3ZVHA

Methylaspartate ammonia lyase from clostridium tetanomorphum mutant q73a
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
415
structure length
414
Chain Sequence
b'MKIVDVLCTPGLTGFYFDDQRAIKKGAGHDGFTYTGSTVTEGFTQVRQKGESISVLLVLEDGQVAHGDCAAVAYSGAGGRDPLFLAKDFIPVIEKEIAPKLIGREITNFKPMAEEFDKMTVNGNRLHTAIRYGITQAILDAVAKTRKVTMAEVIRDEYNPGAEINAVPVFAQSGDDRYDNVDKMIIKEADVLPHALINNVEEKLGLKGEKLLEYVKWLRDRIIKLRVREDYAPIFHIDVYGTIGAAFDVDIKAMADYIQTLAEAAKPFHLRIEGPMDVEDRQKQMEAMRDLRAELDGRGVDAELVADEWCNTVEDVKFFTDNKAGHMVQIKTPDLGGVNNIADAIMYCKANGMGAYCGGTNETNRSAEVTTNIGMACGARQVLAKPGMGVDEGMMIVKNEMNRVLALVGRRKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLASPARTATE AMMONIA-LYASE
molecule tags Lyase
source organism Clostridium tetanomorphum
publication title Engineering Methylaspartate Ammonia Lyase for the Asymmetric Synthesis of Unnatural Amino Acids.
pubmed doi rcsb
total genus 158
structure length 414
sequence length 415
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
A PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3zvhA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3zvhA01
2OZ8A 3OP2A 1SJAA 1BQGA 5EU9A 3MY9A 3CT2A 3CXOA 3R0KA 6ENLA 2QJMA 1EC7A 3OZMA 4DXKA 3ENLA 3TJIA 3SQSA 1KD0A 4HNLA 3S47A 2PSNA 3TJ4A 1JPMA 1TZZA 2DW7A 3P93A 4A6GA 3GY1A 3IJIA 2QDEA 4DYEA 1R6WA 1XS2A 4GYPA 3ZVIA 4G8TA 4MMWA 2GL5A 3DDMA 4H2HA 2PU1A 3THUA 7ENLA 1JCTA 2XH2A 3DG3A 3I4KA 3Q4DA 1FHVA 4GIRA 3QLDA 4FP1A 4KPLA 3T4WA 3BJSA 4H1ZA 3QTPA 3QKEA 4Z17A 3OZYA 2P88A 1P48A 4IP5A 3MKCA 4HCDA 3SN4A 3UJEA 2PP1A 2ONEA 3FJ4A 4Z1YA 2QQ6A 5FJPA 1WUFA 1ELSA 1NELA 4K1WA 3UGVA 4MGGA 2OFJA 2XSXA 4E4UA 4KWSA 4HYRA 1ONEA 1FHUA 3N4FA 3D46A 3T8QA 2ZC8A 3TWBA 5BOEA 3JZUA 4J3ZA 4HNCA 4H19A 3EEZA 2PGEA 2GGEA 3UXKA 2OLAA 3NO1A 2MUCA 3PK7A 2GGJA 4E8GA 4DN1A 1KKOA 3GO2A 1SJBA 4E6MA 4E4FA 4H83A 4KEMA 3TTEA 2GSHA 3V4BA 3RGTA 3UJFA 3FXGA 2HNEA 3QN3A 3V3WA 4JN7A 4EWJA 3NFUA 4X2PA 4ZCWA 2PU0A 2PMQA 4M6UA 3DERA 3B97A 3P0WA 3KUMA 3TCSA 1EBGA 2DW6A 3BOXA 3DESA 4GMEA 4YWSA 3SSZA 4IT1A 3FV9A 2AL1A 2PP3A 1EC8A 2P3ZA 2OZTA 1BKHA 4G7FA 3PWGA 3STPA 3P3BA 2OKTA 2AKZA 4HN8A 3QPEA 1RVKA 3U9IA 1SJDA 3T9PA 3VFCA 3MZNA 1XPYA 3N6HA 1MDLA 4F4RA 2P0IA 2FKPA 3VCNA 2HXUA 3V5FA 1W6TA 3DEQA 1KKRA 1MUCA 4GGBA 1NU5A 3SBFA 3MSYA 2MNRA 4HPNA 2FYMA 3VCCA 2QGYA 4MKSA 3DIPA 2QVHA 2OQHA 2PODA 3H70A 2XGZA 1TE6A 3MUCA 3HPFA 3ZVHB 2OQYA 3RITA 2PTXA 2HXTA 5FJRA 2ZADA 5FJTA 2PTYA 4IHCA 3RCYA 2PTZA 3PFRA 3GD6A 2PS2A 4GGHA 4K8GA 2PGWA 3R1ZA 5IDZA 1F9CA 3DG7A 4GYPC 2XH4A 1ECQA 1WUEA 3VA8A 1IYXA 3NXLA 3JVAA 1YEYA 3Q45A 1JPDX 3BSMA 1MDRA 4KT2A 1EBHA 3RRAA 3UXLA 3FVDA 4A3RA 4M0XA 4HCHA 3ZLFA 1TKKA 4ROPA 2OG9A 3ES8A 3H12A 1L8PA 5BOFA 3ZLGA 2AKMA 3VC6A 3UCDA 2AL2A 1PDYA 5ENLA 3CK5A 3FYYA 1P43A 4DWDA 2P8BA 2XH7A 3DFHA 3EKGA 3JW7A 3FCPA 3MQTA 1JDFA 3V5CA 1KCZA 3R11A 1OEPA 3H7VA 3OW1A 3ES7A 3VDGA 3TWAA 3R25A 4ENLA 3ZVHA 2PP0A 3UJRA 3TOYA 3K1GA 5J04A 5FJOA 3MWCA 4GISA 3N4EA 2O56A 2PTWA 3TW9A 4IP4A 4IL2A 1DTNA 3SN1A 1R0MA 1EC9A 1PDZA 2QJJA 3DFYA 2QJNA 3TQPA 4FI4A 2QDDA 3OTRA 4JN8A 4ZA0A 2I5QA 2NQLA 2OZ3A 3CYJA 3OPSA 4DHGA 2OPJA 4J1OA 3UJ2A 1E9IA 2GDQA 3N6JA 4DX3A 4E5TA 3CB3A 4A35A 2OX4A 2PPGA 4IL0A 2PA6A 3DG6A 3I6EA 3IJQA 4K2SA 2AL2B 3GC2A 3D47A 4IZGA 1SJCA 3UCCA 3DGBA 2PCEA 3IJLA 3S5SA 3NZGA 3ZLHA 2OVLA 2GGIA 2CHRA 4HCLA 3CAWA 2HZGA 3RO6A 3IK4A 4GFIA 3SN0A 1MNSA 3R10A 2OO6A 3RR1A 1MRAA 4JHMA 2GGGA 3UJSA 2XH0A 2RDXA 3VC5A 3T6CA 2GGHA 2P8CA 3H8AA 3SJNA 3R0UA 3U4FA 3I6TA 5FJUA 3PWIA 2POZA
chains in the Genus database with same CATH superfamily
1GOWA 3RG6A 1BQGA 1DXIA 4FNTA 2FVKA 1YYAA 3IV3A 2VMFA 2Z00A 1OT1A 3OZMA 4F0HA 4TTGA 1BSLA 4PBEA 4U5KA 2KZHA 3FEQA 4AY1A 1CXFA 1K4QA 1U83A 1XG3A 4YVPA 4PODA 3CGEA 3N04A 3E9AA 4OGZA 3TYEA 3QOMA 4DBDA 2EKCA 4E3TA 1SZEA 1CDGA 2PD9A 3PPHA 4L6OA 4FP1A 2EQDA 3BJSA 1EJRC 3P81A 3WF3A 1IWBA 2DEPA 2P88A 4PTXA 2W79A 3D3FA 4G5DA 4NIRA 4OECA 5LIUX 3NQDA 4ZQCA 4O53A 5FJPA 4MF4A 5KZEA 4H50A 1H7OA 3MC5A 1SFSA 3W26A 3NRZB 1PIGA 1I9CB 2V8ZA 1A4MA 3QYSA 1F74A 2QCCA 1REQA 2E9BA 4KWSA 1DTUA 1KQYA 5JIPA 2ZDRA 3A6OA 2A1YA 4FLRA 3CTLA 5A8OA 4OKDA 5CLWA 3AMLA 4FNRA 4PUKA 4R3UA 3WBYA 2MUCA 1S5NA 1OFBA 2WJEA 3CAQA 3ITCA 1O60A 1G67A 3BO9A 3QR1A 4QTGA 3CQHA 5JU6A 3H2CA 3F2DA 1DP0A 1JZ7A 3ANYA 3AHVA 2WQPA 2NX3A 4H4RA 4GZ7A 4C6LA 4AAJA 1CYGA 4LSBA 4X2RA 4AD4A 1ZXIC 3H6OA 2GUUA 4AZCB 3U2EA 1UHVA 1WAWA 3THCA 3EXTA 1YLVA 1EB3A 1PB0A 3S6OA 1SGJA 1NSJA 5TBOA 1BWCA 4B5SA 4J3TA 4OBSA 1GZJA 1B3ZA 3B97A 1N55A 3IANA 4TOQA 3RCNA 3WG6A 3UEQA 1OQFA 5A2AA 4V27A 4WD0A 1Z41A 3OZPA 4GZIA 5DX7A 3G1HA 4EANA 4AZIA 2YA2A 3CQIA 3KBMA 4Z1CA 5A8MA 1XH1A 1G0CA 3CBWA 3UWUA 1AG1O 4AYSA 9RUBA 3B9OA 3VUSA 4RW5A 3WJZA 4P7RA 1WA3A 1EEXA 3T1GA 3GG8A 3VM5A 2P0IA 1FDZA 5LNVA 1YXCA 3DEQA 5K4ZA 4W7UA 2FZDA 3PPCA 1W1YA 1OFEA 1DXLA 3QQWA 4IIEA 3XINA 1QVBA 2EBNA 3L12A 3C2FA 2OEKA 1GVEA 5I3IA 3TNOA 2QGYA 4MKSA 3QVQA 3P74A 2D3LA 1TSIA 1GQKA 3EOSA 3CUXA 4ECLA 1TE6A 1YDNA 1P7TA 1TPUA 2C15A 1XIEA 2OQYA 1BYCA 2PTXA 3AXXA 2R1NA 1F3WA 1WDDA 4PTVA 3IWPA 1H4PA 3N18A 4JQ9A 5HDRA 1SZGA 4ZXOA 1WYGA 1JNEA 1LG2A 3MMTA 4F2TA 1FCUA 1PKMA 2JALA 