5JCIA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
432
structure length
432
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFYSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVANIEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
total genus 141
structure length 432
sequence length 432
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jciA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jciA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jciA02
2C7GA 2XVEA 3BI2A 4B67A 1O95A 2GR2A 3M0OA 3SFEA 3UP4A 1V59A 1GRHA 1YQ3A 3F8PA 1HYUA 2V5ZA 1PXBA 1PS9A 4B66A 4U8PA 4H4RA 4GDPA 2WESA 4J31A 3UOYA 1F3PA 2GEWA 2R46A 3KA7A 3NN0X 4ICYA 3QSMA 1NG3A 2FJEA 2E5VA 2V3BA 5JCLA 3NKSA 4OVIA 2BS3A 5M0ZA 3LB8A 1OJTA 1D4EA 1ZDLA 1JU2A 3RNMA 3ICSA 1PHHA 5FS6A 3B3RA 3DJJA 2EQ6A 3SFDA 4BK2A 4EMIA 2WOVA 2R0PA 3SM8A 5U1OA 1NDAA 3C4NA 2C70A 3ZYXA 2DKHA 2V60A 3AE4A 4JNQA 1B37A 5FMHA 1EL5A 1JNRA 1JRZA 1XPQA 2WEUA 4N9XA 4Y4LA 2VVLG 2GVCA 3AE2A 1H82A 3NK1X 4GDEA 2X8CA 1EL8A 4AP1A 3RP8A 1E7PA 3FIMB 3I6DA 1E39A 4TLXA 4BK1A 3AEDA 4A6NB 4B64A 1MO9A 4A79A 2Z5YA 1Y56B 1GV4A 3LADA 1REOA 2DKIA 2R4EA 3CNTA 1CJ2A 1SEZA 2C3CA 1CBOA 2BYBA 4FDCB 3NTDA 3OZ2A 4JY2A 2X50A 2B76A 1VG0A 3ITJA 4LA1A 1ZOYA 4X9NA 4CRTA 1F8SA 5KOWA 4JN9A 2YLXA 1NG4A 2WP5A 5FS8A 1RP0A 3DJDA 5U25A 1IUXA 4YSHA 1EL9A 1BF3A 1NEKA 4EM4A 3CGEA 2ZZ0A 4K8DA 3OC4A 3P9UA 3GWDA 2X99A 1RSGA 1FCDA 3H8LA 4REKA 4TM3A 4YSZA 1NHRA 3CN8A 1FEBA 5IQ1A 3NGCX 5BULA 3NHOX 1IUVA 2Q7VA 3DJEA 3FBSA 4B65A 4BK3A 1TDEA 3AD9B 1M64A 2VOUA 3G5RA 4OPDA 1ZMCA 1UKVG 3UTFA 4Z2TA 3FPZA 3P4PA 1O94A 2WPEA 4J2WA 1E6EA 2B9YA 2XLPA 1D4DA 3DGHA 2C73A 5J7XA 3UTHA 2V6OA 2ZBWA 4IV9A 2WU5A 4J33A 3DJGX 4TM0A 4Z43A 2R0GA 2IVEA 1XHCA 3ISHA 2C65A 3ATRA 1DNCA 1EBDA 2VVMA 3RP6A 4U8MA 1FEAA 3NT6A 3NLCA 4UDQA 3LZWA 4HA6A 2Y6RA 4C3XA 1LQTA 3LZXA 5M10A 1COYA 3L1RA 4I59A 2H88A 4LU6A 1OJAA 3DMEA 1GRGA 1OJCA 3GD4A 2VRLA 3ALLA 4YSXA 1BWCA 3C96A 4I58A 4RSLA 3FMWA 2XVHA 1KFYA 4EQRA 1PXAA 1GREA 1GRAA 1H7XA 2BA9A 1CF3A 4U8NA 1H83A 2QCUA 4APNA 3UKQA 4DSGA 3DK4A 4EMJA 3EPTA 5BUKA 2JKCA 4WX1A 3CNJA 3UKKA 3RHAA 4BV6A 1IUTA 1D7LA 1ONFA 3ICRA 2GAGB 3AEGA 1DOCA 1XDIA 1W4XA 4K5RA 1TYTA 3UCLA 1P2EA 1IJHA 1E1KA 2WOIA 1GTEA 2B7RA 2C75A 3EAOA 2FBWA 4NEVA 4FK1C 4UDPA 5U63A 4U8KA 4E0VA 4TM1A 1ZY8A 2NPXA 1PBBA 4NZHA 3AE3A 5HYMA 1NHSA 1GNDA 3II4A 4K22A 5JCKA 1EL7A 4IA5A 2C64A 4Z25A 3NRNA 4AT0A 1H84A 1NPXA 2QAEA 2XLUA 3VQRA 1TDOA 2OLNA 4A5LA 4A6NA 2FJAA 1BKWA 1Y56A 1DJQA 5JCNA 1PXCA 4EQSA 3UKPA 1GERA 4B68A 3NIXA 2GV8A 3AYIA 2X8HA 1KNPA 2EQ9A 2C66A 2V3AA 4J34A 1PJ7A 4YWOA 4YTPA 2W0HA 3Q6JA 4GUVA 5KOXA 3ZDNA 2XLRA 4X4JA 1S2YA 4EM3A 5ER0A 2YR6A 3CPHG 2JB2A 1D4CA 3KU9A 4HB9A 5HHFA 1GALA 4H2PA 4Z44A 2CDUA 2GF3A 3CPIG 2VVLA 4CNKA 4JY3A 4CY6A 4CNJA 2XFPA 4H4SA 3DGZA 1IUWA 2YVFA 3BHFA 4O5UA 5KRQA 1N1PA 1VQWA 2XVJA 1NENA 1GRBA 4PABA 2XYOA 4J56A 1PN0A 4JQ9A 1IUUA 1DOBA 1E1NA 3AEAA 5EOWA 4CCRA 1L0VA 4D04A 1GETA 1NHQA 5HY5A 4AOXA 4U2TA 4USQA 3P1WA 1K4QA 3P4RA 4FX9A 3IWAA 1F6MA 4H4UA 1JNZA 4J36A 4YT0A 2GMHA 2WP6A 3LXDA 3T37A 1QLBA 3IF9A 1GSNA 4U8LA 1NHPA 4C5OA 1OJDA 3GD3A 1ELIA 4U8IA 2CFYA 1GXFA 1YKJA 4PAAA 4JNAA 3QVPA 2YLZA 2AQJA 3H8IA 4AP3A 2PYXA 2XFUA 3AXBA 3DA1A 3IHMA 5BVAA 2Q0LA 4X9MA 4LIIA 3KLJA 2YWLA 4CBQA 3REDA 3V76A 3GDNA 3AYLA 1L9DA 3DK9A 2UZZA 4YTNA 2YLSA 2QA2A 4A99A 3V3OA 1PJ5A 2E1MA 1GRTA 1LV0A 2BXRA 3NYCA 4Y4NA 3AB1A 4TM4A 3CTYA 4Z24A 3CIRA 4NTDA 1YQZA 2I0ZA 2F5ZA 2JAEA 1TDKA 3AWIA 4OPUA 4ADWA 1VRQB 2C67A 5KVHA 2BABA 1CC2A 2WDQA 1GESA 2GAHB 3GMBA 4UP3A 2YG5A 1CJCA 1OJ9A 3QFAA 3QSSA 3SGLA 3UKAA 4XXGA 2YVGA 2OA1A 2YR5A 3O0HA 1IUSA 3G5QA 2YLRA 2ACZA 1Q1RA 2WHDA 1GPEA 3QFBA 3GYIA 2GR1A 2YLWA 2RGHA 2XFNA 3CGDA 3CGBA 1BGJA 1JRXA 1N4VA 2APGA 2BCGG 5KVIA 3ALMA 3G5SA 4IVMB 3AE8A 2WBAA 4XWRA 2WETA 1K0IA 2FJDA 3GYJA 2TPRA 3BI4A 3S5WA 4B1BA 4KPRA 4DNAA 2WPFA 3CPJG 2GR3A 3BNMA 1ZK7A 5CQFA 3P4SA 2XVFA 5IPYA 4OPGA 3AE7A 1GEUA 2XVIA 3VRBA 2NVKX 4U2SA 2X3NA 2GH5A 5L46A 1TYPA 3GRTA 2ZZCA 3CNSA 4GR1A 1MOKA 2Q6UA 3FG2P 2EQ8A 4J57A 2GR0A 2XFQA 3Q9TA 2BK5A 4H4WA 1GT8A 4KX6A 5DBJA 2YQUA 5GRTA 2YM2A 1QJDA 2B7SA 4Z26A 3KPFA 2EQ7A 2VQBA 4A9WA 2AAQA 1KSUA 1KSSA 2E4GA 1PBDA 3NNEA 2OAMA 3AEEA 4NTCA 3UOVA 1PBEA 3UKFA 2BK4A 4OPLA 2B9XA 1LTXR 2Z5XA 4ECHA 2BS4A 2AR8A 4ZCDA 3VRDB 2X8GA 1ZMDA 1CC4A 3AE6A 3BNUA 1KF6A 1L9EA 2Q0KA 3ATQA 3ALJA 3VRAA 1S3EA 1KDGA 1JOAA 2QA1A 4JDRA 4IA6A 5EB4A 3URHA 4TLZA 2OLOA 3WE0A 2XLSA 1CJ3A 4WCTA 4A65A 5HXIA 3AEFA 3QSEA 2BXSA 1H86A 4EMWA 1FL2A 3AD7B 3AD8B 1CJ4A 1CL0A 1K0LA 2CVJA 1P2HA 4OPTA 1PBFA 2C76A 1LQUA 4H4YA 3EANA 1XANA 2WOWA 2A89A 2V61A 3D1CA 2O9ZA 4CCQA 3CNPA 3JSKA 5JCMA 1PJ6A 2YG7A 3I3LA 1CHUA 3AEBA 4B69A 1GOSA 4D03A 2RABA 1F8WA 1D5TA 1NAAA 2GMJA 2YG4A 2FJBA 2JBVA 4XWZA 2XLTA 4A7AA 4EQWA 3P4QA 1E1MA 5EBKA 1B8SA 2R4JA 4K2XA 1TRBA 1RYIA 2R0CA 4Z2RA 4P9SA 4USRA 3RP7A 5KXJA 2RGJA 1H81A 2J3NA 1PDHA 4C3YA 2WDRA 4H50A 4GRTA 3F8RA 2XFOA 3UKHA 3NH3X 1Q1WA 1H6VA 4BURA 3KVEA 2JB3A 3UOXA 2JK6A 2XDOA 3QJ4A 4AOSA 1AOGA 2RGOA 4GCMA 4CY8A 1K0JA 1ZKQA 4H4PA 1ZX9A 2BC1A 3BHKA 5KWFA 4BJZA 2YG6A 1H7WA 2C3DA 5FS9A 2ARDA 3AYJA 5GSNA 4YSYA 3DH9A 3R9UA 3CNDA 2VQ7A 3COXA 4H4QA 1LJ1A 2A8XA 4EQXA 2WDVA 2WP9A 4OCGA 3AE1A 3S61A 1YY5A 4RG3A 1Z6LA 2WQYA 5LV9A 3QVRA 4U8OA 2JB1A 1BZLA 2GQWA 3LOVA 1CC6A 3CGCA 1S2QA 1M6IA 2YVJA 2YR4A 3GWFA 3ICTA 4BJYA 3UOZA 4H2NA 1DODA 5BRTA 3KD9A 2HQMA 1F8RA 4NTEA 1TDNA 3AECA 3K7MX 3ADAB 3VR9A 3E1TA 4H4ZA 3AE5A 2A87A 3PS9A 4YTMA 2IIDA 2PHHA 2YM1A 3BI5A 1KNRA 3NYEA 5FS7A 3KKJA 2H89A 3AE9A 4YKGA 4K5SA 3SQPA 4FK1A 3EF6A 1BGNA 2VRMA 1VG9A 1JRYA 3K7TA 4Y4MA 1JEHA 4H2QA 4OPIA 5JCIA 3UTGA 1O5WA 1YQ4A 4YKFA 1ZOVA 2WS3A 3GDPA 1DXLA 3VR8A 4O5QA 1GRFA 1DOEA 3PVCA 4H2RA 3GSIA 3K7QX 2CULA 4NEWA 1Q9IA 2YG3A 1MXTA 1D7YA 4ZCCA 1E1LA 4DSHA 2R45A 3NG7X 2XCGA 1Y0PA 3GMCA 3PO7A 4B63A 3IC9A 2BACA 4IVOB 3IHGA 3B6DA 1DJNA 4Z2UA 3DK8A 4H4VA 3NK0X 2R9ZA 1N4WA 5J60A 3V3NA 2YAUA 2TMDA 1FOHA 5EB5A 4C77A 1LVLA 3M12A 1PBCA 4U8JA 1GTHA 5CKUA 5C3JA 2VZ2A 2ZZBA 3LJPA 3NTAA 4EIPA 3HZLA 5C2TA 2BK3A 2YLTA 3UTEA 2OALA 3ABVA 3UKLA 4RG4A 4EIQA 1LPFA 4C74A 2IVDA 1B4VA 1TDFA 2BC0A 4H4TA 3K30A 3NN6X 2GB0A 2WU2A 1N4UA 2B9WA 4MJWA 4GF7A 5IQ4A 2C72A 1FECA 1S3BA 1ZP0A 3M13A 4U2LA 4YXDA 3GRSA 4M52A 1VDCA 3D8XA 3UP5A 4K7ZA 4UDRA 4AT2A 1QO8A 2Y6QA 1B5QA 4H7UA 4DGKA 1X31B 2BCPA 4ZN0A 3NYFA 4H4XA 2BS2A 1L9CA 2GQFA 2GRTA 3F8DA 3H4KA 3NK2X 2WPCA 3C4AA 4OPCA 3L8KA 5TR3A
chains in the Genus database with same CATH superfamily
