3VFCA

Crystal structure of enolase msmeg_6132 (target efi-502282) from mycobacterium smegmatis str. mc2 155 complexed with tartrate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
424
structure length
417
Chain Sequence
b'SMAHNRIRITGARVTPVAFADPPLLNTVGVHQPYALRAVIQLDTDAGLTGLGETYADTVHLERLQAAAHAIVGRSVFSTNVIRALISDALGGDRAGMITSASVVDRVFSPFEVACLDVQGQVTGRPVSDLLGGAVRDAVPFSAYLFYKWAAHPGAEPDGWGAALDPDGIVAQARRMIDEYGFSAIKLKGGVFAPEEEMAAVEALRAAFPDHPLRLDPNAAWTPQTSVKVAAGLEGVLEYLEDPTPGLDGMAEVAAQAPMPLATNMCVVAFDQLPAAVAKNSVQVVLSDHHYWGGLQRSRLLAGICDTFGLGLSMHSNSHLGISLAAMVHLAAATPNLTYACDTHWPWRHEDVVAPGALNFCDGEVQVPATPGLGVEIDEDALAALHEQYLRCGIRDRDDTGYMRSIDPGFNASGPRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable glucarate dehydratase
publication title Crystal structure of enolase MSMEG_6132 from Mycobacterium smegmatis
rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Lyase
total genus 141
structure length 417
sequence length 424
ec nomenclature
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3vfcA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3vfcA01
3JW7A 1MNSA 3K1GA 3FXGA 2MUCA 3S47A 2OPJA 1NU5A 4G7FA 2PTYA 3VCCA 3SSZA 2ZADA 3TJ4A 3PWIA 2PTWA 3RR1A 3NFUA 4IZGA 3R25A 3N6JA 2OQHA 3THUA 4IP5A 1MDLA 4E8GA 2OVLA 2OG9A 3FVDA 3PFRA 4JN7A 4KWSA 1BKHA 4E4FA 3SQSA 2POZA 2GDQA 1E9IA 4HCLA 4MMWA 4Z1YA 3RO6A 3PK7A 1RVKA 2QDEA 4GISA 4ENLA 1KKRA 3GY1A 3SN0A 4FP1A 4M6UA 4G8TA 2GGJA 2QJMA 3DFHA 3OPSA 1EBGA 4IT1A 1EC7A 3GO2A 1XS2A 3TCSA 3RCYA 3UCDA 5EU9A 5FJPA 5FJUA 2OFJA 4ZA0A 3CXOA 2PMQA 3EKGA 7ENLA 3D47A 3DDMA 2PTXA 4KPLA 1SJBA 2XH7A 5FJRA 3CYJA 4HYRA 2NQLA 4GIRA 6ENLA 3V4BA 2GSHA 2HXUA 2XGZA 1P48A 2XH4A 2PU1A 3H12A 4ZCWA 4JN8A 3DG6A 4DN1A 5BOFA 2AKMA 3P3BA 3OW1A 1DTNA 1BQGA 2GGHA 1W6TA 4H19A 5ENLA 4DHGA 3TJIA 3FYYA 2QJNA 3CAWA 3TQPA 2DW6A 4KEMA 2AL2A 1SJDA 3UXKA 4HN8A 1EC9A 3ZVHB 5J04A 2O56A 4A35A 3T4WA 1WUFA 3GD6A 2HZGA 2OZ3A 3FV9A 3D46A 2PA6A 5BOEA 3NZGA 2AL1A 3MWCA 2PCEA 3VCNA 3IK4A 2OKTA 3VA8A 3BOXA 3N4EA 2PS2A 4FI4A 2OLAA 2XH2A 4DXKA 4H1ZA 2FYMA 1NELA 2PP3A 3CK5A 2GGIA 4H83A 4F4RA 3QKEA 3MKCA 2FKPA 3TOYA 1ONEA 2PSNA 3DIPA 3OZMA 3ZLGA 3IJQA 4MGGA 3CT2A 3DFYA 2OO6A 3U9IA 5FJTA 3P93A 2XH0A 3SN4A 5FJOA 4A3RA 4GFIA 4JHMA 3OP2A 4IP4A 2PODA 4MKSA 3DERA 4GGHA 4K1WA 3CB3A 3SBFA 2GGGA 3UXLA 1R6WA 3T6CA 1JPDX 2ONEA 3ENLA 3IJLA 4J3ZA 2P88A 4GYPA 3Q4DA 1R0MA 3NO1A 3JVAA 3UGVA 1L8PA 3QN3A 4H2HA 3JZUA 3UJ2A 4J1OA 4X2PA 1ELSA 3ZLHA 3MY9A 1OEPA 2PP1A 3BSMA 2P3ZA 1YEYA 3MQTA 3BJSA 2RDXA 4DWDA 3RITA 2AKZA 1TKKA 2P8BA 3KUMA 2AL2B 3ES7A 3DG7A 4A6GA 4E4UA 2OQYA 1JPMA 3V5CA 1SJCA 2OZ8A 4E5TA 3R0UA 2QJJA 2P0IA 2GGEA 3H7VA 4KT2A 3B97A 1KKOA 4EWJA 2MNRA 3DGBA 2GL5A 3U4FA 1FHUA 3SJNA 3Q45A 3I4KA 2QVHA 3P0WA 1MDRA 3QLDA 3UJEA 2PGEA 3FCPA 1TZZA 4YWSA 2PGWA 3V3WA 3DEQA 3H70A 3UCCA 3TWAA 4IL0A 4DYEA 3I6EA 1TE6A 1EC8A 2PP0A 1EBHA 1JDFA 3MUCA 3DG3A 3R0KA 2PPGA 3MSYA 4Z17A 1KD0A 3IJIA 1PDYA 3ZLFA 4HNCA 4HPNA 4HNLA 4E6MA 2XSXA 3UJFA 3TW9A 4DX3A 2OZTA 3TWBA 3H8AA 2QGYA 5IDZA 1ECQA 2P8CA 2HNEA 4M0XA 4GGBA 3TTEA 3EEZA 2DW7A 4HCDA 3ZVIA 4K2SA 1P43A 1WUEA 2HXTA 3STPA 2PU0A 3UJRA 3OZYA 3S5SA 1PDZA 4IL2A 3R11A 3ES8A 3VDGA 3UJSA 2ZC8A 4GMEA 4GYPC 3VC6A 4K8GA 1SJAA 2CHRA 2PTZA 3FJ4A 3V5FA 3DESA 3R1ZA 2QDDA 3VC5A 3N6HA 3T9PA 3RGTA 3QTPA 3PWGA 1MUCA 3R10A 3MZNA 2OX4A 3GC2A 3OTRA 3I6TA 1IYXA 1XPYA 1F9CA 4HCHA 3N4FA 3SN1A 4IHCA 1FHVA 3T8QA 1KCZA 3RRAA 3HPFA 1MRAA 3VFCA 1JCTA 3QPEA 2QQ6A 3NXLA 2I5QA 4ROPA 3ZVHA
chains in the Genus database with same CATH superfamily
3N2OA 2XDFA 3S47A 1V79A 4KIRA 5CSRA 4AYGA 2Q3OA 4L61A 3VCCA 4CU7A 3H21A 4DZIA 1FUYA 3ZM8A 2ZTKA 3T09A 4XIMA 3SCWA 4JY8A 3IWPA 3R25A 3BLFA 2HS8A 3DGZA 3EDEA 4IXXA 4M3PA 1SB3B 4GINA 3QKZA 3DZ1A 1Q3NA 3S42A 5TAOA 4H4PA 1V6WA 5G2WA 3PFRA 4FXRA 1KBJA 2QAEA 1VFUA 4HTBA 2WMGA 1W3TA 4ZO8A 1Y7VA 2L5HA 1N62C 4CNSA 5A3HA 2QNEA 1CIUA 4TTUA 1MQRA 2ZUUA 4PUDA 1EP3A 3T42A 4DJDD 1KLZA 2YGYA 3HMJG 4YWIA 2Z1SA 3OA3A 5C2CA 3LN3A 4TV5A 3AROA 4M29A 1D3HA 1JD7A 7PTDA 3ABOA 1KXVA 3BAYA 4GXPA 3WCZA 3DCPA 4IQJA 2G50A 2DUAA 2TRSA 1HP4A 1GOWA 2WPBA 4DNMA 3ARXA 4K38A 5F2IA 1TPVA 3VINA 3CXOA 3UW6A 3P67A 3WUEA 3WLLA 1XLJA 3DDMA 2PTXA 1ZJIA 4NG3A 3VMPA 4PULA 3D3AA 1B1YA 5HPCA 1N5WC 1W8SA 4HSOA 2PDMA 3KVJA 2XHYA 3S83A 2HXUA 3ZMRA 4TV6A 4TTGA 4AF0A 1GGOA 1NHRA 2E3ZA 1I9CB 3H2AA 4IXHA 2IKGA 1LVLA 2D24A 3WDQA 3F4NA 1Q4WA 1E6SM 1ZBVA 4RPQA 3G0UA 1K8XA 3GR8A 1OFQA 2VGGA 2X42A 4ZODA 4HNNA 5BXPA 1BQGA 2QCGA 2RUSA 4AY8A 1FWIC 1HJSA 1H49A 4OUIA 1ZTVA 2BXZA 3UERA 1EO7A 1FCVA 1WKFA 4PTNA 2YA0A 3LRMA 1H7RA 1GJWA 1WUFA 3QR0A 5HPOA 3HW2A 2I17A 5E9XA 2GVJA 1SFSA 2PA6A 3L4ZA 3QHNA 4JTGA 2ZUNA 3N3MA 4E2BA 4ATLA 1JAEA 2PCQA 4GH3A 4FNPA 4HPXA 3URAA 1L2QA 3OGSA 1R3QA 3G18A 5C7HA 2PAJA 2XH2A 1S5VA 5GJNA 5DF0A 1GZ1A 1HX0A 2H8XA 5HMFA 4ZTXA 3H4XA 2DT1A 1M6JA 1TA3B 3ZWSA 5B80A 3ABZA 5J5DA 1F8WA 1MWOA 4GZIA 3S5ZA 3DIPA 1PVNA 3AYVA 3ZLGA 1B57A 2JFEX 4GI4A 4DQWA 3SQLA 1E0WA 5LHFA 1GZJA 1O1ZA 3VIGA 3FLUA 3JZEA 3B9EA 4ZQPA 1FXPA 2NVDA 2RKXA 4IP4A 1RK6A 3DHUA 5IDIA 4Y9OA 2HCVA 3BK0A 1EP2A 2PDXA 3ONBA 3W7IA 3P62A 1X2HA 1Z42A 3APYA 2ZBTA 1J5TA 1PEZA 