1JEHA

Crystal structure of yeast e3, lipoamide dehydrogenase
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
478
structure length
478
Chain Sequence
TINKSHDVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGTCLNVGCIPSKALLNNSHLFHQMHTEAQKRGIDVNGDIKINVANFQKAKDDAVKQLTGGIELLFKKNKVTYYKGNGSFEDETKIRVTPVDGLEGTVKEDHILDVKNIIVATGSEVTPFPGIEIDEEKIVSSTGALSLKEIPKRLTIIGGGIIGLEMGSVYSRLGSKVTVVEFQPQIGASMDGEVAKATQKFLKKQGLDFKLSTKVISAKRNDDKNVVEIVVEDTKTNKQENLEAEVLLVAVGRRPYIAGLGAEKIGLEVDKRGRLVIDDQFNSKFPHIKVVGDVTFGPMLAHKAEEEGIAAVEMLKTGHGHVNYNNIPSVMYSHPEVAWVGKTEEQLKEAGIDYKIGKFPFAANSRAKTNQDTEGFVKILIDSKTERILGAHIIGPNAGEMIAEAGLALEYGASAEDVARVCHAHPTLSEAFKEANMAAYDKAIHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of eucaryotic E3, lipoamide dehydrogenase from yeast.
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords DIHYDROLIPOAMIDE DEHYDROGENASE
total genus 142
structure length 478
sequence length 478
chains with identical sequence B
ec nomenclature ec 1.8.1.4: Dihydrolipoyl dehydrogenase.
pdb deposition date 2001-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1jehA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jehA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jehA02
3P4QA 1FOHA 1GRBA 3AD7B 2WDRA 2A89A 1COYA 4DGKA 3T37A 1DOEA 2R0GA 1F3PA 3KU9A 4A5LA 2R9ZA 3GDPA 3CPJG 4Y4MA 4Z44A 1N4VA 3ITJA 2IVDA 1GETA 1GRAA 2WP6A 2XVIA 2YWLA 3PS9A 5EOWA 1E7PA 3V3OA 4AP3A 3CNTA 3WE0A 4BV6A 1Y56A 1CL0A 2VVMA 4ECHA 1MOKA 1GPEA 4Y4NA 3CGEA 3VR9A 2H89A 5ER0A 1Y0PA 3CIRA 3KKJA 3BNMA 1CC6A 1GOSA 3BHKA 2IVEA 3CNJA 3ISHA 1B8SA 3L8KA 1CF3A 1GSNA 3EAOA 1H83A 3AE6A 4ZCDA 4BK3A 4CNJA 1JU2A 5GSNA 2GEWA 4OPTA 3QFAA 4EQRA 1NHPA 2Q0LA 2EQ6A 1GRTA 1LV0A 1PBDA 1VG0A 3LOVA 1NG3A 3EPTA 4N9XA 4U2SA 5BUKA 5FS9A 5J7XA 3NYEA 3FG2P 2VZ2A 3BI2A 3LADA 4H4UA 3AXBA 2QA1A 2Y6QA 3P4RA 3QJ4A 2E4GA 2JK6A 3RNMA 5EB4A 3EF6A 4KX6A 2C65A 2W0HA 1IUSA 1ELIA 2C7GA 4APNA 2BK4A 4Z2UA 4YTNA 4WX1A 5U1OA 5JCMA 2C73A 1Y56B 3GYJA 3RP8A 2XVHA 4O5UA 2HQMA 1D7LA 4B68A 2GVCA 2XLUA 2WEUA 3BI5A 2JAEA 2XLPA 1PDHA 4AP1A 3R9UA 2FJEA 3QVPA 4H4WA 1GV4A 3NTDA 1ZY8A 2WOWA 3SFDA 2Y6RA 3AEEA 4B67A 3LB8A 3RHAA 4C77A 2X50A 2XFNA 1NG4A 1ZMDA 3ICRA 4OPCA 4J34A 3NYFA 3AD8B 2DKHA 1D4CA 2WETA 1D7YA 2FJDA 4KPRA 4FX9A 4DNAA 1CBOA 1CC2A 2VQBA 3NTAA 4BJYA 4ZN0A 4IVMB 4K8DA 4REKA 1JOAA 4DSGA 5KOXA 1DJNA 5U63A 2WDQA 5EB5A 3AEGA 1KDGA 2JB1A 2BXRA 1N4WA 1V59A 4H4QA 1KSUA 4HA6A 1DOBA 3SGLA 2GMHA 4H4ZA 4EIQA 2C3CA 2VRLA 1GERA 3NK2X 1RP0A 3OZ2A 2XFUA 3GSIA 5HXIA 2BCPA 1IUVA 3GRTA 3DK8A 5L46A 3Q6JA 3IF9A 1NAAA 1QLBA 1GRHA 1B37A 4GF7A 4YKFA 3UOYA 4OCGA 2CULA 3L1RA 2FJAA 3VQRA 1DODA 2ZZCA 3C4AA 3FPZA 4OPIA 1GNDA 2E1MA 4GR1A 1XHCA 1LTXR 1H82A 5U25A 2GF3A 3NRNA 2C72A 3CPIG 1GXFA 5M10A 4YWOA 1XPQA 1VQWA 3G5QA 4A6NB 4RG3A 5C2TA 4B65A 4OPLA 3I6DA 4J2WA 3DMEA 1N4UA 2YVGA 1H86A 3IWAA 2NVKX 4B69A 3UP5A 2E5VA 3AYLA 1S2QA 1GALA 2C64A 4H2PA 3C4NA 4JY2A 3UKPA 2EQ9A 2BC1A 4OVIA 2I0ZA 1NHRA 2OALA 3M13A 1LQUA 1ONFA 2PYXA 5KVHA 4D03A 4K22A 2XCGA 4GCMA 1K0IA 1B4VA 4C5OA 4TM0A 3DK9A 1TDOA 4MJWA 4B64A 2BXSA 3ZYXA 4U8PA 4TLXA 1PBBA 4J57A 2FBWA 5CKUA 3NIXA 2WU5A 3NYCA 4M52A 4BK1A 3DJEA 4J36A 3C96A 1OJAA 3NKSA 1JRZA 2VOUA 1BKWA 4GDEA 4NZHA 2AR8A 1EL9A 1RSGA 1KNPA 4H4SA 3M0OA 1FECA 1PXBA 4X9NA 1JNRA 1S2YA 4CBQA 4USQA 2YLSA 1K4QA 2V61A 4EM4A 5JCIA 4CCQA 4H4RA 4K7ZA 3AECA 4OPGA 4YSXA 1O95A 4JNAA 1BZLA 1UKVG 4H4VA 3F8DA 4YTPA 3AE4A 4A7AA 3I3LA 3H8IA 1NENA 4U8MA 3BI4A 1ZDLA 2XVFA 1O94A 2BK5A 4A99A 1DXLA 1S3EA 2H88A 1EL8A 5JCNA 3O0HA 3AE3A 2J3NA 2ZBWA 3GMCA 4H2RA 1M64A 1P2EA 4HB9A 3QSSA 2YG7A 4ADWA 1JRYA 4K5RA 2BC0A 4DSHA 2GR2A 3AEBA 1EBDA 2R46A 1CJ2A 1DJQA 2AAQA 4JNQA 1TDFA 3B3RA 1ZP0A 3UTGA 3AE8A 5KWFA 1OJCA 3SM8A 1NDAA 4UDRA 1IJHA 1M6IA 1KSSA 1PJ6A 2C67A 3D1CA 3AYJA 3DA1A 3NT6A 2GR0A 1EL5A 5IQ4A 4GUVA 4Z2TA 4EQXA 2AQJA 4YSHA 1F6MA 4TM3A 4Z43A 1D4EA 2GRTA 1NHSA 2V5ZA 3NHOX 4YSZA 3PO7A 4U8LA 1ZOYA 4U8JA 1REOA 4K5SA 4USRA 3OC4A 1VDCA 1XANA 2CDUA 1IUXA 1PBFA 4A79A 4H50A 2GQWA 4EMIA 1P2HA 2XVEA 2WP5A 2X8HA 5FMHA 1IUWA 5GRTA 5C3JA 3CGBA 2EQ7A 5FS7A 1H7XA 3GRSA 3NG7X 4JDRA 2CVJA 3UCLA 3ATQA 1QO8A 2RGHA 2TMDA 4JY3A 3UKLA 3AEAA 4H7UA 5JCKA 2B76A 4U2TA 5KVIA 1PHHA 4EQSA 2BCGG 2XLTA 3UKQA 1QJDA 3REDA 1OJDA 1YY5A 4I58A 5IPYA 4X9MA 3GD4A 1O5WA 1TDEA 3RP7A 4U2LA 1CC4A 3UKKA 2IIDA 2B7SA 3K7MX 4LU6A 4FDCB 2DKIA 3NGCX 3KA7A 3S5WA 2GAHB 3VRAA 3G5SA 2V3BA 2RGJA 2XFOA 4H2NA 2GR1A 2RABA 2JBVA 5TR3A 2CFYA 3KD9A 1N1PA 3P4SA 3NN6X 3PVCA 3UKFA 4ZCCA 3ZDNA 1LQTA 3E1TA 4LA1A 1E1LA 3FIMB 3NNEA 2UZZA 4YSYA 1FL2A 2ARDA 2C70A 1PJ7A 2C76A 2YLWA 3IHMA 1BGNA 3CTYA 4YKGA 1CHUA 3AD9B 3COXA 3V76A 5DBJA 1H84A 4NTCA 2ACZA 4X4JA 2YM2A 3P1WA 4EMJA 3UOZA 1GT8A 4D04A 3CPHG 5BRTA 1GTHA 4H4TA 1L9CA 2R4EA 2YG5A 2YR6A 3H8LA 4J33A 2YLRA 3AE1A 3UTHA 4TM1A 3UP4A 4JQ9A 1S3BA 1BGJA 2JB3A 2YG4A 5HHFA 3DJGX 3P4PA 4B66A 1BWCA 3II4A 4AT2A 3GYIA 2YVJA 2WPEA 3NK0X 2GMJA 4H4YA 1D4DA 3ABVA 1PBEA 2V6OA 2F5ZA 1ZKQA 1K0LA 1GRGA 2BS4A 4LIIA 4Z2RA 3RP6A 1GTEA 4AOSA 1LVLA 2XVJA 1HYUA 4GDPA 1Q1WA 1CJ4A 3H4KA 2A87A 3AE5A 2PHHA 4TM4A 1D5TA 3GMBA 2X8CA 3SQPA 1F8SA 2WP9A 3LXDA 1YQ3A 4Z24A 1K0JA 2YLXA 4I59A 1Q9IA 2VQ7A 1H7WA 4J56A 1PN0A 4IA5A 2BS3A 4U8NA 4YTMA 3UKHA 2GH5A 2Q6UA 1TYPA 5CQFA 2R0PA 1SEZA 2XYOA 2WU2A 1MO9A 4UDQA 1JRXA 2YG3A 2WBAA 1JEHA 4EM3A 2OAMA 1CJCA 2GQFA 2BS2A 1NPXA 4P9SA 4BJZA 3IHGA 1RYIA 2GR3A 2Z5XA 1VRQB 4BURA 3UOXA 3D8XA 4XWZA 3IC9A 2GV8A 3HZLA 3DK4A 5HYMA 3ICSA 5J60A 2V3AA 4OPDA 1L9DA 2OLNA 1E1NA 1GREA 2YLTA 4K2XA 4C74A 4CNKA 4FK1A 4JN9A 3DGHA 1AOGA 3JSKA 1PXAA 1PXCA 2BABA 2XDOA 1GEUA 1IUUA 3M12A 3QSMA 2APGA 3VR8A 5HY5A 2B7RA 4A9WA 5KOWA 3K7TA 3S61A 2BK3A 1Q1RA 4GRTA 3K30A 3P9UA 3GD3A 4AOXA 5M0ZA 1ZX9A 1E39A 3ALLA 4ICYA 1OJTA 3AE7A 5FS8A 3URHA 2WESA 4Y4LA 1LPFA 2QAEA 2YR5A 3ADAB 1YKJA 3DH9A 3AE9A 2YG6A 4PAAA 2VRMA 4NEWA 4C3XA 1JNZA 2B9YA 2C75A 1PS9A 1YQ4A 3QSEA 4U8OA 2Z5YA 1ZMCA 4FK1C 4BK2A 3ALMA 3DJDA 3UOVA 2OLOA 4CY6A 2C66A 2JKCA 3KLJA 1BF3A 4IV9A 3SFEA 3AEDA 2ZZBA 3LZWA 2WOVA 2WOIA 3DGZA 2WHDA 4WCTA 1NHQA 3F8RA 1OJ9A 1MXTA 4A65A 1VG9A 2OA1A 3NH3X 4E0VA 4O5QA 3VRBA 1FCDA 2WPCA 2BACA 3FMWA 4H2QA 1L0VA 3NLCA 2YQUA 1KF6A 2BYBA 4UDPA 3GWDA 4RSLA 2X8GA 3CN8A 3ICTA 1F8WA 5BULA 1E1KA 2XLRA 3AYIA 3B6DA 3CGDA 1IUTA 3UTFA 4YT0A 3BNUA 1FEAA 2XFQA 2C3DA 5EBKA 1KNRA 4B1BA 1TDNA 3AWIA 4EMWA 3CNPA 3ALJA 3CNDA 3UKAA 3GDNA 3LJPA 1ZK7A 4NEVA 2YR4A 4NTDA 1Z6LA 2JB2A 4B63A 1F8RA 2XFPA 2EQ8A 4U8IA 1FEBA 4AT0A 4TLZA 2QA2A 4J31A 2WDVA 4EQWA 2V60A 3BHFA 4U8KA 5KXJA 4CCRA 1NEKA 2B9XA 3K7QX 1H6VA 1B5QA 1KFYA 4CY8A 2YVFA 3F8PA 1GESA 1H81A 2R0CA 2GB0A 2YM1A 4CRTA 1DNCA 1W4XA 1ZOVA 2FJBA 3LZXA 4YXDA 4H4PA 2Q0KA 2X99A 4RG4A 2B9WA 4IA6A 1EL7A 3Q9TA 3QFBA 2QCUA 2BA9A 4H4XA 2GAGB 2RGOA 2NPXA 3QVRA 4XXGA 2WS3A 1PBCA 5LV9A 4EIPA 3AEFA 2ZZ0A 5FS6A 3V3NA 2XLSA 4Z26A 2X3NA 5BVAA 3NK1X 1X31B 1TRBA 4C3YA 2WPFA 5IQ1A 3ATRA 3CGCA 3VRDB 3EANA 4NTEA 2A8XA 2R4JA 2TPRA 5JCLA 1TDKA 3CNSA 1TYTA 4OPUA 1YQZA 3KVEA 3NN0X 3FBSA 2O9ZA 2VVLG 2YAUA 1E1MA 3AB1A 2R45A 2YLZA 1PJ5A 1DOCA 4IVOB 4UP3A 4A6NA 4Z25A 2VVLA 1L9EA 5KRQA 1CJ3A 2Q7VA 2WQYA 4PABA 4XWRA 3UTEA 1E6EA 1LJ1A 3GWFA 3KPFA 3G5RA 1XDIA 3AE2A 3DJJA 1GRFA