3BI2A 3SFEA 3UP4A 2PMQA 4DXKA 1XS2A 2GEWA 2R46A 3THUA 3TOYA 3HPFA 4OVIA 2BS3A 3HYVA 4DN1A 3T2ZA 1JRPA 3B3RA 3DJJA 3SN4A 4EMIA 2I5QA 5U1OA 2HXTA 3ZYXA 4JNQA 1SB3B 3RGTA 1EL5A 3ES7A 2VVLG 1H82A 3RP8A 3FIMB 1E39A 1NELA 4BK1A 2XH7A 1Y56B 1GV4A 2R4EA 3CNTA 2AL2A 1CBOA 3T14A 4JHMA 4FDCB 3OZYA 3OZ2A 4JY2A 2X50A 1VG0A 3TWBA 3ITJA 1F8SA 1NG4A 2WP5A 5FS8A 1RP0A 4YSHA 1XPYA 4Z17A 3P9UA 3GWDA 4YSZA 4REKA 5BOEA 2BRYA 5IQ1A 3NGCX 3FBSA 3AD9B 3R1ZA 4J2WA 1E6EA 2B9YA 3DGHA 5J7XA 4IL0A 3DJGX 3ATRA 2VVMA 1R6WA 3NT6A 3AMZA 4UDQA 3LZWA 1LQTA 3LZXA 5M10A 4H19A 5G5HB 3QLDA 3GD4A 2VRLA 3ALLA 3C96A 3DEQA 4EQRA 1PXAA 1H7XA 3SZFA 4HYRA 4DSGA 3RHAA 3I4KA 1ONFA 3ICRA 1VQZA 1W4XA 3UJFA 3NS1B 2C75A 1N5WC 4K22A 1EL7A 4IA5A 2C64A 2OQYA 1NPXA 2OLNA 1DJQA 3PG6A 5JCNA 5EU9A 2V3AA 3MY9A 4J34A 3MZNA 3ZVHB 3Q6JA 1TKKA 3ZDNA 4Z1YA 2XLRA 3HRDC 2YR6A 1D4CA 4HB9A 2GF3A 3CPIG 2E3TA 4CNKA 4JY3A 3DGZA 2YVFA 3CAWA 3V5CA 3VCCA 3TJ4A 4PABA 1GETA 1NHQA 3DERA 4AOXA 5FJOA 3GD3A 2CFYA 1GXFA 4PAAA 4JNAA 3QVPA 2YLZA 2XFUA 4CBQA 3GDNA 4FP1A 4YTNA 2E1MA 3UJ2A 4M6UA 4E8GA 4Y4NA 4TM4A 3CXBA 1YQZA 2I0ZA 2F5ZA 1TDKA 4ADWA 2C67A 5KVHA 1CC2A 2WDQA 2OFJA 2YG5A 1CJCA 2YR5A 1IUSA 3P93A 3G5QA 2YLRA 1GPEA 3GYIA 1PDYA 3SJNA 2YLWA 2BCGG 1N4VA 4GISA 1K0IA 3S5WA 3BI4A 4B1BA 1ZK7A 2PU1A 4HNLA 4OPGA 2NVKX 3K1GA 3VDGA 3T6CA 3ZLHA 2AL1A 2O56A 4Z26A 2EQ7A 1KSUA 3NNEA 3GD6A 4MGGA 1EBGA 2BS4A 3AE6A 3ATQA 3ALJA 3VRAA 1W6TA 1JOAA 3URHA 3WE0A 2OLOA 4EWJA 3QN3A 3QSEA 1CJ4A 1CL0A 1PBFA 3SR6B 3EANA 2V61A 3CNPA 3RR1A 1SJBA 1GOSA 2RABA 1NAAA 2GMJA 4E4UA 3P4QA 2R4JA 4Z2RA 1RYIA 3NVYB 4P9SA 3RP7A 5KXJA 2WDRA 3T2KA 3KVEA 3UOXA 2XDOA 1TZZA 5KWFA 4HNCA 1H7WA 5FS9A 5GSNA 1ELSA 5KMRA 3COXA 2DW7A 1NU5A 3LOVA 2XGZA 1S2QA 3HYXA 4BJYA 4K2SA 5BOFA 5BRTA 4NTEA 2A87A 4YTMA 3NYEA 2GDQA 1BGNA 2VRMA 1JEHA 1KD0A 3DFHA 2QJMA 3UTGA 1YQ4A 3A7RA 2OPJA 1STZA 1DXLA 1GRFA 1MXTA 1E1LA 2R45A 3KPKA 1MDRA 3N6JA 3VCNA 2BACA 2AL2B 4Z2UA 3NK0X 1N4WA 3UJSA 2MUCA 3T4WA 4C77A 4U8JA 2VZ2A 2ZZBA 1SJAA 3NTAA 2YLTA 2OALA 4F4RA 4C74A 2IVDA 1TDFA 4H4TA 1WUEA 2GB0A 3NN6X 2B9WA 3R0KA 3M13A 3DESA 3UP5A 4K7ZA 2P88A 4UDRA 4AT2A 4ZN0A 4H7UA 1B5QA 5KMSA 2GRTA 2PPGA 3H4KA 2WPCA 2C7GA 2XVEA 2QJNA 2GR2A 3SN1A 3AM9A 1PXBA 1PS9A 4U8PA 4H4RA 2WESA 4J31A 3UOYA 3KA7A 2OX4A 3OP2A 1NG3A 2V3BA 5JCLA 1ZXIC 3LB8A 4X2PA 1D4EA 1JU2A 1PHHA 2R0PA 1KKRA 3MUCA 3FJ4A 3AE4A 5FMHA 3IJIA 1XPQA 4N9XA 4GDEA 3H12A 2X8CA 4AP1A 2C4CA 3I6DA 4G73A 1MO9A 3SY4A 3D47A 2BYBA 3NTDA 3OTRA 4X9NA 4CRTA 4JN9A 3IJQA 1JPMA 3DJDA 1BF3A 4EM4A 3CGEA 4K8DA 3OC4A 4DX3A 4M0XA 1RSGA 1X2GA 3L5OA 1IUVA 3P4PA 1O94A 4IZGA 4MMWA 1RM6B 3UTHA 3RITA 2WU5A 3R25A 4Z43A 3ISHA 1X2HA 1FEAA 3TW9A 4C3XA 1OEPA 1COYA 4I59A 4LU6A 1OJAA 3DMEA 1BWCA 4RSLA 3UJRA 3NZGA 2BA9A 3UKQA 3DK4A 3EPTA 2AKZA 2PP0A 2JKCA 4BV6A 3BOXA 4II3A 3AEGA 3H70A 3UCLA 1E1KA 2WOIA 3QKEA 2FBWA 4FK1C 1DTNA 4U8KA 1ZY8A 4NWZA 3BJSA 3AE3A 3NRNA 4AT0A 4MKSA 3FVDA 1H84A 2XLUA 4A5LA 4A6NA 2FJAA 3H7VA 2PP3A 1PXCA 2GV8A 1KNPA 3CXOA 3SZCA 2PGWA 4YTPA 2OKTA 3DIPA 3SXIA 2QDEA 5KOXA 3NXLA 3P0WA 5ER0A 3KU9A 3ZLFA 3RCYA 5HHFA 4H2PA 2OZ8A 4JN7A 3UXLA 4DWDA 3BHFA 4O5UA 2XVJA 2HXUA 1N61C 4ZCWA 1NENA 1PN0A 1E1NA 3AEAA 5HY5A 4USQA 3P1WA 3P4RA 2OO6A 2ONEA 4H4UA 4J36A 2GMHA 3T37A 1QLBA 1GSNA 4U8LA 1OJDA 1YKJA 3H8IA 4IHCA 3ZLGA 2Q0LA 4LIIA 2YWLA 3QTPA 3REDA 3D46A 3V76A 3EEZA 1L9DA 3V3OA 1PJ5A 1GRTA 1LV0A 4GYPC 2BXRA 3AB1A 3R10A 3AWIA 5J04A 4IP4A 4UP3A 2GAHB 3B9JB 3QFAA 3SGLA 2OLAA 3UKAA 2GGIA 2OA1A 1T3QC 2PTZA 2ACZA 1Q1RA 2WHDA 1MUCA 2RGHA 3CGDA 3CGBA 5KVIA 2WBAA 2WETA 2OQHA 2TPRA 3V3WA 4G74A 5CQFA 5IDZA 4E5TA 2NQLA 5IPYA 2XVIA 3SZ0A 3VRBA 2X3NA 3DG7A 3T9PA 1MOKA 2Q6UA 3FG2P 3Q9TA 4H4WA 4KX6A 1SJCA 2PODA 5DBJA 2YM2A 2DW6A 2E4GA 1KSSA 3UOVA 1PBEA 3UKFA 2BK4A 3JZUA 2AR8A 2X8GA 3BNUA 2P3ZA 3CT2A 1ONEA 2XLSA 3PFRA 3FYYA 3AD8B 3NRZB 1P2HA 2PGEA 4G8TA 1LQUA 2C76A 1XANA 2WOWA 4CCQA 2O9ZA 1PJ6A 2YG7A 2ZC8A 4B69A 2FJBA 2JBVA 4XWZA 2XLTA 3GYXA 4EQWA 5EBKA 2HNEA 2RGJA 1H81A 4H50A 3F8RA 3UKHA 4A35A 3HW2A 3NH3X 2JK6A 2PSNA 4AOSA 4CY8A 1AOGA 4GCMA 1K0JA 1ZKQA 3BHKA 2BC1A 3HYWA 3EKGA 1EC9A 2C3DA 2ARDA 2VQ7A 4H4QA 2WDVA 4OCGA 3S61A 2WQYA 1M6IA 2PA6A 3ICTA 4J1OA 3UOZA 3KD9A 1F8RA 3K7MX 3NVZB 3ADAB 4H4ZA 2GGGA 2IIDA 2PHHA 3TWAA 1KNRA 3A7AA 3KKJA 4OPIA 1JROA 2WS3A 4O5QA 3PVCA 3GSIA 3K7QX 4NEWA 2YG3A 3GMCA 4B63A 3IC9A 2XH4A 4YWSA 2FYMA 5J60A 3V3NA 1FOHA 3M12A 1GTHA 4GGHA 3LJPA 4EIPA 1TE6A 3HZLA 5KNLA 2BK3A 3UTEA 4RG4A 2BC0A 2P0IA 1N4UA 3SX6A 2C72A 4U2LA 3VFCA 4DGKA 2BCPA 4H4XA 3F8DA 3NK2X 4A6GA 2QDDA 3L8KA 5TR3A 2QJJA 1YQ3A 3F8PA 4B66A 4GAPA 1SJDA 3NN0X 2PP1A 2FJEA 3FV9A 3NKSA 1MDLA 1S7MA 5M0ZA 1OJTA 3RNMA 2GL5A 2EQ6A 3SFDA 3NO1A 3SM8A 2QQ6A 1N60C 4J3ZA 4GGBA 1JRZA 3NK1X 5FJPA 4TLXA 3AEDA 4A6NB 4A79A 2Z5YA 2XH2A 1REOA 1RVKA 4H1ZA 1SEZA 2C3CA 2B76A 5FJTA 4LA1A 5KOWA 3VC6A 1EL9A 1NEKA 2ZZ0A 1L8PA 3V4BA 4TM3A 3A7UA 3CB3A 1NHRA 1FEBA 2BRAA 3NHOX 2Q7VA 3DJEA 3G5RA 4OPDA 3UTFA 1UKVG 3TTEA 2WPEA 3T0KA 1D4DA 2C73A 4G6GA 2V6OA 4J33A 3CYJA 4TM0A 3RRAA 2R0GA 2IVEA 1XHCA 1DNCA 1EBDA 4U8MA 3P3BA 4IT1A 2P8BA 2GGEA 2Y6RA 3TQPA 4DHGA 3L1RA 2PCEA 2H88A 3GO2A 1GRGA 1OJCA 4G9KA 3UGVA 4I58A 4KPLA 3FMWA 2XVHA 1KFYA 1GRAA 2FKPA 1H83A 4EMJA 4WX1A 3CNJA 2GAGB 4IP5A 1XDIA 1DOCA 4K5RA 1TYTA 1EC8A 3ES8A 2B7RA 4NEVA 4UDPA 4E0VA 5U63A 5JRBA 4NZHA 3II4A 3MKCA 2QAEA 4H2HA 3VQRA 3IJLA 1BKWA 4E4FA 4EQSA 3UKPA 4G6HA 2X8HA 2EQ9A 1PJ7A 3AN1A 4GUVA 1N62C 4X4JA 1S2YA 4EM3A 3CPHG 4H83A 4Z44A 3RO6A 1GALA 2VVLA 1BQGA 2XFPA 4H4SA 1IUWA 1N1PA 1VQWA 4K1WA 3MQTA 4JQ9A 1DOBA 5EOWA 4CCRA 1L0VA 1K4QA 5KMPA 3I6TA 1JNZA 2WP6A 3IF9A 4C5OA 1FFUC 3AXBA 3IHMA 3DA1A 2XSXA 3KLJA 3R07C 3DK9A 2YLSA 4A99A 3PWIA 3NYCA 3DDMA 4A3RA 4Z24A 4NTDA 2JAEA 4OPUA 3NVWB 1VRQB 1GESA 3QSSA 3QPEA 3S5SA 1WUFA 3O0HA 3U4FA 2GGHA 1FFVC 3QFBA 2GR1A 1R0MA 2XFNA 3DG3A 1BGJA 2APGA 1YEYA 2CHRA 2FJDA 3GYJA 4DNAA 2WPFA 3CPJG 3BNMA 3P4SA 2XVFA 3JW7A 1GEUA 3UXKA 2PS2A 4U2SA 5L46A 1FIQB 3GRTA 2ZZCA 4GR1A 2EQ8A 4J57A 2GR0A 2XFQA 2BK5A 3N6HA 1QJDA 2B7SA 4A9WA 2OAMA 3AEEA 4NTCA 4OPLA 4ZCDA 3VRDB 1ZMDA 1CC4A 1EBHA 1MRAA 4G7FA 1KF6A 1S3EA 2QA1A 4JDRA 1IYXA 4IA6A 3AEFA 1H86A 1FL2A 3AD7B 2AKMA 2CVJA 4OPTA 3D1CA 4D03A 1F8WA 1D5TA 2YG4A 4A7AA 1JPDX 1E1MA 1B8SA 3UJEA 4K2XA 1TRBA 2R0CA 4USRA 4ZA0A 2J3NA 4GRTA 2XFOA 1Q1WA 4HCHA 3Q4DA 4BURA 1ZX9A 4BJZA 2YG6A 4YSYA 4ZOHB 3DH9A 3R9UA 2OVLA 1LJ1A 2A8XA 3FCPA 4EQXA 2WP9A 3AE1A 4FI4A 1YY5A 1Z6LA 3QVRA 2JB1A 1MNSA 1CC6A 2YVJA 3GWFA 3UCCA 4H2NA 2W3SA 2HQMA 1TDNA 3AECA 2QGYA 3VR9A 3AE5A 3BI5A 5FS7A 1F9CA 3AE9A 4YKGA 3B97A 5FJUA 3SQPA 4FK1A 4Y4MA 1VG9A 2GSHA 3K7TA 2QVHA 4H2QA 3FXGA 5JCIA 1H2IA 1ZOVA 2HZGA 1DOEA 3VC5A 2CULA 1Q9IA 5KMQA 1Y0PA 2GGJA 4ROPA 1JDFA 4IVOB 3IHGA 1DJNA 3DK8A 2R9ZA 2XH0A 1KCZA 2TMDA 1LVLA 1PBCA 3R0UA 5C3JA 2W3RA 4TVYA 1LPFA 2WU2A 4MJWA 4GF7A 5IQ4A 1FECA 4YXDA 3GRSA 4IL2A 1VDCA 3R11A 1QO8A 2Y6QA 2BS2A 2GQFA 3T8QA 4KWSA 4OPCA 