3RCYA

Crystal structure of mandelate racemase/muconate lactonizing enzyme-like protein from roseovarius sp. tm1035
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
396
structure length
396
Chain Sequence
b'VKLRDLDIIVTAPPAPGWGGRYWILVKLTTDDGITGWGECYAASVGPEAMRAVIEDVFARHMEGENPENIELMFRRVYSSGFTQRPDLTAIGAFSGLEIACWDILGKARGRPVWALLGGKMNPRIRAYTYLYPLPHHPITPFWTSADMAAESAADCVARGYTAVKFDPAGPYTLRGGHMPAMTDISLSVEFCRKIRAAVGDKADLLFGTHGQFTTAGAIRLGQAIEPYSPLWYEEPVPPDNVGAMAQVARAVRIPVATGERLTTKAEFAPVLREGAAAILQPALGRAGGIWEMKKVAAMAEVYNAQMAPHLYAGPVEWAANVHFAASIPNILMCESIETPFHDALIKGSIRVEGGYITPPEAPGLGIEVDEALARANPYHGTGLHLEMQEASCDYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme-like protein
molecule tags Isomerase
source organism Roseovarius sp. tm1035
publication title CRYSTAL STRUCTURE OF Mandelate racemase/muconate lactonizing enzyme-like protein from Roseovarius sp. TM1035
rcsb
total genus 138
structure length 396
sequence length 396
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rcyA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rcyA01
2AKMA 2OQYA 3SBFA 2GSHA 3UGVA 1BQGA 3MKCA 3RITA 3MUCA 2XH7A 4E6MA 1ELSA 4ZA0A 2P3ZA 5BOFA 2NQLA 3DDMA 4E8GA 3DGBA 3ENLA 2QDDA 6ENLA 2PS2A 2PTWA 4KEMA 3CB3A 4KT2A 4J1OA 5FJOA 1P48A 3ZVHA 2HZGA 2PODA 4HCHA 3KUMA 3GD6A 3S5SA 4GGHA 4GIRA 3ZVIA 2PPGA 2PTXA 2I5QA 3DIPA 2PP0A 3SN0A 3IJLA 2PCEA 4GYPA 2QDEA 2OLAA 1OEPA 3S47A 4H2HA 4DXKA 3IJIA 3Q4DA 5BOEA 3FXGA 3NZGA 3GC2A 2GGHA 1ECQA 5FJPA 3R10A 4G8TA 4K2SA 3FJ4A 2OPJA 3OW1A 2XGZA 3EEZA 3QPEA 1MDLA 3DG7A 4X2PA 3VC5A 3T9PA 2OX4A 1WUEA 3OPSA 3SSZA 3I6EA 2GGGA 4HCDA 1WUFA 3DFHA 2ONEA 4K1WA 4A6GA 1SJAA 4H1ZA 4KWSA 3UCCA 1MNSA 3GO2A 3PK7A 4HYRA 3TWAA 2POZA 4ROPA 3ZLGA 4HNCA 4MMWA 5FJUA 4F4RA 5J04A 4FP1A 2XSXA 1TE6A 2QJMA 4GFIA 2OZ3A 3UXLA 2ZADA 3TOYA 3IK4A 3CXOA 3TJIA 3Q45A 1EC9A 3P0WA 3T4WA 1EC7A 1EBGA 3UJ2A 3MSYA 3DG6A 2O56A 4E4UA 3UCDA 4GGBA 3DG3A 1JCTA 3NXLA 1NU5A 1RVKA 1SJBA 1DTNA 3N6HA 1MDRA 7ENLA 3SN1A 2OVLA 3V4BA 2MNRA 3TJ4A 1FHUA 2PSNA 2XH2A 2OKTA 3JW7A 3QN3A 4IZGA 1JPDX 4DX3A 2XH0A 1FHVA 1R0MA 3UJSA 3R0UA 3R25A 3OZMA 3BOXA 3H7VA 1XPYA 2AL2B 2PTZA 3MZNA 3PWGA 3JZUA 3JVAA 1L8PA 3NO1A 3EKGA 1MRAA 3MY9A 3FYYA 1SJCA 5FJRA 2PA6A 1EBHA 3H70A 4JHMA 2QQ6A 3N4EA 3OP2A 3VFCA 3TWBA 3DERA 3OZYA 3VA8A 4DYEA 3VC6A 3DFYA 2FKPA 4GISA 4A35A 2AL1A 2GGJA 3ES8A 4GYPC 1TKKA 3QLDA 2PP1A 2PTYA 4KPLA 4YWSA 4J3ZA 1KD0A 4K8GA 1P43A 2PGEA 2GL5A 4IT1A 2HXTA 1MUCA 4A3RA 2HNEA 2AL2A 3PFRA 3UXKA 1KKOA 3BSMA 3R1ZA 4IP4A 2PMQA 4ENLA 2GGEA 3RGTA 1KCZA 4E4FA 5ENLA 3B97A 3UJFA 3PWIA 1ONEA 3VDGA 3GY1A 3CAWA 2P8CA 4Z17A 3FV9A 3CT2A 3CYJA 3UJRA 3D46A 2CHRA 4HCLA 4HPNA 3THUA 3I6TA 3I4KA 3HPFA 3TTEA 3VCCA 3CK5A 1PDYA 3P3BA 2ZC8A 3T6CA 1R6WA 3VCNA 3D47A 4Z1YA 1IYXA 2RDXA 4DN1A 3RCYA 2OFJA 4M6UA 5FJTA 3K1GA 4GMEA 3TQPA 2QGYA 3RO6A 3MQTA 3TCSA 2QJJA 2PGWA 2AKZA 2XH4A 3FCPA 2OZ8A 3NFUA 4IP5A 4FI4A 3H8AA 2HXUA 5IDZA 2DW7A 3MWCA 5EU9A 1XS2A 3R0KA 3N4FA 2PU0A 3IJQA 2GGIA 3RR1A 2MUCA 3T8QA 4JN8A 3STPA 2OZTA 2QVHA 1W6TA 2OG9A 4HNLA 4H83A 3P93A 3ZLHA 4IHCA 3TW9A 3V3WA 1JPMA 3RRAA 3DESA 4IL0A 1TZZA 4DHGA 1KKRA 1EC8A 3H12A 3U4FA 2FYMA 3SN4A 2DW6A 3BJSA 3V5CA 3SJNA 3QKEA 4JN7A 2OO6A 4HN8A 3ZVHB 4G7FA 4MKSA 1SJDA 3QTPA 3R11A 4IL2A 1E9IA 3UJEA 4DWDA 2P0IA 2P8BA 4MGGA 3DEQA 4ZCWA 1YEYA 3OTRA 1NELA 2GDQA 2QJNA 4EWJA 2PP3A 3ES7A 4E5TA 1F9CA 3SQSA 3FVDA 3ZLFA 1PDZA 3N6JA 4H19A 2P88A 3U9IA 2PU1A 1JDFA 2OQHA 4M0XA 3V5FA 1BKHA
chains in the Genus database with same CATH superfamily
3MKKA 4QJ3B 2V67A 3N19B 2NVDA 4ORIA 3VE9A 3TIMA 2C7FA 2GSHA 2IQ0A 3NVDA 3QGKC 1NDYA 4L6DA 1MQPA 3B8VA 4ZA0A 1VGAA 4DAIA 2YL9A 3DGBA 1ZFJA 1IXPA 3CUZA 5AC7A 4KEMA 3RUBL 2X8GA 3DAQA 4PFMA 3MHFA 3QY6A 2YDRA 1GJPA 3GW3A 3BGJA 2WVTA 1MO0A 3H22A 3WMSA 2ISWA 3I6RA 3TONA 2Y1HA 5C9XA 2WZHA 1FWGC 2ZX5A 4IUOA 3IWPA 4JDBA 3APTA 2G41A 2ZRZA 4H9ZA 1M03A 2A6NA 3EYPA 2FVLA 5AC8A 2H8ZA 3PPFA 1OF8A 3UZXA 4AHPA 3GC5A 4YVXA 1UR2A 5D2TA 3EWBX 1HQTA 3PBMA 3WMBA 1IZKA 5U4NA 3BMWA 3EF6A 4LBUA 1CCWB 1EDQA 1FY6A 4FXJA 3PBGA 2J47A 3DG7A 2X41A 4U3AA 2DORA 1OK4A 4WDUA 3OLDA 1GEUA 3GX9A 4V15A 1JI2A 1OFOA 2VKZG 5CPMA 2CLOA 2CU0A 1YTDA 1I1XA 2BCPA 4W9TA 3M9YA 1HKWA 1LQAA 4KQNA 3CZ8A 1T8QA 2OGJA 1HG3A 4NI3A 2FZDA 2GJNA 3AMGA 4QLKA 3GO2A 3NTYA 2X1SA 2XZ9A 4OBTA 1L6SA 3DGZA 2QXWA 4UMBA 1RK5A 5DX7A 5AYBA 3LCGA 4MMWA 1X39A 3RHGA 2GWNA 4FP1A 2V5LA 3RIKA 1O12A 1EA0A 2YDQA 1OG6A 3TOYA 3EOOA 4LYQA 7REQB 3WBAA 1XHCA 1EPXA 3ARPA 4AHQA 5I00A 1E4MM 1EBGA 4WJEA 1S5NA 4QQUA 4IH3A 1WYGA 4O14A 3M46A 1CB2A 2JEQA 2O56A 5EMMA 3UCDA 2PDNA 2VZOA 3AIEA 2Y7DA 3MYPA 1W3KA 3VE7A 1CEOA 1PHWA 1DTNA 1PTAA 3S0CA 4F9DA 3REQB 2CNCA 4PMOA 1IEWA 3B8SA 4FIQA 3VM7A 4H4XA 4GI8A 3QMRA 3FEQA 1EP3A 3BANA 1ZB5A 2VR2A 1FHVA 1ZAJA 4ZOAA 2D24A 4BR1A 1A4LA 3INPA 2REQA 3JZUA 2E3TA 4CCCA 4F0RA 6CGTA 2Z1XA 3FS2A 2J24A 4FEZA 3C2YA 1TV4A 4FNTA 3G18A 4K7ZA 1QI2A 4JHZA 3EB4A 2DSWA 4PTNA 3UXIA 4PMXA 1J2WA 1OD0A 4DYEA 3CB8A 1TV5A 1JCJA 2FKPA 1W37A 3BV4A 3M6DA 1FFRA 4GISA 4GH3A 5D8ZA 1XFCA 2QPSA 4DJDC 3R0DA 4TV6A 1H61A 2ANUA 4HZMA 5CPSA 1STZA 2PWGA 1JDEA 4ZZ9A 2Y4SA 5BRBA 3F5JA 5FACA 