3I6TA

Crystal structure of muconate cycloisomerase from jannaschia sp.
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
367
structure length
356
Chain Sequence
DQSQIIAGFTLWHLSLPVTGAVEVVVLRLQADSGAVGYGEASPWVVFTGSVEATYAALDRYLRPLVLGRAVGDHAAIMEDARAAVAHCTEAKAALDTALYDLRARIAGVPVWALLGGRCRDRIPLSCSIADPDFDKDLALMQRLQDDDVRIIKLKTGFKDHAFDMMRLERLRADFPAFDIRVDYNQGLHHDVALARVRDVATFKPTFIEQPVKAHLRGLMARIRDAVDVPLLADESIFGPEDMAEHPEIADGVSIKIMKSGGLTRAQTVARMAAARGLSAYGGDMFEAGLAHLAGAHMIAATPEITLGCEFYQATYFLCDDILAAPFPVADGHVLVPDTPGLGVDVDEDALARFAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Muconate cycloisomerase
publication title Crystal structure of muconate cycloisomerase from Jannaschia sp.
rcsb
source organism Jannaschia sp.
total genus 130
structure length 356
sequence length 367
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3i6tA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3i6tA01
1DTNA 3QTPA 2OZ3A 3T6CA 3RO6A 3ZVIA 3V5FA 3TOYA 2AL2B 3MSYA 2OLAA 3SN1A 3I4KA 4K8GA 4ENLA 3OZMA 4IP5A 2GGHA 2AKMA 4GGBA 4JHMA 3CXOA 2ONEA 3UJEA 2MUCA 3FCPA 1ELSA 1FHVA 3MWCA 1W6TA 3GO2A 1MRAA 3JW7A 1EC9A 1F9CA 3TWAA 3ENLA 4H83A 3RGTA 2OVLA 2PTWA 3V3WA 3DFYA 2XGZA 3QN3A 2DW6A 2FKPA 3DIPA 3GD6A 1XS2A 3SSZA 3TQPA 1SJBA 3V4BA 4KT2A 3VCNA 1BQGA 3GY1A 2XH0A 2XSXA 2OFJA 1KD0A 3TTEA 4IL2A 2GSHA 1WUEA 3DG6A 1SJAA 2OQHA 4ZA0A 1FHUA 2HXTA 3FV9A 3T9PA 4A6GA 3FXGA 3JVAA 2OX4A 4X2PA 3DESA 1IYXA 3I6TA 4MKSA 1EBGA 3UCCA 3ZVHA 4F4RA 2PTXA 3SN4A 3UJRA 5BOFA 1JPDX 4MMWA 3ZLGA 3CT2A 7ENLA 3UJSA 2PGWA 4GYPA 4HYRA 1EBHA 3IJLA 2AKZA 1WUFA 3OP2A 3ZLHA 2AL1A 3UGVA 3ES7A 1R6WA 3OTRA 3SJNA 3RRAA 2PA6A 2CHRA 2QQ6A 2ZC8A 3U9IA 4ROPA 2PSNA 4GISA 2PPGA 2GL5A 4IT1A 2GGGA 4K1WA 3EKGA 1SJCA 4H2HA 4Z17A 1E9IA 4KPLA 2I5QA 3OZYA 1PDZA 4GMEA 4KWSA 3DFHA 3V5CA 2PP0A 4GIRA 2OZTA 3STPA 1JDFA 1R0MA 3MQTA 4DWDA 3VDGA 3D46A 3TCSA 1YEYA 4G7FA 2FYMA 2QDEA 5ENLA 2XH2A 4IHCA 2ZADA 2HNEA 2QGYA 3JZUA 2P8CA 4HCDA 3H8AA 2PCEA 3H7VA 5FJRA 1JCTA 3CK5A 2QVHA 3OW1A 1ONEA 4E8GA 1ECQA 2POZA 3ZVHB 3CYJA 4M0XA 3PWGA 4K2SA 2QJJA 2OO6A 3UCDA 2OPJA 4J3ZA 4A3RA 3VC6A 4E6MA 3P93A 3BSMA 3MY9A 3N6JA 4IL0A 4ZCWA 3DG7A 3DDMA 3R10A 3IJQA 4E4UA 2QDDA 4DHGA 3PK7A 2GGIA 1KKRA 3VFCA 3BOXA 2QJNA 3N4EA 3D47A 4H19A 3UJFA 3UXKA 2P3ZA 3R25A 4DYEA 3NO1A 3TW9A 5FJUA 2OZ8A 1EC8A 4EWJA 2O56A 3VCCA 3TWBA 3R11A 1PDYA 2PP1A 2RDXA 4E5TA 2OQYA 3P0WA 4DXKA 2DW7A 5FJPA 4YWSA 3RITA 5FJOA 3N4FA 4GGHA 2P88A 2HZGA 1EC7A 1BKHA 3RCYA 3IK4A 3CB3A 4HCLA 4Z1YA 3T8QA 3UJ2A 3FYYA 3NFUA 3Q45A 3P3BA 6ENLA 4HCHA 1SJDA 3BJSA 2PTZA 3K1GA 1L8PA 3S47A 3R0UA 2PU1A 2PP3A 2HXUA 3T4WA 4JN8A 1OEPA 5FJTA 4DN1A 3S5SA 2PTYA 1XPYA 2PS2A 2PU0A 2P8BA 3H12A 1NELA 3CAWA 2PMQA 1P48A 3HPFA 3NZGA 3Q4DA 3SBFA 5IDZA 4JN7A 3MKCA 2QJMA 3DEQA 3R1ZA 4H1ZA 4HNLA 1MUCA 3KUMA 1RVKA 1TKKA 3ES8A 3DERA 3FJ4A 4G8TA 2XH7A 4GYPC 4HN8A 4MGGA 4E4FA 4FI4A 3H70A 2AL2A 3DG3A 5BOEA 1P43A 3PFRA 3MUCA 3R0KA 4GFIA 2PODA 4IZGA 1TZZA 3FVDA 3QKEA 3PWIA 2PGEA 3NXLA 3TJIA 2GGJA 3I6EA 3MZNA 3ZLFA 3QLDA 3SN0A 3SQSA 3THUA 3N6HA 3U4FA 2P0IA 3RR1A 4HNCA 1MDLA 4M6UA 1MDRA 3VA8A 3IJIA 1KCZA 3VC5A 4A35A 2OG9A 3UXLA 1JPMA 2GGEA 2GDQA 4KEMA 4IP4A 3GC2A 4HPNA 1TE6A 5EU9A 1MNSA 3EEZA 2MNRA 1NU5A 5J04A 3DGBA 3QPEA 3OPSA 2XH4A 4DX3A 3TJ4A 2OKTA 4J1OA 3B97A 2NQLA 1KKOA 4FP1A
chains in the Genus database with same CATH superfamily
3TA9A 4LB4A 3QQWA 4BV6A 4DYJA 3QTPA 3WJZA 3MV11 3EX1A 1BPLB 3GH7A 4LSBA 4YL2A 4H4TA 1XV8A 4GWEA 4GKTA 1XSKA 5JXQA 4QG8A 3AS1A 3CC1A 3QSRA 3CIXA 3LY0A 2WMIB 3BUVA 1H41A 5CPNA 1CT5A 4GZJA 5AHFA 1GXFA 1PVNA 3GNPA 1W5QA 3QMTA 4R7JA 1PWMA 3A7AA 3KP0A 1XS2A 3PTKA 1FWHC 1OF6A 1G5AA 3RILA 3OQEA 3SIZA 3AO0A 4JAWA 3LXBA 3II4A 5D33A 1R7OA 3SCRA 1BF2A 4UNKA 2X8HA 5A8OA 1F6YA 4GUGA 4I5RA 1XYLA 1QR7A 1VR6A 3NNTA 6REQB 3GX9A 1R3QA 4RUBA 1XDMA 4E8CA 1WUEA 1DJYA 3W1UA 4LFYA 1V6UA 1QI3A 4JNMA 5GJMA 1NHQA 4YPJA 1GRTA 3EEGA 3GU1A 1S3HA 3SB0A 2WKLA 2WANA 2V38A 1TZ9A 1IT8A 1GW1A 1P4CA 3IGHX 1EX1A 4BQ4A 4YTQA 4EM4A 2TPSA 1JYWA 1A5MC 4MMWA 4DRSA 1PKLA 5FJJA 4EAYA 1RQHA 3DH9A 1ZQ5A 1QPOA 4LS2A 7A3HA 4JTQA 1UWIA 2QKFA 3SM0A 5CSUA 3Q65A 1P6BA 4H3DA 1Q8JA 4JTFA 1OT2A 3GYEA 2JGQA 1W8GA 4ZB5A 4GXWA 3SIMA 2VCAA 2CHRA 4PUKA 3U9IA 5CZJA 3I7RA 2R14A 4GISA 2Y5SA 5IFPA 1KFLA 1VFTA 1H51A 1X6NA 1PDZA 5L6UA 1V6TA 4R9XA 4BF7A 4W7VA 1W8SA 3MDWA 1O60A 1IEXA 4LANA 2CC0A 2ZX5A 2OT0A 1WPCA 3HN3A 3IJ7A 1UKOA 3VIJA 3W1TA 3VD9A 3MQTA 3AJXA 3C86A 3VDGA 4JHOA 2A79A 4HK7A 4BQ5A 3WDRA 5HMEA 3MJYA 2EEXA 2XH2A 2HNEA 4GUJA 3NQ6A 3ETRB 3CS2A 4NNAA 3O15A 1YQ2A 2FTPA 1GKPA 4ERGA 1RPKA 1HO1A 4H4YA 3VVGA 1XRTA 2FHBA 5HMDA 1R2SA 4H4SA 1Q66A 4LUJA 3TU9A 2EQ6A 2ZFAA 1E9ZB 1VP5A 1JUKA 1KFJA 3UNTA 2ZBTA 3QQ0A 2OPJA 1TMQA 4H41A 4A3RA 4IIFA 3MY9A 1UJQA 1NEYA 1CPUA 1SZFA 5D9OA 3QPZA 4HU8A 3ARVA 3TJLA 1RQBA 2ZXDA 4WOQA 2Q6ZA 1OGSA 4LAOA 1HKJA 3QFBA 4TR9A 3W25A 4JBRA 1VBGA 1JZ4A 1VEPA 2YL5A 3Q67A 4LY8A 2GGIA 3WD4A 1H7WA 4J5NA 1W32A 2FHFA 5AECA 2BMBA 3TN6A 5H1WA 4H4VA 1B3ZA 5M2FX 1EC8A 1K7EA 2V82A 3SCUA 4ZQCA 2O56A 3TYZA 2B7QA 4K3ZA 1KXQA 5F7UA 3EDKA 4CN1A 2VQUA 3A3HA 2GOKA 1XLIA 3MO4A 3NAVA 1JDEA 4LIIA 