1KN0A

Crystal structure of the human rad52 protein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
184
structure length
184
Chain Sequence
CFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the homologous-pairing domain from the human Rad52 recombinase in the undecameric form.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Rad52
total genus 50
structure length 184
sequence length 184
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04098 Rad52_Rad22 Rad52/22 family double-strand break repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.80 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1kn0A01
5JRBA 1H2IA 1KN0A
chains in the Genus database with same CATH superfamily
2CDUA 4Z1YA 3BOXA 4EMIA 2OZ3A 4E4FA 1GETA 2F5ZA 2X50A 3PK7A 3DK4A 4H4QA 4JHMA 2AL2A 1R6WA 3NVZB 3DFHA 2FKPA 3NFUA 4GMEA 2QJMA 2OG9A 3UJRA 4EM4A 3RRAA 2GR3A 1KKOA 2PU0A 2OX4A 2YVJA 4JN7A 3TWBA 3DJGX 1SJCA 3EAOA 4H83A 3NS1B 2PGWA 3FYYA 4M52A 2WOVA 2E3TA 1KKRA 4GIRA 1GESA 4M0XA 2PCEA 5FJRA 4HNCA 1FECA 2OZ8A 1Q1WA 2C3CA 1MNSA 4E6MA 4J56A 4GR1A 4DNAA 4H4TA 3EUB3 2FYMA 2GGIA 4IZGA 3AN1A 2GR1A 2OKTA 2AAQA 4DX3A 5JCMA 1X2HA 3O0HA 4GGHA 1DTNA 4ZCWA 3ZVHB 3IJLA 3N4EA 1IYXA 3CXOA 3MZNA 3QFAA 2PTWA 3QLDA 3ZVHA 1NDAA 4JQ9A 3RO6A 3R25A 4EQWA 1YQZA 1MDLA 4M6UA 2X8HA 3I6EA 2PSNA 3OW1A 3RITA 5KVHA 5EBKA 1GRHA 1OJTA 4H19A 2YVGA 3U4FA 3CAWA 3VCCA 5KVIA 2GGEA 4H4VA 4ENLA 1F9CA 2WBAA 1FEAA 3EANA 1EC9A 3IJQA 2HXTA 3ES8A 1GEUA 2POZA 1E9IA 3MWCA 5BOFA 1ZDLA 2P88A 3GC2A 3H70A 3NZGA 4H4WA 2GL5A 2I5QA 5JCLA 1XHCA 2RABA 1NELA 1STZA 2JK6A 1GV4A 1F3PA 4GISA 4BV6A 4ZA0A 1K4QA 3V4BA 3T6CA 3NVWB 2PTXA 4A6GA 2W3SA 3DEQA 3IJIA 4ROPA 4HYRA 3PFRA 3K1GA 2EQ6A 3KUMA 5FS9A 3CXBA 2GSHA 3IK4A 3NVYB 3FVDA 2E5AA 4FDCB 2AKZA 4J57A 3TW9A 2EQ7A 2QGYA 4H4SA 3TWAA 1R0MA 3UGVA 2NQLA 3TOYA 3PG6A 1AOGA 2GR0A 3MSYA 4HN8A 1ZKQA 2RDXA 3BJSA 5G5HB 7ENLA 2A8XA 3R11A 4Z17A 3LADA 4J3ZA 4FP1A 5JCNA 5JCKA 2GR2A 4GGBA 3H8AA 3MY9A 1EBHA 3B97A 1ZXIC 3HPFA 3P3BA 3VC5A 3THUA 4GYPA 1GRAA 2ZC8A 1MUCA 3DFYA 3GD3A 5FS8A 4K2SA 3DGZA 1P43A 1TYPA 