3RCYA

Crystal structure of mandelate racemase/muconate lactonizing enzyme-like protein from roseovarius sp. tm1035
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
396
structure length
396
Chain Sequence
VKLRDLDIIVTAPPAPGWGGRYWILVKLTTDDGITGWGECYAASVGPEAMRAVIEDVFARHMEGENPENIELMFRRVYSSGFTQRPDLTAIGAFSGLEIACWDILGKARGRPVWALLGGKMNPRIRAYTYLYPLPHHPITPFWTSADMAAESAADCVARGYTAVKFDPAGPYTLRGGHMPAMTDISLSVEFCRKIRAAVGDKADLLFGTHGQFTTAGAIRLGQAIEPYSPLWYEEPVPPDNVGAMAQVARAVRIPVATGERLTTKAEFAPVLREGAAAILQPALGRAGGIWEMKKVAAMAEVYNAQMAPHLYAGPVEWAANVHFAASIPNILMCESIETPFHDALIKGSIRVEGGYITPPEAPGLGIEVDEALARANPYHGTGLHLEMQEASCDYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme-like protein
publication title CRYSTAL STRUCTURE OF Mandelate racemase/muconate lactonizing enzyme-like protein from Roseovarius sp. TM1035
rcsb
source organism Roseovarius sp. tm1035
molecule tags Isomerase
total genus 138
structure length 396
sequence length 396
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rcyA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rcyA01
3Q4DA 4K2SA 2QJJA 3ZVHA 2PCEA 2PGWA 3N4EA 2I5QA 2PODA 3GD6A 4DHGA 3GC2A 2PU1A 3UXKA 3DEQA 3V4BA 3NZGA 4HN8A 4EWJA 3OTRA 3H70A 1P48A 1TZZA 1NU5A 3JVAA 3FV9A 3N6JA 3CXOA 3ES8A 4K8GA 3FJ4A 3MUCA 3MWCA 1BQGA 3UCCA 3UJEA 4HCDA 2XH7A 2QVHA 3Q45A 1FHVA 2FYMA 3DIPA 1WUFA 1ECQA 3QN3A 2RDXA 4IL2A 2PP0A 3IJQA 4ENLA 4F4RA 3ENLA 4E4UA 5ENLA 4ROPA 4A35A 3H7VA 5FJRA 4M6UA 2OO6A 2HNEA 3QPEA 3VA8A 4J1OA 3UJ2A 2OX4A 2OVLA 3CYJA 2AL1A 3MSYA 4HNCA 3OW1A 2QGYA 3PWGA 2NQLA 2QDDA 1R6WA 3V5CA 2GGEA 2XH0A 3EEZA 2OKTA 3V3WA 3R10A 4E8GA 3MZNA 2AKZA 2PA6A 4X2PA 2PU0A 3TQPA 3CT2A 4GGBA 1KCZA 3PFRA 1PDYA 1KKRA 2P88A 3DG7A 3OZMA 4HCLA 2O56A 4E4FA 3FXGA 2FKPA 1XS2A 3GY1A 2OFJA 4A3RA 2QDEA 4KT2A 5BOFA 3R0UA 4IP4A 3SBFA 2XSXA 2OLAA 3T6CA 3DG3A 3RO6A 4GIRA 1EC8A 3U4FA 2HZGA 4H83A 4A6GA 4E5TA 3ZVHB 1R0MA 2PP3A 3H12A 4Z17A 2PTZA 1EBHA 2P3ZA 2GSHA 1JDFA 4KPLA 2CHRA 3TTEA 1P43A 5FJUA 3S5SA 1MRAA 4DX3A 3UJRA 1L8PA 1KKOA 3SN4A 3VCCA 4IHCA 3I6EA 1EC7A 4HPNA 3IK4A 2PTXA 4ZA0A 3UXLA 4G7FA 1OEPA 3FYYA 4KWSA 4HYRA 4DXKA 3VDGA 3TOYA 3I6TA 3JW7A 2MUCA 4DWDA 7ENLA 1RVKA 3SJNA 3QTPA 3OZYA 3B97A 4J3ZA 3VC5A 3IJIA 4H2HA 3R0KA 3R1ZA 4ZCWA 2P0IA 3P0WA 2ZADA 2XH4A 3DDMA 4DN1A 4IZGA 2QJNA 3EKGA 3UGVA 3CK5A 4HCHA 1MNSA 3T4WA 3VC6A 1FHUA 2XH2A 1W6TA 6ENLA 2GGJA 3U9IA 4FP1A 1PDZA 3RRAA 3SSZA 3ZLFA 2PS2A 3DFYA 3H8AA 2GGGA 3VFCA 3QKEA 3TWBA 1NELA 1JPDX 2GL5A 1E9IA 3S47A 4G8TA 3ZVIA 4KEMA 1TKKA 3KUMA 3FVDA 4H19A 4M0XA 3DGBA 3TJIA 3N4FA 3VCNA 4MMWA 3UJFA 1JCTA 2PP1A 2HXUA 1F9CA 5IDZA 5J04A 3V5FA 1XPYA 3MQTA 3NO1A 2POZA 4K1WA 2PGEA 4GFIA 2PSNA 1EBGA 2AKMA 3BOXA 1IYXA 1SJCA 3RCYA 4IP5A 4MKSA 2PTYA 2GDQA 2ONEA 5FJTA 1SJBA 2QQ6A 2OZ3A 2GGIA 3D47A 1BKHA 4IL0A 2OG9A 1KD0A 5FJPA 4DYEA 5FJOA 1WUEA 4HNLA 1DTNA 1EC9A 3JZUA 3CAWA 4JN7A 4E6MA 1JPMA 4GMEA 3TW9A 3K1GA 3THUA 3PK7A 3OP2A 1ELSA 3MKCA 2MNRA 2QJMA 3I4KA 2PTWA 4GYPA 3UCDA 3ZLGA 3D46A 3P93A 3IJLA 3T8QA 1MDLA 2XGZA 4JN8A 3SN1A 2OZ8A 4FI4A 3DESA 3GO2A 4MGGA 3RR1A 3MY9A 2DW7A 1MDRA 3DG6A 2PMQA 1SJDA 2HXTA 3TJ4A 3P3BA 3R11A 3ES7A 3FCPA 2GGHA 3ZLHA 3UJSA 1ONEA 1SJAA 2ZC8A 5BOEA 2OZTA 2PPGA 3RITA 3N6HA 1MUCA 4GISA 3BJSA 4IT1A 3T9PA 3DERA 4YWSA 2OPJA 3OPSA 2AL2A 3SN0A 3NXLA 3BSMA 3RGTA 2P8BA 5EU9A 3PWIA 2OQHA 3HPFA 4GGHA 4JHMA 2AL2B 4GYPC 1TE6A 4H1ZA 3STPA 3TWAA 3CB3A 3SQSA 3QLDA 4Z1YA 2DW6A 3NFUA 3R25A 3DFHA 3TCSA 2P8CA 2OQYA 1YEYA
chains in the Genus database with same CATH superfamily
1DHKA 3MMWA 4AFYA 8RUCA 2AQVA 1AW2A 1RH9A 4IF2A 2OOGA 2PDNA 3APYA 4AW7A 3A12A 2NX1A 2Y5JA 2VWTA 3AYTA 3KZSA 2I56A 4NXSA 5DY2A 2W4XA 1DEDA 4IMEA 4HHHA 3QQ1A 4WVXA 1J96A 2NPXA 4FALA 4JBRA 5HATA 3TN4A 3CXOA 3PPGA 3GVQA 3PAJA 3FJ4A 5AHNA 1H49A 4JDYA 4U31A 4HNOA 4H8VA 4M51A 2W79A 2FYMA 4X3ZA 1HW6A 1VPQA 3GH7A 5AKQA 2NV9A 3R79A 3AXXA 2PP0A 2DT0A 2W3ZA 1NF0A 1HL2A 2DZVA 2JIWA 4BCEA 1GOQA 1LQAA 5ENLA 2PGFA 1RD5A 1E6SM 5E0KA 5B7YA 3EB2A 2OO6A 1N5XA 4GY7A 3H54A 4B5SA 5D32A 4LPCA 4I7VA 1LBMA 4CLMA 3V35A 4JFVA 3Q6JA 3V3WA 2ZX6A 1BRLA 3NA8A 2QCMA 4BQ5A 1ISVA 1PZ0A 3VIJA 3W00A 3CH9A 1DWHM 3ERPA 4UTIA 1SO5A 2VGIA 3BLDA 3G0SA 1IIGA 4XZLX 1Y7VA 3ZJKA 3GVRA 2PU0A 4NUWA 2CZEA 3W6LA 2UY5A 3C6CA 1V6WA 4GQGA 4LRTA 2WAGA 4BWLA 4UQCA 1X98A 1AL7A 1XS2A 4S3CA 5EMJA 4MHBA 1H63A 2E6YA 3OBKA 4R9OA 1VFMA 3N4AA 3SGZA 4DBDA 4ZO6A 3ZS4A 3M0IA 3H2AA 8A3HA 4JIRA 3GW3A 4P7RA 3CXBA 4UCFA 2J25A 1X6LA 3U57A 5CCZA 4A05A 2CLMA 2CLIA 3LXBA 3NZPA 2DUAA 1GEHA 4LS1A 1XICA 4JFUA 1H0IA 3C2FA 2WPFA 1V6XA 1XLAA 4IGNA 2QJIA 3PZUA 3STEA 2PDBA 4O13A 4DX3A 4XUYA 4V1YA 1NWTA 2BHUA 1VRDA 2XVPA 1QCWA 5D30A 2VELA 4NJIA 2GUUA 4UOZA 2EPMX 2GWGA 4KEVA 1H0GA 3WFAA 3PUDA 5HMEA 3GC4A 3II1A 3BCDA 1GHRA 3UT0A 1U83A 4XSLA 1MVYA 3KWSA 3EA3A 3OB8A 3W72A 4R7OA 5HINA 2ZQ0A 1K3UA 3FJLA 3O3RA 4YJ5A 4D8LA 1O1ZA 2Q09A 3MT1A 1OZMA 1CI1A 3N3MA 3VMNA 3WK0A 2PDHA 3FA4A 1XWYA 2WANA 5LA0A 3RK8A 4QX4A 4NJKA 4EIVA 3KOYA 1YPXA 5A6MA 5JVLA 3R5EA 2B81A 2OB3A 3LK6A 2BX7A 1LTDA 5DQPA 2NVAA 1ME8A 1RV8A 1TX2A 1W5OA 1WDRA 4RW3A 1KGUA 1TA3B 3DZ1A 1V3JA 4C6OA 1TIWA 2GSJA 1HKKA 1V93A 2PUZA 1SPQA 