4HCHA

Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium and l-tartrate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
384
structure length
384
Chain Sequence
SHMIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isomerase/lactonizing enzyme
publication title CRYSTAL STRUCTURE OF D-GLUCARATE DEHYDRATASE FROM AGROBACTERIUM TUMEFACIENS complexed with magnesium and L-tartrate
rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 140
structure length 384
sequence length 384
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hchA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hchA01
3STPA 1R0MA 1W6TA 2DW6A 3DESA 3ZVHA 4GMEA 3RRAA 1EC7A 2HNEA 3FV9A 3UJSA 3FJ4A 5IDZA 2OZ8A 5BOFA 3RITA 4HYRA 2OO6A 1FHUA 1NU5A 3TQPA 1SJAA 4H2HA 3IJLA 2QDDA 4H83A 1WUEA 3VDGA 1KD0A 3CB3A 3DIPA 3R11A 2I5QA 3VCCA 1EC8A 1KKOA 4G7FA 2PP0A 2OKTA 3MUCA 3VCNA 4DN1A 3FCPA 5FJRA 3UJRA 3TOYA 1OEPA 3VA8A 2ZC8A 3RR1A 3EKGA 3OPSA 4EWJA 2PGEA 3H7VA 3S47A 2OFJA 2XH2A 3NFUA 3DG6A 3P93A 3VFCA 1SJBA 3MWCA 4IL2A 4IT1A 3D46A 1MRAA 4DX3A 1TKKA 2PS2A 3R0UA 3FVDA 1YEYA 2PA6A 3UJ2A 1PDZA 3D47A 4K1WA 3GD6A 1F9CA 3CT2A 3EEZA 2XH0A 2AL1A 2OLAA 3PWGA 2PMQA 1BKHA 4E8GA 4GISA 3ES8A 3RCYA 2GGEA 3S5SA 3CXOA 3QKEA 1XPYA 1P43A 1JCTA 4ROPA 2GGIA 4E4UA 4FI4A 1XS2A 4FP1A 7ENLA 4GGHA 2QGYA 4Z1YA 4G8TA 2MUCA 2OPJA 3I6EA 1EBGA 2XGZA 4HN8A 3FXGA 3QN3A 3U9IA 4MKSA 1NELA 3NO1A 3DG7A 3UJFA 3PK7A 3VC5A 1SJDA 4GGBA 3T4WA 3P3BA 3TTEA 1PDYA 4F4RA 3SSZA 2HZGA 2OZ3A 3TWAA 1KCZA 3BJSA 4JHMA 5J04A 4HNCA 3N4FA 2P88A 3GC2A 3R10A 4JN7A 3RO6A 3CYJA 2GSHA 1EBHA 2FKPA 2AKMA 2HXUA 3OZMA 4KEMA 2GL5A 4Z17A 4J3ZA 1ONEA 2OX4A 4ZA0A 1R6WA 4DWDA 5FJOA 1EC9A 1JPMA 3R0KA 2PTXA 1L8PA 4DHGA 3GO2A 1ECQA 2PTWA 2XH4A 3Q45A 4KT2A 2AL2B 3ENLA 4H1ZA 3T6CA 5BOEA 3I4KA 2PU1A 3U4FA 4A3RA 2PSNA 2MNRA 2GGHA 5FJPA 4M6UA 3QTPA 2XH7A 4H19A 3UXLA 3SN1A 3N6JA 3V4BA 2OQYA 4KWSA 3JVAA 3OW1A 1DTNA 2OZTA 4A35A 4E4FA 3GY1A 4GFIA 3DDMA 3SBFA 4MMWA 3MKCA 4X2PA 3TCSA 3PWIA 2QDEA 4HCLA 2PP3A 3SJNA 3CK5A 2AL2A 4K2SA 2QVHA 1MDRA 4IZGA 3JZUA 3BSMA 3IJIA 3R1ZA 4MGGA 3R25A 1SJCA 4KPLA 2QJNA 1MDLA 1RVKA 3ZLHA 1FHVA 3CAWA 2PTYA 4DXKA 1JDFA 3DG3A 3THUA 2PCEA 3H12A 3V5CA 4IL0A 3ZVIA 3N6HA 5FJUA 1MUCA 3IJQA 3TWBA 2POZA 3T8QA 2ZADA 1JPDX 2P3ZA 2PGWA 3DERA 3UXKA 3MY9A 4E5TA 3K1GA 2PODA 4IHCA 3SN0A 4HCDA 2P0IA 4HNLA 3MZNA 4DYEA 2HXTA 3HPFA 4IP4A 3JW7A 3SN4A 1TE6A 2FYMA 3P0WA 2PU0A 3I6TA 3DEQA 3PFRA 1P48A 1MNSA 2OVLA 4K8GA 3OTRA 3ZLFA 4ENLA 2QQ6A 3DFHA 3MQTA 2PTZA 2DW7A 2XSXA 3NXLA 2PP1A 4GYPA 4HPNA 2AKZA 2NQLA 2PPGA 2ONEA 4ZCWA 3DGBA 3OP2A 3UCCA 3TJ4A 3N4EA 4J1OA 3QPEA 5ENLA 2GGJA 3V5FA 4HCHA 4YWSA 4E6MA 1IYXA 3H8AA 3OZYA 3QLDA 2QJMA 1ELSA 3T9PA 2GDQA 3MSYA 1BQGA 2CHRA 3TJIA 4GYPC 2OG9A 3IK4A 4JN8A 3VC6A 3ZVHB 3BOXA 4GIRA 1TZZA 6ENLA 3UCDA 4IP5A 1E9IA 5FJTA 2P8BA 2P8CA 5EU9A 3ZLGA 4A6GA 2RDXA 3ES7A 3H70A 3RGTA 3B97A 2O56A 3V3WA 3UGVA 2GGGA 3Q4DA 3UJEA 4M0XA 1KKRA 2QJJA 3DFYA 3TW9A 3NZGA 1WUFA 3SQSA 3KUMA 2OQHA 3FYYA
chains in the Genus database with same CATH superfamily
4K7YA 3N2XA 1XWYA 2VOMA 4AXNA 3L4ZA 3SRDA 3NQCA 2QEZA 3H26A 4ZB0A 1MMFA 1QI5A 2XIMA 1A4MA 3CB8A 3EWUA 4XQ6A 1ZJBA 1QW9A 3P61A 3U7VA 1G4SA 2IUZA 2X1RA 3EAOA 2VDGA 3GVRA 1SZRA 1DWAM 2C14A 2WVVB 1RLCL 5BOOA 4O57A 4N9CA 4J56A 3UU0A 4MKNA 1T3QC 1TUXA 4MTVA 4RE2A 3QFWA 4DXXA 4KFPA 1Y65A 2QCNA 3IIOA 1GVFA 1PYFA 2A1YA 1G69A 5IXEA 1LL7A 2UZ9A 3IIPA 3NGJA 4P8WA 3AHXA 4M6VA 3TOYA 4UQDA 3CBWA 1CXHA 4C6QA 3QPYA 4HP5A 5BW6A 1EGVA 2WYSA 4QDWA 4B15A 4WK9A 2PLMA 2PLJA 2XVLA 3QPZA 2BHUA 2G37A 5GPRA 3M4HA 2CERA 3CLWA 4RUBA 4R53A 5HJLA 1CB7B 3BW2A 1U2YA 3PUGA 3BQ5A 4NL1A 1LOSA 4R33A 3AS1A 1XLMA 3PTQA 3W1UA 1SMDA 3AS2A 3CMFA 2VYOA 2PWUA 4F2BA 2D2OA 3GBDA 1ME7A 1G7VA 3EDKA 2NQHA 4ADSA 1KO0A 3B9NA 1DJYA 1KBJA 3LHUA 4OWGA 5HQEA 1JIBA 1PKLA 2Z7GA 5DELA 1N7KA 3CIXA 4FMVA 3OG2A 4JTKA 1Y5XA 4MJ4A 4LT9A 2Y24A 3MUXA 5G5GB 3M6YA 2Z7KA 3RCYA 3UPWA 2NVDA 4B5NA 2V3FA 2VD8A 2GSEA 1HKMA 1W9PA 2EXOA 4KEZA 1A5UA 1KM2A 2XN0A 2GGIA 3H2NA 3U2EA 1DHKA 3PY2A 3S2JA 1TPVA 3E2QA 4Q7IA 1N82A 3QTGA 1TWDA 1NP2A 3VNLA 1QWGA 1BAGA 3DXIA 4YTUA 5CBJA 5AOUA 4DNHA 3U9IA 3PTKA 4PFMA 4HBKA 2A7RA 4MJ2A 3VC5A 2VNCA 1NWSA 3NZ1A 2H9AB 2ZZ6A 5B80A 4PEKA 3C6CA 3REQA 3ARSA 4GQQA 4M24A 3FJ6A 4DVOA 3W7CA 3S5NA 3WKZA 3TSMA 3EDFA 3BOLA 3W7LA 5HNNA 4LS2A 3EDJA 3RYSA 4S38A 2XN2A 3N4FA 1IGWA 2C15A 4AIOA 3T7VA 4XD6A 3ANYA 5CC6A 3P5YA 3C2YA 5TBOA 4IG2A 3EWBX 2WOVA 4REQA 4JQ1A 2VEFA 1E71M 1A5LC 4O4WA 1QNPA 1UB3A 4GX8A 3ZFHA 5I02A 3CGEA 4HA4A 1J0KA 4AQLA 1E9LA 1HJUA 2Z1XA 4F9JA 1QK0A 3QQ0A 2CNCA 3LB0A 1EYWA 5H8UA 1IHIA 2G4JA 1IWAA 1Z44A 5A6LA 3C61A 3QV8A 4RCXA 4FF7A 1VBRA 1GNXA 2C19A 3W6MA 4DWSD 3M0KA 4FNPA 1VZWA 3VINA 3WLOA 5DMLA 3AC0A 4Y90A 3MMDA 3JS3A 3BW4A 3E3HA 3GDKA 2ANUA 4HMEA 1OFEA 2HRWA 2DZUA 1ZMDA 4V2XA 7REQB 5XIMA 5F7UA 4FX7A 2PCQA 1OC5A 2V3GA 4TR9A 5MHBA 1QI4A 1SJCA 5IM51 1W1PA 1FH8A 4FDCB 2CU0A 4MB1A 1DWJM 4J3UA 4W8BA 1U5JA 3DJGX 4DJDC 3HMJG 1WKEA 2VZVA 1FWEC 4PTMA 1GVQA 5RUBA 2NX3A 1K8YA 3I7RA 1DXFA 4PSPA 5FEXA 3M43A 1HXJA 1Q3NA 4NZCA 