3ZVHA

Methylaspartate ammonia lyase from clostridium tetanomorphum mutant q73a
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
415
structure length
414
Chain Sequence
MKIVDVLCTPGLTGFYFDDQRAIKKGAGHDGFTYTGSTVTEGFTQVRQKGESISVLLVLEDGQVAHGDCAAVAYSGAGGRDPLFLAKDFIPVIEKEIAPKLIGREITNFKPMAEEFDKMTVNGNRLHTAIRYGITQAILDAVAKTRKVTMAEVIRDEYNPGAEINAVPVFAQSGDDRYDNVDKMIIKEADVLPHALINNVEEKLGLKGEKLLEYVKWLRDRIIKLRVREDYAPIFHIDVYGTIGAAFDVDIKAMADYIQTLAEAAKPFHLRIEGPMDVEDRQKQMEAMRDLRAELDGRGVDAELVADEWCNTVEDVKFFTDNKAGHMVQIKTPDLGGVNNIADAIMYCKANGMGAYCGGTNETNRSAEVTTNIGMACGARQVLAKPGMGVDEGMMIVKNEMNRVLALVGRRKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords METHYLASPARTATE AMMONIA-LYASE
publication title Engineering Methylaspartate Ammonia Lyase for the Asymmetric Synthesis of Unnatural Amino Acids.
pubmed doi rcsb
source organism Clostridium tetanomorphum
total genus 158
structure length 414
sequence length 415
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
A PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3zvhA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3zvhA01
4M0XA 3VC5A 2ZADA 3VA8A 3EKGA 5J04A 4IHCA 3D47A 4MGGA 1EBGA 1RVKA 3I4KA 3U4FA 3UJEA 3CT2A 2PP0A 4GGBA 3DG6A 3D46A 5FJTA 2PSNA 4JN8A 3DG3A 3I6EA 3UJFA 1MUCA 4IL2A 1EC7A 3BJSA 5FJOA 3JW7A 1KD0A 2GGJA 1XPYA 4IL0A 2GDQA 1W6TA 3TJIA 3TOYA 4DWDA 2OPJA 3VDGA 3FYYA 3H8AA 2PTWA 4KPLA 3PFRA 3UXKA 1BQGA 3OW1A 3CB3A 3N6JA 2GGGA 4F4RA 3V5CA 4IZGA 3P0WA 1SJAA 3SJNA 3T4WA 3R0KA 3GD6A 3GC2A 3TWBA 2RDXA 2MNRA 2O56A 3VCCA 2AL2B 2P0IA 2OZ3A 1SJDA 3H7VA 3R11A 3H70A 1TZZA 2P8BA 4DX3A 3ENLA 3NFUA 3V5FA 3N4FA 1KKRA 2PS2A 1BKHA 3T9PA 2DW7A 4GYPC 4GIRA 1R0MA 2AL1A 3ZVHA 3N6HA 2PTZA 2XSXA 3I6TA 3PWGA 4A35A 1EC9A 3ZLHA 3DFYA 1MRAA 2OQHA 3OZMA 3DERA 2XGZA 3TTEA 3MWCA 3STPA 3HPFA 4ENLA 3ZLGA 4KT2A 4YWSA 2QJJA 2XH0A 3DFHA 3DG7A 3B97A 2GGEA 4KEMA 4ZCWA 2QGYA 3ZVIA 4K2SA 1WUEA 1MDRA 2AKZA 3ES8A 1EBHA 2PCEA 3H12A 2PPGA 3T8QA 4HN8A 3TCSA 4FI4A 3DIPA 2FYMA 5ENLA 3K1GA 2OX4A 3FJ4A 1KKOA 4FP1A 1YEYA 4HPNA 3U9IA 1R6WA 4GFIA 3R25A 3RGTA 2PP3A 2GL5A 2PU0A 3RR1A 3VFCA 1SJBA 3SN1A 4K1WA 3R10A 1NELA 2QDEA 4J3ZA 3MKCA 1MNSA 2PGEA 3TW9A 3ZVHB 5BOFA 4HCHA 1ECQA 3UXLA 3THUA 1EC8A 3N4EA 1IYXA 4DHGA 5IDZA 2HNEA 3CAWA 4HCDA 1NU5A 3TQPA 4GGHA 2OVLA 3RCYA 2PODA 2PGWA 3OZYA 2MUCA 2PMQA 2XH2A 4KWSA 4X2PA 1WUFA 2QJMA 3NXLA 4E8GA 4HNCA 3QN3A 3V4BA 2XH7A 3DESA 2HXTA 4Z1YA 3S47A 2P8CA 3FXGA 1TKKA 1ONEA 3UJ2A 4E6MA 4H19A 1L8PA 4J1OA 2PU1A 4HNLA 3QKEA 2QJNA 3IJLA 4IT1A 4Z17A 6ENLA 3NO1A 1PDZA 4EWJA 4JHMA 1ELSA 3MQTA 3GO2A 4DYEA 3CXOA 5EU9A 4E5TA 5BOEA 3VCNA 3FV9A 1FHUA 3NZGA 2ZC8A 1P43A 3V3WA 4H83A 5FJRA 4H1ZA 3TWAA 3IK4A 1DTNA 2HXUA 2ONEA 2I5QA 3P93A 2OO6A 4A6GA 2XH4A 1JPDX 3Q4DA 1PDYA 3OP2A 4IP4A 3TJ4A 1TE6A 3UJRA 3RITA 4E4UA 3R1ZA 3SSZA 3MUCA 2OKTA 3UJSA 1E9IA 3QLDA 1XS2A 4E4FA 1F9CA 2PTXA 4HYRA 2OZ8A 1P48A 3JVAA 3IJQA 1SJCA 2OLAA 2OG9A 7ENLA 3P3BA 3T6CA 3RRAA 3JZUA 4GMEA 4MMWA 4ZA0A 3MSYA 4A3RA 1JDFA 2OQYA 4G8TA 3OPSA 2QQ6A 3DGBA 2OFJA 4HCLA 4G7FA 3SN0A 1FHVA 3UCCA 3DDMA 2FKPA 3EEZA 4ROPA 3QTPA 2QDDA 1JPMA 4MKSA 2PP1A 4DXKA 2NQLA 2GGIA 2QVHA 3UCDA 3IJIA 2PA6A 4M6UA 3CYJA 1JCTA 3SBFA 3ES7A 1OEPA 2HZGA 5FJUA 2AL2A 3PWIA 3FCPA 3KUMA 2PTYA 3GY1A 3PK7A 4H2HA 3DEQA 1MDLA 4GYPA 3MZNA 3S5SA 2P3ZA 3ZLFA 2OZTA 4DN1A 4K8GA 3SN4A 3MY9A 4IP5A 3OTRA 3Q45A 2CHRA 3QPEA 2AKMA 4JN7A 4GISA 2POZA 1KCZA 3BSMA 3R0UA 3BOXA 2DW6A 5FJPA 2GGHA 2P88A 3UGVA 2GSHA 3FVDA 3CK5A 3VC6A 3SQSA 3RO6A
chains in the Genus database with same CATH superfamily
4M0XA 1TTQA 2ZADA 5LIKX 1WKDA 2G97A 3N2BA 4DEFA 1V77A 3P7YA 1JCLA 1F5ZA 3SIZA 4L1GA 1XKYA 1N5XA 2DIEA 4RK8A 4IG2B 1LT8A 5EL1A 3AIBA 5LA1A 2PWEA 2CLMA 2XVPA 1E43A 1OK4A 3E96A 4G9PA 5HMFA 2GWNA 5BYWA 5FS9A 1KCLA 1W91A 5K4ZA 4B3KA 4ZEPA 2V2DA 2ZCGA 2JIEA 2NZLA 4KPLA 2R1LA 2Z26A 1BQGA 3NZ1A 4KEZA 2EBNA 4ZE5A 3B8UA 4GY0A 3GLCA 3TIMA 1FWCC 3RM8A 3NQEA 4O1CA 2CXGA 4PBEA 5HQEA 3AMKA 1I2PA 3VCCA 1VHCA 4GUJA 2EPHA 3H26A 2J7CA 3E0WA 1UJQA 2FPVA 3I7SA 1NH6A 4INFA 4U28A 1I8JA 4ZB5A 1SW3A 4A3QA 4HMDA 2DT3A 2VCBA 1H0IA 1Y0EA 3NG3A 4PUWA 1YNQA 3NOEA 3VNKA 4XIMA 4U33A 1JRCA 5KINA 3NURA 1G69A 1SM9A 1MI3A 1WDQA 8XIAA 3LCXA 3WBEA 1ZCOA 4XZHA 1WE5A 1KCXA 3W28A 2H9AB 3E6EA 3GXMA 3STGA 3M7WA 1RBAA 3WSUA 1HQTA 4HZ7A 4CD4A 3NM1A 2ASHA 2ZZCA 4W5ZA 4QG8A 2VFFA 4GIAA 3M43A 4KS0A 1SMDA 1AJ0A 3DK4A 1EBDA 3KVJA 5FS7A 3UXAA 4AIEA 4P7NA 3Q6JA 3CMFA 3WMLA 1EEXA 4O57A 4BWLC 2QUMA 1TZ7A 1XPGA 4HN8A 2QAPA 5BRPA 3NL2A 1UD4A 4L61A 3WFLA 2ZX6A 2FZDA 3TP4A 1W9XA 2GFTA 3E49A 2YB1A 4WJEA 3AS1A 3ARXA 3PUEA 3MUZ1 3FGCB 3QV8A 1ZS2A 1RY8A 3G8RA 1A5BA 4UFHA 1STZA 3VIMA 4A29A 4PH6A 5CSRA 1MO0A 4JNZA 1PZ2A 3ABRA 1O12A 3HF3A 3PWAA 3CV6A 3L4WA 3AFBA 1EP1A 2F6XA 3D3AA 1W0MA 2ESCA 4GHRA 4BR1A 1TPEA 1W56A 5U1OA 2VURA 1E6QM 1MMFA 2ISVA 3VUSA 1J93A 1O4UA 3HPXA 3T81A 3TQ0A 2CZEA 4GQQA 5GQBA 1MWOA 3II1A 3GTIA 2RDWA 3IUIA 2BHUA 4GGHA 2PGWA 3OZYA 3JU2A 3ITCA 1XJBA 3SFKA 2EPKX 4XVDA 2GVLA 2WMGA 4Z1YA 1KXHA 1GTHA 1KFBA 4AZCB 1NJJA 2XZ9A 4J9JA 3EANA 4M51A 2CLFA 1EGMA 4E6MA 2HTMA 6TAAA 3P0XA 1E6PA 4CQAA 1OWQA 2JIWA 1V8EA 2B7OA 4Z1DA 