R A;  5KVI A;  5JRB A;  2XVI A;  3UCL A;  5IQ1 A;  1NHS A;  2UZZ A;  2Z5Y A;  2XVJ A;  4RSL A;  4EQS A;  1SJB A;  1YQZ A;  3CGD A;  4MMW A;  1B8S A;  4YXD A;  1NU5 A;  5IPY A;  1JEH A;  1EL9 A;  2A89 A;  3C4N A;  4HNL A;  3P0W A;  4EMW A;  2WOI A;  3VRD B;  1IUX A;  4UP3 A;  3P4P A;  1D4C A;  3AE8 A;  1ELS A;  4TM1 A;  2V3B A;  1Y56 B;  3SSZ A;  1L9D A;  3UKK A;  3GO2 A;  3EF6 A;  3K7Q X;  1R6W A;  4Y4N A;  3NGC X;  1GAL A;  4REK A;  4FI4 A;  1QO8 A;  3QVR A;  4JNA A;  4K2X A;  3AE3 A;  3H8I A;  3BI5 A;  2OPJ A;  1GXF A;  3RP7 A;  3QSS A;  1KCZ A;  5FS7 A;  4YKG A;  2QDD A;  4CY6 A;  3BNU A;  4GDP A;  3KUM A;  2GRT A;  1FHV A;  3N4E A;  1JCT A;  1S3B A;  4TM3 A;  1PS9 A;  3UTH A;  3N6J A;  3FYY A;  3GC2 A;  1QLB A;  5C3J A;  4EIQ A;  2R9Z A;  1IYX A;  1LTX R;  3V76 A;  2X8G A;  3MWC A;  2VVM A;  4A9W A;  1S2Y A;  1PBB A;  2DW7 A;  3NN0 X;  1KNR A;  3ES7 A;  4B63 A;  3S47 A;  1FFV C;  1OJD A;  5EB4 A;  1MOK A;  2PTX A;  2GEW A;  2ZBW A;  2AAQ A;  3VRA A;  3NN6 X;  1F3P A;  2ONE A;  2B7S A;  3CND A;  5J7X A;  2GR2 A;  4EM3 A;  3AD7 B;  2WP9 A;  3QJ4 A;  3QTP A;  1KD0 A;  4J36 A;  4DSH A;  3H4K A;  3I6T A;  1IJH A;  2P8C A;  3WE0 A;  3G5Q A;  3T2Z A;  3V3W A;  2YAU A;  4DXK A;  4KX6 A;  2XH7 A;  4IL2 A;  4CRT A;  1XPY A;  1OJC A;  3UP5 A;  4CNJ A;  2A87 A;  3SGL A;  4H4Q A;  5KMQ A;  2GV8 A;  4UDQ A;  1LQT A;  2C4C A;  3VCC A;  3BNM A;  1MNS A;  4RG4 A;  3IF9 A;  3UJE A;  2PMQ A;  2PYX A;  2YG3 A;  3HYW A;  2PA6 A;  3SQS A;  1BF3 A;  2AL2 A;  2BCP A;  3NTD A;  2C66 A;  3TQP A;  3NNE A;  2YVJ A;  1LV0 A;  1JRY A;  4H1Z A;  2DW6 A;  4A3R A;  4KEM A;  5M10 A;  3ZLF A;  1B37 A;  1CJC A;  4EMJ A;  3NG7 X;  2XCG A;  4H4W A;  2YLZ A;  4OCG A;  3RGT A;  2GL5 A;  3HYV A;  4U8K A;  1H2I A;  3D46 A;  4X9M A;  3UP4 A;  1LPF A;  3Q45 A;  1JRO A;  1N63 C;  3FJ4 A;  4H2H A;  1H83 A;  1LJ1 A;  2YR6 A;  4DGK A;  3DIP A;  2WET A;  4DSG A;  1OJT A;  4Z26 A;  1GRA A;  1KKR A;  4ADW A;  1Q1R A;  2JKC A;  5IDZ A;  4A65 A;  3CTY A;  4A35 A;  4CCQ A;  4K1W A;  1F8W A;  4IZG A;  1FO4 A;  3K7M X;  2PP0 A;  3UKA A;  4APN A;  4Z2T A;  1E1L A;  4JN7 A;  3TW9 A;  3HW2 A;  1TDO A;  2XFU A;  3UOZ A;  1GRE A;  3DG7 A;  3NVV B;  3SZ0 A;  3KLJ A;  3ZVH B;  3DES A;  1RYI A;  2R45 A;  1CBO A;  1ZK7 A;  4G9K A;  1GTH A;  2VQ7 A;  3GRT A;  1RM6 B;  3PFR A;  3AE5 A;  1VQZ A;  2GB0 A;  2YLS A;  2O56 A;  2EQ6 A;  3AEB A;  3KVE A;  