2P0IA

Crystal structure of l-rhamnonate dehydratase from gibberella zeae
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
407
structure length
393
Chain Sequence
LSSVKDFPKIKAIRSFIIGHWLIDSDISTPASKWEQYKKSRTSWGINVLGSFLVEIEATDGTVGFATGFGGPPACWLVHQHFERFLIGADPRNTNLLFEQMYRASMFYGRKGLPIAVISVIDLALWDLLGKVRNEPVYRLIGGATKERLDFYCTGPEPTAAKAMGFWGGKVPLPFCPDDGHEGLRKNVEFLRKHREAVGPDFPIMVDCYMSLNVSYTIELVKACLDLNINWWEECLSPDDTDGFALIKRAHPTVKFTTGEHEYSRYGFRKLVEGRNLDIIQPDVMWLGGLTELLKVAALAAAYDVPVVPHASGPYSYHFQISQPNTPFQEYLANSPDGKSVLPVFGDLFIDEPIPTKGYLTTADLDKPGFGLTINPAARAKLIPSDYLFKVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords L-rhamnonate dehydratase
publication title Crystal Structure of L-Rhamnonate Dehydratase from Gibberella Zeae
rcsb
source organism Gibberella zeae
total genus 114
structure length 393
sequence length 407
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.90: L-rhamnonate dehydratase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2p0iA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2p0iA01
4A6GA 2ZADA 3B97A 2OZ8A 4DXKA 2OQHA 2GGIA 1EBGA 4IP4A 3RR1A 2QVHA 4G8TA 6ENLA 3D47A 4M6UA 4HCHA 3UJSA 4YWSA 4K1WA 4H2HA 3DFYA 1R0MA 4KT2A 3UXKA 2XH2A 3ZLFA 3Q4DA 4HCLA 4A3RA 2QGYA 3UJEA 3RCYA 3DERA 3P93A 3DIPA 2PTZA 1JPMA 5FJUA 4MKSA 3ZLHA 2DW6A 2PU0A 3V5CA 3HPFA 2PSNA 2PS2A 3NZGA 2HNEA 5FJOA 1P43A 4M0XA 2MUCA 3JVAA 3S5SA 3ZLGA 2XSXA 3I6EA 1BKHA 4FP1A 4HNCA 1EC7A 2QDDA 1KD0A 3MY9A 2OKTA 2OQYA 3BJSA 2MNRA 2O56A 3OZYA 3GD6A 3UJRA 2OO6A 5BOEA 4KWSA 3OP2A 2P8CA 3SJNA 3DGBA 4JN8A 3NFUA 5BOFA 3DG6A 3QTPA 3I6TA 4GISA 3MSYA 3STPA 3ZVIA 1YEYA 3MZNA 3UCDA 4J3ZA 2PU1A 4ENLA 3NO1A 5J04A 3PWIA 1WUEA 3DESA 3TOYA 2HXUA 5IDZA 3EEZA 3THUA 3TJ4A 2PP1A 2OPJA 2RDXA 4GYPC 4GGHA 1MDLA 4DYEA 3U4FA 4EWJA 3ENLA 2P0IA 1XS2A 3H70A 2OLAA 1FHVA 4IL0A 2AKMA 3V3WA 1EC8A 2AL1A 1TZZA 1KKRA 3GO2A 2ZC8A 3SSZA 4F4RA 4GYPA 3SN1A 1W6TA 1ONEA 4A35A 3R10A 4IZGA 3UJFA 2GL5A 1DTNA 3DDMA 1SJCA 5ENLA 4HNLA 1MUCA 1OEPA 3T9PA 7ENLA 3MWCA 1L8PA 3V5FA 3CK5A 3FCPA 3VA8A 2XH4A 2PA6A 2HXTA 4E5TA 3DFHA 3TQPA 1TE6A 3GC2A 4ZCWA 3QPEA 3H7VA 4GGBA 3UCCA 1EC9A 3IJQA 2I5QA 3RGTA 1NELA 2GGEA 4GFIA 3P3BA 3T8QA 3IK4A 2PPGA 3UJ2A 2PP0A 2GDQA 4GMEA 3VCNA 4ROPA 4ZA0A 3FV9A 3V4BA 5FJPA 2QJNA 2PP3A 3R25A 3ZVHB 4E4UA 1TKKA 3I4KA 1ELSA 2OFJA 3EKGA 3JW7A 2PTYA 4H1ZA 3D46A 3OZMA 3DG3A 1WUFA 4DHGA 3N4FA 2PGWA 4E4FA 2P88A 3MQTA 3N6JA 1MNSA 3PFRA 3FXGA 3FYYA 2XGZA 3OTRA 4GIRA 3RITA 1MRAA 4MMWA 2GSHA 3ZVHA 4K8GA 2PODA 2XH0A 4FI4A 4J1OA 3MKCA 1PDYA 2GGHA 1RVKA 3ES7A 3UGVA 4MGGA 3SQSA 4H83A 2NQLA 3VFCA 2QDEA 3NXLA 4DWDA 3QKEA 3P0WA 3GY1A 1XPYA 3KUMA 1KKOA 3RRAA 3S47A 2GGJA 2OVLA 2XH7A 2CHRA 3DEQA 1E9IA 3TW9A 3UXLA 3VC6A 3VC5A 2ONEA 4IP5A 3SN4A 3IJIA 4Z17A 4HCDA 5EU9A 4H19A 3U9IA 1SJDA 3CYJA 3CXOA 3BOXA 2AL2B 3FJ4A 2P3ZA 4DX3A 4KEMA 3N4EA 3CAWA 2QQ6A 3OW1A 4E6MA 1P48A 3SBFA 3SN0A 4E8GA 2PCEA 4G7FA 3R0UA 1KCZA 3R11A 2POZA 1BQGA 4Z1YA 2QJMA 3T4WA 2PMQA 2OX4A 1JPDX 3H8AA 3TWBA 4IL2A 3OPSA 3ES8A 3TJIA 2AL2A 3TTEA 2OZTA 2PTWA 4X2PA 1SJBA 1SJAA 1ECQA 3K1GA 1R6WA 3QLDA 3R1ZA 2FYMA 1F9CA 3T6CA 3CB3A 3DG7A 4DN1A 2P8BA 1JDFA 2AKZA 4JHMA 4KPLA 4HN8A 4HPNA 2HZGA 3BSMA 3Q45A 2FKPA 3IJLA 1EBHA 3N6HA 1MDRA 3PK7A 1NU5A 3MUCA 3JZUA 3R0KA 3TCSA 2OZ3A 3FVDA 1PDZA 5FJTA 4K2SA 3VCCA 3RO6A 1FHUA 2GGGA 2PTXA 1JCTA 3QN3A 4IHCA 2OG9A 3CT2A 3PWGA 4IT1A 2DW7A 2QJJA 4HYRA 4JN7A 1IYXA 2PGEA 3TWAA 5FJRA 3H12A 3VDGA
chains in the Genus database with same CATH superfamily
1PTAA 2ZADA 3ICJA 4ZFMA 4L61A 1YLVA 2NX3A 3OJGA 5BW6A 1AODA 4HU8A 2Y7EA 3DK4A 1KFWA 1QNPA 5C8BB 2REQA 2FJKA 5FEZA 4DJFD 1Q8JA 3D47A 3ZWSA 1SVDA 3UG8A 4MZYA 1A5BA 1W54A 1KCKA 3W1LA 3CHEA 4UTLA 4EPBC 1PL9A 2Z24A 2XYLA 3W7QA 3S42A 3LCFA 3VABA 3GU1A 5FEWA 3L9CA 3ONCA 1YXDA 2C3DA 3M47A 3CQIA 2ZX8A 3KVJA 2I17A 4LW7A 4MKSA 2Q09A 1QR7A 1HVXA 1XM3A 2HNEA 3LRLA 1UP3A 4LS1A 1WBJA 5D33A 2G96A 4J40A 1LL7A 1DWIM 3OVQA 5HMSA 3B0VC 1BVWA 1Y8BA 1OX6A 5HK4A 1XLMA 2QCDB 2VX6A 4HTBA 5E9AA 3CHFA 1XKJA 2E6DA 1OHLA 3B06A 1W1YA 3G0SA 5KMYA 1JPIA 3W37A 4NEWA 1J10A 4NI3A 2J9ZA 2IXVA 4K7ZA 2OB3A 4H8UA 4IGSA 1T8QA 2J7FA 3GHUA 1O1ZA 3M6DA 3OP2A 2H6RA 5I09A 2BV9A 3QV6A 3DG6A 2JQXA 1YMYA 1WDWA 3STPA 1QPKA 2E68A 2X8HA 1PVNA 2ZRXA 4C6EA 1J0KA 1UUOA 2VZSA 1J2WA 1EJUC 4H41A 1Q63A 5F2LA 5G2WA 2NV2A 5K4XA 1LM1A 4V2XA 3II4A 3TJ4A 4DJDD 5HAOA 3SB0A 4GGHA 3U4FA 1S46A 4HPGA 1YDNA 1XS2A 2V3BA 4AWTA 2OLAA 1CYGA 1EC8A 1AJ0A 2BB0A 2HQMA 2GJLA 3SN1A 4KF1A 1SZRA 1XYCA 1L2UA 4QE5A 1EBDA 3IRDA 4N9EA 2J7HA 4H7ZA 4HNLA 1OEPA 3OLIA 4IMCA 5A8PA 3UVIA 3ZM8A 4DBSA 3V5FA 2YCLB 3M0KA 4UNKA 1LG2A 2ZA2A 1U1UA 2GQ3A 4JYEA 1AL7A 4FOUA 1X7FA 1CGWA 1LOLA 1ZLPA 1AUSL 4X61A 5AECA 4M52A 3GIQA 2NQ9A 3WELA 5AHLA 2GH5A 4PCFA 5HNUA 1PS9A 3LN3A 2V5JA 2QIWA 1J01A 1Z7AA 1MWOA 5A6AA 1ZAJA 3NVZB 1S5MA 3CXBA 3GTIA 4LC6A 1VEMA 1YPIA 1H49A 3NQMA 2VEKA 3DH7A 4WCJA 5EBKA 3QR3A 1WPCA 4ZOBA 1D7FA 1M7OA 3RXZA 2C7FA 4BF5A 3EDKA 1R2TA 1JAEA 1OCBA 1UZ4A 2QJNA 1ICPA 3R25A 1KRBC 3TXVA 1FOBA 2WQDA 3TA9A 3CUIA 3V1PA 1MW2A 2J9YA 2YXGA 3CQJA 4GABA 4WXZA 2NVCA 4NZ1A 1OFPA 3I4KA 5CKSA 5A6BD 4YCPA 3GNXA 1FFVC 3D46A 