1JEHA

Crystal structure of yeast e3, lipoamide dehydrogenase
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
478
structure length
478
Chain Sequence
TINKSHDVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGTCLNVGCIPSKALLNNSHLFHQMHTEAQKRGIDVNGDIKINVANFQKAKDDAVKQLTGGIELLFKKNKVTYYKGNGSFEDETKIRVTPVDGLEGTVKEDHILDVKNIIVATGSEVTPFPGIEIDEEKIVSSTGALSLKEIPKRLTIIGGGIIGLEMGSVYSRLGSKVTVVEFQPQIGASMDGEVAKATQKFLKKQGLDFKLSTKVISAKRNDDKNVVEIVVEDTKTNKQENLEAEVLLVAVGRRPYIAGLGAEKIGLEVDKRGRLVIDDQFNSKFPHIKVVGDVTFGPMLAHKAEEEGIAAVEMLKTGHGHVNYNNIPSVMYSHPEVAWVGKTEEQLKEAGIDYKIGKFPFAANSRAKTNQDTEGFVKILIDSKTERILGAHIIGPNAGEMIAEAGLALEYGASAEDVARVCHAHPTLSEAFKEANMAAYDKAIHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROLIPOAMIDE DEHYDROGENASE
publication title Crystal structure of eucaryotic E3, lipoamide dehydrogenase from yeast.
pubmed rcsb
molecule tags Oxidoreductase
total genus 142
structure length 478
sequence length 478
chains with identical sequence B
ec nomenclature ec 1.8.1.4: Dihydrolipoyl dehydrogenase.
pdb deposition date 2001-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1jehA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jehA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jehA02
2BK4A 2YG5A 1GRHA 1D7LA 3S61A 4AP1A 3UKKA 2HQMA 5L46A 4JY3A 4C3YA 1CF3A 2V6OA 1L9CA 1LJ1A 1M6IA 3ZYXA 3F8PA 1OJTA 2B76A 3ATRA 5BVAA 2YM2A 5J60A 1S2YA 2BC1A 5KOWA 1DJQA 1IUUA 2E5VA 5FS6A 2GMHA 1H84A 4H4ZA 2Q7VA 4C74A 1XDIA 4A65A 3FPZA 5FS7A 3NN6X 4Y4NA 2WOVA 2H88A 3DJGX 3VRBA 3NLCA 1XHCA 4USQA 1MOKA 3REDA 3E1TA 5GSNA 4APNA 3KA7A 1F8RA 1QO8A 1MXTA 1AOGA 1H7XA 2RGHA 1LV0A 4K7ZA 3ICRA 4IVOB 1COYA 4YSZA 4EM4A 5EOWA 1ZDLA 3B3RA 3LZXA 3CPHG 5M0ZA 4YTMA 2BA9A 3QFBA 4H4XA 3ABVA 3VQRA 3AD8B 4TM4A 1JRYA 1GV4A 2XYOA 3DJDA 3GD3A 2BYBA 1H6VA 4ZCDA 3WE0A 2XFNA 1JOAA 2I0ZA 1LTXR 2GR3A 1KDGA 4U8LA 5IQ1A 4YSYA 2OLOA 1GERA 4YTNA 4H4RA 4H4SA 3LJPA 2C66A 2A89A 1KNRA 2YG6A 5KOXA 2IVDA 3RHAA 4YSXA 4Y4LA 3AE4A 2GEWA 3ATQA 1FEAA 4YT0A 2Q0KA 2OAMA 2B7SA 1GXFA 4OPCA 3AB1A 5U25A 2VOUA 4KPRA 2WS3A 3C96A 4USRA 4EQWA 1NHPA 4B67A 4Z2RA 3CNDA 2WDQA 4O5QA 1X31B 3UTFA 1CHUA 4FX9A 3GYIA 5ER0A 3M12A 1PJ5A 2XVFA 4BK1A 2E1MA 1PXCA 2YM1A 1K4QA 4A99A 4Z2TA 3GD4A 3EF6A 2QA1A 1EL5A 2R4JA 3G5QA 3EAOA 2ZZ0A 3AE6A 3PVCA 4U8OA 2WDRA 2XLRA 3AEDA 4YTPA 1GTHA 2APGA 4CRTA 2CULA 1FL2A 4DSGA 2Q0LA 4XWZA 4NEWA 3S5WA 3QSEA 2BCGG 3FG2P 4Z25A 3UKHA 1VDCA 1NPXA 3GMCA 3V3OA 4TLZA 3QSSA 2QAEA 5CQFA 4C5OA 3IHMA 3P4QA 2YLZA 3AEBA 4J2WA 2YLSA 3NGCX 1NENA 4NTEA 4D03A 1V59A 1S2QA 5J7XA 4ICYA 4PABA 3FBSA 1FECA 1TDFA 3BI5A 2XFOA 2XCGA 4WX1A 1DOBA 1Y56B 2WEUA 4U8PA 2EQ7A 1ZMDA 4IA5A 2V61A 1S3BA 1L9DA 4B69A 2EQ6A 3NYFA 4H4TA 4RSLA 2DKHA 2OLNA 5M10A 4U8NA 4AP3A 1Q1RA 3ALMA 1VRQB 4EQXA 3LOVA 3BNMA 2X8HA 1Y0PA 3CN8A 2TPRA 2X50A 4HB9A 4JN9A 1YKJA 1GTEA 4J34A 3P1WA 2VRLA 4KX6A 2WPCA 2YG3A 5BULA 5HY5A 4AOSA 2B9XA 2AQJA 2YVGA 1ZY8A 2PYXA 3B6DA 3CNJA 4MJWA 4B64A 5LV9A 2WPEA 2B7RA 2XLTA 3C4NA 4FK1C 2C3DA 2Q6UA 2PHHA 2X8CA 5CKUA 2CVJA 1LQTA 4B66A 5JCMA 1FCDA 5KVHA 1P2EA 1E1MA 3DMEA 1BZLA 3NTAA 3AEEA 4GF7A 2GMJA 2WETA 5JCLA 3SQPA 4EM3A 1ZOYA 3CNPA 5TR3A 4H2QA 5C2TA 3K7TA 2FJAA 2XVIA 1PBEA 3UTEA 4A6NA 3AYLA 4U2LA 4B68A 3AYIA 3P4PA 4OPGA 2R46A 1L9EA 2GRTA 3GDPA 3H8IA 3LADA 2UZZA 4NTDA 2JBVA 3RP7A 4E0VA 3AWIA 2BK3A 1D5TA 2WHDA 2C72A 2JB3A 3ALJA 1DXLA 1IUSA 4K5SA 3R9UA 1H83A 3UTGA 4O5UA 4GR1A 3KD9A 4IVMB 3UOXA 4YKFA 3IHGA 4EMWA 4H2PA 4UP3A 3Q9TA 4OPTA 1JU2A 3II4A 3BI2A 4C3XA 4CNJA 1DNCA 4YSHA 4Z43A 3K7MX 3EANA 5BUKA 1JRXA 2RGJA 2WU5A 3IC9A 4AT2A 2BS4A 3AE9A 3VR8A 1GEUA 1DOEA 2YG7A 2BS2A 1GNDA 3VRDB 4A9WA 3UCLA 1PXAA 5KXJA 1YQZA 1YQ3A 2C67A 2DKIA 3SFDA 4DGKA 1JEHA 1O94A 3AE5A 3UTHA 1O95A 2C76A 4FDCB 4BV6A 2GVCA 3NYCA 4CY6A 1NEKA 4NEVA 2WP9A 4YKGA 4TM3A 4K22A 1TDKA 1GREA 2O9ZA 2GR0A 5EB4A 1NDAA 1OJCA 3LZWA 1EL8A 3ADAB 1ELIA 4TM0A 4UDPA 3AYJA 2YLXA 2NPXA 2CDUA 1CC2A 4GDEA 2WPFA 4H7UA 2VQ7A 1GOSA 3GRSA 3QVRA 1PHHA 5GRTA 2C75A 4C77A 4Y4MA 4UDRA 1CJ4A 1CJCA 2X8GA 5KRQA 3G5RA 1KSSA 2YVJA 1MO9A 1Q1WA 1IJHA 1PS9A 3AECA 2AR8A 3ZDNA 2WDVA 3AEFA 2WESA 3NH3X 5JCKA 3EPTA 4CCQA 1LQUA 1BGJA 1E1KA 3JSKA 4B65A 1EBDA 4XWRA 3H8LA 1TYPA 4GCMA 1F8SA 1TRBA 2RABA 2XVHA 3NKSA 4IV9A 5KWFA 2FJBA 4ECHA 1PBCA 1GRGA 2YLWA 2GB0A 3NK0X 3P4SA 3SGLA 4K8DA 4H50A 1JRZA 5IPYA 3K30A 1HYUA 4H4VA 2RGOA 2F5ZA 1GALA 4YXDA 2GQWA 3DK9A 2E4GA 5JCIA 1PJ6A 2FBWA 1VQWA 4XXGA 1N4UA 3ICSA 5U63A 1ZMCA 1PN0A 4YWOA 3PS9A 2ZZBA 3CGBA 1D4CA 1CJ2A 2R0GA 3QFAA 4K5RA 1B8SA 1E7PA 4X4JA 2WOIA 3BI4A 4DNAA 1O5WA 1E1NA 2GAGB 2JAEA 1GPEA 3UOZA 1XPQA 4ZCCA 1BWCA 2AAQA 3DGZA 3IWAA 1H7WA 5FS8A 1ZX9A 3HZLA 1TDNA 3T37A 1GT8A 2WQYA 5IQ4A 2YWLA 4A6NB 1ZK7A 4P9SA 3VR9A 2X99A 1B5QA 2VVMA 4FK1A 4U8MA 2JK6A 1JNRA 4RG3A 1F6MA 2GAHB 4Z26A 4H4WA 2B9YA 3KVEA 4BURA 3CTYA 1IUTA 1K0LA 3UKQA 3NK1X 1NHRA 1BGNA 3GDNA 2XFUA 3F8RA 1N4VA 2GQFA 3K7QX 3M0OA 3P4RA 1M64A 4JNQA 1TDOA 3AE7A 4EMIA 2GV8A 3NRNA 4OPDA 3QVPA 1W4XA 4H4UA 4I59A 1RSGA 2VVLA 2BABA 3NHOX 2EQ8A 3AD7B 2VVLG 3ISHA 4X9MA 4CNKA 3CNSA 4RG4A 4LU6A 3DGHA 4OPLA 2A8XA 4H4YA 4NTCA 1QLBA 4JDRA 1EL9A 3NIXA 4ADWA 1CJ3A 3NG7X 3ICTA 2YR6A 3CPIG 4AOXA 4BJYA 3DK4A 2QA2A 3D1CA 3SFEA 3UOYA 4JQ9A 2B9WA 1D7YA 2GF3A 1PBFA 1CL0A 3GWFA 2NVKX 2EQ9A 1D4EA 1RYIA 5C3JA 1DOCA 3DJEA 2GR2A 2C65A 3QSMA 3RNMA 3M13A 2FJEA 1F3PA 1H82A 3L8KA 1GSNA 4GUVA 1NHQA 1PJ7A 2C3CA 2JKCA 4CBQA 2V5ZA 2YR4A 1GETA 4H2NA 2XFQA 3KLJA 5HHFA 3AD9B 4A79A 4LA1A 1ZOVA 4PAAA 2Y6RA 3ITJA 4Z24A 2XVEA 5JCNA 3AEGA 4OVIA 4J57A 2WP6A 3RP8A 2ARDA 4CCRA 1CC6A 3DK8A 3H4KA 2BS3A 3D8XA 4B1BA 3CPJG 2ACZA 5U1OA 2BC0A 1PBBA 2V3AA 2Y6QA 4N9XA 4CY8A 4Z2UA 2VRMA 2YG4A 3G5SA 1OJ9A 2IVEA 1QJDA 1PXBA 3KU9A 2YLTA 1UKVG 1Q9IA 3COXA 1H81A 3O0HA 4ZN0A 5HXIA 2Z5YA 5HYMA 4WCTA 2YLRA 3UKFA 4U8JA 3NK2X 2ZBWA 3F8DA 1E6EA 1KNPA 4OPUA 4BK2A 3CGEA 5EBKA 1ONFA 3GMBA 3UKAA 2R0CA 4EIQA 2XFPA 1S3EA 1IUXA 2CFYA 5DBJA 4HA6A 1BKWA 1SEZA 4I58A 4A7AA 2GR1A 1E1LA 2VQBA 2WU2A 3I6DA 4J33A 2C64A 3Q6JA 3DJJA 4H4QA 3FMWA 2BK5A 4U8IA 1KFYA 4EQSA 2XLPA 4BJZA 2R4EA 1NG4A 4U2SA 1DODA 1FOHA 4Z44A 1GRFA 2FJDA 3P9UA 3V3NA 1GESA 2WOWA 3CGCA 2C73A 4BK3A 1F8WA 3RP6A 3NN0X 4X9NA 1DJNA 4LIIA 4DSHA 1TDEA 3I3LA 1IUWA 1REOA 3UP5A 1GRBA 1LVLA 3GRTA 1Z6LA 2H89A 2V3BA 4H2RA 3V76A 4EQRA 1VG9A 4H4PA 3AEAA 1YQ4A 1P2HA 1TYTA 1KSUA 2C7GA 3LB8A 4B63A 2XLUA 3BHFA 2WP5A 3BHKA 1CC4A 4EIPA 1FEBA 2JB1A 2WBAA 2TMDA 3AE1A 2BXRA 1IUVA 3UKLA 2GH5A 1NAAA 5BRTA 2XDOA 3DA1A 1LPFA 4J56A 1GRTA 1XANA 3UP4A 4NZHA 4REKA 3DH9A 3CNTA 4GRTA 2VZ2A 4EMJA 5KVIA 3NYEA 5FMHA 3AE8A 1NG3A 1VG0A 2ZZCA 5EB5A 2J3NA 4JY2A 3KKJA 4GDPA 4A5LA 2JB2A 2BXSA 1PBDA 3L1RA 3LXDA 3UKPA 2V60A 1ZP0A 1PDHA 4OCGA 4AT0A 1JNZA 2C70A 1N4WA 1RP0A 3BNUA 4TM1A 2BCPA 1YY5A 3URHA 3GWDA 4IA6A 1GRAA 3VRAA 3C4AA 3OC4A 3NTDA 1EL7A 3OZ2A 2YQUA 2IIDA 4K2XA 1N1PA 3GYJA 3KPFA 4D04A 1L0VA 1D4DA 1H86A 3ALLA 4TLXA 1B37A 2BACA 3AXBA 1BF3A 3NT6A 4JNAA 2YAUA 4J36A 4UDQA 2QCUA 2R45A 3QJ4A 4U8KA 3IF9A 3CIRA 3GSIA 3AE3A 1OJAA 1OJDA 3PO7A 5FS9A 1KF6A 3FIMB 4OPIA 2R0PA 2YR5A 2OALA 1E39A 3UOVA 2Z5XA 2X3NA 4J31A 1K0IA 2XLSA 1CBOA 1ZKQA 3AE2A 2XVJA 2R9ZA 3CGDA 2W0HA 2YVFA 2A87A 3NNEA 4U2TA 1B4VA 1NHSA 3SM8A 4M52A 1Y56A 1K0JA 2OA1A
