3I6TA

Crystal structure of muconate cycloisomerase from jannaschia sp.
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
367
structure length
356
Chain Sequence
DQSQIIAGFTLWHLSLPVTGAVEVVVLRLQADSGAVGYGEASPWVVFTGSVEATYAALDRYLRPLVLGRAVGDHAAIMEDARAAVAHCTEAKAALDTALYDLRARIAGVPVWALLGGRCRDRIPLSCSIADPDFDKDLALMQRLQDDDVRIIKLKTGFKDHAFDMMRLERLRADFPAFDIRVDYNQGLHHDVALARVRDVATFKPTFIEQPVKAHLRGLMARIRDAVDVPLLADESIFGPEDMAEHPEIADGVSIKIMKSGGLTRAQTVARMAAARGLSAYGGDMFEAGLAHLAGAHMIAATPEITLGCEFYQATYFLCDDILAAPFPVADGHVLVPDTPGLGVDVDEDALARFAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Muconate cycloisomerase
publication title Crystal structure of muconate cycloisomerase from Jannaschia sp.
rcsb
source organism Jannaschia sp.
molecule tags Isomerase
total genus 130
structure length 356
sequence length 367
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3i6tA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3i6tA01
2HNEA 3JZUA 4ENLA 1TKKA 3D46A 2XGZA 4GIRA 4E5TA 3KUMA 4G8TA 4A6GA 4E6MA 3HPFA 3I6TA 1MUCA 1BKHA 2AL1A 3DERA 4IP5A 3FCPA 3P93A 3MQTA 3QLDA 2OVLA 3SSZA 2FKPA 3DFHA 4DX3A 1ECQA 5J04A 1JDFA 2XH4A 3OTRA 3RITA 1ONEA 1PDZA 3TJIA 1OEPA 1EC7A 3FXGA 2OQYA 4F4RA 4GGBA 3MKCA 3PFRA 3SN0A 4KWSA 4HCLA 3OPSA 4DYEA 2QQ6A 2PGEA 3VCNA 3R25A 1FHUA 2GDQA 4Z17A 3K1GA 1JPDX 4Z1YA 3QPEA 2DW6A 2P0IA 1RVKA 5FJOA 4MMWA 4K8GA 2PMQA 3T6CA 1DTNA 3I6EA 3VFCA 2PU1A 3MUCA 4ZA0A 5ENLA 3IJLA 4E4UA 1BQGA 3T8QA 2OZ3A 3Q4DA 4H83A 3V4BA 4HYRA 4HN8A 2GGIA 2DW7A 3H70A 3R10A 3UGVA 3UJRA 1FHVA 3DEQA 2HXUA 1W6TA 3FJ4A 1SJDA 2QVHA 3ZVHB 1EC9A 1R0MA 2AKZA 1KD0A 1XS2A 2I5QA 4KT2A 3GY1A 3V3WA 3H7VA 2AL2B 1TZZA 4IZGA 2ONEA 2PPGA 5FJUA 3UJFA 3TW9A 3CB3A 3T4WA 3V5FA 2PCEA 3D47A 2PS2A 6ENLA 3DG6A 4H19A 2HZGA 2OZ8A 3U4FA 3EKGA 2QDDA 3RGTA 3THUA 2PA6A 1WUEA 2RDXA 3SJNA 2P8BA 2OQHA 2PTZA 3DG3A 3V5CA 7ENLA 3QKEA 3ES8A 2QJMA 2PGWA 1KKRA 1P48A 3DGBA 2POZA 2QJNA 4H1ZA 1EBGA 3QTPA 3TWAA 5IDZA 3GO2A 3OZYA 3PWIA 4FI4A 3EEZA 1MDLA 3FYYA 3OP2A 3CXOA 1EC8A 1F9CA 3I4KA 1MDRA 3VC6A 4IP4A 4HNCA 2PTXA 2OFJA 2OO6A 3TWBA 3IK4A 3T9PA 1JPMA 1KCZA 2QGYA 3SBFA 1WUFA 2PTWA 3MWCA 2P88A 3S47A 4M6UA 3S5SA 4FP1A 2P3ZA 4JHMA 3NO1A 3OZMA 3GD6A 3DESA 3N4FA 5EU9A 1PDYA 3NFUA 4MGGA 2QJJA 3QN3A 3R0KA 3UJSA 3TQPA 4E4FA 3ENLA 4HPNA 4YWSA 3IJQA 4HCDA 3UXLA 4GYPA 3DIPA 3H12A 2HXTA 3DFYA 4KPLA 2XH7A 4IT1A 3UJEA 2OKTA 2O56A 3MSYA 3R1ZA 4JN8A 3SN1A 2OLAA 3PWGA 2AKMA 3ES7A 3IJIA 3ZLGA 3TCSA 3BOXA 4K2SA 3PK7A 4MKSA 2QDEA 1NU5A 1SJBA 3SN4A 1SJCA 3DDMA 5BOFA 3OW1A 5FJTA 2MUCA 1SJAA 3FV9A 2GGGA 2CHRA 3UJ2A 3N4EA 2PTYA 3N6JA 3ZLFA 3N6HA 4GFIA 3ZLHA 1R6WA 1TE6A 2PODA 3CYJA 2GGEA 3P0WA 3VA8A 4GYPC 2OG9A 3NXLA 3RRAA 3B97A 4H2HA 3JW7A 3Q45A 3ZVHA 4J1OA 3TJ4A 3TOYA 1IYXA 5BOEA 2GGJA 4GISA 3RR1A 1XPYA 2AL2A 3VC5A 2PP1A 2MNRA 4IL0A 2OZTA 4J3ZA 1P43A 4JN7A 3R11A 2GGHA 2P8CA 3ZVIA 2GL5A 1EBHA 3STPA 4ZCWA 4M0XA 4EWJA 1E9IA 4GGHA 3TTEA 2ZADA 1JCTA 4DHGA 3RCYA 4X2PA 1NELA 2PU0A 3MY9A 4E8GA 3H8AA 4IL2A 3UCDA 3UXKA 3SQSA 1MRAA 4G7FA 3MZNA 4HCHA 3JVAA 3CAWA 2XH2A 4A35A 3RO6A 1MNSA 4DXKA 2XH0A 4GMEA 2ZC8A 2PP0A 3CK5A 3BJSA 2NQLA 2XSXA 4ROPA 4IHCA 3R0UA 3UCCA 2OPJA 2GSHA 3U9IA 3GC2A 2OX4A 2PSNA 1L8PA 3P3BA 3CT2A 3VDGA 4DWDA 2PP3A 3NZGA 2FYMA 1YEYA 4A3RA 4KEMA 3BSMA 3FVDA 4DN1A 4HNLA 3DG7A 1KKOA 5FJRA 5FJPA 4K1WA 3VCCA 1ELSA
chains in the Genus database with same CATH superfamily
1V6YA 1CECA 4ENLA 1AZ1A 3IGXA 3RX2A 3GAYA 4R7OA 4JS3A 1B3WA 4CVUA 4BCEA 4JTQA 3E38A 2QCGA 1FIQB 3RLUA 2WPGA 1ONWA 5AY7A 3CV2A 3TN4A 4HZMA 3BGAA 1N5WC 2E6AA 4IP5A 1E0UA 4LX4A 5EBUA 3VMOA 4MG4A 3LCXA 4GY1A 1AJ0A 1FWJC 4BWLA 1WDDA 2G3IA 5DQPA 3B9NA 3DHPA 3M5ZA 3EUB3 1C93A 4KMQA 2WW5A 1T6MA 2FMOA 1KTCA 4M29A 4YU1A 3RJXA 4H8HA 1V6UA 5DRCA 1RBAA 2YPIA 4ZQOA 4GK8A 3R07C 1U33A 5CGTA 3KCLA 5T9CE 4QISA 4NKCA 1OEPA 3HQPA 4JIEA 2YXXA 1JRBA 4LW7A 5HQMA 1J9YA 3VD7A 4DM2A 1UB3A 2W91A 3GNDA 2HEJA 1M03A 3H22A 1UQZA 3NM3A 3W83A 2TODA 4DI9A 3QSRA 5DELA 4Q8UA 5E70A 4HYVA 4GZ7A 1XYCA 3QY6A 5AC7A 5C71A 4LUTA 1N8FA 2BHUA 4HPGA 3DZ1A 3OEXA 2F61A 1OK6A 3MA8A 4JTIA 5E9XA 4EKJA 2DZXA 3M47A 3RM9A 3KRUA 2H9AA 4ZA0A 4C1LA 1RH9A 2EQ6A 3DH7A 1BQGA 1WYIA 3QQ0A 2NQ5A 3D3AA 3SCVA 4PUJA 5CPOA 5HATA 2GVJA 1KBKA 2FLIA 4C5YA 1Y8BA 1VFUA 5JBEA 2DIKA 4OVXA 1S7MA 2CKRA 4GH1A 4MDOA 3D0CA 3LTSA 3QJAA 3ZVHB 2QXWA 1G7VA 4U2YA 4UOQA 1ZZMA 2CHNA 1C8YA 4KW2A 1RA5A 1TZZA 2G41A 1ZK7A 5CSYA 3LRMA 4QSFA 2ONEA 1K8ZA 1LRNA 3UETA 2PGFA 4AVNA 2VC6A 1PE1A 3T0CA 2AQOA 4FS9A 1EYWA 1S1RA 1GYMA 1WAWA 2NLYA 1J8VA 1E1CB 4M51A 3THCA 1E72M 4JQ2A 1W54A 1L0PA 4YXGA 3C0LA 1KFCA 1OZMA 1DV7A 3AHYA 1HKVA 4BR1A 3BZGA 1TV3A 2HVMA 4C91A 1MXDA 1JZ2A 1VYPX 3QRHA 1KFKA 5F4SA 4AY7A 4AQLA 3BW2A 3S2LA 1DVJA 1H7WA 4JTSA 2Z24A 1H41A 4L6HA 1XINA 1SZGA 2PUZA 4ACYA 5FL0A 1I0DA 1UMLA 2O9RA 3K2GA 1MW2A 4LVBA 1UIPA 4K37A 4FF7A 2Q3RA 4FF5A 5U4NA 4MJ2A 1TIWA 3CAQA 3NR0A 1MDRA 2MANA 3T09A 1SW7A 3GX9A 4LNCA 1JPMA 3CGBA 4IPLA 5A95A 2BP1A 4GI9A 4HA1A 4AEFA 3IGUA 2DVUA 2OSWA 4RZ5A 2VEPA 2EGZA 1UP0A 4BF7A 3N4FA 2JE8A 1JYVA 3DFSA 1PDYA 3LB0A 4CNNA 4R27A 1Z32X 1CLXA 5LGXA 3IIXA 4B3ZA 4JY8A 4MB5A 3V7PA 1RZMA 