2R91A 1G01A 4FXFA 1FO4A 3WLSA 1ZP4A 4JHOA 3CH0A 2RH9A 1UR0A 5GNZA 3NYDA 4R53A 3A9IA 3GXIA 2EG6A 2ISFA 4H8NA 2EPOA 2YA0A 3W3OA 3WL0A 3WQEA 4JYDA 1MOKA 1S2VA 4JX5A 2E40A 2D0GA 3VIMA 4P5UA 4BWLA 3MMDA 3S5NA 3WDIA 1MW0A 4GD0A 3PG8A 1XXXA 4RK8A 2XN0A 1RBLA 1BSIA 2XIQA 1IEVA 2XIJA 2AQVA 1I2PA 2A4AA 1FWCC 2YSWA 1V3LA 3UJRA 4XQ6A 3PAOA 2CHRA 3AHXA 4H9VA 4AISA 3KP1A 2VELA 3IVSA 3R5EA 3N12A 4DJEC 2W54A 4B3KA 2ZXDA 5AKQA 3W7IA 3D47A 4XAGA 3L23A 4Z1YA 5FOOA 3TZNA 4LUIA 3OGSA 4DN1A 1HGYA 4NF7A 1E6NA 3A3XA 4RXFA 4PUMA 4K8EA 1ADDA 4Z1BA 3H21A 3WFZA 2P0OA 5CPTA 3CIWA 4ASTA 2TMDA 4EXAA 3WUFA 2R94A 3LBCA 4LNCA 1BF6A 4NAFB 2J27A 2GVGA 3DU0A 4AWEA 1QW9A 5AZ1A 3HGRA 1AD1A 4ADTA 1UR8A 1BKSA 1BEUA 3QF0A 4Q8MA 4RZ5A 4MB1A 3NQ8A 1FBAA 1IR2A 4WEVX 4NAEB 3M7WA 1E1EA 2V5KA 4UUIA 1JPMA 3DESA 3LV5A 1GGOA 4DHGA 5G1TA 3CQIA 3SN4A 2YDSA 1FECA 1QK0A 2W3RA 4Y9AA 3IGSA 3PR2A 4MKSA 4ZMGA 5E9AA 4LY4A 3BLIA 3GXNA 5H6HA 5HQLA 2XINA 4F2UA 2DZPA 3T0BA 4D8ZA 1FWFC 1OCJA 4ZOCA 1L2QA 1C7TA 2ZX6A 2Y8UA 3UERA 3KTCA 3TROA 4E5TA 3N11A 3WDHA 3UPBA 1XIEA 4N6EA 5DF0A 1E0TA 4LYRA 4TMCA 4ERIA 2QKFA 3R4IA 4ZENA 1RCOB 3GD3A 3MC5A 4B3LA 1BKHA 1WOBA 3M07A 2EPLX 3A7UA 2X1IA 1KM6A 4KIEA 1A47A 3OGVA 1Y5WA 5DRIA 1V3JA 4W84A 1VHNA 1GRFA 1UB3A 4A8RA 3BAJA 2EJAA 3LY0A 3GVRA 1V0KA 1XLDA 4GNKB 3VVGA 1LZOA 2PS2A 1ZUAX 1ICQA 2HQMA 5F7UA 4K3ZA 4GLEA 4AD0A 3IIXA 3DZ1A 3VGEA 7A3HA 1UA7A 4BURA 1UYQA 4PN2A 1HNYA 7PTDA 1WP6A 5C54A 1ZHAA 3WZ0E 1JPHA 3HMJG 3ARSA 1VJZA 4NHVA 2GSJA 1MQRA 4WGHA 2ZRXA 4W7UA 3W72A 3IJLA 4JNYA 5G5IA 1W3TA 1XIIA 2D2JA 3VDAA 4PMJA 4H2HA 1IIGA 3FYPA 3DH7A 3LRMA 3EDEA 4H4SA 4GACA 2A85A 2CKSA 1PIIA 2YL6A 2VNCA 4WVXA 1DVJA 1EP2A 1YDNA 2XSAA 3L4XA 5I24A 3CT7A 2EPHA 1PTDA 6REQA 3WNNA 2EG7A 3ZT6A 1MDLA 2XISA 1K7EA 4AMCA 4CCDA 4GJIA 1UD3A 2QLYA 4XZMX 3R43A 3GG8A 4TVUA 2PDQA 3ZFHA 3WJYA 1DQXA 4KEZA 5FEZA 1K9EA 1V3HA 3ZZ1A 1DWGM 4QJ4B 1S39A 1KTBA 2A7RA 3WH6A 3S9YA 3HMCA 3LM3A 4O0ZA 1B0IA 3H2MA 1V8EA 2NVKX 4L80A 4H6KA 2CZEA 4Z2LA 4IJCA 1M68A 2DIKA 4EQSA 1A0EA 3CBWA 1CIUA 4L5ZA 4O1CA 2NT1A 2CETA 3BLLA 1TE6A 4XVDA 5FAGA 3N2OA 3EPMA 3IK4A 4REQB 1KM1A 2EQDA 4KETA 3AROA 2Z1VA 2YBUA 2YA2A 1EJXC 1FRBA 4I5RA 4ECLA 3UJ2A 3MSYA 2D2GA 1ITQA 5I02A 2XYLA 3O6AA 3W1NA 3LXDA 4DO7A 1DWAM 2BV9A 4EMJA 1TMLA 5JH2A 2WKGA 5EMJA 1MDRA 4GYJA 5A6KA 2PSNA 3LENA 2VCBA 2C91A 4PB3A 4IQLA 2QDGA 1TZ9A 2HDJA 3TR2A 3FAXA 2QCDA 3BVJA 2PDBA 1QJWA 2FB3A 1U1UA 2AL2B 5C8BB 1W9DM 3GTIA 4ZB0A 4PCPA 4ICNA 4ZOHB 1DJNA 3HPXA 3W7MA 3PP7A 5D38A 4O57A 1AUSL 2VEMA 2B4GA 2X1TA 2Y7FA 2GVJA 2X8CA 4GVFA 1VLWA 3O6CA 4GBUA 3GD4A 3KX6A 2XFRA 3VA8A 3EA1A 3TYZA 4JBRA 5DQPA 1WAWA 3CGDA 2HV5A 2GGJA 1NEYA 1OJTA 1E4IA 3KBWA 1J9YA 3SAZA 2ZTKA 4DJDD 3OYZA 1CPUA 3U3HA 2G97A 4JL2A 4QCEA 4AD4A 4UNLA 5BZAA 4C65A 4J2PA 3VOCA 2F6XA 5CLTA 4QRNA 1MUCA 1IT8A 2NXGA 2XGIA 5CZSA 3CEUA 4Q8NA 4TUFA 3O2LA 5HJYA 2Z6IA 1JF5A 4O8AA 5I07A 2GQ9A 3GFZA 1EZWA 4FR1A 4TVCA 1AW2A 1A5KC 2VUNA 5LYRA 4XBJA 3EWXA 2V3AA 4HMNA 4IQDA 4E4FA 3O63A 1XLAA 3NAVA 2ZUTA 4GIYA 5IBXC 2G5WA 2FJKA 2C15A 3ITYA 2ZX9A 1ZPTA 2HWGA 1XGDA 3CAWA 2IKJA 4RDZA 4XAYA 2NQJA 1KQYA 1AH4A 2WZEA 3D46A 3EAUA 3XINA 3RU6A 1BYDA 1PDYA 1XD1A 3CV1A 4JTCA 4AIEA 1W1A1 2RGMA 3QV7A 1HTIA 3TE9A 3LRKA 3HZ3A 2DSUA 3EEGA 3MO4A 2BHYA 2DZVA 3BOLA 3NNTA 2PE4A 2RJGA 3MCNA 4KGLA 4HU8A 3G0UA 1TCDA 1OFEA 1ZY9A 2BWGA 3QPZA 3T2OA 4PMYA 3HQNA 3QQ1A 4C6DA 3GDBA 4D9PA 4E8CA 5XINA 4JTIA 1GJUA 2VUYA 4RDVA 4G1KA 1XR2A 2DVTA 2XVPA 3T0AA 3NSMA 1W56A 2XDFA 3C6CA 4XTDA 3WQWA 4V27A 1H51A 3WNPA 2R1PA 4L9XA 5ECVA 2DSKA 2E5DA 2Q8XA 4AZCB 1VCGA 2EBNA 2F38A 2VOTA 3IIVA 1KB3A 2UV8G 1LDCA 1AD4A 1U5HA 4DZAA 3KDNA 3PZMA 2Q71A 2X50A 3ARVA 3ARXA 2EQ7A 3QKEA 1E9YB 3WLLA 4UWMA 3M0IA 2GVEA 3BOFA 4ACYA 1PZ1A 1KA9F 3C5QA 3G0XA 2KZHA 1PSCA 3M0JA 3CIVA 1NHSA 5HQEA 3UG3A 3ETRB 3SQSA 2A0NA 3ZLFA 3VPLA 4QQ3A 3EWUA 3W7NA 1ZZMA 1JD9A 1K1DA 1GWJA 1FWWA 4HKPA 3E9AA 3HFTA 4M52A 5HBFA 3OG3A 4QS5A 3WQ4A 4H6RA 1YQ2A 4PRRA 1SW7A 1TPVA 1ITCA 3VNMA 3UGVA 2V2CA 4H4ZA 3L5AA 4O50A 3A5FA 5CC3A 1QWKA 5CGMA 1GEQA 3UY8A 3DDMA 4E8GA 4L9ZA 3T05A 4REQA 5IXEA 1KRCC 1EQPA 1K4HA 3URBA 3KL5A 2JALA 3S83A 4EX4A 1HJWA 1LRTA 1F05A 2XWDA 2H90A 3P5ZA 2J6XA 1PZ2A 3H7UA 3WKZA 4Y90A 4GGHA 2ZBTA 4FNSA 3OBAA 3PY2A 2VEFA 2NQ9A 3KTXA 1W1B1 3W1TA 4ATWA 3MV11 1GZGA 1C8VA 3AMDA 4CNOA 1N60C 4F0LA 3P67A 4PCTA 1HL9A 3SGGA 1AQMA 3PSVA 2PFHA 4DI8A 1RJQA 4US5D 4YWIA 4J56A 1GREA 3KRUA 1ME7A 1CGXA 3R10A 5KZEA 1UWQA 1AW1A 3PC0A 3OZOA 3SR6B 3TYCA 4F48A 5AVNA 3SCSA 4J3XA 3BG9A 1WKEA 4XAZA 2E5CA 4MSSA 1VH7A 1YDOA 1R9XA 4GO8A 1J0KA 4K37A 2GJXA 3GR7A 4J57A 1WUEA 4C6KA 3TC7A 4XD5A 3MBFA 4I9AA 3TMQA 4N9DA 1SM9A 1LF1A 3GDLA 1JQVA 4S23A 2GZXA 1NDZA 3PNZA 3B04A 5A2BA 3L68A 2J8FA 1MNSA 1V7YA 3EB3A 3TWAA 1SW0A 4RR4A 5JVLA 5CG7A 4EPEC 4Q7BA 1WB0A 4JIHA 3IGHX 3TCEA 3ZS4A 5A6MA 3WH8A 1QNRA 1ISVA 4XG1A 1DNCA 3BLFA 1N61C 2X8HA 4JQAA 4Z0SA 3DI0A 4PFHA 3SDOA 1V02A 1TFVA 1PXGA 5JBDA 3NS1B 5K2ZA 1VYSX 1WA3A 2PZNA 4QX4A 3IRDA 1PEZA 3M4HA 4IX0A 2I14A 2V2HA 3NQ6A 2JGYA 4GGBA 4GPNA 4K39A 5EBUA 3LHVA 3AIRA 4PL1A 3UG5A 3QQ0A 2PBOA 4CEXC 4F2BA 4S38A 1BYCA 1OD8A 2FZMA 3VNZA 7ENLA 4GUGA 3BH4A 5FS8A 