chains in the Genus database with same CATH superfamily
3P4QA 1FOHA 4E5TA 2QQ6A 1DOEA 1F3PA 3KU9A 3R25A 3GDPA 1N4VA 3STPA 2IVDA 1GRAA 5EOWA 1CL0A 1MOKA 4ROPA 5ER0A 1Y0PA 2OKTA 3CIRA 3BNMA 1CC6A 5BOEA 3BHKA 3CNJA 1CF3A 3MWCA 5GSNA 3QFAA 1NHPA 2Q0LA 2EQ6A 1VG0A 4U2SA 5J7XA 3NYEA 3GYXA 2VZ2A 5FJRA 3LADA 5ENLA 3EF6A 2W0HA 2C7GA 4APNA 2BK4A 4II3A 4Z2UA 4WX1A 4II2A 3GYJA 2XVHA 4O5UA 1D7LA 2GVCA 2ONEA 2WEUA 2OLAA 2XLPA 3QVPA 3KPKA 2WOWA 2Y6RA 3DFHA 3T6CA 1ZMDA 3ICRA 4OPCA 2DKHA 1CBOA 3NO1A 4REKA 5KOXA 2PTYA 4DYEA 2WDQA 3NVZB 1V59A 1N4WA 4HA6A 4H4ZA 1P48A 5L46A 1QLBA 4YKFA 4H83A 3C4AA 4FI4A 3FPZA 4GR1A 1H82A 3NRNA 2C72A 3CPIG 1GXFA 1XPQA 3I6DA 3DG3A 1N4UA 2YVGA 3H8AA 3IWAA 3EUB3 4DXKA 3C4NA 4G6GA 4D03A 4HNLA 2XCGA 4GCMA 3FV9A 4E4UA 4U8PA 2OQYA 4TLXA 4M52A 4BK1A 4GFIA 1EL9A 4GYPC 1KNPA 4H4SA 1FECA 4OPGA 1O95A 4JNAA 2XH7A 4YTPA 4A7AA 3H8IA 1NENA 2PSNA 3T0KA 1F9CA 2PP1A 3CMMA 3Q4DA 1M64A 4K5RA 4ADWA 1JRYA 3AEBA 2R46A 3AMZA 1NDAA 3T8QA 1IJHA 4UDRA 1M6IA 3GD6A 3AYJA 2GGHA 4EQXA 3VC5A 3PO7A 4K5SA 4USRA 1IUXA 2PTXA 4H50A 2GQWA 2PGEA 5FMHA 3HW2A 5FS7A 3NG7X 2CVJA 3UCLA 2RGHA 2TMDA 4G7FA 3MSYA 2P8BA 3UKLA 5JCKA 2B76A 4U2TA 3FYYA 1QJDA 1YY5A 3A7AA 5IPYA 3GD4A 1TDEA 4MGGA 3SZCA 2DKIA 1YEYA 3KA7A 2V3BA 3KD9A 1FHUA 3NN6X 2XH4A 3QPEA 4LA1A 4HCHA 2QJJA 1ECQA 3ZVHA 1PJ7A 1H84A 4X4JA 1GT8A 1L9CA 3OZMA 3MQTA 3UJ2A 2BRAA 3JZUA 1WUEA 3HYWA 3PWGA 2YVJA 1TKKA 3ABVA 2V6OA 1N5WC 4G73A 1ZKQA 4Z2RA 3RP6A 1LVLA 2OFJA 5J04A 1Q1WA 1CJ4A 5KMSA 2PHHA 3GMBA 2GGEA 3SQPA 1F8SA 3LXDA 1KCZA 1YQ3A 4Z24A 5CQFA 3SN0A 3TWBA 2R0PA 4UDQA 4EM3A 2OAMA 4P9SA 2BS2A 1NPXA 1N60C 2PPGA 2GR3A 2W3RA 2W54A 2GV8A 1JCTA 3ICSA 5HYMA 4ZA0A 5J60A 3MZNA 3CAWA 1L9DA 2OZ3A 3T4WA 1PXAA 1PXCA 1GEUA 4GIRA 2B7RA 2BK3A 4AOXA 4GRTA 1ZX9A 4TVYA 4ICYA 2QAEA 2RDXA 4C3XA 2XH0A 2Z5YA 3DJDA 2C66A 3CB3A 3F8RA 4JN8A 1MXTA 1VG9A 3H12A 3R07C 1JPMA 2YQUA 2BYBA 4UDPA 2X8GA 3GY1A 4YT0A 1FEAA 2C3DA 1KNRA 4B1BA 3CXBA 4EMWA 3ALJA 3DDMA 3N4EA 4NEVA 2YR4A 4B63A 2XFPA 2EQ8A 3TW9A 2MUCA 4HPNA 4EQWA 2V60A 4H1ZA 3PG6A 1H6VA 1B5QA 2DW7A 2GSHA 4CY8A 2YVFA 3QKEA 2YM1A 4CRTA 1ZOVA 3ES7A 3ZVHB 3LZXA 4H4PA 2AKMA 2Q0KA 4RG4A 1EL7A 3Q9TA 3QFBA 3HRDC 1PBCA 4EIPA 3K1GA 1X2HA 5BVAA 1X31B 3IJLA 2TPRA 1TDKA 3CNSA 4OPUA 2OX4A 2YAUA 1E1MA 1DTNA 2YLZA 1DOCA 4ZCWA 3Q45A 2WQYA 4XWRA 2AKZA 1LJ1A 1H2IA 1E9IA 1GRBA 2WDRA 4DX3A 3DG7A 4IL2A 5FJUA 3P0WA 2R0GA 4H19A 2R9ZA 1JDFA 3ITJA 2PCEA 3NVYB 2XVIA 3PS9A 1VQZA 3V3OA 3NFUA 3RRAA 4HYRA 3D9XA 1B8SA 3EAOA 3SR6B 4BK3A 4CNJA 4EQRA 1N5XA 1LV0A 3LOVA 1NG3A 5BUKA 3GO2A 2GDQA 1SJDA 3P4RA 3RGTA 2E4GA 1BKHA 4IT1A 2C65A 2C73A 3RP8A 4TVWA 1Y56B 2HQMA 3BI5A 1PDHA 2FJEA 4H4WA 1GV4A 3SFDA 3AEEA 2X50A 2XFNA 3NYFA 3AD8B 3VC6A 1D7YA 2FJDA 3P3BA 4GAPA 4BJYA 3SY4A 1N63C 3PWIA 1DJNA 2E5AA 5EB5A 2GGIA 3AEGA 2BXRA 1KSUA 4E4FA 3SGLA 1DOBA 4EIQA 4G8TA 1V97A 2XFUA 3GRTA 3Q6JA 3IF9A 1NAAA 1GRHA 3UOYA 3OTRA 3VQRA 2ZZCA 4KPLA 5M10A 4RG3A 4B65A 4OPLA 4J2WA 1H86A 4IP5A 3NZGA 3UP5A 3AYLA 1S2QA 4H2PA 2QJMA 2EQ9A 3M13A 1LQUA 3VCCA 2PYXA 1ELSA 4TM0A 2QDEA 1TDOA 4HCLA 4A6GA 3IK4A 3NIXA 4IHCA 4J36A 3C96A 3UJFA 4GDEA 1JRZA 4NZHA 2GGGA 2AR8A 3R1ZA 1RSGA 3FCPA 4CBQA 4H4RA 1RVKA 4K7ZA 3AECA 4J1OA 4H4VA 1O94A 1DXLA 4GGBA 2W3SA 1EL8A 5JCNA 2FKPA 3O0HA 3OW1A 3GMCA 4GMEA 3QSSA 1EBDA 1DJQA 3UTGA 1TDFA 3B3RA 5KMQA 1KSSA 1PJ6A 2C67A 3D1CA 3TJ4A 1EL5A 1WYGA 2AQJA 2GRTA 3L5OA 2V5ZA 4J3ZA 4U8LA 4U8JA 3AM9A 1REOA 2E3TA 1XANA 2CDUA 2X8HA 1XS2A 3GRSA 1QO8A 4JY3A 4H7UA 4HNCA 1PHHA 4GYPA 2AL1A 3REDA 1OJDA 4I58A 4X9MA 1CC4A 3P93A 2IIDA 2XH2A 2B7SA 4LU6A 3R11A 3S5WA 3VRAA 4H2NA 2CFYA 3ZDNA 2P3ZA 3BSMA 2OPJA 3E1TA 1E1LA 3NNEA 4YSYA 1FL2A 2ARDA 2C76A 3TTEA 1BGNA 4NTCA 3S5SA 2QGYA 2ACZA 2YM2A 3UOZA 4D04A 2YG5A 3H8LA 3FJ4A 3AE1A 3UTHA 3DEQA 1EC8A 1S3BA 1BGJA 2YG4A 5HHFA 4B66A 1X2GA 4H4YA 3IJQA 1N61C 4LIIA 4YWSA 3DG6A 3MUCA 3H4KA 4G9KA 3AE5A 2WP9A 2PTZA 1Q9IA 2VQ7A 3SN4A 1H7WA 4J56A 1PN0A 4IA5A 4U8NA 3UKHA 2Q6UA 2YG3A 1CJCA 4BJZA 3UOXA 1RYIA 1VRQB 4BURA 4XWZA 3IC9A 3HZLA 2V3AA 4K2XA 4CNKA 4JN9A 3DGHA 1AOGA 3QSMA 5HY5A 3ALLA 1E39A 3AE7A 1KN0A 3R0KA 2YR5A 1YKJA 3DESA 3AE9A 2YG6A 1ZMCA 3ALMA 3UXKA 2JKCA 3KLJA 2WOVA 3IJIA 3CYJA 2WHDA 1VDVA 4WCTA 1NHQA 4A65A 4E0VA 3NH3X 3VRBA 3H70A 3FMWA 1FFVC 2GL5A 1L0VA 1KF6A 3CN8A 5BULA 3B6DA 2HXTA 3CGDA 4MMWA 3BNUA 3UJSA 1FEBA 4TLZA 4J31A 5KXJA 4U8KA 1NEKA 5JRBA 1PDYA 2R0CA 3HYVA 3ZLGA 4EWJA 2B9WA 2PP0A 4IA6A 4XXGA 4JHMA 3AEFA 2ZZ0A 5G5GB 4Z26A 2PTWA 2X3NA 4C3YA 2WPFA 5IQ1A 3VRDB 4NTEA 2A8XA 5JCLA 1TYTA 1YQZA 5FJTA 4KT2A 3FBSA 2O9ZA 4IZGA 2R45A 4UP3A 4A6NA 4Z25A 3EKGA 1CJ3A 4PABA 3G5RA 3DJJA 2HXUA 1S7MA 3V5CA 2A89A 4GGHA 2OQHA 1NU5A 3CPJG 2WP6A 2YWLA 3ES8A 3I4KA 1E7PA 4AP3A 3CNTA 4BV6A 3ENLA 2VVMA 4ECHA 4Y4NA 3CGEA 3VR9A 2H89A 3KKJA 1GOSA 3TQPA 3ZLFA 2IVEA 3L8KA 1H83A 2GEWA 4OPTA 1GRTA 3EPTA 5FS9A 3BI2A 3VFCA 3EEZA 2QA1A 2Y6QA 3QJ4A 3D47A 4KX6A 1IUSA 3SZFA 3DGBA 4KWSA 2JAEA 4X2PA 3THUA 4M0XA 1ZY8A 1MRAA 4C77A 3SSZA 3TCSA 4HN8A 3CT2A 4KPRA 4FX9A 4DNAA 4ZN0A 4K8DA 1EBHA 3GC2A 3N6HA 1KDGA 1GERA 1RP0A 3OZ2A 3GSIA 5HXIA 3I6TA 4GF7A 1B37A 3JW7A 2P88A 4OCGA 3L1RA 2FJAA 4OPIA 1GNDA 2E1MA 1KD0A 5U25A 4DN1A 4A6NB 3DMEA 1PDZA 4B69A 4G74A 3V4BA 1GALA 3UKPA 3BOXA 2BC1A 4OVIA 5KMRA 1NHRA 3S47A 2GGJA 1N62C 1ONFA 3UJEA 5G5HB 4C5OA 1K0IA 3DK9A 3ZLHA 2BXSA 3ZYXA 5FJOA 1PBBA 4J57A 2FBWA 4KEMA 3NYCA 3DJEA 3NKSA 2VOUA 3R10A 3M0OA 1JNRA 4USQA 2YLSA 5JCIA 3AE4A 3I3LA 4U8MA 2BK5A 1TZZA 3SX6A 4ENLA 3A7RA 3D46A 2ZBWA 3T2KA 3MKCA 4H2RA 4HB9A 1P2EA 2W55A 2QJNA 2GR2A 1CJ2A 4JNQA 2AAQA 3V3WA 3SM8A 3OPSA 4Z17A 3MY9A 4H2HA 5IQ4A 4YSHA 1F6MA 4Z43A 1D4EA 1NHSA 3NHOX 3OC4A 1PBFA 3OZYA 1P2HA 4EMIA 2XVEA 1IUWA 2AL2B 1H7XA 2PS2A 2NQLA 4GAVA 2PU1A 3DFYA 5KVIA 4EQSA 3UKQA 3T2ZA 7ENLA 1O5WA 3UKKA 3RP7A 4U2LA 3SXIA 4FDCB 3B97A 3U4FA 2POZA 2RGJA 2JBVA 3PFRA 3UGVA 3PVCA 4ZCCA 3FIMB 2UZZA 2I5QA 1EBGA 2C70A 3IHMA 3CTYA 1CHUA 3COXA 3CPHG 5BRTA 1GTHA 4H4TA 1JROA 3NS1B 4J33A 4TM1A 3UP4A 4G6HA 4JQ9A 3T31A 4Z1YA 3QLDA 3OP2A 2JB3A 3DJGX 3P4PA 4AT2A 2WPEA 3SN1A 3NK0X 2PODA 2F5ZA 1K0LA 1KKRA 1GTEA 2XVJA 1HYUA 4GDPA 2X8CA 4YTMA 2GH5A 1SEZA 2XYOA 1MO9A 2WBAA 1JEHA 2MNRA 2GQFA 1SJAA 3IHGA 4ZOHB 3D8XA 4OPDA 2OLNA 1GREA 4C74A 1JRPA 4FK1A 3JSKA 5BOFA 2BABA 2XDOA 3VR8A 4A9WA 1NELA 4K2SA 5M0ZA 3ETRB 3URHA 1LPFA 3ADAB 4PAAA 1JNZA 2B9YA 3QSEA 4FK1C 4BK2A 4E6MA 4E8GA 1MUCA 3B9JB 4A35A 3SFEA 1BF3A 4IV9A 3AEDA 2ZZBA 