3SM0A 5LIKX 5AYYA 1V93A 1WA3A 2PD5A 1DV7A 1YMYA 4HKPA 5E1QA 5H2ZA 1QMLA 4I6KA 3UXKA 2Z1BA 3STGA 1OT2A 3BAJA 3G1DA 5CG0A 3DYMA 4PMJA 4GJIA 3VOCA 3MZNA 3HPFA 4K68A 1SW0A 5D30A 2HPMA 4PEEA 2DORA 4ATLA 2VOTA 3LTSA 4RLIA 2QQ6A 4JTJA 4JTLA 3VGGA 4I8YA 1TTQA 4ZXLA 1KXVA 2R1LA 1TPWA 2QYGA 2PPGA 4JX4A 5HQMA 1BVWA 4B9ZA 3QPEA 3VOIA 5D33A 4JNZA 5EMKA 3AJXA 3VMPA 1IZCA 3R8GA 3ZMRA 4E6MA 1B54A 4QDPA 2ZX8A 4O14A 1K3UA 4IX2A 2ACQA 5LIXX 3H4GA 3I65A 1GW1A 3NCOA 1IT7A 4LUYA 3R8HA 4AWEA 3L5OA 4JYDA 1NHSA 5JH2A 4ERGA 5ABHA 3RILA 1A5OC 3SCWA 1KNWA 4M7TA 1KLZA 1D8CA 4TXEA 1AD1A 4FXJA 4D1IA 1EEXA 2CZ5A 1PX8A 4FZIA 4K8DA 5FF4A 1QHZA 2XIIA 3A6OA 3LRLA 4NJIA 2W3SA 5ABFA 3LGDA 1XGEA 4E2OA 1Q5MA 4JTGA 3TW7A 3D3AA 1JI1A 2RAGA 1W6TA 3CAVA 2YZRA 3W7OA 3ZVHA 1EC7A 3M0MA 3ALFA 4OIFA 3W29A 4ZQOA 1DORA 1EWEA 6ALDA 2WSQA 1NU5A 1W0MA 2I14A 3WF3A 3HJZA 5E9AA 1JDCA 3VNYA 1PL9A 2ZZBA 2WV8A 3H2CA 3N2BA 2CLOA 1WBHA 3WD2A 4AMAA 5LNRA 3R11A 3V0UA 5I3HA 8RUCA 3GBEA 3GG0A 3URQA 2UBPC 2ZRZA 1J79A 2V30A 2JALA 3DGRA 1W5PA 3OU8A 4ZQCA 2G8ZA 1Z3NA 2ZUUA 1S2VA 4YVXA 1OEPA 4LRTA 4Y9MA 5HMFA 1UR3M 4XAFA 3R94A 4C6IA 1C91A 1YNYA 3MMWA 4WDXA 1OB0A 5C8BB 1ZZMA 4LYKA 3T0BA 2XWEA 2DZSA 4JX5A 3T0DA 2R82A 4DUVA 4OV4A 4WY0A 4WUIA 1F3XA 1QTWA 3OBEA 5DX7A 2IQTA 2BX7A 1YEYA 8XIAA 4ADUA 4L9ZA 2G3IA 5IBXA 3K8KA 4CQDA 1F5ZA 3KTSA 2O0TA 3BANA 1NDWA 1UQYA 3EEZA 1ZK7A 2XM2A 4HPJA 4HMCA 3B8VA 1SM9A 4QSFA 3TDFA 1FWAC 2PMQA 3G1FA 3CGTA 4L6HA 5AC7A 1PZ0A 1VR6A 1SW3A 3SRKA 3ABOA 3O0KA 4DAIA 1HJSA 3MB9A 2QJHA 3GTNA 4LA1A 2WMHA 2H3DA 3Q37A 1TX0A 3S5SA 1POJA 2ZKMX 1VFSA 3Q2DA 1Q6LA 3C2EA 4ROPA 1VHNA 4RE4A 5AYXA 4QNEA 3KOWA 4TX6A 5KZDA 2J6VA 1DIEA 1Q8AA 3EB2A 1WAUA 2HCVA 2D22A 4W4QA 3H7UA 3WEZA 3EXTA 3TN5A 4CD7A 2DQWA 3DK4A 3S5OA 1FH7A 1OGBA 1CXKA 1MZRA 1JULA 3PWAA 4LVBA 5F2MA 4ZEPA 3SIZA 2NUXA 3HPSA 3P81A 3T55A 5KZ6A 1B30A 3PZOA 1CWYA 1CXFA 3P7YA 4A21A 1OABA 3NQBA 3MBFA 2WQDA 2OTDA 3RPMA 3AHTA 4IMDA 3H21A 4UNIA 4OOUA 1GT8A 4W8LA 2RABA 4HTYA 4PMDA 3VU2A 1D3GA 3WLQA 1QUMA 4CU8A 3B05A 3MT1A 2D69A 2E8ZA 4BZYA 3K4WA 1JPMA 4PE8A 5C9RA 3ABSA 1GW9A 1N8IA 2BGSA 1N2VA 2DSUA 3LMYA 3KM8A 3TXVA 1W1B1 4UTUA 1Z41A 1VGAA 3GB6A 5BOEA 3T6CA 3CO8A 3BGAA 4WSHA 2CBUA 1UR9A 1JG9A 1UR4A 4RXGA 3URHA 4FX8A 2J9YA 1SGJA 5EBAA 5L9FA 3S2MA 3C3UA 4PCPA 4R5EA 4JZ5A 2GWNA 2OB3A 1GOWA 2FMNA 1WYIA 2P0OA 1GOKA 5D9PA 4MADA 4FLOA 3HGRA 4LVGA 4FALA 4JCMA 4A3YA 4GFIA 4MMWA 2QDEA 8TIMA 2EQ8A 4PCFA 4O1CA 1GVYA 2Y8UA 1O5XA 4TVWA 4WRHA 1QBAA 2R1KA 1XPGA 1F05A 1P0DA 1GCYA 2GK1B 1I8JA 4LUSA 1KXQA 4HYWA 5LNVA 1SFLA 3BXWA 4JHZA 3ARYA 2VGGA 1E15A 1J18A 1PTGA 2X1SA 3P80A 4PTDA 1UKOA 1ZP3A 3NDOA 1XH1A 4JICA 4L4OA 1UWAA 2CLPA 1JDFA 3TTSA 1ZTVA 2J78A 4F9DA 2LLEA 4KRZA 2NPXA 2Q01A 1ADOA 1JCNA 5AVHA 1R3VA 5E9XA 1A5CA 4EQSA 3VNKA 1I2PA 2HBXA 3WNOA 3LCFA 1K6WA 5DRIA 1R2TA 2A79A 2X0SA 2VEPA 5AYBA 1EA0A 1GERA 3WN6A 4QE4A 3RX4A 2ZVIA 1NWUA 4C6PA 1VLIA 3ABXA 4HHPA 1N62C 3NA8A 5AY7A 2GJXB 4E4PA 1IEVA 5A69A 1WDPA 1E5NA 4OOZA 1G0CA 3F4CA 2A7PA 1H50A 2WNNA 2EG6A 2X8GA 1UWQA 4Y9OA 1P0NA 1KGXA 1A49A 3N34A 5LXEA 4UTTA 2J75A 2IS7A 3TUUA 4ZSUA 5EMYA 4BK9A 4IM4A 3CHEA 3P67A 4IIEA 5J5RA 2WANA 3W38A 4A4AA 1NQ6A 4ZO8A 2ADAA 1A5KC 5BMWA 4JNYA 4I9TA 1JGMA 4JTIA 2IQ0A 3VKDA 3KHJA 1VDVA 1GZGA 2HEJA 3GW3A 4D8LA 3U3HA 3KS5A 1JCYA 5BMXA 3RCMA 2BP1A 1UASA 1IYXA 1ISVA 4K7ZA 2VEMA 4IQEA 3A47A 4PMNA 3M1ZA 1XHCA 5HNUA 1GOMA 4Z1DA 4XV0A 4ML9A 1NSJA 1OZQA 1T0OA 5LNUA 3GUWA 2GVEA 4AY1A 2ISWA 2BWGA 4Z42C 2ISSA 3N2OA 4JTFA 3W25A 4XIAA 2QAEA 4ZE5A 5LKYA 4B16A 1PVNA 3M0YA 4IIFA 4UFKA 3CZGA 5G2IA 3H54A 1Z89A 2GGGA 2V38A 4AHOA 4BFAA 4M0XA 1XQLA 2GUBA 3F2BA 4RDZA 1O66A 1B2YA 3B9AA 2E7FA 4J2PA 1US3A 2DW6A 3APYA 3QZEA 4GFSA 4KKXA 4GVGA 3DESA 4GIYA 4Q8UA 4BQ3A 4R27A 4GMEA 1Q45A 2DZVA 1EGMA 1CT5A 3UJSA 1XSJA 4TU1A 4RDVA 1XL9A 1NAL1 2J7CA 1FHUA 3B0XA 3K2GA 1F3WA 1OC7A 5KETA 3AMCA 4QM1A 1M6JA 3IJDA 4H83A 2OGYA 7PTDA 1VFMA 1W5NA 3CIVA 3M0JA 3WDJA 1H3GA 4XIMA 2RH9A 4WZHA 2J7DA 4ZFCA 4BHYA 1CZ1A 1U83A 3ELFA 1BD0A 5CSSA 3AXXA 2CBIA 2HQAA 1CX9A 3FCPA 2REQB 4C65A 2CCRA 3VDAA 1RUSA 4MFEA 1D2KA 3FA5A 1WV2A 3VA8A 5A6MA 1E1CB 1OK6A 3DC0A 3UA3A 2YVGA 3N2MA 3PJTA 3TIMA 3UG5A 1KBBA 3NFUA 2DPEA 1QNOA 3ANVA 4LAZA 1RJRA 3W6LA 4ACZB 4UTLA 5TF0A 3U5YA 3S83A 1WBJA 3PG6A 4Q8NA 1OYAA 2YB1A 4DX3A 1KRCC 1GRBA 4Q8TA 3TR9A 5CSUA 2X09A 3OHIA 5DANA 4RL3A 1DWIM 4FXSA 3BLFA 2ZZCA 3NUKA 4Q8WA 2I56A 2V5BA 1F9CA 4MJZA 4QJ3B 2VFIA 2GYIA 2XH0A 3ALGA 3DFPA 4OV9A 3ARRA 1JAEA 1A80A 1AQ0A 3RO8A 4ZTYA 4QJ1A 1VFOA 5ECUA 3JZEA 3WUFA 3L2IA 1KXTA 2F6KA 2XM1A 3HJEA 4NJGA 3G22A 3I68A 1XRVA 3WF2A 4IJBA 3QF0A 3E0IA 1AW1A 4KRTA 1JCLA 3G0XA 4WSKA 2E28A 1GJWA 3NQAA 4LC8A 1Z7AA 3UR7A 1Z32X 2QGYA 1U1UA 4JPGA 2AGKA 5BXRA 4LPCA 3GRSA 2B0MA 2TYSA 1GGOA 3W4RA 2QW5A 4FO4A 2DZBA 1SR0A 3RLHA 1NIUA 3PBGA 3WJXA 4AD3A 4H6EA 5AKQA 4FX6M 3H4XA 4G2DA 5AFDA 3GNNA 2WKGA 4QJ5B 4J3WA 3MCOA 4XD4A 5J04A 4WOQA 3R10A 3FSTA 3HF3A 5AHMA 1KRAC 1L6SA 3AMLA 1UD2A 3GFXA 5BNKA 1ISXA 3MVIA 1GXFA 1J6PA 4O1FA 1OFRA 1FX6A 3WQWA 2QS8A 1DE5A 1ONEA 3W73A 2NVCA 3EWWA 3OG3A 2ZDRA 4A22A 3EB3A 3MS8A 