1JEHA

Crystal structure of yeast e3, lipoamide dehydrogenase
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
478
structure length
478
Chain Sequence
TINKSHDVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGTCLNVGCIPSKALLNNSHLFHQMHTEAQKRGIDVNGDIKINVANFQKAKDDAVKQLTGGIELLFKKNKVTYYKGNGSFEDETKIRVTPVDGLEGTVKEDHILDVKNIIVATGSEVTPFPGIEIDEEKIVSSTGALSLKEIPKRLTIIGGGIIGLEMGSVYSRLGSKVTVVEFQPQIGASMDGEVAKATQKFLKKQGLDFKLSTKVISAKRNDDKNVVEIVVEDTKTNKQENLEAEVLLVAVGRRPYIAGLGAEKIGLEVDKRGRLVIDDQFNSKFPHIKVVGDVTFGPMLAHKAEEEGIAAVEMLKTGHGHVNYNNIPSVMYSHPEVAWVGKTEEQLKEAGIDYKIGKFPFAANSRAKTNQDTEGFVKILIDSKTERILGAHIIGPNAGEMIAEAGLALEYGASAEDVARVCHAHPTLSEAFKEANMAAYDKAIHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DIHYDROLIPOAMIDE DEHYDROGENASE
publication title Crystal structure of eucaryotic E3, lipoamide dehydrogenase from yeast.
pubmed rcsb
total genus 142
structure length 478
sequence length 478
chains with identical sequence B
ec nomenclature ec 1.8.1.4: Dihydrolipoyl dehydrogenase.
pdb deposition date 2001-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1jehA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jehA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jehA02
2BK5A 2V5ZA 1DJQA 1NPXA 3EPTA 5CKUA 1K0IA 4A6NB 2YLWA 3ICRA 3DJGX 2WP5A 3P4RA 3BI5A 3GWDA 1Q1WA 3LADA 1PBFA 2QA1A 1JOAA 3COXA 4C3XA 3ABVA 2XFUA 4DNAA 4B69A 3VRAA 2YLXA 1GETA 4YSYA 1MO9A 3GD3A 4U2SA 4U8OA 2WPFA 4EM4A 4P9SA 4YT0A 5KWFA 1OJDA 4FK1C 1DOBA 2E1MA 1VG0A 1COYA 2YLSA 3M12A 2XFPA 4K5SA 1PJ5A 2RABA 3KD9A 4XXGA 3UKHA 2X3NA 3NGCX 4LU6A 5KRQA 1ZMDA 1VQWA 3URHA 3RHAA 1E1LA 1BWCA 3ATRA 2YQUA 3NRNA 5HYMA 2BA9A 1FCDA 2A8XA 1O94A 2V3BA 1ZK7A 1QJDA 4BJZA 2EQ9A 4H4XA 3CGBA 4FK1A 4OCGA 4EQSA 2C70A 2XVHA 3GRTA 1CL0A 2WETA 2YM1A 4JY2A 3GMBA 4O5QA 5BVAA 3IHGA 1VRQB 2BXSA 2WDRA 2GQWA 2NVKX 2ZZBA 4APNA 4JY3A 4E0VA 4Z43A 4UP3A 4A65A 1KSUA 1ZOYA 1FL2A 5EOWA 4D03A 4GDEA 5CQFA 3F8DA 1EBDA 3KPFA 2H89A 4CCRA 4B66A 3AB1A 3ADAB 4DSHA 2B7RA 4CRTA 3H8IA 5M0ZA 2BC1A 4ADWA 2OAMA 4CNJA 2XFOA 4UDPA 1JRZA 4AOSA 4USQA 4H4ZA 3NH3X 3NTDA 5HY5A 1H86A 1D4CA 1ELIA 4M52A 4TM4A 4LIIA 2AR8A 2YAUA 4Y4NA 1XHCA 3GDNA 3II4A 2DKIA 1F3PA 1GRTA 1NG3A 2YM2A 2V61A 3K7TA 2BCGG 1CC2A 1NHSA 2ZZCA 1OJTA 2BCPA 3NG7X 3NTAA 1H7WA 2VOUA 1OJAA 1E7PA 4WX1A 3ZDNA 2ACZA 1N4WA 1TDOA 2FBWA 3SFEA 1GT8A 3VRDB 3AYIA 3IHMA 4CY6A 1E6EA 4J56A 3BI2A 4YXDA 3EAOA 3AD8B 3QSSA 1F6MA 2RGHA 2R9ZA 1GPEA 2XYOA 2BACA 3Q9TA 1B5QA 1CC4A 3H8LA 3NNEA 3H4KA 4JN9A 4JQ9A 1TDKA 2WP9A 3IC9A 2WS3A 2YLRA 3AE1A 4OPGA 1GRFA 1XPQA 5FS6A 4JNAA 5KOWA 4H2PA 2GH5A 2E4GA 4Z2TA 3RNMA 1LTXR 3LOVA 3G5RA 2J3NA 2GR2A 1L9DA 2QCUA 4WCTA 3REDA 1D5TA 1GRBA 4CY8A 1JRYA 4C74A 2GQFA 4GRTA 3ALLA 4BK3A 5U1OA 4J33A 4CBQA 1JNZA 2XLPA 3UKPA 4NTDA 4O5UA 2GR3A 1DXLA 1D4DA 2C64A 4AT2A 4EQXA 5JCKA 4Z25A 2APGA 4K2XA 4A99A 1LJ1A 3KVEA 2C7GA 3CNPA 1E39A 5FMHA 2XDOA 4IA6A 1JU2A 1P2HA 2Y6RA 2CFYA 3DK8A 2X8CA 3P4SA 1S3BA 3DK4A 1YQ3A 1YQZA 3NIXA 3EF6A 2GB0A 3NK1X 2R0CA 3JSKA 1TDNA 2XCGA 2Z5YA 3QVRA 1OJCA 4AP1A 4NEWA 5FS7A 3KLJA 5J7XA 3ITJA 3NK2X 3P1WA 2ARDA 2PHHA 3QVPA 1Q1RA 2OLNA 4USRA 3UKFA 3NLCA 3AYJA 3ISHA 4FDCB 5KVIA 4NTCA 2AAQA 4YSXA 3NHOX 2OLOA 3V3NA 1H6VA 1GEUA 2X99A 2B9YA 2WDQA 2XVFA 3DMEA 3HZLA 4K8DA 4Y4LA 3GD4A 4ZCDA 4GR1A 3I6DA 3RP8A 1TRBA 2YR6A 4BJYA 4U2TA 2NPXA 4H4RA 4H4UA 3SM8A 2RGOA 1PXBA 1H81A 1KNPA 4BK2A 3PS9A 3B6DA 2YG5A 3VQRA 4U8JA 4OPIA 3UKLA 1DOCA 4H4WA 4CCQA 5IPYA 5U25A 1CF3A 1NENA 3UOYA 2YG3A 5M10A 2XVJA 1GNDA 4A5LA 2GRTA 4J31A 3DK9A 3OC4A 3CGDA 4GUVA 3AD9B 2Q0KA 4D04A 1REOA 3UCLA 2GR1A 3QJ4A 1GRHA 4U8MA 4H4TA 2IVDA 4XWRA 5C2TA 1QO8A 1DNCA 5GSNA 1LQUA 2B7SA 1GALA 4Z2UA 2VQ7A 1IJHA 3DA1A 3FMWA 4OPUA 4LA1A 3AXBA 4RG3A 4TM3A 3RP7A 3UOZA 1M64A 2X8HA 4H4YA 1VG9A 1YY5A 1K0LA 4TLZA 3IWAA 1GESA 1HYUA 4C5OA 5KXJA 1PHHA 2YLZA 2V60A 5BRTA 3NYEA 3UTEA 4Z2RA 2UZZA 3CTYA 3K7MX 3F8PA 4B68A 3VR9A 4YSHA 2FJBA 2JB3A 2Q6UA 4U8NA 2W0HA 3IF9A 1MXTA 5C3JA 4IVMB 3UKKA 3E1TA 1E1MA 5J60A 2Q7VA 3RP6A 2FJDA 4ECHA 1XDIA 4AT0A 2YR4A 2GVCA 4H4QA 2JAEA 2ZBWA 3V3OA 1PXAA 2GMHA 1B4VA 1D7LA 1BGNA 1IUWA 3GYIA 4PABA 2GAGB 4RSLA 3AE5A 4A6NA 1PBCA 1S3EA 4AP3A 2O9ZA 1PJ6A 1F8WA 4H4SA 2JB2A 3NKSA 3AYLA 1AOGA 1N4VA 2BS2A 1N4UA 5KOXA 5JCNA 4OPDA 2A87A 1L0VA 5EB5A 1NHRA 1N1PA 4U8PA 2JKCA 1JNRA 2VRLA 5HHFA 1O5WA 5EBKA 1UKVG 4YTMA 3L8KA 4CNKA 1NEKA 3AEEA 1LVLA 3AEAA 1LQTA 1PS9A 3C96A 2C3DA 2TPRA 3UTFA 1NG4A 3CPHG 3P4PA 1JRXA 2XFQA 1E1KA 4Z44A 2TMDA 3P4QA 3AE4A 1KSSA 3WE0A 4ZCCA 3QFAA 4IV9A 4UDRA 3S5WA 1ZOVA 2YG7A 4OPLA 3UTGA 4EQRA 4TM0A 4B67A 1CJ2A 2GF3A 3CGCA 4H4PA 5JCMA 1TDEA 4OPTA 4H2RA 1BZLA 5IQ1A 1F8SA 2V3AA 2X50A 2AQJA 1PBBA 1GXFA 3L1RA 4K22A 3NK0X 1EL9A 2YG4A 3QFBA 4RG4A 2YVGA 2QAEA 3NN0X 3UOXA 3ALJA 3Q6JA 2X8GA 2WPCA 1XANA 3ATQA 4X9NA 1FOHA 4YKGA 1BF3A 1W4XA 2R45A 3NN6X 3NYCA 4IA5A 3UP5A 2JB1A 1CJ4A 2C72A 1GRAA 1D4EA 3AE6A 1L9CA 2XVEA 3CNDA 3K7QX 2YG6A 2FJEA 4GF7A 1ONFA 2HQMA 3CGEA 2RGJA 3UP4A 1Q9IA 1NDAA 3GYJA 5BUKA 3FPZA 3AWIA 2IIDA 3CNSA 2JBVA 5JCIA 1E1NA 4OVIA 2VQBA 3C4NA 2XLRA 1NAAA 1NHPA 3CNJA 4TM1A 4U8LA 1CHUA 2CDUA 2WOWA 1KFYA 4UDQA 1PBDA 1QLBA 2V6OA 1DODA 2VRMA 2QA2A 1ZMCA 1PXCA 1K4QA 1Y56A 2VZ2A 1CJ3A 2IVEA 4H2NA 1O95A 2BK4A 2E5VA 4YTNA 5JCLA 3CIRA 1KF6A 2OALA 3CNTA 3M0OA 3P9UA 4I59A 4C3YA 3UKAA 3BHFA 1NHQA 2OA1A 1V59A 3DJJA 3VR8A 1ZP0A 1PN0A 4I58A 3B3RA 3CPIG 2R4EA 4H50A 1DJNA 3UTHA 1S2YA 2C67A 4AOXA 3C4AA 4YTPA 4EMJA 2VVLA 5ER0A 2Z5XA 3LZWA 1CC6A 1L9EA 3NT6A 3ALMA 1EL5A 2R4JA 2R0PA 3DGHA 1CBOA 2R0GA 1B8SA 4NTEA 3SFDA 3T37A 4EIQA 4JDRA 5L46A 2JK6A 3SGLA 4H2QA 2FJAA 2H88A 3G5QA 1GTHA 5U63A 2XVIA 2YVJA 4PAAA 1YQ4A 2R46A 1IUSA 4EQWA 4HB9A 2CULA 5HXIA 5EB4A 1GTEA 3ICTA 4HA6A 5IQ4A 2WU2A 2BABA 3CPJG 1Y56B 1TDFA 2EQ6A 1FECA 2C65A 2XLSA 1PJ7A 4ICYA 1H83A 1CJCA 3BHKA 4BK1A 2BXRA 3UKQA 3FG2P 4A7AA 2YWLA 4MJWA 1JEHA 3AE9A 4Y4MA 3D1CA 1OJ9A 2EQ7A 2BC0A 2WOVA 2WOIA 4YWOA 3UOVA 2GV8A 1X31B 1ZDLA 4KPRA 1LPFA 1LV0A 3D8XA 1GERA 2B9WA 3K30A 4GDPA 2YLTA 4Z24A 4DGKA 2C66A 1TYPA 4A79A 2B9XA 4H4VA 3LJPA 2WPEA 1ZY8A 4BURA 1D7YA 2ZZ0A 1RSGA 4IVOB 4NEVA 2BS4A 4B64A 1RYIA 3O0HA 1GRGA 1GOSA 3GDPA 3GWFA 3KU9A 4J34A 4KX6A 3NYFA 2BYBA 4TLXA 1KNRA 3VRBA 4FX9A 2C3CA 3KA7A 1GSNA 1TYTA 4BV6A 2WESA 3AEFA 1DOEA 1H82A 4EMIA 2DKHA 2VVMA 2WU5A 2GEWA 4J57A 3LB8A 4U8KA 2C76A 4B65A 2WDVA 4REKA 4X4JA 2YR5A 3BNUA 2BK3A 1FEBA 1PBEA 4J36A 2A89A 4EIPA 1IUXA 1Y0PA 2BS3A 5KVHA 3V76A 1ZKQA 3OZ2A 5BULA 2XLTA 5LV9A 3LXDA 3GSIA 2VVLG 4EM3A 1IUUA 1B37A 4EMWA 3QSEA 3G5SA 3AEGA 1GV4A 4U2LA 4B63A 1GREA 2C73A 2CVJA 5FS8A 2XFNA 4GCMA 2I0ZA 2WQYA 1MOKA 1EL8A 3AEBA 5TR3A 1K0JA 4N9XA 1RP0A 3CN8A 4NZHA 2C75A 4U8IA 1VDCA 5FS9A 3S61A 4XWZA 1S2QA 3GMCA 2F5ZA 1ZX9A 4DSGA 3QSMA 4K5RA 4ZN0A 1BKWA 2YVFA 4JNQA 3DJDA 4K7ZA 3AEDA 1P2EA 2WEUA 4YKFA 2GMJA 3BI4A 3PVCA 2Y6QA 3F8RA 3ICSA 4YSZA 4Z26A 2EQ8A 3I3LA 3FIMB 2WP6A 3DH9A 3DGZA 3AECA 1BGJA 1FEAA 3SQPA 1KDGA 3PO7A 4OPCA 4H7UA 3ZYXA 2B76A 4B1BA 1M6IA 2PYXA 3AE8A 2Q0LA 1F8RA 1PDHA 2XLUA 3KKJA 5DBJA 3M13A 1H84A 3AE7A 4A9WA 1H7XA 1IUTA 1IUVA 2WBAA 3FBSA 3R9UA 3DJEA 4C77A 1EL7A 1Z6LA 3AE3A 3AD7B 3AE2A 2GAHB 3EANA 4X9MA 1SEZA 2WHDA 3BNMA 5GRTA 3LZXA 4J2WA 2GR0A 3GRSA 1YKJA
