3ZVHA

Methylaspartate ammonia lyase from clostridium tetanomorphum mutant q73a
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
415
structure length
414
Chain Sequence
MKIVDVLCTPGLTGFYFDDQRAIKKGAGHDGFTYTGSTVTEGFTQVRQKGESISVLLVLEDGQVAHGDCAAVAYSGAGGRDPLFLAKDFIPVIEKEIAPKLIGREITNFKPMAEEFDKMTVNGNRLHTAIRYGITQAILDAVAKTRKVTMAEVIRDEYNPGAEINAVPVFAQSGDDRYDNVDKMIIKEADVLPHALINNVEEKLGLKGEKLLEYVKWLRDRIIKLRVREDYAPIFHIDVYGTIGAAFDVDIKAMADYIQTLAEAAKPFHLRIEGPMDVEDRQKQMEAMRDLRAELDGRGVDAELVADEWCNTVEDVKFFTDNKAGHMVQIKTPDLGGVNNIADAIMYCKANGMGAYCGGTNETNRSAEVTTNIGMACGARQVLAKPGMGVDEGMMIVKNEMNRVLALVGRRKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering Methylaspartate Ammonia Lyase for the Asymmetric Synthesis of Unnatural Amino Acids.
pubmed doi rcsb
source organism Clostridium tetanomorphum
molecule tags Lyase
molecule keywords METHYLASPARTATE AMMONIA-LYASE
total genus 158
structure length 414
sequence length 415
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
A PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3zvhA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3zvhA01
3I6TA 3SJNA 3PWGA 3PK7A 4DYEA 2XSXA 3P3BA 3BJSA 3T8QA 2P8CA 1IYXA 4IHCA 3QN3A 3OW1A 1SJAA 3I6EA 1W6TA 3NZGA 4JN7A 3CYJA 3BOXA 3IJLA 3TWBA 4K8GA 3U4FA 3STPA 2AL2A 3SN1A 1WUFA 3IJQA 3MKCA 4GGBA 3VCNA 4IP5A 4JN8A 2PP3A 3FXGA 3FVDA 4A6GA 2GGJA 3GY1A 2FKPA 3P93A 3QTPA 3MQTA 4HN8A 3UGVA 2PTYA 3IJIA 4GFIA 3TCSA 2PU0A 2I5QA 3R10A 3FYYA 1BKHA 3DERA 4FP1A 2MUCA 1ECQA 4HCLA 4Z17A 3OTRA 2XH0A 4K1WA 3RCYA 4E6MA 2PU1A 3IK4A 2PCEA 3ZLFA 4G7FA 4IL2A 2QDDA 3TTEA 3H7VA 3DESA 3VA8A 2P88A 3RRAA 3UXLA 1SJBA 1BQGA 2PSNA 4HCHA 2QVHA 3KUMA 3SBFA 2OZTA 1NELA 1EC7A 3FCPA 4IT1A 3UJRA 1SJCA 1JCTA 1FHUA 2OG9A 2AL2B 4E4FA 3U9IA 2ZC8A 3JZUA 2OFJA 4J1OA 4DN1A 2PTZA 3OP2A 2QJJA 4IL0A 3QLDA 3JVAA 3TJ4A 3TOYA 3FV9A 4HYRA 4A35A 1NU5A 3ZVHB 3SSZA 1FHVA 2QDEA 2HZGA 3THUA 3OZMA 6ENLA 1EBGA 2OO6A 4M0XA 2P8BA 4GYPC 3SN4A 4HNLA 4E8GA 4M6UA 1MUCA 3RR1A 3V5FA 3R11A 1KKRA 1PDYA 2GDQA 3TJIA 2ZADA 3DG7A 4Z1YA 3GO2A 1EC9A 1MRAA 3GD6A 4ENLA 4GISA 2PODA 3DFYA 3R1ZA 4HPNA 2GL5A 3T6CA 3RGTA 4YWSA 3DG3A 4H2HA 2DW6A 4GMEA 2O56A 3CB3A 2OQHA 4DX3A 3H70A 1SJDA 3MZNA 1XPYA 3H12A 4F4RA 4H19A 3DIPA 3V5CA 4G8TA 4A3RA 1TKKA 3ES8A 1JPMA 1MDLA 1WUEA 4KWSA 2OLAA 3ENLA 1ONEA 3QKEA 3R0KA 3VC5A 2XH4A 3EEZA 2P3ZA 2XH7A 4E5TA 2PA6A 5BOFA 3CT2A 2OKTA 5IDZA 1KKOA 4ZCWA 3ES7A 4FI4A 3DEQA 3MY9A 3PFRA 2AKZA 3I4KA 1TE6A 1YEYA 3CK5A 1EBHA 2HNEA 3P0WA 3SN0A 3DGBA 2OVLA 4HNCA 3H8AA 7ENLA 3TWAA 4IP4A 4IZGA 3VFCA 2NQLA 2OQYA 3V3WA 1KD0A 4HCDA 2AL1A 5FJPA 1RVKA 1XS2A 2DW7A 3UJEA 2GGIA 3R0UA 3ZLGA 3D46A 4H1ZA 3Q4DA 5J04A 1DTNA 4ROPA 3VCCA 4MGGA 1E9IA 3HPFA 3RO6A 3EKGA 4DHGA 3D47A 2QGYA 3SQSA 5ENLA 3MSYA 5FJOA 1MDRA 2XGZA 3UXKA 5FJRA 3S47A 3K1GA 2ONEA 3T9PA 5EU9A 4GGHA 2POZA 3UJSA 2FYMA 3UCCA 1ELSA 3FJ4A 4E4UA 1R6WA 1R0MA 3N4FA 3MWCA 3NFUA 2PPGA 3S5SA 2MNRA 2PP1A 3NO1A 2GSHA 2PMQA 3BSMA 2GGGA 3CXOA 2PGEA 2QQ6A 3OPSA 4H83A 2XH2A 4ZA0A 3UJ2A 3GC2A 3DG6A 3PWIA 2PS2A 2GGHA 3QPEA 3V4BA 3TQPA 4KT2A 3N6JA 1PDZA 1JDFA 4DWDA 2PP0A 3DFHA 3CAWA 3N4EA 3MUCA 5BOEA 3Q45A 3R25A 2HXTA 4MKSA 3JW7A 3UCDA 1KCZA 5FJTA 1TZZA 5FJUA 1P43A 3ZLHA 1F9CA 2OZ8A 2PGWA 2P0IA 2OZ3A 4JHMA 1P48A 2PTWA 3B97A 3RITA 2QJNA 2OX4A 2RDXA 1OEPA 4KEMA 1MNSA 3NXLA 2AKMA 1L8PA 4MMWA 2OPJA 2QJMA 3ZVHA 3DDMA 2CHRA 4DXKA 4GYPA 3OZYA 3ZVIA 4GIRA 3T4WA 2PTXA 3UJFA 3VC6A 3VDGA 4J3ZA 3TW9A 4X2PA 3N6HA 1JPDX 4EWJA 1EC8A 2HXUA 4K2SA 4KPLA 2GGEA
chains in the Genus database with same CATH superfamily
1XBXA 4HU0A 4P5UA 2XSXA 5BXRA 3Q65A 4GQGA 4XBSA 1W31A 2NPXA 2XM2A 1KBIA 1I2QA 3BOXA 4H9YA 2PZNA 3GTHA 2ANUA 3Q2DA 5I6SA 4J3UA 5BXPA 5FEZA 3HBLA 2HV5A 1N60C 1KQYA 3M9YA 3SRHA 3QY7A 1BF2A 4NXSA 2VURA 3VIJA 3GY1A 3WDPP 4FXFA 2V3EA 2I5GA 3DYOA 3WD0A 3RUBL 1EYEA 5H6HA 3MJYA 2CZDA 2X0YA 1E6PA 4JIQA 3CQ0A 4XG1A 4HK6A 4KPRA 1Z69A 1CB2A 2QGHA 1ZP3A 1F3EA 1Z8AA 2PU0A 1UR2A 3UZ5A 4GR1A 1M3UA 2PDLA 4LYRA 1JPKA 2G97A 4PA8A 4W7UA 4E6MA 2W54A 4IL2A 4GHRA 3M0IA 3CQHA 3VA8A 4HYWA 4PGLA 4NEVA 4S3FA 1MW3A 4R5EA 5GJMA 1EC7A 3EAOA 4NF7A 5EB8A 3QC3A 2PI6A 3G1RA 1ZCOA 1DXIA 3U5YA 2AL2B 3PTKA 4IMDA 4M52A 3CV6A 3M41A 2WOIA 1CXLA 3LXBA 3LCWA 3SADA 1A5BA 2QXWA 1EQCA 2CYGA 1FH7A 3QPZA 1WA3A 4I8DA 3QEZA 5BYWA 1A5UA 1FFQA 1TX0A 5KVHA 1FKXA 4AUBA 3L4XA 4M0XA 1VGAA 3P5ZA 4KRZA 3N17A 4ECLA 4B3KA 4ES4A 4LCSA 1LRQA 3GKAA 4Y2WA 1HP4A 1VKFA 5D2TA 4D6DA 4IH3A 3Q6JA 3IUHA 4ATDA 3S1XA 1E72M 4ZENA 3WBEA 3ZMRA 2H90A 1Z9AA 2NV1A 4N02A 3BCJA 4O4WA 5FS6A 3SSJA 3KCOA 3B0YA 3GXIA 3T6CA 2DSWA 1JFHA 1MFUA 5BWAA 4JFTA 4HPJA 1KNWA 3N11A 1SO3A 3VCRA 4YYFA 5HINA 4EVZA 3G0SA 3A4XA 5EMJA 1H2IA 2RFGA 4WEVX 1PTGA 2A7NA 5F4XA 4HA1A 4O54A 1G69A 1UQZA 1SW7A 4KRTA 1K02A 3BQ6A 4TR9A 4ASTA 2Y6ZA 2P10A 3GXMA 3DIPA 2GLKA 2JKAA 1V3JA 2XGIA 1IXOA 3RX2A 2OSYA 2VNCA 5T9CE 3TW7A 1PO9A 1CGWA 1RQBA 3OBEA 1MVYA 4GBDA 3WDIA 1W1IE 1XHGA 2ZTKA 3HGRA 4HJFA 3R0KA 1R86A 4PSPA 3RX4A 2Q09A 1PIIA 2QCDA 1VQZA 2OX1A 5K4XA 3GBDA 2ZZ1A 4NAEB 3W4RA 2UBPC 3C2VA 5BOFA 2C7FA 4D6FA 4H4PA 4D1IA 5I24A 2HRWA 2G95A 4ZR8A 1SSDA 4DZAA 4ZCWA 1HXJA 4NZFA 2ZRZA 