4B66 A;  2QA1 A;  3CK5 A;  4DYE A;  4YSX A;  3RRA A;  5FJO A;  3L8K A;  1M6I A;  3KD9 A;  3AB1 A;  1D7L A;  1GPE A;  3K7T A;  5GSN A;  4NEV A;  1D5T A;  1K0I A;  5M0Z A;  3M12 A;  1F8R A;  3T2Y A;  5FJU A;  3DG6 A;  2XYO A;  2OAM A;  3ES8 A;  3T6C A;  2FBW A;  2W0H A;  1XHC A;  2ZZ0 A;  2BXR A;  2QQ6 A;  1ZOV A;  3ABV A;  1Y56 A;  4YSY A;  4LII A;  3DJJ A;  3II4 A;  4M52 A;  3OW1 A;  3IJL A;  3SX6 A;  1REO A;  3AE6 A;  1ZMD A;  3HZL A;  4E0V A;  3T31 A;  3QLD A;  3FIM B;  2GH5 A;  2PS2 A;  2E3T A;  3R25 A;  3HYX A;  2Y6Q A;  4JN8 A;  1FEA A;  2P3Z A;  3MZN A;  2DKH A;  3R10 A;  1B4V A;  3CGE A;  3ALM A;  2POZ A;  4HPN A;  3TCS A;  3AE4 A;  4O5Q A;  1H82 A;  3BI2 A;  2GGH A;  2X8H A;  1FEB A;  3GD3 A;  1DOB A;  3SXI A;  2ZZB A;  2YG4 A;  2BA9 A;  2B76 A;  2WPC A;  4AOS A;  1YY5 A;  2R0C A;  3CNP A;  4H4Z A;  4DWD A;  3SBF A;  3OPS A;  4K2S A;  1TYT A;  4G73 A;  3UCC A;  3B9J B;  3F8D A;  4H83 A;  3LZW A;  3QFB A;  3H8A A;  4AP1 A;  3CB3 A;  2JB2 A;  3ZLH A;  2OQY A;  2Y6R A;  3LZX A;  4GAV A;  3NK1 X;  1STZ A;  1PXC A;  2YM1 A;  3G5S A;  5LV9 A;  1GRF A;  2GDQ A;  3S5W A;  2PGE A;  3UXL A;  3NYF A;  1JU2 A;  3DK9 A;  3SM8 A;  5KMP A;  1OJ9 A;  1TRB A;  5JCM A;  1Y0P A;  3NK0 X;  2X8C A;  2Q0L A;  4IP5 A;  1DTN A;  1YQ3 A;  1IUS A;  3VCN A;  2EQ9 A;  4JQ9 A;  1Q9I A;  1NEL A;  3NXL A;  3SN4 A;  2C73 A;  1E1M A;  3DG3 A;  2BK5 A;  4U8M A;  4U8L A;  2BC1 A;  1RSG A;  2WS3 A;  1ZP0 A;  2W54 A;  3TJI A;  4NTD A;  2BS2 A;  4GGH A;  1SB3 B;  1N1P A;  3U4F A;  3RED A;  3UJR A;  1HYU A;  1X2H A;  1H86 A;  4X9N A;  3NVY B;  3L5O A;  1H81 A;  1XDI A;  2RGH A;  5U1O A;  5KXJ A;  3QVP A;  3M13 A;  4FK1 C;  4IV9 A;  3BHF A;  3FG2 P;  1PJ5 A;  1KN0 A;  4YT0 A;  1WYG A;  3M0O A;  1FIQ B;  2ZZC A;  3T9P A;  2HQM A;  2BAB A;  1PJ6 A;  3GSI A;  1N61 C;  3GWD A;  2GR3 A;  4HA6 A;  3AXB A;  4E6M A;  4XWR A;  4B64 A;  4K22 A;  3CPI G;  3QN3 A;  4K8D A;  1DOE A;  3T2K A;  2RAB A;  3LXD A;  3CNJ A;  1EBG A;  3ISH A;  3AE1 A;  4USR A;  1CJ2 A;  1YEY A;  2WDR A;  2XGZ A;  3SZF A;  3UTG A;  3SJN A;  2OAL A;  2OZ8 A;  1TYP A;  2MUC A;  2H88 A;  3F8R A;  1RVK A;  1KKO A;  5G5G B;  2R0P A;  4AT0 A;  2WHD A;  1FCD A;  6ENL A;  3ZVH A;  1L9C A;  3KA7 A;  4H2P A;  3D8X A;  1PBE A;  1NEK A;  2RGJ A;  1P2E A;  3P4Q A;  2R4J A;  3K1G A;  4H2N A;  1DOD A;  1GND A;  2XVF A;  4EQW A;  2CFY A;  4GIR A;  3V5C A;  3CPH G;  2GQW A;  