5JCIA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
432
structure length
432
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFYSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVANIEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
molecule keywords Os09g0567300 protein
total genus 141
structure length 432
sequence length 432
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jciA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jciA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jciA02
4OPCA 2XVJA 1IUVA 2C3DA 2AQJA 1L9EA 1L9DA 1D5TA 3NK1X 4CY8A 5BUKA 2NVKX 2NPXA 4RG4A 2FJBA 1H7XA 1PS9A 2IIDA 4NTEA 2GR2A 2XLUA 1REOA 5CQFA 3GD4A 1N1PA 3AEAA 3BNMA 1BKWA 2YLWA 2BS2A 1KDGA 3DJGX 1O5WA 1LVLA 1TDKA 2XFOA 2YAUA 4Z26A 4EM4A 2R0PA 4I58A 2XFPA 2BC0A 3UKKA 3RNMA 2R4EA 4USQA 2XYOA 3K30A 2CFYA 2C67A 1E1LA 1IUXA 4EIQA 1GT8A 1H84A 1E7PA 1X31B 1B5QA 5U25A 2GR1A 4IV9A 1ZK7A 1Z6LA 4JNQA 1KSUA 4O5UA 1FEBA 4H4PA 4EIPA 3P9UA 1BGNA 1F8RA 3DA1A 3UTFA 1H86A 2XCGA 2YR5A 3AYIA 2B9XA 2XFNA 5FMHA 5IQ4A 1CJCA 5GRTA 3K7TA 4BJZA 4EMJA 1NG4A 3P4RA 4D03A 2QA2A 1O94A 2H89A 4USRA 1CC4A 4OCGA 3AXBA 3UP4A 1H81A 2A87A 1MOKA 4Y4MA 4DSGA 2B7RA 3HZLA 2OALA 3C4AA 4H2RA 1ZKQA 1XANA 4J56A 2YLSA 4JY3A 4H4YA 4A99A 1ZMDA 1PXCA 3FMWA 2TMDA 1DOEA 1TDOA 5M0ZA 1JOAA 2WBAA 4B66A 3CNJA 3G5QA 3ICSA 3DJEA 4OPUA 1GRTA 4H7UA 2FJEA 1CBOA 1H82A 2JK6A 4U8LA 4U2LA 4UP3A 2WDVA 4UDPA 2XVIA 5TR3A 4C5OA 1D4DA 1PJ6A 3LOVA 3P4QA 1E39A 3KVEA 3AB1A 3H8LA 3UOYA 2ZZ0A 1JRXA 3RP8A 2J3NA 4H4WA 3CPHG 4TM3A 4FDCB 2GAGB 1N4UA 2WOWA 3EAOA 4C74A 2V3AA 4A5LA 1NDAA 3LZXA 4N9XA 3QFAA 2XVEA 1D4CA 1GRBA 1ZX9A 2GMHA 3CPJG 2Y6RA 2C75A 2VRLA 1D4EA 2EQ6A 1H83A 3OZ2A 3ALJA 4GRTA 3KD9A 2WPEA 4BJYA 1PBDA 3PVCA 5KVHA 2VQ7A 3DH9A 2GRTA 3FG2P 1SEZA 1F3PA 2B9WA 4C77A 2YLXA 2X50A 4YKFA 1NENA 3IF9A 2JKCA 1NHSA 3PO7A 1PJ5A 2YM2A 3KA7A 4BK3A 4IVMB 4CRTA 2GQWA 3AEFA 1TDFA 2Z5XA 3DK9A 4IA6A 3UOXA 3BHFA 3QVRA 3K7QX 2XVHA 2FBWA 2UZZA 2XLSA 2E4GA 2WU5A 1N4WA 3CGBA 1LPFA 4U2SA 1BGJA 1B8SA 1TYTA 5EOWA 4AP1A 4EM3A 4ECHA 2YLZA 5C3JA 4NTDA 4OPGA 3CIRA 4GUVA 4AT0A 4ZCDA 4U8NA 2DKIA 3NYEA 3CNDA 4TM4A 3UCLA 4U8OA 1OJTA 4K5SA 2W0HA 4YXDA 5IPYA 4A6NA 1COYA 1YY5A 3NT6A 1GERA 4EMWA 2A89A 2V3BA 2H88A 3P4PA 4YSHA 4EQXA 5HXIA 1CC2A 4B1BA 2GF3A 5KRQA 3AE6A 2R9ZA 3DK4A 1QLBA 4ICYA 5IQ1A 1GEUA 1JRZA 3G5RA 4UDQA 4PABA 4Z2RA 4X9NA 5GSNA 2BC1A 3UOVA 4B67A 2R0CA 2C3CA 4U2TA 3NYFA 1IUWA 4B69A 2XFQA 3UKFA 1KNRA 1GRAA 2WOIA 2C66A 2C7GA 3ABVA 2V61A 4HB9A 3UP5A 2YM1A 1KSSA 3UTEA 1GALA 3SFEA 1ELIA 4YT0A 1KFYA 5C2TA 3JSKA 4B63A 3T37A 2DKHA 3ICRA 1NHRA 2BCPA 3IHMA 1S3EA 3Q6JA 2BS3A 5FS8A 3KU9A 2QAEA 4XWRA 4Z44A 2BK4A 1GPEA 3GMCA 1RYIA 2RGOA 1YKJA 1LQUA 2BCGG 2IVEA 3NN6X 4DGKA 4A9WA 3BHKA 5U1OA 5EBKA 1NEKA 4H4ZA 1Y56A 4UDRA 2JAEA 3OC4A 1DODA 1MO9A 5JCNA 2APGA 4AOSA 4K8DA 1E1NA 1FCDA 4YWOA 2BA9A 2R46A 4A65A 4H4TA 3KPFA 3PS9A 4J33A 2WEUA 2C76A 3AE9A 2WU2A 1GESA 3DJJA 2GAHB 1MXTA 4J57A 3NK0X 2V6OA 3S61A 3LJPA 3AD8B 2ACZA 4KPRA 1ZOYA 3L8KA 1IJHA 1LTXR 5BRTA 1D7LA 5EB5A 2PYXA 3O0HA 2JBVA 2WP5A 4DNAA 4Z2UA 3F8RA 3RHAA 4I59A 3COXA 2WESA 3GRSA 1PBEA 5JCIA 3LXDA 1JRYA 1NG3A 4TM0A 1PDHA 1NHPA 4D04A 3H8IA 3DGHA 1CJ3A 3P4SA 2BACA 3UOZA 1BF3A 2YR4A 2GEWA 3CPIG 4YSYA 1OJAA 3NNEA 2FJDA 4H4SA 3VRDB 1ZP0A 4C3XA 1FEAA 1CC6A 2BS4A 3BI2A 1JEHA 1DJNA 4JQ9A 3NYCA 4TLXA 3NN0X 5J7XA 3CN8A 4U8PA 1EBDA 1GRHA 4EQWA 3GRTA 2C70A 4K22A 4K7ZA 3DGZA 5L46A 5HY5A 3B6DA 1GXFA 5FS7A 2BABA 2YG3A 2CDUA 1P2HA 3CNPA 1K4QA 3NGCX 4X4JA 3BI5A 2YG6A 3ICTA 3H4KA 1NPXA 1JNRA 2GV8A 1M64A 2QCUA 3AE3A 2VVMA 3UTHA 5FS6A 2C64A 3S5WA 3FBSA 1HYUA 1D7YA 1YQZA 4MJWA 3ZYXA 1H7WA 4B68A 4XWZA 3LB8A 4Z43A 2OLOA 2GMJA 1OJDA 1E1MA 3IC9A 4H4QA 3M13A 1NHQA 4J34A 5JCKA 4TLZA 1LQTA 2OAMA 4U8MA 2CVJA 2WP6A 2A8XA 3C4NA 3V76A 4A7AA 3WE0A 1ZY8A 5JCMA 4YTNA 3GD3A 2XDOA 3NTDA 4OPDA 1XHCA 4U8JA 2B7SA 2OA1A 1TYPA 2C73A 2YLRA 4H4UA 4EQSA 4Y4LA 2GH5A 2RABA 2GVCA 1QO8A 4CCQA 1F8SA 1RP0A 4YTMA 2Q7VA 4K5RA 1L9CA 3K7MX 4APNA 3AYLA 3VQRA 3BI4A 4Z25A 1KF6A 3ATQA 3AE5A 1ZDLA 3L1RA 3SFDA 3GMBA 3VR9A 2BXRA 3CTYA 4Z2TA 1VG0A 2X8CA 2YVJA 1IUSA 4DSHA 2WP9A 4CNKA 4GCMA 1E1KA 1M6IA 4REKA 3GYJA 3V3NA 1OJCA 4OPIA 4NEVA 1GETA 1VG9A 2R4JA 1TRBA 1YQ4A 3DMEA 3EF6A 3D1CA 2FJAA 2PHHA 5KOWA 1L0VA 4ZN0A 4E0VA 4CNJA 3AD9B 3AE8A 1K0JA 2WQYA 2YWLA 3E1TA 3F8PA 5ER0A 3I6DA 5CKUA 2RGJA 1S2YA 1XPQA 5HYMA 3QJ4A 1VDCA 4WCTA 1KNPA 3II4A 5J60A 1P2EA 3QSSA 1DXLA 2B76A 1NAAA 1O95A 4GF7A 4GR1A 3QVPA 1Q9IA 3UKHA 4CY6A 2ZZCA 1B37A 2BXSA 3NRNA 1PJ7A 4XXGA 2GB0A 2XLTA 1FOHA 2GR0A 1CF3A 3GDPA 1F8WA 3QFBA 3ADAB 2AAQA 1RSGA 3LADA 3AEDA 4NTCA 4JNAA 4JDRA 1QJDA 2WETA 3UKQA 2XLPA 4J31A 3M12A 4H2QA 1Y56B 5BULA 4BURA 3URHA 4NEWA 3NG7X 1VQWA 2Q0LA 3UKAA 4AT2A 3NLCA 3DK8A 4HA6A 3ALLA 2Y6QA 3P1WA 1FECA 1Q1RA 1Y0PA 2VVLG 2EQ7A 5JCLA 3IWAA 2X8GA 3AEGA 2X99A 1K0LA 2WPFA 3DJDA 1E6EA 4RSLA 3NTAA 2ZBWA 1Q1WA 1IUUA 3GDNA 4BK2A 3EANA 1GNDA 2WPCA 4J2WA 2XFUA 3CGCA 3VRAA 4O5QA 1GV4A 2VZ2A 4FK1A 5DBJA 3VR8A 5LV9A 2WDRA 4LA1A 3KLJA 3REDA 2HQMA 4H2NA 1GSNA 1GOSA 1CL0A 1JNZA 4LIIA 1DOCA 4P9SA 4AOXA 2C65A 2WS3A 3AECA 2E1MA 3BNUA 3FPZA 1VRQB 4M52A 2O9ZA 3R9UA 3NH3X 4X9MA 2V5ZA 4RG3A 4FX9A 4H50A 2R0GA 1ONFA 4YSZA 4OVIA 3NHOX 4JY2A 4A6NB 2Q6UA 1BWCA 4PAAA 4NZHA 1DJQA 3AEBA 4U8KA 2TPRA 4IVOB 3AYJA 2GQFA 3AEEA 4U8IA 3NKSA 4H4VA 3ATRA 1W4XA 2F5ZA 2YG7A 4ZCCA 3VRBA 5KOXA 2RGHA 4B64A 4H4XA 1F6MA 1PXAA 3SM8A 2X3NA 3IHGA 1EL9A 1GREA 4Z24A 3AWIA 1ZOVA 4OPLA 3G5SA 2WOVA 1GRFA 4CCRA 4H2PA 2ARDA 2BK3A 4Y4NA 5HHFA 2ZZBA 1EL8A 2JB1A 1UKVG 3NIXA 1PBCA 1S3BA 4GDPA 1S2QA 1CJ4A 3CGEA 2B9YA 3I3LA 2EQ8A 3Q9TA 2JB3A 4JN9A 4B65A 2QA1A 4AP3A 3GYIA 2VOUA 3CNTA 4YSXA 4H4RA 2AR8A 4IA5A 1GTHA 2WDQA 3CGDA 1DOBA 4GDEA 1PHHA 1JU2A 1TDNA 1EL5A 3FIMB 3LZWA 1FL2A 3EPTA 3V3OA 2BYBA 3M0OA 1H6VA 4K2XA 2YG5A 2I0ZA 1CHUA 3D8XA 1TDEA 2OLNA 3F8DA 3RP7A 5KXJA 2IVDA 2JB2A 3NK2X 2C72A 3RP6A 5EB4A 2YVGA 2VRMA 4J36A 4LU6A 1K0IA 1GRGA 3C96A 4KX6A 4TM1A 4C3YA 2WHDA 4CBQA 2VVLA 1B4VA 1LV0A 3UTGA 1ZMCA 4ADWA 2XLRA 1N4VA 4EMIA 3SQPA 3GSIA 3UKLA 4YTPA 5KVIA 2YLTA 3ISHA 4YKGA 2GR3A 2YG4A 1DNCA 4WX1A 4EQRA 4BV6A 5KWFA 3AE2A 2YVFA 1V59A 5FS9A 2BK5A 3AD7B 1XDIA 2R45A 2YQUA 3KKJA 4BK1A 1BZLA 2YR6A 2EQ9A 1IUTA 4OPTA 3GWDA 3AE7A 1PXBA 3B3RA 2Q0KA 3AE4A 1PBBA 3GWFA 1CJ2A 3CNSA 2Z5YA 5U63A 2VQBA 5M10A 3AE1A 1EL7A 2XVFA 3ZDNA 2X8HA 4A79A 3UKPA 3ITJA 5BVAA 1PBFA 3QSEA 2V60A 3SGLA 2CULA 1YQ3A 3ALMA 1OJ9A 1LJ1A 1PN0A 2E5VA 3QSMA 1AOGA 4FK1C 1GTEA
chains in the Genus database with same CATH superfamily