1QATA 3CV7A 2HJPA 1S2CA 1HVXA 3IJQA 1BKSA 3T0BA 3DXIA 4DJFC 3CMGA 1X2GA 1A3XA 2C18A 2GFTA 1LORA 3UA3A 1V7YA 2ZVIA 4H2CA 1VCVA 4O1FA 1RK5A 2HS6A 3AC0A 4JPGA 1XDMA 3O1NA 2YGYA 2VX5A 3PK7A 3KZSA 1EJWC 5I24A 3LZ5A 3OODA 2ZZCA 4ORMA 3GDKA 3OW1A 3CHVA 1TMQA 5FIPA 1J18A 1YHTA 1GHSA 3HA1A 5GNXA 4N9BA 1EDGA 2PTYA 3MCMA 3ZWSA 5C9RA 1I2PA 3CQ0A 3ZLHA 1O68A 4LCRA 9CGTA 2WSRA 1KBJA 4Z2LA 1R6WA 4W4QA 3TYBA 4WHBA 3G6MA 1M7PA 1B31A 2A7RA 3S2JA 3ZVHA 3AXKA 1XV8A 4WDXA 4H8VA 2EEXA 1BVWA 2ABAA 2J13A 5FESA 4PMQA 3SUUA 4C6IA 1A5MC 6REQA 3HFYA 1S2VA 3SURA 4XO7A 2DT3A 4JQ9A 3KZPA 1RQEA 1TJ2A 3MUAA 4HKPA 2D2HA 1WKDA 1LDCA 2DUZA 3BLLA 1E1CA 4D6CA 1WBHA 1QDSA 4XTDA 3PS7A 1QJWA 1TV8A 7TAAA 5LNUA 4FNUA 3R0DA 3VGGA 2C1HA 3LRLA 4H4PA 2WM0A 4ATLA 1RCOB 1L8NA 1OGSA 1ZQ5A 2RDUA 2OSYA 1X6LA 3SO7A 5CBBA 4HCHA 4DWSA 3NO3A 3CO8A 4RL3A 1AFSA 2ZX7A 1EEPA 2VD9A 4LVFA 1KCLA 5C6MA 1BXBA 1J79A 4HSNA 1GOKA 2GQ8A 5L6UA 3WDRA 3AI0A 3FKKA 1MO0A 1VJIA 3SUWA 3C0SA 3GC2A 3MP3A 2NVCA 1CI1A 2X0YA 2A5HA 1V08A 1IT7A 3RHGA 2FYMA 5AOUA 3SUVA 3AHTA 3FVDA 7ODCA 1NAL1 1SO6A 3B4UA 4C6QA 2J7DA 3WNNA 4GA8A 4N6EA 2BXVA 4YMZA 2VRJA 1R85A 1EPXA 2GR2A 4LYKA 2NXGA 3W1QA 2RGMA 4INFA 4A8NA 4W8LA 1TKKA 3M41A 3FN9A 3GW0A 3VKKA 2DGAA 3W24A 3LQGA 2GWGA 1QHPA 4H41A 3P14A 2W5FA 3U2ZA 1NQKA 1J4EA 4DWSD 4EM4A 3LMYA 1DTUA 5HPCA 1JZ5A 4PCPA 2AL1A 1O5QA 5MKGA 3AYRA 2W3RA 2YBVA 1T7LA 5K4ZA 1US2A 4WRHA 3SQLA 3EF6A 1G6CA 4E8DA 4IQDA 1E9ZB 3ARQA 4ZQMA 3AIRA 5C5YA 3WQOA 4JHOA 3WH5A 4YYCA 5BRBA 1B54A 5C7HA 4B92A 3RITA 6CGTA 4MUPA 4LB4A 3URAA 3GTFA 1PDZA 2JKPA 3OA3A 2J77A 3IAPA 3NAVA 3P60A 4NG3A 4WX2A 2Z1KA 3T55A 3FXGA 3QR3A 1K7FA 2OQYA 3PFRA 3V35A 4GBUA 3RAOA 1OC6A 4KWSA 2J47A 4D2JA 4Z17A 3SB0A 3KVLA 2RJGA 3RN6A 3U2EA 1JCXA 1US3A 4Q7NA 2VOTA 3L65A 4AU0A 1A47A 4H04A 4QLKA 1YPIA 3F4DA 4ZEPA 5E0FA 4UR9A 4QLJA 4ALDA 3A7UA 2CBJA 1XLKA 3PN8A 2XDFA 1KTNA 4RLIA 1HKKA 3TN3A 4X0VA 2OOFA 3IJLA 1W1YA 4IMDA 4ZTXA 3LHWA 2HVNA 3WDQA 4QNWA 4H83A 1DXEA 2V3GA 2GQ9A 1V0LA 2XZ9A 2IKJA 1AZ2A 1WZAA 4HGXA 3VU2A 3AHVA 4M6VA 3E0WA 1ZAJA 1FDYA 4UB9A 2GH5A 3ANVA 3UXIA 3L2IA 4UNLA 5EMJA 3I7SA 1Z42A 5DLCA 3T0DA 2YCEA 1US0A 5BXTA 2P0OA 1GTHA 4AXNA 1E4IA 2G96A 3WQCA 1PX8A 4LH8A 4UR8A 3UWZA 1PB0A 1MWOA 4WVXA 6ENLA 2TPRA 2CKSA 5G4WA 1JIBA 3MDUA 3N1AA 4M1BA 5DN1A 1TV7A 4GYKA 4LUSB 1W2PA 3GVVA 3HGJA 4Q4QA 5IBXC 3T8LA 3G0XA 4XTIA 3MO4A 3LPFA 3NGJA 1HJXA 3V0UA 1S2UA 1BF2A 4HOWA 4TVDA 5I03A 3GNPA 4JEQA 1F3EA 3LCLA 3TC6A 5XINA 1TG7A 4YTUA 4EAMA 1VEOA 3NO5A 5BXRA 2DZTA 3EEGA 4QG6A 3SR7A 3AICA 4PMOA 5BMWA 3USBA 3GYCA 3NGFA 4NZ3A 2ALDA 3DFQA 1V6XA 4YCPA 3QGVA 2W92A 2R8WA 2WMHA 4HHHA 2H3DA 3TJXA 1F9CA 1GW1A 4FNSA 2NX1A 4JTAA 3VC6A 4Y2WA 4XX6A 5ABHA 3TOPA 1ZS2A 1E0VA 3DI0A 1S39A 3TW7A 4J27A 2VQTA 3H23A 3P81A 4GXMA 5G1MA 1EQCA 2B7NA 1NH6A 1BG9A 3SGUA 4FXFA 4D9PA 4H7VA 4GO9A 3WDPP 1TIMA 5JIWA 1XC6A 4LB3A 5CSSA 1IEVA 5EGRA 3CEPA 4HPNA 4J3TA 3MZ2A 2I57A 4O1EA 4AX6A 3B8VA 3RIKA 3BMXA 3VZZA 1JYWA 1ADOA 4I6KA 2OKTA 4I7UA 3R1ZA 4UQDA 3CBWA 1W9PA 2SFPA 2OLAA 3TNBA 5T8GA 2DSZA 4PMDA 3MYPA 4DF2A 4ML9A 3QFBA 1EO7A 3HBLA 1XXXA 4EPDC 3ARVA 3NPWA 4BY3A 3RNDA 3HGRA 1WDSA 3S9IA 3CQJA 3L23A 1QI5A 4DPQA 2QVNA 3TAKA 4RV8A 5H8PA 4C7DA 2VR2A 4AHPA 2XG9A 2ACSA 5AYBA 4ZE4A 3HO8A 3NVDA 1O60A 2RKXA 1UH3A 1OINA 2OZTA 4L4MA 4AWTA 2QEZA 1PTDA 1RCQA 3ZVIA 3K30A 4LUSA 4E3VA 2J6XA 3STPA 4ASTA 3BQ6A 2KAUC 4S3FA 1JCNA 1T3QC 1OVDA 3GDRA 6ALDA 1SGJA 9XIMA 1I6NA 2DSUA 1J5TA 2PAJA 3CO4A 2QGHA 2WWDA 2WCAA 4V27A 2VVSA 4KRUA 4QG9A 5IM51 3WY1A 4E38A 3C2RA 3C2OA 3MZNA 3JVAA 2XH2A 4GY0A 4H7CA 2V5KA 3T42A 3HM7A 3TIMA 4I9MA 4UMCA 5E6ZA 1YDNA 2PP0A 1DQWA 3GM8A 5LNSA 3GH7A 3NURA 4QLLA 3UCCA 2PURA 1Q8JA 3SADA 3E0FA 3WNMA 3P82A 4CNTA 3N19B 3O3RA 5KETA 2PE4A 1E15A 1JF5A 4Z2KA 1QRQA 5A3HA 3GDTA 4XVEA 1VJSA 3PSVA 2FFCA 1OHLA 4KEMA 1L6YA 4HNLA 3VIKA 4PMJA 2A4AA 4UTLA 4BF9A 3LM3A 1E6XM 4P61A 3G5EA 2A3EA 1OFPA 2XN0A 4AZGA 5G4HC 2IPWA 3H54A 1QPOA 1IR1A 2CDUA 1A53A 1RP9A 2GJNA 4GBDA 2POTA 3QOMA 1GQLA 2DEPA 3VNLA 3U0HA 1MEHA 3VIGA 1NDWA 3R94A 4MADA 1GCYA 1WOBA 3VOHA 1Z6KA 4DLFA 1V0MA 3XIMA 2W79A 3M0LA 3SCOA 3IACA 2WC4A 3CUZA 1LG1A 3W7GA 3GS6A 5CBJA 5K3VA 2VCBA 5F7UA 4FLQA 2ZRUA 1UZ4A 3WD3A 4DAFA 3UXDA 3CPGA 5A8MA 1B57A 4IIHA 4L4LA 5J5RA 4WDWA 4AEOA 2HQAA 3WO8A 2XH4A 5JIPA 4Q8PA 1YYAA 4P7QA 4XKYA 3WUBA 3S5OA 5LA0A 3APGA 1G4EA 4M8UA 5A8PA 4Q8NA 2IKIA 4MLJA 4JTUA 4N0RA 1R7OA 4QBXA 1OCNA 3U7BA 1M6JA 4GG9A 1TSIA 1V6WA 2YYUA 3TW6A 3GIYA 5CC5A 4MY8A 1JROA 1YXYA 3G1RA 3C52A 3LA4A 1M9HA 3W7IA 1UBSA 1LP6A 2ICSA 1OC7A 2WVVB 4XAGA 4C6OA 2JQXA 4GX9A 3W7DA 3WLOA 1OIMA 5AECA 1QW8A 2R1LA 3NQGA 4GUJA 5CSUA 3ZSTA 3MP5A 3EX6A 5ENLA 1JOAA 1IZCA 1YIXA 2FVLA 3VGEA 2IPFA 2RGLA 3LSBA 2WQDA 1V3LA 2C14A 1GQIA 4D6EA 3DFTA 2PF0A 2YL6A 2VFFA 1UMYA 1W6TA 2PWVA 4QTGA 3GH4A 3EB3A 3WD0A 3N3TA 5AYYA 4UTHA 1BRLA 3VD3A 3D9XA 1AQ0A 3H7VA 3D5HA 4Z1CA 3AYTA 4IZGA 3GXPA 5LNWA 3TA9A 2DH3A 4H19A 1KQZA 2OZ8A 3TQVA 2D69A 1UG6A 3PFMA 1TWZA 3CGEA 3RGTA 2PA6A 4UFIA 2WJZA 2P8BA 3W7QA 1SO3A 4LC8A 4ZQNA 3HQ1A 3FSTA 4JTJA 2B4GA 4F0HA 1VD6A 5A6JA 1CXEA 4Y9OA 1KM1A 3WYZA 4GVIA 3UG8A 3GH5A 1JDDA 2QPUA 1LL4A 