chains in the Genus database with same CATH superfamily
2YG5A 3S61A 1L9CA 5KOWA 3D9XA 3QN3A 2GMHA 4C74A 2WOVA 1XHCA 4IHCA 4USQA 3REDA 4APNA 4HPNA 1AOGA 2RGHA 3ICRA 4YSZA 4EM4A 1ZDLA 1RM6B 3AD8B 3VFCA 3NRZB 1H6VA 4YSYA 1GERA 4H4SA 3LJPA 1WYGA 3R25A 1EBHA 3N6JA 3TWBA 3ATQA 2B7SA 3I6EA 4OPCA 5U25A 3SX6A 4USRA 1NHPA 3I4KA 1BQGA 4ZA0A 3T0KA 3QPEA 1PJ5A 4GYPA 1FO4A 2XH0A 2QA1A 5BOEA 2PCEA 3EAOA 3T8QA 3AE6A 1TZZA 1FL2A 2Q0LA 4XWZA 3KUMA 4HCDA 3GMCA 2QAEA 3IHMA 4E5TA 3AEBA 2YLSA 3NGCX 5J7XA 3BI5A 3JVAA 2WEUA 5FJRA 3MSYA 1ZMDA 4B69A 2EQ6A 2DKHA 2OLNA 4AP3A 1Q1RA 3ALMA 3OW1A 3DDMA 3STPA 3BSMA 1GTEA 2OZ3A 3VC5A 2PGWA 2WPCA 2POZA 5HY5A 1X2GA 3ZLHA 5BOFA 2B7RA 3C4NA 4FK1C 3R0UA 3DG3A 1N5XA 1LQTA 1P2EA 3IK4A 2GMJA 4H2QA 4HCLA 3P4PA 3HYXA 1JRPA 1EC9A 3AWIA 2WHDA 3ALJA 2JB3A 3R9UA 1DXLA 4O5UA 3ZVHB 4H2PA 4CNJA 3AM9A 4G6HA 2PTXA 2BS4A 3UCCA 1GEUA 2YG7A 1PXAA 7ENLA 1YQZA 2DKIA 4DGKA 4A3RA 3CK5A 1O95A 2C76A 3L5OA 1N61C 4BV6A 4II2A 4CY6A 4NEVA 2WP9A 4YKGA 5FJOA 5KMSA 1TDKA 4G74A 3JZUA 5EB4A 1NDAA 4TM0A 2NPXA 3OZYA 1GOSA 1PHHA 2XH7A 1SJAA 1CJ4A 3AECA 3BOXA 5JCKA 3EPTA 4CCQA 1E1KA 4B65A 4XWRA 4GCMA 1F8SA 3NKSA 1PBCA 3UJRA 1YEYA 3K30A 1HYUA 2RGOA 2F5ZA 1GALA 3DK9A 5JCIA 1ECQA 2QQ6A 2PTWA 3PS9A 3CGBA 3R0KA 3QFAA 1E7PA 2WOIA 3OPSA 3BI4A 4DNAA 2JAEA 5KMRA 3MWCA 1BWCA 1H7WA 5EU9A 4GGBA 5IQ4A 2YWLA 3HYVA 4P9SA 1JNRA 6ENLA 4IP4A 4H4WA 3KVEA 3GO2A 4BURA 3DG6A 3UKQA 1N4VA 4EMIA 1XPYA 2W55A 1W4XA 4I59A 2VVLA 2BABA 3ISHA 3AD7B 3CNSA 4LU6A 3DGHA 2CHRA 2A8XA 4H4YA 4JDRA 2YR6A 3TW9A 2QA2A 3SFEA 2NVKX 2EQ9A 1D4EA 3DJEA 3ENLA 1E9IA 3FVDA 1H82A 3R07C 3OP2A 4IL2A 4HN8A 1GETA 4H2NA 3KLJA 4PAAA 4J57A 4G73A 1CC6A 3H4KA 2AKMA 3D8XA 2Y6QA 4CY8A 2PSNA 2GGIA 3G5SA 1OJ9A 2IVEA 3DERA 3NVZB 1PXBA 2XH4A 3VCCA 1Q9IA 1H81A 5HXIA 3GC2A 2PP1A 1TKKA 3RR1A 3NK2X 2PMQA 1KNPA 4H83A 5EBKA 3UKAA 4H2HA 1S3EA 3Q4DA 5DBJA 4GFIA 3I6DA 3SSZA 3Q6JA 4BJZA 2R4EA 1DODA 1FOHA 2FJDA 3DESA 3SY4A 3TTEA 4LIIA 3I3LA 1REOA 4A6GA 2V3BA 4EQRA 3DG7A 4H4PA 3AEAA 3NXLA 1P2HA 1KSUA 2C7GA 3LB8A 2XLUA 3UKLA 1NAAA 1W6TA 3V5FA 2QVHA 3NYEA 3AE8A 1NG3A 4GGHA 1VG0A 5EB5A 2J3NA 3KKJA 4A5LA 2JB2A 2BXSA 1PBDA 1FHVA 3UKPA 1PDHA 5JRBA 1RP0A 2OG9A 2BCPA 3NTDA 3OZ2A 4D04A 4ROPA 1H86A 3AXBA 2MUCA 3PFRA 3NT6A 2YAUA 4J36A 4U8KA 5FS9A 3FIMB 1EBGA 2OALA 2X3NA 2XVJA 3UCDA 2A87A 3NNEA 3V4BA 3DFYA 1ELSA 2PPGA 1K0JA 4AP1A 2PP0A 2HQMA 3MY9A 3NO1A 1LJ1A 3F8PA 5BVAA 1FIQB 2YM2A 1S2YA 1IUUA 1H84A 2Q7VA 4A65A 5FS7A 3NN6X 4Y4NA 3OZMA 3ES7A 3VRBA 3NLCA 3GYXA 3B3RA 2GL5A 1IYXA 4YTMA 1GV4A 3THUA 3GD3A 2BYBA 3WE0A 1JOAA 4YTNA 3JW7A 4H4RA 2C66A 2A89A 2RDXA 3QTPA 1FEAA 1GXFA 3AB1A 3C96A 1NU5A 1DTNA 4B67A 3UTFA 3RRAA 2W3SA 3GD4A 3PK7A 3G5QA 3PVCA 4H19A 4GAVA 2WDRA 3DIPA 3AEDA 5KMPA 1GTHA 4CRTA 4DSGA 3NFUA 4NEWA 3FG2P 1NPXA 3V3OA 5CQFA 3P4QA 2YLZA 4DXKA 1S2QA 2DW7A 4PABA 2PTZA 5FJPA 1DOBA 4U8PA 2EQ7A 1L9DA 4RSLA 2OX4A 3CN8A 3N4EA 4K1WA 2VRLA 5BULA 3I6TA 3P3BA 2PYXA 4B64A 2X8CA 5CKUA 2CVJA 3V5CA 2O56A 1E1MA 2ZC8A 3OTRA 2WETA 4DN1A 4EM3A 1RVKA 1ZOYA 5TR3A 5C2TA 3IJIA 4U2LA 3AYIA 4OPGA 2R46A 3H8IA 2GRTA 3LADA 4NTDA 2E5AA 4K5SA 1H83A 4GR1A 3T6CA 3Q9TA 4OPTA 1KD0A 1SJBA 3BI2A 4YSHA 3AN1A 3T4WA 3K7MX 3EANA 1JRXA 2RGJA 3IC9A 3AE9A 1VQZA 4A9WA 3UCLA 4HYRA 4IT1A 4NNJA 2W3RA 3FXGA 4JHMA 4KWSA 4K22A 1GREA 2O9ZA 4GMEA 1ELIA 5GRTA 1SJDA 5KRQA 3A7RA 1KSSA 1IJHA 1MO9A 5G5HB 1PS9A 3AEFA 1LQUA 3EUB3 2HXUA 3H8LA 2XVHA 5KWFA 2FJBA 2YLWA 2GB0A 3NK0X 3P4SA 3RCYA 4H4VA 1PJ6A 1VQWA 3DGBA 1D4CA 1CJ2A 4K5RA 5ENLA 4MMWA 1O5WA 4ZCCA 2AAQA 3DGZA 3IWAA 5FS8A 1ZX9A 2WQYA 2VVMA 4FK1A 1F6MA 4Z26A 3T2YA 1K0LA 1BGNA 3GDNA 2XFUA 3K7QX 3M0OA 1M64A 3AE7A 4OPDA 4H4UA 4CNKA 2VVLG 4M0XA 4OPLA 3SN4A 4NTCA 1QLBA 4ADWA 4GISA 3ICTA 3DK4A 3ZLFA 1D7YA 4H1ZA 3CT2A 1MNSA 5C3JA 2PU0A 3QSMA 3RNMA 2XSXA 2FJEA 3NVWB 3L8KA 1GSNA 3GD6A 4CBQA 2YR4A 5JCNA 3T31A 4CCRA 4HNLA 2ACZA 1PBBA 2YG4A 2YLTA 3T14A 3SBFA 4WCTA 2ZBWA 4OPUA 4BK2A 3CGEA 3GMBA 4EIQA 1IUXA 1SEZA 2GR1A 2VQBA 4H4QA 3FMWA 2I5QA 4EQSA 2XLPA 1NG4A 2OKTA 2WOWA 3CGCA 1F8WA 3NN0X 4X9NA 3TQPA 1GRBA 1LVLA 3GRTA 3V76A 2PA6A 4B63A 3BHFA 2WP5A 1FEBA 4E4UA 2JB1A 1FFVC 4J56A 3CXBA 4REKA 3DH9A 3CNTA 1KKRA 5FMHA 2ZZCA 3SZFA 1V97A 3ZLGA 1H2IA 3R11A 4J1OA 3L1RA 3LXDA 4OCGA 3SYIA 1JNZA 2C70A 3BNUA 3GWDA 1VDVA 3C4AA 1SJCA 2YQUA 4K2XA 3KPFA 1L0VA 3SXIA 4TLXA 4HCHA 4JNAA 2QCUA 3AE3A 1BKHA 1JCTA 1KF6A 2R0PA 2YR5A 2Z5XA 5J04A 4J31A 3KPKA 1K0IA 3AE2A 1CBOA 1ZKQA 4M52A 1Y56A 2BK4A 2GGGA 3UKKA 3QLDA 1CF3A 1M6IA 4F4RA 3ZYXA 1OJTA 3S5SA 5J60A 1ZXIC 5FS6A 4H4ZA 2H88A 3DJGX 1MOKA 3SQSA 2QJMA 1QO8A 1H7XA 1LV0A 4DYEA 4IVOB 1COYA 3QFBA 4H4XA 3ABVA 4TM4A 4IL0A 2XYOA 3ZVIA 3DJDA 1LTXR 1JPDX 2GR3A 1KDGA 3SZCA 2OLOA 4G6GA 3Q45A 4FP1A 4TVWA 1KNRA 2YG6A 2OVLA 4Y4LA 3AE4A 4GAPA 2Q0KA 2VOUA 2WS3A 4GIRA 4EQWA 4EWJA 4Z2RA 2QDEA 4O5QA 1CHUA 4FX9A 3GYIA 5ER0A 3M12A 4BK1A 1PXCA 2YM1A 4Z2TA 3EF6A 2R4JA 2ZZ0A 3T2ZA 2BRYA 3CXOA 3CAWA 3S5WA 3QSEA 2MNRA 2QDDA 2NQLA 3T9PA 3UKHA 1VDCA 2OZ8A 4C5OA 3FYYA 4J2WA 1SB3B 5FJTA 1V59A 4ICYA 1JROA 1FECA 2XFOA 2XCGA 3U9IA 1S3BA 1N62C 4U8NA 3DFHA 4K2SA 2TPRA 3TOYA 2YG3A 4AOSA 2AQJA 3B6DA 1ZY8A 3CNJA 5LV9A 4MJWA 2Q6UA 2PHHA 2OQHA 4B66A 5KVHA 4YWSA 3AEEA 3SQPA 3CNPA 1S7MA 2XVIA 3UTEA 4A6NA 1JPMA 1L9EA 3RP7A 2UZZA 2BK3A 1D5TA 2XGZA 3UTGA 4YKFA 4EMWA 3HYWA 4UP3A 1R0MA 2OQYA 3II4A 2QJNA 3UGVA 4C3XA 4Z43A 2WU5A 1DOEA 3VRDB 2BS2A 1GNDA 3IJQA 1T3QC 1YQ3A 4JN7A 2C67A 3SFDA 1JEHA 3UTHA 1N5WC 3T2KA 2GVCA 3NYCA 4TM3A 1PDYA 1OJCA 3LZWA 1EL8A 4MGGA 4UDPA 1CC2A 2VQ7A 3MUCA 3QVRA 2C75A 4TVYA 4C77A 1R6WA 4HNCA 2X8GA 3UJ2A 1Q1WA 3RGTA 2WDVA 3HRDC 1MRAA 1EBDA 4IV9A 4ECHA 1GRGA 4K8DA 4H50A 1JRZA 4YXDA 2GQWA 2FBWA 1WUFA 2PP3A 3ICSA 4XXGA 2P88A 3R1ZA 2HXTA 4YWOA 2R0GA 4X4JA 1B8SA 1E1NA 3UOZA 3ETRB 4K8GA 4KEMA 5G5GB 1XPQA 3SN0A 3B97A 3HZLA 1GT8A 4Z17A 1B5QA 2JK6A 2PGEA 1MUCA 2B9YA 4DX3A 4G8TA 3CTYA 1IUTA 3NK1X 1NHRA 2AL2A 3P4RA 2GQFA 3K1GA 2GV8A 3NRNA 4U8MA 4X9MA 1RSGA 3NHOX 2P0IA 2PS2A 1KCZA 1EL9A 2AL1A 1CJ3A 3NG7X 5KMQA 3CPIG 4AOXA 4KT2A 3IJLA 2GF3A 1PBFA 1CL0A 3GWFA 1DOCA 2GR2A 2C65A 3M13A 1F3PA 4GUVA 2QGYA 1PJ7A 2C3CA 2JKCA 2V5ZA 3PWIA 4II3A 2XFQA 3AD9B 4A79A 2GGEA 2Y6RA 1EC8A 4Z24A 2XVEA 2WP6A 4B1BA 2BS3A 1XS2A 4N9XA 2VRMA 4KPLA 3COXA 4ZN0A 2Z5YA 5HYMA 2QJJA 2YLRA 3UJEA 3F8DA 1X2HA 1ONFA 2FKPA 2OPJA 1N60C 3BJSA 3H7VA 2P3ZA 3AMZA 2CFYA 4HA6A 2E3TA 4J33A 3NVVB 5IDZA 2BK5A 4U2SA 4Z44A 