4HCHA

Crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium and l-tartrate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
384
structure length
384
Chain Sequence
SHMIITDVEVRVFRTTTRRHSDSAGHAHPGPAHQVEQAMLTVRTEDGQEGHSFTAPEIVRPHVIEKFVKKVLIGEDHRDRERLWQDLAHWQRGSAAQLTDRTLAVVDCALWDLAGRSLGQPVYKLIGGYRDKVLAYGSIMCGDELEGGLATPEDYGRFAETLVKRGYKGIKLHTWMPPVSWAPDVKMDLKACAAVREAVGPDIRLMIDAFHWYSRTDALALGRGLEKLGFDWIEEPMDEQSLSSYKWLSDNLDIPVVGPESAAGKHWHRAEWIKAGACDILRTGVNDVGGITPALKTMHLAEAFGMECEVHGNTAMNLHVVAATKNCRWYERGLLHPFLEYDDGHDYLKSLSDPMDRDGFVHVPDRPGLGEDIDFTFIDNNRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Isomerase/lactonizing enzyme
publication title CRYSTAL STRUCTURE OF D-GLUCARATE DEHYDRATASE FROM AGROBACTERIUM TUMEFACIENS complexed with magnesium and L-tartrate
rcsb
source organism Agrobacterium tumefaciens
total genus 140
structure length 384
sequence length 384
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hchA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hchA01
2GGHA 4ZA0A 4GYPA 3NO1A 2O56A 4HYRA 1EC7A 4ENLA 4Z17A 3ES7A 3PWGA 2GGIA 2XSXA 3BSMA 2PGEA 2RDXA 3VA8A 3I6EA 5FJRA 4JN8A 4ROPA 2XH7A 4IZGA 4MGGA 2GSHA 3UGVA 3GC2A 2GL5A 2OO6A 3QPEA 3MY9A 1JPMA 3CB3A 2ONEA 1P48A 1SJAA 3DIPA 3STPA 3UJFA 3H12A 2DW6A 2AL2A 4A3RA 1KKRA 1MDRA 5IDZA 3FV9A 3UCDA 2AKZA 1RVKA 3CXOA 2HXTA 3GY1A 2OLAA 1SJDA 3H70A 7ENLA 3V5CA 2PGWA 1ONEA 4HPNA 4J1OA 4H1ZA 3ZVIA 4JN7A 4GYPC 3TWBA 3R10A 2QJJA 3VDGA 1DTNA 1XS2A 3RCYA 3DERA 3TJ4A 1JDFA 3VC6A 3RITA 2MUCA 2CHRA 4MMWA 3TOYA 4HNCA 2XH4A 3SN1A 1TKKA 3R25A 2QVHA 4Z1YA 1FHUA 3SJNA 3QTPA 5FJTA 3OZMA 4E8GA 4DYEA 4GISA 3N4FA 3UJSA 4G7FA 3T8QA 2NQLA 3FXGA 2OQHA 4KPLA 1SJCA 4HCHA 3QN3A 2OKTA 3ZVHA 3ZLGA 3SN4A 1TZZA 4DXKA 1P43A 3R11A 2GGEA 5FJPA 4H83A 2OZ8A 3TQPA 4F4RA 3DFHA 3T4WA 3FVDA 3MWCA 3DG7A 3ZLHA 2PA6A 2XH2A 3MZNA 2QJMA 3IJIA 3JW7A 1R0MA 3THUA 4HCLA 3SQSA 4E4FA 2QGYA 3UJEA 2DW7A 3FJ4A 4G8TA 3H8AA 1BKHA 1ECQA 2OQYA 1JPDX 3JZUA 3B97A 4DWDA 3P3BA 1MRAA 2FYMA 3VC5A 3DFYA 3ES8A 1KKOA 4KEMA 2PP1A 2ZC8A 3PK7A 3BJSA 4M0XA 4MKSA 1XPYA 3V5FA 4A6GA 4DHGA 2GDQA 4GGHA 4YWSA 4JHMA 2AKMA 3FYYA 3TWAA 3U9IA 3JVAA 1ELSA 3V3WA 3T9PA 4HNLA 4E6MA 1MUCA 3UXKA 2QDEA 2PODA 3KUMA 3PWIA 3VCCA 4EWJA 4DX3A 1EBHA 1YEYA 4J3ZA 3TW9A 2PU1A 3IK4A 3RRAA 3R0KA 2AL1A 2OZTA 2PP3A 3N4EA 2PTXA 3QKEA 4IP4A 3HPFA 1WUEA 3N6HA 3GO2A 2P88A 3MKCA 1IYXA 1BQGA 1TE6A 1EC9A 2PPGA 2MNRA 2HXUA 4IL2A 2XGZA 4H2HA 3MQTA 3UJRA 3DG3A 4GIRA 3SN0A 4HN8A 2OX4A 2PTZA 5ENLA 4K1WA 4ZCWA 2P3ZA 5BOEA 5FJUA 2OZ3A 4K2SA 2OG9A 4IP5A 2PU0A 2QDDA 2HZGA 2PS2A 4E5TA 3CT2A 3QLDA 3N6JA 2HNEA 3DG6A 2PTYA 3RGTA 4KT2A 3CAWA 3UCCA 3EKGA 1JCTA 2P0IA 3DESA 3SBFA 3UXLA 1PDYA 3D47A 1MNSA 3S47A 3ZVHB 2OFJA 3EEZA 2OPJA 2POZA 3OW1A 2P8CA 3OPSA 3RR1A 2FKPA 1WUFA 1NELA 3TJIA 3P0WA 4GGBA 3NFUA 2PTWA 3VFCA 3I4KA 3MSYA 3RO6A 3CYJA 3OTRA 1L8PA 3OZYA 3GD6A 3DDMA 3TTEA 2QQ6A 4A35A 4E4UA 4IL0A 3PFRA 3IJLA 3UJ2A 3SSZA 1E9IA 3NXLA 3R1ZA 3S5SA 3V4BA 6ENLA 4IT1A 4HCDA 5J04A 3FCPA 3OP2A 3Q45A 5BOFA 1W6TA 3H7VA 3T6CA 1KD0A 3D46A 2GGJA 3DGBA 1KCZA 1PDZA 4DN1A 1MDLA 4IHCA 1SJBA 5FJOA 1F9CA 4KWSA 1EC8A 3P93A 3I6TA 2AL2B 3VCNA 4M6UA 5EU9A 1R6WA 2XH0A 2PMQA 2PP0A 1FHVA 2ZADA 4X2PA 3TCSA 3CK5A 1NU5A 2I5QA 2QJNA 4FP1A 3NZGA 3MUCA 4K8GA 3U4FA 2PCEA 1EBGA 3ENLA 3R0UA 4H19A 3DEQA 3BOXA 4GFIA 2PSNA 3K1GA 2P8BA 3Q4DA 2GGGA 3IJQA 4GMEA 3ZLFA 1OEPA 2OVLA 4FI4A
chains in the Genus database with same CATH superfamily
3KBNA 3VD9A 4JFUA 2ZBTA 4KEVA 3V1PA 4DZ5A 3NQFA 3UPWA 4B9ZA 3N19B 1M68A 1RA0A 2YDAA 3C56A 3PB0A 5A8QA 5G2IA 1CLKA 1AQHA 5GNXA 5HK4A 3LCWA 1MXDA 3BSMA 5HNTA 2AQOA 4M1BA 2PZNA 1ITCA 2GQAA 6REQA 4QROA 4QQUA 2GQ3A 3EAOA 2PB1A 3KCLA 3LN3A 4RE0A 1OG0A 3UGVA 2YAUA 3L67A 2XSBA 3O3RA 1RP9A 4Q8OA 3G1FA 2VQTA 2D69A 3W7IA 1VYSX 1A3XA 1UZDA 3WO8A 3OLDA 4YTQA 3WFZA 3BLLA 3VU2A 4H2CA 5DCDA 2QUMA 4FOUA 4QG6A 2J6VA 2VDHA 4OQVA 4ZE4A 1TO3A 7ENLA 3W76A 4BF7A 3TXZA 3COTA 4HPNA 3STEA 1VQZA 1C8YA 1OFEA 1XKJA 2O9PA 4IPLA 4NYUA 4FXFA 2YYTA 3AHXA 4EVZA 1D8CA 4M6PA 3BG3A 3GS6A 4J5NA 3QXBA 3W7CA 3G8EA 3WEZA 4XV0A 5FI8A 4EIVA 2WZMA 3L8KA 2FPYA 2W3SA 2FZMA 4GNVA 1OZQA 4L1XA 1FECA 4EAMA 3AHVA 4RNFA 1J0IA 5IRPA 3NO3A 1UR8A 2QVHA 1QO2A 5A2CA 5AC5A 4M51A 4Z2LA 2QUTA 4D1IA 1E6XM 1MQPA 4JOMA 3WH5A 3QHOA 3IJ7A 5G1YA 3T8QA 4DIAA 3AIQA 1MEWA 1PZ0A 1VFOA 1V77A 3W2UA 5IFPA 3KLLA 1WOBA 1IEWA 2VEFA 4P8UA 4MY1A 4N42A 4X61A 2DUXA 2VGFA 3PTQA 2PRLA 2ALDA 4WXZA 1TX2A 3HQOA 3A6OA 1OF8A 3TQPA 4DZAA 1T40A 3L4WA 3VIHA 1UBPC 1MUWA 1OX6A 2VCAA 3C2EA 2ZDSA 3EDFA 1XFBA 1FKWA 2NWSA 4H41A 3VTRA 1R2RA 3B8DA 1ITXA 3AIWA 4IWWA 1R0MA 2FPVA 4Q32A 3DK4A 3H8AA 2E5CA 3W7PA 3KVKA 3SRFA 1LWHA 3KW3A 1KBLA 1E6ZA 4OTKA 4TTGA 1ICSA 2E0PA 1TJ2A 3A4AA 1S38A 1A80A 1LM1A 3HJEA 3EX1A 5CXPA 4YCOA 2I16A 1WX0A 2VFEA 5J5RA 2BODX 3IS4A 4NJKA 3ABSA 4DHGA 1UKSA 3SURA 3W7DA 2UBPC 4HQVA 2ZCGA 4UFMA 4B3ZA 3U9IA 4BR1A 4LOCA 1Z3NA 3MVIA 3QJAA 2W9MA 1OX5A 1ELSA 5EMLA 3V3WA 4LB4A 2QDHA 2ZUNA 2ZZ5A 4W88A 3QSRA 9XIAA 4HU0A 4DNAA 2WKJA 2ASHA 2PDNA 4EWJA 1W37A 2OWWA 2VURA 3LXDA 4FF5A 3WQGA 2EBNA 4O0QA 4WK9A 1DE5A 2DU2A 4G7EB 1F5ZA 3GIPA 