chains in the Genus database with same CATH superfamily
1DJQA 3EPTA 5CKUA 2QQ6A 3ZLHA 3ICRA 3BI5A 3GWDA 2QA1A 3SJNA 1JOAA 6ENLA 3T2YA 4DNAA 4YSYA 1MO9A 2WPFA 2OZ3A 4EM4A 4HCDA 4FK1C 1VG0A 1PJ5A 1KKRA 4LU6A 2YQUA 3TWAA 3ES7A 3P93A 1O94A 3CGBA 2WETA 4JY3A 4UP3A 4D03A 4GDEA 3IJIA 5CQFA 1EBDA 2H89A 3AB1A 3H8IA 3DEQA 3TWBA 1JRZA 3NTDA 5HY5A 1ELIA 4M52A 2GGGA 4E8GA 4LIIA 2YAUA 4Y4NA 3GDNA 1GRTA 1X2HA 3DDMA 3K7TA 2PU1A 1OJAA 4E5TA 1N4WA 1TDOA 2FBWA 3SFEA 3VRDB 4GISA 3DESA 4CY6A 3IK4A 3AD8B 2RGHA 1MDRA 2R9ZA 2BACA 3H8LA 4JN9A 3NNEA 3IC9A 5KOWA 1GRFA 1KD0A 2XH2A 3G5RA 1L9DA 4WCTA 2PGEA 3ALLA 4ROPA 5U1OA 4CBQA 1JNZA 3HYXA 4NTDA 2GR3A 1DXLA 2C64A 4AT2A 4A99A 1X2GA 2XDOA 2CFYA 3P4SA 1YQZA 3NRZB 3NK1X 2R0CA 1TDNA 2Z5YA 4AP1A 3P1WA 2ARDA 3QVPA 3AYJA 1H6VA 3PK7A 1N63C 4GR1A 3I6DA 2YR6A 2NPXA 4BK2A 3PWGA 3VQRA 3TJIA 1DOCA 1FHVA 4CCQA 5IPYA 1NENA 2XVJA 3TCSA 4A5LA 5KMPA 3CGDA 2Q0KA 4D04A 4MKSA 1QO8A 2W3SA 4Z2UA 1IJHA 3FMWA 3UOZA 3CYJA 3IWAA 4IL0A 1GESA 1STZA 2YLZA 3UTEA 2OQYA 3RITA 2HNEA 4J1OA 3BOXA 2JB3A 5BOFA 1E1MA 1XDIA 2GVCA 2JAEA 3FXGA 1B4VA 3MWCA 4AP3A 1F8WA 4H4SA 5FJTA 2JB2A 1AOGA 1N4UA 2P0IA 5JCNA 2VRLA 1O5WA 1UKVG 2AKMA 3L8KA 4G9KA 3C96A 2FKPA 3AE4A 3WE0A 3AMZA 1FFVC 4HYRA 4ZCWA 3UTGA 4H4PA 3QPEA 1BZLA 2AQJA 1MRAA 3NVZB 3UOXA 2X8GA 4GAPA 5J04A 1FOHA 4YKGA 2JB1A 3AE6A 3BJSA 3IJLA 4GYPA 2XVEA 2QGYA 1NDAA 3AWIA 2HZGA 3CXOA 2IIDA 4OVIA 1E1NA 2VQBA 2PU0A 3C4NA 4TM1A 2WOWA 2V6OA 1ZMCA 1K4QA 1ELSA 2E5VA 3D46A 4I59A 3CIRA 3CNTA 1PDYA 1RVKA 2XH0A 3BHFA 3STPA 4FP1A 5G5HB 3UTHA 4I58A 4H50A 1DJNA 4HN8A 3C4AA 3LZWA 3NT6A 3OZYA 2R0GA 3SFDA 4HPNA 4EIQA 2P8BA 2JK6A 5U63A 1IUSA 3EUB3 2BRAA 2CULA 4TVWA 1GTEA 3ICTA 3OP2A 4HA6A 2BABA 2C65A 3BHKA 3UKQA 2YWLA 4MJWA 1OJ9A 2GL5A 3SZWA 2BC0A 2WOVA 3VCCA 4DWDA 1X31B 3SXIA 1ZDLA 1LPFA 1LV0A 2YLTA 2C66A 2MNRA 4BURA 1RSGA 4B64A 3O0HA 1GRGA 4FX9A 3KA7A 1GSNA 2WESA 3AEFA 1DOEA 4EMIA 2VVMA 4TVYA 3BSMA 4J57A 3LB8A 2C76A 3B97A 1FEBA 4G6HA 4J36A 3ZLFA 3T9PA 4KPLA 3T0KA 3G5SA 4U2LA 4GCMA 3FYYA 2WQYA 2I0ZA 3PFRA 1EL8A 1VDCA 1R0MA 4DSGA 1MUCA 3ZVHA 2PTWA 1P2EA 2WEUA 3H12A 5IDZA 3F8RA 1JPDX 4OPCA 2Q0LA 1F8RA 1H7XA 4DYEA 3DJEA 3I6EA 2GAHB 3LZXA 4J2WA 3A7AA 2P88A 1NPXA 4G73A 3P4RA 1Q1WA 5FJOA 2NQLA 3ABVA 1IYXA 2YLXA 4U8OA 5KWFA 3NVVB 1N5XA 2PODA 3KD9A 2PPGA 3N6HA 3UKHA 3NGCX 1EC9A 3URHA 3IJQA 3FJ4A 1E1LA 2HXUA 2OVLA 1FCDA 1QJDA 3GMBA 4JN7A 1R6WA 4Z43A 4E0VA 5EOWA 1FL2A 4B66A 4DSHA 4CRTA 5M0ZA 3UJFA 2PTYA 4II2A 2XFOA 2GGJA 1H86A 1D4CA 3ETRB 2GGIA 3TW9A 1JCTA 2AR8A 4E6MA 1XHCA 2BRYA 1KKOA 2BCPA 3NG7X 3NTAA 2VOUA 3IHMA 4YXDA 3QSSA 1F6MA 2XYOA 1CC4A 1TDKA 2WS3A 4OPGA 4H2PA 3REDA 1D5TA 4GRTA 2AKZA 4IHCA 4J33A 3TJ4A 1SB3B 4EQXA 4K2XA 3KVEA 2C7GA 3CNPA 4IA6A 1JU2A 1S3BA 1YQ3A 3JSKA 4KT2A 3ITJA 3NK2X 1Q1RA 1SJAA 3NLCA 3ISHA 2AAQA 3V3NA 3OTRA 2XVFA 3Q4DA 1TRBA 2ZADA 4HCLA 2OKTA 4H4RA 3RRAA 3PS9A 3UJSA 4DX3A 3AM9A 4U8JA 5U25A 2YG3A 5M10A 1GNDA 4J31A 1TE6A 3DK9A 2FYMA 1REOA 2P8CA 4XWRA 1LQUA 1GALA 4OPUA 4TM3A 4LA1A 3AXBA 4YWSA 1M64A 4JN8A 2AL2B 5KXJA 1L8PA 2V60A 5BRTA 1ZXIC 3NYEA 4G74A 2UZZA 3F8PA 4B68A 4YSHA 2FJBA 5C3JA 4IVMB 3UKKA 2YR4A 2ZBWA 3A7RA 5KMRA 1IUWA 1MNSA 1FHUA 4RSLA 3AE5A 3NS1B 1S3EA 2O9ZA 1PJ6A 5KOXA 3GYXA 4OPDA 2A87A 5EB5A 4U8PA 2CHRA 1LVLA 1LQTA 3UTFA 3ES8A 3L5OA 3P4PA 1JRXA 4Z44A 1E1KA 1NU5A 3MKCA 3S5WA 1ZOVA 4OPLA 4EQRA 3RGTA 2GF3A 3CGCA 3SSZA 4H2RA 5IQ1A 2X50A 3VC5A 1ONEA 3QFBA 4RG4A 3OPSA 4Z17A 3CAWA 4X9NA 3SQSA 1W4XA 3NYCA 1GRAA 4GF7A 3UCCA 3SY4A 2RGJA 3UP4A 1Q9IA 5BUKA 4GAVA 1N61C 3CNSA 2JBVA 5JCIA 1NHPA 1DTNA 3N6JA 2I5QA 4U8LA 2CDUA 3V3WA 1KFYA 1FFUC 1PXCA 1Y56A 2VZ2A 4H2NA 4HCHA 1O95A 2BK4A 3CXBA 3M0OA 2OALA 3R0UA 3UKAA 1V97A 3AN1A 2OA1A 1ZP0A 1PN0A 3B3RA 2MUCA 3CPIG 2C67A 3GY1A 1L9EA 3ALMA 1EL5A 2R0PA 3DGHA 4JDRA 4H2QA 2H88A 2YVJA 4PAAA 2R46A 4EQWA 5HXIA 5EB4A 5IQ4A 5FJRA 3CPJG 1FECA 3GC2A 1CJCA 4A7AA 4Y4MA 2W3RA 1T3QC 3OZMA 4GFIA 4JHMA 4YWOA 3UOVA 2GV8A 2E5AA 3HPFA 1EBGA 1P48A 3D8XA 2B9WA 3K30A 4GDPA 4DGKA 1TYPA 1W6TA 2B9XA 4IL2A 3PG6A 3T14A 2P3ZA 1E9IA 4IZGA 2BYBA 4TLXA 3GD6A 2QJNA 1TYTA 4BV6A 3JZUA 1H82A 2WU5A 2YR5A 2BK3A 1PBEA 1IUXA 1VDVA 3RO6A 5KVHA 4FI4A 3V76A 3JW7A 2VVLG 1IUUA 4X2PA 1GV4A 4B63A 1N60C 2XFNA 3DGBA 5TR3A 1K0JA 3S61A 3CN8A 5FS9A 4XWZA 3GMCA 2F5ZA 2XSXA 3QSMA 4JNQA 3DJDA 2GMJA 4YSZA 2DW6A 3DH9A 3DGZA 4M6UA 1BGJA 2QJMA 1EBHA 1FEAA 3ZYXA 4M0XA 1M6IA 2PYXA 2XLUA 5DBJA 4A9WA 4C77A 1IUVA 2WBAA 3AE2A 1SEZA 3BNMA 1YKJA 2BK5A 2V5ZA 4MMWA 4G6GA 4A6NB 2YLWA 2WP5A 4IP5A 3LADA 3COXA 3VFCA 4C3XA 4Z1YA 3VRAA 1GETA 3MSYA 1NELA 4U2SA 1TKKA 1OJDA 3I6TA 1DOBA 1COYA 2YLSA 4K5SA 2XFPA 4DN1A 3SBFA 2RABA 5KNLA 4DXKA 2X3NA 1EC7A 4MGGA 3RHAA 2GSHA 3ATRA 1WYGA 5HYMA 1YEYA 1ZK7A 4BJZA 2EQ9A 2AL1A 4FK1A 4OCGA 4EQSA 2XVHA 2YM1A 5BVAA 3IHGA 2OG9A 2GQWA 2NVKX 2ZZBA 3F8DA 2PS2A 3KPFA 3ADAB 5ENLA 2B7RA 3SN4A 4ADWA 2OAMA 1EC8A 4AOSA 4USQA 4H4ZA 4TM4A 3II4A 1F3PA 1NG3A 2YM2A 2V61A 1CC2A 1NHSA 1OJTA 3R1ZA 4WX1A 1E7PA 4G8TA 4IP4A 2XH4A 4HNCA 1E6EA 3P3BA 3UJEA 2OX4A 4JQ9A 5KMQA 2YLRA 3QN3A 1XPQA 5FS6A 4JNAA 3LOVA 2J3NA 1GRBA 4C74A 2GQFA 3A7UA 4BK3A 2XLPA 3UKPA 4O5UA 4Z25A 2ONEA 2APGA 1LJ1A 1E39A 5FMHA 2Y6RA 2X8CA 2OLAA 3NIXA 3DIPA 3EF6A 2GB0A 2PP0A 2W55A 3NXLA 5FS7A 2OFJA 3SZFA 2OLNA 3UKFA 4FDCB 4YSXA 3HZLA 4K8DA 4Y4LA 4ZCDA 3RP8A 4U2TA 2RGOA 1H81A 1KNPA 3B6DA 2YG5A 4OPIA 3UKLA 2GGEA 1CF3A 3UOYA 3UCDA 3SZCA 1KCZA 2GRTA 3OC4A 3AD9B 1GRHA 4U8MA 4H4TA 2IVDA 2OPJA 1SJBA 5GSNA 1SJCA 4RG3A 3RP7A 3TOYA 2X8HA 4H4YA 1VG9A 1FIQB 1K0LA 4A35A 1HYUA 1PHHA 4GGBA 3CTYA 3K7MX 3VR9A 3R25A 3IF9A 5J60A 3E1TA 2Q7VA 2FJDA 4ECHA 3V3OA 3NFUA 1BGNA 3T4WA 1PBCA 3VRBA 3UGVA 3AYLA 2BS2A 1N4VA 1L0VA 4A3RA 1NHRA 1JNRA 1WUFA 4YTMA 1NEKA 3AEEA 3VA8A 3AEAA 2C3DA 3EKGA 3THUA 1NG4A 1KSSA 4ZCCA 3QFAA 4UDRA 2C4CA 2W54A 2PSNA 4H19A 2YG7A 4TM0A 4B67A 1CJ2A 2QJJA 1TDEA 4OPTA 1F8SA 2V3AA 4GYPC 3L1RA 1GXFA 4K22A 1EL9A 2YG4A 2PTZA 5FJUA 3ALJA 3Q6JA 1FO4A 1XANA 3NN6X 3UP5A 4IA5A 2QDDA 3GO2A 1CJ4A 3R07C 1D4EA 2C72A 1L9CA 2FJEA 4KEMA 1ONFA 2HQMA 3GYJA 3NO1A 3FPZA 2XLRA 1MDLA 4K2SA 2PMQA 1NAAA 3MUCA 4UDQA 1PBDA 2VRMA 4K1WA 2QA2A 1JDFA 1CJ3A 3ENLA 5JCLA 1KF6A 3P9UA 3VDGA 4C3YA 1F9CA 3CMMA 2GGHA 3DJJA 3VR8A 2R4EA 1S2YA 4EMJA 2VVLA 4IT1A 1CC6A 2R4JA 3T37A 1B8SA 1XS2A 5L46A 1N5WC 2FJAA 3G5QA 2XVIA 1XPYA 1YQ4A 2WU2A 2E3TA 1N62C 1TDFA 3KPKA 2EQ6A 3DERA 4ICYA 2OZ8A 2PP1A 2BXRA 3MY9A 3V4BA 5EU9A 1JEHA 4II3A 3Q45A 