3OC4A

Crystal structure of a pyridine nucleotide-disulfide family oxidoreductase from the enterococcus faecalis v583
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
442
structure length
422
Chain Sequence
LKIVIIGASFAGISAAIASRKKYPQAEISLIDKQATVGYLSGRYITEEELRRQKIQLLLNREVVAMDVENQLIAWTRKEEQQWYSYDKLILATGASQFSTQIRGSQTEKLLKYKFLSAVPLLENSQTVAVIGAGPIGMEAIDFLVKMKKTVHVFESLENLLPKYFDKEMVAEVQKSLEKQAVIFHFEETVLGIEETANGIVLETSEQEISCDSGIFALNLHPQLAYLDKKIQRNLDQTIAVDAYLQTSVPNVFAIGDCISVMNEPVAETFYAPLVNNAVRTGLVVANNLEEKTHRFIGSLRTMGTKVGDYYLASTGLTETEGLFFPQTLASIIVRQPAPPLQHGTEILGKLIYDKVTQRVLGAQLCSKNNCLEKINTLALSIQTGQTLTDLLQKDYFYQPSLTNIYDITNLMGASAYWREND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Oxidoreductase, pyridine nucleotide-disulfide family
publication title Crystal Structure of a pyridine nucleotide-disulfide family oxidoreductase from the Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
total genus 119
structure length 422
sequence length 442
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3oc4A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3oc4A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3oc4A02
2VVLG 2OLOA 3AE8A 3S5WA 1KSSA 4H4TA 1GEUA 2YG5A 4J31A 2XLTA 4EM4A 3CIRA 1NHSA 4B67A 2EQ7A 4UDQA 4K2XA 2R45A 3BNUA 3QVPA 3AD8B 4H2QA 4H2PA 1GRGA 5HY5A 2XYOA 1F3PA 2DKHA 1XDIA 1GV4A 4OPIA 3DJGX 1NG4A 4H4UA 2BXSA 2X3NA 5U63A 2E4GA 1OJCA 1NHQA 3JSKA 3DK8A 1ZY8A 4U8IA 5KOXA 3F8PA 1LPFA 4P9SA 3BI2A 4Z25A 4KX6A 1GOSA 5GSNA 4EQWA 2YWLA 5TR3A 3F8RA 3WE0A 3GMBA 2GR1A 1XPQA 2WDRA 4J33A 3UCLA 2Y6QA 4YKGA 4FDCB 1GRHA 4EIQA 4JNAA 2C3DA 1B5QA 3DGZA 1B4VA 3T37A 1N4WA 3UTFA 1BF3A 2GH5A 1KSUA 4A7AA 2QCUA 1FECA 1V59A 2YR4A 5BULA 4H50A 4JNQA 3H8LA 1K0LA 2WP6A 1P2EA 4BK1A 3LJPA 4GF7A 4YXDA 5EB5A 3B6DA 2Q6UA 3LZWA 4A9WA 4A5LA 1PXCA 4CNKA 3AE6A 4LA1A 1N4VA 1RYIA 2ZZCA 3AB1A 3RP8A 1H6VA 4J2WA 1Y0PA 4Z43A 4I59A 3GYIA 4LIIA 3KKJA 2GQFA 4OVIA 3L1RA 1KFYA 3QVRA 2XFOA 3GWDA 5KRQA 4AP1A 5U25A 3KVEA 2GMHA 3ICRA 3NHOX 3SQPA 4J34A 3REDA 3LZXA 2Y6RA 5EOWA 4YSYA 3L8KA 4Y4NA 3NTDA 2NPXA 4H4VA 2B7RA 2RGHA 5FS9A 1YQ4A 5KXJA 2WESA 3UOYA 4EMIA 1IJHA 3KA7A 4GR1A 1M64A 4EM3A 2B76A 4KPRA 3ALMA 4JN9A 4B1BA 1YQ3A 1GSNA 2JK6A 2BCGG 3AEFA 2XVFA 3K30A 4TLZA 3NLCA 3NK2X 2YM1A 1F6MA 1LVLA 3CNJA 1PHHA 2XFPA 3GYJA 3AEAA 3FIMB 3OZ2A 4ZCDA 5FS6A 2IIDA 1EBDA 3VRDB 1ZOVA 1IUXA 4RG4A 5LV9A 1RP0A 4CCQA 5C2TA 2YG7A 3GRTA 2XFQA 3M0OA 1QLBA 4Z24A 5HXIA 1Y56A 3K7MX 4YSXA 2JB2A 2UZZA 1KNPA 1Q1RA 3NK0X 4J57A 3ATRA 4A79A 1B8SA 3RP7A 1DJQA 4I58A 1VG9A 2VQBA 5BUKA 3AE7A 4A6NB 2XLRA 3P4PA 4IA6A 1S3BA 1M6IA 2YLWA 3D8XA 1GRAA 2TPRA 1HYUA 1F8SA 4YTNA 1AOGA 1PJ5A 2R0PA 1GTEA 3AE5A 2V3AA 2AR8A 2OALA 3URHA 3QSMA 3NN6X 1JOAA 4U8OA 2A87A 2R4JA 2GB0A 1VDCA 3Q6JA 2Q0KA 4IA5A 3S61A 2FJBA 2C67A 1GRFA 1S3EA 2GF3A 3SGLA 1D4CA 4B68A 2WHDA 2WDQA 3RHAA 2VZ2A 4OPDA 4YTMA 2YM2A 5KWFA 4ADWA 2V60A 5GRTA 4NEVA 1H83A 1O95A 2BA9A 3Q9TA 4H7UA 5KOWA 1Q9IA 2V3BA 1EL7A 2RABA 3NYFA 3ATQA 1GESA 4EMWA 5CKUA 2Z5XA 3C96A 3UKPA 4C5OA 3UOXA 2E1MA 4NZHA 2X50A 2O9ZA 1D7YA 1GRBA 1JRYA 2XFUA 4ZN0A 4B69A 2WOIA 5JCKA 4UDPA 4JY2A 1NDAA 1GPEA 1TDEA 2H89A 2WDVA 4GCMA 1PBCA 4DSHA 1K0IA 3IWAA 4BJYA 2BYBA 5JCIA 2YLSA 3ISHA 1CC6A 1S2QA 1RSGA 1GXFA 4C77A 2Q0LA 4C74A 2BK3A 4X9NA 3LB8A 1OJDA 4OPCA 2R46A 4NTCA 4CCRA 3CGBA 5FS8A 3ZYXA 3DK4A 1PBFA 2IVDA 3GDPA 3DA1A 2ZZBA 3DJJA 1X31B 4Z44A 1CJ3A 1VQWA 2R4EA 4IVOB 4UDRA 3LXDA 3CGEA 2CFYA 1H82A 1TDNA 2NVKX 2WQYA 3SM8A 3BHKA 3KU9A 1L9DA 2Q7VA 1IUUA 3QFAA 2OLNA 2C64A 1BGNA 4GDPA 3VRAA 1L9CA 2DKIA 2F5ZA 5JCMA 5HHFA 4GRTA 2BS2A 4JDRA 2QAEA 2WS3A 3P4RA 1CC4A 3RP6A 3UTHA 4M52A 4TM3A 4AT2A 5J7XA 5IQ4A 2WBAA 2W0HA 2I0ZA 4K8DA 3AYJA 1TYTA 1E39A 3FMWA 4AT0A 2B9YA 4CY6A 1IUTA 1DOCA 2YLXA 4D04A 1BWCA 2YQUA 1EL9A 1FCDA 1S2YA 3AXBA 3AWIA 3IHMA 5BVAA 4H4RA 4JQ9A 3KPFA 1NEKA 4DGKA 2QA2A 2YG3A 2GAGB 3P1WA 2RGOA 1TDOA 3D1CA 4U2LA 4E0VA 3UKLA 4OCGA 2GAHB 4XXGA 4TM1A 4DSGA 5L46A 5IPYA 4PAAA 2GEWA 1GREA 1NAAA 2V5ZA 2BXRA 3DGHA 1E1NA 2C70A 3AD9B 2WOWA 4PABA 1COYA 1XANA 2EQ6A 3PVCA 2V6OA 5FS7A 4A65A 3AE3A 3FG2P 1KF6A 2EQ9A 1Q1WA 3IF9A 4X4JA 3UKQA 4EIPA 1DNCA 4U8KA 1SEZA 2YR5A 1IUWA 1TYPA 3KLJA 4A6NA 2AQJA 1GALA 4REKA 1O94A 3UOVA 1GRTA 1ZKQA 1CHUA 2XVHA 2VOUA 3GSIA 4NEWA 2APGA 3BHFA 4LU6A 4O5QA 4APNA 1L9EA 5CQFA 1DJNA 4YSHA 3CPJG 3UKAA 1ZOYA 2GVCA 2VQ7A 4HB9A 4ICYA 2A89A 1K0JA 4RG3A 2FJEA 1PBEA 3NYEA 4U8JA 4H4WA 2C75A 2H88A 2WPCA 2PYXA 3CPHG 3NH3X 3DK9A 3PS9A 1GNDA 2YAUA 2YVGA 3PO7A 5EB4A 2C72A 2TMDA 3GD4A 4YTPA 3GWFA 2GV8A 3ICTA 1H84A 3QJ4A 3AEGA 3UKKA 1VRQB 3CNTA 1D4EA 2X8CA 2YG6A 3UTEA 3GDNA 3HZLA 1H7WA 1YQZA 3DJEA 3OC4A 1CJ4A 2VVLA 1OJAA 3NIXA 4O5UA 4H4QA 1B37A 5JCNA 3AE9A 3O0HA 4Z2UA 1NPXA 4FK1C 4EQXA 1PJ6A 4U8LA 2BCPA 4A99A 3UOZA 4TM0A 2XLPA 3V3OA 4YKFA 4C3XA 5HYMA 1LJ1A 3BNMA 1JU2A 2ARDA 4EMJA 3AEDA 4K22A 4OPUA 1PXBA 1PJ7A 1GETA 2JB1A 2XVIA 4N9XA 3FPZA 2J3NA 1N1PA 1PXAA 2FBWA 3G5QA 3NN0X 1ZK7A 4K5SA 4U2SA 1GTHA 3DJDA 3H8IA 3V3NA 2YVFA 5KVHA 2VRMA 2XFNA 4TLXA 3M12A 4BK3A 1F8WA 2GRTA 5FMHA 4UP3A 4USQA 1LTXR 2VVMA 2X99A 1YKJA 2WPEA 3CTYA 1FOHA 3IHGA 4B66A 4YT0A 3BI5A 1UKVG 1E7PA 4RSLA 5J60A 4IV9A 3AE1A 1CJ2A 2IVEA 3SFEA 4H2NA 1DOBA 2C7GA 2XVEA 2ACZA 3QSEA 4Z2RA 3EANA 2BK5A 3M13A 4J56A 1JEHA 1DXLA 2YLRA 1JRZA 3DMEA 2A8XA 1ZMCA 2C66A 3QFBA 1DOEA 4DNAA 3AE2A 3CNDA 3ABVA 1E1LA 1MO9A 1E1KA 4Y4LA 5DBJA 1QJDA 2JAEA 1ONFA 2HQMA 3G5RA 5IQ1A 4H4YA 1PDHA 1FEBA 5JCLA 2VRLA 5BRTA 1TRBA 2CVJA 2XCGA 2GMJA 3CNPA 2WP9A 3AD7B 3I3LA 3COXA 4BK2A 2YR6A 4JY3A 4BURA 4MJWA 2JB3A 1IUSA 2XVJA 3VR8A 1CF3A 2FJDA 4H4XA 3UTGA 3NK1X 4BV6A 4GDEA 4H4ZA 3P4QA 3LADA 4Z26A 3AE4A 3CN8A 2RGJA 1E6EA 2GR3A 3GRSA 1ZP0A 1IUVA 1L0VA 4D03A 2XLUA 4CY8A 2BS3A 4CBQA 1LQUA 1LV0A 1NHPA 1CBOA 2GQWA 4H2RA 4X9MA 2Z5YA 2BC1A 1F8RA 4HA6A 2X8GA 1CL0A 1PBBA 3E1TA 2JBVA 1KNRA 3LOVA 4XWRA 4EQSA 1D4DA 4H4PA 1E1MA 1LQTA 1Z6LA 2XLSA 1TDKA 3GMCA 4IVMB 4AOSA 4B65A 5C3JA 1ELIA 3FBSA 4Y4MA 3EAOA 2BC0A 3I6DA 1MOKA 3UKHA 4AOXA 2YLTA 2CULA 3G5SA 5M10A 2AAQA 3EPTA 3QSSA 2WETA 4Z2TA 2V61A 3K7QX 2E5VA 3EF6A 3GD3A 1CJCA 2QA1A 2C73A 3NKSA 5M0ZA 3P9UA 3UP5A 4J36A 1DODA 1YY5A 1O5WA 2WP5A 1VG0A 3UP4A 2WU5A 3C4NA 4WX1A 4FK1A 4B63A 3NYCA 5ER0A 3CGCA 3V76A 1GT8A 2JKCA 2C3CA 2B9WA 3ITJA 2C76A 4ECHA 4B64A 3H4KA 4U2TA 3CPIG 3BI4A 4AP3A 4GUVA 3RNMA 3AECA 2WU2A 2WOVA 2EQ8A 1ZMDA 1XHCA 1REOA 4EQRA 1W4XA 4NTDA 1GERA 1TDFA 1PBDA 1MXTA 2YLZA 1BKWA 1D7LA 4YSZA 3IC9A 1CC2A 4C3YA 4OPGA 1PS9A 4H4SA 2BK4A 1EL5A 3II4A 3VRBA 1FEAA 1P2HA 3DH9A 4U8PA 4U8NA 3VR9A 4U8MA 2B9XA 4FX9A 2FJAA 1K4QA 3ADAB 1BZLA 3P4SA 1PN0A 2OAMA 1FL2A 4TM4A 4K5RA 3AEEA 1KDGA 1JNRA 3AYIA 3NRNA 1BGJA 3NNEA 2OA1A 2CDUA 4K7ZA 1QO8A 2GR0A 1EL8A 2ZBWA 4ZCCA 4CRTA 1H81A 4USRA 2R9ZA 1H86A 1ZDLA 4XWZA 3NGCX 3ZDNA 3CNSA 4CNJA 3AEBA 4YWOA 4OPTA 5EBKA 3KD9A 3VQRA 2WPFA 3CGDA 3B3RA 3SFDA 5U1OA 2YG4A 2ZZ0A 1NENA 3ALJA 4OPLA 2WEUA 1Y56B 3ALLA 3K7TA 5KVIA 2BS4A 1OJ9A 1H7XA 1ZX9A 3NG7X 3R9UA 4WCTA 3NT6A 2BACA 2GR2A 2R0GA 2X8HA 2XDOA 3F8DA 4NTEA 1JRXA 1N4UA 3UKFA 3NTAA 3ICSA 1NG3A 3C4AA 1NHRA 1OJTA 2YVJA 2B7SA 4BJZA 3AYLA 1JNZA 2BABA 2PHHA 1D5TA 2C65A 2R0CA
