3RCYA

Crystal structure of mandelate racemase/muconate lactonizing enzyme-like protein from roseovarius sp. tm1035
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
396
structure length
396
Chain Sequence
VKLRDLDIIVTAPPAPGWGGRYWILVKLTTDDGITGWGECYAASVGPEAMRAVIEDVFARHMEGENPENIELMFRRVYSSGFTQRPDLTAIGAFSGLEIACWDILGKARGRPVWALLGGKMNPRIRAYTYLYPLPHHPITPFWTSADMAAESAADCVARGYTAVKFDPAGPYTLRGGHMPAMTDISLSVEFCRKIRAAVGDKADLLFGTHGQFTTAGAIRLGQAIEPYSPLWYEEPVPPDNVGAMAQVARAVRIPVATGERLTTKAEFAPVLREGAAAILQPALGRAGGIWEMKKVAAMAEVYNAQMAPHLYAGPVEWAANVHFAASIPNILMCESIETPFHDALIKGSIRVEGGYITPPEAPGLGIEVDEALARANPYHGTGLHLEMQEASCDYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme-like protein
publication title CRYSTAL STRUCTURE OF Mandelate racemase/muconate lactonizing enzyme-like protein from Roseovarius sp. TM1035
rcsb
source organism Roseovarius sp. tm1035
molecule tags Isomerase
total genus 138
structure length 396
sequence length 396
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rcyA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rcyA01
2O56A 3IJIA 3ZLHA 3PFRA 4ZA0A 3T9PA 3V5FA 3B97A 4E6MA 1XS2A 4DHGA 3THUA 2PSNA 3GY1A 3UCCA 5BOFA 1SJDA 3V4BA 2OX4A 1MDLA 3N4EA 2GGGA 1ECQA 4H19A 3ZVIA 3TOYA 3IK4A 2OLAA 3CAWA 3UJFA 1P48A 2PMQA 4JHMA 4DXKA 2XH0A 2P3ZA 4X2PA 1R0MA 3VA8A 4DX3A 2OFJA 1RVKA 3V3WA 3ES8A 3RO6A 2HXUA 3JVAA 1MDRA 3FYYA 2GDQA 4H2HA 2PPGA 2PP1A 2QDEA 2P8CA 1TE6A 3UJSA 3MWCA 4ROPA 1DTNA 4EWJA 2FKPA 3SBFA 3TJIA 3IJLA 3VCCA 4HNLA 4FI4A 2OZ3A 5J04A 1MRAA 4GFIA 2AKZA 2GL5A 5EU9A 5IDZA 2OO6A 2XH4A 4DYEA 2PP3A 3DFYA 4JN8A 1EBHA 3Q45A 4IL0A 4H1ZA 3NZGA 2QQ6A 1FHVA 3FJ4A 3QPEA 3P0WA 2FYMA 2PGEA 2CHRA 3QN3A 3TWBA 2PP0A 4KT2A 1EBGA 3UJRA 3VC5A 3RR1A 3QTPA 2HZGA 1PDZA 2XH2A 4GGHA 2GGHA 3N6JA 2P8BA 4MKSA 3STPA 1MNSA 3TCSA 3R0KA 3T6CA 4Z1YA 1SJCA 2PA6A 2PS2A 2OQHA 1ONEA 5FJOA 3I6EA 3UJ2A 4GIRA 5FJPA 3EEZA 4JN7A 3NFUA 4H83A 3R25A 3DG7A 3P3BA 2PTYA 3D47A 4KWSA 2NQLA 3H70A 3GD6A 4IL2A 3RITA 3OP2A 3H12A 4K1WA 2AL2A 3Q4DA 3VFCA 1WUEA 1KCZA 2OZTA 4HCDA 3NXLA 3VC6A 3ZLGA 5FJRA 4HN8A 4KEMA 2QDDA 3NO1A 4IT1A 1L8PA 3I4KA 1EC8A 4HNCA 4J1OA 2ONEA 2OZ8A 2P88A 3TWAA 3DGBA 3VCNA 3RRAA 2PU1A 1EC7A 1MUCA 3JZUA 3R0UA 2PCEA 3R11A 3CXOA 2QJJA 3FCPA 3OZYA 4IHCA 3DEQA 4Z17A 1TKKA 3EKGA 3UGVA 1KD0A 3T4WA 1NELA 2GGIA 3CYJA 3MZNA 3ZVHB 1JPDX 1JPMA 1IYXA 2OQYA 2QGYA 3FVDA 4G7FA 3HPFA 4ENLA 1W6TA 2OKTA 3IJQA 1ELSA 4DN1A 4IP4A 4GYPC 4E4FA 3ZLFA 2HNEA 3OZMA 1KKRA 4F4RA 3GC2A 3I6TA 2AL1A 1EC9A 1PDYA 1F9CA 3R1ZA 3CT2A 2GGEA 3RCYA 4IP5A 4K2SA 4A35A 3BJSA 3SN1A 1BKHA 2AKMA 3FXGA 3JW7A 3UXLA 3CK5A 5FJUA 4HPNA 4GGBA 4K8GA 3PK7A 2QJMA 3ENLA 2MUCA 4A6GA 4HYRA 3FV9A 2ZC8A 3QLDA 3UXKA 2PGWA 4MGGA 3R10A 3S47A 4M0XA 2XGZA 2OVLA 2DW7A 3DDMA 1P43A 3SSZA 3DERA 3K1GA 1SJAA 4E8GA 3MUCA 2RDXA 2QJNA 4E4UA 3MSYA 3DFHA 2XSXA 4DWDA 3UJEA 3SN4A 2AL2B 2ZADA 5ENLA 4HCHA 1FHUA 1YEYA 2PODA 3QKEA 4A3RA 1OEPA 2PU0A 2XH7A 1BQGA 4MMWA 2GSHA 4HCLA 2OPJA 2OG9A 4J3ZA 2P0IA 1JDFA 3T8QA 5FJTA 3TQPA 3RGTA 2PTWA 3PWGA 1JCTA 2POZA 3S5SA 3GO2A 2DW6A 3MY9A 1E9IA 3BSMA 3D46A 3P93A 3CB3A 2GGJA 4FP1A 4GISA 2PTXA 1NU5A 1KKOA 3OPSA 6ENLA 3SQSA 1R6WA 3H7VA 3KUMA 3MKCA 3SJNA 4YWSA 3TTEA 3OW1A 7ENLA 4KPLA 3ES7A 3UCDA 3H8AA 4G8TA 3MQTA 3PWIA 2I5QA 2QVHA 1WUFA 3N6HA 3U9IA 2HXTA 3U4FA 3ZVHA 1TZZA 1XPYA 4E5TA 3DG3A 3DIPA 3VDGA 2MNRA 3V5CA 5BOEA 3OTRA 3N4FA 3BOXA 3DG6A 2PTZA 4GMEA 1SJBA 3TW9A 3TJ4A 4GYPA 4ZCWA 4IZGA 3SN0A 3DESA 4M6UA
chains in the Genus database with same CATH superfamily
4Z42C 1SSDA 2ICSA 2FH8A 3N17A 1GPFA 2UY2A 4XISA 4R9OA 1EA9C 4W7WA 4JQ9A 1K77A 2FB3A 2D0GA 3S2CA 3THUA 1K9DA 3GDKA 3V7PA 3GK0A 1W1PA 4IFKA 5DELA 1MO9A 1ZY8A 2WNWA 1BLIA 2WYSA 3TFXA 4PB3A 3QQ0A 3EB2A 3CHCA 2E7FA 4LNYA 3MANA 2GJLA 1P0KA 2VENA 1UG6A 4HQVA 3STGA 2GJRA 2GQAA 4GYJA 4UQAA 1R0MA 3BAJA 3I68A 2ZUTA 2OFJA 1FFRA 1SMDA 2D23A 3RO6A 2BZNA 1UOKA 2PFHA 1ZB5A 3WDQA 1AQFA 2XIBA 4R53A 3AI0A 2YCKX 1P4CA 4CU8A 1K8CA 5HA7A 1TE6A 3UJSA 5J5DA 3MWCA 1F05A 4RE2A 1O1HA 2DQXA 3OA5A 2G0WA 1VRXA 3VIIA 4C6QA 4EWJA 4L4PA 4L9XA 2YBTA 2WHLA 3HZ3A 1ZAIA 4QLKA 3U4AA 4RJEA 4A3HA 1EGVA 1ZS2A 1V3IA 5C55A 4L6OA 2F6UA 1JCYA 4DYEA 2PP3A 3V36A 3OLGA 3GNXA 5CAKA 2ISDA 1OQFA 4UC5A 2VFFA 3SADA 4EAMA 2PGEA 1AW1A 3QN3A 2WP6A 1JOAA 5A95A 8A3HA 4A22A 2VGFA 4L61A 3B8UA 4K36A 2J7BA 3RF9A 5EPDA 4JQAA 1HL2A 3VC5A 1CW2A 2QCFA 2ZE3A 3C2FA 5BROA 4O57A 4R9XA 3L21A 1JD9A 4MWAC 3SUWA 3CV6A 1R2SA 3IPWA 3WH9A 3STPA 4S39A 1Z7AA 3WQOA 1KM3A 5D02A 4JEQA 4XKYA 2DZTA 1KBBA 1L2UA 2CZEA 1DYSA 4EQXA 2CBIA 1ONEA 3FJLA 1XLJA 2YVGA 1FH7A 3DBPA 1CYGA 2GJPA 2ZRXA 1UIPA 4MZ8A 2NQHA 5H8PA 3L68A 2VP8A 3S4TA 4GPNA 5LZLA 4GUFA 3MC5A 3H70A 1NAL1 3N15A 3H12A 1QI5A 2HBVA 3GR8A 3CXBA 4OOUA 1OYAA 1KCZA 1BRLA 3NQDA 3B8TA 3ARSA 1EX5A 3TV8A 2ISFA 2FZMA 4DJEC 2GLKA 5G4HC 3A3XA 1V0MA 3FKKA 1C7TA 1VFMA 3G5EA 4J1OA 4ATDA 2OZ8A 5AN7A 4DWSC 3WKZA 1LRQA 2XIMA 3PJTA 2C0AA 4XZNX 2YA0A 1A5NC 3R11A 4UOZA 1BVZA 4DJED 1TSIA 1H7RA 2YCIX 4XIAA 3P7YA 1TTJA 5D2TA 3UGVA 4KH2A 4AIEA 3E2QA 3KL5A 4F0HA 1KXQA 4BFAA 4IFOA 3LGEA 3LHUA 2XM1A 1FCBA 2GJXA 2QGYA 3B05A 1ME8A 4TMCA 3MHUA 2HNEA 3CL7A 1GOXA 