3CL6A 4IFRA 3TYDA 2GL5A 1W32A 3UXIA 5ABEA 3LHUA 2WYSA 1A5CA 1TKKA 4AD5A 3Q67A 1CTNA 5HUPA 5AECA 4ZR8A 1GW9A 2VRJA 1S1RA 5IDZA 4YCOA 3LPOA 1B3YA 5HPOA 3W1AA 4YVPA 3R4IA 3G6LA 1J10A 3LHVA 3NAVA 1UKQA 1VIWA 3K4WA 4RK8A 4AHOA 2WMKA 4C6MA 2F8QA 4S2CA 1J18A 1SU5A 4KMQA 2PTYA 4IQDA 1JD7A 3SCWA 5GNYA 4LOCA 4DJEA 3SAZA 2CFYA 2I5IA 1PKMA 4GH3A 1UUMA 1CGYA 4YYFA 4J27A 1Z6KA 1SB3B 3CAWA 1BYBA 5LGXA 1J0YA 3A4WA 2NQZA 2OJPA 2O9OA 4LU0A 3A7RA 1OCJA 3PK7A 3TV8A 2YXOA 1EHAA 3CMJA 2ZTJA 3EZ4A 1XBZA 5T8GA 1XBVA 1MSSA 3VNKA 1QPKA 3PTKA 3ZLGA 3AIWA 3S0CA 3DFTA 3Q94A 3P93A 4QLKA 4MNLA 4MPKA 6TAAA 3WBWA 4TVWA 3KL3A 4DI9A 3DHPA 3CQ0A 2ODOA 3F4CA 1Y5WA 2PZ0A 1XLKA 2V5CA 3A24A 5K9DA 3S4TA 2DZTA 1I75A 1W91A 3H7RA 1GZGA 3EDEA 4ECLA 1XDMA 2ZOXA 1AZ2A 3BICA 4LA1A 3PZIA 1J0HA 3BCFA 1AJ2A 2DGAA 1NWSA 4IIFA 2V68A 4HOXA 3AC0A 1EF3A 1FH8A 1V0NA 3HW2A 1G0CA 3KLJA 4LSBA 3C3NA 1J12A 1RCXB 4BF9A 4PB3A 5G1YA 4O1FA 4B9YA 1FBAA 4DUOA 2P8BA 2A5HA 4JXCA 3COTA 2O0TA 1HFBA 1H5VA 4XIMA 6ALDA 2WXDM 3ARSA 2QAFA 4Q8OA 3TWAA 4UC5A 4RZBA 3TSDA 3QLDA 5CSSA 1XYAA 1H1NA 3NFUA 4IMAA 1Z8AA 1VKFA 3OVRA 2CBIA 4IFOA 5EA9A 4RCXA 2XN0A 2V67A 2ANUA 2E6FA 4H6RA 2PU1A 2ZZ6A 2E09A 1CGTA 3KVLA 3V4BA 5DO8A 5EMMA 2HMCA 3CZGA 3ABZA 3ZJ6A 3LADA 1DBTA 1VPYA 2G4JA 4Z2IA 4HMDA 4BK9A 5E9XA 3TNBA 3JVAA 1ISYA 1MXDA 1J0IA 4EVZA 3W01A 3CHFA 2PBGA 2J4GA 1QO2A 3MP3A 4BI6A 2WSRA 5J5DA 2FTYA 1DWAM 1BQGA 1V02A 3W6MA 1W54A 2HVOA 1TPDA 1XGDA 4BR1A 3DIPA 4ZBCA 5A8OA 2FGBA 3B9NA 1KFLA 3RJXA 5DMYA 3FDKA 1UBPC 4G5DA 4IG2A 4E8CA 3R8RA 4BQ2A 3WD3A 1VIZA 1E0UA 4Z1AA 2HNEA 3VA8A 1SYTA 3IRDA 5L9FA 1UD6A 1TFVA 2WBKA 1JZ6A 4LBRA 5C2CA 4RNIA 2O7QA 1W5PA 4EF9A 1YW1A 2FGLA 2B4GA 3WQ6A 5AZ0A 3W7GA 1JRBA 3WH7A 1DWJM 3V5OA 3WLKX 3DFPA 4E3VA 4H9ZA 4KERA 1VFTA 4PULA 3EMZA 3VGHA 4Z2KA 3T7VA 4M7SA 2EGZA 1KQYA 4WSHA 3UW6A 4AZBA 3FXGA 1PX4A 2HWGA 5CBJA 1OG6A 3GNDA 4BZYA 3W7MA 2WM1A 2YFNA 1POJA 5D8ZA 4ZL1A 1V0LA 2CZ5A 2CCRA 4MJ4A 3WLQA 5E0FA 4QSFA 1FWEC 4ZE4A 3GHUA 4DY1A 4PRTA 3VAVA 3RX2A 3GD3A 2C0HA 1AQHA 3C2RA 2C3CA 3BOLA 3MI6A 1SR0A 3DC8A 2D0HA 3ATYA 4OJYA 3POHA 3STGA 4BURA 2KZHA 2ZZCA 1R3QA 1R87A 1TMHA 2QLYA 1Z89A 3RRXA 1K4QA 4LS2A 3CU2A 4HSOA 4IXXA 3NGJA 3S5SA 4MAZA 1L6WA 4AZIA 4ALDA 1F8IA 4C65A 3VCCA 3AS1A 3T2QA 2TYSA 3EWDA 1PUDA 3WBYA 1WOBA 2D0FA 3IK4A 1H7RA 3LSBA 3PJXA 1S38A 1XH0A 1XHGA 5F2LA 4F0KA 1ZAHA 2BNJA 4KWSA 4O53A 4NG3A 1EP3A 4UMAA 3DHFA 1FX6A 1ZBKA 2NZLA 2YGYA 1V3LA 3EWUA 5G4WA 3PF3A 3SJNA 3W7EA 4YL2A 4H50A 4QXIA 4ADSA 1J5SA 3SUSA 3F4DA 4Z2GA 3WQ8A 1QK2A 5JU6A 3BAIA 2BFGA 3G0UA 4JTDA 4OHQA 3A47A 3SCQA 3CQHA 3SSJA 5EBUA 1IQ8A 3WLHA 2X7WA 4XD6A 2G8ZA 2V5LA 1EQPA 3TIMA 1W6TA 3ATZA 4GC4A 1P6BA 2RH9A 3EOSA 1TPFA 3WMSA 4TIMA 3N11A 2PWEA 3DFYA 3D3AA 1ZKQA 1RQBA 3VNYA 5D02A 2PLCA 4G8TA 1IWAA 3GWQA 3ZVIA 4KEMA 4ES4A 4B5WA 4AZ5A 3TJIA 1HO1A 1ONXA 3IIPA 3BSGA 3SECA 3VCNA 4C5ZA 3MJYA 2YVJA 3AMZA 1KLYA 3I7RA 4U28A 4TU1A 4UIOA 1HL9A 3ZM8A 2Z7KA 3APTA 2QJGA 1K9EA 3MI3A 4K1WA 3GR8A 4LY8A 3MUXA 2WJEA 4Q7IA 2X1UA 1XXXA 5JQ9A 3NVYB 1JYWA 1YNPA 1WDDA 3P84A 3NQAA 5FJPA 3DENA 3IJ9A 3A7AA 2PDGA 4AYGA 4JFSA 5IFPA 2XFRA 4TVYA 2ISWA 1JNEA 3GDTA 4F9JA 5HUOA 4PMJA 3DFQA 2J66A 2ISDA 3L5AA 2QIIA 2GPTA 2AOSA 4FOJA 3N1AA 1XUUA 3W7HA 3BJTA 1MDLA 1EA9C 4LNYA 1VLWA 3V0TA 4FI4A 1OBAA 1E4NA 1YYAA 2HE5A 3SRDA 1TB3A 3OQEA 3KP0A 4H2CA 1Q8JA 1Q6FA 3NQVA 1GYNA 2IQ0A 1UB3A 4RE4A 4XZWA 3MCOA 1MXGA 2OLSA 3S2LA 3ZLHA 3GU9A 3LM3A 5AYYA 1N60C 1AG1O 4HZ6A 3SCSA 2DEPA 3EUB3 4M6PA 1FH7A 2E1WA 3EA2A 1AD1A 3GFYA 3V1PA 3N18A 5KINA 3KRZA 5DCDA 1XLLA 2QHAA 3EXSA 2ZX8A 1GREA 2PE4A 1GYLA 2QCLA 3E2RA 4Q8VA 4ZGYA 2FMNA 3WQFA 4JHOA 1T8QA 1PZ1A 1NF7A 3BK0A 1GCYA 3QW3A 1C92A 3FOKA 3WD2A 3KBNA 4QG8A 4MJZA 4P8WA 4L5ZA 5A2CA 3HN3A 2MANA 1GQJA 4PMVA 4QSHA 2H8XA 3CS2A 3B9AA 5BXSA 3KP1A 3T0AA 1VEMA 4LCQA 3BWWA 4GNVA 3D3FA 1W3IA 1Q7ZA 4WRHA 1J2BA 3MO7A 4B2DD 2G37A 5AHIA 1Z44A 2ICSA 1YXCA 3WJWA 1E4IA 3IIZA 2ZIDA 1W1VA 1HXJA 1N5WC 1O1HA 3G1HA 2Z27A 4I9JA 4ACYA 1JGIA 3VKDA 1WV2A 1M9HA 5FL1A 5K9XA 1KFJA 5C70A 4CD7A 1BXCA 3KM8A 4O14A 5HDRA 4YTRA 1YDOA 1GYMA 1L8NA 3AHZA 4Y8EA 3AWNA 4J28A 2RFGA 1KBIA 1BVWA 2XH7A 3R43A 3ZZ1A 4UTFA 2GR3A 2ATSA 3AXMA 1C3FA 1K03A 4NU7A 4MNMA 4MB5A 3WF3A 4XKYA 4ZZ9A 1KFWA 3WH5A 2TPRA 3Q58A 3P5YA 2G4FA 1TQXA 4W85A 1NTHA 4MZYA 1B2YA 3L0GA 3QOKA 1NARA 2FDMA 3VOGA 5DMLA 3VK5A 3M4HA 1BWVA 4QR6A 4CQBA 3OW1A 3LEPA 3AHXA 1S2WA 4XAGA 3PB2A 3ZO9A 3UG4A 5D9PA 3RJYA 3HPAA 3MHUA 1QI5A 4FXRA 3U2ZA 4MDOA 1BF2A 3LERA 4LAOA 4CGTA 4ZFCA 3MVTA 3WMLA 2V8ZA 2XIJA 4LFYA 4Q8MA 4DI8A 3GB6A 2FKPA 2Q3OA 2X0YA 3GHTA 3UZYA 1KTNA 2HDJA 4H6QA 3BLFA 1WYIA 3O15A 1FCVA 5CAKA 3K46A 3V7PA 4DF2A 1HKMA 3BAWA 3R0DA 4N7QA 5M5DA 5DF0A 3VVGA 4D6HA 3CJPA 4GIRA 4KCTA 3N3TA 2WMFA 3SUWA 1IEIA 1P5BA 3QM3A 4PUDA 4P7LA 1NH6A 1X1ZA 4PFMA 2NXGA 5CPMA 4LT9A 2QKFA 3KOXA 3HQNA 2PTZA 2PWFA 3NUKA 1VFFA 5CSYA 3QJAA 4OV9A 1PWMA 3T42A 4UFLA 1SQ7A 4RNFA 1D7YA 5FJUA 2BC1A 5A8MA 3B8TA 3RMJA 1PEZA 2DSWA 4O0KA 1KFEA 1QI0A 3P61A 1GETA 1ZXIC 3KRUA 3NDYA 2NQHA 1GTHA 1QUMA 2W0HA 2IKHA 4UTUA 4LVBA 2ASHA 2Y8KA 5CC7A 2HK1A 3VDGA 1P0KA 5DBUA 4ONVA 1EWDA 3S2CA 3W71A 3R13A 1VPXA 4GIAA 5DMMA 