3RCYA

Crystal structure of mandelate racemase/muconate lactonizing enzyme-like protein from roseovarius sp. tm1035
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
396
structure length
396
Chain Sequence
VKLRDLDIIVTAPPAPGWGGRYWILVKLTTDDGITGWGECYAASVGPEAMRAVIEDVFARHMEGENPENIELMFRRVYSSGFTQRPDLTAIGAFSGLEIACWDILGKARGRPVWALLGGKMNPRIRAYTYLYPLPHHPITPFWTSADMAAESAADCVARGYTAVKFDPAGPYTLRGGHMPAMTDISLSVEFCRKIRAAVGDKADLLFGTHGQFTTAGAIRLGQAIEPYSPLWYEEPVPPDNVGAMAQVARAVRIPVATGERLTTKAEFAPVLREGAAAILQPALGRAGGIWEMKKVAAMAEVYNAQMAPHLYAGPVEWAANVHFAASIPNILMCESIETPFHDALIKGSIRVEGGYITPPEAPGLGIEVDEALARANPYHGTGLHLEMQEASCDYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF Mandelate racemase/muconate lactonizing enzyme-like protein from Roseovarius sp. TM1035
rcsb
source organism Roseovarius sp. tm1035
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme-like protein
total genus 138
structure length 396
sequence length 396
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rcyA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rcyA01
1WUEA 2HNEA 3TW9A 3T4WA 2P88A 3EEZA 3IK4A 5J04A 5FJOA 3DIPA 3T8QA 1MNSA 3P3BA 3CB3A 3P0WA 1DTNA 3SBFA 4GISA 3S5SA 3THUA 3TWBA 4ENLA 3SSZA 2FYMA 2GDQA 2P8CA 2XH2A 1RVKA 2PTYA 3UGVA 1P43A 3CAWA 1OEPA 3PFRA 3VC6A 3UXKA 3TJIA 2XH0A 3VFCA 3TWAA 4GYPC 3SJNA 3ZLGA 1MRAA 2AKZA 1JPMA 2DW7A 2P0IA 3UJFA 4HCLA 3DERA 3MQTA 3NXLA 2QVHA 3U9IA 4E6MA 4IT1A 4KWSA 2PS2A 4K2SA 3BJSA 3FVDA 2OKTA 4HNCA 3MKCA 4M0XA 3V5FA 1EBHA 4MGGA 2QJMA 5ENLA 2PU0A 1KD0A 2PP3A 3QKEA 3DDMA 2PA6A 3FCPA 2P8BA 3N6JA 3QTPA 1YEYA 3OZYA 4DX3A 5BOEA 3DFYA 4JHMA 2PMQA 3MWCA 3TOYA 3B97A 3OPSA 5FJUA 2PPGA 3H7VA 4GIRA 2GGJA 4HN8A 3D46A 2I5QA 1KCZA 3DEQA 1SJCA 3P93A 3I6TA 1TE6A 1XPYA 3R0KA 3N6HA 2PTWA 3IJIA 4IP4A 2AL2B 2OZTA 1MDLA 4H83A 1SJAA 3NZGA 2QQ6A 4H19A 3R11A 2HXUA 2OLAA 1MUCA 3MSYA 4GGBA 3UJEA 4EWJA 1PDYA 3D47A 3ES7A 6ENLA 4IHCA 3BOXA 3R10A 1ECQA 3MZNA 1JCTA 4F4RA 3GD6A 2PP1A 4YWSA 4FI4A 4HYRA 3N4FA 3K1GA 1JPDX 1F9CA 3DGBA 3JZUA 1KKRA 2AL1A 2OQHA 3TQPA 3BSMA 3OZMA 4K1WA 1FHVA 2XGZA 1BKHA 2QJNA 1MDRA 3RO6A 2OZ3A 3IJQA 1P48A 3DESA 3ES8A 3RCYA 1ELSA 2PSNA 4J1OA 3TCSA 2HZGA 4HCHA 2CHRA 2PTZA 1TKKA 3H8AA 3KUMA 4GGHA 3H12A 4A3RA 3ZVHA 2PU1A 3PWGA 1XS2A 2ZC8A 3RR1A 3RRAA 3R1ZA 3TJ4A 3Q4DA 3OP2A 3H70A 4E8GA 5FJPA 3QPEA 3U4FA 3JVAA 3V5CA 1E9IA 2GGEA 3NFUA 3N4EA 4HNLA 2ONEA 7ENLA 4DYEA 1PDZA 3CT2A 4E4FA 4A6GA 4G8TA 1EC8A 1FHUA 2XSXA 4K8GA 1R0MA 2OVLA 3RITA 2OX4A 4GFIA 3DFHA 4KPLA 3HPFA 2AL2A 4KT2A 5FJRA 3VDGA 3ZLFA 2QJJA 1W6TA 3UCCA 1BQGA 3UXLA 1ONEA 2PGWA 3FJ4A 3NO1A 1R6WA 3ZVIA 3PK7A 1TZZA 2XH4A 3V4BA 2QGYA 4DXKA 2GGHA 3FV9A 5IDZA 3QLDA 4ZCWA 2P3ZA 3V3WA 3R0UA 3ZLHA 3MUCA 3SN1A 3I6EA 4IP5A 3SN0A 3SN4A 2GSHA 3ENLA 4MMWA 3UCDA 4IL0A 4E5TA 1WUFA 2GGGA 3VCNA 3T9PA 2RDXA 3MY9A 4Z1YA 3GY1A 4X2PA 3GO2A 4GMEA 2OQYA 2OZ8A 3CK5A 3ZVHB 2AKMA 4A35A 2FKPA 1KKOA 3PWIA 2PCEA 2NQLA 3QN3A 5EU9A 3T6CA 4JN7A 2MUCA 2PGEA 3CYJA 4HCDA 5BOFA 1JDFA 3FYYA 1SJDA 4ZA0A 4Z17A 4J3ZA 4DWDA 3IJLA 2GL5A 2PODA 3DG3A 2ZADA 2O56A 3VC5A 4H2HA 2OPJA 2DW6A 4DHGA 2POZA 1EBGA 2OFJA 3JW7A 3I4KA 3TTEA 3VCCA 1SJBA 4E4UA 3RGTA 4H1ZA 3CXOA 2OO6A 1EC7A 2OG9A 1IYXA 3DG7A 1NELA 2PTXA 2XH7A 2MNRA 4GYPA 4IZGA 2GGIA 3UJ2A 3SQSA 1EC9A 3FXGA 2PP0A 4DN1A 3UJRA 2QDDA 5FJTA 4M6UA 3UJSA 4HPNA 2QDEA 3EKGA 1L8PA 3Q45A 3OTRA 4ROPA 4KEMA 3STPA 4JN8A 4IL2A 2HXTA 4G7FA 4MKSA 3S47A 4FP1A 3R25A 3GC2A 3OW1A 3VA8A 3DG6A 1NU5A
chains in the Genus database with same CATH superfamily
2HNEA 1EOMA 1S39A 4LTSA 5FEZA 3IK4A 4OBTA 3QGVA 3MDUA 5LZLA 1C9DA 3DHFA 3BLPX 3CIXA 3G0XA 4W8LA 3QHNA 2R9ZA 3ZT7A 4FALA 3LCFA 3G6LA 3D3FA 2EKGA 3MVTA 1HVQA 1ZENA 3VC6A 4MKVA 3HQOA 1PZ2A 3GH7A 2XTKA 1V4YA 3SJNA 1OF6A 2OSWA 4ROQA 4B5SA 1OD0A 4M8UA 3ALFA 4XO6A 4S3JA 2QYGA 2OQLA 4QQ3A 3OIHA 3M1ZA 3QY6A 4TXEA 1LLOA 1TELA 1W54A 4PMVA 5FAJA 3IIXA 1EIBA 4NXKA 4KF1A 1X2GA 5D2VA 3OGVA 4FXSA 1TR9A 3W2JA 2PDBA 1YXYA 4M0XA 3GUGA 2JGYA 2UY4A 2GZXA 1KXQA 2VP8A 3R07C 3BZGA 4JTIA 2DJXA 4PMYA 5D2TA 2C0AA 1OY0A 4GFSA 2VZTA 4B2DA 5IDIA 1KGWA 3WENA 1XANA 2NXHA 1GXFA 1GTEA 3OPSA 5FJUA 4DBSA 4GIRA 3KOFA 4REQB 2GQAA 2XFYA 3UYCA 3BANA 2QF7A 1XW8A 2XIJA 1DPMA 1ITCA 3MZ2A 2Z2AA 4L1WA 3T07A 1ZJHA 5LXXA 3STCA 1XUUA 4GZJA 5I79A 1EB3A 4BWLA 2EQ8A 4J27A 2OYLA 4LAUA 4UTHA 4ZVJA 3NA8A 4H19A 3R11A 1GVRA 1V0MA 4K7YA 4ZBCA 1KRAC 1PPIA 1S2CA 1KBIA 5DN1A 2PF0A 3WQDA 2PWUA 4IX2A 3F4CA 5U25A 3IGHX 1GHSA 1TTIA 2TODA 2E5BA 3R89A 4OGZA 3SIMA 4ZEPA 5E6ZA 5JXQA 1MXDA 1DWFM 4TMBA 4ZOCA 1EGMA 2PRLA 4UUIA 3SZ8A 1NHQA 2Z6JA 1HL8A 3RIKA 2GSEA 4YTQA 4HPXA 3MVIA 3W00A 5AC8A 2J79A 1W32A 2WP6A 3WFLA 4AVFA 1BSIA 5AYBA 4H9VA 5KVHA 4JTQA 2QCGA 4JKLA 4ZGYA 4IMGA 5CJNA 1S2WA 2BVWA 2XWDA 5HNTA 2CHRA 4GCAA 3SECA 1MOKA 3EXTA 1KFBA 4MZ8A 3MDWA 1WXYA 3RRXA 1QBBA 5D32A 3RU8X 4IPPA 2WCGA 3PPFA 4MNMA 1MQPA 4RV3A 4LUSA 2OEMA 3H70A 4E8GA 2W91A 2X1IA 1BKSA 4O8RA 3SIZA 1VPXA 1Q65A 3BL3A 4IUOA 4REQA 3PZIA 1LLWA 2NX3A 3VNLA 1KWKA 1EYEA 2F6XA 2VDIA 3W1PA 4UNLA 2PDUA 5FACA 1SPQA 3ZSSA 2A7PA 3W24A 2A21A 3TQKA 1O5QA 4I6KA 4H4RA 1ICSA 4BF9A 1TCMA 4H7VA 5GQBA 3W9ZA 1TQJA 3P5ZA 2J4GA 5GRTA 