3RPMA 3G3DA 1Q45A 3E2VA 2FLIA 1FKWA 4QTGA 1ICSA 2QIIA 2O9PA 1EJVC 1ZMCA 3QBUA 4NEVA 2ZZ4A 4M6VA 3IARA 1K70A 3EA1A 4K7VA 2VWSA 4XK2A 3CUHA 4AQLA 5HPCA 1NP0A 4IJCA 3CTTA 2B31A 3PK7A 2JALA 4PSPA 3W6MA 3ZMRA 1XIEA 3T55A 5CG0A 4HYRA 2YCEA 3S5NA 1OCNA 2GQ3A 4HSHA 2CLKA 3NUKA 3VKBA 4C7FA 3QV9A 2XGZA 3CEPA 3SCPA 2YGYA 1I4NA 4ERGA 1PKNA 1Z3NA 2DIJA 4E8GA 4LUIA 3UF9A 1NPXA 2WW5A 1FKXA 4NZFA 4ZOHB 3B8IA 4AAJA 3MCMA 3TXZA 3E5PA 5FKYA 5HWMA 1O7AA 4D71A 2BFGA 4RNIA 4TVDA 1JCMP 4GKLA 3GNOA 1JCTA 3DFPA 4GKTA 4PRTA 1XYAA 3Q6JA 3GO2A 2HQMA 2J8FA 1ADOA 1WZKA 3SGUA 4TR9A 4XSMA 3KP0A 1C92A 3U0HA 1KKOA 5C54A 3QV8A 1T8XA 2ZRUA 3FK4A 4G6CA 2V3DA 4ZFCA 2EO7A 1Q6EA 4CQ8A 1F3PA 1XQLA 6PTDA 2X41A 5F7UA 3ES7A 5TNVA 3BSGA 4HMDA 3II4A 1JCNA 1U2YA 3H8AA 9CGTA 1W1B1 3VMOA 3WEZA 3W1QA 3EDFA 2FTPA 4TO8A 4ZQPA 4XBSA 2IPWA 3LI0A 3W7CA 4QXIA 3CU2A 2W79A 1RXOB 4HJWA 1EJ7L 2RFGA 2X8GA 5FAJA 3ZVHA 3V1PA 3GHTA 3DG3A 1KTNA 4IX0A 4D72A 2MNRA 1QBAA 5LNVA 4YU1A 1H1ZA 2GDUA 1UD4A 4RZBA 1QPNA 4KKXA 1NTHA 2PWEA 3OODA 4BF9A 4ZMGA 4OHQA 5CG7A 3S6DA 3PUGA 4PH6A 1Q7ZA 3J7HA 2CLOA 2I1OA 1VCGA 2RDUA 1Z9AA 3V5FA 4RK8A 3E96A 4Q8TA 1XS2A 2E25A 3GY1A 4L1XA 1UD5A 2VM8A 3O2LA 4AF0B 3KM8A 1PZ1A 4S3JA 1X97A 3RNDA 4RDZA 4HB7A 4MB4A 2PBGA 4H19A 3CUFA 3BZJA 1V51A 4MWAE 4B3ZA 3PTQA 4ATWA 2Y85A 1FY6A 4W7VA 3V5OA 3TTYA 4LVFA 3VX0A 4X2PA 3USZA 1W9BM 4FIQA 5TD4A 1EEXA 4A2RA 1D3HA 5IXEA 1HW6A 2BVDA 3QGAC 2VX7A 1TMQA 3KBSA 2A3EA 5FI8A 1EYWA 5C5YA 2EBNA 3UQNA 1X8CA 3E0WA 4NXSA 4A21A 3A12A 4P8XA 1VAHA 1FHLA 2L5HA 4PMJA 3GFYA 1EP3A 3SBFA 5H2ZA 1JUEA 1B31A 3A13A 4FI4A 4U2ZA 3WFLA 1PXGA 1UZ4A 4EF8A 4HMNA 4GFIA 2Y62A 4IG2A 1DJHA 3E38A 4BQ3A 3EOEA 1KFJA 1XYMA 1W5PA 4YTSA 2DGAA 4XZ9A 1M01A 4GJ1A 2ZYFA 5I3DA 5REQA 3TQVA 3GXFA 3IIOA 3TK7A 3DJGX 3LADA 2RUSA 1OX4B 4K7YA 1T5AA 3M0ZA 2PP0A 3VNIA 3EOLA 2OOFA 2ZXQA 4LB4A 1V03A 1BWLA 2CKRA 3RR1A 4RV8A 2NV9A 1TO3A 1GVQA 4K37A 1R3RA 4R34A 1KXTA 1SYTA 4E38A 3W28A 4NY2A 2WJZA 1VBRA 1YE6A 2EHHA 1AK5A 4FF5A 1Q1RA 1JULA 1LOSA 1LPFA 3FOKA 2CZ5A 1VPYA 3M6YA 4K39A 3TCEA 2NLYA 5FF2A 3ORWA 3T6CA 4X0VA 4KF1A 2VC7A 4H8NA 2QF8A 4GQQA 4HOXA 1LL7A 2WHMA 2AMGA 3GXTA 3K13A 1B3ZA 3A6OA 3B0XA 5A69A 1F3EA 2ESCA 2Y7DA 4WR3A 2VOMA 4WLCA 3S6TA 4NASA 3VUSA 3SURA 4Y8FA 1PIIA 3Q4DA 4HU3A 4LYRA 4H4RA 1PZ0A 1UD3A 3KBWA 1I2QA 1LWIA 1XBZA 1LOQA 3G0SA 1KFLA 3RPDA 3E1F1 4BI7A 3VOIA 4HNCA 3BG9A 2Z6JA 3V0UA 5D32A 3KP1A 4ROQA 4X63A 4AZBA 1WAWA 4M82A 4JNMA 3JZUA 2NUXA 2J13A 4Z17A 1NDZA 4PUMA 3S9YA 2FPTA 4HJFA 4UOJA 3EUB3 3B0YA 1NF0A 1ZK7A 2Z25A 1FWWA 1NIUA 2DZSA 3JUGA 1TPDA 1JPMA 3M16A 2VX6A 2BV9A 3NQCA 3PB0A 2OEJA 1O5QA 3NQGA 1ZDLA 3FVDA 3GNNA 1UH2A 2QPUA 3UBPC 3RIKA 3EB4A 4DN1A 3LHVA 3ZLFA 4RE3A 3BTNA 5H6HA 1DHPA 1UWUA 2YCLB 2RHGA 5TAOA 3VX1A 3QXBA 2A7NA 2CLMA 4LT9A 1TREA 1XJBA 2A2IA 3I6TA 4RZ4A 1QPRA 1E1CA 1XUUA 3R1ZA 5U7SA 1EL3A 2FH6A 2WVVB 5A8MA 2HJPA 4WOQA 2DSUA 2G96A 2DSVA 1UKQA 1MNZA 4QDPA 3AWOA 5HUOA 3VNJA 4H6EA 1R38A 5EMKA 3N1AA 4UTUA 3VU2A 1FWHC 4LAMA 4XD3A 3UXDA 4K8GA 1E1EA 2Z2BA 4PRRA 2WOQA 4XX6A 1A5MC 3EEGA 3NIYA 4UTWA 1QI2A 4JYDA 1W8SA 2ZC8A 3CS2A 2ZE0A 4DNHA 3IUHA 4IFRA 3O6CA 1EIBA 5MKGB 3UWQA 1F4AA 2BHYA 1KA9F 4LA1A 1JL8A 2NVCA 3E74A 2O0TA 1YBQB 3DZ1A 3O7UA 2WSRA 4KEVA 4EQRA 4H4WA 4CCDA 1C8VA 4UNLA 2ZRWA 3M6DA 1OD8A 3O0HA 4NG3A 3WMSA 3R79A 4RZ6A 5KITA 3LOTA 3AS0A 3TSMA 1KQZA 3N11A 4CNUA 5FACA 3WNKA 3SCOA 3QJAA 3EPNA 3AUJA 5DMYA 1A5KC 1ZSXA 1DJWA 3S2MA 1UHVA 4WDXA 1BF2A 1E0UA 2QLYA 4P7LA 2C16A 3KX6A 6A3HA 3PHAA 5FL1A 3SFWA 2IS7A 2ZUSA 4LC8A 2R82A 4FO4A 1GSNA 4K7ZA 2PZNA 3KBVA 3BLEA 3K1DA 3N14A 3DFOA 1EXBA 4W87A 3Q37A 3EX6A 4K1GA 1AZ2A 3MQTA 3SO7A 3TP4A 4QP0A 1OIMA 3O3RA 1TJPA 3MWAA 2XVGA 2YA2A 5TR3A 3BAIA 3G0XA 1RCXB 3W7OA 3K4AA 4WRHA 1YW1A 4NSBA 1HQTA 4YTTA 5I0DA 5MHBA 2VYOA 4Q8QA 2XVLA 3A22A 3NZRA 3VM7A 3CPGA 1XRTA 1S1PA 2OSXA 2Q6ZA 1SO5A 4J2PA 3RPTA 3UW6A 3TZNA 2D69A 1HKKA 4LBRA 2XIIA 1PZ3A 5D33A 2FVLA 5I24A 3EA2A 1VP5A 4JKMA 2W4XA 3CL6A 5T8GA 2DT1A 3M0IA 4EK7A 4FDCB 4NL1A 2X8CA 2D1ZA 5CSUA 4PN2A 3LUTA 4QSHA 3AROA 1UJPA 5DY3A 3QQ1A 2X1IA 3W85A 3NYDA 3DX5A 1W3NA 1RPKA 5BOFA 1SO4A 1EP2A 1DTUA 2GR2A 5L9FA 2OX4A 3WLOA 1F2JA 2GK1B 4TU1A 3SAZA 2QCEA 1QOPA 1WKEA 1V4YA 5CPLA 2PMQA 1XDIA 4EANA 1DL3A 3PZMA 1HJVA 3B9EA 3TNBA 4MNMA 3L0KA 1C8YA 3L0NA 1H7NA 1XIDA 1JNEA 2J66A 3LEPA 1R3SA 2AOSA 3CZLA 4JL1A 3CQIA 3RXZA 2H3BA 4H8UA 4B90A 2V9DA 3CYVA 1WDWA 3DU0A 3AS2A 2NVKX 2WJDA 3KZSA 1WB0A 3MUIA 4JHOA 4YVVA 4UTMA 3TC3A 1POJA 1OT2A 4IQEA 3STEA 2CKSA 1GGOA 3IJDA 3QFBA 4AZIA 4HU8A 5E0CA 3KRUA 4I5UA 1VD6A 1VHNA 5FCZA 4PL2A 3DUGA 5DF0A 3KWSA 4P61A 4EP8C 4WZHA 1JZ7A 4UMAA 3TQ0A 1WAUA 2YL6A 4QAWA 1GRGA 2PDBA 5C70A 1H7PA 4Z2JA 4L1GA 1I2RA 1TIMA 3DFNA 1FHVA 3GKFA 1KFWA 4UTWC 2V5LA 2YLAA 4MFEA 2FIQA 3P61A 2W9MA 3TWBA 2X2YA 4L4OA 4B5VA 3L4UA 4D6IA 5JQ9A 2WBGA 4J57A 2WP5A 2QPSA 6TAAA 4MLRA 4RXFA 2XH2A 1YDOA 4QJ5B 1PX8A 9XIMA 2E9LA 3UG8A 2GGHA 9XIAA 2FDMA 3RN6A 3KCJA 3HOJA 4PFHA 5I3JA 1YADA 5CC6A 1X7IA 2XN2A 1T96A 4LU0A 1LQ2A 3IK2A 1WDQA 1FWDC 4UFHA 3DENA 1J0HA 1E15A 5CPOA 5FJOA 1PE1A 3W7DA 4PTVA 1RPXA 4MF4A 4JFVA 2H8ZA 3RMEA 4H01A 3KVLA 4OUEA 4R85A 1FP9A 3S1GA 2PI6A 