2P0IA

Crystal structure of l-rhamnonate dehydratase from gibberella zeae
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
407
structure length
393
Chain Sequence
LSSVKDFPKIKAIRSFIIGHWLIDSDISTPASKWEQYKKSRTSWGINVLGSFLVEIEATDGTVGFATGFGGPPACWLVHQHFERFLIGADPRNTNLLFEQMYRASMFYGRKGLPIAVISVIDLALWDLLGKVRNEPVYRLIGGATKERLDFYCTGPEPTAAKAMGFWGGKVPLPFCPDDGHEGLRKNVEFLRKHREAVGPDFPIMVDCYMSLNVSYTIELVKACLDLNINWWEECLSPDDTDGFALIKRAHPTVKFTTGEHEYSRYGFRKLVEGRNLDIIQPDVMWLGGLTELLKVAALAAAYDVPVVPHASGPYSYHFQISQPNTPFQEYLANSPDGKSVLPVFGDLFIDEPIPTKGYLTTADLDKPGFGLTINPAARAKLIPSDYLFKVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of L-Rhamnonate Dehydratase from Gibberella Zeae
rcsb
source organism Gibberella zeae
molecule tags Lyase
molecule keywords L-rhamnonate dehydratase
total genus 114
structure length 393
sequence length 407
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.90: L-rhamnonate dehydratase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2p0iA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2p0iA01
3N4EA 1SJAA 3CB3A 3H7VA 3QLDA 4GMEA 1SJBA 4GGBA 5J04A 3BOXA 4HCDA 4JN8A 2GGIA 3ES7A 2XH0A 2PTWA 3UJEA 4HPNA 3R0UA 4GYPA 3TW9A 1R6WA 3QPEA 3OP2A 2POZA 3EKGA 4MMWA 3ZVIA 3D46A 3R25A 5FJOA 2GGHA 4H1ZA 3MY9A 4GFIA 3ZVHA 1E9IA 3DIPA 4GISA 2OLAA 3N4FA 3N6JA 2HZGA 4A6GA 2OVLA 3P0WA 3I4KA 3JW7A 4X2PA 2MUCA 2AL1A 5FJTA 2QJNA 2O56A 3H12A 1P48A 2AL2B 4H19A 3DG3A 3MKCA 2OO6A 2XH2A 1F9CA 2OG9A 1WUFA 4M0XA 3R1ZA 3P93A 3VC5A 4G8TA 1JPDX 3MQTA 3U9IA 3V3WA 2HNEA 3VFCA 4HNCA 3UJ2A 1MDRA 1XS2A 2PTZA 3VCNA 3VC6A 3T9PA 3GC2A 3TCSA 3IJLA 1KKOA 4ENLA 3H70A 2PODA 2PP3A 3CXOA 1KKRA 5FJPA 5FJRA 3RCYA 1JDFA 3DGBA 2QJMA 2RDXA 3H8AA 3OZMA 4ZA0A 2PU0A 3T8QA 3NO1A 1TE6A 4HN8A 3DESA 3DG6A 3OPSA 3VA8A 2NQLA 3QN3A 2GGGA 3RO6A 3TTEA 1PDZA 3VCCA 3RRAA 2OQYA 3U4FA 3DDMA 1FHUA 