2X1SA 4DB7A 4IJRA 3VMPA 1FEBA 4JX6A 4D8ZA 1RA5A 4JPGA 5JRBA 2OEJA 4RPQA 4UFKA 3MQTA 4LSBA 1AK5A 2ACQA 3LXAA 2VJXA 2CLKA 3DC8A 3KL3A 4UFMA 1GRGA 1CXHA 3KP1A 4ZB2A 2WP5A 3HOJA 4G2DA 4IPNB 1QASA 1FIQB 5BXSA 1X1OA 2F6UA 3SGUA 4O12A 4EQSA 4M81A 4B15A 1OINA 2C1HA 1D3HA 1WDPA 2WLYA 2XFWA 4KCVA 1TE6A 3ZS4A 3GXPA 1H7PA 3UWEA 5A95A 9XIAA 3E12A 3NOYA 3QZEA 4IXXA 3NPXA 1VFMA 1QW7A 4W87A 2OWXA 3LD5A 4PUJA 1SFJA 1YRRA 1GETA 3L23A 2DUZA 3BW3A 3E1F1 2VZUA 1V7AA 3CEUA 4CN1A 4AYSA 3BURA 1X39A 4XAFA 5LNWA 2Z1XA 3OGSA 4WOZA 1CBGA 3BJTA 3QR0A 1MNZA 1VBHA 1N2VA 4C60A 4MOZA 2ZUSA 3OBEA 4C6EA 1HFBA 3LB0A 1XYAA 1DOSA 2GUYA 3DFQA 3SGZA 3AZSA 4ZOBA 1LBMA 3UESA 3EEZA 4DUWA 3AISA 3TXZA 3C0SA 1KGXA 3AJXA 4PRWA 1HL2A 1UWRA 4IPIA 3RPDA 3E5PA 2NX1A 3LRKA 3FS2A 3KRZA 4KIRA 4LUSB 3O0HA 5CC6A 2QXWA 4NAFB 1K3UA 2Y89A 1FFUC 3N29A 4H2HA 5I77A 5DXXA 4GX9A 1M7XA 2ZRUA 5JUVA 3DCPA 2VQTA 3WD2A 1JNDA 4IF2A 1Y5WA 4K8GA 2CERA 3ZSTA 4CU7A 4Y8EA 5C7HA 4LT9A 4YTSA 4PMQA 4E2BA 4PMOA 3QKZA 3BSMA 3GHTA 5HQLA 1H11A 3VOGA 1M03A 3N18A 1HGWA 3KS6A 1K8YA 4EAYA 4S3EA 1EQPA 4NJJA 4AY1A 1W3KA 3CHEA 3BDKA 4Z2GA 3ZT7A 2P50A 1XLGA 4JKLA 3VOIA 2ZA2A 1IEXA 1JZ3A 1Z32X 3U4FA 2ZOXA 4RUBA 3K8MA 1J6PA 2A3HA 3FIGA 3MHFA 3FFSA 2OT0A 1DP0A 1GVOA 3LCGA 3MS8A 3TUUA 2WJDA 3PJWA 3CLMA 3GAKA 1UD2A 3G1HA 1OCQA 5DELA 4QTGA 4DQWA 2DEPA 4L4LA 4C6BA 3QGAC 1OFQA 3U0HA 4CCDA 4DI8A 3G2GA 4WVXA 2WCSA 2PTWA 1XLIA 3XIMA 5BXTA 1F74A 5DEZA 4D9PA 2ZX5A 3MZ2A 5CZTA 4DF2A 4EVZA 2WKJA 4LF2A 1PVNA 2B0MA 3T4WA 4Y8FA 4IFRA 1UZ4A 3PTMA 2CLHA 2CDUA 3R43A 1CECA 4XAPA 4CCZA 2NX3A 5HJYA 1H7WA 1XDIA 1D3GA 2QYGA 3BH4A 3W7EA 2CLOA 3VKAA 2YYTA 1H3GA 3V7PA 3C3NA 3IGXA 3N6HA 2OOGA 1T8QA 3CL6A 4A35A 1OX4B 5FF3A 1DWJM 2A3BA 2W66A 4EK7A 2Q01A 3M6YA 4LALA 1IT8A 4C5ZA 3UERA 1MRAA 3WDHA 1UMYA 2V5BA 2XGZA 3LEPA 5M17A 2QZRA 5HWJA 3LBOA 3SQMA 2G3IA 3O07A 4UBPC 1MXDA 4ENLA 1R5YA 6PTDA 4F0KA 1C29A 1XLEA 4AB4A 2V5CA 2DQXA 4S38A 4X63A 1F6KA 3UWZA 3PANA 4JXCA 3IAQA 2J25A 1RQHA 4JCLA 2QGYA 1C9WA 2W5FA 4XZMX 2HSAA 1SW7A 2D0FA 4MDOA 3ZOAA 3H12A 3VGDA 1G4SA 2VEKA 4RKAA 3W26A 3AAMA 3TCSA 3Q94A 1U5VA 1HP5A 3URAA 4EF9A 3M0KA 1A5SA 1J12A 4HPNA 1FBAA 3IVSA 2WPGA 1MQRA 5TNVA 1XRSA 4IFKB 2DZSA 5HAOA 2A4AA 1PIIA 3ALFA 5G1YA 1NDAA 3DHPA 2Z2AA 3N9KA 3N11A 1GERA 1NWRA 1A0DA 2YVGA 4RW5A 4TX6A 1CGUA 1JR1A 1DL3A 5D9NA 2VENA 1UJPA 4G6CA 5CBJA 3WN6A 5K9CA 1ECQA 5A6AA 3P82A 2IKHA 2C3ZA 2PLCA 5CZSA 3N4EA 3LPGA 5A6TC 1IYXA 4IGSA 1O5QA 1XLDA 4U31A 3OVGA 4FNUA 3U6WA 3CAWA 1UUMA 1XCFA 5CJMA 2ZE0A 4LAOA 3G1XA 2H6RA 2OVLA 2VDGA 3VNZA 2PODA 2I7GA 2MUCA 5GNXA 3M0XA 2XH2A 1PHWA 1YTKA 1WA3A 4EF8A 3TEVA 1XIDA 3E2QA 1LQ2A 3A4JA 1AVAA 2PLJA 4K3ZA 3NQ6A 3MBFA 3M0JA 1LDCA 1JQXA 3M9YA 1J4EA 2JK6A 2OKOA 3QKEA 4HU8A 2QJNA 1XV8A 1R7AA 3BTNA 4AZHA 3W02A 2PURA 1BWVA 1EIXA 1PDZA 4ZSUA 3W7IA 2VX5A 4P8VA 4JHMA 2G4JA 2PRHA 2I57A 2OEMA 3GO2A 1OGGA 3VKJA 2PWFA 3AIEA 3BV7A 3NQVA 3QM3A 2WSKA 4Z1BA 3RLVA 5BOEA 4IICA 1Z8AA 4H4QA 2X7WA 1XXXA 5HPCA 2V3DA 4GNKB 4UTWC 3N12A 5HMSA 2YKKA 2OSYA 4L64A 1C7TA 1YLVA 3Q4DA 3DFOA 3QXBA 3UQNA 3GWQA 1IXQA 4DNHA 1GKPA 1VFSA 3GG7A 4UFLA 3WD0A 3UJRA 1U5JA 4C7FA 1D2KA 2ABAA 4GJJA 2OEKA 4H8UA 1U2YA 2I9EA 2HVMA 3L2IA 2QLYA 4A8NA 5HOSA 2YDRA 4E4FA 2QULA 3M5YA 1A5NC 3S9IA 3KLJA 2BOEX 4EMJA 4R9XA 3GNDA 4HB7A 3W37A 3IACA 4HYRA 4FLSA 3VE9A 2OZ8A 3JVAA 3ZMRA 1GYLA 1Q6GA 4GFSA 4AEFA 2HJPA 3RU6A 1AUSL 1EL3A 3OHMB 3ZWTA 3T0AA 1T8XA 1G94A 5FJJA 3JZUA 2WOIA 3HMCA 3BPWA 5HWMA 3VNDA 1FXPA 3OPSA 3S5YA 5G4HC 4JIQA 5JU6A 3W6MA 3SUVA 4KRTA 3GXDA 3VI2A 4DO6A 4FDCB 4JQ9A 4P61A 1YDOA 1W3IA 2I9UA 4IIHA 3FCPA 5DLCA 4UNLA 1E0WA 3PK7A 1P1XA 3LCFA 5LA2A 3FHQA 5B7ZA 1NHSA 2DJLA 4C6CA 3WUGA 1M1BA 3UU0A 1X1NA 3MA8A 2WVVA 3MY9A 4P2VA 3TN4A 4GYKA 1OC7A 4GISA 3WBAA 3F4CA 1W9BM 3EEGA 3UF9A 3R0UA 1E4LA 2R24A 3L67A 4MWAD 3W27A 1WKYA 1V02E 1XHGA 3B9DA 1W5PA 3FOKA 3QMRA 4MWAC 4LEFA 2OSXA 5KVIA 1AG1O 1WKFA 3S1GA 1YKWA 5JIWA 1EWEA 4MPKA 1JIBA 1XGDA 4AD4A 5JCLA 5DY3A 4H8NA 3THAA 2GVYA 1JULA 4YWOA 3BJSA 4N6EA 2ZBTA 5DT7A 3H2CA 1OABA 2P76A 2W92A 4XUYA 4DWDA 2OPJA 5BROA 3UXKA 1FX6A 3SQPA 3N2CA 3P5ZA 3SY5A 1NAL1 2FMNA 3QC3A 3NEVA 3TU9A 1OYBA 1PKMA 2X7VA 6XIMA 2FFIA 4L80A 5E0CA 2YCIX 2OMAA 1WQ5A 3H70A 1RAKA 1YBQB 4AXNA 2QV4A 1Q1RA 1DJZA 1TPUA 3WH5A 1UC5A 3R4IA 4GC4A 1OM0A 3IIVA 3KE0A 4RZ5A 1PWMA 4QEEA 1VFHA 3I7RA 1ADDA 2YCKX 3CTTA 1FWHC 4GVGA 1Z3NA 5D09A 3GYCA 4BI6A 1OX5A 3PZQA 4XD5A 3DERA 4BHYA 4R53A 2WYSA 1UD5A 4C6IA 3P67A 3KHDA 5TD4A 2NUXA 3H4XA 3ONBA 4DJED 4MNKA 5MKGA 1E51A 1M9HA 4J57A 1TV7A 4M1RA 4S3BA 3UZZA 5CPLA 3BICA 4KESA 3UP8A 4KEMA 4N6FA 1D9EA 3IIPA 1GTEA 4DJEC 1P4CA 1KM3A 2EQ6A 3AJ7A 1MQQA 2FQIA 3OEXA 3FNDA 3SB0A 2GVGA 5KETA 3HRDC 4F66A 1ONFA 2WMFA 2VWSA 4GACA 2W0HA 3AYSA 3L66A 1RLDA 5CZJA 1EDTA 1NDVA 3DIPA 4W93A 2GPTA 1N60C 2CWNA 1EO5A 2UZ9A 1YEYA 3LPOA 1TA3B 4S2CA 4LBRA 3K5XA 3WENA 1TTIA 3RLUA 3CHDA 5B80A 2WVTA 4XO6A 3SN1A 2RDUA 5I0DA 3G22A 2ZUTA 2OGJA 1XWYA 2X05A 3W3OA 4MB5A 4WR3A 3W6LA 4ZQNA 5CKSA 2NWSA 1I6NA 4PCTA 3FHAA 1GHRA 3NVDA 1CGYA 2FZ8A 4GA8A 1IIGA 1MNSA 1JG9A 1WXJA 4A05A 4HHMA 3E2SA 4D2JA 3BG5A 1KFLA 5LGZA 4HMCA 5AOUA 4H7VA 3TTSA 5M2FX 2ZDSA 3B0YA 