3OC4A

Crystal structure of a pyridine nucleotide-disulfide family oxidoreductase from the enterococcus faecalis v583
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
442
structure length
422
Chain Sequence
b'LKIVIIGASFAGISAAIASRKKYPQAEISLIDKQATVGYLSGRYITEEELRRQKIQLLLNREVVAMDVENQLIAWTRKEEQQWYSYDKLILATGASQFSTQIRGSQTEKLLKYKFLSAVPLLENSQTVAVIGAGPIGMEAIDFLVKMKKTVHVFESLENLLPKYFDKEMVAEVQKSLEKQAVIFHFEETVLGIEETANGIVLETSEQEISCDSGIFALNLHPQLAYLDKKIQRNLDQTIAVDAYLQTSVPNVFAIGDCISVMNEPVAETFYAPLVNNAVRTGLVVANNLEEKTHRFIGSLRTMGTKVGDYYLASTGLTETEGLFFPQTLASIIVRQPAPPLQHGTEILGKLIYDKVTQRVLGAQLCSKNNCLEKINTLALSIQTGQTLTDLLQKDYFYQPSLTNIYDITNLMGASAYWREND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxidoreductase, pyridine nucleotide-disulfide family
publication title Crystal Structure of a pyridine nucleotide-disulfide family oxidoreductase from the Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase
total genus 119
structure length 422
sequence length 442
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3oc4A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3oc4A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3oc4A02
1BGNA 1DJNA 1OJCA 5KOXA 4XWZA 2H88A 3UKKA 4DNAA 3NK0X 1F6MA 1PJ6A 3IF9A 5L46A 2AR8A 2R9ZA 1D7YA 1E6EA 2XFNA 1IUVA 3AXBA 1CC4A 3NKSA 1CJ3A 3BNMA 2BCPA 1GXFA 1BF3A 2C75A 3G5RA 3OC4A 4REKA 3NTDA 4U8IA 1TDNA 3RP7A 2YVGA 2GMJA 4ICYA 2JBVA 1E7PA 4APNA 3GMCA 4IVOB 3UTEA 1ZY8A 1PXCA 2BK5A 2GB0A 2XFUA 3AE2A 3BI4A 4U8JA 3UKFA 4B64A 1ZOVA 2C72A 4YSXA 4MJWA 2VRMA 1CBOA 4E0VA 3QVPA 2BC1A 3GYIA 5IQ4A 1JEHA 1GETA 1NDAA 4B63A 4EQRA 4CCQA 2YWLA 1Q1RA 3P4QA 4Z44A 3UCLA 4UDPA 1F8RA 1BKWA 2RGOA 4OPDA 2BC0A 2CVJA 1YKJA 4B67A 3AE3A 3UOZA 1CHUA 2TPRA 2Q0KA 5ER0A 1H7WA 3CGCA 2DKHA 4O5UA 5JCLA 4H4TA 2BXRA 2C76A 5J60A 1TYPA 5LV9A 1SEZA 4ZCCA 2X8CA 1JRXA 3KLJA 1NG4A 3GRSA 4J33A 4UDQA 1H84A 3SFEA 5BVAA 2CDUA 2J3NA 3P4PA 2YG7A 1NEKA 3AE9A 1ZKQA 3GDNA 3AYIA 3K7TA 1NENA 4USRA 2ZZCA 4H7UA 3ABVA 1VQWA 2VVLA 2IIDA 3AYJA 4CY8A 2RGHA 3NYCA 3CIRA 1ONFA 1REOA 3KU9A 4IVMB 4U8OA 4CNKA 4AOXA 2C67A 4YTPA 4YWOA 2VOUA 3NRNA 4GDEA 2GR3A 4Z24A 3UKQA 5M10A 2B76A 3ATRA 2CULA 2YVJA 3ITJA 1PDHA 3VRDB 5BRTA 4A5LA 4B68A 3ALJA 2XLTA 3NN6X 1OJTA 4JY3A 2BK3A 1KF6A 3LADA 1O94A 3UTGA 3E1TA 4U8PA 4KPRA 2WETA 2YM1A 5BULA 3V3OA 4J34A 3RNMA 1GRHA 2VVLG 3QJ4A 3ALLA 3NNEA 2BS4A 3DK8A 2RABA 1K4QA 4YKFA 1ZK7A 4H4WA 1S3EA 5KRQA 1GV4A 2C66A 3LJPA 3C96A 4K5RA 3AE4A 4GF7A 4K5SA 1Y56B 5CKUA 2A87A 1D4EA 1CL0A 3KD9A 1LV0A 1K0JA 2ZZ0A 2C3DA 3GD3A 3BI2A 1L9CA 2E4GA 2I0ZA 1ZMCA 5EOWA 2Y6QA 2DKIA 3SGLA 4Y4LA 5EBKA 5FS6A 4OPCA 4GRTA 4YSHA 2QA2A 5JCIA 3V76A 2VVMA 2V5ZA 1YQ4A 5M0ZA 1E1MA 1Z6LA 2XYOA 3AEEA 4Z26A 3PS9A 1H7XA 4TLZA 1KSUA 2W0HA 2WOVA 4EMIA 2QCUA 2BYBA 2YG3A 1DODA 2WP6A 3Q6JA 2X3NA 3AEFA 3C4NA 4XXGA 1BZLA 4WCTA 5TR3A 2YVFA 4YSZA 4EIPA 4H4XA 4BK1A 4EQWA 3GDPA 1LPFA 3GWFA 3M12A 1P2HA 1CJCA 4H4YA 3T37A 2EQ9A 1TYTA 2YLXA 1E1LA 2YG5A 3FG2P 4EMWA 3K30A 4A6NB 3NHOX 1TDEA 1GEUA 2E5VA 5C3JA 4ADWA 5KOWA 1RYIA 2A8XA 2V3AA 2YR4A 2R4EA 2BS3A 4J57A 4FK1C 4TM3A 3UOYA 3UKLA 4J31A 4U2LA 1ZX9A 2B7RA 2C65A 2WQYA 3QVRA 3UTHA 1XHCA 3EPTA 1D5TA 5HXIA 2ZZBA 1Q1WA 5HYMA 2GAHB 3H4KA 1D4DA 2C7GA 5U1OA 2OLNA 4D04A 3K7QX 4H4RA 1GT8A 1GRBA 2Z5XA 4JQ9A 3B3RA 3ZDNA 2JB2A 3B6DA 3AECA 2VZ2A 3AB1A 3FMWA 3UKHA 4AOSA 5HY5A 1LJ1A 5FS9A 3CPJG 2OAMA 4PABA 2GQFA 3GWDA 3DJGX 2V60A 2NVKX 3O0HA 3CPIG 1ZP0A 1E1NA 2YR5A 4NTCA 3C4AA 4H4VA 3VR8A 1IUSA 1FL2A 3CN8A 2V3BA 1CC6A 3UP5A 4I59A 4C77A 4NTDA 4Z2UA 2BA9A 2JB1A 2WEUA 2CFYA 4EM3A 3NG7X 1TDFA 4D03A 2GR0A 2ARDA 3G5QA 3R9UA 1L9EA 2JAEA 4KX6A 3AYLA 3AD8B 5C2TA 1TDKA 2BACA 4OCGA 3EANA 1H82A 2WU5A 1Y56A 5JCNA 3CNPA 4I58A 2IVDA 4YSYA 4YTNA 4AP3A 1FOHA 4ZN0A 4JNQA 3NLCA 4BURA 1YY5A 1VRQB 3BHFA 2R0CA 2UZZA 3V3NA 4H4PA 1HYUA 4CBQA 1NHQA 2XLSA 1VDCA 3CTYA 4NTEA 3AE1A 2PYXA 4A99A 4GUVA 4Z43A 2WOIA 2IVEA 2GR1A 1PBEA 1NHRA 1W4XA 2B9YA 2BK4A 3DGHA 3DGZA 3P4RA 5BUKA 2XLRA 4NEWA 3NK1X 2WPEA 3AE6A 3NT6A 3L1RA 1AOGA 5IQ1A 3D8XA 1LTXR 4K8DA 4RG3A 1XPQA 1GPEA 2YLZA 3FBSA 2XFPA 3LZXA 2GH5A 2Q0LA 3ADAB 4H4UA 5FS7A 1DJQA 4Z2TA 2XVHA 3AEBA 2JKCA 1DXLA 1VG9A 3AEAA 4AT2A 2NPXA 1GOSA 4A6NA 1B4VA 2BS2A 3P4SA 2WPCA 4BJYA 2WU2A 4BK2A 4OPGA 3BHKA 4U2TA 4Z2RA 4K2XA 2APGA 2OALA 3AWIA 4H4ZA 1NPXA 1GTEA 3PO7A 3KA7A 1MOKA 4NEVA 1L9DA 1ELIA 3P1WA 4YTMA 3ALMA 1E39A 3M0OA 1DNCA 1N4WA 4JNAA 1N4VA 3SFDA 4WX1A 5J7XA 1ZMDA 3VQRA 1KFYA 3NTAA 4Y4NA 2YLRA 1X31B 3D1CA 3ZYXA 4OPUA 1B8SA 2C64A 1FEBA 3CPHG 3QFBA 1GNDA 2R46A 2R45A 4OPTA 4B65A 4CNJA 1IUUA 3SM8A 1N1PA 4U2SA 5CQFA 2Q6UA 4XWRA 2FBWA 3UTFA 2O9ZA 3NGCX 2GR2A 3OZ2A 4USQA 1NHSA 1KDGA 2XFOA 1JU2A 3AE7A 4EM4A 1O5WA 1ZOYA 1GREA 2QA1A 3IHMA 4IV9A 4N9XA 2EQ6A 1TDOA 4NZHA 1QLBA 1EL7A 1H83A 5KXJA 3VR9A 1PBFA 1RSGA 2XVEA 4U8MA 1OJDA 3DJDA 4ECHA 3DH9A 3RP8A 3UP4A 2WP5A 2YM2A 2X50A 1CJ4A 4TM4A 4C3YA 2XFQA 2YQUA 4A7AA 2ACZA 3URHA 4TLXA 4DSGA 5FMHA 2X8HA 2RGJA 3DMEA 2X99A 4FX9A 1COYA 4AT0A 1PS9A 3ICTA 2TMDA 2YLSA 4K22A 4H50A 1GERA 2EQ8A 4H2QA 1IUWA 4OPLA 4M52A 2B9XA 3AE8A 4PAAA 3SQPA 2GAGB 2WDVA 1H81A 2BXSA 1LQUA 4HB9A 1Q9IA 1GTHA 2WP9A 3BI5A 1NG3A 1Y0PA 3CNDA 3ICSA 3QSEA 4GCMA 4X9MA 1GRTA 2B7SA 1KSSA 1LQTA 3GMBA 2FJBA 3RHAA 5GRTA 4U8KA 3Q9TA 2YG4A 3CGEA 1TRBA 4BK3A 2Y6RA 1VG0A 1YQ3A 2HQMA 2XLPA 2FJAA 2XVIA 4FK1A 3CNTA 3UKAA 3VRAA 4JY2A 1QJDA 3G5SA 1RP0A 3ICRA 2OLOA 4H4SA 3NH3X 4U8LA 5KWFA 3VRBA 3IHGA 1KNRA 2Q7VA 3GYJA 3NK2X 3UOVA 3II4A 2Z5YA 3H8LA 3NYFA 1JNRA 3NIXA 1CF3A 1CJ2A 4TM0A 5DBJA 4BV6A 4RSLA 5IPYA 2GF3A 1K0LA 3FIMB 4DSHA 2WS3A 3PVCA 1PJ7A 4JN9A 5U63A 2WHDA 4DGKA 3KKJA 2EQ7A 3UOXA 3GRTA 1BGJA 4H4QA 2VQBA 3DA1A 1NAAA 3AEDA 1JOAA 1XANA 1JRZA 2GRTA 2GEWA 2WESA 2WDQA 2WBAA 4CRTA 4J2WA 1EL9A 1LVLA 1D7LA 1DOBA 1KNPA 3ATQA 3KVEA 1PJ5A 1H6VA 3AD7B 4YKGA 1UKVG 2AAQA 4X4JA 3WE0A 3EF6A 2XLUA 1EL8A 1PBBA 2GV8A 4J56A 2PHHA 1PXBA 4B66A 1S2QA 2XDOA 3S5WA 2QAEA 5U25A 2WPFA 1OJAA 2FJEA 3AD9B 2YAUA 4B1BA 4P9SA 3FPZA 1EBDA 3LOVA 4RG4A 4HA6A 1IUXA 4J36A 1M64A 2V6OA 1QO8A 3H8IA 2AQJA 5GSNA 3UKPA 1GSNA 4H2NA 2E1MA 3F8PA 1S2YA 1XDIA 1B37A 1JRYA 2BCGG 1F3PA 3NN0X 5EB4A 4GR1A 1D4CA 3DK9A 1YQZA 1GRAA 2C3CA 3EAOA 1FCDA 4AP1A 1K0IA 1PHHA 3LZWA 3JSKA 4JDRA 2R4JA 1EL5A 2FJDA 2C70A 4X9NA 1JNZA 2WDRA 4K7ZA 4ZCDA 3CGBA 2V61A 4H2RA 5EB5A 1BWCA 1F8WA 2R0PA 1IUTA 1GRGA 3COXA 4YXDA 1L0VA 3BNUA 1GRFA 4Y4MA 3I6DA 3AEGA 2R0GA 3QSSA 2H89A 1IJHA 3K7MX 2GVCA 5HHFA 1P2EA 1V59A 3AE5A 1E1KA 2WOWA 4A9WA 3M13A 4LU6A 3KPFA 2XVJA 4UDRA 1MO9A 3L8KA 5JCMA 1FECA 1NHPA 1PN0A 4LIIA 2X8GA 3HZLA 4CCRA 2YLTA 4CY6A 4OVIA 4YT0A 4EQXA 1O95A 2XCGA 3I3LA 3F8DA 2YR6A 2OA1A 4TM1A 4GDPA 4EMJA 4B69A 3DK4A 1FEAA 1PBDA 3CNSA 4IA5A 1M6IA 2YLWA 2JB3A 3S61A 5KVHA 3CNJA 3IWAA 4IA6A 3LB8A 3QFAA 3RP6A 4FDCB 5JCKA 2ZBWA 1S3BA 4C3XA 3ISHA 1H86A 1PXAA 2BABA 4LA1A 3F8RA 1DOCA 4O5QA 3QSMA 1N4UA 2B9WA 2C73A 2GQWA 4EQSA 2YG6A 3GSIA 4U8NA 5FS8A 3DJJA 3REDA 5KVIA 2VQ7A 4OPIA 4H2PA 3P9UA 4A65A 4Z25A 4C74A 2JK6A 4A79A 4UP3A 3IC9A 1MXTA 2GMHA 3GD4A 2XVFA 1B5QA 2F5ZA 4EIQA 4C5OA 1CC2A 1GALA 1GESA 1PBCA 1OJ9A 1F8SA 3DJEA 3LXDA 3NYEA 3CGDA 4BJZA 2A89A 2VRLA 1ZDLA 1DOEA