chains in the Genus database with same CATH superfamily
4H4TA 2W54A 1NHSA 4B67A 2EQ7A 2R45A 3QVPA 2E5AA 4H2PA 1GRGA 1F3PA 2DKHA 1GV4A 4OPIA 3DJGX 3SN4A 2E4GA 2QVHA 4DWDA 2AL2B 1ZY8A 3KPKA 3F8PA 1LPFA 3R25A 3DFYA 4Z25A 5TR3A 3F8RA 2GR1A 4FDCB 4H2HA 2C4CA 4EIQA 2C3DA 3UTFA 1BF3A 4A7AA 1K0LA 2WP6A 3B6DA 3LZWA 4CNKA 4LA1A 1N4VA 1RYIA 3UXLA 4J2WA 3GYIA 2GQFA 4II3A 3L1RA 1KFYA 3QVRA 3GWDA 1JPDX 4AP1A 3KVEA 4Y4NA 2B7RA 1YQ4A 1IJHA 4GR1A 1M64A 4JN9A 2PU0A 3NLCA 4IT1A 3NK2X 1EBHA 3AEAA 3OZ2A 5FS6A 4JN8A 5LV9A 3QPEA 5C2TA 2YG7A 3GRTA 4Z24A 2OFJA 4DHGA 2UZZA 1KNPA 3NK0X 3SQSA 3FV9A 4A79A 2CHRA 1B8SA 3RP7A 3SX6A 4A6NB 2XLRA 3P4PA 3D8XA 3N4EA 1F8SA 1AOGA 2R0PA 2OZTA 3T2YA 2FJBA 1GRFA 1S3EA 1D4CA 2WDQA 3R0UA 4YTMA 4H7UA 3Q9TA 1Q9IA 3NYFA 3UOXA 1JRYA 2XFUA 1TDEA 2H89A 4NWZA 5JRBA 3FXGA 1K0IA 3IWAA 3EEZA 2QGYA 1TZZA 3ISHA 1CC6A 1S2QA 3V5CA 4DX3A 4C74A 3Q45A 1H2IA 3LB8A 1PBFA 3DA1A 1WUFA 4IVOB 4KEMA 1R0MA 2WQYA 3JZUA 3R0KA 2C64A 1BGNA 3VRAA 5HHFA 1KN0A 3P4RA 4M52A 3PFRA 5J7XA 3TTEA 4GMEA 3GY1A 1E39A 3FMWA 1IUTA 2PTYA 5ENLA 4DGKA 4U2LA 3DG6A 4TM1A 1E1NA 1COYA 2PP3A 4A65A 3AE3A 3UKQA 2GDQA 3KLJA 3SZCA 3UOVA 1ZKQA 3EKGA 4LU6A 4APNA 3AM9A 1KKRA 3CPJG 4ICYA 4MKSA 1PBEA 3PS9A 3PO7A 4GIRA 3OZMA 3T6CA 4YTPA 3ICTA 1H84A 1VRQB 3CNTA 3STPA 3GDNA 1OEPA 3DJEA 3QLDA 3NIXA 3O0HA 1PJ6A 3OW1A 3ZVIA 4TM0A 3I6TA 1ONEA 4EMJA 3HYVA 2XVIA 2J3NA 1PXAA 4U2SA 4ZOHB 1GTHA 3H8IA 3VA8A 1TE6A 3M12A 3SSZA 5FMHA 2BRYA 4YT0A 3TOYA 4RSLA 1CJ2A 5FJUA 3QSEA 2OQYA 3DERA 4Z2RA 4J56A 4E8GA 2C66A 3QFBA 4G8TA 4G7FA 1E1KA 4Y4LA 5DBJA 3H70A 2OZ8A 1ONFA 2HQMA 3G5RA 2VRLA 5JCLA 5G5GB 2WP9A 3I3LA 3COXA 4JY3A 5FJTA 3D9XA 4H4ZA 3I4KA 3AE4A 3CN8A 2RGJA 4D03A 1W6TA 1IUVA 4H2RA 2Z5YA 3MY9A 4GGBA 4YWSA 3H8AA 1VDVA 1KNRA 3P0WA 1JPMA 2XLSA 4B65A 3GMCA 1ELIA 4Y4MA 3NRZB 2BC0A 3I6DA 2CULA 3G5SA 5M10A 2V61A 3EF6A 2QA1A 2C73A 2WU5A 3C4NA 2DW7A 4ECHA 4B64A 3BI4A 4IHCA 5KMSA 1REOA 4GISA 4TVYA 1MXTA 1BKWA 4K2SA 1JRPA 4H4SA 1P2HA 3VR9A 4U8MA 3ADAB 3AEEA 2OO6A 1KDGA 3NRNA 3CT2A 2OA1A 1EL8A 4CRTA 1ZDLA 3ZDNA 4CNJA 3IK4A 1FIQB 3KD9A 2WPFA 3B3RA 2ZZ0A 3ALJA 1T3QC 5KVIA 3R9UA 2BACA 2R0GA 2XDOA 3F8DA 1JRXA 1N4UA 1NG3A 2B7SA 1D5TA 2OLOA 1KSSA 2YG5A 4J31A 4E4FA 3N4FA 3BNUA 1SJAA 5HY5A 2XYOA 1XPYA 4EWJA 3P3BA 4H4UA 2X3NA 4TVWA 3DK8A 4KX6A 1GOSA 5GSNA 4K8GA 1XPQA 3UCLA 4YKGA 1GRHA 1B5QA 1N4WA 2GH5A 2YR4A 1V59A 3OP2A 3H8LA 4M6UA 4YXDA 5EB5A 2P8BA 3AB1A 2ZZCA 3RP8A 3CYJA 2BRAA 4OVIA 3ICRA 3SQPA 5EOWA 4YSYA 4H4VA 4HN8A 5KXJA 4U2TA 2B76A 3ALMA 3CXOA 3R10A 2JK6A 1FHVA 4KT2A 3SYIA 3NZGA 1F6MA 1LVLA 2OG9A 3FIMB 1ZXIC 4A35A 1IUXA 4RG4A 4NNJA 1RP0A 4CCQA 2XFQA 2QJJA 3TQPA 5J04A 3K7MX 4J57A 1WUEA 2PPGA 1DJQA 4I58A 1VG9A 1MNSA 2VQBA 5BUKA 4IA6A 1S3BA 1GRAA 3T14A 1PJ5A 1GTEA 2OALA 3URHA 3NN6X 2A87A 1VDCA 3UJFA 3T8QA 4B68A 2WHDA 2VZ2A 4OPDA 2YM2A 5KWFA 2V60A 2BA9A 4NEVA 1O95A 2V3BA 2RABA 1GESA 3UKPA 4C5OA 2E1MA 2X50A 1KKOA 4UDPA 1NDAA 1GPEA 4GCMA 4IP4A 3SJNA 2XH2A 5JCIA 3FCPA 3RRAA 1KD0A 4X9NA 1KCZA 4GFIA 2GGGA 2IVDA 4E5TA 3OZYA 4Z44A 3S61A 1VQWA 2R4EA 2AL1A 1TDNA 1H82A 4ZCWA 1SJBA 1IUUA 2OLNA 3PK7A 4JDRA 2QAEA 3UTHA 1CC4A 3RP6A 1XS2A 5IQ4A 1BQGA 1WYGA 3BSMA 4CY6A 3V3WA 4G6GA 1DOCA 4HCHA 1BWCA 3AXBA 5BVAA 2GL5A 1NEKA 2GAGB 3P1WA 3GC2A 2GGHA 1TDOA 1EC8A 1JCTA 3SN1A 4PAAA 4ROPA 1GREA 1NAAA 2WOWA 2EQ6A 3BJSA 2PTXA 3FG2P 4X4JA 1DNCA 1TYPA 2ZC8A 2AQJA 2FYMA 4REKA 2ZADA 1GRTA 1CHUA 2XVHA 2VOUA 3GSIA 2APGA 2PSNA 4YSHA 2GVCA 2VQ7A 2A89A 1K0JA 4RG3A 2FJEA 3NYEA 4H4WA 2H88A 1FFUC 3NH3X 3H12A 1GNDA 2YAUA 2YVGA 5EB4A 2C72A 2TMDA 3QJ4A 3SBFA 3T0KA 1CJ4A 1JDFA 3AE9A 4Z2UA 4EQXA 4YKFA 4MMWA 1LJ1A 3BNMA 4OPUA 4N9XA 1NELA 3FPZA 4K5SA 2FBWA 3NN0X 4X2PA 3BOXA 2XH0A 2GRTA 4J1OA 4UP3A 4USQA 1LTXR 2WPEA 1RM6B 1E7PA 3SFEA 4H2NA 5IDZA 3M13A 2YLRA 1JEHA 1DXLA 1P43A 3D47A 2A8XA 1ZMCA 1DOEA 4DNAA 3RCYA 3ABVA 1E1LA 1MO9A 2GGIA 3SR6B 2JAEA 1PDHA 3SY4A 2PU1A 3ENLA 2YR6A 1PDYA 2QDEA 2JB3A 2XVJA 2FJDA 1L8PA 3NK1X 4BV6A 2OKTA 4Z26A 3MUCA 1E6EA 1L0VA 3QKEA 4CY8A 2BS3A 4CBQA 2GGJA 3T2ZA 1JROA 1PDZA 4FP1A 3GD6A 1CL0A 2JBVA 3LOVA 3GYXA 4EQSA 1D4DA 4IVMB 3CAWA 5C3JA 3FBSA 3UKHA 2AAQA 2WETA 4Z2TA 3GD3A 3HYXA 3NKSA 2DW6A 1DODA 2WP5A 3UP4A 2O56A 4WX1A 4G74A 3NYCA 2MUCA 3CGCA 2C3CA 2B9WA 3UJSA 3SN0A 2WOVA 1ZMDA 1XHCA 4NTDA 1GERA 1D7LA 4FI4A 1CC2A 4C3YA 4OPGA 1PS9A 3DH9A 3U9IA 5BOFA 4HYRA 1BZLA 4DYEA 1PN0A 2OAMA 1FL2A 4TM4A 1RVKA 3AYIA 3MSYA 1BGJA 1MDLA 2CDUA 2GR0A 2ZBWA 2R9ZA 4XWZA 3CNSA 2HNEA 5EBKA 3VQRA 3CGDA 2YG4A 3MKCA 3T2KA 2WEUA 3ALLA 3K7TA 6ENLA 2P3ZA 1H7XA 3NG7X 4Z17A 3R11A 4NTEA 3NTAA 1FFVC 3C4AA 1NHRA 1OJTA 3AN1A 4K1WA 1JNZA 2BABA 1NU5A 2C65A 3AE8A 2XLTA 3RR1A 3CIRA 3CB3A 2W3SA 3AD8B 4H2QA 2W3RA 3NS1B 2GGEA 1NG4A 2BXSA 5U63A 3JSKA 2FKPA 3GMBA 2WDRA 4J33A 3N6HA 3DFHA 3DGZA 1B4VA 3T37A 1KSUA 1FECA 4H50A 1P2EA 4GF7A 7ENLA 4A9WA 3HYWA 3T31A 3UXKA 1H6VA 1Y0PA 4Z43A 4I59A 3CXBA 3KKJA 5KRQA 5U25A 2GMHA 3REDA 3LZXA 2OZ3A 3ES7A 3NTDA 2NPXA 2AKZA 2RGHA 5FS9A 4U8KA 3KA7A 3ZLGA 4EM3A 2XSXA 4KPRA 1YQ3A 2BCGG 3AEFA 2XVFA 3IJLA 4TLZA 2YM1A 3CNJA 3Q4DA 4ZCDA 3ZLHA 3QN3A 5HXIA 1S7MA 1N60C 1N5XA 3ATRA 3GO2A 1M6IA 1HYUA 4YTNA 3S5SA 3QSMA 1JOAA 2GB0A 3Q6JA 2C67A 2GF3A 4M0XA 4H1ZA 4GYPC 3RHAA 5BOEA 1F9CA 4ADWA 1H83A 2PCEA 2Z5XA 3C96A 2QQ6A 3DIPA 1GRBA 2MNRA 4B69A 2WOIA 5JCKA 4JY2A 1SJDA 3IJQA 2BYBA 2E3TA 2PA6A 4HCDA 1GXFA 2Q0LA 3PWGA 5FS8A 3ZYXA 3DK4A 3GDPA 1X31B 2I5QA 3MZNA 4UDRA 4E4UA 1L9DA 3TWAA 2Q7VA 3P93A 4GDPA 2DKIA 3R1ZA 5JCMA 2WS3A 4TM3A 2W0HA 2I0ZA 4K8DA 3AYJA 3TCSA 2B9YA 3NXLA 1EL9A 2YQUA 3T4WA 1FCDA 4JQ9A 2QA2A 2YG3A 1EC7A 3D1CA 3UKLA 2GAHB 4XXGA 4HNCA 3JW7A 3DGHA 2C70A 4PABA 3PVCA 4A3RA 3T9PA 1KF6A 2EQ9A 1Q1WA 3TJIA 3IF9A 1SEZA 2YR5A 2OQHA 2GSHA 3FVDA 1FHUA 1O94A 3BHFA 4O5QA 5CQFA 1DJNA 3UKAA 4HB9A 3DG3A 5FJRA 2C75A 2WPCA 3EUB3 3CPHG 1DTNA 2GV8A 3A7RA 1D4EA 2YG6A 3UTEA 3HZLA 1YQZA 3OC4A 4O5UA 3TJ4A 1NPXA 4FK1C 4U8LA 3UGVA 4C3XA 5HYMA 4JHMA 1TKKA 1PJ7A 1GETA 2JB1A 3G5QA 1ZK7A 3UCDA 4H83A 3DJDA 2YVFA 3HW2A 5KVHA 2VRMA 4TLXA 3HPFA 2HXUA 3RO6A 2VVMA 1MDRA 2X99A 3CTYA 1FOHA 3BI5A 1UKVG 1ELSA 4IV9A 5EU9A 1DOBA 2XVEA 3EANA 2BK5A 4MGGA 3NFUA 3PG6A 3DMEA 2AKMA 3AE2A 3CNDA 2P88A 1QJDA 1EBGA 5IQ1A 5BRTA 3UJRA 1X2GA 3CNPA 3DG7A 4BK2A 4MJWA 3DESA 1IUSA 2QDDA 1CF3A 3UTGA 4GDEA 4II2A 3P4QA 3I6EA 3U4FA 2GR3A 1ZP0A 2QJNA 4HNLA 1LV0A 1NHPA 1F8RA 4HA6A 3VDGA 5KNLA 4XWRA 1Z6LA 4AOSA 5KOXA 3EAOA 1X2HA 4AOXA 2YLTA 3EPTA 2XH4A 3QSSA 5M0ZA 3P9UA 1YY5A 1O5WA 1VG0A 