2AQJA 4KT2A 1L9EA 5G5HB 3T2KA 3AEAA 1SJDA 4JN7A 3T14A 1WYGA 2FYMA 2PCEA 1LVLA 2XFOA 4EM4A 1P43A 2BC0A 3UKKA 2XYOA 2C67A 1E1LA 4EIQA 1H84A 1JPDX 1E7PA 4IV9A 1ZK7A 4O5UA 1BGNA 3UTFA 3SYIA 1H86A 2XCGA 5IQ4A 1CJCA 4EMJA 1NG4A 3MUCA 4USRA 2W3SA 3TWAA 3AXBA 3UP4A 4J1OA 1MOKA 4Y4MA 3VFCA 4H2RA 4JY3A 4J56A 4H4YA 3NVWB 4A99A 1PXCA 2QDEA 3G5QA 4UP3A 1N60C 1D4DA 3I6EA 3AB1A 3UOYA 2ZZ0A 4FDCB 2WOWA 3EAOA 4H1ZA 2XSXA 2V3AA 2Y6RA 2VRLA 2EQ6A 4K8GA 2OZTA 1PBDA 3PVCA 1SEZA 4DWDA 2B9WA 4HCDA 1RVKA 3IF9A 1TZZA 3N4FA 2GQWA 1KD0A 3DK9A 3QVRA 3K7QX 2W54A 2FBWA 3NVVB 2UZZA 2E4GA 2WU5A 3T0KA 3CGBA 2QJJA 5EOWA 4ZCDA 4U8NA 1OJTA 4YXDA 2W0HA 3B9JB 2V3BA 3SY4A 3RRAA 3P4PA 4YWSA 2XGZA 3DEQA 2GGIA 3BJSA 4ICYA 3STPA 5IQ1A 2AKMA 3G5RA 4GAPA 3SXIA 2R0CA 2C3CA 3UKFA 2XH0A 4HB9A 1SJBA 4GMEA 3UTEA 3R10A 2QDDA 3T37A 1NHRA 3T4WA 4Z44A 3KU9A 2BK4A 1RYIA 1YKJA 1LQUA 4H4ZA 4DYEA 4UDRA 1MO9A 2APGA 2BA9A 3KPFA 4G74A 3H8AA 2WEUA 4J33A 4E5TA 3AE9A 3SN1A 3NK0X 3DFHA 5KMRA 4KPRA 1LTXR 5BRTA 3T2YA 2JBVA 4Z2UA 3Q4DA 4I59A 3AMZA 3QPEA 1JRYA 3H8IA 3DGHA 1CJ3A 4E4FA 3CPIG 3UJ2A 3RGTA 3VRDB 4C3XA 1FEAA 3BI2A 4JQ9A 3R25A 4TLXA 2AKZA 2GGHA 1GRHA 3V3WA 5L46A 3B6DA 2YG3A 3SQSA 3NGCX 2YG6A 3H4KA 2QCUA 1M64A 2VVMA 5FS6A 3FBSA 1N5XA 1HYUA 2QVHA 1D7YA 2OLOA 4IP4A 2AL2A 1N63C 2MUCA 3IC9A 4M0XA 4TLZA 2OAMA 4U8MA 3C4NA 4OPDA 1XHCA 2C73A 4EQSA 4EWJA 3NO1A 1RP0A 2Q7VA 3K7MX 5KMQA 2W3RA 3KUMA 3AE5A 3T31A 1VG0A 2X8CA 1IUSA 2WP9A 3GYJA 1GETA 3ZLGA 7ENLA 3DMEA 3EF6A 3CXOA 3D1CA 2PHHA 5KOWA 1L0VA 3SZCA 3NFUA 5ER0A 5HYMA 3BOXA 5J60A 4GF7A 1O95A 4GR1A 3QVPA 4CY6A 2ZZCA 3NRNA 1PJ7A 3N4EA 4G6HA 3FXGA 3ADAB 3SN0A 2NQLA 4J31A 3PG6A 3NLCA 3DK8A 3VC6A 1TKKA 1Q1RA 3IWAA 2X99A 2WPFA 2PMQA 4BK2A 2WPCA 1GNDA 3CGCA 1GV4A 3KLJA 4H2NA 1CL0A 4LIIA 3BNUA 3A7RA 2ONEA 1MDRA 4GGHA 4RG3A 4H50A 2R0GA 1X2GA 3VDGA 3NHOX 1EC8A 1BWCA 1RM6B 4U8KA 2TPRA 4U8IA 4H4VA 5KOXA 4B64A 2ZADA 5BOEA 4GYPA 4OPLA 4CCRA 2BK3A 4E8GA 2ZZBA 3NXLA 1PBCA 2GGJA 2PGEA 4GIRA 2AR8A 4IA5A 4II2A 3QLDA 4GDEA 1EL5A 3EPTA 1JCTA 3UJSA 3RP7A 3A7UA 5EB4A 4C3YA 2VVLA 1SJCA 1ZMCA 2XLRA 1N4VA 3ISHA 2YG4A 4WX1A 4EQRA 5FS9A 2BK5A 5FJRA 3T8QA 4BK1A 2YR6A 2EQ9A 3AE7A 3AE4A 1PBBA 3CNSA 3ITJA 3HYVA 3QSEA 3RITA 2V60A 3IK4A 3ALMA 3P0WA 3TJIA 2OQHA 2O56A 2BRYA 4JHMA 3SZWA 3P93A 4DGKA 1REOA 1BKWA 5EU9A 1O5WA 3UXLA 2YAUA 3MY9A 4Z26A 1L8PA 4I58A 5FJTA 2XFPA 3R1ZA 2R4EA 4NWZA 2CFYA 3TQPA 1B5QA 1Z6LA 4JNQA 3GD6A 1FEBA 5J04A 4H4PA 4EIPA 1JROA 2YR5A 3AYIA 2XFNA 3K7TA 4BJZA 3N6JA 3P4RA 4G8TA 2QA2A 1CC4A 1H81A 2OG9A 3UXKA 2PPGA 5LV9A 2OALA 3C4AA 3QKEA 1XANA 2TMDA 3EEZA 1TDOA 5M0ZA 2WBAA 4H7UA 4U8LA 2WDVA 4C5OA 1PJ6A 3KVEA 2PP0A 2BRAA 3RP8A 2J3NA 4K1WA 2GAGB 4A5LA 3LZXA 1ELSA 2XVEA 3CPJG 2C75A 4IZGA 4GRTA 4BJYA 5KVHA 2VQ7A 2YLXA 3FV9A 4YKFA 1NENA 1V97A 4BK3A 1OEPA 1TDFA 3UOXA 3BHFA 3U4FA 2XLSA 1LPFA 4U2SA 1BGJA 4AP1A 4EM3A 2OKTA 3SBFA 4OPGA 3UCLA 3CNDA 3JW7A 4U8OA 3GY1A 1COYA 1YY5A 4EMWA 2A89A 3TW9A 3VA8A 1CC2A 5KRQA 3DK4A 1QLBA 4JN8A 4PABA 3MQTA 4B67A 3R0KA 3NYFA 1IUWA 2XFQA 3UP5A 1KSSA 4YT0A 1KFYA 3JSKA 2DKHA 3ICRA 1S3EA 3Q6JA 2BS3A 5FS8A 3T2ZA 3TWBA 2IVEA 3UJEA 4A9WA 3BHKA 4ZOHB 5EBKA 1NEKA 2JAEA 5JCNA 3PK7A 4K8DA 1E1NA 1FCDA 4ZA0A 2WU2A 3DJJA 2GAHB 3AD8B 3L8KA 1IJHA 1SJAA 2OZ3A 5EB5A 2PP1A 3COXA 2WESA 2CHRA 1NG3A 3OTRA 4NNJA 3P4SA 2BACA 1BF3A 2YR4A 2GEWA 4YSYA 1OJAA 3NNEA 4G9KA 2BS4A 2C4CA 1EBDA 4ENLA 5HY5A 2CDUA 1K4QA 3GYXA 3BI5A 3SN4A 3NVZB 4A6GA 3UTHA 3S5WA 1N61C 3LB8A 4Z43A 2GMJA 1E1MA 3M13A 5JCKA 2CVJA 3SR6B 3L5OA 3GD3A 4U8JA 2OA1A 2YLRA 3OP2A 3FJ4A 4YTMA 4K5RA 4Z25A 3AYLA 3BI4A 3ATQA 1ZDLA 3MSYA 3VR9A 4FP1A 4X2PA 4DSHA 4CNKA 4GCMA 2GSHA 2PU1A 1KKRA 2R4JA 3EKGA 3UCDA 4H83A 4ZN0A 3FCPA 4CNJA 3AD9B 2OZ8A 1K0JA 3AE8A 2YWLA 5ENLA 3E1TA 3F8PA 1XPQA 2OQYA 1EC9A 1P2EA 4XXGA 2XLTA 2GR0A 3R07C 1RSGA 3LADA 3AEDA 3R0UA 1QJDA 2WETA 3UKQA 3M12A 4BURA 4NEWA 1PDYA 1VQWA 4AT2A 3ALLA 2Y6QA 3SZ0A 3NTAA 1Q1WA 1IUUA 3GDNA 4J2WA 2XFUA 3VRAA 4ZCWA 4O5QA 3VC5A 2VZ2A 4FK1A 5DBJA 4HNCA 4LA1A 3REDA 2E5AA 1GSNA 3CAWA 1GOSA 2PTYA 1DOCA 1FHUA 4AOXA 2C65A 3AECA 2E1MA 3ZVHB 1VRQB 1F9CA 2O9ZA 2P88A 1ONFA 2RDXA 4A6NB 3ENLA 4GFIA 4Z1YA 3AEEA 3ATRA 3AWIA 3G5SA 2WOVA 1GRFA 4H2PA 2ARDA 1KN0A 1S2QA 3CGEA 2JB3A 4H19A 3CNTA 1GTHA 3CGDA 1JU2A 3NZGA 3LZWA 1H6VA 4K2XA 3D8XA 2JB2A 2C72A 4LU6A 4KX6A 2P8CA 3UTGA 2I5QA 1EBHA 4EMIA 3SQPA 3UKLA 4YTPA 4DN1A 1PDZA 4YKGA 1DNCA 3AD7B 1XDIA 3QTPA 3GWDA 3DFYA 1PXBA 3P3BA 2Z5YA 5M10A 1EL7A 2XVFA 3AN1A 3SSZA 2CULA 3MKCA 2PGWA 1YQ3A 6ENLA 1LJ1A 1PN0A 3B97A 4OPCA 2XVJA 1IUVA 3K1GA 3NK1X 4CY8A 5BUKA 2NVKX 4RG4A 1H7XA 4NTEA 2IIDA 2XLUA 1N1PA 3BNMA 2YLWA 3SJNA 2FKPA 1KDGA 3RNMA 2GR1A 3KPKA 3CYJA 1KSUA 1JRPA 1F8RA 1T3QC 3DA1A 3T6CA 5GRTA 4D03A 5FJUA 1O94A 3EUB3 4OCGA 3OPSA 3MZNA 3HYWA 4DSGA 3HZLA 1DOEA 4G6GA 1JOAA 3CNJA 3ICSA 4TVWA 1H82A 4U2LA 5KMSA 2PTXA 3LOVA 3P4QA 1E39A 3H12A 1IYXA 1JRXA 4H4WA 3CPHG 4C74A 4N9XA 1ONEA 1D4CA 1GRBA 1ZX9A 2GMHA 2OPJA 4E4UA 1D4EA 1H83A 3KD9A 2GRTA 4C77A 2X50A 1NHSA 1PJ5A 2YM2A 3KA7A 1EBGA 4IVMB 4CRTA 3AEFA 2PS2A 3H70A 2P0IA 2Z5XA 1JDFA 1JPMA 3I6TA 5KMPA 3DERA 1N4WA 1N5WC 3THUA 2E3TA 4NTDA 2AL2B 3CIRA 4GUVA 4AT0A 2DKIA 4K5SA 4A6NA 3DESA 1GERA 2H88A 2OO6A 2OLAA 4EQXA 4B1BA 3IJQA 3AE6A 2QJNA 1GEUA 4UDQA 3OZYA 3TTEA 5GSNA 1BKHA 1KNRA 2C66A 2WOIA 3V4BA 1YEYA 3ABVA 2V61A 2YM1A 1GALA 4HYRA 1TE6A 5C2TA 4B63A 2BCPA 3IHMA 4XWRA 2QAEA 3GMCA 2RGOA 2PTWA 4A3RA 3NN6X 3HRDC 3ETRB 3ZVIA 5U1OA 1Y56A 5KNLA 3OC4A 1DODA 4AOSA 4YWOA 2P3ZA 4A65A 2PODA 3PS9A 2C76A 3DG6A 4HPNA 3FVDA 1GESA 3S61A 3LJPA 2ACZA 2DW7A 1D7LA 2PYXA 3O0HA 3ES7A 4F4RA 3ZLFA 1PBEA 3LXDA 4TM0A 4D04A 2FJDA 4HN8A 1JEHA 1MRAA 3NN0X 5J7XA 3CN8A 4U8PA 2AL1A 2C70A 4K22A 4K7ZA 1GXFA 2BABA 4X4JA 1NPXA 1JNRA 2GV8A 2OFJA 3TCSA 5IDZA 4IT1A 5FJPA 1YQZA 4MJWA 1H7WA 2GGEA 4B68A 3JZUA 4DX3A 1OJDA 2HNEA 4J34A 2WP6A 2A8XA 3V76A 4A7AA 1ZY8A 5JCMA 2XDOA 2B7SA 3VCNA 4H4UA 1ZXIC 2GH5A 1L9CA 3SFDA 3GMBA 3CTYA 4IHCA 1M6IA 4REKA 3V3NA 4OPIA 1TRBA 3RCYA 1NELA 2WQYA 3I6DA 5CKUA 1S2YA 3QJ4A 1VDCA 1KNPA 3II4A 3CMMA 1NAAA 1P48A 3A7AA 4MGGA 2GB0A 3GDPA 4NTCA 4JDRA 2XLPA 3NG7X 2PP3A 4HA6A 2VVLG 2EQ7A 5JCLA 4RSLA 2X8GA 1K0LA 1E6EA 3IJLA 4IL0A 4GGBA 2PA6A 1XPYA 1JNZA 5FJOA 4M52A 3NH3X 4X9MA 2V5ZA 4FX9A 4YSZA 4HCLA 4JY2A 2Q6UA 1FFUC 4PAAA 1DJQA 3AEBA 3AYJA 3SX6A 2GQFA 1W4XA 2F5ZA 2YG7A 4ZCCA 3VRBA 2RGHA 4H4XA 1F6MA 3SM8A 2X3NA 3IHGA 3N6HA 1GREA 4Z24A 4HNLA 4Y4NA 5HHFA 2JB1A 1UKVG 4GDPA 3I3LA 2EQ8A 4JN9A 2QA1A 3GYIA 2VOUA 4Z17A 4H4RA 1NU5A 3PWIA 3FIMB 1MDLA 3V3OA 2BYBA 4ROPA 2DW6A 2I0ZA 4MKSA 1TDEA 2OLNA 3F8DA 5KXJA 3MWCA 3NK2X 3RP6A 2VRMA 3UJRA 1K0IA 3C96A 2WHDA 1FO4A 1B4VA 1SB3B 5KVIA 2GR3A 5KWFA 3AE2A 2YVFA 2PU0A 3H7VA 2R45A 3FYYA 2YQUA 3KKJA 3GC2A 1BZLA 1IUTA 4OPTA 3B3RA 2VQBA 3OW1A 3ZDNA 4DHGA 3UKPA 5BVAA 3SGLA 3V5CA 1OJ9A 2E5VA 1R6WA 4FK1C 3ES8A 2C3DA 1L9DA 3D9XA 1D5TA 2NPXA 2FJBA 1PS9A 3GO2A 