4H4X A;  4Z43 A;  4GCM A;  3BJS A;  1BQG A;  3NTA A;  3GYX A;  4Z1Y A;  1BGJ A;  2AQJ A;  4Z44 A;  4K5R A;  2IVE A;  5BUL A;  2BS4 A;  2B9X A;  4JN9 A;  3P9U A;  1GES A;  3C4A A;  1S2Q A;  4PAB A;  1H84 A;  3JSK A;  2BK3 A;  4B65 A;  1GT8 A;  2CUL A;  4DX3 A;  2QVH A;  2HNE A;  4EIP A;  1KDG A;  3AE9 A;  4A99 A;  4IA6 A;  2Q7V A;  4GYP A;  4GGB A;  4GFI A;  3R9U A;  3ZYX A;  2WP5 A;  4MKS A;  1PJ7 A;  2R0G A;  1W4X A;  2YM2 A;  3N6H A;  2WOW A;  1E9I A;  1PBD A;  3AD9 B;  1E39 A;  1EL7 A;  3VRB A;  4ZCD A;  3GMB A;  1BGN A;  2GR0 A;  2IID A;  3T0K A;  3G5R A;  3RP6 A;  1MRA A;  4OPG A;  2GAG B;  1OEP A;  2QAE A;  4YSH A;  3PG6 A;  2YG6 A;  1VG9 A;  4B67 A;  1N60 C;  5EB5 A;  3UGV A;  3QFA A;  2GR1 A;  1KF6 A;  4TM4 A;  3NH3 X;  2OA1 A;  4O5U A;  3DDM A;  2BC0 A;  1E6E A;  4TM0 A;  2X3N A;  2A8X A;  4OPD A;  1V59 A;  1Z6L A;  4GDE A;  3K30 A;  2VQB A;  3QKE A;  1SJA A;  2POD A;  3OZY A;  2YLX A;  4CNK A;  1GRB A;  2WU5 A;  3T4W A;  4OVI A;  3A7A A;  3EPT A;  2FJB A;  3NYC A;  4U8J A;  5BRT A;  1IUW A;  4J57 A;  3CAW A;  2APG A;  2YR5 A;  1IUU A;  1X31 B;  4J3Z A;  1NHQ A;  2XH0 A;  3FXG A;  4J31 A;  3AMZ A;  3UXK A;  1ZKQ A;  3Q6J A;  4G6H A;  2OO6 A;  3BOX A;  2F5Z A;  3AE7 A;  3NK2 X;  1CC6 A;  2BS3 A;  2XFQ A;  3ITJ A;  2W3S A;  4HYR A;  4MJW A;  4LU6 A;  3LJP A;  3SFE A;  4H50 A;  4H4R A;  3I4K A;  3B6D A;  3EAO A;  1VDV A;  2WPE A;  4M6U A;  4TVW A;  3T14 A;  4K5S A;  1CC2 A;  2RGO A;  3UOY A;  1SJC A;  3SYI A;  4IT1 A;  3QSE A;  4C3X A;  4IHC A;  1NAA A;  2J3N A;  2MNR A;  1VDC A;  3P4S A;  1FL2 A;  2XH4 A;  4NZH A;  5KMS A;  3ZLG A;  2QGY A;  3AEC A;  3GDP A;  3COX A;  1JDF A;  1N4V A;  3U9I A;  3ICS A;  1VQW A;  5CKU A;  2ARD A;  1FFU C;  4D04 A;  3VDG A;  4A6G A;  2XFO A;  3ALJ A;  3NRN A;  5EOW A;  3IK4 A;  4YWS A;  4JDR A;  2GGE A;  2PCE A;  4M0X A;  3THU A;  3EAN A;  3STP A;  3DME A;  2VVL G;  5HXI A;  3DER A;  4N9X A;  3NKS A;  3GRS A;  4BK1 A;  3BSM A;  1FOH A;  2BAC A;  2ZC8 A;  2WDV A;  3SR6 B;  3VR9 A;  2Q6U A;  3TWA A;  1YKJ A;  4NTE A;  2C65 A;  4ICY A;  3PK7 A;  4XXG A;  1M64 A;  2P88 A;  2PPG A;  1L8P A;  2DKI A;  2JB3 A;  3OC4 A;  1F6M A;  1TDK A;  4ZCC A;  3DGZ A;  4UDP A;  3AM9 A;  1AOG A;  2C3C A;  2WDQ A;  1CF3 A;  2YLR A;  1DJQ A;  1GRH A;  3MSY A;  3OZ2 A;  3MKC A;  3P93 A;  3CNT A;  3SFD A;  2XLR A;  3CMM A;  4EQR A;  2XLU A;  2OKT A;  5J04 A;  1KSU A;  5FS6 A;  