5JCIA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
432
structure length
432
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFYSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVANIEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
total genus 141
structure length 432
sequence length 432
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jciA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jciA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jciA02
2XVJA 1JEHA 2OAMA 3CN8A 4HB9A 3GYJA 4GDEA 3AE7A 5M10A 2YLZA 1F3PA 4GR1A 2B9WA 1LTXR 1MXTA 1VRQB 3PO7A 3LXDA 4GUVA 4OPLA 4YKFA 3SFEA 3UKLA 3UOXA 2V60A 2C66A 3BI5A 2J3NA 4K7ZA 4A79A 4YXDA 1CC4A 3UKQA 3UTGA 3ICTA 3RP6A 2DKIA 4WCTA 4RSLA 5ER0A 4C3XA 2WP5A 1KSSA 1JRYA 3KLJA 2VQBA 1ZK7A 3DK4A 1ZOVA 4IA6A 2B7SA 2YLRA 3KVEA 1GERA 1IUSA 2VRLA 4OPDA 2BC1A 4U8OA 5IQ1A 1PJ7A 3CNJA 2B7RA 3QFBA 1B4VA 3GD3A 4JQ9A 4LU6A 2C67A 3DK8A 4H4WA 4ADWA 1PXCA 3ISHA 4C3YA 1XANA 2BCPA 3NN0X 3GRSA 1GTHA 5TR3A 1PBBA 2WQYA 4H2RA 2I0ZA 1KF6A 1NPXA 4E0VA 1V59A 5U1OA 4O5QA 2CVJA 1ZP0A 4Z26A 1Q1RA 2XVFA 1AOGA 1DOEA 3LZXA 4FX9A 3SFDA 3RNMA 1D4EA 4BJZA 3K7QX 4J57A 3CNPA 4D03A 4CCRA 3AEEA 1K0LA 4UDPA 2X8CA 1Y56B 3VR8A 3AB1A 3GMCA 1ELIA 4RG3A 4DNAA 3CGEA 3AEFA 4Y4LA 1GV4A 4AOSA 4H4UA 1NAAA 3BI4A 4O5UA 4A6NB 3EF6A 1PJ6A 4EIQA 2WPCA 4J31A 3VRAA 1IUXA 3JSKA 3CGCA 2AQJA 4H2QA 4H4VA 2YQUA 1LQUA 1YY5A 2OLOA 4X9NA 4DSHA 3Q9TA 4U8IA 4U8MA 2FJBA 2IVDA 3GWDA 2C3CA 2YVFA 2WP9A 1L9CA 3AEBA 5GRTA 3B6DA 4TM0A 4K5SA 1YQ3A 3FPZA 4NTDA 3T37A 3NK1X 3G5QA 3K7TA 4GRTA 1E1LA 2XVIA 1CJCA 3NKSA 1B37A 3CNTA 4N9XA 3CNSA 1GRTA 2CDUA 1DOCA 2WOVA 3QSEA 1H86A 3AE3A 2R45A 4CY6A 3F8DA 5C3JA 4EQWA 4OPUA 4U8LA 2VZ2A 3P4RA 4USQA 1CL0A 1RSGA 2XFNA 5GSNA 3V3OA 1OJDA 2IVEA 5M0ZA 3AEGA 3VR9A 4U8JA 4EIPA 1JOAA 3LB8A 1JNZA 3VRBA 3BNUA 2EQ9A 2WDRA 2X3NA 4J56A 1CJ2A 4P9SA 2BK3A 3NYFA 2XCGA 4H4XA 2V3BA 2W0HA 1F8RA 3GMBA 2Q6UA 1DODA 4EMJA 1RP0A 1RYIA 1NG3A 2GVCA 3UKHA 4AT0A 2JB1A 3REDA 2V61A 2BK5A 1LVLA 2XYOA 3P4PA 5KOWA 2JK6A 2V3AA 1GTEA 5EBKA 1K4QA 3V76A 3UCLA 3FIMB 1NDAA 2JBVA 4GCMA 4NZHA 4NEVA 1H6VA 2C72A 2YAUA 2WU2A 1MO9A 2YVJA 2YR5A 4EM3A 4EMIA 3G5SA 2Y6QA 4Y4NA 2OALA 2RGJA 2VRMA 5KXJA 3H4KA 3SQPA 1GEUA 2Z5XA 1ONFA 1H7WA 3I6DA 3PVCA 3CGBA 4B64A 5FS8A 3AD8B 3ZDNA 4B67A 1D4CA 3ADAB 1NG4A 3K30A 2GR3A 4OCGA 1REOA 4CCQA 1COYA 4A99A 1NENA 2TPRA 2WOIA 1EL9A 1QO8A 1UKVG 2ACZA 2R4JA 2OA1A 4H2NA 3NRNA 1S3EA 3DH9A 4XXGA 4A5LA 4A9WA 4Z2TA 1NHPA 4U8KA 2BXRA 2Z5YA 2BCGG 3AYIA 3BHKA 4ZCCA 4BJYA 3P4SA 4YTNA 2YG6A 4YSZA 3FBSA 4Z25A 3NGCX 1S2YA 4J2WA 3AYJA 1EL5A 2XFOA 1M64A 1KNPA 1O5WA 3C4NA 4H4SA 3NTAA 1KFYA 1PHHA 1JNRA 3AE2A 3H8IA 4ECHA 3ATRA 1GESA 4AP1A 4Z43A 3UP4A 2VVLG 2EQ6A 3II4A 2BXSA 3NN6X 1ZMDA 3NT6A 4J33A 3ZYXA 3EAOA 2QAEA 2GH5A 2BS3A 2QCUA 1JRXA 3AE5A 2X8GA 4C5OA 5J60A 5BVAA 2F5ZA 1OJAA 1B8SA 4YWOA 2NPXA 2O9ZA 2R0GA 3E1TA 3LJPA 3S5WA 5LV9A 3NLCA 3VRDB 3NK0X 4AOXA 3ICRA 1GRGA 1D5TA 1N1PA 3AE1A 4REKA 1L0VA 1M6IA 2PYXA 1TDNA 2C70A 1GREA 3UKKA 4CY8A 2WHDA 2E1MA 5CKUA 2R0CA 4TLXA 2V5ZA 4Z2RA 2FJEA 5FS6A 3BI2A 2WEUA 4EQXA 5JCKA 1GRBA 2AAQA 4JDRA 2JKCA 4BK1A 4B65A 1CC2A 4YKGA 5EB4A 2C64A 1FOHA 3S61A 4BURA 3DGZA 4NEWA 1B5QA 1CBOA 2ZZ0A 1H81A 4Z44A 1CJ4A 1TDKA 1K0JA 1OJ9A 2GMJA 3NG7X 4B63A 1TDEA 3AD7B 1PBCA 3M0OA 1TYPA 1FCDA 1PBEA 4NTEA 3LOVA 3BHFA 3DJJA 2QA1A 2ZZBA 3LZWA 2X8HA 2WOWA 4DGKA 4H4RA 2R0PA 1E1KA 4UP3A 4CBQA 3HZLA 3UOZA 3QJ4A 3NTDA 1ZOYA 5U63A 4JN9A 1ZX9A 2YG4A 2XLUA 1LQTA 2RGHA 1GRAA 1GSNA 5KWFA 2YLXA 4TM4A 4BK3A 2BS2A 5KVIA 4JNAA 2B76A 2YWLA 1H82A 3ALLA 4ZN0A 1D4DA 2C7GA 2WPFA 5L46A 3AYLA 2VQ7A 1O94A 3Q6JA 1TDOA 2YLWA 1DXLA 5KRQA 2WPEA 5JCIA 2UZZA 3RP7A 3DA1A 1TRBA 1PXAA 2FBWA 1GETA 2E4GA 2YG7A 2GEWA 2YLTA 4KX6A 2WDVA 5HYMA 5DBJA 5IPYA 2GQFA 4YTMA 5HY5A 3O0HA 4XWZA 2RABA 1DOBA 5KOXA 2BC0A 2ZZCA 3QSMA 1OJTA 3UTHA 4YSYA 3SGLA 3AE6A 4JY2A 2RGOA 1CHUA 2QA2A 2WESA 4HA6A 1GXFA 3NH3X 3GD4A 3AE9A 4I58A 2R46A 1PXBA 2VVMA 2OLNA 1BGNA 2R9ZA 1N4VA 2NVKX 1TYTA 2XFPA 4XWRA 4I59A 2EQ8A 1OJCA 1BGJA 4UDQA 2XVEA 4H7UA 4DSGA 2BACA 1N4UA 2A89A 2GAHB 1E7PA 2PHHA 4K8DA 2H89A 4APNA 2ZBWA 1K0IA 3KD9A 3ATQA 3VQRA 5BULA 3DMEA 3L8KA 4H50A 1Z6LA 3AEDA 3EANA 1FL2A 2A87A 3GYIA 3GRTA 2XFQA 3ITJA 1Y0PA 2BK4A 3ICSA 5BRTA 3EPTA 5JCLA 2HQMA 1O95A 1IUVA 1IJHA 5JCNA 3PS9A 1E39A 4U8NA 5HHFA 1FECA 3AWIA 4M52A 1D7LA 5J7XA 1N4WA 1GOSA 2GR2A 4H2PA 2JB2A 4H4QA 3NK2X 1BZLA 1IUWA 2YVGA 3DGHA 3I3LA 4EM4A 3UOYA 4OPIA 2JAEA 1IUTA 3FG2P 2BS4A 1NHRA 2BABA 4K5RA 4OPCA 3GSIA 1VDCA 1NHQA 3AE4A 3KU9A 1Q1WA 1GT8A 3KA7A 3QSSA 4U2SA 4LA1A 1S3BA 4IV9A 2WETA 2R4EA 4USRA 4AP3A 2BA9A 1GPEA 2XFUA 1L9DA 4MJWA 3CPIG 2C65A 1ZY8A 4U2LA 2Q0LA 4BK2A 1DJNA 1NEKA 1DNCA 3AECA 2XVHA 4D04A 2C3DA 2V6OA 2BYBA 5C2TA 4FDCB 5KVHA 4TM3A 2GMHA 4C77A 3AEAA 3K7MX 4A7AA 3DJDA 1Y56A 3NYCA 3COXA 1EBDA 3DJGX 3CNDA 1W4XA 2CFYA 4Z2UA 1KNRA 1YQ4A 1QLBA 4A6NA 4LIIA 3GWFA 2C73A 4H4YA 3M12A 1XPQA 1EL8A 4RG4A 4AT2A 2Q0KA 3OZ2A 1VG0A 5FS9A 3UOVA 3P9UA 3UTEA 4B69A 3AD9B 3ABVA 1PN0A 1KDGA 1P2HA 1SEZA 2GRTA 2YM1A 1BWCA 5JCMA 1GALA 3UP5A 3QFAA 2GF3A 5CQFA 2WS3A 2JB3A 4ICYA 2YR6A 3AE8A 2YM2A 1PBDA 4X9MA 1GNDA 3C4AA 2CULA 2VOUA 1F8SA 2XDOA 4EQSA 1JRZA 5EOWA 2YG3A 3KKJA 3ALJA 5U25A 4H4TA 1VQWA 2XLRA 3AXBA 4YSHA 4YTPA 3UKPA 1IUUA 3RHAA 3CPJG 4FK1A 1E1MA 1E1NA 1HYUA 1PDHA 3ALMA 1ZDLA 3F8PA 1P2EA 1TDFA 4YT0A 2A8XA 2GAGB 3C96A 1FEBA 3H8LA 2VVLA 1LV0A 4OPTA 5IQ4A 3OC4A 3NNEA 2GR0A 2C75A 1GRFA 1CF3A 4NTCA 2X99A 2E5VA 3LADA 4B66A 2FJDA 2B9XA 3F8RA 1ZMCA 2C76A 2IIDA 3CIRA 3NYEA 4X4JA 2Q7VA 3P4QA 3R9UA 1H83A 2YG5A 3BNMA 2GB0A 2YLSA 4H4PA 2XLPA 2X50A 2WDQA 4J36A 4K22A 1ZKQA 4U8PA 1EL7A 3DJEA 4TLZA 4B1BA 1BF3A 1JU2A 3CTYA 4J34A 1FEAA 4U2TA 1YQZA 4GF7A 4TM1A 3UTFA 4EQRA 2YR4A 2GV8A 4OPGA 1E6EA 1PJ5A 4IA5A 2ARDA 4IVMB 3IHGA 4CNJA 2XLTA 1XHCA 3IC9A 3RP8A 3DK9A 3IWAA 1H84A 5EB5A 1D7YA 5FS7A 2EQ7A 1X31B 4JNQA 2APGA 3B3RA 2B9YA 3P1WA 3CGDA 1CJ3A 1QJDA 2WBAA 3NHOX 4Y4MA 2Y6RA 1Q9IA 1S2QA 4C74A 3L1RA 1YKJA 3FMWA 4BV6A 3IHMA 3GDPA 4Z24A 3KPFA 3NIXA 5HXIA 4CRTA 3CPHG 2WP6A 2DKHA 2AR8A 1F8WA 2GR1A 4K2XA 3WE0A 1LJ1A 3QVRA 4OVIA 3V3NA 4PABA 4PAAA 4B68A 3QVPA 4GDPA 4CNKA 1LPFA 4UDRA 3D8XA 4FK1C 4JY3A 1BKWA 1L9EA 4ZCDA 4H4ZA 1DJQA 1F6MA 4IVOB 2FJAA 3D1CA 1MOKA 1H7XA 4KPRA 2XLSA 3SM8A 4EMWA 4YSXA 5BUKA 1XDIA 4WX1A 2GQWA 2H88A 1PBFA 1NHSA 3G5RA 3GDNA 3M13A 1KSUA 5FMHA 2WU5A 1VG9A 1GRHA 3UKFA 1PS9A 4A65A 3UKAA 3IF9A 2TMDA 3URHA 1CC6A
chains in the Genus database with same CATH superfamily