4RNJA 5A94A 4WLCA 5IFTA 1FA2A 3S4TA 1VYRA 3QN3A 3VDHA 4X60A 3E96A 2G95A 4AC1X 3OZMA 3EA3A 3H7VA 1FWJC 3IGXA 3LLDA 4CD8A 3W37A 2V6AA 4DJED 1HF6A 3ATZA 3W00A 4HOWA 3NO1A 3TC3A 2CWXA 3EMZA 2V3EA 2FZ9A 2BTMA 2ZRVA 3CC1A 1XCWA 3CS2A 3NGFA 1ZX9A 1QPNA 1WO2A 3H70A 3FX4A 3VUPA 5I3DA 5CJMA 4X61A 1D8CA 3HG2A 1IZJA 1TV3A 4UOZA 5BRPA 1LT7A 2OQLA 1XGZA 3MYOA 3CL8A 1WPCA 3O15A 3FDKA 2XIOA 4JX4A 4DXXA 4R85A 3GC4A 3L5MA 3APYA 1JCLA 1FQ0A 1F5ZA 4TV5A 5K4XA 1Q2SA 4HP5A 4CU8A 5D8WA 4RE3A 2BVWA 1S46A 4PMZA 1GHSA 4JS3A 4LANA 2QEZA 4XIAA 2VX7A 4MLJA 1ZCCA 4MHBA 2PGEA 3GZ3A 4W87A 4DI9A 1HKKA 3PUDA 4O52A 3S2CA 4A3RA 3UWZA 3PFRA 5JXQA 1KKOA 2A3EA 1A50A 1KFEA 1Z42A 1XYBA 4N42A 3VMOA 3ECQA 3LNMA 1KXHA 3GZAA 4S3EA 1XC6A 1NOUA 2WHJA 5CPQA 3SUVA 4XZWA 3W2UA 1RBOB 3T08A 4D8AA 2PWHA 5DMMA 2R9ZA 4D1JA 1IXNA 4GJ1A 2J7HA 1Q6QA 2DPEA 2QCNA 3TTEA 3T8LA 1HKVA 3W87A 4AF0A 3AIUA 1OQFA 4A21A 4A3UA 2HMCA 3M0MA 1GOWA 3GG0A 4BKNA 1Q4WA 4Z2KA 4ML9A 2OXNA 1B3XA 4BQ4A 2ZWZA 5T9CE 3DC0A 2QUVA 2VX6A 1WXJA 1NARA 4G9PA 3VILA 3GLCA 1ZJBA 4IIBA 3W1UA 4MJ2A 5BU9A 1XLJA 4Q8WA 1R86A 3HO8A 3WJZA 4R3UA 1FWHC 2AMXA 2J7GA 3KCOA 3VD5A 2A3CA 4IGSA 4LCQA 2PDYA 1S2AA 4NJIA 5KZMA 2J4GA 2EGZA 3GIQA 2YZ5A 2V9DA 5BOOA 2WPFA 1D3GA 3N4FA 2GGIA 3O7UA 1KRAC 2B7OA 2VDGA 2OZTA 1CGYA 1ZK7A 2FVMA 2OG9A 4YIWA 3AJ7A 3BWWA 5HULA 3W38A 3DHPA 3U5UA 1IZCA 2V69A 3SUUA 3EWYA 3P14A 3GWQA 1SFLA 2G3NA 4R9XA 4Q7NA 4GVIA 3T7VA 3SSJA 5MKGB 1LOLA 1MQQA 2FYMA 1KXQA 3SJNA 4Z1AA 3PJXA 4JN7A 3ZVHB 3LXBA 3LI1A 3AYRA 2WMIA 3G1RA 2ZZ1A 4AFYA 4MM1A 1H5YA 3VIIA 1I0DA 3WF1A 3VINA 3DH9A 5AC6A 2VFIA 1F8MA 3R13A 2ZA3A 4WR3A 1B3OA 2QIIA 3PZOA 1KM3A 1V79A 2YBVA 3AQUA 3WG6A 4NT0A 4R34A 1OK6A 2Y5EA 1JGIA 5C7HA 1AH0A 2WCAA 3KTSA 2IPWA 4M0XA 1QNVA 4OGZA 1FDYA 3QBUA 2ZRUA 1J5TA 4GZEA 4NRSA 1QVBA 2PWVA 3OIXA 4G1NA 5F2IA 3N2MA 4U31A 3R8GA 2XPKA 4GY7A 2W92A 4ZO7A 2XH7A 5EA9A 4Y7EA 3BZJA 2Q3OA 4FR6A 1XANA 2ZX7A 5CGTA 2DZTA 1NOWA 2ZX8A 4IQEA 1O1ZA 1M9HA 2VQTA 1W9BM 3CAKA 2PTWA 3L0KA 3W2LA 3VOJA 2CLEA 5D03A 3FGCA 2A2IA 3GXFA 4C90A 2FGZA 3ID7A 2QF7A 1JPKA 2GR0A 4J1OA 1X7IA 4EXQA 1GOMA 1M65A 2EPMX 1JZ3A 1B9BA 4GIRA 1VJIA 3ZVIA 3NSNA 2OU4A 4RZ6A 1EX1A 3HGOA 4JKKA 3FN9A 2OEKA 2P76A 1QHZA 3BJFA 4GYPA 1TVPA 1OEPA 2BODX 5DXXA 3FHAA 2GLKA 2WKJA 3QSTA 2PD5A 1K9TA 3QGAC 3U7BA 4CQ9A 4KPRA 1W1YA 4X9SA 4AY1A 1KFLA 3LADA 3AC0A 4L61A 5KINA 3NPVA 1JI1A 2HSAA 2YCLB 3VIOA 3L12A 4MTVA 3WBXA 3WBWA 4GC3A 4S3CA 3QR1A 1ISWA 3OPSA 2W9MA 2GGGA 4MPQA 2CIPA 4KWUA 3TTQA 4GVHA 3G22A 1CLXA 1SJAA 3K4WA 1WYIA 2W61A 1W9XA 3FA5A 2Y85A 1MVYA 2GQ8A 4TX9A 3L4TA 1B3YA 3HIJA 3KL3A 4H4IA 1YPFA 3T09A 4DBEA 5FJUA 5TAOA 5D33A 3MMWA 1R47A 5G5GB 4B92A 2OZ3A 2ISVA 2X0SA 3F4CA 2VVSA 5AHIA 1EC7A 4BQ2A 2GYIA 5K7JA 1OCBA 4BI5A 3UP8A 3ELFA 1GQIA 5C9UA 1SJBA 5CBBA 3SIZA 2G4FA 4I3GA 3STCA 1B54A 3KVMA 3TJ4A 4H41A 4TQTA 3FOKA 1FHDA 1TPDA 2C18A 4BQ5A 1AMYA 3S6TA 2J74A 3KE0A 3AZRA 2CLHA 2J78A 1RLCL 1Q66A 4QEHA 3W85A 5DBTA 3OLGA 2WZTA 3BW4A 1KQZA 3KWSA 1TTIA 2H6RA 4UZUA 3CL7A 1RQBA 1CXHA 1DL3A 1DXFA 3WL1A 3WENA 5DRCA 4Q33A 3SR7A 3GR8A 3VFCA 1JDAA 5REQA 3NEHA 3SCRA 1RP9A 1GK8A 3TV8A 1SW3A 4DZIA 3EPNA 1TB3A 1RJPA 1ZJAA 1WZKA 2WCSA 3ES8A 4GQBA 3QHNA 4GYPC 3BAIA 1TIWA 1BRLA 3AHVA 1NH6A 4NVTA 1F7BA 5DEZA 4LW7A 1KC7A 5EL1A 3SURA 4CNTA 4ZQMA 4UQ9A 2GJPA 2IQTA 1U83A 4EMIA 3R89A 4UFHA 3CNYA 1I8JA 1IR1A 3UG8A 2WLYA 3P7YA 5CQ1A 4O1EA 1FWAC 5I2UA 1PX3A 3U4AA 2VD8A 3CO8A 1KFWA 2OGYA 2TSYA 3G8EA 3WD0A 4ENLA 5LA1A 4WUIA 3PBVA 4HQVA 4IFKA 3GR4A 5DN1A 1DJQA 2PRLA 4WK9A 3EB2A 3TQKA 1UWIA 2JF6A 3CUHA 2KX9A 4LUTB 3UFYA 2UY2A 4YTRA 2RAGA 3CYJA 4H7ZA 4LS0A 4AYGA 4LJ3A 3H54A 4QLLA 5G2IA 2VEGA 2FHFA 3NYZA 3CHFA 4LF1A 4IFOA 1TX2A 1UWUA 3LK6A 2B7QA 4N4PA 1BPLB 3BAYA 4JTJA 4Y96A 1IGSA 2YB1A 1TUFA 4FNPA 4F8XA 3W2KA 3I4EA 2YYTA 2P5NA 4IMCA 1DQUA 3TCSA 1XJBA 4INFA 1CDGA 3WQDA 3FJNA 2XH4A 3GHRA 4Q7IA 4FI4A 4GQQA 1GPWA 2PD9A 2V30A 1GRTA 2DZWA 4XKYB 1CTNA 2Q6ZA 3K2GA 3THCA 4HN4A 3CZEA 1D2KA 1EWDA 4J5NA 1XH2A 4RNFA 4O0QA 2FDMA 4PUJA 1OGBA 1GVIA 1RQEA 4DUVA 2ZZBA 1D8WA 2C3ZA 3K4AA 4XZLX 3AWNA 4NZJA 5BMWA 4O17A 5XIAA 2AGTA 3A3HA 1H1ZA 3MT1A 1F74A 3CHEA 4HK5A 3HRDC 5CBIA 1W5MA 3PZNA 2G50A 1U33A 4JFWA 3MJYA 5IDIA 4C91A 4H8VA 4EQWA 4Z1DA 1LL4A 1OJXA 3GTFA 5DY3A 1M53A 4NNCA 1N55A 3PAJA 2DJLA 1OFAA 3I10A 3N6JA 4HZ6A 2YZRA 1XLIA 2I57A 4H8HA 3LNPA 1B9ZA 3PTMA 3F4NA 1XUUA 1UCWA 3OJGA 3O9NA 9XIMA 5AYXA 1Z8AA 1N63C 4JIRA 4L4LA 1EPVA 3E74A 3SCUA 4OV4A 3RNDA 4QAIA 2WMGA 4XIMA 3D0CA 1W2PA 1LQ0A 3MKCA 1A5BA 3EAOA 3QC0A 4MUPA 3W9ZA 5F1UA 1TJRA 3WQCA 1E72M 3NDOA 8A3HA 5DCBA 3A7RA 1QFEA 1M41A 4QFUA 3MSDA 1O95A 3N3MA 2QCHA 3E0FA 1OFQA 1DEDA 1PWMA 4HTBA 2BG5A 3LHWA 3CQ0A 2FFIA 1RXOB 2V38A 1XLFA 1YHTA 3GBDA 3I3DA 4XUYA 1OGGA 3BPWA 3IIZA 4PBFA 2E7FA 1U5JA 1D3CA 2XG9A 2E8YA 4OE7A 1H1YA 4ZTYA 1C9DA 3GIPA 4W8BA 4K7VA 1RCXB 3QY7A 4X0NA 3CEPA 4XK2A 3V1HA 1E1CA 4LVBA 4TTGA 3OW1A 1X1OA 2WJDA 1EUNA 1I60A 3P60A 1TTPA 1BXCA 4CNSA 1FWSA 4RXGA 4TOQA 4A2RA 4LOCA 4TTUA 5CGQA 1YX1A 1GQLA 1DJZA 2D22A 1F76A 3MSRA 5LSMA 3ITCA 4AF0B 1V6UA 1S2WA 5DT7A 1JD7A 1GQKA 3EANA 1KNWA 1H0GA 3U2ZA 2G8ZA 3C3UA 2WM0A 4HTYA 5JCIA 3B03A 3CM4A 2REQB 