3V3NA 3UJFA 4BK3A 3CYJA 4DSHA 1IUWA 3UP5A 3SJNA 4Z1YA 1VG9A 3D46A 1YQ4A 3VDGA 2WBAA 3H8AA 3AE1A 3DEQA 2BXRA 1IUVA 2GH5A 3P0WA 5BRTA 1GRTA 1XANA 4NZHA 4GRTA 4EMJA 5KVIA 3PWGA 4GYPC 4JY2A 4G7FA 1NELA 2GGJA 2V60A 4A35A 1ZP0A 4AT0A 3MQTA 1N4WA 1KKOA 1YY5A 3URHA 3EKGA 3OC4A 1EL7A 3ES8A 2IIDA 1N1PA 3ALLA 3S47A 2R45A 3QJ4A 3CIRA 4DWDA 1OJDA 3PO7A 4OPIA 1E39A 3UOVA 3N4FA 2OLAA 4MKSA 2XLSA 1FFUC 2R9ZA 3VC6A 3RITA 2YVFA 4FI4A 3SM8A 1NHSA 2BRAA 1GRHA 1D7LA 5L46A 1OEPA 4JY3A 2GSHA 4C3YA 2V6OA 3VA8A 2B76A 3ATRA 2BC1A 1DJQA 3P93A 2E5VA 1XDIA 3FPZA 1P48A 3B9JB 1L8PA 3E1TA 5GSNA 3KA7A 1F8RA 1MXTA 5FJUA 4K7ZA 5EOWA 3LZXA 3CPHG 5M0ZA 2BA9A 3TJIA 4G9KA 3VQRA 1JRYA 4ZCDA 2XFNA 2I0ZA 4U8LA 5IQ1A 3ZVHA 3FJ4A 5KOXA 2IVDA 3RHAA 4YSXA 2GEWA 4YT0A 2OAMA 4KPRA 3PG6A 1TE6A 2WDQA 3CNDA 1X31B 3TCSA 3CMMA 2XVFA 2E1MA 1K4QA 4A99A 1EL5A 4U8OA 2XLRA 4E8GA 4YTPA 2APGA 2CULA 2BCGG 4Z25A 4TLZA 3QSSA 3FV9A 4NTEA 1NENA 4D03A 2AKZA 3FBSA 1TDFA 4WX1A 1Y56B 2PODA 4IA5A 2V61A 3NYFA 4H4TA 1JDFA 3CB3A 3SR6B 5M10A 1VRQB 4EQXA 3LOVA 3BNMA 2X8HA 1Y0PA 2X50A 4HB9A 4JN9A 1YKJA 3H12A 4J34A 3P1WA 4JN8A 4J3ZA 1N63C 4KX6A 2B9XA 2YVGA 2WPEA 2XLTA 2C3DA 4NWZA 1FHUA 3UXLA 5JCMA 1FCDA 1STZA 3DMEA 1BZLA 3NTAA 4GF7A 5JCLA 3K7TA 2FJAA 1PBEA 3AYLA 4B68A 3GDPA 4E0VA 2HNEA 4E4FA 2JBVA 3UOYA 2OO6A 2C72A 1IUSA 3KD9A 4IVMB 3UOXA 3IHGA 3HPFA 3GY1A 1JU2A 1DNCA 5BUKA 4AT2A 3VR8A 5KXJA 1O94A 3AE5A 2OZTA 4FDCB 3U4FA 2OFJA 1NEKA 3QKEA 2GR0A 3ADAB 3AYJA 2YLXA 2CDUA 3V3WA 4GDEA 2WPFA 4H7UA 3GRSA 4Y4MA 4UDRA 1F9CA 1CJCA 2FYMA 4ZCWA 3G5RA 2YVJA 3HW2A 2W54A 2AR8A 3ZDNA 2WESA 3NH3X 1BGJA 3JSKA 1TYPA 1TRBA 2RABA 3SGLA 5IPYA 2E4GA 3SN1A 1N4UA 5U63A 1ZMCA 1PN0A 2ZZBA 2GAGB 1GPEA 4ENLA 1PDZA 1TDNA 3T37A 4A6NB 3FCPA 4M6UA 1ZK7A 3VR9A 2X99A 2ZADA 1EC7A 4RG3A 3UXKA 4IZGA 2GAHB 4ZOHB 3F8RA 4JNQA 1TDOA 3QVPA 2EQ8A 3R10A 4RG4A 4DHGA 3NVYB 3NIXA 1P43A 4BJYA 3A7UA 3D1CA 4JQ9A 2B9WA 1ONEA 1RYIA 2DW6A 3UJSA 1KN0A 4IP5A 1NHQA 2PTYA 5HHFA 3MZNA 4LA1A 1ZOVA 3ITJA 3AEGA 4OVIA 3RP8A 2ARDA 3DK8A 3CPJG 2C4CA 5U1OA 2BC0A 2V3AA 4Z2UA 3RO6A 1QJDA 3SZ0A 3KU9A 1UKVG 2HZGA 3O0HA 2GGHA 3UKFA 4U8JA 1E6EA 2R0CA 2XFPA 1BKWA 3N6HA 4I58A 4A7AA 1E1LA 2WU2A 2C64A 3DJJA 4U8IA 1KFYA 1GRFA 1MDLA 3P9UA 3EEZA 1GESA 2C73A 3RP6A 1DJNA 1TDEA 2AL2B 4H2RA 1Z6LA 2H89A 1WUEA 3SZWA 3H70A 1TYTA 2P8BA 2GDQA 3BHKA 1CC4A 4EIPA 3VCNA 2TMDA 2XDOA 3DA1A 1LPFA 3UP4A 2P8CA 2VZ2A 3A7AA 3D47A 4GDPA 2PU1A 4E6MA 1MDRA 5KNLA 4TM1A 4IA6A 3NS1B 1GRAA 3VRAA 3GYJA 3NZGA 3TWAA 1D4DA 2ONEA 3TJ4A 1B37A 2BACA 1BF3A 4UDQA 3MKCA 3IF9A 3GSIA 1OJAA 2XH2A 4X2PA 3CGDA 2W0HA 4U2TA 1B4VA 2OA1A
chains in the Genus database with same CATH topology
2BK4A 2YG5A 1GRHA 1D7LA 3S61A 4AP1A 3UKKA 2HQMA 5L46A 4JY3A 4C3YA 1CF3A 2V6OA 1L9CA 1LJ1A 1M6IA 3ZYXA 3F8PA 1OJTA 2B76A 3ATRA 5BVAA 2YM2A 5J60A 1S2YA 2BC1A 5KOWA 1DJQA 1IUUA 2E5VA 3D9XA 5FS6A 2GMHA 1H84A 4H4ZA 2Q7VA 4C74A 1XDIA 4A65A 3FPZA 5FS7A 3NN6X 4Y4NA 2WOVA 2H88A 3DJGX 3VRBA 3NLCA 1XHCA 4USQA 1MOKA 3REDA 3E1TA 5GSNA 4APNA 3KA7A 1F8RA 1QO8A 1MXTA 1AOGA 1H7XA 2RGHA 1LV0A 4K7ZA 3GYXA 3ICRA 1COYA 4IVOB 4EM4A 5EOWA 4YSZA 1ZDLA 3B3RA 3LZXA 3CPHG 5M0ZA 4YTMA 2BA9A 3QFBA 4G9KA 4H4XA 3ABVA 3VQRA 3AD8B 4TM4A 1JRYA 1GV4A 2XYOA 3DJDA 3GD3A 2BYBA 1H6VA 4ZCDA 3WE0A 2XFNA 1JOAA 2I0ZA 1LTXR 2GR3A 1KDGA 4U8LA 5IQ1A 3SZCA 4YSYA 2OLOA 1GERA 4G6GA 4YTNA 4H4RA 4H4SA 3LJPA 2C66A 2A89A 1KNRA 2YG6A 5KOXA 2IVDA 3RHAA 4YSXA 4Y4LA 3AE4A 4GAPA 2GEWA 3ATQA 1FEAA 4YT0A 2Q0KA 2OAMA 2B7SA 1GXFA 4OPCA 3AB1A 5U25A 3SX6A 2VOUA 4KPRA 3PG6A 2WS3A 3C96A 4USRA 4EQWA 1NHPA 4B67A 4Z2RA 3CNDA 2WDQA 4O5QA 1X31B 3UTFA 1CHUA 4FX9A 3GYIA 5ER0A 3M12A 3T0KA 3CMMA 1PJ5A 2XVFA 4BK1A 2E1MA 1PXCA 2YM1A 1K4QA 4A99A 4Z2TA 3GD4A 3EF6A 2QA1A 1EL5A 2R4JA 3G5QA 3EAOA 2ZZ0A 3AE6A 3PVCA 4U8OA 3T2ZA 2BRYA 4GAVA 2WDRA 2XLRA 5KMPA 3AEDA 4YTPA 1GTHA 2APGA 4CRTA 2CULA 1FL2A 4DSGA 2Q0LA 4XWZA 4NEWA 3S5WA 3QSEA 2BCGG 3FG2P 4Z25A 3UKHA 1VDCA 1NPXA 3GMCA 3V3OA 4TLZA 3QSSA 2QAEA 5CQFA 4C5OA 3IHMA 3P4QA 2YLZA 3AEBA 4J2WA 2YLSA 3NGCX 1NENA 4NTEA 4D03A 1V59A 1S2QA 5J7XA 4ICYA 4PABA 3FBSA 1FECA 1TDFA 3BI5A 2XFOA 2XCGA 4WX1A 1DOBA 1Y56B 2WEUA 4U8PA 2EQ7A 1ZMDA 4IA5A 2V61A 1S3BA 1L9DA 4B69A 2EQ6A 3NYFA 4H4TA 4RSLA 2DKHA 2OLNA 5M10A 4U8NA 4AP3A 1Q1RA 3ALMA 1VRQB 4EQXA 3LOVA 3BNMA 2X8HA 1Y0PA 3CN8A 2TPRA 2X50A 4HB9A 4JN9A 1YKJA 1GTEA 4J34A 3P1WA 2VRLA 4KX6A 2WPCA 2YG3A 5BULA 5HY5A 4AOSA 2B9XA 2AQJA 2YVGA 1ZY8A 2PYXA 3B6DA 3CNJA 4MJWA 4B64A 5LV9A 2WPEA 2B7RA 2XLTA 3C4NA 4FK1C 2C3DA 2Q6UA 4NWZA 2PHHA 2X8CA 5CKUA 2CVJA 1LQTA 4B66A 5JCMA 1FCDA 5KVHA 1P2EA 1E1MA 3DMEA 1BZLA 3NTAA 3AEEA 4GF7A 2GMJA 2WETA 5JCLA 3SQPA 4EM3A 1ZOYA 3CNPA 5TR3A 4H2QA 5C2TA 1S7MA 3K7TA 2FJAA 2XVIA 1PBEA 3UTEA 4A6NA 3AYLA 4U2LA 4B68A 3AYIA 3P4PA 4OPGA 2R46A 1L9EA 2GRTA 3GDPA 3H8IA 3LADA 2UZZA 3HYXA 2JBVA 4NTDA 3RP7A 3AWIA 2BK3A 1D5TA 2WHDA 2C72A 2JB3A 3ALJA 1DXLA 1IUSA 4K5SA 3R9UA 1H83A 3UTGA 4O5UA 4GR1A 3KD9A 4IVMB 3UOXA 4YKFA 3IHGA 4EMWA 3HYWA 4H2PA 4UP3A 3Q9TA 4OPTA 1JU2A 3II4A 3BI2A 4C3XA 4CNJA 1DNCA 4YSHA 4Z43A 3K7MX 3EANA 5BUKA 1JRXA 2RGJA 2WU5A 3IC9A 4G6HA 2BS4A 4AT2A 3AE9A 3VR8A 1GEUA 1DOEA 2YG7A 2BS2A 1GNDA 3VRDB 4A9WA 3UCLA 1PXAA 5KXJA 1YQZA 1YQ3A 2C67A 2DKIA 3SFDA 4DGKA 4NNJA 1JEHA 1O94A 3AE5A 3UTHA 1O95A 2C76A 3L5OA 3T2KA 4FDCB 4BV6A 2GVCA 3NYCA 4II2A 4CY6A 1NEKA 4NEVA 2WP9A 4YKGA 4TM3A 5KMSA 4K22A 1TDKA 1GREA 2O9ZA 4G74A 2GR0A 5EB4A 1NDAA 1OJCA 3LZWA 1EL8A 3ADAB 1ELIA 4TM0A 4UDPA 3AYJA 2YLXA 2NPXA 2CDUA 1CC2A 4GDEA 2WPFA 4H7UA 2VQ7A 1GOSA 3GRSA 3QVRA 1PHHA 5GRTA 2C75A 4C77A 4Y4MA 4UDRA 1CJ4A 1CJCA 2X8GA 5KRQA 3G5RA 1KSSA 2YVJA 1MO9A 1Q1WA 1IJHA 1PS9A 3AECA 2AR8A 3ZDNA 2WDVA 3AEFA 2WESA 3NH3X 5JCKA 3EPTA 4CCQA 1LQUA 1BGJA 1E1KA 3JSKA 4B65A 1EBDA 4XWRA 3H8LA 1TYPA 4GCMA 1F8SA 1TRBA 2RABA 2XVHA 3NKSA 4IV9A 5KWFA 2FJBA 4ECHA 1PBCA 1GRGA 2YLWA 2GB0A 3NK0X 3P4SA 3SGLA 4K8DA 4H50A 1JRZA 5IPYA 3K30A 1HYUA 4H4VA 2RGOA 2F5ZA 1GALA 4YXDA 2GQWA 3DK9A 2E4GA 5JCIA 1PJ6A 2FBWA 1VQWA 4XXGA 1N4UA 3ICSA 5U63A 1ZMCA 1PN0A 4YWOA 3PS9A 2ZZBA 3CGBA 1D4CA 1CJ2A 2R0GA 3QFAA 4K5RA 1B8SA 1E7PA 4X4JA 2WOIA 3BI4A 4DNAA 1O5WA 1E1NA 2GAGB 2JAEA 1GPEA 5KMRA 3UOZA 1XPQA 4ZCCA 1BWCA 2AAQA 3DGZA 3IWAA 1H7WA 5FS8A 1ZX9A 3HZLA 1TDNA 3T37A 1GT8A 2WQYA 5IQ4A 2YWLA 3HYVA 4A6NB 1ZK7A 4P9SA 3VR9A 2X99A 1B5QA 2VVMA 4FK1A 4U8MA 2JK6A 1JNRA 4RG3A 1F6MA 2GAHB 4Z26A 3T2YA 4H4WA 2B9YA 3KVEA 4BURA 3CTYA 1IUTA 1K0LA 3UKQA 3NK1X 1NHRA 1BGNA 3GDNA 2XFUA 3F8RA 1N4VA 2GQFA 3K7QX 3M0OA 3P4RA 1M64A 4JNQA 1TDOA 3AE7A 4EMIA 2GV8A 3NRNA 4OPDA 3QVPA 1W4XA 4H4UA 4I59A 1RSGA 2VVLA 2BABA 3NHOX 2EQ8A 3AD7B 2VVLG 3ISHA 4X9MA 4CNKA 3CNSA 4RG4A 4LU6A 3DGHA 4OPLA 2A8XA 4H4YA 4NTCA 1QLBA 4JDRA 1EL9A 3NIXA 4ADWA 1CJ3A 3NG7X 3ICTA 5KMQA 2YR6A 3CPIG 4AOXA 4BJYA 3DK4A 2QA2A 3D1CA 3SFEA 3UOYA 4JQ9A 