3DC0A 4UZSA 3W25A 4KIRA 4YPJA 1P0DA 3BANA 1RZMA 4GE8A 1FCUA 3MJYA 2Z1WA 2VEMA 1X39A 1JFXA 4PTXA 3W7OA 4AY1A 2XG9A 4AF0B 4D9PA 1FXPA 2GQ8A 3KS6A 1PPIA 3UZWA 3T0TA 1JI1A 2YA1A 1G1YA 1KBKA 2WJEA 1J0ZA 1GK8A 3I4EA 5CSSA 3CZJA 4QJ4B 2DIJA 1MOKA 4GYFA 3A5FA 4J3TA 1FRBA 2RH9A 2O4MA 2P3ZA 4XSMA 3T55A 3MS8A 2FVLA 3WF3A 1XYAA 3D3AA 4GUGA 4XSLA 1RHCA 3A24A 4DEFA 4YHEA 1BG4A 1IXOA 4FEZA 1OFAA 4IX2A 4CVUA 5BMWA 2WMFA 2HWGA 2FGBA 2XVNA 4ZOEA 4PBFA 3BE7A 1XWYA 2PE4A 1Z8AA 4KT2A 4YHGA 4ZB0A 2VEPA 5JVLA 3QPYA 2VENA 1TQXA 1E73M 3VMOA 2JF6A 1PZ3A 1Q6EA 1TV2A 1SZNA 5EMKA 2X16A 2CXEA 3GH4A 4M82A 3QV8A 5G4HC 3F5KA 3LA4A 4JYEA 5AHLA 1JF6A 1XI3A 3AJ7A 2DZSA 1V3IA 4L56A 2QMJA 3P60A 4ATDA 3S9IA 3UR8A 4FF7A 4M5PA 4V15A 1POKA 2CBVA 1GZJA 3CWOX 3B40A 5D9MA 4CD6A 1NJJA 1GVFA 1UQYA 1HVQA 2FGZA 4BI5A 5BCAA 3WZ0E 4BEQA 4Q7BA 4ORIA 3FAXA 1RPXA 1EX1A 1PTGA 4AZ6A 4C1NA 3ARTA 1B5TA 5J04A 4LV4A 1YE6A 1YTKA 2DT3A 4Q22A 3MYPA 1XD1A 1TPWA 4DXVA 1KCZA 2VEGA 4ZOCA 4C6JA 3EWZA 5EFDA 3LGGA 1MDLA 1XRFA 4WIWA 2NQZA 1KRBC 4IHCA 3THDA 4K7ZA 5FEPA 4ERAA 3LCGA 1JYXA 2R1MA 3KOWA 3P93A 1KBIA 2E1WA 1FIQB 2DFAA 1Q45A 2REQA 2WANA 3VDCA 5D37A 5FF0A 2AGKA 3B0PA 3R7MA 1FWJC 4GVIA 2IPWA 3TROA 3INPA 1PYFA 4LJ3A 2J79A 4WSKA 4I7VA 4CN6A 2ISDA 1PKLA 4OBTA 5K3VA 5CPOA 4NU7A 4JQ3A 5LGZA 1PAMA 5BNKA 3DK9A 1QNPA 1JQVA 1K9DA 5FKYA 1ZJBA 4FK9A 4JTTA 4JHOA 3DHFA 3ZQ9A 3ONCA 3OJGA 1S3HA 4QCFA 4REQA 1SR9A 3D5HA 2TAAA 2QJGA 5I2UA 3CAKA 1R9ZA 1TWWA 2WKLA 3LHZA 2C16A 4HJWA 2Z24A 3S6DA 3ES7A 4LW7A 3AYVA 2JALA 3W7GA 4ZXOA 1WZKA 1XINA 3NVDA 1V59A 5DT7A 4BURA 4ML4A 1XPGA 1YXDA 1QMLA 4ADWA 4MGGA 2IXVA 3V36A 5KSWA 3QPEA 2L5HA 2OO6A 3STCA 4TVWA 1P48A 1SJAA 1R3YA 1E6NA 1TR1A 4HU4A 5I3GA 4NJIA 3EWBX 1KTBA 8CGTA 4QR6A 2NVAA 3UCDA 1BVNP 5EA9A 1K6AA 1H1ZA 3QHNA 3CUXA 3DH9A 4AVOA 2VR2A 3RAOA 3R10A 4Q4SA 3ZJ8A 4BI6A 1W1B1 4QDMA 1F74A 1W54A 4LPCA 3KS5A 2JKPA 2ZA2A 4IG2B 1UR3M 5HUOA 2CHRA 3W86A 2RAGA 4R9XA 1BVZA 5C6MA 4ALDA 3KVLA 4XAYA 5KVIA 1V97A 1XCWA 4DYEA 5JH2A 1R3QA 3GDBA 4QLLA 2NQLA 4CQ9A 1OD8A 5HANA 3DFQA 1E6PA 2YCLB 1IIHA 3ARPA 3ZVHA 2WOQA 4O4VA 4QLJA 5JH1A 4WDTA 3U8GA 3CZ8A 3CQ0A 4F2BA 2PC8A 1NFPA 4N9BA 3TNBA 1SUXA 3W81A 4AVFA 4ERGA 3SGUA 4XBJA 2ZVRA 4NZCA 3E0IA 4CQ8A 4US5D 1MW3A 4LV9A 4YLWA 2NW0A 4H8VA 1ZMDA 1VFMA 4K7YA 3WYZA 2E40A 1UD8A 3K1DA 1UD3A 3B0UX 4CNOA 2VGBA 1I1WA 4HHMA 3FW6A 1LL7A 3PPCA 3S42A 2PP1A 2ZC8A 3I3EA 3PK7A 3BUVA 4MKSA 1MVYA 2Q8LA 4D6EA 4H4XA 4GIEA 3T44A 4Z1BA 1XIBA 2WOWA 3TEVA 1AJ2A 4K1GA 4DB7A 2WHJA 4JHMA 3EBVA 4GZEA 3R2GA 2IPGA 3FJLA 2QCEA 1GYNA 1VENA 4BWLA 2NXIA 3NQ2A 4M6QA 2DSZA 5AN7A 4NUWA 3WMLA 1QCWA 2A1YA 3AHZA 1N82A 3B03A 3RJXA 1V02E 1P0KA 1Q7MA 4MNMA 4D6CA 3O9NA 4P5UA 1JYNA 1AZ2A 3KXQA 4Z1CA 2YKKA 2BXZA 1YNPA 2PU1A 1UD6A 1EJVC 3M5VA 4GR1A 3GU1A 3WEOA 4XZ9A 1BAGA 3W1LA 1QRQA 1GOMA 1TRIA 3LPOA 1O6IA 4G1NA 4H4SA 1OYCA 3W26A 3P67A 5LKYA 1JEZA 5BRBA 4LS0A 4IPNB 1LQ2A 1U1HA 1EZWA 3YPIA 3L23A 3WQCA 1FVPA 3ITGA 3GTXA 3PBGA 3T0DA 3LM3A 1MZHA 1RCXB 2FHFA 1EJTC 4Q4RA 5E9AA 5LA1A 2JFEX 2GDUA 2IKHA 1K7FA 1HP4A 3DFNA 1GZGA 1VBHA 2A7RA 2HMCA 4XX6A 2PU0A 2QVNA 3LRLA 7CGTA 4PH6A 3TYUA 4KWWA 1M03A 3GHSA 5I3IA 3TJXA 3JUGA 4J2PA 2WOVA 1TFVA 1NARA 3GLCA 4APNA 3PVFA 4DLMA 3D47A 1J8VA 3T2OA 2X1TA 5FAJA 1T99A 3C5QA 2PDUA 1F76A 1F6YA 3EOEA 4HIBA 2NLYA 3O06A 4TX8A 3XINA 2GVLA 1B3VA 4ZSUA 3NFUA 1E4NA 4DJEC 2PTWA 4AD4A 1X1ZA 1JZ6A 3MSYA 1CLVA 4MIMA 5DBUA 4JY9A 2VZTA 3L66A 1NM9A 4CCZA 1FEBA 1LRNA 1L6YA 2CPUA 1FWNA 3A5VA 3UZJA 3E5PA 4TOQA 1HNYA 5D2VA 3W7NA 1W5OA 5DEZA 2H9AB 4A3QA 1N60C 2X40A 1MUMA 3AU6A 3MB9A 4JS3A 1FWFC 1KR1A 1AH3A 4LRTA 2CHNA 2GGJA 4XB3A 4O1EA 4GH3A 1LOSA 5G2WA 3V5OA 4MZYA 5D8WA 3UQNA 3WMCA 4ERIA 1TV4A 3H23A 1ZENA 1OVDA 3UWQA 4G9PA 4MUPA 4AD2A 4XZLX 3NM1A 1AH0A 2VOMA 4C90A 2FZNA 1ITUA 3ARRA 1VC4A 3TAOA 2PMQA 4UTHA 5I07A 2ZWYA 2V6OA 3M6YA 2DH2A 2J8GA 3L5AA 4QG9A 2YCKX 3HBLA 3BLEA 3C86A 4LQ1A 3WLTA 1G7VA 2QCLA 1GRTA 3U7VA 4AY8A 4URIA 4HKPA 3MSDA 2G97A 3AOFA 1WXJA 5LA2A 3TW6A 4PFHA 4O18A 2QCMA 1T96A 2Y7FA 1OC7A 3PPHA 2CDUA 2Q71A 3LQLA 2QUUA 1M7OA 1E0XA 3K1GA 2P8BA 1AMKA 3IJQA 5CG7A 2ISVA 3GDLA 4UWMA 3NIYA 4RPPA 4AHPA 1AUSL 5A1AA 2EPKX 2BOEX 3W70A 4W8BA 3E0WA 4EANA 1YRRA 3Q6JA 2I5IA 1EGZA 1K4QA 2GGIA 5AYXA 4C91A 2X50A 5A2BA 3M5XA 1B4KA 3G3DA 1YADA 1B31A 2X8HA 1XLDA 1X2GA 3A9BA 2A3HA 4GOAA 5JCMA 1JGIA 1DNCA 4KESA 3EWUA 3LB8A 1F3WA 1QPOA 5I79A 3O63A 3VGEA 3DIPA 4E2VA 1TPEA 7PTDA 4AF0A 4U33A 3DI1A 2XN1A 3A3HA 1RY8A 4HTBA 4S23A 2VM8A 5I03A 3CGBA 3H70A 1LYXA 4UMAA 4ZGYA 3IUHA 4H1ZA 5IDIA 1FCQA 2A4AA 3MKKA 2BWGA 2GJPA 2P76A 5AHNA 4PMYA 2ODOA 4IOTA 1QI3A 2VCCA 3H4XA 1ZB5A 3RX3A 4DM1A 1NVMA 1X6LA 1YDOA 4CNSA 2FFCA 3DFTA 1GEHA 2IMRA 5G1TA 4HNCA 3MHUA 1TRDA 5JBFA 3DGZA 3IVTA 1RQHA 3BK0A 3W1XA 1UR0A 5M03A 1QDSA 2WSRA 5BXSA 2DT1A 3OZMA 4Y2WA 3CEUA 3PUEA 3FXGA 3UETA 3AWOA 4KPLA 2ZOXA 4CD5A 3CL6A 3T8LA 2X0YA 3KBJA 3N1AA 1LLZA 1B9ZA 1V02A 4PTNA 1GVSA 4HA0A 5I09A 3RK8A 5A6BA 1REQA 5GPRA 2QYGA 4O13A 1JCLA 1OFPA 1XIDA 1EYEA 3SAZA 3AICA 2HVOA 4M7SA 3KLJA 3HG5A 1AW5A 5LGXA 1XANA 1IXNA 4RCXA 4C6LA 3KRUA 4F2TA 1Q4NX 1ZHAA 3B0XA 3UZ5A 1VBRA 3K30A 4RW5A 3WD1A 2GUBA 4MNJA 