4OUIA 4DIAA 3POCA 1V97A 1LRQA 1IV8A 3M0LA 2E3ZA 3WDPP 1WDRA 3M44A 2Z00A 4WGXA 4FXSA 3MJMA 5FJIA 3VIGA 5DFAA 3PVFA 2QJMA 1BWKA 1KM0A 2ZADA 3W25A 2HE8A 4YJ5A 2VI0A 1FKXA 2WAGA 3H53A 3H4XA 5CJNA 3TDFA 3RPTA 3NUKA 3UYIA 2PF0A 1NDWA 3WLQA 3OHIA 4IIDA 1RV8A 5A8MA 1RVKA 1SO6A 1MMFA 4AY7A 3N6HA 2OWXA 3TTOA 2OYLA 4Z42C 2I7GA 1GW1A 3NZQA 2IS7A 4M82A 3RK8A 5BNKA 4AVOA 4IX2A 4LRSA 3QEZA 1RY0A 1TPC1 2HNHA 4IJRA 2WQPA 1R0MA 5BROA 1NVMA 3ARZA 1Z44A 3LZ5A 1VAHA 1X8FA 5A6BA 3GU9A 3CMFA 4OKDA 2EQ9A 1ICSA 5M1TA 3KOYA 2H8XA 3ZSTA 1EBHA 2WNQA 1ISZA 2NXHA 4IISA 4OV9A 3W7DA 2OWCA 2V68A 3O8AA 1DIDA 4ZL1A 3CV7A 3DBPA 4LFYA 2DT3A 3DERA 4QSHA 2CFYA 4S3KA 3AYVA 5BYWA 4LVGA 5HMFA 3H7RA 2PRHA 4I8YA 4UBPC 3BQ5A 1M1BA 4WY0F 1TKKA 4Q8OA 4GNJA 2VR4A 1QO2A 2J3NA 4W8AA 4UQAA 3DX5A 3GU2A 4I6KA 1WBHA 2YPIA 4OVXA 1T40A 1OX6A 3S5ZA 3E2SA 4MIMA 3HG3A 3DFOA 3ZOAA 4HVXA 4OU1A 4PMRA 2PLMA 4AZ6A 3L2MA 1LUCA 3CXBA 1H1NA 3BMXA 2GL5A 2YVFA 1VBJA 4IT1A 4C5ZA 3QYSA 2WM1A 5BWFA 1MWOA 2UY4A 3E6EA 5B80A 5IFPA 1R3SA 3WMCA 4DJFD 2IQDA 3AS1A 4JTLA 3AYSA 2VZUA 2FPTA 3FJ6A 2ZZCA 1CENA 2R1LA 3ZWTA 2WPCA 2VURA 1WNOA 4OOZA 6XIMA 1C9WA 1W5PA 3CQHA 4NL1A 1OYAA 4HNNA 1KFCA 1CYGA 4NQ1A 4PBGA 2DUXA 4GYFA 1LM1A 4Q6JA 1XSIA 5KEZA 4CD5A 3RNMA 5C9WA 3LUTA 4C7GA 2YW3A 1DE5A 2ZC8A 3W6MA 1VCVA 1KR0A 3NL2A 4F79A 2WP5A 2OB3A 3EDFA 1SFSA 2Z24A 3LM7A 1I2NA 3Q37A 3E0LA 1MW1A 4QGCA 1JG9A 3QJAA 1QRQA 1NDVA 1NIUA 3NL5A 4A2SA 3TMLA 3V16A 1ZXIC 4GMEA 1GXFA 2NQ5A 3T2PA 2BVYA 4GH1A 4M6VA 4IXHA 2QUMA 4PUUA 1SR0A 1AL8A 1EKOA 2E6AA 4AWSA 3QV9A 4AAJA 3G5EA 5D04C 1S7MA 4QS6A 3BTNA 4FNQA 3RR1A 1Q4NX 4UFKA 3STPA 4JEJA 4QBXA 5FF2A 5C71A 3LGDA 3CGTA 4RPPA 3PB2A 1GG1A 3PANA 4F9JA 4JD4A 2O0TA 3AMZA 1YPIA 5I7GA 1E1CB 2GWGA 3V5CA 3BJSA 3LZ3A 2Z4GA 3DKLA 3OQ8A 2BGNE 3ZO9A 3C56A 4IF2A 4H4UA 5EKYA 1GTEA 2WMHA 5D32A 3NVWB 1A4MA 4F0MA 5U7SA 3UGRA 4IG2B 4FF7A 3A9BA 3VNJA 2WMFA 4IXXA 3NPUA 1TJ1A 3WF3A 3W81A 3JRKA 3DJJA 1PKYA 1TO3A 5T26A 2OQHA 3U6WA 2HVOA 5JU6A 4GCAA 5I6SA 4GVGA 2C19A 1VFHA 4JIIX 4WXYA 4FA3A 3E0WA 3GTHA 3UYCA 2QUUA 4IJBA 3PPHA 2F84A 1LWIA 1FFUC 4L65A 4Z1CA 1LYXA 1ELSA 3T07A 3SCTA 4AYSA 3EZ4A 3PUOA 3M5XA 2RUSA 3DFNA 1EB3A 5SWUA 1BG4A 4QNWA 4RE0A 4JDRA 2DU2A 3GU1A 3E5PA 4O4WA 2OWWA 1UD8A 1FH8A 4AZBA 5HQMA 2PTDA 3W07A 3SUWA 2WYSA 5DCEA 4GY1A 4OZOA 4N4QA 1V51A 3M41A 4FS9A 4QJ1A 2O4QA 1THFD 4O1DA 4DELA 4EIVA 1ZJIA 2NVCA 4JTGA 1TCMA 4B15A 4QG9A 4MY8A 4AVFA 4H9TA 3Q58A 4PR4A 1P0KA 1LRNA 1JCXA 1A49A 3KS5A 4NZCA 5A5WA 4W85A 1PYFA 1UR3M 1G0CA 2VGGA 3CLWA 5FESA 5KSWA 2QZRA 3TJLA 3RILA 1TQJA 3GRSA 1XDJA 3P81A 3I3BA 1KR1A 4LUYA 4B5WA 1XIBA 3WLNA 2ON3A 3LTPA 1TX0A 3TW6A 2VFHA 3PN8A 3OZPA 4P8XA 5LIXX 2VZVA 4PUEA 2GJRA 3VC5A 4PBEA 4WDXA 1EWEA 4RW3A 5I3GA 2PCQA 3U0HA 2WC4A 1XRSA 3WBYA 3DFHA 3H2OA 3T2QA 2A21A 3OVRA 2Y0FA 1E3XA 2DZSA 1WXZA 5JIWA 5FJJA 1DPMA 5A95A 2QF8A 3R12A 3CQJA 4EMWA 4C60A 2QAFA 5M17A 3S1VA 4JQ4A 3MANA 1FVPA 3LSBA 5CPOA 3IC9A 3D6NA 4F4RA 2PZ0A 1GRBA 1N5XA 4KCUA 3LPFA 1VBUA 3QOMA 1A53A 3I7RA 4ORMA 3CUIA 1LJYA 2MANA 2A6LA 2WBAA 2GOUA 4C6BA 5CJ5A 4IWWA 1D9EA 4AQLA 5CCZA 1X6NA 1GNXA 3MUIA 4YVVA 1EGVA 3WD1A 2D3LA 3A7AA 1ZALA 4V2XA 3M0HA 1CXIA 5FMHA 4DYJA 4GXWA 4G2DA 5C5YA 1F73A 5HUOA 3EDDA 2OKTA 3VOIA 1JPDX 4DX3A 1FWEC 4FNUA 4JNZA 1L0PA 3C3NA 1CXEA 3TFCA 2XWEA 4IIHA 8CGTA 3A4XA 4L1GA 3QTGA 3H4GA 4WSHA 4ZEPA 1UIOA 1L8PA 4O19A 4J3VA 1FXQA 3N6QA 3VK5A 1OABA 5HWMA 1GKRA 1XCFA 2RDTA 5D37A 4BZYA 2PDWA 3VUSA 3ZJ7A 1K4QA 2ZVIA 3GIYA 2C1GA 3BLPX 4I5XA 4B5VA 4BI7A 3W73A 1EXBA 4ADUA 4M6QA 3LHTA 4WRHA 3K46A 2VC5A 2W27A 4GUHA 2WHLA 1MW3A 3LCHA 1UWSA 3MBDA 3GVQA 1WQ5A 3AMLA 5LGXA 1QR7A 3QLDA 1N2VA 3UD6A 3UXAA 2CLFA 1LG1A 4YWSA 4IGMA 1S2UA 2PUZA 3QXBA 3N13A 1GUVA 3FKKA 2CZDA 2YCKX 4JYFA 1UPMB 1KD0A 2PLKA 1AQHA 1K8ZA 2Y89A 2HXTA 4HK7A 3G1XA 2ZRYA 3GH4A 1QMLA 2HNEA 4MNMA 4J4KA 1U2YA 3CWHA 3KBSA 4LC6A 3HG4A 4OQVA 3GAYA 3M5VA 2QW5A 2EG8A 2VZTA 3IAPA 4DUWA 2CWNA 3VD4A 5FF3A 5G4WA 4J3UA 1PX8A 3BAKA 3EDKA 2PDMA 3UWEA 4XVEA 2QJIA 1CGVA 4NNBA 3AU2A 3WF0A 2V5BA 4AEEA 4FNRA 3NQCA 1EOKA 4HPNA 2WSYA 3THUA 4R7OA 4D6GA 2Q8LA 1TYGA 4E38A 3LQLA 1TV7A 2J9XA 4QDMA 4FHAA 3WH5A 1VBRA 4I8DA 2GH5A 3E2RA 2GFTA 2JEPA 2Z2BA 4A8NA 3AS0A 4QROA 3IJ8A 2ZDSA 3HGSA 1GJWA 3R6IA 1L6FA 3DN5A 3W28A 1E6PA 2XU2A 4KRUA 3UZYA 1WZLA 4W88A 3B9AA 3EX3A 1OZQA 1LTDA 4ZQRA 1OADA 3UY7A 1QHOA 4NZ4A 4JTTA 4XD3A 2I9UA 3W7LA 5ABTA 3GNOA 4NJJA 1UH2A 3LOTA 4AZ5A 3RLHA 1BD0A 2PU0A 5G2HA 2ZOXA 3VO0A 4GO9A 2EO7A 2PBGA 2J88A 3GHUA 2H9AA 3E2VA 3QM3A 1DTUA 2ATSA 2ZWYA 4CD4A 3CASA 4JY8A 3KZPA 1AW5A 1NFBA 4P7OA 3VD7A 1FHLA 4KMQA 4AU0A 1KKRA 1DJGA 5LIKX 5TQLA 4EWND 2I56A 3RFAA 3SEPA 1FTXA 1LBMA 5AB3A 3MHGA 3I68A 1DXEA 4IL2A 4CN6A 4XO6A 1HUVA 4EPBC 2O55A 3MDWA 3VIHA 4DUXA 1H63A 1XCXA 4A3YA 4J40A 1JNDA 3MVIA 2VEKA 4US6A 3HTWA 1P0EA 3GQYA 2E25A 4KEUA 4MUZA 5A1AA 3U9IA 5JCLA 1JDFA 3L4WA 1Q2RA 1NWUA 3UVAA 3USZA 1A80A 1Z3NA 4WIWA 1QPOA 4KFPA 3RPMA 2OQYA 1NF0A 2INFA 4UTMA 5A8OA 3B0PA 1FCBA 1GZJA 5B7YA 3F7JA 2Q02A 3SQLA 2V5DA 4MB4A 1ZBCA 4GCXA 1GW9A 1VC4A 5BXRA 1HT6A 2XVLA 5H8UA 5G1MA 5HDRA 3DK9A 3AMCA 3FW6A 3LGEA 3WQFA 1W3HA 3MUAA 3BO9A 4PEEA 2HZGA 1XLHA 1DHKA 