1MOKA 1ODUA 1PAMA 3BAWA 3QSRA 1ITUA 1UHVA 2FHCA 4PN2A 3W7HA 4H41A 2WCSA 2XH4A 2XSBA 1CI1A 1VYPX 3WCZA 5IHSA 4IGMA 3U4FA 1EP2A 3U8GA 2V3AA 4LBRA 3WF4A 3FHAA 2P10A 3W3OA 4W8AA 4RDYA 2VTFA 3S1GA 3OBAA 2VWTA 1CGVA 3Q67A 1GJPA 2CYGA 3IUIA 2R1NA 4TV6A 1XYBA 1QBBA 2YVFA 4LYPA 2WZEA 2ZRWA 3WLSA 5JIWA 1K7FA 1MEWA 3PZQA 4D6HA 1VPXA 4RPPA 1XR2A 2Y8VA 3R5EA 1V97A 1RK6A 4EPDC 3T2QA 1GWJA 5D04C 5K7JA 4LFYA 1V3KA 3R25A 1W31A 4H6KA 2JEPA 4Y96A 3FHQA 3GK0A 3FSUA 1UQZA 3W88A 2DU2A 1ZX9A 2X41A 3OB8A 1ZFJA 1Q85A 3QV7A 4DXKA 4EAMA 1CDGA 1X6LA 3V5CA 3WO8A 2PFHA 3MJMA 1YBQA 4W88A 4BKNA 5BXSA 1AK5A 3RRXA 3GRTA 3CZEA 1FUYA 3RX3A 4EMWA 3VOJA 5XIAA 2QCGA 2BHYA 1E56A 1XUZA 2WP5A 4MKVA 3TTOA 4HMNA 2WLZA 4PRWA 4K8EA 1KW1A 1HGWA 2DZPA 1HKVA 1LYXA 2XHYA 3A4XA 4S1FA 2CFFA 2PRLA 5BCAA 4WJEA 5TD4A 4MUPA 1VBJA 1HJXA 3UBPC 5C9ZA 4QCFA 2BG5A 4EX4A 3RJYA 4ACYA 2FPYA 1HN1A 2WJZA 3IV3A 2VZTA 4I5UA 3C8FA 3LQLA 1LOLA 4GYJA 2E3TA 3EKLA 1NEYA 3IJ7A 1S5WA 1T99A 1XM3A 4JQ4A 2CZDA 1WQ5A 2R14A 2Z25A 1TE1A 2VEKA 2C7FA 4HYVA 4J57A 3NEHA 1PZ1A 1IXPA 1FH9A 1VKFA 2VZSA 3C2RA 4DYKA 2D2JA 1IWPA 2A85A 3ONBA 4NT0A 5JUVA 1PKYA 1OFDA 2Z24A 3KL5A 3RHGA 2Y88A 1VQTA 2D2GA 1E4NA 3WH9A 3CEUA 4I3GA 3LPPA 3VX0A 4PTVA 2PEVA 4GUHA 2WM0A 3QGVA 3CV7A 2VEIA 2YCJA 1TWWA 1A5NC 1QI0A 1R46A 4KGLA 3H55A 1UMLA 1JEHA 1J93A 1J6OA 5BROA 4N0RA 3UT0A 1N63C 3MU7A 4CD4A 5JCIA 1TV2A 2JBMA 3IGHX 1GVIA 2C16A 2QCEA 4TUFA 3CQ0A 4GBUA 4E8CA 4PUEA 2D1ZA 1QPOA 3U5UA 1H7RA 4AIBA 5F4XA 2VR5A 1TTIA 4LAUA 4AWSA 3KTXA 3W26A 1YPFA 2E40A 1I0BA 3WLPA 1KLYA 2KZHA 4DO5A 3HBLA 2W62A 2YLAA 4BI7A 3QSTA 5FJRA 1A5AA 3WG6A 4NZ4A 4F0KA 1XG4A 2V2HA 4HK7A 3SCSA 1E9YB 4EPBC 2QDHA 3UXDA 1NQKA 2CETA 5KSWA 5G2WA 3NRZB 3R79A 4R7OA 1LL4A 1DOSA 1EXBA 4XZHA 1P0BA 4J9JA 3WMBA 2CITA 3MANA 1GRHA 2TPSA 1VS1A 3N04A 2R6OA 1X2GA 3THDA 1AL8A 4FHAA 1OFAA 2NWRA 1LUCA 3V18A 4W86A 3HU7A 3GVVA 1IT0A 4Q8QA 3R0UA 1AMKA 1SSDA 4K1WA 4YTQA 3UR2A 3W2MA 3L12A 5HULA 2WPEA 3NOYA 3HG5A 1OCNA 3QY8A 3GR8A 3CT2A 3O6AA 4J3XA 2PZNA 3L4VA 2A7NA 4DJEA 1RJPA 5GNXA 2VVNA 1LJYA 2R9ZA 4GUGA 1BYCA 1UIOA 4AVNA 3OA5A 4YN5A 4KGJA 1XBVA 3SO7A 1ICSA 4JTSA 4OVXA 2Z2UA 4FI4A 4AY7A 1Q2SA 2V3EA 2VCBA 2XWDA 3KRBA 4NQ1A 1MSSA 3WNMA 3LERA 3UYIA 1A3HA 2EQ9A 1EPVA 2BOEX 2A3LA 1JCJA 1TFVA 2WQPA 1JRCA 3UYCA 3EZ4A 3PK7A 2VCAA 3BE7A 1ITXA 2W6RA 4ICCX 4MWAB 3LLFA 2C6QA 3EXSA 1VC4A 3OYZA 2CIPA 1G9HA 5DO8A 5GJMA 4LVDA 1EWDA 3SI9A 2HDJA 3W1QA 3UY7A 5C9XA 1EO5A 1O5RA 4EMIA 3EMCA 3OGRA 3S5YA 1JR1A 1Q66A 4KEMA 1E6QM 3VABA 4DLMA 1RK5A 1CGWA 3NVDA 3MSRA 4DPPA 3U48A 3TAOA 4WX2A 2O4MA 1J0HA 2OSYA 2PDQA 3CGCA 3WD1A 4GYKA 2F84A 4QEEA 1RCOB 2FVLA 3L68A 1XRTA 4OT7A 1H7NA 1GORA 3VOFA 3Q45A 1RZMA 2CXEA 3NVTA 2PSNA 3P14A 4O53A 1K70A 1LROA 1OFOA 4IMCA 4GPNA 3HGOA 3GZAA 4B5SA 1F74A 1VBGA 8XIMA 3TYBA 5AYIA 1IXQA 3GH5A 1EGZA 4XZLX 4NI3A 1VJZA 2OZTA 3DGHA 1AUSL 2A5HA 2JK2A 4O19A 3IAQA 5EBKA 1DVJA 4APNA 3NQEA 4OFCA 3NO5A 3CGBA 1V6TA 3M0ZA 3MSDA 1UR8A 1FWSA 3CK5A 3DAQA 4R9XA 2NW0A 4J28A 4HU8A 2NZLA 3DFTA 3CT7A 3R1ZA 1K9TA 5HNRA 1LDCA 5I3JA 2CPUA 3QR3A 4UTIA 3TK7A 4G5DA 5GJNA 1Q6CA 4OECA 5FS9A 3TC7A 3B8UA 4DO4A 4L61A 4R7JA 2HBVA 5REQA 2X1UA 1VEPA 2V69A 6A3HA 1XLKA 1S39A 2WC3A 4U4MA 5I3DA 1JPDX 4DJFD 5A6TC 4PUKA 3DK9A 4Q4QA 5ER0A 1S5TA 3SURA 4E5TA 1H49A 4O52A 1FCVA 1RM6B 3FYPA 4DRSA 1MWOA 1P4CA 3S9YA 1A50A 1QOPA 3ZXWA 1TPB1 1QPNA 2WM1A 4RK8A 1ZMCA 3UERA 3CXBA 1UWIA 2OVLA 1A0DA 2FVKA 2BVWA 4ENLA 3FS2A 3O3RA 3TTQA 3NXLA 4CUCA 3LXDA 4AWUA 1R2SA 4W7UA 3S6OA 4HPNA 1RPXA 1FWRA 5EMMA 2Z27A 2EPOA 3OLGA 5C7HA 3CC1A 3KBVA 1JUKA 1SFJA 2PI6A 2CC0A 1TPEA 2E68A 3V5FA 3HG3A 3GYCA 2GH5A 2ACUA 2DP3A 3M46A 4P8VA 3GFYA 5CPLA 3LBMA 1U22A 5A6BD 4KQNA 2QCLA 3TQVA 2XSAA 4GYPC 5A8PA 1WB0A 4Y9NA 3EMQA 3B4UA 2PWHA 1E0VA 2G96A 1XI3A 1EJVC 1IF2A 1BYAA 4CCZA 1TCDA 1EDTA 2CKSA 1QW7A 3SRFA 1RCQA 2PDXA 3IJ6A 4IP7A 4QXIA 2YKKA 2I1OA 1AH3A 2V67A 1REQB 4V27A 4K37A 5BRQA 5A6AA 1BYDA 3ITLA 5FS8A 3UNTA 1E0WA 1UBPC 4DF1A 2Y7GA 3DENA 2WP6A 2QHAA 3PUDA 1UR1A 1KBIA 2J9ZA 2OZ8A 5BOFA 4PTNA 4HNTA 3G18A 4Z2IA 4PODA 4N02A 4LEQA 1E1FA 3S0CA 3UXIA 1TV7A 1O60A 4NIRA 4HU3A 3WD0A 4CN1A 4R85A 4S3EA 1UJPA 2WWCA 3A5VA 3W2KA 3W7JA 1W5QA 4H8NA 3SCPA 4KIEA 1PPIA 2ZYFA 1M41A 1HGYA 5EBUA 3GHRA 4CCEA 4A8RA 3BICA 3L2LA 1MUWA 4POCA 3HM7A 3GR7A 2VUYA 2BXYA 1H7XA 5KZMA 2ICSA 1E40A 2OEKA 6CGTA 3AMDA 3SGUA 1FXQA 4QJ4B 3FKKA 1WOBA 4HA1A 3WNLA 1CENA 4EWJA 5C2GA 2H6RA 4R34A 2WPBA 4I7UA 3LTYA 1DL3A 4C6MA 1YXDA 4NZ5A 3WBXA 1E6NA 3KTCA 4A2RA 1SJBA 3RR4A 2Q09A 3D6NA 3QXBA 3NQ2A 4IT1A 2Y0FA 1L6FA 3EX2A 4LXFA 3D46A 1KV5A 5EFFA 3OODA 4C6DA 1TA3A 3NQVA 2Q8ZA 3NVVB 2PDGA 2Y6ZA 3VZXA 1B1YA 2OGJA 2Y89A 3D47A 3W76A 5FEPA 3QYSA 5HA7A 2ATMA 4A3HA 1B31A 4F66A 4LB3A 4LQ1A 4LBSA 3FKRA 1BWCA 4BWLC 4NF7A 2XISA 4DBEA 4N2YA 1BRLA 4E8GA 3NXFA 5H1WA 4GISA 3LV5A 1FWHC 4JTRA 3HQOA 2EF9A 3QYQA 2Y5JA 2YXOA 3OVRA 2Q3OA 4Z1CA 4N9DA 3DBPA 1PUDA 2CFYA 4FP1A 4NI8A 3NYDA 3XIMA 2HSAA 4O50A 3IACA 2ABAA 4PYSA 2XGZA 5L6UA 3GC4A 1VFFA 1A3WA 4W93A 5HDRA 3LADA 3SUTA 1VB9A 1ONRA 4WXYA 1E6SM 4I7WA 1V4YA 3P3BA 4A3UA 1OT1A 3SGZA 2ZZ0A 