2GR2A 3T9PA 5CQFA 3GD4A 2QGYA 1KKOA 2BS2A 1VDVA 3DJGX 1TDKA 3R11A 3DG3A 1DTNA 2R0PA 3NRZB 4USQA 3K30A 1IUXA 1GT8A 1MNSA 3QN3A 1X31B 5U25A 3P9UA 4E6MA 2B9XA 5FMHA 2MNRA 2H89A 2A87A 2B7RA 1ZKQA 2YLSA 1ZMDA 3FMWA 1W6TA 3V5FA 4B66A 1N62C 4OPUA 3DJEA 1GRTA 2FJEA 1CBOA 4KPLA 2JK6A 4UDPA 2XVIA 5TR3A 3HPFA 3ZLHA 3H8LA 3UCCA 4TM3A 1N4UA 1NDAA 2PTZA 3QFAA 3DG7A 2GDQA 3RO6A 3OZ2A 3ALJA 2WPEA 3DH9A 3FG2P 1F3PA 2XH2A 2JKCA 3PO7A 3CK5A 1WUEA 1FFVC 1ECQA 3OZMA 4IA6A 2XVHA 4FI4A 3CT2A 1B8SA 1TYTA 4ECHA 2HXUA 2YLZA 5C3JA 1BQGA 1FIQB 3NYEA 4TM4A 5G5GB 5IPYA 3NT6A 3S47A 4YSHA 5HXIA 2GF3A 2R9ZA 1JRZA 4Z2RA 4X9NA 2BC1A 2GGGA 3UOVA 1H2IA 4U2TA 4TVYA 4B69A 1GRAA 2C7GA 2PSNA 2GL5A 3SFEA 4MMWA 1ELIA 1GPEA 2BCGG 3DGBA 5JRBA 3VCCA 4II3A 4G73A 2QQ6A 2R46A 4H4TA 2QJMA 1MXTA 4J57A 1FHVA 2V6OA 1ZOYA 1S7MA 2WP5A 4DNAA 3SZFA 3Q45A 5BOFA 3F8RA 3RHAA 3GRSA 5JCIA 1PDHA 1NHPA 3UOZA 3TJ4A 4H4SA 1ZP0A 3D46A 1CC6A 1DJNA 3NYCA 3ZVHA 4EQWA 3GRTA 3DGZA 5FS7A 1P2HA 3CNPA 2OVLA 3ICTA 3AE3A 3U9IA 4GYPC 2C64A 1R0MA 3ZYXA 4XWZA 4H4QA 1NHQA 2POZA 1LQTA 4YTNA 3WE0A 3NTDA 1EC7A 1TYPA 2HZGA 3CXBA 4Y4LA 2RABA 2GVCA 4H2HA 1QO8A 4CCQA 1F8SA 4APNA 3VQRA 1KF6A 3L1RA 3PWGA 1KCZA 2BXRA 4Z2TA 2YVJA 1E9IA 4HCHA 3S5SA 1E1KA 1OJCA 4NEVA 1VG9A 3HYXA 1YQ4A 3RR1A 3CB3A 2FJAA 4KEMA 4E0VA 2RGJA 4WCTA 2XH7A 3QSSA 1DXLA 2B76A 3UKHA 2XH4A 1Q9IA 4DXKA 1B37A 2BXSA 4GISA 1FOHA 1CF3A 1F8WA 3QFBA 2AAQA 4JNAA 4H2QA 1Y56B 5BULA 4IL2A 3URHA 3UJFA 1STZA 2Q0LA 3UKAA 3AM9A 3BSMA 3P1WA 1FECA 1Y0PA 3AEGA 3DJDA 3TOYA 2ZBWA 4KWSA 3EANA 3VR8A 2WDRA 2HQMA 4P9SA 2WS3A 3FPZA 3R9UA 4OVIA 3DIPA 4NZHA 3HW2A 4GAVA 2HXTA 4IVOB 1WUFA 3NKSA 3UGVA 1PXAA 1EL9A 1ZOVA 2ZC8A 1EL8A 3NIXA 1S3BA 1CJ4A 2OX4A 2B9YA 4B65A 3Q9TA 3NVYB 4AP3A 4YSXA 2WDQA 1DOBA 1PHHA 4G7FA 1XS2A 1TDNA 4J3ZA 1FL2A 3M0OA 2YG5A 3NS1B 1CHUA 2P8BA 2IVDA 1X2HA 3D47A 2YVGA 4J36A 1GRGA 4TM1A 4K2SA 4CBQA 4A35A 1LV0A 4ADWA 3GSIA 2W55A 2YLTA 4IP5A 3PFRA 4BV6A 1V59A 3JVAA 3IJIA 2Q0KA 4M6UA 3GWFA 1CJ2A 1VQZA 5U63A 3AE1A 2X8HA 3I4KA 4A79A 1MUCA 1PBFA 3DDMA 3QSMA 1AOGA 1GTEA
chains in the Genus database with same CATH topology
4OPCA 2XVJA 1IUVA 2C3DA 2AQJA 1L9EA 1L9DA 3D9XA 1D5TA 2BRYA 3NK1X 3T2KA 4CY8A 5BUKA 2NVKX 2NPXA 4RG4A 3SZWA 2FJBA 1H7XA 1PS9A 2IIDA 4NTEA 2GR2A 2XLUA 1REOA 5CQFA 3GD4A 1N1PA 3AEAA 3BNMA 1BKWA 3T14A 2YLWA 2BS2A 1KDGA 3DJGX 1O5WA 1LVLA 1TDKA 2XFOA 2YAUA 4Z26A 4EM4A 2R0PA 4I58A 2XFPA 2BC0A 3UKKA 3RNMA 2R4EA 4USQA 2XYOA 3K30A 4NWZA 2CFYA 2C67A 1E1LA 1IUXA 4EIQA 1GT8A 1H84A 1E7PA 1X31B 1B5QA 5U25A 2GR1A 3KPKA 1ZK7A 4IV9A 1Z6LA 4JNQA 1KSUA 4O5UA 1FEBA 4H4PA 4EIPA 3P9UA 1BGNA 1F8RA 3DA1A 3UTFA 3SYIA 1H86A 2XCGA 2YR5A 3AYIA 2B9XA 2XFNA 5FMHA 5IQ4A 1CJCA 5GRTA 3K7TA 4BJZA 4EMJA 1NG4A 3P4RA 4D03A 2QA2A 1O94A 2H89A 4USRA 1CC4A 4OCGA 3AXBA 3UP4A 1H81A 2A87A 1MOKA 3HYWA 4Y4MA 4DSGA 2B7RA 3HZLA 2OALA 3C4AA 4H2RA 1ZKQA 1XANA 4J56A 2YLSA 4JY3A 4H4YA 4A99A 1ZMDA 1PXCA 3FMWA 2TMDA 1DOEA 1TDOA 4G6GA 5M0ZA 1JOAA 2WBAA 4B66A 3CNJA 3G5QA 3ICSA 3DJEA 4OPUA 1GRTA 4H7UA 2FJEA 1CBOA 1H82A 2JK6A 4U8LA 4U2LA 4UP3A 2WDVA 4UDPA 5KMSA 2XVIA 5TR3A 4C5OA 1D4DA 1PJ6A 3LOVA 3P4QA 1E39A 3KVEA 3AB1A 3H8LA 3UOYA 2ZZ0A 1JRXA 2BRAA 3RP8A 2J3NA 4H4WA 3CPHG 4TM3A 4FDCB 2GAGB 1N4UA 2WOWA 3EAOA 4C74A 2V3AA 4A5LA 1NDAA 3LZXA 4N9XA 3QFAA 2XVEA 1D4CA 1GRBA 1ZX9A 2GMHA 3CPJG 2Y6RA 2C75A 2VRLA 1D4EA 2EQ6A 1H83A 3OZ2A 3ALJA 4GRTA 3KD9A 2WPEA 4BJYA 1PBDA 3PVCA 5KVHA 2VQ7A 3DH9A 2GRTA 3FG2P 1SEZA 1F3PA 2B9WA 4C77A 2YLXA 2X50A 4YKFA 1NENA 3IF9A 2JKCA 1NHSA 3PO7A 1PJ5A 2YM2A 3KA7A 4BK3A 4IVMB 4CRTA 2GQWA 3AEFA 1TDFA 2Z5XA 3DK9A 4IA6A 3UOXA 3BHFA 3QVRA 3K7QX 2XVHA 2FBWA 5KMPA 2UZZA 2XLSA 2E4GA 2WU5A 3T0KA 1N4WA 3CGBA 1LPFA 4U2SA 1BGJA 1B8SA 1TYTA 5EOWA 4AP1A 4EM3A 4ECHA 2YLZA 5C3JA 4NTDA 4OPGA 3CIRA 4GUVA 4AT0A 4ZCDA 4U8NA 2DKIA 3NYEA 3CNDA 4TM4A 3UCLA 4U8OA 1OJTA 4K5SA 2W0HA 4YXDA 5IPYA 4A6NA 1COYA 1YY5A 3NT6A 1GERA 4EMWA 2A89A 2V3BA 2H88A 3SY4A 3P4PA 4YSHA 4EQXA 5HXIA 1CC2A 4B1BA 2GF3A 5KRQA 3AE6A 2R9ZA 3DK4A 1QLBA 4ICYA 5IQ1A 1GEUA 1JRZA 3G5RA 4UDQA 4GAPA 3SXIA 4PABA 4Z2RA 4X9NA 5GSNA 2BC1A 3UOVA 4B67A 2R0CA 2C3CA 1H2IA 4U2TA 3NYFA 1IUWA 4B69A 2XFQA 3UKFA 1KNRA 1GRAA 2WOIA 2C66A 2C7GA 3ABVA 2V61A 4HB9A 3UP5A 2YM1A 1KSSA 3UTEA 1GALA 3SFEA 1ELIA 4YT0A 1KFYA 5C2TA 3JSKA 4B63A 3T37A 2DKHA 3ICRA 1NHRA 2BCPA 3IHMA 1S3EA 3Q6JA 2BS3A 5FS8A 3KU9A 2QAEA 4XWRA 4Z44A 2BK4A 1GPEA 3GMCA 1RYIA 2RGOA 1YKJA 1LQUA 2BCGG 5JRBA 2IVEA 3NN6X 4DGKA 4A9WA 3BHKA 5U1OA 5EBKA 1NEKA 4H4ZA 1Y56A 4II3A 4UDRA 2JAEA 3OC4A 5KNLA 1DODA 1MO9A 5JCNA 2APGA 4AOSA 4G73A 4K8DA 1E1NA 1FCDA 4YWOA 2BA9A 2R46A 4A65A 4H4TA 3KPFA 3PS9A 4G74A 2WEUA 4J33A 2C76A 3AE9A 2WU2A 1GESA 3DJJA 2GAHB 1MXTA 4J57A 3NK0X 2V6OA 3S61A 5KMRA 3LJPA 3AD8B 2ACZA 4KPRA 1ZOYA 3L8KA 1LTXR 1IJHA 5BRTA 1D7LA 5EB5A 1S7MA 2PYXA 3T2YA 3O0HA 2JBVA 2WP5A 4DNAA 3SZFA 4Z2UA 3F8RA 3RHAA 4I59A 3COXA 2WESA 3GRSA 1PBEA 5JCIA 3LXDA 1JRYA 1NG3A 4TM0A 1PDHA 1NHPA 4NNJA 3H8IA 3DGHA 1CJ3A 3P4SA 2BACA 3UOZA 4D04A 1BF3A 2YR4A 2GEWA 3CPIG 4YSYA 1OJAA 3NNEA 2FJDA 4H4SA 4G9KA 3VRDB 1ZP0A 4C3XA 1FEAA 1CC6A 2BS4A 3BI2A 1JEHA 1DJNA 4JQ9A 3NYCA 4TLXA 3NN0X 5J7XA 2C4CA 3CN8A 1EBDA 1GRHA 4U8PA 4EQWA 3GRTA 2C70A 4K22A 4K7ZA 3DGZA 5L46A 5HY5A 3B6DA 1GXFA 5FS7A 2BABA 2YG3A 2CDUA 1P2HA 3CNPA 1K4QA 3GYXA 3NGCX 4X4JA 3BI5A 2YG6A 3ICTA 3H4KA 1NPXA 1JNRA 2GV8A 1M64A 2QCUA 3AE3A 2VVMA 3UTHA 5FS6A 2C64A 3S5WA 3FBSA 1HYUA 1D7YA 1YQZA 4MJWA 3ZYXA 1H7WA 4B68A 4XWZA 3LB8A 4Z43A 2OLOA 2GMJA 1OJDA 1E1MA 3IC9A 4H4QA 3M13A 1NHQA 4J34A 5JCKA 4TLZA 1LQTA 2OAMA 4U8MA 2CVJA 2WP6A 2A8XA 3L5OA 3C4NA 3V76A 4A7AA 3WE0A 1ZY8A 5JCMA 4YTNA 3GD3A 2XDOA 3NTDA 4OPDA 1XHCA 4U8JA 2B7SA 2OA1A 1TYPA 2C73A 2YLRA 4H4UA 4EQSA 4Y4LA 2GH5A 2RABA 2GVCA 1QO8A 4CCQA 1F8SA 1RP0A 4YTMA 2Q7VA 4K5RA 1L9CA 3K7MX 5KMQA 4APNA 3AYLA 3VQRA 3BI4A 4Z25A 1KF6A 3ATQA 3AE5A 1ZDLA 3L1RA 3SFDA 3GMBA 3T31A 3VR9A 2BXRA 3CTYA 4Z2TA 1VG0A 2X8CA 2YVJA 1IUSA 4DSHA 2WP9A 4CNKA 4GCMA 1E1KA 1M6IA 4REKA 3GYJA 3V3NA 1OJCA 4OPIA 4NEVA 1GETA 1VG9A 2R4JA 3HYXA 1TRBA 1YQ4A 3DMEA 3EF6A 3D1CA 2FJAA 2PHHA 5KOWA 1L0VA 4ZN0A 3SZCA 4E0VA 4CNJA 3AD9B 3AE8A 1K0JA 2WQYA 2YWLA 3E1TA 3F8PA 5ER0A 3I6DA 5CKUA 2RGJA 1S2YA 1XPQA 5HYMA 3QJ4A 1VDCA 4WCTA 1KNPA 3II4A 3CMMA 5J60A 1P2EA 3QSSA 1DXLA 2B76A 1NAAA 1O95A 4GF7A 4GR1A 3QVPA 1Q9IA 3UKHA 4CY6A 2ZZCA 1B37A 2BXSA 3NRNA 1PJ7A 4XXGA 2GB0A 2XLTA 1FOHA 4G6HA 2GR0A 1CF3A 3GDPA 1F8WA 3QFBA 3ADAB 2AAQA 1RSGA 3LADA 3AEDA 4NTCA 4JNAA 4JDRA 1QJDA 2WETA 3UKQA 2XLPA 4J31A 3M12A 4H2QA 1Y56B 5BULA 4BURA 3URHA 4NEWA 3NG7X 3PG6A 1VQWA 2Q0LA 3UKAA 4AT2A 3NLCA 3DK8A 4HA6A 3ALLA 2Y6QA 3P1WA 1FECA 1Q1RA 1Y0PA 2VVLG 2EQ7A 5JCLA 3IWAA 2X8GA 3AEGA 2X99A 1K0LA 2WPFA 3DJDA 