chains in the Genus database with same CATH superfamily
1DJNA 3UKKA 2AR8A 2R9ZA 1IUVA 1CC4A 3VCCA 2O56A 3T2YA 1BF3A 3OC4A 3NTDA 2W55A 4J1OA 2YVGA 1KD0A 4ICYA 3SN1A 4B64A 4M0XA 4U8JA 2C72A 4MJWA 1CBOA 3QVPA 3R25A 5IQ4A 1GETA 1NDAA 2OFJA 3KPKA 3DDMA 2BC0A 4B67A 3UOZA 5ER0A 2DKHA 2BXRA 2PGEA 4A3RA 1JRXA 3VCNA 1H84A 4KWSA 3T2KA 2J3NA 3P4PA 1NEKA 3CK5A 3AE9A 1ZKQA 1V97A 4GYPA 3K7TA 3TWAA 3FJ4A 3STPA 3ABVA 1ONFA 4DWDA 3KU9A 4U8OA 2C67A 4Z17A 4GDEA 4Z24A 3ATRA 3TJ4A 5BRTA 3VRDB 1PDHA 2XLTA 3NN6X 1OJTA 3TTEA 4G7FA 5KMQA 3LADA 4F4RA 4G74A 3UTGA 5BULA 3V3OA 3RNMA 3ALLA 2BS4A 3LJPA 3CAWA 2XH4A 3KD9A 1LV0A 1L9CA 2Y6QA 3SGLA 1ECQA 4OPCA 3D46A 4GRTA 2PP1A 4YSHA 5JCIA 2VVMA 2V5ZA 2PGWA 1YEYA 3CYJA 4Z26A 4EMIA 2BYBA 3AEFA 5FJPA 3B97A 4GIRA 3M12A 3GWFA 3R07C 1CJCA 4H4YA 3ENLA 2EQ9A 1TYTA 3I6TA 3A7RA 1E1LA 3HPFA 4ADWA 4J57A 3N4EA 4J31A 1ZX9A 2DW7A 3UTHA 1D5TA 2C7GA 2OLNA 4D04A 4H4RA 2Z5XA 3ZDNA 4AOSA 3FMWA 3UKHA 3P3BA 5HY5A 3V5CA 1LJ1A 3CPJG 2OAMA 2GQFA 3GWDA 3O0HA 2OX4A 3PG6A 3PWGA 4H4VA 1IUSA 1FL2A 4GFIA 3UP5A 4I59A 3AMZA 2PP3A 4D03A 3JZUA 3NVZB 2GR0A 2ARDA 4KX6A 3AD8B 2BACA 3CNPA 4YSYA 1YY5A 4G73A 2R0CA 4CBQA 4NTEA 1P48A 3T2ZA 2IVEA 1FO4A 3DGHA 5BUKA 2XLRA 4NEWA 3NK1X 3IJQA 3AE6A 3NT6A 1AOGA 5IQ1A 1BKHA 4RG3A 1GPEA 3LZXA 2Q0LA 4H4UA 5FS7A 4E8GA 1DJQA 2JKCA 1DXLA 4AT2A 2NPXA 1GOSA 3VC6A 2BS2A 3P4SA 4U2TA 4K2XA 2OALA 3AWIA 3PO7A 3H70A 1EC7A 1L9DA 1ELIA 3P1WA 3ALMA 5FJOA 3M0OA 1DNCA 1N4WA 5J7XA 4DHGA 2C64A 2OKTA 3QFBA 4K2SA 1MNSA 4OPTA 3OP2A 4XWRA 1KDGA 2XFOA 3CB3A 4N9XA 2QA1A 2EQ6A 1TDOA 1QLBA 1PBFA 1RSGA 2XVEA 1KKOA 2P8CA 2X50A 4TM4A 4C3YA 2XFQA 4A7AA 1JCTA 3URHA 3H8AA 4TLXA 4FX9A 4AT0A 2YLSA 3T31A 4H50A 1GERA 2W54A 5FJUA 4X9MA 4M6UA 2PTXA 2FKPA 1X2HA 3Q9TA 3MKCA 3ZVIA 3TW9A 3ICRA 3V4BA 3TWBA 5KWFA 3NK2X 3H8LA 1CF3A 2OQHA 1CJ2A 3UJ2A 4RSLA 5IPYA 1ELSA 4FP1A 3PVCA 2WHDA 3AEDA 1JRZA 4YWSA 4J2WA 1EL9A 1D7LA 1KNPA 1JPMA 3NFUA 3AD7B 1PBBA 2GV8A 2XDOA 4B1BA 3FPZA 1EBDA 4JN8A 1IUXA 4J36A 3NRZB 2E1MA 1D4CA 1YQZA 3EAOA 1PHHA 3SZWA 1RM6B 4JDRA 3FYYA 4X9NA 1JNZA 3DG3A 1PDYA 2R0PA 3COXA 2PPGA 1GRFA 3I6DA 3K1GA 2E5AA 1IJHA 3UJFA 5HHFA 4A9WA 2AL2B 5JCMA 2PTZA 1X2GA 3HZLA 4CY6A 4EQXA 1O95A 3CXBA 1JPDX 3SZFA 4TVWA 4TM1A 4B69A 1PBDA 1TE6A 3I4KA 1M6IA 3RR1A 5KVHA 3LB8A 3QFAA 3RP6A 5JCKA 1H86A 1PXAA 2BABA 2B9WA 7ENLA 2YG6A 3GSIA 3REDA 5ENLA 4H2PA 3MUCA 3PK7A 2GMHA 3GD4A 1B5QA 3I6EA 4C5OA 1GESA 1F8SA 3LXDA 3CGDA 2WDVA 4DNAA 2PA6A 3V5FA 1F6MA 1PJ6A 2XFNA 3NKSA 1CJ3A 1SJDA 1XS2A 1GXFA 1JROA 3G5RA 4U8IA 1TDNA 2HZGA 3PWIA 4IVOB 1E7PA 3GMCA 3UTEA 1E9IA 2GB0A 3BI4A 3UKFA 1ZOVA 3OW1A 4YSXA 4HCHA 3GYIA 1TZZA 3DIPA 2YWLA 1Q1RA 4Z44A 2QVHA 1BKWA 2TPRA 2Q0KA 4O5UA 3GD6A 5JCLA 1ONEA 1N61C 3TCSA 3SFEA 5BVAA 2CDUA 2YG7A 1JRPA 1FIQB 3T14A 1VQWA 3AYJA 3NYCA 3CIRA 2QJJA 3UKQA 2CULA 4HN8A 2YVJA 3ITJA 4A5LA 4B68A 3ALJA 1KF6A 2P0IA 4GISA 3QJ4A 1GRHA 3DK8A 1K4QA 4H4WA 1GV4A 2C66A 3SSZA 3AE4A 4K5SA 3A7UA 2A87A 3JW7A 5EBKA 3DFHA 2GGEA 1YQ4A 2ONEA 3N6JA 3GYXA 4E5TA 1H7XA 3PS9A 3UCCA 2QCUA 4GAPA 4XXGA 4YSZA 5TR3A 4EIPA 3GDPA 1P2HA 3MSYA 2YG5A 3FG2P 4EMWA 3NHOX 1TDEA 1GEUA 5C3JA 5KOWA 1RYIA 3SZCA 2A8XA 2BRYA 2YR4A 4FK1C 2QDDA 2B7RA 2C65A 1XHCA 1Q1WA 5U1OA 3B6DA 2JB2A 3AECA 3AB1A 2GDQA 1WYGA 5FS9A 3CPIG 1ZP0A 4Z2UA 1FFVC 3P93A 4II2A 4H1ZA 2I5QA 3G5QA 3R9UA 1L9EA 3AYLA 1TDKA 5JCNA 4I58A 3VA8A 4ZN0A 2XH2A 4BURA 2P8BA 2OQYA 3GO2A 1NHQA 2XLSA 3VFCA 4GYPC 3AE1A 1W4XA 3P4RA 6ENLA 2WPEA 4K8GA 2YLZA 4G8TA 3QKEA 3ADAB 3SN4A 1VG9A 2OPJA 1B4VA 3NZGA 4BJYA 4BK2A 4OPGA 4H4ZA 1NPXA 5BOEA 2QJMA 1MOKA 2PTYA 3VQRA 1L8PA 1P43A 1N4VA 4JNAA 1KFYA 3ETRB 5IDZA 1GNDA 2R45A 4B65A 3SM8A 1N1PA 2Q6UA 2O9ZA 2GR2A 4EM4A 4IV9A 3IHMA 2P88A 2PCEA 1EL7A 5FJRA 1H83A 3NO1A 2QDEA 3DH9A 3RP8A 2YM2A 2ACZA 5FMHA 2X8HA 2RGJA 4G6HA 2MUCA 4H2QA 1IUWA 4OPLA 2B9XA 3AE8A 1LQUA 4GCMA 1GRTA 3N6HA 3V3WA 3GMBA 1NELA 1TRBA 2Y6RA 2XLPA 2XVIA 3G5SA 2OLOA 3II4A 3ZLGA 1STZA 1K0LA 4DSHA 4JN9A 1XANA 3UJSA 1PJ5A 1TKKA 3WE0A 2PU1A 3EF6A 3T9PA 4J56A 3TQPA 2PHHA 1PXBA 4DX3A 4IHCA 3S5WA 5U25A 2FJEA 4RG4A 4HA6A 1QO8A 3H8IA 2AQJA 3SBFA 2AKZA 3S5SA 3F8PA 1S2YA 3NN0X 2BCGG 2AL1A 4GR1A 3DK9A 1GRAA 3LZWA 2R4JA 3RRAA 2WDRA 4K7ZA 3CGBA 1BWCA 3ZLFA 4DXKA 1IUTA 3BNUA 2BRAA 4Y4MA 3QSSA 1S7MA 3ZVHB 1P2EA 3AM9A 3AE5A 2WOWA 3OPSA 4UDRA 3KPFA 1MO9A 1NHPA 4LIIA 4CCRA 3T4WA 3B9JB 4OVIA 3DK4A 1FEAA 3CNSA 4IP5A 4IA5A 5JRBA 4IA6A 3DGBA 2ZBWA 3GY1A 3ISHA 4LA1A 3F8RA 2GQWA 3EUB3 5KVIA 2VQ7A 4Z25A 4C74A 4UP3A 2XVFA 2F5ZA 1GALA 4NWZA 1PBCA 4IZGA 3NYEA 4HNCA 4BJZA 2VRLA 2HNEA 5KOXA 1OJCA 4XWZA 1WUEA 1D7YA 1E6EA 3AXBA 4REKA 2GMJA 2XH7A 2JBVA 4MKSA 4APNA 1ZY8A 1PXCA 2XFUA 2VRMA 4E0VA 3SZ0A 3TOYA 4CCQA 3UCLA 2HXUA 3JVAA 3FCPA 3ZVHA 1YKJA 3DG6A 2C76A 5J60A 1TYPA 2X8CA 1MUCA 3KLJA 4JHMA 3GRSA 4J33A 4UDQA 1N60C 5EU9A 1NU5A 3GDNA 1KKRA 4Z1YA 1NENA 2QJNA 2ZZCA 4II3A 4H7UA 4ZCWA 2RGHA 1XPYA 1REOA 4AOXA 4YTPA 2VOUA 3NRNA 5M10A 2GR3A 3FXGA 4JY3A 1O94A 3E1TA 3HYXA 4KPRA 1EC8A 2YM1A 2VVLG 2OVLA 4YKFA 1ZK7A 5KRQA 3IJIA 4K5RA 2QGYA 4GF7A 3UCDA 5CKUA 1KN0A 4H2HA 3OZMA 2ZZ0A 3BI2A 2DKIA 4Y4LA 3N4FA 3V76A 1RVKA 5M0ZA 1Z6LA 2XYOA 3AEEA 3CXOA 1KSUA 2W0HA 2WOVA 3OZYA 1DODA 2WP6A 5FJTA 1BZLA 2QQ6A 3T37A 3R1ZA 4DN1A 4A6NB 2PU0A 2R4EA 1N5XA 2BS3A 3UOYA 1ZXIC 2PSNA 2XH0A 5HXIA 2ZZBA 5HYMA 2GAHB 1D4DA 3K7QX 1GRBA 3B3RA 4JQ9A 4KPLA 1FHVA 2VZ2A 4IL0A 1H2IA 2V60A 2NVKX 1MRAA 2YR5A 3VDGA 4TVYA 1IYXA 3CN8A 2V3BA 2AL2A 2JB1A 2CFYA 3Q45A 2XGZA 2JAEA 3T6CA 2WU5A 2IVDA 4YTNA 4AP3A 2GL5A 3DERA 2POZA 1VRQB 3V3NA 3FV9A 1HYUA 4A35A 1VDCA 4A99A 4GUVA 4Z43A 2WOIA 4IT1A 3FVDA 2GR1A 2OLAA 1PBEA 2B9YA 3DGZA 1KCZA 4GGHA 3KUMA 3L1RA 3D8XA 1LTXR 1XPQA 3FBSA 2GH5A 4Z2TA 2XVHA 3AEAA 4A6NA 4HPNA 3BHKA 4Z2RA 1BQGA 2GSHA 2APGA 1GTEA 3KA7A 4J3ZA 4NEVA 1EBHA 1E39A 3SFDA 4WX1A 1ZMDA 2C4CA 1X31B 2YLRA 3ZYXA 1B8SA 1FEBA 1VDVA 2R46A 2RDXA 4U2SA 5CQFA 2OO6A 3UTFA 2CHRA 3Q4DA 3NGCX 3OZ2A 1NHSA 1JU2A 1ZOYA 1O5WA 2HXTA 4U8MA 1OJDA 4ECHA 2WP5A 3DMEA 2X99A 1PS9A 3ICTA 3IK4A 4K22A 2EQ8A 4M52A 4PAAA 2GAGB 2BXSA 4HB9A 1Q9IA 2WP9A 1NG3A 3QSEA 3ICSA 1FFUC 1KSSA 1PDZA 4EWJA 1LQTA 2FJBA 3UJRA 5GRTA 3R10A 2PMQA 3D9XA 4BK3A 1VG0A 1YQ3A 3QLDA 2FJAA 4FK1A 3NS1B 4FI4A 3T0KA 1RP0A 4H4SA 3VRBA 3IHGA 1KNRA 2Z5YA 3NYFA 4TM0A 4BV6A 1R0MA 3FIMB 1PJ7A 3UOXA 3GRTA 4DYEA 3DA1A 1JOAA 2GEWA 2WDQA 4CRTA 1LVLA 3ATQA 3KVEA 1H6VA 1F9CA 2FYMA 1UKVG 2XLUA 1S2QA 2QAEA 3AD9B 2YAUA 3SJNA 3LOVA 3SY4A 5GSNA 3UKPA 1XDIA 4G9KA 3U4FA 2PTWA 