3I6TA

Crystal structure of muconate cycloisomerase from jannaschia sp.
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
367
structure length
356
Chain Sequence
DQSQIIAGFTLWHLSLPVTGAVEVVVLRLQADSGAVGYGEASPWVVFTGSVEATYAALDRYLRPLVLGRAVGDHAAIMEDARAAVAHCTEAKAALDTALYDLRARIAGVPVWALLGGRCRDRIPLSCSIADPDFDKDLALMQRLQDDDVRIIKLKTGFKDHAFDMMRLERLRADFPAFDIRVDYNQGLHHDVALARVRDVATFKPTFIEQPVKAHLRGLMARIRDAVDVPLLADESIFGPEDMAEHPEIADGVSIKIMKSGGLTRAQTVARMAAARGLSAYGGDMFEAGLAHLAGAHMIAATPEITLGCEFYQATYFLCDDILAAPFPVADGHVLVPDTPGLGVDVDEDALARFAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of muconate cycloisomerase from Jannaschia sp.
rcsb
source organism Jannaschia sp.
molecule tags Isomerase
molecule keywords Muconate cycloisomerase
total genus 130
structure length 356
sequence length 367
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3i6tA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3i6tA01
1OEPA 2DW6A 3N6HA 2OLAA 3KUMA 3DDMA 5BOEA 2PU1A 1FHVA 3VFCA 2AL1A 1EC9A 4JN7A 3SJNA 4GGHA 3ES8A 3MSYA 3R0UA 4A6GA 4E8GA 3ZLGA 3TTEA 4ENLA 2OX4A 2GGIA 1MDRA 1F9CA 1DTNA 2PTWA 2OQHA 3QPEA 5ENLA 4MKSA 3I4KA 3RCYA 3PK7A 4ZA0A 4M0XA 1JPDX 3MQTA 3SN0A 1R0MA 1FHUA 1P43A 2QDDA 3OP2A 3OZYA 1WUEA 4F4RA 3Q45A 2GGHA 3DEQA 3K1GA 2QGYA 2PODA 4KPLA 2OO6A 1NU5A 1L8PA 5FJPA 3SN4A 2RDXA 3UXKA 3ZVIA 1EBGA 4KWSA 3MZNA 2QJNA 2MNRA 4HN8A 3SQSA 3DESA 4GIRA 1KD0A 4E5TA 3CAWA 2OG9A 7ENLA 1SJCA 2GGEA 3PFRA 3Q4DA 4IL2A 3TWAA 1P48A 4IT1A 4J3ZA 3N6JA 3UJSA 3UXLA 3R1ZA 4DX3A 2PMQA 3TQPA 3MY9A 2QJJA 3OZMA 2XH0A 2PPGA 2OZ8A 3EKGA 3ES7A 3TW9A 3NFUA 4E6MA 4HNLA 3UJ2A 3ENLA 1EC7A 4H2HA 2OVLA 3BJSA 2DW7A 3MUCA 3MKCA 3P93A 2CHRA 1BQGA 2GGGA 2MUCA 3IJQA 4H19A 3QKEA 4JHMA 2PA6A 2FYMA 4H83A 2GSHA 1SJAA 3HPFA 2P3ZA 4FP1A 4E4FA 1XPYA 3JW7A 4GFIA 2AL2A 3U9IA 3H7VA 4HCDA 3DG3A 2ZC8A 3GD6A 2ONEA 3FCPA 3R0KA 3JVAA 3UCCA 3CB3A 1EC8A 3P3BA 3H12A 3VA8A 3S5SA 3DFYA 1ONEA 4MMWA 2AL2B 2PP1A 2AKZA 3CYJA 4DHGA 3NO1A 2XGZA 5J04A 3DERA 2HZGA 1MRAA 3ZVHB 3UJRA 3TJIA 3SN1A 4FI4A 3T8QA 3P0WA 4HPNA 3N4FA 3DIPA 1KKRA 2PP0A 2OQYA 2OZ3A 3FYYA 5FJRA 3QN3A 3V5CA 3JZUA 4IHCA 3MWCA 2HXUA 3VC6A 2GGJA 3OPSA 2AKMA 2PSNA 3V3WA 2P8CA 3EEZA 3CK5A 1E9IA 3DG6A 3NXLA 3IJIA 2POZA 4IP5A 3THUA 4HCLA 5EU9A 3IJLA 3PWGA 3VC5A 4EWJA 2PCEA 2HXTA 1PDZA 3UGVA 1IYXA 1KCZA 5FJUA 3S47A 5BOFA 2XSXA 2O56A 2PGWA 1TZZA 1SJBA 4DN1A 3VDGA 1W6TA 1JPMA 4HNCA 2GDQA 3SBFA 2PTZA 1MDLA 3TOYA 3DGBA 1TKKA 3RITA 3VCNA 3ZLFA 3R11A 3IK4A 3RO6A 2GL5A 4DYEA 3GC2A 2ZADA 4IZGA 4GMEA 4KEMA 2PU0A 2QJMA 3QLDA 3T4WA 3BSMA 3FV9A 2OPJA 4DXKA 1NELA 4M6UA 3RRAA 4A3RA 2XH7A 3H8AA 3UJFA 3UJEA 4IP4A 2FKPA 2PP3A 4JN8A 4HYRA 2PS2A 3TJ4A 3V4BA 4E4UA 3FJ4A 3V5FA 4DWDA 1R6WA 3T9PA 1MUCA 1PDYA 4G7FA 3FVDA 2I5QA 5IDZA 2QQ6A 1XS2A 3QTPA 2OZTA 2OFJA 4K8GA 4MGGA 1MNSA 3D46A 1JDFA 2P8BA 3GO2A 3H70A 6ENLA 1KKOA 3ZLHA 4J1OA 3RGTA 4H1ZA 4ROPA 4GYPC 2P0IA 1ELSA 3N4EA 1TE6A 3BOXA 5FJOA 3DFHA 4G8TA 1ECQA 1SJDA 3OW1A 1BKHA 2XH2A 2NQLA 3NZGA 5FJTA 3DG7A 2QVHA 3VCCA 3B97A 1EBHA 3CT2A 4HCHA 3R25A 3I6EA 4K2SA 4GYPA 3U4FA 3STPA 3UCDA 2PTYA 4KT2A 4Z1YA 2P88A 3CXOA 3PWIA 2XH4A 4GGBA 2HNEA 3FXGA 4ZCWA 2OKTA 3TWBA 4K1WA 3T6CA 3RR1A 4Z17A 3I6TA 2PGEA 3GY1A 4YWSA 4IL0A 3SSZA 2PTXA 1YEYA 3R10A 2QDEA 3D47A 3OTRA 1RVKA 4GISA 1JCTA 3TCSA 4A35A 3ZVHA 1WUFA 4X2PA
chains in the Genus database with same CATH superfamily
1V79A 2EF9A 4LWWA 4FZIA 2PU1A 2YDAA 4IIGA 3ZJ6A 1CENA 2EPKX 3NGJA 2HS6A 5A1AA 3SECA 3HPSA 2XFRA 3GC5A 3R7MA 3E12A 1G4SA 2ZZ6A 1J93A 1F9CA 4OVXA 1M7JA 4DXVA 1OFRA 3IJDA 1HTIA 1JZ8A 2OLSA 4XBSA 4HNTA 4G1KA 4O0ZA 1XGDA 3VD3A 1SSGA 3REQA 4S39A 3HG4A 1MZHA 3Q45A 4YYFA 1XLGA 1K70A 3W1TA 3ARQA 3WJYA 3HTWA 3HG5A 1E9LA 4W7VA 3UXKA 1UD3A 1VAHA 1EBGA 3GC4A 1E5NA 3MZNA 5G2IA 4PMVA 4MKNA 3GIPA 5I06A 4IT1A 4CVUA 2CC0A 4ICCX 3P67A 4HSHA 2YVJA 2I5IA 2WM1A 2FTPA 3MDUA 2J7EA 2GOUA 2JGQA 3W2LA 2ZA3A 1KM1A 1EEXA 3MS8A 2ZTKA 2O55A 2VGFA 4DUXA 1MXSA 4OGZA 4AW7A 1RD5A 1E0XA 4Q7NA 3GNNA 1JYVA 2CLPA 2CYGA 5G1YA 2OVLA 1LZOA 2Z6JA 3NYZA 4DJEC 3SZ8A 5I2UA 2Y8UA 4DBDA 3QJAA 4M7TA 5HUOA 4UFJA 1VCVA 3WK0A 2GGGA 2RHGA 4EF9A 2EQ7A 3N04A 3EDDA 4H83A 3L4YA 3SY5A 4DIAA 1AL7A 2YX0A 4UXDA 4DWSB 2F84A 3QZ6A 3GD6A 4ZB0A 4Z2IA 1ITQA 3EPOA 3N2CA 1UHVA 4KCVA 2DZSA 4DPPA 2QLYA 3W71A 3W87A 3W28A 1EC8A 3ITVA 1WOBA 1JDEA 1US0A 2W63A 2HWGA 2QIWA 1KXHA 1DWGM 1PJ9A 3V1HA 1VEMA 2CBVA 4J27A 1V7YA 3KCOA 1PUDA 1Q2RA 1IEWA 2VMFA 3KL3A 5EBAA 3T8QA 3AMGA 2TMDA 3U2EA 3B0PA 4MYAA 1K6AA 4GKTA 3L12A 1VJSA 5A6KA 4FK9A 1HT6A 1GG0A 1S2AA 1ZLPA 3UY8A 3LHVA 4PUKA 5AHIA 1CXHA 3DUGA 2UY4A 1OD0A 3ZZ1A 2AKMA 4PCTA 3UXAA 1G7UA 4B5XA 3NQAA 1FUYA 1F76A 1KRCC 4Z0SA 1TPC1 4EQXA 2V69A 1H4PA 3VNJA 4WY0A 3KLLA 5FEPA 2OYMA 2YL6A 1JPIA 3BLFA 1EZWA 1XRVA 3GHRA 3BLEA 3A5VA 1GNXA 4PBEA 2RABA 1QNRA 2QAFA 2XSBA 2IPGA 3DI1A 1LT7A 1A53A 1F3TA 3ZR6A 1R87A 2DU2A 4YHGA 1TKKA 1IT8A 4MB4A 1B3WA 1IXQA 4I6KA 1CGVA 4GI9A 4UFIA 3TTQA 1XUZA 3M5ZA 1GYLA 1JZ5A 3GRIA 4HMCA 1XKJA 2ZKMX 3T4WA 3E49A 4XZHA 1XRFA 5J5DA 4PODA 4A3RA 3TA9A 3HA1A 2XH7A 3WELA 1TYTA 4MTVA 4DJDA 4XZIA 4H04A 2OYKA 1PWMA 3QHNA 1OINA 3QY6A 3WBXA 5HDRA 1KFEA 