4B63A 5ER0A 4DN1A 3V76A 1GT8A 2JKCA 3ITJA 2HZGA 4GUVA 4IP5A 3RNMA 4F4RA 3AECA 4G9KA 4EQRA 1W4XA 2YLZA 2OX4A 1FO4A 3IC9A 3FYYA 3VRBA 1EL5A 3II4A 1FEAA 3NVZB 3SZWA 2B9XA 1JNRA 1QO8A 4ZCCA 1H81A 4USRA 1H86A 5G5HB 3ZLFA 3NGCX 3AEBA 4OPTA 5U1OA 2PP1A 1ECQA 2PS2A 5KMRA 3IJIA 2BS4A 3TW9A 1ZX9A 5KMQA 3NT6A 2GR2A 1EC9A 3RGTA 2X8HA 5FJPA 3UKFA 2XGZA 3SZFA 2YVJA 4BJZA 3AYLA 2PHHA 2VVLG 3S5WA 1GEUA 2PTWA 4EM4A 2PTZA 4UDQA 4K2XA 3DDMA 3R07C 3V5FA 1XDIA 1OJCA 1NHQA 3A7UA 4U8IA 4GGHA 4P9SA 3BI2A 4EQWA 2YWLA 3WE0A 3HRDC 2Y6QA 4JNAA 2QCUA 5BULA 4IL2A 4JNQA 4HPNA 4BK1A 3LJPA 4Z1YA 2Q6UA 3K1GA 3N6JA 3S47A 4A5LA 1PXCA 2PP0A 3AE6A 4LIIA 5FJOA 4KWSA 3A7AA 2XFOA 2PGEA 3NHOX 4J34A 1MRAA 2Y6RA 3L8KA 2WESA 3UOYA 4EMIA 4B1BA 1GSNA 3K30A 3KUMA 3VCNA 1PHHA 2XFPA 4ZA0A 1IYXA 3GYJA 3NVYB 2IIDA 1EBDA 3VRDB 1ZOVA 3VC5A 3M0OA 1QLBA 1Y56A 4YSXA 4DXKA 2JB2A 1Q1RA 3PWIA 2OLAA 4IL0A 3AE7A 3ZVHA 2QJMA 3B97A 2XH7A 2YLWA 2TPRA 3AE5A 2V3AA 2AR8A 4U8OA 3CK5A 2R4JA 2Q0KA 4IA5A 2PMQA 3SGLA 4HCLA 5GRTA 5KOWA 1EL7A 3ATQA 5CKUA 4EMWA 4IZGA 2AL2A 4NZHA 2O9ZA 3VFCA 1D7YA 3SXIA 4ZN0A 4J3ZA 2WDVA 1PBCA 4DSHA 1YEYA 2NQLA 4BJYA 3V4BA 2YLSA 3QTPA 1RSGA 4C77A 2BK3A 1OJDA 4OPCA 2R46A 4NTCA 4CCRA 3CGBA 1VQZA 3DGBA 2ZZBA 3DJJA 3NVVB 1CJ3A 4A99A 3LXDA 3CGEA 2CFYA 2NVKX 3SM8A 3BHKA 3KU9A 3QFAA 1L9CA 3AMZA 2F5ZA 2ONEA 4GRTA 2BS2A 3FJ4A 4AT2A 2WBAA 1TYTA 4AT0A 2YLXA 4D04A 3IHMA 3AWIA 1S2YA 4H4RA 3KPFA 4G73A 2RGOA 4E0VA 2POZA 4OCGA 4DSGA 5L46A 5IPYA 2GEWA 2V5ZA 2BXRA 3AD9B 1XANA 2V6OA 4GAVA 5FS7A 2P8CA 3TWBA 4EIPA 1IUWA 4A6NA 1V97A 1GALA 3ETRB 4NEWA 4GYPA 2PODA 1L9EA 1ZOYA 1P48A 4GAPA 4U8JA 2PYXA 3DK9A 3GD4A 3GWFA 3AEGA 3UKKA 2X8CA 1H7WA 2VVLA 1OJAA 4H4QA 1B37A 3SZ0A 5JCNA 2BCPA 3UOZA 3UJEA 3V3OA 2XLPA 3MWCA 1JU2A 2ARDA 3AEDA 4K22A 1PXBA 1N1PA 4E6MA 1SJCA 5KMPA 3V3NA 1N62C 3NVWB 2XFNA 1N63C 4BK3A 1F8WA 4B66A 1YKJA 3JVAA 5J60A 3IHGA 2OPJA 3AE1A 2IVEA 3OPSA 2C7GA 2ACZA 1JRZA 4G6HA 4H4YA 1FEBA 1TRBA 2CVJA 2XCGA 2GMJA 3AD7B 2P0IA 4BURA 3OTRA 3VR8A 4H4XA 3NO1A 3LADA 3GRSA 4JN7A 2XLUA 1BKHA 1LQUA 1CBOA 2GQWA 4X9MA 4H19A 2BC1A 3THUA 3CMMA 2X8GA 1PBBA 3E1TA 4H4PA 1E1MA 1LQTA 1TDKA 3L5OA 3VCCA 1MOKA 1MUCA 3MQTA 3K7QX 2E5VA 1CJCA 3UP5A 4J36A 1SB3B 2W55A 3B9JB 4FK1A 2C76A 3H4KA 3CPIG 1N61C 3ES8A 3RITA 3DEQA 2WU2A 2EQ8A 1TDFA 1PBDA 4YSZA 1N5WC 1STZA 4KPLA 2BK4A 4U8PA 4U8NA 4FX9A 2FJAA 1K4QA 3P4SA 4K5RA 2OVLA 3NNEA 4K7ZA 4YWOA 3SFDA 3H7VA 1NENA 2RDXA 4OPLA 3UCCA 1Y56B 3D46A 4A6GA 1OJ9A 4WCTA 2PGWA 2HXTA 3ZVHB 1R6WA 3ICSA 4ENLA 3UJ2A 3VC6A 1E9IA 4AP3A 2R0CA
chains in the Genus database with same CATH topology
2VVLG 2OLOA 3AE8A 3S5WA 1KSSA 4H4TA 1GEUA 2YG5A 4J31A 2XLTA 4EM4A 3CIRA 1NHSA 4B67A 2EQ7A 4UDQA 4K2XA 2R45A 3BNUA 3QVPA 3AD8B 4H2QA 4H2PA 1GRGA 5HY5A 2XYOA 1F3PA 2DKHA 1XDIA 1GV4A 4OPIA 3DJGX 1NG4A 4H4UA 2BXSA 2X3NA 5U63A 2E4GA 1OJCA 1NHQA 3JSKA 3DK8A 1ZY8A 4U8IA 5KOXA 3KPKA 3F8PA 1LPFA 4P9SA 3BI2A 4Z25A 4KX6A 1GOSA 5GSNA 4EQWA 2YWLA 5TR3A 3F8RA 3WE0A 3GMBA 2GR1A 1XPQA 2WDRA 4J33A 3UCLA 2Y6QA 4YKGA 4FDCB 1GRHA 2C4CA 4EIQA 4JNAA 2C3DA 1B5QA 3DGZA 1B4VA 3T37A 1N4WA 3UTFA 1BF3A 2GH5A 1KSUA 4A7AA 2QCUA 1FECA 1V59A 2YR4A 5BULA 4H50A 4JNQA 3H8LA 1K0LA 2WP6A 1P2EA 4BK1A 3LJPA 4GF7A 4YXDA 5EB5A 3B6DA 2Q6UA 3LZWA 4A9WA 4A5LA 1PXCA 3HYWA 3T31A 4CNKA 3AE6A 4LA1A 1N4VA 1RYIA 2ZZCA 3AB1A 3RP8A 1H6VA 4J2WA 1Y0PA 2BRAA 4Z43A 4I59A 3GYIA 4LIIA 3KKJA 2GQFA 4II3A 3L1RA 4OVIA 1KFYA 3QVRA 2XFOA 3GWDA 5KRQA 4AP1A 5U25A 3KVEA 2GMHA 3ICRA 3NHOX 3SQPA 4J34A 3REDA 3LZXA 2Y6RA 5EOWA 4YSYA 3L8KA 4Y4NA 3NTDA 2NPXA 4H4VA 2B7RA 2RGHA 5FS9A 1YQ4A 5KXJA 2WESA 3UOYA 4EMIA 1IJHA 3KA7A 4GR1A 1M64A 4EM3A 2B76A 4KPRA 3ALMA 4JN9A 4B1BA 1YQ3A 1GSNA 2JK6A 2BCGG 3AEFA 2XVFA 3K30A 4TLZA 3NLCA 3NK2X 2YM1A 3SYIA 1F6MA 1LVLA 3CNJA 1PHHA 2XFPA 3GYJA 3AEAA 3FIMB 3OZ2A 4ZCDA 5FS6A 2IIDA 1EBDA 3VRDB 1ZOVA 1IUXA 4RG4A 4NNJA 5LV9A 1RP0A 4CCQA 5C2TA 2YG7A 3GRTA 2XFQA 3M0OA 1QLBA 4Z24A 5HXIA 1Y56A 1S7MA 3K7MX 4YSXA 2JB2A 2UZZA 1KNPA 1Q1RA 3NK0X 4J57A 3ATRA 4A79A 1B8SA 3RP7A 1DJQA 4I58A 1VG9A 3SX6A 2VQBA 5BUKA 3AE7A 4A6NB 2XLRA 3P4PA 4IA6A 1S3BA 1M6IA 2YLWA 3D8XA 1GRAA 2TPRA 1HYUA 3T14A 1F8SA 4YTNA 1AOGA 1PJ5A 2R0PA 1GTEA 3AE5A 2V3AA 2AR8A 2OALA 3URHA 3QSMA 3NN6X 1JOAA 4U8OA 2A87A 2R4JA 3T2YA 2GB0A 1VDCA 3Q6JA 2Q0KA 4IA5A 3S61A 2FJBA 2C67A 1GRFA 1S3EA 2GF3A 3SGLA 1D4CA 4B68A 2WHDA 2WDQA 3RHAA 2VZ2A 4OPDA 4YTMA 2YM2A 5KWFA 4ADWA 2V60A 5GRTA 4NEVA 1H83A 1O95A 2BA9A 3Q9TA 4H7UA 5KOWA 2V3BA 1Q9IA 1EL7A 2RABA 3NYFA 3ATQA 1GESA 4EMWA 5CKUA 2Z5XA 3C96A 3UKPA 4C5OA 3UOXA 2E1MA 4NZHA 2X50A 2O9ZA 1D7YA 1GRBA 1JRYA 2XFUA 3SXIA 4ZN0A 4B69A 2WOIA 5JCKA 4UDPA 4JY2A 1NDAA 1GPEA 1TDEA 2H89A 2WDVA 4GCMA 1PBCA 4NWZA 5JRBA 4DSHA 1K0IA 3IWAA 4BJYA 2BYBA 5JCIA 2YLSA 3ISHA 1CC6A 1S2QA 1RSGA 1GXFA 4C77A 2Q0LA 4C74A 2BK3A 4X9NA 1H2IA 3LB8A 1OJDA 4OPCA 2R46A 4NTCA 4CCRA 3CGBA 5FS8A 3ZYXA 3DK4A 1PBFA 2IVDA 3GDPA 3DA1A 2ZZBA 3DJJA 1X31B 4Z44A 1CJ3A 1VQWA 2R4EA 4IVOB 4UDRA 3LXDA 3CGEA 2CFYA 1H82A 1TDNA 2NVKX 2WQYA 3SM8A 3BHKA 3KU9A 1L9DA 2Q7VA 1IUUA 3QFAA 2OLNA 2C64A 1BGNA 4GDPA 3VRAA 1L9CA 2DKIA 2F5ZA 5JCMA 5HHFA 1KN0A 4GRTA 4JDRA 2QAEA 2BS2A 2WS3A 1CC4A 3P4RA 3RP6A 4M52A 4TM3A 3UTHA 5J7XA 4AT2A 5IQ4A 2WBAA 2W0HA 2I0ZA 4K8DA 3AYJA 1TYTA 1E39A 3FMWA 4AT0A 2B9YA 4CY6A 1IUTA 4G6GA 1DOCA 2YLXA 4D04A 1BWCA 2YQUA 1EL9A 1FCDA 1S2YA 3AXBA 3AWIA 3IHMA 5BVAA 4H4RA 4JQ9A 3KPFA 1NEKA 4DGKA 2QA2A 2YG3A 2GAGB 3P1WA 4G73A 2RGOA 1TDOA 3D1CA 4U2LA 4E0VA 3UKLA 4OCGA 2GAHB 4XXGA 4TM1A 4DSGA 5L46A 5IPYA 4PAAA 2GEWA 1GREA 1NAAA 2V5ZA 2BXRA 3DGHA 1E1NA 2C70A 3AD9B 2WOWA 4PABA 1COYA 1XANA 2EQ6A 3PVCA 2V6OA 4GAVA 5FS7A 4A65A 3AE3A 3FG2P 1KF6A 2EQ9A 1Q1WA 3IF9A 4X4JA 3UKQA 4EIPA 1DNCA 4U8KA 1SEZA 2YR5A 1IUWA 1TYPA 3KLJA 4A6NA 2AQJA 3SZCA 1GALA 4REKA 1O94A 3UOVA 1GRTA 1ZKQA 1CHUA 2XVHA 2VOUA 3GSIA 4NEWA 2APGA 3BHFA 4LU6A 4O5QA 4APNA 1L9EA 5CQFA 1DJNA 4YSHA 3CPJG 3UKAA 1ZOYA 2GVCA 2VQ7A 4HB9A 4ICYA 2A89A 1K0JA 4GAPA 4RG3A 2FJEA 1PBEA 3NYEA 4U8JA 4H4WA 2C75A 2H88A 2WPCA 2PYXA 3CPHG 3NH3X 3DK9A 3PS9A 1GNDA 2YAUA 2YVGA 3PO7A 5EB4A 2C72A 2TMDA 3GD4A 4YTPA 3GWFA 2GV8A 3ICTA 1H84A 3QJ4A 3AEGA 3UKKA 1VRQB 3CNTA 1D4EA 2X8CA 2YG6A 3UTEA 3GDNA 3HZLA 1H7WA 1YQZA 3DJEA 3T0KA 3OC4A 1CJ4A 2VVLA 1OJAA 3NIXA 4O5UA 4H4QA 1B37A 3SZ0A 5JCNA 3AE9A 3O0HA 4Z2UA 1NPXA 4FK1C 4EQXA 1PJ6A 4U8LA 2BCPA 4A99A 3UOZA 4TM0A 2XLPA 3V3OA 4YKFA 4C3XA 5HYMA 1LJ1A 3BNMA 1JU2A 2ARDA 4EMJA 3AEDA 4K22A 4OPUA 1PXBA 3HYVA 1PJ7A 1GETA 2JB1A 2XVIA 4N9XA 3FPZA 2J3NA 1N1PA 1PXAA 2FBWA 3G5QA 3NN0X 1ZK7A 4K5SA 4U2SA 5KMPA 1GTHA 3DJDA 3H8IA 3V3NA 2YVFA 5KVHA 2VRMA 2XFNA 4TLXA 3M12A 4BK3A 1F8WA 2GRTA 5FMHA 4UP3A 4USQA 1LTXR 2BRYA 2X99A 1YKJA 2WPEA 2VVMA 1FOHA 3CTYA 3IHGA 4B66A 3BI5A 1UKVG 1E7PA 4RSLA 4YT0A 5J60A 4IV9A 3AE1A 1CJ2A 2IVEA 3SFEA 