4B67A 1O95A 3M0OA 3JVAA 1V59A 1GRHA 1HYUA 2V5ZA 4GDPA 1F3PA 4ICYA 3QSMA 2E5VA 4HCLA 4GFIA 1ZDLA 3SQSA 3ICSA 3TCSA 3VA8A 5FS6A 4BK2A 2WOVA 2PU0A 1NDAA 3C4NA 2C70A 2DKHA 2V60A 4GYPA 1B37A 1JNRA 2WEUA 4Y4LA 2GVCA 3AE2A 1EL8A 3TJIA 1E7PA 4B64A 2W54A 3LADA 2DKIA 3GY1A 1CJ2A 1ZOYA 2YLXA 1FHVA 5U25A 1IUXA 1P48A 2X99A 3H8LA 1FCDA 3NFUA 3CN8A 3T2YA 5BULA 4B65A 4BK3A 1TDEA 1M64A 2VOUA 1ZMCA 1PDZA 3OZMA 3FPZA 4Z2TA 4GIRA 2XLPA 2ZBWA 4IV9A 3S47A 3D9XA 2C65A 3RP6A 1WYGA 2ZADA 3NLCA 4HA6A 5G5GB 3IK4A 4YSXA 1GREA 1CF3A 4U8NA 2QCUA 4APNA 5BUKA 3UKKA 1IUTA 1D7LA 3MSYA 1E9IA 4E6MA 1P2EA 1IJHA 4JN8A 5FJRA 1GTEA 3EAOA 4ENLA 4TM1A 2E5AA 2NPXA 1PBBA 5HYMA 1NHSA 1GNDA 5JCKA 4Z25A 1TDOA 4DYEA 1Y56A 1GERA 1KN0A 4B68A 3NIXA 3AYIA 2C66A 3NVVB 1N5XA 4YWOA 2W0HA 2JB2A 3DFYA 3BSMA 2CDUA 4CY6A 3DG6A 1VDVA 4CNJA 5KRQA 3N4EA 3STPA 1GRBA 3DGBA 2XYOA 4J56A 3V5FA 1IUUA 4D04A 3KUMA 4U2TA 3H8AA 7ENLA 3UCDA 4FX9A 3IWAA 1F6MA 4YT0A 3U9IA 3OW1A 3LXDA 1V97A 1NHPA 1ELIA 4U8IA 1JCTA 2AQJA 4AP3A 2PYXA 1FO4A 5BVAA 4X9MA 3AYLA 6ENLA 2UZZA 2QA2A 4GMEA 2P8CA 3OPSA 3CTYA 3CIRA 4NNJA 2POZA 3CK5A 3CMMA 2BABA 3GMBA 1OJ9A 4XXGA 2YVGA 3PK7A 4HCDA 3ENLA 1JRXA 3ALMA 3G5SA 3SZWA 4IVMB 3AE8A 4XWRA 3ETRB 3EUB3 4KPRA 2GR3A 1KKOA 2PTXA 2RDXA 3AE7A 3ZVHA 3I6EA 2GH5A 1TYPA 3SN0A 3CNSA 1BKHA 1GT8A 2PTWA 2YQUA 5GRTA 3T31A 3KPFA 2VQBA 2AAQA 1PBDA 1N63C 4HPNA 2B9XA 1LTXR 2Z5XA 4ECHA 3SSZA 5ENLA 1L9EA 2Q0KA 1KDGA 5EB4A 4TLZA 4HN8A 1CJ3A 4WCTA 4A65A 5HXIA 2BXSA 4EMWA 1K0LA 4H4YA 2A89A 4II2A 3JSKA 5JCMA 3I3LA 1CHUA 3GC2A 3Q45A 3AEBA 4K8GA 3SBFA 4KT2A 4TVWA 1PDHA 4C3YA 1FHUA 1H6VA 2JB3A 3QJ4A 2RGOA 4H4PA 3AYJA 3CNDA 3N4FA 4RG3A 5LV9A 4U8OA 1BZLA 2GQWA 3CGCA 2YR4A 3SYIA 1DODA 3E1TA 2MNRA 3PS9A 2YM1A 2H89A 4K5SA 3EF6A 1JRYA 2PTYA 1O5WA 4YKFA 2W55A 3GDPA 3VR8A 4H2RA 4ZCCA 1D7YA 4KEMA 4DSHA 3NG7X 2XCGA 3PO7A 3B6DA 4H4VA 1ECQA 2YAUA 5EB5A 3MWCA 5CKUA 2OZTA 2OZ3A 3ZVIA 5C2TA 3UKLA 3ABVA 4EIQA 1B4VA 4GAVA 3K30A 3PWGA 1EC7A 1ZP0A 1S3BA 4M52A 3D8XA 1P43A 1X31B 3NYFA 1L9CA 2OG9A 3C4AA
chains in the Genus database with same CATH topology
2C7GA 2XVEA 3BI2A 4B67A 1O95A 2GR2A 3M0OA 3SFEA 3UP4A 1V59A 1GRHA 1YQ3A 3F8PA 1HYUA 2V5ZA 1PXBA 1PS9A 4GAPA 4B66A 4U8PA 4H4RA 4GDPA 2WESA 4J31A 3UOYA 1F3PA 2GEWA 2R46A 3KA7A 3NN0X 4ICYA 3QSMA 1NG3A 2FJEA 2E5VA 2V3BA 5JCLA 3NKSA 4OVIA 2BS3A 1S7MA 5M0ZA 3LB8A 3HYVA 1OJTA 1D4EA 1ZDLA 1JU2A 3RNMA 3ICSA 1PHHA 3T2ZA 5FS6A 3B3RA 3DJJA 2EQ6A 3SFDA 4BK2A 4EMIA 2WOVA 2R0PA 3SM8A 5U1OA 1NDAA 3C4NA 2C70A 3ZYXA 2DKHA 2V60A 3AE4A 4JNQA 1B37A 5FMHA 1EL5A 1JNRA 1JRZA 1XPQA 2WEUA 4N9XA 4Y4LA 2VVLG 2GVCA 3AE2A 1H82A 3NK1X 4GDEA 2X8CA 1EL8A 4AP1A 3RP8A 2C4CA 1E7PA 3FIMB 3I6DA 1E39A 4G73A 4TLXA 4BK1A 3AEDA 4A6NB 4B64A 1MO9A 4A79A 2Z5YA 1Y56B 1GV4A 3SY4A 3LADA 1REOA 2DKIA 2R4EA 3CNTA 1CJ2A 1SEZA 2C3CA 1CBOA 3T14A 2BYBA 4FDCB 3NTDA 3OZ2A 4JY2A 2X50A 2B76A 1VG0A 3ITJA 4LA1A 1ZOYA 4X9NA 4CRTA 1F8SA 5KOWA 4JN9A 2YLXA 1NG4A 2WP5A 5FS8A 1RP0A 3DJDA 5U25A 1IUXA 4YSHA 1EL9A 1BF3A 1NEKA 4EM4A 3CGEA 2ZZ0A 4K8DA 3OC4A 3P9UA 3GWDA 2X99A 1RSGA 1FCDA 3H8LA 4REKA 4TM3A 4YSZA 1NHRA 3L5OA 3CN8A 1FEBA 2BRAA 2BRYA 5IQ1A 3T2YA 3NGCX 5BULA 3NHOX 1IUVA 2Q7VA 3DJEA 3FBSA 4B65A 4BK3A 1TDEA 3AD9B 1M64A 2VOUA 3G5RA 4OPDA 1ZMCA 1UKVG 3UTFA 4Z2TA 3FPZA 3P4PA 1O94A 2WPEA 4J2WA 3T0KA 1E6EA 2B9YA 2XLPA 1D4DA 3DGHA 2C73A 4G6GA 5J7XA 3UTHA 2V6OA 2ZBWA 4IV9A 2WU5A 4J33A 3DJGX 4TM0A 4Z43A 3D9XA 2R0GA 2IVEA 1XHCA 3ISHA 2C65A 3ATRA 1DNCA 1EBDA 2VVMA 3RP6A 4U8MA 1FEAA 3NT6A 3NLCA 4UDQA 3LZWA 4HA6A 2Y6RA 4C3XA 1LQTA 3LZXA 5M10A 1COYA 3L1RA 4I59A 2H88A 4LU6A 1OJAA 3DMEA 1GRGA 1OJCA 3GD4A 2VRLA 3ALLA 4YSXA 1BWCA 3C96A 4G9KA 4I58A 4RSLA 3FMWA 2XVHA 1KFYA 4EQRA 1PXAA 1GREA 1GRAA 1H7XA 2BA9A 1CF3A 4U8NA 1H83A 2QCUA 4APNA 3UKQA 3SZFA 4DSGA 3DK4A 4EMJA 3EPTA 5BUKA 2JKCA 4WX1A 3CNJA 3UKKA 3RHAA 4BV6A 1IUTA 1D7LA 1ONFA 4II3A 3ICRA 2GAGB 3AEGA 1DOCA 1XDIA 1W4XA 4K5RA 1TYTA 3UCLA 1P2EA 1IJHA 1E1KA 2WOIA 1GTEA 2B7RA 2C75A 3EAOA 2FBWA 4NEVA 4FK1C 4UDPA 5U63A 4U8KA 4E0VA 5JRBA 4TM1A 1ZY8A 2NPXA 1PBBA 4NWZA 4NZHA 3AE3A 5HYMA 1NHSA 1GNDA 3II4A 4K22A 5JCKA 1EL7A 4IA5A 2C64A 4Z25A 3NRNA 4AT0A 1H84A 1NPXA 2QAEA 2XLUA 3VQRA 1TDOA 2OLNA 4A5LA 4A6NA 2FJAA 1BKWA 1Y56A 1DJQA 3PG6A 5JCNA 1PXCA 4EQSA 3UKPA 1GERA 1KN0A 4G6HA 3NIXA 4B68A 2GV8A 3AYIA 2X8HA 1KNPA 2EQ9A 2V3AA 2C66A 4J34A 1PJ7A 4YWOA 3SZCA 4YTPA 2W0HA 3Q6JA 4GUVA 3SXIA 3ZDNA 5KOXA 2XLRA 4X4JA 1S2YA 4EM3A 5ER0A 2YR6A 3CPHG 2JB2A 1D4CA 3KU9A 4HB9A 5HHFA 1GALA 4H2PA 4Z44A 2CDUA 2GF3A 3CPIG 2VVLA 4CNKA 4JY3A 4CY6A 4CNJA 2XFPA 4H4SA 3DGZA 1IUWA 2YVFA 3BHFA 4O5UA 5KRQA 1N1PA 1VQWA 2XVJA 1NENA 1GRBA 4PABA 2XYOA 4J56A 1PN0A 4JQ9A 1IUUA 1DOBA 1E1NA 3AEAA 5EOWA 4CCRA 1L0VA 4D04A 1GETA 1NHQA 5HY5A 4AOXA 4U2TA 4USQA 3P1WA 1K4QA 3P4RA 5KMPA 4FX9A 3IWAA 1F6MA 4H4UA 1JNZA 4J36A 4YT0A 2GMHA 2WP6A 3LXDA 3T37A 1QLBA 3IF9A 1GSNA 4U8LA 1NHPA 4C5OA 1OJDA 3GD3A 1ELIA 4U8IA 2CFYA 1GXFA 1YKJA 4PAAA 4JNAA 3QVPA 2YLZA 2AQJA 3H8IA 4AP3A 2PYXA 2XFUA 3AXBA 3DA1A 3IHMA 5BVAA 2Q0LA 4X9MA 4LIIA 3KLJA 2YWLA 4CBQA 3REDA 3V76A 3GDNA 3AYLA 1L9DA 3DK9A 2UZZA 4YTNA 2YLSA 2QA2A 4A99A 3V3OA 1PJ5A 2E1MA 1GRTA 1LV0A 2BXRA 3NYCA 4Y4NA 3AB1A 4TM4A 3CTYA 4Z24A 3CIRA 4NTDA 1YQZA 4NNJA 2I0ZA 2F5ZA 2JAEA 1TDKA 3AWIA 4OPUA 4ADWA 1VRQB 2C67A 5KVHA 3CMMA 2BABA 1CC2A 2WDQA 1GESA 2GAHB 3GMBA 4UP3A 2YG5A 1CJCA 1OJ9A 3QFAA 3QSSA 3SGLA 3UKAA 4XXGA 2YVGA 2OA1A 2YR5A 3O0HA 1IUSA 3G5QA 2YLRA 2ACZA 1Q1RA 2WHDA 1GPEA 3QFBA 3GYIA 2GR1A 2YLWA 2RGHA 2XFNA 3CGDA 3CGBA 1BGJA 1JRXA 1N4VA 2APGA 2BCGG 5KVIA 3ALMA 3G5SA 4IVMB 3AE8A 2WBAA 4XWRA 2WETA 1K0IA 2FJDA 3GYJA 2TPRA 3BI4A 3S5WA 4B1BA 4KPRA 4DNAA 2WPFA 3CPJG 4G74A 2GR3A 3BNMA 1ZK7A 5CQFA 3P4SA 2XVFA 5IPYA 4OPGA 3AE7A 1GEUA 2XVIA 3SZ0A 3VRBA 2NVKX 4U2SA 2X3NA 2GH5A 5L46A 1TYPA 3GRTA 2ZZCA 3CNSA 4GR1A 1MOKA 2Q6UA 3FG2P 2EQ8A 4J57A 2GR0A 2XFQA 3Q9TA 2BK5A 4H4WA 1GT8A 4KX6A 5DBJA 2YQUA 5GRTA 2YM2A 1QJDA 2B7SA 3T31A 3KPFA 4Z26A 2EQ7A 2VQBA 4A9WA 2AAQA 1KSUA 1KSSA 2E4GA 1PBDA 3NNEA 2OAMA 3AEEA 4NTCA 3UOVA 1PBEA 3UKFA 2BK4A 4OPLA 2B9XA 1LTXR 2Z5XA 4ECHA 2BS4A 2AR8A 4ZCDA 3VRDB 2X8GA 1ZMDA 1CC4A 3AE6A 3BNUA 1KF6A 1L9EA 2Q0KA 3ATQA 3ALJA 3VRAA 1S3EA 1KDGA 1JOAA 2QA1A 4JDRA 4IA6A 5EB4A 3URHA 4TLZA 2OLOA 3WE0A 2XLSA 1CJ3A 4WCTA 4A65A 5HXIA 3AEFA 3QSEA 2BXSA 1H86A 4EMWA 1FL2A 3AD7B 3AD8B 1CJ4A 1CL0A 1K0LA 2CVJA 1P2HA 4OPTA 1PBFA 2C76A 1LQUA 4H4YA 3EANA 1XANA 2WOWA 2A89A 2V61A 3D1CA 2O9ZA 4II2A 4CCQA 3CNPA 3JSKA 5JCMA 1PJ6A 2YG7A 3I3LA 1CHUA 3AEBA 4B69A 1GOSA 4D03A 2RABA 1F8WA 1D5TA 1NAAA 2GMJA 2YG4A 2FJBA 2JBVA 4XWZA 2XLTA 3GYXA 4A7AA 4EQWA 3P4QA 1E1MA 5EBKA 1B8SA 2R4JA 4K2XA 1TRBA 1RYIA 2R0CA 4Z2RA 4P9SA 4USRA 3RP7A 5KXJA 2RGJA 1H81A 