2VZ2 A;  1EC9 A;  3AED A;  4GR1 A;  4A5L A;  3ATR A;  4JNQ A;  3BI4 A;  3MUC A;  2HXT A;  3NT6 A;  2OQH A;  3ZVI A;  4EQX A;  2OZ3 A;  4B69 A;  4U2L A;  3DH9 A;  3DGB A;  2OG9 A;  4U2T A;  4Z24 A;  2XVH A;  4FP1 A;  3CPJ G;  1ONE A;  2C70 A;  2C75 A;  5IQ4 A;  5BOE A;  4U8O A;  5G5H B;  3OZM A;  4GAP A;  3CGC A;  3UOV A;  2X99 A;  3NYE A;  4H4S A;  2WOV A;  1EL8 A;  4TLX A;  3PO7 A;  1CJ3 A;  5CQF A;  4FX9 A;  4CY8 A;  1NEN A;  2XLT A;  2FKP A;  2VOU A;  3ICT A;  1MO9 A;  3CGB A;  3DJE A;  3VQR A;  1E1K A;  4KPL A;  3KKJ A;  3DK8 A;  1JPD X;  3ATQ A;  2XH2 A;  4BJZ A;  4D03 A;  2P8B A;  3DA1 A;  3MY9 A;  3RCY A;  3SZC A;  2PHH A;  5J60 A;  2PTZ A;  1CL0 A;  1ZDL A;  3B97 A;  1FHU A;  1N62 C;  2YVF A;  1GRT A;  4U2S A;  2TPR A;  4IVM B;  3I6D A;  3PS9 A;  1JRZ A;  5KOW A;  3MQT A;  3JVA A;  2C7G A;  1O94 A;  1BKH A;  2NQL A;  4HCD A;  2PTW A;  3R1Z A;  4GRT A;  4PAA A;  1OJA A;  3RIT A;  2ACZ A;  3EKG A;  3H7V A;  3SN0 A;  1MXT A;  3DJD A;  3EUB 3;  4II2 A;  4G74 A;  3R07 C;  2PP3 A;  2V60 A;  4ZA0 A;  4GF7 A;  2BRA A;  4G8T A;  4J56 A;  2WES A;  3HRD C;  3LOV A;  4LA1 A;  3O0H A;  2QDE A;  4Z25 A;  4CBQ A;  4USQ A;  4U8I A;  4H4V A;  3NS1 B;  4EWJ A;  3JW7 A;  2PP1 A;  4K7Z A;  4E8G A;  2OZT A;  5FJP A;  1GTE A;  2WEU A;  2P0I A;  3SQP A;  4OPL A;  3UKP A;  3AYJ A;  4EM4 A;  3TWB A;  5KWF A;  1CJ4 A;  3T37 A;  3TOY A;  1YQ4 A;  5FJR A;  4IA5 A;  3FV9 A;  3T8Q A;  2EQ8 A;  3N4F A;  3LB8 A;  4E5T A;  3CN8 A;  4YWO A;  3UKH A;  2WBA A;  1T3Q C;  4Z2R A;  3OTR A;  2OLO A;  2W3R A;  3RHA A;  2YLW A;  1UKV G;  2FYM A;  4F4R A;  4YTN A;  3GD4 A;  2AL1 A;  2JAE A;  2FJD A;  2FJA A;  1BZL A;  2QA2 A;  3DK4 A;  2JB1 A;  1L9E A;  2GQF A;  1B5Q A;  1CC4 A;  4IL0 A;  4ZCW A;  5BOF A;  1PBF A;  1DOC A;  1N4W A;  3BHK A;  2OLA A;  2I0Z A;  3IWA A;  4H4T A;  5BUK A;  2OX4 A;  3S5S A;  4NTC A;  3AYI A;  1IUT A;  1EBH A;  4H4P A;  4A6N B;  2X50 A;  4BUR A;  3CXB A;  3AE2 A;  4AP3 A;  5JCL A;  1DXL A;  1NHP A;  4JY3 A;  3H12 A;  3KU9 A;  3UKQ A;  4EMI A;  3PVC A;  1XS2 A;  2GVC A;  3NFU A;  5ER0 A;  1K0L A;  1PDY A;  1XAN A;  3TJ4 A;  3S61 A;  3D1C A;  4KT2 A;  3I6E A;  1KFY A;  3GYJ A;  3AEA A;  5C2T A;  2V6O A;  2GGG A;  5JCK A;  3JZU A;  1N5W C;  1E1N A;  2I5Q A;  1PHH A;  1NDA A;  1BKW A;  1GV4 A;  1VG0 A;  3ALL A;  3NLC A;  3P4R A;  2YWL A;  1ZY8 A;  3L1R A;  3AYL A;  3A7R A;  3PWG A;  3EEZ A;  3GY1 A;  