4W88A 5A69A 4BV6A 1M65A 5CLWA 1KBJA 3LUTA 4BI5A 2E5DA 4LCRA 3MCNA 4LXFA 3NXFA 1PZ1A 1SSGA 7XIMA 2QVNA 1G4TA 3QN3A 3DESA 3REQB 5C2XA 3VD5A 2NW0A 4GUFA 4J3SA 3ARSA 2RAGA 4DWSC 1IWBA 2VWTA 3ZO9A 5DY2A 4X0VA 1GOXA 3W29A 4M24A 1PHQA 4W8BA 3CIWA 1CXKA 4A3HA 3MV01 4JYEA 2EQ8A 1XC6A 2H8XA 2YA0A 4M3PA 4FNTA 2IW0A 2PFHA 3L12A 4DYEA 2VC9A 2WZIA 1YMYA 3LPPA 1OFOA 5EMLA 3AIUA 1CIUA 1XIBA 2RJHA 2A3LA 4ORMA 3SW6A 2E5BA 4PBFA 2A2IA 3EB3A 1LWHA 1E6RA 3S46A 1H1YA 2A7NA 1CWYA 3HQPA 4CQDA 1JEZA 4C6NA 3QR3A 4GZEA 4GYJA 3GG0A 1PDYA 5C70A 3H4KA 3CQHA 5CC3A 2XIBA 3L65A 1VBUA 1W5MA 1N5WC 1KR1A 4QG9A 1XH0A 1ZUAX 1CXEA 5EMMA 9XIMA 3UJSA 1J18A 3AU6A 1AL8A 3KL5A 5KZ6A 2QAFA 4MUPA 3EOEA 1XS2A 2VEFA 1Q6DA 1ONWA 4H4SA 2PTXA 2NVCA 2ON3A 3WLOA 3IIOA 3ZT5A 2CBJA 1O66A 2X1RA 4AMCA 3SSJA 2ZQ0A 4LX4A 2OLAA 4PMNA 1A5OC 1MW3A 3URHA 1W2VA 1NWUA 4XQ6A 3TAKA 1IZKA 1LOLA 4HQVA 1VIWA 2W79A 4GZJA 4FHAA 2Z00A 2VDHA 2A79A 1WDRA 2GOKA 1I0DA 4OE7A 4PB4A 3R8GA 4Y6GA 3TLQA 3U48A 2X8RA 3AUOA 1MFUA 3LYEA 4MADA 1GQKA 2C1IA 1YDYA 1LUCB 2HPMA 1ZY8A 4DXKA 1YADA 3R8RA 2A7RA 5D04C 1QVBA 3SCOA 4XTIA 1JCTA 5HR7A 5LNVA 1LVLA 3SZ8A 1WZLA 2VFIA 2PTYA 4Y2WA 1ME7A 2QF8A 3FG2P 3WEMA 1F3WA 4LS2A 2WP6A 1R86A 3W1PA 3MP3A 1TCDA 2P3ZA 3A6OA 2CLPA 2BX7A 3VD7A 2FZNA 1GEHA 4DN1A 3VPLA 3G3MA 2BOGX 3SN4A 1ADSA 2CXEA 3UNTA 4F2TA 4YCPA 1JUKA 3BL3A 1ENUA 2WK2A 1XIMA 4MAZA 1XYMA 3KCJA 5AYXA 1PIFA 1F8IA 2DP3A 1J01A 5FSDC 3E0IA 2GSHA 4BF5A 1YYAA 3RO6A 3VC5A 1J2WA 3H22A 3L5LA 1EBGA 4FMVA 3S1VA 5JBFA 3VD3A 4CNUA 5D2YA 3CYVA 5FOOA 2PDMA 1J5SA 4JD4A 1J2BA 2B7QA 3UW6A 2H8ZA 2BS9A 1RPXA 2A6NA 3EB4A 4FAMA 5I3JA 4E3VA 3E3HA 4Z2JA 5I07A 4ZZ9A 3S2LA 1AQ0A 9RUBA 4PTNA 3ABXA 4IL0A 4JAWA 2CBIA 2NV1A 1K02A 3C52A 4ZMGA 7A3HA 3WX7A 2JE8A 2R9RA 5FF4A 3CAVA 5CCZA 2WJFA 3H2NA 2QCDB 3OW1A 3CB3A 1LWIA 3KDOA 1NFBA 1VZWA 4D6IA 5I6SA 2D69A 3THQA 1EO7A 3OB8A 4LF1A 4LV9A 1BLIA 2MNRA 1W1YA 2NLIA 5J5DA 1X6NA 4DNMA 2VC5A 3SGGA 3ARQA 2WMJA 3ZJ7A 1YQZA 1HUVA 3C3UA 1A5KC 4XKYB 1XIIA 1FTXA 3RCNA 3ELFA 4DXVA 3CPRA 4OBRA 1D3CA 4TVDA 5C2GA 3ORWA 4ADWA 5C0QA 3G1VA 3FJNA 4I7VA 4O13A 3GXNA 2PWDA 1HJSA 1QNOA 3DFYA 2R9ZA 3A4WA 4WK9A 3VIGA 4AD2A 1VAHA 4O1AA 3UG5A 1WAUA 1W1TA 1GJUA 3DBPA 1G4PA 1ZFJA 3E2RA 2D0HA 2IQ0A 3P8IA 3WLNA 3AHYA 4J2MA 4H4WA 3B8VA 3DGHA 1PPIA 1WBJA 3MUAA 1Q6OA 5GRTA 5F7UA 3USZA 3LLDA 4Q6JA 5GJPA 4LS0A 3C8NA 2WXDM 4AX6A 2NVAA 2Y7GA 3W07A 1DJXA 3FVMA 1EYWA 2JF6A 4LWWA 2BMBA 2HWGA 5JCMA 2FDMA 5AZ0A 1IQ8A 2BZNA 4B92A 3SQLA 1OY0A 1PKLA 1R47A 4QBXA 2C3DA 3GH4A 4B5UA 4OKDA 1S2TA 4E0CA 3B40A 3EOUA 2Y8UA 2AGTA 3VOCA 2J7EA 3QV9A 5GNZA 5PTDA 3HPZA 1OG6A 3TR9A 2Y7FA 1MEWA 4IMEA 5G5HB 3U9IA 4J2PA 5EFFA 2PU0A 4MYXA 5LIUX 4NX0A 1JDAA 1TE1A 3W7HA 2PDLA 1JRPA 5AY7A 1N8FA 4H4XA 2Y8KA 4R7WA 1ADOA 3WJSA 1B3YA 1U83A 1V3MA 2DZTA 3TA6A 1CTNA 2KX9A 5REQA 2PDNA 2IXVA 3CH0A 4UTFA 1Z48A 4HPXA 4D6DA 4NSBA 3ZVHB 3WQVA 4QCFA 3SI9A 3BWWA 3UXLA 1JZ6A 5H8PA 1KTCA 1KM1A 4M6VA 1PL9A 3LV6A 4H6KA 1D7YA 3ERPA 3WUFA 5IDZA 1V59A 2W3SA 1HO4A 3VNIA 4PTVA 3UCQA 2AQWA 2RHGA 3AIRA 3G6LA 3EAUA 2IXUA 3H21A 3GBEA 2QUNA 1SZNA 4JICA 1V6WA 5FEZA 4IGMA 5A6LA 1MXGA 4HD5A 1XICA 2EPOA 1LPFA 4C65A 3W6YA 2HROA 1Y7VA 2G37A 3L5AA 1CLVA 2Z28A 1TV4A 1JCNA 1DJQA 3BGJA 6TIMA 4J56A 1HJQA 4ZSTA 1YXDA 2D3NA 3APGA 2R1NA 3D0CA 3TXVA 1UW9A 2UBPC 3CXOA 1ZBWA 3H2EA 1ZY9A 4H83A 4ADTA 1Q66A 3B0PA 1NY1A 3PVFA 1UG6A 5AYYA 1C8QA 3GRIA 3LCHA 3B04A 2F38A 5AHEA 4C1NB 1OFRA 4A6GA 1JPDX 3WLLA 1UWQA 4OJYA 4AAJA 2DJXA 3CT7A 4PMJA 3P81A 3VCRA 3W83A 2Z6IA 1TJ2A 2J8GA 3WDIA 4D6CA 4JDRA 5IOBA 3W38A 2XZ7A 4MJMA 2DUAA 1E9IA 2VVNA 4FS9A 2Y1HA 1P6WA 1Y8BA 3DHUA 1KXTA 1GG1A 3FLUA 3NQGA 4IG2A 2DFAA 1E73M 3BZGA 5T91A 1VLIA 7REQB 4JIRA 3F03K 2FPTA 1T40A 1JGMA 3CGTA 3GRTA 3W1TA 3ARWA 3N73A 7ENLA 2QHAA 1KBKA 4LFYA 1PXGA 4W5UA 4NRRA 3VKCA 3TSMA 4R5EA 3AHVA 2Z4GA 2G0WA 1IE7C 1GVQA 4HTBA 4TV5A 1WDSA 1FHVA 3SRFA 6A3HA 3W82A 1VEMA 5HA7A 3MJMA 3DAQA 1JPMA 3WJWA 2BBFA 1POJA 1MEHA 3BAKA 3R5EA 1FCUA 3V75A 2G8ZA 4ATLA 4NIRA 3WQ8A 4LU0A 4M6UA 1EHAA 3S1XA 2VX6A 3FKRA 3BAXA 1EXBA 3KAOA 4TR9A 3WFZA 3KUMA 3BV4A 1UUQA 3V35A 1PWLA 3BQ6A 5M03A 4GYPA 6XIAA 5F4XA 2BASA 2FHFA 3AICA 3C0JA 1B3WA 4JTFA 3UY7A 2NWRA 1BRLB 4DO5A 2Q71A 3JS3A 1OB0A 4O1FA 5E5CA 2W54A 2FHBA 2GUBA 1KCZA 1GRHA 4K7VA 3CMGA 5DO8A 4YU1A 5CLTA 1JDEA 2D22A 3MBDA 4JTJA 1R3QA 2YQUA 2FLIA 1A5MC 3Q65A 5D03A 2B4GA 3SQSA 2IPWA 3A47A 4E3TA 3D47A 4MNJA 1GCYA 2R82A 4UTUA 4EPBC 1XIHA 3UA4A 3QW3A 4FK9A 2H9AA 3ANYA 4NI8A 3GU1A 4JTUA 2H3DA 4D1JA 3DG6A 1E5JA 1XIGA 1JUEA 1TIMA 4L65A 4PL2A 1UQZA 1AH4A 2ATMA 3I6EA 4UFIA 7PTDA 5LGXA 2CHOA 2DZXA 1LG2A 1NARA 2GLKA 3EBVA 5AB3A 2OSWA 1K03A 1XD1A 3MTWA 4MLJA 2VL4A 2WBGA 4M6QA 3T07A 2ADAA 5EYWA 1QWGA 4H7ZA 5LKYA 1E70M 3WBXA 3GHRA 3C6CA 3AU2A 1DORA 1SFTA 1VYSX 2ZZ0A 4AC7C 1Q63A 4LAMA 3H2OA 1N8WA 3DX5A 3AMGA 3FGCA 4RE2A 4WJXA 4BURA 3PZUA 4B3LA 1JROA 3ITYA 1AW5A 1N82A 2P0IA 3CU2A 1I2RA 1S5TA 3EX1A 3JR2A 4B16A 1W9PA 1ZZMA 1O1HA 1M7OA 3RIKA 3CLWA 2OB3A 4AEEA 1TELA 3V5FA 1ZP3A 1ZNNA 3N4FA 1XX1A 1POKA 3KVMA 5KSWA 5H2ZA 2CLEA 2QCFA 1R0MA 2WNQA 5GNYA 3OGRA 3KOFA 3PBWA 4GKLA 3WK0A 3LADA 1UIPA 1XUUA 5LXXA 4EXQA 3T2QA 4LAZA 4Q32A 