2J3NA 1PDHA 4C3YA 2WDRA 4H50A 4GRTA 3F8RA 2XFOA 3T2KA 3UKHA 3NH3X 1Q1WA 1H6VA 4BURA 3KVEA 2JB3A 3UOXA 2JK6A 2XDOA 3QJ4A 4AOSA 1AOGA 2RGOA 4GCMA 4CY8A 1K0JA 1ZKQA 4H4PA 1ZX9A 2BC1A 3BHKA 3HYWA 4BJZA 5KWFA 2YG6A 1H7WA 2C3DA 5FS9A 2ARDA 3AYJA 5GSNA 4YSYA 3DH9A 5KMRA 3R9UA 3CNDA 2VQ7A 3COXA 3SZWA 4H4QA 1LJ1A 2A8XA 4EQXA 2WDVA 2WP9A 4OCGA 3AE1A 3S61A 1YY5A 4RG3A 1Z6LA 2WQYA 5LV9A 3QVRA 4U8OA 2JB1A 1BZLA 2GQWA 3LOVA 1CC6A 3CGCA 1S2QA 1M6IA 2YVJA 2YR4A 3GWFA 3HYXA 3ICTA 3SYIA 4BJYA 3UOZA 4H2NA 1DODA 5BRTA 3KD9A 2HQMA 1F8RA 4NTEA 1TDNA 3AECA 3K7MX 3ADAB 3VR9A 3E1TA 4H4ZA 3AE5A 2A87A 3PS9A 4YTMA 2IIDA 2PHHA 2YM1A 3BI5A 1KNRA 3NYEA 5FS7A 3KKJA 2H89A 3AE9A 4YKGA 4K5SA 3SQPA 4FK1A 3EF6A 1BGNA 2VRMA 1VG9A 1JRYA 3K7TA 4Y4MA 1JEHA 4H2QA 4OPIA 5JCIA 3UTGA 1O5WA 1H2IA 1YQ4A 4YKFA 1ZOVA 2WS3A 3GDPA 1DXLA 3VR8A 4O5QA 1GRFA 1DOEA 3PVCA 4H2RA 3GSIA 3K7QX 2CULA 4NEWA 1Q9IA 2YG3A 1MXTA 1D7YA 4ZCCA 5KMQA 1E1LA 4DSHA 2R45A 3NG7X 2XCGA 1Y0PA 3GMCA 3KPKA 3PO7A 4B63A 3IC9A 2BACA 4IVOB 3IHGA 3B6DA 1DJNA 4Z2UA 3DK8A 4H4VA 3NK0X 2R9ZA 1N4WA 5J60A 3V3NA 2YAUA 2TMDA 1FOHA 5EB5A 4C77A 1LVLA 3M12A 1PBCA 4U8JA 1GTHA 5CKUA 5C3JA 2VZ2A 2ZZBA 3LJPA 3NTAA 4EIPA 3HZLA 5C2TA 5KNLA 2BK3A 2YLTA 3UTEA 2OALA 3ABVA 3UKLA 4RG4A 4EIQA 1LPFA 4C74A 2IVDA 1B4VA 1TDFA 2BC0A 4H4TA 4GAVA 3K30A 3NN6X 2GB0A 2WU2A 1N4UA 2B9WA 4MJWA 4GF7A 3SX6A 5IQ4A 2C72A 1FECA 1S3BA 1ZP0A 3M13A 4U2LA 4YXDA 3GRSA 4M52A 1VDCA 3D8XA 3UP5A 4K7ZA 4UDRA 4AT2A 1QO8A 2Y6QA 1B5QA 4H7UA 4DGKA 1X31B 2BCPA 4ZN0A 5KMSA 3NYFA 4H4XA 2BS2A 1L9CA 2GQFA 2GRTA 3F8DA 3H4KA 3NK2X 2WPCA 3C4AA 4OPCA 3L8KA 5TR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C7G A;  2XVE A;  3BI2 A;  4B67 A;  1O95 A;  2GR2 A;  3M0O A;  3SFE A;  3UP4 A;  1V59 A;  1GRH A;  1YQ3 A;  3F8P A;  1HYU A;  2V5Z A;  1PXB A;  1PS9 A;  4B66 A;  4U8P A;  4H4R A;  4GDP A;  2WES A;  4J31 A;  3UOY A;  1F3P A;  2GEW A;  2R46 A;  3KA7 A;  3NN0 X;  4ICY A;  3QSM A;  1NG3 A;  2FJE A;  2E5V A;  2V3B A;  5JCL A;  3NKS A;  4OVI A;  2BS3 A;  5M0Z A;  3LB8 A;  1OJT A;  1D4E A;  1ZDL A;  1JU2 A;  3RNM A;  3ICS A;  1PHH A;  5FS6 A;  3B3R A;  3DJJ A;  2EQ6 A;  3SFD A;  4BK2 A;  4EMI A;  2WOV A;  2R0P A;  3SM8 A;  5U1O A;  1NDA A;  3C4N A;  2C70 A;  3ZYX A;  2DKH A;  2V60 A;  3AE4 A;  4JNQ A;  1B37 A;  5FMH A;  1EL5 A;  1JNR A;  1JRZ A;  1XPQ A;  2WEU A;  4N9X A;  4Y4L A;  2VVL G;  2GVC A;  3AE2 A;  1H82 A;  3NK1 X;  4GDE A;  2X8C A;  1EL8 A;  4AP1 A;  3RP8 A;  1E7P A;  3FIM B;  3I6D A;  1E39 A;  4TLX A;  4BK1 A;  3AED A;  4A6N B;  4B64 A;  1MO9 A;  4A79 A;  2Z5Y A;  1Y56 B;  1GV4 A;  3LAD A;  1REO A;  2DKI A;  2R4E A;  3CNT A;  1CJ2 A;  1SEZ A;  2C3C A;  1CBO A;  2BYB A;  4FDC B;  3NTD A;  3OZ2 A;  4JY2 A;  2X50 A;  2B76 A;  1VG0 A;  3ITJ A;  4LA1 A;  1ZOY A;  4X9N A;  4CRT A;  1F8S A;  5KOW A;  4JN9 A;  2YLX A;  1NG4 A;  2WP5 A;  5FS8 A;  1RP0 A;  3DJD A;  5U25 A;  1IUX A;  4YSH A;  1EL9 A;  1BF3 A;  1NEK A;  4EM4 A;  3CGE A;  2ZZ0 A;  4K8D A;  3OC4 A;  3P9U A;  3GWD A;  2X99 A;  1RSG A;  1FCD A;  3H8L A;  4REK A;  4TM3 A;  4YSZ A;  1NHR A;  3CN8 A;  1FEB A;  5IQ1 A;  3NGC X;  5BUL A;  3NHO X;  1IUV A;  2Q7V A;  3DJE A;  3FBS A;  4B65 A;  4BK3 A;  1TDE A;  3AD9 B;  1M64 A;  2VOU A;  3G5R A;  4OPD A;  1ZMC A;  1UKV G;  3UTF A;  4Z2T A;  3FPZ A;  3P4P A;  1O94 A;  2WPE A;  4J2W A;  1E6E A;  2B9Y A;  2XLP A;  1D4D A;  3DGH A;  2C73 A;  5J7X A;  3UTH A;  2V6O A;  2ZBW A;  4IV9 A;  2WU5 A;  4J33 A;  3DJG X;  4TM0 A;  4Z43 A;  2R0G A;  2IVE A;  1XHC A;  3ISH A;  2C65 A;  3ATR A;  1DNC A;  1EBD A;  2VVM A;  3RP6 A;  4U8M A;  1FEA A;  3NT6 A;  3NLC A;  4UDQ A;  3LZW A;  4HA6 A;  2Y6R A;  4C3X A;  1LQT A;  3LZX A;  5M10 A;  1COY A;  3L1R A;  4I59 A;  2H88 A;  4LU6 A;  1OJA A;  3DME A;  1GRG A;  1OJC A;  3GD4 A;  2VRL A;  3ALL A;  4YSX A;  1BWC A;  3C96 A;  4I58 A;  4RSL A;  3FMW A;  2XVH A;  1KFY A;  4EQR A;  1PXA A;  1GRE A;  1GRA A;  1H7X A;  2BA9 A;  1CF3 A;  4U8N A;  1H83 A;  2QCU A;  4APN A;  3UKQ A;  4DSG A;  3DK4 A;  4EMJ A;  3EPT A;  5BUK A;  2JKC A;  4WX1 A;  3CNJ A;  3UKK A;  3RHA A;  4BV6 A;  1IUT A;  1D7L A;  1ONF A;  3ICR A;  2GAG B;  3AEG A;  1DOC A;  1XDI A;  1W4X A;  4K5R A;  1TYT A;  3UCL A;  1P2E A;  1IJH A;  1E1K A;  2WOI A;  1GTE A;  2B7R A;  2C75 A;  3EAO A;  2FBW A;  4NEV A;  4FK1 C;  4UDP A;  5U63 A;  4U8K A;  4E0V A;  4TM1 A;  1ZY8 A;  2NPX A;  1PBB A;  4NZH A;  3AE3 A;  5HYM A;  1NHS A;  1GND A;  3II4 A;  4K22 A;  5JCK A;  1EL7 A;  4IA5 A;  2C64 A;  4Z25 A;  3NRN A;  4AT0 A;  1H84 A;  1NPX A;  2QAE A;  2XLU A;  3VQR A;  1TDO A;  2OLN A;  4A5L A;  4A6N A;  2FJA A;  1BKW A;  1Y56 A;  1DJQ A;  5JCN A;  1PXC A;  4EQS A;  3UKP A;  1GER A;  4B68 A;  3NIX A;  2GV8 A;  3AYI A;  2X8H A;  1KNP A;  2EQ9 A;  2C66 A;  2V3A A;  4J34 A;  1PJ7 A;  4YWO A;  4YTP A;  2W0H A;  3Q6J A;  4GUV A;  5KOX A;  3ZDN A;  2XLR A;  4X4J A;  1S2Y A;  4EM3 A;  5ER0 A;  2YR6 A;  3CPH G;  2JB2 A;  1D4C A;  3KU9 A;  4HB9 A;  5HHF A;  1GAL A;  4H2P A;  4Z44 A;  2CDU A;  2GF3 A;  3CPI G;  2VVL A;  4CNK A;  4JY3 A;  4CY6 A;  4CNJ A;  2XFP A;  4H4S A;  3DGZ A;  1IUW A;  2YVF A;  3BHF A;  4O5U A;  5KRQ A;  1N1P A;  1VQW A;  2XVJ A;  1NEN A;  1GRB A;  4PAB A;  2XYO A;  4J56 A;  1PN0 A;  4JQ9 A;  1IUU A;  1DOB A;  1E1N A;  3AEA A;  5EOW A;  4CCR A;  1L0V A;  4D04 A;  1GET A;  1NHQ A;  5HY5 A;  4AOX A;  4U2T A;  4USQ A;  3P1W A;  1K4Q A;  3P4R A;  4FX9 A;  3IWA A;  1F6M A;  4H4U A;  1JNZ A;  4J36 A;  4YT0 A;  2GMH A;  2WP6 A;  3LXD A;  3T37 A;  1QLB A;  3IF9 A;  1GSN A;  4U8L A;  1NHP A;  4C5O A;  1OJD A;  3GD3 A;  1ELI A;  4U8I A;  2CFY A;  1GXF A;  1YKJ A;  4PAA A;  4JNA A;  3QVP A;  2YLZ A;  2AQJ A;  3H8I A;  4AP3 A;  2PYX A;  2XFU A;  3AXB A;  3DA1 A;  3IHM A;  5BVA A;  2Q0L A;  4X9M A;  4LII A;  3KLJ A;  2YWL A;  4CBQ A;  3RED A;  3V76 A;  3GDN A;  3AYL A;  1L9D A;  3DK9 A;  2UZZ A;  4YTN A;  2YLS A;  2QA2 A;  4A99 A;  3V3O A;  1PJ5 A;  2E1M A;  1GRT A;  1LV0 A;  2BXR A;  3NYC A;  4Y4N A;  3AB1 A;  4TM4 A;  3CTY A;  4Z24 A;  3CIR A;  4NTD A;  1YQZ A;  2I0Z A;  2F5Z A;  2JAE A;  1TDK A;  3AWI A;  4OPU A;  4ADW A;  1VRQ B;  2C67 A;  5KVH A;  2BAB A;  1CC2 A;  2WDQ A;  1GES A;  2GAH B;  3GMB A;  4UP3 A;  2YG5 A;  1CJC A;  1OJ9 A;  3QFA A;  3QSS A;  3SGL A;  3UKA A;  4XXG A;  2YVG A;  2OA1 A;  2YR5 A;  3O0H A;  1IUS A;  3G5Q A;  2YLR A;  2ACZ A;  1Q1R A;  2WHD A;  1GPE A;  3QFB A;  3GYI A;  2GR1 A;  2YLW A;  2RGH A;  2XFN A;  3CGD A;  3CGB A;  1BGJ A;  1JRX A;  1N4V A;  2APG A;  2BCG G;  5KVI A;  3ALM A;  3G5S A;  4IVM B;  3AE8 A;  2WBA A;  4XWR A;  2WET A;  1K0I A;  2FJD A;  3GYJ A;  2TPR A;  3BI4 