3HYXA 2XVJA 4HB9A 2YLZA 1F3PA 3PO7A 3UOXA 3SFEA 2C66A 4K7ZA 4A79A 5J04A 1CC4A 3UKQA 3UTGA 4C3XA 4X2PA 3MQTA 2B7SA 2YLRA 4U8OA 2BC1A 3GD3A 3MZNA 2C67A 3DK8A 4ADWA 5TR3A 1PBBA 2WQYA 4H2RA 2I0ZA 1KF6A 1NPXA 4DYEA 1PDYA 4Z26A 1Q1RA 3SFDA 4F4RA 2P88A 4J57A 4CCRA 3AEEA 1Y56B 3D46A 4Y4LA 4A6NB 3EF6A 2WPCA 4J31A 4H2QA 2PTYA 2OLOA 4X9NA 3Q9TA 4U8IA 1KKRA 2FJBA 2HNEA 3ENLA 2IVDA 3DG6A 3AEBA 2RDXA 3FPZA 1H2IA 3GD6A 3T37A 3NK1X 3ZVHB 4N9XA 3R07C 3S47A 3F8DA 2VZ2A 1JROA 3NRZB 3AEGA 3VR9A 4EIPA 3LB8A 1JNZA 3SZCA 2WDRA 1CJ2A 2XCGA 3GMBA 4GAPA 4EMJA 2HZGA 1NG3A 2GVCA 3REDA 4DHGA 1LVLA 2XYOA 1GTEA 4FP1A 2Y6QA 2ZADA 3Q4DA 3PVCA 2P3ZA 2PP0A 3AD8B 1NENA 2ACZA 4KX6A 4HYRA 1S3EA 4Z2TA 3H8AA 2BXRA 2Z5YA 2BCGG 2XH2A 3P0WA 3NGCX 1S2YA 1M64A 3NTAA 2O56A 1KFYA 1PHHA 3AE2A 1GESA 3FCPA 3SR6B 3II4A 5G5HB 2QAEA 3AE5A 2X8GA 3GYXA 4C5OA 3B97A 2GGGA 1B8SA 2O9ZA 2R0GA 5LV9A 2OX4A 3ICRA 5BOEA 2PYXA 3KUMA 1TDNA 3UKKA 4CY8A 4G73A 2E1MA 3T8QA 2R0CA 4GIRA 4TLXA 5FS6A 5JCKA 1GRBA 2AAQA 1CC2A 5EB4A 4BURA 1B5QA 4Z44A 1CJ4A 1TDKA 1K0JA 1TYPA 5KMSA 3LOVA 3BHFA 2ZZBA 3BJSA 1OEPA 4H4RA 1E1KA 3UOZA 3NTDA 3IK4A 2YLXA 3SN4A 2BS2A 2YWLA 3SJNA 3OPSA 4MKSA 1D4DA 1O94A 1TDOA 1DXLA 2MUCA 5JCIA 2QQ6A 3HRDC 2UZZA 1TRBA 4IHCA 3K1GA 4MMWA 1SJDA 3ZVIA 5HYMA 5DBJA 2GQFA 4G6HA 2ZZCA 3DIPA 2WESA 1BGNA 2I5QA 1OJCA 4UDQA 4DSGA 1WUEA 1N4UA 2PHHA 4APNA 1TKKA 2W3SA 3DMEA 3N6HA 1Z6LA 2A87A 2QJNA 3ITJA 5BRTA 1MRAA 5JCLA 1IUVA 4Z1YA 1MNSA 1FECA 3V4BA 4M52A 1D7LA 5J7XA 3ZLFA 2GR2A 3TWAA 3NK2X 3VDGA 1IUWA 2JAEA 3FG2P 1F9CA 2AL1A 4JN8A 2BRAA 3AE4A 4IV9A 2WETA 2XFUA 2C65A 1DJNA 2XVHA 2BYBA 5C2TA 3DJDA 1Y56A 3NYCA 1EBDA 3DJGX 3CNDA 1W4XA 1PDZA 2PTZA 1QLBA 4A6NA 4LIIA 2AL2B 3PG6A 4RG4A 3UTEA 1SEZA 3UP5A 5CQFA 4GGHA 3ZVHA 1TE6A 2YM2A 3RCYA 4X9MA 2VOUA 2YG3A 3ALJA 3ETRB 5U25A 1VQWA 1EC7A 3SQSA 4YTPA 2GL5A 3CPJG 3UJ2A 3NFUA 1TDFA 2A8XA 3NVVB 2GAGB 3C96A 4K2SA 2VVLA 5IQ4A 3NNEA 2GR0A 2C75A 1CF3A 2E5VA 1R0MA 3FV9A 3JZUA 2FJDA 4HNCA 3R9UA 3RITA 1H83A 2GB0A 2OZ3A 4J36A 2WDQA 1JU2A 4J34A 3NXLA 3EUB3 4U2TA 4TM1A 3UTFA 4EQRA 2GV8A 4KWSA 3CMMA 1PJ5A 3DESA 5EB5A 4JNQA 1RM6B 2APGA 4M0XA 4G7FA 2WBAA 2C4CA 3EEZA 1IYXA 3T2KA 4CRTA 4K2XA 2GR1A 1LJ1A 3V3NA 3D8XA 1BKWA 4IVOB 3AN1A 1MOKA 4YSXA 5BUKA 1XDIA 4WX1A 2GQWA 3G5RA 1PS9A 2TMDA 4E6MA 3VA8A 1JEHA 3CN8A 4TVWA 4GR1A 2B9WA 4OPLA 4YKFA 3UKLA 2J3NA 3A7UA 3ICTA 4KPLA 3RP6A 4RSLA 2OQYA 2WP5A 2VQBA 4DX3A 4NWZA 5IQ1A 3CNJA 1ONEA 1B4VA 4LU6A 1PXCA 4H4WA 3ISHA 4C3YA 5U1OA 3L5OA 2XVFA 1AOGA 4G6GA 3RNMA 1P43A 3I6EA 3CNPA 2DW6A 1EC9A 1K0LA 4NNJA 3IJIA 4AOSA 4HPNA 1NAAA 4O5UA 1PJ6A 3CGCA 1LQUA 4DSHA 3GWDA 3B6DA 4K5SA 2PCEA 3K7TA 3R25A 3T2YA 1B37A 3CNTA 3CNSA 4DN1A 3QSEA 3AE3A 5C3JA 4U8LA 3P4RA 2XFNA 2OG9A 3CXBA 2W0HA 4HCLA 3MY9A 2Q6UA 1RYIA 2PTWA 2V3AA 5EBKA 1JPDX 2JBVA 4NZHA 2C72A 2WU2A 4EM3A 3T6CA 3G5SA 4G9KA 3SQPA 1ONFA 3I6DA 3ZDNA 3ADAB 1R6WA 3UCCA 3K30A 2GR3A 4OCGA 1REOA 1COYA 4A99A 1UKVG 4CY6A 1EL9A 4H2NA 4II2A 4A5LA 1NHPA 1MDRA 4YSZA 3FBSA 2AL2A 3AYJA 1MUCA 3UJEA 4E5TA 3ATRA 3NT6A 2BXSA 3NN6X 4J33A 2BS3A 1JRXA 3OTRA 5BVAA 3LJPA 3NLCA 4IL0A 1GRGA 3A7RA 3AE1A 4REKA 1L0VA 3A7AA 1VDVA 3RRAA 1GREA 2WHDA 2OZTA 4IP5A 2V5ZA 4Z2RA 2FJEA 3BI2A 2NQLA 1NU5A 2JKCA 4B65A 4YKGA 2ZZ0A 2GMJA 3AD7B 1PBCA 4K8GA 2PP1A 4FI4A 3LZWA 2X8HA 4DGKA 2GDQA 3N4EA 3DG3A 3HZLA 3QJ4A 3THUA 5U63A 2YG4A 3QTPA 4J1OA 5L46A 3AYLA 3Q6JA 2YLWA 1X2HA 5JRBA 2HXTA 3MWCA 1GETA 2YLTA 5IPYA 3O0HA 4XWZA 4YWSA 2RABA 1DOBA 3HW2A 1OJTA 1CHUA 3NH3X 2P8BA 3AM9A 3AE9A 2R46A 2W54A 2VVMA 2R9ZA 2NVKX 1TYTA 3SN1A 2XVEA 4H7UA 3U9IA 5KNLA 2H89A 1K0IA 3KD9A 2XH7A 1STZA 4H50A 2FYMA 3ICSA 3T4WA 1O95A 1IJHA 3PS9A 2QVHA 1FFUC 3CB3A 3AWIA 3QPEA 2PODA 3DGBA 1BZLA 2YVGA 3DGHA 4OPIA 5FJTA 1XPYA 2BABA 4OPCA 1NHQA 4LA1A 5FJPA 2R4EA 2BA9A 2Q0LA 1JRPA 1NEKA 3D9XA 3AECA 4TM3A 4C77A 3AEAA 4A7AA 3COXA 3VC5A 3DERA 1KNRA 3AMZA 2C73A 1SJAA 3DFHA 1NELA 4GISA 1PN0A 1KDGA 1P2HA 2YR6A 3AE8A 1PBDA 2CULA 1X2GA 5EOWA 3UJSA 3CK5A 4H4TA 3RHAA 4FK1A 1HYUA 1PDHA 3F8PA 1P2EA 3FXGA 2PGWA 3H8LA 3OC4A 4ZOHB 4NTCA 2X99A 3LADA 1YEYA 2QJMA 2W55A 3F8RA 3TTEA 4H19A 4U8PA 3BNMA 4K22A 1ZKQA 1EL7A 4TLZA 3TJ4A 1BF3A 3UJRA 3TWBA 2ONEA 2YR4A 2XLTA 1H84A 3B3RA 2B9YA 2OLAA 2PSNA 1N62C 3NHOX 1Q9IA 2ZC8A 4C74A 3FMWA 4BV6A 3IHMA 4EWJA 3GDPA 3P93A 4Z24A 3KPFA 3P3BA 3CPHG 4HNLA 2AR8A 5FJRA 3WE0A 3H70A 4OVIA 4E4FA 3QVPA 1LPFA 4FK1C 2FJAA 4KPRA 2H88A 2WU5A 3UKAA 3URHA 1CC6A 2OAMA 5M10A 1KN0A 3LXDA 3VCNA 5IDZA 4WCTA 5BOFA 1JRYA 3KLJA 1ZOVA 4IA6A 1N63C 1IUSA 2VRLA 2B7RA 2PMQA 3QFBA 4JQ9A 5ENLA 2BCPA 3NN0X 2CVJA 3I4KA 4ZCWA 3LZXA 3PK7A 5G5GB 1D4EA 4D03A 2OKTA 4UDPA 3R0UA 3VCCA 4H4UA 3BI4A 3ZLGA 3VRAA 4H4VA 1YY5A 2YVFA 4HCDA 4TM0A 5GRTA 4NTDA 3G5QA 1E1LA 3NKSA 3JVAA 1EBGA 1KKOA 4OPUA 4USQA 1CL0A 5GSNA 5M0ZA 2IVEA 3DG7A 3SBFA 4U8JA 3HYWA 1JOAA 3BNUA 1W6TA 2EQ9A 3OZMA 4P9SA 2BK3A 4H4XA 2V3BA 1F8RA 3SZWA 1RP0A 3UKHA 1S7MA 2GGJA 2V61A 3BOXA 2BK5A 3V76A 3FIMB 1NDAA 4KT2A 4GCMA 2YAUA 2YR5A 1KD0A 2RGJA 3H4KA 1GEUA 4ZA0A 1DTNA 2MNRA 5KMQA 3CGBA 4B64A 3CAWA 5FS8A 3NVZB 2TPRA 2WOIA 2R4JA 4A9WA 2OA1A 3NRNA 3DH9A 3BHKA 4ZCCA 1FHVA 4BJYA 4Z25A 4DWDA 4J2WA 3UCDA 4J3ZA 1KNPA 3C4NA 3H8IA 4ECHA 1SJBA 4AP1A 2VVLG 2EQ6A 3R0KA 2PU0A 3HPFA 3EAOA 2GH5A 3R1ZA 3V5FA 3KPKA 2XSXA 3SN0A 3VRDB 4AOXA 2P0IA 1D5TA 1N1PA 3N4FA 3DDMA 3V3WA 1ELSA 1JDFA 2C70A 4GFIA 3TW9A 2WEUA 4EQXA 4JDRA 3NVWB 3PWGA 2C64A 1FOHA 3DGZA 1H81A 4B63A 1OJ9A 1TDEA 3M0OA 3VFCA 1FCDA 2XH4A 3QLDA 2QA1A 5FJOA 4E4UA 2PPGA 2WOWA 4JN9A 1ZX9A 2XLUA 5KWFA 1GRAA 1GSNA 4TM4A 2B76A 1H82A 4ZN0A 2VQ7A 5KRQA 3RP7A 2E4GA 5KOXA 3OP2A 4YSYA 3SGLA 3AE6A 1WYGA 2RGOA 2QA2A 1GXFA 3N6JA 1PXBA 3TOYA 1N4VA 2XFPA 2QDDA 1BGJA 3SX6A 2A89A 2GAHB 4K8DA 3VQRA 3ATQA 3L8KA 3CT2A 2PP3A 3EANA 1FL2A 4G8TA 2QDEA 4ROPA 3DFYA 3SYIA 4GYPA 5JCNA 4U8NA 4H2HA 4EM4A 3UOYA 2BS4A 1NHRA 3RGTA 1VDCA 3KU9A 3QSSA 1Q1WA 3KA7A 1JCTA 1S3BA 3MSYA 4MJWA 3CPIG 1ZY8A 3RO6A 4BK2A 4D04A 1DNCA 2C3DA 2V6OA 4FDCB 3K7MX 4K1WA 3ES7A 2CFYA 1YQ4A 4JHMA 4AT2A 1XPQA 1EL8A 3OZ2A 4B69A 1BWCA 1V97A 1FHUA 2WS3A 2POZA 4ICYA 2QGYA 3GC2A 1GNDA 3C4AA 1F8SA 4GYPC 4IP4A 2XDOA 4EQSA 3NS1B 2PGEA 2XLRA 4YSHA 3MUCA 2E5AA 1IUUA 1E1MA 3ALMA 3ES8A 3NZGA 4YT0A 1FEBA 3TQPA 1N5WC 4OPTA 3PWIA 1GRFA 4B66A 3SXIA 2IIDA 2C76A 3CIRA 1SB3B 3FVDA 2Q7VA 3P4QA 2YG5A 4BK3A 4B1BA 3CTYA 1FEAA 4GF7A 1SJCA 4OPGA 1E6EA 2HXUA 4IA5A 3SZFA 2ARDA 3IHGA 3SZ0A 1XHCA 3DK9A 2EQ7A 1CJ3A 1EC8A 4M6UA 2Y6RA 3IJLA 1EBHA 1YKJA 2OZ8A 2OPJA 5HXIA 1F8WA 4A6GA 4PABA 4B68A 4GDPA 4CNKA 4UDRA 5KMPA 3TCSA 4ZCDA 7ENLA 4H4ZA 1DJQA 1H7XA 2XLSA 4EMWA 1WUFA 3M13A 5FMHA 2FKPA 1GRHA 4A65A 1BQGA 3GYJA 4GDEA 3AE7A 1LTXR 1MXTA 1VRQB 4GUVA 3DEQA 2V60A 2BRYA 1L8PA 3BI5A 4YXDA 2DKIA 5ER0A 3HYVA 1KSSA 1ZK7A 3DK4A 1N60C 3KVEA 4OPDA 1GERA 1PJ7A 1XANA 3GRSA 1GTHA 4E0VA 1V59A 4O5QA 1ZP0A 4KEMA 1DOEA 4FX9A 4BJZA 5KMRA 3K7QX 2X8CA 3VR8A 3AB1A 3GMCA 1N61C 2GGHA 3UXKA 1ELIA 4RG3A 4DNAA 