4HCHA

Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium and l-tartrate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
384
structure length
384
Chain Sequence
SHMIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF D-GLUCARATE DEHYDRATASE FROM AGROBACTERIUM TUMEFACIENS complexed with magnesium and L-tartrate
rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
molecule keywords Isomerase/lactonizing enzyme
total genus 140
structure length 384
sequence length 384
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hchA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hchA01
1ONEA 3MQTA 4A3RA 3FV9A 3DERA 3STPA 3IJQA 1XS2A 5J04A 3MZNA 1MUCA 2OX4A 1ECQA 4FP1A 2GGJA 3R25A 3FCPA 2OLAA 4KEMA 3NO1A 3DG6A 2PCEA 3THUA 2ZC8A 2OZTA 4GYPA 4H19A 2RDXA 2QDDA 3D46A 3H70A 3CXOA 3R0KA 4K1WA 2PSNA 3DFYA 3PWIA 2HZGA 3QLDA 1RVKA 3RR1A 3ZLGA 2GGIA 3VC6A 4GFIA 4A35A 3MKCA 4FI4A 2ZADA 3NZGA 3T8QA 3QPEA 3HPFA 2PP0A 1R0MA 5BOFA 2FYMA 3GY1A 3QTPA 1FHVA 2HXTA 2OQHA 7ENLA 2OO6A 3ES7A 3ZVHA 3R0UA 5FJRA 2GGEA 3UJSA 2P8CA 2MNRA 4HNCA 3DESA 3MY9A 3UJEA 4K2SA 3ZLFA 4DHGA 3S5SA 2PU1A 3TCSA 2P0IA 1FHUA 3PFRA 5IDZA 4DWDA 1TE6A 3P93A 2OG9A 2PODA 6ENLA 1BQGA 5BOEA 2OPJA 3BOXA 1L8PA 3CAWA 3GO2A 4ZCWA 3R10A 3OTRA 4IP5A 2ONEA 3BSMA 3TJ4A 4E8GA 5FJUA 1SJAA 2PTZA 3EKGA 4KPLA 3SN0A 3UXLA 3I6EA 2XH2A 3IJIA 3FXGA 3N6JA 3MSYA 3UCCA 4M0XA 2XH4A 1PDYA 5ENLA 3DIPA 3S47A 3NFUA 3ES8A 3U4FA 1ELSA 2GGGA 4E6MA 4EWJA 4IHCA 3FYYA 3V4BA 3FVDA 3VDGA 1MDLA 2AL1A 3UJRA 4K8GA 1XPYA 2HXUA 2OZ3A 2PA6A 3SN4A 4Z1YA 3TQPA 2AL2A 2FKPA 3H8AA 4IT1A 1PDZA 3OPSA 3N6HA 1NU5A 3VCCA 2XH7A 3VC5A 2QVHA 4H2HA 4HYRA 3TWAA 2AL2B 1MNSA 4G8TA 1SJDA 3OZYA 5FJOA 3UJ2A 1SJBA 3ENLA 4Z17A 4GGHA 1E9IA 1EC8A 3N4FA 1JPDX 3RGTA 3I4KA 2XH0A 4HCLA 1TKKA 2AKZA 2O56A 1R6WA 4IP4A 3ZVIA 4E4FA 3R1ZA 3T4WA 1DTNA 2XGZA 3DFHA 2OKTA 2CHRA 3P0WA 3SJNA 4MMWA 3DEQA 4HCHA 3CB3A 2OVLA 4J3ZA 2PP3A 1EC7A 3GC2A 3EEZA 2PU0A 3UGVA 2QJJA 3UCDA 4A6GA 3VA8A 2PPGA 3RRAA 4DN1A 4M6UA 4HCDA 2QDEA 3P3BA 5EU9A 1KKOA 2GGHA 4ENLA 2MUCA 4GISA 4H1ZA 3I6TA 4ROPA 3D47A 3SBFA 3ZVHB 1TZZA 2DW6A 1JDFA 3MUCA 2OFJA 3NXLA 3ZLHA 2GSHA 3RCYA 3QKEA 2OQYA 3TWBA 3QN3A 4GIRA 3Q45A 1KCZA 3IJLA 1JCTA 1SJCA 4GYPC 4GGBA 3DGBA 3DG7A 3JVAA 2XSXA 4HNLA 4JHMA 2P8BA 3TOYA 4HN8A 3BJSA 2P3ZA 3R11A 1P48A 1KD0A 3K1GA 3KUMA 3DG3A 3VCNA 1WUFA 1MRAA 2QQ6A 1BKHA 4F4RA 4E4UA 4DXKA 2GDQA 3T9PA 3SQSA 2NQLA 3TW9A 3V5FA 3V5CA 4JN8A 1JPMA 3JZUA 4DYEA 1IYXA 1P43A 2PTWA 2POZA 3CT2A 3PWGA 1F9CA 3DDMA 3B97A 3RITA 3CYJA 4E5TA 2PTXA 1WUEA 4X2PA 3CK5A 1KKRA 4KWSA 2PGEA 1EBHA 1MDRA 3JW7A 3MWCA 4IL2A 3H12A 1EBGA 1W6TA 3U9IA 4G7FA 4HPNA 3RO6A 3PK7A 3FJ4A 2PP1A 3TJIA 1EC9A 2PGWA 3H7VA 4IL0A 3UJFA 4J1OA 2GL5A 2QJNA 4MGGA 3IK4A 3GD6A 3VFCA 1OEPA 2OZ8A 1NELA 4KT2A 4IZGA 5FJPA 3V3WA 3OZMA 3N4EA 3T6CA 3SN1A 2PMQA 4DX3A 3OP2A 2PTYA 1YEYA 2PS2A 2QJMA 4GMEA 3TTEA 4H83A 5FJTA 3OW1A 3Q4DA 2AKMA 2DW7A 2I5QA 2P88A 3SSZA 4ZA0A 4YWSA 2HNEA 2QGYA 3UXKA 4MKSA 4JN7A
chains in the Genus database with same CATH superfamily
1B57A 3V7PA 4HQVA 2OT1A 3W22A 5IHSA 4MYXA 4B9YA 3QOKA 2OX4A 4NU7A 2BX7A 3VU2A 3CHEA 2JKPA 2AQOA 3OQEA 2QPSA 3PPHA 1EGMA 4WOZA 3S2NA 3SCVA 3Q94A 1A49A 4AHOA 2D0GA 2QCFA 3T1GA 3KS5A 2D1ZA 3EOLA 2VRJA 2WM0A 4K1WA 1R3RA 1RV8A 3H2AA 3RR1A 1GVEA 3WLQA 5CJMA 1PZ2A 1N7KA 2J25A 2V3EA 3H22A 4U3CA 1FECA 1I0DA 2RGMA 4QG9A 4DUWA 3GK0A 3OLDA 1F4AA 3PG9A 3MTWA 4MJZA 3NL5A 3PBMA 3W1NA 3U7VA 1B4EA 2VC9A 4IMCA 4HTBA 3NVZB 1VQZA 4F3HA 5A6BD 3UR2A 4C6PA 5LHFA 4AIUA 5EBKA 1O5KA 3WJYA 4R7JA 3FY1A 4WX2A 3VABA 1EP1A 4I6VA 2F6XA 1P5BA 4X22A 4O16A 1XRTA 3QMSA 2ZUNA 1QHPA 5T9CE 3L4YA 2VZUA 3KP0A 3LCHA 2X1TA 4GVGA 1TE6A 1PYMA 1H11A 5TNVA 3W75A 3C56A 1GKRA 4PMYA 5G4WA 3B05A 3I3DA 4LCQA 3H2NA 1UQYA 4C1NB 2GK1A 3VINA 1I2NA 3REQB 5FL1A 5CPTA 3LM3A 4R7WA 2VM8A 5DRCA 4K6AA 2VC7A 1SFTA 4GI6A 5I3JA 3E96A 1UR3M 3VD7A 3GR8A 3UR8A 1Q63A 1E0UA 1G4EA 4LEFA 3ITXA 2GJPA 4NVTA 1LROA 1DWGM 3I3EA 4QJ1A 3CWOX 3VIGA 2NZLA 4OT7A 3H7UA 5BYWA 4AWSA 2XWEA 4HU3A 3MMTA 5EMJA 3CPRA 5AYYA 1Q6FA 1ZGDA 1C7TA 3I7QA 1MDLA 4A8IA 3U6WA 5HDRA 1TTIA 1H1YA 2CU0A 4DWSA 1UBPC 1BWCA 3PY2A 3HV9A 4US5D 4WGXA 3AMGA 1J0JA 1S2UA 5H6HA 3WQ5A 5FJOA 1SSGA 1K8XA 2HS6A 1J8VA 3FIGA 1CXFA 6TIMA 5BXSA 3PB2A 4DBSA 4CU6A 5U1OA 4Q4SA 1WKYA 4FLSA 1Z42A 2J75A 3GXPA 1KCLA 2E6YA 2KZHA 2P10A 3KBWA 1IZCA 3CLMA 4TX8A 4CCDA 1J2WA 3H4WA 2AAMA 4IJBA 2H3DA 4Q8NA 4N7QA 2EG7A 4DRSA 9CGTA 2V3DA 1VBHA 3WO8A 2XWDA 1XANA 1E43A 4ICMA 1GVSA 4HU0A 4LB3A 2X8CA 2G3NA 3PG6A 2GDUA 4AIBA 1QO2A 4CQBA 1GVIA 4C1LA 4YTTA 3RK8A 3N6QA 3NVTA 2PWFA 3S9IA 2E5BA 3ITYA 1VIWA 1JZ7A 5C0QA 3WY1A 1R30A 3B40A 4TR9A 1LORA 4JAWA 2V0TA 4ZGYA 1KFEA 1KV5A 4J5NA 1ISXA 2J79A 2QIIA 4KFPA 1SFJA 3QN3A 2YR1A 3E1F1 1KR1A 1XYLA 4LFYA 1SJCA 4GJ1A 3UZWA 4GYPC 1AJ2A 1DKWA 5HWJA 2HVMA 3B0UX 4F0SA 1PS9A 1KFCA 3BLFA 1V4YA 3K4WA 4LUSB 8TIMA 3G6LA 4M8UA 4YTRA 3UZ5A 3O06A 3WLHA 2PC4A 3QPZA 2BY2A 3WG6A 2W67A 3PFMA 1I2OA 5AZ0A 2Z2BA 2BSLA 4C7FA 1VFUA 4MWAC 5IFPA 4HPJA 2R8WA 5ECUA 2WMHA 4LQ1A 1BVNP 2Z25A 2DH2A 3W25A 2FHCA 5G5HB 