4WDTA 2VP8A 3W86A 1W1ZA 2PTXA 5LNVA 1OBAA 1CXKA 3T0TA 2POTA 2IW0A 4MF4A 4DZ5A 2QDEA 4PTXA 4QHRA 1WKFA 1D3HA 5FL0A 2BY3A 2J8GA 1Q6GA 4Z2IA 1P4CA 4DO6A 2E09A 3RX4A 2J66A 3LGGA 2X2GA 2PB1A 4C6NA 3KLJA 3II4A 2W67A 1P0NA 4PMNA 1IQ8A 2HRWA 2GGHA 4UTHA 3RCNA 4O8RA 2R24A 3WSUA 1HGWA 2Y7GA 5REQB 4CNUA 5XIMA 1P6CA 5CG0A 3TC6A 4CVWA 4N9EA 5HJXA 3DGRA 4H9UA 4WOQA 4LB3A 1NF7A 1ZU8A 1Q1RA 1TMQA 3BL3A 4QNEA 4R7WA 1VENA 3KWXA 3ZJ6A 2HPIA 4H00A 2GJXB 2TPSA 1UWRA 1VPXA 4UIOA 1DWHM 1UOKA 4R88A 1R7AA 1ZBKA 2PDHA 4BV6A 5FEWA 5DELA 2CZ5A 2EHHA 4HNCA 2D20A 3P61A 3DYMA 2X40A 3P74A 1CGWA 5KTLA 2QDHA 3TJIA 3WDRA 3Q45A 3MWAA 3A4WA 3QVQA 4C7DA 3U48A 1YYAA 2NV2A 3EWCA 1Q8JA 3NZ1A 2HCVA 3JR2A 4JFVA 2VM8A 3TA9A 3HQ1A 3JUGA 2VD9A 3D3FA 1QOQA 3W4RA 1V6TA 1PAMA 5GJNA 3RM4A 3S2LA 4HMEA 2ESCA 1G6CA 5D2WA 3BLKA 3SW6A 2GK1A 5FIPA 1MFVA 7XIMA 3LD5A 4NX5A 3W6LA 2FHBA 5JCMA 1HX0A 3VX0A 1OCQA 3UPMA 2OODA 3LCXA 3SM0A 4AD2A 1DORA 2V8ZA 3GNDA 4V28A 4DO4A 1SZEA 1M7XA 4LC8A 4MNJA 4HNTA 5FD0A 3NEVA 4ZOEA 3FYYA 1SJCA 1WKYA 1QDSA 5FJRA 3IJ7A 4L56A 1RBAA 1E0XA 4JR5A 4HSHA 5CPLA 4OWGA 4AZHA 4DF0A 2ZUMA 4HU3A 3VIFA 2VHLA 5C9ZA 3OZYA 3TN5A 3ITVA 3HF3A 4P7NA 3WLKX 3ZR5A 1KW1A 1C8XA 4YTUA 1HJSA 2VGBA 4WX2A 1E51A 3KCJA 3LLFA 3LPGA 3WDQA 4P7QA 4XV0A 4A8LA 5JCKA 3MI6A 2OO0A 4MJ4A 5F4SA 1UWAA 1IT0A 1DXLA 3HPSA 4LCRA 3W7OA 4Q6XA 1JJKA 2C79A 4LVFA 1QBAA 1MXDA 1P43A 2WWDA 2XFFA 4Y8EA 4W7VA 4PGLA 1MZHA 3TX9A 3PM6A 1AK5A 4RV8A 3VU2A 2PC8A 1Z6KA 1KXVA 2AAQA 3A64A 3W26A 4NJHA 1XH0A 2YLAA 3PG6A 3N73A 5TIMA 1TYTA 1VRDA 5D9OA 3B97A 2JIWA 1TRDA 3V0SA 3WCZA 3GY1A 2W4XA 3W24A 3WQ6A 2Z27A 1TWIA 3NQEA 1KBJA 2NZLA 2WCGA 4U33A 4C6LA 5DMYA 4QR6A 2VGIA 3TA6A 3HGJA 4MPKA 4NEVA 2JF7A 1EJSC 3CWNA 3VIPA 4RDWA 4M81A 3LCLA 5CC5A 2E77A 3WD3A 4XZIA 3OG2A 2RDXA 3GVGA 3VIKA 2NSOA 2INEA 3Q94A 1XBYA 3WJWA 1EL3A 1J6PA 1O5RA 1P1XA 4GQGA 3AAMA 4TU1A 4WHBA 3M0YA 4B3ZA 2GJLA 4F66A 2NWRA 5KZDA 3UF9A 4PTWA 3SIMA 1R5YA 3FA3A 1HJQA 4WXZA 2HE5A 1UG6A 3H2CA 3MWCA 5EU9A 2XIIA 5C70A 1BZLA 3UESA 3WEMA 4JN8A 1EZ2A 2QVHA 2ZUNA 2HVMA 2FJUB 4OHQA 4M80A 1BSLA 1KBLA 3GRIA 2XGBA 2CXEA 4ATLA 4HHHA 1TPH1 3W7KA 3FYOA 1EC8A 2VENA 1UR9A 3U4FA 1E40A 4FOKA 2ZVRA 2CITA 3MCMA 5I0DA 3RJYA 2X2YA 4KERA 1IT7A 3VFLA 1YDVA 3DEQA 3HURA 1YEYA 3OTRA 1SU5A 3M16A 3ZQ9A 7CGTA 3TVAA 4DF2A 3KBNA 1F9CA 2YA1A 3NDZA 4GHRA 1E6SM 1WZMA 3ITGA 4IFKB 1TJPA 1E1FA 1JEHA 1BXNA 2E9LA 3L8KA 4J35A 2Z1SA 3GM8A 4X3ZA 4LBSA 1MYRA 1NOFA 3SCVA 2NUYA 4ZODA 1HL8A 3TSMA 1TTQA 2J13A 3EOEA 4H6QA 4UNIA 5FS9A 1E4LA 1OYBA 1DV7A 1GOKA 3B9DA 1XV8A 2D2HA 3ZM8A 4H7CA 2XHYA 3NZRA 1GERA 1KGXA 1YXYA 1ZJHA 4F0HA 3R58A 1OT1A 3B0UX 2EQ6A 3ANYA 2JKPA 3H6OA 4F3HA 2HK0A 2QMJA 4RZ4A 3KM8A 1W54A 4CD6A 1M5WA 3V1PA 4KH2A 2E6FA 3OU8A 5I23A 3CU2A 1ALDA 1K9FA 5LA0A 2FMOA 5JH1A 2O9OA 2PDJA 5LGZA 4YHGA 4O4VA 5AHMA 4C1KA 5BW6A 2DVUA 1S2TA 1XLEA 2GUYA 4M7TA 4FDCB 3LA4A 3VZXA 1I2QA 4ML4A 1WDQA 1OFBA 4KRTA 4BJHA 4FLSA 4PA8A 1KM5A 2VX4A 3BLOA 1KV8A 3IJDA 3T4CA 3TYDA 2OOGA 3APGA 2CBJA 4C6JA 2E9BA 2A3BA 2Q8ZA 2DH3A 1K6WA 5LIWX 4MDPA 5PTDA 2C0HA 2C6QA 4YXGA 3C8NA 4LA1A 4H04A 2FFCA 4XBSA 1K77A 4GUFA 4EPDC 4MZ1A 1F3TA 1BGGA 3NCOA 4MNKA 1BGAA 3DHFA 1W31A 3QHMA 1NDAA 3AXKA 1VFTA 3ITXA 4PUWA 2JBMA 3T42A 1W17A 4MYXA 3ZIZA 1EC9A 5K9CA 1OIFA 3USBA 3WF2A 4AW7A 4UXDA 3DG6A 4B5NA 1EFZA 1ZQ5A 4LAOA 4QXIA 1H7XA 1HVXA 4DEFA 5I3HA 1C92A 1AFSA 1KBKA 1PBGA 3CAQA 3DKJA 1YRRA 1K9DA 2G3MA 4LSBA 3BG3A 1UJQA 4HJFA 3AZTA 2HQAA 4KBXA 1H7PA 4PUKA 4GYKA 4HNVA 3WO8A 4QE5A 2BDQA 4IZGA 1W1IE 5AYZA 2XH0A 4GNVA 2BOFX 3ITLA 3R25A 4S3JA 2J75A 2PTZA 3MZNA 1SO4A 1H60A 1NFGA 2F61A 3TXVA 1B3WA 1Y8BA 4KGJA 1S5TA 2V3BA 1QAPA 3B0VC 3TN4A 4AHOA 3AXIA 4GC4A 4RE4A 2DZBA 4I5UA 2OEJA 2CLMA 4JL1A 3UR5A 4PTDA 3TWBA 4QEEA 3M0KA 3MCOA 5EMYA 3VYLA 4A22A 3MKVA 1ZMDA 4JKMA 4YYFA 5CXPA 4ES4A 3OB8A 1X98A 1GYLA 3QZEA 1ICPA 1V6YA 4A35A 1UMLA 1DJHA 4LV9A 1KLYA 2PP1A 2VWSA 3VGFA 4K36A 5CZTA 5GPRA 1KCLA 2VRJA 4CNNA 2VGFA 1EJUC 5U1OA 1JYVA 4HA0A 2INZA 1DP0A 1JZ4A 2PURA 4RL3A 3WLMA 3R79A 5FS6A 3N25A 2I9EA 4KF1A 2FH8A 5DANA 2X05A 1ZMCA 3CMJA 5E93A 4A8IA 3UXKA 1HKJA 4GG9A 4I9MA 3BSMA 1WXYA 1OINA 4R33A 4L6HA 1R30A 3RGTA 1CXLA 2VO5A 1K03A 4W93A 1J2BA 4QSFA 5ENLA 4XBKA 4D8LA 1UJPA 4MDOA 1AQFA 1J6OA 3NL6A 4DM2A 1QI3A 3MUZ1 5LXXA 4IGNA 1MEHA 3TZFA 3B0YA 2XN2A 1ONEA 4YYCA 4HOZA 2P8CA 1KTCA 4DPPA 2F5ZA 3VXGA 1RAKA 1XD0A 1EJ7L 2P1FA 2VDHA 3VCCA 4CQBA 4CN4A 4UTTC 4K1GA 2IKHA 4AZGA 1BYAA 2JIEA 4XZHA 1EIBA 2QNEA 3HG5A 4M3PA 3SFWA 4HPGA 1VR6A 2X7WA 5DCDA 2ZA2A 3CZKA 1EJRC 1KN0A 4IPIA 3SUSA 1XLBA 4JICA 1UZDA 4U4MA 4DXVA 2YCJA 4JPGA 2YL5A 1FCVA 1G7VA 5DT5A 1R2RA 2QGYA 1IE7C 1HZYA 4D1IA 2PGWA 3VDBA 3MW7A 2ZDRA 1WBJA 1R38A 1YE6A 1IXOA 1KRBC 1Z89A 1E5JA 1ODUA 4FSAA 1T96A 1XQLA 4HYWA 1CLVA 1Q7MA 2O9TA 4D6DA 4ZQNA 2D0HA 5K9XA 4YL2A 4RJEA 1A5CA 4MOZA 2PDGA 3R94A 4IL0A 4M19A 1XPGA 2HROA 2G3FA 1W32A 3H26A 3NIYA 3S6DA 2DT0A 4BK9A 4XD6A 5EBAA 2TPRA 3COTA 1DYSA 1XYZA 1VEMA 5J5DA 4WJXA 2P8BA 1TPB1 1XLGA 2B31A 2VC7A 4XSLA 3VM5A 4QITA 2ZZ7A 2UWFA 3BW3A 2ZZ4A 1A3WA 2ZTJA 4XUGA 1I75A 1V03A 2LLEA 2F2KA 4H3DA 1F8IA 2C0AA 2Z7GA 4OUEA 3KVKA 4ALDA 1V3KA 3KL0A 2H3BA 