3LZWA 2OZTA 1FO4A 1KKOA 2OG9A 2OA1A 4O5QA 4H2QA 1STZA 3GWDA 1W6TA 4RSLA 3ICTA 1E1KA 1MDRA 6ENLA 3UCDA 1IUTA 1P43A 2OZ8A 1TDNA 3AWIA 3CNPA 3CNDA 2O56A 3GDNA 1ZK7A 2JB2A 1F8RA 4U8IA 1BQGA 3FXGA 2QVHA 3T2YA 1GESA 4IP4A 5KMPA 3QTPA 3SZWA 1W4XA 2FJBA 2X99A 2QCUA 2BA9A 2GAGB 2RGOA 3PK7A 3CK5A 3QVRA 3NVVB 5LV9A 5FS6A 1EC9A 2C4CA 3NK1X 3NVWB 3EANA 1XPYA 3KVEA 3NN0X 1FIQB 2VVLA 5KRQA 2Q7VA 3UTEA 1E6EA 3GWFA 1XDIA 3H7VA 3AD7B 1COYA 4DGKA 3T37A 4A5LA 4Y4MA 4Z44A 1GETA 3WE0A 1Y56A 1GPEA 3ISHA 3AE6A 1GSNA 4ZCDA 1JU2A 1MNSA 3V5FA 1PBDA 4N9XA 3FG2P 3ZVIA 4H4UA 3AXBA 5KNLA 2JK6A 3RNMA 5EB4A 3T9PA 3BJSA 1ELIA 4YTNA 5U1OA 5JCMA 1R6WA 3QN3A 4B68A 2XLUA 4AP1A 3R9UA 3NTDA 4B67A 3LB8A 1WUFA 3RHAA 1NG4A 4J34A 1D4CA 2WETA 2VQBA 1CC2A 3NTAA 4IVMB 1IYXA 1JOAA 4DSGA 5U63A 2JB1A 4H4QA 2BRYA 2GMHA 2C3CA 2VRLA 3NK2X 1JPDX 3SZ0A 2BCPA 4HCDA 1IUVA 3DK8A 2HZGA 3TOYA 2CULA 1DODA 1XHCA 1OEPA 1LTXR 2GF3A 4MKSA 4YWOA 1VQWA 3G5QA 5C2TA 2PP3A 2NVKX 1FFUC 2E5VA 2C64A 4JY2A 2I0ZA 2OALA 5KVHA 4K22A 1B4VA 4MJWA 4B64A 5CKUA 2WU5A 1OJAA 1BKWA 2XGZA 1RM6B 4K8GA 1PXBA 4X9NA 1S2YA 1K4QA 2ZADA 4EM4A 2V61A 4CCQA 4YSXA 1BZLA 1UKVG 3F8DA 4GISA 4IL0A 3BI4A 1ZDLA 2XVFA 4A99A 1S3EA 2H88A 3SJNA 3AE3A 2J3NA 1ONEA 3VA8A 2YG7A 4DSHA 2BC0A 1ZP0A 5KWFA 3AE8A 1OJCA 3HPFA 3DA1A 2XSXA 3NT6A 2GR0A 4GUVA 4Z2TA 4TM3A 4YSZA 1ZOYA 1VDCA 4A79A 3RCYA 2WP5A 5GRTA 3DERA 3CGBA 2EQ7A 5C3JA 3SBFA 4JDRA 3ATQA 3AEAA 2PU0A 3KUMA 2BCGG 2XLTA 1ZXIC 3K7MX 5EU9A 3NGCX 2GAHB 3G5SA 2XFOA 2GR1A 2RABA 3P4SA 5TR3A 1N1PA 4DHGA 3UKFA 1LQTA 2P0IA 2QDDA 4YKGA 2YLWA 3AD9B 3V76A 5DBJA 4M6UA 3P1WA 2CHRA 4EMJA 2YR6A 2R4EA 2YLRA 1MDLA 2FYMA 1BWCA 3II4A 3GYIA 2GMJA 1D4DA 1PBEA 3TJIA 2BS4A 1GRGA 4AOSA 2A87A 3N6JA 4TM4A 1D5TA 1SB3B 3I6EA 2OO6A 1K0JA 2YLXA 4I59A 4JN7A 3JVAA 3TWAA 2BS3A 1TYPA 2WU2A 3VCNA 1JRXA 4NNJA 3A7UA 2HNEA 2Z5XA 3U9IA 3DK4A 2PGWA 1E1NA 2YLTA 3M12A 1EC7A 1IUUA 3SYIA 2APGA 5KOWA 3K7TA 3S61A 1Q1RA 3K30A 3P9UA 3GD3A 3DIPA 1FHVA 1R0MA 1OJTA 5FS8A 2WESA 4Y4LA 2OVLA 3NRZB 1SJCA 3T14A 3DH9A 1TE6A 2VRMA 4NEWA 2C75A 1PS9A 1YQ4A 4U8OA 2AL2A 1SJBA 3UOVA 2OLOA 4CY6A 3AN1A 2WOIA 1T3QC 3DGZA 3CXOA 3UJRA 1OJ9A 2ZC8A 1L8PA 2WPCA 1FCDA 2BACA 3NLCA 4F4RA 1F8WA 5FJPA 3N4FA 2XLRA 3AYIA 3RO6A 3UTFA 2XFQA 5EBKA 3UKAA 3NXLA 3LJPA 4NTDA 2P8CA 4A3RA 1Z6LA 2DW6A 4AT0A 3RR1A 2QA2A 3SQSA 3UXLA 2WDVA 3BHFA 4CCRA 2B9XA 3K7QX 1KFYA 3F8PA 4DWDA 1H81A 2GB0A 1DNCA 2PMQA 4FP1A 4YXDA 4H4XA 3RITA 2NPXA 4K1WA 2WS3A 3V3NA 2XLSA 4NWZA 1TRBA 3UCCA 3ATRA 3VDGA 3CGCA 3R0UA 2R4JA 2VVLG 3AB1A 1PJ5A 4IVOB 5IDZA 1L9EA 3HYXA 2PA6A 3KPFA 3FVDA 3AE2A 1GRFA
chains in the Genus database with same CATH topology
3P4QA 1FOHA 1GRBA 1S7MA 3AD7B 2WDRA 2A89A 1COYA 4DGKA 3T37A 1DOEA 2R0GA 1F3PA 3KU9A 4A5LA 2R9ZA 3GDPA 3CPJG 4Y4MA 4Z44A 1N4VA 3ITJA 2IVDA 1GETA 1GRAA 2WP6A 2XVIA 2YWLA 3PS9A 5EOWA 1E7PA 3V3OA 4AP3A 3CNTA 3WE0A 4BV6A 1Y56A 1CL0A 2VVMA 4ECHA 1MOKA 1GPEA 4Y4NA 3CGEA 3VR9A 2H89A 5ER0A 1Y0PA 3CIRA 3KKJA 3BNMA 1CC6A 1GOSA 3BHKA 2IVEA 3D9XA 3CNJA 3ISHA 1B8SA 3L8KA 1CF3A 1GSNA 3EAOA 1H83A 3AE6A 4ZCDA 4BK3A 4CNJA 1JU2A 5GSNA 2GEWA 4OPTA 3QFAA 4EQRA 1NHPA 2Q0LA 2EQ6A 1GRTA 1LV0A 1PBDA 1VG0A 3LOVA 1NG3A 3EPTA 4N9XA 4U2SA 5BUKA 5FS9A 5J7XA 3NYEA 3FG2P 3GYXA 2VZ2A 3BI2A 3LADA 4H4UA 3AXBA 2QA1A 2Y6QA 3P4RA 3QJ4A 5KNLA 2E4GA 2JK6A 3RNMA 5EB4A 3EF6A 4KX6A 2C65A 2W0HA 1IUSA 1ELIA 2C7GA 3SZFA 4APNA 2BK4A 4II3A 4Z2UA 4YTNA 4WX1A 5U1OA 5JCMA 2C73A 1Y56B 3GYJA 4II2A 2XVHA 4O5UA 2HQMA 1D7LA 3RP8A 4B68A 2GVCA 2XLUA 2WEUA 3BI5A 2JAEA 2XLPA 1PDHA 4AP1A 3R9UA 2FJEA 3QVPA 4H4WA 1GV4A 3KPKA 3NTDA 1ZY8A 2WOWA 3SFDA 2Y6RA 3AEEA 4B67A 3LB8A 3RHAA 4C77A 2X50A 2XFNA 1NG4A 1ZMDA 3ICRA 4OPCA 4J34A 3NYFA 3AD8B 2DKHA 1D4CA 2WETA 1D7YA 2FJDA 4KPRA 4FX9A 4DNAA 1CBOA 1CC2A 2VQBA 3NTAA 4GAPA 4BJYA 4ZN0A 4IVMB 4K8DA 4REKA 3SY4A 1JOAA 4DSGA 5KOXA 1DJNA 5U63A 2WDQA 5EB5A 3AEGA 1KDGA 2JB1A 2BXRA 1N4WA 1V59A 4H4QA 2BRYA 1KSUA 4HA6A 1DOBA 3SGLA 2GMHA 4H4ZA 4EIQA 2C3CA 2VRLA 1GERA 3NK2X 1RP0A 3OZ2A 2XFUA 3GSIA 5HXIA 3SZ0A 2BCPA 1IUVA 3GRTA 3DK8A 5L46A 3Q6JA 3IF9A 1NAAA 1QLBA 1GRHA 1B37A 4GF7A 4YKFA 3UOYA 4OCGA 2CULA 3L1RA 2FJAA 3VQRA 1DODA 2ZZCA 3C4AA 3FPZA 4OPIA 1GNDA 2E1MA 4GR1A 1XHCA 1LTXR 1H82A 5U25A 2GF3A 3NRNA 2C72A 3CPIG 1GXFA 5M10A 4YWOA 1XPQA 1VQWA 3G5QA 4A6NB 4RG3A 5C2TA 4B65A 4OPLA 3I6DA 4J2WA 3DMEA 1N4UA 2YVGA 1H86A 3IWAA 2NVKX 4B69A 3UP5A 4G74A 2E5VA 3AYLA 1S2QA 1GALA 2C64A 4H2PA 3C4NA 4JY2A 3UKPA 2EQ9A 2BC1A 4OVIA 5KMRA 2I0ZA 1NHRA 2OALA 3M13A 1LQUA 1ONFA 2PYXA 4G6GA 5KVHA 4D03A 4K22A 2XCGA 4GCMA 1K0IA 1B4VA 4C5OA 4TM0A 3DK9A 1TDOA 4MJWA 4B64A 2BXSA 3ZYXA 4U8PA 4TLXA 1PBBA 4J57A 2FBWA 5CKUA 3NIXA 2WU5A 3NYCA 4M52A 4BK1A 3DJEA 4J36A 3C96A 1OJAA 3NKSA 1JRZA 2VOUA 1BKWA 4GDEA 4NZHA 2AR8A 1EL9A 1RSGA 1KNPA 4H4SA 3M0OA 1FECA 1PXBA 4X9NA 1JNRA 1S2YA 4CBQA 4USQA 2YLSA 1K4QA 2V61A 4EM4A 5JCIA 4CCQA 4H4RA 4K7ZA 3AECA 4OPGA 4YSXA 1O95A 4JNAA 1BZLA 1UKVG 4H4VA 3F8DA 4YTPA 3AE4A 4A7AA 3I3LA 3H8IA 1NENA 4U8MA 3BI4A 1ZDLA 2XVFA 1O94A 2BK5A 3T0KA 4A99A 1DXLA 1S3EA 3SX6A 2H88A 1EL8A 5JCNA 3CMMA 3O0HA 3AE3A 2J3NA 2ZBWA 3T2KA 3GMCA 4H2RA 1M64A 1P2EA 4HB9A 3QSSA 2YG7A 4ADWA 1JRYA 4K5RA 2BC0A 4DSHA 2GR2A 3AEBA 1EBDA 2R46A 1CJ2A 1DJQA 2AAQA 4JNQA 1TDFA 3B3RA 1ZP0A 5KMQA 3AE8A 3UTGA 1OJCA 3SM8A 5KWFA 1NDAA 4UDRA 1IJHA 1M6IA 1KSSA 1PJ6A 2C67A 3D1CA 3AYJA 3DA1A 3NT6A 2GR0A 1EL5A 5IQ4A 4GUVA 4Z2TA 4EQXA 2AQJA 4YSHA 1F6MA 4TM3A 4Z43A 1D4EA 2GRTA 1NHSA 3L5OA 2V5ZA 3NHOX 4YSZA 3PO7A 4U8LA 1ZOYA 4U8JA 1REOA 4K5SA 4USRA 3OC4A 1VDCA 1XANA 2CDUA 1IUXA 1PBFA 4A79A 4H50A 2GQWA 4EMIA 1P2HA 2XVEA 2WP5A 2X8HA 5FMHA 1IUWA 5GRTA 5C3JA 3CGBA 2EQ7A 5FS7A 1H7XA 3GRSA 3NG7X 4JDRA 2CVJA 3UCLA 3ATQA 1QO8A 2RGHA 2TMDA 4JY3A 4GAVA 3AEAA 3UKLA 4H7UA 5JCKA 2B76A 4U2TA 5KVIA 1PHHA 4EQSA 2BCGG 2XLTA 3UKQA 1QJDA 3T2ZA 3REDA 1OJDA 1YY5A 4I58A 5IPYA 4X9MA 3GD4A 1O5WA 1TDEA 3RP7A 4U2LA 1CC4A 3UKKA 3SXIA 2IIDA 2B7SA 3K7MX 4LU6A 4FDCB 3SZCA 2DKIA 3NGCX 3KA7A 3S5WA 2GAHB 3VRAA 3G5SA 2V3BA 2RGJA 2XFOA 4H2NA 2GR1A 2RABA 2JBVA 5TR3A 2CFYA 3KD9A 1N1PA 3P4SA 3NN6X 3PVCA 3UKFA 4ZCCA 3ZDNA 1LQTA 3E1TA 4LA1A 1E1LA 3FIMB 3NNEA 2UZZA 4YSYA 1FL2A 2ARDA 2C70A 1PJ7A 2C76A 2YLWA 3IHMA 1BGNA 3CTYA 4YKGA 1CHUA 3AD9B 3COXA 3V76A 5DBJA 1H84A 4NTCA 2ACZA 4X4JA 2YM2A 3P1WA 4EMJA 3UOZA 1GT8A 4D04A 3CPHG 5BRTA 1GTHA 4H4TA 1L9CA 2R4EA 2YG5A 2YR6A 3H8LA 4J33A 2YLRA 3AE1A 3UTHA 4TM1A 3UP4A 4G6HA 4JQ9A 1S3BA 3T31A 2BRAA 1BGJA 2JB3A 2YG4A 5HHFA 3DJGX 3HYWA 3P4PA 4B66A 1BWCA 3II4A 4AT2A 3GYIA 2YVJA 2WPEA 3NK0X 2GMJA 4H4YA 1D4DA 3ABVA 1PBEA 2V6OA 2F5ZA 4G73A 1ZKQA 1K0LA 1GRGA 2BS4A 4LIIA 4Z2RA 3RP6A 1GTEA 4AOSA 1LVLA 2XVJA 1HYUA 4GDPA 1Q1WA 1CJ4A 3H4KA 4G9KA 5KMSA 2A87A 3AE5A 2PHHA 4TM4A 1D5TA 3GMBA 2X8CA 3SQPA 1F8SA 2WP9A 3LXDA 1YQ3A 4Z24A 1K0JA 2YLXA 4I59A 1Q9IA 