4JN7A 4AP1A 2C3CA 1FCDA 1K0IA 3JSKA 3QN3A 1EL5A 2C70A 2V61A 4H2RA 4IL2A 1GRGA 1L0VA 2R0GA 3BJSA 1MDRA 3QTPA 3SXIA 2GVCA 1V59A 1E1KA 3L8KA 1FECA 1PN0A 3RGTA 3RO6A 2YLTA 4YT0A 2XCGA 3I3LA 2P3ZA 2OZTA 4GDPA 4EMJA 4HNLA 2YLWA 3SX6A 2JB3A 3S61A 4ROPA 1R6WA 3SN0A 4C3XA 1DOCA 3DESA 4O5QA 3P0WA 2C73A 3DJJA 4OPIA 3P9UA 4A65A 4HYRA 3IC9A 1MXTA 4H83A 4EIQA 4H19A 2A89A 3SQSA 3UJEA 1DOEA 3L5OA 1BGNA 2H88A 3NK0X 4K1WA 3IF9A 5L46A 3MWCA 3BNMA 2BCPA 2C75A 3RP7A 2BK5A 3SR6B 3AE2A 3EEZA 3RITA 2BC1A 5KMPA 1JEHA 4B63A 4EQRA 2GGJA 2XSXA 3NVVB 3P4QA 4UDPA 1F8RA 2RGOA 4OPDA 2CVJA 3AE3A 1CHUA 4MGGA 3CMMA 1H7WA 3CGCA 3ES8A 5KMSA 4H4TA 5LV9A 1SEZA 4ZCCA 1NG4A 3AYIA 1N5WC 4USRA 3UXLA 3UXKA 2VVLA 2IIDA 4CY8A 4IVMB 3T8QA 4CNKA 4KT2A 2OZ8A 3AN1A 1DTNA 4YWOA 2B76A 4GGBA 3H12A 2BK3A 4U8PA 2WETA 4J34A 3NNEA 2PODA 1JDFA 2RABA 1S3EA 2E3TA 3C96A 1Y56B 1D4EA 1CL0A 1K0JA 2C3DA 3GD3A 2E4GA 2I0ZA 1ZMCA 5EOWA 5FS6A 2GGHA 2QA2A 4E4UA 3RCYA 1E1MA 4ZOHB 3S47A 4TLZA 2YG3A 3Q6JA 2PS2A 2X3NA 3C4NA 4WCTA 2YVFA 1W6TA 4H4XA 4BK1A 4EQWA 1LPFA 3DEQA 4NNJA 2PP0A 2YLXA 3BOXA 3K30A 2W3SA 2E5VA 3R11A 2V3AA 1EBGA 4TM3A 3UKLA 4U2LA 2WQYA 3QVRA 3EPTA 3H4KA 5J04A 1GT8A 4PABA 3DJGX 1E1NA 4NTCA 1SB3B 3C4AA 3VR8A 3ZLHA 3UGVA 1CC6A 4C77A 4NTDA 2BA9A 2WEUA 3HW2A 4EM3A 4GAVA 3NG7X 1TDFA 3HYVA 2ZC8A 5C2TA 4OCGA 3EANA 1H82A 1Y56A 1FOHA 4ENLA 4JNQA 3NLCA 1EC9A 3BHFA 2UZZA 4H4PA 3CTYA 2PYXA 3MY9A 3NVYB 3TJIA 1NHRA 2BK4A 2AKMA 4HCDA 4K8DA 5G5GB 3AEBA 3R0KA 2WPCA 2WU2A 1MDLA 4X2PA 1SJCA 1T3QC 3D47A 4YTMA 2DW6A 4G6GA 3NTAA 3DG7A 4Y4NA 3D1CA 3BSMA 4GMEA 4OPUA 3CPHG 4CNJA 1IUUA 2FBWA 3A7AA 4USQA 3AE7A 4KEMA 3QPEA 1GREA 4NZHA 2ZADA 5KXJA 3VR9A 5KMRA 3R0UA 3DJDA 3UP4A 1CJ4A 2YQUA 4DSGA 1COYA 2TMDA 3MZNA 4IP4A 3SQPA 1H81A 1WUFA 1GTHA 3BI5A 3CNDA 1Y0PA 3HYWA 2B7SA 5KNLA 3RHAA 4HCLA 4U8KA 2YG4A 3CGEA 2HQMA 3CNTA 3UKAA 3VRAA 3PFRA 4JY2A 2OZ3A 1QJDA 2GGIA 3NH3X 4U8LA 2Q7VA 3GYJA 3UOVA 1JNRA 3NIXA 5DBJA 2GF3A 2WS3A 5U63A 4DGKA 3KKJA 2EQ7A 4H4QA 1BGJA 2VQBA 1NAAA 2WESA 2GRTA 2WBAA 1DOBA 4YKGA 2AAQA 4E4FA 4X4JA 3SYIA 1EL8A 2MNRA 4B66A 5G5HB 2WPFA 1OJAA 1VQZA 3GC2A 4P9SA 1M64A 2V6OA 3OTRA 1GSNA 4H2NA 5BOFA 3CT2A 3EKGA 1B37A 1JRYA 1F3PA 5EB4A 1SJBA 3DFYA 2FJDA 3THUA 4A6GA 1SJAA 4ZCDA 5EB5A 1F8WA 4YXDA 3H7VA 2W3RA 3AEGA 2H89A 3VC5A 3NVWB 3K7MX 3U9IA 3M13A 4LU6A 2XVJA 2X8GA 3MQTA 1FHUA 3F8DA 2YR6A 2OA1A 1N62C 1N63C 4E6MA 3CNJA 3IWAA 4ZA0A 3IJLA 1OEPA 4FDCB 1S3BA 3QSMA 1N4UA 2GGGA 3NXLA 4EQSA 4U8NA 5FS8A 3HRDC 2JK6A 4A79A 4MMWA 1CC2A 3ES7A 1OJ9A 3DJEA 2OG9A 2NQLA 1ZDLA 2XFPA
chains in the Genus database with same CATH topology
3L5OA 1BGNA 1DJNA 1OJCA 5KOXA 4XWZA 2H88A 3UKKA 4DNAA 3NK0X 1F6MA 1PJ6A 3IF9A 5L46A 2AR8A 2R9ZA 1D7YA 1E6EA 2XFNA 1IUVA 3AXBA 1CC4A 3NKSA 1CJ3A 3BNMA 2BCPA 3T2YA 1GXFA 1BF3A 2C75A 3G5RA 3OC4A 4REKA 3NTDA 4U8IA 1TDNA 3RP7A 2YVGA 2GMJA 4ICYA 2JBVA 1E7PA 4APNA 3GMCA 4IVOB 3UTEA 1ZY8A 1PXCA 2BK5A 2GB0A 2XFUA 3AE2A 3BI4A 4U8JA 3UKFA 4B64A 1ZOVA 2C72A 4YSXA 4MJWA 2VRMA 1CBOA 4E0VA 3QVPA 3SZ0A 2BC1A 3GYIA 5IQ4A 5KMPA 1JEHA 1GETA 1NDAA 4B63A 4EQRA 3KPKA 4CCQA 2YWLA 1Q1RA 3P4QA 4Z44A 3UCLA 4UDPA 1F8RA 1BKWA 2RGOA 4OPDA 2BC0A 2CVJA 1YKJA 4B67A 3AE3A 3UOZA 1CHUA 2TPRA 3CMMA 2Q0KA 5ER0A 1H7WA 3CGCA 2DKHA 4O5UA 5KMSA 5JCLA 4H4TA 2BXRA 2C76A 5J60A 1TYPA 5LV9A 1SEZA 4ZCCA 2X8CA 1JRXA 3KLJA 1NG4A 3GRSA 4J33A 4UDQA 1H84A 3SFEA 5BVAA 2CDUA 3T2KA 2J3NA 3P4PA 2YG7A 1NEKA 3AE9A 1ZKQA 3GDNA 3AYIA 3K7TA 1NENA 4USRA 3T14A 2ZZCA 4II3A 4H7UA 3ABVA 1VQWA 2VVLA 2IIDA 3AYJA 4CY8A 2RGHA 3NYCA 3CIRA 1ONFA 1REOA 3KU9A 4IVMB 4U8OA 4CNKA 4AOXA 2C67A 4YTPA 4YWOA 2VOUA 3NRNA 4GDEA 2GR3A 4Z24A 3UKQA 5M10A 2B76A 3ATRA 2CULA 2YVJA 3ITJA 1PDHA 3VRDB 5BRTA 4A5LA 4B68A 3ALJA 2XLTA 3NN6X 1OJTA 4JY3A 2BK3A 5KMQA 1KF6A 3LADA 1O94A 4G74A 3E1TA 3UTGA 3HYXA 4U8PA 4KPRA 2WETA 2YM1A 5BULA 3V3OA 4J34A 3RNMA 1GRHA 2VVLG 3QJ4A 3ALLA 3NNEA 2BS4A 3DK8A 2RABA 1K4QA 4YKFA 1ZK7A 4H4WA 1S3EA 5KRQA 1GV4A 2C66A 3LJPA 3C96A 4K5RA 3AE4A 4GF7A 4K5SA 1Y56B 5CKUA 2A87A 1D4EA 1CL0A 1KN0A 3KD9A 1LV0A 1K0JA 2ZZ0A 2C3DA 3GD3A 3BI2A 1L9CA 2E4GA 2I0ZA 1ZMCA 5EOWA 2Y6QA 2DKIA 3SGLA 4Y4LA 5EBKA 5FS6A 4OPCA 4GRTA 4YSHA 2QA2A 5JCIA 3V76A 2VVMA 2V5ZA 1YQ4A 5M0ZA 1E1MA 1Z6LA 2XYOA 3AEEA 3GYXA 4Z26A 3PS9A 1H7XA 4TLZA 1KSUA 2W0HA 2WOVA 4EMIA 2QCUA 2BYBA 2YG3A 1DODA 2WP6A 3Q6JA 2X3NA 3AEFA 3C4NA 4GAPA 4XXGA 1BZLA 4WCTA 5TR3A 2YVFA 3VQRA 4EIPA 4YSZA 4H4XA 4BK1A 4EQWA 3GDPA 1LPFA 3GWFA 3M12A 1P2HA 1CJCA 4H4YA 3T37A 2EQ9A 1TYTA 4NNJA 2YLXA 1E1LA 2YG5A 3FG2P 4EMWA 3K30A 4A6NB 3NHOX 1TDEA 1GEUA 2E5VA 5C3JA 4ADWA 5KOWA 1RYIA 3SZCA 2A8XA 2BRYA 2V3AA 2YR4A 2R4EA 2BS3A 4J57A 4FK1C 4TM3A 3UOYA 3UKLA 4J31A 4U2LA 1ZX9A 2B7RA 2C65A 2WQYA 3QVRA 3UTHA 1XHCA 3EPTA 1D5TA 5HXIA 2ZZBA 1Q1WA 5HYMA 2GAHB 3H4KA 1D4DA 2C7GA 5U1OA 2OLNA 4D04A 3K7QX 4H4RA 1GT8A 1GRBA 2Z5XA 4JQ9A 3B3RA 3ZDNA 2JB2A 3B6DA 3AECA 2VZ2A 3AB1A 3FMWA 3UKHA 4AOSA 5HY5A 1LJ1A 5FS9A 3CPJG 2OAMA 4PABA 2GQFA 3GWDA 1H2IA 3DJGX 2V60A 2NVKX 3O0HA 3CPIG 1ZP0A 1E1NA 2YR5A 3PG6A 4NTCA 3C4AA 4H4VA 3VR8A 1IUSA 1FL2A 3CN8A 2V3BA 1CC6A 3UP5A 4I59A 4C77A 4NTDA 4Z2UA 2BA9A 2JB1A 2WEUA 2CFYA 4EM3A 4GAVA 3NG7X 1TDFA 4II2A 4D03A 2GR0A 3HYVA 2ARDA 3G5QA 3R9UA 1L9EA 2JAEA 4KX6A 3AYLA 3AD8B 5C2TA 1TDKA 2BACA 4OCGA 3EANA 1H82A 2WU5A 1Y56A 5JCNA 3CNPA 4I58A 2IVDA 4YSYA 4YTNA 4AP3A 1FOHA 4ZN0A 4JNQA 3NLCA 4BURA 1YY5A 4G73A 1VRQB 3BHFA 2R0CA 2UZZA 3V3NA 4H4PA 1HYUA 4CBQA 1NHQA 2XLSA 1VDCA 3CTYA 4NTEA 3AE1A 2PYXA 4A99A 4GUVA 3T2ZA 4Z43A 2WOIA 2IVEA 2GR1A 1PBEA 1NHRA 1W4XA 2B9YA 2BK4A 3DGHA 3DGZA 3P4RA 5BUKA 2XLRA 4NEWA 3NK1X 2WPEA 3AE6A 3NT6A 3L1RA 1AOGA 5IQ1A 3D8XA 1LTXR 4K8DA 4RG3A 1XPQA 1GPEA 2YLZA 3FBSA 2XFPA 3LZXA 2GH5A 2Q0LA 3ADAB 4H4UA 5FS7A 1DJQA 4Z2TA 2XVHA 3AEBA 2JKCA 1DXLA 1VG9A 3AEAA 4AT2A 2NPXA 1GOSA 4A6NA 1B4VA 2BS2A 3P4SA 2WPCA 4BJYA 2WU2A 4BK2A 4OPGA 3BHKA 4U2TA 4Z2RA 4K2XA 2APGA 2OALA 3AWIA 4H4ZA 1NPXA 1GTEA 3PO7A 3KA7A 1MOKA 4NEVA 1L9DA 1ELIA 3P1WA 4YTMA 3ALMA 1E39A 3M0OA 1DNCA 1N4WA 4JNAA 1N4VA 3SFDA 4WX1A 5J7XA 1ZMDA 4G6GA 1KFYA 3NTAA 4Y4NA 2C4CA 1X31B 2YLRA 3D1CA 3ZYXA 4OPUA 1B8SA 2C64A 1FEBA 3CPHG 3QFBA 1GNDA 2R46A 2R45A 4OPTA 4B65A 4CNJA 1IUUA 3SM8A 1N1PA 4U2SA 5CQFA 2Q6UA 4XWRA 2FBWA 3UTFA 2O9ZA 3NGCX 2GR2A 3OZ2A 4USQA 1NHSA 1KDGA 2XFOA 1JU2A 3AE7A 4EM4A 1O5WA 1ZOYA 1GREA 2QA1A 3IHMA 4IV9A 4N9XA 2EQ6A 1TDOA 4NZHA 1QLBA 1EL7A 1H83A 5KXJA 3VR9A 5KMRA 1PBFA 1RSGA 2XVEA 4U8MA 1OJDA 3DJDA 4ECHA 3DH9A 3RP8A 3UP4A 2WP5A 2YM2A 2X50A 1CJ4A 4TM4A 4C3YA 2XFQA 2YQUA 4A7AA 2ACZA 3URHA 4TLXA 4DSGA 5FMHA 2X8HA 2RGJA 3DMEA 2X99A 4FX9A 1COYA 4G6HA 1PS9A 4AT0A 3ICTA 2TMDA 2YLSA 4K22A 3T31A 4H50A 1GERA 2EQ8A 4H2QA 1IUWA 4OPLA 4M52A 2B9XA 3AE8A 4PAAA 3SQPA 2GAGB 2WDVA 1H81A 2BXSA 1LQUA 4HB9A 1Q9IA 1GTHA 2WP9A 3BI5A 1NG3A 1Y0PA 3CNDA 3ICSA 