1IEWA 5ECVA 1W1VA 4M80A 3UWQA 3PM6A 3SSJA 4LEQA 3B05A 2EAWA 2YBUA 1FFUC 2NSXA 1V4YA 2C1GA 1GUVA 2YL9A 2F38A 2Z4GA 3UPWA 3AHYA 1MXGA 4ZFMA 1XC6A 1W5MA 3W85A 2WSKA 3FJNA 1H50A 3C2RA 1MW1A 3VGEA 2P3ZA 2WVSA 4DWSC 5C6MA 1H09A 1FQ0A 3CO8A 3WBWA 2WNWA 3M5ZA 4P8VA 3W3OA 8XIAA 3Q2DA 1SW7A 2OKOA 5EMLA 4CD7A 2QCNA 3GNRA 4R7WA 3QBUA 2PDLA 3KBMA 1VFSA 4UFKA 1BEUA 3KLKA 1DJZA 3QGKC 5HULA 4E5TA 4KEVA 2QJJA 1K9FA 2QCDB 1EIXA 1M5WA 3BW4A 2EPNA 4FOUA 4MWAB 3KBNA 4BURA 3I10A 3VIKA 4AVNA 2W91A 1LBFA 2V38A 1N60C 2DSKA 6XIAA 4WDUA 2WMJA 2VOTA 4CNNA 2NQJA 3QLDA 4V1XA 3H54A 1TZZA 3U7BA 4NU7A 4Q4MA 1ZMDA 1BRLA 2WM1A 4Y9AA 1HXJA 1FDJA 4PA8A 4QXIA 3DFOA 1DJHA 4BY3A 3RPTA 4G2DA 4OU1A 4YHEA 2EPHA 1WB0A 2P0OA 4JIPA 4IJBA 4MJ2A 1U1JA 3R0KA 4MFEA 1VDVA 1V51A 3GVGA 2NQ5A 4FLSA 2V8ZA 3F5JA 4KETA 2FTYA 1GQIA 2OMAA 1ONRA 1SZGA 2NVAA 4C6OA 2C16A 3UJFA 1CGWA 4A8IA 1XG4A 4KWOA 4IF2A 4H8VA 1DVJA 3EWCA 5F2GA 1MYRA 3WJYA 5LSMA 3O6CA 4FNQA 4TVDA 5FAJA 5U4NA 4K2SA 1TJ1A 1LROA 3F7JA 1WZKA 3WQCA 4BKNA 4QBXA 1JZ3A 2V0TA 3UJRA 1VH7A 3CQ0A 4ZB5A 5I5RA 1EXBA 1D8CA 4OTKA 1V3JA 4H9ZA 2ON3A 4B9ZA 2W5FA 5C5YA 5JRBA 2X8HA 3QGVA 1BZLA 3WQ4A 2BODX 3FYOA 3U48A 4B5NA 2ANUA 5AYZA 4HMDA 1HL9A 4D2JA 1E9ZB 1XIGA 3NNTA 1T99A 2ZXQA 2WVVA 3C5QA 2OX4A 1IYXA 2VJXA 1SZNA 4WY0F 1R85A 2X0YA 1XI3A 4G1KA 3M41A 1O68A 3PJXA 2GQ8A 1F3TA 3DJGX 1TSIA 2AGKA 2WJDA 3T1GA 1UIOA 4F9JA 2OT1A 1UOZA 2FZBA 1PJ9A 5D05A 3UZXA 3QPEA 1J9YA 5DXYA 3TYUA 3BMVA 1XHCA 2WQDA 1Q7QA 4Y9NA 1L6GA 2X2YA 3FXGA 5JIWA 4PUNA 1UB3A 1XYBA 1TTPA 3S3GA 3VM7A 3K13A 1NU5A 4R33A 1PPIA 4GWEA 4WKHA 1Y65A 3RN6A 1UWIA 1X2GA 2E9BA 3INPA 1MDLA 3GNXA 3UESA 1WA3A 3TXVA 3VVGA 3N9KA 4N4QA 1EGMA 2OVLA 4ZGYA 1IGSA 1E3ZA 2QIIA 2YVFA 4Q32A 1RR2A 3W87A 1H5YA 4JN7A 3HJZA 1G94A 4D72A 5B7YA 5LNUA 4DJDA 1RVKA 4JYEA 2FVMA 3A9BA 1EDGA 4GNJA 2O4MA 2J7FA 3OIHA 2G5WA 1TCMA 1VBUA 3LXDA 3UPBA 2ATSA 3MI2A 1WO2A 2PZNA 2VC5A 4NAFB 4CQBA 2Y5SA 5JMUA 5FJUA 5EYWA 3MSGA 3U57A 4BEUA 1NOUA 4ZA0A 1M03A 1JGMA 2CLHA 4NJKA 2EPLX 5EBUA 1SJBA 2XH7A 4HNTA 1QBBA 3PZUA 2VGFA 3FY1A 3FYPA 3VKAA 4A3HA 1MNZA 2D2JA 3WH8A 3MVTA 4DUOA 3T0CA 2IXUA 4CLMA 2GSHA 2ZXAA 3RR4A 4NJIA 3H2MA 2VDIA 1Q66A 3L5MA 4DO7A 1R38A 5HK4A 3BH4A 4IP7A 2V3DA 4HK7A 3UWEA 2WMKA 3G6MA 1QPOA 1N5XA 3MANA 1A5KC 2D2HA 3H2CA 2PB1A 4ERGA 2PLKA 4KS0A 3NYZA 2ZZ3A 3EAUA 1GTHA 1PZ2A 3NQ7A 4K3ZA 1EUNA 3TJXA 4IQDA 1W3KA 4DLMA 1JGIA 1K8YA 1RCOB 4CCEA 1T3QC 3D46A 3CIXA 5GJMA 4UFIA 4B92A 4KRUA 3TYDA 2V2CA 3MS8A 4MG4A 3EKLA 2FQIA 4NAEA 2ZVRA 1R9ZA 1GOOA 4O4VA 5D9NA 2QUVA 4LWWA 2PRHA 2HISA 5LHEA 4B9YA 3VD5A 4ADSA 1OM0A 2W3ZA 2GUUA 3A23A 3KL0A 3LTPA 2QXWA 3O05A 5HDRA 3WEZA 4UTTA 2B7OA 3GTHA 1DWGM 3QKEA 1GNXA 1Q8AA 1M68A 1GERA 1I0BA 4E38A 1KV8A 3IJQA 2YDRA 3USZA 2OXNA 2WHMA 5KZ6A 4E2VA 4L1XA 1PWLA 3G0SA 4L80A 2WXDM 4LBRA 2YB1A 2C3ZA 5G4EA 3FK4A 4Q8QA 1RA0A 4J3WA 4LUSA 2DIEA 1J79A 1R87A 3CUFA 1JPDX 4GJIA 3AICA 4KFPA 3W7QA 4ALDA 1NDAA 3NQAA 3C6CA 2OSWA 3TYAA 1GVSA 6ALDA 1GRAA 2VX7A 5EMYA 1TTJA 1R0MA 4Y9PA 3F03K 3P5YA 4EXAA 7XIMA 2PWHA 2NWRA 2WYSA 3JVAA 1WDPA 2DSVA 3LB8A 3UGVA 3QPYA 4I7VA 3LPPA 2VRQA 4J1OA 4W87A 3M7WA 3A7RA 3F4DA 4B3LA 4UQBA 3MY9A 2PP1A 4JFTA 3GYCA 3B0PA 1SM9A 4PUJA 4AG0A 2AKZA 1Q8JA 2DIJA 2PWUA 5AHMA 2EG7A 2F84A 2F9RA 4O8RA 2ZXDA 3NL5A 1OFBA 3HPSA 1H51A 2W61A 5I23A 4GBUA 4N9CA 1DXEA 2GGEA 3D0CA 3ARQA 3EKZA 4XV0A 5H6HA 4KCWA 4S1FA 4EWJA 3W37A 4FF7A 3GG1A 5D9MA 4EF8A 1UWAA 3R89A 1RJRA 4B5UA 3O0FA 1XG3A 1DNCA 2PBOA 3W7GA 1X6NA 3ZIZA 1JXKA 1I2QA 1SFJA 1RY0A 3FXYA 3CQIA 3CGDA 2HVOA 4KCVA 3F2CA 2G37A 4GVIA 3IV3A 4KGJA 4MY8A 3WQ5A 4HA1A 1EA0A 1OT1A 1BF6A 2FHFA 3GHUA 2PP0A 5EA9A 3MUCA 4KESA 2RGLA 3I3BA 3TQVA 1DJGA 4MOZA 4YMZA 3SQPA 2JQXA 2JGYA 5H8PA 4X63A 2Z2UA 3GR7A 2CZEA 3HV9A 3UNDA 1TFVA 2WPEA 2W27A 4HPNA 2Y61A 1VKFA 1XLMA 4U5IA 2PWEA 1PZ3A 3OYZA 3K2GA 1GREA 5LNRA 1DWJM 3RX2A 1VBHA 1AG1O 1Z7AA 4C6IA 2Z27A 2QGYA 4DAFA 1XC4A 4CD5A 3WQOA 4FXJA 3TC3A 3M9YA 3GTIA 4Q4OA 3P82A 3RLUA 3WO8A 3MZ2A 3TZNA 1Q6LA 1DJWA 3GWQA 4H7CA 4PRWA 5G5GB 2WSRA 1PZ0A 5DT5A 3WJSA 2O9RA 3KOWA 4ZQOA 1ZGDA 1TV5A 4HHLA 1S5TA 4CCDA 2YXXA 4K8GA 2CHRA 2Q01A 2ZUMA 1TR9A 1BHGA 1TQXA 4O8AA 5HANA 1EX1A 3PWGA 1T0OA 4H9MA 1RAKA 1P1XA 1XLFA 1Q85A 1FDYA 3KP0A 1J0IA 4Q6JA 2QVNA 5FJIA 1R7AA 2ZUVA 3W1LA 2Y8UA 3GBDA 4NX0A 1JIBA 4QTGA 4BS0A 1DHPA 1WKDA 4B2DD 4IJCA 1M7JA 3JW7A 3GNOA 5CSYA 3HGJA 3CAKA 2IKHA 5D2WA 2G0WA 1W37A 1H62A 5E6YA 2HQMA 3SCTA 5KVHA 4IP5A 4YYCA 4PTWA 3W4RA 2VWTA 1EHAA 1EQCA 4S3DA 4FXFA 1UP2A 4EP8C 3MMUA 4RZ6A 1E40A 3ECQA 3GQYA 4YS1A 1AL8A 3KCJA 1KQZA 2OYKA 3ALGA 1J0KA 3O6DA 2ODOA 3KOFA 4D6EA 1V8EA 1HNYA 5AC7A 2PD5A 5BXSA 3A13A 1YMYA 1EBGA 2NLIA 1TYGA 1T41A 4XAGA 2GQ3A 3L4TA 4P8XA 4W7WA 2QV4A 3RM4A 3GXNA 3EXRA 3VNIA 3PJUA 4EQSA 2JBMA 3VIMA 4DZ5A 4UZUA 5HR7A 2VEKA 2BVDA 3VZXA 1B31A 3U2OA 1VLIA 3A12A 7ENLA 5JQ9A 4LAKA 4LUYA 4XQ6A 1EEPA 2QUNA 3WLJA 4N9BA 1JZ8A 2PDGA 1UMYA 1LWIA 4AB4A 3B4UA 3WBYA 3OBEA 4WJ8A 6ENLA 3MCOA 4ZQMA 2PTDA 2Z25A 3DX5A 2XGZA 3QMRA 3OZPA 1QHZA 4QSHA 3GR4A 1XKYA 3DG6A 3NM1A 4H9TA 4P61A 3RHGA 2CITA 2CXEA 4HZ6A 2FH6A 4UXDA 3UZWA 4CGTA 2WPCA 4Q8MA 2W3SA 3VNJA 1RQBA 1IV8A 1VPYA 5EPDA 1N8WA 2OLHA 3AXXA 