5DMLA 4IF2A 3B40A 3ETRB 3RYSA 4H41A 3KXQA 5DY2A 5H1WA 2ZZ3A 1GZGA 4PR4A 4G2DA 1UOKA 3NQ6A 3W7KA 4GCXA 4S3FA 3APTA 2PDYA 4FX8A 1KLYA 1YNYA 1Z48A 2WPCA 4QNWA 1B54A 1YBQB 4PUJA 4FOKA 1G9HA 3S6OA 1XI3A 3L23A 3QZ6A 2PZ0A 3L8KA 1FHLA 1A3HA 2C1IA 4XQ6A 3ENLA 2F61A 5DRCA 4IGHA 1V6VA 2OLHA 3WLOA 2VRKA 2VGBA 1PTDA 3SGGA 3NVYB 1E1CA 3HW2A 2AKMA 1BXCA 3BOFA 3PWIA 4LUSB 4ZB5A 1HUVA 1GRFA 1PVNA 5TIMA 4UCGA 3O2LA 2G50A 1NJJA 2XWEA 1KM0A 1BYCA 3UERA 2PGRA 3GTXA 4R53A 1W9UA 3W84A 4H4IA 5A95A 1TO3A 1X7FA 3GBDA 3DG3A 4MSSA 4X22A 3EWZA 1H41A 3BLLA 1NP2A 1SMAA 2ACRA 3A64A 4GPNA 3F2DA 5I3FA 4IFKB 2DZBA 1VFOA 2WPFA 3QC0A 4O0ZA 3W7HA 3VCCA 3GG7A 2XPKA 4HU3A 5ABFA 1KFJA 2OXNA 3T81A 1VYSX 1QDSA 2D22A 2XH7A 3LZ5A 1VFFA 4IZGA 2E25A 4HK7A 3E96A 3SQSA 1AD4A 3ZR4A 4Q3MA 1JCYA 1U33A 1CGYA 5G5IA 3KOYA 2QZRA 4JQ1A 1P7TB 3GE7A 4ICMA 1DOSA 4GACA 2J7BA 3THAA 4PTWA 5A8PA 1HL2A 1R87A 2D69A 1V3JA 2PWHA 1J93A 4KIEA 1RK5A 3F2BA 3R25A 4WJEA 3KRBA 4KFPA 3CJPA 3BJTA 3AIBA 4PL2A 4JHZA 4HU0A 3T09A 4IPLA 2IMRA 3IJ7A 4Q4MA 1E6XM 4JR5A 3TFXA 2BWGA 3TYZA 1DTNA 1QO5A 2ALDA 4XZIA 2W55A 3BARA 2XGIA 4QG6A 1Q4NX 3SSZA 1ZMDA 1J10A 2VFHA 3NM1A 4E38A 1RVKA 4DRSA 4RL3A 3CAWA 5LHFA 3AU6A 3MO7A 4YTSA 4LAOA 2FVKA 4N4PA 4PCFA 3SW6A 1FRBA 3S9YA 1IEVA 3KVKA 3MMUA 2A85A 1RBLA 1OFOA 4ORIA 2OU4A 1IEWA 3UWVA 2ZUMA 2WNNA 5DX7A 1TPB1 3W2LA 4GA8A 4IT1A 4X3ZA 1KBJA 3HPAA 5AHFA 2JEPA 2V6AA 3H54A 4HOZA 2OOFA 1IT8A 2OYKA 3EA1A 2VD8A 1ZPTA 3A7RA 3BLKA 5DY3A 2OGYA 3ARSA 2X2YA 5U7SA 4NZ1A 3W1RA 1TPVA 3UXIA 3B97A 3TK7A 1MXGA 1E6ZA 4PBEA 1EXBA 2GFTA 3FGCB 4NSBA 1XYAA 5JCKA 3TYCA 4OVXA 1O68A 2ZX7A 4D8AA 4MY8A 3MJYA 4DIAA 2EQ6A 1NWRA 4IISA 3H53A 3B9JB 1S38A 1VPQA 3RILA 4G9PA 4FNRA 4GYFA 3K1DA 4CNOA 5K7JA 4LT9A 3IJ9A 4LVDA 2O4QA 2DUAA 1SO6A 5FEPA 1EJXC 3B8VA 3KTXA 2V3BA 1ZCCA 4ONVA 2BSLA 2EBNA 4Q4SA 1N5XA 3BSGA 3RLGA 1LL4A 1R3YA 1XDIA 3BXWA 1G7UA 4RPQA 4W8AA 2OR2A 5ABEA 3AXHA 1TWIA 3E5BA 3ABZA 4ZENA 2BASA 3UGRA 3EXRA 1GUVA 1JUBA 1ECQA 1J11A 1XIBA 3IUIA 3WMSA 1KN0A 1NPXA 5E0CA 1OFDA 4A3HA 4I6VA 4HJFA 2WO5A 3K1GA 4MY9A 1YTEA 4UQEA 4TR9A 3FEQA 3EKZA 1XCXA 3OZMA 1IWBA 4LS0A 2GVLA 3NQ8A 3FNDA 3OO2A 5AECA 1EFZA 4FR1A 2OZ3A 4RX0A 4MUZA 2YAUA 3ES8A 5K9CA 1KRCC 1SR0A 2WOWA 5KZDA 2POTA 1FDJA 1TKKA 1NQKA 1OHLA 3WD2A 2TAAA 1PIGA 3H12A 4BURA 3MMTA 4AEFA 4X9YA 3B0XA 3GXNA 1FFVC 3GIYA 3QV7A 3RRAA 3BAWA 1D7KA 3B8SA 4LNCA 4MAVA 5AVNA 3N2XA 2F5ZA 3G0SA 3WH9A 2XM1A 3C86A 3CUJA 1G4PA 2XIOA 2E68A 4CU7A 2VWSA 1K03A 4PC8A 1NTHA 4NY2A 2BHYA 3KLLA 1Q6GA 1Z9AA 4BJHA 1P0DA 3TU9A 3H21A 3VX1A 4AZCB 1OGSA 2OTDA 4EIVA 3WQ4A 4AY1A 3Q37A 4WKAA 4F9DA 5A1AA 1F76A 3LRKA 4FK9A 3STEA 4NKCA 4JTGA 4OT7A 1RALA 3WQOA 4Y9PA 4UXDA 1LCOA 3IARA 1ZSXA 4F48A 4FXJA 1QHOA 1XSKA 4XTIA 1KBLA 5HUOA 1S5MA 1R6WA 1C93A 3CV7A 3HFYA 1TZZA 2Q8ZA 3W88A 4M29A 3R8RA 1O5RA 4O0KA 4DXKA 3WQVA 3EF6A 2FIQA 4WR3A 2Y24A 4L9ZA 1HJWA 4S23A 4ZO9A 2FZMA 3M0MA 2HE8A 3V3WA 1X6LA 4OV9A 1BF6A 2QJIA 3I6EA 3L2MA 2DT3A 4QEEA 1Q1RA 4B3ZA 1BWCA 3BAYA 1D9EA 4M5PA 4WIWA 3AQUA 2NVAA 2Y8UA 4KMQA 3NGJA 1PHWA 2CLFA 5RUBA 2RAGA 3KL0A 4O19A 4X2RA 4E5TA 5EYWA 4L64A 4UFKA 4M6VA 3AFBA 2WVVB 2X0YA 2REQB 1XBVA 3GO2A 3M6YA 4Z2IA 1RH9A 3BW4A 3OVQA 4WVXA 3LCXA 1EPVA 1LM1A 4NNAA 3W7GA 2JK6A 2VFEA 3WLSA 1N8IA 2ANUA 2I56A 1W3NA 2BNJA 3BE7A 5LYRA 3TW6A 3O1NA 1SB3B 3LHUA 1IHIA 1WDDA 4OUEA 3IJLA 4JQ4A 3GNDA 3PUEA 3PTDA 1NFBA 5BMXA 2PODA 1DWHM 1IXNA 2GJLA 2RFGA 1B30A 2W63A 1W3KA 2O4MA 5BCAA 3DZ1A 2INZA 2OPJA 1Q6OA 4JIPA 3CV1A 8CGTA 3P14A 3TYDA 1YQ2A 1BEUA 1NF7A 1XR2A 5CSUA 1KTNA 3LLFA 3DGHA 3VTRA 3M64A 2HPMA 3PS7A 1YKWA 1K8ZA 3WDJA 1VFLA 1BRLB 1XHGA 1JOAA 3HPSA 4QP0A 1XLJA 1E5NA 1BHGA 1S2TA 3W2NA 1K6AA 1K9DA 4WJXA 3H4KA 3L4YA 2Y70A 5FS9A 1UKOA 4ZO7A 4IH3A 1YDNA 2W54A 5T8GA 1RZMA 3BG9A 2BXVA 2R82A 5BRQA 3S47A 4RNIA 4PTXA 5CXPA 1QUMA 4YHGA 5C9WA 4A29A 1PX4A 3AZTA 4J3UA 3LLXA 1WB0A 1KCXA 2ZZ6A 1PYFA 3CLMA 3IC9A 5MKGB 3RHGA 1O60A 2VCBA 5H8PA 1TPDA 5DT5A 1OD8A 4YL2A 1Q3NA 1XM3A 3A3HA 1OIFA 1FWHC 1WCGA 3W7DA 3WD1A 5I7GA 1FKWA 4EXBA 5GVJA 1GNXA 3UG8A 3FLUA 1FP9A 2XH0A 3K8KA 3V35A 5EL1A 3MYPA 4JFUA 1E15A 3IACA 2DW7A 2DZXA 4CUCA 4GRTA 1LL6A 2BY3A 4EM4A 4GI9A 1FH9A 4IJRA 3GNPA 4F0HA 4NAEB 4JQ3A 2CHNA 2NXGA 3TLQA 2Y5SA 2WOVA 1PJ9A 5A6LA 1VC4A 2D1ZA 3RJYA 2OKTA 1EBHA 1E51A 5ENLA 5G1TA 2BGQA 2FZDA 4YCOA 4RW3A 3WELA 3TROA 2QR6A 4UBPC 1V6XA 4ZFCA 1ZRQA 1A49A 1K6WA 2QJHA 1XL9A 1DIKA 1RLCL 1FWWA 1CT5A 3F03K 3UWZA 5LNWA 2FVLA 2FGBA 3K4WA 4QJ3B 1FWCC 1T7LA 1ISXA 1SZRA 1XDLA 1GYLA 4M3PA 3WK3A 2V5DA 3NPUA 1H2JA 3IIZA 2UWFA 3G1VA 4Z1CA 2VFIA 5C2XA 3N6QA 5D38A 1E1FA 3RPTA 4NJKA 3WJXA 1TE6A 1ZL1A 4KGJA 2C14A 4NAFB 3WDQA 4JTDA 3IGUA 1UWTA 3CUIA 1W8SA 2XN1A 3CUZA 1FA2A 4PUDA 1N7KA 1KO0A 3UJEA 4GZEA 1J5TA 3UZXA 4PCTA 1DIOA 3UNDA 1W9PA 1JI1A 3BW3A 4CNNA 4JCLA 3WNOA 4QXIA 2UY5A 2QCLA 4Q32A 4OZOA 3HU7A 4BS0A 1ZCOA 1TFVA 1L9WA 3AS3A 3JZUA 3EZ4A 2AL1A 3OLGA 2VXNA 3UXAA 4BQ4A 4U2ZA 3NQBA 1MEHA 3JS3A 4NYYA 1CXLA 3RCNA 2C7FA 3NQ2A 4D6FA 1WQ5A 4WX2A 3IJQA 4UTWA 3QFAA 1X98A 3WQEA 1V0LA 4WCJA 1MRQA 1WKFA 1TRDA 1VHNA 4DUWA 4GQRA 4MZYA 3DGRA 1F61A 1ALDA 2WANA 4HTBA 4L4MA 4MADA 4CD7A 2G8ZA 3O15A 3D3AA 3WLPA 