3UEQA 1F8WA 4WF7A 3OO2A 3GG1A 3AIWA 1FWBC 1VBHA 3NSXA 1OM0A 5CAHA 1XBXA 1CI1A 5EYWA 2A5HA 2B81A 3E0VA 3GVWA 1XQKA 1CLKA 3DFSA 4HNUA 1PZ0A 3V0TA 4DLMA 2NQLA 1IWBA 3H2NA 3KBVA 5D30A 3M0XA 4LAUA 1UQZA 1SPQA 1Q6DA 3NOYA 2H9AB 7ODCA 1OC7A 2Y8VA 1XINA 2HS6A 1G4EA 3V75A 3CYVA 3AXMA 4HHMA 4Q8TA 1V93A 2PP0A 1YW1A 3LHUA 1B2YA 1F4AA 2OKOA 4M7SA 3NL3A 3A12A 1E70M 3POHA 4N02A 2GVLA 2YW4A 3G1VA 4HNOA 3NZGA 2YCIX 2BC1A 4UTWA 5BXSA 3CHCA 4LCSA 3VMPA 3URNA 3BICA 3H2AA 4TR9A 4XTIA 3SRDA 4O1BA 4XISA 4XSMA 3D9XA 1SGJA 2CBIA 2X1UA 3VKJA 4X2PA 1UKQA 4IQJA 1O5QA 2OX4A 5BXTA 1J01A 1JXKA 3FLUA 3W29A 3RX3A 5HNUA 1RD6A 4ZE4A 3VNYA 5I3JA 4UTTA 4Q4MA 3FVMA 3VNIA 4KKXA 1CECA 4AEFA 3MB9A 3VKCA 1OX4A 1OT2A 2JQXA 3SCPA 2WMJA 4I6VA 2C8NA 3ABXA 1W8GA 1HJXA 1IEXA 2VRQA 2ZRWA 2XVKA 1NP0A 1W1VA 2A79A 3WNLA 5T8GA 1O7AA 4GFIA 2IMRA 2DP3A 4JGDA 4O1FA 4PSRA 1XIGA 4YS1A 2VX5A 2JE8A 4H4QA 9RUBA 3TAKA 4PB5A 4IP7A 3EOLA 3SFKA 4DB7A 1FDJA 1HP5A 3G1AA 4DBWA 1OB0A 3WEZA 5EMUA 3EXSA 1SFJA 5MKGA 2X09A 2V3FA 3F4WA 1CGUA 1JCTA 3O6YX 1TPEA 3L4YA 4N2YA 3WLJA 4EM3A 3NA8A 3CIXA 4YTQA 4EAYA 2C1HA 1KFJA 1R87A 4XAFA 3PZIA 1JQXA 4MWAA 3M47A 5HWNA 1GVRA 3ONCA 3VIJA 2Z28A 1E6RA 5HA7A 2Y62A 2X99A 4YCOA 2B7PA 1EDGA 3QFAA 1F4HA 2YVJA 3GUWA 1Q3NA 3NRZB 1Q65A 4KFOA 3EKGA 1G4SA 2QCCA 6TAAA 4GIEA 1LQ2A 1Q13A 5LIUX 1QW8A 3ALGA 3N4EA 2PRMA 5LNWA 1XIHA 2ZQ0A 4D71A 1JDCA 3QV8A 4Z08A 4RCXA 1R3YA 4DRSA 3GDMA 3TFXA 3WQ8A 2W6RA 2OJPA 2BFGA 1V6VA 2L5HA 4JIEA 1EEXA 4MB5A 3RU8X 2GVYA 1TPFA 2V3GA 1XYLA 1A5SA 2YLLA 1TUXA 4FK9A 4JIPA 2WNWA 3OLEA 3JS3A 1XC4A 3ANVA 9XIAA 1XFBA 1H2JA 5A6LA 1O5KA 4K8GA 3ARWA 3AXXA 2DIJA 1JROA 4U10A 1NAL1 1B3VA 1POJA 1R3TA 3STGA 4HHLA 3F2DA 4NYUA 4UCFA 2QPXA 5AC5A 3UWQA 3R8HA 3IIOA 4WDWA 4Y8FA 2I5GA 2BGSA 3AXHA 3N14A 1EDTA 3VTRA 1NY1A 3OGRA 3PWIA 2F2HA 1J4EA 3WJXA 4DWSB 3MPGA 4LYKA 3W82A 4DM1A 4FLOA 3BARA 5KITA 1VEOA 2J7EA 4IIGA 2FTYA 1QT1A 3UR2A 1KM2A 1JDDA 3GKFA 1BYBA 4YU1A 1VZWA 4EK7A 3M7SA 4LIIA 4IPLA 3HA1A 4MYAA 2WKLA 5IOBA 4QM1A 5D2VA 2VTFA 3O07A 4YLWA 4ICMA 3WFAA 5E1QA 1GV4A 3W76A 1L8NA 4HGXA 3U7VA 3THDA 2GPTA 3I7QA 4WKHA 5HK4A 4AUBA 3I3EA 1FCUA 3W84A 3UPWA 2OZ8A 5JBFA 3ME3A 2W62A 5DMNA 3EA2A 2HXUA 2DEPA 2WNZA 3ZT5A 2R82A 3L0GA 2EKGA 1E6XM 3W7HA 3VZZA 1FCQA 1RCQA 1GRAA 1M01A 1E15A 4DQWA 4WD0A 4TIMA 3TLLA 2OCZA 4FIRA 3W1MA 3BCDA 5ECUA 5RUBA 4ROQA 2C3CA 2D2OA 1VHCA 1UC4A 1W3JA 3WD4A 1PCKA 3PZVA 3NQVA 4BFAA 3M43A 4GABA 2VR5A 4E2OA 5LZLA 3URHA 3R11A 1E9IA 1RSCA 3W0KA 2QULA 3KZSA 1DE6A 2J25A 4QLJA 2JK6A 3W02A 3LHZA 1VFMA 5DLCA 2V0TA 3H23A 4X9YA 4F2TA 3P6LA 5H1WA 1OF6A 2FGBA 2QJNA 1ODZA 1TWZA 2J9YA 5IRPA 1G4TA 3S3GA 4B91A 1CXFA 2QCFA 1PWLA 2Z29A 5L9FA 2PLJA 1SO3A 1B57A 5K9DA 1OX4B 4YCPA 4AC7C 3TU9A 4W89A 2DGAA 3R7MA 3SGUA 4PCNA 3CUJA 1PYMA 4UFIA 2DUZA 4GX8A 1R9YA 2AKMA 4C5YA 3O0FA 2V81A 1IF2A 4D2JA 1C91A 3AJXA 2Y6ZA 2ISDA 2V2DA 2A7NA 3IVUA 3GB6A 1XIJA 4E6MA 4DY1A 2WLZA 4AWUA 1SZFA 3D5HA 4PH6A 5D9NA 4BY3A 4UCGA 2XVNA 1EO7A 4HJWA 1SUXA 3ENLA 6ENLA 3GFYA 4J3WA 4MWAD 1JVNA 2FZ8A 1NWRA 8XIMA 3S8HA 5D4YA 5FJOA 1A0DA 1P48A 5JRBA 4CNPA 1L2UA 2C3DA 1J0YA 2ZE3A 2PDLA 3K8LA 5CPNA 5AN7A 4AZIA 3DXIA 1GOQA 5HXMA 2NPXA 3B06A 1GVFA 2E5BA 5TR3A 3AUJA 1M7JA 3WQVA 3FIGA 1A5OC 1TR1A 3UG4A 3PSWA 3UZ5A 3AFBA 3T1GA 4XB3A 3WK3A 3S1GA 1QASA 4L64A 3B05A 4LRTA 3IS4A 1XH1A 3GC2A 3G1YA 1PS9A 3IARA 1EJWC 1MW2A 3NZPA 3GE7A 2OPJA 1XDMA 5HNTA 2E8ZA 3UZJA 4PRTA 2ZFAA 4AD1A 1X97A 2EF9A 2WOVA 3BG5A 5JQ9A 4HU4A 5C0QA 1RK6A 5EGRA 1GVEA 5TBOA 3QYQA 2ZZ6A 1RA5A 3I6EA 3O16A 4DNMA 3LN3A 1JAKA 1G7UA 2WQDA 1ZGDA 4FX7A 2CKRA 3NPWA 2HEJA 3IUIA 2G3JA 6REQB 3ZXWA 1NQKA 4H9XA 3U57A 5DBUA 5AYIA 3DYPA 4CU7A 4CCZA 2NLYA 3WJSA 4FO4A 1PL9A 4LALA 5HWJA 3GTXA 2OOFA 4CGTA 2CHOA 1I9CB 1TA3A 4LUTA 3UXLA 4DWSD 1GVYA 4NY2A 3L2IA 1CW2A 3CXOA 2WMIB 3LPOA 1U1HA 2VQUA 3E2QA 1ZLPA 2DV0A 4JTUA 3AUOA 2F7FA 4WZHA 3DUGA 4M1RA 4TX6A 3DC8A 3GK0A 2Y7EA 3AS2A 3UR7A 1TWDA 2YFOA 3N2BA 1US2A 1P0BA 2OX1A 5G4EA 2OVLA 1FDZA 1OCNA 1L6YA 1GKPA 4WCJA 1O66A 1PE1A 3R07C 3IK2A 3LBOA 1Q7QA 3UJSA 4S3GA 5KVIA 1REQB 1P5BA 3VAVA 2NUWA 1SB3B 2P10A 3WQPA 2BOGX 1M6IA 3DFQA 2DVXA 2YJQA 2V3DA 3KBMA 3BUVA 4H9MA 2Z2AA 1M7PA 3S5OA 3ONBA 5A8QA 3AZSA 2CZVA 4ZO6A 1P6BA 3QPYA 4IIEA 4Q4KA 3FK4A 3G1SA 1J18A 4LF2A 3KFTA 5H8MA 2J7BA 2AL1A 1B90A 5L6UA 1QPRA 4LNYA 4RV3A 1G1YA 4ZR8A 2TRSA 3PPCA 3PUGA 1PTGA 3B0XA 1HKIA 5E5CA 2R9RA 1O1HA 4XO7A 2QR6A 1VFFA 4AXNA 3L4ZA 3ZJKA 3Q67A 4X0VA 3LG3A 1AODA 4XZBA 2BASA 3W75A 5I03A 4B5UA 2NLIA 5KZ6A 4I7WA 5JUVA 5F4WA 3NO5A 3G1DA 4Z0JA 3T44A 4NEWA 3WD2A 1UD4A 3RM9A 4YVPA 3IUDA 3GXDA 1DXIA 2QCDB 4S3FA 4QE1A 1OSEA 2ALRA 2QV5A 2TYSA 3CZLA 3KP0A 2CLKA 3WYZA 1UBPC 2BXYA 3FSTA 1KO0A 4YHEA 4OBSA 4RLIA 4H2CA 3GW0A 3I6TA 4P8UA 4TVYA 3AIQA 4BA0A 3P3BA 4F0SA 5M2FX 5CAKA 1UA3A 1FXPA 2BS9A 3FAWA 1J0IA 1RY8A 2E1DA 3CUFA 5I79A 4HIBA 5A8NA 3C0SA 5LNRA 1EJVC 2PWEA 3UWWA 3A3WA 4UR7A 4J3SA 4AIUA 4O10A 5LIYX 3L66A 2WHKA 3RMJA 4J7RA 2OFJA 4PTMA 4PL2A 1FWNA 1TG7A 4EQXA 3AYTA 1WV2A 3T81A 3ZMRA 3O6DA 2YYUA 2G0WA 3AU6A 2OMAA 5A8PA 1OC5A 5CSUA 2CPUA 3ATYA 1ZY8A 3TR9A 2DW7A 1E9ZB 3B3DA 4J3TA 5TF0A 2D23A 3PF3A 3EWDA 1V0NA 2OTDA 1C7SA 1LLOA 