3IUHA 3DG3A 1WUFA 3WDPP 3QZEA 3IPWA 3H21A 3G1XA 3MDUA 4NASA 1CWYA 4XBJA 2P50A 4UWMA 4K7YA 1YTDA 1R9XA 2FZNA 3KVLA 1YPXA 2A7PA 2XH0A 2ATSA 1GQNA 5G4WA 1XSIA 4GPNA 4ZMGA 5MF5A 5DLCA 3PZVA 3HURA 2GR1A 4J5NA 1I1WA 3HFYA 2Y7FA 3MI2A 4Z0JA 3GDKA 3NQFA 4AD5A 2CERA 1UPPA 5BROA 3STEA 4WY0F 3KOFA 2A2IA 1GZGA 4XZIA 3IJ8A 5U4NA 3BAJA 1EKOA 1SJDA 3DYOA 1CCWB 2AL2B 4WGXA 3T0CA 2INFA 3L8KA 4KEMA 1XQKA 3DK8A 1GQKA 4UFHA 3K2GA 5J8LA 3LU2A 2OCZA 3CUJA 4W88A 3KHDA 2R1KA 3TSDA 1W1IE 1XSKA 1EIBA 3TQ0A 3DI0A 3MVIA 3FJNA 1XLLA 4HBKA 4KCWA 4LNYA 3RJYA 1DKWA 1H62A 1FIQB 4Z2KA 3VDHA 1QI5A 4Y9AA 3QLDA 4BEQA 3ARQA 1SFTA 3T6CA 1BHGA 1XFBA 2XIJA 3TTOA 2BP1A 4LANA 1QPRA 3UNTA 1ME9A 2E5CA 4NXSA 4DF1A 3P6LA 2C0AA 4QNEA 4X2RA 1A3HA 3TYEA 3UWUA 2FKPA 3IUDA 2GRTA 1WA3A 3KZSA 3WZ0E 1UR3M 5CLWA 3GSMA 3BICA 4F48A 4D6JA 3EZ4A 1IIHA 1XL9A 3AFBA 1EWEA 3NDOA 1Q4NX 4US6A 3SADA 3V0TA 1VBUA 5C2GA 1QK2A 3U2CA 2O55A 3NZPA 3CWOX 4BWLC 1KBJA 1IEQA 4RZBA 2VUNA 1E1CA 4Q8TA 4HKPA 1K9EA 4DBWA 4LSBA 3NQVA 1K9FA 1AH0A 3LHYA 2IQ0A 3ITOA 3H12A 3W87A 5JIWA 3LDVA 2QCNA 5FSEC 1LQAA 2BASA 1M9HA 2BVDA 2Z1BA 3G1VA 2NT0A 1UZHA 3FSUA 3K5XA 3PR2A 2YYUA 4PTXA 2J3NA 4UR8A 2E25A 3PBMA 3TU9A 2PAJA 3ITTA 1PKLA 1BG9A 3OVGA 3OIHA 3UXDA 4UQBA 3U48A 3A21A 1FEBA 1XLKA 4UZSA 1LQ0A 1EYWA 4NRSA 3VE7A 1NHSA 4UR9A 1S39A 1YW1A 3STGA 4GCAA 1HFBA 5CLTA 4H4PA 4J57A 2NV1A 1JPMA 7PTDA 2QAFA 3W7NA 4W86A 3EXSA 3ISIX 3U0HA 5JH2A 3W83A 3AHZA 1V0NA 4W84A 2A0NA 3PB2A 5DMYA 5HNRA 4ZO6A 3WDJA 1H7RA 4L1GA 1JAKA 3WNNA 5AHIA 3ARVA 4F0KA 2NV9A 4OHQA 2I9UA 2OSXA 1S5NA 4JNMA 5LIWX 4RNFA 2OEKA 3R58A 2CNCA 2PC4A 1OCNA 3MSDA 2WCGA 4JTEA 1UWIA 2OO6A 2RDTA 2ZZ2A 2H3BA 4KWWA 3EOEA 2X7VA 2WVUA 1TYPA 4L5ZA 2UV8G 1VBRA 4OIFA 4FB7A 4OBRA 2J8FA 2ZZ7A 5D05A 5JRBA 2Z25A 3JU2A 1K8XA 4YTQA 3WQ6A 3U6WA 4MWAC 4HT3A 5IXEA 3BCDA 3NPXA 3G1HA 4W85A 3RCNA 1JPKA 4A2SA 2QDHA 5J5RA 4E3TA 3LB0A 4W8LA 1EJSC 1A49A 4PULA 2DIEA 2HXUA 3VKAA 3W3OA 5KVIA 5EL1A 1TRDA 2PP1A 4MIMA 1K3UA 3O0HA 4MZ1A 2AGKA 1EO7A 3BMWA 1A5UA 4IOTA 5HUPA 3UPMA 2HTMA 4I90A 3QFAA 3BWWA 3DFQA 4GC3A 3TR9A 1FHVA 3WBAA 4X22A 3AIWA 1D3HA 3V3WA 4R3UA 1ISVA 3ITCA 5CSSA 2IPFA 1ONEA 4IX0A 5D2XA 4WOQA 3N9RA 2EPOA 3VDAA 1HG3A 3K8MA 2V38A 1JCLA 4CCZA 1I8JA 3TSMA 3BQ6A 4LS0A 1P5BA 2WVSA 3LY0A 3EWZA 3LB8A 2DUZA 1EL3A 4IFOA 4E5TA 2HXTA 1EF2A 4C6OA 1SFLA 3FGCB 3FKRA 3WK3A 5HQLA 1N8FA 3VIKA 2YXXA 3UF9A 3WMSA 3L5LA 2CZEA 1PSCA 1FCUA 1BWVA 1E70M 1Q5MA 3NM1A 1V5XA 1YE4A 4NX5A 2XSAA 3IV3A 6XIMA 2X40A 5AHNA 3UJ2A 1KBBA 1B4EA 1TTQA 4Z1BA 3KCOA 4AIUA 4YXGA 1FWCC 1CXEA 4WQ6A 5FJPA 3C3NA 5B7YA 2D3NA 4G6CA 3LPGA 3VIIA 3HM7A 2NWSA 1CW2A 3ZVHB 4R27A 3GIPA 3TYBA 1CDGA 1UOKA 3M0ZA 1UUMA 3BW2A 3K8LA 3MCOA 5C9UA 5HBFA 2QJGA 3M0VA 2RHGA 2YBVA 1NWUA 1TJ0A 1U22A 2YFOA 3JW7A 4GVGA 1F5ZA 4N9BA 3TNBA 2EO7A 4AEEA 4PTWA 3KWXA 5CJNA 4B5UA 1M53A 4HK7A 3ITLA 3MBFA 2VZTA 2GSHA 3N9SA 4XZBA 4EMIA 3DFSA 1XLGA 3RG6A 5KZMA 3NAVA 3GVWA 1FWSA 3IWPA 4POCA 2FZDA 2OLHA 2MANA 1F05A 3B8SA 1A5CA 4X63A 2D3LA 2PLCA 1FWEC 1DXFA 4LXFA 3WLNA 1Z9AA 1A50A 3QKEA 3TAOA 3CGEA 4XZMX 4BCEA 5LA0A 1E15A 1UIPA 1XBVA 1QUMA 3MB9A 5U1OA 1FP9A 1L6YA 3F4CA 4D6IA 3K46A 3UR7A 5AVHA 4P8UA 3G6LA 4WSJA 1OM0A 1UR9A 3WNPA 2ZWZA 4QIUA 5C6MA 1RV8A 3BAIA 2Z7KA 3IAQA 4XVDA 1SMDA 2A6LA 1XRVA 3KBWA 5GVJA 1J0JA 2YSWA 4QSFA 3R2GA 3N4EA 2PWFA 3L2MA 2XVKA 2J24A 4V28A 3SN0A 1P7TA 1GYNA 1Z42A 1E4LA 2Y63A 1PYFA 2E4TA 4IMDA 3LCGA 2Y2WA 4O11A 3QXBA 5T26A 2YPIA 3AYRA 4AYGA 3WBWA 3I10A 3L68A 2ODOA 3AAMA 5FA5A 4HHPA 4JHOA 1V0LA 3ZSSA 4DO6A 2J79A 2XUCA 5A5WA 3SR7A 5LSMA 5DXYA 4NJHA 3EBVA 2BNJA 2GJXB 5LNSA 3QV8A 3UW6A 3W6LA 3S83A 1JDFA 3VCRA 2CKSA 2WBGA 5K9CA 1TVLA 1LCOA 2IXUA 2HZGA 4J3UA 4A22A 1ZB5A 5C9XA 1Q6EA 1BD0A 4KPRA 4BA0A 5FS6A 2L5HA 3E0FA 3KXQA 4AD0A 4PMNA 3R0KA 3IIVA 2FDMA 5FJTA 2PWGA 2EG8A 4K2SA 1HO4A 3WIJA 3LMZA 4LUJA 3WL0A 3E49A 1BRLB 4UTUA 2D0FA 3WDHA 2X30A 5EKYA 1VLWA 4LS2A 1FWBC 3FS2A 1VDVA 5DELA 2JE8A 3P7YA 3KS5A 2G5WA 1FBAA 4AD2A 1BF2A 4LTSA 1BSLA 3MMWA 3GHRA 2HWGA 1GPWA 2P0OA 3F4NA 4GOAA 2G3JA 4MWAD 4ZQRA 3RNDA 3F03K 3HG5A 4IIFA 2XFRA 2CPUA 3PPCA 4N42A 4U2YA 3T7VA 4GCXA 5I23A 3ZXWA 1ODUA 3WCZA 5G1YA 3ARYA 1JD9A 4HA3A 2V5DA 1WE5A 4F0HA 2ZRVA 4K1WA 4HA1A 1RLCL 3NQEA 4H2HA 4Q7NA 5A8NA 1JXJA 3AZRA 5ABFA 1GERA 3C8FA 3H26A 2JFEX 4PL2A 4XAZA 1YTKA 3AXXA 2A7RA 4F0SA 1EIXA 3RR4A 3GWQA 3EANA 1MO0A 2WJEA 4E0CA 2XGIA 2POTA 1BGAA 4XD5A 1AH4A 4A3YA 1LWHA 4NUWA 1PKYA 4FX7A 2PSNA 2C18A 2I14A 5HPCA 1ICQA 2GSEA 1HJVA 1V79A 3ZLGA 4ZQOA 3W38A 1H1YA 1ZY9A 2ZX6A 4AWSA 4FP1A 2ANUA 4Q7BA 3VZZA 6CGTA 2WOWA 4CNNA 3T1GA 4ONVA 4HYWA 1PHWA 5E1QA 4AY7A 1EX1A 2CU0A 3BSHA 5FCZA 3BOFA 1L8NA 3DZ1A 4I7WA 5F2MA 2VRKA 4R53A 1POKA 2QPSA 1OINA 4KWSA 5CJMA 4H50A 2GJPA 1SR0A 2WAGA 2GPTA 2ZE0A 3LPFA 3UESA 2X0YA 3UERA 1SUXA 1AG1O 2D22A 1TUXA 4GISA 5CC6A 2ZVIA 3TX9A 1WDPA 2OWXA 2V69A 1SO3A 2GJNA 3BLLA 4UUIA 1WV2A 3A24A 2VL4A 1XH2A 1R8LA 1BVNP 2QF7A 3KBNA 4XAYA 2GDUA 1HKMA 3OHMB 2BX7A 1TYGA 4RX0A 4NIRA 3QOMA 1Q6QA 1F3TA 1NWTA 2QXWA 1VPQA 2ABBA 3KAOA 1UD2A 3M7SA 3WLHA 3QW3A 3A3XA 4DVOA 1US0A 4D6FA 2OOGA 3MMUA 1WKYA 3LXDA 3KVKA 1OSEA 1P7TB 4BS0A 3GO2A 1TQJA 2NVDA 3VIMA 