2EQ7A 3MQTA 3ZLGA 1GERA 2GDQA 3V5FA 4H4VA 4KWSA 1ZY8A 1D7YA 4ZOHB 3H70A 1GOSA 3GDPA 3GWFA 4J34A 4KX6A 4E4FA 3D9XA 2GEWA 2WDVA 1H2IA 4EIPA 1Y0PA 2PCEA 2RDXA 1ZKQA 3LXDA 1B37A 3QSEA 3AEGA 1GREA 2C73A 2PA6A 4H2HA 2ZC8A 3QKEA 3AEBA 1RP0A 3S5SA 1ZX9A 4K5RA 3AEDA 4YKFA 3BI4A 3PVCA 2WP6A 3KUMA 3AECA 5KMSA 1KDGA 3V5CA 4H7UA 3KKJA 4ENLA 1PDHA 3M13A 1H84A 4J3ZA 3R9UA 1Z6LA 2WHDA 5GRTA 3DG6A 2GR0A 1K0IA 4H83A 3H8AA 3DJGX 1PBFA 3ZVHB 2PGWA 2XFUA 4B69A 3GD3A 4P9SA 4YT0A 3SR6B 2E1MA 3M12A 1BQGA 5G5GB 2QDEA 3D47A 4XXGA 5KRQA 1ZMDA 1VQWA 4GGHA 1BWCA 3NRNA 2BA9A 1KN0A 2A8XA 2V3BA 2XH7A 4H4XA 2C70A 2PTXA 3GRTA 1CL0A 4JY2A 3SN0A 4O5QA 1VRQB 2BXSA 2WDRA 4APNA 4A65A 1KSUA 1ZOYA 2PP3A 4CCRA 3EEZA 3TQPA 3PWIA 2BC1A 3SYIA 4UDPA 3T31A 3NH3X 1JPMA 2DKIA 2BCGG 3VC6A 4K8GA 2ZZCA 4GIRA 3S47A 2OQHA 1H7WA 3ZDNA 2ACZA 1GT8A 4EWJA 3AYIA 1TZZA 4J56A 3BI2A 3EAOA 3VCNA 1GPEA 3Q9TA 2O56A 1B5QA 3H4KA 2WP9A 3AE1A 3SX6A 5FJPA 2GH5A 2E4GA 4Z2TA 3RNMA 1LTXR 4GMEA 2GR2A 2QCUA 4CY8A 1JRYA 3TTEA 3N4EA 1D4DA 5JCKA 3NVYB 1P2HA 3DK8A 3DK4A 2POZA 2XCGA 3QVRA 1OJCA 4NEWA 3U4FA 3KLJA 5J7XA 2PHHA 4USRA 4NTCA 5KVIA 3NHOX 2OLOA 1GEUA 2X99A 3DFHA 2B9YA 2WDQA 3DMEA 3GD4A 4BJYA 1OEPA 2AL2A 4H4UA 3SM8A 1PXBA 1P43A 4H4WA 3UJ2A 3FVDA 3N4FA 4A6GA 4GUVA 3UCLA 2GR1A 3QJ4A 3ZVIA 5C2TA 1DNCA 2B7SA 2HXTA 1PDZA 2VQ7A 3DA1A 1YY5A 4TLZA 4C5OA 4E4UA 4Z2RA 3I4KA 2Q6UA 4U8NA 2W0HA 1MXTA 3P0WA 3RP6A 3DG3A 4AT0A 4H4QA 3MZNA 1PXAA 2GMHA 3T2ZA 1D7LA 3GYIA 4PABA 2GAGB 4CNJA 3NKSA 3R0KA 3R11A 1N1PA 3CT2A 2JKCA 5HHFA 5EBKA 4CNKA 1PS9A 2TPRA 3CPHG 2XFQA 2TMDA 3P4QA 4IV9A 3QTPA 1BKHA 5JCMA 3T6CA 2XGZA 1PBBA 3JVAA 3NK0X 2YVGA 1JRPA 2QAEA 3NN0X 2WPCA 3ATQA 3T2KA 1BF3A 2R45A 4NWZA 3CNDA 3K7QX 2YG6A 3CGEA 3CNJA 1CHUA 1JROA 1S7MA 1QLBA 1DODA 3UXKA 2IVEA 4YTNA 3DFYA 1NHQA 3H7VA 3RR1A 1WUEA 1V59A 1RM6B 4AOXA 4YTPA 5ER0A 2Z5XA 5BOEA 4NTEA 1CBOA 3SGLA 3NZGA 1GTHA 3R10A 4F4RA 3T8QA 3SZ0A 4HB9A 1Y56B 3FCPA 3NVWB 2XLSA 1PJ7A 1H83A 4BK1A 3FG2P 3AE9A 3D1CA 4NNJA 2WOIA 4H1ZA 2DW7A 3UJRA 4KPRA 3B9JB 1VQZA 2QVHA 4Z24A 4A79A 3LJPA 2WPEA 3CK5A 2ZZ0A 4IVOB 3CB3A 4NEVA 2BS4A 1RYIA 3FV9A 3KU9A 3NYFA 2OO6A 1KNRA 3HYWA 2C3CA 3SN1A 5JRBA 2DKHA 4U8KA 4B65A 4REKA 4X4JA 3BNUA 1SJDA 2OZTA 2A89A 2BS3A 4HNLA 5BULA 3OZ2A 2XLTA 5LV9A 3GSIA 3UXLA 4EM3A 4EMWA 2CVJA 5FS8A 4N9XA 1MOKA 4A6NA 4NZHA 3OW1A 4U8IA 2C75A 3DG7A 1S2QA 4ZA0A 4ZN0A 1BKWA 3HYVA 2YVFA 4K7ZA 1ECQA 2Y6QA 3ICSA 4Z26A 2EQ8A 3U9IA 3I3LA 3FIMB 3HW2A 3SQPA 3PO7A 4G7FA 2B76A 4B1BA 3HRDC 3AE8A 3AE7A 3FBSA 1IUTA 7ENLA 1EL7A 3AE3A 3AD7B 3K1GA 3EANA 4X9MA 4DHGA 3QLDA 3RCYA 3GRSA
chains in the Genus database with same CATH topology
2BK5A 2V5ZA 1DJQA 1NPXA 3EPTA 5CKUA 1K0IA 4G6GA 2YLWA 4G73A 3ICRA 4A6NB 3DJGX 2WP5A 3P4RA 3BI5A 3GWDA 1Q1WA 3LADA 1PBFA 2QA1A 1JOAA 3COXA 4C3XA 3T2YA 3ABVA 2XFUA 4DNAA 4B69A 3VRAA 2YLXA 1GETA 4YSYA 1MO9A 3GD3A 4U2SA 4U8OA 2WPFA 4EM4A 4P9SA 4YT0A 5KWFA 1OJDA 4FK1C 1DOBA 2E1MA 1VG0A 1COYA 2YLSA 3M12A 2XFPA 4K5SA 1PJ5A 2RABA 5KNLA 3KD9A 4XXGA 3UKHA 2X3NA 3NGCX 4LU6A 5KRQA 1ZMDA 1VQWA 3URHA 3RHAA 1E1LA 1BWCA 3ATRA 2YQUA 3NRNA 5HYMA 2BA9A 1FCDA 1KN0A 2A8XA 2V3BA 1O94A 1ZK7A 1QJDA 4BJZA 2EQ9A 4H4XA 3CGBA 4FK1A 4OCGA 4EQSA 2C70A 2XVHA 3GRTA 1CL0A 2WETA 2YM1A 4JY2A 3GMBA 4O5QA 5BVAA 3IHGA 1VRQB 2BXSA 2WDRA 2GQWA 2NVKX 2ZZBA 4APNA 4JY3A 4E0VA 4Z43A 4UP3A 4A65A 1KSUA 1ZOYA 1FL2A 5EOWA 4D03A 4GDEA 5CQFA 3F8DA 1EBDA 3KPFA 2H89A 4CCRA 4B66A 3AB1A 3ADAB 4DSHA 2B7RA 4CRTA 3H8IA 5M0ZA 2BC1A 4ADWA 3SYIA 2OAMA 4II2A 4CNJA 2XFOA 4UDPA 1JRZA 3T31A 4AOSA 4USQA 4H4ZA 3NH3X 3NTDA 5HY5A 1H86A 1D4CA 1ELIA 4M52A 4TM4A 4LIIA 2AR8A 2YAUA 4Y4NA 1XHCA 3GDNA 3II4A 2DKIA 1F3PA 1GRTA 1NG3A 2BRYA 2YM2A 2V61A 3K7TA 2BCGG 1CC2A 1NHSA 2ZZCA 1OJTA 2BCPA 3NG7X 3NTAA 1H7WA 2VOUA 1OJAA 1E7PA 4WX1A 3ZDNA 2ACZA 1N4WA 1TDOA 2FBWA 3SFEA 1GT8A 3VRDB 3AYIA 3IHMA 4CY6A 1E6EA 4J56A 3BI2A 4YXDA 3EAOA 3AD8B 3QSSA 1F6MA 2RGHA 2R9ZA 1GPEA 2XYOA 2BACA 3Q9TA 1B5QA 1CC4A 3H8LA 3NNEA 3H4KA 4JN9A 4JQ9A 1TDKA 2WP9A 3IC9A 2WS3A 2YLRA 3AE1A 4OPGA 1GRFA 1XPQA 5FS6A 4JNAA 3SX6A 4H2PA 2GH5A 2E4GA 4Z2TA 3RNMA 1LTXR 3LOVA 3G5RA 2J3NA 2GR2A 1L9DA 2QCUA 4WCTA 3REDA 1D5TA 1GRBA 4CY8A 1JRYA 4C74A 2GQFA 4GRTA 3ALLA 4BK3A 5U1OA 4J33A 4CBQA 1JNZA 3HYXA 2XLPA 5KMQA 3UKPA 4NTDA 4O5UA 2GR3A 1DXLA 1D4DA 2C64A 4AT2A 4EQXA 5JCKA 4Z25A 2APGA 4K2XA 4A99A 1LJ1A 3KVEA 2C7GA 3CNPA 1E39A 5FMHA 2XDOA 4IA6A 1JU2A 1P2HA 2Y6RA 2CFYA 3DK8A 2X8CA 3P4SA 1S3BA 3DK4A 1YQ3A 1YQZA 3NIXA 3EF6A 2GB0A 3NK1X 2R0CA 3JSKA 1TDNA 2XCGA 2Z5YA 3QVRA 1OJCA 4AP1A 4NEWA 5FS7A 3KLJA 5J7XA 3ITJA 3NK2X 3P1WA 2ARDA 2PHHA 3QVPA 1Q1RA 2OLNA 4USRA 3SZFA 3UKFA 3NLCA 3AYJA 3ISHA 4FDCB 5KVIA 4NTCA 2AAQA 4YSXA 3NHOX 2OLOA 3V3NA 1H6VA 1GEUA 2X99A 2B9YA 2WDQA 2XVFA 3DMEA 3HZLA 4K8DA 4Y4LA 3GD4A 4ZCDA 4GR1A 3I6DA 3RP8A 1TRBA 2YR6A 4BJYA 4U2TA 2NPXA 4H4RA 4H4UA 3SM8A 2RGOA 1PXBA 1H81A 1KNPA 4BK2A 3PS9A 3B6DA 2YG5A 3VQRA 4U8JA 4OPIA 3UKLA 1DOCA 4H4WA 4CCQA 5IPYA 5U25A 1CF3A 1NENA 3UOYA 2YG3A 5M10A 3SZCA 2XVJA 1GNDA 4A5LA 2GRTA 4J31A 3DK9A 3OC4A 5KMPA 3CGDA 4GUVA 3AD9B 2Q0KA 4D04A 1REOA 3UCLA 2GR1A 3QJ4A 1GRHA 4U8MA 4H4TA 2IVDA 4XWRA 5C2TA 1QO8A 1DNCA 5GSNA 1LQUA 2B7SA 1GALA 4Z2UA 2VQ7A 1IJHA 3DA1A 3FMWA 4OPUA 4LA1A 3AXBA 4RG3A 4TM3A 3RP7A 3UOZA 1M64A 2X8HA 4H4YA 1VG9A 1YY5A 1K0LA 4TLZA 3IWAA 1GESA 1HYUA 4C5OA 5KXJA 1PHHA 2YLZA 2V60A 5BRTA 3NYEA 3UTEA 4G74A 4Z2RA 2UZZA 3CTYA 3K7MX 3F8PA 4B68A 3VR9A 4YSHA 2FJBA 2JB3A 2Q6UA 4U8NA 2W0HA 3IF9A 1MXTA 5C3JA 4IVMB 3UKKA 3E1TA 1E1MA 5J60A 2Q7VA 3RP6A 2FJDA 4ECHA 1XDIA 4AT0A 2YR4A 2GVCA 4H4QA 2JAEA 2ZBWA 3V3OA 1PXAA 2GMHA 3T2ZA 1B4VA 1D7LA 5KMRA 1BGNA 1IUWA 3GYIA 4PABA 2GAGB 4RSLA 3AE5A 4A6NA 1PBCA 1S3EA 4AP3A 2O9ZA 1PJ6A 1F8WA 4H4SA 2JB2A 3NKSA 3AYLA 1AOGA 1N4VA 2BS2A 1N4UA 5KOXA 3GYXA 5JCNA 4OPDA 2A87A 1L0VA 5EB5A 1NHRA 1N1PA 4U8PA 2JKCA 1JNRA 2VRLA 5HHFA 1O5WA 5EBKA 1UKVG 4YTMA 3L8KA 4CNKA 1NEKA 3AEEA 1LVLA 4G9KA 3AEAA 1LQTA 1PS9A 3C96A 2C3DA 2TPRA 3UTFA 1NG4A 3CPHG 3L5OA 3P4PA 1JRXA 2XFQA 1E1KA 4Z44A 2TMDA 3P4QA 3AE4A 1KSSA 3WE0A 4ZCCA 3QFAA 4IV9A 4UDRA 3S5WA 1ZOVA 2C4CA 2YG7A 4OPLA 3UTGA 4EQRA 4TM0A 4B67A 1CJ2A 2GF3A 3CGCA 4H4PA 5JCMA 1TDEA 4OPTA 4H2RA 1BZLA 5IQ1A 1F8SA 2V3AA 2X50A 2AQJA 1PBBA 1GXFA 3L1RA 4K22A 3NK0X 1EL9A 2YG4A 3QFBA 4RG4A 2YVGA 2QAEA 3NN0X 3UOXA 3ALJA 3Q6JA 2X8GA 2WPCA 1XANA 3ATQA 4GAPA 4X9NA 1FOHA 3T2KA 4YKGA 1BF3A 1W4XA 2R45A 3NN6X 3NYCA 4IA5A 3UP5A 2JB1A 1CJ4A 2C72A 1GRAA 1D4EA 3AE6A 1L9CA 4NWZA 2XVEA 3CNDA 3K7QX 2YG6A 2FJEA 4GF7A 1ONFA 2HQMA 3SY4A 3CGEA 2RGJA 3UP4A 1Q9IA 1NDAA 3GYJA 5BUKA 3FPZA 3AWIA 4GAVA 2IIDA 3CNSA 2JBVA 5JCIA 1E1NA 4OVIA 2VQBA 3C4NA 2XLRA 1NAAA 1NHPA 3CNJA 4TM1A 4U8LA 1CHUA 2CDUA 2WOWA 1S7MA 1KFYA 4UDQA 1PBDA 1QLBA 2V6OA 1DODA 2VRMA 2QA2A 1ZMCA 1PXCA 1K4QA 1Y56A 2VZ2A 1CJ3A 2IVEA 4H2NA 1O95A 