1KD0A

Crystal structure of beta-methylaspartase from clostridium tetanomorphum. apo-structure.
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
413
structure length
413
Chain Sequence
MKIVDVLCTPGLTGFYFDDQRAIKKGAGHDGFTYTGSTVTEGFTQVRQKGESISVLLVLEDGQVAHGDCAAVQYSGAGGRDPLFLAKDFIPVIEKEIAPKLIGREITNFKPMAEEFDKMTVNGNRLHTAIRYGITQAILDAVAKTRKVTMAEVIRDEYNPGAEINAVPVFAQSGDDRYDNVDKMIIKEADVLPHALINNVEEKLGLKGEKLLEYVKWLRDRIIKLRVREDYAPIFHIDVYGTIGAAFDVDIKAMADYIQTLAEAAKPFHLRIEGPMDVEDRQKQMEAMRDLRAELDGRGVDAELVADEWCNTVEDVKFFTDNKAGHMVQIKTPDLGGVNNIADAIMYCKANGMGAYCGGTCNETNRSAEVTTNIGMACGARQVLAKPGMGVDEGMMIVKNEMNRVLALVGRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords beta-methylaspartase
publication title The structure of 3-methylaspartase from Clostridium tetanomorphum functions via the common enolase chemical step.
pubmed doi rcsb
source organism Clostridium tetanomorphum
molecule tags Lyase
total genus 145
structure length 413
sequence length 413
chains with identical sequence B
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
A PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1kd0A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1kd0A01
2MNRA 1SJBA 2ZADA 2PSNA 1BQGA 3PWIA 4IHCA 3UXLA 3MQTA 3ZLGA 3JW7A 3QN3A 4E8GA 1MUCA 2FYMA 3NO1A 3TTEA 2RDXA 3N4EA 3ZLHA 2OX4A 3R11A 1MNSA 4FP1A 4JN7A 3VCNA 3ENLA 3RITA 3OP2A 3OTRA 1ELSA 3BSMA 2OPJA 6ENLA 3ZVIA 3T6CA 4IT1A 4A35A 2PGEA 1OEPA 3P0WA 4GISA 3NXLA 4A3RA 1R6WA 2GGGA 3K1GA 4DXKA 4KEMA 4MMWA 2AL2B 2PTWA 3OW1A 4K1WA 1R0MA 1SJCA 3MSYA 4G8TA 2O56A 2QDEA 3V3WA 3HPFA 2XH7A 4IP5A 3D46A 3U4FA 2OLAA 4HNLA 1MDRA 3TQPA 3Q4DA 3GC2A 3QTPA 3EEZA 4GYPC 2QJMA 3ZVHB 2PODA 1EC7A 2HZGA 2PU1A 4DX3A 2P8BA 4E6MA 3CK5A 2GGHA 3DG3A 4H1ZA 3MUCA 1FHVA 4GGBA 3UJRA 3CYJA 2XH2A 4DYEA 4M6UA 3UXKA 4IL2A 2XGZA 2GDQA 3MWCA 2ONEA 3CB3A 3R1ZA 3T9PA 5J04A 3DIPA 4HN8A 3RR1A 3B97A 2POZA 3R10A 1EBGA 2DW7A 2PP1A 3DG7A 3IJLA 1PDZA 2PP0A 3RCYA 3DEQA 4HCHA 4H19A 3FJ4A 3JZUA 1KD0A 1XPYA 3SBFA 4GGHA 1EBHA 3H12A 4H2HA 3V5FA 2AL2A 3I6EA 2OZ8A 4DWDA 2CHRA 5BOEA 1BKHA 3PFRA 3S5SA 3UJFA 3N6JA 4KT2A 4K2SA 4HCDA 3P93A 3QKEA 3TWAA 3UJ2A 3T8QA 1TKKA 3ES8A 2HNEA 4IL0A 2GL5A 4MKSA 1TE6A 5FJTA 2GGEA 3ZVHA 3EKGA 2OFJA 3DFYA 2PTYA 4J3ZA 3VFCA 2FKPA 2P88A 5FJOA 2OZTA 5FJUA 2PU0A 3OZMA 2PTZA 3V5CA 2GGIA 2OO6A 4IP4A 3UCDA 1L8PA 4ZA0A 3ES7A 5FJPA 1DTNA 4ZCWA 1NU5A 1E9IA 3SQSA 3BOXA 4GMEA 4FI4A 2QQ6A 3FCPA 4IZGA 3TWBA 3TJ4A 4Z17A 3VC5A 4KPLA 2QVHA 2DW6A 2MUCA 4HNCA 4E4FA 3N4FA 3DESA 4GFIA 4JHMA 1WUEA 4GIRA 4KWSA 3RO6A 3NFUA 3MY9A 2QGYA 4E5TA 4A6GA 1EC8A 2AL1A 2NQLA 3SN0A 1YEYA 4MGGA 3H70A 4ROPA 1ECQA 4DHGA 3FV9A 3DERA 3UCCA 2QJJA 1P43A 1FHUA 1PDYA 1KKOA 2HXTA 2P0IA 4YWSA 3TJIA 3H8AA 2GSHA 3TOYA 4F4RA 3VDGA 1JCTA 3UJSA 4H83A 1ONEA 3MKCA 4HPNA 2PTXA 2AKZA 3I4KA 4ENLA 3SN1A 3DG6A 3U9IA 4GYPA 2XH0A 4J1OA 3R0KA 3IK4A 3FYYA 3GY1A 1W6TA 1EC9A 5BOFA 3CT2A 3V4BA 4DN1A 4EWJA 4HCLA 3KUMA 3IJIA 2PPGA 5ENLA 4E4UA 4Z1YA 1JPDX 1JDFA 2AKMA 1NELA 3R0UA 4K8GA 3MZNA 1IYXA 2P3ZA 4G7FA 3Q45A 4HYRA 1KKRA 3SSZA 3UGVA 3FXGA 3VCCA 3RGTA 3S47A 3JVAA 3ZLFA 5IDZA 3D47A 1WUFA 2I5QA 2OZ3A 3THUA 3N6HA 3TW9A 3GO2A 7ENLA 3UJEA 2GGJA 3H7VA 3GD6A 2OVLA 3VA8A 2OQHA 5EU9A 3VC6A 3OZYA 2OG9A 3IJQA 3PK7A 2QJNA 3QLDA 1P48A 3NZGA 2PMQA 2PGWA 4M0XA 1JPMA 3TCSA 3OPSA 2ZC8A 3I6TA 1F9CA 1KCZA 2OKTA 1TZZA 3SJNA 2QDDA 1MDLA 2PA6A 2PCEA 3PWGA 2PS2A 3CAWA 2XH4A 2OQYA 1SJAA 3QPEA 1RVKA 1MRAA 3STPA 1XS2A 3RRAA 2XSXA 3T4WA 4X2PA 5FJRA 3DDMA 3BJSA 1SJDA 2HXUA 3DFHA 3P3BA 3R25A 3FVDA 2P8CA 3SN4A 3DGBA 4JN8A 3CXOA 2PP3A
chains in the Genus database with same CATH superfamily
3GTXA 1EX5A 3ZQ9A 4JL2A 4Q4OA 4FLOA 4L4LA 4N6FA 3LCIA 3A6OA 1JAEA 3BJTA 2G4JA 4TV6A 4YYCA 2D2GA 3UZYA 1HJSA 1W3IA 5CPMA 5KETA 1L6FA 1VFHA 4LAUA 4QTGA 3LB8A 3SQPA 2V30A 4TVDA 1UASA 5AC7A 4AZHA 2ZTJA 3NXFA 1E1FA 1NOUA 4R7OA 4AZCA 4M81A 3R2GA 4O11A 1RCQA 3AWNA 5HNNA 1OX5A 5C9XA 3HG5A 1JEHA 3DHPA 3WQPA 4JNMA 3K2GA 1TELA 6REQA 3AFBA 1M1BA 3I3DA 4D6EA 4GY7A 5IHSA 4EAYA 2D69A 2WMIA 5CXPA 2CLOA 2E40A 2OB3A 5LHEA 5I00A 3W7GA 1A53A 4UTHA 4Q8NA 7XIMA 2W79A 5GPRA 2Z1BA 3B3DA 4BK9A 4P7QA 5CH9A 4NRSA 3BLOA 4HHHA 4J3TA 4LB3A 3TN4A 1I6NA 2V3BA 2TSYA 3P7YA 3LNPA 1HN1A 3TQPA 1XYAA 4B2DD 3NM1A 4IQLA 2VI0A 4AYGA 2QJMA 1EIXA 3V1HA 1HNYA 1B90A 3MUZ1 5I09A 3TA9A 2EJAA 2HZGA 3GDLA 1W3JA 4B5WA 3EPNA 1K4QA 4KERA 3RX2A 2FMNA 4AD2A 5LIKX 7REQA 4DUOA 3HRDC 3N1AA 2ZE0A 4LUTB 2RGMA 4IOTA 2DFAA 5JU6A 3NQAA 2JF6A 1CENA 1SU5A 2ZXBA 3M0IA 4HN8A 2QPUA 4JTEA 5REQA 3B97A 2C0AA 3NL6A 3SUWA 3EWZA 1N60C 3FIGA 4HCHA 2WVUA 1OT2A 3CHCA 3CO8A 7CGTA 2O9PA 3H7RA 2ACUA 5PTDA 1XPYA 2AAMA 4IUOA 4L65A 1I0BA 4LYKA 2IKHA 2Q8ZA 3W6LA 3W7OA 3I6EA 3KX6A 3WQEA 1OC6A 1PEZA 5DMMA 1UUMA 5JCLA 1G7VA 5BOEA 3BMVA 3R13A 4XIAA 3WD2A 3S5SA 2NQZA 2O92A 1OJXA 4JTGA 4UTUA 3GDKA 1TA3A 4KT2A 1KC7A 3AXMA 1YQZA 1LWIA 4ATDA 3V16A 3VIPA 3MB9A 1VIZA 1QNRA 3LPGA 5IM51 3ZJ8A 3TTYA 2J66A 3EKGA 3ZFHA 3WLIA 3GNRA 4M6VA 4DWSD 4NEVA 3AMKA 4B5SA 2DP3A 2D2JA 1XQKA 1JDEA 4HZMA 1ICQA 1GRHA 2XTKA 3RPTA 3FCPA 4QS5A 1PZ2A 4XAZA 2F61A 3CYVA 3TJ4A 3F1QA 1L6YA 2QZRA 1UWSA 1YIXA 2MUCA 4K36A 3VCRA 3VGDA 