3H12A 4BURA 4EQSA 1GERA 1PDZA 2GDQA 2XH4A 1GRTA 2ZZBA 3FV9A 3NO1A 2AL2B 4HPNA 3VFCA 1EC7A 1NHQA 2HNEA 4GFIA 2PS2A 3DERA 3DG7A 4IT1A 3NXLA 3QFBA 1N5WC 4JDRA 1V59A 5J04A 3VDGA 1JOAA 2XH7A 2YQUA 1Q1RA 3D47A 1SJBA 3P93A 1WUEA 4E4UA 1SJAA 3R0UA 2GGGA 2QAEA 2NVKX 2OQYA 1SB3B 1TE6A 4LIIA 3B9JB 1YEYA 3CT2A 3QN3A 3CYJA 1NHRA 2HZGA 3ETRB 3EEZA 2P8CA 3SR6B 1JDFA 3JW7A 2AKMA 3T9PA 2P0IA 3TCSA 1D7YA 3UXLA 3HW2A 5ER0A 3TJ4A 1W6TA 1F8WA 4IL0A 2WOWA 3MQTA 2YAUA 2PPGA 3GRTA 4DN1A 1M6IA 4X2PA 2EQ8A 3TTEA 2OLAA 1S7MA 2HQMA 3MUCA 4MGGA 2GGJA 2O56A 3TJIA 3QPEA 4MKSA 2TPRA 3N4FA 4GYPC 1KN0A 4ZOHB 3SJNA 1JPDX 4EMWA 1LPFA 2OZTA 2R9ZA 1WUFA 5FJUA 2WP6A 1GRBA 5G5GB 2V6OA 3JZUA 3FXGA 3UCDA 5FMHA 1MOKA 4G7FA 4EMJA 1P48A 1ZMDA 4HCHA 3DG3A 2XH0A 3R07C 5FS7A 2DW7A 1JRPA 1H2IA 2GGHA 1BQGA 1MO9A 4LA1A 3AMZA 1BWCA 1XANA 2W55A 3A7RA 1TZZA 4EQRA 5U25A 1FHVA 3CGCA 1JROA 2J3NA 4IP4A 3DGHA 1X2GA 3NRZB 4YWSA 4DXKA 3L8KA 3MKCA 3UJEA 1L8PA 3NVVB 3DG6A 1ELSA 4KWSA 4NEWA 1EBGA 3PWIA 5U1OA 5IDZA 1WYGA 3ES7A 1SJDA 5ENLA 2P8BA 4K8GA 2GRTA 2PP1A 2C3DA 1N60C 1NHSA 2WP5A 4H4PA 2QJNA 3SN0A 3DH9A 2X8CA 4K8DA 4DYEA 3S5SA 4H50A 2CHRA 2PP3A 1XS2A 3OPSA 4H4XA 2V3AA 3Q4DA 3R0KA 3URHA 2PTZA 2W3RA 5GRTA 3UXKA 1ZY8A 3N6JA 1BKHA 1OEPA 3OP2A 3DK9A 3RCYA 1MRAA 3I6TA 1TKKA 2WPCA 3GO2A 1N63C 3A7UA 1FEBA 3GD6A 1XDIA 2QJJA 1ZMCA 3CGBA 3GY1A 4APNA 1JCTA 2W0HA 3SN1A 3V5FA 1MDRA 1ONFA 3DIPA 4HNLA 3UJFA 1GRFA 2YVFA 4GRTA 3H7VA 4FX9A 2AL1A 2ZZ0A 5FS6A 2QDEA 3QTPA 4F4RA 1T3QC 3AM9A 1FIQB 1FFUC 2OQHA 3SQPA 4J1OA 4FI4A 2MNRA 1ECQA 1XPYA 4DWDA 2OFJA 2WOIA 4K1WA 2PA6A 4H4RA 4H1ZA 6ENLA 1GXFA 3SN4A 1LVLA 3R10A 3LB8A 4ADWA 4HCLA 3H4KA 1EC8A 1N5XA 4H4ZA 2QQ6A 3SSZA 1RM6B 5EU9A 3HRDC 2OPJA 1KCZA 3VCNA 3D9XA 2V3BA 1N62C 4H4YA 2NPXA 3ZLHA 1GREA 3CK5A 3T4WA 4KPRA 5JRBA 3FG2P 1ONEA 2ONEA 4TVWA 4G8TA 2PODA 3EF6A 4H2HA 4MMWA 1ZK7A 2XH2A 5JCIA 4KT2A 4EM3A 1FFVC 3CGEA 3DJJA 3IC9A 2GQWA 3JVAA 5FJTA 4KPLA 4NEVA 1RVKA 5BOEA 2WPEA 3QKEA 4A3RA 2EQ9A 1GSNA 3GD4A 4E8GA 1GRGA 4A35A 3R1ZA 3ZVIA 2BC0A 1N61C 3II4A 1NPXA 3I4KA 3OZYA 4K7ZA 3UJ2A 3ZLGA 3U9IA 5FJOA 