1N5WC 1DWJM 3EX6A 3P93A 4ZQCA 5C2GA 4AG0A 4H8UA 4NXKA 4APNA 4FLQA 3H24A 1XSJA 3RRAA 2BXVA 4JDYA 3H12A 3MO7A 1J11A 1E0VA 2CYGA 1UHVA 2I16A 3IIPA 3BW2A 1Y0EA 3OA5A 4Q3MA 1QXLA 3QFWA 3VOGA 4UOQA 4BHYA 3NGJA 4RNIA 2OT1A 2OLHA 3KRBA 1JUEA 2O9RA 2UBPC 3BAXA 4JOMA 4PEKA 4NZ5A 4XAPA 4I7VA 3TOPA 2W66A 4OIFA 1X2HA 4MJZA 1GONA 1A5LC 2VC6A 1OG0A 3K5XA 3W1QA 4WOZA 3PBWA 1V7AA 2YXXA 1RM6B 4PCFA 1DQWA 3V5FA 1KWKA 4MKNA 5CC6A 3N1AA 2ACSA 1BQGA 1OY0A 1PJ9A 3RITA 1N82A 4C6PA 3LU2A 5FF0A 4GKTA 3V0UA 2WO5A 5FKYA 2QCLA 4F0KA 4OECA 1DWIM 1VFSA 2CXGA 3B9OA 3HV9A 3NVTA 3N04A 4Q32A 4BCEA 2XN1A 3T0DA 2WB5A 3S5SA 2QIWA 2NT0A 4B5XA 2GQ3A 1I4NA 3VCRA 3QFBA 3TYUA 1H2IA 2PCEA 5I3KA 1ME8A 3EMQA 3S47A 2XFYA 1JYWA 1GG0A 2WPEA 4A3QA 3Q4DA 1WZAA 5HOSA 3BCFA 3SI9A 4B5SA 5BOEA 1J5SA 1K02A 1VIZA 1QNOA 4UMAA 1JNEA 1H49A 1JF6A 3CJPA 2DT2A 3FJ4A 2PWUA 1IHIA 4S2CA 1QNPA 4UTWC 2H3DA 3EUB3 3O3RA 4BF5A 4E8DA 3FA4A 1VJSA 1SQ7A 5ABHA 4K8HA 2QCGA 3C2RA 1UROA 1X1ZA 2FTWA 3T9PA 3GG7A 2BOEX 5J8LA 1ENUA 5BCAA 3URAA 1R7OA 4U3CA 3QKZA 3SECA 2Y5SA 2EEXA 1FX6A 3THQA 3NR0A 1YMYA 1Z41A 1X7FA 5I06A 3ABRA 3FHQA 4ZXOA 3CGEA 3J7HA 4LUSA 2EPKX 1EOMA 3SCOA 3IUHA 1XM3A 3CQKA 4XX6A 1D7YA 1FWRA 4NKCA 2XTKA 3U2EA 5J04A 4QDPA 3E1F1 5LNUA 2J7CA 3ARRA 4JXCA 4NUWA 3WIJA 3CGBA 4H4VA 3UNDA 1KCXA 1XWYA 2JKEA 5E09A 1RALA 1Q6RA 4R27A 2FB2A 1RH9A 4MFDA 1I6NA 5HR6A 2HVNA 3WDJA 1UP2A 4GRTA 3FY1A 2VEPA 3DG3A 3O1NA 2VOMA 5A6AA 3WK2A 3A4AA 1DBTA 1QCWA 2V6OA 3SADA 4GKLA 2E0PA 5BRQA 3ABQA 1HXJA 2MNRA 5HMEA 4EP8C 4C1NA 4XZ9A 1GSNA 2OEMA 3W01A 5KMYA 3LSCA 2CLLA 4KESA 4PTVA 1D7FA 2WJEA 4QIUA 4FXRA 1LT8A 3G6MA 4QISA 3U8GA 2BVTA 3KOXA 3NQGA 1CNVA 3BOXA 4KCWA 1XPYA 2JKAA 5GRTA 1I2OA 4Y2WA 3QRHA 2WHMA 1JPIA 1JZ5A 2YOCA 2D73A 1ONFA 1G5AA 4R7JA 4GA8A 1XKJA 3IVTA 4JCLA 2EJ1A 4ERGA 3MSGA 1L6WA 3ABSA 1SZRA 3IV8A 5CC7A 3HPAA 1QU4A 3LHYA 1BHGA 3E12A 4DPQA 5DO8A 1BLIA 1A3XA 4JHMA 2EKCA 3FXYA 4U5IA 3AICA 1K8CA 3DYOA 3PZTA 1YIXA 1HL2A 3FJLA 4TXEA 4DNHA 3EX2A 4J2MA 2BXZA 1JIBA 4QJ5B 1F6YA 3DHUA 1UQYA 3OVPA 3GVVA 2FVKA 5HMSA 1QI5A 4M51A 1FEBA 2OSYA 3KRZA 3M5ZA 1WX0A 1E6QM 4PYSA 4Q8UA 2CHNA 4JTDA 4LX4A 3G1HA 3KAOA 5EPDA 5AHFA 3AIBA 4L4MA 4CVUA 3W7JA 5FEPA 4L7ZA 2IKGA 1VKFA 2G4JA 3UZWA 2WC7A 1E0UA 3KCLA 1J79A 3UR8A 4ZGYA 1XRTA 3DFTA 4RKAA 3RLGA 1Y5VA 2VJXA 1LP6A 1VB9A 1QI4A 1ONRA 3T0CA 4IMAA 1L9WA 4PMUA 2GGEA 4C6MA 2WPBA 3K4DA 1Q6LA 1KCKA 1K4GA 4AXKA 3BLEA 3QY8A 1A0CA 3D3AA 2J8TA 5M5DA 4O1AA 3SCWA 1FOBA 4BF9A 4Y9MA 3GXMA 3LCIA 2ODOA 3VGGA 2Y2WA 2Z7KA 4LQ1A 4E2DA 1HO1A 4G7EA 1Q45A 5CEWA 3AM9A 4Y9NA 2VEIA 4TO8A 2QHAA 3WLPA 2ZXQA 1HKMA 2YBTA 4B2DA 3W88A 1LBLA 4KWWA 4QDWA 3PPGA 3SGZA 2Q09A 4ZE5A 1YXCA 4GIAA 5G4HC 3LCFA 3OA3A 2ASHA 4HA1A 1O5XA 1BWCA 2IPJA 4GJJA 1UKTA 4NYYA 4W8LA 3AI0A 3IEBA 3LEPA 3AALA 4U28A 4C6QA 1ZL1A 4IP5A 3LERA 3H8AA 1JCYA 1O94A 4QE4A 2B0MA 4H4TA 1NQ6A 2WMKA 3GXPA 4ACZB 1R3RA 3NWRA 4URIA 1T41A 4UC5A 2NV9A 3T8QA 1S5VA 3B40A 1O68A 1TREA 4EOUA 4CUCA 4XKMA 1U5VA 2D3NA 4I9JA 4ZB5A 1LUCB 4IHCA 1AA1B 1BQCA 3WLIA 3V3WA 4HBKA 3GUGA 1UZ4A 2ABBA 2QUTA 1A5NC 3CZJA 2V5JA 4Z2HA 4ZBCA 2DW6A 1PKMA 1M3UA 4UTUA 2OO6A 4YMZA 1K7FA 1YBQA 2XVGA 4EAMA 4U5KA 4XWUA 4DWDA 4C6OA 2DQXA 4LH8A 2ZZ3A 5LNSA 4JKLA 1K8XA 2QAEA 3LI0A 4I90A 4LT9A 4NI8A 3VNDA 2GDQA 1UUQA 5A8GA 2P53A 4EWJA 2PP3A 3WNKA 2I5IA 2RDUA 4H4PA 1T6MA 1XYMA 3OVQA 3MMTA 4P8WA 3LMYA 2PU1A 2FGLA 1V08A 3RPDA 4GE8A 1ISYA 3PJWA 4MB3A 1YLVA 4PB4A 1V6XA 4Q4PA 2GOKA 1NWSA 8TIMA 3MI3A 1EA9C 3L67A 1JRPA 2VVNA 4ZVJA 5CSSA 5H8PA 1JRCA 2GSEA 1UH4A 1IIHA 2WC3A 1PV8A 3F4VA 1QNQA 1GOIA 2Z0IA 4JTFA 2QDDA 5IBXA 5FF7A 2W63A 1AJ2A 3WMLA 2NX9A 3VOHA 3WLTA 1KGUA 1MFUA 2XM2A 2XIBA 1KBBA 5HJLA 2X16A 3NQMA 4KT2A 3EXTA 3REQA 1F07A 4FAMA 3L21A 3RR4A 1UKPA 3KUMA 4PE8A 3GD6A 1V0LA 3S6OA 2R1KA 2I5QA 1H09A 3KLKA 3GXTA 2CEQA 1TWSA 3DOPA 4HSOA 4FB7A 3RLVA 1XI3A 1YNYA 1JZ6A 3M6YA 5I78A 4RNHA 2CBUA 1V59A 4GXMA 3IJIA 4JFSA 2ACRA 3KBJA 4HZ8A 2WSQA 1FP9A 3FGCB 4GRSA 1QUMA 2C16A 1P6WA 3N9SA 4G8TA 4K2SA 3C2OA 2GUBA 2Y61A 2EQ8A 2BSLA 1BFNA 1EF2A 1W0MA 3W74A 1VPYA 3EOUA 1KM4A 5ABFA 1S1RA 1UPPA 5EFDA 3C0LA 4P7LA 2EPNA 5E9XA 4UQDA 3NG3A 1WUFA 1US3A 3NO3A 3RN6A 4K1WA 3GTNA 4CU6A 2HS8A 3M64A 4KWSA 2WJZA 3LX9A 3IAQA 2YCLA 3PK7A 1GORA 5KETA 4RDYA 4GQ0A 1IWAA 1Z9AA 3MA8A 4QP0A 1EHNA 3ZLGA 1VRXA 3C0JA 4DF1A 3N2TA 5I77A 1RA0A 4O11A 4US5A 3N17A 4IUGA 3W2MA 1XW8A 1SSGA 4V1XA 1AG1O 5F1VA 3VX1A 2HBVA 2J77A 1TPWA 3P0WA 1ZTVA 1W3NA 4L6OA 4Y9PA 3QC3A 4M6PA 1WE5A 1XLCA 1ZRQA 3FNDA 4ONVA 3VKBA 3LMZA 1OFPA 4IOTA 4UTLA 4UTKA 1W5OA 3HQPA 1R3QA 1DJYA 1KLZA 3B9JB 2DSVA 2ACUA 3NOEA 4DJEA 4JTRA 3TN6A 1YKWA 4UTIA 1TJ0A 3PNUA 2XSBA 4O13A 1F61A 1AJZA 2Z25A 3PWGA 4PUNA 1P0DA 3VDCA 3JVAA 2DFAA 4C7FA 2Z26A 3II1A 3UA4A 1JCNA 3S2MA 2XM1A 1NPXA 4H6EA 3PTKA 3K30A 3TNBA 2QQ6A 5CZKA 5G1YA 3E0IA 3BMVA 1XDLA 1MRQA 3LYEA 1RLDA 3H2EA 3NQ2A 3ORWA 3CTTA 3DFYA 2HTMA 5FSDC 1LL7A 3Q65A 1LG2A 1NM9A 3DI1A 1FWTA 1LOQA 1UASA 3AWOA 4WY0A 1A5UA 2W5FA 4GY0A 2ICSA 3C4UA 3WQOA 2D1ZA 1C90A 4WJ8A 2WBGA 1O60A 4DLFA 3FKRA 3QW3A 2TODA 3ZJ8A 4MWAB 3MI2A 4S3BA 4PRWA 2IXVA 4PMVA 4TVDA 1ZNNA 4KCTA 5LHEA 1XRVA 2WZMA 1TV2A 1T5AA 3IRSA 4JCMA 3WBEA 