5BWAA 4NEVA 3H26A 4D72A 2J7FA 4TU1A 4B5XA 3M0VA 1TV5A 2HPMA 3GS6A 1FFVC 4OZOA 3W00A 1W1YA 4IQDA 5E6ZA 4UIOA 3MU7A 4KRZA 2QAPA 4JTAA 2Y70A 3AHZA 4EACA 2PLCA 4JQAA 3D3AA 4IXHA 4HMCA 1H1ZA 4FNRA 1QT1A 3IARA 2PWDA 3UFYA 1E6ZA 3BURA 1RHCA 4K36A 2GR3A 4L6DA 3H12A 1RAKA 3P6LA 2DIJA 3G5EA 2ESCA 4O4VA 4MZ1A 3ZSTA 3BZGA 2X2GA 1NOFA 1FX6A 2G41A 3GB6A 5FEPA 3FGCA 2QV5A 4D6IA 1FWFC 3WD3A 3NVYB 2EQDA 4B3KA 1BG4A 1E0UA 2BGQA 4GY1A 2IW0A 3E5PA 3UXAA 3QZEA 3DBNA 2V3EA 2HSAA 5J5DA 3ZJ7A 2GUBA 3E74A 2RDTA 3QLLA 5CPTA 4KESA 5CZ0A 1DQUA 1E9YB 4AD5A 3TNOA 2YFNA 2P0IA 3W26A 4EPEC 1TIMA 4IP7A 1JNEA 4MM1A 2XSAA 2HK0A 3I3DA 1OCNA 2GGEA 3WLOA 2VZSA 2EJ1A 1PIIA 1NFBA 3IIOA 2VP8A 5E9AA 1FH9A 3P14A 1PS9A 2W5FA 1E0XA 2A3LA 3LB8A 2AGKA 5DXYA 2QUUA 1IXOA 1K02A 1Q6OA 1Q6FA 5IFTA 4EP8C 4E3VA 2V3AA 1VBRA 4M52A 3PZ9A 3COTA 4AW7A 5JCMA 1VBUA 3FY1A 2O55A 3LNMA 1K9DA 4Q4MA 3MP5A 1FHDA 2EJAA 2Y63A 3TYEA 1W5PA 1QBBA 4C6BA 4LAZA 2J88A 3QGVA 1E71M 2PRMA 3BLLA 3S0CA 3L4TA 2WSKA 2XFWA 3QHNA 2QCNA 1RCXB 2YSWA 1MRAA 3JW7A 4JTCA 3SRFA 4Z2IA 3C52A 1EC9A 1TJRA 1F9CA 4A29A 2YBVA 4B4HA 5EBUA 2V5CA 4PZVA 5DMLA 3QN3A 5HQLA 3UNDA 3H23A 3R79A 3WNLA 2FFIA 1Z48A 2VR5A 3V4BA 1NFGA 3WH5A 1BQGA 1W91A 4JTRA 2ODOA 4Z1BA 1NOWA 2VCBA 5FSEC 2G5WA 2OR2A 2V5DA 3JU2A 2J13A 4JS3A 5FF2A 5C70A 3CYVA 4H9MA 4MJ2A 3LRMA 7REQB 2OQHA 1Q6QA 3A22A 3SRHA 5DRIA 1TZ7A 5K9XA 4Q8NA 3KAOA 1S2VA 3W73A 1O6IA 1DJHA 2BC0A 3S42A 5FA5A 3I6TA 1E3ZA 4YIWA 1N62C 2PTDA 4BFAA 1XBZA 3LBMA 1Q2RA 1BXCA 4LVBA 5GRTA 5BROA 4WGXA 3JS3A 1MYRA 4Y9NA 1EH9A 4F3HA 1UKPA 4K7YA 2PGWA 3IIPA 1VJZA 1UP0A 1EHNA 6XIMA 2V5BA 3H54A 1FTXA 5HBFA 3RM9A 1GQNA 4ZODA 2Q71A 4MKNA 4PCPA 1AQHA 3OLDA 3AMZA 1QW9A 4NI8A 1J6PA 2QCMA 2C1IA 4XX6A 4Z0SA 3L5AA 1FDYA 4GUFA 4K1WA 2WBGA 3CH0A 5AZ1A 1M65A 2DT0A 3PG8A 3UWVA 1PIGA 2PLJA 2J6XA 2MANA 3DKLA 3W1NA 1XF0A 1GREA 5D8ZA 2A7RA 2WZTA 1DWIM 1F4HA 3V5CA 3T40A 1NP0A 1JCMP 3VKAA 3UG8A 1JRCA 3SQMA 2YLAA 2Z1XA 3U2ZA 1G67A 4B5UA 1LZOA 1OJTA 3H4GA 1FDJA 3GXNA 4A2RA 2BXZA 4LGXA 4PTDA 3K5XA 1K03A 1F76A 4PSPA 2Z1VA 3TTSA 3BJFA 3PBUA 1R8LA 4INFA 3ZR5A 4MADA 4MZ8A 3VO0A 4Y9PA 2ZQ0A 3HTWA 1Q7MA 3GHTA 5F4XA 4LF2A 1OSEA 1QHOA 5LA0A 2QYGA 3ZVHB 5LSMA 3QM3A 1RSCA 1YNYA 2CWXA 2QJJA 2YVJA 4PB4A 5T91A 1FP9A 1ZALA 2H3DA 3EOOA 1PZ0A 1YMYA 3TUUA 1HKKA 1QASA 3QKZA 2VC9A 2FJUB 4N6FA 5TBOA 3NIYA 4JKMA 1OVDA 4WJXA 1F7BA 4DXVA 1XH1A 4MSSA 3W7CA 2PWGA 4GFSA 1ADDA 4M80A 4WDXA 1LUCB 1BF6A 1JR1A 3CHDA 2GR0A 3W70A 3AUJA 2C15A 2XPKA 3PK7A 1WAWA 3UERA 3NVDA 3QZAA 3VUPA 4EQXA 1M6JA 3NO1A 2P3EA 2VC7A 2FGZA 4ES4A 1BYDA 3VI2A 3W7OA 5DCDA 3MYOA 3R11A 1P7TB 5GPRA 2P1FA 1V3JA 3AIEA 4QDPA 4WUIA 3RITA 5FS7A 3WMCA 1IZJA 2R9ZA 4YVPA 4MPKA 1BKSA 1VPXA 5I24A 1H2IA 1TPFA 1JUBA 1UWSA 1ZAJA 1ZCOA 4N02A 2E67A 2Z26A 3NDOA 2F6UA 2C0HA 2WVUA 4LBUA 3RLUA 3A4WA 1CGTA 1JCLA 4KBXA 2NLIA 1D2KA 5DBUA 4F0KA 2IQ0A 1RJPA 3KOWA 3C2FA 1XLFA 3EB2A 3HM7A 4O1DA 4O1FA 1L8PA 5AC7A 3FAWA 2BB0A 2VQTA 4LQ1A 3S47A 1WYGA 4WDWA 2DH2A 2O4MA 3NZPA 1GJWA 2DSVA 4IGMA 2PS2A 3WK3A 2PU0A 2ZICA 1QFEA 4UXDA 3PBMA 3KHJA 3B8UA 2HK1A 2DZUA 3QVQA 3W72A 2PDUA 1RP8A 2F2HA 3VNZA 3LU2A 3HG2A 1K4QA 4WQ6A 3TLLA 4P5UA 1J6OA 3GG8A 4FNSA 3ZMRA 2FZDA 2NVCA 2ZZ6A 2YYUA 4E38A 1X2HA 5BNKA 3OYZA 1A5KC 3KBMA 3MUCA 3R0KA 3WJYA 3S6TA 3FVDA 1EJUC 4TUFA 3W7HA 3FEMA 1DJXA 1O1ZA 4IOTA 4O8AA 5DX7A 3QY6A 2VR4A 2Z1BA 1FWJC 2Q8XA 3M41A 3UVAA 2YB4A 2G3IA 3REQB 3QLDA 1OX4B 1QI2A 4HNCA 4NG3A 2I7GA 1RY8A 3JR2A 4A35A 4EPDC 2Z1SA 2JFEX 2Z00A 4LWWA 4C6QA 1PIFA 1GW9A 3DYOA 4Z2JA 2ZXQA 3IGXA 3DK9A 4QJ5B 3K1DA 5EU9A 4ZFMA 1LORA 1UASA 4W8LA 2CXGA 2X1RA 3TC6A 3H4KA 1WXYA 1K8YA 1FFRA 1X6UA 1K7XA 3T44A 1J96A 4FXFA 1YQZA 1KKOA 1UKSA 3MI6A 1W5OA 5EMUA 2FVLA 4G7EB 4F0SA 2WCGA 2CKRA 2XVLA 4WDUA 3KFTA 1CX9A 4L4MA 1DHKA 2DFAA 4XZMX 4GJJA 3P5YA 5G2HA 4G2DA 2GDVA 3UWZA 4XZBA 3KCLA 4AAJA 3I4KA 4KFPA 5D09A 2P53A 3SGUA 4ENLA 1OGBA 4A4AA 4KRUA 3M16A 9CGTA 3W01A 4TX9A 4P8WA 4J56A 2NVKX 3U8GA 1DORA 4QSHA 1A0CA 5G4WA 4G9PA 3C61A 3OLIA 3DFTA 1PUDA 2YCKX 3C3UA 5HJLA 5C7HA 4DJEC 1EYWA 1O94A 2GSJA 3TTYA 1TO3A 4JIPA 3VZXA 4GOAA 3FJ6A 5I3DA 4JFSA 5KTLA 3NGJA 3T2QA 3RO8A 1XBXA 1I2PA 1Y5VA 2YCLB 2XH0A 4HU3A 3BANA 5F2MA 4TX6A 3VIFA 3PZQA 1DWGM 1Q85A 2GH5A 2OLSA 3GYCA 3ORWA 2IXVA 1JPHA 2OU4A 4V28A 1O5RA 4KH2A 2BY1A 1GVRA 2J7DA 1CLKA 4F8XA 1ZFJA 4LF1A 3IC9A 4ADUA 1VBHA 1DXFA 1OABA 4HJFA 1R9XA 1MMFA 1W56A 2PGRA 2VZTA 1T6MA 4WY0A 1OM0A 2HMCA 3UESA 2ZWYA 3Q6JA 3LMZA 4V1YA 2PDXA 3ONBA 1RD5A 5BOFA 2HROA 1KRCC 2WP5A 2DT3A 2ABAA 2XDFA 3ID7A 2WHMA 2OEKA 3R94A 3FNDA 3WK1A 1FCVA 4AX7A 4J3SA 3RDKA 4AC7C 2J8FA 2KZHA 3N4AA 1IHIA 1XSIA 3QC3A 1QBAA 2PA6A 3A64A 4TTUA 4XAZA 2QQ6A 3BMVA 3ZM8A 1CENA 3S1GA 1OADA 1X7IA 3SCNA 1XHCA 1DWFM 3KP1A 4GVHA 4ZL1A 2Y61A 3SRDA 4JX5A 3QBUA 1OYAA 3T09A 4MY8A 2BS9A 3L4WA 1RP9A 4PRWA 1JNDA 3HFYA 4IMFA 4FNPA 1JYXA 3PHAA 4ERAA 5CZSA 4QTGA 5I5RA 4Z2KA 2CBIA 4RZ6A 3D46A 2Q09A 3FK4A 1OCJA 1K77A 4WXYA 5ENLA 1TYTA 1Q7QA 4QFUA 2J79A 2VWTA 4KCUA 1J18A 1PPIA 3RNDA 1KM4A 4AXNA 5EMLA 1VYRA 3M0JA 2F2KA 1NIUA 5E70A 3WX7A 3RX3A 1ONEA 1XBVA 4CN6A 2V5JA 4PTWA 1E1CA 2J25A 1A0EA 1AK5A 3WYZA 2CIPA 2BGNE 