2P0IA

Crystal structure of l-rhamnonate dehydratase from gibberella zeae
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
407
structure length
393
Chain Sequence
LSSVKDFPKIKAIRSFIIGHWLIDSDISTPASKWEQYKKSRTSWGINVLGSFLVEIEATDGTVGFATGFGGPPACWLVHQHFERFLIGADPRNTNLLFEQMYRASMFYGRKGLPIAVISVIDLALWDLLGKVRNEPVYRLIGGATKERLDFYCTGPEPTAAKAMGFWGGKVPLPFCPDDGHEGLRKNVEFLRKHREAVGPDFPIMVDCYMSLNVSYTIELVKACLDLNINWWEECLSPDDTDGFALIKRAHPTVKFTTGEHEYSRYGFRKLVEGRNLDIIQPDVMWLGGLTELLKVAALAAAYDVPVVPHASGPYSYHFQISQPNTPFQEYLANSPDGKSVLPVFGDLFIDEPIPTKGYLTTADLDKPGFGLTINPAARAKLIPSDYLFKVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-rhamnonate dehydratase
publication title Crystal Structure of L-Rhamnonate Dehydratase from Gibberella Zeae
rcsb
source organism Gibberella zeae
molecule tags Lyase
total genus 114
structure length 393
sequence length 407
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.90: L-rhamnonate dehydratase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2p0iA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2p0iA01
3RO6A 3TCSA 3UXLA 1ECQA 3DESA 2QVHA 2OVLA 1ONEA 1W6TA 2AL2B 2XH2A 3P3BA 3H12A 2XH4A 4MKSA 4HPNA 4HN8A 2QDEA 3TWBA 5FJPA 2AL1A 3TJ4A 4J3ZA 3FCPA 4DYEA 3VCCA 3N6JA 5FJOA 3QKEA 4HNLA 4E6MA 1WUEA 1FHVA 2GGJA 4GYPA 4HCHA 3ZLGA 3H70A 3UJRA 3P93A 3DEQA 3ES8A 3T8QA 2HXUA 1R0MA 3OW1A 5EU9A 1PDZA 3PK7A 2PU1A 3SN0A 3OP2A 1EC8A 5BOFA 2OLAA 2PA6A 4E4UA 1MNSA 1MDRA 4MMWA 3PFRA 4H1ZA 2DW7A 3CK5A 1KD0A 4DHGA 4K2SA 6ENLA 3IJQA 4DXKA 3NZGA 1SJCA 3RCYA 2GL5A 1JCTA 1SJDA 3V4BA 4E4FA 3UJFA 4GGHA 1P43A 3UXKA 3I6EA 2OKTA 2GGIA 2I5QA 3DIPA 1NELA 2QJMA 2GDQA 4M0XA 1NU5A 3HPFA 3OTRA 4EWJA 2OX4A 3ENLA 3T4WA 3SN1A 3OPSA 1RVKA 3DFHA 2PP3A 2XGZA 1WUFA 3Q45A 3CB3A 4H83A 4H2HA 3FVDA 3QN3A 2OQYA 3S5SA 3TJIA 3GY1A 3SN4A 3THUA 4G8TA 4GGBA 4JHMA 3D47A 4ZA0A 3R11A 4E5TA 3T6CA 3FXGA 1KCZA 2FKPA 3UGVA 3UJEA 3CT2A 3V3WA 4HYRA 4IZGA 2PTYA 3PWGA 3N6HA 4H19A 4IP4A 2OQHA 3GD6A 2AL2A 2PGWA 4KWSA 7ENLA 4HNCA 4IP5A 2DW6A 3CYJA 2PS2A 3CAWA 1BQGA 3H7VA 3MZNA 3KUMA 2QJJA 3SJNA 2GGHA 2HZGA 3H8AA 3ZLHA 1PDYA 3DG3A 1DTNA 3JVAA 3FYYA 2XSXA 2QJNA 2GGGA 5ENLA 4DWDA 3ZVHA 4FI4A 2PSNA 3TWAA 4JN7A 2GSHA 3R1ZA 1BKHA 3ZLFA 3QTPA 3T9PA 3CXOA 1EBHA 2OFJA 2AKZA 2ONEA 5FJTA 2O56A 3OZMA 2PGEA 3TW9A 3Q4DA 3R25A 3R10A 3RR1A 1TE6A 2HNEA 2PTXA 3TQPA 2NQLA 1EC9A 3U9IA 3RRAA 3EEZA 3VA8A 3VC6A 4GISA 4F4RA 3SSZA 4Z1YA 3BJSA 4ENLA 4GFIA 1SJAA 2OG9A 4DX3A 2PODA 1MRAA 3VDGA 3UJ2A 4JN8A 5FJUA 4FP1A 2QDDA 2AKMA 3JW7A 3PWIA 5BOEA 3K1GA 3MSYA 2PPGA 3VCNA 2PP1A 2PTZA 3RGTA 2GGEA 2PCEA 3MWCA 3R0KA 1JPDX 3MQTA 1L8PA 5FJRA 3RITA 4E8GA 5J04A 4A6GA 1YEYA 3DERA 4KEMA 4A35A 1MDLA 3DG6A 1IYXA 3MKCA 4Z17A 2P88A 3V5FA 4GIRA 3MUCA 3BSMA 2HXTA 3DFYA 2POZA 4ZCWA 4MGGA 3S47A 3TOYA 3U4FA 3QPEA 3MY9A 1KKRA 2P8CA 2P0IA 4A3RA 2QGYA 3B97A 3DDMA 4J1OA 2OZTA 3BOXA 4M6UA 2OO6A 1TZZA 3N4EA 1F9CA 4HCDA 4IHCA 4GMEA 3D46A 3ZVHB 2P3ZA 1R6WA 4IL2A 3IJIA 3NO1A 4YWSA 1XPYA 1JDFA 1OEPA 4KT2A 1EBGA 4K1WA 2PU0A 2MNRA 3ZVIA 3NXLA 4KPLA 4K8GA 4DN1A 4HCLA 3TTEA 2OZ8A 3NFUA 2FYMA 3OZYA 3GC2A 3UJSA 3ES7A 3VFCA 2OPJA 4IL0A 2CHRA 3FJ4A 4IT1A 3UCCA 2PTWA 2XH7A 2PMQA 3V5CA 2PP0A 4GYPC 1FHUA 3IJLA 2OZ3A 4G7FA 3STPA 3P0WA 1E9IA 3QLDA 1ELSA 3UCDA 1KKOA 1SJBA 3DGBA 1XS2A 1EC7A 1MUCA 4X2PA 2QQ6A 3N4FA 3SBFA 2ZC8A 3R0UA 3EKGA 3VC5A 2XH0A 3JZUA 3IK4A 2ZADA 1JPMA 3I4KA 1TKKA 2MUCA 4ROPA 1P48A 2P8BA 3GO2A 3FV9A 2RDXA 3SQSA 5IDZA 3DG7A 3I6TA
chains in the Genus database with same CATH superfamily
1DJYA 4LOCA 4H4IA 1HFBA 2BS9A 1O68A 3OGSA 1JYWA 2OSYA 4J3SA 1RCOB 3VD5A 1TYGA 1QOXA 3WQCA 2FPTA 1PIFA 2V38A 3T0TA 4P8UA 1A4MA 1W6TA 5G5IA 1AD4A 2PWHA 5D33A 4FX8A 2E9LA 5BZAA 3HQPA 4GABA 1XIEA 3WH7A 1US0A 2YA0A 4KRUA 5M5DA 3TJ4A 3QKZA 4Z2HA 4D71A 1W32A 1TVLA 3GIPA 4FB7A 1HGWA 4C6MA 2INFA 1FHLA 3FLUA 2WQDA 4WY0B 1XGZA 1WDPA 3KL3A 3ALFA 5I3DA 2C1IA 1AZ1A 1ITXA 3IIPA 1XM3A 3AMGA 1DE6A 5I09A 3B04A 5BOFA 2DDXA 4EVZA 3HQOA 3URAA 4YCPA 4GXPA 3H4XA 1V3HA 3MMTA 1V59A 2CETA 5C2XA 1R3WA 3NZGA 4O4WA 1SJCA 2NUXA 2ZDRA 3OYXA 4AHOA 3MUAA 2ABAA 4C6PA 1GOKA 1SJDA 2B7OA 4GGHA 3EMCA 1B30A 1FP8A 4JY8A 4DF0A 1E6QM 3W37A 3O9NA 3P80A 3S6TA 3G1VA 4CN1A 3CPRA 1P1XA 3SFKA 3UEQA 2E5DA 3CUGA 4LQ1A 1VFSA 5IFTA 3W27A 3W2UA 4EXBA 3W2JA 3RDKA 3Q45A 3DXIA 4W5UA 4LBUA 3U7VA 1K7XA 1QBAA 3B06A 2ZA3A 2J75A 3W24A 5DMMA 1ZFJA 4M81A 4Y90A 2INZA 3IGSA 3M47A 3D47A 1DJNA 3R07C 1XF0A 4GC3A 1SSGA 4YYFA 2OEJA 1OGSA 3CPUA 1GOIA 1NSJA 3CC1A 2Y1HA 1TPB1 3T4CA 3UVIA 1TO3A 1B4EA 3G1YA 3G6MA 4YTQA 3VKKA 4JQ4A 5DLCA 5CC3A 1YDNA 2PGWA 5C9XA 4EOUA 3ABSA 1WOBA 1TR9A 2VMFA 4ZBCA 1KBLA 1H61A 2FHBA 1XIBA 3TLQA 1CI1A 4D6FA 3VAVA 1UJPA 2PDIA 4WF7A 4LEQA 1C8QA 1LORA 4L5ZA 1OCJA 2BOGX 3MC5A 5CSSA 5HQEA 4BHYA 2IW0A 1EBDA 4HU0A 2CZFA 3E0LA 2GSHA 4QRNA 4W5ZA 1E6XM 1EJWC 5KINA 1AK5A 2WSKA 4QIUA 5G5HB 3MHFA 1GKPA 4BWLA 2PCQA 5G4WA 2V3EA 4LNCA 1PCWA 1JCYA 3GXIA 3H7UA 3CEPA 3KOWA 1TWZA 4CU7A 1VEPA 3VA8A 1LYXA 1E0UA 5HDRA 2V6AA 3NM1A 1F76A 4JTHA 2HV5A 2O55A 2GWGA 4GFIA 1GRBA 4HJWA 5CSUA 4CCZA 1BF2A 3CWOX 2ZUUA 5JMUA 3GM8A 3UERA 2ZIDA 1K6WA 2QZRA 2YYUA 2Z29A 5JIWA 4ZO6A 2BDQA 