4HCHA

Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium and l-tartrate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
384
structure length
384
Chain Sequence
SHMIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isomerase/lactonizing enzyme
publication title CRYSTAL STRUCTURE OF D-GLUCARATE DEHYDRATASE FROM AGROBACTERIUM TUMEFACIENS complexed with magnesium and L-tartrate
rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 140
structure length 384
sequence length 384
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hchA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hchA01
3RR1A 1TZZA 3UXKA 5ENLA 4M6UA 2MUCA 4KWSA 3TTEA 4HCLA 2AKMA 4MGGA 1WUEA 3OPSA 4A6GA 5FJPA 4IZGA 3TJ4A 2PS2A 2QJJA 2GGHA 3V4BA 1SJDA 2PTWA 2QJMA 5FJOA 1R0MA 1E9IA 4H2HA 4GFIA 4HCHA 2OZ8A 2PP1A 2QDEA 2GGEA 4E6MA 2OG9A 3N6HA 2OQHA 4FP1A 3T6CA 2GL5A 2RDXA 4DHGA 1KKOA 3P0WA 4ZCWA 3RGTA 2AL2A 2XH0A 3QLDA 3ZLGA 2DW7A 3D46A 2CHRA 4KT2A 2PTXA 4GMEA 2PTYA 3ZVHB 3CT2A 2GGJA 2PCEA 3OTRA 3V5CA 3DIPA 2ZC8A 1PDYA 4KEMA 3NFUA 3H70A 3UJ2A 3QN3A 2OX4A 1NU5A 4F4RA 5IDZA 3ZVIA 3Q4DA 1MUCA 4DYEA 3GC2A 2P0IA 1XS2A 4J3ZA 4ROPA 4E4UA 4M0XA 6ENLA 1P43A 5FJUA 1F9CA 1EC8A 4GGBA 3NXLA 3SN1A 3RRAA 1P48A 2MNRA 1NELA 3N4EA 2XSXA 3R25A 3P93A 4HN8A 1BQGA 3GY1A 2GGIA 4FI4A 3TCSA 4IP5A 4K2SA 3MY9A 3MZNA 3U4FA 4HCDA 3QTPA 3FVDA 3V5FA 1OEPA 4H19A 1L8PA 2XH2A 2XGZA 3T9PA 3GO2A 3PK7A 4E4FA 3THUA 1KKRA 3IJLA 3R1ZA 4DX3A 4HPNA 1BKHA 4GISA 3BOXA 3SSZA 3DESA 1WUFA 3DGBA 3T8QA 1MNSA 4IL0A 3CB3A 3GD6A 5J04A 4JN8A 3MQTA 3JVAA 4J1OA 2HXTA 3RO6A 3SN0A 3DFHA 2FYMA 3FXGA 4G8TA 3FYYA 4GIRA 3CXOA 2PU1A 1TKKA 3BJSA 3VDGA 1KD0A 1ELSA 2GGGA 3FJ4A 3DG3A 7ENLA 3TJIA 1XPYA 3N4FA 3H8AA 3SN4A 4HYRA 3ZLHA 3UCCA 1YEYA 3DG7A 2QDDA 2XH4A 4H83A 2OZ3A 1FHVA 3ZVHA 1JDFA 1MDLA 4MMWA 2OO6A 3MWCA 3IJQA 2PODA 2P8CA 4DXKA 1JCTA 3FV9A 3JW7A 3JZUA 5BOEA 2PGWA 3MSYA 3I6TA 3EKGA 3NZGA 4ZA0A 1R6WA 2POZA 3DDMA 2PU0A 2HZGA 2P8BA 3MUCA 4GYPC 1EBHA 2AKZA 1EC7A 3DG6A 1PDZA 3OZMA 3QKEA 3TWBA 3VFCA 2PMQA 3R10A 3U9IA 3MKCA 3TWAA 3PWGA 1DTNA 4H1ZA 3UCDA 2OQYA 3FCPA 4HNCA 4Z1YA 3D47A 1SJAA 3ENLA 3SJNA 2OPJA 3T4WA 3BSMA 4JHMA 3KUMA 3UJRA 2DW6A 1ECQA 3UGVA 1JPDX 3TOYA 4A35A 5BOFA 2P3ZA 3NO1A 3QPEA 5FJRA 3I4KA 2GSHA 2PP0A 2NQLA 3ES8A 3TW9A 3PWIA 5EU9A 3VA8A 3B97A 3UJFA 4IL2A 1KCZA 2AL2B 1SJCA 1MRAA 3DERA 4K8GA 3OW1A 1FHUA 3OP2A 2PSNA 1EC9A 3ES7A 4DN1A 3RITA 3R11A 2OKTA 2XH7A 3VC5A 3OZYA 3VCNA 4GGHA 3N6JA 4A3RA 4MKSA 1IYXA 3K1GA 4Z17A 2QVHA 3UJEA 4GYPA 1SJBA 2PGEA 3HPFA 3VCCA 2HXUA 3V3WA 3IK4A 2OLAA 2I5QA 4G7FA 1EBGA 3TQPA 3I6EA 5FJTA 3VC6A 2QJNA 3R0KA 2GDQA 4IHCA 3STPA 2PA6A 3CYJA 3RCYA 3P3BA 2PPGA 1TE6A 1JPMA 3SBFA 3UJSA 4E8GA 4K1WA 3CK5A 4E5TA 3R0UA 4HNLA 2OVLA 3Q45A 3S47A 4EWJA 2PP3A 4YWSA 2QGYA 2ONEA 4DWDA 3S5SA 2AL1A 2OFJA 4X2PA 3H12A 3PFRA 4ENLA 1RVKA 4IP4A 3ZLFA 2PTZA 2ZADA 4KPLA 2O56A 4JN7A 1W6TA 3SQSA 2P88A 1ONEA 3IJIA 3CAWA 3DEQA 1MDRA 4IT1A 2HNEA 3UXLA 2QQ6A 2OZTA 3H7VA 2FKPA 3DFYA 3EEZA
chains in the Genus database with same CATH superfamily
4PTVA 1NWTA 3L2MA 2GJRA 2XIBA 1K6WA 3TNBA 2P3EA 1EB3A 3RR4A 1W3JA 4FALA 1S38A 4AD0A 2QJJA 3ALGA 3FYOA 3H2MA 4PEEA 3AQUA 3LHZA 4RJEA 4HPJA 4GYKA 4A3QA 3EXSA 2PI6A 1ICQA 2NLIA 2BDQA 3H6OA 2Z1XA 3C6CA 2UY4A 4GIEA 1QTWA 2VELA 4RZ6A 1W1A1 3QPZA 1RA5A 3S46A 5FIPA 1H3GA 3T55A 2AL2A 1X2HA 3U2EA 4HA1A 1JXKA 3N4AA 4AG0A 1ONXA 2GLKA 3ZVHB 3EDFA 3PM6A 4C7FA 2EXOA 3BGAA 4LAUA 2JGQA 4JL1A 3S5ZA 4JFUA 1MFVA 1V77A 3MSDA 1NEYA 3NFUA 2R9ZA 1FXQA 5HMSA 1J10A 1EDGA 3QN3A 3LCLA 2PE4A 4I6VA 3WDJA 4DBEA 1U5HA 2EPKX 4K8EA 3CV2A 2VUYA 1GRFA 4B2DD 1Q6CA 2X8CA 3UFYA 4IIHA 4UC5A 1P0EA 1XS2A 4IMDA 2NX9A 4M0XA 2YLLA 1W5OA 4ZE4A 5FJUA 3STGA 2RFGA 1EC8A 3PJXA 4I8YA 1THFD 3WLJA 1Q1RA 4GBUA 5F1VA 3HGOA 4EXAA 1UR0A 1V0LA 7ODCA 5FL0A 1DJZA 2FJUB 1OCQA 4XV0A 4PTNA 1XQLA 4NL1A 1KA9F 3L2IA 4B2DA 2GGIA 3W7HA 3W7IA 1E1FA 4HNOA 2V2CA 2WMIB 1UJQA 4UMBA 2GFTA 4KRZA 1UWAA 1T6MA 1TVLA 3KVMA 2GSJA 4JD4A 4W87A 4Y9MA 1Z69A 3AFBA 4YL2A 4QNEA 3EB3A 4E2BA 3O07A 3RX2A 1ESWA 1VBGA 2DVTA 3SSZA 4NKCA 1VJIA 4BJHA 1H0IA 1KXQA 4F9DA 4PMNA 1KLYA 1SW7A 5JBFA 4PMJA 2NW0A 1ZQ5A 1R2RA 1AFSA 4D6CA 3CL7A 3KS6A 1BVWA 3HU7A 2VEFA 2O9PA 2J8FA 1RD6A 4ERIA 1MNZA 3PBYA 1O94A 3FXGA 5LIWX 4RPPA 1DIOA 4L1GA 1HX0A 3NQMA 2PCQA 2PDQA 4CCDA 3FA4A 2ANUA 1XF0A 1KQYA 3IAQA 3N9SA 4I7VA 5H6HA 3KLLA 2YYUA 1GT8A 1A49A 1FA2A 4DIAA 1GRAA 4OECA 3KHJA 3MI6A 7ENLA 2PDWA 3UXDA 4JFSA 1EO7A 1UR4A 3ABRA 1FWCC 2P50A 2D2OA 4UTLA 1NHSA 2OT0A 3AROA 1LJYA 4K38A 2C1IA 2ZX7A 3Q94A 1XV8A 3S5OA 1EJRC 1E3XA 3R94A 5T8GA 3IJQA 2E28A 1WPCA 3BGGA 2YZ5A 1XP3A 5G5IA 3VGBA 4PUJA 1UPPA 2WNWA 3VKJA 2KX9A 3CASA 3OOQA 4O13A 5HPOA 3F2BA 2X30A 4IX0A 4H8VA 4MYAA 4GYPC 4E4PA 5F1UA 3QQ1A 2WZIA 2DEPA 3P7YA 3ZT7A 4L4PA 4IIEA 5HR6A 2GR1A 4JTJA 3W7JA 2MANA 1P6BA 2ZQ0A 4E8CA 2HS8A 3U48A 4IFRA 2CZ5A 4MM1A 3QFBA 2C91A 1I2NA 1QPRA 4GABA 3O0KA 2PTDA 4Z08A 3ZT6A 5A6MA 3WF3A 3WLSA 4IGMA 4EK7A 2OQLA 5AYBA 3WLPA 3ENLA 1H0GA 4LUTB 1ZRQA 4O18A 4ADUA 4PTDA 3W1NA 4I9JA 2WPGA 1G4EA 2R94A 4JHMA 4JTAA 3E3HA 6XIAA 