3AS0A 5AVNA 2VZVA 3BSMA 2Q3OA 1VHNA 5CGQA 2Y7EA 4Z42C 1XGZA 3MHUA 1LP6A 1FEBA 1BD0A 3BZJA 1QRQA 1P1MA 1LG2A 3T0TA 3S8HA 3PULA 3IJQA 2DIKA 4JY9A 4JEJA 4ZO6A 3G1RA 3GIPA 2A21A 1H60A 4FZIA 2OCZA 4NAFA 3EOLA 4K1GA 5AC8A 1W9XA 1R2TA 5FJUA 2OZ8A 4R3UA 3SR7A 1VFHA 4H9XA 3VCCA 3TWBA 3H4XA 1VLWA 5F2GA 4NSBA 4US6A 1GTHA 1PE1A 3CZ8A 4B16A 5HINA 3UPBA 4ZO7A 4DO6A 4UFIA 1ICQA 4ZE5A 3CZLA 1XLKA 5FF3A 2GPTA 3D0CA 2WCAA 1AQ0A 3HIJA 1QXLA 4H6KA 5HQMA 1W1B1 3FYYA 2FZBA 1FKXA 2OGJA 3W07A 2ZUMA 1BSIA 3EKZA 2XU2A 1SJDA 3OVGA 3G1YA 2G8ZA 3NWRA 4JX4A 3LTPA 1LT7A 4L6HA 3HF3A 4JQ2A 4IFKB 1G1YA 1AH0A 1XANA 2VZOA 3E5BA 4JTTA 4AZCB 4H2CA 2X41A 2FIQA 1TJ0A 1KR1A 1XPYA 2Z0IA 3JRKA 4AZGA 4AIBA 3NZGA 1IT0A 4JN7A 1O66A 2Q02A 3NG3A 4A8IA 2QJMA 4H1ZA 1PZ2A 4WIWA 3DERA 3UR5A 2BVWA 1GSNA 1TTPA 2X1UA 4PB3A 1ODZA 2L5HA 4AUBA 4C7GA 2HQAA 4Q4SA 4S3EA 1UMYA 4W93A 5AN7A 3VINA 1WKEA 1U33A 1PEZA 4AVFA 3WELA 4DZAA 1RXOB 1WDDA 1MSSA 1UKTA 4GNVA 3T0DA 4FIRA 2P76A 3T7VA 4W88A 8XIAA 4LOCA 2PDMA 1UA3A 4AY7A 3H2OA 5C55A 1YXDA 4I7VA 5U7SA 2REQA 4K7ZA 4JL1A 4Y2WA 3PBYA 4GI9A 2Z28A 4I3GA 3RXZA 2W3SA 2DSZA 4W8AA 3SN0A 4DNAA 5FS9A 4PRTA 1XIGA 1I4NA 3N6HA 2CLMA 1K8ZA 4PFHA 4W85A 4M6UA 2BFGA 1XLHA 2UZ9A 1EKOA 2C16A 1V0KA 4HIBA 3W74A 2XJ7A 5FF7A 2ZA2A 5G4EA 2VTFA 1G4TA 4XV0A 2ISFA 3RM8A 1Q1WA 1HF6A 3MCOA 4AZ7A 4PB5A 4KEMA 4LT9A 2Y24A 5AY7A 2D20A 2G3JA 4UZSA 4QE5A 2WYSA 7CGTA 3GZAA 3NZRA 1Z6KA 2CWNA 4LUTA 4M6VA 5EFFA 4JDRA 3TJ4A 3HURA 4J1OA 5I3JA 4CCZA 3ARUA 2AQOA 1CEOA 4XVDA 4ECLA 4LALA 1M01A 5HAOA 4EOUA 5HNTA 1EP2A 4H6RA 4AD3A 1WDWA 3PB0A 3HPAA 3TCEA 4XISA 4G5DA 4CQBA 4QCEA 2NUWA 3N17A 1QNSA 3WD1A 4UCFA 5DEZA 1S46A 2YJQA 4YVVA 1Z69A 2WMHA 4HZ7A 4YVXA 2NX1A 3CXOA 4RX0A 3T42A 3CUIA 3NDZA 5I77A 4NJHA 4AMCA 2E4TA 1WBHA 4WY0F 1S39A 2DZAA 3VNIA 3T55A 1YPXA 1JRPA 2WLYA 1XLLA 4QS6A 3DUGA 1NHSA 1UB3A 3AYSA 3TQPA 3W1QA 3NQBA 1JEZA 4Q3MA 3VOJA 3N34A 5AYIA 3LMYA 3LYEA 1GOIA 3B8VA 1KM1A 4ZR8A 3WEZA 4UQAA 1FWBC 1UD3A 2O7SA 3HRDC 3R7MA 3WMSA 3UGRA 2QCDB 3STFA 1ICSA 2WJFA 1KM5A 4JOMA 3DG6A 3SCPA 4UBPC 2GJXA 1QPQA 1RLDA 2XGBA 1KXHA 2PF8A 4QDWA 4S3AA 4S3FA 3TXVA 3SQLA 3NL5A 1C93A 1NY1A 3O7UA 4NZ3A 4AD2A 5H2ZA 2C3ZA 4JFTA 3QXBA 4IGHA 3GUGA 3L4YA 1QI5A 3IVUA 1J2WA 2QPXA 2WJEA 4MDPA 3T81A 4N6EA 1MOKA 2NSXA 3OBAA 3B04A 4YS1A 1G01A 3OP2A 4DZ5A 3NUKA 5CPLA 4LUSA 1IIGA 2G3NA 4ZQRA 3WDPP 2D0GA 3INPA 2CNCA 3GD4A 2ZRYA 3EDDA 3CQJA 3KM8A 3NJ3A 2ZVRA 2D23A 3WUBA 4QISA 3W7IA 1IZCA 2GWGA 4EPKA 1QOQA 2GQAA 4L6OA 3OA3A 4H4UA 1GRGA 1SFTA 1MRQA 2W9MA 3WNKA 4KCWA 5U25A 2ZUUA 3NRZB 2X16A 1OZQA 4H8HA 2IKJA 5JBEA 2YB1A 3W7RA 2C8NA 4YNGA 5AOUA 1RBOB 3RAOA 2ZADA 3NM1A 4LCSA 3WY1A 2X7WA 3WK2A 3MUAA 4NZCA 1KV5A 5AHLA 4FO4A 4FXJA 2PWUA 3GFZA 5A6BA 1L6GA 5DMYA 3OW1A 4E8GA 1KRBC 2ZA3A 4GABA 1D9EA 1V93A 1OK4A 4ZQPA 4C5ZA 2POTA 4QG9A 1ESWA 3AM9A 3UCDA 5EA9A 3O0KA 3P93A 1CZ1A 1EOKA 1AMYA 3C2EA 2X42A 5FF4A 1DHPA 4UTLA 4DLMA 1US2A 1LBLA 4PC8A 4J3WA 4OECA 2WOIA 3R10A 3ZJ8A 3CB8A 3OLEA 1TX2A 3G0UA 2W61A 1J0KA 5IRPA 1BYAA 2PWFA 5CQ1A 4YCOA 1NH6A 1MZRA 1TJPA 3W75A 2ZZBA 2PZNA 3GVRA 3T07A 5JIWA 1QVBA 2FPYA 2INFA 1KKRA 2CU0A 1VFSA 4FX6M 1VRXA 1H5YA 4XKYA 4GQQA 1VJSA 1W3LA 3W02A 2HCVA 2ZCGA 3P8JA 1PJ9A 2NQJA 2R94A 1ZHAA 4DBEA 3W2NA 5DCEA 1MFVA 2E6FA 4MWAC 5G1YA 5DANA 2HS8A 1XIMA 3C0QA 1UW9A 3C2VA 3CUHA 4PMQA 4W84A 1CXEA 4GRSA 1P6CA 3M6DA 3N4FA 1VC4A 4B5TA 2TRSA 2ZYFA 3TK7A 3RYSA 3B8WA 2Y6ZA 3WLKX 1TUFA 3BAJA 4RCXA 2BP1A 3CB3A 1W9DM 3WLIA 2CBVA 1BTCA 2C13A 1U2YA 5KSWA 3PP7A 1OFAA 3Q45A 1ZX9A 4GKLA 3CV2A 1IWPA 5I3KA 4DJDC 5M5DA 3M5VA 2EPHA 2Y7FA 1SZEA 1FRBA 3FJNA 3R0UA 4I9MA 2QS8A 2HXUA 3GAKA 4Y90A 5AYBA 1AW2A 1ZJIA 1N5WC 3BQ5A 1B2YA 3VMNA 3GG1A 3S5SA 2PTYA 4ZE4A 4A3UA 5TR3A 2JE8A 3M5XA 1P5BA 3MV01 1DBTA 2JF7A 1NELA 3EOEA 2WBKA 3OBKA 1M68A 3MKCA 1W1A1 3M0LA 1VFFA 1MXGA 2Z1WA 2QR6A 1QUMA 3TDFA 2FVMA 4JZ5A 3HMCA 2WCSA 2XIQA 1I60A 2HBVA 1WV2A 3ATZA 4CNPA 3KL0A 3TN5A 3GSMA 2J6VA 4F0HA 3FSTA 1AZ1A 2WPCA 1GQLA 4G1NA 4RZ5A 1PKMA 5A8MA 2OXNA 3QW4B 4I90A 3L2IA 5FEZA 4FX7A 3EYPA 3THUA 4KPRA 4M1RA 3FDKA 3RFAA 2CW6A 3AWNA 5REQB 2D1ZA 2DZPA 4WJEA 3N11A 2NV1A 4E2OA 1LOQA 1UZHA 4ACZB 3VOFA 3G3DA 3IAQA 3EOSA 4ZOBA 5H8PA 4HZ8A 5AHMA 4E2BA 4DUWA 5FAGA 1LVLA 3M44A 4LNYA 3T8LA 3DI0A 3UCQA 3NS1B 1A5CA 4S39A 4HOZA 5A3HA 6REQA 3NQGA 1Q7ZA 4ONVA 1ZMCA 3O0HA 4PSRA 2GK1B 2X0YA 3LBOA 3CPUA 5HJYA 2WC7A 1X8CA 4C5YA 4AY8A 2ZRUA 1KFWA 1B3YA 3ARQA 1ZDLA 4C7DA 1B3XA 2VDHA 4F0LA 5KETA 3FXYA 3A9BA 3NQVA 2J4GA 3TAKA 3T0BA 2B7NA 1LBMA 2D2GA 3VKBA 1U5JA 1ZY9A 1HJQA 4MYAA 4Q8QA 3PJUA 3VMOA 4KIEA 2AKMA 1Y5XA 2Q3RA 1DKWA 2WMGA 4QQ3A 1S7MA 2ONEA 1WDSA 4MVAA 4YWOA 3PPCA 1H7RA 1QO2A 4JY8A 2XYLA 1V7AA 2WVSA 4C6EA 4RNFA 5FEWA 3TZNA 3MVIA 3TW6A 3A4XA 3SY5A 5FSDC 2EXOA 1R85A 2DW6A 2PLKA 1SVDA 1LWIA 1TWDA 3AIRA 1KN0A 4CLMA 5ABFB 3BAYA 3FA5A 4KT2A 1QI0A 1HJXA 3S1VA 3DU0A 2D0FA 3A3WA 2JKEA 5DY3A 2ZUSA 4QROA 2EGZA 3F2CA 1EP3A 1GVSA 3TSMA 1R38A 1MFUA 1KB3A 3TSBA 1SJAA 3C3NA 4BR1A 3LB0A 8A3HA 3FV9A 4AY1A 2PDCA 4KEVA 3AISA 3E96A 2J9XA 3S9ZA 2QJGA 1WOAA 2UWFA 4DWSB 1EX5A 4UTMA 3E9AA 4PL1A 4C91A 5K3VA 4CNSA 5F2LA 3A5FA 2F84A 4L1XA 2YVGA 5T8GA 