2VQ7A 1H7WA 4J56A 1PN0A 4IA5A 2BS3A 4U8NA 4YTMA 3UKHA 2GH5A 2Q6UA 1TYPA 5CQFA 2R0PA 1SEZA 2XYOA 2WU2A 1MO9A 4UDQA 1JRXA 2YG3A 2WBAA 1JEHA 4EM3A 2OAMA 4NNJA 1CJCA 2GQFA 2BS2A 1NPXA 4P9SA 4BJZA 3IHGA 1RYIA 2GR3A 2Z5XA 1VRQB 4BURA 3UOXA 3D8XA 4XWZA 3IC9A 2GV8A 3HZLA 3DK4A 5HYMA 3ICSA 5J60A 2V3AA 4OPDA 1L9DA 2OLNA 1E1NA 1GREA 2YLTA 4K2XA 4C74A 4CNKA 4FK1A 4JN9A 3DGHA 1AOGA 3JSKA 1PXAA 1PXCA 2BABA 2XDOA 1GEUA 1IUUA 3M12A 3QSMA 2APGA 3SYIA 3VR8A 5HY5A 2B7RA 4A9WA 5KOWA 3K7TA 3S61A 2BK3A 1Q1RA 4GRTA 3K30A 3P9UA 3GD3A 4AOXA 5M0ZA 1ZX9A 1E39A 3ALLA 4ICYA 1OJTA 3AE7A 5FS8A 3URHA 1KN0A 2WESA 4Y4LA 1LPFA 2QAEA 2YR5A 3ADAB 1YKJA 3T14A 3DH9A 3AE9A 2YG6A 4PAAA 2VRMA 4NEWA 4C3XA 1JNZA 2B9YA 2C75A 1PS9A 1YQ4A 3QSEA 4U8OA 2Z5YA 1ZMCA 4FK1C 4BK2A 3ALMA 3DJDA 3UOVA 2OLOA 4CY6A 2C66A 2JKCA 3KLJA 1BF3A 4IV9A 3SFEA 3AEDA 2ZZBA 3LZWA 2WOVA 2WOIA 3DGZA 2WHDA 4WCTA 1NHQA 3F8RA 1OJ9A 1MXTA 4A65A 1VG9A 2OA1A 3NH3X 4E0VA 4O5QA 3VRBA 1FCDA 2WPCA 2BACA 3FMWA 4H2QA 1L0VA 3NLCA 2YQUA 1KF6A 2BYBA 4UDPA 3GWDA 4RSLA 2X8GA 3CN8A 3ICTA 1F8WA 5BULA 1E1KA 2XLRA 3AYIA 3B6DA 3CGDA 1IUTA 3UTFA 4YT0A 3BNUA 1FEAA 2XFQA 2C3DA 5EBKA 1KNRA 4B1BA 1TDNA 3AWIA 4EMWA 3CNPA 3ALJA 3CNDA 3UKAA 3GDNA 3LJPA 1ZK7A 4NEVA 2YR4A 4NTDA 1Z6LA 2JB2A 4B63A 1F8RA 2XFPA 2EQ8A 4U8IA 1FEBA 4AT0A 4TLZA 2QA2A 4J31A 2WDVA 4EQWA 2V60A 3BHFA 4U8KA 5KXJA 4CCRA 1NEKA 2B9XA 3PG6A 5JRBA 3K7QX 1H6VA 1B5QA 1KFYA 4CY8A 2YVFA 3F8PA 3T2YA 1GESA 1H81A 5KMPA 2R0CA 2GB0A 2YM1A 3SZWA 4CRTA 1DNCA 1W4XA 1ZOVA 3HYVA 2FJBA 3LZXA 4YXDA 4H4PA 2Q0KA 2X99A 4RG4A 2B9WA 4IA6A 1EL7A 3Q9TA 3QFBA 2QCUA 2BA9A 4H4XA 2GAGB 2RGOA 2NPXA 3QVRA 4XXGA 2WS3A 1PBCA 5LV9A 4EIPA 3AEFA 2ZZ0A 5FS6A 3V3NA 2XLSA 4Z26A 2C4CA 2X3NA 5BVAA 3NK1X 4NWZA 1X31B 1TRBA 4C3YA 2WPFA 5IQ1A 3ATRA 3CGCA 3VRDB 3EANA 4NTEA 2A8XA 2R4JA 2TPRA 5JCLA 1TDKA 3CNSA 1TYTA 4OPUA 1YQZA 3KVEA 3NN0X 3FBSA 2O9ZA 2VVLG 2YAUA 1E1MA 3AB1A 2R45A 2YLZA 1PJ5A 1DOCA 4IVOB 4UP3A 4A6NA 4Z25A 2VVLA 1L9EA 3HYXA 5KRQA 1CJ3A 2Q7VA 2WQYA 4PABA 4XWRA 3UTEA 1E6EA 1LJ1A 3GWFA 3KPFA 3G5RA 1XDIA 3AE2A 3DJJA 1GRFA 1H2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4Q A;  1FOH A;  1GRB A;  3AD7 B;  2WDR A;  2A89 A;  1COY A;  4DGK A;  3T37 A;  1DOE A;  2R0G A;  1F3P A;  3KU9 A;  4A5L A;  2R9Z A;  3GDP A;  3CPJ G;  4Y4M A;  4Z44 A;  1N4V A;  3ITJ A;  2IVD A;  1GET A;  1GRA A;  2WP6 A;  2XVI A;  2YWL A;  3PS9 A;  5EOW A;  1E7P A;  3V3O A;  4AP3 A;  3CNT A;  3WE0 A;  4BV6 A;  1Y56 A;  1CL0 A;  2VVM A;  4ECH A;  1MOK A;  1GPE A;  4Y4N A;  3CGE A;  3VR9 A;  2H89 A;  5ER0 A;  1Y0P A;  3CIR A;  3KKJ A;  3BNM A;  1CC6 A;  1GOS A;  3BHK A;  2IVE A;  3CNJ A;  3ISH A;  1B8S A;  3L8K A;  1CF3 A;  1GSN A;  3EAO A;  1H83 A;  3AE6 A;  4ZCD A;  4BK3 A;  4CNJ A;  1JU2 A;  5GSN A;  2GEW A;  4OPT A;  3QFA A;  4EQR A;  1NHP A;  2Q0L A;  2EQ6 A;  1GRT A;  1LV0 A;  1PBD A;  1VG0 A;  3LOV A;  1NG3 A;  3EPT A;  4N9X A;  4U2S A;  5BUK A;  5FS9 A;  5J7X A;  3NYE A;  3FG2 P;  2VZ2 A;  3BI2 A;  3LAD A;  4H4U A;  3AXB A;  2QA1 A;  2Y6Q A;  3P4R A;  3QJ4 A;  2E4G A;  2JK6 A;  3RNM A;  5EB4 A;  3EF6 A;  4KX6 A;  2C65 A;  2W0H A;  1IUS A;  1ELI A;  2C7G A;  4APN A;  2BK4 A;  4Z2U A;  4YTN A;  4WX1 A;  5U1O A;  5JCM A;  2C73 A;  1Y56 B;  3GYJ A;  3RP8 A;  2XVH A;  4O5U A;  2HQM A;  1D7L A;  4B68 A;  2GVC A;  2XLU A;  2WEU A;  3BI5 A;  2JAE A;  2XLP A;  1PDH A;  4AP1 A;  3R9U A;  2FJE A;  3QVP A;  4H4W A;  1GV4 A;  3NTD A;  1ZY8 A;  2WOW A;  3SFD A;  2Y6R A;  3AEE A;  4B67 A;  3LB8 A;  3RHA A;  4C77 A;  2X50 A;  2XFN A;  1NG4 A;  1ZMD A;  3ICR A;  4OPC A;  4J34 A;  3NYF A;  3AD8 B;  2DKH A;  1D4C A;  2WET A;  1D7Y A;  2FJD A;  4KPR A;  4FX9 A;  4DNA A;  1CBO A;  1CC2 A;  2VQB A;  3NTA A;  4BJY A;  4ZN0 A;  4IVM B;  4K8D A;  4REK A;  1JOA A;  4DSG A;  5KOX A;  1DJN A;  5U63 A;  2WDQ A;  5EB5 A;  3AEG A;  1KDG A;  2JB1 A;  2BXR A;  1N4W A;  1V59 A;  4H4Q A;  1KSU A;  4HA6 A;  1DOB A;  3SGL A;  2GMH A;  4H4Z A;  4EIQ A;  2C3C A;  2VRL A;  1GER A;  3NK2 X;  1RP0 A;  3OZ2 A;  2XFU A;  3GSI A;  5HXI A;  2BCP A;  1IUV A;  3GRT A;  3DK8 A;  5L46 A;  3Q6J A;  3IF9 A;  1NAA A;  1QLB A;  1GRH A;  1B37 A;  4GF7 A;  4YKF A;  3UOY A;  4OCG A;  2CUL A;  3L1R A;  2FJA A;  3VQR A;  1DOD A;  2ZZC A;  3C4A A;  3FPZ A;  4OPI A;  1GND A;  2E1M A;  4GR1 A;  1XHC A;  1LTX R;  1H82 A;  5U25 A;  2GF3 A;  3NRN A;  2C72 A;  3CPI G;  1GXF A;  5M10 A;  4YWO A;  1XPQ A;  1VQW A;  3G5Q A;  4A6N B;  4RG3 A;  5C2T A;  4B65 A;  4OPL A;  3I6D A;  4J2W A;  3DME A;  1N4U A;  2YVG A;  1H86 A;  3IWA A;  2NVK X;  4B69 A;  3UP5 A;  2E5V A;  3AYL A;  1S2Q A;  1GAL A;  2C64 A;  4H2P A;  3C4N A;  4JY2 A;  3UKP A;  2EQ9 A;  2BC1 A;  4OVI A;  2I0Z A;  1NHR A;  2OAL A;  3M13 A;  1LQU A;  1ONF A;  2PYX A;  5KVH A;  4D03 A;  4K22 A;  2XCG A;  4GCM A;  1K0I A;  1B4V A;  4C5O A;  4TM0 A;  3DK9 A;  1TDO A;  4MJW A;  4B64 A;  2BXS A;  3ZYX A;  4U8P A;  4TLX A;  1PBB A;  4J57 A;  2FBW A;  5CKU A;  3NIX A;  2WU5 A;  3NYC A;  4M52 A;  4BK1 A;  3DJE A;  4J36 A;  3C96 A;  1OJA A;  3NKS A;  1JRZ A;  2VOU A;  1BKW A;  4GDE A;  4NZH A;  2AR8 A;  1EL9 A;  1RSG A;  1KNP A;  4H4S A;  3M0O A;  1FEC A;  1PXB A;  4X9N A;  1JNR A;  1S2Y A;  4CBQ A;  4USQ A;  2YLS A;  1K4Q A;  2V61 A;  4EM4 A;  5JCI A;  4CCQ A;  4H4R A;  4K7Z A;  3AEC A;  4OPG A;  4YSX A;  1O95 A;  4JNA A;  1BZL A;  1UKV G;  4H4V A;  3F8D A;  4YTP A;  3AE4 A;  4A7A A;  3I3L A;  3H8I A;  1NEN A;  4U8M A;  3BI4 A;  1ZDL A;  2XVF A;  1O94 A;  2BK5 A;  4A99 A;  1DXL A;  1S3E A;  2H88 A;  1EL8 A;  5JCN A;  3O0H A;  3AE3 A;  2J3N A;  2ZBW A;  3GMC A;  4H2R A;  1M64 A;  1P2E A;  4HB9 A;  3QSS A;  2YG7 A;  4ADW A;  1JRY A;  4K5R A;  2BC0 A;  4DSH A;  2GR2 A;  3AEB A;  1EBD A;  2R46 A;  1CJ2 A;  1DJQ A;  2AAQ A;  4JNQ A;  1TDF A;  3B3R A;  1ZP0 A;  3UTG A;  3AE8 A;  5KWF A;  1OJC A;  3SM8 A;  1NDA A;  4UDR A;  1IJH A;  1M6I A;  1KSS A;  1PJ6 A;  2C67 A;  3D1C A;  3AYJ A;  3DA1 A;  3NT6 A;  2GR0 A;  1EL5 A;  5IQ4 A;  4GUV A;  4Z2T A;  4EQX A;  2AQJ A;  4YSH A;  1F6M A;  4TM3 A;  4Z43 A;  1D4E A;  2GRT A;  1NHS A;  2V5Z A;  3NHO X;  4YSZ A;  3PO7 A;  4U8L A;  1ZOY A;  4U8J A;  1REO A;  4K5S A;  4USR A;  3OC4 A;  1VDC A;  1XAN A;  2CDU A;  1IUX A;  1PBF A;  4A79 A;  4H50 A;  2GQW A;  4EMI A;  1P2H A;  2XVE A;  2WP5 A;  2X8H A;  5FMH A;  1IUW A;  5GRT A;  5C3J A;  3CGB A;  2EQ7 A;  5FS7 A;  1H7X A;  3GRS A;  3NG7 X;  4JDR A;  2CVJ A;  3UCL A;  3ATQ A;  1QO8 A;  2RGH A;  2TMD A;  4JY3 A;  3UKL A;  3AEA A;  4H7U A;  5JCK A;  2B76 A;  4U2T A;  5KVI A;  1PHH A;  4EQS A;  2BCG G;  2XLT A;  3UKQ A;  1QJD A;  3RED A;  1OJD A;  1YY5 A;  4I58 A;  5IPY A;  4X9M A;  3GD4 A;  1O5W A;  1TDE A;  3RP7 A;  4U2L A;  1CC4 A;  3UKK A;  2IID A;  2B7S A;  