3ARTA 3LLXA 3W23A 1FUYA 4AB4A 1XUZA 2CLIA 1RP8A 3ICJA 1Q85A 4B4HA 4KWVA 1TVLA 2WVUA 2ZUUA 4HHPA 1BAGA 1REQA 1KCZA 3SCQA 4NZFA 4HD5A 3S1UA 4FMVA 2FH6A 4UR9A 2PF8A 3TQ0A 2VMFA 4Z17A 1V4YA 3FV9A 5AVHA 3WLRA 2X8RA 3S1XA 3I4KA 4LYPA 3CK5A 5B7ZA 1TTJA 1DJIA 1F6KA 4K8DA 5D09A 3KDOA 1HO4A 4E3TA 3O0HA 4MFEA 4UFLA 1Q63A 2DDXA 3V7PA 1NP2A 4LWWA 4RZBA 3MV01 4IIFA 1XIFA 1AQ0A 1E43A 3ARYA 5FJTA 4WY0B 3P2VA 2DY3A 1RPKA 3RO6A 1UP0A 3VMNA 2ZUWA 4AH7A 5HPOA 5JBEA 3P84A 2QV4A 4UQEA 3BC9A 3NFUA 3UNTA 4DBDA 2BHUA 2E9MA 2ZC1A 4MKVA 4LVDA 4O53A 1N62C 1XX1A 1KXTA 5C2CA 3NVZB 3LBMA 3TTYA 1FEAA 5AY7A 4BI6A 3EOSA 1UR4A 2RHGA 5CZJA 3C0QA 3THAA 1VQTA 2O7QA 4H83A 4ZOBA 3ZLHA 3RAOA 4KWOA 2B7NA 4O54A 4AD3A 1V77A 2WVVA 3TW9A 4JFTA 2IPGA 4CLMA 4E0CA 3VGDA 1KV5A 7TIMA 1G4PA 5FCZA 3PB0A 5ABGA 2E28A 5CKSA 1VDVA 3DK8A 4FX8A 4FLRA 2NW0A 3ZWSA 1HJVA 5GJPA 3W7PA 1B31A 2UY5A 5U25A 1VEPA 3O05A 1C29A 3VKKA 3L65A 3FSUA 4ZCWA 1AMKA 4L1WA 4B16A 3WY1A 3PBUA 3WELA 3GDKA 4OT7A 1OHLA 1CWYA 1EYWA 2Y24A 3TNOA 2WXDM 4GUIA 5HPCA 2WBKA 1EQCA 4IMEA 4H19A 1HIZA 1X6UA 3PFMA 4IMGA 3AHTA 4NZ1A 1X1NA 1FFQA 1M7OA 1M6JA 4D6HA 3SBFA 2ISSA 4DWSA 1XYFA 1S5WA 3L4VA 1GCYA 2NVAA 5HUPA 3N18A 1S2CA 3SO7A 2WVSA 5LA2A 3PBYA 4QCFA 1VCFA 2J7FA 5BOFA 2VT0A 1OX5A 3WH9A 3O0KA 2VYOA 4JZ5A 3GNPA 1L6GA 1XYAA 4POCA 1X38A 2QMKA 5BU6A 2WWCA 4GI6A 2E5AA 3MTWA 2HPMA 3N4AA 2PODA 3VD3A 1XG3A 1W9PA 4R5EA 2W0HA 2QJGA 2OELA 3DIPA 3SN0A 4H01A 5I5RA 2FIQA 1VQZA 4U2YA 4D6CA 5IM51 4LB4A 2RKXA 2PI6A 2WSPA 3DECA 4O18A 4C6EA 4NAFA 3AOFA 3EBVA 3QR0A 2Y5JA 4V1YA 4FALA 1SO5A 2PEVA 2NXIA 1OVDA 1ITXA 1UD6A 4MNLA 1OC6A 4JQ1A 3HB9A 4TVWA 5AHLA 1VD6A 2TAAA 3OVGA 2CLPA 1XIMA 3W53A 3CL6A 3W7EA 1KBIA 2GQWA 4UQBA 3GHTA 1CT5A 2IXUA 2VWTA 3LV6A 4W5UA 1P1MA 1H41A 1WDDA 4M24A 2CERA 5GVJA 2C13A 1JFHA 1H4PA 5DMLA 1GYNA 1JL8A 4MZ8A 3EX1A 4S39A 5HATA 5EBKA 5TD4A 3A13A 4PMQA 1EP1A 4Z2JA 2VL4A 4QAWA 1GT8A 4TX8A 3LXAA 3CV2A 2POZA 4ROPA 1EUAA 4S2BA 3W1LA 4L9YA 7TAAA 3EKLA 2VFFA 1LWJA 4GUJA 3MS8A 3QZAA 2VRKA 1LORA 2O4MA 7REQA 1QI0A 2G37A 1GQJA 4D6FA 1ZAHA 2XSXA 1MNZA 4M29A 4DYKA 3VKDA 1H7WA 2ZE0A 3NQDA 4HT3A 1B30A 2NSXA 3RXZA 1J10A 2BNJA 2QYGA 1WAUA 3AIVA 4ZQPA 3DHDA 2GR2A 3W2NA 3CHDA 2FDSA 2IUZA 2Q3RA 3E38A 3NM1A 1RPXA 1XG4A 2Y70A 1JGMA 4HMDA 1NU5A 1P7TA 3SY1A 1HFBA 1KRMA 2V5CA 1E55A 5CBJA 3A4JA 4AZCA 2VFDA 1S1PA 4N0RA 1RVGA 5JCNA 4BS0A 1GEHA 2JFEX 4M1BA 1BXBA 1MSSA 1TJ2A 4UFJA 3B8DA 1R3VA 2QCEA 4J28A 4MY9A 3SZ8A 3GYEA 4MG4A 1UIPA 1J93A 1QHPA 3F2BA 2ZZ5A 4Y6GA 1MZRA 3CLMA 3YPIA 2BBFA 2OR2A 2AQOA 5G2WA 3WUEA 4MJMA 4P7RA 2AAAA 3AS3A 2ADAA 2RGLA 1RQHA 2HK1A 1RZMA 1Q8AA 4B9ZA 3G24A 4S3AA 2IPFA 1DJWA 2X30A 1W1TA 2Z6JA 3S2NA 1MEIA 3VNLA 5DY2A 3HN3A 3GKAA 1H0IA 3NJ3A 4IPPA 6PTDA 1EHAA 4MWAE 1S38A 3OBKA 4B2DD 1J0JA 4ATDA 2EAWA 1EGZA 3DENA 1X2GA 2OSWA 3SUTA 5E0KA 4H4WA 3GYCA 3I7SA 3S2JA 1QPQA 1PO9A 4JTAA 1Y65A 1UOZA 1Z32X 5C9RA 2F8QA 1PX4A 3WEOA 1UD5A 3W1XA 1YTEA 4KRZA 3UWUA 1WDPA 5GNYA 2HISA 1W1PA 3PZQA 2WVVB 2XUCA 2E4TA 2WP6A 1DIKA 4D6JA 3KLLA 3O06A 1XISA 3W7RA 2GR3A 1VFOA 1MUMA 1OZMA 5E70A 5AC4A 2VFEA 2ZA1A 3GDRA 4BF7A 3Q6JA 4AX7A 4Z2GA 1GRHA 3A24A 4EKJA 3UT0A 1Q6EA 3VDGA 4HK6A 4GR1A 2ZYFA 4QTGA 4O0KA 4HCLA 1N8FA 4F40A 4ILSA 3HPFA 4ADWA 1XP3A 3BJTA 3HJEA 2ZXBA 1WKDA 1ZAIA 6TIMA 3L2LA 2FLIA 2A3HA 4FOUA 4DNAA 2CC0A 4KEVA 3RCYA 1YE4A 1EX5A 3KOWA 3CPUA 1T3QC 3QFEA 4HB7A 3KXQA 3TQPA 3P0XA 1W91A 4K7YA 4IPJA 3GSMA 4MAVA 5HAOA 3TKFA 2X1RA 4R9OA 3UWYA 4HPXA 4LUSB 1B4KA 2NX3A 6XIAA 1F3PA 1M04A 4JQ9A 3U5YA 1K6AA 2VDIA 4CN1A 1EEPA 5IDZA 3T55A 1C3FA 1IXQA 3HJZA 1UUOA 3G0SA 4HMCA 4Q8QA 3P82A 5LXEA 1US0A 1JZ7A 1PB0A 4Q22A 4A05A 1ECEA 3UETA 2KAUC 3CPGA 3IGUA 1PCWA 3UWVA 1R2SA 2E6DA 4HZ7A 1ZCOA 1QPKA 1B3ZA 1XICA 1UH3A 3FG2P 1E56A 3LPPA 5FL1A 1H50A 1SJDA 1RD5A 3BGAA 1YADA 2CFFA 5D2YA 4DJFC 4W86A 4CQ8A 4LEQA 2BVDA 4J27A 5FF4A 3W7GA 2YDAA 1HP4A 4GQRA 1XLLA 4KW2A 5D9MA 3ARUA 1ADSA 3ES7A 5EFFA 3C86A 1QW7A 2E68A 1SR9A 1PDZA 2W3SA 3RF9A 5C2XA 1SFTA 4ICCX 2XJ7A 2ZXAA 3TXZA 1MO9A 1E0WA 1FWIC 4OJYA 1J0ZA 2ATMA 4WKAA 3ABZA 3MUXA 4MADA 3CH9A 1KTNA 3QLLA 1NHQA 4CKQA 3EKZA 5HNRA 1NSJA 3W7CA 2A3AA 1JFXA 1YNPA 1N7KA 1XHGA 3W6YA 3LCWA 3CB3A 3AN1A 1E6ZA 3PZUA 3FFSA 5K3VA 2AQWA 4TMBA 3PHAA 4HCHA 4DZHA 4PC8A 5KVHA 2PPGA 1HVQA 2CCRA 2VFGA 1IEIA 1QBBA 1Q7ZA 1Z69A 3UA3A 3NDYA 5FA5A 3WNOA 1XBZA 3MVTA 1BRLB 1G9HA 2OYMA 1VYPX 3F1QA 2FMNA 3IANA 3FXGA 1O4UA 1H7NA 3PWAA 3N29A 3G3MA 1ECQA 3P62A 3SRFA 2HBXA 3CHVA 3N34A 3HW2A 3NQAA 2FPYA 4MVAA 2XGZA 1S3TC 3OODA 3EEZA 1WDWA 5H2ZA 2NQHA 3LB0A 3STFA 3RCMA 3JU2A 5AECA 3WF4A 1XRFA 1OFRA 3SSZA 2RABA 4HCDA 3WK1A 3WQGA 2GQAA 1B4EA 1TPUA 2J62A 4H1ZA 2D69A 2DIEA 4JTEA 3V35A 2C1IA 5FS7A 1JAEA 3R2GA 4HYRA 1GVSA 1VP5A 2C14A 1QOPA 1Q6CA 3QW4B 4GZIA 9CGTA 2BX7A 3A47A 4AEOA 1ISXA 4DO5A 5A3HA 4HYVA 5FSEC 2IKIA 3VNKA 1ML1A 3B4YA 3BURA 3TSBA 3T4WA 3QGVA 5F2GA 2WOIA 1BVWA 1UC5A 1O6IA 3FDGA 3BE7A 3EXRA 4E2VA 3M5YA 1Y5XA 1XKYA 3VGBA 2OSXA 1XLMA 2R1NA 5EY5A 4JTSA 3SN1A 3TTSA 4ZO9A 3V4BA 2OZ0A 5HINA 2ZICA 3JW7A 4JX6A 2ZUVA 3OEXA 2R6OA 2PWDA 4L4PA 3B8WA 4C6IA 3B8TA 1I1WA 4PSPA 3WNMA 1V5XA 2Y88A 3C8FA 4IM4A 1R46A 5FI8A 2YIHA 4N7QA 4NXSA