2FKPA 4FXJA 4DNHA 3HPXA 1RJQA 4DWDA 4HOZA 5CZJA 2F38A 1I1WA 1D8CA 6XIMA 1UP3A 4K8EA 3CJPA 1NDYA 5HPCA 4H00A 3IJ9A 1ZKQA 1S3TC 3XINA 1OC5A 2P8BA 5A6BA 3OBAA 4YPJA 5F7UA 4WKHA 1PZ0A 4ADWA 3NZRA 1BQCA 4H8NA 1QCWA 2XDFA 1V3HA 3QFWA 1QNPA 4GYPC 3AIWA 3KCJA 1UASA 3AXMA 1OT2A 3S4TA 4WXZA 2BX7A 4GACA 4IG2B 5LIWX 2VX7A 2HE5A 1OD8A 2DZXA 2WPBA 3KOWA 1ICSA 1ZB5A 2XH2A 2IQDA 4PMXA 4AIBA 1OFDA 1F6KA 3NS1B 4H9UA 4KGJA 5C9XA 3CO4A 4DO7A 4C1KA 4KGLA 3OC4A 2HSAA 1AJ2A 3S2NA 3O06A 4K2SA 3LGDA 1VIWA 2FZDA 3KP0A 1HL8A 1H60A 3DHUA 2BXYA 1PCKA 2B81A 3VUSA 3UG4A 1TTQA 3IRSA 2W66A 3QW4B 4IGSA 3WLJA 4AH7A 3A47A 1W1A1 5HXMA 1SFLA 2P76A 3GG7A 2FLIA 4JTTA 4Q33A 2BFGA 2D2GA 4X63A 2NLIA 2PDXA 4YVXA 1M1BA 5D03A 4JICA 2G37A 1SQ7A 1JGMA 2GSEA 5CKSA 3Q94A 1TFVA 3DECA 4GISA 4L4MA 2AAMA 5IFPA 1AW2A 4LX4A 3W1MA 3DCPA 4JDBA 2Z1XA 1RCQA 1Q85A 4NZ5A 2JFEX 2BHUA 4CD6A 1LRTA 3VDHA 2ZZ7A 3SQLA 2YR1A 4ZZ9A 1FEBA 1FWFC 4CNOA 4LVFA 3SJNA 5C7VA 4LJ3A 4A21A 4E8GA 3ARXA 2VCCA 1UBPC 2PBGA 1LCOA 1T7LA 5REQA 4J5NA 3VUPA 4AY7A 3E2RA 3WD1A 2PTWA 4MDPA 5ENLA 1CTNA 3SUWA 2HQMA 3WD2A 2XVPA 1NHPA 1SYTA 3SY1A 2ZRZA 2B7NA 5KZEA 4GO9A 6TAAA 1B0IA 3T8LA 3VGHA 2OCZA 3VGFA 2J9YA 3C52A 2XZ7A 4XSMA 1WUEA 4XQ6A 2WPCA 1L8PA 2RJHA 1DWIM 1TTJA 3H2EA 1JPKA 2IPFA 3EANA 2ZZ4A 4TO8A 1MW0A 1X38A 1E1CA 5AYXA 3TN4A 3WQDA 3PJWA 4HGXA 3ARPA 1LLWA 4L9XA 5H8PA 2X1SA 4JTFA 4W8LA 1UWRA 4ROQA 3MY9A 2ZVRA 3KEHA 3C2VA 1MFVA 1T96A 4V1XA 4AWSA 3ITOA 3ES7A 3BCJA 4J35A 3TW9A 5KINA 1KRMA 3T0DA 4HNLA 4LS2A 1EC7A 3CZGA 4H4IA 4FNRA 4NYUA 1H5VA 2IKIA 1DWAM 4KRUA 2W0HA 4HU0A 3I6RA 4HU8A 1F73A 1SJAA 4FXRA 1EBDA 4UFLA 4YHEA 1ZCOA 3K2GA 3RPMA 3IARA 2BY2A 4GX8A 1S38A 1TB3A 3NOEA 4B5SA 3GVVA 4M52A 1TJ0A 2EHHA 1KBLA 4BY3A 2W5FA 2QJIA 4UTTC 2O7QA 5FKYA 4HQVA 1TV2A 4JTAA 3VVGA 5DX7A 3VA8A 1JUBA 5SWUA 1M5WA 1UOKA 1H61A 3ZR5A 3GW3A 4PH6A 3MDWA 1X7FA 4DHGA 2Y5SA 3W26A 3OYZA 3NQ6A 1LWHA 2IKGA 2C7FA 5C9ZA 3Q6JA 1XYBA 3EMZA 3TJIA 4M24A 2XG9A 2R94A 3PVFA 4NUWA 3FLUA 4S3AA 5LXEA 1UKPA 3M64A 1PTDA 3DYOA 3CAQA 4CGTA 3FX4A 1QNSA 3V5CA 3LPFA 1OABA 1VFOA 5F2IA 2VNCA 3D3AA 2J25A 2VVSA 4LUTA 2E68A 5C8BB 4K36A 1YQZA 2X0SA 2PEVA 3UG8A 3UF9A 1OX4A 3CIXA 1US2A 5GQBA 2VELA 3UWWA 3AS2A 4WKFA 1NVMA 5BWFA 3IJLA 2HVNA 3DHFA 3ZJ8A 1BSIA 3BMWA 1Y65A 4AC1X 1IYXA 4BV6A 1XW8A 1VBJA 3SRFA 2VFHA 1ZHAA 1GQLA 3B04A 2DSWA 1R9XA 2YFNA 1HKKA 4IQEA 4F9JA 1J8VA 3CEUA 2J7BA 2WVUA 4JX5A 3QQWA 3MUIA 2ZRXA 1XISA 2P5NA 2XJ7A 3TIMA 3S8HA 5D09A 4O16A 3CS2A 3W2JA 5G5GB 1TCDA 4WJ8A 1OFPA 2C0HA 1BPLB 4CCDA 3LBOA 2B4GA 5D9PA 2WP6A 1ZBVA 1TV5A 3CV7A 2VX5A 2WCGA 2CBIA 3IGHX 5FEWA 4Q3MA 1FDJA 1W5NA 3N2MA 1G4PA 3CYVA 4HPXA 4XD6A 2VUYA 1TJ2A 2CHOA 4GY0A 3G6LA 1XUUA 4BJHA 5HQLA 2NUWA 1H7PA 3FGCA 1M04A 1FDZA 5A8PA 5D32A 4OQVA 1V02A 3T9PA 2RDWA 3MANA 2J78A 1FO4A 4RJEA 6CGTA 3U3HA 1ZJBA 3BOFA 3Q37A 2OELA 3ZYZA 4AFYA 4REQB 4F48A 1Q8AA 4LYKA 4NJGA 4H50A 3BSHA 2X2YA 4S2BA 4O1CA 2J9XA 3B8SA 1XM3A 1A0DA 3R43A 4UTIA 4GNKB 3ITCA 4NIRA 4MYXA 3VMPA 2Q3OA 3PG8A 2P0IA 3G24A 1F3EA 3BOXA 1R7AA 5A5WA 4DEFA 5D37A 3BCFA 2QT3A 4ASTA 2E7FA 3E5PA 3C3NA 4MJ4A 1REQB 5DCDA 2W79A 4Z42C 4GXWA 4P61A 5DCEA 4GUHA 3V36A 3K4DA 4QROA 4NHVA 1J2BA 3B9EA 3CM4A 2ACRA 2YA0A 1U1UA 3IAQA 3G1XA 2OOFA 3BLOA 4GGBA 2Z1KA 5DQPA 2FB3A 5GPRA 1JI1A 3PJUA 3F4NA 3EA3A 3T6CA 4MM1A 1Q7ZA 4QLKA 3ZFHA 2WC4A 2DT0A 4Y90A 1JCJA 2OTDA 4KEZA 4QG6A 3L5LA 1JZ4A 3PULA 1TG7A 2D23A 3O07A 2PTXA 3R10A 5DMMA 1QO5A 3LTSA 3CH9A 4WUIA 2R1KA 1TPB1 3E9AA 4BQ5A 4E3TA 3QFBA 5AZ1A 4GLEA 1RM6B 3KUMA 2DUAA 1Q2SA 3AHVA 3KRUA 1EA9C 1RJPA 4RPQA 4L6HA 3QR1A 1GV4A 1QW8A 1TPVA 4I8YA 2R1PA 2JF6A 1UJQA 2OX4A 4I8DA 1ITCA 3UD6A 3G0UA 2ZWZA 3UR8A 3ARVA 3S1UA 3QEZA 1QNQA 1TWDA 2NVCA 4LALA 4M8UA 1TE1A 4U31A 1LL6A 3QRHA 2BNJA 1TWWA 3CH0A 3SRKA 4NQ1A 2C15A 1J0YA 1VB9A 5DMLA 2G95A 4YIWA 5I3IA 1W3TA 2A7NA 1EX5A 5AN7A 1FWTA 2KAUC 2NWSA 5GJPA 2QDDA 1N82A 5I02A 4HU3A 1V6YA 5FJPA 5I3HA 3ZVIA 1GREA 4NRSA 5JQ9A 3EB2A 4LNCA 3N13A 3PM6A 4Y96A 2CLEA 1W91A 4Y9MA 4C5YA 3USBA 3UJSA 3PBMA 1CIUA 3CMJA 4A05A 4KPRA 1KTCA 1IXOA 1BZLA 3V0SA 4Q6XA 3WLSA 2I56A 1K8ZA 1DHPA 2NUXA 1XDIA 3M0JA 5GNYA 4S3GA 4O0QA 1GONA 2FPYA 4H2HA 3U6WA 3BJSA 2GQ9A 1BYDA 2XN1A 3MUCA 2BV9A 4B9ZA 4YTSA 1E1CB 4NEWA 1QNVA 1XRSA 1E1EA 1MZRA 1Z41A 3MP3A 3I4EA 1KCLA 3JS3A 2CW6A 4H4YA 5K7JA 2BSLA 1E55A 3UZYA 2AL2A 1C93A 4HTBA 4M29A 3BW4A 5LNVA 1VBUA 1J18A 2OB3A 5CSRA 4GYJA 2GRTA 4PB5A 1CGTA 5HNTA 3D3FA 3P3BA 4UFHA 2JIEA 1E4NA 1W3KA 1V51A 2E9BA 2UWFA 3I7QA 2NXGA 2HBXA 1W5PA 1RBOB 3CYJA 1I0DA 3NO1A 2QEZA 3TN6A 1MW2A 1BHGA 4L5ZA 3UWUA 3P0WA 1I60A 5ABHA 3UGRA 2WQDA 3IGSA 4R53A 4ERAA 2PP0A 1V3MA 2W91A 4IFOA 1W1YA 3W0KA 3VOJA 4Y9NA 4LAKA 3GSMA 1SFSA 4CNSA 4KH2A 3G1AA 1VZWA 5ER0A 4EM3A 3EDEA 3EDKA 2H3DA 2IW0A 4GBUA 3U7VA 1JUKA 2YB4A 4PUMA 3VKDA 3PWGA 3WQ5A 1Q6FA 2O0TA 1EL3A 2WC3A 4FB7A 4O28A 3GIQA 1LDCA 2FTWA 4H9VA 4CEXC 4AIOA 2ACUA 4J3TA 2WB5A 2O56A 3PF3A 3DKLA 1FXQA 1K9DA 1H0GA 3DYPA 1DQWA 3IV8A 3ONBA 4A8NA 3HN3A 4O57A 1D7KA 3V1PA 1B3ZA 2X0YA 3RITA 4AX6A 3H54A 1RBLA 2PB1A 2Z1VA 1K9EA 3SIZA 1B3XA 5EMYA 5I5RA 3MUAA 4W4QA 4IIDA 4DWSA 3DI0A 2TRSA 3UZ5A 2QJMA 3HOJA 3ARZA 4JY9A 