3R25A 4NZJA 1UPPA 3FFSA 2WOVA 3KE0A 3B03A 3PJUA 2WSQA 1B2YA 4AD1A 5HXMA 3AIVA 4HCDA 1JQVA 4HZ8A 2HNHA 1US0A 5FJRA 4IT1A 4F0SA 3T40A 4F0LA 1EJUC 1RLDA 1JXKA 1RSCA 1OC5A 2Z24A 1IT8A 4GRSA 4DXXA 1NVMA 3NXFA 5L6UA 4G9PA 4NAFB 1SR9A 1G6CA 7REQA 4ZO8A 3NQBA 5FL0A 1OCJA 1VENA 1M7OA 3MP5A 3NJ3A 4ZOCA 3WQEA 5CBIA 1D2KA 4WKFA 3VK5A 4UTJA 4HHLA 5GJMA 5B7YA 1QK2A 1W6TA 2OKTA 3VKCA 4ZEPA 2DZAA 3OVPA 3QC3A 3F7JA 5I3HA 5ABGA 4NI8A 1H1YA 1SVDA 5D03A 1GYNA 1XFCA 1QK0A 3GAYA 1J0YA 3QLLA 4I3GA 1EKOA 3AJXA 2PZ0A 1ODUA 3DHFA 4OBRA 3BAKA 3UG4A 4WDTA 4K2SA 1M68A 5IBXC 3IJ9A 1JZ3A 2YKKA 3R58A 3UYCA 4Z2KA 4JY8A 1ONFA 1I6NA 4Q4PA 4IFKB 4F40A 3W27A 1HJUA 1DHKA 1W1IE 4K3ZA 2X8HA 1P1MA 3W2LA 1TJ2A 4V15A 2WO5A 3QGVA 3FIGA 3NAVA 4QDWA 2Y4SA 2DW7A 1EIXA 1V5XA 2QAFA 3AXKA 3WLPA 3C4UA 3WD2A 2VFHA 3PTKA 4TV5A 3F5JA 3CASA 1NH6A 5CJNA 2Y5JA 2XM2A 3PPGA 1EWEA 2I7GA 3UU0A 1MQPA 1CGYA 3QKEA 3UPMA 1BQGA 4ZQOA 2OG9A 3CV1A 5ABEA 3CWOX 4RUBA 4ORMA 2E68A 4O13A 3G1AA 3CMGA 4OUIA 2NW0A 5B7ZA 4JZ5A 5XINA 5AHFA 3IV3A 3PZQA 2OSYA 3G2GA 1P5BA 2ACRA 3KBJA 4XUGA 1KLYA 2NX3A 3FHAA 3ARWA 1NOUA 3H2AA 1QT1A 2B4GA 3Q58A 3U5YA 3Q2DA 3P8JA 5AC6A 2D2GA 1XYZA 1GRTA 2FQIA 1W9XA 2V5CA 3MJMA 3GNDA 5M17A 3H7VA 4G56A 3PZNA 3TYEA 1S2VA 3PBMA 1FFQA 4H4IA 2ANUA 4N0RA 1V0KA 2AAAA 2BY2A 2CWXA 2VZTA 3LD5A 4HHMA 4ACZA 3MW7A 4NNCA 4PTNA 3PSWA 2PGRA 3WLTA 1MFVA 2G3JA 1TZZA 4HZMA 2VRKA 1L8NA 1XPYA 2WXDM 1V3LA 3CJPA 4WCJA 1GUVA 2BGQA 2ATMA 4O53A 3SR6B 4BWLA 4NVTA 1VPQA 1XHGA 1EQPA 4XKYB 2PTZA 3HJEA 3LS9A 4LRSA 4Q8WA 4BI6A 2R1KA 3C52A 3ZT7A 4Q4KA 3ALGA 2BX7A 3K46A 4C5YA 3MPGA 1TPH1 2GDVA 5BXPA 2G37A 2ZRYA 2HMCA 2VO5A 5BWFA 3ZLHA 4XZHA 3T9PA 3MSGA 3L0GA 1ITCA 4BEQA 2ISVA 4DHGA 1GZGA 1OGBA 1RA5A 3DK9A 4NAEA 2WVUA 4R7JA 2BOEX 3KW3A 3BMVA 2IUZA 3RU8X 4CQDA 3CGDA 1BRLB 4KIRA 1J4EA 1UJQA 3M4HA 2R1LA 2I9EA 3IRSA 4JTCA 2XSBA 2CETA 2RGLA 4ZO9A 4JDYA 3TC7A 3GC5A 4PCSA 1PHWA 4XQ6A 1MZHA 5AC4A 2PGFA 1OYCA 4D8LA 1PCWA 2PB1A 4XKMA 4W89A 1YYAA 1EO5A 2JQXA 4Z08A 1JQXA 3LENA 1H62A 2YL5A 4MY8A 3LXCA 4FS9A 2V0TA 3BARA 4LH8A 4YHGA 2A79A 2VR2A 2CHNA 5DMNA 1WPCA 4ZOAA 1J6OA 2GJXB 2EQ8A 2OCZA 1VFFA 1XICA 5E0KA 1XINA 3NZ1A 1XG4A 3NNTA 1TQXA 4AG0A 1FWIC 2YZ5A 2PDUA 4DB7A 5EU9A 2EPKX 2WBKA 2X8RA 1KRMA 3N19B 4LS0A 3PF3A 2OEKA 3G1RA 1E0XA 2DEPA 4WIWA 4XZWA 3H24A 2PF0A 2BVTA 4GVIA 4EIVA 5AYZA 2A3BA 4PB5A 1E6RA 3NQ6A 4D1IA 3LCLA 2IPGA 4QG6A 1JFHA 1CWYA 2QUVA 4S23A 2VOTA 3AIBA 4N9BA 4IQJA 5FESA 1D3GA 4B2DA 1KBLA 1MVYA 4S3DA 5I79A 3V35A 1WQ5A 1L6GA 2BG5A 1O12A 1GTHA 2QYGA 1G4EA 5DLCA 1VEMA 3FJNA 3VUPA 2TPSA 5KZMA 5EMYA 3AZTA 1YNPA 3MKVA 3WL0A 3RLHA 1T40A 1QOQA 3W83A 4I9MA 2QV5A 4UNKA 3A4WA 5G2IA 1H2JA 1PS9A 4GXWA 3F4VA 2HE5A 4CN6A 3QZAA 3CHFA 1VRDA 5A3HA 1C8XA 2HTMA 3STFA 3SM0A 3LQLA 2GWNA 1FIQB 5JCMA 2WM0A 2XTKA 1ZTVA 1SGJA 4PODA 3DKLA 2VC9A 3AWNA 4IL2A 5A1AA 4N7QA 3TLQA 5D9PA 4JFUA 1D3CA 3KOYA 2WPCA 2QMJA 1CB2A 1E0TA 1W54A 3M64A 3NO1A 3PN8A 2BHUA 3WLJA 1WOAA 3RILA 2DT3A 4IISA 3IS4A 1AH3A 1OYBA 2WNZA 4AYSA 2H8XA 3BO9A 4GH1A 2QJJA 3FCPA 2ZIDA 3QM3A 2F38A 2Y61A 3APTA 2VZSA 3WNOA 3NQEA 3BICA 4UTKA 1UD8A 1CXHA 2Y24A 4MHBA 3CYJA 3ZVHB 4BWLC 3HIJA 5FAGA 3N73A 2EGZA 2GOKA 3W26A 1YQZA 3MBFA 5T9BG 2GYIA 3WUEA 5G1MA 2VRJA 3F4DA 3H6OA 3HPXA 1A0CA 2EQDA 2Y88A 4QIUA 4E2OA 3C3NA 2VELA 2D0FA 3KWXA 1TZ9A 4PMVA 3RAOA 5A8GA 1NDYA 4YLWA 5M03A 3GYEA 3CT2A 3WK0A 3CLMA 2J7EA 1O68A 1M7XA 1PWMA 4M1BA 3FAWA 2WC4A 2ZZCA 3ITVA 1YTKA 3I65A 4LY8A 4J3UA 2OSWA 2XFWA 1WZLA 4D6DA 1ZALA 2A6LA 3Q65A 1VFUA 5HNTA 2WSKA 3GZAA 1I2NA 1MXDA 2HEJA 1O5XA 4O18A 4U3CA 3ZJ6A 3HG5A 5AHMA 4EE9A 4ICMA 1I2OA 4H9TA 3XISA 3DDMA 4GZJA 3ZWSA 3IGHX 4B4FA 5IHSA 2YXGA 4B5TA 2NQ9A 1W2PA 1A0EA 1HO1A 1IQ8A 4JTDA 4JQ3A 3LSCA 1K7EA 2I5IA 3RG6A 3W02A 4ERAA 5LHEA 1XM3A 2YZRA 5LIUX 5CSRA 3W6LA 4WJ8A 3U48A 2R1NA 4HSOA 1HTIA 3ZJ7A 4CQ9A 2J77A 2ZQ0A 1H0IA 5ER0A 2ZRZA 1JZ2A 4CD5A 4PTDA 3QY7A 4RPQA 5E1QA 3PUDA 2W63A 2HISA 5F2IA 1WV2A 4IG2B 2WPEA 3CZEA 3MSRA 1A5LC 1Q66A 3VKKA 5PTDA 3MA8A 5DX7A 5F1VA 3TTQA 1RALA 3I3BA 4YWSA 2WQPA 3WMBA 1CGWA 4PBEA 4QS5A 4ZQNA 1WKFA 3U5UA 3O9NA 1XBVA 5TQLA 4Z2HA 3SUTA 3B04A 3G18A 2FHFA 3QV6A 5ABFA 4CNTA 5JIPA 3AHYA 3ITXA 2BY3A 2WKLA 4LEFA 5F2MA 4MVAA 3P5YA 3DC0A 3PZGA 3PTMA 3LV6A 4B2DD 1BZLA 1IF2A 1FEBA 5DBTA 4JTIA 4QS6A 4WEVX 3V1HA 1ZBCA 3FVMA 4FALA 4HTBA 3NVVB 1CLVA 5JCNA 1K8XA 3L2IA 3UR8A 2QAPA 1JAKA 5M3WA 2O56A 4CEXC 4J3WA 2F7FA 3ITTA 3NQ2A 2VJXA 1UR9A 2RJHA 4NZCA 3G8EA 1IEIA 3RM4A 1S3TC 3L4TA 3H7UA 4C6MA 1MDLA 2Z1BA 1K4HA 2V82A 1W32A 1FWTA 3HV9A 3L2MA 2FJUB 2EQ6A 1VHCA 8CGTA 3GH5A 2CLLA 5LNRA 5G2WA 1XLGA 4GG9A 1B9BA 4Q7IA 1ZJBA 2PWVA 3GLCA 2P3ZA 2HK0A 2A4AA 3N4AA 1IEXA 4MYXA 4Z2LA 1PCKA 3UR2A 1X2HA 1XIBA 3EDJA 4XVDA 3BLDA 3E5BA 3HQOA 1W9UA 5I5RA 1VJSA 2YJQA 1X6UA 3AAMA 5KZDA 3VAVA 2X7VA 1E4LA 4RPPA 1QPQA 1JYXA 3KL3A 3T0TA 1GRFA 3O06A 1F5ZA 4AEOA 2AAMA 1G67A 1ZPTA 1UP2A 3N6QA 3V18A 4EM4A 4P7QA 3BGJA 2WVTA 1E1CB 1RCOB 4O52A 1KCLA 2AMXA 2OMAA 1R3VA 3JU2A 3WFAA 3UA4A 3FY1A 2Q3OA 1XSIA 3Q45A 4IL0A 2R14A 3HMCA 5I2UA 2WZEA 2E1WA 2C1GA 1UASA 1HF6A 5GVJA 5LGXA 3QH2A 3M5ZA 3S8HA 1DE5A 1JRBA 3OVGA 1YDVA 1J0JA 1JGIA 3SUUA 3UJRA 5U4NA 4UOQA 