1IGSA 1NQKA 2D1ZA 3DESA 2X42A 1J6OA 4ZQOA 4ERAA 1FP8A 3S1UA 4OHQA 1DHKA 1BKSA 2H8ZA 3VGFA 3SRKA 1GESA 4F2BA 2QW5A 4A6GA 5DT7A 5AECA 4DHGA 3DJGX 4OU1A 2XVPA 2NQ9A 3PANA 1N5XA 1J9YA 2BVTA 4WHBA 1OCQA 4JPGA 2FJUB 3KLKA 2HK0A 3DGHA 1FWBC 3TC6A 3OODA 4M6QA 4K8DA 5A8QA 3KBWA 1YPIA 1O12A 3SR6B 1UJPA 2OYMA 1CXHA 1J96A 2R1NA 2CPUA 2O9OA 3KFTA 1MO9A 3S46A 4DO4A 4S23A 3TMLA 3TU9A 4DBDA 2XSAA 3ERPA 2Z1WA 4FNTA 3OVRA 2DGAA 3LBCA 2PTXA 1C8QA 2DT1A 2GJXB 2SFPA 3FW6A 3IVSA 4I90A 4QAIA 4PMRA 5J5DA 1ZP3A 2E0PA 1EBDA 1GUVA 1JCNA 4PN2A 4GXPA 1P6BA 5FI8A 3VDHA 3VIJA 2HROA 4E4UA 3AHZA 3SCSA 4RNJA 1VCFA 4FX6M 7A3HA 1WAWA 5D2XA 3HIJA 4MB4A 1W2PA 1O1ZA 2J9ZA 3H21A 4MYXA 3TYBA 5K4ZA 3IEBA 4PEEA 1N7KA 1RQHA 4G1KA 3GXPA 3W2JA 1TX2A 2PFHA 2Y62A 2W3RA 1T0OA 4B5TA 3QV8A 4RDYA 1FWCC 1SSDA 1JCYA 4LEQA 2RDTA 3AMDA 2CETA 3CV7A 3I10A 1QO5A 1MWOA 1J0JA 3AMCA 1S5NA 3L9CA 2BCPA 3ID7A 3DI0A 2DEPA 2Z24A 4F9JA 4OVXA 3H7VA 3NOEA 4XX6A 1U5JA 2HS8A 2ZKMX 3S1GA 3E0IA 3R12A 1EYEA 1YBQB 3LRLA 1BWVA 1UR3M 1C9WA 4JIRA 4LY4A 1UG6A 1TPUA 2PGWA 1TVLA 1YQ2A 1QK2A 2VZVA 4GZIA 4MB3A 4XAFA 3UEQA 2H9AB 5JBDA 3AM9A 4GVFA 1Y0EA 4D8LA 1N5WC 2QJIA 1GKPA 4NZJA 2QPSA 3LTSA 2BLEA 5EA9A 1T7LA 2XH4A 1RPXA 3N34A 1ISWA 3M0MA 5JH1A 1TB3A 3GNXA 3T4WA 4PULA 1JZ2A 3S42A 4B2DA 3CGTA 4ACYA 3CZGA 3VD9A 2XWEA 2J88A 3FVDA 1KCKA 1HL9A 3VUPA 3U48A 1A5NC 1BWCA 3NYZA 2BGQA 4LC8A 2RH9A 4FEZA 1TX0A 4RE2A 3O9NA 3BH4A 3R5EA 4N7QA 3MQTA 3I3BA 1BPLB 4DEFA 3N2CA 3EDKA 3HQ1A 5HPCA 4IISA 2V2DA 3UBPC 3D3FA 1PWLA 1XIJA 4X63A 2OLHA 5E1QA 4GZ7A 4H4ZA 5FS9A 3WDHA 4H6QA 3UESA 4U3CA 2Y7EA 3G6LA 5HUOA 9RUBA 1TPB1 3UF9A 3AICA 2X1UA 3R43A 3P0WA 4UCGA 4R34A 3O8AA 2QAFA 1SMAA 1XKJA 4DPPA 3EKLA 1JDAA 3MO7A 4J56A 1DIDA 2FPTA 2AL2B 4X22A 3TJXA 3C0LA 3LXBA 4Z2GA 1ZGDA 3QVQA 1SVDA 3W7LA 3KTSA 2Z1SA 3APGA 3E6EA 4ZQNA 4JIQA 3V3WA 4D6GA 4P8VA 2ALRA 4J2PA 3SY1A 1Z7AA 3FJ6A 4QRNA 4QR6A 4UTJA 5FEXA 3ANYA 3S2CA 1VFMA 3Q4DA 1CI1A 4O52A 2WP5A 1HIZA 4BY3A 1XSIA 4X2RA 3GR8A 1ZALA 1WXJA 1CGWA 4M3PA 3L4WA 4HSHA 4H1ZA 3W26A 1FWRA 1CB7B 2J9XA 1V7YA 2XH2A 4O10A 5E6ZA 1UB3A 3P5YA 2B0MA 4QROA 4DZHA 5HDRA 3VIMA 1BYAA 1IGWA 5FOOA 1HGYA 3D9XA 3C52A 3FN9A 3GFYA 1S5WA 2PP1A 1IE7C 3F2CA 4GO8A 3MHGA 1R3RA 4WDWA 1XBYA 5DRCA 1KRMA 1LL7A 2V2CA 2BC0A 1OFEA 2GJNA 4LRSA 4US5D 1GK8A 5G1YA 3WMLA 1NWTA 1FO4A 2X40A 5TQLA 4UFHA 1HVQA 2W9MA 1G67A 4PMVA 5DEZA 3D3AA 2OZ8A 4EWND 4DWDA 1A5CA 4XQ6A 4H50A 4GXMA 3H4XA 2CZDA 4IMGA 2BS9A 4LBSA 1JD7A 4GQ0A 5AC8A 1LRNA 3M0JA 2R1PA 4K2SA 2XIJA 5KEZA 2CU0A 2GWNA 4FXJA 1TKKA 2X16A 1FFVC 2CBVA 4RNFA 2NT0A 3TH6A 4DJEC 4JYDA 3ABXA 5FJTA 2V5LA 1JPIA 4PUDA 4J3ZA 1HW6A 2DY3A 4DZAA 2Y89A 1UR4A 4TOQA 3VIFA 3CM4A 3AYRA 2WYSA 4IFKA 3ES7A 2E09A 1HF6A 4IXXA 1YDNA 4XZBA 1GETA 1KM6A 3S9ZA 2GRTA 5F2GA 2A6NA 1P0BA 4GHRA 1ITQA 3R07C 4UFLA 4PMZA 1N62C 1TVNA 3B9EA 1KXQA 3ZO9A 3CGDA 1KBJA 2W55A 1P6WA 3E49A 2VCBA 1UWAA 1U1JA 3QGVA 2X1RA 3PP7A 4H01A 5E0FA 1TCDA 4JTSA 2WC3A 1MSSA 1QI3A 5U25A 4FNUA 4KWOA 1KGWA 4CNSA 4MGGA 3RXZA 1YYAA 3PJTA 4S3EA 4ZO9A 8XIAA 2FVLA 5AHNA 3ARVA 2VZSA 2YVFA 1ZJBA 4KW2A 3CL8A 4XK2A 3GAYA 2J7HA 4W5UA 1GXFA 1PDYA 4RDZA 4CD5A 3GRIA 2QJGA 1W3NA 4FXRA 4UOJA 3AIEA 4K38A 1MRQA 1M03A 3FA5A 3MBFA 4GCAA 4F0LA 4XD4A 2J74A 2I57A 2YCIX 3KL5A 4GYKA 4N9BA 5CKSA 5K9XA 3MKCA 1NOWA 4XWUA 3MHUA 5K3VA 1CZ1A 1US2A 3CPGA 3UR8A 2WMFA 2IPGA 3U2CA 1IWAA 3PBWA 3M0ZA 1TZ9A 4Y9MA 3ZS4A 3W00A 5BNKA 3CT2A 2WP6A 3WL0A 1AFSA 3LD5A 3GYCA 1TWDA 1Q85A 1X1ZA 1KM4A 1A4LA 3R58A 1JPDX 4KCVA 4E8CA 1RBAA 2J78A 3MKVA 3WJWA 4MAZA 3LN3A 3KL3A 4CVWA 1FTXA 3L2IA 3GTIA 2J75A 3LPPA 5H91A 1QTWA 3N4AA 3PG9A 4LB4A 3G1SA 4LTSA 4JQ2A 1XLAA 5A8OA 2VC7A 3VABA 2A21A 4Y8FA 2CITA 2UV8G 5HMSA 3RJYA 2YDAA 1DORA 4EAMA 1JNEA 4IUGA 1H6VA 2KZHA 1EDQA 4ZQCA 1NFPA 3OQ8A 2VNCA 1WAUA 3ITOA 1KXTA 4IIDA 2BY1A 3HMCA 3GKAA 3OIHA 1JPMA 3EB4A 4O4VA 2QV5A 3T0TA 3A4AA 2R1MA 4NVTA 5G4WA 2FH6A 3ARXA 3AROA 1FKWA 3REQB 1YDVA 4Z2LA 5EFFA 1U33A 3GH5A 1F6KA 2CXGA 4H4YA 1B3XA 4BV6A 3DU0A 3WBYA 4C6BA 2CHNA 4RXFA 1KO0A 2A6LA 3UXAA 4H4SA 3ARSA 2DVXA 1AJZA 1GOIA 4LWWA 3VKAA 4ZQMA 3C56A 4MDOA 1EJSC 1R3QA 1ZAJA 4O54A 2NV2A 1Q1RA 3TQKA 3TTSA 1QOPA 4DJDD 3NGFA 4MWAD 4TMCA 1AQ0A 4M5PA 1FCQA 2ZDSA 1GVRA 4HA0A 1IT7A 1RLDA 5EBKA 4IJBA 3LGEA 2JBMA 3S2MA 1FFQA 2OMAA 2RDXA 4S3KA 4KCUA 3W72A 3AIBA 1QWKA 2PWGA 1XANA 4IMFA 1FCUA 4JN7A 3RITA 1ELSA 5C2GA 2QUTA 4FNRA 3T6CA 1J2BA 4PTDA 1FIQB 2RDWA 3HGOA 4R7JA 3GLCA 1I2NA 4PBFA 1JFHA 2Y7FA 3DH9A 1K9DA 3CZKA 1ZAIA 4CNTA 2W66A 3SQLA 3H4GA 2NVDA 3SCQA 3L12A 4US5A 2BBFA 3NQMA 2VQTA 5M17A 2R8WA 4YCPA 4UTMA 2EQ9A 5I3GA 1O94A 1S5VA 2OU4A 2FH8A 1QMLA 1DWIM 4PL1A 4PUUA 3WQWA 2O56A 1QRQA 3B05A 3HV8A 2OGJA 4GABA 1XLHA 5I6SA 3RX3A 4CN4A 4LNCA 1B9ZA 1IV8A 2XN0A 4JX6A 2JF7A 4O15A 2OWCA 2O9TA 2LLEA 3W85A 3ONCA 3EDFA 1QCWA 2C8NA 1XLCA 3T0BA 3RPDA 4H7CA 4AWSA 4H9ZA 4WDTA 1WXYA 2PU1A 4QJ4B 5F1VA 4EP8C 3W7QA 1XINA 1D3GA 1J5TA 1YDYA 3SSJA 1A4MA 1EUNA 4IG2A 3URAA 2HVMA 3NCOA 1H4PA 2VGGA 4V28A 4QX4A 4DLMA 1W3KA 2YXGA 5J04A 3L0NA 1IHIA 5GRTA 1H3GA 4C1NA 3L5LA 3S5ZA 3BL3A 3UNTA 5AHLA 3P14A 4WUIA 3K4AA 2NVCA 1JAKA 3PUDA 4XUYA 4P7NA 3LQLA 3MYPA 2NV9A 3BICA 1XCXA 3CQJA 4LYQA 4LQ1A 4POCA 