1ZBVA 1EA0A 3D0CA 3BH4A 3E5PA 4L4MA 2DGAA 5DFAA 1UH4A 3RIKA 1H51A 4FDCB 1US3A 3EPOA 5LHFA 1QTWA 3ABZA 1KQYA 2Z00A 4GO9A 1LVLA 1E51A 2G95A 1TV7A 4ZOAA 4IISA 4FR1A 3PZNA 2Y7GA 5KINA 3GM8A 3H7VA 4O0KA 4ZB0A 4L64A 4CNSA 1EJVC 1S3TC 1UWUA 4CN6A 2I5QA 3ITXA 2WVVA 3IGHX 1WXZA 2F84A 4RL3A 1C8XA 1ESWA 4HZ8A 4ZQPA 5HR7A 1QASA 3IK4A 4AMAA 3GK0A 4AZCA 2GDQA 1MEIA 4ROPA 5C9WA 1HKKA 1M01A 2YL9A 2QPXA 1KW1A 2YCKX 1JPHA 1ML1A 1R46A 2VVNA 3VXGA 3W2NA 3K1DA 4C6PA 1YYAA 1TKKA 1RZMA 2EGZA 1UH2A 3VVGA 4XKYB 1E55A 4BV6A 1WOBA 5ABHA 4JEQA 1OF8A 4O10A 2YX0A 3T0AA 4BI7A 2VXNA 3V35A 2JGYA 1KTNA 3NURA 1PJ9A 2C15A 1AZ2A 2YDAA 4WSHA 1VLIA 4PZVA 3P8IA 2RGMA 4YNGA 1M7PA 1KRCC 3NNTA 2ZUUA 3FJ6A 1LL6A 4J1OA 2P1FA 4HIBA 3ES7A 1VC4A 1O95A 1W5PA 1DIDA 4Y9MA 3TK7A 5HXMA 2BWGA 2YFNA 5ABFB 3IIPA 1YQ2A 5D2TA 3S47A 3FLUA 4RDYA 3NSXA 4JIEA 3N2OA 4Q8PA 5F4WA 4O19A 4UOZA 1XGDA 1PIIA 3C2VA 3CH0A 1E73M 4UFIA 1YADA 3FA3A 1SZFA 2Z2AA 1S5VA 1ZP4A 2ONEA 5ABTA 3EKZA 1DJHA 3WUFA 4PMRA 4CD8A 1PE1A 3QBUA 2ZXBA 3G1RA 2XVLA 3B9AA 2W3SA 3OW1A 1G9HA 4A2RA 1KCZA 5GNXA 3QM3A 4Q8QA 2QJMA 3L0KA 2YR1A 2WJDA 4JX4A 1TELA 2ZUWA 3AS3A 4K68A 3VNYA 1OFQA 2YJQA 1UPMB 3EA1A 3ERPA 3II1A 1W3IA 3SUVA 2PDFA 7CGTA 2WM0A 5DRIA 2VX7A 2QCHA 1GETA 4KESA 3GXIA 1SJAA 2ZTKA 3SDOA 2P76A 4OT7A 1SM9A 2ZZ6A 3R1ZA 3KZPA 3GVVA 3W00A 2ZCGA 1PWMA 1YIXA 1OYCA 5JCNA 4NU7A 1NHPA 3B0XA 1THFD 2OT1A 3IRSA 1ICSA 4EANA 3T05A 4A8NA 3L5MA 4L1WA 3PANA 2G3IA 4J27A 1CX9A 1ZNNA 2XVGA 3QYSA 1O12A 2PFHA 3JZUA 3FN9A 4P7LA 2X16A 2FH8A 1QO5A 1W9PA 2P10A 3QN3A 5JUVA 1M7XA 2YB1A 3ZS4A 1F8WA 1H2JA 1V02A 3URBA 3VMOA 5G2IA 2PUZA 3GXFA 2DSWA 5LNRA 2HVNA 5I7GA 3NQCA 1DEDA 4QBXA 3C2YA 1ZCOA 3NL2A 4UFKA 2OZ8A 3Q2DA 4XZLX 4O14A 2YCEA 2GVYA 2PLMA 4GY1A 2Z6JA 1H0GA 3W01A 4BI5A 3LCHA 4H8VA 1I2OA 4HCHA 2QJHA 3HRDC 1RK6A 3F2BA 3T8LA 1STZA 1KBKA 1KLZA 3C0QA 4HNTA 1GOIA 3POHA 2IKJA 3WLIA 3HF3A 1P0KA 4GACA 4MLRA 3LERA 2XIOA 5I00A 3GU2A 1EOMA 2ZX5A 2PDIA 3DERA 1JDCA 2Z2UA 5HPOA 2KZHA 4IPPA 1JRCA 1SZEA 1QI0A 7ODCA 1RVGA 3XINA 4C6IA 4AZCB 1KB3A 4Q22A 4IIGA 1Q6CA 1T7LA 1E5JA 6ALDA 3CQHA 3WSUA 1JF5A 2QMJA 4M0XA 2HROA 1W1PA 4D71A 3WBXA 1DJGA 2XISA 3UZZA 1JYNA 1GHSA 3CUFA 4KQNA 4UCFA 1K03A 4JL1A 4HNCA 6REQB 1RAKA 1O4UA 3NSMA 3QQ1A 5LIXX 1W1B1 1V3IA 3KOWA 3BGJA 2BHUA 1UW9A 5D8ZA 1AFSA 5E0CA 2Q8ZA 2CWXA 1KXHA 2J77A 1FKWA 4X0VA 3GRTA 3F4VA 4CD5A 1EXBA 3GDTA 1DP0A 1Q1RA 5CPSA 2R1NA 4Q6XA 3K4WA 1FWHC 2WJFA 2Y88A 4NSBA 3GYEA 1V03A 5HQEA 3MPGA 2R91A 3GXDA 3E0WA 2PZNA 4AEOA 4Q8UA 4LY4A 3H4XA 3HZ3A 4PMDA 3YPIA 3U2EA 4FAMA 2Z7GA 5LNWA 4TMCA 1IR2A 5BRPA 2E8YA 4PCNA 3GQYA 3URQA 1V6VA 4Z2GA 3BL3A 5EMUA 1K4QA 1GJUA 3BURA 2OTDA 3BARA 2QT3A 1BYBA 1TIWA 1JI2A 1ITCA 4ZBCA 4K39A 1ITUA 3WQ5A 1QBAA 5AVNA 5KETA 3H2EA 4H9XA 4S2CA 1XLFA 2ATMA 1D7KA 2AMXA 4K36A 4B92A 3SUWA 3P5YA 4AMCA 1S1RA 4HHMA 1KFKA 4OOUA 1F3PA 5DCEA 2V3GA 1LLZA 3HW2A 5KITA 1M04A 3I3BA 2A3EA 1EHNA 2J47A 3W76A 3P81A 2CLPA 4PN2A 4Y2WA 1VP5A 3S6DA 1UR1A 4K6AA 3CV7A 3WLRA 1RSCA 3H54A 5M03A 2ZUVA 3O15A 4C60A 3MCNA 1WAWA 4R7OA 2UY2A 4HPJA 5A2CA 4UFMA 3STFA 3PZTA 3FYPA 3UR8A 1GW9A 1UYQA 4B2DA 2Z4GA 1UWSA 2EAWA 1V51A 1P0DA 1M1BA 3KRUA 3WF4A 4IFRA 4GQBA 1VRXA 1IZJA 1VYRA 1X8CA 1J6OA 3VD4A 1KTCA 3WF0A 1A5AA 4JXCA 4PMZA 7A3HA 5CEWA 1HP4A 1H4PA 2PP3A 4I5UA 1LQ2A 1GOWA 3INPA 1ISYA 1UROA 2W3RA 5FS9A 1PKMA 1SMAA 3W1NA 2FGZA 2FHCA 3KLKA 2FGLA 3GU9A 1NAL1 5A95A 4DHGA 2EJAA 1KCLA 5IHRA 1QNSA 4MJ4A 3L23A 1QXLA 4FR6A 1P1MA 4AUBA 2DFAA 3GDLA 2Y24A 4K8GA 3THCA 5F7UA 3KE0A 3GNOA 4LV9A 3E2VA 3W7KA 2BCPA 4H3DA 3WFAA 2F38A 1XICA 3SCPA 4TVCA 5TR3A 4UQAA 4XG1A 1XANA 1YBQB 3VFCA 2YDQA 3ANUA 2BVTA 3NQAA 3P0WA 4LB4A 4HVXA 3CNYA 3M0JA 4N02A 1OK6A 4WKHA 2BXZA 1JNDA 4J3SA 1V7AA 1FXQA 1W1VA 1NIUA 5TAOA 3KWSA 2G4FA 2Y4SA 4DWSB 1R7AA 1K1DA 3OHIA 4U28A 3SM0A 5B7ZA 2VWTA 2G3MA 3EDFA 4B5WA 3KL0A 3SN4A 3L4TA 1KFBA 2WKJA 1S2AA 2ZC1A 4N6EA 3AIEA 2J8GA 3U2ZA 4PCPA 1N62C 1JEHA 1L6FA 4LALA 3QGAC 3CBWA 1GT8A 1G4TA 3MKKA 1NHQA 4GE8A 2H9AB 4MB3A 3WQWA 1HO1A 4I5RA 2WJZA 3WQEA 5CBIA 3PB0A 1GKPA 2WMHA 3A13A 4ACZA 3URAA 4H6QA 2HBXA 3G18A 5HANA 4DUOA 2CLKA 4LBUA 3ANYA 2PDQA 4G7EA 1EYEA 5LXXA 4IPIA 3K1GA 4H9VA 4MJ2A 1IZCA 4BQ5A 4JFUA 1F4AA 4DLFA 2CEQA 4YCOA 1C9WA 1DL3A 2CFFA 4DUXA 3L67A 1IHIA 1GQIA 1Q45A 4M80A 1FO4A 2WBKA 3U7VA 4HA4A 1XLHA 1J18A 4GJ1A 3LZ3A 1NH6A 3CL6A 1GG0A 1NWSA 3N6HA 4US5A 4JDRA 2XG9A 1W3TA 1E4IA 3CMJA 3GZAA 1NDVA 4U2ZA 3ARRA 2ZKMX 4J2MA 3LPOA 4CLMA 1ZJIA 2DZVA 3UT0A 3VCCA 3VMNA 1SSDA 2YZ5A 3S6OA 1JCTA 2PDJA 3TKFA 1F8IA 3CT2A 1N2VA 4Z2LA 4GRSA 3PBUA 3TR2A 2WOQA 1LP6A 1E6RA 3WH5A 5CZJA 1QT1A 1HZYA 2EBNA 1QPOA 4K3ZA 2QCLA 1RCXB 1OWQA 3RDKA 2J75A 1GVQA 3Q67A 1UD6A 1J5SA 3P0XA 3B0UX 4OBTA 1GREA 4OOZA 1VHCA 2OQHA 2GR3A 4ZQCA 2VC9A 3G5EA 3VKCA 4LPCA 3UWYA 4MG4A 4EOUA 3KP1A 3MP4A 4B4HA 5FL0A 3PBVA 4DJFA 1N7KA 4NZJA 4QXIA 4YWSA 3LM3A 1R87A 4OGZA 2ON3A 4S3KA 4F9DA 3D5HA 3PAOA 1FDZA 2NXGA 3S0CA 3LV6A 4JL2A 1VFSA 2QGYA 4UTKA 3W27A 5D04C 2CLOA 4DUVA 2DVTA 3W2UA 2VZVA 4FALA 4NG3A 4C7DA 4ROQA 4PMOA 2WCAA 1EJTC 3AMKA 3SQPA 4PB4A 2EKCA 3HPSA 3WUEA 3NZGA 2AOSA 5D09A 1J2BA 3SSJA 2G8ZA 1O94A 3A5VA 1OGBA 1KM5A 3HIJA 3ZYZA 