3TX9A 3VCNA 1JIBA 4B2DA 4PMDA 4PL1A 4MWAE 1N8WA 3SRKA 4V1XA 1JPDX 3KLLA 4M19A 2PDUA 5IRPA 3RX3A 1FWIC 5B7ZA 4Q3MA 3F03K 1E55A 1GHSA 1OD0A 5EMLA 1ZY9A 1KKRA 1RXOB 1XLLA 2C13A 1KXQA 2Y5SA 5DELA 3DDMA 4UR8A 2WCAA 4O1FA 5CSYA 1P1MA 4M6UA 3AMDA 4GUGA 4UB9A 5D02A 3IV3A 1S1PA 5LSMA 1SO5A 4H2CA 2NT0A 3FIGA 1BYCA 3LADA 2ISWA 4WZHA 3IRDA 3RO8A 1R6WA 4RW3A 1RLCL 3A4WA 1Q85A 1NAL1 4KT2A 4GZEA 1LL6A 3GIYA 4FEZA 2WKGA 1JXJA 2JGYA 4L4PA 4WKHA 3ZVIA 4K8GA 2NSOA 4GHRA 1E4MM 4OECA 1B3OA 3TIMA 5F7UA 3T0CA 1KM1A 2JBMA 1Z9AA 4DWSA 4GJIA 4MWAD 5LKYA 2RHGA 1W8GA 4AZ5A 2I16A 3TN3A 1THFD 3W22A 1S3HA 1PX8A 1HJQA 5IBXC 3UCCA 4IJBA 3EPOA 4W4QA 4GYPC 4H6QA 3AIEA 3PBMA 4WDWA 3NS1B 1AH3A 1AJ2A 3S6DA 3W73A 1O5XA 1XR2A 1V3LA 2RDTA 5D05A 3G1HA 4PB4A 4DJDC 1E1CB 4JCLA 1PIGA 5E5CA 3K8LA 5REQB 4ZO7A 5DN1A 3ZIZA 3KWXA 1TJRA 3LBOA 4BK9A 2Z00A 1WPCA 2GPTA 1TKKA 4MPKA 5BXPA 5FIPA 1MO9A 3G1RA 3U2CA 2PDWA 3NVDA 3WNKA 1IEVA 4HBKA 1V8EA 1E73M 4GUFA 2XN0A 2WO5A 3ZJ8A 5IDZA 1E6PA 4QQ3A 1SMDA 3DG7A 3I65A 2XVPA 5A8GA 4R34A 2VCCA 4J3TA 1XRFA 2W3RA 1ITCA 5T9CE 2J7FA 4F0SA 2DH3A 4IISA 2D0HA 1ISWA 5K9XA 3LHVA 4CQBA 2ODOA 1SW0A 1E4LA 3VNZA 3VIJA 2ANUA 1QNSA 3CHFA 1DBTA 2W91A 2DSVA 5LXXA 1E15A 2HWGA 1F4HA 4O10A 3E2VA 1I75A 4DYEA 5M17A 1KRAC 1KGWA 4D8ZA 3DH9A 1UR9A 6XIMA 3QKEA 3NNTA 1CLXA 1E51A 1GVSA 5A3HA 2EKGA 5EGRA 3H2NA 3UJRA 3RX4A 4H4XA 1FWRA 2WVTA 2XUCA 3HG2A 1A4LA 1K4QA 5B80A 4AD5A 3M5XA 2BASA 2DUAA 4Z1BA 2Y7EA 3I3DA 4PULA 4KFPA 1F07A 2QHAA 3SGGA 1KV8A 2P3EA 4ZO8A 3Q2DA 2JIEA 3OP2A 3OLDA 1Z41A 5HNNA 1ZSXA 2OLAA 5FF3A 4F2BA 3N13A 4L7ZA 6ENLA 3PG8A 1OX5A 4XBJA 5I6SA 4LAMA 2E6YA 1VBGA 2E7FA 2V3DA 5E9AA 2ZWZA 3P0XA 4JFSA 3SR6B 2D3NA 3KAOA 3T78A 1A5OC 5CC5A 3GNOA 2Z26A 1EJRC 3L23A 1EP2A 1E6NA 3TMLA 3KP0A 4QLKA 1AJ0A 2HNHA 4LVBA 3NL5A 4JPGA 2NVKX 1UBPC 3VDCA 2OOGA 3B9JB 1QMLA 1POJA 2GJPA 1K7EA 2CBVA 2DY3A 3WLRA 3DFHA 1OABA 3Q6JA 4WDUA 1UUMA 1GYLA 4Q6JA 4TMCA 1HT6A 4HU3A 3QGVA 1TPH1 3SO7A 4L64A 1FBAA 1W56A 1GZGA 1YMYA 4J57A 5BWFA 1XSKA 3R8RA 1X38A 4G8TA 4JEQA 4X9YA 5D04C 4RDYA 2QULA 2C7FA 3G1FA 3QQ1A 3QV7A 4HK6A 1EO7A 1Q6OA 1Q6EA 3L0NA 3AALA 3KBSA 2R8WA 4G9PA 4C7FA 3B05A 1CEOA 3HPXA 2ZRVA 1RV8A 3PWGA 3SCSA 5AC5A 3N9SA 3A9BA 2Z25A 3GS6A 4C7GA 1T3QC 1KFBA 4GVIA 4F0LA 4IP5A 3R4IA 3RF9A 1XUZA 3W7OA 4TV5A 5GNZA 7TAAA 4B3LA 1PZ3A 4WEVX 4Z2KA 3WNLA 2A4AA 3M5YA 5TIMA 1Y5WA 4PMZA 3PANA 3EWXA 2EG6A 1LUCB 3F5KA 4QEEA 3C0LA 1HJVA 2C79A 1LRTA 4O14A 1MW3A 3AU2A 5AFDA 2WBGA 4LPCA 3ONCA 4Q22A 5CZTA 1JDDA 3MS8A 5I79A 1VPYA 3GE7A 1CGTA 3WDJA 3BK0A 3OZMA 1FFQA 1ZAIA 1J11A 1OFAA 1R3QA 4LV4A 2FFIA 1GOWA 3AIWA 2BY2A 4B15A 4UQAA 4XUYA 2WV8A 3V1PA 5L9FA 1FWSA 3RPMA 4L80A 1GG0A 5D9OA 4CKQA 4CLMA 3EXSA 4DJEC 5D2VA 1CW2A 3MZ2A 2VD8A 3WQ8A 2FVMA 1Q6LA 1FWEC 3GAKA 3VDGA 3W72A 3UJ2A 3BARA 1J5TA 1LG1A 5CPMA 3U5UA 1E43A 5F4SA 3JW7A 3OIXA 3ATZA 7REQA 3AIUA 2IQ0A 2I5IA 4C6KA 1UKQA 3NDOA 1Q8JA 3HA1A 1XLAA 2Q8ZA 2H3BA 1S38A 1TA3A 4JR5A 1TMHA 1X1ZA 2EEXA 2DT3A 2ZFAA 3ZR4A 4HNVA 2BGSA 4OBTA 2O9RA 1EJXC 4PBEA 3S2MA 3SI9A 1S5MA 5CPOA 4ZR8A 5G2IA 4R88A 4J2PA 4IX0A 1W37A 1WBJA 2ZZ7A 3SY8A 4C1NA 5LNRA 5I3GA 1EUAA 4ATLA 3N29A 3U6WA 1UZHA 2CLFA 1VPQA 4R5EA 4ERGA 1XWYA 3MY9A 1WZMA 3MU7A 1X8CA 3NEVA 5A6BD 4K7VA 4V28A 3A7UA 1TV5A 2ZCGA 1FX6A 1OFEA 4K37A 1TTJA 3QFEA 1UWAA 2Z1BA 4EPBC 1QVBA 2VJXA 2Y62A 1F9CA 3IC9A 2KAUC 4QTGA 1GWJA 3FN9A 4JFVA 2ZUTA 1AMKA 4GA8A 1DJXA 1DIOA 5I2UA 3B4YA 2PWGA 5AYZA 4O50A 3NO1A 4C6NA 4U2ZA 2VUYA 1IZKA 1DJHA 3ZJ7A 3MVIA 1X6LA 4AYGA 3WJZA 3C8FA 1J12A 3E0WA 3CO4A 4K1WA 3S1WA 3M0XA 4C7DA 4DAFA 3EXRA 1QTWA 3WQDA 3O05A 5D4YA 3O06A 2NLYA 1JCJA 3SM0A 1TQXA 1N5WC 5D32A 3WLKX 1XIIA 1FWTA 4DJFA 1UIOA 1QHOA 4HA1A 1WA3A 3WDIA 5FAGA 4HMEA 3JS3A 4NASA 5HR7A 3C86A 2YL5A 1F3TA 4BJHA 3FVMA 1GSNA 1ONXA 3UG8A 3B0XA 1FFRA 5D30A 3TC3A 1R3RA 2WKJA 3T44A 4DNMA 1UROA 1WOAA 3U2ZA 1NFBA 1UR0A 1VPXA 3ARXA 1EC7A 3WLJA 2Y61A 4XAGA 1US3A 2QJHA 2D69A 2OELA 2EXOA 3ZQ9A 4Q8QA 2W62A 1QO2A 4B4FA 3I4KA 4S3BA 3MPGA 1MWOA 4HZ7A 5CXPA 4J3WA 3HMJG 1ISVA 4TXEA 1J0JA 3LPFA 4PODA 3N15A 3MUIA 2CZEA 4S39A 2RDXA 4HU8A 1REQB 4FLRA 4BKNA 3TYDA 1UA7A 4RCXA 4UQDA 2IUZA 2OWWA 2EPOA 5AYYA 5JH2A 3BSHA 3AC0A 2F38A 3SIMA 4QSFA 1Z48A 3QPZA 1DWJM 2ZRWA 2Y2WA 1A50A 1GVIA 3C2VA 1ONEA 4IJCA 3WFLA 2WPFA 4Z2IA 3L68A 2V2DA 2XH2A 1V02E 5CG0A 1P0EA 2XH4A 5T9BG 1BVNP 1HKWA 1NH6A 1KBIA 4IOTA 1OD8A 1L6GA 3EDJA 3ZO9A 3ID7A 3FHQA 2X1RA 3TYEA 1PWLA 3TW6A 3W1NA 1SSDA 1QFEA 3M16A 3M4HA 1SFLA 2UWFA 2ZZ4A 1ZAJA 2DSUA 1MI3A 4WVXA 3ZLGA 2BC1A 1ZMCA 3LNMA 4LUSB 1JYVA 3EKLA 1DYSA 4MAZA 1R0MA 5EBUA 1UD5A 4CNPA 4I5UA 1UR4A 2Z27A 4Q7IA 3S5NA 1S2TA 4CCCA 5A2CA 2PA6A 3GDTA 4GI4A 5JIPA 1H3GA 2ZYFA 2DW7A 4MAVA 3WMCA 3K4WA 2A3HA 5ER0A 1A0EA 3QZ6A 1VENA 4BZYA 1K70A 1OFBA 1AMYA 2WJDA 2QMKA 3QSRA 4GCAA 4KKXA 9XIMA 3G3DA 1DVJA 2OKTA 2GGIA 1CGWA 1OYAA 3TXZA 4OGZA 2G4JA 4Q8OA 4WR3A 2PDNA 3B9NA 4KFOA 3HPFA 4N2YA 3WL1A 4JAWA 6ALDA 3PR2A 1SPQA 3UZ5A 2Q3OA 1UYQA 2XIQA 5BMXA 4UUIA 3I6RA 3TSBA 1AQFA 3UWZA 1W3TA 2Y88A 3S5YA 2NQ5A 3IAPA 3CB3A 3WUEA 2IPGA 3R8GA 4JTDA 4JIEA 5LHEA 2IKHA 1VLIA 4N9BA 2EQDA 1HXJA 4F48A 3WBYA 4QM1A 1GQLA 4H4VA 3PPCA 3U2OA 1B4KA 4AF0B 