5TIMA 5KZEA 2J4GA 3RLVA 1FWEC 1WAUA 2OQYA 2POTA 3WQFA 3C6CA 3IC9A 2DSVA 2GR0A 2RDUA 2G8ZA 1GOIA 2VT0A 5IXEA 4X22A 1TPH1 1DJQA 2FYMA 7REQB 3VC5A 4UNKA 1XRTA 3NPWA 4LB3A 3EXRA 3CV6A 2C0AA 4XUGA 4UTMA 4C7FA 2WPFA 2Z6IA 1H1NA 2ZXDA 3R94A 4UTLA 5AZ0A 1C8XA 5CSRA 3SEPA 2BVWA 2EQDA 3UESA 3W23A 2OGYA 2NXHA 1VHCA 2PI6A 2NUYA 3AC0A 3UVIA 4QE5A 1N63C 3NRZB 1D3GA 5AYIA 2XJ7A 3VOIA 1YLVA 3W72A 2X7WA 3RYSA 1OT1A 4Q8WA 1R3RA 3W2LA 4KEUA 4BCEA 2QIIA 3SCSA 3GNNA 4IFKB 3N2MA 4UNLA 3FN9A 4LVBA 4LUIA 2E9BA 2VX7A 4BF9A 2ZX9A 1DIEA 3WLRA 3K8KA 2GDVA 5ABHA 3RRAA 4K6AA 1QNVA 1R7AA 7ODCA 3W87A 1EPVA 1O1ZA 1W1TA 2O55A 5PTDA 2WBAA 5BMXA 2YLLA 3WLSA 4E3TA 4XKYA 4DJFC 1WDWA 3IIPA 1EP3A 3I7RA 3NTYA 3GO2A 3PTMA 1VRXA 1WDQA 1DQXA 1EC9A 1H7NA 4OWGA 2XPKA 4PEEA 1HKVA 1T6MA 2HV5A 2MNRA 3GXNA 3IRSA 4PUMA 4J3SA 1R5YA 3REQA 4GIRA 3WDRA 3TMLA 3B8IA 3KBVA 3VOCA 4LALA 3B8TA 1XBVA 1O94A 4QLKA 3A9IA 5BOEA 1H61A 3BLIA 4UTTC 1IWAA 3SCOA 4I6VA 1ECEA 5BXPA 1HTIA 3EDDA 5SWUA 3NQAA 3BJTA 1UCWA 1DWHM 4ZOHB 4CU6A 4HZ7A 3RUBL 4C6BA 2XVPA 4H6EA 2PBGA 1R9YA 3NOEA 4UFKA 1GW9A 1I6NA 1UH2A 3C0LA 1VYRA 4NZ1A 2V6AA 4MG4A 3S47A 1KLZA 4RDWA 3VZYA 3L7RA 3EEZA 4NJGA 2BVTA 4MUZA 5CEWA 3LHUA 1LL6A 2YB1A 1ME8A 3L2MA 4LTSA 3SUWA 3LI0A 3NL5A 1LP6A 4UOZA 3BQ6A 4CCEA 1V6WA 4M3PA 2PFHA 3LSCA 1S7MA 2V3GA 2R1LA 3K4DA 1KGWA 2WPEA 1H7RA 3II1A 2VFHA 3LV6A 1XYMA 4IQJA 1PUDA 4DBUA 2YCLA 2V5JA 3GD6A 3F2CA 4Y9MA 3SQPA 1KRCC 4Y9AA 3EXTA 2VFGA 1J96A 3IVSA 1YX1A 3RCNA 3LUTA 3QVQA 1EYWA 1XR2A 2Y24A 3BGAA 3BG9A 1DEDA 3WLOA 3WD0A 1QJWA 4QG8A 3IARA 3OP2A 5H8PA 2OXNA 1JDCA 3GIYA 4FPSA 3JS3A 3RNMA 4D8LA 4Z1DA 4OE7A 1A3WA 3O6CA 1CGVA 2VELA 4V28A 1SJBA 2EEXA 3RR4A 1WNOA 1PL9A 4Q8VA 1TV7A 3CMFA 1FWDC 2Y5EA 4YU1A 3UGRA 1HL2A 1VH7A 3S9ZA 3E1F1 3VUSA 3MMTA 3ZR6A 2EG8A 1K1DA 3E2RA 3GNPA 2FDSA 3DFOA 4GI4A 3KTXA 3WK0A 1EP1A 2QJNA 1W5QA 3NL6A 4FNSA 3MUCA 4XISA 2DZWA 4H6KA 4F0KA 1DVJA 4MPQA 3SSJA 3RO8A 3W7JA 3QOMA 2ISFA 4DPQA 2YFOA 1GWJA 1J0JA 4PC8A 4MZ8A 3QW4B 2GGGA 3IIZA 4KEZA 2O9RA 4GJIA 4GH1A 3WLPA 5A8PA 1YQZA 4KBXA 4ZQRA 1DKWA 2JEQA 5EY5A 2RHGA 1E9YB 3GYEA 4DAIA 1PVNA 3HGRA 1OQFA 1ZSXA 4H01A 1KFWA 1KXTA 4OOUA 3I3BA 3TN6A 4GUJA 4DM2A 4HSNA 4MDOA 2BHZA 1VFHA 4EX4A 3VOGA 2VR4A 2V3DA 3HM7A 4FX7A 4UQEA 2TPSA 2ONEA 4L4OA 3UFYA 1L6SA 4NX5A 2Z25A 3NEVA 1TPFA 3R6IA 4I5RA 3QV9A 1F6KA 1KKRA 3OBAA 3ITCA 4LAOA 1RVKA 4GI9A 4JKKA 1TSIA 2W54A 3WBYA 1KFKA 3O0KA 4KFPA 3E96A 2WQDA 2BGQA 3E5BA 1DWJM 4O1AA 4F0HA 4YYCA 3GG1A 3C2OA 3NEHA 1KXQA 1XD0A 1V6TA 1DPMA 1GRGA 1XS2A 2R9ZA 3KCJA 2QW5A 2WMKA 1ZAHA 1Z9AA 4YYFA 1TB3A 2JIWA 4GYJA 2VX6A 2Z1KA 3H55A 4XAGA 3EOUA 1WQ5A 3HURA 3BSGA 4UTIA 3VX1A 4Z1YA 4YVXA 3PULA 3S2JA 3ORWA 2HISA 2OKOA 3ARQA 4CD8A 3UP8A 1R2TA 1HXJA 4IFRA 3VIIA 4HOWA 4R53A 2PD5A 1JRBA 4DWSC 1KC7A 4MY9A 4WLCA 4NAFB 1TWSA 2INFA 1QW9A 1UUQA 3FEMA 3WUGA 9RUBA 3S0CA 1CZ1A 3F4VA 4LBRA 4CN1A 3SCQA 3ZLHA 4EM4A 3EPOA 1NQKA 1XLMA 3MZNA 2GFTA 4QS5A 1OX4B 2ZUWA 1CGXA 4DRSA 4E4FA 4S3BA 3IJDA 2WV8A 1HJVA 4G8TA 2VZOA 1XISA 4PFMA 1IR1A 4FZIA 1FH7A 4PYSA 2C18A 2ZZCA 4GX8A 1XH2A 1E72M 4JTRA 4L6HA 4K8EA 3B97A 3QBUA 1DIDA 2H9AA 1GORA 2WK2A 1PKNA 3B05A 3CB8A 4PMRA 1RQBA 4HBKA 3C2YA 4M0XA 4D6IA 2BP1A 3GVQA 3APGA 2GDQA 4L7ZA 4S3EA 4RXGA 1JAKA 1O12A 1JXJA 2FTPA 5DMNA 5EMJA 1JL8A 2XU2A 4NEWA 2Y7EA 3LBCA 4DJDD 1FX6A 4FMVA 4AMAA 2XFFA 4GABA 3PUGA 1HL9A 3W1MA 2NQJA 3GKFA 1HKKA 3QFEA 4WY0A 4U3AA 5CBJA 3IIVA 4OUEA 1EJSC 4OKDA 1O7AA 2RJHA 4HHHA 4LNCA 4GJJA 1L2QA 2W3ZA 5B7ZA 4XQ6A 2G50A 5A2AA 3CUJA 5C7VA 2E6YA 4LUTB 4JXCA 2V2DA 3VD4A 1FA2A 1UA3A 2JE8A 3QR0A 4YCPA 4JQ1A 4UTWC 3IAQA 3HQ1A 3GR7A 1IIGA 1IHIA 1ZBCA 1W1VA 4NQ1A 3N2CA 1AMYA 3SGZA 3NGJA 3CJPA 2ATSA 3M4HA 1V3MA 4WKHA 2YSWA 4I8YA 4C7GA 4S3DA 4F0LA 1DQWA 2QF8A 4MNKA 3E2SA 4ZSTA 4G56A 2CBIA 5AYBA 3VMNA 3L21A 1FWTA 1NOWA 1EGMA 1H7PA 2XFWA 4O11A 1NF0A 3WNOA 3QY6A 3QLDA 3T05A 1VZWA 3WQ6A 3NA8A 2CWNA 3NQCA 4HOZA 4XBSA 1RCOB 4CLMA 3GX9A 1ZAIA 3EPMA 3LTSA 4LCQA 3W02A 2EGZA 4HNTA 2PDJA 2IPJA 1CGUA 1YPXA 3A12A 3XIMA 4J3VA 2ZUVA 2XIMA 1EXPA 4FNRA 4ZFMA 4F9DA 1SB3B 3KVJA 2CZ5A 3FGCA 1Y5WA 4RLIA 3F5LA 1LTDA 6PTDA 1JZ2A 5AOUA 3OZPA 3CAQA 4GY7A 4KCTA 4U4MA 1TMLA 1X8CA 3WELA 2VHLA 2CZDA 1SMDA 4IMAA 1PCKA 3T42A 2Y62A 4MYAA 4J40A 2F2KA 3OQEA 1E9IA 2V5BA 2C19A 3AIBA 3SR7A 4HB7A 3VNLA 3WBXA 2TSYA 4QX4A 3WF4A 4ONVA 5BOFA 1GEQA 4P7QA 2ZRUA 3C0JA 3A4WA 4NIRA 4WDXA 5DY3A 2BC1A 3EX2A 4Q3MA 5IOBA 1GHSA 4TU1A 6XIMA 3ZR4A 4AD0A 3GVGA 1EHNA 2BVDA 2WC3A 3VOJA 1F9CA 3Q65A 3EZ4A 5LXEA 2Q09A 4V1XA 4HHPA 1GUVA 4FX9A 4AD1A 4A29A 7REQA 3KHDA 4PBGA 4D8ZA 3MV11 1ZBKA 3ZR5A 3U7BA 3VINA 2I5QA 3EA1A 1C9DA 4ADUA 4M7TA 4XZBA 1TPDA 1LF1A 2PCQA 4K8GA 1OABA 4LYQA 4GFIA 1FKXA 1LCOA 3I65A 4JNMA 2YCEA 3PC0A 1G9HA 1M7PA 3KHJA 5IBXC 3ARXA 2HRWA 2OVLA 5FAGA 3IK2A 3URHA 3DFPA 4C1LA 3CHDA 1OFDA 2O56A 3UZXA 5F4WA 5C71A 3EKLA 3F4NA 1H50A 4FS9A 4GYKA 4QIUA 3EDKA 1SW7A 3VA8A 3W37A 5FJRA 2VUNA 3AMZA 2DSUA 4JQ9A 1NOFA 2NPXA 1RK5A 2XWEA 1JPMA 4HPXA 3W3OA 3BCJA 3VKDA 4QEHA 5D33A 4POCA 4EK7A 3CV2A 4M80A 5CSUA 5DRIA 4YXGA 3H12A 1EDQA 4UCFA 2Y8KA 4O54A 4H6RA 2R1KA 4D72A 4OGZA 3R0DA 1EL3A 1KM5A 2TRSA 2ZTKA 1M6IA 4ILSA 