3T4CA 3BCJA 3B8IA 3ZMRA 1L2UA 1L6GA 2FHCA 4HK7A 3F2CA 1G4SA 2TSYA 1WA3A 1G5AA 1YQ2A 3EDKA 4I90A 4FMVA 2CXEA 1VP5A 2VZUA 2QUNA 4WJEA 1MW3A 5FI8A 4GC3A 1GSNA 3RG6A 4O10A 1TPB1 5A6BA 1TYPA 1FEAA 5F4WA 1UKTA 1ZUAX 2GR1A 3LK6A 1EJ7L 3WDIA 2DPEA 2PTXA 3AMZA 3H2CA 1DE5A 4BFAA 1R2TA 1XDIA 1EPVA 2V3BA 4MWAB 4QCFA 3ZT5A 1NTHA 2P88A 1H63A 1PAMA 2QKFA 1H51A 4QJ3B 3AN1A 1IXPA 3KBMA 1R3YA 4XD3A 1N61C 4K8HA 2P1FA 3NL2A 3KRSA 2C8NA 2ZKMX 2UV8G 3VIOA 1HO1A 1EP2A 1P1MA 3K4AA 4KS0A 3LXAA 3TN6A 4RR4A 3SIMA 1U30A 4DJDD 1ZMDA 1TREA 1Z8AA 3QGKC 2D2GA 3WEZA 3PBYA 3KL0A 4YHEA 4FZIA 2WVVA 5H91A 2BODX 1CX9A 2X40A 5DCDA 3LUTA 4HJWA 5I79A 4CVWA 1SW3A 1QW9A 1N8IA 5A6BD 3TCSA 5ABEA 1NU5A 3SN4A 3OBKA 3CUGA 1KGUA 3NPUA 4EXQA 3A4WA 3JU2A 4X61A 4MWAE 4RCXA 1LQ0A 3O07A 2OCZA 3OU8A 1TFVA 3MHGA 3IV8A 2PDCA 2CLPA 2O55A 1V3MA 2Y8UA 3E2SA 2VFHA 4CU6A 1G0CA 4PTVA 3QV9A 3B97A 2C1GA 1UWUA 3NOEA 4WCJA 4EPKA 2GGJA 1S5NA 1XIHA 1NPXA 1XPYA 3S83A 5I0DA 1I45A 1K9EA 3B06A 5I3JA 1IZKA 2BVWA 1EOKA 5HMDA 2P8CA 3MTWA 3CM4A 3THAA 2WPFA 1WXZA 4O1AA 4LFYA 3ARTA 3F5JA 1UPPA 4MZ8A 3GBDA 1BFNA 1JCTA 1P0DA 3AZTA 3QXBA 4Q8TA 1DWGM 5M03A 1LWJA 4J3SA 1JEHA 1XIFA 4K6AA 4ZL1A 2HWGA 4F0RA 3G1SA 4WGHA 1MNSA 5ABGA 4OHQA 3BLIA 1WOAA 3GXMA 3DOPA 1MEWA 3NDOA 5H2ZA 1CW2A 3SM0A 3CGTA 1UOKA 3U5YA 1GONA 2R1KA 1ISZA 1OD0A 1XIEA 4JTRA 3VKBA 4XQ6A 3QR0A 4XZLX 3SDOA 4FEZA 3CZKA 3QPYA 2I5IA 1TPEA 2PSNA 1UWRA 3V1PA 1H3GA 1CB2A 4O19A 1ZJIA 2OJPA 2P50A 3LZ3A 5GJNA 2WPEA 1F5ZA 1PHQA 4E2BA 3C3UA 2BOGX 3SRFA 1X1NA 2OLHA 3RPTA 2CZ5A 4XBJA 2WKGA 3QGAC 4JAWA 3B9OA 4QS6A 5HOSA 3I10A 5AZ1A 1GVSA 2Z1VA 5CJMA 3DYMA 5CZKA 1YLVA 3AS1A 4NU7A 3VNMA 1ZBVA 4H6EA 1VYSX 3B04A 1SW0A 3G0SA 4M24A 4LSBA 3HMCA 3WLPA 4KRZA 3ONBA 5CEWA 2ZRZA 2C13A 4PTXA 1GOOA 4PGLA 2J88A 2CLKA 3IVSA 2WMKA 3F5KA 2DUXA 3URBA 3WBXA 2A3CA 4F0KA 4ZZ9A 4OQVA 3D3FA 4Q4MA 5AYZA 3FYOA 1XIDA 2G95A 4NZCA 1JDFA 1XGDA 3HW2A 4IIDA 4XAYA 3LI1A 5IOBA 1CGWA 4L80A 2D20A 2H90A 1U1JA 3NQ6A 3KDOA 1Y0EA 2BVDA 4GGBA 2AAAA 3BAJA 3MKCA 4YNGA 3WBEA 1X2HA 2BY2A 3S1WA 2Z1SA 2XWDA 3KBSA 5AKQA 2WQPA 2CBVA 2NQHA 4H6KA 5F1UA 1NOFA 4CD7A 2Z2BA 2D3LA 4KQNA 4PH6A 1DWFM 1L9WA 4UQBA 4H9VA 3ITXA 4K8GA 3HV9A 5D2TA 1OQFA 1JRPA 3HTWA 3AM9A 1O66A 4OOUA 3E96A 3U7VA 3BZJA 4PFMA 4FPSA 5BZAA 1GW9A 1J0JA 3CAVA 1TVLA 4JFUA 3FA5A 4PEKA 2Q8LA 2XIJA 2CZFA 3IJ7A 2X30A 4GLEA 2QJIA 3NWRA 1XW8A 1E4MM 1EWDA 2QR6A 3MJMA 5A8NA 2ZBTA 1OY0A 3FJ4A 3W7LA 3ARXA 5K9DA 3GVGA 2QW5A 1W5NA 3NZQA 1GNXA 4KT2A 5H1WA 3S6DA 2HPIA 3BK0A 4LS0A 2OEJA 3WNLA 3AXMA 2CLEA 3ARRA 3T4WA 3V5FA 1YQZA 3GHTA 1GG0A 3GLCA 3NXFA 4K68A 2G97A 2BBFA 1LG2A 4NJJA 4ZOBA 3EX4A 4Q4SA 1ISXA 3VIMA 1J0ZA 4PUMA 4UTFA 5JMUA 4AWSA 1XICA 1NP0A 2ALRA 3RNMA 3UPBA 1F3WA 1G4PA 3UY7A 1BLIA 2QUVA 1CIUA 1XP3A 1NWSA 3GO2A 3G3DA 2A6LA 3GAKA 3OZYA 3EANA 5CPMA 4J3XA 4AFYA 1KM5A 1PL9A 3W87A 1XLBA 3O8AA 1EF3A 3GTIA 4DJFA 3H4XA 1PTGA 3KBWA 3M0VA 1F8MA 3T2QA 3CXOA 2GYIA 5C7VA 3DC0A 3VOFA 4IPJA 4WOQA 3WF1A 5LIKX 1SSDA 3GFXA 4H01A 1PBGA 5HMSA 5JUVA 4M3PA 1HKWA 3GUWA 1W3LA 3LHZA 5D32A 3UWWA 4EMWA 3ZXWA 2DQWA 4XB3A 1X98A 2H8XA 4HTBA 3S6TA 3PPHA 2IPGA 2P53A 4FXJA 4O1DA 3P0XA 2EF9A 5AZ0A 1GJWA 2ZDSA 1FWGC 1JFHA 2E9BA 1L6FA 1CCWB 2VZVA 3ALFA 3ARUA 3DYOA 4XZNX 1RBOB 3KOZA 2C16A 1MMFA 1SVDA 1W0MA 4KERA 3LERA 3L4UA 3C3NA 5HA7A 3TR9A 4DBDA 5TQLA 3DKJA 1A0EA 4NP7A 3BOLA 1XLFA 4J40A 4DJFD 4EM3A 3TSMA 5K7JA 1E51A 3LBOA 4NJIA 3HG5A 1IEQA 1EWEA 5JRBA 1M01A 3NQ8A 4M1RA 4BJHA 1H1NA 1ZY9A 5CXPA 4GACA 1PZ3A 2UZ9A 1IGWA 4DIAA 4O0KA 3TYCA 2J9YA 2ATSA 2CLFA 1J2BA 2C15A 1D7KA 5BMXA 1Q85A 4MF4A 1B9BA 3ZLFA 3KL5A 3W6MA 4O14A 1JCLA 4YIWA 1AH4A 3EWZA 5CZJA 4FSAA 4S3JA 1R3SA 4A3YA 5LHFA 4H9TA 2F7FA 4PL1A 4A4AA 4CQCA 4QQ3A 2YBUA 3QOKA 1H09A 5AYIA 3S42A 3WUFA 4YTTA 2FGLA 1PWMA 2QMKA 2VO5A 2ZXDA 4XD4A 2AAQA 4W85A 3BJFA 2WKJA 3UG3A 3UFYA 1RUSA 1NHRA 3WJSA 1DL3A 2XTKA 3C2FA 4AYSA 4M0XA 3GHSA 1G94A 4AZ5A 2R9ZA 4N7QA 1GREA 3FYPA 1JPKA 3PR2A 1MZHA 4QFUA 2Y1HA 4IGSA 4LS2A 1G4TA 3M0YA 4X2PA 1MXGA 3IAQA 3RYSA 3MY9A 4E8GA 3THDA 1M65A 4JDYA 3KVJA 2Z6IA 3P84A 4IX2A 1M68A 5D37A 3DGHA 3HMJG 2YL9A 3NM1A 1H50A 2R6OA 1W31A 4IQEA 1AUSL 4L1WA 1LRTA 2YW3A 1F3PA 2HCVA 5GNYA 1N63C 1K8CA 4C6DA 4HOZA 3N13A 2PRHA 4JZ5A 1K8YA 3I7QA 1DWJM 2X2GA 3QHMA 1QVBA 1KKOA 4IJCA 3USZA 5C9ZA 4C6CA 5FJPA 1GJUA 5KZMA 3HQOA 3P62A 3U57A 1AJ2A 3GU9A 3W7PA 2PWDA 3F5LA 2V5CA 2G4FA 4WEVX 1HJUA 1TE1A 1O1HA 5EMMA 4XUGA 5AHNA 2C71A 4ZQPA 3FGCB 3MSGA 2QCNA 4GIRA 7TIMA 3CXBA 3M0IA 1OYCA 1R3VA 5DT5A 2G3NA 3F03K 1G7UA 4EE9A 5C2CA 1KXVA 1KM2A 1LT8A 4KF1A 3W02A 1TRIA 1UUQA 2FKPA 4FB7A 2GK1A 2QIWA 3DFHA 4RXFA 4W9TA 4GPNA 1T8XA 3EKZA 3W7CA 3CIVA 1JF6A 3AHZA 3VM7A 3HRDC 1UD2A 5D2YA 3T2PA 3VVGA 5EPDA 4I5UA 2ZRVA 1N5XA 3WQWA 3SCSA 2I56A 1Z3NA 1KRCC 1EIXA 4ZODA 1DJIA 3U5UA 1UKSA 3C86A 3M5XA 3WQ8A 5FF0A 1HT6A 1TTJA 3ZT7A 2YCJA 3E0IA 2QQ6A 5FAGA 4K38A 3EDDA 4NSBA 3RPMA 4GINA 4HA0A 2CXGA 1W2VA 4DXVA 1JPDX 4OU1A 1H2JA 4OE7A 5C2XA 4M80A 5FJOA 4JTGA 3V0TA 2YVJA 1EDQA 3B0VC 4CQ8A 4GY7A 4CD4A 4PBGA 3S3GA 3S9ZA 1B4KA 3LHUA 2QAEA 3NG3A 1YPFA 5IBXA 3WNOA 4NJKA 2J7EA 3KOYA 1P6CA 4J3WA 3N3MA 3W73A 1SSGA 2WBAA 3S1XA 4CUCA 