3QSEA 4GCMA 4X9MA 1GRTA 3HYWA 2B7SA 1KSSA 1LQTA 5KNLA 3GMBA 2FJBA 3RHAA 5GRTA 4U8KA 3Q9TA 2YG4A 3CGEA 1TRBA 3D9XA 4BK3A 2Y6RA 1VG0A 1YQ3A 2HQMA 2XLPA 2FJAA 2XVIA 4FK1A 3CNTA 3UKAA 3T0KA 3VRAA 4JY2A 1QJDA 3G5SA 1RP0A 3ICRA 2OLOA 4H4SA 3NH3X 4U8LA 5KWFA 3VRBA 3IHGA 1KNRA 2Q7VA 3GYJA 3NK2X 3UOVA 3II4A 2Z5YA 3H8LA 3NYFA 1JNRA 3NIXA 1CF3A 1CJ2A 4TM0A 5DBJA 4BV6A 4RSLA 5IPYA 2GF3A 1K0LA 3FIMB 4DSHA 2WS3A 3PVCA 1PJ7A 4JN9A 5U63A 2WHDA 4DGKA 3KKJA 2EQ7A 3UOXA 3GRTA 1BGJA 4H4QA 2VQBA 3DA1A 1NAAA 3AEDA 1JOAA 1XANA 1JRZA 2GRTA 2GEWA 2WESA 2WDQA 2WBAA 4CRTA 4J2WA 1EL9A 1LVLA 1D7LA 1DOBA 1KNPA 3ATQA 3KVEA 1PJ5A 1H6VA 3AD7B 4YKGA 1UKVG 2AAQA 4X4JA 3WE0A 3SYIA 3EF6A 2XLUA 1EL8A 1PBBA 2GV8A 4J56A 2PHHA 1PXBA 4B66A 1S2QA 2XDOA 3S5WA 2QAEA 5U25A 2WPFA 1OJAA 2FJEA 3AD9B 2YAUA 4B1BA 4P9SA 3FPZA 1EBDA 3LOVA 4RG4A 4HA6A 3SY4A 1IUXA 4J36A 1M64A 2V6OA 1QO8A 3H8IA 2AQJA 5GSNA 3UKPA 1GSNA 4H2NA 2E1MA 3F8PA 1S2YA 1XDIA 1B37A 1JRYA 2BCGG 1F3PA 3NN0X 4G9KA 5EB4A 4GR1A 1D4CA 3DK9A 1YQZA 1GRAA 2C3CA 3EAOA 1FCDA 4AP1A 1K0IA 1PHHA 3LZWA 3SZWA 3JSKA 4JDRA 2R4JA 1EL5A 2FJDA 2C70A 4X9NA 1JNZA 2WDRA 4K7ZA 4ZCDA 3CGBA 2V61A 4H2RA 5EB5A 1BWCA 1F8WA 2R0PA 1IUTA 1GRGA 3COXA 4YXDA 1L0VA 3BNUA 2BRAA 1GRFA 4Y4MA 3I6DA 3AEGA 2R0GA 3QSSA 2H89A 1S7MA 1IJHA 3K7MX 3SXIA 2GVCA 5HHFA 1P2EA 1V59A 3AE5A 1E1KA 2WOWA 4A9WA 3M13A 4LU6A 3KPFA 2XVJA 4UDRA 1MO9A 3L8KA 5JCMA 1FECA 1NHPA 1PN0A 4LIIA 2X8GA 3HZLA 4CCRA 2YLTA 4CY6A 4OVIA 4YT0A 4EQXA 1O95A 2XCGA 3I3LA 3F8DA 2YR6A 3SZFA 2OA1A 4TM1A 4GDPA 4EMJA 4B69A 3DK4A 1FEAA 1PBDA 3CNSA 4IA5A 1M6IA 2YLWA 3SX6A 2JB3A 3S61A 5KVHA 3CNJA 5JRBA 3IWAA 4IA6A 3LB8A 3QFAA 3RP6A 4FDCB 5JCKA 2ZBWA 1S3BA 4C3XA 3ISHA 1H86A 1PXAA 2BABA 4LA1A 3F8RA 1DOCA 4O5QA 3QSMA 1N4UA 2B9WA 2C73A 2GQWA 4EQSA 2YG6A 3GSIA 4U8NA 5FS8A 3DJJA 3REDA 5KVIA 2VQ7A 4OPIA 4H2PA 3P9UA 4A65A 4Z25A 4C74A 2JK6A 4A79A 4UP3A 3IC9A 1MXTA 2GMHA 3GD4A 2XVFA 1B5QA 2F5ZA 4EIQA 4C5OA 1CC2A 1GALA 4NWZA 1GESA 1PBCA 1OJ9A 1F8SA 3DJEA 3LXDA 3NYEA 3CGDA 4BJZA 2A89A 2VRLA 1ZDLA 1DOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGN A;  1DJN A;  1OJC A;  5KOX A;  4XWZ A;  2H88 A;  3UKK A;  4DNA A;  3NK0 X;  1F6M A;  1PJ6 A;  3IF9 A;  5L46 A;  2AR8 A;  2R9Z A;  1D7Y A;  1E6E A;  2XFN A;  1IUV A;  3AXB A;  1CC4 A;  3NKS A;  1CJ3 A;  3BNM A;  2BCP A;  1GXF A;  1BF3 A;  2C75 A;  3G5R A;  3OC4 A;  4REK A;  3NTD A;  4U8I A;  1TDN A;  3RP7 A;  2YVG A;  2GMJ A;  4ICY A;  2JBV A;  1E7P A;  4APN A;  3GMC A;  4IVO B;  3UTE A;  1ZY8 A;  1PXC A;  2BK5 A;  2GB0 A;  2XFU A;  3AE2 A;  3BI4 A;  4U8J A;  3UKF A;  4B64 A;  1ZOV A;  2C72 A;  4YSX A;  4MJW A;  2VRM A;  1CBO A;  4E0V A;  3QVP A;  2BC1 A;  3GYI A;  5IQ4 A;  1JEH A;  1GET A;  1NDA A;  4B63 A;  4EQR A;  4CCQ A;  2YWL A;  1Q1R A;  3P4Q A;  4Z44 A;  3UCL A;  4UDP A;  1F8R A;  1BKW A;  2RGO A;  4OPD A;  2BC0 A;  2CVJ A;  1YKJ A;  4B67 A;  3AE3 A;  3UOZ A;  1CHU A;  2TPR A;  2Q0K A;  5ER0 A;  1H7W A;  3CGC A;  2DKH A;  4O5U A;  5JCL A;  4H4T A;  2BXR A;  2C76 A;  5J60 A;  1TYP A;  5LV9 A;  1SEZ A;  4ZCC A;  2X8C A;  1JRX A;  3KLJ A;  1NG4 A;  3GRS A;  4J33 A;  4UDQ A;  1H84 A;  3SFE A;  5BVA A;  2CDU A;  2J3N A;  3P4P A;  2YG7 A;  1NEK A;  3AE9 A;  1ZKQ A;  3GDN A;  3AYI A;  3K7T A;  1NEN A;  4USR A;  2ZZC A;  4H7U A;  3ABV A;  1VQW A;  2VVL A;  2IID A;  3AYJ A;  4CY8 A;  2RGH A;  3NYC A;  3CIR A;  1ONF A;  1REO A;  3KU9 A;  4IVM B;  4U8O A;  4CNK A;  4AOX A;  2C67 A;  4YTP A;  4YWO A;  2VOU A;  3NRN A;  4GDE A;  2GR3 A;  4Z24 A;  3UKQ A;  5M10 A;  2B76 A;  3ATR A;  2CUL A;  2YVJ A;  3ITJ A;  1PDH A;  3VRD B;  5BRT A;  4A5L A;  4B68 A;  3ALJ A;  2XLT A;  3NN6 X;  1OJT A;  4JY3 A;  2BK3 A;  1KF6 A;  3LAD A;  1O94 A;  3UTG A;  3E1T A;  4U8P A;  4KPR A;  2WET A;  2YM1 A;  5BUL A;  3V3O A;  4J34 A;  3RNM A;  1GRH A;  2VVL G;  3QJ4 A;  3ALL A;  3NNE A;  2BS4 A;  3DK8 A;  2RAB A;  1K4Q A;  4YKF A;  1ZK7 A;  4H4W A;  1S3E A;  5KRQ A;  1GV4 A;  2C66 A;  3LJP A;  3C96 A;  4K5R A;  3AE4 A;  4GF7 A;  4K5S A;  1Y56 B;  5CKU A;  2A87 A;  1D4E A;  1CL0 A;  3KD9 A;  1LV0 A;  1K0J A;  2ZZ0 A;  2C3D A;  3GD3 A;  3BI2 A;  1L9C A;  2E4G A;  2I0Z A;  1ZMC A;  5EOW A;  2Y6Q A;  2DKI A;  3SGL A;  4Y4L A;  5EBK A;  5FS6 A;  4OPC A;  4GRT A;  4YSH A;  2QA2 A;  5JCI A;  3V76 A;  2VVM A;  2V5Z A;  1YQ4 A;  5M0Z A;  1E1M A;  1Z6L A;  2XYO A;  3AEE A;  4Z26 A;  3PS9 A;  1H7X A;  4TLZ A;  1KSU A;  2W0H A;  2WOV A;  4EMI A;  2QCU A;  2BYB A;  2YG3 A;  1DOD A;  2WP6 A;  3Q6J A;  2X3N A;  3AEF A;  3C4N A;  4XXG A;  1BZL A;  4WCT A;  5TR3 A;  2YVF A;  4YSZ A;  4EIP A;  4H4X A;  4BK1 A;  4EQW A;  3GDP A;  1LPF A;  3GWF A;  3M12 A;  1P2H A;  1CJC A;  4H4Y A;  3T37 A;  2EQ9 A;  1TYT A;  2YLX A;  1E1L A;  2YG5 A;  3FG2 P;  4EMW A;  3K30 A;  4A6N B;  3NHO X;  1TDE A;  1GEU A;  2E5V A;  5C3J A;  4ADW A;  5KOW A;  1RYI A;  2A8X A;  2V3A A;  2YR4 A;  2R4E A;  2BS3 A;  4J57 A;  4FK1 C;  4TM3 A;  3UOY A;  3UKL A;  4J31 A;  4U2L A;  1ZX9 A;  2B7R A;  2C65 A;  2WQY A;  3QVR A;  3UTH A;  1XHC A;  3EPT A;  1D5T A;  5HXI A;  2ZZB A;  1Q1W A;  5HYM A;  2GAH B;  3H4K A;  1D4D A;  2C7G A;  5U1O A;  2OLN A;  4D04 A;  3K7Q X;  4H4R A;  1GT8 A;  1GRB A;  2Z5X A;  4JQ9 A;  3B3R A;  3ZDN A;  2JB2 A;  3B6D A;  3AEC A;  2VZ2 A;  3AB1 A;  3FMW A;  3UKH A;  4AOS A;  5HY5 A;  1LJ1 A;  5FS9 A;  3CPJ G;  2OAM A;  4PAB A;  2GQF A;  3GWD A;  3DJG X;  2V60 A;  2NVK X;  3O0H A;  3CPI G;  1ZP0 A;  1E1N A;  2YR5 A;  4NTC A;  3C4A A;  4H4V A;  3VR8 A;  1IUS A;  1FL2 A;  3CN8 A;  2V3B A;  1CC6 A;  3UP5 A;  4I59 A;  4C77 A;  4NTD A;  4Z2U A;  2BA9 A;  2JB1 A;  2WEU A;  2CFY A;  4EM3 A;  3NG7 X;  1TDF A;  4D03 A;  2GR0 A;  2ARD A;  3G5Q A;  3R9U A;  1L9E A;  2JAE A;  4KX6 A;  3AYL A;  3AD8 B;  5C2T A;  1TDK A;  2BAC A;  4OCG A;  3EAN A;  1H82 A;  2WU5 A;  1Y56 A;  5JCN A;  3CNP A;  4I58 A;  2IVD A;  4YSY A;  4YTN A;  4AP3 A;  1FOH A;  4ZN0 A;  4JNQ A;  3NLC A;  4BUR A;  1YY5 A;  1VRQ B;  3BHF A;  2R0C A;  2UZZ A;  3V3N A;  4H4P A;  1HYU A;  4CBQ A;  1NHQ A;  2XLS A;  1VDC A;  3CTY A;  4NTE A;  3AE1 A;  2PYX A;  4A99 A;  4GUV A;  4Z43 A;  2WOI A;  2IVE A;  2GR1 A;  1PBE A;  1NHR A;  1W4X A;  2B9Y A;  2BK4 A;  3DGH A;  3DGZ A;  3P4R A;  5BUK A;  2XLR A;  4NEW A;  3NK1 X;  2WPE A;  3AE6 A;  3NT6 A;  3L1R A;  1AOG A;  5IQ1 A;  3D8X A;  1LTX R;  4K8D A;  4RG3 A;  1XPQ A;  1GPE A;  2YLZ A;  3FBS A;  2XFP A;  3LZX A;  2GH5 A;  2Q0L A;  3ADA B;  4H4U A;  5FS7 A;  1DJQ A;  4Z2T A;  2XVH A;  3AEB A;  2JKC A;  1DXL A;  1VG9 A;  3AEA A;  4AT2 A;  2NPX A;  1GOS A;  4A6N A;  1B4V A;  2BS2 A;  3P4S A;  2WPC A;  4BJY A;  2WU2 A;  4BK2 A;  4OPG A;  3BHK A;  4U2T A;  4Z2R A;  4K2X A;  2APG A;  2OAL A;  3AWI A;  4H4Z A;  1NPX A;  1GTE