3ZVHA

Methylaspartate ammonia lyase from clostridium tetanomorphum mutant q73a
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
415
structure length
414
Chain Sequence
MKIVDVLCTPGLTGFYFDDQRAIKKGAGHDGFTYTGSTVTEGFTQVRQKGESISVLLVLEDGQVAHGDCAAVAYSGAGGRDPLFLAKDFIPVIEKEIAPKLIGREITNFKPMAEEFDKMTVNGNRLHTAIRYGITQAILDAVAKTRKVTMAEVIRDEYNPGAEINAVPVFAQSGDDRYDNVDKMIIKEADVLPHALINNVEEKLGLKGEKLLEYVKWLRDRIIKLRVREDYAPIFHIDVYGTIGAAFDVDIKAMADYIQTLAEAAKPFHLRIEGPMDVEDRQKQMEAMRDLRAELDGRGVDAELVADEWCNTVEDVKFFTDNKAGHMVQIKTPDLGGVNNIADAIMYCKANGMGAYCGGTNETNRSAEVTTNIGMACGARQVLAKPGMGVDEGMMIVKNEMNRVLALVGRRKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLASPARTATE AMMONIA-LYASE
publication title Engineering Methylaspartate Ammonia Lyase for the Asymmetric Synthesis of Unnatural Amino Acids.
pubmed doi rcsb
source organism Clostridium tetanomorphum
molecule tags Lyase
total genus 158
structure length 414
sequence length 415
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
A PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3zvhA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3zvhA01
1TZZA 2P8BA 3UJ2A 2QJJA 4YWSA 3OP2A 2AKMA 3DG7A 3IK4A 2AL2B 2XH7A 3RRAA 4DXKA 1ELSA 3SN0A 2OZ3A 1SJCA 4IZGA 3U9IA 3JW7A 1P43A 3TWAA 2XH2A 3V3WA 3MQTA 3VC6A 3QN3A 3GY1A 4ZCWA 3FVDA 3R10A 2OFJA 4DYEA 4HCLA 1JPDX 2GDQA 3MZNA 1KD0A 3ES7A 3NZGA 4IHCA 3RR1A 2GGHA 3T6CA 1BQGA 1PDYA 3S5SA 1E9IA 4E6MA 4H19A 3UGVA 1W6TA 3CB3A 2QGYA 1KKOA 2OQHA 3P0WA 3SQSA 3CAWA 3H8AA 2PP1A 3ZLGA 2PPGA 5FJRA 4IP4A 3PWGA 3Q45A 3I4KA 3IJIA 3RO6A 3TW9A 2P8CA 3DGBA 3STPA 3OTRA 2XSXA 3OPSA 1TE6A 3U4FA 4J1OA 3DG3A 1MNSA 1NELA 3VC5A 1EBHA 1P48A 4G7FA 4J3ZA 3DFHA 2PGEA 1ONEA 1WUEA 2PP3A 1PDZA 3DERA 4DWDA 1XPYA 2QDEA 3VFCA 3P93A 4KPLA 4FI4A 1SJBA 2OX4A 5FJTA 3EKGA 4M0XA 2OLAA 3QPEA 3R11A 4A3RA 5BOEA 3H12A 4GYPA 4E5TA 4Z1YA 1FHUA 4A6GA 4G8TA 2HXUA 3UCDA 4MGGA 4GMEA 3IJQA 3T4WA 1RVKA 2XH0A 3CT2A 4JN8A 3D47A 3ZVIA 2HNEA 4JN7A 3TCSA 2POZA 3FJ4A 4IT1A 1TKKA 2GGJA 3OZYA 3ZVHB 3RITA 3ZLHA 2HZGA 4GIRA 1EC9A 3I6EA 3MY9A 7ENLA 3GC2A 5FJPA 3PFRA 2QJNA 2AL2A 1BKHA 2PGWA 3R0UA 2XGZA 3I6TA 2MNRA 3N6HA 3T9PA 4HPNA 3D46A 3IJLA 2PTXA 2OZTA 2XH4A 3BJSA 3B97A 3VCNA 3THUA 3QKEA 3UJFA 4K2SA 3SJNA 4X2PA 3V5CA 2ONEA 4ROPA 3SN4A 3PK7A 4E4FA 2DW7A 3Q4DA 1KKRA 3MKCA 3CK5A 3UJSA 3UJEA 3UXKA 3NO1A 3V4BA 3JVAA 4HCDA 1WUFA 4MKSA 3TQPA 1DTNA 4GFIA 2OVLA 4K1WA 4KEMA 2PMQA 4DX3A 4HCHA 3GO2A 3S47A 2AL1A 2GGGA 3MUCA 4Z17A 4HNCA 3UJRA 3OW1A 2OG9A 3RGTA 3OZMA 1FHVA 3CXOA 3MSYA 3DEQA 2FYMA 4GYPC 2ZADA 4IL2A 2PTZA 2FKPA 3BSMA 1JCTA 3DESA 3SN1A 4GISA 4K8GA 1IYXA 2OPJA 2PA6A 1R6WA 2O56A 3K1GA 3N4EA 2PTWA 2PCEA 4HN8A 3PWIA 3R0KA 3TWBA 3H7VA 2AKZA 3VCCA 2P0IA 2GGEA 1EBGA 5IDZA 2PSNA 2OO6A 2QQ6A 3ZVHA 2PTYA 3TTEA 2GL5A 3SSZA 5BOFA 2OQYA 1JPMA 4DN1A 3CYJA 3ENLA 4GGBA 3ES8A 4MMWA 1OEPA 3H70A 3T8QA 3R25A 3ZLFA 3JZUA 4ZA0A 3VA8A 2I5QA 4HYRA 2RDXA 1JDFA 4H83A 3FV9A 3N4FA 2P88A 4E4UA 1SJAA 1MDRA 1YEYA 4FP1A 5EU9A 2PODA 2PU0A 1NU5A 3RCYA 4F4RA 1XS2A 1MDLA 3QTPA 1EC8A 5FJOA 3EEZA 3BOXA 2DW6A 2MUCA 4M6UA 3P3BA 3GD6A 5ENLA 2P3ZA 3TJ4A 4DHGA 1KCZA 2QDDA 3FCPA 6ENLA 1L8PA 4A35A 3MWCA 3KUMA 3UXLA 2PP0A 3NFUA 1MUCA 4E8GA 3TOYA 2ZC8A 2OZ8A 3N6JA 2QJMA 3VDGA 2CHRA 3NXLA 2GSHA 2GGIA 3FYYA 3V5FA 1SJDA 3DFYA 4KWSA 3DDMA 3DIPA 4GGHA 4EWJA 1R0MA 2PS2A 3QLDA 2HXTA 5FJUA 3R1ZA 4H1ZA 3SBFA 3HPFA 3TJIA 4IP5A 4ENLA 3UCCA 4H2HA 5J04A 4IL0A 3FXGA 4JHMA 2NQLA 1F9CA 1EC7A 4KT2A 2OKTA 2QVHA 1ECQA 2PU1A 4HNLA 3DG6A 1MRAA
chains in the Genus database with same CATH superfamily
3QM3A 4GQ0A 5AHLA 1FFRA 3IIPA 1L6WA 4QLJA 1R9XA 2AL2B 2ZA3A 4C7GA 2AQWA 1J2WA 4EWND 2ZDRA 3G8RA 4GC4A 1YDYA 4ONVA 1HNYA 3CYVA 1B31A 5AHIA 2C3ZA 1XISA 4X9SA 3QN3A 2W91A 3IGXA 2VWTA 2WJDA 3W07A 1C8VA 3FJNA 3IS4A 2PCQA 4JTIA 2HSAA 1FFQA 1RV8A 3CEUA 4G5DA 1HO4A 5ABGA 4AG0A 1JCXA 1VIWA 4QG8A 5CC6A 4IJBA 3LV6A 3RPMA 1MO0A 1GHSA 2DT0A 4C90A 1P0NA 4GRTA 3BDKA 3MUAA 4D6GA 3RM9A 3NUKA 4JD4A 3DFPA 5CPQA 4B2DA 4NXKA 3N18A 3NNTA 1O68A 4NL1A 2FHFA 2OYMA 4LX4A 2J7CA 3F2BA 3P6LA 2VOTA 4FX7A 3T2QA 1UR0A 4FOUA 1L8NA 1M3UA 2PGFA 4OUIA 3CUJA 3WDJA 4US5A 3MBFA 1X2HA 2XU2A 3WYZA 4RW3A 4GINA 3M44A 4A3HA 1T3QC 4XUGA 5C2GA 4XX6A 2A1YA 3W25A 2H6RA 2W3SA 1MQPA 2ZUVA 1DPMA 3E2QA 4PMUA 4NI3A 3QMSA 4Z1BA 5LSMA 2CBUA 1XPYA 4FA3A 2BY0A 3N12A 3CGCA 5E93A 3OYXA 2WC7A 4EAMA 3REQA 4I9AA 4IP7A 3GU2A 1G7UA 3UQNA 1V0NA 1DJXA 1N7KA 2NUYA 4TUFA 4BF9A 1TR1A 1UWAA 5ER0A 3W7KA 3PBUA 3G1DA 1NOUA 3PBGA 1CI1A 3SRDA 3HFYA 1RVKA 2GRTA 4JDYA 4D6EA 1DXEA 5A2CA 3W81A 1I2PA 1O6IA 3WLHA 1F5ZA 2W92A 2Y7EA 2OWXA 4ACYA 1US3A 4IUGA 1XLHA 2CBIA 3BLDA 2PBGA 1RBOB 3ZLHA 3VNLA 3AUJA 2WPFA 4PE8A 4J3VA 1CTNA 3PJXA 1TR9A 2HNHA 4FNQA 3BICA 1BGAA 1W8GA 8A3HA 4M82A 1VQZA 3D46A 2BHUA 3CMGA 1XIIA 2Z1WA 3G6LA 2BCPA 3HQNA 4REQB 4RX0A 4WGHA 2PB1A 3EWDA 3TXZA 4UTMA 2REQA 4XAGA 3F5LA 3KVJA 4LBUA 3URQA 4XK2A 1SR9A 3PK7A 1AVAA 5J5RA 4E4FA 3NL5A 4MB1A 2GR0A 3DN5A 4CQ9A 3C3UA 4A3UA 4ZEPA 5AVNA 2FVKA 4UNIA 3BLLA 2PDUA 3LM3A 1LG2A 3FKKA 4AD5A 3JVAA 3CWOX 4I8YA 4PB3A 4CLMA 1DTNA 3SRFA 1SGJA 1BF2A 2ZZBA 2X41A 1YW1A 3W4RA 2VD8A 1E56A 2E40A 3LI0A 