3RO8A 3WD1A 3ABQA 4RNFA 1OGGA 1OC7A 2DZPA 5BRBA 1XIFA 3MMWA 1RV8A 3F5KA 3AYSA 1SJCA 3CAKA 1O5RA 3AMDA 5CH9A 4DF1A 4ZVJA 3M7SA 1VBHA 2CZFA 4P7NA 1IIHA 3PZ9A 1JEHA 2YBUA 4Q6XA 2R1PA 3HJZA 3A64A 4HNTA 4GVGA 4HYWA 1R7OA 2O7SA 3ZT6A 5EY5A 2ZRVA 4KGJA 4G5DA 2DVXA 4NZ5A 3D47A 4XO7A 3W70A 3NPXA 4V28A 3VFCA 1RAKA 4O19A 1DQXA 1GW1A 2X1SA 3NXLA 5AC7A 2E77A 3L5OA 4BF7A 4KEMA 4AIUA 1EO7A 1VFTA 5D05A 1GYMA 2O9RA 1HP5A 1EHNA 4PTWA 1GRAA 1AOGA 3QTGA 3TYDA 3TYAA 3NVWB 4F9JA 4A8RA 3A4XA 2G5WA 3FNDA 2XU2A 1VCFA 4YIWA 1Q8AA 4IPJA 3AN1A 4POCA 1HZYA 3EKGA 3FJ6A 4K6AA 3LCXA 1UWSA 3F1QA 3LMYA 2J3NA 3ZWTA 3OHMB 3M41A 1U22A 3TN5A 2GSJA 4GCAA 1NWRA 2X16A 2VUNA 3GTNA 5F2LA 1V59A 1LLZA 3VTRA 2X0SA 4JIIX 3DGHA 3GC2A 1GJUA 1JR1A 3WLRA 1I0DA 2VD9A 2ABAA 1Z8AA 2H90A 1PDYA 1F9CA 3NEVA 1EWDA 3AS3A 3WBXA 2HRWA 1U5HA 2KX9A 3LBOA 1G7UA 2PDNA 3ZXWA 3WK1A 4RCXA 4FF7A 4GC3A 1K7XA 4I6KA 5MF5A 1Q85A 3HG4A 3GH7A 1W3IA 4FLSA 4NZ4A 3W76A 3LCIA 4RZ5A 1N60C 2Y7FA 4MGGA 2IPJA 3R10A 4C60A 3G1FA 1YMYA 1POKA 4GO9A 5BMWA 4B16A 1XLKA 4CQAA 4IUOA 3TMLA 1RBAA 1VQZA 1M3UA 3MUCA 3S5YA 4H4VA 1M7PA 3OGRA 3LSBA 3LTSA 1XIIA 4O0KA 2C3ZA 4LRTA 1FHUA 2QJIA 4A3RA 4BKNA 4U5IA 3W87A 4X60A 2PU0A 3UG3A 2ZTJA 5CLWA 3BH4A 4GXMA 3PNZA 1E5JA 1GG0A 2Q8ZA 1RA0A 5FEZA 3TQPA 3OIXA 2XN1A 4O28A 3RGTA 3IEBA 3TROA 4D9PA 1TVNA 1G9HA 4JIQA 3ZSSA 1ML1A 4DBWA 2XUCA 1UR4A 3TYUA 1YXYA 4H9VA 4QDMA 5JH1A 4BA0A 3P93A 2GGJA 3BAXA 3A3HA 2WZTA 2YFNA 2HQAA 3PPFA 1PTGA 3C6CA 4E2VA 3SQSA 3N2CA 2CLPA 1T8QA 3U2ZA 1VQTA 2J75A 4CN4A 3ID7A 1EEPA 3RJYA 4DUVA 1V7YA 1GJPA 1GKPA 4GNVA 1DXEA 3OOQA 4LF2A 1JROA 3CTLA 3B9NA 2G97A 4QSFA 3H23A 3LRMA 1RP9A 3R12A 1RD5A 1BD0A 4C6NA 1QBBA 4OV4A 4M6QA 1ISZA 1WUFA 3S2NA 1M7JA 3THDA 3OJGA 4Q4QA 3UXAA 4Z0JA 4HNVA 3LHTA 2Q09A 1WBJA 2WC7A 4FNTA 2BBFA 1B1YA 3T4CA 3QVQA 1TWWA 1CCWB 1QTWA 3TJXA 3W6YA 2J74A 4Y9MA 2E3ZA 1MW0A 3N4FA 4PUEA 7TIMA 5A2BA 3PM6A 2PWGA 1A5UA 1OINA 2BDQA 3O07A 1U83A 4JIRA 4F9DA 2CZDA 2Z00A 1UR3M 4PMNA 4C1LA 4JHZA 1MUMA 1ECEA 3CL8A 3PBVA 4J2MA 1RY8A 4JTUA 3F03K 4F2BA 3GXNA 4HSNA 4O1BA 3UVAA 2HV5A 1ZP3A 1IGSA 1QFEA 5LIWX 1QASA 2V5BA 3S5ZA 1TV4A 2W61A 4NJGA 2A7PA 1WXJA 3G1XA 2Z1WA 4WY0A 4JFSA 1GVOA 1O5KA 2VEIA 1GREA 3AU6A 4GINA 4KCVA 5EMLA 7PTDA 3KFTA 4GI8A 3IK4A 5I23A 2FZBA 3S9ZA 3VKJA 1LVLA 1U33A 4EQWA 3GR4A 2GRTA 3ATZA 3WQPA 1OWQA 1FDZA 1BEUA 4PB4A 4O1FA 4QJ4B 3VIFA 1RH9A 2P53A 3LCFA 1ZRQA 3H4WA 1ALDA 7REQB 4OJYA 3ZIZA 3N34A 1G69A 5CC7A 2ZC1A 3NQ7A 4GOAA 3EX1A 4WKHA 5AHLA 1JFXA 3QSRA 3JVAA 1ONXA 4AFYA 1HP4A 1VIZA 2OTDA 1NM9A 3UPWA 2Q02A 1GQKA 3UWEA 2QDEA 1XYCA 1Z44A 5BYWA 3BW4A 1KGWA 5FS8A 2J9YA 4XTIA 1BXNA 1B90A 1TPB1 3GD3A 1OY0A 3OGSA 2X09A 5F1UA 3MTWA 3KRZA 3VCCA 7TAAA 5T9CE 5CPMA 1B0IA 1CECA 5DMLA 3OZOA 4I5RA 1FDJA 2Y2WA 5H91A 4MTVA 1TMLA 4ZSUA 4N02A 4QE5A 5GNXA 2Y5EA 1GONA 4O4VA 3FJ4A 1N62C 1QW8A 2CHRA 3PZTA 3H2OA 4F0RA 3BXWA 2PRHA 3WJXA 1VBUA 1XCFA 1Q13A 2OOGA 3WQ4A 3MI6A 2PAJA 1NWUA 5LXEA 2INEA 1ZZMA 4DNMA 4HP5A 3WDPP 3QOKA 4UMBA 1IWPA 1PIFA 4GIYA 1G4PA 3N04A 2A85A 4IIDA 1TR1A 3UY8A 4QGCA 4JTFA 4YS1A 5I00A 2PA6A 2PLKA 1RJPA 1BGAA 2V3EA 1VPXA 2DH2A 5A6SA 4GIAA 1XH1A 2NXHA 4CNPA 3TA9A 3NQ8A 1V6VA 3WSUA 3MDWA 3K4DA 1CT5A 4NUWA 2ZUUA 4WF7A 2Y7EA 4X2RA 2VGIA 1TRDA 3URNA 5A8NA 3QZEA 4IIBA 1VR6A 1WUEA 4IIFA 4C7GA 4BV6A 4Z1BA 4FLOA 4GYKA 3AMZA 1CBGA 4M7SA 3T1GA 3FAXA 4HN8A 2WSYA 3TN6A 3KRSA 6ALDA 3DGBA 3ARUA 4HZ6A 4BI5A 1KXHA 2ZZ3A 4IGNA 3TYCA 4OBTA 1V08A 4ACZB 3RUBL 3VYLA 5A5WA 3EX2A 1GPWA 5C9ZA 5DY2A 3T0CA 4D2JA 3EAOA 3SECA 2IKJA 4L80A 1QU4A 2GGIA 3QZ6A 1G7VA 3GDLA 4CEUC 3F2DA 4Y2WA 5A6MA 3UZXA 2ISSA 1DJQA 4GY7A 2UWFA 5K3VA 4OIFA 1HKWA 3F2CA 4UZUA 2J8GA 1QDSA 4OE7A 2Z1VA 5DRCA 1R86A 4BS0A 4IP4A 1E4NA 2DZUA 3LTPA 5EB8A 1HVQA 3KTXA 3QEZA 4O17A 1RBOB 2VDGA 1CEOA 1JEZA 3NR0A 1W1ZA 2V63A 2R8WA 3F2BA 2G4JA 1BG4A 4QFUA 2D20A 4RR4A 2IPFA 4MM1A 2AKMA 4ZTXA 2GVJA 3TDFA 1CIUA 4FR6A 2NV2A 4NAEB 3R6IA 3EKZA 4Q8OA 2QF7A 2QW5A 3LK6A 3UXKA 2PGWA 3FGCA 4B9ZA 1Q6CA 2OVLA 1F74A 3EMCA 2Y8VA 4Q4SA 2DFAA 1LLWA 5HWNA 1ZFJA 3RM8A 4US5A 1X1NA 3A7RA 1BPLB 2Y63A 1J5TA 2RDXA 3WF0A 3CMFA 4YTQA 1PX3A 1S5NA 3GSMA 4EAYA 3SN4A 2AL2B 2WOIA 4B5XA 3VM5A 3VOCA 2WC3A 5XIAA 3BCDA 3RLVA 4Q4OA 1LG1A 2JKAA 4MMWA 2QCHA 2JGYA 5F4XA 2X05A 4HZ7A 4UNIA 8TIMA 3JS3A 1KC7A 4ZGYA 3KTCA 3W7HA 3O6DA 3EWYA 3CGBA 3RJXA 4Z2IA 3WQDA 5HMDA 1O4UA 1QNVA 5LYRA 1GT8A 3M07A 1SM9A 1O60A 1SZFA 4S2BA 4GH3A 3V75A 4KWUA 4MPKA 3N2MA 3TEVA 1C7SA 3CIVA 1U5JA 3BDKA 3NZQA 3GHUA 4U3AA 1LBLA 4LGXA 1QATA 2PF8A 2XYLA 1EJRC 3UCDA 3MMDA 3RNMA 2Z29A 3VZZA 1S39A 4IMAA 3M1ZA 4GUIA 4ES4A 2TAAA 5B80A 3IAPA 2DT0A 4GHRA 4C7DA 4MFDA 1W9VA 3SDOA 3OZPA 5GRTA 5IFTA 4H9YA 3G1HA 1IXOA 1J2BA 2BGSA 3V5CA 3IJ8A 2YDQA 2VKZG 2BY1A 2Y1HA 4NX5A 1IR2A 2FGBA 3GBDA 3KAOA 3TSBA 3TW9A 3QF0A 4V2XA 1ITUA 1S5WA 3AICA 4U5KA 1QO2A 5AHNA 3MV01 1QNOA 1US3A 5E5CA 4FX6M 3H4GA 5FEXA 1ZBWA 3LBMA 4LQ1A 1AUSL 3CUZA 4EPKA 1OADA 3R2GA 4X9YA 4HPHA 4S3FA 4QISA 4KFOA 2VCAA 3QHMA 1NFGA 1GVSA 1KW1A 2PSNA 1IZKA 1OFAA 3CGTA 4URIA 4PCTA 1GVYA 3KLJA 4H8HA 5IFPA 2D22A 2CLIA 1GK8A 2GPTA 4U28A 1ZXIC 2DSKA 3B06A 3WEOA 4DAIA 3A47A 1XX1A 5BZAA 2QGHA 5C8BB 1UKTA 2OLAA 