4H2NA 1DOBA 2C7GA 2XVEA 2ACZA 3QSEA 4Z2RA 3EANA 2BK5A 3M13A 4J56A 1JEHA 1DXLA 2YLRA 3PG6A 1JRZA 3DMEA 2A8XA 1ZMCA 2C66A 3QFBA 1DOEA 4DNAA 3AE2A 3CNDA 3ABVA 1E1LA 1MO9A 1E1KA 4Y4LA 5DBJA 1QJDA 2JAEA 1ONFA 2HQMA 3G5RA 4G6HA 5IQ1A 4H4YA 1PDHA 1FEBA 5JCLA 2VRLA 3SY4A 5BRTA 1TRBA 2CVJA 2XCGA 2GMJA 3CNPA 2WP9A 3AD7B 3I3LA 3COXA 4BK2A 2YR6A 4JY3A 4BURA 4MJWA 2JB3A 1IUSA 2XVJA 3VR8A 3D9XA 1CF3A 2FJDA 4H4XA 3UTGA 3NK1X 4BV6A 4GDEA 4II2A 4H4ZA 3P4QA 3LADA 4Z26A 3AE4A 3CN8A 2RGJA 1E6EA 2GR3A 3GRSA 1ZP0A 1IUVA 1L0VA 4D03A 2XLUA 4CY8A 2BS3A 4CBQA 1LQUA 3T2ZA 1LV0A 1NHPA 1CBOA 2GQWA 4H2RA 4X9MA 2Z5YA 2BC1A 1F8RA 4HA6A 3CMMA 2X8GA 1CL0A 1PBBA 3E1TA 2JBVA 1KNRA 3LOVA 4XWRA 5KNLA 3GYXA 4EQSA 1D4DA 4H4PA 1E1MA 1LQTA 1Z6LA 2XLSA 1TDKA 3GMCA 4IVMB 4AOSA 4B65A 5C3JA 3L5OA 1ELIA 3FBSA 4Y4MA 3EAOA 2BC0A 3I6DA 1MOKA 3UKHA 4AOXA 2YLTA 2CULA 3G5SA 5M10A 2AAQA 3EPTA 3QSSA 2WETA 4Z2TA 2V61A 3K7QX 2E5VA 3EF6A 3GD3A 1CJCA 2QA1A 3HYXA 2C73A 3NKSA 5M0ZA 3P9UA 3UP5A 4J36A 1DODA 1YY5A 1O5WA 2WP5A 1VG0A 3UP4A 2WU5A 3C4NA 4WX1A 4G74A 4FK1A 4B63A 3NYCA 5ER0A 3CGCA 3V76A 1GT8A 2JKCA 2C3CA 2B9WA 3ITJA 2C76A 4ECHA 4B64A 3H4KA 4U2TA 3CPIG 3BI4A 4AP3A 4GUVA 3RNMA 3AECA 2WU2A 2WOVA 2EQ8A 5KMSA 1ZMDA 1XHCA 1REOA 4G9KA 4EQRA 1W4XA 4NTDA 1GERA 1TDFA 1PBDA 1MXTA 2YLZA 1BKWA 1D7LA 4YSZA 3IC9A 1CC2A 4C3YA 4OPGA 1PS9A 4H4SA 2BK4A 1EL5A 3II4A 3VRBA 1FEAA 1P2HA 3DH9A 4U8PA 4U8NA 3SZWA 4U8MA 3VR9A 2B9XA 4FX9A 2FJAA 1K4QA 3ADAB 1BZLA 3P4SA 1PN0A 2OAMA 1FL2A 4TM4A 4K5RA 3AEEA 1KDGA 1JNRA 3AYIA 3NRNA 1BGJA 3NNEA 2OA1A 2CDUA 4K7ZA 1QO8A 2GR0A 1EL8A 2ZBWA 4ZCCA 4CRTA 1H81A 4USRA 2R9ZA 1H86A 1ZDLA 4XWZA 3NGCX 3ZDNA 3CNSA 4CNJA 3AEBA 4YWOA 4OPTA 5EBKA 3KD9A 3VQRA 2WPFA 3CGDA 3B3RA 3SFDA 5U1OA 2YG4A 3T2KA 2ZZ0A 1NENA 3ALJA 5KMRA 4OPLA 2WEUA 1Y56B 3ALLA 3K7TA 5KVIA 2BS4A 1OJ9A 1H7XA 1ZX9A 3NG7X 5KMQA 3R9UA 4WCTA 3NT6A 2BACA 2GR2A 2R0GA 2X8HA 2XDOA 3F8DA 4NTEA 1JRXA 1N4UA 3UKFA 3NTAA 3ICSA 1NG3A 3SZFA 3C4AA 1NHRA 1OJTA 2YVJA 2B7SA 4BJZA 3AYLA 1JNZA 2BABA 2PHHA 1D5TA 2C65A 2R0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VVL G;  2OLO A;  3AE8 A;  3S5W A;  1KSS A;  4H4T A;  1GEU A;  2YG5 A;  4J31 A;  2XLT A;  4EM4 A;  3CIR A;  1NHS A;  4B67 A;  2EQ7 A;  4UDQ A;  4K2X A;  2R45 A;  3BNU A;  3QVP A;  3AD8 B;  4H2Q A;  4H2P A;  1GRG A;  5HY5 A;  2XYO A;  1F3P A;  2DKH A;  1XDI A;  1GV4 A;  4OPI A;  3DJG X;  1NG4 A;  4H4U A;  2BXS A;  2X3N A;  5U63 A;  2E4G A;  1OJC A;  1NHQ A;  3JSK A;  3DK8 A;  1ZY8 A;  4U8I A;  5KOX A;  3F8P A;  1LPF A;  4P9S A;  3BI2 A;  4Z25 A;  4KX6 A;  1GOS A;  5GSN A;  4EQW A;  2YWL A;  5TR3 A;  3F8R A;  3WE0 A;  3GMB A;  2GR1 A;  1XPQ A;  2WDR A;  4J33 A;  3UCL A;  2Y6Q A;  4YKG A;  4FDC B;  1GRH A;  4EIQ A;  4JNA A;  2C3D A;  1B5Q A;  3DGZ A;  1B4V A;  3T37 A;  1N4W A;  3UTF A;  1BF3 A;  2GH5 A;  1KSU A;  4A7A A;  2QCU A;  1FEC A;  1V59 A;  2YR4 A;  5BUL A;  4H50 A;  4JNQ A;  3H8L A;  1K0L A;  2WP6 A;  1P2E A;  4BK1 A;  3LJP A;  4GF7 A;  4YXD A;  5EB5 A;  3B6D A;  2Q6U A;  3LZW A;  4A9W A;  4A5L A;  1PXC A;  4CNK A;  3AE6 A;  4LA1 A;  1N4V A;  1RYI A;  2ZZC A;  3AB1 A;  3RP8 A;  1H6V A;  4J2W A;  1Y0P A;  4Z43 A;  4I59 A;  3GYI A;  4LII A;  3KKJ A;  2GQF A;  4OVI A;  3L1R A;  1KFY A;  3QVR A;  2XFO A;  3GWD A;  5KRQ A;  4AP1 A;  5U25 A;  3KVE A;  2GMH A;  3ICR A;  3NHO X;  3SQP A;  4J34 A;  3RED A;  3LZX A;  2Y6R A;  5EOW A;  4YSY A;  3L8K A;  4Y4N A;  3NTD A;  2NPX A;  4H4V A;  2B7R A;  2RGH A;  5FS9 A;  1YQ4 A;  5KXJ A;  2WES A;  3UOY A;  4EMI A;  1IJH A;  3KA7 A;  4GR1 A;  1M64 A;  4EM3 A;  2B76 A;  4KPR A;  3ALM A;  4JN9 A;  4B1B A;  1YQ3 A;  1GSN A;  2JK6 A;  2BCG G;  3AEF A;  2XVF A;  3K30 A;  4TLZ A;  3NLC A;  3NK2 X;  2YM1 A;  1F6M A;  1LVL A;  3CNJ A;  1PHH A;  2XFP A;  3GYJ A;  3AEA A;  3FIM B;  3OZ2 A;  4ZCD A;  5FS6 A;  2IID A;  1EBD A;  3VRD B;  1ZOV A;  1IUX A;  4RG4 A;  5LV9 A;  1RP0 A;  4CCQ A;  5C2T A;  2YG7 A;  3GRT A;  2XFQ A;  3M0O A;  1QLB A;  4Z24 A;  5HXI A;  1Y56 A;  3K7M X;  4YSX A;  2JB2 A;  2UZZ A;  1KNP A;  1Q1R A;  3NK0 X;  4J57 A;  3ATR A;  4A79 A;  1B8S A;  3RP7 A;  1DJQ A;  4I58 A;  1VG9 A;  2VQB A;  5BUK A;  3AE7 A;  4A6N B;  2XLR A;  3P4P A;  4IA6 A;  1S3B A;  1M6I A;  2YLW A;  3D8X A;  1GRA A;  2TPR A;  1HYU A;  1F8S A;  4YTN A;  1AOG A;  1PJ5 A;  2R0P A;  1GTE A;  3AE5 A;  2V3A A;  2AR8 A;  2OAL A;  3URH A;  3QSM A;  3NN6 X;  1JOA A;  4U8O A;  2A87 A;  2R4J A;  2GB0 A;  1VDC A;  3Q6J A;  2Q0K A;  4IA5 A;  3S61 A;  2FJB A;  2C67 A;  1GRF A;  1S3E A;  2GF3 A;  3SGL A;  1D4C A;  4B68 A;  2WHD A;  2WDQ A;  3RHA A;  2VZ2 A;  4OPD A;  4YTM A;  2YM2 A;  5KWF A;  4ADW A;  2V60 A;  5GRT A;  4NEV A;  1H83 A;  1O95 A;  2BA9 A;  3Q9T A;  4H7U A;  5KOW A;  1Q9I A;  2V3B A;  1EL7 A;  2RAB A;  3NYF A;  3ATQ A;  1GES A;  4EMW A;  5CKU A;  2Z5X A;  3C96 A;  3UKP A;  4C5O A;  3UOX A;  2E1M A;  4NZH A;  2X50 A;  2O9Z A;  1D7Y A;  1GRB A;  1JRY A;  2XFU A;  4ZN0 A;  4B69 A;  2WOI A;  5JCK A;  4UDP A;  4JY2 A;  1NDA A;  1GPE A;  1TDE A;  2H89 A;  2WDV A;  4GCM A;  1PBC A;  4DSH A;  1K0I A;  3IWA A;  4BJY A;  2BYB A;  5JCI A;  2YLS A;  3ISH A;  1CC6 A;  1S2Q A;  1RSG A;  1GXF A;  4C77 A;  2Q0L A;  4C74 A;  2BK3 A;  4X9N A;  3LB8 A;  1OJD A;  4OPC A;  2R46 A;  4NTC A;  4CCR A;  3CGB A;  5FS8 A;  3ZYX A;  3DK4 A;  1PBF A;  2IVD A;  3GDP A;  3DA1 A;  2ZZB A;  3DJJ A;  1X31 B;  4Z44 A;  1CJ3 A;  1VQW A;  2R4E A;  4IVO B;  4UDR A;  3LXD A;  3CGE A;  2CFY A;  1H82 A;  1TDN A;  2NVK X;  2WQY A;  3SM8 A;  3BHK A;  3KU9 A;  1L9D A;  2Q7V A;  1IUU A;  3QFA A;  2OLN A;  2C64 A;  1BGN A;  4GDP A;  3VRA A;  1L9C A;  2DKI A;  2F5Z A;  5JCM A;  5HHF A;  4GRT A;  2BS2 A;  4JDR A;  2QAE A;  2WS3 A;  3P4R A;  1CC4 A;  3RP6 A;  3UTH A;  4M52 A;  4TM3 A;  4AT2 A;  5J7X A;  5IQ4 A;  2WBA A;  2W0H A;  2I0Z A;  4K8D A;  3AYJ A;  1TYT A;  1E39 A;  3FMW A;  4AT0 A;  2B9Y A;  4CY6 A;  1IUT A;  1DOC A;  2YLX A;  4D04 A;  1BWC A;  2YQU A;  1EL9 A;  1FCD A;  1S2Y A;  3AXB A;  3AWI A;  3IHM A;  5BVA A;  4H4R A;  4JQ9 A;  3KPF A;  1NEK A;  4DGK A;  2QA2 A;  2YG3 A;  2GAG B;  3P1W A;  2RGO A;  1TDO A;  3D1C A;  4U2L A;  4E0V A;  3UKL A;  4OCG A;  2GAH B;  4XXG A;  4TM1 A;  4DSG A;  5L46 A;  5IPY A;  4PAA A;  2GEW A;  1GRE A;  1NAA A;  2V5Z A;  2BXR A;  3DGH A;  1E1N A;  2C70 A;  3AD9 B;  2WOW A;  4PAB A;  1COY A;  1XAN A;  2EQ6 A;  3PVC A;  2V6O A;  5FS7 A;  4A65 A;  3AE3 A;  3FG2 P;  1KF6 A;  2EQ9 A;  1Q1W A;  3IF9 A;  4X4J A;  3UKQ A;  4EIP A;  1DNC A;  4U8K A;  1SEZ A;  2YR5 A;  1IUW A;  1TYP A;  3KLJ A;  4A6N A;  2AQJ A;  1GAL A;  4REK A;  1O94 A;  3UOV A;  1GRT A;  1ZKQ A;  1CHU A;  2XVH A;  2VOU A;  3GSI A;  4NEW A;  2APG A;  3BHF A;  4LU6 A;  4O5Q A;  4APN A;  1L9E