1K9FA 2DZXA 4JNMA 4DZHA 1B3ZA 3TONA 2E68A 3WENA 3M16A 2YVFA 1DWAM 2DGAA 3K5XA 3NO1A 2I56A 1WZKA 1AW1A 1CT5A 3FSUA 3GVWA 4XZ9A 1WDSA 4H9VA 4CQCA 5I3IA 2PLKA 4J3XA 3MSRA 1HVXA 5TR3A 2VRKA 1Q63A 2QUVA 3CPUA 5E09A 4PMQA 1O5KA 2GJPA 3LQLA 3KZPA 1DWJM 3FJLA 1VHCA 4AIBA 2HVOA 1HFBA 2HE5A 1B9ZA 4HA4A 2XH7A 3VC5A 2E1DA 3MYOA 3IWPA 3QSTA 2WLYA 1CCWB 1H4PA 4DVOA 4HPHA 4HYWA 2W4XA 1TB3A 3NPWA 3MUIA 4CQ9A 1CDGA 1XI3A 1OYAA 1A4LA 1WZLA 2G50A 1XIIA 4PCSA 4N02A 1H7OA 2V3DA 1UKQA 2VYOA 3L8KA 5AC8A 1NARA 4EX4A 1JGMA 4BI6A 3RPDA 5B7YA 4OBRA 1BD0A 3TJLA 3THDA 5HDRA 2FFCA 1YPIA 3QZ6A 4XZIA 3AC0A 4B5WA 3TYCA 3KOZA 1W1IE 4FIQA 5LZLA 2JF6A 4G2DA 4HN4A 1NFBA 1Z7AA 2WM1A 4NT0A 4K6AA 2GR3A 2VMFA 1UQZA 4GNKB 2WJZA 3GUGA 4YWSA 1W3TA 3PNZA 2ACQA 1NH6A 1M65A 2IQ0A 2PTZA 3CQ0A 4QE1A 4Y9OA 4G56A 3Q37A 4H9XA 5AHFA 2ZX6A 3TA6A 1MDRA 1V8EA 3UD6A 1MFUA 2CW6A 1ZENA 1W17A 2EG6A 1XIDA 1BGGA 1ZX9A 1TZZA 3G1SA 3UXKA 4AC7C 1YX1A 3J7HA 4P7OA 1E43A 3VYLA 4HCLA 4EQXA 5FJJA 1NFGA 4YTTA 4R27A 4DJDC 2FMOA 3BMXA 1JL8A 4B5TA 3R07C 1XLLA 1MUMA 3V4BA 1JFHA 3L0NA 3KOWA 4WQ6A 4LX4A 1IWBA 4REQA 3CWHA 1B4KA 2PP1A 3CH9A 2ZXDA 3OC4A 1E71M 1GZGA 2JEQA 2ZC1A 4RV3A 4P7NA 1XIGA 4C60A 3LPPA 3VX1A 4DHGA 5I3HA 4Q4KA 4Q7IA 3UZJA 8A3HA 1SZNA 3VKAA 4EAYA 1LOQA 3NIYA 1AQHA 1JRCA 1V97A 4LAZA 2NQHA 4GMEA 3GLCA 8RUCA 1E72M 2D2HA 4QEEA 2VEPA 4ZQOA 2VWTA 3AXHA 3WFLA 4ZOCA 1AD1A 1PKMA 3W38A 5CAKA 4GJIA 1PS9A 5I78A 5JH1A 3S2LA 3UG3A 3AJ7A 5IDZA 3NO5A 3ZR4A 4LBUA 4M51A 1Z44A 1IEIA 4DYEA 2YL8A 4HJFA 3DH9A 4QISA 4JY9A 4ADSA 4BS0A 1EWDA 3ABXA 5A2CA 1T8XA 2GSEA 4U10A 1EHNA 4F0SA 4ADWA 3BV7A 2WSPA 3VZYA 2CHNA 5U25A 3CXBA 1KNWA 2INZA 1NELA 2QPXA 4GLEA 3W86A 1NF7A 4HN8A 1VRDA 2DIJA 3PSVA 2VDGA 5G1TA 1V6VA 4ICMA 1OFPA 2OEJA 3TN3A 1J0JA 4HCDA 4Q8TA 2CZFA 4EMIA 3I7QA 3PWAA 1RV8A 3KDNA 4GQQA 2W62A 3LHYA 1B31A 3KEHA 1DL3A 4E38A 1RALA 4UBPC 2OXNA 3BH4A 3SIMA 1RLDA 2YXOA 3U0HA 3BOXA 2H6RA 3IIZA 4ML9A 1VDVA 1E1CA 1OFQA 3ZJ6A 3N19B 3LEPA 3G1HA 2ESCA 3M0KA 3A5FA 3CB3A 4I5UA 2FH6A 1Q66A 5KTLA 4IGNA 4PBEA 3N73A 4BF5A 4TU1A 1OT1A 4WSKA 2W6RA 3HG5A 1Q2RA 4PMOA 4B5XA 3MZ2A 2JALA 3BGJA 1B57A 4JL2A 1OSEA 2WBAA 1OFBA 3SFKA 4PB4A 2Z7GA 2BX7A 2PRLA 3TOPA 1GGOA 1ZZMA 2GWNA 2PWFA 4EACA 3SY8A 1FEAA 1K02A 2DT2A 3K4DA 3VX0A 3W7DA 1OD8A 1NHPA 3CZGA 2UV8G 2A3AA 1H61A 5M5DA 1YHTA 1LYXA 4Q4SA 3KBSA 4CCEA 4B9ZA 4FNUA 4O4VA 5DFAA 3LM3A 4ML4A 4UQBA 1PCKA 1PYFA 2O4QA 3TYBA 2J9XA 2QCGA 1AOGA 2ATMA 1UZHA 2GVLA 1G7VA 4CD6A 2IW0A 2PODA 4D6DA 4JCMA 1L2QA 4BI7A 5I3DA 1DIKA 1UASA 3IVTA 2ZFAA 4QS5A 1L6YA 1DXIA 4WDUA 3AHYA 4RZ5A 2GJLA 3AJXA 1NTHA 2POZA 2J7HA 3DDMA 4YCOA 4P7QA 4K36A 3WD3A 4DO5A 1QW8A 3GRIA 2WOIA 1JGIA 2G5WA 4CNOA 4GACA 5IOBA 3P8IA 2YX0A 3WEOA 4W89A 4LS1A 3QFEA 8XIMA 4NZ1A 3O0FA 4KCVA 4MWAD 1VJSA 2VKZG 5LNUA 4IH3A 3B8TA 3AIUA 4FB7A 4LC8A 2PD5A 1PX4A 2EQ9A 4MWAE 4GI6A 1OC7A 5HNTA 5A5WA 3I65A 3OB8A 4LRSA 5G1MA 2E5BA 3A7AA 1KC7A 1S5TA 1GVRA 3VNZA 1XGEA 3OU8A 4TX9A 4JTDA 5BXPA 4KPRA 5A6LA 4MWAA 3UWZA 3EX1A 1ISWA 1X1NA 1KO0A 3FOKA 2J8GA 2ZZ2A 1V08A 3CM4A 3NQBA 2QJGA 3KOYA 2AAAA 3W87A 4RXGA 1CGWA 4HPGA 5H8PA 3B0XA 3WLKX 2Y5JA 3GUWA 3RDKA 3WLLA 1W5MA 5DY3A 1KRAC 3WBYA 2XM2A 2DZPA 3U2OA 2V3AA 2OYLA 4GFSA 3P14A 4UFLA 1JYXA 4H4RA 3DECA 4DNMA 1WB0A 4LS2A 2BGSA 3W1LA 5ECVA 4H7VA 3C0SA 3GZAA 2WZHA 4V28A 3A3XA 3PBWA 2Z1BA 1IEVA 3B8IA 1EF2A 4UNIA 3RCYA 4AIEA 5EMKA 5T91A 2YYTA 1JPMA 1LT7A 5DEZA 2E1WA 4DZIA 4H00A 3FEMA 4TMBA 3WMBA 1XDMA 2AQOA 4K8DA 1ZJHA 3TMQA 1QW9A 1JI1A 4EWJA 1EEXA 2PP3A 2BASA 2ONEA 1CTNA 4M80A 3S5SA 2F84A 2D0GA 3H12A 3VIMA 3OHMB 1A5LC 5CPOA 1WV2A 3ZLFA 3HBLA 3ANUA 5EMYA 1UMYA 2E0PA 1XHCA 1LBMA 3AYRA 4M6PA 4W84A 3VGDA 1W6TA 3G0UA 3N2CA 3AZRA 1QXLA 2JFEX 1HZYA 4BV6A 4HQVA 3W22A 4BZYA 5ENLA 2G3IA 5CZKA 4KWSA 3N2XA 3CWNA 1ENUA 2AKMA 1R7OA 5C9RA 3CGDA 3W1XA 3IIPA 3M9YA 3W7PA 2Z6JA 1KFEA 3V75A 2CLIA 4LGXA 5E6ZA 3B8DA 4XZHA 5A3HA 2CLLA 4XKMA 3DU0A 2O4MA 1S2AA 4QG8A 4LY8A 4I9AA 3ORWA 4NJIA 1JDDA 4NZ3A 3TC6A 5EFFA 3GXIA 5AFDA 3R5EA 4M3PA 3N6HA 1JEZA 3AIQA 2G3JA 2OB3A 3LPOA 3NOYA 4J3TA 4WVXA 4AZIA 1FWHC 4AMCA 1BVNP 7REQA 1DOSA 1TV5A 4AIUA 1OK4A 4NAEB 4JYEA 3OLIA 4INFA 1XH0A 3MKVA 3XISA 4AX6A 4CNSA 4UQ9A 4W8AA 3B05A 1S5VA 5EFDA 2P0OA 3EB2A 2W3SA 4IG2B 3WJSA 2B31A 4DJEC 1HKKA 2CBVA 1QMLA 4EWND 1OFRA 3NCOA 3EOSA 4QE5A 1VS1A 4ZFCA 3GH5A 1JNDA 3EMQA 3MI2A 4H4VA 1BG4A 2J13A 4JEQA 3LHWA 1TQJA 3Q4DA 4HSNA 5D2TA 3SGUA 1ZALA 1SZRA 1EPXA 1JJKA 1S3HA 4JQ3A 4RNIA 3QW3A 1KCKA 1Z6KA 4MPQA 4IIFA 3C3UA 2C0HA 1RM6B 2TRSA 3WL0A 3WYZA 5E9XA 4DBUA 1KCXA 3L0KA 2Z7KA 4Q6JA 3R25A 2GUYA 3RIKA 3IV8A 2WBKA 3BSGA 1G7UA 3PBVA 1ZTVA 5D33A 5EMUA 4X63A 1M01A 3M0ZA 4XSMA 4O1BA 2ZZ6A 1TVNA 5GJMA 3DHUA 1KM1A 4NYUA 2XHYA 2KZHA 3FVMA 1O5QA 1TPVA 3RN6A 3VNJA 2RGLA 3EZ4A 2PZ0A 4FX7A 4FIRA 3URNA 2J79A 1H1NA 3GDTA 1HW6A 1VF8A 5PTDA 4UNKA 3EDDA 4AY1A 3LNPA 3G0XA 4NP7A 1C7TA 4IJBA 1TZ9A 1QBAA 1OB0A 1UC4A 2R1NA 5FF2A 1KM0A 1DIEA 1UZDA 2OTDA 2YB4A 2YQUA 2CZDA 2DZSA 3QOMA 3RPTA 4DO6A 3I3EA 1QNRA 3F4WA 2CCRA 2Q8ZA 3FN9A 1PIIA 3NQVA 1P0NA 5I0DA 3S1UA 1A53A 2BY1A 2QUNA 1P1XA 4TVDA 1MO0A 1S2UA 5ER0A 