3I6TA

Crystal structure of muconate cycloisomerase from jannaschia sp.
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
367
structure length
356
Chain Sequence
b'DQSQIIAGFTLWHLSLPVTGAVEVVVLRLQADSGAVGYGEASPWVVFTGSVEATYAALDRYLRPLVLGRAVGDHAAIMEDARAAVAHCTEAKAALDTALYDLRARIAGVPVWALLGGRCRDRIPLSCSIADPDFDKDLALMQRLQDDDVRIIKLKTGFKDHAFDMMRLERLRADFPAFDIRVDYNQGLHHDVALARVRDVATFKPTFIEQPVKAHLRGLMARIRDAVDVPLLADESIFGPEDMAEHPEIADGVSIKIMKSGGLTRAQTVARMAAARGLSAYGGDMFEAGLAHLAGAHMIAATPEITLGCEFYQATYFLCDDILAAPFPVADGHVLVPDTPGLGVDVDEDALARFAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Muconate cycloisomerase
publication title Crystal structure of muconate cycloisomerase from Jannaschia sp.
rcsb
source organism Jannaschia sp.
molecule tags Isomerase
total genus 130
structure length 356
sequence length 367
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3i6tA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3i6tA01
2P0IA 2FYMA 3JVAA 1EBHA 3PWGA 3ZVIA 5FJTA 4GISA 3SN1A 4JN7A 2PTWA 1MDLA 1KKRA 3VA8A 4H83A 3FYYA 4ZA0A 2QGYA 2GL5A 4G7FA 3OZMA 4IL2A 3V5CA 4KWSA 1SJBA 3S47A 1SJDA 2PP1A 3R0UA 1NELA 3OP2A 2XH4A 2GSHA 4A3RA 2RDXA 4M6UA 1L8PA 3CXOA 4IL0A 1JPDX 1BQGA 3UGVA 2QDDA 3U9IA 2MNRA 4H2HA 4K8GA 1IYXA 2PA6A 1RVKA 4E4FA 3MSYA 4E8GA 2OZ8A 4IT1A 2AL1A 3PK7A 5FJPA 2OG9A 2QDEA 3MUCA 3T9PA 4A35A 3R25A 3NXLA 1EC9A 2PU0A 2HXUA 3PFRA 3H12A 3TW9A 4A6GA 4HCLA 2PCEA 3QN3A 3MY9A 4MGGA 1E9IA 3GO2A 3ES7A 2XH7A 1MDRA 2CHRA 2AL2A 3GD6A 4DX3A 3UJFA 2OO6A 3DIPA 3SSZA 3P93A 1KD0A 3CT2A 3MZNA 3VC5A 3H8AA 4GYPC 3RGTA 2ONEA 2OLAA 2HXTA 3OZYA 1MNSA 3I6EA 4GGBA 4YWSA 5ENLA 1FHVA 3R10A 4HYRA 2P8CA 1DTNA 5J04A 1SJAA 3P0WA 2XGZA 3I4KA 3H7VA 3N4EA 3B97A 2NQLA 4JHMA 3DG3A 4GYPA 3TJIA 2AKZA 1KCZA 2QVHA 4IP5A 4MKSA 2PGWA 3V4BA 2OQHA 3N6JA 3RRAA 4M0XA 4Z17A 4FP1A 2PP3A 2GGGA 3TQPA 4GFIA 2QJJA 3R0KA 2OKTA 3UXLA 1JPMA 2PMQA 4HPNA 4H1ZA 1ELSA 1MRAA 3SQSA 2GGHA 1R0MA 2PSNA 3V3WA 2ZADA 4HCDA 2POZA 3Q45A 1EC7A 3D47A 1KKOA 3N4FA 3TWAA 3QKEA 3VCCA 2XH0A 3ZVHB 7ENLA 4KT2A 4FI4A 4DYEA 4DXKA 2QJNA 2ZC8A 2AKMA 1PDZA 1NU5A 6ENLA 2P8BA 4J3ZA 2OPJA 1OEPA 3VC6A 3T6CA 3NO1A 3DGBA 4ZCWA 3VFCA 3VCNA 2OQYA 2QQ6A 3SJNA 3H70A 2I5QA 3UJEA 3DFYA 2GDQA 1BKHA 3ZLGA 1P48A 3D46A 2GGJA 3ES8A 1XPYA 3DFHA 4IZGA 5BOEA 3TCSA 5FJOA 1W6TA 2MUCA 3P3BA 2HZGA 3IJIA 3T4WA 3CB3A 5BOFA 1SJCA 3I6TA 3BSMA 3JW7A 4HCHA 3STPA 4KPLA 3OW1A 3MQTA 4X2PA 3UXKA 4IHCA 3DEQA 4IP4A 1WUEA 2PTZA 2OVLA 2DW6A 4HNCA 4H19A 1TZZA 3FJ4A 3IK4A 3BJSA 3R1ZA 2HNEA 1TE6A 2GGIA 3CYJA 4KEMA 5EU9A 2OFJA 1ONEA 3UJRA 4DHGA 4G8TA 1WUFA 4DWDA 1TKKA 4K2SA 1EC8A 3RCYA 3PWIA 3RITA 4GIRA 3Q4DA 3U4FA 2PPGA 3DDMA 3S5SA 2PU1A 3TOYA 3UJ2A 3THUA 3ZLHA 4F4RA 3V5FA 3TTEA 5IDZA 3UCDA 3CAWA 4E4UA 3CK5A 4HNLA 3RO6A 4EWJA 3DESA 2PODA 3UJSA 4GGHA 2O56A 3OPSA 3R11A 3VDGA 1MUCA 2XSXA 5FJRA 4HN8A 2P3ZA 3ZVHA 3MKCA 3FCPA 2PTXA 3JZUA 3SN4A 2GGEA 4GMEA 1ECQA 1JDFA 3RR1A 1R6WA 4ROPA 4DN1A 4E5TA 2PS2A 3DG6A 3EKGA 3UCCA 3T8QA 5FJUA 3TJ4A 1F9CA 3N6HA 4ENLA 2XH2A 4J1OA 1XS2A 3HPFA 4JN8A 3DG7A 1FHUA 3NFUA 3FVDA 4MMWA 3TWBA 3OTRA 3DERA 3FV9A 3ENLA 3GC2A 3SN0A 3EEZA 4E6MA 2OZTA 3FXGA 1YEYA 2AL2B 2P88A 2OX4A 1PDYA 2QJMA 3KUMA 2PGEA 3QTPA 1EBGA 2OZ3A 2DW7A 2PP0A 4K1WA 1P43A 3GY1A 3BOXA 4Z1YA 3QPEA 1JCTA 3ZLFA 2PTYA 3IJLA 3QLDA 3K1GA 3SBFA 3NZGA 2FKPA 3MWCA 3IJQA
chains in the Genus database with same CATH superfamily
2WC7A 4S1FA 2R9ZA 1SZRA 2F61A 1EBHA 3ZIZA 2DQWA 2X40A 3ZJ6A 1YDYA 2ABBA 4DNAA 3HPSA 3UG5A 3B05A 5JH2A 5A8OA 4IM4A 1KFCA 3CM4A 4HZMA 3LYEA 3AIWA 2QKFA 2JF6A 3FJ6A 1ZCOA 1KR1A 4KEVA 4R53A 4W89A 1M01A 5C8BB 4IXHA 1XI3A 4C1KA 4BZYA 4FDCB 4CNUA 3B0XA 1NFGA 1PIIA 1JDCA 4GNKB 3CUJA 1SR0A 1X1OA 3AHXA 4LB3A 3R43A 5JCKA 2YDRA 1O60A 4LUJA 5MKGB 3VGEA 1KFLA 1ZUAX 1CB7B 2PA6A 4W88A 3PB2A 5A6KA 2PDLA 2BHZA 3S2CA 4ACYA 3LGDA 5E70A 3W7CA 1NARA 1RCQA 2DH2A 4S3BA 3C2VA 1M7XA 4UTTA 1IEQA 1GOIA 1XDLA 5MF5A 3TXVA 3AHTA 2BTMA 3EMZA 1WOBA 4WUIA 3QN3A 5AB3A 4AQLA 3MY9A 3ARTA 3VKJA 4D6FA 4DZ5A 4TU1A 1R87A 3OQ8A 1FP9A 1K9EA 3RK8A 2VUYA 1FTXA 2TODA 1V02E 1SVDA 4FOJA 2WNQA 4DJDC 1TFVA 3MZNA 3PVFA 4RZ4A 4XD3A 2DZSA 4CU8A 5AYXA 4O1EA 3CXBA 2OLAA 3KHDA 1MNSA 3IIZA 2D1ZA 4O14A 2DT2A 3WFAA 2P8CA 4GUJA 3G22A 3COTA 3WLJA 3ZWSA 1ONRA 2EPMX 3NVDA 4F48A 4PCNA 2GQAA 2PUZA 4JFUA 1QAPA 1U33A 3ZM8A 5DEZA 4HU3A 5G4HC 3UWWA 4PMUA 4WDXA 1A3HA 2CEQA 3DXIA 4HHLA 4D6EA 2GSEA 4S3KA 1ZFJA 1N8WA 1A5OC 3KZPA 3O0HA 4GVHA 4C1LA 1A4LA 2Y62A 3USBA 3N18A 1YKWA 2ACQA 3R0KA 1A5NC 1W9BM 3LM3A 2OWXA 2FH6A 4HPNA 3UWUA 2FTYA 1SYTA 2ZRUA 3FW6A 4GA8A 1XD1A 4FIQA 2UY4A 1XLJA 3FDGA 4YTUA 2BNJA 4M29A 4N6EA 2O9RA 4HZ8A 3E2VA 2J7HA 1M1BA 4DXKA 1HUVA 1OSEA 1US0A 4RE0A 4H4TA 1KGUA 3N9SA 1R38A 1S2CA 1T8XA 2P8BA 2WVUA 2OPJA 4J3ZA 1FQ0A 1UB3A 3WBEA 2HISA 2W6RA 1HL9A 1P7TA 1S2TA 3NDZA 1K8YA 1PXGA 1TWDA 3LS9A 4AC7C 5DN1A 4AFYA 3VVGA 4LALA 3QV9A 1QWGA 3LPGA 3TVAA 2HTMA 4FNSA 4DPPA 1P48A 3UP8A 2Z1KA 4JTJA 3TC3A 2E67A 3URHA 3VE7A 1JULA 3LD5A 3QZEA 4PUUA 1UBSA 3CIWA 5HNNA 3HQ1A 1VH7A 4XAGA 1E6PA 3GZAA 1OYBA 1NQ6A 1K4HA 2A4AA 2D0GA 4AIEA 1BWLA 3LQLA 3LCFA 3O0FA 1Z44A 1R9YA 2I16A 1GQJA 3PM6A 