A;  5CQF A;  1DJN A;  4YSH A;  3CPJ G;  3UKA A;  1ZOY A;  2GVC A;  2VQ7 A;  4HB9 A;  4ICY A;  2A89 A;  1K0J A;  4RG3 A;  2FJE A;  1PBE A;  3NYE A;  4U8J A;  4H4W A;  2C75 A;  2H88 A;  2WPC A;  2PYX A;  3CPH G;  3NH3 X;  3DK9 A;  3PS9 A;  1GND A;  2YAU A;  2YVG A;  3PO7 A;  5EB4 A;  2C72 A;  2TMD A;  3GD4 A;  4YTP A;  3GWF A;  2GV8 A;  3ICT A;  1H84 A;  3QJ4 A;  3AEG A;  3UKK A;  1VRQ B;  3CNT A;  1D4E A;  2X8C A;  2YG6 A;  3UTE A;  3GDN A;  3HZL A;  1H7W A;  1YQZ A;  3DJE A;  3OC4 A;  1CJ4 A;  2VVL A;  1OJA A;  3NIX A;  4O5U A;  4H4Q A;  1B37 A;  5JCN A;  3AE9 A;  3O0H A;  4Z2U A;  1NPX A;  4FK1 C;  4EQX A;  1PJ6 A;  4U8L A;  2BCP A;  4A99 A;  3UOZ A;  4TM0 A;  2XLP A;  3V3O A;  4YKF A;  4C3X A;  5HYM A;  1LJ1 A;  3BNM A;  1JU2 A;  2ARD A;  4EMJ A;  3AED A;  4K22 A;  4OPU A;  1PXB A;  1PJ7 A;  1GET A;  2JB1 A;  2XVI A;  4N9X A;  3FPZ A;  2J3N A;  1N1P A;  1PXA A;  2FBW A;  3G5Q A;  3NN0 X;  1ZK7 A;  4K5S A;  4U2S A;  1GTH A;  3DJD A;  3H8I A;  3V3N A;  2YVF A;  5KVH A;  2VRM A;  2XFN A;  4TLX A;  3M12 A;  4BK3 A;  1F8W A;  2GRT A;  5FMH A;  4UP3 A;  4USQ A;  1LTX R;  2VVM A;  2X99 A;  1YKJ A;  2WPE A;  3CTY A;  1FOH A;  3IHG A;  4B66 A;  4YT0 A;  3BI5 A;  1UKV G;  1E7P A;  4RSL A;  5J60 A;  4IV9 A;  3AE1 A;  1CJ2 A;  2IVE A;  3SFE A;  4H2N A;  1DOB A;  2C7G A;  2XVE A;  2ACZ A;  3QSE A;  4Z2R A;  3EAN A;  2BK5 A;  3M13 A;  4J56 A;  1JEH A;  1DXL A;  2YLR A;  1JRZ A;  3DME A;  2A8X A;  1ZMC A;  2C66 A;  3QFB A;  1DOE A;  4DNA A;  3AE2 A;  3CND A;  3ABV A;  1E1L A;  1MO9 A;  1E1K A;  4Y4L A;  5DBJ A;  1QJD A;  2JAE A;  1ONF A;  2HQM A;  3G5R A;  5IQ1 A;  4H4Y A;  1PDH A;  1FEB A;  5JCL A;  2VRL A;  5BRT A;  1TRB A;  2CVJ A;  2XCG A;  2GMJ A;  3CNP A;  2WP9 A;  3AD7 B;  3I3L A;  3COX A;  4BK2 A;  2YR6 A;  4JY3 A;  4BUR A;  4MJW A;  2JB3 A;  1IUS A;  2XVJ A;  3VR8 A;  1CF3 A;  2FJD A;  4H4X A;  3UTG A;  3NK1 X;  4BV6 A;  4GDE A;  4H4Z A;  3P4Q A;  3LAD A;  4Z26 A;  3AE4 A;  3CN8 A;  2RGJ A;  1E6E A;  2GR3 A;  3GRS A;  1ZP0 A;  1IUV A;  1L0V A;  4D03 A;  2XLU A;  4CY8 A;  2BS3 A;  4CBQ A;  1LQU A;  1LV0 A;  1NHP A;  1CBO A;  2GQW A;  4H2R A;  4X9M A;  2Z5Y A;  2BC1 A;  1F8R A;  4HA6 A;  2X8G A;  1CL0 A;  1PBB A;  3E1T A;  2JBV A;  1KNR A;  3LOV A;  4XWR A;  4EQS A;  1D4D A;  4H4P A;  1E1M A;  1LQT A;  1Z6L A;  2XLS A;  1TDK A;  3GMC A;  4IVM B;  4AOS A;  4B65 A;  5C3J A;  1ELI A;  3FBS A;  4Y4M A;  3EAO A;  2BC0 A;  3I6D A;  1MOK A;  3UKH A;  4AOX A;  2YLT A;  2CUL A;  3G5S A;  5M10 A;  2AAQ A;  3EPT A;  3QSS A;  2WET A;  4Z2T A;  2V61 A;  3K7Q X;  2E5V A;  3EF6 A;  3GD3 A;  1CJC A;  2QA1 A;  2C73 A;  3NKS A;  5M0Z A;  3P9U A;  3UP5 A;  4J36 A;  1DOD A;  1YY5 A;  1O5W A;  2WP5 A;  1VG0 A;  3UP4 A;  2WU5 A;  3C4N A;  4WX1 A;  4FK1 A;  4B63 A;  3NYC A;  5ER0 A;  3CGC A;  3V76 A;  1GT8 A;  2JKC A;  2C3C A;  2B9W A;  3ITJ A;  2C76 A;  4ECH A;  4B64 A;  3H4K A;  4U2T A;  3CPI G;  3BI4 A;  4AP3 A;  4GUV A;  3RNM A;  3AEC A;  2WU2 A;  2WOV A;  2EQ8 A;  1ZMD A;  1XHC A;  1REO A;  4EQR A;  1W4X A;  4NTD A;  1GER A;  1TDF A;  1PBD A;  1MXT A;  2YLZ A;  1BKW A;  1D7L A;  4YSZ A;  3IC9 A;  1CC2 A;  4C3Y A;  4OPG A;  1PS9 A;  4H4S A;  2BK4 A;  1EL5 A;  3II4 A;  3VRB A;  1FEA A;  1P2H A;  3DH9 A;  4U8P A;  4U8N A;  3VR9 A;  4U8M A;  2B9X A;  4FX9 A;  2FJA A;  1K4Q A;  3ADA B;  1BZL A;  3P4S A;  1PN0 A;  2OAM A;  1FL2 A;  4TM4 A;  4K5R A;  3AEE A;  1KDG A;  1JNR A;  3AYI A;  3NRN A;  1BGJ A;  3NNE A;  2OA1 A;  2CDU A;  4K7Z A;  1QO8 A;  2GR0 A;  1EL8 A;  2ZBW A;  4ZCC A;  4CRT A;  1H81 A;  4USR A;  2R9Z A;  1H86 A;  1ZDL A;  4XWZ A;  3NGC X;  3ZDN A;  3CNS A;  4CNJ A;  3AEB A;  4YWO A;  4OPT A;  5EBK A;  3KD9 A;  3VQR A;  2WPF A;  3CGD A;  3B3R A;  3SFD A;  5U1O A;  2YG4 A;  2ZZ0 A;  1NEN A;  3ALJ A;  4OPL A;  2WEU A;  1Y56 B;  3ALL A;  3K7T A;  5KVI A;  2BS4 A;  1OJ9 A;  1H7X A;  1ZX9 A;  3NG7 X;  3R9U A;  4WCT A;  3NT6 A;  2BAC A;  2GR2 A;  2R0G A;  2X8H A;  2XDO A;  3F8D A;  4NTE A;  1JRX A;  1N4U A;  3UKF A;  3NTA A;  3ICS A;  1NG3 A;  3C4A A;  1NHR A;  1OJT A;  2YVJ A;  2B7S A;  4BJZ A;  3AYL A;  1JNZ A;  2BAB A;  2PHH A;  1D5T A;  2C65 A;  2R0C A; 
#chains in the Genus database with same CATH topology
 4H4T A;  2W54 A;  1NHS A;  4B67 A;  2EQ7 A;  2R45 A;  3QVP A;  2E5A A;  4H2P A;  1GRG A;  1F3P A;  2DKH A;  1GV4 A;  4OPI A;  3DJG X;  3SN4 A;  2E4G A;  2QVH A;  4DWD A;  2AL2 B;  1ZY8 A;  3KPK A;  3F8P A;  1LPF A;  3R25 A;  3DFY A;  4Z25 A;  5TR3 A;  3F8R A;  2GR1 A;  4FDC B;  4H2H A;  2C4C A;  4EIQ A;  2C3D A;  3UTF A;  1BF3 A;  4A7A A;  1K0L A;  2WP6 A;  3B6D A;  3LZW A;  4CNK A;  4LA1 A;  1N4V A;  1RYI A;  3UXL A;  4J2W A;  3GYI A;  2GQF A;  4II3 A;  3L1R A;  1KFY A;  3QVR A;  3GWD A;  1JPD X;  4AP1 A;  3KVE A;  4Y4N A;  2B7R A;  1YQ4 A;  1IJH A;  4GR1 A;  1M64 A;  4JN9 A;  2PU0 A;  3NLC A;  4IT1 A;  3NK2 X;  1EBH A;  3AEA A;  3OZ2 A;  5FS6 A;  4JN8 A;  5LV9 A;  3QPE A;  5C2T A;  2YG7 A;  3GRT A;  4Z24 A;  2OFJ A;  4DHG A;  2UZZ A;  1KNP A;  3NK0 X;  3SQS A;  3FV9 A;  4A79 A;  2CHR A;  1B8S A;  3RP7 A;  3SX6 A;  4A6N B;  2XLR A;  3P4P A;  3D8X A;  3N4E A;  1F8S A;  1AOG A;  2R0P A;  2OZT A;  3T2Y A;  2FJB A;  1GRF A;  1S3E A;  1D4C A;  2WDQ A;  3R0U A;  4YTM A;  4H7U A;  3Q9T A;  1Q9I A;  3NYF A;  3UOX A;  1JRY A;  2XFU A;  1TDE A;  2H89 A;  4NWZ A;  5JRB A;  3FXG A;  1K0I A;  3IWA A;  3EEZ A;  2QGY A;  1TZZ A;  3ISH A;  1CC6 A;  1S2Q A;  3V5C A;  4DX3 A;  4C74 A;  3Q45 A;  1H2I A;  3LB8 A;  1PBF A;  3DA1 A;  1WUF A;  4IVO B;  4KEM A;  1R0M A;  2WQY A;  3JZU A;  3R0K A;  2C64 A;  1BGN A;  3VRA A;  5HHF A;  1KN0 A;  3P4R A;  4M52 A;  3PFR A;  5J7X A;  3TTE A;  4GME A;  3GY1 A;  1E39 A;  3FMW A;  1IUT A;  2PTY A;  5ENL A;  4DGK A;  4U2L A;  3DG6 A;  4TM1 A;  1E1N A;  1COY A;  2PP3 A;  4A65 A;  3AE3 A;  3UKQ A;  2GDQ A;  3KLJ A;  3SZC A;  3UOV A;  1ZKQ A;  3EKG A;  4LU6 A;  4APN A;  3AM9 A;  1KKR A;  3CPJ G;  4ICY A;  4MKS A;  1PBE A;  3PS9 A;  3PO7 A;  4GIR A;  3OZM A;  3T6C A;  4YTP A;  3ICT A;  1H84 A;  1VRQ B;  3CNT A;  3STP A;  3GDN A;  1OEP A;  3DJE A;  3QLD A;  3NIX A;  3O0H A;  1PJ6 A;  3OW1 A;  3ZVI A;  4TM0 A;  3I6T A;  1ONE A;  4EMJ A;  3HYV A;  2XVI A;  2J3N A;  1PXA A;  4U2S A;  4ZOH B;  1GTH A;  3H8I A;  3VA8 A;  1TE6 A;  3M12 A;  3SSZ A;  5FMH A;  2BRY A;  4YT0 A;  3TOY A;  4RSL A;  1CJ2 A;  5FJU A;  3QSE A;  2OQY A;  3DER A;  4Z2R A;  4J56 A;  4E8G A;  2C66 A;  3QFB A;  4G8T A;  4G7F A;  1E1K A;  4Y4L A;  5DBJ A;  3H70 A;  2OZ8 A;  1ONF A;  2HQM A;  3G5R A;  2VRL A;  5JCL A;  5G5G B;  2WP9 A;  3I3L A;  3COX A;  4JY3 A;  5FJT A;  3D9X A;  4H4Z A;  3I4K A;  3AE4 A;  3CN8 A;  2RGJ A;  4D03 A;  1W6T A;  1IUV A;  4H2R A;  