3K7M X;  4LU6 A;  4FDC B;  2DKI A;  3NGC X;  3KA7 A;  3S5W A;  2GAH B;  3VRA A;  3G5S A;  2V3B A;  2RGJ A;  2XFO A;  4H2N A;  2GR1 A;  2RAB A;  2JBV A;  5TR3 A;  2CFY A;  3KD9 A;  1N1P A;  3P4S A;  3NN6 X;  3PVC A;  3UKF A;  4ZCC A;  3ZDN A;  1LQT A;  3E1T A;  4LA1 A;  1E1L A;  3FIM B;  3NNE A;  2UZZ A;  4YSY A;  1FL2 A;  2ARD A;  2C70 A;  1PJ7 A;  2C76 A;  2YLW A;  3IHM A;  1BGN A;  3CTY A;  4YKG A;  1CHU A;  3AD9 B;  3COX A;  3V76 A;  5DBJ A;  1H84 A;  4NTC A;  2ACZ A;  4X4J A;  2YM2 A;  3P1W A;  4EMJ A;  3UOZ A;  1GT8 A;  4D04 A;  3CPH G;  5BRT A;  1GTH A;  4H4T A;  1L9C A;  2R4E A;  2YG5 A;  2YR6 A;  3H8L A;  4J33 A;  2YLR A;  3AE1 A;  3UTH A;  4TM1 A;  3UP4 A;  4JQ9 A;  1S3B A;  1BGJ A;  2JB3 A;  2YG4 A;  5HHF A;  3DJG X;  3P4P A;  4B66 A;  1BWC A;  3II4 A;  4AT2 A;  3GYI A;  2YVJ A;  2WPE A;  3NK0 X;  2GMJ A;  4H4Y A;  1D4D A;  3ABV A;  1PBE A;  2V6O A;  2F5Z A;  1ZKQ A;  1K0L A;  1GRG A;  2BS4 A;  4LII A;  4Z2R A;  3RP6 A;  1GTE A;  4AOS A;  1LVL A;  2XVJ A;  1HYU A;  4GDP A;  1Q1W A;  1CJ4 A;  3H4K A;  2A87 A;  3AE5 A;  2PHH A;  4TM4 A;  1D5T A;  3GMB A;  2X8C A;  3SQP A;  1F8S A;  2WP9 A;  3LXD A;  1YQ3 A;  4Z24 A;  1K0J A;  2YLX A;  4I59 A;  1Q9I A;  2VQ7 A;  1H7W A;  4J56 A;  1PN0 A;  4IA5 A;  2BS3 A;  4U8N A;  4YTM A;  3UKH A;  2GH5 A;  2Q6U A;  1TYP A;  5CQF A;  2R0P A;  1SEZ A;  2XYO A;  2WU2 A;  1MO9 A;  4UDQ A;  1JRX A;  2YG3 A;  2WBA A;  1JEH A;  4EM3 A;  2OAM A;  1CJC A;  2GQF A;  2BS2 A;  1NPX A;  4P9S A;  4BJZ A;  3IHG A;  1RYI A;  2GR3 A;  2Z5X A;  1VRQ B;  4BUR A;  3UOX A;  3D8X A;  4XWZ A;  3IC9 A;  2GV8 A;  3HZL A;  3DK4 A;  5HYM A;  3ICS A;  5J60 A;  2V3A A;  4OPD A;  1L9D A;  2OLN A;  1E1N A;  1GRE A;  2YLT A;  4K2X A;  4C74 A;  4CNK A;  4FK1 A;  4JN9 A;  3DGH A;  1AOG A;  3JSK A;  1PXA A;  1PXC A;  2BAB A;  2XDO A;  1GEU A;  1IUU A;  3M12 A;  3QSM A;  2APG A;  3VR8 A;  5HY5 A;  2B7R A;  4A9W A;  5KOW A;  3K7T A;  3S61 A;  2BK3 A;  1Q1R A;  4GRT A;  3K30 A;  3P9U A;  3GD3 A;  4AOX A;  5M0Z A;  1ZX9 A;  1E39 A;  3ALL A;  4ICY A;  1OJT A;  3AE7 A;  5FS8 A;  3URH A;  2WES A;  4Y4L A;  1LPF A;  2QAE A;  2YR5 A;  3ADA B;  1YKJ A;  3DH9 A;  3AE9 A;  2YG6 A;  4PAA A;  2VRM A;  4NEW A;  4C3X A;  1JNZ A;  2B9Y A;  2C75 A;  1PS9 A;  1YQ4 A;  3QSE A;  4U8O A;  2Z5Y A;  1ZMC A;  4FK1 C;  4BK2 A;  3ALM A;  3DJD A;  3UOV A;  2OLO A;  4CY6 A;  2C66 A;  2JKC A;  3KLJ A;  1BF3 A;  4IV9 A;  3SFE A;  3AED A;  2ZZB A;  3LZW A;  2WOV A;  2WOI A;  3DGZ A;  2WHD A;  4WCT A;  1NHQ A;  3F8R A;  1OJ9 A;  1MXT A;  4A65 A;  1VG9 A;  2OA1 A;  3NH3 X;  4E0V A;  4O5Q A;  3VRB A;  1FCD A;  2WPC A;  2BAC A;  3FMW A;  4H2Q A;  1L0V A;  3NLC A;  2YQU A;  1KF6 A;  2BYB A;  4UDP A;  3GWD A;  4RSL A;  2X8G A;  3CN8 A;  3ICT A;  1F8W A;  5BUL A;  1E1K A;  2XLR A;  3AYI A;  3B6D A;  3CGD A;  1IUT A;  3UTF A;  4YT0 A;  3BNU A;  1FEA A;  2XFQ A;  2C3D A;  5EBK A;  1KNR A;  4B1B A;  1TDN A;  3AWI A;  4EMW A;  3CNP A;  3ALJ A;  3CND A;  3UKA A;  3GDN A;  3LJP A;  1ZK7 A;  4NEV A;  2YR4 A;  4NTD A;  1Z6L A;  2JB2 A;  4B63 A;  1F8R A;  2XFP A;  2EQ8 A;  4U8I A;  1FEB A;  4AT0 A;  4TLZ A;  2QA2 A;  4J31 A;  2WDV A;  4EQW A;  2V60 A;  3BHF A;  4U8K A;  5KXJ A;  4CCR A;  1NEK A;  2B9X A;  3K7Q X;  1H6V A;  1B5Q A;  1KFY A;  4CY8 A;  2YVF A;  3F8P A;  1GES A;  1H81 A;  2R0C A;  2GB0 A;  2YM1 A;  4CRT A;  1DNC A;  1W4X A;  1ZOV A;  2FJB A;  3LZX A;  4YXD A;  4H4P A;  2Q0K A;  2X99 A;  4RG4 A;  2B9W A;  4IA6 A;  1EL7 A;  3Q9T A;  3QFB A;  2QCU A;  2BA9 A;  4H4X A;  2GAG B;  2RGO A;  2NPX A;  3QVR A;  4XXG A;  2WS3 A;  1PBC A;  5LV9 A;  4EIP A;  3AEF A;  2ZZ0 A;  5FS6 A;  3V3N A;  2XLS A;  4Z26 A;  2X3N A;  5BVA A;  3NK1 X;  1X31 B;  1TRB A;  4C3Y A;  2WPF A;  5IQ1 A;  3ATR A;  3CGC A;  3VRD B;  3EAN A;  4NTE A;  2A8X A;  2R4J A;  2TPR A;  5JCL A;  1TDK A;  3CNS A;  1TYT A;  4OPU A;  1YQZ A;  3KVE A;  3NN0 X;  3FBS A;  2O9Z A;  2VVL G;  2YAU A;  1E1M A;  3AB1 A;  2R45 A;  2YLZ A;  1PJ5 A;  1DOC A;  4IVO B;  4UP3 A;  4A6N A;  4Z25 A;  2VVL A;  1L9E A;  5KRQ A;  1CJ3 A;  2Q7V A;  2WQY A;  4PAB A;  4XWR A;  3UTE A;  1E6E A;  1LJ1 A;  3GWF A;  3KPF A;  3G5R A;  1XDI A;  3AE2 A;  3DJJ A;  1GRF A; 
#chains in the Genus database with same CATH topology
 3P4Q A;  1FOH A;  4E5T A;  2QQ6 A;  1DOE A;  1F3P A;  3KU9 A;  3R25 A;  3GDP A;  1N4V A;  3STP A;  2IVD A;  1GRA A;  5EOW A;  1CL0 A;  1MOK A;  4ROP A;  5ER0 A;  1Y0P A;  2OKT A;  3CIR A;  3BNM A;  1CC6 A;  5BOE A;  3BHK A;  3CNJ A;  1CF3 A;  3MWC A;  5GSN A;  3QFA A;  1NHP A;  2Q0L A;  2EQ6 A;  1VG0 A;  4U2S A;  5J7X A;  3NYE A;  3GYX A;  2VZ2 A;  5FJR A;  3LAD A;  5ENL A;  3EF6 A;  2W0H A;  2C7G A;  4APN A;  2BK4 A;  4II3 A;  4Z2U A;  4WX1 A;  4II2 A;  3GYJ A;  2XVH A;  4O5U A;  1D7L A;  2GVC A;  2ONE A;  2WEU A;  2OLA A;  2XLP A;  3QVP A;  3KPK A;  2WOW A;  2Y6R A;  3DFH A;  3T6C A;  1ZMD A;  3ICR A;  4OPC A;  2DKH A;  1CBO A;  3NO1 A;  4REK A;  5KOX A;  2PTY A;  4DYE A;  2WDQ A;  3NVZ B;  1V59 A;  1N4W A;  4HA6 A;  4H4Z A;  1P48 A;  5L46 A;  1QLB A;  4YKF A;  4H83 A;  3C4A A;  4FI4 A;  3FPZ A;  4GR1 A;  1H82 A;  3NRN A;  2C72 A;  3CPI G;  1GXF A;  1XPQ A;  3I6D A;  3DG3 A;  1N4U A;  2YVG A;  3H8A A;  3IWA A;  3EUB 3;  4DXK A;  3C4N A;  4G6G A;  4D03 A;  4HNL A;  2XCG A;  4GCM A;  3FV9 A;  4E4U A;  4U8P A;  2OQY A;  4TLX A;  4M52 A;  4BK1 A;  4GFI A;  1EL9 A;  4GYP C;  1KNP A;  4H4S A;  1FEC A;  4OPG A;  1O95 A;  4JNA A;  2XH7 A;  4YTP A;  4A7A A;  3H8I A;  1NEN A;  2PSN A;  3T0K A;  1F9C A;  2PP1 A;  3CMM A;  3Q4D A;  1M64 A;  4K5R A;  4ADW A;  1JRY A;  3AEB A;  2R46 A;  3AMZ A;  1NDA A;  3T8Q A;  1IJH A;  4UDR A;  1M6I A;  3GD6 A;  3AYJ A;  2GGH A;  4EQX A;  3VC5 A;  3PO7 A;  4K5S A;  4USR A;  1IUX A;  2PTX A;  4H50 A;  2GQW A;  2PGE A;  5FMH A;  3HW2 A;  5FS7 A;  3NG7 X;  2CVJ A;  3UCL A;  2RGH A;  2TMD A;  4G7F A;  3MSY A;  2P8B A;  3UKL A;  5JCK A;  2B76 A;  4U2T A;  3FYY A;  1QJD A;  1YY5 A;  3A7A A;  5IPY A;  3GD4 A;  1TDE A;  4MGG A;  3SZC A;  2DKI A;  1YEY A;  3KA7 A;  2V3B A;  3KD9 A;  1FHU A;  3NN6 X;  2XH4 A;  3QPE A;  4LA1 A;  4HCH A;  2QJJ A;  1ECQ A;  3ZVH A;  1PJ7 A;  1H84 A;  4X4J A;  1GT8 A;  1L9C A;  3OZM A;  3MQT A;  3UJ2 A;  2BRA A;  3JZU A;  1WUE A;  3HYW A;  3PWG A;  2YVJ A;  1TKK A;  3ABV A;  2V6O A;  1N5W C;  4G73 A;  1ZKQ A;  4Z2R A;  3RP6 A;  1LVL A;  2OFJ A;  5J04 A;  1Q1W A;  1CJ4 A;  5KMS A;  2PHH A;  3GMB A;  2GGE A;  3SQP A;  1F8S A;  3LXD A;  1KCZ A;  1YQ3 A;  4Z24 A;  5CQF A;  3SN0 A;  3TWB A;  2R0P A;  4UDQ A;  4EM3 A;  2OAM A;  4P9S A;  2BS2 A;  1NPX A;  1N60 C;  2PPG A;  2GR3 A;  2W3R A;  2W54 A;  2GV8 A;  1JCT A;  3ICS A;  5HYM A;  4ZA0 A;  5J60 A;  3MZN A;  3CAW A;  1L9D