5CSSA 1H1ZA 1VBGA 4F9DA 3OC4A 3HOJA 3PZMA 3B9NA 4YCPA 2E9MA 2E5DA 1VCGA 4H9VA 3BJSA 3C2RA 4LU0A 3ORWA 3CGCA 3H2CA 3UJRA 1UKTA 1XBZA 3LHVA 4NYYA 1YDNA 2XIMA 3UG4A 4LVBA 2JK6A 3OBKA 1FCUA 1A50A 1QHZA 1UH4A 4FLQA 4LUYA 2X1IA 1ALDA 2ZDSA 3AIVA 2OLSA 1QW8A 2GJRA 3STFA 4TVWA 4GI6A 3UJ2A 3DGRA 3ZLHA 3GVWA 1ISVA 3KM8A 5FMHA 2H9AA 2VX5A 4ZSUA 5E9AA 1HVXA 3WLSA 4YN5A 2XDFA 2BXYA 1Y5XA 4HPJA 4GGHA 4NZJA 3KRUA 4WZHA 5TQLA 1TVPA 3WMCA 4DUWA 2V5BA 4G9PA 3L65A 4KGLA 2DZBA 1GVOA 2DSVA 4CCDA 1QOXA 4J2PA 4EMJA 4M6PA 3WQ6A 3O8AA 1GYNA 4DN1A 1F3XA 1J0ZA 3T8QA 4O11A 3E38A 4XTIA 3AIEA 3RPMA 4L6HA 3BAYA 3F4NA 4IFRA 1F6KA 4JL1A 4BQ4A 4DXVA 1V77A 1MEHA 2QMKA 2P76A 4C6KA 2X7VA 3VXGA 1XQKA 1EUNA 4OFCA 3GUGA 5DCEA 5B7YA 2CC0A 4ILSA 1MUMA 2EQ9A 3T07A 1W3HA 1DBTA 4W5ZA 1E0TA 5G5GB 2NQ5A 4C6IA 1BQCA 4HIBA 4RPQA 3T44A 4C5YA 4TUFA 1GVEA 4DO6A 1GONA 3BAKA 3HIJA 4I9JA 4WJ8A 4OVXA 1XG4A 4GRSA 3RILA 1QNRA 4PTDA 4K7VA 2HVNA 1EO7A 4RNFA 4FXRA 1IT0A 1ZBKA 4Y96A 3NPXA 1SZNA 3SBFA 1E71M 1HKMA 1EQCA 5CSRA 2PDBA 2Q8XA 1ZU8A 3SCUA 4DO5A 1OCBA 3WH7A 4Q3MA 1TWZA 4M19A 3SQPA 4RE2A 1ODUA 1P5BA 4GISA 3IUIA 4ADTA 2PTWA 1MDLA 2GUYA 3L2IA 1HW6A 3KBWA 4Q7NA 4ECLA 4KRZA 4G7FA 1JJKA 3UZYA 4EP8C 1F6YA 1EO5A 2VGBA 3VD9A 3NG3A 1N5WC 1B4KA 1OFOA 2TPRA 3PBUA 3MI6A 4K8HA 5U1OA 4IQEA 3OP2A 3CJPA 1EP3A 1GORA 5H8UA 3TR2A 3QLLA 1ZALA 3HPAA 2VRKA 1HKJA 2YR1A 1TJPA 4EXQA 1OX6A 1S2WA 4K8GA 1RVKA 4RKAA 1TUXA 3SY1A 4E2OA 4HA1A 2XWEA 2FTWA 4HK6A 3L4UA 2CLIA 4RCXA 5CSUA 3VOCA 2GR3A 4DLMA 4J3VA 1EHAA 3NXLA 3UT0A 3RG6A 3GQYA 2E40A 4MWAD 3G0SA 4A6GA 4P8XA 1BD0A 1JZ2A 1VLIA 5G4EA 2BSLA 2WVTA 4MAZA 5D8ZA 3BLFA 4MOZA 5B7ZA 2CFFA 5L9FA 3G8RA 1Q7MA 3POCA 5KSWA 2BOFX 4I7VA 3KS6A 3SSZA 3P93A 3NM3A 3EWYA 2X09A 4IP7A 4PL2A 1O5XA 3WLKX 1ESWA 4UC5A 3S1GA 3NR0A 3T2PA 4K6AA 3SSJA 2JQXA 5LIYX 4WSHA 3M5YA 4UOJA 1ZDLA 4PRTA 1BG9A 4RPPA 4PODA 2PWFA 3A3HA 3MC5A 2IPJA 1U5JA 4L4PA 2PDXA 3SGZA 1NHQA 3DG3A 1US3A 5LIWX 1CBGA 3GC5A 4XTDA 3TROA 5CJMA 4AC1X 1MEWA 3C3NA 1SU5A 1OHLA 1Y5VA 4ZXLA 1C90A 1E6XM 2HK1A 8A3HA 3W7PA 4GCAA 1GRBA 4JX4A 3EPMA 4FEZA 2C14A 1YE6A 4GVIA 2V6OA 1CXFA 2EF9A 3EF6A 1J0KA 1R85A 2QJJA 3TTQA 1KGXA 2OKTA 4JFWA 3R94A 1PKMA 3HO8A 2NVKX 7TAAA 1HN1A 2DT0A 4HCDA 1TQJA 3CPRA 4ZTYA 3N4FA 1VRDA 4S39A 3OLEA 5JH1A 4AIUA 3VCCA 5M1TA 2QAPA 5LGZA 2Z29A 2NXGA 5JU6A 1NU5A 2CWNA 1C91A 3BAXA 3TMQA 1O94A 4FS9A 3WDRA 3P80A 4ZODA 4EAMA 3W6YA 3EZ4A 2JE8A 4FNQA 3E3HA 2QQ6A 3DCPA 3PANA 1TV7A 2EQ6A 1DVJA 4O12A 4DI8A 4M1RA 1XIHA 3EWXA 2R1PA 5G5HB 3OYZA 3IIVA 5BOEA 1TJ2A 1G4PA 1J0YA 2XYLA 1UD4A 2WC4A 2C91A 4DJEA 2BOEX 4LNYA 1OJTA 1H49A 1GXFA 5BOFA 1SFLA 4KCUA 5AVHA 1B54A 3LENA 3ETRB 4EK7A 2HNHA 1JRBA 2ESCA 2QUNA 3OW1A 8XIMA 3L7RA 1TREA 1WUEA 4B15A 1E6NA 3R2GA 3G24A 1R3QA 4IIEA 1TZZA 3IK4A 2B7NA 2DZWA 1CZ1A 1JZ4A 1BXCA 2GJPA 3LPOA 5CPMA 5CQ1A 2OFJA 2FZ9A 1OB0A 4XQ6A 3E0VA 5CZTA 1AD4A 3AQUA 5EBUA 1JQVA 3CQ0A 3DBNA 4LYKA 4U31A 3K4WA 5FEPA 2VRQA 3S6TA 1VIZA 4RV3A 1XLEA 2V81A 2EJ1A 1TVNA 4M52A 3EDKA 2Z2AA 3FLUA 1IZCA 3SEPA 2ALRA 3IGSA 3N12A 3W85A 3G1XA 3NA8A 3MKKA 4MNLA 1Z32X 4OJYA 1MFVA 4D6HA 1AW5A 1E1CB 1C8XA 3HB9A 3P62A 5LA2A 1UWSA 1L6FA 1MWOA 1EQPA 5IHSA 3UQNA 4V15A 2REQA 1M41A 4W85A 2D0FA 1DIOA 1DJNA 2VENA 3PUGA 3VIMA 3GLCA 1FWRA 3D5HA 4L4OA 2W3RA 4NKCA 1JEHA 4JTCA 1XW8A 3TSBA 2WZEA 3WF4A 3BC9A 3IJ7A 2C3DA 1THFD 4OUIA 1J6PA 3ZXWA 4J28A 3OBEA 5F2IA 1X1NA 2XPKA 3FVDA 3D6NA 3K4AA 4HJWA 1XPGA 3F2CA 4GOAA 1E6SM 3TJXA 1VEPA 2DQXA 2E8YA 5KZ6A 5H1WA 1KWKA 3WDJA 3VKKA 4KEZA 1V59A 2EG8A 2Y7GA 3TSMA 3INPA 2XJ7A 5KETA 3T0AA 5BXPA 4XD4A 3GXDA 1OFPA 5REQB 2GQ9A 4LVFA 2QDGA 3L12A 4L1WA 4Z1YA 1ZMDA 3TYAA 3QPEA 3EDJA 1P0KA 1H50A 3V0UA 4CVUA 3M16A 3WQ8A 1MQRA 1DJZA 2X50A 1XH0A 2P0IA 5F1UA 2CXGA 3CZ8A 1WBHA 3IV8A 2WJFA 3PWGA 3LNMA 4CD4A 4LPCA 2ACUA 1C9WA 5LXEA 1GOQA 3G3DA 1CLXA 3QM3A 4P7LA 1JNEA 1O95A 5CC3A 1TJRA 4A3HA 3MA8A 4EOUA 4F2BA 3DK9A 3H23A 4QBXA 3BQ6A 4NL1A 1Q6GA 1KM2A 5C7VA 4RZ5A 4AWEA 1YXDA 1PE1A 3VNIA 2CLFA 3VGFA 1W3TA 1XL9A 3QJAA 1LLOA 1OVDA 1Q6QA 2CKRA 2YBVA 4QHRA 2Y7DA 1P6WA 3LOTA 3GTXA 3B0YA 3QQWA 4E8GA 1G4SA 2EXOA 5A2AA 4HPGA 4FX9A 4PFHA 1TIMA 3H54A 3NQ8A 5HXMA 1BF6A 1XQLA 1K7FA 3PG9A 1SB3B 4PCSA 4NRRA 1NF7A 1B9ZA 1NFPA 3AMGA 3H26A 4I9TA 4B5NA 2UY3A 4L6OA 2WKJA 3FS2A 1W1YA 3R89A 4AIBA 1Q6OA 1ITXA 1W37A 3PJUA 3A12A 2V5KA 2VP8A 5BZAA 2CLOA 3K8MA 1S5TA 4NQ1A 4LWWA 1DTUA 4UTWC 5JBEA 4HBKA 4IPLA 3QFEA 3HV8A 4S2BA 3W22A 4QROA 2OO6A 3S6OA 3T55A 1GVFA 4DAIA 2YCEA 5XIAA 1H7WA 4XKYB 3GNNA 1GEQA 1QPOA 1BSLA 1K9FA 1XUUA 4AB4A 1GZ1A 4GGBA 1N63C 3F4CA 2BY3A 3TUUA 1KGWA 3RRXA 2NX1A 2AGTA 4ZFCA 3AISA 3L21A 4QG8A 3LU2A 3VO0A 5E1QA 5G1YA 2Y70A 3BARA 4QAIA 2ZRVA 3I6RA 1UD6A 1ZTVA 3VUPA 3GRSA 4IMFA 4C91A 3QW3A 3BV7A 5EPDA 2PGWA 1VFUA 3MCMA 3VMNA 3OVPA 1OQFA 2VGFA 4B5TA 5JBDA 9XIAA 2YBUA 1WYIA 4L4LA 4LXFA 3MJMA 2FGZA 3W07A 2D69A 1L2UA 3LLDA 4ZXOA 3P81A 1EJUC 4NJHA 1EOKA 3EWUA 3VCRA 5D37A 1G67A 3TQVA 4LFYA 2BXZA 3HG4A 4CVWA 1FKWA 2POZA 3E9AA 3H2EA 4EPDC 3C0LA 3FJLA 3B40A 1NVMA 5JIWA 5AN7A 1SO6A 3N6QA 2Y5JA 4JTLA 3TN3A 5U25A 1CCWB 1EX5A 4J35A 2P5NA 2BDQA 4X61A 3DGBA 4HNNA 4ZCWA 3ARRA 2FZNA 2OMAA 