3MY9A 3BL3A 4HTBA 1ZDLA 3EMZA 1TE6A 3WX7A 1AW5A 2GQ8A 4JTJA 4HHHA 2E77A 3R5EA 4UTJA 3CT7A 5HQMA 4TVYA 2G3MA 5EMUA 4R88A 1K8XA 2QMJA 4J2PA 4PL2A 3D5HA 3WD3A 5D2XA 4MPKA 1XGDA 1CX9A 1RVKA 3PZQA 5HNNA 3TJXA 1UW9A 1FQ0A 4ZOAA 3AO0A 5ABFB 4GRTA 4HA3A 1MQQA 4FX9A 4LOCA 3WIJA 1E9IA 3IIXA 3AXKA 3BAXA 3POCA 4N4QA 3PB0A 2NQZA 2VL4A 4UXDA 2XVLA 3VD7A 5EGRA 1QNVA 4EMJA 1KQZA 3GH7A 1KTBA 3AXMA 5U1OA 2GR1A 4UBPC 5CEWA 2Z28A 1XYCA 3ZT6A 1UWTA 3ZR6A 1U33A 4GGHA 3GNDA 5EMMA 4AX7A 5LXEA 2FHFA 4X9SA 3H4WA 1OCBA 2FLIA 1HW6A 2A6LA 3FS2A 2ZC1A 2E1WA 1P7TB 4BQ2A 1W91A 3GVGA 1R0MA 1C9WA 3THCA 1V51A 3KAOA 1IZCA 3W23A 3E2QA 3GD3A 3WQ6A 2D0HA 3W1QA 2E5BA 4LCQA 2QUVA 2V2HA 5AHMA 2Z26A 5BCAA 3VOHA 1MI3A 1LBLA 5K4ZA 3C52A 1I0BA 4NQ1A 4TX9A 3MPGA 4MM1A 5E0KA 4KCUA 3QYQA 1H1NA 5BRQA 3DK9A 2WWCA 5D8ZA 3W84A 3WMBA 4JX4A 2WMKA 1W37A 3FAXA 3G0UA 3XINA 3LNMA 1KCZA 3OZOA 5FJTA 5HA7A 1G6CA 3PZOA 5REQA 1F9CA 2PDIA 1GNXA 3U5UA 4YVVA 2BASA 5D9MA 3TE9A 1A5LC 4Q32A 1E40A 3AROA 5I02A 1AOGA 3KZSA 1R7AA 3IV8A 4MWAA 3E2RA 2ZUMA 1MFVA 2ZDSA 4R27A 5H8UA 3H22A 3LHTA 2VELA 4HMNA 2DSVA 5CZ0A 2F6KA 4I3GA 4CCZA 3UWZA 3FKRA 4A8LA 3HFYA 4EWJA 1PWMA 4EAYA 2V38A 1OABA 4Z1BA 4D6EA 4UOJA 3VUPA 4ACZA 3Q94A 4M19A 3W2NA 5U25A 3SFWA 3ZWSA 3UESA 2ZUNA 4NKCA 3M6YA 1S3HA 2QV4A 2CHNA 4B5XA 1XLKA 1AZ2A 1TQXA 4C6MA 3VPLA 1RD6A 3C3NA 5A8GA 3G0XA 2WCSA 3FDKA 1SM9A 5E0FA 4XO6A 4BWLC 4KETA 2E09A 5CAHA 4JHOA 1DJHA 4A21A 4TTGA 4LUTA 4UB9A 3NVWB 2BOFX 3QTGA 3LBOA 2WSPA 5J5RA 5MKGB 5E5CA 3TYUA 3W1NA 3KTCA 4FAMA 3VNZA 2GGJA 4GUFA 1IWBA 3PN8A 2FKPA 4Q8QA 3VXGA 3QTPA 3UYCA 5C2CA 1E6NA 3QGAC 1R2SA 4H8VA 3QV8A 4B5SA 1PVNA 2W3ZA 3TCSA 1D3HA 3TUUA 3UXAA 2XVNA 2CLIA 3OTRA 1NDAA 2OMAA 3IJ7A 4JD4A 4FNPA 1YHTA 4DQWA 5KZMA 1XBZA 2V68A 3ARUA 1ZSXA 4Q8TA 2HK1A 4BZYA 1Z42A 3B8SA 4KWWA 1SZFA 3ANYA 1X98A 2CZFA 1ISYA 1N7KA 3GRSA 3M0MA 3P67A 3WQ5A 4LAMA 1MEWA 2V5DA 3UJRA 5I78A 5I06A 4LJ3A 1C29A 2NQ5A 1UPPA 4DO5A 2YA0A 3PF3A 2WZTA 2OOGA 1KM6A 1F5ZA 2JEPA 2PLMA 4OJYA 3BCFA 2XVKA 1MOKA 4DF2A 5EL1A 4CNPA 1OF6A 2JBMA 4HU4A 4LS1A 4A35A 3VGHA 2J77A 3TDFA 4DJDC 3CM4A 2PUZA 1ZMDA 3IRSA 2C8NA 1Q13A 4ZQMA 1JNEA 4BF7A 3N2XA 4REQA 2VQUA 1EJ7L 1MUCA 3H26A 2G50A 3NWRA 3TJIA 2ISVA 3P5YA 2BVTA 1J79A 3TTOA 1ZJIA 1G67A 5I09A 3ALFA 1K1DA 2DQWA 1FHDA 4AZHA 2WVVB 2GL5A 1J8VA 2QULA 4X60A 4IJCA 1X6UA 2ZBTA 4QQUA 1R3RA 3ZJ7A 3M44A 1L6FA 1VQTA 1U30A 2C1IA 1SSGA 1FCVA 4AMAA 3WLMA 3S1VA 1SO5A 4JPGA 3H23A 4PMNA 2XFFA 1BRLB 4BA0A 1ZENA 5HPOA 1V0MA 1IR2A 2Q02A 3ABOA 3W87A 3G5EA 4ZQPA 4O17A 2XH4A 4H4WA 4JTTA 1CECA 4MWAE 3EEZA 5FEXA 4QSFA 5HJYA 3MHFA 5AC4A 4IMFA 3EDDA 3NL3A 1DJZA 1F74A 3N19B 5REQB 1DBTA 3HIJA 3TNOA 2PGFA 1EGMA 2WNQA 4Q6JA 3WFLA 1SFTA 4ZQCA 4Y9NA 3UVIA 1FTXA 2OVLA 1BF6A 3WCZA 2WQDA 4NZCA 1US2A 4Y9OA 2Z00A 2R1PA 1QI5A 4B5TA 1F8WA 3CZGA 4GBUA 2WM1A 2FPVA 5HQEA 5AY7A 1OJXA 3MI2A 3UJEA 1FVPA 4NZ1A 4NX5A 5ECVA 3WK1A 3OLDA 3LTSA 4H1ZA 4JS3A 1BZLA 5HNTA 7REQA 3NSNA 1TV4A 3KBNA 4O0KA 1JXJA 1KBLA 2VO5A 2OSXA 3AQUA 5E93A 1KW1A 3RK8A 4RV8A 2Y61A 5GNYA 1B90A 4HU8A 4IUOA 4GNKB 3HPZA 3PUEA 2C79A 1XLIA 3GNPA 3AFBA 2F2HA 3IWPA 1TV2A 7XIMA 5JQ9A 1SZRA 2D2JA 4RXGA 4CKQA 2PE4A 4KWOA 4R7OA 3LLFA 1Q2SA 3CAQA 8CGTA 2Q6ZA 3MZ2A 3O16A 4L1XA 1KRMA 4RX0A 2CW6A 3H4XA 3EXSA 4J57A 3CUFA 3GX9A 3WNPA 4J28A 2DJLA 2CWXA 2Z1SA 3EKLA 2CNCA 4LUSB 1BXBA 2AQOA 1V59A 3EA3A 3GDKA 3QR0A 3S83A 1O12A 3OPSA 1YYAA 3MSGA 4PMYA 3W7DA 1FCUA 2Y70A 4RDVA 1V02E 1QOPA 4EXQA 2FJKA 2PC4A 5AHNA 4F8XA 4HJWA 1H7PA 4Q4KA 5CCZA 1OC7A 4RZ6A 3HB9A 2Q71A 4YWIA 2IQTA 3DFHA 4DJFA 3SRFA 3GC5A 3N4EA 2FZNA 3H7UA 5I03A 3VIOA 3USZA 2WBKA 3KOYA 4D71A 4MB5A 2P50A 1FHLA 2ZZ3A 3S1GA 3JW7A 4FX6M 4QLLA 1XKJA 3AMZA 2J6VA 3KS5A 1HNYA 4XZBA 2FVKA 1QNQA 5C6MA 1P0NA 3GU2A 1P48A 4DJDD 1TWIA 4YXGA 2BZNA 2V5KA 3WEMA 1X7IA 1PTDA 2XIIA 4FIQA 2E1DA 2ZZ4A 4CQCA 3TROA 2PWVA 1F6YA 4FEZA 1FRBA 1BG9A 1CXIA 4PTWA 1RK6A 3GHSA 1PV8A 3N1AA 4H6QA 1NP2A 3KW3A 3M0XA 3OO2A 4FNTA 1KO0A 4WF7A 4YS1A 2DZXA 1J93A 4HGXA 5I79A 1Q66A 5G5IA 3MSRA 3IJ8A 3ZIZA 3HO8A 1T8XA 4S3DA 1QPQA 3PK7A 2QIWA 1A5NC 1IIHA 4TX8A 4EMWA 1TV3A 3SB0A 4JFVA 2Y5JA 1TRDA 2PDUA 1PX8A 4AC1X 3B9DA 4AD1A 5T9BG 3VI2A 3W6YA 5TNVA 2FDMA 2AQWA 4CU7A 4K8GA 3WSUA 2WYSA 2L5HA 4C7DA 5TQLA 3STPA 3WO8A 2F5ZA 3A3WA 2CC0A 1HG3A 2J4GA 3PPGA 3A21A 1LPFA 5HK4A 1XYFA 3RMJA 2DQXA 4Q8UA 1KM4A 1GVQA 1M65A 3L65A 2OWXA 5D38A 2Q8LA 1BEUA 3UFYA 3CZLA 1TVPA 2XZ7A 1JZ2A 4O50A 2GR3A 5A6KA 3SCRA 5A6AA 1TCMA 1R5YA 2NSXA 3W1RA 4HZ6A 3BOLA 1KFJA 4KMQA 5HMFA 2D69A 5DXXA 3NZRA 4GA8A 1S2WA 4AB4A 2VP8A 1FKWA 3N14A 1CDGA 4JOMA 4OHQA 2V30A 1UR4A 1P1MA 3LXCA 1LF1A 2W5FA 1A5OC 5DLCA 1BGAA 1M6JA 2CBIA 2OO0A 4ZO7A 2PU1A 3P84A 2BC0A 1H5VA 2YCIX 3KWSA 3LB0A 4IFOA 4BCEA 3DFOA 2QIIA 2CZEA 3Q58A 3TV8A 2WP6A 4XIAA 3PR2A 3WFAA 4TV5A 3RYSA 4E2DA 3CEPA 2XFRA 3VZXA 4IMCA 1LLZA 3K8MA 4CQAA 1EOKA 1E5NA 3OHIA 4NL1A 3KVJA 2VZTA 1H51A 1RCXB 1TE1A 2ACSA 4E38A 1QHPA 1UIPA 2VWSA 4LYPA 1RK5A 2X42A 3UETA 2DT3A 4FR6A 2FZ9A 4JIIX 2OLSA 3W88A 1A47A 2BGNE 4GY1A 3BDKA 2NVDA 5CG0A 2QCFA 3OLEA 1NOFA 3ARTA 2PC8A 2DT1A 1WKDA 1D3GA 2ASHA 4O1EA 1REQB 4NJIA 2OGYA 3T09A 2AAAA 3IRDA 3EB4A 4AZGA 4NNBA 3T0CA 