2X8GA 4DHGA 2ZZCA 4EQXA 1TYTA 1DXLA 3CB3A 2X99A 3FJ4A 3N6HA 4YWOA 3GRSA 3KLJA 3P0WA 3VC6A 3V5CA 1JPMA 2PTYA 3SBFA 3UJSA 2OO6A 2QVHA 2DW6A 4H4UA 3ENLA 3L5OA 4KEMA 4TVYA 3OC4A 2CFYA 1FHUA 2PGEA 2PU1A 4IL2A 3Q6JA 1PDYA 2XSXA 1KD0A 3ZLFA 1JEHA 1FO4A 2QDDA 3Q45A 1NU5A 1V97A 1VDVA 3CGDA 3PWGA 4HCDA 2HXUA 2W54A 1NHPA 3EKGA 2PP0A 3D46A 2P3ZA 3FCPA 2PMQA 4JN8A 3T8QA 3DESA 3DK8A 3RR1A 3TQPA 3DGBA 2GH5A 3RNMA 3BSMA 2OVLA 3OZMA 5TR3A 3RGTA 2BC1A 2BCPA 3V3WA 4EWJA 3STPA 1BZLA 2ZADA 1DNCA 3A7AA 4IHCA 1ZX9A 3S47A 1H6VA 1EBDA 2WPFA 3LXDA 4IP5A 5FJPA 3SQSA 3VA8A 4E5TA 2MUCA 3DDMA 3UCCA 3OTRA 1VQZA 2XGZA
chains in the Genus database with same CATH topology
2CDUA 4H4ZA 4EMIA 2R9ZA 1GETA 2F5ZA 2WP6A 1GRBA 2X50A 2V6OA 3DK4A 2EQ6A 3D9XA 2V3BA 4H4YA 2NPXA 4H4QA 1GREA 5FS9A 4KPRA 5FMHA 1MOKA 4EMJA 1ZMDA 5JRBA 3FG2P 4FDCB 5FS7A 1H2IA 3EF6A 4J57A 2EQ7A 4H4SA 4EM4A 1MO9A 1ZK7A 2GR3A 4LA1A 4EM3A 5JCIA 1BWCA 1XANA 2YVJA 3IC9A 3CGEA 3DJJA 2GQWA 3PG6A 2GR0A 4EQRA 3DJGX 5U25A 1AOGA 1ZKQA 3CGCA 3EAOA 4NEVA 2J3NA 2WPEA 2A8XA 4M52A 2EQ9A 1GSNA 2WOVA 3DGHA 1GRGA 3GD4A 3LADA 2BC0A 5JCNA 1GESA 5JCKA 2GR2A 1FECA 3L8KA 3II4A 1NPXA 4K7ZA 1Q1WA 2C3CA 4EQXA 2X8GA 2ZZCA 4NEWA 4J56A 1TYTA 5U1OA 1DXLA 4GR1A 1GRAA 2X99A 4DNAA 4H4TA 2GRTA 4YWOA 3GRSA 3KLJA 2C3DA 3GD3A 1NHSA 2WP5A 4H4PA 5FS8A 2GR1A 2AAQA 3DH9A 2X8CA 4K8DA 5JCMA 4H50A 3DGZA 1TYPA 3O0HA 4BURA 4EQSA 1GERA 4H4UA 1GRTA 2ZZBA 3L5OA 4H4XA 2V3AA 3OC4A 3URHA 3QFAA 5GRTA 2CFYA 1NHQA 1ZY8A 1NDAA 4JQ9A 3DK9A 3QFBA 4EQWA 1YQZA 3Q6JA 4JDRA 2WPCA 1V59A 1JEHA 2X8HA 5KVHA 1JOAA 2YQUA 1Q1RA 1FEBA 5EBKA 1GRHA 1OJTA 1XDIA 2YVGA 3CGDA 1ZMCA 3CGBA 2QAEA 4APNA 2NVKX 5KVIA 1NHPA 2W0HA 4H4VA 2WBAA 1FEAA 4LIIA 3EANA 1ONFA 1GRFA 1NHRA 2YVFA 1GEUA 4GRTA 4FX9A 3DK8A 1ZDLA 2GH5A 2ZZ0A 5FS6A 3RNMA 1D7YA 5TR3A 4H4WA 5ER0A 3SQPA 1F8WA 2BC1A 2BCPA 2WOWA 2YAUA 3GRTA 2WOIA 5JCLA 1XHCA 1M6IA 2RABA 2EQ8A 1BZLA 4H4RA 1DNCA 1ZX9A 1S7MA 2JK6A 2HQMA 1H6VA 1EBDA 2WPFA 3LXDA 1GXFA 1GV4A 1F3PA 1LVLA 2TPRA 4BV6A 3LB8A 4ADWA 1KN0A 3H4KA 1K4QA 4EMWA 1LPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRB A;  1H2I A;  1KN0 A; 