A;  3PO7 A;  3KA7 A;  1MOK A;  4NEV A;  1L9D A;  1ELI A;  3P1W A;  4YTM A;  3ALM A;  1E39 A;  3M0O A;  1DNC A;  1N4W A;  4JNA A;  1N4V A;  3SFD A;  4WX1 A;  5J7X A;  1ZMD A;  3VQR A;  1KFY A;  3NTA A;  4Y4N A;  2YLR A;  1X31 B;  3D1C A;  3ZYX A;  4OPU A;  1B8S A;  2C64 A;  1FEB A;  3CPH G;  3QFB A;  1GND A;  2R46 A;  2R45 A;  4OPT A;  4B65 A;  4CNJ A;  1IUU A;  3SM8 A;  1N1P A;  4U2S A;  5CQF A;  2Q6U A;  4XWR A;  2FBW A;  3UTF A;  2O9Z A;  3NGC X;  2GR2 A;  3OZ2 A;  4USQ A;  1NHS A;  1KDG A;  2XFO A;  1JU2 A;  3AE7 A;  4EM4 A;  1O5W A;  1ZOY A;  1GRE A;  2QA1 A;  3IHM A;  4IV9 A;  4N9X A;  2EQ6 A;  1TDO A;  4NZH A;  1QLB A;  1EL7 A;  1H83 A;  5KXJ A;  3VR9 A;  1PBF A;  1RSG A;  2XVE A;  4U8M A;  1OJD A;  3DJD A;  4ECH A;  3DH9 A;  3RP8 A;  3UP4 A;  2WP5 A;  2YM2 A;  2X50 A;  1CJ4 A;  4TM4 A;  4C3Y A;  2XFQ A;  2YQU A;  4A7A A;  2ACZ A;  3URH A;  4TLX A;  4DSG A;  5FMH A;  2X8H A;  2RGJ A;  3DME A;  2X99 A;  4FX9 A;  1COY A;  4AT0 A;  1PS9 A;  3ICT A;  2TMD A;  2YLS A;  4K22 A;  4H50 A;  1GER A;  2EQ8 A;  4H2Q A;  1IUW A;  4OPL A;  4M52 A;  2B9X A;  3AE8 A;  4PAA A;  3SQP A;  2GAG B;  2WDV A;  1H81 A;  2BXS A;  1LQU A;  4HB9 A;  1Q9I A;  1GTH A;  2WP9 A;  3BI5 A;  1NG3 A;  1Y0P A;  3CND A;  3ICS A;  3QSE A;  4GCM A;  4X9M A;  1GRT A;  2B7S A;  1KSS A;  1LQT A;  3GMB A;  2FJB A;  3RHA A;  5GRT A;  4U8K A;  3Q9T A;  2YG4 A;  3CGE A;  1TRB A;  4BK3 A;  2Y6R A;  1VG0 A;  1YQ3 A;  2HQM A;  2XLP A;  2FJA A;  2XVI A;  4FK1 A;  3CNT A;  3UKA A;  3VRA A;  4JY2 A;  1QJD A;  3G5S A;  1RP0 A;  3ICR A;  2OLO A;  4H4S A;  3NH3 X;  4U8L A;  5KWF A;  3VRB A;  3IHG A;  1KNR A;  2Q7V A;  3GYJ A;  3NK2 X;  3UOV A;  3II4 A;  2Z5Y A;  3H8L A;  3NYF A;  1JNR A;  3NIX A;  1CF3 A;  1CJ2 A;  4TM0 A;  5DBJ A;  4BV6 A;  4RSL A;  5IPY A;  2GF3 A;  1K0L A;  3FIM B;  4DSH A;  2WS3 A;  3PVC A;  1PJ7 A;  4JN9 A;  5U63 A;  2WHD A;  4DGK A;  3KKJ A;  2EQ7 A;  3UOX A;  3GRT A;  1BGJ A;  4H4Q A;  2VQB A;  3DA1 A;  1NAA A;  3AED A;  1JOA A;  1XAN A;  1JRZ A;  2GRT A;  2GEW A;  2WES A;  2WDQ A;  2WBA A;  4CRT A;  4J2W A;  1EL9 A;  1LVL A;  1D7L A;  1DOB A;  1KNP A;  3ATQ A;  3KVE A;  1PJ5 A;  1H6V A;  3AD7 B;  4YKG A;  1UKV G;  2AAQ A;  4X4J A;  3WE0 A;  3EF6 A;  2XLU A;  1EL8 A;  1PBB A;  2GV8 A;  4J56 A;  2PHH A;  1PXB A;  4B66 A;  1S2Q A;  2XDO A;  3S5W A;  2QAE A;  5U25 A;  2WPF A;  1OJA A;  2FJE A;  3AD9 B;  2YAU A;  4B1B A;  4P9S A;  3FPZ A;  1EBD A;  3LOV A;  4RG4 A;  4HA6 A;  1IUX A;  4J36 A;  1M64 A;  2V6O A;  1QO8 A;  3H8I A;  2AQJ A;  5GSN A;  3UKP A;  1GSN A;  4H2N A;  2E1M A;  3F8P A;  1S2Y A;  1XDI A;  1B37 A;  1JRY A;  2BCG G;  1F3P A;  3NN0 X;  5EB4 A;  4GR1 A;  1D4C A;  3DK9 A;  1YQZ A;  1GRA A;  2C3C A;  3EAO A;  1FCD A;  4AP1 A;  1K0I A;  1PHH A;  3LZW A;  3JSK A;  4JDR A;  2R4J A;  1EL5 A;  2FJD A;  2C70 A;  4X9N A;  1JNZ A;  2WDR A;  4K7Z A;  4ZCD A;  3CGB A;  2V61 A;  4H2R A;  5EB5 A;  1BWC A;  1F8W A;  2R0P A;  1IUT A;  1GRG A;  3COX A;  4YXD A;  1L0V A;  3BNU A;  1GRF A;  4Y4M A;  3I6D A;  3AEG A;  2R0G A;  3QSS A;  2H89 A;  1IJH A;  3K7M X;  2GVC A;  5HHF A;  1P2E A;  1V59 A;  3AE5 A;  1E1K A;  2WOW A;  4A9W A;  3M13 A;  4LU6 A;  3KPF A;  2XVJ A;  4UDR A;  1MO9 A;  3L8K A;  5JCM A;  1FEC A;  1NHP A;  1PN0 A;  4LII A;  2X8G A;  3HZL A;  4CCR A;  2YLT A;  4CY6 A;  4OVI A;  4YT0 A;  4EQX A;  1O95 A;  2XCG A;  3I3L A;  3F8D A;  2YR6 A;  2OA1 A;  4TM1 A;  4GDP A;  4EMJ A;  4B69 A;  3DK4 A;  1FEA A;  1PBD A;  3CNS A;  4IA5 A;  1M6I A;  2YLW A;  2JB3 A;  3S61 A;  5KVH A;  3CNJ A;  3IWA A;  4IA6 A;  3LB8 A;  3QFA A;  3RP6 A;  4FDC B;  5JCK A;  2ZBW A;  1S3B A;  4C3X A;  3ISH A;  1H86 A;  1PXA A;  2BAB A;  4LA1 A;  3F8R A;  1DOC A;  4O5Q A;  3QSM A;  1N4U A;  2B9W A;  2C73 A;  2GQW A;  4EQS A;  2YG6 A;  3GSI A;  4U8N A;  5FS8 A;  3DJJ A;  3RED A;  5KVI A;  2VQ7 A;  4OPI A;  4H2P A;  3P9U A;  4A65 A;  4Z25 A;  4C74 A;  2JK6 A;  4A79 A;  4UP3 A;  3IC9 A;  1MXT A;  2GMH A;  3GD4 A;  2XVF A;  1B5Q A;  2F5Z A;  4EIQ A;  4C5O A;  1CC2 A;  1GAL A;  1GES A;  1PBC A;  1OJ9 A;  1F8S A;  3DJE A;  3LXD A;  3NYE A;  3CGD A;  4BJZ A;  2A89 A;  2VRL A;  1ZDL A;  1DOE A; 
#chains in the Genus database with same CATH topology
 1DJN A;  3UKK A;  2AR8 A;  2R9Z A;  1IUV A;  1CC4 A;  3VCC A;  2O56 A;  3T2Y A;  1BF3 A;  3OC4 A;  3NTD A;  2W55 A;  4J1O A;  2YVG A;  1KD0 A;  4ICY A;  3SN1 A;  4B64 A;  4M0X A;  4U8J A;  2C72 A;  4MJW A;  1CBO A;  3QVP A;  3R25 A;  5IQ4 A;  1GET A;  1NDA A;  2OFJ A;  3KPK A;  3DDM A;  2BC0 A;  4B67 A;  3UOZ A;  5ER0 A;  2DKH A;  2BXR A;  2PGE A;  4A3R A;  1JRX A;  3VCN A;  1H84 A;  4KWS A;  3T2K A;  2J3N A;  3P4P A;  1NEK A;  3CK5 A;  3AE9 A;  1ZKQ A;  1V97 A;  4GYP A;  3K7T A;  3TWA A;  3FJ4 A;  3STP A;  3ABV A;  1ONF A;  4DWD A;  3KU9 A;  4U8O A;  2C67 A;  4Z17 A;  4GDE A;  4Z24 A;  3ATR A;  3TJ4 A;  5BRT A;  3VRD B;  1PDH A;  2XLT A;  3NN6 X;  1OJT A;  3TTE A;  4G7F A;  5KMQ A;  3LAD A;  4F4R A;  4G74 A;  3UTG A;  5BUL A;  3V3O A;  3RNM A;  3ALL A;  2BS4 A;  3LJP A;  3CAW A;  2XH4 A;  3KD9 A;  1LV0 A;  1L9C A;  2Y6Q A;  3SGL A;  1ECQ A;  4OPC A;  3D46 A;  4GRT A;  2PP1 A;  4YSH A;  5JCI A;  2VVM A;  2V5Z A;  2PGW A;  1YEY A;  3CYJ A;  4Z26 A;  4EMI A;  2BYB A;  3AEF A;  5FJP A;  3B97 A;  4GIR A;  3M12 A;  3GWF A;  3R07 C;  1CJC A;  4H4Y A;  3ENL A;  2EQ9 A;  1TYT A;  3I6T A;  3A7R A;  1E1L A;  3HPF A;  4ADW A;  4J57 A;  3N4E A;  4J31 A;  1ZX9 A;  2DW7 A;  3UTH A;  1D5T A;  2C7G A;  2OLN A;  4D04 A;  4H4R A;  2Z5X A;  3ZDN A;  4AOS A;  3FMW A;  3UKH A;  3P3B A;  5HY5 A;  3V5C A;  1LJ1 A;  3CPJ G;  2OAM A;  2GQF A;  3GWD A;  3O0H A;  2OX4 A;  3PG6 A;  3PWG A;  4H4V A;  1IUS A;  1FL2 A;  4GFI A;  3UP5 A;  4I59 A;  3AMZ A;  2PP3 A;  4D03 A;  3JZU A;  3NVZ B;  2GR0 A;  2ARD A;  4KX6 A;  3AD8 B;  2BAC A;  3CNP A;  4YSY A;  1YY5 A;  4G73 A;  2R0C A;  4CBQ A;  4NTE A;  1P48 A;  3T2Z A;  2IVE A;  1FO4 A;  3DGH A;  5BUK A;  2XLR A;  4NEW A;  3NK1 X;  3IJQ A;  3AE6 A;  3NT6 A;  1AOG A;  5IQ1 A;  1BKH A;  4RG3 A;  1GPE A;  3LZX A;  2Q0L A;  4H4U A;  5FS7 A;  4E8G A;  1DJQ A;  2JKC A;  1DXL A;  4AT2 A;  2NPX A;  1GOS A;  3VC6 A;  2BS2 A;  3P4S A;  4U2T A;  4K2X A;  2OAL A;  3AWI A;  3PO7 A;  3H70 A;  1EC7 A;  1L9D A;  1ELI A;  3P1W A;  3ALM A;  5FJO A;  3M0O A;  1DNC A;  1N4W A;  5J7X A;  4DHG A;  2C64 A;  2OKT A;  3QFB A;  4K2S A;  1MNS A;  4OPT A;  3OP2 A;  4XWR A;  1KDG A;  2XFO A;  3CB3 A;  4N9X A;  2QA1 A;  2EQ6 A;  1TDO A;  1QLB A;  1PBF A;  1RSG A;  2XVE A;  1KKO A;  2P8C A;  2X50 A;  4TM4 A;  4C3Y A;  2XFQ A;  4A7A A;  1JCT A;  3URH A;  3H8A A;  4TLX A;  4FX9 A;  4AT0 A;  2YLS A;  3T31 A;  4H50 A;  1GER A;  2W54 A;  5FJU A;  4X9M A;  