4R27A 2WWDA 4FLSA 3MSRA 1G0CA 3TJLA 1I2QA 3GKAA 2GGGA 5FACA 3B8VA 2EEXA 2QCCA 5DT7A 4URIA 3VIPA 1OD8A 2G3IA 4EPKA 1IEIA 4HZ7A 3EANA 3WFAA 5E5CA 1ZJHA 1B3XA 4XO7A 3HV9A 4GYPC 5K9XA 5F1UA 5DX7A 4DNHA 1AFSA 4AQLA 3A23A 5D32A 4LY4A 3MTWA 1JCLA 1TTQA 4GISA 3QV7A 3AQUA 5E0FA 3OGRA 1JAKA 2VFGA 3S5NA 3HTWA 4AXKA 2I57A 2YL9A 3VIGA 4O53A 1FWGC 1VFTA 3EX3A 4GQRA 1EP3A 1J6PA 3MDWA 3CAVA 1RALA 3TDFA 3VNDA 1GQJA 3W88A 2QS8A 3C0SA 3SQPA 4PUUA 3CU2A 3RO8A 2OQYA 1JPMA 4DJDA 4EQXA 1VLWA 1OVDA 1IXPA 4WUIA 3ENLA 1MI3A 1S5TA 2BGNE 1JPHA 5FSEC 1JD9A 1V02A 3TCEA 1ZENA 4Y2WA 3VPLA 3APTA 4DM2A 4GIYA 3U7BA 3GDRA 1W5PA 2JIWA 4QDPA 1RH9A 1C8YA 3NVZB 3UXAA 1FFUC 2WYSA 1J0KA 5A6KA 4QCFA 5HINA 2BLEA 4W4QA 3NM3A 4ZVJA 4DAFA 4EX4A 3FKRA 3AIEA 2YCEA 3N17A 2YLLA 3WH8A 4CD6A 1Q6LA 2XSBA 3ATYA 5KVHA 4LVBA 3E96A 2PLCA 3WMSA 4ZB0A 5C9ZA 4POCA 3EF6A 3AS2A 5I77A 3TR9A 5AECA 3HQPA 3FGCA 5H91A 2IPGA 3C2EA 1WPCA 1XLDA 4WDUA 2ZRWA 1S1RA 3MP5A 4QR6A 2OZ8A 1JZ2A 3WF2A 2IPJA 2QAFA 2VCCA 4TX6A 3TH6A 4OZOA 4HA3A 1P0KA 3POHA 2GGIA 4BFAA 4XD6A 2GJRA 2FIQA 2VMFA 3G0XA 4MLRA 4QEEA 4LB3A 3QW3A 4GJ1A 3W0KA 2DPEA 3IPWA 1OHLA 4MJ4A 2F2HA 3N13A 1MNZA 5T9CE 1KR0A 1UASA 4NUWA 2HXTA 3SBFA 4I5RA 1Z32X 4J3TA 2QR6A 4IP5A 4U4MA 3FJLA 2VD9A 3M0JA 4Q8MA 4AZIA 3FXGA 2YBTA 3ZXWA 1ENUA 2OKTA 3BL3A 3L2MA 4W87A 2VC7A 3E6EA 2CU0A 3VE9A 3P61A 1EB3A 4MB4A 4ADUA 3LTYA 4GOAA 1XYFA 1YTKA 2O7SA 2INEA 2QUTA 2DT1A 5DMLA 2RUSA 3W00A 4NX0A 2HCVA 3A4AA 2UY4A 1V59A 3E0IA 2B7QA 4IFOA 2RFGA 4PODA 1CENA 4Q4QA 4YJ5A 4YWIA 4ASTA 4K36A 1H6VA 3WDHA 3M5VA 4PC8A 3WLSA 4AD2A 5IDIA 1IZCA 2HEJA 1XH0A 4LPCA 3UG4A 4FLOA 4QNEA 1SFTA 3EDEA 3ES7A 4MPQA 4M56A 4KF1A 2VELA 1ZK7A 2TAAA 2CLMA 5HAOA 2FGZA 3P62A 3KRSA 2J79A 2XHYA 1FVPA 1LBMA 1NF7A 2PPGA 4LTSA 8RUCA 5FF7A 3PWGA 1X97A 2WHJA 4Q4SA 4BHYA 3T42A 3W9ZA 3I4KA 3IJIA 3R8GA 2J7GA 3RO6A 4AVNA 3TW9A 1C7SA 4WOZA 2INFA 4P8XA 2B31A 5MKGB 3GIQA 1GPWA 3CHVA 1W3JA 2F8QA 1UA3A 1TV5A 2WOWA 2NXHA 2WKJA 4W84A 4X0VA 1MNSA 1NHPA 3WN6A 4K38A 1GEUA 5KZMA 4JIRA 1LBFA 2YVFA 2VL4A 1UKQA 2XIQA 1SSGA 3AO0A 3TFXA 3FA3A 3W7JA 2DVXA 3KOWA 4FOKA 4GK8A 4H01A 3LZ3A 4CD4A 1SVDA 4O1EA 1S1PA 1QOPA 2OLHA 5IM51 3LD5A 4AD4A 1T0OA 1XLAA 1KM4A 1EF3A 2BASA 4JQ9A 1AQHA 1F3XA 2NQZA 5IRPA 4HD5A 5CCZA 3T07A 4MGGA 1GRFA 1K8ZA 3PANA 4C7FA 1M7XA 3AIVA 1E3ZA 3BO9A 4JN7A 2KAUC 1V02E 4NNAA 4ZE5A 3GC5A 3HGOA 1C91A 1KGWA 3ZVHB 1V3MA 3RITA 3FHAA 5CJ5A 1XUUA 3H4GA 2SFPA 4M29A 1E4NA 2CBJA 1CZ1A 2QF8A 3CUGA 4KH2A 3S6OA 2BVWA 1BVZA 3APYA 4V27A 1RLCL 1P6CA 3W85A 3N6HA 4L5ZA 3AYTA 3R43A 2JKPA 1GRGA 4HPNA 2Z2AA 3O6AA 3MB9A 3ZZ1A 3IUHA 2FB3A 2W66A 4E2VA 5LA1A 3KS6A 3SCVA 4MIMA 1FWRA 3N2XA 4OUEA 4IQJA 2EF9A 4L64A 3EOEA 2ZRZA 1J2BA 2IQTA 2VFHA 2G96A 4TQTA 4GUFA 1XBYA 2VX5A 1XG3A 3HU7A 4JYFA 1Q2RA 2WLZA 5BXSA 4PB5A 3A3HA 1VRDA 3O63A 4Q7NA 3VNJA 1YBQB 1TJ2A 2Z29A 5HMDA 3K1DA 1OABA 4IQEA 3B0VC 5BMXA 2V5BA 3QPZA 2POTA 2V2DA 4L9XA 4ZO7A 4ADSA 4NNBA 3WF3A 5EYWA 1MUMA 3P0XA 1OCQA 2YX0A 3L4XA 3S47A 4TVYA 4MHBA 3LLXA 4Z17A 1LBLA 1WAWA 1R3QA 3DYPA 3URNA 3UXDA 4JFTA 4UTIA 2YFOA 4JL2A 4B2DD 5FEWA 2TPSA 4AVFA 3VMPA 3GUGA 1FBAA 2QDHA 1UB3A 3WD1A 2Y4SA 5DQPA 1CXIA 1N5WC 1V97A 2CWNA 4BS0A 1IYXA 2OPJA 3QV9A 2PWVA 2PUZA 4AZHA 1XC6A 4IMFA 1GVIA 5FMHA 3H54A 1BZLA 1EIBA 4O12A 4OU1A 4RE2A 5U25A 3DECA 3ZR5A 1OCBA 2J9XA 4JQ1A 4UOJA 5D2XA 4V1XA 2ZE0A 3UYIA 4H7ZA 2WMIA 3H24A 3H4KA 1UC4A 3CGDA 1TG7A 1W3LA 5JQ9A 3URAA 3GX9A 3CH0A 4GGBA 2J78A 1MW2A 3PWAA 5XIMA 5EBAA 3M0KA 1ZB5A 3UZZA 3VA8A 1KRCC 3FXYA 1TPEA 2YXXA 1PB0A 3O15A 3KBNA 3MVIA 1QHOA 5A94A 2E6AA 2BS9A 3LA4A 1OFRA 3KOFA 2WZEA 3UY7A 3IIOA 4QE1A 3NCOA 3T1GA 3C2RA 4WDWA 1NU5A 4I7WA 3MT1A 1CXFA 3M43A 3PBYA 1GEQA 2Z1KA 1OF8A 1BYAA 3QOMA 3OQEA 2RAGA 3GHSA 2Y70A 3AC0A 2YYTA 5IOBA 3IJ6A 2R14A 3H4XA 4R33A 4D8LA 4L61A 2XIMA 1ICQA 1F61A 2PDHA 1YIXA 1EP2A 2FMOA 3R58A 3R2GA 2QJGA 5IBXA 1SZEA 4R9XA 1EFZA 4GFSA 4EE9A 2Z1XA 3TYUA 1TMHA 3TC3A 5HMFA 3ANVA 5EMYA 3L66A 4GI6A 1AQ0A 4RNFA 3QHNA 3FYYA 3MP4A 2JKAA 1ICPA 2GWGA 3G2GA 3E49A 1N82A 4W89A 3EUB3 1RM6B 5AVHA 3ABSA 1X96A 2CFFA 1L6FA 4CNNA 3TFCA 1UWTA 3E5PA 2IKIA 2WMKA 1IT0A 2QCDA 4ENLA 1XSIA 3WQGA 1Z42A 3CZ8A 5DBTA 1PHWA 2AAAA 4L6DA 4NVTA 1F2JA 2J7FA 3O05A 1K7XA 4FXRA 3LGGA 4G1NA 4NILA 2ZZ1A 3VKKA 3GNXA 4FPSA 2ADAA 1TZZA 2VZSA 3UJ2A 4QDMA 2OTDA 1Q6QA 1TUXA 3OA3A 1Z7AA 1TJ1A 3LMZA 4U28A 3KXQA 3VOIA 1GVEA 4XZMX 1SO4A 1XC4A 3URHA 4Q4OA 1AZ1A 3TP4A 4AEEA 4J2MA 4R7JA 3QVQA 4N9BA 1O12A 5D04C 1XGZA 3FJ6A 1TREA 4ZCWA 3PZMA 1B54A 3UZ5A 3S42A 3G1VA 3IIZA 3HRDC 1FWJC 2R94A 1JDEA 4M6VA 2CIPA 2QCGA 1JRPA 1UKPA 3T6CA 2VP8A 1H3GA 3QRHA 4ICNA 4PMXA 3C2FA 1W6TA 2OQHA 5IFTA 3P0WA 4CNTA 3CAWA 3NOEA 2Q8ZA 4NG3A 3KBSA 4U10A 2TODA 3GHRA 4IJRA 2JE8A 4Y9OA 4A29A 3S5ZA 3OTRA 4KESA 5CG7A 1DV7A 1BWVA 3XISA 3U4FA 2VZUA 3OODA 4J57A 4BI5A 5IFPA 1XLJA 5FL0A 3GR8A 2X99A 1OYCA 3O2LA 4HU4A 3IRSA 2PGEA 2J9ZA 5E1QA 4FIRA 2DEPA 4WGXA 3UESA 4AZCA 2OX4A 1TZ9A 1DTUA 2GWNA 3A13A 4UTLA 1ONFA 4DPPA 3CBWA 4GH1A 4KEZA 2QF7A 2E6YA 3PM6A 4FK9A 1VFUA 3WD3A 1JUEA 1WXYA 2PC4A 3CEPA 3TMLA 1FEBA 3TKFA 4B3KA 1XANA 4GQQA 1JUKA 4NSBA 3A4WA 3ETRB 5LA0A 3TCSA 2GGJA 2CWXA 2CKSA 1HUVA 3CM4A 