2PDGA 2WWCA 2Y7GA 3QEZA 3THCA 1AMKA 1RY8A 3V1HA 1KV8A 4BQ5A 4FNQA 5ABFB 1A5SA 2NZLA 1OC7A 2YPIA 1TX2A 4DYKA 2CLMA 3P67A 4W93A 1WXJA 2ZZCA 5K9DA 5A6BA 3EWWA 3SR7A 2GK1B 5JUVA 1DXFA 3URNA 1RVGA 2XFWA 4DAIA 2BC0A 4FEZA 2G3NA 3A5VA 1H11A 4X60A 2OJPA 1JYNA 3W73A 2ZOXA 3PHAA 4TUFA 4KFOA 4IFOA 2KAUC 4JTKA 2JKAA 3L2LA 3VOGA 4TO8A 5CKSA 1JG9A 3L12A 2QVNA 1KCKA 1ZHAA 1E55A 4DYJA 3H7RA 5E70A 4QLJA 4P7OA 3SJ3A 4O11A 1SFTA 1JPHA 3B9EA 1V7AA 4LH8A 5D37A 3DFOA 3W7JA 1W5OA 4R7JA 4K68A 3UW6A 3QLDA 1IXPA 3N18A 3BAKA 4AHPA 2EG7A 4O53A 1RP8A 2QJGA 4XAFA 1QNSA 2VNCA 3XISA 5ABHA 5CSSA 1ZBVA 5D9MA 4CU6A 1KGUA 4ZOAA 3L4WA 4F9JA 3AMLA 1PV8A 3WQFA 4N4QA 4ZR8A 3RJXA 2I16A 3L67A 2VTFA 2AGTA 5EMJA 3I3BA 1P0BA 2QPXA 1XRTA 2YB1A 4CLMA 2C18A 3MSGA 4LF1A 5H8UA 4AIBA 1KV5A 5I06A 2PCEA 1SU5A 1T40A 3TNBA 2BVDA 1Q6FA 4PUUA 3CWHA 3C0LA 2NVCA 1KFKA 2GJRA 4DWSC 1OFRA 1SSGA 5HUPA 2BVTA 3SUUA 3LB0A 3LCIA 5E9AA 3PZMA 1O1HA 2VZSA 2DV0A 2WBGA 3NXFA 1UASA 3UA4A 5CLWA 1HW6A 1X39A 4XD3A 3NL6A 1F5ZA 1NFGA 3AJ7A 3KRSA 3VNMA 1SJBA 3W85A 1X96A 1CNVA 4QR6A 2TMDA 4ZB0A 1KGXA 1KM6A 3UR7A 3OLDA 1CB7B 1TVPA 1XLBA 1B31A 1NELA 3ABSA 3Q6JA 1PZ3A 4U4MA 4IGNA 4AEOA 2XVNA 3HG2A 4IGSA 2DVTA 2JIEA 5HATA 4HNVA 2C19A 1POJA 4IL2A 1QO2A 3VDCA 3EPOA 2HXTA 4EF8A 1BSLA 3PR2A 1IZKA 4J57A 4UFJA 4LCSA 3MCNA 3O9NA 3GRSA 1TTJA 1XIJA 2E67A 3FEMA 3DG6A 1H1YA 1W9BM 4V15A 3EEZA 4CN1A 3HGOA 1XQKA 1W0MA 3VKDA 1YXDA 4A05A 2FFIA 3ABRA 3PPCA 1FWFC 4MYAA 1HF6A 1MO0A 3UR2A 1TVLA 3THUA 1YTDA 2V3FA 1OFBA 2P8CA 2ZCGA 3ARWA 5C2CA 1F73A 2QMJA 1B57A 3GR7A 5I0DA 1P43A 1HO4A 5HPOA 1A0CA 2V81A 4JIEA 1W5QA 5M5DA 5C9UA 2AKZA 4QM1A 3B8TA 5DMMA 3CQ0A 2P0IA 2TPRA 1DYSA 4DWSB 3ARPA 1T41A 4NI8A 4OWGA 4JX6A 2XSAA 3GVRA 5A8QA 3U2CA 3A4XA 3FA5A 1DKWA 1KTCA 4OOZA 4GUJA 2B31A 1TPFA 3LG3A 3DENA 4QLKA 2F6UA 4H9ZA 5DEZA 3B0PA 1ZX9A 1UKPA 2ZXQA 4JCMA 1ITQA 2YOCA 3NVDA 4FNTA 4NNBA 4G1KA 3EX4A 3KE0A 3P8JA 2FHBA 1LWHA 1OYCA 4I9TA 3JR2A 1EGVA 4N6EA 3TX9A 3MWCA 3NNTA 3TOYA 1U1JA 3NQCA 1Q13A 4O1FA 1GG0A 2I5QA 4C6QA 1XF0A 3RU6A 3CWOX 1QPNA 4MHBA 4FR6A 2YA2A 3DHUA 2X05A 1C7TA 1OJXA 2DT1A 4NZFA 2IKGA 1EA9C 2BC1A 3B04A 3E38A 3QQ1A 1EKOA 1V5XA 2FH8A 3OBKA 1CEOA 1Y0EA 3AS1A 1UKSA 4AY7A 4PRWA 5G1YA 4BI6A 4YJ5A 4ASTA 3THQA 4BWLC 2HNHA 2QQ6A 1IR2A 1N5WC 3R7MA 1PDYA 1V3IA 1UPMB 5C70A 3S5OA 3C0SA 5AFDA 4HMNA 4DAFA 1H61A 1OK6A 3MZNA 1GORA 4KEUA 2O0TA 2YDQA 3M41A 4C65A 2FPVA 3APYA 3K8LA 2GR0A 4FPSA 1JPDX 2XZ9A 3R0DA 4ZZ9A 2GK1A 2V82A 4QE4A 3RPDA 1LORA 2PWEA 3SCOA 3MCOA 3UPBA 4TVWA 3ZM8A 4ATWA 2GPTA 1GONA 3SFWA 3CNYA 3CQHA 4JZ5A 1TG7A 2YSWA 3DOPA 2ZRUA 1JJKA 3OQ8A 3EDJA 1JNDA 4P2VA 3URHA 4FIQA 4QGCA 1G0CA 1RJQA 1MQRA 4K6AA 3AXIA 3GG0A 4IG2A 3R1ZA 3CPGA 1H5YA 3O3RA 3SB0A 5AVHA 4GC4A 2BGSA 4Q22A 1NARA 1FP8A 2W6RA 3QHMA 4HHPA 3SCQA 1Q2RA 3TYEA 3P7YA 3SGZA 5BXSA 3MHFA 1MZRA 3WD3A 1P5BA 3A3XA 3TSBA 1SO3A 2R1PA 2GGEA 2ONEA 1W31A 2AMXA 1E4NA 4ERIA 4US6A 3G8EA 1XC6A 4J5NA 2CLKA 1DORA 4EPEC 5CBBA 3UQNA 2BCPA 4CCZA 2F38A 4H9XA 1UA7A 4RV8A 5JBDA 3MC5A 3CV2A 1FO4A 3VIIA 4IP7A 2W5FA 4FLSA 1KM2A 4PGLA 1K7FA 1RK6A 1K7EA 3GU2A 4AVOA 1S7MA 3N29A 3T0DA 3W7IA 4CQ9A 4TVCA 3TZFA 2O55A 2CLLA 3SDOA 1P6BA 2VFFA 4N9BA 3RX3A 4UZSA 1VJSA 2E7FA 3VGFA 5EMKA 1QXLA 5FSDC 3VYLA 1O95A 3INPA 4JIRA 3K46A 2QNEA 4MB5A 3PN8A 3IRSA 2DPEA 5I3KA 3QF0A 4IP5A 4M24A 4O4WA 2QF8A 3EX1A 3SN0A 1MXSA 2QAEA 1I8JA 3MUZ1 1VBRA 3MWAA 5D30A 4TU1A 4XVEA 1LROA 3GM8A 3HZ3A 1F6KA 1JAKA 2E6YA 4NF7A 3H2OA 1SZFA 5DXXA 3OBEA 3ZOAA 1XDMA 1VYPX 1NVMA 1JGMA 4X2PA 1HJXA 2O9PA 3EGJA 3GLCA 3VKJA 4HPJA 3F7JA 3QR1A 4EPBC 3EMZA 3QN3A 2ZX8A 3L4VA 1ZJBA 2NW0A 3AHZA 1KR1A 4HHMA 1AFSA 3F4DA 1K9TA 2GVYA 1JDFA 4LOCA 1OX6A 4TX8A 5C9RA 3VIFA 3L21A 5AYIA 4KGLA 1NWSA 3OZPA 5LGXA 4NNCA 4RK8A 4ML9A 1HO1A 1TIMA 4MG4A 4DHGA 2V63A 5H91A 3NZPA 4W86A 3WNMA 1XX1A 3GYEA 3G2GA 3TSDA 3NR0A 3MP5A 4C60A 2IPFA 1GOIA 4J2PA 2PTXA 4LAKA 1EZWA 1UUOA 3LNPA 1CGUA 1TV8A 4PB4A 1F3XA 5GNXA 4RCXA 3VZXA 1GG1A 3QH2A 1C29A 4S38A 3QRHA 3H23A 3K4AA 5FJTA 1C91A 3FAXA 1Z8AA 1FHDA 2QEZA 5T91A 4MOZA 1V0KA 4NJIA 2AAMA 4PRTA 1DVJA 2DZPA 2VWTA 3I7QA 1O7AA 1IT7A 4DM1A 3WLJA 1B4EA 4MWAB 5J04A 2PDLA 1Q5MA 3JUGA 4JOMA 4GH1A 1ZAIA 3EKLA 1Q1WA 1ZJAA 5K4XA 3MMDA 3WQPA 1UR2A 3V0SA 1YDYA 1LOLA 4Y9AA 3LM7A 2Q01A 1OB0A 2VVSA 2HTMA 3PB2A 5F2MA 5AOUA 2E6FA 1UD5A 2VO5A 3UGVA 1IR1A 4NL1A 4JX5A 3MHGA 1XD0A 3O6AA 5ABTA 3KBJA 2VHLA 4TVDA 1C9WA 1E71M 3MKKA 1KB3A 4M6PA 3LXBA 2H8ZA 5F4XA 1GZJA 4NUWA 1KBBA 4E0CA 4M6QA 1QOPA 1K7XA 4K2SA 1EH9A 5HNRA 3WBAA 1ZJIA 4EAMA 3USBA 1BGGA 2ZIDA 4WOQA 3TAOA 3DDMA 3W01A 1DXIA 2WMKA 2P8BA 4IMAA 4CEXC 5AYZA 3VIKA 4GG9A 1JDAA 3OZYA 5A2BA 3OU8A 3IVTA 3U5YA 3TJLA 1ZB5A 4HOWA 1XLFA 4PMXA 5GJNA 1AMYA 2Z4GA 3DAQA 3OYZA 1DWJM 1CI1A 2WZTA 4JGDA 3KCOA 1STZA 4JFTA 4WKFA 2B7OA 4ICNA 1RLDA 1EF2A 3P93A 1FECA 3LPFA 3M0YA 1ML1A 3WLLA 3P0XA 2E1WA 3QKZA 1GOXA 3S4TA 4H4WA 1VH7A 4GX8A 3O05A 4RXFA 3SAZA 3EWCA 1EJRC 1Q6DA 2PTWA 2QCDB 4IP4A 2I14A 2BXZA 4UZUA 4PL1A 2I9EA 2G96A 1Q6QA 3H4WA 3ABXA 1EEPA 5I3GA 4GUIA 4GYKA 1I2QA 2DZSA 3LGGA 4GI8A 1QJWA 5D9NA 3E02A 3GFYA 1RQBA 2WMFA 4F0SA 3UR5A 1ZAJA 2BBFA 2J27A 2V9DA 3M47A 4MB3A 3QFBA 5JCNA 4G56A 