1MXGA 5CC5A 4LVFA 3XIMA 1VJZA 3U3HA 3G1SA 1GRFA 3R13A 4DYEA 4GPNA 3TVAA 1ZQ5A 3CYVA 1JDDA 4Z1DA 1N63C 1ZCCA 1W5MA 4AVOA 5E6YA 1N5WC 1IT8A 3WLKX 3HG5A 4TOQA 1MDRA 4MY1A 1HJQA 2MANA 1FWRA 3AIWA 1LUCA 2WOQA 3NUKA 2PDLA 3IUHA 4S3BA 3TAOA 4GK8A 6CGTA 3H7VA 3LPOA 1KXQA 3VX0A 1DJZA 2C1IA 3B9OA 3BAWA 4NX5A 4FAMA 2E9LA 2GL5A 2QJNA 4BY3A 2ZXDA 2ZXBA 1V6VA 2ZX7A 5CLTA 3KL0A 3S6TA 4UNIA 3C3NA 4HZMA 1W9BM 4Z1BA 3B8WA 2CKRA 3VOCA 3QQWA 1W0MA 3MANA 3F2DA 3PBWA 5CPMA 1UD5A 1YIXA 4X60A 3PF3A 2H9AB 4X9YA 1CB7B 2VXNA 2PS2A 2E3ZA 1YW1A 5A69A 1TWSA 3UGRA 2QCEA 1XDMA 4Q4RA 5LA2A 4RK8A 4ORMA 4P8UA 1ITXA 3W7IA 2D23A 3E38A 2G37A 1UMYA 2QGYA 2XYLA 1VQTA 4J3UA 1Z3NA 2QUNA 3SM0A 1XIEA 4LYRA 1JGMA 2C6QA 3MBFA 3QTGA 4KPRA 3ISIX 3IAQA 1FKXA 4LYQA 3WLPA 3GHUA 4XK2A 3SURA 4B3ZA 2OZTA 5HMFA 4RJEA 4UTHA 2D2HA 1U5VA 3H70A 3SEPA 3CXOA 4AY7A 5D9OA 1MEWA 3T0DA 1UWAA 1F3XA 3W7RA 1EA9C 4ADWA 1XISA 2WCSA 1CGXA 1MUMA 3NDOA 5CZTA 3QYSA 4CN6A 3QSRA 1KLYA 2HZGA 1IIHA 4QCEA 4P7RA 1SW7A 1EGZA 4Q7BA 3SY5A 2WWDA 3G0XA 5K4XA 4HZ7A 5A2CA 1HL2A 2BCPA 4EQXA 4AMCA 1BG4A 1GYLA 4L1XA 4QJ4B 3L5OA 3CV2A 4H4WA 1R9ZA 3IVTA 5M5DA 4WDWA 4O1BA 5A6TC 4O19A 4E2VA 4NYUA 1KR0A 3HPSA 2WZHA 3MS8A 1XIGA 1DOSA 1WKDA 3GYCA 3LA4A 4S3KA 4BQ3A 1ZZMA 3N2TA 2W61A 1N5XA 3QW3A 2XIQA 3LBMA 4YNGA 4JQ2A 2ZTKA 1FCBA 3KL3A 4CNTA 4GCXA 3DYOA 3L21A 2Z1SA 1ESWA 1E0VA 1H60A 5BWAA 5BXPA 3SFWA 1FWWA 3ZSTA 1B90A 1PB0A 1C93A 4F40A 2PODA 1VJSA 4AD5A 5FF3A 1BXCA 3CH0A 3TROA 1T8QA 1XF0A 4ZCWA 2VC6A 3BMVA 4AD3A 1FFUC 3PPCA 4F2BA 4Y6GA 5FSDC 4O10A 1T96A 2WWCA 4NJJA 3LHWA 4UOZA 3S5OA 3DJGX 4LV9A 2V67A 2IPFA 3VMPA 4KPLA 2VEMA 3OYXA 1EYEA 2AAQA 1EGVA 5AC6A 3ABXA 3H53A 2QJIA 1KM4A 1P7TB 2O9OA 2BZNA 5MF5A 1TIMA 1ZBVA 3EMZA 3LZ5A 3LSBA 2H90A 1DXLA 2SFPA 1RCXB 1ELSA 3KBNA 2JEPA 4QIUA 3KZPA 2A4AA 4EIVA 1FQ0A 3HGJA 2Y1HA 3GH4A 3F7JA 1JPKA 2IXVA 1TA3A 3LU2A 4K8GA 2GYIA 5A6JA 1GGOA 4DWSD 1IXOA 4G7EB 4JTAA 1XLHA 2VUYA 1P1XA 3IIPA 3AS0A 2OQLA 1X39A 3IK2A 1EO5A 2X8GA 1SJDA 1W5OA 4FHAA 4GZ7A 1HQTA 2EPNA 2PRLA 5LKYA 3EAUA 2I1OA 3RGTA 4C6JA 1NPXA 3RPMA 3NNTA 2OEKA 1AH3A 3DGRA 1T6MA 4H4PA 2O56A 3VAVA 3A9IA 2FIQA 4IGNA 1O1ZA 4JDBA 3ONBA 4TTGA 1BZLA 5AYIA 5GNXA 4IFOA 5C7HA 4J9JA 3AISA 4DUOA 2J8TA 1VC4A 3NQ7A 1Y5XA 3B9AA 4C1KA 1M3UA 2BFGA 2X99A 1MO9A 5DXXA 4NAFB 2ZX6A 1EQPA 2VMFA 4CD7A 1TWDA 4LXFA 1R7OA 3KLJA 5JCKA 4DPQA 2GGHA 4A29A 3H2MA 1A5KC 5MKGB 3LDVA 5DCBA 2FZ8A 3D47A 4Z0SA 2DJXA 4NJKA 2E6AA 1FRBA 3KHDA 3BG5A 2QR6A 4LS1A 4GNJA 2ZZ6A 2GH5A 1OADA 5HINA 5C9RA 1EEXA 4E3TA 1Q1RA 4HKPA 5DFAA 1XD1A 1C9DA 3QXBA 1T0OA 1Z6KA 2RH9A 1GVFA 1LF1A 3NGFA 4ZOEA 3N15A 4YPJA 2IPJA 2WVVA 3TOYA 3LB0A 1GTHA 1X2HA 1KM0A 3P61A 1NIUA 4LVAA 4EF8A 2ACUA 3DG3A 3RU8X 2R14A 3T42A 4LVGA 1NF7A 5IDIA 3QF0A 4C6EA 3VNYA 1S5NA 5GJMA 1BKHA 4Z2LA 1GORA 4KFNA 1KRMA 4HD5A 4EXAA 1E6ZA 1WQ5A 3W01A 3VIPA 1NHQA 3W7LA 3L4VA 1H63A 4CQCA 2OX1A 5E5CA 1PUDA 4NZFA 3J7HA 4IFKA 3N12A 4EMJA 2LLEA 2NPXA 2ZWYA 2F38A 1AQ0A 1U33A 4WDXA 5KZ6A 1LOSA 2Z1KA 3O63A 1WUEA 5LA0A 1PKMA 3ARZA 3NQ2A 2PGEA 3TTSA 3QZEA 1M41A 1JUKA 2NVCA 2XSAA 3VD3A 2W66A 2R1KA 5LA1A 3BXWA 4D71A 4O50A 3SIMA 3MMDA 3M5XA 1QOQA 3UBPC 3IUDA 3LRKA 2OGYA 3ITOA 2PGWA 2W9MA 5ABEA 2JKAA 3ALFA 4DO5A 3UJFA 2IKHA 1ZAHA 4AY8A 4EM4A 5HWNA 2QPUA 4RNIA 4C6CA 3LK6A 5JH1A 1GVQA 4I9JA 1YPIA 2V3GA 2ZZCA 1JAEA 2QV5A 3BLOA 4A4AA 4DWSC 4ZFMA 3N19B 4WD0A 4I5UA 3FYOA 4PH6A 3G1FA 4KRZA 5AHMA 4XVEA 3GD3A 2WC4A 1QMLA 5EL1A 4NRRA 1POKA 3OGVA 4NIRA 2VFFA 5LIYX 2G3JA 1J79A 1E4IA 3PS7A 5CGTA 5TR3A 4MVAA 1GYNA 4FF7A 3EB2A 3KW3A 3GNNA 1OCQA 3L2MA 1BKSA 3HGOA 4JTTA 1MUCA 2HS8A 3GXDA 5FEXA 3NQBA 4FX7A 3WNMA 5D2WA 5J8LA 1C90A 5TBOA 4GO9A 4JL1A 3L4TA 4WKHA 2Q8LA 2Z7GA 4HZ8A 1QNOA 3FXYA 1C29A 3DFYA 5AZ1A 3C0SA 4WRHA 3FGCB 4UOJA 3P74A 1QBAA 3EDJA 1UKSA 3LCGA 1JD7A 4W5UA 3M0LA 3T8QA 3QPEA 3TUUA 4AYSA 4O1EA 1A5MC 3BGGA 1ADDA 1CGWA 4DY1A 2WKJA 3K4DA 1A50A 3ZS4A 5M1TA 3IJDA 3IJ6A 1NQ6A 3S6DA 1POJA 1Q6RA 3FN9A 3AYSA 3DN5A 2Y2WA 6PTDA 4WSKA 3ZVHA 3CQIA 2OYMA 1XYBA 5E70A 5FJRA 3T0CA 3TFXA 3UJSA 2XTKA 4HNOA 2YFOA 1S5TA 2DUZA 4O11A 2Z26A 2V2HA 1VBGA 3CIWA 3CMGA 3VOGA 2OZ0A 3MI3A 2YBTA 3A3WA 1BRLA 1XLJA 5IDZA 2YL6A 4IIDA 1KM5A 1VZWA 1TTJA 2ON3A 3I10A 3AHZA 6ENLA 1ZAJA 3IARA 1EJUC 3DC8A 4CQ8A 2DZXA 2X1SA 1VDVA 4C5YA 1V6WA 2J47A 2DSKA 4UCGA 2PDWA 2NX9A 4FA3A 3MKVA 3L5AA 1NEYA 4D2JA 2WQPA 4UWMA 2A3HA 2E25A 4DO7A 3MW7A 2QAEA 4FIRA 3UZZA 4GZEA 4JFWA 3F2BA 1Y5VA 4QG6A 3TTYA 1V3LA 3W1TA 1SGJA 3FHAA 4M0XA 2QCMA 4CNOA 3NQFA 3E12A 1KRCC 4WEVX 5A6MA 3TX9A 3TE9A 2WPGA 3DK9A 2VC5A 4NKCA 4JTIA 2C14A 2DSVA 3LS9A 4UFMA 4H50A 3G77A 2A0NA 1ZFJA 3VGDA 1BD0A 3HTWA 2WW5A 2I57A 2AL1A 4GBUA 4BR1A 4QDWA 3USBA 2VFIA 1WZKA 3C8FA 4H4TA 4JOMA 2W6RA 1H0GA 3GBEA 3PNUA 3ZWSA 5GVJA 5KSWA 1HJWA 4GC4A 2PGRA 3N6HA 3L67A 1EUNA 1L6SA 4QGCA 2R6OA 3RLVA 4H2HA 3WQ8A 3L9CA 3NEVA 3M4HA 4UFLA 3W85A 2VVNA 1S7MA 3H4KA 3YPIA 4PTMA 4MY8A 1JPDX 4FF5A 2X1RA 2P1FA 2FFIA 1W1B1 3THQA 3PZGA 5GJNA 3DH7A 5EMLA 1OX5A 4PGLA 2WAGA 1P0KA 2HBXA 5BRPA 3CZLA 3N9RA 2BVTA 3QH2A 1W1PA 1QPQA 1H7PA 1GQJA 1PHWA 3RIKA 2BXVA 4QQUA 2DV0A 2PAJA 