2BK4A 2E5VA 4YTNA 5JCLA 3CIRA 1KF6A 2OALA 3CNTA 3M0OA 3P9UA 4I59A 4C3YA 3UKAA 3BHFA 3CMMA 1NHQA 2OA1A 1V59A 3DJJA 5KOWA 3VR8A 1ZP0A 1PN0A 4I58A 3B3RA 3CPIG 2R4EA 4H50A 1DJNA 3UTHA 1S2YA 2C67A 4AOXA 3C4AA 4YTPA 4EMJA 2VVLA 5ER0A 2Z5XA 3LZWA 1CC6A 1L9EA 3NT6A 3ALMA 1EL5A 2R4JA 2R0PA 3DGHA 1CBOA 2R0GA 1B8SA 4NTEA 3SFDA 3T37A 4EIQA 4JDRA 5L46A 2JK6A 3SGLA 4H2QA 2FJAA 2H88A 3G5QA 1GTHA 5U63A 2XVIA 2YVJA 4PAAA 1YQ4A 2R46A 1IUSA 3SZ0A 4EQWA 4HB9A 2BRAA 2CULA 5HXIA 5EB4A 1GTEA 3ICTA 4HA6A 5IQ4A 2WU2A 2BABA 3CPJG 1Y56B 1TDFA 3KPKA 2EQ6A 1FECA 2C65A 2XLSA 1PJ7A 4ICYA 1H83A 1CJCA 3BHKA 4BK1A 2BXRA 3UKQA 3FG2P 4A7AA 2YWLA 4MJWA 1JEHA 3AE9A 4Y4MA 3D1CA 1OJ9A 4II3A 4NNJA 2EQ7A 3SZWA 2BC0A 2WOVA 2WOIA 4YWOA 3UOVA 2GV8A 1X31B 3SXIA 1ZDLA 4KPRA 1LPFA 1LV0A 3D8XA 1GERA 2B9WA 3K30A 4GDPA 2YLTA 4Z24A 4DGKA 2C66A 1TYPA 4A79A 2B9XA 4H4VA 3LJPA 2WPEA 1ZY8A 4BURA 1D7YA 2ZZ0A 1RSGA 4IVOB 4NEVA 2BS4A 4B64A 3PG6A 1RYIA 3T14A 3O0HA 1GRGA 1GOSA 3GDPA 3GWFA 3KU9A 4J34A 4KX6A 3NYFA 2BYBA 4TLXA 1KNRA 3HYWA 3VRBA 4FX9A 2C3CA 3KA7A 1GSNA 1TYTA 4BV6A 2WESA 3AEFA 5JRBA 1DOEA 1H82A 4EMIA 2DKHA 2VVMA 2WU5A 3D9XA 2GEWA 4J57A 3LB8A 4U8KA 2C76A 4B65A 2WDVA 4REKA 4X4JA 2YR5A 1H2IA 3BNUA 2BK3A 1FEBA 1PBEA 4G6HA 2A89A 4J36A 1IUXA 4EIPA 1Y0PA 2BS3A 5KVHA 3V76A 1ZKQA 3OZ2A 5BULA 2XLTA 5LV9A 3LXDA 3GSIA 2VVLG 4EM3A 1IUUA 1B37A 4EMWA 3T0KA 3QSEA 3G5SA 3AEGA 1GV4A 4U2LA 4B63A 1GREA 2C73A 2CVJA 5FS8A 2XFNA 4GCMA 2I0ZA 2WQYA 1MOKA 1EL8A 3AEBA 5TR3A 1K0JA 4N9XA 1RP0A 3CN8A 4NZHA 2C75A 4U8IA 1VDCA 5FS9A 3S61A 4XWZA 1S2QA 3GMCA 2F5ZA 1ZX9A 4DSGA 3QSMA 4K5RA 4ZN0A 1BKWA 3HYVA 2YVFA 4JNQA 3DJDA 4K7ZA 3AEDA 1P2EA 2WEUA 4YKFA 2GMJA 3BI4A 3PVCA 2Y6QA 3F8RA 3ICSA 4YSZA 4Z26A 2EQ8A 3I3LA 3FIMB 2WP6A 3DH9A 3DGZA 3AECA 1BGJA 5KMSA 1FEAA 3SQPA 1KDGA 3PO7A 4OPCA 4H7UA 3ZYXA 2B76A 4B1BA 1M6IA 2PYXA 3AE8A 2Q0LA 1F8RA 1PDHA 2XLUA 3KKJA 5DBJA 3M13A 1H84A 3AE7A 4A9WA 1H7XA 1IUTA 1IUVA 2WBAA 3FBSA 3R9UA 3DJEA 4C77A 1EL7A 1Z6LA 3AE3A 3AD7B 3AE2A 2GAHB 3EANA 4X9MA 1SEZA 2WHDA 3BNMA 5GRTA 3LZXA 4J2WA 2GR0A 3GRSA 1YKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BK5 A;  2V5Z A;  1DJQ A;  1NPX A;  3EPT A;  5CKU A;  1K0I A;  4A6N B;  2YLW A;  3ICR A;  3DJG X;  2WP5 A;  3P4R A;  3BI5 A;  3GWD A;  1Q1W A;  3LAD A;  1PBF A;  2QA1 A;  1JOA A;  3COX A;  4C3X A;  3ABV A;  2XFU A;  4DNA A;  4B69 A;  3VRA A;  2YLX A;  1GET A;  4YSY A;  1MO9 A;  3GD3 A;  4U2S A;  4U8O A;  2WPF A;  4EM4 A;  4P9S A;  4YT0 A;  5KWF A;  1OJD A;  4FK1 C;  1DOB A;  2E1M A;  1VG0 A;  1COY A;  2YLS A;  3M12 A;  2XFP A;  4K5S A;  1PJ5 A;  2RAB A;  3KD9 A;  4XXG A;  3UKH A;  2X3N A;  3NGC X;  4LU6 A;  5KRQ A;  1ZMD A;  1VQW A;  3URH A;  3RHA A;  1E1L A;  1BWC A;  3ATR A;  2YQU A;  3NRN A;  5HYM A;  2BA9 A;  1FCD A;  2A8X A;  1O94 A;  2V3B A;  1ZK7 A;  1QJD A;  4BJZ A;  2EQ9 A;  4H4X A;  3CGB A;  4FK1 A;  4OCG A;  4EQS A;  2C70 A;  2XVH A;  3GRT A;  1CL0 A;  2WET A;  2YM1 A;  4JY2 A;  3GMB A;  4O5Q A;  5BVA A;  3IHG A;  1VRQ B;  2BXS A;  2WDR A;  2GQW A;  2NVK X;  2ZZB A;  4APN A;  4JY3 A;  4E0V A;  4Z43 A;  4UP3 A;  4A65 A;  1KSU A;  1ZOY A;  1FL2 A;  5EOW A;  4D03 A;  4GDE A;  5CQF A;  3F8D A;  1EBD A;  3KPF A;  2H89 A;  4CCR A;  4B66 A;  3AB1 A;  3ADA B;  4DSH A;  2B7R A;  4CRT A;  3H8I A;  5M0Z A;  2BC1 A;  4ADW A;  2OAM A;  4CNJ A;  2XFO A;  4UDP A;  1JRZ A;  4AOS A;  4USQ A;  4H4Z A;  3NH3 X;  3NTD A;  5HY5 A;  1H86 A;  1D4C A;  1ELI A;  4M52 A;  4TM4 A;  4LII A;  2AR8 A;  2YAU A;  4Y4N A;  1XHC A;  3GDN A;  3II4 A;  2DKI A;  1F3P A;  1GRT A;  1NG3 A;  2YM2 A;  2V61 A;  3K7T A;  2BCG G;  1CC2 A;  1NHS A;  2ZZC A;  1OJT A;  2BCP A;  3NG7 X;  3NTA A;  1H7W A;  2VOU A;  1OJA A;  1E7P A;  4WX1 A;  3ZDN A;  2ACZ A;  1N4W A;  1TDO A;  2FBW A;  3SFE A;  1GT8 A;  3VRD B;  3AYI A;  3IHM A;  4CY6 A;  1E6E A;  4J56 A;  3BI2 A;  4YXD A;  3EAO A;  3AD8 B;  3QSS A;  1F6M A;  2RGH A;  2R9Z A;  1GPE A;  2XYO A;  2BAC A;  3Q9T A;  1B5Q A;  1CC4 A;  3H8L A;  3NNE A;  3H4K A;  4JN9 A;  4JQ9 A;  1TDK A;  2WP9 A;  3IC9 A;  2WS3 A;  2YLR A;  3AE1 A;  4OPG A;  1GRF A;  1XPQ A;  5FS6 A;  4JNA A;  5KOW A;  4H2P A;  2GH5 A;  2E4G A;  4Z2T A;  3RNM A;  1LTX R;  3LOV A;  3G5R A;  2J3N A;  2GR2 A;  1L9D A;  2QCU A;  4WCT A;  3RED A;  1D5T A;  1GRB A;  4CY8 A;  1JRY A;  4C74 A;  2GQF A;  4GRT A;  3ALL A;  4BK3 A;  5U1O A;  4J33 A;  4CBQ A;  1JNZ A;  2XLP A;  3UKP A;  4NTD A;  4O5U A;  2GR3 A;  1DXL A;  1D4D A;  2C64 A;  4AT2 A;  4EQX A;  5JCK A;  4Z25 A;  2APG A;  4K2X A;  4A99 A;  1LJ1 A;  3KVE A;  2C7G A;  3CNP A;  1E39 A;  5FMH A;  2XDO A;  4IA6 A;  1JU2 A;  1P2H A;  2Y6R A;  2CFY A;  3DK8 A;  2X8C A;  3P4S A;  1S3B A;  3DK4 A;  1YQ3 A;  1YQZ A;  3NIX A;  3EF6 A;  2GB0 A;  3NK1 X;  2R0C A;  3JSK A;  1TDN A;  2XCG A;  2Z5Y A;  3QVR A;  1OJC A;  4AP1 A;  4NEW A;  5FS7 A;  3KLJ A;  5J7X A;  3ITJ A;  3NK2 X;  3P1W A;  2ARD A;  2PHH A;  3QVP A;  1Q1R A;  2OLN A;  4USR A;  3UKF A;  3NLC A;  3AYJ A;  3ISH A;  4FDC B;  5KVI A;  4NTC A;  2AAQ A;  4YSX A;  3NHO X;  2OLO A;  3V3N A;  1H6V A;  1GEU A;  2X99 A;  2B9Y A;  2WDQ A;  2XVF A;  3DME A;  3HZL A;  4K8D A;  4Y4L A;  3GD4 A;  4ZCD A;  4GR1 A;  3I6D A;  3RP8 A;  1TRB A;  2YR6 A;  4BJY A;  4U2T A;  2NPX A;  4H4R A;  4H4U A;  3SM8 A;  2RGO A;  1PXB A;  1H81 A;  1KNP A;  4BK2 A;  3PS9 A;  3B6D A;  2YG5 A;  3VQR A;  4U8J A;  4OPI A;  3UKL A;  1DOC A;  4H4W A;  4CCQ A;  5IPY A;  5U25 A;  1CF3 A;  1NEN A;  3UOY A;  2YG3 A;  5M10 A;  2XVJ A;  1GND A;  4A5L A;  2GRT A;  4J31 A;  3DK9 A;  3OC4 A;  3CGD A;  4GUV A;  3AD9 B;  2Q0K A;  4D04 A;  1REO A;  3UCL A;  2GR1 A;  3QJ4 A;  1GRH A;  4U8M A;  4H4T A;  2IVD A;  4XWR A;  5C2T A;  1QO8 A;  1DNC A;  5GSN A;  1LQU A;  2B7S A;  1GAL A;  4Z2U A;  2VQ7 A;  1IJH A;  3DA1 A;  3FMW A;  4OPU A;  4LA1 A;  3AXB A;  4RG3 A;  4TM3 A;  3RP7 A;  3UOZ A;  1M64 A;  2X8H A;  4H4Y A;  1VG9 A;  1YY5 A;  1K0L A;  4TLZ A;  3IWA A;  1GES A;  1HYU A;  4C5O A;  5KXJ A;  1PHH A;  2YLZ A;  2V60 A;  5BRT A;  3NYE A;  3UTE A;  4Z2R A;  2UZZ A;  3CTY A;  3K7M X;  3F8P A;  4B68 A;  3VR9 A;  4YSH A;  2FJB A;  2JB3 A;  2Q6U A;  4U8N A;  2W0H A;  3IF9 A;  1MXT A;  5C3J A;  4IVM B;  3UKK A;  3E1T A;  1E1M A;  5J60 A;  2Q7V A;  3RP6 A;  2FJD A;  4ECH A;  1XDI A;  4AT0 A;  2YR4 A;  2GVC A;  4H4Q A;  2JAE A;  2ZBW A;  3V3O A;  1PXA A;  2GMH A;  1B4V A;  1D7L A;  1BGN A;  1IUW A;  3GYI A;  4PAB A;  2GAG B;  4RSL A;  3AE5 A;  4A6N A;  1PBC A;  1S3E A;  4AP3 A;  2O9Z A;  1PJ6 A;  1F8W A;  4H4S A;  2JB2 A;  3NKS A;  3AYL A;  1AOG A;  1N4V A;  2BS2 A;  1N4U A;  5KOX A;  5JCN A;  4OPD A;  2A87 A;  1L0V A;  5EB5 A;  1NHR A;  1N1P A;  4U8P A;  2JKC A;  1JNR A;  2VRL A;  5HHF A;  1O5W A;  5EBK A;  1UKV G;  4YTM