1CX9A 2VRJA 4IIGA 4KGLA 5I77A 2Z4GA 4AY7A 3URQA 4XZIA 4DBSA 1AH4A 4ROQA 1JYVA 2VVSA 2WWCA 1CYGA 2DZVA 5FSDC 2DT0A 3LERA 1N8IA 2VC5A 4H8UA 2V68A 4O57A 1PS9A 3MANA 3PFMA 5FMHA 2FVKA 1U5JA 4LF1A 1ITQA 5D03A 3E38A 2VZSA 2JKAA 5MKGB 1KGUA 4E8GA 2YVJA 4MLJA 2Z2BA 5I3FA 3GC4A 3BTNA 3M1ZA 3SM0A 4NEVA 4S3CA 1F07A 1HG3A 4L1WA 3GD4A 3WDHA 1XGDA 4GKLA 3LHWA 1UOZA 3R11A 1K8CA 1AQFA 4S2BA 2BXYA 5LNSA 4M19A 4H83A 1GETA 1JULA 5FOOA 4UQAA 2G3NA 5LZLA 1WZAA 1CWYA 4L6DA 3GFYA 2ZUMA 3U3HA 3WLMA 2NWRA 2CCRA 1VB9A 3CZKA 3KL5A 3FJ4A 1YQ2A 4M29A 1GXFA 4FA3A 4ZO6A 5D2XA 1TWIA 3JZUA 3L4YA 1IT0A 4AC1X 2XN2A 1VCFA 2BG5A 4N4PA 3CUFA 4R7OA 2F7FA 3F5JA 5A8MA 4KEMA 3S6OA 2R1PA 3VDAA 3V5FA 4QRNA 4Q8NA 1TYPA 3PN8A 1UWAA 4B5XA 2WSPA 2WCGA 2YXOA 4PUNA 1V08A 3ZMRA 1ZBVA 3JVAA 2ZUUA 1KQZA 2C1IA 1GJUA 1V6YA 4GK8A 2WSKA 1W3NA 2ZRZA 1EQPA 3CUIA 4F3HA 3H53A 3OGSA 3GYCA 2JK6A 4XD3A 2BGSA 1OIMA 3W2MA 1J18A 2Y6ZA 1Q2SA 2J7GA 3URBA 1TA3B 4HD5A 2Y8UA 2Y61A 3GIQA 1V6UA 5AVHA 3PZUA 3F4DA 2Y0FA 3SRDA 3FA5A 3R0KA 3T08A 1SR0A 4BEUA 3VX0A 2BV9A 2PP3A 3VD3A 3VIFA 4ZFCA 3RNDA 3R8HA 4EWND 3LCXA 1LVLA 4XZWA 1C91A 2A85A 2P88A 1B30A 1ZTVA 2AQWA 5CZTA 3NPUA 1UASA 5C2GA 4NZFA 2DY3A 3R8GA 1YDVA 4B5SA 3TFCA 2XGZA 3UJRA 1XRSA 4LVDA 3DBNA 4I6KA 4QDWA 2ISWA 2DJLA 3WENA 4ICNA 3AHTA 3E74A 3MTWA 1YBQB 4Q4PA 5FJUA 3WLJA 1YPIA 4MB1A 3DC8A 2YLAA 2VCBA 1LBMA 1VKFA 3RJYA 1IXQA 4B5NA 3PP7A 2HNEA 1XLAA 1VJZA 4CU8A 1BPLB 4H9MA 1OINA 2GVYA 1H63A 1JCYA 3B04A 4HN4A 2QCHA 4JCLA 1EH9A 4AWSA 1H2JA 5LXXA 1Y65A 3FG2P 1XUUA 4NXKA 1QHOA 1U1UA 4BQ4A 1WUFA 3S4TA 1F3TA 3M0HA 5CGTA 1AZ1A 1J4EA 1OBAA 2WSQA 3VMPA 3OHIA 3TZNA 8RUCA 3GHRA 1R46A 3WK1A 2G3MA 1G4EA 4A2SA 1QHZA 1E55A 1R3VA 4WY0F 3S2MA 1R38A 3AS2A 3VKBA 1OJTA 4FLQA 2WPCA 7A3HA 2GH5A 4YWOA 1EKOA 1HZYA 1XDMA 2J13A 4E4UA 3V1HA 3APYA 1HF6A 2J77A 4ZMGA 3M46A 1QNOA 2V8ZA 3WIJA 1C7TA 3VAVA 3BW3A 2DUZA 3TNOA 1RJRA 1W6TA 1OX4A 3IWPA 2OT0A 2Z00A 4R34A 1DP0A 3UG4A 3WFLA 1EP2A 1CNVA 4DO6A 1NSJA 1J2WA 4GFSA 4JNZA 2C15A 3DENA 2Z7GA 4JKLA 3WLQA 3EWCA 3VK5A 4Y6GA 4QAWA 3LGEA 2HTMA 3O6AA 5HMFA 3TCSA 5A6BD 1XH1A 4LUJA 4IPPA 4CQBA 4YMZA 3O8AA 4N4QA 2CC0A 3RMEA 3B8WA 2X2GA 4IIDA 4FP1A 1P6WA 4L61A 2PCEA 1OK4A 1CW2A 1W9BM 1XV8A 5DFAA 2AMGA 3SY1A 5AHMA 1S39A 3SIMA 3WNPA 4AZHA 2V3FA 1B3ZA 1OK6A 4JX5A 2ZZBA 5I5RA 4JTGA 1I4NA 3KOXA 2CLMA 2WVTA 4ZA0A 2PD9A 2QUNA 1C7SA 2NSOA 3L5LA 3I7SA 1RD5A 4B2DA 1V6VA 1HJUA 4WRHA 2Q6ZA 4J28A 2PGEA 2XUCA 3HW2A 4ATLA 1RLCL 2Y70A 4JN8A 1UP2A 2QULA 1LT8A 2DVUA 2OJPA 4MSSA 5CJ5A 4RKAA 3WDJA 4XAFA 1O5KA 1R85A 4N6EA 4OHQA 1MRQA 1M5WA 2NVCA 3ZO9A 1F8WA 5TD4A 7TIMA 3GW0A 3UJFA 1TE1A 1GCYA 1Q13A 2EHHA 4AZCA 1K77A 1GPWA 2DW6A 4V1YA 2I1OA 3FV9A 1OADA 2P53A 3H22A 4GIAA 1B2YA 2QGHA 1W5MA 3W75A 4LGXA 3S1GA 4DI9A 4FLRA 4GVFA 4A8RA 3TTOA 4W8LA 2XZ9A 1EXBA 4QEEA 1ZDLA 1ISVA 3GXIA 4JTKA 3UWZA 4FLOA 4ZTXA 1KGXA 2PDXA 3SUSA 1DXIA 1VQTA 2MUCA 2R8WA 3BLPX 1N2VA 3TOYA 1BZLA 4WXYA 2FJKA 2XH4A 3TC3A 2E6AA 2PWHA 5A6LA 1EBDA 4E2DA 3CPRA 3WFAA 2TODA 1GOKA 2QV4A 4M81A 4G7FA 4JL2A 1AQ0A 2OQHA 2VX5A 3ZSSA 1SJCA 3D3FA 3N04A 1WCGA 1E6RA 2VUYA 5HJLA 5ER0A 2C3ZA 1V7YA 1TZZA 2WBKA 4D6FA 1OYAA 1Q6LA 2WNQA 5LYRA 2EPLX 3GRTA 2VTFA 1QW8A 1UWTA 4GQQA 4TMBA 1GG1A 4Z42C 3TTSA 3HQPA 1ISWA 1DJGA 3M64A 4AIEA 3LNMA 2I57A 3ZIZA 2HDJA 2Q3OA 4ZB2A 3SQSA 5AC4A 3I68A 3WLLA 1FWBC 5BU9A 1K7EA 3U57A 4MAZA 4NYYA 3RCMA 4Q4OA 3S5ZA 1H5VA 5CH9A 1ZMCA 1H62A 4KCVA 1D7YA 2VNCA 1E40A 1TPUA 5BWAA 2DORA 3ARYA 4JYDA 4L80A 2DUAA 4XK2A 3K8LA 3W7EA 2OCZA 1KLYA 5A6SA 1XP3A 2GJXB 3EDJA 1FP8A 2A3AA 4U10A 4J9JA 1MO9A 3GNDA 1NDVA 1VEPA 1YNQA 3EB4A 4NKCA 1SMAA 3WJYA 1PO9A 2PODA 5CC3A 2NXGA 2YCJA 4J7RA 4L9YA 5DT5A 3G1DA 2CLOA 1QPKA 4LS1A 4KQNA 3TYEA 4G2DA 5M5DA 4LAUA 4LUSB 2QR6A 4AHQA 1WDSA 1PX3A 1JVNA 3VKJA 1UC4A 2BLEA 1OCBA 3EB3A 1M53A 1EF2A 4NRSA 1H60A 1RUSA 3UU0A 3QKEA 2D3NA 3FJ6A 2QAPA 2E8ZA 4U5KA 1LPFA 3FSUA 3HOJA 4WSHA 4FDCB 3N2OA 2PDQA 4BWLC 4H4ZA 1KN0A 2YA2A 1BG9A 1HJQA 5A8NA 2V30A 3BLFA 3C61A 5RUBA 1UP0A 1WPCA 1OFOA 1H51A 2P5NA 2VZVA 3WMSA 4U5IA 3RM9A 1GOOA 1GQIA 3OODA 1IEIA 1E3XA 3NQ6A 4QXIA 3CIXA 5D8ZA 2WB5A 1GQNA 2DVTA 1S2UA 1YPFA 4K2SA 4OBRA 4JDRA 2J9ZA 3DJGX 4NI8A 5AC8A 3PG9A 4QDPA 5HQMA 4UC5A 3GKAA 4JPGA 1UZ1A 3PS7A 1RXOB 4Y90A 1MZRA 1X97A 4GY0A 3A47A 3DAQA 2V9DA 3QY8A 3PBYA 1YIXA 4QSHA 3WH9A 2E5BA 3WL0A 4HHLA 2HCVA 1POJA 1FOBA 3VDBA 3VYLA 3P61A 4DYJA 3G0XA 3QHMA 4J35A 1E4IA 3GC5A 1BWCA 1WBJA 2FKPA 1KA9F 3KBMA 4H4TA 3ONBA 1O66A 3MI6A 1EX5A 2R82A 1JPKA 2CLLA 4C5YA 2ZUTA 1W17A 4XWUA 2HNHA 4JFSA 4TUFA 5I24A 1S3TC 1XSJA 2QQ6A 1UWIA 3GVWA 2ON3A 4QCEA 3WD2A 3CZGA 3PZVA 1A47A 2Y4SA 3GDMA 5T8GA 4MM1A 2J27A 1VLWA 3I7QA 4HK6A 2QCDA 2GRTA 3HPAA 3S5OA 4AU0A 3P82A 4XIAA 4RJEA 1GQLA 4S2CA 3UG5A 3GE7A 3CGEA 3TC7A 4K8HA 5G5IA 3GR4A 3UYIA 2WZIA 3NZ1A 5G4EA 2IKIA 1ZGDA 2QHAA 5REQA 2W61A 2BMBA 1NY1A 3MDUA 4RR4A 1XYLA 2WMIB 3CK5A 1D3CA 1QNRA 4HU8A 5JRBA 5KVHA 3CU2A 4TO8A 4GKTA 2DV0A 1GREA 4Z0JA 2PWGA 3BG5A 5KITA 3NGFA 4MKNA 3ZM8A 4C6CA 3UW6A 1FBAA 1QOXA 1RQEA 3VNYA 4ADSA 3CGTA 3GNRA 3PY2A 1TELA 1E9ZB 2HK1A 1HKIA 1LUCA 1E1EA 4NZ5A 3S1XA 3GRSA 3AZSA 4G1KA 4Q6XA 4RDZA 5EMMA 1EEPA 5CGQA 