3KRSA 4NNCA 4Q8VA 3EX6A 1DEDA 4FNTA 4B92A 4DN1A 3U57A 4BA0A 1FTXA 1UR9A 3P3BA 4GZJA 3GHSA 1EJVC 2YL9A 3SR6B 2GLKA 3WQWA 4QS6A 3L2IA 1PCKA 2PE4A 2QDHA 4MWAD 2ACQA 2QCGA 4K7VA 4W89A 2GSEA 2V69A 1JIBA 4HK7A 4P61A 4CCCA 3UG4A 3S46A 5HR7A 3N4AA 2WJEA 3POHA 1Z44A 2XIBA 4H01A 4NZCA 2HDJA 3BCJA 1W8GA 3LCLA 4HB7A 5D02A 3OODA 3AWOA 3IJLA 2NX1A 4O53A 4ERAA 1SSDA 2EJAA 4IJRA 1OC6A 1LWJA 2EKCA 4MZ1A 4GGBA 4J7RA 1LTDA 1ENUA 3ABRA 4S3GA 2JE8A 1IEQA 1GOOA 2JALA 5FJJA 3KCJA 1I9CB 5KEZA 3QFAA 1UR1A 3B3DA 1GOWA 2EPLX 1M7OA 3MMUA 4J4KA 1EXPA 3R11A 4H9UA 1UD8A 3NQ8A 1YTDA 5DXYA 1H6VA 3GTIA 4XAFA 4RXFA 1DXIA 4JFVA 1LJYA 3RX3A 2W54A 1HW6A 5I06A 5XIAA 2EBNA 4DXKA 2INZA 4CEUC 5BNKA 1OZMA 3DYMA 2ZA3A 1O4UA 3S1UA 4IPJA 1JDEA 5IBXC 3CPGA 5BRBA 4ZBCA 1XIJA 3GXTA 4PCNA 3G8RA 2Y0FA 3DECA 4C7DA 3RFAA 1W5NA 4XZWA 4UIOA 3NVYB 4GWEA 3GDTA 5BROA 3ABQA 3B4YA 1LUCB 1OG0A 1K8ZA 1YNPA 3PN8A 3OIHA 4PUKA 1XH2A 5IRPA 3GXMA 4FX8A 3HGRA 1LLWA 5JMUA 1JXKA 3UF9A 4GVIA 1EC9A 3UXDA 3IVUA 4DO6A 1J01A 1JI1A 5AFDA 3NTYA 1XBVA 2VKZG 3H23A 2VGGA 2WVVB 2H9AA 3AIBA 3TQKA 3VVGA 2CLEA 3LXBA 5K7JA 4ZTYA 2IKJA 3TJXA 4XO7A 3ZJ6A 3M0KA 4YVVA 2VVSA 2JBMA 3A47A 1YEYA 2PLJA 3EEGA 1O94A 1OCNA 1GZJA 3R5EA 1LYXA 4AW7A 1E4LA 3F5LA 1UIOA 2DIJA 3B03A 1ODZA 2I5QA 3AXKA 3NSNA 4ZOBA 3VILA 4ONVA 1ZJBA 1IE7C 1X6UA 4G56A 1RM6B 3FOKA 3MZNA 4Q4KA 1QNPA 1SUXA 1UUOA 3W00A 2X40A 5HUPA 2JGQA 2OO0A 3F4WA 4R5EA 3PTDA 2ZUMA 2A21A 1FP9A 3OA3A 3S5ZA 4OJYA 2X42A 1DNCA 1NOFA 2PSNA 3UU0A 3II4A 3OLGA 2OJPA 2TMDA 4E3VA 1GW1A 3ARWA 3VC6A 4FS9A 3AIRA 2HK1A 1RA0A 5GRTA 3CEUA 2VWTA 3M0MA 5CGMA 4RDYA 3TTOA 1AL8A 2DZPA 3V36A 3TA6A 5CBBA 4HNNA 3GDMA 5HPOA 2WXDM 4HA0A 2D2JA 4UTUA 5A6LA 4S3EA 4J3XA 4HOZA 3WF4A 3GLCA 3WN6A 4URIA 3DESA 2XINA 1NTHA 4DHGA 1R85A 4XAZA 4IX0A 3ABOA 3WCZA 1FCUA 5K4ZA 1K6WA 4E4PA 1QCWA 3UWUA 4P8VA 1FDJA 5FA5A 4CUCA 4PMXA 3ME3A 3KRBA 1EOMA 2YL8A 2XFRA 3BW4A 4AFYA 4EMWA 2C16A 3PG8A 1L8PA 1QRQA 3VKBA 2PWDA 4MLJA 5DELA 3VDCA 2B0MA 3GC4A 2YAUA 5A8OA 3LSCA 4BJHA 3KOXA 2XFYA 3K8KA 3A5VA 2Z0IA 1HKJA 2VGIA 4LUTB 3BV4A 2PDFA 2VP8A 2PWEA 4GQQA 4K37A 5A3HA 2CPUA 1XDJA 4O4WA 1PDYA 5DT5A 8CGTA 1PE1A 4BV6A 1QI0A 4LAUA 3LG3A 3LADA 4W86A 3PZOA 1XYMA 2G5WA 3A64A 1GHRA 1REQA 1S46A 5I23A 2ISFA 2NQ9A 5KVHA 2P76A 4WXYA 2FKPA 3H8AA 4ZB5A 3CUIA 4E2OA 5BXRA 4C6IA 4OZOA 2I5IA 1LQ0A 3D0CA 2UV8G 3W7JA 2DPEA 1S3HA 1KBJA 4GLEA 1JD9A 3R89A 2R1PA 2YBVA 4AZIA 4ASTA 5MHBA 3GVGA 1ADSA 2OSWA 1XKYA 1EJ7L 2DZVA 1RQBA 2QXWA 2X8HA 1S2VA 1H7RA 3MSGA 4JTLA 2OELA 1HP4A 4AMAA 3CV6A 3TZNA 1KRAC 3P0WA 4K8HA 3VDBA 1Q7MA 4AVFA 4DJDA 3UA4A 1XIBA 4QR6A 2PU0A 1B3OA 2AAAA 2IXUA 4GUJA 3XINA 1KA9F 2V2DA 3DFNA 1EIXA 4AWTA 4M6UA 5LNSA 1XRSA 3KBJA 2CBUA 1P4CA 4E2DA 4ENLA 2MUCA 4TVUA 7A3HA 1L6GA 3WF2A 2ZVIA 1GERA 4QDPA 1QW9A 4H7ZA 5LXXA 1JDFA 4GI8A 1ISVA 1XC6A 2VZOA 3N9KA 4WY0A 4NEVA 3BE7A 1IZJA 4J40A 3BSGA 1DJNA 3BH4A 3L8KA 4MNMA 3CS2A 3M44A 1R2RA 3KVMA 1CCWB 1XLDA 4K3ZA 1XQKA 5J5DA 1V97A 5I09A 3EXTA 1VCVA 1IQ8A 2Y7DA 5LHEA 4IGMA 5B7ZA 4GYFA 3RUBL 3EX1A 3WBEA 4RZ5A 4DLMA 3WMCA 1BXBA 4WSJA 1W8SA 1BEUA 3A3XA 4US6A 2VQUA 4NZ1A 2GR2A 4HIBA 4Y8FA 2VI0A 1O95A 3UWYA 4IG2B 1EHNA 4G5DA 1YXDA 1LBMA 3SW6A 1VIZA 1AA1B 4N4QA 4S38A 3S1VA 1HO1A 1WDQA 4ADSA 2WBAA 1AZ1A 5BRQA 3VIFA 3CYJA 2GQ9A 3AIQA 2HCVA 2X1IA 2VDHA 4PMZA 3A7RA 1E55A 1D8WA 1UR2A 2EQ6A 1UZ4A 3AIEA 1B1YA 3GFYA 2V5LA 1AMYA 3O16A 3DBNA 3TJIA 2J8GA 1AL7A 1EHAA 4ZE5A 3MMWA 1OX4A 1GWJA 2UBPC 1CGUA 3EPOA 4PMRA 4NI8A 1YDOA 2PWVA 3BOFA 2J7EA 2O4MA 4CVUA 2Q02A 2OZ8A 4IMGA 2V6AA 2HV5A 2A3AA 3SN1A 6TAAA 4GIEA 3CHCA 2WHMA 4L4OA 2YA1A 2VRKA 5LIWX 1QWKA 5LYRA 1RVGA 5CAKA 3KWXA 1MZHA 3WDRA 4HA3A 3A22A 4RLIA 5I2UA 2Y85A 1F76A 2OGJA 4PCPA 1E9YB 2G4JA 3WK0A 2ZUTA 3REQA 2C8NA 1MW1A 2XN1A 3VO0A 1QJWA 3OIXA 1CI1A 1MXSA 4A3RA 3M16A 3BDKA 4QDMA 4FLRA 2WHKA 2XFWA 3NDYA 3HU7A 2FVLA 1HJUA 1Z32X 3B06A 2XGBA 3WFAA 1GSNA 2CLHA 2J7HA 4Y9PA 3FCPA 1YQ2A 1B54A 2ATSA 2DZTA 4Q8WA 4TIMA 1W1IE 1EYWA 4ZO9A 2VNCA 4ZR8A 1J10A 1QUMA 4GYKA 1U1HA 1KFWA 3LNPA 3OLIA 2G41A 2WMKA 4RDZA 3K2GA 1MEHA 2DZBA 1RAKA 1PEZA 3NZQA 4D6JA 3B0PA 1O6IA 3WQ4A 5C2XA 1QOXA 3TDFA 3NYZA 3GVQA 1US3A 2E8ZA 4UB9A 4GD0A 1KXTA 2ESCA 1M03A 1TWIA 3PSWA 3WLTA 3RNMA 1FY6A 3C2OA 1JZ5A 1TREA 2YGYA 2ZZ2A 3WQDA 4I5RA 3ZOAA 3QY7A 5I02A 1WDDA 3S9YA 1M6JA 1F74A 3QFBA 2PLCA 4LUSA 1CIUA 4UQDA 1TV4A 4AHQA 3G6MA 3ZYZA 3RPTA 1LQAA 4GXWA 2WV8A 2CBJA 4Y7EA 3DCPA 1NY1A 4JHOA 1EJTC 3Q58A 3LPFA 7ODCA 1J11A 1ICQA 4QE5A 2E40A 3LLXA 4XZMX 1J4EA 2ZKMX 1G6CA 1X98A 2YLLA 2V5BA 1C92A 3CAWA 1RUSA 1SFSA 3OTRA 3M0IA 1AG1O 3B0XA 1JCYA 2HBVA 5FACA 1PYFA 2FZDA 4JTEA 3EKGA 1SR9A 2CETA 2DH3A 3NL3A 3KVKA 1JUEA 4N9EA 3N2BA 2WSQA 3NR0A 4Q6XA 3AOFA 3VI2A 4L5ZA 2I17A 2NW0A 2CHNA 3LPPA 1XBZA 5ENLA 3UZXA 3UYIA 4AAJA 1XLAA 4QTGA 2GJXB 4X9SA 3U2ZA 4KCWA 3VKAA 1C9WA 1C8QA 3GUGA 1J5TA 3E0VA 4EQWA 3TKFA 3JZEA 2CKSA 3LLDA 3TYUA 5C9WA 3TH6A 4DAIA 4Z1YA 4BEQA 2A2IA 4N6FA 3WD0A 1O7AA 2HSAA 1XLIA 2HPIA 1F7BA 1KXVA 2CCRA 4EM3A 4HT3A 3H2OA 1PTAA 3TW7A 1VPXA 4JIHA 4ZXOA 4MUPA 3RDKA 3DBPA 4GA8A 4KWVA 2QAFA 3VX1A 3AXMA 3I4KA 3M5ZA 4FLOA 3W7EA 