A;  3L8K A;  4CNK A;  1NEK A;  3AEE A;  1LVL A;  3AEA A;  1LQT A;  1PS9 A;  3C96 A;  2C3D A;  2TPR A;  3UTF A;  1NG4 A;  3CPH G;  3P4P A;  1JRX A;  2XFQ A;  1E1K A;  4Z44 A;  2TMD A;  3P4Q A;  3AE4 A;  1KSS A;  3WE0 A;  4ZCC A;  3QFA A;  4IV9 A;  4UDR A;  3S5W A;  1ZOV A;  2YG7 A;  4OPL A;  3UTG A;  4EQR A;  4TM0 A;  4B67 A;  1CJ2 A;  2GF3 A;  3CGC A;  4H4P A;  5JCM A;  1TDE A;  4OPT A;  4H2R A;  1BZL A;  5IQ1 A;  1F8S A;  2V3A A;  2X50 A;  2AQJ A;  1PBB A;  1GXF A;  3L1R A;  4K22 A;  3NK0 X;  1EL9 A;  2YG4 A;  3QFB A;  4RG4 A;  2YVG A;  2QAE A;  3NN0 X;  3UOX A;  3ALJ A;  3Q6J A;  2X8G A;  2WPC A;  1XAN A;  3ATQ A;  4X9N A;  1FOH A;  4YKG A;  1BF3 A;  1W4X A;  2R45 A;  3NN6 X;  3NYC A;  4IA5 A;  3UP5 A;  2JB1 A;  1CJ4 A;  2C72 A;  1GRA A;  1D4E A;  3AE6 A;  1L9C A;  2XVE A;  3CND A;  3K7Q X;  2YG6 A;  2FJE A;  4GF7 A;  1ONF A;  2HQM A;  3CGE A;  2RGJ A;  3UP4 A;  1Q9I A;  1NDA A;  3GYJ A;  5BUK A;  3FPZ A;  3AWI A;  2IID A;  3CNS A;  2JBV A;  5JCI A;  1E1N A;  4OVI A;  2VQB A;  3C4N A;  2XLR A;  1NAA A;  1NHP A;  3CNJ A;  4TM1 A;  4U8L A;  1CHU A;  2CDU A;  2WOW A;  1KFY A;  4UDQ A;  1PBD A;  1QLB A;  2V6O A;  1DOD A;  2VRM A;  2QA2 A;  1ZMC A;  1PXC A;  1K4Q A;  1Y56 A;  2VZ2 A;  1CJ3 A;  2IVE A;  4H2N A;  1O95 A;  2BK4 A;  2E5V A;  4YTN A;  5JCL A;  3CIR A;  1KF6 A;  2OAL A;  3CNT A;  3M0O A;  3P9U A;  4I59 A;  4C3Y A;  3UKA A;  3BHF A;  1NHQ A;  2OA1 A;  1V59 A;  3DJJ A;  3VR8 A;  1ZP0 A;  1PN0 A;  4I58 A;  3B3R A;  3CPI G;  2R4E A;  4H50 A;  1DJN A;  3UTH A;  1S2Y A;  2C67 A;  4AOX A;  3C4A A;  4YTP A;  4EMJ A;  2VVL A;  5ER0 A;  2Z5X A;  3LZW A;  1CC6 A;  1L9E A;  3NT6 A;  3ALM A;  1EL5 A;  2R4J A;  2R0P A;  3DGH A;  1CBO A;  2R0G A;  1B8S A;  4NTE A;  3SFD A;  3T37 A;  4EIQ A;  4JDR A;  5L46 A;  2JK6 A;  3SGL A;  4H2Q A;  2FJA A;  2H88 A;  3G5Q A;  1GTH A;  5U63 A;  2XVI A;  2YVJ A;  4PAA A;  1YQ4 A;  2R46 A;  1IUS A;  4EQW A;  4HB9 A;  2CUL A;  5HXI A;  5EB4 A;  1GTE A;  3ICT A;  4HA6 A;  5IQ4 A;  2WU2 A;  2BAB A;  3CPJ G;  1Y56 B;  1TDF A;  2EQ6 A;  1FEC A;  2C65 A;  2XLS A;  1PJ7 A;  4ICY A;  1H83 A;  1CJC A;  3BHK A;  4BK1 A;  2BXR A;  3UKQ A;  3FG2 P;  4A7A A;  2YWL A;  4MJW A;  1JEH A;  3AE9 A;  4Y4M A;  3D1C A;  1OJ9 A;  2EQ7 A;  2BC0 A;  2WOV A;  2WOI A;  4YWO A;  3UOV A;  2GV8 A;  1X31 B;  1ZDL A;  4KPR A;  1LPF A;  1LV0 A;  3D8X A;  1GER A;  2B9W A;  3K30 A;  4GDP A;  2YLT A;  4Z24 A;  4DGK A;  2C66 A;  1TYP A;  4A79 A;  2B9X A;  4H4V A;  3LJP A;  2WPE A;  1ZY8 A;  4BUR A;  1D7Y A;  2ZZ0 A;  1RSG A;  4IVO B;  4NEV A;  2BS4 A;  4B64 A;  1RYI A;  3O0H A;  1GRG A;  1GOS A;  3GDP A;  3GWF A;  3KU9 A;  4J34 A;  4KX6 A;  3NYF A;  2BYB A;  4TLX A;  1KNR A;  3VRB A;  4FX9 A;  2C3C A;  3KA7 A;  1GSN A;  1TYT A;  4BV6 A;  2WES A;  3AEF A;  1DOE A;  1H82 A;  4EMI A;  2DKH A;  2VVM A;  2WU5 A;  2GEW A;  4J57 A;  3LB8 A;  4U8K A;  2C76 A;  4B65 A;  2WDV A;  4REK A;  4X4J A;  2YR5 A;  3BNU A;  2BK3 A;  1FEB A;  1PBE A;  4J36 A;  2A89 A;  4EIP A;  1IUX A;  1Y0P A;  2BS3 A;  5KVH A;  3V76 A;  1ZKQ A;  3OZ2 A;  5BUL A;  2XLT A;  5LV9 A;  3LXD A;  3GSI A;  2VVL G;  4EM3 A;  1IUU A;  1B37 A;  4EMW A;  3QSE A;  3G5S A;  3AEG A;  1GV4 A;  4U2L A;  4B63 A;  1GRE A;  2C73 A;  2CVJ A;  5FS8 A;  2XFN A;  4GCM A;  2I0Z A;  2WQY A;  1MOK A;  1EL8 A;  3AEB A;  5TR3 A;  1K0J A;  4N9X A;  1RP0 A;  3CN8 A;  4NZH A;  2C75 A;  4U8I A;  1VDC A;  5FS9 A;  3S61 A;  4XWZ A;  1S2Q A;  3GMC A;  2F5Z A;  1ZX9 A;  4DSG A;  3QSM A;  4K5R A;  4ZN0 A;  1BKW A;  2YVF A;  4JNQ A;  3DJD A;  4K7Z A;  3AED A;  1P2E A;  2WEU A;  4YKF A;  2GMJ A;  3BI4 A;  3PVC A;  2Y6Q A;  3F8R A;  3ICS A;  4YSZ A;  4Z26 A;  2EQ8 A;  3I3L A;  3FIM B;  2WP6 A;  3DH9 A;  3DGZ A;  3AEC A;  1BGJ A;  1FEA A;  3SQP A;  1KDG A;  3PO7 A;  4OPC A;  4H7U A;  3ZYX A;  2B76 A;  4B1B A;  1M6I A;  2PYX A;  3AE8 A;  2Q0L A;  1F8R A;  1PDH A;  2XLU A;  3KKJ A;  5DBJ A;  3M13 A;  1H84 A;  3AE7 A;  4A9W A;  1H7X A;  1IUT A;  1IUV A;  2WBA A;  3FBS A;  3R9U A;  3DJE A;  4C77 A;  1EL7 A;  1Z6L A;  3AE3 A;  3AD7 B;  3AE2 A;  2GAH B;  3EAN A;  4X9M A;  1SEZ A;  2WHD A;  3BNM A;  5GRT A;  3LZX A;  4J2W A;  2GR0 A;  3GRS A;  1YKJ A; 
#chains in the Genus database with same CATH topology
 1DJQ A;  3EPT A;  5CKU A;  2QQ6 A;  3ZLH A;  3ICR A;  3BI5 A;  3GWD A;  2QA1 A;  3SJN A;  1JOA A;  6ENL A;  3T2Y A;  4DNA A;  4YSY A;  1MO9 A;  2WPF A;  2OZ3 A;  4EM4 A;  4HCD A;  4FK1 C;  1VG0 A;  1PJ5 A;  1KKR A;  4LU6 A;  2YQU A;  3TWA A;  3ES7 A;  3P93 A;  1O94 A;  3CGB A;  2WET A;  4JY3 A;  4UP3 A;  4D03 A;  4GDE A;  3IJI A;  5CQF A;  1EBD A;  2H89 A;  3AB1 A;  3H8I A;  3DEQ A;  3TWB A;  1JRZ A;  3NTD A;  5HY5 A;  1ELI A;  4M52 A;  2GGG A;  4E8G A;  4LII A;  2YAU A;  4Y4N A;  3GDN A;  1GRT A;  1X2H A;  3DDM A;  3K7T A;  2PU1 A;  1OJA A;  4E5T A;  1N4W A;  1TDO A;  2FBW A;  3SFE A;  3VRD B;  4GIS A;  3DES A;  4CY6 A;  3IK4 A;  3AD8 B;  2RGH A;  1MDR A;  2R9Z A;  2BAC A;  3H8L A;  4JN9 A;  3NNE A;  3IC9 A;  5KOW A;  1GRF A;  1KD0 A;  2XH2 A;  3G5R A;  1L9D A;  4WCT A;  2PGE A;  3ALL A;  4ROP A;  5U1O A;  4CBQ A;  1JNZ A;  3HYX A;  4NTD A;  2GR3 A;  1DXL A;  2C64 A;  4AT2 A;  4A99 A;  1X2G A;  2XDO A;  2CFY A;  3P4S A;  1YQZ A;  3NRZ B;  3NK1 X;  2R0C A;  1TDN A;  2Z5Y A;  4AP1 A;  3P1W A;  2ARD A;  3QVP A;  3AYJ A;  1H6V A;  3PK7 A;  1N63 C;  4GR1 A;  3I6D A;  2YR6 A;  2NPX A;  4BK2 A;  3PWG A;  3VQR A;  3TJI A;  1DOC A;  1FHV A;  4CCQ A;  5IPY A;  1NEN A;  2XVJ A;  3TCS A;  4A5L A;  5KMP A;  3CGD A;  2Q0K A;  4D04 A;  4MKS A;  1QO8 A;  2W3S A;  4Z2U A;  1IJH A;  3FMW A;  3UOZ A;  3CYJ A;  3IWA A;  4IL0 A;  1GES A;  1STZ A;  2YLZ A;  3UTE A;  2OQY A;  3RIT A;  2HNE A;  4J1O A;  3BOX A;  2JB3 A;  5BOF A;  1E1M A;  1XDI A;  2GVC A;  2JAE A;  3FXG A;  1B4V A;  3MWC A;  4AP3 A;  1F8W A;  4H4S A;  5FJT A;  2JB2 A;  1AOG A;  1N4U A;  2P0I A;  5JCN A;  2VRL A;  1O5W A;  1UKV G;  2AKM A;  3L8K A;  4G9K A;  3C96 A;  2FKP A;  3AE4 A;  3WE0 A;  3AMZ A;  1FFV C;  4HYR A;  4ZCW A;  3UTG A;  4H4P A;  3QPE A;  1BZL A;  2AQJ A;  1MRA A;  3NVZ B;  3UOX A;  2X8G A;  4GAP A;  5J04 A;  1FOH A;  4YKG A;  2JB1 A;  3AE6 A;  3BJS A;  3IJL A;  4GYP A;  2XVE A;  2QGY A;  1NDA A;  3AWI A;  2HZG A;  3CXO A;  2IID A;  4OVI A;  1E1N A;  2VQB A;  2PU0 A;  3C4N A;  4TM1 A;  2WOW A;  2V6O A;  1ZMC A;  1K4Q A;  1ELS A;  2E5V A;  3D46 A;  4I59 A;  3CIR A;  3CNT A;  1PDY A;  1RVK A;  2XH0 A;  3BHF A;  3STP A;  4FP1 A;  5G5H B;  3UTH A;  4I58 A;  4H50 A;  1DJN A;  4HN8 A;  3C4A A;  3LZW A;  3NT6 A;  3OZY A;  2R0G A;  3SFD A;  4HPN A;  4EIQ A;  2P8B A;  2JK6 A;  5U63 A;  1IUS A;  3EUB 3;  2BRA A;  2CUL A;  4TVW A;  1GTE A;  3ICT A;  3OP2 A;  4HA6 