A;  3S5W A;  4B1B A;  4KPR A;  4DNA A;  2WPF A;  3CPJ G;  2GR3 A;  3BNM A;  1ZK7 A;  5CQF A;  3P4S A;  2XVF A;  5IPY A;  4OPG A;  3AE7 A;  1GEU A;  2XVI A;  3VRB A;  2NVK X;  4U2S A;  2X3N A;  2GH5 A;  5L46 A;  1TYP A;  3GRT A;  2ZZC A;  3CNS A;  4GR1 A;  1MOK A;  2Q6U A;  3FG2 P;  2EQ8 A;  4J57 A;  2GR0 A;  2XFQ A;  3Q9T A;  2BK5 A;  4H4W A;  1GT8 A;  4KX6 A;  5DBJ A;  2YQU A;  5GRT A;  2YM2 A;  1QJD A;  2B7S A;  4Z26 A;  3KPF A;  2EQ7 A;  2VQB A;  4A9W A;  2AAQ A;  1KSU A;  1KSS A;  2E4G A;  1PBD A;  3NNE A;  2OAM A;  3AEE A;  4NTC A;  3UOV A;  1PBE A;  3UKF A;  2BK4 A;  4OPL A;  2B9X A;  1LTX R;  2Z5X A;  4ECH A;  2BS4 A;  2AR8 A;  4ZCD A;  3VRD B;  2X8G A;  1ZMD A;  1CC4 A;  3AE6 A;  3BNU A;  1KF6 A;  1L9E A;  2Q0K A;  3ATQ A;  3ALJ A;  3VRA A;  1S3E A;  1KDG A;  1JOA A;  2QA1 A;  4JDR A;  4IA6 A;  5EB4 A;  3URH A;  4TLZ A;  2OLO A;  3WE0 A;  2XLS A;  1CJ3 A;  4WCT A;  4A65 A;  5HXI A;  3AEF A;  3QSE A;  2BXS A;  1H86 A;  4EMW A;  1FL2 A;  3AD7 B;  3AD8 B;  1CJ4 A;  1CL0 A;  1K0L A;  2CVJ A;  1P2H A;  4OPT A;  1PBF A;  2C76 A;  1LQU A;  4H4Y A;  3EAN A;  1XAN A;  2WOW A;  2A89 A;  2V61 A;  3D1C A;  2O9Z A;  4CCQ A;  3CNP A;  3JSK A;  5JCM A;  1PJ6 A;  2YG7 A;  3I3L A;  1CHU A;  3AEB A;  4B69 A;  1GOS A;  4D03 A;  2RAB A;  1F8W A;  1D5T A;  1NAA A;  2GMJ A;  2YG4 A;  2FJB A;  2JBV A;  4XWZ A;  2XLT A;  4A7A A;  4EQW A;  3P4Q A;  1E1M A;  5EBK A;  1B8S A;  2R4J A;  4K2X A;  1TRB A;  1RYI A;  2R0C A;  4Z2R A;  4P9S A;  4USR A;  3RP7 A;  5KXJ A;  2RGJ A;  1H81 A;  2J3N A;  1PDH A;  4C3Y A;  2WDR A;  4H50 A;  4GRT A;  3F8R A;  2XFO A;  3UKH A;  3NH3 X;  1Q1W A;  1H6V A;  4BUR A;  3KVE A;  2JB3 A;  3UOX A;  2JK6 A;  2XDO A;  3QJ4 A;  4AOS A;  1AOG A;  2RGO A;  4GCM A;  4CY8 A;  1K0J A;  1ZKQ A;  4H4P A;  1ZX9 A;  2BC1 A;  3BHK A;  5KWF A;  4BJZ A;  2YG6 A;  1H7W A;  2C3D A;  5FS9 A;  2ARD A;  3AYJ A;  5GSN A;  4YSY A;  3DH9 A;  3R9U A;  3CND A;  2VQ7 A;  3COX A;  4H4Q A;  1LJ1 A;  2A8X A;  4EQX A;  2WDV A;  2WP9 A;  4OCG A;  3AE1 A;  3S61 A;  1YY5 A;  4RG3 A;  1Z6L A;  2WQY A;  5LV9 A;  3QVR A;  4U8O A;  2JB1 A;  1BZL A;  2GQW A;  3LOV A;  1CC6 A;  3CGC A;  1S2Q A;  1M6I A;  2YVJ A;  2YR4 A;  3GWF A;  3ICT A;  4BJY A;  3UOZ A;  4H2N A;  1DOD A;  5BRT A;  3KD9 A;  2HQM A;  1F8R A;  4NTE A;  1TDN A;  3AEC A;  3K7M X;  3ADA B;  3VR9 A;  3E1T A;  4H4Z A;  3AE5 A;  2A87 A;  3PS9 A;  4YTM A;  2IID A;  2PHH A;  2YM1 A;  3BI5 A;  1KNR A;  3NYE A;  5FS7 A;  3KKJ A;  2H89 A;  3AE9 A;  4YKG A;  4K5S A;  3SQP A;  4FK1 A;  3EF6 A;  1BGN A;  2VRM A;  1VG9 A;  1JRY A;  3K7T A;  4Y4M A;  1JEH A;  4H2Q A;  4OPI A;  5JCI A;  3UTG A;  1O5W A;  1YQ4 A;  4YKF A;  1ZOV A;  2WS3 A;  3GDP A;  1DXL A;  3VR8 A;  4O5Q A;  1GRF A;  1DOE A;  3PVC A;  4H2R A;  3GSI A;  3K7Q X;  2CUL A;  4NEW A;  1Q9I A;  2YG3 A;  1MXT A;  1D7Y A;  4ZCC A;  1E1L A;  4DSH A;  2R45 A;  3NG7 X;  2XCG A;  1Y0P A;  3GMC A;  3PO7 A;  4B63 A;  3IC9 A;  2BAC A;  4IVO B;  3IHG A;  3B6D A;  1DJN A;  4Z2U A;  3DK8 A;  4H4V A;  3NK0 X;  2R9Z A;  1N4W A;  5J60 A;  3V3N A;  2YAU A;  2TMD A;  1FOH A;  5EB5 A;  4C77 A;  1LVL A;  3M12 A;  1PBC A;  4U8J A;  1GTH A;  5CKU A;  5C3J A;  2VZ2 A;  2ZZB A;  3LJP A;  3NTA A;  4EIP A;  3HZL A;  5C2T A;  2BK3 A;  2YLT A;  3UTE A;  2OAL A;  3ABV A;  3UKL A;  4RG4 A;  4EIQ A;  1LPF A;  4C74 A;  2IVD A;  1B4V A;  1TDF A;  2BC0 A;  4H4T A;  3K30 A;  3NN6 X;  2GB0 A;  2WU2 A;  1N4U A;  2B9W A;  4MJW A;  4GF7 A;  5IQ4 A;  2C72 A;  1FEC A;  1S3B A;  1ZP0 A;  3M13 A;  4U2L A;  4YXD A;  3GRS A;  4M52 A;  1VDC A;  3D8X A;  3UP5 A;  4K7Z A;  4UDR A;  4AT2 A;  1QO8 A;  2Y6Q A;  1B5Q A;  4H7U A;  4DGK A;  1X31 B;  2BCP A;  4ZN0 A;  3NYF A;  4H4X A;  2BS2 A;  1L9C A;  2GQF A;  2GRT A;  3F8D A;  3H4K A;  3NK2 X;  2WPC A;  3C4A A;  4OPC A;  3L8K A;  5TR3 A; 
#chains in the Genus database with same CATH topology
 3BI2 A;  3SFE A;  3UP4 A;  2PMQ A;  4DXK A;  1XS2 A;  2GEW A;  2R46 A;  3THU A;  3TOY A;  3HPF A;  4OVI A;  2BS3 A;  3HYV A;  4DN1 A;  3T2Z A;  1JRP A;  3B3R A;  3DJJ A;  3SN4 A;  4EMI A;  2I5Q A;  5U1O A;  2HXT A;  3ZYX A;  4JNQ A;  1SB3 B;  3RGT A;  1EL5 A;  3ES7 A;  2VVL G;  1H82 A;  3RP8 A;  3FIM B;  1E39 A;  1NEL A;  4BK1 A;  2XH7 A;  1Y56 B;  1GV4 A;  2R4E A;  3CNT A;  2AL2 A;  1CBO A;  3T14 A;  4JHM A;  4FDC B;  3OZY A;  3OZ2 A;  4JY2 A;  2X50 A;  1VG0 A;  3TWB A;  3ITJ A;  1F8S A;  1NG4 A;  2WP5 A;  5FS8 A;  1RP0 A;  4YSH A;  1XPY A;  4Z17 A;  3P9U A;  3GWD A;  4YSZ A;  4REK A;  5BOE A;  2BRY A;  5IQ1 A;  3NGC X;  3FBS A;  3AD9 B;  3R1Z A;  4J2W A;  1E6E A;  2B9Y A;  3DGH A;  5J7X A;  4IL0 A;  3DJG X;  3ATR A;  2VVM A;  1R6W A;  3NT6 A;  3AMZ A;  4UDQ A;  3LZW A;  1LQT A;  3LZX A;  5M10 A;  4H19 A;  5G5H B;  3QLD A;  3GD4 A;  2VRL A;  3ALL A;  3C96 A;  3DEQ A;  4EQR A;  1PXA A;  1H7X A;  3SZF A;  4HYR A;  4DSG A;  3RHA A;  3I4K A;  1ONF A;  3ICR A;  1VQZ A;  1W4X A;  3UJF A;  3NS1 B;  2C75 A;  1N5W C;  4K22 A;  1EL7 A;  4IA5 A;  2C64 A;  2OQY A;  1NPX A;  2OLN A;  1DJQ A;  3PG6 A;  5JCN A;  5EU9 A;  2V3A A;  3MY9 A;  4J34 A;  3MZN A;  3ZVH B;  3Q6J A;  1TKK A;  3ZDN A;  4Z1Y A;  2XLR A;  3HRD C;  2YR6 A;  1D4C A;  4HB9 A;  2GF3 A;  3CPI G;  2E3T A;  4CNK A;  4JY3 A;  3DGZ A;  2YVF A;  3CAW A;  3V5C A;  3VCC A;  3TJ4 A;  4PAB A;  1GET A;  1NHQ A;  3DER A;  4AOX A;  5FJO A;  3GD3 A;  2CFY A;  1GXF A;  4PAA A;  4JNA A;  3QVP A;  2YLZ A;  2XFU A;  4CBQ A;  3GDN A;  4FP1 A;  4YTN A;  2E1M A;  3UJ2 A;  4M6U A;  4E8G A;  4Y4N A;  4TM4 A;  3CXB A;  1YQZ A;  2I0Z A;  2F5Z A;  1TDK A;  4ADW A;  2C67 A;  5KVH A;  1CC2 A;  2WDQ A;  2OFJ A;  2YG5 A;  1CJC A;  2YR5 A;  1IUS A;  3P93 A;  3G5Q A;  2YLR A;  1GPE A;  3GYI A;  1PDY A;  3SJN A;  2YLW A;  2BCG G;  1N4V A;  4GIS A;  1K0I A;  3S5W A;  3BI4 A;  4B1B A;  1ZK7 A;  2PU1 A;  4HNL A;  4OPG A;  2NVK X;  3K1G A;  3VDG A;  3T6C A;  3ZLH A;  2AL1 A;  2O56 A;  4Z26 A;  2EQ7 A;  1KSU A;  3NNE A;  3GD6 A;  4MGG A;  1EBG A;  2BS4 A;  3AE6 A;  3ATQ A;  3ALJ A;  3VRA A;  1W6T A;  1JOA A;  3URH A;  3WE0 A;  2OLO A;  4EWJ A;  3QN3 A;  3QSE A;  1CJ4 A;  1CL0 A;  1PBF A;  3SR6 B;  3EAN A;  2V61 A;  3CNP A;  3RR1 A;  1SJB A;  1GOS A;  2RAB A;  1NAA A;  2GMJ A;  4E4U A;  3P4Q A;  2R4J A;  4Z2R A;  1RYI A;  3NVY B;  4P9S A;  3RP7 A;  5KXJ A;  2WDR A;  3T2K A;  3KVE A;  3UOX A;  2XDO A;  1TZZ A;  5KWF A;  4HNC A;  1H7W A;  5FS9 A;  5GSN A;  1ELS A;  5KMR A;  3COX A;  2DW7 A;  1NU5 A;  3LOV A;  2XGZ A;  1S2Q A;  3HYX A;  4BJY A;  4K2S A;  5BOF A;  5BRT A;  4NTE A;  2A87 A;  4YTM A;  3NYE A;  2GDQ A;  1BGN A;  2VRM A;  1JEH A;  1KD0 A;  3DFH A;  