1WZKA 3N14A 3CXBA 4QS5A 4WX2A 2ZZ4A 1V0KA 1Q8AA 4RW3A 3LX9A 5EMYA 1P1MA 1FWWA 3QHMA 2B81A 4V1YA 3VNYA 1F4AA 5CZKA 4JTSA 1E6ZA 2FB2A 4LYKA 4AD5A 1OJXA 5F4WA 4LUIA 1LYXA 1A49A 4UZUA 4GI6A 4AZCA 3TN5A 4O53A 2BXZA 1PTAA 2GVEA 2I17A 1E3XA 4XK2A 1KNWA 4Q4OA 1ICQA 4O54A 4LNYA 1OADA 1TJ1A 4QROA 4NAEB 2NPXA 3VDBA 2XGBA 2WZTA 3LXBA 4OTKA 3VOJA 3F2BA 1ISYA 5D2XA 4UQCA 3S5OA 3T8QA 4QNWA 2FVLA 3BANA 5EBAA 1BD0A 5A2BA 3GTNA 1XYBA 2X42A 2HS6A 1TRDA 2DSZA 2HQAA 4LS1A 3SCRA 1LRQA 4YVPA 3OLGA 5BWFA 3GVWA 5FI8A 1JAKA 3CO8A 3FKKA 4HGXA 4OFCA 3FEMA 4NJHA 3GDLA 4ZQRA 1SO3A 4BKNA 1O5XA 1AOGA 2O9RA 3GW0A 3QY8A 1K9DA 3GVQA 1WDWA 3OBAA 3G5EA 2A8XA 1HL8A 3NQDA 3PBVA 4E2VA 1VPYA 4B2DA 1UR1A 4HP5A 2VMFA 1LF1A 2ZUWA 4M7TA 2NQ5A 3QFAA 4Z42C 3A5FA 2ZVRA 1J8VA 5FIPA 3D9XA 1RD6A 3R8HA 3KW3A 3WQGA 1HKJA 1H51A 1Q6CA 1ML1A 3PBGA 4EANA 2HNEA 1B4EA 3K8KA 2ZX9A 2VEGA 1S3TC 2PLMA 5G1MA 3ABQA 3OA5A 2BGSA 4QSHA 5DX7A 3P60A 4HNCA 3TQVA 4DO4A 3V4BA 4S3GA 1BKSA 3BAWA 1B9BA 4EAMA 1UD6A 1UASA 4NY2A 2A5HA 1GUVA 2RUSA 1L8PA 4P7LA 1TPH1 3DXIA 4XZ9A 3EX4A 4S3FA 3WK2A 2P10A 3WMBA 3CPUA 2OODA 1FWNA 4LUSA 3KRUA 1MOKA 2R8WA 4NAFA 1T99A 3ICJA 3PPFA 4FOJA 1LT7A 4EP8C 3QPZA 2W3RA 3CGDA 4ZENA 3F1QA 2NT0A 3VCNA 1ZJBA 4L6OA 5GJNA 3KBMA 3SRDA 1RP8A 4ORIA 3MUXA 1B31A 1OCNA 3GH7A 2WVSA 2TSYA 2ACSA 1J96A 3N3MA 4LUTB 1PX8A 2WPEA 5FSEC 2YPIA 2VDIA 2WSYA 4FX9A 1QMLA 4H01A 3WLIA 2UV8G 2PDXA 3UG4A 1UOZA 1R46A 2Y0FA 3CGEA 1W1VA 3B03A 4J27A 3WQWA 3ME3A 1XYFA 2VFHA 4L4MA 1VFFA 1RQEA 2O4MA 3SRKA 5HINA 3W71A 4YTQA 1XUZA 4QRNA 2YVFA 1EQCA 3TR2A 3TN6A 1NQKA 1ZKQA 5SWUA 5IHSA 3VXGA 2YL9A 3T0DA 3K1DA 3LENA 1EF3A 3O6DA 5D02A 3WH8A 1WP6A 3PJTA 1W9VA 1NDZA 1QBBA 1DPMA 3G8EA 1LBLA 5E0FA 3OLDA 4UQDA 3C0QA 5TF0A 4NG3A 3CGCA 3O0KA 3DFPA 1UP3A 1XINA 2QCCA 4DYJA 3KOXA 2FHCA 2YA2A 1X38A 4ZTYA 4AC1X 1J79A 2QW5A 4MB1A 2D24A 2GSJA 4FLOA 5D4YA 4D6HA 1KWKA 1V6VA 1V0MA 4DM2A 1KGUA 3GY1A 4CNPA 3FJLA 2VRQA 3RILA 2ZZ5A 2KZHA 5ABFB 3GNXA 2W9MA 3MZNA 3CS2A 4I90A 2OTDA 2G5WA 3W7JA 2XTKA 2Z25A 4IUGA 2QCMA 3QPEA 3NUKA 1UR2A 3S3GA 5LIYX 4LOCA 4QCEA 1F6PA 2IMRA 1TPWA 5FJPA 5BCAA 4UQEA 3FN9A 3MP5A 3CK5A 1DIOA 1V97A 3OODA 3T4CA 3POHA 4MWAB 3VU2A 1VRDA 3NVWB 2GZXA 5D38A 1CCWB 2A1YA 3AQUA 4LUJA 3DZ1A 3D46A 1X98A 4XO7A 2LLEA 1S2CA 1NQ6A 5LIWX 1XSJA 2FTPA 1LBFA 2FZMA 3S1UA 1GZJA 3FX4A 4RJEA 3M5ZA 5TQLA 3TVAA 2ZUVA 3GNOA 3MKKA 4DXXA 1XGZA 4KRUA 1NOWA 4AIOA 1K9FA 3TK7A 5M3WA 4GRSA 2Q3OA 1FDYA 1FWFC 1I2NA 1V3JA 3L2MA 4C6FA 3BSHA 5IBXA 1SJAA 4IFKA 2CLIA 4RE4A 1MW2A 5EA9A 3PZVA 3RLGA 4M82A 2AL2B 3ISIX 3DU0A 3R11A 5CJNA 1TZZA 5DCBA 3NFUA 1MXSA 1C91A 3HPSA 3ANUA 1S2UA 1BKHA 1BHGA 1K8CA 1JI1A 1PTGA 4BQ5A 1CXLA 3CWHA 2XFFA 3S2NA 3RLHA 3NS1B 2YXGA 4GJ1A 4OV4A 3S9ZA 2DVUA 1QNVA 4QS6A 4KGLA 3GB6A 2XYLA 2JKPA 4H9XA 1ZB5A 1FP8A 3TYEA 1EC9A 3MYPA 1MQPA 2YX0A 4O0ZA 1FWJC 2X1UA 2J88A 5LNRA 4H3DA 2P5NA 3KTCA 4Q8MA 5IDIA 2VEPA 4GXPA 3CQKA 2Z1KA 3FAWA 2J7DA 3N2XA 1HGYA 3MV11 4YVVA 2WZHA 1H62A 1PCWA 3LBMA 2J79A 1ZCCA 3D6NA 1QJWA 3T1GA 3NL6A 2GGEA 2X99A 1NSJA 4FO4A 3UVAA 5AFDA 3PR2A 2AKZA 3G1AA 2HE8A 1EBHA 4KFOA 4QR6A 4XAYA 3G0UA 3MO4A 4H8VA 4O4WA 4US5D 1UZDA 4Q8NA 1HXJA 1UIOA 1QHOA 3E9AA 1X96A 1SW0A 3LHZA 3N3TA 2OLSA 3LLFA 5ENLA 2NQZA 3C2YA 4PCNA 4GLEA 3WJZA 2X50A 4HJWA 1IR2A 3W7PA 1JD7A 4QLJA 5AHMA 1R6WA 5A6BA 3GIPA 3PM6A 3PNZA 2XIJA 3W7QA 3BOLA 4JTCA 3TX9A 4LCQA 1UHVA 1XLFA 4GINA 3MUIA 5HR6A 4MFDA 3R89A 3ZQ9A 4OIFA 3MMUA 2WW5A 4LRTA 4J3ZA 1YPXA 1GYNA 1L2QA 5CC7A 1JJKA 2VI0A 1WV2A 2XINA 1QCWA 4I8YA 3SY1A 2PGEA 3NR0A 3UYIA 5T26A 2QR6A 3AO0A 4WSHA 3NTYA 2E3ZA 3R13A 3T44A 2J7FA 3DUGA 3IV8A 1DIKA 3L4ZA 2VOMA 4ADUA 4DUOA 2NXIA 3UR5A 1FEAA 2OXNA 4N7QA 2A3EA 3EB2A 2F61A 4TMCA 2B7PA 4N9DA 4HJFA 4PMXA 3PS7A 2DZPA 2E68A 3W7RA 2GDUA 1KXVA 1JAEA 4JKMA 2HXTA 4DWSB 2VEIA 1I1XA 4HU4A 1W5NA 4H19A 2C18A 4QITA 2CIPA 4ZBCA 3O6YX 3POCA 2J77A 3LBCA 3ZJ8A 4EQRA 2J7BA 1ECEA 1A3WA 4S1FA 5C6MA 2WV8A 3IRDA 1ELSA 1U30A 3DJJA 3BAJA 4MG4A 4PBGA 1NF7A 4YIWA 2ABBA 4NQ1A 3GSMA 3CASA 4NI3A 1JZ7A 1PE1A 5K9DA 1HX0A 3UT0A 2ATSA 3SCSA 1I45A 4UTKA 1ZJIA 3O15A 4PRTA 4NRSA 1PIGA 3NGFA 1T7LA 1U1UA 4KH2A 4CD8A 2CESA 3RMEA 2VGFA 4H04A 2OO6A 5G2HA 1UKSA 1F4HA 2P53A 1IT7A 1KM5A 4GH1A 4Q8VA 3QFBA 1T96A 4EE9A 1EKOA 2VGIA 3HQNA 5D2WA 1Y5XA 3UWQA 1LL6A 5CEWA 2WLZA 1FH8A 4H4UA 2Y7DA 2INZA 1QOQA 4I5RA 3QH2A 4ICCX 4NT0A 3V1PA 3IJQA 5DRIA 3M7SA 3PJUA 3MVTA 4B5NA 1DIEA 5AYZA 1F7BA 4PB3A 4X9SA 1R3VA 1GOOA 1LP6A 1G5AA 2VC6A 5CGTA 4QQUA 3AZTA 3W25A 7TAAA 4CVWA 5IFPA 3DOPA 3RM4A 4HHLA 4Z2LA 5IHRA 1NOUA 3TV8A 1BZLA 1H41A 2ICSA 3S0CA 1FDJA 1TPB1 4MKSA 2EKGA 4NASA 3BAIA 4DJFD 4KIEA 3UCDA 2W3ZA 3F2DA 2BVDA 1OEPA 3A12A 4MY1A 4NJGA 3QVQA 4KPRA 2NV2A 1WYGA 4DJFC 5LHEA 1YBQA 5D2TA 2QDGA 4W8LA 4EM4A 3N6QA 4GZ7A 3ZZ1A 4LEQA 3WF3A 5F1UA 2EEXA 1BXNA 4XISA 4DIAA 4O28A 1KBLA 4NNAA 3M16A 5FKYA 1BTCA 5CBIA 5CGMA 4JTKA 1JDCA 4JIHA 3SJ3A 1LLOA 1NFGA 3P6LA 3UGVA 2OYLA 3LDVA 3MPGA 3RX2A 3EWUA 3W81A 2BWGA 3SCPA 4PMVA 2W4XA 4TQTA 2ZZ1A 1NP2A 4UMAA 3B8WA 2C16A 1H7XA 2CW6A 3CNYA 4RCXA 3KFTA 4FALA 3W1QA 2DV0A 4IIEA 3VO0A 4Y9NA 3TYZA 3K4AA 1CEOA 1OFBA 3L8KA 4QLKA 1A50A 1E4IA 1V5XA 1AZ2A 3DI0A 2C0HA 