3GTIA 2WJFA 1KNWA 4DBUA 1ZAHA 4HJWA 3GW3A 1PKLA 2HE5A 2C8NA 4FAMA 3PBWA 4XBJA 4P8UA 1U5VA 5CJ5A 2CZEA 5DLCA 1XLCA 1XLKA 1N61C 3N2MA 1AJZA 1E6QM 3NYZA 4MFEA 2ZUTA 3P81A 1EXPA 1DBTA 2O92A 1OGGA 3R94A 1NAL1 2GWNA 2XN2A 4L61A 4C6KA 5T9CE 1NWTA 5EMMA 4XTDA 2IPGA 4H4UA 2WV8A 4I7WA 3B8IA 4WLCA 3LTYA 2PTZA 5HDRA 1JFHA 3BGAA 3VD3A 1AW5A 3NZ1A 2W92A 1VYRA 2DZTA 1VRXA 3K30A 2R1LA 2Y8KA 3BZJA 4HA1A 5CG0A 1F07A 3KP0A 3QBUA 3GWQA 3LCHA 5FJPA 1PSCA 3W2KA 1VRDA 1QMLA 3SGUA 5LA0A 1I2RA 1PL9A 4I5RA 3F2CA 3WLMA 2YDRA 2OLSA 1VPYA 4QG8A 6CGTA 3KCJA 5KTLA 4H4XA 3GDBA 1IGWA 4A6GA 3W02A 1NHSA 2JE8A 3AZSA 3VE7A 9XIAA 4DO6A 1PUDA 3VD9A 4D9PA 3GD3A 4N0RA 1S5TA 2GQ9A 1CBGA 1H1ZA 3RITA 4JHOA 2GUBA 1VHCA 2YL6A 4H8VA 2GDUA 1PZ1A 3I3DA 2J74A 5HQEA 2ZDSA 1S2UA 3C2YA 3WL0A 3CZEA 2CC0A 3C0JA 1J2BA 3MV11 3GHRA 1QW7A 2GR3A 3F5LA 3JRKA 2PGWA 3O63A 3SI9A 1KRBC 3NZRA 2VJXA 1V3LA 5XINA 1JRPA 1P1MA 1SUXA 1B9BA 5CC6A 3ZMRA 1O66A 3B9AA 2OKOA 4AYSA 4H6KA 2EPNA 3GVWA 5LA2A 2Z1KA 4BR1A 2JKPA 2WHJA 5AHLA 4ILSA 4AMAA 2BLEA 3T2PA 5F7UA 4R3UA 3VIPA 5CPOA 1WZKA 2I17A 5FL0A 4Y7EA 2YBUA 2GH5A 3BV7A 3DECA 4AZHA 6ALDA 1JR1A 1VCFA 4I90A 4B91A 1U1UA 4J4KA 5DBUA 3KW3A 3BJFA 3EA2A 1J0HA 3HIJA 2Y2WA 4GMEA 4EQXA 3QPZA 3ZVHB 4LW7A 1G7VA 2XISA 3NUKA 3WQ6A 4YNGA 1GERA 4V28A 2H3DA 4WRHA 4UCFA 4US5D 1F4HA 1ZLPA 4H01A 4XKYA 2D2OA 2I5IA 3HM7A 3LHWA 4U28A 3UZJA 3W7EA 2C16A 3L7RA 5TF0A 3W1QA 5I00A 1TMHA 3R79A 1MZHA 4LVFA 4RE3A 5HXMA 3WNKA 3UY8A 1BYBA 1J0YA 4PTMA 3W72A 1XG3A 1WZMA 4NG3A 1J12A 1YADA 4WDXA 2WHKA 3C2EA 2RHGA 3JW7A 3S2LA 2WNZA 2ICSA 3DFSA 3QVQA 3NIYA 3QSRA 3UETA 1XH0A 3KP1A 4JY9A 4E3VA 1JQXA 4IWWA 3W87A 2OO6A 1EC7A 3AS2A 1LPFA 4H4QA 1FX6A 4GYPA 2X7VA 4UFMA 5HK4A 3TYBA 1FWJC 2FB3A 2XIQA 4J56A 2C15A 3ARVA 4NZJA 1TV4A 2Y7DA 3N19B 5HJXA 2NVKX 4JTLA 1LDCA 1OT2A 5ER0A 3HGRA 1JI2A 3NEHA 1PYMA 4JN8A 5KMYA 1XRSA 3GD4A 1H0IA 2C1GA 2ZA2A 4XD5A 4FP1A 3E3HA 1GCYA 4UTMA 1A4LA 3OZOA 3V18A 4AZ6A 3QOKA 4C5ZA 2IKHA 5EMLA 4UIOA 2VMFA 1LYXA 2YFNA 4AYGA 1X2HA 4GIAA 1XICA 1MNSA 2XIBA 1IXOA 3LEPA 2WZMA 2VEKA 2J8GA 2WSYA 7XIMA 1U83A 2INEA 1PKNA 1H63A 4WF7A 2ZFAA 4XIMA 3EX3A 4GH3A 1G67A 3WLQA 3HA1A 3WY1A 2CZFA 2P1FA 5PTDA 3BMWA 3WBYA 4C7GA 4LALA 1A0DA 1XBXA 3IUHA 1MYRA 2HS6A 1X1NA 3KTCA 1HIZA 3VINA 4Q8PA 4F66A 3SSJA 4AH7A 4B16A 2FGZA 3SURA 4XAZA 3GNNA 1CENA 4IX0A 2J7GA 1JZ4A 3TUUA 3UWQA 4S3DA 4AHQA 1KD0A 3KM8A 4KRTA 4WK9A 4Q8WA 5BU9A 3EOEA 3HGJA 4UOJA 1U1HA 3H55A 2YDSA 3WUFA 1W17A 1KXVA 4CU8A 3KEHA 4OE7A 1CGWA 4B9YA 2WOQA 4CQDA 1WYIA 1XGEA 4M51A 2QCEA 1VJIA 1FCBA 1TPUA 2ZUSA 2OOGA 2WM0A 3H7VA 3DFTA 2PWDA 3QQ0A 5I09A 4L4OA 4PA8A 1GOQA 4G7EB 2PGFA 5SWUA 2BOFX 1AW2A 4DZHA 1YNPA 3LNMA 2DSUA 3N13A 3W07A 5JBEA 1SJCA 1ZBCA 1NP0A 4LV4A 2X1SA 4RNHA 1Q66A 1G4TA 3LS9A 4JQAA 3NDYA 2P10A 2VUYA 2Z26A 3E0WA 2H90A 1IWPA 4LS2A 2WVUA 4O52A 4GVGA 4IXXA 3R0KA 1X1OA 4GI4A 1DJQA 2BDQA 3M4HA 1UG6A 2VQUA 3PZ9A 3LI0A 3NOYA 2PRMA 1UHVA 3I10A 4GNKB 4A8RA 1GJPA 5G4HC 3KFTA 1MUCA 4GGBA 3M0IA 1LVLA 4QFUA 3WH5A 5KITA 1T3QC 4XZMX 1BWVA 3ICJA 1CWYA 5I23A 5AC5A 4YWSA 1TWZA 3IS4A 3QW3A 1A50A 3N4FA 3B8WA 3P61A 1DQWA 2V68A 3N4AA 4GO9A 2DSZA 2HK0A 4UTJA 3EWDA 3GXTA 4C1KA 4ZQCA 1DJNA 1X97A 4XD4A 1H7OA 3U7BA 1KXHA 2ZTKA 3CH0A 1MNZA 5FF3A 3VD4A 5CSRA 1E70M 4HT3A 3HO8A 1P48A 2B0MA 1N8WA 3LHYA 4IPJA 3N04A 4LAZA 4GKLA 3TCSA 2YJQA 2QUVA 1LRTA 5A2CA 4MDPA 4J9JA 3H8AA 2CFYA 2QAFA 2OELA 2Z1BA 1W91A 4FX7A 4S39A 2ACQA 1NSJA 4Q4QA 3GDKA 3BAJA 2FB2A 4WOZA 3UZZA 3RCMA 3NQGA 1GV4A 3OP2A 3WF0A 4MNKA 4UQBA 5F1UA 3CU2A 2FJKA 3SQPA 4IMFA 2RGLA 3F4WA 3AHYA 4FIRA 1SGJA 4NILA 1BVNP 2VELA 3II4A 4DYEA 2PF8A 3TC6A 5L6UA 1S3HA 1TR1A 3ARYA 1FXQA 2YXXA 3QC3A 2DY3A 1NQ6A 1UWIA 2OVLA 3CIVA 2HQMA 1HG3A 2PLJA 3CTTA 4ADWA 2GUYA 3HPFA 3GKFA 3GHTA 3VDGA 3ZLFA 3MU7A 3DI0A 1CLVA 1W6TA 4A2SA 1J0JA 1US3A 3DGZA 1W3IA 1K9FA 4TVYA 1PAMA 1SZNA 3FJ4A 3ZT6A 3URQA 4K3ZA 1FFRA 4GXWA 4QSFA 3UP8A 5CEWA 5CJMA 3FG2P 4ZXOA 2W79A 1H7XA 3LXDA 2P3ZA 3B9DA 3PC0A 2C71A 2VD9A 3GU1A 2GQ3A 5BU6A 3EB2A 2V3DA 3ONBA 5HANA 2JKEA 4RE2A 1K8YA 4FDCB 1Y8BA 3T0CA 5I07A 3DFQA 9XIMA 3GC5A 1E6NA 3WUGA 1XYZA 4M81A 1VD6A 3FW6A 1OFPA 3G1AA 4Z0JA 1FWTA 4YTUA 3N17A 1SZEA 1XJBA 4BV6A 1C8QA 5DRIA 2CDUA 3G22A 2FKPA 1LJYA 1KKOA 1I75A 2I5GA 2MUCA 1RR2A 1D2KA 3WBEA 2VFGA 2FTPA 4B5UA 1XLHA 3CMFA 4RNFA 1Q7QA 3B0VC 1V8EA 1QK0A 3H2CA 3ZQ9A 1ISYA 2WLZA 3WQGA 3L0GA 4LRSA 1W9DM 1V02A 4OUIA 4UQDA 2GQ8A 3OC4A 2BB0A 5AHEA 1JDEA 1M5WA 1IF2A 2NV2A 4DBDA 2WSKA 1V3MA 3F1QA 3QM3A 1E9LA 4UTFA 1XQLA 3VK5A 2KZHA 1IYXA 1HQTA 3H22A 4KESA 2DU2A 2MNRA 3W6YA 2A6LA 4GIYA 3UESA 2V38A 3CAKA 5BMWA 1FWEC 3T40A 1UYQA 3N1AA 1XKYA 2ZZ4A 4K8DA 1BG4A 2R6OA 4Z2JA 3SCPA 2HS8A 3ZXWA 5AKQA 3AMCA 1XIEA 4GBUA 1XDJA 3PPHA 3QMSA 1TUFA 2PDIA 4MPKA 1SYTA 4YTTA 2HDJA 3UZ5A 4UQCA 5FSEC 3WQCA 3KBVA 3N9RA 2NUYA 1ODZA 4L6DA 3HGSA 3KAOA 2E09A 3FDGA 4JTAA 3KHDA 4F40A 1MSSA 2OT1A 3L0NA 4A3UA 4DNMA 2BXYA 1E0TA 3IJDA 2HQAA 4AD2A 1E0XA 4MNJA 3LHTA 1RJRA 1P6WA 3KCLA 3KOWA 2YA0A 3SBFA 3N25A 1E6SM 1TIWA 2YKKA 3FIGA 3D6NA 4AF0A 2XH2A 3RMEA 4PCSA 3M7SA 4GY7A 4XK2A 1J18A 3LA4A 1A3WA 4GYPC 4CQBA 2XINA 3M7WA 1DE5A 1GYNA 2QPSA 3T42A 4C6JA 5BWFA 