1RJQA 3W7DA 1S3TC 2I17A 3A4XA 4HMCA 3M5YA 1LUCB 1OYBA 3GC2A 4DBSA 1GVOA 4AHOA 1H51A 1ZNNA 5F4XA 3CV1A 3TYAA 4C6MA 2E8YA 3BLPX 1EZ2A 3VD5A 1K6WA 3ONBA 2E5CA 1EPXA 2EQ7A 5LIUX 3LRLA 1UJPA 1NWRA 4ICCX 1F4HA 2MANA 5DMMA 3W7MA 4B4HA 5H8MA 2QUVA 3NJ3A 1TPB1 4AHQA 1JDCA 3II1A 4JTFA 2YAUA 4HNOA 1T41A 3AU6A 4F0SA 3PAJA 1NWTA 3DKJA 3DU0A 4GHRA 1F6YA 1K3UA 1LROA 4ZMGA 2VCAA 3OC4A 4WY0A 1UWQA 3S2CA 1PX3A 3EPMA 4NF7A 2XVKA 3WQCA 1CGXA 3ITOA 4HTBA 1S39A 1V7AA 3WF1A 3UXKA 3VKBA 3DBNA 3O3RA 3TQPA 1GJWA 2DZSA 4Y8EA 2OGJA 1UR3M 1D3CA 5HULA 1OG6A 2QJHA 3L5MA 1Z41A 4V28A 3HJZA 2E6FA 1ZAIA 2VR5A 3E12A 1AZ2A 5D30A 4JN6A 4FR1A 3ITYA 1LL7A 4PBEA 1TIWA 1BAGA 1DOSA 2XVPA 1G7VA 4OVXA 2NVCA 3HQ1A 1BXCA 2V5DA 1O66A 3BARA 4D6JA 3BSMA 3SN1A 3BW4A 4QSHA 1DNCA 1REQB 4JTLA 1T8XA 3DHPA 2Y5SA 1WXJA 3LHVA 3SI9A 2ZC1A 1Z48A 2WLYA 4P2VA 2Z1VA 3MMUA 2WO5A 3N9KA 3BMWA 5HQLA 1H2IA 1V6WA 4I7UA 2GL5A 3E2SA 4TOQA 1A4MA 3RAOA 1US0A 4MMWA 1YQZA 2X1TA 2VYOA 3CTLA 1WBJA 4HU3A 1PXGA 4DQWA 3PS7A 4A2SA 1OFEA 3GTHA 3ZT5A 3MI3A 1W37A 4O13A 3W7CA 3GD3A 1W1A1 4NNCA 1E1CA 1I60A 4E4UA 3DJGX 3W84A 1K03A 2BGQA 5HXMA 1GTEA 1F3EA 4GY0A 1EPVA 1SYTA 4D71A 1NQ6A 5FJOA 4DO6A 2CHNA 1LWJA 4QRNA 4P7LA 4OJYA 2GVGA 1GKQA 3MI2A 1HFBA 3DX5A 3V1PA 1TV2A 4IFKA 4O1BA 4Z2IA 1V3IA 4AZBA 2WVVA 3U5YA 3V16A 1Y5XA 1TX2A 3BGAA 4HQVA 3TYBA 3RF9A 3AU2A 4NZCA 1ZBWA 1PCWA 1KWGA 1XD0A 4INFA 2XN1A 2QGHA 3ARXA 1BRLB 5D38A 3AXKA 1XLLA 4ZOHB 1XIHA 2ZC8A 4XD4A 1JYWA 3W2MA 1SR0A 3VDGA 3MUZ1 1KC7A 4DLMA 2WNQA 3SRHA 1DE5A 4UOZA 3NDZA 2WZTA 4ZGYA 1XWYA 1RK6A 1W8SA 2BHYA 1QPNA 4LYKA 3PY2A 1IT8A 3WUEA 4D8ZA 4JTEA 3AXHA 4M80A 1GOIA 1RAKA 5BXTA 4B5XA 3THCA 3B4YA 2PWGA 1U83A 2VJXA 2ZA1A 3A4JA 3HF3A 4GBDA 2ZZ2A 3LSBA 4DELA 3GTXA 3S2MA 2VTFA 5DN1A 3OP2A 4AVOA 4MDOA 3K5XA 2P1FA 5LIWX 2Z28A 1POJA 1TYPA 2C8NA 3LHWA 4Q22A 4B5TA 2Y8UA 4JIIX 4G56A 1M7PA 1K4QA 1W5MA 2OZ3A 4JAWA 1G01A 4TTUA 5D4YA 4LALA 1CB7B 2V5CA 3MQTA 4LRTA 1TCMA 4NJKA 1EO5A 3WDPP 2GVYA 4JKMA 4FMVA 2J8GA 2GLKA 5J5DA 1JPIA 2PDJA 2OFJA 1RBLA 4H8VA 4DJEA 1Q6EA 4MWAB 2GDQA 3GXPA 3SUVA 1A5BA 2UY2A 1NWUA 1ESWA 2TMDA 3CUHA 5M3WA 2GGHA 4RW5A 3OEXA 1GJUA 4JTQA 1MMFA 1R3TA 4V33A 1GVQA 3H8AA 3M0XA 2ZQ0A 4AMAA 1H50A 1CLKA 3QW4B 4OECA 4Q8QA 4LU0A 5D37A 1NSJA 4RE4A 2XSXA 3OPSA 3DGZA 2WNNA 2YL6A 2W0UA 4H9TA 4N9EA 3B04A 4Q8OA 4WXYA 4HOZA 1C29A 1EJXC 9XIMA 4QDWA 3GVRA 2E09A 1TV4A 3SB0A 3NZRA 4V15A 2QDEA 2VR4A 4A8NA 4L4LA 1JG9A 2DGAA 2EGZA 3AS0A 3NQMA 1XIMA 3UG5A 4ZQOA 5TBOA 3GM8A 3W87A 5C70A 1TQJA 3ZJ8A 2Y5EA 4GBUA 3R11A 2JK6A 4NASA 4A3RA 2PF0A 4P61A 4GYFA 2D20A 1XKYA 2XSAA 4UQDA 2F6KA 2BP1A 2G4JA 3M0LA 3GNOA 2I16A 1IGWA 1DYSA 4H41A 2FTYA 3KDOA 1H11A 3A3XA 3ARPA 2HROA 1XF0A 4YU1A 1QI2A 3B40A 2CFYA 2OSYA 3T8LA 2GVLA 2XIOA 3QZAA 5H6HA 1ZLPA 3WG6A 1ZDLA 4GIRA 3A3WA 4HSNA 3L0KA 3W1UA 4GX8A 5GPRA 4MJ2A 1GRAA 1Q7QA 4N7QA 2OEMA 1W3KA 1GG1A 2ZUMA 3DC0A 4LV4A 4CUCA 3BMVA 3SUTA 1KM0A 2P76A 3IJLA 3CV2A 3KBVA 3UF9A 3SCNA 3B97A 3FAXA 4Z0JA 5C7HA 3LN3A 5DEZA 4NJHA 3T09A 4E0CA 1OFBA 1UH3A 3HG2A 3R6IA 1HJXA 3COTA 3F4CA 3W83A 4CCEA 3VNKA 5FAJA 1LWIA 5I07A 2R9ZA 1ZGDA 2V3DA 1RY0A 2HRWA 5A8GA 4RE3A 3RU6A 3VVGA 2NWRA 3G8EA 3JUGA 1ZJAA 1LPFA 3LXAA 2HS6A 3WQ6A 5CC3A 3LQLA 3PF3A 1GOXA 3W1PA 1QFEA 2A0NA 3KDNA 3TIMA 4K1WA 2WSKA 4Z2HA 5CZSA 2A3LA 2F84A 4J27A 1YXDA 2A85A 4GIAA 4NT0A 2Y24A 3GO2A 5HDRA 1UUOA 3E0VA 3N2CA 4JTJA 5LKYA 1P5BA 1OFOA 1V7YA 4Z2JA 3UWZA 1TCDA 3DFOA 4HSOA 4MY1A 3EX1A 2ZWZA 3EX6A 3PBVA 2D24A 4BQ4A 1K8CA 2FYMA 2CXEA 1TVNA 2H9AA 1PCKA 4PUJA 2PTZA 3LI1A 3LADA 2PDGA 1QOQA 4FZIA 1X7IA 5AYYA 3SY8A 2AQVA 1W91A 4K8GA 4H4WA 3WNMA 3MCOA 3RNDA 6REQB 1OG0A 1AJ2A 3TJXA 1XYZA 5U4NA 3PWIA 3U2ZA 3R0KA 4OV4A 2NQHA 1HJQA 1EOMA 3BUVA 3CNYA 3WMLA 4RE0A 2AQOA 3VMNA 5BOFA 4F9JA 5I5RA 3AUOA 2VC5A 5XIAA 2JKEA 1JUBA 1QPRA 3IGUA 1EDQA 1L2QA 7TAAA 1XDJA 3G6MA 3O07A 4ZQNA 3O0KA 4MWAC 3HG3A 3WQOA 4UWMA 1E6SM 3SUSA 3L4WA 1JIBA 3PB2A 1JGMA 4UMBA 3VD4A 1MDLA 9RUBA 3O6DA 4QLLA 5C9RA 1N61C 4QM1A 1QOXA 2O7QA 5LNRA 2PF8A 4QTGA 4DF1A 4DHGA 2ZXBA 2WCAA 1AK5A 4JIPA 4ZOBA 4OKDA 1F6PA 4PL1A 3FIGA 2P53A 2V3EA 3G22A 2PWUA 2WB5A 1EJ7L 2X16A 2QV4A 3LPPA 3BSHA 3ABXA 3TX9A 4AX6A 1ZJIA 1W1VA 3NXLA 1KM6A 3VGHA 3W26A 1E0WA 1D7FA 2QV5A 1Y7VA 4AUBA 1D2KA 1WBHA 4P7OA 4PL2A 2FGLA 3QZ6A 1A3XA 1XCWA 2GUYA 3DH9A 3LG3A 3QH2A 1HQTA 3P81A 2D3NA 3DKLA 5REQB 3ARTA 1OGSA 1U1UA 2PDWA 3BJFA 5ABTA 3QXBA 1Q6OA 4N6FA 1B3VA 4YVVA 4UTWC 1IZKA 2I5IA 4PMRA 1WXZA 2G3MA 1UOZA 3OOQA 3SFKA 1WZMA 1FRBA 4W5ZA 1HP4A 3BOLA 3THQA 1FCUA 1FWWA 4JY9A 2P8BA 3N3TA 5AHEA 2GSEA 1J6OA 4FX8A 3R89A 1ZRQA 2EPMX 4MM1A 4U33A 1AH0A 1MWOA 2V82A 4QEHA 2ACUA 2RKXA 2ZX6A 1W9DM 2NX1A 2A4AA 4I9MA 4XKYA 3H7UA 3WQPA 4IZGA 3W22A 3V3WA 5CKSA 4Z42C 1XLEA 2UZ9A 1VH7A 2XISA 5FIPA 3NURA 3NPUA 4LAUA 3ARRA 4EPDC 1VR6A 4IH3A 2WANA 4EK7A 5FCZA 1H61A 4H8NA 1ZBKA 4TR9A 5LZLA 1RQHA 3GK0A 1JEZA 3B05A 4I6KA 1XIDA 1H63A 1T8QA 4BA0A 1B0IA 2OSWA 3WUGA 4W8BA 1US2A 3L4VA 3NGJA 3KTXA 4ACZA 3F7JA 4MOZA 1DJNA 2BSLA 5A6MA 1IWBA 1CWYA 2Y62A 4HPGA 5DCDA 2XFYA 2WHKA 4UR8A 4HJWA 1W17A 3SY5A 3ZJ6A 3W86A 3WQEA 3XIMA 3WSUA 1N2VA 3SRKA 4NZ4A 4FEZA 4UXDA 3QQ0A 2C19A 4C65A 2J6XA 2J75A 2G3FA 