3MKKA 3AWOA 4Y90A 1W5QA 1RBLA 4FX6M 1EC9A 1E0TA 2ZE0A 1PZ1A 4FK9A 1ZDLA 3TK7A 1S2AA 4UTFA 1JCJA 3S1UA 4WKAA 2ZKMX 3C86A 3SCSA 2VX5A 3NUKA 1VP5A 4BQ2A 1C29A 1T7LA 1VLWA 3N11A 2Y7DA 2VD8A 4O4WA 1XFCA 1I2OA 3IK4A 3FA5A 3PHAA 3TIMA 1OQFA 3LHUA 3LTYA 4NL1A 4O16A 1H61A 4H1ZA 1F7BA 1Q7MA 1BXBA 5A2AA 5I3KA 3SZ8A 4DF1A 1WKEA 2QIWA 1KNWA 3PF3A 3UNTA 1OX6A 3VIHA 3PANA 3TN5A 3M07A 1UROA 2YVGA 1W1B1 4Y8EA 4Z0JA 3RX4A 3WBEA 3D6NA 4DIAA 1JF5A 5HQLA 2EF9A 3SW6A 3ITVA 4YL2A 1MMFA 1RUSA 3ENLA 1J96A 3LBCA 4JEJA 1MEWA 1XLLA 4MJMA 3VCRA 2WOVA 1RA5A 3Q37A 4EMWA 3APGA 1MZHA 3EMZA 1US2A 5ABFA 2GJPA 3M4HA 4CNPA 4X22A 4WF7A 4XBKA 1HGWA 1US0A 2BY0A 1NAL1 4AYSA 3KTXA 2QUTA 2C1IA 4FNTA 6REQB 6REQA 1OG6A 1P5BA 1RCQA 1UR9A 3UPMA 4HZ8A 1RP8A 4KPRA 4IX0A 3MSDA 2P8BA 4ERAA 4NHVA 3VOHA 1OF6A 1EOMA 1NARA 2P0IA 3NVYB 2VZSA 2EPOA 1FWNA 4LUTB 2NX9A 3MYPA 2V9DA 1FIQB 1RVGA 4JEQA 2FMOA 4ERIA 1DL3A 5I78A 1JEZA 4MVAA 2ALDA 3QYQA 3FHAA 3UJEA 3AI0A 2XFFA 3W7MA 2PGWA 3V3WA 4RE2A 2VWSA 4LBUA 4JTEA 3SUTA 3KE0A 1RBAA 1S39A 2V5CA 3HN3A 4AFYA 2VGBA 1K9DA 3JRKA 1DV7A 3ZFHA 3NQCA 3NGJA 1EBHA 3E2VA 3IVSA 2FZDA 4DI9A 3A3HA 3NA8A 2XIMA 3PAOA 3PVFA 4LAZA 1OCBA 4Q4SA 3AUOA 4NZCA 3UYCA 2QW5A 4H9UA 2V2HA 2JKEA 1LWHA 2BCPA 2XSXA 2ICSA 3SCVA 1TMHA 1X97A 3O6YX 1VAHA 4YPJA 3STEA 2D73A 4ZXLA 1DXLA 3RM9A 4J28A 1BWLA 3T78A 3FAWA 2ZIDA 4MAZA 1GTEA 3HTWA 2R14A 2V3EA 2ZZ2A 5T26A 1KR0A 3BE7A 3OZYA 2YW3A 4XD3A 4Q8TA 3EB3A 1GVFA 2IQ0A 3R11A 2IPWA 3VDGA 4B5WA 4H4QA 2F61A 4HA0A 2J7EA 7CGTA 3QEZA 2YCKX 3MP5A 1YPFA 2YOCA 1XGZA 4W8LA 2BTMA 1IIGA 3PJTA 4EANA 1V3KA 1NEYA 2FHCA 4DM2A 2DZTA 4XZHA 1CGUA 1ITQA 2Y62A 3AU2A 1VBRA 4CQDA 3OTRA 3ITCA 4OZOA 5ABEA 3GXDA 3GHTA 4OOUA 4B2DA 4DJEC 1SGJA 1VD6A 3IACA 5CJ5A 3LXCA 2WCGA 1D3CA 3ARWA 1VJZA 3GVRA 2V5KA 3GVQA 2ZE3A 5E93A 1ME8A 3F4WA 2BHUA 3QGAC 1NQ6A 3G2GA 3NXLA 1D9EA 2VMFA 1NDZA 4NQ1A 4FX9A 1KFEA 3GIQA 1P0BA 4MY9A 2CYGA 1GWJA 1W1IE 3CO4A 1UH3A 3GDTA 5C0QA 2OGYA 4O0QA 1GETA 3PP7A 4G6CA 2DZWA 1IZKA 1DEDA 3N6JA 4C60A 5E6ZA 3JU2A 3WELA 1SYTA 4QAWA 2HJPA 4PCTA 1CXIA 2GVLA 3AZSA 3L2IA 4HCLA 2CW6A 2Z1XA 5J5RA 4ENLA 2XZ9A 3GY1A 1TZ9A 1UH4A 3B8TA 3SUUA 1V77A 2DU2A 4QSFA 3VIOA 2DDXA 4HTYA 1XIJA 3NPXA 1EJWC 3OPSA 1TPH1 4KBXA 5BRBA 4EF9A 2Y1HA 4ORMA 3KOYA 1JL8A 5HNNA 3C0QA 3BZJA 5A95A 3UGRA 4B4HA 1GXFA 2V3BA 1PSCA 1TX2A 2PRLA 3R79A 2H9AA 1EOKA 3LBOA 2KX9A 3ABQA 2BOFX 2WSYA 3CL7A 5EMUA 4GQRA 3GFYA 2NX3A 3CASA 1UC4A 5A6LA 2ACUA 2YZ5A 1DWAM 3EX2A 2OOFA 2P53A 1VR6A 2A2IA 1XL9A 1PBGA 1V6VA 1JEHA 1OSEA 3MMDA 1QVBA 2QPUA 2OR2A 1N61C 2VFGA 3ZWTA 4NX5A 1Y0EA 5IBXC 1XRTA 3S0CA 3OBKA 5HWMA 3PY2A 1JCXA 2VELA 1ESWA 1UH2A 1V02E 1SFTA 2Y88A 5HQMA 3DGHA 3WF2A 3RPMA 4QS6A 2CFYA 4HYWA 2Z24A 3STFA 4P5UA 5EMKA 2QULA 3L5LA 2EQ9A 3MU7A 3QSTA 1W1YA 3FV9A 4UFJA 5PTDA 3CIWA 3VKCA 3KTCA 3KFTA 5DY2A 4O54A 3II4A 3G8RA 3BAIA 4EAYA 2WB5A 1JFXA 3C3NA 2RAGA 4D8LA 1B9ZA 4JNYA 4MWAC 2J47A 4KGLA 4R34A 1P4CA 2BHYA 1I6NA 3P7YA 5C2XA 2J25A 5IOBA 2Q71A 4I90A 1VFMA 2PP3A 3W1XA 3AJ7A 4INFA 3KOXA 1XDJA 4HHHA 4IPPA 3WQWA 1XSJA 3DFYA 3IAQA 5FJTA 4F48A 3GG8A 4QCEA 3DFPA 2BV9A 1V6YA 2GLKA 2I56A 1JZ4A 3WSUA 1PKNA 3MDUA 3LCIA 2PODA 2JF7A 1LZOA 1PTDA 2Q3RA 1GSNA 4X2RA 5CPSA 1R5YA 4X61A 2FHBA 3NG3A 3HFTA 1FOBA 5A2CA 3GHRA 5M5DA 3CL8A 1WBHA 5E5CA 5K4ZA 1O6IA 1XIBA 4PEKA 4D6IA 2Y0FA 3M5VA 3WMLA 2J74A 2BC0A 3Q6JA 3NQ2A 1DXIA 4C6PA 1V08A 3VM5A 1F73A 4DVOA 4CD6A 3BSMA 2DVXA 1AH4A 1YPIA 6TAAA 2W0UA 3TR2A 4LVGA 5I07A 2RDXA 3VFLA 5AHEA 3VX0A 1I1WA 1QNVA 2WWCA 3EWBX 2PDBA 1E6PA 4AD5A 5A2BA 1KGWA 3PUDA 1RK5A 4UQDA 3DG7A 4AD2A 2XVKA 3R0UA 2FMNA 3M0IA 3RMJA 2DJLA 1MEHA 1A5LC 1VCFA 4DBSA 3TU9A 1W9XA 1OCQA 1QTWA 1IT8A 4V28A 2XISA 3OO2A 3FCPA 4WSJA 5G4HC 1POKA 1PKYA 3DC8A 3TDFA 2QS8A 4K36A 2PDWA 1CW2A 2HWGA 5A6AA 4MPKA 1R3VA 4JR5A 1G1YA 1QK2A 4A8RA 5TIMA 3MUIA 3BO9A 2WSQA 1K3UA 5FMHA 1EWDA 1TVPA 3TQ0A 3BZGA 4CQ9A 4Q7BA 3N6QA 3G1YA 4KERA 5HJYA 4GY0A 1TYTA 4RZ5A 1XR2A 2QYGA 5HWJA 1HKVA 1YIXA 4M24A 1H2JA 1FWAC 4OWGA 3A7UA 2VQTA 3NO3A 4E6MA 1QRQA 3L68A 3HF3A 1IWPA 4IFKB 3FEMA 2EXOA 2VD9A 1X6UA 1WX0A 3TMQA 1W3NA 2P8CA 4KWUA 4HNOA 4N9DA 7TIMA 4R9OA 3BC9A 3EEZA 3BJFA 1THFD 5I6SA 1XIIA 4IIBA 4Z08A 3M0HA 3LA4A 4XBSA 2IPJA 1FHDA 4MYAA 3HB9A 1ZMCA 4FNUA 3RJXA 1GZGA 3WH9A 3KL3A 3C61A 3RYSA 4HP5A 1SZFA 3PPFA 1ZXIC 2ZC8A 4GMEA 4AZGA 4QEEA 5AFDA 4QCFA 2Z28A 4WXYA 2V69A 4I6KA 3TV8A 1BF2A 3QW4B 4OE7A 4LJ3A 4EMJA 3W70A 2FGBA 3M7SA 3TFCA 3RGTA 4M6VA 2V3AA 1UKSA 3NQMA 3N25A 4JKMA 5FI8A 5HBFA 1J6PA 3BWWA 1OGSA 1PWMA 4IUGA 4OIFA 3ARUA 2ZUSA 3OGVA 1REQA 3AZTA 4QDWA 1V0NA 3WLPA 4QLJA 4JX4A 1SO4A 2Y89A 1FY6A 4J3XA 4A8LA 3TZFA 4HBKA 1F3EA 1FWEC 1XX1A 5AN7A 1W9UA 2CIPA 1EA9C 1OD8A 2G4FA 3LCLA 4MSSA 1E0UA 1U22A 4C7DA 3T07A 4P7RA 1YPXA 3TCEA 4C90A 2PC8A 4O1EA 1NH6A 1AW2A 4ZOBA 1AOGA 3NQVA 1CGVA 3TQKA 1G4EA 4QJ5B 4N7QA 1V93A 2WBKA 3IGSA 3WDHA 3S6TA 4CCCA 1F8IA 1Q65A 3LNMA 2BXYA 2GVYA 3U5YA 4CNOA 4Z2KA 1K7XA 1JG9A 5AYYA 3SM0A 4F0RA 1IF2A 5I3GA 5H8UA 4IGNA 5CG0A 2NUYA 3WK3A 1NSJA 2WCSA 5CJMA 1VFFA 2ZZ7A 1HGYA 3E1F1 3T0AA 4M6UA 3TYBA 4O12A 2V2DA 4DBDA 3MYOA 4AWUA 3HURA 3W25A 4C6BA 2FPVA 4WIWA 3DECA 1UR4A 1VYSX 3LZ5A 3N2MA 4J9JA 3T40A 