1ONEA 4HCLA 3FVDA 2AKMA 3SBFA 3FXGA 3FV9A 2PA6A 2I5QA 3NZGA 4A35A 4F4RA 4IL2A 2PP1A 3UXKA 3KUMA 3TWBA 3PK7A 3IJQA 1WUEA 4DXKA 3ENLA 4IP4A 4KWSA 1EC7A 2PU1A 2OFJA 2QVHA 4MGGA 1P43A 2ONEA 2QGYA 2FYMA 4K2SA 5EU9A 2PPGA 4KEMA 5BOFA 3ES8A 2PP0A 3V4BA 3TOYA 2P8CA 4KT2A 3TJ4A 3CT2A 4M6UA 4YWSA 2PTXA 1EBGA 3R10A 2PS2A 4H83A 2P88A 4EWJA 3TJIA 3DEQA 3DFYA 3SJNA 2OZTA 2FKPA 1MDLA 2OX4A 3RITA 2PSNA 3RGTA 4DWDA 3CAWA 3FCPA 4G7FA 1W6TA 2GGEA 3SN0A 3ZLFA 1FHVA 3Q45A 1OEPA 3JZUA 7ENLA 2GDQA 4A3RA 1MUCA 4JN7A 3T6CA 3SQSA 4IZGA 3DFHA 2ZADA 3S47A 2MNRA 3DG7A 4Z17A 3GD6A 1TKKA 4KPLA 1ECQA 4JHMA 3UJFA 3GO2A 4DHGA 1NELA 2HXTA 4FI4A 2GSHA 4GIRA 4IT1A 2XGZA 3K1GA 3I6EA 3NFUA 3I6TA 3T4WA 3QKEA 1MRAA 3MWCA 3STPA 4Z1YA 3Q4DA 1JPMA 4K1WA 1RVKA 3OZYA 3UJRA 3PWIA 2GGJA 3R0KA 3UXLA 4DN1A 3N6HA 3EEZA 3FYYA 4K8GA 4E8GA 4MKSA 5BOEA 3OW1A 5ENLA 3MZNA 1SJCA 2OZ8A 2XH7A 3UGVA 3D47A 3RR1A 4HCHA 1KCZA 3SN4A 4DYEA 3ZVHB 4IP5A 1ELSA 3MUCA 3SSZA 3BJSA 4J1OA 3TQPA 3PFRA 4E5TA 2HXUA 1L8PA 1SJDA 2AL2A 1XPYA 1IYXA 2QQ6A 1KD0A 1TZZA 2P0IA 3ZLHA 4E4FA 4HNLA 2OPJA 1JCTA 4J3ZA 4FP1A 3CYJA 3VDGA 6ENLA 2DW7A 2PMQA 4E6MA 4E4UA 5IDZA 2DW6A 3UCCA 3V5FA 3HPFA 3JVAA 3S5SA 3OTRA 4IL0A 1PDYA 1YEYA 2OZ3A 1EC9A 3CK5A 3BSMA 3ZLGA 3GY1A 1BKHA 3TWAA 4HYRA 4ZCWA 1EC8A 5FJUA 3IJIA 2OQHA 2GL5A 3B97A 3P3BA 1R0MA 2ZC8A 3QTPA 1DTNA 2P3ZA 1NU5A 3SN1A 3UCDA 3R11A 3IK4A 2QDDA 3UJSA 4IHCA 2XSXA 3MSYA 4GYPC 2CHRA 2XH4A 2PTYA 2PGWA 2QJJA 3V5CA 2QDEA 2AKZA 3DERA 3PWGA 2PCEA 2OKTA 3NXLA 4ROPA 3FJ4A 1EBHA 1BQGA 1MNSA 3THUA 2PGEA 2P8BA 4GGHA 4DX3A 4H2HA
chains in the Genus database with same CATH superfamily