5EBK A;  3QPE A;  3FMW A;  1JPM A;  5JCI A;  1N5X A;  1ZXI C;  2FJE A;  4OPU A;  1Q1W A;  4JY2 A;  5DBJ A;  5HHF A;  3HPF A;  1MDL A;  2YLT A;  3VA8 A;  1LVL A;  3I3L A;  4BK2 A;  3P3B A;  3UOX A;  1D4E A;  4B68 A;  1JOA A;  1TDE A;  3NRZ B;  1MDR A;  4ZN0 A;  2E1M A;  5FS8 A;  3TTE A;  2XFN A;  4J34 A;  4Y4M A;  4YSZ A;  2VVL A;  2H89 A;  2RDX A; 
#chains in the Genus database with same CATH homology
 1GRF A;  2YR4 A;  3S5W A;  1FOH A;  2BAC A;  2WDV A;  3NYF A;  1JU2 A;  4FK1 A;  3VR9 A;  4EMW A;  2WOI A;  2Q6U A;  3DK9 A;  3SM8 A;  1ONF A;  3VRD B;  5KMP A;  1OJ9 A;  1TRB A;  5JCM A;  1Y0P A;  2XDO A;  3NK0 X;  1YKJ A;  4NTE A;  1GSN A;  1D7Y A;  1IUX A;  2C65 A;  2X8C A;  2Q0L A;  4ICY A;  4XXG A;  4UP3 A;  3P4P A;  1D4C A;  3AE8 A;  2C72 A;  4A6N B;  1YQ3 A;  1IUS A;  1M64 A;  2EQ9 A;  4D04 A;  1JNZ A;  4JQ9 A;  4TM1 A;  1Q9I A;  2V3B A;  2DKI A;  1Y56 B;  3H8L A;  1JNR A;  1NHR A;  2JB3 A;  3OC4 A;  1L9D A;  3UKK A;  2C73 A;  1F6M A;  3EF6 A;  2YQU A;  3K7Q X;  1TDK A;  4ZCC A;  1E1M A;  1EBD A;  3DGZ A;  4WX1 A;  4BK1 A;  4UDP A;  4Y4N A;  3UTE A;  1GET A;  3D9X A;  1AOG A;  2BK5 A;  3NGC X;  2V61 A;  2C3D A;  2C3C A;  1GAL A;  1O95 A;  2WDQ A;  4U8M A;  4REK A;  1CF3 A;  2BRY A;  2YLR A;  3FPZ A;  4U8L A;  1DJQ A;  2BC1 A;  1QO8 A;  2GMJ A;  1RSG A;  4GUV A;  4TLZ A;  1GRH A;  2WS3 A;  1ZP0 A;  3QVR A;  4JNA A;  3CIR A;  3OZ2 A;  3CNT A;  3C96 A;  4NTD A;  2BS2 A;  2XLR A;  3CMM A;  4K2X A;  3SFD A;  3AEE A;  3AE3 A;  3BI5 A;  3H8I A;  4EQR A;  4H2Q A;  1N1P A;  3RED A;  1GXF A;  2XLU A;  4IVO B;  1KSU A;  5FS6 A;  2VZ2 A;  3RP7 A;  3QSS A;  3AED A;  2XLP A;  1NPX A;  1HYU A;  5FS7 A;  4YKF A;  3KPK A;  4YKG A;  2CVJ A;  4GR1 A;  2V5Z A;  2EQ7 A;  1H86 A;  3BNU A;  3E1T A;  4GDP A;  3L5O A;  4X9N A;  1H81 A;  3ATR A;  4JNQ A;  3BI4 A;  4CCR A;  4C74 A;  2GRT A;  1XDI A;  2JBV A;  2RGH A;  5U1O A;  5KXJ A;  4FDC B;  2OLN A;  3NT6 A;  3LAD A;  3QVP A;  3M13 A;  1S3B A;  4TM3 A;  1GOS A;  1QJD A;  4FK1 C;  1PS9 A;  3BHF A;  4IV9 A;  3FG2 P;  3UTH A;  5KRQ A;  4EQX A;  1PJ5 A;  1O5W A;  1QLB A;  5C3J A;  4EIQ A;  4B69 A;  2R9Z A;  1LTX R;  4U2L A;  3DH9 A;  1KN0 A;  5FMH A;  3V76 A;  4YTP A;  2X8G A;  2VVM A;  3RNM A;  4A9W A;  4YT0 A;  4I58 A;  4U2T A;  3M0O A;  4Z24 A;  2XVH A;  1S2Y A;  1PBB A;  1TDN A;  3CPJ G;  3NN0 X;  2YG5 A;  4NWZ A;  2ZZC A;  1KNR A;  4B63 A;  4UDR A;  2HQM A;  