3E02A 3B8DA 1W9BM 1QBBA 3KLJA 4PUEA 2YCKX 3VE7A 2VRJA 3OIXA 5HNTA 3RK8A 3AZTA 5LGXA 4K37A 1Q2SA 4E5TA 2QYGA 4NJIA 1RA5A 3UWEA 1UH4A 2ACSA 4I90A 4I9TA 1ME7A 3DC8A 1J0JA 4HK5A 2ZDSA 2Q09A 2R9RA 4D6HA 4BR1A 1FDZA 4TVWA 3W7PA 4XBSA 1NDWA 3RJYA 2X8RA 2XFWA 4MY8A 3VU2A 5A5WA 5CPMA 2X0HA 3RX3A 4UC5A 1LZOA 4NZ3A 4UFLA 5C71A 4GO9A 2PLKA 2VVNA 4YHEA 4FAMA 2XVLA 3WK0A 4KGJA 3W6YA 4PUNA 1B1YA 1KQYA 2NQ5A 1P1XA 4UTHA 3PPCA 3N04A 1UD4A 4X2PA 3OVRA 3LCLA 2ONEA 3U6WA 2AGKA 1PZ0A 4A3QA 1B3YA 5CPOA 3MC5A 4AD1A 2VFDA 4C6LA 4AC7C 1EP1A 3PUGA 4B9YA 2OWCA 1UPMB 4QQ3A 3A6OA 3TXVA 1GPFA 1OX4A 1RK5A 4JTKA 1VENA 3V4BA 3SM0A 5JCIA 1VFFA 1U30A 4UTTA 2QCHA 1JZ6A 2WKGA 1W3NA 1OGGA 3NRZB 1OM0A 4AIBA 4O54A 3LRMA 3WCZA 4HCHA 5EMLA 2Z25A 3EPOA 1DQUA 2AL1A 4UZSA 4H6QA 3NZ1A 1IF2A 1JR1A 2XVGA 1MYRA 3GFZA 4CNPA 1R46A 2W3RA 5F2MA 1UR2A 1KTCA 3DEQA 4NEVA 3AIWA 2WPGA 1SZFA 2BOGX 1RP8A 4DI9A 5LIXX 2B81A 5MHBA 4Q8UA 4C6IA 2ZADA 1ZUAX 2YBVA 1R30A 3PZNA 4JTHA 3JU2A 2O56A 3HURA 1JNEA 1CPUA 2FPVA 4QISA 1LM1A 3M07A 3CASA 3K8MA 4PMOA 5I3KA 3T55A 3TC6A 3QHMA 8CGTA 1W0MA 3QQ1A 2WBGA 4M6PA 5F4WA 2GQAA 4EACA 2W79A 3VM7A 3QR3A 3EDDA 4HPJA 1UBPC 3STFA 1H7RA 4JX4A 1R5YA 2J24A 4AIEA 1SO6A 3A7AA 3ONCA 4WSKA 1JCYA 4IPNB 5KITA 1TA3A 5JH2A 3U5UA 3N4FA 2Z4GA 3KCJA 1S3HA 3W7RA 1QK2A 3F1QA 4IIHA 4OWGA 2PDPA 1ZAJA 2JGQA 1UP0A 2YZRA 2EPKX 3HJEA 1HJWA 3KOXA 3RLVA 3NDOA 1PIGA 2ISDA 2NV9A 4H4IA 1FDJA 5G1TA 1X6UA 3EA3A 1VHCA 1NQKA 3AXXA 1VPYA 3AHZA 2WJFA 4EANA 4K39A 4KWOA 4LUYA 1L8PA 3RMJA 1EHAA 1OYAA 4LYPA 4Q8WA 3WD4A 4CD5A 3RILA 2D73A 1HW6A 1DJQA 1O95A 3KOZA 2PD9A 4CU7A 3HQOA 1W1PA 1Q8JA 2CHRA 3BQ6A 2DZXA 1AA1B 4L4OA 4KWSA 3W2JA 2NPXA 3F2CA 4ZQCA 1IXQA 1I4NA 2NT1A 4GVIA 2ZRXA 1RXOB 4FIQA 2DIKA 1RD6A 1E9YB 1IEQA 3G1SA 1XJBA 2XGBA 3THDA 1BXNA 4PCPA 1O4UA 5CGMA 3LCHA 5A6SA 4JHMA 4TXEA 3AN1A 1M1BA 3OG2A 2JIEA 4XIAA 1NF0A 1E5NA 3AHTA 1TELA 1AG1O 1NOFA 1BWLA 4WY0F 4L1WA 3THAA 2NW0A 4Q33A 1TQXA 4AD3A 4TVUA 5AYZA 2DZTA 2G4FA 3H2CA 3OVQA 3K46A 1HN1A 4LW7A 5JCLA 5HR6A 2YL8A 4P5UA 2HE8A 3CPUA 3GXNA 4XVEA 1K9DA 1EIXA 2VFFA 4EQWA 4S39A 4TTGA 2W27A 2ESCA 4D6DA 4PYSA 4J40A 1SJCA 1DJIA 1UKSA 3LPOA 3PZ9A 3GC4A 3LTPA 2PURA 3TWAA 2V0TA 3PBWA 3VKDA 5M1TA 2BC0A 4WJXA 4BQ3A 4G9PA 4BY3A 1MXSA 1XD1A 2CLKA 2WPCA 1ITCA 4H9UA 2FB2A 3ATZA 1E43A 4XAFA 3EXTA 3FEMA 2DUAA 1LJYA 3NVDA 1GJPA 4WZHA 1KKOA 2ICSA 2YOCA 5I3FA 1CGTA 1SW3A 3C52A 1I1WA 4TU1A 4K8HA 4DUOA 3C2VA 1XBZA 4H00A 4LYRA 1E9ZB 1P6WA 3QC3A 3LRKA 3CQKA 1ZS2A 2Z7GA 5HJLA 4AXNA 3A9BA 2X7WA 2D2OA 1TPVA 5FJIA 2DSWA 3MS8A 2YCLB 1ZMDA 4YHGA 4WLCA 2DJXA 1H1NA 5TIMA 3GH7A 3RN6A 1L2UA 1VYPX 4LEFA 1ONEA 1Q6GA 3K4AA 4XAZA 1R3WA 3BURA 1EDTA 3VABA 4JTDA 1X6LA 4BURA 5KZEA 4KETA 1LRQA 1CCWB 3NZQA 1PX8A 2G50A 3EB2A 1VFOA 3A47A 1EYWA 2ZVIA 1XBVA 3IEBA 4GYPA 2G8ZA 2B7OA 4MLJA 5I78A 3NQCA 4P8VA 3I4EA 3F4NA 3BW2A 3AMKA 4LIIA 3MHGA 5CGTA 1MXDA 4E2BA 2Y7DA 1OADA 4A05A 1Q65A 5GNXA 1IGSA 2ALDA 4LVAA 3QJAA 2DVUA 3ZT6A 2BBFA 4G2DA 3I6EA 2AL2A 3VIOA 1C8QA 3GSMA 2GPTA 4PB4A 2PGWA 5CAHA 1WA3A 1MQQA 1XLGA 2ACRA 2WMGA 2PTXA 1LDCA 3B8IA 4GXPA 1TYGA 3THUA 3JRKA 4TMCA 5KMYA 1OQFA 3HOJA 2OKOA 3CZEA 4IPIA 2WW5A 5C9WA 3K4WA 1WKYA 3LHUA 3BTNA 2V3BA 1IXOA 2FGBA 5TNVA 2UBPC 4CVWA 1P7TB 2VGFA 4WJ8A 2YDQA 3S46A 3O06A 2J7EA 2ZRYA 3U8GA 1U33A 4XD3A 4MFEA 3PBMA 3I68A 3K13A 3T40A 4MKSA 3F2DA 4GXMA 3UXIA 2YCIX 2HE5A 1JQVA 1AJZA 3M5XA 4PMZA 3W71A 4JHOA 5CPTA 1SW0A 1XHCA 2WOIA 3OA5A 3UWUA 4LOCA 4XSMA 4R5EA 1TWDA 1P1MA 1EJRC 2NX3A 2WPEA 4J9JA 3GVQA 1ONXA 2OSXA 3WBEA 5CC5A 2ZVRA 2OOGA 1GTHA 3GS6A 4GY1A 2HWGA 2X8GA 3TE9A 1QHPA 2HVMA 1H7WA 1HT6A 1UQZA 1XR2A 4OE7A 3VOCA 1GZJA 2WHMA 4GUGA 1QR7A 1G4PA 4Q7BA 3EX2A 2IQDA 1X38A 3ZJKA 1TMLA 1DJYA 1AL7A 1X1NA 5CSUA 4GH3A 3H55A 3H22A 5KZ6A 1JZ4A 4QP0A 1BWCA 3BAXA 6XIAA 3FEQA 3O8AA 4CNOA 3DK4A 3BC9A 3H2EA 4H9MA 5TD4A 2ATSA 5BCAA 3GG8A 1FCQA 1Y5VA 3SSZA 4Q7IA 3QGVA 4JNYA 3AISA 1F7BA 3UZXA 1OEPA 2VOMA 3H70A 3VTRA 3VUPA 4UB9A 1UG6A 4O19A 1VEOA 3KFTA 2C0HA 4O10A 3TSDA 1B2YA 4Y9PA 2PODA 4REQA 1S5NA 2H3BA 3EB3A 3NQAA 3HMCA 5EY5A 2A7NA 4FF5A 5FL1A 3BJTA 1K02A 1VBJA 4GC3A 2UY3A 4GY7A 4LXFA 1MW0A 4BCEA 1FXPA 3EXSA 4HIBA 2Z1SA 5BRBA 4UFKA 1VP5A 1CT5A 1RCXB 2QCMA 1EQCA 5LNVA 1LL4A 1UD8A 3CZLA 3GDBA 1SSDA 3P14A 3WJYA 1W9PA 3GZ3A 1DXLA 2F38A 3KBMA 4K7VA 3CQ0A 4P7RA 5LGZA 4LB4A 2BODX 3WF4A 1CGWA 3NFUA 3DUGA 2ANUA 2F61A 4JTAA 1FCVA 2J62A 2PDLA 3VIIA 4A2RA 1KBKA 1YNYA 1VBUA 4QG6A 1FP9A 1NP0A 4GUIA 2EQ8A 3U3HA 1HKIA 1A3WA 4C6PA 2YXGA 3H2FA 2XUCA 3W7QA 1BYDA 1W1TA 3QYQA 1LT8A 2QCDB 2QPXA 1R0MA 1S46A 4UFHA 1U2YA 3PUOA 4WK9A 3HPFA 3CGTA 1GRBA 3NEVA 4KEUA 3DOPA 2A3HA 1ZXIC 2VGIA 4ADWA 1TO3A 1V0KA 2FFCA 1JXKA 1CEOA 1J01A 2OYKA 1EC7A 1UZ4A 1EX5A 4XG1A 3TV8A 3KRZA 3WMBA 4ILSA 1EO7A 3OIHA 4HNLA 4HNUA 2CZEA 3E3HA 5LNWA 1RJPA 4HZMA 1OCJA 3S5OA 3RNMA 1ZPTA 3TMQA 2IXVA 4B9ZA 1XLMA 1T7LA 1HX0A 2EHHA 3EWXA 5G2HA 1EEPA 4LNCA 4G7EB 4DVOA 4YXGA 4UOQA 4PFMA 3P8JA 4I7VA 2J8FA 4HA4A 3N73A 4J35A 4CU6A 5HNUA 3L7RA 3JW7A 4W7VA 2XH2A 3PZVA 4U2YA 1LQ0A 2HVOA 5FF0A 2JEQA 4XAYA 2WP6A 2Z6JA 4HMEA 5FKYA 3TA6A 3AWOA 1P0EA 5AZ1A 2XZ7A 3LLDA 1JPDX 2L5HA 1HGWA 4X9YA 1OC6A 3CH9A 3GU1A 