1TRDA 4FO4A 4FXFA 2H90A 1KCXA 1X6UA 4YU1A 3RLUA 2BOGX 4G1NA 5I3HA 2VYOA 1WX0A 4C6KA 4ZCWA 2P0IA 1B30A 1HKIA 3ARUA 4LVGA 1Y5XA 1C9DA 4GVFA 1QTWA 3NO5A 3QW4B 4JPGA 3VO0A 2F5ZA 2RUSA 1O60A 3CZKA 4Q8NA 1OF6A 3WBEA 3ZJ8A 1SZFA 1TVNA 1OX6A 1YNQA 1B3ZA 1NFBA 2O4MA 4C6EA 3FX4A 3UCQA 4CQ8A 1WZMA 2F6XA 3LRLA 4LALA 1OFBA 4BA0A 2FDSA 4LC6A 4EQXA 3OBEA 1ZLPA 3WL0A 1K02A 4JY9A 1G01A 4F2BA 3DAQA 1N7KA 2PDIA 3TZNA 1E1EA 5D04C 4NZFA 3MMUA 2OWCA 1Q6QA 4QIUA 1TVLA 3DXIA 3AS3A 4EANA 2PLJA 1XSIA 2QIWA 1D8CA 2Y7DA 4LVAA 3B8WA 4MFDA 1LT7A 3BAYA 1XQKA 2WJDA 4F40A 1SR9A 1OK4A 5CZKA 2J6XA 1KRBC 4TQTA 4GC3A 3BOXA 5CZSA 3OC4A 2NLYA 3MUAA 3GRIA 3MPGA 4J7RA 5CC3A 2HNHA 1IT7A 4Z2LA 4WOQA 1XYBA 1GV4A 5EL1A 2CXGA 2OG9A 4N02A 5A6KA 3BMXA 2YLAA 2GFTA 4O50A 5FJOA 1EC9A 4G9PA 1G6CA 3FVMA 2I9EA 3OYXA 2X16A 3QSTA 1HKJA 3S6TA 3RXZA 3H22A 4HU4A 4CD8A 1A3WA 3ZR6A 3NL3A 2ON3A 3SO7A 5D9NA 1IXOA 2EQ6A 1UWIA 1PX8A 3MHGA 1AMYA 1ONWA 3H23A 4R53A 1XF0A 5D9MA 1UD4A 4JN8A 4MUPA 2J24A 3QR0A 1M6IA 4JR5A 2X8RA 3DESA 4CN6A 2I7GA 4IPNB 4NRSA 2DW7A 2F61A 1PIIA 2XWDA 1L6FA 4HNVA 4WLCA 2NXIA 5EB8A 4LX4A 1DKWA 2YVGA 3P6LA 3FYPA 1TJ0A 2VFIA 1ALDA 3E5PA 1Z48A 2QNEA 3GR4A 1SJAA 4JZ5A 1WKDA 4IMCA 2PPGA 5B80A 3DC0A 3YPIA 2PDKA 3BJSA 1QWGA 3POCA 4XWUA 4A4AA 3SN0A 1GOWA 3WQOA 4PRRA 2WJZA 1LYXA 3IAQA 1TTJA 1QNRA 3QZEA 4PCTA 3QBUA 1RBOB 2FZ8A 3N2OA 2OQHA 1P6WA 1HGWA 1WOAA 2DU2A 4US6A 3UWWA 5LXEA 1OFRA 1IR2A 4O52A 1WBHA 3TLQA 4MWAD 1YTEA 4QISA 3S1GA 4CCCA 1EXPA 3CM4A 2VM8A 4XX6A 1H51A 5CPLA 2IPGA 2NX3A 4KFPA 3LBCA 4ZOHB 2WHKA 1ZHAA 3AIUA 2O92A 4ATWA 4DJDC 4RJEA 2R6OA 1QVBA 4GZ7A 3GVVA 4WXYA 1H7OA 1ENUA 2TPSA 1DXLA 2YCLB 3EX2A 3EKLA 2O4QA 1HVXA 3BW2A 1UR4A 1W9BM 4UB9A 2WSQA 5IOBA 1ME7A 4O8AA 3RNMA 5C71A 1XH2A 3H70A 3BDKA 4PMQA 4UMBA 5D2TA 4KPRA 1ZBCA 3DBNA 3D0CA 4PTVA 4PMOA 2DJXA 3NQ6A 5CPQA 3N6JA 3O16A 3WD0A 2FFIA 2DFAA 1GNXA 1ITXA 1BQCA 2PBOA 3O06A 3RX4A 3LS9A 1V3MA 1X8FA 3LM7A 1XP3A 1XLBA 4IQLA 1UA7A 1XL9A 3UG5A 1EJVC 1W1ZA 1TV8A 2DUZA 4MKNA 4A35A 3H7VA 4XKYB 5G5IA 1JCNA 1V51A 4ADUA 5DN1A 4DXXA 1NDAA 3KRBA 1FWAC 1A5NC 4Q6XA 4EM4A 2VZTA 4PTDA 1W3TA 2WC3A 3WNKA 3IUHA 3LXDA 1T3QC 3N73A 3PZOA 4EMWA 1QPNA 3W4RA 1OC7A 4V2XA 3BAKA 3WY1A 1NDYA 2YDSA 1XG4A 1ZCOA 1VRXA 2J8FA 4HPJA 4E3TA 1E56A 1LQ2A 3DG7A 3OO2A 2VXNA 5LIXX 1NM9A 4XO6A 2ZA1A 3CHDA 1N8IA 3MMDA 4U2YA 3VNIA 1HQTA 1KBJA 4NAFA 1FEAA 3M16A 3HU7A 3FHQA 3I3DA 2GVGA 4C6BA 2GDVA 2VO5A 3OGRA 3WK1A 2VMFA 1YHTA 3VIHA 2NUXA 3SBFA 5KETA 3ZMRA 1PXGA 4JKKA 4DZAA 2HROA 3RO6A 4IJBA 4J3WA 1OCBA 2CDUA 3THDA 2VQTA 1DXFA 3QMSA 1O95A 1QI2A 4N42A 4L4OA 4HMEA 1VBRA 4JNZA 2GJRA 4C6NA 3UU0A 1RD6A 3NPWA 2E1DA 4I7UA 3AIVA 2RDTA 3TTEA 4POCA 3KHDA 3O6YX 1PKLA 2E9LA 1NIUA 3TYAA 4F9DA 3QMRA 3GX9A 1WKFA 3VD7A 1WDSA 3LLXA 3ZJ7A 5HQLA 5A8GA 1ZL1A 2AQWA 2XIIA 1XISA 3HO8A 2WPEA 4LUSB 3VIIA 4WY0A 1HJWA 2BY2A 5A8QA 3W2MA 3LQLA 1Z32X 1JVNA 1I2QA 2JKAA 1A0CA 1EYWA 2YB4A 2AGTA 1UH3A 4G7EA 2A3AA 2ZZ4A 2MUCA 1ZALA 2YB1A 3FG2P 1H11A 4IFKB 1QXLA 1S1PA 1Z9AA 2VHLA 2HE8A 1I2NA 3WYZA 1MOKA 1KXQA 3W7JA 3FDGA 1JG9A 2XFFA 3SY8A 1UOKA 5LGZA 1K8YA 5H8PA 2W92A 1JRCA 4NXKA 1GW1A 4JKMA 1Q6OA 3B0PA 2YYUA 1K77A 3AS2A 3G2GA 1C8VA 1PPIA 1MNSA 3PZMA 3MKVA 6ENLA 5I3FA 4Z1CA 1XIJA 3U9IA 3M64A 2YL5A 2CLPA 2Y7GA 4C91A 5CGMA 3TYUA 3A6OA 1PVNA 2VJXA 3E0VA 1BWKA 1EPXA 3QKEA 1NDVA 4AEOA 3S47A 4RZ5A 2DH3A 3GDBA 1H7NA 4DPPA 2BVDA 3I68A 2QCNA 4AIUA 3NG3A 2V63A 4C6JA 3AIQA 3WDJA 6TIMA 4D72A 3TK7A 2PAJA 1F9CA 5FKYA 4WDWA 3A22A 3N25A 3ARZA 2VRQA 2V3DA 3V5FA 1I8JA 3BV7A 3PAOA 2PDMA 3NO1A 4LQ1A 1I2OA 2JEPA 3ARPA 2OTDA 2VFHA 4GVHA 5I02A 1E0VA 3OIHA 1V0KA 3TYCA 1LBFA 4L1GA 2B7PA 7TAAA 3V75A 1XH1A 1JROA 1SGJA 1E6QM 2QQ6A 4XZ9A 2WWDA 2F9RA 1F3XA 3IJDA 1N62C 3LYEA 1G4EA 3U0HA 3EX3A 1EXBA 2IS7A 3W82A 2EEXA 3FK4A 2YDRA 3FKKA 2F38A 4GMEA 3HF3A 2HVMA 3TW9A 2YSWA 1RP9A 3D5HA 2YPIA 3AS0A 1GOKA 3E12A 3L4UA 3B8SA 2MNRA 1KLZA 2EG6A 4AZGA 3EDFA 4KS0A 1A5AA 4OE7A 5A2BA 3EPNA 2ATMA 3AISA 2VCBA 4O11A 4ZSTA 4HHMA 4EQRA 1CX9A 2J27A 2VC9A 4A21A 3PUOA 3QFBA 1ISXA 4AIBA 1MQPA 2DT1A 4R5EA 1JXJA 5BU6A 3PTDA 3AU6A 1CENA 1C8YA 2YAUA 2Y62A 2XVKA 4PE8A 2B7NA 3T0DA 1XSKA 4CD4A 4RDZA 4PMYA 4FDCB 1TPEA 4DLFA 3CAQA 2OZTA 2WMHA 1F61A 3C4UA 5CLTA 2JBMA 3WH9A 4E2BA 1L6GA 3T9PA 3DERA 1W3KA 1SUXA 4A2RA 3BURA 2ZE0A 2QVNA 3N2TA 2ALDA 2R9ZA 3UPMA 1XSJA 3BUVA 5E09A 3W7IA 1LWIA 3I3EA 3OU8A 1J11A 2V3FA 4ATLA 4L7ZA 4TMBA 3ITLA 2Z1VA 1SM9A 3Q4DA 3SQMA 5I09A 2BY1A 5M2FX 2Z1BA 3HOJA 2ZA3A 4K38A 3DEQA 2YYTA 3TEVA 2PDCA 3QEZA 3W1MA 3NZGA 4EK7A 2RGMA 4JTRA 4ORIA 1XINA 3W07A 3RLVA 4G56A 1JXKA 1H61A 5FA5A 4US5A 1P48A 2W27A 4S3AA 4WKAA 2CERA 3KDOA 3T4CA 2P50A 1P0BA 4M56A 3TSMA 3VD5A 3BE7A 1F8WA 4PCSA 1ZP4A 4MIMA 4DBSA 4M6QA 3F4NA 2C79A 3NNTA 1KM6A 4PMNA 1JOAA 2CLOA 1KGWA 3P80A 4HMCA 2VR2A 3UYCA 4AWEA 3TUUA 3GKFA 3BARA 2ZTKA 4L9YA 2X99A 3LCLA 3L23A 5K9CA 1WP6A 5EGRA 4AU0A 2W67A 4ROPA 5LNSA 3VDBA 2JF6A 3ONBA 3QPEA 3CTTA 3CIWA 3AU2A 3VI2A 4JTUA 4N9DA 1R6WA 4NZ5A 3U5YA 5TNVA 4PCFA 1EKOA 3SCRA 4AXNA 1CXEA 3CYVA 1H62A 3E0FA 3WNPA 2WPCA 3ABQA 1S46A 1KM1A 2QPSA 2WCGA 3LMYA 4UZSA 4DWSB 2QCGA 4X2PA 4GGBA 4W88A 1DQUA 3QTGA 4O1CA 3B9JB 1G69A 