3M0YA 3NQGA 3Q58A 2Z00A 5EMKA 1A3WA 1GQIA 1PTDA 4BA0A 4XAPA 3NQEA 5TBOA 2FJKA 2VEMA 4KGJA 1UD8A 3GQYA 4W8AA 1PHWA 3BZJA 3SZ8A 3T05A 1AW5A 3OVQA 4I5XA 1JUBA 3LCXA 4BF7A 2YPIA 3L0GA 1OCJA 2QHAA 1ITUA 2Z26A 2RUSA 3W23A 1LROA 2V68A 3OB8A 4LS1A 1E15A 1ZAHA 2VFGA 5J8LA 2OFJA 2UWFA 2WOQA 3HB9A 2HPMA 3W73A 2FZNA 1UH4A 2WJZA 2FFCA 1EHAA 1VGAA 4E3VA 1DNCA 1KM5A 1SM9A 3P62A 3ZJKA 4AD3A 1UUOA 3URQA 3M07A 1ZNNA 4J3VA 1SFJA 2QCLA 1UWQA 2O7SA 1UP3A 3LM7A 2OCZA 3L0KA 5HQMA 2DH3A 3B9NA 2WWCA 2QQ6A 5CPLA 4PMNA 1VPXA 1L8NA 3FYPA 4I8DA 1W3HA 2ZZ0A 2PLJA 1GRAA 3WLQA 2QVHA 3SIZA 4HA4A 4XISA 1Q6FA 4GUGA 4Z1CA 1O5RA 1UHVA 5EMMA 1XUUA 2JQXA 3O6YX 5HPOA 4DYJA 2H90A 1WUEA 3MP3A 3SN0A 3N11A 2ZUSA 3M64A 1UYQA 2GFTA 3DKJA 3BPWA 3MUIA 5L6UA 1JRBA 1UP2A 3MU7A 2Y8VA 5D8WA 1M3UA 3C86A 2DORA 4J57A 4GKTA 2VO5A 3NPUA 1P0DA 3LMZA 2PE4A 4AHOA 2WBAA 1VC4A 1W1IE 2QCDA 5DX7A 4WVXA 1ADDA 2P0IA 2QAEA 2VR4A 5C9RA 3BQ6A 4H8VA 4D1JA 3DFOA 3O07A 3VDGA 2DJXA 3SIMA 1QW7A 3NVVB 1G4TA 4JYEA 1XIMA 3C5QA 3TLLA 3NQ8A 2WLZA 4MF4A 1R3SA 1WB0A 2Z27A 1HP5A 4JQAA 1HO1A 2PDHA 4YLWA 1MZRA 3EDEA 3B04A 1PKYA 3HPSA 5D9PA 2PC8A 1YE4A 4RE3A 2QVNA 3N15A 1GYNA 3E3HA 3E1F1 5F2IA 1W1A1 1NH6A 1X98A 3WNKA 2Y2WA 4N02A 3NPWA 3QM3A 2YB1A 4I9AA 4BI7A 1IYXA 4WSHA 4DJDA 1LOSA 3SSZA 2ZICA 3WJYA 4MWAA 1AMYA 2XFFA 3RJXA 1U1HA 1XLIA 1J8VA 3EB3A 3L5OA 4TR9A 1K7EA 2PDMA 5HBFA 4IMCA 3UU0A 2YZRA 2FZ8A 5AC5A 3EMQA 3ZJ6A 3NQDA 5HJYA 3CASA 5MKGB 3IAPA 4I9JA 3KBMA 3OZYA 1PO9A 1MUWA 1H61A 2IUZA 3RR4A 3PTQA 3W7NA 2NVKX 1C9DA 1ZU8A 1M7JA 4UR9A 1V93A 3BAIA 3PJUA 3PBYA 5AC6A 4L4OA 3AN1A 4OIFA 5C7HA 4PCTA 1E4LA 1GG1A 1TR9A 3RCNA 1E56A 4R5EA 3VNIA 3VOGA 1KM2A 5CGMA 4PODA 2WSYA 1C7SA 1ML1A 1XG4A 4C91A 3TE9A 1R2RA 3VMPA 4JN6A 3B4YA 1YTKA 3DDMA 1NVMA 1FXQA 2DZAA 5DMLA 4HHMA 3UETA 3CHVA 1FECA 4YHGA 2PP3A 3P67A 3OC4A 3AI0A 2ANUA 2PSNA 5E6YA 1LQ2A 3P61A 1TMHA 2REQB 5KZEA 1S46A 5DMYA 3OU8A 5EKYA 4LC6A 2D20A 3LPFA 3P82A 3LV6A 4FXSA 2E5BA 1KWKA 2VGIA 4UTTA 5JBFA 3R11A 5LIUX 5ECVA 1KM3A 4GE8A 3W7CA 4BFAA 1UZ1A 1OY0A 3BWWA 1IEXA 2E5AA 2J7CA 2NXHA 4HSNA 4JQ1A 3CHDA 5AYYA 4GQGA 4FB7A 1T96A 4CU7A 4JFSA 1F8IA 4HPHA 2WMHA 5HANA 1H7NA 3LHYA 3H26A 3DBNA 1V77A 3PB0A 2WJFA 1GNXA 5AVNA 1EOMA 5AFDA 2PGRA 3C4UA 3OW1A 3LNMA 1HJXA 3IK2A 4O50A 1YTEA 3QC0A 4GG9A 1Y65A 4LV9A 1R7AA 1Z42A 4MKNA 5BRPA 4RZ6A 3W27A 3OG2A 2DVUA 4LCSA 2ZBTA 1JFXA 2J6XA 3CUGA 3GC2A 3WF1A 2F84A 1EC7A 1K6AA 4KCWA 2PDQA 5EBUA 4W7WA 4DX3A 5CSUA 4WCJA 1KFJA 1WP6A 3EA2A 1OT1A 3ZR5A 4ZVJA 4AF0B 3NVZB 4DYEA 1DWHM 2JALA 1GKRA 4QSHA 1UA7A 4FOKA 1H7XA 3SURA 1Q65A 2DZVA 1UOZA 3DX5A 2INFA 3VKCA 3KEHA 2ZA1A 4DBUA 3VMOA 4PMXA 4JTFA 3T0CA 3MYOA 1XDMA 4JCMA 1MMFA 4XTDA 3QTGA 5E93A 3CIWA 3SFKA 3GKFA 5TIMA 1H1NA 1W8SA 1D8WA 1N63C 4RCXA 1G69A 3JS3A 5T9BG 3QZAA 4QDWA 3MDUA 1CLVA 3GD3A 2YA1A 3PFRA 5TF0A 3GBEA 4EM4A 4NHVA 1OYAA 4K8HA 5BRQA 5KZ6A 1TV4A 1XLBA 3BW2A 4L1WA 1L6GA 2HMCA 3CAKA 3TV8A 4UBPC 3VIGA 1VYPX 4DF2A 3K4WA 4DF0A 4WRHA 1HKMA 4B4FA 2A5HA 2YSWA 3DOPA 1FWNA 3DYPA 3NOYA 1MFVA 4P2VA 2O55A 4QXIA 1TR1A 2PU0A 5AHMA 1V3MA 1TRIA 3UCDA 3ZZ1A 1GVQA 1I8JA 4PBEA 1MQQA 4LUTA 4XTIA 2I14A 4H00A 1ZL1A 1FWHC 5FSDC 4ZFCA 5DELA 3TWBA 3COTA 4P5UA 3FVMA 4Z17A 7TAAA 3SCNA 2HSAA 3S4TA 3EB2A 2DW6A 3UT0A 3TX9A 1JYNA 4G7EB 1UOKA 3GU9A 3THQA 2YYUA 4H3DA 3N9SA 1WNOA 4Q8VA 4E5TA 4Q3MA 2A79A 4JKMA 1JCMP 5C8BB 3LK6A 3T78A 3NRZB 5I2UA 2C79A 1ECQA 1WKFA 3CQKA 1W56A 2WNWA 5AHIA 2A4AA 1MQPA 2QCNA 3A64A 1EQPA 3ANUA 4A2SA 1PB0A 3UCCA 2CXEA 1REQA 1FHUA 2WCAA 3CO4A 3QFWA 4ZXOA 1QBAA 4GX8A 4WY0F 1CXEA 3LOTA 4BEUA 3H8AA 4AD4A 2J4GA 3FSTA 3VK5A 1IXOA 3CUJA 4MNJA 4PBGA 2PB1A 3NJ3A 1ZX9A 4C7DA 4HB7A 5E9XA 4DAIA 2R9RA 1VJIA 2ATMA 5EB8A 3FYYA 3KWSA 3N6QA 1ISXA 3GC4A 2Q02A 1S5TA 2ADAA 3CAVA 3BG9A 4F8XA 2GSEA 1N61C 1V6YA 2FTPA 4U33A 4WOQA 2YW3A 3OO2A 1XKYA 1H7PA 3FNDA 2ZX6A 2A7PA 4ZTXA 2GH5A 1JRCA 1QNSA 4LGXA 3IPWA 4J7RA 1NDAA 1OD8A 1ZK7A 3W1TA 5IDZA 4W88A 3AS1A 1XYCA 2NW0A 4KETA 2BHUA 1ONRA 1CYGA 1BG4A 3WLPA 4PMQA 3E12A 2HISA 7ENLA 4EPEC 3MUY1 3GXFA 1UC4A 4AWUA 1A5KC 1NIUA 4C7FA 4Q7BA 5LGZA 3U6WA 2WPBA 1P48A 1ZCOA 4D6IA 5A8GA 1K9EA 3QHMA 3UWVA 4MKVA 3GUWA 4PE8A 2WM1A 5I7GA 1F9CA 3HMJG 1WV2A 3FOKA 2Z1XA 3A7AA 3QHNA 1BVNP 4QJ1A 4NAEA 2FGZA 3MJMA 4RV3A 4UTKA 3PNZA 2GJXA 1QOQA 3VOJA 1B3WA 1MXSA 3WLJA 5HQEA 4TTGA 4ERIA 1G7UA 1PCWA 6TIMA 3CTLA 3ABRA 3VD4A 1KN0A 1W9UA 1XBXA 3TN5A 4PMDA 2C7FA 3GDMA 3EMCA 4DO5A 2PDLA 5HQLA 2VEKA 3WBEA 1J18A 6XIAA 1XQLA 4JDRA 1ONWA 1S5MA 4UTFA 4U2YA 5AB3A 4I6VA 3OEXA 1VB9A 1Q1WA 2QYGA 2X0HA 4N4PA 4KIEA 1WOAA 2X7WA 4LF1A 3ZLHA 3H2EA 1F07A 3QQ0A 3WF2A 4Q4SA 3M41A 1D3HA 3W22A 4FSAA 4L6DA 2NXGA 1EQCA 1F3XA 4A35A 4DXVA 4GISA 1YBQA 3AXHA 5EL1A 4DELA 1QI5A 4CCDA 3Q67A 3WF0A 3QR0A 2DSWA 4FMVA 2GR1A 1A50A 4QLJA 4H4TA 4LBRA 1CGYA 1GT8A 4H7VA 1VBRA 3KDNA 4KFPA 3NO5A 3MS8A 2OXNA 3CL7A 4CQCA 3KS6A 1PUDA 1MXGA 2VJXA 4IP7A 3WFAA 1W9DM 4DO7A 5DBTA 4D6DA 3BSHA 1G4SA 2W5FA 2VOTA 3M0LA 2FGLA 1FDZA 2OSWA 5HWJA 3WNMA 1V0KA 5CC7A 3GUGA 2PURA 1GZJA 1T8QA 8A3HA 2CLPA 3WEOA 2VFEA 1FHVA 3C2EA 4ECLA 4GGBA 4GFSA 2PCQA 5T8GA 4JTQA 5CC5A 1WKEA 5AVHA 3WH6A 4LANA 4DJDC 4H6EA 5FL1A 4C6NA 3BGJA 3CB3A 4K8EA 4MWAC 3KLLA 2G95A 