4H6QA 7REQB 4O16A 4UXDA 2PGWA 1B57A 1GOKA 3PY2A 4NF7A 1KM4A 1IYXA 2FPTA 4WRHA 1UWSA 4P8UA 2F8QA 4WSJA 3NQGA 4NJIA 4V2XA 1YDYA 3D5HA 1A3WA 3OQ8A 1X8CA 3LM3A 1GVOA 3VGEA 2J7HA 5AHFA 5AYXA 5DBUA 5G1YA 3U7BA 1W5OA 2AOSA 2A3BA 2XIQA 4PUDA 2G97A 1G4PA 2AMXA 4RW3A 1S5MA 2C0HA 4Q4OA 2PDJA 3KCJA 2Y8KA 3TSDA 4ZL1A 1T99A 2E5CA 1KFLA 4ZBCA 2E8ZA 2NT0A 2P8BA 4ACZB 1LM1A 5FF3A 1E0VA 1JDFA 3WLMA 3RIKA 3IGXA 1ZENA 5CPTA 4JFWA 4N9CA 4GVFA 2WVSA 2PDQA 1NF0A 2W62A 1UD8A 2QF7A 3USZA 3GH4A 3RO8A 2XIIA 3DGRA 3BGGA 3B03A 3N2BA 1XBVA 5LNUA 3VKAA 1Q6QA 4F8XA 1GSNA 1MZRA 3BCFA 3PBYA 1KFEA 1WP6A 2W27A 1RR2A 3S5ZA 3RNDA 2V3EA 3GYEA 2DZBA 1HL2A 3W70A 3UNTA 3FYOA 2AMGA 4WK9A 1I2NA 1B5TA 3FHAA 1KXQA 1HW6A 3CZJA 3UYIA 2IQTA 2XVNA 1DQWA 4NL1A 4A35A 3RPTA 3IJQA 3KOFA 4Q8WA 3BMXA 2WM0A 3ISIX 1E0WA 2Q6ZA 1TPDA 1H1ZA 3B9NA 2VC6A 3N6QA 3HURA 3P5ZA 2EHHA 3W81A 4H9TA 5I7GA 2FHFA 4DZIA 3SGUA 4H4WA 1VBJA 1I4NA 5MF5A 1M5WA 1UD4A 4LYRA 4NNAA 4JOMA 4N6EA 2FZNA 2PDIA 4BQ3A 4GFIA 3EDKA 3VZYA 5HNNA 3O1NA 3ARXA 2DH2A 1K8YA 4WGXA 1MOKA 3PUOA 4NRRA 4OUIA 3UVIA 3WSUA 2BP1A 2D20A 3VX1A 2VOMA 1FEBA 1E5NA 2Q09A 1AD1A 1OX4B 4IIHA 2X1UA 4QDWA 3L0GA 2B7OA 3TQVA 1GVFA 4NNBA 3LV5A 2FHCA 3AMKA 1IZJA 4PSRA 1VS1A 3TXVA 1B2YA 4UOJA 1EEPA 3CT2A 4M7SA 3TSBA 3UNDA 3K30A 3AS1A 3AYTA 5D38A 2W61A 3S47A 3K4WA 1Y5WA 4MM1A 3UZXA 3TJXA 3C2OA 4NASA 3CUJA 1BYDA 3C6CA 2FVLA 4H4SA 3GG7A 1PUDA 4IJRA 3THUA 5JCKA 3GSMA 1D8CA 4O17A 2ZVRA 1PS9A 3CUHA 3N17A 2G3FA 2J6XA 5HAOA 1G4EA 4GWEA 3W24A 3F2BA 5E70A 2ZBTA 4FX7A 4C6IA 1V79A 1GQIA 1XLHA 5A94A 4HZ7A 1K02A 3TA9A 2D23A 1A0EA 1AL7A 2WC4A 3H4WA 2VFGA 2PWGA 3TU9A 1NP0A 3N4FA 1OBAA 3LRMA 3RUBL 3T8QA 3AC0A 1J79A 1FWBC 4DWSC 2C0AA 1Q4WA 5LXXA 3T40A 1F3EA 2MANA 3WJXA 3V18A 3CH9A 2J4GA 5C71A 5FS9A 3LYEA 1W54A 2E09A 1L0PA 1LLZA 3C61A 4LVAA 1MI3A 1PZ0A 2BXZA 1KM1A 2EO7A 4NJGA 4JTLA 2DZUA 4U31A 1VPYA 4YWOA 3QMRA 3QMSA 4H83A 4TMBA 3S1UA 4MJMA 1TMHA 4BF7A 5HNTA 4G2DA 4HN4A 3ZR6A 4A8IA 4CQ9A 1QJWA 3MMDA 1GEUA 3LV6A 3NQVA 3EEGA 1J0ZA 2A0NA 2FB3A 1Y0EA 2QHAA 1GRBA 1BWLA 3GU9A 9XIAA 1SZRA 1YTEA 4O0QA 3HV9A 2FGLA 2FH8A 1AW5A 3NPXA 3LLXA 4C6NA 1W1B1 1SYTA 1Z7AA 4YTSA 1YW1A 2DPEA 1LZOA 3KBSA 1EC8A 3DHFA 5CC7A 4PMVA 2ZA2A 3M5VA 4QEEA 1UKQA 4PUJA 2BB0A 3M6DA 2NSOA 1JZ6A 2BHZA 2F6UA 3GD3A 1TO3A 5I24A 4KIEA 1D2KA 1EJUC 3VOIA 1EFZA 3LRKA 4ZR8A 1E9LA 3AIWA 1AD4A 1XL9A 1C3FA 1BD0A 3VOJA 1AQ0A 4HZMA 2DGAA 1TV2A 1V08A 1SB3B 2J7DA 3PUGA 1M6IA 4LNYA 1E6RA 3L5OA 5EMUA 4P7LA 3K2GA 4QHRA 3CH0A 1UPPA 2DVTA 1GW9A 3A3XA 3SQLA 4Q6JA 3BLOA 2WBKA 4P8XA 3W1NA 4JFVA 4LV4A 3DGZA 2GR0A 5JBFA 2XZ9A 4H2CA 3TYAA 1PXGA 3DI0A 3HV8A 4QX4A 1JQVA 3G6LA 1G4TA 3LI0A 3F4CA 4M8UA 1X98A 5CG0A 4QLLA 3UFYA 1JFXA 1S5VA 3VIPA 4UCFA 3DG7A 4LBUA 2NXIA 1GZGA 1JOAA 1H11A 1WUEA 2WB5A 5MKGA 3OVQA 5A6TC 1YEYA 3BAJA 3EPNA 4D6IA 4JDYA 5HNRA 3AFBA 1KNWA 3EXRA 2F2KA 2W67A 2V81A 1EBHA 4FK9A 3E2RA 3QW3A 3BAIA 4N9BA 1D3GA 4EX4A 4PMUA 3KVKA 2ABAA 3UXAA 3L0KA 4Z42C 1UWAA 4JAWA 1W1ZA 5EB8A 4EOUA 3UG8A 5A8GA 1H1YA 3WD4A 1QUMA 4S1FA 2DJXA 3RPDA 2PCQA 1FP8A 1BRLB 3ATZA 4DEFA 1J5SA 4XVEA 4GI6A 3B0VC 4WGHA 3U0HA 3GIQA 3NYZA 3BAXA 3ES7A 5U25A 3GHRA 4J3XA 1XYBA 4L9XA 3ZT7A 2PZ0A 2OYKA 3W53A 2PC8A 4GNVA 4K7YA 2VWSA 5J04A 1ISVA 2VELA 3MWCA 3ALFA 4YXGA 4PCFA 2GYIA 3WH8A 3HJZA 3WDQA 4IMAA 2LLEA 4XVDA 2CDUA 3NYDA 4MFEA 5D2WA 2A6LA 3AYSA 1YPFA 2YDAA 4JTKA 1ZY9A 2QJJA 1PJ9A 2B4GA 2VO5A 4AF0A 1D7FA 1H1NA 5HA7A 1VFFA 1Z8AA 3BLEA 4C7GA 2Y8VA 4XZ9A 3UWQA 3IARA 2Y70A 3W7GA 3CL6A 1FQ0A 5XIMA 3IJ8A 3OPSA 1BZLA 3E0VA 4AZHA 1TV3A 1UUQA 1T7LA 4KH2A 4LU0A 3BAYA 1J0KA 5A8NA 1HJXA 4JEJA 3NZPA 1OCQA 3GUWA 4KEUA 1EWDA 2CCRA 3ZLHA 1OX6A 1YRRA 2OJPA 2YLLA 2E25A 1V8EA 3W7MA 2XFYA 4ROQA 4ATDA 2A6NA 1LUCA 1UUMA 2W66A 1WYIA 3NDOA 4GH3A 3T6CA 3C0QA 3SJNA 3HJEA 2W54A 3KP1A 4DLMA 1JULA 3GR8A 3WH6A 4UFIA 3WBAA 1RY8A 3WUEA 3PSVA 3W4RA 2VDHA 2X41A 3UR8A 2OXNA 3WDIA 1JCXA 1ZQ5A 3GXNA 5EU9A 3L5AA 3DFSA 5I3JA 6ENLA 4WIWA 4WY0F 4IIDA 4RX0A 4HPGA 1QDSA 4XSLA 3SRDA 1TZZA 4LAMA 4AVFA 1SQ7A 3XISA 1THFD 3EWZA 3ITOA 3D0CA 2YFNA 3L5MA 3T0AA 5FL0A 4LJ3A 1JUEA 1PZ3A 1JCTA 4US6A 3A4AA 3PZUA 1OFOA 2DJLA 2XWDA 1OFDA 3T4WA 1R2SA 4A3HA 1MQPA 3OZYA 3FAWA 3U2OA 3GW0A 3SN4A 4ZE4A 1JL8A 4LEFA 4K1WA 4EXBA 4TUFA 1X1OA 1Y5VA 4XUYA 3LZ5A 3DYMA 4AD0A 1E1EA 3G2GA 2WK2A 1OINA 5AVNA 3D46A 4GVHA 4IGSA 2QIIA 3IIPA 3H24A 3QZEA 4MB5A 2PRMA 2V5JA 3MCNA 3NQCA 4U10A 2XYLA 1NWRA 2Z27A 2D2OA 1NDVA 4GI9A 4RK8A 3OEXA 5AYYA 4PMJA 6ALDA 3T7VA 4GA8A 4PMZA 4ZTXA 2PEVA 3KWSA 3OODA 5AOUA 5MHBA 1JZ8A 4Q8TA 2AQVA 2PDPA 4GUHA 4QRNA 4UOQA 3S5OA 2YSWA 3UZ5A 1OCBA 3O6DA 2IKJA 1WZMA 3DU0A 4KFPA 4AD1A 5I3DA 1KM0A 3GM8A 3N2CA 3Q65A 5FAGA 3UR5A 4XO7A 3T2PA 5BWAA 3BAKA 3ZSSA 1TTQA 1P6BA 2YCJA 1Z3NA 2GWGA 2VZTA 1GNXA 2BSLA 4XD3A 4C1NB 5E6YA 4MWAD 1E0UA 4IT1A 1PKLA 1V3IA 3EKZA 4QNEA 3ZZ1A 1PO9A 3M6YA 3T42A 1UKTA 2Z1BA 4HJWA 1EGMA 1DV7A 1P4CA 2F7FA 1J0YA 4QS6A 1CNVA 4K37A 1EF2A 4N2YA 4REQB 3REQA 4B2DA 1SZFA 2QCHA 1UWQA 4GY1A 3CL7A 1M68A 2WVUA 2QR6A 2BGQA 3BMVA 2Z2UA 1CXEA 1UKPA 1SUXA 3A12A 3W75A 4NP7A 3WDJA 1KKRA 4QP0A 3T44A 3QV8A 4UFMA 3VGBA 1XDLA 4GD0A 1EHAA 2W0UA 2ZRYA 1PTAA 3W74A 1TCDA 1PTDA 3DZ1A 