4QISA 2X16A 2WMGA 3B9AA 3QSTA 4CNNA 3A5VA 1P6WA 3V3WA 4Q8VA 2GQAA 2GJLA 4AZ7A 1WAUA 3W38A 3W1LA 4GZ7A 3CGEA 4WUIA 3F4CA 3EB2A 1I2QA 2W66A 1JF6A 2OEKA 4JN6A 1DP0A 4E2BA 4H4TA 2YVGA 3QH2A 3TSMA 2CCRA 4FZIA 2A3BA 2QJJA 4ADWA 4LVAA 4DXXA 4NILA 3SFWA 2V3BA 1VEMA 4RE3A 1XLEA 3BV4A 4AD2A 1R2SA 3BPWA 1E9ZB 4MUZA 4S2BA 3ALGA 2VWSA 5CPSA 5J5DA 1XG4A 4WOQA 4H9UA 2J78A 1TFVA 3IGXA 1W9BM 1AL8A 3PFMA 1V6VA 3S1VA 2PF8A 3AUOA 1N82A 1JDCA 1QI4A 1IXOA 3TOPA 4AC1X 3W7JA 4O18A 3FNDA 4S23A 5CPNA 3MWAA 3Q4DA 5JVLA 2PAJA 3IIXA 3KOXA 4EF8A 2HRWA 1EC9A 5HNTA 3GX9A 3OA3A 4LU0A 1D3HA 1LT7A 3SCNA 1EKOA 4L6OA 3MHGA 4K6AA 1QPQA 2YW4A 3UWQA 4DX3A 3M64A 3PF3A 2G3MA 1BTMA 4NJIA 5M1TA 1QASA 3NVZB 3ITVA 3V7PA 2G41A 1G69A 4QAWA 3CQKA 3NTYA 3M0MA 3R43A 2PPGA 2QDHA 1OFQA 2ZICA 1NFPA 2VVSA 4ILSA 2VRKA 3WD1A 2UY5A 2J24A 4PCSA 2J79A 2XVNA 3IJ6A 1QWKA 3II4A 4JQ9A 1YEYA 2CEQA 1RH9A 3NVTA 1IYXA 3AZSA 2I9EA 4GIYA 3ARWA 4D8LA 3KOFA 1YNYA 4PB5A 2G4FA 3QPEA 1UKTA 1UKOA 4PE8A 3QLLA 4FIQA 1JZ5A 4BS0A 2VX7A 3EZ4A 2AGTA 2AQWA 3E9AA 3VGBA 1TZZA 4YVXA 1EJUC 1OG0A 3GNXA 4H4RA 3EX3A 3FA5A 2OSWA 1GOOA 3R6IA 3W76A 1RQHA 2P3ZA 1IQ8A 1F3PA 4WD0A 1RP9A 3RRXA 2ISSA 4YMZA 3K13A 2VFDA 1M03A 2FJUB 3VIFA 3IJ8A 4PCPA 3SB0A 4MSSA 4M6PA 3ANYA 3UD6A 1VFMA 4UCGA 3PNUA 2DVTA 2BB0A 3PZQA 1OZMA 4PUUA 4AAJA 3GSMA 1OIFA 4KWUA 3RHGA 4LUTA 1AODA 3TQVA 1O60A 4UZSA 4IL0A 3PP7A 3GHSA 3HW2A 4IT1A 1YDYA 2YFOA 2ZA2A 2GK1A 3FYPA 4PZVA 4GNKB 1A5KC 1DQXA 2QGHA 3WFAA 3TC7A 1Q7ZA 1LL4A 5DMYA 3LTPA 1HG3A 4QLJA 2G3NA 4DI9A 4H04A 3UA4A 2PLJA 5DRIA 1EA9C 1M53A 1TCDA 2X09A 2XIMA 2PURA 2Z1SA 5DRCA 4NZ4A 4FOUA 1QOPA 1J96A 3P61A 3UZJA 4O0QA 4EQWA 4PTXA 3CHCA 1F2JA 1W2VA 2R9RA 2C15A 1YPXA 2QPSA 1DJZA 1M7PA 1ME9A 1C7SA 2XSBA 1AW1A 3U57A 3OC4A 2JF6A 3MV01 4YVPA 2OKOA 2VRJA 3OBEA 1JROA 5I3FA 3PAJA 1JDEA 5D9PA 5FI8A 5ECUA 3QTGA 1JJKA 1XQKA 2R1KA 2V5JA 2EPLX 1ECEA 1G6CA 2GR3A 5E0KA 2CZ5A 1PPIA 4O54A 1U1UA 2D0FA 5FEXA 4KWOA 1QPNA 4ZQMA 2FPVA 3RLHA 2GVYA 3TR2A 5LA2A 2YCEA 1BG9A 2FIQA 4GACA 3G8EA 1V0MA 3LB0A 4XV0A 1SQ7A 5KZEA 1H2JA 2XVKA 1VH7A 1JPIA 3W1TA 5JXQA 3RLUA 3KXQA 1GPFA 2ZRZA 4IM4A 3M9YA 1S2UA 4Y8FA 4C6DA 1W1IE 1HL2A 3UR8A 4AX6A 3L0GA 1S46A 4W86A 1VDVA 1HO1A 1QI3A 1EUNA 1LQ2A 5CAHA 3TZFA 2REQB 3W01A 4GLEA 2R1NA 2PU1A 1BTCA 1FDZA 3WQFA 1MZHA 2IKGA 2HBXA 4B4HA 4HGXA 3I68A 3BC9A 1G4EA 1MEHA 2NXGA 4HYWA 1KD0A 4AD0A 2YBUA 4KFNA 3W7HA 2GL5A 4OQVA 1ZCCA 1OK6A 1XDJA 2VEPA 1KV5A 3STEA 3UBPC 5L6UA 4XIMA 1CZ1A 3FSTA 4B16A 3OVGA 3LTSA 5EKYA 5CAKA 1W54A 4W88A 2QCGA 3C0JA 3HTWA 3BZJA 3BAXA 3VMOA 4LRTA 2O7QA 4JDRA 3HIJA 3NOYA 1MZRA 1JZ6A 3FK4A 1PAMA 2E3ZA 2I57A 5FL1A 3V0SA 4LYQA 3APTA 2ACSA 5FS7A 1HL9A 1O5KA 3EANA 1R86A 2J7HA 4IIBA 1U1JA 4TMBA 3EB3A 1J5SA 3PHAA 3LN3A 2DZWA 2XN1A 3W83A 3KZPA 3LTYA 3GY1A 4V33A 4GGBA 4ZA0A 1FCBA 1J8VA 3R11A 4A8NA 2OZ0A 4PEKA 4U5IA 2E77A 1XQLA 1YE6A 2TYSA 1DHKA 2WJZA 1G67A 5FA5A 4E0CA 1QW8A 2A0NA 3N6HA 1U30A 4XKYB 1FHDA 1WKDA 2AL2A 1I2RA 4NZJA 4HNCA 1C29A 1ZNNA 4NAFB 1V0LA 1BQGA 3VIKA 3PB2A 2QCNA 1CDGA 5EFFA 2GGHA 1EXBA 3FYYA 3NRZB 1W2PA 4M80A 4FI4A 4CQ8A 3VX1A 4Y9OA 2TAAA 3POCA 2Z1WA 4DLFA 1QXLA 5DMLA 1E6SM 4ZVJA 4ZXLA 5LNSA 1T41A 2OODA 3PUEA 3E5BA 4DQWA 1WE5A 2GVLA 5FF0A 3S9ZA 1EBHA 1YDVA 4DYJA 2BLEA 2OB3A 3FAWA 3E6EA 4CNTA 1NOWA 2WK2A 1R46A 2X99A 3R10A 1TE6A 3SCUA 3GR7A 2OX1A 3TQPA 1GK8A 3KRUA 3RPTA 1RJQA 1VBRA 5I03A 3P84A 3CWHA 3B0YA 2NXIA 1I6NA 3SUTA 3R89A 4GY1A 1SJAA 3T09A 3RU6A 3WBXA 4DYKA 4UTKA 3WG6A 1XLBA 2V82A 3WEOA 1IEWA 2HK1A 2XG9A 1P0BA 4JOMA 1MW2A 3NZRA 1F74A 3ANVA 3CPGA 4LAOA 4DJFD 1DWFM 3W9ZA 1XFBA 2W3SA 5ABGA 4XD6A 2D24A 3PSVA 4W84A 4HSHA 5LXEA 4GYKA 1B3YA 2BVDA 2JK6A 1PHWA 1FH8A 2TRSA 1RQBA 1R30A 1Z3NA 4H7VA 4XAZA 3QOKA 4QE1A 2HROA 3AO0A 5HWJA 1XHCA 2VM8A 4MPQA 4J1OA 4GIEA 4BEQA 1H41A 3NPWA 2CITA 3WLPA 3O1NA 2Y89A 4P7RA 3EA2A 5C7HA 5JBEA 1NY1A 4CD5A 2PDFA 2O9OA 2HE8A 3MB9A 2ESCA 2NQJA 3VMPA 5DY3A 4J35A 1A5LC 3P6LA 5ABHA 2FH6A 2VDIA 3UG5A 2OU4A 3GC2A 2GVJA 2E0PA 1XRTA 4A21A 1UWQA 4JNZA 2DZUA 4D6EA 3UG3A 2A8XA 3GD4A 1DE5A 4I6VA 1S7MA 2PDYA 3TVAA 3WN6A 3DAQA 5SWUA 3GR8A 1ELSA 3UCDA 1TV2A 3NCOA 4IGSA 3C0QA 4NZFA 3D9XA 5CZJA 4LVDA 4M6VA 3LCIA 1SU5A 4XZ9A 3GDMA 1K4GA 4HJFA 3MSRA 1OFPA 2PDXA 3EOUA 3QGAC 1M5WA 1IV8A 4J2MA 5BU6A 4TQTA 1WP6A 1ZGDA 2D3LA 5FL0A 1ITUA 4JIRA 1W5QA 3KHJA 3BLOA 3KFTA 4JX5A 2NV2A 1Y65A 3RLGA 2ZZ6A 1O1ZA 3CQHA 1CGUA 3SY5A 2VC6A 3O2LA 1HJSA 5I3KA 2RABA 1A80A 3H2OA 1B2YA 1Z89A 1SFJA 3BLLA 5U4NA 2BVYA 3GB6A 4M6QA 3ABOA 2VR2A 1FH9A 4I9AA 4OOZA 1LZOA 1GGOA 5IOBA 3ZOAA 1M6IA 3FY1A 3NVYB 1H1ZA 1BGAA 5K4XA 4B3ZA 3TFCA 2QMJA 1XD0A 4JTCA 3UWWA 5FJIA 2EQ9A 3AJXA 1CLVA 4RX0A 4JTSA 5LNVA 3NPVA 4TVWA 5IBXA 2GWNA 5A8MA 2CLOA 4PUEA 2P50A 3L65A 4GYPA 2AGKA 2FHFA 4MIMA 1GRAA 4FXRA 5A6SA 1RY0A 1JQXA 5DBTA 3W7KA 1XV8A 3CM4A 1P0KA 3ATYA 3U8GA 1C93A 4Q8MA 2HPMA 3FS2A 4DJDA 1E6RA 5G4EA 1KC7A 2DH2A 4O0ZA 3UGRA 4XVEA 4ACZA 4QG9A 3LPPA 1YNQA 3ZWSA 3AXKA 2WMIA 4ZSUA 3NQDA 2XHYA 5F2MA 4Z1DA 4F3HA 2GR0A 3VTRA 4AZCB 5CBJA 3ARTA 3O6DA 1K8ZA 3F1QA 3LSBA 1F73A 4BI7A 1RBAA 3W1XA 1ZU8A 3CMGA 2VFIA 2CYGA 3GR4A 4I90A 2GOUA 2J77A 1ZL1A 1EX5A 5G1TA 4ICCX 4WSHA 4L9XA 