1E6EA 4RSLA 3NTAA 3SZ0A 2ZBWA 1Q1WA 1IUUA 3GDNA 4BK2A 3EANA 1GNDA 2WPCA 4J2WA 2XFUA 3CGCA 3VRAA 4O5QA 1GV4A 2VZ2A 4FK1A 5DBJA 3VR8A 5LV9A 2WDRA 4LA1A 3KLJA 3REDA 2HQMA 4H2NA 1GSNA 1GOSA 1CL0A 1JNZA 4LIIA 1DOCA 4P9SA 4AOXA 2C65A 2WS3A 3AECA 2E1MA 3BNUA 3FPZA 1VRQB 4M52A 2O9ZA 3R9UA 3NH3X 4X9MA 2V5ZA 4RG3A 4FX9A 4H50A 2R0GA 1ONFA 4YSZA 4OVIA 3NHOX 4JY2A 4A6NB 2Q6UA 1BWCA 4PAAA 4NZHA 1DJQA 4GAVA 3AEBA 4U8KA 2TPRA 4IVOB 3AYJA 3SX6A 2GQFA 3AEEA 4U8IA 3NKSA 4H4VA 3ATRA 1W4XA 2F5ZA 2YG7A 4ZCCA 3VRBA 5KOXA 2RGHA 4B64A 4H4XA 1F6MA 1PXAA 3SM8A 2X3NA 3IHGA 1EL9A 1GREA 4Z24A 3AWIA 3T2ZA 1ZOVA 4OPLA 3G5SA 2WOVA 1GRFA 4CCRA 4H2PA 2ARDA 2BK3A 4Y4NA 1KN0A 5HHFA 2ZZBA 1EL8A 2JB1A 1UKVG 3NIXA 1PBCA 1S3BA 4GDPA 1S2QA 1CJ4A 3CGEA 2B9YA 3I3LA 2EQ8A 3Q9TA 2JB3A 4JN9A 4B65A 2QA1A 4AP3A 3GYIA 2VOUA 3CNTA 4YSXA 4H4RA 2AR8A 4IA5A 1GTHA 2WDQA 4II2A 3CGDA 1DOBA 4GDEA 1PHHA 1JU2A 1TDNA 1EL5A 3FIMB 3LZWA 1FL2A 3EPTA 3V3OA 2BYBA 3M0OA 1H6VA 4K2XA 2YG5A 2I0ZA 1CHUA 3D8XA 1TDEA 2OLNA 3F8DA 3RP7A 5KXJA 2IVDA 2JB2A 3NK2X 2C72A 3RP6A 5EB4A 2YVGA 2VRMA 4J36A 4LU6A 1K0IA 1GRGA 3C96A 4KX6A 4TM1A 4C3YA 2WHDA 4CBQA 2VVLA 1B4VA 1LV0A 3UTGA 1ZMCA 4ADWA 2XLRA 1N4VA 4EMIA 3SQPA 3GSIA 3UKLA 4YTPA 5KVIA 2YLTA 3ISHA 4YKGA 2GR3A 2YG4A 1DNCA 4WX1A 4EQRA 4BV6A 5KWFA 3AE2A 2YVFA 1V59A 5FS9A 2BK5A 3AD7B 1XDIA 2R45A 2YQUA 3KKJA 4BK1A 1BZLA 2YR6A 2EQ9A 1IUTA 4OPTA 3GWDA 3AE7A 1PXBA 3B3RA 2Q0KA 3AE4A 1PBBA 3GWFA 1CJ2A 3CNSA 2Z5YA 5U63A 2VQBA 5M10A 3AE1A 1EL7A 2XVFA 3ZDNA 2X8HA 4A79A 3UKPA 3ITJA 5BVAA 3HYVA 1PBFA 3QSEA 2V60A 3SGLA 2CULA 1YQ3A 3ALMA 1OJ9A 1LJ1A 1PN0A 2E5VA 3QSMA 1AOGA 4FK1C 1GTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPC A;  2XVJ A;  1IUV A;  2C3D A;  2AQJ A;  1L9E A;  1L9D A;  1D5T A;  3NK1 X;  4CY8 A;  5BUK A;  2NVK X;  2NPX A;  4RG4 A;  2FJB A;  1H7X A;  1PS9 A;  2IID A;  4NTE A;  2GR2 A;  2XLU A;  1REO A;  5CQF A;  3GD4 A;  1N1P A;  3AEA A;  3BNM A;  1BKW A;  2YLW A;  2BS2 A;  1KDG A;  3DJG X;  1O5W A;  1LVL A;  1TDK A;  2XFO A;  2YAU A;  4Z26 A;  4EM4 A;  2R0P A;  4I58 A;  2XFP A;  2BC0 A;  3UKK A;  3RNM A;  2R4E A;  4USQ A;  2XYO A;  3K30 A;  2CFY A;  2C67 A;  1E1L A;  1IUX A;  4EIQ A;  1GT8 A;  1H84 A;  1E7P A;  1X31 B;  1B5Q A;  5U25 A;  2GR1 A;  4IV9 A;  1ZK7 A;  1Z6L A;  4JNQ A;  1KSU A;  4O5U A;  1FEB A;  4H4P A;  4EIP A;  3P9U A;  1BGN A;  1F8R A;  3DA1 A;  3UTF A;  1H86 A;  2XCG A;  2YR5 A;  3AYI A;  2B9X A;  2XFN A;  5FMH A;  5IQ4 A;  1CJC A;  5GRT A;  3K7T A;  4BJZ A;  4EMJ A;  1NG4 A;  3P4R A;  4D03 A;  2QA2 A;  1O94 A;  2H89 A;  4USR A;  1CC4 A;  4OCG A;  3AXB A;  3UP4 A;  1H81 A;  2A87 A;  1MOK A;  4Y4M A;  4DSG A;  2B7R A;  3HZL A;  2OAL A;  3C4A A;  4H2R A;  1ZKQ A;  1XAN A;  4J56 A;  2YLS A;  4JY3 A;  4H4Y A;  4A99 A;  1ZMD A;  1PXC A;  3FMW A;  2TMD A;  1DOE A;  1TDO A;  5M0Z A;  1JOA A;  2WBA A;  4B66 A;  3CNJ A;  3G5Q A;  3ICS A;  3DJE A;  4OPU A;  1GRT A;  4H7U A;  2FJE A;  1CBO A;  1H82 A;  2JK6 A;  4U8L A;  4U2L A;  4UP3 A;  2WDV A;  4UDP A;  2XVI A;  5TR3 A;  4C5O A;  1D4D A;  1PJ6 A;  3LOV A;  3P4Q A;  1E39 A;  3KVE A;  3AB1 A;  3H8L A;  3UOY A;  2ZZ0 A;  1JRX A;  3RP8 A;  2J3N A;  4H4W A;  3CPH G;  4TM3 A;  4FDC B;  2GAG B;  1N4U A;  2WOW A;  3EAO A;  4C74 A;  2V3A A;  4A5L A;  1NDA A;  3LZX A;  4N9X A;  3QFA A;  2XVE A;  1D4C A;  1GRB A;  1ZX9 A;  2GMH A;  3CPJ G;  2Y6R A;  2C75 A;  2VRL A;  1D4E A;  2EQ6 A;  1H83 A;  3OZ2 A;  3ALJ A;  4GRT A;  3KD9 A;  2WPE A;  4BJY A;  1PBD A;  3PVC A;  5KVH A;  2VQ7 A;  3DH9 A;  2GRT A;  3FG2 P;  1SEZ A;  1F3P A;  2B9W A;  4C77 A;  2YLX A;  2X50 A;  4YKF A;  1NEN A;  3IF9 A;  2JKC A;  1NHS A;  3PO7 A;  1PJ5 A;  2YM2 A;  3KA7 A;  4BK3 A;  4IVM B;  4CRT A;  2GQW A;  3AEF A;  1TDF A;  2Z5X A;  3DK9 A;  4IA6 A;  3UOX A;  3BHF A;  3QVR A;  3K7Q X;  2XVH A;  2FBW A;  2UZZ A;  2XLS A;  2E4G A;  2WU5 A;  1N4W A;  3CGB A;  1LPF A;  4U2S A;  1BGJ A;  1B8S A;  1TYT A;  5EOW A;  4AP1 A;  4EM3 A;  4ECH A;  2YLZ A;  5C3J A;  4NTD A;  4OPG A;  3CIR A;  4GUV A;  4AT0 A;  4ZCD A;  4U8N A;  2DKI A;  3NYE A;  3CND A;  4TM4 A;  3UCL A;  4U8O A;  1OJT A;  4K5S A;  2W0H A;  4YXD A;  5IPY A;  4A6N A;  1COY A;  1YY5 A;  3NT6 A;  1GER A;  4EMW A;  2A89 A;  2V3B A;  2H88 A;  3P4P A;  4YSH A;  4EQX A;  5HXI A;  1CC2 A;  4B1B A;  2GF3 A;  5KRQ A;  3AE6 A;  2R9Z A;  3DK4 A;  1QLB A;  4ICY A;  5IQ1 A;  1GEU A;  1JRZ A;  3G5R A;  4UDQ A;  4PAB A;  4Z2R A;  4X9N A;  5GSN A;  2BC1 A;  3UOV A;  4B67 A;  2R0C A;  2C3C A;  4U2T A;  3NYF A;  1IUW A;  4B69 A;  2XFQ A;  3UKF A;  1KNR A;  1GRA A;  2WOI A;  2C66 A;  2C7G A;  3ABV A;  2V61 A;  4HB9 A;  3UP5 A;  2YM1 A;  1KSS A;  3UTE A;  1GAL A;  3SFE A;  1ELI A;  4YT0 A;  1KFY A;  5C2T A;  3JSK A;  4B63 A;  3T37 A;  2DKH A;  3ICR A;  1NHR A;  2BCP A;  3IHM A;  1S3E A;  3Q6J A;  2BS3 A;  5FS8 A;  3KU9 A;  2QAE A;  4XWR A;  4Z44 A;  2BK4 A;  1GPE A;  3GMC A;  1RYI A;  2RGO A;  1YKJ A;  1LQU A;  2BCG G;  2IVE A;  3NN6 X;  4DGK A;  4A9W A;  3BHK A;  5U1O A;  5EBK A;  1NEK A;  4H4Z A;  1Y56 A;  4UDR A;  2JAE A;  3OC4 A;  1DOD A;  1MO9 A;  5JCN A;  2APG A;  4AOS A;  4K8D A;  1E1N A;  1FCD A;  4YWO A;  2BA9 A;  2R46 A;  4A65 A;  4H4T A;  3KPF A;  3PS9 A;  4J33 A;  2WEU A;  2C76 A;  3AE9 A;  2WU2 A;  1GES A;  3DJJ A;  2GAH B;  1MXT A;  4J57 A;  3NK0 X;  2V6O A;  3S61 A;  3LJP A;  3AD8 B;  2ACZ A;  4KPR A;  1ZOY A;  3L8K A;  1IJH A;  1LTX R;  5BRT A;  1D7L A;  5EB5 A;  2PYX A;  3O0H A;  2JBV A;  2WP5 A;  4DNA A;  4Z2U A;  3F8R A;  3RHA A;  4I59 A;  3COX A;  2WES A;  3GRS A;  1PBE A;  5JCI A;  3LXD A;  1JRY A;  1NG3 A;  4TM0 A;  1PDH A;  1NHP A;  4D04 A;  3H8I A;  3DGH A;  1CJ3 A;  3P4S A;  2BAC A;  3UOZ A;  1BF3 A;  2YR4 A;  2GEW A;  3CPI G;  4YSY A;  1OJA A;  3NNE A;  2FJD A;  4H4S A;  3VRD B;  1ZP0 A;  4C3X A;  1FEA A;  1CC6 A;  2BS4 A;  3BI2 A;  1JEH A;  1DJN A;  4JQ9 A;  3NYC A;  4TLX A;  3NN0 X;  5J7X A;  3CN8 A;  4U8P A;  1EBD A;  1GRH A;  4EQW A;  3GRT A;  2C70 A;  4K22 A;  4K7Z A;  3DGZ A;  5L46 A;  5HY5 A;  3B6D A;  1GXF A;  5FS7 A;  2BAB A;  2YG3 A;  2CDU A;  1P2H A;  3CNP A;  1K4Q A;  3NGC X;  4X4J A;  3BI5 A;  2YG6 A;  3ICT A;  3H4K A;  1NPX A;  1JNR A;  2GV8 A;  1M64 A;  2QCU A;  3AE3 A;  2VVM A;  3UTH A;  5FS6 A;  2C64 A;  3S5W A;  3FBS A;  1HYU A;  1D7Y A;  1YQZ A;  4MJW A;  3ZYX A;  1H7W A;  4B68 A;  4XWZ A;  3LB8 A;  4Z43 A;  2OLO A;  2GMJ A;  1OJD A;  1E1M A;  3IC9 A;  4H4Q A;  3M13 A;  1NHQ A;  4J34 A;  5JCK A;  4TLZ A;  1LQT A;  2OAM A;  4U8M A;  2CVJ A;  2WP6 A;  2A8X A;  3C4N A;  3V76 A;  4A7A A;  3WE0 A;  1ZY8 A;  5JCM A;  4YTN A;  3GD3 A;  2XDO A;  3NTD A;  4OPD A;  1XHC A;  4U8J