5B7ZA 1XD0A 3DBPA 1B57A 2QUVA 1QI4A 4AXKA 2GQWA 2QDEA 1E6XM 4RZ4A 4YWOA 4WQ6A 1JUKA 1JDDA 2FFCA 4A29A 4XKMA 1VJZA 4ZENA 4JEQA 1IWBA 4LYRA 3HG4A 1D8WA 1F05A 4C1LA 4Q8TA 2EBNA 2RHGA 4ZB0A 4JTTA 5D2WA 2J7HA 2V3EA 4E5TA 9XIMA 1JDCA 3FSTA 2WQPA 1WXZA 5CH9A 4I5RA 3TH6A 1L6SA 4KPLA 2Z0IA 2DIEA 3DN5A 2ZUUA 4JAWA 3WF2A 4C1NB 4H4UA 4RLIA 3HM7A 3SDOA 1RA0A 1ZNNA 4M19A 3AIRA 1MO0A 1EOMA 3HG3A 2AAAA 4B5VA 2Z6JA 1XANA 4GUGA 1C8QA 5FCZA 1ZY8A 1WDQA 1OT2A 1RPXA 4GD0A 4F0HA 4JL2A 4Z08A 3EWYA 1E0WA 1WZLA 1US3A 4S1FA 1E9ZB 1IF2A 1MQQA 1DP0A 3E0LA 1FP9A 3AROA 4HP5A 1BLIA 3MVIA 1BZLA 2J7DA 5IRPA 1R38A 4JQAA 1SSGA 3HPZA 4WY0B 4IPPA 2CETA 1DWGM 3SURA 3FKRA 3TROA 4MJ2A 3M0JA 2GWNA 4GZEA 1RPKA 2FPTA 4AX6A 2X42A 4DRSA 2QZRA 2OLHA 3Q2DA 5A8PA 3B4YA 2I14A 2FTWA 5G2WA 1UJQA 4QEEA 3DDMA 4JOMA 4OVXA 1E3ZA 3LDVA 2AMXA 3SRHA 3WLRA 2IXUA 2GK1B 1S5MA 2XTKA 5LKYA 4A22A 2X09A 3L5LA 1CXFA 4QE4A 2ZUTA 3SR7A 3QR1A 2WC4A 4HKPA 1A4LA 4A2SA 4J3TA 1TWWA 2PS2A 4KKXA 3H8AA 3VUPA 5JBDA 3ANYA 1XKJA 3LLFA 1E1CA 1FA2A 1E9IA 3GHSA 1HO4A 2C15A 4QCEA 1JGMA 1EJ7L 3B0VC 3QY7A 1MW2A 1L0PA 5U4NA 4V28A 1VCFA 3N4FA 4F66A 2WP5A 3WF4A 3IRSA 3CGDA 4D6IA 4LTSA 3GAYA 2H3DA 3KOZA 3WELA 2OT0A 2PSNA 3OIXA 3NEHA 4O4WA 3BH4A 3TLLA 1BYCA 1Z41A 4Q6JA 4HHPA 2DPEA 3W7DA 4PMDA 5C6MA 2QPXA 3G6MA 4S3GA 1KR0A 4IL0A 6PTDA 4WD0A 1M6JA 1EFZA 1S7MA 2VD9A 1U5VA 3HV9A 3EDKA 3LGDA 1WCGA 2G97A 4K39A 5BU9A 1VF8A 4KGLA 2WK2A 5FF3A 1AODA 4XISA 1KN0A 1N55A 4D8ZA 5H2ZA 4ZTYA 1KWGA 1HZYA 1JFXA 2CHOA 5G5HB 1CB7B 3R8GA 2PTWA 4WJ8A 3M5ZA 2W3SA 1KV5A 2YA2A 3UWZA 2H9AB 5JIWA 3UR2A 3IV8A 3DJGX 4H4QA 4AD1A 4PEKA 1CGWA 1QNOA 5KTLA 1TVPA 1XGZA 3W88A 3MY9A 2V6OA 1FDJA 2OGJA 1O12A 2XU2A 3N17A 3EB4A 3VGDA 1IHIA 4DNAA 1QI3A 4PBFA 3AIEA 3P8IA 1DXEA 1VFHA 1WBJA 3ITVA 3T0TA 3XIMA 4HJFA 1GRTA 2A0NA 4EAYA 3S8HA 2IMRA 2PWHA 3NVVB 4FOKA 2OQLA 4LWWA 4HZMA 1XX1A 1N2VA 4NYUA 4HPHA 5DT7A 1E70M 1VYPX 4P7NA 3WQCA 3PULA 5F2MA 1J9YA 3MV11 3NS1B 4OIFA 1FOBA 4E38A 3EANA 5BXRA 9CGTA 1A5KC 3CB3A 3TU9A 1KM4A 1OWQA 4UQDA 3VDHA 4HGXA 4GJ1A 2IXVA 2VEKA 2HS8A 3VGEA 3AHVA 2VVSA 1CXKA 4FEZA 2V2CA 4KEUA 2R8WA 2ZUNA 5ECVA 4MADA 4PUNA 3STCA 4HOWA 5TR3A 1DJZA 4IGHA 4NZ4A 4NL1A 2QMJA 3OG2A 3OZPA 4F0RA 1OC5A 3VZYA 3UXKA 3KCJA 4Q3MA 3SCTA 3THQA 3WLJA 3PJUA 2GR0A 1CGXA 4PMXA 4FX7A 3NEVA 3NR0A 3W29A 1TZ7A 3KWXA 2ZUVA 3V36A 4H3DA 1VYRA 3MSRA 4LY4A 3WK2A 1HJUA 1S39A 2V6AA 4HTYA 4JQ2A 3T1GA 2CU0A 1EHNA 3BW4A 3DYOA 1LOLA 4GI4A 2VEGA 5BOOA 3WN6A 1ECQA 2XVNA 1GRFA 1KTCA 4H4PA 4IL2A 4LAMA 3VCRA 1Q8AA 3AYVA 1GKPA 1RK5A 4ENLA 2HBVA 3DGZA 1JEHA 3UZ5A 1LUCA 4E4UA 3RU8X 3A4XA 2FZBA 1XDLA 2KAUC 4KETA 4LW7A 3OA5A 3B4UA 3AQUA 5DEZA 1LL4A 3FY1A 3G22A 2FJKA 1PZ3A 3PWGA 3CH0A 4B92A 3OLDA 4LF1A 2ZZ0A 4IWWA 4JFWA 2X8CA 4PEEA 4M82A 3DH9A 1JZ8A 1V77A 2DZUA 3SFWA 3W23A 4JNMA 4MNKA 4OKDA 3OVGA 4KFOA 1KCZA 4HSNA 3THAA 3G3MA 8XIMA 4FNPA 4ZE5A 1TJRA 1O4UA 4YHEA 3GG0A 4EAMA 4LYKA 4DXVA 2UV8G 1YTDA 1JJKA 1XLHA 2EG8A 4QRNA 1VBJA 4EMJA 3AFBA 4H6KA 2J75A 3NJ3A 2VFEA 4GI8A 2E4TA 3MDWA 5AN7A 3HGSA 1CYGA 2I57A 3DG3A 3S5ZA 3ICJA 4PUJA 3EYPA 1E55A 2O9PA 3TXVA 4PTXA 3FEQA 3WJSA 4Z1BA 3DYMA 2FMOA 5HK4A 3H2EA 2OYKA 1EO7A 4GUHA 3CEPA 4DUWA 3R89A 3E96A 3E2VA 3EF6A 1DE6A 2OT1A 4W7WA 3TW7A 2J62A 4K37A 3WDHA 1CPUA 1ICSA 1W3LA 1M41A 1XD1A 5H8MA 4PMRA 2DIKA 4TX9A 3GSMA 2VNCA 3R07C 4I5UA 1QW7A 2WW5A 3WNOA 5FD0A 1M5WA 5D4YA 2PF0A 1PTAA 2FB3A 1EUAA 2WOVA 4AD0A 3EEGA 4W7UA 2XIBA 3UZXA 2E77A 5A5WA 3E1F1 3B3DA 4JTLA 4K7YA 3E2SA 4F48A 3DFSA 4FPSA 5A6LA 5FEZA 4RV8A 4P8VA 4HU3A 5C9WA 4KF1A 2BCPA 1N82A 4WOZA 3LPFA 7ENLA 1X1OA 5T9CE 4J2MA 4NYYA 5CXPA 1EB3A 3NQCA 3KE0A 3NQ2A 3P7YA 4I6VA 4GQ0A 1XCFA 2CKSA 1IE7C 4L64A 1P7TB 5TIMA 4JTAA 4JGDA 3U2CA 2ZE3A 3GAKA 3WDPP 3LNPA 5GJMA 1FKXA 1AH3A 3P0WA 5HPCA 3WMCA 1F4HA 3SR6B 2CLEA 4CNOA 1J5TA 2HPIA 3CK5A 2DZPA 3IJ7A 3P62A 1TRIA 3NPVA 2FJUB 1OINA 2GGJA 5E5CA 4JYDA 1JYNA 4NI3A 4S39A 2EPKX 2INFA 4V27A 2J7BA 3NVDA 4CNPA 4YPJA 1LJYA 2Z2AA 3VFCA 2P1FA 1SW7A 4GRTA 1W31A 1W9VA 4XZIA 1M04A 1UMLA 1Y8BA 4JD4A 4DJFA 5K3VA 4Y9AA 4ZO8A 2DT3A 3SIZA 2OYLA 4PMZA 3ARYA 4NI8A 4OUIA 2PRHA 1E1CB 1ZAJA 4YMZA 3M44A 2VX6A 2PCQA 3VPLA 1F3EA 1RBAA 3QGVA 1FRBA 1TTQA 4HVXA 2ZDSA 4S23A 4R33A 4AZCA 3N14A 5HOSA 3EWZA 4ADTA 1SJCA 3LNMA 1OADA 3WQPA 1UH2A 3PPFA 1OSEA 5CJNA 2Y70A 3E2QA 1SJBA 2QXWA 5FAJA 2ZCGA 3V0SA 2VRKA 2GGIA 3HV8A 5TF0A 1UKTA 1KWKA 4HSHA 1KBLA 1XIEA 4K1GA 3L9CA 1XM3A 5CGQA 3HTWA 2RGLA 1H5YA 4R85A 2F2KA 4MB4A 4DNHA 4B16A 2VZSA 3SW6A 2ZFAA 4L4PA 2O7SA 2VEPA 3THUA 3XISA 2A3BA 3PUEA 5JCIA 3WH8A 3WZ0E 1ELSA 3AHTA 2BB0A 1GPFA 3SJ3A 2CBVA 4UUIA 2BGSA 3KS5A 3PZQA 1H41A 3T8QA 4Q7BA 3S6DA 3ITXA 4QHRA 5F7UA 4EM3A 1EBDA 5GRTA 1AH0A 4ICMA 3W87A 3K13A 3S1VA 4BQ4A 2WHMA 1GVEA 2YJQA 3MW7A 5G2HA 4P7OA 1EUNA 1VBGA 2GGHA 2Q8LA 3CQJA 4IPIA 4UQAA 5BOEA 4CKQA 3RX3A 5HWNA 1AMKA 4BV6A 1UC5A 2BOFX 3VD4A 5CSUA 2EHHA 4D6JA 1H1YA 1N8FA 2XINA 3TNOA 2CWNA 2JE8A 4QP0A 3LU2A 2AL2A 3FYOA 3N2XA 5GJPA 5EU9A 4GO8A 1HP5A 2QCDB 5C7VA 3QV9A 4I8DA 1W1B1 1JIBA 1PIGA 3I7QA 3STPA 2NLIA 4OBSA 3ARWA 4Z1YA 5I06A 3R25A 5HBFA 1JYVA 4JNYA 1VCGA 4GZIA 4WIWA 1GHSA 2QPUA 4BHYA 5F4WA 4JTSA 4ERGA 3CLWA 3HURA 