3SO7A 4JIIX 2QF7A 5HAOA 3MYOA 5D9PA 1D3HA 2Z1VA 4ENLA 1TA3A 1KFBA 1WDRA 1PWLA 2E4TA 4PMNA 1UJQA 1QK0A 1FHLA 3QYSA 4R88A 3N9KA 3PZIA 1XLCA 5BW6A 3H54A 4I5UA 4E2BA 3MHFA 1GQKA 1XCXA 4L9XA 4H9VA 3EWYA 1XICA 3L0KA 3MY9A 5EB8A 1GZ1A 1PKMA 1ZCOA 2D23A 1L6FA 4QHRA 3NUKA 1RJQA 1VJIA 4ZZ9A 3FXYA 4GNJA 3SI9A 3LOTA 1L6WA 1RSCA 2XIBA 1EZ2A 2NV1A 1UKQA 3KWXA 5C55A 6ALDA 2AKZA 4H9YA 2FFIA 4B16A 1A3HA 4IQEA 1C8QA 1R3WA 2G41A 2UY3A 3V5CA 1E3ZA 1GRBA 2HQMA 1MO0A 3HGOA 3NWRA 4NHVA 1SM9A 1OCJA 4K7VA 3WSUA 1K8ZA 1P6CA 1BYDA 3GHUA 1DJNA 1VYPX 4P7RA 3CM4A 4Z1AA 1E6SM 3CQJA 3VDGA 2XIQA 1NDAA 4V2XA 5CJNA 1O5XA 1CENA 1E56A 4AWTA 1CECA 4M1RA 1EQCA 4CNUA 4IGSA 3MPGA 4PUJA 1LOQA 1LWIA 3K5XA 4ICMA 2A3EA 2I14A 5CPNA 4X63A 4LYPA 5K7JA 1QBAA 4Y96A 2ADAA 3K4WA 3EPNA 3WNNA 1FHUA 4N9DA 1TCDA 3VPLA 2PDMA 3QFWA 4J3WA 3BAXA 4LVAA 3L0NA 3N4FA 2VX4A 4C6FA 2UY4A 4NL1A 1PKYA 1CGWA 3QN3A 1JPHA 4EE9A 1V6XA 4DXKA 1VF8A 2WWDA 3K4AA 3BAKA 5DY2A 2VYOA 4HPHA 5A95A 2GR2A 3T4WA 4AZGA 1W91A 2XH2A 2QJMA 2X2YA 3THUA 1B3WA 4IFOA 1FWCC 3QEZA 5TQLA 3L12A 4IIBA 4Q8MA 3GHTA 4S3FA 1EJWC 3HMJG 3K46A 2YVFA 2DDXA 5B80A 2RDTA 3MCMA 2C7FA 1PEZA 4PMUA 3BJSA 2PRHA 3CIWA 4HJFA 4MWAE 1G94A 3C2VA 3VCRA 4O0ZA 1DL3A 1W1ZA 1LLWA 3AS0A 5FS7A 5DQPA 5ABFA 3W73A 1OSEA 4UR8A 5HQLA 1TTJA 4OVXA 1E0WA 2WNNA 4KH2A 3NPVA 1UH3A 4H8HA 4IUOA 3VILA 3OIHA 2W4XA 1SPQA 2WYSA 4ACZB 2CETA 3J7HA 2ACRA 2OYLA 1V79A 2VR5A 3H26A 4E8CA 1DWGM 1UHVA 2IQ0A 1XIGA 4OECA 4LEFA 1YEYA 4XTDA 3T0AA 1E1CA 5DCBA 2E7FA 2XISA 1XIEA 1J79A 4PTDA 4PMQA 3GG0A 5C9UA 3QQ0A 2PDYA 3KDNA 1ZNNA 1EUNA 3N4EA 3WBAA 1C9WA 4DF0A 4A3HA 3RPTA 4HA3A 4L65A 7TAAA 5F4SA 4DF2A 3SFWA 4O8AA 2RJGA 4DNHA 4UFHA 4QAIA 4Q33A 1SSDA 1FWSA 1X2HA 1ZZMA 1GW1A 3Q37A 3VNIA 4H2HA 5I3KA 1EEXA 4QP0A 5FACA 1HN1A 1QHPA 5CZKA 1H5YA 5ENLA 4K1WA 2EKCA 5EL1A 1C8VA 2D24A 1RALA 3KL0A 3K13A 4IJBA 1E4LA 1FWRA 4GINA 3TLLA 5C5YA 3MHGA 2YW4A 1LOLA 4BZYA 2HZGA 4EPBC 4IIFA 1RK6A 5AC6A 5HATA 5FF2A 2QAFA 3N6JA 3WLNA 3N2XA 3RPMA 4P7OA 1UUOA 1WBHA 3UCCA 4PMDA 1VP5A 3V0UA 1QU4A 3EKGA 3DUGA 1XC4A 2X41A 1L0PA 4XVDA 4ZQOA 3SBFA 3KCOA 2ZRYA 5FIPA 5CLWA 5JQ9A 4EXAA 5JUVA 3W2KA 2ZZ1A 3A21A 4MAVA 3OPSA 1B9BA 3LM7A 1CGTA 2WPBA 1H09A 3WQWA 5EYWA 3T40A 1J11A 2VKZG 2E25A 2GJNA 3MU7A 4WVXA 2HBXA 4LUYA 4Y8EA 4WQ6A 2YDRA 1IGSA 2GVEA 4PA8A 1AQMA 4K38A 5LHEA 3O0FA 4WX2A 4C6KA 3KBWA 1JZ3A 4XG1A 3BOFA 1Z89A 1U22A 1ALDA 1DJZA 1F8MA 1UWUA 3NQMA 2XTKA 3SQMA 3FCPA 4ZXLA 4UB9A 3G6MA 2G0WA 4PUEA 5TR3A 3T0BA 3PZNA 3TSBA 5JBDA 1QOQA 1V0MA 4HZMA 4AVNA 4A3UA 5FL0A 4QISA 1E71M 3UR5A 2E67A 2VVNA 4Z2JA 3E12A 2XGIA 1ZY8A 4NP7A 1I2QA 1RH9A 2F38A 2EXOA 3SIZA 4PMOA 2PWEA 3D0CA 3PBVA 1OC5A 3E49A 3P14A 4O10A 1UP3A 4GRTA 4OZOA 4DJED 2WP6A 3WH7A 6TAAA 2NVKX 2DH3A 3A7AA 4MY8A 1TZ7A 2GJXA 2VDGA 4WJEA 2EJAA 3QQWA 3UA4A 4QBXA 1H11A 3CQIA 1UG6A 1E0UA 5E9XA 3DEQA 1GVYA 2O9TA 4FIQA 4JIHA 3LSBA 4U3CA 4GMEA 4MKVA 4AIUA 3GU9A 1KQYA 3G1XA 2HPMA 3NZPA 4Q8UA 2IKGA 3O6YX 2Q8XA 4AISA 3MZ2A 4J2MA 1ISXA 4HYRA 1LRTA 4HMDA 1M41A 3VIMA 2HEJA 3OGRA 1EFZA 5BXRA 2ZZ7A 1P7TB 2PDIA 2YW3A 2RDWA 2WVVB 4WOQA 3B3DA 2YDQA 1KM3A 5K9CA 4PSPA 3WUFA 5LSMA 2I7GA 2V81A 1GOQA 2FTWA 2CLIA 3W38A 4KFNA 3THQA 3CV1A 4JIPA 1MQRA 4AHOA 1HJWA 5I7GA 3MW7A 1XGZA 4JIQA 3OQ8A 3DU0A 4MVAA 2EQ7A 2AL2A 1KM2A 2W67A 4ZO7A 4FXSA 3SUUA 4XZMX 1V03A 1QR7A 1SJDA 2CNCA 3UZZA 4DELA 1EOKA 3VI2A 1ONEA 3G1AA 5HWNA 4D6JA 1IF2A 4GUIA 1BHGA 5E6YA 2BFGA 2QJJA 1YW1A 1WDDA 1YDNA 2WZTA 4A8NA 3R07C 3DERA 2ACUA 1OWQA 1TIMA 5I3JA 5D04C 3RITA 4EF8A 1OJXA 1F4HA 4MWAA 3AO0A 1ZALA 1OCQA 4DUVA 1HGYA 3MO7A 3GXFA 2E28A 1P1XA 5DN1A 1E6QM 2FZ9A 3GM8A 3GXPA 1AODA 4HA1A 2IPFA 2EPHA 2NV9A 3EMZA 3USBA 2IQDA 4D8AA 1TVPA 1RAKA 1HX0A 3BPWA 2OX1A 4JFVA 1F73A 3P8IA 3G1VA 1QI2A 4C60A 3QH2A 1NDZA 4LXFA 2EQ9A 4UOQA 5HA7A 1UJPA 3PF3A 1SU5A 3OLEA 4DZHA 2A6LA 4LNYA 3ANYA 1RJPA 1J9YA 3N9RA 2R91A 3DG7A 3VM5A 1RLDA 1NHRA 3VGGA 3CZEA 4JTIA 4WGHA 3CT7A 4UR9A 1XH0A 3U2OA 2FHCA 3M7SA 4EF9A 3R89A 3VD5A 1B3YA 4PODA 1JD9A 5DXYA 2X8GA 1DJHA 1OIFA 3WG6A 2VP8A 1UWSA 1K7XA 3ES8A 2W55A 3ITOA 2OR2A 3P80A 1WO2A 4Q8TA 4WJ8A 5FF7A 1EA9C 3CWHA 3CGDA 4YWSA 1GG0A 1W3TA 3KZPA 4W84A 2F6UA 4IP7A 3MUY1 2CFFA 3HQNA 3EMQA 4W7VA 3PJWA 2WMIA 4WF7A 1BGAA 3WJXA 4KFOA 1JCJA 4HP5A 5C7HA 3H2AA 2I56A 1O95A 2J8FA 2V5CA 3AXXA 1XHGA 2AAAA 4C6DA 3WQ5A 3ITLA 5CG0A 2AL1A 4B5VA 3CO4A 4H4UA 2OZTA 1JDEA 3TA9A 3B9OA 2RUSA 1NHSA 4ZL1A 3W84A 2EF9A 4B92A 3F1QA 1IYXA 4JHZA 1Q66A 5CQ1A 3RN6A 1J0HA 3CHCA 3PPFA 3N3MA 2ZRXA 3CL8A 1KTNA 1SFSA 1L8NA 4JIRA 5HWJA 5IHSA 1F61A 4JTHA 3L0GA 3BGGA 2VZUA 1I8JA 1E0VA 3EAUA 2PTZA 5KZMA 1VIZA 4AIBA 3M41A 2J75A 1R47A 4ORMA 2CBUA 1XLGA 5AHFA 2B7QA 1MW2A 1FFUC 1FH8A 1PX4A 3QZEA 3T4CA 1JXKA 3WY1A 2PWDA 4E5TA 4GO8A 1N8WA 4AYSA 3L4XA 2X8RA 3CAWA 3P6LA 1GTHA 4J56A 2QLYA 5EMUA 4BY3A 2ZDRA 4IGHA 1TR9A 1F05A 2OB3A 2R1NA 3DESA 3OA5A 1AL7A 2O0TA 2VXNA 4ZQNA 5C54A 4DJFD 4O14A 1JYWA 2QJHA 1G67A 1UWQA 3KP1A 2J62A 1NELA 1YTDA 3V0SA 2W79A 3T78A 1UZHA 4RV8A 3I4KA 1A5BA 4JICA 3TCEA 4JDYA 4B3KA 3F03K 2NZLA 4KS0A 4Y9NA 3WK2A 1E43A 4MLRA 1AW1A 1GRHA 5H1WA 2DP3A 3F2DA 3S1VA 2FIQA 3GTNA 4NF7A 5T9BG 2HJPA 3PFRA 1ZX9A 3NVZB 