2C70 A;  2BAB A;  1DJN A;  1PJ6 A;  1OJD A;  2C75 A;  3GSI A;  5BVA A;  5EB4 A;  2WPF A;  3GMC A;  4DSH A;  1MOK A;  3GWD A;  5IQ4 A;  2GR3 A;  4HA6 A;  2GEW A;  2ZBW A;  4U8O A;  2AAQ A;  2XVE A;  3AXB A;  3VRA A;  2GAH B;  3NN6 X;  3AEF A;  1F3P A;  3CGC A;  2B7S A;  4GAP A;  2X99 A;  3NYE A;  4XWR A;  3CND A;  3UOV A;  4B64 A;  1P2H A;  5J7X A;  2GR2 A;  4H4S A;  2WOV A;  4EM3 A;  3CPI G;  4K22 A;  5GRT A;  1KNP A;  3UTF A;  4K8D A;  1S7M A;  1DOE A;  1EL8 A;  4TLX A;  3PO7 A;  1CJ3 A;  3AD7 B;  2WP9 A;  3QJ4 A;  3T2K A;  5HY5 A;  5HYM A;  2V3A A;  4J36 A;  4FX9 A;  2Z5X A;  2RAB A;  3H4K A;  1IJH A;  5CQF A;  4C3Y A;  3WE0 A;  2YVG A;  4CY8 A;  1NEN A;  4OPI A;  2XLT A;  1LQU A;  3G5Q A;  3LXD A;  3SY4 A;  3CNJ A;  3T2Z A;  2VOU A;  2YAU A;  2VRL A;  3ICT A;  3ISH A;  1MO9 A;  3AE1 A;  3CGB A;  3DJE A;  3VQR A;  4USR A;  1CJ2 A;  1E1K A;  4KX6 A;  3KKJ A;  4A79 A;  3DK8 A;  2WDR A;  4C77 A;  3ATQ A;  3ADA B;  3SZF A;  3UTG A;  4BV6 A;  4CRT A;  4BJZ A;  1OJC A;  3UP5 A;  2OAL A;  4CNJ A;  2A87 A;  3SGL A;  1TYP A;  1GEU A;  4D03 A;  3DA1 A;  1S3E A;  3SZC A;  2PHH A;  4H4Q A;  5KMQ A;  5J60 A;  2H88 A;  3F8R A;  1CL0 A;  2GV8 A;  4G6G A;  2R0P A;  4UDQ A;  4AT0 A;  2WHD A;  1FCD A;  1ZDL A;  3NIX A;  4CY6 A;  1LQT A;  4X4J A;  2C4C A;  4C5O A;  3BNM A;  4RG4 A;  2YVF A;  1GRT A;  3IF9 A;  1L9C A;  3KA7 A;  4H2P A;  4U2S A;  3IHM A;  3D8X A;  2TPR A;  2PYX A;  1PBE A;  2YG3 A;  3HYW A;  4BK3 A;  4Z2U A;  1BF3 A;  4IVM B;  3I6D A;  3PS9 A;  1NEK A;  2C64 A;  2RGJ A;  4DNA A;  2BCP A;  1JRZ A;  3NTD A;  3GDN A;  1H7X A;  5KOW A;  1P2E A;  2C7G A;  2C66 A;  3P4Q A;  3NHO X;  2YVJ A;  2QCU A;  3NNE A;  1LV0 A;  1JRY A;  1O94 A;  2R4J A;  5M10 A;  1B37 A;  4GRT A;  4H2N A;  4PAA A;  1OJA A;  3F8P A;  1DOD A;  1GND A;  2XVF A;  1CJC A;  1F8S A;  4EMJ A;  4EQW A;  2VRM A;  2CFY A;  1PBC A;  3NG7 X;  2ACZ A;  4B1B A;  2XCG A;  4H4W A;  2YLZ A;  3CPH G;  4H2R A;  2GQW A;  4H4X A;  1EL5 A;  3GYI A;  4GCM A;  4OCG A;  4Z43 A;  1MXT A;  1L0V A;  3DJD A;  3HYV A;  3NTA A;  3GYX A;  1H7W A;  5FS9 A;  2BK4 A;  4II2 A;  1BGJ A;  4G74 A;  2BYB A;  2AQJ A;  4U8K A;  2B9Y A;  2V60 A;  2IVE A;  4K5R A;  2BS4 A;  4GF7 A;  4NEW A;  2B9X A;  4Z44 A;  5BUL A;  1H2I A;  2BRA A;  4JN9 A;  4X9M A;  4BJY A;  3P9U A;  1GES A;  2AR8 A;  3C4A A;  3UP4 A;  1S2Q A;  4J56 A;  2WQY A;  4PAB A;  1RP0 A;  1H84 A;  2WES