5H91A 4Z1AA 2VXNA 3H2FA 3SFKA 1W1VA 2GJPA 1V77A 1BG4A 4ML9A 3NQ2A 4W7WA 1T8QA 4MOZA 4NJKA 1US0A 2A21A 2Z28A 3GZAA 4EQXA 2PWUA 1GXFA 1ZRQA 2ZA3A 1WBHA 3W00A 1QFEA 2YFOA 4GPNA 2O7SA 3R7MA 1QMLA 3DECA 3SGGA 4YVVA 1FP9A 3ALGA 4AWSA 5CQ1A 1CB7B 3BC9A 3VA8A 2PC4A 5KMYA 1EL3A 2RABA 3QM3A 4ADSA 4FS9A 2FB2A 2WSQA 2VYOA 1WBJA 4Y8FA 1JAKA 2R9ZA 5GVJA 3R5EA 4JIPA 1XC6A 1TIWA 3RYSA 4XZIA 2J7FA 3VOHA 1EXPA 2V2CA 3UXLA 1XYCA 3E1F1 3MSRA 4JFSA 3CQJA 4EWND 1L8PA 3I65A 1XIFA 4Z08A 3KTXA 1RZMA 4W86A 3CAVA 5E1QA 3GWQA 2J78A 1KBBA 3SCVA 4XTIA 3MMUA 1LG1A 3OU8A 3WQGA 2RJHA 4AD2A 5DY3A 3HTWA 4CQDA 1W1A1 3LXAA 5GRTA 3VNIA 1IHIA 3T05A 1Z9AA 1HJUA 3EKGA 3WQDA 3AZSA 2HK1A 2BOEX 4YTTA 1E6XM 1B0IA 3NOYA 3S9IA 5AC4A 5JCNA 4K36A 1UUOA 2W6RA 3NQAA 2RGLA 1NTHA 3WLQA 1MO9A 5BWFA 4MTVA 3WH7A 4CQBA 1CGUA 1TQJA 1LPFA 3E96A 5FS8A 3DX5A 1T8XA 1BPLB 5HANA 3W9ZA 5T26A 4IP4A 3RAOA 3GHSA 1F3PA 1OZMA 1U5JA 4UTIA 2WHMA 5HQMA 1V0LA 3OVRA 1J6PA 4Y9OA 4QLKA 4O4VA 1UOKA 1XISA 1NH6A 2BX7A 4GY7A 3SY8A 2QJNA 1ZDLA 4K68A 1I6NA 1UWUA 1F76A 4F79A 2CKRA 2ZOXA 4BA0A 5DCEA 5K3VA 2I5QA 1VR6A 3P2VA 3N12A 4WKHA 1E9IA 4ICMA 4GI8A 5AHEA 2GJRA 2OLHA 2CPUA 3GC2A 1DBTA 1VHNA 4CNTA 3D47A 1C90A 1I60A 1IF2A 1UJQA 2RJGA 1D7KA 4H8HA 3IUHA 1KGUA 3AWNA 1FKXA 2YZ5A 4GO8A 5M03A 4O14A 1MUWA 1GOXA 2ZX6A 1F2JA 3RO6A 4YLWA 3VDHA 4M19A 3B40A 1UH4A 2RHGA 1FWWA 4XV0A 3FSTA 1IT7A 4XAZA 4KWWA 1ISZA 3BXWA 4B15A 3WELA 4Q8OA 4WJEA 4NILA 3KRBA 2ZUNA 1K8ZA 5GNZA 1CW2A 5BRPA 1VAHA 1KRMA 5FJUA 5F2LA 3KHJA 2DORA 4OVXA 4AG0A 4MWAA 4Z2GA 4JX6A 5CJ5A 4ERIA 1KN0A 1TPWA 3P7YA 4J2PA 2VM8A 1VLIA 2HV5A 4ORIA 5G5GB 3O63A 4DXKA 4N9EA 4HNLA 1TA3A 2IPWA 5M1TA 4BURA 4WUIA 2OKOA 5FEZA 3W6LA 1VGAA 3OBAA 3IJIA 3N73A 1GYMA 5KVIA 2J24A 2I14A 1XG4A 4G8TA 5CC5A 1PVNA 4WKAA 2PWVA 1UR8A 4S3CA 1TWZA 4EPKA 2B7NA 1EF3A 3GFZA 3TTYA 4FNQA 3SJ3A 4O15A 1RSCA 3HIJA 5JCLA 3KS5A 1ZU8A 4Q4SA 1E15A 2ACSA 3VIJA 1RAKA 4KS0A 1AW1A 2WOIA 1YQ2A 5I78A 4IMCA 1UQZA 4H8UA 2CFFA 1OCJA 3FA3A 4MGGA 2PLCA 4F0MA 2WPEA 1V7AA 1IEWA 4HU8A 2WMFA 4PSPA 3PPFA 1XJBA 4XD4A 4MKNA 2PTDA 4YCOA 2ZA1A 3WD2A 3SURA 3POCA 4QLJA 2AGTA 3KBNA 4J3ZA 3GE7A 3G77A 2PGEA 2WAGA 1GJPA 1UKSA 3NO1A 1J0HA 1WZKA 1A0CA 3BQ6A 3ICJA 5C55A 2C71A 1SJBA 4WX2A 3AYRA 4IICA 3NSMA 2VD9A 4DO6A 3GVGA 1EO5A 1B1YA 4GVIA 2WZIA 2XFRA 3OO2A 3UJFA 4ZGYA 3OLGA 2D1ZA 3QN3A 3ABRA 3KZPA 1RQHA 1FTXA 2XIJA 1GQNA 2W5FA 5D9PA 4BHYA 3KBVA 1FY6A 3ZOAA 3W7CA 1R3TA 3GD4A 2J9YA 4RXFA 3VDCA 3TVAA 3GIPA 3NPWA 4M6QA 1F05A 3WD3A 2A2IA 1OC7A 1TPFA 1S5WA 4RDYA 1VFTA 1TB3A 4IXHA 4MWAE 3LHWA 4DNHA 3O05A 4GC4A 2FHBA 5I06A 3WJYA 2CZVA 3M47A 1L8NA 2VJXA 5CLTA 3PWGA 1QNQA 1YBQA 3S9YA 3TAOA 5F7UA 1FRBA 1J5TA 1B4KA 3MSDA 1RVKA 3LPGA 2X7VA 2TMDA 3B06A 1ZJIA 1ZP3A 4E0CA 4IPPA 2RGMA 1X7IA 4IGHA 4JN6A 1FA2A 1W5MA 1M7OA 2J77A 2Y24A 1A3HA 4S3EA 4GUIA 3CHEA 3WCZA 5DMLA 2DH3A 3PG6A 4CU6A 2PODA 1O94A 3GVRA 4Y9MA 4C90A 5DF0A 3R8RA 3QHOA 3T55A 4MWAC 2DSVA 1KRAC 1LLWA 3GU2A 2GJXA 5DELA 5GQBA 3S1XA 4RE2A 2Z7KA 4CNSA 1H7PA 2IPJA 3BJFA 1G7VA 3RF9A 4UWMA 4PCNA 1E4LA 4K8GA 4RLIA 3BZJA 3EDEA 3GDKA 2X8RA 1K6WA 4GG9A 2TPRA 4YN5A 1XW8A 2NXGA 4DELA 3NAVA 2PF8A 2J74A 1PKYA 3PJWA 3GC4A 1HL9A 2BC1A 3JVAA 5BNKA 3B04A 2BMBA 3S8HA 3ARRA 1DL3A 1VEOA 4R34A 3FKKA 1OFAA 3CHFA 3WNOA 2Z6IA 3ZWSA 1XFBA 1M65A 5HWJA 5AC7A 4IGMA 4B92A 3RM9A 4ROPA 2FZBA 1GTHA 2CLIA 3PZOA 3V36A 2DT2A 4WQ6A 1XGEA 2IPGA 4OIFA 4JKMA 3AIUA 4RDVA 2DSZA 3O0KA 1QO5A 2NQ9A 4AW7A 3PAOA 4UFHA 3EDDA 1N63C 1P43A 1LYXA 5E0CA 3SY1A 3TTQA 1OF8A 3MHUA 4YTRA 2VD8A 1KBJA 4PGLA 1EGZA 4UCGA 6REQA 1CB2A 4BEQA 1MRQA 2ABBA 3VNZA 3N2TA 1M03A 3R25A 4HBKA 3TA6A 1CZ1A 4XAPA 2NXHA 3ATYA 3IV8A 1IWAA 3PANA 1V7YA 2VTFA 3QGAC 1O5QA 4J28A 1NM9A 1XYFA 4PFMA 4Z2HA 5CH9A 4XQ6A 2WM1A 4ZQOA 4DVOA 3DFTA 4A05A 3HM7A 1S3HA 3CZLA 3N11A 1BVZA 1WX0A 2X30A 4LX4A 4ZA0A 4UFKA 1XH2A 4DQWA 2HE8A 3W72A 3C3NA 4N42A 3ZS4A 3FLUA 2BHYA 3BE7A 3EA1A 5BU6A 5LIKX 7XIMA 2ZE0A 2E7FA 5FSEC 1JZ3A 3ABXA 1KM6A 2OT1A 1JCNA 4AD3A 4DPPA 4K1GA 3ZT5A 2PDHA 3TN5A 3UCCA 4QJ4B 3QYQA 1IXOA 4JIHA 3UVAA 3CHCA 1S2CA 1WDSA 3S1GA 3NO3A 3OVPA 4NU7A 3S2MA 2ANUA 2B7PA 4O1FA 2R1KA 4PB4A 4NAFA 1RVGA 4ZOEA 4LUYA 5LHEA 2DZWA 1XLCA 2YCKX 3VNJA 2QJGA 1J4EA 4CD5A 2XH0A 4L4MA 5KINA 1XRTA 2VVSA 1UD5A 1DJIA 1BYBA 4ZO7A 4Q7NA 3IIZA 1UH3A 1BRLA 1XPGA 2POZA 1OIMA 3QFEA 4TR9A 4Q7IA 4AEOA 1AUSL 4DNAA 2DZPA 3IVTA 3OG3A 4PUEA 4TVDA 4Z2KA 5CGMA 1YTDA 1PAMA 3KLLA 1G6CA 3DKLA 3TR9A 4A3UA 3WNLA 4NEWA 1CENA 3URAA 1A5CA 4DJDA 4Y8EA 4LUTA 3GY1A 1FWTA 4ZMGA 1UMYA 1V6XA 3R13A 4FXJA 1QRQA 3A7AA 5H8PA 2EPKX 1ODUA 1A5LC 2C91A 1K70A 3ETRB 2YA0A 4DZ5A 3LOTA 4HSNA 4LUSB 2R91A 2IPFA 3TOPA 1XRSA 3ARYA 3M64A 2X1IA 4C7DA 1OD0A 3SCWA 1JI2A 3MUIA 2QQ6A 3T8LA 4NXSA 4PCSA 4O1CA 1ZJBA 3CPRA 5A6BA 1VQTA 4UTTA 1E72M 4JQ4A 1R9XA 4E4UA 2E68A 2YL9A 1JEHA 4HYRA 3W7QA 4D6EA 1A5MC 5CPQA 1FWIC 3SR6B 5ER0A 2ZXDA 4CVUA 3AUJA 3W1TA 4O11A 3BV4A 3MW7A 5K9XA 3WQOA 4E8GA 1GCYA 3TUUA 5AFDA 4RJEA 4GOAA 4JNZA 3WLNA 1AK5A 4H7VA 4P5UA 4HVXA 3W29A 3E2QA 3AI0A 1YNYA 5CPNA 1XLAA 1P1MA 3CT7A 3WMCA 1NDAA 4MPKA 4J4KA 1EYWA 4Y96A 3LGEA 3PJXA 2BTMA 3ARQA 4M6UA 3UA4A 1W3JA 4EF8A 3LG3A 4R7JA 4IM4A 2WOWA 3CGBA 