#chains in the Genus database with same CATH topology
 2CDU A;  4Z1Y A;  3BOX A;  4EMI A;  2OZ3 A;  4E4F A;  1GET A;  2F5Z A;  2X50 A;  3PK7 A;  3DK4 A;  4H4Q A;  4JHM A;  2AL2 A;  1R6W A;  3NVZ B;  3DFH A;  2FKP A;  3NFU A;  4GME A;  2QJM A;  2OG9 A;  3UJR A;  4EM4 A;  3RRA A;  2GR3 A;  1KKO A;  2PU0 A;  2OX4 A;  2YVJ A;  4JN7 A;  3TWB A;  3DJG X;  1SJC A;  3EAO A;  4H83 A;  3NS1 B;  2PGW A;  3FYY A;  4M52 A;  2WOV A;  2E3T A;  1KKR A;  4GIR A;  1GES A;  4M0X A;  2PCE A;  5FJR A;  4HNC A;  1FEC A;  2OZ8 A;  1Q1W A;  2C3C A;  1MNS A;  4E6M A;  4J56 A;  4GR1 A;  4DNA A;  4H4T A;  3EUB 3;  2FYM A;  2GGI A;  4IZG A;  3AN1 A;  2GR1 A;  2OKT A;  2AAQ A;  4DX3 A;  5JCM A;  1X2H A;  3O0H A;  4GGH A;  1DTN A;  4ZCW A;  3ZVH B;  3IJL A;  3N4E A;  1IYX A;  3CXO A;  3MZN A;  3QFA A;  2PTW A;  3QLD A;  3ZVH A;  1NDA A;  4JQ9 A;  3RO6 A;  3R25 A;  4EQW A;  1YQZ A;  1MDL A;  4M6U A;  2X8H A;  3I6E A;  2PSN A;  3OW1 A;  3RIT A;  5KVH A;  5EBK A;  1GRH A;  1OJT A;  4H19 A;  2YVG A;  3U4F A;  3CAW A;  3VCC A;  5KVI A;  2GGE A;  4H4V A;  4ENL A;  1F9C A;  2WBA A;  1FEA A;  3EAN A;  1EC9 A;  3IJQ A;  2HXT A;  3ES8 A;  1GEU A;  2POZ A;  1E9I A;  3MWC A;  5BOF A;  1ZDL A;  2P88 A;  3GC2 A;  3H70 A;  3NZG A;  4H4W A;  2GL5 A;  2I5Q A;  5JCL A;  1XHC A;  2RAB A;  1NEL A;  1STZ A;  2JK6 A;  1GV4 A;  1F3P A;  4GIS A;  4BV6 A;  4ZA0 A;  1K4Q A;  3V4B A;  3T6C A;  3NVW B;  2PTX A;  4A6G A;  2W3S A;  3DEQ A;  3IJI A;  4ROP A;  4HYR A;  3PFR A;  3K1G A;  2EQ6 A;  3KUM A;  5FS9 A;  3CXB A;  2GSH A;  3IK4 A;  3NVY B;  3FVD A;  2E5A A;  4FDC B;  2AKZ A;  4J57 A;  3TW9 A;  2EQ7 A;  2QGY A;  4H4S A;  3TWA A;  1R0M A;  3UGV A;  2NQL A;  3TOY A;  3PG6 A;  1AOG A;  2GR0 A;  3MSY A;  4HN8 A;  1ZKQ A;  2RDX A;  3BJS A;  5G5H B;  7ENL A;  2A8X A;  3R11 A;  4Z17 A;  3LAD A;  4J3Z A;  4FP1 A;  5JCN A;  5JCK A;  2GR2 A;  4GGB A;  3H8A A;  3MY9 A;  1EBH A;  3B97 A;  1ZXI C;  3HPF A;  3P3B A;  3VC5 A;  3THU A;  4GYP A;  1GRA A;  2ZC8 A;  1MUC A;  3DFY A;  3GD3 A;  5FS8 A;  