1KN0A

Crystal structure of the human rad52 protein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
184
structure length
184
Chain Sequence
CFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rad52
publication title Crystal structure of the homologous-pairing domain from the human Rad52 recombinase in the undecameric form.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 50
structure length 184
sequence length 184
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04098 Rad52_Rad22 Rad52/22 family double-strand break repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.80 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1kn0A01
5JRBA 1KN0A 1H2IA
chains in the Genus database with same CATH superfamily
2GQWA 3H4KA 2QVHA 4TVYA 3ZVHA 3RR1A 4EMIA 3ES8A 1S7MA 2DW7A 4GISA 1VDVA 3O0HA 2QAEA 2AKZA 5J04A 3TW9A 3NVYB 2MNRA 3EUB3 2W3RA 2BCPA 1LVLA 3P0WA 3T8QA 3RRAA 3KUMA 2W54A 2OZ3A 3SR6B 3UXKA 1GV4A 3R10A 3QLDA 1TYTA 1GRFA 4MMWA 4H50A 3GC2A 3DJJA 4ADWA 5FJTA 3HRDC 1WUFA 2XH4A 2R9ZA 3MQTA 3N6JA 1NHQA 3T6CA 1TZZA 4K1WA 1K4QA 2GR3A 3CGBA 4LIIA 1ZMDA 2I5QA 2PODA 3EANA 2X99A 2MUCA 4DN1A 3S5SA 1NELA 1MO9A 3TWAA 3DK9A 4J3ZA 1N63C 3VC5A 3GRTA 4KPLA 2E5AA 2W0HA 2TPRA 3CGEA 2OLAA 3LXDA 3PK7A 3URHA 3GY1A 3EKGA 2XH7A 3RO6A 3ZVHB 4K2SA 3DJGX 2HZGA 2P8CA 3D46A 3UXLA 1FEAA 4KEMA 1V59A 1VQZA 2GGGA 3H12A 1OEPA 4J57A 1P43A 3RITA 1M6IA 2E3TA 5EBKA 3QFBA 3DEQA 4BV6A 5FS6A 1YQZA 4A6GA 3GD6A 5TR3A 3R0UA 2HXUA 2OVLA 4ZOHB 2JK6A 2HQMA 2X8CA 3MY9A 2EQ7A 4ROPA 4HPNA 1KKRA 3TJ4A 1DNCA 1PDYA 1XHCA 2WOWA 2GDQA 5FS9A 5G5HB 3TOYA 3SN0A 5IDZA 3FXGA 5EU9A 2QJJA 1KD0A 2YVGA 2PCEA 1EC9A 4EWJA 1JPMA 2V3BA 1H2IA 3VA8A 5JCIA 1FECA 2WOVA 4FX9A 1STZA 4DNAA 4EQSA 3NXLA 1RM6B 1ZK7A 3MWCA 3UJSA 1NPXA 1FFVC 4H4PA 1EBDA 2CFYA 1F3PA 1GRHA 4HN8A 4H19A 4H4TA 5U25A 2PMQA 2OQYA 2PS2A 2ZZ0A 3D47A 2ZZCA 1JEHA 3UJRA 3II4A 1E9IA 2RABA 4G8TA 4GR1A 3RCYA 3IC9A 4H4RA 2GR2A 4APNA 2AL2A 2PU1A 3V4BA 1DXLA 2FYMA 4GMEA 5G5GB 1EC7A 3VDGA 3HW2A 3AMZA 1ZY8A 1ZMCA 2PU0A 1EBGA 1XANA 4M52A 1P48A 4GYPC 1TKKA 2OO6A 3EEZA 3N4FA 