1EDGA 1MW1A 1O95A 4M3PA 1EDQA 1K7FA 1NIUA 3K8MA 3KL3A 4YWSA 4GMEA 1QBAA 3II4A 3BLIA 3FV9A 2AL1A 2RFGA 3LZ3A 3O7UA 1IEIA 1BKHA 1BYAA 1LUCB 1Q6RA 2ACUA 1MEHA 3MVTA 1I2RA 1E55A 5IM51 1N8FA 4US5D 1OABA 4NYYA 2DUZA 4L64A 3BL3A 3PTQA 2X09A 1FWSA 2W63A 3R07C 3E6EA 3VCNA 2FH6A 1VFLA 1QCWA 2X42A 5HINA 1UC5A 3M0LA 1MUCA 1Q1RA 4N9DA 4CKQA 1J01A 2CZ5A 4D6FA 3RU6A 2GPTA 2ZZ7A 3TYBA 3ITGA 1SFLA 3AN1A 1Q63A 3VCCA 1DPMA 3GTIA 3P80A 2QCFA 1LRNA 3CLWA 2C79A 1V0NA 2OQHA 4HZ6A 4YVXA 4WSKA 5C70A 3EX1A 8TIMA 1PIFA 3T2QA 1S2VA 2RAGA 1T6MA 4GY0A 5E9AA 2WBGA 2ZUWA 3IAPA 1UJPA 2XUCA 3OBKA 1YKWA 1VH7A 2ZKMX 1V3HA 4LAUA 3NR0A 2G95A 4DJDC 2HE5A 3THAA 5KVHA 4ICNA 3OA3A 4U33A 3VKJA 5M2FX 5JBDA 1QW7A 1JCLA 2ZZ0A 3GDMA 3A3WA 2X1TA 1OYCA 1IEQA 3NXLA 1VIWA 4GXWA 2QAEA 2NUYA 4UFLA 5C5YA 4HK7A 1MDRA 3A64A 5D02A 4FLOA 3SADA 3D9XA 3GXPA 2E1WA 5LIYX 1R3RA 2ZIDA 4IQLA 1ZBKA 1SFJA 1UA3A 4ZOBA 1XLIA 4DM2A 4L4PA 1RY0A 1EUNA 1DJNA 1Q6DA 3WMSA 5KITA 1GJWA 4JCLA 5K9CA 5AECA 3B8TA 4HYWA 3L68A 1H09A 2YYUA 1Q6LA 3VYLA 1HKWA 3L4XA 3BLFA 2VKZG 3JW7A 5IBXA 1PE1A 1R2TA 4UZSA 4NEVA 2NW0A 2QNEA 1W3HA 3IJ9A 4EQWA 3ANUA 3W76A 2ZX9A 3BMWA 1RHCA 5BXPA 1YHTA 1XLEA 5FS7A 3OC4A 1W32A 1TYPA 1XBXA 2GVYA 2J9ZA 4D6DA 4ENLA 5HPOA 2I56A 3MCMA 2PP0A 4Y90A 1D3HA 4PBFA 2XVPA 5JCIA 3PC0A 1RBOB 2E0PA 5FAJA 4LAKA 3U2ZA 1VB9A 1S1RA 1Q66A 2I9UA 2ISDA 2Z4GA 4U2ZA 1QU4A 3W1UA 4R33A 3N9SA 3TQKA 3CIWA 3TQPA 1LVLA 5EMJA 1W2VA 3TN3A 3NDZA 3W7LA 4AY8A 4RNIA 4RNFA 2OZ3A 1H41A 3W87A 1XIBA 2CZEA 3NDYA 3V35A 5BXTA 3A3HA 1QOPA 4AISA 5HWMA 3WF1A 2I17A 5C9ZA 2RKXA 3RM4A 2JKPA 1XIJA 4LOCA 3IIXA 1X97A 3LPPA 2Y2WA 2DV0A 5D03A 3WD0A 3WYZA 4B3KA 4GQQA 2V5KA 4JX4A 4HNUA 4ZB2A 2OVLA 3KCOA 4JBRA 2W4XA 2CHRA 1ITXA 1F3XA 4L1GA 4QGCA 2JKEA 3RLVA 4XKYB 1RPKA 3GDRA 5CKSA 5TAOA 4PH6A 2WWDA 4XKYA 2PBOA 1XD1A 1KR1A 4NAEA 1AOGA 1SU5A 4EQSA 4J56A 4HNVA 1KFJA 5LHFA 3DI1A 3DC0A 3U4FA 4O1EA 3V1PA 4CEUC 4FOKA 5JQ9A 2GVLA 1JPIA 3CQ0A 3PBVA 2IS7A 2VDGA 2CLEA 3PB0A 1JZ4A 5CJNA 1X2GA 2ZRZA 1T3QC 3GXTA 4A4AA 2XIOA 1KD0A 4MYAA 1BEUA 1JUBA 4GC3A 2WCGA 3FAXA 4RZBA 2QDEA 4EM4A 3SUUA 1R86A 4CNUA 1KWKA 4ZVJA 3FX4A 5IRPA 2Y61A 3QRHA 4KPLA 4ZODA 3M0IA 4FNPA 1CT5A 1ME8A 3HQNA 1BLIA 2XINA 3M9YA 3NQFA 5G1TA 3VNLA 5I5RA 1NELA 4U5IA 4JIIX 2VQTA 3KRUA 3QZAA 5F4XA 1V02E 3C5QA 2ASHA 2ZYFA 4L1WA 3NEVA 4CN1A 4JX5A 4LNCA 2F5ZA 3OLIA 4NNCA 3VO0A 2OB3A 4FF7A 4ONVA 2CEQA 1SMAA 3M0JA 2GK1A 1L6SA 3EB3A 3PTMA 1M3UA 4MUZA 2W3SA 2GGEA 4GUGA 2WJZA 4UR7A 1SW0A 1RM6B 1PEZA 2W3ZA 4UQAA 1BVNP 3WF2A 1KKOA 4Z0JA 3SZ8A 2CBVA 3DFOA 1Q6OA 3KP0A 3LD5A 3HMJG 3F5KA 3DN5A 3AAMA 2BHUA 2GSHA 5EMLA 4A2SA 2RH9A 1VEMA 4JTHA 2VP8A 2Z1WA 1UROA 4F3HA 2P3EA 4AX6A 2XM2A 2DIJA 3GDBA 4ZSTA 2ZCGA 4X2PA 3UR2A 1JR1A 3H26A 2PU0A 3BAWA 4CGTA 2HISA 5REQB 4HOXA 2QJIA 4BY3A 2O92A 1FX6A 4QS5A 3H7RA 4XX6A 1H50A 1GRGA 4GJIA 3C3UA 4M80A 4O8RA 3EAOA 3A22A 2P1FA 5FL1A 3FHQA 1ZB5A 1M41A 3OB8A 1FWNA 4RZ6A 2PP3A 1MWOA 2ACRA 3MKKA 1FCQA 5TQLA 4GXPA 1V3MA 1ITQA 2V38A 3PZNA 4R5EA 1J0IA 1DIDA 2Z2BA 2VCBA 4QE5A 2V30A 3VFCA 3O6AA 4GRSA 3F7JA 4CEXC 3N6HA 1EQCA 4L9YA 2VEFA 2VRKA 3OQEA 4ADWA 3JRKA 3V5FA 3Q2DA 4LGXA 4O10A 1J11A 2QIWA 5GNYA 5FF2A 5IFPA 3NG3A 3LSBA 2XVKA 1QWGA 3CYVA 1PIIA 5A95A 3BANA 1IQ8A 3VD4A 4UZUA 4CD4A 1WZAA 1OX4A 2QVHA 3NNTA 4JTAA 4LBRA 2FJUB 2C19A 3R0DA 3G0XA 3CUGA 1O5RA 2X8GA 4KWUA 1EIXA 1TV4A 3MUZ1 3U2CA 3B8DA 4I7VA 3W01A 1NDZA 1JGMA 4JQ1A 2G4JA 5FF0A 1US3A 3DK4A 5AY7A 3RHGA 3HMCA 2FPYA 2QXWA 4WY0B 1C8VA 1X39A 3WDRA 3QTGA 3T0CA 3SY5A 2WVVB 4OQVA 1GRAA 1QNPA 4WKFA 5LIXX 2X50A 3FVMA 2ZFAA 5C9RA 1A53A 5BXSA 2OWWA 4V1YA 3M4HA 4FPSA 3ORWA 3WQ6A 4R85A 4HPHA 3RRAA 4GI4A 1ZMCA 4MZ1A 4D1IA 1WB0A 4HCHA 3HGSA 4QQ3A 2EQ9A 4ALDA 3TFCA 3GTXA 1F7BA 4FNUA 1DE6A 5M5DA 2PDFA 1WXJA 3MA8A 1TPH1 3GC5A 1GYNA 2ZDSA 3BVJA 3TTSA 1NJJA 4X63A 4AC1X 3HFYA 3KRSA 4OTKA 4IXXA 3B0XA 2UZ9A 1AVAA 2X40A 3SCSA 3AXHA 1LRQA 2CXEA 3FCPA 3NL3A 3EWWA 4WEVX 4RR4A 2EF9A 1JFHA 3T0BA 1W8SA 1HKIA 2C1HA 1QHZA 3WLOA 3STEA 1GQLA 3PZMA 4GH1A 2QV5A 3F4WA 2EJ1A 5KTLA 1KXVA 2C1IA 2YVGA 1QW8A 5LA1A 2J7BA 3TOYA 2BOFX 1GVYA 5DEZA 2A7NA 5IXEA 3TXZA 4D72A 3UXDA 4PE8A 1XUZA 2KAUC 4FX8A 4WDWA 4EPDC 1DTNA 1K3UA 7REQA 3RX3A 1EC9A 2QCGA 4BS0A 4PB5A 3SUWA 2HNHA 4LAOA 4P7NA 1OYAA 4FI4A 2RDTA 1LT7A 1YTKA 4LEQA 4CNOA 2YLAA 4WOQA 1H2JA 3MI2A 4O1AA 4HA4A 3N6JA 3HG5A 2OX4A 3I6EA 3CS2A 5C8BB 5D2VA 1G9HA 4I8DA 3WK0A 1VJIA 3QHNA 2J27A 4I9JA 3HG4A 4AEEA 4QAWA 2HQMA 3VMNA 3AZTA 3LUTA 2BBFA 3KL0A 2TSYA 3KS6A 4L4OA 4EF9A 2XWEA 3W1RA 1TR1A 4RUBA 5A6BD 2GVEA 1WDWA 3SRKA 3GTHA 1X6LA 1LOQA 1BSIA 2P8CA 1ZLPA 3AU2A 4JNMA 1VHCA 3AMGA 5TF0A 2C7FA 1KGWA 1NQ6A 3KWXA 4CU8A 2YQUA 3PWIA 1W2PA 1ZJAA 3S5YA 3LY0A 4FLSA 4RDWA 1M6JA 4B5UA 3ONBA 1KGXA 2G3JA 4E2BA 3VGDA 3R79A 2OWXA 1KO0A 1V3JA 3H53A 3WNPA 3WF0A 4H4VA 3W2MA 3WJWA 5DMYA 2EG7A 1UQYA 4A29A 3MCOA 2QGHA 4JTFA 4QJ1A 1QI3A 3WNNA 2GUBA 2GR2A 1LP6A 2BDQA 1R6WA 1HJWA 4GYPA 2QVNA 2WSPA 4AIBA 4L9ZA 3LCLA 2WC7A 4GK8A 4AZGA 3WQWA 4IPLA 2PE4A 4N4QA 4AZ5A 2C16A 5G2IA 3GAYA 3UA3A 3DG3A 3Q4DA 4FAMA 2BXYA 1E51A 2R9RA 2VR5A 3F4VA 2R1LA 1GVRA 3BW4A 4HNOA 2NPXA 6TAAA 4JKLA 2UY5A 3LCHA 3CZGA 4UTMA 4D8LA 4O19A 