3RCYA

Crystal structure of mandelate racemase/muconate lactonizing enzyme-like protein from roseovarius sp. tm1035
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
396
structure length
396
Chain Sequence
VKLRDLDIIVTAPPAPGWGGRYWILVKLTTDDGITGWGECYAASVGPEAMRAVIEDVFARHMEGENPENIELMFRRVYSSGFTQRPDLTAIGAFSGLEIACWDILGKARGRPVWALLGGKMNPRIRAYTYLYPLPHHPITPFWTSADMAAESAADCVARGYTAVKFDPAGPYTLRGGHMPAMTDISLSVEFCRKIRAAVGDKADLLFGTHGQFTTAGAIRLGQAIEPYSPLWYEEPVPPDNVGAMAQVARAVRIPVATGERLTTKAEFAPVLREGAAAILQPALGRAGGIWEMKKVAAMAEVYNAQMAPHLYAGPVEWAANVHFAASIPNILMCESIETPFHDALIKGSIRVEGGYITPPEAPGLGIEVDEALARANPYHGTGLHLEMQEASCDYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme-like protein
publication title CRYSTAL STRUCTURE OF Mandelate racemase/muconate lactonizing enzyme-like protein from Roseovarius sp. TM1035
rcsb
source organism Roseovarius sp. tm1035
total genus 138
structure length 396
sequence length 396
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rcyA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rcyA01
4H83A 3PFRA 3FVDA 2I5QA 3S5SA 3SBFA 1FHUA 3VC5A 2FYMA 4GYPC 2GGJA 3UJRA 1IYXA 3NO1A 2PSNA 4ZA0A 3OP2A 3ENLA 3GY1A 3THUA 3UCDA 3DFYA 2PODA 3TWBA 2MUCA 4HCLA 2GGEA 3QTPA 4H2HA 3CYJA 1JCTA 5BOFA 1JPDX 2OQHA 3UGVA 2XSXA 4KEMA 1WUEA 3KUMA 2P3ZA 1BKHA 4HCHA 1OEPA 1EBGA 3DESA 3EKGA 4JHMA 2HXTA 3MZNA 4MGGA 3ZVHB 2OVLA 4A35A 3SN4A 1MNSA 5FJOA 1PDZA 2P8CA 4E4FA 4HCDA 3GO2A 3OZYA 1P48A 1ONEA 3V4BA 4DN1A 5FJPA 5FJRA 2AL1A 3UJSA 1RVKA 1KCZA 3MQTA 4JN8A 2OLAA 2QDEA 3FCPA 3CT2A 4EWJA 3T4WA 3R10A 2PP1A 4HN8A 4H19A 3SJNA 1F9CA 1EBHA 4IL2A 3R1ZA 3H7VA 1L8PA 4K8GA 2O56A 4H1ZA 3H8AA 2GL5A 4J3ZA 3R0UA 4IP4A 2PGWA 1R0MA 3OW1A 3BOXA 6ENLA 3IJIA 3TTEA 3IK4A 3TW9A 2QJMA 3FV9A 3ZVIA 2QGYA 4X2PA 3DG7A 3N4EA 2ZADA 5EU9A 4ENLA 3N6JA 3JZUA 3N4FA 3H12A 3I6TA 7ENLA 1BQGA 4HPNA 2QJNA 1KKOA 2AKMA 4G8TA 2DW6A 3ES8A 3TJIA 3DGBA 3DG6A 3FYYA 4M0XA 4KT2A 1SJCA 4Z1YA 3VA8A 2POZA 3SN1A 2OFJA 3D46A 2AL2B 4E8GA 1XPYA 3DIPA 2PU1A 1EC9A 2OKTA 2GDQA 3GD6A 2GGGA 1MDLA 5J04A 4DHGA 1P43A 3UJEA 3U9IA 1NU5A 1MDRA 3U4FA 4K1WA 3ES7A 2P8BA 3P3BA 3VCNA 3IJLA 4GFIA 4HNLA 3BSMA 2HXUA 3DEQA 3DFHA 3UJFA 4GMEA 2PTZA 1ECQA 3ZLHA 1E9IA 2OO6A 4F4RA 1PDYA 4J1OA 2HNEA 1WUFA 4IP5A 2OZ3A 3OZMA 1DTNA 2GGHA 4IL0A 3SN0A 1JPMA 2AKZA 3SQSA 1SJDA 2QJJA 3CB3A 3RO6A 4E6MA 3TOYA 4DWDA 3I6EA 2PTXA 4KPLA 4A3RA 3ZVHA 1EC8A 4ROPA 4GIRA 3FJ4A 4A6GA 3R25A 2XH7A 3V5CA 3T9PA 2PCEA 2QQ6A 3NZGA 1TE6A 2PGEA 4GGBA 3CK5A 3CXOA 4MMWA 3RRAA 3IJQA 3P0WA 2P88A 2OPJA 3TQPA 5ENLA 2OQYA 1TKKA 3NFUA 4HNCA 4DYEA 3RR1A 3I4KA 3CAWA 3TCSA 2PMQA 3QN3A 3UCCA 2ONEA 3ZLGA 1TZZA 1MRAA 3NXLA 3Q45A 3VCCA 4GISA 3ZLFA 2GGIA 3V3WA 3JW7A 3V5FA 3RCYA 2P0IA 4HYRA 2XGZA 2XH4A 3Q4DA 3MKCA 4FP1A 3QPEA 4FI4A 2PP0A 3PWIA 2OZ8A 3HPFA 2RDXA 1EC7A 2PTYA 2MNRA 4IT1A 1XS2A 2PU0A 3S47A 1KKRA 2XH0A 3UJ2A 3DDMA 4IHCA 3GC2A 4K2SA 2PP3A 4MKSA 4KWSA 4E5TA 3R11A 2XH2A 3T6CA 3DG3A 3T8QA 4G7FA 3TJ4A 3MSYA 3OPSA 2NQLA 3N6HA 3B97A 3PWGA 4Z17A 3VFCA 4DX3A 2AL2A 1SJBA 2PPGA 2DW7A 3QLDA 3EEZA 3K1GA 3OTRA 5FJTA 2OG9A 3UXLA 3R0KA 3MUCA 3RITA 3FXGA 3UXKA 1JDFA 2GSHA 2OZTA 3SSZA 1MUCA 2FKPA 1YEYA 4DXKA 3BJSA 3MY9A 2HZGA 3VDGA 3PK7A 3JVAA 1KD0A 4ZCWA 2PTWA 4M6UA 1W6TA 1ELSA 2QVHA 3D47A 4E4UA 2QDDA 2CHRA 1SJAA 5FJUA 5IDZA 1FHVA 3VC6A 3RGTA 2PA6A 3STPA 3H70A 4YWSA 1R6WA 3P93A 3TWAA 5BOEA 4GYPA 4IZGA 4JN7A 2OX4A 2ZC8A 1NELA 3MWCA 3DERA 2PS2A 3QKEA 4GGHA
chains in the Genus database with same CATH superfamily
1ONXA 1MZRA 4ZOBA 4AWTA 1W56A 3GXFA 5E93A 1IZKA 2GFTA 1SFJA 3VIJA 3P84A 5KSWA 3T7VA 3M5VA 4JTAA 1Q8JA 2IKIA 3C2YA 5J5RA 3E5PA 3QYQA 1VFOA 4TVYA 4Q32A 2G3JA 4JX4A 3DC0A 3QKZA 4CGTA 3S1UA 1K3UA 2GR0A 2XVGA 2ZUMA 1GOWA 2O55A 4QQ3A 1GPWA 4DYJA 4HNVA 4HK5A 5CPMA 1ISWA 1VIWA 1TMQA 4ERIA 4IXXA 1KCLA 1RA5A 4EPEC 2QCEA 3AIVA 3W1LA 1K9FA 1FWSA 4QLJA 3TIMA 5I06A 2BTMA 4GY7A 4NJGA 2Z26A 4W8LA 4MZ1A 4DI8A 1F61A 1X38A 2PDCA 3I10A 3BZJA 5MHBA 1TIMA 1E73M 1FKWA 3CO8A 4QG6A 3TNOA 3MKKA 3FCPA 5C9WA 4QCEA 4PCPA 2YSWA 4FNUA 4E8CA 3NOYA 2VWTA 1M68A 5DEZA 4U31A 1Q66A 1H5VA 3R1ZA 1VHCA 3D0CA 5HXMA 2O56A 2J7FA 2CDUA 1OK6A 5AYZA 5LA2A 2J7HA 2V8ZA 1CNVA 4H2CA 5LZLA 1RZMA 5HNRA 3BLEA 2BXZA 3AUJA 3IK4A 2Z2AA 1IIHA 4PFHA 3O2LA 3N4EA 2VVSA 2A0NA 1OM0A 1DJNA 3JZUA 2PWUA 3GTHA 3HO8A 3NQMA 3IAPA 1IEXA 2W63A 3W29A 2WQPA 2ABAA 3K4WA 4JHZA 1KLZA 4ASTA 5HJYA 1XYMA 3ARSA 2B7PA 3ES8A 3PZNA 2BCPA 1SFLA 5KMYA 3DJGX 2P3EA 5CBIA 4KT2A 3BCDA 3LCXA 2F2KA 5HR6A 2R1KA 3TJLA 3BGJA 1V0LA 2NX9A 1TO3A 3CGTA 1YTKA 4AH7A 1X6NA 1N5XA 1XQKA 2HDJA 1MVYA 2GJLA 2FZBA 4F0KA 1GNXA 1KO0A 3SFKA 5J04A 1I60A 3STGA 1JGIA 1LLOA 4WDTA 1D8CA 3KL0A 4ZOCA 3U4FA 3BVJA 3ABQA 3KS5A 2P8BA 3VILA 4XISA 3GVWA 5C9UA 1PCWA 1QOXA 1XI3A 2VEIA 4PSRA 1H0GA 1IT0A 4BEUA 1YPFA 3CQIA 1T8XA 2ZFAA 2E8YA 3NAVA 2PDUA 3AISA 3DFHA 1XHGA 1G0CA 4XZBA 1REQB 3IJ8A 2D23A 2W27A 1DJQA 1OFBA 4JZ5A 1G5AA 1SUXA 4HTBA 4Q4KA 2HNEA 4DBUA 2WM0A 3HZ3A 4QBXA 4GYFA 4IL0A 1JPMA 2KAUC 1TJ1A 4QE4A 3RO6A 4YTRA 1YLVA 3SQMA 4PUMA 3L4UA 1RBAA 3R25A 2V38A 1XBYA 4PUWA 1UKQA 1WDDA 4H01A 5EMKA 1A4MA 3HRDC 4WY0F 3CK5A 4Z0JA 1W9BM 3RPDA 2P88A 