2QUTA 3ERPA 2PAJA 3PZGA 4AEFA 5CH9A 3YPIA 2QT3A 2XVPA 3CZKA 2YAUA 4A2RA 3UCCA 4JTIA 4XZNX 2OYMA 3KBWA 3VOCA 1HJVA 3ZR6A 3DJJA 3RAOA 5IRPA 3T81A 1JDFA 1XKJA 2EKCA 4QJ5B 3WMCA 3KWSA 1RCQA 2XN2A 5LGXA 3CJPA 3QHNA 3BLKA 3MV11 2VTFA 1J0YA 4KRUA 1AG1O 4DXKA 2ZUMA 2RHGA 3OA3A 4IXXA 3APTA 3S1VA 4O28A 3LQGA 7XIMA 1GZ1A 3MMTA 3CHFA 5CLWA 5FESA 2PU0A 4FXSA 4LQ1A 4H4UA 1TE1A 5HMDA 4CNTA 4LEQA 3PZVA 1XLKA 4PUWA 3S9ZA 3GB6A 3WQEA 3PJWA 1E51A 4MG4A 3REQB 1CGXA 5C9UA 2H3DA 4BF7A 3AS0A 2L5HA 1EJTC 1LORA 4UIOA 1UOKA 1TX0A 3CO4A 4XSLA 2A21A 3MMDA 4AVFA 5CZSA 3ETRB 1SO3A 4Y96A 4OGZA 3V1HA 1AW5A 1KB3A 1JPHA 2CLEA 4HHMA 1E0WA 3TCEA 4LYPA 4Z1DA 1QNPA 3CS2A 1DXLA 1W5PA 3BXWA 4QAWA 1VFUA 1KGXA 1GOQA 3NRZB 3HQPA 3QFAA 1GPFA 4KQNA 3BV4A 1FHUA 1N5XA 2A6LA 1LOSA 2HDJA 4PCPA 4Q4RA 3WEZA 4ZGYA 1EC9A 4DBSA 1Q6FA 2RJGA 1WAUA 4HSOA 1TO3A 1XDJA 1VIZA 4IP7A 3KHDA 5F2MA 2BWGA 5BU6A 4HHPA 3DFSA 5KZDA 1WYIA 3NL2A 5BRPA 5EB8A 3W01A 4DF0A 2J3NA 3AHZA 4S2BA 2IPFA 5H91A 4QDMA 2WHMA 1QI3A 1ZNNA 4MZYA 4G7EA 2E6YA 1SW0A 4ICNA 3KM8A 1J0IA 3U6WA 3STPA 2PC8A 1RCXB 3MMWA 3SEPA 4PRRA 5JCLA 5CPSA 1OX5A 3AIVA 2E5AA 3DK9A 2QCLA 3EPMA 2OCZA 1F3WA 3FJ6A 1R9XA 1YQZA 4OIFA 3BAKA 1YRRA 4UOJA 4LYQA 2QGYA 3KCLA 4QLLA 3AYTA 1ZKQA 4UMAA 2FLIA 4B3ZA 3W02A 2O56A 3NGJA 4IMAA 3EPNA 4PUMA 1V6XA 5CZTA 4PUUA 1F6KA 2V6OA 4JDBA 1UWUA 4IFKB 3WQ8A 4YHEA 4NU7A 1JYNA 2FZDA 1R30A 2EPMX 4AWSA 4RZ4A 3E1F1 3L7RA 4NQ1A 1Y0EA 2ZZ7A 3W25A 1LL6A 2W55A 4PBGA 1X2GA 1E9YB 3QV8A 1EJ7L 3TQ0A 2ZZ1A 3OIXA 4J3VA 3V36A 4M19A 2Y24A 2QW5A 1GORA 4GJJA 2NT0A 4CQAA 1JZ7A 1VFOA 3M6DA 1NSJA 3CTTA 3CUXA 4HCHA 4C6CA 1QVBA 2Q3OA 3N2BA 3OG3A 1OQFA 5M2FX 2GGEA 1LVLA 1H6VA 2VOMA 5K9DA 1M6JA 3TNOA 1JZ2A 2RDXA 5G5HB 4IFOA 2XH0A 1JI2A 1LTDA 1BFNA 1RVGA 1SFJA 4L80A 2F5ZA 1GRBA 1O1HA 3WF1A 4CEXC 4JS3A 5I09A 3A3HA 1UIPA 5E0CA 4KEMA 2CDUA 1PWMA 5ABFB 2ZTJA 3H70A 3NTYA 3QM3A 1PV8A 3FDKA 3SB0A 3E5BA 1P5BA 2QUUA 1D7KA 4OVXA 4GX9A 3W70A 2JKAA 3RG6A 4WXZA 4QJ3B 2XIMA 1VH7A 4XK2A 4Z1BA 1NQKA 2FDSA 2Y7FA 2WCAA 1FOBA 4CN6A 1KGUA 5KMYA 3WUGA 3GR8A 3P84A 2J6VA 2HBXA 1Y7VA 2QVNA 3WLTA 1HXJA 3WX7A 4XTDA 3ZJ8A 4V27A 2OGJA 2G3MA 1XIBA 2NX3A 2ZRYA 3QYQA 3OODA 3AUOA 4IP5A 3PJTA 2VHLA 2QCDB 1S46A 2E9MA 2YCIX 3R7MA 4P8WA 2HEJA 3W29A 4MY9A 3TFXA 5EYWA 4RLIA 5HXMA 1RK5A 1FH8A 4KETA 1O6IA 1R85A 5CLTA 3SO7A 3LGDA 1N61C 1H49A 4X9SA 5G4HC 4HOZA 4ORMA 4S3GA 1S2CA 2ADAA 4AVNA 1QRQA 4IL0A 3N3MA 1E6XM 4UTHA 3P81A 3HQOA 2J88A 4C65A 5G2IA 4C6BA 4C5YA 4LCSA 3LGEA 3TN6A 4GC4A 3VIGA 2GUBA 2ZZBA 2NVKX 2CKSA 3UZXA 1KWGA 4I90A 3LTSA 1XIEA 2YA2A 1M7PA 4TO8A 3LX9A 3HB9A 1JCJA 2UWFA 1KD0A 2F7FA 3AMZA 2J47A 1L0PA 3PF3A 3IIOA 1I2OA 1XYMA 3TJIA 4HHHA 3DFNA 2UZ9A 1JF5A 4HYRA 3GTNA 4TVWA 2QDDA 3MHUA 3UWQA 2ZA2A 4ICCX 2BY2A 3W6YA 4J56A 4AWEA 3GNPA 4YPJA 3C86A 1IXQA 4UTTA 3UZZA 3KS5A 1EP2A 2CLKA 4DPPA 3JZUA 4LNYA 5BOEA 4N9BA 3MUY1 4O15A 2F8QA 1V3IA 3EKGA 4RNJA 1W9UA 3S2NA 3M5VA 4K68A 3KBMA 3NVTA 3BJFA 3CHVA 3HW2A 1SZEA 1KM5A 5CSRA 1JR1A 2YR1A 4MDPA 5BXTA 2ZZ4A 3MKCA 3TWAA 3R6IA 1YNPA 4CLMA 1N63C 3WNNA 3L4XA 3TYUA 1XBXA 3QC0A 3ZZ1A 3O06A 1CXLA 4HNCA 2ZUWA 4GY0A 4K3ZA 1OX6A 4KEZA 1A5AA 2Y6ZA 3SJNA 1BG9A 1TV8A 3GKFA 3H24A 3BSMA 3O6CA 1RHCA 2WVVB 2YKKA 2V68A 1PE1A 3EWUA 3WG6A 1BHGA 3GAYA 1P0DA 3QPEA 1XFCA 3LLDA 2REQB 4ZOHB 3LBOA 1C7SA 1YPFA 1UD5A 4GHRA 4M82A 4YVVA 4GZEA 3ABQA 1NPXA 1PWLA 3ZQ9A 3ES8A 1LLOA 1JDCA 5BW6A 2BC1A 2A7PA 3TXVA 4IUGA 4J4KA 1R3TA 4JTKA 1ZGDA 3PPHA 2AAQA 1GHRA 3MUAA 1FCUA 2XZ7A 3OZYA 4W88A 3AI0A 5HUPA 1ZB5A 2FZ9A 3UZYA 4W5UA 1Q1WA 3SCUA 4BA0A 3LK6A 1EFZA 5FS8A 3ZSSA 1N62C 2V3FA 4ROQA 3IPWA 1BLIA 2IKGA 4OJYA 1UPMB 2PC4A 3RJYA 1NP0A 4B15A 3GU2A 3WH7A 1TWIA 5D2VA 2FGLA 4YVXA 3ISIX 4MF4A 2X8RA 2GDQA 4AWUA 4IHCA 4DUOA 2PA6A 1W9PA 2PDPA 5TF0A 4QTGA 3AZSA 4ZZ9A 1UQYA 3M0JA 3HGRA 4IF2A 1FCBA 4JCLA 1CXEA 5BWAA 1GZJA 3Q45A 3TYZA 4GVHA 3QXBA 1G01A 2PGFA 5DRCA 3WDHA 1E55A 1PBGA 2WMHA 3W7LA 1KRMA 5CPMA 1BYCA 1U1UA 4RE3A 4O1CA 3CWOX 4G9PA 4ACZB 3G18A 4FPSA 3WJWA 3CQIA 3TSMA 3OIHA 3MBFA 2VEIA 2D3NA 3M43A 1W8SA 3GW0A 1YXDA 1AODA 3UXLA 4K7YA 3PTMA 1UD4A 2D2GA 2WMIA 4LF2A 1Q8JA 3O2LA 2C3DA 2HV5A 4X9YA 1DNCA 1XH2A 3CLWA 2CLHA 1DIDA 5JIPA 1H50A 4DXVA 2A3BA 3DK4A 4HD5A 1HO4A 4CD7A 2WJFA 1GVIA 2GGHA 4LAKA 1SJDA 2PTWA 4L1XA 4Q4MA 1DWHM 3OYZA 4L4MA 3I3BA 4X0VA 5I06A 3FK4A 5IBXC 1I0DA 2QEZA 3H2AA 1TIMA 1YIXA 3LY0A 1HGYA 2PDUA 5TAOA 1XBZA 3QOKA 3USZA 1KKOA 4ZSTA 2PRHA 3CT7A 4WY0B 4P8XA 4V1YA 3EWCA 3S6OA 1DQXA 3VIFA 4KT2A 2VI0A 3P5ZA 4BQ4A 3WEMA 4O1FA 4IISA 1XCWA 4O0KA 2V0TA 3BAJA 4RW3A 1NWSA 4X60A 4N4PA 5GNYA 1NP2A 1CLXA 1KXHA 4JX5A 5HPCA 5CGMA 3QGVA 4JQ2A 3VNKA 2WHLA 5CG0A 1IIGA 3TC7A 3NS1B 1XXXA 1QI4A 4AIOA 3TSDA 3G1XA 1VBJA 4UWMA 4ZO7A 5MKGA 3W1AA 3CU2A 3G1AA 1LL4A 4H01A 2WOWA 1R3RA 3GC2A 2YCKX 4TVCA 1UP0A 1V6WA 4IMCA 3L4VA 4BQ3A 3RM4A 2PDLA 3QMTA 4CN4A 3WFZA 1LZOA 4BK9A 4HKPA 1W8GA 3NQCA 2A7RA 4LA1A 3OG2A 1F61A 3GXNA 4XD3A 3NDOA 5I07A 1NJJA 1PZ3A 2BLEA 1OCBA 3C2VA 3SFWA 2G8ZA 3TCSA 4K2SA 1ONWA 4GQRA 3CUHA 1UH3A 3V5FA 4UMCA 2TPRA 2ATSA 1VQZA 3GIPA 1PCWA 1J11A 4JTQA 3W1RA 1R3VA 4W85A 3W82A 