1EC9A 4XUYA 4C6FA 2XZ9A 5A1AA 4KKXA 3CH0A 3WBXA 4L4OA 3PULA 2VR2A 4HKPA 3NSXA 4IOTA 5G4HC 3EWUA 4F2TA 2IS7A 3KHDA 4LB3A 1S39A 4LC8A 3W7MA 3WEZA 3HGJA 1P0BA 1XISA 1KTNA 1BYCA 3PVFA 4EF8A 3D6NA 3WLOA 3OYXA 3NR0A 1IZJA 2YDRA 3RCMA 4CCDA 3S6DA 1SFSA 1HF6A 4PMXA 3TTQA 3RIKA 2A8XA 2ZRWA 1C93A 2Z2BA 1TKKA 1TPEA 1RBLA 5FA5A 3HFTA 5JCMA 9XIAA 2AMGA 1F4HA 1IQ8A 1TPVA 1YMYA 3RM9A 1MW1A 3UY8A 3NS1B 4LNCA 2P3ZA 4ORMA 2ZA2A 3H4GA 2NWRA 5LHEA 3RNMA 4IPNB 4MPQA 4P7NA 3SUSA 2WPGA 2FZMA 4DBDA 1BD0A 3CWHA 5F2MA 3R8GA 2A3BA 2AKZA 3N9RA 4PTDA 4MWAC 1YEYA 5G2WA 4L56A 3VFCA 7ODCA 4UZSA 1TVLA 4HCDA 2IKJA 1J0IA 3W85A 1R85A 3W22A 4RCXA 1EPXA 2IPWA 1V6YA 4MY8A 4EQRA 1GRHA 2VR4A 3R0UA 4QLJA 4J56A 1XD0A 2Y2WA 4AZ5A 5BOOA 4UUIA 2OYLA 4P8VA 4PYSA 3GC4A 5FACA 3U7BA 4LW7A 3GK0A 3LI1A 2BTMA 3AZSA 2GUUA 3BV4A 5A8MA 5AC5A 3F4NA 1Z44A 3A6OA 3T7VA 4RE2A 1GKRA 8RUCA 3LCLA 1KM1A 1XCFA 5A6JA 1AFSA 5T8GA 1TREA 5I07A 4UMCA 3TYAA 1UZ4A 3W7NA 4O12A 5D2YA 4H4TA 4DWSA 1POKA 2PMQA 2FQIA 3KBWA 4AXKA 5EBKA 5KITA 5EA9A 1VJIA 5B7YA 1MW2A 3DGHA 4UTTA 4PMVA 3LB8A 4GQRA 5LIWX 2F9RA 3RMEA 4N42A 4I5RA 3WELA 2VMFA 1ZY8A 1VPQA 1S7MA 3MCOA 2BWGA 3LDVA 3B9AA 1MNZA 2V67A 3BLIA 1DWAM 1BVWA 4CNOA 4JYDA 3AUOA 2GH5A 1WOAA 3OA3A 2OT1A 4Z1DA 3G1HA 4MFDA 1EDTA 4V2XA 4MHBA 3VGEA 3LRMA 1J18A 4OFCA 1J6OA 2DZSA 3EX4A 1QHOA 3W53A 2X50A 4WHBA 5A95A 3WF3A 3GIQA 4UCFA 2PGWA 1TWWA 2BXYA 4GUIA 5DQPA 1IGSA 2D73A 3W7CA 3URAA 4QAWA 2X7WA 1SW0A 3C8FA 1YXCA 3ANUA 3ERPA 4O16A 4H4ZA 2W61A 3S5ZA 3RNDA 4YIWA 1NF0A 1H1ZA 2FVLA 3BLKA 1A0EA 4ZMGA 4DRSA 5CSSA 1B3ZA 2WM0A 3ZVIA 3SECA 7TAAA 4D8AA 1SQ7A 3BAKA 4M7TA 3VC6A 5HNUA 2F38A 1DHPA 3WDRA 1I75A 3KFTA 3BAIA 3W02A 1GHSA 4J3VA 3KL3A 3LHYA 6REQA 1HKIA 1WXYA 3DFPA 4H7VA 4IQLA 5A6LA 1WDDA 2WSYA 2V2CA 5HMDA 2DZVA 1CXEA 1QXLA 2BXZA 2X2YA 1PE1A 3R8RA 1SJAA 2YB1A 1CT5A 1S5TA 4ZQNA 1M9HA 3IJLA 2DGAA 4YTRA 3B06A 4W8BA 1RP9A 2AL2A 1PKYA 3C2FA 4GCXA 1B3VA 2D23A 4YTQA 2XN2A 3A64A 3NL5A 1WUFA 1X97A 3F2DA 3GG7A 1Q2RA 1EGVA 3AIWA 3MKCA 3TW6A 4RJEA 4RE0A 1YPFA 4INFA 2PWGA 3VOIA 4JZ5A 4A6GA 4BKNA 4ADSA 4JFWA 1OIMA 3HPXA 4WQ6A 2QKFA 3TFXA 3PSVA 3UP8A 4F3HA 2DSZA 4YTSA 3LHZA 4C6LA 2EBNA 4L80A 3VIMA 4B9ZA 2VUNA 3IAPA 3M4HA 4GVHA 4TVWA 3WLHA 2QF8A 4HPXA 5ABEA 1Q6GA 2I5QA 3CUXA 2FVMA 3AS0A 4OOUA 5C70A 3WNOA 4GQ0A 4BV6A 3LV5A 3PNZA 3EWXA 3SCQA 5CH9A 2DP3A 1VBGA 2BC1A 4X63A 1XXXA 3LQGA 4PCTA 3T81A 1DORA 4YTUA 3TP4A 1LQAA 5EFFA 3BLLA 1SJCA 1HO4A 3HM7A 5DO8A 3MYOA 2OG9A 4N9EA 1DQXA 1QASA 3R7MA 4E4FA 4N6FA 4O19A 1T8QA 4WCJA 3ABQA 4GWEA 4HHPA 3AHTA 4QDPA 1YADA 1IR1A 1RLDA 3GHTA 1YTDA 1V3MA 3FV9A 1W32A 2HVOA 3UEQA 2WKJA 1JDCA 2Q01A 2FH8A 1YE4A 2X30A 1N2VA 1VH7A 4J4KA 3BAWA 2EF9A 3SN4A 1VDVA 3SY8A 1U1UA 4FXRA 2DUXA 2QEZA 3C5QA 5A6BD 4D6GA 2PDYA 1Q45A 3U2CA 1GJUA 3UPWA 3WH7A 2V81A 4E3VA 3DYPA 3LPOA 3C8NA 3FFSA 3PZNA 4ML4A 3M6DA 5LA2A 2EPMX 3LQLA 4ACYA 3O6DA 2Y63A 2PODA 3AMDA 3WLLA 5HNRA 3W7PA 1M03A 3TKFA 3V18A 2QJGA 4QG9A 4M81A 1FWHC 4FPSA 1YDOA 1D8CA 1B0IA 4HK7A 2VEGA 1XPYA 3WYZA 4QNEA 3H12A 3QZAA 4NRRA 3RM4A 2Y5SA 2V63A 4BY3A 3QGKC 2YBTA 3GDLA 3TLQA 2F7FA 1YDYA 4GO9A 4WDXA 4D8LA 1LLWA 1XLMA 3STFA 3BARA 5C8BB 2VC5A 3EWDA 3WH5A 1E9LA 2YLLA 2PDBA 4NAEA 3G6MA 2OLAA 9CGTA 3ENLA 1ZPTA 5I00A 1ZBVA 4RPPA 4OVXA 3ARZA 4Q33A 5H2ZA 4HZ7A 4JGDA 3DKLA 1LUCA 3AHXA 3B05A 2PF8A 5F7UA 1OD0A 2ZOXA 3HGSA 3QMRA 4LXFA 3A7RA 1BTCA 2V82A 4W7WA 1VBRA 1A3XA 4ERIA 2OLHA 1IEVA 1V7YA 4QEHA 4AEOA 2VRKA 4DBWA 3F4CA 1KM3A 4KH2A 2VRJA 1EBHA 3WBWA 4I7UA 4PRTA 2HMCA 1OFEA 2VFHA 1XBVA 3H8AA 3GXDA 5C9UA 1L2UA 3UWUA 4O8RA 4W84A 1TVNA 2RHGA 3B4UA 1TV7A 3GDTA 2YX0A 3TOPA 4MOZA 1IEXA 2V8ZA 3SY5A 3ZWTA 3OGRA 1EJTC 4MGGA 4TX6A 3NEVA 3LN3A 3EXRA 1UR9A 1KWGA 1QO2A 5AYZA 5HUOA 4H4XA 3URNA 4TMBA 1RHCA 3UR2A 2EPNA 3U2ZA 1ECEA 1TPDA 3UXIA 4Z2HA 4H6KA 2VXNA 3NQEA 1BG4A 5DN1A 1KXHA 2QAPA 1F8MA 4K6AA 1ELSA 1GHRA 1CWYA 3A5FA 1R6WA 4WSJA 2PDCA 4FOJA 2Y88A 3PUDA 3OQ8A 1XUUA 1O94A 2ZRUA 3BSMA 1B3OA 3CXOA 2D22A 3YPIA 5A94A 3GNNA 2XH2A 1UD8A 3B04A 2ZXAA 4MG4A 3GXPA 1B5TA 2CKRA 3T2PA 3MB9A 1TV5A 2TPSA 1IE7C 4JTHA 3C61A 3CHVA 4QRNA 3T05A 4HPGA 3AMGA 4MYXA 3NIYA 5HULA 3TFCA 4Q4RA 4HOXA 1K8CA 1DIDA 3EWCA 4L65A 3VM5A 5DX7A 4Y90A 2HXTA 1JXKA 3VOCA 2NQ9A 4MKSA 1WKFA 3EOLA 3EGJA 4QQ3A 2J8TA 1P43A 4AQLA 2X1RA 2VC7A 4P8XA 2OZ8A 3IIZA 2VOTA 1EEPA 4O14A 4NNCA 4HT3A 1PIGA 4BJHA 1Z48A 2VVSA 4M3PA 3UA3A 1QI2A 3SUWA 5GVJA 1GVIA 3P82A 1MNSA 2VX5A 2AGTA 1OX4B 4M1RA 1S38A 2WCAA 2VEKA 4GYPA 4JR5A 3PBUA 3TZFA 4D6IA 2PTXA 4JTIA 3TA6A 4ACZB 2FB3A 3OIHA 3CV7A 2HBVA 2PBOA 3IANA 2GJXA 1JD7A 2FDSA 1EC8A 1GQLA 5D37A 1N63C 3TN4A 1B3XA 2Z7GA 4Q8OA 1HJUA 1E55A 1RA0A 4UTWC 3QM3A 3W2MA 3VX1A 4M7SA 1JIBA 1HX0A 4TV6A 3C86A 3ECQA 1ZBKA 5CC5A 9XIMA 2PCQA 1DKWA 3UZZA 3QPYA 2J13A 2R8WA 2XYLA 3AXHA 2EQ8A 2Z1BA 3WH8A 4QX4A 1UC5A 2JF7A 3AIBA 3QFEA 4H4RA 2QCEA 2ICSA 1X8CA 4CNTA 3CUGA 2NVCA 3LTPA 3CQKA 1KV8A 2UY2A 1Y0EA 3CZEA 1VFLA 3T4CA 1TA3A 1BXNA 4MLJA 2VVNA 3T0DA 3N73A 1YQ2A 3PBYA 4JFSA 4UFKA 3GU9A 2ZXQA 3HG4A 3UGVA 1AL7A 3VD5A 2UWFA 4JTQA 1GREA 3EPOA 4ZTYA 3EX3A 5AC7A 4R9OA 2CLLA 4Y96A 3RPMA 4NYUA 3VIKA 5ECUA 2C0HA 1U1HA 5KSWA 2Y0FA 3WLKX 1VJZA 4F66A 1LOLA 