3L0GA 3MZ2A 5CJNA 2VM8A 1EJUC 1XLFA 3MHGA 4IQLA 3AMZA 3RRAA 4M6QA 3H4WA 5TAOA 2WCAA 3PSWA 3S6OA 4QSFA 5K4ZA 1H6VA 5GJNA 4HMNA 3UPMA 3SCOA 3C56A 3U5YA 3R13A 4HYRA 4NZ3A 2A1YA 3VOFA 2PF0A 1W56A 3W00A 3BK0A 3PZQA 2G97A 4KCTA 3WF0A 3GXNA 3TH6A 3O15A 3AMDA 5T26A 2G50A 5BRQA 5JCLA 4MG4A 1L0PA 3PG6A 4YWOA 3WDQA 2A85A 4S3KA 1JDFA 3LD5A 2X41A 5DY3A 3GO2A 5BYWA 4NX0A 4AEFA 1RP9A 1KKOA 1TVPA 3KBNA 3NL5A 4WSHA 2ALRA 3M07A 1LOQA 1Z44A 2ZDRA 4LUTB 3QV7A 4JHOA 4QAWA 2ZZCA 3M46A 5ABFB 3BAYA 2QF7A 1W3NA 2WZMA 3A21A 4LBRA 3A23A 1FIQB 3G3DA 5FOOA 1AVAA 1HG3A 2QUVA 1RXOB 2J66A 1TA3A 3S42A 1WZKA 2QPXA 1TZ9A 4GXMA 3YPIA 4JQ3A 2H90A 5HOSA 4R9OA 3KW3A 4B3KA 1LBLA 3N17A 4FSAA 2TYSA 2WJEA 4U28A 3IIPA 2WYSA 3URQA 3G5EA 3T0AA 4HT3A 1H41A 3MYOA 4DI8A 2XIIA 1UKQA 2FZ8A 2PTYA 4PCPA 2V3BA 4H4QA 2QPUA 2BWGA 2FFCA 4IFKB 4GZ7A 4N6EA 2ZDSA 1TV8A 3EAOA 1GOMA 2NQ9A 4LF2A 2DT2A 4RW5A 2PWDA 4IX2A 4O54A 1M3UA 5I3JA 1GQJA 2Z0IA 1ZALA 2PWUA 2ESCA 4I5XA 1TYGA 1TRDA 4WIWA 3GYCA 4IL0A 1R3RA 3G77A 1CXKA 3MVIA 3RM9A 1MQRA 2ON3A 4C6MA 1O95A 2W0UA 4Q8UA 1MQQA 2C8NA 1LLZA 2GZXA 1QBAA 2X7VA 1WXZA 4C7GA 1D9EA 1KM3A 3U5UA 3TVAA 3HIJA 3VNDA 2BASA 4ACZB 5CG0A 2X1UA 2BB0A 1V3KA 4LUSB 4XG1A 5AC6A 1D3CA 2E1WA 2VYOA 1VKFA 2ZE0A 3NQBA 1ISYA 3N3TA 4ENLA 5C7HA 3GNXA 3LLFA 1D7FA 3VM5A 4C6PA 3AN1A 4RV8A 3WQFA 4FNTA 4V2XA 3GH5A 4JQ9A 1U2YA 4LT9A 4S3BA 5EBUA 4O11A 3UPBA 2C79A 2WMJA 2C1HA 5KTLA 3S83A 3VOIA 4N0RA 1M53A 3TTYA 1UWQA 3C2YA 3IK2A 1V0LA 1IXPA 2GR0A 3DAQA 2C14A 1DQXA 4PB4A 4YWIA 1NWUA 1VD6A 1GOOA 3SN4A 1N5XA 3FA4A 2D3NA 2EXOA 1TWZA 2QJNA 1WDWA 1ZENA 3N25A 2HTMA 3WH9A 2LLEA 2INEA 2GGEA 1XF0A 3BLKA 2INFA 3B03A 3N6JA 1KW1A 4AAJA 1VYSX 1QWGA 1O12A 2GK1A 1N8FA 4A2RA 3AHZA 3AWOA 3CO8A 2FZNA 1DIKA 3WDPP 4DLMA 3WL1A 4J2PA 3B0XA 4R27A 3GHUA 4AWTA 2DZAA 1GEHA 4LA1A 4NI3A 4XAFA 1GTEA 2ZZ3A 4Z2HA 3N19B 1JVNA 3QFEA 3II1A 1E6QM 3CHFA 1HIZA 5FEXA 5C9WA 4JYDA 2XM1A 2OR2A 3WUFA 3GR4A 3UR2A 2J7FA 1R3TA 1ISWA 2Q8LA 4GIAA 1VPXA 3CNYA 3F1QA 3G8EA 5DBTA 5G4WA 3LXDA 2WOQA 4EOUA 3ARRA 5MKGB 1R2TA 1R3VA 1VEPA 5XIMA 5I6SA 3CWNA 2V2CA 3HF3A 1VS1A 2NX3A 5CC5A 1S5TA 4EPBC 4RX0A 1TPH1 1U33A 3FW6A 1IR2A 4EAMA 3WDJA 3EOOA 3WF2A 2J8FA 5HATA 4N42A 2V67A 2QCCA 4XTIA 1FWRA 2PC4A 4WJXA 1TPFA 2X0HA 3WCZA 2DH3A 3GRTA 5E9XA 2V6AA 3WK3A 1M65A 5A6MA 1XGEA 3SQPA 1PZ1A 4LRTA 4LVAA 1KRBC 1L2QA 1ODZA 1Q3NA 2PDKA 4IQDA 4CCZA 3ZS4A 3K8KA 1XYAA 3VI2A 2CKSA 4B5TA 1LPFA 3H2CA 3H55A 2VFFA 4QDPA 1A4LA 1V0KA 1GK8A 4AEEA 2REQB 2OSWA 3N2XA 3UW6A 3EPMA 3W38A 4ICNA 4GCAA 3W22A 3FEMA 4OUEA 3CMGA 1TJ1A 5IDIA 4DBWA 4X60A 3QC3A 2YIHA 4NILA 1O6IA 3DJGX 4AIEA 4EAYA 5LA0A 2V8ZA 2Z28A 1V7AA 3PTMA 3USZA 3KXQA 2VTFA 1O4UA 4LS1A 3SIMA 3W4RA 3SY8A 3OYXA 1MYRA 2YCJA 2YAUA 2OWWA 3G8RA 3TFCA 5E0FA 1YQ2A 3L5AA 1UKTA 3BLDA 4PUNA 2FVKA 1DYSA 4AWEA 5LHFA 2A7PA 1XYZA 3TOYA 2VRQA 1D7YA 3R11A 1QPRA 3MP5A 1U1JA 3ARTA 1DQUA 1VLIA 4FR1A 1FH8A 1VYPX 1YPFA 2O4QA 2VRKA 3BW2A 4UOZA 1C8QA 1R7OA 1QNOA 2PLJA 1D8WA 4ZTXA 1JDDA 2X1IA 4G6CA 4NT0A 4O12A 1JZ6A 2E09A 1H51A 1UPPA 1XLBA 8TIMA 1W3IA 1NJJA 3UWYA 1XQLA 2ZXBA 3M4HA 4JD4A 4TIMA 2RGLA 4MZ1A 4I9AA 1W5OA 4OU1A 2ALDA 2J75A 2Z24A 2PS2A 3TQKA 3TJ4A 3FJ4A 3V18A 4AF0B 1N61C 3FIGA 1V5XA 3QZAA 1MUCA 1Q5MA 3SADA 1ENUA 3CPRA 1BYAA 2BY1A 3B06A 3WJZA 3QY8A 3AS3A 3QBUA 1EKOA 3L2LA 3J7HA 4GC4A 1GYNA 1I0BA 3EX3A 2BY3A 3B3DA 3LENA 1GKQA 2WO5A 4CU8A 4M19A 1JULA 1CGYA 4AZ5A 1FWJC 3VDBA 3I3DA 1ISXA 2HNHA 4NG3A 1Z42A 1FWWA 3O6AA 4JY8A 3MUXA 4XAZA 1KFLA 4L9ZA 4X0NA 2FPTA 2YDRA 2F61A 4WRHA 2P3EA 1K8YA 1GTHA 2E6AA 1VCFA 2CWNA 3APYA 1GORA 4BS0A 1WQ5A 2DY3A 2GJRA 1ML1A 4UQ9A 5FS7A 4RDYA 3R12A 1RA5A 3STPA 4H9ZA 3MMTA 3ABOA 3T0CA 1N62C 1HKIA 1Z69A 3O0HA 4JTCA 3UG5A 3W7RA 4LV9A 1C29A 4M1BA 4XIAA 2OSYA 2ZICA 3VGGA 3E0WA 4JYEA 3OQEA 4HMDA 3KRSA 1VLWA 4H6EA 4PN2A 4WDUA 1W1PA 1M7PA 3LQLA 3LTYA 2JEPA 5TIMA 3ABRA 4MKVA 3NVDA 5HK4A 1AW1A 1OZQA 1SMAA 2NX9A 2CXGA 3TX9A 1K9FA 4YWSA 3WX7A 2TPRA 1Q7MA 3WLPA 3OBKA 3ALFA 4M6PA 3KTSA 1RV8A 3LRLA 3T05A 4XD3A 3LTPA 4GRSA 2Z6IA 2DT3A 3K1DA 5DANA 5CGMA 2BOEX 5H91A 1A0EA 2X50A 3WLKX 4ATLA 1E40A 4UNKA 4CNNA 1GYMA 3LOTA 2EO7A 2B7OA 4N9DA 3W7KA 4ML9A 5I00A 2ZWYA 1WXJA 1ONRA 1KC7A 2QUNA 1Q66A 3URAA 4D6DA 3ZLGA 1G1YA 1J9YA 4P8UA 2ZX9A 1VBRA 1C8XA 3WJSA 3F7JA 1Z89A 1HO1A 4RZBA 2EKCA 1AL8A 1VFMA 1NP0A 3E6EA 1RA0A 3B0YA 1LBFA 3EWWA 4Q8OA 4E4PA 1BXNA 1MVYA 4WGXA 1XRTA 3B05A 3WENA 5BW6A 4TVCA 3LLXA 1DJYA 2YQUA 4U3AA 2CITA 3EA1A 2V68A 1W37A 5HQMA 3W53A 3OP2A 1UWSA 1BF2A 1YTEA 1IT7A 3CIVA 3NQMA 3LSCA 2GWGA 3HJZA 4LVBA 4O8AA 4FIRA 4ZQOA 1F2JA 3R6IA 4IIEA 3VINA 2PD9A 1GGOA 3R4IA 3R58A 5TBOA 1GVSA 3VIIA 5JVLA 4RZ4A 1V77A 1YXDA 3FXYA 1QFEA 1KWKA 2HRWA 2D1ZA 2J7CA 2OG9A 3C0JA 3BGAA 3EWZA 4J3ZA 3UZWA 1YMYA 3QGAC 2QCGA 3DZ1A 2A3AA 3STEA 2EPNA 3OZMA 1E6RA 5BRBA 3T42A 4KIRA 3V35A 4U5KA 2JEQA 3F2DA 5CGTA 1XIFA 1ZAHA 3WQ6A 5LNRA 1NAL1 4PUEA 4D6HA 3ATZA 1JD7A 3UJ2A 1YXYA 4MUPA 1B57A 1FA2A 1TMHA 1JIBA 1CXIA 3TR9A 1UD4A 3WG6A 1RPKA 1DJXA 4IGHA 2CZDA 1A3XA 4LVDA 3QKEA 1OCQA 2V5CA 2FZBA 3E0VA 1IF2A 3HPFA 4I9JA 1UZHA 1VRXA 3AHXA 1C9DA 1S2CA 4LRSA 4XO6A 4B4HA 4FNUA 2Y4SA 1WDRA 1ICQA 