A;  2B7S A;  2OA1 A;  1TYP A;  2C73 A;  2YLR A;  4H4U A;  4EQS A;  4Y4L A;  2GH5 A;  2RAB A;  2GVC A;  1QO8 A;  4CCQ A;  1F8S A;  1RP0 A;  4YTM A;  2Q7V A;  4K5R A;  1L9C A;  3K7M X;  4APN A;  3AYL A;  3VQR A;  3BI4 A;  4Z25 A;  1KF6 A;  3ATQ A;  3AE5 A;  1ZDL A;  3L1R A;  3SFD A;  3GMB A;  3VR9 A;  2BXR A;  3CTY A;  4Z2T A;  1VG0 A;  2X8C A;  2YVJ A;  1IUS A;  4DSH A;  2WP9 A;  4CNK A;  4GCM A;  1E1K A;  1M6I A;  4REK A;  3GYJ A;  3V3N A;  1OJC A;  4OPI A;  4NEV A;  1GET A;  1VG9 A;  2R4J A;  1TRB A;  1YQ4 A;  3DME A;  3EF6 A;  3D1C A;  2FJA A;  2PHH A;  5KOW A;  1L0V A;  4ZN0 A;  4E0V A;  4CNJ A;  3AD9 B;  3AE8 A;  1K0J A;  2WQY A;  2YWL A;  3E1T A;  3F8P A;  5ER0 A;  3I6D A;  5CKU A;  2RGJ A;  1S2Y A;  1XPQ A;  5HYM A;  3QJ4 A;  1VDC A;  4WCT A;  1KNP A;  3II4 A;  5J60 A;  1P2E A;  3QSS A;  1DXL A;  2B76 A;  1NAA A;  1O95 A;  4GF7 A;  4GR1 A;  3QVP A;  1Q9I A;  3UKH A;  4CY6 A;  2ZZC A;  1B37 A;  2BXS A;  3NRN A;  1PJ7 A;  4XXG A;  2GB0 A;  2XLT A;  1FOH A;  2GR0 A;  1CF3 A;  3GDP A;  1F8W A;  3QFB A;  3ADA B;  2AAQ A;  1RSG A;  3LAD A;  3AED A;  4NTC A;  4JNA A;  4JDR A;  1QJD A;  2WET A;  3UKQ A;  2XLP A;  4J31 A;  3M12 A;  4H2Q A;  1Y56 B;  5BUL A;  4BUR A;  3URH A;  4NEW A;  3NG7 X;  1VQW A;  2Q0L A;  3UKA A;  4AT2 A;  3NLC A;  3DK8 A;  4HA6 A;  3ALL A;  2Y6Q A;  3P1W A;  1FEC A;  1Q1R A;  1Y0P A;  2VVL G;  2EQ7 A;  5JCL A;  3IWA A;  2X8G A;  3AEG A;  2X99 A;  1K0L A;  2WPF A;  3DJD A;  1E6E A;  4RSL A;  3NTA A;  2ZBW A;  1Q1W A;  1IUU A;  3GDN A;  4BK2 A;  3EAN A;  1GND A;  2WPC A;  4J2W A;  2XFU A;  3CGC A;  3VRA A;  4O5Q A;  1GV4 A;  2VZ2 A;  4FK1 A;  5DBJ A;  3VR8 A;  5LV9 A;  2WDR A;  4LA1 A;  3KLJ A;  3RED A;  2HQM A;  4H2N A;  1GSN A;  1GOS A;  1CL0 A;  1JNZ A;  4LII A;  1DOC A;  4P9S A;  4AOX A;  2C65 A;  2WS3 A;  3AEC A;  2E1M A;  3BNU A;  3FPZ A;  1VRQ B;  4M52 A;  2O9Z A;  3R9U A;  3NH3 X;  4X9M A;  2V5Z A;  4RG3 A;  4FX9 A;  4H50 A;  2R0G A;  1ONF A;  4YSZ A;  4OVI A;  3NHO X;  4JY2 A;  4A6N B;  2Q6U A;  1BWC A;  4PAA A;  4NZH A;  1DJQ A;  3AEB A;  4U8K A;  2TPR A;  4IVO B;  3AYJ A;  2GQF A;  3AEE A;  4U8I A;  3NKS A;  4H4V A;  3ATR A;  1W4X A;  2F5Z A;  2YG7 A;  4ZCC A;  3VRB A;  5KOX A;  2RGH A;  4B64 A;  4H4X A;  1F6M A;  1PXA A;  3SM8 A;  2X3N A;  3IHG A;  1EL9 A;  1GRE A;  4Z24 A;  3AWI A;  1ZOV A;  4OPL A;  3G5S A;  2WOV A;  1GRF A;  4CCR A;  4H2P A;  2ARD A;  2BK3 A;  4Y4N A;  5HHF A;  2ZZB A;  1EL8 A;  2JB1 A;  1UKV G;  3NIX A;  1PBC A;  1S3B A;  4GDP A;  1S2Q A;  1CJ4 A;  3CGE A;  2B9Y A;  3I3L A;  2EQ8 A;  3Q9T A;  2JB3 A;  4JN9 A;  4B65 A;  2QA1 A;  4AP3 A;  3GYI A;  2VOU A;  3CNT A;  4YSX A;  4H4R A;  2AR8 A;  4IA5 A;  1GTH A;  2WDQ A;  3CGD A;  1DOB A;  4GDE A;  1PHH A;  1JU2 A;  1TDN A;  1EL5 A;  3FIM B;  3LZW A;  1FL2 A;  3EPT A;  3V3O A;  2BYB A;  3M0O A;  1H6V A;  4K2X A;  2YG5 A;  2I0Z A;  1CHU A;  3D8X A;  1TDE A;  2OLN A;  3F8D A;  3RP7 A;  5KXJ A;  2IVD A;  2JB2 A;  3NK2 X;  2C72 A;  3RP6 A;  5EB4 A;  2YVG A;  2VRM A;  4J36 A;  4LU6 A;  1K0I A;  1GRG A;  3C96 A;  4KX6 A;  4TM1 A;  4C3Y A;  2WHD A;  4CBQ A;  2VVL A;  1B4V A;  1LV0 A;  3UTG A;  1ZMC A;  4ADW A;  2XLR A;  1N4V A;  4EMI A;  3SQP A;  3GSI A;  3UKL A;  4YTP A;  5KVI A;  2YLT A;  3ISH A;  4YKG A;  2GR3 A;  2YG4 A;  1DNC A;  4WX1 A;  4EQR A;  4BV6 A;  5KWF A;  3AE2 A;  2YVF A;  1V59 A;  5FS9 A;  2BK5 A;  3AD7 B;  1XDI A;  2R45 A;  2YQU A;  3KKJ A;  4BK1 A;  1BZL A;  2YR6 A;  2EQ9 A;  1IUT A;  4OPT A;  3GWD A;  3AE7 A;  1PXB A;  3B3R A;  2Q0K A;  3AE4 A;  1PBB A;  3GWF A;  1CJ2 A;  3CNS A;  2Z5Y A;  5U63 A;  2VQB A;  5M10 A;  3AE1 A;  1EL7 A;  2XVF A;  3ZDN A;  2X8H A;  4A79 A;  3UKP A;  3ITJ A;  5BVA A;  1PBF A;  3QSE A;  2V60 A;  3SGL A;  2CUL A;  1YQ3 A;  3ALM A;  1OJ9 A;  1LJ1 A;  1PN0 A;  2E5V A;  3QSM A;  1AOG A;  4FK1 C;  1GTE A; 
#chains in the Genus database with same CATH topology
 2AQJ A;  4KT2 A;  1L9E A;  5G5H B;  3T2K A;  3AEA A;  1SJD A;  4JN7 A;  3T14 A;  1WYG A;  2FYM A;  2PCE A;  1LVL A;  2XFO A;  4EM4 A;  1P43 A;  2BC0 A;  3UKK A;  2XYO A;  2C67 A;  1E1L A;  4EIQ A;  1H84 A;  1JPD X;  1E7P A;  4IV9 A;  1ZK7 A;  4O5U A;  1BGN A;  3UTF A;  3SYI A;  1H86 A;  2XCG A;  5IQ4 A;  1CJC A;  4EMJ A;  1NG4 A;  3MUC A;  4USR A;  2W3S A;  3TWA A;  3AXB A;  3UP4 A;  4J1O A;  1MOK A;  4Y4M A;  3VFC A;  4H2R A;  4JY3 A;  4J56 A;  4H4Y A;  3NVW B;  4A99 A;  1PXC A;  2QDE A;  3G5Q A;  4UP3 A;  1N60 C;  1D4D A;  3I6E A;  3AB1 A;  3UOY A;  2ZZ0 A;  4FDC B;  2WOW A;  3EAO A;  4H1Z A;  2XSX A;  2V3A A;  2Y6R A;  2VRL A;  2EQ6 A;  4K8G A;  2OZT A;  1PBD A;  3PVC A;  1SEZ A;  4DWD A;  2B9W A;  4HCD A;  1RVK A;  3IF9 A;  1TZZ A;  3N4F A;  2GQW A;  1KD0 A;  3DK9 A;  3QVR A;  3K7Q X;  2W54 A;  2FBW A;  3NVV B;  2UZZ A;  2E4G A;  2WU5 A;  3T0K A;  3CGB A;  2QJJ A;  5EOW A;  4ZCD A;  4U8N A;  1OJT A;  4YXD A;  2W0H A;  3B9J B;  2V3B A;  3SY4 A;  3RRA A;  3P4P A;  4YWS A;  2XGZ A;  3DEQ A;  2GGI A;  3BJS A;  4ICY A;  3STP A;  5IQ1 A;  2AKM A;  3G5R A;  4GAP A;  3SXI A;  2R0C A;  2C3C A;  3UKF A;  2XH0 A;  4HB9 A;  1SJB A;  4GME A;  3UTE A;  3R10 A;  2QDD A;  3T37 A;  1NHR A;  3T4W A;  4Z44 A;  3KU9 A;  2BK4 A;  1RYI A;  1YKJ A;  1LQU A;  4H4Z A;  4DYE A;  4UDR A;  1MO9 A;  2APG A;  2BA9 A;  3KPF A;  4G74 A;  3H8A A;  2WEU A;  4J33 A;  4E5T A;  3AE9 A;  3SN1 A;  3NK0 X;  3DFH A;  5KMR A;  4KPR A;  1LTX R;  5BRT A;  3T2Y A;  2JBV A;  4Z2U A;  3Q4D A;  4I59 A;  3AMZ A;  3QPE A;  1JRY A;  3H8I A;  3DGH A;  1CJ3 A;  4E4F A;  3CPI G;  3UJ2 A;  3RGT A;  3VRD B;  4C3X A;  1FEA A;  3BI2 A;  4JQ9 A;  3R25 A;  4TLX A;  2AKZ A;  2GGH A;  1GRH A;  3V3W A;  5L46 A;  3B6D A;  2YG3 A;  3SQS A;  3NGC X;  2YG6 A;  3H4K A;  2QCU A;  1M64 A;  2VVM A;  5FS6 A;  3FBS A;  1N5X A;  1HYU A;  2QVH A;  1D7Y A;  2OLO A;  4IP4 A;  2AL2 A;  1N63 C;  2MUC A;  3IC9 A;  4M0X A;  4TLZ A;  2OAM A;  4U8M A;  3C4N A;  4OPD A;  1XHC A;  2C73 A;  4EQS A;  4EWJ A;  3NO1 A;  1RP0 A;  2Q7V A;  3K7M X;  5KMQ A;  2W3R A;  3KUM A;  3AE5 A;  3T31 A;  1VG0 A;  2X8C A;  1IUS A;  2WP9 A;  3GYJ A;  1GET A;  3ZLG A;  7ENL A;  3DME A;  3EF6 A;  3CXO A;  3D1C A;  2PHH A;  5KOW A;  1L0V A;  3SZC A;  3NFU A;  5ER0 A;  5HYM A;  3BOX A;  5J60 A;  4GF7 A;  1O95 A;  4GR1 A;  3QVP A;  4CY6 A;  2ZZC A;  3NRN A;  1PJ7 A;  3N4E A;  4G6H A;  3FXG A;  3ADA B;  3SN0 A;  2NQL A;  4J31 A;  3PG6 A;  3NLC A;  3DK8 A;  3VC6 A;  1TKK A;  1Q1R A;  3IWA A;  2X99 A;  2WPF A;  2PMQ A;  4BK2 A;  2WPC A;  1GND A;  3CGC A;  1GV4 A;  3KLJ A;  4H2N A;  1CL0 A;  4LII A;  3BNU A;  3A7R A;  2ONE A;  1MDR A;  4GGH A;  4RG3 A;  4H50 A;  2R0G