4H3DA 3VO0A 2FLIA 2GJXB 3LM7A 4Q6JA 4PTWA 4FSAA 1PDYA 2DP3A 4E6MA 5M2FX 3EOOA 3O9NA 2YIHA 3W7OA 3FDKA 4OHQA 4IP4A 2V2HA 3UWVA 6TAAA 1V93A 3H2NA 4DBDA 2FZMA 1R85A 3W3OA 3C56A 2VC6A 3MCNA 4XZIA 3RCMA 3B06A 1OCNA 1EOKA 1R87A 1WB0A 2ZTKA 4QGCA 1Q63A 3Q6JA 2DIEA 3N14A 1IR2A 5EMKA 2IQ0A 3KW3A 1Q7MA 1F6KA 2P5NA 1MZHA 3QPYA 3W2NA 3W1RA 1SMDA 2G97A 4KPLA 2XYLA 3RX4A 5C9XA 2EKGA 2HISA 2Z24A 3S3GA 1Y0EA 2X2GA 1ONWA 3HA1A 2JGYA 3WELA 1QCWA 5BRPA 2WXDM 1DXFA 4S3AA 1EZWA 4JYEA 2Y0FA 3H6OA 3M41A 2PAJA 4NZ5A 4GMEA 2QXWA 5I09A 3IAPA 3MA8A 1PSCA 2WWCA 4KRZA 1Z9AA 1L6SA 3BXWA 2C3CA 1H62A 1XBXA 2FHBA 5C6MA 3VINA 3L5OA 3BAIA 3BAYA 4LUTB 4M81A 3EA2A 4KQNA 4RR4A 2DZBA 5FJPA 1V6XA 1J11A 4O50A 1QBAA 3VCRA 4YTTA 4PTXA 4DI8A 1ICSA 1YE4A 5FESA 4N2YA 1Q1RA 1BPLB 4ZZ9A 3M0ZA 3BJSA 1OFDA 3WBAA 9XIAA 5AKQA 1SM9A 1T40A 3UFYA 3UJFA 4B15A 4UR7A 3TTYA 5BXPA 1K7FA 5CZTA 4BWLC 3V5CA 1J12A 1MUWA 4XVDA 1J96A 4ROPA 1Z89A 3TTSA 1F07A 4RK8A 4JFUA 3WEOA 5JBFA 3AROA 3EYPA 1DORA 3M4HA 5IBXC 1H7NA 3CAKA 4BEQA 1KKRA 1SW7A 3K8LA 3LCFA 5EGRA 1OFPA 3UJSA 2YVJA 1BLIA 1E0UA 2RJGA 3K8KA 1RVGA 3OBAA 2NV2A 3GDMA 3ZR6A 4AEOA 5DY2A 4JS3A 1W3HA 4ECLA 1QAPA 1EXPA 2W63A 2FVMA 1EUAA 5JCMA 1VBGA 5MKGA 2V3GA 1GERA 1QATA 2CLLA 3PTMA 1PAMA 5JXQA 2RGMA 2V8ZA 5HWJA 3VOFA 1Z44A 2HTMA 1N63C 3KHJA 1NFBA 1X1ZA 3P5ZA 4RDYA 1AH3A 3JR2A 1WZKA 4L80A 1WP6A 4UBPC 5D02A 3CUZA 4F0MA 5M17A 1DIDA 5I3DA 1WOBA 2PWDA 3OLDA 5KSWA 3DFQA 4F0KA 2QCFA 4DZHA 3OLGA 5HQMA 3LGEA 2OO0A 4AMCA 2XM2A 2DZWA 4H6EA 5T9BG 1S5WA 5LXEA 1BQCA 2E28A 2V9DA 5KEZA 1KFWA 4UQCA 4C6KA 1VPQA 3IUDA 1EGVA 4NZ1A 4AD0A 1HVQA 1DWHM 2GSJA 2EG7A 3UWWA 4GZJA 2PSNA 3MVTA 4EKJA 4YN5A 3FYPA 3N6QA 3ZVHA 1A0CA 2BMBA 3KVMA 2CKRA 5C8BB 3B0PA 4WDTA 3BANA 1E0VA 3T8QA 1LOLA 3VD7A 3G1FA 5B80A 2H3DA 1ZY8A 1NEYA 1JI1A 1J10A 2IKJA 3W53A 4HYRA 4O4VA 1A5SA 1G4EA 4MB3A 3EPNA 3PZOA 1EKOA 1E6RA 4OOZA 4JGDA 4RJEA 3GTIA 1ZALA 2WAGA 2WCGA 4IPLA 3SCRA 5JH1A 2DH2A 3GH4A 4JDBA 3FA5A 3GWQA 1PYFA 5G2WA 4X2RA 3K2GA 1RCOB 2A6NA 3V75A 4DJFD 3B4UA 3DGHA 2RABA 1YBQA 1EA9C 3CJPA 1E9LA 4ZQRA 3MWCA 3E0FA 3AAMA 1U1HA 4AW7A 3WQWA 4DXVA 5FA5A 5AB3A 4M52A 4Z2KA 3MZ2A 1AQMA 1KCKA 2FQIA 4G6CA 2V69A 3ISIX 4CN6A 2VC9A 5G1YA 8XIMA 2ZUWA 4A3YA 3S1WA 3WH7A 4O11A 4RDVA 1ZCOA 3U2OA 1TTJA 2YSWA 5E9XA 1YXCA 4DBEA 4H7VA 4UIOA 4MUPA 2VQUA 4AC1X 3B9AA 3LSCA 4GA8A 5A6BD 4ZTXA 1FCBA 1XFBA 1PTGA 5F1VA 2W61A 4LVGA 5HUOA 4JKKA 2B7PA 3PSWA 4JIQA 4ZB2A 4BF5A 1M6IA 6TIMA 1EHNA 1KRMA 3VK5A 3WUBA 1UMLA 4EMIA 5C2CA 1WV2A 3BVJA 4S3JA 1TVPA 1V0LA 2WNWA 1DWIM 3ELFA 4FLQA 1HVXA 4C6QA 3TSBA 4XIMA 1F3PA 5CLTA 3PZQA 4O0ZA 5CBIA 4FNTA 5LXXA 1RHCA 2EPHA 4E38A 5I3JA 1JZ5A 3U9IA 4DZAA 1QNQA 5FI8A 2E7FA 3WF0A 2J7BA 3ABRA 3PVFA 1IQ8A 1H7PA 1F76A 5CH9A 5BXRA 2VEMA 3VX0A 3UA3A 4CCZA 1JYVA 4L56A 3R07C 5GJPA 2GK1B 3HPSA 3DCPA 3ANUA 5A3HA 1F8WA 1U5VA 3F4DA 2VUYA 2OCZA 3N34A 2YW4A 1PWLA 2IMRA 2J13A 1BQGA 1GVRA 1QNVA 2VX4A 5XINA 4O4WA 2CHOA 4R34A 5G1MA 5JU6A 1JZ8A 2Y7GA 1UMYA 2XJ7A 2PP1A 3Q37A 1XRFA 4DBUA 2VO5A 2P8CA 4ICMA 2E5AA 1IEVA 3QY6A 5ABHA 4CQBA 3AYVA 4JEJA 2IW0A 2F6XA 3EXRA 3E0LA 3VC5A 4G7FA 3KTSA 7XIMA 3SCWA 2PDCA 4H4ZA 3V7PA 4QAIA 1QPQA 4QE5A 1XIJA 3CXBA 3LUTA 3UETA 1NDZA 3RLHA 4K7ZA 1JD7A 5KVIA 1TPUA 4RPQA 3CL6A 3N2BA 1WDPA 3SJ3A 5LIKX 1PV8A 5D2YA 2R8WA 2GUUA 1C90A 1PWMA 3P84A 3QPEA 3DFTA 4GIEA 4QS5A 3IC9A 1M65A 3KE0A 2ZX5A 1FWIC 1WQ5A 3T4WA 2ZYFA 3D47A 3S4TA 4MNMA 3O0FA 4Z08A 2VKZG 1ZFJA 3RJXA 4IGHA 3ZO9A 2FDMA 2G3JA 4K3ZA 2HZGA 1JNDA 3EDKA 3E1F1 3ZMRA 7ENLA 4FDCB 2J74A 2VM8A 3MP3A 4KFOA 3G1AA 2D2JA 1KWKA 4Y96A 3T0CA 3MW7A 4LCSA 3VIKA 4RXGA 2PRLA 1BYCA 4DJFC 3GBEA 1STZA 4LF2A 2RDTA 2FPYA 4PR4A 4KRUA 1XSKA 4BQ2A 2A21A 3QR0A 4NIRA 2WJZA 3LY0A 1HL9A 4PRWA 1QI4A 4XD5A 4L6HA 4O17A 2QIWA 2CERA 3CZGA 1VCGA 1WYGA 3MU7A 2VUNA 1RR2A 1H60A 4E8DA 4U31A 1GESA 3EWWA 1V6YA 5LA2A 3DHUA 4IFRA 3I6RA 3GDLA 3MKCA 3WLIA 5AFDA 1U5JA 3L2IA 3FOKA 1TUFA 1O5XA 3AALA 4NYYA 1GRHA 2ZX7A 1IHIA 1UWIA 3MV11 1M5WA 1XX1A 3QKZA 3QMTA 5I24A 3QYSA 1RP9A 1NH6A 1S5MA 5EFDA 1XH2A 2A6LA 3M47A 4DX3A 1LCOA 1TRIA 3UZYA 5B7ZA 4WJEA 3H2OA 1J4EA 1VD6A 3IJ9A 1TMQA 2OYLA 4XQ6A 4LS1A 4DZ5A 1J0HA 3NL6A 1FHVA 4HZ8A 1GOOA 1UROA 2C1HA 1N8FA 1DXIA 1Q3NA 1Q4WA 4RCXA 4UTKA 1GHRA 3TEVA 3VD9A 4BK9A 4M7TA 1WDSA 3LX9A 2OELA 1NVMA 4AHPA 4IGMA 3V36A 2VRKA 3ITCA 4JYDA 4GI4A 3GAKA 4GZIA 1YHTA 4NY2A 1ADDA 3VKAA 4F9DA 2RH9A 3OZOA 1OT2A 2CDUA 1E4IA 1W31A 4CN4A 1SUXA 3W2KA 2ZCGA 3YPIA 4WXZA 4ES4A 1LUCA 2ZZ6A 1ISVA 4W8LA 1I45A 3F4WA 4PBFA 1BYBA 3KWSA 3CQJA 4C1NB 3K4DA 1BWKA 1UKTA 1JEHA 5ECVA 5I2UA 3WBXA 2FVLA 3GR4A 4Y7EA 3CUIA 1YDOA 4S3DA 5MF5A 1ZL1A 2G5WA 2UWFA 3VIFA 2DSZA 3RCYA 3U0HA 3KVLA 1E6QM 3CGBA 2D3LA 3VFLA 3P3BA 2F5ZA 5FS7A 5I03A 1IEWA 3LEPA 4ALDA 1XLCA 1K77A 4YL2A 3UEQA 1GWJA 3EKLA 2CLPA 4FXSA 4L9YA 2H90A 4QAWA 2FDSA 1NAL1 2WZHA 3T0DA 3PZUA 1M6JA 1G9HA 2HPIA 4NEWA 3S1VA 4IMCA 4AY7A 3BMXA 1V5XA 1PTAA 2W4XA 2GSHA 1ISXA 3UPBA 3BLFA 3FSTA 5PTDA 3CO4A 2VCBA 4D8AA 4RLIA 1K4HA 5AC5A 1BD0A 2QVNA 2DZPA 4O18A 4XSLA 3W76A 2INZA 1U22A 4UNKA 2E8ZA 3W75A 1J9YA 3M64A 4JCMA 3NVYB 3C3NA 4DAIA 2OJPA 4KFPA 1REQA 1CECA 2X1IA 2A79A 1ECQA 2Z1BA 4IQDA 3POCA 2WSQA 