3IANA 1PL9A 3TE9A 1OG0A 2W6RA 1MEHA 5HULA 1F8IA 3STGA 1FKWA 3M47A 1TTIA 3DJJA 5K3VA 1DVJA 1AA1B 5TD4A 3WDIA 4PYSA 1XDMA 4KKXA 1KGWA 1HKJA 1YRRA 3TROA 5U25A 4HKPA 4EMJA 4JIHA 5HR6A 2C19A 4XV0A 1GRHA 1UZ1A 3VGEA 3P62A 3B9AA 3PAOA 3PANA 1MRAA 3TXZA 3NVTA 3BARA 1Q1WA 1DHKA 3ZSSA 1S5VA 3FSUA 4Q4SA 3WYZA 3ETRB 4TTGA 4ZXLA 2GDVA 3QSTA 3K8MA 2OQYA 1HO4A 3MO7A 2WBGA 2IKHA 3HMCA 4OTKA 3KX6A 1OCNA 3UESA 1OF8A 2VCAA 5DEZA 4MIMA 2PWGA 3DG6A 4C65A 1SSDA 4G7EA 4L4PA 3THUA 2YL8A 2E5BA 4LQ1A 4QXIA 5FD0A 1Y0EA 4TU1A 3VZXA 2HXTA 1KM4A 4AHQA 3UPWA 4P8WA 1TVLA 3GAYA 1NWSA 2J4GA 2TODA 3W76A 1IT0A 2AAAA 4HHHA 3TV8A 4AEOA 3HFYA 3WJXA 3W7NA 2IUZA 1KGUA 2GVJA 1HN1A 1A0CA 1GOQA 4CNTA 4ECLA 3EEGA 2R1MA 2XIOA 4QDWA 3N2TA 5EPDA 4YTRA 3SGUA 1PVNA 3ONCA 5C2XA 4Q4RA 2WZEA 2VT0A 4L4LA 3RX4A 3VKJA 2GL5A 4H3DA 3W7IA 3VAVA 3LXBA 1SB3B 1LM1A 1PXGA 1J10A 1XSJA 2NX1A 4ZMGA 3CXBA 2G41A 2QNEA 1E6XM 3VABA 1KGXA 2I14A 1ZY9A 5A8QA 4U10A 1WP6A 2H8XA 4DJDC 4HOXA 1K77A 1BGAA 2GJPA 2CDUA 3ZT6A 4UZUA 2X16A 1WKDA 1KXVA 1DXIA 4H8VA 5AC4A 5I07A 5A6LA 3L5OA 2WXDM 1K8XA 4LAOA 1OGSA 1AUSL 4C1NB 1QI5A 3V7PA 1XIJA 5A2CA 2VQTA 3QTPA 2IS7A 4K8GA 4CU6A 1PV8A 1BFNA 2YDQA 3GZ3A 4RNFA 2PWFA 3FJNA 4DQWA 5C9UA 3NIYA 4APNA 3H70A 1NP2A 1WYGA 3DYMA 1HJSA 1GOXA 4PULA 5EY5A 4UCFA 4ADUA 1X98A 2VR4A 3NA8A 4R3UA 1TX0A 1ZY8A 4IJRA 2ZZBA 3QZEA 6TIMA 2YXXA 3RUBL 1HX0A 4AHPA 1BKHA 2ZZ0A 1B3OA 2GVGA 5DELA 5ABFA 5HWNA 3N14A 3H2FA 4ZGYA 4NAEB 1FWNA 3PPGA 1E0WA 2GJNA 3H6OA 4JHZA 3DG7A 3MI2A 2RDTA 1VENA 3RAOA 4UTUA 3GNPA 1ADOA 2HISA 2Y70A 3W23A 1UD5A 2QR6A 1EGVA 4TVDA 5F2GA 4JKKA 1AH4A 1ZX9A 4KFNA 3SCVA 4F66A 4PMDA 4ZCWA 1B4EA 4LB3A 3C8NA 4QQ3A 1L6YA 5H2ZA 4M80A 1ZQ5A 4LAZA 3NSMA 4US5D 4L64A 3I6TA 2A5HA 3RJXA 1AQMA 2J7GA 1NY1A 1ADDA 4WVXA 3O6YX 1Q6LA 2VZSA 3IIXA 3GU9A 1JAKA 2BTMA 1Y5VA 1FFUC 1RK6A 1AZ1A 3FOKA 2NT1A 3EWCA 3WH8A 2VJXA 3WSUA 1UR4A 5DMNA 3RXZA 5M03A 1OEPA 2DW6A 2VZTA 3TN5A 4UNLA 3ZXWA 3BCDA 3WQOA 3W7HA 4I7VA 2J13A 4GY1A 2ZOXA 3WUEA 1EHNA 4DVOA 2G3FA 4XWUA 4OOZA 3R0UA 4ACZA 3VIMA 1KA9F 3RU6A 1KXQA 3WJWA 3GTNA 1PX4A 3NL6A 4HK6A 4IGNA 3PNUA 3LXAA 3WF1A 3JZEA 4JQ1A 1XLCA 2BZNA 1S2UA 4MKSA 2ZX6A 3ALGA 4NZ1A 3N2BA 3PK7A 2Y2WA 2GPTA 3S5ZA 3FG2P 4RNJA 2PDCA 3L66A 3RRXA 2ZUWA 3A9BA 1QBBA 1SGJA 2UY5A 4JS3A 2VC7A 2YCKX 5FCZA 4HZMA 1UR8A 3ID7A 1W3LA 4LS0A 2CLKA 5CBIA 3BJTA 3DESA 1ESWA 5KEZA 3DBPA 3NVWB 2SFPA 2VURA 1A3WA 1U5HA 2XSAA 4LW7A 4KESA 3GNRA 1X6UA 3GHSA 3PFMA 1J79A 4IM4A 4E8DA 3AIRA 4AX7A 1EB3A 3TYEA 1XYFA 2VWTA 4ZB5A 3LMZA 3PJXA 5FAJA 1ZU8A 3SFWA 2I1OA 3LERA 1GVRA 3SURA 4C90A 4Q22A 4ADTA 3DFNA 1SR9A 1UYQA 3ENLA 1BLIA 4DXXA 1EPXA 2DW7A 3L65A 3S2LA 2G0WA 4EQRA 2YPIA 4I9TA 4Q4KA 5I3KA 3U2ZA 2F6UA 2Y7DA 3RMJA 4ZOBA 2OYLA 3AXKA 4GQBA 4FP1A 3HG3A 3C2RA 1YNPA 3AIEA 1KNWA 1IEIA 3GR7A 4JDRA 4TVYA 4ZSTA 2WSKA 4P7QA 1M7OA 3GKAA 3MCNA 1K7FA 5I23A 1WXYA 3BVJA 1E0TA 2GVYA 2ZE3A 1XDLA 5CXPA 1K03A 1NOUA 2JALA 5HMDA 5K9DA 2P53A 1F8MA 3N9RA 4BF9A 3MI6A 1ZSXA 3AFBA 4W8AA 1PCWA 3IAPA 1T0OA 3BV7A 3TC7A 1BXBA 4XSLA 4MAZA 3LHUA 4ILSA 4MMWA 3GE7A 4HK7A 4PUWA 4DWSC 3H2AA 4AU0A 2WOWA 3KS5A 3OGRA 4K8HA 2VKZG 5D02A 1BGGA 1IHIA 3ZVHB 3AO0A 1GWJA 3WNLA 1I2RA 3VD9A 2A7RA 1EZ2A 1JF5A 5CSYA 4JTGA 4HPNA 3GRSA 1JXKA 3UBPC 3EDJA 2ZZ1A 3GTIA 5U4NA 2W55A 4PEKA 1KBKA 2WMGA 3C3UA 2BVWA 4HPHA 5CZ0A 5JCIA 3AM9A 3VD7A 3S1WA 3MW7A 1FWGC 4WLCA 1NWRA 1ME7A 2ODOA 9CGTA 3FEQA 4Q8NA 1DJQA 3EEZA 1EP1A 1LL4A 1OYCA 1YKWA 4IMFA 1W1B1 1K4QA 3Q2DA 2I16A 3OO2A 4HJWA 1PIGA 1D2KA 3BZJA 2D2HA 3M5YA 2CFFA 2VGBA 4TV5A 1FRBA 2C3ZA 1C9WA 4ACYA 2G96A 4UB9A 1KTBA 1X8CA 4N4PA 1QHZA 4LANA 1TZ7A 4RDWA 3E0LA 3NOYA 3LHTA 5A8MA 3MWAA 2C18A 1C3FA 1NSJA 4Q7IA 3TYBA 3MHFA 5E1QA 3O3RA 3AIVA 2J6VA 4YYCA 5E93A 1J6OA 1GOWA 4JFWA 4RR4A 4QSHA 3TJXA 1R38A 4YVPA 3T0BA 3TW7A 3PG9A 5JCKA 3NSXA 3TQ0A 3MT1A 2D73A 1EPVA 4FIQA 1NM9A 4LNYA 1RZMA 1VBHA 1PX3A 1BSLA 4Y8FA 1GXFA 1V93A 3RLGA 4UUIA 4MY9A 3E3HA 4IP4A 5CGQA 3PAJA 1DTUA 1BD0A 5KZDA 1JNDA 3CZKA 3HGOA 1B30A 3LS9A 2CZEA 1OX6A 3R94A 4JGDA 4JKMA 1PYFA 3CT7A 7PTDA 2I5QA 4S3FA 2ZRVA 3NQCA 5ABGA 4LOCA 5CPNA 4Z1DA 2BHZA 4PRWA 1GVEA 3M16A 3TSBA 3NDZA 2DSVA 1QUMA 1V6TA 5HBFA 3VOGA 1E6NA 1WDDA 2YA1A 3KBVA 4UTFA 1QOXA 3RGTA 4F2BA 2NWRA 3DH7A 4H1ZA 4FEZA 4PFHA 1VPQA 3NDYA 4ROPA 2D24A 3SM0A 3VD5A 2J27A 3G1VA 3N4EA 3UVIA 3GG0A 3VIFA 3B4UA 1FX6A 3L68A 1WDQA 2JQXA 4P8XA 2ISFA 3VTRA 1UKSA 4GRTA 1J96A 4QM1A 1ZZMA 3IUDA 2EKGA 3SAZA 2QAEA 2V0TA 2V6OA 4IMEA 3WQEA 3LI1A 1E56A 3L9CA 3GH7A 3MKVA 3CT2A 3CZJA 1HNYA 1O68A 1SPQA 1LORA 4Z1YA 2VFGA 4O1BA 4JNYA 4REQA 4S3EA 4E0CA 4EVZA 3T7VA 1JQVA 3IWPA 1P7TB 3UU0A 3RM8A 1KM5A 1JRBA 3RLHA 3AMKA 4KCUA 3WQWA 2YYUA 3NO3A 4GD0A 1TUFA 2RFGA 1U5VA 3K46A 4PR4A 4IPLA 5DFAA 1XCXA 1T99A 4JTEA 3ERPA 3LRMA 3E0IA 1FP8A 1R46A 1BVWA 3A6OA 3W70A 3KP1A 1S46A 3UWVA 4H8HA 4GH3A 1FFQA 1A3HA 3N6HA 2OLAA 4PL2A 3IRDA 1A50A 4B5WA 3M1ZA 5L9FA 3T78A 1AD4A 3SCSA 3ZMRA 5KZ6A 2R91A 3S1XA 1MDRA 2J8TA 4RUBA 3CUZA 3CV1A 4C6DA 1EOKA 1ICPA 4F2TA 1M41A 3RCYA 1DWHM 4NZJA 4AVOA 2B7PA 5I03A 3W6YA 1BWLA 4ZEPA 4DZIA 1EOMA 2A3CA 1R0MA 3H7UA 1FEAA 1P43A 4FXSA 4GY7A 1VGAA 2GFTA 5D9MA 3R5EA 3K1GA 