A;  1X2G A;  3VDG A;  3NHO X;  1EC8 A;  1BWC A;  1RM6 B;  4U8K A;  2TPR A;  4U8I A;  4H4V A;  5KOX A;  4B64 A;  2ZAD A;  5BOE A;  4GYP A;  4OPL A;  4CCR A;  2BK3 A;  4E8G A;  2ZZB A;  3NXL A;  1PBC A;  2GGJ A;  2PGE A;  4GIR A;  2AR8 A;  4IA5 A;  4II2 A;  3QLD A;  4GDE A;  1EL5 A;  3EPT A;  1JCT A;  3UJS A;  3RP7 A;  3A7U A;  5EB4 A;  4C3Y A;  2VVL A;  1SJC A;  1ZMC A;  2XLR A;  1N4V A;  3ISH A;  2YG4 A;  4WX1 A;  4EQR A;  5FS9 A;  2BK5 A;  5FJR A;  3T8Q A;  4BK1 A;  2YR6 A;  2EQ9 A;  3AE7 A;  3AE4 A;  1PBB A;  3CNS A;  3ITJ A;  3HYV A;  3QSE A;  3RIT A;  2V60 A;  3IK4 A;  3ALM A;  3P0W A;  3TJI A;  2OQH A;  2O56 A;  2BRY A;  4JHM A;  3SZW A;  3P93 A;  4DGK A;  1REO A;  1BKW A;  5EU9 A;  1O5W A;  3UXL A;  2YAU A;  3MY9 A;  4Z26 A;  1L8P A;  4I58 A;  5FJT A;  2XFP A;  3R1Z A;  2R4E A;  4NWZ A;  2CFY A;  3TQP A;  1B5Q A;  1Z6L A;  4JNQ A;  3GD6 A;  1FEB A;  5J04 A;  4H4P A;  4EIP A;  1JRO A;  2YR5 A;  3AYI A;  2XFN A;  3K7T A;  4BJZ A;  3N6J A;  3P4R A;  4G8T A;  2QA2 A;  1CC4 A;  1H81 A;  2OG9 A;  3UXK A;  2PPG A;  5LV9 A;  2OAL A;  3C4A A;  3QKE A;  1XAN A;  2TMD A;  3EEZ A;  1TDO A;  5M0Z A;  2WBA A;  4H7U A;  4U8L A;  2WDV A;  4C5O A;  1PJ6 A;  3KVE A;  2PP0 A;  2BRA A;  3RP8 A;  2J3N A;  4K1W A;  2GAG B;  4A5L A;  3LZX A;  1ELS A;  2XVE A;  3CPJ G;  2C75 A;  4IZG A;  4GRT A;  4BJY A;  5KVH A;  2VQ7 A;  2YLX A;  3FV9 A;  4YKF A;  1NEN A;  1V97 A;  4BK3 A;  1OEP A;  1TDF A;  3UOX A;  3BHF A;  3U4F A;  2XLS A;  1LPF A;  4U2S A;  1BGJ A;  4AP1 A;  4EM3 A;  2OKT A;  3SBF A;  4OPG A;  3UCL A;  3CND A;  3JW7 A;  4U8O A;  3GY1 A;  1COY A;  1YY5 A;  4EMW A;  2A89 A;  3TW9 A;  3VA8 A;  1CC2 A;  5KRQ A;  3DK4 A;  1QLB A;  4JN8 A;  4PAB A;  3MQT A;  4B67 A;  3R0K A;  3NYF A;  1IUW A;  2XFQ A;  3UP5 A;  1KSS A;  4YT0 A;  1KFY A;  3JSK A;  2DKH A;  3ICR A;  1S3E A;  3Q6J A;  2BS3 A;  5FS8 A;  3T2Z A;  3TWB A;  2IVE A;  3UJE A;  4A9W A;  3BHK A;  4ZOH B;  5EBK A;  1NEK A;  2JAE A;  5JCN A;  3PK7 A;  4K8D A;  1E1N A;  1FCD A;  4ZA0 A;  2WU2 A;  3DJJ A;  2GAH B;  3AD8 B;  3L8K A;  1IJH A;  1SJA A;  2OZ3 A;  5EB5 A;  2PP1 A;  3COX A;  2WES A;  2CHR A;  1NG3 A;  3OTR A;  4NNJ A;  3P4S A;  2BAC A;  1BF3 A;  2YR4 A;  2GEW A;  4YSY A;  1OJA A;  3NNE A;  4G9K A;  2BS4 A;  2C4C A;  1EBD A;  4ENL A;  5HY5 A;  2CDU A;  1K4Q A;  3GYX A;  3BI5 A;  3SN4 A;  3NVZ B;  4A6G A;  3UTH A;  3S5W A;  1N61 C;  3LB8 A;  4Z43 A;  2GMJ A;  1E1M A;  3M13 A;  5JCK A;  2CVJ A;  3SR6 B;  3L5O A;  3GD3 A;  4U8J A;  2OA1 A;  2YLR A;  3OP2 A;  3FJ4 A;  4YTM A;  4K5R A;  4Z25 A;  3AYL A;  3BI4 A;  3ATQ A;  1ZDL A;  3MSY A;  3VR9 A;  4FP1 A;  4X2P A;  4DSH A;  4CNK A;  4GCM A;  2GSH A;  2PU1 A;  1KKR A;  2R4J A;  3EKG A;  3UCD A;  4H83 A;  4ZN0 A;  3FCP A;  4CNJ A;  3AD9 B;  2OZ8 A;  1K0J A;  3AE8 A;  2YWL A;  5ENL A;  3E1T A;  3F8P A;  1XPQ A;  2OQY A;  1EC9 A;  1P2E A;  4XXG A;  2XLT A;  2GR0 A;  3R07 C;  1RSG A;  3LAD A;  3AED A;  3R0U A;  1QJD A;  2WET A;  3UKQ A;  3M12 A;  4BUR A;  4NEW A;  1PDY A;  1VQW A;  4AT2 A;  3ALL A;  2Y6Q A;  3SZ0 A;  3NTA A;  1Q1W A;  1IUU A;  3GDN A;  4J2W A;  2XFU A;  3VRA A;  4ZCW A;  4O5Q A;  3VC5 A;  2VZ2 A;  4FK1 A;  5DBJ A;  4HNC A;  4LA1 A;  3RED A;  2E5A A;  1GSN A;  3CAW A;  1GOS A;  2PTY A;  1DOC A;  1FHU A;  4AOX A;  2C65 A;  3AEC A;  2E1M A;  3ZVH B;  1VRQ B;  1F9C A;  2O9Z A;  2P88 A;  1ONF A;  2RDX A;  4A6N B;  3ENL A;  4GFI A;  4Z1Y A;  3AEE A;  3ATR A;  3AWI A;  3G5S A;  2WOV A;  1GRF A;  4H2P A;  2ARD A;  1KN0 A;  1S2Q A;  3CGE A;  2JB3 A;  4H19 A;  3CNT A;  1GTH A;  3CGD A;  1JU2 A;  3NZG A;  3LZW A;  1H6V A;  4K2X A;  3D8X A;  2JB2 A;  2C72 A;  4LU6 A;  4KX6 A;  2P8C A;  3UTG A;  2I5Q A;  1EBH A;  4EMI A;  3SQP A;  3UKL A;  4YTP A;  4DN1 A;  1PDZ A;  4YKG A;  1DNC A;  3AD7 B;  1XDI A;  3QTP A;  3GWD A;  3DFY A;  1PXB A;  3P3B A;  2Z5Y A;  5M10 A;  1EL7 A;  2XVF A;  3AN1 A;  3SSZ A;  2CUL A;  3MKC A;  2PGW A;  1YQ3 A;  6ENL A;  1LJ1 A;  1PN0 A;  3B97 A;  4OPC A;  2XVJ A;  1IUV A;  3K1G A;  3NK1 X;  4CY8 A;  5BUK A;  2NVK X;  4RG4 A;  1H7X A;  4NTE A;  2IID A;  2XLU A;  1N1P A;  3BNM A;  2YLW A;  3SJN A;  2FKP A;  1KDG A;  3RNM A;  2GR1 A;  3KPK A;  3CYJ A;  1KSU A;  1JRP A;  1F8R A;  1T3Q C;  3DA1 A;  3T6C A;  5GRT A;  4D03 A;  5FJU A;  1O94 A;  3EUB 3;  4OCG A;  3OPS A;  3MZN A;  3HYW A;  4DSG A;  3HZL A;  1DOE A;  4G6G A;  1JOA A;  3CNJ A;  3ICS A;  4TVW A;  1H82 A;  4U2L A;  5KMS A;  2PTX A;  3LOV A;  3P4Q A;  1E39 A;  3H12 A;  1IYX A;  1JRX A;  4H4W A;  3CPH G;  4C74 A;  4N9X A;  1ONE A;  1D4C A;  1GRB A;  1ZX9 A;  2GMH A;  2OPJ A;  4E4U A;  1D4E A;  1H83 A;  3KD9 A;  2GRT A;  4C77 A;  2X50 A;  1NHS A;  1PJ5 A;  2YM2 A;  3KA7 A;  1EBG A;  4IVM B;  4CRT A;  3AEF A;  2PS2 A;  3H70 A;  2P0I A;  2Z5X A;  1JDF A;  1JPM A;  3I6T A;  5KMP A;  3DER A;  1N4W A;  1N5W C;  3THU A;  2E3T A;  4NTD A;  2AL2 B;  3CIR A;  4GUV A;  4AT0 A;  2DKI A;  4K5S A;  4A6N A;  3DES A;  1GER A;  2H88 A;  2OO6 A;  2OLA A;  4EQX A;  4B1B A;  3IJQ A;  3AE6 A;  2QJN A;  1GEU A;  4UDQ A;  3OZY A;  3TTE A;  5GSN A;  1BKH A;  1KNR A;  2C66 A;  2WOI A;  3V4B A;  1YEY A;  3ABV A;  2V61 A;  2YM1 A;  1GAL A;  4HYR A;  1TE6 A;  5C2T A;  4B63 A;  2BCP A;  3IHM A;  4XWR A;  2QAE A;  3GMC A;  2RGO A;  2PTW A;  4A3R A;  3NN6 X;  3HRD C;  3ETR B;  3ZVI A;  5U1O A;  1Y56 A;  5KNL A;  3OC4 A;  1DOD A;  4AOS A;  4YWO A;  2P3Z A;  4A65 A;  2POD A;  3PS9 A;  2C76 A;  3DG6 A;  4HPN A;  3FVD A;  1GES A;  3S61 A;  3LJP A;  2ACZ A;  2DW7 A;  1D7L A;  2PYX A;  3O0H A;  3ES7 A;  4F4R A;  3ZLF A;  1PBE A;  3LXD A;  4TM0 A;  4D04 A;  2FJD A;  4HN8 A;  1JEH A;  1MRA A;  3NN0 X;  5J7X A;  3CN8 A;  4U8P A;  2AL1 A;  2C70 A;  4K22 A;  4K7Z A;  1GXF A;  2BAB A;  4X4J A;  1NPX A;  1JNR A;  2GV8 A;  2OFJ A;  3TCS A;  5IDZ A;  4IT1 A;  5FJP A;  1YQZ A;  4MJW A;  1H7W A;  2GGE A;  4B68 A;  3JZU A;  4DX3 A;  1OJD A;  2HNE A;  4J34 A;  2WP6 A;  2A8X A;  3V76 A;  4A7A A;  1ZY8 A;  5JCM A;  2XDO A;  2B7S A;  3VCN A;  4H4U A;  1ZXI C;  2GH5 A;  1L9C A;  3SFD A;  3GMB A;  3CTY A;  4IHC A;  1M6I A;  4REK A;  3V3N A;  4OPI A;  1TRB A;  3RCY A;  1NEL A;  2WQY A;  3I6D A;  5CKU A;  1S2Y A;  3QJ4 A;  1VDC A;  1KNP A;  3II4 A;  3CMM A;  1NAA A;  1P48 A;  3A7A A;  4MGG A;  2GB0 A;  3GDP A;  4NTC A;  4JDR A;  2XLP A;  3NG7 X;  2PP3 A;  4HA6 A;  2VVL G;  2EQ7 A;  5JCL A;  4RSL A;  2X8G A;  1K0L A;  1E6E A;  3IJL A;  4IL0 A;  4GGB A;  2PA6 A;  1XPY A;  1JNZ A;  5FJO A;  4M52 A;  3NH3 X;  4X9M A;  2V5Z A;  4FX9 A;  4YSZ A;  4HCL A;  4JY2 A;  2Q6U A;  1FFU C;  4PAA A;  1DJQ A;  3AEB A;  3AYJ A;  3SX6 A;  2GQF A;  1W4X