4J9JA 2BG5A 5I78A 5EFDA 3W6YA 2NVAA 4KBXA 2E6AA 5FL1A 5LIYX 2A7NA 4CQBA 2DSUA 4DQWA 5EMJA 2FGBA 3ZT5A 4JYDA 2GR2A 1UWTA 1KGUA 4YMZA 3DU0A 3WK1A 3AYSA 5DEZA 4PH6A 2SFPA 4H2CA 1UZDA 4H4RA 1DV7A 1E0TA 1GUVA 4KFNA 1OD0A 4ECLA 4BR1A 4HA0A 4WJEA 4PCTA 1AOGA 1TQXA 1SW3A 3W86A 5TQLA 1TIMA 1XLBA 3CH9A 4HNNA 1YEYA 4I9TA 1HW6A 1NARA 3O06A 1ADDA 3W1RA 4Q8MA 1X39A 5AY7A 3FOKA 3FW6A 4LH8A 4RE0A 2D24A 5M5DA 1FX6A 1MSSA 2ZZ5A 1M6IA 3LG3A 3A47A 5CH9A 4O1CA 3OVPA 3T44A 2D2OA 7TIMA 1IWAA 3W84A 3ARZA 3UZXA 3NQBA 3MO7A 5C0QA 3DK9A 3GFZA 3W29A 5RUBA 1QVBA 3BLEA 1TE1A 4B5NA 2FH6A 3DH9A 3HPAA 5I03A 4XZNX 3ARPA 1Y5WA 3NL3A 4UTWA 3L2LA 1PCWA 3DBNA 1KKRA 4D6EA 2PD9A 4LBSA 4GI6A 2C79A 3BZJA 4Q8VA 2E5DA 1UD5A 1X6UA 3KL3A 1WKDA 3MI6A 3EAOA 4YJ5A 3E1F1 4G7EB 5AHFA 3HA1A 2W61A 4NJJA 3DFHA 2Y8UA 1QK0A 5EB8A 2PGRA 1IQ8A 1Q65A 3A4XA 1XI3A 4LJ3A 1WDDA 3C61A 1RQHA 1H1NA 4EM4A 4LWWA 4O15A 1RD6A 2QIIA 2VELA 1G4PA 3VOJA 4C1LA 1DJZA 3S2JA 4R7JA 2NLYA 1P1XA 1F61A 4HPXA 5U25A 1V08A 1FXPA 3AZTA 1TREA 2VP8A 5HATA 3VU2A 3BSGA 2C3CA 4ZGYA 2DUAA 4PGLA 5I3IA 1SO6A 1FFQA 1TB3A 5G1MA 1YKWA 1Z8AA 2EQ6A 3PZIA 3LNMA 1OGSA 1GRAA 4S3GA 1GWJA 4IPLA 5D32A 1OG6A 1OJTA 1JXKA 4PRWA 4QG9A 1XLDA 2R9RA 3CMFA 5A6BA 3A9IA 4WGHA 4MNJA 2AAMA 5HR6A 3BJTA 3TVAA 5CG0A 3WQ8A 3PBYA 1MRAA 1L2QA 1F3WA 1JUBA 3B9OA 3B0YA 1AW5A 3MMTA 2HE5A 1TVPA 2J74A 2Y8KA 4UTMA 5SWUA 4XV0A 1HUVA 5CSUA 3NL6A 3N17A 4P2VA 3NXLA 4M6VA 1WZMA 2CZ5A 4MNMA 4O57A 1SU5A 2XFWA 1Q6OA 3MP5A 4XD4A 1JCYA 1CXKA 2B7PA 4EACA 3TC7A 1GONA 3TE9A 3UP8A 1E9IA 1QFEA 4IX2A 1EF3A 2NXIA 3DENA 4RZ4A 1NWRA 1XLEA 4PSRA 4X0NA 1JCJA 4F0LA 3AU6A 1QO2A 1BAGA 2QCGA 3AQUA 4ZB5A 4WD0A 3GBEA 1E1FA 3ME3A 5GRTA 4O13A 1CXIA 5C9RA 5D8WA 4AQLA 4ZE4A 4DX3A 5DX7A 4M56A 5A8MA 3CAWA 4QHRA 3GDBA 4DELA 1S1PA 4QAWA 2PCEA 4NAEA 2POZA 3BLKA 4C6KA 1NP0A 2FMNA 1LYXA 3LTPA 3VNZA 2XN0A 5A94A 3TYZA 2ZZ0A 4NYUA 4XISA 2R24A 1EP3A 3E3HA 3VOIA 1R47A 3TTEA 2PTWA 4GNVA 2PDGA 4BQ3A 4NI8A 5DANA 3HPZA 1GNXA 3KCLA 4DPQA 5BOOA 3AYVA 2HQAA 1WZLA 1X98A 3TXZA 3WKZA 1IE7C 4I5XA 4NEVA 4DNHA 4HPNA 3G3DA 1MZRA 2JIEA 2FPVA 3TN5A 4J35A 3M16A 3AISA 3BDKA 4FLQA 2VDIA 4AIEA 1UKPA 1R38A 5LXEA 1TPVA 3W1PA 4FA3A 1CGUA 4UOJA 5CAHA 1DWGM 5GJPA 2OT0A 3R4IA 4DNAA 1FP8A 1U30A 1GJPA 4TQTA 4LYQA 1I60A 4XD6A 4ZTYA 2I57A 3OYZA 2OG9A 3WQ4A 3HU7A 4KWOA 4KFOA 4C1NA 4DF2A 3EXRA 2VC6A 4NZ3A 1VENA 1Z32X 2DVXA 1JFHA 1EOKA 3DHUA 4UTTA 3FNDA 1H61A 2PGEA 4LYPA 3AALA 3A23A 2D69A 2JK2A 4UIOA 4AXNA 3OZOA 2J62A 1OY0A 4ERGA 4YPJA 4DAFA 4LCQA 3BW4A 1ZZMA 3MANA 3PUOA 2FFIA 4M6QA 2NUXA 4LVDA 3HG2A 2JEQA 2FB3A 3ITGA 4MYXA 1I45A 2PE4A 2NSXA 2EQ7A 1AQFA 3UJSA 4KEVA 1GRGA 1YX1A 1C93A 5A3HA 3GLCA 1EH9A 3H24A 2ADAA 1Q6RA 3L4YA 3MJYA 1A5MC 4Y9OA 3RCYA 4W5UA 2X99A 3C0SA 3PPGA 4QDWA 2IQTA 4NVTA 5C71A 3S2NA 3WH7A 3CT7A 5AC5A 2W4XA 5A6JA 5I79A 3W25A 2D20A 1P0NA 1UASA 3BGGA 5CPMA 1K9TA 3FDKA 1OG0A 2HPMA 2WSRA 3VGFA 5EBAA 3QY7A 3OIXA 3OQEA 2WPBA 3R94A 5CAKA 3AROA 3IIXA 4RE4A 2JKPA 4B9YA 5JBFA 1UKSA 1GOKA 2OKOA 4U33A 4AFYA 3MC5A 5CG7A 3VD5A 4IGMA 1UR8A 3UJRA 4QEHA 1VFOA 2B0MA 4HHLA 2FZ8A 3DGBA 3L66A 5AYXA 1SW7A 4DZIA 3MDWA 3C5QA 4C65A 4R7WA 3IANA 2Y6ZA 1Q6GA 4M82A 1ZPTA 1K6AA 3QPYA 2GSJA 3MP3A 3VOGA 1VB9A 4Q32A 1C7TA 3PZUA 3W7GA 2WZEA 2B7OA 3ZSTA 2DT0A 3HN3A 1WZKA 2RABA 5T9BG 4Q4PA 1O7AA 3EAUA 1U5HA 4RPQA 3WG6A 5LZLA 1TPDA 2GVLA 2VEMA 3W75A 1DHPA 2C1IA 5FEPA 4UXDA 2W79A 1G6CA 1W9BM 4WLCA 3FYOA 2V0TA 4MDOA 3PC0A 4ERAA 2AL1A 1RALA 3EDJA 1XDJA 4NAEB 3SSZA 5JIPA 4O52A 3WUBA 3BV7A 3GE7A 3E9AA 1UZ1A 1RP8A 1MVYA 1W9VA 2GL5A 2X41A 5H8UA 1S2TA 2QUNA 2W66A 5HWJA 3WF2A 1R3YA 1GVRA 3AS1A 3PM6A 3KEHA 4MTVA 2EQDA 1KFJA 2XH4A 2YZRA 1JZ6A 5I06A 2ZIDA 4TX6A 4H4QA 2X2GA 3ALFA 4U4MA 3EDDA 3VKDA 4QJ4B 3HQ1A 2X0SA 3WEMA 1FDYA 1POJA 3RGTA 3R8HA 4Y9NA 4NZ5A 1JYVA 4PBGA 1LRQA 2PP0A 4AWUA 3ORWA 4IJCA 1AQ0A 1Z69A 2VX4A 2YA1A 4W8BA 3E74A 4G56A 2PRMA 1TWDA 3LI1A 1JEZA 4JBRA 4QDPA 5E0KA 5AFDA 2VGBA 3BVJA 2XINA 1ELSA 3TNOA 3AIUA 3G24A 2XIMA 1FH7A 1S2UA 1E43A 4QE1A 3SCVA 4E2OA 4ASTA 3B3DA 3N4FA 2PGWA 1MNSA 1RXOB 3W28A 3OTRA 5G1TA 4JKKA 3LHWA 4C91A 1EDQA 2W67A 4TX8A 1PUDA 2ZRUA 4XIAA 3VFLA 1EDGA 3UGVA 1ZJHA 3TAKA 3WN6A 1TWIA 4IGNA 3CUGA 1NDYA 1NFGA 3DJGX 4URIA 4A29A 1BF6A 2XIBA 2QCEA 1EB3A 4W9TA 2Z6IA 3BGAA 4S1FA 1E0XA 2HJPA 3WD1A 1X2GA 3W7IA 2R1PA 3BAYA 4QQUA 4GVFA 4XZWA 1JUEA 3IJIA 4Z17A 3GAKA 1ZBKA 3CXOA 5AZ0A 4H9ZA 1JJKA 3F5KA 4I8DA 4IIEA 4YTUA 4IPNB 3THQA 1P48A 3BCJA 3KFTA 5CPNA 2V3EA 3R0UA 4Q4MA 1BQGA 1PPIA 4GXWA 3QV7A 5I77A 3GXMA 4JCMA 4IIBA 3S1XA 3C2OA 3GG8A 4IL2A 4QLJA 4LY8A 1TCMA 4CQ9A 2PDUA 2OZTA 2QW5A 4Y90A 4H6EA 4J3XA 4MHBA 4DZ5A 1F2JA 2WZHA 4PUDA 2PCQA 3KL5A 3KBVA 1P6CA 2FVLA 1F9CA 1P0EA 4IPJA 3GTNA 4JTKA 3MHUA 4UQCA 5KSWA 2BLEA 1B3WA 1VEOA 3VKKA 3GXNA 4M7SA 3AXIA 4WIWA 1EBHA 3B04A 1QCWA 3QW4B 3EEGA 1C7SA 4O53A 4UTIA 3W53A 4W89A 2NPXA 5FSDC 2ZX7A 2YGYA 3A22A 3HG3A 3RCMA 5AHEA 1W3HA 4UQ9A 3VZXA 4RXGA 2DQWA 2ZDSA 4WEVX 3RO6A 3ABQA 1T99A 3T4CA 2RDWA 1N61C 2FMOA 1B30A 1TR9A 4BQ4A 2WHKA 1MOKA 3CGCA 4BFAA 4RDZA 2ZZCA 5FJRA 4FLSA 4DJFC 4M51A 1LOSA 3VIPA 4YVXA 3VNKA 5GPRA 1BXCA 4DBEA 1QW9A 1TA3B 4HU0A 1VZWA 1Y5XA 4UB9A 