1Y5VA 3A4AA 4LUYA 3B9JB 1R87A 3G24A 2WPGA 4MSSA 2OYKA 4PMZA 4PBGA 1LT8A 4WSHA 5CZTA 3UR7A 2V5KA 3BW2A 3NM1A 4GNJA 4DIAA 3W84A 3GU9A 1AL8A 2E6AA 1YKWA 4QX4A 2ZZ7A 3AMKA 3CT7A 1FWJC 3P60A 3O05A 5FIPA 3NQAA 4XIMA 4P7RA 2WSPA 2QDGA 2B7PA 5C9RA 2VXNA 1B3XA 2CCRA 3D5HA 3ONBA 3PBGA 3WF3A 3DK4A 1FFUC 2WK2A 1A4LA 2ZA3A 4OBSA 1EPXA 1N5WC 3KCLA 3I3DA 2OO6A 1UC5A 3NOEA 3ZR4A 4KW2A 2GJNA 1CXFA 3DFYA 3S2LA 1OC6A 6REQA 3NZGA 2Q01A 2FHCA 1X2GA 4ZB0A 3BQ5A 3DGZA 4DM1A 2GOUA 4XO6A 2FB2A 2E0PA 4IGMA 4ONVA 3N2OA 2F6XA 3AOFA 4JQ1A 3UESA 3LB8A 3URHA 1Y65A 2JBMA 3ZR5A 4J27A 4KERA 4O11A 1YX1A 1H50A 5JCIA 2WB5A 4IICA 2HZGA 5JH2A 1PV8A 4B5WA 1NJJA 3HGOA 3W24A 4L6HA 3C5QA 1XLCA 3HURA 4L65A 3E49A 4A3UA 4AYGA 1E5NA 3R0KA 1J8VA 3CQJA 2PDYA 1YXDA 4MUPA 2WWDA 3GD4A 3FKRA 1IWBA 5AC5A 1MQQA 3LX9A 4LJ3A 5FF7A 2CNCA 3C56A 5K9DA 4ZO7A 1RK6A 3FEMA 5FJPA 3EEZA 1BYDA 4CCEA 1RQHA 1QVBA 1X1ZA 4DYKA 4FHAA 3EGJA 4MWAA 1J96A 1XC4A 3WQFA 3UWYA 3UWUA 2D2HA 2ZZ1A 1U1JA 1M65A 4KPRA 1LCOA 4CLMA 5CPQA 4X9SA 1E9LA 1O6IA 1EOMA 4GK8A 3UCQA 2PDPA 5AYBA 3TZFA 1H61A 2Q8XA 3VIKA 3JZEA 3G1YA 3UWZA 3C8FA 3AS1A 4UZSA 3D3AA 5G5GB 1PBGA 4DF0A 2BY0A 3U8GA 2PCEA 4QG8A 2DZVA 5HAOA 1BVWA 4OECA 2P0OA 1ITQA 2ZXAA 5D9NA 4E0CA 1XPGA 3ABOA 4R5EA 4UTHA 3YPIA 1R46A 5IDIA 3MZNA 4GC4A 4XWUA 3E2SA 3TKFA 1IIGA 1FXQA 1OJTA 2QZRA 2OJPA 3CUGA 5TF0A 1Q6OA 4KQNA 4UQEA 1YHTA 1BF6A 1GWJA 4CNNA 3F4WA 3IACA 4JX4A 3WLKX 4N9EA 2AL1A 1C90A 3EDDA 5FMHA 1L9WA 2DV0A 3WD3A 2GQ8A 3K2GA 1TPFA 5LNWA 4JOMA 1A53A 3RX4A 3WD4A 1H7OA 2IQTA 1HGWA 2PEVA 1UROA 3URQA 4XD5A 3MMUA 3GTIA 2OYMA 4BJHA 3GYCA 2ZBTA 3NQFA 2FFIA 3UA3A 3TIMA 3GG0A 3U2CA 1DWIM 4GZ7A 3NSNA 4KFNA 3ZT5A 1V0LA 1Z32X 3WENA 4E4UA 1PWLA 3REQB 4MB3A 3ZOAA 3NVYB 2CWNA 3PFMA 1YTEA 1TE1A 3BJTA 1IGWA 4HTYA 3BJFA 2YW4A 4JNZA 1RR2A 4AZ7A 4DO6A 4N9CA 2YPIA 2RDTA 4ZE4A 2O7QA 1UR8A 4J3XA 1RD6A 3T0DA 3WLIA 1DVJA 7A3HA 1DORA 3L2LA 1W3LA 5AHIA 1PO9A 4ASTA 1PKLA 1XL9A 2J62A 1V77A 2VR4A 2ZA2A 3BL3A 4LTSA 4KFPA 3CMJA 5K9XA 9RUBA 3LRKA 2VZVA 2JKPA 3W7LA 3GTHA 3ICJA 2DQWA 3MKCA 3ARTA 4AWEA 4H4XA 4Z1DA 4Y96A 4H4ZA 1SZGA 1W1YA 4JTKA 4LY4A 3DYOA 1UR2A 3DYMA 1YDYA 2ZX9A 1KM2A 4Y9NA 4O8RA 4WVXA 1WOBA 4ZB2A 4TUFA 1KM1A 1XH0A 1A5CA 2C3DA 1SZNA 3BC9A 3WH6A 4TVYA 1XKJA 5KSWA 3FA5A 1UD6A 3NDYA 4J3VA 5JCLA 3WNLA 2BLEA 2YBVA 3R07C 1SJBA 5C7HA 4AD3A 1FWGC 3QMRA 3O0KA 4G2DA 3VDBA 1E51A 3OU8A 1OFPA 5JVLA 3AHTA 4HU4A 2EG8A 3LLDA 5SWUA 1KV8A 2J78A 4KRUA 4KMQA 2V2CA 3OHIA 3OGVA 2A1YA 3TYZA 2NV1A 3L5AA 2VL4A 4TMBA 4MWAD 3UR5A 3MYPA 1GTEA 3LHYA 2ZKMX 2C15A 4UUIA 3XIMA 1SB3B 5HNUA 3ZVIA 1J0KA 3G6MA 3SGGA 2ADAA 1BSLA 1QW7A 2W92A 1XLDA 3AXHA 4QITA 3I7QA 3H53A 1DV7A 1Q63A 3K8KA 2ZICA 3C3UA 4LV9A 2E67A 2ACQA 2ZZBA 3C2YA 4IJRA 4IUGA 2RH9A 2C79A 1QCWA 1ICPA 3QR3A 4PUKA 1HFBA 3BLFA 3PBWA 4F2TA 4EM3A 2DJLA 4QHRA 2VQTA 1A47A 3BOFA 3CNYA 4MADA 3VE9A 4WJEA 3S1WA 2F84A 2FMOA 1CXLA 2PP1A 2QKFA 4FX9A 5LIYX 1VIWA 4M6PA 1ZMDA 3UZYA 3QYSA 2QCCA 4GI4A 3C8NA 4AZ5A 2V69A 4BK9A 1SR0A 4DWSD 1EQCA 5CSYA 2X30A 4QM1A 3H2CA 2X2GA 5DT5A 2OWXA 2FDSA 1R2TA 1Q7QA 3AQUA 3NZPA 4TX6A 2V6OA 4UFMA 8RUCA 1AA1B 3H2MA 2VQUA 4MDPA 4JEJA 3QPEA 1ZCOA 2EKGA 1UCWA 2RKXA 3MHFA 4C6OA 4LX4A 3QR0A 4PMQA 3OIHA 3VILA 4O14A 4BCEA 1VBJA 2BMBA 3VD5A 2J8TA 2OB3A 4UBPC 3NOYA 3WD0A 5T26A 1XLEA 3PULA 1RK5A 1PDZA 1EH9A 3DI1A 1OABA 1KR1A 1TPEA 1WP6A 4LAKA 1MWOA 2YYUA 2XFFA 1CNVA 4GGHA 2NZLA 4M81A 1DJXA 4DO5A 4QJ1A 2PDHA 4K8EA 4MJMA 4Z1YA 1FECA 1SFLA 3WNMA 5EMJA 5CAHA 3HG2A 5KINA 5HNRA 1PTDA 1XH2A 2E6FA 5A6KA 1JI1A 1AQMA 4AC1X 3AMGA 1F4HA 1MZRA 2E6DA 3GXDA 4XZBA 3NDZA 4ADSA 4AWUA 4OVXA 2NXIA 2ZVIA 5DQPA 2DSZA 4K68A 1PJ9A 5JXQA 2HSAA 1QHZA 4B92A 1DJZA 1NQ6A 3NG3A 3FW6A 2OZTA 4EACA 1VFLA 4YVPA 3L4ZA 3LHWA 1JIBA 1UP3A 1S1RA 2XDFA 4V1XA 2JIWA 1PTAA 2R6OA 1REQA 1R3QA 2NUYA 1EC7A 1JCLA 2UV8G 1VB9A 2Z26A 3WJSA 3P14A 2WCAA 1T6MA 4C6IA 4B15A 3B4YA 4IHCA 5KZ6A 4LUSB 4J3TA 4KEZA 3NL5A 3S1UA 3T0BA 4M19A 3CV7A 3HPSA 1P6WA 4NJJA 2ZUNA 4X22A 2HPIA 1GW9A 3M9YA 1NFBA 2A3AA 3M0MA 3H2NA 5D8ZA 4W8LA 3DYPA 4BQ2A 4RDYA 3GZ3A 4Y7EA 1GQNA 3RDKA 2BHZA 2REQA 2D2OA 3LXBA 4FX8A 1F76A 1WE5A 1QI3A 4QEHA 3BJSA 1E72M 3ZYZA 3SCVA 3M5YA 5E0FA 3O6AA 1G1YA 1MQRA 3R8HA 4JBRA 4N42A 2EJAA 5BXSA 2XISA 1GKQA 4AXNA 4WY0B 3S5OA 1S2TA 3FV9A 5CC3A 3WF4A 4UB9A 1OBAA 2DORA 3TXVA 5C6MA 4IPLA 1P43A 3SSZA 4IQLA 1LL6A 1GOMA 3UG5A 3MSYA 1SO6A 3DFHA 4DWDA 4EQSA 5HNNA 3ZM8A 4HYVA 1F61A 3EPMA 3GRTA 1OEPA 2GSHA 3WH8A 2OPJA 4ZQCA 3WBWA 5M5DA 3LPGA 4KESA 1ZJHA 5CJ5A 3EWUA 4UR7A 1QPKA 3W38A 1GEHA 1E70M 1QWGA 5G5HB 1R30A 1BWKA 4KWVA 3VKDA 5A6BA 1JDEA 1Q6QA 3B9DA 4HNUA 3S1XA 1XLAA 3W88A 5CKSA 4PMRA 4QROA 2W0HA 3CB3A 2FMNA 2QVNA 3TJLA 3CC1A 4HGXA 1DJNA 4JGDA 2D2JA 1ZY9A 4FXSA 7CGTA 5D04C 2WZMA 5HINA 1S38A 1WX0A 1LUCA 3EOOA 1JDCA 5AB3A 4JNYA 4MZ1A 2YL8A 4E3TA 5K4ZA 3E6EA 3NO5A 4ZR8A 3MB9A 2ZWYA 1EUAA 1Q7MA 2E4TA 1ZQ5A 3LY0A 3E9AA 2EG7A 2PDKA 5AHEA 3MHGA 5FA5A 5EFFA 1CPUA 2P3EA 1G01A 2NSXA 3BAWA 5DCEA 3LCGA 1QR7A 4G1KA 2XN0A 3W1AA 4JN6A 2PD9A 1W1A1 5A6LA 1F6KA 2J7HA 2OLHA 5I78A 2X0YA 4NZ3A 3WQGA 1J6PA 3H54A 1OX4A 4ZCWA 1XI3A 4DVOA 4IZGA 3SN0A 3S9IA 1K9FA 4LXFA 3QYQA 1KTCA 1HJSA 3WIJA 