3CGEA 3AEFA 1GV4A 3D47A 4EIQA 2QJJA 1IUXA 3JSKA 2AQJA 3R11A 2YQUA 5FJUA 4U8MA 3FJ4A 2C3CA 2WP9A 1L9CA 1YQ3A 1TZZA 3JW7A 4GRTA 2XVIA 1CJCA 1GRTA 2CDUA 1DOCA 2WOVA 1H86A 2R45A 3PFRA 4JN7A 4EQWA 1JPMA 3CYJA 1RSGA 4Z17A 3V3OA 4IZGA 1OJDA 3ZLHA 4II3A 3VRBA 2X3NA 4J56A 3NYFA 1RVKA 2OVLA 1DODA 4AT0A 2JB1A 3P4PA 5KOWA 2JK6A 1K4QA 3UCLA 4NEVA 1H6VA 1MO9A 2YVJA 3BSMA 3B9JB 4EMIA 4Y4NA 2OALA 2VRMA 5KXJA 3CXOA 2Z5XA 1H7WA 3UJFA 4B67A 1D4CA 1NG4A 1VQZA 2GGIA 4HN8A 4CCQA 1QO8A 4XXGA 3GO2A 4E8GA 4U8KA 3AYIA 4YTNA 3P4SA 2YG6A 1EL5A 2XFOA 1O5WA 4H4SA 1JNRA 4Z43A 3UP4A 2CHRA 1ZMDA 5EU9A 3ZYXA 2PU1A 2QCUA 3UXLA 5J60A 2F5ZA 1OJAA 4YWOA 2NPXA 3S5WA 3E1TA 3NK0X 4GAVA 1M6IA 3TJIA 2AKZA 5CKUA 4A3RA 2GGEA 4BK1A 3S61A 3H12A 4NEWA 1CBOA 1ECQA 3NG7X 2PS2A 1PBEA 4NTEA 3DJJA 2OO6A 3T9PA 3QN3A 2R0PA 4UP3A 4CBQA 1ZOYA 1LQTA 2RGHA 4JNAA 5KVIA 3T31A 3ALLA 2C7GA 2WPFA 3IJQA 3EKGA 3SSZA 2WPEA 4ENLA 2DW7A 3DA1A 4A35A 2FBWA 1PXAA 2YG7A 3RR1A 2GEWA 2WDVA 2AKMA 4YTMA 5HY5A 2BC0A 3QSMA 3UTHA 4JY2A 4I58A 4HA6A 3GD4A 1KCZA 2OLNA 3STPA 3T2ZA 4XWRA 4I59A 2EQ8A 2BACA 1E7PA 3R10A 2ZBWA 5BULA 1XS2A 3AEDA 3GYIA 3GRTA 2XFQA 1Y0PA 2BK4A 3EPTA 2HQMA 1E39A 3GY1A 5HHFA 1N4WA 1GOSA 4H2PA 2JB2A 4H4QA 3I3LA 1FO4A 3MKCA 3SY4A 1IUTA 2OQHA 3V5CA 4K5RA 3GSIA 1GT8A 4U2SA 4USRA 4AP3A 1MDLA 1GPEA 1L9DA 6ENLA 4U2LA 2E3TA 3NO1A 4MGGA 3T0KA 4IT1A 5KVHA 2GMHA 3U4FA 4Z2UA 2P8CA 1N5XA 2XGZA 3GWFA 2GSHA 4H4YA 3M12A 2Q0KA 1BKHA 1P48A 3Q45A 1VG0A 5FS9A 3UOVA 3P9UA 3AD9B 3ABVA 2GRTA 4TVYA 2YM1A 5JCMA 4H1ZA 1GALA 3QFAA 2GF3A 2JB3A 4DXKA 2OFJA 3S5SA 1JRZA 3KKJA 3AXBA 3UKPA 1E1NA 1ZDLA 3VC6A 1FFVC 1LV0A 4IL2A 2B9XA 1ZMCA 3NYEA 4X4JA 4GMEA 4H83A 2YLSA 4H4PA 2XLPA 2X50A 3RP8A 3DJEA 3QKEA 3UGVA 1YQZA 2W3RA 2PA6A 4IVMB 3FYYA 4CNJA 2PTXA 3IC9A 3IWAA 1FIQB 1D7YA 5FS7A 1X31B 4GGBA 3I6TA 3P1WA 3CGDA 1QJDA 3T14A 1T3QC 4Y4MA 1S2QA 3L1RA 3OW1A 2XH0A 4HCHA 3NIXA 2WP6A 2DKHA 3QVRA 3H7VA 4G74A 3NVYB 4PAAA 4JY3A 1L9EA 1F6MA 3D1CA 1ZXIC 3SM8A 1PBFA 1NHSA 3GDNA 1KSUA 3OZYA 1E9IA 1VG9A 3UKFA 3IF9A
chains in the Genus database with same CATH topology
3HYXA 2XVJA 1JEHA 2OAMA 3CN8A 4HB9A 3GYJA 4GDEA 3AE7A 5M10A 2YLZA 1F3PA 1KN0A 4GR1A 2B9WA 1LTXR 1MXTA 1VRQB 3PO7A 3LXDA 4GUVA 4OPLA 4YKFA 3SFEA 3UKLA 3UOXA 2V60A 2BRYA 2C66A 3BI5A 2J3NA 4K7ZA 4A79A 4YXDA 1CC4A 3UKQA 3UTGA 3ICTA 3RP6A 2DKIA 4WCTA 4RSLA 5ER0A 4C3XA 2WP5A 3HYVA 1KSSA 1JRYA 3KLJA 2VQBA 1ZK7A 3DK4A 4NWZA 1ZOVA 4IA6A 2B7SA 2YLRA 3KVEA 1GERA 1IUSA 2VRLA 4OPDA 2BC1A 4U8OA 5IQ1A 1PJ7A 3CNJA 2B7RA 3QFBA 1B4VA 3GD3A 4JQ9A 4LU6A 2C67A 3DK8A 4H4WA 4ADWA 1PXCA 3ISHA 4C3YA 1XANA 2BCPA 3NN0X 3GRSA 1GTHA 5TR3A 1PBBA 2WQYA 4H2RA 2I0ZA 1KF6A 1NPXA 4E0VA 1V59A 5U1OA 4O5QA 2CVJA 1ZP0A 3L5OA 4Z26A 1Q1RA 2XVFA 1AOGA 1DOEA 3LZXA 4FX9A 4G6GA 3SFDA 3RNMA 1D4EA 4BJZA 5KMRA 3K7QX 4J57A 3CNPA 4D03A 4CCRA 3AEEA 1K0LA 4NNJA 4UDPA 2X8CA 1Y56B 3VR8A 3AB1A 3GMCA 1ELIA 4RG3A 4DNAA 3CGEA 3AEFA 4Y4LA 1GV4A 4AOSA 4H4UA 1NAAA 3BI4A 4O5UA 4A6NB 3EF6A 1PJ6A 4EIQA 2WPCA 4J31A 3VRAA 1IUXA 3JSKA 3CGCA 2AQJA 4H2QA 4H4VA 2YQUA 1LQUA 1YY5A 2OLOA 4X9NA 4DSHA 3Q9TA 4U8IA 4U8MA 2FJBA 2IVDA 3GWDA 2C3CA 2YVFA 2WP9A 1L9CA 3AEBA 5GRTA 3B6DA 4TM0A 4K5SA 1YQ3A 3FPZA 1H2IA 4NTDA 3T37A 3NK1X 3G5QA 3K7TA 4GRTA 1E1LA 2XVIA 1CJCA 3NKSA 3T2YA 1B37A 3CNTA 4N9XA 3CNSA 1GRTA 2CDUA 1DOCA 2WOVA 3QSEA 1H86A 3AE3A 2R45A 4CY6A 3F8DA 5C3JA 4EQWA 4OPUA 4U8LA 2VZ2A 3P4RA 4USQA 1CL0A 1RSGA 2XFNA 5GSNA 3V3OA 1OJDA 2IVEA 5M0ZA 3AEGA 3VR9A 4U8JA 4II3A 4EIPA 3HYWA 1JOAA 3LB8A 1JNZA 3VRBA 3SZCA 3BNUA 2EQ9A 2WDRA 2X3NA 4J56A 1CJ2A 4P9SA 2BK3A 3NYFA 2XCGA 4H4XA 2V3BA 2W0HA 1F8RA 3GMBA 2Q6UA 3SZWA 4GAPA 1DODA 4EMJA 1RP0A 1RYIA 1NG3A 2GVCA 3UKHA 4AT0A 1S7MA 2JB1A 3REDA 2V61A 2BK5A 1LVLA 2XYOA 3P4PA 5KOWA 2JK6A 2V3AA 1GTEA 5EBKA 1K4QA 3V76A 3UCLA 3FIMB 1NDAA 2JBVA 4GCMA 4NZHA 4NEVA 1H6VA 2C72A 2YAUA 2WU2A 1MO9A 2YVJA 2YR5A 4EM3A 4EMIA 3G5SA 2Y6QA 4Y4NA 4G9KA 2OALA 2RGJA 2VRMA 5KXJA 3H4KA 3SQPA 1GEUA 2Z5XA 1ONFA 1H7WA 3I6DA 3PVCA 5KMQA 3CGBA 4B64A 5FS8A 3AD8B 3ZDNA 4B67A 1D4CA 3ADAB 1NG4A 3K30A 2GR3A 4OCGA 1REOA 4CCQA 1COYA 4A99A 1NENA 2TPRA 2WOIA 1EL9A 1QO8A 1UKVG 2ACZA 2R4JA 2OA1A 4H2NA 3NRNA 1S3EA 3DH9A 4II2A 4XXGA 4A5LA 4A9WA 4Z2TA 1NHPA 4U8KA 2BXRA 2Z5YA 2BCGG 3AYIA 3BHKA 4ZCCA 4BJYA 3P4SA 4YTNA 2YG6A 4YSZA 3FBSA 4Z25A 3NGCX 1S2YA 4J2WA 3AYJA 1EL5A 2XFOA 1M64A 1KNPA 1O5WA 3C4NA 4H4SA 3NTAA 1KFYA 1PHHA 1JNRA 3AE2A 3H8IA 4ECHA 3ATRA 1GESA 4AP1A 4Z43A 3UP4A 2VVLG 2EQ6A 3II4A 2BXSA 3NN6X 1ZMDA 3NT6A 4J33A 3ZYXA 3EAOA 2QAEA 2GH5A 2BS3A 2QCUA 1JRXA 3AE5A 2X8GA 3GYXA 4C5OA 5J60A 5BVAA 3KPKA 2F5ZA 1OJAA 1B8SA 4YWOA 2NPXA 2O9ZA 2R0GA 3E1TA 3LJPA 3S5WA 5LV9A 3NLCA 3VRDB 3NK0X 4GAVA 4AOXA 3ICRA 1GRGA 1D5TA 1N1PA 3AE1A 4REKA 1L0VA 1M6IA 2PYXA 1TDNA 2C70A 1GREA 3UKKA 4G73A 2WHDA 2E1MA 4CY8A 5CKUA 2R0CA 4TLXA 2V5ZA 4Z2RA 2FJEA 5FS6A 3BI2A 2WEUA 4EQXA 5JCKA 1GRBA 2AAQA 4JDRA 2JKCA 4BK1A 4B65A 1CC2A 4YKGA 5EB4A 2C64A 1FOHA 3S61A 4BURA 3DGZA 4NEWA 1B5QA 1CBOA 2ZZ0A 1H81A 4Z44A 1CJ4A 1TDKA 1K0JA 1OJ9A 2GMJA 3NG7X 4B63A 1TDEA 3AD7B 1PBCA 3M0OA 1TYPA 1FCDA 1PBEA 4NTEA 5KMSA 3LOVA 3BHFA 3DJJA 2QA1A 2ZZBA 3LZWA 2X8HA 2WOWA 4DGKA 4H4RA 2R0PA 1E1KA 4UP3A 4CBQA 3HZLA 3UOZA 3QJ4A 3NTDA 1ZOYA 5U63A 4JN9A 1ZX9A 2YG4A 2XLUA 1LQTA 2RGHA 1GRAA 1GSNA 5KWFA 2YLXA 4TM4A 4BK3A 2BS2A 5KVIA 4JNAA 3T31A 2B76A 2YWLA 1H82A 3ALLA 4ZN0A 1D4DA 2C7GA 2WPFA 5L46A 3AYLA 2VQ7A 1O94A 3Q6JA 1TDOA 2YLWA 1DXLA 5KRQA 2WPEA 5JCIA 5JRBA 2UZZA 3RP7A 3DA1A 1TRBA 1PXAA 2FBWA 1GETA 2E4GA 2YG7A 2GEWA 2YLTA 4KX6A 2WDVA 5HYMA 5DBJA 5IPYA 2GQFA 4G6HA 4YTMA 5HY5A 3O0HA 4XWZA 2RABA 1DOBA 5KOXA 2BC0A 2ZZCA 3QSMA 1OJTA 3UTHA 4YSYA 3SGLA 3AE6A 4JY2A 2RGOA 1CHUA 2QA2A 2WESA 4HA6A 1GXFA 3NH3X 3GD4A 3AE9A 4I58A 2R46A 1PXBA 2VVMA 2OLNA 1BGNA 2R9ZA 1N4VA 2NVKX 1TYTA 2XFPA 4XWRA 3T2ZA 4I59A 2EQ8A 1OJCA 1BGJA 4UDQA 2XVEA 4H7UA 3SX6A 4DSGA 2BACA 1N4UA 2A89A 2GAHB 1E7PA 2PHHA 5KNLA 4K8DA 2H89A 4APNA 2ZBWA 1K0IA 3KD9A 3ATQA 3VQRA 5BULA 3DMEA 3L8KA 4H50A 1Z6LA 3AEDA 3EANA 1FL2A 2A87A 3GYIA 3GRTA 2XFQA 3ITJA 1Y0PA 2BK4A 3ICSA 5BRTA 3EPTA 5JCLA 2HQMA 3SYIA 1O95A 1IUVA 1IJHA 5JCNA 3PS9A 1E39A 4U8NA 5HHFA 1FECA 3AWIA 4M52A 1D7LA 5J7XA 1N4WA 1GOSA 2GR2A 4H2PA 2JB2A 4H4QA 3NK2X 1BZLA 1IUWA 2YVGA 3DGHA 3I3LA 4EM4A 3UOYA 4OPIA 2JAEA 3SY4A 1IUTA 3FG2P 2BS4A 1NHRA 2BABA 2BRAA 4K5RA 4OPCA 3GSIA 1VDCA 1NHQA 3AE4A 3KU9A 1Q1WA 1GT8A 3KA7A 3QSSA 4U2SA 4LA1A 1S3BA 4IV9A 2WETA 2R4EA 4USRA 4AP3A 2BA9A 1GPEA 2XFUA 1L9DA 4MJWA 3CPIG 2C65A 1ZY8A 4U2LA 2Q0LA 4BK2A 3T0KA 1DJNA 1NEKA 1DNCA 3D9XA 2XVHA 3AECA 4D04A 2C3DA 2V6OA 2BYBA 5C2TA 4FDCB 5KVHA 4TM3A 2GMHA 4C77A 3AEAA 3K7MX 4A7AA 3DJDA 1Y56A 3NYCA 3COXA 1EBDA 3DJGX 3CNDA 1W4XA 2CFYA 4Z2UA 1KNRA 