2PFHA 2V2HA 3RUBL 3H70A 1VQZA 4LV9A 1HG3A 1NQKA 2RGMA 1Y0EA 3PZOA 5I09A 3UFYA 3QR0A 3C2EA 3C86A 1YPIA 4TR9A 1SJCA 3RLUA 9XIMA 3S6DA 1H1NA 3PZTA 4KPLA 3MBFA 3STCA 4GUIA 2DZAA 4LF2A 3TYCA 4ZMGA 1LLWA 3KW3A 1CGTA 5FJIA 4JIEA 4AD4A 4IP4A 4YMZA 3N3TA 4LNCA 3DFPA 9RUBA 3KHJA 2GDVA 4TX8A 2HMCA 4UNIA 4H01A 2BY0A 2UY2A 3W7IA 2QS8A 1RY8A 1NH6A 3CTTA 4UTMA 1O5QA 3MV01 1KTCA 4DHGA 2J7GA 3CUXA 4G8TA 1WUFA 4C6PA 4IF2A 1TKKA 4K2SA 4O16A 1KTNA 3E0FA 3RITA 1TWIA 4Z2GA 5HINA 5M17A 1DJWA 3GH5A 1T8QA 3RO8A 3R0DA 2WPBA 3WLHA 3QFAA 1K4QA 3W75A 2XIIA 2VJXA 2J25A 4XO7A 3CGDA 3MHGA 4ZGYA 4EACA 4QNWA 4UFKA 4F2UA 4QAWA 4K38A 1O66A 2VELA 3GHRA 3NDYA 2X99A 1XX1A 2A85A 2Z7KA 3EWZA 1AZ1A 1D3HA 1IF2A 4X2RA 1G9HA 1ENUA 3CGTA 3DYMA 1VQTA 4IMCA 1Q6LA 5DMYA 3WLOA 3KRBA 4XVDA 2QCDB 3TNOA 3DU0A 1JDFA 4XISA 2YL9A 1C3FA 3DG6A 3MYOA 2JFEX 2OCZA 3AIQA 3A64A 1KCXA 2A79A 3APTA 1QMLA 1XDIA 1ZNNA 1S5VA 4U10A 3UETA 3W1UA 4WGXA 3G6LA 1EX1A 5G2WA 3UVIA 4Q4SA 3M0JA 4YL2A 1W3IA 1V97A 1G94A 1SO4A 2AQWA 2F9RA 3S83A 4GUFA 4G2DA 3VKBA 3NQBA 1DJYA 2QLYA 2WVVA 3WQFA 3OEXA 3DX5A 2HV5A 5I06A 3W7MA 3KTXA 4LCSA 4E3TA 4PRRA 3DYOA 4FX7A 4HMDA 4ZQRA 2G3MA 5BCAA 3S9YA 4IJBA 3LGGA 3SI9A 4GWEA 3GWQA 4NXSA 2F7FA 1XIFA 2J47A 3CAQA 3W01A 1YXYA 2W62A 4KH2A 3DBPA 1ISWA 2ZOXA 2PDQA 4IQLA 1HJWA 4AEEA 1H4PA 3SFKA 1I2NA 3MSGA 3O06A 4N02A 3UU0A 1CB2A 2QJGA 4I8DA 1ZJAA 3NO3A 3GR4A 1FFUC 2QIIA 1FWAC 5HJXA 3NYDA 1LP6A 3I3BA 5K4ZA 4J4KA 1BF2A 1XIMA 3CBWA 3WBXA 3S1UA 2WKLA 2QAEA 3GD3A 3G1FA 2GSHA 1EP2A 4AG0A 1KCKA 5I6SA 3HJZA 5H91A 1U1UA 3KZSA 4IL0A 4AD1A 1IIHA 4H3DA 1BQGA 4NHVA 1J9YA 3U9IA 2GOUA 4EQXA 2DEPA 3LCXA 3OG2A 1RZMA 3S8HA 1NAL1 3U2CA 1G1YA 3MSYA 4EKJA 4TX6A 1K8ZA 4HD5A 3VZZA 3FGCA 3SY5A 4K7ZA 4J27A 4INFA 1GOKA 1FY6A 2YL5A 3T9PA 3WEMA 4MWAE 5DXXA 6REQB 2VFGA 1O1ZA 3R25A 3FX4A 1MQQA 4F2TA 3CWNA 1Q6FA 1W1ZA 5AOUA 4CN6A 3POHA 2EPKX 1ZBVA 1DWFM 2ZBTA 3EAUA 3LK6A 5ABGA 2NLIA 1M9HA 4R5EA 2W9MA 1QK0A 1E9IA 5H6HA 1XHCA 3N04A 4Z2HA 4FF7A 4CN4A 3L2MA 2UWFA 3VM5A 2NZLA 2O9OA 4PGLA 3WMBA 3LV6A 5FKYA 2ZXQA 1KM3A 2J9XA 3BK0A 1CW2A 3OLDA 2ONEA 3PPGA 1NDZA 3TK7A 2GVGA 1EGZA 2OU4A 4I5XA 1X96A 3NURA 2YA0A 1LL7A 4Q8MA 1GG1A 1SJAA 3NVWB 3H7VA 4KETA 4H2CA 4BJHA 2NQLA 4E8DA 5CC7A 2XISA 2R8WA 1GTHA 1OFBA 1J93A 5AC8A 4JYFA 5BRPA 1AMYA 4IOTA 3EMCA 4WEVX 2F84A 3F2BA 4BHYA 4XZWA 1KXQA 3T2OA 2ZE3A 3E02A 5D9PA 3RRAA 3W28A 2E5BA 3GXMA 3P8IA 4R9OA 5HANA 4L64A 2ZRYA 4GFIA 1OC6A 2CZEA 2D73A 2Y61A 1E73M 1FCQA 4D8LA 2G50A 2YJQA 3UZ5A 3CNYA 3LI1A 4PMVA 2NWSA 4D6CA 1WQ5A 1A5MC 3W2NA 2OR2A 3II1A 3VILA 2WKGA 3MBDA 4FOKA 4Z1AA 4XVEA 4Z08A 3LXCA 2C3ZA 2FLIA 1W9VA 4GC4A 1K9TA 3STEA 1SGJA 1C8VA 1RVGA 3WF1A 3E2SA 2Y5EA 3ARSA 4D1IA 3DFYA 1FH9A 4TX9A 1JZ3A 3LSCA 3W1AA 3QHNA 1XPYA 4IZGA 2E8ZA 3MB9A 3XINA 2W91A 5FJOA 1KFEA 2EO7A 1AG1O 2HZGA 1S1PA 3KOXA 1FOBA 1IEWA 3A22A 5ER0A 4RW3A 3UXIA 4WGHA 1CDGA 3E49A 2WSRA 4O57A 4Z0SA 4G1NA 2WV8A 2Z1SA 3ZZ1A 2WXDM 1PWLA 4H41A 1UWAA 4J56A 1UOKA 3NVTA 4R88A 3MWAA 1R3TA 3BMVA 1W9PA 4JY8A 1EJXC 4TMCA 2IXUA 3L68A 7REQA 3BAJA 5GJNA 3H22A 3WQEA 1JYNA 3CYJA 4JEJA 2H8ZA 2WSYA 1C29A 3VX1A 3JU2A 5ECVA 4AWSA 4DEFA 1R2TA 2G8ZA 2Z6IA 4UFLA 3PZQA 4N9DA 2BODX 2EQ7A 4QQUA 4JX6A 4CD8A 1RP9A 1PCWA 3EB4A 5AYZA 1AVAA 1ZXIC 3EEGA 1E0VA 2HEJA 3M7SA 5IDZA 3BGAA 4FOUA 4B5XA 2C1GA 2J7EA 3LB8A 1QBBA 1ZGDA 1OX4A 3M5XA 2ZZ7A 4I6KA 2E1WA 1YQ2A 3VDGA 1EFZA 3B9DA 2L5HA 2ZRXA 3IIXA 1OJXA 2PD5A 1JAKA 1E5NA 3AOFA 1XUZA 1I0BA 2ZCGA 3V5OA 2VWSA 3G2GA 1V4YA 3GBEA 5CXPA 3MP3A 2GGEA 2R1MA 5FIPA 1G0CA 4GUGA 3B9OA 3NRZB 1XIBA 1XFBA 3KLJA 4QCEA 4IIHA 1TJ0A 3W2MA 4UFMA 2ZVIA 3IAQA 1Q6DA 4BI7A 5I03A 2QJHA 1TPWA 1FH8A 6XIMA 3KBJA 2ZXBA 1TPB1 1JROA 4A3QA 2VFDA 3PTMA 4MY1A 6A3HA 1GQNA 2Z24A 5C5YA 1MXGA 4L1XA 3JZEA 2X41A 4OU1A 3D3AA 3N19B 3QQ1A 3FXGA 2CNCA 2QZRA 1NOFA 3AFBA 4LGXA 2YCIX 4RDVA 1VJZA 2EQDA 3WZ0E 3GYCA 4R7JA 4TTUA 1OCJA 1UR8A 4DF2A 1UD8A 4AZ6A 5E09A 5ABFB 4OWGA 4Y9NA 4MWAC 1QPNA 4MB4A 4JX5A 3V35A 3NVYB 1RLDA 2D22A 4JDBA 7ODCA 4J9JA 4RW5A 4K37A 2XFRA 2A5HA 5CSYA 3SCQA 3GDLA 1XANA 1WDQA 4AZBA 3LDVA 3VM7A 3TH6A 2QNEA 4Q6JA 3NTYA 2YXGA 3TZFA 3ZR6A 3SN1A 2Z2UA 2Z27A 3BJTA 4AD0A 3FYYA 1M53A 5JCIA 1S46A 4OTKA 3WH6A 3TU9A 1IXOA 2A6LA 5CZ0A 4PBEA 4C6NA 4CNOA 4HZ6A 4IL2A 1NWRA 4Y9AA 5J8LA 1OCNA 4PC8A 5K2ZA 3EX3A 7A3HA 4GABA 1ZAIA 4QXIA 4ACZB 3RX3A 2EHHA 4DF0A 2ASHA 4QE4A 5EMMA 2YA1A 1FXPA 3WNOA 2MNRA 2BZNA 4LUIA 3W88A 4OBSA 3NZ1A 4UTKA 1XYZA 3URAA 3DJJA 1CGYA 1ZMCA 3GNRA 3BAWA 1YNYA 4S3GA 3OBAA 2F6KA 2P3EA 2Q8LA 1H63A 1YBQA 2FGLA 1M5WA 1W32A 2RJGA 2E0PA 3L66A 3MUCA 2G41A 5H8PA 3UR7A 4DJFA 2CETA 5BMXA 4HKPA 3H12A 2EPLX 1CXEA 1S5MA 1BRLB 1YYAA 2OSXA 5AHFA 4D6GA 3QXBA 4AVOA 4DXXA 2ATSA 5HDRA 3S1WA 1A5KC 1C92A 2CLPA 2V68A 5IFTA 1IWBA 3EWWA 4PB3A 4DBDA 2WPGA 1WP6A 2SFPA 3AMDA 1A5BA 2AAAA 1TA3B 3CZLA 3NQ2A 4K7YA 3GD4A 5I7GA 5BRQA 3CT2A 3W83A 2ZVRA 4D71A 4X0NA 3RGTA 5A8GA 4GKTA 3TJLA 1JI2A 4BWLC 2ICSA 3H7UA 3MCNA 2BB0A 3FYPA 1V51A 4IG2B 1GSNA 1J10A 3TTYA 4HYRA 1DTNA 5HULA 1UIOA 1SFJA 1RJQA 3N4EA 3QC3A 1H2IA 1I1WA 3EDEA 4D72A 3N2BA 4JTIA 2J66A 3PUOA 1UD5A 1NDWA 1W3LA 3WQPA 3VZYA 5D4YA 4C1NA 5AC6A 4MB1A 