3UJEA 5JCNA 2GR0A 1MDRA 4EQRA 3NRZB 4FI4A 4A35A 4EMJA 1MRAA 1SJAA 2A8XA 1XS2A 5FJPA 5FJRA 3DERA 4IZGA 3ES7A 1F9CA 1SJBA 2V6OA 3DH9A 1JOAA 4M0XA 3EF6A 5FMHA 4M6UA 4ENLA 4DHGA 3LADA 2WPEA 2OG9A 4EQXA 4HNCA 3JW7A 3STPA 3DG7A 3U9IA 1R6WA 3B9JB 1GERA 1FFUC 1D7YA 3CT2A 3FCPA 1N60C 2PPGA 3TQPA 3L8KA 3NS1B 4K7ZA 3ZLGA 5JCLA 3ENLA 3I4KA 2PTZA 3FG2P 4HNLA 1FIQB 2GR1A 2X8GA 3D9XA 3KLJA 5GRTA 4JN8A 2PTWA 4GFIA 4IP5A 3I6EA 3CK5A 4H4UA 3CXOA 3N4EA 3S47A 3QTPA 2GSHA 2WBAA 3V3WA 2QDDA 4K8DA 4EMWA 1NU5A 4HCHA 2OX4A 5KVHA 3A7AA 3DFHA 4E5TA 2WP6A 5FJOA 2ZZBA 3OP2A 4HCDA 4NEWA 3BJSA 1ONEA 1GREA 4DX3A 3GD3A 3R07C 4H4VA 3LB8A 2WPCA 3P93A 4EM4A 3DGHA 3Q45A 3DESA 4X2PA 3A7UA 4ZCWA 3DDMA 1FO4A 3OTRA 2QQ6A 3VFCA 1W6TA 2P88A 4H83A 3FYYA 2OZTA 5KVIA 2POZA 3AM9A 4H1ZA 4H4XA 4H4SA 1V97A 2HNEA 2ZADA 5JCKA 1TYPA 3CAWA 3PWIA 1X2GA 4Z1YA 2W3SA 3MKCA 4G7FA 3IK4A 2NPXA 3DIPA 3H70A 4A3RA 3VCNA 4DYEA 3GO2A 1GEUA 2GH5A 3PG6A 2BC0A 2YQUA 2P0IA 4E4FA 1AOGA 1KKOA 3HPFA 2PSNA 3TJIA 4H2HA 1NHPA 3NVVB 2FKPA 2NQLA 4YWSA 1JROA 3NVZB 1BWCA 1BZLA 2XH0A 4KT2A 1GSNA 2PTXA 3TCSA 1TE6A 2DW6A 2GGEA 2XGZA 3DG6A 1KN0A 2AKMA 1N61C 1XDIA 1GXFA 2OKTA 3UJFA 1N5XA 3NFUA 1SJCA 2YVFA 2OQHA 1KCZA 2QDEA 2J3NA 3CB3A 4GGBA 5ER0A 3IJLA 3R0KA 3PFRA 2EQ9A 3THUA 2PP1A 2OPJA 2YAUA 6ENLA 4KPRA 4MGGA 2QJMA 4NEVA 1MOKA 5U1OA 3T4WA 3IJIA 3IJQA 3K1GA 1BKHA 2PGEA 3ZLHA 4YWOA 3Q4DA 4KWSA 5JCMA 2RDXA 1WUEA 2P3ZA 2GRTA 5BOFA 2QJNA 5BOEA 1DTNA 2O56A 3I6TA 4J1OA 3SQSA 3V5CA 4JQ9A 3DK8A 1OJTA 1IYXA 3TWBA 1RVKA 2XH2A 3QN3A 2AAQA 3DFYA 3SSZA 1L8PA 1ZX9A 4E8GA 3QPEA 4F4RA 1ZXIC 3UGVA 3V5FA 4IL2A 2EQ8A 2ZC8A 1GRGA 2V3AA 2HXTA 2AL2B 3GRSA 1GRTA 1LPFA 1R0MA 3SJNA 2BC1A 2X8HA 4IT1A 1GRAA 4FDCB 3PWGA 3R11A 2AL1A 4H4ZA 3R1ZA 4DWDA 2QGYA 3ETRB 3ZLFA 2PA6A 3U4FA 1NDAA 5FS7A 3DGBA 1N5WC 4E6MA 1MUCA 4LA1A 1ONFA 1SJDA 1YEYA 3FV9A 3N6HA 3OZYA 2EQ6A 2XSXA 3SQPA 3OW1A 1ELSA 2X50A 3QKEA 2C3DA 4IP4A 1GRBA 4E4UA 3FVDA 4MKSA 2OFJA 4JHMA 5FJUA 3RNMA 3VC6A 2ONEA 3MZNA 2CHRA 3ZVIA 3CGDA 1EBHA 3H7VA 3JZUA 1EC8A 3DK4A 3OC4A 2PTYA 4GIRA 1NHRA 4Z17A 3AN1A 1SB3B 4J56A 4EQWA 3SN4A 