2QJM A;  3UTG A;  1YQ4 A;  3A7R A;  2OPJ A;  1STZ A;  1DXL A;  1GRF A;  1MXT A;  1E1L A;  2R45 A;  3KPK A;  1MDR A;  3N6J A;  3VCN A;  2BAC A;  2AL2 B;  4Z2U A;  3NK0 X;  1N4W A;  3UJS A;  2MUC A;  3T4W A;  4C77 A;  4U8J A;  2VZ2 A;  2ZZB A;  1SJA A;  3NTA A;  2YLT A;  2OAL A;  4F4R A;  4C74 A;  2IVD A;  1TDF A;  4H4T A;  1WUE A;  2GB0 A;  3NN6 X;  2B9W A;  3R0K A;  3M13 A;  3DES A;  3UP5 A;  4K7Z A;  2P88 A;  4UDR A;  4AT2 A;  4ZN0 A;  4H7U A;  1B5Q A;  5KMS A;  2GRT A;  2PPG A;  3H4K A;  2WPC A;  2C7G A;  2XVE A;  2QJN A;  2GR2 A;  3SN1 A;  3AM9 A;  1PXB A;  1PS9 A;  4U8P A;  4H4R A;  2WES A;  4J31 A;  3UOY A;  3KA7 A;  2OX4 A;  3OP2 A;  1NG3 A;  2V3B A;  5JCL A;  1ZXI C;  3LB8 A;  4X2P A;  1D4E A;  1JU2 A;  1PHH A;  2R0P A;  1KKR A;  3MUC A;  3FJ4 A;  3AE4 A;  5FMH A;  3IJI A;  1XPQ A;  4N9X A;  4GDE A;  3H12 A;  2X8C A;  4AP1 A;  2C4C A;  3I6D A;  4G73 A;  1MO9 A;  3SY4 A;  3D47 A;  2BYB A;  3NTD A;  3OTR A;  4X9N A;  4CRT A;  4JN9 A;  3IJQ A;  1JPM A;  3DJD A;  1BF3 A;  4EM4 A;  3CGE A;  4K8D A;  3OC4 A;  4DX3 A;  4M0X A;  1RSG A;  1X2G A;  3L5O A;  1IUV A;  3P4P A;  1O94 A;  4IZG A;  4MMW A;  1RM6 B;  3UTH A;  3RIT A;  2WU5 A;  3R25 A;  4Z43 A;  3ISH A;  1X2H A;  1FEA A;  3TW9 A;  4C3X A;  1OEP A;  1COY A;  4I59 A;  4LU6 A;  1OJA A;  3DME A;  1BWC A;  4RSL A;  3UJR A;  3NZG A;  2BA9 A;  3UKQ A;  3DK4 A;  3EPT A;  2AKZ A;  2PP0 A;  2JKC A;  4BV6 A;  3BOX A;  4II3 A;  3AEG A;  3H70 A;  3UCL A;  1E1K A;  2WOI A;  3QKE A;  2FBW A;  4FK1 C;  1DTN A;  4U8K A;  1ZY8 A;  4NWZ A;  3BJS A;  3AE3 A;  3NRN A;  4AT0 A;  4MKS A;  3FVD A;  1H84 A;  2XLU A;  4A5L A;  4A6N A;  2FJA A;  3H7V A;  2PP3 A;  1PXC A;  2GV8 A;  1KNP A;  3CXO A;  3SZC A;  2PGW A;  4YTP A;  2OKT A;  3DIP A;  3SXI A;  2QDE A;  5KOX A;  3NXL A;  3P0W A;  5ER0 A;  3KU9 A;  3ZLF A;  3RCY A;  5HHF A;  4H2P A;  2OZ8 A;  4JN7 A;  3UXL A;  4DWD A;  3BHF A;  4O5U A;  2XVJ A;  2HXU A;  1N61 C;  4ZCW A;  1NEN A;  1PN0 A;  1E1N A;  3AEA A;  5HY5 A;  4USQ A;  3P1W A;  3P4R A;  2OO6 A;  2ONE A;  4H4U A;  4J36 A;  2GMH A;  3T37 A;  1QLB A;  1GSN A;  4U8L A;  1OJD A;  1YKJ A;  3H8I A;  4IHC A;  3ZLG A;  2Q0L A;  4LII A;  2YWL A;  3QTP A;  3RED A;  3D46 A;  3V76 A;  3EEZ A;  1L9D A;  3V3O A;  1PJ5 A;  1GRT A;  1LV0 A;  4GYP C;  2BXR A;  3AB1 A;  3R10 A;  3AWI A;  5J04 A;  4IP4 A;  4UP3 A;  2GAH B;  3B9J B;  3QFA A;  3SGL A;  2OLA A;  3UKA A;  2GGI A;  2OA1 A;  1T3Q C;  2PTZ A;  2ACZ A;  1Q1R A;  2WHD A;  1MUC A;  2RGH A;  3CGD A;  3CGB A;  5KVI A;  2WBA A;  2WET A;  2OQH A;  2TPR A;  3V3W A;  4G74 A;  5CQF A;  5IDZ A;  4E5T A;  2NQL A;  5IPY A;  2XVI A;  3SZ0 A;  3VRB A;  2X3N A;  3DG7 A;  3T9P A;  1MOK A;  2Q6U A;  3FG2 P;  3Q9T A;  4H4W A;  4KX6 A;  1SJC A;  2POD A;  5DBJ A;  2YM2 A;  2DW6 A;  2E4G A;  1KSS A;  3UOV A;  1PBE A;  3UKF A;  2BK4 A;  3JZU A;  2AR8 A;  2X8G A;  3BNU A;  2P3Z A;  3CT2 A;  1ONE A;  2XLS A;  3PFR A;  3FYY A;  3AD8 B;  3NRZ B;  1P2H A;  2PGE A;  4G8T A;  1LQU A;  2C76 A;  1XAN A;  2WOW A;  4CCQ A;  2O9Z A;  1PJ6 A;  2YG7 A;  2ZC8 A;  4B69 A;  2FJB A;  2JBV A;  4XWZ A;  2XLT A;  3GYX A;  4EQW A;  5EBK A;  2HNE A;  2RGJ A;  1H81 A;  4H50 A;  3F8R A;  3UKH A;  4A35 A;  3HW2 A;  3NH3 X;  2JK6 A;  2PSN A;  4AOS A;  4CY8 A;  1AOG A;  4GCM A;  1K0J A;  1ZKQ A;  3BHK A;  2BC1 A;  3HYW A;  3EKG A;  1EC9 A;  2C3D A;  2ARD A;  2VQ7 A;  4H4Q A;  2WDV A;  4OCG A;  3S61 A;  2WQY A;  1M6I A;  2PA6 A;  3ICT A;  4J1O A;  3UOZ A;  3KD9 A;  1F8R A;  3K7M X;  3NVZ B;  3ADA B;  4H4Z A;  2GGG A;  2IID A;  2PHH A;  3TWA A;  1KNR A;  3A7A A;  3KKJ A;  4OPI A;  1JRO A;  2WS3 A;  4O5Q A;  3PVC A;  3GSI A;  3K7Q X;  4NEW A;  2YG3 A;  3GMC A;  4B63 A;  3IC9 A;  2XH4 A;  4YWS A;  2FYM A;  5J60 A;  3V3N A;  1FOH A;  3M12 A;  1GTH A;  4GGH A;  3LJP A;  4EIP A;  1TE6 A;  3HZL A;  5KNL A;  2BK3 A;  3UTE A;  4RG4 A;  2BC0 A;  2P0I A;  1N4U A;  3SX6 A;  2C72 A;  4U2L A;  3VFC A;  4DGK A;  2BCP A;  4H4X A;  3F8D A;  3NK2 X;  4A6G A;  2QDD A;  3L8K A;  5TR3 A;  2QJJ A;  1YQ3 A;  3F8P A;  4B66 A;  4GAP A;  1SJD A;  3NN0 X;  2PP1 A;  2FJE A;  3FV9 A;  3NKS A;  1MDL A;  1S7M A;  5M0Z A;  1OJT A;  3RNM A;  2GL5 A;  2EQ6 A;  3SFD A;  3NO1 A;  3SM8 A;  2QQ6 A;  1N60 C;  4J3Z A;  4GGB A;  1JRZ A;  3NK1 X;  5FJP A;  4TLX A;  3AED A;  4A6N B;  4A79 A;  2Z5Y A;  2XH2 A;  1REO A;  1RVK A;  4H1Z A;  1SEZ A;  2C3C A;  2B76 A;  5FJT A;  4LA1 A;  5KOW A;  3VC6 A;  1EL9 A;  1NEK A;  2ZZ0 A;  1L8P A;  3V4B A;  4TM3 A;  3A7U A;  3CB3 A;  1NHR A;  1FEB A;  2BRA A;  3NHO X;  2Q7V A;  3DJE A;  3G5R A;  4OPD A;  3UTF A;  1UKV G;  3TTE A;  2WPE A;  3T0K A;  1D4D A;  2C73 A;  4G6G A;  2V6O A;  4J33 A;  3CYJ A;  4TM0 A;  3RRA A;  2R0G A;  2IVE A;  1XHC A;  1DNC A;  1EBD A;  4U8M A;  3P3B A;  4IT1 A;  2P8B A;  2GGE A;  2Y6R A;  3TQP A;  4DHG A;  3L1R A;  2PCE A;  2H88 A;  3GO2 A;  1GRG A;  1OJC A;  4G9K A;  3UGV A;  4I58 A;  4KPL A;  3FMW A;  2XVH A;  1KFY A;  1GRA A;  2FKP A;  1H83 A;  4EMJ A;  4WX1 A;  3CNJ A;  2GAG B;  4IP5 A;  1XDI A;  1DOC A;  4K5R A;  1TYT A;  1EC8 A;  3ES8 A;  2B7R A;  4NEV A;  4UDP A;  4E0V A;  5U63 A;  5JRB A;  4NZH A;  3II4 A;  3MKC A;  2QAE A;  4H2H A;  3VQR A;  3IJL A;  1BKW A;  4E4F A;  4EQS A;  3UKP A;  4G6H A;  2X8H A;  2EQ9 A;  1PJ7 A;  3AN1 A;  4GUV A;  1N62 C;  4X4J A;  1S2Y A;  4EM3 A;  3CPH G;  4H83 A;  4Z44 A;  3RO6 A;  1GAL A;  2VVL A;  1BQG A;  2XFP A;  4H4S A;  1IUW A;  1N1P A;  1VQW A;  4K1W A;  3MQT A;  4JQ9 A;  1DOB A;  5EOW A;  4CCR A;  1L0V A;  1K4Q A;  5KMP A;  3I6T A;  1JNZ A;  2WP6 A;  3IF9 A;  4C5O A;  1FFU C;  3AXB A;  3IHM A;  3DA1 A;  2XSX A;  3KLJ A;  3R07 C;  3DK9 A;  2YLS A;  4A99 A;  3PWI A;  3NYC A;  3DDM A;  4A3R A;  4Z24 A;  4NTD A;  2JAE A;  4OPU A;  3NVW B;  1VRQ B;  1GES A;  3QSS A;  3QPE A;  3S5S A;  1WUF A;  3O0H A;  3U4F A;  2GGH A;  1FFV C;  3QFB A;  2GR1 A;  1R0M A;  2XFN A;  3DG3 A;  1BGJ A;  2APG A;  1YEY A;  2CHR A;  2FJD A;  3GYJ A;  4DNA A;  2WPF A;  3CPJ G;  3BNM A;  3P4S A;  2XVF A;  3JW7 A;  1GEU A;  3UXK A;  2PS2 A;  4U2S A;  5L46 A;  1FIQ B;  3GRT A;  2ZZC A;  4GR1 A;  2EQ8 A;  4J57 A;  2GR0 A;  2XFQ A;  2BK5 A;  3N6H A;  1QJD A;  2B7S A;  4A9W A;  2OAM A;  3AEE A;  4NTC A;  4OPL A;  4ZCD A;  3VRD B;  1ZMD A;  1CC4 A;  1EBH A;  1MRA A;  4G7F A;  1KF6 A;  1S3E A;  2QA1 A;  4JDR A;  1IYX A;  4IA6 A;  3AEF A;  1H86 A;  1FL2 A;  3AD7 B;  2AKM A;  2CVJ A;  4OPT A;  3D1C A;  4D03 A;  1F8W A;  1D5T A;  2YG4 A;  4A7A A;  1JPD X;  1E1M A;  1B8S A;  3UJE A;  4K2X A;  1TRB A;  2R0C A;  4USR A;  4ZA0 A;  2J3N A;  4GRT A;  2XFO A;  1Q1W A;  4HCH A;  3Q4D A;  4BUR