5AN7A 3VGDA 3E5BA 1PZ3A 1KM3A 1QAPA 4EXQA 1JQXA 1V6TA 1VRDA 2VM8A 4QS5A 3NQDA 3FK4A 4OTKA 1J0YA 3GZ3A 3RM9A 3GW3A 3VD3A 4L1XA 1W32A 4B3ZA 2HE8A 2XH2A 1B3VA 4JY8A 3QLLA 5I6SA 2EPLX 4LF2A 2WC7A 4MJMA 4QG6A 2OWCA 1DIKA 3DI1A 4DF0A 4QFUA 3JS3A 3M46A 4PUEA 1O5RA 1JG9A 3N19B 4AXKA 3S1GA 3CC1A 4YYCA 1XYMA 1V3HA 3CO4A 3PP7A 1B31A 2V82A 3WY1A 2J7CA 3TJLA 3CIXA 1W2VA 4B2DD 4YIWA 1BKHA 3NRZB 2OJPA 5HNNA 2ZFAA 3REQB 3CZJA 2WP6A 4TIMA 3T08A 5HOSA 3BJSA 3USZA 3QTGA 3NTYA 3N25A 4GJJA 4ZSTA 4HNVA 1A0DA 4DO4A 5C9ZA 2NVKX 2WQPA 1CGYA 3GS6A 4IUOA 1MUMA 3EMQA 2RKXA 1PIGA 4OBSA 3WD3A 4EXAA 4Z2HA 5DXXA 3RM4A 1ODZA 3XIMA 3VYLA 3HPXA 2QVNA 4MAZA 3ZVIA 4RE3A 3WMBA 4IIDA 3DFTA 3QMRA 5FI8A 3TMLA 3OZPA 1AQHA 3BLIA 1WUEA 1XV8A 4Q33A 1WCGA 1LWIA 4RXFA 4UNIA 4AISA 3LQGA 3LX9A 1W3JA 1AW2A 4UTWC 1A0CA 2WPEA 3C0LA 4B91A 4MWAE 4XKMA 4DYEA 3A4WA 1V6WA 4Z0SA 2ZXQA 1TV8A 1IWBA 3WFZA 3M1ZA 3UPBA 2V5KA 1B1YA 4PB3A 2NXHA 1ECEA 1FKXA 4AVOA 4O1BA 3UJFA 5I3KA 4J28A 4OJYA 3GAYA 3W4RA 3T42A 1Q6DA 4FX6M 3HV9A 4JGDA 3DFNA 3VD9A 4BF9A 1MQPA 1E3ZA 1B4KA 2VD8A 1DOSA 1EX5A 4IJBA 1W5OA 1QATA 3M5XA 1NPXA 1W2PA 4MM1A 1F6PA 4XK2A 4TMBA 4MY9A 4Q8NA 3BG9A 2ZX9A 2WNNA 1KR0A 1OABA 2WKLA 4NJGA 2F9RA 4EXBA 3WNKA 5LNVA 3E0IA 3QR0A 3T8QA 4D9PA 2CKRA 3ZZ1A 2D2HA 3DXIA 2YCLA 3M0HA 4R9OA 1FCBA 5FS8A 3ONBA 4GK8A 2QKFA 3N2XA 4O17A 2A5HA 1XC6A 3CPRA 2HVMA 4FOKA 5FF2A 1VEPA 1Q7MA 4KIEA 2TPRA 4O0QA 2ASHA 4C6NA 1E71M 4GBDA 3G0XA 4US5D 4H1ZA 1N8WA 1VKFA 2XGZA 3MA8A 3SFWA 1MW3A 2E9LA 1WX0A 3R8RA 4CD4A 2WP5A 1XH1A 4AW7A 2WSYA 3EWYA 1L0PA 3JRKA 4EKJA 3DBPA 3NYZA 1PTDA 4Q4SA 5FS7A 1XCWA 3C56A 2FZBA 1E6NA 4PTNA 3GY1A 1UIOA 2WK2A 1ZHAA 3B9JB 1LLOA 3W1QA 2P5NA 2Y85A 3EWXA 3B4UA 1Q7QA 1V77A 5AC7A 3WH8A 2WZIA 5JCIA 2YIHA 4OU1A 4FXFA 4HCDA 4ZOEA 4CN4A 2BY3A 3FHAA 2GVJA 1XDMA 3SW6A 3W2JA 1KM2A 3EPNA 2ZZ3A 4OKDA 1MQRA 1H7NA 3JZEA 4C6CA 3RHGA 3MHFA 1FHDA 1UUQA 1B3OA 1TZ9A 4GINA 2HSAA 4ZOHB 2FJUB 1ISXA 3CEPA 3S9ZA 3BQ5A 2I56A 3NDZA 1HGWA 2AL2A 3CUXA 1LG1A 1RPXA 2WC4A 3VIGA 3AS0A 3WQCA 1VIWA 3OGRA 4DM2A 4KRTA 4W7WA 4W5ZA 3TLLA 4JHMA 2YQUA 3LXCA 3SZ8A 4M24A 5F1UA 3ZMRA 4HZMA 2GR0A 1W8GA 1FWJC 2X1IA 3KTXA 1V59A 4FHAA 4P8VA 1MDRA 2ZUSA 2OLSA 3LTSA 1XHCA 1RA0A 9XIAA 3NVTA 2EPNA 1XG3A 1D7YA 2GWGA 1FHUA 1HP5A 3BTNA 1LT7A 4UTTC 1R3RA 1BYCA 4NP7A 3A4JA 4HSNA 3CHCA 3WQPA 4KWUA 4A3QA 4KKXA 5D03A 3P8JA 5CGQA 3LADA 2WM1A 4MOZA 3RRXA 3UR2A 4JD4A 4XSLA 4WDUA 4AVNA 4BKNA 3LGEA 2BZNA 3S46A 4WUIA 2VRQA 5I02A 3SQLA 2DV0A 1EBGA 1O60A 3M0LA 2PWUA 3TFCA 1Y7VA 3T2QA 3U3HA 1FCQA 4S39A 1NHRA 1SZNA 3HB9A 3AMDA 5LA2A 3ARUA 1QHOA 1GSNA 1VCVA 1TPC1 5EGRA 1B2YA 3APGA 1VQTA 2H90A 1JZ2A 1RUSA 4FX8A 2BMBA 3W7OA 4V33A 1K02A 3C52A 4CU6A 3TYUA 1A53A 5FJUA 3TEVA 3B9DA 5MKGA 1AMKA 3DHDA 3HBLA 5T91A 1HN1A 1F74A 1I9CB 1LOQA 3B8VA 1P43A 2C13A 4X60A 2VCBA 2PWDA 2XSXA 4WRHA 3EX4A 3SGGA 4ES4A 3WBEA 4EVZA 3SY8A 1FH9A 3W1XA 1H5VA 3UWQA 1OC6A 2VOMA 3LSCA 5H6HA 1MNZA 1OC7A 1DIOA 3OZYA 4L4LA 3MV11 1CGVA 4ML9A 3GD6A 4PEKA 4FNTA 5BYWA 4S3FA 1HX0A 1GQJA 2Z0IA 1GQLA 4H4IA 5JCLA 4LX4A 3W74A 2P8CA 2C19A 3W6MA 3NFUA 1HL9A 1BEUA 6TIMA 2WNWA 3AO0A 3WLSA 3GIYA 1FWNA 3MYOA 3RLGA 3WLJA 5GNYA 1V6UA 3VIHA 3UY8A 2QHAA 1XD0A 4HTYA 4ENLA 1XF0A 1S2WA 3RFAA 4LV4A 2UY5A 3L4ZA 1XP3A 3DESA 3QQWA 2NUWA 5LA1A 2WMFA 1KWGA 1TWSA 4S3JA 4LAZA 4W93A 1YNQA 4EX4A 4HQVA 3K4DA 5CGMA 3H2AA 3P14A 4C6JA 4KIRA 1SQ7A 2R1MA 4EF9A 4EWJA 3HJZA 4MDPA 3UZYA 3CL8A 4MZ8A 2G4JA 3SEPA 2BOGX 4JHZA 1A4LA 4MAVA 3GC5A 4D8ZA 3TONA 2XWEA 4QSHA 4JTQA 3VDCA 2BY2A 3OGSA 3VE9A 4YS1A 3VOHA 4K8HA 3RAOA 4UBPC 2WHMA 1NVMA 1HJQA 4FNQA 3TQPA 4CGTA 5IBXA 1HNYA 2OZ0A 3SRHA 3B8IA 1EO5A 2FVMA 4LRTA 3MV01 4PUJA 4GX9A 4EM3A 2G3NA 2DPEA 1DHKA 2X8CA 3UD6A 3OA5A 3UWZA 4GI8A 2PPGA 1XHGA 4YHEA 1J0ZA 1XYBA 2PWHA 2NT1A 4L9XA 1XG4A 4AZHA 3CPGA 3VNLA 3FGCA 1XKYA 2XU2A 1H7PA 3PTMA 2DT2A 3H53A 3WNOA 3VKJA 3DC8A 3NQGA 2ZE3A 3UY7A 1FY6A 4NJKA 4X9SA 3ARWA 5ER0A 2J7DA 3PG8A 1G4SA 1ZBWA 3APTA 1F73A 2OFJA 1IXOA 3V16A 3MHGA 4RKAA 4Z2JA 1SFJA 4B5VA 1TZ7A 2ZA1A 1WYIA 4GVHA 4GQRA 3W26A 1U33A 4WZHA 4HU3A 3ZVHA 1CECA 2DIJA 1JCNA 4QP0A 4XAPA 3NG3A 1ZENA 1PO9A 4PUWA 2FIQA 5BCAA 4EE9A 4LYRA 5HMFA 1HTIA 3HGRA 3VUSA 1ZSXA 3UA3A 3E0LA 2GQWA 1REQB 1GV4A 3M9YA 2D73A 3LNPA 1RM6B 1X38A 3NM3A 1KM4A 1VGAA 2F6XA 1CEOA 9CGTA 1XW8A 2XH7A 2Z1XA 2F6UA 2RH9A 5TBOA 3S2LA 2J88A 1VFFA 1ZXIC 4OQVA 3CAQA 3AI0A 5K3VA 5MKGB 5D2VA 4JR5A 2INEA 5EU9A 5A6LA 3SR6B 1SW0A 4WJ8A 3MUY1 2RUSA 4PTMA 1O1HA 1Z3NA 5CC7A 4DAIA 3IAPA 1S7MA 4GI4A 4F0RA 3TUUA 1UC5A 5G5GB 3R11A 4I7VA 3RK8A 1NEYA 1W1ZA 1ONWA 4WVXA 3S9YA 4KFPA 1SZGA 1OFRA 1J6PA 3TZNA 4ALDA 3G1YA 3CTTA 4Q4OA 2C71A 2YVJA 2WSKA 5DY3A 3CHDA 2BBFA 4WJXA 4X2PA 1BXNA 1QJWA 3B8WA 3QFBA 1ME8A 4UQDA 4DRSA 4OUEA 5BWFA 4HU4A 3ZO9A 2BTMA 4DZAA 1US2A 3HGJA 4O0ZA 4E2DA 4J4KA 4GUFA 3UXIA 1V93A 1U1HA 5CPOA 4L80A 4GBUA 1EPVA 3QH2A 1FUYA 4NQ1A 4JNZA 2ZUNA 3KP0A 4AD1A 3R5EA 3POCA 3UXAA 3GR4A 3MUCA 1LBFA 2VMFA 5EFFA 1G7UA 1VH7A 2GJXA 3WX7A 1PDZA 2IPGA 2NZLA 5BNKA 4ZTXA 1V6YA 3L0GA 1QW7A 1C8YA 2QDGA 3RILA 1MRQA 4HYRA 4DJED 3AUOA 3GUWA 4QROA 3TA6A 5HQMA 4JEJA 2YKKA 1XD1A 2B4GA 2YVGA 3E96A 2WMGA 3R79A 1EWDA 