1N62C 3JVAA 3MUCA 1ECQA 3MSYA 1BQGA 2GGJA 1FEBA 2WP5A 3NZGA 4HCLA 1MNSA 1NHSA 3OPSA 2GGIA 4JN7A 1JPDX 2P8BA 2C3CA 4BURA 4EM3A 3BSMA 4H4QA 5JRBA 1GETA 1JRPA 2WOIA 3BOXA 2OZ8A 3B97A 4DXKA 4GGHA 7ENLA 4ZA0A 1GESA 3DGZA 4K8GA 3UCDA 3T9PA 3VCCA 2WPFA 1ZKQA 5ENLA 1JDFA 4GYPA 1X2HA 3SBFA 3GD4A 1Q1WA 4H4WA 4JDRA 1MDLA 2PGWA 3EAOA 2GGHA 2GL5A 2CDUA 4GRTA 3CYJA 2F5ZA 3DG3A 1Q1RA 2YVJA 4IL0A 4TVWA 1H6VA 3H8AA 3QFAA 1FHUA 3FJ4A 3NVWB 2W55A 4FP1A 3CXBA 2PP3A 1F8WA 4IHCA 3RGTA 1XPYA 3P3BA 1T3QC 2NVKX 3TTEA 1WYGA 4H4YA 3UJ2A 1PDZA 3A7RA 2PP0A 3NO1A 3R25A 1ZDLA 5FS8A 3UCCA 3Q6JA 3OZMA 3SN1A 3CGCA 1FHVA 3L5OA 1JCTA 4HYRA
chains in the Genus database with same CATH topology
1GRHA 2GQWA 3H4KA 4EMIA 4H4TA 5U25A 1S7MA 4H4XA 4H4SA 1NDAA 2ZZ0A 2ZZCA 1JEHA 3O0HA 3II4A 5FS7A 5JCKA 2QAEA 1TYPA 2RABA 4GR1A 3IC9A 4H4RA 2GR2A 2BCPA 4APNA 1LVLA 1DXLA 4LA1A 2NPXA 1GV4A 1ONFA 1ZY8A 1ZMCA 1TYTA 1GRFA 2EQ6A 4H50A 1GEUA 1XANA 4M52A 3DJJA 3SQPA 4ADWA 2GH5A 3PG6A 2BC0A 2X50A 2YQUA 5JCNA 1AOGA 2GR0A 2C3DA 4EQRA 1GRBA 2R9ZA 1NHPA 1NHQA 4EMJA 3RNMA 1BWCA 1BZLA 2A8XA 1K4QA 2GR3A 1GSNA 3CGBA 3CGDA 4LIIA 1KN0A 1ZMDA 1XDIA 1GXFA 3DK4A 2V6OA 3DH9A 1JOAA 3EANA 3OC4A 3EF6A 5FMHA 2X99A 2YVFA 1NHRA 2J3NA 3LADA 5ER0A 4J56A 4EQWA 2WPEA 1MO9A 3DK9A 2EQ9A 4EQXA 2YAUA 1FEBA 2WP5A 4KPRA 3GRTA 4NEVA 1NHSA 2W0HA 1MOKA 2TPRA 5U1OA 3CGEA 3LXDA 2C3CA 4BURA 4EM3A 1GERA 3URHA 4H4QA 1D7YA 5JRBA 1GETA 2WOIA 4YWOA 3L8KA 4K7ZA 3DJGX 5JCMA 5JCLA 1GESA 3DGZA 1FEAA 1V59A 2GRTA 3FG2P 2GR1A 3KLJA 2WPFA 2X8GA 3D9XA 1ZKQA 4J57A 5GRTA 1M6IA 5EBKA 3GD4A 3QFBA 4BV6A 5FS6A 1Q1WA 4H4WA 4H4UA 1YQZA 4JDRA 3EAOA 4JQ9A 3DK8A 1OJTA 5TR3A 2CDUA 2WBAA 4GRTA 4EMWA 4K8DA 2F5ZA 2JK6A 2HQMA 1Q1RA 2YVJA 2X8CA 2AAQA 2EQ7A 1H6VA 3QFAA 5KVHA 1ZX9A 1DNCA 1XHCA 2WOWA 5FS9A 2WP6A 1F8WA 2ZZBA 2NVKX 4NEWA 2YVGA 1GREA 4H4YA 2EQ8A 2V3BA 1GRGA 1H2IA 2V3AA 3GD3A 3GRSA 4H4VA 3LB8A 2WPCA 1GRTA 1LPFA 4EM4A 3DGHA 5JCIA 2BC1A 1FECA 5KVIA 1ZDLA 2WOVA 2X8HA 4FX9A 5FS8A 4DNAA 3Q6JA 4EQSA 1GRAA 4FDCB 1ZK7A 3CGCA 1NPXA 3L5OA 4H4PA 1EBDA 2CFYA 1F3PA 4H4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRB A;  1KN0 A;  1H2I A; 