1TZ9A 1TTPA 3GAYA 5E6ZA 3OG2A 3VZYA 3AMCA 2E0PA 3BUVA 1O1HA 4NJGA 3FA4A 3N04A 3XISA 2V6AA 1QUMA 4WDTA 3L4VA 4LUJA 3EUB3 1Q1WA 5FF4A 1STZA 3BH4A 2R1KA 5A6SA 1MXSA 1BRLA 3B0VC 1ME9A 2J7HA 1X1OA 3STEA 5GJPA 3R79A 4J3XA 2X1SA 3S5NA 1E1EA 4RPQA 1DJWA 3LUTA 3CUHA 3CGCA 1JDAA 1E6SM 1Q6LA 1XANA 4XQ6A 1SU5A 1W3IA 1YBQB 2HZGA 3QR1A 2E8YA 3INPA 2XSAA 1E4MM 2OO6A 2VFFA 4I7VA 4L6OA 1SZNA 4M6UA 3V0UA 2WJFA 3SQLA 1KKRA 2GQAA 2YFNA 3PAOA 1W3KA 1EHNA 3HJZA 2Y7EA 3WQCA 3M64A 4GYJA 4ADTA 2VENA 4S3JA 4DZ5A 1AH3A 2QCHA 4A3QA 5FAGA 3CZKA 1Q1RA 3KCLA 2EPKX 3LZ3A 4KGJA 4MZ8A 5FSEC 1ZMCA 4QE5A 1VCGA 3GR7A 1P1XA 1XH2A 4PB3A 2FFCA 3KBSA 1YXDA 2XN0A 1I1WA 4ONVA 2V5LA 3L5LA 1K3UA 3PZVA 5DANA 4F0LA 1XQLA 4G8TA 1W0MA 5U7SA 5KEZA 5I77A 1RBOB 1Q7ZA 3NQAA 1E6RA 2QT3A 4FDCB 1JCLA 4H7CA 4Q4QA 1VZWA 1GVOA 1GPWA 4LAOA 2UZ9A 5D9NA 1ZP4A 5H1WA 3F7JA 2YCKX 4BURA 2HS8A 4JAWA 1XKYA 2NXIA 2O4QA 2XIJA 3CT2A 4MUPA 4DNHA 3C0SA 3BK0A 2GZXA 1XLEA 3DEQA 3NVDA 2O0TA 5I5RA 1MUWA 3W29A 3EOSA 2E3ZA 2QAEA 4K8HA 1EOMA 3H21A 3O0KA 2E9LA 3N3TA 1OK6A 1BKSA 2J8FA 4GFSA 3C3UA 3IGXA 4L9YA 3E0FA 1EJVC 3LENA 1XS2A 3CASA 3AYTA 1GJPA 4M5PA 1RAKA 1V6XA 1CTNA 3CH9A 3SZ8A 2WLYA 1QPKA 3EWWA 3K2GA 3ZXWA 4P7LA 1YNYA 1TELA 4J3WA 1D2KA 4XZIA 1Q5MA 3S5OA 1VB9A 2WOQA 4GC3A 3U4AA 2WXDM 4JN6A 2G4JA 4RDYA 3FKKA 4O0QA 1OHLA 1GW1A 2G3FA 4K36A 4Y7EA 1AA1B 4WOQA 3W6LA 1BYBA 1O5KA 4MLRA 4WK9A 3UERA 4WGHA 3N3MA 3WH6A 1WB0A 3A47A 1ZBWA 3APTA 4GQBA 2ZZBA 1FP9A 1OINA 2CLFA 4V28A 5K7JA 1RZMA 3FDGA 2E9MA 3VMOA 4ZSTA 2Y7GA 3A3HA 2A7RA 1CENA 4EIVA 1E3XA 2PP1A 1E0XA 5I3KA 3AHVA 2PDKA 5JH2A 1TMLA 2CBJA 3QV6A 4DBUA 1T3QC 4WJXA 3A4WA 3T55A 4IIGA 3GTXA 2Z2UA 4TVUA 1JYWA 3E2VA 5H91A 5AYBA 1KRAC 1ZX9A 4IG2B 3O8AA 3PG6A 4E8DA 2JIEA 3LPGA 2DSUA 4LC6A 1YTKA 1KFEA 1E9ZB 1E0UA 4WIWA 5FAJA 2W62A 1GOIA 1T6MA 4U2YA 1UWUA 2GRTA 3PC0A 2V5CA 3BGGA 1BXCA 1ODUA 3MP3A 2NQHA 5BRBA 1HT6A 3AIQA 4IQJA 3LM3A 1ALDA 1XIEA 4UQEA 4KS0A 3JRKA 4XZWA 2FGLA 1FWNA 3FHAA 4MB1A 4AF0B 1E73M 2ZX6A 1KR1A 3L4ZA 2OPJA 3NXFA 1G94A 4GY0A 2ZZ0A 4WVXA 1ODZA 3IV3A 1IZKA 3FK4A 1G0CA 1FDJA 1T40A 2X8RA 3PTMA 1C8YA 1EA0A 2PWFA 2XWEA 3IJDA 3CHEA 1JYNA 2YJQA 2ZE0A 4RR4A 3TYEA 4TVDA 1Y7VA 4K7VA 2J7GA 1IYXA 1S1RA 3M0KA 4UNIA 3V75A 4JXCA 3NZGA 3RLHA 4RZ4A 2NX3A 5KVIA 1B4KA 1UC4A 1Q4NX 4O1DA 1F8IA 1P0DA 3HV9A 1KCKA 1VFTA 2WSKA 4L6DA 4DBSA 3KEHA 5DMMA 1W1TA 3GFXA 4H9MA 2VRQA 3LRKA 2B31A 4H9TA 3FVDA 1H7RA 3FAWA 3VDAA 2I5IA 1OM0A 3LTYA 3U8GA 5C9XA 3N29A 3W1MA 2HTMA 3A3XA 1LORA 4S3GA 3REQA 3KDOA 5C54A 1UR1A 4R3UA 2J66A 2GUBA 2VFDA 2E28A 3R10A 1UKPA 1H3GA 2XHYA 4F2UA 3TC3A 3JZEA 2HVNA 2LLEA 2R94A 3WQDA 3CLWA 1ZB5A 3QMTA 2NT0A 3B8UA 4HZ8A 1W54A 1XLHA 3DESA 2P88A 4M80A 3RRAA 1X1NA 1Q7MA 3G1VA 3RFAA 4F48A 3AWOA 3VE7A 4H4IA 4Y9MA 4EXAA 3LSCA 3HTWA 1ZTVA 5C7HA 3FEMA 3S6OA 2XWDA 4DO7A 5HR6A 3UU0A 3E6EA 5C9ZA 3W25A 3W00A 4O11A 2R9ZA 2RH9A 1W3LA 3S8HA 4GZJA 3TXZA 4H9VA 1JPHA 2CLMA 4DWSD 3SCVA 2OSWA 3THUA 2ZX5A 1NFGA 3FIGA 1GV4A 4GYPC 1QR7A 1UMYA 2D2OA 3C56A 2E6AA 2CLPA 1CGUA 5CZSA 4WR3A 2EKCA 4KGLA 4RE4A 1DJQA 1EA9C 2GDQA 4Q8MA 1RH9A 2JALA 3GO2A 3WD1A 4LT9A 2VOMA 3QFBA 3DFSA 1OFAA 2YAUA 4PMZA 4POCA 3LYEA 1HN1A 3W3OA 1XLGA 1W9VA 2O56A 3VD4A 4AEEA 5CC6A 4UMBA 2CLKA 1IT7A 3NO3A 4KW2A 4FZIA 5M1TA 1WXJA 1CEOA 2VCAA 1IT8A 2EQ6A 2EKGA 4F4RA 1GT8A 1QDSA 3R89A 4O28A 1GEQA 4US5A 3DBNA 1NPXA 5CGMA 2HVMA 1CGYA 4WGXA 1KFLA 1OGBA 2Z29A 4QEEA 1ONEA 2JF6A 1SR9A 2NSOA 1D3CA 2R1NA 1OGGA 4IG2A 4LAKA 4LBRA 1UWIA 1HKVA 3FNDA 1LTDA 2TODA 4JBRA 1THFD 4B3ZA 2A1YA 4GJJA 3EXTA 3C6CA 4J3SA 2CLHA 3ES7A 1XC4A 4EP8C 3PS7A 1KRCC 4K1GA 2ZXBA 2FMNA 3QW4B 1NFBA 3NM3A 2D2HA 4XAPA 1P4CA 4IZGA 4AISA 4V1YA 4EE9A 3PPHA 1NWTA 3VM7A 1I0DA 1FCQA 5AFDA 2WHMA 4TMCA 1A80A 4US5D 5A8OA 4CEUC 2E40A 3GW0A 1H63A 2WMIA 4CNNA 4ZOBA 4H2CA 1U22A 1CLXA 1G1YA 3QF0A 3WQGA 2A5HA 2HPIA 3IIVA 2GK1A 4LYKA 3WENA 2GVLA 5LIYX 2QJHA 1GWJA 3S9IA 4AZBA 2BV9A 1AH4A 1AZ1A 4YCOA 2EXOA 4XD5A 3HMJG 4UTFA 3W7HA 1U83A 2XINA 2CIPA 1V0LA 4LBSA 1BGGA 2D0GA 4LU0A 3NDZA 4JFUA 3C2RA 5AECA 3W7KA 4XKYA 1RBAA 1XLDA 3IS4A 5HWJA 3L4YA 1XCXA 4PMRA 1OX4A 1C8XA 2PDGA 3HJEA 1VHNA 1T5AA 3UZXA 3BO9A 2CDUA 1TTJA 4FIRA 3DG6A 4NZ3A 1OCQA 3CMGA 1UQYA 2QCLA 3RG6A 3GNXA 3WDQA 2ACRA 1L6YA 4H4VA 2XM1A 1UASA 1UKQA 4IISA 4AD2A 4N4PA 3LLDA 3BJFA 3N6JA 5A69A 3LCXA 5DT5A 2EQ9A 5KZDA 4P7QA 2ZKMX 4OIFA 2PP0A 3G8RA 4IJRA 3OQEA 3FN9A 4RKAA 1JPIA 5AVHA 2Z4GA 1DWIM 4CUCA 2HSAA 3GIPA 3S9YA 1GQJA 2XUCA 3ONBA 4EM4A 1B4EA 4GXMA 4LYQA 1VPYA 4ML9A 4DWSC 3SY1A 1RY0A 2BX7A 3C2YA 4JTLA 4WKHA 2G0WA 4PC8A 2PTDA 1YDVA 1UH3A 4EXBA 1RJRA 4E2BA 5D30A 2QCNA 2Y89A 2CKSA 4QXIA 3NSMA 4M51A 3PSWA 3P61A 1I45A 3BZJA 2V3DA 3VDGA 5AKQA 4PB4A 4H01A 3S5YA 1NHPA 2ADAA 2GJLA 3O3RA 2V6OA 2YXOA 4O52A 4B4FA 3MVTA 3O1NA 1FWRA 1W5QA 1NDYA 4JY8A 4CQ9A 2ZX8A 5JMUA 3ANVA 3QN3A 3OW1A 1OC6A 4K37A 1IV8A 1W6TA 3TWBA 3AS2A 1NAL1 2YBUA 3G6LA 2HDJA 3IJQA 4W8AA 3UXDA 3M0VA 2OKOA 1QI0A 1OCJA 1H5YA 3AHZA 4GOAA 1XI3A 1KFKA 1DWGM 3H2AA 2PP3A 3OU8A 1WP6A 3PBWA 3VNJA 5EKYA 3F2BA 4B15A 3IUDA 4UFIA 3KBVA 2VEPA 4P8UA 5I0DA 4KBXA 1YBQA 2D1ZA 4OBSA 3WF0A 3CBWA 1W3TA 5ABFA 3UD6A 1V79A 1CBGA 2PDNA 2BLEA 3B8DA 