4K2S A;  3DGZ A;  1P43 A;  1TYP A;  3H12 A;  4BUR A;  4EQS A;  1GER A;  1PDZ A;  2GDQ A;  2XH4 A;  1GRT A;  2ZZB A;  3FV9 A;  3NO1 A;  2AL2 B;  4HPN A;  3VFC A;  1EC7 A;  1NHQ A;  2HNE A;  4GFI A;  2PS2 A;  3DER A;  3DG7 A;  4IT1 A;  3NXL A;  3QFB A;  1N5W C;  4JDR A;  1V59 A;  5J04 A;  3VDG A;  1JOA A;  2XH7 A;  2YQU A;  1Q1R A;  3D47 A;  1SJB A;  3P93 A;  1WUE A;  4E4U A;  1SJA A;  3R0U A;  2GGG A;  2QAE A;  2NVK X;  2OQY A;  1SB3 B;  1TE6 A;  4LII A;  3B9J B;  1YEY A;  3CT2 A;  3QN3 A;  3CYJ A;  1NHR A;  2HZG A;  3ETR B;  3EEZ A;  2P8C A;  3SR6 B;  1JDF A;  3JW7 A;  2AKM A;  3T9P A;  2P0I A;  3TCS A;  1D7Y A;  3UXL A;  3HW2 A;  5ER0 A;  3TJ4 A;  1W6T A;  1F8W A;  4IL0 A;  2WOW A;  3MQT A;  2YAU A;  2PPG A;  3GRT A;  4DN1 A;  1M6I A;  4X2P A;  2EQ8 A;  3TTE A;  2OLA A;  1S7M A;  2HQM A;  3MUC A;  4MGG A;  2GGJ A;  2O56 A;  3TJI A;  3QPE A;  4MKS A;  2TPR A;  3N4F A;  4GYP C;  1KN0 A;  4ZOH B;  3SJN A;  1JPD X;  4EMW A;  1LPF A;  2OZT A;  2R9Z A;  1WUF A;  5FJU A;  2WP6 A;  1GRB A;  5G5G B;  2V6O A;  3JZU A;  3FXG A;  3UCD A;  5FMH A;  1MOK A;  4G7F A;  4EMJ A;  1P48 A;  1ZMD A;  4HCH A;  3DG3 A;  2XH0 A;  3R07 C;  5FS7 A;  2DW7 A;  1JRP A;  1H2I A;  2GGH A;  1BQG A;  1MO9 A;  4LA1 A;  3AMZ A;  1BWC A;  1XAN A;  2W55 A;  3A7R A;  1TZZ A;  4EQR A;  5U25 A;  1FHV A;  3CGC A;  1JRO A;  2J3N A;  4IP4 A;  3DGH A;  1X2G A;  3NRZ B;  4YWS A;  4DXK A;  3L8K A;  3MKC A;  3UJE A;  1L8P A;  3NVV B;  3DG6 A;  1ELS A;  4KWS A;  4NEW A;  1EBG A;  3PWI A;  5U1O A;  5IDZ A;  1WYG A;  3ES7 A;  1SJD A;  5ENL A;  2P8B A;  4K8G A;  2GRT A;  2PP1 A;  2C3D A;  1N60 C;  1NHS A;  2WP5 A;  4H4P A;  2QJN A;  3SN0 A;  3DH9 A;  2X8C A;  4K8D A;  4DYE A;  3S5S A;  4H50 A;  2CHR A;  2PP3 A;  1XS2 A;  3OPS A;  4H4X A;  2V3A A;  3Q4D A;  3R0K A;  3URH A;  2PTZ A;  2W3R A;  5GRT A;  3UXK A;  1ZY8 A;  3N6J A;  1BKH A;  1OEP A;  3OP2 A;  3DK9 A;  3RCY A;  1MRA A;  3I6T A;  1TKK A;  2WPC A;  3GO2 A;  1N63 C;  3A7U A;  1FEB A;  3GD6 A;  1XDI A;  2QJJ A;  1ZMC A;  3CGB A;  3GY1 A;  4APN A;  1JCT A;  2W0H