1KXTA 1MUWA 3BK0A 1FWRA 1LORA 1X1OA 3TQVA 1BRLA 2GZXA 2HEJA 5LIUX 2QVHA 1JFXA 2XSBA 4M81A 2DZXA 3N3MA 3C2FA 3KW3A 2WO5A 1XDIA 3S9IA 2DSKA 2PEVA 1OT1A 4TV5A 4H9MA 3E0VA 1J0IA 2OOFA 1IGWA 4IFKB 2KAUC 4JFSA 1M7JA 3VGBA 3P80A 4JIHA 3BPWA 1TWWA 3PJWA 3LBMA 2G41A 3E38A 1NDAA 3SCWA 2VDHA 4P7QA 3ZLHA 1I2QA 1B54A 1C9DA 2PU0A 5G2HA 1LZOA 4ZL1A 1LUCB 3I65A 1GHRA 1FWGC 2PS2A 2VFFA 3NS1B 3OB8A 3GD3A 4L9ZA 4U10A 3VKBA 3S5SA 2MUCA 2ZZ4A 2J7GA 1BG4A 1SB3B 1BLIA 4LNCA 1BWLA 4NKCA 4R88A 2XDFA 4JNYA 1CT5A 1XX1A 4MJZA 1VHNA 3KX6A 1HGYA 3TCEA 2DUXA 1TR1A 4WF7A 4Y8FA 2FTYA 5BXPA 5FMHA 3C2RA 1ENUA 1KD0A 3AJXA 4HMCA 2C1GA 3NO5A 3LCIA 4GKLA 1AVAA 1DWHM 1Q7ZA 2BOFX 2VNCA 3GTHA 4ZENA 1RCOB 3TYDA 2Z1VA 3FXYA 3GB6A 4H00A 3F4DA 4DO5A 1HJUA 4E2BA 5TD4A 4WHBA 5I0DA 3H55A 1H7WA 3EX6A 3MWAA 1GZ1A 5A69A 4LUYA 4J3ZA 3V7PA 2PB1A 4YN5A 2V2HA 2VQUA 2Y7DA 1GK8A 2V2DA 3EX2A 1BKSA 4FXJA 1OBAA 4EK7A 2Y62A 2Z27A 1HXJA 3M41A 1E4MM 3B8TA 3RLVA 1BXBA 2BC1A 1MW0A 4YL2A 1LLWA 3UVAA 1MDLA 1DPMA 3UCQA 4PBFA 3QEZA 4FXSA 1UCWA 3AN1A 3LLFA 4DIAA 3RNMA 4YTRA 1FEAA 4AZ6A 1DXIA 1UC4A 3H23A 3PTQA 3R10A 5ENLA 3GW0A 4PYSA 3AS2A 1AJ2A 3MWCA 1G7VA 1G0CA 4RLIA 1WOAA 2DVUA 3CZGA 3G8EA 4UTHA 4CQ8A 1EFZA 3ID7A 4ZCWA 5D37A 3NVYB 1I75A 3A7UA 2B31A 2AQVA 3IJQA 3SJ3A 1AMYA 1BVZA 4I9MA 2Y5JA 4FSAA 4H4UA 4S38A 3TYCA 1NSJA 7REQB 1Z89A 1X8FA 4BEUA 3LLDA 2R8WA 4MB4A 5ECVA 1T40A 1NTHA 3HQNA 3HMCA 2V67A 3PUDA 3WDQA 1AL8A 3V4BA 2E9MA 4CQDA 2J6XA 1F6KA 3FY1A 3H2CA 2ZRWA 2XM1A 3W1AA 5LGXA 4RZ5A 5PTDA 1KO0A 5I3HA 3UNDA 4LA1A 3QQ0A 1KA9F 2NX9A 4FOJA 3ZT6A 3AMLA 3N15A 3GFYA 3KHJA 1W9UA 1TUFA 2ZUMA 3RX3A 4QS6A 4M3PA 3GH4A 1E3XA 4UOQA 1GEQA 1ONFA 4J3WA 2P88A 4TUFA 1WDQA 3NZRA 4GC4A 2YBTA 1U5JA 3PZ9A 4GIRA 3QMSA 3NGFA 1JGMA 1D8WA 3GKAA 1H6VA 4KEUA 3CM4A 1R3WA 3PSWA 4XKYA 5FEXA 4GH1A 2WBAA 3L7RA 1BTCA 3DJJA 1F6YA 3SAZA 4DWDA 4EIVA 4JKMA 4UMBA 2XIQA 5CC3A 4DYKA 3ZFHA 1KBIA 3NIYA 3WK2A 3I4EA 2RJGA 1YRRA 3FFSA 4UZUA 2BOEX 1ZP3A 2W3ZA 4PL1A 1JDAA 3LOTA 1JZ7A 1HKJA 4JICA 3TH6A 4BURA 1CIUA 1ZALA 2TPSA 2P3ZA 1H1ZA 2X0HA 2CIPA 2GQ8A 2V9DA 5D30A 3P2VA 1KLYA 6XIAA 4PFMA 3CL7A 1XIMA 3V75A 4M29A 4Z1YA 5FESA 2PMQA 3W7CA 4XBKA 3U57A 3H8AA 3TWBA 2YDRA 4JX6A 2VFEA 4ZR8A 3HFTA 1NOWA 4PMQA 3P74A 3TN4A 1IWPA 1EGMA 2UZ9A 4QISA 3E12A 4C6BA 1SJBA 4J7RA 3TLQA 3GUGA 1G4EA 1VS1A 1VJSA 2ISVA 1L6SA 1M68A 4IMGA 1GTHA 3NOYA 1UHVA 4CNUA 1OK4A 2B7QA 1KGWA 5CZTA 4HN8A 4FF7A 1LT8A 4YVVA 2WZMA 1W9DM 5AYYA 4ADSA 3MW7A 3H2FA 1DE5A 2CBVA 2PDYA 1TV4A 4CQAA 3ANVA 3MT1A 2V2CA 3L65A 1OF6A 2XFFA 4N4PA 4Z1DA 1NU5A 2BHYA 2QMKA 1E0WA 1RJRA 3NOEA 3F1QA 2X1UA 2V81A 2GGGA 3VX0A 3LV5A 3RU8X 4FO4A 4BI6A 4NT0A 2OX1A 5CGTA 5HINA 2ZZBA 3VPLA 3CGBA 3CJPA 1NDWA 1XBZA 1I1XA 4ZE5A 2BGQA 3WLKX 4D72A 1NY1A 4JTHA 3UG5A 3MMDA 1DWJM 1OT2A 1IT8A 5CSYA 3W7HA 4CU8A 2VKZG 3QHMA 3A4AA 3ZJ7A 3EGJA 1I2PA 3Q37A 3CGDA 3CZ8A 3HGOA 2JKAA 1Z48A 2PDPA 4NNAA 1VJZA 2Y0FA 4A3HA 3VAVA 4J2PA 2O7SA 4GX8A 3RO8A 4ERIA 1TWZA 2E1DA 2ZDRA 5GJMA 3UEQA 4MLJA 1UOZA 4M5PA 3UXKA 5I3DA 3ZLFA 3Q4DA 3T0BA 3UJEA 4GZ7A 3AJ7A 2YA2A 4F9JA 3DIPA 4IM4A 2BC0A 4N4QA 3NVVB 3AIQA 3V18A 2DW6A 1GVFA 1MXGA 2GK1B 2JF7A 3V5CA 3N34A 1FDJA 2RDUA 3DFOA 5D9NA 4S3AA 4GY7A 5BRBA 3BMVA 3SUUA 1B3XA 2YOCA 1R85A 2GQ9A 2YXOA 3NJ3A 1JZ3A 3QVQA 1EUNA 3K4AA 3BJFA 5A6SA 2F5ZA 2W91A 4ORIA 1PV8A 1FA2A 1VYPX 2MNRA 5T9CE 4H6KA 3SGUA 2X8RA 2NQ5A 4DI9A 4HPHA 4KWVA 3W7MA 4AHQA 1ITXA 2VQTA 4DXVA 4PC8A 5BOEA 3QMTA 1T8XA 3SJNA 1ZY8A 6REQA 1X1ZA 1F8MA 1RH9A 1OC5A 3KLJA 3KRZA 3AIVA 3MSYA 1FWWA 3W88A 4PE8A 4GG9A 5I2UA 1XINA 1TJ2A 4H4YA 3IVUA 1Y0EA 4Y9PA 4HN4A 1Y65A 1DNCA 1AA1B 3NPUA 1I2NA 3AYTA 4AVFA 4YHGA 1KRAC 3PZGA 2EQ8A 1E0VA 4PUUA 2V63A 3E2SA 3B4YA 4QJ1A 2WSPA 1TFVA 1DJNA 5AB3A 3FAWA 1MXDA 2XVPA 1KNWA 1MEWA 1VFLA 1DE6A 4AD4A 3L5AA 1E6QM 4DUWA 5ABGA 3HO8A 3P67A 3W7JA 1IGSA 1VFMA 1SGJA 4ZOCA 1GJWA 4GYPA 3WENA 3ABSA 2XM2A 1I2RA 3KOZA 3NR0A 1UD8A 1V7YA 2CESA 3EA2A 1DTNA 4XZHA 3TV8A 3R6IA 4NF7A 2WB5A 3UU0A 5IBXC 3W7DA 4OUIA 1L8PA 3R7MA 3W7RA 2VZOA 5XIAA 1GG1A 2CXGA 5CBBA 1V0MA 3R12A 1DBTA 3GH7A 1JZ5A 4GHRA 3MSRA 4DBDA 5U7SA 1H0IA 1MYRA 2W55A 4A8RA 3UCCA 5DMNA 3W71A 1HKVA 3W2LA 4CD7A 5EMMA 2HK1A 2RAGA 4AY1A 2WVTA 4WY0B 5C54A 1QBBA 3T2OA 2O0TA 4FIQA 5BMXA 4EAMA 3P3BA 1TO3A 2OO0A 2UBPC 2WPGA 1ZAHA 4IQEA 1G5AA 4KERA 1L6GA 4E8CA 2Y61A 2TAAA 2HV5A 4AD3A 1SFSA 1UMYA 3W07A 1EJWC 3QFEA 2Z2BA 3NVDA 4CCDA 1AJZA 3D6NA 4YU1A 3OG3A 3L12A 4KETA 4Y96A 1XYAA 4JIRA 1ZRQA 4B90A 1OADA 3ATZA 1W8SA 1K8CA 1CZ1A 3RUBL 3QSRA 3DYMA 1KFEA 1TPUA 4ZO9A 2ISFA 4E4FA 1RQEA 3FX4A 3C2EA 4KRZA 5A2BA 2OXNA 3PF3A 3GVQA 2CBJA 2PDWA 1UP0A 5F1VA 3DYPA 1VIZA 4FI4A 4BF7A 1X2HA 3RPMA 3KRBA 1GRFA 1T6MA 2QDEA 4ADUA 2QPUA 5E09A 1CNVA 3B03A 1TMHA 3H7RA 1HVQA 4JX5A 2YCJA 2CW6A 1XFCA 1YNYA 2E9BA 2HMCA 4WDWA 4AYSA 1ZL1A 3FA5A 3ECQA 4OFCA 2OWWA 4LEQA 1EA9C 1Q6LA 3G6MA 3UXLA 3MCMA 3TTSA 4B16A 3WLOA 2J27A 4H9YA 3NXFA 1GW1A 1YBQA 3LXBA 2DSZA 4XBSA 3AC0A 3MUXA 5FF7A 4JFVA 2WNQA 1LBLA 1NOUA 2C6QA 1LRTA 4E38A 3A6OA 3AHYA 4LYKA 2WOIA 4S3CA 4JTGA 3B05A 4DWSA 4IG2A 1MMFA 1GVIA 2J78A 4MYAA 3GDMA 2Q6ZA 1JPDX 2GUYA 4IMFA 1FRBA 2F6KA 2INZA 4C7FA 4P7NA 3WO8A 1E6XM 