2ALRA 1GV4A 1XYZA 1TR9A 2ONEA 1LQ2A 1BGGA 4V33A 3N3MA 1UCWA 4ZTYA 4ASTA 2YL5A 1UB3A 9XIMA 2Y88A 1EJWC 3PJUA 3M0HA 4NZFA 2PI6A 4LUIA 3LLDA 4XD6A 4LWWA 1KR0A 1CECA 1EUAA 2G50A 4LW7A 1PSCA 1TJRA 4N02A 2FJKA 3QGKC 3CC1A 2CWXA 4QJ3B 3RDKA 3KOYA 1EP3A 3EAUA 4XUGA 1ZBWA 4H19A 3SQPA 3EEZA 2OOFA 4DY1A 4Y9PA 4EXQA 2YB1A 4ZFMA 4UNIA 1DJQA 4ZB0A 4MB1A 2J6VA 3M0KA 3QPZA 4K39A 4HZ8A 3S0CA 4S3JA 3AXKA 3G1XA 2OOGA 1HGWA 2NVDA 2VI0A 5CGQA 3EUB3 1K7EA 2VFDA 2QW5A 3STGA 3N2XA 4CD8A 4Y6GA 3AXIA 1BXCA 1E6PA 4C6DA 2ISFA 3LMZA 1U22A 1JRBA 4ZB5A 2EEXA 2C3CA 2WVTA 3OZOA 3NXFA 4HOWA 1E40A 1NHPA 3RK8A 3P0WA 1AFSA 1PL9A 3ITLA 3ZM8A 1Q65A 2YCLB 2QDGA 2QZRA 2XGBA 5G5HB 4KWOA 1MVYA 3CUIA 4BZYA 3O0FA 1XM3A 3H2AA 4N0RA 3ABSA 3PBMA 2IXUA 1F61A 2BXVA 2E6AA 5FD0A 1OZQA 1LROA 4RV3A 1SJDA 1UP0A 2QF8A 3VKDA 1EQPA 3CEPA 3IJ7A 1TV7A 5FI8A 4RDZA 3ZR5A 4DF1A 2CHNA 5CAKA 5H1WA 3AIEA 5JH2A 5G4EA 3S42A 3TQ0A 1GRHA 1SVDA 2IXVA 4GGBA 3W7RA 3PS7A 2D24A 3HG3A 1NU5A 4J57A 2YW3A 1A5AA 1M53A 2MNRA 4JIQA 4IG2A 1XGDA 1WNOA 3GNRA 4O12A 5I07A 3P14A 3LM7A 3ZVHB 1DJZA 1TRIA 3S6DA 5AKQA 1OGSA 1P0DA 3M0MA 2X2GA 3VMPA 1UD2A 3A9IA 1FWGC 1UA7A 3RCYA 3WJSA 4L80A 2UWFA 4J3UA 4GGHA 4GCAA 2P50A 3QW4B 3GVWA 2G3IA 3WLSA 4HD5A 5IDZA 1F9CA 3A4JA 4L6DA 4CQ8A 3VTRA 1Q6CA 2INFA 4AF0B 1DEDA 4PMQA 4DBEA 2REQB 3G1AA 1HJVA 4LAZA 4KCWA 3LSCA 1H7NA 4M5PA 4D2JA 4TV5A 3WX7A 2DZSA 2FDSA 2ZUTA 4XZWA 2ADAA 3ZQ9A 1V6WA 2HVOA 5B7ZA 1XDIA 2X7WA 4PTMA 3G1SA 4EQRA 1XCXA 2YR1A 1EKOA 3FVDA 2E8YA 4OV9A 4MNLA 3WQFA 3W6MA 4ES4A 3TC6A 8CGTA 3TAKA 4ML4A 3R89A 4H8NA 3MYOA 3HW2A 4CVWA 2VEMA 4FALA 1PDYA 3H2MA 1K9EA 3QR3A 5D2TA 1XIMA 4C6BA 2HSAA 3PZTA 4DWSA 3L0NA 3AHXA 4DWDA 2QS8A 5AYBA 2H9AB 1JUKA 4DJED 2QLYA 3LERA 3N9RA 1OC5A 3R11A 4G9PA 4I6VA 5HUPA 9CGTA 4IFRA 4LC8A 4NZ1A 2W0HA 2V3BA 3ZMRA 4Q33A 3AMZA 4HA0A 3LPOA 3AHZA 3MDWA 5AC8A 4TVWA 3IS4A 1HF6A 3EOLA 3UJRA 1RCXB 2OGJA 2H90A 3HQOA 4D6CA 3GVQA 3THDA 5AHLA 3H22A 4D6GA 1X2HA 2A7RA 4MVAA 5C2CA 2Y5JA 4J5NA 3R94A 2OEMA 2WQDA 1SSDA 4IQDA 2NQLA 1MNZA 3GU1A 4W87A 4I5UA 3DOPA 4PMNA 2PWDA 1V03A 3VIOA 3DFPA 2BVYA 1VBHA 1I2OA 5EFDA 2IUZA 5FEXA 1NDWA 2AL2B 3RILA 2GQ8A 4R7WA 1RJQA 4D6JA 2Y62A 3KTCA 1IXNA 3FKRA 3ERPA 1TPVA 1R47A 2QMKA 4S39A 2NX1A 2WKGA 1B4EA 2WKLA 1XYLA 2DSUA 1K6AA 1C7SA 3GVVA 3DXIA 2E1DA 1XIGA 5DBTA 1JCJA 1VFSA 4W85A 2V3GA 2W92A 2O0TA 2E4TA 2D0FA 2RDXA 3OHIA 2GGHA 2HMCA 1SM9A 5FF4A 1QNVA 1W9PA 3LI1A 2PDGA 4JIRA 3S2CA 3EBVA 4K7ZA 2CESA 1EJTC 1RP9A 1X38A 1CX9A 3K46A 3MY9A 3NQEA 1O6IA 1W5NA 3LTPA 3R0KA 1J8VA 3T08A 1HO1A 1EC7A 1IIGA 1H51A 2AGKA 3ABOA 4IJBA 3SQSA 3GH7A 5L9FA 1GESA 2C13A 4GQGA 3RM8A 2ZX8A 2V5DA 4YYCA 1S2UA 1XS2A 4PUNA 3WN6A 1BTCA 1YXDA 3LX9A 4L56A 2GH5A 2OODA 2QAPA 4MMWA 5CZ0A 1BG9A 1L9WA 3U8GA 4BEUA 4AY7A 1K1DA 2O4MA 3NL2A 4R53A 4H4YA 5E93A 2HEJA 3WLIA 1Q1WA 1QOQA 2WVVA 3AIRA 5E9XA 3FSUA 4UNLA 4GIEA 4CD7A 4ZOAA 1TTIA 1XHGA 3UJEA 3FJ4A 4Z1YA 1CLKA 1YX1A 2Y7DA 2V2DA 4D8ZA 1HP5A 3HA1A 2OFJA 1R2RA 4QQUA 2W3RA 4DRSA 1M04A 3G0UA 3PZVA 4JTIA 1QPRA 1GPWA 1UR2A 4APNA 4LIIA 2YL6A 3FDGA 3RN6A 3AM9A 3VD5A 4AWTA 4G6CA 3BQ5A 4IF2A 2QULA 1H3GA 4S23A 3PZIA 3VIGA 1ENUA 5AHIA 1ICPA 2YBTA 1ZL1A 3S46A 3QBUA 3N3TA 4QG6A 4XZNX 3ZIZA 2DY3A 3MP5A 3GXFA 2A3LA 3BCDA 4H6EA 1E1FA 3VINA 5BMXA 4PTNA 3M46A 3A13A 3V4BA 3RGTA 4XZMX 1YADA 4YWIA 2QPXA 3WDHA 4F0RA 2YGYA 2VCAA 1FCBA 2X0SA 1YIXA 3AO0A 3SI9A 1E9YB 3TONA 1O68A 3I10A 1WE5A 2XIBA 4O8AA 1AQMA 1JCYA 1W5QA 1XQKA 4AB4A 2Q8LA 3I7RA 3BWWA 4MB3A 4UTJA 1R3SA 5JH1A 2WMGA 1B31A 3KVJA 1QR7A 3GNPA 3RX2A 5LNRA 2I57A 3SSZA 5CZTA 1QATA 1CGVA 4J9JA 4FDCB 5CSUA 3FJ6A 1TVPA 3P82A 7TIMA 3OGVA 1XLFA 4ZFCA 1K03A 2WZMA 3UERA 2FTPA 3UWEA 4HYVA 5EKYA 3NTYA 1OK4A 3C0LA 1XIHA 3U9IA 3T9PA 4RNJA 1YXYA 3EPMA 1J2BA 3O2LA 1VPQA 4GQ0A 4NUWA 4MZ8A 2QDHA 2WOVA 1OGGA 3EPOA 4TV6A 1FWJC 4B9YA 1M7JA 4GX8A 2PUZA 2Z0IA 1T41A 2JF6A 2DVXA 3FA4A 4OJYA 2FYMA 4JKKA 4LUJA 4DWSB 3A5FA 4U3CA 3ARSA 4QCFA 4JYDA 4M6VA 2O9PA 4KRZA 4EMWA 4H9ZA 3AMDA 3ANVA 1V51A 1F4AA 1K8CA 2G8ZA 1U30A 3PB2A 3NVTA 5I6SA 2HXTA 3VOCA 2ZADA 5FJTA 1Q3NA 4HK5A 3N14A 2E28A 2V5LA 3W28A 4XSMA 5CSSA 4HSOA 3NZRA 1ZUAX 3VIIA 3NQBA 4MIMA 1FWAC 1OCNA 5M17A 2DSKA 3LHUA 2JK6A 1MFUA 4O28A 5IFTA 5MKGB 4A8LA 1XQLA 3QGVA 2V3FA 2YAUA 1NWTA 1XD0A 4BF9A 4PRTA 3W7KA 4F40A 3A21A 5CXPA 1ZAJA 4PC8A 4IJCA 4DXXA 3BSMA 4KT2A 1SO5A 2VWTA 5HUOA 3RLHA 2UY4A 4A8RA 1GVQA 3MKVA 1N62C 2JGYA 4PUMA 2E9LA 2VDIA 1K4GA 5C9WA 4F48A 1LL4A 2VX7A 2R14A 3H12A 4UB9A 3VE9A 4S3GA 1EP2A 1ZK7A 3MV01 3ARZA 4H6RA 1AMKA 1I1XA 3V0TA 3VC6A 4REQA 4J3SA 3REQB 3WF4A 3EXSA 2EKGA 1TIMA 3NVVB 1M01A 5HMFA 3Q37A 2PDWA 4WXYA 3MUY1 3EOOA 2QKFA 4JGDA 4EP8C 2TRSA 2XISA 4FOUA 1X8FA 1PYFA 3RLGA 5EY5A 1K9TA 1W9BM 3OW1A 5EYWA 1U5HA 2OSYA 3LRLA 3WFLA 1G4SA 5ABHA 4DI8A 1FEAA 3UT0A 1Q4NX 1B3YA 3GRSA 3SCUA 4DPQA 5TD4A 2V68A 3TFXA 3WBEA 1E3XA 1BAGA 1VENA 4GISA 1XLGA 1VRXA 3CMJA 4AHQA 4UR8A 4F66A 3NQ8A 1Y5XA 5CPLA 1WQ5A 5A6LA 4ZQNA 3GK0A 3BARA 3RMEA 2V3AA 5EA9A 2P10A 3MJYA 4M51A 3SN1A 3VFLA 4B3ZA 1PDZA 4LVBA 3EB4A 1XCWA 2JBMA 3NOEA 1FH7A 4YL2A 2CLOA 2VGFA 2L5HA 1J10A 1RLDA 1I0DA 1OJXA 3EGJA 4X9SA 1EDTA 3BPWA 1VPXA 2D3NA 3HU7A 3VILA 2E5AA 5E0FA 