3UWUA 3N29A 1TV2A 3ITOA 3BXWA 3R10A 4TUFA 1UA7A 2QV5A 5LNRA 2NV9A 3URNA 4M52A 4H9MA 3GU2A 2XIBA 4HPHA 3EB2A 1DXIA 4N2YA 4ICMA 1YMYA 3UZZA 2QPXA 2ZWYA 3P74A 5U1OA 2VC7A 1H5YA 3GG0A 4HJFA 1EJXC 1QT1A 4LBSA 1TA3B 3CJPA 1ML1A 3TYZA 3HZ3A 5I5RA 3VZXA 2HVOA 2BOEX 4NYUA 2QCLA 2VX4A 3E49A 2VUYA 2Y88A 3F1QA 4OJYA 3DG3A 1H1ZA 6A3HA 1UZDA 5JH1A 5JCIA 3GUGA 3LPGA 4DPPA 1GZGA 4Z1AA 5C9UA 2G0WA 3ITYA 1Z44A 3KWXA 1CB7B 3G1DA 3E1F1 1OG0A 3A9IA 2QF7A 2W27A 4J5NA 3S2NA 1DJZA 4DBWA 4ZOHB 1B0IA 5FSEC 2QAFA 4BQ4A 1DWAM 1UD3A 2V5LA 3R2GA 1QNOA 4Q4PA 5EMYA 4IH3A 3TC7A 3QW3A 2IS7A 3PPFA 4LV4A 1OG6A 1GJPA 4C6BA 1WX0A 3O6DA 3UR5A 4ZQCA 4WJ8A 4GCAA 4JDBA 1A0CA 2WC7A 3BWWA 3W38A 1PIGA 1KR1A 2ASHA 1P7TA 3LTPA 2VFDA 2BMBA 3LDVA 3NDZA 2ZUVA 3OZMA 1J12A 1FXPA 2PZNA 5DO8A 1KLYA 3S46A 4CNPA 3K46A 4GZEA 2CYGA 4AZCB 4EWND 3QN3A 3UJSA 4EACA 3W72A 4QCEA 4E4FA 4A05A 1NSJA 4LEQA 4I9AA 3BTNA 2PWFA 1UR8A 2JF7A 4DNAA 3AMGA 5KSWA 2BVTA 4EANA 2EPOA 2RDWA 3GTNA 5C9WA 2Q71A 2WJDA 3SN1A 1ZHAA 3B9AA 3C56A 2VGIA 3VZYA 3BGGA 1XBVA 5IDIA 1F73A 3QF0A 2FFIA 1XD1A 1RXOB 1RQHA 3IPWA 1J6PA 2YA1A 3LPOA 2ZZ5A 2I5GA 1RY0A 2VEIA 4DBEA 4Z2IA 1FBAA 2YDRA 3C2YA 4BQ2A 5HNUA 4RW3A 4Q33A 4GUIA 2Y24A 3OC4A 1LWIA 2GJXB 2PBOA 3GG1A 4PMXA 2PEVA 1JNDA 3W2KA 3WJWA 1XLDA 3ZJKA 4NRRA 5EFDA 4IGMA 1KFBA 1A4MA 1K4QA 1LUCB 2F8QA 2OG9A 1LF1A 1L2QA 4LUIA 2G5WA 4MKVA 5E93A 4QJ4B 3VCRA 1PWLA 2G4JA 1KM3A 3WDHA 2VKZG 1W3HA 4Q8WA 4DM1A 2R1PA 1V77A 1R9ZA 4LCQA 3AMDA 5I3FA 1PIFA 4ACZA 3W1TA 5CQ1A 1U5JA 4KFOA 3RILA 3T7VA 3N14A 4IUGA 4LNYA 4XUYA 5F4XA 4ZCWA 1T40A 1W1B1 3MUY1 2ADAA 1E9IA 3CQKA 4KESA 4H4WA 1QPRA 3RCYA 5C2GA 3MANA 1N62C 1SQ7A 1PO9A 4E2DA 4IL2A 4I8YA 5D4YA 2HE5A 1CGVA 1CXKA 4OGZA 2ZE3A 2BY1A 1DBTA 2BY3A 4AVFA 5F2MA 1A49A 2OXNA 3UQNA 3JRKA 1ZX9A 1XH1A 3R58A 4NQ1A 1E40A 3MKVA 3BPWA 3WLJA 4IHCA 3LS9A 2Y89A 4WDTA 7A3HA 2GJRA 4Z2JA 3HPSA 3U3HA 4CN4A 4XVDA 1YKWA 5DFAA 2WZEA 1ONFA 3VDGA 4KKXA 1G9HA 2NVKX 5B80A 4JYEA 3H2OA 3DG7A 1NVMA 3W85A 4JY9A 1KFLA 1T96A 3PTDA 3VGBA 1DJWA 4REQB 1ICQA 1IXNA 3ZJ6A 3WD2A 2JALA 1MRQA 3TQKA 3BLFA 1KR0A 3LV6A 4WSHA 2XVGA 4J9JA 3GC4A 4RDWA 2JIEA 1EP3A 4JTFA 4FNTA 4DF0A 1W9UA 2YDQA 3GVRA 4IOTA 3KLKA 3DC8A 2NQ9A 2PLJA 3BURA 3FCPA 2EPLX 3P93A 1W17A 4RK8A 2BZNA 1AQMA 4IIGA 4P5UA 3ITCA 3PPGA 3TONA 1ZCCA 3II1A 3EOUA 2E3TA 3EKLA 4LUYA 1ZNNA 1GERA 2INEA 1XCXA 3U2OA 1FWEC 1ZDLA 3OBEA 2AMXA 2GJXA 1RD6A 2QT3A 2CERA 3H4GA 5C70A 1M41A 4U2ZA 1BAGA 4W8BA 1TMLA 3K4DA 1W1PA 1V4YA 1GZJA 1LUCA 2FGZA 4RE0A 4M19A 2Z25A 3R25A 4GRTA 1KFWA 1LBLA 2VD8A 1QNRA 4GNJA 1CXFA 2X41A 1TCDA 4KCUA 4QDWA 2DQXA 1OX4B 3LLDA 4QJ1A 3MW7A 3SFKA 2GUYA 2PMQA 3UVAA 3PANA 3NUKA 4IJBA 3O6YX 5JBFA 1J0IA 1XL9A 4GIYA 4M5PA 3GBEA 1UR9A 1XG4A 3T8QA 4H50A 3WQ4A 3EWBX 2OZ3A 2X8CA 4JL1A 4H9ZA 1RR2A 1PEZA 4D8AA 1KW1A 1MW0A 1V8EA 4AEEA 4C5ZA 3G18A 3DK4A 2AAMA 3NL3A 3N12A 2E5CA 4BI7A 4LVGA 4O52A 1AMKA 4XK2A 3UT0A 2GSEA 3SZ8A 2CBUA 1PTAA 4JR5A 2FZNA 1CXIA 4J57A 3VKCA 3GYEA 4TMCA 3GKFA 5TF0A 1UUOA 3WFZA 3HPAA 3A4JA 1XLGA 3H53A 3VTRA 2WNQA 3L66A 3MV11 2E3ZA 2YB1A 2C19A 2HMCA 3DG6A 4FNRA 3SFWA 3C6CA 3L7RA 2FMNA 2WVTA 1KFEA 3EX3A 3TLLA 5LA1A 4AIEA 3UWYA 1BTCA 3E02A 4JICA 2EG6A 2Z00A 3NPXA 3RR4A 2VGBA 4GOAA 3LNPA 2EQ8A 5G2HA 3E12A 4RE4A 1WZKA 3M9YA 2RABA 5CJNA 4XIMA 4D72A 4AY8A 1JZ4A 1ZP3A 5CAHA 1FP9A 5CGMA 1XG3A 1UKOA 1UP2A 3UZ5A 2CEQA 3AXHA 2RH9A 1OM0A 3VX1A 2ZWZA 4HSHA 3OP2A 1GZ1A 1LPFA 3I4KA 3EDFA 4IFOA 1N82A 5F1VA 3NCOA 1E0XA 3IK4A 1HKJA 4IFKA 5DY2A 2V3FA 4ZO6A 3QVQA 3WLRA 1EGZA 4V2XA 2IXUA 9XIAA 1YTKA 4M6UA 2QIIA 1U2YA 3TSDA 4EVZA 5ABTA 1EA9C 4B9ZA 3NO1A 3DESA 2PZ0A 1UH2A 3QHNA 2OT1A 4RNJA 1FWDC 3AUOA 4RPPA 4S3CA 3LMZA 2XFFA 1FQ0A 4OBTA 3S4TA 5REQB 2OLSA 2YXGA 3DIPA 3G1FA 3R89A 3QH2A 1EB3A 2E4TA 4APNA 1O5RA 5C0QA 4ZE5A 3S0CA 5A6MA 3UG5A 1V3HA 2CIPA 2REQA 3R8RA 4G7EB 4MKSA 3VD5A 3A5FA 1GXFA 3WMCA 4AIBA 1TJ1A 1SJCA 1QBAA 2AGTA 3MV01 5D04C 3PB2A 2J66A 1HG3A 1KM0A 1NFBA 5EFFA 4QEEA 1XR2A 1GTEA 1VQTA 5FKYA 4PR4A 5BNKA 1QHZA 1RALA 2ZDRA 4ZQRA 2Y7FA 4PRTA 2E28A 3G1AA 2A1YA 4GYPC 1C92A 2DZVA 3OOQA 2UY3A 4FOUA 3Q45A 3MMDA 3TOYA 1VBHA 4OIFA 2FQIA 3N4AA 1FP8A 2BY0A 2NT1A 2ZRXA 3NNTA 1PV8A 1DEDA 3UESA 1DJHA 3AISA 5AHMA 1GQNA 4DZ5A 2BGQA 1SR0A 1JZ7A 3G1VA 1QOPA 3G8EA 3LG3A 3OVQA 1S2AA 1TCMA 1R2RA 1A80A 4JTCA 2FJUB 1PCKA 1B90A 3BW4A 4O8AA 5AVHA 3EMZA 3QV6A 4WD0A 1E6RA 1S5WA 4FX8A 1LOSA 1CDGA 4LF2A 3C0QA 1NM9A 1NHQA 4KWUA 1E6SM 3QMRA 4S39A 2ABBA 4A8LA 4J56A 3GTXA 4OBRA 4AD5A 2IQ0A 4GKTA 1FX6A 1MOKA 3OIXA 3PJTA 1KM6A 4EPEC 2FJKA 1GEUA 1GRFA 4V28A 3QFAA 1U83A 3O16A 3T44A 1DXFA 1PYMA 4IG2B 2GRTA 5HWMA 1Q7MA 4E2OA 4AUBA 4Q4RA 1DHKA 3RK8A 1P6WA 2VGFA 3NVYB 5KTLA 5FJRA 3O06A 1ISYA 4RX0A 4AX7A 2D2JA 3KP1A 1JI2A 3AMCA 1ELSA 3ZR6A 4MUZA 3TUUA 3TAOA 1OIFA 3REQB 1QWKA 3BG3A 4GKLA 5REQA 1LLOA 2NT0A 3IGHX 1V51A 3PAOA 2BV9A 2AQVA 1CPUA 1TX2A 2WOIA 2V5JA 2YL5A 3WJYA 4OWGA 4JXCA 3PZGA 1EJRC 1UUMA 1CGXA 4MPQA 2PTDA 3INPA 2DZSA 4Q8MA 2XIMA 4GNVA 4FNPA 6PTDA 3WK1A 4F79A 2V82A 3ZIZA 3LCWA 4FA3A 4IFRA 5ECUA 1TYTA 5FJIA 2WKLA 4A22A 5CG7A 2GVEA 3R7MA 3E9AA 1QOQA 3M0JA 3JZEA 1WZLA 4U10A 2OYLA 5FEZA 3FXYA 1SMAA 4HBKA 