A;  2OZ3 A;  3T4W A;  1PXA A;  1PXC A;  1GEU A;  4GIR A;  2B7R A;  2BK3 A;  4AOX A;  4GRT A;  1ZX9 A;  4TVY A;  4ICY A;  2QAE A;  2RDX A;  4C3X A;  2XH0 A;  2Z5Y A;  3DJD A;  2C66 A;  3CB3 A;  3F8R A;  4JN8 A;  1MXT A;  1VG9 A;  3H12 A;  3R07 C;  1JPM A;  2YQU A;  2BYB A;  4UDP A;  2X8G A;  3GY1 A;  4YT0 A;  1FEA A;  2C3D A;  1KNR A;  4B1B A;  3CXB A;  4EMW A;  3ALJ A;  3DDM A;  3N4E A;  4NEV A;  2YR4 A;  4B63 A;  2XFP A;  2EQ8 A;  3TW9 A;  2MUC A;  4HPN A;  4EQW A;  2V60 A;  4H1Z A;  3PG6 A;  1H6V A;  1B5Q A;  2DW7 A;  2GSH A;  4CY8 A;  2YVF A;  3QKE A;  2YM1 A;  4CRT A;  1ZOV A;  3ES7 A;  3ZVH B;  3LZX A;  4H4P A;  2AKM A;  2Q0K A;  4RG4 A;  1EL7 A;  3Q9T A;  3QFB A;  3HRD C;  1PBC A;  4EIP A;  3K1G A;  1X2H A;  5BVA A;  1X31 B;  3IJL A;  2TPR A;  1TDK A;  3CNS A;  4OPU A;  2OX4 A;  2YAU A;  1E1M A;  1DTN A;  2YLZ A;  1DOC A;  4ZCW A;  3Q45 A;  2WQY A;  4XWR A;  2AKZ A;  1LJ1 A;  1H2I A;  1E9I A;  1GRB A;  2WDR A;  4DX3 A;  3DG7 A;  4IL2 A;  5FJU A;  3P0W A;  2R0G A;  4H19 A;  2R9Z A;  1JDF A;  3ITJ A;  2PCE A;  3NVY B;  2XVI A;  3PS9 A;  1VQZ A;  3V3O A;  3NFU A;  3RRA A;  4HYR A;  3D9X A;  1B8S A;  3EAO A;  3SR6 B;  4BK3 A;  4CNJ A;  4EQR A;  1N5X A;  1LV0 A;  3LOV A;  1NG3 A;  5BUK A;  3GO2 A;  2GDQ A;  1SJD A;  3P4R A;  3RGT A;  2E4G A;  1BKH A;  4IT1 A;  2C65 A;  2C73 A;  3RP8 A;  4TVW A;  1Y56 B;  2HQM A;  3BI5 A;  1PDH A;  2FJE A;  4H4W A;  1GV4 A;  3SFD A;  3AEE A;  2X50 A;  2XFN A;  3NYF A;  3AD8 B;  3VC6 A;  1D7Y A;  2FJD A;  3P3B A;  4GAP A;  4BJY A;  3SY4 A;  1N63 C;  3PWI A;  1DJN A;  2E5A A;  5EB5 A;  2GGI A;  3AEG A;  2BXR A;  1KSU A;  4E4F A;  3SGL A;  1DOB A;  4EIQ A;  4G8T A;  1V97 A;  2XFU A;  3GRT A;  3Q6J A;  3IF9 A;  1NAA A;  1GRH A;  3UOY A;  3OTR A;  3VQR A;  2ZZC A;  4KPL A;  5M10 A;  4RG3 A;  4B65 A;  4OPL A;  4J2W A;  1H86 A;  4IP5 A;  3NZG A;  3UP5 A;  3AYL A;  1S2Q A;  4H2P A;  2QJM A;  2EQ9 A;  3M13 A;  1LQU A;  3VCC A;  2PYX A;  1ELS A;  4TM0 A;  2QDE A;  1TDO A;  4HCL A;  4A6G A;  3IK4 A;  3NIX A;  4IHC A;  4J36 A;  3C96 A;  3UJF A;  4GDE A;  1JRZ A;  4NZH A;  2GGG A;  2AR8 A;  3R1Z A;  1RSG A;  3FCP A;  4CBQ A;  4H4R A;  1RVK A;  4K7Z A;  3AEC A;  4J1O A;  4H4V A;  1O94 A;  1DXL A;  4GGB A;  2W3S A;  1EL8 A;  5JCN A;  2FKP A;  3O0H A;  3OW1 A;  3GMC A;  4GME A;  3QSS A;  1EBD A;  1DJQ A;  3UTG A;  1TDF A;  3B3R A;  5KMQ A;  1KSS A;  1PJ6 A;  2C67 A;  3D1C A;  3TJ4 A;  1EL5 A;  1WYG A;  2AQJ A;  2GRT A;  3L5O A;  2V5Z A;  4J3Z A;  4U8L A;  4U8J A;  3AM9 A;  1REO A;  2E3T A;  1XAN A;  2CDU A;  2X8H A;  1XS2 A;  3GRS A;  1QO8 A;  4JY3 A;  4H7U A;  4HNC A;  1PHH A;  4GYP A;  2AL1 A;  3RED A;  1OJD A;  4I58 A;  4X9M A;  1CC4 A;  3P93 A;  2IID A;  2XH2 A;  2B7S A;  4LU6 A;  3R11 A;  3S5W A;  3VRA A;  4H2N A;  2CFY A;  3ZDN A;  2P3Z A;  3BSM A;  2OPJ A;  3E1T A;  1E1L A;  3NNE A;  4YSY A;  1FL2 A;  2ARD A;  2C76 A;  3TTE A;  1BGN A;  4NTC A;  3S5S A;  2QGY A;  2ACZ A;  2YM2 A;  3UOZ A;  4D04 A;  2YG5 A;  3H8L A;  3FJ4 A;  3AE1 A;  3UTH A;  3DEQ A;  1EC8 A;  1S3B A;  1BGJ A;  2YG4 A;  5HHF A;  4B66 A;  1X2G A;  4H4Y A;  3IJQ A;  1N61 C;  4LII A;  4YWS A;  3DG6 A;  3MUC A;  3H4K A;  4G9K A;  3AE5 A;  2WP9 A;  2PTZ A;  1Q9I A;  2VQ7 A;  3SN4 A;  1H7W A;  4J56 A;  1PN0 A;  4IA5 A;  4U8N A;  3UKH A;  2Q6U A;  2YG3 A;  1CJC A;  4BJZ A;  3UOX A;  1RYI A;  1VRQ B;  4BUR A;  4XWZ A;  3IC9 A;  3HZL A;  2V3A A;  4K2X A;  4CNK A;  4JN9 A;  3DGH A;  1AOG A;  3QSM A;  5HY5 A;  3ALL A;  1E39 A;  3AE7 A;  1KN0 A;  3R0K A;  2YR5 A;  1YKJ A;  3DES A;  3AE9 A;  2YG6 A;  1ZMC A;  3ALM A;  3UXK A;  2JKC A;  3KLJ A;  2WOV A;  3IJI A;  3CYJ A;  2WHD A;  1VDV A;  4WCT A;  1NHQ A;  4A65 A;  4E0V A;  3NH3 X;  3VRB A;  3H70 A;  3FMW A;  1FFV C;  2GL5 A;  1L0V A;  1KF6 A;  3CN8 A;  5BUL A;  3B6D A;  2HXT A;  3CGD A;  4MMW A;  3BNU A;  3UJS A;  1FEB A;  4TLZ A;  4J31 A;  5KXJ A;  4U8K A;  1NEK A;  5JRB A;  1PDY A;  2R0C A;  3HYV A;  3ZLG A;  4EWJ A;  2B9W A;  2PP0 A;  4IA6 A;  4XXG A;  4JHM A;  3AEF A;  2ZZ0 A;  5G5G B;  4Z26 A;  2PTW A;  2X3N A;  4C3Y A;  2WPF A;  5IQ1 A;  3VRD B;  4NTE A;  2A8X A;  5JCL A;  1TYT A;  1YQZ A;  5FJT A;  4KT2 A;  3FBS A;  2O9Z A;  4IZG A;  2R45 A;  4UP3 A;  4A6N A;  4Z25 A;  3EKG A;  1CJ3 A;  4PAB A;  3G5R A;  3DJJ A;  2HXU A;  1S7M A;  3V5C A;  2A89 A;  4GGH A;  2OQH A;  1NU5 A;  3CPJ G;  2WP6 A;  2YWL A;  3ES8 A;  3I4K A;  1E7P A;  4AP3 A;  3CNT A;  4BV6 A;  3ENL A;  2VVM A;  4ECH A;  4Y4N A;  3CGE A;  3VR9 A;  2H89 A;  3KKJ A;  1GOS A;  3TQP A;  3ZLF A;  2IVE A;  3L8K A;  1H83 A;  2GEW A;  4OPT A;  1GRT A;  3EPT A;  5FS9 A;  3BI2 A;  3VFC A;  3EEZ A;  2QA1 A;  2Y6Q A;  3QJ4 A;  3D47 A;  4KX6 A;  1IUS A;  3SZF A;  3DGB A;  4KWS A;  2JAE A;  4X2P A;  3THU A;  4M0X A;  1ZY8 A;  1MRA A;  4C77 A;  3SSZ A;  3TCS A;  4HN8 A;  3CT2 A;  4KPR A;  4FX9 A;  4DNA A;  4ZN0 A;  4K8D A;  1EBH A;  3GC2 A;  3N6H A;  1KDG A;  1GER A;  1RP0 A;  3OZ2 A;  3GSI A;  5HXI A;  3I6T A;  4GF7 A;  1B37 A;  3JW7 A;  2P88 A;  4OCG A;  3L1R A;  2FJA A;  4OPI A;  1GND A;  2E1M A;  1KD0 A;  5U25 A;  4DN1 A;  4A6N B;  3DME A;  1PDZ A;  4B69 A;  4G74 A;  3V4B A;  1GAL A;  3UKP A;  3BOX A;  2BC1 A;  4OVI A;  5KMR A;  1NHR A;  3S47 A;  2GGJ A;  1N62 C;  1ONF A;  3UJE A;  5G5H B;  4C5O A;  1K0I A;  3DK9 A;  3ZLH A;  2BXS A;  3ZYX A;  5FJO A;  1PBB A;  4J57 A;  2FBW A;  4KEM A;  3NYC A;  3DJE A;  3NKS A;  2VOU A;  3R10 A;  3M0O A;  1JNR A;  4USQ A;  2YLS A;  5JCI A;  3AE4 A;  3I3L A;  4U8M A;  2BK5 A;  1TZZ A;  3SX6 A;  4ENL A;  3A7R A;  3D46 A;  2ZBW A;  3T2K A;  3MKC A;  4H2R A;  4HB9 A;  1P2E A;  2W55 A;  2QJN A;  2GR2 A;  1CJ2 A;  4JNQ A;  2AAQ A;  3V3W A;  3SM8 A;  3OPS A;  4Z17 A;  3MY9 A;  4H2H A;  5IQ4 A;  4YSH A;  1F6M A;  4Z43 A;  1D4E A;  1NHS A;  3NHO X;  3OC4 A;  1PBF A;  3OZY A;  1P2H A;  4EMI A;  2XVE A;  1IUW A;  2AL2 B;  1H7X A;  2PS2 A;  2NQL A;  4GAV A;  2PU1 A;  3DFY A;  5KVI A;  4EQS A;  3UKQ A;  3T2Z A;  7ENL A;  1O5W A;  3UKK A;  3RP7 A;  4U2L A;  3SXI A;  4FDC B;  3B97 A;  3U4F A;  2POZ A;  2RGJ A;  2JBV A;  3PFR A;  3UGV A;  3PVC A;  4ZCC A;  3FIM B;  2UZZ A;  2I5Q A;  1EBG A;  2C70 A;  3IHM A;  3CTY A;  1CHU A;  3COX A;  3CPH G;  5BRT A;  1GTH A;  4H4T A;  1JRO A;  3NS1 B;  4J33 A;  4TM1 A;  3UP4 A;  4G6H A;  4JQ9 A;  3T31 A;  4Z1Y A;  3QLD A;  3OP2 A;  2JB3 A;  3DJG X;  3P4P A;  4AT2 A;  2WPE A;  3SN1 A;  3NK0 X;  2POD A;  2F5Z A;  1K0L A;  1KKR A;  1GTE A;  2XVJ A;  1HYU A;  4GDP A;  2X8C A;  4YTM A;  2GH5 A;  1SEZ A;  2XYO A;  1MO9 A;  2WBA A;  1JEH A;  2MNR A;  2GQF A;  1SJA A;  3IHG A;  4ZOH B;  3D8X A;  4OPD A;  2OLN A;  1GRE A;  4C74 A;  1JRP A;  4FK1 A;  3JSK A;  5BOF A;  2BAB A;  2XDO A;  3VR8 A;  