1JCNA 4EK7A 1OK4A 1PWMA 3W7OA 3WEZA 3R8GA 4Q8QA 3QOMA 1TTPA 2ACUA 5AZ1A 4UTTC 3CGEA 1JZ5A 3BJSA 2YVGA 2A2IA 4CNUA 1VFHA 4LYRA 2QJMA 4YIWA 4EX4A 4WY0B 3D0CA 2R1KA 1G4EA 3IK2A 4E2DA 3LU2A 3XIMA 4JL1A 3FCPA 2DQXA 3E2RA 4Q7BA 1Y65A 4HNUA 1VBJA 2XVLA 1W56A 4XV0A 3AOFA 4FNSA 2V67A 2ZRXA 3GNXA 2VGIA 4HNOA 3UPMA 1VKFA 2J77A 4NT0A 2PPGA 3TMLA 4JTUA 3U7VA 2R94A 3C2OA 2GGJA 1HGWA 1MMFA 3VCRA 2VQTA 1QNVA 1VEMA 4LVBA 3CQJA 3A12A 2YW3A 5FA5A 3R13A 4ZO8A 2X99A 2R1NA 3IJ6A 4MAZA 3I6TA 2IQTA 4WKHA 1OSEA 3C4UA 2PBOA 4OTKA 5IOBA 1K3UA 3M43A 3GC4A 4XKYB 3U48A 2XU2A 3SUSA 4LUYA 3GXIA 1QR7A 3NGFA 1SJAA 3IIOA 3WMLA 2A8XA 2FDMA 4G1NA 3OGSA 5A5WA 2VDGA 2FDSA 2OLAA 3P82A 4LU0A 4EWJA 2V8ZA 4U31A 5D8ZA 1BAGA 5E93A 2J88A 3TR2A 3V5OA 1UH4A 2FZ8A 1JCTA 4H9TA 1KR0A 3W1UA 2BY1A 4AZ7A 3NQEA 3OODA 4W89A 2QUTA 4HYRA 3PUGA 3FKKA 1HFBA 5C71A 2ZRZA 1KKRA 1ICQA 1EP3A 4KCWA 2QW5A 4Z1DA 1MFVA 3Q58A 4D6DA 2DT0A 3ARRA 1B5TA 3GRIA 3W1NA 3S2JA 2ZYFA 4RR4A 3EWUA 3NQDA 3A4WA 5BXTA 3CHEA 2Y8VA 3BH4A 1ECEA 1C90A 1OCJA 2ZXDA 2WCSA 4BF5A 3M0KA 2NUWA 3FKRA 3VOHA 2BX7A 4CN4A 4PZVA 1XS2A 2WC3A 1J79A 3H7UA 1Q63A 3G1SA 3LSCA 1O5KA 2GR2A 2V3GA 1RUSA 4MDOA 3WK0A 3W26A 2PD5A 4ADTA 3MP3A 1YDOA 4L1GA 3U4FA 2VEIA 3SRFA 3VNKA 2BP1A 1ZFJA 1BF2A 2VKZG 3L5MA 1PDZA 3S83A 1E4LA 1K1DA 3NRZB 4NP7A 2DH2A 4DO5A 1AZ2A 4GOAA 3UNTA 4RKAA 3CHDA 4PMUA 3MSRA 2WMIB 1OC5A 2GVGA 3TP4A 4IMEA 1ADSA 5LNSA 1MUMA 1QPQA 2WXDM 3EAOA 2ZA3A 4GY1A 1BTMA 1QWKA 3C3NA 3PJXA 1EHNA 4GD0A 2WQPA 2WJEA 3SM0A 1V3HA 4QITA 2NSOA 1S1PA 1WDPA 3VDAA 2HJPA 2VR5A 4WD0A 3VIHA 4UTWC 3PZVA 4XVDA 3URAA 3UCCA 5AN7A 3LTPA 5M2FX 1X7IA 4CCDA 1U2YA 3NO1A 4RDYA 1F6PA 3CV6A 2IPJA 5K3VA 2ZE0A 5FD0A 2FHFA 3UFYA 5ABGA 2EQ7A 2WCAA 3WZ0E 3FYPA 3LBMA 1ENUA 1YHTA 4GQQA 4W7VA 2GGHA 4UOZA 4F3HA 2PDKA 3LK6A 4DZAA 1FWDC 2FPYA 5D9OA 3WYZA 2A3EA 2ZX6A 3GS6A 1QPOA 4Q8VA 1JEZA 1K8XA 1JCMP 4EF9A 4INFA 2ZX9A 2WMIA 2QIIA 4AD4A 3WLNA 3MMWA 5CBJA 4MMWA 4O1BA 4WDUA 3PTKA 2D73A 3KZSA 1WUFA 3L66A 3NG3A 4TTUA 5CZJA 4Z1YA 3FN9A 1JCXA 1FWNA 2OZ8A 1YXCA 3CK5A 2R14A 1ISWA 1T8XA 3WDPP 4QAIA 3VGGA 3IANA 4H2CA 2JQXA 2CWNA 2D23A 4EVZA 3PG6A 5FESA 2QCHA 5AHNA 1I0DA 1L6YA 1VBGA 4PBFA 4AD3A 4AX7A 5BOFA 4D6GA 3FYYA 4GBDA 3PBGA 4ZQNA 3W1MA 1RA0A 4HQVA 1OX4B 4LB4A 3VMNA 4RLIA 4LNYA 5KINA 2O56A 1JYXA 5LIUX 3MI3A 4L65A 3KLJA 3REQB 2FZNA 5DMYA 1FWSA 4C7FA 2X50A 4H1ZA 4ZTYA 3O0KA 2X2GA 2OG9A 4I9AA 5HA7A 1LOSA 1O5XA 1X8FA 1GKPA 1YW1A 1K4HA 5A6MA 1R2RA 3G18A 3DFPA 4JTEA 1NHPA 4LAMA 1OZQA 2QDDA 2WPGA 1IT0A 3UJSA 4UWMA 4ZSTA 5M03A 2F6KA 4K8HA 1C92A 4R7OA 2CU0A 3KBSA 2X16A 4G7FA 4S3EA 2W0UA 4UFLA 3O6YX 1F3EA 3OA3A 1KBKA 3TW9A 5LXEA 2BODX 1GQKA 2WLYA 3AS0A 3CZGA 5C9ZA 1Q85A 1VB9A 2BTMA 3NJ3A 3WN6A 3CB3A 2Y89A 1J6PA 3UCQA 1X6UA 2RDWA 3S5SA 4ENLA 2GDQA 4CCCA 1WO2A 1WKYA 4B5TA 3SUTA 1RHCA 2EQ9A 1PEZA 1HJQA 1CXHA 3EPMA 1XG4A 1I45A 1PX8A 4HCLA 2YX0A 1XXXA 3BUVA 3U9IA 4A3QA 2TSYA 2WZIA 1V6UA 3T05A 3DC8A 3VNYA 1M9HA 3NO3A 3FVDA 5B7ZA 3W3OA 4IOTA 5FI8A 1F8MA 4IIGA 2MANA 3GG1A 5CPTA 3FY1A 1VAHA 1W1B1 2E9LA 1W1A1 2YCLB 3ZYZA 3RLUA 4DX3A 5T26A 3L2IA 4FZIA 2X0SA 5A8GA 5FS6A 3NQAA 1A5NC 3LX9A 4MB4A 3UVIA 2GOUA 4C1NB 4DJDC 4LV9A 3SCRA 3W23A 4QJ5B 4HN8A 2PC4A 3ARZA 4ZE4A 3S1VA 3GFZA 4XB3A 1V6TA 5F4SA 3QMTA 3GR8A 2X1TA 3B4UA 2RDTA 3VMPA 3DKLA 3GDLA 5HMDA 1N60C 1UKQA 2BMBA 4B4HA 3VNJA 2V30A 4KQNA 5HWJA 3NYDA 1I6NA 3B4YA 3HG5A 5AC7A 4H83A 3RM9A 1CW2A 3HURA 5D8WA 1ADOA 4A8IA 4AX6A 4P7LA 4B5NA 1KM5A 4URIA 1E5JA 3TTYA 3A4JA 1H7WA 3MYOA 1XGDA 4C6LA 1XUZA 5HULA 3GKAA 2W61A 3BLIA 1UWRA 1E43A 3MBFA 2EXOA 2QUMA 1FWRA 5I02A 3LSBA 1R5YA 2EHHA 3HMCA 4MUPA 1LBMA 2HMCA 5CAHA 3TXVA 1WAUA 3W27A 1WBHA 1FWGC 5LIWX 2RUSA 3QY8A 4DF1A 3DX5A 3QFEA 4K39A 3H6OA 3WX7A 4K7VA 4EM3A 1S46A 2NWSA 4D6HA 1F74A 3AMKA 2HZGA 3IIVA 1VIZA 3TEVA 5AC6A 1EO7A 3EYPA 1GW1A 3C8NA 4JN6A 2DVUA 1UQZA 3CH9A 2PDHA 1T8QA 2DIJA 2CKSA 4OIFA 2ODOA 2O7SA 2PI6A 2YL5A 3W7PA 3K4DA 4XWUA 4LIIA 3A23A 3W70A 4B4FA 1UD6A 4W85A 5BRPA 2IKJA 1SW7A 4JDBA 1E9IA 1VCGA 3U0HA 4L7ZA 4L80A 4X0VA 1UOZA 5XIAA 1EEXA 4DO4A 4FLRA 1NOFA 1YLVA 3OBAA 1SMDA 3GHUA 5KZEA 3WL1A 4DJEC 1FHUA 4LWWA 4KETA 4QQUA 4K8GA 4MLRA 5CGTA 1Y5VA 2XZ7A 2OX1A 1S5WA 3P8IA 2X1RA 2GVEA 4DJFC 5FJRA 3PZQA 1UP0A 3IV3A 3LM3A 3Q65A 2XGBA 4MYXA 1HP5A 3JU2A 1UWSA 3LY0A 3TA6A 4DXXA 5K2ZA 1ONEA 3OHIA 3E2VA 1S5VA 5EBKA 2E6DA 2ZXBA 3L65A 5FAGA 5KZMA 4B5WA 3CHVA 4IPIA 4XZLX 1GETA 4HK5A 2E0PA 3N9KA 3ATZA 1QPKA 4AD1A 3EMQA 5JCIA 1J8VA 1XIHA 3P5YA 5CH9A 1D8WA 3PG8A 3WFZA 1KFLA 4O15A 2EPKX 1K77A 1F8WA 2VC6A 4HP5A 2GSHA 4UOQA 4AFYA 2C0HA 2PD9A 3UCDA 1N8FA 3M0JA 4R9XA 2G4FA 3M44A 3U2OA 3GG8A 4DUVA 3GIQA 1XCWA 4CVWA 1WYGA 1MI3A 3L0KA 1O12A 3LGDA 1M03A 3W81A 2CBUA 1ZALA 2C79A 2EG6A 4GY0A 2HBXA 3GAKA 4Z08A 4JYEA 1UJQA 4QDPA 5TAOA 1C8VA 1LZOA 1UR0A 2NX9A 3AIWA 4XUGA 1MFUA 3BC9A 2ZADA 5G1MA 1OBAA 1V0NA 1EX5A 4F0RA 4RJEA 3N9SA 1W1PA 3I4KA 3TTEA 3LCLA 4P7RA 2ASHA 2PTDA 2CLHA 3II1A 4DBWA 1U5JA 3ARXA 2Z1XA 4ZQRA 2VGGA 2F84A 1US2A 4Y9NA 2OB3A 2DGAA 1TX0A 1ZXIC 3S5ZA 4Q33A 3W29A 5I3DA 3FXGA 2WKJA 4AC1X 1AZ1A 1GW9A 4C6EA 4M6UA 2CLOA 2IKIA 2ATSA 4AVNA 1H60A 1EJSC 2YR1A 3G1RA 2WJZA 4BF7A 1YTKA 1FOBA 