2B9WA 1D7YA 2GF3A 1PBFA 1CL0A 3GWFA 2NVKX 2EQ9A 1D4EA 1RYIA 5C3JA 1DOCA 3DJEA 2GR2A 2C65A 3QSMA 3RNMA 1KN0A 3M13A 2FJEA 1F3PA 1H82A 3L8KA 1GSNA 4GUVA 1NHQA 1PJ7A 2C3CA 2JKCA 4CBQA 2V5ZA 2YR4A 4II3A 1GETA 4H2NA 2XFQA 3KLJA 5HHFA 3AD9B 4A79A 4LA1A 1ZOVA 4PAAA 2Y6RA 3ITJA 4Z24A 2XVEA 5JCNA 3AEGA 4OVIA 3T31A 4J57A 2WP6A 4G73A 2ARDA 3RP8A 4CCRA 1CC6A 3DK8A 3H4KA 2BS3A 3D8XA 4B1BA 3CPJG 2C4CA 2ACZA 5U1OA 2BC0A 2V3AA 1PBBA 2Y6QA 4N9XA 4CY8A 4Z2UA 2VRMA 2YG4A 3G5SA 1OJ9A 2IVEA 1QJDA 3SZ0A 1PXBA 3KU9A 2YLTA 1UKVG 3T14A 1Q9IA 3COXA 1H81A 3O0HA 4ZN0A 5HXIA 2Z5YA 5HYMA 4WCTA 2YLRA 3UKFA 4U8JA 3NK2X 2ZBWA 3F8DA 1E6EA 1KNPA 4OPUA 4BK2A 3CGEA 5EBKA 1ONFA 3GMBA 3UKAA 2R0CA 4EIQA 2XFPA 1S3EA 1IUXA 2CFYA 5DBJA 4HA6A 1BKWA 1SEZA 4I58A 4A7AA 2GR1A 1E1LA 2VQBA 2WU2A 3I6DA 4J33A 2C64A 3Q6JA 3DJJA 4H4QA 3FMWA 2BK5A 4U8IA 1KFYA 4EQSA 2XLPA 4BJZA 2R4EA 1NG4A 4U2SA 1DODA 1FOHA 4Z44A 1GRFA 2FJDA 3P9UA 3V3NA 1GESA 2WOWA 3CGCA 2C73A 3SY4A 4BK3A 1F8WA 3RP6A 3NN0X 4X9NA 1DJNA 4LIIA 4DSHA 1TDEA 3I3LA 1IUWA 1REOA 3UP5A 1GRBA 1LVLA 3GRTA 2V3BA 1Z6LA 2H89A 4H2RA 3V76A 4EQRA 1VG9A 4H4PA 3AEAA 1YQ4A 3SZWA 1P2HA 1TYTA 1KSUA 2C7GA 3LB8A 4B63A 2XLUA 3BHFA 2WP5A 3BHKA 1CC4A 4EIPA 1FEBA 2JB1A 2WBAA 2TMDA 3AE1A 2BXRA 1IUVA 3UKLA 2GH5A 1NAAA 5BRTA 2XDOA 3DA1A 1LPFA 4J56A 1GRTA 1XANA 3UP4A 4NZHA 4REKA 3DH9A 3CNTA 4GRTA 2VZ2A 4EMJA 5KVIA 3NYEA 5FMHA 3AE8A 1NG3A 1VG0A 2ZZCA 3SZFA 5EB5A 1H2IA 2J3NA 4JY2A 3KKJA 4GDPA 4A5LA 2JB2A 2BXSA 1PBDA 3L1RA 3LXDA 3UKPA 2V60A 1ZP0A 1PDHA 4OCGA 3SYIA 5JRBA 4AT0A 5KNLA 1JNZA 2C70A 1N4WA 1RP0A 3BNUA 4TM1A 2BCPA 1YY5A 3URHA 3GWDA 4IA6A 1GRAA 3VRAA 3C4AA 3OC4A 3NTDA 1EL7A 3OZ2A 2YQUA 2IIDA 4K2XA 1N1PA 3GYJA 3KPFA 4D04A 1L0VA 1D4DA 1H86A 3ALLA 4TLXA 3SXIA 1B37A 2BACA 3AXBA 1BF3A 3NT6A 4JNAA 2YAUA 4J36A 4UDQA 2QCUA 2R45A 3QJ4A 4U8KA 3IF9A 3CIRA 3GSIA 3AE3A 1OJAA 1OJDA 3PO7A 5FS9A 1KF6A 3FIMB 4OPIA 2R0PA 2YR5A 2OALA 1E39A 3UOVA 4E0VA 2Z5XA 2X3NA 4J31A 3KPKA 1K0IA 2XLSA 1CBOA 1ZKQA 3AE2A 2XVJA 2R9ZA 3CGDA 2W0HA 2YVFA 2A87A 3NNEA 4U2TA 1B4VA 1NHSA 3SM8A 4M52A 2BRAA 1Y56A 1K0JA 2OA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BK4 A;  2YG5 A;  1GRH A;  1D7L A;  3S61 A;  4AP1 A;  3UKK A;  2HQM A;  5L46 A;  4JY3 A;  4C3Y A;  1CF3 A;  2V6O A;  1L9C A;  1LJ1 A;  1M6I A;  3ZYX A;  3F8P A;  1OJT A;  2B76 A;  3ATR A;  5BVA A;  2YM2 A;  5J60 A;  1S2Y A;  2BC1 A;  5KOW A;  1DJQ A;  1IUU A;  2E5V A;  5FS6 A;  2GMH A;  1H84 A;  4H4Z A;  2Q7V A;  4C74 A;  1XDI A;  4A65 A;  3FPZ A;  5FS7 A;  3NN6 X;  4Y4N A;  2WOV A;  2H88 A;  3DJG X;  3VRB A;  3NLC A;  1XHC A;  4USQ A;  1MOK A;  3RED A;  3E1T A;  5GSN A;  4APN A;  3KA7 A;  1F8R A;  1QO8 A;  1MXT A;  1AOG A;  1H7X A;  2RGH A;  1LV0 A;  4K7Z A;  3ICR A;  4IVO B;  1COY A;  4YSZ A;  4EM4 A;  5EOW A;  1ZDL A;  3B3R A;  3LZX A;  3CPH G;  5M0Z A;  4YTM A;  2BA9 A;  3QFB A;  4H4X A;  3ABV A;  3VQR A;  3AD8 B;  4TM4 A;  1JRY A;  1GV4 A;  2XYO A;  3DJD A;  3GD3 A;  2BYB A;  1H6V A;  4ZCD A;  3WE0 A;  2XFN A;  1JOA A;  2I0Z A;  1LTX R;  2GR3 A;  1KDG A;  4U8L A;  5IQ1 A;  4YSY A;  2OLO A;  1GER A;  4YTN A;  4H4R A;  4H4S A;  3LJP A;  2C66 A;  2A89 A;  1KNR A;  2YG6 A;  5KOX A;  2IVD A;  3RHA A;  4YSX A;  4Y4L A;  3AE4 A;  2GEW A;  3ATQ A;  1FEA A;  4YT0 A;  2Q0K A;  2OAM A;  2B7S A;  1GXF A;  4OPC A;  3AB1 A;  5U25 A;  2VOU A;  4KPR A;  2WS3 A;  3C96 A;  4USR A;  4EQW A;  1NHP A;  4B67 A;  4Z2R A;  3CND A;  2WDQ A;  4O5Q A;  1X31 B;  3UTF A;  1CHU A;  4FX9 A;  3GYI A;  5ER0 A;  3M12 A;  1PJ5 A;  2XVF A;  4BK1 A;  2E1M A;  1PXC A;  2YM1 A;  1K4Q A;  4A99 A;  4Z2T A;  3GD4 A;  3EF6 A;  2QA1 A;  1EL5 A;  2R4J A;  3G5Q A;  3EAO A;  2ZZ0 A;  3AE6 A;  3PVC A;  4U8O A;  2WDR A;  2XLR A;  3AED A;  4YTP A;  1GTH A;  2APG A;  4CRT A;  2CUL A;  1FL2 A;  4DSG A;  2Q0L A;  4XWZ A;  4NEW A;  3S5W A;  3QSE A;  2BCG G;  3FG2 P;  4Z25 A;  3UKH A;  1VDC A;  1NPX A;  3GMC A;  3V3O A;  4TLZ A;  3QSS A;  2QAE A;  5CQF A;  4C5O A;  3IHM A;  3P4Q A;  2YLZ A;  3AEB A;  4J2W A;  2YLS A;  3NGC X;  1NEN A;  4NTE A;  4D03 A;  1V59 A;  1S2Q A;  5J7X A;  4ICY A;  4PAB A;  3FBS A;  1FEC A;  1TDF A;  3BI5 A;  2XFO A;  2XCG A;  4WX1 A;  1DOB A;  1Y56 B;  2WEU A;  4U8P A;  2EQ7 A;  1ZMD A;  4IA5 A;  2V61 A;  1S3B A;  1L9D A;  4B69 A;  2EQ6 A;  3NYF A;  4H4T A;  4RSL A;  2DKH A;  2OLN A;  5M10 A;  4U8N A;  4AP3 A;  1Q1R A;  3ALM A;  1VRQ B;  4EQX A;  3LOV A;  3BNM A;  2X8H A;  1Y0P A;  3CN8 A;  2TPR A;  2X50 A;  4HB9 A;  4JN9 A;  1YKJ A;  1GTE A;  4J34 A;  3P1W A;  2VRL A;  4KX6 A;  2WPC A;  2YG3 A;  5BUL A;  5HY5 A;  4AOS A;  2B9X A;  2AQJ A;  2YVG A;  1ZY8 A;  2PYX A;  3B6D A;  3CNJ A;  4MJW A;  4B64 A;  5LV9 A;  2WPE A;  2B7R A;  2XLT A;  3C4N A;  4FK1 C;  2C3D A;  2Q6U A;  2PHH A;  2X8C A;  5CKU A;  2CVJ A;  1LQT A;  4B66 A;  5JCM A;  1FCD A;  5KVH A;  1P2E A;  1E1M A;  3DME A;  1BZL A;  3NTA A;  3AEE A;  4GF7 A;  2GMJ A;  2WET A;  5JCL A;  3SQP A;  4EM3 A;  1ZOY A;  3CNP A;  5TR3 A;  4H2Q A;  5C2T A;  3K7T A;  2FJA A;  2XVI A;  1PBE A;  3UTE A;  4A6N A;  3AYL A;  4U2L A;  4B68 A;  3AYI A;  3P4P A;  4OPG A;  2R46 A;  1L9E A;  2GRT A;  3GDP A;  3H8I A;  3LAD A;  2UZZ A;  4NTD A;  2JBV A;  3RP7 A;  4E0V A;  3AWI A;  2BK3 A;  1D5T A;  2WHD A;  2C72 A;  2JB3 A;  3ALJ A;  1DXL A;  1IUS A;  4K5S A;  3R9U A;  1H83 A;  3UTG A;  4O5U A;  4GR1 A;  3KD9 A;  4IVM B;  3UOX A;  4YKF A;  3IHG A;  4EMW A;  4H2P A;  4UP3 A;  3Q9T A;  4OPT A;  1JU2 A;  3II4 A;  3BI2 A;  4C3X A;  4CNJ A;  1DNC A;  4YSH A;  4Z43 A;  3K7M X;  3EAN A;  5BUK A;  1JRX A;  2RGJ A;  2WU5 A;  3IC9 A;  4AT2 A;  2BS4 A;  3AE9 A;  3VR8 A;  1GEU A;  1DOE A;  2YG7 A;  2BS2 A;  1GND A;  3VRD B;  4A9W A;  3UCL A;  1PXA A;  5KXJ A;  1YQZ A;  1YQ3 A;  2C67 A;  2DKI A;  3SFD A;  4DGK A;  1JEH A;  1O94 A;  3AE5 A;  3UTH A;  1O95 A;  2C76 A;  4FDC B;  4BV6 A;  2GVC A;  3NYC A;  4CY6 A;  1NEK A;  4NEV A;  2WP9 A;  4YKG A;  4TM3 A;  4K22 A;  1TDK A;  1GRE A;  2O9Z A;  2GR0 A;  5EB4 A;  1NDA A;  1OJC A;  3LZW A;  1EL8 A;  3ADA B;  1ELI A;  4TM0 A;  4UDP A;  3AYJ A;  2YLX A;  2NPX A;  2CDU A;  1CC2 A;  4GDE A;  2WPF A;  4H7U A;  2VQ7 A;  1GOS A;  3GRS A;  3QVR A;  1PHH A;  5GRT A;  2C75 A;  4C77 A;  4Y4M A;  4UDR A;  1CJ4 A;  1CJC A;  2X8G A;  5KRQ A;  3G5R A;  1KSS A;  2YVJ A;  1MO9 A;  1Q1W A;  1IJH A;  1PS9 A;  3AEC A;  2AR8 A;  3ZDN A;  2WDV A;  3AEF A;  2WES A;  3NH3 X;  5JCK A;  3EPT A;  4CCQ A;  1LQU A;  1BGJ A;  1E1K A;  3JSK A;  4B65 A;  1EBD A;  4XWR A;  3H8L A;  1TYP A;  4GCM A;  1F8S A;  1TRB A;  2RAB A;  2XVH A;  3NKS A;  4IV9 A;  5KWF A;  2FJB A;  4ECH A;  1PBC A;  1GRG A;  2YLW A;  2GB0 A;  3NK0 X;  3P4S A;  3SGL A;  4K8D A;  4H50 A;  1JRZ A;  5IPY A;  3K30 A;  1HYU A;  4H4V A;  2RGO A;  