1YQ4A 1QLBA 4A6NA 4LIIA 3GWFA 2C73A 4H4YA 3M12A 1XPQA 1EL8A 3PG6A 4RG4A 4AT2A 2Q0KA 3OZ2A 1VG0A 5FS9A 3UOVA 3P9UA 3UTEA 4B69A 3AD9B 3ABVA 1PN0A 1KDGA 1P2HA 1SEZA 2GRTA 2YM1A 1BWCA 5JCMA 1GALA 3UP5A 3QFAA 2GF3A 5CQFA 2WS3A 2JB3A 4ICYA 2YR6A 3AE8A 2YM2A 1PBDA 4X9MA 1GNDA 3C4AA 2CULA 2VOUA 1F8SA 2XDOA 4EQSA 1JRZA 5EOWA 2YG3A 3KKJA 3ALJA 5U25A 4H4TA 1VQWA 2XLRA 3AXBA 4YSHA 4YTPA 3UKPA 1IUUA 3RHAA 3CPJG 4FK1A 1E1MA 1E1NA 1HYUA 1PDHA 3ALMA 1ZDLA 3F8PA 1P2EA 1TDFA 4YT0A 2A8XA 2GAGB 3C96A 1FEBA 3H8LA 2VVLA 1LV0A 4OPTA 5IQ4A 3OC4A 3NNEA 2GR0A 2C75A 1GRFA 1CF3A 4NTCA 2X99A 2E5VA 3LADA 4B66A 3SXIA 2FJDA 2B9XA 3F8RA 1ZMCA 2C76A 2IIDA 3CIRA 3NYEA 4X4JA 2Q7VA 3P4QA 3R9UA 1H83A 2YG5A 3BNMA 2GB0A 2YLSA 4H4PA 2XLPA 2X50A 2WDQA 4J36A 4K22A 1ZKQA 4U8PA 1EL7A 3DJEA 4TLZA 4B1BA 1BF3A 1JU2A 3CTYA 4J34A 1FEAA 4U2TA 1YQZA 4GF7A 4TM1A 3UTFA 4EQRA 2YR4A 2GV8A 4OPGA 1E6EA 3CMMA 1PJ5A 4IA5A 3SZFA 2ARDA 4IVMB 3IHGA 4CNJA 3SZ0A 2XLTA 1XHCA 3IC9A 3RP8A 3DK9A 3IWAA 1H84A 5EB5A 1D7YA 5FS7A 2EQ7A 1X31B 4JNQA 2APGA 3B3RA 2B9YA 3P1WA 3CGDA 1CJ3A 1QJDA 3T14A 2WBAA 3NHOX 4Y4MA 2Y6RA 1Q9IA 2C4CA 1S2QA 4C74A 3L1RA 1YKJA 3FMWA 4BV6A 3IHMA 3GDPA 4Z24A 3KPFA 3NIXA 3T2KA 5HXIA 4CRTA 3CPHG 2WP6A 2DKHA 2AR8A 1F8WA 2GR1A 4K2XA 3WE0A 1LJ1A 3QVRA 4OVIA 3V3NA 4G74A 4PABA 4PAAA 4B68A 3QVPA 4GDPA 4CNKA 1LPFA 4UDRA 3D8XA 5KMPA 4FK1C 4JY3A 1BKWA 1L9EA 4ZCDA 4H4ZA 1DJQA 1F6MA 4IVOB 2FJAA 3D1CA 1MOKA 1H7XA 4KPRA 2XLSA 3SM8A 4EMWA 4YSXA 5BUKA 1XDIA 4WX1A 2GQWA 2H88A 1PBFA 1NHSA 3G5RA 3GDNA 3M13A 1KSUA 5FMHA 2WU5A 1VG9A 1GRHA 3UKFA 1PS9A 4A65A 3UKAA 3IF9A 2TMDA 3URHA 1CC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XVJ A;  1JEH A;  2OAM A;  3CN8 A;  4HB9 A;  3GYJ A;  4GDE A;  3AE7 A;  5M10 A;  2YLZ A;  1F3P A;  4GR1 A;  2B9W A;  1LTX R;  1MXT A;  1VRQ B;  3PO7 A;  3LXD A;  4GUV A;  4OPL A;  4YKF A;  3SFE A;  3UKL A;  3UOX A;  2V60 A;  2C66 A;  3BI5 A;  2J3N A;  4K7Z A;  4A79 A;  4YXD A;  1CC4 A;  3UKQ A;  3UTG A;  3ICT A;  3RP6 A;  2DKI A;  4WCT A;  4RSL A;  5ER0 A;  4C3X A;  2WP5 A;  1KSS A;  1JRY A;  3KLJ A;  2VQB A;  1ZK7 A;  3DK4 A;  1ZOV A;  4IA6 A;  2B7S A;  2YLR A;  3KVE A;  1GER A;  1IUS A;  2VRL A;  4OPD A;  2BC1 A;  4U8O A;  5IQ1 A;  1PJ7 A;  3CNJ A;  2B7R A;  3QFB A;  1B4V A;  3GD3 A;  4JQ9 A;  4LU6 A;  2C67 A;  3DK8 A;  4H4W A;  4ADW A;  1PXC A;  3ISH A;  4C3Y A;  1XAN A;  2BCP A;  3NN0 X;  3GRS A;  1GTH A;  5TR3 A;  1PBB A;  2WQY A;  4H2R A;  2I0Z A;  1KF6 A;  1NPX A;  4E0V A;  1V59 A;  5U1O A;  4O5Q A;  2CVJ A;  1ZP0 A;  4Z26 A;  1Q1R A;  2XVF A;  1AOG A;  1DOE A;  3LZX A;  4FX9 A;  3SFD A;  3RNM A;  1D4E A;  4BJZ A;  3K7Q X;  4J57 A;  3CNP A;  4D03 A;  4CCR A;  3AEE A;  1K0L A;  4UDP A;  2X8C A;  1Y56 B;  3VR8 A;  3AB1 A;  3GMC A;  1ELI A;  4RG3 A;  4DNA A;  3CGE A;  3AEF A;  4Y4L A;  1GV4 A;  4AOS A;  4H4U A;  1NAA A;  3BI4 A;  4O5U A;  4A6N B;  3EF6 A;  1PJ6 A;  4EIQ A;  2WPC A;  4J31 A;  3VRA A;  1IUX A;  3JSK A;  3CGC A;  2AQJ A;  4H2Q A;  4H4V A;  2YQU A;  1LQU A;  1YY5 A;  2OLO A;  4X9N A;  4DSH A;  3Q9T A;  4U8I A;  4U8M A;  2FJB A;  2IVD A;  3GWD A;  2C3C A;  2YVF A;  2WP9 A;  1L9C A;  3AEB A;  5GRT A;  3B6D A;  4TM0 A;  4K5S A;  1YQ3 A;  3FPZ A;  4NTD A;  3T37 A;  3NK1 X;  3G5Q A;  3K7T A;  4GRT A;  1E1L A;  2XVI A;  1CJC A;  3NKS A;  1B37 A;  3CNT A;  4N9X A;  3CNS A;  1GRT A;  2CDU A;  1DOC A;  2WOV A;  3QSE A;  1H86 A;  3AE3 A;  2R45 A;  4CY6 A;  3F8D A;  5C3J A;  4EQW A;  4OPU A;  4U8L A;  2VZ2 A;  3P4R A;  4USQ A;  1CL0 A;  1RSG A;  2XFN A;  5GSN A;  3V3O A;  1OJD A;  2IVE A;  5M0Z A;  3AEG A;  3VR9 A;  4U8J A;  4EIP A;  1JOA A;  3LB8 A;  1JNZ A;  3VRB A;  3BNU A;  2EQ9 A;  2WDR A;  2X3N A;  4J56 A;  1CJ2 A;  4P9S A;  2BK3 A;  3NYF A;  2XCG A;  4H4X A;  2V3B A;  2W0H A;  1F8R A;  3GMB A;  2Q6U A;  1DOD A;  4EMJ A;  1RP0 A;  1RYI A;  1NG3 A;  2GVC A;  3UKH A;  4AT0 A;  2JB1 A;  3RED A;  2V61 A;  2BK5 A;  1LVL A;  2XYO A;  3P4P A;  5KOW A;  2JK6 A;  2V3A A;  1GTE A;  5EBK A;  1K4Q A;  3V76 A;  3UCL A;  3FIM B;  1NDA A;  2JBV A;  4GCM A;  4NZH A;  4NEV A;  1H6V A;  2C72 A;  2YAU A;  2WU2 A;  1MO9 A;  2YVJ A;  2YR5 A;  4EM3 A;  4EMI A;  3G5S A;  2Y6Q A;  4Y4N A;  2OAL A;  2RGJ A;  2VRM A;  5KXJ A;  3H4K A;  3SQP A;  1GEU A;  2Z5X A;  1ONF A;  1H7W A;  3I6D A;  3PVC A;  3CGB A;  4B64 A;  5FS8 A;  3AD8 B;  3ZDN A;  4B67 A;  1D4C A;  3ADA B;  1NG4 A;  3K30 A;  2GR3 A;  4OCG A;  1REO A;  4CCQ A;  1COY A;  4A99 A;  1NEN A;  2TPR A;  2WOI A;  1EL9 A;  1QO8 A;  1UKV G;  2ACZ A;  2R4J A;  2OA1 A;  4H2N A;  3NRN A;  1S3E A;  3DH9 A;  4XXG A;  4A5L A;  4A9W A;  4Z2T A;  1NHP A;  4U8K A;  2BXR A;  2Z5Y A;  2BCG G;  3AYI A;  3BHK A;  4ZCC A;  4BJY A;  3P4S A;  4YTN A;  2YG6 A;  4YSZ A;  3FBS A;  4Z25 A;  3NGC X;  1S2Y A;  4J2W A;  3AYJ A;  1EL5 A;  2XFO A;  1M64 A;  1KNP A;  1O5W A;  3C4N A;  4H4S A;  3NTA A;  1KFY A;  1PHH A;  1JNR A;  3AE2 A;  3H8I A;  4ECH A;  3ATR A;  1GES A;  4AP1 A;  4Z43 A;  3UP4 A;  2VVL G;  2EQ6 A;  3II4 A;  2BXS A;  3NN6 X;  1ZMD A;  3NT6 A;  4J33 A;  3ZYX A;  3EAO A;  2QAE A;  2GH5 A;  2BS3 A;  2QCU A;  1JRX A;  3AE5 A;  2X8G A;  4C5O A;  5J60 A;  5BVA A;  2F5Z A;  1OJA A;  1B8S A;  4YWO A;  2NPX A;  2O9Z A;  2R0G A;  3E1T A;  3LJP A;  3S5W A;  5LV9 A;  3NLC A;  3VRD B;  3NK0 X;  4AOX A;  3ICR A;  1GRG A;  1D5T A;  1N1P A;  3AE1 A;  4REK A;  1L0V A;  1M6I A;  2PYX A;  1TDN A;  2C70 A;  1GRE A;  3UKK A;  4CY8 A;  2WHD A;  2E1M A;  5CKU A;  2R0C A;  4TLX A;  2V5Z A;  4Z2R A;  2FJE A;  5FS6 A;  3BI2 A;  2WEU A;  4EQX A;  5JCK A;  1GRB A;  2AAQ A;  4JDR A;  2JKC A;  4BK1 A;  4B65 A;  1CC2 A;  4YKG A;  5EB4 A;  2C64 A;  1FOH A;  3S61 A;  4BUR A;  3DGZ A;  4NEW A;  1B5Q A;  1CBO A;  2ZZ0 A;  1H81 A;  4Z44 A;  1CJ4 A;  1TDK A;  1K0J A;  1OJ9 A;  2GMJ A;  3NG7 X;  4B63 A;  1TDE A;  3AD7 B;  1PBC A;  3M0O A;  1TYP A;  1FCD A;  1PBE A;  4NTE A;  3LOV A;  3BHF A;  3DJJ A;  2QA1 A;  2ZZB A;  3LZW A;  2X8H A;  2WOW A;  4DGK A;  4H4R A;  2R0P A;  1E1K A;  4UP3 A;  4CBQ A;  3HZL A;  3UOZ A;  3QJ4 A;  3NTD A;  1ZOY A;  5U63 A;  4JN9 A;  1ZX9 A;  2YG4 A;  2XLU A;  1LQT A;  2RGH A;  1GRA A;  1GSN A;  5KWF A;  2YLX A;  4TM4 A;  4BK3 A;  2BS2 A;  5KVI A;  4JNA A;  2B76 A;  2YWL A;  1H82 A;  3ALL A;  4ZN0 A;  1D4D A;  2C7G A;  2WPF A;  5L46 A;  3AYL A;  2VQ7 A;  1O94 A;  3Q6J A;  1TDO A;  2YLW A;  1DXL A;  5KRQ A;  2WPE A;  5JCI A;  2UZZ A;  3RP7 A;  3DA1 A;  1TRB A;  1PXA A;  2FBW A;  1GET A;  2E4G A;  2YG7 A;  2GEW A;  2YLT A;  4KX6 A;  2WDV A;  5HYM A;  5DBJ A;  5IPY A;  2GQF A;  4YTM A;  5HY5 A;  3O0H A;  4XWZ A;  2RAB A;  1DOB A;  5KOX A;  2BC0 A;  2ZZC A;  3QSM