#chains in the Genus database with same CATH topology
 2GQW A;  3H4K A;  2QVH A;  4TVY A;  3ZVH A;  3RR1 A;  4EMI A;  3ES8 A;  1S7M A;  2DW7 A;  4GIS A;  1VDV A;  3O0H A;  2QAE A;  2AKZ A;  5J04 A;  3TW9 A;  3NVY B;  2MNR A;  3EUB 3;  2W3R A;  2BCP A;  1LVL A;  3P0W A;  3T8Q A;  3RRA A;  3KUM A;  2W54 A;  2OZ3 A;  3SR6 B;  3UXK A;  1GV4 A;  3R10 A;  3QLD A;  1TYT A;  1GRF A;  4MMW A;  4H50 A;  3GC2 A;  3DJJ A;  4ADW A;  5FJT A;  3HRD C;  1WUF A;  2XH4 A;  2R9Z A;  3MQT A;  3N6J A;  1NHQ A;  3T6C A;  1TZZ A;  4K1W A;  1K4Q A;  2GR3 A;  3CGB A;  4LII A;  1ZMD A;  2I5Q A;  2POD A;  3EAN A;  2X99 A;  2MUC A;  4DN1 A;  3S5S A;  1NEL A;  1MO9 A;  3TWA A;  3DK9 A;  4J3Z A;  1N63 C;  3VC5 A;  3GRT A;  4KPL A;  2E5A A;  2W0H A;  2TPR A;  3CGE A;  2OLA A;  3LXD A;  3PK7 A;  3URH A;  3GY1 A;  3EKG A;  2XH7 A;  3RO6 A;  3ZVH B;  4K2S A;  3DJG X;  2HZG A;  2P8C A;  3D46 A;  3UXL A;  1FEA A;  4KEM A;  1V59 A;  1VQZ A;  2GGG A;  3H12 A;  1OEP A;  4J57 A;  1P43 A;  3RIT A;  1M6I A;  2E3T A;  5EBK A;  3QFB A;  3DEQ A;  4BV6 A;  5FS6 A;  1YQZ A;  4A6G A;  3GD6 A;  5TR3 A;  3R0U A;  2HXU A;  2OVL A;  4ZOH B;  2JK6 A;  2HQM A;  2X8C A;  3MY9 A;  2EQ7 A;  4ROP A;  4HPN A;  1KKR A;  3TJ4 A;  1DNC A;  1PDY A;  1XHC A;  2WOW A;  2GDQ A;  5FS9 A;  5G5H B;  3TOY A;  3SN0 A;  5IDZ A;  3FXG A;  5EU9 A;  2QJJ A;  1KD0 A;  2YVG A;  2PCE A;  1EC9 A;  4EWJ A;  1JPM A;  2V3B A;  1H2I A;  3VA8 A;  5JCI A;  1FEC A;  2WOV A;  4FX9 A;  1STZ A;  4DNA A;  4EQS A;  3NXL A;  1RM6 B;  1ZK7 A;  3MWC A;  3UJS A;  1NPX A;  1FFV C;  4H4P A;  1EBD A;  2CFY A;  1F3P A;  1GRH A;  4HN8 A;  4H19 A;  4H4T A;  5U25 A;  2PMQ A;  2OQY A;  2PS2 A;  2ZZ0 A;  3D47 A;  2ZZC A;  1JEH A;  3UJR A;  3II4 A;  1E9I A;  2RAB A;  4G8T A;  4GR1 A;  3RCY A;  3IC9 A;  4H4R A;  2GR2 A;  4APN A;  2AL2 A;  2PU1 A;  3V4B A;  1DXL A;  2FYM A;  4GME A;  5G5G B;  1EC7 A;  3VDG A;  3HW2 A;  3AMZ A;  1ZY8 A;  1ZMC A;  2PU0 A;  1EBG A;  1XAN A;  4M52 A;  1P48 A;  4GYP C;  1TKK A;  2OO6 A;  3EEZ A;  