1JPDX 3BLOA 3NSNA 3EF6A 3KZSA 4UQEA 3AXXA 1UQYA 4JTJA 4LRTA 3BCDA 1EXPA 2ZX9A 4W8BA 5EY5A 4NAEB 2QT3A 1BWCA 3CL8A 3VX0A 4UWMA 1NFPA 4H4WA 2DZXA 3VM5A 1S2TA 2G3MA 1YYAA 1SSDA 3IJ6A 2NZLA 2VD9A 3D5HA 1NWSA 4CU7A 4Z17A 5AC6A 2Z6IA 3GNDA 5H8MA 1TV7A 1GPWA 2XN0A 4PMJA 3UYIA 4IG2A 1SZGA 1LCOA 1ZPTA 1W2VA 3VIIA 3C2YA 3TQKA 3PNUA 3V16A 1RA0A 1YEYA 1DWAM 3QOKA 1O95A 3TMLA 4DJFC 2ZZCA 4XO6A 4N9CA 1KM2A 3O6AA 1XSJA 3P8IA 2QCCA 3CV1A 3OU8A 1JZ2A 3NTYA 1ECQA 2OO0A 4R27A 1HVQA 3KVKA 4WCJA 3DHFA 3NXFA 4ZSTA 1D3HA 3H21A 4LYQA 1OB0A 2E7FA 1XUUA 3M7WA 3CT7A 1WA3A 3WQCA 2ZUTA 5A2CA 2W4XA 4J3VA 2A8XA 3R8RA 1GZ1A 5I00A 3WLJA 3DYMA 3H4WA 1ONRA 2VDIA 3G22A 3PAOA 2E9BA 1O1HA 2OYKA 3F4DA 4E8DA 3DCPA 2GQ8A 3V0SA 3ZJ6A 3U2CA 1KGXA 4P7NA 2W6RA 1AJ0A 1Q13A 2QJNA 2XVGA 3UJFA 1MO9A 4KFOA 2XINA 2PDWA 3TW9A 2YZ5A 3TXZA 3EWCA 2BHUA 1NVMA 2PDQA 2X99A 5I09A 3KBJA 4KIRA 4CQDA 2Z7GA 4GIYA 3WFAA 1DOSA 5TIMA 1RJRA 4AEFA 1TPDA 4HA0A 4XO7A 1S5TA 4AEEA 1OF8A 3L21A 3WDIA 3UQNA 5DY2A 2W66A 4OOUA 3L4XA 3NFUA 4QITA 3CZEA 5AC5A 3C5QA 3BCJA 1GVFA 2VDGA 3UZ5A 3UG4A 2W3RA 4S3BA 1UD6A 4M51A 1MW3A 2VEIA 4L64A 1JYNA 5BXTA 3PR2A 3N12A 2VI0A 1Z41A 4DNMA 2TAAA 5BMXA 5LNWA 4S38A 1QNPA 4LS0A 1G6CA 4H04A 2RGLA 3XINA 2PWHA 2NQHA 3POCA 2G97A 2XIIA 2HV5A 5RUBA 3LXDA 2I5IA 4HB7A 3S46A 2KAUC 1ENUA 2CLPA 4J27A 1QK0A 5EMYA 2A5HA 3C56A 3LDVA 2V5LA 3WN6A 4NT0A 4WR3A 1TPUA 3FJ4A 4C6KA 3P60A 5LA2A 4YTUA 3MHGA 1A53A 3C0JA 2CLHA 5LYRA 5LKYA 2DY3A 3DYPA 3CTLA 4FI4A 4LH8A 3URHA 3VGEA 2EBNA 2EKCA 1DQWA 1NSJA 2VFIA 2NWRA 3MKVA 2I9UA 6PTDA 1CXHA 1TMHA 3E0FA 4HYVA 4JCLA 4RV8A 4WKFA 5C6MA 3NSXA 4D8AA 2W54A 2FPTA 3G1XA 4X9SA 3NM3A 2BXVA 2ABBA 3ANUA 3HOJA 5I7GA 1AD1A 2NXIA 2OWWA 1P0NA 4MNJA 2E28A 4OIFA 3K8LA 4NY2A 1EPVA 2VL4A 4GACA 3ITLA 1MDLA 5LIUX 3VA8A 2WWCA 5PTDA 4Q7BA 2QUTA 4O0ZA 2BHYA 4N2YA 2VFEA 1KCZA 3TYAA 1DXLA 4MNKA 1JAKA 4KFNA 2HVOA 5E0KA 1JPMA 3EXSA 2CBUA 3U7VA 2INEA 2PUZA 4PN2A 1GERA 3W23A 1MNSA 3EPNA 3LXCA 1UR1A 4TVWA 3OGRA 2BDQA 1W3HA 3WG6A 4REQB 3QMSA 3DFNA 1IV8A 3SR6B 3RJXA 2OSWA 4GI8A 1E15A 4QDMA 3VGGA 5LNVA 4U5KA 7REQA 2OKTA 3IUHA 4ALDA 5HA7A 1H7NA 4D6DA 3UF9A 1KFEA 1Y7VA 4NNBA 4ROQA 1MXSA 4NIRA 4BQ2A 1BLIA 3NZ1A 3W3OA 2QCHA 1JRBA 4JNZA 1SW7A 5DELA 1LL4A 4HTBA 1F3WA 4LJ3A 2AL2B 1O68A 4AHQA 3A21A 3G8EA 3CH9A 4MOZA 4ZO8A 1YTKA 3U3HA 4PE8A 4JHMA 4PGLA 1TV4A 3TN4A 2E9MA 1GEUA 1UUMA 3VFLA 4JKLA 3A13A 3WQ5A 1Q45A 3NVVB 3S5OA 2AAAA 3PF3A 3W7MA 4G6CA 1H50A 2ZTKA 1W6TA 3GO2A 5K4ZA 4DAFA 3EWUA 3GQYA 4RV3A 4BZYA 5HOSA 4M6PA 4ZVJA 1ME8A 5AFDA 1H1YA 1JZ8A 2CZEA 1LBFA 2GVEA 3B03A 3BW3A 4I7UA 2IXUA 3DIPA 4FSAA 1RPXA 1GQKA 4ZOEA 3F03K 3FYPA 4HJWA 2ZXAA 1JGMA 1OFPA 3O05A 2QLYA 3APGA 4Q4OA 9RUBA 3TYDA 3VKJA 4I9TA 2WMJA 3CHVA 3ARXA 1GZGA 5KZMA 1U30A 1X1OA 5D9MA 1XGDA 3WH8A 4HK6A 3O9NA 4MY9A 4QX4A 1G4PA 3CM4A 4S2CA 4QNEA 4NXKA 1KFKA 5BCAA 2XN1A 3ITCA 5IBXA 5HATA 3JVAA 3DESA 4GNJA 1UWTA 3G77A 4ZSUA 1X39A 1Y0EA 3ELFA 4BJHA 1E1EA 3ZVHA 1V02E 3BOLA 2YBUA 4MAZA 3VIOA 1Z32X 1IT7A 1YIXA 1OQFA 3OHMB 1SFSA 4HNOA 4EMJA 1G9HA 4AVOA 3ZLHA 1CGWA 1QW7A 1T40A 1FWDC 1DNCA 1H61A 2DGAA 3RRAA 2ZZ5A 4BEQA 4GYJA 2QDGA 2GOUA 1B3OA 3AZTA 4C7FA 3RN6A 4U31A 3QR0A 3QOMA 3QY7A 3W7QA 3IV8A 3F5LA 3FHAA 3P2VA 1F07A 4H2HA 3F1QA 4JL2A 3NQ2A 3TEVA 1KTBA 1V6XA 3L0GA 3MHFA 3UT0A 2PURA 2XZ9A 4YWIA 1RLCL 1XRVA 3H24A 1P7TA 1JQXA 3B9EA 3QR3A 1VH7A 4YMZA 1TR1A 2JEQA 3WIJA 1V3KA 3THCA 1H11A 2DJXA 3EANA 4RXGA 1OBAA 4W5ZA 3GU9A 1MEWA 4WSJA 1XLJA 4O13A 1R47A 3ABXA 3HQPA 3OIXA 1I75A 2YYTA 5CLWA 1TYPA 4HZMA 1XLCA 2O9RA 2V30A 1BVNP 2P0OA 3DX5A 4ORMA 4M3PA 5JCIA 5I3GA 2PLMA 4Q8UA 1R7AA 4IJBA 1XI3A 4DUOA 3R0DA 4NX0A 3SSJA 1QNQA 1W3NA 4JICA 4L1WA 1J11A 5BXSA 5CG0A 3B0UX 3N6JA 3H2FA 2A3AA 4ZCWA 1R9YA 1BWVA 5D02A 5LIXX 4GQBA 3GHSA 1DP0A 2E6DA 3PTDA 3S6DA 4QHRA 2FTYA 5CPSA 3QMRA 4W9TA 1SPQA 1A0DA 2BVTA 3S2JA 3NCOA 1I0BA 4R9OA 1LRTA 4KGJA 1MWOA 1YE6A 4IIDA 1PBGA 3S5ZA 3EPMA 1X6LA 4I6VA 3EZ4A 4F66A 1UD5A 3EGJA 2YL9A 3R8GA 1ML1A 1E43A 2O4QA 4HA3A 3RX2A 4R7WA 4PH6A 2BGSA 1TA3B 2VEFA 3VNDA 3T05A 5CSYA 3IJDA 1HT6A 1IEQA 2PF0A 4YHGA 1EQPA 3REQA 3NPVA 3W24A 3EB3A 1OX4A 1RQEA 3E2QA 1EB3A 3A6OA 4PUWA 3TC3A 1HN1A 2Y8VA 4HNVA 4IMAA 1FH8A 2ZUWA 2DUZA 3BQ6A 4AISA 1W3KA 3EX2A 1F5ZA 4CGTA 1E4NA 4UTIA 1VEOA 3UWQA 1AL8A 4D8LA 3G1DA 1GVEA 2YBTA 4K38A 3VU2A 2QXWA 3OOQA 5TF0A 3SBFA 5IDZA 2J78A 3ONCA 3S1WA 1H0IA 4WK9A 2VM8A 1UHVA 3NVTA 3IJ8A 4L4OA 2C7FA 2J7CA 1JZ3A 2UY2A 2V81A 5D30A 3TYUA 4G7EA 3MI3A 4JTUA 1LQAA 1R5YA 1KM3A 2HJPA 2EPOA 4XVEA 3H70A 1R3RA 4BWLA 1DWJM 1KLYA 1UPMB 5D32A 4D1IA 2YDQA 2PWEA 1EF3A 3WDQA 4GD0A 4NZFA 1ZZMA 2QMJA 3UU0A 2Z2AA 4P61A 4RK8A 4ADSA 3QV8A 3OVQA 1A5BA 3LHYA 2XZ7A 1N5XA 2V3GA 3B9AA 2WM0A 3MUZ1 5FESA 3ZLFA 3WD2A 4OV9A 4H9VA 4BURA 1NF0A 1ZJBA 3VOCA 1KRMA 5D2WA 3HGJA 2OOFA 1XKJA 1PYMA 3F5JA 1AZ2A 3BLKA 4AWTA 4GRTA 2X8RA 1ZTVA 2YCLA 3UG5A 3GFYA 4B5SA 2GQ9A 1PZ3A 3K4WA 3PN8A 4LBRA 4IIEA 5FS8A 5G1MA 4ASTA 3G6MA 4FNUA 4H4QA 1FWEC 2PCQA 4JYEA 5J5RA 2PDJA 1SYTA 4PULA 1B0IA 3AHXA 1JDCA 1ZBCA 3J7HA 3R13A 3GRIA 3RLHA 2WOVA 3B3DA 1XIBA 5D38A 3RO6A 3TLQA 1G7UA 1UKQA 4KGLA 4H4PA 4BY3A 1OYBA 4PUDA 1HFBA 3SN1A 