4L4LA 4Y90A 1E9ZB 1CXEA 3OO2A 4D1JA 4AX7A 2IXUA 4YMZA 4QQ3A 3V4BA 3NVTA 3IIVA 5EFDA 5FJJA 1TV2A 5LIXX 2DZBA 4J5NA 5I6SA 4O15A 2PDLA 1U30A 1BYCA 2NVDA 1Q4NX 2KAUC 3BLIA 2CZVA 1DXIA 1P0BA 3DAQA 4OQVA 1S2UA 3F4NA 4OZOA 4AWTA 1GETA 1AD1A 4FNQA 4UTTC 2ZX8A 3H4XA 1R8LA 4YTRA 3RLGA 4DZHA 3XINA 1S5VA 3HW2A 3BCFA 2VD8A 2WMIA 3N29A 5IHRA 5D09A 2AQWA 4H2HA 1B5TA 3AC0A 3ANVA 3GRIA 1E6QM 1H51A 4HA4A 4ROPA 3OBAA 1LG2A 2NLIA 1WYIA 3CO4A 3TJIA 4NILA 2X42A 4C90A 4HNNA 4AVOA 5JBFA 1RBLA 1M6JA 2EAWA 4FSAA 2F6KA 3HPAA 4MNLA 1D7YA 3PZOA 3EANA 3GFZA 4FNPA 2NX9A 4IF2A 1S5MA 3N2TA 3N9KA 1W9DM 5C9WA 3PWAA 4KS0A 4U10A 1TJ0A 2V30A 1KFCA 1H60A 5CQ1A 3FGCB 1HO4A 4Q8MA 1UA3A 3E0FA 5U25A 2ZUVA 4HPGA 4H6QA 5ABHA 4PTMA 1ZGDA 2XSAA 3A3WA 3VOGA 2XG9A 1H41A 3VGHA 2PWUA 4L4MA 1L6WA 3LGGA 4FXJA 1MI3A 4TX9A 5A8OA 3T2OA 1QI4A 4JTGA 4P7OA 1OG6A 1H7WA 5GQBA 4Z1CA 2NVAA 1FWFC 3TA6A 4R27A 4G1NA 3I6EA 3RK8A 2E6YA 1S2AA 4GIRA 3ARYA 4C1NB 2XIJA 1PYFA 4I9JA 3EXRA 3SZ8A 1XANA 4GX8A 5A6BD 2VNCA 4L9YA 4HA0A 1VF8A 2R94A 1E55A 4MPQA 3GG8A 1KBKA 3O16A 1N8FA 2X40A 1IZCA 5BXRA 4ZO6A 1UP0A 1FCUA 4A3QA 4XBJA 2YVJA 1L8PA 4F0MA 3I4KA 2O92A 2J47A 5CEWA 1WZMA 1NSJA 3BGGA 1DIOA 3MYOA 2WKJA 4LUJA 4RXGA 1SW0A 4QAIA 4JDBA 4ZQRA 3W2MA 1EB3A 4BQ5A 3TSDA 1OCQA 3H2FA 2E9MA 4MKVA 3BMXA 3EPOA 1DWFM 2CYGA 2YCJA 3QC0A 1J11A 6CGTA 2RAGA 3GUGA 3THAA 5HMEA 3IJQA 3NS1B 2IKGA 5K2ZA 1MXGA 3N3TA 1UWQA 3C0SA 2WNNA 3CZGA 3LLXA 2J24A 3UZJA 3KL0A 5IM51 4TV6A 2CFFA 3MSDA 1W5NA 3PY2A 2D3LA 4X61A 1AMYA 3P82A 3AUOA 2DIEA 3G1DA 3IGXA 1EZWA 3GU1A 3HG3A 3UXLA 4AVFA 2DDXA 2ZUMA 3O8AA 2C8NA 1NWSA 1D7FA 3BLOA 4JYEA 4ALDA 4D6EA 3MVTA 3QLDA 4PUUA 1YXCA 1T0OA 4IPPA 4W93A 1VEPA 4P8WA 1G4TA 4HHHA 3O15A 5IBXA 3W1XA 2E8ZA 1YTDA 3EBVA 3L23A 4X3ZA 4XZMX 2OT0A 4H4UA 2C0HA 5DXXA 2BS9A 2V2HA 3C2OA 5A6TC 1D8CA 5LGZA 4OT7A 5ENLA 3BLLA 4O0ZA 2DT2A 1Y0EA 4GYFA 3WNNA 2J27A 2WHJA 1DWGM 1L6FA 4GO8A 4FB7A 4F66A 3W7MA 1TCMA 4GBDA 3OLIA 4LC6A 5FJTA 3NSMA 4JFWA 1YPFA 5KMYA 2PTWA 5GJPA 4Y9PA 1XF0A 2V67A 4JQ4A 3W3OA 5EKYA 2POZA 4L64A 2XFRA 2JE8A 1G94A 1RHCA 3TFCA 1GHSA 4JQ2A 1V8EA 3BSMA 1H5VA 1LQ0A 4FP1A 2NWSA 3SUVA 1NP2A 1A5SA 3IVUA 5D30A 2H9AA 3A5VA 6REQB 4GJIA 4WK9A 1O1ZA 2YW3A 4P8VA 2V3FA 5KVHA 4ZQMA 3LTYA 1KBIA 3LN3A 4N2YA 3LYEA 1HNYA 2W3SA 2W66A 4K8HA 4WHBA 2GSEA 2HDJA 4U31A 4IJBA 2XFYA 5I3KA 3L7RA 1UYQA 4JTJA 1V93A 4JTAA 3SY5A 4DJFA 3PG6A 4RL3A 1P7TA 3UNTA 3E02A 1QNSA 3BZGA 3VIMA 2ZDRA 4WJXA 2V6AA 4LW7A 5AYYA 2YA1A 3WELA 4IPNB 4PULA 2VFIA 3OB8A 1ZJAA 1H5YA 1I1XA 2ZCGA 1A49A 3FEQA 1ZENA 4F8XA 1L2QA 4WDUA 1QO5A 3AIUA 4DBEA 3UXIA 1IV8A 1VLIA 5FEPA 5U1OA 1P0NA 5C2GA 5AECA 4M6UA 2F2HA 3RLUA 1R5YA 2X99A 4MZYA 1PL9A 5G4WA 3T44A 3W72A 5AC8A 5D2XA 4YWOA 4ADWA 3KS5A 4B4HA 4MWAB 3I6RA 3CAVA 1EJXC 3L67A 1H6VA 2OYLA 3KTSA 1E4IA 4H50A 3PJXA 3MO7A 1UR0A 1JZ6A 4J4KA 4LVAA 1JRCA 4CQCA 3MI2A 3B0PA 4J56A 3DBNA 4KEUA 3DOPA 4NYYA 1XLBA 1V3MA 3BG5A 3ANUA 2CEQA 4LPCA 3UJFA 1P48A 3VIPA 2QCNA 3VDHA 3WDJA 2INFA 2V5DA 3P0XA 3RCMA 3T05A 2VCCA 4GUGA 1JPIA 2BOGX 3M44A 2RGMA 2VRQA 4YTUA 3SCNA 5CJMA 1SFTA 2EPMX 3O1NA 3QPYA 3QFAA 1FWCC 1VYPX 2G3MA 4XVEA 3IGSA 5DMMA 5BOOA 2GDQA 3IGUA 1MW3A 4IXXA 5JCKA 1OFRA 2YIHA 1PX4A 3KVKA 1PKMA 4DWSB 5KVIA 1LF1A 3MUXA 3ITLA 2EPHA 3CZKA 4EPBC 1CI1A 3VXGA 4LEQA 2WAGA 3SUSA 4KRTA 1JD7A 1SUXA 1JF5A 1W5MA 2I17A 2FGZA 4JN8A 3OG3A 5I09A 2E3TA 3P6LA 4N9DA 4AIBA 1HL9A 3QHOA 1TV7A 2BXZA 4DBSA 1KRBC 1QUMA 3DC8A 1JAEA 4D6FA 5K9CA 1TPUA 4Y8EA 4AD4A 5A6JA 1EBGA 3I3EA 4KRZA 4S3BA 1F8WA 1RUSA 4CD6A 4CD4A 2ZX7A 4D6CA 1N2VA 5F4SA 1FH9A 2OX1A 1FWSA 4O54A 3N9SA 1MW2A 2GH5A 4EKJA 2OXNA 3DI0A 3VIJA 1GVFA 5E9AA 2J9XA 3BANA 2EPLX 2GUYA 2OLSA 4NIRA 1ADSA 5G1TA 4FA3A 4CKQA 3FYOA 2AGKA 1V6XA 1FRBA 3P74A 5T91A 3MUAA 3B3DA 3W2JA 5A2CA 3RX2A 4DXVA 5DFAA 2XIOA 1GZ1A 4LALA 5HQMA 3T42A 3GWQA 4Q7BA 1FEAA 4FMVA 3SRKA 3GG7A 4PUWA 3PG9A 2UY5A 3B0VC 3GD6A 4XSLA 3T2PA 4ILSA 3URAA 4K1WA 1VH7A 2CLEA 4M80A 3W7JA 4HMEA 1IHIA 3VOJA 4FXRA 2IQ0A 4X0NA 3RFAA 3G22A 1F07A 4I8YA 1XDLA 1TWIA 5HK4A 1ZCCA 2C7FA 3SCWA 3MZ2A 2ONEA 3QQWA 4AY8A 4OKDA 5I06A 2VDIA 3ZJ8A 1ONRA 4IM4A 2I16A 3KBMA 4NNAA 4B3KA 2PC4A 3AXMA 1OSEA 1GOWA 4DJFC 3V0TA 4OV9A 3ABXA 1GRHA 4B91A 4ZE5A 4AX6A 3N18A 2Z2UA 3VNYA 1KD0A 3QSTA 4IMGA 4JIHA 4AC7C 4M52A 4ML9A 2J88A 4DJFD 3WFZA 5JU6A 1OT1A 2VURA 3QMTA 1K9TA 4PGLA 1DWJM 1R47A 4C6KA 1ISVA 1JGMA 4CGTA 1ISWA 3B8DA 3W7RA 1V97A 2WWCA 3UWWA 3W22A 3ITYA 4E4FA 1OX6A 3GRSA 1AQ0A 1OCBA 3N2BA 4ZSTA 3KZPA 3LRLA 1K03A 2ZFAA 3OC4A 1DKWA 4YWIA 3VKAA 2YQUA 3K8MA 1DEDA 3SY8A 4F79A 1AH4A 4LIIA 3RR4A 2DZWA 3VOFA 3LPFA 3BVJA 3VNKA 3LZ3A 2VR5A 3HFTA 2LLEA 3WLHA 3NQMA 2AGTA 3FXGA 3EWCA 1PVNA 1MEHA 3M0HA 4GGBA 4R33A 5HOSA 1BQCA 2G4FA 3N2XA 4FPSA 1XQKA 3PJWA 2FVMA 1GVRA 5M2FX 2G8ZA 5KETA 2VFEA 1PSCA 1W8GA 1K4GA 4C6JA 3C0JA 1E0VA 1KV5A 2BNJA 5H8MA 3EWXA 1TIWA 4Q8NA 4G7EA 3IVTA 2HVOA 3S2JA 3BSHA 3TN4A 2ZDSA 3PG8A 4JL2A 3LNMA 2PODA 2PBOA 1QNQA 1IEVA 1X6NA 1SQ7A 4EPEC 4GJJA 1W3HA 3GC4A 3VPLA 1L0PA 4IIHA 2W91A 3T8QA 4CVUA 1V6YA 2OEMA 1L6YA 1I9CB 1CB7B 2DVTA 4UTFA 3VNMA 3LB0A 1XLIA 2PTDA 5BW6A 1VZWA 2PDQA 2UY3A 2VGGA 3MKKA 1HKJA 2Z7GA 1B3WA 3FHQA 3GVRA 