3THDA 4YCOA 3SUWA 1H09A 3BW4A 4RNIA 1RVKA 1CXEA 3GXPA 1ZXIC 4NIRA 1AOGA 4ZMGA 3ZT6A 1UHVA 3MA8A 2QW5A 1LL7A 3TYCA 3C3UA 2J25A 5C9RA 2OQYA 1PKMA 2NWSA 2J62A 1KR1A 3WMLA 2O0TA 3A21A 4RE2A 1B9ZA 4HZ6A 3CUJA 4ZOHB 2QF8A 2DZPA 3LNPA 4TX9A 2FKPA 5H8PA 4KEUA 4C6OA 1TQJA 3AS3A 5CSRA 4MB1A 3PBWA 2J9YA 1OK4A 4XD5A 3WL0A 4HYRA 5C9ZA 3SCVA 4IWWA 3IPWA 1FWJC 1JRPA 3B8DA 3ARPA 4JFWA 2OLHA 2WOVA 4K7ZA 2ZRXA 2BBFA 4AIEA 5DBUA 3WD0A 1PYMA 1ZBKA 3E1F1 3CYJA 3NM3A 4DY1A 3WKZA 8CGTA 1EHAA 4R9OA 5A8PA 5K9CA 1NIUA 3WQOA 3YPIA 2WC3A 1ME7A 2WMFA 1KGXA 3CV6A 4BF7A 4DWDA 3NR0A 1F05A 4L56A 1AFSA 2O4QA 4GCXA 2ATMA 5HULA 3DZ1A 4X0NA 1I8JA 2XFYA 2DIEA 1LLOA 4PUJA 4QJ1A 3WNOA 3GTHA 1S39A 1KCLA 2OFJA 3VNMA 4IXHA 1W1B1 1IR2A 1GJPA 4ZFCA 4UTMA 1I4NA 3LPOA 1CT5A 2HNEA 4NUWA 2JF7A 4JQ2A 5EMJA 3VOFA 1TPVA 4LAZA 4TR9A 2BCPA 4MB3A 3N11A 4F0KA 2FTWA 4RZ6A 2QJGA 4C65A 4DBDA 3P60A 1W5NA 4NEWA 3O8AA 7ODCA 1GOMA 2Z1VA 4PFMA 1E56A 4LUYA 4ES4A 1PKYA 2YL6A 2IPWA 3W02A 4QITA 2EG7A 2XIJA 3G0UA 1PX4A 4JCMA 1V6XA 4R9XA 4RE4A 1XC6A 3WX7A 4QG6A 2J27A 3N3MA 1K1DA 2PTDA 3MWCA 2WVVA 3K8KA 3B0UX 1E0XA 3LBMA 1RALA 5J04A 1ZY8A 3UWUA 3T7VA 4A6GA 1U1HA 3LOTA 3MJYA 3DG6A 2CWXA 1WNOA 3MKCA 1EPVA 3V5FA 4H7CA 3EWUA 2GDUA 3ANUA 2YCKX 1IWBA 2WAGA 2ZUWA 2J9ZA 2PRHA 3MBFA 4YTUA 4O28A 1XLKA 1ZP3A 2ZE0A 3VK5A 1KM6A 1KGUA 4AB4A 4BR1A 5JU6A 4X0VA 4WX2A 5C5YA 2OZTA 3I3BA 3UNTA 1TIWA 4UQCA 5I3IA 2WHMA 3R12A 4IHCA 2RKXA 2DJXA 1AJZA 4E2OA 3G24A 1L0PA 3QR0A 1A5AA 2GR2A 2AMGA 2GJXA 4UTFA 4TV6A 2HDJA 1HW6A 4ZOBA 2JGQA 2D2OA 3RMEA 1TWDA 1IEXA 4BY3A 4FX9A 1TSIA 4Q4PA 3NFUA 1VYSX 2FYMA 2I9UA 3BCFA 3L66A 1C8YA 1GQIA 3DHDA 5A2AA 2TODA 4IH3A 2NX3A 4Q4KA 4CD6A 5LNUA 3CAKA 4G7EA 3HBLA 1K8CA 5EBAA 2QJIA 3IJLA 3P82A 1EF2A 3STPA 3W0KA 3G3MA 3BO9A 4GIAA 2GVGA 4US5A 2DZAA 1CB2A 1GKRA 1XCWA 1XLGA 3W7EA 3MP3A 2GUYA 1LOQA 3W7RA 1RCXB 4C91A 2E40A 3GDBA 4JTFA 2ZC8A 1UCWA 4CEXC 2V63A 3DJGX 2E6DA 1RAKA 1VFTA 1R9YA 1U5JA 2BVWA 4TO8A 1EA0A 2DT2A 2A2IA 3NQVA 3SDOA 3IGUA 3NPUA 4N9EA 4EAMA 4S3GA 4YVVA 1H50A 2YDQA 4CD7A 3KW3A 2UV8G 4CVWA 1TV4A 3O63A 4QEHA 2JEQA 3DESA 1YXCA 2O92A 3CO8A 1BYDA 4HPJA 3H2CA 3N12A 4L6DA 1PYFA 4JX6A 3DFNA 4R7OA 5DT7A 3AMLA 3UZXA 3DJJA 2J6XA 4XBSA 1OWQA 1V6YA 4ONVA 2ZX5A 4CN6A 2CXEA 4LY4A 3QY7A 1WXJA 2HVMA 4LUJA 1EL3A 1UOKA 1UP0A 2FLIA 2YCLB 3THCA 1NWTA 2ACUA 1RY8A 3VI2A 3RNMA 2JKAA 2J6VA 4HOXA 3IUHA 4WHBA 2VR5A 3G77A 4AZHA 4KRTA 2PDPA 2HXUA 2A7NA 3OIHA 4FLQA 2IPFA 3UVAA 1EC8A 5CH9A 3SSJA 1SFSA 1UD6A 4WLCA 1UD8A 3AYSA 3LZ3A 1MNSA 1RPKA 4F0RA 5IM51 4L6HA 1S2VA 1LG2A 3CK5A 3MMWA 1H7RA 2OO0A 3ZT7A 3ZYZA 2BHUA 3C2YA 3K2GA 1EEPA 1JNDA 1XBYA 4IFRA 1XYFA 2RGLA 5BW6A 3REQB 4HPHA 4IQLA 1P43A 4NXSA 3BL3A 1NVMA 1TJ2A 3MMUA 3PZUA 4O1DA 1GESA 4DUOA 3EMQA 4H9ZA 4CU6A 3VX0A 3QM3A 1I2OA 4IMAA 3H2EA 3LQLA 3IIZA 4IIFA 1OF8A 1ISYA 3ARRA 3S2NA 1F8MA 3NZPA 2V5DA 5KZ6A 1XDLA 2F9RA 2XIOA 2XGZA 3M0JA 3WUGA 2PBOA 4MY9A 4UTHA 4H4QA 1KCXA 3UWEA 1BKSA 5C2CA 2BHYA 1AUSL 1EDQA 1Q65A 4WJ8A 6A3HA 3AS1A 3WSUA 4IMEA 3EXTA 5I77A 1HP4A 1NOUA 1H0GA 1F61A 1W9UA 4KIEA 2ZZCA 1XKJA 2DV0A 4MG4A 4UTUA 2VELA 4HTYA 1M65A 2E5BA 2JKPA 2ABBA 1K3UA 1ZQ5A 2XSAA 3CUHA 5DT5A 5CPQA 3MTWA 4RUBA 4YU1A 3TW7A 5F4XA 3ETRB 1OZQA 3KVLA 3CGTA 3R2GA 1OT1A 1YHTA 2L5HA 4J3VA 1DEDA 1TWSA 2HZGA 1GRFA 3TN5A 1DV7A 3WH9A 1YRRA 3KZSA 3O15A 4Q8NA 3D3FA 4LEFA 3SY1A 1ADSA 3BANA 2XU2A 1T6MA 3GVQA 4O1CA 2QUVA 2X0SA 4RV8A 4KW2A 2VWTA 3KS5A 3S2JA 4HOZA 3QTPA 4DRSA 1KFKA 5JCIA 4PYSA 1PL9A 3WLNA 4OV9A 5RUBA 3ZWTA 2DQWA 4U10A 1EPXA 2ZUSA 3RR1A 3G2GA 3GBDA 3WNMA 3UWYA 4XAPA 2R9ZA 3MW7A 2W0UA 1NHRA 1LQAA 4NNBA 1XC4A 4NZCA 3VC6A 3L2MA 4GISA 5ECVA 2WPBA 1UC5A 4O1AA 4UR7A 1G7UA 3ABRA 2YYTA 2PODA 4HZ8A 1TTQA 4NJGA 1EO5A 1KO0A 5EFDA 2AAAA 3CUZA 3P5ZA 3N2OA 5CCZA 1ZENA 3VKBA 4ZQRA 5DANA 4H9XA 1DORA 2GGEA 4GR1A 3KDNA 3TONA 2VOMA 1A5CA 1IT8A 4NNCA 2I5GA 4MNKA 2G0WA 2YLLA 3EX4A 3UW6A 4UQBA 1UA3A 2ZZ1A 4IPPA 4B5SA 3AS2A 5MKGB 1IXPA 3CV1A 2CERA 1H0IA 4MWAA 1JCXA 1FCQA 3W84A 3C5QA 3LERA 3VU2A 1GHRA 4N02A 1ZB5A 3AQUA 3NAVA 3GH7A 2QGYA 3B97A 1L8NA 5CZKA 1F8WA 2WP5A 1J9YA 1ISZA 3KBMA 3W81A 1OIMA 2E5AA 3VIPA 3MDUA 1VAHA 1WAWA 4UFIA 4EP8C 4R85A 1W8SA 3STFA 2CU0A 2D20A 2DZSA 4QGCA 1YQ2A 4TU1A 2V3AA 1JZ8A 3DC0A 1YIXA 2PF0A 1NJJA 4LCQA 3O3RA 1X1OA 2REQA 4D6GA 1VFUA 2J4GA 1I45A 4GG9A 1H1NA 3EDEA 1FFVC 5ABEA 3P7YA 3GH5A 4JYFA 3NQ6A 4M7SA 2W67A 2Y0FA 1JCNA 2WP6A 3OOQA 4OUIA 4ZODA 4QR6A 3CBWA 4KWVA 4IMCA 2ZA1A 4I9TA 3HGRA 1TMQA 4K68A 4NF7A 3KLJA 2PLKA 3M41A 2V5KA 3W28A 4CCEA 2GJNA 1XW8A 2EJ1A 1LPFA 1FKXA 1G94A 4F40A 1OJTA 3JZUA 3IK4A 1OFRA 2DU2A 1YPIA 1UR2A 4U3CA 2Z0IA 3MO4A 5M03A 3C0SA 4IX2A 4DJDD 2ACRA 2P8BA 1YBQA 1QNRA 5BNKA 3SQSA 2YVJA 1I1WA 1VFHA 3NYDA 3NQ7A 1EXPA 4LA1A 4DBWA 5U7SA 5GRTA 1H4PA 3RU8X 4NY2A 2WNZA 3B9EA 4DO5A 4ORMA 4IG2B 4XBKA 2ZVRA 4KCTA 1MUMA 1W31A 4QS6A 1B3XA 3TU9A 2XISA 2VZTA 3FHAA 2Q8XA 2DJLA 4W9TA 2G95A 5K9DA 2AMXA 2RAGA 4DF2A 2OGJA 2CFFA 4PMQA 4HPNA 1KFWA 2D73A 3B8SA 3TEVA 2ZTJA 5HJLA 1IEQA 1XLMA 4HNLA 1J0HA 1N61C 3PBYA 2I56A 3OGRA 4KBXA 2RH9A 4IMFA 4RDZA 3IVSA 3VOCA 4UFJA 1VJIA 3N6QA 2BZNA 3MUXA 2R1LA 3QEZA 2BOFX 4V2XA 3AICA 2XJ7A 5EU9A 4M29A 