3TW6A 3PUDA 3MO4A 5A6TC 4I7WA 3MCNA 5C7HA 1XLJA 1GJWA 3DGBA 1UIOA 3W1MA 2GJNA 4AX7A 3GC4A 5J04A 2BXVA 3BLDA 4CQBA 1QWGA 3SCPA 3JVAA 1W1B1 1NDVA 1RD5A 1VQTA 2HXTA 4OUEA 3HQ1A 4NAFB 1H1YA 3MS8A 3QJAA 4MLRA 1IXOA 4GXPA 4Q7BA 2C6QA 2ZUSA 3GXDA 3ZOAA 2VRJA 1UOZA 1ZAHA 2R1KA 4UTJA 2VZOA 3C56A 3L4TA 1ELSA 3QHMA 4C6OA 4IICA 2R1MA 5DN1A 3N4FA 5CZ0A 2EO7A 1PX3A 2ZRUA 1VPXA 4B92A 1DKWA 3KTCA 5DMMA 2XH4A 1JXJA 4H83A 4FOKA 1UBSA 1KXTA 3DC0A 4MUPA 4HYVA 3PZQA 4EIVA 2H9AB 5CPTA 4XG1A 4L65A 3KLKA 2VCAA 3WN6A 1X38A 4WEVX 3RM9A 1ZL1A 2ACUA 5CQ1A 2PDXA 2YSWA 3FV9A 4MFDA 2WP5A 1A3XA 2ZRWA 4U4MA 5C70A 3LXCA 1T5AA 1AL7A 1R46A 3LMYA 1WBHA 3O6DA 4GH1A 4ZA0A 2J66A 4FAMA 2BODX 3KBVA 4H4XA 1MEHA 3I7RA 4DWSD 2FVLA 4Y9PA 4Q8OA 1ONRA 2Y8VA 4LUJA 3HRDC 2PLMA 1DXEA 4KEUA 4PUDA 7A3HA 1UJPA 4EM3A 3WJZA 4S3AA 3VDBA 5CSYA 1LPFA 3VKDA 1FTXA 5FF4A 5LNSA 1TA3B 4LIIA 2QUMA 4F48A 3GG0A 3WBEA 3O63A 1EOKA 5FEXA 3W1UA 3EF6A 2BTMA 3L21A 4DWSA 4RPQA 2OPJA 3T4WA 1FHDA 2QXWA 3GTIA 3PG6A 3AS1A 3FGCA 1JD7A 1TX2A 4V1XA 3W4RA 3FY1A 2DSKA 3AMGA 1ADOA 4NSBA 3SY5A 1POJA 5FJRA 1A5KC 5CG7A 1QI2A 5MF5A 3E12A 3VIKA 1VR6A 3OLEA 1WNOA 4R7OA 3C2RA 1NFPA 3MW7A 3U5UA 3EWDA 1V3JA 3BLOA 5E93A 7TAAA 3VKKA 1GTEA 3M1ZA 1UR2A 2FFIA 3ARUA 1MZRA 4O16A 1HJWA 4NEWA 2TMDA 2EJAA 3VCNA 2NQZA 2EQ8A 1QDSA 3MJMA 3LUTA 3IJ9A 1GSNA 2F9RA 4S39A 3SCOA 2PD9A 2X99A 5I6SA 1OFDA 4MHBA 1EZWA 2VDIA 3GVQA 3TUUA 4CD8A 1PXGA 3DFQA 3P62A 2POTA 5LXXA 4XUGA 5U1OA 3SCTA 1HIZA 2ABAA 2Q8XA 5I03A 4Q6XA 1L6FA 3C2EA 4C1NB 1GESA 3QH2A 1JUEA 4GC3A 1OJTA 1O60A 5E1QA 3B8WA 3N29A 1SR0A 1WDPA 3H21A 1K77A 3TTSA 2DV0A 3NQ8A 1X98A 5RUBA 2WZMA 1ZPTA 2Z24A 1VFFA 4MZ1A 1X6UA 4HGXA 3SCWA 4TV6A 4C6JA 3PJUA 3L5LA 4NEVA 5T26A 5CPNA 4JXCA 4O53A 2WV8A 2HNEA 3P74A 1FQ0A 3BMVA 4HNTA 5HOSA 4O0ZA 1AH4A 3ARQA 1UYQA 3BMWA 2BGQA 3ATYA 3LTYA 4BURA 4QGCA 4EM4A 1DBTA 4TTUA 1XFBA 4AZ7A 3U7BA 4BCEA 3ME3A 2VDHA 1CI1A 1OG6A 3S2CA 1F3TA 3R43A 1OZQA 4A3HA 4HMDA 3BARA 4DM1A 3IANA 5FOOA 3OGVA 1R0MA 1Q4NX 3JZEA 1M41A 1S5WA 4UXDA 5K7JA 5I5RA 4GA8A 3FNDA 4LU0A 3B8VA 2YZRA 3HV8A 1Z42A 4OE7A 4YWOA 1V3HA 3MTWA 1EKOA 3DYMA 3QFWA 4ZCWA 3WD0A 7CGTA 5IFPA 1RSCA 3BAYA 1HVQA 1TMLA 2WM0A 1TVPA 3WQ4A 2PCEA 4DO4A 1CPUA 2OR2A 1YNQA 4FNRA 5AHIA 2WAGA 4HMCA 3FKRA 3S5YA 1K70A 4A4AA 3EGJA 1E3ZA 3QF0A 1J12A 4AVOA 1VCFA 1NU5A 5JUVA 4IMEA 2D0HA 1MSSA 2HTMA 3ZMRA 3DAQA 4GQ0A 3ZVIA 2OWCA 4X2RA 4D1IA 2G4JA 3P8JA 4GUFA 5A8OA 4KW2A 6ALDA 3F1QA 3GR4A 4K39A 5AN7A 2ZZ3A 3AWNA 3W3OA 4ONVA 1KW1A 4I9TA 4C7GA 5K4ZA 1IZJA 3O6YX 2J25A 1MQPA 1VPYA 1PKLA 5K9XA 2XDFA 4F3HA 1EJXC 1W3LA 4PB5A 1WA3A 2MNRA 1GEUA 1NHQA 2VFFA 3B9JB 1JZ3A 3RMJA 1XIFA 1YADA 4JTLA 4PSPA 1XC6A 3T0CA 4ALDA 2J7FA 5EBUA 1TYPA 2CLMA 3G3DA 3EAOA 2R6OA 3KCOA 5A8QA 5HWJA 3GYEA 2H8ZA 4XZBA 3G5EA 1JYVA 1GVOA 2YCJA 5I24A 4O10A 3EA3A 2PGRA 2HRWA 1Z41A 3THUA 4AF0B 4IXHA 3R1ZA 3FSTA 5CSSA 1HN1A 1Z89A 3G3MA 4CU7A 1EX5A 1FKXA 5TNVA 2IPGA 1PEZA 1KTBA 1IWPA 3F5LA 5D2YA 3G1VA 5D4YA 3OO2A 1QASA 2G3FA 5FS9A 2XSAA 1PIGA 3H2CA 2C3ZA 2PWVA 1KRCC 3PPGA 3N15A 1V6YA 4XAFA 1QI0A 2VC9A 4D6EA 3MP3A 3PAOA 4PUKA 2NLYA 1EJUC 4ZQNA 1J01A 2E25A 1J9YA 2WC7A 2YA1A 1H51A 5LIKX 4D8AA 3LRMA 1W1TA 1SB3B 4G1KA 4JDYA 3R8RA 1GETA 2G0WA 4S1FA 2Q71A 2C15A 3WELA 1MYRA 4OKDA 2A0NA 1OX4B 1XLGA 3LPFA 3VNMA 1IEQA 5LXEA 1OFOA 5D09A 4PFHA 3B40A 3DGZA 4HPXA 1FHVA 2ZVRA 5ABEA 1JPKA 1T8QA 1K8ZA 3ZJKA 4HU8A 4DF1A 3MWCA 3E9AA 3CIWA 5LA0A 1ICPA 3D3AA 1XIHA 3WNLA 1Q65A 1OT2A 4O0QA 2EG7A 4BF9A 5J8LA 3T0BA 3MANA 3NA8A 3GRTA 2FDMA 2WC3A 5LIYX 3MA8A 1WYGA 1IEXA 1EJSC 2YL5A 5H8MA 5ECUA 2P8BA 4Z0SA 2IKJA 5AKQA 2EPHA 3ARRA 4HIBA 3CGCA 4H04A 3W2NA 1DTUA 2D24A 2CESA 2HMCA 4UB9A 3K2GA 1UR3M 2IQTA 2DZWA 3EBVA 3VIHA 2WK2A 3C2OA 3UF9A 1SYTA 3STFA 5BU9A 5BXRA 3H23A 3VO0A 1GVSA 1E0TA 3KRUA 1RBAA 3AS3A 4H50A 1TG7A 3L4YA 4TR9A 4DF2A 4C6IA 1HJSA 3M0IA 2OWXA 1UB3A 3FA5A 1FRBA 2FPVA 2W5FA 3UBPC 3U7VA 2C1HA 3C0QA 2PDIA 3GWQA 3WK3A 1YE4A 4H8HA 5CBBA 4P5UA 3CHEA 5AOUA 5DO8A 1WP6A 2JKEA 1RJPA 1QOPA 1K4HA 3OVGA 2V82A 4GO9A 3PS7A 4N2YA 1CIUA 1J6OA 2A2IA 2AL2B 3H4XA 1TJ2A 2YGYA 3IVSA 3V5OA 2F38A 4K8GA 1UKOA 2V2HA 1IE7C 1ISXA 3B4YA 1WO2A 1QNQA 1BWLA 5HQLA 3GHUA 3NQDA 4H6KA 4AZ6A 4CNUA 4MSSA 3EX6A 3FJNA 3W75A 1IYXA 3T44A 4U3AA 3LD5A 3W0KA 2VWSA 3TXZA 4YXGA 4MJZA 3BO9A 4OT7A 1OVDA 5GRTA 1SJBA 3NGFA 4NAEA 5DCDA 1D3CA 1EP3A 3WQVA 4LVGA 4DZAA 3IJ7A 3IIVA 1C92A 4IG2A 2QJNA 1JCXA 2PUZA 3B4UA 4KCUA 2BVTA 4J3SA 4QRNA 3G6MA 3AICA 3T0DA 1JNEA 4K1WA 2DIKA 4WGHA 3LLXA 1AMYA 4WSHA 1EIBA 3LTPA 3S47A 4K7VA 1OM0A 3THQA 3SCVA 3HGSA 1MW2A 1TRIA 5FJIA 3MP4A 3W85A 4W93A 2CIPA 1EH9A 2CC0A 2J62A 2E7FA 3L9CA 3PY2A 4CU8A 3PVFA 4WIWA 4WJ8A 5AHMA 1IR1A 2J74A 3IUHA 4W7UA 5AZ0A 1PZ0A 1F3XA 1VBUA 1P7TA 1BWVA 2WXDM 1Y65A 2BVDA 2AGTA 2C71A 3URHA 4DUWA 3PTKA 3H54A 2R82A 3G77A 1XD0A 1ZHAA 3E6EA 3RXZA 1NY1A 1DV7A 2OMAA 2PS2A 1E6SM 1O7AA 2Z2AA 4JTUA 1A50A 1CW2A 5DMYA 8XIAA 3PZMA 1S5NA 3UQNA 3R0DA 1KM4A 1ML1A 3T6CA 1LDCA 1VYRA 4GH3A 3P61A 3OLDA 2QDGA 3ABZA 1Q6OA 4RV8A 5M1TA 3MCMA 1DWFM 3ITYA 2PTYA 1LOLA 2YDSA 3KBNA 1AJ0A 4JGDA 4O1AA 1DHPA 3BZGA 2DSWA 2QNEA 