5D03A 3IV3A 1T41A 3GR4A 3WMBA 5K9CA 4U2ZA 3USZA 3VMOA 1JQVA 4Y9MA 3CPUA 1DTNA 1NOUA 4NT0A 3IAPA 3CB3A 1OVDA 2VEIA 3LHZA 4AEOA 3C5QA 3UGVA 3W1XA 2Z24A 1VGAA 4O1FA 2OTDA 1BGGA 2Y8UA 2OLSA 5E9AA 4D6IA 1QPRA 2DSUA 3VNMA 5TAOA 1N60C 5LIXX 1LDCA 4K8DA 5FF0A 4RNHA 4BHYA 3LM7A 3F03K 4DB7A 1GEUA 4LAMA 3I6TA 1OIFA 2O9TA 3W7GA 4LALA 3T40A 4QX4A 2DVUA 3ZVHB 3HG2A 4ZVJA 2XVKA 4WXZA 1JCMP 4Z2IA 3W2MA 5A8MA 1KRBC 4DJEC 4B2DD 4P8XA 4MSSA 2WB5A 1LG1A 3EF6A 3DOPA 4GVHA 3IANA 3I6RA 1DE5A 1E15A 3E6EA 1EX1A 2GOKA 3DG7A 3TYBA 3WLRA 1ISYA 3P60A 3CGTA 3SZ8A 1UR0A 1MUWA 5M03A 1DJQA 4R88A 1J6OA 1TPEA 1W5PA 4OKDA 1UP3A 3G22A 5G5GB 2D3LA 5F1UA 1B0IA 3A4WA 3SY8A 3O9NA 4O12A 1U5HA 1I2PA 3BAYA 2FHFA 1FWFC 4UXDA 3T2QA 4R9OA 4AH7A 1SU5A 1E6PA 2HRWA 3W84A 1N8FA 2EF9A 1Y8BA 3PAJA 2ZXQA 1TJ1A 2W62A 1LL6A 1QOPA 2GWGA 4GUIA 4R85A 5DF0A 4CVWA 3QFWA 1IYXA 3PR2A 3CT2A 3SDOA 4GRSA 1UUQA 2HEJA 1LL4A 1NDZA 4XBJA 4JFUA 3ZJ8A 5GPRA 4UFJA 1RA5A 1LRTA 1FWHC 2Z6IA 2EPMX 2VDIA 2Z1BA 3EX3A 5CPOA 3AIVA 3FAWA 3HG3A 2GVGA 1H7WA 3E0WA 4PE8A 1XHGA 6A3HA 1SMDA 3W28A 1Y5WA 4C6LA 4FXJA 2Q01A 3ARTA 3VMNA 1OK4A 2VO5A 4IL0A 4YJ5A 3KOWA 5G5IA 3KRUA 4RUBA 1WDWA 1UR4A 4EXBA 3PHAA 1ONFA 4IZGA 1W9PA 5FF2A 1S39A 3EB4A 2BV9A 3WL0A 1Q2RA 4RE2A 5FI8A 2PI6A 1BGAA 2DIKA 5CSSA 3S5NA 3QV9A 4HSNA 4EAYA 3UFYA 5SWUA 1R86A 4YN5A 4AZ7A 1MFVA 1OFOA 3AHXA 3QBUA 4U2YA 1SW0A 3V0TA 2WMJA 5CPNA 1BYCA 2EHHA 2CXEA 3ARXA 4UMAA 2FJUB 4XG1A 1XWYA 4XSLA 2D24A 3IJQA 1PIGA 4L9ZA 3CQKA 3RLHA 4PB5A 3PZTA 1E1EA 1OZQA 3KTXA 1TA3B 4IFKB 3RU6A 1JCLA 3MI6A 2A7RA 4GKLA 2OODA 3HQ1A 3IUIA 1UD3A 1O66A 1Y65A 1Q13A 1V7YA 2V5KA 5D37A 4PMOA 4GVFA 3GG1A 2OYKA 3UEQA 1DQUA 4L4LA 1R2TA 1G01A 3W7CA 3PTKA 4S3DA 4WSHA 3DH9A 3M0JA 4UTTC 3SY1A 4GOAA 4G6CA 1KFJA 2E8YA 1Q2SA 1TFVA 3QTPA 2YVJA 4V27A 2YCLA 1B3XA 3NOYA 2VQTA 1JCJA 2FVMA 4RZBA 2CITA 3TIMA 2PDGA 1TR9A 4AX7A 3U4AA 2PEVA 5CZJA 2MNRA 1M04A 2J9ZA 2YB1A 1D7FA 1TYGA 3A21A 3LOTA 1OD0A 3W4RA 3WUBA 3HRDC 4POCA 3DI0A 3EWXA 3S5SA 4BKNA 3AI0A 1WXZA 4DYKA 4IMAA 1RBLA 4LRSA 1V0MA 3SSJA 2PDCA 2GQWA 1HL9A 5FIPA 2OWCA 4TUFA 1FH7A 3UERA 1LWIA 3SCRA 4UTTA 2BMBA 3G1XA 3P5ZA 2VFHA 2F2HA 2A7NA 1EB3A 3BOXA 4UZSA 1LM1A 1TTPA 3UZJA 1E56A 5HNRA 4XZBA 1WA3A 4NAFA 2BOGX 4NX0A 3GXNA 3KDOA 2WHLA 1Q66A 3K8MA 4A8NA 2YBUA 2C1GA 1ZBCA 4ICNA 4L6DA 2XH2A 3QVQA 5FEWA 2I9UA 1GHSA 3UCCA 1R9XA 3RM9A 3BLLA 4ACZA 5C9ZA 3NA8A 3VKDA 4LSBA 3IRSA 4DBUA 3LNMA 3G8EA 2HMCA 2V2CA 1H5VA 2BHYA 3SRDA 2E7FA 5TIMA 2CZDA 1EZWA 2GR0A 2ZZBA 3TZFA 3W6LA 3MSDA 1AW1A 3N9SA 3MKKA 1DHPA 4AD0A 5LZLA 4GNVA 2OB3A 1K8CA 3W1MA 4GIYA 4HPGA 5A94A 3N04A 3VGEA 5DRIA 1HN1A 2FMOA 4Q8PA 3UNTA 4WVXA 1C3FA 3QMRA 4HBKA 2ISDA 4QNEA 2QYGA 3ABSA 2ZC1A 3SFKA 4WKFA 2AL2A 3WNNA 2XFFA 3OPSA 3NCOA 2V6OA 4JR5A 1F4HA 3WF1A 1VBRA 1K4GA 4XD3A 4H3DA 3CGDA 1VB9A 1F61A 4HYRA 3DFQA 2QF8A 2B7QA 4F0HA 1SJBA 3B0VC 4GJJA 5HR6A 2WANA 2PDNA 2JFEX 4GR1A 3WF0A 4UTMA 3ITTA 2ZRVA 4OBSA 2VR5A 5CC3A 4GY7A 4HCLA 5AYZA 4QITA 4RDWA 4BQ2A 4IPNB 1JEHA 3VGBA 3WMSA 2I16A 4LVDA 2IS7A 4PUEA 2FFCA 4ATWA 1E1FA 5IHRA 3G0UA 4R53A 1CECA 3WDQA 1JF6A 1DJXA 3INPA 5C9XA 4HCHA 2X0HA 4ZQPA 1TV2A 2OWWA 2BVDA 2JK6A 3S2CA 3C0JA 4Q32A 5I03A 3VTRA 4ERIA 4NY2A 1HJXA 2YX0A 2NSOA 3GDKA 3ID7A 4GINA 2FPVA 3PBUA 1YBQB 1OT1A 3M0ZA 1JJKA 5HPCA 4LC8A 1XCXA 3URQA 1K8YA 1FWBC 2R9RA 4H4VA 5JCLA 2ZZ4A 1AH0A 1GTEA 3FS2A 3PJXA 3SBFA 3AM9A 4FNRA 4WLCA 3W2JA 3BANA 3CWHA 1DJYA 2CYGA 3M0VA 4P7LA 3R94A 2C19A 3M5YA 1TR1A 3BOLA 1V93A 3WQ6A 3W7NA 3UWQA 3OA5A 5FL0A 2X05A 2YZRA 3BLPX 1K9FA 4WY0B 5E0FA 4LVBA 1GNXA 1A4LA 3QJAA 1OC7A 4DBEA 1KFLA 4B16A 2DGAA 2BXZA 2NT0A 3GE7A 4NP7A 1CX9A 5CZ0A 1PZ3A 1F5ZA 1XH1A 1W2VA 5A1AA 5BU6A 3UR7A 1UPMB 2G0WA 4JCMA 3PUEA 3BZGA 5M17A 5CKSA 3OLEA 4IIFA 2PWGA 2PDXA 1KTBA 1XC4A 4D1IA 2GDQA 2PDQA 3TYZA 1RZMA 1P1MA 5A8NA 4G7EA 2ZQ0A 2Z2AA 1TJRA 4H9MA 3QHOA 1MSSA 1G69A 1FXQA 2NQLA 3S2MA 4ZQRA 1OFEA 4I7UA 1EZ2A 5LGZA 4Q8QA 2G4FA 2GR1A 1EF2A 1E0WA 5I5RA 4QJ3B 5F4SA 4X61A 2BOFX 2OSYA 1ZB5A 1OSEA 3T07A 3TC7A 1B9ZA 2OCZA 2YCJA 5K9XA 1GKPA 3KVJA 4IQJA 3F2CA 2PBOA 1W2PA 2INFA 1ITUA 3NAVA 2YB4A 4KIRA 1VCFA 4YHGA 1XLLA 5CH9A 4B5UA 1BFNA 4H6RA 2PP1A 1DIDA 4U33A 2XN0A 3LXAA 1CGVA 5HWMA 4O15A 4JIEA 2NQJA 1B3VA 2DQXA 2H8XA 4WDTA 1B30A 5I79A 4UQEA 3W72A 4IXXA 3WBWA 3C4UA 5FS6A 1V8EA 3W81A 1JYNA 3SCQA 3IJ7A 1UKQA 1D3CA 3WQVA 2QS8A 3TN3A 1V03A 1EP3A 4PRWA 2CZVA 3QPYA 4HGXA 2WBGA 3WEMA 5CGQA 4Q4MA 2Y24A 2BVYA 3WLOA 1A0EA 2PFHA 2DFAA 4PYSA 1YE6A 1FEBA 2NV9A 4AZHA 2EXOA 1ZRQA 1H2JA 1OCJA 1XI3A 2D22A 2ZX8A 4AXNA 3SSZA 4RZ4A 3ZO9A 1R87A 2HNEA 1XV8A 4KCTA 4A3QA 5EKYA 3QM3A 3TTQA 4LUIA 3A7AA 2X8RA 3CAVA 4NAEB 3LBOA 1XS2A 1ZSXA 4A8RA 1IEXA 3MV11 3DU0A 3PTQA 4YVPA 1SB3B 3NSXA 1I0BA 4WGHA 4RR4A 5L6UA 4JTGA 3WKZA 1STZA 1IWPA 2OLAA 2Z2UA 3WK2A 3S4TA 3THUA 5DMMA 3IVSA 1XYCA 1XCWA 2BHZA 1MQQA 4GCAA 4HTYA 4CQAA 4CQDA 5GJPA 4S23A 4H4RA 4HU4A 3E2SA 2CLIA 3NJ3A 4HPHA 3GW3A 5DT7A 2NQZA 2WZEA 3GIPA 5AVNA 3GHRA 1D7KA 1BTCA 4FMVA 2AGTA 4HU8A 1SZEA 4F2TA 5FMHA 3NIYA 3QSTA 4ML4A 2P50A 5HAOA 5CG7A 2WP5A 2GGEA 4HNCA 2FZBA 1EPXA 4A3HA 3N29A 1WYIA 3PAOA 1UC5A 