3ZT5A 4WJXA 4HK6A 4V15A 1DXFA 3KS5A 1OFAA 3WK3A 4URIA 1LBFA 2WSKA 2QMJA 3EX2A 4AB4A 5M2FX 1W9XA 4JQ4A 1IEWA 1QUMA 3AO0A 2EBNA 2QUNA 1FUYA 2VP8A 4UMAA 4Q4KA 4NZ1A 3OOQA 4K68A 4AZBA 3W9ZA 4IGHA 2OZ0A 4FF5A 5CSRA 1EA9C 2V3FA 3UZWA 2AL2A 1YPFA 2OWWA 3IRDA 3A4XA 2CHRA 2EKCA 1FX6A 1ADOA 8RUCA 1IT8A 3BCJA 3DGRA 5DANA 3MVTA 3UJFA 2F5ZA 1PIIA 3LTPA 1BRLB 1A5LC 4PRWA 2VKZG 1VJSA 2TMDA 1QO2A 1XYMA 3AQUA 7PTDA 1XGDA 5LIYX 4MKSA 2V63A 1JCXA 1EJUC 1YE6A 4J40A 2TYSA 5ER0A 4K3ZA 3PWAA 2OEKA 1CCWB 3TSBA 3OZMA 4CNPA 3QH2A 2FZ9A 4H9MA 1YHTA 3R4IA 1JDDA 1TMQA 1BYBA 1HL2A 5K7JA 2OO6A 4P7LA 4MLRA 2B7QA 3KP1A 1N8IA 3LHZA 5CJMA 3BW3A 3K5XA 1UD5A 3S1VA 1UD2A 2HEJA 4ZFMA 5U1OA 3CV1A 5HMEA 4BCEA 3IRSA 1UIOA 2VUYA 4LAOA 4XAGA 4WXZA 3ANVA 3R8HA 1NTHA 3PUOA 5FF0A 2E25A 2DIEA 5BWAA 1JUKA 1BWKA 1FWJC 1S1PA 2WHMA 3BAYA 3URNA 4B5NA 4BQ4A 4NX0A 3CZ8A 4UTTC 2FIQA 1X1OA 4IM4A 2P76A 1FEBA 4B3LA 1TWWA 3RO6A 3V5OA 2YCKX 2PWHA 4L6HA 2E68A 3Q94A 1O95A 3U7VA 2BMBA 3THCA 1FWTA 1IEVA 3FLUA 1QW8A 1UJQA 4IMEA 2AQVA 3S5OA 3QOMA 4JX4A 2PC4A 5F1UA 2VRQA 2X09A 5C9WA 2QJJA 3IANA 3O06A 1S2TA 4J28A 4YWSA 3UYIA 3W70A 3W74A 2FZBA 4JFUA 4PSRA 2GSHA 4AIUA 1SSGA 2NUWA 3E9AA 2ZFAA 3QFEA 1JZ3A 4Z1DA 2YBVA 3SQMA 3CUXA 4D9PA 1P7TA 4HGXA 1O1HA 4GJJA 1XCWA 2R82A 1PHQA 2B81A 1LOLA 2GWGA 1IZKA 1FDYA 1TCMA 5FACA 4CD6A 4O18A 3K46A 3EGJA 4QAWA 3TCEA 1D7KA 4TVYA 3PZ9A 3AXIA 1UIPA 4AVOA 3BLDA 3PZIA 2WOVA 2WOIA 4AW7A 4K7ZA 4WOZA 4Z2IA 4G7FA 3Q45A 2ZZCA 2ZXQA 3FHQA 1X1NA 3UG3A 2V38A 2BXVA 3DENA 3P8JA 2ACSA 3TONA 2WHKA 5D2VA 1E4IA 2EG7A 2JEPA 1FFRA 3NIYA 2HE5A 1BEUA 2QNEA 1LRQA 3KOWA 1DKWA 3LCWA 2ISSA 2VUNA 3UYCA 3BLKA 3N29A 2QIWA 4K39A 3TW9A 2GGJA 4RE4A 4HA1A 2VX5A 4BZYA 4XD3A 2QDHA 4JHZA 1KR1A 4H41A 1KBBA 2AGKA 2WZEA 3PZUA 2WC4A 1TPDA 1WKDA 2J47A 5CSYA 2JKEA 3FEQA 4JBRA 3KBVA 1Y5XA 2YGYA 2YW4A 1LCOA 1V3JA 1DJWA 4WDUA 3AZRA 2ZX8A 3BTNA 4EQSA 1SPQA 2EG6A 3W07A 3MA8A 4S38A 1EEXA 4BF9A 3M0HA 2EHHA 3ABOA 1FCVA 4DY1A 3TTOA 2X0YA 3CMJA 2DZBA 4NG3A 3SRDA 4G5DA 1RD6A 3NEHA 3SCUA 5CJ5A 4WY0B 1NHSA 4LBUA 2YL8A 1I9CB 1GCYA 2MNRA 5GNXA 5I5RA 2OGYA 3T09A 3FEMA 2ZZ6A 1OYCA 2D0GA 1HG3A 2XGBA 4HYVA 3GFZA 4IPIA 3UXLA 2G50A 1PZ3A 2D23A 4NRRA 2W4XA 3ZLGA 1PTGA 1V5XA 4OKDA 5BW6A 1AH3A 5BCAA 1S2AA 3AXKA 3TFCA 3TTEA 1S1RA 2A85A 1A49A 2WPGA 2IW0A 1AOGA 1MNSA 2VZOA 4FP1A 3TEVA 2WVVA 1XISA 3TA6A 3MDWA 1K9TA 3CEUA 1XLMA 1JULA 1G4EA 4XIMA 2WJEA 1PJ9A 1UR1A 2YFOA 3GRSA 3ZSTA 4D6HA 4GNJA 3IV3A 4IT1A 4K37A 2PGEA 1KXVA 1UA3A 2QIIA 3M5ZA 3UWQA 2Y63A 2OLSA 2ESCA 4ZE5A 1X2HA 1Q45A 4CD8A 1VFOA 2C19A 2CBJA 3G5EA 3VIHA 1FWFC 5M5DA 3FXYA 1E6NA 4M51A 1WDSA 2ZUWA 1Y5VA 3DFSA 2BY3A 3REQA 3A4WA 2VM8A 4A8IA 3AHVA 2E6YA 4QSFA 4ES4A 4JX5A 3M6YA 3EOUA 3N12A 2FDSA 3EBVA 2YBTA 3EEZA 3UY8A 3G1DA 1GRGA 2CKSA 1DL3A 4ACZA 1E6SM 2FHFA 2NT1A 2QGHA 1P0KA 1BSIA 1OF8A 3QYQA 3TW6A 1A5MC 3GNNA 3DKLA 3DBPA 2OQLA 1F05A 4RPQA 1OK4A 4FS9A 3A22A 5F2MA 3LHTA 3WD3A 3K8MA 1A5AA 1H60A 2QCHA 2OOGA 1QASA 1YPXA 3WLRA 3DIPA 1EUAA 4CUCA 3D0CA 3PBVA 1XDIA 1EBGA 4O8RA 3GNOA 4N4QA 2VR5A 5G2HA 3NM3A 5FS8A 1Y5WA 4GRSA 2GJPA 3CIXA 4XV0A 3ARPA 1X8FA 1KV8A 2VR2A 3AYTA 1M04A 2FB3A 1TZ7A 4PUMA 1Z44A 3WUEA 2C13A 3L66A 5A6SA 1ZTVA 3VGEA 3IGHX 1U1UA 4B9YA 2BZNA 1EWDA 4H9VA 2PDXA 2X2YA 4J3XA 1VH7A 3ME3A 5C9ZA 5LNSA 3T07A 3THDA 1OYBA 3LS9A 1VBUA 1PE1A 5HULA 3WLNA 4JIPA 4HA3A 1JRPA 3LADA 3FS2A 5D37A 3VFLA 1ZXIC 2VEFA 3CUZA 3USBA 2HNHA 1U5HA 4WKFA 5FJPA 1OSEA 4FR1A 1IZJA 2NLYA 1OM0A 4ZO6A 4GMEA 4HMDA 2F2HA 4IGMA 4UZUA 3KM8A 1XIFA 3UZ5A 1OGGA 3IJ6A 4L56A 2DUZA 1OFRA 1P1XA 1FOBA 3TN3A 2ASHA 2O0TA 4HU3A 3N4FA 4BQ5A 5FD0A 2VC6A 3NNTA 3W6YA 3ARUA 4HJWA 5ABGA 1V6VA 2VRKA 3RF9A 2W62A 3MMWA 3QR1A 4IQEA 4CVUA 2ZWYA 3MY9A 2YJQA 2AL1A 3DN5A 1YEYA 2DDXA 3CQIA 1OX6A 1N8FA 1TREA 2OEJA 3BJFA 3FV9A 3KBNA 2AGTA 1JCLA 3IS4A 1CTNA 2GUYA 5XIMA 4ORIA 5HUPA 4WDXA 1KGXA 4R33A 1UKOA 1EFZA 1PS9A 2Z4GA 1F6YA 1W0MA 1V6UA 4ERGA 3HQPA 1AMKA 3GDBA 2XN2A 3L4TA 4UWMA 3AU2A 3C2FA 3GYEA 3LTYA 3CC1A 1A3HA 1VDVA 2PDUA 3PS7A 1ONEA 2E3ZA 1GW9A 4ENLA 4HTBA 1GOWA 3DG6A 4GYPA 1W5OA 3KHDA 1M9HA 3GTNA 3NZPA 3MVIA 3WQ5A 1EC9A 1GORA 1SZNA 4QCFA 3QF0A 5FAJA 1F8WA 1XD1A 4LUSA 4EWJA 1PZ1A 3QHOA 5LXEA 4LVDA 3GIQA 3W1NA 4NUWA 4XBJA 4JEQA 5FJJA 1FKXA 1RK6A 5A6JA 1Z69A 2QDGA 1DP0A 3N25A 2G5WA 4GZEA 2GZXA 4E2BA 4HYRA 3DXIA 1KKRA 2GJLA 4OFCA 4GC4A 2YL5A 1VBHA 3N3MA 3E2SA 1HUVA 3B8TA 3G1XA 3UZJA 2XG9A 3VTRA 2RJHA 4PUNA 1HJQA 3LCLA 1VQTA 3N17A 1FQ0A 2J7BA 3VUSA 2AAQA 2EQ6A 1DVJA 3THUA 1GTEA 3IGUA 3LLXA 3GTFA 4H9YA 4PSPA 2WO5A 1ZBWA 4C5YA 3N2XA 1VJZA 4CNOA 1JZ8A 3W7HA 1GRTA 4ML9A 1FWDC 1E1CB 1OCBA 1XLGA 2GQ3A 3HGJA 1UQYA 1R87A 5DY2A 1HTIA 4CCZA 5D9OA 2EJ1A 5DT5A 4OV4A 3OPSA 4OECA 1D7YA 3UFYA 3STGA 2GK1A 1K70A 3VGGA 4L61A 4S3FA 4H7ZA 3U2OA 5EGRA 3L21A 3VKJA 2EXOA 1H62A 4PA8A 2OQYA 3RLGA 2YBUA 4YTSA 1DXEA 3OGSA 3L4VA 3CJPA 4HNTA 2W0HA 4X2PA 4HBKA 3BJSA 4ASTA 2VDGA 4JTDA 2VX6A 3IJ9A 3U4AA 3S0CA 3P0XA 3H54A 1THFD 1W9VA 1DJQA 1V03A 4H4RA 3NL5A 2IS7A 4FIRA 5AY7A 5I3DA 1WXZA 2VL4A 3TK7A 4DO6A 3EWWA 1MXDA 4QG6A 3AJ7A 1B54A 1UMYA 1TPC1 2WPEA 1K6WA 3ARRA 4C60A 3AZSA 4ZENA 1V8EA 2ZUTA 4E8GA 2PDPA 1DWAM 1NF7A 3ELFA 2QEZA 2HDJA 3O0FA 