3G1DA 4M6PA 2C16A 3WUGA 4CKQA 3OOQA 3VM5A 4V1YA 2VC5A 5G5HB 1XQLA 4L65A 5KVHA 2H9AA 1X97A 3VX1A 4Z1CA 1WDSA 3BG3A 1N5XA 3LK6A 1R3TA 2P8BA 1Q4WA 3LHTA 2G97A 3LA4A 2ZQ0A 3QGVA 2ACUA 4C1KA 1JIBA 1VAHA 4OZOA 1E9LA 5A6TC 3KM8A 3PK7A 1BFNA 3TN3A 2Q71A 2QULA 5EMLA 3CLWA 1FCVA 4UCGA 1OYAA 4GUGA 1Q66A 5GNZA 1MW1A 4DI8A 3WJZA 4JTTA 1EEPA 1MEHA 3MBDA 2ZBTA 4QX4A 1W31A 4IHCA 2REQB 3M7WA 3NCOA 1R9YA 2FPYA 3AMCA 1HT6A 1H09A 1XIFA 4G5DA 1G67A 2YLAA 3AIBA 2D0HA 3TMQA 3HMJG 1V02E 1J79A 1XGEA 3FEMA 3TWAA 1JVNA 3U7BA 3VI2A 3VMPA 4AF0A 2QAEA 1W91A 3VDGA 4PMUA 1IEIA 1KN0A 4EQRA 1ZU8A 3A5FA 2CBIA 5E6YA 4PUKA 2GYIA 4DXKA 4AEFA 1E5NA 1QI2A 1Q8AA 1RK5A 3COTA 1QNQA 5CC5A 2IUZA 2Z1SA 4M6UA 1U5VA 1O66A 2QCMA 4WX2A 5AKQA 1LROA 3O9NA 1Q13A 4PUMA 2PF8A 5DBTA 2FB2A 4IGHA 4IQLA 4HCLA 4F3HA 3AHXA 4A3RA 2HISA 3EXTA 1QRQA 3DN5A 3EB3A 1EEXA 2Q8XA 3KOYA 5C5YA 3OLEA 1CENA 3ABXA 3RX4A 1BTMA 4GD0A 3NL5A 1UD3A 3ZJ8A 4W7VA 1XRTA 3GG7A 1DVJA 2VX5A 4W87A 3O6CA 2DSVA 3XISA 3WQVA 2BGSA 3S8HA 2OEJA 3BLOA 5EMYA 4F2BA 1T3QC 3UZ5A 3PBWA 2XFYA 5C7HA 1ISWA 2PDXA 1R3VA 5D9OA 1PTGA 4MB1A 3CIWA 2GFTA 1HKWA 3WH6A 1W3NA 1A47A 4XQ6A 1DIEA 1X6LA 3RM8A 3MTWA 3ZT7A 4L6OA 4I7UA 2CZVA 1QU4A 2XN2A 4JN8A 3QSTA 1BSIA 3BAWA 4H4TA 4ZB2A 5A1AA 4Q7IA 3GVGA 1DJQA 3MZNA 1VCGA 1P6BA 2PU1A 3SRFA 3O0FA 1PCKA 5BMWA 2QCCA 3T2PA 3UBPC 1KQZA 1TV5A 4H4XA 1S38A 4CQCA 4XB3A 3WNMA 3TOYA 2ABAA 5LGZA 4ZSUA 3LUTA 2C1HA 1Q3NA 2OPJA 4WKFA 1EZ2A 1CB2A 4L7ZA 1Q6FA 3WEZA 3N2BA 1YXCA 1S3HA 3C3UA 2Y1HA 3SRDA 3L4VA 4S3EA 4DPPA 4DB7A 4IG2B 4C6QA 3LM7A 2PRLA 1FECA 3ELFA 4XTDA 3W81A 4PCSA 1H63A 4XTIA 2O9TA 4O16A 4E2VA 1NJJA 2ZICA 4OWGA 3KCJA 4QAIA 3T40A 1SPQA 3S3GA 1QNRA 2AQOA 4Z2IA 2Y70A 2O7QA 1T96A 1W5QA 3T0DA 3G1SA 4LAKA 4LU0A 1NELA 1R2SA 1AD4A 5I5RA 3A3HA 1QMLA 2QUMA 1W3KA 5KTLA 1J12A 4ZXLA 4UR7A 3EF6A 1J0HA 1M41A 3SCSA 3PNUA 1OFBA 3AHVA 1FQ0A 1HQTA 4GFSA 3WL1A 4B3LA 4TXEA 3SCOA 3LRMA 3M5ZA 4E4UA 1O5QA 5IOBA 1N55A 4B5TA 4MKNA 1JGIA 1Q2RA 4UNLA 3NEHA 1XCXA 2E6YA 2IKGA 2PTYA 1HL2A 5A8OA 3AIRA 3OZMA 3W72A 1E6ZA 1XUZA 3I7SA 1JCMP 1YDOA 2ACRA 1MFUA 1YXYA 3SCQA 4AF0B 1FWIC 1DQWA 4O1EA 3O2LA 3OEXA 5HA7A 4CNOA 3OU8A 3BCFA 2W9MA 1V3JA 1DQXA 4S3BA 2GGHA 1XUUA 5C2XA 3Q6JA 5EBUA 3SQSA 4AZ7A 5HUOA 2D1ZA 2ISWA 1X7IA 2E09A 3NZQA 4Q8WA 1XPYA 3SUTA 2EEXA 3GD4A 1KKOA 1E40A 1RBLA 1PX8A 2OYMA 3C86A 5IFTA 2HDJA 1ZUAX 3OC4A 1E6PA 4I6VA 3AM9A 4JTUA 4MF4A 2NX1A 1PWLA 3HOJA 4H19A 4UC5A 3BOXA 3S5OA 1IT7A 4MKVA 4MPKA 3WLQA 2CLEA 4W8AA 3KOXA 2VRJA 4HNOA 3TOPA 3SBFA 1VPYA 4E8GA 1VFUA 2OYKA 4PMXA 3JR2A 1ZAIA 2VTFA 3GX9A 4AIOA 3I68A 3OPSA 1RJPA 1BYAA 1DORA 4AHPA 4MSSA 2VGGA 4M8UA 2WPCA 1DTUA 3H7UA 1FWDC 1NFBA 2W0UA 1T0OA 3UETA 1K7FA 1CLXA 1K7XA 1VR6A 2FTPA 2PDBA 2DH3A 2AKZA 3I3EA 4KPLA 5FOOA 4ML4A 1VF8A 2J66A 1ZS2A 4H4ZA 4QLLA 4XUYA 3WDRA 1E1CB 3G8RA 2PWVA 2XWDA 4LCSA 4FF5A 4TVDA 2BODX 3F5LA 1UH3A 1EJRC 1TTIA 1ZJBA 4LEFA 4D6CA 4JQ9A 3OLGA 2GQAA 2Z28A 1Z44A 1GVOA 1ZBCA 3SUSA 2Z29A 1F3EA 4YLWA 1H7XA 1B9BA 4HYVA 4NX0A 2YL5A 3VOCA 5FF4A 3RMJA 3A12A 1R5YA 3CPUA 4FLRA 3F2DA 3I7QA 3PWGA 3UR5A 3OODA 1EP1A 4PODA 3S6TA 2WLYA 4YWOA 1VYSX 4REQA 3IARA 1ADSA 4P7OA 1F3XA 5EY5A 2ZRYA 3V36A 4L4PA 6A3HA 3QC0A 3CIVA 2F7FA 2XZ9A 2A21A 3LS9A 3PJTA 4ZO8A 5G4EA 5HNTA 2J4GA 3B97A 2GGIA 2NQJA 2Y89A 2ZA3A 3W1UA 3M43A 2FZ9A 6ENLA 1WNOA 4EQSA 4LIIA 1UP2A 3EWBX 3WJYA 1H7OA 2HCVA 3DOPA 3MS8A 1QW8A 3N2CA 1TV2A 1JR1A 3S1VA 1ZQ5A 3VGHA 1QNOA 4O54A 5KEZA 2NWRA 4JQ1A 3GTXA 4PTDA 2W0HA 3A7RA 2JGQA 4RPPA 4JS3A 1E72M 5FF3A 3PNZA 4IF2A 5K9DA 1ZK7A 2X42A 2X50A 1CGXA 3HPFA 4JQ3A 2QUVA 5CPQA 4RV8A 1XH0A 1B3ZA 2Q02A 2WANA 3I6EA 3LTYA 1F4HA 4ATLA 2V3AA 5FIPA 3NO3A 4QGCA 1XJBA 2J25A 3OQ8A 3RU6A 1XIDA 5HWMA 2ALRA 2OQYA 4U3CA 1VD6A 2VC7A 3FEQA 4GNKB 3H6OA 4GZJA 4F8XA 1C90A 3M07A 4AWEA 3CQ0A 4O8AA 2BDQA 3S1UA 5BOFA 4PFHA 3I6TA 4GYFA 2UWFA 2OSWA 1PX3A 2C14A 3APYA 1JULA 2VUYA 1AH3A 2IPJA 4C6LA 4NYYA 3USBA 5HDRA 3CAKA 1IV8A 3PZOA 3IV8A 2WC3A 1GVEA 2J13A 4EF8A 1C91A 1X6NA 3S5ZA 5AYBA 3MYPA 3VNMA 3GXTA 3V0UA 1WBHA 2VFIA 4G1NA 2Z1WA 4GYPC 1CXLA 3ENLA 4IJRA 1GGOA 1UR0A 4PUNA 2AKMA 4JOMA 4NXKA 1GRTA 2CXEA 3W73A 2ZC8A 4F4RA 5AC6A 3WJXA 4YTTA 3TC6A 3H2MA 2QEZA 2Y8VA 1PBGA 2BVWA 2R9ZA 2PI6A 3N6QA 7ENLA 3EB4A 4KRUA 3KBJA 2EJ1A 4LVGA 4Z08A 3WMLA 4K8EA 4N9CA 4O4WA 4OVXA 3IIZA 5BWAA 1HF6A 2PA6A 4LUSA 2QS8A 3LYEA 1W1TA 1CGTA 3IJDA 4JTJA 3GC2A 1QNVA 2YL8A 1RBAA 4AHOA 4O1DA 1WZAA 1EC9A 1GESA 4TTGA 3VM7A 3AUJA 3I3DA 3WF1A 3GBDA 3LMYA 2XGBA 3AXHA 1TMLA 2VD9A 3K13A 4ICCX 4N0RA 2WPFA 3GR7A 4LQ1A 3WEOA 2FHFA 1UJQA 3CTLA 1TG7A 5ECUA 2IW0A 2DT3A 5CZKA 1UWAA 1L9WA 4KGLA 1SSGA 1DJIA 2DIKA 3T78A 4E8DA 1OD8A 2X09A 1X96A 9RUBA 4JFTA 3IJ7A 1FFRA 3N3TA 5DT5A 4H4SA 4B9ZA 3QJAA 4UTFA 4RNHA 3H4KA 4LF1A 4Y8EA 1UBPC 4J3TA 1BGGA 4JTDA 1H5YA 1KCXA 1W1A1 1XRFA 4OECA 2E5AA 1TSIA 3R0DA 4REQB 3TJXA 1AZ1A 2DQXA 2I16A 3N6JA 3NPVA 5BXSA 1JYWA 3N9KA 3RITA 3OBEA 4NZ4A 4MMWA 2W54A 2WWCA 1Q1WA 1N82A 3KLLA 4LVFA 3ARXA 2IPWA 3R89A 4U31A 1F07A 5HWNA 3CZLA 1EZWA 1ZJAA 1J8VA 1K4GA 3O3RA 1A5LC 3B9NA 3RX2A 2NQLA 2IQDA 5G5IA 3G3MA 5JBDA 1DXLA 3VNJA 3THDA 3DC0A 1UQYA 2OVLA 3PHAA 1GOOA 2R6OA 3D3FA 1MXSA 1WYGA 4JZ5A 