4HT3A 6REQA 3S4TA 2J9XA 3PNUA 5IFTA 4NILA 1QNQA 3AMZA 1W1TA 1NHQA 4XKYA 1OJXA 1KRBC 4H4ZA 2P88A 2GRTA 2VFFA 2Q6ZA 4EQWA 1P1MA 4J5NA 1ZAHA 1NOFA 5TR3A 3OZMA 4WVXA 3M9YA 1FWWA 4Z17A 1PWLA 5CPTA 2G3FA 4ZA0A 2INEA 3MUAA 4XK2A 2ZIDA 3UY8A 3N17A 5FJOA 3E02A 5FL1A 1US0A 5BYWA 1RH9A 3ZJ7A 1S3HA 5AN7A 2YDSA 4ZOHB 3DFQA 3UVAA 5I2UA 4GQGA 4DWSA 4YCOA 2AL2B 4UQEA 4S3GA 4DYJA 1AJ2A 4RE3A 3H6OA 4LANA 1KFWA 4UTFA 1RPKA 4H7CA 4IPNB 1C8VA 2XH7A 1FO4A 4FEZA 1EQPA 4H4VA 4B4FA 1VRXA 2D0FA 2A4AA 3F5LA 3EKZA 3A4WA 1XLJA 3S1UA 3KEHA 1NF0A 3G1HA 4Z1AA 4MWAC 4D2JA 3PVFA 3CLMA 4F0SA 4UTWA 4GA8A 2NV2A 3NAVA 4N7QA 2X1TA 1RR2A 3DYPA 3KRZA 5F1UA 4X2PA 3TCSA 4H7ZA 4F2TA 1P7TB 3CMJA 4K3ZA 1JDDA 3BAIA 4AVFA 3ZJ6A 4BF9A 4YPJA 3W7PA 2BMBA 3IAPA 3LGGA 5SWUA 3E0VA 2YAUA 1GG1A 1GJUA 2E77A 3I6RA 3MVTA 2QJGA 4ML4A 4R7WA 3CASA 2QAPA 4D1JA 1FWJC 1RVKA 1SO3A 4GRTA 3UQNA 1TJ1A 3GIQA 1TTJA 2HK0A 5EA9A 4A8NA 1PSCA 1HP5A 4LNYA 4XSLA 1M7JA 1KTNA 4PMRA 4O10A 4IGHA 3B0PA 3TYUA 1Q6RA 3LHTA 5HUPA 2GVJA 4IPJA 3T8QA 1THFD 4XAYA 3ISIX 1EHAA 1KTBA 3K4AA 4AF0B 4MDPA 3O8AA 4RNJA 4C7GA 2WVSA 4JR5A 3K1GA 4IHCA 3AN1A 4XZIA 3S2LA 3LM7A 2NT0A 4H04A 3B8DA 3S6DA 3PR2A 2PUZA 4GQ0A 2HMCA 2EJ1A 4PCTA 1W5OA 1E0TA 3BCJA 1M9HA 1K4HA 5A1AA 1JYVA 1M03A 5GQBA 2WSRA 3C86A 4QBXA 4NJJA 2XSXA 1VBUA 2AAMA 2J66A 1FP8A 1WE5A 1SO5A 1E6PA 2BOGX 3SCNA 5B7YA 1QOXA 4UQCA 3UCCA 3LBOA 2ZA3A 1K8CA 2R94A 2Z1SA 4LV9A 1SU5A 1GVEA 4UTKA 4CNPA 5ENLA 3WNPA 2WMKA 2YFOA 4A05A 4LUTB 1NP0A 1P6WA 2J3NA 1BG4A 1QPQA 3L9CA 1XDMA 4Z1BA 3HTWA 3A7UA 1WNOA 4IIHA 3NQ7A 1C8XA 2FB2A 1GRTA 2HJPA 3DFOA 2VL4A 3GTIA 2C0HA 3OQ8A 1HL9A 3OIXA 2OG9A 1N5XA 3SRHA 4M6QA 3AQUA 2G0WA 1K1DA 1P6CA 4C90A 1GREA 2WW5A 3M5VA 3WDHA 5U1OA 4X0VA 3VXGA 3XINA 2FJUB 3H22A 3WQ6A 2GOKA 3TYCA 3GG1A 4QTGA 1W3HA 2E8YA 3CH0A 3UJEA 1T40A 3DFYA 2XU2A 1LQ2A 3LLDA 1D9EA 1KM0A 5CC5A 1LLWA 1XICA 1FDZA 1TQJA 2VURA 2O9PA 3KW3A 2HNEA 4M7SA 1FWDC 3UZWA 5IDZA 4HN4A 3Q6JA 3LU2A 4K8HA 3GRIA 2EQ7A 4DBSA 1LG1A 2BVTA 3N2CA 3BZGA 3W53A 1UD8A 9XIAA 4NYYA 4D8AA 1KQYA 4UFMA 4I8DA 4JFTA 1K4QA 2PDBA 2WZMA 4QFUA 2B4GA 4EE9A 4BI6A 2YGYA 5T26A 4PULA 3BL3A 3PFMA 2NSXA 3VDGA 1GPWA 2GFTA 3IGXA 1XIHA 3CJPA 4LW7A 4KERA 2OKTA 3CWHA 5IHRA 1W32A 1NOUA 2QUMA 4H9YA 2VWSA 5D03A 1UD6A 4TMBA 1TPC1 3PNZA 1RQBA 2W0UA 3NSNA 2VGFA 1OC6A 3OPSA 3P74A 1E4IA 4BCEA 4JTHA 1DE6A 2WK2A 2WOIA 1DKWA 3TZNA 3W02A 3FOKA 1KM3A 1F3TA 3EX4A 3KBWA 3ID7A 1UWRA 2BNJA 4FSAA 1GUVA 4XZMX 2D0HA 3L4TA 6PTDA 1ZBCA 3NNTA 1A5MC 1JZ7A 2R1MA 2J24A 2NXIA 4WR3A 5CJ5A 4H9ZA 2Y85A 4M3PA 3C2OA 1X38A 5I3KA 3W1TA 4IMGA 1H5YA 2DY3A 3A21A 1PKMA 2V6AA 1F3EA 2HVOA 4QISA 4LC6A 3FXYA 5HWMA 1BKHA 3HA1A 1W9UA 3APTA 1LZOA 3LB8A 1AZ2A 3LV6A 1WDSA 4NAFB 2ZZ3A 1Q1WA 4AD4A 1A0EA 4LALA 1EJXC 4TTGA 2GVLA 1ZHAA 3VIGA 4A2SA 4QIUA 3N73A 4HNVA 4RZ4A 1YIXA 3SB0A 2YB4A 3LS9A 2X0YA 2D73A 3W2JA 1UD5A 3LK6A 3KE0A 4UFHA 4XZBA 3QN3A 3CV1A 3M5YA 1CXIA 3CUZA 2WBGA 3DGZA 1SMAA 4O1DA 3L8KA 4GGBA 2F5ZA 1JF6A 1ZJAA 2ZZ2A 4U28A 4C6EA 4TMCA 2IKGA 3BV4A 2VZOA 3ITTA 3IIVA 3KOXA 4F4RA 3O6YX 2PBOA 4PZVA 3G1SA 3WDPP 1NFBA 2VRQA 3M7SA 3MYOA 4JHMA 1XIJA 1WXJA 3TP4A 4PRRA 3A9IA 1V51A 5C54A 5GRTA 2X99A 3EOLA 1KM5A 1V03A 2D3LA 3KLKA 3R4IA 3ZIZA 4AZCA 1WAWA 4KCVA 3NYZA 4ROQA 2ZOXA 3UZJA 4ATDA 3ZQ9A 4UNLA 3NDYA 1XW8A 4AZIA 3KFTA 1W9BM 4FR6A 3N1AA 3M64A 3BC9A 3MBDA 2NLIA 4DBWA 3K46A 3HPZA 5I79A 2G4FA 1XLCA 1G7UA 3M5XA 5HANA 1QNVA 1TSIA 1IGSA 2GUYA 2W66A 4IJRA 1W1ZA 1VP5A 1XIEA 4WDUA 2TAAA 2OMAA 1SZGA 3BVJA 1OBAA 1BXBA 3BQ6A 2ACSA 1KA9F 4A3RA 1B3WA 1BYBA 4FA3A 3HPAA 3POCA 1HFBA 1FCBA 3N6JA 3AHZA 3S5ZA 5I5RA 1YDNA 2X2GA 1CXEA 5GNZA 3AM9A 3AROA 1TYGA 2EHHA 3LNMA 3CGDA 1B4EA 1Y0EA 3VFLA 1LT8A 1TPUA 3QMSA 2GPTA 1HKJA 3SBFA 3T09A 3W7IA 4CNSA 2VI0A 5U25A 2PD9A 1XHGA 4EM3A 1VJSA 4Y7EA 5AZ1A 3SJNA 1KGUA 2WJFA 4RXFA 3A4JA 1WZAA 2DSZA 1LTDA 2YFNA 3AYSA 1JAKA 4DJDD 1OYCA 3CQJA 3SAZA 4XVDA 3NJ3A 3L0KA 5CZSA 3B9EA 1J2WA 2FH8A 1MFVA 3WH8A 5CAKA 5LA0A 2PCEA 3RCNA 3GG8A 3ZZ1A 2HNHA 3S1XA 2WNZA 3W71A 4B92A 1VCFA 2R24A 2J7GA 4Z08A 3TR2A 2IPGA 2PGWA 5E70A 5EY5A 3WLRA 3WEMA 3GXIA 3FGCB 2UY3A 3EX3A 4ORMA 1I4NA 5EGRA 1G4PA 3PSVA 3UW6A 2P0IA 5BU6A 1T5AA 4ZQMA 2OLSA 2J88A 3L65A 4GOAA 4IP4A 3S9ZA 3G24A 2O9OA 5A6SA 1S2TA 1DTUA 2V3BA 1FXPA 3L21A 5CKSA 3PPGA 2VXNA 4IOTA 3PFRA 4AB4A 1VLWA 1TV8A 2OX1A 3VIKA 5AC8A 2CW6A 2A8XA 2IKHA 3OGSA 1FY6A 1KCXA 4AZ6A 1IT8A 2AKZA 1LQAA 5DT5A 3N9KA 4ASTA 1ZQ5A 3CM4A 1WYGA 3AICA 3ZO9A 1R2RA 3N4EA 1ME8A 2GJLA 3QOMA 4RZ5A 2ISVA 3OZOA 2J6XA 3UVIA 1XQKA 2OJPA 3OZYA 1GONA 4X63A 4W89A 1AZ1A 4QDMA 4FNUA 1FEAA 1XP3A 1XLDA 1M3UA 3MPGA 2YA1A 3ZT5A 2BGQA 3VNIA 1PYMA 4IP5A 1VBHA 1H0GA 2P8BA 4MY8A 3BAKA 5KTLA 3ZLGA 3QM3A 3EPMA 2WKLA 3PULA 5K9XA 3VKJA 1XIGA 2QV4A 1SSGA 4X9SA 2GQWA 4QGCA 3V3WA 4TX9A 1H1NA 3EOSA 4CEXC 2YPIA 5DMYA 4IQJA 1TV5A 3E6EA 1R7AA 1ONWA 4H4UA 4U10A 2NQ5A 5I0DA 2ALDA 1LPFA 4MHBA 2QMKA 4U5IA 3TW9A 1R3TA 5HNTA 3GTXA 4X2RA 1TZ7A 3STPA 1TR1A 4ILSA 3VKBA 1MW0A 1W3JA 1BWLA 2ZX7A 3NZQA 4MY9A 4OU1A 1AFSA 3ZWTA 4EPEC 3PJUA 5K4ZA 3UZZA 3W72A 3QZAA 3NL5A 3TX9A 4I9JA 1GOQA 3F4WA 2XFYA 1SO6A 4LYQA 