3N4F A;  3UJE A;  5JCN A;  2GR0 A;  1MDR A;  4EQR A;  3NRZ B;  4FI4 A;  4A35 A;  4EMJ A;  1MRA A;  1SJA A;  2A8X A;  1XS2 A;  5FJP A;  5FJR A;  3DER A;  4IZG A;  3ES7 A;  1F9C A;  1SJB A;  2V6O A;  3DH9 A;  1JOA A;  4M0X A;  3EF6 A;  5FMH A;  4M6U A;  4ENL A;  4DHG A;  3LAD A;  2WPE A;  2OG9 A;  4EQX A;  4HNC A;  3JW7 A;  3STP A;  3DG7 A;  3U9I A;  1R6W A;  3B9J B;  1GER A;  1FFU C;  1D7Y A;  3CT2 A;  3FCP A;  1N60 C;  2PPG A;  3TQP A;  3L8K A;  3NS1 B;  4K7Z A;  3ZLG A;  5JCL A;  3ENL A;  3I4K A;  2PTZ A;  3FG2 P;  4HNL A;  1FIQ B;  2GR1 A;  2X8G A;  3D9X A;  3KLJ A;  5GRT A;  4JN8 A;  2PTW A;  4GFI A;  4IP5 A;  3I6E A;  3CK5 A;  4H4U A;  3CXO A;  3N4E A;  3S47 A;  3QTP A;  2GSH A;  2WBA A;  3V3W A;  2QDD A;  4K8D A;  4EMW A;  1NU5 A;  4HCH A;  2OX4 A;  5KVH A;  3A7A A;  3DFH A;  4E5T A;  2WP6 A;  5FJO A;  2ZZB A;  3OP2 A;  4HCD A;  4NEW A;  3BJS A;  1ONE A;  1GRE A;  4DX3 A;  3GD3 A;  3R07 C;  4H4V A;  3LB8 A;  2WPC A;  3P93 A;  4EM4 A;  3DGH A;  3Q45 A;  3DES A;  4X2P A;  3A7U A;  4ZCW A;  3DDM A;  1FO4 A;  3OTR A;  2QQ6 A;  3VFC A;  1W6T A;  2P88 A;  4H83 A;  3FYY A;  2OZT A;  5KVI A;  2POZ A;  3AM9 A;  4H1Z A;  4H4X A;  4H4S A;  1V97 A;  2HNE A;  2ZAD A;  5JCK A;  1TYP A;  3CAW A;  3PWI A;  1X2G A;  4Z1Y A;  2W3S A;  3MKC A;  4G7F A;  3IK4 A;  2NPX A;  3DIP A;  3H70 A;  4A3R A;  3VCN A;  4DYE A;  3GO2 A;  1GEU A;  2GH5 A;  3PG6 A;  2BC0 A;  2YQU A;  2P0I A;  4E4F A;  1AOG A;  1KKO A;  3HPF A;  2PSN A;  3TJI A;  4H2H A;  1NHP A;  3NVV B;  2FKP A;  2NQL A;  4YWS A;  1JRO A;  3NVZ B;  1BWC A;  1BZL A;  2XH0 A;  4KT2 A;  1GSN A;  2PTX A;  3TCS A;  1TE6 A;  2DW6 A;  2GGE A;  2XGZ A;  3DG6 A;  1KN0 A;  2AKM A;  1N61 C;  1XDI A;  1GXF A;  2OKT A;  3UJF A;  1N5X A;  3NFU A;  1SJC A;  2YVF A;  2OQH A;  1KCZ A;  2QDE A;  2J3N A;  3CB3 A;  4GGB A;  5ER0 A;  3IJL A;  3R0K A;  3PFR A;  2EQ9 A;  3THU A;  2PP1 A;  2OPJ A;  2YAU A;  6ENL A;  4KPR A;  4MGG A;  2QJM A;  4NEV A;  1MOK A;  5U1O A;  3T4W A;  3IJI A;  3IJQ A;  3K1G A;  1BKH A;  2PGE A;  3ZLH A;  4YWO A;  3Q4D A;  4KWS