3WFAA 1HF6A 2O0TA 2QT3A 2EO7A 1PCKA 1V93A 4KPRA 3T0TA 4TU1A 3MW7A 4NL1A 4IISA 1RK6A 2FGBA 5A69A 1GVSA 1WKYA 3TFXA 5CPTA 2YAUA 1XL9A 1B54A 1TWIA 4HMCA 3PZGA 3WLLA 4RZ6A 3WLSA 1HX0A 2PWGA 2OT1A 3BH4A 1HJUA 4UFHA 3GU2A 4GACA 1R3WA 1V7AA 1PB0A 1AZ1A 1UZHA 2WMKA 3PWIA 1KFBA 1ZLPA 3UWVA 1RAKA 3V0TA 4PBGA 2OZ8A 4LAKA 3MMUA 5E0KA 2PLKA 1DIOA 1EKOA 3WELA 4AISA 4H9ZA 4PCTA 3GW3A 2UZ9A 4ICCX 1TTJA 3VKKA 3W3OA 3QMSA 1R30A 3B9OA 4CD6A 3UWUA 2VEPA 5ABFA 1KLYA 2Y7EA 3CUZA 2L5HA 2ZZCA 2CZFA 3R0KA 2VR4A 1XYZA 2QW5A 2J7DA 4GXMA 2NX3A 2YDSA 1TWZA 1WV2A 2NWRA 3R07C 1Q5MA 3PZQA 4D8LA 2PE4A 4AHQA 1Q4NX 3KBMA 4KCUA 5EMLA 1DHPA 4F2BA 3MB9A 1BEUA 3R8HA 3OGRA 3LU2A 4J2MA 1AVAA 1ZBVA 3NTYA 4AX7A 3HGSA 3H70A 1Y5WA 4GYKA 3PPHA 3OHMB 4I9TA 1GONA 4DZAA 1BVWA 2GUYA 2FQIA 4WUIA 5I3DA 5LIYX 1XP3A 4OZOA 3QKEA 1MFVA 1F73A 3GM8A 4TX9A 3ARPA 4WSKA 1UQYA 4QLLA 3M41A 2XSAA 2Z27A 3P8IA 3S5SA 2ZXAA 4HOZA 4GC3A 1BWVA 4DI9A 2BASA 2FYMA 3R43A 3W25A 3NO1A 2Z25A 3VABA 1NDAA 3OP2A 1GJPA 3ENLA 4OGZA 5XIMA 3BG9A 1ESWA 4G56A 1ISYA 4UTTC 2IQ0A 4DLFA 2ZUUA 1K77A 5FACA 1BGAA 5FD0A 1A53A 1GERA 1S7MA 1PIGA 3AHYA 1OFOA 4JTQA 2V5CA 3PBMA 3WLHA 1RJPA 4PMZA 1H61A 1IEVA 2A3BA 1A5SA 1LT7A 1I1XA 3ICJA 1CI1A 1UPPA 2YBUA 4R9XA 3STFA 4XX6A 4WKFA 4MAVA 1OF6A 3R7MA 3B40A 2PZNA 1MNSA 3A12A 1H4PA 1GYLA 1EUAA 4NZ5A 5BYWA 1CX9A 1M03A 4J3XA 5I3KA 2OXNA 3WF4A 5G4HC 1GVQA 1JXKA 1KCZA 1W9PA 3MQTA 1T8QA 1RK5A 4CU8A 3B0VC 2WSYA 1GVOA 4AZGA 1ZAJA 1KRBC 1YXYA 3AS3A 5A6MA 1H7RA 4LF1A 1JZ5A 7REQA 2AGTA 3TYEA 1RP9A 3ZJ7A 5IHRA 2VGFA 1PZ2A 1QNRA 3BL3A 3HGJA 3BJTA 5EBUA 2IPWA 2V81A 3CASA 4HJFA 4GI4A 5I79A 5G4WA 3BG3A 1YRRA 1SW0A 4K68A 1HJSA 3VIFA 2GVEA 1AOGA 3BICA 5FF0A 1KR1A 5F7UA 4UXDA 2CCRA 3N4FA 3ARRA 3HURA 4N9EA 3FA4A 5EFDA 3PN8A 4ZOAA 4G8TA 4H4RA 4EMJA 4O1AA 3ALFA 3MVTA 3KOWA 3V0UA 1XRTA 5A2BA 3KOXA 4M0XA 5HWJA 3PSWA 2BGSA 3VA8A 1KBKA 1JROA 1C8YA 1GQIA 4O8AA 1BSIA 1R3TA 1E1CA 2ZZ7A 2JEQA 3FGCB 5DX7A 3W9ZA 2VUYA 2ZICA 4B90A 3B8WA 3DBPA 2WPCA 3GD6A 4GA8A 4BK9A 2QCCA 2E5BA 4CD5A 2V5LA 1IWAA 4OV9A 1OHLA 2QCMA 3P3BA 3GH5A 2QCFA 1QI5A 4U10A 5E70A 3O16A 4C5ZA 3FNDA 3BPWA 1ME7A 1VBJA 1SO4A 5IFPA 4IQEA 2V5DA 1EO5A 1FDZA 3GBEA 3UWZA 2HS6A 3TN4A 1CGUA 2BDQA 4LC6A 1GZJA 1S5MA 2FPYA 3MCMA 1GRHA 1Q2RA 5ABEA 2BODX 7ODCA 4MWAB 5D2XA 3CJPA 3TKFA 1SO6A 2ZIDA 3OZMA 4M56A 4UQBA 2YDRA 1WKDA 3STEA 2AKZA 3FKKA 3GXPA 3CZJA 4HNNA 1P6WA 4DWDA 1L6SA 3G0XA 4JCLA 1EC8A 1LPFA 5JCKA 3KEHA 4PFMA 1WKEA 2PFHA 3CIXA 4ZZ9A 2OTDA 5ECUA 4IPJA 4PUEA 4W8BA 1TE6A 2HMCA 4S1FA 4MHBA 4Q8NA 2Z1XA 5E6ZA 3V1PA 1Q6LA 1DBTA 1LWHA 2YW3A 3LV6A 4PH6A 3O1NA 4UNLA 3VUSA 1QNOA 4PMVA 4HNTA 3WQ4A 2WVUA 3QZAA 3QH2A 3RO8A 2VC7A 3BZGA 4BKNA 3NQ8A 2W66A 2WWCA 1LQ0A 4QEHA 1IXPA 1FH9A 3JR2A 4R34A 3FOKA 4LBSA 2NUWA 3NVZB 3W2KA 4L65A 4CQDA 4L1WA 4HYRA 4H4IA 3VKBA 2YLLA 3QLLA 1YYAA 4FI4A 3QHOA 2WNQA 3C8NA 5GNZA 2VNCA 1XISA 2X1SA 3CGEA 5A94A 3ALGA 2RDXA 4JNYA 2YVFA 2QS8A 1DL3A 2PLJA 3CPUA 1G01A 3MDWA 2E7FA 2D2JA 3VD7A 4IHCA 3HG5A 1X98A 3M5XA 3N14A 4PUKA 2DH3A 6XIMA 2CLFA 1M01A 2NQLA 3N6HA 2PF8A 2DT0A 3N73A 1LYXA 4JX5A 5HPOA 4MG4A 2XU2A 2YVJA 5C5YA 5FJTA 1AQMA 3NG3A 2D73A 1EIXA 3TNBA 4XB3A 3G18A 1HL2A 1S39A 5C6MA 1EQPA 2B7OA 2WVVB 5CC3A 1YEYA 5A8QA 2X1IA 4UZSA 3AU6A 1O1HA 3GDMA 2Y6ZA 4P7OA 2HROA 4U33A 4K38A 2OO0A 1YPXA 3T0CA 4ZCWA 1FX6A 2VM8A 3MBDA 4PUJA 4E4UA 1FVPA 1VCGA 1FA2A 2G3NA 2GQ9A 2I56A 3GG1A 3QHNA 3P81A 2FFCA 3W27A 1HGYA 4QX4A 1NWUA 4GH3A 2UWFA 3FY1A 4EXBA 3MCOA 1R2SA 1QK0A 3N4AA 1E1EA 2OX4A 1XYBA 1K9DA 1MUWA 1SZNA 2GLKA 4UMBA 1P6CA 4WY0B 3W37A 1JGMA 3ID7A 5BCAA 3PBGA 1NWSA 1Q6QA 4UQ9A 1FECA 3KBVA 2QR6A 4UTTA 2EQ9A 3EXTA 3VFLA 4AWSA 5FMHA 3WF2A 4LA1A 1YE4A 2VELA 4J3VA 3KX6A 3HQ1A 1NIUA 4B15A 2HQMA 1EXBA 1M41A 4DXVA 3UF9A 2V2HA 4NX0A 3GTIA 2PODA 3M9YA 3QTPA 1O66A 2DGAA 3LD5A 1WDRA 1NWRA 5BOFA 3TK7A 4I8DA 3CV7A 3ZJKA 2X40A 6ALDA 2F6UA 4FXRA 4ZFMA 3THDA 4DF1A 1V51A 4PMJA 2VKZG 2FTWA 1HVXA 2BVWA 4O54A 3TXZA 4L1XA 4GABA 2JIEA 1I4NA 1OX5A 2QGHA 3UYCA 4GVGA 2FFIA 1L6YA 3VIPA 5FI8A 3WY1A 2GWNA 2OVLA 3SRDA 5ECVA 3M0VA 3B9NA 4E3VA 1DXFA 1J4EA 4JXCA 4HN4A 4H4QA 2VFDA 1RVKA 4O4WA 4HPGA 1XW8A 1QATA 1UP2A 5C54A 1GEUA 1EF3A 3MA8A 1XH0A 2V5BA 1QDSA 4AVFA 1RUSA 5AHIA 2WMFA 3T4CA 4DXXA 3GTFA 2OCZA 2PP1A 5G2HA 5EB8A 1R85A 3B8SA 2XZ9A 5D2VA 1A5UA 1NOUA 1Q85A 1EBHA 3NL5A 3PZ9A 4DELA 5DY3A 5F4SA 3T8LA 3WDHA 3DFOA 3W84A 3JZEA 1ZRQA 3W7CA 1T6MA 4IP4A 1MEIA 2WCSA 1BAGA 4A21A 3VOHA 6ENLA 2ZWYA 1HXJA 3TW9A 4WKAA 5D2YA 5AYXA 2YW4A 2GK1A 4K8HA 4YCPA 2ZZ0A 3AIQA 2ZTJA 1W1A1 3VD4A 4MY9A 1EH9A 3NPVA 4L9XA 1IEWA 3HQNA 4ZXOA 1ITCA 5HULA 3HPAA 3SCSA 4DJDC 1XH2A 1BQCA 4RJEA 1VFSA 3B8VA 5EMYA 1ZBCA 1KFKA 4AAJA 3WDRA 4M5PA 5ER0A 2I5IA 1EP2A 3PBUA 4HT3A 5BXRA 1OFRA 4WJEA 2E6FA 1XLKA 1LROA 1CGWA 1U83A 1Z32X 2DVXA 1ZXIC 3M4HA 1PWMA 4US5D 5FAJA 2CLLA 1D9EA 1W17A 2WC4A 3SO7A 2ZE0A 4JIEA 4JTDA 1R7AA 1K9EA 3U0HA 3UJEA 4BA0A 1WZMA 1H11A 2DU2A 3TOPA 1N82A 3ES7A 2GJXA 2VCBA 3VIGA 4C6BA 2NLIA 3ANYA 1GW9A 2F9RA 4JPGA 2DSWA 1F05A 3APTA 4L4OA 3ZM8A 5DMYA 4G5DA 1FH7A 1BF6A 4N9BA 4REQB 2PUZA 5CPQA 1JCYA 4WSJA 2Y1HA 1TPH1 1G4TA 1HN1A 4MTVA 4O8RA 2OMAA 3W7PA 4GZIA 3W38A 