4NT0A 3WBAA 1OSEA 4MYAA 4GI8A 4LW7A 2QCEA 3SN0A 2DSKA 4MKVA 1KFEA 5D2XA 1MVYA 1RSCA 2W79A 4DB7A 2FVLA 4H1ZA 1FECA 2XFRA 3U4AA 4Y9MA 2V81A 1BFNA 4TTUA 5DXXA 4C6IA 3W1UA 3BW2A 3O6CA 1ODZA 1DQWA 1CGVA 1HIZA 1UBSA 4O1EA 1DJQA 4S3AA 4WSJA 4AIBA 4C5ZA 4PTDA 4H9MA 1M7XA 4DAIA 4K1GA 1EF3A 3UXKA 4B5UA 4UWMA 2G96A 1XD1A 1EIXA 3G0SA 3GDKA 4APNA 4FSAA 4HPGA 3BW3A 4KCVA 4IIGA 1GRHA 1VS1A 3KVKA 5I06A 1K77A 3OTRA 1GETA 1XIJA 1FTXA 3H4GA 1G4PA 1BHGA 1G01A 3N18A 1ESWA 4EE9A 2QAEA 3TA6A 2B4GA 3VM5A 3A3XA 4Y8EA 3TXVA 3UY8A 4MY1A 1RQEA 1JEZA 3HURA 4R53A 1Q6CA 2VZSA 4X60A 3S5SA 5KVIA 3M07A 4WGXA 2HS8A 1O1HA 3T0BA 3OZPA 4R7WA 4QXIA 4Y7EA 3FJLA 1VF8A 4PMOA 6XIAA 3D3AA 2B81A 2XTKA 1A3XA 3FSUA 4DUVA 5I3HA 2CBUA 4LYRA 1T8XA 1KCKA 1PSCA 3DENA 1NFGA 4DO4A 1GVQA 2ADAA 3EX6A 4Q4OA 4DXVA 2GJRA 2YCIX 4AEFA 2ZX6A 3IWPA 2XPKA 2FQIA 3OQ8A 3TFXA 1MNZA 2EPHA 3LB8A 3AYTA 3AZRA 4JICA 4IFOA 1GVFA 3LCGA 3NSXA 4LBSA 1O5RA 2BY1A 4CCDA 4HYVA 3WELA 5HMFA 3JVAA 1MEWA 2GGGA 4LVFA 1SZEA 4GQRA 3TWAA 2F2HA 1KRMA 3CYVA 4WXZA 3T2QA 4F0HA 4GVGA 2CBJA 2VGIA 1XRVA 4AX7A 3CV7A 2ZUMA 3SADA 1A0CA 2QUMA 3NGFA 1GPWA 3R8HA 3TW9A 3L12A 4GI9A 4LRSA 1XUUA 4IUOA 3WO8A 5GQBA 2EHHA 1IXQA 3SQMA 2FGZA 3AXMA 5E70A 4UQEA 3EEZA 1T99A 5CBIA 1GVYA 3G6LA 3RCNA 2XZ9A 4ENLA 4J5NA 3JR2A 1W9XA 2YBTA 4FX6M 3ZS4A 1Q8AA 5A6BA 3CL8A 4GVHA 5A8QA 4LS0A 5E6ZA 3LLFA 4FP1A 1TX0A 4MNJA 5AHLA 1VRDA 3RM8A 2AKMA 3PWIA 5ABTA 3MSYA 3C3NA 4W7WA 1IIGA 1XYBA 2QCDA 2GQ3A 3LXAA 3HMCA 4UOQA 4DJED 1VIZA 2QKFA 3A13A 1WO2A 1EDGA 2VL4A 2Q6ZA 3CQ0A 4M8UA 5FF4A 2W54A 2AOSA 2VCBA 4A29A 2Y85A 1A5NC 3GC4A 3AXHA 1L2QA 3T2PA 4AC7C 4FXJA 2A3EA 3PZVA 4XAFA 1RR2A 3GU1A 4AIUA 1ZDLA 4LSBA 1FDYA 2HXTA 1E71M 3BMXA 3L4YA 3AFBA 4US5D 4WY0F 4MGGA 2OMAA 1MO0A 2ZWYA 2P8CA 5HANA 3AM9A 1GVOA 3TTOA 4YLWA 1QPOA 4JHZA 2CHNA 1R5YA 4TX8A 4EQXA 2W4XA 1J0IA 3PJTA 4A3HA 1MFUA 2DEPA 4PUMA 1I0BA 1V97A 2EF9A 6CGTA 3IJIA 3TYUA 1XPYA 2FPYA 2UZ9A 3LLXA 1Q1RA 1UKSA 1OEPA 4K8EA 5C55A 4GRTA 3RN6A 2WMHA 3XINA 3PZTA 3GHRA 4K38A 4P8XA 3DC8A 3IAQA 2F84A 3UG4A 4AW7A 3R58A 1JFHA 1V4YA 1UR1A 4YWOA 3F2CA 3EDFA 3C6CA 2J7CA 4KWWA 3PJUA 3MVTA 1FWWA 1BGGA 4ZGYA 2ZZ3A 3GNNA 4LBRA 1X2GA 1JQVA 2BVTA 1YTKA 3RILA 1AQHA 2YGYA 2NLIA 5LYRA 4LY8A 1LVLA 4L1GA 1IT7A 2W27A 4I8YA 2ZZBA 4LC6A 4DWSC 4ZB5A 2W55A 5KZMA 4HU4A 2XH0A 5EB8A 2EPKX 3WF0A 1V77A 3O0KA 2Y8UA 1TV8A 1VP5A 2V9DA 3AUJA 3N3TA 4NVTA 1QHZA 3I7SA 1W1VA 3NQEA 4OJYA 3GAYA 2TPSA 1QR7A 4RK8A 1Q6DA 3RX2A 2Y7GA 3W7QA 3M7SA 3E0IA 4NHVA 3T8LA 3M0YA 4HKPA 1PXGA 1YQZA 3BQ5A 1YYAA 1F6PA 3TYBA 1ECQA 3HPSA 1GT8A 3M1ZA 3QY6A 4UCFA 2J13A 1XH0A 3RM4A 3AS0A 3SECA 1B9BA 3VNKA 3QYQA 1XBXA 1S5WA 5DCEA 4MKSA 5I23A 1H7OA 2NUWA 4DIAA 4REQA 1C92A 4QLLA 3L2LA 2GR1A 4X61A 2AL1A 4DO6A 3Q65A 3IIOA 1FWCC 4M3PA 4PRRA 5K7JA 1GEQA 1V02A 4B5XA 1W5PA 2XZ7A 4HCHA 5BXRA 2BXYA 3CUXA 1DNCA 3GVWA 2CKRA 2CLHA 2P10A 4JEJA 5AC7A 3SCWA 3T8QA 4AD4A 3OW1A 5HNRA 3URBA 4JQ1A 8A3HA 1P6CA 1NPXA 1XYMA 1EHNA 1VJSA 1ZMDA 1FCVA 3ZZ1A 2PBGA 1XKYA 1GQNA 3GWQA 1SZNA 1YADA 1RJPA 1GEUA 3KCOA 4OWGA 2Y7FA 3QF0A 1J0ZA 2BGNE 1XCFA 1S2CA 2VYOA 4POCA 1DKWA 3OO2A 3BLPX 1W1YA 4A3UA 5TQLA 3QMSA 1FH7A 1JCTA 4HTBA 3ZSTA 4W8AA 4QJ5B 4KERA 2PDJA 5FEPA 3M0IA 4WKAA 4JL2A 3Q37A 4ML4A 3KS6A 3VABA 3WJYA 3TYZA 1QNVA 4HMNA 4FXSA 4FF7A 2DT0A 4EWJA 3HGJA 2OX4A 1NHSA 1PVNA 4W89A 2C14A 1OM0A 2VC5A 3SN1A 2YZRA 3GDLA 4D1IA 4GZIA 4UC5A 1N7KA 3A3HA 4JTIA 4M52A 4INFA 1JZ3A 1HNYA 3NQMA 3QRHA 2DZTA 4D6IA 3TROA 3CNYA 2Z28A 4V27A 2C18A 2FGLA 3VDAA 3THUA 3WZ0E 1IZCA 1QDSA 2PWUA 2NUYA 3AMZA 4MNMA 3L4ZA 2BWGA 3OB8A 2IQDA 3GVGA 1CENA 2NWRA 2VOTA 2FTPA 4AY1A 4CQAA 4JTAA 2CLEA 4RV3A 4NG3A 1KWKA 2DW6A 2PS2A 1RK6A 4WJEA 4DF1A 1L2UA 1LOLA 2CC0A 1H49A 1DTNA 1XGDA 3L8KA 5ENLA 4JYEA 4DWSB 4UIOA 1BWLA 5BMWA 4CNSA 3WDQA 1R3YA 4FHAA 1U2YA 5K3VA 2WSPA 3VIHA 3USBA 3FAXA 4MLRA 5I00A 4IXXA 1UMLA 3BLKA 4EANA 2E4TA 3ZJKA 1Q3NA 4MOZA 2NZLA 5FESA 4QX4A 2J8FA 1JPKA 3R25A 2X7VA 4JIQA 4A22A 3O0HA 3UA3A 4N6EA 2WM1A 3RRAA 1MYRA 3CJPA 2FZNA 2PDHA 4ZOEA 4EAYA 1E40A 1VLWA 1HL8A 3WQ6A 1B0IA 5A94A 2WNWA 1GJUA 5HJXA 1R2RA 2E9MA 3INPA 1Q7QA 2I7GA 4H4PA 2WXDM 1QI0A 4HD5A 2VENA 3C2OA 3ABXA 4C60A 1OADA 2J7GA 4HHHA 1X6UA 3IACA 4D72A 3WUBA 1JGMA 1K8XA 4IF2A 1TELA 5HWMA 5AZ0A 4TUFA 4C1LA 6REQA 5I3JA 1MDLA 1VKFA 3THQA 2P88A 1JULA 2X41A 4E4PA 1YLVA 1KBJA 3N2XA 3LZ5A 4LYKA 3B3DA 4C6QA 3TOYA 4U28A 1OX6A 3AHTA 4FNPA 1J6PA 3BGJA 5CG7A 2O7SA 1XFCA 3L4WA 5U25A 2WCGA 4FO4A 5C9WA 1PHQA 1XSJA 4GMEA 2NV1A 2EBNA 2IXUA 4CNUA 3BJTA 4AU0A 4EMIA 4MF4A 3I7QA 3E2RA 1Q4WA 5EY5A 4H01A 3PUGA 3I3EA 4OUEA 4CQDA 3SJ3A 2V2HA 3NXLA 5A6AA 4QJ4B 3F4VA 1L6FA 3QVQA 2ZX8A 3E38A 1DJIA 2Y7DA 3UJSA 1Z69A 3ES7A 1UP2A 1BSIA 1FKWA 2G3IA 4OFCA 3S83A 4S3EA 3C2FA 2OPJA 3FA3A 5JCLA 2NVAA 2X1IA 3W2KA 4BQ3A 4KEVA 1FEBA 2NVCA 3WF4A 3PS7A 4NJKA 4JIIX 4Y6GA 5AVNA 1K9DA 3TQ0A 4GC4A 2Q71A 3FKKA 3GH4A 1W3IA 1XS2A 2PDKA 4HHMA 4PMYA 4X2PA 4ADSA 3C52A 2W6RA 1Q66A 2OR2A 2E8ZA 3MYOA 3VC5A 1PE1A 2ZADA 1JPMA 3SIZA 2W9MA 2X05A 2NX1A 4MVAA 2ISDA 1Q2RA 5E0CA 3G8RA 5HOSA 1BD0A 4XZHA 3W1PA 3LGGA 4UFKA 1GERA 3HV8A 4PRWA 3L4VA 1QO5A 4U31A 3TCSA 1LBMA 3W85A 4BA0A 1AQ0A 3L4XA 