4NAFB 3PZUA 1R8LA 2PP3A 3CT7A 2Y85A 2A3AA 4LS1A 1FWTA 1DEDA 4H4RA 1VAHA 1TZ9A 4Z42C 1FEBA 4DO4A 3W7NA 4XBSA 1Z6KA 2B7QA 1QI5A 3CMJA 3LB0A 4LF1A 4HK7A 3A3WA 3ARZA 4Q8PA 2ZZ6A 4BY3A 1FVPA 3LBOA 4DYEA 1LWHA 1U1HA 2XFYA 4ZFMA 2YCKX 1TRIA 3IRDA 1YRRA 3W81A 1KWGA 3PNUA 3OGRA 2QV5A 1TX2A 1BXBA 5FS9A 3NZPA 1MW0A 1X8FA 5D2TA 3EA2A 3PAJA 4R34A 3IVUA 3ZLGA 3C2YA 3QYSA 2F6XA 4BEQA 1RCOB 3DFHA 3SUSA 4YWOA 4IMAA 1F4HA 4MG4A 4ZOAA 1Z89A 4EQWA 1DKWA 1N82A 2CBIA 2HBVA 4GJ1A 3WH5A 4BV6A 1GZJA 1EPXA 4LY8A 3WUFA 1Q7ZA 3VIIA 3GTHA 5KVIA 1OGBA 5K4XA 1WKDA 4GY0A 2A2IA 2ZZ1A 2OT1A 1NSJA 1AJZA 1JOAA 4DBWA 1B9BA 1QOPA 4XIMA 3CC1A 2QUUA 3R79A 1JQXA 2Q02A 3W53A 5E5CA 3VKCA 1GOOA 1ZCCA 3G18A 1JCMP 3MYPA 4WHBA 5KINA 3QSRA 3ARPA 4GXMA 3CZKA 2YW3A 2PE4A 3PWAA 4GIRA 3K2GA 1KFKA 3HJEA 3R6IA 1DIKA 2D3NA 1A5LC 3TOYA 3QBUA 4HOWA 2CYGA 4M24A 3CIXA 2WCSA 1ISXA 1WZMA 2RFGA 1QI2A 1MW3A 1YW1A 2PWVA 4Q8OA 1FFRA 5A94A 3L2LA 5JRBA 3CAWA 1XDMA 4QITA 1GRHA 3QKZA 3DHDA 1KXHA 3UJSA 1ZRQA 1ZLPA 1PZ3A 2Y8UA 1GVQA 3UYCA 1VENA 1PVNA 4JQ3A 3FEQA 3ZVHA 4JNYA 1EF2A 4L9XA 3QRHA 1DHKA 2G97A 1X39A 5JMUA 4FXJA 1AK5A 3I3DA 4HTYA 1B2YA 3RMEA 3EX6A 4GMEA 4KMQA 1ME8A 4BF9A 2GJXA 3GKAA 1EA9C 2PDHA 3UESA 5H8MA 4A4AA 3ECQA 3CPGA 3HG3A 3SCVA 4NI3A 5DT5A 3O05A 1DE5A 3T1GA 4N9BA 3NPWA 2ZFAA 3DOPA 1XS2A 3AALA 1XYBA 3BG3A 3LRKA 1JGIA 5HQEA 2V67A 3LZ3A 1VF8A 1LT7A 2XINA 4WSKA 1AQ0A 3C4UA 4E6MA 2RHGA 4ZO7A 3T7VA 2PWHA 1TTIA 5A6BD 3BLEA 3CZEA 3CV2A 4D6IA 5A6MA 5FEXA 5I79A 3CHVA 1X7IA 4PR4A 2C7FA 2NUWA 2CESA 3FSTA 3KBNA 1JCXA 1TZ7A 2GVLA 3TC6A 4V2XA 5A8NA 2DY3A 3RPTA 2P1FA 1VHNA 3UR5A 4XBKA 3HPZA 1E70M 1WX0A 3DECA 3DK4A 4Q32A 3WY1A 3F5LA 4ATLA 1SUXA 4O17A 3T0TA 1A3WA 1V6YA 1UKPA 5HNUA 1A80A 5KEZA 3CUFA 3TP4A 4AYSA 1BPLB 4PEKA 2DVUA 4QQ3A 3SQLA 3XIMA 3B8SA 1IV8A 4WK9A 3DI1A 1B3WA 3WFZA 3IJ6A 1FWCC 2G5WA 3K30A 3OZMA 1GQKA 2J7DA 3MO7A 2NLYA 1E9YB 4LCQA 3DHPA 5CPQA 1E9LA 3R0UA 4EIVA 5LNWA 2V8ZA 3LHYA 4Y8EA 3WJZA 2W54A 1EUAA 1DWJM 1PB0A 4L56A 1SW7A 1O6IA 1CGVA 3RYSA 2BY1A 1JCLA 4JBRA 1OT2A 4V27A 1ZK7A 3L5OA 1NWTA 3C5QA 3F4WA 1MO0A 1U5HA 3FDKA 4KKXA 4RZ6A 3LCLA 2J75A 1IZKA 5GNZA 3DJGX 3MUY1 4XK2A 1H3GA 5IFPA 4XZHA 3BLDA 1AOGA 4WKHA 1AL7A 3KX6A 3URBA 4LUTA 1V8EA 2RJHA 3GR7A 5AYIA 1W3NA 1B3ZA 1J5SA 5D32A 5JXQA 1DXEA 3TA6A 2XH7A 4ZO6A 2ANUA 4CN1A 4MB3A 4GY7A 1KQZA 2CZFA 2VURA 5CLWA 2VMFA 3RLHA 3KL3A 3AS1A 4DWSA 1XD0A 4DZAA 4U2YA 2GK1A 2ATMA 3DIPA 2IKGA 2CLEA 3L67A 3NWRA 4B3KA 1F8MA 1IT7A 4FLOA 3OVRA 4HU0A 1FECA 3ZFHA 1V3LA 1KLZA 3HU7A 3B9EA 4PMDA 5D33A 2O7QA 1W9DM 4LQ1A 2ZXDA 1QI4A 2YDSA 1GERA 1XRTA 2PLMA 1V6VA 2E5CA 2FGBA 3AMZA 1KBJA 3PJWA 3NQVA 4CNNA 1GKRA 4NXKA 2WLYA 3GAKA 3O7UA 4JHMA 3EOSA 2J62A 1VS1A 3TJIA 2WP5A 5F2GA 4DNMA 4CGTA 4REQB 3UY7A 2OQHA 1AZ2A 1QCWA 1UHVA 4MYAA 4M81A 3W23A 2G4JA 2YFNA 2ZUNA 3WBYA 4IJCA 3GSMA 1GPWA 2CPUA 1ODZA 1YX1A 1H09A 2VEMA 3NEHA 1OWQA 3V0SA 3EOEA 1MRAA 1PKNA 2BY2A 1FX6A 1LVLA 1FWGC 1H7NA 1EGVA 4NSBA 3C8FA 1D7FA 3HTWA 2DZPA 1V7YA 3MKVA 5MKGA 2QJNA 1X6NA 3WQ4A 1IR1A 3VC6A 2HVMA 3T6CA 4AZ7A 3FA4A 1RQEA 1VBUA 1R46A 3MUXA 2O4MA 5EFFA 2OQYA 3QV6A 4ADUA 3S42A 2Z1VA 4MUPA 1OC5A 3CZJA 3ALGA 4UMCA 1FEAA 1A49A 4PSPA 3L5AA 4H4QA 2NQ9A 1WXJA 3WD2A 3L9CA 5D09A 4LBRA 3O6CA 1Z48A 3TCSA 5HWMA 1XLLA 3ID7A 3EOOA 5M5DA 3VNJA 3P3BA 4TMBA 1NOUA 1I2PA 1XCFA 3VNYA 1NTHA 4CUCA 1EZ2A 4KWVA 4XSLA 2ZRWA 1JZ5A 3OGVA 5EGRA 1JZ7A 1WZLA 1RK6A 1XYAA 5AFDA 1ZY9A 3LTYA 4WDTA 1T99A 2WMFA 3T08A 3DH9A 2H6RA 4JIIX 6PTDA 3GU9A 4RNIA 3MO4A 1W17A 3B8WA 3BO9A 2WM1A 4JTQA 3N2CA 5CBIA 3RM9A 1PTAA 1IR2A 4EF9A 4NU7A 1FWDC 3DDMA 4MF4A 3AXXA 4PUNA 3QOMA 2WCAA 4OOZA 4BF5A 1KXTA 1HJXA 1SR9A 4O4WA 4PUMA 4EWND 4NNCA 5CGQA 4C6MA 1ITQA 4HU4A 4C7FA 1FWWA 4GY1A 1O12A 4OZOA 1M7JA 1XISA 2XIQA 3P84A 2YZ5A 2VD9A 3W2UA 3PBYA 3QGAC 2E3ZA 2P3ZA 3AUJA 3K5XA 3Q94A 4DZIA 2WMIB 1XHGA 4KCTA 3W38A 1GV4A 4MM1A 5FSDC 3VDCA 1A5CA 1TV4A 1OT1A 1NIUA 3GKFA 4EQRA 1Q85A 1Q65A 3QFWA 1UA3A 3SADA 1QI3A 2QCCA 5GNXA 3DGZA 4LW7A 5JUVA 5DF0A 5KZEA 1HKVA 4M51A 1MUWA 2WSKA 4XD6A 4D8AA 1R3YA 3E1F1 2J74A 4WJXA 5BXTA 3LHTA 4NILA 3WLMA 4GR1A 5CLTA 4Q8UA 3O16A 2J3NA 1SFSA 4FIRA 2XFWA 3CGEA 5I3DA 5FACA 4XIAA 4WQ6A 1UG6A 3MMUA 3RNMA 4TVCA 1UASA 1QU4A 3TN5A 1PDYA 4ATDA 4O13A 2V5CA 4O15A 3C8NA 3QZAA 4AYGA 2DW7A 1F07A 1EXPA 2XIBA 3L4XA 1P0DA 4TO8A 1BFNA 1RD5A 3B9AA 1HIZA 4TVUA 3H2AA 1MYRA 3FXYA 3IJQA 4YYCA 1JAEA 4H9ZA 4QDWA 2FDMA 5CBBA 3ZVIA 1C7TA 2XN0A 2Y4SA 1Q7QA 1RPXA 3DC8A 4CQ8A 3EWCA 4DJED 1RBLA 2GL5A 1LL4A 1S5NA 2ZUVA 3ISIX 2CU0A 4XUYA 3N14A 4UNKA 5M3WA 2BP1A 2WAGA 4ICMA 4QDMA 3EXRA 2WB5A 2X8GA 1SJBA 4NI8A 1M3UA 2WZMA 5TD4A 1EF3A 4GX9A 4TOQA 2B81A 4GG9A 3M0YA 4DYJA 3UPBA 2VFEA 5TF0A 3EKZA 1YHTA 3L8KA 3GIYA 3WX7A 3LXBA 4HHMA 3WJSA 1IYXA 2G3JA 2RUSA 5DRCA 3L4YA 1KRBC 3RDKA 1EYEA 1Y5WA 3W2KA 4GNVA 2QDEA 3VTRA 3WF3A 4NZFA 3SRHA 1G01A 4UFJA 4WIWA 4F0MA 2OXNA 2PU0A 2HXUA 4Q8NA 3VOHA 3QZ6A 1O7AA 3ANUA 4B90A 4O10A 4RXFA 2XFFA 2ZWZA 3KFTA 5D38A 1DV7A 1NDYA 1E3ZA 3ES7A 1H1YA 4C6CA 2ODOA 2CHRA 3M41A 3OOQA 2BC0A 1V3MA 2DUAA 3UJFA 1XH1A 4H4YA 1JFXA 1O5RA 3MVIA 1FCBA 4YXGA 1N8FA 3KCJA 2QPSA 1EWEA 2PWEA 3H8AA 1G7UA 2HXTA 5CKSA 