2ZX7A 2C3CA 4YVXA 4NASA 2WK2A 1S3TC 3CS2A 4CU6A 1JZ8A 4Q6JA 3E2VA 1UJQA 1XIEA 3TMQA 4O10A 5CSSA 1RJQA 2AQVA 2YA0A 3S42A 2QDGA 1GOOA 1HNYA 4A3QA 3VE9A 4ZOHB 2CWNA 3PVFA 1FDJA 4KPLA 3PG9A 1N8FA 4GIRA 1ZJIA 2E5CA 2CW6A 2WMIA 3PF3A 1R7OA 1V3KA 2B7QA 1MRQA 2DJLA 2CLEA 4CQBA 5BXPA 5I3JA 3Q67A 1ICSA 3B9EA 1JXJA 1AW2A 5GJNA 1Q4WA 2HK1A 3IUHA 5FEZA 2QEZA 3QQWA 4Y9MA 3PZIA 3BGGA 1FWJC 1SZRA 2BY3A 1TZZA 1R47A 1GRFA 3A3XA 3E38A 5A6BA 1C8VA 4IPIA 2VYOA 4LVBA 2GJXB 1Q65A 3M16A 4N9DA 3EX3A 3WDIA 2QVNA 1UHVA 3EWZA 5HNNA 4DRSA 4XZWA 3YPIA 4CNTA 2D3LA 2JK2A 3EPNA 4RX0A 3COTA 1I2PA 1SM9A 2EG6A 4FAMA 5FJJA 1UROA 4DQWA 5CAHA 3ECQA 2WVTA 4NKCA 1HO1A 4GBDA 5CPSA 3AIBA 1N2VA 3GDBA 3II1A 3W23A 1DIEA 1UH4A 5CEWA 1UBPC 4EVZA 1W1VA 3RLUA 3UWEA 2QULA 5AC7A 1UH3A 2CIPA 5AYIA 3EX1A 1MZHA 1BF2A 3UPWA 4P7QA 4MLJA 4RDVA 4PMNA 4LAZA 1E6PA 2EBNA 1Z42A 4A3YA 3BJFA 3WF3A 4LAOA 3RX3A 2XVPA 3AJXA 3CZKA 2QIWA 1R5YA 4WJXA 5K9XA 2ZX9A 1GT8A 1W3HA 1NQ6A 4AZHA 3QLDA 2DZPA 4H3DA 3UXLA 2NUXA 3WMLA 1GYNA 2V2DA 3GRIA 4XQ6A 4E4PA 4IPNB 3CUGA 3UP8A 2HVMA 2FH8A 4LS0A 2ASHA 1QNQA 4WOQA 4I7VA 3I7SA 5B80A 4DO7A 1A5KC 3G1FA 2F84A 1W3IA 3D47A 3DHFA 3EEGA 5G2IA 3L4YA 2BGQA 1NHRA 2PDIA 5AYBA 3AIUA 1W0MA 1W1ZA 3UNTA 4J4KA 3C52A 2IKHA 1H7NA 3GTXA 3W1UA 4M19A 4Z2IA 4LXFA 2R1NA 3LK6A 4AVOA 4Q4OA 1E4NA 2BVTA 3W1PA 2FMNA 2W67A 3TJXA 4BI6A 1GRAA 5IM51 4H83A 4W7WA 1OIMA 1XF0A 4XO6A 4XAGA 3LI1A 3SBFA 5E9AA 3VC5A 4DNHA 1W1B1 3OVPA 4E8DA 1DWHM 3GXMA 1TYGA 1GKRA 1TTIA 3W85A 4OBRA 3ZWTA 1GREA 2HWGA 3KVMA 4BURA 4S3BA 4A05A 2WHMA 2OLHA 4E2BA 1UWQA 1W9XA 4QS5A 3ABOA 3H2EA 3CL6A 3BLPX 3WQPA 3N2MA 5GNXA 1ZGDA 2V67A 3NOEA 5FEPA 1WUEA 5EYWA 4H4XA 1V7YA 1OCNA 2G4JA 3AHZA 1NOWA 4HCHA 2VDGA 3FYOA 1I2QA 4JFWA 4W84A 3PTQA 1XSKA 1FDYA 1PZ1A 1LRTA 3BQ5A 2CEQA 2E68A 4O1DA 2WBAA 1TWSA 2NQ5A 2ZZ4A 3GIYA 4HB7A 3EOLA 1TA3B 2Z00A 3AYVA 3A4AA 1W32A 1CGYA 1ALDA 3GDKA 4KIRA 4H8UA 3UGRA 2IPFA 3CTLA 3UG5A 2NXIA 4L56A 1ZMCA 1QBBA 4DZHA 2ACRA 4MKVA 1BGGA 1VZWA 2P5NA 4OTKA 5A6JA 1DOSA 2RH9A 1SU5A 3W82A 4UWMA 4OHQA 1ZL1A 3TR9A 2PDFA 1KGUA 3OGSA 4BFAA 4BQ5A 4XZ9A 3FLUA 4M29A 2OU4A 1X1ZA 4JDBA 1UKSA 2IW0A 1BXBA 3T1GA 3TTEA 4DJDA 4RNJA 3D3FA 2QKFA 1H09A 3BE7A 5FS8A 1CGXA 1H0IA 4UZUA 3VTRA 2FVLA 1QW7A 5DXYA 2YIHA 2ZADA 4QJ3B 2TAAA 4AFYA 2BHUA 2R1PA 2CLMA 4FOJA 4HQVA 3E2RA 1OFDA 1TSIA 1KKOA 3B05A 3TTOA 4ML4A 3NUKA 3WJXA 1I2OA 3M5ZA 1GVIA 4IUGA 3I3DA 3CMJA 1F07A 3T0DA 1MI3A 1JCJA 3A3HA 3EWXA 1OC7A 3K1DA 1VBHA 1DQUA 2VUNA 1MW0A 3THQA 5KVHA 1A50A 1BRLB 1UC4A 1FCUA 1DNCA 1GOMA 2CITA 5C9RA 4DF0A 1XUZA 1AJ2A 1UZDA 2Z1KA 4N2YA 5H91A 2GGGA 6XIAA 1SMAA 3P74A 3RR4A 4UFIA 3CQKA 3U9IA 1KCKA 1NU5A 4AD1A 1LG2A 1OT2A 4FALA 3QJAA 3IGXA 1NHPA 1LLWA 3VCNA 2TPSA 3SFWA 4WJ8A 4YL2A 5DMLA 5HMDA 3RXZA 2ZYFA 1DKWA 3LHWA 3SM0A 3SI9A 3QFWA 3ZS4A 4TXEA 2WC7A 1UB3A 3WD4A 4GOAA 4TIMA 1R3SA 2V3BA 3AJ7A 2V68A 3BUVA 1PJ9A 1LUCA 1TIWA 3HIJA 3V16A 2NX1A 4M6PA 3SN0A 4YVPA 5XINA 2J3NA 4FHAA 1JPIA 3GAKA 1VBGA 3C2FA 1E6RA 3R5EA 4Q22A 1V6XA 2E77A 4UTWC 1W5MA 1JQXA 3H2AA 3O05A 1XG4A 2CLKA 4HMNA 4APNA 4PULA 3SEPA 3EWCA 1V0KA 3A64A 4XD4A 1KM4A 4W86A 2VC9A 5HA7A 5L6UA 4GGBA 1S2CA 1C9WA 1RQHA 1QVBA 2OPJA 2WOIA 1LF1A 5IDIA 1EDQA 2V69A 3LENA 2XFRA 1DXLA 3IVSA 2G37A 2UY4A 1UMYA 3WIJA 1NP2A 3M44A 3G8RA 4OBSA 3UA3A 2V3EA 3T40A 1RBLA 4TV5A 4AZBA 3RU8X 4CCZA 2XM2A 3AOFA 3C4UA 1D3GA 3GKFA 1S5NA 3KDNA 2VCAA 3I7QA 3Q4DA 3MV01 1K4QA 4GIAA 3CXBA 1RXOB 1QBAA 5JIWA 3WEOA 3PB2A 3TYDA 3FIGA 3Q2DA 4FZIA 1LCOA 1GOXA 3IK2A 3T42A 3S2NA 4QJ1A 2PDPA 1GORA 1V02E 3LCFA 1VF8A 2WCAA 3DDMA 4IICA 4L6DA 4LBRA 2JKPA 5FEXA 3KM8A 3M7WA 4O28A 2JALA 2ZX8A 4QNWA 3RILA 3TVAA 4JYDA 1KWKA 1TUXA 3IGUA 3TONA 1TTQA 5CJ5A 3AZSA 3NM3A 5HQMA 4K6AA 1UC5A 3LN3A 3MUCA 4JL1A 4I9MA 4RDYA 1YX1A 4PCSA 1YHTA 4G1NA 4DZ5A 5LXXA 3SSZA 2PDQA 1KC7A 2GOUA 2ACQA 3GSMA 4P7NA 2O7SA 1DE5A 3MY9A 2OLSA 2WAGA 3LLDA 3UBPC 3SQPA 1KD0A 1BWKA 2RGLA 2PTWA 2V3FA 3G1XA 2PURA 5A8PA 1Z69A 3G6MA 1ELSA 2REQB 1RD6A 3SCRA 4IX2A 3GHTA 4JTUA 1EPXA 2CHRA 1SB3B 4J28A 3R12A 4HSHA 5CAKA 1B9ZA 3SQLA 5KZMA 4HSNA 3M6YA 2EKCA 2WZTA 1YPIA 1RLCL 1QPNA 2DUXA 1UA7A 3TWAA 1JOAA 3BTNA 1GKPA 4JN7A 3KCLA 4CD8A 5H6HA 2Q01A 3QRHA 3F2BA 3UXAA 4YTSA 4JFUA 2OSYA 2H9AB 3BGAA 4OT7A 3KZPA 2WHLA 3WK3A 1OCBA 1MQRA 1QPKA 4HP5A 4OBTA 4QROA 1HIZA 4GYPC 1IQ8A 3DENA 3CV6A 3WH7A 2RJGA 5HJLA 2ATMA 1Z6KA 5REQA 1W3JA 4AIOA 2J4GA 2CZEA 3TWBA 1NF7A 2W54A 3OEXA 4G6CA 2ZUTA 3H21A 1NWTA 3TYBA 1JDCA 3WX7A 1I2NA 2V3DA 2WJEA 1TREA 4KEMA 4YNGA 4GR1A 2QHAA 1KM6A 3KUMA 2XWEA 4TQTA 3GNOA 3S2MA 1XQLA 1OEPA 4AZIA 3W53A 3BC9A 4F0HA 1Q45A 2X1UA 4J27A 3NXFA 4S3JA 2Y85A 2WNWA 3CL8A 3VZZA 1IZCA 1JIBA 1KNWA 4X63A 3NIYA 3NVTA 4ZO9A 4XZNX 1H63A 1O5KA 4B3ZA 1P48A 2R9ZA 4JTSA 3PM6A 1QJWA 3ARZA 1WDQA 3VNKA 4CCEA 4H4UA 2Z7KA 3WG6A 1VAHA 2VXNA 1SW3A 5L9FA 7TAAA 2RDTA 1OB0A 1T96A 1UBSA 3M0YA 3HMJG 2ZRXA 3H4GA 1J2BA 4UR8A 1ZY9A 2WJFA 4EACA 4HA4A 2FJUB 3UU0A 3VD5A 1GPFA 4R88A 3WLPA 3CMGA 4C6PA 1VJSA 3NQCA 2VC6A 3S3GA 3NVYB 2O9RA 5LYRA 4IFRA 4FNPA 1KRAC 5G1YA 5HQEA 2ABBA 3A47A 2VFHA 2F7FA 2NWSA 4NEWA 3N6JA 2GJRA 4KFPA 4LUSA 4CQ9A 1K7EA 2GVLA 2AKMA 2GR2A 3PUDA 1CXIA 4JTGA 5LKYA 