4AB4A 2HS8A 2VUYA 3ITCA 3WEMA 2A0NA 3RRXA 4PMYA 4KPLA 2DIKA 3BAYA 4AD2A 4HT3A 3UD6A 4WX2A 1VBGA 4XAYA 3S6OA 3PWIA 4YYCA 3FSTA 4US6A 4J7RA 1JI2A 3BE7A 1UWAA 1BXBA 2PDFA 3NL3A 3U4FA 4CD8A 1G0CA 1GCYA 1UUQA 2GZXA 2W3RA 5EBAA 4AZCA 3KCOA 2BC0A 3TAOA 1FBAA 3AXXA 1DIDA 5CZ0A 3VDCA 1ADDA 3AXIA 5BNKA 3P8IA 3DCPA 4F48A 4C6FA 3A4JA 5E09A 2O9TA 2NWRA 4NF7A 2XIQA 1ZBVA 5C7VA 3DESA 3IJIA 1D8WA 3NPWA 3UEQA 4V27A 4I7UA 1Z41A 5RUBA 2V3BA 2IQDA 4E6MA 4JTLA 2JIEA 1EPVA 2F2KA 4L1WA 3BQ6A 2PLJA 4IGSA 2GVGA 2AQVA 4D6JA 1ECQA 2GGGA 1BWVA 3GDMA 3L4VA 3EDEA 1HUVA 3HPZA 1JVNA 1K8ZA 1KN0A 3C2RA 1REQB 3SR7A 2POTA 2WJFA 4PUNA 3FX4A 4IWWA 4O8AA 2PDJA 3INPA 4Y6GA 5ECVA 4IMFA 2F5ZA 1OZMA 1RVKA 5CBJA 4S2CA 5FS7A 1XG3A 2PDGA 3ZQ9A 1J18A 2DVUA 4Q7NA 2EXOA 4J40A 3FYYA 3GIYA 3CZ8A 1PEZA 5EYWA 4LYKA 4AD0A 3UETA 3DECA 1JPHA 4D6HA 1ISXA 1TUXA 3ARXA 4JTHA 3LPOA 2WLYA 1NDAA 3W81A 4H6RA 3POHA 3LCWA 4FLQA 4IGHA 3UFYA 2REQB 2VEPA 1RVGA 2GL5A 5G5IA 3GVGA 3I4EA 2I56A 2PDXA 3W74A 4N4PA 1OVDA 3G1VA 2QQ6A 1T99A 2WPBA 3B8SA 2QCGA 4E2DA 2OO0A 4GE8A 5LSMA 2YLLA 3EWWA 3BV7A 5C9XA 3KEHA 1NHQA 4GI9A 1RZMA 1PUDA 1UBPC 3U2EA 2W67A 1LM1A 3LMZA 4P5UA 1Z69A 3VINA 2DU2A 2XWEA 4LBUA 4H9XA 1GVEA 1TVPA 2O9OA 2WMFA 1WXYA 5AOUA 4C6PA 4JIEA 2OODA 2PE4A 1GHRA 1PKYA 1F3XA 2P50A 1NF7A 3CHVA 3VOHA 1Z6KA 4BEUA 3WQ8A 4C1KA 3O63A 1G4SA 5IOBA 1A3WA 5TIMA 3DH7A 4GABA 4OOZA 2X50A 3IIPA 4UFLA 1R7AA 3I7SA 2NQZA 2J25A 3TW7A 1MRQA 3USBA 3A23A 1AFSA 3H2EA 4H83A 5CCZA 4C91A 1YNYA 1JYVA 5HMSA 3RITA 1ONWA 1T41A 1P6BA 2QCLA 1PIGA 4AY7A 3T8LA 2O4MA 1KM6A 1GYLA 4JDRA 4MLJA 4R3UA 1GZJA 3WBYA 4WXYA 1FWBC 3WQVA 3R8GA 5DANA 1FXPA 1XDMA 4WKAA 1LUCB 1J9YA 1BHGA 3L12A 3LCHA 5M1TA 4NJKA 1MUCA 3DH9A 1JYNA 1K6AA 2R9RA 4Q8PA 4Y9OA 3L8KA 3ONCA 1EBDA 4BURA 1F73A 3R13A 6XIMA 4GVFA 1SFSA 3HO8A 4MY1A 4C5ZA 3K5XA 1OHLA 4JIPA 3WDIA 5REQB 1LRNA 1LP6A 1PYMA 3N13A 3CH0A 4N6FA 1XCWA 3DHDA 5J5RA 2VTFA 1GXFA 5JBEA 3LV5A 1XP3A 5FOOA 1KKRA 4F4RA 3VGEA 1YPXA 1E6NA 4HNOA 2VFGA 3R8RA 1FO4A 2NPXA 1W3TA 2JF6A 5LIKX 4FLRA 3RCYA 4V1YA 3W29A 1AW2A 1BKHA 5EBKA 2TMDA 3JW7A 2PRMA 2VZOA 3U7BA 2Z1XA 5FJUA 1F8IA 4S3CA 5HATA 4LSBA 3KDNA 3WUBA 1GOQA 3GIPA 4EF9A 3SRDA 2QJMA 3P80A 2XJ7A 3DJJA 3EA3A 4EXQA 2VHLA 4PYSA 2GR3A 2WLZA 1E40A 2ODOA 3HGSA 4D8ZA 2VCBA 3II1A 5BU9A 1J79A 1UA7A 1JZ8A 2B7OA 2GVEA 2CPUA 4JTTA 3K1GA 4QCEA 2QJNA 5DEZA 3GVWA 5LA2A 1XR2A 3TE9A 3UJEA 1AJ2A 3S1VA 2WM1A 1OFBA 5AZ0A 4HCHA 1BTMA 1CXIA 2Z1SA 1YEYA 2XZ9A 2J6XA 4MJZA 1TR9A 1HJWA 1TPVA 1XV8A 1OX5A 2WMIB 4DRSA 1EGMA 2BSLA 4J3ZA 3UVIA 2P0IA 4H7ZA 1JDFA 3WJZA 3UERA 1EOKA 2UY4A 2TSYA 5D2WA 3PWGA 4IOTA 4S38A 3TC6A 1OF8A 1A4MA 2BC1A 4A05A 3D6NA 3FSUA 3D9XA 3JRKA 2BVYA 1UWIA 1R2RA 2JGQA 3CIWA 2PRLA 5FSDC 3NGFA 1UIOA 1LZOA 2XVKA 1FVPA 3SJNA 2JEQA 3HN3A 3IJ6A 2QUNA 3O0FA 7ENLA 4HOZA 3LPPA 1CXKA 5DXYA 2HROA 2G95A 2ZA1A 3FS2A 1UQYA 1QOXA 4JTRA 5HDRA 2Z2AA 3NM3A 3CH9A 3ZJKA 2QAEA 1DJGA 1MUWA 4E5TA 3B4UA 4AHQA 1UBSA 4A4AA 4KBXA 5EGRA 1UZDA 4CCCA 1QJWA 1N82A 3PZIA 1I0BA 2FZDA 3BOXA 1LTDA 3BG3A 4CU6A 4Q4MA 3GQYA 3TJ4A 1CGUA 4GYPA 3DK8A 1EP1A 4OTKA 3L9CA 1AD4A 5DCDA 2BTMA 4J9JA 4AY1A 4BR1A 1AL7A 1YDNA 4WDWA 4H4YA 1CENA 2E5CA 4LS2A 1AVAA 2V38A 1FFVC 2BASA 4ZOEA 2ACUA 2INZA 1A5AA 4YJ5A 1CGTA 2JKEA 3WZ0E 1TX0A 1TELA 1DBTA 3C2VA 3N4EA 2PWFA 4I5XA 2YDAA 3AZRA 3VNLA 2D73A 3AYVA 1TTIA 4IQDA 2BCPA 2CBJA 4AISA 3TOYA 1C3FA 4I9TA 4E2BA 3CAWA 3B9OA 3CQ0A 2J7CA 1KXVA 4UQBA 5D37A 2Z0IA 4HKPA 3WCZA 4NHVA 1WZAA 1TPWA 1XRVA 1THFD 5DCBA 3R4IA 3VA8A 2FFCA 2QV4A 5BU6A 2Z4GA 3OYXA 4IP7A 4H9ZA 4Q6JA 1XGDA 5EBUA 4YCPA 3TQKA 3DGRA 4CNOA 4Z2GA 1XRSA 1GJWA 3B9AA 2YDRA 2ASHA 2WV8A 4LAUA 4YN5A 4YCOA 2P8CA 4M24A 4DO7A 1BFNA 4M51A 4HPJA 2FKPA 2W54A 1NQKA 1FUYA 1E3XA 3PAJA 4UQDA 1K02A 2VEFA 4MJ4A 3TTSA 3LLFA 3VD3A 2X1UA 1FWRA 4ACYA 3TR9A 4WXZA 2FVKA 3MT1A 1KWGA 2ZZ5A 2TYSA 3GBEA 4DQWA 2R1MA 3WG6A 1A3XA 1VFOA 4QJ3B 3ARQA 1WO2A 1MW1A 1SPQA 1KFEA 1DQUA 2QCDA 3BOLA 3KVMA 3AISA 3GVQA 3HQ1A 4DO4A 3H7RA 4IMDA 2C1HA 2Y70A 1U1UA 3CAQA 3HU7A 1SU5A 5GJNA 4PMUA 3W2NA 1ZBKA 2V2DA 1C9WA 1J10A 4QBXA 3ABRA 1K8YA 3N6JA 2CIPA 3H55A 1EFZA 2J7FA 2ZVRA 4GFSA 2DZXA 4FNRA 1X6LA 3A9BA 4EXBA 2Q3RA 3PR2A 3WLLA 3BMWA 4PCPA 5E70A 3SIZA 3PZVA 3QRHA 3AIRA 2PS2A 2EQ9A 4GNKB 2OQHA 3EMZA 2I5GA 4NX0A 5HJXA 5LXXA 3UZWA 2Z27A 3E0LA 4JN7A 3NFUA 3TLLA 2NQLA 1MMFA 2QNEA 5G1YA 2AQOA 3IRDA 1EGZA 1MEIA 1OK6A 2H9AB 4IMEA 2F61A 3EMQA 4W8BA 3CWHA 1DIEA 2OQLA 4DZ5A 2YYTA 4LB3A 3P62A 1Q8JA 3NDOA 1ME9A 3W73A 2QDHA 5C2CA 3EWZA 4QCFA 3W2UA 1UWTA 2QT3A 2BGNE 4J3SA 2CBUA 4AW7A 1CGXA 2XHYA 4FXFA 3WBEA 5I02A 1GOKA 3W37A 1P7TB 1A50A 3U3HA 4JICA 3KS6A 4M5PA 2G3FA 1HKVA 4IIGA 2OQYA 1W2VA 2G50A 5FEWA 3RYSA 3E0VA 3HPFA 4ENLA 1LORA 3MMTA 1FCQA 3BCJA 1N5XA 2E1DA 4LUTA 2YXOA 4GYPC 4IH3A 4MYAA 4BY3A 2PCQA 3MP3A 1UZHA 4O4WA 4Z1AA 3PPHA 1M04A 4O1AA 4P2VA 2VVNA 1Z89A 2OU4A 4HK5A 1OJXA 1GQJA 4KETA 2EPNA 1E6PA 4DBDA 2CDUA 1KGUA 2BB0A 1V7AA 3ZZ1A 3CHEA 3W23A 1A0DA 3M46A 2WHKA 4AEFA 1XYLA 4GIEA 4HPNA 1A80A 3VO0A 4NEWA 3GFXA 1B4KA 4PA8A 1JNDA 1WDDA 1YQ2A 3VNZA 5D8WA 1OFEA 5CSSA 4JPGA 3KHJA 1TG7A 4M0XA 3N25A 2J6VA 4Q3MA 4MJ2A 3NYZA 1W1TA 1UWRA 1XYBA 3K30A 2FHBA 