3TAOA 3EKGA 2FH8A 1Q6CA 3OZOA 3D47A 4IM4A 3TTQA 3REQB 3GBEA 3UR2A 1H0IA 1HKIA 1GKQA 3PUEA 2E6FA 5D9PA 3UZZA 4MHBA 1NWSA 1J0ZA 3VPLA 3D9XA 3V4BA 2FZMA 5IHSA 3H4KA 1VJIA 4MTVA 4ZQNA 2VO5A 4DN1A 1OJXA 1K7EA 1OC7A 3P3BA 3LCFA 3WLHA 1QW9A 3TYZA 3M0XA 1F2JA 3FDKA 4JTLA 3W02A 1QAPA 3IJ8A 1W6TA 4GUIA 4NZ5A 2NQHA 2FJKA 2QJNA 5K9DA 2PDFA 4IMAA 1KB3A 4S3GA 4M6QA 1NM9A 3M5YA 4GZ7A 3F2BA 2NV2A 4N6EA 1P0DA 7TAAA 3A4AA 4BWLC 2OODA 1B3XA 4RE3A 3PULA 4NVTA 5BOEA 1JDEA 2AL1A 3DJJA 1LRQA 1YX1A 4EAMA 1V0MA 4QJ1A 4ZTYA 1VCGA 2XVGA 5F2MA 1GW9A 2Z29A 3RF9A 3IJ9A 1YDOA 3I4EA 1JVNA 2BOGX 4C6KA 4DXKA 2CBIA 1QBAA 3VZZA 3U0HA 3W81A 5I00A 4GRTA 3VDAA 1CGTA 4H83A 3VZYA 4FALA 1HJWA 1L6WA 1A47A 3H23A 5C2GA 4KWWA 1EJUC 2XUCA 1KN0A 4MZ1A 3P93A 3E12A 1VQZA 4H4VA 2PDQA 2WC3A 2PDJA 4B4FA 4EK7A 1OJTA 3LPGA 3SIMA 1TYPA 1VPQA 1WDSA 3B8WA 1T8XA 3CLMA 1E9LA 4G7EB 4XB3A 2JKAA 5BW6A 5MKGB 1B4EA 2E5BA 2XPKA 5MKGA 1LLWA 4S3BA 4TVUA 4DWSB 3TUUA 3EWWA 1CLKA 5LZLA 3CZGA 1NP0A 4IPIA 1XRFA 4NJJA 2QCLA 4CD4A 3WDJA 1WOAA 3AIQA 3GXPA 4FOKA 2R91A 4JTRA 3GS6A 1WPCA 3MCMA 4C5YA 3C8NA 4YTSA 1HO4A 4KFOA 3N34A 3PTMA 4UCFA 3G1SA 1EH9A 2FVLA 5LIWX 4PMQA 3EDFA 2BBFA 1BQCA 4FIRA 5G1TA 3CMJA 1Y8BA 4GX9A 3R43A 1OIMA 2VURA 3PZQA 1PHQA 5C7VA 4H4IA 1CYGA 1OC6A 3H7VA 4H3DA 1XBYA 3BGAA 4DI8A 3A21A 3W9ZA 1T8QA 1Y5XA 2VNCA 3U4FA 2PWDA 5BRQA 5BYWA 1JDAA 1P0NA 1VQTA 3GZAA 2I7GA 3SRDA 4O28A 1WYGA 4RDZA 4REQB 4REQA 4YWSA 5BROA 1JI1A 3ARZA 3UWZA 1G67A 3LMZA 2PF0A 4DYEA 4LY4A 4Q8NA 5FF0A 4PSPA 4JD4A 3EZ4A 2CZVA 4IPNB 5ABTA 1UD3A 5D38A 1JDFA 2YA2A 2QUUA 1SVDA 3W23A 5M2FX 4QG6A 4Q8UA 1QO2A 2W62A 2WZMA 3BDKA 3KLLA 1H7WA 3ELFA 4N02A 3GW0A 4MLJA 3SIZA 1YDVA 1BVNP 4LGXA 1UD2A 5DX7A 1A0DA 4B16A 1F6PA 5AHFA 1TRDA 2EKGA 2ZA1A 1YDYA 3CT7A 5KZMA 1A5MC 1XW8A 3ARYA 1EJTC 1WE5A 2OZTA 3GUWA 3IARA 1GG0A 1GT8A 1QU4A 2DT0A 5C54A 4JFSA 3B9DA 4FLQA 2DW7A 2INEA 4GCXA 4IX2A 2VC7A 2W9MA 1TMLA 2PI6A 4FZIA 4EX4A 4LB3A 3CB8A 1D2KA 2DQWA 3IEBA 4PUMA 1DHKA 1FWDC 3UA3A 2R24A 2R8WA 3S5SA 3BJTA 2A1YA 3ARRA 3VC6A 3QRHA 1EFZA 1YADA 3E0WA 5XIAA 4ZBCA 1G4TA 1QPNA 3NVDA 3HQOA 3V5FA 5C9WA 2V5DA 3NQEA 2GK1A 5A6KA 2E25A 1CLXA 5E09A 3P0XA 4KCUA 4W84A 3I6TA 3SAZA 1AA1B 4X0VA 3CQJA 5L6UA 3ICJA 1W2PA 1KCZA 4AZHA 2VEPA 3SJ3A 2HE5A 3VFCA 2DZAA 1FO4A 1GYLA 3UG4A 2PBGA 3CV1A 4FEZA 3IJ7A 3NJ3A 1C8VA 1W1ZA 5FJJA 1X1ZA 1MNSA 4UBPC 3DI0A 4CU8A 4NNBA 3GX9A 3P61A 2PTYA 3WLOA 4UTMA 2XINA 3W1AA 4LC8A 4FDCB 1GOKA 1NOWA 1IT7A 3NFUA 5AYXA 2PZ0A 3H7RA 5LA0A 2WWDA 2X40A 4ZOHB 1XICA 1DJIA 4HT3A 4ILSA 1S1RA 3FVDA 1H7XA 1PTGA 4QITA 2VFHA 4PSRA 1H6VA 4U28A 5HXMA 3N3TA 3RO6A 2Y85A 5G1YA 2Z6IA 2QDEA 5REQB 2QDGA 1KKRA 1ME7A 4FP1A 3W7OA 5EMJA 1E51A 2GJRA 4L9ZA 1F3WA 2QJMA 3DFHA 2XWEA 1J2BA 4AAJA 3UR7A 5U25A 4M52A 2C79A 3AMGA 3LY0A 4WOQA 1YYAA 3MP3A 1TV7A 5FEPA 4Q4KA 1V7AA 6XIMA 1CCWB 3L9CA 1F4HA 5DMMA 4JFUA 1E4NA 3GB6A 2RFGA 4JKKA 1K8ZA 3THCA 1HL2A 2R1MA 2C15A 4CUCA 2PRMA 2VFFA 4ONVA 1IZJA 1V59A 1TELA 4PRRA 1N82A 1C93A 3A64A 4DUVA 3AIWA 1HKKA 2WMIA 1Q6OA 1OG0A 3HPXA 1XGDA 3VKBA 3H2OA 3ZT6A 3DHDA 1NPXA 4PMVA 3S2CA 5E0CA 3KM8A 1KRCC 3W7HA 1W54A 4FA3A 2GQ9A 3BLKA 1TWIA 3HG2A 1OIFA 1QCWA 3M47A 4NRSA 1E56A 1WDWA 4W5UA 5RUBA 1ZJHA 1K70A 1W3LA 1VFHA 3ANVA 4H00A 3W74A 4HN8A 3NRZB 3PAJA 1FDZA 4M8UA 4C6FA 1P6BA 3GD6A 3TONA 2OZ3A 5JU6A 1WXYA 2ZQ0A 5LIKX 3S6OA 4HYVA 3E3HA 1GRTA 3SGGA 3NIYA 2PCEA 3PBUA 4QRNA 3NS1B 2FZNA 1O5RA 2XU2A 4JXCA 4URIA 4DM1A 1EF3A 1R2TA 3RO8A 1LJYA 1GKRA 1RBOB 3NCOA 1GVEA 2PLJA 3KDOA 1RXOB 3ITTA 4CVUA 3CUGA 4PMUA 4RLIA 3EX1A 2RH9A 4M56A 1G01A 5A1AA 3L21A 5D2YA 3BCDA 3MKCA 3R6IA 3FKRA 3F5LA 4IUOA 2XWDA 3DYOA 4DZAA 4WHBA 5EFDA 4GO8A 3CT2A 3LCXA 3N2XA 1ENUA 3DENA 2OO6A 4NNCA 1W8GA 3EUB3 3SN4A 1HF6A 3U4AA 2HBVA 4RNIA 4GFIA 2ZFAA 3OG3A 1VYPX 1FTXA 5FCZA 4JTDA 2E09A 4Y96A 3LHYA 3UWUA 4O14A 4M81A 2WZHA 3MJMA 3PZIA 3Q4DA 1W3HA 2VP8A 3S1XA 2Y7FA 4W8AA 1RZMA 2Q09A 1XSKA 4YN5A 3U2CA 1E6ZA 3ANUA 3CTTA 5A8PA 1SFLA 3WUFA 1TPUA 2X1TA 5EY5A 1KM4A 1TVNA 3ZLHA 1YDNA 4NEVA 4B5VA 5HNRA 1YQZA 3LNPA 3CEPA 1YEYA 2D23A 5G5IA 1E1CA 2YB4A 4LS2A 3PR2A 2YBVA 4BI7A 1R47A 3ARTA 3B4YA 3M0KA 2D20A 3KCLA 1XDIA 2QCFA 5DMNA 5LNVA 1VFTA 4MY1A 5SWUA 3QW3A 1KCLA 3KBJA 1SJCA 2Z00A 4JYDA 3CUJA 3V35A 4H50A 5CLTA 4GVHA 3S1VA 2Z1VA 4CVWA 3M16A 3LG3A 3EA2A 4XIAA 1FHUA 4P7NA 2QVHA 3EANA 1VIZA 1LRTA 1XLGA 3W7EA 2Y8VA 4J27A 4UNKA 4E3VA 1MO9A 3H53A 4AVFA 1UD6A 3UCCA 1L9WA 3K8LA 1ZKQA 3AO0A 3QV6A 1FEAA 4DF2A 1RP9A 4U2YA 4K39A 4JDBA 4N0RA 4OV9A 1PHWA 4QG8A 2G97A 2JKPA 1IZCA 3ZO9A 1A3HA 3EDJA 2ZRYA 3MUXA 2FTWA 2X8CA 4EACA 1J5SA 4QIUA 2FDMA 3ZLFA 1UPPA 4O19A 1D8WA 4I5RA 4PB5A 3MV01 4LVFA 2YFNA 3O7UA 4AMCA 2IUZA 4CKQA 1HJQA 3WQEA 2O92A 4NASA 3DU0A 2HEJA 5HNTA 4DUWA 4TVWA 4EXBA 1P7TA 5LIXX 4GKTA 2HS6A 2R1NA 1E4MM 3BTNA 1IEVA 4CQ8A 3T55A 1CWYA 1CPUA 3H7UA 1U1UA 2YCEA 3GFZA 1RJQA 1WUEA 3FKKA 5E0FA 4Q4PA 4B91A 4IQEA 4O1DA 2VEIA 1Q2SA 2ZC1A 3QFAA 1E55A 3EF6A 1M6IA 1TPDA 1Q6DA 3NQ6A 4PYSA 1UA7A 2ATMA 4LNYA 3Q94A 3ZYZA 4XD4A 1R2SA 2GUBA 2SFPA 3UR8A 4U33A 3LTSA 3WLQA 1KFJA 3R10A 4DJED 2GQWA 3ITOA 3U6WA 4EM3A 4Z2HA 3CUXA 4FNRA 1MQQA 1XPYA 5CPNA 1JOAA 1EXPA 3BLDA 5JVLA 5C70A 4S3AA 4J2MA 