2Z5Y A;  3MY9 A;  4GGB A;  4YWS A;  3H8A A;  1VDV A;  1KNR A;  3P0W A;  1JPM A;  2XLS A;  4B65 A;  3GMC A;  1ELI A;  4Y4M A;  3NRZ B;  2BC0 A;  3I6D A;  2CUL A;  3G5S A;  5M10 A;  2V61 A;  3EF6 A;  2QA1 A;  2C73 A;  2WU5 A;  3C4N A;  2DW7 A;  4ECH A;  4B64 A;  3BI4 A;  4IHC A;  5KMS A;  1REO A;  4GIS A;  4TVY A;  1MXT A;  1BKW A;  4K2S A;  1JRP A;  4H4S A;  1P2H A;  3VR9 A;  4U8M A;  3ADA B;  3AEE A;  2OO6 A;  1KDG A;  3NRN A;  3CT2 A;  2OA1 A;  1EL8 A;  4CRT A;  1ZDL A;  3ZDN A;  4CNJ A;  3IK4 A;  1FIQ B;  3KD9 A;  2WPF A;  3B3R A;  2ZZ0 A;  3ALJ A;  1T3Q C;  5KVI A;  3R9U A;  2BAC A;  2R0G A;  2XDO A;  3F8D A;  1JRX A;  1N4U A;  1NG3 A;  2B7S A;  1D5T A;  2OLO A;  1KSS A;  2YG5 A;  4J31 A;  4E4F A;  3N4F A;  3BNU A;  1SJA A;  5HY5 A;  2XYO A;  1XPY A;  4EWJ A;  3P3B A;  4H4U A;  2X3N A;  4TVW A;  3DK8 A;  4KX6 A;  1GOS A;  5GSN A;  4K8G A;  1XPQ A;  3UCL A;  4YKG A;  1GRH A;  1B5Q A;  1N4W A;  2GH5 A;  2YR4 A;  1V59 A;  3OP2 A;  3H8L A;  4M6U A;  4YXD A;  5EB5 A;  2P8B A;  3AB1 A;  2ZZC A;  3RP8 A;  3CYJ A;  2BRA A;  4OVI A;  3ICR A;  3SQP A;  5EOW A;  4YSY A;  4H4V A;  4HN8 A;  5KXJ A;  4U2T A;  2B76 A;  3ALM A;  3CXO A;  3R10 A;  2JK6 A;  1FHV A;  4KT2 A;  3SYI A;  3NZG A;  1F6M A;  1LVL A;  2OG9 A;  3FIM B;  1ZXI C;  4A35 A;  1IUX A;  4RG4 A;  4NNJ A;  1RP0 A;  4CCQ A;  2XFQ A;  2QJJ A;  3TQP A;  5J04 A;  3K7M X;  4J57 A;  1WUE A;  2PPG A;  1DJQ A;  4I58 A;  1VG9 A;  1MNS A;  2VQB A;  5BUK A;  4IA6 A;  1S3B A;  1GRA A;  3T14 A;  1PJ5 A;  1GTE A;  2OAL A;  3URH A;  3NN6 X;  2A87 A;  1VDC A;  3UJF A;  3T8Q A;  4B68 A;  2WHD A;  2VZ2 A;  4OPD A;  2YM2 A;  5KWF A;  2V60 A;  2BA9 A;  4NEV A;  1O95 A;  2V3B A;  2RAB A;  1GES A;  3UKP A;  4C5O A;  2E1M A;  2X50 A;  1KKO A;  4UDP A;  1NDA A;  1GPE A;  4GCM A;  4IP4 A;  3SJN A;  2XH2 A;  5JCI A;  3FCP A;  3RRA A;  1KD0 A;  4X9N A;  1KCZ A;  4GFI A;  2GGG A;  2IVD A;  4E5T A;  3OZY A;  4Z44 A;  3S61 A;  1VQW A;  2R4E A;  2AL1 A;  1TDN A;  1H82 A;  4ZCW A;  1SJB A;  1IUU A;  2OLN A;  3PK7 A;  4JDR A;  2QAE A;  3UTH A;  1CC4 A;  3RP6 A;  1XS2 A;  5IQ4 A;  1BQG A;  1WYG A;  3BSM A;  4CY6 A;  3V3W A;  4G6G A;  1DOC A;  4HCH A;  1BWC A;  3AXB A;  5BVA A;  2GL5 A;  1NEK A;  2GAG B;  3P1W A;  3GC2 A;  2GGH A;  1TDO A;  1EC8 A;  1JCT A;  3SN1 A;  4PAA A;  4ROP A;  1GRE A;  1NAA A;  2WOW A;  2EQ6 A;  3BJS A;  2PTX A;  3FG2 P;  4X4J A;  1DNC A;  1TYP A;  2ZC8 A;  2AQJ A;  2FYM A;  4REK A;  2ZAD A;  1GRT A;  1CHU A;  2XVH A;  2VOU A;  3GSI A;  2APG A;  2PSN A;  4YSH A;  2GVC A;  2VQ7 A;  2A89 A;  1K0J A;  4RG3 A;  2FJE A;  3NYE A;  4H4W A;  2H88 A;  1FFU C;  3NH3 X;  3H12 A;  1GND A;  2YAU A;  2YVG A;  5EB4 A;  2C72 A;  2TMD A;  3QJ4 A;  3SBF A;  3T0K A;  1CJ4 A;  1JDF A;  3AE9 A;  4Z2U A;  4EQX A;  4YKF A;  4MMW A;  1LJ1 A;  3BNM A;  4OPU A;  4N9X A;  1NEL A;  3FPZ A;  4K5S A;  2FBW A;  3NN0 X;  4X2P A;  3BOX A;  2XH0 A;  2GRT A;  4J1O A;  4UP3 A;  4USQ A;  1LTX R;  2WPE A;  1RM6 B;  1E7P A;  3SFE A;  4H2N A;  5IDZ A;  3M13 A;  2YLR A;  1JEH A;  1DXL A;  1P43 A;  3D47 A;  2A8X A;  1ZMC A;  1DOE A;  4DNA A;  3RCY A;  3ABV A;  1E1L A;  1MO9 A;  2GGI A;  3SR6 B;  2JAE A;  1PDH A;  3SY4 A;  2PU1 A;  3ENL A;  2YR6 A;  1PDY A;  2QDE A;  2JB3 A;  2XVJ A;  2FJD A;  1L8P A;  3NK1 X;  4BV6 A;  2OKT A;  4Z26 A;  3MUC A;  1E6E A;  1L0V A;  3QKE A;  4CY8 A;  2BS3 A;  4CBQ A;  2GGJ A;  3T2Z A;  1JRO A;  1PDZ A;  4FP1 A;  3GD6 A;  1CL0 A;  2JBV A;  3LOV A;  3GYX A;  4EQS A;  1D4D A;  4IVM B;  3CAW A;  5C3J A;  3FBS A;  3UKH A;  2AAQ A;  2WET A;  4Z2T A;  3GD3 A;  3HYX A;  3NKS A;  2DW6 A;  1DOD A;  2WP5 A;  3UP4 A;  2O56 A;  4WX1 A;  4G74 A;  3NYC A;  2MUC A;  3CGC A;  2C3C A;  2B9W A;  3UJS A;  3SN0 A;  2WOV A;  1ZMD A;  1XHC A;  4NTD A;  1GER A;  1D7L A;  4FI4 A;  1CC2 A;  4C3Y A;  4OPG A;  1PS9 A;  3DH9 A;  3U9I A;  5BOF A;  4HYR A;  1BZL A;  4DYE A;  1PN0 A;  2OAM A;  1FL2 A;  4TM4 A;  1RVK A;  3AYI A;  3MSY A;  1BGJ A;  1MDL A;  2CDU A;  2GR0 A;  2ZBW A;  2R9Z A;  4XWZ A;  3CNS A;  2HNE A;  5EBK A;  3VQR A;  3CGD A;  2YG4 A;  3MKC A;  3T2K A;  2WEU A;  3ALL A;  3K7T A;  6ENL A;  2P3Z A;  1H7X A;  3NG7 X;  4Z17 A;  3R11 A;  4NTE A;  3NTA A;  1FFV C;  3C4A A;  1NHR A;  1OJT A;  3AN1 A;  4K1W A;  1JNZ A;  2BAB A;  1NU5 A;  2C65 A;  3AE8 A;  2XLT A;  3RR1 A;  3CIR A;  3CB3 A;  2W3S A;  3AD8 B;  4H2Q A;  2W3R A;  3NS1 B;  2GGE A;  1NG4 A;  2BXS A;  5U63 A;  3JSK A;  2FKP A;  3GMB A;  2WDR A;  4J33 A;  3N6H A;  3DFH A;  3DGZ A;  1B4V A;  3T37 A;  1KSU A;  1FEC A;  4H50 A;  1P2E A;  4GF7 A;  7ENL A;  4A9W A;  3HYW A;  3T31 A;  3UXK A;  1H6V A;  1Y0P A;  4Z43 A;  4I59 A;  3CXB A;  3KKJ A;  5KRQ A;  5U25 A;  2GMH A;  3RED A;  3LZX A;  2OZ3 A;  3ES7 A;  3NTD A;  2NPX A;  2AKZ A;  2RGH A;  5FS9 A;  4U8K A;  3KA7 A;  3ZLG A;  4EM3 A;  2XSX A;  4KPR A;  1YQ3 A;  2BCG G;  3AEF A;  2XVF A;  3IJL A;  4TLZ A;  2YM1 A;  3CNJ A;  3Q4D A;  4ZCD A;  3ZLH A;  3QN3 A;  5HXI A;  1S7M A;  1N60 C;  1N5X A;  3ATR A;  3GO2 A;  1M6I A;  1HYU A;  4YTN A;  3S5S A;  3QSM A;  1JOA A;  2GB0 A;  3Q6J A;  2C67 A;  2GF3 A;  4M0X A;  4H1Z A;  4GYP C;  3RHA A;  5BOE A;  1F9C A;  4ADW A;  1H83 A;  2PCE A;  2Z5X A;  3C96 A;  2QQ6 A;  3DIP A;  1GRB A;  2MNR A;  4B69 A;  2WOI A;  5JCK A;  4JY2 A;  1SJD A;  3IJQ A;  2BYB A;  2E3T A;  2PA6 A;  4HCD A;  1GXF A;  2Q0L A;  3PWG A;  5FS8 A;  3ZYX A;  3DK4 A;  3GDP A;  1X31 B;  2I5Q A;  3MZN A;  4UDR A;  4E4U A;  1L9D A;  3TWA A;  2Q7V A;  3P93 A;  4GDP A;  2DKI A;  3R1Z A;  5JCM A;  2WS3 A;  4TM3 A;  2W0H A;  2I0Z A;  4K8D A;  3AYJ A;  3TCS A;  2B9Y A;  3NXL A;  1EL9 A;  2YQU A;  3T4W A;  1FCD A;  4JQ9 A;  2QA2 A;  2YG3 A;  1EC7 A;  3D1C A;  3UKL A;  2GAH B;  4XXG A;  4HNC A;  3JW7 A;  3DGH A;  2C70 A;  4PAB A;  3PVC A;  4A3R A;  3T9P A;  1KF6 A;  2EQ9 A;  1Q1W A;  3TJI A;  3IF9 A;  1SEZ A;  2YR5 A;  2OQH A;  2GSH A;  3FVD A;  1FHU A;  1O94 A;  3BHF A;  4O5Q A;  5CQF A;  1DJN A;  3UKA A;  4HB9 A;  3DG3 A;  5FJR A;  2C75 A;  2WPC A;  3EUB 3;  3CPH G;  1DTN A;  2GV8 A;  3A7R A;  1D4E A;  2YG6 A;  3UTE A;  3HZL A;  1YQZ A;  3OC4 A;  4O5U A;  3TJ4 A;  1NPX A;  4FK1 C;  4U8L A;  3UGV A;  4C3X A;  5HYM A;  4JHM A;  1TKK A;  1PJ7 A;  1GET A;  2JB1 A;  3G5Q A;  1ZK7 A;  3UCD A;  4H83 A;  3DJD A;  2YVF A;  3HW2 A;  5KVH A;  2VRM A;  4TLX A;  3HPF A;  2HXU A;  3RO6 A;  2VVM A;  1MDR A;  2X99 A;  3CTY A;  1FOH A;  3BI5 A;  1UKV G;  1ELS A;  4IV9 A;  5EU9 A;  1DOB A;  2XVE A;  3EAN A;  2BK5 A;  4MGG A;  3NFU A;  3PG6 A;  3DME A;  2AKM A;  3AE2 A;  3CND A;  2P88 A;  1QJD A;  1EBG A;  5IQ1 A;  5BRT A;  3UJR A;  1X2G A;  3CNP A;  3DG7 A;  4BK2 A;  4MJW A;  3DES A;  1IUS A;  2QDD A;  1CF3 A;  3UTG A;  4GDE