2F5Z A;  1GAL A;  4YXD A;  2GQW A;  3DK9 A;  2E4G A;  5JCI A;  1PJ6 A;  2FBW A;  1VQW A;  4XXG A;  1N4U A;  3ICS A;  5U63 A;  1ZMC A;  1PN0 A;  4YWO A;  3PS9 A;  2ZZB A;  3CGB A;  1D4C A;  1CJ2 A;  2R0G A;  3QFA A;  4K5R A;  1B8S A;  1E7P A;  4X4J A;  2WOI A;  3BI4 A;  4DNA A;  1O5W A;  1E1N A;  2GAG B;  2JAE A;  1GPE A;  3UOZ A;  1XPQ A;  4ZCC A;  1BWC A;  2AAQ A;  3DGZ A;  3IWA A;  1H7W A;  5FS8 A;  1ZX9 A;  3HZL A;  1TDN A;  3T37 A;  1GT8 A;  2WQY A;  5IQ4 A;  2YWL A;  4A6N B;  1ZK7 A;  4P9S A;  3VR9 A;  2X99 A;  1B5Q A;  2VVM A;  4FK1 A;  4U8M A;  2JK6 A;  1JNR A;  4RG3 A;  1F6M A;  2GAH B;  4Z26 A;  4H4W A;  2B9Y A;  3KVE A;  4BUR A;  3CTY A;  1IUT A;  1K0L A;  3UKQ A;  3NK1 X;  1NHR A;  1BGN A;  3GDN A;  2XFU A;  3F8R A;  1N4V A;  2GQF A;  3K7Q X;  3M0O A;  3P4R A;  1M64 A;  4JNQ A;  1TDO A;  3AE7 A;  4EMI A;  2GV8 A;  3NRN A;  4OPD A;  3QVP A;  1W4X A;  4H4U A;  4I59 A;  1RSG A;  2VVL A;  2BAB A;  3NHO X;  2EQ8 A;  3AD7 B;  2VVL G;  3ISH A;  4X9M A;  4CNK A;  3CNS A;  4RG4 A;  4LU6 A;  3DGH A;  4OPL A;  2A8X A;  4H4Y A;  4NTC A;  1QLB A;  4JDR A;  1EL9 A;  3NIX A;  4ADW A;  1CJ3 A;  3NG7 X;  3ICT A;  2YR6 A;  3CPI G;  4AOX A;  4BJY A;  3DK4 A;  2QA2 A;  3D1C A;  3SFE A;  3UOY A;  4JQ9 A;  2B9W A;  1D7Y A;  2GF3 A;  1PBF A;  1CL0 A;  3GWF A;  2NVK X;  2EQ9 A;  1D4E A;  1RYI A;  5C3J A;  1DOC A;  3DJE A;  2GR2 A;  2C65 A;  3QSM A;  3RNM A;  3M13 A;  2FJE A;  1F3P A;  1H82 A;  3L8K A;  1GSN A;  4GUV A;  1NHQ A;  1PJ7 A;  2C3C A;  2JKC A;  4CBQ A;  2V5Z A;  2YR4 A;  1GET A;  4H2N A;  2XFQ A;  3KLJ A;  5HHF A;  3AD9 B;  4A79 A;  4LA1 A;  1ZOV A;  4PAA A;  2Y6R A;  3ITJ A;  4Z24 A;  2XVE A;  5JCN A;  3AEG A;  4OVI A;  4J57 A;  2WP6 A;  3RP8 A;  2ARD A;  4CCR A;  1CC6 A;  3DK8 A;  3H4K A;  2BS3 A;  3D8X A;  4B1B A;  3CPJ G;  2ACZ A;  5U1O A;  2BC0 A;  1PBB A;  2V3A A;  2Y6Q A;  4N9X A;  4CY8 A;  4Z2U A;  2VRM A;  2YG4 A;  3G5S A;  1OJ9 A;  2IVE A;  1QJD A;  1PXB A;  3KU9 A;  2YLT A;  1UKV G;  1Q9I A;  3COX A;  1H81 A;  3O0H A;  4ZN0 A;  5HXI A;  2Z5Y A;  5HYM A;  4WCT A;  2YLR A;  3UKF A;  4U8J A;  3NK2 X;  2ZBW A;  3F8D A;  1E6E A;  1KNP A;  4OPU A;  4BK2 A;  3CGE A;  5EBK A;  1ONF A;  3GMB A;  3UKA A;  2R0C A;  4EIQ A;  2XFP A;  1S3E A;  1IUX A;  2CFY A;  5DBJ A;  4HA6 A;  1BKW A;  1SEZ A;  4I58 A;  4A7A A;  2GR1 A;  1E1L A;  2VQB A;  2WU2 A;  3I6D A;  4J33 A;  2C64 A;  3Q6J A;  3DJJ A;  4H4Q A;  3FMW A;  2BK5 A;  4U8I A;  1KFY A;  4EQS A;  2XLP A;  4BJZ A;  2R4E A;  1NG4 A;  4U2S A;  1DOD A;  1FOH A;  4Z44 A;  1GRF A;  2FJD A;  3P9U A;  3V3N A;  1GES A;  2WOW A;  3CGC A;  2C73 A;  4BK3 A;  1F8W A;  3RP6 A;  3NN0 X;  4X9N A;  1DJN A;  4LII A;  4DSH A;  1TDE A;  3I3L A;  1IUW A;  1REO A;  3UP5 A;  1GRB A;  1LVL A;  3GRT A;  1Z6L A;  2H89 A;  2V3B A;  4H2R A;  3V76 A;  4EQR A;  1VG9 A;  4H4P A;  3AEA A;  1YQ4 A;  1P2H A;  1TYT A;  1KSU A;  2C7G A;  3LB8 A;  4B63 A;  2XLU A;  3BHF A;  2WP5 A;  3BHK A;  1CC4 A;  4EIP A;  1FEB A;  2JB1 A;  2WBA A;  2TMD A;  3AE1 A;  2BXR A;  1IUV A;  3UKL A;  2GH5 A;  1NAA A;  5BRT A;  2XDO A;  3DA1 A;  1LPF A;  4J56 A;  1GRT A;  1XAN A;  3UP4 A;  4NZH A;  4REK A;  3DH9 A;  3CNT A;  4GRT A;  2VZ2 A;  4EMJ A;  5KVI A;  3NYE A;  5FMH A;  3AE8 A;  1NG3 A;  1VG0 A;  2ZZC A;  5EB5 A;  2J3N A;  4JY2 A;  3KKJ A;  4GDP A;  4A5L A;  2JB2 A;  2BXS A;  1PBD A;  3L1R A;  3LXD A;  3UKP A;  2V60 A;  1ZP0 A;  1PDH A;  4OCG A;  4AT0 A;  1JNZ A;  2C70 A;  1N4W A;  1RP0 A;  3BNU A;  4TM1 A;  2BCP A;  1YY5 A;  3URH A;  3GWD A;  4IA6 A;  1GRA A;  3VRA A;  3C4A A;  3OC4 A;  3NTD A;  1EL7 A;  3OZ2 A;  2YQU A;  2IID A;  4K2X A;  1N1P A;  3GYJ A;  3KPF A;  4D04 A;  1L0V A;  1D4D A;  1H86 A;  3ALL A;  4TLX A;  1B37 A;  2BAC A;  3AXB A;  1BF3 A;  3NT6 A;  4JNA A;  2YAU A;  4J36 A;  4UDQ A;  2QCU A;  2R45 A;  3QJ4 A;  4U8K A;  3IF9 A;  3CIR A;  3GSI A;  3AE3 A;  1OJA A;  1OJD A;  3PO7 A;  5FS9 A;  1KF6 A;  3FIM B;  4OPI A;  2R0P A;  2YR5 A;  2OAL A;  1E39 A;  3UOV A;  2Z5X A;  2X3N A;  4J31 A;  1K0I A;  2XLS A;  1CBO A;  1ZKQ A;  3AE2 A;  2XVJ A;  2R9Z A;  3CGD A;  2W0H A;  2YVF A;  2A87 A;  3NNE A;  4U2T A;  1B4V A;  1NHS A;  3SM8 A;  4M52 A;  1Y56 A;  1K0J A;  2OA1 A; 
#chains in the Genus database with same CATH topology
 2YG5 A;  3S61 A;  1L9C A;  5KOW A;  3D9X A;  3QN3 A;  2GMH A;  4C74 A;  2WOV A;  1XHC A;  4IHC A;  4USQ A;  3RED A;  4APN A;  4HPN A;  1AOG A;  2RGH A;  3ICR A;  4YSZ A;  4EM4 A;  1ZDL A;  1RM6 B;  3AD8 B;  3VFC A;  3NRZ B;  1H6V A;  4YSY A;  1GER A;  4H4S A;  3LJP A;  1WYG A;  3R25 A;  1EBH A;  3N6J A;  3TWB A;  3ATQ A;  2B7S A;  3I6E A;  4OPC A;  5U25 A;  3SX6 A;  4USR A;  1NHP A;  3I4K A;  1BQG A;  4ZA0 A;  3T0K A;  3QPE A;  1PJ5 A;  4GYP A;  1FO4 A;  2XH0 A;  2QA1 A;  5BOE A;  2PCE A;  3EAO A;  3T8Q A;  3AE6 A;  1TZZ A;  1FL2 A;  2Q0L A;  4XWZ A;  3KUM A;  4HCD A;  3GMC A;  2QAE A;  3IHM A;  4E5T A;  3AEB A;  2YLS A;  3NGC X;  5J7X A;  3BI5 A;  3JVA A;  2WEU A;  5FJR A;  3MSY A;  1ZMD A;  4B69 A;  2EQ6 A;  2DKH A;  2OLN A;  4AP3 A;  1Q1R A;  3ALM A;  3OW1 A;  3DDM A;  3STP A;  3BSM A;  1GTE A;  2OZ3 A;  3VC5 A;  2PGW A;  2WPC A;  2POZ A;  5HY5 A;  1X2G A;  3ZLH A;  5BOF A;  2B7R A;  3C4N A;  4FK1 C;  3R0U A;  3DG3 A;  1N5X A;  1LQT A;  1P2E A;  3IK4 A;  2GMJ A;  4H2Q A;  4HCL A;  3P4P A;  3HYX A;  1JRP A;  1EC9 A;  3AWI A;  2WHD A;  3ALJ A;  2JB3 A;  3R9U A;  1DXL A;  4O5U A;  3ZVH B;  4H2P A;  4CNJ A;  3AM9 A;  4G6H A;  2PTX A;  2BS4 A;  3UCC A;  1GEU A;  2YG7 A;  1PXA A;  7ENL A;  1YQZ A;  2DKI A;  4DGK A;  4A3R A;  3CK5 A;  1O95 A;  2C76 A;  3L5O A;  1N61 C;  4BV6 A;  4II2 A;  4CY6 A;  4NEV A;  2WP9 A;  4YKG A;  5FJO A;  5KMS A;  1TDK A;  4G74 A;  3JZU A;  5EB4 A;  1NDA A;  4TM0 A;  2NPX A;  3OZY A;  1GOS A;  1PHH A;  2XH7 A;  1SJA A;  1CJ4 A;  3AEC A;  3BOX A;  5JCK A;  3EPT A;  4CCQ A;  1E1K A;  4B65 A;  4XWR A;  4GCM A;  1F8S A;  3NKS A;  1PBC A;  3UJR A;  1YEY A;  3K30 A;  1HYU A;  2RGO A;  2F5Z A;  1GAL A;  3DK9 A;  5JCI A;  1ECQ A;  2QQ6 A;  2PTW A;  3PS9 A;  3CGB A;  3R0K A;  3QFA A;  1E7P A;  2WOI A;  3OPS A;  3BI4 A;  4DNA A;  2JAE A;  5KMR A;  3MWC A;  1BWC A;  1H7W A;  5EU9 A;  4GGB A;  5IQ4 A;  2YWL A;  3HYV A;  4P9S A;  1JNR A;  6ENL A;  4IP4 A;  4H4W A;  3KVE A;  3GO2 A;  4BUR A;  3DG6 A;  3UKQ A;  1N4V A;  4EMI A;  1XPY A;  2W55 A;  1W4X A;  4I59 A;  2VVL A;  2BAB A;  3ISH A;  3AD7 B;  3CNS A;  4LU6 A;  3DGH A;  2CHR A;  2A8X A;  4H4Y A;  4JDR A;  2YR6 A;  3TW9 A;  2QA2 A;  3SFE A;  2NVK X;  2EQ9 A;  1D4E A;  3DJE A;  3ENL A;  1E9I A;  3FVD A;  1H82 A;  3R07 C;  3OP2 A;  4IL2 A;  4HN8 A;  1GET A;  4H2N A;  3KLJ A;  4PAA A;  4J57 A;  4G73 A;  1CC6 A;  3H4K A;  2AKM A;  3D8X A;  2Y6Q