A;  5JCM A;  2RDX A;  1WUE A;  2P3Z A;  2GRT A;  5BOF A;  2QJN A;  5BOE A;  1DTN A;  2O56 A;  3I6T A;  4J1O A;  3SQS A;  3V5C A;  4JQ9 A;  3DK8 A;  1OJT A;  1IYX A;  3TWB A;  1RVK A;  2XH2 A;  3QN3 A;  2AAQ A;  3DFY A;  3SSZ A;  1L8P A;  1ZX9 A;  4E8G A;  3QPE A;  4F4R A;  1ZXI C;  3UGV A;  3V5F A;  4IL2 A;  2EQ8 A;  2ZC8 A;  1GRG A;  2V3A A;  2HXT A;  2AL2 B;  3GRS A;  1GRT A;  1LPF A;  1R0M A;  3SJN A;  2BC1 A;  2X8H A;  4IT1 A;  1GRA A;  4FDC B;  3PWG A;  3R11 A;  2AL1 A;  4H4Z A;  3R1Z A;  4DWD A;  2QGY A;  3ETR B;  3ZLF A;  2PA6 A;  3U4F A;  1NDA A;  5FS7 A;  3DGB A;  1N5W C;  4E6M A;  1MUC A;  4LA1 A;  1ONF A;  1SJD A;  1YEY A;  3FV9 A;  3N6H A;  3OZY A;  2EQ6 A;  2XSX A;  3SQP A;  3OW1 A;  1ELS A;  2X50 A;  3QKE A;  2C3D A;  4IP4 A;  1GRB A;  4E4U A;  3FVD A;  4MKS A;  2OFJ A;  4JHM A;  5FJU A;  3RNM A;  3VC6 A;  2ONE A;  3MZN A;  2CHR A;  3ZVI A;  3CGD A;  1EBH A;  3H7V A;  3JZU A;  1EC8 A;  3DK4 A;  3OC4 A;  2PTY A;  4GIR A;  1NHR A;  4Z17 A;  3AN1 A;  1SB3 B;  4J56 A;  4EQW A;  3SN4 A;  1N62 C;  3JVA A;  3MUC A;  1ECQ A;  3MSY A;  1BQG A;  2GGJ A;  1FEB A;  2WP5 A;  3NZG A;  4HCL A;  1MNS A;  1NHS A;  3OPS A;  2GGI A;  4JN7 A;  1JPD X;  2P8B A;  2C3C A;  4BUR A;  4EM3 A;  3BSM A;  4H4Q A;  5JRB A;  1GET A;  1JRP A;  2WOI A;  3BOX A;  2OZ8 A;  3B97 A;  4DXK A;  4GGH A;  7ENL A;  4ZA0 A;  1GES A;  3DGZ A;  4K8G A;  3UCD A;  3T9P A;  3VCC A;  2WPF A;  1ZKQ A;  5ENL A;  1JDF A;  4GYP A;  1X2H A;  3SBF A;  3GD4 A;  1Q1W A;  4H4W A;  4JDR A;  1MDL A;  2PGW A;  3EAO A;  2GGH A;  2GL5 A;  2CDU A;  4GRT A;  3CYJ A;  2F5Z A;  3DG3 A;  1Q1R A;  2YVJ A;  4IL0 A;  4TVW A;  1H6V A;  3H8A A;  3QFA A;  1FHU A;  3FJ4 A;  3NVW B;  2W55 A;  4FP1 A;  3CXB A;  2PP3 A;  1F8W A;  4IHC A;  3RGT A;  1XPY A;  3P3B A;  1T3Q C;  2NVK X;  3TTE A;  1WYG A;  4H4Y A;  3UJ2 A;  1PDZ A;  3A7R A;  2PP0 A;  3NO1 A;  3R25 A;  1ZDL A;  5FS8 A;  3UCC A;  3Q6J A;  3OZM A;  3SN1 A;  3CGC A;  1FHV A;  3L5O A;  1JCT A;  4HYR A; 
#chains in the Genus database with same CATH homology