1E0XA 2AMXA 5CAHA 3HRDC 4Z2IA 3BW4A 1XSIA 4KS0A 1T3QC 3NS1B 3H53A 3NNTA 2QCNA 1NP0A 2D3LA 3P0WA 3M07A 4H6EA 4XZIA 4CQAA 2E6YA 2W4XA 3GRTA 3K13A 4QLJA 5FS8A 1U30A 1DWHM 2FIQA 4FNTA 3PBGA 3VNDA 1Q2RA 1X38A 1UJPA 1BTMA 1YPFA 4LC8A 5A6TC 1ELSA 1DP0A 3O1NA 2DT3A 3PPCA 2FVKA 3ABOA 1QW7A 4BEUA 2YXXA 2Q71A 4AH7A 3TW6A 3CQKA 1XH2A 2YSWA 1TV2A 1ZBCA 4MTVA 4RUBA 3NL2A 4RDZA 3QH2A 1NWSA 5M2FX 2ZA3A 4EPEC 2E4TA 1V7AA 3LHZA 4LVGA 2XSAA 4AXNA 5KZMA 4MJ4A 3Q2DA 1A5SA 3IEBA 4A22A 1Z8AA 1RA5A 3P0XA 3UW6A 3W6LA 4ZQNA 4MAVA 3G1AA 1YIXA 5HQMA 4QG9A 2PF8A 3TC7A 3B9JB 1JCYA 5LIKX 2HSAA 2QAFA 3TAKA 4W4QA 3VOGA 1MOKA 1XRVA 1CEOA 3A6OA 4ASTA 4AWUA 2QPXA 3KS5A 1M04A 2DVXA 5BROA 4X0VA 1M65A 5EY5A 1ME7A 2QCEA 3A24A 3WBAA 3KRSA 2VEIA 3MSRA 2FPVA 4AD5A 1FRBA 4UTUA 4DRSA 1BVNP 5I02A 2Z4GA 3QPYA 1JD9A 5GQBA 1KA9F 2I56A 3UWZA 3TFCA 3HURA 1LUCB 4CLMA 4EM4A 1FFVC 2WZHA 1KRMA 1G4EA 1G69A 3UF9A 2YYUA 2GGIA 3UWEA 3GDTA 2YL6A 4L6DA 1L6YA 3A13A 1SM9A 3VIFA 4A3UA 1ZKQA 1QNQA 4DWDA 1PV8A 3E6EA 4PUKA 3IARA 2WMJA 4XBJA 3RCYA 4M7SA 3K1DA 2BGNE 1EIBA 4F40A 1I60A 1V6TA 3OZPA 1TELA 4JQ9A 3EX2A 4CCEA 4IXXA 1V3HA 1W2VA 5K7JA 3THUA 1VLWA 1VFFA 2JALA 1TR9A 3LX9A 5I07A 4F0RA 4HB7A 1JRCA 3HBLA 3VUSA 1LORA 2B0MA 2XM2A 5HA7A 2BASA 3CHFA 4ATWA 1W54A 5HMEA 3IVSA 4H4UA 1P4CA 4E2DA 1DYSA 3M0XA 1TV3A 4NJGA 3R58A 4DPQA 1ZS2A 3BLLA 1UP2A 4CNTA 4UIOA 3MI3A 1EB3A 4ZENA 1R6WA 4WCJA 2Y63A 1UYQA 1H6VA 3LHWA 2WHMA 3DFTA 3UWQA 4C5ZA 3GFYA 1KBLA 1ADDA 3T78A 3DYPA 1PZ0A 5A95A 3N13A 3HMJG 3KWXA 3ZWTA 2H3BA 3QMSA 1WKEA 1Q1RA 3LUTA 3BG9A 1D7YA 2ZTJA 3WQOA 2W92A 1FHUA 3NFUA 2XTKA 4DBSA 2EKGA 4K36A 1Z69A 1RP8A 3FFSA 3MS8A 2OODA 2R24A 3UZXA 5DELA 4BFAA 1M6JA 5BNKA 5IBXC 5G1TA 1R9ZA 1RV8A 5B80A 2CLMA 1MNZA 4AF0B 4ERAA 1KBIA 3WD1A 2E9LA 3G1YA 4NF7A 2Y1HA 4AMAA 4UUIA 3CIVA 3ABRA 3QTPA 1GRTA 1V0NA 2A0NA 2C79A 2IKHA 2FHCA 3O6DA 1OF8A 4KFNA 3ARYA 2OOGA 1P43A 4S3FA 4S38A 4J3SA 4DAFA 1X6LA 1X97A 5BU6A 1E56A 3W7LA 4MY9A 2FJUB 1JCTA 1FHDA 2HK0A 2IUZA 2A3LA 4H8UA 1DJXA 1QNPA 3EPNA 1J96A 3NAVA 4PZVA 1VDVA 1QNSA 3IANA 4JQAA 3VA8A 4P5UA 2WQDA 1JIBA 2PDNA 3E0WA 4N7QA 4XO6A 1XBYA 2X0YA 3VIHA 2I57A 1CLKA 1EJVC 3ZQ9A 3VIGA 1Y8BA 4LCRA 3WG6A 4HOZA 3B03A 3AJXA 1TPFA 4FB7A 5FS7A 3QY8A 1UWUA 1P1XA 3THAA 4Z2JA 2YDAA 4FPSA 4IISA 5CCZA 4D9PA 1AQMA 3BXWA 2DVTA 5L6UA 3ZSTA 1E1CA 3PZNA 1GESA 3WNPA 4ICNA 2ZDRA 1WKYA 1BLIA 1GGOA 2QDDA 3U7BA 2CBJA 1Q1WA 1B0IA 1AA1B 5JCNA 4C7DA 3QW4B 4BR1A 3V18A 1QR7A 4IT1A 2RAGA 4YYFA 1RA0A 4W5UA 3EMQA 5CZSA 4GI4A 4MY8A 1EJRC 3RR4A 4J3WA 3EAOA 2V30A 5MHBA 3E96A 5A5WA 3CUIA 2C0AA 1TUFA 2W79A 2INEA 4YLWA 1H7RA 5DANA 1UR4A 1BYBA 3GM8A 2QUVA 3LBMA 2XWDA 1JF6A 2VCBA 5EL1A 1E1FA 3NL3A 1QNOA 2BVTA 3VDAA 2OT0A 3BCDA 4LC6A 3H7RA 4NNBA 2VKZG 4WD0A 4XAZA 3R8HA 1UZDA 4S3CA 2DORA 1KD0A 1VPXA 3AAMA 2GWNA 1R7OA 2RH9A 5REQA 4CQDA 3WH8A 3ABZA 3I6EA 1I45A 2BFGA 3GXPA 4QS5A 3NQ7A 3BVJA 3NQ6A 3SUWA 3PF3A 2YCLB 4JY9A 4IMGA 4A2RA 3RLVA 2XU2A 4XAFA 2XSBA 1VGAA 2O92A 3HF3A 3KE0A 4JGDA 3O63A 1LJYA 4LUSB 4JIRA 3SURA 4HNUA 3UA3A 2QVHA 1K3UA 1PX4A 4RLIA 1S5WA 4LVDA 2ZUMA 3WDIA 3A5VA 3SCNA 1XJBA 3W02A 4IPNB 2BX7A 3UVAA 4NT0A 3URNA 2IPWA 4QEHA 3PHAA 4MWAB 4GBUA 1SSDA 3L0NA 2CCRA 3A9IA 3UXLA 2PMQA 4MPQA 4W86A 3W74A 4MVAA 4AU0A 2Z1XA 2DJXA 3UZZA 3AHYA 3TW7A 3V3WA 3P60A 3ZMRA 2ZADA 2GSJA 2VFFA 4PCFA 3TWAA 3EOUA 1H41A 1BTCA 2NQZA 3CV1A 1CPUA 3R12A 5AHLA 4H6QA 1HKWA 4D6DA 1JYWA 3DHFA 4GE8A 3F5JA 3G0XA 5BOOA 1OINA 4JYDA 1PSCA 1EGMA 2Y8VA 3CMFA 4G56A 1OK4A 1BZLA 3TLLA 2W3ZA 4GO9A 4O1DA 3FYOA 4ZOHB 4NUWA 3Q6JA 3D46A 3ZT6A 4K3ZA 2NQJA 2PDMA 3BL3A 4ZSTA 3FY1A 2HE8A 5D2WA 3EOLA 4XZMX 1K02A 1EHNA 3FA5A 4L9YA 4WVXA 2F2KA 3LBCA 3V7PA 4X9YA 5BXRA 4YCOA 3VD3A 1UQYA 1H5YA 4K8DA 4U33A 2YOCA 2YAUA 1H60A 2WNZA 3MQTA 2OWCA 1UIPA 4IWWA 2WQPA 3O9NA 4XKYA 4HGXA 1UCWA 5AC4A 3MT1A 4L4MA 4MSSA 1GVSA 3CUHA 1E1EA 2DW6A 3S9IA 3R1ZA 3W7OA 4WKAA 1QW9A 3KAOA 3AIUA 1AD1A 2NT0A 1IEVA 1RBAA 1CTNA 6CGTA 2QPUA 2VD8A 3PPFA 4AVNA 3HGJA 1QK2A 1O4UA 3GNDA 4PB4A 1RBOB 4GI9A 4Q4MA 2UV8G 1VFHA 1XKJA 2JBMA 4JFTA 4B92A 3SAZA 1B3XA 3M5ZA 1BKSA 5FAJA 2PLKA 4FXSA 3BUVA 3CH9A 2YYTA 3CUGA 3WLLA 3OU8A 2QYGA 4IGSA 4JICA 3QMTA 4E4UA 1KXVA 2JEPA 3NGFA 4EWJA 3W72A 2PURA 1J0IA 2QJIA 3WFLA 4MB5A 3SW6A 4UR8A 3KCLA 4Q33A 3S0CA 4TV6A 1G7VA 4B9YA 1H62A 2PRHA 1UWTA 4UMAA 4S3JA 4Z1DA 1Q8AA 2C13A 3QQ0A 5T9CE 3FCPA 2PTXA 3J7HA 3TFXA 2NV2A 2OELA 5DMNA 3WUGA 1S2VA 3WK2A 4U3AA 2ZZ4A 3BPWA 4MJZA 3G1SA 3TYDA 4YWIA 5BW6A 4H8NA 3ARXA 1BWVA 1X2HA 3W7QA 3AMCA 5D03A 2XZ7A 1JF5A 4MFDA 3C2FA 3DG7A 3GXTA 3MP4A 4KPRA 3VKDA 4JIQA 1SZEA 3TWBA 1YDOA 3MANA 5LNVA 1I9CB 3IWPA 3I4EA 1TTQA 3NZRA 1WDWA 4LAZA 2PLCA 3QV7A 5GNYA 1MW2A 3RU8X 1O68A 4M3PA 1NDAA 2OLHA 3BG5A 2P88A 5D30A 4G6CA 1WAUA 4J7RA 4WOZA 1J11A 1E40A 3VGHA 3P14A 3NPUA 1VJIA 1XLDA 2QF8A 5C70A 3E2RA 3I10A 5CZJA 3ICJA 4QFUA 4N9CA 2EQ8A 4N6FA 3LXAA 3UXAA 1KLYA 3CAVA 1W5MA 1YTEA 1E6QM 2VTFA 3EX1A 3P67A 4X60A 4HPXA 2Y88A 4IGNA 5HQLA 3UPMA 2W0UA 4PMXA 3AXKA 3KDNA 4C6BA 1VFOA 2FYMA 3KOYA 1TE1A 4MLJA 4GFSA 1RCXB 3SUUA 4JR5A 3SJ3A 1CX9A 1A0EA 4H83A 3XISA 3WELA 4MUZA 3KBVA 3HPXA 2QV4A 1FUYA 2QCMA 2XGIA 3WL1A 