3RK8A 3BOFA 1K7XA 5FKYA 4P7RA 1FQ0A 3DBNA 4O16A 3UFYA 1S38A 1BYCA 4WDUA 2GVGA 4G2DA 2BXYA 1TZ9A 5A8NA 2A7NA 2PGFA 2EPKX 1ZENA 4IQLA 4NY2A 4DUVA 3EOUA 1XPYA 4JTHA 2Y0FA 2PGRA 4JIPA 4M82A 4YWIA 2IKGA 5C9ZA 1EC9A 4UNIA 2W3RA 4H9TA 2W62A 4OU1A 1U1HA 1GJUA 4CQAA 2A7PA 3VIKA 3A24A 3KXQA 4KF1A 3LI0A 2X2GA 4K1WA 3O0FA 2Z29A 3CZLA 4EPKA 1IGSA 3B3DA 1LOLA 2W4XA 4IG2B 2ZOXA 3SUSA 3PPCA 2QCNA 3S5ZA 3KBJA 3QGVA 4MOZA 4R27A 3DUGA 3DHDA 2CBJA 3MC5A 4IMCA 1EP1A 2YCLB 4QNEA 1K7FA 1DJYA 3OG2A 1ZPTA 4MSSA 4X2RA 4UB9A 3T07A 3ZLHA 3UZYA 1T40A 4MWAE 3O0HA 4ZR8A 3VIOA 4UTHA 4UTWA 1JCNA 3MO4A 3SIMA 2WHJA 1SFTA 3GZ3A 3RPTA 4NXSA 2HPIA 4ZQRA 3W1NA 4IM4A 3QYSA 4FNTA 1XC4A 2VZTA 1E43A 1E55A 4LUSB 4DO5A 4RDWA 3B06A 3N2TA 4PL2A 4GFSA 1IHIA 2YCJA 3TXVA 1O5QA 5HR7A 1RBOB 3L4WA 2PCEA 4S3GA 3SY1A 3CPRA 1GKQA 1M65A 3LEPA 5AY7A 3H4KA 2A2IA 3RRAA 4BV6A 3GE7A 5E9XA 2PDMA 4AXNA 4NNCA 2YCIX 4YN5A 1HG3A 1TUFA 4OOZA 1TR1A 3L4XA 1FWEC 2X0SA 4ICNA 4LEQA 2P10A 3DKJA 3Q45A 3V7PA 2VL4A 1W9DM 1VP5A 2E67A 4MPKA 5T9CE 1MW2A 1VPXA 2YB1A 4D6EA 3EWWA 3PFMA 5C7VA 4GUFA 2XVLA 1Q7MA 2QCGA 3KAOA 2V2CA 3VZXA 1OWQA 1EJ7L 1F7BA 2W5FA 3WCZA 1ZJAA 4B5NA 1HL9A 4TVWA 3H7UA 1DE6A 1XANA 2O4MA 2FTPA 3BLFA 2PCQA 1R3YA 4WQ6A 3QV9A 1S2AA 4POCA 3GYCA 4CNOA 5BU6A 4DPQA 4F79A 3M07A 4M7TA 4WGXA 2WCGA 2TODA 3PJTA 3GC2A 3C61A 4ROQA 2EPLX 2AAQA 4LS2A 5CGQA 4ZO6A 2FMOA 4P7LA 3SZ8A 2E4TA 3GIQA 3DJJA 3MSYA 1Y5XA 3AZTA 2ZUSA 4MIMA 3OYXA 3NA8A 4EQSA 4IX0A 4RNHA 5I3IA 2VJXA 1ONRA 3LADA 2PPGA 4C6JA 3TTSA 2XGIA 4K8EA 2CFFA 3CNYA 5BRQA 3ANUA 5CZTA 3CWNA 2EKGA 3EDDA 1SMDA 4LU0A 2JBMA 2ZDSA 4KFNA 5JCLA 2E3ZA 2Q09A 3W7JA 4U28A 4DBEA 3IUIA 2PRHA 2WBGA 2WJDA 5A6KA 1N8WA 4PL1A 3LA4A 4NZ1A 5IBXC 3ZXWA 4LJ3A 2W0HA 2E28A 2W79A 3OQ8A 2WMGA 2EAWA 3P60A 3EPOA 4FPSA 4LSBA 1BLIA 5AB3A 1UWUA 4GYPA 1HL8A 3WLRA 3BAJA 3NSXA 4O14A 4M8UA 3G1RA 3UG8A 1DEDA 4Y8EA 3T2PA 4JIHA 2FZNA 1AA1B 4PYSA 3UXDA 2E3TA 3RUBL 1A0EA 3CBWA 1GRTA 3RFAA 3TU9A 3UERA 5K7JA 1EJXC 4TR9A 5U7SA 1TYTA 4F3HA 4BHYA 1V6WA 3ONCA 5KINA 2E25A 5D03A 1AW5A 2JKAA 2PSNA 4ZOEA 1UR0A 3MT1A 4LVGA 2QF8A 3UCDA 3HB9A 1UG6A 1OSEA 1XPGA 2WSPA 2WWDA 3VMPA 1QPOA 3AIRA 1F8WA 2OQHA 3DH9A 4QTGA 4LANA 2ZBTA 3GG0A 2D2OA 2WJZA 3SCWA 4EAYA 4WXYA 3CQ0A 1LBMA 4Q8MA 4NQ1A 4S3KA 4JHMA 4Q4SA 1EJRC 4JTIA 3UQNA 4AUBA 2QPUA 2WW5A 3VGHA 3WNMA 2BSLA 1JCMP 3W26A 1D8WA 4WVXA 2P8CA 4E4FA 2Y5SA 1OY0A 3HBLA 1QXLA 4V27A 2BVDA 7PTDA 4LW7A 2Y89A 2I5GA 1KTNA 3CMFA 4NF7A 5K2ZA 4H9UA 4D2JA 4K37A 4CN6A 2WPBA 1UWAA 4H19A 2BX7A 3SJNA 3S0CA 3EWYA 3TA6A 1WA3A 4N4QA 3L0NA 2OWXA 1UPMB 2WNNA 2V9DA 3DZ1A 5LHEA 4I6VA 2Y7GA 5F1UA 8XIAA 1JZ2A 1AH0A 4NAFA 4WZHA 2BOGX 4D6JA 1PBGA 3AXMA 3G1YA 3W7NA 1HJVA 2Q6ZA 3WUFA 1BWLA 5EU9A 4JQAA 5ABTA 4LVDA 1FWWA 4DJED 1UKPA 3QV7A 2QJNA 1S5VA 2VP8A 4JDYA 4JY8A 1UIOA 3QZEA 5F2MA 5HOSA 3TJIA 1T0OA 2XSBA 3EB4A 5FF7A 3VDBA 1W8GA 1SJCA 2YL5A 3W6LA 3H2CA 3B9JB 3H4WA 1N61C 2QPSA 2AL2B 2C0AA 3TQ0A 3DYPA 3H23A 1TR9A 3LCIA 3WUEA 4H4TA 4OV4A 1J11A 3E5BA 5JCIA 1XGEA 1QI4A 1AODA 4ZTYA 1RQBA 1ZKQA 1XKJA 3FG2P 3V35A 3CUHA 3DYOA 4EPBC 3IIZA 3XIMA 3N9SA 4X3ZA 1XSJA 3LZ5A 2CHNA 3ZSSA 1IT7A 2BC0A 5EKYA 2FZ9A 4BF9A 2PTZA 3GKAA 4A8IA 2DSKA 4P8XA 3OB8A 1XG3A 3GD3A 2G95A 5CGTA 4FIQA 2C8NA 1YE6A 2A5HA 4H7CA 2FGZA 1J01A 3TYAA 1PDYA 3EKLA 1V6VA 1FXQA 4J1OA 4ORIA 1A5CA 5DY2A 3SB0A 5HWNA 2XDFA 5D30A 4JD4A 3QV8A 3NO5A 5AYYA 2JEPA 1PVNA 2GVYA 3BAIA 1AMKA 1XLBA 5A6BD 3L67A 4XBJA 1NDWA 3OO2A 4A2RA 3HTWA 4D72A 4XIMA 4IPLA 3APGA 3LHTA 4PTMA 1P0DA 3KCJA 5MKGB 5ENLA 4XBSA 2FHCA 2J9YA 3AUOA 2ZZ3A 3E12A 5G1MA 4HPHA 3T08A 3UY7A 1MXSA 1XCFA 3IARA 2F61A 3G1VA 1JJKA 3PZOA 4X9YA 4B5XA 1GESA 3SUUA 4DWSB 5D2WA 3URBA 2PD5A 1S2WA 4TMBA 1XFBA 1CIUA 3K4AA 2EF9A 2O4QA 1CB2A 2HE8A 4I9JA 4Z1BA 3EMZA 5IRPA 4WRHA 1UD8A 2Z1VA 3GLCA 3DHPA 4EMWA 2E9BA 2IKJA 1QNSA 1G9HA 4WF7A 1ISZA 3DFTA 1GW1A 4UQDA 1OYAA 5HWMA 4C90A 2Z24A 1H7PA 2PTYA 1XS2A 2G5WA 1KXQA 2V6OA 4OUEA 4HYWA 2WZHA 4WIWA 4Y2WA 3LPOA 5FJIA 1Q6RA 5SWUA 4N42A 1MFUA 1WZLA 3AFBA 4G7FA 3OIXA 4DYKA 1JEZA 2DQXA 3W87A 1A3HA 3PWGA 1K6AA 2OYMA 4ZTXA 3D9XA 4IH3A 3VFCA 4Z17A 3EXRA 1M7XA 2DW7A 4W5ZA 1H2IA 4XAYA 4S3CA 3G1DA 3MP5A 5IBXA 1VCVA 1C9DA 3AXHA 2VX4A 2O92A 4JEJA 3H4XA 4I9AA 4PMXA 3BJSA 1KV5A 4NEVA 2DZXA 2BV9A 3PBVA 4OIFA 3N2OA 2AGKA 3VNLA 1TV2A 4RE3A 3WD0A 3P2VA 3DFQA 5DT5A 1CZ1A 3DI1A 2QVHA 1GEHA 3UG4A 2PWVA 1EDGA 4LF2A 4IXHA 3U2OA 2BC1A 1ECEA 1NH6A 3L68A 3BV4A 4TOQA 4L9ZA 1B0IA 5C55A 4MY1A 3O63A 2CBIA 2CLHA 4PTXA 1OYBA 4GVHA 3DERA 4ML9A 2CERA 2C18A 3NPXA 3W24A 1Q1RA 1GTHA 2Y4SA 1D2KA 2X8HA 2VD8A 3WEZA 1FWTA 1QMLA 2Q8LA 3E02A 3GB6A 5E6YA 2P76A 3WNKA 5HMSA 1W1TA 1EWEA 3UJRA 3SIZA 1HKMA 2EEXA 5EA9A 1ODUA 1V6YA 1B1YA 4PMOA 1G6CA 2Q3OA 4AZ6A 4GI8A 4UMAA 4YHGA 3DFYA 1PYFA 2WXDM 2WMJA 4OKDA 5HJXA 1JFXA 1XX1A 2E6AA 4GY0A 2HS8A 2GDUA 3BCJA 1BKHA 2AAAA 3ABXA 4QITA 1OVDA 4CD7A 1P4CA 1EQCA 3EWBX 4Y96A 2HXTA 4MGGA 2Y5EA 2PWDA 3O6CA 3AS1A 3C3NA 3KVLA 4TUFA 3ZVHB 1CLVA 3WK1A 2V5JA 4K1GA 4O1BA 2GZXA 1NPXA 4RZBA 1PDZA 3H55A 4H8VA 5DQPA 3E74A 4NZCA 1OD0A 3GFYA 5TAOA 4AD0A 4DN1A 3EBVA 3W86A 2J7CA 2CKRA 3ABZA 3P80A 2D0HA 2NW0A 2VFEA 4DJDD 3BV7A 1JZ4A 1O94A 