4ZB2A 5HNRA 4GE8A 3S1GA 4AZBA 5FS6A 1XDLA 2YBUA 2X1RA 1I4NA 5EA9A 5H1WA 2E4TA 3CV1A 2P10A 3B0UX 3HPZA 4OUIA 2OZ0A 1R2TA 4FZIA 4JR5A 2QULA 5JCMA 1EL3A 4UQCA 3CZLA 4J3ZA 3C52A 2O7QA 2RDTA 1F9CA 2VC7A 1XYBA 5C2GA 4JNZA 3ABSA 1GJPA 1BWKA 3XINA 4CVUA 4XVDA 3F4VA 3S4TA 4PTWA 1WXZA 1RZMA 1S1RA 5FS7A 3A9IA 3COTA 2VR5A 3CO8A 4NUWA 3RCNA 3S1WA 1G5AA 4JFVA 3TAOA 1YXYA 5HJYA 1G9HA 2DZBA 1G1YA 2VEMA 3OVQA 2VX4A 3GO2A 1HL9A 3KL3A 4UFMA 3LXDA 1KKRA 1LROA 4GIYA 2O9OA 3W24A 3W73A 4IPJA 4XBKA 4H4QA 1LCOA 1ZP3A 1S2TA 4DAIA 1FFQA 1OABA 1KTCA 3TYAA 3GXMA 3DESA 4AD1A 1QPQA 2A3HA 4U2YA 1LUCA 3ANVA 4YYFA 2XISA 2Y8KA 3EKZA 5K4XA 2E5DA 4V2XA 3LCWA 3RO6A 1OYBA 4W7WA 4D6HA 1X96A 1UR1A 4JYFA 1ME8A 4PEKA 1NAL1 3UYCA 1AQMA 3FYYA 1WQ5A 2WPBA 2X1IA 1TJ0A 2B81A 3WNOA 4ASTA 4GIRA 2GUUA 2Z27A 2FTPA 1P0KA 5HJLA 4L4LA 3FJ4A 2VP8A 2B4GA 1PHWA 1OCNA 3BAIA 3LGGA 5JXQA 1RP9A 1CLVA 4D6JA 1WKEA 2DZAA 5DXXA 2WOVA 3W1TA 1YPXA 3DX5A 3L23A 1VC4A 5A6SA 4MNJA 3VVGA 1CXKA 1OF8A 4UFKA 1FH9A 5A69A 1PIFA 5SWUA 4KIEA 4PA8A 2VX7A 4KEVA 1SO5A 4KWOA 1YXCA 3EOEA 1OIFA 1VIWA 2QMKA 1J2WA 5CC3A 3ZYZA 1K9EA 3QRHA 1R6WA 2ISSA 3M46A 2YDRA 5BYWA 3FX4A 3VGHA 1DEDA 1NOWA 2DPEA 3BPWA 1GQLA 3STEA 3CH0A 3BVJA 3CAQA 4KBXA 4WHBA 5A6JA 1ZY8A 4PMXA 3SRFA 1SZFA 4C6PA 4EP8C 1ZJBA 4MNKA 1JCNA 4DZ5A 1UWTA 4DPQA 4C5ZA 2RDUA 1J18A 3WUEA 1PUDA 1TR9A 1RJQA 2WVSA 1JPIA 1FX6A 4X22A 4E2OA 4Q3MA 5D8ZA 4YYCA 1Q6EA 3W7RA 5HK4A 3H2NA 4GX8A 4REQB 2R8WA 3C4UA 1FO4A 5HUOA 4JIRA 2FZNA 1MZHA 4H9TA 5G1YA 3GHSA 1HTIA 4WY0F 4S3FA 4APNA 3T40A 3KE0A 2W3ZA 1EZ2A 3P0XA 4L6HA 4IL2A 1KCZA 1VP5A 4NRSA 1B3OA 4WOQA 3GDLA 1W1VA 2LLEA 2PDBA 2PSNA 4F0RA 3F5JA 1H7WA 4W5ZA 4ZB5A 1I2RA 1L9WA 4A3RA 4NXKA 4TQTA 3PNUA 4AXKA 1QHPA 4PUEA 2PZNA 3AWOA 4GYPA 4ZVJA 4Y8EA 1FWBC 4UCGA 4W8BA 1XLDA 1O5XA 2EQDA 3VILA 4N7QA 1ZY9A 1LLWA 2OLAA 5FAGA 1VKFA 5ABFA 3K46A 2CWXA 5HANA 4S38A 1WDDA 2ZX8A 2ZXQA 3CYJA 4KRTA 3P3BA 4UCFA 3SBFA 5BMXA 1CXFA 1XD1A 4UUIA 4GI8A 3TX9A 4HT3A 3UG4A 4E8GA 2PWGA 1GTHA 1MXDA 3W74A 2ISVA 4PMRA 2OEMA 3FKKA 4B4HA 2VC5A 1UMLA 3PFRA 3CV6A 2YCLA 1A5NC 4PMVA 3I4EA 1RY8A 4RK8A 3UWYA 3VK5A 3BANA 3IGHX 1VCGA 2W54A 2XN0A 3MJYA 2ZXBA 3APGA 3E5PA 4H9YA 1RR2A 1RQHA 3LDVA 1XC4A 4G1NA 4RDWA 4HZ8A 5AVHA 1XR2A 2TODA 3WJXA 1FEBA 2EKGA 3L2LA 3W27A 1ZMCA 1CGYA 2HS6A 2V30A 1S2VA 3VIOA 4QQUA 4R9XA 3L12A 1HO1A 4ECLA 1UZ1A 2VJXA 2OSXA 3PANA 3AIRA 1AA1B 5DANA 3WK2A 5FKYA 2WNNA 5FJOA 3MWAA 4NJHA 2Z1KA 4IMFA 3H2OA 2VQTA 5IDIA 2OG9A 2J77A 4AXNA 1WDWA 1XLCA 1STZA 3PN8A 4GUHA 4KGJA 4J2MA 2PBGA 1FWNA 2PRMA 5JRBA 4RE0A 1W56A 3EDJA 1W54A 2JK2A 1FDZA 3CT2A 2GGJA 2O9TA 3OTRA 4EPDC 1XICA 3VDAA 1GV4A 4LBSA 2PFHA 3CIVA 4ZENA 2E9BA 3IVUA 4JDRA 4F0KA 3NQ6A 2AAMA 4GG9A 3CGEA 4DJDD 2VZUA 5C9XA 1UHVA 3TLLA 1O5RA 3L5AA 4QJ4B 3VIPA 1FFUC 3PSWA 5DBTA 1ZBCA 1H7NA 3GHRA 1ZXIC 3TN5A 4GUJA 2PB1A 3QY8A 1VYSX 4US5D 1T3QC 1X8CA 4E4UA 1P6WA 3HJZA 5FI8A 1ZAIA 3F4NA 3VM7A 1R3WA 1VBRA 4DJDA 4CVWA 1JUKA 3NSNA 3PAJA 1N55A 1XGDA 3F4CA 3SSJA 4UNLA 4L9XA 3Q58A 3S6DA 1F74A 2A3LA 4US5A 3AYVA 2TYSA 1GCYA 2VC6A 4HSHA 2DP3A 3VUPA 3TKFA 3MY9A 3OVRA 1PL9A 1C9DA 4UOZA 1QW7A 3S0CA 4RZBA 2I9EA 4PFMA 5A8GA 4DUXA 3T09A 4DRSA 5DBUA 3GNDA 1UP2A 2JEPA 4QSHA 4O11A 1M04A 4MWAB 4O50A 3OBEA 1MQQA 2WVVA 2VR2A 1N8IA 1NDYA 1NDAA 3H4KA 1MNSA 3WH9A 5HQMA 2REQA 2G37A 4QDPA 3TU9A 1W31A 1NF0A 1D7YA 4JIQA 3OGRA 3VFLA 4LVDA 4GRSA 1W3HA 5GPRA 2D2JA 3SQMA 3NM3A 4KWUA 4PTXA 3W7CA 1K4QA 5C8BB 5DCBA 4Z1CA 4RCXA 5A2BA 3EEGA 3EANA 3CGTA 3R8GA 4JOMA 4WGXA 2ZIDA 3GZ3A 2X8GA 1NDZA 1Q13A 4JQ4A 5REQA 2EBNA 1DXFA 3SN4A 3CLMA 3DFTA 2PDFA 4R85A 3WNKA 1SQ7A 4RNFA 4DLFA 3LOTA 4XWUA 2GVJA 3M07A 4QHRA 1MW0A 3BOLA 1MWOA 3RO8A 1TPFA 3UNTA 3UXIA 3GSMA 2ZCGA 2WBGA 2WPFA 1J0ZA 3WJYA 1ZU8A 5FD0A 5TQLA 2CKRA 1GVYA 2DSUA 4IIBA 3MUCA 1MEIA 3STCA 5D38A 1ZLPA 1TPEA 5DLCA 1DYSA 3KOXA 3ATZA 1JFXA 5F2GA 4B5UA 3RLVA 4CNPA 2VD8A 1UR8A 5BRQA 3VE9A 3GD4A 1OFAA 3L67A 1IR2A 1EGZA 4S23A 4HU0A 3B9NA 1XLMA 1BF6A 5FA5A 2QPSA 3GDKA 3NVVB 4DB7A 2W66A 5DELA 5G2WA 1FHLA 1SVDA 3QTGA 1HG3A 1JROA 3GNOA 3R2GA 4XZLX 1B30A 3IUDA 3DGHA 4AB4A 2J7DA 3KP1A 2GR0A 4FR1A 1GYLA 3MP5A 3PP7A 4D71A 3LBMA 4E3TA 2P3ZA 2ALDA 4LT9A 1H60A 1K3UA 3S6TA 3KOFA 1E5JA 4JKMA 2TAAA 2BBFA 3AALA 1B3YA 4L9ZA 2DT3A 2GJXB 5I3KA 7REQB 3OW1A 3SIZA 4AZGA 3BE7A 4ZO9A 1TTJA 3K8LA 3WDIA 2PF8A 3ZM8A 3SR6B 1BTCA 3IIXA 4GGHA 3M5YA 4H9UA 3I7SA 1CX9A 2XUCA 4D6FA 3LHVA 6TAAA 3ZFHA 4N0RA 3SJ3A 1M9HA 2Q8LA 3DHFA 3F4DA 7PTDA 1TTPA 3CAVA 5DMNA 1M1BA 2C0AA 5FEPA 3O15A 2QIIA 4K8HA 2VR4A 3S83A 4HA3A 2PLJA 1DJYA 1R47A 1IXNA 4G7FA 3ARSA 5FJTA 2GQWA 3N11A 4LY4A 3CEPA 1K8YA 3NSXA 1GREA 3W72A 3ZT5A 1POKA 1U1HA 1PPIA 3IV3A 2QF7A 4JKLA 1DP0A 3CK5A 3R0UA 5FCZA 2J8TA 3TSBA 1EXPA 3M41A 1AZ1A 3GG7A 3GKAA 4MJ4A 1SUXA 1ME7A 5LNRA 3BLLA 4IOTA 4A29A 1H63A 1GJUA 1VENA 4S3JA 3WIJA 1PX8A 1ONEA 4WKAA 4IGSA 3DCPA 4L56A 3CQJA 4ZE5A 3V0SA 3MT1A 1MMFA 3Q2DA 3DYPA 3EA1A 4PMZA 5DXYA 1S3TC 1G0CA 1T41A 2NPXA 3RX4A 3W2KA 1ZJIA 3U4AA 4MGGA 1EF3A 3SRHA 4Q8NA 1IT0A 3AXMA 4B16A 3B06A 2BP1A 2VO5A 1HKJA 4AYGA 4IZGA 3FLUA 3MDWA 2YJQA 3WDRA 2V2DA 2ZVIA 3PB2A 