2QGYA 3SGGA 1UMLA 3PBUA 1NU5A 3A7RA 3RCNA 5DRIA 3VFLA 2YBUA 4B9YA 1T8XA 3DFTA 1UP2A 2GVEA 2ADAA 4WEVX 2WP5A 4X2RA 2GWNA 4D6GA 3GNOA 3PFRA 3AJ7A 2GUYA 5EA9A 5I77A 3N15A 2QAPA 1XHGA 5H8UA 3O7UA 2PDUA 2A21A 3WMBA 5AC8A 3WEMA 3QY7A 3F5LA 1US3A 2FZMA 3ABXA 4I3GA 4MY1A 2IPWA 4AB4A 4QAIA 1G9HA 2QCEA 3GDRA 7TIMA 5FJIA 2AMGA 5F1UA 3RJYA 2WJDA 3P5YA 2P3ZA 2BGSA 2RUSA 2ZXAA 2X1TA 3PBYA 1MWOA 1G67A 2FHFA 5A8NA 2BOFX 5U1OA 5CBJA 1OADA 2YBVA 4WD0A 1FWBC 4Z1AA 3TKFA 3VO0A 1XIBA 3B8WA 3H12A 1EGZA 1CBGA 1JCXA 1JL8A 1ONEA 4Q4MA 4ATDA 1EEPA 1J01A 1TELA 1F4AA 2ISVA 1EJXC 1JF6A 4P7OA 1R30A 5GNXA 2NSXA 3TC6A 1XYMA 3EYPA 2HPMA 3GDLA 1JZ2A 4QS6A 1UR2A 1NWTA 2XM2A 2PI6A 3T2QA 2QHAA 1OQFA 5FSEC 1WDPA 1XLDA 4WKAA 4GK8A 3URNA 2DIJA 3TZNA 4PCSA 1GPWA 6REQA 3R8GA 2ZBTA 3CB8A 3GD3A 4HZ6A 1CLKA 1DP0A 2V82A 3GFYA 1FXPA 4PMQA 2X42A 5LHEA 2JIWA 3LY0A 4HPJA 3VNLA 3AALA 3B8TA 3OB8A 3H21A 2BHYA 1VEOA 3S5OA 1T5AA 1YDOA 4QGCA 4IXHA 2POZA 4R88A 2AQWA 3JR2A 4J7RA 3NQEA 3I10A 5MF5A 4C6EA 3OG2A 4EP8C 4GABA 2DUXA 4UQEA 4MF4A 1XYCA 3FYOA 3WBYA 1PKLA 2PBOA 3VMNA 3P7YA 2XWDA 4PSPA 2V5KA 1A5BA 2FPVA 2Z25A 4D8ZA 3TEVA 1RPXA 2VDIA 5A6SA 3JUGA 4X9YA 4FOKA 3MC5A 4KS0A 2WPEA 3GLCA 3CGCA 3OA5A 2QYGA 1AFSA 3DXIA 3GYEA 2PDQA 2PGFA 3SCPA 2WJFA 3GC2A 2ZX8A 2PWEA 3APGA 4GMEA 2XPKA 1YE4A 3GTFA 4GI4A 3FV9A 3H4KA 2X05A 1B3YA 2BC0A 1J5SA 3EOUA 3H8AA 3T07A 4CQ8A 3TUUA 2GOKA 3CWHA 4AUBA 4V28A 3MBDA 1VBGA 2ISWA 2W67A 3RNMA 4M6VA 2IMRA 1MXGA 3QOMA 2C3DA 1PX8A 2PZ0A 1UROA 1W54A 4O18A 1H62A 2Y24A 3WBEA 1AH0A 4O53A 4XKYB 5IHRA 1U30A 4Y9AA 2CBJA 4QE4A 2WMIA 4OECA 2CCRA 2OZTA 3L2MA 1Z48A 1MNSA 4G56A 1GERA 3O05A 6ENLA 1FECA 4V33A 4KFOA 3WH5A 1DE6A 2V3EA 5D2XA 1CECA 1G94A 2X8CA 3T08A 3MCMA 1TIMA 1N60C 2DORA 4GVFA 1A5AA 5FJOA 1UQYA 3DFHA 5LZLA 1J6PA 4A3UA 3M41A 2UV8G 5JRBA 3ITYA 9XIMA 2E6YA 2J62A 1OJTA 3LCFA 1B4KA 3CU2A 4HA3A 4O8RA 4U2YA 3M0VA 3HURA 3LN3A 2ZUVA 1JDCA 3T44A 4F40A 5BNKA 4O17A 2J7HA 3TXVA 1KLYA 4D9PA 1BKSA 4PMYA 2JBMA 3GHTA 3I6EA 4DZAA 1S2WA 3W1XA 1SO6A 1YBQB 2V3AA 4HSNA 1UG6A 3VDCA 4L9YA 4C7DA 3LSBA 4XZ9A 2WQPA 3UR7A 2PDJA 2Y6ZA 1GZ1A 3CQJA 1W9BM 4OV4A 4YCOA 2FH8A 3IV3A 3BV4A 1Z8AA 4H7ZA 4E3VA 3SSZA 5D30A 3PZIA 5K2ZA 4LCQA 3H23A 4DI9A 2TAAA 3AU2A 3VKBA 2Y62A 1B54A 4N4QA 3M7SA 1UD6A 3VPLA 1WUFA 2G3NA 3N1AA 1N2VA 3CUGA 4NP7A 4IISA 2GQWA 3E02A 3TDFA 4FHAA 3GBDA 3MMWA 1HKVA 4TX6A 4CVWA 2W4XA 1EC9A 3PZUA 5C6MA 1I75A 3MSYA 3ZJKA 4EPKA 4GWEA 3GWQA 5FS9A 5FEZA 4JX6A 1YDYA 3F4DA 3L4UA 3NQDA 4EXAA 3TTEA 4ORIA 4UOJA 1E0VA 1P0NA 1EXPA 1TR9A 1DTNA 1LJYA 3ABZA 1GVFA 2WZIA 1DBTA 3WLIA 2VR2A 4GXPA 4QHRA 5M5DA 1QK0A 3GXIA 4PA8A 3SFKA 5AYZA 3G1DA 4E8CA 4U3CA 3MUZ1 3VNMA 1S5NA 3MQTA 3RPTA 1QMLA 4WDXA 2DVUA 1HP5A 1M9HA 1ME8A 4IPPA 1GESA 2GGHA 4EXQA 2QCDA 1E1FA 5AC5A 3AISA 4OUIA 3ARUA 1WZMA 3ZQ9A 4KPLA 4XAGA 1OT1A 1JG9A 5AYIA 1W9UA 4RXFA 4KWSA 5G1TA 3MBFA 1G01A 5AZ0A 1YLVA 1DPMA 1Q8JA 3AICA 4HHLA 4AD3A 4IICA 2BOGX 4GJIA 4N7QA 1OF6A 2PDPA 2W9MA 4RKAA 1SJCA 4LUSA 2GJXA 3AS1A 4QDMA 1CWYA 2DZWA 4TV6A 3S3GA 1VCGA 1FWIC 3D6NA 5HWMA 3GH4A 3WFAA 1UP0A 1AMYA 1XLAA 1CW2A 4J40A 3R2GA 4GJ1A 5DT7A 3N9KA 1SVDA 4QG8A 4ZR8A 1R3WA 4IPJA 5H6HA 3APTA 1MUMA 2JE8A 1YE6A 3EX2A 1ITXA 4Q7BA 4WF7A 4MWAC 3BQ5A 4H4RA 3P93A 2CHRA 1V3JA 4K68A 4LCSA 3MJMA 4D72A 4XVEA 2FYMA 2GSHA 1UH2A 4PCNA 3LPGA 4JIIX 1P1MA 2YVGA 2VUNA 4NNAA 3V75A 4UR7A 3SCNA 1T8QA 4IWWA 3CWOX 3EOEA 1VJZA 3RHGA 3HM7A 4IJBA 4OBSA 3SB0A 5FACA 1O66A 4O1AA 4WOZA 1W1VA 4E2DA 1YNYA 5FAGA 3WF4A 3VXGA 2PGRA 3UZJA 3MA8A 3DGRA 2OOGA 1DXEA 4RDVA 1MRQA 1DE5A 4CEUC 4U4MA 3MCOA 1F07A 4W85A 4B2DD 3FDGA 5EGRA 1SZRA 3QPYA 5MHBA 3VNYA 3DHDA 1WAWA 2XUCA 2HZGA 4HNUA 2EPOA 1DWJM 1NFPA 4FI4A 3CHCA 1GJWA 3N4FA 4D1IA 4H4PA 1QOPA 1TMQA 3FSTA 1SO4A 3OBEA 3WLNA 1YADA 1JUEA 3AIUA 5LGZA 5AHLA 1UR1A 4DYJA 6ALDA 3JZUA 4MOZA 2F9RA 1LWIA 4J3VA 3TFXA 1SFTA 1V3LA 1QO2A 3B40A 2WPGA 3OPSA 3G1YA 2BCPA 3KWXA 5LIYX 3BLLA 4UTWC 1YPXA 3R89A 1BRLA 4C6CA 5A6JA 9RUBA 4ZOCA 5LGXA 3BC9A 1MSSA 2QJHA 3PUOA 4IP5A 1STZA 2Q3RA 5TF0A 4R33A 4GJJA 1XR2A 3NQFA 4JN6A 4FDCB 2ZZ2A 7REQA 1XICA 3RYSA 2WSPA 4DNAA 4O15A 1TZZA 5CZKA 1Z7AA 2Q6ZA 3M7WA 3VCRA 2PTZA 2ZXQA 4UFMA 5C55A 4Y8EA 2Z2UA 2VZVA 3VCNA 5G5HB 2CHNA 3EWXA 4QQUA 1NF0A 1OK6A 2QV5A 4NSBA 1SO3A 1QK2A 2J6XA 3W7QA 3NPXA 2GVLA 3M0KA 4Q4OA 2PDHA 3HG2A 3H2MA 1OGBA 2ZXDA 4WSKA 1EDTA 4H7CA 4PTVA 3T09A 4R9XA 3WQVA 3VU2A 4UTMA 1BRLB 3RO8A 1KXTA 5XIAA 3WLMA 4MLRA 4MPKA 3AYRA 4AIUA 3KBWA 3TCEA 1GW1A 4ZSUA 2VR5A 3HQ1A 1P6WA 3WK2A 3M0ZA 3ABSA 4M56A 4CQBA 1R6WA 1ME9A 3W86A 4RE4A 1RLCL 4K38A 1HUVA 4G7FA 3UERA 4O13A 5EL1A 1M03A 3CGTA 3TYCA 2NVDA 2BBFA 1NFBA 2POTA 1SW7A 4RE3A 5G2HA 3LM7A 2WMIB 3RX2A 4NF7A 4ZQMA 3EXRA 3ICJA 2Y0FA 2D20A 4PSRA 1FTXA 1OG6A 3SI9A 4NY2A 3DK4A 1UUOA 3MSGA 3VGDA 5LIXX 1ELSA 4UIOA 3CTTA 4US5A 3EBVA 3O63A 1X97A 2ZZ5A 4D6IA 3OIHA 3WQ8A 1XC6A 3GXPA 2HQAA 2PLCA 2A2IA 1C91A 2QCHA 2CETA 3W1UA 3GVQA 3AUOA 5I7GA 2A3LA 3W3OA 2ZX7A 3OLEA 1PKMA 2GR3A 3UCQA 4GVIA 3BGGA 5BXSA 1Q1RA 4G1NA 3BOLA 5T9CE 2ZUUA 4YU1A 3WUGA 1ODUA 3H26A 3CXOA 3DFSA 1VF8A 3IIOA 2Y88A 3PWIA 2FGZA 1I2QA 2WV8A 3CHEA 2HV5A 1V6WA 4LBUA 5DF0A 1IWBA 