2GFTA 3UCQA 3OZOA 4PTMA 2F8QA 1O1HA 3UG8A 2GVYA 1KRCC 1SJDA 2GJNA 3S5OA 3IC9A 1HO1A 3CV7A 3E74A 4AHQA 5LGXA 4JTHA 1H7PA 4AY8A 3W7EA 1FWBC 2QCDA 3LV5A 2ZUUA 3TNBA 4H2HA 4PMOA 1KN0A 4D8ZA 2O9TA 3VX0A 3PSVA 2A3CA 1TPDA 4HHHA 3PUEA 2AL1A 1REQB 3W25A 1J01A 3JUGA 3H6OA 1DQXA 1DIEA 3B0UX 4I3GA 4TVDA 2VL4A 4IPIA 1V5XA 1UR3M 5I00A 2D2GA 3WIJA 4HCLA 3PFMA 2ZA1A 3DENA 1NHRA 2PCEA 3U2OA 1B31A 3LERA 2V3AA 1BYCA 4MIMA 3OHMB 3AROA 4MGGA 5KITA 4PSRA 2V3EA 3AJ7A 4XWUA 1ZAHA 2XN1A 2FJKA 3MTWA 2PDWA 2A21A 1V6WA 1TJ1A 4OT7A 3WQWA 3U0HA 2GR2A 4UMBA 4MJ2A 4J57A 1X8CA 3VZXA 1GWJA 3W27A 4PTNA 2HQMA 5AECA 4WJEA 3W7DA 3REQB 5H2ZA 1BVWA 1F6PA 1TB3A 4FXFA 2F6UA 3SECA 3CL8A 3ZT5A 1J0JA 2ACSA 1J0HA 4DM2A 1XIJA 3M1ZA 1Q6EA 3G3MA 2NT1A 2PD9A 3LGEA 2OEKA 3RIKA 1LRTA 5AHIA 1ICSA 2VZSA 4C1NB 4HA0A 1V0LA 3BLOA 3B8VA 4M0XA 4Z17A 1EEPA 1FWSA 2YVGA 3K8LA 3PY2A 2ZKMX 2EJAA 2IKJA 1J5TA 4S2CA 2Y24A 1QT1A 2YL8A 1EP1A 5C2XA 5HBFA 2CZDA 3O0KA 3ITOA 3VYLA 4YVVA 1EC7A 3V1PA 2WOIA 2E25A 3GTFA 5DX7A 4HSOA 3BW3A 4CEUC 4KT2A 4J40A 1NF0A 2MANA 5GJPA 1OEPA 4WY0B 4I5UA 3IV3A 4LAOA 3UEQA 2YQUA 4KFOA 1RH9A 4CQ9A 6REQA 1F76A 1UJQA 1C93A 1W91A 4LAUA 5DFAA 1A3XA 5A3HA 5HPCA 3L5LA 4KW2A 2X1SA 3VMPA 3E0IA 4BF7A 2DSZA 3VE9A 4FNRA 3EXSA 2FZDA 1F7BA 3GH7A 1QDSA 1BWKA 4O28A 3KVLA 2WJDA 4EMWA 3W00A 3PP7A 2VXNA 5CC5A 3M44A 3OVQA 3I6TA 4IFKB 1CT5A 5LNUA 4E2BA 2AQVA 3B8UA 2BGQA 4H00A 1JCJA 3KLLA 2WOWA 3OIHA 2TYSA 3M0HA 5LXXA 2WJEA 1HL2A 3ITXA 4M1BA 2J27A 4AHPA 3C0JA 3QV8A 1D8WA 2H8XA 1OYAA 1LL6A 1GVYA 3HV9A 5EU9A 4AZCB 1QHOA 4GQBA 4DJFD 4JPGA 4B4FA 2CFYA 1MFUA 5IM51 2PZNA 4GYFA 1JRPA 2D24A 4XD5A 2WWDA 3IJDA 3W7HA 5G2HA 3B8DA 1PIGA 1F4AA 1OCQA 1EDTA 2JKAA 3R8RA 4ZE4A 3W7JA 1HKIA 2J7FA 1VKFA 3V36A 1WNOA 2GQ8A 2O56A 2C3CA 1VFSA 1VCVA 2JGYA 4I5RA 4HN8A 4UFIA 3MKCA 3ELFA 1D8CA 5F1VA 3M0KA 4W93A 3WQCA 3G1RA 3SN4A 3CWOX 3W29A 3NOYA 4DJEC 4ROPA 3S2NA 4ZOEA 3EKGA 5CGMA 2ZTKA 3WDHA 1PUDA 5IDIA 2BGSA 4S3AA 1GOXA 4GYJA 1V03A 3LCIA 4JCLA 4H4PA 4AXKA 3WK1A 3GVGA 1QO2A 3UWYA 4J1OA 2PDGA 4TTGA 3MJYA 3W2LA 1XSJA 5CG0A 2GR0A 3OTRA 4U5IA 4QS6A 4J3TA 3SN0A 5F2MA 5C0QA 1HTIA 2ACRA 2Z00A 1B30A 1HO4A 3NVVB 3U4AA 4M6VA 3WLRA 2AL2B 1KNWA 4QP0A 2R91A 4LOCA 4CCCA 3NSMA 4UZSA 5I3IA 3KUMA 2W67A 2VZTA 2NW0A 2PGEA 3E12A 5T9BG 4YPJA 1K6AA 4WF7A 2Z2BA 2YLAA 4B5SA 5IBXA 3HGOA 3PUDA 4KWWA 4WDUA 2W55A 3QY7A 2EGZA 3MWCA 1FH7A 5CEWA 1ADOA 5EYWA 3HQOA 4R3UA 1TQXA 2AOSA 3GNPA 4EE9A 1OG6A 3Q67A 3FHQA 3D3FA 3B4UA 4NVTA 3WK3A 4DJDA 1KKRA 4F66A 3DFNA 3TYZA 2H90A 4EAYA 3GS6A 1F3EA 4JAWA 4C6QA 1VYRA 3T8LA 1W5QA 4XZ9A 5FF4A 3M0MA 4ES4A 3BURA 1G4TA 4AD3A 2YPIA 3TTOA 4BCEA 1VYSX 3JS3A 1IIGA 1WPCA 2IPGA 4LSBA 3NQEA 1E43A 4AZIA 3TN6A 1ZSXA 2TMDA 3BLKA 3BZGA 4ZQPA 5C7HA 2ALDA 3ZJKA 2WK2A 1QBAA 2DSKA 1WV2A 1Q4NX 4BQ5A 1MZRA 1WXYA 4NX5A 2OQLA 1UP0A 1Z42A 1W5OA 3ALFA 4MHBA 1XICA 4HA4A 2V6AA 2G3IA 2CZVA 2NXIA 5XIMA 2V63A 3M46A 3FA3A 3WF2A 4E8CA 5G1MA 3G0UA 3E0LA 4BI5A 1I2QA 3AWOA 1H2JA 5JBFA 6ALDA 3CAKA 3SUTA 1UUQA 2CLLA 2PDKA 4ML9A 3WSUA 3UBPC 3WEOA 1H7OA 3L23A 1DNCA 2BHUA 2ZZ2A 2BOGX 3FEMA 2IS7A 3GG1A 1M7PA 4QJ1A 5A2BA 4AISA 1C7SA 4JQ4A 1F3PA 1RR2A 1FWNA 3MI2A 3ZSSA 2V38A 3QYQA 4MDOA 2PF0A 4WLCA 1PTGA 3KOFA 5ABFA 3NQCA 3H2FA 3BOLA 1VCFA 1H5VA 4QJ5B 2WLZA 1JYXA 2O55A 3P8JA 3G1VA 1IWPA 2X2GA 4O1BA 3LRLA 3RCMA 3PZVA 2XIJA 2DSWA 1BGAA 1D2KA 1WZKA 4O52A 3QTGA 5ABTA 1TPVA 1LOLA 2PWUA 3ZS4A 3R13A 1XYLA 1KV8A 4YJ5A 4QLKA 4HK5A 3BCJA 1UR1A 3B0PA 4UZUA 5M03A 3DUGA 3N6JA 3DFOA 2QMJA 1I2RA 2VGIA 4IUGA 1OFRA 1D7KA 3DK8A 4IIBA 1Q13A 2HWGA 1DXLA 1TPEA 3ERPA 4R7WA 4ZL1A 3LADA 3LA4A 5AC7A 1CGXA 2J13A 2ZICA 4F8XA 3AMKA 2BXVA 3VGGA 3A3XA 4M56A 3AXIA 1RM6B 2J8GA 2WO5A 1R3WA 4ACZA 3D47A 1WDSA 2WPCA 4UFHA 4JNZA 3WK0A 4DIAA 1OIFA 2WOQA 1TR1A 3P74A 4YNGA 1B5TA 2OOFA 3M4HA 1XGEA 1I6NA 3KVMA 2ZA2A 4HJFA 4POCA 4R9XA 1OIMA 3VFCA 2C71A 3WUEA 1AJ0A 4W7VA 5JCMA 3PTKA 5ABHA 4W8LA 4PTXA 1DWAM 1HJQA 5FEWA 1OY0A 1BRLA 1YMYA 2O0TA 2X1UA 4H6RA 3VK5A 5I5RA 5HR7A 4US5A 4UQ9A 1PS9A 1W8SA 1Q5MA 3ZOAA 2VVSA 3T4WA 1LQAA 1QTWA 5HWNA 3N25A 4YTRA 2NVAA 1K1DA 1A0CA 4B16A 1YADA 1OG0A 1TA3A 4UQEA 4GZJA 4JTKA 1EZWA 3O15A 4BI6A 2E6DA 1JCNA 4PUWA 4IHCA 3CHEA 5KVHA 3AXHA 1WBJA 2PTZA 1HL8A 1V3IA 4ICCX 2OVLA 4HNCA 1F3TA 3PBVA 4IG2A 5D2VA 3CHCA 2XHYA 4HVXA 3FHAA 2ZYFA 3SFWA 1W5NA 3GG7A 3MUZ1 4JCMA 1GG0A 2DUZA 1LQ2A 1XLIA 2WPFA 4XZLX 2FPTA 1JL8A 4J2MA 1E4IA 4B91A 4H4VA 3KP0A 3T0CA 3U4FA 3S5SA 1W5PA 4MNJA 3NQMA 3C61A 4NAFA 2VR5A 4GH1A 3EA3A 4Y7EA 1JUBA 1BAGA 3P82A 4DWSD 2EG6A 1TO3A 4QIUA 3RXZA 1GW9A 2QUTA 4GPNA 3S2MA 4LYPA 4V28A 3OPSA 3VINA 3K4DA 2DV0A 1DE6A 4LEQA 1GJWA 4QNEA 5A6BA 1IXQA 4G7EB 1L2QA 2VZUA 1IGSA 4DZHA 2GVEA 4E2VA 2FMNA 2WYSA 5CPTA 4URIA 1RD6A 1VEMA 1V02A 1NM9A 3T81A 1UR2A 1FA2A 1WOAA 4E5TA 5RUBA 4C60A 3VKAA 4IGHA 4KIEA 2X8HA 1QPKA 1L6SA 3GB6A 1P0NA 1AH4A 4GXPA 2XH2A 3L4TA 4QLLA 2GOKA 4DVOA 4HN4A 4JIPA 1VP5A 4YTTA 2OSWA 1XINA 2DZUA 4DF1A 1T7LA 1GW1A 4GCXA 4Q4QA 4FX8A 3VOFA 3WBWA 2TAAA 4I9MA 3AS3A 1P0BA 1U1JA 1IZJA 3A9BA 1B3OA 2EPNA 3I65A 3ZYZA 4H50A 3VOIA 5I3JA 4JS3A 5FSEC 2PTYA 3UYIA 2ZZBA 2Q3RA 1VZWA 4PMYA 4GD0A 3ZJ7A 3M7WA 2G3FA 