4ZR8A 4H8UA 3MU7A 2BGSA 3SN0A 2YX0A 1NEYA 5KINA 3VCNA 3WKZA 3GNRA 2W66A 3T0AA 5I00A 2YR1A 3BLOA 2ZRWA 2BLEA 3CYVA 3VKAA 4AZIA 2QHAA 2ISFA 2WSQA 3R8GA 2WSKA 4XZWA 1FWNA 2QCEA 4PUDA 3S1UA 1IHIA 5DF0A 2OWWA 4UUIA 1VIWA 4S3DA 3KW3A 5HNNA 1P5BA 3VFCA 3NQVA 3R12A 4O1BA 2ZTJA 3VFLA 5I3IA 3GD3A 3TU9A 3W1LA 4LALA 3TYDA 8XIMA 8A3HA 2PD9A 2DT0A 5BROA 3ID7A 4HN8A 4W86A 2WOVA 5I23A 3GNNA 3NQDA 3I6RA 4F3HA 4JD4A 4IMGA 1ZU8A 4LAMA 1LL7A 3OHIA 2PGRA 4F0SA 3BSHA 4Y9NA 1W9XA 5EMLA 4DUWA 1U5HA 3MYOA 3K8MA 2V81A 4EQXA 2PFHA 4UNIA 4HU8A 3V18A 3WL0A 1JYNA 1VBRA 4N9CA 3CUXA 2G37A 3EMCA 2ZZ7A 1DWHM 2YFNA 3HFTA 3UJFA 3RJYA 2EQ9A 4TOQA 1EZWA 2VCAA 4UTTC 1Q3NA 3DBPA 3DENA 4XKMA 4EQSA 4R34A 1DPMA 3FG2P 1E56A 3ZSSA 4KCWA 2QJMA 2E8ZA 3A24A 2PB1A 2POZA 4KEVA 2QJNA 2WOWA 3W4RA 1JEZA 3QQ1A 3LU2A 3REQA 1UW9A 4FHAA 2CWNA 2ZUNA 4DVOA 1E6ZA 2J8GA 4LS1A 1TV4A 1W1IE 4MNJA 1V79A 3U2CA 1EGVA 3TFCA 3VD9A 3XINA 3FYYA 1EJSC 2WAGA 3GR7A 2PDFA 5FJJA 3WMSA 3BAXA 3TWBA 4AVOA 2D3NA 4DB7A 3NQEA 4QITA 2OGJA 1XQKA 3GHRA 1BWVA 3MWCA 3S47A 2OWXA 1KCXA 4DYKA 1X8FA 3LRKA 5I3KA 3J7HA 1DORA 4IPNB 4HMCA 1TPC1 5D8ZA 1DIKA 1XBYA 4PL2A 3Q94A 1TR1A 4HCDA 3W01A 3UXLA 4QE4A 3GIQA 5D9MA 1VLIA 2XH7A 3UJEA 3W00A 1LWHA 1BPLB 3B9EA 4C65A 4EOUA 4S23A 3A3XA 3GDBA 3TYUA 1RBLA 1FECA 3GVWA 3CL6A 1EYEA 3OLEA 1WDQA 3N2BA 2CWXA 4Z42C 3CWNA 3AS3A 1UCWA 4QHRA 3W9ZA 3GNXA 4BS0A 3N34A 3C2EA 3BQ5A 4HMNA 3BANA 1EHAA 3F2BA 1DYSA 5JCNA 4Z1BA 1HW6A 2X1RA 4FLOA 1NOUA 2R82A 1XF0A 4JKMA 3RF9A 1TE6A 1VBUA 4DELA 2NSXA 2HS8A 2R91A 3RRAA 3MBFA 1S5MA 1M04A 5A2BA 4XAZA 4NNCA 1QNQA 1XX1A 4GO8A 1O4UA 2V6OA 2XPKA 5DMMA 4MWAC 4DEFA 2F5ZA 3WG6A 2A21A 4FLRA 4JN7A 1VBGA 3K8LA 1VPQA 2RDTA 4UIOA 4J4KA 2GL5A 4U3CA 4S2BA 4TX6A 1J0YA 4KCTA 1C9WA 1S5VA 3NL6A 3PNUA 1P0BA 1SU5A 1NJJA 1TJPA 3MKKA 4ADSA 2X2YA 5FACA 4HZ7A 2YQUA 1HIZA 3W07A 1CGYA 3DKLA 3SQSA 1PHWA 3BAWA 2VFIA 1IQ8A 4PSPA 1CBGA 3ELFA 1JDCA 1RLCL 4POCA 2XH0A 4L6DA 2DZWA 5G5HB 4GMEA 4AF0A 7REQB 4H6RA 4F9DA 4UFMA 2NQLA 1V3IA 3L0NA 3DX5A 4WR3A 3ZJ8A 1G67A 3QV8A 1R7AA 3CT2A 4PBEA 3FA3A 3FVMA 4CQ9A 1DJXA 5HK4A 5EY5A 1KM4A 3H2NA 4Q3MA 1V6TA 3WH8A 3I4EA 4B5TA 2ZZ0A 1HQTA 1XUZA 1XLJA 1A5UA 4TV6A 3S5NA 3P8IA 4ZMGA 4W8AA 1NDAA 4HP5A 5D38A 5EL1A 1XCWA 1YNPA 3AXIA 3NEHA 3GFZA 3PG9A 4E5TA 1JD9A 1EFZA 1XM3A 2QV4A 1V02E 1KWKA 1OT2A 3HPFA 3I6TA 4H4UA 4IMEA 4NX5A 1PS9A 2JF6A 3M07A 3WF3A 1XUUA 1LTDA 4URIA 1RSCA 3VAVA 4D1JA 2FZBA 3QW4B 2XUCA 4PCSA 2DIEA 1W9VA 5AFDA 3H2AA 1FWAC 1BGGA 1J0HA 2H6RA 3PNZA 2OR2A 1JAEA 2XVPA 1BYBA 4Q8QA 3FK4A 1SPQA 2RHGA 4D6JA 4J2MA 3TZNA 2QLYA 3IVTA 2ACQA 3GHUA 4JTEA 4LXFA 2GZXA 3PG6A 4AZ7A 4I5RA 4ML4A 4DYEA 1ZAIA 1OSEA 3LPPA 5CBIA 1Y5VA 3ABRA 3AWNA 2BVYA 1BXCA 3GSMA 2E25A 1B3YA 2YZ5A 3CASA 4F0MA 5KVIA 5CH9A 2BFGA 3CT7A 1XFBA 1DTNA 4P7LA 2Q01A 1UWAA 2Y0FA 4AAJA 4O4VA 1L6SA 3WEMA 5HANA 3MUCA 5MHBA 2Y7GA 3EWXA 3VMNA 2VFGA 2NX3A 4ES4A 5CLWA 3Q4DA 3N25A 2J7GA 2QDGA 3ARSA 1YDOA 3P5ZA 4DBUA 5HPOA 3N2TA 3GZ3A 5LHEA 3GIPA 3UNTA 4DZIA 1BQCA 3DEQA 4XISA 1BG4A 1GVQA 4CCDA 5G1YA 1O7AA 2ODOA 1B3ZA 2FTPA 2V2DA 1E1FA 2YCLB 7REQA 1FCQA 2WMGA 3VMPA 5KMYA 3W81A 1CYGA 4Y9AA 4XD5A 3WJXA 1E6PA 4RE3A 2V69A 4XZBA 3C61A 4KGJA 4IUOA 1I75A 3TMLA 2V38A 2PDKA 3DH9A 4UQ9A 3ME3A 1K70A 3QYQA 3DGRA 1WUEA 1VS1A 3SJNA 5LKYA 3POCA 2PTZA 2ZZ2A 2TMDA 1LBFA 3M7WA 2VZSA 4FOJA 2IMRA 4PCNA 4J2PA 3W2UA 3UZXA 3KLJA 3ZO9A 1XLIA 4R7WA 3PUGA 4HNNA 3TEVA 4MOZA 1VFTA 3U48A 5C8BB 2R24A 2EJ1A 1EHNA 2VOMA 2VX6A 4M6QA 2PBGA 5D05A 1O12A 4FI4A 4ZO8A 3E5BA 4UQEA 3WIJA 1UASA 2F2HA 2BTMA 1C7SA 1GT8A 4FNQA 3AIWA 4EAYA 2BG5A 3RM8A 3FY1A 2PWHA 4GXWA 1QBBA 2X7WA 4B9YA 5HMFA 4AY1A 1DE6A 2X1TA 1NWRA 4RKAA 1S2TA 3UCQA 1EJUC 1XQLA 5LIYX 1WV2A 2NUXA 1A5KC 1KV5A 1JD7A 2FPTA 1D7FA 2IW0A 2B0MA 3GXDA 5A8GA 3BE7A 3GD6A 1K77A 2ACRA 2XVLA 1Q1WA 4RV3A 1NDYA 1GWJA 1HFBA 1CENA 4GIAA 4L65A 5AN7A 3G1XA 5I6SA 1LRQA 4L6OA 3UD6A 3VE9A 1MYRA 4LUJA 2C3CA 4C6FA 4PBFA 3CAKA 4F2UA 5JH2A 3CUJA 3PUDA 5CCZA 3UY8A 1ESWA 4FX9A 3O6CA 1FWHC 4LIIA 2JK6A 3B8WA 1JJKA 3DUGA 1X1OA 4JQ3A 2ZQ0A 1E55A 2WHLA 3W22A 2VDHA 1H61A 4UBPC 4B5NA 3UYCA 2XVKA 2DSWA 1W5OA 5A94A 1Z9AA 5CC6A 3PBUA 4PTDA 4Z0SA 3S2CA 2GGGA 2CHRA 3DBNA 3PULA 2VGGA 3UJ2A 3P7YA 1JZ6A 1IE7C 5I3DA 4GFIA 2P3EA 4O28A 2XN2A 3XISA 2TYSA 2WMJA 3W1AA 3ARWA 1JUEA 3HF3A 2YCLA 5CC3A 5JBDA 4GISA 3RR1A 3WNKA 3N73A 4MNKA 5B7ZA 5KZ6A 1GESA 2HDJA 3FKRA 2VDGA 4AISA 5BWFA 4K7ZA 4IL0A 1I4NA 3CS2A 1O94A 2GGHA 2J27A 2ZUWA 2W0UA 4NAEB 4GI8A 4JEJA 1OYBA 4AC7C 1H7RA 1QHOA 2GJLA 3SY8A 1V3JA 2G3JA 2GQAA 1PX3A 3HGSA 4NX0A 4B5XA 1UJQA 2VI0A 1KBIA 1MRAA 4QAWA 2EG7A 3AFBA 4M7TA 1RPKA 1WQ5A 2FTYA 3ABQA 3WLKX 3T07A 1V5XA 2GR3A 4GVGA 2ZC8A 2X42A 5SWUA 1FDZA 2YVFA 1K6AA 2YOCA 4HIBA 4UWMA 5KVHA 3WH6A 5AHLA 2W4XA 2X7VA 3EDJA 1GVYA 1HTIA 3GG7A 3TTOA 4H7ZA 3P3BA 2QPSA 3ITLA 4OV9A 2E40A 3MI6A 4JFWA 3ZZ1A 2BXZA 3II4A 3O9NA 3P61A 4H9XA 2QZRA 3WK3A 3H21A 4C6JA 1XLHA 2OT0A 4CQBA 2ZFAA 1UWQA 2VZOA 3IIPA 1IR2A 2WMIB 4Q32A 1JPIA 4MJZA 2VELA 1AQFA 3OBAA 2Z26A 3KUMA 3O2LA 4G8TA 4L9ZA 1QO2A 1LCOA 3RRXA 4UOJA 1J2WA 3PTQA 3MVTA 2VYOA 4LRTA 3E2QA 1JG9A 3AIQA 1A0DA 4L64A 1MW1A 1NIUA 3WQGA 1UD6A 