4GUHA 1H41A 2WMJA 3L4UA 1RLCL 4EIVA 4F66A 4GD0A 4Q8PA 3BG3A 5FSEC 2PZ0A 1B4EA 1Q7MA 1LL4A 4PUKA 1OK6A 4PH6A 2GJRA 1E70M 2GGGA 4RZ4A 3MANA 3K1GA 3SCVA 4YWIA 1K02A 1TPFA 2R9ZA 5G2WA 1GJUA 2Y8UA 2NVAA 4AZCB 1JD9A 1RQEA 2XH7A 5DXXA 4OE7A 4E0CA 1UP0A 3D46A 1F2JA 1PBGA 4O1EA 4W87A 3TR9A 1H5VA 4W89A 1TTPA 2BWGA 2Q3OA 4N2YA 1KBIA 3NVTA 4TX6A 2ZE3A 3BMXA 1N2VA 4Y2WA 4CQBA 4PC8A 2V5KA 1WZAA 1XICA 2FGBA 3AYSA 1H7RA 4GVIA 1OZMA 3AIUA 1ECEA 2ABBA 2PZNA 1V0MA 4O1FA 2WC7A 4GVHA 4B16A 1E51A 3UJRA 4Z1AA 2REQA 3P74A 5FJIA 3T2PA 3BMWA 2FVKA 3P6LA 5IXEA 1AL8A 3APTA 4O1CA 3WBWA 3GVQA 4GI9A 1ZSXA 3PFMA 5F4XA 1VCGA 3OBEA 1G01A 1PDZA 1TIWA 1WOBA 3KW3A 1DV7A 3EX6A 3GW0A 1RALA 4P7OA 3E5PA 7REQB 1IIGA 5B7ZA 3OIXA 1PKMA 3ITVA 3FJ4A 1KD0A 1XSKA 1H1ZA 2XM2A 3TYEA 4V33A 3LY0A 2HV5A 1U5VA 3H12A 2EPLX 2WVTA 3A5FA 1G0CA 2TAAA 2HBXA 1J10A 4FLRA 4KF1A 3HG4A 3NPXA 4AH7A 1I2QA 1OINA 1V6XA 1KB3A 1C92A 1JPHA 2YOCA 1NOFA 3V0SA 5FIPA 3TWAA 1D2KA 4W85A 1ONXA 4YVVA 3ES8A 2GLKA 3AZTA 1O68A 4RW3A 1Q6GA 2AAAA 1UKSA 5CPOA 4IXHA 2G97A 2I5IA 3FJNA 2NWRA 2CLLA 5D2YA 2CZVA 2FKPA 2IXVA 3R79A 4ZTYA 3NQ6A 5BMWA 2F7FA 2P0OA 1SGJA 2YCJA 4X0NA 1LLWA 1NDYA 2NQ5A 2BOEX 4YHEA 4JQ9A 4UUIA 3T4CA 2WHJA 3PZNA 3U5UA 3JR2A 5G5HB 1BVWA 3N04A 1OGBA 1VLIA 4UMCA 1U2YA 3IJDA 2Y5JA 3TNOA 4GFIA 1GERA 1HQTA 2I16A 1NDWA 5RUBA 3GG7A 4N0RA 1AJ2A 3TROA 3L4XA 4LSBA 2XIBA 4L4MA 4B3KA 3IUIA 4ROPA 3AISA 2GVEA 1D9EA 2Z29A 3LRMA 1N55A 5CLWA 3VOFA 1W2VA 3HPAA 4TXEA 2PBOA 1TV2A 4IGNA 2NUXA 4A29A 4S3DA 1B3YA 1SB3B 3DYOA 2A2IA 2Z6JA 4Q8MA 4N9DA 4JFVA 3D6NA 1H09A 1M01A 3TMQA 4YU1A 1TYTA 2WOWA 4OGZA 3TQ0A 3M5XA 4F0HA 4Y96A 1DJZA 1SW3A 4MLJA 1GTHA 5HWMA 4FF7A 4GJIA 2ZYFA 1V08A 3CH9A 4ADSA 1Q6QA 5BOOA 1VBJA 4C6JA 4PMJA 4PCFA 3O16A 3EWYA 1VYRA 2WQPA 3IUDA 5A6BD 3IJIA 5ENLA 1YRRA 3W7KA 3H2CA 4LUIA 3SCRA 1XGZA 3WD0A 3LBMA 4PCNA 3T8LA 3VM7A 1Q13A 3ZOAA 1UQZA 3A7UA 1X38A 1QHOA 3GG8A 1F4HA 4XO7A 4UMBA 3PAJA 4G7EA 4ZOHB 5IFTA 1GRBA 1TWSA 1XRVA 2I56A 4FO4A 3WX7A 3N2MA 4NZFA 3AIQA 4QQUA 3KVMA 3KCJA 4RL3A 3LZ3A 1QNPA 3U8GA 4W4QA 5CG7A 1E4MM 1OVDA 3N6HA 2PRHA 4EMJA 5EPDA 2MANA 3GZ3A 1TYPA 1XYLA 1EO7A 3VC6A 4CEXC 1NP2A 1EH9A 5BXRA 3LHWA 4PTNA 3PK7A 3CGCA 2ZQ0A 3WFZA 1G1YA 3BSGA 4O28A 5DQPA 4LCQA 4F3HA 5AN7A 3WUBA 2XFYA 1GEQA 2GR3A 1R8LA 2KX9A 3ABSA 3BANA 2G3IA 2QDDA 1TPWA 3MTWA 4NSBA 1MDLA 2DZTA 5IHRA 3MMTA 1PZ0A 2VD9A 3VNKA 3GFXA 1XS2A 3KWXA 1UROA 3RRAA 2O9RA 2DZXA 3KBSA 4RNHA 2CLMA 5DBUA 3DFHA 1NFGA 1K3UA 5IBXA 1M68A 3CXOA 4HMEA 4Y90A 3QV7A 4H8UA 1J2WA 4XKYA 3M9YA 1CBGA 1I75A 2QUUA 3SUTA 1WX0A 4WJEA 1G4PA 5G5GB 4IHCA 2PWEA 2ZX5A 1JZ6A 2JFEX 4ZQPA 2NXIA 3WMSA 2NV1A 4LVGA 1AZ2A 4LS2A 1AH0A 3R94A 3VVGA 1FWWA 2QJHA 1SO5A 3BW4A 1V4YA 1ME8A 2OX4A 2PLKA 3C2VA 4X9YA 1ICPA 4PEKA 6ENLA 1JJKA 3AS0A 4R3UA 5D03A 3GH4A 1WYGA 3CHFA 5MF5A 3BZGA 3DGZA 1PKLA 3VIOA 3KZSA 4LU0A 3IVUA 1E5JA 1A47A 1EL3A 4CQDA 4IGSA 4DXKA 1A0EA 3GVVA 1X2GA 3Q65A 1JI2A 3SUSA 3KE0A 3MSYA 3WQCA 5JCNA 3W37A 1YDOA 1QR7A 3MCNA 1G9HA 1YXDA 2F6KA 1NHRA 1PYMA 3RLHA 2WHLA 4E4PA 3G1HA 3VOHA 5I07A 2QCFA 1BF2A 2DUXA 3AHYA 3C6CA 2PDNA 3EWXA 2VXNA 4P8XA 1M65A 2G41A 4UTLA 4LA1A 3QTPA 1XIBA 3I4EA 4RDWA 4GYPC 2I9EA 1QHPA 3BAWA 3ZVHB 3LI1A 1CXLA 3PY2A 2PODA 1RAKA 4YJ5A 4KEUA 3MZ2A 5KVIA 3G1VA 1MNZA 5JMUA 2P8BA 5FL0A 4KFNA 3CYJA 4EF9A 4GWEA 3E02A 1E9ZB 3RRXA 3J7HA 2ISDA 3F7JA 4KWVA 1EB3A 4GOAA 4HHPA 1PL9A 2D2OA 2Z2UA 3U2EA 3WK2A 3R10A 4F0RA 1ME7A 1LPFA 1XI3A 3CGBA 1FXPA 5KINA 1J6PA 1FHDA 3KDOA 1VCVA 4PL2A 4PTWA 3L8KA 2OSXA 1JIBA 3HO8A 2XVGA 4IIGA 5AYIA 2V6OA 2ZUVA 1AW1A 1VFTA 3K30A 4NI8A 2QXWA 8CGTA 3RPMA 1XLEA 2TPRA 3KP0A 3OJGA 2NLIA 4UOZA 5IRPA 1A5BA 3R89A 3IC9A 2RKXA 3T2QA 3VU2A 4U5IA 1TTJA 4OQVA 1XLDA 3W7JA 4PR4A 2GVYA 3C8FA 1VD6A 1IXQA 2X0SA 3VZZA 3N19B 1OBAA 3LU2A 4C65A 3OLIA 3OYZA 4WSJA 3DFYA 4DJFD 4MIMA 2X8HA 4BKNA 2H3DA 2Q3RA 3LM3A 3EAUA 4MVAA 4DQWA 1HVXA 4CQ8A 2ZTKA 5A5WA 1FBAA 2ZIDA 4ZA0A 4ZCWA 3WYZA 5A8NA 1Y7VA 2ZX7A 4CU8A 3GDRA 4NX5A 1GG0A 3NS1B 1A80A 1EP1A 5AYBA 2OR2A 5A6BA 4NZ3A 1KFCA 3QR3A 2CFYA 3ITLA 4GH3A 2C91A 2Q6ZA 5FESA 3PBMA 1QPOA 3GX9A 2B7OA 4KWWA 1JI1A 5JBEA 5AYXA 4ZB0A 4IFKB 1IXNA 4AHQA 1UKPA 4H4XA 1BG9A 1RPKA 2VFDA 1ITXA 4GUJA 1R85A 3RU6A 4JFWA 1RJPA 2ZUUA 3UG4A 1LORA 3GR7A 3S8HA 1J79A 1XC6A 1B3VA 1BRLA 4MUPA 1ISYA 2Q71A 1EHNA 3II1A 2F8QA 1F3PA 3TAOA 1GVOA 1ZBVA 4M7TA 3A13A 1GQLA 1TJ1A 4JIIX 4F4RA 4K6AA 1MW3A 4JKLA 2PDBA 3EWCA 5JXQA 2IMRA 3CPUA 4UFIA 1T41A 3CWOX 4IICA 3B03A 2YCLB 4HK5A 3DK8A 4EE9A 4GO9A 3U0HA 2INZA 1I4NA 7TIMA 2B31A 2IXUA 4JFTA 4ZOEA 2E3TA 4JTCA 1JQVA 3BXWA 4Q7NA 2CESA 4M80A 2J25A 2XYLA 4AX7A 4H2CA 1T40A 3R0DA 2GUUA 3R0UA 2VDHA 1M5WA 3BG5A 3WELA 3T55A 2CZ5A 4MADA 4CQ9A 3PBUA 4RV8A 2XIIA 4XVDA 4QM1A 4UR8A 3CWHA 1YLVA 4I8YA 3VXGA 3QMTA 3WLOA 4WD0A 3EOOA 1H11A 1TPVA 2PRMA 3SY5A 1XLLA 2H8XA 3D47A 4KRZA 1TMLA 2X8CA 4RW5A 5EMJA 3W7RA 4OBRA 3P84A 1PIFA 3NEVA 1J0KA 2YXOA 1ESWA 1NY1A 3GD6A 3VA8A 4TVCA 3VYLA 3WEZA 3WDQA 2QJNA 2DUAA 2YCEA 1KWGA 1IR1A 1KTNA 1DEDA 1QWGA 4R53A 1SYTA 2D3NA 2IKIA 4DBEA 1D8CA 3F4WA 3TCSA 3CB8A 5LA1A 2V82A 2GR0A 3N9KA 2OKTA 3SJNA 3PZGA 3A3HA 4DWSA 4RX0A 2X50A 5A8PA 3W38A 1ZHAA 3VI2A 4JNYA 3CZJA 2IQDA 1TUXA 