3SAZA 3U48A 3T78A 4FP1A 3QYSA 4G6CA 2X1TA 4Z17A 3VKKA 1IWAA 4K8DA 3EPMA 1HKJA 3FY1A 1UJQA 3A9BA 5E9AA 3AYSA 2OXNA 4CQDA 3WLSA 1BQGA 1I1XA 3HZ3A 4KWVA 1QW7A 4C5ZA 1D7YA 3HPAA 3CGBA 3GWQA 4PE8A 3U2OA 1KXQA 4DB7A 3S2NA 2JGYA 3ELFA 1OQFA 4WSKA 2FPYA 1KGUA 3MCNA 2X2GA 3GR4A 1WKEA 3ARPA 2Z2AA 5B7ZA 5E0CA 2WNZA 3O9NA 1NQKA 3ZSTA 1H4PA 2PTZA 4NSBA 3TYDA 4JEJA 3RPDA 4IL0A 4QDMA 3H2MA 4C6OA 5A6MA 3LHUA 4HIBA 1C9DA 2HE8A 1XFCA 3VD9A 3MP4A 4B2DA 3VO0A 1ITXA 3W2KA 1MXDA 4QP0A 2IXVA 3DC0A 3M1ZA 4E8GA 5JBEA 3F4VA 1NHRA 3RR1A 3MO4A 1RPKA 4IIFA 2J9ZA 4ZXLA 1DQWA 2YCJA 4UOQA 2WZEA 3B9OA 4Z1YA 2NV2A 1MRAA 3GD6A 3ISIX 1LWIA 3AAMA 1L8NA 3S2JA 3LMYA 1Q3NA 4S3CA 4LANA 4HD5A 1LBMA 4AY8A 3A7UA 3GVRA 3DJGX 4MJZA 2R91A 1NARA 2YVJA 2FZBA 3S1UA 3CYVA 1M68A 5GPRA 3VFLA 1SJDA 4NT0A 1PKNA 2YQUA 1XSIA 2PD9A 1K7FA 3PPCA 3TJLA 3WNKA 1SO4A 3CIVA 2PWHA 3G22A 3TVAA 1AJ2A 1G4SA 1ZGDA 3GUGA 3U3HA 2E5AA 5TAOA 3PBMA 3VK5A 4PBFA 5IXEA 1T99A 2WW5A 2YB4A 3VC5A 4WZHA 3VIFA 1VFMA 3XIMA 4E5TA 2DFAA 5LXXA 3BV7A 4OUIA 1C8VA 4L6HA 3LLXA 2CERA 5IBXA 1WKYA 3A24A 3I3DA 3V5OA 4AXNA 2GWNA 1FECA 3QHNA 3BMWA 1OYCA 1GERA 1NDZA 1PKLA 1TMQA 3CGTA 1Y5VA 3UVAA 3I7SA 3WF4A 5JXQA 1XX1A 2XIBA 1KV5A 3BW3A 4PBGA 2OEKA 1NHQA 4QFUA 3FLUA 4MAVA 2TYSA 1QRQA 2PB1A 1XIMA 4JCLA 2IKGA 2YVGA 1W1A1 1ZBCA 4J2MA 5C9RA 3KTXA 3AJ7A 8XIAA 4TU1A 5C0QA 4OV4A 1VPXA 4R53A 1A0CA 2PF0A 3E02A 6PTDA 1W1ZA 2AQVA 1DIKA 3LU2A 4CGTA 1MDRA 2J24A 3E5PA 4GYKA 1H7XA 1JR1A 3GLCA 1REQA 5CQ1A 1ADSA 4AWUA 4AY1A 4RE3A 3VINA 3FJ4A 3EWYA 4AIBA 3N12A 4MY9A 4BEUA 2ZZ6A 1OSEA 1JRCA 2DPEA 2VD8A 4WSHA 1XFBA 3PJUA 3E12A 3OVRA 2OYMA 3NVYB 4Q3MA 3MBFA 1H2JA 4PMQA 2QQ6A 1JJKA 3TYCA 2G3JA 3VE9A 2QPSA 2DORA 2X8GA 1N62C 3CS2A 5G5HB 4J9JA 1PKMA 3SCWA 1RUSA 3W7QA 1D9EA 3V1PA 5BMXA 2BB0A 1BSIA 1BAGA 3TC6A 3P8JA 3KOWA 2YL8A 1E15A 1UOZA 4JIRA 5BRPA 3DOPA 1PSCA 3QJAA 2CESA 2Z1WA 2YOCA 5CPQA 1KC7A 1UWRA 3FG2P 2OZ3A 2CBUA 6CGTA 1HL9A 1VYRA 5G4EA 1POJA 1GETA 3VNKA 3SQPA 4GD0A 3PUGA 2X8HA 1LROA 1FBAA 4Y6GA 2WZIA 4W7VA 1OEPA 5A6BA 2PAJA 2QZRA 3W86A 3CU2A 1ZS2A 1J0ZA 2YDAA 2R82A 1KCLA 2FPTA 2Y8UA 3CQIA 4B2DD 4EF9A 5KZ6A 3BWWA 1NDWA 1LBFA 3W75A 2WHLA 1FFUC 2XSBA 4JKLA 2ZRXA 4JTKA 4K3ZA 2BHYA 1RA5A 1XPGA 1FUYA 4CN1A 4I8YA 4DXVA 2YIHA 4XZNX 3W9ZA 4JTEA 3I6TA 4RUBA 1OZMA 4A29A 5D8WA 3N4AA 1FIQB 3RU6A 1V6VA 1O1ZA 3OC4A 3OLIA 2E6YA 1Q6CA 1R9ZA 1VFSA 4EPKA 3PBGA 5I3IA 5LYRA 3SN1A 4FLOA 2BMBA 1J5SA 3AISA 3PM6A 2ZCGA 3HURA 3A9IA 2UY5A 3RO8A 1OFPA 2X0HA 2DZBA 2KAUC 2QR6A 1QOQA 3HN3A 3KM8A 4U3CA 4PTNA 5HUPA 3D3FA 4NAFA 4Q22A 1W3HA 5BXSA 2ZWZA 1W5OA 1VRXA 1SR0A 1XLAA 3KX6A 3MV11 2YYTA 1TUXA 3PTDA 2PTYA 3GE7A 3B9NA 3P81A 4Z1CA 5AHLA 4J3TA 5EBUA 5FMHA 3UZJA 1ECQA 4HCLA 4RLIA 3BC9A 1E4NA 3N2MA 1XH0A 2FB2A 2PRLA 4DJEC 6A3HA 2RDWA 4QLKA 4H8NA 3OYZA 4C90A 4IMEA 3H7VA 1I2RA 3IVTA 3MKKA 2QVHA 2FJUB 4UTHA 5HBFA 1R47A 3IGUA 3MP5A 1D7KA 2I16A 2OU4A 1VAHA 4IIEA 1N8FA 3ARYA 1AW1A 2OZTA 1NELA 5HOSA 1LWJA 2DIKA 2OODA 1WZAA 2J9YA 3LS9A 3W2UA 1MMFA 1ZJAA 4GG9A 4DF1A 2WP5A 1Y5XA 1VEMA 2ZX7A 1B57A 4S2BA 4H50A 1CNVA 1HUVA 3PZIA 3SSZA 3RPTA 3WJWA 4LEQA 2ACUA 1EX5A 2J79A 4LVAA 1EJUC 1VD6A 1XLCA 1HL8A 3WUGA 3ZJKA 1EHAA 3D0CA 4FNRA 1H1YA 2RJGA 3NCOA 4AD0A 3HRDC 3GKFA 2BS9A 4BI6A 4DAIA 3BE7A 4JNMA 4DJDA 1U5JA 4B92A 3ID7A 3MV01 4GI9A 4W89A 5A8NA 1PXGA 1R3TA 2XIQA 5HJLA 2ZUSA 2ISDA 3BQ5A 2W9MA 4BHYA 1MRQA 2W27A 4NVTA 5CSYA 4CVWA 4I6KA 1PPIA 4H19A 1QFEA 4QG6A 1QW8A 4WY0F 1U1JA 4XISA 2WPCA 2FFIA 2O9PA 4A3RA 1GVYA 4O0ZA 2IKHA 4MTVA 3LZ5A 4XB3A 4KWSA 3ITTA 1TO3A 2GOUA 4NYYA 1L6WA 1R3VA 4LX4A 1V02A 1CCWB 4EQWA 4FA3A 5HMEA 4M6PA 4NZJA 3WMLA 2YCEA 3B9EA 4NJJA 3CV2A 1UWSA 3VGGA 4GJIA 2YYUA 5IDZA 1KKOA 2DH2A 4PEEA 3O63A 2BGSA 1JQXA 2VFIA 5MF5A 4HA0A 1S2VA 3CK5A 3VU2A 1W2PA 4QJ4B 1ISVA 5LA0A 2TAAA 4M82A 1XRSA 3LGGA 3QHMA 1LQ0A 4DZIA 3CPUA 3BG3A 1M01A 1TPUA 1FFVC 1F07A 3VNYA 5FSDC 1J96A 3W72A 3NZPA 1KTCA 2EEXA 1TYTA 4KEUA 1GZGA 2DY3A 1OT2A 1P0EA 3T0AA 1DTNA 2W3RA 4K38A 3SRDA 3WKZA 4LWWA 4LRTA 5CPSA 3RO6A 4A4AA 1XIBA 3OJGA 3ME3A 4HA4A 3K4WA 4H6RA 4F40A 2DVXA 4J7RA 4Z2GA 1LZOA 4W86A 4QJ3B 1OADA 1V77A 3UQNA 2PBGA 4X2RA 1P6CA 2XIMA 5JCIA 2ONEA 4NG3A 2OEMA 3SM0A 3DJJA 3LXAA 3UWEA 1KB3A 2NW0A 3G18A 3SW6A 3L0GA 4UNLA 4DF0A 1E43A 2I17A 3K4DA 4ZFCA 3N4FA 4P61A 5DRIA 1IF2A 4M1BA 3VDCA 3WLNA 2RGLA 1JCXA 2XN1A 3A23A 4UIOA 3F4DA 1R2RA 9RUBA 4U10A 1F05A 4G9PA 4QAIA 2CETA 1H11A 2X7VA 3W26A 4L4LA 2B7OA 1IEIA 4QCFA 3NZQA 3QPEA 3L4TA 2I9EA 3MS8A 2BY1A 4W87A 4OTKA 1JDFA 2WPFA 2NVAA 3OBAA 4H8HA 5H8MA 2O7SA 1ADDA 3CV1A 3DYMA 4WOZA 3TN5A 1Y5WA 2BCPA 3RXZA 2ABBA 3H24A 3ZLHA 3MHGA 3VTRA 4MF4A 4O18A 2WPEA 2PTWA 1E51A 5FD0A 4EACA 4HNVA 2EO7A 5AHFA 3W2JA 4NZ4A 2CFFA 2W63A 1CXHA 3QZEA 2BVDA 2OX4A 4H00A 4AH7A 1ZFJA 4D6HA 1XG3A 4HYVA 4QITA 2C3DA 5JH1A 1UKOA 5ABTA 2DIEA 4IXXA 1C90A 5B80A 2Y4SA 2JE8A 4GKTA 2WBAA 3T4WA 1OCNA 3UJFA 1CGVA 2O7QA 3LXDA 4HK5A 4YPJA 1GCYA 1S5NA 2G5WA 1XIHA 4CQ8A 4KIRA 1XIDA 3T2OA 1LWHA 1Y65A 2Z6IA 2IPFA 2QS8A 2X05A 1W56A 1LLOA 2HJPA 5E1QA 5LIKX 1GVSA 1GTHA 1ZU8A 1ZK7A 3ETRB 1YTEA 3TONA 1TA3B 3W83A 3VX0A 1A3HA 1TWSA 3ITOA 4U5KA 1QNPA 2NX1A 3ABSA 1WNOA 1LG2A 4NRSA 4NUWA 3H4KA 