1KXHA 4IF2A 4L9YA 1AOGA 2Y6ZA 3I7RA 4YTRA 2ZUTA 1VPYA 3TYEA 3L12A 1VEMA 2NZLA 1R9YA 1TTIA 3WBYA 1J93A 1Q6DA 3OTRA 4HD5A 3CZ8A 1S1PA 3LXCA 3SRDA 4IIBA 3BW3A 3CHCA 4PB3A 4CD5A 2EG8A 3OPSA 3VI2A 1UR3M 1Q4NX 1V97A 3B9DA 3AYSA 1MUWA 2HK0A 1ONXA 1UZHA 4GABA 3M46A 1VLWA 4YTSA 1DIOA 3WX7A 1TZ7A 2XJ7A 4D8ZA 1QPKA 3QPEA 1G69A 3MCNA 1Y7VA 5LXXA 4K3ZA 2YXOA 2V63A 4B3LA 1I1WA 3RX3A 4YCOA 2OOGA 1DXLA 3IIZA 4EX4A 3VINA 1XISA 3BMVA 2DT1A 2ZXBA 1PXGA 1VQZA 3NSNA 3KEHA 4NAEA 4NXSA 3TK7A 4ZVJA 3LTYA 3TDFA 1VFOA 1M7XA 3T08A 3PSWA 2PLMA 1WBJA 3FSUA 3ABSA 1XHCA 3W7JA 4D8LA 1ZJBA 5B7YA 4Y6GA 5D9NA 2OGYA 4IQJA 1YBQB 1TJRA 2PD5A 3SCQA 3H70A 1VFLA 5DBUA 3UJRA 2HXUA 3VDHA 1BVNP 3LXBA 3PP7A 4NAFB 4CNUA 2VL4A 3AJ7A 3QMSA 3APTA 3NYDA 4UCFA 2AKZA 1KD0A 4K7VA 4KBXA 3NSXA 1N8WA 1A5SA 2PC4A 5DXYA 5FJUA 3FEQA 1KA9F 3C4UA 1TVPA 2ZOXA 4BI6A 4M7SA 4KWOA 3U4FA 3DFOA 3SCRA 3EKGA 1AL8A 3TJLA 1HVQA 3P6LA 1SZFA 1V93A 4MZ1A 1ITCA 4HPXA 4JNZA 2BASA 4CD8A 2PDYA 3KBJA 1N7KA 3UVIA 4LT9A 1BSIA 1GQKA 4ILSA 4H1ZA 1D7YA 2HTMA 3TWAA 5FOOA 2L5HA 8CGTA 5HWJA 3PVFA 1JZ8A 1FKXA 1Q6FA 3QBUA 2BHYA 3CL8A 1TR9A 2PC8A 1HJQA 1D3GA 3S2MA 4Z2GA 2X8RA 3P5YA 3TTSA 2Q8ZA 5DRIA 4LYPA 1SUXA 5AVNA 4RZ4A 3O0KA 4ICCX 2OB3A 3PJXA 4L9XA 3W1UA 3B05A 4LPCA 5GPRA 4MSSA 2OFJA 4JL2A 4O12A 4HU0A 3PM6A 3W7HA 1QUMA 4J7RA 4MNMA 3RCMA 3UR8A 3TXVA 2F38A 5D2VA 3T40A 3M1ZA 3SCNA 1TTPA 2BDQA 4BEQA 2WP5A 3MJYA 3VPLA 1FH9A 3GB6A 1H7PA 5IFPA 3GDMA 2Y70A 2VXNA 1QI0A 2B31A 2J8TA 4EMJA 2DJLA 4V15A 4MHBA 5M1TA 3IGSA 3F7JA 3TQPA 1W1ZA 3F2DA 1M7JA 2QJGA 3L4YA 4GYPA 1QWGA 3CLMA 4MY1A 3UG4A 2E1WA 2O56A 3IRDA 3MSYA 3M0ZA 3BLPX 2EAWA 1UR1A 2Q09A 5HDRA 3CMJA 3Q2DA 1IF2A 2WHMA 1TELA 4NT0A 4ATDA 2WO5A 1UKPA 4L1XA 2Z2UA 4YL2A 3AXXA 3BOXA 3IANA 5IRPA 3OG3A 3OZPA 4LANA 3VIIA 1MQPA 2GQ3A 3GW3A 1B30A 2A7NA 5HUPA 4K8DA 3N4EA 2CESA 4LF1A 1XLCA 2X0HA 1RD5A 1CZ1A 1DIDA 1UWTA 4O1CA 4JKKA 2X8HA 5BRPA 2PODA 4Z08A 2JEPA 3CV6A 2FZ8A 2J8FA 2FVMA 2GPTA 3TYAA 3A9BA 4RUBA 4TIMA 4G6CA 2QS8A 2EPNA 4P2VA 2CPUA 3PZOA 1GVIA 1JUKA 2MNRA 1W3JA 3WLIA 3O0HA 4J3ZA 4MVAA 4ZO7A 1ZCOA 3KTCA 1ZALA 4F0LA 2TPSA 4Q8VA 1UR2A 5TIMA 1OGGA 1KWGA 5I7GA 1ZY8A 2BXYA 1IIHA 4FLSA 4EWJA 3G8RA 2WLYA 3A12A 2WBKA 1XYFA 1LJYA 4KCVA 3SRKA 1XLEA 5T91A 1AH3A 3UGRA 3CV1A 3E5PA 1D8WA 1T5AA 3CWHA 1BYAA 3AMKA 2XM2A 4RE2A 2XYLA 5FS6A 3CAWA 4A35A 4LAUA 2QMJA 3W76A 2Y61A 3BMWA 5G2IA 1Q5MA 1RVGA 1XH2A 5HWNA 3H4KA 2OWCA 4ROPA 1GOMA 3RLVA 1E9LA 4QNEA 3EA1A 1XLLA 3WD1A 1OK4A 2J7FA 4ATWA 2F9RA 1P6BA 4AMCA 4YWOA 5I78A 1DHPA 3CL7A 5T26A 2DVXA 2ZA1A 5D2WA 1IV8A 3PB0A 3NOYA 2W3SA 1XYBA 3AZSA 4IWWA 3KLLA 3NRZB 4S3BA 5A6AA 3KBNA 3E3HA 2XSAA 1XLAA 2G50A 4C6PA 3DECA 2ZICA 3VO0A 3IRSA 2NUYA 1EGMA 3CUFA 3PZMA 1WP6A 1NF7A 3SIZA 3EWYA 4E6MA 4ICNA 3WJZA 3BJTA 1A4LA 1M6IA 5XIMA 1TPDA 4AB4A 3FW6A 4C6KA 2F2KA 2Y5JA 1BD0A 1JR1A 3Q67A 3CUIA 3NQ7A 1O5KA 1KXTA 1X96A 1ZBKA 3B9JB 1TO3A 3OVPA 1W1TA 2A2IA 3W27A 4PUNA 5E6YA 2VWSA 4LUTB 4WSKA 3V36A 4F8XA 5K2ZA 4J28A 5M2FX 4GYJA 3NVVB 3CZLA 3WLHA 3GNOA 1WCGA 5EMUA 2H9AB 3OVRA 4MM1A 1KBBA 4NVTA 3N9KA 2BSLA 3E0VA 1FWBC 3M0HA 4JFVA 1XLMA 1GETA 3EWWA 3KE0A 3H7UA 3SGGA 3ZOAA 4GD0A 1RVKA 3W3OA 5TR3A 2QCMA 4WXYA 1A5LC 5TNVA 3UF9A 4UTKA 1N60C 4PC8A 3WSUA 4AHOA 1LT7A 3LBCA 4M82A 1Q2SA 2FPYA 1E43A 3WLQA 4K39A 1EO5A 1MQRA 5GVJA 4UTTA 4IJRA 1PKYA 2Z4GA 1XKJA 1VEPA 3EOOA 3ANUA 5CSRA 1D8CA 1ENUA 4PRWA 5BCAA 2Z7KA 3AS0A 4AZBA 1XDLA 3HB9A 3W1MA 2CU0A 3GXIA 3W75A 1BWLA 1SR9A 2J25A 3BH4A 2QVHA 3H2EA 1B3OA 3KXQA 1TQXA 2Z1WA 2FIQA 3AIVA 3DHFA 3CUHA 4YWIA 2CLHA 2PPGA 4PTWA 1MQQA 4A3QA 3TW9A 4CKQA 2WNNA 3EXRA 2QCHA 4OBSA 3LADA 3CH9A 3EZ4A 3KRZA 1EOMA 2QDDA 1ADDA 2PDHA 2PLKA 3KCJA 4F2TA 3QKEA 4IP7A 2VEKA 2OMAA 3QKZA 4DAIA 1ODZA 1R47A 2QUMA 1JVNA 4UR7A 1A5BA 1EBGA 4NZ5A 1AG1O 4O50A 2UY4A 5CPLA 3QTPA 4NYYA 4DJEC 4JQ4A 4NF7A 5TAOA 5IDZA 4TVYA 3AQUA 1GORA 2DSKA 5BRQA 3M0XA 3ARYA 3RO8A 2WK2A 1UZ1A 3H6OA 4DYJA 1OFQA 3IUHA 4UZSA 2DY3A 4PRRA 4N4PA 1KXQA 2AMGA 4Q6JA 1OJXA 1EL3A 4AWUA 4RZ6A 4C6EA 2ZUUA 2VC5A 3R13A 4JYFA 8RUCA 3WDJA 3EOSA 4XD6A 1QOXA 3G6LA 1PUDA 3SBFA 4P8VA 1UPMB 2CLOA 4KIEA 2P3ZA 3BG5A 1F7BA 6TAAA 3QM3A 1ZXIC 1RP8A 3TE9A 1QXLA 1BVZA 2GOUA 1W9BM 5EU9A 1V7AA 3NFUA 4EK7A 4WXZA 1ZPTA 3P80A 4MGGA 3FAWA 1K4HA 3T78A 3DYPA 2PRMA 3EWCA 2E5DA 3RUBL 3CGDA 2YW4A 1VC4A 4CN6A 5BW6A 4NZFA 3VK5A 3L5OA 1UKQA 4UMAA 4UTIA 3VOCA 1YTDA 4GQ0A 5L9FA 1AODA 3WLMA 1WKYA 3BOFA 1WAUA 4AW7A 4E2VA 4MAZA 1QCWA 2GVYA 2JGQA 4DO5A 3W25A 1XJBA 2O92A 3B8SA 4O17A 2AKMA 5A6LA 3PZTA 3ZR4A 3NSMA 4MWAA 4V1XA 3UZWA 3QZ6A 4ORIA 2DT2A 4NRSA 3POHA 3OQ8A 5D02A 6REQB 3W2NA 2Z29A 1XSKA 2ZZBA 1B3XA 2YFOA 2E5AA 2ZX8A 1OFRA 1F3XA 3VABA 4HSOA 2YVGA 4N42A 2Y5EA 4H6QA 3SSJA 1UD4A 1E3XA 3N6HA 5BOOA 5K4XA 4LQ1A 2HK1A 4ZGYA 2XM1A 3P0WA 4NZ1A 4AZ6A 1AJZA 3SY5A 3FJLA 4H2HA 1PZ1A 3JW7A 1HX0A 2Z6JA 3OGVA 5JCKA 5BOEA 4Y90A 4XG1A 1HL8A 4ZSTA 4DWSB 4YHGA 1PJ9A 3WELA 5DBTA 2V9DA 3I3EA 3CH0A 1XH0A 2X99A 3P2VA 2DSVA 1UH4A 1XRTA 3DFNA 3D6NA 4MWAD 1XBXA 5GNZA 1GRAA 3W7MA 3THQA 4O18A 2WSYA 4DLMA 4DHGA 3TP4A 3S6OA 4P8UA 2W55A 4NI8A 1SM9A 1AMYA 2A7PA 1NARA 3FHAA 3GWQA 3UXKA 1F6YA 2E0PA 4G7FA 4W5ZA 