1JVNA 1E72M 4GBDA 3BLFA 4L9XA 3SAZA 2GJRA 2EPMX 1M1BA 4F79A 2B7OA 1BQCA 1EFZA 2J66A 4LS1A 3ABRA 1H63A 3M0YA 3O16A 4N9BA 1QK2A 4R34A 3EMZA 4UTKA 4DM2A 3LLFA 4RW3A 3P84A 4KETA 3DFYA 1RM6B 2YDRA 3VZZA 1IEWA 1UR2A 1W17A 1B90A 1M9HA 3PZVA 4J40A 4Q8OA 5C8BB 1SJBA 1UG6A 1U83A 5EMKA 4PMOA 1ECEA 2C1GA 4Q4QA 2PI6A 1JZ7A 3L5OA 4M1BA 3HU7A 3LGDA 1KD0A 4A8LA 2HS6A 4RDYA 3TTEA 2RGMA 4L7ZA 3A47A 3EBVA 5CG7A 1NQKA 2Y85A 1TELA 2W0UA 1LF1A 3OG2A 1V0MA 3MSGA 1VENA 3EX6A 3MVTA 4A2SA 2YIHA 3T9PA 4GO8A 4QRNA 3FXGA 3KRBA 3LERA 3C2OA 4E0CA 1BTMA 3DGRA 5AHNA 2YX0A 1X1ZA 4ZXLA 5JU6A 1ISYA 5CC7A 3N2TA 1LQ0A 1QOPA 3FSUA 3AN1A 1RALA 1EJ7L 2NW0A 3WH6A 3DAQA 2X09A 4FOUA 3W1AA 2W3ZA 4BK9A 1JCJA 5D9NA 1RJQA 1Z44A 4H7VA 3W7GA 4HHMA 3HO8A 1OT1A 2HWGA 3BVJA 5HNRA 4HKPA 1RK5A 3BGJA 3MUIA 5CJNA 5I03A 2FLIA 5K7JA 1F6PA 3TW7A 2PPGA 3H2CA 1F05A 1OFRA 1SJCA 2QUVA 4MJ4A 2H90A 1AJZA 3N2MA 4GUHA 2QDHA 5DQPA 1QPRA 3UPWA 5A6TC 2WZIA 4JIHA 1SO3A 3LHZA 2PP0A 1KCLA 3WBEA 4FALA 1VF8A 2FJKA 5GQBA 2PGFA 3STPA 4UTUA 3SECA 3R07C 3N19B 2QIIA 4C1NB 2ISDA 2WC4A 3BH4A 4HPGA 3WNOA 4LVAA 4UMBA 3UXDA 3WLPA 5HNNA 3LZ5A 5I02A 1E51A 3NDYA 5CEWA 3EDFA 3GTHA 3N9SA 2V3DA 3GKAA 1C7TA 3H8AA 1ZLPA 1FWGC 1N8FA 4EQRA 3L5LA 4WKHA 2QVHA 3M7SA 4F48A 1QJWA 2V5KA 3GZ3A 1E70M 2NV9A 1FY6A 5C0QA 3MWAA 1C8VA 4OBRA 1H6VA 4BF9A 3CASA 3EKLA 3N15A 3KDNA 4IFKA 4N7QA 3LGEA 4FX9A 2ASHA 3A7RA 1B9ZA 4AZCA 4HK5A 2F5ZA 1L6YA 1QAPA 1KA9F 3LHWA 1A5LC 3E2VA 5LGZA 3EXTA 1SFLA 3ZR4A 1E6QM 4QQUA 1E1FA 3G0XA 1ZJAA 2VRJA 4AZIA 5MHBA 3WH9A 3BOXA 4J2MA 3D47A 3QGKC 5HQEA 4W87A 3THAA 4OBSA 4N9DA 1BRLB 1E40A 1US0A 3WQWA 5LIWX 2EG7A 5C9ZA 4A8NA 4J7RA 4CCEA 1XKYA 1EDTA 1W1VA 3BL3A 4JIQA 4EVZA 3R2GA 1V8EA 3VKCA 2WVVB 2GYIA 2C91A 3VKKA 2FDMA 3PZNA 1FUYA 5CC3A 3IK4A 1MI3A 3KTXA 4IPIA 3A24A 5A2BA 3D3FA 1G7VA 1JPKA 4MHBA 4AC1X 2WHJA 4W4QA 1Q6LA 1BWLA 3CIVA 1YPFA 1L6WA 3L5MA 2EG6A 2PTZA 3L9CA 3GBEA 2D22A 1UR9A 3KXQA 1S5VA 1VFMA 4MLJA 5FCZA 2PP3A 5FJTA 3ZQ9A 2YKKA 3N04A 1QDSA 1C29A 2DVTA 4J57A 1O7AA 3SFWA 4NKCA 1Y65A 2XGIA 1LM1A 2VCCA 1ZP4A 5HANA 1A3WA 4OT7A 1ZY8A 3LCWA 5HUPA 2XFFA 1FBAA 3E2RA 1OX5A 4PMUA 3WLMA 1DWHM 5D8WA 2R1NA 3WEMA 4MTVA 1OFDA 2GSEA 1C8QA 5FD0A 4AYSA 4E4FA 2VOTA 3L67A 5G5IA 3F4NA 5A1AA 3RK8A 2WPEA 1P43A 4GFIA 2BLEA 1Q6EA 1UMLA 4U2ZA 4UNLA 2ICSA 2HDJA 1SU5A 2F61A 2INZA 3BC9A 1IXPA 1SQ7A 2NQZA 2GQ3A 1CCWB 2GGJA 4O1BA 1V51A 1EIXA 5G2WA 2C79A 1M3UA 4HOWA 1AD4A 4JXCA 3CTTA 1BVWA 1UR0A 3GRSA 4S3JA 2CEQA 4CN4A 1FP8A 1WZLA 1GGOA 3KL3A 3K46A 4JTSA 3AFBA 2QCEA 1MQPA 4Q7NA 2CZ5A 4QXIA 1ITUA 3LCFA 4FXSA 2OT1A 5LIYX 1OC6A 1U22A 1P0EA 4Y96A 3K13A 5HUOA 3SCWA 3G2GA 1Y5WA 1XRFA 3EEZA 4B3LA 1LLOA 4MNMA 1ZU8A 2FTWA 1IGSA 1HJUA 4IFOA 2QCDA 3BE7A 4DLFA 1V5XA 3GNNA 4EK7A 1C9WA 2NVAA 3E38A 1VZWA 3QR1A 1L6FA 3B9DA 2Z2UA 1E5JA 1L2QA 1S2CA 2NQLA 3UBPC 3EOUA 3LD5A 1E9LA 4LB3A 1BWKA 4AF0B 3E12A 4O57A 1GESA 1EDQA 3LBCA 4JYDA 1ISWA 3V1PA 1UCWA 4I5XA 1V97A 3LPOA 1ALDA 1NDAA 4BI6A 4HPXA 4JYFA 1KBLA 3TOYA 2IKHA 2OLAA 4GXPA 1KC7A 2J8GA 1OINA 4IMEA 4YJ5A 3PZIA 3OZMA 2GGHA 1XCFA 3ANVA 4Y9AA 2YCEA 3TVAA 1DV7A 4AYGA 3LCGA 1M41A 1LLWA 3I3EA 4N4QA 2ON3A 3IRSA 1V77A 1Q1RA 3PSWA 3GH5A 2YCJA 3CWNA 1SW3A 1F4AA 1EQCA 1JDAA 4AQLA 1HKMA 3GY1A 3KCJA 4XAPA 4TMCA 3CL7A 2OFJA 1AUSL 3WQ6A 3DJJA 3D9XA 4LBSA 2E77A 2FGBA 2FMOA 2R1MA 3AXIA 3OA5A 3M47A 5AHIA 3B0PA 5BU6A 3MMWA 5CZTA 4X2PA 3N2OA 3WNNA 1QWGA 3U57A 1EBGA 1B57A 5KVHA 2D2HA 2CLEA 3SN4A 1W1IE 3IJ9A 2WJDA 2YR1A 3L23A 3OHIA 1SUXA 1NWTA 1Z7AA 2W92A 3N14A 3LCHA 1N55A 2DUXA 4YN5A 2OQLA 3USBA 1W0MA 3MYPA 3CZJA 4E2VA 2FFCA 1JF6A 5EBAA 4LU0A 5F4WA 4LAUA 4H4XA 1FECA 3FG2P 2I5QA 4B9YA 3BGAA 4RZ4A 2WKJA 2UY5A 4YTSA 3S83A 3BMWA 4PFMA 4D1JA 3O3RA 3E02A 4QE1A 4EXQA 1GONA 1R0MA 1ZXIC 4UCGA 1IGWA 1D7FA 5AZ0A 3GW3A 4BS0A 3IK2A 3V75A 2F6XA 2EF9A 2J9YA 3DXIA 1KXTA 3BDKA 1HJVA 2DT1A 2IKIA 1LDCA 3AXHA 3PB2A 4HCDA 2FPVA 2ZX6A 3WF1A 1F3PA 1T7LA 1XYBA 2V8ZA 3CGDA 3G6LA 1ISZA 3GH4A 2DV0A 4MF4A 1C8XA 5I3FA 5U4NA 1DJQA 3RHGA 1TRDA 4L9YA 3N9RA 2WJZA 3OYXA 1W9PA 5LNRA 2FH6A 4UFHA 3MSRA 3VYLA 2VENA 4UTHA 1PB0A 1OY0A 1UOKA 1KRAC 3VDHA 3U5UA 4DF2A 3M0IA 5CXPA 5A6SA 1ZKQA 4ZMGA 3EX4A 3KLKA 3GLCA 4IMGA 5XINA 2O9OA 3NPUA 4H9TA 2X2YA 2QJIA 1Q6RA 4GO9A 2W62A 4MLRA 1SGJA 2VX6A 4WSKA 2OSYA 4IQEA 4I9AA 4P7OA 3GVGA 5AYZA 4QEEA 3JUGA 4DWSD 3V36A 3DN5A 2PC8A 1XLDA 2BOGX 1MW2A 3FKRA 3W7KA 2EKGA 3VDCA 4F2UA 2QV4A 3FOKA 1DEDA 1ZNNA 3QV6A 1B54A 3CGCA 1Q5MA 1TRIA 4BQ3A 4OWGA 4M8UA 5M03A 3SFKA 1XYMA 1VCFA 2WPGA 1H5VA 1VPQA 2P88A 4B5VA 3NA8A 3QPYA 2VFGA 1AW5A 2JGYA 4LVDA 3W83A 2GVGA 2XN2A 4QGCA 3VK5A 4HCHA 1XIFA 1AMKA 5TD4A 2HVMA 1JFXA 5KZEA 3STGA 4B15A 5JBDA 3C8NA 1PSCA 1V03A 1XDLA 4JN8A 3C0SA 1EJWC 3R12A 1W31A 2F7FA 4J3TA 1Z3NA 2D73A 1GPFA 5ABTA 1GKQA 3NPWA 2NSOA 2GK1A 2Q01A 1STZA 4LEFA 2B4GA 2GJNA 4A3HA 1P0BA 4ADTA 4NXSA 2CFYA 2XH7A 3MP4A 5IOBA 1N8WA 3EWZA 1E6RA 4TO8A 2I9EA 1M04A 5HWNA 3H2AA 2W79A 1JYVA 3UPMA 3WK0A 3RNMA 5BU9A 2X30A 5AVHA 3H53A 3TR2A 3VD3A 3WLHA 2WM1A 4CVWA 4O0KA 4DZHA 2YL6A 3QKEA 4B91A 2WMKA 1WKYA 1H0GA 3THDA 3AUOA 2BV9A 3U48A 1VQTA 3SQSA 3E49A 3U4FA 3RR1A 4O8RA 3UWEA 1MW0A 3CV6A 1EWEA 