5EBAA 3V18A 1QNSA 3T05A 4R33A 4D2JA 2OZ8A 5CJNA 5I2UA 1FWWA 2FTWA 4FF5A 4NG3A 3ID7A 4FX6M 4RE2A 2OQHA 1DJWA 1R86A 4KWVA 3DENA 3URQA 4GY1A 4HNUA 5M03A 4NNCA 2CHRA 3TVAA 1IZKA 1X8FA 3SURA 3LSCA 3W2MA 1K7EA 3WY1A 4BWLC 2DSZA 2ZRXA 3G1DA 4M52A 3UPBA 2P53A 3E49A 1PDYA 3WBAA 5C2CA 4GINA 1XRFA 4CNNA 2VGBA 1T0OA 2XIQA 1ONFA 3M5XA 4J7RA 3LA4A 3HMCA 3W81A 1GQJA 3ITGA 4AD3A 9RUBA 1GOOA 1F76A 4AY8A 5TIMA 3EXTA 4IJCA 2H9AA 5F7UA 1MUCA 4OBSA 3NVWB 4ZOAA 2QS8A 1X39A 1A3WA 1EDQA 2D69A 4QITA 4WCJA 4OZOA 3S42A 3TEVA 4MJMA 1XIMA 2WMJA 3T2PA 3A22A 2B7PA 4KH2A 3B0YA 2UBPC 2CBUA 3PTQA 4Z2GA 5CZJA 2Z26A 5DT5A 4H2CA 4Q33A 1VLIA 3MHFA 3LRLA 4Q4PA 3RRAA 1FWEC 1RH9A 2DZVA 5AYYA 2XIOA 3HG3A 2VFIA 1BQGA 3GY1A 1HP5A 5EKYA 4AU0A 5EPDA 3BG9A 3VIIA 2H3BA 4DJED 1R9YA 4UTWC 3UXAA 4UTUA 2JF7A 1JVNA 3AXIA 4OV4A 3PK7A 3IJLA 1ZSXA 3R12A 3D3FA 3GIYA 3N34A 1Q3NA 3E0FA 3PBGA 2BG5A 3W84A 2F61A 2A79A 5A6AA 4LB3A 2Y63A 4AD2A 3NL5A 2VFDA 3MBDA 2XVLA 4DJEA 2W63A 2OOFA 4YLWA 2HE8A 5F4SA 1HT6A 3M6YA 4H41A 1SO4A 2DZTA 3L4WA 3VUSA 4WKFA 4POCA 1EX1A 5XIAA 2ZUUA 3WKZA 1JIBA 3CXOA 2IQDA 4LSBA 3LBCA 1TUFA 2WB5A 3EX4A 2DVXA 1J2BA 1S39A 4G7EB 3T0TA 2CNCA 4LVAA 2R9RA 2CWNA 3LN3A 1YEYA 2WMFA 1A47A 2OZ3A 4K1GA 3HGJA 1BGAA 1EHAA 1Q4WA 1MDLA 2YDAA 3D5HA 3F2DA 1JZ6A 2WSQA 1XHGA 3AYSA 3D6NA 3NAVA 3LLFA 2PBOA 3NEVA 4IX2A 4C1NA 3KRBA 4H6QA 2VX6A 4LV9A 1EYEA 1UD2A 4Q32A 2JK6A 1DWIM 1TPUA 4PRWA 1CZ1A 3DG6A 3GFZA 1NWRA 4M29A 5HNUA 2XINA 1JF6A 3R10A 4DY1A 3NVDA 3MHGA 3DI0A 3POCA 5U4NA 1Q7MA 1TCDA 3FIGA 1JRBA 4I6KA 3C61A 1XYCA 3E38A 3WQDA 4XKYB 1BXCA 4FNSA 3QVQA 4JIPA 2G97A 3NPUA 3PG9A 3NQEA 2GOKA 3NPXA 2J7BA 5A2AA 3UJRA 5DMLA 2DW6A 4F0LA 4LCRA 4A35A 4JBRA 5CXPA 1OADA 1B2YA 5E70A 2VZSA 3M0XA 2PP0A 1H7PA 3UWVA 4DEFA 3INPA 3NEHA 1OGGA 4H4ZA 4JQ1A 3SW6A 5U7SA 1CXIA 3WF0A 3TROA 3W00A 1V79A 2CERA 3UYIA 1MRAA 2DFAA 3VI2A 3SAZA 1R87A 2J9YA 5LA1A 3A3WA 3TLQA 4DN1A 1KM3A 1IGSA 1MRQA 1E73M 1GRHA 3N6JA 4MB4A 1LQ0A 3ELFA 4NJJA 4YIWA 1ME9A 1QO2A 4ZTYA 3SZ8A 2A1YA 1UD6A 2RAGA 1SSGA 4GRTA 2C13A 4QCFA 3RUBL 4ZO6A 5K3VA 4XVEA 2OSWA 2FVKA 3OZPA 2GK1B 4PRTA 4XISA 9CGTA 5LIXX 5G4WA 4FO4A 2QIWA 3HV9A 6REQB 1A5OC 2Z1SA 4LUSA 3P67A 1XUUA 3UA4A 4ERGA 3ONCA 4M56A 3NSMA 2VM8A 4A8LA 3TMLA 2FB3A 2V38A 1JZ5A 3RHGA 1B3VA 1WOBA 1DJNA 3GD3A 2PWUA 3E96A 3O3RA 2ON3A 3N2TA 4QCEA 5JQ9A 4HTYA 3ARVA 4US6A 1G67A 1GVQA 3MVIA 3WZ0E 1TV7A 2QLYA 2WNQA 5I77A 3URAA 1FWGC 5KITA 3CMGA 2RABA 1FBAA 1SO6A 1KM2A 4J35A 2J9ZA 3IGSA 2A85A 3UG8A 4NF7A 4LOCA 1R3SA 3PPCA 6TIMA 3ITXA 2WWDA 3RR1A 4MADA 1YDOA 1X6LA 4QJ1A 3LCXA 4M5PA 2W9MA 4J3WA 4B4FA 2I5IA 2FZ8A 3WDQA 5FSEC 1UC5A 4AEEA 2Y62A 1SW3A 1YNYA 3UP8A 5D05A 4KCWA 1HKIA 1TMHA 4EF8A 5JBEA 1OC5A 1DJHA 3NQFA 3NQAA 4HZMA 4C1KA 3CMJA 3N1AA 3WF2A 4UR8A 3SQPA 1R7AA 1US3A 5EY5A 3RRXA 2YOCA 4GQGA 2X0HA 3QZAA 3EDKA 2GL5A 5LIUX 4O8RA 1UKTA 5DY2A 4MZ8A 4M81A 5KZMA 1L2UA 1TTQA 2NV2A 3MCOA 2GWGA 2RGMA 2E6AA 4NVTA 4A8NA 3NDZA 1F3EA 3TAKA 1V3KA 1XM3A 4WF7A 4Z2IA 4D6GA 3B03A 3WQGA 3DIPA 2I1OA 5D9MA 4HZ7A 5AYZA 2NQ5A 1REQB 2WANA 1OX4A 2VVSA 4JNYA 1D8WA 4LJ3A 3NWRA 2OX4A 4F0MA 1SFSA 2WZEA 1LRNA 4RX0A 1JAEA 2NQ9A 1KLZA 1EQCA 1WKFA 5D9PA 1UR9A 1XRSA 1SMDA 2QAPA 4XD5A 3LCGA 3UWEA 3TZNA 4ES4A 1R8LA 2C1GA 2P0IA 1M68A 4IQEA 3PZUA 3RU8X 5L6UA 1XW8A 4GOAA 1RQEA 2CITA 3QPYA 5JCKA 5E0FA 4O1DA 1I2PA 1R3QA 1VZWA 3ABOA 3PC0A 3T08A 3EWXA 1DE5A 1YBQA 1UBPC 5IM51 4WD0A 2WCGA 1PJ9A 4KFNA 3UA3A 2QV5A 2QAFA 3MZNA 3QTPA 4U31A 3IUIA 3MU7A 2DQWA 2BY0A 4NZ5A 3UR7A 3THCA 4FK9A 2XIIA 2Z6IA 1RBOB 3D0CA 3MKKA 4HU3A 3W6LA 4YTSA 2VZVA 4JZ5A 3C3NA 3P60A 3H7UA 4NZ4A 2WQPA 1VAHA 3O05A 1QOXA 1UWQA 2WHJA 3WF4A 3NR0A 4MDOA 2W61A 3KVLA 3BW4A 1FH7A 2FTYA 3HPSA 5LHFA 1F05A 3TYDA 3OZOA 1AD4A 3NZRA 4JTRA 4H7ZA 1C3FA 1Q6RA 1HJUA 3QR0A 1KGWA 2B7QA 3H4GA 4Z2HA 2H90A 3DFHA 1IGWA 1VRXA 2WHKA 1R3YA 3W88A 1K1DA 3G24A 1Q6LA 2NX1A 3QZEA 1XJBA 3V0TA 4DAFA 3IGUA 1D3HA 1YQ2A 2D0FA 4EPEC 5KEZA 4YTQA 4XO7A 1NVMA 4HK6A 4DJFC 1H09A 4GUIA 2V5BA 1E6RA 5CEWA 3DG7A 3LNMA 3G1FA 3MVTA 2QCMA 3W26A 4C6EA 3LXBA 2VGFA 1W2VA 3BW2A 2HROA 4GVFA 4WK9A 2XIJA 2ZBTA 5C0QA 1QT1A 2PURA 1LT8A 2D73A 1HP4A 1PB0A 3HTWA 3V0UA 3WMLA 3CHCA 2CBJA 4DI9A 2VVNA 4K37A 1XKYA 3TJXA 1H1ZA 3LCHA 2WVUA 5LHEA 4C6QA 3LCFA 4XO6A 4BQ2A 3NZGA 4EOUA 1C91A 5AY7A 3JR2A 3EOOA 2HZGA 3CNYA 3I68A 1FWFC 2HNHA 4UFJA 2OEKA 5I23A 3SUWA 3DZ1A 4FEZA 4BFAA 2GRTA 2VEGA 3TTOA 4MAVA 4N42A 4HNNA 2EGZA 4HZ6A 5HAOA 2J24A 2X8HA 2Y8UA 3FCPA 2WMGA 1FKWA 4Q8PA 4UTFA 5C9WA 2EAWA 1QJWA 2BSLA 3GW3A 2ZDRA 2YW4A 1BRLA 1EBDA 2OODA 1J0HA 1DORA 4FLOA 5DQPA 2WSRA 4TTGA 1H2IA 2C8NA 3AU6A 1CGUA 4I5XA 3WLRA 1AH0A 1YYAA 3KDOA 1JDAA 3DKLA 5FF0A 1QO5A 2W27A 2Y5SA 1ZBWA 3GXFA 1TZ7A 3HN3A 4QR6A 3TW9A 2ODOA 3EMCA 4U5IA 5EU9A 5LSMA 4LTSA 3AN1A 4NY2A 4R7WA 2XYLA 4DUVA 4HMNA 2V3EA 2WO5A 3UETA 4LXFA 1QK2A 4P61A 4YTRA 4ZODA 1KR1A 1IT8A 3WNPA 4UQEA 3O0HA 3KLJA 3R11A 5D03A 2Y7DA 1QK0A 1TMQA 3IJ6A 1OF6A 4MKSA 1W5NA 4Z17A 5AHEA 3AMDA 2BOEX 3B8UA 5CC6A 4O4WA 2WKJA 1J79A 1ZK7A 3SADA 3WD1A 2ZDSA 2O0TA 2XPKA 4MYXA 4WDTA 1GNXA 1VEPA 3GC5A 3K30A 4N9DA 1MW1A 3KL0A 4WOZA 