2IS7A 2XN2A 1AJ0A 3EA1A 2YPIA 4E38A 4KGLA 4L1GA 4KBXA 2ODOA 4D6DA 2A21A 3EANA 1NDVA 3H2MA 1W9VA 3DK9A 1P1XA 3S6OA 4K8GA 4QCFA 1SGJA 1Q6FA 4J3ZA 5K4ZA 3B0UX 3Q6JA 2IQTA 3UG3A 2VQTA 2AQOA 1NAL1 3LS9A 2WHKA 1MO0A 3MI6A 1I6NA 4JTJA 1FWRA 3ITCA 4BEQA 3CO4A 4FX7A 2DZUA 2XVKA 4AEEA 4O50A 1N8IA 2WYSA 4GZJA 3W2JA 2IXVA 3VI2A 2CLPA 2ISWA 1HUVA 1E9YB 2DP3A 3DGBA 3DG6A 2G3MA 4GQQA 1WOBA 4IGMA 3MVIA 3UNDA 1C91A 8TIMA 5HNUA 2YKKA 4RV3A 1A49A 2ZUWA 3SN1A 1WYIA 3IGHX 3AYTA 3HM7A 4ZSTA 1J5SA 5D38A 1H3GA 3AU2A 4Z1DA 1QNPA 1OX4B 3PPGA 2E6DA 3NZ1A 3PZVA 3GH7A 2OB3A 1L2UA 1EZWA 2BNJA 3LSBA 3RM9A 3PBWA 1O68A 2CLIA 4US6A 4AHOA 3BURA 3UESA 4WX2A 1AK5A 5AHNA 1NTHA 2EG7A 2E8ZA 3NEVA 4W4QA 4AZCB 3HQPA 3UZWA 3UZXA 3GDTA 3ZSTA 4JQ9A 2R24A 3WSUA 4EQRA 4JAWA 1JPKA 2C0HA 5KZ6A 1R2TA 1VBRA 4GYJA 2A3AA 1BHGA 4IPPA 3ZO9A 4H9XA 1JDAA 2PB1A 3N17A 4FLRA 1SZGA 3EXSA 2Y88A 1FOBA 2FHBA 3E0LA 1JDEA 3E9AA 1KQYA 1NFBA 4AC1X 4EX4A 5CQ1A 1WAWA 1PL9A 3NL2A 4S2CA 3RM4A 2QJIA 4NJHA 3S5YA 4UFJA 5DCEA 2VOMA 3FA5A 1UA3A 1VPYA 4KS0A 1LL7A 1UUQA 2YL9A 1OGSA 1NQKA 4OWGA 1KM1A 4Y90A 3PUGA 4MMWA 3MUZ1 2CC0A 2E5DA 3DKLA 3VPLA 4LVFA 4GQBA 4YIWA 4AX6A 4S39A 2VGGA 3N04A 1FBAA 3AWNA 1QR7A 3UCCA 4GNVA 1ZFJA 1KFCA 1TPC1 1FCVA 5JBFA 3LX9A 3MHGA 3NR0A 1KV8A 1QO5A 2PWHA 1ZX9A 5G4EA 2GGIA 4K8DA 3KWSA 1VQTA 3GH4A 1V6TA 1A0CA 3M7SA 2QJHA 2A3LA 4MNMA 3W7OA 2XGZA 3C3UA 4BWLC 4UFMA 3S1XA 3N9KA 4CN4A 1HT6A 2WLZA 4LCQA 1ONFA 3II4A 3WMSA 2X7VA 4H50A 2WPGA 4MLRA 3O15A 3L4TA 4CCCA 1BYAA 3THAA 1V5XA 4GKTA 2WQDA 3TLQA 3UR2A 1TVNA 1OFPA 4C6NA 2I17A 3HGRA 4AU0A 3CGBA 3QSRA 1EX1A 1BG9A 4DUWA 4ATLA 2NT0A 1GZGA 5A5WA 1FXPA 4JTKA 4S3AA 1V79A 3SR6B 4C6IA 3D5HA 4DX3A 2ZRUA 3T81A 5CJNA 4AMCA 3TA9A 1K6WA 4EF9A 4YLWA 3IIPA 1UD4A 1ITQA 3UW6A 2NVCA 4E3TA 2Y8KA 1POJA 4PE8A 2VX7A 1EFZA 1VLWA 1M7OA 2TSYA 2HZGA 2QCDB 2JFEX 4ZFCA 2PD9A 1H1ZA 3WLJA 1KFJA 4AQLA 1L2QA 3KTSA 3QC3A 3RMEA 4O1CA 1LL4A 2DT1A 3N25A 4KRUA 3VE7A 4H6QA 4XG1A 1WZAA 4RL3A 5D09A 1OCQA 4YMZA 3KP1A 1OC5A 1REQA 3VMOA 3G77A 3C0JA 5HATA 1E6SM 1QI0A 4Q7BA 1RCOB 3EB3A 1OZMA 1OINA 4Y8FA 5G5HB 4FLOA 1K8XA 4H9YA 1MSSA 1P5BA 1MMFA 4O0KA 4FR6A 3A21A 5FS7A 2UV8G 4AZ5A 2QXWA 1AL7A 1WE5A 2P50A 4MUZA 2ZDRA 1YNPA 4W93A 2ZUNA 2CXEA 4MWAC 1POKA 5EPDA 5I07A 3GY1A 1V6UA 3KRSA 3TP4A 1GOIA 3SCOA 2ON3A 5AC8A 2UY5A 2BWGA 1ZP3A 1B57A 4BQ4A 4C6EA 3NYZA 3MMWA 1LRQA 1N5WC 3W4RA 3XINA 4JTCA 1EP3A 3OLIA 1TELA 1RD5A 2QMKA 2ZTKA 3NURA 3G3MA 3VKJA 4HKPA 1UQZA 1Q8AA 2LLEA 4TO8A 1VKFA 1L9WA 4MF4A 4FXJA 4KWOA 1XLAA 5FCZA 2DIKA 4ICMA 1D7YA 2XIQA 5TF0A 5KVIA 4C1LA 3HG3A 3PANA 1XGDA 3OZYA 4C6QA 1FKXA 1W3NA 3B4UA 3E1F1 1ONEA 5FJPA 6A3HA 4W7UA 2EPHA 3OBAA 1JVNA 5CLTA 3SUWA 4M52A 3FS2A 4WCJA 1KCXA 2GQAA 3T4WA 1J9YA 3TMLA 3EGJA 4IGHA 4H9MA 2YYUA 5DCDA 4H41A 3IPWA 4C6OA 1UWSA 3CHVA 4DJFC 5DCBA 1ICQA 4GO9A 4DAIA 3P61A 1WP6A 1V02A 2QJGA 2XG9A 4LY8A 1CECA 1EEPA 4RZ5A 4MB3A 2Y7DA 2XN0A 5H1WA 2A6NA 1RLDA 4K3ZA 5A6TC 4H6EA 2RAGA 3QY7A 3LHYA 4QXIA 5D9NA 4C7GA 1HKIA 3M0XA 2V82A 2C3ZA 4D8AA 3LHUA 3SRHA 4E2VA 2WLYA 2EQ6A 4ACZA 4GBUA 4MYXA 3F7JA 1MOKA 3I6TA 3U5UA 1ITXA 2DZSA 1EJSC 4CUCA 2VOTA 3LUTA 1H49A 2MANA 5JUVA 3W01A 3FW6A 4M6QA 3MHUA 2ANUA 3TYZA 1M04A 1MEHA 1LZOA 1VFUA 1THFD 3MO7A 3EAOA 2G41A 1QHZA 4HSOA 3DIPA 2A79A 5HMFA 3GNXA 4L80A 2C13A 4ADTA 2DIEA 3CH0A 3G1SA 4BQ3A 2OKTA 1XR2A 3WDJA 3E2QA 3U2ZA 1ONWA 3KCOA 3M0IA 1J6PA 1TX0A 3O6AA 1CW2A 2BG5A 1H7XA 4UOQA 1SO3A 3DAQA 1GRGA 3ITVA 5AFDA 5D2TA 1BVNP 4CEXC 3EA3A 5D8WA 2G3FA 3FN9A 3UWYA 1N63C 3AXKA 3ARVA 3CHFA 2HXUA 1S2UA 4BF5A 3CLWA 1BYBA 3FVMA 2FPVA 2KX9A 3ATZA 3DXIA 4HZ7A 3IIOA 2OELA 1AH4A 1JG9A 3HGOA 3PR2A 5CC6A 2Z7GA 1WXJA 1UR9A 4I5RA 1OG0A 3N18A 4LUIA 4B9ZA 4ACZB 3H2FA 2BY2A 4NRSA 4YJ5A 1FEBA 4B9YA 3JU2A 2A1YA 3R0DA 4PUNA 4UTJA 4E6MA 1J5TA 4U5IA 5LIWX 1VQZA 4ROPA 1T5AA 4FOUA 1FWNA 4LUTA 3W7QA 4XO7A 2GYIA 4WDXA 2QV5A 5HAOA 1E70M 6REQB 3TTQA 1PX3A 3OLGA 5LIXX 4X0VA 4ZO7A 3DC8A 4AEFA 4IMGA 5DMMA 1TVPA 4L6OA 3CHDA 3GHSA 1XUUA 3QN3A 9XIAA 4YTTA 1MRAA 3EA2A 4YTUA 1NDYA 1OG6A 3MYPA 4BWLA 3F4WA 1Z44A 4XWUA 3SY8A 3WQ6A 1DORA 3LHVA 4LYQA 4FF7A 2F8QA 3P7YA 2GJNA 3MCNA 2XIIA 1WKFA 2VRJA 1AMYA 2J7EA 3QM3A 4MNJA 4K7VA 1DIKA 5AHLA 2J9ZA 3K2GA 4BQ2A 3K4DA 2R6OA 2OSWA 2R9RA 5DELA 4FNQA 2HE5A 1Z48A 4KCTA 3G5EA 3UR7A 3W02A 4XBKA 4Q8OA 3WN6A 2DZTA 3VOJA 3KTXA 3MDUA 3MUXA 3Q37A 4IF2A 6CGTA 3HPFA 3NWRA 3GXDA 3C0QA 1W91A 4C60A 3GC5A 4JKLA 4QFUA 3CU2A 3C6CA 2Z1WA 5BRBA 3W73A 4LRTA 2J27A 1WB0A 1RQEA 2D2HA 1R9YA 3GNRA 3U4AA 4ZB5A 3TJ4A 4C5YA 3AS2A 4DBSA 2NXGA 4BY3A 2P0OA 3A5VA 4F9DA 3TQVA 3LTYA 2D3NA 4HPXA 2E1DA 4LUTB 2VGIA 3FGCA 3GS6A 4GJIA 3VM5A 4NZ4A 3R8RA 3EOSA 3CZ8A 1SQ7A 4NYUA 3ITXA 2WPFA 1ADDA 2VEMA 3VDGA 1B2YA 3KBSA 2JGQA 2R8WA 1Q1WA 1ITUA 4I90A 1IXOA 3HU7A 3V75A 6TAAA 1VS1A 1WDWA 4Z1CA 4GY1A 2O7QA 3C56A 3GFXA 4KERA 2VC5A 3CAQA 4HA0A 3LB0A 4HOXA 2YL6A 3HFTA 3UPBA 1KWGA 3DGHA 1VBUA 3LLFA 1FP8A 3VC6A 2A3EA 4LT9A 3STPA 1OIFA 1P7TB 1O1ZA 1H7OA 2CESA 3W07A 4LS1A 1G1YA 1L6FA 3A9BA 4FOKA 4DY1A 3M0MA 3TTYA 3C0SA 4MWAA 3GG8A 1QOQA 2TYSA 1DJIA 3IS4A 4JTLA 1HTIA 1XKYA 1G69A 2DSUA 3RN6A 3VX0A 4N0RA 1XV8A 2WNZA 2PTDA 1GRBA 4UTKA 2GGJA 