A;  4II2 A;  3P4Q A;  3I6E A;  3U4F A;  2GR3 A;  1ZP0 A;  2QJN A;  4HNL A;  1LV0 A;  1NHP A;  1F8R A;  4HA6 A;  3VDG A;  5KNL A;  4XWR A;  1Z6L A;  4AOS A;  5KOX A;  3EAO A;  1X2H A;  4AOX A;  2YLT A;  3EPT A;  2XH4 A;  3QSS A;  5M0Z A;  3P9U A;  1YY5 A;  1O5W A;  1VG0 A;  4B63 A;  5ER0 A;  4DN1 A;  3V76 A;  1GT8 A;  2JKC A;  3ITJ A;  2HZG A;  4GUV A;  4IP5 A;  3RNM A;  4F4R A;  3AEC A;  4G9K A;  4EQR A;  1W4X A;  2YLZ A;  2OX4 A;  1FO4 A;  3IC9 A;  3FYY A;  3VRB A;  1EL5 A;  3II4 A;  1FEA A;  3NVZ B;  3SZW A;  2B9X A;  1JNR A;  1QO8 A;  4ZCC A;  1H81 A;  4USR A;  1H86 A;  5G5H B;  3ZLF A;  3NGC X;  3AEB A;  4OPT A;  5U1O A;  2PP1 A;  1ECQ A;  2PS2 A;  5KMR A;  3IJI A;  2BS4 A;  3TW9 A;  1ZX9 A;  5KMQ A;  3NT6 A;  2GR2 A;  1EC9 A;  3RGT A;  2X8H A;  5FJP A;  3UKF A;  2XGZ A;  3SZF A;  2YVJ A;  4BJZ A;  3AYL A;  2PHH A;  2VVL G;  3S5W A;  1GEU A;  2PTW A;  4EM4 A;  2PTZ A;  4UDQ A;  4K2X A;  3DDM A;  3R07 C;  3V5F A;  1XDI A;  1OJC A;  1NHQ A;  3A7U A;  4U8I A;  4GGH A;  4P9S A;  3BI2 A;  4EQW A;  2YWL A;  3WE0 A;  3HRD C;  2Y6Q A;  4JNA A;  2QCU A;  5BUL A;  4IL2 A;  4JNQ A;  4HPN A;  4BK1 A;  3LJP A;  4Z1Y A;  2Q6U A;  3K1G A;  3N6J A;  3S47 A;  4A5L A;  1PXC A;  2PP0 A;  3AE6 A;  4LII A;  5FJO A;  4KWS A;  3A7A A;  2XFO A;  2PGE A;  3NHO X;  4J34 A;  1MRA A;  2Y6R A;  3L8K A;  2WES A;  3UOY A;  4EMI A;  4B1B A;  1GSN A;  3K30 A;  3KUM A;  3VCN A;  1PHH A;  2XFP A;  4ZA0 A;  1IYX A;  3GYJ A;  3NVY B;  2IID A;  1EBD A;  3VRD B;  1ZOV A;  3VC5 A;  3M0O A;  1QLB A;  1Y56 A;  4YSX A;  4DXK A;  2JB2 A;  1Q1R A;  3PWI A;  2OLA A;  4IL0 A;  3AE7 A;  3ZVH A;  2QJM A;  3B97 A;  2XH7 A;  2YLW A;  2TPR A;  3AE5 A;  2V3A A;  2AR8 A;  4U8O A;  3CK5 A;  2R4J A;  2Q0K A;  4IA5 A;  2PMQ A;  3SGL A;  4HCL A;  5GRT A;  5KOW A;  1EL7 A;  3ATQ A;  5CKU A;  4EMW A;  4IZG A;  2AL2 A;  4NZH A;  2O9Z A;  3VFC A;  1D7Y A;  3SXI A;  4ZN0 A;  4J3Z A;  2WDV A;  1PBC A;  4DSH A;  1YEY A;  2NQL A;  4BJY A;  3V4B A;  2YLS A;  3QTP A;  1RSG A;  4C77 A;  2BK3 A;  1OJD A;  4OPC A;  2R46 A;  4NTC A;  4CCR A;  3CGB A;  1VQZ A;  3DGB A;  2ZZB A;  3DJJ A;  3NVV B;  1CJ3 A;  4A99 A;  3LXD A;  3CGE A;  2CFY A;  2NVK X;  3SM8 A;  3BHK A;  3KU9 A;  3QFA A;  1L9C A;  3AMZ A;  2F5Z A;  2ONE A;  4GRT A;  2BS2 A;  3FJ4 A;  4AT2 A;  2WBA A;  1TYT A;  4AT0 A;  2YLX A;  4D04 A;  3IHM A;  3AWI A;  1S2Y A;  4H4R A;  3KPF A;  4G73 A;  2RGO A;  4E0V A;  2POZ A;  4OCG A;  4DSG A;  5L46 A;  5IPY A;  2GEW A;  2V5Z A;  2BXR A;  3AD9 B;  1XAN A;  2V6O A;  4GAV A;  5FS7 A;  2P8C A;  3TWB A;  4EIP A;  1IUW A;  4A6N A;  1V97 A;  1GAL A;  3ETR B;  4NEW A;  4GYP A;  2POD A;  1L9E A;  1ZOY A;  1P48 A;  4GAP A;  4U8J A;  2PYX A;  3DK9 A;  3GD4 A;  3GWF A;  3AEG A;  3UKK A;  2X8C A;  1H7W A;  2VVL A;  1OJA A;  4H4Q A;  1B37 A;  3SZ0 A;  5JCN A;  2BCP A;  3UOZ A;  3UJE A;  3V3O A;  2XLP A;  3MWC A;  1JU2 A;  2ARD A;  3AED A;  4K22 A;  1PXB A;  1N1P A;  4E6M A;  1SJC A;  5KMP A;  3V3N A;  1N62 C;  3NVW B;  2XFN A;  1N63 C;  4BK3 A;  1F8W A;  4B66 A;  1YKJ A;  3JVA A;  5J60 A;  3IHG A;  2OPJ A;  3AE1 A;  2IVE A;  3OPS A;  2C7G A;  2ACZ A;  1JRZ A;  4G6H A;  4H4Y A;  1FEB A;  1TRB A;  2CVJ A;  2XCG A;  2GMJ A;  3AD7 B;  2P0I A;  4BUR A;  3OTR A;  3VR8 A;  4H4X A;  3NO1 A;  3LAD A;  3GRS A;  4JN7 A;  2XLU A;  1BKH A;  1LQU A;  1CBO A;  2GQW A;  4X9M A;  4H19 A;  2BC1 A;  3THU A;  3CMM A;  2X8G A;  1PBB A;  3E1T A;  4H4P A;  1E1M A;  1LQT A;  1TDK A;  3L5O A;  3VCC A;  1MOK A;  1MUC A;  3MQT A;  3K7Q X;  2E5V A;  1CJC A;  3UP5 A;  4J36 A;  1SB3 B;  2W55 A;  3B9J B;  4FK1 A;  2C76 A;  3H4K A;  3CPI G;  1N61 C;  3ES8 A;  3RIT A;  3DEQ A;  2WU2 A;  2EQ8 A;  1TDF A;  1PBD A;  4YSZ A;  1N5W C;  1STZ A;  4KPL A;  2BK4 A;  4U8P A;  4U8N A;  4FX9 A;  2FJA A;  1K4Q A;  3P4S A;  4K5R A;  2OVL A;  3NNE A;  4K7Z A;  4YWO A;  3SFD A;  3H7V A;  1NEN A;  2RDX A;  4OPL A;  3UCC A;  1Y56 B;  3D46 A;  4A6G A;  1OJ9 A;  4WCT A;  2PGW A;  2HXT A;  3ZVH B;  1R6W A;  3ICS A;  4ENL A;  3UJ2 A;  3VC6 A;  1E9I A;  4AP3 A;  2R0C A; 
#chains in the Genus database with same CATH homology
 2VVL G;  2OLO A;  3AE8 A;  3S5W A;  1KSS A;  4H4T A;  1GEU A;  2YG5 A;  4J31 A;  2XLT A;  4EM4 A;  3CIR A;  1NHS A;  4B67 A;  2EQ7 A;  4UDQ A;  4K2X A;  2R45 A;  3BNU A;  3QVP A;  3AD8 B;  4H2Q A;  4H2P A;  1GRG A;  5HY5 A;  2XYO A;  1F3P A;  2DKH A;  1XDI A;  1GV4 A;  4OPI A;  3DJG X;  1NG4 A;  4H4U A;  2BXS A;  2X3N A;  5U63 A;  2E4G A;  1OJC A;  1NHQ A;  3JSK A;  3DK8 A;  1ZY8 A;  4U8I A;  5KOX A;  3KPK A;  3F8P A;  1LPF A;  4P9S A;  3BI2 A;  4Z25 A;  4KX6 A;  1GOS A;  5GSN A;  4EQW A;  2YWL A;  5TR3 A;  3F8R A;  3WE0 A;  3GMB A;  2GR1 A;  1XPQ A;  2WDR A;  4J33 A;  3UCL A;  2Y6Q A;  4YKG A;  4FDC B;  1GRH A;  2C4C A;  4EIQ A;  4JNA A;  2C3D A;  1B5Q A;  3DGZ A;  1B4V A;  3T37 A;  1N4W A;  3UTF A;  1BF3 A;  2GH5 A;  1KSU A;  4A7A A;  2QCU A;  1FEC A;  1V59 A;  2YR4 A;  5BUL A;  4H50 A;  4JNQ A;  3H8L A;  1K0L A;  2WP6 A;  1P2E A;  4BK1 A;  3LJP A;  4GF7 A;  4YXD A;  5EB5 A;  3B6D A;  2Q6U A;  3LZW A;  4A9W A;  4A5L A;  1PXC A;  3HYW A;  3T31 A;  4CNK A;  3AE6 A;  4LA1 A;  1N4V A;  1RYI A;  2ZZC A;  3AB1 A;  3RP8 A;  1H6V A;  4J2W A;  1Y0P A;  2BRA A;  4Z43 A;  4I59 A;  3GYI A;  4LII A;  3KKJ A;  2GQF A;  4II3 A;  3L1R A;  4OVI A;  1KFY A;  3QVR A;  2XFO A;  3GWD A;  5KRQ A;  4AP1 A;  5U25 A;  3KVE A;  2GMH A;  3ICR A;  3NHO X;  3SQP A;  4J34 A;  3RED A;  3LZX A;  2Y6R A;  5EOW A;  4YSY A;  3L8K A;  4Y4N A;  3NTD A;  2NPX A;  4H4V A;  2B7R A;  2RGH A;  5FS9 A;  1YQ4 A;  5KXJ A;  2WES A;  3UOY A;  4EMI A;  1IJH A;  3KA7 A;  4GR1 A;  1M64 A;  4EM3 A;  2B76 A;  4KPR A;  3ALM A;  4JN9 A;  4B1B A;  1YQ3 A;  1GSN A;  2JK6 A;  2BCG G;  3AEF A;  2XVF A;  3K30 A;  4TLZ A;  3NLC A;  3NK2 X;  2YM1 A;  3SYI A;  1F6M A;  1LVL A;  3CNJ A;  1PHH A;  2XFP A;  3GYJ A;  3AEA A;  3FIM B;  3OZ2 A;  4ZCD A;  5FS6 A;  2IID A;  1EBD A;  3VRD B;  1ZOV A;  1IUX A;  4RG4 A;  4NNJ A;  5LV9 A;  1RP0 A;  4CCQ A;  5C2T A;  2YG7 A;  3GRT A;  2XFQ A;  3M0O A;  1QLB A;  4Z24 A;  5HXI A;  1Y56 A;  1S7M A;  3K7M X;  4YSX A;  2JB2 A;  2UZZ A;  1KNP A;  1Q1R A;  3NK0 X;  4J57 A;  3ATR A;  4A79 A;  1B8S A;  3RP7 A;  1DJQ A;  4I58 A;  1VG9 A;  3SX6 A;  2VQB A;  5BUK A;  3AE7 A;  4A6N B;  2XLR A;  3P4P A;  4IA6 A;  1S3B A;  1M6I A;  2YLW A;  3D8X A;  1GRA A;  2TPR A;  1HYU A;  3T14 A;  1F8S A;  4YTN A;  1AOG A;  1PJ5 A;  2R0P A;  1GTE A;  3AE5 A;  2V3A A;  2AR8 A;  2OAL A;  3URH A;  3QSM A;  3NN6 X;  1JOA A;  4U8O A;  2A87 A;  2R4J A;  3T2Y A;  2GB0 A;  1VDC A;  3Q6J A;  2Q0K A;  4IA5 A;  3S61 A;  2FJB A;  2C67 A;  1GRF A;  1S3E A;  2GF3 A;  3SGL A;  1D4C A;  4B68 A;  