1B4KA 2A85A 2VD9A 1M53A 3MU7A 2P0IA 8XIAA 2CBVA 3W1PA 1YRRA 3PZVA 2X7WA 1GEHA 4O0KA 2E67A 1EWDA 3PBGA 4PMNA 4DQWA 3PULA 3THCA 1ML1A 2Y7EA 5BOEA 3CO4A 4KEUA 4MIMA 4L4PA 3RG6A 2YYUA 5I3HA 5CAHA 4LA1A 3GO2A 1FWDC 4J28A 1DQXA 1KM1A 4C1NA 3KL5A 5DCEA 2DSZA 1SJAA 3AC0A 2FMNA 3A24A 3OGSA 1D9EA 3N25A 3I6EA 4TVYA 4JTHA 3W1UA 4A8LA 3BQ5A 1FXPA 5CXPA 2R24A 1CW2A 2BOEX 1XW8A 4BF5A 1SM9A 1UYQA 2Z00A 2J4GA 4H04A 1VRXA 4TVDA 2QCDB 2W91A 3JR2A 4JS3A 3MA8A 4AISA 2WJFA 4U31A 3T0AA 3FVDA 4JNZA 1OBAA 1XPYA 3PUDA 3CL7A 3T0BA 4ZMGA 4DEFA 4B5NA 1UJQA 3C0LA 1JYWA 1PJ9A 4XBSA 3CTLA 2D3NA 2QVHA 2P53A 1SZNA 4J3SA 3L0GA 1MNSA 4D72A 3H2FA 3PJTA 4QM1A 1ZALA 1WDPA 3DENA 4JIRA 2Y88A 1XCFA 4P7NA 4JEQA 2FB3A 2JIWA 5MKGA 1F8WA 2JGYA 4WUIA 2XZ9A 1JF5A 4IP4A 3ZVIA 5EFDA 2IKIA 2ZOXA 3CUGA 3UG5A 2G96A 1VHCA 4NEWA 3KOZA 1AH4A 2BNJA 1TPH1 1RR2A 4HHMA 2C3CA 3KHJA 1DJIA 2YL5A 2NLIA 2VEFA 1KQYA 3TLQA 2WC7A 3WFZA 3RHGA 4PTDA 1OD8A 3EEZA 2OU4A 5GNYA 3MWAA 4WJ8A 1HGYA 2D2OA 2E4TA 4YLWA 4GQBA 4Y8EA 1NQKA 3FLUA 4GY1A 5A6AA 4IGHA 4I7WA 2QZRA 3GIQA 1Z8AA 4G1NA 2YXOA 4BCEA 5H2ZA 1WZAA 5A8GA 2OEJA 1XLMA 1TZZA 1DWJM 4PUWA 4MAVA 1R8LA 4AVNA 3LCIA 1E3ZA 4O17A 4Z0JA 2NVKX 3TYCA 3MP3A 4KEVA 1LOQA 3A5FA 3W26A 4EK7A 1OHLA 1GOXA 3AUOA 4DM1A 1YYAA 4HNLA 4MFEA 1Z89A 1CTNA 1CWYA 1VFMA 4QG8A 1UPPA 3AYRA 3LI1A 5PTDA 2GJXA 3HPXA 1G67A 3KLLA 4JIQA 3CUZA 2PDYA 1WB0A 4Q4PA 4E4UA 4Y90A 3GDRA 4DUXA 2D0FA 1H62A 3WH6A 3SQSA 3QKZA 1DJWA 1HGWA 1IXPA 4IQLA 1QO5A 2FGZA 3BURA 5DY2A 1W17A 1PWMA 3OG3A 4OE7A 3M46A 2QPXA 4UFKA 5AB3A 2B81A 5HNUA 2YFNA 4HN4A 4CU7A 1D7YA 1KKRA 1OG6A 1YMYA 3A6OA 1EBHA 3TYAA 2NUWA 3W70A 4KQNA 2P0OA 1FWGC 1LP6A 2Q71A 2Z7KA 2DZWA 3SUUA 4A05A 3C8NA 2QJGA 4NJGA 3GNXA 3B9EA 3VZZA 1J96A 2R1NA 5D2YA 3IK4A 4GUFA 4NZ5A 4QE4A 4Z2GA 1HJSA 2OEMA 1KGXA 3S1XA 2G95A 3QY8A 5U25A 5XINA 1AK5A 2Z6JA 2EJ1A 5XIMA 4QBXA 1WAWA 4DX3A 5LNRA 3OP2A 4PB4A 4W7UA 1ZNNA 3EWZA 3WEZA 3D9XA 4XO6A 3AMZA 2QJMA 3E5PA 4ML9A 1Y7VA 4Z2KA 5CSUA 5AOUA 2GRTA 1UB3A 1AJZA 4GJIA 1GKQA 3CNYA 3B8VA 5ABFA 4FDCB 4F2UA 4J3VA 1RJPA 1IHIA 1GUVA 3A4AA 4WHBA 1ONEA 4H4QA 4D1JA 4BI5A 4YVXA 1VFLA 3EX4A 4XZHA 1X8FA 3G1AA 1AD4A 5T26A 3HMJG 4IM4A 1UD6A 4I5XA 1A5SA 1K70A 4M7SA 1T99A 2OSXA 3NO1A 1TUXA 1CNVA 3VIIA 2CEQA 4ZE4A 1E1CB 4Q33A 1P0NA 3TYDA 1MQPA 4O1CA 3DHFA 4KCUA 1RP8A 2XU2A 1GVOA 4BURA 1N62C 1GZ1A 4XQ6A 3C2RA 2INEA 4GH3A 4S3AA 3AMCA 2I14A 3QY6A 4CNNA 1SVDA 3BLKA 5J5RA 3FW6A 1WYGA 2D2GA 3AIUA 2A79A 3KAOA 3GVVA 4PODA 1UUMA 3HPFA 3QQ0A 3I7RA 2XIOA 1WKFA 3TJLA 4JQAA 5I7GA 5K9DA 1QNRA 1JZ2A 1W91A 3NEHA 3OBKA 3KX6A 2R82A 2OQHA 1XQLA 4C6FA 2XZ7A 2VENA 3NVVB 1Z41A 2E3TA 3LD5A 1YNYA 2W5FA 3ITGA 1XRVA 1KBLA 2QIWA 2BP1A 3W7MA 3MY9A 4QSHA 4B5XA 1EBDA 2WM1A 4K2SA 3W29A 1ZBWA 4W93A 4JN6A 1M5WA 4PTNA 1TV8A 4H41A 3L4WA 4L9XA 1TRIA 4O0ZA 1OFBA 4AF0B 3G24A 3GD4A 4QP0A 4JX5A 2J6XA 1BWKA 1K02A 4D8ZA 3WIJA 1VD6A 5BU9A 4M7TA 3OVGA 4ROQA 3BO9A 3G1RA 4B5WA 4DI9A 3W87A 1WKEA 2WMIA 2ZUSA 3BSMA 2XG9A 5KZEA 4HHLA 1LOLA 2VUNA 5GQBA 3TJ4A 3PPFA 4L7ZA 1XINA 2PTZA 4JKLA 1HF6A 1ZJHA 3SRKA 1TQJA 3IJIA 1GW9A 5G1TA 3AYTA 4CU8A 1RBOB 2R1LA 3RF9A 1PKLA 1NJJA 3HPAA 1X8CA 3GH7A 3HG4A 3S47A 2ISSA 3RNDA 3QW4B 5CJ5A 4XKMA 2A8XA 1FWCC 4OU1A 4QQ3A 3NQ6A 2WBKA 3ETRB 3V18A 1X97A 4PEKA 4CD8A 1SQ7A 3CUXA 1SO3A 4HJFA 1E72M 2WP6A 1JG9A 3SN4A 4YWIA 3TQPA 5F4XA 3EDFA 5FEZA 1K9EA 1MFUA 2DZAA 1EJXC 1PWLA 1FWNA 3VCCA 3WLSA 3F4DA 3SQMA 4H9TA 3LB8A 1CZ1A 4PCFA 4DELA 4FLQA 1KGUA 1E9IA 3WDJA 5CBJA 5CBIA 4MLRA 2FGLA 4WDUA 2W27A 3ZMRA 5G2HA 1BLIA 1A3HA 4XWUA 4V2XA 2FGBA 3T44A 1U22A 1H2IA 2ZE3A 4F66A 1YKWA 1V0LA 3L66A 4GG9A 4MJMA 2CZ5A 4D6EA 1E6RA 4UZUA 3WUEA 4IP7A 3TSDA 3T78A 2PDHA 4AIOA 1XSJA 3MSRA 4DVOA 2W3SA 3V1HA 1IV8A 1FWSA 4LBRA 3WQGA 4I8DA 3DFSA 4TMBA 3AXHA 4IXHA 3UCDA 1Z7AA 1K4HA 1EF3A 3S1WA 3RRAA 5B7YA 2XIJA 2WC3A 4HCDA 2NX3A 4IIBA 3EWYA 3LENA 4UMBA 3LRMA 5EU9A 4TTUA 1WX0A 3CLWA 3FGCA 4RW3A 1RBAA 2E28A 2X2YA 1PCWA 1MXDA 4EPDC 4JYFA 4LC6A 3NQAA 3GTHA 3LV5A 4O1DA 4DF0A 3B9NA 5CEWA 4JZ5A 2NVAA 2OFJA 3R8GA 3FEQA 4FR6A 3ZLHA 1DBTA 1OGGA 3LN3A 3S6OA 1WOBA 1S1RA 1YXCA 1KGWA 4JY9A 3O1NA 3W02A 4LOCA 2C1HA 2WQDA 3Q45A 1T8XA 3W82A 4MB1A 3V35A 5JIWA 4D6FA 3ICJA 1JRBA 3DGBA 2XSXA 1GRGA 1CB2A 1G0CA 4XIMA 4L9YA 3FKKA 2P8BA 1QR7A 4S2BA 4MG4A 5CSYA 3PZMA 2F6UA 1YDNA 2WSRA 3HURA 1NWSA 2RAGA 2XM2A 3MHGA 3BQ6A 3A7UA 4DNAA 4TMCA 1XYFA 1UZ1A 4WJXA 4MYAA 4MTVA 3OQ8A 1MRQA 1G1YA 4IPIA 5JVLA 1QT1A 4MPQA 4FALA 4AIEA 4LNYA 1J12A 5FOOA 4KH2A 1ADOA 1AW5A 4YCOA 1IIGA 1W3LA 1FWTA 4REQB 2PTWA 4EKJA 1SZFA 1TRDA 3UD6A 1BSIA 2Z1WA 4JX6A 3UW6A 1HKKA 1TWWA 2EEXA 3OGRA 4CD5A 3WEOA 1M1BA 4Q3MA 3PSVA 4V1YA 2WLZA 1NWTA 2VX4A 4KWSA 4C6QA 3MPGA 4BS0A 2PLMA 4S39A 3MWCA 1T7LA 4ACZB 2PD5A 4S2CA 5I3DA 1OYBA 4F0KA 3DKLA 2G97A 3AFBA 4JXCA 1MO0A 4GUHA 4ZFCA 5CSRA 1VH7A 1PTDA 1UH4A 3VFCA 1L6WA 3PWAA 3EPNA 1PKNA 2V5DA 1HP5A 1QW7A 3LY0A 1EJWC 1N8IA 5D9MA 3HB9A 4PUJA 3T55A 1P6BA 4GQRA 1GVYA 2HVNA 1RCQA 2XVGA 3E9AA 2ABAA 2RJHA 3KBVA 4FNSA 3KZSA 4Y2WA 2AKMA 2Z27A 3NM3A 5LXEA 3W74A 1XKJA 4MKSA 4F4RA 4HOWA 2A3BA 3PJWA 1V08A 1XHCA 4O28A 4ZO8A 