3T08A 1W8SA 1NOFA 2X8GA 3L0KA 3WD1A 1US2A 3EOUA 4RX0A 3INPA 3NM1A 1CT5A 3U6WA 1IGSA 4DJDD 3H4KA 5I78A 3O07A 2R9RA 4FZIA 1P0DA 4IX2A 4DJFC 4KWOA 1W9XA 1V7AA 5KEZA 3G3DA 3MUY1 3SFKA 1EPVA 4K8GA 1X96A 5FF7A 4X61A 3LTYA 3GUGA 3U3HA 4PUKA 1ZK7A 1UWSA 1JF5A 1UOZA 1WUFA 2ACRA 5DRIA 4BEUA 4GUIA 3GD4A 2E8ZA 4WCJA 3TMQA 1UP0A 3N15A 1IEXA 4GBUA 3IJQA 1MZHA 1OD8A 5A6AA 4JDBA 5JBFA 3UR7A 3GDKA 1LLOA 3GDRA 3NPUA 3SB0A 1TTPA 3IIOA 1NDWA 2QT3A 4PN2A 2OSXA 1YDVA 3CC1A 3O05A 3W27A 3RM8A 1P6CA 1FWGC 3REQA 3GVGA 4FXJA 2IQDA 3CL8A 4UNIA 1KFBA 1YXYA 3LRKA 7ODCA 3TZFA 2QS8A 4W93A 4I6KA 2WM0A 5TBOA 3KX6A 1TA3A 3CT2A 4R34A 4QDMA 3VNLA 2FQIA 3WLPA 4GVIA 1GUVA 4DF0A 1G7VA 7XIMA 3HMJG 4DIAA 4M5PA 4PODA 3QQ0A 4KT2A 2W5FA 4UMCA 1DE5A 1XIIA 1ZPTA 3CUGA 2GSEA 3W28A 1OF8A 2RDWA 1WXYA 4GWEA 1EL3A 1PIFA 4LV9A 1FP8A 2DSKA 2WKJA 3PNZA 1XFCA 3S1XA 4GX8A 5BRPA 4Y9MA 4UNKA 3UJRA 2P5NA 3UY8A 3UZJA 3U5UA 1A5LC 1VDVA 4HT3A 1ONFA 4PSRA 1AA1B 2YFOA 4PUEA 4PUWA 2RDUA 2PEVA 3C61A 2YXXA 2VDIA 4YLWA 3FGCB 1YRRA 3JW7A 3NRZB 3ELFA 5PTDA 1BGGA 2G96A 3FJ6A 3WNMA 1NEYA 1RVKA 1QT1A 5C7HA 3H2OA 3AMDA 3VC5A 1Q6RA 4EXQA 4XZBA 1QBBA 1E4LA 3CIXA 2D69A 3TYBA 3IVTA 5C9UA 2BODX 1EIXA 4JTHA 2DJLA 2CKRA 3GHRA 4CNUA 3UWEA 4MM1A 2NWRA 3HJZA 3W70A 3W53A 5FJJA 1FCUA 3HJEA 2OWWA 1E73M 4PA8A 3S83A 4K68A 3VNZA 2XIOA 3OLEA 1GEQA 3N34A 1XIGA 3ZR5A 3B03A 1WO2A 4AB4A 3NQMA 3W02A 2R1PA 4IISA 4LEQA 2G5WA 5I3IA 1FHDA 2QCCA 4CN4A 1X2HA 4PB4A 5JCLA 4H8UA 3VMOA 4H7CA 4MLJA 3UJFA 4W7VA 1QBAA 2YR1A 3KDNA 1HKWA 3CPUA 4H4YA 4JIEA 1U1UA 2XVLA 3HRDC 2POZA 2AAMA 4H4SA 1EBGA 3PB0A 2OU4A 2VC5A 1Q66A 1TMQA 2A6NA 1IYXA 2RABA 4V1XA 5D03A 2XM1A 3W2KA 4GKLA 4ERAA 3SCVA 1OFPA 1O5XA 2HQAA 2ONEA 4AZCB 4JN6A 3SUTA 2ZRYA 3QYSA 1U33A 3N2MA 1CBGA 4M3PA 3S46A 3VKJA 2VURA 3F5KA 3WL1A 2JFEX 4CD5A 2FZDA 4MKVA 1BXBA 1BEUA 2QF7A 5HULA 1IEVA 3IS4A 1RK6A 3BGJA 3VDCA 1ZJIA 4J57A 4PUMA 4W84A 1L9WA 2XZ7A 2PRMA 1AJZA 5F4SA 3I4KA 4S3JA 1HKVA 3L5MA 3TFCA 1FFVC 3QH2A 1Q3NA 3CASA 4ZO7A 4FNQA 3G1AA 2KX9A 2XM2A 4YCPA 4UQEA 4JTEA 1Q7QA 1UQZA 1LG2A 4M29A 4KWUA 3WLTA 3K2GA 2GUYA 1WE5A 2CLKA 5G4HC 4YYCA 1S5TA 3N29A 5LA1A 3M7SA 3IACA 1ICPA 3S9IA 2D22A 4B3LA 2G3MA 4QAIA 3UBPC 2HCVA 1LROA 1VENA 2E40A 4JHZA 4FMVA 3WQDA 4AHQA 3ZWTA 4GISA 1F3PA 1XFBA 4O28A 3BL3A 2OPJA 2X2GA 1QOPA 3E5BA 1NP2A 3OA3A 5DY3A 4RE3A 3BJFA 4D9PA 3HPFA 1JUEA 2AL2B 1F6PA 4GYPC 3A9IA 3MA8A 3DFNA 1NQKA 3W85A 7A3HA 1R7OA 4H9TA 5G4EA 1E6ZA 3NL5A 1HL8A 3BLPX 3M6DA 2DQWA 3R58A 3WK3A 5J5RA 2FVMA 3VIOA 3UR5A 4YIWA 1W9UA 1FKWA 2W3RA 1AK5A 3UZWA 5KZ6A 2A2IA 3GC2A 1W1YA 4AZHA 1R3YA 2REQA 2XPKA 3TC6A 3QV8A 1N8WA 1XIHA 2C3DA 1TV5A 4Q4KA 1SW3A 1H60A 2P76A 3L4VA 4U33A 1WAWA 4ZQOA 1XDJA 1NU5A 5E9AA 5G1TA 1W0MA 4IJCA 1JNDA 3W86A 4ZTXA 4QLLA 1HG3A 2ZWYA 1KQZA 2VFDA 1LOSA 4ZFMA 5AVHA 4H6EA 1YE4A 4XQ6A 2HQMA 1TPUA 3NZ1A 1OIFA 2E67A 2QVHA 3JS3A 3L5OA 1S2VA 4HNUA 1JZ7A 5K2ZA 1DJQA 1YPIA 2EQDA 2WSPA 1G4PA 4CQDA 2QDGA 1IT0A 3AHYA 2ZRWA 3O7UA 2VZOA 3HMCA 2QGYA 3PSWA 4FIQA 1SVDA 4LYPA 2GGEA 1M65A 1XQLA 3NSXA 1ZU8A 1C8XA 5D2XA 4P5UA 2OYMA 4L1XA 1JQVA 3CL7A 4EACA 3QC3A 4LH8A 3QPYA 3A3XA 1CXIA 5LNUA 3REQB 1QWKA 2FZMA 3AOFA 2XIMA 3B9OA 2RKXA 3GU1A 4AAJA 3IGSA 3NVWB 1DIEA 3OZMA 2ZZ3A 2YCKX 1GWJA 4HNNA 1AQ0A 4E4FA 2Y8VA 1OZQA 1LDCA 1LRTA 5AYXA 3TN3A 1GRHA 1I1WA 1XKYA 1NOWA 3L67A 3OLIA 3DI1A 5CBBA 1V6YA 2TODA 4OTKA 4UFJA 2BVYA 5DCBA 3M07A 1SO4A 2PDUA 4S3BA 1OY0A 4DPQA 1EJXC 2HZGA 3U2OA 2JGYA 3ARTA 2ZYFA 4PGLA 4RNHA 3R7MA 3CUJA 2I9UA 5JMUA 3T0CA 1DORA 3UR8A 2DZWA 1QW9A 3W26A 1J0KA 5CJMA 3TQ0A 1EBHA 1UG6A 3RCMA 2V3BA 4OQVA 4XO7A 6REQB 1GOXA 4TV6A 1XUZA 4P8XA 1MRAA 4LB3A 2JK2A 1RJPA 5JBEA 1G5AA 2VL4A 2J74A 3M5YA 4D6CA 3FAWA 3O63A 3NL6A 2VKZG 1TELA 4UXDA 4BWLC 4A8LA 4GQBA 4HPNA 3VX1A 3IGXA 4L6HA 2YW4A 2GVLA 2IPJA 4E4PA 2I16A 2PGRA 4ZQRA 2FHCA 1MEWA 1X1NA 3WDIA 5LYRA 1EJSC 4OBRA 1MO9A 3H4WA 3IJ8A 3OZYA 3VOHA 3B97A 1JZ5A 2CLLA 5F1VA 3URNA 4Y2WA 1XR2A 1CLKA 4KRZA 4X0VA 3TR2A 3QHMA 4GYJA 3N9KA 4W89A 4XTDA 3A9BA 3M0ZA 1T96A 3ARVA 3EAOA 2PDFA 1PX3A 4P8UA 1MEIA 2A3LA 4NNBA 4IMDA 1DJYA 4H4XA 3OHMB 2VDGA 1JFHA 2ACUA 3N13A 5HWJA 1FFRA 1T6MA 3P5ZA 3RRAA 4OECA 1A4MA 1UP3A 3VOIA 4MY1A 3CPRA 5H91A 1M1BA 3GXIA 2G3IA 4U2ZA 1XYLA 2BTMA 3LGEA 3T07A 3S9ZA 5A1AA 3E49A 2Q3RA 1WZAA 3F2DA 3ZT6A 3PY2A 1DTUA 5HMFA 3QFEA 4M0XA 3KAOA 4Q8WA 2R24A 3IIXA 1ISZA 3QC0A 2PC4A 2I5GA 3KTSA 3CO8A 3PTQA 5JCKA 1ZAIA 3QVQA 3DGHA 3UXDA 3QHNA 3EX6A 3QFAA 3VIPA 4D2JA 1F6KA 1O5QA 5D38A 4C6FA 1P1XA 4AISA 1ZENA 3B0YA 1YDNA 3MDUA 2OZ3A 3W7RA 3BQ6A 3R8HA 3HIJA 1ITQA 3WFLA 5E6ZA 5LNVA 1KCLA 3TA6A 1DTNA 4HNLA 2C16A 5TAOA 4D8AA 1R86A 4RW5A 5FI8A 2E3TA 4JN7A 4OOZA 4DM2A 2EQ8A 4RE0A 1H1ZA 2X7VA 3W38A 2BSLA 2VUNA 4GYFA 3OP2A 2OCZA 3TKFA 2UY3A 2VCCA 1ZTVA 4FNSA 3CHCA 3AN1A 3VX0A 2C1IA 4ICNA 3G0XA 4LBSA 2FVKA 1VB9A 1F6YA 3AYRA 3W7OA 1V5XA 4B2DA 5A8NA 1E71M 2Z26A 4OGZA 3L4XA 1MDRA 1DXIA 3QMTA 1U5HA 4UFMA 2QJHA 2VI0A 4DBEA 3T81A 2EKCA 2A3CA 4DJEC 3LZ3A 5REQB 1YBQB 3ITGA 1CW2A 4OFCA 4OZOA 3F1QA 4PTWA 4Q4MA 1Q85A 1R3TA 4IT1A 3W7CA 3ABRA 3EB3A 3PBGA 4TOQA 3OPSA 1M53A 2NSOA 4I7WA 2J13A 1TREA 3S6OA 4C7FA 4CEXC 5ABFB 4XIAA 1VEOA 3W2NA 4F2UA 