1YE6A 3CB8A 4ZB5A 1Z89A 1IEXA 3R79A 2DZUA 4DXKA 1I2NA 4TU1A 3ALGA 1OZQA 1QFEA 3LQLA 4RDVA 4UOZA 1OGBA 1IWAA 3T0TA 5DANA 2XSXA 2V3DA 1OFAA 4WZHA 3MMWA 3IC9A 3CHFA 1EIBA 2GSHA 3WF2A 1X7IA 1RQBA 2CLIA 4FR6A 3FEMA 4IMCA 2W63A 3DI1A 5MKGB 4MY9A 4R9OA 1GK8A 3I3DA 3MPGA 4TVWA 3F4NA 2XGIA 4OECA 3FS2A 4HZ8A 1F76A 2YDSA 2WCSA 1F8IA 3BLEA 4JIRA 4H4IA 4K1WA 5CZ0A 2WMFA 3VCCA 4JIQA 4RJEA 2OU4A 2WVSA 3HG4A 1NF0A 5GQBA 5FF3A 3MT1A 5EBAA 3EPMA 3A4AA 3DK9A 2DU2A 1HJVA 3AROA 2DZPA 2YBTA 2XFRA 4PTMA 1S5TA 4HOXA 1AL7A 5FSDC 5FS7A 3LEPA 3A3WA 3G2GA 3KDNA 1Q6CA 4JFTA 3AIEA 2Q3OA 4GFSA 5BXPA 2JKAA 3IWPA 2EQDA 4DX3A 3NS1B 3WBWA 5D9PA 3ATYA 1H1YA 2QUUA 3OJGA 3ARZA 3M4HA 4OV4A 4GE8A 1F4AA 3GC5A 4C1NB 3VUSA 3W82A 2PDGA 4PEEA 3AALA 4U5KA 4JQ1A 1T0OA 1XKYA 4L1GA 3W53A 5FL1A 2JK2A 2GR0A 1W56A 2X16A 2X0SA 2J6VA 1HL9A 3UERA 3C5QA 1CLKA 1D9EA 4H4QA 3TXZA 1N2VA 4MMWA 3CQIA 1W3TA 3Q37A 4BHYA 1EJVC 1TPH1 3A21A 1LYXA 1NQ6A 3ZR5A 1Q6RA 2NPXA 2J78A 3GXFA 2V0TA 1XBZA 3PG8A 4CCZA 5CPNA 1W8GA 3HJZA 4E4UA 3VGFA 1MSSA 3BLKA 1T99A 4HYRA 1E1EA 3L4ZA 2GGIA 4CEXC 4GZIA 1ME8A 3KP0A 1R2SA 1R30A 4AXKA 2DW7A 1VFSA 1K8XA 4QDMA 3M5VA 3PBVA 5FAJA 4EF8A 3GVQA 1HUVA 3W2MA 3NZ1A 3KRBA 4PUEA 3NDYA 2W62A 1ZRQA 4EQWA 1U5VA 4P8WA 1RK6A 5AYXA 3EAOA 4MYXA 3OYZA 4C6NA 2VX7A 3VNYA 1LLZA 4PN2A 4F66A 4K36A 3CB3A 3TZFA 1RAKA 2PS2A 2UY2A 5E0KA 3W7EA 2FB2A 2Y8VA 4GUHA 5HINA 1KN0A 1QPQA 5AB3A 3W6LA 4NUWA 2CCRA 2RDXA 5JU6A 3WF0A 2EHHA 2W3ZA 1K9DA 1YPXA 7ENLA 4EXBA 3ES8A 3GTHA 3B0PA 1P48A 4AYGA 2W67A 1ZBCA 2EPMX 3N2CA 1TV5A 4RNIA 1VKFA 1XDJA 1WXYA 5FCZA 3EDEA 3O0FA 1JCJA 4HU3A 4JTKA 2ZUSA 4Y9MA 2PWEA 3RCNA 1MDLA 1GVEA 3M6DA 5CAKA 1H2IA 3V0SA 3CPRA 3COTA 4WOZA 3W0KA 2WVUA 3EPOA 4NEWA 2Y7DA 3TC3A 1OFDA 4MYAA 3A4XA 4PCFA 4QSHA 2C3DA 4IM4A 4QAIA 1OJTA 2E67A 2XIIA 3CZJA 1A3HA 5FMHA 3S5YA 2KZHA 1F4HA 1SB3B 4CCCA 2PTWA 2G3FA 4KEZA 4DO4A 1THFD 4FP1A 2WXDM 4DUXA 2Y63A 1V6VA 2XFWA 2Z7GA 4Z2HA 4C1NA 1PKMA 4TR9A 2A79A 3SQPA 1VRXA 5ABFB 1HO4A 2GOKA 2NV2A 3WD4A 2PLCA 3VNZA 4YWSA 1KBLA 1VENA 4AD0A 2C1IA 2HRWA 4PZVA 3QMTA 4PMNA 2A3AA 2VR4A 4KPLA 5M5DA 2A85A 4IT1A 3OG2A 4QROA 1YW1A 3STFA 1TVNA 1JQVA 5AHFA 2J7CA 2J79A 4NNBA 3LENA 3NPVA 5C9XA 1K02A 1KC7A 4E4PA 2O4MA 4IGNA 4LBRA 5M17A 4PTNA 1J11A 3CU2A 4QE5A 3VGDA 5JCLA 4OT7A 1BZLA 2IXVA 1OYAA 4O11A 4MB3A 1CGTA 5BXSA 3QZEA 2GUUA 1QNPA 1W3NA 1JDAA 4S3EA 4B91A 3V75A 1XIJA 2VRQA 3CNYA 1YXDA 4HA3A 1F6KA 3VIHA 1WPCA 1W32A 4N6FA 4U4MA 3NVWB 5D33A 1HP5A 3TJ4A 3VM5A 2EXOA 4RPQA 5TD4A 2HSAA 3H24A 3OZOA 4Y9PA 2PP1A 2WWCA 3WUEA 2DVTA 4UFHA 1P43A 4DI8A 1YNQA 4U3AA 4JTTA 5FEPA 1UD8A 1WE5A 3H2MA 3URHA 3KTXA 3H4WA 1TWIA 3W7RA 3V16A 3VNJA 3AS2A 3V5OA 4UTWC 4HPJA 2XWEA 3AIUA 3O6AA 4GGHA 3QPZA 2B7PA 4W89A 1CGUA 1C7TA 4GR1A 1QI4A 4WIWA 2NX9A 3GKAA 4Z0JA 1GRBA 2WPCA 1WDPA 4O54A 1M3UA 3SI9A 1GEQA 2D0GA 3KX6A 4YVPA 3GRTA 1OCBA 2DIJA 3IJ9A 4XSLA 4C90A 5BU6A 2RUSA 2EKGA 1ZKQA 5EKYA 3W74A 3LOTA 2V5BA 3GXNA 1GRGA 4WSJA 2ISWA 2I9EA 4KEUA 3WLNA 4H4TA 2WSPA 3SCWA 4WY0B 3WZ0E 4O57A 1BWKA 4K1GA 2OX4A 2IKHA 4CN1A 1L8PA 4UFJA 1W8SA 1E73M 2B81A 5LGZA 1VCFA 3WFLA 2PP3A 2HE8A 3PZNA 4TVUA 4JIIX 3G0UA 3SRHA 2HV5A 2XIOA 4BK9A 4PMUA 1PCWA 1F61A 3GFYA 5A1AA 1SFLA 1ZFJA 4Y8FA 1AA1B 4XZHA 4BA0A 1VR6A 3DCPA 2PDJA 1WKFA 3LN3A 2J62A 3OVGA 4DZAA 2WZHA 1X7FA 3W71A 5ABFA 4X63A 3VDAA 3B3DA 3N6QA 4B5UA 4XKYB 4JYDA 4W88A 3L2MA 4QDPA 4FR1A 2OSXA 2CITA 2DFAA 4NJHA 2NSOA 2VC9A 4EQRA 2XGBA 1U1UA 3H2FA 3B8TA 4HTYA 6TIMA 2D0FA 2D0HA 3VNKA 3ZFHA 5CZSA 2XSBA 2ZZ4A 4LYRA 1JAKA 4BF5A 3MC5A 1ISWA 3WMBA 1NP2A 1TRDA 3FGCA 2Q6ZA 5GJMA 1ITUA 4X0NA 3MWAA 1ONEA 4A8IA 4JTLA 4L5ZA 2WNZA 3WQFA 4GWEA 3TROA 4D71A 2X09A 3CZEA 1Q6QA 1VRDA 1LBMA 1PZ2A 3HG3A 1I2OA 1X1ZA 1CWYA 1DQUA 2FDMA 5F2GA 3U4AA 5KZDA 3TH6A 4US5A 4JCMA 4D6IA 1QAPA 3BL3A 2V6AA 3VE7A 1NHPA 3NYZA 4GQBA 2AOSA 4OUEA 3MHFA 4I3GA 1R38A 3UNDA 2YAUA 2ANUA 4B2DA 1BRLB 2FGBA 1PIIA 4TX9A 4YLWA 4R7JA 4E0CA 1C3FA 2HQMA 3DGZA 2C91A 1EA0A 3W86A 1KQYA 2GVLA 3TV8A 4S1FA 3V4BA 3BSGA 2ZA2A 1IT0A 2Z1BA 1OT1A 5AC6A 4UQAA 2AQWA 3GU1A 5FA5A 5FEXA 2D2OA 3HURA 3KFTA 1R46A 3UZJA 4LCSA 3PPCA 3GY1A 3V3WA 2AL2B 1QR7A 4MFDA 4WY0A 4US5D 1XYLA 2EJAA 2PCEA 1AQHA 4GH3A 1UR0A 1TZ9A 4YTQA 1OFBA 1QK2A 3EWUA 4J35A 2FH6A 5D03A 4B2DD 1GHRA 2CBIA 2PCQA 4FOKA 1JXKA 3NQFA 1Q66A 3LHTA 3V5CA 3DJJA 1ZMCA 3U8GA 2Y62A 2OYKA 1K03A 2DJXA 3TCEA 1A5AA 1GEHA 1GOQA 4AWEA 4HNTA 1XD0A 1KB3A 1RY8A 1YNYA 1H49A 3WF4A 1D3HA 2VZTA 3N18A 1FRBA 1F3TA 2X50A 5LXEA 4OFCA 1TA3A 4PMRA 3NL5A 4QEHA 2NQZA 4O4WA 4U31A 4JNMA 1OC5A 3KHJA 3HG2A 1POJA 1ALDA 3ZWTA 4IP4A 4HNCA 3QC0A 2O4QA 3BCDA 3W37A 5DXXA 1VFFA 3L9CA 1KCZA 1Q4WA 4UZUA 3PTMA 1B2YA 2QCCA 1TUFA 3K4WA 2OELA 3LLXA 4OUIA 4JHMA 4J3VA 3A23A 2ZZ6A 4LAOA 4S2CA 3BLDA 3TKFA 2BNJA 2VJXA 2EO7A 4MLRA 4CLMA 1MI3A 1JZ3A 3OLIA 2IKGA 3H12A 1VBJA 3EMQA 3MDWA 3LXDA 1S3HA 1UD5A 4EXAA 5EYWA 1KV8A 1F8WA 3GDLA 2WC3A 5D8WA 1G1YA 2E6DA 2ZUMA 1FFVC 4HMEA 3SR6B 4WJXA 1Q1RA 2WLZA 1TUXA 1BWCA 1MXSA 1U22A 4CQAA 4QRNA 1E6QM 4LV9A 3ZM8A 3NZRA 2RFGA 2F84A 3TFXA 2CLMA 3QSTA 1XYMA 3DJGX 3DDMA 5BOFA 2OKOA 3QTGA 4AZCA 1AH0A 4OZOA 4BI5A 3WK0A 3ORWA 2VHLA 3VUPA 3WH7A 4LU0A 