4NVTA 5MKGB 1JPIA 2W61A 3C56A 4H9UA 3JRKA 5EY5A 3PG8A 3BWWA 3T44A 3WLMA 2GUBA 3RMEA 2E68A 1S2TA 1EA9C 4HPNA 3DK9A 1JFHA 5E5CA 2CLFA 3KL3A 1ONFA 2EPKX 2OQLA 4GQRA 2HPIA 5EMYA 3GUWA 5CPQA 4GZIA 2XSBA 1GNXA 5H2ZA 2NQ9A 3ZVIA 1ICPA 4GISA 2OLAA 4XAGA 3AMKA 1GKRA 3LHVA 4CQ9A 1KO0A 2EPNA 3NQ8A 3NR0A 4JGDA 4LANA 4M5PA 4XIMA 1FWGC 3DYMA 4LRSA 2I17A 2DH2A 1W3NA 9RUBA 5KZDA 3VC5A 2G3JA 4IOTA 1B9BA 5DRCA 5G2WA 4Q8WA 2FJKA 2G8ZA 3G1VA 3TN6A 4AISA 2R1KA 2WMHA 4MUZA 3VD5A 2CKRA 4GVHA 1QNSA 4OWGA 1TV3A 1ZMDA 3NQFA 3ABQA 5LXEA 1EWDA 2RJHA 2SFPA 5KINA 1JCYA 3EX2A 3VNIA 4HMDA 3GIPA 2QNEA 4LH8A 5CJMA 5FJRA 3EBVA 4URIA 2WMGA 4C6LA 4H3DA 3CIWA 3LXAA 3QPYA 1C8QA 2CXEA 2VFEA 2A3BA 3NG3A 3L2MA 4ZXLA 5D02A 2XFFA 4S39A 3Q37A 2XU2A 3H2MA 2R91A 3ZWSA 2BCPA 1SUXA 2D23A 3QN3A 3W1LA 1AFSA 1M5WA 3WF4A 2ZXAA 3DDMA 3KTSA 3NPXA 3M5ZA 2DUAA 5CH9A 3SM0A 1T8QA 2MANA 4O50A 5AC4A 8CGTA 2YLAA 5IOBA 1W1A1 2ZDSA 1E0XA 5CSRA 4QDWA 4XSLA 2DP3A 5I3GA 2CWXA 1JCNA 1KBJA 4O8RA 3NVVB 1Q6OA 3FHAA 2NVAA 1R3SA 5JCNA 3FGCB 2QZRA 3HJZA 5DELA 4ADWA 3CUJA 4HPGA 4V28A 3S9YA 4IIGA 3N6QA 4K2SA 1ZJAA 5MKGA 3CHEA 3TFCA 2BBFA 4KCTA 4GH3A 3Q67A 3F4VA 1F73A 3QMTA 3P84A 4JX6A 1MVYA 1BRLA 3SB0A 4EANA 3NPWA 6PTDA 2A7RA 2ZWYA 3CH0A 3SUWA 5D33A 3THQA 5AVHA 3COTA 1JZ3A 2VCAA 3L2LA 2PDKA 2D1ZA 2ZUTA 1VIWA 4HSHA 2ZTKA 3AS3A 2GK1B 3WLIA 3ZIZA 1VBUA 3N1AA 4QAIA 3TW7A 3VIOA 4X9SA 4YNGA 1XG4A 1OINA 5HPOA 1TWWA 5K2ZA 2J7DA 2DT0A 1VD6A 4ZTYA 1D2KA 3DFNA 2HVMA 4EXBA 4XISA 4JN7A 2X1TA 3QTGA 4AG0A 1NP2A 1OD0A 4FLOA 3MUY1 2J47A 1JGMA 4J3UA 5JMUA 4WD0A 2MNRA 3PULA 3M9YA 3QMRA 3RM4A 4DI8A 3MB9A 4WOZA 1R9ZA 3WCZA 5I00A 4UXDA 2UY4A 1M7XA 5I06A 1XLFA 4KMQA 3W7CA 1E4IA 2Z24A 5HULA 2WQPA 3CQIA 1AMKA 4G56A 5BRQA 3OHIA 1W3JA 3NIYA 4GVGA 4ZFCA 1F3XA 4MAVA 3V36A 2W62A 2E77A 4QE1A 3NVZB 3PWIA 2PDNA 3GXPA 1OB0A 1X1NA 3G2GA 1REQA 3GIQA 1OJTA 1KXQA 4MKSA 1E9YB 2NV2A 2WZEA 3QY8A 5EMUA 4FX8A 4MKVA 5TR3A 1DQWA 2D22A 4HZ6A 2OZ8A 2YCEA 2Y8KA 3AROA 3EOOA 3H54A 4ATLA 3AHTA 3E1F1 1JVNA 3MV11 3C8FA 4GNKB 2QIWA 3WDHA 1GVYA 1SB3B 3GU2A 5FS9A 4IISA 3QW3A 