1YDVA 1EXBA 3W1QA 1HP4A 1AH3A 3CO8A 3PBWA 3AZTA 5JIPA 4P8UA 1BXNA 3KL5A 4JTRA 4ZA0A 1XLBA 4M6QA 1ZY8A 3L4VA 2WPEA 5DXYA 1CIUA 1GJPA 3ARVA 3H2OA 5AC5A 1ZENA 1DHPA 4KWSA 3KTSA 1OK6A 1XGZA 3M0IA 1OBAA 2BG5A 2RDUA 1S2AA 3BAIA 9CGTA 4A3RA 2V0TA 3GHTA 4PN2A 5U4NA 2JK2A 4L61A 2R1NA 3DH7A 3TAOA 4O0KA 3GG8A 1CECA 2NVCA 2NX3A 2WZTA 1V3JA 1XLCA 4A2SA 3W2JA 2INFA 4F0SA 1KR0A 4TIMA 3BCFA 3ITGA 2XVNA 4LYRA 3S2LA 3BE7A 4NJJA 3LLXA 2GJLA 2ZZCA 2DT1A 2VEPA 2J4GA 3DFSA 5FAGA 5TAOA 2VX6A 3NQFA 4Z1BA 3W7RA 3BMWA 2Z26A 4IX0A 4NAEB 4IQDA 2FHFA 3EBVA 4O19A 3VMOA 4KRTA 3B3DA 4PUJA 2OYMA 2WNWA 1EC9A 5A6SA 3W1TA 4WDWA 4N4PA 4UCGA 3G5EA 3FKKA 1YQZA 4PUEA 1J79A 3THCA 3NQDA 4B5UA 1XG3A 4E0CA 3D9XA 4GNJA 2RABA 4AVFA 1LF1A 3S5ZA 3ARQA 5E0CA 2VR4A 4DX3A 4C6OA 3EDDA 3WLIA 1N62C 3AI0A 1KQYA 4GYPC 3QHOA 3WLNA 4B4HA 4HNVA 1XC6A 5D9NA 3MHUA 2X1TA 2W5FA 5I3HA 2QVNA 4H9UA 2GUUA 5EMLA 2E6AA 4YS1A 5D9OA 2YCJA 3SCOA 4H7ZA 3VNMA 1DL3A 3PULA 2XZ9A 1TVLA 1DWIM 3ITVA 2OEMA 1E5JA 4NX0A 1UZ1A 2F2HA 1EIXA 2QCFA 4GQGA 3GDMA 3TOPA 3FSUA 5CBJA 1GQLA 2C1IA 2AKZA 3I68A 4NJIA 4IP5A 4Z1CA 3V4BA 4JTUA 4NEVA 2VC7A 1WB0A 1XP3A 2PLJA 4FNPA 3Q37A 4E4PA 3QGVA 4ZQCA 2WWCA 2XGBA 4LTSA 4ML4A 3ABXA 4H1ZA 1R0MA 4X3ZA 2PI6A 3R5EA 1AW1A 2BV9A 3GXFA 1B4EA 3W6MA 7ENLA 2G0WA 2PEVA 4GC3A 3F4VA 3LG3A 4B2DD 3F1QA 2J6XA 1ONFA 1TPC1 4O54A 3CZGA 2QT3A 4Q4PA 3U6WA 1UROA 1W1IE 5LIXX 2YVJA 1RXOB 1S38A 1SSGA 2W61A 4GYKA 4UTIA 1QRQA 1QNVA 1BKHA 2VOMA 2NPXA 3VNLA 1JGMA 4C6LA 3ES8A 3TDFA 4B5VA 4L80A 1V08A 4NG3A 5HMSA 1W6TA 3BLPX 1HFBA 4OUEA 1BYAA 5CZKA 2WCGA 2TSYA 1G6CA 1TTJA 1Z7AA 2BBFA 3T0DA 2YA2A 3K46A 1PKLA 5HNTA 1VEOA 3HGRA 3HW2A 1H61A 2WM0A 4QE1A 1E3XA 1PIFA 1Q3NA 2CHOA 4FAMA 4HCHA 3UA4A 3CB8A 2FFIA 4APNA 2VOTA 2OGYA 1V0KA 3TYBA 2VZVA 4PL1A 1IGWA 3WNLA 1BSIA 2XVKA 3PTQA 1KW1A 4CD6A 2JIWA 1Q2SA 1VYPX 1KBKA 2XM1A 2FZMA 5J5DA 1UMYA 3F7JA 3UNTA 3S3GA 5EBAA 1OABA 2ZUSA 1DQUA 5TNVA 5EKYA 1VC4A 2IKIA 1TTPA 4A8LA 4REQA 2QCGA 4F0LA 4YHEA 2X0HA 3SO7A 3GXNA 5EA9A 3RM8A 2V5LA 2P50A 2Y0FA 4ROQA 3I7RA 4FLRA 1CI1A 4F4RA 3AYTA 3LTPA 3W76A 4P61A 4LY4A 3BTNA 1JDEA 1T5AA 1GETA 5T26A 4HP5A 4W7UA 3M64A 4XZNX 3AM9A 4HNLA 2V2DA 3RO6A 3TYEA 1UR0A 4N42A 2ZZ5A 2I7GA 3NGJA 5FJRA 1QHPA 1XBVA 2ADAA 1ADSA 1W2PA 2X0SA 3M9YA 4UXDA 1LQ0A 3N11A 1I2OA 1QO5A 1C8QA 1KBBA 1OFEA 3PG6A 5E93A 2FQIA 2J9ZA 4LEFA 3WMSA 4WR3A 2HPIA 1T0OA 5ECUA 3TJ4A 1V0MA 4C6EA 1F9CA 3KRZA 3TTSA 4BA0A 1GNXA 1XRSA 2IQ0A 3KLKA 3WO8A 2QGHA 4XV0A 3L0KA 4JN8A 1F8WA 1BEUA 3A5FA 1JZ6A 1BGGA 3H21A 4PMRA 3RU6A 5KMYA 3VNKA 3UG3A 4L7ZA 2I1OA 2OZTA 1HP5A 2Y6ZA 3GDKA 5GRTA 4KQNA 2OZ0A 3BWWA 3A47A 4ADSA 4M80A 1JPIA 1L8NA 1UUMA 4AZHA 2QUMA 1S7MA 2QR6A 3OA5A 3MZ2A 4LRTA 3CWHA 4F0KA 1EBGA 1IWAA 2OZ3A 2NSXA 8TIMA 3DZ1A 1FDYA 4CEXC 5A6LA 1QXLA 3S1VA 2D20A 4GINA 5D9MA 4F0HA 1T40A 5BRBA 5LA1A 1SPQA 3VIPA 1U22A 4HSNA 1PTDA 3K1GA 5D2XA 5EMJA 3SR6B 3MUAA 1XIIA 5SWUA 3WNNA 1EEXA 3WJXA 1CXKA 4UTWA 4C65A 4LX4A 1GOWA 1OC7A 1ZJHA 4L9ZA 3TXZA 3EPOA 3S2JA 3TSDA 3QHMA 5IHRA 1Z41A 3NDOA 3ZR5A 1MO9A 3WEZA 3VGDA 1EJSC 2ZQ0A 3TYUA 4XAPA 4H9MA 3MW7A 2OYLA 1ICQA 4Q8TA 2V9DA 4JD4A 3AYVA 4JTEA 4HU8A 3W1NA 3S47A 4HMCA 2KAUC 1N2VA 2PP1A 2O7SA 5LNSA 2CKSA 3SIZA 2XH4A 4JTGA 3TE9A 1L8PA 5HUOA 1SW0A 3PZGA 4CU7A 3CHDA 4IIGA 2WMIA 4TQTA 2VFIA 3UGVA 2ZC1A 3F03K 2X2YA 3TA9A 4QISA 3VDBA 4ZOCA 4EX4A 4WXYA 2BWGA 1NFBA 4JQ2A 3P61A 3CGBA 3WENA 4AZGA 5EMUA 3N4AA 1GZGA 1P7TB 1M6IA 3H4GA 1JDDA 2ZX9A 3B06A 1PKYA 2VT0A 4PYSA 5E0KA 2IPFA 3B8TA 4HNTA 3QPZA 3W7KA 2WOVA 3AN1A 4CU6A 5A2CA 2D23A 1V6XA 2HE5A 1KFBA 1RJPA 3L0GA 4IUOA 4O8AA 1GTEA 1EDGA 2EAWA 3WMLA 4IMEA 5HNRA 4EPBC 1FO4A 2CBUA 5I3KA 2BMBA 3GO2A 3CPUA 3CU2A 1O5KA 1JYVA 4YVXA 2XVPA 3U3HA 3MPGA 2A3BA 1HGYA 1UUOA 2CXEA 4X22A 4E38A 1HXJA 2B7PA 1KM4A 3VC5A 5F2LA 1Q63A 3GIPA 1P6BA 3FKRA 1LRNA 3CUZA 3T42A 2GWGA 2X30A 4Q8QA 4PE8A 1E4MM 3U7VA 1JZ8A 3KBSA 1QJWA 1FHVA 4GI8A 1F74A 3L4ZA 3B4YA 3WLTA 4RXGA 4ZB2A 4UOQA 1DOSA 2J8TA 1VPYA 3VIKA 1GRAA 4GVGA 3WYZA 1WDPA 2WMKA 3WDQA 3ITCA 1JDAA 2KZHA 1KCZA 2E6FA 1MRQA 2CDUA 4RNJA 4WX2A 2GRTA 4OOUA 1GVIA 5CPLA 3C52A 3IIPA 5CJ5A 4PFMA 2G4FA 2H9AB 5K9XA 2BVDA 1W1VA 3M6YA 5HK4A 3P2VA 1L6GA 4I7UA 1VJSA 2YIHA 3SQSA 4DJFC 3V16A 1R2RA 1I4NA 1J12A 4GVFA 1ITCA 4Q4KA 3SCPA 2Z0IA 3PB0A 1PDZA 1X7FA 1AQFA 5F4XA 6ENLA 1XCWA 2XG9A 3GXIA 1KB3A 3GR8A 4DBUA 3NO1A 3MUIA 2TRSA 1XIDA 3OGSA 2DIKA 3VCNA 4OBRA 3LLFA 2QEZA 4ZBCA 3NJ3A 1RJRA 1Y65A 2GGJA 2GR1A 1TIWA 5HMFA 4UR7A 1VD6A 4EPKA 4Q8WA 3CEUA 1ECEA 3VD5A 4NASA 3VGBA 3EA1A 1W9UA 1MEIA 3HQNA 2VM8A 2GDUA 3HFTA 5EFDA 4Q4RA 4I8YA 4BS0A 1IXNA 2WSPA 4HA3A 1R47A 4X2PA 1J4EA 3C2OA 3HG2A 1LDCA 2PDIA 4ZTXA 1BVZA 2WJZA 3NUKA 3MMWA 3DEQA 4KGJA 5AYBA 3ARUA 1KO0A 1A53A 3GTIA 3U8GA 5DLCA 4LYQA 5A8MA 3MMDA 2V3DA 4O18A 1HT6A 1R3SA 5FL0A 3FVMA 4H04A 1YPXA 2ABAA 1ONEA 2NXHA 4LS2A 3LCHA 1KV5A 2YZRA 1ZX9A 3R8GA 1W56A 4AMCA 4D6JA 1EC8A 2VC9A 1RUSA 4IGMA 1DJIA 3Q4DA 3IUDA 4GQRA 4ORMA 2PU1A 1KM1A 4AHOA 1HJVA 4DB7A 5BU9A 5IOBA 3V5FA 4CQBA 4LIIA 4P2VA 1TMQA 4P7QA 3I7SA 1HQTA 1DJQA 1VHCA 1SO5A 3DESA 4U4MA 4BKNA 3NOEA 2XSXA 1TMLA 3UR2A 5T8GA 3M0VA 4GIYA 3AIBA 1N8IA 3VDHA 4UTJA 4A3YA 