1GW1A 1AJ0A 3WO8A 1MRAA 1LBMA 1MEIA 4LYPA 3HQOA 1SFTA 3Q6JA 1F4AA 4J4KA 4WEVX 1ZMCA 3H22A 1SJDA 3NSNA 1H63A 3GH7A 1S3HA 3OBAA 3O7UA 4KCTA 1Q63A 3EWUA 2PF8A 1GVEA 1LWJA 1VEOA 5U4NA 3CHEA 1UZ4A 1V7AA 2QR6A 1W1TA 1EP2A 5E70A 3NQCA 3UG5A 4HTYA 2V3EA 1SR0A 2WMGA 3G8RA 1VKFA 3UVAA 5EYWA 3VCNA 5K2ZA 1J0IA 3DC0A 3M5VA 1AW2A 1LBLA 4O0QA 3A9IA 4W8BA 3N2OA 3H53A 3ZXWA 1Z32X 4F79A 4H9XA 2NX9A 1E40A 3SY8A 5CAKA 3NXLA 3RO8A 3LXDA 3C3NA 4J3SA 4D2JA 1JGMA 4NZCA 2DIJA 4J35A 4U2ZA 2OT0A 4Y6GA 2PDIA 4PMYA 1JCJA 1XXXA 3EXSA 1UKTA 4I7WA 3HPFA 2XVLA 3WQGA 1GPFA 2WSPA 3VX1A 1XFCA 4LIIA 2YDRA 1MZHA 5JRBA 4AYSA 4L9XA 2CLHA 2X8GA 4NJIA 2QKFA 4O14A 4MDPA 1KCLA 1QBBA 1KA9F 4LAZA 1ZQ5A 3SGZA 3WDPP 4M1RA 1E0XA 3EANA 5D38A 2BGSA 4HKPA 3E0VA 3FJLA 1E1EA 1F5ZA 1G5AA 2GYIA 3FA4A 1TSIA 3CK5A 2OTDA 2QLYA 4FDCB 5A3HA 4ICNA 4XD5A 1FVPA 2ZVIA 1SZFA 5LZLA 1H49A 4NXSA 3AU6A 2QCGA 4I9MA 5BU6A 3QMRA 2GDQA 2ONEA 4BHYA 3QEZA 1R3VA 3RR1A 2DW7A 1NEYA 1BXNA 3GC5A 3IJLA 1XG3A 1Z48A 3PUGA 4PFMA 1R86A 3TKFA 4Q8WA 2VCCA 2C1HA 2VURA 1CXIA 3POHA 2VC5A 1W5PA 4H19A 4UQBA 1R38A 1DOSA 4BR1A 3H2OA 4UXDA 2Z7KA 3B0UX 2DJLA 3WNPA 3EA3A 4GNKB 3VD3A 2CLEA 2G37A 2QF8A 4LVAA 1M41A 4ADTA 4HOWA 5KTLA 2CC0A 2VVSA 1OHLA 2C3CA 1ZB5A 3HZ3A 3P93A 1XV8A 2Z7GA 1WDDA 3FGCB 1VBGA 5CPSA 3CMFA 1XC4A 5AOUA 2XWDA 2UY5A 3OGVA 3N14A 4GUFA 3GTHA 2GGEA 3RM8A 4O12A 1Q8JA 3M7SA 3FHAA 1MO0A 3DHDA 2OZTA 1KQYA 3C2YA 2F6UA 3PPFA 5EBAA 4Z0JA 3ETRB 3UVIA 1UBSA 3W1PA 1UWUA 5IBXC 2VX4A 4AX6A 1E9IA 4GRTA 1KRBC 3GU1A 3A7RA 4ZOCA 4UFKA 3DUGA 5D2WA 2WZMA 1W1ZA 4F2UA 4CNNA 1GOQA 1H0IA 1X97A 2JKAA 1LP6A 3KRSA 4U3AA 3ARQA 4H4IA 4J2MA 1GSNA 1X6NA 1F3TA 3ZWSA 4KEZA 1JYXA 1I2RA 4K7YA 2Y70A 8XIMA 3AUOA 3NSMA 5GJPA 9XIAA 3NSXA 1NPXA 3ZMRA 3H70A 3W2LA 1K77A 5ECUA 3TXZA 3DERA 4DM2A 3LB0A 9CGTA 1X96A 1ODUA 4DBWA 3RAOA 3P2VA 1X8CA 3PZTA 4C6PA 1GVFA 4OOUA 3QRHA 5LNUA 4ORMA 3JZEA 3OHIA 1E6XM 4XBSA 4QLLA 4JKKA 1Z6KA 3IIVA 1AA1B 4JQ3A 3TNBA 5CAHA 1JXJA 4G6CA 1V59A 2HCVA 3TW7A 3G2GA 2DZUA 3CPRA 4IMAA 3UZZA 5C9UA 3HPXA 1VPYA 4LUYA 1HT6A 3ATYA 3S5YA 4K1GA 4JHOA 4Q8UA 2CYGA 3ECQA 3LSBA 3V4BA 1E73M 1GJWA 3T0AA 3BARA 4YXGA 4HCLA 2QCEA 1KGUA 1L2UA 3AALA 5KMYA 1JDFA 1XL9A 1NELA 3CTTA 4Q7IA 4ZB5A 4F9DA 4Y7EA 1GWJA 3GXDA 2EPOA 3DZ1A 1FY6A 3FXGA 3EDDA 2GVGA 1VIWA 4JIEA 4LFYA 3TLQA 2YL6A 4LY8A 1B30A 3QLLA 4FX9A 3KAOA 1BYDA 3BK0A 5F2LA 4H6RA 1AH4A 2G0WA 3EYPA 2HK1A 1EDGA 4DZ5A 4JD4A 4FK9A 4N9CA 3DK9A 1KBLA 1F61A 2OQHA 1R3YA 5LHFA 2ZWZA 1KFWA 3G0UA 4LAMA 4O17A 3QLDA 2HVOA 1V0LA 3UNDA 1GRFA 4IWWA 4AUBA 4MJ4A 3MI2A 2PMQA 3W6MA 1X39A 4LW7A 3EDJA 3GWQA 3FSUA 1HO4A 5ABFB 3W2MA 4OTKA 1P0EA 1X6UA 4Y9PA 1TTQA 4MY9A 2VHLA 3LHUA 3VINA 3MCOA 4O8AA 1HJVA 3WK0A 2X05A 2VX7A 2C71A 1YTDA 3N18A 1RVKA 5I3JA 3STPA 4F40A 3TP4A 3M0VA 4LCRA 4F48A 5C6MA 4GINA 3NAVA 5FJRA 4A4AA 3AMLA 2WZHA 4GQRA 3DGBA 1I2OA 4M24A 4KGLA 5HWNA 1BWLA 1X6LA 3SGUA 2BVYA 1ZBKA 3AJXA 3S2JA 3TFXA 4L5ZA 1I1WA 3VNYA 2UY4A 2NSOA 3R6IA 3QFAA 1XWYA 2CHOA 3HBLA 3H2AA 1YNPA 3NO1A 1ZY9A 5LA2A 4XZNX 5TD4A 3N4EA 1LWHA 5C71A 1B57A 1T8XA 4JTJA 1Q2RA 1B5TA 1E5NA 3NVDA 1OD0A 4NI3A 5GNZA 5HAOA 1Z89A 4RUBA 4Z42C 1V79A 4OUIA 2G3JA 4AXKA 1E1CA 1QOXA 1SQ7A 2ZRVA 3SCWA 2BVDA 2WSRA 4RZBA 3U7BA 1NDVA 4KEMA 4XD6A 3EF6A 4JAWA 5CZJA 1SJCA 2ABAA 5HNRA 3B0XA 4H4VA 2OELA 4MY8A 2QDEA 9XIMA 1R46A 3HG3A 2XHYA 3MP4A 1LZOA 5CZTA 3WKZA 1OQFA 3L68A 2FTYA 2GQ9A 4PUWA 1K8CA 4XZIA 1J0YA 1NARA 4NJKA 4NXKA 2VEPA 1JF6A 2RGLA 4MG4A 4AQLA 5LIXX 4YVXA 4H9TA 3OYXA 4W93A 3RM4A 6ALDA 3AIRA 3M6DA 3G24A 3DG3A 4IIBA 3VAVA 4KH2A 2VFHA 3SM0A 4QEHA 2X1TA 3A21A 1XX1A 3AHXA 2CDUA 1UWRA 3GNPA 3UXKA 2E28A 1DJYA 3PULA 1EXPA 4D6FA 4S3JA 4C6OA 1CXKA 1M6JA 1P4CA 1FFUC 1QPQA 4FOUA 5G1TA 1US3A 2POZA 4LEFA 1VZWA 4YTTA 3K4DA 4GK8A 4BQ3A 5M1TA 1UH2A 3HF3A 4XSLA 3RN6A 5JH2A 3WLLA 1OF6A 3AS3A 1C90A 3F4NA 4ATLA 4MSSA 4EK7A 3ALFA 1E71M 4XZMX 1LQ0A 1NAL1 5E0KA 1ZY8A 1IR2A 3DYMA 3LBOA 2PI6A 1NHQA 3EXRA 1VRXA 3N9RA 3EXTA 4S3AA 3QFBA 5FF3A 3RFAA 4M82A 4AVFA 2OO0A 3W1MA 1XYFA 1A5OC 2VTFA 5E5CA 1C91A 1AD1A 3L7RA 3G22A 2NX3A 4UQ9A 1DIEA 1LG2A 3MP5A 4DWSC 1EJTC 5JUVA 4WSKA 2R1LA 4H8NA 1EJ7L 3PVFA 1GVSA 5C2XA 5FJOA 3UP8A 5CGTA 4S2BA 3FAWA 3GHSA 4NJGA 2GPTA 2UZ9A 2YLAA 3NA8A 1TRDA 4IP4A 5GJMA 5F4SA 2E6FA 1JZ5A 2PWUA 2DZSA 5FCZA 1EEPA 1AQHA 4NYUA 4NJHA 4FI4A 1R5YA 1J12A 5FAGA 1UR0A 3GW3A 4TIMA 4GVGA 2NX1A 3PZQA 4E4FA 1TE1A 4MWAE 1QFEA 3TJLA 4EVZA 2VT0A 3H24A 4ZBCA 3CAQA 4OOZA 5K4XA 1CB2A 3NFUA 2VELA 3OHMB 1HXJA 1EC8A 5BMXA 3VZYA 3SB0A 1QVBA 4GI4A 4DF1A 1XR2A 2XFWA 4RZ5A 3RU8X 4I9TA 3P81A 2RAGA 2E7FA 4YPJA 4QP0A 4XG1A 3SFWA 3IJ8A 4XAYA 3VDBA 1LYXA 2AOSA 4A3HA 2PAJA 3EOSA 5D2TA 3UW6A 3ZR6A 1NWUA 1UD3A 3ICJA 2P10A 3OG3A 3KBJA 5EY5A 2V5DA 2WMKA 2WKLA 3HG2A 2Y5EA 4FX7A 1GQNA 3WL1A 5T9CE 3EEGA 3NZ1A 1TQJA 3CNYA 1GONA 4GQBA 1STZA 4LXFA 1RBLA 2WPCA 3HW2A 1RJRA 1H2JA 2C16A 4BS0A 2BDQA 2INEA 2J27A 1EJWC 1REQB 3SUUA 3EUB3 4DJFC 3UWWA 3UR7A 1DJXA 2TPSA 4XZHA 3WH7A 1CNVA 2V3GA 4YL2A 3URBA 2E4TA 4JL1A 3TYUA 5D33A 3WUGA 5ABHA 3M16A 4TV5A 3WLKX 4C90A 3GD4A 3ZWTA 4QE4A 2XSBA 3WLTA 2ZXDA 4AMCA 1CXFA 2DQXA 1HKKA 3W88A 3IIOA 4B15A 2NQJA 1BYCA 4ADUA 1LUCB 2I5QA 1ITCA 1CLXA 3W83A 