4DQWA 2XYLA 3IGHX 1QHOA 2CXEA 4MZ8A 3GG1A 3NSMA 3W1LA 1E6RA 4UFKA 4AIOA 4WDTA 3PN8A 4A8IA 5I7GA 3ZSSA 3MI2A 1T5AA 3E38A 1OYCA 2Q01A 4DHGA 1DJHA 1RCQA 4XAYA 1RM6B 4GKTA 5TQLA 3MC5A 1VC4A 4HMNA 2ZC1A 2REQB 3G1DA 3PANA 4FX8A 1EEXA 4JY8A 1EWEA 4JX6A 4URIA 4INFA 1M3UA 3HPSA 3ECQA 1UP2A 3UVIA 5FEWA 2QULA 1US0A 3ISIX 4GY0A 2C1HA 1W2PA 2Y7FA 2OXNA 3H21A 3LCFA 4ZXOA 4U3CA 4IJRA 3BTNA 4IXHA 3DECA 2X1TA 2YXGA 1KW1A 2XZ9A 3VNDA 3ZQ9A 2O9TA 3NCOA 4M8UA 1K8XA 3UERA 3A23A 3QYQA 1W5NA 4IPLA 4TVDA 3ABXA 3QRHA 3CV1A 3NM3A 3EAUA 6A3HA 1RBLA 2VDHA 3M0MA 4M6UA 5FS8A 3KL0A 4TX6A 3WQEA 3RILA 4HNCA 1ZY9A 1CLXA 3RPTA 4B5UA 5I6SA 3H2MA 3A13A 1QJWA 5AHEA 3NDOA 3H26A 3R10A 3S5OA 1A80A 2P3EA 1KBKA 3WMBA 4WF7A 3IPWA 4N4QA 1JAEA 1DQWA 3CB8A 2WZIA 1X39A 2FPVA 1XIDA 4TXEA 5BWFA 1S5NA 2WB5A 4JYEA 2J9ZA 2Y5SA 4LRSA 3A21A 2BXYA 5EMLA 2WVVA 1U1HA 1MMFA 3P74A 3W76A 5LNWA 4XZMX 2OFJA 3K5XA 4UOQA 2X2YA 2QAPA 1GOOA 2YIHA 1A5MC 3TN6A 4GZJA 4IP4A 3W22A 1MUWA 1NP0A 1ESWA 1PWLA 2PD9A 1L2UA 3PBMA 3N9RA 2XJ7A 4H4TA 4JIQA 1J8VA 3NURA 3AXIA 3QF0A 4DBWA 4K7VA 4QROA 3EX1A 4L6OA 1R9YA 3NZQA 2PP3A 3KHJA 4LUTB 3GR7A 2GRTA 4PZVA 4AC1X 3IUIA 2GSHA 4V15A 1PHWA 1PTDA 3BV4A 3MSDA 1ZMDA 3B8UA 2WJFA 2G3JA 4ZO9A 3IEBA 1EP2A 3PVFA 2PC8A 3B05A 3BLLA 1GPWA 3LGGA 3IANA 1MEHA 1E4MM 5CAHA 5FMHA 4GHRA 3S1UA 5G1MA 2YVFA 1HJSA 3KTXA 3RPDA 1VH7A 3L4ZA 1GKQA 2DZBA 2OGYA 3PNUA 1QNQA 4OWGA 3UXLA 5KZEA 4JYFA 2VC7A 4EPBC 3FYYA 3SGUA 2ZWZA 3TOYA 2AMGA 2CWXA 4K8DA 3W1NA 2PWDA 4LCRA 1A53A 1S2AA 3CGEA 1TCMA 1ZFJA 2QUNA 4Q8PA 1MI3A 2R1LA 5DELA 3LD5A 1FWJC 2PI6A 4O0QA 1UD2A 1GVIA 1FWSA 1W9PA 4GI9A 2IUZA 3UGRA 1Q4WA 1NJJA 5KITA 3IV3A 1VYSX 1JCYA 2R1NA 3GNXA 2IKIA 2Z6IA 3UGVA 4HBKA 1QASA 3T4WA 4XTIA 1I9CB 4OU1A 3UESA 1VFUA 4FR1A 1FTXA 4I8YA 1D3CA 1TJ1A 2FIQA 5LIYX 1IEWA 5JH2A 3GBDA 3VIKA 3CPGA 3ONCA 3B04A 1HNYA 4HJWA 2W6RA 2B7OA 1R30A 1PO9A 5DLCA 3WLLA 2D24A 4JL1A 1EEPA 3KUMA 3PWAA 4UTWA 2FHFA 1J4EA 2W9MA 4JCLA 4JIIX 5GPRA 4NAEA 3FVDA 3I6RA 2WKLA 1B90A 3EWCA 4CVUA 4Q8UA 3WEOA 1Z69A 2Y88A 1NFGA 4MMWA 3D9XA 4PR4A 4NZCA 4GA8A 1ICQA 3MB9A 3WF1A 1QR7A 1JULA 3KEHA 1AW1A 1J2WA 2CZFA 3HBLA 4C6DA 3VTRA 4W87A 3UETA 5LNRA 1TR9A 4IP5A 3LENA 3GZ3A 4APNA 3NPXA 4CQAA 2YCLA 3BGAA 5C8BB 2JKEA 5DMNA 4RPQA 2NV2A 4Y96A 1GK8A 2A1YA 4ILSA 3VIMA 2FZ9A 2HPMA 3TFXA 4DYEA 3LRMA 5KZMA 2P53A 1JPMA 1W1A1 1NOUA 2P0OA 3QGAC 3M9YA 1M7XA 1X7FA 1G7UA 4MWAA 1QOXA 3TN5A 3LA4A 3CWOX 1TWIA 4JS3A 4G1KA 3GUWA 3LB8A 5CQ1A 4AH7A 2XFYA 4UR7A 4FLOA 1ML1A 4Z2HA 2J47A 3VUSA 2INEA 3V0UA 1K9TA 3O6AA 1R8LA 3AJXA 2XGZA 2X0HA 2UWFA 5HWMA 5D09A 4NIRA 1RR2A 2ISSA 5CSRA 4F0MA 3MWAA 3DG6A 3TOPA 2HXTA 3LY0A 5LSMA 3W81A 1UWAA 1XC4A 3SCUA 2GJPA 1LORA 1YADA 3A5FA 1ONEA 1H2JA 4IIHA 3NVTA 1VQZA 3GDMA 1ZUAX 5KMYA 3TAKA 5BW6A 4YWSA 2J79A 3S9YA 1E0TA 5EFFA 4EX4A 2WLZA 3EXRA 5AC5A 2GQ9A 5JIPA 1WAUA 3W7LA 1F2JA 1TE6A 1KM3A 5ECUA 4GNKB 4CNNA 3M0YA 3BO9A 1PYMA 1S2TA 4Y6GA 2DW6A 1V0MA 5BXTA 3L21A 5FACA 2HRWA 3RF9A 1Q5MA 1VLIA 4NP7A 4KCVA 4ADWA 1K1DA 4K2SA 1RJRA 1V3KA 2YLLA 3N4EA 2I5QA 1Q45A 4U4MA 4GBDA 2H3BA 3WD4A 1X7IA 1C7TA 3QY8A 1C91A 3CO4A 1AL8A 4I5XA 4EPEC 1V6VA 2CZDA 5CPOA 3NQDA 4NF7A 3QY6A 5BMWA 4FX9A 1TZZA 2Z24A 6XIMA 4B5NA 4UTWC 4LUSA 3BMWA 2QGHA 3S1WA 4U3AA 3MUCA 3DJJA 4MB1A 5A6TC 2J7FA 4MWAE 3UCCA 1DWFM 5AFDA 3I3BA 2GR1A 4DJFD 2UBPC 1PZ2A 1VBUA 3TDFA 5J8LA 1GOMA 4IFKA 2ESCA 3TTYA 5FS6A 4DO4A 3DHUA 2A3EA 4MSSA 1PJ9A 1TV2A 3HGJA 1OGBA 5FJRA 4RV3A 5CZ0A 3O0FA 4UBPC 1C7SA 2QCHA 2H6RA 3QPZA 2ZVRA 3BG5A 1WXJA 1V08A 2QDHA 2R91A 4H7VA 1QHPA 1OFEA 1HN1A 1JUBA 2WHJA 3TVAA 3LCXA 1QK0A 4CU7A 3OOQA 3Q65A 1AQFA 1MUMA 3WLMA 4KRTA 4E0CA 3GRSA 4CU6A 2PA6A 2V81A 3TQPA 1PDYA 3C0QA 3URAA 4MYAA 6XIAA 1XIMA 3DX5A 4EMIA 3W1QA 3APGA 3AALA 4LANA 1NDZA 1H7XA 4L6DA 3F03K 1P0NA 1X97A 2JK6A 4EQSA 2WVVB 1D2KA 2BASA 2E0PA 5BOFA 4GUJA 3EPMA 3R0UA 4HU0A 3GE7A 3UNTA 3WEZA 3TYEA 1JDAA 3S2JA 1EC8A 2CZVA 1IZCA 3FNDA 1DQXA 1VHCA 2WBAA 5M1TA 1EYEA 3ZVHB 2BY3A 4MJMA 3GIQA 3M5XA 3N04A 3K1DA 1QAPA 3L7RA 3RNDA 2E5BA 2WVUA 1B54A 2Y89A 3WJXA 3A3HA 3PTMA 2CHRA 1LCOA 2BV9A 3UEQA 3MANA 4Q22A 1YLVA 4QGCA 2ZX9A 1ADOA 4GNJA 4AUBA 3H2NA 5HNUA 1H6VA 2EXOA 3SY1A 3LHZA 3UWQA 1W37A 4TV5A 1FO4A 3GIPA 4B9ZA 1TQJA 2G0WA 4AY7A 1Q2SA 1TPWA 3L65A 3IK2A 1YIXA 2PDLA 1O66A 4ZA0A 1RALA 5FEPA 4J40A 5T9BG 1A50A 2PWVA 2VX5A 4O1AA 2YCJA 3A4JA 3H55A 4HYRA 3LB0A 4N9EA 3UG8A 5DXXA 3HPXA 1XLDA 5IXEA 3PZGA 1A49A 1PCKA 4NNAA 3V1HA 4FXSA 3WJZA 5JH1A 2X30A 3OYZA 4HK5A 1FWCC 1CECA 4RKAA 3Q37A 1BGAA 1UWUA 3N9SA 3C0SA 3QV6A 4AG0A 3LCWA 1XYFA 2EAWA 1IXQA 1I0BA 1E0XA 3SUUA 4EPKA 5A6BA 2ZXBA 4IZGA 3NQBA 4ZOCA 4W5UA 3VGFA 2CNCA 4ZB2A 4FLRA 2WP6A 1FHUA 4J2PA 2AQOA 1KXHA 1TJPA 4TTGA 1V3IA 1PSCA 1CEOA 1R46A 3SSZA 4U5KA 2G41A 1Z42A 2BWGA 4MLRA 2E3ZA 3FAXA 3OGSA 4BS0A 2G3FA 2W61A 4G2DA 1NELA 2X1IA 1HT6A 5HJYA 4AY8A 1H50A 2VTFA 3WG6A 2ZZ1A 4FOUA 2WZHA 1G67A 4J3XA 4FX6M 1TYTA 1LM1A 2X1SA 3WNNA 3BLEA 3H2FA 3QHOA 1B5TA 4DO5A 4NAEB 1XPYA 1S2CA 2J77A 1AQMA 2J3NA 3MS8A 4I9TA 1O6IA 3U7VA 4WSJA 3NSNA 3B06A 4TVUA 3FIGA 1EO5A 2BXVA 3LCGA 2X05A 2J88A 4QS6A 5FJTA 4HA0A 4QE5A 3VE7A 3F2CA 4N9BA 2C14A 4Q32A 4C6QA 1OC6A 4O15A 