1SZFA 3UA3A 4L1XA 5JH1A 1OHLA 3VNIA 5I09A 1E9YB 1EXBA 1XBYA 3VGBA 4C7FA 2PGEA 3GU1A 3O0FA 1YDVA 1I1XA 1CI1A 4GUJA 3BAJA 2AOSA 3V0UA 1JCTA 3O2LA 5REQB 3KL0A 2CXEA 1AJ0A 2XFFA 3W2NA 4AD2A 1OB0A 4GPNA 2NQZA 3N2OA 2VOTA 4HOWA 3PB0A 4Z1CA 3H53A 3NQ2A 2WVSA 4N9BA 1S39A 2E6FA 3KWSA 3POHA 3W85A 3BO9A 5CPQA 1ITUA 5D2VA 4CKQA 4J3UA 1GEUA 4NAEA 4H8UA 1JR1A 1G6CA 3CZ8A 1RQHA 1H0IA 1F3PA 2WOIA 1QJWA 3NPUA 3QPEA 3QHOA 1FBAA 4BQ4A 2VHLA 2CWXA 1QOQA 4LY4A 4PC8A 4DLFA 4M0XA 3WNOA 2FTYA 3WUBA 1BAGA 2XTKA 2QIIA 3HV8A 3IVUA 4UTHA 4AQLA 1OFOA 1FWEC 3S6DA 3UETA 4JFSA 1QWKA 4S38A 3P61A 1YIXA 4F4RA 3H4GA 3HGJA 4Q32A 3NXFA 4CQCA 1IEQA 4K7VA 1PZ2A 4D1JA 4DJDD 3PC0A 3KDOA 1WZAA 1QDSA 3KTXA 1YW1A 4FXFA 4JNMA 3SUSA 1UWUA 3UQNA 3CIWA 1EJSC 2HEJA 1RUSA 1P48A 1XYLA 1BXCA 4GA8A 3R1ZA 1XINA 2H3BA 4DX3A 1K6WA 5D2TA 2FJKA 2XU2A 2VFDA 3ZIZA 1KM2A 3KAOA 2X2GA 2YCLB 4LUJA 2XGIA 1GZGA 1E4LA 3EKGA 1VQZA 4Y7EA 3W2KA 3OGSA 4LTSA 5A6BD 2WHJA 4C6NA 3ZT7A 3LADA 1OK4A 1VRDA 1RJRA 1JNEA 4NZCA 1OYBA 3PZMA 3N6QA 3W72A 5C5YA 1VH7A 1WKFA 3SUVA 4UTLA 1QI3A 4KW2A 4O14A 4MFEA 4HK5A 3QVQA 2EQ9A 4GFIA 4BFAA 5BOOA 3GVRA 4HJFA 3TMQA 2MANA 4FA3A 5I78A 4IG2A 1JAEA 4IH3A 3A64A 3FN9A 1CCWB 2QW5A 4JQ2A 4M51A 3M5XA 3W82A 2DZVA 2HK0A 3RDKA 5AOUA 5LA1A 3GG1A 3NJ3A 1XH0A 3BH4A 3AXIA 1ECEA 3GUGA 3T1GA 4G7EB 4KEUA 2VD9A 4CD4A 3F5KA 1G0CA 3TSDA 2YXOA 4GKLA 3IVSA 3DIPA 3HGRA 2W61A 5FJRA 2WC7A 3FNDA 3OVPA 2WLZA 4WHBA 2RJGA 3QPZA 3W7CA 2KX9A 1AQHA 2J47A 4KBXA 2WNNA 1A47A 1KR0A 5I3DA 3AC0A 1FFRA 2EPHA 1GETA 4QJ3B 1XV8A 1OYAA 3IJIA 4UTTA 4X22A 1HL2A 3FKKA 3WLHA 2E25A 2D69A 2YJQA 1R3QA 4C1NA 3BJFA 4LXFA 1HJXA 4O50A 3N73A 2V30A 2GK1B 1H63A 3L4ZA 2WMKA 3UT0A 1Q6QA 1EFZA 1PWLA 4HU4A 4D71A 1JDAA 3I3EA 1GJPA 1YX1A 4U2ZA 4AMCA 3QV8A 2W92A 3LQGA 1EIXA 1LROA 3HO8A 1LG2A 2QCMA 3SUTA 1X1ZA 3VE9A 5CEWA 4L80A 3U48A 3TONA 4IOTA 2Y5EA 4KEMA 4Z2LA 3HPAA 1BYCA 5CG7A 4CUCA 1K4HA 3NCOA 2JKEA 1UJPA 5JIWA 2ZUSA 4IMCA 2PDMA 3SCRA 3TNBA 2KZHA 1EUAA 1OGGA 1J0KA 5PTDA 3P60A 1ZMDA 4LC6A 1KRAC 3EKZA 1XKYA 1SO5A 1V97A 1IZJA 2E8ZA 4GIEA 3A9IA 1Z32X 1WA3A 2DIEA 4D2JA 5FF3A 3EB3A 3UFYA 2RKXA 3FDKA 3CC1A 5DRCA 2CFYA 4AZCA 4NI8A 4JQAA 2DIKA 1XS2A 4DAIA 1POKA 2Z27A 4MGGA 4HB7A 3BG5A 1KFCA 3SGZA 4B5VA 4W9TA 4L61A 1XBVA 2RGMA 3WLTA 4J1OA 1EQCA 3BGJA 1IWPA 1A5MC 3GDTA 1EQPA 4OIFA 1MI3A 5HMEA 4Z2GA 1PB0A 5HR7A 3W1NA 2B31A 3P74A 1GVYA 2OKOA 4YN5A 4G8TA 2BGQA 5G4HC 3CZEA 4LIIA 4H4VA 3P80A 5JUVA 3OW1A 1OFEA 1QI4A 3IVTA 4ZE4A 1M7XA 3OLDA 3P81A 1XLEA 2WW5A 1EYEA 4GHRA 4F0LA 3MV11 2A3EA 1VJIA 1HKWA 2E9LA 3PZVA 4H01A 4HVXA 4H4SA 2A6LA 4KCWA 4XBKA 4C6QA 4DB7A 3W75A 1F61A 3P8JA 4HSOA 1QT1A 1VC4A 4MB5A 2ASHA 3M0XA 2W62A 4EWND 3LI0A 2XH4A 4A3HA 3T2PA 1E6SM 4PL1A 3P14A 1VFUA 1PPIA 3EKLA 3W27A 4JIRA 1HQTA 4CD7A 2CBUA 2QMJA 4LAUA 3TP4A 2WNWA 4XZNX 1V03A 1EA0A 2PD5A 1PHQA 2CESA 3W7LA 3QW3A 1RVKA 2VXNA 3TCSA 3ZVHA 2VL4A 4G5DA 2AGKA 1XIGA 2OGYA 2QDGA 1HKMA 2X09A 3SR7A 1B31A 2AL1A 4KWWA 1EJWC 3BSGA 4QEHA 3HBLA 2WHKA 1AOGA 5CQ1A 2XINA 2ANUA 3GIYA 1ZJHA 4PRTA 2JF7A 5IFTA 3UZZA 3P84A 2GGIA 5E09A 5BMXA 2WMHA 4C91A 1CB2A 2J9ZA 4YTTA 3RK8A 4AD0A 3MO4A 2Y5JA 4QITA 1E4IA 4B2DA 4AXNA 3M6DA 2XIQA 1XLJA 1JPDX 2BDQA 3LCIA 3GFXA 4TVWA 2IKJA 3D0CA 1Q4NX 3MTWA 1ZRQA 1XLMA 3DEQA 1OWQA 2ISDA 3S2JA 1N55A 3IJ8A 2QULA 4DF1A 1H3GA 2IPJA 4LYQA 4E2BA 2DZUA 2C1IA 1OC6A 5HANA 4UC5A 1ZTVA 3E2QA 3RILA 3BE7A 1WYIA 3BQ6A 3TYAA 3WH7A 4AZCB 3AU6A 3VZZA 1O1HA 2QJGA 4JOMA 5C71A 4QTGA 3WLRA 1EO7A 4GQQA 1JYNA 4AD4A 2O4MA 4H41A 1TJPA 1NDVA 3A4JA 2BLEA 2ZTJA 1G4TA 3CLMA 3ARSA 1SFJA 2F6XA 2EG8A 2OZ8A 2ZUTA 1R3YA 4J3WA 1PAMA 4LUIA 4WK9A 3LZ5A 4E6MA 4GCXA 4RE0A 1YXCA 2D0GA 2YCEA 1W31A 1NDWA 4ZOHB 1FH7A 3KDNA 2NT0A 1OX4B 2CLMA 4JTKA 3C4UA 4JHMA 4A8LA 2PA6A 3OLIA 2JKAA 1A49A 3OQ8A 3B8IA 1XPYA 1H50A 4R7JA 3P5ZA 5LIUX 2F5ZA 1GKPA 3EOLA 3HU7A 4IF2A 4DY1A 1YHTA 1C7TA 3BG3A 3FCPA 1EWEA 5CJ5A 4WXYA 4EACA 1RBAA 3U2CA 3M44A 1QU4A 1H7XA 1YNQA 1R2RA 4PCFA 4W88A 5GJMA 4ONVA 3KL5A 2WBAA 2AKZA 3ME3A 5CSUA 2V5JA 2PDIA 5KZMA 1DIOA 2E9MA 1QXLA 4PTXA 4PB3A 3GVWA 1H7RA 4URIA 3PUGA 3UJRA 1ZPTA 3SN1A 3Q67A 1F3XA 2PCQA 3DOPA 2DUZA 4UMBA 3TK7A 3TZFA 1NOWA 2VCBA 1XBZA 3KRZA 3N18A 3L0KA 3CHVA 5RUBA 3E2VA 4DZHA 1RCXB 2CZVA 2ISSA 5T8GA 4JL2A 3VE7A 3CK5A 5B7ZA 1J2WA 1X6NA 3REQB 3HW2A 1BG9A 1RP8A 1AW5A 3ZOAA 3W81A 2TSYA 4W86A 1NH6A 4ZOAA 3A7AA 3WFZA 4Q8QA 1JROA 2E5DA 4A8IA 1PDZA 5E6YA 1ONFA 3SSJA 1TQJA 3L0NA 4PBGA 3BAXA 4DELA 4ZFCA 1GOIA 2FMNA 2ATSA 2R9ZA 3V0TA 1JPMA 3B8VA 1MDLA 2NV1A 5D05A 5EMKA 3M43A 3CAVA 2YZRA 3AYVA 4HBKA 2CIPA 4BF7A 3PSVA 2YYTA 4I5UA 3E38A 1B9BA 4O1FA 2CLOA 3INPA 1U5JA 4TMBA 4ADSA 2PU0A 3SCQA 2OPJA 1GHRA 4DXKA 4FF5A 4K39A 3TW6A 3EX1A 4TX9A 2YZ5A 4MNMA 3KVJA 4QLLA 5HMSA 3GM8A 1RAKA 4HHMA 2Q01A 3EGJA 2NW0A 1H5YA 1UR9A 4LH8A 3QMRA 4FOUA 3QSRA 3S2MA 1PSCA 2H8ZA 1OIFA 2PDFA 3KLKA 3M0YA 1VFSA 2WNZA 4JTSA 4E4UA 2OWXA 4ZFMA 3VIOA 1OY0A 4PTDA 3BLIA 1CPUA 1ZBWA 3FHQA 1UWIA 1J0ZA 4HPGA 4XK2A 5DO8A 5KVHA 2X8RA 3QOKA 4DUVA 5CPSA 4OBTA 5JBEA 1EWDA 2WM0A 4ZVJA 1MO9A 2OFJA 3XIMA 3N29A 3W25A 4BK9A 2QF8A 7TAAA 4LY8A 4MNJA 4H9TA 1MW3A 4JX4A 3AZRA 3W7MA 2PTDA 4QJ1A 