4A9W A;  1NEL A;  4K2S A;  5M0Z A;  3ETR B;  3URH A;  1LPF A;  3ADA B;  4PAA A;  1JNZ A;  2B9Y A;  3QSE A;  4FK1 C;  4BK2 A;  4E6M A;  4E8G A;  1MUC A;  3B9J B;  4A35 A;  3SFE A;  1BF3 A;  4IV9 A;  3AED A;  2ZZB A;  3LZW A;  2OZT A;  1FO4 A;  1KKO A;  2OG9 A;  2OA1 A;  4O5Q A;  4H2Q A;  1STZ A;  3GWD A;  1W6T A;  4RSL A;  3ICT A;  1E1K A;  1MDR A;  6ENL A;  3UCD A;  1IUT A;  1P43 A;  2OZ8 A;  1TDN A;  3AWI A;  3CNP A;  3CND A;  2O56 A;  3GDN A;  1ZK7 A;  2JB2 A;  1F8R A;  4U8I A;  1BQG A;  3FXG A;  2QVH A;  3T2Y A;  1GES A;  4IP4 A;  5KMP A;  3QTP A;  3SZW A;  1W4X A;  2FJB A;  2X99 A;  2QCU A;  2BA9 A;  2GAG B;  2RGO A;  3PK7 A;  3CK5 A;  3QVR A;  3NVV B;  5LV9 A;  5FS6 A;  1EC9 A;  2C4C A;  3NK1 X;  3NVW B;  3EAN A;  1XPY A;  3KVE A;  3NN0 X;  1FIQ B;  2VVL A;  5KRQ A;  2Q7V A;  3UTE A;  1E6E A;  3GWF A;  1XDI A;  3H7V A;  3AD7 B;  1COY A;  4DGK A;  3T37 A;  4A5L A;  4Y4M A;  4Z44 A;  1GET A;  3WE0 A;  1Y56 A;  1GPE A;  3ISH A;  3AE6 A;  1GSN A;  4ZCD A;  1JU2 A;  1MNS A;  3V5F A;  1PBD A;  4N9X A;  3FG2 P;  3ZVI A;  4H4U A;  3AXB A;  5KNL A;  2JK6 A;  3RNM A;  5EB4 A;  3T9P A;  3BJS A;  1ELI A;  4YTN A;  5U1O A;  5JCM A;  1R6W A;  3QN3 A;  4B68 A;  2XLU A;  4AP1 A;  3R9U A;  3NTD A;  4B67 A;  3LB8 A;  1WUF A;  3RHA A;  1NG4 A;  4J34 A;  1D4C A;  2WET A;  2VQB A;  1CC2 A;  3NTA A;  4IVM B;  1IYX A;  1JOA A;  4DSG A;  5U63 A;  2JB1 A;  4H4Q A;  2BRY A;  2GMH A;  2C3C A;  2VRL A;  3NK2 X;  1JPD X;  3SZ0 A;  2BCP A;  4HCD A;  1IUV A;  3DK8 A;  2HZG A;  3TOY A;  2CUL A;  1DOD A;  1XHC A;  1OEP A;  1LTX R;  2GF3 A;  4MKS A;  4YWO A;  1VQW A;  3G5Q A;  5C2T A;  2PP3 A;  2NVK X;  1FFU C;  2E5V A;  2C64 A;  4JY2 A;  2I0Z A;  2OAL A;  5KVH A;  4K22 A;  1B4V A;  4MJW A;  4B64 A;  5CKU A;  2WU5 A;  1OJA A;  1BKW A;  2XGZ A;  1RM6 B;  4K8G A;  1PXB A;  4X9N A;  1S2Y A;  1K4Q A;  2ZAD A;  4EM4 A;  2V61 A;  4CCQ A;  4YSX A;  1BZL A;  1UKV G;  3F8D A;  4GIS A;  4IL0 A;  3BI4 A;  1ZDL A;  2XVF A;  4A99 A;  1S3E A;  2H88 A;  3SJN A;  3AE3 A;  2J3N A;  1ONE A;  3VA8 A;  2YG7 A;  4DSH A;  2BC0 A;  1ZP0 A;  5KWF A;  3AE8 A;  1OJC A;  3HPF A;  3DA1 A;  2XSX A;  3NT6 A;  2GR0 A;  4GUV A;  4Z2T A;  4TM3 A;  4YSZ A;  1ZOY A;  1VDC A;  4A79 A;  3RCY A;  2WP5 A;  5GRT A;  3DER A;  3CGB A;  2EQ7 A;  5C3J A;  3SBF A;  4JDR A;  3ATQ A;  3AEA A;  2PU0 A;  3KUM A;  2BCG G;  2XLT A;  1ZXI C;  3K7M X;  5EU9 A;  3NGC X;  2GAH B;  3G5S A;  2XFO A;  2GR1 A;  2RAB A;  3P4S A;  5TR3 A;  1N1P A;  4DHG A;  3UKF A;  1LQT A;  2P0I A;  2QDD A;  4YKG A;  2YLW A;  3AD9 B;  3V76 A;  5DBJ A;  4M6U A;  3P1W A;  2CHR A;  4EMJ A;  2YR6 A;  2R4E A;  2YLR A;  1MDL A;  2FYM A;  1BWC A;  3II4 A;  3GYI A;  2GMJ A;  1D4D A;  1PBE A;  3TJI A;  2BS4 A;  1GRG A;  4AOS A;  2A87 A;  3N6J A;  4TM4 A;  1D5T A;  1SB3 B;  3I6E A;  2OO6 A;  1K0J A;  2YLX A;  4I59 A;  4JN7 A;  3JVA A;  3TWA A;  2BS3 A;  1TYP A;  2WU2 A;  3VCN A;  1JRX A;  4NNJ A;  3A7U A;  2HNE A;  2Z5X A;  3U9I A;  3DK4 A;  2PGW A;  1E1N A;  2YLT A;  3M12 A;  1EC7 A;  1IUU A;  3SYI A;  2APG A;  5KOW A;  3K7T A;  3S61 A;  1Q1R A;  3K30 A;  3P9U A;  3GD3 A;  3DIP A;  1FHV A;  1R0M A;  1OJT A;  5FS8 A;  2WES A;  4Y4L A;  2OVL A;  3NRZ B;  1SJC A;  3T14 A;  3DH9 A;  1TE6 A;  2VRM A;  4NEW A;  2C75 A;  1PS9 A;  1YQ4 A;  4U8O A;  2AL2 A;  1SJB A;  3UOV A;  2OLO A;  4CY6 A;  3AN1 A;  2WOI A;  1T3Q C;  3DGZ A;  3CXO A;  3UJR A;  1OJ9 A;  2ZC8 A;  1L8P A;  2WPC A;  1FCD A;  2BAC A;  3NLC A;  4F4R A;  1F8W A;  5FJP A;  3N4F A;  2XLR A;  3AYI A;  3RO6 A;  3UTF A;  2XFQ A;  5EBK A;  3UKA A;  3NXL A;  3LJP A;  4NTD A;  2P8C A;  4A3R A;  1Z6L A;  2DW6 A;  4AT0 A;  3RR1 A;  2QA2 A;  3SQS A;  3UXL A;  2WDV A;  3BHF A;  4CCR A;  2B9X A;  3K7Q X;  1KFY A;  3F8P A;  4DWD A;  1H81 A;  2GB0 A;  1DNC A;  2PMQ A;  4FP1 A;  4YXD A;  4H4X A;  3RIT A;  2NPX A;  4K1W A;  2WS3 A;  3V3N A;  2XLS A;  4NWZ A;  1TRB A;  3UCC A;  3ATR A;  3VDG A;  3CGC A;  3R0U A;  2R4J A;  2VVL G;  3AB1 A;  1PJ5 A;  4IVO B;  5IDZ A;  1L9E A;  3HYX A;  2PA6 A;  3KPF A;  3FVD A;  3AE2 A;  1GRF A; 
#chains in the Genus database with same CATH homology
 3P4Q A;  1FOH A;  1GRB A;  1S7M A;  3AD7 B;  2WDR A;  2A89 A;  1COY A;  4DGK A;  3T37 A;  1DOE A;  2R0G A;  1F3P A;  3KU9 A;  4A5L A;  2R9Z A;  3GDP A;  3CPJ G;  4Y4M A;  4Z44 A;  1N4V A;  3ITJ A;  2IVD A;  1GET A;  1GRA A;  2WP6 A;  2XVI A;  2YWL A;  3PS9 A;  5EOW A;  1E7P A;  3V3O A;  4AP3 A;  3CNT A;  3WE0 A;  4BV6 A;  1Y56 A;  1CL0 A;  2VVM A;  4ECH A;  1MOK A;  1GPE A;  4Y4N A;  3CGE A;  3VR9 A;  2H89 A;  5ER0 A;  1Y0P A;  3CIR A;  3KKJ A;  3BNM A;  1CC6 A;  1GOS A;  3BHK A;  2IVE A;  3D9X A;  3CNJ A;  3ISH A;  1B8S A;  3L8K A;  1CF3 A;  1GSN A;  3EAO A;  1H83 A;  3AE6 A;  4ZCD A;  4BK3 A;  4CNJ A;  1JU2 A;  5GSN A;  2GEW A;  4OPT A;  3QFA A;  4EQR A;  1NHP A;  2Q0L A;  2EQ6 A;  1GRT A;  1LV0 A;  1PBD A;  1VG0 A;  3LOV A;  1NG3 A;  3EPT A;  4N9X A;  4U2S A;  5BUK A;  5FS9 A;  5J7X A;  3NYE A;  3FG2 P;  3GYX A;  2VZ2 A;  3BI2 A;  3LAD A;  4H4U A;  3AXB A;  2QA1 A;  2Y6Q A;  3P4R A;  3QJ4 A;  5KNL A;  2E4G A;  2JK6 A;  3RNM A;  5EB4 A;  3EF6 A;  4KX6 A;  2C65 A;  2W0H A;  1IUS A;  1ELI A;  2C7G A;  3SZF A;  4APN A;  2BK4 A;  4II3 A;  4Z2U A;  4YTN A;  4WX1 A;  5U1O A;  5JCM A;  2C73 A;  1Y56 B;  3GYJ A;  4II2 A;  2XVH A;  4O5U A;  2HQM A;  1D7L A;  3RP8 A;  4B68 A;  2GVC A;  2XLU A;  2WEU A;  3BI5 A;  2JAE A;  2XLP A;  1PDH A;  4AP1 A;  3R9U A;  2FJE A;  3QVP A;  4H4W A;  1GV4 A;  3KPK A;  3NTD A;  1ZY8 A;  2WOW A;  3SFD A;  2Y6R A;  3AEE A;  4B67 A;  3LB8 A;  3RHA A;  4C77 A;  2X50 A;  2XFN A;  1NG4 A;  1ZMD A;  3ICR A;  4OPC A;  4J34 A;  3NYF A;  3AD8 B;  2DKH A;  1D4C A;  2WET A;  1D7Y A;  2FJD A;  4KPR A;  4FX9 A;  4DNA A;  1CBO A;  1CC2 A;  2VQB A;  3NTA A;  4GAP A;  4BJY A;  4ZN0 A;  4IVM B;  4K8D A;  4REK A;  3SY4 A;  1JOA A;  4DSG A;  5KOX A;  1DJN A;  5U63 A;  2WDQ A;  5EB5 A;  3AEG A;  1KDG A;  2JB1 A;  2BXR A;  1N4W A;  1V59 A;  4H4Q A;  2BRY A;  1KSU A;  4HA6 A;  1DOB A;  3SGL A;  2GMH A;  4H4Z A;  4EIQ A;  2C3C A;  2VRL A;  1GER A;  3NK2 X;  1RP0 A;  3OZ2 A;  2XFU A;  3GSI A;  5HXI A;  3SZ0 A;  2BCP A;  1IUV A;  3GRT A;  3DK8 A;  5L46 A;  3Q6J A;  3IF9 A;  1NAA A;  1QLB A;  1GRH A;  1B37 A;  4GF7 A;  4YKF A;  3UOY A;  4OCG A;  2CUL A;  3L1R A;  2FJA A;  3VQR A;  1DOD A;  2ZZC A;  3C4A A;  3FPZ A;  4OPI A;  1GND A;  2E1M A;  4GR1 A;  1XHC A;  1LTX R;  1H82 A;  5U25 A;  2GF3 A;  3NRN A;  2C72 A;  3CPI G;  1GXF A;  5M10 A;  4YWO A;  1XPQ A;  1VQW A;  3G5Q A;  4A6N B;  4RG3 A;  5C2T A;  4B65 A;  4OPL A;  3I6D A;  4J2W A;  3DME A;  1N4U A;  2YVG A;  1H86 A;  3IWA A;  2NVK X;  4B69 A;  3UP5 A;  4G74 A;  2E5V A;  