1R3QA 2WNWA 4PBGA 1RQEA 3PBYA 2JK2A 5FCZA 4MNLA 4PSPA 2E4TA 2H8XA 2GOKA 1WV2A 2P5NA 4HB7A 4A22A 4MJZA 3I68A 3CUFA 1QNPA 3AYRA 4AQLA 3S5NA 1JROA 3B9OA 2J6VA 4JTTA 1XLLA 2J7CA 3UWWA 3S42A 1X1ZA 3OB8A 3AUOA 4G7EA 4XBKA 4DXVA 1UUMA 3HB9A 3SRKA 1UH3A 1MQQA 3TQ0A 4F8XA 1R7AA 1Q8JA 3CAVA 3T8LA 3W7RA 1C3FA 3F4VA 2BZNA 1W9XA 4J40A 4LYQA 4QHRA 3VDBA 1KFEA 1QRQA 3MQTA 2CBIA 3E74A 3WLHA 1IGSA 4ZXLA 4DJEA 3ITOA 3OVPA 1UBPC 3FSUA 3G77A 2PDWA 1Q6CA 1J9YA 2E3ZA 4B3LA 3VD5A 3QV8A 4EOUA 1XWYA 3CZLA 4LUIA 1H1NA 5FIPA 3PB0A 2OCZA 3C5QA 2PDQA 3DFYA 4W5UA 1EL3A 5I03A 1V7YA 1B0IA 5DMNA 2V2DA 2WKGA 1E6PA 3FVMA 4O16A 4PEKA 5C7HA 4O17A 4GLEA 1TQXA 2J7EA 3ITGA 3TXZA 3PNUA 1UZ1A 3IIPA 4JICA 4G6CA 3UU0A 1KCZA 4WSKA 3U2ZA 2J9XA 2G3MA 4S2BA 2WBKA 1NDZA 3BAIA 5L9FA 3TTOA 3TCEA 3HJEA 1PB0A 3P60A 3TN6A 1E3XA 2WVTA 4X63A 4OHQA 1R7OA 3VXGA 1GVFA 3RMJA 4RPPA 1QW9A 4M19A 4N9EA 3NPVA 4FX6M 3WQWA 2JEQA 1RQHA 1WAWA 2OEJA 1GJUA 2YVFA 3MB9A 4N9CA 4BEQA 1UZ4A 2W62A 5TNVA 1JFXA 4U3CA 1DJZA 3F4NA 4MB1A 2E5AA 2R8WA 4ORMA 1GVEA 4UTKA 4H9YA 1QW8A 5LSMA 5CZ0A 4LBRA 3QR0A 4CD8A 4C6CA 3I6RA 4BI5A 5G5GB 1Y7VA 1BLIA 1XLAA 1FHVA 2AQOA 2QHAA 3P2VA 4PMJA 1UR1A 5A2AA 4HZ8A 2PE4A 1MDRA 1EJWC 3C0QA 2H9AB 3BLDA 2DZWA 5F2LA 2PWGA 3MCMA 2DT2A 4NASA 4FB7A 4J1OA 5E0FA 1JDDA 1LRNA 3C3UA 4C6PA 2FPTA 4YVPA 1OFAA 2WHMA 2PZNA 1VQZA 1Z42A 3PWGA 3S3GA 4JAWA 3QZEA 1CGTA 4DJDA 4LX4A 5EPDA 1KM4A 2IXVA 3RG6A 4AZIA 2CEQA 1LBLA 1AG1O 2G0WA 3URBA 3I3EA 2UBPC 2FTWA 1EUAA 5HR7A 2GYIA 1ZS2A 2WVSA 2A5HA 1JULA 1VEOA 1DV7A 3ITLA 3WIJA 3HF3A 4KPRA 4N9DA 3GQYA 2OX4A 2WMHA 2AL2A 2NT0A 3O6CA 4JTRA 2VR4A 2J7DA 1R47A 3WO8A 3SADA 2W4XA 1F3TA 4JFWA 4EXQA 5A69A 1BQGA 1WE5A 3C2RA 4QCFA 3GW0A 1DJIA 3W0KA 5DELA 3IJ8A 3O0FA 4D2JA 4BI7A 4OBRA 2E5DA 1QWGA 1FWIC 4JL2A 4M82A 4EACA 4PFHA 2G3JA 1M65A 1SFJA 6REQA 3RM8A 4AZGA 5IHSA 1JXKA 2PDNA 1ZK7A 5TBOA 5M1TA 1EDQA 1L6WA 3SN1A 4F2UA 3SCWA 4NZ4A 1Z44A 1C8YA 2WSRA 4ALDA 2ZZBA 4G5DA 2PB1A 5CPQA 2OWCA 1VQTA 1MW0A 1DP0A 5LA1A 2EAWA 2AAAA 3L4TA 2EPHA 3MY9A 1FQ0A 1NF0A 1Q4WA 3PNZA 3IPWA 2YCEA 1EYWA 4UR9A 3BG3A 3CS2A 3BLFA 3GAYA 1MO9A 2JF6A 4Q4OA 4IJCA 3AU2A 3G1HA 3BCJA 5EU9A 1XHCA 4RZ6A 4JN7A 3IAQA 3CZJA 3CYJA 2WVVA 3N73A 2HROA 1XIGA 1XSJA 3ZJ7A 5D04C 3FDKA 4IJBA 3Q2DA 3GZAA 3LUTA 5I2UA 2CZDA 3GFXA 3NQFA 2GL5A 3WF1A 5AC4A 4W84A 2ZZ5A 1QI4A 1Y5XA 2NLYA 2QULA 1Z3NA 1M68A 3NVTA 4GWEA 1SW3A 4LEQA 5G2HA 2D2GA 3LXCA 4QISA 3KRZA 1UB3A 4XO7A 3RK8A 4ACZA 4Q6JA 3R6IA 4ZB2A 3AIVA 3UBPC 3BICA 1EC9A 3KBNA 3OLEA 3MPGA 3SQLA 3UY7A 4HPGA 4QE5A 1W5PA 2B81A 4L4PA 1XFBA 1TTQA 1OVDA 2ZC1A 2QDEA 1QAPA 2CKRA 3Q45A 4ROPA 3STPA 1EPXA 3G3MA 4YN5A 1REQB 5A6BD 1XKJA 5LNUA 5EY5A 4ZSUA 1EP2A 3NQ7A 1CIUA 2C6QA 4K8EA 3OW1A 4WSJA 1HT6A 3W7NA 3WNNA 2NX1A 3CPRA 1P7TA 1I2PA 3DK4A 4YMZA 3PBUA 4EMJA 3P3BA 4H50A 3OGRA 3WF2A 1TA3B 8A3HA 5FKYA 3A21A 4H6EA 3A5FA 3LV5A 3BMVA 1GOMA 1EX1A 4Q8OA 2Q3OA 1QPRA 3EDDA 6A3HA 1DIDA 4FNUA 4Q4RA 5HJYA 1OEPA 4H8UA 4V2XA 3A47A 2ZTJA 1W1ZA 1EZ2A 3RX2A 1CLXA 3GTNA 1JPMA 3THDA 4XSMA 2P3EA 3L5AA 4HSOA 2WYSA 3UJFA 3TTSA 3T78A 2QVHA 1XBYA 4I3GA 4DI9A 4Y2WA 2CHOA 4AISA 4DJFA 2WZEA 3DC0A 2VDHA 4M7SA 3UT0A 1ZP4A 4YVXA 1PTAA 1WNOA 3DKJA 4J3WA 3ZS4A 1AK5A 3EX6A 1XYLA 3QMRA 1OF8A 2E9MA 2IPWA 4LY8A 1LRQA 5CG7A 3N2CA 2PEVA 4GNVA 3LYEA 5DXYA 5AYYA 3KVMA 8XIMA 3WLKX 2GR1A 2YXGA 4GQGA 4TIMA 4C6NA 2FGLA 4PCPA 5BXRA 3KZPA 1YYAA 5J5RA 5HINA 2VENA 3QZAA 3CYVA 3EDKA 1ODUA 3EXSA 3RM4A 2XYLA 4GXMA 6PTDA 3E49A 1QHPA 4S3GA 5AHMA 5BZAA 4QS6A 3MUY1 4H9MA 2BOGX 4LBSA 3TFCA 5CQ1A 4F0MA 2I57A 1IIHA 4LCQA 2FZ9A 4HZ6A 3HOJA 2FLIA 1TJ1A 5C2GA 4S3AA 1SFSA 1HZYA 2PDJA 3C6CA 3LTSA 2V6OA 1LG2A 3DFNA 3PZTA 1Y5WA 1XIFA 1QOXA 5E9XA 5DO8A 1JUKA 1N55A 3W75A 5FEWA 3ME3A 4IHCA 4NZ5A 3CZ8A 3BOXA 1QVBA 4HHHA 4O1CA 3CTLA 1ITXA 3A7UA 4J28A 2ZZ0A 2X8CA 4KCTA 4B3KA 3CO8A 3ARQA 4H4VA 2A3CA 4QRNA 4W87A 3DBNA 3E2SA 3E1F1 1G69A 1XIDA 4QTGA 1PTGA 3BSMA 4K1WA 1FH7A 3PTMA 5MKGA 5FF4A 5A6SA 2OMAA 1HXJA 5E6YA 2WBAA 2QJNA 4H7ZA 3PJWA 7REQB 1EBDA 1PKMA 5AY7A 4US5A 3AHVA 4RZ5A 4UTLA 1NOWA 3WLRA 4FXRA 1CXFA 4A3RA 1PZ0A 1J96A 3GHSA 1BQCA 4LGXA 3PVFA 5D33A 4DWSA 2ABBA 4YTRA 3R12A 1GOWA 3NSXA 3TN5A 4AXNA 2JIWA 4UR7A 1JF5A 3I4EA 2A1YA 3TDFA 3WD0A 3GH4A 1E9YB 1VENA 3COTA 3GNRA 4P8XA 3V5CA 2PC8A 1VBUA 2ON3A 1FY6A 3LZ3A 1HN1A 3L5LA 1DJYA 1KWGA 2Z6IA 2WOIA 6REQB 4GVIA 4J3VA 4OJYA 2BOEX 1E40A 1S2AA 4DI8A 4KWVA 4Z1AA 2Z7KA 4C90A 5C0QA 3DFHA 1BXNA 3W7QA 1E1EA 2J7HA 3CGTA 1HKIA 3GB6A 3KS5A 4KWOA 4BFAA 5U4NA 3AISA 4TX6A 1YE4A 4D8ZA 4DLFA 4H6QA 2EGZA 2X8HA 3CGDA 2QGHA 3WKZA 4A2RA 4Q8TA 2DZAA 4AY8A 2F2HA 5IDZA 1XH1A 4JIHA 3GVGA 1FXPA 5AB3A 5EFDA 1E4MM 5M17A 2W3SA 4GC3A 4CNPA 4N42A 1XSIA 2W27A 1W2VA 4JY8A 2E6AA 4H4TA 4PULA 4J3SA 4MLJA 1GREA 3W53A 2NT1A 2BHZA 1YNQA 3ID7A 3CC1A 4IQJA 3HRDC 1KQZA 3KS6A 1DHKA 3R8HA 2NVDA 2E28A 8TIMA 2EG8A 3UG4A 4EANA 3VCNA 3T9PA 2CZ5A 2CW6A 8XIAA 3LN3A 1IIGA 3G5EA 1RD6A 1X38A 4K1GA 1E0UA 4QNEA 3EWBX 1QNRA 3B05A 1VJZA 2KX9A 4KWWA 1KCLA 3GXDA 5KSWA 3OLIA 2C3DA 2ISDA 4YYCA 3N12A 1A5AA 2H9AA 2WZHA 3A9BA 4LUTB 1REQA 2QUUA 3AHTA 4JFSA 3N15A 1FH8A 4LF2A 2OODA 2A3LA 3E5PA 3VX0A 3ZJKA 5BYWA 4B5VA 1FTXA 2XJ7A 