1ZDLA 2PDWA 2YYTA 4RPPA 1ZNNA 4KESA 3L23A 1ZS2A 5C71A 1R3QA 5G5IA 1EA0A 1PAMA 4BI7A 1LBFA 4W9TA 4Y6GA 5HINA 4WD0A 3GVQA 4MDPA 3H7RA 3WMBA 1TV7A 2YA2A 4H2HA 3VZYA 4YCOA 1JCTA 1N60C 3HG2A 3N2CA 3NPUA 1JPDX 1XCXA 1OT1A 2XFFA 3BCFA 1ZCOA 2DORA 1C7SA 2PC8A 3QY8A 3AO0A 1CWYA 4JKMA 2YR1A 4HNOA 4LYKA 4Z08A 1C93A 1EBGA 1PHQA 4IIHA 1A0DA 2EQ8A 1MNZA 1RVGA 3ETRB 3B8UA 3PZUA 4HZ8A 5AKQA 1DQXA 3SN4A 1S5TA 1ZB5A 3ITLA 3VNJA 4DJEC 2VX5A 5HQLA 3LPPA 1BPLB 3I4EA 1UR1A 3NM1A 1LL6A 4GK8A 2GSEA 1TJ2A 4DJFA 2DV0A 3EDKA 3F5KA 4JN8A 2XZ7A 3VGEA 5CC7A 3NDZA 4FDCB 2EHHA 1E0WA 4X9SA 1ZK7A 4AXKA 2CLOA 4Q3MA 3OA3A 5K4XA 3N3TA 3GXIA 4URIA 3JRKA 3UETA 1GK8A 1XD1A 3M0KA 4AF0B 1EJTC 5D02A 3F4VA 1TVLA 4C91A 2VDIA 1GWJA 5DO8A 1RH9A 4Q4MA 2OGJA 3NGFA 1F8MA 1X7IA 2H8XA 5JQ9A 4DB7A 2X8CA 3FYPA 2YL8A 3U57A 2A3HA 2E0PA 1Q7ZA 2Z28A 3SW6A 1AD1A 1K9TA 3WFLA 3W83A 4AHPA 1TJ0A 1PTDA 5H8MA 4X2PA 3E3HA 1T99A 2NXHA 4DAFA 3WK2A 4QJ4B 2WVVA 2PWFA 3H12A 4LB3A 1BQGA 1WDSA 5FF2A 4UTIA 4PGLA 3N1AA 4XZHA 3G24A 2QUTA 2NLYA 3LZ3A 4NVTA 3NQEA 3LMZA 4G7EA 3NL6A 2ISDA 3W1RA 4UQEA 1V0MA 4MJ2A 3LDVA 2PDBA 1HP4A 2GJPA 2WMHA 5KITA 1OJTA 3CEUA 2NT1A 2X05A 1LOSA 3VMNA 2FTYA 1Y7VA 2NVKX 1YQZA 2ACSA 1VB9A 2DEPA 3H2NA 2PU1A 1FEAA 2VWSA 3A5FA 3LPFA 4LEFA 4KWUA 2GDQA 1GHSA 4EPDC 3GX9A 2G0WA 1M3UA 4JEQA 3C0LA 4WY0A 3A7AA 4EKJA 1RM6B 1YMYA 3WF1A 2YZRA 3QF0A 2YZ5A 4CNNA 4HK7A 4PMDA 3SUTA 1YQ2A 4OE7A 1BG4A 4I7WA 4HTYA 3GG7A 3H6OA 1EPVA 2RFGA 2WSKA 3H26A 2ZE3A 3NQAA 5F1VA 1XM3A 2XHYA 1KM0A 1K70A 5F4WA 1KB3A 4C6MA 1DHKA 3NVWB 4KEUA 4NUWA 2VZVA 2OO6A 2Z6IA 1RPXA 3GNNA 1CYGA 2INZA 4U2YA 3MZ2A 1V0NA 4M6VA 2OZ3A 3S2CA 1BSLA 2R82A 3PJWA 4TMCA 3TC6A 3G6LA 3RYSA 1PUDA 4G7EB 4LNYA 4XD6A 4F8XA 4GIYA 4RE2A 2OGYA 1OADA 4S3DA 1JRBA 3MU7A 3R6IA 3VIIA 4JTFA 1GQLA 1DJWA 2RDUA 4IIFA 1YKWA 3NQ6A 3CXOA 4L9YA 1I9CB 3EX6A 3TR2A 4TTUA 1NSJA 1ZTVA 4JS3A 2IPJA 3UVIA 3G0SA 3W6MA 1R46A 2QZRA 4C6KA 1PKLA 4D6GA 4OQVA 5DXXA 4ERGA 3IJ9A 2V30A 1XFCA 4L61A 3S5OA 1B3WA 3EZ4A 3TEVA 1V03A 4IMFA 4GJJA 4BZYA 3F03K 4K7ZA 1ZSXA 3WNOA 4LUYA 3V3WA 2OX1A 4HA1A 3WD3A 4NU7A 3MV11 3FX4A 3KRBA 1DP0A 1VFFA 4ZE4A 3RMJA 3W7LA 3MSRA 1FTXA 2PAJA 2JGYA 3E0VA 1OBAA 1X1OA 3LQGA 3RU6A 3ARXA 4QSHA 4XK2A 2JK6A 3S47A 5F2GA 2VENA 3TX9A 3KBWA 4BF7A 1G4SA 1K1DA 1TWWA 2GQ8A 3QR1A 1WZKA 1IR1A 2W55A 5HPCA 3ZFHA 2DZVA 1ADOA 1IXNA 3L66A 3OPSA 3B97A 5A8OA 2D22A 4NAEA 3S1WA 3O3RA 3WL0A 3ABSA 1VFLA 4HIBA 4CVUA 5EMUA 4KGJA 1E0TA 5CZJA 2OG9A 2YOCA 2QUMA 3MSDA 4L64A 2FPTA 1JDFA 4NI8A 1FWCC 2HTMA 2FKPA 3SGGA 4Q4PA 1OCJA 3LNMA 3N3MA 5D8ZA 3JVAA 5CH9A 4Q33A 3PJXA 1TCDA 4U3CA 4AD3A 1UUMA 2OYKA 1UW9A 3C2VA 2QDDA 1RR2A 1G7VA 4REQA 1ZAIA 1YTDA 2Y62A 1FFQA 1OYCA 4R85A 5BOEA 3O07A 3P67A 3W71A 2H6RA 1QPQA 3VNZA 3F4CA 1NJJA 2ZXQA 3L5OA 4GGHA 4U2ZA 2PDHA 4S23A 4Q7NA 4GNKB 1M53A 1X6UA 1V77A 2PDYA 1M9HA 5FL1A 3BW3A 5GRTA 4NJJA 1MQPA 5I00A 1U5JA 4DEFA 3LRKA 2VZOA 1B31A 1CTNA 2FB3A 2QCLA 4X22A 1STZA 4LAUA 4D6HA 5I24A 1GYMA 3K5XA 2Q8ZA 4IMEA 3SY5A 1JDDA 1KRCC 4I6KA 4PTVA 4NAEB 2GGEA 1KM3A 2NQZA 4OOUA 1EBDA 3DFPA 5H8UA 3DGZA 5CCZA 4XAZA 2P1FA 2G4FA 3VM7A 2XSXA 2NZLA 5D33A 4K36A 1XIHA 3B0PA 3O6DA 1G7UA 4DJEA 2ZX5A 5FEWA 4RKAA 4K39A 5AZ1A 3DOPA 2XIMA 3VNIA 1B9BA 2BGNE 3FJNA 1W54A 3B8DA 4TX8A 2BP1A 1TV4A 4QR6A 4C6CA 3EYPA 4FS9A 4V1YA 3OOQA 3O06A 4GG9A 2QAFA 3GXNA 2CETA 3WUBA 5ABGA 4TVCA 3REQB 1E9LA 1QFEA 4A29A 3AMDA 3VINA 3GHRA 4A4AA 1U5VA 4RUBA 2VMFA 1GQNA 1TV3A 3P0XA 3R10A 5TBOA 3EMCA 1Q2SA 3GZAA 1C8XA 1MEWA 4AYSA 1WNOA 4IL2A 3M0ZA 1L8PA 4F0SA 3O6YX 9RUBA 4PODA 3H8AA 1FWIC 4FXSA 1I0BA 3WEMA 1V3LA 1PO9A 4ATWA 1R0MA 3OW1A 3WH8A 3GRTA 3M0HA 1IEQA 3KVJA 3PNUA 2OKOA 1Z3NA 2XVNA 2OEMA 2BXVA 2DJXA 3F4DA 1QTWA 6PTDA 1JCXA 1J0HA 3MWAA 1DYSA 3LLXA 5KETA 4ENLA 5DN1A 5T9BG 4FF5A 1EJUC 4RW3A 2DIJA 7XIMA 4ZQCA 2BFGA 5A95A 1TV5A 4GUGA 3A4JA 2WSQA 3U2EA 1U2YA 1YDVA 2PWEA 1UWIA 1M6JA 3FYYA 3VDHA 1E4LA 3QPZA 3WQWA 2X09A 4MFDA 1F76A 1W37A 4IGNA 1DWFM 1DIDA 4ZQOA 3WBAA 1JRPA 1TPB1 3W2UA 4ZENA 2YB4A 2XIOA 1LG1A 4RW5A 1YIXA 2BVYA 2Q71A 4NP7A 1L8NA 4FX9A 4C1NB 3QY6A 3WH5A 8CGTA 3ZYZA 1LOQA 4WGHA 3IJLA 3OGVA 1B90A 1A3WA 4LCRA 2XM1A 3BSMA 4EQWA 4I7UA 4QE5A 3KOZA 2BOEX 1JD9A 3CHEA 3RJXA 4LB4A 4DZIA 3FSTA 4JYEA 1XDJA 3W2MA 5HNTA 4XKYB 8A3HA 1JNDA 4C6LA 1W1PA 3R8GA 1R9XA 1X6LA 1VFTA 1V3JA 4Z42C 2GGHA 1TPWA 1I8JA 3V5OA 3MP3A 1PX8A 4ZL1A 3PNZA 3PTDA 1IZJA 4ZGYA 4OVXA 3HFYA 3GUWA 3WQ8A 5FL0A 1DV7A 1TA3A 2VZSA 5ABHA 3NZGA 1UASA 2PGEA 1F74A 4X61A 2ESCA 2HCVA 1EGMA 4IQDA 3LYEA 1OGGA 4XIAA 1UWTA 2X50A 2WOVA 2ZQ0A 3USBA 3QPYA 1W2VA 3WBYA 3EOEA 1TPUA 2ZA1A 2Z2BA 1WCGA 3NXLA 4GX8A 4I3GA 4ILSA 5EBKA 4RV8A 3VCCA 3MS8A 4EXQA 4F40A 4J35A 1IGWA 1XRVA 1J96A 1LTDA 2ZVIA 2SFPA 3QGKC 3L4ZA 5G2WA 3VGGA 5CZ0A 5DMNA 2EXOA 1EOKA 3JW7A 3W7HA 4PMYA 4IMAA 3SECA 4XVEA 4CLMA 4Z2JA 1QAPA 3CZEA 1NP0A 3W72A 2XJ7A 5LHFA 3EOOA 4UIOA 2ZKMX 1P6BA 1SR0A 1F3WA 3PPFA 3GTNA 4S2BA 1GVRA 2GPTA 1FCBA 1JZ7A 1L0PA 3EUB3 1J8VA 3PG6A 2FZ8A 2IMRA 3H54A 4K7YA 5CJMA 4PBFA 3IIVA 4MM1A 3UJ2A 3N15A 5BNKA 2QAEA 1XIBA 1Z7AA 1Y65A 4U5KA 1FIQB 5CZKA 3A7UA 3T0AA 4PEKA 4PEEA 5J5DA 2UBPC 2ISVA 1Z41A 3WLTA 1WPCA 2WZMA 1DWAM 1BRLA 