A;  2F5Z A;  2YG7 A;  4ZCC A;  3VRB A;  2RGH A;  4H4X A;  1F6M A;  3SM8 A;  2X3N A;  3IHG A;  3N6H A;  1GRE A;  4Z24 A;  4HNL A;  4Y4N A;  5HHF A;  2JB1 A;  1UKV G;  4GDP A;  3I3L A;  2EQ8 A;  4JN9 A;  2QA1 A;  3GYI A;  2VOU A;  4Z17 A;  4H4R A;  1NU5 A;  3PWI A;  3FIM B;  1MDL A;  3V3O A;  2BYB A;  4ROP A;  2DW6 A;  2I0Z A;  4MKS A;  1TDE A;  2OLN A;  3F8D A;  5KXJ A;  3MWC A;  3NK2 X;  3RP6 A;  2VRM A;  3UJR A;  1K0I A;  3C96 A;  2WHD A;  1FO4 A;  1B4V A;  1SB3 B;  5KVI A;  2GR3 A;  5KWF A;  3AE2 A;  2YVF A;  2PU0 A;  3H7V A;  2R45 A;  3FYY A;  2YQU A;  3KKJ A;  3GC2 A;  1BZL A;  1IUT A;  4OPT A;  3B3R A;  2VQB A;  3OW1 A;  3ZDN A;  4DHG A;  3UKP A;  5BVA A;  3SGL A;  3V5C A;  1OJ9 A;  2E5V A;  1R6W A;  4FK1 C;  3ES8 A;  2C3D A;  1L9D A;  3D9X A;  1D5T A;  2NPX A;  2FJB A;  1PS9 A;  3GO2 A;  2GR2 A;  3T9P A;  5CQF A;  3GD4 A;  2QGY A;  1KKO A;  2BS2 A;  1VDV A;  3DJG X;  1TDK A;  3R11 A;  3DG3 A;  1DTN A;  2R0P A;  3NRZ B;  4USQ A;  3K30 A;  1IUX A;  1GT8 A;  1MNS A;  3QN3 A;  1X31 B;  5U25 A;  3P9U A;  4E6M A;  2B9X A;  5FMH A;  2MNR A;  2H89 A;  2A87 A;  2B7R A;  1ZKQ A;  2YLS A;  1ZMD A;  3FMW A;  1W6T A;  3V5F A;  4B66 A;  1N62 C;  4OPU A;  3DJE A;  1GRT A;  2FJE A;  1CBO A;  4KPL A;  2JK6 A;  4UDP A;  2XVI A;  5TR3 A;  3HPF A;  3ZLH A;  3H8L A;  3UCC A;  4TM3 A;  1N4U A;  1NDA A;  2PTZ A;  3QFA A;  3DG7 A;  2GDQ A;  3RO6 A;  3OZ2 A;  3ALJ A;  2WPE A;  3DH9 A;  3FG2 P;  1F3P A;  2XH2 A;  2JKC A;  3PO7 A;  3CK5 A;  1WUE A;  1FFV C;  1ECQ A;  3OZM A;  4IA6 A;  2XVH A;  4FI4 A;  3CT2 A;  1B8S A;  1TYT A;  4ECH A;  2HXU A;  2YLZ A;  5C3J A;  1BQG A;  1FIQ B;  3NYE A;  4TM4 A;  5G5G B;  5IPY A;  3NT6 A;  3S47 A;  4YSH A;  5HXI A;  2GF3 A;  2R9Z A;  1JRZ A;  4Z2R A;  4X9N A;  2BC1 A;  2GGG A;  3UOV A;  1H2I A;  4U2T A;  4TVY A;  4B69 A;  1GRA A;  2C7G A;  2PSN A;  2GL5 A;  3SFE A;  4MMW A;  1ELI A;  1GPE A;  2BCG G;  3DGB A;  5JRB A;  3VCC A;  4II3 A;  4G73 A;  2QQ6 A;  2R46 A;  4H4T A;  2QJM A;  1MXT A;  4J57 A;  1FHV A;  2V6O A;  1ZOY A;  1S7M A;  2WP5 A;  4DNA A;  3SZF A;  3Q45 A;  5BOF A;  3F8R A;  3RHA A;  3GRS A;  5JCI A;  1PDH A;  1NHP A;  3UOZ A;  3TJ4 A;  4H4S A;  1ZP0 A;  3D46 A;  1CC6 A;  1DJN A;  3NYC A;  3ZVH A;  4EQW A;  3GRT A;  3DGZ A;  5FS7 A;  1P2H A;  3CNP A;  2OVL A;  3ICT A;  3AE3 A;  3U9I A;  4GYP C;  2C64 A;  1R0M A;  3ZYX A;  4XWZ A;  4H4Q A;  1NHQ A;  2POZ A;  1LQT A;  4YTN A;  3WE0 A;  3NTD A;  1EC7 A;  1TYP A;  2HZG A;  3CXB A;  4Y4L A;  2RAB A;  2GVC A;  4H2H A;  1QO8 A;  4CCQ A;  1F8S A;  4APN A;  3VQR A;  1KF6 A;  3L1R A;  3PWG A;  1KCZ A;  2BXR A;  4Z2T A;  2YVJ A;  1E9I A;  4HCH A;  3S5S A;  1E1K A;  1OJC A;  4NEV A;  1VG9 A;  3HYX A;  1YQ4 A;  3RR1 A;  3CB3 A;  2FJA A;  4KEM A;  4E0V A;  2RGJ A;  4WCT A;  2XH7 A;  3QSS A;  1DXL A;  2B76 A;  3UKH A;  2XH4 A;  1Q9I A;  4DXK A;  1B37 A;  2BXS A;  4GIS A;  1FOH A;  1CF3 A;  1F8W A;  3QFB A;  2AAQ A;  4JNA A;  4H2Q A;  1Y56 B;  5BUL A;  4IL2 A;  3URH A;  3UJF A;  1STZ A;  2Q0L A;  3UKA A;  3AM9 A;  3BSM A;  3P1W A;  1FEC A;  1Y0P A;  3AEG A;  3DJD A;  3TOY A;  2ZBW A;  4KWS A;  3EAN A;  3VR8 A;  2WDR A;  2HQM A;  4P9S A;  2WS3 A;  3FPZ A;  3R9U A;  4OVI A;  3DIP A;  4NZH A;  3HW2 A;  4GAV A;  2HXT A;  4IVO B;  1WUF A;  3NKS A;  3UGV A;  1PXA A;  1EL9 A;  1ZOV A;  2ZC8 A;  1EL8 A;  3NIX A;  1S3B A;  1CJ4 A;  2OX4 A;  2B9Y A;  4B65 A;  3Q9T A;  3NVY B;  4AP3 A;  4YSX A;  2WDQ A;  1DOB A;  1PHH A;  4G7F A;  1XS2 A;  1TDN A;  4J3Z A;  1FL2 A;  3M0O A;  2YG5 A;  3NS1 B;  1CHU A;  2P8B A;  2IVD A;  1X2H A;  3D47 A;  2YVG A;  4J36 A;  1GRG A;  4TM1 A;  4K2S A;  4CBQ A;  4A35 A;  1LV0 A;  4ADW A;  3GSI A;  2W55 A;  2YLT A;  4IP5 A;  3PFR A;  4BV6 A;  1V59 A;  3JVA A;  3IJI A;  2Q0K A;  4M6U A;  3GWF A;  1CJ2 A;  1VQZ A;  5U63 A;  3AE1 A;  2X8H A;  3I4K A;  4A79 A;  1MUC A;  1PBF A;  3DDM A;  3QSM A;  1AOG A;  1GTE A; 
#chains in the Genus database with same CATH homology
 4OPC A;  2XVJ A;  1IUV A;  2C3D A;  2AQJ A;  1L9E A;  1L9D A;  3D9X A;  1D5T A;  2BRY A;  3NK1 X;  3T2K A;  4CY8 A;  5BUK A;  2NVK X;  2NPX A;  4RG4 A;  3SZW A;  2FJB A;  1H7X A;  1PS9 A;  2IID A;  4NTE A;  2GR2 A;  2XLU A;  1REO A;  5CQF A;  3GD4 A;  1N1P A;  3AEA A;  3BNM A;  1BKW A;  3T14 A;  2YLW A;  2BS2 A;  1KDG A;  3DJG X;  1O5W A;  1LVL A;  1TDK A;  2XFO A;  2YAU A;  4Z26 A;  4EM4 A;  2R0P A;  4I58 A;  2XFP A;  2BC0 A;  3UKK A;  3RNM A;  2R4E A;  4USQ A;  2XYO A;  3K30 A;  4NWZ A;  2CFY A;  2C67 A;  1E1L A;  1IUX A;  4EIQ A;  1GT8 A;  1H84 A;  1E7P A;  1X31 B;  1B5Q A;  5U25 A;  2GR1 A;  3KPK A;  1ZK7 A;  4IV9 A;  1Z6L A;  4JNQ A;  1KSU A;  4O5U A;  1FEB A;  4H4P A;  4EIP A;  3P9U A;  1BGN A;  1F8R A;  3DA1 A;  3UTF A;  3SYI A;  1H86 A;  2XCG A;  2YR5 A;  3AYI A;  2B9X A;  2XFN A;  5FMH A;  5IQ4 A;  1CJC A;  5GRT A;  3K7T A;  4BJZ A;  4EMJ A;  1NG4 A;  3P4R A;  4D03 A;  2QA2 A;  1O94 A;  2H89 A;  4USR A;  1CC4 A;  4OCG A;  3AXB A;  3UP4 A;  1H81 A;  2A87 A;  1MOK A;  3HYW A;  4Y4M A;  4DSG A;  2B7R A;  3HZL A;  2OAL A;  3C4A A;  4H2R A;  1ZKQ A;  1XAN A;  4J56 A;  2YLS A;  4JY3 A;  4H4Y A;  4A99 A;  1ZMD A;  1PXC A;  3FMW A;  2TMD A;  1DOE A;  1TDO A;  4G6G A;  5M0Z A;  1JOA A;  2WBA A;  4B66 A;  3CNJ A;  3G5Q A;  3ICS A;  3DJE A;  4OPU A;  1GRT A;  4H7U A;  2FJE A;  1CBO A;  1H82 A;  2JK6 A;  4U8L A;  4U2L A;  4UP3 A;  2WDV A;  4UDP A;  5KMS A;  2XVI A;  5TR3 A;  4C5O A;  1D4D A;  1PJ6 A;  3LOV A;  3P4Q A;  1E39 A;  3KVE A;  3AB1 A;  3H8L A;  3UOY A;  2ZZ0 A;  1JRX A;  2BRA A;  3RP8 A;  2J3N A;  4H4W A;  3CPH G;  4TM3 A;  4FDC B;  2GAG B;  1N4U A;  2WOW A;  3EAO A;  4C74 A;  2V3A A;  4A5L A;  1NDA A;  3LZX A;  4N9X A;  3QFA A;  2XVE A;  1D4C A;  1GRB A;  1ZX9 A;  2GMH A;  3CPJ G;  2Y6R A;  2C75 A;  2VRL A;  1D4E A;  2EQ6 A;  1H83 A;  3OZ2 A;  3ALJ A;  4GRT A;  3KD9 A;  2WPE A;  4BJY A;  1PBD A;  3PVC A;  5KVH A;  2VQ7 A;  3DH9 A;  2GRT A;  3FG2 P;  1SEZ A;  1F3P A;  2B9W A;  4C77 A;  2YLX A;  2X50 A;  4YKF A;  1NEN A;  3IF9 A;  2JKC A;  1NHS A;  3PO7 A;  1PJ5 A;  2YM2 A;  3KA7 A;  4BK3 A;  4IVM B;  4CRT A;  2GQW A;  3AEF A;  1TDF A;  2Z5X A;  3DK9 A;  4IA6 A;  3UOX A;  3BHF A;  3QVR A;  3K7Q X;  2XVH A;  2FBW A;  5KMP A;  2UZZ A;  2XLS A;  2E4G A;  2WU5 A;  3T0K A;  1N4W A;  3CGB A;  1LPF A;  4U2S A;  1BGJ A;  1B8S A;  1TYT A;  5EOW A;  4AP1 A;  4EM3 A;  4ECH A;  2YLZ A;  5C3J A;  4NTD A;  4OPG A;  3CIR A;  4GUV A;  4AT0 A;  4ZCD A;  4U8N A;  2DKI A;  3NYE A;  3CND A;  4TM4 A;  3UCL A;  4U8O A;  1OJT A;  4K5S A;  2W0H A;  4YXD A;  5IPY A;  4A6N A;  1COY A;  1YY5 A;  3NT6 A;  1GER A;  4EMW A;  2A89 