A;  4CY8 A;  2PSN A;  2GGI A;  3G5S A;  1OJ9 A;  2IVE A;  3DER A;  3NVZ B;  1PXB A;  2XH4 A;  3VCC A;  1Q9I A;  1H81 A;  5HXI A;  3GC2 A;  2PP1 A;  1TKK A;  3RR1 A;  3NK2 X;  2PMQ A;  1KNP A;  4H83 A;  5EBK A;  3UKA A;  4H2H A;  1S3E A;  3Q4D A;  5DBJ A;  4GFI A;  3I6D A;  3SSZ A;  3Q6J A;  4BJZ A;  2R4E A;  1DOD A;  1FOH A;  2FJD A;  3DES A;  3SY4 A;  3TTE A;  4LII A;  3I3L A;  1REO A;  4A6G A;  2V3B A;  4EQR A;  3DG7 A;  4H4P A;  3AEA A;  3NXL A;  1P2H A;  1KSU A;  2C7G A;  3LB8 A;  2XLU A;  3UKL A;  1NAA A;  1W6T A;  3V5F A;  2QVH A;  3NYE A;  3AE8 A;  1NG3 A;  4GGH A;  1VG0 A;  5EB5 A;  2J3N A;  3KKJ A;  4A5L A;  2JB2 A;  2BXS A;  1PBD A;  1FHV A;  3UKP A;  1PDH A;  5JRB A;  1RP0 A;  2OG9 A;  2BCP A;  3NTD A;  3OZ2 A;  4D04 A;  4ROP A;  1H86 A;  3AXB A;  2MUC A;  3PFR A;  3NT6 A;  2YAU A;  4J36 A;  4U8K A;  5FS9 A;  3FIM B;  1EBG A;  2OAL A;  2X3N A;  2XVJ A;  3UCD A;  2A87 A;  3NNE A;  3V4B A;  3DFY A;  1ELS A;  2PPG A;  1K0J A;  4AP1 A;  2PP0 A;  2HQM A;  3MY9 A;  3NO1 A;  1LJ1 A;  3F8P A;  5BVA A;  1FIQ B;  2YM2 A;  1S2Y A;  1IUU A;  1H84 A;  2Q7V A;  4A65 A;  5FS7 A;  3NN6 X;  4Y4N A;  3OZM A;  3ES7 A;  3VRB A;  3NLC A;  3GYX A;  3B3R A;  2GL5 A;  1IYX A;  4YTM A;  1GV4 A;  3THU A;  3GD3 A;  2BYB A;  3WE0 A;  1JOA A;  4YTN A;  3JW7 A;  4H4R A;  2C66 A;  2A89 A;  2RDX A;  3QTP A;  1FEA A;  1GXF A;  3AB1 A;  3C96 A;  1NU5 A;  1DTN A;  4B67 A;  3UTF A;  3RRA A;  2W3S A;  3GD4 A;  3PK7 A;  3G5Q A;  3PVC A;  4H19 A;  4GAV A;  2WDR A;  3DIP A;  3AED A;  5KMP A;  1GTH A;  4CRT A;  4DSG A;  3NFU A;  4NEW A;  3FG2 P;  1NPX A;  3V3O A;  5CQF A;  3P4Q A;  2YLZ A;  4DXK A;  1S2Q A;  2DW7 A;  4PAB A;  2PTZ A;  5FJP A;  1DOB A;  4U8P A;  2EQ7 A;  1L9D A;  4RSL A;  2OX4 A;  3CN8 A;  3N4E A;  4K1W A;  2VRL A;  5BUL A;  3I6T A;  3P3B A;  2PYX A;  4B64 A;  2X8C A;  5CKU A;  2CVJ A;  3V5C A;  2O56 A;  1E1M A;  2ZC8 A;  3OTR A;  2WET A;  4DN1 A;  4EM3 A;  1RVK A;  1ZOY A;  5TR3 A;  5C2T A;  3IJI A;  4U2L A;  3AYI A;  4OPG A;  2R46 A;  3H8I A;  2GRT A;  3LAD A;  4NTD A;  2E5A A;  4K5S A;  1H83 A;  4GR1 A;  3T6C A;  3Q9T A;  4OPT A;  1KD0 A;  1SJB A;  3BI2 A;  4YSH A;  3AN1 A;  3T4W A;  3K7M X;  3EAN A;  1JRX A;  2RGJ A;  3IC9 A;  3AE9 A;  1VQZ A;  4A9W A;  3UCL A;  4HYR A;  4IT1 A;  4NNJ A;  2W3R A;  3FXG A;  4JHM A;  4KWS A;  4K22 A;  1GRE A;  2O9Z A;  4GME A;  1ELI A;  5GRT A;  1SJD A;  5KRQ A;  3A7R A;  1KSS A;  1IJH A;  1MO9 A;  5G5H B;  1PS9 A;  3AEF A;  1LQU A;  3EUB 3;  2HXU A;  3H8L A;  2XVH A;  5KWF A;  2FJB A;  2YLW A;  2GB0 A;  3NK0 X;  3P4S A;  3RCY A;  4H4V A;  1PJ6 A;  1VQW A;  3DGB A;  1D4C A;  1CJ2 A;  4K5R A;  5ENL A;  4MMW A;  1O5W A;  4ZCC A;  2AAQ A;  3DGZ A;  3IWA A;  5FS8 A;  1ZX9 A;  2WQY A;  2VVM A;  4FK1 A;  1F6M A;  4Z26 A;  3T2Y A;  1K0L A;  1BGN A;  3GDN A;  2XFU A;  3K7Q X;  3M0O A;  1M64 A;  3AE7 A;  4OPD A;  4H4U A;  4CNK A;  2VVL G;  4M0X A;  4OPL A;  3SN4 A;  4NTC A;  1QLB A;  4ADW A;  4GIS A;  3ICT A;  3DK4 A;  3ZLF A;  1D7Y A;  4H1Z A;  3CT2 A;  1MNS A;  5C3J A;  2PU0 A;  3QSM A;  3RNM A;  2XSX A;  2FJE A;  3NVW B;  3L8K A;  1GSN A;  3GD6 A;  4CBQ A;  2YR4 A;  5JCN A;  3T31 A;  4CCR A;  4HNL A;  2ACZ A;  1PBB A;  2YG4 A;  2YLT A;  3T14 A;  3SBF A;  4WCT A;  2ZBW A;  4OPU A;  4BK2 A;  3CGE A;  3GMB A;  4EIQ A;  1IUX A;  1SEZ A;  2GR1 A;  2VQB A;  4H4Q A;  3FMW A;  2I5Q A;  4EQS A;  2XLP A;  1NG4 A;  2OKT A;  2WOW A;  3CGC A;  1F8W A;  3NN0 X;  4X9N A;  3TQP A;  1GRB A;  1LVL A;  3GRT A;  3V76 A;  2PA6 A;  4B63 A;  3BHF A;  2WP5 A;  1FEB A;  4E4U A;  2JB1 A;  1FFV C;  4J56 A;  3CXB A;  4REK A;  3DH9 A;  3CNT A;  1KKR A;  5FMH A;  2ZZC A;  3SZF A;  1V97 A;  3ZLG A;  1H2I A;  3R11 A;  4J1O A;  3L1R A;  3LXD A;  4OCG A;  3SYI A;  1JNZ A;  2C70 A;  3BNU A;  3GWD A;  1VDV A;  3C4A A;  1SJC A;  2YQU A;  4K2X A;  3KPF A;  1L0V A;  3SXI A;  4TLX A;  4HCH A;  4JNA A;  2QCU A;  3AE3 A;  1BKH A;  1JCT A;  1KF6 A;  2R0P A;  2YR5 A;  2Z5X A;  5J04 A;  4J31 A;  3KPK A;  1K0I A;  3AE2 A;  1CBO A;  1ZKQ A;  4M52 A;  1Y56 A;  2BK4 A;  2GGG A;  3UKK A;  3QLD A;  1CF3 A;  1M6I A;  4F4R A;  3ZYX A;  1OJT A;  3S5S A;  5J60 A;  1ZXI C;  5FS6 A;  4H4Z A;  2H88 A;  3DJG X;  1MOK A;  3SQS A;  2QJM A;  1QO8 A;  1H7X A;  1LV0 A;  4DYE A;  4IVO B;  1COY A;  3QFB A;  4H4X A;  3ABV A;  4TM4 A;  4IL0 A;  2XYO A;  3ZVI A;  3DJD A;  1LTX R;  1JPD X;  2GR3 A;  1KDG A;  3SZC A;  2OLO A;  4G6G A;  3Q45 A;  4FP1 A;  4TVW A;  1KNR A;  2YG6 A;  2OVL A;  4Y4L A;  3AE4 A;  4GAP A;  2Q0K A;  2VOU A;  2WS3 A;  4GIR A;  4EQW A;  4EWJ A;  4Z2R A;  2QDE A;  4O5Q A;  1CHU A;  4FX9 A;  3GYI A;  5ER0 A;  3M12 A;  4BK1 A;  1PXC A;  2YM1 A;  4Z2T A;  3EF6 A;  2R4J A;  2ZZ0 A;  3T2Z A;  2BRY A;  3CXO A;  3CAW A;  3S5W A;  3QSE A;  2MNR A;  2QDD A;  2NQL A;  3T9P A;  3UKH A;  1VDC A;  2OZ8 A;  4C5O A;  3FYY A;  4J2W A;  1SB3 B;  5FJT A;  1V59 A;  4ICY A;  1JRO A;  1FEC A;  2XFO A;  2XCG A;  3U9I A;  1S3B A;  1N62 C;  4U8N A;  3DFH A;  4K2S A;  2TPR A;  3TOY A;  2YG3 A;  4AOS A;  2AQJ A;  3B6D A;  1ZY8 A;  3CNJ A;  5LV9 A;  4MJW A;  2Q6U A;  2PHH A;  2OQH A;  4B66 A;  5KVH A;  4YWS A;  3AEE A;  3SQP A;  3CNP A;  1S7M A;  2XVI A;  3UTE A;  4A6N A;  1JPM A;  1L9E A;  3RP7 A;  2UZZ A;  2BK3 A;  1D5T A;  2XGZ A;  3UTG A;  4YKF A;  4EMW A;  3HYW A;  4UP3 A;  1R0M A;  2OQY A;  3II4 A;  2QJN A;  3UGV A;  4C3X A;  4Z43 A;  2WU5 A;  1DOE A;  3VRD B;  2BS2 A;  1GND A;  3IJQ A;  1T3Q C;  1YQ3 A;  4JN7 A;  2C67 A;  3SFD A;  1JEH A;  3UTH A;  1N5W C;  3T2K A;  2GVC A;  3NYC A;  4TM3 A;  1PDY A;  1OJC A;  3LZW A;  1EL8 A;  4MGG A;  4UDP A;  1CC2 A;  2VQ7 A;  3MUC A;  3QVR A;  2C75 A;  4TVY A;  4C77 A;  1R6W A;  4HNC A;  2X8G A;  3UJ2 A;  1Q1W A;  3RGT A;  2WDV A;  3HRD C;  1MRA A;  1EBD A;  4IV9 A;  4ECH A;  1GRG A;  4K8D A;  4H50 A;  1JRZ A;  4YXD A;  2GQW A;  2FBW A;  1WUF A;  2PP3 A;  3ICS A;  4XXG A;  2P88 A;  3R1Z A;  2HXT A;  4YWO A;  2R0G A;  4X4J A;  1B8S A;  1E1N A;  3UOZ A;  3ETR B;  4K8G A;  4KEM A;  5G5G B;  1XPQ A;  3SN0 A;  3B97 A;  3HZL A;  1GT8 A;  4Z17 A;  1B5Q A;  2JK6 A;  2PGE A;  1MUC A;  2B9Y A;  4DX3 A;  4G8T A;  3CTY A;  1IUT A;  3NK1 X;  1NHR A;  2AL2 A;  3P4R A;  2GQF A;  3K1G A;  2GV8 A;  3NRN A;  4U8M A;  4X9M A;  1RSG A;  3NHO X;  2P0I A;  2PS2 A;  1KCZ A;  1EL9 A;  2AL1 A;  1CJ3 A;  3NG7 X;  5KMQ A;  3CPI G;  4AOX A;  4KT2 A;  3IJL A;  2GF3 A;  1PBF A;  1CL0 A;  3GWF A;  1DOC A;  2GR2 A;  2C65 A;  3M13 A;  1F3P A;  4GUV A;  2QGY A;  1PJ7 A;  2C3C A;  2JKC A;  2V5Z A;  3PWI A;  4II3 A;  2XFQ A;  3AD9 B;  4A79 A;  2GGE A;  2Y6R A;  1EC8 A;  4Z24 A;  2XVE A;  2WP6 A;  4B1B A;  2BS3 A;  1XS2 A;  4N9X A;  2VRM A;  4KPL A;  3COX A;  4ZN0 A;  2Z5Y A;  5HYM