1DWJM 2YA0A 4MNMA 1TPH1 1LOQA 1R2SA 3FK4A 1EA0A 2OG9A 1KM0A 2ZVRA 4D6CA 4WKHA 5IOBA 1B3ZA 3AMZA 1LDCA 4KQNA 3LZ5A 4HYWA 4KIRA 2VOMA 4JEJA 4ZE4A 3C2RA 1VENA 4HOZA 2XUCA 4ZO7A 2CIPA 2PD5A 3CBWA 3TUUA 1F8MA 1ME9A 4UTWA 1Q7ZA 2J6VA 3FY1A 3GXTA 3W1QA 2CKRA 4O57A 4JY9A 3OZPA 4MNLA 1RR2A 3G1YA 1XW8A 1OFBA 1NHPA 2JEQA 1C93A 1FWEC 3B0VC 4MAVA 2O7QA 3M0KA 1WBJA 1H51A 3WQ6A 4CKQA 3GM8A 1N8WA 2J7FA 4GJ1A 4NAEB 4AZ5A 2E5CA 1XIDA 2WSQA 4ALDA 4HD5A 4MJZA 3KZPA 4QDMA 4JTIA 4R88A 4DUWA 3DJJA 5FF2A 1CGXA 4XUGA 1K4GA 1HGWA 3IIZA 4IJRA 4LPCA 4Z1BA 1BZLA 2J7GA 3HPZA 3ENLA 2AMGA 3FDKA 4GIAA 1FRBA 3WQDA 1V3HA 2DIKA 2PDKA 2VENA 3EAOA 4QS6A 2NWSA 3DECA 1HX0A 3UXIA 1W91A 3AMGA 1TV7A 2E6DA 1OWQA 2Q09A 3F2BA 3E0WA 4PCSA 2DT0A 1C3FA 2Y7DA 3WMBA 2PTWA 4K1WA 1D7FA 2B7NA 2ZZ5A 2GQAA 2HVNA 2C3DA 2XVKA 5F4WA 4AU0A 3LSCA 1IZCA 1XRSA 3XISA 1GZGA 3C2OA 3AHTA 3QV9A 2DSVA 1DJGA 4LX4A 1I0DA 1XDLA 1KFEA 3BLLA 1FH7A 3M44A 3UCQA 3CWNA 3LXCA 1V3KA 4AVNA 4E2DA 3CMGA 1RK5A 1VS1A 5CSSA 4U31A 2VFFA 5D04C 3HFTA 4LF2A 1JNDA 2C1IA 3A24A 3SUVA 4GXWA 1WZKA 1CW2A 2DQWA 3LERA 2ZUNA 1O6IA 2XGZA 1VYSX 3OZOA 1Q6EA 2XINA 3UA3A 1KCXA 4W8LA 2ZX9A 5C5YA 4MZ1A 4HNUA 4LRTA 1UWTA 5CZ0A 1KBKA 2XU2A 1RXOB 5H8MA 2KAUC 3T08A 3WNLA 3WN6A 2E1WA 3JZUA 1KFLA 1F6PA 3MCMA 3T0DA 1ZP4A 1HL8A 2G3MA 3PF3A 1BD0A 1SR9A 4DYKA 3B4UA 1V02A 3V5FA 2A3BA 3S9YA 3DI1A 5JCKA 1Q6RA 4Q4QA 3TYDA 1I45A 3LCFA 5G2IA 4JIHA 2F6XA 2Q8LA 2WNZA 1GZ1A 2V5BA 4NASA 4TMBA 3GZAA 3V0UA 4QCEA 1CEOA 2PF0A 2ZA2A 1EWEA 1XD0A 3LLFA 3ZVHA 4OUEA 1V02E 4QGCA 5GJNA 1EDTA 2P88A 3BCFA 1K03A 2J8FA 3W24A 1HFBA 3TYZA 1DTNA 1OC7A 4US6A 3VE9A 2GUBA 1EJRC 2BP1A 4HPGA 3VOIA 1JUEA 1ZZMA 2C15A 3U57A 3UR2A 5GVJA 2VVNA 4DUXA 3WG6A 5FMHA 3DH7A 3WLHA 4IF2A 1HJWA 1KTCA 3LDVA 1LRTA 1KTBA 1GREA 3MJYA 4XO6A 4B4HA 2CLIA 1OGSA 4UNIA 4KPLA 1O5XA 1H50A 1TFVA 3BGAA 4F0KA 1A0CA 1X7FA 3AS2A 1TV8A 1O5KA 3NTYA 5F7UA 2NQLA 5LXXA 4GNVA 3EPMA 3MC5A 1GHRA 3QPZA 3PNUA 1AZ1A 1OX4B 4L9YA 2XZ9A 2ZZ7A 1XH2A 1R2TA 2WW5A 1QNVA 3AAMA 4CCEA 4J3WA 1RHCA 2C0HA 3WQVA 1CWYA 3O3RA 1P43A 1W5QA 1ENUA 2EPNA 2I1OA 3PSWA 4V1XA 4PTMA 2W67A 5HA7A 1JL8A 2ZZ2A 1KXHA 2DT3A 1JCTA 1Q66A 2R1KA 3OQEA 4NZ5A 1LTDA 3LA4A 4H83A 1E9LA 3L65A 4UR7A 4L7ZA 5GNYA 4ZZ9A 1B1YA 3PHAA 4UFJA 1GOXA 5C2CA 2Z0IA 2HE8A 5LSMA 2WCSA 4KMQA 3W25A 1Z3NA 1RY8A 4KWUA 3R0KA 2XPKA 5A6LA 2W61A 2ZA3A 3L23A 1D3CA 1BF6A 2JGYA 1LLOA 2BVWA 4Y9NA 5XIAA 4DN1A 1DJNA 3OLDA 5DN1A 1KLYA 3B9DA 1R9ZA 2F2KA 2O4MA 3AWOA 3GE7A 3A47A 2YAUA 2BODX 4K8GA 2I17A 4E2VA 5IFPA 3MZNA 5AC4A 4W7VA 4CQAA 2P3ZA 2ATSA 1P7TB 5CLTA 5CBJA 2G4FA 4MPKA 1XIIA 3WCZA 4FR6A 4HVXA 2YDQA 2W63A 3NPVA 3S47A 3B9JB 3WZ0E 2ZXAA 4XKMA 2IPFA 1DJIA 4MJ2A 4UTIA 3S6TA 3ZLFA 2FHBA 3W7PA 5H6HA 3TXVA 1S7MA 3TC3A 2VC9A 1EIBA 3QW4B 2H9AA 2ZRZA 3GO2A 5AKQA 3GNDA 3UJEA 2PTDA 3LI0A 5I0DA 4UCFA 3LGDA 3B8UA 2W0UA 2Y5SA 2QV4A 5FKYA 3UERA 2HWGA 3NZGA 5A6AA 4EQXA 4A21A 5HJLA 2PUZA 3AC0A 2ZC8A 4PFHA 1IF2A 1HKIA 3E96A 3WIJA 2BHZA 3VZXA 3QW3A 4IIEA 4XZWA 3RM9A 1EF2A 1J0ZA 2YCLA 3KTCA 3KHJA 1SFSA 2GQ8A 4QJ3B 4C6QA 5LNWA 1HP4A 3N3TA 1QI2A 4I3GA 4IPJA 3CUIA 2YFNA 3QMSA 4KPRA 2FPVA 1VP5A 2W92A 2HXUA 2V5CA 2XIMA 1WKYA 3BCDA 3HJEA 4AZIA 4B92A 2V5JA 4LYRA 4JN8A 1WPCA 4HQVA 2XISA 3NURA 5I77A 4FAMA 5I3IA 1J4EA 3GDTA 4NNCA 2PLCA 2YLLA 1I2PA 3W87A 3W2UA 1BQGA 3O6AA 3RMJA 5B7YA 4ZOBA 4DM1A 1XHCA 4ZMGA 1E55A 3QZ6A 3VNJA 1UD6A 3JW7A 3QN3A 1W8GA 3HN3A 2ZDRA 4NJJA 5G5IA 3KLJA 3VPLA 4TU1A 4Q8OA 1XIGA 4LOCA 3S2LA 3WDRA 1PX4A 1P0NA 1MW0A 3OP2A 3OTRA 2F38A 4Q8QA 5FEWA 1UWIA 3GAKA 3NUKA 2UY3A 2J62A 3WF4A 2DV0A 4K7VA 1VPQA 1A5SA 4FPSA 1F76A 3INPA 3B8SA 3RK8A 1WYIA 1W1B1 2Y4SA 2YA2A 5DFAA 1R6WA 1ALDA 4ZO8A 3WSUA 3ITXA 3W02A 4R9OA 1R3TA 4ZR8A 1K7FA 2E8ZA 1BXBA 3O63A 3U2ZA 1DBTA 3F4DA 2WVVB 1RVGA 2YIHA 3S2NA 3N73A 1QPKA 4LALA 2WV8A 4UB9A 1A3XA 2OOFA 5I79A 2P1FA 1EKOA 3KVJA 1WA3A 2C3ZA 3U4FA 2V67A 2NPXA 3EOEA 3S5NA 2HPIA 2FVMA 4ATWA 4HHLA 4C6IA 2WCGA 3TYAA 1K8ZA 3W0KA 3W84A 4AG0A 5K9CA 3TYCA 1PWMA 2DSUA 1FH8A 2R24A 4JNZA 4E6MA 3ONBA 4JTKA 5JQ9A 3IIXA 5TR3A 1LVLA 5A6TC 3UWYA 4UQDA 2AMXA 4B5UA 1DTUA 5JCIA 2WANA 3FG2P 1K4HA 4WK9A 1CGTA 4QIUA 2Y85A 4ADWA 3A23A 4BJHA 1MEWA 2D24A 2DSKA 3WQOA 1W9PA 4ACZB 3C0QA 1UUQA 5H8PA 1VFLA 3W01A 3TR2A 1VAHA 2PWVA 4HZ8A 3CEPA 3DCPA 3EMZA 5C55A 4IIFA 4NAFB 2X99A 4S3BA 3T40A 3D5HA 2FTWA 1CGUA 4X0VA 1XH1A 2JK2A 4BEQA 1F3WA 4CGTA 1GOMA 4UFMA 2HBVA 3VD5A 2GR2A 3PUEA 4QQ3A 4JZ5A 2WQDA 3BV4A 2WNQA 3E0FA 1KV5A 3PTMA 1C7TA 1AUSL 4KRTA 3PJWA 3F4CA 2AQWA 2XZ7A 3QKEA 3UJ2A 2JGQA 3E2VA 2I7GA 3PM6A 4HJFA 4UTWC 1SO6A 5CBIA 1VQZA 1HKJA 4Q22A 4DB7A 1LM1A 2IKGA 4AXNA 3BAKA 3VFCA 1XM3A 4PGLA 3IGXA 3VNLA 3W7EA 3IIPA 1UCWA 3Q2DA 5TAOA 3TOPA 4HPJA 2O4QA 1L8PA 3GXMA 1FWSA 1R47A 1W31A 3OBKA 4S3GA 3NVYB 2E1DA 3S1WA 1DHPA 1VHCA 3CIVA 3C3UA 4HU0A 4NY2A 1O60A 3UG8A 4EF8A 3GRTA 2ISWA 4L64A 5D9NA 4AC7C 5BZAA 3M46A 2WBKA 4GIRA 4KWSA 3V0TA 2GVJA 2D2HA 4LS0A 4RLIA 3MMDA 1J5SA 5L9FA 4GIYA 3A9BA 1VFUA 4V27A 2BOGX 1LJYA 2J8TA 4F2TA 3H2MA 4L9ZA 1T6MA 2Y61A 1AK5A 3LHVA 4O0ZA 3PBGA 2XM1A 1ONFA 3XINA 3SDOA 3UWEA 3FGCA 1BHGA 4BWLA 4F0SA 1S2UA 4EKJA 4JDBA 1S38A 3B8WA 3EOLA 1CPUA 2WNNA 4LAKA 1UH3A 3GHRA 2V0TA 5DCEA 