3TMQA 3L2MA 1AOGA 1V02A 3NQMA 5ABFA 4W5UA 3WEOA 3BK0A 3CEPA 1UJPA 1UH3A 3VE9A 4PUUA 1TE6A 4HNNA 1F8MA 3W1XA 1FWAC 4KEUA 3AYRA 5G1TA 3DFPA 1GK8A 3TROA 3PWAA 1JAEA 1J4EA 4IUOA 4IH3A 3FKKA 1X38A 1T96A 4Z2LA 4FP1A 5JIPA 2W55A 4DBDA 2FH8A 4DWSA 1E0WA 1A3HA 5HWMA 1ZB5A 1BYCA 4PTMA 4GVGA 5AYYA 1QO5A 3GE7A 4ATLA 4DJDD 1EJVC 4HNTA 1SR0A 4CD7A 2CERA 3D6NA 2QVNA 3MDUA 1WKDA 5BXPA 1LLZA 2A1YA 5EBKA 3G3MA 4NAEA 3PTMA 3TFCA 1H62A 1RUSA 3AHTA 1CXLA 1E55A 3EWDA 3BMXA 1RK6A 3LGGA 3NEVA 3SUSA 5A2AA 2V63A 4CD8A 1IQ8A 3ENLA 1RBLA 1XC6A 1BHGA 2XGZA 4HT3A 4WJ8A 5C71A 3OQ8A 4AIOA 3FJLA 2W67A 1WNOA 4I8DA 4EMIA 4WGHA 1K4HA 1L9WA 4JCMA 2CHOA 3QH2A 2BBFA 1U1HA 3EMQA 4ICNA 1V0LA 4DI9A 4AZBA 3SADA 4ZOAA 2ACSA 1QCWA 3RCMA 3CPGA 1LRNA 3HV9A 4J35A 1H49A 4OQVA 4CEUC 3UP8A 2DDXA 4C6NA 1C9DA 3LV5A 4U2YA 2O9PA 2GVYA 3HGSA 4I5UA 4MKSA 2YA1A 4YXGA 1UR8A 1JEHA 2CLIA 3UCCA 5G5GB 5CBJA 2BHZA 3W85A 3APTA 1W9UA 2D24A 3GNOA 4HD5A 2A3HA 3CMFA 4ATDA 4MFDA 1TTIA 1ONWA 3ZLGA 3P5ZA 1TTQA 2RJHA 3BWWA 2CDUA 4HPJA 4OGZA 1AQFA 3EX3A 2WB5A 3IJLA 2GR2A 1VHCA 5EFDA 1KCKA 4FLOA 2Y62A 3SY1A 2XUCA 5EPDA 4PYSA 2FB2A 3STCA 1D8CA 1JROA 3ABZA 1XM3A 5E0FA 4UTTA 4B9ZA 2H9AB 2ZC8A 3TA6A 3DECA 3GVVA 4FB7A 4H8UA 2J7BA 2PDPA 4O53A 3CNYA 7TIMA 2J8TA 1NF7A 2VX5A 3MKKA 1E9IA 1OK6A 1PX8A 1O5XA 3N13A 4GMEA 5BYWA 4JQ3A 3FA3A 1EEPA 4UFJA 4PCTA 4OHQA 4Y7EA 1GKRA 5GJPA 2Z27A 2A3CA 3DENA 4LY4A 3BG9A 3VIHA 3W0KA 3R6IA 3PNZA 4DAIA 4S1FA 3CUGA 5A8PA 4JTEA 4XIMA 4S3DA 1HL9A 4LXFA 3RF9A 3URQA 8TIMA 1R3WA 4O0QA 5ABGA 4FIQA 4L61A 2DSKA 1JCTA 3SW6A 2BTMA 3B9NA 4M7SA 3VGFA 4MY1A 5JCLA 2Y8UA 5G2IA 4NQ1A 1GJUA 2POZA 5CBBA 3TTQA 1I2QA 3O06A 4M0XA 3ARPA 1GOMA 3E0VA 3DC8A 1VIWA 2ACUA 3K8KA 3NYDA 3WQPA 1DL3A 3VC6A 1HGWA 2VURA 2E3ZA 4LUTB 3CAKA 4EXAA 1QTWA 3M1ZA 4NI3A 1XIDA 1FWIC 3DJGX 4S3GA 5C2CA 2AOSA 3QTGA 4MZYA 4M56A 1Q4WA 1LWJA 3SUVA 4LC8A 4GVIA 3AU6A 2Y8KA 1SO6A 4L65A 1HP4A 3WQDA 3SCQA 1JGIA 4BA0A 3S5YA 3P74A 2DVXA 4WDTA 4EAMA 3ITYA 3P82A 2GFTA 2HRWA 2X40A 1LROA 3U4AA 5ECUA 4R88A 1W37A 4NJKA 4WKAA 3IRDA 3ITVA 1T99A 2BOFX 5H6HA 2ISWA 1C90A 1SW0A 2OMAA 5A69A 5A6JA 2EPKX 3T8QA 1EO7A 5M3WA 4QSFA 2IKGA 1J5TA 1MXDA 1KWKA 2B7PA 3E0IA 2HBXA 4KCTA 3UY8A 3IAPA 1ODUA 3LSBA 3A3XA 4RJEA 4NASA 1V59A 1X7FA 3ALGA 3NOYA 4FK9A 3PM6A 4HQVA 3M0KA 3L0KA 2HISA 4ATWA 3FYOA 1KTNA 3U2EA 4DUVA 4REQA 3UWUA 3CAWA 3OB8A 2ANUA 3ZT7A 5CCZA 1YNQA 2IUZA 2J7GA 1SZRA 4OKDA 2Y4SA 1T3QC 2CLLA 3R89A 4QLKA 1EJTC 3I7QA 3L68A 4J2PA 3VDAA 1UP2A 5JUVA 4ZOCA 2AQWA 4FDCB 3BLIA 3NGFA 2A7NA 4PTXA 1OIMA 2AL2A 3AICA 1XDJA 2Z4GA 4GINA 1F73A 2BSLA 3O2LA 4Y8EA 3CUJA 3O6CA 4IGSA 2BC1A 3QHOA 5AB3A 3F4WA 4UUIA 1G69A 4L56A 4ZTYA 3FS2A 4M6QA 3SEPA 4AHOA 5JRBA 2OGYA 1FFUC 4MUZA 2GJLA 1KQYA 3KWSA 3CHFA 3B8TA 1CTNA 2A6LA 4YCPA 1REQB 4HBKA 1X98A 3EMCA 1T8QA 1W2PA 1EF2A 3W2KA 3I3BA 3STEA 5CBIA 4PBFA 2GDQA 5BMWA 4AMAA 3I6RA 1JZ6A 1VFUA 1J0IA 4O16A 3WENA 3ITGA 2JK6A 4DPQA 1WXJA 4BI5A 1PHWA 4K8DA 3BW2A 1XP3A 2VKZG 3E2SA 1SO4A 5D03A 1XYFA 4M19A 1UIPA 3B97A 3QFEA 4RPQA 4KWOA 3O1NA 2A0NA 1PWLA 3VNLA 2KX9A 3WF0A 1Q65A 1QW8A 4LPCA 2W0HA 4C6OA 3T6CA 3CUFA 1FH7A 3S9YA 1BGGA 2DIEA 4J3XA 1K9FA 1VYSX 1ZRQA 3LNPA 4I9JA 1AVAA 4O12A 3BV7A 3W84A 1TJ2A 4IP5A 5AYXA 1XWYA 1S3TC 2MUCA 3FCPA 1ELSA 4HVXA 1V3IA 1KFBA 1M03A 4UTWA 3MWCA 4XK2A 4PUEA 1R3YA 1R86A 4GNKB 1CYGA 1E6XM 2VD8A 1JDDA 4FNTA 2PEVA 4K8HA 4H83A 5HR7A 3RGTA 1XFBA 1QNRA 3O0FA 2BY2A 2ADAA 3GD6A 3L4VA 2Z6JA 4XAYA 1G94A 1W3TA 1UBPC 5A8NA 5DO8A 1WKFA 2YL8A 1YE4A 1E4LA 5FIPA 4R5EA 4DXXA 4Q8TA 2ZRWA 5C9WA 3CLWA 2EPNA 2WAGA 4IL2A 4GUIA 4Q7IA 4WSHA 3PY2A 2UY4A 3LG3A 4XTDA 1OD0A 4GIAA 6TAAA 1IXNA 2C14A 3L65A 5DT5A 5CSSA 2YZRA 3KTSA 3PVFA 1QOXA 2OX4A 2HVNA 4CD6A 1ADOA 1DQXA 1HUVA 2NLYA 4H01A 3FFSA 2RFGA 1GNXA 4UZUA 4F4RA 2PTXA 1M7PA 1OHLA 3W1PA 3VNJA 4YTRA 2ISSA 1UWRA 4S23A 3W7DA 5BW6A 7ENLA 1K3UA 4GYPA 1EBHA 4QNWA 1LL7A 2AKZA 1JL8A 1JULA 1S1RA 3ES7A 1VGAA 4LRSA 4NJJA 4W7UA 3HV8A 3GTFA 3ZSSA 2QIWA 4A8RA 3TC7A 4AH7A 5A8QA 3WUGA 3H2MA 4U10A 3WH7A 2VVNA 1EZ2A 1QNVA 1DJIA 3EKGA 3C0LA 3VGBA 1YADA 1FO4A 4GI4A 2Y5EA 2WSYA 1OG0A 1XH0A 4XIAA 3CEUA 2PDHA 3TNBA 4DNHA 1U1UA 2V0TA 5D37A 5CJ5A 4O11A 1OYCA 3B9OA 3TQ0A 2A3EA 1WDRA 5F4SA 3GDRA 1C91A 2QDEA 4CNTA 4B90A 3Q58A 1X1NA 1TA3A 4J4KA 4HN4A 3FDGA 2VXNA 4LTSA 5A6AA 3W6LA 1P1XA 1I2NA 3H7VA 1PKYA 2V6OA 3ICJA 4X3ZA 3IGUA 4WHBA 1E6PA 1D8WA 1FQ0A 4FLSA 4ICMA 3GC4A 4MDOA 3B40A 2BY0A 1XR2A 1QNOA 5HK4A 4FLQA 1X96A 1GYNA 1GEHA 2CKSA 1NOUA 2IPFA 3IACA 3LA4A 5KITA 1LL6A 2PWVA 3VM7A 3WL0A 3PANA 3PG6A 1FEAA 1V4YA 2EQ8A 1NHRA 3DG7A 4CVUA 4EF9A 2OEJA 1T8XA 5FL0A 2YAUA 4U3AA 3WQOA 1KFCA 1IWBA 5E5CA 3WJSA 1UP3A 1PV8A 4OUIA 2EG8A 3GKFA 1IXQA 3IUDA 2ZZ1A 3AMDA 3GXDA 2BASA 1VIZA 3R25A 1B1YA 2PRLA 5FF0A 4GCXA 4ML4A 1FWNA 1VD6A 4QS5A 1EDGA 1TWZA 2OQYA 1QI4A 2GVLA 5FJPA 4YWSA 4EE9A 1J5SA 4GZEA 1CBGA 4ZTXA 5FJOA 4AZ6A 1NAL1 3NL3A 1CNVA 3RCYA 1ZBKA 3VMPA 1TFVA 1NWUA 4HCLA 3W2LA 1G4SA 2X0SA 1J79A 2TMDA 3UJ2A 1GT8A 1OFBA 4QBXA 1PCKA 4LYRA 1I45A 1F3TA 4UNIA 4ADWA 4PR4A 2TSYA 4JPGA 4AX6A 4LV4A 2VOMA 3V0UA 5I07A 1A50A 4IX2A 2FGLA 1OC5A 4ACYA 3MPGA 3B4YA 1OEPA 5IBXC 1DJGA 