A;  3SN1 A;  3V5F A;  1MDR A;  1ONF A;  3DIP A;  4HNL A;  3UJF A;  1GRF A;  2YVF A;  4GRT A;  3H7V A;  4FX9 A;  2AL1 A;  2ZZ0 A;  5FS6 A;  2QDE A;  3QTP A;  4F4R A;  1T3Q C;  3AM9 A;  1FIQ B;  1FFU C;  2OQH A;  3SQP A;  4J1O A;  4FI4 A;  2MNR A;  1ECQ A;  1XPY A;  4DWD A;  2OFJ A;  2WOI A;  4K1W A;  2PA6 A;  4H4R A;  4H1Z A;  6ENL A;  1GXF A;  3SN4 A;  1LVL A;  3R10 A;  3LB8 A;  4ADW A;  4HCL A;  3H4K A;  1EC8 A;  1N5X A;  4H4Z A;  2QQ6 A;  3SSZ A;  1RM6 B;  5EU9 A;  3HRD C;  2OPJ A;  1KCZ A;  3VCN A;  3D9X A;  2V3B A;  1N62 C;  4H4Y A;  2NPX A;  3ZLH A;  1GRE A;  3CK5 A;  3T4W A;  4KPR A;  5JRB A;  3FG2 P;  1ONE A;  2ONE A;  4TVW A;  4G8T A;  2POD A;  3EF6 A;  4H2H A;  4MMW A;  1ZK7 A;  2XH2 A;  5JCI A;  4KT2 A;  4EM3 A;  1FFV C;  3CGE A;  3DJJ A;  3IC9 A;  2GQW A;  3JVA A;  5FJT A;  4KPL A;  4NEV A;  1RVK A;  5BOE A;  2WPE A;  3QKE A;  4A3R A;  2EQ9 A;  1GSN A;  3GD4 A;  4E8G A;  1GRG A;  4A35 A;  3R1Z A;  3ZVI A;  2BC0 A;  1N61 C;  3II4 A;  1NPX A;  3I4K A;  3OZY A;  4K7Z A;  3UJ2 A;  3ZLG A;  3U9I A;  5FJO A;  2X8G A;  4DHG A;  2ZZC A;  4EQX A;  1TYT A;  1DXL A;  3CB3 A;  2X99 A;  3FJ4 A;  3N6H A;  4YWO A;  3GRS A;  3KLJ A;  3P0W A;  3VC6 A;  3V5C A;  1JPM A;  2PTY A;  3SBF A;  3UJS A;  2OO6 A;  2QVH A;  2DW6 A;  4H4U A;  3ENL A;  3L5O A;  4KEM A;  4TVY A;  3OC4 A;  2CFY A;  1FHU A;  2PGE A;  2PU1 A;  4IL2 A;  3Q6J A;  1PDY A;  2XSX A;  1KD0 A;  3ZLF A;  1JEH A;  1FO4 A;  2QDD A;  3Q45 A;  1NU5 A;  1V97 A;  1VDV A;  3CGD A;  3PWG A;  4HCD A;  2HXU A;  2W54 A;  1NHP A;  3EKG A;  2PP0 A;  3D46 A;  2P3Z A;  3FCP A;  2PMQ A;  4JN8 A;  3T8Q A;  3DES A;  3DK8 A;  3RR1 A;  3TQP A;  3DGB A;  2GH5 A;  3RNM A;  3BSM A;  2OVL A;  3OZM A;  5TR3 A;  3RGT A;  2BC1 A;  2BCP A;  3V3W A;  4EWJ A;  3STP A;  1BZL A;  2ZAD A;  1DNC A;  3A7A A;  4IHC A;  1ZX9 A;  3S47 A;  1H6V A;  1EBD A;  2WPF A;  3LXD A;  4IP5 A;  5FJP A;  3SQS A;  3VA8 A;  4E5T A;  2MUC A;  3DDM A;  3UCC A;  3OTR A;  1VQZ A;  2XGZ A; 
#chains in the Genus database with same CATH homology