2QAPA 4Y9NA 3BK0A 2QJJA 4AFYA 4AZ5A 1FWHC 1XW8A 2VEIA 4EM4A 4QJ5B 1HF6A 2BB0A 4DEFA 4GKLA 2A8XA 1GYLA 1KXQA 4KCWA 1QVBA 5DFAA 1ZY9A 5H1WA 3KZPA 3W2LA 1PBGA 5T91A 3L8KA 1XSJA 3NL3A 3AZSA 4GKTA 4QJ4B 3UWQA 4NXSA 1ZBVA 3AXMA 2IXUA 1QXLA 5BROA 1O5RA 3MZNA 1AL8A 3LTSA 2OZ0A 5LHFA 5G5IA 3NVVB 4HHMA 1PJ9A 2V6OA 1Q5MA 4FX6M 1E6NA 2ZUNA 4C7DA 3S5SA 2FTPA 1MZRA 3EB4A 4LYQA 1CGYA 1L9WA 4ZQMA 1DWFM 1X7FA 1JVNA 2GQ3A 4DPQA 2ZTJA 3Q45A 5DT5A 2R82A 3Q94A 1OWQA 3HB9A 1JROA 3RPDA 3BE7A 4OOUA 2EKCA 1UH2A 3O6YX 2OR2A 5HUPA 5FJJA 3ZWSA 1E5JA 2WBKA 4H4UA 3DG3A 1CBGA 4XZWA 3MKVA 3RM8A 3WH5A 7PTDA 4ZENA 1BRLA 3EWZA 1GOWA 1YKWA 3DFHA 4J3WA 2G3NA 3HMJG 2ZBTA 3R5EA 4DWDA 4H9VA 5H8PA 1UCWA 1VBRA 3PR2A 4NAFA 4O16A 4M3PA 2E4TA 3QSRA 4JIHA 3W7NA 3AZRA 1JF5A 3CLMA 3L5AA 4HA1A 4RZ4A 4EOUA 3TZNA 4EXQA 4Z1YA 2VRQA 4EP8C 4HOWA 2HXUA 5HMEA 3ZM8A 1LRNA 1A5KC 2XGIA 1KTNA 3H23A 4X3ZA 1QW7A 5I7GA 1JGIA 1VZWA 3BCJA 3TU9A 1L0PA 3DJJA 2DSUA 4KCUA 4B5SA 4EAYA 2I5GA 4KCVA 1S2TA 2NSOA 4KBXA 4Y6GA 3GQYA 4LGXA 4XO6A 2HK1A 3WL0A 4NX5A 4DXXA 3MUXA 2GH5A 1C8XA 2AAMA 4PULA 5CAKA 3NQVA 3TN4A 3SGZA 1ISYA 4YVPA 1XH1A 2WHLA 4A4AA 2HMCA 1GG0A 3B0XA 3LS9A 3IIXA 1XQKA 5JIPA 3GH5A 4K1GA 4JQ2A 3IV8A 1FEAA 4MWAA 5CZKA 3M46A 2A7RA 4QE4A 3SN4A 3WEZA 3AIBA 1OK4A 5E0KA 3T7VA 1TTIA 2YW3A 5ABEA 2XIIA 4UTJA 2EQ9A 2VVSA 4ZTYA 3WJSA 5HNRA 4K8EA 6PTDA 3EDJA 1VJSA 1WZAA 1IWAA 4R88A 1RQBA 5AC4A 4UQ9A 1AD1A 4BZYA 4CNUA 4BV6A 3M0HA 2TRSA 3FAWA 4ZSUA 1DWAM 1J0ZA 5D9PA 3VGBA 3LCIA 1N8WA 3H53A 3B9EA 3DXIA 3GKFA 1FDYA 3RU8X 4HHHA 3VKCA 5K4ZA 1X8FA 3B8TA 4RV3A 3WLNA 3ABZA 5GNYA 1P0DA 1FWCC 3KX6A 2C0AA 3VKJA 4MAZA 3CWNA 4X60A 3T44A 3MANA 1XFCA 1OK6A 1ODUA 1X6NA 2ZX8A 3FY1A 3SSJA 3NQ2A 5F2LA 1QO2A 3I3EA 3P8IA 1WO2A 2GQWA 2V6AA 1SZGA 1G4SA 3NL2A 3MHFA 1H2JA 3LNMA 3AIUA 1EA0A 2KX9A 1GONA 5JIWA 2YA2A 3CHCA 3FK4A 1PPIA 4WR3A 1EX1A 5GNZA 2AMXA 3S1XA 1NTHA 1TX0A 3NQEA 4UTWA 3SEPA 4IIEA 5I23A 4E3VA 4HMNA 4TV5A 2AGTA 2OO6A 3OU8A 4TX9A 3EEGA 1JZ7A 2ZE3A 4YLWA 1R8LA 1KBLA 1FO4A 3OB8A 2FHCA 1W5QA 1KFEA 3BAKA 1DQWA 5DY3A 2VNCA 3T05A 3VDAA 1W5OA 4H83A 1HG3A 2OMAA 3E2RA 4IG2B 3LOTA 6ALDA 1BF6A 2DQWA 3ERPA 3WBWA 1HO1A 3A9IA 4UFJA 4L65A 1EQPA 4YS1A 2ZZCA 3T0BA 4F4RA 1U5HA 4W85A 3TAOA 3N29A 2XN2A 3W82A 1JZ3A 1V3JA 3LNPA 2XPKA 4DZIA 1OFAA 3QTGA 2BVTA 2DZUA 4TIMA 3TJ4A 1BKSA 3KVKA 1WDWA 4ZO9A 4YTUA 2BFGA 1MO9A 3STGA 3WLJA 1LYXA 4W93A 1XPGA 5EL1A 4GABA 2UV8G 1UR9A 2ZXQA 3V5OA 3N11A 3W7LA 2GOUA 5C55A 1BVNP 3LBCA 3AMCA 2NLYA 4AY1A 2ZOXA 1D3GA 3S9YA 4HZ6A 3TOYA 3WLOA 3WDIA 3D9XA 1EUNA 2XINA 1HJUA 3VDBA 4V1YA 4XUYA 3GB6A 4Q4KA 3V5FA 3P7YA 4R7WA 3DFYA 1XYBA 5DF0A 3ICJA 5FS9A 4GGHA 2WSRA 2XFRA 1UWSA 3LCWA 4OBSA 4UQBA 4Q8NA 2C1GA 1E4MM 3DYOA 3R1ZA 5F4SA 4YYFA 4MSSA 2AMGA 1JULA 5EBKA 4QHRA 2DY3A 3IAQA 2CYGA 4AF0B 1H4PA 2BHZA 4IL0A 3UG8A 5J04A 2NX9A 1WZLA 2A3CA 2I9EA 2PDMA 2PDNA 3HN3A 4KCTA 4KW2A 4IOTA 4O1CA 2E67A 1JRCA 2PWFA 4NAEB 3L4YA 4HTYA 3AM9A 1DQXA 2BZNA 3OVPA 2Y5JA 4FNPA 3LQGA 4S2CA 1ZJBA 4F3HA 1KGUA 3VD3A 2W62A 2BVYA 3EMCA 4KFNA 3L4UA 4LANA 4ML4A 3MMDA 3WLRA 4CQAA 4X63A 2XH7A 4ATDA 2OODA 4MWAE 2HPMA 3S6TA 3CS2A 2VFEA 1YNQA 2C18A 5K9CA 2E9LA 4HPHA 3P2VA 3VUSA 3I10A 3CLWA 4C6DA 1OZMA 4WSHA 4DNMA 3H2MA 2PWEA 3NZGA 4IHCA 1SO5A 1R3VA 2GZXA 4UTTC 2V38A 5DRCA 3U2EA 1OJXA 1UP2A 1EWDA 2I56A 4JX6A 3ZLGA 4O1FA 4H2CA 3N2TA 3K30A 2NVDA 2QAEA 4HHLA 1TB3A 4ZFMA 1HKJA 3ARZA 2E0PA 3LYEA 4PEKA 3DGBA 1WKFA 1O1ZA 3PB0A 4IPJA 2E25A 3QZEA 4S3GA 3NAVA 1THFD 4OV9A 5E70A 1I0DA 1WYIA 3WO8A 4YYCA 4LCQA 1H7OA 2VX7A 4Z1AA 2WMFA 4H4RA 1WUEA 1PKMA 2WMJA 4X22A 4GI8A 3ITVA 2ZUSA 4AX7A 3R8RA 3ZWTA 2F6UA 4O57A 3E5BA 3G5EA 5REQA 4NHVA 2ALRA 1EEXA 3L4TA 2OEKA 4C60A 1UOKA 3SQLA 3IJQA 1MEHA 4D1IA 4JN8A 3CT2A 2WC4A 1A5NC 1BSIA 2HNEA 3CT7A 4S2BA 1AMYA 1DVJA 5C7VA 3OZYA 4IM4A 1HJVA 4WX2A 1NY1A 1J5SA 2TYSA 3UBPC 3NG3A 3VILA 5M03A 4PUKA 2ZX9A 3TK7A 4C91A 4YWOA 1B3OA 3BAJA 1UP3A 1GQKA 1DBTA 1VCFA 1TPH1 3GE7A 2OT1A 2XH4A 2XZ9A 3P67A 4FLRA 2EAWA 3G1RA 4PMJA 1JL8A 2D2GA 2ZICA 3VDCA 5J8LA 2BXZA 1PZ1A 1XIEA 3G0UA 4AAJA 1RZMA 3R8HA 2Q8XA 3FVMA 1PEZA 2I14A 3R12A 3MV01 4LT9A 1GOMA 2A2IA 3MYPA 4CEUC 4YTQA 2CLEA 1JAEA 2Y1HA 1UQYA 5GJMA 1YXYA 3LB0A 1M01A 3B9OA 3SDOA 3ARYA 7TIMA 3MHUA 3NWRA 3UJEA 3FDGA 3MDUA 1V3LA 1CX9A 4GO8A 2P3EA 4S3KA 1QW8A 3RR4A 2R1LA 4W88A 4LUIA 4JZ5A 4DWSB 1YPFA 2O4QA 2C7FA 4Y9AA 3S2NA 2ZA2A 4LC8A 4NP7A 3S2JA 4ZE4A 4QLKA 3R94A 3WDQA 4O1AA 1KV5A 3OZMA 3CIVA 5HQEA 4QIUA 5FEZA 3V0UA 4DM1A 4LVDA 2YA1A 4N4PA 4H04A 1KM1A 4DWSD 3AI0A 1QNSA 3IJ7A 2CCRA 3OJGA 3DHDA 3SZ8A 3OHIA 4D6FA 1VAHA 3F5JA 1R6WA 3CMJA 2B7NA 5CLWA 1VF8A 2WVTA 1G4TA 2YQUA 2Z27A 2PEVA 2W5FA 3W7EA 3H7VA 3LV5A 2YLAA 4JBRA 2P0IA 1GNXA 2DSVA 3WJZA 4IMEA 4FALA 5IDZA 1F8MA 2QQ6A 2VEKA 3VYLA 4UZUA 3SECA 4JTGA 1VQTA 4LSBA 3F4VA 5DMNA 7REQB 3CYJA 4ZXOA 1E70M 4DO7A 3V35A 1A53A 1M03A 3BGJA 1H1ZA 2J88A 3A24A 3AHVA 4QG9A 4DO5A 3JZUA 3PNZA 4ZA0A 2J7HA 2JF6A 4O1DA 1IWPA 2NUXA 4HGXA 3KL3A 3FV9A 1B3WA 3M7SA 1B5TA 9CGTA 1EBDA 3ITTA 3BG5A 1YEYA 3UG3A 3MKKA 2W54A 3M9YA 4WKAA 2QMJA 4PH6A 2YA0A 2JALA 3BOXA 2OT0A 1E0TA 5CPNA 3CHEA 3A5VA 2YJQA 5CQ1A 3ID7A 3GNPA 3GNDA 1CXEA 1J79A 4D6CA 3PPGA 