3VMNA 3NVTA 1Q13A 3SURA 4IL2A 4AHOA 4AD3A 1HJXA 2WANA 1TR9A 2E5AA 2QDHA 3EA2A 4X9YA 2G96A 1GRAA 1ZQ5A 1UR3M 2YCLB 4AD0A 4AUBA 1FHDA 1VR6A 2BY1A 3GE7A 4RNJA 5MHBA 4AWSA 1TA3A 5TBOA 1I4NA 4F8XA 1TPFA 2QPXA 2ZUNA 4PCFA 5EMJA 3H2AA 2O56A 3QQ1A 2UY2A 3WLTA 2ZX8A 3H7VA 3TONA 2XG9A 2KAUC 3PZ9A 4NJIA 3IJ8A 3TSBA 3HG3A 5D9PA 4ML4A 2NQJA 1K6WA 1FWEC 2ZWYA 3W7CA 4H7CA 3ITXA 5D2VA 1AZ1A 2WZMA 2EG8A 2YVJA 4IM4A 5IM51 4XZWA 1WZAA 1XBZA 1YHTA 1KB3A 1HO1A 2NLYA 3AYRA 4JL1A 4DZAA 1Z42A 1E4MM 1GVSA 3TJXA 1FWGC 2GUUA 4KT2A 4XD6A 4S3AA 2J8TA 3W1RA 4AIBA 4ATDA 3REQA 5K2ZA 3MDWA 3KBVA 4Q8QA 5CG0A 1HP4A 4L9YA 3OGVA 5CXPA 4JTIA 3BUVA 3O3RA 2RKXA 2AGKA 4QDPA 2ZTKA 1WUEA 1L6YA 4JDYA 3WYZA 3GG1A 4JZ5A 4MIMA 2J78A 4Y9PA 3O1NA 5AYBA 1LOQA 2GQ8A 2FMOA 4RNIA 1W3HA 1JYNA 5XINA 3UPWA 1UUOA 4FIRA 3BOFA 4U2YA 5CSSA 3IVUA 5D30A 2GJLA 3SRHA 4CEXC 3LB8A 2AMXA 1AD4A 5HWNA 3OG2A 3GQYA 3DHDA 4DLFA 1LRTA 3URNA 2VR5A 1YE4A 3W7NA 2ZUUA 4HN4A 2DH3A 2ALDA 4AWUA 3BCDA 2FPYA 1L6GA 5CSYA 1L6FA 2JGYA 5FEPA 3A7AA 4PMRA 2X8CA 3UZWA 3CUJA 3M07A 2WMIB 1A4LA 4WUIA 1OYAA 2OO0A 3TW9A 1C93A 2WSRA 3IAPA 6ALDA 4IIBA 1JFXA 1VJZA 1AJ2A 1VB9A 4X61A 4BF7A 3SUWA 1EX5A 4DF0A 3WJYA 3BG9A 4ZXOA 1T0OA 3UWYA 3QW4B 4CN4A 2Y7EA 3RDKA 4XD3A 1NF0A 3R0DA 3NJ3A 5FA5A 4MY9A 3BAYA 5C5YA 3UJ2A 1JUBA 1BVZA 1E6XM 4J1OA 3LGGA 5EBKA 3FA3A 3NQ2A 5LZLA 1R3WA 4N9BA 3OA3A 3QEZA 4S3CA 1HN1A 2Q6ZA 2ALRA 2YXOA 3WJXA 4CUCA 1UA3A 4AG0A 4B4FA 3AMLA 4I9MA 3VX1A 4JIIX 4IIDA 4AD1A 2ISWA 3EKLA 3O7UA 1OT1A 1UQYA 3W2LA 4D6GA 3OYZA 1ME8A 4ZO9A 1KFCA 3DECA 3MCOA 4WKAA 1EHNA 2OLHA 1TVPA 3KL0A 2FIQA 3DFNA 1E0XA 2PDHA 3A9IA 1XIEA 3KM8A 3OP2A 3CZLA 4IP4A 1F8MA 4B5TA 4YNGA 4GC3A 3WLSA 2CETA 3FSTA 1AJZA 3CUIA 3XINA 4CGTA 2YZ5A 2RFGA 4A4AA 4HK6A 4ZE4A 4DBEA 1KM2A 2C71A 1I0BA 1GT8A 2DVXA 3D5HA 2V5KA 3UZ5A 3CTLA 1HKVA 2SFPA 3W76A 3INPA 4C7GA 1BWLA 1R3RA 1UKOA 5I79A 3T09A 3W72A 4W7UA 4GR1A 1US0A 4PR4A 4W89A 2W61A 1TREA 3PPGA 3UPBA 4UR9A 2GWGA 3URQA 2C1GA 2IUZA 1AMYA 1Q6RA 2I1OA 5FEWA 1Q6LA 1J10A 1WZMA 3ZR4A 1N7KA 2QQ6A 4QQ3A 4G7FA 2QJHA 4ZL1A 2R1MA 3AXXA 3VDCA 2XFYA 2QCDA 4FSAA 3CV2A 2FKPA 3M6DA 2QDDA 1K7FA 1GJWA 5AC4A 4RXFA 3FAXA 3W85A 1DQUA 1BGAA 1VPXA 3IJ7A 3WO8A 4N42A 4GBDA 3LRMA 1VYPX 1EJ7L 1TJRA 1TWIA 3B0XA 1H5VA 4N9CA 4CNNA 5HQMA 3GZAA 4XKYA 2GRTA 3RK8A 3UWVA 3LXDA 5HDRA 1XQKA 3WNLA 1FWSA 4IP5A 3Q45A 4FF7A 2AKMA 3FDKA 2Z7KA 2BVYA 1DXIA 3AS0A 2GQ9A 1S7MA 5L9FA 3PN8A 4ROQA 4LW7A 3AMZA 3WNKA 5A8QA 4ES4A 1FCVA 3RF9A 4HOXA 2V30A 1LWJA 1K77A 5HNNA 4DNAA 3WUEA 1IHIA 3A3XA 3EWDA 5FD0A 4IHCA 1VQZA 1TYTA 1RVKA 3U7BA 1QXLA 4G5DA 5C54A 5JIPA 3M0LA 4B2DD 5EMKA 2OWCA 2AQVA 1RSCA 3CUFA 1K6AA 4KWOA 3WQEA 4IPLA 4Q6XA 1TTJA 3EF6A 1TR1A 4MY8A 4FLQA 2E6FA 1F3PA 3G0XA 3VIOA 3W2JA 3SY8A 3CWNA 3PJXA 2V9DA 3FA4A 2R6OA 4AMAA 1EA9C 3JW7A 4U3AA 1LCOA 3TFXA 4BWLA 1JFHA 1AW1A 4AVNA 3DYOA 3HFTA 4H00A 5CPTA 3VDGA 3KZSA 1BYBA 1OK6A 2J6VA 4XIAA 4HNVA 2AOSA 3GYEA 2ZC1A 3DHFA 3G1FA 3EWWA 3ARRA 1GORA 1QOXA 3VDAA 2DZAA 1GK8A 4X3ZA 2Z7GA 3S5NA 3WQ6A 4IIFA 1M01A 4JFWA 3RNDA 1DHPA 1N63C 1OZQA 3CPGA 4DX3A 1OX6A 1TVNA 4HU0A 2WBKA 3RUBL 1W37A 3AXKA 1P6CA 1SR0A 2EF9A 4JTEA 3PULA 1HJUA 3L5MA 1OGSA 2W6RA 3ZVHA 4JQ4A 4EPDC 4CCEA 1JYWA 4LYPA 3N4AA 1GVYA 4H8HA 2JKEA 1DBTA 1EB3A 4F0MA 1ZALA 3J7HA 3STEA 2YSWA 2JQXA 5HATA 1QATA 3IRSA 3R12A 1RA0A 3TTEA 1S5NA 2HVNA 3GRSA 4FB7A 4HA4A 3ZLGA 3GR8A 2J9YA 1NHPA 3PTKA 4YWSA 2XH0A 3WMCA 4OBTA 1DWIM 2XWDA 1CW2A 4I5UA 4HNTA 4MPQA 3WD1A 3RHGA 2WO5A 3A24A 1BTMA 5JVLA 4Z1AA 4MLRA 4PE8A 2F7FA 1UA7A 3L4UA 2VFDA 1DE6A 3HQOA 3W00A 2ZE3A 3ID7A 4LBUA 2VUYA 4N9EA 1KV8A 1EXPA 3QHOA 4H4TA 3L0KA 3S8HA 2ZDRA 1TB3A 5I24A 2OX4A 3N1AA 1VIZA 4UB9A 4WSKA 1KKOA 3KXQA 1RK6A 2E0PA 4HYWA 4U2ZA 4ZOAA 1VFUA 2NXHA 4C1NA 2FTWA 4S3JA 3EWZA 4UTJA 4JCMA 3AXHA 1K4HA 3UZXA 3QMTA 4M7SA 2NX9A 3HGRA 2VX4A 1TMHA 2YJQA 4O11A 1SR9A 3AROA 4J5NA 1OQFA 3L4YA 3BLEA 4ZR8A 1NWTA 4XZBA 3UEQA 2IQTA 3I3EA 2FTYA 1JCYA 2EJAA 2VCAA 4YXGA 2Q8ZA 7REQA 2YXXA 2DT0A 4TO8A 4DLMA 4JDBA 3KCLA 4C90A 5BMWA 2CFYA 5C2CA 5FL0A 3TQPA 3RCYA 4JX4A 1NTHA 1QK0A 4GI4A 2E5CA 3AMDA 4E8GA 1UWTA 3QSTA 1OF8A 4G1NA 1QAPA 1XBYA 5EFDA 1T6MA 1OD0A 4GY7A 3AI0A 4IISA 1JZ5A 4LA1A 1JZ4A 3BCFA 4JS3A 1QBAA 1BSLA 2INEA 4LVDA 3IJLA 1YIXA 1QI4A 3AHZA 5DMYA 2WOWA 5LXEA 1CXFA 4ZQOA 1BXBA 4JKKA 1V3KA 1F76A 4DJDA 3S6DA 4Z08A 3UD6A 1YX1A 1N62C 4DBSA 4PL1A 1H0GA 4REQB 1JNEA 1FHUA 3MVIA 1Y65A 1YXYA 3NNTA 3BLIA 2CKRA 1NIUA 4Q4MA 4YTTA 1BRLA 1E56A 1TVLA 2WAGA 2EPMX 2YW3A 2HXUA 1OFPA 4FOKA 3AYVA 2WQPA 4IX0A 1HNYA 1B30A 3B9NA 3HMJG 2AAQA 3AMCA 4MVAA 2XN1A 3NZQA 3ATYA 1QR7A 5C71A 4JQ3A 1EOMA 2XGIA 4FNRA 1XH2A 1TQJA 5DFAA 4DI9A 3MU7A 3EWBX 4US6A 3GNNA 1BG9A 3TTOA 3MWAA 2G95A 1L6WA 3AS3A 2DDXA 3NQAA 5TR3A 1VD6A 2INFA 5HMDA 3L68A 5HBFA 3LS9A 3HURA 4O15A 4LY8A 2QS8A 1O5KA 4DZ5A 1E6NA 1R87A 3NQ7A 2W91A 3BW2A 3EDJA 3RRAA 2HRWA 3G1DA 3UXIA 5MF5A 3H6OA 1LL4A 4EIVA 4G8TA 5K9XA 1OSEA 5HULA 2EQ7A 1DV7A 1E72M 1FH9A 1IXNA 1E1FA 1W8GA 1EGVA 2QVHA 4MSSA 5EKYA 3SBFA 4DBWA 3VIPA 3NDYA 1I1WA 1N55A 1M04A 3QOKA 3EXSA 1KO0A 3WQ4A 2Z29A 2XM2A 4I8DA 1QHZA 1IT0A 3N2TA 4BI7A 4CLMA 3M1ZA 3PG9A 4I9JA 4CVUA 4HA0A 1XBXA 2PGFA 2E6AA 