2EPOA 1DYSA 4NZJA 4Y9NA 2HJPA 4EQRA 4OBRA 1UOZA 3P14A 4ZB0A 4DIAA 3CGEA 1ECQA 4AF0A 3GVRA 4FP1A 1FO4A 3WNPA 1P7TA 1L2QA 3DG6A 3GHTA 2CLFA 4LT9A 3N2XA 3QR0A 4PUUA 5IFTA 2RDXA 3CUJA 3SJ3A 1ZMDA 1QW8A 4CD6A 4DM2A 1F6YA 3ZFHA 4W88A 1EPVA 1M01A 1ONXA 4JX4A 3R0KA 5AC5A 5BW6A 4M29A 5REQA 4Q4QA 4H7VA 1FEAA 3KOYA 4JTQA 3ZLGA 1RPKA 3MKCA 4PCTA 1OB0A 1R3TA 3QZ6A 3ITLA 4I8YA 1FHLA 4KETA 4QNWA 1VYRA 1XLKA 2A6LA 1NP0A 1OWQA 4XAPA 3WD1A 2XSBA 1FHVA 4OQVA 3W2KA 7ENLA 2DT0A 2IQTA 1XDIA 3NQVA 2NVDA 3K4AA 3AROA 4JGDA 1THFD 1F3WA 1N2VA 4LNCA 3W7PA 2Y8KA 1CXLA 3AXIA 5C70A 3STEA 5HNTA 2GUBA 1JULA 3WLMA 4BQ5A 1WAUA 4DLFA 2NXHA 4DBDA 2J3NA 3ZQ9A 2NQ5A 3M5VA 4JTUA 4QEHA 2EGZA 2GK1B 3MV01 4H6EA 2DU2A 2PBGA 4ZQMA 5E1QA 3ZXWA 1KTCA 1CEOA 2OMAA 3WJZA 3VD4A 3EWUA 2FZNA 3UP8A 1ZY8A 1VPYA 3FFSA 3TR2A 2WZIA 3HIJA 4H8VA 3CIXA 4I7VA 1A5OC 1DHKA 1YPXA 3VDHA 1REQB 3R79A 3MUIA 5I3IA 1O12A 1F6PA 2QCLA 4XBKA 1YXYA 2W3ZA 1TVLA 5DANA 5EMYA 2PDJA 3FDKA 3GW0A 3LUTA 3TMLA 3MSYA 1GG1A 3ORWA 4XISA 1QI3A 2A1YA 2R1MA 1M7XA 1JYVA 3K5XA 1TVNA 3AWNA 3QV7A 3VM5A 3QRHA 2Y5SA 3ES8A 4P5UA 3WNOA 4RPQA 3WD4A 1UOKA 1OF6A 3A3HA 2DT3A 2WSPA 4NNAA 4AY1A 3URHA 1ITQA 1KQZA 3IJ9A 3O05A 4YMZA 1Q6EA 3QV8A 3URAA 3V4BA 4PBGA 4YXGA 1HUVA 4HVXA 2ZE0A 3I4EA 3U5UA 3RAOA 3K46A 1F07A 4E2BA 3OC4A 4PMJA 4W7WA 1TYPA 5A95A 3KTCA 1Q3NA 4C91A 5JBFA 2XUCA 3GUWA 2BY0A 3N11A 4UQCA 5KTLA 4DZIA 5I3FA 1WCGA 1QXLA 3BL3A 2IUZA 4HNUA 3OHMB 3C86A 3H4XA 4DUVA 4NAEA 3ENLA 1E51A 4B4FA 1ZTVA 2GOUA 3VNKA 1GEQA 2XIMA 3N4FA 3MDUA 3UPWA 2VZTA 1SZRA 3U5YA 3P67A 1JNDA 5T9BG 3DHDA 1UZDA 3PNZA 2CHRA 3M43A 3EOOA 1VFSA 4FOUA 1V77A 3DEQA 4E8CA 2PRMA 1UKOA 1DIEA 3MP4A 1FDZA 1JZ6A 1V6YA 3N1AA 2FH6A 3SI9A 4A6GA 3WQOA 3GC5A 5HMSA 1A5BA 3IACA 1OT2A 1RALA 3CIVA 1WPCA 1YQZA 5JUVA 5HJLA 4YYFA 4K68A 1OFPA 1CXKA 3FDGA 2QUUA 1ZJAA 4XD4A 1LRQA 4J56A 3E3HA 3FJLA 2AGKA 1GV4A 4LS2A 2UY3A 4FZIA 1UJPA 3O0FA 1XIDA 1XL9A 3MUCA 3MJMA 2WNWA 2PDUA 3L4ZA 4G9PA 1TPC1 1LZOA 2WLYA 1CDGA 3VE7A 1NHRA 3UR5A 1IEWA 2XVLA 4WQ6A 2PWHA 5T91A 4CD4A 2CBIA 4HJWA 3MB9A 1R3SA 1F3EA 4LYKA 4RE4A 3GTNA 1VF8A 2VEGA 4XIAA 1ZPTA 2VCCA 4LV4A 4TO8A 2VTFA 3O15A 4UR9A 4L80A 4AZCB 5FKYA 1H1ZA 1P48A 2Y6ZA 4M6VA 1GQIA 2EG6A 1EO7A 5EGRA 4EAMA 3APGA 3CV7A 3WJWA 3N14A 2GSJA 4EPEC 4D9PA 1GZGA 1WDRA 2ABBA 4LAOA 3L5MA 3A4JA 3HF3A 4H9XA 1PL9A 3WBXA 4FPSA 1OQFA 2Q09A 3Q65A 5C7VA 3E0FA 3NO3A 1HKVA 3V5FA 3KP1A 1IEIA 2I9EA 3JZUA 1SFLA 5HA7A 3VZXA 1GJUA 3LZ3A 2Q3RA 2F2KA 4J3TA 5KMYA 2POZA 4JY8A 3PWGA 3RR4A 3HPZA 5DLCA 3GS6A 3B97A 2ZA1A 5A5WA 4K36A 2YCLB 2CLPA 2HK0A 4E38A 3P82A 3B8DA 4M5PA 1FFVC 3SCUA 1RD6A 3IV8A 4H2CA 2NSXA 3EWCA 3GG8A 3IGHX 4IL2A 4D6CA 5AC7A 2RHGA 1S38A 3CWNA 5ER0A 4JYDA 1YE4A 1Q7QA 2WJZA 5K3VA 2DT1A 1DWIM 1TMLA 1V6XA 1W5QA 4L1GA 3GSMA 1A3WA 3GD6A 4L65A 5EMKA 4ZEPA 3KWSA 4UC5A 1W3KA 1XX1A 2WOIA 2WOVA 1WV2A 5JH2A 3FA3A 1JAKA 4LEQA 3B8UA 1Q6DA 3BMWA 5EBAA 5G2IA 1YNQA 3UG3A 3KTSA 5C5YA 4RL3A 4GMEA 4GQGA 1L8NA 1KBBA 3W07A 1UIPA 2ACSA 1JCNA 2CIPA 1A0DA 2DW7A 2Q8ZA 4KCVA 3RXZA 3WUFA 3A13A 3WD3A 4NXSA 1LL7A 3W6YA 4AB4A 1UD4A 4O0QA 5HMEA 3SCPA 3STPA 1PZ1A 1TUFA 4P8WA 3CH9A 4K39A 2EQ9A 4GE8A 1IGSA 4N4PA 4MDPA 4TQTA 1H7OA 2GQ8A 1US2A 4Q7NA 2PCEA 1ECEA 1VFHA 1UP2A 3UCQA 4H19A 4QJ5B 3FNDA 2J13A 5AECA 4XTIA 4PMQA 5JCMA 1YBQA 1IEVA 3W1QA 3H2EA 1O1HA 2V9DA 4J27A 3W1LA 1B31A 2YDRA 1J6PA 1KXHA 2PZ0A 1TV7A 2GVEA 3TSBA 3PZIA 1A80A 3C2EA 3T2PA 1QWGA 1C8VA 1OK6A 1HL8A 2C15A 4F9JA 5FJIA 3UZYA 3GY1A 1I2QA 3IIZA 3KLKA 1US0A 3RLGA 3S0CA 3CU2A 3EMCA 4XVDA 3DHPA 3SRHA 3DFTA 3VIHA 1G5AA 1TX2A 4W5ZA 3NZRA 1RH9A 4JPGA 3R43A 3BG3A 3VOJA 2PDPA 2P8CA 3PJUA 2VL4A 4DZ5A 2GDVA 3ZLFA 1K3UA 3CL6A 3APYA 4C65A 1BF2A 1NSJA 3GAKA 3PUGA 3VCRA 5F1VA 5C6MA 3F5KA 3KE0A 3CJPA 1FHUA 4DWDA 1V0NA 2HE8A 3P84A 4MJ4A 1AJ0A 3BJTA 1PIFA 3NM1A 4HA1A 3A23A 1MZRA 3I65A 1S2AA 2D73A 1K9DA 1BQGA 4YTUA 3NS1B 3MYPA 3M41A 4UTKA 1RLDA 2V30A 3MDWA 4HA4A 1AVAA 4H4IA 4IUOA 4S3FA 4AXKA 1EFZA 4E8GA 4JBRA 2PDKA 4UNLA 3W7OA 5C71A 2CHOA 1WNOA 1V3MA 4N9CA 2FTPA 4OV4A 4RPPA 1W54A 4WIWA 4QLLA 3EA1A 3QR1A 3NQEA 1KC7A 3QLLA 4NILA 4RW5A 4XAGA 4IHCA 3TC3A 3E0IA 5REQB 1Q4NX 4S3JA 1LLZA 3VDGA 1X6LA 3II1A 2HPMA 5AYXA 1OFAA 1F3TA 5B80A 1VAHA 3AHYA 1R38A 5LNVA 2BASA 4O13A 1JRPA 3VOFA 1J0KA 4M56A 1LQ2A 2CDUA 3VC5A 3LTSA 4BF7A 2HNHA 3M47A 5I00A 5A6SA 4BF9A 3UJ2A 1VCGA 1NHPA 1Q6OA 5DQPA 5E6ZA 3NQMA 1NWRA 3T2OA 3NPXA 1OY0A 1XR2A 3IGUA 1FDYA 3B9DA 4OIFA 4IICA 1IWAA 4YL2A 1R6WA 2IQDA 1WZLA 3AS1A 3CQHA 3OO2A 4R3UA 3BW3A 5U4NA 2YCIX 4UFIA 3NSMA 3UVAA 3W9ZA 1PTGA 1KNWA 1N82A 2UY4A 3CQJA 5I78A 2QCNA 5DCDA 1VS1A 3QGKC 2VDGA 2E5DA 3BZJA 4JFTA 2JEQA 2NV2A 4PA8A 3RN6A 5FAGA 3UQNA 2WYSA 5HQEA 4IMFA 4M19A 3UXAA 1XBXA 1XUUA 4FK9A 5H8UA 3G1DA 4GISA 1MWOA 1KCXA 4QLJA 1ZXIC 4H4UA 1R3YA 2GQAA 1L6YA 3TQVA 1XDLA 2QCDA 4L64A 6XIMA 3UWZA 2KAUC 5TD4A 3CZ8A 2O9RA 3WUGA 4Y96A 2W63A 2GSHA 1M9HA 3RCYA 1KTNA 3W73A 3SR7A 2ZRYA 5EFFA 2ODOA 4G2DA 4Z42C 2QDGA 2QV4A 4M6PA 3D3AA 3DKJA 4NUWA 1EX5A 2VRQA 2TPSA 4Q7IA 4XKYB 4KKXA 4W84A 4EMIA 2EQDA 1ZCOA 1TJ2A 5K2ZA 1W9DM 2VHLA 4MOZA 3QGAC 4AZBA 3N2MA 5BMXA 