3DK4A 1JPKA 1L6WA 3ZM8A 2H6RA 5H1WA 3W7IA 3H4WA 4HPNA 1JF5A 3F4VA 2FZDA 2PDFA 3ATZA 4B90A 3AXXA 5CBBA 4RK8A 3TDFA 2DZWA 3NZRA 3U9IA 4O1DA 2D3LA 3MKKA 3IK4A 1W6TA 2QCMA 3RYSA 2HQMA 4HOXA 1UKQA 4GZJA 3GK0A 4ICCX 1MW2A 4H9UA 2XFRA 3SAZA 1TJ0A 1OFOA 1H7WA 2VGFA 3L5MA 5LNRA 3TSDA 2WKJA 1U22A 2D0FA 2D0HA 3MUAA 1LLZA 2X1IA 1JVNA 4MTVA 5I06A 4AMAA 4YCOA 1JROA 4WIWA 1BGGA 5CC6A 3S3GA 3CZEA 3WH5A 4NP7A 3NO3A 3B8IA 4LUSB 4XZLX 3RNDA 4WGHA 3RLUA 4RNIA 2H3BA 5AYZA 4MZYA 1K8XA 2OZ3A 4S3CA 3UZXA 1BTMA 3BOFA 1Q6LA 2YYTA 1DWGM 4GI8A 2P53A 1ZUAX 1E9YB 2DVTA 3C0JA 1M7XA 4PZVA 2YVJA 4QBXA 4JTRA 3V18A 5CG0A 2VGBA 1UC5A 2OSYA 5FEZA 5CC3A 1AQMA 3I6TA 3AOFA 3RLVA 5BXSA 1VRDA 2FB2A 1RH9A 3QBUA 3SEPA 3HGSA 3AYVA 4QE1A 2PCEA 2ZZ4A 3RMEA 1UW9A 5JIPA 2XGIA 1NF0A 1SJAA 8TIMA 3VOCA 2EF9A 1XRTA 1US0A 5MHBA 2XSXA 2J8GA 4A8LA 1JZ4A 3SADA 2V8ZA 3WJSA 1XLKA 1E6RA 3HV9A 3P60A 4E2OA 2ON3A 1OFDA 5AZ1A 2GK1B 1YKWA 4TTUA 4C1KA 4S2CA 1XF0A 1YXYA 4DUVA 3BLEA 1XLJA 4IH3A 3MV11 3RUBL 1JYWA 4W86A 5KZMA 4NNAA 2WJDA 2C6QA 1IIHA 4C6EA 3DFQA 3NR0A 4R7WA 3URHA 2OJPA 4GY0A 4HNVA 1OABA 4C6KA 1UR2A 3QQ1A 5CPQA 2ICSA 4WGXA 2CCRA 4KESA 3G3DA 5A2CA 1GQKA 2G96A 3ZSSA 1W1VA 2EO7A 1ZS2A 3WJZA 4NZ4A 1EOKA 4DIAA 4FIQA 4GUIA 4IQDA 4EQRA 1QATA 5C7VA 2QUVA 1ZKQA 1F74A 2ZZ1A 3FKRA 1K8YA 3MHFA 2Z6IA 4PRTA 1HJUA 4H4PA 3PC0A 4AAJA 4EXAA 3W75A 5ABFA 3F5KA 2V6AA 3H2NA 3NQ2A 5LYRA 1OB0A 2Y24A 4IP5A 4GQQA 1FHLA 2QAPA 5JCMA 3LRKA 3OLEA 4HNLA 1MDRA 4ZQRA 3ZT7A 1R9YA 3FDGA 2EGZA 3WBXA 4X60A 2A0NA 3A4JA 4TX9A 3UD6A 4JTAA 4EPDC 1V0NA 4XBKA 4G2DA 3MI3A 5BU9A 1OZQA 4LVBA 3SCTA 2GGHA 1BVZA 4EPBC 4KFOA 4BQ2A 2A8XA 4UNKA 4MHBA 2CWNA 3G77A 3KVKA 1B31A 1SO3A 3NQ7A 3M5YA 1GVIA 3QGAC 3ISIX 2V3AA 3GXNA 3TIMA 3WFLA 1RJQA 4A3YA 1YW1A 3R1ZA 6TAAA 3G8EA 4DNHA 1L2QA 4ONVA 4RE0A 2R6OA 4R27A 3B8VA 4W84A 2PP0A 1GQJA 4FXFA 2X2GA 3N13A 5HATA 3LEPA 4JDYA 3XIMA 5EMUA 4QNEA 1VEMA 1IWBA 3PSVA 5E9AA 3HOJA 2XIOA 3FKKA 3SBFA 3DHFA 4REQB 1W1PA 3S83A 1WQ5A 1JEZA 1Q4WA 3NL3A 1J11A 3HFYA 4A2RA 2XDFA 4NYYA 1TJRA 4B9ZA 4AZ7A 3PAOA 3M4HA 1UR9A 2RFGA 4PYSA 3W71A 4DNAA 4TVUA 3P5ZA 2OYLA 1UMLA 3EX1A 3EWDA 3QZEA 1JOAA 1G94A 5E09A 3T8QA 4J9JA 4ILSA 2ZOXA 5I3FA 4IFOA 3NQFA 4JCLA 3QOKA 4MOZA 4A8RA 1BFNA 2IQ0A 3CT7A 3T44A 4H4WA 1TWZA 4Q6JA 3RDKA 1MQRA 4ZL1A 1YX1A 4MYAA 3BC9A 1WDWA 1C29A 3V5CA 1WZMA 2BV9A 2GOUA 2WKGA 1LL6A 2HS6A 5I03A 4H6KA 5HJXA 2D73A 3UA4A 5DCBA 1YNQA 2FDMA 4LH8A 1QNQA 4NILA 1NU5A 3BAXA 3O15A 3G3MA 1XDJA 3ZT6A 3NQVA 1H1YA 3L4YA 3TVAA 4HP5A 4YWOA 2V9DA 3LCGA 3SGGA 2CEQA 3G1RA 3WD4A 2B7PA 3DFNA 2UBPC 4D8ZA 3T81A 3L2LA 4INFA 1E0VA 2CZEA 4YTUA 1LT8A 1NWRA 4DRSA 2IPWA 4YMZA 6XIMA 1PX3A 1S2VA 1QNOA 1AVAA 2YVGA 3CS2A 3E2RA 1EGZA 5BROA 1GV4A 1SZRA 1P5BA 3L67A 3CV2A 3FA3A 4CD7A 4L4PA 4ZSTA 1KKOA 4CN1A 1R3WA 2V2HA 4R9XA 1RP9A 4PB4A 4A3QA 4UOQA 4CLMA 1KFKA 3MSDA 4IX0A 3NGJA 4MNKA 5JIWA 4AFYA 5K9DA 3V35A 2C18A 1JYVA 1O66A 5GQBA 1EPXA 1ODZA 3M47A 2VWSA 3GU2A 3S6DA 3O6CA 1UD4A 4O16A 5BOFA 4OV9A 5LA0A 3WF3A 4QFUA 3GIPA 2PPGA 4Z1YA 3VGBA 5A8MA 3CLWA 5I78A 1RCOB 2AKMA 3VIIA 2W3ZA 1PSCA 4O1AA 3N2BA 4AD0A 3MV01 4Q6XA 1LQAA 4BF5A 5MKGA 5D9MA 3HQNA 4Q4MA 1GVYA 2YX0A 5AHEA 2W3SA 2DSZA 3MWAA 1SMDA 4I5UA 2QT3A 1L0PA 3PB2A 4ROQA 3DHUA 1K7XA 1WE5A 3GBDA 5DO8A 4DI8A 2A3HA 1DIKA 5BYWA 3R8RA 4QG9A 2PEVA 4P61A 1JR1A 3TQVA 2DPEA 2QF7A 2JIEA 1CIUA 1NFBA 3IJQA 1IWPA 2J9YA 4OZOA 1XLFA 5U7SA 6REQB 3BO9A 3MSRA 1MYRA 3IJ7A 1ZCCA 4GBDA 3T1GA 2WMIB 4EX4A 1KCZA 4Z2JA 3WY1A 1U83A 3VIKA 3AIWA 2W27A 4EACA 2IPJA 2YDSA 2WBGA 1TV5A 4ICMA 3PWGA 2PS2A 3CAWA 4P7RA 2FPYA 4AIBA 3S6OA 4Q33A 3O6DA 2XN1A 1NJJA 1W54A 1IQ8A 1ZDLA 3R25A 4NL1A 3VE7A 4JTHA 4BI5A 3TZFA 1K9FA 3LCHA 4FNSA 1RQBA 5M3WA 1GJPA 4JGDA 3PWIA 1I60A 1VR6A 4I7VA 2QUMA 3GG0A 3L2MA 4W5ZA 1NP0A 4W7UA 2BOFX 5G4HC 2WK2A 1MUCA 2FYMA 4YS1A 2DH2A 3K8KA 4JTUA 4YYFA 3STEA 4PUJA 5REQB 2GDUA 1QDSA 3OA5A 2OEMA 1LUCA 3K8LA 2ZZBA 1OADA 4AC1X 4XKYB 4IPLA 4IJCA 1TUFA 5EMLA 5CPNA 3V1PA 1OG0A 1WZLA 3OVPA 2EQ8A 4C7GA 4EQWA 2V69A 1JG9A 3FFSA 2BG5A 4N42A 2GDVA 2CFFA 1B2YA 3BV7A 4W9TA 4EXBA 1A0DA 3RX4A 1VLWA 4BWLC 1KR0A 2X1SA 1DE6A 2BY2A 1TA3B 4AF0A 4OT7A 3UPBA 4DLFA 3F5JA 4HIBA 5DXYA 3WDIA 3PPCA 1JQXA 2E9BA 3MUXA 1DQWA 2Y88A 1PIGA 2VZTA 1TJPA 3EPOA 3TC7A 1E43A 3TTQA 1DWFM 4KRUA 3HU7A 4WR3A 3W29A 2G3FA 4AZGA 1EJVC 2BB0A 3LGGA 1EJXC 2Z25A 4E38A 1V51A 4P8WA 2DT2A 2EPKX 2E67A 1BTCA 3TN6A 2BASA 3W2NA 1E72M 5LGXA 3VM5A 3A12A 1OFPA 2I9UA 1MEHA 3ZR4A 1Q6OA 5A94A 3MWCA 5FS7A 4X3ZA 4QHRA 3M1ZA 2JE8A 4F0MA 3AIVA 1ZBCA 3DFPA 3B0PA 4C6FA 2GSJA 1F73A 3EX4A 1QXLA 4QDPA 4B5XA 1RBOB 4Z2KA 4HNNA 2GQWA 1O5QA 1XYBA 3LENA 4HZ7A 4GH1A 3SW6A 3OVGA 3T2OA 3A5VA 1FA2A 5D32A 1WDQA 3BGGA 3W3OA 4M1BA 1JXKA 3V75A 5C0QA 5I24A 2YKKA 1FDJA 1OIFA 1Z41A 1EZWA 2OT1A 2PDWA 2TODA 2JK6A 3W2KA 3PZOA 4ZOAA 2CBIA 4ML4A 4N6EA 1JZ7A 2AQOA 4Q32A 3CU2A 3QY6A 4UQCA 5D4YA 4V1YA 1MW1A 5HNTA 4M56A 3KRBA 4ZGYA 5A1AA 4UC5A 4G1NA 3EZ4A 3O0KA 2HNEA 5A2AA 3SCPA 1YADA 4IL0A 1KRAC 1BXCA 2GL5A 2VFIA 1F7BA 2EKGA 2W6RA 2VEGA 2W91A 3W82A 4A8NA 4KKXA 5FJUA 1BSLA 2RHGA 3PTDA 4RPPA 1F3EA 4XSMA 4AY7A 3U5YA 4R85A 4ZODA 4E3TA 4ZEPA 1RM6B 3LQGA 1V3IA 4AISA 3H6OA 4J27A 3IAQA 4NKCA