2WAGA 4US6A 2AQWA 4GZ7A 4FIRA 4EQRA 1YPIA 1V5XA 3AXMA 1JZ6A 4JN6A 4NAFA 4CNTA 1E4MM 2V63A 2W27A 3VGDA 1J0IA 3F03K 1UBSA 3DIPA 1TG7A 1NDYA 4FAMA 3W1PA 4L7ZA 4XZWA 2XVGA 1Q1RA 3T1GA 3BG5A 3TCEA 5I07A 2QCCA 2ZZ1A 1UOZA 3TQ0A 4EKJA 2ZC8A 2XH2A 5HOSA 1TJRA 5T9CE 2BFGA 1V0MA 2QAFA 4ERIA 5I78A 2VELA 2FZ8A 1DXIA 1VFTA 1L2UA 3FA4A 1H7PA 3AYVA 4JDYA 3WK0A 3VK5A 1ZU8A 4Q4OA 1BF6A 3WD4A 4Z2KA 4MZ8A 3THQA 3PB2A 1TB3A 1UH3A 1PDZA 1Q6OA 1UOKA 1I0DA 4QAWA 1HUVA 3SY8A 2ZZ4A 2DV0A 2E25A 2A21A 3BW3A 1CYGA 5LHEA 2YW3A 2C91A 4GK8A 3D9XA 4YVVA 1EDGA 4G56A 5ABTA 3QGKC 4GHRA 5AB3A 3USBA 3REQB 3G77A 2BXVA 4GKLA 1L8NA 4XKMA 4UTHA 3QEZA 1F8WA 4RPQA 4RZ6A 1XDLA 4CQAA 1KXHA 1SZEA 5TQLA 4H9XA 3F2DA 4GXPA 1XS2A 5JH1A 1D3HA 4GGHA 3HQPA 4M51A 2YXGA 1XIMA 2E5AA 4HN8A 2VZUA 2E1WA 1Q6DA 1ALDA 4IG2B 4GR1A 1WDDA 1SJDA 3GXNA 3Q65A 1RLDA 1H6VA 3T4WA 3PSWA 3T2OA 3M5ZA 3NSMA 3GXMA 2WNQA 2DQXA 3ZR5A 3E5PA 4QS6A 3L67A 1CB2A 2FFCA 4GRSA 3MDUA 2RDUA 3IGUA 4K39A 2ZDSA 4CD5A 3L4UA 4JN7A 3G8RA 3YPIA 4JIEA 2GSHA 4OHQA 1WDWA 2AKMA 4WIWA 1L6GA 1GK8A 2FTWA 2INZA 3UWEA 5JU6A 2OX4A 3GM8A 5M03A 4M19A 4O0ZA 1DWFM 3WDIA 3AZRA 2DH2A 1UPMB 3P5ZA 2FB3A 4JY8A 1L8PA 3W1XA 1D3CA 1EQCA 2VMFA 5EB8A 5KITA 4TVCA 3QC3A 1QCWA 3NDZA 3UETA 1C9DA 4KPRA 4PC8A 1QPRA 3B03A 3RU8X 1XLEA 3O9NA 4G1KA 3QW3A 5JVLA 4AW7A 2ZC1A 2C8NA 4WKAA 4DPQA 1LBMA 2D24A 1EUAA 3TE9A 3QW4B 2YL6A 5LXXA 1M01A 4LJ3A 4WJXA 1CECA 3STEA 4N6EA 4GKTA 2ZE3A 3UWYA 5E0KA 1W1IE 1UIPA 2QCMA 4GC4A 3A7RA 4K2SA 2ZTJA 4YXGA 1ICPA 1XH0A 1KCLA 4GNKB 1KB3A 3STCA 3ZS4A 4H4TA 4MNMA 6XIAA 1LLOA 1LBFA 1LLZA 4JTQA 3PC0A 4D6JA 2FFIA 4KH2A 3WY1A 3VCRA 1EJSC 1HO4A 2VDHA 2ZXDA 3AJ7A 1W3LA 1WCGA 2VX7A 3CV6A 4O8AA 4FNQA 4JHOA 1V0NA 6TAAA 4D9PA 2OKOA 3ZVIA 3N6HA 1A47A 2FPTA 1M53A 5JXQA 3UG3A 2P3ZA 4IJCA 1XGZA 2Y4SA 2JKEA 4HOXA 1UROA 2AMXA 2OOGA 3VIFA 3P8JA 4Q6JA 2B81A 4GZEA 4S3FA 2HE5A 4BS0A 4WGXA 3BCFA 2UV8G 1ZAJA 1FFRA 5CPSA 4L4LA 1FFQA 1XYAA 2FYMA 3GH4A 3KZPA 2UY4A 3MP4A 3P6LA 1EPXA 2V82A 2PU0A 4KW2A 3DEQA 1R86A 3OLIA 1MNSA 3ZLFA 1RAKA 2J7FA 3DFHA 2PTZA 3GIYA 3GDTA 3CHCA 1RY0A 4DF2A 1ECEA 2WHMA 2O4QA 4AD1A 4ZR8A 2ZE0A 1CGTA 4ZCWA 3CPGA 3C2FA 4HZ6A 5DCEA 2V2DA 3H23A 4XX6A 3B9JB 2WC7A 3AIBA 4ZQNA 3S46A 1R47A 2YBTA 1AW2A 3AMGA 4AWTA 1QDSA 1JYXA 1OX4A 1C7SA 1D8WA 2J7EA 5GJPA 5ABFB 3CUFA 4UZUA 2PE4A 5EKYA 3CL6A 1QPKA 3WUBA 1XGDA 4JN8A 3ZVHB 3LHZA 1M7XA 4PSRA 3ANUA 1UKQA 3WQ8A 2P8CA 4CEUC 2F38A 3ES7A 2WXDM 2X0HA 3VILA 5A6JA 2ZWZA 4C1NA 2O9RA 1F4HA 1UG6A 1OCQA 4ES4A 1E51A 1RBOB 3GU9A 4JIHA 3GYEA 3NWRA 2EQ6A 2QJJA 2NVAA 2X8HA 3BSGA 1WUFA 5F2LA 3EOUA 4H2CA 2B7PA 1O94A 4N4QA 1Y7VA 4AYGA 2CLIA 3LN3A 4IMFA 3WFZA 6TIMA 3RAOA 2VC5A 3KX6A 1B3YA 4MVAA 1LP6A 3VVGA 1UC4A 4H4XA 3L4WA 4XBSA 2X16A 5HR7A 1ODZA 3ZSSA 4UC5A 1V3LA 1FFUC 2I17A 3GU2A 4WY0B 2ZCGA 1KKOA 2EPKX 1O6IA 2ALRA 4RV3A 4AC7C 3HQNA 3FK4A 4CKQA 4L9XA 3VUSA 5CLWA 1X1ZA 3AIUA 3VZZA 2OEJA 1JXJA 1IEIA 4CVWA 2DUAA 3MZ2A 2OT1A 1GEUA 3C56A 3EPNA 3TJXA 3RMJA 4DAFA 2D3NA 1DQXA 1EJTC 2OFJA 4GQRA 4M52A 1H1ZA 2OEMA 3M7WA 4UQ9A 4NEVA 1S3TC 4F0RA 4YYCA 1XFBA 4FLQA 1DJZA 3KOFA 2YJQA 1MQPA 1HKKA 1G94A 7A3HA 1J0ZA 3PTMA 5CC7A 4YTTA 5M3WA 1PHWA 2JKAA 5D4YA 3R07C 2DFAA 4ZENA 3BJTA 3FVDA 3N9SA 5AECA 4M8UA 1BTMA 2PDWA 1BSIA 1R3QA 3GD6A 2ZRXA 1Q6GA 3EOOA 2G95A 1Z9AA 3N29A 1B9ZA 1G1YA 3SUSA 2BY2A 4R88A 2YQUA 1W3KA 3K13A 5CZKA 4FXRA 2GGEA 3KBNA 2DIKA 3IC9A 5D8WA 1XPYA 3ARTA 1JCTA 1X8CA 2PDJA 4GO9A 3BWWA 1ONXA 2VUNA 3LPGA 4DIAA 3TN6A 4O1EA 5FL0A 5I6SA 3O6DA 5DY2A 1LRTA 3TA9A 3II4A 3S8HA 3G0SA 4JKLA 2GQ9A 3EEGA 3T07A 3RIKA 2PRHA 2WOQA 2RGLA 3HURA 4PH6A 3SEPA 1HP4A 4IF2A 1TZ9A 4YHGA 1W3IA 2BY0A 3TTEA 1ITQA 4MG4A 1NDAA 2YW4A 5C9WA 3BJSA 4AD2A 4UTMA 4QE1A 4JTTA 2HVNA 1UZHA 1J10A 3LYEA 4HNCA 3VAVA 1QVBA 3N11A 4FR1A 2E67A 3CYJA 5HPCA 3QVQA 1EBHA 2F2KA 2Y7EA 3VNDA 3M0HA 4FNRA 1EB3A 2PTDA 2CZFA 2PGRA 1PE1A 1PCWA 1YYAA 4GWEA 3VIMA 1H09A 3T81A 5EPDA 3TYAA 2GR2A 3W70A 1EOKA 3GIPA 4JBRA 3W7MA 4B3ZA 3IEBA 4LBUA 4DHGA 1UCWA 4UR9A 3GNRA 4B3LA 3WEOA 4EF8A 2VFEA 4IFKB 2PDCA 3EXRA 1XKYA 2C18A 1XIIA 3D5HA 2UY5A 4LUSB 3W1MA 3UXLA 3UPBA 3ITOA 3SN1A 1H63A 2L5HA 1BWVA 5A3HA 1I60A 3QV9A 3ZR4A 1TV4A 2DT3A 1ISWA 1YX1A 3WDQA 3PBYA 4ZODA 3STFA 3II1A 3CWOX 1NFGA 3PS7A 1GOIA 3GXTA 1FWFC 1V79A 3U0HA 4JL1A 4DNAA 5HATA 3EB4A 2KAUC 1AQFA 1F61A 1XYZA 2VX4A 4JS3A 2DVXA 4WKFA 1UPPA 4NRRA 2WMGA 2XINA 1XC6A 2PWVA 3FEMA 4KPLA 4E3VA 3UEQA 2XN1A 4DJFA 1AG1O 3O15A 3PZTA 1SPQA 1W37A 2QCFA 1UH4A 4UMAA 1XCWA 4X9YA 1X8FA 1HF6A 4JQ3A 4NNCA 4HNNA 4GC3A 1TWSA 3G8EA 2CLHA 3RM8A 1NJJA 4OBTA 5JBDA 1R3SA 2VC7A 3W2LA 3L4XA 4B2DD 1X97A 1HG3A 3VMNA 2PBGA 3H7RA 5LNSA 2WHKA 3SSJA 4P7NA 3TFXA 1FQ0A 3MCNA 1KFCA 3GDMA 4UQBA 5D2VA 3VD5A 3BLEA 3BZJA 3NL6A 4EXQA 1AQMA 1GOOA 3O6CA 1XJBA 3QFBA 1EJ7L 3ITGA 4ZQPA 3WELA 3NGFA 2C3CA 2BC0A 2J8FA 5D9NA 4OQVA 2GSJA 1V6YA 1P48A 3BSHA 1YXYA 3N4AA 1W9DM 2FDMA 1R87A 4Q8VA 5A6BA 2QPUA 1LBLA 3LENA 3BCDA 3DU0A 4MUZA 2NQLA 2EQDA 4JOMA 4NY2A 4NSBA 4ADTA 3CUIA 2DSVA 4J1OA 1G67A 1JVNA 1O7AA 4XZNX 4LRSA 2GGJA 4PFHA 4KIRA 4LOCA 2X05A 1TVNA 1MXGA 1CLKA 4C5ZA 1K9EA 1H0IA 3QMRA 