A;  2QJJ A;  2YLR A;  3UJE A;  3F8D A;  1X2H A;  1ONF A;  2FKP A;  2OPJ A;  1N60 C;  3BJS A;  3H7V A;  2P3Z A;  3AMZ A;  2CFY A;  4HA6 A;  2E3T A;  4J33 A;  3NVV B;  5IDZ A;  2BK5 A;  4U2S A;  4Z44 A;  3V3N A;  3UJF A;  4BK3 A;  3CYJ A;  4DSH A;  1IUW A;  3UP5 A;  3SJN A;  4Z1Y A;  1VG9 A;  3D46 A;  1YQ4 A;  3VDG A;  2WBA A;  3H8A A;  3AE1 A;  3DEQ A;  2BXR A;  1IUV A;  2GH5 A;  3P0W A;  5BRT A;  1GRT A;  1XAN A;  4NZH A;  4GRT A;  4EMJ A;  5KVI A;  3PWG A;  4GYP C;  4JY2 A;  4G7F A;  1NEL A;  2GGJ A;  2V60 A;  4A35 A;  1ZP0 A;  4AT0 A;  3MQT A;  1N4W A;  1KKO A;  1YY5 A;  3URH A;  3EKG A;  3OC4 A;  1EL7 A;  3ES8 A;  2IID A;  1N1P A;  3ALL A;  3S47 A;  2R45 A;  3QJ4 A;  3CIR A;  4DWD A;  1OJD A;  3PO7 A;  4OPI A;  1E39 A;  3UOV A;  3N4F A;  2OLA A;  4MKS A;  2XLS A;  1FFU C;  2R9Z A;  3VC6 A;  3RIT A;  2YVF A;  4FI4 A;  3SM8 A;  1NHS A;  2BRA A;  1GRH A;  1D7L A;  5L46 A;  1OEP A;  4JY3 A;  2GSH A;  4C3Y A;  2V6O A;  3VA8 A;  2B76 A;  3ATR A;  2BC1 A;  1DJQ A;  3P93 A;  2E5V A;  1XDI A;  3FPZ A;  1P48 A;  3B9J B;  1L8P A;  3E1T A;  5GSN A;  3KA7 A;  1F8R A;  1MXT A;  5FJU A;  4K7Z A;  5EOW A;  3LZX A;  3CPH G;  5M0Z A;  2BA9 A;  3TJI A;  4G9K A;  3VQR A;  1JRY A;  4ZCD A;  2XFN A;  2I0Z A;  4U8L A;  5IQ1 A;  3ZVH A;  3FJ4 A;  5KOX A;  2IVD A;  3RHA A;  4YSX A;  2GEW A;  4YT0 A;  2OAM A;  4KPR A;  3PG6 A;  1TE6 A;  2WDQ A;  3CND A;  1X31 B;  3TCS A;  3CMM A;  2XVF A;  2E1M A;  1K4Q A;  4A99 A;  1EL5 A;  4U8O A;  2XLR A;  4E8G A;  4YTP A;  2APG A;  2CUL A;  2BCG G;  4Z25 A;  4TLZ A;  3QSS A;  3FV9 A;  4NTE A;  1NEN A;  4D03 A;  2AKZ A;  3FBS A;  1TDF A;  4WX1 A;  1Y56 B;  2POD A;  4IA5 A;  2V61 A;  3NYF A;  4H4T A;  1JDF A;  3CB3 A;  3SR6 B;  5M10 A;  1VRQ B;  4EQX A;  3LOV A;  3BNM A;  2X8H A;  1Y0P A;  2X50 A;  4HB9 A;  4JN9 A;  1YKJ A;  3H12 A;  4J34 A;  3P1W A;  4JN8 A;  4J3Z A;  1N63 C;  4KX6 A;  2B9X A;  2YVG A;  2WPE A;  2XLT A;  2C3D A;  4NWZ A;  1FHU A;  3UXL A;  5JCM A;  1FCD A;  1STZ A;  3DME A;  1BZL A;  3NTA A;  4GF7 A;  5JCL A;  3K7T A;  2FJA A;  1PBE A;  3AYL A;  4B68 A;  3GDP A;  4E0V A;  2HNE A;  4E4F A;  2JBV A;  3UOY A;  2OO6 A;  2C72 A;  1IUS A;  3KD9 A;  4IVM B;  3UOX A;  3IHG A;  3HPF A;  3GY1 A;  1JU2 A;  1DNC A;  5BUK A;  4AT2 A;  3VR8 A;  5KXJ A;  1O94 A;  3AE5 A;  2OZT A;  4FDC B;  3U4F A;  2OFJ A;  1NEK A;  3QKE A;  2GR0 A;  3ADA B;  3AYJ A;  2YLX A;  2CDU A;  3V3W A;  4GDE A;  2WPF A;  4H7U A;  3GRS A;  4Y4M A;  4UDR A;  1F9C A;  1CJC A;  2FYM A;  4ZCW A;  3G5R A;  2YVJ A;  3HW2 A;  2W54 A;  2AR8 A;  3ZDN A;  2WES A;  3NH3 X;  1BGJ A;  3JSK A;  1TYP A;  1TRB A;  2RAB A;  3SGL A;  5IPY A;  2E4G A;  3SN1 A;  1N4U A;  5U63 A;  1ZMC A;  1PN0 A;  2ZZB A;  2GAG B;  1GPE A;  4ENL A;  1PDZ A;  1TDN A;  3T37 A;  4A6N B;  3FCP A;  4M6U A;  1ZK7 A;  3VR9 A;  2X99 A;  2ZAD A;  1EC7 A;  4RG3 A;  3UXK A;  4IZG A;  2GAH B;  4ZOH B;  3F8R A;  4JNQ A;  1TDO A;  3QVP A;  2EQ8 A;  3R10 A;  4RG4 A;  4DHG A;  3NVY B;  3NIX A;  1P43 A;  4BJY A;  3A7U A;  3D1C A;  4JQ9 A;  2B9W A;  1ONE A;  1RYI A;  2DW6 A;  3UJS A;  1KN0 A;  4IP5 A;  1NHQ A;  2PTY A;  5HHF A;  3MZN A;  4LA1 A;  1ZOV A;  3ITJ A;  3AEG A;  4OVI A;  3RP8 A;  2ARD A;  3DK8 A;  3CPJ G;  2C4C A;  5U1O A;  2BC0 A;  2V3A A;  4Z2U A;  3RO6 A;  1QJD A;  3SZ0 A;  3KU9 A;  1UKV G;  2HZG A;  3O0H A;  2GGH A;  3UKF A;  4U8J A;  1E6E A;  2R0C A;  2XFP A;  1BKW A;  3N6H A;  4I58 A;  4A7A A;  1E1L A;  2WU2 A;  2C64 A;  3DJJ A;  4U8I A;  1KFY A;  1GRF A;  1MDL A;  3P9U A;  3EEZ A;  1GES A;  2C73 A;  3RP6 A;  1DJN A;  1TDE A;  2AL2 B;  4H2R A;  1Z6L A;  2H89 A;  1WUE A;  3SZW A;  3H70 A;  1TYT A;  2P8B A;  2GDQ A;  3BHK A;  1CC4 A;  4EIP A;  3VCN A;  2TMD A;  2XDO A;  3DA1 A;  1LPF A;  3UP4 A;  2P8C A;  2VZ2 A;  3A7A A;  3D47 A;  4GDP A;  2PU1 A;  4E6M A;  1MDR A;  5KNL A;  4TM1 A;  4IA6 A;  3NS1 B;  1GRA A;  3VRA A;  3GYJ A;  3NZG A;  3TWA A;  1D4D A;  2ONE A;  3TJ4 A;  1B37 A;  2BAC A;  1BF3 A;  4UDQ A;  3MKC A;  3IF9 A;  3GSI A;  1OJA A;  2XH2 A;  4X2P A;  3CGD A;  2W0H A;  4U2T A;  1B4V A;  2OA1 A; 
#chains in the Genus database with same CATH homology
 2BK4 A;  2YG5 A;  1GRH A;  1D7L A;  3S61 A;  4AP1 A;  3UKK A;  2HQM A;  5L46 A;  4JY3 A;  4C3Y A;  1CF3 A;  2V6O A;  1L9C A;  1LJ1 A;  1M6I A;  3ZYX A;  3F8P A;  1OJT A;  2B76 A;  3ATR A;  5BVA A;  2YM2 A;  5J60 A;  1S2Y A;  2BC1 A;  5KOW A;  1DJQ A;  1IUU A;  2E5V A;  3D9X A;  5FS6 A;  2GMH A;  1H84 A;  4H4Z A;  2Q7V A;  4C74 A;  1XDI A;  4A65 A;  3FPZ A;  5FS7 A;  3NN6 X;  4Y4N A;  2WOV A;  2H88 A;  3DJG X;  3VRB A;  3NLC A;  1XHC A;  4USQ A;  1MOK A;  3RED A;  3E1T A;  5GSN A;  4APN A;  3KA7 A;  1F8R A;  1QO8 A;  1MXT A;  1AOG A;  1H7X A;  2RGH A;  1LV0 A;  4K7Z A;  3GYX A;  3ICR A;  1COY A;  4IVO B;  4EM4 A;  5EOW A;  4YSZ A;  1ZDL A;  3B3R A;  3LZX A;  3CPH G;  5M0Z A;  4YTM A;  2BA9 A;  3QFB A;  4G9K A;  4H4X A;  3ABV A;  3VQR A;  3AD8 B;  4TM4 A;  1JRY A;  1GV4 A;  2XYO A;  3DJD A;  3GD3 A;  2BYB A;  1H6V A;  4ZCD A;  3WE0 A;  2XFN A;  1JOA A;  2I0Z A;  1LTX R;  2GR3 A;  1KDG A;  4U8L A;  5IQ1 A;  3SZC A;  4YSY A;  2OLO A;  1GER A;  4G6G A;  4YTN A;  4H4R A;  4H4S A;  3LJP A;  2C66 A;  2A89 A;  1KNR A;  2YG6 A;  5KOX A;  2IVD A;  3RHA A;  4YSX A;  4Y4L A;  3AE4 A;  4GAP A;  2GEW A;  3ATQ A;  1FEA A;  4YT0 A;  2Q0K A;  2OAM A;  2B7S A;  1GXF A;  4OPC A;  3AB1 A;  5U25 A;  3SX6 A;  2VOU A;  4KPR A;  3PG6 A;  2WS3 A;  3C96 A;  4USR A;  4EQW A;  1NHP A;  4B67 A;  4Z2R A;  3CND A;  2WDQ A;  4O5Q A;  1X31 B;  3UTF A;  1CHU A;  4FX9 A;  3GYI A;  5ER0 A;  3M12 A;  3T0K A;  3CMM A;  1PJ5 A;  2XVF A;  4BK1 A;  2E1M A;  1PXC A;  2YM1 A;  1K4Q A;  4A99 A;  4Z2T A;  3GD4 A;  3EF6 A;  2QA1 A;  1EL5 A;  2R4J A;  3G5Q A;  3EAO A;  2ZZ0 A;  3AE6 A;  3PVC A;  4U8O A;  3T2Z A;  2BRY A;  4GAV A;  2WDR A;  2XLR A;  5KMP A;  3AED A;  4YTP A;  1GTH A;  2APG A;  4CRT A;  2CUL A;  1FL2 A;  4DSG A;  2Q0L A;  4XWZ A;  4NEW A;  3S5W A;  3QSE A;  2BCG G;  3FG2 P;  4Z25 A;  3UKH A;  1VDC A;  1NPX A;  3GMC A;  3V3O A;  4TLZ A;  3QSS A;  2QAE A;  5CQF A;  4C5O A;  3IHM A;  3P4Q A;  2YLZ A;  3AEB A;  4J2W A;  2YLS A;  3NGC X;  1NEN A;  4NTE A;  4D03 A;  1V59 A;  1S2Q A;  5J7X A;  4ICY A;  4PAB A;  3FBS A;  1FEC A;  1TDF A;  3BI5 A;  2XFO A;  2XCG A;  4WX1 A;  1DOB A;  1Y56 B;  2WEU A;  4U8P A;  2EQ7 A;  1ZMD A;  4IA5 A;  2V61 A;  1S3B A;  1L9D A;  4B69 A;  2EQ6 A;  3NYF A;  4H4T A;  4RSL A;  2DKH A;  2OLN A;  5M10 A;  4U8N A;  4AP3 A;  1Q1R A;  3ALM A;  1VRQ B;  4EQX A;  3LOV A;  3BNM A;  2X8H A;  1Y0P A;  3CN8 A;  2TPR A;  2X50 A;  4HB9 A;  4JN9 A;  1YKJ A;  1GTE A;  4J34 A;  3P1W A;  2VRL A;  4KX6 A;  2WPC A;  2YG3 A;  5BUL A;  5HY5 A;  4AOS A;  