1O4UA 2D1ZA 4MVAA 1J0KA 4AZCB 5MKGB 3V7PA 2YPIA 4AISA 4XIAA 2EQ7A 1F73A 2WNZA 4QEHA 2QF8A 3KVKA 4XZMX 1ISYA 4ZQMA 3L65A 3CPGA 4B5NA 4AYSA 1W1PA 6CGTA 3NYZA 2UY3A 1YDVA 4FOUA 1WZMA 2JIWA 3UG5A 1XCFA 1GRGA 3HO8A 3VCRA 1TV4A 5DRIA 4JAWA 1GYNA 3PHAA 3NL3A 1XRTA 2FVMA 4LALA 3NZQA 3GTFA 3CMFA 4CD5A 1WZAA 1L6WA 4JN7A 2PWDA 2J27A 3TA9A 2NV9A 2P88A 3ARXA 1B54A 3R58A 2X1SA 3ZWSA 4ZSUA 1OGSA 4PUNA 1XYLA 1NOFA 4IIDA 3QQWA 1UKPA 4UZUA 4BQ5A 1AUSL 2QZRA 4CUCA 3NNTA 1I6NA 2R1LA 1FWIC 2C7FA 5GNZA 4ZB0A 5EMJA 3WLOA 4YN5A 1T40A 4ZMGA 4EANA 1Q7QA 3BJTA 1UWRA 2FMNA 2A4AA 4IQLA 3KW3A 4R5EA 4MB1A 4GD0A 4GO8A 2Z0IA 3BLIA 1AVAA 2VEKA 2QJMA 4J2PA 4H6RA 2CHOA 2GOUA 2V6AA 4NHVA 1ZJAA 5I02A 1KFCA 3W7QA 2JGYA 2VNCA 4E6MA 3W23A 3RCMA 3KFTA 4QS6A 5D9NA 4GVGA 2V3BA 3P0WA 2PF0A 2XM1A 4LPCA 1FCQA 3VU2A 3ZS4A 4GI4A 2BOGX 2DJLA 4ATDA 4LS0A 1PYMA 1FFRA 3UCQA 4PL1A 1CGVA 3FW6A 2OSYA 4Z2LA 3H2EA 1DHKA 3QV6A 1OC6A 2JBMA 4QLJA 1J5SA 1FP9A 3O1NA 2FGBA 4GYJA 3CUZA 3QLLA 3A12A 4F4RA 1R5YA 1E6QM 3PBMA 1XBYA 3EAUA 3U57A 3F7JA 3KZSA 1OZMA 3MO7A 4AMAA 5CC7A 1XSKA 4UQDA 4X61A 1JAKA 2Z1VA 2ZTKA 4AUBA 1K03A 1O68A 1P43A 3LI1A 1BWCA 3GTHA 2HQAA 4MB5A 4AEOA 3FAXA 4PC8A 5AC7A 4U5KA 4LYKA 4B91A 4XBSA 1QPNA 4O52A 4DWSB 2V67A 1XGZA 3S2MA 3P93A 1LQAA 1OK6A 3T07A 3FGCB 1D8CA 3CEUA 4H8UA 5IBXA 2DJXA 1KBBA 1F3PA 3V35A 1J96A 3FVDA 3GNRA 4P2VA 1EQPA 5LNVA 2V5CA 4KS0A 1G4PA 2C14A 1GHSA 1FP8A 1JEHA 3E2QA 2C79A 3APYA 4HPNA 2VGIA 4L7ZA 3M0HA 3B9DA 2Z2BA 4N9EA 4X3ZA 4AD5A 4OQVA 1V3MA 1B0IA 4JICA 4QBXA 4ZTXA 1XDIA 3AIBA 3W2LA 2FHFA 1W3IA 5KZ6A 1GK8A 4QDWA 3VE7A 4JN8A 3CZJA 1F4HA 2BMBA 4FF7A 3AS2A 1C8QA 3UVAA 5K2ZA 1B9BA 2BV9A 4XX6A 4Y6GA 4LVBA 1FDJA 4TVYA 3C2YA 4V33A 4H4SA 1JDEA 3DOPA 2NVDA 2XFRA 3OBAA 1E4IA 3O7UA 3FDGA 2FQIA 2WZTA 2BS9A 3ZLHA 2OGYA 2XGIA 1LBFA 2ZUVA 5J5DA 3BLFA 1WCGA 3LYEA 4W4QA 3ZVHA 3M44A 1US2A 4BHYA 3FYPA 2I14A 2Y5EA 4ATWA 3Q6JA 4L6DA 5AC4A 1EDTA 3FS2A 2YW3A 2YXXA 2VT0A 4AAJA 2HJPA 1WX0A 3RU6A 4S2CA 2V9DA 3S8HA 2Z1WA 4DO7A 4EAMA 4UTMA 4WR3A 2CEQA 3EYPA 3R8HA 3RK8A 1Q6DA 3KCJA 1CYGA 1IT7A 2AOSA 2PMQA 2V63A 4ILSA 2DQXA 3E0LA 5FF7A 3U9IA 2Y61A 3TK7A 3AAMA 5BROA 2INFA 2I9UA 1W0MA 4XAGA 4NI8A 4QE4A 1KR0A 1GKRA 3U3HA 1N5WC 2YFOA 5D02A 1LG2A 4ZO8A 3R4IA 1LQ2A 4PCNA 3GHTA 3MI3A 2ZRVA 1PKYA 3WLHA 4ADTA 1AK5A 3NURA 3BSHA 5XINA 2QJIA 3G1YA 3TFCA 2DVUA 4Z2JA 4WUIA 5E9AA 3UGVA 3ITCA 1NIUA 3LU2A 3SGZA 1VLWA 5F4XA 4HTBA 4YNGA 1OD0A 2FZBA 4GNVA 3B3DA 2RUSA 3D9XA 1YKWA 1W32A 3B97A 1VPQA 3KRZA 5KETA 3N9KA 2VZTA 2ZZ5A 1QAPA 3RITA 4CD4A 1U5VA 4QFUA 3SY1A 2OKTA 3ARPA 3EXRA 2BCPA 2OLSA 2WQDA 3BQ6A 3EMZA 2ZUTA 2B7NA 5A6KA 4TOQA 2OKOA 1GW1A 5I7GA 2IS7A 3EWYA 4GZIA 3CPRA 4KF1A 4ZFMA 1V02E 3SDOA 2X0SA 3VCCA 1A5BA 4EXQA 3UEQA 5A94A 5AC6A 1D2KA 1S2WA 3I3DA 2IUZA 2I5QA 3O9NA 1Q6QA 3I6EA 1QNOA 3VC6A 4O12A 5HWMA 2CFFA 2XFWA 3HG4A 3VOFA 2HK0A 1GEHA 4AY7A 1LWHA 1V02A 1QBBA 4AQLA 1C8XA 1TTIA 2DT1A 2ICSA 4EPBC 4C6FA 2Y2WA 4E5TA 1E4LA 5C55A 3P6LA 4EKJA 9XIAA 4QQ3A 4DWDA 4YJ5A 3UZ5A 4X2PA 3I10A 4IP4A 3KX6A 2Y85A 2ABBA 1HL2A 4LVFA 1KFJA 3CUFA 1FECA 4BEUA 2ISDA 1DQWA 2Y0FA 1QUMA 1TJ1A 5CJMA 2BHUA 3CAWA 4JQ9A 4FNQA 4YWIA 1FY6A 4O54A 4NJKA 5T9BG 4CGTA 3UZWA 1PZ2A 1XYAA 3A13A 2XWDA 1KRBC 2QPUA 5KVIA 1XX1A 4N6FA 3THAA 4Q8WA 3AISA 4MB3A 7TIMA 3MSGA 5DF0A 3ARZA 2IKIA 5LA2A 3VNYA 5FJPA 4LUTA 3GDMA 4Z0JA 1JULA 4P8VA 3NVYB 1Y5XA 2IXVA 4M1BA 4I8DA 1Q85A 3H22A 5C5YA 3CQHA 1G4TA 5CGTA 5E5CA 3SUSA 1XINA 1E9IA 1WXJA 4H2HA 2HBVA 3VZXA 3WD4A 3NYDA 4FHAA 4QNWA 3C8FA 4GZ7A 2HQMA 3IC9A 1AZ2A 1JOAA 3QV9A 3T2QA 1ITQA 4PR4A 1XQKA 3RGTA 3C0LA 4EF9A 3ARYA 2CZEA 1GQNA 2DW7A 5BMWA 2OELA 1CWYA 3CUIA 2PTXA 4JQAA 2VRQA 4GKTA 2ZWYA 1E1EA 3OQEA 1JZ4A 2E6DA 3BCDA 1W3NA 1RXOB 3NQGA 1JRPA 1K7FA 1GW9A 3UU0A 4ZXOA 5CGQA 2E40A 3HURA 1I0BA 4ZL1A 3B0PA 3M7SA 1KV5A 2PDCA 4LWWA 4AFYA 1ALDA 2CLFA 4JPGA 1D9EA 3W53A 2ZRZA 1Z32X 2GQ3A 2ZE3A 1OJXA 3U2CA 1F5ZA 1XUZA 4IGHA 3NXLA 4MOZA 1ZFJA 4WZHA 3AXXA 4XAZA 1EJWC 1Q8AA 3VDCA 3T8LA 3N4EA 1L6GA 3KVJA 4ZBCA 2FZMA 1Z9AA 2VOTA 3B0VC 2QAEA 1O12A 4MNMA 1E9LA 3OEXA 1I9CB 2AQWA 3G6LA 4UFIA 3BLPX 2D3LA 1OEPA 1S5MA 4H19A 5LNWA 3EOUA 1JD9A 1N8WA 1OHLA 5LKYA 4R53A 4E4FA 4F40A 4KESA 3NZ1A 4EMJA 1GKPA 1T99A 1HKMA 5DT7A 4ZXLA 4OOUA 3GNXA 1AH3A 1KFKA 4QAIA 4GKLA 4KWWA 3OBKA 1OG0A 3E74A 4M6VA 3C2FA 1UH2A 3NXFA 3S3GA 4B3KA 1KV8A 2EPOA 1X7IA 1UCWA 4DLMA 3L5MA 2XTKA 3GD6A 3G8EA 1S1PA 4YU1A 3V16A 3TE9A 5HMFA 4RDVA 2IKHA 2E67A 2Z00A 4J1OA 4NZCA 3SN0A 4UR7A 3LZ3A 1TYTA 2GJXA 1BVZA 2FYMA 2HCVA 2QV4A 3PTDA 4PCFA 3GAKA 1X7FA 2OO0A 4Q4OA 2RDWA 3BJSA 1KBLA 2EEXA 2CBIA 1X1ZA 2GGGA 3QKZA 1A5SA 4PMUA 2X42A 3WLQA 1TPC1 3K4WA 3WFAA 1JG9A 1VCVA 2QMJA 1Y5VA 4I9MA 3VABA 1QPKA 4MWAC 1ZS2A 1QFEA 1UA3A 1XSJA 3TIMA 1CGTA 5D37A 3LI0A 1U83A 2YFNA 4FMVA 2NSOA 1V5XA 2PGWA 2VENA 1P0BA 1XYFA 1F2JA 4AHQA 2G3NA 2Z25A 4JIEA 1I8JA 4HMEA 3RF9A 2AKZA 3ARTA 4I3GA 2OJPA 3TWBA 2NXGA 3GXTA 3KBJA 2ALRA 1GQKA 3QQ0A 1OCJA 2ZA3A 4H1ZA 1P7TB 4S3EA 3RX3A 2PDMA 1XWYA 2GVGA 5A6BD 3BQ5A 3GK0A 3GVVA 1V93A 1SGJA 2WMKA 3SRDA 1SJAA 3G1RA 2J7CA 4LANA 5KZEA 2VQUA 1I1XA 2A3EA 1VFLA 3TOYA 