6REQB 4IT1A 1W3LA 3SGGA 4GXMA 3N17A 8XIAA 3AZTA 1P6BA 1SYTA 3D46A 4JTEA 4XAPA 2WVUA 1EGVA 1TYTA 2FH8A 1PHQA 4GVGA 4GC3A 2VQUA 4EACA 4PCNA 3RX4A 1EC8A 3CPUA 1XUZA 4EQSA 5BRQA 5CZ0A 1VPXA 5GQBA 4R27A 2DVXA 2PP0A 4LRSA 2ZADA 2GK1B 2BY3A 4JR5A 3FK4A 5XIMA 3IUIA 4JIEA 1GVQA 1UZ4A 1SZGA 3A4XA 3BMWA 4H4PA 3PWAA 1VJSA 4IJRA 1AW2A 1VHNA 2HVNA 3THAA 3AN1A 3MCNA 4DNMA 3WF2A 2AAMA 3NM3A 1RM6B 2F2HA 3VKAA 3GU2A 5LIWX 4JY8A 4US5A 2OMAA 1K9FA 4ACZA 1EJ7L 1R2SA 1TWZA 3QZ6A 4GCAA 4JZ5A 4XD4A 4PUWA 4I9TA 3NO1A 2ZICA 3I3DA 2D0HA 4AFYA 1WYGA 1YMYA 1OB0A 1JCNA 1J0YA 4FIRA 1F6PA 4BQ2A 2XDFA 2ICSA 1U83A 3LHYA 5JCLA 5EFFA 1GT8A 3R4IA 4UMBA 3DBPA 5FS9A 4O16A 3GC2A 1CB7B 4PUUA 2VOTA 3NQDA 5D02A 1P0EA 2VFDA 3M44A 3ATZA 1IGWA 4GWEA 3OC4A 1Q1RA 4AIOA 1LROA 3KOYA 2R14A 1AD1A 1QWKA 1KM1A 1ZJIA 3ARZA 3N3TA 5HNNA 1TPVA 3MV01 3B9AA 2PLCA 4V33A 1B57A 1EPXA 3W1RA 1M1BA 4GQ0A 2V5DA 3S2CA 4GVHA 4NG3A 4J1OA 1VFLA 1XC6A 4PRRA 4JN7A 1W56A 1IEXA 2VMFA 1R3SA 2Z29A 2ALRA 2CLKA 4A21A 1JDFA 3W1PA 4D1JA 4UXDA 3PBUA 4GI6A 2PLJA 4MMWA 4Q8PA 5G4WA 3KAOA 2ZZ2A 3IJ8A 2ATMA 3AUJA 4LVGA 2P1FA 2CLEA 2OT1A 3CTTA 6A3HA 4LA1A 3XISA 2E8YA 1HP5A 2VEIA 2BASA 4PB5A 4TXEA 3HGJA 1SGJA 5A69A 4ZOAA 5EPDA 4PN2A 2W6RA 1JUBA 3IVUA 2YR1A 3W27A 2QV5A 1KM0A 2HS8A 1K02A 2ZX6A 3SDOA 3ZLGA 2FHBA 3TU9A 4E38A 3S83A 5F1UA 1RPKA 3PNUA 1Z41A 2A6NA 3AXMA 3OU8A 2WZEA 2A7NA 4F4RA 3LTPA 3W29A 1A5SA 3WQVA 3G3MA 3MWCA 1U5VA 3DCPA 4HPJA 3JW7A 1LQ0A 1F2JA 4OJYA 1K8YA 2VFIA 3HFTA 1Q6RA 3FFSA 1ZXIC 1Q63A 1BKSA 4ML9A 2FB3A 2Y89A 1UYQA 2JGQA 4AZIA 1HUVA 3BAYA 3DH7A 3O15A 2W3RA 4I8DA 2OEKA 4WKFA 4KW2A 4A6GA 3EGJA 3PJXA 2NSXA 1T5AA 4J4KA 2JBMA 3USZA 1W32A 3NDYA 3UERA 3KL3A 1QW7A 2XYLA 5EBKA 2E9LA 3TJLA 4DWSD 3VUPA 5ABGA 3W1NA 4JD4A 3G2GA 3QF0A 4KIEA 1MI3A 1UBSA 2WHLA 1T3QC 1S1PA 3FY1A 4DVOA 3L9CA 2E9MA 3LG3A 2BDQA 2NX9A 3PTDA 4DUOA 5I0DA 5GJPA 2D0GA 3E0VA 2QIWA 4IP4A 4A8IA 5ECVA 2E3ZA 3CYVA 4RNJA 5LNRA 1STZA 4C5ZA 3N6HA 2Q8ZA 3ABXA 1KFCA 4MJZA 5FS6A 1RVGA 2X30A 3AMGA 3NVYB 4RE3A 2W0UA 1WKYA 2IS7A 4GXPA 3CGCA 4DBEA 2ZXQA 1CXKA 1I0DA 4LBSA 3OBEA 2BVYA 2WVVA 4ASTA 4H9ZA 2WQPA 3DKLA 1NDYA 4C6NA 3TE9A 4HK7A 4JFTA 5I23A 3CTLA 1HT6A 4JEJA 3BLKA 1RBLA 4LYKA 1N5WC 5DLCA 3ZS4A 4KMQA 4EP8C 4UMCA 2EO7A 1JDAA 5I06A 2G3IA 4DY1A 2FZ8A 3L4ZA 2FLIA 1FWWA 1I2OA 3IIOA 3NQGA 3C4UA 3P2VA 3B9NA 2GSEA 2QCGA 3KM8A 3AIVA 3CQKA 4FX8A 4CEUC 2B7PA 1W9VA 1OM0A 2DZBA 5CPLA 3WJZA 2WBGA 4CUCA 1I2PA 1OGSA 1ICQA 2NUWA 1UC5A 3WF1A 4G7EA 2GWGA 1FFRA 2FB2A 1UUMA 1LQAA 3PPGA 1OCNA 1X96A 3O2LA 1UD2A 3FLUA 3IV3A 4WGXA 2DZPA 3VIOA 5AC7A 1JQXA 3M9YA 4C6EA 3W00A 4TVDA 4DAFA 4REQB 1S5WA 4P8WA 3ITYA 2QUVA 2XM1A 3O0HA 4I9JA 5HINA 3KTCA 3DGRA 3ABQA 4ZTYA 1NFGA 1ZS2A 3OZYA 5DMYA 5D2TA 3NSMA 1Q6DA 4GZJA 6CGTA 4JTUA 1ZRQA 2E6DA 3UWUA 2V69A 3LDVA 3P74A 2OO0A 1UR1A 3S5SA 4AAJA 4YIWA 3E6EA 5HUPA 3W0KA 4D6DA 2XVKA 5A6TC 4DLFA 3WNMA 5I00A 3BICA 3DGBA 1EO7A 2H90A 2VD8A 5D30A 3ZZ1A 3QV6A 1W0MA 3BJFA 2ZUSA 3OA3A 1IE7C 1DQUA 2OODA 1CXHA 5TAOA 3GAKA 4QGCA 4X2PA 2UY5A 3LXBA 1PXGA 3V7PA 3GRIA 3VZXA 2HQAA 2XIOA 1J0KA 2R24A 4NZ4A 2Y7DA 4GUFA 2HBVA 1ICPA 1XW8A 3OG2A 1E15A 3U6WA 4JTSA 3MDWA 2TPRA 3VOFA 1XLEA 1LBFA 2WLZA 1H3GA 1M01A 3LV5A 3UWVA 3RHGA 4FI4A 1JZ5A 1TIWA 3TP4A 4XD5A 5E5CA 1QNSA 3BLOA 1XLFA 3UNDA 1HKWA 4N02A 4K68A 4H04A 2ANUA 1Q65A 3ELFA 3OVRA 1XYFA 2GUUA 2VRKA 3NPXA 4QS6A 1MYRA 1NQ6A 2D2GA 3OZOA 4NJHA 4AZ7A 4CD7A 1TREA 3DK8A 2FVMA 2XH7A 2ZFAA 3BV4A 4P8XA 2GL5A 2WLYA 1R8LA 4AQLA 2O9OA 5AKQA 3AYRA 2PDBA 1SO6A 1Q5MA 5EBAA 3W28A 3DJJA 3HRDC 1Q6FA 2C14A 3RFAA 3W83A 1H0IA 1QFEA 1EIBA 4L1GA 4QJ1A 4B5TA 3ID7A 1ZQ5A 3BAIA 4AXNA 3GY1A 1XIMA 2DQXA 3NQ7A 2CIPA 3QTGA 5HJXA 1ZUAX 4LH8A 3TWBA 1B54A 1GYMA 1XBZA 3GFXA 1FUYA 1TWDA 3M0XA 3TH6A 5I02A 1KM4A 2VGGA 4YNGA 3WNKA 5H8UA 3O1NA 4KRUA 4LT9A 3WF0A 3VC6A 2PUZA 1GERA 3QGVA 3EOSA 4JGDA 3EX6A 4H8NA 2OU4A 3BCFA 4PB4A 3RIKA 4O15A 2W62A 3ANVA 3TR2A 1SVDA 4LX4A 4JQAA 4TV5A 3VOHA 2LLEA 1IWPA 1K9EA 3NVWB 3LNPA 4IQLA 5FS8A 3CUHA 4GZIA 4MB3A 4GZ7A 3LX9A 3OEXA 2C71A 1VGAA 1VLIA 3PG8A 4W89A 1PE1A 4BK9A 3VKKA 1W9PA 5HBFA 4HVXA 3UXDA 5A94A 4FR1A 4AWUA 2A0NA 3VGBA 2D0FA 2WW5A 1KCKA 2BHYA 2H8ZA 2ZE0A 3IJIA 3T07A 5DO8A 3ECQA 4X9YA 4TVUA 1TTIA 1WXZA 3PHAA 4H9XA 4B91A 3KBSA 3BVJA 4RV3A 1OF6A 3CEPA 1JPDX 1UQZA 3OVGA 5BXTA 4PSRA 4XZNX 2ZQ0A 3VE7A 2BOFX 3W1QA 2YXGA 2C3CA 2PGRA 1RBAA 3MBDA 3SFKA 1IT8A 4H4RA 1EO5A 4H7CA 3N6QA 1XIJA 4RE2A 1NIUA 3UY8A 4W7WA 2E1DA 5CZSA 5L6UA 2J88A 2TMDA 4HZ8A 3W7MA 1VBUA 3WH6A 3L4TA 2QNEA 4IG2A 1E70M 3SB0A 9XIMA 1DHPA 3VABA 1UH4A 1JAEA 1CCWB 3I6RA 3T9PA 3HV8A 3M0MA 5D09A 1DJXA 2GK1A 1L2UA 2QDEA 5F2IA 2XINA 3PZMA 5DRCA 1B4EA 2IQTA 3HGSA 5GVJA 3CC1A 4GO9A 5CPMA 3BURA 2GPTA 1IR2A 3UWEA 1G4SA 5DCEA 3TX9A 6TIMA 4IX0A 1UD5A 4D2JA 4JCMA 5KZ6A 3VDHA 1XKYA 4JFWA 3HPFA 3QSTA 3R8RA 2A3CA 3STGA 3TA6A 4L4MA 2PC4A 1MW0A 1QI0A 4ICCX 3UEQA 3UWYA 1P5BA 3PB2A 1SW0A 1J2BA 2CITA 3POCA 1FP9A 1CB2A 4PBEA 4RUBA 1RP8A 1RR2A 2CW6A 1VEMA 5CC6A 3AISA 1LG2A 5AY7A 4UQCA 1IQ8A 4BA0A 1SW3A 3EWXA 1ODUA 1P4CA 2ZA1A 1RY0A 4D71A 4H4VA 2PDKA 1YYAA 2J7FA 1JZ4A 1ZKQA 1FWGC 8TIMA 1W1PA 3ITXA 4UCGA 1ZLPA 2ZWZA 3RU8X 