1GEHA 4MAZA 3NQGA 4UIOA 2C0AA 1BPLB 4GIRA 1YNQA 1TZZA 4M29A 4AEEA 3QR1A 3V5OA 5EMUA 1H61A 5FSDC 4QNWA 4H3DA 1E9IA 2ZZ5A 1YRRA 4NNAA 3O06A 4NZJA 1HTIA 1R9ZA 4NUWA 5HAOA 3PBWA 2QIIA 1GQJA 3V16A 2VFDA 2OOFA 1HJQA 4UFLA 5T8GA 4LCSA 4CQ8A 1YDYA 1JUEA 3NZGA 3A24A 2AQOA 3M16A 4LUIA 4XD5A 3LCWA 3WQCA 1R0MA 3KCJA 3O7UA 5BU9A 3N13A 5I3GA 3C0SA 3KWSA 3H24A 4MM1A 3S2CA 1MW2A 3TMQA 4DUOA 4QSHA 1W54A 3TQPA 3M41A 3HRDC 1VAHA 2J74A 1M04A 4QR6A 2G97A 1FHLA 1S46A 3RMEA 1OSEA 3R2GA 5FSEC 4NX5A 1ZY9A 3CB3A 4N4PA 4MF4A 1SB3B 3VD9A 5F2IA 3DK8A 4N9BA 5D05A 2NQJA 1OHLA 2V6OA 4H6QA 3GTHA 1RY8A 4U31A 5AHFA 4GVHA 3U2ZA 2NX9A 2QV5A 2YCEA 4XISA 3HIJA 2FIQA 3K30A 3B0VC 3OBKA 4IMEA 4MOZA 3UWQA 1KR1A 1KFJA 2EKCA 3LTPA 3H7VA 3S47A 2DVTA 4AX7A 2WPFA 3NEVA 1Z48A 3WQPA 4GXMA 4Y9AA 4NXSA 1TIWA 8CGTA 1MRAA 1SFTA 1PJ9A 1KR0A 2NVKX 4OKDA 3IRDA 5DN1A 3UWZA 1H11A 1T7LA 1ZALA 1J5SA 4H7VA 3NG3A 5FEWA 1W2VA 4UXDA 3VIHA 1OG0A 2OWXA 2NV1A 4IPPA 1DJWA 4FNTA 4LF1A 4U2ZA 4AZGA 1KM1A 2AGTA 2DJXA 1TREA 1FTXA 3BK0A 5HINA 3RNMA 1TO3A 2EAWA 4IFKA 5PTDA 1EFZA 3QKEA 3MHGA 5IBXC 1WDRA 5H8MA 2ZX6A 5FS6A 1TELA 4CD8A 2ZXAA 3Q58A 3RK8A 2YA0A 2CWNA 4NAEA 5T91A 2EG8A 3E38A 3NO1A 3SY1A 3DG7A 4Q4RA 3ATYA 4KEUA 4JY9A 3WJSA 4DEFA 2ON3A 3U6WA 4CU7A 2VQTA 1E55A 4XO7A 3WK1A 2HZGA 2PDUA 2Z6JA 2YL5A 4BQ5A 2DJLA 2WPCA 1ZENA 4Q4MA 3QGAC 4OE7A 3V75A 1EOMA 2E6FA 4Z0SA 1M7PA 4LY8A 4Y8EA 3EWZA 3S6TA 3ECQA 2GQ8A 2BC1A 2YCLA 4L80A 4D6FA 5C6MA 2BV9A 3KL0A 4UWMA 3DH7A 5I3IA 2ZUSA 3BLIA 3B4YA 3T0TA 5AYZA 4NG3A 3UXAA 1NY1A 3SQPA 3XISA 2PTWA 5LIYX 2HWGA 4O1BA 1CGXA 4RW5A 5KZEA 4GY7A 3WUEA 4AD5A 3AWOA 4O0QA 4ADWA 2V5DA 3IJ9A 4ICMA 4XVEA 1T41A 2ZICA 3W86A 4MYAA 1ZBWA 3F2CA 1J4EA 1VPQA 1TWIA 1PIFA 3OW1A 1BWKA 3K1DA 4OJYA 4PB4A 2XYLA 1F6PA 1XSIA 1H41A 2P1FA 3EA3A 3GQYA 1FFVC 4H4QA 4NZFA 2WKJA 4GI6A 2TPRA 1YBQB 5EFDA 4GH3A 3KVKA 4B5VA 1OD0A 1K77A 2QVHA 4G9PA 3KLLA 1WOAA 2OYLA 3RLGA 2DVUA 1DIKA 4FB7A 3WL1A 1JROA 3AS3A 5FKYA 2PDFA 3H2EA 1UUMA 5C0QA 2W79A 5BRBA 4B4HA 2QVNA 1B9BA 1QI3A 3LHYA 5JCNA 4P8XA 1LQ0A 2WOWA 1E73M 4FX9A 4MZ1A 3EWDA 4F8XA 3VDBA 1U1JA 3TROA 2GVYA 2G3MA 1EH9A 1E43A 4E3TA 2J8GA 3JR2A 3OZPA 1LWJA 3NM1A 4UFIA 1VFHA 2WJEA 4GNVA 4YCPA 4C7FA 4PMZA 4P5UA 2FZBA 4Q22A 4YS1A 1C92A 4PMOA 4IXXA 4QAIA 4Z2GA 1I2RA 3TU9A 3C5QA 4TX8A 3KXQA 3LHWA 3O16A 3P60A 4XUYA 5CQ1A 3I7QA 3UESA 2DW7A 1NH6A 2XG9A 4HSHA 5G4HC 1FVPA 3WQ5A 1IEQA 5I03A 1OYBA 4IFRA 4HNUA 1XIBA 3F4VA 5HJYA 2X50A 4KCWA 3I7SA 3ERPA 3GC5A 2W0HA 5CZ0A 2RDWA 3INPA 4Q32A 4UTTC 3NPUA 3VI2A 3W2NA 2CBJA 2D20A 3WQEA 1OADA 5CAHA 1ELSA 3TJIA 2EPLX 4W85A 3MC5A 1KFBA 1DYSA 4H00A 1IEXA 1RVGA 1YW1A 4P7OA 3PPHA 2BCPA 1HO1A 3WZ0E 5JCKA 1XV8A 5D2YA 3MP3A 1K6AA 3RF9A 1CLVA 1OG6A 1W5MA 3B97A 3CO4A 1R8LA 1QRQA 4D72A 4QP0A 3V0SA 4GUJA 2QGHA 5I09A 3AUOA 3LSBA 3CHFA 3OVQA 2CXGA 1VCVA 4C91A 3R7MA 1XIFA 3PUEA 4KCTA 5E93A 3VIOA 1GETA 4S3DA 1ZCCA 4H2HA 4GUIA 3SCRA 2DT0A 4LY4A 3ZT6A 2E5CA 7TAAA 1FHDA 1XLGA 5TIMA 4O16A 4K6AA 4GQBA 4G7FA 3T40A 1QJWA 4RDWA 2SFPA 1LUCB 3EF6A 2FJKA 4MB5A 5FAJA 3WK3A 1TWZA 5AHIA 4KS0A 3UR5A 3C3NA 3WQOA 3SGGA 1HJVA 1Q6QA 3TXZA 3VPLA 3EBVA 3OA3A 3W7EA 1S5NA 3G3DA 1FWNA 1BGGA 4RNIA 4L1XA 5TNVA 4IL2A 1PTAA 2Q8XA 4TTUA 3U57A 4LVAA 1H1YA 2J8TA 2H90A 3H4WA 1AQHA 1AH4A 1TJ0A 2EEXA 3WLJA 3LMZA 1ADDA 4M56A 1EYEA 3PZIA 3MSGA 4PTWA 4ONVA 5H6HA 1XYCA 1V6WA 3WL0A 1XIDA 1WXZA 3GVWA 3JRKA 4JIPA 1ONFA 3MUZ1 3PP7A 2J62A 3VKAA 4DZAA 2BASA 4QLKA 5FCZA 1M7OA 5U7SA 1KV8A 3MV11 3QY6A 1TMHA 4L5ZA 3WQVA 2ZX9A 3ES8A 3S1WA 1PIGA 3LXBA 3GE7A 2P3EA 3CHVA 2WZHA 1RQEA 5K3VA 5DBTA 3LPFA 3CWNA 1E3XA 4S3BA 1BVZA 5HMSA 5E6ZA 5CLTA 3HGJA 3NQ8A 5CC3A 1V59A 4OTKA 3CZJA 1LWIA 4HSOA 3N3MA 3AS0A 2MUCA 1UUQA 1Q7ZA 1OINA 2E0PA 2YSWA 3HV8A 4O15A 1RCXB 3LQGA 2V81A 1U5VA 3L66A 3S2NA 3UJFA 3BJFA 1CPUA 3DFNA 3OQEA 3CMGA 5G4EA 4GJJA 2YL9A 3SSZA 4N42A 1L6WA 1TMQA 2F6UA 1KCZA 1F07A 4AMCA 5D9OA 2ZXBA 3UGRA 3MV01 3RO6A 1OIFA 1TVLA 2J7BA 3T78A 5CSRA 4Q4KA 5AC6A 2WSKA 5IOBA 1TR9A 4GIAA 3W2UA 4H01A 1X2HA 1QO2A 4DUWA 2Z2BA 3H2OA 3PF3A 3SR6B 1LF1A 4JFUA 4YVPA 3UPMA 4HPXA 3OEXA 3KOZA 4TO8A 2PF0A 2X7VA 4GY1A 2PU1A 3ME3A 4AZHA 4AU0A 4AHPA 5BXPA 4M6UA 3RFAA 1R30A 1OGGA 2X30A 3KVLA 4BURA 2BBFA 4DF0A 3VKCA 4MNKA 3HQ1A 4MY1A 4AZ7A 1C93A 4MWAD 3KOYA 5AHNA 1GTEA 4JFVA 3VNJA 4LSBA 5CJNA 1E0UA 3C4UA 4NJHA 4A35A 5REQB 4JKKA 1ESWA 4DJDA 1VPYA 3DFSA 3LM3A 4M5PA 1W8GA 3KS6A 3LXCA 1AJZA 2FQIA 3G1VA 5AZ0A 9CGTA 3UG8A 4LGXA 2JIEA 4PL1A 3ABRA 1LRQA 1YHTA 2CZVA 5D32A 5M17A 3GXPA 5CZJA 3USZA 5ABGA 5HMDA 4S39A 4IFOA 4IIDA 2DSWA 2NQZA 4J40A 1G6CA 3W85A 3EDEA 1JRPA 4GCAA 4EACA 1VYRA 4JGDA 1W17A 1V3JA 2FDSA 2CBVA 5EYWA 1Q13A 2GVGA 1G4TA 4AD0A 7XIMA 4PMQA 4JXCA 4I9AA 3TLQA 1XRSA 1H7WA 4ATWA 4Q7NA 3U2OA 3GAKA 3A9BA 4OZOA 1TCMA 5XINA 1KGWA 2E5DA 3R0DA 4ZZ9A 1EP3A 3AOFA 1A5BA 5G4WA 3GU1A 2V5KA 4W87A 1F4AA 4S3JA 2VKZG 3DHUA 2H8ZA 1P0EA 2XUCA 3IARA 3AIVA 4MNJA 3T8LA 3NPVA 1MRQA 1KBLA 4JTCA 3LEPA 3KVJA 2H3BA 3WMSA 3BGGA 4UNKA 1OCJA 2TMDA 3C0QA 3AIWA 3NVZB 3M0XA 5CSYA 4V1XA 4DZHA 1Q4WA 4DELA 5MKGA 3UR8A 1LG2A 5LYRA 3QFEA 2ASHA 4FK9A 1N8WA 2E9MA 