3WD3A 1E72M 1A5NC 5JCMA 3MU7A 4A22A 3GUWA 3GXMA 2ABBA 3ZJ7A 2BXVA 1TPWA 3EAUA 1ECQA 3EMQA 4FLOA 4GNJA 2QUTA 4DBUA 3WD0A 1LTDA 6XIAA 1Z9AA 1S1RA 5K4XA 3QKZA 1POJA 5AHMA 2ZIDA 5AVHA 2G8ZA 1B9ZA 1XDJA 4PTNA 3U4FA 3UCDA 3NNTA 1AQ0A 3SRDA 1RHCA 2NQHA 4YXGA 1N5WC 3C6CA 1DNCA 3PUEA 1X96A 3M0MA 3MMDA 2NQ5A 1E51A 3FXGA 1K02A 3WBWA 4Q4PA 4NXSA 1WKYA 4DO6A 2Z1WA 1Z6KA 1F3WA 1KM6A 2OEMA 3CMFA 4UTWA 5DN1A 5HNNA 1PTGA 1X39A 2NVAA 5AYBA 1EYWA 3KZPA 5D9NA 3O6CA 3UG3A 1AG1O 4A35A 3L4WA 1F05A 1ZBKA 4X2PA 2I57A 3EXTA 3NL2A 1L9WA 4PFMA 3WBAA 4JTDA 4J3SA 4PMNA 3WIJA 3UNDA 2QPSA 5AVNA 2EPLX 1ZAIA 3LEPA 4GI8A 4S23A 3GTHA 5BWAA 4QS5A 1IZCA 2G5WA 1GSNA 3HQPA 1W32A 4MJ2A 2OQHA 1TPDA 1E43A 3PUDA 4XD4A 1E73M 4EF8A 1UWTA 3W02A 2D0FA 5AYYA 2DZBA 3LCHA 1GQIA 3SN0A 2CLFA 1SM9A 1C7SA 4AD1A 3GXTA 3KM8A 3VIGA 4FMVA 2PODA 4EQWA 2PFHA 1SMDA 1B1YA 1GVIA 2OO6A 2GQ3A 2C91A 2VD8A 3RMEA 3MYPA 3EWYA 1KD0A 5HJLA 2PDLA 4H9XA 5JMUA 4IL2A 1UZDA 1EDQA 2A0NA 4B91A 1TMLA 1VHCA 5JBDA 1NDAA 3I7RA 5BZAA 4FNPA 2JK2A 3XISA 1B2YA 3F2CA 3TSMA 2WSYA 4QNWA 3QHMA 3BL3A 3EX4A 2IQTA 1IXNA 3O16A 3I3BA 1IGWA 2EPMX 3PPCA 3UWQA 4BWLA 3OA3A 4D8AA 6REQB 2Z1SA 5FF2A 2B7QA 3G18A 1HL9A 2X8HA 1GEQA 2D2OA 4P7LA 4QR6A 1H2JA 3A4XA 1Q65A 2GDUA 1TV4A 3KVKA 3OZOA 4K7ZA 1DXFA 2HMCA 3TU9A 4MB3A 1WX0A 2B0MA 2HCVA 2PWVA 2Z2BA 1LL7A 4QFUA 5FF0A 3VOCA 1REQA 2XVLA 1D3GA 4OE7A 2D3LA 1H7NA 2QCDB 1VFTA 2XIMA 1E71M 4JTLA 2OU4A 1HJUA 3B9OA 4LCRA 4O1EA 4AZHA 3WN6A 1Q45A 2BODX 2AAQA 3BWWA 5HPOA 2J79A 1EJTC 3LMYA 1KQYA 4J9JA 2DT1A 3DFYA 2XGBA 5A8OA 4GQGA 1RSCA 2E28A 4F0MA 2GJXB 5I3FA 2PP1A 2DP3A 3C0LA 5D8ZA 4NX5A 1JCYA 8XIMA 5J04A 4F0RA 4GC3A 4KWUA 1TRIA 5FL0A 2PDWA 4Y6GA 1W5MA 1FP9A 4H6RA 1JYWA 1M6JA 1N63C 3PNZA 2OX1A 4GFSA 5C2CA 1EO5A 2XFYA 3OU8A 1TQXA 3QN3A 4IFRA 1QPQA 1W17A 1UUQA 3GAKA 1EP2A 4WZHA 4AISA 4B92A 4B4FA 4RDZA 5E5CA 1QAPA 1YYAA 1E9IA 1QI2A 5IHSA 1C92A 2P1FA 3W7OA 4F8XA 4DBEA 3UA4A 5CJMA 4HCLA 2R6OA 1O1ZA 1JRPA 3VKAA 5LA2A 1HW6A 5GRTA 4GVHA 3VYLA 1W8GA 5GVJA 4DF2A 5BRPA 1FKXA 3BANA 1DJIA 1FWDC 4AD5A 2VEKA 4P8VA 2R1NA 3B8UA 3VOHA 3QYQA 4RL3A 3HQNA 3HGSA 4WDWA 2AQVA 3CQIA 4HNCA 4G9PA 3DKJA 2Q8ZA 4JR5A 3FK4A 5EB8A 1PS9A 1N8WA 1V6XA 1KM0A 1JZ7A 5IOBA 3E74A 3CPUA 3RIKA 1A5OC 3O0KA 1Q6GA 1PE1A 4M3PA 4QRNA 4RK8A 3BICA 2J77A 3EZ4A 4GUIA 3MMUA 3CHDA 3U8GA 1BWCA 3A3XA 3CGBA 3NR0A 4LFYA 1WBHA 3PS7A 2NXIA 1W1ZA 4JEQA 3T4CA 2Q02A 1HXJA 2F2KA 1M01A 2VOMA 3UJEA 3CLWA 3NM1A 3M0IA 1VFLA 3TYZA 4JN8A 4MZYA 3CPGA 4I7UA 3V5FA 1NDZA 4IMAA 4JTRA 4UOQA 1CNVA 5BMWA 4EM4A 1TV3A 1PDYA 5JIPA 1ZUAX 1UR0A 3U7BA 1TPUA 5A6AA 1T3QC 1G7VA 3NGFA 4QE5A 3G3MA 3L8KA 3K4WA 1ZJIA 3S0CA 2VWSA 1R9ZA 4FLQA 1D3HA 3EWUA 1UH4A 3CUFA 1K7XA 1XIHA 1L2UA 3EWBX 1IWAA 3FS2A 2C6QA 3ZLHA 2HBVA 2W3RA 3L4XA 2HPIA 3SUUA 3IUHA 3M0LA 1CXFA 1LOSA 2Z7GA 5IXEA 3G1HA 1Q7QA 3W9ZA 1LWJA 2YLLA 1FH9A 1OVDA 4J56A 1W8SA 2DSZA 3CUXA 4HTYA 1C8YA 1T40A 1L6FA 3C2EA 1SJDA 2HVOA 3WQPA 1BVNP 1LG1A 3KBMA 3QMSA 3NG3A 4P5UA 1NARA 2DVTA 3AMLA 2BS9A 4WGHA 8A3HA 1UUMA 3WMCA 1IV8A 4V15A 2VVNA 4UZSA 4PGLA 3R25A 4GZIA 4GI6A 2TPSA 4JTIA 4PZVA 3ANVA 3G0SA 4CQDA 3SR6B 1TWIA 4NU7A 2P88A 3KZSA 3PTQA 1ISVA 4JIQA 3AHYA 3TYDA 1V59A 3N34A 5E70A 5HAOA 1P0KA 5AY7A 4DYKA 1L8NA 1E9ZB 1QW9A 4Z2KA 1WKEA 4K1WA 1PIIA 3UEQA 3JRKA 1R8LA 3B4YA 4AZ6A 3E2SA 4WX2A 4Y9PA 4MDOA 5K9CA 3QC0A 1AD1A 2XZ9A 1J0IA 1OSEA 4ORMA 3RLUA 3WNNA 3TA6A 5A8GA 2VEPA 3ARYA 2ABAA 3EXSA 2J24A 1ZCCA 4Z0JA 3NQVA 1EJVC 3QGKC 4F2UA 1LQ2A 3PBWA 3DDMA 2Y89A 4ZBCA 3V5OA 1KBBA 2HJPA 4NEVA 4PTWA 5F2LA 3THCA 1XXXA 3MPGA 1XBXA 2WVVB 1YBQA 2Y1HA 1F4HA 3CQ0A 3VILA 1KBIA 1LRNA 1OZMA 2FGLA 1XIMA 3C8FA 3GKFA 4FX9A 1W9DM 5KITA 2NVKX 4GYFA 3PHAA 4I9MA 3WF3A 1L6SA 5CZSA 1DEDA 1DJWA 2DSUA 1XIDA 3RG6A 4ZQRA 2CEQA 3OZYA 1Q13A 2XWEA 3U0HA 4XUYA 1F5ZA 3LPPA 4UWMA 4ATWA 1BF6A 3GXFA 3W83A 3ITGA 2OEJA 3NM3A 2QDHA 4XAPA 2AQOA 2MNRA 4HN8A 4WR3A 2WJZA 2NQJA 1DWFM 1GW9A 2PRLA 4UMCA 2CU0A 1ZMCA 3CAKA 5I0DA 5AB3A 3TWAA 4O52A 4ZE5A 3GBEA 2E4TA 4KF1A 1Q4WA 2EAWA 4TX8A 3MP4A 4D6EA 3VNKA 4YCPA 3TQPA 1K8CA 2YW4A 2WSQA 4JTHA 3B0UX 4CCEA 1RCOB 2FHBA 1JPHA 1N7KA 2YKKA 3THDA 1UB3A 4MAVA 4W7UA 4OOUA 1KCXA 4CU7A 2EQ6A 1V4YA 1I4NA 3MKCA 2I5GA 2MUCA 1H11A 2BVTA 4QBXA 4CCCA 2Y8VA 2WLYA 5CAKA 3A3HA 3PZNA 1QRQA 3F2BA 4PMRA 4E4FA 3JW7A 4K7YA 1KFJA 2QS8A 3WQ4A 3W1PA 2G4JA 1RLDA 3DG3A 4DJED 1BTMA 4I7WA 2UY2A 3UCCA 2ZA1A 3AJXA 2I7GA 3MB9A 3TJLA 3PTDA 1A5LC 3S5SA 4ZOEA 1RVGA 4FR6A 3HRDC 2AL2B 1HJWA 2ZRYA 4ZO8A 3KBSA 4H6QA 2XN2A 1R86A 3LG3A 3MKKA 1YTDA 3NQGA 3C0QA 2QCFA 2BG5A 3KLJA 2XIBA 4CD5A 1OFAA 3F4CA 3BTNA 4WQ6A 4BCEA 4PMJA 1DJGA 4MWAE 2ZX5A 3W37A 2OJPA 2X8GA 3PJTA 3FYYA 2JK6A 4XZBA 1OFBA 2OODA 4MLJA 4IHCA 1J0JA 4H4XA 4C5ZA 1ONWA 2FJUB 3MI3A 1V02E 1X8FA 3N11A 4AY1A 1UCWA 1BYBA 1A80A 3NSNA 4M1RA 2CLHA 5TNVA 3GTXA 1W3JA 5DXXA 1PZ3A 3EOSA 1UD8A 1E3ZA 4LYPA 1OM0A 4AYGA 2PCEA 4QJ4B 2C13A 2H9AB 4GINA 3DHPA 3G6MA 4UQAA 3WEOA 3BPWA 4HN4A 1KCZA 1WE5A 3OODA 4TUFA 2E3TA 1CX9A 4D6JA 4UTJA 2GYIA 3LU2A 2DVXA 1R2SA 1SUXA 2ZVIA 3WDRA 4K8DA 1E0UA 2GDQA 3DC8A 2C1GA 2WHMA 1P7TA 1NEYA 3U2OA 1I2NA 2YA2A 4HYWA 4WDTA 5HWJA 1XANA 5D8WA 3IK4A 1GHSA 