3AYL A;  1S2Q A;  1GAL A;  2C64 A;  4H2P A;  3C4N A;  4JY2 A;  3UKP A;  2EQ9 A;  2BC1 A;  4OVI A;  5KMR A;  2I0Z A;  1NHR A;  2OAL A;  3M13 A;  1LQU A;  1ONF A;  2PYX A;  4G6G A;  5KVH A;  4D03 A;  4K22 A;  2XCG A;  4GCM A;  1K0I A;  1B4V A;  4C5O A;  4TM0 A;  3DK9 A;  1TDO A;  4MJW A;  4B64 A;  2BXS A;  3ZYX A;  4U8P A;  4TLX A;  1PBB A;  4J57 A;  2FBW A;  5CKU A;  3NIX A;  2WU5 A;  3NYC A;  4M52 A;  4BK1 A;  3DJE A;  4J36 A;  3C96 A;  1OJA A;  3NKS A;  1JRZ A;  2VOU A;  1BKW A;  4GDE A;  4NZH A;  2AR8 A;  1EL9 A;  1RSG A;  1KNP A;  4H4S A;  3M0O A;  1FEC A;  1PXB A;  4X9N A;  1JNR A;  1S2Y A;  4CBQ A;  4USQ A;  2YLS A;  1K4Q A;  2V61 A;  4EM4 A;  5JCI A;  4CCQ A;  4H4R A;  4K7Z A;  3AEC A;  4OPG A;  4YSX A;  1O95 A;  4JNA A;  1BZL A;  1UKV G;  4H4V A;  3F8D A;  4YTP A;  3AE4 A;  4A7A A;  3I3L A;  3H8I A;  1NEN A;  4U8M A;  3BI4 A;  1ZDL A;  2XVF A;  1O94 A;  2BK5 A;  3T0K A;  4A99 A;  1DXL A;  1S3E A;  3SX6 A;  2H88 A;  1EL8 A;  5JCN A;  3CMM A;  3O0H A;  3AE3 A;  2J3N A;  2ZBW A;  3T2K A;  3GMC A;  4H2R A;  1M64 A;  1P2E A;  4HB9 A;  3QSS A;  2YG7 A;  4ADW A;  1JRY A;  4K5R A;  2BC0 A;  4DSH A;  2GR2 A;  3AEB A;  1EBD A;  2R46 A;  1CJ2 A;  1DJQ A;  2AAQ A;  4JNQ A;  1TDF A;  3B3R A;  1ZP0 A;  5KMQ A;  3AE8 A;  3UTG A;  1OJC A;  3SM8 A;  5KWF A;  1NDA A;  4UDR A;  1IJH A;  1M6I A;  1KSS A;  1PJ6 A;  2C67 A;  3D1C A;  3AYJ A;  3DA1 A;  3NT6 A;  2GR0 A;  1EL5 A;  5IQ4 A;  4GUV A;  4Z2T A;  4EQX A;  2AQJ A;  4YSH A;  1F6M A;  4TM3 A;  4Z43 A;  1D4E A;  2GRT A;  1NHS A;  3L5O A;  2V5Z A;  3NHO X;  4YSZ A;  3PO7 A;  4U8L A;  1ZOY A;  4U8J A;  1REO A;  4K5S A;  4USR A;  3OC4 A;  1VDC A;  1XAN A;  2CDU A;  1IUX A;  1PBF A;  4A79 A;  4H50 A;  2GQW A;  4EMI A;  1P2H A;  2XVE A;  2WP5 A;  2X8H A;  5FMH A;  1IUW A;  5GRT A;  5C3J A;  3CGB A;  2EQ7 A;  5FS7 A;  1H7X A;  3GRS A;  3NG7 X;  4JDR A;  2CVJ A;  3UCL A;  3ATQ A;  1QO8 A;  2RGH A;  2TMD A;  4JY3 A;  4GAV A;  3AEA A;  3UKL A;  4H7U A;  5JCK A;  2B76 A;  4U2T A;  5KVI A;  1PHH A;  4EQS A;  2BCG G;  2XLT A;  3UKQ A;  1QJD A;  3T2Z A;  3RED A;  1OJD A;  1YY5 A;  4I58 A;  5IPY A;  4X9M A;  3GD4 A;  1O5W A;  1TDE A;  3RP7 A;  4U2L A;  1CC4 A;  3UKK A;  3SXI A;  2IID A;  2B7S A;  3K7M X;  4LU6 A;  4FDC B;  3SZC A;  2DKI A;  3NGC X;  3KA7 A;  3S5W A;  2GAH B;  3VRA A;  3G5S A;  2V3B A;  2RGJ A;  2XFO A;  4H2N A;  2GR1 A;  2RAB A;  2JBV A;  5TR3 A;  2CFY A;  3KD9 A;  1N1P A;  3P4S A;  3NN6 X;  3PVC A;  3UKF A;  4ZCC A;  3ZDN A;  1LQT A;  3E1T A;  4LA1 A;  1E1L A;  3FIM B;  3NNE A;  2UZZ A;  4YSY A;  1FL2 A;  2ARD A;  2C70 A;  1PJ7 A;  2C76 A;  2YLW A;  3IHM A;  1BGN A;  3CTY A;  4YKG A;  1CHU A;  3AD9 B;  3COX A;  3V76 A;  5DBJ A;  1H84 A;  4NTC A;  2ACZ A;  4X4J A;  2YM2 A;  3P1W A;  4EMJ A;  3UOZ A;  1GT8 A;  4D04 A;  3CPH G;  5BRT A;  1GTH A;  4H4T A;  1L9C A;  2R4E A;  2YG5 A;  2YR6 A;  3H8L A;  4J33 A;  2YLR A;  3AE1 A;  3UTH A;  4TM1 A;  3UP4 A;  4G6H A;  4JQ9 A;  1S3B A;  3T31 A;  2BRA A;  1BGJ A;  2JB3 A;  2YG4 A;  5HHF A;  3DJG X;  3HYW A;  3P4P A;  4B66 A;  1BWC A;  3II4 A;  4AT2 A;  3GYI A;  2YVJ A;  2WPE A;  3NK0 X;  2GMJ A;  4H4Y A;  1D4D A;  3ABV A;  1PBE A;  2V6O A;  2F5Z A;  4G73 A;  1ZKQ A;  1K0L A;  1GRG A;  2BS4 A;  4LII A;  4Z2R A;  3RP6 A;  1GTE A;  4AOS A;  1LVL A;  2XVJ A;  1HYU A;  4GDP A;  1Q1W A;  1CJ4 A;  3H4K A;  4G9K A;  5KMS A;  2A87 A;  3AE5 A;  2PHH A;  4TM4 A;  1D5T A;  3GMB A;  2X8C A;  3SQP A;  1F8S A;  2WP9 A;  3LXD A;  1YQ3 A;  4Z24 A;  1K0J A;  2YLX A;  4I59 A;  1Q9I A;  2VQ7 A;  1H7W A;  4J56 A;  1PN0 A;  4IA5 A;  2BS3 A;  4U8N A;  4YTM A;  3UKH A;  2GH5 A;  2Q6U A;  1TYP A;  5CQF A;  2R0P A;  1SEZ A;  2XYO A;  2WU2 A;  1MO9 A;  4UDQ A;  1JRX A;  2YG3 A;  2WBA A;  1JEH A;  4EM3 A;  2OAM A;  4NNJ A;  1CJC A;  2GQF A;  2BS2 A;  1NPX A;  4P9S A;  4BJZ A;  3IHG A;  1RYI A;  2GR3 A;  2Z5X A;  1VRQ B;  4BUR A;  3UOX A;  3D8X A;  4XWZ A;  3IC9 A;  2GV8 A;  3HZL A;  3DK4 A;  5HYM A;  3ICS A;  5J60 A;  2V3A A;  4OPD A;  1L9D A;  2OLN A;  1E1N A;  1GRE A;  2YLT A;  4K2X A;  4C74 A;  4CNK A;  4FK1 A;  4JN9 A;  3DGH A;  1AOG A;  3JSK A;  1PXA A;  1PXC A;  2BAB A;  2XDO A;  1GEU A;  1IUU A;  3M12 A;  3QSM A;  2APG A;  3SYI A;  3VR8 A;  5HY5 A;  2B7R A;  4A9W A;  5KOW A;  3K7T A;  3S61 A;  2BK3 A;  1Q1R A;  4GRT A;  3K30 A;  3P9U A;  3GD3 A;  4AOX A;  5M0Z A;  1ZX9 A;  1E39 A;  3ALL A;  4ICY A;  1OJT A;  3AE7 A;  5FS8 A;  3URH A;  1KN0 A;  2WES A;  4Y4L A;  1LPF A;  2QAE A;  2YR5 A;  3ADA B;  1YKJ A;  3T14 A;  3DH9 A;  3AE9 A;  2YG6 A;  4PAA A;  2VRM A;  4NEW A;  4C3X A;  1JNZ A;  2B9Y A;  2C75 A;  1PS9 A;  1YQ4 A;  3QSE A;  4U8O A;  2Z5Y A;  1ZMC A;  4FK1 C;  4BK2 A;  3ALM A;  3DJD A;  3UOV A;  2OLO A;  4CY6 A;  2C66 A;  2JKC A;  3KLJ A;  1BF3 A;  4IV9 A;  3SFE A;  3AED A;  2ZZB A;  3LZW A;  2WOV A;  2WOI A;  3DGZ A;  2WHD A;  4WCT A;  1NHQ A;  3F8R A;  1OJ9 A;  1MXT A;  4A65 A;  1VG9 A;  2OA1 A;  3NH3 X;  4E0V A;  4O5Q A;  3VRB A;  1FCD A;  2WPC A;  2BAC A;  3FMW A;  4H2Q A;  1L0V A;  3NLC A;  2YQU A;  1KF6 A;  2BYB A;  4UDP A;  3GWD A;  4RSL A;  2X8G A;  3CN8 A;  3ICT A;  1F8W A;  5BUL A;  1E1K A;  2XLR A;  3AYI A;  3B6D A;  3CGD A;  1IUT A;  3UTF A;  4YT0 A;  3BNU A;  1FEA A;  2XFQ A;  2C3D A;  5EBK A;  1KNR A;  4B1B A;  1TDN A;  3AWI A;  4EMW A;  3CNP A;  3ALJ A;  3CND A;  3UKA A;  3GDN A;  3LJP A;  1ZK7 A;  4NEV A;  2YR4 A;  4NTD A;  1Z6L A;  2JB2 A;  4B63 A;  1F8R A;  2XFP A;  2EQ8 A;  4U8I A;  1FEB A;  4AT0 A;  4TLZ A;  2QA2 A;  4J31 A;  2WDV A;  4EQW A;  2V60 A;  3BHF A;  4U8K A;  5KXJ A;  4CCR A;  1NEK A;  2B9X A;  3PG6 A;  5JRB A;  3K7Q X;  1H6V A;  1B5Q A;  1KFY A;  4CY8 A;  2YVF A;  3F8P A;  3T2Y A;  1GES A;  1H81 A;  5KMP A;  2R0C A;  2GB0 A;  2YM1 A;  3SZW A;  4CRT A;  1DNC A;  1W4X A;  1ZOV A;  3HYV A;  2FJB A;  3LZX A;  4YXD A;  4H4P A;  2Q0K A;  2X99 A;  4RG4 A;  2B9W A;  4IA6 A;  1EL7 A;  3Q9T A;  3QFB A;  2QCU A;  2BA9 A;  4H4X A;  2GAG B;  2RGO A;  2NPX A;  3QVR A;  4XXG A;  2WS3 A;  1PBC A;  5LV9 A;  4EIP A;  3AEF A;  2ZZ0 A;  5FS6 A;  3V3N A;  2XLS A;  4Z26 A;  2C4C A;  2X3N A;  5BVA A;  3NK1 X;  4NWZ A;  1X31 B;  1TRB A;  4C3Y A;  2WPF A;  5IQ1 A;  3ATR A;  3CGC A;  3VRD B;  3EAN A;  4NTE A;  2A8X A;  2R4J A;  2TPR A;  5JCL A;  1TDK A;  3CNS A;  1TYT A;  4OPU A;  1YQZ A;  3KVE A;  3NN0 X;  3FBS A;  2O9Z A;  2VVL G;  2YAU A;  1E1M A;  3AB1 A;  2R45 A;  2YLZ A;  1PJ5 A;  1DOC A;  4IVO B;  4UP3 A;  4A6N A;  4Z25 A;  2VVL A;  1L9E A;  3HYX A;  5KRQ A;  1CJ3 A;  2Q7V A;  2WQY A;  4PAB A;  4XWR A;  3UTE A;  1E6E A;  1LJ1 A;  3GWF A;  3KPF A;  3G5R A;  1XDI A;  3AE2 A;  3DJJ A;  1GRF A;  1H2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...