1SR9A 2G3NA 3WUGA 4LS0A 3IS4A 3CU2A 3VD3A 1YBQB 2ZRUA 4LCSA 3GU2A 1PV8A 3BMWA 3B8UA 4QR6A 3GXFA 3ZVHA 3HGOA 4AIEA 2Q8ZA 4S2CA 2J66A 2J13A 2MUCA 3P5ZA 4Z1DA 2HVMA 1GEHA 1XXXA 3BPWA 2W63A 3KP1A 1O5QA 3IJDA 4WEVX 4AD1A 3ZQ9A 4BFAA 3FNDA 3MDWA 3NVVB 3CHDA 3W88A 2CKRA 1UUOA 4HU0A 1KQYA 1G9HA 1VPXA 2VDGA 5C9ZA 4JYFA 1OBAA 4JN6A 5CC6A 3CZKA 3ARVA 3LERA 3QV8A 4GCAA 5D04C 4H8NA 2EJ1A 3S2JA 2WJZA 4YHGA 1AW1A 2X8RA 2PDHA 1I60A 2BHZA 1VB9A 5EGRA 3RDKA 1ALDA 1R3WA 3UF9A 4LRTA 3THQA 1XINA 4ORIA 5D09A 3I7RA 4PL1A 2WKLA 2NQ9A 3RG6A 3HMCA 2A3AA 2HPMA 1LUCA 4B90A 3L8KA 4L64A 1XIDA 4NXKA 3NQ8A 2VL4A 5AYBA 3L2MA 1J0YA 3RAOA 3NZRA 1I0DA 3S6DA 1IEIA 3TN4A 4CEUC 1Q1WA 3NO5A 1V0LA 4GO9A 1LCOA 2ABBA 1JCMP 3WN6A 4F0SA 1J4EA 4K7VA 4H6QA 5D9OA 2BB0A 3S1GA 4JQ3A 1TE1A 1TUXA 2E4TA 4JFWA 5F4XA 3B9AA 1W9BM 4L4PA 3MHFA 3MVIA 3BQ6A 5CPQA 1P6WA 3CPGA 5CBIA 1GEUA 3NM3A 1BTCA 4WGHA 1W2VA 1IXNA 2RDTA 1UHVA 3GH7A 4ZCWA 3CS2A 3B9NA 3HPAA 3GH5A 3PTDA 2J6VA 4XG1A 3LYEA 4QQUA 4AVOA 5KZEA 2ZRXA 1SZRA 2LLEA 2J8FA 3CGTA 5T91A 4K37A 4JQ1A 4ZOEA 1HKMA 2NSOA 1OT2A 4QFUA 4O10A 4G56A 3KRSA 3GVVA 2ABAA 3PUGA 2Y5EA 1RV8A 4NF7A 4WY0A 3QQWA 4OOZA 2FFIA 2XSAA 3D3FA 3HJEA 1NDWA 1S2CA 1KO0A 4WK9A 3VI2A 4QDPA 4WSKA 2BVYA 2OWXA 4BQ3A 3WJXA 3KWSA 3W7KA 5KEZA 7A3HA 1J11A 3LSCA 4MWAD 4KRTA 1KFKA 1MXDA 3EXSA 3NZPA 4IIFA 2WJFA 2QZRA 2V82A 4GUGA 4CEXC 4XO6A 1GONA 1EKOA 1TJ0A 1ML1A 3ONCA 1Q45A 1XBZA 2DFAA 2QMJA 4MKVA 2PSNA 3U7VA 2ZZ6A 2WK2A 3FX4A 3WG6A 1EJ7L 1PUDA 5XINA 3U9IA 2WNZA 1A50A 4CCZA 2I1OA 1KFCA 4UTIA 1JNDA 3GXMA 3CTLA 1DTUA 3L0GA 3GDMA 3PZMA 4MKSA 4FO4A 5A5WA 1FH8A 2QCMA 2YYUA 1EPXA 5FACA 3DUGA 1OX4B 4DLFA 3IJLA 3SCRA 4JL2A 4LUJA 4GYPA 3EOSA 4D6CA 4PR4A 5CJNA 4AU0A 2JK2A 5FIPA 5XIMA 1E6XM 1G69A 2TAAA 1KTBA 3O2LA 5F4SA 5TR3A 1KXTA 1FCUA 4LU0A 1H5VA 1LTDA 4GHRA 1NFBA 3SCQA 2V6OA 1T40A 2YL5A 2E7FA 1CXKA 1AD1A 1UWRA 4XSMA 2HSAA 1XRVA 3PNZA 1KM0A 2QLYA 4TOQA 4ASTA 3KUMA 4LYQA 4E4UA 5I09A 2PGRA 3V5CA 3ALFA 1Q6FA 4L6DA 1ISXA 1LBMA 2Y2WA 3GK0A 1SPQA 5D33A 4Z2JA 1GJPA 3IGXA 2GSEA 5BRPA 2CHNA 3ZOAA 1UASA 2ISSA 4S2BA 2W54A 1G7VA 3TYCA 2Z1BA 4X9YA 1FA2A 1W3JA 4XSLA 2HROA 5I2UA 4X60A 3S9YA 5U7SA 3EEGA 3H2FA 3M0VA 5AHLA 3JUGA 2NZLA 3PG6A 4S3JA 1UR3M 4AH7A 2G3MA 1FVPA 4K8DA 4PH6A 1EP1A 2X7VA 4Q7NA 3MPGA 4B3KA 2B81A 3WQDA 3EB2A 4EKJA 4NI8A 1GG1A 2Y63A 1QNQA 3TTEA 2QJGA 5FL0A 3R2GA 1ZY8A 4U4MA 2BG5A 4X3ZA 1HJUA 4R7OA 4EM4A 3ITGA 2O55A 2GOKA 3H2EA 1K03A 3FN9A 3ES8A 4PCSA 4ML9A 1RALA 4LUIA 3N2BA 3NSNA 1GQLA 1YNQA 2UY3A 1H60A 2Q8LA 1H1NA 1JXJA 1JQXA 3FJ4A 4DJEA 2BDQA 5D2TA 5A8GA 1FWRA 3WH6A 2C71A 3B9JB 4ZO9A 3U3HA 1N7KA 1SU5A 2C0HA 1FWBC 5FL1A 3LHZA 5G2HA 1DJQA 2VRKA 5FKYA 4W5ZA 1XLKA 1M1BA 3N4FA 3ORWA 4DXXA 3CMGA 3ITLA 2ZDSA 5CBBA 3E0VA 1QR7A 9RUBA 3A4XA 4V1YA 5CXPA 2BWGA 2O9PA 5I77A 4HU4A 2GR1A 3KAOA 2JEPA 1WDQA 3UT0A 2BMBA 3NZQA 4G7FA 4ZE5A 4AUBA 2A0NA 3TJ4A 3W7CA 1DJXA 2CERA 4A22A 3QF0A 1Q6RA 3HM7A 1UJQA 4GI9A 4RNFA 2VC6A 3EWXA 4F9DA 2X1IA 3VX1A 5C9UA 3A4JA 3L4YA 2EQDA 1R9XA 3VE7A 3ERPA 1YNPA 3MJYA 4JTKA 4AC7C 3NAVA 1KRAC 4Z1YA 3HPZA 1OZQA 2X1UA 3PK7A 2A7NA 1TA3A 5T9BG 5HAOA 3W7DA 1E70M 2FFCA 1E6RA 4G8TA 3C2FA 4AC1X 3SADA 3BICA 3M0ZA 4FIQA 1HT6A 1GV4A 4JGDA 3DFSA 5FS9A 1KM1A 3KRBA 1GRGA 1N55A 1FWTA 4J3VA 1ZHAA 5EL1A 5IFTA 3LK6A 2DQXA 1ZX9A 3B8IA 3L4WA 1R86A 3VOJA 3S8HA 1I2NA 3W71A 1UMLA 2DZBA 2PUZA 2PDKA 1ZBCA 1LQ0A 4XZWA 4WDXA 5IBXA 2ASHA 2HRWA 4DYJA 4IPLA 5I3IA 2DORA 2WAGA 4RR4A 2VC9A 3H12A 1XYFA 1FP8A 4LSBA 5CLWA 1FKXA 1EIBA 2CC0A 2J77A 3K5XA 5DT7A 4EQWA 2P5NA 3IIZA 2XVPA 4GI8A 1EJSC 4QNWA 2VENA 3KDNA 3KVKA 3S2NA 3QM3A 4E0CA 1WZAA 4MWAE 1HP5A 2QCDA 1W5PA 4MWAA 2HNHA 4PE8A 2E40A 2JALA 1KFBA 1A5NC 2VRJA 2OWWA 3MWCA 4MB4A 2QT3A 2WHJA 1BWKA 3IRSA 5FAGA 3WDRA 4LXFA 3UA4A 4C7FA 1TPFA 2YJQA 2XGBA 4GUJA 3S1WA 2PS2A 1CXEA 4PZVA 4XKYB 4XKYA 4YU1A 1ZQ5A 2IS7A 3VNZA 2REQB 3N9SA 4JTJA 2ZZCA 1B90A 2CESA 2GGIA 5CQ1A 3T8LA 2ZCGA 4F4RA 2RDWA 3P8IA 2VEGA 4KFNA 4YVXA 4E2DA 1PYFA 3QFEA 2WM0A 4QE4A 4PCFA 4PMYA 3EMCA 3O63A 4GOAA 4UQ9A 1ZENA 2YSWA 3T81A 4C6QA 3W1PA 2ZX8A 5CAKA 1YTEA 1U2YA 3NPUA 4I5UA 4CU6A 3LOTA 3M0JA 3KOZA 4GJ1A 1VHNA 3K4AA 3MMTA 1R9YA 1XWYA 1RD6A 2ONEA 2Z2BA 4P8WA 4GX8A 2NXIA 2G4JA 3HOJA 5DANA 4L5ZA 4H4TA 3M1ZA 3C2YA 4I8YA 4UTUA 1XDLA 4NJHA 3W2KA 3QN3A 1FECA 3BQ5A 4D8ZA 3T2PA 2E1WA 4OFCA 4N6FA 3PBWA 1XD1A 5I3HA 2YIHA 4JZ5A 3QHOA 3RITA 1V0KA 4A3YA 2VFDA 5B7ZA 3WQPA 5KZDA 4CQCA 2WC7A 5EMMA 3AZRA 2CWXA 4H8HA 4LNCA 2IPFA 2AL2B 4EQRA 2OQYA 3R5EA 1C8YA 2GSJA 4KQNA 4H04A 1AUSL 2PDCA 3IGUA 4I8DA 4KT2A 3VYLA 3O06A 2WBAA 3B97A 2MNRA 3LGEA 4ICMA 3QY8A 1ZY9A 2ISVA 1ISZA 4J35A 3A7AA 5LA1A 1A80A 4UFHA 2YW4A 3UR5A 1BWCA 1F61A 2DUXA 1E0VA 1ICSA 2CETA 2ZWYA 2GUYA 3CWOX 1XLEA 1DQXA 4HN4A 1TV2A 3DEQA 3CYVA 4NJGA 3LI0A 4HQVA 1FWWA 1PIFA 3DFNA 1NHQA 3DN5A 1S5WA 1P0EA 3I6EA 1G0CA 4GFSA 2NXHA 1HW6A 1F6YA 1F74A 3GNPA 3I7SA 2G8ZA 3B3DA 3DOPA 3PSVA 3MSYA 4BI5A 4Z17A 2ISWA 2QF8A 1BGGA 1F05A 3EA3A 4JQ2A 1KLYA 3DFQA 4OGZA 1DJNA 4C65A 4GR1A 5CSSA 4WUIA 4IMCA 3CAQA 4X9SA 1BSLA 1WDRA 1DIKA 4DB7A 3G1DA 3RU8X 1AL7A 5C71A 5D03A 3RLHA 1IXOA 4YTUA 1VJSA 2YXOA 1QHOA 4GPNA 4NAFA 1UIPA 2YX0A 4WCJA 3AU6A 