A;  1OJT A;  3UTH A;  4YSY A;  3SGL A;  3AE6 A;  4JY2 A;  2RGO A;  1CHU A;  2QA2 A;  2WES A;  4HA6 A;  1GXF A;  3NH3 X;  3GD4 A;  3AE9 A;  4I58 A;  2R46 A;  1PXB A;  2VVM A;  2OLN A;  1BGN A;  2R9Z A;  1N4V A;  2NVK X;  1TYT A;  2XFP A;  4XWR A;  4I59 A;  2EQ8 A;  1OJC A;  1BGJ A;  4UDQ A;  2XVE A;  4H7U A;  4DSG A;  2BAC A;  1N4U A;  2A89 A;  2GAH B;  1E7P A;  2PHH A;  4K8D A;  2H89 A;  4APN A;  2ZBW A;  1K0I A;  3KD9 A;  3ATQ A;  3VQR A;  5BUL A;  3DME A;  3L8K A;  4H50 A;  1Z6L A;  3AED A;  3EAN A;  1FL2 A;  2A87 A;  3GYI A;  3GRT A;  2XFQ A;  3ITJ A;  1Y0P A;  2BK4 A;  3ICS A;  5BRT A;  3EPT A;  5JCL A;  2HQM A;  1O95 A;  1IUV A;  1IJH A;  5JCN A;  3PS9 A;  1E39 A;  4U8N A;  5HHF A;  1FEC A;  3AWI A;  4M52 A;  1D7L A;  5J7X A;  1N4W A;  1GOS A;  2GR2 A;  4H2P A;  2JB2 A;  4H4Q A;  3NK2 X;  1BZL A;  1IUW A;  2YVG A;  3DGH A;  3I3L A;  4EM4 A;  3UOY A;  4OPI A;  2JAE A;  1IUT A;  3FG2 P;  2BS4 A;  1NHR A;  2BAB A;  4K5R A;  4OPC A;  3GSI A;  1VDC A;  1NHQ A;  3AE4 A;  3KU9 A;  1Q1W A;  1GT8 A;  3KA7 A;  3QSS A;  4U2S A;  4LA1 A;  1S3B A;  4IV9 A;  2WET A;  2R4E A;  4USR A;  4AP3 A;  2BA9 A;  1GPE A;  2XFU A;  1L9D A;  4MJW A;  3CPI G;  2C65 A;  1ZY8 A;  4U2L A;  2Q0L A;  4BK2 A;  1DJN A;  1NEK A;  1DNC A;  3AEC A;  2XVH A;  4D04 A;  2C3D A;  2V6O A;  2BYB A;  5C2T A;  4FDC B;  5KVH A;  4TM3 A;  2GMH A;  4C77 A;  3AEA A;  3K7M X;  4A7A A;  3DJD A;  1Y56 A;  3NYC A;  3COX A;  1EBD A;  3DJG X;  3CND A;  1W4X A;  2CFY A;  4Z2U A;  1KNR A;  1YQ4 A;  1QLB A;  4A6N A;  4LII A;  3GWF A;  2C73 A;  4H4Y A;  3M12 A;  1XPQ A;  1EL8 A;  4RG4 A;  4AT2 A;  2Q0K A;  3OZ2 A;  1VG0 A;  5FS9 A;  3UOV A;  3P9U A;  3UTE A;  4B69 A;  3AD9 B;  3ABV A;  1PN0 A;  1KDG A;  1P2H A;  1SEZ A;  2GRT A;  2YM1 A;  1BWC A;  5JCM A;  1GAL A;  3UP5 A;  3QFA A;  2GF3 A;  5CQF A;  2WS3 A;  2JB3 A;  4ICY A;  2YR6 A;  3AE8 A;  2YM2 A;  1PBD A;  4X9M A;  1GND A;  3C4A A;  2CUL A;  2VOU A;  1F8S A;  2XDO A;  4EQS A;  1JRZ A;  5EOW A;  2YG3 A;  3KKJ A;  3ALJ A;  5U25 A;  4H4T A;  1VQW A;  2XLR A;  3AXB A;  4YSH A;  4YTP A;  3UKP A;  1IUU A;  3RHA A;  3CPJ G;  4FK1 A;  1E1M A;  1E1N A;  1HYU A;  1PDH A;  3ALM A;  1ZDL A;  3F8P A;  1P2E A;  1TDF A;  4YT0 A;  2A8X A;  2GAG B;  3C96 A;  1FEB A;  3H8L A;  2VVL A;  1LV0 A;  4OPT A;  5IQ4 A;  3OC4 A;  3NNE A;  2GR0 A;  2C75 A;  1GRF A;  1CF3 A;  4NTC A;  2X99 A;  2E5V A;  3LAD A;  4B66 A;  2FJD A;  2B9X A;  3F8R A;  1ZMC A;  2C76 A;  2IID A;  3CIR A;  3NYE A;  4X4J A;  2Q7V A;  3P4Q A;  3R9U A;  1H83 A;  2YG5 A;  3BNM A;  2GB0 A;  2YLS A;  4H4P A;  2XLP A;  2X50 A;  2WDQ A;  4J36 A;  4K22 A;  1ZKQ A;  4U8P A;  1EL7 A;  3DJE A;  4TLZ A;  4B1B A;  1BF3 A;  1JU2 A;  3CTY A;  4J34 A;  1FEA A;  4U2T A;  1YQZ A;  4GF7 A;  4TM1 A;  3UTF A;  4EQR A;  2YR4 A;  2GV8 A;  4OPG A;  1E6E A;  1PJ5 A;  4IA5 A;  2ARD A;  4IVM B;  3IHG A;  4CNJ A;  2XLT A;  1XHC A;  3IC9 A;  3RP8 A;  3DK9 A;  3IWA A;  1H84 A;  5EB5 A;  1D7Y A;  5FS7 A;  2EQ7 A;  1X31 B;  4JNQ A;  2APG A;  3B3R A;  2B9Y A;  3P1W A;  3CGD A;  1CJ3 A;  1QJD A;  2WBA A;  3NHO X;  4Y4M A;  2Y6R A;  1Q9I A;  1S2Q A;  4C74 A;  3L1R A;  1YKJ A;  3FMW A;  4BV6 A;  3IHM A;  3GDP A;  4Z24 A;  3KPF A;  3NIX A;  5HXI A;  4CRT A;  3CPH G;  2WP6 A;  2DKH A;  2AR8 A;  1F8W A;  2GR1 A;  4K2X A;  3WE0 A;  1LJ1 A;  3QVR A;  4OVI A;  3V3N A;  4PAB A;  4PAA A;  4B68 A;  3QVP A;  4GDP A;  4CNK A;  1LPF A;  4UDR A;  3D8X A;  4FK1 C;  4JY3 A;  1BKW A;  1L9E A;  4ZCD A;  4H4Z A;  1DJQ A;  1F6M A;  4IVO B;  2FJA A;  3D1C A;  1MOK A;  1H7X A;  4KPR A;  2XLS A;  3SM8 A;  4EMW A;  4YSX A;  5BUK A;  1XDI A;  4WX1 A;  2GQW A;  2H88 A;  1PBF A;  1NHS A;  3G5R A;  3GDN A;  3M13 A;  1KSU A;  5FMH A;  2WU5 A;  1VG9 A;  1GRH A;  3UKF A;  1PS9 A;  4A65 A;  3UKA A;  3IF9 A;  2TMD A;  3URH A;  1CC6 A; 
#chains in the Genus database with same CATH topology
 3HYX A;  2XVJ A;  4HB9 A;  2YLZ A;  1F3P A;  3PO7 A;  3UOX A;  3SFE A;  2C66 A;  4K7Z A;  4A79 A;  5J04 A;  1CC4 A;  3UKQ A;  3UTG A;  4C3X A;  4X2P A;  3MQT A;  2B7S A;  2YLR A;  4U8O A;  2BC1 A;  3GD3 A;  3MZN A;  2C67 A;  3DK8 A;  4ADW A;  5TR3 A;  1PBB A;  2WQY A;  4H2R A;  2I0Z A;  1KF6 A;  1NPX A;  4DYE A;  1PDY A;  4Z26 A;  1Q1R A;  3SFD A;  4F4R A;  2P88 A;  4J57 A;  4CCR A;  3AEE A;  1Y56 B;  3D46 A;  4Y4L A;  4A6N B;  3EF6 A;  2WPC A;  4J31 A;  4H2Q A;  2PTY A;  2OLO A;  4X9N A;  3Q9T A;  4U8I A;  1KKR A;  2FJB A;  2HNE A;  3ENL A;  2IVD A;  3DG6 A;  3AEB A;  2RDX A;  3FPZ A;  1H2I A;  3GD6 A;  3T37 A;  3NK1 X;  3ZVH B;  4N9X A;  3R07 C;  3S47 A;  3F8D A;  2VZ2 A;  1JRO A;  3NRZ B;  3AEG A;  3VR9 A;  4EIP A;  3LB8 A;  1JNZ A;  3SZC A;  2WDR A;  1CJ2 A;  2XCG A;  3GMB A;  4GAP A;  4EMJ A;  2HZG A;  1NG3 A;  2GVC A;  3RED A;  4DHG A;  1LVL A;  2XYO A;  1GTE A;  4FP1 A;  2Y6Q A;  2ZAD A;  3Q4D A;  3PVC A;  2P3Z A;  2PP0 A;  3AD8 B;  1NEN A;  2ACZ A;  4KX6 A;  4HYR A;  1S3E A;  4Z2T A;  3H8A A;  2BXR A;  2Z5Y A;  2BCG G;  2XH2 A;  3P0W A;  3NGC X;  1S2Y A;  1M64 A;  3NTA A;  2O56 A;  1KFY A;  1PHH A;  3AE2 A;  1GES A;  3FCP A;  3SR6 B;  3II4 A;  5G5H B;  2QAE A;  3AE5 A;  2X8G A;  3GYX A;  4C5O A;  3B97 A;  2GGG A;  1B8S A;  2O9Z A;  2R0G A;  5LV9 A;  2OX4 A;  3ICR A;  5BOE A;  2PYX A;  3KUM A;  1TDN A;  3UKK A;  4CY8 A;  4G73 A;  2E1M A;  3T8Q A;  2R0C A;  4GIR A;  4TLX A;  5FS6 A;  5JCK A;  1GRB A;  2AAQ A;  1CC2 A;  5EB4 A;  4BUR A;  1B5Q A;  4Z44 A;  1CJ4 A;  1TDK A;  1K0J A;  1TYP A;  5KMS A;  3LOV A;  3BHF A;  2ZZB A;  3BJS A;  1OEP A;  4H4R A;  1E1K A;  3UOZ A;  3NTD A;  3IK4 A;  2YLX A;  3SN4 A;  2BS2 A;  2YWL A;  3SJN A;  3OPS A;  4MKS A;  1D4D A;  1O94 A;  1TDO A;  1DXL A;  2MUC A;  5JCI A;  2QQ6 A;  3HRD C;  2UZZ A;  1TRB A;  4IHC A;  3K1G A;  4MMW A;  1SJD A;  3ZVI A;  5HYM A;  5DBJ A;  2GQF A;  4G6H A;  2ZZC A;  3DIP A;  2WES A;  1BGN A;  2I5Q A;  1OJC A;  4UDQ A;  4DSG A;  1WUE A;  1N4U A;  2PHH A;  4APN A;  1TKK A;  2W3S A;  3DME A;  3N6H A;  1Z6L A;  2A87 A;  2QJN A;  3ITJ A;  5BRT A;  1MRA A;  5JCL A;  1IUV A;  4Z1Y A;  1MNS A;  1FEC A;  3V4B A;  4M52 A;  1D7L A;  5J7X A;  3ZLF A;  2GR2 A;  3TWA A;  3NK2 X;  3VDG A;  1IUW A;  2JAE A;  3FG2 P;  1F9C A;  2AL1 A;  4JN8 A;  2BRA A;  3AE4 A;  4IV9 A;  2WET A;  2XFU A;  2C65 A;  1DJN A;  2XVH A;  2BYB A;  5C2T A;  3DJD A;  1Y56 A;  3NYC A;  1EBD A;  3DJG X;  3CND A;  1W4X A;  1PDZ A;  2PTZ A;  1QLB A;  4A6N A;  4LII A;  2AL2 B;  3PG6 A;  4RG4 A;  3UTE A;  1SEZ A;  3UP5 A;  5CQF A;  4GGH A;  3ZVH A;  1TE6 A;  2YM2 A;  3RCY A;  4X9M A;  2VOU A;  2YG3 A;  3ALJ A;  3ETR B;  5U25 A;  1VQW A;  1EC7 A;  3SQS A;  