A;  1ZX9 A;  4BJZ A;  2YG6 A;  4YSY A;  4ZOH B;  3DH9 A;  3R9U A;  2OVL A;  1LJ1 A;  2A8X A;  3FCP A;  4EQX A;  2WP9 A;  3AE1 A;  4FI4 A;  1YY5 A;  1Z6L A;  3QVR A;  2JB1 A;  1MNS A;  1CC6 A;  2YVJ A;  3GWF A;  3UCC A;  4H2N A;  2W3S A;  2HQM A;  1TDN A;  3AEC A;  2QGY A;  3VR9 A;  3AE5 A;  3BI5 A;  5FS7 A;  1F9C A;  3AE9 A;  4YKG A;  3B97 A;  5FJU A;  3SQP A;  4FK1 A;  4Y4M A;  1VG9 A;  2GSH A;  3K7T A;  2QVH A;  4H2Q A;  3FXG A;  5JCI A;  1H2I A;  1ZOV A;  2HZG A;  1DOE A;  3VC5 A;  2CUL A;  1Q9I A;  5KMQ A;  1Y0P A;  2GGJ A;  4ROP A;  1JDF A;  4IVO B;  3IHG A;  1DJN A;  3DK8 A;  2R9Z A;  2XH0 A;  1KCZ A;  2TMD A;  1LVL A;  1PBC A;  3R0U A;  5C3J A;  2W3R A;  4TVY A;  1LPF A;  2WU2 A;  4MJW A;  4GF7 A;  5IQ4 A;  1FEC A;  4YXD A;  3GRS A;  4IL2 A;  1VDC A;  3R11 A;  1QO8 A;  2Y6Q A;  2BS2 A;  2GQF A;  3T8Q A;  4KWS A;  4OPC A;  4B67 A;  1O95 A;  3M0O A;  3JVA A;  1V59 A;  1GRH A;  1HYU A;  2V5Z A;  4GDP A;  1F3P A;  4ICY A;  3QSM A;  2E5V A;  4HCL A;  4GFI A;  1ZDL A;  3SQS A;  3ICS A;  3TCS A;  3VA8 A;  5FS6 A;  4BK2 A;  2WOV A;  2PU0 A;  1NDA A;  3C4N A;  2C70 A;  2DKH A;  2V60 A;  4GYP A;  1B37 A;  1JNR A;  2WEU A;  4Y4L A;  2GVC A;  3AE2 A;  1EL8 A;  3TJI A;  1E7P A;  4B64 A;  2W54 A;  3LAD A;  2DKI A;  3GY1 A;  1CJ2 A;  1ZOY A;  2YLX A;  1FHV A;  5U25 A;  1IUX A;  1P48 A;  2X99 A;  3H8L A;  1FCD A;  3NFU A;  3CN8 A;  3T2Y A;  5BUL A;  4B65 A;  4BK3 A;  1TDE A;  1M64 A;  2VOU A;  1ZMC A;  1PDZ A;  3OZM A;  3FPZ A;  4Z2T A;  4GIR A;  2XLP A;  2ZBW A;  4IV9 A;  3S47 A;  3D9X A;  2C65 A;  3RP6 A;  1WYG A;  2ZAD A;  3NLC A;  4HA6 A;  5G5G B;  3IK4 A;  4YSX A;  1GRE A;  1CF3 A;  4U8N A;  2QCU A;  4APN A;  5BUK A;  3UKK A;  1IUT A;  1D7L A;  3MSY A;  1E9I A;  4E6M A;  1P2E A;  1IJH A;  4JN8 A;  5FJR A;  1GTE A;  3EAO A;  4ENL A;  4TM1 A;  2E5A A;  2NPX A;  1PBB A;  5HYM A;  1NHS A;  1GND A;  5JCK A;  4Z25 A;  1TDO A;  4DYE A;  1Y56 A;  1GER A;  1KN0 A;  4B68 A;  3NIX A;  3AYI A;  2C66 A;  3NVV B;  1N5X A;  4YWO A;  2W0H A;  2JB2 A;  3DFY A;  3BSM A;  2CDU A;  4CY6 A;  3DG6 A;  1VDV A;  4CNJ A;  5KRQ A;  3N4E A;  3STP A;  1GRB A;  3DGB A;  2XYO A;  4J56 A;  3V5F A;  1IUU A;  4D04 A;  3KUM A;  4U2T A;  3H8A A;  7ENL A;  3UCD A;  4FX9 A;  3IWA A;  1F6M A;  4YT0 A;  3U9I A;  3OW1 A;  3LXD A;  1V97 A;  1NHP A;  1ELI A;  4U8I A;  1JCT A;  2AQJ A;  4AP3 A;  2PYX A;  1FO4 A;  5BVA A;  4X9M A;  3AYL A;  6ENL A;  2UZZ A;  2QA2 A;  4GME A;  2P8C A;  3OPS A;  3CTY A;  3CIR A;  4NNJ A;  2POZ A;  3CK5 A;  3CMM A;  2BAB A;  3GMB A;  1OJ9 A;  4XXG A;  2YVG A;  3PK7 A;  4HCD A;  3ENL A;  1JRX A;  3ALM A;  3G5S A;  3SZW A;  4IVM B;  3AE8 A;  4XWR A;  3ETR B;  3EUB 3;  4KPR A;  2GR3 A;  1KKO A;  2PTX A;  2RDX A;  3AE7 A;  3ZVH A;  3I6E A;  2GH5 A;  1TYP A;  3SN0 A;  3CNS A;  1BKH A;  1GT8 A;  2PTW A;  2YQU A;  5GRT A;  3T31 A;  3KPF A;  2VQB A;  2AAQ A;  1PBD A;  1N63 C;  4HPN A;  2B9X A;  1LTX R;  2Z5X A;  4ECH A;  3SSZ A;  5ENL A;  1L9E A;  2Q0K A;  1KDG A;  5EB4 A;  4TLZ A;  4HN8 A;  1CJ3 A;  4WCT A;  4A65 A;  5HXI A;  2BXS A;  4EMW A;  1K0L A;  4H4Y A;  2A89 A;  4II2 A;  3JSK A;  5JCM A;  3I3L A;  1CHU A;  3GC2 A;  3Q45 A;  3AEB A;  4K8G A;  3SBF A;  4KT2 A;  4TVW A;  1PDH A;  4C3Y A;  1FHU A;  1H6V A;  2JB3 A;  3QJ4 A;  2RGO A;  4H4P A;  3AYJ A;  3CND A;  3N4F A;  4RG3 A;  5LV9 A;  4U8O A;  1BZL A;  2GQW A;  3CGC A;  2YR4 A;  3SYI A;  1DOD A;  3E1T A;  2MNR A;  3PS9 A;  2YM1 A;  2H89 A;  4K5S A;  3EF6 A;  1JRY A;  2PTY A;  1O5W A;  4YKF A;  2W55 A;  3GDP A;  3VR8 A;  4H2R A;  4ZCC A;  1D7Y A;  4KEM A;  4DSH A;  3NG7 X;  2XCG A;  3PO7 A;  3B6D A;  4H4V A;  1ECQ A;  2YAU A;  5EB5 A;  3MWC A;  5CKU A;  2OZT A;  2OZ3 A;  3ZVI A;  5C2T A;  3UKL A;  3ABV A;  4EIQ A;  1B4V A;  4GAV A;  3K30 A;  3PWG A;  1EC7 A;  1ZP0 A;  1S3B A;  4M52 A;  3D8X A;  1P43 A;  1X31 B;  3NYF A;  1L9C A;  2OG9 A;  3C4A A; 
#chains in the Genus database with same CATH homology
 2C7G A;  2XVE A;  3BI2 A;  4B67 A;  1O95 A;  2GR2 A;  3M0O A;  3SFE A;  3UP4 A;  1V59 A;  1GRH A;  1YQ3 A;  3F8P A;  1HYU A;  2V5Z A;  1PXB A;  1PS9 A;  4GAP A;  4B66 A;  4U8P A;  4H4R A;  4GDP A;  2WES A;  4J31 A;  3UOY A;  1F3P A;  2GEW A;  2R46 A;  3KA7 A;  3NN0 X;  4ICY A;  3QSM A;  1NG3 A;  2FJE A;  2E5V A;  2V3B A;  5JCL A;  3NKS A;  4OVI A;  2BS3 A;  1S7M A;  5M0Z A;  3LB8 A;  3HYV A;  1OJT A;  1D4E A;  1ZDL A;  1JU2 A;  3RNM A;  3ICS A;  1PHH A;  3T2Z A;  5FS6 A;  3B3R A;  3DJJ A;  2EQ6 A;  3SFD A;  4BK2 A;  4EMI A;  2WOV A;  2R0P A;  3SM8 A;  5U1O A;  1NDA A;  3C4N A;  2C70 A;  3ZYX A;  2DKH A;  2V60 A;  3AE4 A;  4JNQ A;  1B37 A;  5FMH A;  1EL5 A;  1JNR A;  1JRZ A;  1XPQ A;  2WEU A;  4N9X A;  4Y4L A;  2VVL G;  2GVC A;  3AE2 A;  1H82 A;  3NK1 X;  4GDE A;  2X8C A;  1EL8 A;  4AP1 A;  3RP8 A;  2C4C A;  1E7P A;  3FIM B;  3I6D A;  1E39 A;  4G73 A;  4TLX A;  4BK1 A;  3AED A;  4A6N B;  4B64 A;  1MO9 A;  4A79 A;  2Z5Y A;  1Y56 B;  1GV4 A;  3SY4 A;  3LAD A;  1REO A;  2DKI A;  2R4E A;  3CNT A;  1CJ2 A;  1SEZ A;  2C3C A;  1CBO A;  3T14 A;  2BYB A;  4FDC B;  3NTD A;  3OZ2 A;  4JY2 A;  2X50 A;  2B76 A;  1VG0 A;  3ITJ A;  4LA1 A;  1ZOY A;  4X9N A;  4CRT A;  1F8S A;  5KOW A;  4JN9 A;  2YLX A;  1NG4 A;  2WP5 A;  5FS8 A;  1RP0 A;  3DJD A;  5U25 A;  1IUX A;  4YSH A;  1EL9 A;  1BF3 A;  1NEK A;  4EM4 A;  3CGE A;  2ZZ0 A;  4K8D A;  3OC4 A;  3P9U A;  3GWD A;  2X99 A;  1RSG A;  1FCD A;  3H8L A;  4REK A;  4TM3 A;  4YSZ A;  1NHR A;  3L5O A;  3CN8 A;  1FEB A;  2BRA A;  2BRY A;  5IQ1 A;  3T2Y A;  3NGC X;  5BUL A;  3NHO X;  1IUV A;  2Q7V A;  3DJE A;  3FBS A;  4B65 A;  4BK3 A;  1TDE A;  3AD9 B;  1M64 A;  2VOU A;  3G5R A;  4OPD A;  1ZMC A;  1UKV G;  3UTF A;  4Z2T A;  3FPZ A;  3P4P A;  1O94 A;  2WPE A;  4J2W A;  3T0K A;  1E6E A;  2B9Y A;  2XLP A;  1D4D A;  3DGH A;  2C73 A;  4G6G A;  5J7X A;  3UTH A;  2V6O A;  2ZBW A;  4IV9 A;  2WU5 A;  4J33 A;  3DJG X;  4TM0 A;  4Z43 A;  3D9X A;  2R0G A;  2IVE A;  1XHC A;  3ISH A;  2C65 A;  3ATR A;  1DNC A;  1EBD A;  2VVM A;  3RP6 A;  4U8M A;  1FEA A;  3NT6 A;  3NLC A;  4UDQ A;  3LZW A;  4HA6 A;  2Y6R A;  4C3X A;  1LQT A;  3LZX A;  5M10 A;  1COY A;  3L1R A;  4I59 A;  2H88 A;  4LU6 A;  1OJA A;  3DME A;  1GRG A;  1OJC A;  3GD4 A;  2VRL A;  3ALL A;  4YSX A;  1BWC A;  3C96 A;  4G9K A;  4I58 A;  4RSL A;  3FMW A;  2XVH A;  1KFY A;  4EQR A;  1PXA A;  1GRE A;  1GRA A;  1H7X A;  2BA9 A;  1CF3 A;  4U8N A;  1H83 A;  2QCU A;  4APN A;  3UKQ A;  3SZF A;  4DSG A;  3DK4 A;  4EMJ A;  3EPT A;  5BUK A;  2JKC A;  4WX1 A;  3CNJ A;  3UKK A;  3RHA A;  4BV6 A;  1IUT A;  1D7L A;  1ONF A;  4II3 A;  3ICR A;  2GAG B;  3AEG A;  