 2CDU A;  4H4Z A;  4EMI A;  2R9Z A;  1GET A;  2F5Z A;  2WP6 A;  1GRB A;  2X50 A;  2V6O A;  3DK4 A;  2EQ6 A;  3D9X A;  2V3B A;  4H4Y A;  2NPX A;  4H4Q A;  1GRE A;  5FS9 A;  4KPR A;  5FMH A;  1MOK A;  4EMJ A;  1ZMD A;  5JRB A;  3FG2 P;  4FDC B;  5FS7 A;  1H2I A;  3EF6 A;  4J57 A;  2EQ7 A;  4H4S A;  4EM4 A;  1MO9 A;  1ZK7 A;  2GR3 A;  4LA1 A;  4EM3 A;  5JCI A;  1BWC A;  1XAN A;  2YVJ A;  3IC9 A;  3CGE A;  3DJJ A;  2GQW A;  3PG6 A;  2GR0 A;  4EQR A;  3DJG X;  5U25 A;  1AOG A;  1ZKQ A;  3CGC A;  3EAO A;  4NEV A;  2J3N A;  2WPE A;  2A8X A;  4M52 A;  2EQ9 A;  1GSN A;  2WOV A;  3DGH A;  1GRG A;  3GD4 A;  3LAD A;  2BC0 A;  5JCN A;  1GES A;  5JCK A;  2GR2 A;  1FEC A;  3L8K A;  3II4 A;  1NPX A;  4K7Z A;  1Q1W A;  2C3C A;  4EQX A;  2X8G A;  2ZZC A;  4NEW A;  4J56 A;  1TYT A;  5U1O A;  1DXL A;  4GR1 A;  1GRA A;  2X99 A;  4DNA A;  4H4T A;  2GRT A;  4YWO A;  3GRS A;  3KLJ A;  2C3D A;  3GD3 A;  1NHS A;  2WP5 A;  4H4P A;  5FS8 A;  2GR1 A;  2AAQ A;  3DH9 A;  2X8C A;  4K8D A;  5JCM A;  4H50 A;  3DGZ A;  1TYP A;  3O0H A;  4BUR A;  4EQS A;  1GER A;  4H4U A;  1GRT A;  2ZZB A;  3L5O A;  4H4X A;  2V3A A;  3OC4 A;  3URH A;  3QFA A;  5GRT A;  2CFY A;  1NHQ A;  1ZY8 A;  1NDA A;  4JQ9 A;  3DK9 A;  3QFB A;  4EQW A;  1YQZ A;  3Q6J A;  4JDR A;  2WPC A;  1V59 A;  1JEH A;  2X8H A;  5KVH A;  1JOA A;  2YQU A;  1Q1R A;  1FEB A;  5EBK A;  1GRH A;  1OJT A;  1XDI A;  2YVG A;  3CGD A;  1ZMC A;  3CGB A;  2QAE A;  4APN A;  2NVK X;  5KVI A;  1NHP A;  2W0H A;  4H4V A;  2WBA A;  1FEA A;  4LII A;  3EAN A;  1ONF A;  1GRF A;  1NHR A;  2YVF A;  1GEU A;  4GRT A;  4FX9 A;  3DK8 A;  1ZDL A;  2GH5 A;  2ZZ0 A;  5FS6 A;  3RNM A;  1D7Y A;  5TR3 A;  4H4W A;  5ER0 A;  3SQP A;  1F8W A;  2BC1 A;  2BCP A;  2WOW A;  2YAU A;  3GRT A;  2WOI A;  5JCL A;  1XHC A;  1M6I A;  2RAB A;  2EQ8 A;  1BZL A;  4H4R A;  1DNC A;  1ZX9 A;  1S7M A;  2JK6 A;  2HQM A;  1H6V A;  1EBD A;  2WPF A;  3LXD A;  1GXF A;  1GV4 A;  1F3P A;  1LVL A;  2TPR A;  4BV6 A;  3LB8 A;  4ADW A;  1KN0 A;  3H4K A;  1K4Q A;  4EMW A;  1LPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...