4YTP A;  2GL5 A;  3CPJ G;  3UJ2 A;  3NFU A;  1TDF A;  2A8X A;  3NVV B;  2GAG B;  3C96 A;  4K2S A;  2VVL A;  5IQ4 A;  3NNE A;  2GR0 A;  2C75 A;  1CF3 A;  2E5V A;  1R0M A;  3FV9 A;  3JZU A;  2FJD A;  4HNC A;  3R9U A;  3RIT A;  1H83 A;  2GB0 A;  2OZ3 A;  4J36 A;  2WDQ A;  1JU2 A;  4J34 A;  3NXL A;  3EUB 3;  4U2T A;  4TM1 A;  3UTF A;  4EQR A;  2GV8 A;  4KWS A;  3CMM A;  1PJ5 A;  3DES A;  5EB5 A;  4JNQ A;  1RM6 B;  2APG A;  4M0X A;  4G7F A;  2WBA A;  2C4C A;  3EEZ A;  1IYX A;  3T2K A;  4CRT A;  4K2X A;  2GR1 A;  1LJ1 A;  3V3N A;  3D8X A;  1BKW A;  4IVO B;  3AN1 A;  1MOK A;  4YSX A;  5BUK A;  1XDI A;  4WX1 A;  2GQW A;  3G5R A;  1PS9 A;  2TMD A;  4E6M A;  3VA8 A;  1JEH A;  3CN8 A;  4TVW A;  4GR1 A;  2B9W A;  4OPL A;  4YKF A;  3UKL A;  2J3N A;  3A7U A;  3ICT A;  4KPL A;  3RP6 A;  4RSL A;  2OQY A;  2WP5 A;  2VQB A;  4DX3 A;  4NWZ A;  5IQ1 A;  3CNJ A;  1ONE A;  1B4V A;  4LU6 A;  1PXC A;  4H4W A;  3ISH A;  4C3Y A;  5U1O A;  3L5O A;  2XVF A;  1AOG A;  4G6G A;  3RNM A;  1P43 A;  3I6E A;  3CNP A;  2DW6 A;  1EC9 A;  1K0L A;  4NNJ A;  3IJI A;  4AOS A;  4HPN A;  1NAA A;  4O5U A;  1PJ6 A;  3CGC A;  1LQU A;  4DSH A;  3GWD A;  3B6D A;  4K5S A;  2PCE A;  3K7T A;  3R25 A;  3T2Y A;  1B37 A;  3CNT A;  3CNS A;  4DN1 A;  3QSE A;  3AE3 A;  5C3J A;  4U8L A;  3P4R A;  2XFN A;  2OG9 A;  3CXB A;  2W0H A;  4HCL A;  3MY9 A;  2Q6U A;  1RYI A;  2PTW A;  2V3A A;  5EBK A;  1JPD X;  2JBV A;  4NZH A;  2C72 A;  2WU2 A;  4EM3 A;  3T6C A;  3G5S A;  4G9K A;  3SQP A;  1ONF A;  3I6D A;  3ZDN A;  3ADA B;  1R6W A;  3UCC A;  3K30 A;  2GR3 A;  4OCG A;  1REO A;  1COY A;  4A99 A;  1UKV G;  4CY6 A;  1EL9 A;  4H2N A;  4II2 A;  4A5L A;  1NHP A;  1MDR A;  4YSZ A;  3FBS A;  2AL2 A;  3AYJ A;  1MUC A;  3UJE A;  4E5T A;  3ATR A;  3NT6 A;  2BXS A;  3NN6 X;  4J33 A;  2BS3 A;  1JRX A;  3OTR A;  5BVA A;  3LJP A;  3NLC A;  4IL0 A;  1GRG A;  3A7R A;  3AE1 A;  4REK A;  1L0V A;  3A7A A;  1VDV A;  3RRA A;  1GRE A;  2WHD A;  2OZT A;  4IP5 A;  2V5Z A;  4Z2R A;  2FJE A;  3BI2 A;  2NQL A;  1NU5 A;  2JKC A;  4B65 A;  4YKG A;  2ZZ0 A;  2GMJ A;  3AD7 B;  1PBC A;  4K8G A;  2PP1 A;  4FI4 A;  3LZW A;  2X8H A;  4DGK A;  2GDQ A;  3N4E A;  3DG3 A;  3HZL A;  3QJ4 A;  3THU A;  5U63 A;  2YG4 A;  3QTP A;  4J1O A;  5L46 A;  3AYL A;  3Q6J A;  2YLW A;  1X2H A;  5JRB A;  2HXT A;  3MWC A;  1GET A;  2YLT A;  5IPY A;  3O0H A;  4XWZ A;  4YWS A;  2RAB A;  1DOB A;  3HW2 A;  1OJT A;  1CHU A;  3NH3 X;  2P8B A;  3AM9 A;  3AE9 A;  2R46 A;  2W54 A;  2VVM A;  2R9Z A;  2NVK X;  1TYT A;  3SN1 A;  2XVE A;  4H7U A;  3U9I A;  5KNL A;  2H89 A;  1K0I A;  3KD9 A;  2XH7 A;  1STZ A;  4H50 A;  2FYM A;  3ICS A;  3T4W A;  1O95 A;  1IJH A;  3PS9 A;  2QVH A;  1FFU C;  3CB3 A;  3AWI A;  3QPE A;  2POD A;  3DGB A;  1BZL A;  2YVG A;  3DGH A;  4OPI A;  5FJT A;  1XPY A;  2BAB A;  4OPC A;  1NHQ A;  4LA1 A;  5FJP A;  2R4E A;  2BA9 A;  2Q0L A;  1JRP A;  1NEK A;  3D9X A;  3AEC A;  4TM3 A;  4C77 A;  3AEA A;  4A7A A;  3COX A;  3VC5 A;  3DER A;  1KNR A;  3AMZ A;  2C73 A;  1SJA A;  3DFH A;  1NEL A;  4GIS A;  1PN0 A;  1KDG A;  1P2H A;  2YR6 A;  3AE8 A;  1PBD A;  2CUL A;  1X2G A;  5EOW A;  3UJS A;  3CK5 A;  4H4T A;  3RHA A;  4FK1 A;  1HYU A;  1PDH A;  3F8P A;  1P2E A;  3FXG A;  2PGW A;  3H8L A;  3OC4 A;  4ZOH B;  4NTC A;  2X99 A;  3LAD A;  1YEY A;  2QJM A;  2W55 A;  3F8R A;  3TTE A;  4H19 A;  4U8P A;  3BNM A;  4K22 A;  1ZKQ A;  1EL7 A;  4TLZ A;  3TJ4 A;  1BF3 A;  3UJR A;  3TWB A;  2ONE A;  2YR4 A;  2XLT A;  1H84 A;  3B3R A;  2B9Y A;  2OLA A;  2PSN A;  1N62 C;  3NHO X;  1Q9I A;  2ZC8 A;  4C74 A;  3FMW A;  4BV6 A;  3IHM A;  4EWJ A;  3GDP A;  3P93 A;  4Z24 A;  3KPF A;  3P3B A;  3CPH G;  4HNL A;  2AR8 A;  5FJR A;  3WE0 A;  3H70 A;  4OVI A;  4E4F A;  3QVP A;  1LPF A;  4FK1 C;  2FJA A;  4KPR A;  2H88 A;  2WU5 A;  3UKA A;  3URH A;  1CC6 A;  2OAM A;  5M10 A;  1KN0 A;  3LXD A;  3VCN A;  5IDZ A;  4WCT A;  5BOF A;  1JRY A;  3KLJ A;  1ZOV A;  4IA6 A;  1N63 C;  1IUS A;  2VRL A;  2B7R A;  2PMQ A;  3QFB A;  4JQ9 A;  5ENL A;  2BCP A;  3NN0 X;  2CVJ A;  3I4K A;  4ZCW A;  3LZX A;  3PK7 A;  5G5G B;  1D4E A;  4D03 A;  2OKT A;  4UDP A;  3R0U A;  3VCC A;  4H4U A;  3BI4 A;  3ZLG A;  3VRA A;  4H4V A;  1YY5 A;  2YVF A;  4HCD A;  4TM0 A;  5GRT A;  4NTD A;  3G5Q A;  1E1L A;  3NKS A;  3JVA A;  1EBG A;  1KKO A;  4OPU A;  4USQ A;  1CL0 A;  5GSN A;  5M0Z A;  2IVE A;  3DG7 A;  3SBF A;  4U8J A;  3HYW A;  1JOA A;  3BNU A;  1W6T A;  2EQ9 A;  3OZM A;  4P9S A;  2BK3 A;  4H4X A;  2V3B A;  1F8R A;  3SZW A;  1RP0 A;  3UKH A;  1S7M A;  2GGJ A;  2V61 A;  3BOX A;  2BK5 A;  3V76 A;  3FIM B;  1NDA A;  4KT2 A;  4GCM A;  2YAU A;  2YR5 A;  1KD0 A;  2RGJ A;  3H4K A;  1GEU A;  4ZA0 A;  1DTN A;  2MNR A;  5KMQ A;  3CGB A;  4B64 A;  3CAW A;  5FS8 A;  3NVZ B;  2TPR A;  2WOI A;  2R4J A;  4A9W A;  2OA1 A;  3NRN A;  3DH9 A;  3BHK A;  4ZCC A;  1FHV A;  4BJY A;  4Z25 A;  4DWD A;  4J2W A;  3UCD A;  4J3Z A;  1KNP A;  3C4N A;  3H8I A;  4ECH A;  1SJB A;  4AP1 A;  2VVL G;  2EQ6 A;  3R0K A;  2PU0 A;  3HPF A;  3EAO A;  2GH5 A;  3R1Z A;  3V5F A;  3KPK A;  2XSX A;  3SN0 A;  3VRD B;  4AOX A;  2P0I A;  1D5T A;  1N1P A;  3N4F A;  3DDM A;  3V3W A;  1ELS A;  1JDF A;  2C70 A;  4GFI A;  3TW9 A;  2WEU A;  4EQX A;  4JDR A;  3NVW B;  3PWG A;  2C64 A;  1FOH A;  3DGZ A;  1H81 A;  4B63 A;  1OJ9 A;  1TDE A;  3M0O A;  3VFC A;  1FCD A;  2XH4 A;  3QLD A;  2QA1 A;  5FJO A;  4E4U A;  2PPG A;  2WOW A;  4JN9 A;  1ZX9 A;  2XLU A;  5KWF A;  1GRA A;  1GSN A;  4TM4 A;  2B76 A;  1H82 A;  4ZN0 A;  2VQ7 A;  5KRQ A;  3RP7 A;  2E4G A;  5KOX A;  3OP2 A;  4YSY A;  3SGL A;  3AE6 A;  1WYG A;  2RGO A;  2QA2 A;  1GXF A;  3N6J A;  1PXB A;  3TOY A;  1N4V A;  2XFP A;  2QDD A;  1BGJ A;  3SX6 A;  2A89 A;  2GAH B;  4K8D A;  3VQR A;  3ATQ A;  3L8K A;  3CT2 A;  2PP3 A;  3EAN A;  1FL2 A;  4G8T A;  2QDE A;  4ROP A;  3DFY A;  3SYI A;  4GYP A;  5JCN A;  4U8N A;  4H2H A;  4EM4 A;  3UOY A;  2BS4 A;  1NHR A;  3RGT A;  1VDC A;  3KU9 A;  3QSS A;  1Q1W A;  3KA7 A;  1JCT A;  1S3B A;  3MSY A;  4MJW A;  3CPI G;  1ZY8 A;  3RO6 A;  4BK2 A;  4D04 A;  1DNC A;  2C3D A;  2V6O A;  4FDC B;  3K7M X;  4K1W A;  3ES7 A;  2CFY A;  1YQ4 A;  4JHM A;  4AT2 A;  1XPQ A;  1EL8 A;  3OZ2 A;  4B69 A;  1BWC A;  1V97 A;  1FHU A;  2WS3 A;  2POZ A;  4ICY A;  2QGY A;  3GC2 A;  1GND A;  3C4A A;  1F8S A;  4GYP C;  4IP4 A;  2XDO A;  4EQS A;  3NS1 B;  2PGE A;  2XLR A;  4YSH A;  3MUC A;  2E5A A;  1IUU A;  1E1M A;  3ALM A;  3ES8 A;  3NZG A;  4YT0 A;  1FEB A;  3TQP A;  1N5W C;  4OPT A;  3PWI A;  1GRF A;  4B66 A;  3SXI A;  2IID A;  2C76 A;  3CIR A;  1SB3 B;  3FVD A;  2Q7V A;  3P4Q A;  2YG5 A;  4BK3 A;  4B1B A;  3CTY A;  1FEA