3UWEA 1DKWA 3NUKA 3WL0A 4BQ3A 4DRSA 5DT5A 1GRTA 3MSRA 4DF0A 4DYEA 4NZ4A 4DM2A 1GJUA 1UA3A 1PIFA 1W1IE 2A8XA 5LNSA 4RNHA 3UXIA 2EG6A 2NV2A 4KRTA 6A3HA 2O92A 2A6NA 3NL3A 4L1WA 1RH9A 3FA3A 5T9BG 5JXQA 3BDKA 2F7FA 1ZFJA 1NHQA 5EMMA 2QUMA 2FIQA 4EQSA 4AG0A 2R82A 3HFTA 1W0MA 3UZXA 3V4BA 3C5QA 1HVQA 3KOYA 5FF7A 4H7VA 3M5VA 5EMUA 4MFDA 3VNZA 3I7SA 4JIPA 3FVDA 1FDYA 3QV9A 4ZXOA 1MEWA 4OZOA 1U83A 4MJMA 2QUUA 4IJCA 4LUYA 3TMLA 3UYCA 2E1DA 4F79A 3AQUA 3LCWA 1K4GA 1XG3A 5EFFA 2INZA 2YDSA 8RUCA 3A22A 4EMWA 3QM3A 4S3JA 2WVVA 4INFA 4I5RA 5FF4A 5IRPA 2WKJA 3VX1A 3GXDA 1HFBA 3A24A 2A79A 3UYIA 3EX6A 1TE6A 1R5YA 3SCUA 1ZL1A 1UIOA 4MVAA 4ERGA 3WK1A 3QXBA 1SZEA 3NZGA 2VEIA 1UD2A 1IEXA 1A4MA 3AHTA 1VYRA 3LM3A 3KOZA 1IEVA 2QVHA 2ZFAA 4YL2A 4EIVA 4GNVA 3RNDA 5KETA 2R14A 4AZBA 3QH2A 1DJNA 2XVNA 2C3CA 4OJYA 1CDGA 4KT2A 2Y7FA 4C6OA 4DO4A 3PZ9A 2D0HA 3VMOA 2V81A 3BAIA 3NEVA 1UR3M 3BAKA 3C2OA 1TV7A 4JTUA 1GCYA 4JDYA 4GUFA 4N02A 2X40A 3W24A 1I2PA 1LUCB 4B5UA 2Z1BA 2V2DA 3KHJA 1P4CA 3RR1A 2R1LA 3VIJA 4XAYA 1BG4A 8CGTA 4FLRA 3N4AA 1OJXA 3CZLA 4IFKA 3ITXA 1W9XA 3STCA 4UQBA 4AC7C 1JI2A 1XLIA 3WH6A 2E3ZA 3N9SA 3DK8A 1PEZA 1KV8A 3LNPA 4QLJA 1S2VA 9XIAA 1G4EA 2EQDA 5HJXA 3OHMB 1JGIA 1VPYA 3OOQA 4LF1A 4C6BA 1S7MA 3WFLA 2YCIX 3GX9A 4GGHA 3ES8A 4YMZA 2HROA 4AMAA 3WMSA 4XTDA 2BVDA 4GQ0A 4A6GA 5FI8A 1VIZA 4S3DA 2VDGA 3ZR4A 1DIEA 3R0DA 3K5XA 4LSBA 4WY0F 2Q09A 1E5JA 3VZYA 4GBDA 5I3GA 4Q8VA 2CKRA 1LUCA 4J2MA 1RQBA 3TQVA 5JCNA 1ZP4A 2QGHA 1W1TA 4IMGA 4Z08A 5HMFA 4GX9A 1UBSA 4MB1A 5FS8A 3HQOA 2O9RA 2Y85A 2DH2A 1G69A 1HJQA 2PDBA 3ATYA 3PY2A 1P0DA 3SCTA 1W5QA 1KTNA 1AK5A 5HINA 5CH9A 5H1WA 4GIRA 1RY8A 5A3HA 3NQ7A 4HNOA 4PMZA 4CD8A 2WKLA 3C2FA 3DENA 1BEUA 7ENLA 4ML4A 2Z4GA 3LBMA 4HA4A 1CGWA 2ZA2A 4WJEA 3OGVA 3KRBA 2BC1A 2Y63A 4MWAB 1W9VA 2WMFA 2GLKA 2W27A 4EPEC 3TLQA 1AJZA 1WDSA 2PPGA 1DV7A 4AZ7A 2X7WA 4M81A 5HJYA 3W07A 5CSSA 3C86A 1GRBA 3RF9A 3DU0A 4KETA 4QISA 1XIEA 2PUZA 4QG9A 2FVLA 1H1YA 2UZ9A 1CZ1A 3ANUA 4K1GA 3MV01 1KR1A 3KOXA 4AVFA 4Q8PA 4ZODA 1DOSA 3GDKA 4B15A 2G3MA 5C9RA 3EDFA 1WO2A 3L2IA 1UH3A 4DJFD 3U9IA 3H7VA 3K4AA 5C2GA 1Q63A 4MWAD 1PKNA 4L4OA 1CXLA 2GSJA 2UBPC 2XIJA 2OQLA 2ICSA 1KLZA 3R0KA 2OWCA 4B16A 4QIUA 3IJ6A 3WLLA 1UQZA 4DUOA 2Y7GA 1EJRC 1TJRA 4KFPA 2P0OA 5FIPA 2YVFA 1JZ3A 4XKYA 3FA5A 2PURA 4A8RA 4GQRA 4RLIA 4NJIA 3PZGA 1FFVC 4K6AA 3QMTA 1FCQA 1TUXA 1IR1A 4EANA 1F6YA 5CC7A 1EP3A 5HUPA 7A3HA 3BW3A 1XCFA 2EJ1A 3QYSA 4EKJA 2PF8A 1QATA 1H1NA 3NTYA 5JBFA 1RY0A 1KO0A 5TR3A 4EMIA 4CN1A 4DJFA 1WPCA 2HXUA 2EBNA 3P8IA 1FWCC 4JAWA 3V3WA 4IGMA 2GJLA 4HA0A 4Z1BA 4J57A 1LQ0A 2Q71A 4GO8A 1ZK7A 1TSIA 1XSIA 3W1LA 2Z00A 3FJ6A 4HNNA 4AZIA 4LVGA 3A12A 5AECA 5CPMA 4L6OA 4EWJA 1ZS2A 2QCNA 2QV4A 2W3SA 5CLTA 5C0QA 2P10A 3O9NA 4EPDC 3DFQA 5FJUA 2FFIA 5BOFA 2YBTA 2Y8KA 1ISZA 1SJBA 1CGXA 4DN1A 3LPOA 1L6WA 2HK1A 3W7JA 5A2AA 3SBFA 1VQTA 3EUB3 3DGBA 2OSXA 5G2WA 2HE8A 2PWHA 5G5IA 1DIDA 1GQNA 2YLAA 4BEUA 3RO6A 1TVNA 2J88A 4Q8WA 1XI3A 4M5PA 7REQB 4L7ZA 1XSKA 5EYWA 3F4WA 5HNUA 1FY6A 4O4VA 4DJEA 3E96A 2R24A 4GOAA 1NELA 4M6UA 5LKYA 2RDUA 2VENA 1HJVA 1JOAA 4QCEA 4JIEA 1K3UA 1WZLA 3WNPA 4F3HA 5M2FX 3RPDA 4QEEA 3LHZA 1IQ8A 3UP8A 3NZQA 3S46A 3O6DA 3EF6A 1WCGA 4S1FA 2O9TA 5F4XA 2Z2AA 2QCLA 3AZSA 4BI6A 3QLLA 5E0KA 1SU5A 5M3WA 3EPNA 1GRGA 4R7OA 4XISA 3MHUA 2O9PA 3LX9A 2Y61A 2WCSA 1O5XA 3IPWA 5IBXC 4MADA 4Y2WA 1MFUA 5D04C 4QCFA 1BWKA 1YTKA 3LYEA 4C6FA 3WQCA 1FWSA 3H4XA 3RR4A 4GYKA 1A5KC 2PRHA 1GT8A 4ALDA 3THQA 4S2CA 2OXNA 5HQEA 4DPQA 3HV9A 4NAFB 3URBA 4KMQA 3LHWA 3PPHA 3GU2A 5L6UA 4LAMA 3POCA 2E8YA 1PYMA 3G22A 4XKMA 2WZHA 5AHEA 4UR9A 4FO4A 3KBJA 1C8VA 1GVQA 2C0AA 2WWDA 2VZOA 1UWAA 1EDGA 3CV6A 5B80A 2NV9A 2A3HA 3AWNA 1ZGDA 1ZP3A 1XCWA 1X6LA 5FJTA 1Q6DA 5BCAA 2BP1A 4HA1A 3B97A 4IIHA 4GYPA 2F2HA 2WOVA 1WAUA 4PE8A 4L6DA 5C70A 3P2VA 3CGEA 3E0FA 4JCLA 2XFWA 5CLWA 2HNEA 2V5LA 4H6KA 4JBRA 4MSSA 4A3YA 1OC7A 3T40A 5KSWA 1P0EA 2YOCA 4TMCA 2ZUMA 2DEPA 1ZNNA 4IXXA 5A2BA 1QR7A 5B7YA 3NZPA 4BI7A 2DDXA 5ABTA 5D2YA 4Z17A 3NVZB 4HZ7A 3F5JA 3GS6A 3S6TA 3SRHA 1J4EA 3MJYA 3A7UA 1QPNA 3OZPA 2AGTA 1YEYA 4BZYA 5KMYA 1F6PA 4J28A 2DQWA 3LGEA 3AUJA 4PEEA 3CL6A 2QKFA 1KQZA 2C16A 5F4WA 3PZOA 3V16A 2IXUA 2CLIA 3TTSA 3K13A 5I79A 3WDHA 4IIFA 1CT5A 2XISA 1MOKA 4CLMA 2BVYA 4C6IA 4JN7A 1R9YA 1XGZA 1ALDA 4OV9A 1S3HA 1NFGA 1F7BA 3W6MA 4W89A 3OVGA 4JYFA 4CN6A 3KE0A 1W2VA 2BMBA 3A4AA 1JRCA 4JFVA 4ZENA 3VKCA 3I4KA 3LRKA 3L21A 3NPVA 2VP8A 3LV6A 4KERA 4DZ5A 4JXCA 4H4TA 3ELFA 1N8IA 4JKLA 3O8AA 3BXWA 3WQGA 2VI0A 2ZRUA 3STFA 2G3JA 3WLOA 1VR6A 4I90A 4W7WA 2OO0A 2V5DA 2ZC1A 1HVXA 1AODA 4POCA 2RDXA 1CB7B 1FWHC 3BZGA 4C6JA 1TO3A 1RQEA 2Z29A 2VX6A 1P0BA 3ZWSA 3UVAA 4PMOA 3CAWA 3OJGA 3AIBA 3Q4DA 4LBSA 4BF5A 3WO8A 4IQJA 3TR2A 2PMQA 4V1YA 2QJJA 2YFOA 4UR8A 3FVMA 4GZJA 2Y7EA 3NFUA 2E5AA 2H9AA 2V2HA 3BUVA 1HGYA 4OBRA 2V3FA 4XZWA 4ERIA 3CUIA 3E5BA 4N9EA 1HGWA 3KS6A 3LNMA 1BQGA 4ZO6A 4H19A 3S5NA 3WZ0E 2OMAA 4C6LA 4FPSA 5FESA 1PO9A 1PHWA 4Q8MA 4BA0A 1YDNA 1O5KA 4PUDA 4US6A 1LYXA 4AHOA 3G2GA 3N3MA 3G0XA 2YL5A 4IPNB 4DBSA 5A95A 3A4WA 3JVAA 2GUUA 3KFTA 1VFHA 3PWAA 4LC8A 1H7OA 3GQYA 1V0MA 5FJJA 5CPOA 4X0VA