1EJTC 3FFSA 1VS1A 1VC4A 3B9JB 4GPNA 2GQ8A 3PSVA 4MWAD 3WNOA 3NA8A 2HQMA 3VAVA 3EDFA 4CCDA 2Q02A 2EG6A 2V67A 5A8NA 1MFUA 4B16A 1ZQ5A 3BWWA 1KW1A 4HU0A 3GVWA 4EF9A 5I0DA 4I5UA 5C5YA 4DYJA 1AW1A 3BPWA 3L2LA 4H7CA 3EBVA 1D7YA 3CUXA 3L67A 5ABFB 2QZRA 2DSKA 2CC0A 4JL1A 1JI2A 1CNVA 3R7MA 3WK3A 3UU0A 4LNYA 4RXFA 3W7IA 4AY8A 2J25A 3BLKA 5BYWA 2ZRVA 5CPLA 5CBJA 1OC7A 1VJZA 1RY8A 4AZ7A 2EG8A 3W7HA 4ZQPA 5C9UA 3Q58A 1FHDA 1M7JA 1D9EA 3STEA 3RYSA 3M1ZA 3WNKA 5CSYA 1LOQA 1XLBA 1CIUA 4YIWA 4S3CA 3CV6A 4K68A 3R10A 4V2XA 2CITA 2CLHA 5TF0A 3S2LA 1KD0A 2PGRA 3RRXA 4H4TA 4AZ6A 1QI3A 4KGLA 3UNTA 2J9YA 1UZ1A 3S9IA 2X2YA 2YPIA 2QCNA 2ASHA 1MXGA 2OEJA 1HZYA 3M0MA 3W6MA 4LUSB 4PSRA 1ZTVA 4DWSC 1Q6RA 5AYIA 1W1ZA 1XV8A 1V79A 1F74A 3ARUA 3CTTA 3GZAA 2AAQA 3KCLA 1O60A 1LQ2A 4APNA 2YKKA 1XCFA 2CPUA 2GFTA 4S3EA 3HZ3A 4MZYA 2R1MA 1R3SA 2BY3A 3L68A 1ONRA 1EH9A 1P48A 5FF3A 1UUMA 3L5LA 4NRSA 2JQXA 2PP3A 2QJIA 1JDAA 2XDFA 3AYSA 4UCFA 4HYVA 1WDQA 3VOGA 4MKVA 3DI0A 2BWGA 1W2VA 4JQ3A 1H5VA 1SJBA 4FI4A 4MNLA 1QO5A 3KHDA 4JTRA 1GUVA 3PFMA 3BCDA 1TJRA 2YBUA 2WJEA 2ON3A 4C1KA 3UGRA 5BOEA 3URBA 2GVEA 3ZYZA 5HBFA 4A6GA 3ARQA 5HJXA 5AHNA 1WOAA 2XIBA 4YPJA 1S2VA 3LXCA 1E73M 2C91A 4MY9A 1FOBA 4B4FA 4JQ4A 1I2RA 3MUY1 2VXNA 2PDIA 1YNPA 1KQZA 4HA0A 1BTMA 1E72M 4JICA 1PIIA 4U5KA 3LB8A 4H9ZA 1W9UA 2FJKA 3B03A 2VDGA 4U3AA 1LRTA 3GYCA 4FHAA 3M16A 4GLEA 2CZ5A 2CW6A 1WKDA 1VFMA 2MNRA 2BDQA 2X1UA 1ME9A 2J8TA 1JFHA 2D1ZA 3GHTA 5CJNA 4B91A 3TN6A 4PMQA 5A1AA 4FR6A 3TYZA 1UD2A 2LLEA 1AW2A 4QQUA 4PTDA 2GJPA 5BU6A 1Q6CA 4O0KA 2PDFA 3NTYA 2WP5A 5D9MA 1IR1A 4I6VA 1AQFA 4I5XA 4QXIA 3TN5A 3UA4A 2W9MA 3UNDA 1VYSX 1TTPA 1PIFA 5EKYA 3D3FA 4LAMA 4CD8A 3KAOA 3FLUA 5BOOA 1LT7A 1XM3A 3P60A 4AZGA 3C8NA 5JBDA 3SCOA 3B0YA 6A3HA 3UY8A 1RD5A 1V6VA 5C2XA 3SADA 1G1YA 4N9CA 3TLLA 1DKWA 1F05A 2OXNA 4EVZA 4B3LA 1QWKA 2PLMA 1HKWA 5HATA 2XFFA 3EOSA 4TO8A 4W9TA 2CETA 3NM1A 4LS2A 3WLTA 1FUYA 2BVDA 4A21A 1W1IE 3WMCA 3QMRA 3PAOA 3ZS4A 3B9DA 1CLVA 4LAKA 3NO3A 1E1FA 4GUJA 2D69A 2YCLA 4M7SA 4D6IA 4IPPA 1DE6A 4I8DA 2V2CA 2OG9A 3RGTA 4O8RA 4B5WA 5HWNA 4ATWA 3SCUA 2YGYA 3EMQA 1TPC1 4HVXA 3J7HA 4Q8VA 1ISWA 1YRRA 2O9PA 4R9OA 1ZSXA 3FG2P 2NWSA 3OVGA 4ZOCA 2ZUUA 3CWHA 1VRXA 1XINA 2OOFA 4GQBA 2QLYA 3IANA 1KFLA 3L21A 4HN8A 2DORA 3GFYA 5U7SA 4NYUA 3GW3A 4O14A 1IIGA 2AKZA 4PUDA 1B90A 4M8UA 1C7TA 3CPRA 3T4CA 3QF0A 2IKGA 1K9EA 1RJRA 3U7VA 4DYKA 4HB7A 1XYAA 4JKLA 3WH6A 4YTRA 2Y7FA 3H21A 3QGAC 3VI2A 2QPUA 2VT0A 3UZWA 3ZLFA 1RPXA 5HMSA 4UQEA 1E51A 4P8WA 3WJXA 1OINA 1PO9A 3W1TA 4U2ZA 1SJAA 3ITLA 3GIPA 3JS3A 4J7RA 4FP1A 4I3GA 2XWDA 1K1DA 3L0NA 1DHPA 3APGA 1B9ZA 2Y88A 3W02A 2Q71A 2R91A 2CZFA 4RNIA 3GRTA 2MUCA 3GD6A 1KV8A 2GDUA 3FA4A 3U2CA 2XN0A 1P7TA 1HL2A 1XLIA 3RXZA 1EJUC 4MADA 1UZDA 4F2BA 3GD4A 2TSYA 1PHQA 3HO8A 1JRBA 2E5BA 5DELA 4S3BA 2PI6A 3KOYA 1OBAA 3B0UX 1NDVA 2FZ9A 3WQFA 3EWUA 4PBGA 2ZZ7A 3WENA 2NQJA 3PTQA 3FSUA 1KTBA 1NJJA 4GJJA 3G3MA 3M0VA 4KERA 3VZYA 1PX4A 3WY1A 4ORMA 3TQ0A 4NJJA 2YDSA 5JCNA 4IIFA 2CNCA 2E5DA 1K9FA 3LBOA 5DXYA 2E68A 3REQB 3LDVA 4US5D 4MYAA 4CVUA 4H1ZA 4A22A 3DI1A 3WQVA 2CZDA 4JXCA 3CMFA 4JOMA 4H4PA 3VMOA 3OQ8A 2WQDA 3KP1A 1M41A 2WOQA 3SR6B 1PKLA 4KT2A 3MJMA 2QVHA 4UCGA 2F7FA 4F0HA 2BGSA 1VPXA 1XICA 3I65A 3SGGA 1VIZA 4OBRA 4RNHA 2P10A 3CL7A 4YCPA 3UVIA 2WM0A 4Q6XA 3B8WA 1KGXA 3A5FA 5F2GA 1RA0A 1Z69A 4GZ7A 4PGLA 5G5HB 1H41A 3MYOA 1OC5A 3WBYA 1H49A 4UTFA 1E0XA 3SN0A 2RGLA 2HK0A 5I00A 2BV9A 3C2YA 3NZPA 2BXYA 5CBBA 4C6NA 4FOJA 2FH6A 1T96A 1HIZA 1G5AA 1XRVA 2REQB 1XDIA 1QK0A 3GFXA 5HPCA 4XAPA 4LEQA 2NLIA 5LNSA 3CIXA 4PZVA 2GR1A 2EQ6A 3AHXA 2CBVA 1A4LA 3TLQA 4R3UA 1GQNA 1IIHA 4BWLA 1YADA 1C9WA 4XBKA 3CB3A 1PZ2A 2A3AA 1FWBC 4IMAA 5TR3A 3BLOA 5LYRA 5FJRA 3G18A 3IK2A 2QULA 3PHAA 1T6MA 2ISFA 3PZIA 4Q3MA 3CIWA 4KKXA 2BNJA 3PG9A 5BRQA 3W01A 2GUBA 1XIBA 1FH9A 2OQLA 3HM7A 1S2CA 3STCA 2G0WA 4IGSA 1ZAHA 1NP2A 2PRHA 1F3WA 3TNOA 2RDUA 3R79A 4GYJA 3QV6A 3NGFA 1QJWA 2GQ9A 2G41A 5A2AA 3ZT7A 1FWSA 4H6RA 5TAOA 3T78A 4IGNA 2W55A 3LHZA 3UPMA 1TWWA 1S2AA 2OX1A 2H8XA 5HA7A 1R7OA 2PDBA 3VNYA 3OZPA 1OX6A 4U5IA 5A6AA 2IKHA 3EKGA 1OSEA 3NQ8A 3EWYA 4ZBCA 5KZDA 3LK6A 3RM4A 5AYXA 3DAQA 1J0YA 3FW6A 2V3FA 4W7UA 4G8TA 3G24A 4C6EA 4IJCA 5D8WA 1LLWA 2B4GA 1W9XA 4PFHA 1GZ1A 2PE4A 3FJ4A 2DUZA 3NEHA 1YPXA 1PVNA 4GYKA 4KWWA 1PTDA 2FZNA 5F2IA 1A0DA 3MY9A 3GR7A 4J28A 1CLXA 3LMYA 4G7EA 3VNIA 4A8LA 1I6NA 2GDVA 2Z2BA 3KM8A 3Q65A 2VDIA 5CGQA 3AMZA 1I2NA 4L1XA 4PEEA 3KBWA 2ISVA 5BZAA 1Q85A 1UIOA 4XTIA 4RL3A 1KB3A 3D3AA 4DJDD 3S8HA 4DRSA 3PJWA 3DHFA 4XBJA 3S1UA 4DUXA 3NSXA 3UR7A 4WDXA 1KFJA 3GIYA 5L6UA 5RUBA 3W70A 3SUWA 1BG9A 2GJXA 3N3MA 2Q3RA 4AEFA 3HW2A 1DJWA 1DIKA 5FF2A 3M6DA 4ATLA 1TPWA 4B92A 3N2MA 2QKFA 1E15A 4HCDA 5AZ0A 4GZEA 3FGCB 6CGTA 3QV8A 3USZA 4CN1A 3ME3A 1LWHA 2EO7A 4KS0A 3GXFA 3W27A 5FEXA 2E3ZA 4PCSA 4QROA 2ISSA 1UR4A 3CHFA 3RLGA 3WZ0E 4UUIA 3PTKA 2X42A 1I75A 4ZR8A 4YCOA 1R3YA 3W74A 3WL1A 3RG6A 3IARA 5A8PA 3NPVA 2DT2A 4XKMA 3ARSA 1LG1A 1H0GA 2KZHA 1PYMA 3DH7A 2HJPA 1JCTA 3NPWA 2PA6A 2PTDA 4UR9A 2DJLA 5I3IA 1X39A 3N4EA 4GI9A 5G4WA 3VX1A 2TPRA 1BHGA 2DZVA 4L6OA 3PP7A 4UNLA 5GRTA 1CB2A 1P6BA 1JQXA 3ITXA 2NSXA 