4M6U A;  2PTX A;  2FKP A;  1X2H A;  3Q9T A;  3MKC A;  3ZVI A;  3TW9 A;  3ICR A;  3V4B A;  3TWB A;  5KWF A;  3NK2 X;  3H8L A;  1CF3 A;  2OQH A;  1CJ2 A;  3UJ2 A;  4RSL A;  5IPY A;  1ELS A;  4FP1 A;  3PVC A;  2WHD A;  3AED A;  1JRZ A;  4YWS A;  4J2W A;  1EL9 A;  1D7L A;  1KNP A;  1JPM A;  3NFU A;  3AD7 B;  1PBB A;  2GV8 A;  2XDO A;  4B1B A;  3FPZ A;  1EBD A;  4JN8 A;  1IUX A;  4J36 A;  3NRZ B;  2E1M A;  1D4C A;  1YQZ A;  3EAO A;  1PHH A;  3SZW A;  1RM6 B;  4JDR A;  3FYY A;  4X9N A;  1JNZ A;  3DG3 A;  1PDY A;  2R0P A;  3COX A;  2PPG A;  1GRF A;  3I6D A;  3K1G A;  2E5A A;  1IJH A;  3UJF A;  5HHF A;  4A9W A;  2AL2 B;  5JCM A;  2PTZ A;  1X2G A;  3HZL A;  4CY6 A;  4EQX A;  1O95 A;  3CXB A;  1JPD X;  3SZF A;  4TVW A;  4TM1 A;  4B69 A;  1PBD A;  1TE6 A;  3I4K A;  1M6I A;  3RR1 A;  5KVH A;  3LB8 A;  3QFA A;  3RP6 A;  5JCK A;  1H86 A;  1PXA A;  2BAB A;  2B9W A;  7ENL A;  2YG6 A;  3GSI A;  3RED A;  5ENL A;  4H2P A;  3MUC A;  3PK7 A;  2GMH A;  3GD4 A;  1B5Q A;  3I6E A;  4C5O A;  1GES A;  1F8S A;  3LXD A;  3CGD A;  2WDV A;  4DNA A;  2PA6 A;  3V5F A;  1F6M A;  1PJ6 A;  2XFN A;  3NKS A;  1CJ3 A;  1SJD A;  1XS2 A;  1GXF A;  1JRO A;  3G5R A;  4U8I A;  1TDN A;  2HZG A;  3PWI A;  4IVO B;  1E7P A;  3GMC A;  3UTE A;  1E9I A;  2GB0 A;  3BI4 A;  3UKF A;  1ZOV A;  3OW1 A;  4YSX A;  4HCH A;  3GYI A;  1TZZ A;  3DIP A;  2YWL A;  1Q1R A;  4Z44 A;  2QVH A;  1BKW A;  2TPR A;  2Q0K A;  4O5U A;  3GD6 A;  5JCL A;  1ONE A;  1N61 C;  3TCS A;  3SFE A;  5BVA A;  2CDU A;  2YG7 A;  1JRP A;  1FIQ B;  3T14 A;  1VQW A;  3AYJ A;  3NYC A;  3CIR A;  2QJJ A;  3UKQ A;  2CUL A;  4HN8 A;  2YVJ A;  3ITJ A;  4A5L A;  4B68 A;  3ALJ A;  1KF6 A;  2P0I A;  4GIS A;  3QJ4 A;  1GRH A;  3DK8 A;  1K4Q A;  4H4W A;  1GV4 A;  2C66 A;  3SSZ A;  3AE4 A;  4K5S A;  3A7U A;  2A87 A;  3JW7 A;  5EBK A;  3DFH A;  2GGE A;  1YQ4 A;  2ONE A;  3N6J A;  3GYX A;  4E5T A;  1H7X A;  3PS9 A;  3UCC A;  2QCU A;  4GAP A;  4XXG A;  4YSZ A;  5TR3 A;  4EIP A;  3GDP A;  1P2H A;  3MSY A;  2YG5 A;  3FG2 P;  4EMW A;  3NHO X;  1TDE A;  1GEU A;  5C3J A;  5KOW A;  1RYI A;  3SZC A;  2A8X A;  2BRY A;  2YR4 A;  4FK1 C;  2QDD A;  2B7R A;  2C65 A;  1XHC A;  1Q1W A;  5U1O A;  3B6D A;  2JB2 A;  3AEC A;  3AB1 A;  2GDQ A;  1WYG A;  5FS9 A;  3CPI G;  1ZP0 A;  4Z2U A;  1FFV C;  3P93 A;  4II2 A;  4H1Z A;  2I5Q A;  3G5Q A;  3R9U A;  1L9E A;  3AYL A;  1TDK A;  5JCN A;  4I58 A;  3VA8 A;  4ZN0 A;  2XH2 A;  4BUR A;  2P8B A;  2OQY A;  3GO2 A;  1NHQ A;  2XLS A;  3VFC A;  4GYP C;  3AE1 A;  1W4X A;  3P4R A;  6ENL A;  2WPE A;  4K8G A;  2YLZ A;  4G8T A;  3QKE A;  3ADA B;  3SN4 A;  1VG9 A;  2OPJ A;  1B4V A;  3NZG A;  4BJY A;  4BK2 A;  4OPG A;  4H4Z A;  1NPX A;  5BOE A;  2QJM A;  1MOK A;  2PTY A;  3VQR A;  1L8P A;  1P43 A;  1N4V A;  4JNA A;  1KFY A;  3ETR B;  5IDZ A;  1GND A;  2R45 A;  4B65 A;  3SM8 A;  1N1P A;  2Q6U A;  2O9Z A;  2GR2 A;  4EM4 A;  4IV9 A;  3IHM A;  2P88 A;  2PCE A;  1EL7 A;  5FJR A;  1H83 A;  3NO1 A;  2QDE A;  3DH9 A;  3RP8 A;  2YM2 A;  2ACZ A;  5FMH A;  2X8H A;  2RGJ A;  4G6H A;  2MUC A;  4H2Q A;  1IUW A;  4OPL A;  2B9X A;  3AE8 A;  1LQU A;  4GCM A;  1GRT A;  3N6H A;  3V3W A;  3GMB A;  1NEL A;  1TRB A;  2Y6R A;  2XLP A;  2XVI A;  3G5S A;  2OLO A;  3II4 A;  3ZLG A;  1STZ A;  1K0L A;  4DSH A;  4JN9 A;  1XAN A;  3UJS A;  1PJ5 A;  1TKK A;  3WE0 A;  2PU1 A;  3EF6 A;  3T9P A;  4J56 A;  3TQP A;  2PHH A;  1PXB A;  4DX3 A;  4IHC A;  3S5W A;  5U25 A;  2FJE A;  4RG4 A;  4HA6 A;  1QO8 A;  3H8I A;  2AQJ A;  3SBF A;  2AKZ A;  3S5S A;  3F8P A;  1S2Y A;  3NN0 X;  2BCG G;  2AL1 A;  4GR1 A;  3DK9 A;  1GRA A;  3LZW A;  2R4J A;  3RRA A;  2WDR A;  4K7Z A;  3CGB A;  1BWC A;  3ZLF A;  4DXK A;  1IUT A;  3BNU A;  2BRA A;  4Y4M A;  3QSS A;  1S7M A;  3ZVH B;  1P2E A;  3AM9 A;  3AE5 A;  2WOW A;  3OPS A;  4UDR A;  3KPF A;  1MO9 A;  1NHP A;  4LII A;  4CCR A;  3T4W A;  3B9J B;  4OVI A;  3DK4 A;  1FEA A;  3CNS A;  4IP5 A;  4IA5 A;  5JRB A;  4IA6 A;  3DGB A;  2ZBW A;  3GY1 A;  3ISH A;  4LA1 A;  3F8R A;  2GQW A;  3EUB 3;  5KVI A;  2VQ7 A;  4Z25 A;  4C74 A;  4UP3 A;  2XVF A;  2F5Z A;  1GAL A;  4NWZ A;  1PBC A;  4IZG A;  3NYE A;  4HNC A;  4BJZ A;  2VRL A;  2HNE A;  5KOX A;  1OJC A;  4XWZ A;  1WUE A;  1D7Y A;  1E6E A;  3AXB A;  4REK A;  2GMJ A;  2XH7 A;  2JBV A;  4MKS A;  4APN A;  1ZY8 A;  1PXC A;  2XFU A;  2VRM A;  4E0V A;  3SZ0 A;  3TOY A;  4CCQ A;  3UCL A;  2HXU A;  3JVA A;  3FCP A;  3ZVH A;  1YKJ A;  3DG6 A;  2C76 A;  5J60 A;  1TYP A;  2X8C A;  1MUC A;  3KLJ A;  4JHM A;  3GRS A;  4J33 A;  4UDQ A;  1N60 C;  5EU9 A;  1NU5 A;  3GDN A;  1KKR A;  4Z1Y A;  1NEN A;  2QJN A;  2ZZC A;  4II3 A;  4H7U A;  4ZCW A;  2RGH A;  1XPY A;  1REO A;  4AOX A;  4YTP A;  2VOU A;  3NRN A;  5M10 A;  2GR3 A;  3FXG A;  4JY3 A;  1O94 A;  3E1T A;  3HYX A;  4KPR A;  1EC8 A;  2YM1 A;  2VVL G;  2OVL A;  4YKF A;  1ZK7 A;  5KRQ A;  3IJI A;  4K5R A;  2QGY A;  4GF7 A;  3UCD A;  5CKU A;  1KN0 A;  4H2H A;  3OZM A;  2ZZ0 A;  3BI2 A;  2DKI A;  4Y4L A;  3N4F A;  3V76 A;  1RVK A;  5M0Z A;  1Z6L A;  2XYO A;  3AEE A;  3CXO A;  1KSU A;  2W0H A;  2WOV A;  3OZY A;  1DOD A;  2WP6 A;  5FJT A;  1BZL A;  2QQ6 A;  3T37 A;  3R1Z A;  4DN1 A;  4A6N B;  2PU0 A;  2R4E A;  1N5X A;  2BS3 A;  3UOY A;  1ZXI C;  2PSN A;  2XH0 A;  5HXI A;  2ZZB A;  5HYM A;  2GAH B;  1D4D A;  3K7Q X;  1GRB A;  3B3R A;  4JQ9 A;  4KPL A;  1FHV A;  2VZ2 A;  4IL0 A;  1H2I A;  2V60 A;  2NVK X;  1MRA A;  2YR5 A;  3VDG A;  4TVY A;  1IYX A;  3CN8 A;  2V3B A;  2AL2 A;  2JB1 A;  2CFY A;  3Q45 A;  2XGZ A;  2JAE A;  3T6C A;  2WU5 A;  2IVD A;  4YTN A;  4AP3 A;  2GL5 A;  3DER A;  2POZ A;  1VRQ B;  3V3N A;  3FV9 A;  1HYU A;  4A35 A;  1VDC A;  4A99 A;  4GUV A;  4Z43 A;  2WOI A;  4IT1 A;  3FVD A;  2GR1 A;  2OLA A;  1PBE A;  2B9Y A;  3DGZ A;  1KCZ A;  4GGH A;  3KUM A;  3L1R A;  3D8X A;  1LTX R;  1XPQ A;  3FBS A;  2GH5 A;  4Z2T A;  2XVH A;  3AEA A;  4A6N A;  4HPN A;  3BHK A;  4Z2R A;  1BQG A;  2GSH A;  2APG A;  1GTE A;  3KA7 A;  4J3Z A;  4NEV A;  1EBH A;  1E39 A;  3SFD A;  4WX1 A;  1ZMD A;  2C4C A;  1X31 B;  2YLR A;  3ZYX A;  1B8S A;  1FEB A;  1VDV A;  2R46 A;  2RDX A;  4U2S A;  5CQF A;  2OO6 A;  3UTF A;  2CHR A;  3Q4D A;  3NGC X;  3OZ2 A;  1NHS A;  1JU2 A;  1ZOY A;  1O5W A;  2HXT A;  4U8M A;  1OJD A;  4ECH A;  2WP5 A;  3DME A;  2X99 A;  1PS9 A;  3ICT A;  3IK4 A;  4K22 A;  2EQ8 A;  4M52 A;  4PAA A;  2GAG B;  2BXS A;  4HB9 A;  1Q9I A;  2WP9 A;  1NG3 A;  3QSE A;  3ICS A;  1FFU C;  1KSS A;  1PDZ A;  4EWJ A;  1LQT A;  2FJB A;  3UJR A;  5GRT A;  3R10 A;  2PMQ A;  3D9X A;  4BK3 A;  1VG0 A;  1YQ3 A;  3QLD A;  2FJA A;  4FK1 A;  3NS1 B;  4FI4 A;  3T0K A;  1RP0 A;  4H4S A;  3VRB A;  3IHG A;  1KNR A;  2Z5Y A;  3NYF A;  4TM0 A;  4BV6 A;  1R0M A;  3FIM B;  1PJ7 