2PWHA 3P84A 1OY0A 4HA3A 2YCLA 2PZNA 2ZZ6A 2OYLA 2VVNA 1VCVA 4IL0A 3SRHA 3AUOA 1IR1A 5KETA 4IQJA 3SRFA 1TWSA 1E56A 4IZGA 5I3HA 4RNHA 4HHHA 4GFSA 3E74A 3HPZA 2YDSA 1DWHM 3IUIA 4R27A 4UTUA 1F4HA 1QNOA 4GO9A 3JU2A 5I3KA 5LSMA 1EZWA 5A6AA 4E8CA 1MNSA 3LS9A 1GOMA 5EMMA 1AL8A 4GNKB 1DVJA 3RR1A 4CCDA 2BOGX 2BFGA 2OLSA 2V5CA 1GHSA 3W22A 2C1GA 1GHRA 1LORA 1NHSA 5AYIA 2ZX7A 2GJXB 3FS2A 1LWIA 4DBSA 1W9VA 3IRSA 4URIA 1EWEA 1F8WA 4UMAA 1AJ0A 4H01A 3TYZA 1TPEA 3Q6JA 1UZ1A 1JEZA 4WXZA 3TTOA 3VNMA 1JCMP 3CV7A 4H4ZA 3TJIA 1DJHA 1JPMA 1CTNA 4A6GA 3GH5A 4IMGA 4I3GA 1FFVC 3E2VA 1CPUA 3UPBA 5I2UA 3QMTA 4H4TA 3CV6A 2VR4A 2XN1A 1KQZA 4MAVA 4Q8NA 2GL5A 2FFCA 4UTLA 1HX0A 1P6WA 2Y7EA 2PDNA 5DCBA 4HB7A 3KXQA 3UCQA 1HO4A 1QT1A 2FVMA 2RDUA 3G0SA 3PG8A 4IP5A 3ITXA 1QASA 1A5UA 1AA1B 3LADA 2VZOA 3RR4A 2FMOA 5D8ZA 3AHTA 1HXJA 4KRTA 4LYPA 3N15A 1J96A 4R9XA 3APTA 3QH2A 1SR9A 5C9XA 3S6TA 1VJZA 2DQWA 3GTFA 3L65A 1T40A 4YJ5A 2W55A 5BW6A 5BOEA 1P7TB 2DVUA 3FXYA 3ZYZA 2EQ7A 5BRQA 1ONFA 1N82A 4L1XA 2GFTA 2OLAA 7ODCA 3SCTA 5CPMA 1B3OA 4RE0A 5L6UA 3AZRA 4A21A 2FMNA 2Y5SA 3P8JA 4R88A 1KV8A 1B30A 4MNKA 4HP5A 4S2CA 2WP6A 1ZGDA 3GBEA 2JK2A 2QV4A 2ZX5A 4AXKA 2J8FA 5IHRA 3TW6A 1IXPA 3WLJA 1U1UA 3KLJA 1FBAA 4ZQMA 2WNZA 3EWUA 3NFUA 3SCQA 4AIEA 2WZEA 2Y7FA 4JTDA 1Q8AA 3N25A 4OFCA 3VNYA 3I3DA 4Q8MA 4O57A 4H4QA 3K1DA 3KCLA 4ZO8A 4MDOA 1RD6A 1OG6A 3MTWA 1A49A 3W07A 3C0JA 4XO6A 4QE1A 3E3HA 4LA1A 4WJ8A 4LF2A 4OWGA 4LVFA 3I3EA 1EX1A 1GRTA 2OKTA 5D05A 3OHMB 2E5DA 1R9ZA 3QF0A 3LHTA 4IISA 4AQLA 2R1MA 1MQRA 3QV7A 2ZZ2A 1Y8BA 3ONCA 2BV9A 3WKZA 4ZEPA 1XLKA 4GNJA 3TH6A 3SBFA 4JTQA 3H55A 1XH0A 1XLLA 2J7CA 3O07A 2WMKA 2VQUA 4AVOA 2V6OA 2BS9A 3DHPA 3H70A 4WLCA 4S3KA 4K8EA 4HPJA 4NI8A 2NUWA 4JQ2A 2EG6A 5EMKA 1VDVA 3F1QA 1H5YA 4R7OA 1TJ0A 2PTYA 1UMLA 3SGZA 4H9XA 3P62A 4UFJA 5EL1A 3NCOA 4C91A 4Q4PA 2E6DA 4DAFA 1VYPX 1UG6A 3SQMA 4IGNA 4OBTA 1S1PA 1Q6GA 1F6KA 1H5VA 3VK5A 4H41A 1KM3A 1QPQA 1TJ1A 4E2DA 1N2VA 4U28A 1C8QA 3Q45A 1DKWA 3OLDA 3P6LA 3B4UA 3V1HA 1QI4A 1XLJA 3BG5A 2V67A 5DXYA 3S2NA 1RA5A 4JHOA 1XGZA 5A8PA 3WK3A 2CETA 4S3BA 4M29A 4FMVA 2GQ9A 1ZCOA 2YW4A 4OZOA 4XIMA 1TWWA 4E2OA 4DJEC 2QCDA 1E5JA 4KRUA 4YYFA 3UCDA 3AALA 3E0LA 4IUOA 2BGNE 1DQUA 4W5UA 2PDCA 5FESA 3AHYA 4U4MA 3FGCA 1MMFA 3SAZA 3W2NA 3TE9A 3LPFA 4DO4A 1N8IA 3V5OA 1NFPA 3O16A 2WANA 4LY4A 1TCMA 3VD3A 3N29A 3H7VA 4D71A 5HULA 3BW2A 4AEFA 2JF7A 3CHVA 3DAQA 3TN6A 4IG2B 1LBLA 3W85A 2A8XA 1IIHA 2B81A 3KOXA 3NPUA 4ZOCA 1UIOA 2IKHA 1QHOA 4C7FA 2BZNA 1GEQA 2UY3A 2PTWA 4J40A 1X1ZA 3BZGA 2YKKA 4PCPA 1ZALA 3WZ0E 4CCEA 4MB4A 1V6YA 4MHBA 6XIAA 5TR3A 2VC5A 4PB3A 2FZMA 4NHVA 1R7AA 1R0MA 1A5KC 3UF9A 2IMRA 3EA3A 1FXPA 4QROA 3EMCA 3MUXA 4W9TA 1AZ1A 4HHPA 1QXLA 1W5PA 4QXIA 2OPJA 3G8RA 3LCWA 3THQA 4DM1A 3NWRA 5CSRA 3CUFA 3GS6A 5T91A 4E5TA 1GVIA 3L5LA 1LRTA 3IJ6A 5ABEA 3DBNA 2ATSA 3W7PA 4JDRA 4B4HA 3XIMA 2R1PA 4EXAA 1T96A 2E6FA 1FOBA 4FA3A 3CMGA 5EPDA 2CIPA 4KIRA 5H2ZA 4AIOA 3LBOA 2GGIA 4IFKA 3TLQA 2XSBA 3QY8A 1JIBA 3CAWA 1KXTA 2I16A 3TMLA 3NIYA 3IK4A 1E0XA 1WKYA 1A4LA 2E77A 3C2RA 1YNQA 3L4UA 1ZX9A 2ATMA 3H8AA 2XVLA 2C8NA 3VKKA 5C54A 3CWOX 1JI1A 4BK9A 1LWHA 3I6TA 2EJAA 4XB3A 4M7TA 4V15A 2WNWA 3ZJ6A 1XP3A 1CGXA 2WPBA 2E3TA 1A5NC 3VGHA 1QI2A 2G41A 5F2IA 5HJYA 3GNDA 3V0SA 3BDKA 1DXFA 1FHDA 2JIWA 1NHRA 1V6TA 3CO8A 3EDFA 1UP2A 2HBXA 2AAAA 4G1NA 2OWCA 3G22A 4ERAA 4I90A 1TV5A 3VIHA 4M56A 5CZJA 2D0HA 2JFEX 2V63A 2ZZ3A 3WENA 1RPXA 3BOFA 2DZAA 1UKOA 2PU1A 7ENLA 1EBDA 2XH2A 1VLWA 3TYDA 2WNNA 3TCEA 5DO8A 4RV8A 1MXDA 3CIVA 2VEKA 4HOZA 1P48A 1NFGA 3H21A 3MB9A 3MT1A 1JJKA 1ITCA 1RV8A 1H7RA 6TIMA 1S2TA 3APYA 4LTSA 4ACZA 4B5NA 3EMQA 1P0BA 1NAL1 3PNUA 4LS0A 4P61A 2TODA 3SEPA 1F07A 2BODX 4IIGA 1EJXC 4UTWA 4ACYA 4BI6A 4INFA 1OG0A 1LCOA 3GKAA 3V0UA 2CW6A 2ZC8A 1XIIA 3PBGA 4JTGA 1S2AA 5K4XA 3QFWA 5A6SA 1V4YA 5HNUA 3DH9A 4ZZ9A 1H0IA 3E0FA 4PA8A 3OG2A 1ONRA 2WMIB 4NZ5A 2ICSA 2GGJA 5FJJA 5LIWX 1CCWB 1OIFA 1HG3A 2VEIA 2EG8A 4X0NA 1XRFA 3WLRA 1KFWA 3BV7A 4MPQA 2OQLA 2X1RA 4KEMA 5E0KA 1N5XA 3HPSA 5HJLA 1H62A 3N2OA 4MDPA 4I9TA 4B5TA 4ORMA 1XHCA 3STFA 4Q8UA 1G5AA 3WFZA 1ZFJA 4DF0A 4QISA 3VNKA 2DZXA 3WDPP 3KUMA 1KBLA 3UZJA 1EO7A 3W3OA 3VDBA 3WQCA 2I5GA 4PMRA 1VP5A 1GG1A 2WCAA 5LA2A 4GX9A 1JYXA 4OOZA 1R87A 4P8WA 1DJGA 1TJPA 5FCZA 1AZ2A 1Z6KA 3EX2A 1KB3A 3WEOA 3S1WA 1XKJA 4NJJA 5DN1A 4UOZA 2J25A 3W0KA 1W6TA 1FFQA 2WHKA 3STCA 4FOJA 3M7SA 5JBEA 1B9ZA 5E5CA 3TK7A 1I2PA 3CUZA 2BVWA 1S7MA 3U57A 1U5VA 3O06A 1OFPA 3L9CA 3U5UA 4GJJA 1ML1A 3VOFA 1NHQA 3LXCA 1V59A 1TJ2A 1VYRA 2UBPC 1E1CB 4C6FA 4PL2A 4DUOA 4O1BA 4IHCA 1W9DM 3C2EA 3L4ZA 4MADA 2EPOA 1QI0A 3SSJA 1GW1A 2OO0A 4RKAA 3EF6A 4XTDA 2PAJA 4I7UA 4XAYA 4UIOA 4HKPA 1DWGM 4KGJA 1ECQA 4DYKA 3W1PA 4KCUA 3CPGA 4HK6A 3EA2A 1NP2A 4I5XA 4ZXLA 3D6NA 4X3ZA 4OUEA 1OK6A 4Q4RA 2GSEA 3GIYA 4PBGA 4AU0A 1TPB1 3KVLA 3IPWA 3KTSA 4DJDD 3CASA 3LGGA 1Q2SA 2H6RA 3ZLFA 4LYKA 4H9MA 2AQOA 1JGIA 1TRDA 2D2HA 1FXQA 4JL1A 2KX9A 5DLCA 3NM1A 2QJHA 4AFYA 4X0VA 3MWAA 4ZE5A 3DBPA 3GFYA 2POTA 4E38A 1NVMA 4KFNA 2EGZA 5AVHA 3IIVA 3HGRA 4IFOA 1QPKA 3CZ8A 3BLPX 3QJAA 4MNMA 2NV2A 3NZ1A 1GT8A 2WZHA 4GJ1A 3TROA 4HU4A 3EOEA 1XBYA 1Y7VA 2CLMA 4O50A 1HUVA 