1DOC A;  1XDI A;  1W4X A;  4K5R A;  1TYT A;  3UCL A;  1P2E A;  1IJH A;  1E1K A;  2WOI A;  1GTE A;  2B7R A;  2C75 A;  3EAO A;  2FBW A;  4NEV A;  4FK1 C;  4UDP A;  5U63 A;  4U8K A;  4E0V A;  5JRB A;  4TM1 A;  1ZY8 A;  2NPX A;  1PBB A;  4NWZ A;  4NZH A;  3AE3 A;  5HYM A;  1NHS A;  1GND A;  3II4 A;  4K22 A;  5JCK A;  1EL7 A;  4IA5 A;  2C64 A;  4Z25 A;  3NRN A;  4AT0 A;  1H84 A;  1NPX A;  2QAE A;  2XLU A;  3VQR A;  1TDO A;  2OLN A;  4A5L A;  4A6N A;  2FJA A;  1BKW A;  1Y56 A;  1DJQ A;  3PG6 A;  5JCN A;  1PXC A;  4EQS A;  3UKP A;  1GER A;  1KN0 A;  4G6H A;  3NIX A;  4B68 A;  2GV8 A;  3AYI A;  2X8H A;  1KNP A;  2EQ9 A;  2V3A A;  2C66 A;  4J34 A;  1PJ7 A;  4YWO A;  3SZC A;  4YTP A;  2W0H A;  3Q6J A;  4GUV A;  3SXI A;  3ZDN A;  5KOX A;  2XLR A;  4X4J A;  1S2Y A;  4EM3 A;  5ER0 A;  2YR6 A;  3CPH G;  2JB2 A;  1D4C A;  3KU9 A;  4HB9 A;  5HHF A;  1GAL A;  4H2P A;  4Z44 A;  2CDU A;  2GF3 A;  3CPI G;  2VVL A;  4CNK A;  4JY3 A;  4CY6 A;  4CNJ A;  2XFP A;  4H4S A;  3DGZ A;  1IUW A;  2YVF A;  3BHF A;  4O5U A;  5KRQ A;  1N1P A;  1VQW A;  2XVJ A;  1NEN A;  1GRB A;  4PAB A;  2XYO A;  4J56 A;  1PN0 A;  4JQ9 A;  1IUU A;  1DOB A;  1E1N A;  3AEA A;  5EOW A;  4CCR A;  1L0V A;  4D04 A;  1GET A;  1NHQ A;  5HY5 A;  4AOX A;  4U2T A;  4USQ A;  3P1W A;  1K4Q A;  3P4R A;  5KMP A;  4FX9 A;  3IWA A;  1F6M A;  4H4U A;  1JNZ A;  4J36 A;  4YT0 A;  2GMH A;  2WP6 A;  3LXD A;  3T37 A;  1QLB A;  3IF9 A;  1GSN A;  4U8L A;  1NHP A;  4C5O A;  1OJD A;  3GD3 A;  1ELI A;  4U8I A;  2CFY A;  1GXF A;  1YKJ A;  4PAA A;  4JNA A;  3QVP A;  2YLZ A;  2AQJ A;  3H8I A;  4AP3 A;  2PYX A;  2XFU A;  3AXB A;  3DA1 A;  3IHM A;  5BVA A;  2Q0L A;  4X9M A;  4LII A;  3KLJ A;  2YWL A;  4CBQ A;  3RED A;  3V76 A;  3GDN A;  3AYL A;  1L9D A;  3DK9 A;  2UZZ A;  4YTN A;  2YLS A;  2QA2 A;  4A99 A;  3V3O A;  1PJ5 A;  2E1M A;  1GRT A;  1LV0 A;  2BXR A;  3NYC A;  4Y4N A;  3AB1 A;  4TM4 A;  3CTY A;  4Z24 A;  3CIR A;  4NTD A;  1YQZ A;  4NNJ A;  2I0Z A;  2F5Z A;  2JAE A;  1TDK A;  3AWI A;  4OPU A;  4ADW A;  1VRQ B;  2C67 A;  5KVH A;  3CMM A;  2BAB A;  1CC2 A;  2WDQ A;  1GES A;  2GAH B;  3GMB A;  4UP3 A;  2YG5 A;  1CJC A;  1OJ9 A;  3QFA A;  3QSS A;  3SGL A;  3UKA A;  4XXG A;  2YVG A;  2OA1 A;  2YR5 A;  3O0H A;  1IUS A;  3G5Q A;  2YLR A;  2ACZ A;  1Q1R A;  2WHD A;  1GPE A;  3QFB A;  3GYI A;  2GR1 A;  2YLW A;  2RGH A;  2XFN A;  3CGD A;  3CGB A;  1BGJ A;  1JRX A;  1N4V A;  2APG A;  2BCG G;  5KVI A;  3ALM A;  3G5S A;  4IVM B;  3AE8 A;  2WBA A;  4XWR A;  2WET A;  1K0I A;  2FJD A;  3GYJ A;  2TPR A;  3BI4 A;  3S5W A;  4B1B A;  4KPR A;  4DNA A;  2WPF A;  3CPJ G;  4G74 A;  2GR3 A;  3BNM A;  1ZK7 A;  5CQF A;  3P4S A;  2XVF A;  5IPY A;  4OPG A;  3AE7 A;  1GEU A;  2XVI A;  3SZ0 A;  3VRB A;  2NVK X;  4U2S A;  2X3N A;  2GH5 A;  5L46 A;  1TYP A;  3GRT A;  2ZZC A;  3CNS A;  4GR1 A;  1MOK A;  2Q6U A;  3FG2 P;  2EQ8 A;  4J57 A;  2GR0 A;  2XFQ A;  3Q9T A;  2BK5 A;  4H4W A;  1GT8 A;  4KX6 A;  5DBJ A;  2YQU A;  5GRT A;  2YM2 A;  1QJD A;  2B7S A;  3T31 A;  3KPF A;  4Z26 A;  2EQ7 A;  2VQB A;  4A9W A;  2AAQ A;  1KSU A;  1KSS A;  2E4G A;  1PBD A;  3NNE A;  2OAM A;  3AEE A;  4NTC A;  3UOV A;  1PBE A;  3UKF A;  2BK4 A;  4OPL A;  2B9X A;  1LTX R;  2Z5X A;  4ECH A;  2BS4 A;  2AR8 A;  4ZCD A;  3VRD B;  2X8G A;  1ZMD A;  1CC4 A;  3AE6 A;  3BNU A;  1KF6 A;  1L9E A;  2Q0K A;  3ATQ A;  3ALJ A;  3VRA A;  1S3E A;  1KDG A;  1JOA A;  2QA1 A;  4JDR A;  4IA6 A;  5EB4 A;  3URH A;  4TLZ A;  2OLO A;  3WE0 A;  2XLS A;  1CJ3 A;  4WCT A;  4A65 A;  5HXI A;  3AEF A;  3QSE A;  2BXS A;  1H86 A;  4EMW A;  1FL2 A;  3AD7 B;  3AD8 B;  1CJ4 A;  1CL0 A;  1K0L A;  2CVJ A;  1P2H A;  4OPT A;  1PBF A;  2C76 A;  1LQU A;  4H4Y A;  3EAN A;  1XAN A;  2WOW A;  2A89 A;  2V61 A;  3D1C A;  2O9Z A;  4II2 A;  4CCQ A;  3CNP A;  3JSK A;  5JCM A;  1PJ6 A;  2YG7 A;  3I3L A;  1CHU A;  3AEB A;  4B69 A;  1GOS A;  4D03 A;  2RAB A;  1F8W A;  1D5T A;  1NAA A;  2GMJ A;  2YG4 A;  2FJB A;  2JBV A;  4XWZ A;  2XLT A;  3GYX A;  4A7A A;  4EQW A;  3P4Q A;  1E1M A;  5EBK A;  1B8S A;  2R4J A;  4K2X A;  1TRB A;  1RYI A;  2R0C A;  4Z2R A;  4P9S A;  4USR A;  3RP7 A;  5KXJ A;  2RGJ A;  1H81 A;  2J3N A;  1PDH A;  4C3Y A;  2WDR A;  4H50 A;  4GRT A;  3F8R A;  2XFO A;  3T2K A;  3UKH A;  3NH3 X;  1Q1W A;  1H6V A;  4BUR A;  3KVE A;  2JB3 A;  3UOX A;  2JK6 A;  2XDO A;  3QJ4 A;  4AOS A;  1AOG A;  2RGO A;  4GCM A;  4CY8 A;  1K0J A;  1ZKQ A;  4H4P A;  1ZX9 A;  2BC1 A;  3BHK A;  3HYW A;  4BJZ A;  5KWF A;  2YG6 A;  1H7W A;  2C3D A;  5FS9 A;  2ARD A;  3AYJ A;  5GSN A;  4YSY A;  3DH9 A;  5KMR A;  3R9U A;  3CND A;  2VQ7 A;  3COX A;  3SZW A;  4H4Q A;  1LJ1 A;  2A8X A;  4EQX A;  2WDV A;  2WP9 A;  4OCG A;  3AE1 A;  3S61 A;  1YY5 A;  4RG3 A;  1Z6L A;  2WQY A;  5LV9 A;  3QVR A;  4U8O A;  2JB1 A;  1BZL A;  2GQW A;  3LOV A;  1CC6 A;  3CGC A;  1S2Q A;  1M6I A;  2YVJ A;  2YR4 A;  3GWF A;  3HYX A;  3ICT A;  3SYI A;  4BJY A;  3UOZ A;  4H2N A;  1DOD A;  5BRT A;  3KD9 A;  2HQM A;  1F8R A;  4NTE A;  1TDN A;  3AEC A;  3K7M X;  3ADA B;  3VR9 A;  3E1T A;  4H4Z A;  3AE5 A;  2A87 A;  3PS9 A;  4YTM A;  2IID A;  2PHH A;  2YM1 A;  3BI5 A;  1KNR A;  3NYE A;  5FS7 A;  3KKJ A;  2H89 A;  3AE9 A;  4YKG A;  4K5S A;  3SQP A;  4FK1 A;  3EF6 A;  1BGN A;  2VRM A;  1VG9 A;  1JRY A;  3K7T A;  4Y4M A;  1JEH A;  4H2Q A;  4OPI A;  5JCI A;  3UTG A;  1O5W A;  1H2I A;  1YQ4 A;  4YKF A;  1ZOV A;  2WS3 A;  3GDP A;  1DXL A;  3VR8 A;  4O5Q A;  1GRF A;  1DOE A;  3PVC A;  4H2R A;  3GSI A;  3K7Q X;  2CUL A;  4NEW A;  1Q9I A;  2YG3 A;  1MXT A;  1D7Y A;  4ZCC A;  5KMQ A;  1E1L A;  4DSH A;  2R45 A;  3NG7 X;  2XCG A;  1Y0P A;  3GMC A;  3KPK A;  3PO7 A;  4B63 A;  3IC9 A;  2BAC A;  4IVO B;  3IHG A;  3B6D A;  1DJN A;  4Z2U A;  3DK8 A;  4H4V A;  3NK0 X;  2R9Z A;  1N4W A;  5J60 A;  3V3N A;  2YAU A;  2TMD A;  1FOH A;  5EB5 A;  4C77 A;  1LVL A;  3M12 A;  1PBC A;  4U8J A;  1GTH A;  5CKU A;  5C3J A;  2VZ2 A;  2ZZB A;  3LJP A;  3NTA A;  4EIP A;  3HZL A;  5C2T A;  5KNL A;  2BK3 A;  2YLT A;  3UTE A;  2OAL A;  3ABV A;  3UKL A;  4RG4 A;  4EIQ A;  1LPF A;  4C74 A;  2IVD A;  1B4V A;  1TDF A;  2BC0 A;  4H4T A;  4GAV A;  3K30 A;  3NN6 X;  2GB0 A;  2WU2 A;  1N4U A;  2B9W A;  4MJW A;  4GF7 A;  3SX6 A;  5IQ4 A;  2C72 A;  1FEC A;  1S3B A;  1ZP0 A;  3M13 A;  4U2L A;  4YXD A;  3GRS A;  4M52 A;  1VDC A;  3D8X A;  3UP5 A;  4K7Z A;  4UDR A;  4AT2 A;  1QO8 A;  2Y6Q A;  1B5Q A;  4H7U A;  4DGK A;  1X31 B;  2BCP A;  4ZN0 A;  5KMS A;  3NYF A;  4H4X A;  2BS2 A;  1L9C A;  2GQF A;  2GRT A;  3F8D A;  3H4K A;  3NK2 X;  2WPC A;  3C4A A;  4OPC A;  3L8K A;  5TR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...