2J7HA 3GD4A 4P7QA 1RZMA 5A6BD 3W7OA 2EPNA 1EWDA 4Y96A 3QQ0A 3IGSA 4DVOA 3VC6A 3PC0A 3F5JA 4YHGA 2Z1SA 5J04A 3ZIZA 3W7MA 4H9ZA 5C55A 3N2MA 1V08A 3T55A 3SCUA 2V3EA 3SCTA 1F61A 1L2UA 3I4KA 4LTSA 4MNMA 5E93A 2O9OA 3GH5A 4X22A 4KEVA 1UWUA 2VM8A 1DJGA 1LRNA 4MZ8A 4U5IA 1BYAA 4TVCA 4LAUA 2ZICA 3K46A 3TYCA 4APNA 1ZAIA 1EC7A 4NAEA 1Z69A 1UKPA 3THDA 1JF6A 1GNXA 3C5QA 1BVNP 4RV3A 1J0ZA 3PZIA 3V1HA 5BWAA 1DWGM 3M0HA 2GYIA 4UTTA 3QOMA 3UPMA 3TQKA 2VRKA 3NCOA 2DZUA 2G4FA 2V6OA 2R1KA 1TJ0A 1UWIA 3PF3A 1PCKA 4GUGA 2VZSA 4NZJA 3V5CA 2V82A 3U2ZA 3BSGA 1SFSA 2J75A 1X8FA 4W84A 1UMLA 3KCOA 2YLAA 1AQMA 2VC7A 1RH9A 1V6TA 3P80A 4L4PA 2BP1A 3K13A 3KBSA 1NFPA 1QPKA 1PO9A 1ZLPA 4JQ1A 4PEEA 2WWDA 3BMVA 1GKQA 4NNCA 1XFBA 2NVKX 1LROA 3SCWA 4XAGA 4RZ4A 1VS1A 2VVSA 1QRQA 2CYGA 3WEOA 4K8HA 1KW1A 4GY1A 1B3OA 3WCZA 4X60A 3EXRA 1I2QA 4JNYA 1XDJA 3A22A 1VBGA 1UC4A 4OGZA 1G0CA 4ZOEA 4KETA 2NXGA 2VELA 4ILSA 4V27A 1TPDA 2E6DA 4FA3A 4UR7A 2VNCA 4N0RA 4AW7A 3W23A 1ZP4A 3T40A 4LAKA 3EMQA 4L6DA 1IEVA 1Q7ZA 3M5VA 2Y5JA 4KRZA 4MKNA 3E0FA 1FKWA 1SMAA 3LU2A 1OG0A 4A3UA 3LZ3A 4IPJA 1J0HA 2XFRA 1E9YB 4B5VA 4UCGA 4FX8A 4HA1A 3O9NA 2X2GA 4Q3MA 3T0TA 1H60A 3M0MA 4IPPA 4NEVA 2PPGA 1PEZA 1JRBA 4XSLA 1O95A 1QK2A 3N9RA 2RH9A 5HANA 3ANVA 3M64A 4UTWA 4H6RA 4GXWA 3U57A 1QFEA 2ODOA 1PYMA 1F8WA 3W88A 1N8IA 1DNCA 3GR4A 4B4HA 2WCAA 1IEQA 4LUTA 2YL8A 4KCUA 5C9UA 3HJEA 4JFVA 4QXIA 2PDIA 2QCLA 4N4QA 1LL7A 3WQ5A 4WKFA 1V3HA 1JD9A 3CMJA 4R27A 4Z1CA 5FS6A 4ERIA 5FACA 4AVFA 1V3LA 3VE7A 1REQA 3NIYA 2XM1A 2QGHA 1GOQA 1CGXA 1H1ZA 3OLIA 3RX3A 4AIUA 1SZEA 3SO7A 5BOFA 1W32A 5A5WA 2HISA 2Q8XA 4JTTA 1XQLA 1PB0A 3PFMA 4K38A 4F3HA 4EM3A 3BO9A 3TZFA 1KFEA 4ZQPA 3TZNA 4KWSA 1GRFA 5CH9A 3AN1A 4RDYA 4UTMA 3APYA 2IQDA 1X6LA 4MWAE 3IIZA 4FNSA 3ETRB 3UA3A 2P8CA 3W01A 1TMLA 4HYVA 4CQCA 3PG8A 2F6KA 2C3CA 4WF7A 2HCVA 3W86A 1R2RA 4YS1A 1GYMA 4O0QA 3MO7A 5A8OA 1S2WA 4YYFA 1K8XA 1H4PA 1CB7B 2Z1BA 4NZ4A 1OC5A 3WF0A 2YIHA 2PC4A 4RXGA 3NYDA 1J5TA 1TWZA 2BFGA 3E74A 1XHCA 3NZGA 3QF0A 5ABFA 1W9UA 3LI0A 2GVJA 3VM7A 5FJRA 1QI3A 4FEZA 4FOUA 1KQYA 5KZMA 5FS8A 1OFDA 4DO7A 3LSBA 3TFCA 2DSKA 3MYOA 4N02A 2EG6A 5H1WA 1ONRA 3TNBA 4NYUA 1C3FA 1M5WA 2WHMA 2YCJA 1CENA 3BQ5A 1GV4A 4XUGA 3OJGA 1WXYA 3GC4A 1H7NA 3UFYA 3TDFA 4YHEA 4JTDA 3JUGA 1FFRA 3HO8A 2P3EA 1QNSA 4MWAA 2GDVA 3GUWA 4LH8A 3STFA 3KWSA 2J6XA 4JIPA 4A2SA 3BJFA 1UKTA 3DGRA 3N34A 4FR6A 1E5NA 1DIDA 3EWXA 3GVRA 4TMBA 2NSXA 2Y6ZA 3EYPA 2BLEA 5C9RA 2VRJA 1FUYA 5M1TA 3AIWA 1ZBCA 1BF2A 1QO5A 1W1ZA 4H41A 4NZ3A 1R2SA 1KRAC 4DZHA 3CO4A 4Q7NA 3N13A 4ZQCA 4AU0A 1SU5A 4IP7A 2GJRA 1ZL1A 3MSYA 4A3RA 1V3IA 1ZGDA 4RR4A 1A5AA 4QE4A 1KM6A 1JDDA 2DUXA 5E9AA 1R9ZA 2G3NA 3BC9A 1S46A 5I3DA 3LMYA 4S39A 2HZGA 1SZRA 2AL2A 2DH2A 4GUHA 1S5MA 1YNPA 2C6QA 4B91A 3IC9A 1VJSA 4HMEA 3W74A 2QEZA 1GVFA 3OIHA 2PC8A 3V0UA 1A5CA 3VOFA 3E5BA 4MAVA 3IUDA 3RU8X 1U1JA 3UWUA 3NQ8A 4D6FA 3SUUA 1H2JA 2Q02A 5A6MA 2Z1VA 3VZXA 2GJPA 4HZMA 4AZ7A 1IWAA 4A21A 5FAGA 4BK9A 2BSLA 3E2VA 3ZXWA 4ADSA 3VA8A 3BMXA 4Z0SA 3CEPA 1ISZA 3CUHA 3EPMA 4JGDA 4Y9OA 5AVHA 1ZX9A 3N25A 2J8FA 2PP0A 4DJEA 4DRSA 3T78A 3H7RA 4DM1A 1XIFA 1KBBA 3V18A 3CBWA 1XR2A 3AM9A 4QNEA 2X16A 4RZBA 5FJOA 4WEVX 1LQAA 3TC6A 5H8MA 2QKFA 4R7JA 3LHVA 3T05A 1T41A 2E67A 3OZOA 3H8AA 4FNQA 2WC7A 3WQCA 3A9BA 1ITUA 1DJWA 3EA1A 1QPOA 3HG2A 4IMGA 3BXWA 5FF2A 1C8YA 4LRSA 2FVKA 3VD9A 2ZRZA 3S2JA 1RQBA 4UUIA 3WQDA 1L0PA 3Q37A 4EXAA 4WXYA 2BC0A 3ENLA 2E1DA 3GKAA 4MHBA 2PS2A 2YDAA 3OU8A 1NDYA 4GE8A 3VNJA 2H90A 4LANA 1L6SA 4AQLA 4M52A 2Y62A 1TO3A 4DAIA 1JZ2A 1P0BA 1JQVA 4C6MA 3BGGA 3VNMA 4I9TA 4GRTA 4PCPA 1B57A 1ITCA 1VC4A 3A3HA 1PS9A 3FYPA 3I7QA 2YCEA 1JVNA 3SIMA 5IRPA 4AH7A 2OQHA 1V0NA 1KLZA 3CAQA 2FZ9A 4O8RA 4F0SA 3FEQA 4HU3A 1JCMP 3MWCA 5ABGA 4HZ8A 2DY3A 3ARTA 4PC8A 3LNMA 4KF1A 2PGRA 4DUXA 3M0IA 2VTFA 4DWSA 1WXZA 2QCNA 2D3LA 3W4RA 3W2MA 3OQEA 1BXCA 3OVQA 7TIMA 1EDQA 1PZ3A 4IOTA 4N2YA 3GW3A 4HPHA 3SCQA 3U3HA 4MJ4A 2V2HA 4RDZA 1MDRA 3EWYA 2ZKMX 3UG8A 3DFSA 3RPTA 2DVTA 3MSRA 2QJIA 4GVHA 3LGEA 2ZZ2A 2YOCA 3IGHX 1AW2A 1QTWA 2E7FA 4M80A 1BG4A 4XD4A 2IPJA 2F8QA 3NVVB 2E09A 4E8DA 4K36A 3LV5A 4JTQA 4D71A 4XBJA 3ABSA 1A0CA 1KR0A 1UB3A 3R25A 1AQHA 1BSIA 4WDWA 4EOUA 1PKYA 3TW6A 2OZ0A 3DFTA 1W3NA 3BARA 5CJ5A 3LTYA 4NU7A 3R10A 2BCPA 1ZDLA 4GX8A 4MYAA 2NUYA 4FIQA 3URBA 1NELA 4V33A 4GO9A 3GU2A 2GK1B 4NVTA 3RMJA 4X2RA 3R07C 4PUEA 1OVDA 4XX6A 2QCEA 2ZX7A 1GREA 4XAZA 2Y24A 3GDTA 4E38A 3C61A 2EHHA 1XG3A 2YL6A 4XZNX 2QV5A 3MI2A 2O9PA 3HG5A 1Z7AA 1IEIA 1SVDA 4BZYA 5KITA 3KZPA 5I3KA 5A2CA 1EZWA 3IJDA 1FH7A 3QZ6A 2C79A 1NP0A 3M46A 3WLKX 4YMZA 4PUDA 5KVHA 3UETA 2PCQA 2C13A 5G2WA 3B9OA 4GCAA 1GQLA 5FESA 1SFLA 4GI8A 1HKMA 2QPSA 3QLLA 2WNWA 4D72A 2CC0A 8A3HA 1P43A 4U5KA 1DHKA 3H4GA 1Q4NX 1F3EA 3UNDA 1MVYA 4G7EB 3NL5A 3NYZA 4ECLA 3WKZA 1SZGA 2PDKA 1UWSA 2WCGA 3T8LA 1V4YA 1DE5A 1X7FA 1DJHA 5A2AA 4AF0B 4I3GA 2Z6JA 1BPLB 1UR0A 3CHCA 4O8AA 4Q8PA 3FJ6A 4EACA 4DUVA 4H9MA 4QE5A 3QLDA 4IJBA 1G67A 5I03A 3NA8A 3LG3A 1F9CA 4F48A 4LJ3A 3BK0A 1TPVA 1TWSA 1V93A 4WXZA 2ZA3A 3T42A 5A1AA 3TLLA 4EQXA 5F1VA 1FP9A 3E38A 4HBKA 3JZEA 1DQXA 1FFVC 4PMYA 2A7PA 4PYSA 1PUDA 2BVWA 2BTMA 2V5DA 3TROA 