 1GRH A;  2GQW A;  3H4K A;  4EMI A;  4H4T A;  5U25 A;  1S7M A;  4H4X A;  4H4S A;  1NDA A;  2ZZ0 A;  2ZZC A;  1JEH A;  3O0H A;  3II4 A;  5FS7 A;  5JCK A;  2QAE A;  1TYP A;  2RAB A;  4GR1 A;  3IC9 A;  4H4R A;  2GR2 A;  2BCP A;  4APN A;  1LVL A;  1DXL A;  4LA1 A;  2NPX A;  1GV4 A;  1ONF A;  1ZY8 A;  1ZMC A;  1TYT A;  1GRF A;  2EQ6 A;  4H50 A;  1GEU A;  1XAN A;  4M52 A;  3DJJ A;  3SQP A;  4ADW A;  2GH5 A;  3PG6 A;  2BC0 A;  2X50 A;  2YQU A;  5JCN A;  1AOG A;  2GR0 A;  2C3D A;  4EQR A;  1GRB A;  2R9Z A;  1NHP A;  1NHQ A;  4EMJ A;  3RNM A;  1BWC A;  1BZL A;  2A8X A;  1K4Q A;  2GR3 A;  1GSN A;  3CGB A;  3CGD A;  4LII A;  1KN0 A;  1ZMD A;  1XDI A;  1GXF A;  3DK4 A;  2V6O A;  3DH9 A;  1JOA A;  3EAN A;  3OC4 A;  3EF6 A;  5FMH A;  2X99 A;  2YVF A;  1NHR A;  2J3N A;  3LAD A;  5ER0 A;  4J56 A;  4EQW A;  2WPE A;  1MO9 A;  3DK9 A;  2EQ9 A;  4EQX A;  2YAU A;  1FEB A;  2WP5 A;  4KPR A;  3GRT A;  4NEV A;  1NHS A;  2W0H A;  1MOK A;  2TPR A;  5U1O A;  3CGE A;  3LXD A;  2C3C A;  4BUR A;  4EM3 A;  1GER A;  3URH A;  4H4Q A;  1D7Y A;  5JRB A;  1GET A;  2WOI A;  4YWO A;  3L8K A;  4K7Z A;  3DJG X;  5JCM A;  5JCL A;  1GES A;  3DGZ A;  1FEA A;  1V59 A;  2GRT A;  3FG2 P;  2GR1 A;  3KLJ A;  2WPF A;  2X8G A;  3D9X A;  1ZKQ A;  4J57 A;  5GRT A;  1M6I A;  5EBK A;  3GD4 A;  3QFB A;  4BV6 A;  5FS6 A;  1Q1W A;  4H4W A;  4H4U A;  1YQZ A;  4JDR A;  3EAO A;  4JQ9 A;  3DK8 A;  1OJT A;  5TR3 A;  2CDU A;  2WBA A;  4GRT A;  4EMW A;  4K8D A;  2F5Z A;  2JK6 A;  2HQM A;  1Q1R A;  2YVJ A;  2X8C A;  2AAQ A;  2EQ7 A;  1H6V A;  3QFA A;  5KVH A;  1ZX9 A;  1DNC A;  1XHC A;  2WOW A;  5FS9 A;  2WP6 A;  1F8W A;  2ZZB A;  2NVK X;  4NEW A;  2YVG A;  1GRE A;  4H4Y A;  2EQ8 A;  2V3B A;  1GRG A;  1H2I A;  2V3A A;  3GD3 A;  3GRS A;  4H4V A;  3LB8 A;  2WPC A;  1GRT A;  1LPF A;  4EM4 A;  3DGH A;  5JCI A;  2BC1 A;  1FEC A;  5KVI A;  1ZDL A;  2WOV A;  2X8H A;  4FX9 A;  5FS8 A;  4DNA A;  3Q6J A;  4EQS A;  1GRA A;  4FDC B;  1ZK7 A;  3CGC A;  1NPX A;  3L5O A;  4H4P A;  1EBD A;  2CFY A;  1F3P A;  4H4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...