4JTGA 3CHVA 4U5KA 2X8RA 3H7RA 2MANA 3TC6A 4JXCA 3FOKA 3TAOA 8TIMA 1JXKA 4KGLA 4KRZA 2HK0A 4N6FA 5LIYX 1GRTA 3NUKA 2FFCA 1BWKA 4X3ZA 2WZIA 4RZ4A 3KOZA 3UZYA 1MQRA 1A5BA 2ZXQA 5GJMA 3CGDA 3BTNA 1YTDA 4PCFA 5FS9A 4UNIA 1MQQA 2PZNA 3H6OA 1PO9A 4TVCA 4HMDA 2WHKA 1FHVA 1WKEA 2E28A 3MJMA 3PSWA 4JL1A 1OC6A 2X7WA 1C8VA 1H7WA 2WNQA 4K8HA 4UTTA 5DCDA 1AW5A 3ES8A 4RDVA 1RBLA 2EQ6A 4ASTA 4ORIA 3WK1A 4UR9A 4ZFMA 4JTEA 1PX3A 5HMDA 4RDWA 3VE7A 3AXXA 4FS9A 5G1MA 4N9CA 3O16A 3WQGA 4FLSA 1R47A 3LS9A 2VDGA 1LQ0A 3L4TA 2LLEA 3F5JA 3P5YA 5JQ9A 1OY0A 1EEXA 5I0DA 4K2SA 4EXQA 2OSXA 1DIDA 1F6KA 4QNWA 4MJ2A 2E68A 2V68A 3U48A 3WLOA 3F4DA 5K4ZA 4OBSA 1TYPA 1BRLA 2RDWA 3H2FA 1KM0A 3MT1A 4M1BA 3KVMA 4XK2A 2IKJA 1KTNA 1FRBA 5DMNA 2EPMX 2I5QA 5M3WA 2XIBA 3NYZA 1OF6A 1JZ4A 1ZZMA 4BI5A 3VGDA 7REQB 5CGQA 4D2JA 1GREA 3PTQA 1V3KA 2ZXBA 3DYOA 3LBCA 1B3ZA 2C16A 4ZSTA 4UBPC 4B9ZA 3L67A 1PBGA 2VZOA 3MP4A 2VX5A 4EPDC 1EGZA 5GNYA 1QI5A 3POHA 3LCWA 2VO5A 3HN3A 4XISA 1IIHA 1VCVA 2GYIA 3CZKA 3FGCA 3IK2A 1TPUA 4MB4A 4C1NB 1IGWA 4I6KA 4X2RA 4NAEA 2FZDA 3HPAA 4Q8TA 1E6ZA 3OBKA 3UCQA 4L4LA 1NHPA 4QCEA 3SCPA 1FA2A 3S46A 3TKFA 5BYWA 3WMSA 4BFAA 1J0KA 2V2CA 2B7QA 3NWRA 1UPPA 3V36A 1RK5A 4MKNA 1TYTA 5IFPA 2XINA 3HG3A 2YVFA 1EJTC 4H9VA 4MM1A 5LHFA 1EGMA 3KUMA 2ZTKA 1U83A 4EMWA 3W3OA 4JNMA 2R91A 1BSLA 2QJNA 5HPCA 3WLHA 5MHBA 1ZCOA 3H22A 1OC5A 2PSNA 3KP1A 3EOSA 1N62C 3L5LA 3C2EA 4NX5A 1SVDA 3N73A 4GNVA 1Y5XA 4JN7A 3WIJA 1PIIA 4IQDA 1FFUC 5U1OA 3NQBA 3TTQA 1W3KA 4NZ1A 2YXGA 3TV8A 1JUBA 3THAA 3EPNA 1IT0A 3E49A 4KMQA 3WH8A 4JNYA 4IMGA 3MCNA 2HE5A 4ERIA 1WXZA 2GQ9A 3CUFA 3S2LA 3VDBA 2V69A 3T81A 3LHYA 4GO9A 2BY3A 3W7PA 4YIWA 3PC0A 1HF6A 3S1XA 4ICNA 4MZ1A 1KWGA 3KVJA 1FWAC 1R85A 1Q45A 3FJNA 1XIDA 1BYBA 3A47A 2C6QA 1C90A 1XP3A 4OVXA 2OG9A 1LCOA 4XG1A 1F4AA 1QW7A 4PA8A 1NF0A 3ARZA 5B7YA 4XUGA 1QBBA 5JBFA 1E3ZA 1OX4A 3II1A 3CUIA 1XIGA 4HB7A 4K36A 3GNRA 3CH0A 3F7JA 1LLWA 1TPDA 3AYRA 2PCEA 1O4UA 4IIEA 2WBAA 1UWIA 2A1YA 3CIWA 1DL3A 5KITA 4H7ZA 1HVXA 2WPGA 3KEHA 3PVFA 3NA8A 1TPFA 1Z7AA 4GO8A 1XXXA 4V15A 2POZA 1C9DA 2VGFA 1VRXA 4UTWA 3W7GA 3S47A 1HQTA 4FXFA 4J7RA 2EAWA 4JYDA 4IIHA 1P7TA 3M44A 5AYBA 3MKVA 3EGJA 3DH7A 3PZOA 3DK8A 2VRQA 1R2TA 3BVJA 3AIBA 2E25A 1WX0A 3BSGA 3SUSA 1OYBA 1TVNA 1I60A 3QMTA 3R0DA 2D23A 4S3FA 3N17A 3ZVHB 3SRFA 4XZMX 1X98A 2WVSA 2WKLA 2VEKA 2VC7A 1JDFA 1I1XA 1EZ2A 4BF5A 1V6UA 3TSDA 2WB5A 3W7NA 4JGDA 2CXGA 5BRPA 4DN1A 2Q02A 1B1YA 3QW4B 5BU9A 4FIRA 2YLAA 3GC5A 3CZGA 3U7BA 3UY7A 4RPPA 3TP4A 1H63A 1XYLA 1KLYA 2VHLA 4N0RA 4AQLA 3ABQA 1NARA 2QEZA 3GBEA 1KM5A 1D7KA 3RPDA 1FHUA 2A3CA 4A2SA 4GZJA 3BV7A 1ZBCA 1IWAA 2OZ3A 3DX5A 5E09A 3OA5A 4M56A 3COTA 2OJPA 2PI6A 3QGKC 5C71A 3P81A 2VD9A 4CEUC 2Q3RA 4A8IA 4FX7A 4YWIA 3N4FA 3SBFA 4ZQOA 5EMUA 1GW1A 3IIVA 5H8UA 4XTIA 4MB5A 4ZQPA 4JY9A 1W3LA 1O66A 4IPLA 1XBVA 2MUCA 2Z2AA 1KB3A 4ROPA 1K02A 4R7JA 3WLTA 1P48A 1W1A1 3GTXA 4DELA 1WYIA 2VI0A 4UOJA 3K4DA 5D9MA 1OVDA 4OIFA 3HQNA 4DUWA 2YDRA 5J5RA 1C91A 3PULA 1K4HA 4Z2GA 5I5RA 2YAUA 2QVHA 4M82A 1FO4A 3H4KA 1TCMA 1EB3A 3ZT5A 2Z2UA 3WLQA 3BXWA 4IQJA 4LCSA 3RXZA 4NP7A 4IGHA 1UUQA 3FA4A 3IVUA 1F7BA 1GXFA 3VIIA 5CLWA 1XRSA 3LYEA 3TWBA 3W7IA 1VCGA 1QNQA 2UBPC 3S42A 5CPLA 3UPBA 4GUHA 1Z32X 2QCFA 5FJOA 4FNQA 4YHGA 1EOKA 3VFLA 4E6MA 1N5XA 1FWFC 4NI3A 1UH2A 1JUEA 3EEGA 4G1KA 3S5OA 5A6JA 4GUJA 3DEQA 4C6EA 2X8HA 3BCJA 4NZ3A 4GYJA 5C54A 3RJXA 1L6YA 4S2CA 1K6AA 1HZYA 2DGAA 3USZA 2X30A 2FH8A 1LP6A 1XLHA 2C3DA 5A6MA 4EMJA 5CPTA 1TG7A 3ISIX 3PJWA 1NWSA 2HISA 3W29A 1PB0A 5GNXA 1P6BA 1J6OA 2VZVA 3CAQA 3VD7A 1V0NA 2I17A 3LRMA 2G3FA 5F2IA 4IFKA 3AIQA 2W92A 4B91A 4O17A 1EQPA 1A53A 1DWHM 2DIKA 3ENLA 4RJEA 3WENA 5TR3A 3VOJA 4E2VA 4UNKA 3I4EA 1S5NA 5F2GA 4QE5A 1V5XA 2J88A 1JVNA 1WUFA 5H2ZA 4H2HA 3L2IA 4A05A 2Z7GA 3KWSA 2C19A 2CFYA 1H5YA 3IJ9A 2J66A 4M7TA 2WHLA 1V08A 3WF2A 2EQ8A 3VNDA 4XZBA 4PB3A 3M0KA 3T1GA 3CHDA 2DZVA 5E93A 2W3ZA 4M24A 3EA1A 1LROA 1Q7MA 2JFEX 2Z2BA 5E0FA 3TCEA 1GJWA 5A95A 1IEIA 2P53A 3VKDA 3W70A 3IANA 3W82A 5A5WA 2Y4SA 1NWRA 1WZLA 3C4UA 4C90A 2QIIA 1DIKA 1KLZA 5AC4A 1TPC1 2WYSA 3C8NA 1Z42A 3WK0A 3LPGA 4CVUA 4D1JA 5G1YA 1I9CB 4MFEA 3KCLA 3H21A 4C5YA 2DSZA 4CQ9A 1WKYA 4LNYA 4LUTB 3V18A 4J4KA 2VFGA 4OZOA 1TVPA 4WY0A 3HGSA 4JKLA 4O4VA 4HQVA 2Y8VA 2Y70A 1W1PA 2GK1B 4XX6A 1VZWA 1WDQA 4HNOA 4ERAA 3OLEA 3LI0A 4RKAA 4KF1A 1B90A 2O56A 1UD3A 2GSEA 2WWDA 5CJNA 2WOWA 3QHMA 3M46A 4XSMA 4A8LA 2VGBA 1JL8A 1KFCA 2PDLA 2VUNA 4NZ5A 5G2HA 4F4RA 3KTCA 4R33A 4WK9A 3F5LA 3FW6A 4IMDA 5H8MA 5KVHA 1N60C 3ECQA 3D5HA 4Q6XA 1MRAA 3IGHX 1G0CA 4NRSA 7A3HA 1CTNA 1CBGA 4PSRA 4B5VA 1FP9A 1TRDA 1U5HA 2XN2A 2PP1A 1JDAA 4Z2JA 4QSHA 5TBOA 1V79A 1JRBA 4EM4A 3TH6A 2WSRA 5AVHA 1D3GA 3UZWA 3W6YA 1N2VA 3VM7A 1EIBA 4EM3A 2A6NA 3W2NA 4G56A 3N1AA 4E8GA 3A4AA 3EMZA 4AZ6A 2PWDA 1OJXA 3RCMA 3W7LA 3BSMA 1ZK7A 1EH9A 1J01A 4JS3A 3TTYA 1QU4A 3O6AA 3GQYA 4QJ3B 5E1QA 1VYRA 2JQXA 3EWDA 4NNAA 3BOXA 1XICA 3TLLA 2D2GA 3N4EA 5AC8A 1V7YA 4IICA 4NRRA 1R8LA 3D46A 1V93A 3ITXA 1GV4A 2P0OA 3GG7A 3SRDA 4GQ0A 1ZS2A 4MYXA 2PU0A 4O11A 4KPLA 6PTDA 1LF1A 1YKWA 1AG1O 3LGDA 4FNRA 4PMJA 2PWVA 3WUFA 3BMVA 3L7RA 2POTA 2XDFA 1C3FA 1JAKA 3C2RA 