1X8FA 4BF5A 2NUXA 3UJSA 3MBFA 4LALA 1OCJA 1WXJA 4WKFA 3SCNA 4MNMA 4QS5A 1GVRA 3KX6A 3E9AA 3KHDA 2I9EA 2INFA 3GTNA 3QTPA 1J2WA 1W1PA 5DEZA 1Z89A 3H55A 2WKGA 3C4UA 4F0HA 1PKLA 3GSMA 3CH9A 3E2QA 3GHSA 3VO0A 4L7ZA 4HCHA 4ZO7A 3MCNA 3N2TA 3UY8A 5CKSA 2J62A 3OHIA 1UQYA 2J24A 4MF4A 1C90A 4HMCA 2TPSA 1H3GA 3HU7A 3T4CA 1OFPA 3UXDA 5I24A 4EIVA 4MM1A 1HUVA 1U1HA 1XFBA 4XTIA 4C6CA 3URNA 3B8DA 2G95A 2ZADA 4PUUA 4H6EA 3UCQA 1LQ2A 1DWIM 2GVGA 4O1AA 2YFOA 4D6DA 1OGGA 4D1IA 3N29A 4U10A 4MNKA 4A8NA 4PTVA 5KMYA 1QWGA 3PJWA 1ZZMA 3EPOA 1B2YA 1N2VA 3BG3A 3IUHA 4DO5A 1EJVC 1UR0A 3UU0A 4S3FA 2ZX7A 3NL3A 5EFFA 4WD0A 3W84A 3SCOA 5T8GA 5KINA 3B40A 1LBLA 1KWKA 1JUBA 1JD9A 2QPXA 3W7LA 1EPVA 2EG8A 4PTDA 1M7PA 6PTDA 1K9EA 3DC0A 2WHKA 5EU9A 1L8NA 2NLYA 2GR0A 3AHVA 1XISA 3A3WA 3PFMA 1Y5VA 5DXXA 1SO6A 2EJAA 3AIUA 4DRSA 4ZMGA 4QLLA 4CNUA 4KPLA 4LYKA 2BZNA 2DEPA 5I03A 1E73M 1FXQA 1JRPA 4PMDA 1FX6A 2XIBA 1XYZA 4KWVA 3NQGA 4XO7A 3ANYA 2WPGA 2WOIA 2XH4A 3GAYA 4HSNA 1FP9A 5BOFA 2H3DA 1AMKA 3H2NA 1BXNA 3FEQA 1HKJA 4NRRA 1U5VA 3OW1A 2YDQA 2AQOA 4FPSA 3VOIA 8CGTA 4LPCA 3M43A 3M6DA 3TQPA 2XN1A 3MUY1 3B04A 1N8FA 3CQKA 3R8RA 5J04A 4FX8A 3BL3A 4S3EA 2O56A 3T4WA 2F2KA 5T9CE 2TYSA 5AC6A 5K2ZA 1IR2A 5CEWA 2VZUA 1P0KA 2D0FA 3V0SA 4ZOCA 1J8VA 1LPFA 2OKTA 3QFBA 3OYXA 3PB0A 1WYIA 1FRBA 4APNA 1R7OA 1FH7A 1PKMA 1UD5A 1CXLA 1K7FA 4FI4A 1KCKA 1XYAA 3ZT7A 3AIVA 1BYAA 2G96A 4JTAA 4AQLA 1ADSA 1KBBA 4JCMA 4J5NA 2QGHA 4HHMA 1NELA 3PG8A 1CDGA 1M41A 5JBDA 3BOFA 4H01A 3ZSTA 2E9MA 1AVAA 1KGXA 2ACQA 1K1DA 3SB0A 3VD7A 2V5JA 3MB9A 3WLIA 4JHMA 1ZCCA 3PSWA 1PE1A 4GGHA 4K1WA 1KRBC 3DHPA 1R8LA 1B3WA 3AN1A 4V15A 3GRIA 5DBTA 5BXTA 5GNZA 1QW7A 4YVPA 3RFAA 1RCXB 2PDYA 3P8JA 5DRIA 2V81A 2C13A 3CHVA 5CPTA 3HGSA 4TX9A 1I75A 3NOYA 3CPUA 2WMFA 2FJUB 3EDKA 3UJ2A 3VMNA 1DXFA 3QTGA 1IT0A 4K8HA 4O50A 2EO7A 3FIGA 3FHQA 3W7PA 4WR3A 1L6YA 1B0IA 3BAKA 4ES4A 4AY1A 4W86A 5D37A 2YCLB 1NFPA 4YWOA 3NL2A 1TZ7A 2V30A 4EWND 1ZUAX 1CXHA 1TIWA 4GXMA 4RPPA 1LF1A 3NPWA 1A5AA 5A6TC 1DORA 4HJFA 5LKYA 5D30A 2QPSA 3W00A 3UD6A 1SQ7A 2AGTA 1K02A 4DBEA 5GRTA 3Q45A 1AODA 4P7LA 2D22A 1UP3A 2BGSA 5K9CA 1E6NA 3CV2A 4MB1A 2ZYFA 4O15A 2VHLA 3W7JA 1Q6QA 2W4XA 4PBGA 1EO5A 3E0LA 3O0HA 2VR5A 3AYTA 2UZ9A 3FAXA 1BGAA 4W8BA 1UC5A 1HL8A 3CL6A 2YDSA 2DPEA 3G1FA 1DE5A 1I8JA 1FWCC 1BD0A 3IJIA 1PDYA 2WBGA 1GRBA 4ADTA 1UKOA 3O3RA 3MV11 4HNLA 5GNXA 3WL0A 4UOZA 2VTFA 4I7UA 2A6LA 2VFIA 3W2LA 1QI5A 3O0KA 4GQQA 2O4QA 1AJZA 4O52A 4HNUA 2RJGA 4HA4A 2VX4A 3ZVIA 1BYBA 3NYDA 3S9IA 3IANA 4Z1BA 1P43A 1U33A 4DBWA 4JTUA 3TNOA 1PDZA 3LLFA 4C1NB 5AC5A 2IKJA 3KVMA 3UXIA 3G22A 1GESA 2WANA 2AAMA 1R3SA 1RQHA 3EOOA 2FPYA 2ZOXA 3N6HA 2UV8G 1AZ1A 1F07A 3DXIA 3CWHA 2X05A 3N04A 2OT0A 4XUYA 4V27A 3VIIA 1YKWA 3TJLA 2W3RA 3ZR4A 2EHHA 2WV8A 1Q63A 4J3TA 3SN1A 4XZIA 1OFOA 4Q4QA 4ATDA 1V6TA 3QV9A 2F6KA 2FB2A 4A3UA 4W7UA 6CGTA 4AZ6A 3GRSA 5MF5A 1JZ6A 4A3QA 3LADA 1TWZA 1Z3NA 4C6EA 1MRQA 3PTQA 3W83A 3AIRA 4MFDA 1WNOA 1TUFA 3ZJKA 2XIOA 3KZSA 3M64A 2JIWA 4Y8FA 1H41A 2ZZ5A 2C3DA 3KEHA 4RDWA 5DCBA 1G4SA 1Z32X 5LIUX 4UQEA 4AHQA 5JBFA 2BS9A 5I02A 4IG2B 4NUWA 4FX7A 3UYIA 2W67A 2C6QA 4ADUA 2HV5A 1S5MA 5FF2A 1QDSA 3FGCB 4B5XA 4GISA 4M1RA 2X7WA 5FF7A 1SMDA 2J4GA 3T08A 3EWZA 4R85A 4BZYA 2IMRA 4DPPA 3R94A 4R3UA 3V18A 1ZCOA 1EC7A 3I65A 3W7NA 3GO2A 3N13A 3SY1A 3TCSA 1UJPA 5HMSA 3SY5A 2A3BA 4FF5A 4JTQA 2O9OA 6A3HA 1PXGA 1MW2A 3QV7A 3GFXA 2ZXBA 3RCYA 3PBVA 4AISA 1L6FA 1LOQA 2CXGA 2UBPC 1ONWA 1VBJA 2X16A 1H0GA 2VXNA 1MSSA 1PX4A 2OO0A 2E8ZA 3U2ZA 3TVAA 1XCWA 4FNSA 3QXBA 4A2RA 5ABGA 3KL5A 3KLJA 1LL7A 3XIMA 1KM5A 2AAAA 1UWTA 1EWEA 2OJPA 3WEMA 1KTCA 1K8CA 1GYMA 1MFVA 2WOWA 4JDRA 4NI3A 4GYJA 3AXKA 4BJHA 1OY0A 1XIMA 4QLKA 4FR1A 3EDDA 4QG9A 2J75A 3KRZA 1BFNA 5ENLA 2WP6A 4LAOA 5M17A 4K8EA 2DW6A 2DZXA 1OB0A 3RPDA 1BWVA 4WOZA 5BU6A 3SR6B 1XF0A 5LNSA 3AM9A 3QPZA 4PBFA 2C14A 4I9JA 1XIEA 3EWYA 2HZGA 3GM8A 1JYVA 4LUTA 3AXMA 4H4SA 4I9TA 2X0SA 2WKJA 1WQ5A 3WZ0E 3WMCA 1HJVA 4N9EA 4JTHA 1VRXA 3BOXA 1F3XA 2J9XA 3SO7A 3N4EA 4KRZA 1DIEA 4PMOA 1EQPA 3MMWA 4RE4A 3W6LA 1EZ2A 1W56A 1A53A 1Z9AA 3C3UA 3AWNA 4F0MA 3DK9A 2DZSA 4YCPA 1X1NA 4UIOA 3APTA 3P60A 1Z8AA 3BUVA 2FGZA 1BXCA 2GQAA 2HK0A 4IFOA 3TTOA 5A94A 1OYCA 3SGZA 4QE5A 3UETA 4UOJA 3IPWA 2WZTA 1Q6GA 4HA3A 1TG7A 1QFEA 4WZHA 1UUQA 1YE6A 5HNUA 4PL2A 3MHGA 1R6WA 2JIEA 1LP6A 3RLVA 2QHAA 3IK2A 1STZA 4W7VA 5LIYX 4PMXA 3CV7A 4UWMA 2BX7A 3KS5A 3IC9A 2Q02A 3BSGA 3PBGA 4Z2IA 4L4MA 3R07C 3JZUA 3URBA 1C8QA 4AF0B 3GH4A 5A8MA 1LG1A 3PBYA 1QJWA 1X98A 2A4AA 4ZE4A 5A8NA 1DJYA 1X39A 1JPKA 4M6PA 4XZMX 2FB3A 1RPXA 5BXRA 3QVQA 3E74A 1XLHA 2X1RA 5IM51 3HQNA 1ODZA 4XUGA 2E6DA 3TTSA 3ABSA 5TBOA 1JUKA 4RXGA 1R30A 2HVNA 5IFPA 3V1PA 1Z41A 1NWRA 1ISYA 1LDCA 1RHCA 3POCA 4Q22A 4YCOA 1KXHA 4PTMA 3FJLA 1POJA 1SW0A 1Z69A 3POHA 2W6RA 3W73A 2CZFA 2EPMX 1BVZA 3QY6A 3IIVA 5JCKA 3ETRB 2EG6A 2CZDA 4KEZA 2YA1A 1ZJAA 4GZJA 5D8ZA 2CBJA 1KW1A 3H70A 4XAZA 4RDVA 1FWFC 4DBUA 4Q7IA 2DH2A 5I3FA 4MAVA 1SMAA 3R4IA 2A8XA 2B31A 4U2ZA 3VKDA 1UW9A 1AK5A 2NX1A 1TE6A 3C2OA 3V75A 4L1GA 1KM6A 1HO1A 1KV5A 3BVJA 2CDUA 3DAQA 1GOXA 1B3ZA 3WNLA 4RW3A 1UYQA 3OQEA 4Y6GA 2P10A 3FW6A 2NVKX 3T44A 4PGLA 1UQZA 