A;  1LPF A;  3JSK A;  3LOV A;  4LA1 A;  3O0H A;  5TR3 A;  2XLS A;  4Z25 A;  3AD8 B;  4II3 A;  2TMD A;  1NG3 A;  2BK3 A;  3IC9 A;  1H83 A;  4CBQ A;  1LJ1 A;  4A6N A;  4B65 A;  4USQ A;  2YR6 A;  1GT8 A;  4DGK A;  2CUL A;  2WET A;  4DSG A;  4U8I A;  3KPF A;  1OJT A;  4Z26 A;  4EIP A;  1GRA A;  2GF3 A;  4ADW A;  1Q1R A;  1KDG A;  2JKC A;  4WCT A;  3AE9 A;  5KMR A;  4H4V A;  4A99 A;  4IA6 A;  4K7Z A;  2Q7V A;  4A65 A;  3CTY A;  3R9U A;  4CCQ A;  3ZYX A;  2WP5 A;  1FEC A;  1PJ7 A;  1GTE A;  1F8W A;  1GER A;  2O9Z A;  2R0G A;  2WEU A;  4XWZ A;  3SQP A;  3K7M X;  4OPL A;  3UKP A;  3CNS A;  3AYJ A;  3UKA A;  1W4X A;  5L46 A;  1ZMC A;  4EM4 A;  5KNL A;  2YM2 A;  5KWF A;  4APN A;  1CJ4 A;  1XPQ A;  4KPR A;  3T37 A;  2WOW A;  4H7U A;  1YQ4 A;  4Z2T A;  4ECH A;  1PBD A;  4IA5 A;  4J33 A;  1TDF A;  1E1L A;  3AD9 B;  2EQ8 A;  4A5L A;  1E39 A;  1EL7 A;  3DGH A;  3VRB A;  2Q0K A;  3AEG A;  4ZCD A;  3GMB A;  4AT2 A;  3LB8 A;  1BGN A;  2E5V A;  3UKL A;  4A7A A;  2GR0 A;  2IID A;  3CN8 A;  3T0K A;  3G5R A;  4NNJ A;  4YWO A;  1TDO A;  3RP6 A;  3UKH A;  2WBA A;  2XFU A;  4OPG A;  4BK2 A;  2GAG B;  3UOZ A;  4Z2R A;  1D4D A;  2QAE A;  2OLO A;  1GRE A;  4YTM A;  4I59 A;  4YSH A;  3PG6 A;  3V3O A;  3RHA A;  5KOX A;  2YG6 A;  1VG9 A;  4B67 A;  5EB5 A;  3SZ0 A;  3QFA A;  1BWC A;  2GR1 A;  1KF6 A;  1UKV G;  2YLW A;  4TM4 A;  3KLJ A;  3FBS A;  2CDU A;  3NH3 X;  3SZW A;  1K4Q A;  2OA1 A;  4U8N A;  4O5U A;  1RYI A;  2JK6 A;  2R45 A;  2BC0 A;  1CBO A;  4YTN A;  1ZK7 A;  1E6E A;  4G9K A;  1GTH A;  3GD4 A;  2VQ7 A;  2X3N A;  4TM0 A;  2A8X A;  4OPD A;  2JAE A;  1V59 A;  1Z6L A;  2C76 A;  4GDE A;  3ICR A;  2FJD A;  3K30 A;  4H4Y A;  3GRT A;  2VQB A;  2BXS A;  4OPC A;  2FJA A;  5U63 A;  4AOX A;  3AWI A;  3AE5 A;  1BZL A;  2YLX A;  2GB0 A;  2YLS A;  2WP6 A;  2QA2 A;  3DJG X;  3DK4 A;  1N4U A;  2GMH A;  2JB1 A;  3V3N A;  4CNK A;  1GRB A;  2EQ6 A;  2WU5 A;  2E4G A;  1L9E A;  3AEB A;  3KVE A;  4B66 A;  2QA1 A;  2GQF A;  4U8P A;  1B5Q A;  1CC4 A;  3UKF A;  1PBF A;  4YSX A;  1DOC A;  1N4W A;  4OVI A;  3L8K A;  2WU2 A;  3EPT A;  3ZDN A;  3BHK A;  2NPX A;  1GRG A;  2I0Z A;  1M6I A;  1NG4 A;  2FJB A;  3NYC A;  3QSM A;  4J2W A;  4U8J A;  3IWA A;  4H4T A;  3VR8 A;  1CHU A;  5BUK A;  5BRT A;  1IUW A;  3KD9 A;  4J57 A;  3AB1 A;  1D7L A;  4NTC A;  2APG A;  3AYI A;  1IUT A;  1GPE A;  3K7T A;  4H4P A;  1IUU A;  2YR5 A;  2X50 A;  1PXA A;  2R4E