4DZ5A 4ZO7A 1F73A 4HCHA 1ZBKA 3H8AA 1Z69A 2BB0A 3AMKA 2I16A 2KX9A 2WHLA 5DMNA 2OU4A 4PGLA 4F0MA 4GINA 2QJMA 2GR3A 1CGUA 1XCFA 4E8DA 4GCXA 3MSYA 3PBMA 1JZ8A 1RA5A 3VDHA 5I24A 3UCDA 5JBEA 3LOTA 1IV8A 4Z2JA 3TNBA 2JGYA 2HS6A 5LIUX 1S1PA 1Q2RA 2O56A 3MUIA 1QT1A 1R9YA 4LF2A 1V6UA 1MUMA 1EHNA 4UUIA 3BG9A 1JDAA 2Y63A 5TAOA 4HPHA 2YL8A 2C79A 1I75A 3SW6A 1OF6A 4TQTA 4DI8A 1JOAA 1SR9A 1CGYA 2INFA 4KFNA 5A8QA 1S2CA 2F61A 3ARXA 1OFPA 3FV9A 3PTDA 1B90A 2OO6A 3UWWA 2ZUNA 2R1PA 2OT0A 4J35A 3W74A 1BKSA 3DZ1A 4NVTA 2FHBA 3WBWA 3NS1B 1KD0A 2VR2A 2QUNA 4WDWA 2YR1A 1S2UA 5K9CA 1TA3B 3ITCA 1VEMA 1QW8A 2OQLA 4HNOA 3UJRA 5JCMA 3A3WA 4H4SA 3O05A 2WO5A 4OBRA 2CWXA 2GJRA 3CPUA 2QUTA 3NVWB 1UYQA 1VFLA 1YTKA 3BMWA 3WJWA 1IWBA 4PBGA 2YBVA 1U5HA 3LPOA 3IV8A 1N60C 1E6ZA 1BRLB 4GY0A 4F0LA 2W55A 1AW5A 3B40A 3WFAA 3THCA 2WVVA 3L2MA 1VYSX 4S3CA 2OWWA 5K2ZA 2D2HA 3E2VA 1PWMA 3KP0A 4JD4A 3BUVA 2NXGA 1PX4A 1E6XM 1JCXA 3WMLA 2VRJA 3LZ5A 4QG9A 1QATA 1ML1A 1QWKA 4CN4A 4R9OA 4QG6A 4YL2A 1K9FA 4UOZA 3T0AA 1XDJA 1BXCA 2V2CA 4B90A 5A5WA 2CEQA 1K8XA 4D8ZA 3W37A 3L0NA 1QNRA 1X6NA 4HK6A 1JEZA 2ZWYA 4B5WA 3WLLA 1OQFA 3P8IA 3VGHA 1ZP4A 4B91A 6REQB 1XD0A 5C2XA 2ZRVA 1EO7A 4ZOEA 4Y2WA 2J77A 1SFSA 4XKYB 2IKJA 1K9DA 4US5D 3IRSA 2D23A 3QQ1A 5JMUA 2XJ7A 1E9ZB 3E0FA 4AZ5A 3PAOA 3DN5A 4G8TA 2BODX 2XVPA 1A0CA 4UBPC 4DJEC 1WO2A 2XFFA 4BY3A 1NELA 4CGTA 1UC5A 4BR1A 4ZOAA 1MXSA 3GVGA 1C8YA 1O95A 1V3HA 1ZGDA 2OZ0A 1JPIA 3HO8A 2W5FA 3PPFA 3SCUA 1TV3A 2ISDA 2OZ3A 4WEVX 3W1LA 4DWSB 4H8UA 2I9EA 3ITXA 2WPGA 1F7BA 1NF7A 4UCFA 2HQMA 4JNMA 3NSXA 5LGXA 2F8QA 4BQ2A 3GDBA 1HT6A 2VRKA 4H50A 2FKPA 3VGBA 4EXAA 4B5XA 3B06A 4S3AA 4AZBA 4MJMA 2GLKA 2W9MA 3QFAA 1E0XA 2PTXA 4IGNA 1O5QA 2H9AA 4IUOA 1CBGA 2WMIB 1JDEA 1U1HA 2WZIA 5HPOA 4QQUA 3COTA 4KT2A 3GHUA 2PDIA 3RXZA 2WB5A 2IQDA 4IUGA 5CGTA 4JX6A 4L4MA 4C6JA 3BO9A 3PJWA 5FF3A 2XZ9A 2GQ3A 1XBYA 3H53A 4LH8A 2HPIA 2OQYA 3M6DA 4L64A 3VIJA 4LV4A 2DIJA 4AVOA 3P2VA 1XISA 3P62A 2A3EA 2VVSA 1UWSA 4D6EA 4W5ZA 3FAXA 3GY1A 1W3TA 4PTXA 1WX0A 1ZNNA 1C90A 2QZRA 3M44A 4DZIA 4JQAA 3AI0A 1PKNA 3UFYA 1ISYA 3JZUA 3BSMA 3SECA 7TIMA 3I3EA 5IRPA 3PPCA 1W8SA 1EF2A 1ZRQA 2A3CA 1MQQA 2WCGA 4EMJA 4AX6A 4O18A 4LCRA 2CLMA 4AXKA 3WDRA 5FOOA 2A6LA 5E09A 3THUA 2AOSA 4MLJA 4CNOA 3W6YA 4HVXA 3WH6A 3VM7A 3BPWA 2ZQ0A 3ZSTA 1SYTA 3CPRA 3DERA 3B3DA 2VJXA 2EBNA 1J2BA 7REQA 1UR2A 5KVIA 1DWGM 4GG9A 1QI2A 4EM4A 3FG2P 4TVDA 4NNBA 5DCBA 3IGSA 2PODA 2CLFA 2VT0A 4PBEA 3WJYA 1ZKQA 4U5KA 1XSKA 3E96A 3WLKX 3MYPA 5A8MA 2PDMA 3P0WA 5F1VA 3AU2A 3L0GA 3SJ3A 4Q8OA 1ZB5A 3WBAA 1DXLA 2E4TA 2DZXA 3SIMA 4BEQA 3HFYA 5IDIA 2VP8A 3N18A 3BLPX 1GRGA 2VQUA 2PP1A 3CV2A 3DHPA 3SCTA 1W56A 2OCZA 5DBUA 1RBLA 4KCUA 1JNEA 5CBBA 4L6OA 4BQ4A 4UB9A 1UP3A 3DI1A 3WMCA 1UD4A 3TEVA 3PG9A 4YMZA 2PWFA 2DIEA 1TMLA 3ATZA 3R13A 1OM0A 1SO4A 2QNEA 5FI8A 4JTDA 4RZBA 3T9PA 2NSOA 4Z2HA 4PA8A 1UMYA 1BQGA 2CESA 2YA2A 3W28A 3VC6A 3DCPA 3TFCA 1W9XA 1IQ8A 5K4XA 4IIBA 4M6PA 4GNJA 2ZX5A 4DM2A 2NX1A 1ZSXA 2W91A 5ECVA 4ZSTA 3NZRA 3SQMA 4QE5A 3AALA 2PDPA 3FDKA 2GR1A 2E6AA 4D6IA 2E1DA 5DRCA 4JYFA 1TYTA 3RG6A 6XIMA 4CN6A 4LUJA 3GVQA 4RX0A 2FTYA 3Q4DA 4NASA 1D7KA 4M81A 4EK7A 4GZIA 1OWQA 4GD0A 2OQHA 3MKKA 3ONCA 3UZ5A 3WLTA 3BG3A 3A13A 1VRDA 3F1QA 4QLLA 1MNZA 1UZ4A 3WYZA 3BAXA 1CTNA 5FMHA 3LZ3A 5BRPA 2XIQA 3RITA 1O12A 3LRKA 2WC4A 1MZHA 3NOEA 1I2QA 4JL2A 4I5XA 3F4NA 3VE7A 4MB3A 1L9WA 1H2JA 3TC3A 4IMAA 1QASA 2DUZA 3KLJA 2FZMA 3W75A 3V7PA 4ZO9A 3UZYA 4ZBCA 1GQIA 5LNWA 4L4PA 2V9DA 4X0NA 3MI6A 4DI9A 1FCUA 4M1BA 5KMYA 4HHMA 4LS1A 1EZ2A 1JD7A 2Z0IA 3K8LA 4G1NA 3RR1A 4RE0A 3VOGA 1GTHA 2PGEA 1KFEA 2IW0A 4HIBA 2FTPA 1GQKA 3DG6A 3WSUA 3LUTA 3A7AA 2F7FA 3ZM8A 5C70A 3UG4A 3FN9A 4U33A 3OOQA 3FYOA 3VFCA 4ZL1A 1HQTA 1XC4A 4NKCA 1NM9A 1XYLA 1WZKA 1I45A 3L7RA 3MCMA 3HB9A 2DZAA 2E6YA 4ZO6A 2JFEX 1TPFA 3IVTA 3GDRA 4OGZA 2FZNA 4WD0A 4O28A 1PB0A 1J11A 3CU2A 1F76A 2VO5A 3ORWA 3ZOAA 3VGFA 4LAOA 5CH9A 4ZOBA 3SUWA 5K9DA 1MXDA 2VCCA 1MO9A 4CD6A 4E0CA 2WMIA 2VR4A 3AXHA 1EA9C 3GX9A 4H9UA 3UP8A 5D09A 1QU4A 5FD0A 2VGIA 3CXOA 2VENA 3FIGA 5A2BA 4QS5A 1J5TA 2XTKA 3NQDA 1XBXA 4AZCB 2XZ7A 3CUJA 1R3YA 3FJNA 4ALDA 3LA4A 3SR7A 1YQZA 1XLIA 3W82A 3CQKA 1EBGA 3B8TA 4LAMA 3BV7A 5LSMA 3CQIA 4AIEA 1S1RA 2HK1A 1JNDA 2D0GA 3MO4A 1R3WA 3DX5A 3N9RA 1HIZA 1DNCA 4EXBA 3AHYA 3WLHA 1X1OA 4DNMA 1IIGA 3AHVA 4HU0A 3KBSA 4DO7A 2XPKA 5DQPA 4GACA 2GR0A 3S1VA 1UA7A 3GC2A 4C6OA 4K1GA 3TQKA 2ZUWA 4XB3A 3V1HA 3KWXA 2YDQA 4LIIA 3W24A 3TONA 5BWFA 4O17A 3EX6A 5D2XA 2VEGA 2J47A 3DYOA 1NTHA 3NO3A 3RU6A 2NWSA 3AXKA 3LI1A 2QCDB 3TW6A 1EBDA 3I4EA 4J2MA 3PJXA 1DQUA 2P5NA 3MA8A 5J5DA 3BARA 4AH7A 4EOUA 1JPKA 3RPTA 3NURA 1OFQA 1XANA 1YADA 3L5LA 3V4BA 4WQ6A 3BOFA 3GNPA 1DTNA 4XWUA 2IXVA 1QNSA 5IFPA 1W1A1 1YXCA 1EXPA 3GNDA 4UMBA 1TPDA 5CGMA 1GOXA 3KRSA 3RLVA 4MLRA 5E0CA 4XSMA 5D38A 4DWSC 2EKGA 5LZLA 3PWIA 4HZ8A 2Y7DA 3TTYA 1GRAA 2ISFA 4CQ9A 5M5DA 4PMUA 2ZRYA 3AIEA 3T42A 3IJIA 4LB4A 1RD5A 1CW2A 4H9VA 1QO5A 5A95A 3AO0A 3V35A 3VX1A 4B2DA 4RKAA 3B8WA 2QJNA 1C8QA 4V33A 4UTWC 1LVLA 3ZLHA 1US2A 5C5YA 3NTYA 2HV5A 3GD4A 4EANA 1FHVA 1MVYA 1NWRA 4CQCA 