1NP2A 1VEPA 4DO6A 2DGAA 1JZ2A 5EKYA 1AMYA 3VNKA 1O7AA 1V7YA 1SSGA 3NVZB 5KTLA 3ME3A 1PS9A 1ECQA 5DO8A 3AYRA 3I3EA 4BF9A 3M0LA 2C19A 3L12A 3CHCA 3B0UX 3W38A 2VVSA 4YTQA 5E1QA 4YXGA 1M65A 3CUIA 2PU0A 3VOCA 5BWAA 2RGMA 3LQLA 4HOWA 4EQXA 3H4GA 4H7VA 5BMWA 2NVCA 3WY1A 4FOJA 4JL1A 2C0AA 1XV8A 3BW2A 3V36A 4RV3A 3VIFA 4JTSA 2QDDA 1RM6B 2CLFA 4UC5A 3VC5A 1PX3A 4UQCA 1TTQA 1K6WA 2O0TA 5CZJA 3UZJA 5JBEA 1XRSA 2J7HA 1X38A 3NZ1A 2PWVA 3CPRA 2GYIA 1B9BA 2E5DA 4E2OA 2D0GA 3AXIA 3HV8A 4HIBA 3RRAA 3WDIA 1V03A 2QJHA 1HVQA 5TF0A 5DN1A 3WNNA 3UEQA 3AHXA 1V02A 3PB2A 3TLQA 2FZ9A 4LX4A 2GPTA 3AS3A 5EBKA 2H90A 4ZO6A 4UTKA 1SUXA 1BRLB 3ZZ1A 1Z44A 4IIGA 1GVQA 3SSZA 4JIQA 5JCMA 2XFYA 3N17A 1EUAA 1FKWA 2PTWA 4ZEPA 3MO7A 2O7QA 5BOOA 1MW3A 2XGIA 5CBJA 3NSXA 5FF4A 3BLLA 1B4KA 3SQMA 3NTYA 2TSYA 3QOMA 1EB3A 3DH7A 4HJWA 2DH3A 1OYBA 2OG9A 1JFHA 2E6YA 4M7SA 1BKHA 3NGFA 3GUGA 3QQ1A 3V0UA 2GDQA 3OODA 1DE6A 5HR6A 3QH2A 4YYFA 3PS7A 3CUZA 2J3NA 3EBVA 1ONFA 3LD5A 1PTAA 2FVKA 1W1TA 1PYMA 3AYSA 2GFTA 3MI3A 2A5HA 1O5XA 3UVAA 2C91A 4Y7EA 3WX7A 1ZLPA 4AXKA 1GQJA 4C6JA 1SZEA 2I5GA 1OK6A 2O9TA 2J8GA 1AQHA 2IQTA 3II1A 1VF8A 2PMQA 3WQFA 4QGCA 2CU0A 4QEHA 3WL1A 1K77A 4J2PA 3HQPA 1A4LA 2NQLA 4HYRA 3TC6A 4H6KA 1X96A 2XYLA 3AISA 4IH3A 1VEOA 2Y5JA 4US6A 3IVUA 2A3CA 4DWSD 4FB7A 1IXPA 3GE7A 3L7RA 5F2LA 1J6OA 2E77A 1GPWA 3WJWA 4JN8A 2WVVB 3NL6A 4UUIA 3SFKA 3S5OA 3W2MA 3NXFA 4MNJA 4UZSA 2ISDA 1LL4A 3VXGA 3W24A 4ICNA 1CNVA 4RZ4A 3W1NA 3VIPA 4AIBA 3QC3A 4H19A 1EL3A 2GJNA 4M5PA 3UXAA 1LRNA 4N42A 3UXKA 2J7BA 1W31A 1NWTA 5K3VA 5GQBA 3CZ8A 2E0PA 2OEJA 4GY1A 3LEPA 4ZVJA 4AHPA 3NZGA 1S46A 3MTWA 4L4LA 1QI2A 4FS9A 2E3TA 4FLOA 3SFWA 5LXXA 4U3AA 3DGRA 4GNKB 3T05A 2P50A 3C2VA 1XM3A 4U5KA 4ZXOA 1A5OC 3RMEA 1J93A 1KXQA 2X50A 1E9YB 3VNDA 4UQAA 1EZWA 4MB5A 1ZAJA 1J18A 3CK5A 1OX5A 4RUBA 4DELA 1GVYA 1VCVA 3TX9A 3LRLA 3E96A 3GW3A 3OU8A 2RDUA 3VUSA 4W85A 1K6AA 4MGGA 3EOUA 1G5AA 1BYCA 3CZJA 5AOUA 3CGCA 1DWHM 1B3VA 2VI0A 5HUPA 1ITXA 5FJOA 1ADDA 1YLVA 4RCXA 3TW6A 4NNAA 3A24A 3OP2A 3THDA 4IFKA 1EYEA 4ATWA 2GGGA 4EPKA 2A3LA 2WQPA 5AHNA 3TMLA 4GABA 2R9RA 4L9XA 3K1DA 1D7KA 3WUBA 3RILA 4K6AA 1K4QA 1CB2A 3VGGA 3UG8A 1MW0A 1GYNA 1QNPA 4UTWC 1UR8A 5EBAA 3NQFA 1MUMA 1L8PA 1XPGA 1JDDA 3DI1A 2WZIA 3OOQA 3TN3A 2BY3A 3WMSA 2HE8A 4AZBA 4H4UA 1FFQA 1B54A 4QISA 4LW7A 4FSAA 3O8AA 5DY3A 4PBEA 2J7GA 3BAXA 1ODUA 1TKKA 3IVTA 3QR1A 3C56A 4XISA 1H1YA 4AD0A 1QNOA 5IHRA 4CD8A 4W9TA 3WD3A 2CBVA 4GC3A 3BGJA 1NOFA 2GWNA 3G3MA 4JTCA 3EX4A 4L65A 1GQKA 5K9XA 3HGRA 4QP0A 1NDVA 3I4KA 1RLDA 3AALA 4NAEB 1XH0A 1NF0A 2PGEA 2W0HA 3LB0A 3LX9A 4RZBA 3BANA 3E2RA 4JX6A 3TWAA 2OX1A 4YJ5A 3MO4A 5AC8A 3AS0A 1XYMA 1KBKA 3ZSSA 1ZP3A 2A3HA 4XZ9A 3FFSA 2XTKA 2PPGA 4HPHA 1OGBA 4ZFCA 4B3ZA 2DY3A 3WQ6A 2J79A 1UBSA 4GVFA 5LYRA 3V7PA 1OFRA 3WQGA 1H63A 1NHPA 1XCXA 3A4WA 4XVEA 2V3GA 3TW9A 3WBAA 3GKAA 4LUSB 1NIUA 3H8AA 3L23A 4ROQA 4GGBA 3ZJ8A 3SUSA 3GG0A 3KXQA 3T2OA 5G4WA 1CZ1A 2PE4A 4L4OA 4RL3A 5K4XA 5AY7A 2YR1A 1XLCA 3CJPA 3MP4A 1N8IA 3N73A 4TQTA 4IL2A 4ZSTA 2JF6A 2VYOA 5L9FA 3REQA 1XJBA 3XINA 3TP4A 3NQDA 3WK0A 4HOXA 1SJAA 3WF3A 2Z7GA 1ZPTA 1UWQA 2OSXA 3GC5A 2VQUA 2DZPA 3AMKA 3QY7A 3BCFA 1EDQA 2OLSA 2TMDA 5HUOA 4WDWA 1E5NA 1YW1A 3GC2A 5DQPA 1PCWA 3W6YA 5FSDC 1JYXA 3MUAA 2VUNA 1B5TA 3IIPA 5JXQA 4S39A 3GU9A 3OBAA 1TMQA 1KBLA 4BF7A 5LGXA 1KM3A 2F8QA 1JQVA 2NW0A 4C1LA 3SEPA 1RY8A 5HA7A 1SR0A 4MUPA 2I5QA 3HG5A 4Y2WA 3V0TA 3VTRA 4A4AA 2AMGA 3Q67A 3LZ3A 3PC0A 3TH6A 1FCBA 1US3A 3RR1A 2OU4A 3BAJA 3FS2A 3L2LA 4DJFC 2VR4A 4M82A 4IGHA 5D2XA 3D5HA 1JYNA 2G3JA 2GJLA 2OQLA 4PFMA 5HINA 4GK8A 3AMCA 5AC4A 1O66A 5BCAA 3PN8A 3DKJA 4IMFA 3W1TA 1LT8A 4HK5A 3VGBA 4J57A 3H4WA 4QM1A 1PCKA 1F6KA 3SGUA 2R9ZA 2WOQA 2E68A 1OFDA 2XM1A 1VYRA 1GORA 4L6HA 2E28A 4P8UA 2GGJA 4PB3A 2OELA 3KVLA 5CZ0A 2QCCA 4A29A 1I45A 4HOZA 1W5OA 3MSRA 1XLDA 1ZNNA 4G1NA 1GOQA 3BG9A 1YTDA 5BNKA 1C9WA 4L6OA 3UCDA 2QEZA 2YCJA 3LXAA 2PDNA 1FEBA 2YL6A 4G7EA 4OBSA 5LNWA 2A7RA 2AQWA 3S2MA 3ID7A 3SRHA 3UBPC 4WRHA 5GPRA 4QJ4B 4DWSA 2B7PA 3HZ3A 4GIAA 3F1QA 1ZS2A 3O9NA 3EB4A 4CN1A 1BKSA 3THAA 3TTYA 3N1AA 5E0KA 2GR3A 4RW5A 3GRTA 1P48A 2J78A 2ZX9A 3GNDA 3COTA 1TREA 2YLAA 4XKMA 3LI1A 4O18A 1F8MA 3NVTA 4NEWA 4H2CA 1GHSA 3RCNA 3WKZA 4DPQA 1JPHA 2DT3A 3W2UA 1S1PA 3OHMB 1DOSA 3CV6A 3K4DA 2WNQA 3MI6A 3JR2A 3OC4A 1WZMA 1CB7B 3ZR6A 3TW7A 4KEMA 4O1FA 1AH0A 3HFYA 4PODA 4WLCA 4O57A 1T5AA 2QCHA 2PLMA 2C8NA 3VILA 1LOLA 2B0MA 3CIVA 2I9UA 1TRIA 3F5KA 3QZ6A 1BPLB 1CI1A 2Y4SA 1GVOA 4P7OA 2XM2A 2J6XA 1BLIA 1E6QM 2BNJA 3L66A 1M9HA 4M7TA 2ZUWA 4XD6A 4J3SA 3OLDA 5HMEA 3E38A 1GQNA 2OB3A 1C7TA 3OLIA 3ISIX 1XLBA 2I16A 4OBRA 2OLAA 3UP8A 4TVYA 1WP6A 2FYMA 5EB8A 5GNYA 1BSIA 1KWGA 4LRSA 3WFAA 2F5ZA 3TAKA 1ZAIA 3SECA 1ISWA 4GY7A 1ONEA 1WKYA 4AZ7A 3ITXA 3T0TA 1CGXA 2CLOA 1QPKA 5ABHA 5DLCA 2Y7GA 2YVJA 2Y6ZA 4MB3A 4LA1A 2PDUA 4CQAA 3CB3A 2JE8A 2WJEA 3TA6A 2J9ZA 3GIYA 5CSUA 1T96A 4DEFA 1TB3A 1LL6A 3BG5A 3FG2P 1DIDA 3A5VA 3PWAA 3NEHA 3SUWA 4LY8A 3DKLA 3NO1A 4DY1A 1M7XA 1E0XA 4HSHA 2WVTA 3EOEA 3W7RA 1CLVA 4XAYA 1QMLA 2XN2A 1QUMA 1TJPA 2F6UA 3XISA 3IRDA 4Z42C 5JUVA 1UKQA 5KVIA 1AJ2A 3W86A 5BMXA 4PN2A 5KITA 2PF8A 4DWDA 1U83A 4FMVA 