2D3NA 2P5NA 2BXVA 1B54A 2GQWA 3G6LA 3IC9A 3VGFA 1P1XA 4BQ4A 1HVXA 3GXMA 3ETRB 2XH7A 2QEZA 3ZO9A 2B81A 3QKZA 4DNAA 5H8UA 1Q6RA 5EA9A 2XVPA 2WJEA 4U4MA 3NWRA 2D0HA 3T08A 2I57A 1TV5A 4HK7A 4LANA 2RABA 3QY6A 2DW6A 1MSSA 3M7WA 1NFPA 3W9ZA 4NNBA 2V68A 4MUZA 5TBOA 4AMAA 4FNUA 3AU2A 3M5XA 1BVNP 1QNRA 4NJIA 3WO8A 1R6WA 1IZJA 3LBCA 3MJYA 3TTEA 2WZIA 5D9OA 2FTYA 4WUIA 4ZBCA 3POCA 4LCSA 4TQTA 4G8TA 4W5ZA 4MNKA 3CBWA 2I5QA 4AUBA 4O1CA 2EPOA 3TX9A 1N63C 1XBXA 2DSWA 3GDTA 4RE4A 4RX0A 1FOBA 1I1WA 3R94A 3AYTA 1K1DA 2X0HA 4CVWA 2DJXA 3P84A 1TTPA 1LQAA 3Q67A 3H4KA 3C86A 3DFQA 4O12A 1EDGA 4YYFA 3DG6A 3DFTA 4FAMA 3OVRA 4S3AA 4RW5A 1KM0A 3NPVA 3GW3A 3GNRA 3T81A 1FQ0A 1O66A 2NUWA 1EJSC 3BLKA 1VJIA 1V02A 3W1MA 3ERPA 3PPCA 1BG9A 1LYXA 3PUEA 1HL8A 2C71A 1B9ZA 3GE7A 3ZR6A 4H4QA 4L7ZA 4F2UA 4H9UA 5C0QA 3WJWA 3B97A 1WBHA 3R7MA 2B7QA 3AIWA 4O1DA 1DWHM 3BGAA 5FS6A 3MS8A 2E5AA 2EJ1A 4CN1A 1N61C 4H7VA 1I45A 4PMOA 1SW3A 4A29A 1W17A 2XZ7A 4ML4A 5CZKA 4APNA 4LYQA 3A7UA 3HF3A 3WX7A 2OWWA 1OFDA 2WZHA 4NRSA 2NSOA 5CPNA 4I9AA 2GUUA 4DF2A 1FX6A 2XH0A 4GZIA 4QQUA 5EMUA 1P0DA 3M0KA 1CGVA 4DLMA 4H4TA 1XXXA 2QMKA 2FZ9A 3VGGA 3V3WA 4V33A 1JYWA 5F2GA 5A2AA 3GHSA 1W91A 4H4SA 1JUBA 3KHDA 2WMGA 2PPGA 2V5JA 1UUMA 3S42A 3MBDA 2SFPA 1DTNA 3QFEA 3GU2A 4UIOA 3HB9A 3QW3A 2VDHA 3W1TA 3SCRA 4PFMA 2WCGA 3IWPA 4LAOA 1GNXA 3NL6A 1BWCA 2AKZA 1UKSA 1W3KA 5EMMA 3T07A 2XH4A 1VEOA 2O4QA 1HJQA 1JUKA 4H1ZA 2UZ9A 4HA3A 1ZP4A 4QNWA 1STZA 1XRFA 1ZLPA 2YDSA 5JMUA 1EUNA 3SQPA 2P76A 4C65A 1GEQA 4DUWA 4DUOA 2FPYA 4KWOA 1A5BA 4DBUA 4JS3A 2WMHA 2Y8UA 1VFSA 5HBFA 2V3GA 2V8ZA 3QTPA 1MEWA 4DPQA 3WK2A 4G7EB 4CNSA 4DM2A 2QUMA 6XIAA 2P8BA 1ITXA 5E9XA 3M5VA 2ZXBA 1QPOA 3TUUA 4R7WA 3EF6A 1OK4A 3W7NA 3H26A 4WSKA 3SCQA 2VC6A 1GESA 2WBAA 1PHQA 4B3LA 5FJIA 3CIXA 4QLJA 3C0LA 4YL2A 5D2YA 4DJDA 1TFVA 4BHYA 1VLWA 1AH0A 1VJZA 3TW6A 4DY1A 3VIHA 4DYJA 1RP8A 3APYA 1M41A 4F0KA 2CXGA 1RQBA 4REQA 3PS7A 1CDGA 1KR0A 3B40A 3BURA 4DLFA 2CU0A 2D24A 4AD5A 1DIKA 2ABBA 5HQLA 2YL9A 3AHVA 1NDVA 5A8PA 2AL2A 4O50A 4IMCA 3MO4A 4M3PA 3AMLA 4F3HA 2BXYA 2QJHA 3ZLGA 2EQ7A 3ECQA 1B4EA 3WDHA 3FG2P 4M8UA 4HN4A 3PAOA 4ZXLA 4ZENA 1DJIA 2OR2A 3OQ8A 3R0UA 1OGSA 1E73M 1KM4A 3N12A 1QAPA 1I75A 4AVNA 2NXGA 3T4WA 1NELA 1R9XA 4ERIA 1V79A 4NRRA 3EB3A 2FJKA 4WQ6A 4XAZA 4AZCB 2ALRA 2A3LA 1AZ1A 1IYXA 1Y5WA 1QXLA 4XUYA 4TXEA 4D6GA 1XD1A 3EAUA 5C9UA 1X8FA 4G7FA 4A2SA 3A9IA 1GOIA 2PD5A 3GVVA 4GX9A 1J93A 4S3EA 3A24A 4JCMA 1XSKA 3N9RA 2OZ0A 2XVNA 3OEXA 1Q5MA 2DUAA 1S5TA 3APGA 4WY0F 3W4RA 2QXWA 3G1SA 4DI8A 2VEMA 3F5LA 4LBSA 4O16A 2XGBA 1J01A 2ON3A 4MB1A 1N55A 2PDIA 1C8QA 4LAZA 2VX4A 3M0JA 2A3HA 4UR8A 1ZJIA 5HWJA 1K4QA 2VFDA 2PWHA 1X38A 4ADUA 4RNHA 4AH7A 1OD0A 1GEUA 3OQEA 1LWHA 5I3GA 1TMHA 3M0XA 1C91A 2J7GA 2VMFA 4PCFA 3VIGA 2J7DA 1TJ1A 1UOZA 3OBEA 2OGYA 1XHCA 1TPC1 2I14A 3W0KA 2IKIA 1SZEA 5HR6A 3CGEA 2WMKA 2XSXA 1W31A 3H21A 2H3DA 3SJ3A 1T7LA 3LG3A 3THCA 2JEPA 1H3GA 4JKLA 5A8QA 3RX3A 4DUXA 4OU1A 4DZIA 5D4YA 4AHPA 2IXVA 3ATYA 4XAGA 3WUGA 1HIZA 3SI9A 1QI0A 4XTDA 3QW4B 3LM3A 3CQKA 3OVQA 3E2RA 2QR6A 4JKKA 4NI3A 1KRCC 4WSJA 3MY9A 2PTXA 4EMWA 1W3JA 3VMPA 1JDAA 2R24A 3UZZA 4XAFA 1KRAC 2ZUWA 1EZ2A 3ARVA 3SW6A 4W4QA 3CEUA 3KUMA 4GZEA 3OW1A 2GR1A 3W7QA 3OLEA 4JXCA 4AIOA 4I6VA 4UXDA 1TWZA 1H0GA 2C18A 7XIMA 3C2EA 2GVYA 4EWND 3D3FA 4ZL1A 3NTYA 4B9YA 1VKFA 4GACA 3R43A 3N6HA 4LYPA 3O6YX 4Q4RA 2OGJA 2A21A 3W53A 1N7KA 3S3GA 4N6EA 3DIPA 4PZVA 1M03A 2I9UA 5H1WA 5KTLA 5AZ1A 4FOJA 3TAKA 3BUVA 1Q6GA 1D7KA 2GQ9A 2PC8A 1Y5XA 1W9PA 2BWGA 3CHDA 2E5DA 3PANA 4DJDC 4FX7A 2XGIA 1NHPA 1RCQA 2C91A 4PRWA 1TA3A 5HMFA 4GQBA 5BRPA 3ALFA 4GLEA 2C1IA 1CX9A 1J5SA 4DJDD 4ZA0A 2JFEX 3BPWA 4US5D 5HANA 3L65A 3WY1A 2Z6IA 3WK3A 1Q2SA 2CBVA 3THQA 4Q8VA 3W7PA 4W88A 3QGKC 1SJDA 3WN6A 2VGBA 2C6QA 3RCNA 1X1OA 1SMAA 3L4XA 2VX5A 5DN1A 2ZX5A 3P67A 5K7JA 3R89A 2H6RA 5FSEC 1MFUA 1I8JA 1QMLA 1Q1WA 1V6WA 3VI2A 1EA0A 3CZJA 2NQJA 1EJTC 1DOSA 2HBXA 1BYBA 1DWAM 3W86A 3WNPA 1WCGA 3WLQA 3SFKA 4Q33A 3CM4A 1PPIA 4NP7A 3W75A 4OFCA 1OIFA 3OG2A 3STCA 6TIMA 3AFBA 4DX3A 2DPEA 3SQLA 1ENUA 3UWVA 1G5AA 2YAUA 5D9MA 1LWJA 4B5UA 4S3GA 1TYPA 1A5OC 1H49A 1TUFA 4GUHA 1LOLA 5AVHA 2W55A 2W62A 1QNPA 3HBLA 5ABFB 4MDOA 4HNLA 4HHPA 5J04A 5I03A 1FDYA 2PDWA 1OFOA 1WDSA 5FS9A 5IDZA 2B7NA 1XFBA 3EOUA 2CLHA 1EBHA 2QS8A 3T09A 3IUIA 3EZ4A 1PZ2A 4FZIA 4M56A 4AZ6A 3TONA 3TYBA 4LVDA 3QY8A 4FR1A 5LNSA 1XC6A 4KGLA 3HV8A 4EMJA 2NT1A 2WVSA 2DUZA 1R85A 4HD5A 4S3KA 1UUOA 1LLOA 4DI9A 3KBNA 4FEZA 3ME3A 4L56A 4OGZA 3UP8A 4H4PA 3QPZA 3VDAA 4JTSA 4OWGA 1HX0A 3V0SA 2YX0A 3V16A 3B8VA 3GS6A 1V02E 5GNYA 1BYAA 3W00A 3BWWA 4M29A 3NGJA 4R7OA 1E1FA 3QOMA 1ZUAX 3KOWA 1VS1A 3WQWA 1FHDA 1XLFA 3AJ7A 3CUXA 4NYUA 1C93A 2YR1A 2W0UA 4JD4A 3M0YA 4UMCA 3W01A 2W27A 1ZAJA 1FWEC 4FNSA 2FZ8A 3NCOA 1V3HA 3UT0A 2E9BA 3OP2A 3REQA 1F3WA 1AJ0A 3IAQA 1IT7A 2YOCA 3HTWA 4DEFA 4O0QA 2QIWA 4LNCA 5A94A 3P2VA 5HPOA 2VEKA 5LHFA 2Q71A 4YPJA 4PSRA 1Q6FA 2QDDA 4EXAA 1X7FA 2P10A 4B5NA 4IXHA 2PLCA 3AO0A 1NY1A 2E5BA 3AHZA 3VCNA 3TWAA 4RE0A 1Q2RA 2PU1A 1EDQA 1Q6LA 2J9ZA 2TODA 3KOXA 2QPXA 4RDWA 3WF2A 3AM9A 2YVFA 4IPIA 1J0ZA 3DEQA 3S83A 1SZRA 3HQNA 1JZ4A 2BOFX 1JPDX 2P1FA