1CXKA 4LNCA 2B31A 3RCNA 2X41A 3FXGA 2VR2A 1Y8BA 4CNUA 4XKMA 4IQJA 2J78A 2C1IA 3KW3A 1VFHA 1A5BA 1JL8A 3K30A 1TTPA 1WO2A 4NI3A 2GQWA 4E0CA 2A85A 3B9DA 3MJYA 3F5JA 2CBVA 2HISA 3WDQA 1IR2A 3OODA 4N4PA 2BY1A 2ALRA 1XLEA 1A5MC 1X97A 2KZHA 1SSGA 5E0FA 3TE9A 4PR4A 4DBDA 4JNMA 1CGVA 3M46A 4HOWA 1TMHA 4QGCA 4LRSA 1S1PA 2ZVRA 3K8KA 1W9UA 1VYRA 3P8JA 3FVDA 1UUOA 5M1TA 4YHEA 1FHUA 1LRNA 1A47A 2XUCA 4LALA 1XYCA 2I7GA 3N2BA 1O4UA 4AD4A 1JUBA 4F0LA 1A4LA 3G2GA 4N9CA 1QUMA 3W7KA 5CPNA 5GJPA 3C2EA 1KBBA 1RV8A 1B5TA 1QRQA 3GR4A 1XLGA 3LNPA 3U5YA 1FWBC 4IP7A 3MPGA 4O18A 3H22A 3P5ZA 4PC8A 2DPEA 1HQTA 1JQVA 3OIHA 3L8KA 1XRFA 2FIQA 1EJVC 4KWWA 4QISA 4MZYA 3WL1A 3UY8A 3MZNA 3DH7A 2J79A 1US3A 3AYSA 1B4EA 2VR5A 3GVRA 3D6NA 4R53A 3DK8A 4Q8WA 3FEMA 5CG7A 2J7GA 4AY8A 4GINA 2AL1A 2J7BA 2HV5A 4JIIX 1Q6EA 1XSIA 1OGBA 4O57A 4YU1A 1XYFA 3VGFA 4BR1A 5CG0A 1ME8A 3T44A 1QASA 3A6OA 4EWJA 2W3ZA 1UD2A 1V4YA 3MSGA 1UR3M 2H3BA 4F0MA 4J3SA 1C7TA 1V3HA 1B3VA 3ZR6A 1J0KA 3O7UA 5DLCA 3GU9A 3AWOA 4H1ZA 3J7HA 2GL5A 1EL3A 1ZP4A 5LA1A 2F5ZA 3VAVA 4QQUA 3T2QA 4NJIA 1R3RA 3R79A 5CC5A 3IJIA 3ANVA 4ZODA 1TCMA 3V18A 2CPUA 2EPMX 5KZDA 4L5ZA 1X7FA 2XINA 2QGYA 3DG7A 4GZ7A 3ELFA 3NJ3A 1KW1A 1BZLA 1EYWA 1F3TA 3U7BA 4CD4A 2RABA 4H6RA 2RGMA 4PZVA 2AOSA 2J25A 3RHGA 5BXSA 2J47A 1VEOA 2VCCA 4AYGA 4B2DA 3W7EA 1E6ZA 5ABFB 4WOZA 4CCDA 4IWWA 2REQA 1JAKA 1E0VA 4H7ZA 1QHOA 3FA3A 4NNBA 1JF5A 4J5NA 3E96A 2AMGA 1R9ZA 1TQXA 4J7RA 2E40A 1AQFA 3NEHA 4KWVA 2E09A 3ATYA 3HPSA 3VKAA 4Q8PA 5IFTA 1MDLA 4F9JA 3UZ5A 3IWPA 4QAIA 4Y9OA 1MDRA 2ISSA 3W7MA 3KL5A 5EL1A 3W2LA 4RE0A 1UP0A 2H9AA 5I09A 3DCPA 2QYGA 3MP4A 3OU8A 4AMAA 4F2UA 1W2PA 4AEOA 4JBRA 1F4AA 2WZIA 3LGGA 4UQCA 4HU4A 3IV8A 1G4PA 3UA4A 5C8BB 3V36A 3MUAA 1FHLA 2FZMA 3B0YA 3LBOA 5C2XA 1DWIM 3AALA 3TSBA 1CXFA 5AHMA 1LWJA 1O5RA 4F4RA 1Q3NA 4NX5A 4HVXA 5A6SA 1U22A 1GOKA 2CHOA 4GE8A 2CWXA 3N29A 2PZ0A 1HP5A 3P5YA 4G9PA 1KBIA 3WJWA 2CFYA 3CV1A 2XTKA 1SJDA 3OA5A 4ZSUA 4AD5A 5T26A 4A3RA 3LXDA 1J0YA 5G5GB 1FCQA 4JTEA 3T55A 3T9PA 3TN6A 4QHRA 3TYUA 5LA0A 3H2OA 1K02A 2ATSA 3NDYA 3P0WA 2DQWA 5EFFA 3WH6A 3LCWA 2OQYA 1QPRA 4HYVA 4CNSA 4YXGA 1TKKA 3NZQA 3S1GA 1XLLA 4P61A 3GW0A 2I9EA 4DF2A 4JIQA 5I78A 4JGDA 1KFLA 2W61A 1PZ0A 1GOQA 2YFNA 4MJZA 1JI2A 5FA5A 4BS0A 3OG3A 4JQ3A 4A22A 3WQVA 1PV8A 1XBZA 1U1JA 4MKNA 2V5KA 5F2LA 4RE4A 5M17A 2PBOA 4MAZA 1B3YA 1G94A 2ZA3A 1TPFA 2VFIA 1YXDA 3UT0A 3CUIA 1V59A 4KW2A 3WNLA 1KGXA 2WZEA 3ARUA 4EE9A 3EDJA 2PRLA 4Q6XA 5CGMA 7REQB 4GZEA 3EX2A 2XN1A 1RY0A 3POHA 2IQDA 3WK0A 4ECLA 1W31A 2B7NA 3L0GA 2GSJA 4KWSA 1NHQA 2XH2A 4PTDA 1I45A 1PZ3A 1DJHA 1R87A 4IIEA 5LGZA 1YDOA 1H2JA 3TSDA 4DUOA 3QGAC 4Z0SA 2VD9A 3BANA 3K13A 3SRKA 2XFYA 3CUJA 1M7PA 2A6LA 4WR3A 3KVKA 1XLDA 2FB2A 3TZNA 1EB3A 4MYAA 3A23A 3I65A 2GSHA 2FDSA 2X8RA 3HMCA 1JUKA 1BFNA 3NQGA 2YXXA 4FK9A 2NVDA 4ZEPA 1BWCA 1K8YA 1ZCCA 2WOQA 3S6DA 2Z6JA 4O4VA 1EO7A 4MNLA 4MWAD 4QP0A 4ZO8A 4WXZA 4M6UA 3IVTA 1CGTA 3TC3A 3ISIX 3LXAA 2XIJA 4C65A 1HKJA 2OEJA 4IG2A 3WUGA 5A3HA 4CVWA 5D37A 2YDQA 1FHVA 1X1NA 3PTMA 2YCLA 1E1CB 4KCVA 1VYPX 3UZJA 4M51A 1B3XA 3BW2A 1XLIA 3L9CA 1AD4A 4AW7A 3BG5A 1UIPA 5EGRA 2ICSA 1XIMA 1H60A 4TVDA 3SURA 4R5EA 1H6VA 3EWUA 4LC8A 2CBUA 3CIWA 4D1IA 1GZ1A 8RUCA 2C7FA 2QAPA 1VRXA 3MMDA 5AC6A 3W74A 1ZMDA 4PMQA 1TB3A 4D6CA 3KL3A 4DO4A 1VEPA 3W88A 4ZA0A 3LSCA 3IUDA 2CU0A 3QW3A 5BROA 1AH3A 3AAMA 5DFAA 1SPQA 3RCMA 1VGAA 5CPLA 3C5QA 4L7ZA 1J6OA 3CUFA 4GI9A 5AC4A 1UZ4A 2BHZA 4BCEA 1E0UA 3SCUA 5JRBA 4A8LA 4QS6A 3VD9A 2ALDA 4DJFD 1QCWA 2BBFA 2C79A 4KEVA 2QUNA 1W5PA 1ISVA 1TWDA 2HVNA 3OVQA 4TTGA 1PYMA 3GNDA 2HPMA 3QFAA 1SSDA 4JQ4A 1E71M 1PEZA 2OOGA 1JYVA 4U4MA 3CGDA 3PUEA 1YXCA 1FRBA 2Y63A 3W1XA 2PDNA 4MJMA 2R14A 3FDGA 1ZZMA 1TJPA 2HBXA 3URHA 5BRPA 4QDMA 1OABA 2WOWA 2G3IA 1UKOA 3UJSA 5M03A 3UWQA 1UCWA 4Z1AA 1HJWA 4IGSA 4MNKA 4DWSC 1J12A 4JFTA 2BMBA 4LH8A 2C3DA 1VR6A 2YBVA 2DDXA 4HN8A 5BZAA 2Y2WA 5FS6A 3R94A 1GG0A 2GOKA 4A2SA 2OWCA 2D24A 5C0QA 3TLLA 5LNVA 4GO8A 3FDKA 3WLKX 3CAKA 1UH2A 4V1XA 3IANA 4UTMA 2OZ0A 4PMUA 5EMJA 5JCNA 4R7OA 3URQA 3NGJA 1QK2A 1H41A 4NJKA 3VIHA 2Q3RA 4X0NA 2GUBA 1QWGA 4V33A 1K8CA 4FA3A 1JYWA 2OJPA 3WQDA 1VH7A 2NV9A 3W70A 1LORA 3OZPA 3AIWA 3TCEA 5EY5A 3AZRA 1TX2A 4OUIA 1C90A 2D0FA 3ERPA 3RG6A 3NVDA 1KBLA 3W76A 2V6AA 4UFLA 2CNCA 3WLIA 1R3VA 4O1EA 3QXBA 1W5OA 1HZYA 4O12A 1XDIA 3VOIA 2ISFA 4Z1YA 3LCHA 1EWDA 3GAYA 2OFJA 4J9JA 3D46A 1XCWA 3S9YA 3ITYA 3B8IA 5JH2A 3F4NA 5C2GA 2ZX6A 3OLEA 3ZJ8A 4AZ7A 3NNTA 1E3XA 2NUYA 3UPMA 4YYFA 1M1BA 4HU0A 1VRDA 5KTLA 3AROA 2Z2UA 1OD8A 3K8LA 4XTIA 2AQWA 5I2UA 1BKSA 1XBXA 3GBDA 3GUGA 2HVOA 3L65A 5HK4A 2FDMA 1EX5A 1HGWA 4EQXA 4P8UA 4HGXA 4XVDA 2X0HA 1CEOA 4XD5A 3LMYA 3XISA 3M47A 4B4HA 5MF5A 4GLEA 1ECQA 1K4HA 2WPEA 2XFWA 5HDRA 1J2WA 3RJYA 2WP6A 4GC4A 4B5UA 4EXAA 2E5AA 3MMTA 4IP5A 5D04C 4C6DA 2ZXDA 3TC7A 2C6QA 4XV0A 4JL2A 1JYNA 1NHSA 1KM5A 4B91A 4LTSA 4GUJA 9XIMA 5DF0A 4AVNA 2ZZ6A 2J24A 1JYXA 3E0IA 3TOYA 3WQFA 5BMXA 1XWYA 1KXHA 3I6EA 4FSAA 3ABRA 1DXIA 1O12A 4WHBA 1QW8A 1R8LA 1YNYA 3LERA 3V5CA 3HQOA 4RDZA 1V3MA 2QLYA 3K8MA 3AHTA 1PX4A 4NNAA 1TMLA 5CSYA 2YQUA 3SAZA 3URAA 1F3XA 4LV4A 1GTEA 3TQPA 4FLQA 2WM1A 3RR1A 