1QBBA 4HMNA 1SO5A 3BSHA 3ZWSA 4F2UA 3LRMA 4RE4A 2J3NA 4QM1A 4ES4A 4S3AA 5EKYA 1BVWA 2HE5A 1DJWA 1TUFA 4DBDA 3FOKA 7XIMA 2POZA 4INFA 2X7VA 4JX6A 3QGAC 4ECLA 1HJSA 3GNOA 4OUIA 4JTAA 5F4XA 1A50A 4K37A 2O7QA 3NO5A 3P5YA 3RO6A 3CV7A 2GVGA 5LNWA 1X98A 4HT3A 4C1KA 1XXXA 1W5PA 4ZVJA 2Z1XA 2MANA 1TUXA 1KWKA 3MI2A 2BY2A 2W0HA 2Y1HA 1ISYA 4MB5A 2GVJA 3IJLA 5H8MA 4WSJA 1OY0A 2Z7KA 3BXWA 3S46A 4HYVA 2PRMA 4MWAD 1H49A 2FMOA 1KD0A 5IHRA 4L6OA 1XDJA 3S2LA 1S5TA 4X9SA 1GONA 5FJOA 1HO4A 4GIYA 4UUIA 5CZJA 1K4HA 2ZE3A 3LEPA 4CEXC 3K2GA 1HFBA 1FHVA 3RF9A 4N2YA 5L9FA 3W07A 4LEQA 3TSMA 2X8CA 3G24A 5B7YA 1A5MC 1HW6A 5LIUX 1XGEA 2Q01A 5H91A 1H6VA 3NYZA 2YQUA 2FMNA 1XG3A 1I0BA 1JZ7A 4JTQA 3RXZA 3TN4A 2WKGA 4C6IA 4F66A 1GVOA 1BGGA 3FYPA 2W66A 3TYCA 3EWDA 3ABZA 3EMCA 4KRZA 2WM1A 5HMDA 3RLGA 4MYXA 4NNCA 2PEVA 3GTHA 1ZFJA 5M1TA 1M65A 3PWGA 2VJXA 3PUDA 5JMUA 1REQB 1BTCA 1VPQA 5AHIA 3LI1A 3S3GA 1DOSA 1CXIA 1PSCA 1A5UA 2NUXA 4K39A 1LZOA 1GKPA 4DJDA 3FDGA 3IGUA 4FNPA 3UYCA 3OLIA 3PG6A 3EF6A 2GJLA 3SCNA 4C7DA 1WYIA 3N11A 3G6LA 1U1JA 1KFLA 4A3RA 1WZLA 1MDRA 5IDZA 1X8FA 3CXOA 2X09A 2ZKMX 5FF4A 4IPIA 3AI0A 1ZY9A 2J7HA 1XSKA 2NLIA 3M0YA 3TYAA 2YXXA 1E9LA 3NYDA 2OYKA 3A7RA 1NWTA 1QUMA 1V7AA 3ARVA 4W4QA 2GR3A 1M6JA 4DXXA 3NZQA 2OWXA 1XLHA 3QPZA 3B8VA 3RLHA 3HZ3A 3URNA 1BWVA 1I9CB 3VNJA 1TKKA 1H2IA 5DF0A 3OO2A 4O0KA 1DE6A 3VE9A 1J5SA 3HO8A 2BCPA 1EWDA 5AHEA 1XHCA 5GNZA 3BZGA 3ARWA 3UT0A 4DZIA 1TQJA 1U2YA 4RW3A 1LG1A 2F84A 4K3ZA 4XUYA 1D9EA 3N13A 2V5LA 3AXHA 2SFPA 5U7SA 3SRHA 3SR6B 5AECA 2OZ8A 2JQXA 3CL7A 3F4CA 1F3EA 4EKJA 4CCDA 4CGTA 2PA6A 1EA0A 1ADOA 1KRAC 4XKYB 3HU7A 3UJEA 1TJPA 4YS1A 3VNMA 3PZTA 3W6MA 3G1HA 2ACSA 1BKHA 4LBUA 4CVWA 2B0MA 4RXFA 3MO4A 2YYUA 5AB3A 3EEGA 2V3BA 3WNLA 3BGJA 1MRAA 1TJ1A 4NI3A 1GVIA 5GJNA 3KVMA 3LS9A 3POHA 3REQB 4OU1A 3VXGA 5GJMA 3T2PA 4F8XA 2Y7GA 1J6OA 3G1RA 2PLKA 1I45A 3RLUA 3W7QA 3PZGA 4GGHA 2YL6A 2QCCA 3GUGA 3UG3A 3MBFA 4O4WA 3FHQA 1W3KA 2B7NA 2I17A 3QGKC 4M24A 4UFLA 4H00A 1F8IA 2B4GA 1HGWA 3NDOA 3M5ZA 4TVCA 1UR9A 1S2WA 4DO4A 1H1YA 4NJJA 3FKRA 3WLKX 3P7YA 2FTYA 2VFFA 1NDWA 1YE4A 1WA3A 3KUMA 5LA0A 1UPPA 1N61C 4EMWA 1KNWA 1NTHA 1EB3A 4XO7A 2A3LA 3CO8A 4FNTA 4TX9A 4N0RA 4KWOA 4PMVA 3O16A 3UZYA 4J3ZA 5BROA 4M52A 4P7NA 3OOQA 3B4UA 3CLWA 1JCXA 3NAVA 1R86A 3SADA 2WJZA 3MSGA 3QY7A 1C93A 3W74A 2FQIA 4A8LA 2C0HA 4TQTA 3WDQA 3NZRA 4PULA 4XIMA 3W82A 5M17A 2X0HA 2W27A 2PPGA 5H6HA 1S2TA 4BV6A 1ZP4A 4TTUA 2VWSA 4W85A 4DQWA 3N12A 3DXIA 4EAYA 1Y5VA 4IMFA 1BFNA 4KF1A 4R9OA 4HNVA 1W8GA 2OZ3A 3FX4A 2QCFA 3RILA 2FPTA 3OIXA 2OG9A 3RPDA 3AXIA 1Q4WA 1P1MA 2KZHA 2OSYA 4GXWA 4JX4A 3CXBA 2PDFA 4E3VA 2FZBA 3FS2A 1XRVA 1YXCA 3W1AA 4JTCA 2VGIA 1NOUA 1AK5A 4EMIA 2EG6A 3H4WA 1GRAA 1TTQA 2PF0A 3DG6A 1LT7A 3ALGA 1SZRA 4R5EA 1SZFA 5C2CA 1Q6GA 2VEKA 1GESA 1NPXA 4DO5A 4IFKA 2AQVA 1NH6A 1VD6A 1G6CA 3AMKA 1AOGA 1QT1A 3G0SA 3LK6A 1KCXA 3BH4A 2CZVA 4NRRA 4PR4A 4EOUA 3FKKA 1KW1A 3RR1A 5LNVA 3L4VA 1BF2A 3LCFA 1H7WA 4YTRA 1UR2A 2QPSA 5HPCA 2DIEA 3DDMA 2FDMA 2CZEA 1E5NA 1XQKA 3DKJA 4FXRA 2IW0A 3NVVB 1LDCA 4LY4A 4HCDA 4L64A 1E4MM 4EM3A 2E09A 2KX9A 2WM0A 3H7VA 3Q2DA 1FTXA 2FJUB 5D32A 3W6LA 4PCFA 1L6GA 1DJYA 3ITVA 4P2VA 4BQ3A 5JXQA 1A4LA 4IMDA 5K2ZA 1NF7A 1D8WA 2R9RA 3DYOA 1CBGA 1XCFA 2ZZ6A 1P0BA 3I6TA 2YB4A 4PB3A 4M6UA 1F7BA 1R6WA 5CPTA 3MC5A 4MTVA 1TZ9A 4RK8A 4Z2GA 2PDPA 4HZ6A 3UXIA 4PMZA 4KKXA 3AALA 4GC4A 3U4FA 3TW7A 3EA2A 3HMCA 4RZ6A 1V0LA 3KE0A 4H19A 2RKXA 4L4PA 1X6UA 2Y8VA 4IGNA 2BZNA 3IPWA 2B81A 2INEA 2QMKA 4IISA 3E3HA 2GGHA 2GSJA 5CBIA 4GYPA 2A2IA 1NHQA 3R58A 1HL8A 5HNUA 5A3HA 1EC7A 1ONFA 4MFEA 3VKCA 3GDTA 3APTA 3VIJA 3FA4A 1JRPA 2J9YA 1IXPA 4Q4MA 1U5HA 2ABAA 3FVMA 1J5TA 4HMCA 3KFTA 4Z2KA 5H2ZA 3M6DA 4FOKA 3WX7A 3AMCA 5CCZA 1YDYA 2GSHA 3LTYA 3SW6A 2ABBA 4YVVA 1C92A 3N34A 4CNNA 2RGLA 3SCUA 3E0FA 2WC7A 2CXGA 4Z08A 3LHTA 3P62A 4K36A 5C70A 3IEBA 4C6QA 1GVEA 4MOZA 1BTMA 3QR1A 3QFBA 2FGLA 3H2CA 2YZ5A 1GOWA 4Q7NA 3RG6A 5C8BB 2E3TA 5G5GB 2NQ5A 2Z1BA 4C6PA 3ZYZA 3RDKA 4N7QA 2V3AA 3GBEA 3IGSA 2F9RA 4XAZA 3LGDA 3NQBA 5BRPA 3IGXA 2G3FA 3MI3A 2WPGA 3MJMA 4C65A 1U30A 1CXLA 2G37A 1PTAA 3U0HA 1A5LC 4UTUA 4GBDA 4E0CA 3GQYA 4NVTA 3N4AA 3EA3A 1F4AA 1BXBA 4O1DA 5FJTA 3C3UA 4AX7A 4A3YA 3KLKA 1WV2A 3ETRB 3TFXA 3TOPA 2GYIA 2YJQA 2W5FA 3FNDA 1FFQA 4WY0B 2ZTJA 3WUBA 3SN4A 1VFUA 3UVAA 1X38A 1G69A 4GQRA 2CLPA 4IMEA 1KFJA 4GY1A 1ZL1A 4DBWA 1XM3A 1U33A 1PB0A 4CQDA 5BOOA 4KRTA 5A6KA 1IT7A 2V0TA 3FHAA 1W1YA 2NX1A 3S8HA 3UF9A 2CHOA 3A22A 4NZ3A 3TYZA 1XLLA 2YIHA 4MWAC 2NT1A 3LRKA 2X0SA 3DHPA 4UZUA 3P3BA 1JI2A 2EJ1A 3AJXA 4YL2A 5GRTA 1MXGA 2PDCA 4GRSA 3DFYA 4FOJA 1L9WA 1CXFA 3AIRA 1WB0A 3C52A 3HPSA 1QVBA 3UY7A 2PZ0A 4AYGA 1Z6KA 1XIHA 4GUHA 2AKMA 4HGXA 3SECA 3BZJA 4NX0A 4I7WA 3WMBA 1PIIA 2Q3RA 1WP6A 2J7BA 3LLXA 3PNZA 4ZOBA 3MUAA 3AHYA 4JEQA 1MFUA 5TF0A 4TVYA 4TIMA 1GHRA 3PWIA 4IICA 1S2CA 3H4GA 3IANA 1H7XA 3BV7A 3O05A 4NAFA 1EBHA 4W5ZA 1DBTA 1V93A 2JK2A 4JAWA 1DHKA 3TW9A 4D6GA 4JN6A 3A4JA 4AD5A 5E70A 3FGCB 3VFLA 1GKQA 3LPPA 3ZOAA 2PTXA 2YDSA 3N15A 4PL2A 3R5EA 1XBYA 4KCUA 2Z26A 1V8EA 4FALA 2X1SA 4V27A 4UQDA 2D2HA 3SCRA 5G1MA 3SCPA 2DPEA 2ZX5A 3LMYA 4H7ZA 2WCAA 4J27A 