5CPOA 4L1WA 4RX0A 1V3LA 3UG3A 4IPJA 4R53A 4ZSUA 4D1JA 2ZDRA 3ES7A 1LYXA 4NSBA 1LLOA 1TVLA 1GOIA 1Y5WA 4UFMA 2C18A 2R1KA 3TA9A 1KKOA 4AZCB 4AZCA 2QDHA 3AQUA 3RLGA 1E4LA 4R27A 5CGMA 2UWFA 4EE9A 3RCMA 1FWHC 1ZK7A 5A6MA 2XFWA 3HQ1A 2VOMA 1ZAHA 4KF1A 1BG4A 3P80A 1AZ2A 2KZHA 4V2XA 1EBDA 1EC8A 4OT7A 5FS7A 5BZAA 2VCBA 4QHRA 1UWUA 2Z2AA 5CPMA 5DMLA 1ZSXA 2QUMA 3KBVA 4JDYA 2QJIA 4V33A 3U2EA 4PMNA 5DCDA 1D7FA 4ZQCA 3WLSA 4AD4A 5G5HB 3PZ9A 3UFYA 1UD4A 1I2RA 5REQA 4TVCA 5FEWA 4UNLA 2F2HA 3UWYA 2V68A 1OABA 1MXSA 1BTMA 5A6SA 1JZ7A 3PBMA 3U8GA 2HNEA 4TMBA 2IKIA 3B03A 4HU8A 4C1KA 2WLZA 4GVGA 2E5CA 4BI6A 1U30A 3STPA 5ABFB 1ME9A 1XYLA 1OK4A 4EPDC 3NWRA 1F76A 1K4GA 3LM7A 3TN6A 2XIIA 1XIHA 4GYPC 3DK4A 4GQ0A 2WO5A 3HIJA 1OCNA 5F7UA 1UG6A 3K8MA 3PTKA 2PTZA 2DSUA 3SCPA 1ZB5A 3NPVA 1KC7A 3QLLA 2X41A 2B7QA 4IMEA 1DP0A 2POTA 4K1GA 4LVBA 4XBJA 1UBPC 1IEQA 4HB7A 4JFVA 3MZNA 2A3EA 1ECEA 2CZ5A 2WHLA 1S7MA 1PB0A 1ZBKA 2FPTA 1JZ5A 3I7QA 3H6OA 4GA8A 4PTXA 3SY8A 1JCTA 1FFRA 4LAUA 2QQ6A 3VNYA 6TIMA 1XGEA 3TKFA 1XLAA 4IWWA 3EPMA 2CHOA 3B0YA 4GZEA 3IUIA 5CGQA 5IXEA 2EKCA 3PWIA 5D8WA 3VUPA 4NZ3A 3THUA 5CC3A 1HKWA 5M03A 3T2QA 3LLDA 4IGMA 4ZB2A 3G24A 1ZP4A 2E5AA 4YLWA 3LU2A 3N18A 4R88A 3WFZA 4MMWA 4BCEA 1W0MA 1YTKA 4C91A 1IEXA 4MLRA 5LGZA 1HG3A 3G1XA 3KS6A 3AXHA 3WNKA 1C7SA 3R58A 3W29A 1K4HA 1FWGC 4GQGA 2X09A 2X0HA 3F4CA 1XS2A 1M3UA 1P1MA 4ICCX 3W1MA 2NT0A 1XKJA 1DQWA 3LCHA 4JIRA 4ZQRA 2Y8KA 2BVTA 5CG7A 3P6LA 1B3OA 2XG9A 3G6LA 4UMBA 5FSEC 2DVTA 4O11A 2JEQA 1W17A 5CCZA 3ZR5A 1L2UA 5FJRA 5M3WA 1C9DA 1MOKA 2X30A 3WNOA 1OFAA 4BK9A 1WCGA 3P14A 4AWEA 2XFRA 3CLWA 4S23A 3W53A 3L0NA 1UKTA 2PU1A 2ZA2A 1AQFA 2AKMA 5AKQA 2W66A 1A0CA 3B9OA 2AAQA 5DELA 1UWSA 3W82A 3Q58A 1TPB1 3RU6A 4XZNX 4I9MA 3TJIA 3CUHA 4D8AA 4YIWA 3LPFA 1E3XA 4O17A 1EX5A 3W6MA 1IXQA 4UTHA 4ZR8A 3VNLA 4Q3MA 3GDLA 4MPQA 2QCEA 5H8MA 2E1DA 1DKWA 2Z6JA 1W91A 5ECUA 1TV4A 3G1HA 4LFYA 2XJ7A 2RABA 1JNEA 2HPIA 4MYXA 4GRSA 5GJPA 4LYRA 4IJRA 1TTIA 3GC4A 1J12A 3P2VA 2WPFA 1FHLA 1VFLA 2CLLA 1W3IA 1GRFA 1IE7C 4F3HA 1YE4A 5C9XA 3SUVA 3IUDA 2PEVA 1HJXA 1LLZA 4RV8A 4Q8VA 3GG7A 3QHMA 3F2DA 1G6CA 4MNLA 2F7FA 3LHTA 3R12A 4EOUA 3P81A 4MDOA 4WJXA 4B5TA 2NPXA 2XH0A 3FSTA 1IR1A 3GZ3A 2YCIX 3KCOA 4A3RA 1GK8A 4UR9A 3TSDA 2ZWZA 1OHLA 2H9AB 1JCNA 5CZSA 4Q8OA 1I4NA 1A5UA 3WH7A 1TO3A 1PIGA 3QFWA 3C0SA 4J3ZA 3LXBA 2Q6ZA 1MQPA 2W55A 3I6RA 3USBA 1A0EA 1GHRA 3BURA 3ATYA 2VR2A 1H7PA 3WQ8A 1UR2A 4H2HA 1S38A 2CLKA 5HWNA 3AMDA 3ATZA 5TNVA 1RLCL 1UP0A 1RJPA 3OEXA 4BV6A 4H4YA 3MQTA 5A8OA 2PGFA 1UA3A 3G3DA 3LHVA 1JYWA 3VDHA 4GQBA 1EF2A 8XIMA 1X7FA 1DYSA 3QYSA 1W9PA 5I7GA 1UCWA 2ACRA 3VGFA 3CNYA 4A6GA 2YL8A 1YQ2A 3FJ6A 1MVYA 2Z1KA 3G1RA 2J7DA 4CN4A 3DGBA 4DNAA 1OINA 1R3YA 1YXYA 1X7IA 5I79A 4CNTA 4MKNA 4FR6A 1YBQA 1MEIA 1HFBA 1OWQA 3QJAA 4LANA 4AIOA 5D02A 3MUZ1 2PD9A 4D71A 2A79A 4BA0A 4JPGA 3EAOA 1UZHA 2PFHA 4H6RA 4H8UA 4IL0A 4JQ4A 1IQ8A 1JR1A 3R0DA 2KAUC 4IMGA 1V3MA 4LYPA 1OZMA 1OADA 1TX0A 4TU1A 2H6RA 3W76A 3PPHA 4U3CA 4E8DA 4RJEA 1JRBA 2BXVA 1KD0A 1KR1A 3DYMA 3WQVA 2CWNA 2Z26A 3ZJ6A 1KGUA 4DAIA 3AIBA 4O0ZA 4QJ3B 1VZWA 3M44A 1WBJA 7REQB 7REQA 1PX8A 2VFEA 3GAKA 3OA5A 4KW2A 2TPRA 3WD4A 3LLXA 2HTMA 1HIZA 5C9RA 1QI4A 3IIXA 3R7MA 5DFAA 2D2OA 4NKCA 3S46A 1M01A 4JTTA 3LS9A 3IV8A 3E02A 1QO5A 1W32A 5FEZA 4WX2A 1DPMA 2GR2A 3VD9A 4UMCA 1Z48A 2W79A 3J7HA 4J56A 2F6XA 4H41A 1A4MA 1S2TA 3RK8A 4E8CA 4WDTA 4LH8A 2GH5A 3OGRA 3ZT5A 4JNMA 3M0YA 1E1FA 3LRKA 3T9PA 1UR1A 2OZ0A 4F0KA 5AYIA 3MA8A 3B0VC 3NVWB 3P84A 1TV8A 2UY5A 3GNNA 5CAHA 4JIEA 1O95A 4HPJA 3AS2A 1JRCA 4IHCA 1FHVA 1H11A 1ITCA 4NILA 1SW3A 2C7FA 1QHPA 3OG2A 3SDOA 1WOBA 4TMCA 3W26A 1TWDA 4HZ7A 4HNVA 3W28A 5AHIA 2HMCA 5F4WA 4ROPA 3C2EA 2Z1WA 3M6YA 4L9YA 2ZX5A 4W4QA 5IRPA 2R94A 4OV4A 4MADA 3P74A 2MANA 3PZGA 4OBTA 3G1AA 4KIEA 4R7JA 2ZX6A 1ZL1A 3M5XA 3VOGA 2WCAA 4QNEA 4E8GA 3A6OA 4Y9MA 3OVPA 1S2WA 3ABRA 3LV6A 4GYFA 4J3UA 2BSLA 1QNSA 4KWSA 2EQ6A 3E2SA 2RHGA 4E4FA 4PMRA 4F0LA 2POZA 3RNMA 1E9IA 3B06A 4PFHA 3URHA 3O15A 3TROA 3PZTA 2E6AA 1H1ZA 3SN0A 4UNIA 1VIWA 1CTNA 2GRTA 1LQAA 1IIHA 4PC8A 4QAIA 1S3HA 1RH9A 4Z2LA 1HTIA 3O16A 3B0XA 5ER0A 3AAMA 2GOUA 3WF4A 2HQAA 2VZVA 4DJDC 4NIRA 3TFXA 3B8VA 3L4VA 2X99A 3BOLA 4JHZA 1V5XA 5FJPA 1LOSA 4GIYA 4LT9A 1OX4A 2OFJA 4LEFA 4PUKA 4D6GA 2GWGA 4AWSA 4X0NA 4EVZA 2C1HA 1UD8A 1G7UA 4D6FA 1XH2A 4LF2A 1M04A 3BLEA 3CMFA 1QOQA 2NQZA 4JKLA 2IW0A 5JH1A 4GI6A 1TIMA 2D3LA 2G3IA 4F2BA 2NUWA 4MUZA 3FA3A 4UCGA 1NTHA 3W27A 4HPGA 5TQLA 2WLYA 2YDAA 2IPGA 2CNCA 1REQB 4H9VA 5E70A 2GGHA 2TODA 2BP1A 4PMJA 3L4XA 4S3CA 2HK1A 3WNMA 4O53A 3CGEA 2ZICA 1BVWA 4FAMA 1SJDA 2QMKA 3ITYA 1C91A 1LG2A 2D0HA 3I3DA 3KBWA 3L5OA 4A35A 2AQVA 1GPFA 1YRRA 3DBPA 4I3GA 4J40A 4ZB0A 4G9PA 3NQBA 4QE1A 1UOKA 2Z7KA 5C55A 3LV5A 1HZYA 2Z0IA 1I2PA 3VCNA 3WNPA 3SRFA 5U1OA 1JAKA 3UQNA 1Q4NX 4AEEA 5A6JA 2FTPA 3VABA 2WC4A 3WH5A 4AY7A 5C8BB 3QZEA 1WAUA 3MKVA 3OIXA 3LSBA 3GXIA 3MBDA 3WD1A 4IIDA 1JCYA 4ACYA 1E4IA 4NZ1A 4WXZA 1EEXA 3OVRA 5K7JA 1JPIA 2FKPA 4ZOAA 4C6LA 4DYKA 1XLIA 1P6CA 3EWDA 8TIMA 1Q7ZA 3G77A 4O13A 1Q6EA 3H26A 4UTTC 3WK1A 2QR6A 3VGDA 3VAVA 1F4AA 2GDVA 3DERA 5G1MA 3EGJA 3TXZA 2VGIA 3EMQA 4MJ4A 3GXT<