A;  4GF7 A;  1SJC A;  4OPG A;  1E6E A;  2HXU A;  4IA5 A;  3SZF A;  2ARD A;  3IHG A;  3SZ0 A;  1XHC A;  3DK9 A;  2EQ7 A;  1CJ3 A;  1EC8 A;  4M6U A;  2Y6R A;  3IJL A;  1EBH A;  1YKJ A;  2OZ8 A;  2OPJ A;  5HXI A;  1F8W A;  4A6G A;  4PAB A;  4B68 A;  4GDP A;  4CNK A;  4UDR A;  5KMP A;  3TCS A;  4ZCD A;  7ENL A;  4H4Z A;  1DJQ A;  1H7X A;  2XLS A;  4EMW A;  1WUF A;  3M13 A;  5FMH A;  2FKP A;  1GRH A;  4A65 A;  1BQG A;  3GYJ A;  4GDE A;  3AE7 A;  1LTX R;  1MXT A;  1VRQ B;  4GUV A;  3DEQ A;  2V60 A;  2BRY A;  1L8P A;  3BI5 A;  4YXD A;  2DKI A;  5ER0 A;  3HYV A;  1KSS A;  1ZK7 A;  3DK4 A;  1N60 C;  3KVE A;  4OPD A;  1GER A;  1PJ7 A;  1XAN A;  3GRS A;  1GTH A;  4E0V A;  1V59 A;  4O5Q A;  1ZP0 A;  4KEM A;  1DOE A;  4FX9 A;  4BJZ A;  5KMR A;  3K7Q X;  2X8C A;  3VR8 A;  3AB1 A;  3GMC A;  1N61 C;  2GGH A;  3UXK A;  1ELI A;  4RG3 A;  4DNA A;  3CGE A;  3AEF A;  1GV4 A;  3D47 A;  4EIQ A;  2QJJ A;  1IUX A;  3JSK A;  2AQJ A;  3R11 A;  2YQU A;  5FJU A;  4U8M A;  3FJ4 A;  2C3C A;  2WP9 A;  1L9C A;  1YQ3 A;  1TZZ A;  3JW7 A;  4GRT A;  2XVI A;  1CJC A;  1GRT A;  2CDU A;  1DOC A;  2WOV A;  1H86 A;  2R45 A;  3PFR A;  4JN7 A;  4EQW A;  1JPM A;  3CYJ A;  1RSG A;  4Z17 A;  3V3O A;  4IZG A;  1OJD A;  3ZLH A;  4II3 A;  3VRB A;  2X3N A;  4J56 A;  3NYF A;  1RVK A;  2OVL A;  1DOD A;  4AT0 A;  2JB1 A;  3P4P A;  5KOW A;  2JK6 A;  1K4Q A;  3UCL A;  4NEV A;  1H6V A;  1MO9 A;  2YVJ A;  3BSM A;  3B9J B;  4EMI A;  4Y4N A;  2OAL A;  2VRM A;  5KXJ A;  3CXO A;  2Z5X A;  1H7W A;  3UJF A;  4B67 A;  1D4C A;  1NG4 A;  1VQZ A;  2GGI A;  4HN8 A;  4CCQ A;  1QO8 A;  4XXG A;  3GO2 A;  4E8G A;  4U8K A;  3AYI A;  4YTN A;  3P4S A;  2YG6 A;  1EL5 A;  2XFO A;  1O5W A;  4H4S A;  1JNR A;  4Z43 A;  3UP4 A;  2CHR A;  1ZMD A;  5EU9 A;  3ZYX A;  2PU1 A;  2QCU A;  3UXL A;  5J60 A;  2F5Z A;  1OJA A;  4YWO A;  2NPX A;  3S5W A;  3E1T A;  3NK0 X;  4GAV A;  1M6I A;  3TJI A;  2AKZ A;  5CKU A;  4A3R A;  2GGE A;  4BK1 A;  3S61 A;  3H12 A;  4NEW A;  1CBO A;  1ECQ A;  3NG7 X;  2PS2 A;  1PBE A;  4NTE A;  3DJJ A;  2OO6 A;  3T9P A;  3QN3 A;  2R0P A;  4UP3 A;  4CBQ A;  1ZOY A;  1LQT A;  2RGH A;  4JNA A;  5KVI A;  3T31 A;  3ALL A;  2C7G A;  2WPF A;  3IJQ A;  3EKG A;  3SSZ A;  2WPE A;  4ENL A;  2DW7 A;  3DA1 A;  4A35 A;  2FBW A;  1PXA A;  2YG7 A;  3RR1 A;  2GEW A;  2WDV A;  2AKM A;  4YTM A;  5HY5 A;  2BC0 A;  3QSM A;  3UTH A;  4JY2 A;  4I58 A;  4HA6 A;  3GD4 A;  1KCZ A;  2OLN A;  3STP A;  3T2Z A;  4XWR A;  4I59 A;  2EQ8 A;  2BAC A;  1E7P A;  3R10 A;  2ZBW A;  5BUL A;  1XS2 A;  3AED A;  3GYI A;  3GRT A;  2XFQ A;  1Y0P A;  2BK4 A;  3EPT A;  2HQM A;  1E39 A;  3GY1 A;  5HHF A;  1N4W A;  1GOS A;  4H2P A;  2JB2 A;  4H4Q A;  3I3L A;  1FO4 A;  3MKC A;  3SY4 A;  1IUT A;  2OQH A;  3V5C A;  4K5R A;  3GSI A;  1GT8 A;  4U2S A;  4USR A;  4AP3 A;  1MDL A;  1GPE A;  1L9D A;  6ENL A;  4U2L A;  2E3T A;  3NO1 A;  4MGG A;  3T0K A;  4IT1 A;  5KVH A;  2GMH A;  3U4F A;  4Z2U A;  2P8C A;  1N5X A;  2XGZ A;  3GWF A;  2GSH A;  4H4Y A;  3M12 A;  2Q0K A;  1BKH A;  1P48 A;  3Q45 A;  1VG0 A;  5FS9 A;  3UOV A;  3P9U A;  3AD9 B;  3ABV A;  2GRT A;  4TVY A;  2YM1 A;  5JCM A;  4H1Z A;  1GAL A;  3QFA A;  2GF3 A;  2JB3 A;  4DXK A;  2OFJ A;  3S5S A;  1JRZ A;  3KKJ A;  3AXB A;  3UKP A;  1E1N A;  1ZDL A;  3VC6 A;  1FFV C;  1LV0 A;  4IL2 A;  2B9X A;  1ZMC A;  3NYE A;  4X4J A;  4GME A;  4H83 A;  2YLS A;  4H4P A;  2XLP A;  2X50 A;  3RP8 A;  3DJE A;  3QKE A;  3UGV A;  1YQZ A;  2W3R A;  2PA6 A;  4IVM B;  3FYY A;  4CNJ A;  2PTX A;  3IC9 A;  3IWA A;  1FIQ B;  1D7Y A;  5FS7 A;  1X31 B;  4GGB A;  3I6T A;  3P1W A;  3CGD A;  1QJD A;  3T14 A;  1T3Q C;  4Y4M A;  1S2Q A;  3L1R A;  3OW1 A;  2XH0 A;  4HCH A;  3NIX A;  2WP6 A;  2DKH A;  3QVR A;  3H7V A;  4G74 A;  3NVY B;  4PAA A;  4JY3 A;  1L9E A;  1F6M A;  3D1C A;  1ZXI C;  3SM8 A;  1PBF A;  1NHS A;  3GDN A;  1KSU A;  3OZY A;  1E9I A;  1VG9 A;  3UKF A;  3IF9 A; 
#chains in the Genus database with same CATH homology
 3HYX A;  2XVJ A;  1JEH A;  2OAM A;  3CN8 A;  4HB9 A;  3GYJ A;  4GDE A;  3AE7 A;  5M10 A;  2YLZ A;  1F3P A;  1KN0 A;  4GR1 A;  2B9W A;  1LTX R;  1MXT A;  1VRQ B;  3PO7 A;  3LXD A;  4GUV A;  4OPL A;  4YKF A;  3SFE A;  3UKL A;  3UOX A;  2V60 A;  2BRY A;  2C66 A;  3BI5 A;  2J3N A;  4K7Z A;  4A79 A;  4YXD A;  1CC4 A;  3UKQ A;  3UTG A;  3ICT A;  3RP6 A;  2DKI A;  4WCT A;  4RSL A;  5ER0 A;  4C3X A;  2WP5 A;  3HYV A;  1KSS A;  1JRY A;  3KLJ A;  2VQB A;  1ZK7 A;  3DK4 A;  4NWZ A;  1ZOV A;  4IA6 A;  2B7S A;  2YLR A;  3KVE A;  1GER A;  1IUS A;  2VRL A;  4OPD A;  2BC1 A;  4U8O A;  5IQ1 A;  1PJ7 A;  3CNJ A;  2B7R A;  3QFB A;  1B4V A;  3GD3 A;  4JQ9 A;  4LU6 A;  2C67 A;  3DK8 A;  4H4W A;  4ADW A;  1PXC A;  3ISH A;  4C3Y A;  1XAN A;  2BCP A;  3NN0 X;  3GRS A;  1GTH A;  5TR3 A;  1PBB A;  2WQY A;  4H2R A;  2I0Z A;  1KF6 A;  1NPX A;  4E0V A;  1V59 A;  5U1O A;  4O5Q A;  2CVJ A;  1ZP0 A;  3L5O A;  4Z26 A;  1Q1R A;  2XVF A;  1AOG A;  1DOE A;  3LZX A;  4FX9 A;  4G6G A;  3SFD A;  3RNM A;  1D4E A;  4BJZ A;  5KMR A;  3K7Q X;  4J57 A;  3CNP A;  4D03 A;  4CCR A;  3AEE A;  1K0L A;  4NNJ A;  4UDP A;  2X8C A;  1Y56 B;  3VR8 A;  3AB1 A;  3GMC A;  1ELI A;  4RG3 A;  4DNA A;  3CGE A;  3AEF A;  4Y4L A;  1GV4 A;  4AOS A;  4H4U A;  1NAA A;  3BI4 A;  4O5U A;  4A6N B;  3EF6 A;  1PJ6 A;  4EIQ A;  2WPC A;  4J31 A;  3VRA A;  1IUX A;  3JSK A;  3CGC A;  2AQJ A;  4H2Q A;  4H4V A;  2YQU A;  1LQU A;  1YY5 A;  2OLO A;  4X9N A;  4DSH A;  3Q9T A;  4U8I A;  4U8M A;  2FJB A;  2IVD A;  3GWD A;  2C3C A;  2YVF A;  2WP9 A;  1L9C A;  3AEB A;  5GRT A;  3B6D A;  4TM0 A;  4K5S A;  1YQ3 A;  3FPZ A;  1H2I A;  4NTD A;  3T37 A;  3NK1 X;  3G5Q A;  3K7T A;  4GRT A;  1E1L A;  2XVI A;  1CJC A;  3NKS A;  3T2Y A;  1B37 A;  3CNT A;  4N9X A;  3CNS A;  1GRT A;  2CDU A;  1DOC A;  2WOV A;  3QSE A;  1H86 A;  3AE3 A;  2R45 A;  4CY6 A;  3F8D A;  5C3J A;  4EQW A;  4OPU A;  4U8L A;  2VZ2 A;  3P4R A;  4USQ A;  1CL0 A;  1RSG A;  2XFN A;  5GSN A;  3V3O A;  1OJD A;  2IVE A;  5M0Z A;  3AEG A;  3VR9 A;  4U8J A;  4II3 A;  4EIP A;  3HYW A;  1JOA A;  3LB8 A;  1JNZ A;  3VRB A;  3SZC A;  3BNU A;  2EQ9 A;  2WDR A;  2X3N A;  4J56 A;  1CJ2 A;  4P9S A;  2BK3 A;  3NYF A;  2XCG A;  4H4X A;  2V3B A;  2W0H A;  1F8R A;  3GMB A;  2Q6U A;  3SZW A;  4GAP A;  1DOD A;  4EMJ A;  1RP0 A;  1RYI A;  1NG3 A;  2GVC A;  3UKH A;  4AT0 A;  1S7M A;  2JB1 A;  3RED A;  2V61 A;  2BK5 A;  1LVL A;  2XYO A;  3P4P A;  5KOW A;  2JK6 A;  2V3A A;  1GTE A;  5EBK A;  1K4Q A;  3V76 A;  3UCL A;  3FIM B;  1NDA A;  2JBV A;  4GCM A;  4NZH A;  4NEV A;  1H6V A;  2C72 A;  2YAU A;  2WU2 A;  1MO9 A;  2YVJ A;  2YR5 A;  4EM3 A;  4EMI A;  3G5S A;  