4ZODA 2HDJA 1XLFA 1XI3A 3TAKA 3OG3A 4ML9A 4GACA 2O9RA 4CQCA 4LBSA 4LUTA 4EMJA 4U3CA 2X0SA 5CG0A 3PZGA 3QR1A 2HS8A 3N25A 2YDRA 4B5VA 5BW6A 4KIEA 1XRTA 4XV0A 5E6YA 4WQ6A 2VZTA 1KBIA 3LXDA 1A47A 5E6ZA 1HTIA 5FD0A 3W23A 1D7KA 1W2PA 3CZJA 3RUBL 1QWGA 2P88A 4BI7A 1GYNA 3N15A 1N60C 3Q2DA 4Z2LA 3PJTA 3UVAA 1R7AA 3P82A 3W28A 4NZJA 1Q8AA 2YB1A 1XS2A 1K4GA 1EC8A 3LHYA 4OBTA 3KL5A 4KMQA 1AODA 4LQ1A 1OX5A 1GZGA 1E55A 1XQLA 4D72A 1NARA 1Y8BA 1KLYA 4X0NA 4LRSA 2Z7KA 2WPBA 4OQVA 2I9UA 1GK8A 1EDGA 3CGEA 2YR1A 4AYSA 4EXBA 1V8EA 3HFTA 3W1NA 1SFJA 2EJAA 3LXBA 2WCSA 3W6LA 3KUMA 3PZTA 3KBJA 2QUMA 3NOYA 5EPDA 4E2DA 1B4KA 3EX4A 3LCGA 3SGUA 3TROA 1V03A 2QJMA 4PSPA 3C2OA 4H4QA 2EXOA 3BV4A 3LHTA 3I7RA 1DIEA 1RBAA 4GE8A 4RPPA 5FOOA 4O52A 3PTDA 4R7OA 3D6NA 3DIPA 3E74A 5M5DA 4C6FA 1K6AA 1GOKA 2IUZA 4LWWA 3TOPA 1YLVA 2EPLX 3NR0A 4XTDA 2YB4A 3RPTA 1H1YA 1XIFA 3DFSA 4DBWA 3HIJA 2HVNA 2PFHA 1DWGM 3KLKA 2PU1A 3ZFHA 4DJDC 1J5TA 1I8JA 2VEPA 4CCCA 3QQWA 4HN4A 1DL3A 4HHPA 2X7VA 3DK8A 2PLJA 2NXIA 2NXGA 2Z0IA 3RRAA 5AYBA 5LHEA 1EGMA 4O0QA 3LPGA 1D8CA 3KEHA 1JJKA 3VC6A 1QT1A 4C5YA 1NM9A 4L4MA 5HWMA 1E40A 4QSFA 5DMYA 1PE1A 4DJFA 1ZHAA 3AIRA 5G4EA 5HANA 4WF7A 5D33A 1XDLA 4PMNA 4EIVA 2Y6ZA 2W0HA 3EA1A 1KO0A 1M9HA 3W1MA 5G4HC 2ZXAA 3RR1A 3HPZA 4JQAA 3D0CA 1A80A 3I3DA 1KFBA 2FMNA 3A64A 2QGYA 4J56A 1EXBA 4HNVA 8XIAA 3SQSA 5DXXA 3LCXA 4QS6A 1TV3A 3L4ZA 3F5KA 3GDKA 1K70A 2PDYA 2X0YA 2P50A 1FP8A 2E77A 3NQ7A 4DIAA 1HXJA 2YDAA 3C0LA 4J1OA 5A6BA 3GXIA 2V5LA 3KZSA 4IICA 1DP0A 1S5VA 3OO2A 5JVLA 3DERA 1KR1A 4H9YA 4NAFB 1RSCA 1VB9A 3LENA 4DB7A 2RJHA 5D9NA 3WDRA 5CJMA 3VFCA 1TPFA 1OT1A 3CV7A 3H26A 1R86A 2O4MA 2Q8LA 4NI8A 3LZ5A 4H4YA 5B7YA 5JUVA 2J77A 4QJ1A 1GQIA 3DGRA 4PCNA 3SUUA 2DUXA 4XZHA 1R2RA 2XH0A 3L9CA 3USBA 4ZL1A 3WLKX 1DIOA 1TKKA 2BTMA 3HG5A 3HPAA 3MJYA 4XWUA 5D03A 3UYCA 3AYRA 4M24A 2WMIB 5EA9A 2V63A 1TWSA 5FS8A 4LV9A 3GW0A 3DK9A 5L9FA 1QNOA 2Q6ZA 4JEQA 4KIRA 1UD3A 5AC8A 4Q4PA 1TZ7A 2VURA 1ML1A 1GVSA 4S3FA 4KWUA 3GHUA 3P5YA 1I0BA 5D2TA 2XG9A 4Q4RA 4X61A 2ZZ3A 1V77A 3L0GA 4IMDA 5FS6A 1FKWA 1KRBC 3ZSTA 3QKEA 2ABAA 1IEXA 4F66A 1W9VA 3NDYA 1BFNA 3G77A 5CZJA 5U1OA 2GK1A 1IZJA 4F2UA 4JTTA 2DW7A 4AU0A 2GJNA 5A6TC 2VEGA 4DLFA 4Z0SA 2Z00A 1FH8A 3NQBA 1VFLA 1O5QA 4ORIA 4ZXLA 3GTNA 3HPXA 3NO1A 1B30A 4HKPA 5DO8A 4H4VA 4L7ZA 2H8ZA 2PZ0A 4HU8A 1GVYA 2HV5A 2GVJA 1H09A 3SIMA 4B5UA 2OVLA 2Q01A 2ZUTA 3AMGA 2XWEA 1DJHA 3W1XA 2ZZ4A 4MKNA 4Q32A 2VGBA 3G0SA 3OW1A 4LAZA 4W5UA 4D1JA 1TE1A 4P7NA 1SB3B 4QJ3B 1YMYA 3OYZA 3GG7A 1IT7A 4JTSA 1A49A 1GKPA 1ZCCA 2WZIA 4WSJA 2DV0A 3ITGA 1K8YA 3QBUA 1UUQA 2Z6IA 3RFAA 4S1FA 2PD5A 4Y90A 4IIBA 2VDHA 2E6DA 3TWBA 3VXGA 3VCCA 1YE6A 1EBGA 1JCNA 4QX4A 4XZ9A 2WOVA 4J5NA 1YX1A 2D0HA 3I3BA 3SR7A 3TUUA 4DN1A 4Y9MA 1XRSA 2ZZ5A 1V6TA 1QASA 3AXIA 3N9RA 4F40A 2NV1A 2R1PA 3R25A 1AW5A 4AISA 3TVAA 1GKRA 2WC3A 3WNNA 4PUWA 5A95A 5A8QA 1SZNA 4E8CA 2VENA 1GSNA 4YTSA 5D2VA 3INPA 5EU9A 3S83A 3W38A 2QNEA 3OBEA 4OGZA 2WKLA 3O6CA 2X8CA 5CC7A 1MEIA 3AHYA 4J3XA 2JBMA 1L6YA 4FF7A 2DFAA 3L65A 5A6JA 2DW6A 1OZQA 2X50A 1JF6A 1UIPA 3GVGA 3SW6A 4LCRA 1NPXA 1RQEA 2R24A 3VGDA 4UTUA 1UA7A 1N62C 3GUWA 3TQVA 2X1RA 5AY7A 3W7GA 2BOEX 1KCZA 4TV6A 1T99A 3FCPA 1YTDA 3MI6A 2VZVA 1KA9F 4UMCA 1BVWA 2YXOA 1FY6A 4BKNA 1W54A 1EYEA 1B57A 2EPNA 5DCEA 4LUJA 4E8GA 2OU4A 4WRHA 3RDKA 2CXGA 1YPIA 3OLIA 4WD0A 2A7PA 4XISA 1NIUA 3UT0A 1BG4A 5LNUA 1SJDA 1PUDA 1GOQA 3OBKA 2O9OA 1OD0A 3LLFA 3U4AA 3VNZA 4AZCB 4FNSA 2QEZA 3TJIA 1MW1A 2C16A 4H2HA 4J4KA 1OF6A 5EMJA 5CXPA 2D23A 4N42A 4GCAA 1CXHA 2J47A 2QMKA 3TC7A 1SPQA 4JTCA 4AWSA 1TJPA 1ECEA 3DG6A 3VM5A 1E6ZA 4XZBA 4MTVA 1XUZA 3C6CA 3BAWA 3KTCA 3FX4A 3M7WA 1JOAA 1DHKA 3IK4A 1WX0A 2WSPA 2YFNA 3P80A 1LTDA 4MJMA 2RDWA 1GCYA 2WVUA 3BGGA 3LGDA 3QSTA 3BG3A 4L1GA 2Y85A 3PUDA 1EJSC 1A0EA 1Z6KA 1P43A 3CB8A 1W3TA 4C1NA 4BF7A 1UR8A 1EF2A 2J7DA 1UPPA 3GY1A 4LA1A 1GVFA 1AH4A 4RUBA 3G3DA 2C14A 2FH8A 4D2JA 3FVDA 3SCPA 3C5QA 2HBVA 4JPGA 1C93A 3PNUA 3UCQA 1J18A 2QUUA 1VEPA 1VHNA 4FNRA 3IV3A 3AS1A 1ZZMA 4MFDA 1GT8A 3TTQA 1FWEC 3T2PA 4MPKA 4WY0B 1E9IA 1AOGA 2X1SA 3S5YA 3UGVA 1ZX9A 4OTKA 1EJWC 4XZNX 3WNLA 1YYAA 3WQ8A 5IHSA 1ADOA 3CL8A 1SFSA 1EGZA 1CDGA 4DF2A 1F3TA 1I1XA 4TVCA 1BEUA 2NZLA 2DQXA 1TV7A 4IQLA 1V4YA 1ZU8A 5SWUA 4KPRA 3STPA 1YQ2A 3W1QA 4K8DA 3LBMA 4Q8PA 1VFHA 3Q67A 4PN2A 1KM5A 1PS9A 1Q7ZA 1K9TA 1V3KA 2FZBA 1ITUA 1NFPA 4BI6A 3MSDA 3A7RA 3QFEA 3LU2A 4CKQA 1PDZA 4FS9A 1I9CB 2PC8A 1N8IA 4OFCA 1HKKA 4HK7A 4ERGA 3AJXA 2DU2A 3P93A 3IUIA 4MAVA 2V30A 3NQ6A 1EJVC 3FYOA 4AB4A 1A5UA 2OLAA 3G1YA 3NO5A 4GR1A 5K7JA 3DBPA 2E9MA 3UCDA 7A3HA 4J3UA 4NJGA 4JFWA 4QNWA 1LORA 1MVYA 4B3ZA 3KWXA 5AOUA 4N9DA 5BU9A 5K4XA 2VR2A 4HSHA 2VGGA 3IVSA 4L4PA 3C8FA 3WD0A 3V0TA 3NVWB 1L6GA 3WQ4A 2I7GA 1KLZA 2QCEA 1EC9A 1HKVA 1KBJA 1V51A 3UERA 5A2BA 3C0QA 4Q4MA 4C6JA 1BXBA 1X98A 3H7RA 3R0UA 4JNZA 4PMYA 1JFXA 1UD6A 3TONA 1Q45A 3RLUA 3MO7A 3TYCA 5HJYA 3QY8A 1NHQA 5D9OA 1E1CB 1QPKA 2J3NA 1QW9A 1PL9A 2R1NA 3RCNA 3VCNA 1LQAA 4ERAA 3WJWA 1FA2A 4PRTA 1NHRA 1SFLA 5FSDC 4GCXA 4K2SA 3GXMA 3S0CA 4OT7A 1H7XA 3UR2A 1S38A 2P0OA 4RNJA 1R9ZA 1TJ0A 1Q13A 5CSSA 3A7UA 4W7WA 3Q4DA 4JNMA 4IFKB 3HV8A 1W1YA 3W73A