4MNMA 3SQMA 1XLBA 6XIAA 2C19A 3WNMA 4K68A 3NGFA 3CXBA 3S2MA 4JTGA 4RNFA 1EQPA 4A8NA 3R8HA 3BG5A 3BICA 3QW3A 3WJZA 4ZQRA 2B81A 4GFIA 1IXNA 1HTIA 5GRTA 4DJED 3KZPA 4H8UA 2MUCA 1ME8A 2PZ0A 4HN4A 3RCYA 1LL6A 2NLIA 2FHCA 5D33A 4DUWA 5DFAA 2INZA 3VGDA 3LM7A 4GYFA 1W8SA 4UTWA 3ZLFA 4IX2A 2YXGA 3UWQA 4BS0A 1VCFA 1XYZA 2D20A 3FGCB 4QDWA 3WDHA 2ZA3A 3QFAA 4B16A 1F7BA 2J7BA 3FCPA 1AQHA 2XFWA 1B3WA 5AYIA 2A79A 3HQOA 2VJXA 1A0DA 1H7WA 4XAGA 2E67A 2HS6A 3CHFA 4BK9A 3LHVA 2UY3A 4R7JA 1N82A 1NHSA 5HWMA 1V6UA 3DFNA 1OG6A 1Y8BA 4HMEA 3I7RA 3ZVHB 4Q6XA 4R33A 2EAWA 3PANA 3WUFA 2NXHA 4HNLA 1DQUA 1JVNA 1AD4A 3V5FA 4H7ZA 1X96A 4FALA 1DNCA 1UJPA 3BAJA 2VDHA 2WAGA 2WKGA 2J75A 1R8LA 1FXPA 2V2DA 3GW3A 3W7GA 1B3YA 2Z27A 2BY3A 4EKJA 1G5AA 4HPNA 4IICA 4UTKA 4JIEA 4QM1A 2J7CA 2A6NA 3CB3A 1P6WA 1ZAIA 4PODA 4RDWA 2WZMA 4ZO6A 2DUZA 3MZNA 1QVBA 4LSBA 4BFAA 1V5XA 1S2TA 5E70A 4IX0A 1EO5A 5I3GA 2JK2A 2Q3RA 1O7AA 2PDWA 1JYVA 3UZWA 4PTVA 4WDWA 4J27A 1IGWA 4FR1A 4XZLX 2VR5A 4XZHA 3HV8A 4Q7IA 3G1FA 5M03A 3GFYA 1JNDA 3MO7A 3TTYA 4AY7A 1GPFA 4S2CA 5G1TA 2FTWA 1NFPA 6REQB 1FDYA 3L7RA 1UA3A 3P14A 3H53A 5K3VA 2YDSA 1O68A 4U31A 3QRHA 4ZO9A 2GVJA 3QXBA 4F0RA 3CZJA 3I4KA 1W2VA 1E3ZA 1NOUA 1JCJA 2ZRVA 2VZOA 3P0WA 3SN0A 3SRKA 3UGRA 1X2GA 2V0TA 2BDQA 1JRPA 3DZ1A 2CXEA 2YW4A 1XUZA 1XH1A 2VHLA 3FJLA 4O4VA 2QHAA 5BNKA 3DFTA 5FJPA 3KRSA 3F5KA 3CWOX 2CPUA 2C0AA 1H6VA 3ZLGA 1RCOB 4JQ3A 3B03A 1WBJA 5M17A 4HVXA 1EXBA 3VCCA 1GG1A 1HKKA 3HPFA 4JTFA 1VBJA 1GEHA 3EKGA 1DEDA 1E56A 4XBKA 4N0RA 1FDZA 2WSQA 3EA2A 1J9YA 4XD4A 4PEKA 5FJOA 1NVMA 3M0ZA 3V1HA 3KP0A 5FJRA 1TPC1 1YX1A 3O06A 4C6JA 3CTTA 2BFGA 3G1XA 2V69A 3NOEA 4PUKA 4PMOA 3NZ1A 3ARQA 2X16A 1OF8A 3UCCA 3HQ1A 1JZ3A 1JDEA 3EDEA 1H62A 4QGCA 1VRDA 1UUQA 2ZUVA 5IOBA 4ZOCA 1NOWA 2PPGA 3AU6A 3GDRA 2OOFA 3PJTA 2AMXA 2Z0IA 4NILA 3BLDA 1UZHA 1WOBA 2E4TA 1YKWA 3RLVA 4GVIA 4H83A 1X38A 2FHBA 3GC2A 1QW9A 1GTEA 1M7PA 1EF3A 4YWOA 2J88A 3FHQA 3R2GA 3V4BA 3AJXA 4RW3A 2IXUA 1JD9A 3WQ8A 1L6SA 4PUNA 2I56A 2FTYA 4Q8NA 4N7QA 3T0TA 6TAAA 1GQNA 4F0HA 2F61A 1KN0A 3P8IA 1JI2A 3KS6A 2TPRA 3CAWA 3MUCA 3HA1A 1NSJA 1GOOA 5BOEA 1SFLA 4CU8A 3SDOA 3UWWA 5PTDA 5EMKA 1QBBA 1FWJC 5LGZA 4RXFA 4PUUA 1P0KA 1TTQA 4GUGA 4MFEA 4AIUA 1JL8A 5LA1A 4LPCA 3F4WA 3KL0A 3L2MA 4C6QA 1K4GA 1DTUA 3FXYA 4FXJA 1PUDA 2CZ5A 4FF5A 2W3SA 5AOUA 2QJMA 4YMZA 3TMLA 1T0OA 2BNJA 2WLZA 4DUXA 3CGEA 4IM4A 4LVBA 2W66A 3DBPA 1TPFA 3OGVA 1XYAA 2WJEA 4IFKA 4LVGA 4W4QA 3TA9A 4WXYA 4KCTA 1OGSA 3CZ8A 4FLSA 3DI0A 3BZGA 3TAOA 3VKJA 2VCCA 3WK2A 4X0VA 4DYJA 3P3BA 3QY6A 3T8QA 3TMQA 5FF3A 4JQ9A 4F2BA 3DGZA 4PH6A 2C13A 1JUEA 4E3TA 1UD6A 5A6TC 4J35A 1JI1A 4EPEC 4DBEA 1DOSA 3VOFA 1TJ2A 3LCIA 2VX4A 2X1IA 4FNUA 4NJHA 2VZVA 3O6AA 4O53A 4XD3A 3QHOA 4UFMA 4WY0A 3QZ6A 4GCAA 4C6PA 2YW3A 1IT0A 1XM3A 1QMLA 3VCNA 4LH8A 4NX0A 2DZAA 5LHFA 1WXZA 1X39A 4DYKA 1OC5A 1S2CA 3W2LA 4OQVA 3EZ4A 4JNZA 3SO7A 3BLOA 1Z89A 3MTWA 3MUY1 3L21A 3P7YA 1KLYA 4PRWA 3RILA 1QJWA 4IPLA 4RNIA 2BSLA 1EFZA 4I5UA 2R14A 4WJEA 3A4JA 1BKHA 1ZJHA 2XH0A 2BOGX 5CZTA 3L4WA 4RZBA 2PDHA 4LB4A 1XINA 5I2UA 5C7VA 4C1NB 3KOXA 5I3FA 1N61C 3H6OA 2ZE3A 4H9UA 3VNIA 3EX1A 3ZR4A 5GQBA 1JDDA 3NL6A 3O05A 4AYSA 2QMKA 3MC5A 1AQMA 1BWLA 5CLWA 3EMCA 4AIEA 1RXOB 4LBUA 2ZC8A 4N6EA 1LM1A 3C0QA 3IIPA 3QLDA 4KFPA 1ITQA 3FYPA 3LCFA 4URIA 1H7NA 3RJYA 3AIEA 1HKMA 2WZHA 1K9FA 3SUTA 3OHMB 3WK3A 1JZ6A 1MZRA 3LSBA 1ESWA 4XWUA 5DCEA 3L2LA 4S3AA 4XO7A 1QT1A 3ATZA 3H2CA 4PN2A 1X1ZA 1A5KC 2Y24A 3DAQA 4AFYA 3GTFA 4DNAA 1TYGA 1EWDA 3WMCA 1OZQA 4M29A 4GISA 3L5MA 2J47A 2OB3A 2ZZ7A 1PZ2A 3NRZB 4AAJA 2DW6A 3VAVA 3N9KA 1MEIA 3LG3A 1GOXA 5TF0A 1UA7A 3VNLA 1QI3A 1VLWA 5C55A 2O92A 1WYGA 3R43A 1W5PA 1E0VA 3M7SA 1EUAA 1FWTA 4HMDA 2Y8KA 4ADWA 3GH4A 2QDHA 5BMWA 4BWLA 4EMIA 4G1NA 3AIRA 5D4YA 5E09A 3M16A 3MA8A 4PCSA 3NVVB 1TB3A 3M5YA 4CVUA 3BVJA 2WOVA 3MSDA 5LKYA 4LA1A 5GJNA 3H2FA 3ITYA 4GINA 4C1KA 5F2GA 4TVCA 3BPWA 1GUVA 2VCBA 3CLMA 4UQDA 3GH5A 5TIMA 1ML1A 2PA6A 3AALA 3G8EA 1JCYA 2OKTA 4CEXC 1EPVA 2VZSA 3N2TA 1X6LA 1I8JA 4FI4A 2C6QA 3MMDA 5D2WA 1M7JA 1S5MA 3B40A 4GH1A 4AZ7A 4TIMA 1S2UA 1XDJA 2HNEA 2GVEA 1UWQA 2IMRA 3EA1A 1CXFA 1VJSA 3GZAA 4IP4A 1EF2A 3NPVA 4G7EA 3OG3A 2CLOA 3SUVA 2HPMA 4RNHA 3OVQA 1E70M 3N34A 3O15A 1A50A 2DW7A 1JCMP 3UT0A 3THAA 1I2PA 4I9MA 3SR7A 1ZLPA 2GK1B 3DX5A 8XIMA 5AZ1A 3LBCA 5J04A 5FL0A 1DVJA 3QQ1A 3UPBA 1WO2A 3WJSA 4HP5A 1BYAA 1KFCA 4X0NA 3CAVA 4LAZA 4DHGA 2DUAA 3E49A 3GVWA 1XDLA 4CNSA 5ENLA 3MSYA 4A8RA 2WNWA 4HSNA 5HR7A 3E38A 5FF2A 1OVDA 3NL2A 1GKPA 4ZGYA 3LGDA 1EUNA 1PS9A 4JEQA 3KP1A 1T41A 1TYPA 5ABGA 3FSTA 3UJSA 4O1CA 3L9CA 1V0KA 2FYMA 4L4PA 2J27A 4GE8A 2PFHA 3L5OA 1XBYA 4FLRA 3ARVA 2ZWYA 1TX2A 1KXTA 2H9AB 1AG1O 3NO1A 3GR8A 1XHCA 2GGGA 4M6VA 2GFTA 1TIWA 3BMXA 4EOUA 1XSJA 5JU6A 3WUEA 4ZTXA 2W0UA 2X8CA 1ISZA 2GJNA 3PWIA 4AC7C 3DGRA 2NZLA 3PUOA 4GUHA 4UQBA 1A5AA 1WDRA 3AIVA 4QJ1A 4FNSA 3M46A 1V93A 1V3IA 1RJPA 2RGMA 1K4HA 5F1VA 1R3QA 1H60A 2YGYA 1JEHA 3WJYA 1ISXA 4ZE5A 1B31A 4GZIA 3M0YA 4XX6A 1PHWA 3UF9A 4MJ2A 4UTLA 3C4UA 1TR1A 5FJUA 1FEAA 5IRPA 2EPLX 1JGIA 3WLJA 1UR8A 2NV9A 2V3AA 4ICCX 4NAFB 4GX8A 1J10A 4IPIA 1W17A 1VFUA 2H8ZA 3SURA 4DUOA 3ZFHA 3MJMA 3WQWA 