2NX9A 2BFGA 4PEEA 1SUXA 2GUUA 2JALA 2CHRA 2RFGA 4DUXA 1R7AA 2G37A 5HPOA 1UWRA 4YTSA 3I7RA 3QW3A 9RUBA 2WZMA 1XG3A 3HU7A 4G7FA 2HVOA 1UH3A 1M6JA 2H8ZA 2A7PA 1VBUA 2CESA 1KKOA 4L65A 3S9IA 3OYZA 2VEMA 4GK8A 3OG2A 4C6JA 2PFHA 1V3MA 4HHPA 3VIMA 5FEWA 1BZLA 3SRHA 4AMAA 4GY7A 4O15A 2OOFA 5LGZA 1VJZA 3GG1A 2ON3A 2SFPA 3FEMA 1XYCA 2C0HA 1Z6KA 3QHNA 1UW9A 3R13A 1GG1A 4AYSA 2JE8A 1T5AA 4S1FA 2G50A 4UMAA 2HPIA 4RNJA 5XIMA 3T55A 3PAOA 3UXLA 1YTEA 4LB3A 1AL7A 1SZFA 1FWHC 3QR1A 2YBVA 4PFHA 3VZZA 1GNXA 4F0MA 1R9XA 4E2DA 3SQPA 1DXLA 2AL2B 2UY4A 1DQUA 3W23A 2DZXA 1M3UA 3V1HA 4AG0A 3KL0A 1ZP4A 2QDEA 5AZ1A 3GZAA 4YL2A 1RD5A 3NEHA 1XBZA 1ISXA 1UWSA 3RJYA 1UB3A 3GK0A 2QUNA 3NURA 3FG2P 5LIXX 1D2KA 1R7OA 1XHGA 4HVXA 1HVQA 2D2JA 2OT1A 2VR4A 1FWBC 4LAKA 4LALA 2GGJA 3T05A 2PWEA 1ONWA 3BURA 1FWNA 1VHNA 3PJXA 1WDWA 2WVUA 1HJUA 2BP1A 1B31A 1J79A 3E2QA 3GNDA 1KQYA 1OBAA 2Y24A 3GUGA 3GIQA 1SW7A 2OYMA 2BXZA 2IKIA 2WPEA 1PDZA 1T0OA 3EKZA 4N4QA 4UZUA 2QLYA 4Z08A 1K7FA 1X6NA 4Y9AA 1MDRA 3DGRA 3PFRA 1L6WA 1C9WA 3WDPP 3HF3A 1E3XA 3IJQA 3KE0A 4DXKA 3RCYA 2CHOA 1Z8AA 5A8OA 3S1GA 8XIMA 1DWGM 1JYXA 3RYSA 1OQFA 4E4FA 4LYPA 1R38A 1GUVA 3J7HA 2YB4A 4KESA 1VHCA 3PBUA 4S3JA 4M0XA 4WDTA 5LIWX 3BGAA 4O53A 1KFLA 1UZ4A 4FK9A 4JBRA 1PTAA 4DZAA 3TYAA 4PN2A 1UPMB 1E1CA 3IVTA 3NIYA 3OVRA 1GCYA 3SR7A 3CLMA 5REQA 2WW5A 3D0CA 1FWGC 2ALRA 1QNPA 4J56A 1EOMA 3C61A 5M2FX 3MI6A 3QFBA 3S3GA 5D2WA 3STGA 1K03A 4C6CA 3FXYA 1V6WA 4AWSA 4ZOCA 1HJXA 4EKJA 3S8HA 3GHUA 3QZEA 1I2NA 1OHLA 1RVGA 2VC9A 3W6MA 3UPWA 3AJ7A 4ZQCA 2VDHA 4FDCB 5E9XA 1KBKA 3SAZA 2E67A 1X8FA 1RJRA 1RP8A 2V3FA 3LDVA 3O6YX 3QPYA 3E12A 4B90A 3ITLA 1QNOA 2Z4GA 1UOZA 1XIMA 2HVNA 5A8NA 3ARYA 1JPHA 3MANA 3H7VA 4I9JA 2QUUA 1E72M 3MZNA 5LIUX 2YZ5A 3Q67A 4L4OA 1VFOA 3F4WA 2A5HA 1E0VA 3O07A 2CKSA 4QFUA 4EPEC 4YXGA 1JUKA 2X0HA 3OGVA 3GRSA 4LV9A 3SW6A 2ATSA 3R1ZA 3T9PA 2AAMA 2V5LA 2H9AB 3AYVA 3W1QA 2WPCA 1QK2A 2OXNA 2WOQA 3DCPA 3UNDA 4UMBA 2PGEA 3OODA 4DM2A 2FB3A 1JD9A 3L5OA 5CZSA 4Q4RA 4RR4A 4ADUA 1F3XA 5DO8A 1PZ0A 3HB9A 4LGXA 4Z1YA 2RJGA 4KCUA 2R1PA 4GPNA 3A64A 3RFAA 3KDOA 2UY2A 5D8WA 3LCXA 1RLDA 4I5XA 5FJUA 3I10A 3NQ8A 4WOZA 3PTKA 3UZZA 5D37A 3WJWA 3DUGA 2FHCA 5CLTA 4NJHA 4AWEA 1VBHA 3CQIA 4YTRA 2I1OA 1GYNA 3EBVA 3WQPA 1JZ7A 1GVEA 3SGZA 5DCBA 2ICSA 2YR1A 4KEMA 1U22A 5BXTA 3QR3A 1K9TA 4OE7A 4IUGA 3M5VA 1YXYA 2YSWA 4GIRA 1AW2A 4Q4SA 4QP0A 3LI1A 2BY0A 3QBUA 3VOHA 3B4UA 1W9VA 4PL2A 4A2RA 2O9TA 1UR8A 4JTKA 1JI2A 3DFTA 2W63A 4HPXA 3UPMA 2H6RA 1RCQA 4TX6A 3ZR5A 4S3KA 3EDDA 3IJDA 4XIAA 4Q8UA 4S38A 5HATA 1FY6A 3DKLA 2GOKA 1KXTA 3B8VA 2NXHA 1Q1WA 2JK2A 4I3GA 1DJGA 1QOQA 4ACZB 1L6SA 3O7UA 1AVAA 2WMIB 2R24A 3TN6A 2CLLA 3VNIA 1LRNA 3A7AA 3HRDC 2PLMA 1BAGA 1LUCA 3WMBA 3WJXA 3GD3A 1C7TA 3NSNA 3DHFA 1JAEA 1G9HA 4H6RA 3LQGA 4W87A 4GX8A 2D1ZA 4JFTA 3OVQA 1XLDA 4WSKA 3H26A 4ZTXA 2J47A 3UR2A 2PC8A 2QT3A 4C6BA 2ZVIA 1WDRA 3K8MA 1SJBA 2W5FA 3DGBA 3M0VA 4D6HA 2GLKA 5FOOA 4FMVA 2JKEA 4WDXA 4B92A 1TREA 1OGGA 1Y7VA 3HOJA 1TJ1A 3FX4A 2E1DA 1KM3A 2IMRA 1RHCA 1D7YA 4EX4A 4MZYA 1H6VA 4S3DA 3QMRA 3OQEA 3UU0A 4PGLA 2ZOXA 5CGMA 1XI3A 4XVDA 2Z1XA 4GFSA 4DO7A 2BC0A 3IARA 2VXNA 1OT2A 4NL1A 2F5ZA 1UWUA 3LRLA 4R27A 3W7MA 2R6OA 3TMQA 3DYPA 3H54A 3PUDA 1W91A 1Y5VA 4HIBA 3N19B 3MP5A 2OWXA 3E0VA 1POKA 3E74A 4XO6A 4O13A 2V67A 2F6XA 1DXEA 2XGIA 1UIPA 1TV3A 1IGSA 3P3BA 5HMSA 2VTFA 1X97A 4QDWA 3DGHA 4P7OA 5FJPA 4AISA 3BUVA 4J28A 3AMKA 3OJGA 1W1ZA 1TZ7A 3A9IA 4GQBA 3WJSA 4CD8A 2YDAA 4HNTA 4EK7A 5AYIA 1LT8A 3G1XA 4W8LA 1O12A 5E6YA 4FAMA 3PBGA 4PCNA 1E4NA 2C91A 3BJFA 4YS1A 1LBLA 4AD1A 4KPRA 4HZMA 2RDUA 3EWCA 3PTMA 4YTTA 3GKAA 1MUWA 4F66A 3GFYA 2ZRUA 4PUKA 1F5ZA 5D09A 1JR1A 3IEBA 3WEMA 1PS9A 4DNHA 1DXIA 1KXHA 4ZXOA 3TA9A 1Q6FA 4GJJA 4MMWA 4Z1CA 4DHGA 3BOFA 1XYZA 4O8AA 3W86A 4GNJA 1UJQA 1WV2A 2DUXA 3PBVA 1DOSA 2HJPA 1Q6QA 3NSMA 4P7QA 1A5UA 4MNLA 4P61A 3B0PA 5DQPA 4E38A 3URHA 4HA4A 3O0FA 4GBUA 1WDDA 1QPRA 1B3VA 3DIPA 3LGEA 4XKMA 5AC6A 3LUTA 5D38A 3ORWA 1HN1A 4PC8A 3GRTA 5AHIA 2A3LA 1YNPA 2G97A 4DBSA 2PUZA 5CC7A 1MSSA 5CBBA 4PUDA 2ZXAA 3NJ3A 4W7UA 1J2BA 3T4WA 2DVUA 2WVVB 3VXGA 2VX4A 4OV4A 1LTDA 4KCWA 3HG4A 4ZOAA 2J9XA 4Z1AA 2OCZA 3Q94A 4B9YA 4E3TA 4AXNA 3H2MA 2J7EA 5TAOA 3SCQA 3VKAA 2EQ7A 4JTJA 1ZJIA 4AHQA 1REQA 5FACA 4XTDA 2DPEA 4FNTA 1SO6A 4IPNB 3M6YA 5F1UA 4QHRA 3NDYA 4PR4A 4ATWA 3CT2A 2QCCA 1ME8A 1SR9A 2OLSA 4GXWA 4FOKA 2PTYA 4IZGA 3DU0A 1Z44A 4EF9A 4H19A 5DXYA 3NQAA 5EMKA 1TJPA 7ENLA 5AHFA 2GVEA 1J93A 2V30A 3PM6A 5GJNA 4NKCA 2CBIA 2GJXB 1MFVA 2B31A 3CAWA 3GG8A 1KRCC 4XSLA 2HS6A 3JRKA 1KM2A 2WSYA 4K3ZA 2QDGA 2P5NA 1LRQA 1SZRA 3H8AA 4BI6A 2V8ZA 4D6DA 1AH0A 2IS7A 3NZ1A 4L1WA 4GH1A 3ZVHA 2VZUA 5IXEA 4PBFA 2E6AA 3EOOA 2ZE3A 3TZNA 3AWNA 4LUSA 4RNFA 4FR6A 1VIWA 2GQWA 1GKQA 4GUIA 4BEUA 5LA0A 3ITTA 5FSDC 1STZA 4KETA 4YPJA 2XWEA 4QE4A 3MV11 4G7EB 4AZBA 3GYCA 2FZ8A 4DJEA 3OU8A 3W7CA 3FDGA 1TV7A 2YJQA 2BGQA 1LWIA 3TDFA 2OYKA 1JNEA 3DHUA 3LM3A 1FCUA 5AOUA 3LCFA 3QYSA 1S5TA 1EWDA 1IF2A 1ZAHA 1KA9F 5IDIA 3FEQA 4A3YA 4RLIA 3NL6A 4MJ4A 3NO5A 4QBXA 3PTDA 3LXDA 1MMFA 2F6KA 3UFYA 1ENUA 4FA3A 2ZZ5A 4H8UA 3EWWA 1FVPA 2O4MA 3DFOA 1O94A 4FF5A 1TMLA 1UWTA 3OHIA 