1QTWA 2PLJA 1E4MM 1O4UA 2XSAA 1RA0A 4IH3A 1STZA 3B9AA 4WHBA 3L8KA 2O7QA 2RDWA 3K1GA 5HMSA 1KXHA 1ZTVA 4XAFA 2PGRA 4DNMA 3IGHX 3N4EA 5A2CA 1EIBA 3DJGX 1EA0A 3H23A 2PDMA 2DDXA 5REQA 3CV1A 1MW0A 1W8GA 5TIMA 1GOOA 2OELA 3WUGA 2CLFA 4JXCA 3DFYA 1O12A 4W89A 5IOBA 4CQCA 4BQ5A 4XKMA 4GQBA 3UBPC 4MJZA 3PBWA 1HL8A 2A3CA 2I5IA 5DXXA 4EPBC 3LN3A 4JQAA 4LV9A 2PPGA 1Z69A 1A0DA 5AHNA 4XK2A 2Z1KA 1JROA 2NX9A 4OU1A 2VGIA 4RL3A 2VRJA 4WVXA 2PCEA 3L21A 4C1NA 1QPNA 3C56A 3WQ4A 2WW5A 2YA1A 1DE5A 3RCMA 4HCLA 1LBMA 2X05A 4RZ4A 4PEEA 3MJMA 1JYWA 3OJGA 3I7SA 3LGDA 1OC6A 2VURA 1IWPA 3KEHA 4AMAA 3URQA 4TU1A 1JQXA 4WF7A 4W8AA 5D32A 1TA3B 3L66A 4GXMA 3PTKA 5DT7A 4BI7A 1G1YA 3BTNA 2ISSA 1GRFA 1IZKA 1QHPA 3GX9A 4GZEA 4H3DA 1TUFA 2RUSA 1N61C 4DI9A 5G5IA 3T2OA 4GR1A 4BCEA 5HK4A 2PSNA 1HKVA 1EZ2A 4EACA 4CCZA 1B9BA 2G96A 4O0KA 3COTA 1OJTA 4ZO6A 3LBCA 3GR7A 1UYQA 2AAMA 1FWHC 1C7TA 3PR2A 3AROA 4C65A 3M1ZA 1XWYA 5D4YA 3AICA 1FHVA 5CBJA 1KFKA 4EKJA 2Q3RA 5I77A 1N60C 2Y89A 5CSYA 1Q7ZA 4F9DA 3T0DA 4KW2A 3O6CA 2X8CA 2NZLA 4IUGA 2G3NA 3MBFA 3MKCA 4C60A 4Q32A 4HHLA 3NUKA 1ZMDA 3AIVA 4F0LA 1ZAHA 3CGCA 2W91A 3HN3A 3OYXA 3N1AA 1CXIA 4O4WA 3GNXA 3M41A 1OD8A 3R58A 2Z24A 1OT2A 1PCWA 3WQ8A 2Z1XA 3GXDA 5I09A 1UW9A 3CIXA 1W3IA 1IGSA 1WZLA 2EPLX 2ZVIA 3VI2A 2EPMX 2VR2A 2VNCA 4FXRA 2Y7GA 4F9JA 1AJ2A 4WDUA 3AU6A 1Q8JA 2NLYA 3DCPA 5HXMA 1KFBA 2BGSA 3UXKA 1TZ9A 7CGTA 4E4PA 4AHPA 4MUPA 4QSHA 4K38A 3ZFHA 5JVLA 1E9ZB 3A7RA 4C6MA 3T0TA 3E38A 1V6UA 1F8MA 3WL0A 4DO5A 1UH2A 4XZBA 1J93A 5I03A 4LCQA 2DT0A 3MV11 4KFOA 1TPC1 2HNEA 1VIZA 3QKZA 2R82A 1LWJA 3DC8A 2CBJA 2OEJA 1Z89A 1XLBA 3R2GA 2H8ZA 3QXBA 1PWLA 5KSWA 3M0YA 1GOIA 4JPGA 3LHVA 1ESWA 5ECVA 4YTQA 1EBGA 3PUEA 1ZZMA 3B8VA 1SSGA 2VRQA 1MEWA 1DYSA 4UTHA 3MS8A 2ZZBA 1A80A 1A5BA 3FJLA 1AW2A 4TVUA 3F2CA 4HSHA 3HQPA 3DGHA 1PX4A 3MDUA 1SPQA 4ZQRA 4AZBA 2XGIA 1HP4A 1RCQA 2WMHA 1KBKA 1JNDA 2BWGA 4N7QA 3BG9A 5E6ZA 4GUJA 1QAPA 2INEA 4GBUA 4J35A 2FKPA 1WOBA 4JICA 5C2XA 2ACQA 1FFUC 4IFKB 3V16A 3LNMA 2FFIA 4ICCX 3RMJA 1IXQA 1DJWA 3TNBA 4YHGA 1JXJA 3TV8A 3A9BA 2NVKX 1ZNNA 2PDKA 1YQZA 1CLXA 4EM3A 2B0MA 6REQB 3B9EA 2VZVA 3ZR4A 5CBIA 4H7ZA 3W37A 2FGZA 4FB7A 1HJQA 1W3KA 2O9RA 4NYUA 5FJRA 1AH0A 1U2YA 3MHGA 4KCTA 3NSNA 3EX3A 4MKVA 4DZHA 4KF1A 4XD5A 4QCEA 1ZP4A 3LDVA 3MMWA 1EX5A 1AQFA 7PTDA 3TN4A 1JF5A 3ARVA 3Q94A 1AODA 4QG9A 4AX7A 4GYPC 3SCNA 5F4SA 4X22A 2ZRWA 1KM5A 1RK5A 5I3FA 4FF5A 4EVZA 2PDXA 4KETA 3TDFA 1S38A 4GQRA 3M0VA 1I1WA 1J18A 2XM1A 5KZDA 1OHLA 3LXBA 2PLMA 3SW6A 1JPKA 3URHA 2ZRVA 3CZEA 3M16A 3KLKA 4IX0A 1TX2A 1VZWA 3WUFA 4I9AA 2OG9A 3K8KA 3OGSA 3ZLGA 2V6AA 2NV9A 5BCAA 4UTWC 4NZCA 4LALA 1UWTA 4NRSA 2TAAA 3G3DA 4XBJA 3RJXA 1ZS2A 1FH9A 4PYSA 1P1XA 4FLQA 3UG5A 3OVGA 3LTSA 2IKGA 5BMWA 3MQTA 4JTUA 1Q45A 3W71A 3BOLA 4EMIA 4LS1A 2DT1A 1HT6A 2GDUA 4FXFA 3OLEA 4IMFA 3M0XA 3B8SA 2V5BA 5I79A 1E71M 3VMOA 1EHNA 4GCXA 3I6RA 4JTCA 4UC5A 1U1HA 2OSXA 3MUAA 2X2YA 3USBA 1W37A 4I6KA 4JNYA 5FJOA 1XC4A 4RPPA 3DENA 1NOWA 1JYVA 3VD7A 3P67A 1L6YA 2WBAA 3AS2A 5DY2A 2CLLA 1MZHA 5JIWA 4I9MA 1VKFA 1NDYA 3TKFA 3CZKA 1NWUA 1UZDA 1R3WA 4P8VA 3MYPA 1VBGA 3RX4A 1EOKA 4WR3A 4BR1A 4WY0A 1HKMA 4YS1A 4CNPA 4XZHA 1CLVA 1VD6A 1LL7A 4M82A 2NWSA 3NQ6A 4Y2WA 5KEZA 5EBKA 5HMEA 3LB8A 2GJNA 2E5BA 4J7RA 1C29A 2VFEA 2GDQA 4DX3A 1KW1A 3CB3A 2FZ8A 4AXNA 3KDOA 4QNWA 3DG6A 5FACA 1B90A 3UY8A 1JXKA 2J8GA 3ABZA 1MFVA 2ZQ0A 3AMCA 4LUSA 3IC9A 1BFNA 2Z26A 3HG2A 5A2BA 5LGXA 3EOUA 1DWAM 1JAEA 2I1OA 1V0MA 3Q67A 3G1VA 1H61A 7A3HA 3URNA 3S5NA 5H8MA 3ARWA 3SN0A 1NQKA 2FTYA 3GLCA 5FJIA 4NAEB 1NARA 3NO5A 4JHMA 1VBUA 3MO7A 2QPSA 3QR0A 1T0OA 4HTBA 1IV8A 1KRBC 2WMJA 3FN9A 4KMQA 1RQEA 3OP2A 2WC3A 3TIMA 3L2IA 3KE0A 2NVAA 5F2GA 3NVYB 1XLMA 3A23A 1ECEA 3W88A 3S1VA 4HQVA 2BY3A 3MO4A 3QV6A 3NEHA 4QIUA 4XZLX 1E1CA 2DU2A 3GRIA 4ERGA 1KRCC 1VF8A 2CLPA 5GPRA 2CU0A 4LPCA 1XYMA 3WH9A 1CIUA 3IVUA 4FX6M 3WEMA 1GKRA 2VEGA 5F1VA 3DDMA 1E3ZA 2QCDB 1ZKQA 1ME9A 3OOQA 2JGQA 1DWJM 3I4KA 4GIRA 3QQ0A 1VEPA 4MY9A 3ITTA 4Z17A 1GKPA 2NSXA 4FSAA 4O1DA 4C6CA 5ABFA 3NQMA 2C18A 1D9EA 2PP1A 5G2HA 4Q7BA 1WUFA 4Q4KA 4JQ3A 2EPHA 5JMUA 1TFVA 3EWBX 3ZWTA 3GNNA 3GW3A 4IQEA 5CZSA 3VIKA 3NVWB 3H7UA 2VEPA 5HPCA 1BTMA 3SCPA 4IIFA 3KW3A 3II1A 2GK1B 1O5XA 3UPMA 4KPRA 1C9DA 2O4QA 4L61A 2DSWA 1R9YA 2Y8UA 2PDBA 2X1SA 4NY2A 1NPXA 5A5WA 1TWDA 4MG4A 3PK7A 1R3QA 5FF7A 7TAAA 3M43A 4YCPA 3QSRA 1UR4A 4GUFA 3ZO9A 4L6HA 1B3WA 4AIUA 3B3DA 3W27A 1PX3A 4GE8A 1EYEA 4PCTA 1SMDA 3GXIA 3MU7A 5A6JA 1IGWA 5F4WA 1G69A 4HTYA 4A8NA 2HDJA 3W7HA 1EJSC 1L6FA 2E3ZA 2GSJA 2VCCA 4GYJA 1TWIA 1B3XA 3IACA 2QUTA 2VHLA 3GBDA 2P5NA 4M6PA 5H6HA 1CBGA 2J79A 4B16A 4JDBA 4PTDA 3IGUA 4X61A 1HJSA 5EBUA 3NS1B 4CD6A 3BGJA 1W9XA 3DESA 2G5WA 3QC0A 4CNNA 5IDIA 2JEPA 5BYWA 3W86A 1SO6A 3SO7A 4HHMA 4UQBA 5GJPA 3O8AA 4IP7A 2YXXA 3STPA 4XBKA 4O0ZA 3NSXA 4HPXA 3BSGA 4JYEA 1VJSA 4Q3MA 3MZNA 3GRTA 1GQJA 2VZUA 1LLOA 3PUDA 4LRSA 1TMLA 5AN7A 4ATLA 4B91A 5CG7A 1JZ5A 1QO2A 4Q8QA 3VUPA 4PTWA 3B05A 1R30A 4J3WA 2QUUA 3AISA 4AVNA 2WZTA 4OV4A 1OF6A 4OOUA 1WOAA 4C6JA 4DJFC 5HQEA 3UETA 2IKIA 1DIOA 4FR6A 1EGVA 1YE6A 3E5BA 1DOSA 5C6MA 4HNNA 1VCFA 3WK2A 1G7UA 2QEZA 4MAZA 3DFQA 4XAGA 3NJ3A 