4OT7A 3HTWA 4U10A 3DYMA 3RNMA 4H2CA 3QTGA 3ABOA 4MB4A 3P3BA 4OWGA 4TV6A 4WHBA 4ERAA 1LLZA 4XBKA 4EMWA 1ITQA 1B90A 1M53A 3A4XA 5F2MA 3UR2A 5U7SA 5BNKA 1E1CB 4S23A 3RR4A 1VRXA 2YCLA 3MHGA 1RM6B 2UY5A 2JBMA 4QIUA 1DJIA 1F73A 4P8XA 1RJPA 2WKLA 2QCGA 1M3UA 3IJ6A 4UQ9A 1ZRQA 1HKWA 2F9RA 1TSIA 1AODA 2ZYFA 4J28A 4FF5A 1RBOB 3ES7A 5JMUA 2VEMA 2WC4A 1Q3NA 4LGXA 1S39A 3PZGA 3PWIA 3A21A 4I5XA 3T2PA 1KTNA 1W1A1 4K1GA 3PBYA 1KQZA 3S5SA 1XIJA 1UP2A 1EPXA 2V81A 3B3DA 2PDWA 4QJ5B 1A5LC 3K4DA 1GOKA 3B9EA 1RCOB 3ITTA 2HQMA 3RRXA 4UZSA 3LI1A 3V36A 1TTPA 1GG0A 2QNEA 2OX1A 2QCHA 3CC1A 4PUUA 1UD3A 3FVDA 1W2PA 4FR1A 2OG9A 1IV8A 3B4UA 3GG8A 2W63A 3PZTA 5C9WA 4H50A 2FH6A 1R85A 2JEQA 1GESA 1TRIA 4MJZA 2O4QA 4ICNA 3XISA 1TWDA 4UFJA 3UY8A 3H4WA 1CZ1A 3GIQA 2FH8A 2XN0A 4QAWA 2XIIA 3COTA 3U7VA 4WOQA 3ZYZA 4NZCA 1E15A 2DSUA 3QC0A 4JN8A 2ZVIA 1X7IA 3B05A 1W17A 3NQCA 4HSOA 1G01A 3VABA 4YLWA 2X1TA 3JRKA 2QIIA 1ESWA 4O10A 5HNUA 5IFTA 5JXQA 3C8FA 2ACRA 4PUKA 5AVNA 4JEJA 3IVTA 1CLXA 1MYRA 1AL7A 3VTRA 3TOYA 2YB4A 3WD3A 2CBVA 4YTRA 4AZGA 1IXOA 1KBIA 1A3XA 1VENA 1EDGA 4WDUA 1Q6EA 3N6JA 4F4RA 1WOAA 4IXHA 3P0WA 4JR5A 3OOQA 4RE0A 4YPJA 1CXIA 1W54A 5H8UA 3GD6A 3PZMA 3H2MA 2BB0A 1PSCA 3PAOA 3G0SA 3E02A 3VILA 3L4TA 3BVJA 2VFGA 4JFTA 4F79A 3PSVA 2JK2A 1TV2A 4P5UA 4DJDD 4GH3A 4QFUA 4C6DA 2IKIA 3ZJKA 2WMIA 3HN3A 1LM1A 4XBSA 2XVLA 4IMAA 3MDUA 3WF2A 1XSIA 4DJDC 1B3ZA 3WLJA 3EDDA 5G2IA 4OECA 1SZFA 3G18A 5CC5A 2DSWA 3TMQA 3FK4A 3OZMA 5ABHA 3AC0A 3S4TA 2EXOA 2BG5A 3IARA 1TCMA 4M19A 3QV6A 3W2NA 1DXLA 2Y70A 1IR1A 1JGIA 3CV7A 4DPPA 4UNIA 1WX0A 3DG7A 4W9TA 2QMJA 1H7OA 1AQFA 2PF8A 3NQFA 1W8SA 2CZVA 4HSHA 4PCSA 4BQ4A 3CWOX 3B4YA 4QX4A 1IZCA 4IFOA 1FXQA 4N4PA 2VFEA 3IV3A 5DRCA 3T7VA 4GNVA 4Q22A 1ISXA 4LYRA 5FEXA 2DZVA 3ES8A 1KLYA 2UWFA 5BOOA 4W4QA 1O7AA 4MZ1A 1BYDA 3PB0A 3P84A 4JHOA 5JCKA 2ZXQA 1ISWA 4JN6A 3L5OA 5TIMA 4FI4A 2O55A 4LCSA 2WBAA 3K1GA 3VGFA 2OR2A 2Y5SA 4D6EA 3V5OA 3FJ4A 2VT0A 3B0UX 1TZ9A 2DSVA 3B0VC 1XF0A 1UROA 3L2LA 3VAVA 3G1RA 3GU9A 2PTDA 3BLOA 5ECVA 1TV3A 2HBXA 2JF7A 1XLCA 3GFXA 3C4UA 1VLWA 5HUPA 3TA9A 3TH6A 3MI6A 4NZ1A 1KC7A 5TAOA 4WD0A 3QHNA 1QNPA 4J7RA 1RY0A 3VKKA 4TOQA 4C1LA 2VQUA 5DMLA 1E6SM 2C19A 3F4VA 2XDFA 1UR8A 2W67A 6REQB 2DU2A 1JPIA 3EPOA 4IQDA 3VM5A 4HZ6A 4HCHA 4H4ZA 3FY1A 5EY5A 1BFNA 5J5RA 2ZFAA 3WK1A 2CU0A 3GK0A 5HPOA 4TVUA 3CHFA 3GIYA 3GXIA 2PMQA 1S3HA 1WNOA 1XW8A 3NXLA 3A13A 2WHLA 4NL1A 2VHLA 1VPQA 4J40A 5ABTA 1MUWA 3GVGA 3FXGA 1R3YA 5BMXA 1ONEA 3H23A 1ITXA 3WG6A 5LA0A 3GUGA 1RJQA 3O2LA 4KQNA 4Z17A 1OBAA 1TYGA 3NO1A 3NZRA 1Z44A 1FQ0A 1SB3B 2QIWA 1UWAA 4GK8A 2OWWA 3W75A 3NAVA 3MMTA 4G1KA 3EOLA 1B4KA 4L56A 1GONA 3FYOA 2DT1A 4AWEA 1FRBA 3W1UA 1B9ZA 2OU4A 4DY1A 3OVRA 1EP2A 8CGTA 4UTTC 4ACZB 2AQOA 2DT2A 5RUBA 5I23A 1UR4A 1FFQA 3KDNA 1QI5A 1GXFA 1CB2A 4E4UA 1C92A 3MUCA 2OKTA 3NSXA 1XD0A 2PD9A 1SGJA 4YJ5A 8TIMA 1S2VA 1XLBA 1QPNA 5C9XA 5F2IA 1W3LA 3NO5A 2Y63A 3WH9A 4QE1A 2PDBA 5FCZA 3I3BA 4P7OA 4RZ6A 2OQLA 3EDEA 2V69A 5HNRA 3BG3A 1ICPA 3AHXA 3DKJA 2L5HA 4FX7A 4MMWA 1JF5A 5B7YA 1XSKA 1W3JA 1Z89A 4BJHA 2ZRWA 2OQYA 1G7UA 3DGBA 4JOMA 4PN2A 5E6ZA 3ITGA 3S2MA 1H50A 1NEYA 4CD5A 1VKFA 3RX4A 1Q6QA 3QMSA 1XRTA 4F0RA 1SPQA 3CYJA 1M7PA 3O63A 1BWKA 4GPNA 1FOBA 4J35A 1HJVA 3W1NA 3C2FA 4C6LA 2ISFA 2ZZ7A 3A4AA 2GR0A 3KTSA 3AXIA 3BMWA 3O05A 4P8WA 1JEHA 1DQWA 2GJXB 2OZTA 1DYSA 2WB5A 4J4KA 2FZBA 3C2VA 1HKIA 3C2EA 4U4MA 3GNPA 3MMDA 2POZA 1GVIA 3B9AA 2F84A 3LCLA 5J8LA 4AZ6A 3II4A 4GKTA 3QJAA 2HPIA 1Q7QA 1HG3A 4OOUA 2G3JA 4LB4A 5FL1A 1RP9A 1I2OA 1GQJA 5LYRA 3WDPP 2PRMA 4POCA 5FJIA 4OOZA 3DKLA 3KVLA 5I5RA 3LMZA 2Z27A 5G4WA 3LTPA 4RNFA 2Q3RA 3W7KA 2QAEA 2A85A 4KCTA 4WJ8A 3DI1A 3DG3A 2VO5A 1GVRA 3FXYA 1O60A 2XUCA 4FXSA 2VP8A 3KLKA 1KD0A 3T08A 4PUNA 2JALA 2CZDA 1QDSA 2GDQA 3I4EA 2XU2A 5G1TA 3LQGA 3QV7A 1IXPA 3I10A 3MI3A 3I3DA 2V3AA 4PZVA 5DCDA 2QUUA 2WNNA 4IMCA 3U2OA 4ZGYA 4IZGA 3A23A 4LY4A 2HK1A 3R6IA 4IGHA 4HOZA 4XG1A 1VHNA 4IMFA 4QISA 5K7JA 1Q7MA 2Y61A 5JH1A 3EDKA 4UC5A 4CNTA 1FHLA 1A3HA 3F7JA 2CZFA 2VZTA 4RE3A 1E0VA 4BFAA 1YW1A 2XPKA 4Z2HA 2YLLA 4BS0A 4W7WA 1PZ0A 2DPEA 3IUHA 4HIBA 1TX0A 1HVQA 1F3XA 1HKKA 1EJSC 3TCEA 4L9ZA 3ARPA 3P61A 4LNCA 3ZLHA 2A3CA 3QY7A 3PG6A 4EX4A 2EPLX 4XV0A 3SR7A 1CGTA 2V5LA 4Y9AA 3WLMA 4MKVA 4AWTA 5C7VA 5DBTA 3STPA 2W62A 2D1ZA 1CT5A 4G56A 4YL2A 4HHPA 4DBUA 5I3GA 3W70A 3DGZA 1ZHAA 5ER0A 1HIZA 1ZK7A 2GQAA 1OHLA 4R88A 1GQNA 4WY0B 3HGSA 3WQFA 1ICSA 4HHHA 3HV8A 3G24A 1YQ2A 1ZSXA 2D2JA 2J24A 4LVGA 5CQ1A 4PTDA 2VD8A 1R9XA 1L8NA 2JKAA 3M44A 4LVFA 3W7LA 2ACUA 4REQA 1FWRA 2E8YA 3AIVA 3SAZA 1LTDA 2ZWZA 1JYXA 3W1LA 1LJYA 4A22A 4C6OA 3THCA 1VBRA 4KERA 4WGHA 4NUWA 4MZYA 1RCQA 3IPWA 3LHTA 3U2EA 1KGWA 3QBUA 3O16A 3NWRA 4JNMA 3CB8A 3GAYA 3WFAA 3R7MA 1SJBA 1F6YA 3BW4A 5LNSA 2YFNA 2GSEA 3VMOA 1CLKA 1UZHA 1V02A 4GZIA 1PX4A 2NQHA 1R3TA 1ME9A 1R7OA 4GCXA 4M8UA 1QW8A 4AXKA 1GVEA 4EWND 3P62A 2ZXAA 1JPHA 3B8DA 5DN1A 5DXYA 5BRBA 2VR2A 2VKZG 4DELA 2PUZA 3M0VA 3THUA 1EC8A 1NHQA 2TYSA 3GD3A 2WMKA 1KCKA 1OIMA 2Y8VA 1K9TA 1EF2A 3CQ0A 5AHLA 2QJMA 5HJLA 2IPGA 2ZUMA 2XH7A 1VCFA 1EYEA 1Y5VA 4GIYA 4QHRA 4C5YA 1XC4A 1GRBA 1KTBA 1R30A 4JTHA 1NOFA 2BXYA 1I75A 