3MANA 3VZZA 3USBA 2X1UA 2YDQA 5F2LA 2TRSA 4C6IA 1GQIA 7TIMA 5AB3A 3TQ0A 3ZVHA 1R3SA 5LIUX 4ZODA 1HL2A 5J5DA 1LOQA 6ALDA 3FW6A 2P53A 2PLKA 3EYPA 5HAOA 2VYOA 2VEFA 4XVEA 3TNBA 4QTGA 3MWAA 2GQWA 1ITUA 3PZ9A 1K7XA 3SJNA 4MJMA 3KLKA 5F2IA 1DWHM 1WX0A 2DZWA 4YLWA 1VLIA 1M1BA 1QOXA 4RZ5A 3K8KA 1E6ZA 1TG7A 4EK7A 3DHPA 5JUVA 4M8UA 3CL7A 4LF2A 4NJKA 2OJPA 1LCOA 4CCEA 4FOKA 2YLAA 3DI1A 1SW3A 3I3BA 3EKZA 2RDUA 4H41A 4AHOA 3TCEA 3UR5A 4Z1AA 1Z6KA 1LVLA 1EZ2A 4K7YA 3OGSA 1V0NA 1RD5A 4E8CA 1J0YA 1MEHA 4RK8A 3FXGA 1QI4A 1RY8A 1XGEA 4IPPA 1NM9A 2VEMA 3VDHA 1VEPA 3LBMA 1KBKA 1TWZA 1KM2A 1VS1A 1OFOA 3LHWA 4GIYA 5EPDA 4HN8A 3W7LA 3BCDA 3S1WA 5EFDA 5FI8A 3L8KA 3CIWA 3K30A 3IIOA 4MNKA 5A2BA 3MMTA 5A2AA 3DH7A 3IJIA 3B8VA 1O5QA 2O9RA 4CNUA 1SFJA 3UA4A 1WCGA 2ZUWA 3GYCA 2DZUA 3S4TA 3NQBA 1JGMA 2Y7FA 2ZIDA 4K1WA 3NYZA 3KOFA 4XSLA 2QYGA 3W82A 3GZ3A 1FH8A 2J6XA 4E2VA 5DXYA 3RRXA 2YXXA 4KERA 3P0XA 5E6YA 3OOQA 1G7VA 1FHUA 3NYDA 3DUGA 5JBDA 5IHRA 2YBVA 4PULA 1QTWA 1GORA 1EZWA 3U9IA 1VFHA 2OZ0A 3KOZA 3RN6A 4CD6A 5A5WA 2OFJA 4KWUA 1UR3M 4N9DA 4OOZA 4DN1A 2QJJA 4WKFA 4GO8A 4LVFA 3JVAA 3II1A 4I6VA 2VZUA 1G4TA 1FHVA 2QDEA 1FWCC 3E2SA 3TSDA 2A3LA 4IQEA 4MKVA 3OZMA 3A22A 1L2QA 2DZPA 3B8IA 3HU7A 5DT7A 1O66A 1Q65A 1H49A 2PDQA 1RJQA 3E0IA 3W6MA 1FWAC 4BF5A 4UC5A 3TLLA 3BJTA 1XIFA 4LNYA 4WKAA 1Z3NA 1PL9A 4NHVA 5JIPA 2NT1A 3H54A 1I9CB 1O5RA 1RR2A 3SI9A 5IFTA 1AH0A 5C71A 4KFOA 1ZL1A 4LFYA 1SB3B 1ENUA 2ZX9A 5LNWA 1E1CB 4B90A 3NQCA 1UH4A 3QFWA 5C5YA 2VWTA 3CGDA 1XD1A 5G1MA 4JTUA 3T1GA 3N18A 2VKZG 2HQAA 3IJ6A 1Z7AA 5DELA 4QCEA 4Y9PA 2EJ1A 2VX7A 3OLGA 1RM6B 2Z1VA 4FMVA 4O1BA 1VF8A 3O0FA 1HJVA 3W1TA 4Q4SA 1GRBA 2VGFA 3V5CA 3VGBA 3EWBX 2ZUTA 5ABHA 3LADA 4QSHA 3W71A 3EAUA 2NUYA 2R1LA 3MI6A 1R9YA 2REQB 4FSAA 3V36A 1W9BM 1CXKA 3PBVA 3BOFA 2WBGA 3LEPA 4OUEA 4PZVA 1JZ4A 1HIZA 2BP1A 1I4NA 3G1DA 3T40A 1JRBA 1M5WA 4LGXA 4YN5A 2WMHA 3COTA 5CPLA 1S46A 5AC6A 2EJAA 4FX8A 1C7TA 3P6LA 3SCTA 3N25A 2C15A 3RM8A 3EOEA 4AW7A 4MYAA 1W9DM 1XYMA 1B2YA 3BSHA 8TIMA 1EYWA 3R13A 3ZO9A 3EOOA 1ZHAA 3NQ7A 4BR1A 2CU0A 3U57A 2FGBA 4DLFA 3SQSA 1N5WC 3FA3A 3WDJA 1EEXA 3BW4A 3J7HA 3W1AA 5HWNA 2V3BA 3WLRA 1HO1A 1UBPC 1F73A 3VKBA 1XC6A 1W3NA 2W0HA 4DEFA 2PDPA 5AYYA 1UB3A 3CUIA 3GTIA 3CPRA 4LEFA 2B7PA 3W74A 3WLQA 5ER0A 5CJ5A 4G2DA 3RHGA 3AC0A 3MDWA 3CHDA 2AAMA 3I65A 2W6RA 3VYLA 4JX6A 4IMGA 2H6RA 2MNRA 2XISA 3UWYA 3PPFA 1QAPA 4QE1A 4XAZA 4N9CA 3DFQA 2A2IA 4XBJA 1K9DA 2Z24A 1DXFA 5CSUA 4C91A 5M5DA 1GESA 1HKWA 5I3HA 3AYVA 4ADUA 1LOSA 5SWUA 2EG6A 3TQPA 4A3YA 1M7OA 3NGJA 3E0VA 4ZBCA 5FF7A 1DJYA 4UR8A 5EMYA 1XL9A 3O6CA 4BF9A 4HNTA 2J62A 3R25A 2H3BA 1UBSA 4C6KA 5JCKA 3C0LA 3PTQA 1JG9A 3HGOA 4RW5A 1QPNA 2YCLA 3NOYA 2ODOA 1XWYA 3JU2A 3QV9A 2RABA 5MHBA 4JHMA 4V1XA 2WANA 3UNDA 5FEWA 3RITA 4XK2A 3AYRA 2DEPA 2QJNA 4JTDA 4PTMA 3THDA 1WDSA 4C7FA 4LY4A 3CQJA 3RLUA 3WF1A 2J7DA 4NY2A 2I57A 1KGWA 1GXFA 3CWNA 2VTFA 4DXKA 2ZUUA 3GXFA 3LD5A 2D2GA 5BXTA 1TSIA 1R3WA 3VKDA 4EQSA 1V3LA 4XVDA 4H6EA 4P2VA 3AN1A 2BOEX 3R12A 3CTLA 1MYRA 2BXVA 2G8ZA 4ICMA 4AWSA 3ORWA 4LS2A 3QH2A 4H4SA 3KE0A 1HFBA 3SCPA 1JOAA 2Y7DA 1PWLA 5J8LA 3REQB 3FSUA 1A3WA 5TD4A 1CI1A 4HNUA 4XUGA 1AUSL 4U5IA 1K6WA 4LVDA 2XGBA 4I9JA 4IHCA 1TPWA 4C7GA 1DHKA 2WMGA 2B7NA 5GNXA 3HQPA 3U4FA 4QIUA 1EXPA 4B5WA 1TZ7A 1WDWA 3LERA 1J5TA 3ABRA 3CMJA 4KEVA 4GI4A 3PZGA 4QNWA 1UP2A 3AS1A 3G1YA 3T08A 2ISWA 2Y5EA 4L4MA 3RAOA 3LCHA 4JTSA 2WVSA 3WLPA 3P93A 1XICA 2J3NA 4MWAD 4PMDA 1PEZA 2ALRA 1RALA 2YR1A 3W37A 3TEVA 3ZT7A 4WLCA 2A3AA 3OB8A 3QOMA 2REQA 4X3ZA 3TSBA 3FYYA 3ALGA 1ZXIC 1F4AA 2PWDA 1X7FA 5LZLA 1UYQA 3S2CA 2C18A 3FGCA 1MSSA 1UH2A 4YJ5A 3BLFA 4G7FA 3HOJA 4BI5A 2HISA 3R6IA 1AJ0A 2PSNA 3GRIA 2CHOA 3HG2A 2NWSA 1FH9A 1R7OA 4Q7BA 1RV8A 1V03A 4IT1A 1JCTA 4MJ4A 4IIHA 1SZEA 1J12A 4G56A 3V0TA 1W9XA 1CLKA 3MHUA 5D9OA 4X22A 2VD9A 1OD8A 4GPNA 4IGHA 3AWNA 2QPXA 4IUGA 3JZUA 4J1OA 4XIMA 1JZ7A 3APGA 3II4A 1QHZA 3TJ4A 1Z32X 2GUYA 3NDOA 4TO8A 4H4UA 1Z41A 4W93A 3SCOA 3IUIA 3VD3A 4AD5A 3QR3A 5FS9A 3DKJA 1E6QM 3LCGA 3CMFA 5T91A 2ESCA 4YTTA 5CBIA 2KX9A 1KM0A 1XRTA 3CL8A 1Q6OA 1EBDA 3CC1A 3K46A 3UG4A 2NQJA 3TK7A 2ACQA 4MZYA 3DCPA 3I68A 4PRRA 4GY7A 1SUXA 3T42A 2D3NA 2H9AA 1VBUA 2XPKA 1DL3A 4Q4PA 4UTTC 5LGXA 1QU4A 4Q4MA 3BW2A 3P60A 2DZTA 4GJ1A 2OCZA 2DDXA 1BPLB 3BG9A 4F0MA 2OYKA 3L2IA 3ITLA 4E0CA 1XV8A 1PCWA 3UY7A 1GRAA 5JRBA 4F9JA 1VFOA 1GOMA 3EX6A 5M2FX 3F1QA 3GUWA 2YZ5A 1OJTA 2BODX 3UNTA 1UUMA 4FHAA 3RLGA 1JPMA 2WCGA 2HK0A 4JY9A 1CGXA 3V35A 1UR0A 2PRMA 4OECA 1UP0A 4R34A 3SGUA 3HQNA 1LRTA 2CITA 3D9XA 1M6IA 2WVVA 2W67A 4V27A 2WNNA 2NUWA 4C6BA 1JAEA 3L12A 2BBFA 2J7EA 3WG6A 3ABZA 1BQCA 3R94A 1X6NA 4B5NA 1EDQA 2EG8A 4AZCA 1N55A 1MWOA 4DLMA 3LPPA 2CEQA 3GFZA 5CZKA 1BVNP 3KRZA 4S23A 4FF7A 5IBXC 4HNCA 1LJYA 3AICA 2C16A 4AYGA 1CW2A 4IIBA 2QJIA 3V3WA 1PZ3A 3A4AA 3PWAA 4H4QA 4JQ4A 4GNVA 2AL1A 5C2XA 4PSRA 1GONA 2DH3A 7PTDA 5FS7A 3L67A 2R24A 2IPGA 4QBXA 3AOFA 4NXKA 2HROA 2FH6A 4PCPA 3SFKA 3W7EA 3EBVA 3WBYA 2SFPA 4P8WA 3DHDA 4Z0JA 5G2HA 1DV7A 1JFXA 2D3LA 1EH9A 1X8FA 4UQAA 1CYGA 1DIOA 4EM3A 1M53A 3UXKA 1UWAA 2E5DA 3CUJA 2R6OA 1EIBA 3E96A 5BW6A 3NO5A 3UW6A 3PZTA 4QROA 4PBEA 2POZA 