A;  3UOX A;  3GRT A;  4DYE A;  3DA1 A;  1JOA A;  2GEW A;  2WDQ A;  4CRT A;  1LVL A;  3ATQ A;  3KVE A;  1H6V A;  1F9C A;  2FYM A;  1UKV G;  2XLU A;  1S2Q A;  2QAE A;  3AD9 B;  2YAU A;  3SJN A;  3LOV A;  3SY4 A;  5GSN A;  3UKP A;  1XDI A;  4G9K A;  3U4F A;  2PTW A;  4JN7 A;  4AP1 A;  2C3C A;  1FCD A;  1K0I A;  3JSK A;  3QN3 A;  1EL5 A;  2C70 A;  2V61 A;  4H2R A;  4IL2 A;  1GRG A;  1L0V A;  2R0G A;  3BJS A;  1MDR A;  3QTP A;  3SXI A;  2GVC A;  1V59 A;  1E1K A;  3L8K A;  1FEC A;  1PN0 A;  3RGT A;  3RO6 A;  2YLT A;  4YT0 A;  2XCG A;  3I3L A;  2P3Z A;  2OZT A;  4GDP A;  4EMJ A;  4HNL A;  2YLW A;  3SX6 A;  2JB3 A;  3S61 A;  4ROP A;  1R6W A;  3SN0 A;  4C3X A;  1DOC A;  3DES A;  4O5Q A;  3P0W A;  2C73 A;  3DJJ A;  4OPI A;  3P9U A;  4A65 A;  4HYR A;  3IC9 A;  1MXT A;  4H83 A;  4EIQ A;  4H19 A;  2A89 A;  3SQS A;  3UJE A;  1DOE A;  3L5O A;  1BGN A;  2H88 A;  3NK0 X;  4K1W A;  3IF9 A;  5L46 A;  3MWC A;  3BNM A;  2BCP A;  2C75 A;  3RP7 A;  2BK5 A;  3SR6 B;  3AE2 A;  3EEZ A;  3RIT A;  2BC1 A;  5KMP A;  1JEH A;  4B63 A;  4EQR A;  2GGJ A;  2XSX A;  3NVV B;  3P4Q A;  4UDP A;  1F8R A;  2RGO A;  4OPD A;  2CVJ A;  3AE3 A;  1CHU A;  4MGG A;  3CMM A;  1H7W A;  3CGC A;  3ES8 A;  5KMS A;  4H4T A;  5LV9 A;  1SEZ A;  4ZCC A;  1NG4 A;  3AYI A;  1N5W C;  4USR A;  3UXL A;  3UXK A;  2VVL A;  2IID A;  4CY8 A;  4IVM B;  3T8Q A;  4CNK A;  4KT2 A;  2OZ8 A;  3AN1 A;  1DTN A;  4YWO A;  2B76 A;  4GGB A;  3H12 A;  2BK3 A;  4U8P A;  2WET A;  4J34 A;  3NNE A;  2POD A;  1JDF A;  2RAB A;  1S3E A;  2E3T A;  3C96 A;  1Y56 B;  1D4E A;  1CL0 A;  1K0J A;  2C3D A;  3GD3 A;  2E4G A;  2I0Z A;  1ZMC A;  5EOW A;  5FS6 A;  2GGH A;  2QA2 A;  4E4U A;  3RCY A;  1E1M A;  4ZOH B;  3S47 A;  4TLZ A;  2YG3 A;  3Q6J A;  2PS2 A;  2X3N A;  3C4N A;  4WCT A;  2YVF A;  1W6T A;  4H4X A;  4BK1 A;  4EQW A;  1LPF A;  3DEQ A;  4NNJ A;  2PP0 A;  2YLX A;  3BOX A;  3K30 A;  2W3S A;  2E5V A;  3R11 A;  2V3A A;  1EBG A;  4TM3 A;  3UKL A;  4U2L A;  2WQY A;  3QVR A;  3EPT A;  3H4K A;  5J04 A;  1GT8 A;  4PAB A;  3DJG X;  1E1N A;  4NTC A;  1SB3 B;  3C4A A;  3VR8 A;  3ZLH A;  3UGV A;  1CC6 A;  4C77 A;  4NTD A;  2BA9 A;  2WEU A;  3HW2 A;  4EM3 A;  4GAV A;  3NG7 X;  1TDF A;  3HYV A;  2ZC8 A;  5C2T A;  4OCG A;  3EAN A;  1H82 A;  1Y56 A;  1FOH A;  4ENL A;  4JNQ A;  3NLC A;  1EC9 A;  3BHF A;  2UZZ A;  4H4P A;  3CTY A;  2PYX A;  3MY9 A;  3NVY B;  3TJI A;  1NHR A;  2BK4 A;  2AKM A;  4HCD A;  4K8D A;  5G5G B;  3AEB A;  3R0K A;  2WPC A;  2WU2 A;  1MDL A;  4X2P A;  1SJC A;  1T3Q C;  3D47 A;  4YTM A;  2DW6 A;  4G6G A;  3NTA A;  3DG7 A;  4Y4N A;  3D1C A;  3BSM A;  4GME A;  4OPU A;  3CPH G;  4CNJ A;  1IUU A;  2FBW A;  3A7A A;  4USQ A;  3AE7 A;  4KEM A;  3QPE A;  1GRE A;  4NZH A;  2ZAD A;  5KXJ A;  3VR9 A;  5KMR A;  3R0U A;  3DJD A;  3UP4 A;  1CJ4 A;  2YQU A;  4DSG A;  1COY A;  2TMD A;  3MZN A;  4IP4 A;  3SQP A;  1H81 A;  1WUF A;  1GTH A;  3BI5 A;  3CND A;  1Y0P A;  3HYW A;  2B7S A;  5KNL A;  3RHA A;  4HCL A;  4U8K A;  2YG4 A;  3CGE A;  2HQM A;  3CNT A;  3UKA A;  3VRA A;  3PFR A;  4JY2 A;  2OZ3 A;  1QJD A;  2GGI A;  3NH3 X;  4U8L A;  2Q7V A;  3GYJ A;  3UOV A;  1JNR A;  3NIX A;  5DBJ A;  2GF3 A;  2WS3 A;  5U63 A;  4DGK A;  3KKJ A;  2EQ7 A;  4H4Q A;  1BGJ A;  2VQB A;  1NAA A;  2WES A;  2GRT A;  2WBA A;  1DOB A;  4YKG A;  2AAQ A;  4E4F A;  4X4J A;  3SYI A;  1EL8 A;  2MNR A;  4B66 A;  5G5H B;  2WPF A;  1OJA A;  1VQZ A;  3GC2 A;  4P9S A;  1M64 A;  2V6O A;  3OTR A;  1GSN A;  4H2N A;  5BOF A;  3CT2 A;  3EKG A;  1B37 A;  1JRY A;  1F3P A;  5EB4 A;  1SJB A;  3DFY A;  2FJD A;  3THU A;  4A6G A;  1SJA A;  4ZCD A;  5EB5 A;  1F8W A;  4YXD A;  3H7V A;  2W3R A;  3AEG A;  2H89 A;  3VC5 A;  3NVW B;  3K7M X;  3U9I A;  3M13 A;  4LU6 A;  2XVJ A;  2X8G A;  3MQT A;  1FHU A;  3F8D A;  2YR6 A;  2OA1 A;  1N62 C;  1N63 C;  4E6M A;  3CNJ A;  3IWA A;  4ZA0 A;  3IJL A;  1OEP A;  4FDC B;  1S3B A;  3QSM A;  1N4U A;  2GGG A;  3NXL A;  4EQS A;  4U8N A;  5FS8 A;  3HRD C;  2JK6 A;  4A79 A;  4MMW A;  1CC2 A;  3ES7 A;  1OJ9 A;  3DJE A;  2OG9 A;  2NQL A;  1ZDL A;  2XFP A; 
#chains in the Genus database with same CATH homology
 3L5O A;  1BGN A;  1DJN A;  1OJC A;  5KOX A;  4XWZ A;  2H88 A;  3UKK A;  4DNA A;  3NK0 X;  1F6M A;  1PJ6 A;  3IF9 A;  5L46 A;  2AR8 A;  2R9Z A;  1D7Y A;  1E6E A;  2XFN A;  1IUV A;  3AXB A;  1CC4 A;  3NKS A;  1CJ3 A;  3BNM A;  2BCP A;  3T2Y A;  1GXF A;  1BF3 A;  2C75 A;  3G5R A;  3OC4 A;  4REK A;  3NTD A;  4U8I A;  1TDN A;  3RP7 A;  2YVG A;  2GMJ A;  4ICY A;  2JBV A;  1E7P A;  4APN A;  3GMC A;  4IVO B;  3UTE A;  1ZY8 A;  1PXC A;  2BK5 A;  2GB0 A;  2XFU A;  3AE2 A;  3BI4 A;  4U8J A;  3UKF A;  4B64 A;  1ZOV A;  2C72 A;  4YSX A;  4MJW A;  2VRM A;  1CBO A;  4E0V A;  3QVP A;  3SZ0 A;  2BC1 A;  3GYI A;  5IQ4 A;  5KMP A;  1JEH A;  1GET A;  1NDA A;  4B63 A;  4EQR A;  3KPK A;  4CCQ A;  2YWL A;  1Q1R A;  3P4Q A;  4Z44 A;  3UCL A;  4UDP A;  1F8R A;  1BKW A;  2RGO A;  4OPD A;  2BC0 A;  2CVJ A;  1YKJ A;  4B67 A;  3AE3 A;  3UOZ A;  1CHU A;  2TPR A;  3CMM A;  2Q0K A;  5ER0 A;  1H7W A;  3CGC A;  2DKH A;  4O5U A;  5KMS A;  5JCL A;  4H4T A;  2BXR A;  2C76 A;  5J60 A;  1TYP A;  5LV9 A;  1SEZ A;  4ZCC A;  2X8C A;  1JRX A;  3KLJ A;  1NG4 A;  3GRS A;  4J33 A;  4UDQ A;  1H84 A;  3SFE A;  5BVA A;  2CDU A;  3T2K A;  2J3N A;  3P4P A;  2YG7 A;  1NEK A;  3AE9 A;  1ZKQ A;  3GDN A;  3AYI A;  3K7T A;  1NEN A;  4USR A;  3T14 A;  2ZZC A;  4II3 A;  4H7U A;  3ABV A;  1VQW A;  2VVL A;  2IID A;  3AYJ A;  4CY8 A;  2RGH A;  3NYC A;  3CIR A;  1ONF A;  1REO A;  3KU9 A;  4IVM B;  4U8O A;  4CNK A;  4AOX A;  2C67 A;  4YTP A;  4YWO A;  2VOU A;  3NRN A;  4GDE A;  2GR3 A;  4Z24 A;  3UKQ A;  5M10 A;  2B76 A;  3ATR A;  2CUL A;  2YVJ A;  3ITJ A;  1PDH A;  3VRD B;  5BRT A;  4A5L A;  4B68 A;  3ALJ A;  2XLT A;  3NN6 X;  1OJT A;  4JY3 A;  2BK3 A;  5KMQ A;  1KF6 A;  3LAD A;  1O94 A;  4G74 A;  3E1T A;  3UTG A;  3HYX A;  4U8P A;  4KPR A;  2WET A;  2YM1 A;  5BUL A;  3V3O A;  4J34 A;  3RNM A;  1GRH A;  2VVL G;  3QJ4 A;  3ALL A;  3NNE A;  2BS4 A;  3DK8 A;  2RAB A;  1K4Q A;  4YKF A;  1ZK7 A;  4H4W A;  1S3E A;  5KRQ A;  1GV4 A;  2C66 A;  3LJP A;  3C96 A;  4K5R A;  3AE4 A;  4GF7 A;  4K5S A;  1Y56 B;  5CKU A;  2A87 A;  1D4E A;  1CL0 A;  1KN0 A;  3KD9 A;  1LV0 A;  1K0J A;  2ZZ0 A;  2C3D A;  3GD3 A;  3BI2 A;  1L9C A;  2E4G A;  2I0Z A;  1ZMC A;  5EOW A;  2Y6Q A;  2DKI A;  3SGL A;  4Y4L A;  5EBK A;  5FS6 A;  4OPC A;  4GRT A;  4YSH A;  2QA2 A;  5JCI A;  3V76 A;  2VVM A;  2V5Z A;  1YQ4 A;  5M0Z A;  1E1M A;  1Z6L A;  2XYO A;  3AEE A;  3GYX A;  4Z26 A;  3PS9 A;  1H7X A;  4TLZ A;  1KSU A;  2W0H A;  2WOV A;  4EMI A;  2QCU A;  2BYB A;  2YG3 A;  1DOD A;  2WP6 A;  3Q6J A;  2X3N A;  3AEF A;  3C4N A;  4GAP A;  