3GG0A 1U33A 1M41A 3GXNA 1Q2SA 2C1HA 3T07A 3L9CA 3TQKA 3URNA 4IGMA 5AHMA 2BMBA 1XLJA 3MQTA 3SUUA 2CIPA 1L8PA 1IZJA 1K9EA 3A4XA 3RITA 1VYPX 4IJRA 4HHLA 1RA5A 5EBKA 7TIMA 1G4TA 3AZTA 1PUDA 1UZ1A 2OT0A 4A4AA 3MUCA 3K30A 3DFYA 4ZCWA 3ZM8A 2IPJA 3RG6A 3JZEA 2CDUA 4HK5A 3N2TA 4AF0A 3SURA 4AUBA 1MRQA 1EYEA 3BAJA 3HFYA 1YPFA 4Z2LA 4AFYA 1ICPA 1VC4A 1ZUAX 4XZIA 1CX9A 2HCVA 3QHOA 4B2DD 4WKFA 2XFWA 4LANA 4ATDA 1LWHA 4MWAC 3W71A 3LHWA 3CEUA 5F4WA 2QVNA 2P76A 4JIPA 1UQYA 3GXTA 3TTEA 2OYLA 4BCEA 3KL5A 3QY8A 1X2HA 4ZL1A 3M0ZA 4CN4A 1HX0A 1UD4A 4HP5A 3DK4A 3KCJA 5HR6A 2VEGA 1RPXA 3E0FA 2PMQA 5IHSA 3MSDA 1NDYA 4UTJA 1G7VA 4AVOA 2W0HA 3FYOA 1OC7A 1ADDA 1A47A 2J3NA 3E3HA 1E9IA 1GOQA 1CIUA 2JIWA 1MUCA 4YNGA 2OGYA 2YCJA 1WZAA 2Y5JA 1G4SA 3U3HA 3M7WA 2YB1A 4ZZ9A 1X39A 4ZQNA 2X1SA 1T8QA 1VCFA 3UR5A 5EMYA 5A6LA 1TE1A 1NEYA 4XZLX 4DWSD 1ZLPA 4AVNA 4F9DA 1BYAA 2D0GA 3PPFA 1TPEA 1ICSA 4NI8A 3QFAA 4QAIA 3F2DA 3PG9A 2O9PA 1ODUA 4JZ5A 4WXYA 3V0TA 2F61A 2HMCA 3MDWA 1M7OA 1MXGA 3RLVA 4WQ6A 3UT0A 3CZLA 1E0TA 3LSCA 1NP2A 1B3WA 4H6KA 1XYAA 3UQNA 1FEAA 4EQSA 3H4WA 2WMJA 2UY3A 1W9DM 1WCGA 3W74A 2X50A 2YIHA 3CIVA 3PNZA 4XD4A 2VT0A 4LXFA 4NYYA 5ABFB 2Y6ZA 1NP0A 3LX9A 4RNHA 1S2WA 3WLMA 3L0KA 2Z7KA 3ZFHA 1GQKA 3LCHA 4O8RA 4WRHA 5HBFA 3PK7A 5LGXA 3PG6A 4O12A 1ITQA 1OINA 4E4UA 1CCWB 3TJXA 5BWAA 4GYFA 3DBPA 2NSXA 3WF1A 3VYLA 2EGZA 2WM0A 4E8CA 1WQ5A 3PN8A 4Q8PA 2ZXDA 3S6OA 1E1FA 1SGJA 4JX4A 1NDZA 3CU2A 2V0TA 1ML1A 3VUSA 1HO4A 2E1WA 3BZGA 2YOCA 3DGZA 1B5TA 1NELA 2QJMA 3PPHA 1NU5A 4IP7A 1HKMA 3TR9A 1W1TA 2ZZ2A 3WQ5A 2ZZ0A 3K46A 3TN4A 2C3CA 3QQ0A 4LIIA 1UC4A 4MZ8A 3P67A 1TZ9A 1VQTA 2VP8A 3BICA 5FAJA 3N2BA 1H7XA 1JD7A 1CGYA 2DQXA 3S9YA 1YW1A 1DWAM 2R14A 3IV8A 1TB3A 5HJYA 3VDHA 5FKYA 5HQLA 1X1NA 1ZPTA 3CLWA 1GZJA 3GW0A 4GX9A 5KTLA 4MHBA 2F6UA 4Z0SA 3WNNA 2BG5A 4MWAB 5DFAA 1SO3A 1E5JA 4JHMA 1C8XA 3FXGA 2J8TA 5FSEC 1W5OA 4JKKA 3E96A 3BAYA 4ADTA 2H8XA 4PSPA 4PMRA 5I7GA 3A5FA 1J18A 4GI6A 4Q7NA 3WQWA 4L4MA 2NPXA 4K7YA 4DZ5A 3GVVA 3VOIA 1ZJAA 4PBGA 1G5AA 1R3VA 1HTIA 3OZOA 2CW6A 3A4JA 3Q58A 3G1SA 5D9NA 3B8UA 4IIDA 2EPNA 3ZLHA 3DG3A 4V1YA 4Y96A 5HUPA 5HWNA 3GTFA 2DSWA 3BMWA 3AIRA 3BDKA 5EYWA 1SB3B 2GRTA 4O16A 3UXDA 1M7JA 4AMCA 3QV6A 3ZLFA 5FJJA 1UKPA 4RL3A 4O1BA 2AKZA 2ZX7A 4Y2WA 3CB8A 3WEZA 3DKJA 1EJ7L 1KM4A 3BAWA 3HGOA 3CT7A 3D6NA 1W17A 3MUZ1 1FIQB 5D03A 4JIHA 3N34A 4H8VA 2BTMA 3B03A 4PUWA 1PEZA 3BAKA 1UASA 3A6OA 3ARUA 1VB9A 4LVGA 2WLYA 1YBQB 3GTNA 4Z0JA 1KBBA 4QCFA 4WGHA 4H9TA 1D8WA 4JN8A 3N4AA 3JUGA 4TVYA 2D2HA 3PZIA 4J27A 5BOEA 2YXXA 3CMJA 3OG3A 3HJZA 5C9UA 2PTZA 2WJEA 3A3WA 1IWPA 3TNBA 3GFZA 4C6LA 3KBNA 1AZ2A 4QROA 4BF9A 2BNJA 3WDRA 3P74A 4XZWA 4UTIA 5AECA 3HFTA 1CWYA 3DERA 3DI1A 2VGGA 4Z17A 1VFFA 3ITGA 3QJAA 1EDTA 3VCRA 4BURA 3W07A 1ZJHA 1NTHA 3CMFA 4E8DA 1TIMA 1YX1A 2HQAA 4LAUA 3SCOA 1YXDA 3BLFA 4LX4A 5BROA 1OGBA 2EO7A 2H90A 1VGAA 3KBVA 4DLMA 1BXCA 5T8GA 1BVWA 4XKYA 3APGA 4FOJA 1G1YA 4J40A 3EX1A 4JTRA 4JDYA 2R1MA 3GDRA 3WH5A 2FJKA 2X0YA 4NAFA 3CHEA 2WBKA 4L9ZA 2MNRA 2PLCA 3U0HA 1MOKA 2KZHA 3GZ3A 3OLGA 1X7FA 1HKIA 3WQEA 3MCOA 4MJZA 2WQPA 3GFXA 3F2BA 5GJPA 4EACA 3SGUA 1NDWA 2E8YA 3ARQA 3EPMA 2WZHA 3EWYA 3VNLA 2XM1A 3LHTA 1DWIM 3OBAA 2PTWA 4DPPA 1EX1A 3BG3A 4F8XA 4W85A 4AEOA 4FPSA 4P5UA 3V75A 1UH4A 4Z42C 2GUBA 1V3JA 4NXKA 5IHRA 1PKLA 4UQ9A 1BPLB 1H51A 4HNNA 1CXLA 3LENA 3WCZA 4RE0A 3EDKA 4KEZA 2QQ6A 1GOXA 3R0UA 3MHUA 3WDHA 1NQKA 2Q8LA 1QWGA 2PZ0A 4U4MA 3MUY1 3UWVA 1GEHA 2FB2A 1OCNA 1O6IA 3GO2A 1ONFA 3NVWB 3FV9A 3LRKA 2FZMA 1UP3A 1SMAA 4FNSA 3L4UA 5EA9A 4DVOA 4BV6A 1QJWA 4HA3A 2ACQA 3STCA 3PZMA 4PTVA 2OVLA 3WNPA 3KTSA 3A12A 3VZXA 4GY0A 1VBJA 5FS6A 3LMYA 5HINA 1VR6A 3TTSA 5GPRA 1DJWA 1XDIA 1DTUA 2QCLA 4RZBA 4ZEPA 4LCRA 2HBVA 3AROA 3V16A 2R82A 4UOZA 1HKVA 4XWUA 2OEMA 1KTCA 1UMYA 5H91A 4NQ1A 4MDPA 4D9PA 1W3NA 3BE7A 2JEPA 2BX7A 1BXBA 1WUEA 4TVUA 3E2SA 2Z6IA 3H70A 2EG8A 1BF6A 2QCMA 3RMJA 4CGTA 2ZUVA 3GLCA 2G5WA 2EKCA 3OEXA 2INEA 1QI2A 1CGXA 2VQTA 4AD3A 3EAUA 1CXKA 4F9JA 5CQ1A 1TUXA 2XWDA 3PZ9A 3PZNA 3S2CA 5KETA 3N2MA 1IHIA 5A1AA 2H9AA 3S5ZA 5JRBA 1VD6A 1V6TA 2CZDA 2XGBA 3ZMRA 3UJFA 3GXDA 3AXIA 1J0YA 5G2WA 5JCKA 1AH4A 1XL9A 3HJEA 3EB4A 4MADA 1SM9A 4LWWA 2WMKA 4TOQA 3UETA 1ZJBA 2GDQA 4HMCA 1Q63A 2C71A 4H4SA 3GVRA 3EWBX 4H8NA 1CNVA 4GD0A 4XD3A 3W26A 3VVGA 1P0DA 3VOGA 4U33A 2E5CA 2QCDB 1MXSA 4L1XA 1F8IA 1FXQA 1XH1A 3SEPA 1JCLA 3TUUA 3GNPA 3R94A 4BWLC 4HT3A 3LY0A 4H83A 4PH6A 1D7FA 1SR0A 3C56A 1TWWA 1H7PA 4QDPA 3AMCA 3TJIA 5D2TA 4GXMA 1TTIA 3KRZA 3DFQA 4YN5A 6TIMA 2X2YA 3EUB3 1PKNA 2GFTA 3RM9A 1XANA 2FMOA 5A2BA 4ICMA 1QK0A 2XM2A 1XINA 7XIMA 4WJXA 1W3HA 2OWCA 5I02A 4KIRA 4HSOA 4YHEA 4IP4A 2VURA 2J7DA 3ARSA 4KWSA 1CECA 5FS8A 5CEWA 7CGTA 4P8VA 5CKSA 1QRQA 3ERPA 1H60A 4XO7A 2AQOA 1GW9A 2GZXA 3LD5A 1GQJA 3SJNA 4HNUA 3CL7A 1F6YA 1JOAA 2Q09A 3SUVA 3VGFA 1ZHAA 4GBDA 2QR6A 1HKKA 4LT9A 2BXVA 5PTDA 3VO0A 4O0KA 1GYMA 5CGTA 1UQZA 4NYUA 2PGFA 1RUSA 1IR1A 2E9BA 1KR0A 1LDCA 2VFEA 5FJTA 3ARVA 1EJSC 1EP3A 1F3EA 1YDOA 4H4YA 3KLKA 2PDBA 1E4IA 1V03A 1M1BA 5BOOA 4UFLA 3G5EA 1FWDC 2W61A 4A3QA 1LBFA 5KEZA 3M0LA 4NJJA 2FGBA 4B3KA 4AZCA 5DF0A 3SSZA 3VMNA 3DBNA 3N2CA 3BG9A 4I5RA