1HNYA 1S5MA 1EGZA 3ZWSA 4XAFA 2PZ0A 5A8GA 1IR2A 3LX9A 2J27A 3VUSA 4EMWA 1E6SM 1QHPA 5FAJA 3R1ZA 4PMYA 4P7RA 3BAXA 1CIUA 2Y7GA 3FA4A 1H2JA 3CMJA 3PUEA 1ZCCA 4CQAA 2XIBA 4GE8A 4FR1A 3EDEA 3KWXA 1XIJA 3W9ZA 4BKNA 3BAKA 3R58A 1K8CA 1ADSA 4BF5A 4FXRA 1ZUAX 4E4PA 2P50A 2PODA 3GNRA 1BXBA 1KGWA 3E6EA 2RAGA 3Q94A 1NDWA 1TIWA 2YDAA 3PWIA 1ME7A 1JJKA 4GJ1A 2AAMA 2PDKA 3H6OA 3R5EA 4LAKA 1UWUA 2PD9A 3I6EA 1WE5A 3QW3A 1N61C 3MZNA 1WQ5A 3MMDA 1KW1A 5E0CA 3DK4A 1XCXA 4QG6A 1GOKA 1ZK7A 1JCNA 3LUTA 1IWAA 3VC5A 2OODA 1CXFA 3PZTA 4IG2B 1NQ6A 3W76A 5T9BG 1UUOA 1A4LA 1UH4A 1E5NA 5AKQA 2IPJA 1GETA 3ZT6A 4XG1A 3TTOA 1ITXA 3G1FA 4QE4A 2D3LA 5J04A 3YPIA 3L0NA 3EXRA 1S5WA 3NYZA 3KBVA 3OBEA 2VRQA 2BCPA 3RJYA 3GXPA 3AMKA 5DFAA 3BARA 1MZHA 4LNCA 2XFRA 1P6WA 1SR9A 5D05A 3WKZA 1I0DA 3LXAA 1DTNA 4MKVA 1L8NA 3W81A 3MW7A 1OFOA 2D69A 3UYCA 4RLIA 2DORA 4HU0A 2A2IA 2ZE0A 3QGAC 1DJNA 1S2AA 3AWOA 1FCUA 3FAXA 4O54A 5JH1A 4I6KA 1HXJA 1XW8A 2QF8A 3VE7A 3HQ1A 3FN9A 1AFSA 4UQ9A 4QR6A 3MA8A 4NU7A 4JFUA 1W1ZA 3B06A 3P61A 1V08A 5JQ9A 4BCEA 1VEMA 3OO2A 3EWWA 3HMJG 2PBOA 4NNCA 1VYPX 2G0WA 1TJ1A 2H6RA 4Z1CA 3W37A 4RE2A 2J7EA 1WAUA 2QCLA 2E68A 4PCNA 2DZWA 3UZXA 5IXEA 5DMMA 3IUIA 2UBPC 2J24A 3BW4A 3IS4A 3VKDA 4KW2A 2VC6A 1I1WA 3RPMA 3W38A 1JXJA 4C1NA 2ZX7A 5E9XA 2Q8LA 1UZ1A 3ECQA 4XSMA 5LZLA 1MUMA 2H8ZA 2ZWZA 3E1F1 3QZ6A 1HZYA 3U5YA 2C3CA 1YW1A 1LPFA 1PHQA 3CBWA 4GYKA 2BOEX 1HL2A 3KS6A 4JDYA 5EB8A 4IIHA 1Q6DA 4NF7A 1TCDA 3L12A 4X63A 4NYYA 1Q2SA 3A5VA 3K4DA 3M4HA 3WNMA 3ZOAA 4B3ZA 3OG3A 3U2OA 3CJPA 3LI1A 5T26A 3WQVA 4AFYA 2VEPA 4I7WA 4IIGA 3BAIA 3NVWB 5JMUA 1J01A 4XZ9A 2R9RA 3PZUA 1JCXA 1N8IA 4Y6GA 5I2UA 4K8EA 3KCOA 1LJYA 1J0HA 4RR4A 2AL1A 3PPHA 1MW1A 4P2VA 1ZMDA 3P67A 1R6WA 2GUYA 2WXDM 4XQ6A 3SGGA 4BWLC 1GWJA 1MEHA 1KBKA 2NX9A 3S5NA 2C1HA 4JDBA 5GNXA 4ZZ9A 2GL5A 3ERPA 4NJIA 2ZRZA 4URIA 2C19A 3SY8A 3EWBX 4CNOA 4UB9A 1GOWA 4FOJA 1V7YA 2E9LA 2I1OA 4EANA 4NZ5A 3AALA 2JEPA 2RKXA 3KLJA 2OZTA 3TV8A 1BRLA 3T08A 4PUNA 5LXXA 3M0HA 3G0SA 3LK6A 3M64A 5M17A 4C6PA 3AI0A 1R9ZA 5A5WA 1EGVA 4IHCA 3U6WA 2WVVA 3QV7A 4XD5A 3M0ZA 3AC0A 3M07A 4C6IA 3G18A 3L8KA 4L4LA 1XD0A 1UD4A 1J0ZA 3WUEA 3GAYA 2XTKA 3PTQA 2FQIA 1TB3A 4QJ4B 4FF7A 3B4UA 4XBJA 3C4UA 1B4EA 4Q32A 5C54A 3AMLA 5FOOA 3IIVA 2GJPA 3FVMA 5K9CA 3U7BA 2TYSA 2NXHA 4IL0A 1PL9A 2VFFA 1CI1A 3A4JA 4EWND 3LCIA 2WMIA 4JQ1A 1EO5A 1F74A 1KM6A 1NP2A 3LOTA 4JTKA 3UXKA 4AIUA 1GHRA 1J10A 1A5AA 5IHRA 1XCWA 1FWSA 4UOZA 2IS7A 3LV6A 1YXYA 3KOYA 2BVDA 3IANA 3APYA 3G24A 3NQ8A 1PDYA 3MJMA 2RDXA 4U4MA 3PJTA 4S3CA 5E93A 4X61A 2YW3A 1NTHA 3I7SA 1WDPA 4V1XA 4Z2HA 2G50A 3TONA 3P7YA 4KMQA 3K4AA 2X1IA 1M5WA 4ZQNA 1M6IA 3GR4A 5E1QA 3TQVA 1SMAA 1BAGA 1XIHA 1V3LA 1JI1A 2J62A 4U3CA 4L4PA 3GUWA 3R4IA 4GI6A 1GVOA 2UY3A 4H4IA 3HQNA 4GK8A 3AXKA 1V3HA 5JCKA 2E09A 3KZPA 5I6SA 3DH7A 4X60A 3EA2A 2X1SA 2P8BA 3Q4DA 4Z08A 1VCGA 3URBA 4X9YA 1BVZA 5CPQA 3WCZA 1GZJA 1UBSA 4Q8VA 1MEIA 4O52A 3WDHA 3DHDA 4AF0A 4L5ZA 1F8IA 4ZXOA 3GDMA 1GRAA 3TOPA 1DTUA 5CSRA 5MKGB 2OB3A 3PZOA 2J3NA 7XIMA 2R8WA 3DGZA 5BOEA 4TV6A 1VCVA 4RW5A 4NZ1A 1XXXA 2C18A 1S38A 3BLPX 4F40A 1GUVA 3N2XA 1DVJA 3IPWA 1JCYA 3L4ZA 1R46A 2XWEA 2GLKA 3V18A 4GVFA 1YBQB 1GORA 3A9IA 5H8UA 4AEOA 1MNZA 1G4EA 4ORIA 1TV3A 3BGGA 3NOEA 4JHZA 2IPWA 1PYFA 3W82A 2WSRA 3O6YX 1N2VA 1V6VA 3MSDA 2WOWA 2QCGA 3CGEA 4JQ9A 5D2TA 1JIBA 1TPEA 1BG9A 3WZ0E 1UH2A 4JX6A 2I14A 3UZJA 2X7VA 2MNRA 1GCYA 1GVYA 4FPSA 4PCSA 3E3HA 4ILSA 1TVPA 1JZ5A 2XH4A 4E2DA 4DF1A 3GDTA 1IF2A 3M0MA 3UWWA 4GIEA 3N6QA 1CDGA 2EPLX 2V3FA 3MB9A 3QFWA 1VBJA 4I8YA 1JD7A 2P10A 2QCFA 3F5KA 2SFPA 2X8CA 3CZGA 5HPCA 1QWKA 3VCRA 4RDWA 2ATMA 2C3DA 4CQ9A 4LEQA 4K7VA 2B31A 3FHQA 3L7RA 4K8GA 1LWHA 3ITTA 3VGHA 4C1LA 3CXBA 4D6GA 4OBTA 3GG7A 2YGYA 2YXGA 3HPXA 2J75A 7PTDA 4DO5A 4LVFA 3H7RA 5FEXA 4QM1A 1ISVA 2PFHA 4GA8A 2R1KA 3N2BA 1OCBA 3LTYA 4LAMA 2PAJA 3PZGA 3B9JB 2EAWA 3LPGA 3VOIA 4TX8A 2ZDRA 2WP6A 1CGVA 1XLGA 2I57A 4XZIA 2ISVA 3SSZA 1X2GA 4NRRA 5DF0A 4GCAA 3KBWA 2E8YA 3MUXA 4HGXA 3G1SA 1VS1A 4RNIA 2XSXA 1KWGA 1IEVA 4LA1A 2Z2BA 2F6KA 3C6CA 3RCNA 3GTIA 1HVXA 3GIYA 5LGXA 1WZMA 4C6JA 2VWSA 2BX7A 5C5YA 3MC5A 1SM9A 1CECA 1DIDA 4OVXA 4O4WA 4ZA0A 1NDYA 1EXBA 1JG9A 4CCDA 3K2GA 2WMFA 3NQFA 3F7JA 1F8WA 3CIWA 3BXWA 5JBFA 4ZOHB 2WZEA 3G1VA 2FB3A 2F9RA 2BODX 5I0DA 2ZOXA 3P80A 3UJRA 3P81A 3WDJA 1M53A 3UXIA 4FMVA 4BEUA 3CT2A 1L0PA 2XG9A 2JKPA 1P0KA 3WF2A 4FNQA 4RL3A 1YPIA 1WUFA 1W5NA 3FEQA 4O15A 3VOGA 3AIVA 1XQLA 2E1DA 3HA1A 4UFMA 3KRSA 3SJ3A 5DRCA 2C71A 4MWAB 4JQ4A 4UTJA 5CH9A 2Z24A 4ROPA 4GY0A 4UQDA 3CL6A 5K4XA 2ZUVA 4IT1A 4CU8A 4MB4A 2XIOA 1V0NA 4AU0A 3UY7A 2XHYA 2YDSA 2E6AA 2AMGA 3SRKA 4FS9A 2XVKA 2C0AA 4YLWA 3KRUA 4J9JA 1FIQB 3OGVA 5I79A 5H91A 1JDFA 2PD5A 3B8DA 2E5DA 1KBIA 4ZB2A 5C9UA 3UD6A 1PTDA 4S2BA 3NVZB 1HX0A 3WD0A 3SDOA 4MPQA 3DZ1A 2QJHA 1K8XA 5L9FA 1EIBA 2JK2A 4IWWA 4M24A 1XLAA 2OTDA 5FJRA 1OFEA 2DEPA 2ZE3A 1ZP3A 3LHVA 2DJLA 5BRPA 4ZEPA 2IQDA 2X50A 1UPPA 4KWWA 5A94A 4Z2GA 4PMXA 2J9ZA 1HGYA 4FOKA 4H8VA 3GIQA 3GM8A 3S2MA 3WLQA 4IPJA 2ZTJA 5EGRA 4DYKA 2E5AA 4QCFA 3DK8A 5B7YA 1N63C 2VEMA 3NL6A 4C60A 1EUAA 2EHHA 1FFQA 4DHGA 3CLMA 1K7FA 1YX1A 4DO4A 