3LHZA 1GHRA 4U3AA 3AXXA 3W1QA 4O1FA 2E9LA 1XHCA 2YJQA 3G0UA 4GISA 1CBGA 1E51A 1LWIA 3FEQA 2VRKA 2X99A 3PSVA 2VVNA 5BMWA 2QF7A 4PCFA 4QSFA 3B8TA 4F48A 3RNDA 4E2OA 3RCYA 1ZY8A 4B92A 5T91A 5A8GA 5CXPA 3K46A 2XH4A 3GVGA 3AI0A 1K8ZA 4GCAA 4FLSA 1Q7QA 4MB5A 4ATDA 2W3SA 1XIJA 2HEJA 4KCWA 1C3FA 4GD0A 3NL3A 3S9IA 2WBKA 1GSNA 4HMDA 3AIEA 5BXTA 1MXGA 5FF4A 3OHIA 1E4IA 4DO6A 1NY1A 3AN1A 5FSDC 4IMDA 4Q4QA 1OFEA 4H4ZA 2ZRZA 2MNRA 4GIEA 5LSMA 4UC5A 1H1YA 2FLIA 3P14A 4RK8A 5H8PA 4LY4A 4K2SA 3OLDA 4IJCA 3VCRA 3AMZA 1MQQA 1L6GA 4JQ2A 3DG3A 4XUGA 2C15A 5BW6A 2WSRA 3KWXA 4EM4A 2GK1B 1OF8A 2AL2A 4YWOA 3T78A 3OTRA 1D3CA 3O0KA 2I14A 5J8LA 3TW7A 1E15A 3QQ1A 3LQLA 4DPPA 3DHUA 4GH1A 4GWEA 1BTCA 1MUCA 1ZAHA 4DLMA 4HHHA 2VO5A 3BLOA 3AMGA 5JIPA 2POTA 1ADSA 2VFFA 4YYCA 3PK7A 3CWOX 1B4KA 3S2LA 4YVVA 3FXYA 3WFZA 1EHAA 3TZFA 2YLAA 2PDGA 3KFTA 3KHJA 3LGDA 1VC4A 1PKNA 4UQAA 5I0DA 1TE1A 4Z2KA 3LTSA 2DZWA 4NXKA 1PHWA 1TRDA 3ARTA 1SZEA 3P93A 3ZZ1A 4GI6A 4FIRA 1Z89A 1MO9A 2WP5A 1TV8A 2ZC8A 2TPRA 1M7JA 1WX0A 1VDVA 3SSJA 3IJDA 3SR7A 1PIFA 4FNRA 1H62A 3VIMA 3R2GA 2D69A 4JDRA 4FX8A 3GNPA 3IJ6A 4LVAA 1DPMA 1PWLA 3A9IA 3IEBA 5M5DA 4ZB0A 3IIXA 3THUA 3S83A 1O60A 2MUCA 3CUXA 3L7RA 2ZZBA 4O0ZA 2O9PA 3S5NA 1UD3A 1ODZA 5MKGA 2A7RA 1DTUA 1E5JA 3UGVA 3CB8A 3QR3A 3ARYA 4HNUA 2GR3A 1ZALA 3CEPA 5AHFA 3MUY1 1Q6DA 4XZLX 3EKGA 2HQAA 5D9MA 1IWBA 3NSNA 1N62C 3TV8A 4A35A 2WMIB 1XRSA 3NCOA 3VYLA 2WKGA 4DWSA 2W6RA 1VEMA 2WB5A 4B3LA 1NDZA 1NM9A 4LBUA 3OBKA 5DRCA 1F2JA 3U48A 1XXXA 1HKWA 1PE1A 2BS9A 1SR9A 5DANA 2Y70A 4EOUA 4JX6A 3S1VA 4M1BA 2VGBA 1W3LA 4Q7IA 1UMLA 3ME3A 2FGLA 3T05A 4JQ1A 3MJMA 1F9CA 1LBLA 2WKLA 4KFOA 1XJBA 1X2GA 3N11A 2VTFA 2XPKA 2QPXA 5LXEA 3ZT6A 3QTGA 1US0A 4M80A 3WDPP 1KBJA 4Q8UA 1JD7A 4BI5A 3R58A 1WXZA 4J56A 4WKHA 4JCMA 1VHNA 1R86A 1KTBA 3WENA 2CXGA 2GRTA 1SW7A 3W22A 3PZMA 2EJ1A 3B4YA 4CKQA 4FNSA 3VNYA 1CXHA 4X60A 3IJ7A 2C1HA 5AN7A 2Q02A 2NQHA 1QW9A 3LBMA 4WDWA 3QW4B 3F2CA 2R91A 4GQ0A 5DBTA 3IAQA 3EKZA 2ZZ5A 3O8AA 1H51A 1LM1A 3I68A 5BWFA 3VOCA 1ZHAA 2I57A 4O17A 3NVVB 4KIEA 1D3HA 3KLKA 1X8FA 3L2IA 2F2HA 1IXQA 2DH2A 1NOFA 4IFOA 1E6QM 2C91A 1XLHA 3IRSA 3SUVA 4ZQPA 3SCVA 1KN0A 1SO5A 2G96A 2GR1A 4DBWA 3PAJA 1IWPA 3N13A 4RNFA 1WQ5A 4M81A 4D9PA 2JE8A 1S2TA 1A5OC 3W7DA 5AHEA 1Y5VA 2R1LA 4Z2GA 2R1MA 1YBQA 2W91A 5XIAA 3TYCA 3NQBA 4W85A 2NPXA 4WK9A 3KHDA 1F3EA 4LGXA 1GV4A 1G67A 4H7VA 3WKZA 2DZAA 3PS7A 1VENA 2QUUA 3CQJA 5HBFA 2XGBA 5A2CA 4C7FA 3KS6A 4AIUA 2GH5A 1TPDA 4P2VA 1O5XA 5I77A 3MHFA 3ZIZA 4Y9AA 2J6XA 3RM8A 3N9RA 2FVMA 2PTXA 3WNNA 3ZVHA 2X16A 1SYTA 2WKJA 3NDOA 1QO2A 4KH2A 2DUZA 5AOUA 3BQ6A 2HBVA 1OZQA 4GRSA 4TVUA 2X2YA 4N02A 5LNWA 2ZA2A 2B81A 2YXOA 4HNCA 1ICPA 4ZQNA 2A4AA 3CAWA 1MYRA 1IT8A 4R7WA 4LIIA 4NHVA 2PMQA 1V97A 4E2DA 3UD6A 3BOLA 2ONEA 2PDKA 4CEUC 5GVJA 4FX6M 3S2JA 4AY7A 3DFSA 1XIIA 2FVKA 3L5LA 2GDVA 1S3HA 1V08A 1O95A 2ZXBA 1LVLA 5AC5A 1TG7A 4PA8A 4H04A 1CLXA 1YBQB 3WD2A 2Q8XA 2R94A 4D6IA 5BWAA 2FJKA 2PP0A 4JR5A 1AUSL 2G97A 1IEIA 3NSMA 2X8GA 1WXYA 4EANA 5JH1A 2DVTA 3BO9A 1NEYA 4PN2A 2Z1BA 1A80A 3GVVA 3EF6A 3U6WA 1G4EA 3TFCA 8XIMA 2PP3A 2QNEA 1O7AA 2TMDA 4JICA 4QRNA 1X39A 4A3HA 1JPHA 5A1AA 3B03A 5K9DA 4WLCA 1GQJA 4GHRA 2YX0A 1FUYA 2HNHA 2J9XA 1ZJBA 4HZMA 3RITA 3NZPA 3UXKA 1OX4A 2J75A 4HK6A 4GX9A 1VJIA 4C7DA 1LP6A 1F3PA 3ONBA 3UWWA 1PKMA 1Q13A 3WLMA 3LB8A 2C71A 3A3WA 3RIKA 3BAXA 1KXVA 4P5UA 3I7RA 4UR9A 4FB7A 3WBWA 1EXPA 3TSMA 4PB5A 1AFSA 3KE0A 4AZCA 5HMEA 4MPQA 4IJBA 1OFAA 1W1IE 3VX1A 4JHOA 4NRRA 1L6WA 5H2ZA 2OSXA 1IF2A 1J0IA 1UOKA 3AYRA 4QDPA 2VX6A 3OVGA 2OOFA 3QFEA 3NQ7A 4QG9A 5DT7A 3C2OA 3UYIA 4KKXA 4H8HA 5A8MA 4FO4A 1H7WA 1UR2A 1QNVA 3PFRA 4QDWA 3DN5A 3AQUA 4H4WA 1KA9F 2I5QA 5U25A 2DVUA 2YA1A 3CL7A 2WO5A 1JZ3A 4J3WA 2ADAA 1AZ2A 1QWKA 1EOMA 1IYXA 1DWGM 3MYOA 3VOGA 3A4WA 1Z8AA 5LNUA 3CHCA 1US2A 4HBKA 1AQ0A 3N34A 4TX6A 1P0EA 3CYJA 2OWWA 2HSAA 4H4PA 3RX2A 2YFOA 3FHAA 2Y8UA 3RAOA 3S6TA 3HV8A 4B5VA 1OX6A 2PBGA 3DI0A 4NILA 1DQWA 1EGVA 1LUCB 5LNSA 1AG1O 2AAMA 3NQVA 5GJMA 2WVSA 3QMTA 4UOJA 1JF6A 3WF0A 2YCEA 3DESA 1F6PA 3WNPA 2J74A 4GQRA 3RNMA 1IIGA 1MW3A 3FAXA 1XGZA 1NVMA 3BK0A 1ENUA 4GXPA 3RF9A 3HPXA 4H8NA 3SGUA 4QLKA 1C29A 3F1QA 3LBCA 1CB7B 5FJRA 3Q58A 5D9OA 3LCGA 4YS1A 3S46A 1DVJA 1MUMA 1A5LC 3M43A 2QDEA 2HRWA 4KEZA 1YDYA 3B04A 4AD2A 3CT2A 3WMCA 3HA1A 1QT1A 5C70A 2OODA 5FSEC 1LQ2A 3LXCA 3BDKA 3EX4A 4RXFA 3M0LA 4GPNA 3H7VA 3ARQA 2Z4GA 1DWJM 4LWWA 3L0KA 1EA9C 3WLQA 5T8GA 1W5QA 2YBTA 2J8TA 4B2DD 4MADA 3HV9A 1M6IA 1RCXB 3R0UA 3WLOA 3G1AA 2VEKA 3BOXA 4UCGA 3NS1B 3QEZA 4NYYA 3MKVA 2XYLA 4MFEA 4LX4A 3M6DA 4M1RA 3URNA 1P0BA 1U33A 3N12A 1E3ZA 3CQHA 3M64A 3VOFA 1J10A 3PZTA 2J77A 7ENLA 3PTKA 4CNPA 2XISA 5FIPA 3E0FA 2QCDA 2YDAA 1W8SA 4AWEA 1B30A 5AVNA 2QCHA 1AL8A 4N6FA 3KRZA 1FWGC 1HO4A 1E9ZB 1BD0A 5TNVA 1JFHA 3CTTA 3PAOA 3ZWSA 3A4XA 3CM4A 5A6LA 4DM1A 3M5YA 5BU9A 4DVOA 3QOKA 1P0NA 3GHUA 3VD3A 3QV6A 1KFWA 1S1RA 5F2IA 1I75A 3BWWA 3LXBA 4DHGA 2ZWZA 1CXLA 3JUGA 2VEFA 1VYSX 5I7GA 3BLIA 4HHLA 1CT5A 3RLHA 3TAOA 1W3KA 2Y7FA 1RA0A 1CENA 3BLKA 4XSLA 3RLVA 2C16A 4ACYA 1QI3A 4Q4RA 3WQCA 1HKKA 4RLIA 4HNLA 2IUZA 3BSHA 2DT3A 2RJHA 3HN3A 1J79A 1EEXA 3HJEA