3R1ZA 4PMYA 2YIHA 4AUBA 3HF3A 1ADDA 1P0EA 1HN1A 2BY2A 2DFAA 3SCRA 2YYTA 3W6YA 3OYZA 4HNTA 2YVFA 2HS6A 1O1HA 1FWFC 1XSIA 5LKYA 1FDJA 5JXQA 3BSHA 1JDDA 3SECA 1LOLA 3M07A 4UUIA 3O15A 1J2WA 1LOSA 4JZ5A 1E70M 1C8YA 3NQ7A 4YHEA 3VKBA 5A6KA 1N8WA 1GEHA 1ONXA 3RJYA 5DT5A 5BOFA 3U7VA 2AKMA 3DH7A 2WXDM 3WH5A 1ADOA 2XVGA 3CB8A 4EAMA 1ISXA 1K8XA 3RXZA 3WQEA 1BXNA 3S83A 2Y6ZA 3T09A 4JR5A 1L6GA 1KLYA 2Z25A 4F2UA 1TE1A 3KVMA 3VD9A 1DORA 2Q3OA 3V5CA 3H4XA 3VGFA 5FA5A 2X0HA 3CEUA 1OEPA 1OYBA 4C6OA 1X7FA 3KM8A 1J9YA 4GRTA 1JF6A 3LHYA 2X8HA 1KCLA 4O13A 3ZVHA 1JPHA 4C1LA 1X6NA 5HOSA 4D6HA 2WJFA 3W1XA 2O56A 4N6FA 4E8DA 4PN2A 5I3GA 5D37A 4F0KA 1RD5A 4DZAA 5CC6A 1UASA 2Z1SA 1XI3A 5C7VA 1HNYA 1PZ1A 4H4UA 2PFHA 1YDOA 4UMBA 3M5YA 3UY7A 3BG3A 4JN8A 1MXSA 5C9UA 1OB0A 3VM7A 1O1ZA 1YNPA 3T81A 1BVWA 1Q6FA 1Q2RA 3C2YA 3CL8A 1PTGA 3BCJA 2WSYA 3MI6A 4Z1BA 3HBLA 5B7YA 3WQVA 1XLDA 4S3DA 3NVZB 3G8EA 4TQTA 1XSJA 4GIAA 2GLKA 1QNSA 2A3EA 3R10A 1X6UA 4LVDA 2GGGA 1CXLA 4L4LA 4JHZA 3VC5A 3KBWA 3GFXA 2C6QA 5FOOA 1E6SM 3RPMA 1PZ2A 2BVDA 3W84A 2WLYA 3R8HA 3W7EA 1X1NA 4DO7A 1UD3A 4X60A 1KCXA 3WFAA 1KCKA 3HRDC 1VFUA 3TYUA 2QUVA 3M5XA 1EJVC 3HO8A 4OBRA 1OVDA 2O55A 2ZICA 2D0GA 5J5DA 1L2QA 3SUVA 1P0KA 2QUNA 1D3CA 3GDLA 2J66A 3PN8A 2FTWA 4M52A 5D2YA 1Z32X 4L7ZA 3CGTA 4K8HA 2GQWA 1UWIA 3ZVIA 5B80A 1TYGA 4UQ9A 4ZO9A 4B3LA 3L4VA 2OR2A 3HQ1A 1H7XA 5FKYA 2V0TA 3VE7A 4J3VA 4Q8PA 2YDRA 4H1ZA 4A3YA 3C86A 4BFAA 4QR6A 1TVLA 4NX0A 2CC0A 2DZTA 1R5YA 3KOZA 1ALDA 2VGBA 3AXMA 2CERA 2ZZ5A 3C4UA 3UPWA 4C5ZA 3H54A 1OWQA 5BROA 4U3AA 3K5XA 3BLDA 8XIAA 5DRIA 1JVNA 2XSXA 4LANA 2ON3A 2ZC1A 4UTKA 1ONEA 2A79A 3KAOA 3WNKA 3N9KA 2WLZA 1IZCA 2OT0A 5HWNA 1E4NA 2HVNA 1AH3A 3B9JB 4KWVA 1W1PA 3SIZA 3F4DA 3SUSA 2XN0A 4Q22A 2A7PA 3FNDA 1RBLA 4TO8A 2VC7A 1S3TC 1ZSXA 2DT3A 4HA1A 2WKJA 2ZUMA 3CHDA 4FR1A 4B5XA 1XKYA 2WHJA 3W38A 4GYFA 4K3ZA 1ISWA 3WQ5A 1UOZA 1VFOA 3NVDA 4CU7A 3IJDA 3TZNA 4LF1A 1M1BA 3KRZA 2HCVA 5M3WA 3I4EA 2PMQA 1M7XA 4JIEA 1UD6A 3PF3A 4D9PA 4A2RA 4G56A 5T8GA 2VFIA 2CITA 1XANA 3F4NA 3W2UA 2ZUUA 3TP4A 2DW6A 4E2VA 2Z2AA 1XINA 5BU9A 2CBUA 2QYGA 1BF6A 1UIPA 4US5A 2CKSA 1LJYA 4P7OA 3VZZA 1JD9A 3FYPA 2OZTA 1A5SA 2DIKA 2ZWZA 1TX0A 3DK8A 4K7VA 2WWCA 3A7UA 3TMQA 3I7QA 3R4IA 1VC4A 4MY8A 5HJXA 2ZUVA 2YCIX 4ATWA 1XPYA 3UZZA 4DYJA 3B8WA 3QFBA 3O6YX 4JY9A 1AH4A 3INPA 1POKA 4OE7A 1PHQA 3E02A 3OIXA 5T9BG 3HGOA 4RE4A 4MZYA 1M9HA 4BQ4A 2WMIA 3C8FA 4DF2A 3CNYA 2ODOA 3APGA 1LQAA 5AHMA 4HMEA 3DKJA 3HPFA 1W3NA 3PVFA 3RITA 3VXGA 1F8IA 5DRCA 4H9UA 2V82A 2YX0A 2UV8G 4QBXA 3UWVA 1J12A 4TX9A 3NZQA 2HRWA 2PS2A 3FEMA 4XIAA 4LQ1A 4JFUA 1VFHA 3U48A 5FMHA 1TG7A 1YPIA 1DWFM 1WDRA 4G1KA 1K9DA 2CXGA 1ICSA 4EIVA 3DUGA 3ME3A 1XX1A 1DIKA 3SUTA 2WSRA 2F6KA 1EJ7L 3TEVA 3ECQA 4CUCA 3UG4A 2GOUA 2J88A 4QAIA 4KQNA 3UXIA 1F5ZA 2J8TA 3N19B 3WY1A 4NQ1A 3IGSA 1TKKA 4LRTA 3S2LA 4H6KA 3UZWA 4TVCA 2FLIA 4PEKA 2EPNA 4J2MA 4P7QA 1E6QM 3KHDA 1V6VA 3DYOA 1KTCA 2BVTA 2C3DA 1HTIA 2Y63A 5U4NA 2QT3A 3ZJ8A 1TMQA 4PUUA 5D2XA 2XIMA 4WDTA 5D9NA 3DFHA 4QSFA 5RUBA 2CZFA 4RXGA 1E6NA 1KCZA 2A5HA 1V97A 3S9ZA 4I5RA 1C92A 2NUXA 4K8DA 3VU2A 2C3ZA 4NVTA 2X99A 3O3RA 3EB2A 4UBPC 3E5PA 5CPOA 4G7EB 1EA9C 4Q4MA 2QCNA 5JUVA 1O7AA 2YOCA 2J9XA 3LEPA 1XIDA 1UR0A 4V28A 1GVSA 5EBAA 2ZE3A 3TW9A 1HQTA 1YE4A 2WHLA 2V69A 2PDUA 4NSBA 5A8QA 4H00A 2WSKA 1HZYA 4DLFA 4O54A 3M5ZA 3UZYA 4C6KA 1EXBA 2AAQA 3PM6A 2VFHA 3H2EA 1YPXA 2QDDA 3QV9A 3BJTA 2QCLA 4R9OA 3NL5A 4S3FA 4DHGA 3CYJA 3K4AA 2PWEA 4QITA 1MUMA 1E4IA 4KESA 3U6WA 3H2NA 2Y4SA 3EANA 3P5YA 2PA6A 1A5OC 1GYLA 4S3AA 1H0GA 2I9EA 1EH9A 1QNRA 3GYCA 3RLUA 1A47A 2Q02A 3UWYA 1TREA 3CAKA 1K9FA 1J6OA 4BKNA 1REQB 4Z0SA 1CWYA 5EMYA 2D69A 1CI1A 3CV2A 3G1FA 3H4KA 2HZGA 2XDFA 3E0IA 4HU0A 2JQXA 4CLMA 1K7XA 3LLFA 5G4WA 3HOJA 3QZ6A 4BQ2A 3UJSA 1BKSA 3GXMA 3UESA 5DCDA 4AD5A 1US2A 4KEVA 3R0UA 3RU8X 3G1RA 1R8LA 3M0ZA 4GIYA 4HU3A 2VENA 4DJFA 1ADSA 2OZ8A 3LA4A 4NAFB 2VT0A 3KZSA 4O18A 2DZVA 4KERA 2INZA 3CWHA 1WKDA 4GBDA 3CXOA 1SZNA 1ZCCA 1MW3A 5XIAA 4ZSUA 4TIMA 3TJ4A 3W1QA 4H4PA 1N7KA 3GNOA 1Z42A 2E40A 2GJLA 4C6PA 4LB4A 1DJYA 1GETA 4PUWA 3VKCA 2CFYA 2GDVA 3U5YA 4JTEA 4W8BA 4MNJA 8XIMA 3MZ2A 5FIPA 2A85A 3LMYA 3QLDA 4QE4A 1RALA 2VC9A 3L4YA 2R8WA 2Z6JA 1W31A 2G0WA 2TYSA 4JL2A 5G2WA 2TPSA 4QM1A 3EDJA 1W17A 3UGVA 2WJDA 2Q01A 1KTNA 1AQHA 5ABTA 1PX8A 5HBFA 1FHLA 3L2MA 3SB0A 3VIMA 1XR2A 2Q8ZA 2PD5A 5CCZA 4C5YA 2H3BA 2WYSA 4W8LA 2EAWA 4LVGA 4V1XA 1FDYA 1KFCA 1IT8A 4L65A 4HNCA 3CLMA 4JCMA 1XDJA 3GQYA 1ME7A 2OYMA 1XUUA 3WLLA 1QBBA 3BICA 4TXEA 3POHA 4LC6A 4AWEA 4DUXA 1RLCL 4W84A 1V3LA 2OU4A 1WV2A 3NURA 4E4FA 4LUTB 1I75A 2BLEA 4PRWA 5DMMA 3WLKX 3R43A 3FXGA 1F3TA 2YCEA 3W7DA 5A3HA 1HIZA 1UR3M 1UBPC 3PTDA 4EWJA 5FSDC 1WXZA 4Y9AA 4MFDA 2XG9A 1EOMA 4PFHA 3E49A 3PZQA 1E73M 2OCZA 1SR0A 3GHUA 1DJXA 3CO4A 1UR1A 5XINA 1F73A 1Q85A 2ISWA 3V7PA 3W83A 4A3QA 3BOXA 1MO0A 3VGGA 3TC7A 4UTFA 5K7JA 1XCFA 1UP3A 5GJMA 4TX6A 3G6MA 1JG9A 3KDNA 5D30A 2EQ8A 4DUWA 4L5ZA 1B54A 4JY8A 3WUBA 5H8UA 1S39A 2JKAA 4ADTA 3W7NA 2AKZA 2HROA 2NQHA 3QPEA 4BJHA 1KTBA 2GWNA 1EPVA 1YBQB 3NM3A 5EGRA 1HKJA 1UR9A 5ABFB 1C9WA 2R94A 1S2WA 1MDLA 2QMJA 2IQ0A 1ZJHA 3SCOA 4EAYA 3FGCB 4F2BA