2QPSA 2WSPA 1SZNA 4JTHA 1EHAA 1AH4A 4IQJA 5HDRA 4XWUA 4AG0A 4X0NA 5D9PA 2FZNA 2V6AA 2VJXA 3F2BA 1TPVA 3W28A 3KL5A 3QC0A 3ITXA 1TYGA 3VPLA 1HG3A 1YDNA 3P0WA 3HZ3A 3FIGA 4R33A 3GVWA 4X0VA 1Z42A 1GRBA 3MI2A 5FL1A 2J47A 3BSHA 2D3NA 3AS2A 2UV8G 3WLLA 2QAFA 3IIZA 4JNYA 3LCXA 4B5WA 4K37A 1YRRA 1UYQA 3DBPA 2EQ9A 4M81A 1HKVA 5M1TA 6ENLA 1WZKA 4ZB0A 1DYSA 5T9CE 3BJSA 3TJXA 1U5HA 4OTKA 4GQRA 2W27A 3RMEA 3K1GA 1CGXA 1ZGDA 4XZNX 4P8UA 1UUQA 3T2PA 3PPGA 5LNUA 5ABEA 4QAWA 3AZRA 3JZEA 1B3WA 2VX4A 4G1KA 1XISA 4TVDA 3W6MA 3POHA 2DP3A 3HPFA 1FA2A 1WBJA 4C6DA 5HWJA 4DM1A 3KUMA 1HTIA 4IISA 3VX1A 1RVKA 1I2RA 2NUXA 2O7QA 2GUUA 3UETA 3QYQA 4FR6A 4AIEA 5K9DA 4L80A 3EUB3 1HL8A 1UD2A 3KHDA 1A4MA 4EM3A 4IGNA 4RDZA 5C2XA 3PBWA 5K2ZA 2VFHA 4V2XA 3BV4A 3MMTA 2YFOA 1TZZA 4H4ZA 2WWDA 2JKAA 2VYOA 2WPBA 1UD8A 4H8NA 1XJBA 4HHHA 3AYVA 3BG3A 4HPHA 2H8XA 3V5OA 3T4CA 3LADA 4H9YA 2Y1HA 1YTDA 2GWNA 1HO4A 4TIMA 4GH3A 3ZWTA 3W4RA 1MQRA 4A22A 4CEXC 1F3XA 3UA3A 2NXGA 4AHPA 3H22A 2VR2A 1NJJA 2A6NA 4XKMA 2CBJA 3UXLA 2P5NA 1FOBA 1KXVA 3QFAA 3PG9A 3ZIZA 3QQ1A 2GR1A 3DC0A 2D2JA 3GXMA 4UOQA 2E0PA 1K9EA 2HQMA 9XIAA 4JTDA 1J9YA 5D2VA 8XIMA 1XFCA 4IIBA 1TV8A 2PDLA 5CJMA 4H9ZA 4HHPA 3UZZA 1B30A 2J7HA 4JIEA 4UTFA 3V7PA 2NV2A 4IJCA 2BNJA 1JD9A 3KW3A 1BYBA 1XG4A 1W9VA 1XHGA 2I16A 1LUCA 1AJ2A 1H3GA 1ICPA 2J74A 4LC6A 6A3HA 3NQ7A 3ISIX 1KNWA 2PDFA 3ZVIA 4A3QA 3EA1A 4BHYA 3W22A 2YVFA 1S2UA 4DB7A 3NQCA 1K6AA 4D8ZA 5D04C 3GG0A 4OJYA 1SMDA 2G3FA 1H7OA 4PTVA 4QLLA 5BWFA 1ZJHA 4EX4A 4DBWA 2CZDA 2A4AA 3N3TA 1J0JA 1GYLA 4M5PA 5ECVA 2LLEA 4V15A 3TWAA 3ABSA 3N3MA 2H9AA 1RR2A 2R6OA 4C6MA 5CC5A 4C1KA 2ZXBA 3UZWA 4O17A 3SGZA 2DSWA 2IMRA 4NUWA 3WLSA 4O10A 1E6NA 3VCNA 4ZQOA 3CWOX 1LG1A 3O07A 4IICA 3URNA 5FMHA 4YYCA 4HTYA 4U5IA 2CETA 5CAHA 3NR0A 4RNJA 1CGYA 4DIAA 1N82A 4TV5A 1ZSXA 3ABQA 2GSHA 1NARA 2QMKA 2WHLA 5GNZA 2Y2WA 4GPNA 4UQCA 4JN6A 1QU4A 3W29A 3P0XA 1R3TA 2CITA 2HXTA 4IF2A 3T2OA 1G0CA 1SB3B 4XTIA 3VNYA 4IJRA 1JI2A 4Q6XA 1JF5A 3N25A 5LA1A 1J12A 4PODA 3K30A 3MP3A 3OODA 3DI1A 3NO3A 2WOQA 3VXGA 2VEKA 2ACQA 1CWYA 1R30A 2R82A 1P0DA 3UGVA 1E3XA 1JFHA 1XYAA 1LQ2A 3AMCA 2ZC1A 4PUJA 5A6BD 3OTRA 2ATSA 3SJNA 1RZMA 2DZBA 3W71A 4GZ7A 3AAMA 2AQVA 1H7PA 4HHLA 2PSNA 3QHMA 2XM1A 1PCWA 5KEZA 3GD3A 4KPLA 4WLCA 3C2RA 3FW6A 2AAQA 1ONFA 1EZWA 1A5NC 2WLZA 4KWSA 3TYCA 7ODCA 3HPZA 2CYGA 4MB3A 4GIRA 3XISA 1FXPA 2RH9A 1M7JA 2YXOA 3LM3A 4XBSA 3I10A 3ARZA 3HJZA 1PX4A 4PL2A 1LYXA 5ABHA 1XLEA 3KX6A 1SFJA 5I06A 1TUXA 2FYMA 3W86A 3TN3A 3DOPA 3WF3A 1ISXA 2QGYA 3H2NA 3LRKA 4Z1AA 1DIKA 4GC4A 1YXCA 3S1UA 1XDIA 1TPC1 4MWAE 3GDLA 3CAVA 2PCEA 1XIIA 1TTJA 1GOXA 3RU8X 4QJ1A 2GRTA 3A23A 2CXEA 4IPPA 1Z8AA 3KOFA 4A05A 2C6QA 4H4RA 3AS3A 4LW7A 3AOFA 3RPDA 3TR9A 3EPOA 5CAKA 3TFXA 1KQZA 3WQEA 1VB9A 3HPSA 4D9PA 4C6FA 2E1WA 2CLFA 4LCRA 3E0WA 2YPIA 3ZR6A 5J8LA 4XZHA 4H6EA 1QPNA 4F2BA 4LUIA 4JR5A 1TX0A 2XVPA 4EPBC 2CZFA 4DWSC 1T5AA 3VABA 3ZFHA 1TE1A 4PMZA 2ZUNA 4JKKA 2Y88A 2YXXA 1GG1A 1CGUA 4IPNB 5BZAA 2WSQA 3PFMA 1FWTA 1TMLA 4TVCA 1GOOA 3S4TA 1GHSA 4N4PA 3I4EA 5BOOA 2DQWA 3CAQA 4ZBCA 3WBAA 4GX9A 2F8QA 1UR3M 3EWXA 1DJWA 4HSHA 3OVPA 2VGGA 1EGMA 5DXXA 3ATYA 2ZIDA 3LPFA 4WF7A 4LUYA 1WDQA 2PE4A 2DW7A 2PDBA 3AROA 2WZHA 4J3UA 3KS5A 3IIXA 1GOQA 3CO8A 1BKHA 3F4VA 4LX4A 3RR4A 5B7ZA 1EBDA 2E6YA 3F4CA 1W3IA 4TOQA 1HKWA 5BXRA 3P3BA 1EJXC 1XGEA 3V35A 3W1RA 1REQA 3RM4A 3S2LA 3WMLA 4F2TA 2BZNA 3IGSA 2X05A 4YHEA 3GR8A 3KTCA 4KKXA 1FHLA 4RXFA 3WQFA 3IEBA 3VD4A 4DQWA 1EA0A 4L9ZA 4XSLA 2O92A 2RHGA 2PRHA 3OLGA 1TKKA 3AJ7A 1A5UA 3LI0A 5HPOA 4HP5A 2DZSA 1X8FA 4DBUA 3OEXA 1HW6A 4MG4A 2YW4A 4PRRA 3DHPA 1TPB1 2Y5JA 3CPRA 4H7ZA 2Z29A 4KQNA 1I6NA 4UTTC 5DMNA 4V27A 5F1VA 1IR1A 1YLVA 4BI7A 1KV8A 2CZVA 4AD0A 3NSMA 4FAMA 4C90A 5C9XA 3LN3A 3LEPA 4O14A 4JGDA 1N60C 3TYBA 4PMVA 4GLEA 4HMNA 1UA7A 3C8FA 1VJIA 2O9TA 1EOMA 1W5MA 5IDIA 3W2JA 5JVLA 1XBYA 4HSOA 1TWSA 2HPIA 3VIMA 2E3TA 3AIWA 3T0CA 2ZZ4A 4DY1A 5HNUA 4NZJA 2OSXA 2VEGA 3LLXA 2D2OA 4NX5A 3M0XA 3GC2A 4GQ0A 4HPNA 1NU5A 4R85A 1C7SA 3DGBA 4O1EA 3S2CA 2WNNA 4OOZA 4CNUA 3OPSA 2W63A 3QF0A 3PJXA 1IZKA 3AZSA 1E0VA 2PDNA 2WNWA 4NJGA 2V3BA 2E8ZA 4UOJA 3Q37A 1EP1A 4Q8WA 1CXIA 3FGCB 4UR8A 3SCVA 3GRTA 1M7OA 5CKSA 5E6YA 1UWQA 3GVQA 1ZENA 3V5FA 3S2NA 3WLTA 1TVLA 4EKJA 4AWUA 1AQMA 3AMGA 2ZA1A 4UR7A 4P7QA 5KZ6A 1FVPA 4WEVX 3HQOA 4OU1A 2ZKMX 1M7XA 1S2WA 2HNHA 1EJRC 1XX1A 2XIJA 4PEKA 3HJEA 4Y9OA 5I78A 2PTWA 2YQUA 3A7UA 3O6DA 2QHAA 2FKPA 3HBLA 1RH9A 3G1HA 3UWYA 3T0AA 2JALA 1KLZA 2Z25A 3CGBA 4GR1A 1I1XA 1OGGA 2ACRA 3VZYA 4DJED 4O50A 3SCTA 3V1HA 4MJZA 1DXEA 1FWCC 1XL9A 5C9RA 3B0XA 5KZDA 1UROA 4EF8A 1XRSA 2ZRXA 5KMYA 4XD4A 2OWCA 1D3GA 3MMUA 1H7XA 1PX3A 2GQWA 8CGTA 1XQKA 3DFSA 1LRQA 3EWYA 1LT8A 1NWRA 2V69A 4FEZA 1CLVA 1TV2A 1Q63A 3N1AA 4WZHA 3ZYZA 2CFFA 1ZBVA 4XZLX 1IYXA 3HG3A 3PSVA 5CGMA 4Z0JA 2DZTA 4MAVA 3CZKA 5CPMA 4W86A 1HJSA 3L66A 1BXNA 2R1PA 3GWQA 4DUXA 2QUMA 4OUEA 2DT2A 4Q6JA 4US5D 3URAA 4APNA 4EIVA 4HYRA 1GQJA 3HG5A 1YDOA 3GFXA 1XH2A 4EXBA 2XVNA 1CLXA 5DLCA 2XWDA 1GEQA 3L4UA 1OC7A 1IEIA 1DE5A 2NPXA 3IV3A 2WNZA 1K9TA 3VAVA 8RUCA 3W7PA 2IQTA 3EDJA 1IIHA 4O18A 1PXGA 2CLKA 1OD8A 2VFDA 1I2OA