3ZWTA 2H3BA 2EQ8A 2ZRVA 3VD7A 4W5UA 3G1SA 3GSMA 4EQXA 1G4TA 1M04A 4B5WA 2W63A 3TMQA 1DXFA 3TAKA 2PLMA 4S1FA 1ONXA 1K9TA 3GBDA 4DF1A 4MFDA 5ABTA 1FQ0A 3TV8A 4DO7A 3PBMA 4F79A 2PS2A 4PRWA 4Q7IA 3CT2A 1D2KA 1OYBA 5J5DA 5LIKX 1PIFA 4H4YA 1X7IA 4QFUA 2OOGA 2PTYA 4ZQCA 1PYMA 3U48A 3D6NA 3TLQA 1JCTA 1SFLA 1PDYA 4ADTA 1TVLA 1JUEA 3N9SA 5HJYA 1TCMA 4JTDA 4WD0A 1TMHA 4ACYA 1GYLA 3G77A 1JOAA 4AC7C 3QMRA 3FA3A 1UD4A 5HR7A 3R79A 4S3KA 3T1GA 3TJIA 4B4HA 4DPPA 3P0WA 1DTUA 3H7RA 3D9XA 4LUTA 3H6OA 5T91A 3BWWA 3CAVA 2F8QA 3C2FA 4TX6A 3JU2A 3RM4A 4CCCA 5JIWA 2BB0A 5FEZA 1UMYA 3SUVA 3NJ3A 2WMJA 5GNYA 4BJHA 4MZ1A 4I7UA 1OGGA 3GR8A 1FHDA 1HJXA 3H7UA 3B0VC 3UJ2A 5C9XA 5CBBA 3L5MA 5A8GA 1XL9A 3TXVA 4K8DA 2Y63A 3GWQA 1NHPA 3H4KA 2P50A 1FDZA 2DSKA 4BHYA 4CNPA 3GTFA 5HMSA 2WCSA 3UA3A 3T6CA 3CS2A 4F0SA 3W88A 5D9OA 4AEEA 2QCNA 2G5WA 2VC6A 3OBKA 2UV8G 4PTMA 3AYTA 3ITTA 3O07A 2WJDA 4Y9OA 1JFHA 1GNXA 1JD7A 3SJ3A 4QTGA 3R13A 4A05A 1PHWA 4A4AA 3SZ8A 3WDIA 4H9TA 1FCBA 4JDBA 4AEOA 3ERPA 5KTLA 1A0DA 4P61A 1IZCA 3MP4A 4Y8FA 3TVAA 4NSBA 5D2YA 2CYGA 3WCZA 3S1UA 3NZGA 4NXSA 1CIUA 1ZCCA 3MP5A 3B8UA 1B1YA 3G8RA 1B90A 4HPGA 3GUWA 3AXKA 5FL1A 4Q4KA 1QOPA 3GH5A 3TR9A 2HVMA 2ZVIA 5E09A 1CEOA 3C8NA 4LAMA 4GQGA 2Q02A 4D6HA 2EKGA 3ZT7A 4FLSA 5MF5A 4EXBA 3OVPA 1BQCA 4AXKA 1XDIA 1IZJA 3NURA 1W2PA 2PGFA 3TQKA 1UW9A 2R6OA 5FEWA 3I10A 1XYCA 3LCIA 1BRLB 3I6EA 4LF2A 4AD3A 1XLKA 1XLJA 1LWJA 1OZMA 5CJMA 2HROA 2QDGA 2BNJA 1RBOB 4ZENA 4C6MA 2YBTA 3EX3A 2WHKA 3W71A 5HR6A 4ZO8A 5C0QA 4FR6A 4LVFA 4BI7A 2V5KA 5JBEA 2HXTA 2ZYFA 2OLAA 1HO1A 4NT0A 1VAHA 1DWIM 1ZAJA 3O7UA 4IUGA 2CEQA 2VC9A 2AAQA 4IIEA 3GZ3A 1PZ1A 1W9UA 4BKNA 3TYDA 1KBJA 4GG9A 4QJ5B 4ZQPA 3BQ5A 2DEPA 4AMCA 5FESA 4H7VA 1N5XA 4X60A 2WMGA 8A3HA 4GNKB 3FYOA 3UR2A 4W87A 2QS8A 3AQUA 3SCVA 1Q7ZA 1J93A 2CESA 3SN1A 3R25A 1KBBA 3UG8A 1JRCA 3OHMB 1RA5A 3KRBA 1D7FA 1TJRA 3QM3A 3W2NA 3PZQA 3EX4A 4S38A 5CAHA 3DECA 2CU0A 3WBEA 2ZX8A 1VDVA 4OT7A 4AH7A 2Y88A 3E02A 4IXXA 1JNEA 2G4JA 3VO0A 3H2MA 3KOFA 1K03A 3ME3A 3NR0A 1TX0A 1GGOA 1GV4A 1QASA 4F40A 3M5YA 2GGEA 4EMJA 3C2RA 3ZT6A 3ZT5A 3LCHA 1Q3NA 4US6A 2GWNA 4WDWA 2WOIA 5FA5A 4O19A 1FH9A 1DWFM 3QRHA 1GSNA 3V16A 1N8FA 1FY6A 1LLOA 1NFBA 2AOSA 2W92A 2QGYA 1EUAA 3LY0A 3L2IA 3W1UA 1I60A 4ZE5A 5M3WA 1F3PA 3NVTA 4F9JA 4S3GA 3SY8A 2D2JA 3C0SA 3U5UA 2YL5A 1W31A 5E93A 3CPGA 3TKFA 1H4PA 1XJBA 5DANA 1RCQA 3EOOA 1XPYA 2NQ9A 3WL1A 2GLKA 3AUOA 3IAPA 3LZ5A 2Z0IA 1V3HA 1JNDA 4LC6A 4YTTA 4PTVA 3FYYA 4LCRA 3TWAA 3W4RA 1AD4A 3W7HA 3N25A 4NILA 4UBPC 3S1WA 1H41A 1WKEA 5I3DA 4ZQMA 2YL9A 3K8MA 5MKGA 1AJ0A 3UXKA 2E77A 2VI0A 5K4ZA 4KWUA 5DMMA 3M47A 4G6CA 4F48A 4PCTA 3GG7A 1SQ7A 1FDJA 3MUZ1 3PM6A 1TV8A 2H6RA 1O5QA 2X1UA 3P8JA 1X1OA 3GNXA 3BL3A 2YA0A 4UTKA 3S2NA 1GTEA 3W01A 1X1NA 4IQDA 1Q2RA 3KWSA 2WNZA 4U2YA 3QFAA 5EGRA 3DOPA 1WUEA 1EHAA 1WAWA 3SY5A 1UB3A 3MKCA 3UCQA 3AM9A 5U4NA 1IZKA 2I5GA 4OBSA 2JIEA 3LADA 3GXMA 1DXEA 1Q8JA 4ZBCA 3W2JA 4LS2A 4IL2A 1FXQA 3ARSA 3A23A 3QMTA 5AVNA 3ZJ7A 1GJWA 4GX9A 3IUDA 4RZBA 4CD4A 3DI0A 5DMLA 4S39A 3PSVA 1PWMA 3PJUA 3O6DA 2J7DA 3AMDA 4WZHA 5HNRA 4UFJA 4TMCA 4AZBA 3M0JA 4W7UA 1H0GA 1ADSA 1C90A 1HVXA 2C1HA 2OEMA 4H4IA 2VRQA 4IJCA 3MWAA 1VFTA 3TC6A 4LYRA 3HA1A 4RDYA 1S5MA 2RFGA 3A64A 2HS6A 1QWGA 1O1HA 5KZDA 5HQEA 5CPQA 1Z69A 4QE1A 4WDUA 3IGHX 3RU6A 1XIIA 4I9MA 1CTNA 5HULA 2XFYA 3PAOA 4WOZA 2OPJA 1B3XA 2ZA3A 1OFRA 3GTIA 3LB0A 9CGTA 1S5NA 1LL4A 2PTDA 4B90A 3DHDA 4NZJA 5FF3A 4GGBA 4NY2A 3HG3A 1Y0EA 2BBFA 3W24A 4IF2A 3CMJA 1T7LA 4IM4A 3OTRA 3UWWA 1I2RA 2QPUA 1TJ0A 3QQ1A 1MWOA 2BSLA 4RL3A 3H2OA 2OEJA 4O12A 5FCZA 4WJXA 1T0OA 1VS1A 1M7XA 4FXJA 4IL0A 1N55A 3SSZA 1LORA 3NXLA 2D2OA 1US0A 3V4BA 3BLDA 1N7KA 3NQ8A 1SO3A 5CC7A 2OGJA 2C13A 1YBQA 1XIFA 1V5XA 3EB2A 1J6PA 3Q94A 4AEFA 4XVEA 2P3EA 3TONA 5F2MA 4YTUA 4O50A 3E0LA 3GDRA 3VM7A 1XQLA 2PDGA 1E0TA 4AZCB 1EDGA 1Z48A 2DSWA 4U2ZA 1PCWA 2B7OA 2XIIA 3VGDA 3WEMA 3TUUA 1R7OA 5AFDA 2RABA 4UTJA 5HXMA 2VD9A 1NU5A 3AZRA 2HE8A 5BWFA 4EQRA 3DZ1A 1WKDA 4L4LA 2H8XA 2DJXA 3E2VA 1NEYA 4E8DA 5KINA 2CBJA 3OLGA 3ENLA 3DYPA 5KEZA 2CFYA 3BOXA 2PSNA 2QT3A 3AU2A 4ZEPA 2PDLA 3QW3A 1GKRA 5T9CE 4FB7A 5DXXA 4JNYA 1OEPA 4W86A 2ZZ4A 4ZB5A 1W1IE 4M8UA 1A5NC 3U2ZA 3BDKA 1D7KA 3BCDA 1ME7A 5BZAA 1YXYA 3NCOA 3L5OA 3KOZA 2EG7A 2CLFA 3WH8A 1EF3A 4W9TA 3MT1A 2CKRA 3WQ4A 4IZGA 3DHUA 1M3UA 3R12A 4Q8QA 1K70A 1I75A 4NAEB 3BAJA 5CGMA 3U2CA 3M0VA 3AMLA 2NT0A 3LBMA 3CB3A 2C79A 2TYSA 3DFSA 3M07A 5BU6A 2WAGA 2PDHA 2XSAA 1BEUA 4RZ5A 2C6QA 2J66A 4KPRA 4S3JA 4PZVA 3FEQA 4LWWA 2C91A 1KV5A 3UBPC 3NL2A 4J3UA 1UOKA 2V63A 3M0KA 1A4MA 2UY2A 6XIAA 3GH7A 1MEHA 4Y9PA 3SUTA 1VFSA 4HTYA 1TG7A 3ZVIA 3SCTA 3CBWA 1PTDA 5A5WA 2E6FA 5JCNA 3LXCA 4Z0SA 1FWHC 3URAA 1MFVA 1JROA 3TYBA 3LCLA 4Z2IA 5U1OA 1TV3A 2XVGA 1SFTA 2DIKA 1PJ9A 2WZHA 4F0MA 3V0TA 3KTSA 1NAL1 4B9YA 3IIXA 4UIOA 4GISA 3E9AA 3UJSA 1GOXA 2WC4A 1G4PA 1JR1A 3PR2A 2DT2A 3EANA 5U25A 3DX5A 4MADA 4TV6A 1V3LA 1BSLA 5JIPA 1UWRA 3BO9A 1TPC1 3ISIX 3T0CA 3HIJA 3N2BA 3HF3A 3MCOA 3TQVA 3IRDA 2BC0A 1QPQA 3EKZA 1XYBA 4BF5A 4LFYA 4AB4A 5F1VA 1NP0A 1V4YA 4HCLA 4WCJA 1Q6QA 4RPQA 3M0ZA 1V3KA 2J24A 3M7WA 5IFTA 2OZ0A 3MKVA 3ALFA 1Q6CA