A;  4BUR A;  5GSN A;  4NEV A;  1D5T A;  1X31 B;  2B9W A;  3AE2 A;  4AP3 A;  1NHQ A;  5JCL A;  1K0I A;  1DXL A;  5M0Z A;  1NHP A;  1IUV A;  1F8R A;  3M12 A;  4JY3 A;  3KU9 A;  3T2Y A;  2XYO A;  1ZOY A;  4J31 A;  3UKQ A;  4EMI A;  2OAM A;  2FBW A;  1ZKQ A;  2W0H A;  3Q6J A;  3PVC A;  1XHC A;  2GVC A;  4G6H A;  2ZZ0 A;  5ER0 A;  2BXR A;  1ZOV A;  3ABV A;  1Y56 A;  1K0L A;  4YSY A;  2F5Z A;  4LII A;  1XAN A;  3AE7 A;  3DJJ A;  3NK2 X;  3II4 A;  1CC6 A;  3RP8 A;  4M52 A;  2C67 A;  2R46 A;  5KVH A;  2BS3 A;  2XFQ A;  3ITJ A;  3S61 A;  3SX6 A;  3IHG A;  1REO A;  3AE6 A;  3P1W A;  1ZMD A;  3D1C A;  4MJW A;  3URH A;  1KFY A;  4LU6 A;  3HZL A;  4E0V A;  3T31 A;  3GYJ A;  4H4U A;  3FIM B;  2NVK X;  2GH5 A;  3AEA A;  3LJP A;  3SFE A;  4OPT A;  4HB9 A;  5C2T A;  4P9S A;  3HYX A;  2Y6Q A;  2V6O A;  4H50 A;  1ELI A;  4H4R A;  1FEA A;  5JCK A;  1E1N A;  1PHH A;  2DKH A;  2XFP A;  1NDA A;  5JCN A;  1BKW A;  3B6D A;  1GV4 A;  1VG0 A;  3ALL A;  3EAO A;  3NLC A;  4Y4L A;  3P4R A;  1B4V A;  1VRQ B;  3CGE A;  3ALM A;  2YWL A;  1COY A;  3AE4 A;  2WPE A;  1ZY8 A;  5U25 A;  2YG7 A;  1KSS A;  1JRX A;  3L1R A;  4O5Q A;  1H82 A;  3T14 A;  4K5S A;  3AYL A;  1CC2 A;  2RGO A;  3UOY A;  3BI2 A;  2X8H A;  3SYI A;  5EBK A;  3QSE A;  4C3X A;  1FEB A;  3GD3 A;  1NAA A;  2J3N A;  1DOB A;  1VDC A;  3SXI A;  2ZZB A;  2BCG G;  3P4S A;  1FL2 A;  2YG4 A;  3FMW A;  3Q9T A;  4NZH A;  1PN0 A;  5JCI A;  2BA9 A;  5KMS A;  2B76 A;  2WPC A;  4AOS A;  2FJE A;  3AEC A;  1ZX9 A;  3COX A;  1YY5 A;  2R0C A;  3GDP A;  4OPU A;  3CNP A;  1N4V A;  1PXB A;  1PDH A;  1SEZ A;  1Q1W A;  4JY2 A;  5DBJ A;  5HHF A;  1K0J A;  1DNC A;  1H6V A;  4H4Z A;  3ICS A;  4RG3 A;  1VQW A;  3GWF A;  5CKU A;  1E7P A;  2ARD A;  3B3R A;  1TYT A;  2YLT A;  2IVD A;  4G73 A;  2B7R A;  1LVL A;  5KVI A;  5JRB A;  2XVI A;  3I3L A;  5IQ1 A;  3F8D A;  3UCL A;  3UOX A;  1NHS A;  2UZZ A;  1D4E A;  3LZW A;  3QFB A;  4AP1 A;  3NRN A;  2XFO A;  3ALJ A;  2Z5Y A;  4B68 A;  1JOA A;  2JB2 A;  5EOW A;  1TDE A;  2XVJ A;  2Y6R A;  4RSL A;  4ZN0 A;  2E1M A;  3LZX A;  1YQZ A;  3CGD A;  4JDR A;  4EQS A;  4GAV A;  5FS8 A;  1B8S A;  3EAN A;  2XFN A;  3DME A;  4YXD A;  3NK1 X;  1PXC A;  2VVL G;  5HXI A;  5IPY A;  4J34 A;  2YM1 A;  4N9X A;  3NKS A;  4Y4M A;  1JEH A;  4YSZ A;  3G5S A;  1EL9 A;  2A89 A;  2VVL A;  2H89 A;  3GRS A;  5LV9 A;  3C4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...