1VBHA 3SUVA 4NZ5A 1D3CA 3BGGA 5I2UA 3W82A 1UWIA 4GO8A 2NVDA 1HGWA 3C56A 1I75A 2V2CA 4O4VA 5K3VA 4C7GA 2BHYA 2X8RA 5FF0A 4UR9A 1SW3A 1POJA 2J24A 3F2DA 3RCNA 2J88A 1BWCA 2P0OA 3N9RA 4JTTA 4XZBA 4YHGA 4O1AA 2Q3OA 3W7GA 5DBTA 3MV11 3VNZA 4FR1A 2Q8ZA 3FN9A 3AZRA 2GPTA 1K8XA 3WQVA 2GUBA 3AXMA 2A3EA 2YKKA 1WE5A 1KFJA 3W71A 4Z2LA 3FOKA 4US6A 1YEYA 4ZZ9A 3TX9A 3B8IA 3AZSA 4FR6A 4ZQMA 1NOWA 4DQWA 4UQBA 2VQUA 1VR6A 2Y2WA 2GYIA 2RDTA 2A1YA 3SCRA 4ORIA 4IIDA 3N2XA 1LUCA 1CXLA 2YFOA 5CAKA 1YTDA 3CLMA 5GVJA 3U2EA 3BZJA 3GY1A 4R85A 5AHEA 4QJ4B 1XXXA 3ZLFA 4MZ1A 2OJPA 4UCFA 3QLDA 3EWBX 1HZYA 3HGSA 4ZVJA 5C9UA 2PBGA 2FKPA 4BQ2A 3PJXA 3T40A 3DI0A 1GREA 3PJTA 1EBDA 1GRGA 1XIGA 5FJTA 1NY1A 1E9ZB 1KRAC 1XWYA 2RKXA 3SIMA 1DWGM 3AYRA 2YLLA 1NDVA 1KCLA 3M47A 2ZZ0A 3HG5A 1KFWA 4H8HA 2OWWA 3PN8A 3W4RA 1F73A 1K8CA 1PCKA 3N73A 1UOZA 1MI3A 4FA3A 4OV9A 1XYMA 4FNUA 4JDYA 1P1MA 1K70A 1SQ7A 1XSKA 4Y9OA 5G4WA 4HZ7A 3EYPA 5C71A 1OZMA 3RM4A 2A8XA 3II4A 5CPSA 4UWMA 2DU2A 5HR6A 2OZ8A 1U5VA 5FJPA 2Y8KA 1LWJA 4DI9A 2POTA 2OG9A 3VOJA 5C2GA 3UERA 2OB3A 5LSMA 2HPMA 4A35A 2G95A 5I77A 4PEEA 4W7WA 3GU2A 2DDXA 1ZB5A 1K4GA 2A7PA 3GG0A 3TW9A 4XUGA 5LZLA 1WYGA 2Q09A 3IGHX 1W1B1 1XLHA 7XIMA 2OX1A 2AAMA 1RSCA 5I3GA 2X8CA 3N34A 3H2MA 3ITTA 1KM6A 1WDRA 2WNNA 2OYKA 3WDPP 4AF0A 5A69A 1PYFA 1B90A 1A5UA 1NP2A 2R9RA 4AIOA 3GD6A 3OO2A 3F4DA 1KM5A 3OLGA 2V3FA 3Q65A 2Q6ZA 3E5BA 3AO0A 4ZR8A 5EMKA 1R3VA 1ZJIA 3EKLA 4GZIA 3SCTA 2A7NA 3CQIA 1OGGA 5I0DA 1R7AA 1YNPA 1W1PA 1UWRA 1K7EA 3R10A 3KOWA 4JTSA 1W1TA 1PYMA 2Y7EA 2DH3A 4LV4A 1DXIA 1TYPA 3B97A 3G8EA 5GJMA 1GEHA 4MKVA 5CPNA 1FWEC 5D02A 1UC4A 4GYPA 3OHIA 2QHAA 5DO8A 3PG8A 4HPHA 3APYA 1G5AA 4MKSA 5CPOA 4ZO8A 3S5NA 3NIYA 1H0IA 1FBAA 4NEWA 3LM7A 4A05A 3AMLA 5FF3A 1P6CA 3RX4A 1RAKA 3GDBA 3DKJA 5LNRA 1HJUA 1GVRA 3QMRA 5FESA 1ZHAA 1KC7A 4KCWA 3EUB3 1LBLA 3OLIA 4WXZA 3TIMA 4Y9MA 4HYWA 3PZ9A 2KX9A 1LBMA 3G1DA 1YLVA 3GVRA 2J8FA 3LQGA 3QKEA 4H4ZA 2VVNA 4GH3A 2AKMA 2XIOA 1PJ9A 4IQJA 1FWHC 2C18A 3AICA 4FLSA 3WNMA 1AQHA 3FJNA 3PSWA 4DBEA 3T2QA 3W70A 1JG9A 2DZVA 3P6LA 2REQB 3ITYA 1SMAA 4DWSC 2VX4A 2NV9A 2J79A 3TN4A 1BYDA 4OQVA 4KWUA 1OFQA 3B04A 4KRUA 3SJNA 3ITLA 2PDYA 3ABQA 1E6ZA 2PRMA 3GFXA 3V1HA 4GXWA 4AEOA 1ZQ5A 1CLVA 4WY0F 1GKQA 2ISWA 3LI0A 5LHEA 4HQVA 2VUNA 4NYUA 2E3TA 2MUCA 4MADA 5D2YA 3MU7A 4ZB5A 1GYMA 1Y7VA 4GIEA 4LANA 5D04C 1XDJA 2A3HA 3WQDA 4RDYA 5DBUA 3MSDA 4ZEPA 5C9WA 3UXKA 1XGDA 3QEZA 2DPEA 1IEXA 4QE5A 1RQHA 3FNDA 2PAJA 3HM7A 3MVTA 3QF0A 1UKSA 1UKOA 4W8AA 2Z25A 4AX7A 3O2LA 2YCLA 3WL0A 3GFZA 3HN3A 4KEMA 4WOQA 3DC0A 2FVLA 3FAWA 5G2IA 3KP1A 2VC5A 2W27A 4OV4A 3IK2A 4LUSA 1ONWA 2PPGA 1UZ4A 3NO5A 6XIAA 2CBVA 2E5AA 4EF8A 1C9DA 1FXQA 4MWAA 4QSHA 4OECA 3H4KA 4QJ3B 3TTEA 4M82A 4KCVA 3IS4A 3UCDA 4PCPA 3WQGA 1LOQA 2DSUA 5E0FA 2PODA 2BS9A 4PMQA 3NL6A 2X16A 1GHRA 2J7BA 3R11A 3PZIA 3A7UA 1XYCA 2J6VA 1UW9A 1LTDA 2QCHA 3ARWA 3QOKA 2PWDA 3AYSA 4UNLA 1DQWA 1GJUA 1W0MA 2WBGA 4CD7A 4D2JA 4YVPA 1EJ7L 4IH3A 5TBOA 3ZO9A 1H7XA 2E77A 1N55A 1QASA 2Y7FA 1IHIA 4WRHA 1A47A 2QXWA 3CO4A 4R33A 4W84A 3U48A 1E4LA 3ATYA 4S23A 5FJUA 2YB4A 2VFHA 3B0VC 1TV5A 4RV8A 3S9ZA 1OFDA 3P7YA 2EKCA 2PC4A 4NIRA 3T09A 3AHZA 4AY7A 4C90A 4PBGA 1RY0A 4ENLA 4PH6A 3KVKA 5FA5A 3HPFA 4Z0JA 3WCZA 3THDA 1TX0A 1PX8A 2B7OA 4AZ5A 3EDFA 3UGRA 1CGWA 4ALDA 5FS6A 3EEZA 4J5NA 3PC0A 1PX3A 4N2YA 4AD2A 2FB2A 5C9XA 2ZE0A 4KEUA 4HHPA 2PRLA 1I8JA 1P0EA 2ISVA 4N9EA 3W24A 1JEZA 2XVLA 3KXQA 1CENA 2W0HA 2QJMA 3TR9A 1NJJA 3C0SA 2WVSA 4UBPC 2VZOA 1CXHA 1TWWA 3RPDA 3TCEA 4MFEA 1LYXA 3OVGA 2PP0A 2R1KA 3EGJA 1X98A 2VEFA 1MMFA 4B5WA 3C3UA 4G5DA 1PBGA 4Q8VA 2G96A 1ML1A 1XYFA 3U2ZA 3JVAA 3S5YA 3M5VA 3SRFA 2HBXA 2XVGA 1F61A 1MXSA 2B4GA 3M43A 3V75A 4JN7A 2C19A 5EMYA 5F4WA 4EM3A 3SCWA 2PC8A 3VPLA 1J2BA 3RNDA 1LM1A 1V79A 4I9AA 4Q22A 4UTLA 4BWLA 2VHLA 4UB9A 3FK4A 1T6MA 5FF7A 2ZUTA 3GRIA 1N7KA 2VX7A 2EG7A 1F05A 2VWTA 3IGUA 3A4WA 1NELA 3RAOA 2HS8A 3IIOA 2C16A 2FFCA 4P8WA 2RDXA 3KL0A 1VFLA 1V6UA 3GHSA 1J18A 2WSQA 2HROA 2JKEA 1VPQA 2P53A 4E4FA 2DZTA 5AZ1A 3TQKA 3GBDA 4L65A 4LH8A 1TG7A 1OD0A 2YXOA 3GUWA 4B3LA 3IGXA 3W84A 1UD2A 2V69A 3AIRA 4FHAA 3BQ5A 4Y2WA 2F5ZA 4GACA 4RK8A 3PR2A 1EL3A 1LROA 2D2HA 2GVJA 3LCWA 2PWGA 4GJIA 2Z6JA 2I5GA 1CNVA 1K03A 2OKOA 1RHCA 3DAQA 3R07C 4O0ZA 3LPFA 4DY1A 1JXKA 3N3MA 1TPH1 1POKA 3A7RA 1E0WA 4O1CA 4FK9A 1R3RA 1US2A 1OGSA 4Q7BA 1HVQA 1TV8A 4Y90A 1TSIA 1FKXA 4IFOA 3T05A 3N9KA 1E4NA 1V93A 2OGJA 1MXDA 2D2JA 4O50A 4XG1A 3HFYA 2A6NA 4MPKA 4YTQA 4A8IA 2FPYA 4RX0A 3BICA 5FCZA 3GIQA 4EQSA 4R7OA 3W26A 3OZYA 3RMJA 3KDOA 2YDQA 3NSNA 1ZPTA 4AUBA 1SO3A 4NJKA 2X42A 3L5MA 1F3WA 1PWMA 3JRKA 1H11A 3MCOA 3KTCA 4P7OA 5PTDA 3I4KA 3ONCA 1J8VA 4JIHA 5DY3A 1IQ8A 4DELA 1XCXA 4L1GA 3S1XA 4Q7IA 2J9YA 1X6UA 2I9UA 2G37A 1TPUA 5HUPA 1E72M 4CKQA 2AQOA 4H9YA 1GKPA 4I7WA 4JN6A 3R7MA 3LMZA 1W9XA 1EOMA 4FP1A 3LMYA 1D3GA 3VABA 4ZQOA 4LRSA 2R14A 1JPMA 5A6AA 2V82A 4GLEA 1NHPA 1JUEA 1HF6A 5D8WA 3QVQA 3IVTA 3G6MA 3IUHA 3AU2A 2NUYA 2OTDA 3UNDA 1RLCL 3OA3A 4FF5A 5AKQA 1EA0A 2AAQA 3N2TA 2QF7A 2Z28A 3UD6A 1REQA 4UQCA 1XV8A 3GYEA 4DJDD 5CH9A 4A29A 4C6FA 4QSFA 1OADA 4OE7A 4B9ZA 3L4WA 3O6YX 1ICPA