4HHLA 2WW5A 1D3GA 1UD2A 4H2HA 3PG9A 3W82A 2OO0A 2J13A 1JGIA 2HWGA 4XAPA 5CCZA 2NPXA 3KBWA 5F2GA 4LC8A 1BTCA 4TMCA 1O6IA 4S3KA 3RXZA 4P8VA 1VBHA 3AN1A 2BHUA 3PP7A 3AIEA 5D4YA 4XZHA 3UJ2A 2DQWA 2QDHA 1US0A 3WQ5A 4EP8C 2PLMA 1GHRA 3G1DA 4JYFA 1KFWA 2P0OA 2YBTA 4ADUA 5D2WA 2Z0IA 2E77A 1AOGA 3KL3A 4GE8A 3TMQA 4NYUA 3ANYA 5CC3A 5HNUA 3WK2A 3UR8A 1CYGA 2XIMA 4QCEA 2CBJA 1T96A 3E0LA 3YPIA 3BLOA 2G41A 2P88A 3VIMA 4JDRA 2VX6A 3C56A 1L2QA 5B7YA 5FJOA 4GIEA 2W3RA 4FMVA 4RUBA 2VEMA 3P0WA 5CPLA 1YE6A 2VX4A 2I9UA 2VOMA 1AH3A 3EDFA 5A3HA 3FOKA 1TPEA 1RCQA 1MW3A 2B4GA 3EX2A 3QYSA 3VABA 3GDMA 3NURA 2V2CA 3TJIA 3DYMA 3S9IA 4PYSA 3HPXA 3TWAA 4IQLA 4CN6A 3JZEA 1DIEA 5TR3A 4EPKA 1CGVA 2DSKA 3WBWA 5DFAA 4BQ2A 3VAVA 1UZDA 1WZLA 3M5VA 1RD5A 4WSHA 2PRHA 1GPWA 2YZRA 1W1YA 3DERA 1HL9A 1X6NA 3NL3A 1F7BA 4IMCA 5D9PA 1E0WA 3M0ZA 2Q02A 3QKEA 4OECA 3UWUA 3N6JA 4AUBA 1GVSA 1YEYA 3VMOA 4XBSA 3MANA 2QT3A 1WBJA 2HSAA 2VEGA 4J7RA 2XUCA 1A80A 4AC7C 4H4SA 4L6OA 3V0UA 3AHXA 1R46A 1XCFA 2CBVA 1RXOB 3VNDA 3RUBL 1EDTA 1OCQA 1OYAA 2YLAA 3HV8A 2PBGA 3DEQA 1IZCA 3B06A 1XGZA 3BAXA 3L4ZA 3OJGA 2G97A 3EUB3 3AAMA 1ZMCA 1QI2A 3BQ6A 5I6SA 3WF4A 1NDYA 5XIMA 4ADSA 3TONA 5TD4A 1JZ3A 3AYSA 1SO4A 3IGXA 1MDLA 3T0BA 3A22A 2EPLX 3M5YA 3VNZA 4ZMGA 1AQFA 3MSYA 4GXPA 2ZUWA 2E8YA 4C6FA 3AIRA 6ENLA 1ONRA 2XHYA 4NXSA 4UTTA 2D0HA 4M80A 5A6AA 1EWDA 4K38A 4LVAA 2VR2A 4OBSA 2BV9A 3PAJA 3PY2A 5IFTA 4C1LA 4QAWA 3GD6A 1Z7AA 3IGSA 4C5YA 1OX4A 3VIJA 5IXEA 1I1WA 1QTWA 2QV5A 4EQRA 2XVGA 1F9CA 3W1AA 1GKRA 4XUYA 3GDTA 4GUFA 3NAVA 2ZZ2A 2GSJA 3ARUA 1WP6A 3L68A 3T4CA 2Q09A 3WG6A 1BPLB 3RFAA 1EWEA 1ELSA 1Q7MA 2Y85A 4LXFA 1OCNA 1LWIA 2OWXA 1NHRA 1UD3A 4H7CA 4DPQA 3GNOA 3CO4A 2WWDA 4LS1A 2JGQA 4Q8NA 2ZC8A 2EPOA 4NAEA 3ERPA 4ACZB 1M04A 4ZL1A 4V27A 3UEQA 1J0ZA 3EA3A 2X41A 1EIXA 1TVNA 2X1UA 3PTQA 1SVDA 3EAUA 1ZKQA 3N4EA 4TX9A 4HNLA 1UZHA 5HBFA 4C6OA 4E4FA 1MEWA 4MY1A 3VPLA 4MWAC 4Z2GA 1MW2A 4HD5A 1HKVA 2D20A 1Z69A 4N7QA 4IIFA 4H00A 1R0MA 3VGDA 1CCWB 5EBAA 1BVWA 4KRUA 2DJLA 3G0UA 4H4ZA 2J47A 4GRSA 1M7JA 2QJJA 3WMBA 3BCFA 2FQIA 1OM0A 4XZBA 4KCVA 2FFCA 4RDZA 2WQDA 4PFMA 5D02A 1GSNA 3OA5A 4AU0A 2PDFA 2YQUA 1EJVC 1MW1A 4GI6A 4CKQA 3FV9A 1JRBA 1WX0A 2QDGA 2WM1A 3W7MA 3GXPA 3CIWA 4AF0B 1W3JA 1VCVA 4AZ5A 1TV7A 1AL8A 3AXMA 1G5AA 2ZUVA 4AIOA 1A5CA 2P50A 1DQXA 3AYVA 1ZBWA 3ZIZA 1EGZA 4PH6A 4B15A 1SSDA 2YCLA 1R38A 1GOKA 4W5ZA 5BW6A 4Z42C 1ZBKA 3IUDA 1DWIM 3G1YA 5KEZA 1ME7A 4JD4A 4GYJA 1K4QA 4NVTA 1ISZA 2HEJA 1B1YA 2ZXAA 4YYFA 3MA8A 1ME8A 2OSXA 3Q94A 2NQLA 3VD7A 2VM8A 3T6CA 3T7VA 3PJTA 3DYOA 5I78A 3BOLA 2DP3A 5BWAA 3IAPA 1W3LA 3BDKA 1GPFA 3UXDA 2WSPA 3QGKC 1XYBA 3U4AA 1HNYA 4J3ZA 4PUKA 5REQA 1H6VA 2V5CA 4EQSA 1ZNNA 4AW7A 3NQMA 1N62C 5EBUA 4N2YA 4PSRA 1W1VA 4HSNA 1MUWA 2HISA 1F4AA 2OFJA 4HIBA 3L5OA 1W37A 2ZZ7A 2G37A 2XFRA 5FS7A 3GVVA 1XLIA 2CFFA 5IFPA 1GESA 1R3SA 4X0NA 3DG7A 3WH8A 1W5MA 3UG3A 2RABA 1HP4A 1X8CA 5CSYA 2GGIA 3HFTA 1EF3A 1P4CA 5E0KA 3WFAA 1ZUAX 4L4LA 3VI2A 5JH2A 3L4UA 1RM6B 2DVXA 4HOXA 3WDHA 1XIIA 3MV01 1M7OA 4Q4PA 5K9XA 4RW5A 1KXTA 4JIIX 1HKMA 1UMYA 3LB8A 4AZBA 5HQMA 4MKSA 4LA1A 3A13A 5E5CA 3CHFA 3VA8A 4ZO6A 4F2TA 5AYXA 3RO8A 3FK4A 4UTIA 2EO7A 3T8QA 1EHAA 4HMEA 5H2ZA 1UC4A 1N2VA 2YZ5A 5CPSA 1JZ7A 2PFHA 3WJSA 1TPC1 4D8LA 1NIUA 3AZRA 4AIUA 2WAGA 2PTYA 2TYSA 3MI6A 2WKLA 2GVJA 5JCLA 3IEBA 3AIUA 3U6WA 5LNVA 4L9YA 4F0LA 4WQ6A 3PUOA 3W83A 3ANUA 2BS9A 4R88A 3RX4A 1ZGDA 1DWAM 3I7SA 3WH6A 5IRPA 3IVUA 3OHMB 4GR1A 5K4ZA 2B7NA 5T9BG 4U33A 3SQMA 2Z29A 3CBWA 2PWVA 1TV3A 3WH7A 2QMKA 4IIBA 4DUXA 5GNYA 3FX4A 1GRGA 3W37A 4WGHA 2W3ZA 2PU0A 2PA6A 1IZJA 1IE7C 2EEXA 4NI3A 1BWKA 1C7SA 4PUEA 2D3NA 5LHEA 4FHAA 1JCJA 3N34A 3EB4A 2ZRVA 2VGFA 4KEZA 3P6LA 1UQYA 1RBAA 3J7HA 1AQHA 1M3UA 4MIMA 1VEPA 4DVOA 4YHEA 2Z1SA 4AXKA 5BROA 1A5KC 3ZR5A 1GQLA 3HTWA 5D09A 5GPRA 1POKA 1ONFA 1A47A 4YVVA 3KDOA 1OIMA 2BGNE 1NM9A 2OEKA 4MFDA 1RAKA 3N6HA 1A0EA 3DHDA 4H3DA 2OZTA 1W8GA 2XDFA 2ISWA 1D3CA 2YIHA 1WA3A 3WBXA 1EJTC 2Z2UA 3U3HA 1IXQA 1ZP3A 4KS0A 3ITCA 3H2FA 1B3OA 2J66A 3ZR6A 3KL5A 3D47A 1A5MC 1VFMA 3R10A 4PEEA 1H2IA 4NAFA 3NEVA 1IV8A 3DI1A 5E1QA 3M5XA 1H62A 5KZ6A 2AQWA 3TZNA 7A3HA 3VOJA 2CYGA 2O7QA 1FFQA 4LUJA 4FI4A 4DZ5A 1JD9A 3EEGA 3MP4A 2Q8XA 4M7TA 1KM1A 4OKDA 3ABQA 1EOKA 2OQHA 5C7VA 2W9MA 4NJGA 4PMQA 2XGZA 1UKTA 4O1EA 1SFLA 3VZYA 2RDUA 3KWXA 1YBQA 3W2UA 3GRTA 1HJUA 3DESA 3WNLA 2WMGA 4JIQA 4RE0A 1V6WA 4U3AA 1CB2A 2A0NA 3TN4A 1VFSA 4UTUA 4TOQA 4U2YA 4GQBA 2W0HA 2QS8A 3TKFA 1R2SA 2A79A 1P1XA 1EA0A 1DEDA 2ISSA 2WB5A 4Q8UA 3S1XA 1TJRA 3CGCA 2V5LA 3HG4A 1H4PA 3G3DA 3VM5A 1BWLA 4E2OA 3IVSA 1AL7A 1CXEA 3QJAA 1YRRA 2CWXA 3BW2A 5D2YA 1HVXA 4HKPA 2Q8LA 3WDRA 4QBXA 2VYOA 3S5YA 2B7PA 4IIHA 2VOTA 4CVUA 1H09A 4O4VA 1XV8A 3UA3A 2VCAA 3ITTA 1F8IA 4R33A 3BQ5A 5A6JA 3ZFHA 2VCCA 1BXBA 3W7LA 1L0PA 2P76A 4H04A 1VFUA 2O9RA 2VZOA 2CNCA 1PKYA 1THFD 3CQKA 4QIUA 3BLEA 4FLQA 4O8AA 4PTNA 5HNNA 2CETA 3GK0A 3TYUA 4IICA 3W4RA 4OQVA 3O8AA 1QI3A 2YCIX 1E4IA 4PUNA 4GK8A 4WZHA 3LHVA 4LEFA 3ATYA 4GHRA 4DNHA 5HQLA 1TSIA 2GJPA 4LQ1A 1JL8A 4MWAE 1WPCA 1VR6A 1P6CA 1TPWA 2DSWA 1XRVA 3HBLA 2QCCA 1TV5A 1V79A 2OSYA 4LBUA 4HSHA 1MWOA 4QE1A 4GO8A 1S3TC 