1E3ZA 2BY3A 3MCMA 4JYFA 3W9ZA 4CEUC 1G9HA 4I7WA 4GABA 2FJKA 5A8MA 3MB9A 1QOPA 3UR7A 4Q4QA 3WLRA 2V2CA 2Z1WA 3H54A 2J9ZA 4A8IA 3WMSA 1P7TB 2QMKA 2Y85A 2OELA 4E5TA 3F4WA 1OX4A 3FV9A 4PMDA 1H49A 4Q33A 4H1ZA 1C8XA 5FF0A 4E8CA 1ZMCA 3NL3A 4ZVJA 1WKEA 5H6HA 1W5QA 1ODZA 2E4TA 1JOAA 1GPWA 3NPUA 1UOKA 4MJ2A 3TJ4A 4O18A 1BAGA 4AHPA 1JXKA 4HOWA 2REQB 5F2GA 4J3XA 2WPBA 3LA4A 1VYRA 1VDVA 2ZRYA 4WDXA 2EAWA 3RCMA 2D0GA 4LQ1A 2CITA 1XM3A 1V79A 1RUSA 4X0NA 5E6YA 4QJ1A 1TUFA 3VIIA 3OC4A 4KGJA 4HK7A 1YNYA 5T9CE 1E55A 1SO6A 1D8WA 4M5PA 3VOHA 4GVIA 3R2GA 4GMEA 1QU4A 4F9JA 2E9LA 2C91A 3DYPA 3P2VA 3SR6B 4H9UA 1ZTVA 4HNNA 3TNOA 2OFJA 4H9TA 3CL8A 3B8TA 2TRSA 4QM1A 1J9YA 1TG7A 5K3VA 2BV9A 4ROPA 3QTPA 1QI2A 2GR1A 5AC6A 3EWCA 4DWSD 4ZOCA 3SCVA 4C6KA 4RX0A 3QYSA 4GQ0A 1TFVA 3IJIA 4O19A 1QWKA 4KMQA 2VX7A 3GVVA 3GDRA 1QUMA 4UTHA 3O06A 3LTSA 5FF7A 3OLEA 3ZLFA 3TYDA 1CI1A 4B5SA 1IGSA 3VIKA 3EZ4A 3MW7A 4WLCA 4AHQA 3VFLA 3OTRA 4K7ZA 2DORA 4MTVA 1S2AA 3SFWA 3GR7A 2Q8LA 3VYLA 3VUPA 3FW6A 3CH9A 4PMZA 2BDQA 3RXZA 3HBLA 1P5BA 4JHZA 3TC7A 3GXFA 1RXOB 2V3BA 1RR2A 3M47A 1UPPA 4OBSA 1KRMA 1KRBC 4ML9A 5EPDA 3N17A 4AFYA 4MGGA 1GEQA 4CQ8A 3GXTA 1EUNA 1P0DA 3FDGA 3DN5A 4GXMA 3CT2A 2QUVA 1CGVA 2E77A 1SUXA 4CNOA 1VFOA 4K8DA 1NDWA 1ZU8A 1TJPA 4R34A 4Q8UA 3UJFA 1MUCA 2X30A 3PB2A 4UIOA 3SECA 2BY0A 2YYUA 1KV5A 1Q65A 4HTYA 3TTQA 2BY2A 2ZZBA 3TYUA 3GX9A 4LVBA 2XVGA 4ONVA 3LOTA 5AECA 4US5A 1DKWA 3PFRA 1GEUA 1E1EA 1AH3A 3LNPA 2E40A 2W0UA 4UMBA 4H6QA 3WDJA 3CHVA 4B5WA 4GI9A 4LPCA 4MB3A 3TWBA 3LM3A 4CU6A 1RV8A 4R3UA 1FY6A 1VBJA 3W84A 3W7GA 1FDZA 1RK5A 4RLIA 1HZYA 3IWPA 1VP5A 2DW7A 3EX6A 4PUMA 4GOAA 4GIRA 3EX2A 5XIMA 4NKCA 2E9MA 3TN3A 3PTDA 3LCWA 1QNQA 2PTZA 2XSXA 3I6TA 3MSGA 4YCOA 1V6UA 1JXJA 3AUJA 3GKFA 4UCFA 4L9XA 2GQWA 4O1DA 1UD8A 2RGMA 3VIFA 5DMNA 5AZ1A 2Z2UA 4Q8WA 3LY0A 1ZMDA 7ODCA 2WSQA 4AX7A 2EGZA 2QJJA 3RYSA 4NX5A 4BEQA 3DFHA 1LQ0A 1IGWA 4W85A 2ZRXA 1KXQA 4P7RA 1DVJA 2YA1A 3G1YA 2I5IA 1S1PA 3N2OA 4B9YA 4CN6A 1HW6A 3GZ3A 1BYCA 2AAAA 4OUIA 2WQDA 3AXMA 5HUOA 4ASTA 2VD9A 1V7YA 1EPVA 5D8ZA 4V28A 2EQDA 2HE5A 4V15A 3SEPA 2YL5A 4O0KA 1GOMA 3LHUA 3P5YA 3ZWSA 2V38A 3M4HA 3M0YA 3NM3A 4PB5A 5E09A 1A0EA 3M5XA 4UMCA 1R9YA 1A80A 1KFWA 3GDBA 4GFIA 2E28A 1VQTA 4IQEA 3T0BA 1ZXIC 3E0VA 1YPFA 4K1WA 3UXDA 3HM7A 4YTUA 1A4MA 5IXEA 2PF0A 2HS8A 4MNLA 2PB1A 3CQJA 3WQOA 4BEUA 4ZTXA 1O6IA 3TYBA 1EFZA 4PULA 4M29A 2ZTJA 5HK4A 1KM4A 1GOWA 2Z24A 5C9ZA 1A53A 4CNSA 3KWXA 3AOFA 4L1WA 4EPEC 1ODUA 3HGJA 3OG3A 1XFCA 2R91A 3PBUA 1IWPA 5FMHA 4NJKA 4WDTA 1F3TA 2D20A 1Z41A 1O68A 3LXCA 1B54A 2Y88A 3CUXA 1F2JA 4JTAA 1WO2A 2NSOA 3SUTA 4DZIA 3LQLA 1XCWA 3WZ0E 1OFAA 2PDYA 3VGEA 4UQAA 4WGXA 4CCCA 3ARYA 1DWAM 3UR8A 5L6UA 5I3HA 4NP7A 5A6SA 2QF7A 1AD1A 4AEOA 4QJ4B 1C90A 1H6VA 1DXFA 2XN2A 4QGCA 1E0TA 2PE4A 4LV4A 3W1XA 1NHRA 4DJFA 2X40A 3WLQA 5BU6A 1JI2A 3IK2A 1B5TA 5EU9A 3EDFA 2PDCA 1RD5A 4IGNA 2EG7A 2OCZA 4ZFMA 3V3WA 1YDVA 3DC0A 3UBPC 2TODA 3LHYA 4YWIA 4FX6M 2FVMA 1UBPC 1WB0A 1J11A 1DTNA 1JPKA 1R8LA 6CGTA 3K30A 2I5QA 3R94A 3ECQA 2J13A 3EUB3 1VCVA 4L4OA 3QQWA 3G77A 3W1MA 2V68A 9CGTA 3I6RA 1KFKA 2D2GA 3KS5A 2H3BA 1QNRA 3BLKA 3RITA 4QEHA 3R1ZA 3M41A 4S3DA 3BE7A 3HZ3A 4LC6A 1S5WA 2TPRA 1ZPTA 1AA1B 1GSNA 1A47A 2FGBA 2EKCA 2WHJA 3PTQA 2BODX 4RDVA 4A8LA 1US2A 1XLHA 3VIJA 3RN6A 4EXBA 4TVYA 2BHZA 5KMYA 5C8BB 3S9YA 5E70A 4TTGA 4ZA0A 1VFTA 2ZXDA 3F4DA 1JDFA 4AY7A 2O0TA 1EGZA 4H6EA 4E4PA 3SN0A 4M56A 3VGBA 3WD4A 4WCJA 3U2CA 2VGBA 5JBDA 2E25A 3KOYA 3LCIA 1IZJA 3HB9A 4GWEA 3OHIA 3BGAA 2A3AA 3NPWA 1YTEA 4QDMA 2PA6A 3NGJA 2OT1A 2GR2A 2OGYA 1HF6A 2XJ7A 1G7VA 2GQ3A 4KFPA 4PFMA 1Q4WA 3C56A 1XBVA 3DEQA 3GTHA 3B9JB 3KBJA 4QLLA 3A7UA 5JCNA 1AH0A 4KW2A 5DF0A 2WOQA 2B7NA 1XDMA 5I2UA 1AMKA 3KRBA 4TXEA 4WQ6A 4FLRA 4JTRA 2BGQA 2WSPA 3NQMA 3E0LA 4L7ZA 3QGKC 4L5ZA 3MHUA 5CAHA 5JCIA 4L6HA 3SM0A 3L4XA 1K4QA 4D1IA 5E9XA 3EKGA 3PP7A 1NVMA 2Y2WA 1WOBA 2O9TA 1OFEA 1YPIA 4TU1A 4OUEA 1ZBKA 4QDWA 3L0NA 1NM9A 3R79A 3UJEA 1DJNA 3CUZA 4NXKA 1D8CA 5FJTA 2PSNA 3P8JA 4ATWA 1U33A 5D8WA 2WM0A 4W8AA 4FPSA 4QSFA 3BLPX 1PV8A 4KBXA 2FB3A 4C7DA 2X09A 3D3FA 5ECUA 3ATZA 4EPKA 4JFUA 4R9OA 2X0SA 2CPUA 1MZHA 3OZPA 1DXEA 2GJNA 2F2KA 2I5GA 1JYVA 2P1FA 1W1B1 3SJNA 1GQIA 1GKRA 2RDXA 4F2BA 3C0LA 4MFEA 3PPHA 5LNUA 3L0GA 2OZ3A 3P14A 1SJDA 2PD5A 3EKZA 1US3A 5BU9A 1UH2A 3NDZA 3HFYA 1X2HA 5XIAA 4XSMA 1RCXB 1WDDA 3VVGA 2BHYA 4M1BA 2YR1A 2GK1A 1BVWA 4GYPC 4BQ2A 2V63A 1WPCA 4C6JA 4FNPA 4Q7BA 4J3WA 3ABZA 4Q4KA 1GWJA 3NEHA 1QO2A 2VOTA 3PWGA 3HV9A 2VR4A 3DBNA 3EMZA 3LK6A 2PWGA 3A64A 4C1KA 1XI3A 3FSUA 1PKNA 1J0YA 3HQ1A 1LUCA 2BOFX 2G50A 1MSSA 4P8UA 3NSNA 3QGVA 5LHFA 4KFNA 3A7RA 3OIXA 5T8GA 5AC7A 3CQIA 5CPOA 5LSMA 4GO8A 4GYFA 1U22A 3GDKA 4I6KA 5KTLA 4NYYA 3ZVIA 4F40A 2J9XA 3WQPA 1QI0A 3APTA 3GDMA 3C86A 3TW7A 4XZLX 3GC5A 2E1WA 1YTDA 2CLLA 2PI6A 1V6YA 3W7DA 1KM0A 1FWBC 1O5RA 1PTDA 2OYKA 1M6IA 1SYTA 3EA3A 3YPIA 4XWUA 2JFEX 3HW2A 3HJZA 3VINA 5CSUA 4G7EA 2X2YA 3G6MA 4TTUA 2OYMA 4OZOA 3QRHA 1NPXA 4GIEA 5EGRA 4AF0A 1D7FA 1VH7A 1X6UA 1RPKA 1VF8A 1FA2A 3TJLA 5CG7A 4AZBA 5H91A 3WK3A 4H4RA 1H63A 4TX9A 4O1BA 2PZNA 3U8GA 1W9DM 4H4YA 3KX6A 2NUWA 3K2GA 1JZ8A 5I00A 2I56A 1RLCL 4E2DA