1J2WA 2IQDA 3UPMA 3WQFA 4L1WA 1AL8A 1FWBC 4PUDA 4NEWA 2C3CA 3VIIA 2EG7A 1XCWA 3IGSA 2GYIA 1A5SA 3AIUA 3QSRA 4AVOA 2WC4A 2WK2A 3VGFA 5K9DA 1OFDA 3CL6A 4ZA0A 3IACA 1R30A 4I9AA 4GK8A 2W4XA 2GGHA 5IDIA 2GJXB 2NX9A 1RQHA 3BLPX 1DP0A 4DIAA 1K77A 3HF3A 2J78A 4FK9A 2FMOA 1GVRA 3FJ6A 4D72A 2WMJA 3S0CA 1PAMA 3Q45A 1OWQA 5AHEA 3QY8A 5JBFA 2J8GA 2CCRA 3Q67A 4E2OA 4PB5A 3QSTA 5XIMA 2RKXA 4Z2IA 3K8LA 2DV0A 3W24A 3B97A 3P74A 5AZ0A 2F6UA 3GNOA 1XYLA 4C1LA 3GDBA 3LPFA 1UKTA 1O6IA 4KEMA 5G2IA 3RR4A 2AKMA 3PG9A 2GR0A 5CG7A 3EDKA 2OQLA 1T7LA 2WOWA 3OZYA 5AVNA 1KWKA 5F1UA 4S1FA 3G3MA 4S39A 3B3DA 1DIEA 1ZCCA 3AXXA 3N6HA 3M0HA 1EO7A 2XFYA 4M24A 2HXUA 3VKCA 1JYXA 4MY1A 1HP5A 2TMDA 3UG5A 1ADOA 3WQPA 3SUUA 3PWGA 4DYEA 3TIMA 2RDTA 3BJSA 5KETA 1VBHA 5KINA 4JDYA 3T8LA 3IC9A 2EQDA 5DEZA 2WVUA 3QGVA 1SMDA 4W85A 5BU9A 3CYJA 4HQVA 3WNLA 1YXYA 3VNDA 5XINA 3NPWA 1ISWA 4BEQA 4CD8A 3URBA 1JUKA 4D9PA 1SYTA 2C91A 3CHCA 1WAUA 1P5BA 2OEJA 1GRGA 2KZHA 4GGBA 4H3DA 4TQTA 1Q8JA 2C1GA 4ORIA 1O5XA 4AEFA 5JVLA 2QNEA 1VEOA 2PWUA 3ARXA 1ITCA 1YW1A 3H55A 3MQTA 2DVTA 2WVTA 4MDOA 4MKNA 5CPMA 4QS6A 2WV8A 4JIHA 4XZ9A 2XIOA 4UOZA 1UUOA 2H8XA 2V3GA 2G96A 1FXQA 4WJ8A 5A8QA 1ZKQA 3DERA 3W1LA 4PMUA 1KBJA 2Z1KA 1HVQA 2JK6A 4JDRA 4DO6A 1OIFA 1S5WA 5D2VA 3U0HA 4ERAA 3DHUA 4AWEA 1H0IA 4UFHA 4DJFC 1E4IA 1UG6A 4JYFA 3SBFA 3CAKA 3U7VA 3POHA 2CFYA 2INEA 1UIOA 5DY2A 3IEBA 1GEUA 1E5JA 4LUSA 4ROQA 4UCGA 3S9ZA 1GVFA 1B30A 4GKLA 1YNQA 3F5JA 2VT0A 3MI3A 1XRFA 4XD6A 3FEQA 2RUSA 2VM8A 3NEHA 3W73A 3LRLA 1C3FA 2V5JA 4S3BA 3OBKA 1JCNA 3MVIA 3W01A 1O60A 1PTAA 3MMUA 1LP6A 2OELA 2FTPA 5JCLA 2WHKA 4YU1A 4MAZA 1I2OA 2X0SA 4YVPA 3SCNA 1TCDA 4HHMA 4ZOHB 4DPQA 3DXIA 1HJSA 1ZNNA 2VI0A 2ZVIA 3G24A 3GRTA 3R11A 4O13A 1KFBA 4AHPA 2F6XA 4UNKA 5CSRA 3R4IA 3F2CA 2NVKX 3A12A 3WMSA 5G1YA 1O95A 1P7TA 4US6A 1ONWA 1FX6A 2POTA 3IVSA 3OIXA 3THQA 4ENLA 2OGJA 1OB0A 4C6NA 1O4UA 4UTIA 1KFWA 1XSKA 4H2HA 1XDIA 3VDBA 1RSCA 4FOUA 1K6AA 2OQHA 2QLYA 1PX4A 2EHHA 2E8ZA 3NDYA 3WQVA 2HWGA 4D8ZA 1GG0A 4F0KA 4R7WA 1I6NA 3HW2A 3P2VA 3STCA 1ICQA 3BGAA 3ARRA 4JL1A 3WH9A 3WLTA 1E1CA 3V0SA 3WQOA 1QNOA 5D02A 3E0WA 4DO4A 1DJIA 1WUEA 4W5ZA 3QKEA 1NIUA 5RUBA 3ITGA 1V08A 1CGTA 1F2JA 3I4EA 1OX5A 3B0PA 3PJWA 1U5VA 2DJXA 3KVKA 1D8WA 3WUBA 4IWWA 3TH6A 4ZXOA 4QJ5B 4QHRA 3EWZA 1LL7A 1MZHA 2Y85A 3KVLA 4OKDA 3URQA 4CLMA 4YYCA 3SIZA 2Y1HA 7ENLA 1FWDC 3GYEA 4AZIA 2NQLA 4O15A 1PYFA 4P7OA 4M6QA 1F61A 1ZY9A 1UMLA 1UPMB 2C14A 2GGIA 4L64A 4Y9AA 3TR9A 7CGTA 4P7RA 2P1FA 3NUKA 3I7QA 2DT0A 1PZ1A 3KXQA 4EQXA 1HGYA 4QE4A 4ZQOA 3LV6A 3NQVA 1K8YA 2VEIA 3GXNA 4LV9A 3NAVA 2W55A 4EX4A 5K9CA 1OFBA 1NP0A 1HVXA 2JKEA 3NURA 1CIUA 1EP3A 3I10A 2WC3A 3BMVA 4PUEA 3SIMA 4W88A 1VYSX 2G41A 3GTNA 4JQAA 3T9PA 5EU9A 1OFQA 4HNNA 3NJ3A 4WDUA 2XTKA 1XYBA 1MO9A 1UHVA 1G7UA 4NU7A 1XIJA 1RLCL 3QQ0A 4E4PA 2EPOA 2ZDRA 1UD5A 4FB7A 2VC6A 2JIWA 3UZYA 2TSYA 2E68A 1GJWA 3NM1A 3MBDA 3ONCA 3TC7A 4FLQA 5L9FA 2GSHA 5CC3A 2QCGA 4AD4A 2DSKA 2PGEA 3AZRA 4AVFA 3B8WA 2D24A 2HEJA 2Q8XA 7A3HA 3T0BA 2X41A 1V7AA 3GNRA 3LGEA 5F4SA 1QCWA 4GZEA 2V9DA 3KVMA 2O9TA 4EAMA 1W1PA 1AMYA 4UTUA 4S3KA 3H7RA 3M5XA 3T44A 4JNYA 3R07C 1E6XM 1A49A 2I7GA 1AW2A 1XLFA 4MB4A 3UCDA 4V33A 1A5CA 4IXHA 4PMJA 4NNAA 4QS5A 1Q6EA 1K9TA 3EB3A 1PB0A 3L0KA 4DWSB 2VDGA 3OVPA 4YNGA 5GNZA 2GQ3A 2JGQA 2RDXA 3NXLA 1OFRA 3W38A 4MB3A 2EPHA 3DDMA 3TTSA 1C92A 3G3DA 1DWFM 3AS3A 4LAUA 5MKGA 4GIRA 2BGQA 4HHLA 2F2KA 1ZZMA 1FFRA 1OBAA 3QC0A 1NTHA 4A8IA 4J3ZA 1NWRA 3B8TA 5FCZA 1LL4A 2DVUA 2O9OA 3RX3A 3NTYA 3VILA 4HOWA 1QPRA 4PFHA 1J01A 5DY3A 1VP5A 1SVDA 3N2CA 1VC4A 4C5YA 4JDBA 1GZJA 2P8CA 4Z42C 3STGA 2OWCA 3ZYZA 5LSMA 3NVZB 4OU1A 3G77A 1D7FA 2A3EA 3GB6A 3UG8A 2A7PA 1LG1A 4APNA 2V3FA 3OVGA 1K70A 4L7ZA 3G2GA 3K1DA 2QCCA 4GRSA 3FYOA 2YL5A 2OR2A 1Q85A 3B4YA 4IP5A 1PZ0A 4AF0A 3WFZA 5D09A 5CBJA 3MUZ1 4GXPA 3DENA 1ZQ5A 3WNNA 2ATMA 2IQ0A 5A8PA 1UD2A 2ZTJA 1TR9A 5AYXA 5DCDA 3K5XA 1KM5A 3W1XA 1ZALA 1TTIA 3Q37A 3RCNA 3KHJA 3TN3A 3EF6A 1S5VA 1E4LA 2MANA 4UMAA 2HNHA 4S3EA 4HOZA 3NQDA 3KTSA 3AZTA 2CXGA 2E7FA 1H41A 4REQB 4GVFA 4ERGA 1IIGA 3IK4A 3O2LA 4AU0A 5FEPA 1XJBA 4UR9A 2WQPA 3P62A 4HCHA 3BLEA 3KUMA 1WV2A 2VGGA 1Q4WA 2QUMA 1KRBC 4LUIA 1RVGA 3PNUA 4GABA 4OV9A 4A22A 2VX6A 1U2YA 2X09A 2GSEA 3TXVA 4YVXA 3H2EA 2W91A 1QNSA 4K7ZA 3UWVA 1U5HA 1GSNA 3PJXA 4Y8EA 3GVVA 3GIYA 1Q7QA 3OP2A 3WJXA 4AMCA 4S38A 2ZYFA 4GUJA 1DXEA 4JKKA 2A4AA 3EPNA 5FJJA 3CNYA 1KXVA 3V7PA 1ME7A 5C9WA 5BZAA 3WQ4A 1RCQA 1B9BA 2DU2A 1C8QA 6ENLA 4JIPA 2P8BA 4HU3A 3U2EA 4ZVJA 2ZADA 3GAKA 1AQFA 2FZDA 1GYNA 3BSGA 5DRCA 4PR4A 3M43A 2QV5A 2QDGA 2O4MA 1E71M 3RGTA 3S3GA 2ISSA 1DYSA 4GMEA 4IGMA 1V4YA 1AJZA 1PHQA 2HCVA 3C0JA 2VQTA 3M5ZA 3H70A 1CB7B 2BHUA 4YCPA 1W8GA 2QVNA 4FO4A 1XW8A 3JR2A 4NIRA 2F8QA 3C2EA 4Y8FA 5DCBA 2W79A 5CPOA 2GOKA 2HBXA 1Q6QA 3KL5A 3W81A 4D6JA 4AIOA 1RPXA 4LCRA 3FA5A 4LV4A 2GVYA 1EB3A 5CPTA 3BANA 4AD3A 3KWXA 3ES8A 3LX9A 3N6QA 2E25A 4N9BA 3W1PA 5CLTA 2PGRA 1UOKA 4DVOA 1JZ5A 1B9ZA 1TJRA 2ZZ5A 2VUYA 4HTYA 2GDVA 5DMNA 3NQ8A 2YFOA 2WMFA 4DAFA 2QCDB 4AG0A 5HDRA 4L9ZA 4KCVA 3SGZA 4YHGA 1YRRA 2WWDA 4KESA 4G7EB 5FF0A 1AQ0A 4RDZA 2WO5A 1FWGC 2C3ZA 4ZSUA 1MO0A 3MUXA 5CKSA 1X2HA