2Y6Q A;  4Y4N A;  4G9K A;  2OAL A;  2RGJ A;  2VRM A;  5KXJ A;  3H4K A;  3SQP A;  1GEU A;  2Z5X A;  1ONF A;  1H7W A;  3I6D A;  3PVC A;  5KMQ A;  3CGB A;  4B64 A;  5FS8 A;  3AD8 B;  3ZDN A;  4B67 A;  1D4C A;  3ADA B;  1NG4 A;  3K30 A;  2GR3 A;  4OCG A;  1REO A;  4CCQ A;  1COY A;  4A99 A;  1NEN A;  2TPR A;  2WOI A;  1EL9 A;  1QO8 A;  1UKV G;  2ACZ A;  2R4J A;  2OA1 A;  4H2N A;  3NRN A;  1S3E A;  3DH9 A;  4II2 A;  4XXG A;  4A5L A;  4A9W A;  4Z2T A;  1NHP A;  4U8K A;  2BXR A;  2Z5Y A;  2BCG G;  3AYI A;  3BHK A;  4ZCC A;  4BJY A;  3P4S A;  4YTN A;  2YG6 A;  4YSZ A;  3FBS A;  4Z25 A;  3NGC X;  1S2Y A;  4J2W A;  3AYJ A;  1EL5 A;  2XFO A;  1M64 A;  1KNP A;  1O5W A;  3C4N A;  4H4S A;  3NTA A;  1KFY A;  1PHH A;  1JNR A;  3AE2 A;  3H8I A;  4ECH A;  3ATR A;  1GES A;  4AP1 A;  4Z43 A;  3UP4 A;  2VVL G;  2EQ6 A;  3II4 A;  2BXS A;  3NN6 X;  1ZMD A;  3NT6 A;  4J33 A;  3ZYX A;  3EAO A;  2QAE A;  2GH5 A;  2BS3 A;  2QCU A;  1JRX A;  3AE5 A;  2X8G A;  3GYX A;  4C5O A;  5J60 A;  5BVA A;  3KPK A;  2F5Z A;  1OJA A;  1B8S A;  4YWO A;  2NPX A;  2O9Z A;  2R0G A;  3E1T A;  3LJP A;  3S5W A;  5LV9 A;  3NLC A;  3VRD B;  3NK0 X;  4GAV A;  4AOX A;  3ICR A;  1GRG A;  1D5T A;  1N1P A;  3AE1 A;  4REK A;  1L0V A;  1M6I A;  2PYX A;  1TDN A;  2C70 A;  1GRE A;  3UKK A;  4G73 A;  2WHD A;  2E1M A;  4CY8 A;  5CKU A;  2R0C A;  4TLX A;  2V5Z A;  4Z2R A;  2FJE A;  5FS6 A;  3BI2 A;  2WEU A;  4EQX A;  5JCK A;  1GRB A;  2AAQ A;  4JDR A;  2JKC A;  4BK1 A;  4B65 A;  1CC2 A;  4YKG A;  5EB4 A;  2C64 A;  1FOH A;  3S61 A;  4BUR A;  3DGZ A;  4NEW A;  1B5Q A;  1CBO A;  2ZZ0 A;  1H81 A;  4Z44 A;  1CJ4 A;  1TDK A;  1K0J A;  1OJ9 A;  2GMJ A;  3NG7 X;  4B63 A;  1TDE A;  3AD7 B;  1PBC A;  3M0O A;  1TYP A;  1FCD A;  1PBE A;  4NTE A;  5KMS A;  3LOV A;  3BHF A;  3DJJ A;  2QA1 A;  2ZZB A;  3LZW A;  2X8H A;  2WOW A;  4DGK A;  4H4R A;  2R0P A;  1E1K A;  4UP3 A;  4CBQ A;  3HZL A;  3UOZ A;  3QJ4 A;  3NTD A;  1ZOY A;  5U63 A;  4JN9 A;  1ZX9 A;  2YG4 A;  2XLU A;  1LQT A;  2RGH A;  1GRA A;  1GSN A;  5KWF A;  2YLX A;  4TM4 A;  4BK3 A;  2BS2 A;  5KVI A;  4JNA A;  3T31 A;  2B76 A;  2YWL A;  1H82 A;  3ALL A;  4ZN0 A;  1D4D A;  2C7G A;  2WPF A;  5L46 A;  3AYL A;  2VQ7 A;  1O94 A;  3Q6J A;  1TDO A;  2YLW A;  1DXL A;  5KRQ A;  2WPE A;  5JCI A;  5JRB A;  2UZZ A;  3RP7 A;  3DA1 A;  1TRB A;  1PXA A;  2FBW A;  1GET A;  2E4G A;  2YG7 A;  2GEW A;  2YLT A;  4KX6 A;  2WDV A;  5HYM A;  5DBJ A;  5IPY A;  2GQF A;  4G6H A;  4YTM A;  5HY5 A;  3O0H A;  4XWZ A;  2RAB A;  1DOB A;  5KOX A;  2BC0 A;  2ZZC A;  3QSM A;  1OJT A;  3UTH A;  4YSY A;  3SGL A;  3AE6 A;  4JY2 A;  2RGO A;  1CHU A;  2QA2 A;  2WES A;  4HA6 A;  1GXF A;  3NH3 X;  3GD4 A;  3AE9 A;  4I58 A;  2R46 A;  1PXB A;  2VVM A;  2OLN A;  1BGN A;  2R9Z A;  1N4V A;  2NVK X;  1TYT A;  2XFP A;  4XWR A;  3T2Z A;  4I59 A;  2EQ8 A;  1OJC A;  1BGJ A;  4UDQ A;  2XVE A;  4H7U A;  3SX6 A;  4DSG A;  2BAC A;  1N4U A;  2A89 A;  2GAH B;  1E7P A;  2PHH A;  5KNL A;  4K8D A;  2H89 A;  4APN A;  2ZBW A;  1K0I A;  3KD9 A;  3ATQ A;  3VQR A;  5BUL A;  3DME A;  3L8K A;  4H50 A;  1Z6L A;  3AED A;  3EAN A;  1FL2 A;  2A87 A;  3GYI A;  3GRT A;  2XFQ A;  3ITJ A;  1Y0P A;  2BK4 A;  3ICS A;  5BRT A;  3EPT A;  5JCL A;  2HQM A;  3SYI A;  1O95 A;  1IUV A;  1IJH A;  5JCN A;  3PS9 A;  1E39 A;  4U8N A;  5HHF A;  1FEC A;  3AWI A;  4M52 A;  1D7L A;  5J7X A;  1N4W A;  1GOS A;  2GR2 A;  4H2P A;  2JB2 A;  4H4Q A;  3NK2 X;  1BZL A;  1IUW A;  2YVG A;  3DGH A;  3I3L A;  4EM4 A;  3UOY A;  4OPI A;  2JAE A;  3SY4 A;  1IUT A;  3FG2 P;  2BS4 A;  1NHR A;  2BAB A;  2BRA A;  4K5R A;  4OPC A;  3GSI A;  1VDC A;  1NHQ A;  3AE4 A;  3KU9 A;  1Q1W A;  1GT8 A;  3KA7 A;  3QSS A;  4U2S A;  4LA1 A;  1S3B A;  4IV9 A;  2WET A;  2R4E A;  4USR A;  4AP3 A;  2BA9 A;  1GPE A;  2XFU A;  1L9D A;  4MJW A;  3CPI G;  2C65 A;  1ZY8 A;  4U2L A;  2Q0L A;  4BK2 A;  3T0K A;  1DJN A;  1NEK A;  1DNC A;  3D9X A;  2XVH A;  3AEC A;  4D04 A;  2C3D A;  2V6O A;  2BYB A;  5C2T A;  4FDC B;  5KVH A;  4TM3 A;  2GMH A;  4C77 A;  3AEA A;  3K7M X;  4A7A A;  3DJD A;  1Y56 A;  3NYC A;  3COX A;  1EBD A;  3DJG X;  3CND A;  1W4X A;  2CFY A;  4Z2U A;  1KNR A;  1YQ4 A;  1QLB A;  4A6N A;  4LII A;  3GWF A;  2C73 A;  4H4Y A;  3M12 A;  1XPQ A;  1EL8 A;  3PG6 A;  4RG4 A;  4AT2 A;  2Q0K A;  3OZ2 A;  1VG0 A;  5FS9 A;  3UOV A;  3P9U A;  3UTE A;  4B69 A;  3AD9 B;  3ABV A;  1PN0 A;  1KDG A;  1P2H A;  1SEZ A;  2GRT A;  2YM1 A;  1BWC A;  5JCM A;  1GAL A;  3UP5 A;  3QFA A;  2GF3 A;  5CQF A;  2WS3 A;  2JB3 A;  4ICY A;  2YR6 A;  3AE8 A;  2YM2 A;  1PBD A;  4X9M A;  1GND A;  3C4A A;  2CUL A;  2VOU A;  1F8S A;  2XDO A;  4EQS A;  1JRZ A;  5EOW A;  2YG3 A;  3KKJ A;  3ALJ A;  5U25 A;  4H4T A;  1VQW A;  2XLR A;  3AXB A;  4YSH A;  4YTP A;  3UKP A;  1IUU A;  3RHA A;  3CPJ G;  4FK1 A;  1E1M A;  1E1N A;  1HYU A;  1PDH A;  3ALM A;  1ZDL A;  3F8P A;  1P2E A;  1TDF A;  4YT0 A;  2A8X A;  2GAG B;  3C96 A;  1FEB A;  3H8L A;  2VVL A;  1LV0 A;  4OPT A;  5IQ4 A;  3OC4 A;  3NNE A;  2GR0 A;  2C75 A;  1GRF A;  1CF3 A;  4NTC A;  2X99 A;  2E5V A;  3LAD A;  4B66 A;  3SXI A;  2FJD A;  2B9X A;  3F8R A;  1ZMC A;  2C76 A;  2IID A;  3CIR A;  3NYE A;  4X4J A;  2Q7V A;  3P4Q A;  3R9U A;  1H83 A;  2YG5 A;  3BNM A;  2GB0 A;  2YLS A;  4H4P A;  2XLP A;  2X50 A;  2WDQ A;  4J36 A;  4K22 A;  1ZKQ A;  4U8P A;  1EL7 A;  3DJE A;  4TLZ A;  4B1B A;  1BF3 A;  1JU2 A;  3CTY A;  4J34 A;  1FEA A;  4U2T A;  1YQZ A;  4GF7 A;  4TM1 A;  3UTF A;  4EQR A;  2YR4 A;  2GV8 A;  4OPG A;  1E6E A;  3CMM A;  1PJ5 A;  4IA5 A;  3SZF A;  2ARD A;  4IVM B;  3IHG A;  4CNJ A;  3SZ0 A;  2XLT A;  1XHC A;  3IC9 A;  3RP8 A;  3DK9 A;  3IWA A;  1H84 A;  5EB5 A;  1D7Y A;  5FS7 A;  2EQ7 A;  1X31 B;  4JNQ A;  2APG A;  3B3R A;  2B9Y A;  3P1W A;  3CGD A;  1CJ3 A;  1QJD A;  3T14 A;  2WBA A;  3NHO X;  4Y4M A;  2Y6R A;  1Q9I A;  2C4C A;  1S2Q A;  4C74 A;  3L1R A;  1YKJ A;  3FMW A;  4BV6 A;  3IHM A;  3GDP A;  4Z24 A;  3KPF A;  3NIX A;  3T2K A;  5HXI A;  4CRT A;  3CPH G;  2WP6 A;  2DKH A;  2AR8 A;  1F8W A;  2GR1 A;  4K2X A;  3WE0 A;  1LJ1 A;  3QVR A;  4OVI A;  3V3N A;  4G74 A;  4PAB A;  4PAA A;  4B68 A;  3QVP A;  4GDP A;  4CNK A;  1LPF A;  4UDR A;  3D8X A;  5KMP A;  4FK1 C;  4JY3 A;  1BKW A;  1L9E A;  4ZCD A;  4H4Z A;  1DJQ A;  1F6M A;  4IVO B;  2FJA A;  3D1C A;  1MOK A;  1H7X A;  4KPR A;  2XLS A;  3SM8 A;  4EMW A;  4YSX A;  5BUK A;  1XDI A;  4WX1 A;  2GQW A;  2H88 A;  1PBF A;  1NHS A;  3G5R A;  3GDN A;  3M13 A;  1KSU A;  5FMH A;  2WU5 A;  1VG9 A;  1GRH A;  3UKF A;  1PS9 A;  4A65 A;  3UKA A;  3IF9 A;  2TMD A;  3URH A;  1CC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...