1KD0A 1XHCA 4E6MA 4IICA 4RZ6A 4WKFA 1D7FA 3L2IA 3CV6A 3K8MA 4JCMA 1QMLA 4DUXA 3K1GA 4LXFA 3W7PA 2W62A 2E5CA 3WBAA 2JF7A 4MWAB 1XC6A 4LUYA 2V9DA 1GVFA 1M7JA 3TTSA 2OMAA 5LHEA 3L12A 3GTHA 1ADDA 4J4KA 2Q8ZA 4XUGA 2E9BA 1SJDA 1JYXA 4RXGA 5AOUA 1C93A 1QU4A 3TE9A 3P3BA 4CEUC 1K6WA 4ZMGA 2QR6A 3OQ8A 3G18A 4AIEA 3RO8A 2D0GA 2ZC8A 4I9MA 3M7WA 2ZRXA 4DWSA 4F8XA 4L80A 2HV5A 4EOUA 1O94A 2Y85A 4QQUA 1KO0A 4QJ1A 3HGOA 1ZS2A 1TWSA 5M17A 3BSMA 1R3SA 3JR2A 4I9AA 1WYGA 5CPSA 1M7OA 3WUFA 1IZJA 1XLGA 1HGYA 1LWHA 3VE9A 4GH1A 4GGHA 4JQ3A 2EPLX 4IP7A 4QNWA 3W74A 1RLDA 1MZRA 3C86A 3SQSA 2AGKA 3TYZA 1KRMA 4PL2A 5D2VA 2ZZ5A 5HR7A 1M01A 1VBHA 1EJWC 5C54A 1YEYA 5DANA 2QV5A 1RSCA 1CLVA 4Z0JA 2F84A 4TVCA 4NKCA 3GDLA 5AZ1A 2PODA 2Y2WA 2E9MA 1V6UA 3UYIA 2NW0A 3MSGA 1V97A 1SZEA 4C1NA 1P4CA 4IIGA 5I79A 1LL7A 3AWOA 1V59A 3I10A 2VR4A 1UKSA 2O9RA 2XDFA 1OG0A 4AVFA 1FY6A 5A94A 3PSVA 4QS5A 3ES8A 1YE6A 3C0JA 2GJXA 1JPKA 1LBLA 4GCXA 3UJEA 3VM7A 1G9HA 1S3TC 1FHVA 3AMCA 3QN3A 3UF9A 1FWBC 5TD4A 1R85A 2Y1HA 3EMCA 3W83A 3GBEA 5BZAA 2OWXA 5EBAA 4NZJA 3ENLA 2FLIA 2JQXA 1LZOA 4X9SA 1TCDA 3EMQA 3SCPA 5IM51 1LP6A 4RXFA 1DYSA 5D2YA 3NVZB 2NQLA 2DZSA 2R1KA 4PCPA 5FOOA 2VC6A 3LHYA 2GK1A 4DAFA 3II4A 4XVEA 3PC0A 3KXQA 2BG5A 2OKTA 3R12A 3VM5A 4E8GA 2BXZA 4XAFA 4WDUA 4JTIA 2OEMA 1JAKA 1W9DM 3HG2A 4GFSA 4MB3A 3C0LA 4X63A 3F5JA 2Z29A 2NSXA 3QQWA 3TW6A 4H4ZA 1GESA 1NFPA 4PBGA 4H9UA 1WNOA 1UA3A 3PFMA 3TX9A 3ORWA 2BHZA 1RLCL 3LV6A 1CXHA 1T40A 4B5XA 3MUZ1 3W7NA 3AXKA 4K3ZA 1A5BA 1VD6A 1NQ6A 1FH9A 1OB0A 4B3KA 3RUBL 4JX5A 1BSLA 1F4AA 1TV7A 1FCQA 3PM6A 2E28A 3PZNA 3I4EA 3UA3A 3P8JA 2F7FA 4GXMA 3MP5A 2WMIB 2C6QA 5DXYA 1SW0A 3VOCA 2D2JA 3PG9A 1I4NA 4PUUA 4B90A 3BC9A 1N63C 4DWSC 2P3ZA 1B4KA 2JIEA 3U2EA 5I07A 3EOEA 3F2BA 4UNLA 1GQIA 1P43A 4RL3A 2GH5A 3WEMA 2YDQA 1U22A 2NX9A 3LX9A 2HJPA 2YZRA 3LN3A 4AD2A 3RMEA 2WLYA 4JICA 5GNXA 2B31A 1JEZA 4PL1A 3H4GA 2E6AA 1UD3A 3LCIA 1UR1A 4F0LA 5I03A 3MKKA 3P60A 4G7FA 1DJIA 4J3UA 3NGFA 1P1MA 1LWJA 1HJVA 2CLHA 2WNNA 3UPWA 4FAMA 5MF5A 2VGBA 1B3WA 4HA3A 4UZUA 3LI0A 1BXNA 2ZA2A 1K7XA 2H9AA 1U30A 3M1ZA 3ALGA 2POTA 2VEMA 4S3FA 4W8AA 2Z28A 2J9XA 2TMDA 2B7QA 1UWTA 1TV4A 5C5YA 2UZ9A 3LUTA 2XUCA 5BWAA 2Z4GA 4B4FA 2ZADA 1R5YA 1VS1A 1E51A 4O1BA 3VKCA 4Y9OA 1DNCA 3WUBA 4CCZA 3QGKC 2BZNA 3PS7A 2CC0A 4GUFA 3BSHA 1BRLB 4AZ7A 4UQ9A 3MCMA 1TV3A 1OM0A 2ACSA 1VJSA 4M6VA 3W1RA 1K8CA 4JEJA 2DDXA 2Z2UA 4MPQA 4WSKA 1GG0A 4FB7A 4GQQA 5CG0A 4Q4QA 3L2MA 3DH7A 3CGTA 2YL6A 1JPDX 1Z3NA 3GRTA 4CCEA 4QJ4B 3FFSA 4H19A 2Q02A 2DIJA 1R47A 4PTMA 3PZ9A 3M41A 4UQBA 3NL2A 1VFLA 7CGTA 1XLCA 3BXWA 3BMVA 4GXWA 1VFSA 3PJWA 2OKOA 4ASTA 5LHFA 2PGEA 4EPDC 5FSEC 1ODUA 1SFSA 2PWUA 3DK8A 2CHNA 4UFHA 2NWSA 5I3KA 3IGUA 3N19B 1NAL1 3CQKA 3B40A 4S38A 3KVMA 3CUHA 4Z2JA 1FWNA 4KCUA 4TUFA 1ZMCA 2EO7A 2C7FA 1AH4A 4HNTA 1AW5A 1CZ1A 2Z2BA 3EDJA 1V02E 5BRBA 3AMKA 3U4AA 2Q8XA 4X2RA 4EQWA 1TO3A 1EDTA 1EGMA 4QTGA 5DT5A 4GK8A 1Q65A 3AYSA 3P82A 3KW3A 4WEVX 3K4AA 3N12A 3PZTA 3AI0A 1F8MA 1E43A 4IX0A 1RAKA 1H09A 5H8UA 3ITYA 1SO6A 5AY7A 1W8GA 2DVXA 4MGGA 3T40A 3BZJA 3N2CA 4MY8A 2CW6A 4QBXA 3WKZA 3ALFA 2PDPA 3ES7A 4WHBA 3AM9A 3L66A 4RPPA 1XIFA 5AYBA 3O6CA 3GNRA 4A3YA 4QQ3A 4DJED 4WKHA 1GZJA 2JEQA 4TMCA 3VABA 3DUGA 2TRSA 2NVKX 1WKYA 1OFAA 4FF5A 2VZVA 1OJTA 3GG7A 3KOWA 1AZ1A 2A79A 3MCNA 1EIBA 2VOTA 4S3KA 2PDJA 3KRSA 3BG9A 4JTJA 4Q4OA 1J01A 3TMLA 2Y24A 3H4XA 3GXPA 8TIMA 2J9YA 4QM1A 3L2LA 4C6CA 3WQ5A 4LYQA 1CGUA 2F2HA 4C90A 4NNCA 4K8EA 4H9YA 5EFDA 3LXCA 4D1JA 4DVOA 1JPIA 1PAMA 1QW8A 2QJJA 3SI9A 2PCEA 2PGWA 2YCIX 5JXQA 2X41A 3WF0A 4K6AA 3NQGA 1DPMA 1ZSXA 3TONA 6CGTA 4W86A 4FSAA 5C9ZA 2WNQA 1VZWA 3W1PA 1CDGA 4NHVA 3OHIA 2EPNA 3AUJA 1V79A 3IAPA 2ZRUA 1REQA 4CCDA 2QEZA 1Y0EA 3P81A 2DV0A 1GQNA 3ABOA 4ML4A 4MNJA 1D7KA 7PTDA 2OEKA 1ADSA 4LGXA 2DUXA 4O10A 1ECEA 1BTMA 1KM5A 2VT0A 3ME3A 1LPFA 5HNNA 3ITTA 4CD6A 3O0KA 3EOOA 2GJXB 2QCEA 2HEJA 1IZKA 4H8NA 1Q1RA 1NHRA 2W55A 3M6YA 4NJHA 4R3UA 3GM8A 1P7TA 5AYZA 1SZRA 3UJ2A 1C90A 1FDZA 3CYJA 1R3VA 4X22A 1MNZA 2AL1A 4AWSA 2GVYA 1TR1A 4NQ1A 2PZNA 3CLMA 3MMTA 3IJ6A 4KW2A 3A3WA 1PYFA 1FUYA 1OGSA 3BLKA 5CZJA 3UNDA 3LG3A 2W0UA 5HAOA 2FVLA 3MZNA 2XHYA 1N61C 1UC4A 2ACQA 3SQPA 2EG7A 4WUIA 3CZJA 3MV01 4H4IA 5T91A 2O56A 4ROQA 1QHZA 1WB0A 1MRQA 2A7NA 4IGSA 2E68A 4ZOAA 1KM2A 2XSXA 3TTQA 5IHRA 2E6DA 3ZR4A 1TWZA 3ANVA 3V18A 5F1UA 3UY7A 3VIGA 3GQYA 3CUIA 1CWYA 4CQ9A 3RHGA 5BRQA 2ZZ2A 9XIAA 5D8WA 4JTQA 1SFLA 1VQTA 3T0BA 3W7KA 1Q13A 3BCJA 2OR2A 1ODZA 4DB7A 2ZXQA 3W37A 4L9XA 3VKBA 2PDYA 1DIDA 2J8GA 4HB7A 1Q6CA 3SGGA 5IBXA 2WZMA 1JRPA 1GVOA 3URQA 4WDXA 3OLGA 1PHQA 4ZQNA 1XI3A 1NWUA 4AVNA 3M0VA 1TPC1 1OIMA 1T99A 5FJIA 2PTXA 5FS9A 3QLLA 5A95A 4RDWA 2YOCA 2V5JA 3C52A 3K8KA 4F79A 3SZ8A 5F2IA 2ZZ7A 1B9BA 1KB3A 2AAQA 2D2OA 4C5YA 3KCLA 5EBKA 1GXFA 4IG2B 3WUGA 4GG9A 1RVGA 3MHFA 3SM0A 5HJXA 4J3VA 3EBVA 4I3GA 5C2GA 1EX5A 2DQXA 4H2HA 3WNLA 3R0KA 1L2QA 2RJHA 3R1ZA 1SFTA 1YTKA 4Q8QA 3ZFHA 4AWTA 4N6FA 4DN1A 3W7QA 1JCJA 2QJNA 3BVJA 5K4ZA 4DZIA 3EKGA 2IPWA 2DP3A 3KLLA 3FW6A 1ZDLA 1QPOA 1XRVA 1UWRA 3HQ1A 3W2UA 3WQGA 1Q6EA 5HJLA 5CEWA 3WO8A 2ZX7A 2ZKMX 3NQ8A 3RM9A 3OODA 3ZIZA 5F2GA 1V03A 3C3UA 2QCDA 