1W37A 3EB2A 3BUVA 3TTYA 4HOXA 5A8GA 3HQOA 3PY2A 1OFEA 2V68A 1LTDA 1MQQA 3T81A 3WK0A 3CYJA 4DWSC 3SI9A 3L2IA 2D0GA 2DJXA 1V3MA 2WSQA 2QYGA 4DY1A 3OYXA 4HD5A 2ZWYA 3KBMA 4ZO7A 3F5JA 2DEPA 5CPTA 1U1JA 3N4AA 4MB5A 4AZBA 4D1IA 4D6HA 1E9YB 4S2BA 5EMKA 1A4MA 2OX4A 4GUIA 5HMEA 3SCUA 1NF0A 4RK8A 2QV4A 3QGKC 3Q58A 1TPFA 1NP2A 3TSBA 5E5CA 1IEVA 1JL8A 1TCDA 1K8ZA 3IUIA 4ZQNA 3ITYA 2VYOA 3U5YA 5J5DA 2IKHA 3I7RA 1CI1A 4EQXA 4JQ2A 1R6WA 5D38A 2GUBA 1RPKA 4JTRA 3GKFA 1JQVA 5H8PA 5M1TA 1JNEA 2YW4A 3N13A 3CB3A 4D6DA 2DJLA 3RPDA 1XIIA 3U4AA 1G69A 3NSNA 3RYSA 1SR9A 2CETA 4HMEA 1JDEA 2E8ZA 3SIZA 3VINA 1O6IA 2W6RA 3IJ6A 5TIMA 3QV9A 4LCRA 1FVPA 3QZ6A 5CZSA 5FJIA 3NDYA 2RFGA 1QOPA 3A9BA 3T0TA 4IWWA 3GXPA 4LAUA 2ZYFA 1ZGDA 3TW6A 4I8YA 1TPWA 3CV1A 4F40A 5E9XA 3PG6A 3NEVA 1CXFA 4TR9A 3BZGA 4GI9A 1KTBA 3LSBA 1QI3A 3CV2A 1GCYA 4MFDA 3V1HA 1IYXA 2ESCA 1SO4A 4DJEA 4RNIA 2G50A 3EMZA 3G22A 4D8LA 3LHVA 1LRNA 3V5OA 2HBVA 2FLIA 3T09A 1LDCA 1L6WA 2WW5A 1FWAC 2P3EA 1ZKQA 1VFHA 3FAXA 4I3GA 4EPEC 2ZOXA 4A21A 4ICMA 1MFVA 1P6WA 3LD5A 4LUSB 5GQBA 2XIIA 2Z26A 4XAFA 1XLCA 4QQ3A 4NL1A 3R07C 5BZAA 2FPTA 3CWHA 4BJHA 1GRHA 3U2OA 3WYZA 4O50A 2NW0A 2O4QA 5B80A 2BY0A 2P53A 2R14A 4J3VA 3P93A 1TA3A 3QFWA 3TQKA 4QLKA 2VHLA 5BXRA 4WXYA 1KM1A 3HGSA 4GY0A 1XDLA 1QHZA 3LBOA 5DCDA 3D9XA 2VZUA 2YLLA 3H2OA 1OIFA 4O28A 1VPXA 1RA5A 4DLMA 3O0KA 1N8IA 3NWRA 3CUZA 1BZLA 1EC7A 8TIMA 3CUHA 2QDDA 1KFLA 3W2MA 4F2TA 1U2YA 1UJPA 4H7CA 4IQJA 3UQNA 3L4WA 4B15A 3P5ZA 1D3GA 4TO8A 2AAQA 4BHYA 1CLKA 4B5XA 1LF1A 3NGJA 3LGDA 1PYMA 1RY8A 4CVUA 2E0PA 2WCSA 3PWAA 1A5OC 3SO7A 1E1EA 2QZRA 4C5YA 1TJ1A 4WR3A 2JIWA 1OX5A 2AAAA 1EP2A 3REQA 1LWJA 4M7TA 5CQ1A 4JDYA 3W85A 2W63A 1BWKA 1K8YA 1TV3A 1B57A 2A3BA 1DJYA 4Z42C 2VR5A 3TP4A 1A3WA 4NY2A 2J9XA 2UY3A 3KS6A 1OYBA 4LVBA 5D2YA 4NAFA 1XLAA 1N60C 1XYZA 3ZQ9A 5CSRA 3DGZA 3VO0A 3B40A 3SCNA 1BWCA 1UMLA 4GUHA 1RLDA 2WKGA 4TX9A 3EEZA 2NQHA 2O9RA 3RJXA 3NQ2A 3M6YA 1CPUA 4Q8OA 3OLDA 2AMGA 3OGVA 3PN8A 3E6EA 1GRBA 3DGHA 4JAWA 4U5KA 3JUGA 2X8GA 4AX7A 3WJWA 2CZDA 3KVMA 1UA3A 4JTFA 4AB4A 1MI3A 1IZKA 2WVVB 2QCFA 4IZGA 3W02A 3PBGA 1C8QA 4PTVA 1SJCA 2C8NA 4HHHA 4WKAA 4HMNA 1T41A 1KM6A 3BLPX 1GOQA 2PRHA 3OBKA 5XIMA 1O68A 3FCPA 1P0BA 4HZ6A 1BPLB 1IXPA 1RY0A 4DWSD 3ABRA 2GOUA 4YTSA 3M0XA 7TAAA 3S4TA 4JIPA 1V3LA 2OYLA 2H3DA 5E6ZA 3P60A 3VIJA 4S3DA 2F8QA 1M3UA 4GFIA 5DT7A 3ZR4A 4PMVA 4DEFA 5AYZA 2Q3OA 1FWFC 1QWGA 4A05A 1J93A 4WOZA 5F2GA 5K2ZA 4DYJA 5JVLA 1VJIA 3KBSA 4N9DA 3B9EA 4FNPA 1GXFA 1GOXA 1V6XA 3MJMA 1K9DA 3WQFA 4HK5A 3PZMA 1YHTA 1J96A 3AICA 1HIZA 1DQUA 1RP9A 5F4SA 2DZAA 1QPNA 2PDNA 3ZWTA 2QUUA 4FK9A 2X1SA 3AXKA 3VTRA 2X05A 3UPWA 3MQTA 1XIHA 3FYYA 3SQMA 4GA8A 2V3FA 3AWOA 2B7NA 3QHNA 5DBUA 4DXXA 3O1NA 2BGNE 1Z6KA 2PODA 2EPMX 2GOKA 5IHSA 4AY8A 1RVKA 3FHQA 2CLHA 4MGGA 4M19A 1GEHA 2VEPA 3EX1A 4C6FA 1MZHA 1EHAA 3QHOA 4Y7EA 2BY1A 2NUYA 3KUMA 2PDLA 1E6SM 4F79A 1KM0A 3M5VA 4RW5A 4GIAA 3QY8A 3CV6A 3GRIA 1RHCA 4N7QA 3DEQA 3TYAA 1EQPA 4K7VA 2OR2A 4H9UA 5K9XA 4CCCA 4ADWA 3B0PA 4HNUA 3ZR6A 1OZQA 3CYVA 4MY8A 3UYCA 2A1YA 1AQMA 1QDSA 3N04A 4ZZ9A 4IIHA 3V0SA 2QQ6A 2R82A 4E6MA 2ZRZA 4IUGA 4FIRA 2WXDM 2WHJA 4G7FA 4FEZA 2O4MA 4PMJA 4ZXOA 1WDRA 3TW7A 4K1GA 5AHMA 1W56A 3SIMA 4GIYA 1M5WA 3CASA 1HKIA 2W5FA 4CN1A 4IXHA 4E4PA 1FWTA 2E77A 1OQFA 3W7LA 3ABOA 1H2IA 4KCVA 1ZX9A 3GG0A 3OO2A 5I07A 1JDDA 3BAKA 1W17A 4LVAA 3DUGA 1WKEA 4HMDA 4FS9A 5TNVA 2JALA 2FZMA 3Q45A 3FDGA 2A3AA 1OCQA 3CZKA 1D2KA 4NAFB 1NQ6A 4IQDA 5H1WA 4YVPA 3TCSA 1DJXA 2VFDA 4KCUA 3CQKA 3O7UA 3AU2A 3DGRA 4WK9A 4U5IA 4C6DA 1ZTVA 1QI4A 4HOZA 4L6DA 3EKLA 4D8AA 2CHOA 4DNMA 2CLLA 5F4XA 1FH8A 2AQWA 4JTLA 4O12A 3HJEA 3LXAA 4Z1AA 2DW7A 2QJJA 4FXRA 2PWEA 2E5BA 1UA7A 4F0MA 1JOAA 4BZYA 3CU2A 3PUEA 2A8XA 1UKTA 1E56A 4A6GA 8CGTA 2H8ZA 3RR1A 2HPIA 2WHLA 4W4QA 3TZFA 1FTXA 3WLPA 2CLIA 4JCLA 4P61A 1HJSA 3DAQA 4GIEA 2NSOA 2GVEA 3LI0A 5E93A 3EMCA 1JRPA 2WV8A 3AMGA 1XR2A 2V3DA 5HMDA 4UMCA 4QNWA 4HJWA 2WMIA 4P8WA 5L6UA 3HTWA 4O1AA 3QR1A 2CITA 2PTZA 1OJXA 4NILA 3PPHA 2ISDA 3WQDA 1HJWA 3TFXA 4L9YA 1WP6A 5FJOA 2Q8LA 3S2CA 1UKOA 3RMEA 3ITVA 4PB5A 4MUPA 2PZ0A 1M03A 2RJHA 2VCAA 2Y5SA 2I7GA 3GRSA 3C6CA 1H3GA 1GOMA 1GPFA 3ARTA 5EA9A 4O4VA 2VFHA 3RLHA 3UZWA 3AOFA 3IVTA 2DH2A 3S2MA 5AZ1A 4NJIA 3T07A 4JQAA 1JYXA 3PULA 3IGUA 3L4XA 2OEMA 3CB8A 1IIGA 3FSTA 5JXQA 2QF8A 1GKRA 1NOFA 2Z1KA 5FKYA 2VJXA 1J5TA 3QTPA 5M3WA 3LCLA 3E2RA 4GNJA 3UCDA 3S1WA 3N12A 4JTIA 1R86A 2VO5A 1A5KC 1K4HA 3IEBA 2A79A 1LPFA 3NQ6A 3VGEA 3QKZA 1N63C 3WLMA 5AC4A 4CEXC 1GORA 5A6KA 4G2DA 1TPEA 3LEPA 3VD7A 3J7HA 3R13A 3W22A 2JKEA 1JROA 1V3KA 3A3WA 1TZZA 2PDHA 1UD4A 4EP8C 3GYCA 1YDYA 4PMYA 3W1MA 5JCMA 1PXGA 2DU2A 4A35A 3VZYA 3N11A 4AG0A 3VGGA 4BY3A 3TTQA 5AC8A 2G0WA 2DP3A 2XTKA 2R94A 4GYJA 4ZQMA 2V6AA 1KBLA 3A7AA 1BQCA 3CK5A 1S2CA 3UWVA 1B3YA 1C8VA 4AIBA 2E28A 3SFKA 5I24A 1OCJA 1O5XA 5HJLA 7XIMA 2D2GA 2ZXAA 4OE7A 3PPFA 2X7WA 4XO6A 4KH2A 3G77A 1DYSA 3N2MA 2PBGA 2X1TA 3CLMA 4BQ2A 4JDBA 1GZJA 1PZ2A 3W23A 3M5YA 3NQ8A 2JK6A 3VCNA 3F7JA 3FV9A 3O6YX 5K4ZA 1A5NC 4R5EA 4LBRA 1NF7A 2I5GA 4GRTA 5AOUA 3WD2A 4F66A 4LAMA 4XX6A 4AAJA 1E4NA 3MUZ1 4WDXA 5H8MA 1KWKA 3PFMA 1PKNA 2Q01A