4XXG A;  1BZL A;  4WCT A;  5TR3 A;  2YVF A;  3VQR A;  4EIP A;  4YSZ A;  4H4X A;  4BK1 A;  4EQW A;  3GDP A;  1LPF A;  3GWF A;  3M12 A;  1P2H A;  1CJC A;  4H4Y A;  3T37 A;  2EQ9 A;  1TYT A;  4NNJ A;  2YLX A;  1E1L A;  2YG5 A;  3FG2 P;  4EMW A;  3K30 A;  4A6N B;  3NHO X;  1TDE A;  1GEU A;  2E5V A;  5C3J A;  4ADW A;  5KOW A;  1RYI A;  3SZC A;  2A8X A;  2BRY A;  2V3A A;  2YR4 A;  2R4E A;  2BS3 A;  4J57 A;  4FK1 C;  4TM3 A;  3UOY A;  3UKL A;  4J31 A;  4U2L A;  1ZX9 A;  2B7R A;  2C65 A;  2WQY A;  3QVR A;  3UTH A;  1XHC A;  3EPT A;  1D5T A;  5HXI A;  2ZZB A;  1Q1W A;  5HYM A;  2GAH B;  3H4K A;  1D4D A;  2C7G A;  5U1O A;  2OLN A;  4D04 A;  3K7Q X;  4H4R A;  1GT8 A;  1GRB A;  2Z5X A;  4JQ9 A;  3B3R A;  3ZDN A;  2JB2 A;  3B6D A;  3AEC A;  2VZ2 A;  3AB1 A;  3FMW A;  3UKH A;  4AOS A;  5HY5 A;  1LJ1 A;  5FS9 A;  3CPJ G;  2OAM A;  4PAB A;  2GQF A;  3GWD A;  1H2I A;  3DJG X;  2V60 A;  2NVK X;  3O0H A;  3CPI G;  1ZP0 A;  1E1N A;  2YR5 A;  3PG6 A;  4NTC A;  3C4A A;  4H4V A;  3VR8 A;  1IUS A;  1FL2 A;  3CN8 A;  2V3B A;  1CC6 A;  3UP5 A;  4I59 A;  4C77 A;  4NTD A;  4Z2U A;  2BA9 A;  2JB1 A;  2WEU A;  2CFY A;  4EM3 A;  4GAV A;  3NG7 X;  1TDF A;  4II2 A;  4D03 A;  2GR0 A;  3HYV A;  2ARD A;  3G5Q A;  3R9U A;  1L9E A;  2JAE A;  4KX6 A;  3AYL A;  3AD8 B;  5C2T A;  1TDK A;  2BAC A;  4OCG A;  3EAN A;  1H82 A;  2WU5 A;  1Y56 A;  5JCN A;  3CNP A;  4I58 A;  2IVD A;  4YSY A;  4YTN A;  4AP3 A;  1FOH A;  4ZN0 A;  4JNQ A;  3NLC A;  4BUR A;  1YY5 A;  4G73 A;  1VRQ B;  3BHF A;  2R0C A;  2UZZ A;  3V3N A;  4H4P A;  1HYU A;  4CBQ A;  1NHQ A;  2XLS A;  1VDC A;  3CTY A;  4NTE A;  3AE1 A;  2PYX A;  4A99 A;  4GUV A;  3T2Z A;  4Z43 A;  2WOI A;  2IVE A;  2GR1 A;  1PBE A;  1NHR A;  1W4X A;  2B9Y A;  2BK4 A;  3DGH A;  3DGZ A;  3P4R A;  5BUK A;  2XLR A;  4NEW A;  3NK1 X;  2WPE A;  3AE6 A;  3NT6 A;  3L1R A;  1AOG A;  5IQ1 A;  3D8X A;  1LTX R;  4K8D A;  4RG3 A;  1XPQ A;  1GPE A;  2YLZ A;  3FBS A;  2XFP A;  3LZX A;  2GH5 A;  2Q0L A;  3ADA B;  4H4U A;  5FS7 A;  1DJQ A;  4Z2T A;  2XVH A;  3AEB A;  2JKC A;  1DXL A;  1VG9 A;  3AEA A;  4AT2 A;  2NPX A;  1GOS A;  4A6N A;  1B4V A;  2BS2 A;  3P4S A;  2WPC A;  4BJY A;  2WU2 A;  4BK2 A;  4OPG A;  3BHK A;  4U2T A;  4Z2R A;  4K2X A;  2APG A;  2OAL A;  3AWI A;  4H4Z A;  1NPX A;  1GTE A;  3PO7 A;  3KA7 A;  1MOK A;  4NEV A;  1L9D A;  1ELI A;  3P1W A;  4YTM A;  3ALM A;  1E39 A;  3M0O A;  1DNC A;  1N4W A;  4JNA A;  1N4V A;  3SFD A;  4WX1 A;  5J7X A;  1ZMD A;  4G6G A;  1KFY A;  3NTA A;  4Y4N A;  2C4C A;  1X31 B;  2YLR A;  3D1C A;  3ZYX A;  4OPU A;  1B8S A;  2C64 A;  1FEB A;  3CPH G;  3QFB A;  1GND A;  2R46 A;  2R45 A;  4OPT A;  4B65 A;  4CNJ A;  1IUU A;  3SM8 A;  1N1P A;  4U2S A;  5CQF A;  2Q6U A;  4XWR A;  2FBW A;  3UTF A;  2O9Z A;  3NGC X;  2GR2 A;  3OZ2 A;  4USQ A;  1NHS A;  1KDG A;  2XFO A;  1JU2 A;  3AE7 A;  4EM4 A;  1O5W A;  1ZOY A;  1GRE A;  2QA1 A;  3IHM A;  4IV9 A;  4N9X A;  2EQ6 A;  1TDO A;  4NZH A;  1QLB A;  1EL7 A;  1H83 A;  5KXJ A;  3VR9 A;  5KMR A;  1PBF A;  1RSG A;  2XVE A;  4U8M A;  1OJD A;  3DJD A;  4ECH A;  3DH9 A;  3RP8 A;  3UP4 A;  2WP5 A;  2YM2 A;  2X50 A;  1CJ4 A;  4TM4 A;  4C3Y A;  2XFQ A;  2YQU A;  4A7A A;  2ACZ A;  3URH A;  4TLX A;  4DSG A;  5FMH A;  2X8H A;  2RGJ A;  3DME A;  2X99 A;  4FX9 A;  1COY A;  4G6H A;  1PS9 A;  4AT0 A;  3ICT A;  2TMD A;  2YLS A;  4K22 A;  3T31 A;  4H50 A;  1GER A;  2EQ8 A;  4H2Q A;  1IUW A;  4OPL A;  4M52 A;  2B9X A;  3AE8 A;  4PAA A;  3SQP A;  2GAG B;  2WDV A;  1H81 A;  2BXS A;  1LQU A;  4HB9 A;  1Q9I A;  1GTH A;  2WP9 A;  3BI5 A;  1NG3 A;  1Y0P A;  3CND A;  3ICS A;  3QSE A;  4GCM A;  4X9M A;  1GRT A;  3HYW A;  2B7S A;  1KSS A;  1LQT A;  5KNL A;  3GMB A;  2FJB A;  3RHA A;  5GRT A;  4U8K A;  3Q9T A;  2YG4 A;  3CGE A;  1TRB A;  3D9X A;  4BK3 A;  2Y6R A;  1VG0 A;  1YQ3 A;  2HQM A;  2XLP A;  2FJA A;  2XVI A;  4FK1 A;  3CNT A;  3UKA A;  3T0K A;  3VRA A;  4JY2 A;  1QJD A;  3G5S A;  1RP0 A;  3ICR A;  2OLO A;  4H4S A;  3NH3 X;  4U8L A;  5KWF A;  3VRB A;  3IHG A;  1KNR A;  2Q7V A;  3GYJ A;  3NK2 X;  3UOV A;  3II4 A;  2Z5Y A;  3H8L A;  3NYF A;  1JNR A;  3NIX A;  1CF3 A;  1CJ2 A;  4TM0 A;  5DBJ A;  4BV6 A;  4RSL A;  5IPY A;  2GF3 A;  1K0L A;  3FIM B;  4DSH A;  2WS3 A;  3PVC A;  1PJ7 A;  4JN9 A;  5U63 A;  2WHD A;  4DGK A;  3KKJ A;  2EQ7 A;  3UOX A;  3GRT A;  1BGJ A;  4H4Q A;  2VQB A;  3DA1 A;  1NAA A;  3AED A;  1JOA A;  1XAN A;  1JRZ A;  2GRT A;  2GEW A;  2WES A;  2WDQ A;  2WBA A;  4CRT A;  4J2W A;  1EL9 A;  1LVL A;  1D7L A;  1DOB A;  1KNP A;  3ATQ A;  3KVE A;  1PJ5 A;  1H6V A;  3AD7 B;  4YKG A;  1UKV G;  2AAQ A;  4X4J A;  3WE0 A;  3SYI A;  3EF6 A;  2XLU A;  1EL8 A;  1PBB A;  2GV8 A;  4J56 A;  2PHH A;  1PXB A;  4B66 A;  1S2Q A;  2XDO A;  3S5W A;  2QAE A;  5U25 A;  2WPF A;  1OJA A;  2FJE A;  3AD9 B;  2YAU A;  4B1B A;  4P9S A;  3FPZ A;  1EBD A;  3LOV A;  4RG4 A;  4HA6 A;  3SY4 A;  1IUX A;  4J36 A;  1M64 A;  2V6O A;  1QO8 A;  3H8I A;  2AQJ A;  5GSN A;  3UKP A;  1GSN A;  4H2N A;  2E1M A;  3F8P A;  1S2Y A;  1XDI A;  1B37 A;  1JRY A;  2BCG G;  1F3P A;  3NN0 X;  4G9K A;  5EB4 A;  4GR1 A;  1D4C A;  3DK9 A;  1YQZ A;  1GRA A;  2C3C A;  3EAO A;  1FCD A;  4AP1 A;  1K0I A;  1PHH A;  3LZW A;  3SZW A;  3JSK A;  4JDR A;  2R4J A;  1EL5 A;  2FJD A;  2C70 A;  4X9N A;  1JNZ A;  2WDR A;  4K7Z A;  4ZCD A;  3CGB A;  2V61 A;  4H2R A;  5EB5 A;  1BWC A;  1F8W A;  2R0P A;  1IUT A;  1GRG A;  3COX A;  4YXD A;  1L0V A;  3BNU A;  2BRA A;  1GRF A;  4Y4M A;  3I6D A;  3AEG A;  2R0G A;  3QSS A;  2H89 A;  1S7M A;  1IJH A;  3K7M X;  3SXI A;  2GVC A;  5HHF A;  1P2E A;  1V59 A;  3AE5 A;  1E1K A;  2WOW A;  4A9W A;  3M13 A;  4LU6 A;  3KPF A;  2XVJ A;  4UDR A;  1MO9 A;  3L8K A;  5JCM A;  1FEC A;  1NHP A;  1PN0 A;  4LII A;  2X8G A;  3HZL A;  4CCR A;  2YLT A;  4CY6 A;  4OVI A;  4YT0 A;  4EQX A;  1O95 A;  2XCG A;  3I3L A;  3F8D A;  2YR6 A;  3SZF A;  2OA1 A;  4TM1 A;  4GDP A;  4EMJ A;  4B69 A;  3DK4 A;  1FEA A;  1PBD A;  3CNS A;  4IA5 A;  1M6I A;  2YLW A;  3SX6 A;  2JB3 A;  3S61 A;  5KVH A;  3CNJ A;  5JRB A;  3IWA A;  4IA6 A;  3LB8 A;  3QFA A;  3RP6 A;  4FDC B;  5JCK A;  2ZBW A;  1S3B A;  4C3X A;  3ISH A;  1H86 A;  1PXA A;  2BAB A;  4LA1 A;  3F8R A;  1DOC A;  4O5Q A;  3QSM A;  1N4U A;  2B9W A;  2C73 A;  2GQW A;  4EQS A;  2YG6 A;  3GSI A;  4U8N A;  5FS8 A;  3DJJ A;  3RED A;  5KVI A;  2VQ7 A;  4OPI A;  4H2P A;  3P9U A;  4A65 A;  4Z25 A;  4C74 A;  2JK6 A;  4A79 A;  4UP3 A;  3IC9 A;  1MXT A;  2GMH A;  3GD4 A;  2XVF A;  1B5Q A;  2F5Z A;  4EIQ A;  4C5O A;  1CC2 A;  1GAL A;  4NWZ A;  1GES A;  1PBC A;  1OJ9 A;  1F8S A;  3DJE A;  3LXD A;  3NYE A;  3CGD A;  4BJZ A;  2A89 A;  2VRL A;  1ZDL A;  1DOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...