5TBOA 4CEUC 5BOFA 2Y7GA 1V3LA 1RLCL 2WCSA 3CZEA 1AJ2A 2D23A 5A6BA 3RLHA 2NQLA 4QSFA 3M7WA 3EOLA 3BL3A 3R13A 3VA8A 1I75A 3UJFA 1YTEA 1V6TA 1C93A 2FB2A 1YDNA 1HNYA 1Y5WA 3VOJA 3GG8A 1CECA 5TD4A 3O8AA 3VMNA 1SSDA 3SCQA 3WH6A 1KBIA 3W6MA 4HBKA 3NDYA 2PLCA 3K13A 3FG2P 2INEA 1HJXA 4PZVA 1RP8A 1BF2A 3GXPA 3U2ZA 4GJ1A 4AH7A 1GEQA 3H53A 4H9MA 4B3LA 2GPTA 3AZTA 1E6NA 2Y70A 4H4IA 3UY7A 1GXFA 1EBGA 1RK6A 3TQPA 1BAGA 1QWKA 4FLRA 3A47A 4Q8QA 5JU6A 4HVXA 4GPNA 3GIQA 5AHLA 4JTGA 1W1YA 3TQKA 3HF3A 1K9TA 1TE6A 1VFHA 3PPFA 3BCJA 1H7XA 1TFVA 3WUBA 2ZX9A 4URIA 4MY1A 2VD9A 1DQUA 1AQ0A 1M7JA 4EQWA 4DM2A 1KTNA 4XB3A 3BG3A 4C6MA 1L8NA 4O1EA 3AU2A 2AL1A 4LF1A 1CB2A 1QU4A 4ORIA 1QATA 1RPXA 4JN6A 4IPPA 4KMQA 1EGVA 2J75A 4J5NA 1A5MC 1XLHA 5F2IA 4DELA 3M4HA 1SU5A 1DJXA 1QOQA 4RDYA 3SUTA 5BWFA 4NZFA 2XG9A 4Y2WA 4I7UA 3GU1A 3UNDA 3BAWA 1EXBA 2P5NA 4A8RA 5KSWA 3IAPA 4AZ5A 3H7VA 1WOAA 3G0SA 1TPWA 3EEZA 2YA0A 4JEJA 3TZFA 3OGSA 4BEQA 2J7EA 5HBFA 2MUCA 4E2VA 5C2XA 2DUZA 3HFTA 2BXYA 4QLKA 1WUEA 3VOHA 1LUCB 1RJRA 4U28A 1WBJA 4LW7A 3IJDA 2W91A 4JX6A 4CU6A 3G2GA 4H6EA 3MUXA 1YTDA 4C6NA 3MC5A 3HJEA 3LS9A 4GFIA 4U2ZA 2WYSA 1FWAC 3HOJA 4DYKA 3UR8A 3NUKA 4GXWA 1MO9A 2YXGA 2QDEA 2PDNA 5GNXA 4XIMA 3W7OA 2UY5A 1H41A 3ONBA 3BOFA 2PWHA 4AHOA 2DT0A 4FX8A 4AW7A 4HOXA 1HUVA 2WC4A 1EJVC 1H2JA 5D30A 3E0IA 5IXEA 1P4CA 2XVNA 3VOIA 1H5VA 3FFSA 1A0EA 1ISZA 2DSVA 3QLDA 3D46A 3L0GA 4GNJA 1XISA 2BFGA 1G94A 3W2JA 2C16A 1TRDA 1V7AA 3CUGA 3V5CA 3DXIA 4XUYA 5D2WA 1E70M 4IJRA 5JCNA 4G6CA 2IPJA 2VCCA 3HM7A 2HISA 1E0XA 1GERA 3S5NA 1MEWA 4W8LA 4RE4A 5HMEA 3CZ8A 4NI3A 4UTKA 1IQ8A 3IK2A 4ACYA 1XCXA 5FAJA 4OBTA 4C91A 3GU9A 1JZ8A 1J8VA 1W9XA 3DFPA 3TR2A 4GCAA 5D8WA 3BWWA 4GBDA 1HF6A 3RILA 5XIMA 4B5SA 4CCCA 1EOMA 3VAVA 1MXGA 3SRKA 1HJQA 5BXSA 4U33A 1LBLA 4AD4A 3N13A 3T78A 1TJPA 2WSKA 4RDZA 3B9EA 4LYRA 3CHDA 5FACA 3A4JA 4E3VA 2PDHA 1OGBA 3NM1A 2XSXA 3N18A 4Y7EA 3OYXA 3VD4A 2NT1A 3AMLA 2WPCA 4L5ZA 1TUXA 3MMUA 4C6DA 2X1UA 1U30A 4EVZA 2H8XA 3WCZA 1H7RA 5B7ZA 2HWGA 2WKLA 2XFYA 4XKYA 4L4OA 1DPMA 2DDXA 5IHRA 2ZICA 2F6KA 4GISA 3E0WA 1UD3A 2VXNA 3B8SA 1KFLA 3N3TA 3SI9A 6A3HA 4J3UA 4XZWA 3PZNA 4L6OA 4AWTA 1TWZA 1LWJA 3G22A 3GE7A 4MNLA 5I3GA 1M53A 4G8TA 4E8DA 1GONA 3N12A 3WNMA 1GG1A 2OOGA 4GI9A 4MAZA 1BZLA 4LAOA 3BAXA 3PULA 1XPYA 1FWSA 3CV7A 4Q8MA 4PMDA 3H8AA 4H4YA 2HPMA 4JTHA 3BTNA 3HQNA 1GQIA 2VCBA 3KAOA 2V3GA 2VFGA 3TTYA 1K6AA 1DVJA 5AECA 1RY0A 1FWRA 2FH8A 1DWGM 2I57A 1A5UA 1V51A 5BOOA 4IWWA 1VEMA 3PR2A 3JUGA 1HKVA 3Q65A 1DJGA 2WSYA 4KCTA 1Z8AA 2WP6A 2GK1A 3LPGA 4NRRA 1B3WA 3MSYA 2YCLB 5MHBA 6REQA 1BEUA 3A4XA 4TX6A 3NZPA 4YVPA 1PAMA 5M17A 4YS1A 1LG1A 3ITTA 5CSUA 3QKEA 2V69A 2CXEA 3MDUA 3WSUA 3VMPA 1FIQB 4AHPA 1TQXA 1HQTA 2Q3RA 3GDRA 1DTNA 4X0NA 1UP3A 3SCRA 2OQYA 1XANA 1J4EA 1UROA 2YVGA 4GCXA 4LB4A 1FWTA 3PZOA 3WQPA 4Z1YA 4QG6A 5BCAA 2R1PA 1EUNA 4TV5A 1E0UA 3QBUA 4M7SA 5JH2A 3W7EA 4F2BA 3TW7A 1ECQA 1JPDX 1VEOA 1C29A 2NUXA 1UD8A 4GVIA 1N8FA 2X40A 1U5JA 2GSHA 4A2SA 3IARA 3K8MA 5JBDA 2BNJA 2NZLA 2PWEA 3CAKA 2X2GA 1UUMA 3CC1A 1WKYA 1A0DA 1XSIA 3DBPA 3MYPA 2RH9A 3OLGA 3DERA 4J27A 1YW1A 3OP2A 4PB3A 3BLEA 1TREA 2A3CA 1SFLA 2BVYA 3R89A 1I1WA 3QC3A 3CL6A 3GM8A 1E9ZB 1UWSA 3S2JA 1MUWA 1EIXA 2E77A 3URBA 4Y9NA 2G95A 4BY3A 1PTDA 4CCZA 1UUQA 3BC9A 3DH7A 2DH2A 3IEBA 4IPLA 2IPWA 3AHXA 4OV9A 1GUVA 1G6CA 2YDQA 3VGGA 4FS9A 3RLUA 3UESA 3T4CA 1O1ZA 3V3WA 4FR6A 4FOJA 2AGKA 1TWWA 1BPLB 2KAUC 2IMRA 1SFTA 2QCNA 5E0KA 1R9ZA 3MB9A 1REQA 4LAMA 3JS3A 4WSJA 1BYAA 4RNHA 1FWDC 1FVPA 3AO0A 3RNMA 1GPWA 2FPTA 3BDKA 5M3WA 1ADDA 1EPVA 4WJXA 4Q8VA 5H2ZA 4F2TA 3UJSA 3UY8A 1Z48A 3SQLA 2NV1A 2CFYA 1TWSA 3DK8A 4NNBA 1TSIA 3PZTA 1UW9A 2J7GA 3UT0A 4NILA 3AMKA 4O17A 3SECA 2QR6A 1ODZA 1UWIA 1TPB1 2NVAA 2ZADA 1GOMA 4H4PA 3DFOA 3ICJA 3WUFA 3VD7A 1A0CA 3EX3A 5AC5A 2NUWA 3DEQA 4XQ6A 3M0MA 3ITLA 2X0YA 3H7RA 4TMCA 3QGKC 3QY6A 3REQA 2FHBA 4RW5A 1NWUA 3A24A 5FEZA 1W2PA 4R7JA 1OBAA 3OPSA 1RUSA 4A6GA 2GZXA 2XZ9A 1N7KA 4FLQA 2QHAA 2YLAA 2FIQA 4CQDA 3DJGX 4FNPA 4HK7A 3GQYA 3LXAA 4S3BA 4BR1A 3SCSA 2NQJA 1TJRA 3EKLA 5A1AA 4Z1AA 1GRTA 3E2RA 4GXMA 2A6NA 4JTEA 1M3UA 4H9ZA 3BUVA 2JE8A 4R88A 3VMOA 1ZDLA 5REQB 5FMHA 3EWWA 1KXVA 3B9OA 4PULA 2CETA 2D22A 3VINA 5IHSA 5E6YA 3CYVA 5D32A 3VPLA 5C54A 3N9RA 1F8IA 3ZIZA 1DE6A 4FDCB 3NQ2A 1Q5MA 3DBNA 3RPMA 2X09A 4H3DA 2R14A 1ADSA 2VURA 2E3ZA 4CQ8A 3SCNA 1N60C 3GRSA 1W1ZA 2VX5A 3M5ZA 3UPWA 2I5GA 3HPAA 4B5VA 3E2SA 2BXZA 2E5CA 3HMJG 4GZJA 2Z29A 3NG3A 3PG8A 2PDKA 1BSIA 2W92A 1RBLA 4B90A 2W0UA 1V03A 1MXSA 3HZ3A 4LNCA 5JMUA 1E5NA 2XVGA 3A23A 3ITOA 4E0CA 4GGBA 8CGTA 3SN1A 2QJHA 4MJ2A 2GH5A 4Q4QA 2SFPA 3QYSA 2E6FA 4DBDA 1K8CA 3GBDA 1RCOB 2EQ6A 2X1TA 2OLHA 1F8WA 1FFVC 4UTTC 4W7VA 4PODA 1OYCA 1IZCA 1GOXA 2Y4SA 4JIHA 1V0KA 3WK1A 3LG3A 4IFKA 3IS4A 2ZA1A 1G4SA 2HK1A 4DX3A 3EWBX 4M6QA 5EL1A 4Y9AA 2I7GA 5HQEA 4UR9A 2EF9A 3BG5A 2BOFX 3VNDA 5ABTA 4XD6A 1FXPA 4H4TA 2Q01A 4HJWA 4RXFA 3L4UA 4FSAA 1V4YA 2ZZ0A 1AQFA 1LWIA 3LB8A 5G2HA 3VNIA 3DKJA 3TP4A 2BVWA 3JU2A 4Y8FA 2NSXA 2BZNA 3VOGA 4FA3A 4Y90A 2B0MA 1P1MA 2AMXA 1GOIA 3IJ8A 4F79A 1TKKA 2RKXA 4UFHA 1F6YA 4O19A