2CWNA 1OFQA 3WLLA 2PRHA 1W3TA 4ZTXA 3N2OA 4JQ1A 2IQ0A 4UTIA 4A3YA 1DORA 4HNVA 3SQPA 1E73M 1YTKA 3SGUA 2P3EA 5DBUA 1G9HA 1I1WA 1WP6A 2G3MA 2QKFA 4KESA 5AY7A 1Y0EA 1TELA 1OINA 3NZ1A 2NT1A 2DT2A 3WZ0E 3CMJA 3HOJA 1TMQA 1BG9A 1PBGA 1KWKA 4UQAA 2TRSA 2PWUA 4JTSA 3U9IA 5LGXA 3R8RA 3FA4A 1XGZA 3PK7A 4FXFA 1BAGA 4PFHA 1QPOA 4PMDA 3VOHA 1XSIA 3N13A 2DJLA 1AODA 3BLIA 3MHUA 3CV1A 4IFRA 4QLKA 1A4MA 2RJGA 1QU4A 4KT2A 1I6NA 2ZRXA 3JRKA 3NZPA 4U4MA 3TR9A 1OFRA 3LX9A 5HUOA 4LAKA 1LT8A 1XBYA 5DEZA 3WQFA 1V02E 3E02A 1FFRA 3FAXA 4JL2A 2E5CA 3WNKA 2DZSA 2J9XA 4KFOA 5FJTA 3OW1A 1P6CA 3Q4DA 1KFKA 1AQMA 3QMTA 4IX2A 3AAMA 5JIPA 1NFPA 4YU1A 3MQTA 4W9TA 1OC5A 4EPBC 1CGTA 3W88A 3DGHA 4ZOHB 3GR7A 2O4QA 8A3HA 1X2GA 3UWVA 2ICSA 2GVLA 2RDWA 3BICA 3V5OA 4S3CA 4W7VA 1RP9A 2Z1VA 1Q6CA 3RMJA 4Y9OA 3KBSA 5LSMA 4GYPA 4H9ZA 3D46A 3CASA 2ZDSA 3BV7A 1TTQA 1YLVA 3V0SA 3NL6A 5AC4A 2J7CA 3HJZA 3GAYA 3V1PA 1E9ZB 3O7UA 3GU9A 3DFOA 4PRTA 4WY0F 3VIJA 4RCXA 3KOFA 3POCA 1J0ZA 4FI4A 5AHEA 3M7SA 3VNDA 2QMJA 1RCOB 3CHDA 3TA9A 3C61A 2PP0A 2ZUUA 1ME8A 3S3GA 2E9MA 3CAKA 1XM3A 3ZR5A 1K6AA 3LYEA 3GX9A 1JUBA 1S2CA 1CXIA 1GESA 2WVTA 2X0SA 2DORA 4X0VA 3UESA 2W79A 4MADA 4GXPA 4O1AA 3VD5A 4CNSA 1PX4A 1QK2A 4JCLA 4ZQNA 3PVFA 3PFRA 1JGIA 1GT8A 1RSCA 5BWFA 3M07A 3M1ZA 1KN0A 4PCSA 4LGXA 1FWJC 4KF1A 4AUBA 3FA5A 3EXRA 5C55A 3STGA 1V3KA 1F3PA 2P5NA 3MCMA 3R10A 6XIAA 1FBAA 1VEOA 4LTSA 3M7WA 2FTYA 3B0YA 5G4EA 3IGXA 1OCBA 1NOWA 3PM6A 3EYPA 7XIMA 3NWRA 3QC0A 2CLMA 1W1A1 4QE1A 1XP3A 1XYZA 1UKTA 1WZMA 3SAZA 3S1GA 3LCXA 2YPIA 1CLVA 3MO7A 2A5HA 1KM2A 5AYBA 2WOWA 4GYJA 4O8RA 1M68A 3ATZA 3AO0A 1FHDA 4DNMA 4L6OA 3FYYA 2EQ8A 1DIKA 4Q8UA 2I5GA 3RM8A 1TCMA 2HXUA 2PA6A 2XISA 4X63A 4IT1A 1LCOA 1W56A 1Z9AA 1PDZA 2D20A 4ZODA 3DK8A 1WE5A 3CXBA 3C6CA 1S3TC 3GG0A 4FR1A 1E4MM 4O4VA 4EP8C 3NPVA 5KZDA 3TWAA 2R94A 3BMXA 2ACRA 4U10A 1GJWA 3URNA 2Z4GA 3C2FA 4TX9A 2W92A 5CZSA 3MBDA 2IMRA 1NF0A 4KWOA 2VX6A 3CT7A 4ES4A 1UP0A 4C5ZA 3NL2A 4FXSA 3P80A 5JBDA 3SADA 4CCEA 3R1ZA 4CNPA 1XGDA 3WD2A 1TJ0A 1DWFM 3T4WA 4AX6A 3PZ9A 3HO8A 4LBSA 5I0DA 2XGZA 3DFHA 4KRTA 4PUMA 5KZMA 5U7SA 1NFGA 1PVNA 5JCNA 1LBLA 2CNCA 3W3OA 4JTDA 3DAQA 4I9AA 4AHPA 1EC7A 3LMYA 4W8LA 4Z1AA 1UD2A 4QRNA 3KVLA 3D6NA 3VA8A 2O92A 1W9XA 2REQB 5A2AA 3TXVA 3KFTA 1B2YA 4P7QA 2C7FA 3VUPA 3UWEA 4C6KA 2DQWA 3CZJA 1KKOA 1Z48A 4FSAA 5BXTA 1OX4B 4IWWA 1KCKA 4MB3A 3JUGA 4MAZA 2VYOA 4L1WA 1D3GA 4D6DA 3NXLA 3N3MA 3ALGA 1VFOA 3QKEA 2DEPA 2QULA 3W1AA 3B4UA 4XUYA 3TWBA 4B9ZA 3EXSA 3K1DA 1HZYA 1L0PA 3KEHA 3W0KA 1XUZA 3TC6A 1EWEA 4JIIX 1X38A 4XUGA 2FZMA 2D69A 4YS1A 3CMFA 4KGLA 4J3WA 4ATLA 3M64A 2CLLA 2QEZA 1E40A 3BLEA 3EANA 5TQLA 1NARA 3T09A 2NXGA 2WJDA 4NHVA 3IIVA 4IH3A 3FJ6A 7REQA 3VD9A 4MPKA 3EA3A 1LVLA 3TFCA 1YADA 2QQ6A 3VNJA 1RQHA 1G7UA 3MUAA 1B3YA 4UBPC 2G8ZA 2VR4A 1ZK7A 4Q8MA 4NI3A 1H50A 1VKFA 4Z2JA 1O68A 3TW9A 2EPHA 5ABGA 4JN8A 1XLCA 2YCKX 1SZGA 3EUB3 1VRDA 1P43A 1GRTA 3B8SA 5D2TA 4MJ2A 5D9PA 4V28A 3W2NA 2ZZ7A 5D09A 1E1CA 1B3ZA 3AU2A 1SR0A 3SUVA 3DDMA 1PPIA 3SGZA 3I3BA 4H9VA 1QNQA 1S2WA 1F2JA 4GFSA 4E5TA 3EWWA 3TCEA 5I24A 5FF7A 1J5SA 3L0NA 4HMEA 3JW7A 1KBKA 2CLKA 4B3KA 3URBA 2PUZA 4HHHA 1QHOA 1GG0A 4TV6A 5LIUX 2ATMA 4BEUA 3TV8A 2HQMA 2C3DA 4XZLX 4GRTA 4ZB2A 2HWGA 4LB4A 4ZOCA 3HA1A 3CHFA 3W2UA 1ICSA 4M1RA 3W27A 3CQ0A 4KW2A 2ZZ5A 3OZMA 2WCAA 2VFGA 4LCRA 3WDHA 4J2MA 1VBJA 1ITCA 2PTYA 4MKVA 5D8ZA 1F8MA 1JFXA 5EA9A 3QEZA 5ABHA 4Z2HA 5CPLA 2XGIA 1UH2A 2NXIA 4QSFA 4AC1X 3WBAA 1VFTA 3S83A 5CG0A 2W3RA 1BTMA 2BGNE 3NVDA 2WO5A 1BHGA 4S1FA 2V3FA 3TU9A 2J7DA 2RFGA 4W8BA 1ZP4A 4LWWA 4OUIA 4ZA0A 1OFDA 1FCQA 1XLBA 1VYSX 1XICA 3BTNA 3RCMA 3ITCA 3W86A 4RXGA 1GRAA 4C6OA 1K9TA 1IXQA 3GFXA 1O5RA 4H4SA 5H8PA 5AHFA 3IC9A 3SCSA 1MNZA 4A2RA 2H8ZA 2Z28A 3C2VA 3C52A 5AHNA 3STFA 1JNEA 4D8AA 3U48A 4V33A 4Q8OA 2QHAA 3HQNA 3VGGA 1N8WA 4H00A 4AU0A 3ARQA 3G3MA 4IF2A 2J7FA 5IM51 1EQCA 1TV3A 3S2JA 1R9YA 3NG3A 1JZ8A 2L5HA 2TSYA 5E93A 1XG4A 4F79A 1FH9A 1RD5A 3LCFA 5CZKA 4BWLC 3BCDA 4QCFA 1OJXA 2HVOA 1A5NC 4MUZA 3TP4A 4A35A 2ZADA 5DMLA 1ZHAA 1O5QA 4C6BA 2ZYFA 1R47A 3LV6A 1TPUA 2AOSA 1VHNA 4OHQA 4JEJA 4B5SA 6REQB 3AICA 1DJGA 2QGHA 2BY3A 5AKQA 2CZEA 2PDIA 1P6WA 3BGAA 4JTKA 5FESA 3MUZ1 1QPNA 1EH9A 1U5JA 4I90A 2B7OA 3UJEA 3CB8A 1TZ9A 2OR2A 5HMDA 4US5A 2KX9A 1R3VA 1TCDA 1TO3A 4OGZA 1VENA 4IUGA 3DFPA 1U1JA 1ZBKA 1FWAC 1G94A 4GUGA 2X0YA 4PTWA 4U5IA 1ZKQA 3LRLA 3NXFA 5DN1A 2W55A 3WH5A 1W31A 5BOOA 1NWUA 4FOKA 3R58A 3CO8A 1B5TA 2YXGA 1UR8A 2OPJA 1YX1A 4QAWA 4XZIA 3PC0A 4V1XA 4M82A 4GZIA 2VWSA 4Z1CA 3AZTA 4EANA 4CCZA 1V0KA 4JYEA 3MCNA 3O6CA 3LMZA 1DJHA 3UG8A 1XIMA 2EQ7A 1FX6A 4KWWA 3ANVA 3W76A 4B5TA 2ZXAA 5E0KA 2QLYA 1OJTA 3BVJA 3EAOA 1Q6LA 4IIGA 2BS9A 2B7NA 2QCCA 1WXJA 2UZ9A 1T3QC 2HROA 3MVIA 4U5KA 1W1VA 3ELFA 4JQ9A 3ANUA 3CBWA 3MZ2A 2GR3A 1MYRA 4LYPA 4HNTA 3GU1A 1CENA 2BBFA 1JPIA 1DVJA 1S2TA 1UWSA 2ZIDA 1TZ7A 3F5JA 4OBTA 4G8TA 4H6QA 2GJNA 3GBDA 4E8DA 3WQCA 4HMNA 3VM7A 4A2SA 1ODUA 2RGLA 3ARSA 3T7VA 3BLDA 1LLOA 4LY4A 1PAMA 1VEPA 5A6BA 5ABFB 1HG3A 1TKKA 1S5MA 2PDMA 1WDSA 1VEMA 2Q3OA 3W83A 3GU2A 2ZBTA 4D6GA 4TU1A 3AN1A 4RKAA 