1W1TA 5BCAA 5G5GB 2ZVIA 3USZA 2WZEA 3PBWA 3ITCA 4ZQCA 2HK0A 2WMGA 5K4XA 1I0DA 1LRNA 3RU6A 3C5QA 4IOTA 1CIUA 1BWCA 3STFA 4N4PA 4BF5A 1OVDA 2FTPA 4EXBA 1UUOA 5I3GA 4H8HA 4O18A 2YDAA 1W56A 1BG4A 4XBJA 5KVIA 2Y61A 3AAMA 2DSUA 3T05A 1F07A 1ZZMA 2VQUA 3TP4A 5IHSA 1GJWA 1E15A 1D9EA 1F76A 2WKGA 3EWXA 1LL6A 2QYGA 4GABA 1P0EA 3J7HA 2OELA 2OODA 4YNGA 5XIMA 1S2UA 1HUVA 4AQLA 3RR4A 2O55A 2D20A 2C8NA 1XV8A 2GQ3A 1BG9A 3VU2A 3VNJA 3D6NA 4AWUA 5AB3A 1QPQA 4CNTA 4Z0SA 5FL0A 3EXTA 1UPPA 2WNWA 1U5JA 1GERA 3U7BA 2ALRA 4AY1A 4ATDA 1OT1A 5DCEA 3GKAA 3H2CA 3GFZA 1E5JA 3SN1A 1YX1A 3GIYA 3TCEA 3MO4A 4R9XA 1KXTA 2X0SA 4F2TA 1Q63A 3E74A 4NASA 1AFSA 5LIUX 2FZNA 1C29A 3QSRA 2PMQA 2HVNA 5IBXC 2FPYA 4GI6A 2ZZBA 4LVDA 3RLHA 1IV8A 4DJDA 1B3VA 3A64A 4QCFA 4BI5A 2PLMA 3VIFA 3NTYA 3P14A 4TX8A 4ICCX 1LVLA 2XSBA 1ZRQA 1BTCA 1W1IE 3DK4A 2VENA 4CQCA 1LG1A 4GACA 4DO6A 1NHPA 4FLSA 4IMFA 1L6YA 4R27A 5CLWA 4N9CA 5K7JA 1FEBA 2YA0A 1K7EA 4BEQA 2OO0A 3PWIA 5EYWA 2V2DA 3KOFA 5D37A 1GOIA 4HZ8A 4J35A 1OK6A 4RDYA 4LV4A 4Q4SA 3HQOA 1KR1A 4XK2A 3KTCA 4PMUA 3NDZA 4PC8A 2GOKA 1G4SA 1HX0A 4HK7A 3IWPA 2Z25A 2GYIA 4KEZA 4OUEA 5E1QA 2Y63A 5BROA 1GVRA 1UMYA 2EPHA 3CUXA 1UCWA 7TIMA 3HFTA 3H6OA 1A47A 2HSAA 3BLOA 3S2MA 2YBVA 1MW1A 3CUFA 3K4DA 3JU2A 1MQRA 4EE9A 4WGHA 5AHFA 3BG3A 2IPFA 5SWUA 3MYOA 3ZSTA 4B15A 4QNEA 4ORMA 1SO3A 1TUXA 4M52A 2B0MA 4NSBA 2CEQA 2V38A 3WSUA 2A85A 2WSYA 2V30A 3TJXA 3WFZA 1UZDA 1FWRA 1B3XA 2C0AA 4NT0A 1REQB 3DGRA 4H9XA 3MWCA 3M43A 4XVDA 2QUMA 1BHGA 4WJEA 1C9WA 1EH9A 3U48A 3FGCA 1E9YB 5A2AA 5A3HA 4FK9A 1UW9A 1OJXA 3QOMA 4MUZA 3GFXA 4MF4A 3C2VA 5JUVA 5M3WA 3LQGA 3CGCA 4F0SA 4XBSA 1UH4A 4AMCA 1AOGA 5U25A 2QW5A 1OX4A 5D05A 1VHNA 1JZ2A 3HG5A 3NZRA 1MXSA 1RQEA 1RZMA 4P7QA 1ZJAA 5FEXA 2I1OA 1XLFA 3C2YA 1BF6A 3OVPA 3PP7A 4JQ9A 1V3HA 5G2IA 3GXDA 1OHLA 2YL8A 2WNZA 3SIMA 5AHMA 1G1YA 3NQFA 1T8XA 3IARA 4YTUA 1KV8A 4BKNA 2W63A 4L4MA 1KKRA 1SZGA 1K70A 2J7CA 3CUZA 1DV7A 2ISFA 1XLMA 3B0XA 1E6NA 3GS6A 1OX5A 4A3RA 4GVGA 1E1FA 1U2YA 3MU7A 2PTDA 4NILA 3W9ZA 3RFAA 3VZZA 4GXPA 1BYAA 4YHGA 2OLAA 3T6CA 3GC5A 4H4WA 3MTWA 3M46A 2WHLA 3U4FA 4NZ3A 3CHEA 4WY0F 4KWWA 1K9FA 5BMXA 1NWRA 2XVGA 4A6GA 1G4TA 1QO5A 3AXHA 1EDQA 3VYLA 4DO7A 3G77A 2YL9A 3SRKA 1UYQA 5XINA 4IIDA 3AMGA 3O1NA 3WLSA 4N2YA 1VGAA 3SUVA 2CFFA 3AICA 3C2OA 1DJXA 1UPMB 4HIBA 1L8PA 1BVNP 1KKOA 1EZWA 1Q4NX 1YMYA 2CITA 4WX2A 1F7BA 1NVMA 4AMAA 2C18A 1JCLA 3VD3A 5IFTA 2PDXA 4FF7A 4PB5A 4C6PA 1TZ9A 1BAGA 3LZ5A 4LUJA 3NWRA 2QF8A 4OBTA 1W5MA 2XG9A 4HZ7A 3URHA 2E5DA 4J3ZA 4IGMA 2C71A 4J56A 4YTTA 1O5RA 3HA1A 4NVTA 2D1ZA 4D71A 5F4XA 3ZT5A 1XG3A 4E8DA 4P2VA 1M03A 3VOJA 2CBUA 5IDIA 5CC6A 5D33A 2WPGA 3SEPA 1IR1A 2JALA 2BP1A 4NZ1A 2XH2A 3ZT7A 4B4HA 4MDPA 1MYRA 1Q6LA 3KLKA 1DL3A 3O6DA 3O8AA 2WO5A 2GGGA 1UR0A 3RYSA 1ME9A 1F3WA 3TJLA 5U7SA 3R6IA 5E70A 1R9ZA 3GTXA 1H4PA 3E9AA 5E93A 3CHVA 3LCHA 1JCTA 1FWDC 4DZ5A 3GTFA 3G5EA 3GVWA 3O0HA 1ZJBA 2OOFA 4EKJA 1V7YA 1KRAC 4GY1A 3TSBA 4KRUA 3TAOA 4JFTA 3S2NA 4UTLA 3CGBA 1FIQB 4Q33A 1VAHA 1TPVA 4HPXA 3QZ6A 5DFAA 2CYGA 4H01A 5I77A 2Y5EA 2WMJA 3BPWA 5EMKA 4UR8A 2BC0A 4HPGA 3DI0A 4PSPA 5HQMA 3L0NA 4YTQA 1UZHA 3QV7A 1BWLA 4IUOA 3NOEA 3KBSA 3LHTA 3D47A 1SZNA 3R94A 1Q6GA 3CMGA 4EF8A 1PCWA 3P67A 1WUEA 4L61A 1V6TA 1TUFA 2IW0A 3W75A 3EWBX 4UR9A 2YBTA 3CZLA 3WLOA 1BPLB 4QDWA 2Z00A 1Q6DA 2EJ1A 4O57A 3UCDA 3KZPA 1IWPA 3T8LA 2DY3A 5L6UA 1XRSA 3IJLA 1MFUA 2V69A 2OZ8A 2WZTA 4AX7A 4J3SA 4E2VA 1XGEA 1ISWA 3GLCA 3KBWA 3RLGA 4XB3A 2W66A 1YPFA 3CT7A 3TJ4A 1GQLA 2QAEA 3PBUA 5GVJA 3GTIA 5C55A 4HYWA 1TE1A 1EF2A 1W1PA 2WPBA 4CNSA 2D23A 4QAWA 5JRBA 1UASA 2NQ5A 4N0RA 3CIVA 3W24A 3LMZA 4AD4A 4CN1A 1G94A 2D2GA 4JIPA 4Q4PA 3UZZA 4QITA 4BF7A 1LLZA 3NXLA 1PKYA 3RGTA 8XIAA 1XYMA 2Z1XA 4M80A 2J8TA 4L56A 1PV8A 1ZB5A 3T2PA 4DM1A 1DWIM 5DRCA 3W84A 2VVNA 2NUYA 4AEFA 2ADAA 3LTPA 1A5OC 4LCSA 1JZ4A 4UTHA 3DFHA 3TCSA 2P8CA 2OQYA 3OJGA 1I45A 2GVEA 4E2OA 1EX1A 3GD6A 2Z1SA 5A6BD 6REQA 3AO0A 1MWOA 1JI2A 2RJGA 1S5WA 3S3GA 3UWYA 1AJ0A 2X8HA 4A8RA 1EDGA 2XISA 4ZQPA 4LEFA 4S3DA 1BD0A 1OFQA 4H9MA 2INZA 2ABBA 1XLEA 2V3GA 3TR9A 4XSMA 3FV9A 4QG9A 3NO3A 4IQEA 3TC3A 3GXFA 4HOZA 2Y0FA 3CAVA 4L65A 4A3UA 2VFGA 2CLFA 2R14A 2XGBA 1DJNA 3B8DA 1FHLA 3GG8A 1THFD 3G8EA 3MZ2A 3BANA 3E02A 1TPH1 5HMDA 2A8XA 2BMBA 4J1OA 2OVLA 3DKLA 1TPB1 4IM4A 4PH6A 2QDDA 1H2IA 1I6NA 1R3WA 1EZ2A 1VEPA 3CQIA 3HFYA 5EKYA 4X0NA 1OX4B 3L68A 4QEHA 1PTGA 3G1VA 1B0IA 1FXPA 1GT8A 3CWNA 1UHVA 2GUBA 3LLDA 4LC8A 2NT0A 3NYDA 4E2DA 2A21A 4D6DA 1IXNA 4ZOBA 4J5NA 3EPOA 3PFRA 1GVYA 3GNPA 3H53A 4GYKA 3VZXA 3W2LA 3QR3A 3B9EA 1B1YA 3TC7A 4EXAA 4YWIA 3FSUA 2E8YA 3M5VA 3GY1A 4XD3A 5FSDC 2FHBA 1CCWB 3VKAA 4O17A 1B9ZA 1KCKA 5HR6A 4LB4A 3NIYA 4GR1A 4D1IA 4FHAA 1OFOA 3LHWA 4WZHA 3RAOA 3VOFA 4WK9A 1A5SA 4UTTA 1WDPA 4AZ6A 3HZ3A 4K8HA 4ZODA 3GXNA 2CESA 3FXYA 4K36A 3UWVA 1WKEA 1JPHA 3OEXA 4H83A 4NEVA 1GEUA 2WCAA 4AD3A 8CGTA 1R0MA 1DHPA 1WA3A 4REQA 4UOJA 2GDUA 3ZOAA 1JDFA 1NSJA 4XD4A 4QFUA 2ZUMA 1OCQA 5LZLA 5LIWX 4MYXA 1W2VA 1HVQA 4DWSD 5HNTA 3UVAA 2R82A 2VFFA 1UZ4A 3WCZA 3W1UA 3FHAA 5AC8A 2H8ZA 2WC7A 4IHCA 4WJXA 4XZNX 2XWEA 3OVQA 4FIRA 1QATA 1GJPA 3CEUA 1W3JA 3GW0A 1K7FA 3UA4A 1OQFA