A;  2BAB A;  2C65 A;  3BHK A;  3UKQ A;  2YWL A;  4MJW A;  1OJ9 A;  2GL5 A;  3SZW A;  2BC0 A;  2WOV A;  3VCC A;  4DWD A;  1X31 B;  3SXI A;  1ZDL A;  1LPF A;  1LV0 A;  2YLT A;  2C66 A;  2MNR A;  4BUR A;  1RSG A;  4B64 A;  3O0H A;  1GRG A;  4FX9 A;  3KA7 A;  1GSN A;  2WES A;  3AEF A;  1DOE A;  4EMI A;  2VVM A;  4TVY A;  3BSM A;  4J57 A;  3LB8 A;  2C76 A;  3B97 A;  1FEB A;  4G6H A;  4J36 A;  3ZLF A;  3T9P A;  4KPL A;  3T0K A;  3G5S A;  4U2L A;  4GCM A;  3FYY A;  2WQY A;  2I0Z A;  3PFR A;  1EL8 A;  1VDC A;  1R0M A;  4DSG A;  1MUC A;  3ZVH A;  2PTW A;  1P2E A;  2WEU A;  3H12 A;  5IDZ A;  3F8R A;  1JPD X;  4OPC A;  2Q0L A;  1F8R A;  1H7X A;  4DYE A;  3DJE A;  3I6E A;  2GAH B;  3LZX A;  4J2W A;  3A7A A;  2P88 A;  1NPX A;  4G73 A;  3P4R A;  1Q1W A;  5FJO A;  2NQL A;  3ABV A;  1IYX A;  2YLX A;  4U8O A;  5KWF A;  3NVV B;  1N5X A;  2POD A;  3KD9 A;  2PPG A;  3N6H A;  3UKH A;  3NGC X;  1EC9 A;  3URH A;  3IJQ A;  3FJ4 A;  1E1L A;  2HXU A;  2OVL A;  1FCD A;  1QJD A;  3GMB A;  4JN7 A;  1R6W A;  4Z43 A;  4E0V A;  5EOW A;  1FL2 A;  4B66 A;  4DSH A;  4CRT A;  5M0Z A;  3UJF A;  2PTY A;  4II2 A;  2XFO A;  2GGJ A;  1H86 A;  1D4C A;  3ETR B;  2GGI A;  3TW9 A;  1JCT A;  2AR8 A;  4E6M A;  1XHC A;  2BRY A;  1KKO A;  2BCP A;  3NG7 X;  3NTA A;  2VOU A;  3IHM A;  4YXD A;  3QSS A;  1F6M A;  2XYO A;  1CC4 A;  1TDK A;  2WS3 A;  4OPG A;  4H2P A;  3RED A;  1D5T A;  4GRT A;  2AKZ A;  4IHC A;  4J33 A;  3TJ4 A;  1SB3 B;  4EQX A;  4K2X A;  3KVE A;  2C7G A;  3CNP A;  4IA6 A;  1JU2 A;  1S3B A;  1YQ3 A;  3JSK A;  4KT2 A;  3ITJ A;  3NK2 X;  1Q1R A;  1SJA A;  3NLC A;  3ISH A;  2AAQ A;  3V3N A;  3OTR A;  2XVF A;  3Q4D A;  1TRB A;  2ZAD A;  4HCL A;  2OKT A;  4H4R A;  3RRA A;  3PS9 A;  3UJS A;  4DX3 A;  3AM9 A;  4U8J A;  5U25 A;  2YG3 A;  5M10 A;  1GND A;  4J31 A;  1TE6 A;  3DK9 A;  2FYM A;  1REO A;  2P8C A;  4XWR A;  1LQU A;  1GAL A;  4OPU A;  4TM3 A;  4LA1 A;  3AXB A;  4YWS A;  1M64 A;  4JN8 A;  2AL2 B;  5KXJ A;  1L8P A;  2V60 A;  5BRT A;  1ZXI C;  3NYE A;  4G74 A;  2UZZ A;  3F8P A;  4B68 A;  4YSH A;  2FJB A;  5C3J A;  4IVM B;  3UKK A;  2YR4 A;  2ZBW A;  3A7R A;  5KMR A;  1IUW A;  1MNS A;  1FHU A;  4RSL A;  3AE5 A;  3NS1 B;  1S3E A;  2O9Z A;  1PJ6 A;  5KOX A;  3GYX A;  4OPD A;  2A87 A;  5EB5 A;  4U8P A;  2CHR A;  1LVL A;  1LQT A;  3UTF A;  3ES8 A;  3L5O A;  3P4P A;  1JRX A;  4Z44 A;  1E1K A;  1NU5 A;  3MKC A;  3S5W A;  1ZOV A;  4OPL A;  4EQR A;  3RGT A;  2GF3 A;  3CGC A;  3SSZ A;  4H2R A;  5IQ1 A;  2X50 A;  3VC5 A;  1ONE A;  3QFB A;  4RG4 A;  3OPS A;  4Z17 A;  3CAW A;  4X9N A;  3SQS A;  1W4X A;  3NYC A;  1GRA A;  4GF7 A;  3UCC A;  3SY4 A;  2RGJ A;  3UP4 A;  1Q9I A;  5BUK A;  4GAV A;  1N61 C;  3CNS A;  2JBV A;  5JCI A;  1NHP A;  1DTN A;  3N6J A;  2I5Q A;  4U8L A;  2CDU A;  3V3W A;  1KFY A;  1FFU C;  1PXC A;  1Y56 A;  2VZ2 A;  4H2N A;  4HCH A;  1O95 A;  2BK4 A;  3CXB A;  3M0O A;  2OAL A;  3R0U A;  3UKA A;  1V97 A;  3AN1 A;  2OA1 A;  1ZP0 A;  1PN0 A;  3B3R A;  2MUC A;  3CPI G;  2C67 A;  3GY1 A;  1L9E A;  3ALM A;  1EL5 A;  2R0P A;  3DGH A;  4JDR A;  4H2Q A;  2H88 A;  2YVJ A;  4PAA A;  2R46 A;  4EQW A;  5HXI A;  5EB4 A;  5IQ4 A;  5FJR A;  3CPJ G;  1FEC A;  3GC2 A;  1CJC A;  4A7A A;  4Y4M A;  2W3R A;  1T3Q C;  3OZM A;  4GFI A;  4JHM A;  4YWO A;  3UOV A;  2GV8 A;  2E5A A;  3HPF A;  1EBG A;  1P48 A;  3D8X A;  2B9W A;  3K30 A;  4GDP A;  4DGK A;  1TYP A;  1W6T A;  2B9X A;  4IL2 A;  3PG6 A;  3T14 A;  2P3Z A;  1E9I A;  4IZG A;  2BYB A;  4TLX A;  3GD6 A;  2QJN A;  1TYT A;  4BV6 A;  3JZU A;  1H82 A;  2WU5 A;  2YR5 A;  2BK3 A;  1PBE A;  1IUX A;  1VDV A;  3RO6 A;  5KVH A;  4FI4 A;  3V76 A;  3JW7 A;  2VVL G;  1IUU A;  4X2P A;  1GV4 A;  4B63 A;  1N60 C;  2XFN A;  3DGB A;  5TR3 A;  1K0J A;  3S61 A;  3CN8 A;  5FS9 A;  4XWZ A;  3GMC A;  2F5Z A;  2XSX A;  3QSM A;  4JNQ A;  3DJD A;  2GMJ A;  4YSZ A;  2DW6 A;  3DH9 A;  3DGZ A;  4M6U A;  1BGJ A;  2QJM A;  1EBH A;  1FEA A;  3ZYX A;  4M0X A;  1M6I A;  2PYX A;  2XLU A;  5DBJ A;  4A9W A;  4C77 A;  1IUV A;  2WBA A;  3AE2 A;  1SEZ A;  3BNM A;  1YKJ A;  2BK5 A;  2V5Z A;  4MMW A;  4G6G A;  4A6N B;  2YLW A;  2WP5 A;  4IP5 A;  3LAD A;  3COX A;  3VFC A;  4C3X A;  4Z1Y A;  3VRA A;  1GET A;  3MSY A;  1NEL A;  4U2S A;  1TKK A;  1OJD A;  3I6T A;  1DOB A;  1COY A;  2YLS A;  4K5S A;  2XFP A;  4DN1 A;  3SBF A;  2RAB A;  5KNL A;  4DXK A;  2X3N A;  1EC7 A;  4MGG A;  3RHA A;  2GSH A;  3ATR A;  1WYG A;  5HYM A;  1YEY A;  1ZK7 A;  4BJZ A;  2EQ9 A;  2AL1 A;  4FK1 A;  4OCG A;  4EQS A;  2XVH A;  2YM1 A;  5BVA A;  3IHG A;  2OG9 A;  2GQW A;  2NVK X;  2ZZB A;  3F8D A;  2PS2 A;  3KPF A;  3ADA B;  5ENL A;  2B7R A;  3SN4 A;  4ADW A;  2OAM A;  1EC8 A;  4AOS A;  4USQ A;  4H4Z A;  4TM4 A;  3II4 A;  1F3P A;  1NG3 A;  2YM2 A;  2V61 A;  1CC2 A;  1NHS A;  1OJT A;  3R1Z A;  4WX1 A;  1E7P A;  4G8T A;  4IP4 A;  2XH4 A;  4HNC A;  1E6E A;  3P3B A;  3UJE A;  2OX4 A;  4JQ9 A;  5KMQ A;  2YLR A;  3QN3 A;  1XPQ A;  5FS6 A;  4JNA A;  3LOV A;  2J3N A;  1GRB A;  4C74 A;  2GQF A;  3A7U A;  4BK3 A;  2XLP A;  3UKP A;  4O5U A;  4Z25 A;  2ONE A;  2APG A;  1LJ1 A;  1E39 A;  5FMH A;  2Y6R A;  2X8C A;  2OLA A;  3NIX A;  3DIP A;  3EF6 A;  2GB0 A;  2PP0 A;  2W55 A;  3NXL A;  5FS7 A;  2OFJ A;  3SZF A;  2OLN A;  3UKF A;  4FDC B;  4YSX A;  3HZL A;  4K8D A;  4Y4L A;  4ZCD A;  3RP8 A;  4U2T A;  2RGO A;  1H81 A;  1KNP A;  3B6D A;  2YG5 A;  4OPI A;  3UKL A;  2GGE A;  1CF3 A;  3UOY A;  3UCD A;  3SZC A;  1KCZ A;  2GRT A;  3OC4 A;  3AD9 B;  1GRH A;  4U8M A;  4H4T A;  2IVD A;  2OPJ A;  1SJB A;  5GSN A;  1SJC A;  4RG3 A;  3RP7 A;  3TOY A;  2X8H A;  4H4Y A;  1VG9 A;  1FIQ B;  1K0L A;  4A35 A;  1HYU A;  1PHH A;  4GGB A;  3CTY A;  3K7M X;  3VR9 A;  3R25 A;  3IF9 A;  5J60 A;  3E1T A;  2Q7V A;  2FJD A;  4ECH A;  3V3O A;  3NFU A;  1BGN A;  3T4W A;  1PBC A;  3VRB A;  3UGV A;  3AYL A;  2BS2 A;  1N4V A;  1L0V A;  4A3R A;  1NHR A;  1JNR A;  1WUF A;  4YTM A;  1NEK A;  3AEE A;  3VA8 A;  3AEA A;  2C3D A;  3EKG A;  3THU A;  1NG4 A;  1KSS A;  4ZCC A;  3QFA A;  4UDR A;  2C4C A;  2W54 A;  2PSN A;  4H19 A;  2YG7 A;  4TM0 A;  4B67 A;  1CJ2 A;  2QJJ A;  1TDE A;  4OPT A;  1F8S A;  2V3A A;  4GYP C;  3L1R A;  1GXF A;  4K22 A;  1EL9 A;  2YG4 A;  2PTZ A;  5FJU A;  3ALJ A;  3Q6J A;  1FO4 A;  1XAN A;  3NN6 X;  3UP5 A;  4IA5 A;  2QDD A;  3GO2 A;  1CJ4 A;  3R07 C;  1D4E A;  2C72 A;  1L9C A;  2FJE A;  4KEM A;  1ONF A;  2HQM A;  3GYJ A;  3NO1 A;  3FPZ A;  2XLR A;  1MDL A;  4K2S A;  2PMQ A;  1NAA A;  3MUC A;  4UDQ A;  1PBD A;  2VRM A;  4K1W A;  2QA2 A;  1JDF A;  1CJ3 A;  3ENL A;  5JCL A;  1KF6 A;  3P9U A;  3VDG A;  4C3Y A;  1F9C A;  3CMM A;  2GGH A;  3DJJ A;  3VR8 A;  2R4E A;  1S2Y A;  4EMJ A;  2VVL A;  4IT1 A;  1CC6 A;  2R4J A;  3T37 A;  1B8S A;  