1XBZA 4D72A 4IFRA 3WLTA 4MZ1A 1GQIA 1JEHA 4HZMA 4BZYA 3VDHA 2QIWA 4FS9A 1W3TA 2WPEA 3STGA 2DDXA 4BEUA 1TCDA 3S1GA 2A3AA 3UF9A 1J5SA 3VO0A 3KVLA 1U5HA 2GGGA 1R8LA 1B3ZA 2A3BA 2RDXA 1CTNA 1G4SA 1OFEA 2ZRYA 4KW2A 1V51A 2IUZA 3LLDA 4HGXA 2OQYA 3M0XA 3NVZB 3S8HA 3ANVA 5HMFA 5EB8A 1UJPA 4Z1BA 3SCNA 1FBAA 4KKXA 3QPYA 1VLWA 4HYWA 4LSBA 8RUCA 1AD1A 2PGEA 1JF6A 2P53A 3LMZA 5H6HA 4HZ7A 3M5ZA 1B4KA 3E0IA 5C6MA 1ISVA 3GH5A 1KC7A 1PIIA 3UZWA 3DN5A 4ZOEA 4NJHA 2H3BA 1UP3A 3BMXA 4DF0A 4R27A 1KFCA 4MVAA 1LQ2A 5IBXC 4K37A 5JMUA 2PCQA 4UMAA 2VFDA 1D8CA 1HJSA 4QJ1A 2G3IA 4J2MA 4E4UA 3CUHA 4ZQPA 5JH1A 4WDWA 4PUMA 2J7FA 1A4MA 3M0HA 1QI5A 4F79A 1GZ1A 4UC5A 1R3WA 4KERA 1EQCA 3P74A 4AEEA 3NPWA 2TRSA 1IEXA 3W2MA 4PTDA 4XIAA 1G1YA 4MM1A 3TIMA 3WJYA 4YCPA 3DH9A 1F3PA 4DN1A 2FMNA 3UJRA 4ZOHB 1LQ0A 3T2OA 4KRZA 3DHPA 3PSWA 2VRQA 4JKKA 2Y88A 3PM6A 1M7PA 1FUYA 1M41A 4CD6A 3V1PA 2QLYA 2CERA 4XISA 4NQ1A 4YU1A 3MT1A 1NDVA 1XYMA 2VEFA 1FWAC 1DTUA 2EPMX 1UMLA 5CZTA 4GJ1A 3T4WA 3M16A 4WHBA 3IRDA 1VLIA 2CZVA 1TYGA 3DIPA 2X40A 1MEIA 1DNCA 3EOSA 3N14A 2OWWA 3BWWA 4DELA 2ESCA 4GISA 2Q3RA 3TWBA 1EDGA 2Z28A 1XYFA 1TMQA 4NEWA 2ZDRA 3G8RA 1L6SA 1SR9A 2AOSA 3MUIA 3VFCA 1DHPA 3E0FA 1W5NA 2D0GA 3AROA 1AVAA 5CGQA 1PWLA 1PBGA 3LDVA 3U2EA 1OJTA 1ICPA 4ERGA 2XG9A 3NM3A 1DQUA 3H2AA 3O6DA 3AM9A 1QNQA 1DJXA 4UQAA 4PE8A 4M1BA 1ZY9A 3ZWSA 2E5CA 5I5RA 3V5FA 2NQJA 1B3WA 2E8ZA 2PP3A 3G1FA 5GNZA 3LERA 3PZNA 3T55A 3QTPA 1JYWA 5HMEA 1O1ZA 4UFIA 2VVNA 3C2VA 5EMUA 3B0YA 3HQ1A 4LCRA 1KW1A 3CMJA 2YYUA 3C52A 2NQ9A 3N3MA 4FOJA 3N2TA 3O16A 1WOAA 1LQAA 1UUQA 3O06A 4DLMA 5G5HB 3NVWB 1IEIA 2YL8A 3BGGA 4LJ3A 4L9XA 4GNJA 2VUNA 4X9SA 2YDAA 1E73M 2JF7A 2Z2BA 1JD7A 1TJPA 3D5HA 4CD4A 3FA4A 4IQEA 3MKVA 5CC5A 4M1RA 2R91A 4S3BA 3NCOA 1LF1A 5HJLA 2QCNA 1RCXB 3KHJA 1K9EA 2CESA 4DZIA 4GX9A 3I65A 4V1XA 3NL5A 4TTGA 4UNIA 1D7FA 3SUVA 1GEUA 5EGRA 3ES7A 4NU7A 3MS8A 4PMRA 4PMOA 1Z6KA 2X8GA 4IFKA 5G4WA 2HV5A 3SRHA 1ESWA 1GVOA 4YXGA 2Y7FA 4AHOA 2CPUA 3AMGA 4ACYA 5LIKX 2V5JA 1M53A 1LOQA 2G5WA 4DUOA 5B80A 3H4GA 2DIKA 3DGBA 1YQZA 1CX9A 1GJWA 3VGEA 2V5KA 4AWTA 1UR3M 2HVNA 3TQPA 1OWQA 4ZODA 4ZTXA 2Z24A 4Q8MA 1BKHA 1SQ7A 3WJZA 1GEHA 5GJMA 3RO6A 4B90A 3GIPA 1ZTVA 2ZBTA 4W7UA 2PSNA 3VOIA 4FX9A 2F9RA 3QQWA 4YWOA 2Y63A 1UCWA 4Y9MA 3EMCA 1Z41A 3ARTA 4GGHA 1LT8A 1R85A 4D6JA 5G2IA 3FS2A 3CWNA 4E8CA 1RP9A 3ZJ6A 1A53A 7REQA 1G01A 2CLPA 4XKMA 4HMCA 2RH9A 4JTJA 1UD4A 2IQDA 3VE9A 3M46A 2XN0A 3FJNA 3W1XA 1V59A 2Q6ZA 4G8TA 6TIMA 4A8LA 4IG2B 1TPH1 3C2FA 4EMIA 3VGHA 5REQB 2IS7A 4FF7A 3RLHA 4M52A 1E9ZB 3EB3A 4AWUA 5FF0A 2ZKMX 2FJUB 5IM51 5A8OA 1WDQA 3PBMA 1OG0A 5J5DA 3TQVA 4JPGA 4NX5A 3DJGX 4WXZA 3FAWA 2G3FA 4E2BA 4FXFA 3KLKA 1JCLA 4WY0A 4I7VA 2YXOA 3VOFA 2XH4A 3CB8A 4M56A 4W88A 1WZAA 3AWNA 4ES4A 1UPPA 2Y62A 5DCDA 5JBFA 1TWWA 1TYPA 5BOOA 3CUXA 2Y4SA 1QK2A 2B7QA 5BRBA 1B2YA 1UP2A 4NZ3A 5HR6A 2GJXB 5FS8A 5ECVA 3WDIA 1XISA 3ABOA 1R3TA 1J01A 3TSMA 2TPSA 5I3IA 3BK0A 4B2DD 1CXIA 3NQVA 2ISFA 4DBEA 4Z0SA 2Y0FA 1FEAA 3VGBA 1LWJA 3R4IA 2PDXA 3LENA 2E40A 1WDRA 3TC3A 4DJED 3S6TA 2V2HA 5A94A 5TQLA 7ODCA 2J78A 4BQ3A 1UR8A 1TE1A 4Z17A 3U5UA 2Z7GA 1J2WA 2E9BA 1A5LC 4CQCA 4XZNX 3S1WA 3VC5A 1XLDA 3AUJA 3SR6B 4QROA 1R30A 1H5VA 1WKEA 1Q6EA 3LCWA 3WD4A 1B3VA 3QGAC 4P61A 3RGTA 1M6JA 3CGBA 1ONXA 3DK8A 2J9ZA 1R9XA 4EMWA 3G1XA 3W1LA 2DEPA 1B3XA 3BV4A 2RGMA 1TV2A 3NZQA 2UY2A 5CGMA 4MF4A 4CNSA 3BTNA 3T2QA 4O0QA 4JEQA 1O4UA 4ZOBA 1OG6A 4HK6A 2ZVIA 1GGOA 3H26A 1L8PA 4KWUA 1HTIA 2I7GA 3LPOA 4I8DA 4AMCA 3VUPA 3SCTA 2WNQA 3ITXA 1W1TA 4HA4A 1EUNA 3DU0A 3GC2A 1OC6A 2NXIA 4H4PA 1FKXA 2LLEA 2IQ0A 1NU5A 1WUEA 4FOUA 3R2GA 3TV8A 3VKCA 2VURA 3A9IA 3KRUA 4AZCA 3QV6A 3UWEA 1TWSA 4PB5A 1N63C 3TE9A 4KFNA 2PAJA 2X8RA 2J8FA 5JIWA 2NQ5A 4JNZA 1LT7A 1S5NA 3WQ8A 3CT7A 2HRWA 2ZICA 3LBOA 1T99A 4O57A 3UXKA 1GYMA 1L6FA 4PN2A 4JXCA 5AHIA 2VL4A 5HOSA 3DUGA 5A8NA 3GTFA 1JPIA 1JZ8A 4CCEA 1FCVA 3T1GA 2EJ1A 1W9VA 4MTVA 3B3DA 2WC7A 1ADDA 1M1BA 1G94A 1NEYA 1R9ZA 2ZRWA 3SEPA 3NXLA 3NL2A 3PF3A 2YVJA 3BPWA 4J3XA 1WKDA 1IQ8A 5IBXA 2V69A 1AH0A 1Q2SA 4FSAA 3WCZA 2ZA1A 4DJDD 3E6EA 3LRMA 3CMGA 1TMLA 1JPKA 3CAQA 3CEUA 3RNMA 4BY3A 4FA3A 5DCEA 3ZT5A 1ONWA 1FFUC 4HYVA 2OT0A 4O54A 1RV8A 2YLLA 4YS1A 3PSVA 4FLOA 2UZ9A 4WEVX 2NQZA 1GKQA 2PMQA 1HX0A 1P0NA 1GEQA 3MO4A 4JKMA 3UYIA 4IXHA 2F7FA 3T08A 1XFCA 1L8NA 1TUXA 3F5KA 4DPPA 2BY2A 1O94A 4UB9A 1SO5A 1OYBA 1QT1A 9RUBA 4N02A 2CITA 3WEOA 3GXMA 4NIRA 3WMCA 1DWGM 2F8QA 3S46A 1PE1A 1XPYA 4UFHA 4LUTA 4RDWA 3W6LA 1RCOB 4KCUA 2AL2B 2X09A 3M0LA 4IIDA 3A24A 1JVNA 3W22A 3OG2A 3M6DA 4X61A 3HQNA 2YCJA 3Q67A 1U30A 2HXUA 1GQNA 1SZGA 5F4WA 2ZQ0A 3VU2A 4HN4A 1I4NA 2WK2A 3WEMA 1OINA 2DORA 5CZSA 1BZLA 3MHUA 3LMYA 1CZ1A 3B8DA 1OFQA 4F2BA 1GOOA 1BYDA 1TRIA 1CDGA 2CXEA 3KVJA 5FJIA 3LRLA 1WDWA 3SUWA 4XZ9A 3W74A 2R24A 3POHA 1OCBA 3UWYA 3QHOA 2XFFA 2A4AA 5MF5A 3QXBA 4C6IA 3SY8A 3RF9A 5GJPA 4IUGA 1JAEA 2QV4A 2QXWA 3TC7A 2WSQA 1TZ9A 2Y1HA 4POCA 4TVUA 3H24A 1J4EA 2QUNA 1RJPA 1LG1A 2XSBA 2C13A 4CD5A 3O07A 3USZA 2Z1WA 3QTGA 1SW0A 1BGAA 3ZVHA 2DH3A 1OADA 5C55A 2GUUA 2JALA 2X42A 3UZYA 3RR1A 4XAYA 4ZE5A 4JX4A 3TJ4A 2YFOA 4Z2LA 4P7QA 3O0HA 1ME9A 3R58A 2ZE3A 5FEXA