2WHD A;  2WDQ A;  3RHA A;  2VZ2 A;  4OPD A;  4YTM A;  2YM2 A;  5KWF A;  4ADW A;  2V60 A;  5GRT A;  4NEV A;  1H83 A;  1O95 A;  2BA9 A;  3Q9T A;  4H7U A;  5KOW A;  2V3B A;  1Q9I A;  1EL7 A;  2RAB A;  3NYF A;  3ATQ A;  1GES A;  4EMW A;  5CKU A;  2Z5X A;  3C96 A;  3UKP A;  4C5O A;  3UOX A;  2E1M A;  4NZH A;  2X50 A;  2O9Z A;  1D7Y A;  1GRB A;  1JRY A;  2XFU A;  3SXI A;  4ZN0 A;  4B69 A;  2WOI A;  5JCK A;  4UDP A;  4JY2 A;  1NDA A;  1GPE A;  1TDE A;  2H89 A;  2WDV A;  4GCM A;  1PBC A;  4NWZ A;  5JRB A;  4DSH A;  1K0I A;  3IWA A;  4BJY A;  2BYB A;  5JCI A;  2YLS A;  3ISH A;  1CC6 A;  1S2Q A;  1RSG A;  1GXF A;  4C77 A;  2Q0L A;  4C74 A;  2BK3 A;  4X9N A;  1H2I A;  3LB8 A;  1OJD A;  4OPC A;  2R46 A;  4NTC A;  4CCR A;  3CGB A;  5FS8 A;  3ZYX A;  3DK4 A;  1PBF A;  2IVD A;  3GDP A;  3DA1 A;  2ZZB A;  3DJJ A;  1X31 B;  4Z44 A;  1CJ3 A;  1VQW A;  2R4E A;  4IVO B;  4UDR A;  3LXD A;  3CGE A;  2CFY A;  1H82 A;  1TDN A;  2NVK X;  2WQY A;  3SM8 A;  3BHK A;  3KU9 A;  1L9D A;  2Q7V A;  1IUU A;  3QFA A;  2OLN A;  2C64 A;  1BGN A;  4GDP A;  3VRA A;  1L9C A;  2DKI A;  2F5Z A;  5JCM A;  5HHF A;  1KN0 A;  4GRT A;  4JDR A;  2QAE A;  2BS2 A;  2WS3 A;  1CC4 A;  3P4R A;  3RP6 A;  4M52 A;  4TM3 A;  3UTH A;  5J7X A;  4AT2 A;  5IQ4 A;  2WBA A;  2W0H A;  2I0Z A;  4K8D A;  3AYJ A;  1TYT A;  1E39 A;  3FMW A;  4AT0 A;  2B9Y A;  4CY6 A;  1IUT A;  4G6G A;  1DOC A;  2YLX A;  4D04 A;  1BWC A;  2YQU A;  1EL9 A;  1FCD A;  1S2Y A;  3AXB A;  3AWI A;  3IHM A;  5BVA A;  4H4R A;  4JQ9 A;  3KPF A;  1NEK A;  4DGK A;  2QA2 A;  2YG3 A;  2GAG B;  3P1W A;  4G73 A;  2RGO A;  1TDO A;  3D1C A;  4U2L A;  4E0V A;  3UKL A;  4OCG A;  2GAH B;  4XXG A;  4TM1 A;  4DSG A;  5L46 A;  5IPY A;  4PAA A;  2GEW A;  1GRE A;  1NAA A;  2V5Z A;  2BXR A;  3DGH A;  1E1N A;  2C70 A;  3AD9 B;  2WOW A;  4PAB A;  1COY A;  1XAN A;  2EQ6 A;  3PVC A;  2V6O A;  4GAV A;  5FS7 A;  4A65 A;  3AE3 A;  3FG2 P;  1KF6 A;  2EQ9 A;  1Q1W A;  3IF9 A;  4X4J A;  3UKQ A;  4EIP A;  1DNC A;  4U8K A;  1SEZ A;  2YR5 A;  1IUW A;  1TYP A;  3KLJ A;  4A6N A;  2AQJ A;  3SZC A;  1GAL A;  4REK A;  1O94 A;  3UOV A;  1GRT A;  1ZKQ A;  1CHU A;  2XVH A;  2VOU A;  3GSI A;  4NEW A;  2APG A;  3BHF A;  4LU6 A;  4O5Q A;  4APN A;  1L9E A;  5CQF A;  1DJN A;  4YSH A;  3CPJ G;  3UKA A;  1ZOY A;  2GVC A;  2VQ7 A;  4HB9 A;  4ICY A;  2A89 A;  1K0J A;  4GAP A;  4RG3 A;  2FJE A;  1PBE A;  3NYE A;  4U8J A;  4H4W A;  2C75 A;  2H88 A;  2WPC A;  2PYX A;  3CPH G;  3NH3 X;  3DK9 A;  3PS9 A;  1GND A;  2YAU A;  2YVG A;  3PO7 A;  5EB4 A;  2C72 A;  2TMD A;  3GD4 A;  4YTP A;  3GWF A;  2GV8 A;  3ICT A;  1H84 A;  3QJ4 A;  3AEG A;  3UKK A;  1VRQ B;  3CNT A;  1D4E A;  2X8C A;  2YG6 A;  3UTE A;  3GDN A;  3HZL A;  1H7W A;  1YQZ A;  3DJE A;  3T0K A;  3OC4 A;  1CJ4 A;  2VVL A;  1OJA A;  3NIX A;  4O5U A;  4H4Q A;  1B37 A;  3SZ0 A;  5JCN A;  3AE9 A;  3O0H A;  4Z2U A;  1NPX A;  4FK1 C;  4EQX A;  1PJ6 A;  4U8L A;  2BCP A;  4A99 A;  3UOZ A;  4TM0 A;  2XLP A;  3V3O A;  4YKF A;  4C3X A;  5HYM A;  1LJ1 A;  3BNM A;  1JU2 A;  2ARD A;  4EMJ A;  3AED A;  4K22 A;  4OPU A;  1PXB A;  3HYV A;  1PJ7 A;  1GET A;  2JB1 A;  2XVI A;  4N9X A;  3FPZ A;  2J3N A;  1N1P A;  1PXA A;  2FBW A;  3G5Q A;  3NN0 X;  1ZK7 A;  4K5S A;  4U2S A;  5KMP A;  1GTH A;  3DJD A;  3H8I A;  3V3N A;  2YVF A;  5KVH A;  2VRM A;  2XFN A;  4TLX A;  3M12 A;  4BK3 A;  1F8W A;  2GRT A;  5FMH A;  4UP3 A;  4USQ A;  1LTX R;  2BRY A;  2X99 A;  1YKJ A;  2WPE A;  2VVM A;  1FOH A;  3CTY A;  3IHG A;  4B66 A;  3BI5 A;  1UKV G;  1E7P A;  4RSL A;  4YT0 A;  5J60 A;  4IV9 A;  3AE1 A;  1CJ2 A;  2IVE A;  3SFE A;  4H2N A;  1DOB A;  2C7G A;  2XVE A;  2ACZ A;  3QSE A;  4Z2R A;  3EAN A;  2BK5 A;  3M13 A;  4J56 A;  1JEH A;  1DXL A;  2YLR A;  3PG6 A;  1JRZ A;  3DME A;  2A8X A;  1ZMC A;  2C66 A;  3QFB A;  1DOE A;  4DNA A;  3AE2 A;  3CND A;  3ABV A;  1E1L A;  1MO9 A;  1E1K A;  4Y4L A;  5DBJ A;  1QJD A;  2JAE A;  1ONF A;  2HQM A;  3G5R A;  4G6H A;  5IQ1 A;  4H4Y A;  1PDH A;  1FEB A;  5JCL A;  2VRL A;  3SY4 A;  5BRT A;  1TRB A;  2CVJ A;  2XCG A;  2GMJ A;  3CNP A;  2WP9 A;  3AD7 B;  3I3L A;  3COX A;  4BK2 A;  2YR6 A;  4JY3 A;  4BUR A;  4MJW A;  2JB3 A;  1IUS A;  2XVJ A;  3VR8 A;  3D9X A;  1CF3 A;  2FJD A;  4H4X A;  3UTG A;  3NK1 X;  4BV6 A;  4GDE A;  4II2 A;  4H4Z A;  3P4Q A;  3LAD A;  4Z26 A;  3AE4 A;  3CN8 A;  2RGJ A;  1E6E A;  2GR3 A;  3GRS A;  1ZP0 A;  1IUV A;  1L0V A;  4D03 A;  2XLU A;  4CY8 A;  2BS3 A;  4CBQ A;  1LQU A;  3T2Z A;  1LV0 A;  1NHP A;  1CBO A;  2GQW A;  4H2R A;  4X9M A;  2Z5Y A;  2BC1 A;  1F8R A;  4HA6 A;  3CMM A;  2X8G A;  1CL0 A;  1PBB A;  3E1T A;  2JBV A;  1KNR A;  3LOV A;  4XWR A;  5KNL A;  3GYX A;  4EQS A;  1D4D A;  4H4P A;  1E1M A;  1LQT A;  1Z6L A;  2XLS A;  1TDK A;  3GMC A;  4IVM B;  4AOS A;  4B65 A;  5C3J A;  3L5O A;  1ELI A;  3FBS A;  4Y4M A;  3EAO A;  2BC0 A;  3I6D A;  1MOK A;  3UKH A;  4AOX A;  2YLT A;  2CUL A;  3G5S A;  5M10 A;  2AAQ A;  3EPT A;  3QSS A;  2WET A;  4Z2T A;  2V61 A;  3K7Q X;  2E5V A;  3EF6 A;  3GD3 A;  1CJC A;  2QA1 A;  3HYX A;  2C73 A;  3NKS A;  5M0Z A;  3P9U A;  3UP5 A;  4J36 A;  1DOD A;  1YY5 A;  1O5W A;  2WP5 A;  1VG0 A;  3UP4 A;  2WU5 A;  3C4N A;  4WX1 A;  4G74 A;  4FK1 A;  4B63 A;  3NYC A;  5ER0 A;  3CGC A;  3V76 A;  1GT8 A;  2JKC A;  2C3C A;  2B9W A;  3ITJ A;  2C76 A;  4ECH A;  4B64 A;  3H4K A;  4U2T A;  3CPI G;  3BI4 A;  4AP3 A;  4GUV A;  3RNM A;  3AEC A;  2WU2 A;  2WOV A;  2EQ8 A;  5KMS A;  1ZMD A;  1XHC A;  1REO A;  4G9K A;  4EQR A;  1W4X A;  4NTD A;  1GER A;  1TDF A;  1PBD A;  1MXT A;  2YLZ A;  1BKW A;  1D7L A;  4YSZ A;  3IC9 A;  1CC2 A;  4C3Y A;  4OPG A;  1PS9 A;  4H4S A;  2BK4 A;  1EL5 A;  3II4 A;  3VRB A;  1FEA A;  1P2H A;  3DH9 A;  4U8P A;  4U8N A;  3SZW A;  4U8M A;  3VR9 A;  2B9X A;  4FX9 A;  2FJA A;  1K4Q A;  3ADA B;  1BZL A;  3P4S A;  1PN0 A;  2OAM A;  1FL2 A;  4TM4 A;  4K5R A;  3AEE A;  1KDG A;  1JNR A;  3AYI A;  3NRN A;  1BGJ A;  3NNE A;  2OA1 A;  2CDU A;  4K7Z A;  1QO8 A;  2GR0 A;  1EL8 A;  2ZBW A;  4ZCC A;  4CRT A;  1H81 A;  4USR A;  2R9Z A;  1H86 A;  1ZDL A;  4XWZ A;  3NGC X;  3ZDN A;  3CNS A;  4CNJ A;  3AEB A;  4YWO A;  4OPT A;  5EBK A;  3KD9 A;  3VQR A;  2WPF A;  3CGD A;  3B3R A;  3SFD A;  5U1O A;  2YG4 A;  3T2K A;  2ZZ0 A;  1NEN A;  3ALJ A;  5KMR A;  4OPL A;  2WEU A;  1Y56 B;  3ALL A;  3K7T A;  5KVI A;  2BS4 A;  1OJ9 A;  1H7X A;  1ZX9 A;  3NG7 X;  5KMQ A;  3R9U A;  4WCT A;  3NT6 A;  2BAC A;  2GR2 A;  2R0G A;  2X8H A;  2XDO A;  3F8D A;  4NTE A;  1JRX A;  1N4U A;  3UKF A;  3NTA A;  3ICS A;  1NG3 A;  3SZF A;  3C4A A;  1NHR A;  1OJT A;  2YVJ A;  2B7S A;  4BJZ A;  3AYL A;  1JNZ A;  2BAB A;  2PHH A;  1D5T A;  2C65 A;  2R0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...