1CXHA 3E2RA 1SFJA 1UHVA 2YCIX 1JL8A 5HNRA 2WPBA 2W61A 2GGEA 3L4VA 4HNOA 2DORA 1UROA 2GJPA 3NXLA 4WDUA 1EZ2A 3STEA 2ISVA 4DJDA 2AL2A 3VC5A 3EA3A 5H8UA 4GYFA 2ZTKA 5A6KA 2ZX6A 5HAOA 2VVNA 3ABZA 4W7WA 3LX9A 2QYGA 2J3NA 1EBHA 4M6PA 5I06A 2Y2WA 1V3KA 1H0IA 1E0TA 2H8ZA 3SAZA 5H8MA 3SGZA 2CZVA 2D24A 4JTHA 4LJ3A 5HR7A 3UCDA 1GGOA 3PBGA 4FX6M 4UFLA 1DIEA 3PZIA 3RX4A 3EYPA 4G5DA 3ARPA 3QV7A 1GVFA 2WZIA 3NVZB 5G4EA 5I77A 1NOWA 1E5NA 1NWTA 1JQXA 2V5DA 3NQMA 1FH8A 3LSCA 4HZ6A 3LCFA 2RAGA 1CXLA 4HNVA 5KEZA 3KOXA 3NEVA 3W6YA 2PDBA 2P5NA 1BEUA 5CGQA 3W7OA 2V30A 3VOGA 4CU8A 1EX1A 3SCUA 4X9SA 4G56A 1PYFA 4K8EA 3BVJA 5LSMA 1WXJA 2ZVRA 3I68A 1A50A 5I3HA 1ICPA 1R87A 1Q45A 1LLWA 4S38A 1Q7QA 4JHZA 3W2JA 1LVLA 1XWYA 5AC8A 3VDBA 2YSWA 4XAPA 1EUAA 3E74A 1ADSA 1BKHA 4AZHA 5CPTA 3PTKA 4UCGA 3E6EA 1XRVA 3N2OA 2J24A 1K6WA 1STZA 4DUVA 1MFUA 5A2CA 3RLHA 4KPRA 4I9TA 4REQA 3QQWA 1HNYA 3F4CA 4PA8A 2PI6A 1FO4A 2A3BA 3M16A 2CW6A 4GX8A 4M81A 2GSJA 3EB4A 4W87A 4D6GA 4V33A 4ADWA 2ISDA 1BYCA 4A29A 4Y8EA 1ZBWA 2VMFA 3T05A 3TX9A 1YDVA 2CZDA 5J8LA 5HULA 2BC0A 1IT8A 3LV5A 1H7NA 2H3BA 2PF8A 2PGEA 3PF3A 4PE8A 2GDQA 1Z48A 2WHKA 3K1GA 4EP8C 1GUVA 3N9SA 4LYQA 2VEFA 3UR2A 3PZQA 4GC4A 3IS4A 3TSBA 1DOSA 4IX0A 3AO0A 2ZX9A 2V2CA 1Z41A 2WHJA 1AK5A 4ZXLA 1TYGA 3A7RA 2NV1A 1ZP4A 5PTDA 3GR8A 4L61A 2PU1A 1FCUA 2O9TA 3M6YA 4JIPA 4ZB2A 2FB3A 1FWFC 2PDWA 1QTWA 2EBNA 2ATMA 4KWVA 4IMAA 1XCFA 5M3WA 4WF7A 4LY4A 4N9DA 1T41A 1BTMA 1QNSA 1GG1A 1XFCA 3H7RA 2Z0IA 4MB1A 3WN6A 4DJEA 4ZSUA 2V68A 3FJNA 1GPFA 2YLLA 1OX4A 3O05A 4RNFA 7CGTA 1EC9A 1R0MA 3KOWA 1XS2A 1XGEA 2I5QA 3Q65A 3KWSA 3MVIA 1ZTVA 1R3RA 1TWWA 1EQPA 1I1XA 2VEGA 3KHDA 3L0KA 4AH7A 4D1IA 4NNAA 2YDAA 4GQGA 1UWSA 2HZGA 3NIYA 3SEPA 1AW1A 2BOFX 3FX4A 4DBSA 4ERGA 3BV7A 5AHEA 2OQHA 3WLLA 2FPVA 1V0KA 2CNCA 3FJ6A 2I7GA 3RFAA 1J0KA 2DDXA 2B7OA 3IIVA 3C2VA 4IXXA 1K4GA 2V8ZA 2YCKX 4IQLA 3WQDA 4JBRA 2QULA 5EBKA 1C29A 1EBDA 1UWIA 1C91A 4JIHA 1OWQA 5HQLA 1J10A 3ITVA 4MKNA 3W28A 4PUUA 3A5VA 3NVTA 4DJED 3VNIA 3CHEA 3ATZA 3QR1A 4YVVA 3JUGA 2WANA 1K3UA 2CFYA 1C9DA 1GKRA 4GRSA 2NVDA 3KTSA 3BG9A 4WY0F 1R86A 1J01A 3CHDA 4XBSA 2PDUA 3PBWA 1ZB5A 4UXDA 1PSCA 5HJXA 3CGCA 3UWVA 3UYIA 2X1SA 4O13A 1WUFA 1G01A 2ZCGA 3B0XA 1PPIA 3B40A 4KRTA 3NTYA 2PDLA 4L7ZA 4A3UA 4DF1A 1Q2RA 5CG0A 3A6OA 4Z1DA 1XIMA 3R0KA 1D2KA 2YIHA 4MJ4A 1QNVA 1GVRA 4XIAA 3CIXA 4L56A 3O7UA 4PYSA 5I09A 1R5YA 2HXTA 1BYDA 2E68A 4V1YA 3VXGA 1ME9A 4MB4A 3ECQA 2C79A 4I5XA 4M56A 1BF6A 3GG8A 4JN8A 2PDPA 1A5OC 2WP6A 4R5EA 3RLGA 2JBMA 2R1MA 2INFA 4KFNA 1OF6A 1YTEA 1XYAA 3W1RA 5JXQA 3MBDA 1VYRA 4UQCA 4ECLA 3BO9A 2YB4A 4GJJA 2DH2A 5U25A 2VQUA 4I6VA 4E8CA 2ESCA 1UA3A 3TA6A 1BXNA 1SJAA 3FV9A 1QPNA 2ZYFA 1TPVA 5T9BG 2WYSA 3N9RA 3MO7A 4X3ZA 1XSIA 4UTJA 5KZEA 3CTLA 4QGCA 3CEUA 1E4NA 1Q7ZA 4XSMA 2A3LA 3CYJA 4W5UA 3ISIX 3OB8A 4IIEA 1FDJA 1ZAHA 3KVMA 3CMFA 5E5CA 1HN1A 5JVLA 2X1UA 3L67A 1IYXA 2VDIA 4C7FA 1GPWA 1CNVA 1H62A 3WEOA 3MB9A 1EXBA 2R1NA 3DAQA 1FTXA 4PULA 4G7EA 1GYLA 2W6RA 3KAOA 1GOIA 3IK2A 5DY3A 4NIRA 3G1HA 4NJGA 3EX2A 2ZRYA 4GI6A 2DZAA 4X2RA 3VOIA 1ZLPA 2QAPA 1MEIA 2YJQA 5H6HA 1GQJA 3MMUA 2J74A 5LIXX 2WJFA 7XIMA 3C8FA 5DMYA 2I9UA 1R9XA 5IHSA 3F4WA 1NELA 4Q4OA 3SJ3A 2HPMA 1TQJA 4LAKA 2NWSA 3DU0A 3W88A 3L8KA 4PSRA 3CLWA 3IVUA 4GUFA 4HHMA 3QHOA 5E9AA 2BHZA 3HIJA 1H6VA 4UC5A 2RJHA 2VENA 1VB9A 3BJSA 1Q65A 4WLCA 4PMYA 5E09A 2QDHA 3B8DA 2VCCA 3MCOA 1HJSA 1BGAA 3R0UA 4X60A 2E9MA 3TTYA 1X39A 3PUOA 3UU0A 2BX7A 1P1XA 2OYMA 1E6NA 4FXRA 2VURA 2A6NA 4BKNA 2NW0A 4GCXA 1W9DM 4O53A 3S1GA 1K7EA 1I0BA 3Q58A 1S46A 1HP4A 4GXPA 3SY1A 3WL1A 3S5ZA 3C0JA 5A6TC 3Q6JA 4H4XA 2GK1B 3FAXA 2VEMA 5JQ9A 4NL1A 3PUEA 4X22A 2FH8A 1REQB 2CZEA 4P7RA 3NJ3A 4DUOA 4ERAA 3PAJA 2UWFA 3KBVA 5EA9A 3D46A 1M1BA 2XGZA 3A64A 2P76A 4NZJA 4H4YA 1JULA 4UTMA 1K1DA 3BUVA 5A69A 4AIUA 3LCIA 4IG2A 3SCTA 1MUCA 1IEIA 1UBPC 3EGJA 1XIGA 4FAMA 1IIGA 1AD1A 3WLSA 3AHXA 4PUKA 5AHIA 1HL2A 3SSZA 4N9EA 1EF2A 3BICA 4HK6A 4MIMA 4GVFA 1RA0A 1FY6A 1J5SA 3L4TA 5KITA 4O0ZA 2NXIA 3B03A 1OADA 2I16A 3M7SA 1KO0A 4GVHA 3O63A 4N02A 3VDCA 3KOFA 5GJPA 4LOCA 3EX1A 1FEBA 3QY8A 1O6IA 2PRLA 1ZSXA 4HT3A 3R4IA 2C6QA 1EC7A 1A5NC 4LC6A 4R3UA 4F4RA 1ICSA 2IPJA 1GV4A 3HQNA 2TAAA 4HCLA 4KIRA 5FS9A 2TRSA 3QFEA 5HR6A 5FF2A 1IXOA 4TMBA 3JR2A 1F74A 3WMLA 3N17A 3WK2A 3VIJA 1RLDA 5AC5A 3IJDA 1X38A 2XISA 4JGDA 1TPFA 3QC3A 1HKMA 1W1A1 3QLLA 4OTKA 4BWLC 4A3HA 1AW2A 5EMKA 3MHUA 4GNKB 2OEMA 4MZYA 1UQYA 2GVGA 2UY5A 4H00A 3W7NA 3SCPA 3MSRA 1KFJA 4L4PA 3A3HA 5HXMA 1LQAA 3W29A 1AD4A 1CEOA 5EB8A 3QYSA 3NQBA 5XIAA 4C6MA 2INZA 3K1DA 3M5YA 1SMDA 4YN5A 3NQ2A 4CNSA 3DK8A 4MTVA 4GHRA 1F05A 1EKOA 3IJ6A 3ZQ9A 3BARA 3NA8A 1GOWA 3AU6A 4CGTA 4KFPA 1FXQA 1SJDA 4P7NA 4AG0A 5HJLA 1NY1A 3OQEA 3R43A 3MMTA 4B90A 2VP8A 1TWSA 1MVYA 1CT5A 1JPHA 1NFGA 1TJ0A 5JCMA 4CCEA 4Q22A 5DCBA 3D47A 1XRFA 5I3GA 3LM7A 4EMIA 4XZ9A 2W9MA 3LYEA 4HYWA 5CJ5A 3GRSA 2E8YA 3T1GA 1VFMA 1GYNA 2J9XA 4IICA 2ON3A 1E4LA 4WKFA 4PUWA 1LM1A 2WM1A 5IFTA 1ZGDA 2O7SA 2CETA 1REQA 1UC5A 1KKRA 5F2IA 5LZLA 3STCA 3DGBA 5D9OA 4S3AA 2VM8A 1EP1A 3RMEA 3TNOA 4AC1X 2V3EA 8XIAA 1P7TB 1JNEA 2HNHA 2AGKA 5ECVA 2G3MA 2JFEX 3EXSA