A;  2V3B A;  2H88 A;  3SY4 A;  3P4P A;  4YSH A;  4EQX A;  5HXI A;  1CC2 A;  4B1B A;  2GF3 A;  5KRQ A;  3AE6 A;  2R9Z A;  3DK4 A;  1QLB A;  4ICY A;  5IQ1 A;  1GEU A;  1JRZ A;  3G5R A;  4UDQ A;  4GAP A;  3SXI A;  4PAB A;  4Z2R A;  4X9N A;  5GSN A;  2BC1 A;  3UOV A;  4B67 A;  2R0C A;  2C3C A;  1H2I A;  4U2T A;  3NYF A;  1IUW A;  4B69 A;  2XFQ A;  3UKF A;  1KNR A;  1GRA A;  2WOI A;  2C66 A;  2C7G A;  3ABV A;  2V61 A;  4HB9 A;  3UP5 A;  2YM1 A;  1KSS A;  3UTE A;  1GAL A;  3SFE A;  1ELI A;  4YT0 A;  1KFY A;  5C2T A;  3JSK A;  4B63 A;  3T37 A;  2DKH A;  3ICR A;  1NHR A;  2BCP A;  3IHM A;  1S3E A;  3Q6J A;  2BS3 A;  5FS8 A;  3KU9 A;  2QAE A;  4XWR A;  4Z44 A;  2BK4 A;  1GPE A;  3GMC A;  1RYI A;  2RGO A;  1YKJ A;  1LQU A;  2BCG G;  5JRB A;  2IVE A;  3NN6 X;  4DGK A;  4A9W A;  3BHK A;  5U1O A;  5EBK A;  1NEK A;  4H4Z A;  1Y56 A;  4II3 A;  4UDR A;  2JAE A;  3OC4 A;  5KNL A;  1DOD A;  1MO9 A;  5JCN A;  2APG A;  4AOS A;  4G73 A;  4K8D A;  1E1N A;  1FCD A;  4YWO A;  2BA9 A;  2R46 A;  4A65 A;  4H4T A;  3KPF A;  3PS9 A;  4G74 A;  2WEU A;  4J33 A;  2C76 A;  3AE9 A;  2WU2 A;  1GES A;  3DJJ A;  2GAH B;  1MXT A;  4J57 A;  3NK0 X;  2V6O A;  3S61 A;  5KMR A;  3LJP A;  3AD8 B;  2ACZ A;  4KPR A;  1ZOY A;  3L8K A;  1LTX R;  1IJH A;  5BRT A;  1D7L A;  5EB5 A;  1S7M A;  2PYX A;  3T2Y A;  3O0H A;  2JBV A;  2WP5 A;  4DNA A;  3SZF A;  4Z2U A;  3F8R A;  3RHA A;  4I59 A;  3COX A;  2WES A;  3GRS A;  1PBE A;  5JCI A;  3LXD A;  1JRY A;  1NG3 A;  4TM0 A;  1PDH A;  1NHP A;  4NNJ A;  3H8I A;  3DGH A;  1CJ3 A;  3P4S A;  2BAC A;  3UOZ A;  4D04 A;  1BF3 A;  2YR4 A;  2GEW A;  3CPI G;  4YSY A;  1OJA A;  3NNE A;  2FJD A;  4H4S A;  4G9K A;  3VRD B;  1ZP0 A;  4C3X A;  1FEA A;  1CC6 A;  2BS4 A;  3BI2 A;  1JEH A;  1DJN A;  4JQ9 A;  3NYC A;  4TLX A;  3NN0 X;  5J7X A;  2C4C A;  3CN8 A;  1EBD A;  1GRH A;  4U8P A;  4EQW A;  3GRT A;  2C70 A;  4K22 A;  4K7Z A;  3DGZ A;  5L46 A;  5HY5 A;  3B6D A;  1GXF A;  5FS7 A;  2BAB A;  2YG3 A;  2CDU A;  1P2H A;  3CNP A;  1K4Q A;  3GYX A;  3NGC X;  4X4J A;  3BI5 A;  2YG6 A;  3ICT A;  3H4K A;  1NPX A;  1JNR A;  2GV8 A;  1M64 A;  2QCU A;  3AE3 A;  2VVM A;  3UTH A;  5FS6 A;  2C64 A;  3S5W A;  3FBS A;  1HYU A;  1D7Y A;  1YQZ A;  4MJW A;  3ZYX A;  1H7W A;  4B68 A;  4XWZ A;  3LB8 A;  4Z43 A;  2OLO A;  2GMJ A;  1OJD A;  1E1M A;  3IC9 A;  4H4Q A;  3M13 A;  1NHQ A;  4J34 A;  5JCK A;  4TLZ A;  1LQT A;  2OAM A;  4U8M A;  2CVJ A;  2WP6 A;  2A8X A;  3L5O A;  3C4N A;  3V76 A;  4A7A A;  3WE0 A;  1ZY8 A;  5JCM A;  4YTN A;  3GD3 A;  2XDO A;  3NTD A;  4OPD A;  1XHC A;  4U8J A;  2B7S A;  2OA1 A;  1TYP A;  2C73 A;  2YLR A;  4H4U A;  4EQS A;  4Y4L A;  2GH5 A;  2RAB A;  2GVC A;  1QO8 A;  4CCQ A;  1F8S A;  1RP0 A;  4YTM A;  2Q7V A;  4K5R A;  1L9C A;  3K7M X;  5KMQ A;  4APN A;  3AYL A;  3VQR A;  3BI4 A;  4Z25 A;  1KF6 A;  3ATQ A;  3AE5 A;  1ZDL A;  3L1R A;  3SFD A;  3GMB A;  3T31 A;  3VR9 A;  2BXR A;  3CTY A;  4Z2T A;  1VG0 A;  2X8C A;  2YVJ A;  1IUS A;  4DSH A;  2WP9 A;  4CNK A;  4GCM A;  1E1K A;  1M6I A;  4REK A;  3GYJ A;  3V3N A;  1OJC A;  4OPI A;  4NEV A;  1GET A;  1VG9 A;  2R4J A;  3HYX A;  1TRB A;  1YQ4 A;  3DME A;  3EF6 A;  3D1C A;  2FJA A;  2PHH A;  5KOW A;  1L0V A;  4ZN0 A;  3SZC A;  4E0V A;  4CNJ A;  3AD9 B;  3AE8 A;  1K0J A;  2WQY A;  2YWL A;  3E1T A;  3F8P A;  5ER0 A;  3I6D A;  5CKU A;  2RGJ A;  1S2Y A;  1XPQ A;  5HYM A;  3QJ4 A;  1VDC A;  4WCT A;  1KNP A;  3II4 A;  3CMM A;  5J60 A;  1P2E A;  3QSS A;  1DXL A;  2B76 A;  1NAA A;  1O95 A;  4GF7 A;  4GR1 A;  3QVP A;  1Q9I A;  3UKH A;  4CY6 A;  2ZZC A;  1B37 A;  2BXS A;  3NRN A;  1PJ7 A;  4XXG A;  2GB0 A;  2XLT A;  1FOH A;  4G6H A;  2GR0 A;  1CF3 A;  3GDP A;  1F8W A;  3QFB A;  3ADA B;  2AAQ A;  1RSG A;  3LAD A;  3AED A;  4NTC A;  4JNA A;  4JDR A;  1QJD A;  2WET A;  3UKQ A;  2XLP A;  4J31 A;  3M12 A;  4H2Q A;  1Y56 B;  5BUL A;  4BUR A;  3URH A;  4NEW A;  3NG7 X;  3PG6 A;  1VQW A;  2Q0L A;  3UKA A;  4AT2 A;  3NLC A;  3DK8 A;  4HA6 A;  3ALL A;  2Y6Q A;  3P1W A;  1FEC A;  1Q1R A;  1Y0P A;  2VVL G;  2EQ7 A;  5JCL A;  3IWA A;  2X8G A;  3AEG A;  2X99 A;  1K0L A;  2WPF A;  3DJD A;  1E6E A;  4RSL A;  3NTA A;  3SZ0 A;  2ZBW A;  1Q1W A;  1IUU A;  3GDN A;  4BK2 A;  3EAN A;  1GND A;  2WPC A;  4J2W A;  2XFU A;  3CGC A;  3VRA A;  4O5Q A;  1GV4 A;  2VZ2 A;  4FK1 A;  5DBJ A;  3VR8 A;  5LV9 A;  2WDR A;  4LA1 A;  3KLJ A;  3RED A;  2HQM A;  4H2N A;  1GSN A;  1GOS A;  1CL0 A;  1JNZ A;  4LII A;  1DOC A;  4P9S A;  4AOX A;  2C65 A;  2WS3 A;  3AEC A;  2E1M A;  3BNU A;  3FPZ A;  1VRQ B;  4M52 A;  2O9Z A;  3R9U A;  3NH3 X;  4X9M A;  2V5Z A;  4RG3 A;  4FX9 A;  4H50 A;  2R0G A;  1ONF A;  4YSZ A;  4OVI A;  3NHO X;  4JY2 A;  4A6N B;  2Q6U A;  1BWC A;  4PAA A;  4NZH A;  1DJQ A;  4GAV A;  3AEB A;  4U8K A;  2TPR A;  4IVO B;  3AYJ A;  3SX6 A;  2GQF A;  3AEE A;  4U8I A;  3NKS A;  4H4V A;  3ATR A;  1W4X A;  2F5Z A;  2YG7 A;  4ZCC A;  3VRB A;  5KOX A;  2RGH A;  4B64 A;  4H4X A;  1F6M A;  1PXA A;  3SM8 A;  2X3N A;  3IHG A;  1EL9 A;  1GRE A;  4Z24 A;  3AWI A;  3T2Z A;  1ZOV A;  4OPL A;  3G5S A;  2WOV A;  1GRF A;  4CCR A;  4H2P A;  2ARD A;  2BK3 A;  4Y4N A;  1KN0 A;  5HHF A;  2ZZB A;  1EL8 A;  2JB1 A;  1UKV G;  3NIX A;  1PBC A;  1S3B A;  4GDP A;  1S2Q A;  1CJ4 A;  3CGE A;  2B9Y A;  3I3L A;  2EQ8 A;  3Q9T A;  2JB3 A;  4JN9 A;  4B65 A;  2QA1 A;  4AP3 A;  3GYI A;  2VOU A;  3CNT A;  4YSX A;  4H4R A;  2AR8 A;  4IA5 A;  1GTH A;  2WDQ A;  4II2 A;  3CGD A;  1DOB A;  4GDE A;  1PHH A;  1JU2 A;  1TDN A;  1EL5 A;  3FIM B;  3LZW A;  1FL2 A;  3EPT A;  3V3O A;  2BYB A;  3M0O A;  1H6V A;  4K2X A;  2YG5 A;  2I0Z A;  1CHU A;  3D8X A;  1TDE A;  2OLN A;  3F8D A;  3RP7 A;  5KXJ A;  2IVD A;  2JB2 A;  3NK2 X;  2C72 A;  3RP6 A;  5EB4 A;  2YVG A;  2VRM A;  4J36 A;  4LU6 A;  1K0I A;  1GRG A;  3C96 A;  4KX6 A;  4TM1 A;  4C3Y A;  2WHD A;  4CBQ A;  2VVL A;  1B4V A;  1LV0 A;  3UTG A;  1ZMC A;  4ADW A;  2XLR A;  1N4V A;  4EMI A;  3SQP A;  3GSI A;  3UKL A;  4YTP A;  5KVI A;  2YLT A;  3ISH A;  4YKG A;  2GR3 A;  2YG4 A;  1DNC A;  4WX1 A;  4EQR A;  4BV6 A;  5KWF A;  3AE2 A;  2YVF A;  1V59 A;  5FS9 A;  2BK5 A;  3AD7 B;  1XDI A;  2R45 A;  2YQU A;  3KKJ A;  4BK1 A;  1BZL A;  2YR6 A;  2EQ9 A;  1IUT A;  4OPT A;  3GWD A;  3AE7 A;  1PXB A;  3B3R A;  2Q0K A;  3AE4 A;  1PBB A;  3GWF A;  1CJ2 A;  3CNS A;  2Z5Y A;  5U63 A;  2VQB A;  5M10 A;  3AE1 A;  1EL7 A;  2XVF A;  3ZDN A;  2X8H A;  4A79 A;  3UKP A;  3ITJ A;  5BVA A;  3HYV A;  1PBF A;  3QSE A;  2V60 A;  3SGL A;  2CUL A;  1YQ3 A;  3ALM A;  1OJ9 A;  1LJ1 A;  1PN0 A;  2E5V A;  3QSM A;  1AOG A;  4FK1 C;  1GTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...