2B9X A;  2AQJ A;  2YVG A;  1ZY8 A;  2PYX A;  3B6D A;  3CNJ A;  4MJW A;  4B64 A;  5LV9 A;  2WPE A;  2B7R A;  2XLT A;  3C4N A;  4FK1 C;  2C3D A;  2Q6U A;  4NWZ A;  2PHH A;  2X8C A;  5CKU A;  2CVJ A;  1LQT A;  4B66 A;  5JCM A;  1FCD A;  5KVH A;  1P2E A;  1E1M A;  3DME A;  1BZL A;  3NTA A;  3AEE A;  4GF7 A;  2GMJ A;  2WET A;  5JCL A;  3SQP A;  4EM3 A;  1ZOY A;  3CNP A;  5TR3 A;  4H2Q A;  5C2T A;  1S7M A;  3K7T A;  2FJA A;  2XVI A;  1PBE A;  3UTE A;  4A6N A;  3AYL A;  4U2L A;  4B68 A;  3AYI A;  3P4P A;  4OPG A;  2R46 A;  1L9E A;  2GRT A;  3GDP A;  3H8I A;  3LAD A;  2UZZ A;  3HYX A;  2JBV A;  4NTD A;  3RP7 A;  3AWI A;  2BK3 A;  1D5T A;  2WHD A;  2C72 A;  2JB3 A;  3ALJ A;  1DXL A;  1IUS A;  4K5S A;  3R9U A;  1H83 A;  3UTG A;  4O5U A;  4GR1 A;  3KD9 A;  4IVM B;  3UOX A;  4YKF A;  3IHG A;  4EMW A;  3HYW A;  4H2P A;  4UP3 A;  3Q9T A;  4OPT A;  1JU2 A;  3II4 A;  3BI2 A;  4C3X A;  4CNJ A;  1DNC A;  4YSH A;  4Z43 A;  3K7M X;  3EAN A;  5BUK A;  1JRX A;  2RGJ A;  2WU5 A;  3IC9 A;  4G6H A;  2BS4 A;  4AT2 A;  3AE9 A;  3VR8 A;  1GEU A;  1DOE A;  2YG7 A;  2BS2 A;  1GND A;  3VRD B;  4A9W A;  3UCL A;  1PXA A;  5KXJ A;  1YQZ A;  1YQ3 A;  2C67 A;  2DKI A;  3SFD A;  4DGK A;  4NNJ A;  1JEH A;  1O94 A;  3AE5 A;  3UTH A;  1O95 A;  2C76 A;  3L5O A;  3T2K A;  4FDC B;  4BV6 A;  2GVC A;  3NYC A;  4II2 A;  4CY6 A;  1NEK A;  4NEV A;  2WP9 A;  4YKG A;  4TM3 A;  5KMS A;  4K22 A;  1TDK A;  1GRE A;  2O9Z A;  4G74 A;  2GR0 A;  5EB4 A;  1NDA A;  1OJC A;  3LZW A;  1EL8 A;  3ADA B;  1ELI A;  4TM0 A;  4UDP A;  3AYJ A;  2YLX A;  2NPX A;  2CDU A;  1CC2 A;  4GDE A;  2WPF A;  4H7U A;  2VQ7 A;  1GOS A;  3GRS A;  3QVR A;  1PHH A;  5GRT A;  2C75 A;  4C77 A;  4Y4M A;  4UDR A;  1CJ4 A;  1CJC A;  2X8G A;  5KRQ A;  3G5R A;  1KSS A;  2YVJ A;  1MO9 A;  1Q1W A;  1IJH A;  1PS9 A;  3AEC A;  2AR8 A;  3ZDN A;  2WDV A;  3AEF A;  2WES A;  3NH3 X;  5JCK A;  3EPT A;  4CCQ A;  1LQU A;  1BGJ A;  1E1K A;  3JSK A;  4B65 A;  1EBD A;  4XWR A;  3H8L A;  1TYP A;  4GCM A;  1F8S A;  1TRB A;  2RAB A;  2XVH A;  3NKS A;  4IV9 A;  5KWF A;  2FJB A;  4ECH A;  1PBC A;  1GRG A;  2YLW A;  2GB0 A;  3NK0 X;  3P4S A;  3SGL A;  4K8D A;  4H50 A;  1JRZ A;  5IPY A;  3K30 A;  1HYU A;  4H4V A;  2RGO A;  2F5Z A;  1GAL A;  4YXD A;  2GQW A;  3DK9 A;  2E4G A;  5JCI A;  1PJ6 A;  2FBW A;  1VQW A;  4XXG A;  1N4U A;  3ICS A;  5U63 A;  1ZMC A;  1PN0 A;  4YWO A;  3PS9 A;  2ZZB A;  3CGB A;  1D4C A;  1CJ2 A;  2R0G A;  3QFA A;  4K5R A;  1B8S A;  1E7P A;  4X4J A;  2WOI A;  3BI4 A;  4DNA A;  1O5W A;  1E1N A;  2GAG B;  2JAE A;  1GPE A;  5KMR A;  3UOZ A;  1XPQ A;  4ZCC A;  1BWC A;  2AAQ A;  3DGZ A;  3IWA A;  1H7W A;  5FS8 A;  1ZX9 A;  3HZL A;  1TDN A;  3T37 A;  1GT8 A;  2WQY A;  5IQ4 A;  2YWL A;  3HYV A;  4A6N B;  1ZK7 A;  4P9S A;  3VR9 A;  2X99 A;  1B5Q A;  2VVM A;  4FK1 A;  4U8M A;  2JK6 A;  1JNR A;  4RG3 A;  1F6M A;  2GAH B;  4Z26 A;  3T2Y A;  4H4W A;  2B9Y A;  3KVE A;  4BUR A;  3CTY A;  1IUT A;  1K0L A;  3UKQ A;  3NK1 X;  1NHR A;  1BGN A;  3GDN A;  2XFU A;  3F8R A;  1N4V A;  2GQF A;  3K7Q X;  3M0O A;  3P4R A;  1M64 A;  4JNQ A;  1TDO A;  3AE7 A;  4EMI A;  2GV8 A;  3NRN A;  4OPD A;  3QVP A;  1W4X A;  4H4U A;  4I59 A;  1RSG A;  2VVL A;  2BAB A;  3NHO X;  2EQ8 A;  3AD7 B;  2VVL G;  3ISH A;  4X9M A;  4CNK A;  3CNS A;  4RG4 A;  4LU6 A;  3DGH A;  4OPL A;  2A8X A;  4H4Y A;  4NTC A;  1QLB A;  4JDR A;  1EL9 A;  3NIX A;  4ADW A;  1CJ3 A;  3NG7 X;  3ICT A;  5KMQ A;  2YR6 A;  3CPI G;  4AOX A;  4BJY A;  3DK4 A;  2QA2 A;  3D1C A;  3SFE A;  3UOY A;  4JQ9 A;  2B9W A;  1D7Y A;  2GF3 A;  1PBF A;  1CL0 A;  3GWF A;  2NVK X;  2EQ9 A;  1D4E A;  1RYI A;  5C3J A;  1DOC A;  3DJE A;  2GR2 A;  2C65 A;  3QSM A;  3RNM A;  1KN0 A;  3M13 A;  2FJE A;  1F3P A;  1H82 A;  3L8K A;  1GSN A;  4GUV A;  1NHQ A;  1PJ7 A;  2C3C A;  2JKC A;  4CBQ A;  2V5Z A;  2YR4 A;  4II3 A;  1GET A;  4H2N A;  2XFQ A;  3KLJ A;  5HHF A;  3AD9 B;  4A79 A;  4LA1 A;  1ZOV A;  4PAA A;  2Y6R A;  3ITJ A;  4Z24 A;  2XVE A;  5JCN A;  3AEG A;  4OVI A;  3T31 A;  4J57 A;  2WP6 A;  4G73 A;  2ARD A;  3RP8 A;  4CCR A;  1CC6 A;  3DK8 A;  3H4K A;  2BS3 A;  3D8X A;  4B1B A;  3CPJ G;  2C4C A;  2ACZ A;  5U1O A;  2BC0 A;  2V3A A;  1PBB A;  2Y6Q A;  4N9X A;  4CY8 A;  4Z2U A;  2VRM A;  2YG4 A;  3G5S A;  1OJ9 A;  2IVE A;  1QJD A;  3SZ0 A;  1PXB A;  3KU9 A;  2YLT A;  1UKV G;  3T14 A;  1Q9I A;  3COX A;  1H81 A;  3O0H A;  4ZN0 A;  5HXI A;  2Z5Y A;  5HYM A;  4WCT A;  2YLR A;  3UKF A;  4U8J A;  3NK2 X;  2ZBW A;  3F8D A;  1E6E A;  1KNP A;  4OPU A;  4BK2 A;  3CGE A;  5EBK A;  1ONF A;  3GMB A;  3UKA A;  2R0C A;  4EIQ A;  2XFP A;  1S3E A;  1IUX A;  2CFY A;  5DBJ A;  4HA6 A;  1BKW A;  1SEZ A;  4I58 A;  4A7A A;  2GR1 A;  1E1L A;  2VQB A;  2WU2 A;  3I6D A;  4J33 A;  2C64 A;  3Q6J A;  3DJJ A;  4H4Q A;  3FMW A;  2BK5 A;  4U8I A;  1KFY A;  4EQS A;  2XLP A;  4BJZ A;  2R4E A;  1NG4 A;  4U2S A;  1DOD A;  1FOH A;  4Z44 A;  1GRF A;  2FJD A;  3P9U A;  3V3N A;  1GES A;  2WOW A;  3CGC A;  2C73 A;  3SY4 A;  4BK3 A;  1F8W A;  3RP6 A;  3NN0 X;  4X9N A;  1DJN A;  4LII A;  4DSH A;  1TDE A;  3I3L A;  1IUW A;  1REO A;  3UP5 A;  1GRB A;  1LVL A;  3GRT A;  2V3B A;  1Z6L A;  2H89 A;  4H2R A;  3V76 A;  4EQR A;  1VG9 A;  4H4P A;  3AEA A;  1YQ4 A;  3SZW A;  1P2H A;  1TYT A;  1KSU A;  2C7G A;  3LB8 A;  4B63 A;  2XLU A;  3BHF A;  2WP5 A;  3BHK A;  1CC4 A;  4EIP A;  1FEB A;  2JB1 A;  2WBA A;  2TMD A;  3AE1 A;  2BXR A;  1IUV A;  3UKL A;  2GH5 A;  1NAA A;  5BRT A;  2XDO A;  3DA1 A;  1LPF A;  4J56 A;  1GRT A;  1XAN A;  3UP4 A;  4NZH A;  4REK A;  3DH9 A;  3CNT A;  4GRT A;  2VZ2 A;  4EMJ A;  5KVI A;  3NYE A;  5FMH A;  3AE8 A;  1NG3 A;  1VG0 A;  2ZZC A;  3SZF A;  5EB5 A;  1H2I A;  2J3N A;  4JY2 A;  3KKJ A;  4GDP A;  4A5L A;  2JB2 A;  2BXS A;  1PBD A;  3L1R A;  3LXD A;  3UKP A;  2V60 A;  1ZP0 A;  1PDH A;  4OCG A;  3SYI A;  5JRB A;  4AT0 A;  5KNL A;  1JNZ A;  2C70 A;  1N4W A;  1RP0 A;  3BNU A;  4TM1 A;  2BCP A;  1YY5 A;  3URH A;  3GWD A;  4IA6 A;  1GRA A;  3VRA A;  3C4A A;  3OC4 A;  3NTD A;  1EL7 A;  3OZ2 A;  2YQU A;  2IID A;  4K2X A;  1N1P A;  3GYJ A;  3KPF A;  4D04 A;  1L0V A;  1D4D A;  1H86 A;  3ALL A;  4TLX A;  3SXI A;  1B37 A;  2BAC A;  3AXB A;  1BF3 A;  3NT6 A;  4JNA A;  2YAU A;  4J36 A;  4UDQ A;  2QCU A;  2R45 A;  3QJ4 A;  4U8K A;  3IF9 A;  3CIR A;  3GSI A;  3AE3 A;  1OJA A;  1OJD A;  3PO7 A;  5FS9 A;  1KF6 A;  3FIM B;  4OPI A;  2R0P A;  2YR5 A;  2OAL A;  1E39 A;  3UOV A;  4E0V A;  2Z5X A;  2X3N A;  4J31 A;  3KPK A;  1K0I A;  2XLS A;  1CBO A;  1ZKQ A;  3AE2 A;  2XVJ A;  2R9Z A;  3CGD A;  2W0H A;  2YVF A;  2A87 A;  3NNE A;  4U2T A;  1B4V A;  1NHS A;  3SM8 A;  4M52 A;  2BRA A;  1Y56 A;  1K0J A;  2OA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...