1XS2 A;  5L46 A;  1N5W C;  2FJA A;  3G5Q A;  2XVI A;  1XPY A;  1YQ4 A;  2WU2 A;  2E3T A;  1N62 C;  1TDF A;  3KPK A;  2EQ6 A;  3DER A;  4ICY A;  2OZ8 A;  2PP1 A;  2BXR A;  3MY9 A;  3V4B A;  5EU9 A;  1JEH A;  4II3 A;  3Q45 A;  2EQ7 A;  3MQT A;  3ZLG A;  1GER A;  2GDQ A;  3V5F A;  4H4V A;  4KWS A;  1ZY8 A;  1D7Y A;  4ZOH B;  3H70 A;  1GOS A;  3GDP A;  3GWF A;  4J34 A;  4KX6 A;  4E4F A;  3D9X A;  2GEW A;  2WDV A;  1H2I A;  4EIP A;  1Y0P A;  2PCE A;  2RDX A;  1ZKQ A;  3LXD A;  1B37 A;  3QSE A;  3AEG A;  1GRE A;  2C73 A;  2PA6 A;  4H2H A;  2ZC8 A;  3QKE A;  3AEB A;  1RP0 A;  3S5S A;  1ZX9 A;  4K5R A;  3AED A;  4YKF A;  3BI4 A;  3PVC A;  2WP6 A;  3KUM A;  3AEC A;  5KMS A;  1KDG A;  3V5C A;  4H7U A;  3KKJ A;  4ENL A;  1PDH A;  3M13 A;  1H84 A;  4J3Z A;  3R9U A;  1Z6L A;  2WHD A;  5GRT A;  3DG6 A;  2GR0 A;  1K0I A;  4H83 A;  3H8A A;  3DJG X;  1PBF A;  3ZVH B;  2PGW A;  2XFU A;  4B69 A;  3GD3 A;  4P9S A;  4YT0 A;  3SR6 B;  2E1M A;  3M12 A;  1BQG A;  5G5G B;  2QDE A;  3D47 A;  4XXG A;  5KRQ A;  1ZMD A;  1VQW A;  4GGH A;  1BWC A;  3NRN A;  2BA9 A;  1KN0 A;  2A8X A;  2V3B A;  2XH7 A;  4H4X A;  2C70 A;  2PTX A;  3GRT A;  1CL0 A;  4JY2 A;  3SN0 A;  4O5Q A;  1VRQ B;  2BXS A;  2WDR A;  4APN A;  4A65 A;  1KSU A;  1ZOY A;  2PP3 A;  4CCR A;  3EEZ A;  3TQP A;  3PWI A;  2BC1 A;  3SYI A;  4UDP A;  3T31 A;  3NH3 X;  1JPM A;  2DKI A;  2BCG G;  3VC6 A;  4K8G A;  2ZZC A;  4GIR A;  3S47 A;  2OQH A;  1H7W A;  3ZDN A;  2ACZ A;  1GT8 A;  4EWJ A;  3AYI A;  1TZZ A;  4J56 A;  3BI2 A;  3EAO A;  3VCN A;  1GPE A;  3Q9T A;  2O56 A;  1B5Q A;  3H4K A;  2WP9 A;  3AE1 A;  3SX6 A;  5FJP A;  2GH5 A;  2E4G A;  4Z2T A;  3RNM A;  1LTX R;  4GME A;  2GR2 A;  2QCU A;  4CY8 A;  1JRY A;  3TTE A;  3N4E A;  1D4D A;  5JCK A;  3NVY B;  1P2H A;  3DK8 A;  3DK4 A;  2POZ A;  2XCG A;  3QVR A;  1OJC A;  4NEW A;  3U4F A;  3KLJ A;  5J7X A;  2PHH A;  4USR A;  4NTC A;  5KVI A;  3NHO X;  2OLO A;  1GEU A;  2X99 A;  3DFH A;  2B9Y A;  2WDQ A;  3DME A;  3GD4 A;  4BJY A;  1OEP A;  2AL2 A;  4H4U A;  3SM8 A;  1PXB A;  1P43 A;  4H4W A;  3UJ2 A;  3FVD A;  3N4F A;  4A6G A;  4GUV A;  3UCL A;  2GR1 A;  3QJ4 A;  3ZVI A;  5C2T A;  1DNC A;  2B7S A;  2HXT A;  1PDZ A;  2VQ7 A;  3DA1 A;  1YY5 A;  4TLZ A;  4C5O A;  4E4U A;  4Z2R A;  3I4K A;  2Q6U A;  4U8N A;  2W0H A;  1MXT A;  3P0W A;  3RP6 A;  3DG3 A;  4AT0 A;  4H4Q A;  3MZN A;  1PXA A;  2GMH A;  3T2Z A;  1D7L A;  3GYI A;  4PAB A;  2GAG B;  4CNJ A;  3NKS A;  3R0K A;  3R11 A;  1N1P A;  3CT2 A;  2JKC A;  5HHF A;  5EBK A;  4CNK A;  1PS9 A;  2TPR A;  3CPH G;  2XFQ A;  2TMD A;  3P4Q A;  4IV9 A;  3QTP A;  1BKH A;  5JCM A;  3T6C A;  2XGZ A;  1PBB A;  3JVA A;  3NK0 X;  2YVG A;  1JRP A;  2QAE A;  3NN0 X;  2WPC A;  3ATQ A;  3T2K A;  1BF3 A;  2R45 A;  4NWZ A;  3CND A;  3K7Q X;  2YG6 A;  3CGE A;  3CNJ A;  1CHU A;  1JRO A;  1S7M A;  1QLB A;  1DOD A;  3UXK A;  2IVE A;  4YTN A;  3DFY A;  1NHQ A;  3H7V A;  3RR1 A;  1WUE A;  1V59 A;  1RM6 B;  4AOX A;  4YTP A;  5ER0 A;  2Z5X A;  5BOE A;  4NTE A;  1CBO A;  3SGL A;  3NZG A;  1GTH A;  3R10 A;  4F4R A;  3T8Q A;  3SZ0 A;  4HB9 A;  1Y56 B;  3FCP A;  3NVW B;  2XLS A;  1PJ7 A;  1H83 A;  4BK1 A;  3FG2 P;  3AE9 A;  3D1C A;  4NNJ A;  2WOI A;  4H1Z A;  2DW7 A;  3UJR A;  4KPR A;  3B9J B;  1VQZ A;  2QVH A;  4Z24 A;  4A79 A;  3LJP A;  2WPE A;  3CK5 A;  2ZZ0 A;  4IVO B;  3CB3 A;  4NEV A;  2BS4 A;  1RYI A;  3FV9 A;  3KU9 A;  3NYF A;  2OO6 A;  1KNR A;  3HYW A;  2C3C A;  3SN1 A;  5JRB A;  2DKH A;  4U8K A;  4B65 A;  4REK A;  4X4J A;  3BNU A;  1SJD A;  2OZT A;  2A89 A;  2BS3 A;  4HNL A;  5BUL A;  3OZ2 A;  2XLT A;  5LV9 A;  3GSI A;  3UXL A;  4EM3 A;  4EMW A;  2CVJ A;  5FS8 A;  4N9X A;  1MOK A;  4A6N A;  4NZH A;  3OW1 A;  4U8I A;  2C75 A;  3DG7 A;  1S2Q A;  4ZA0 A;  4ZN0 A;  1BKW A;  3HYV A;  2YVF A;  4K7Z A;  1ECQ A;  2Y6Q A;  3ICS A;  4Z26 A;  2EQ8 A;  3U9I A;  3I3L A;  3FIM B;  3HW2 A;  3SQP A;  3PO7 A;  4G7F A;  2B76 A;  4B1B A;  3HRD C;  3AE8 A;  3AE7 A;  3FBS A;  1IUT A;  7ENL A;  1EL7 A;  3AE3 A;  3AD7 B;  3K1G A;  3EAN A;  4X9M A;  4DHG A;  3QLD A;  3RCY A;  3GRS A; 
#chains in the Genus database with same CATH homology
 2BK5 A;  2V5Z A;  1DJQ A;  1NPX A;  3EPT A;  5CKU A;  1K0I A;  4G6G A;  2YLW A;  4G73 A;  3ICR A;  4A6N B;  3DJG X;  2WP5 A;  3P4R A;  3BI5 A;  3GWD A;  1Q1W A;  3LAD A;  1PBF A;  2QA1 A;  1JOA A;  3COX A;  4C3X A;  3T2Y A;  3ABV A;  2XFU A;  4DNA A;  4B69 A;  3VRA A;  2YLX A;  1GET A;  4YSY A;  1MO9 A;  3GD3 A;  4U2S A;  4U8O A;  2WPF A;  4EM4 A;  4P9S A;  4YT0 A;  5KWF A;  1OJD A;  4FK1 C;  1DOB A;  2E1M A;  1VG0 A;  1COY A;  2YLS A;  3M12 A;  2XFP A;  4K5S A;  1PJ5 A;  2RAB A;  5KNL A;  3KD9 A;  4XXG A;  3UKH A;  2X3N A;  3NGC X;  4LU6 A;  5KRQ A;  1ZMD A;  1VQW A;  3URH A;  3RHA A;  1E1L A;  1BWC A;  3ATR A;  2YQU A;  3NRN A;  5HYM A;  2BA9 A;  1FCD A;  1KN0 A;  2A8X A;  2V3B A;  1O94 A;  1ZK7 A;  1QJD A;  4BJZ A;  2EQ9 A;  4H4X A;  3CGB A;  4FK1 A;  4OCG A;  4EQS A;  2C70 A;  2XVH A;  3GRT A;  1CL0 A;  2WET A;  2YM1 A;  4JY2 A;  3GMB A;  4O5Q A;  5BVA A;  3IHG A;  1VRQ B;  2BXS A;  2WDR A;  2GQW A;  2NVK X;  2ZZB A;  4APN A;  4JY3 A;  4E0V A;  4Z43 A;  4UP3 A;  4A65 A;  1KSU A;  1ZOY A;  1FL2 A;  5EOW A;  4D03 A;  4GDE A;  5CQF A;  3F8D A;  1EBD A;  3KPF A;  2H89 A;  4CCR A;  4B66 A;  3AB1 A;  3ADA B;  4DSH A;  2B7R A;  4CRT A;  3H8I A;  5M0Z A;  2BC1 A;  4ADW A;  3SYI A;  2OAM A;  4II2 A;  4CNJ A;  2XFO A;  4UDP A;  1JRZ A;  3T31 A;  4AOS A;  4USQ A;  4H4Z A;  3NH3 X;  3NTD A;  5HY5 A;  1H86 A;  1D4C A;  1ELI A;  4M52 A;  4TM4 A;  4LII A;  2AR8 A;  2YAU A;  4Y4N A;  1XHC A;  3GDN A;  3II4 A;  2DKI A;  1F3P A;  1GRT A;  1NG3 A;  2BRY A;  2YM2 A;  2V61 A;  3K7T A;  2BCG G;  1CC2 A;  1NHS A;  2ZZC A;  1OJT A;  2BCP A;  3NG7 X;  3NTA A;  1H7W A;  2VOU A;  1OJA A;  1E7P A;  4WX1 A;  3ZDN A;  2ACZ A;  1N4W A;  1TDO A;  2FBW A;  3SFE A;  1GT8 A;  3VRD B;  3AYI A;  3IHM A;  4CY6 A;  1E6E A;  4J56 A;  3BI2 A;  4YXD A;  3EAO A;  3AD8 B;  3QSS A;  1F6M A;  2RGH A;  2R9Z A;  1GPE A;  2XYO A;  2BAC A;  3Q9T A;  1B5Q A;  1CC4 A;  3H8L A;  3NNE A;  3H4K A;  4JN9 A;  4JQ9 A;  1TDK A;  2WP9 A;  3IC9 A;  2WS3 A;  2YLR A;  3AE1 A;  4OPG A;  1GRF A;  1XPQ A;  5FS6 A;  4JNA A;  3SX6 A;  4H2P A;  2GH5 A;  2E4G A;  4Z2T A;  3RNM A;  1LTX R;  3LOV A;  3G5R A;  2J3N A;  2GR2 A;  1L9D A;  2QCU A;  4WCT A;  3RED A;  1D5T A;  1GRB A;  4CY8 A;  1JRY A;  4C74 A;  2GQF A;  4GRT A;  3ALL A;  4BK3 A;  5U1O A;  4J33 A;  4CBQ A;  1JNZ A;  3HYX A;  2XLP A;  5KMQ A;  3UKP A;  4NTD A;  4O5U A;  2GR3 A;  1DXL A;  1D4D A;  2C64 A;  4AT2 A;  4EQX A;  5JCK A;  4Z25 A;  2APG A;  4K2X A;  4A99 A;  1LJ1 A;  3KVE A;  2C7G A;  3CNP A;  1E39 A;  5FMH A;  2XDO A;  