1E3XA 3GG7A 3GM8A 4RNJA 2YVGA 3BJFA 1V79A 1AW2A 2V63A 1RLCL 1JYXA 1E6XM 4YCPA 4W85A 5ABTA 3GVWA 2GVYA 1RK5A 2Q6ZA 3VGHA 4ZZ9A 4HSHA 2YSWA 1NAL1 4HSOA 3M6DA 2QDEA 2HISA 3CUHA 1AUSL 3OZPA 3Q6JA 5EYWA 3UXIA 1E0XA 4MNLA 2V5JA 1G4TA 4HYVA 2JIEA 2YVFA 4PUNA 1EUAA 3E74A 2GUYA 4NZ4A 2GZXA 3HJEA 4NJHA 1MI3A 2GWNA 5AHLA 5FF4A 3AHTA 2H3BA 1KW1A 4F8XA 1BQCA 3R12A 3BWWA 1KCZA 2ASHA 7PTDA 2WZMA 1FIQB 3DJJA 3L2LA 3P62A 2WVUA 3FHQA 4M1BA 1ICPA 1V02A 1IWBA 5HBFA 2YDQA 2ZUVA 3G1VA 2DP3A 3BJSA 1YDVA 1MQRA 4EE9A 2OT0A 3WF3A 4FXRA 2ZZ0A 1QNVA 2G50A 2QNEA 2V8ZA 4TXEA 4GC3A 1QK0A 5CQ1A 4M24A 1NFBA 3VIKA 4C6DA 3HMCA 4GKTA 1ONRA 1DWAM 4GH1A 3V5CA 4K1GA 3U0HA 4Z08A 2YIHA 1X1OA 4OTKA 4PBFA 1D3HA 3RJXA 1S5WA 4LAZA 4X2RA 3B9JB 3KCLA 2BWGA 3NQCA 3ARUA 3TEVA 3EX2A 3TQ0A 2FHBA 2F9RA 2FDSA 4BI7A 1NDAA 3WMLA 1GRHA 1CLXA 8RUCA 3CK5A 2VZSA 5DMNA 3IGSA 1A47A 3ABZA 3ZWTA 2J24A 4H4YA 2J8FA 2RABA 4N2YA 3WSUA 4KGJA 4MNKA 4NL1A 1MW3A 1GQKA 4NSBA 1DL3A 4BQ4A 4ERGA 3GKAA 1SPQA 4N02A 2X30A 4LANA 2ZX9A 2XJ7A 4YHEA 3DHUA 1BYBA 5HJYA 1WXYA 1W3IA 3OBEA 1K1DA 3U2CA 3ITVA 5CPSA 1MOKA 3LPGA 1ZS2A 4MFDA 1SMAA 4AD2A 3V3WA 1TX0A 3HN3A 3U8GA 2PMQA 4W87A 2V3AA 3AXXA 2EKGA 3N34A 3H4GA 2J7GA 3LEPA 4PR4A 3L65A 3G3DA 2OOFA 2R91A 1H3GA 5A8PA 2ISVA 1JQXA 3TTEA 1XRFA 2F6KA 1GQNA 1X96A 2HTMA 3B04A 3M9YA 4JTFA 4PN2A 4JD4A 3HBLA 1H49A 5JXQA 4OVXA 2EG8A 3VIOA 1A53A 2NUYA 5FCZA 3FV9A 3DERA 3DX5A 2QMKA 1F05A 5J04A 2AQWA 4IIHA 4LX4A 3EWDA 4JHZA 1GK8A 4UFHA 2IKGA 5D9NA 3CZEA 2ZC8A 4UTWA 2XPKA 4KS0A 3GDLA 4JTCA 4EACA 3ECQA 1CBGA 3O6YX 3UY8A 3A9BA 5TF0A 3EA2A 3P0XA 1PO9A 5M3WA 3QLDA 3NQGA 1OABA 3BGJA 3WDPP 2FQIA 1MMFA 2GGIA 1AQFA 5IXEA 2DUAA 2WZTA 1NDYA 4YIWA 1XIIA 1ZX9A 1JPHA 4Y9AA 4LUTA 3R4IA 4EQSA 1YPFA 5FEPA 5D8WA 4ZL1A 2HXTA 4CGTA 5F2MA 4N9BA 1ZENA 4B2DA 2FDMA 2J62A 3MI2A 4PSRA 2GUUA 5EBUA 2UWFA 1RPXA 1GXFA 3EZ4A 4B90A 2BGSA 4K8EA 2DVTA 5KITA 5A8QA 2J66A 2WSKA 3P81A 3T81A 5D2VA 2CFYA 1FFQA 1GOQA 3MUY1 3OG2A 3UT0A 1W3NA 3O0KA 4XB3A 1XLEA 3GXFA 4JDRA 2J88A 2E6FA 3N3TA 1V7AA 2RKXA 1K77A 1E70M 4ZQCA 3OU8A 4ADTA 4DF2A 3ZT5A 4UOQA 3QYQA 4HMCA 3IRDA 1PX8A 3UXLA 3N6JA 1BSLA 2PGFA 1GJPA 5GNZA 1Q5MA 1I45A 2IPGA 3Q37A 3H55A 2XH4A 3UWWA 2WMFA 1X6NA 4BWLA 4E6MA 3AMKA 3W23A 2POTA 4EWJA 2A3EA 1UHVA 2CC0A 5A6KA 4YWOA 1XYAA 3H54A 4PTVA 2OZ3A 4CQ9A 1HT6A 2QCHA 1NP2A 1XLFA 4AD4A 2XN2A 1E5NA 2XH7A 1EL3A 2HE5A 5HANA 1RK6A 2NQHA 3ZJKA 4HZ6A 4CN4A 1TPVA 3H21A 3PZUA 3A12A 1E0TA 2J7BA 2VT0A 1MVYA 1TJPA 5IBXA 3VNLA 3VZYA 3W24A 1Q85A 1FWEC 2YW4A 2DIEA 3GYEA 1HJVA 4JIPA 1QATA 2AKZA 5HJXA 3OVQA 1TVPA 1UA7A 4PSPA 5G2WA 1PV8A 3RPDA 3DK4A 3O8AA 1EDGA 3ONCA 2WPEA 4TX6A 4AZ5A 2Q8XA 2O7SA 2ZICA 1E5JA 2EPKX 2FTWA 2V82A 3WLNA 4XSMA 4MNJA 5EPDA 5FS8A 2QJJA 3HZ3A 2GQ3A 1L6FA 2NUXA 5FSEC 4QEEA 3W6MA 3BCFA 4FEZA 3WX7A 3DZ1A 1HFBA 4GABA 3LTYA 2Y5JA 4JTJA 3ZZ1A 3ANYA 2VX5A 1UQZA 3R8HA 4ZO7A 2C13A 4O54A 3QQ1A 4PRRA 5I3KA 3MP5A 1FOBA 4NASA 1OGBA 1O5XA 3GWQA 3O6DA 3P6LA 4GIRA 2E5AA 2TYSA 1H51A 1JCTA 3BG9A 3QOMA 1DP0A 3FSTA 1XXXA 3UPBA 2C71A 1HX0A 1UZHA 3VK5A 1JZ4A 3GKFA 1WOAA 2TAAA 3DGZA 4PZVA 1TYTA 3JU2A 4JKMA 4DJFA 1LRNA 1KD0A 4X0NA 1OYCA 5JBEA 4NYYA 3SCOA 3VCNA 3EOUA 3WYZA 1IXNA 4AWUA 1Q8JA 1BRLB 3GZ3A 3MYOA 3BK0A 3M6YA 4EOUA 3OVPA 3V0UA 4IQDA 3RLUA 4ZSTA 5D2XA 2Y61A 4KERA 2XVNA 1GYMA 5CLWA 5I77A 3T9PA 2ALRA 1L9WA 1H4PA 3VNZA 2VGBA 3ZIZA 1XPGA 4C7GA 1ZL1A 2O0TA 2JK2A 4C90A 3CUFA 3A4XA 1H0IA 2FLIA 2YJQA 3LHTA 4FNQA 4H8HA 4B5VA 1WO2A 3FVMA 3RITA 1PKYA 2PTXA 3CEPA 5EMMA 3HGSA 3IEBA 4ILSA 1H1NA 2CWXA 3H24A 4TVWA 1W1YA 3GNRA 1TIWA 4KIEA 4V15A 1VR6A 1W9UA 3THDA 1W6TA 1V51A 1I1XA 3KCOA 3LQLA 4MWAB 4FNUA 2Y89A 1JVNA 4XKYA 4QAIA 2A7PA 4DO4A 1FWIC 1J9YA 3S9ZA 1E4NA 4J1OA 1C7SA 1OEPA 4PB3A 1NELA 3HW2A 1DPMA 1EKOA 5FJPA 3N4EA 3BUVA 1AQHA 1F8IA 2WPCA 4DXXA 4WKAA 3NPUA 4UNKA 2BC0A 1KO0A 1E9LA 1ZUAX 5D05A 4RE3A 1WBHA 4UR7A 3TNBA 2CLOA 4TV5A 3WK3A 1UWIA 3WFLA 3R7MA 1GOMA 3VDAA 1C91A 1E71M 1RY0A 3C2YA 2VEPA 3CZKA 4QROA 1ZAIA 4MZYA 3MHFA 3NDZA 2WNZA 4IG2A 1L2UA 3AQUA 3L7RA 4YWSA 2GJRA 4DPPA 1UC4A 4OECA 2RDTA 1JXJA 4H9YA 4LCSA 3LGGA 1FKWA 2GGJA 1A5AA 4OWGA 3F4NA 1LG2A 4A21A 1WBJA 1FA2A 1ZDLA 1IT7A 2VGFA 4IMDA 2E09A 2QDDA 2VFEA 1DXEA 3T08A 3SB0A 1H7NA 2ZRZA 1PZ0A 1R7AA 4JNMA 1KV8A 2YW3A 2O7QA 3PWIA 5C2CA 1FCVA 1RVKA 1HNYA 3ERPA 3LHUA 1J0HA 2YKKA 3VE9A 3NYDA 4FIQA 4FNPA 1BF6A 2BDQA 1SO4A 2FH8A 5FS7A 2FYMA 2ZTJA 3W7QA 5HXMA 2YYTA 2A3CA 4QFUA 3S42A 4UMCA 1JEZA 4EVZA 3AUJA 1BXNA 1QDSA 1AMKA 3ES7A 3TN6A 4PL1A 4XTDA 1TE1A 2E68A 1JDCA 1ME9A 3M0HA 4NF7A 2VCBA 1UG6A 9XIMA 1V6TA 4LPCA 4D6HA 3VUSA 2AMXA 2ZVRA 2PU1A 4UQBA 1I75A 4YTQA 1NDVA 3EB3A 3NQDA 4RNFA 1G4PA 1MW0A 4R27A 5JRBA 4HPXA 3P93A 3PBYA 1IR1A 2OG9A 3EOEA 2F8QA 3VXGA 3FX4A 1QBBA 4H8UA 3WL1A 3BAIA 4WK9A 5CJNA 4N0RA 4NG3A 1ISZA 4MDOA 2VD8A 3S5YA 3PTMA 2O55A 4UTJA 2VX7A 1I2RA 3WDIA 2WPFA 3LQGA 4I6KA 1XLGA 4M3PA 1W3JA 5FJUA 3GTXA 4MKNA 2QUVA 3VYLA 1DE6A 4DJFD 2CXGA 3FXGA 2JF7A 4EF9A 4XX6A 3B8IA 1NHSA 2E6DA 2QVNA 3TLLA 2BC1A 1KWGA 3OZOA 1NH6A 3NFUA 3CM4A 1Q6QA 2XDFA 3FSUA 4RV3A 3GQYA 3NO5A 1UW9A 2B31A 1V59A 2NWRA 1OX6A