2PWDA 2DT1A 4I7VA 5DXXA 2QCHA 2VD9A 3TN4A 3H12A 4M82A 1Q4NX 1DHPA 3EUB3 1DJGA 4GVIA 1UH2A 4NX0A 3IJQA 2FMOA 2MANA 2POZA 1VH7A 3D3FA 1NVMA 4Q4SA 1ME9A 4FLSA 5C55A 4WXZA 5LIWX 3MY9A 4C6CA 1DQWA 2QJIA 2IMRA 2GK1A 1JYWA 4WHBA 1O5KA 3GSMA 1WXYA 1J0YA 1GHRA 5A6KA 4KWOA 5CPOA 4HNLA 3RJXA 1LCOA 3MUY1 1ZUAX 5BXTA 4JIIX 4QHRA 1OVDA 1EX1A 1S7MA 5DCDA 4HMDA 3SN4A 2W54A 3UCQA 4L65A 3C0LA 1KCKA 1O4UA 3MTWA 2DZTA 3T4CA 1M68A 3BURA 3UZXA 1W2PA 4URIA 4ZB2A 1EIBA 5F4WA 3MMUA 4H6RA 4QITA 4XZ9A 3GH7A 4BF7A 3P84A 2WNWA 4YIWA 3BAYA 5DMMA 1JZ3A 1V3MA 1J96A 4TV5A 1ZXIC 2QULA 4PUNA 1EJUC 3NR0A 4C5YA 3I10A 4TOQA 1JFXA 3DI0A 4DB7A 4FF5A 3A64A 1UKPA 2GOUA 2GJXA 1CIUA 3GFZA 1GPFA 3LCIA 4DBDA 3SDOA 5G1MA 1KM6A 2NUYA 2VC6A 2ATSA 5EMLA 5LA2A 1VJIA 3FY1A 2DDXA 2QLYA 1RD6A 1X1NA 2CHRA 3KP1A 1RBAA 3PHAA 2AAAA 2OYMA 1H7OA 5CEWA 1N8FA 4QROA 1UZ1A 5FJTA 4CQBA 4F79A 4A6GA 3RM4A 3QHNA 1DIOA 3W87A 2R9RA 1EDQA 4JDRA 3UGVA 1BEUA 3LSCA 4UR7A 1SZNA 1GHSA 1ZJIA 2FGBA 9RUBA 3QV6A 1GYMA 3IVUA 1IIHA 1K03A 3SY5A 2YLLA 2DEPA 2XIOA 3WH5A 5HBFA 3ARPA 4Q4PA 4V15A 4HA0A 3T0CA 4DUXA 4GIEA 4HYRA 7CGTA 2E6DA 4WOZA 1ICQA 2G50A 3CS2A 4AIUA 4BV6A 4X60A 2XVKA 2NLYA 3T05A 3QR0A 4JEQA 4XBKA 1X7IA 1XX1A 1YLVA 2I5QA 1EC8A 2PP0A 2J4GA 1HNYA 2XIBA 3NPWA 2TODA 3VO0A 1FECA 3MUCA 3DH9A 5G2HA 3GXFA 4L9YA 3VCNA 4K36A 2I5IA 1WKYA 3AAMA 3WBYA 2I5GA 1ZDLA 1K7EA 5DFAA 5M1TA 1OGSA 4XAGA 1R7OA 2RDTA 5A8NA 3EKGA 3CL8A 1ITCA 1QR7A 4INFA 3P93A 4HA3A 1ZS2A 2OXNA 3ZT7A 1U33A 4GI4A 1PZ3A 3WD3A 2BOFX 1JUBA 3RDKA 1BLIA 3BGJA 4JEJA 3HN3A 4KFOA 1B3OA 2FPVA 3WUGA 4JIRA 4Y9PA 5D02A 3W00A 4P7RA 1K4GA 3WQDA 2REQA 3UJ2A 2YCKX 5FF7A 2B7NA 3GG7A 3NPXA 4C1LA 1TJPA 3SFKA 1E1CA 1XLAA 2VHLA 1DJIA 1B3XA 2A6NA 4BF5A 2GZXA 1N61C 2QCDA 5BWAA 1FCQA 4ACZA 4HSNA 4ZQRA 1MW3A 3WK2A 2HVMA 4EF9A 4K7VA 1H5VA 2Y70A 4KESA 5GNYA 2HS8A 1KRMA 4GX9A 1KTCA 3WNKA 1L6YA 1FDJA 4K38A 1UW9A 3FA3A 1B0IA 1EZWA 2PF8A 2VFGA 3MO7A 2JQXA 1KC7A 2XGBA 4FOJA 5FJJA 1JZ4A 2PDLA 3F5KA 3FXGA 4I9MA 5MF5A 3IVSA 3WJZA 4HTBA 2H8XA 5DEZA 2V5LA 4KEVA 4PUWA 1DJNA 3GNOA 4MWAE 3MMTA 2I7GA 3THAA 1H60A 2QR6A 4WLCA 3N12A 3PZ9A 1I2OA 5BZAA 4OBSA 4NU7A 4Y8FA 2ZUTA 4JQ9A 3L4YA 4LNCA 2R8WA 2BTMA 3JUGA 1BF2A 2R91A 2V5CA 3TYEA 2QPSA 1P1XA 2O7SA 4YTRA 2UWFA 3QQWA 1GKPA 1BG9A 3AIRA 4EVZA 3VD7A 4F0HA 3LLXA 2QPXA 1EF3A 1PBGA 3H2AA 1Q7MA 1R6WA 3OC4A 1XLLA 3TYDA 3NM3A 3R0KA 4L1WA 1IE7C 4D6CA 3E74A 3C0JA 5EL1A 2Y61A 1Q7QA 4G6CA 1TVPA 5D37A 4H1ZA 3I4KA 2QIWA 1CXLA 1XCXA 1B3VA 2J27A 1TRIA 3A3XA 4WKHA 4H19A 1F6YA 2BVDA 2EPHA 1GZ1A 3TOPA 4UTJA 2Z28A 4A8IA 1GQLA 4QCEA 4J27A 3Q94A 2ACRA 2FHFA 4DO6A 4AY8A 3N15A 1BTCA 3NZPA 1ZLPA 1Q63A 3MKCA 1KM4A 4UOJA 4UOQA 1E3ZA 1OCBA 2G3JA 1TX2A 1M1BA 4HCLA 3G2GA 4IIGA 3TYZA 4C1KA 3ARVA 4ZB5A 3N3TA 3W7DA 1KQZA 3SUVA 5FF0A 1K7XA 2PWEA 4EWND 2CDUA 3OLDA 9XIMA 4PMVA 4UZSA 1OX5A 4E2DA 3A23A 1EUNA 4C60A 1G5AA 4IX0A 3W7QA 1Q65A 3PZGA 3SZ8A 4C6FA 2BHZA 1A53A 2CLKA 3W27A 1FWCC 1XRFA 3CAWA 2PTYA 1PEZA 5KVHA 1Q6FA 2Y8KA 4Q3MA 2OYKA 4MYXA 4HHHA 1C7TA 2WWDA 3IUHA 3VGEA 4IPIA 2O55A 1H62A 1RXOB 1R38A 4HQVA 1B5TA 3W84A 3VD4A 1DBTA 4HPGA 3PAJA 4O11A 3W23A 2WSPA 1UJQA 4RNHA 4Q33A 2VX6A 3WLNA 3HOJA 4KWWA 4S2CA 2HXTA 1OX4B 4PCSA 1KWKA 1F3PA 3JW7A 4YWIA 1W9VA 1LM1A 1WKDA 3E2RA 3O07A 1FP9A 2V68A 3UNDA 1DWHM 3OTRA 5I77A 1BHGA 3MQTA 3CTTA 2Z2AA 1JI2A 4KWUA 4WDTA 1XFCA 4E38A 4GYPA 2E09A 3TNOA 3CZKA 2F2HA 1GYNA 3DGBA 3TJ4A 3G0UA 1QXLA 2ZXQA 4C1NB 4D71A 4Z0JA 3GW0A 4W5UA 1POKA 1IEWA 1H2IA 1E4LA 4YWSA 2RGMA 4JTEA 1AD4A 4AFYA 3KCOA 1RV8A 1T96A 2QF8A 4H9MA 3L5MA 1XD1A 3VOHA 1ZL1A 2VGBA 2Z1VA 1L0PA 1JPHA 3H4KA 1EKOA 3IK4A 1M5WA 3BOXA 2WLYA 1FWTA 2J79A 3E5BA 4FNSA 3G1YA 1MW1A 1UD3A 1OD8A 4H4WA 1GSNA 1X96A 5EU9A 1RALA 2EPNA 2GDUA 3RGTA 4U3CA 4F3HA 4AC1X 1PZ2A 2VM8A 2X7WA 3RPDA 1EL3A 4BA0A 3HGSA 1CLXA 4AEOA 4D6GA 5M2FX 4O54A 3B04A 2QT3A 1ZAIA 3SQSA 2POTA 2Q3RA 1W3NA 3FYYA 2FGZA 3QLDA 4H9TA 4H4RA 4S23A 1MQRA 3LI0A 4HZ7A 4ZMGA 1NFPA 3PN8A 3W01A 3MHUA 2A3AA 1ZCOA 4IPLA 2BS9A 4PR4A 1XG3A 4E2BA 2OELA 2GWGA 2A3HA 5AC4A 4QQ3A 4H4IA 5HUOA 2FGLA 4YLWA 3WENA 3DHFA 3GLCA 1RA0A 2W4XA 1GQNA 3BLOA 2GJPA 4GI9A 2IXUA 4U2YA 2B7OA 3QMTA 5CPNA 1R9XA 3TSBA 1WUEA 3WLMA 5DY3A 3TAKA 1IXNA 3VCCA 4O0KA 5CBIA 2ZUVA 3O0FA 4CLMA 4S3KA 2NV9A 1RQHA 3LCHA 4S2BA 2A0NA 1NOWA 5CPQA 3TN3A 1D7YA 1UKTA 3CZ8A 1LL6A 3NL3A 3SCQA 2IPWA 1FWBC 1X98A 3WX7A 3CUHA 4XTDA 1BVNP 3U4AA 3E12A 1E5JA 5CCZA 3W1NA 1OY0A 3BMVA 4W7WA 5D2WA 5FIPA 4YYFA 4FOKA 3B0UX 4BWLA 2VDIA 4UFJA 5H8PA 3EGJA 2P53A 2YYTA 1TKKA 3GNXA 5G5IA 3M0VA 1MYRA 1HL2A 2FLIA 2C3ZA 2B7QA 1D7FA 1S2WA 1H4PA 3GWQA 3EA1A 2EO7A 1AJ0A 4A8LA 3M0LA 5JRBA 3KBJA 1JL8A 3E2SA 2YYUA 1PHQA 2ZTKA 2ESCA 3EWXA 2Z29A 2B31A 1XLBA 1GKQA 1HL8A 1JCMP 4ZOCA 1LOQA 2ZBTA 5A2AA 1WZLA 2CHNA 3EWCA 3WF0A 5A94A 2YBUA 3W81A 1W91A 7ENLA 3MJYA 4NZ3A 3RLUA 4Z1YA 2JE8A 2C1IA 4FPSA 4HHLA 4UCGA 1AA1B 1VIWA 2ODOA 2YVJA 2BXZA 2PB1A 1FBAA 2HTMA 3IIZA 4MKSA 3VYLA 2JK6A 3A3HA 1YKWA 5EMJA 3TJLA 2WMJA 3EANA 4H4YA 3GS6A 4GH1A 2YXXA 3IK2A 4IISA 2J7HA 3NQ6A 4C6NA 2AMGA 1PDYA 3QZ6A 1R5YA 3WFLA 4MIMA 4B9YA 4GLEA 4E2VA 4M1RA 1IZJA