4IA6 A;  1JU2 A;  1P2H A;  2Y6R A;  2CFY A;  3DK8 A;  2X8C A;  3P4S A;  1S3B A;  3DK4 A;  1YQ3 A;  1YQZ A;  3NIX A;  3EF6 A;  2GB0 A;  3NK1 X;  2R0C A;  3JSK A;  1TDN A;  2XCG A;  2Z5Y A;  3QVR A;  1OJC A;  4AP1 A;  4NEW A;  5FS7 A;  3KLJ A;  5J7X A;  3ITJ A;  3NK2 X;  3P1W A;  2ARD A;  2PHH A;  3QVP A;  1Q1R A;  2OLN A;  4USR A;  3SZF A;  3UKF A;  3NLC A;  3AYJ A;  3ISH A;  4FDC B;  5KVI A;  4NTC A;  2AAQ A;  4YSX A;  3NHO X;  2OLO A;  3V3N A;  1H6V A;  1GEU A;  2X99 A;  2B9Y A;  2WDQ A;  2XVF A;  3DME A;  3HZL A;  4K8D A;  4Y4L A;  3GD4 A;  4ZCD A;  4GR1 A;  3I6D A;  3RP8 A;  1TRB A;  2YR6 A;  4BJY A;  4U2T A;  2NPX A;  4H4R A;  4H4U A;  3SM8 A;  2RGO A;  1PXB A;  1H81 A;  1KNP A;  4BK2 A;  3PS9 A;  3B6D A;  2YG5 A;  3VQR A;  4U8J A;  4OPI A;  3UKL A;  1DOC A;  4H4W A;  4CCQ A;  5IPY A;  5U25 A;  1CF3 A;  1NEN A;  3UOY A;  2YG3 A;  5M10 A;  3SZC A;  2XVJ A;  1GND A;  4A5L A;  2GRT A;  4J31 A;  3DK9 A;  3OC4 A;  5KMP A;  3CGD A;  4GUV A;  3AD9 B;  2Q0K A;  4D04 A;  1REO A;  3UCL A;  2GR1 A;  3QJ4 A;  1GRH A;  4U8M A;  4H4T A;  2IVD A;  4XWR A;  5C2T A;  1QO8 A;  1DNC A;  5GSN A;  1LQU A;  2B7S A;  1GAL A;  4Z2U A;  2VQ7 A;  1IJH A;  3DA1 A;  3FMW A;  4OPU A;  4LA1 A;  3AXB A;  4RG3 A;  4TM3 A;  3RP7 A;  3UOZ A;  1M64 A;  2X8H A;  4H4Y A;  1VG9 A;  1YY5 A;  1K0L A;  4TLZ A;  3IWA A;  1GES A;  1HYU A;  4C5O A;  5KXJ A;  1PHH A;  2YLZ A;  2V60 A;  5BRT A;  3NYE A;  3UTE A;  4G74 A;  4Z2R A;  2UZZ A;  3CTY A;  3K7M X;  3F8P A;  4B68 A;  3VR9 A;  4YSH A;  2FJB A;  2JB3 A;  2Q6U A;  4U8N A;  2W0H A;  3IF9 A;  1MXT A;  5C3J A;  4IVM B;  3UKK A;  3E1T A;  1E1M A;  5J60 A;  2Q7V A;  3RP6 A;  2FJD A;  4ECH A;  1XDI A;  4AT0 A;  2YR4 A;  2GVC A;  4H4Q A;  2JAE A;  2ZBW A;  3V3O A;  1PXA A;  2GMH A;  3T2Z A;  1B4V A;  1D7L A;  5KMR A;  1BGN A;  1IUW A;  3GYI A;  4PAB A;  2GAG B;  4RSL A;  3AE5 A;  4A6N A;  1PBC A;  1S3E A;  4AP3 A;  2O9Z A;  1PJ6 A;  1F8W A;  4H4S A;  2JB2 A;  3NKS A;  3AYL A;  1AOG A;  1N4V A;  2BS2 A;  1N4U A;  5KOX A;  3GYX A;  5JCN A;  4OPD A;  2A87 A;  1L0V A;  5EB5 A;  1NHR A;  1N1P A;  4U8P A;  2JKC A;  1JNR A;  2VRL A;  5HHF A;  1O5W A;  5EBK A;  1UKV G;  4YTM A;  3L8K A;  4CNK A;  1NEK A;  3AEE A;  1LVL A;  4G9K A;  3AEA A;  1LQT A;  1PS9 A;  3C96 A;  2C3D A;  2TPR A;  3UTF A;  1NG4 A;  3CPH G;  3L5O A;  3P4P A;  1JRX A;  2XFQ A;  1E1K A;  4Z44 A;  2TMD A;  3P4Q A;  3AE4 A;  1KSS A;  3WE0 A;  4ZCC A;  3QFA A;  4IV9 A;  4UDR A;  3S5W A;  1ZOV A;  2C4C A;  2YG7 A;  4OPL A;  3UTG A;  4EQR A;  4TM0 A;  4B67 A;  1CJ2 A;  2GF3 A;  3CGC A;  4H4P A;  5JCM A;  1TDE A;  4OPT A;  4H2R A;  1BZL A;  5IQ1 A;  1F8S A;  2V3A A;  2X50 A;  2AQJ A;  1PBB A;  1GXF A;  3L1R A;  4K22 A;  3NK0 X;  1EL9 A;  2YG4 A;  3QFB A;  4RG4 A;  2YVG A;  2QAE A;  3NN0 X;  3UOX A;  3ALJ A;  3Q6J A;  2X8G A;  2WPC A;  1XAN A;  3ATQ A;  4GAP A;  4X9N A;  1FOH A;  3T2K A;  4YKG A;  1BF3 A;  1W4X A;  2R45 A;  3NN6 X;  3NYC A;  4IA5 A;  3UP5 A;  2JB1 A;  1CJ4 A;  2C72 A;  1GRA A;  1D4E A;  3AE6 A;  1L9C A;  4NWZ A;  2XVE A;  3CND A;  3K7Q X;  2YG6 A;  2FJE A;  4GF7 A;  1ONF A;  2HQM A;  3SY4 A;  3CGE A;  2RGJ A;  3UP4 A;  1Q9I A;  1NDA A;  3GYJ A;  5BUK A;  3FPZ A;  3AWI A;  4GAV A;  2IID A;  3CNS A;  2JBV A;  5JCI A;  1E1N A;  4OVI A;  2VQB A;  3C4N A;  2XLR A;  1NAA A;  1NHP A;  3CNJ A;  4TM1 A;  4U8L A;  1CHU A;  2CDU A;  2WOW A;  1S7M A;  1KFY A;  4UDQ A;  1PBD A;  1QLB A;  2V6O A;  1DOD A;  2VRM A;  2QA2 A;  1ZMC A;  1PXC A;  1K4Q A;  1Y56 A;  2VZ2 A;  1CJ3 A;  2IVE A;  4H2N A;  1O95 A;  2BK4 A;  2E5V A;  4YTN A;  5JCL A;  3CIR A;  1KF6 A;  2OAL A;  3CNT A;  3M0O A;  3P9U A;  4I59 A;  4C3Y A;  3UKA A;  3BHF A;  3CMM A;  1NHQ A;  2OA1 A;  1V59 A;  3DJJ A;  5KOW A;  3VR8 A;  1ZP0 A;  1PN0 A;  4I58 A;  3B3R A;  3CPI G;  2R4E A;  4H50 A;  1DJN A;  3UTH A;  1S2Y A;  2C67 A;  4AOX A;  3C4A A;  4YTP A;  4EMJ A;  2VVL A;  5ER0 A;  2Z5X A;  3LZW A;  1CC6 A;  1L9E A;  3NT6 A;  3ALM A;  1EL5 A;  2R4J A;  2R0P A;  3DGH A;  1CBO A;  2R0G A;  1B8S A;  4NTE A;  3SFD A;  3T37 A;  4EIQ A;  4JDR A;  5L46 A;  2JK6 A;  3SGL A;  4H2Q A;  2FJA A;  2H88 A;  3G5Q A;  1GTH A;  5U63 A;  2XVI A;  2YVJ A;  4PAA A;  1YQ4 A;  2R46 A;  1IUS A;  3SZ0 A;  4EQW A;  4HB9 A;  2BRA A;  2CUL A;  5HXI A;  5EB4 A;  1GTE A;  3ICT A;  4HA6 A;  5IQ4 A;  2WU2 A;  2BAB A;  3CPJ G;  1Y56 B;  1TDF A;  3KPK A;  2EQ6 A;  1FEC A;  2C65 A;  2XLS A;  1PJ7 A;  4ICY A;  1H83 A;  1CJC A;  3BHK A;  4BK1 A;  2BXR A;  3UKQ A;  3FG2 P;  4A7A A;  2YWL A;  4MJW A;  1JEH A;  3AE9 A;  4Y4M A;  3D1C A;  1OJ9 A;  4II3 A;  4NNJ A;  2EQ7 A;  3SZW A;  2BC0 A;  2WOV A;  2WOI A;  4YWO A;  3UOV A;  2GV8 A;  1X31 B;  3SXI A;  1ZDL A;  4KPR A;  1LPF A;  1LV0 A;  3D8X A;  1GER A;  2B9W A;  3K30 A;  4GDP A;  2YLT A;  4Z24 A;  4DGK A;  2C66 A;  1TYP A;  4A79 A;  2B9X A;  4H4V A;  3LJP A;  2WPE A;  1ZY8 A;  4BUR A;  1D7Y A;  2ZZ0 A;  1RSG A;  4IVO B;  4NEV A;  2BS4 A;  4B64 A;  3PG6 A;  1RYI A;  3T14 A;  3O0H A;  1GRG A;  1GOS A;  3GDP A;  3GWF A;  3KU9 A;  4J34 A;  4KX6 A;  3NYF A;  2BYB A;  4TLX A;  1KNR A;  3HYW A;  3VRB A;  4FX9 A;  2C3C A;  3KA7 A;  1GSN A;  1TYT A;  4BV6 A;  2WES A;  3AEF A;  5JRB A;  1DOE A;  1H82 A;  4EMI A;  2DKH A;  2VVM A;  2WU5 A;  3D9X A;  2GEW A;  4J57 A;  3LB8 A;  4U8K A;  2C76 A;  4B65 A;  2WDV A;  4REK A;  4X4J A;  2YR5 A;  1H2I A;  3BNU A;  2BK3 A;  1FEB A;  1PBE A;  4G6H A;  2A89 A;  4J36 A;  1IUX A;  4EIP A;  1Y0P A;  2BS3 A;  5KVH A;  3V76 A;  1ZKQ A;  3OZ2 A;  5BUL A;  2XLT A;  5LV9 A;  3LXD A;  3GSI A;  2VVL G;  4EM3 A;  1IUU A;  1B37 A;  4EMW A;  3T0K A;  3QSE A;  3G5S A;  3AEG A;  1GV4 A;  4U2L A;  4B63 A;  1GRE A;  2C73 A;  2CVJ A;  5FS8 A;  2XFN A;  4GCM A;  2I0Z A;  2WQY A;  1MOK A;  1EL8 A;  3AEB A;  5TR3 A;  1K0J A;  4N9X A;  1RP0 A;  3CN8 A;  4NZH A;  2C75 A;  4U8I A;  1VDC A;  5FS9 A;  3S61 A;  4XWZ A;  1S2Q A;  3GMC A;  2F5Z A;  1ZX9 A;  4DSG A;  3QSM A;  4K5R A;  4ZN0 A;  1BKW A;  3HYV A;  2YVF A;  4JNQ A;  3DJD A;  4K7Z A;  3AED A;  1P2E A;  2WEU A;  4YKF A;  2GMJ A;  3BI4 A;  3PVC A;  2Y6Q A;  3F8R A;  3ICS A;  4YSZ A;  4Z26 A;  2EQ8 A;  3I3L A;  3FIM B;  2WP6 A;  3DH9 A;  3DGZ A;  3AEC A;  1BGJ A;  5KMS A;  1FEA A;  3SQP A;  1KDG A;  3PO7 A;  4OPC A;  4H7U A;  3ZYX A;  2B76 A;  4B1B A;  1M6I A;  2PYX A;  3AE8 A;  2Q0L A;  1F8R A;  1PDH A;  2XLU A;  3KKJ A;  5DBJ A;  3M13 A;  1H84 A;  3AE7 A;  4A9W A;  1H7X A;  1IUT A;  1IUV A;  2WBA A;  3FBS A;  3R9U A;  3DJE A;  4C77 A;  1EL7 A;  1Z6L A;  3AE3 A;  3AD7 B;  3AE2 A;  2GAH B;  3EAN A;  4X9M A;  1SEZ A;  2WHD A;  3BNM A;  5GRT A;  3LZX A;  4J2W A;  2GR0 A;  3GRS A;  1YKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...