2HK0A 4W7UA 5TBOA 3LI1A 3CHFA 5BU9A 1PTGA 3THCA 3W7OA 3PFRA 4CD7A 3WD0A 1O94A 4LV4A 3N2XA 3N3TA 1XHCA 1W3LA 5ABEA 5E9XA 4BI7A 1HXJA 4HNLA 1XCFA 1Z42A 3ZJ6A 3LPGA 5A5WA 3E5PA 2L5HA 4UUIA 3TKFA 4MDOA 5U25A 1SVDA 1TPFA 2VOMA 3GS6A 2BVDA 2GJRA 3W38A 4I8YA 3L0NA 1QPKA 4LWWA 1JF5A 4WJEA 3BG3A 3JS3A 4MLJA 4NEVA 2JK6A 3HB9A 5EFDA 4IWWA 3UWZA 3RPMA 4F3HA 4YHEA 1FX6A 1KXVA 1K02A 2WMIA 3DCPA 3KLLA 1NY1A 4CCZA 3S1WA 1NFGA 4C6IA 4QTGA 1QW7A 3BQ5A 2IQDA 2BASA 3IK4A 4LTSA 3PUGA 3UJSA 1TVPA 2GFTA 4GOAA 3OBKA 4R53A 1MFUA 3MSYA 4Q8OA 4J3XA 2A3LA 4GBUA 3DERA 3W1NA 3H53A 2REQA 2PWHA 4ICNA 1EGVA 3BGGA 4H04A 4A8LA 4EAMA 5F2LA 1XUUA 3UPBA 4FF5A 3NXFA 2OYMA 2RUSA 5HBFA 3R6IA 4HZ8A 3U4AA 3I7SA 4H2HA 3P5YA 3LI0A 2H6RA 4JIEA 1KRAC 3CB3A 2OCZA 3M5VA 4NZFA 5A8NA 2CNCA 3AIVA 4GGBA 3LHZA 2OKOA 4GJIA 3DJJA 2ZZ2A 4GJ1A 1UKSA 4AXKA 4H4ZA 1K77A 1WA3A 3NM3A 2QCFA 4YVXA 1EJXC 3UD6A 1HN1A 1S2CA 1QAPA 1RZMA 2WMIB 2POZA 3CPGA 3UZ5A 1DV7A 1UR2A 1K8YA 2OWCA 4QJ5B 1LCOA 4GQQA 5BYWA 3POHA 3DIPA 3KOWA 3MKVA 1HJWA 1ML1A 4V1XA 4D8ZA 1ZENA 2G0WA 4MB1A 2D2JA 4A6GA 4MLRA 3W7KA 1AL8A 1W5PA 4JXCA 2CDUA 3G0UA 1LLWA 4NSBA 1ZY8A 2EQ7A 2VD8A 5CG0A 2D2HA 3ITGA 4EMWA 3MKCA 3CH9A 1LYXA 1F9CA 3MP4A 3A64A 2WANA 1VP5A 1VB9A 5I3FA 3NAVA 3PVFA 1DEDA 1O5QA 1W5MA 1JPKA 1QBAA 2F2HA 3UZZA 3AHXA 4K8EA 4S1FA 1YXYA 1JF6A 3G1AA 3W00A 3IC9A 1WDDA 4MY1A 4ICCX 4KFOA 2ZOXA 3IGHX 3W1TA 2PDFA 1FWNA 2RDUA 5E9AA 3PTKA 4CNSA 1T8XA 4C60A 4ONVA 3AU2A 1XYLA 1NAL1 1UC4A 3OZMA 4HA4A 3A7RA 4GIEA 3QYQA 1VPQA 2FPTA 1FFQA 4WGHA 4XD4A 1A5NC 3QFWA 1FCVA 3BXWA 2CZ5A 3EWYA 3L4XA 4X0VA 4H4XA 4BKNA 3T07A 1XL9A 4TXEA 1V3KA 1WOAA 2QVNA 3IGXA 4M1RA 3KL0A 1M68A 3NZGA 3PNUA 4XAYA 3ZOAA 1OK6A 1X39A 2X41A 3URQA 1K9DA 4UTKA 1ZRQA 3IJQA 3PTDA 1OCJA 3JUGA 3MI6A 1E6XM 4I7WA 4B90A 2VKZG 2A6NA 7ODCA 4HP5A 3DZ1A 3LZ5A 1CGXA 5CPOA 3A6OA 1R38A 4Q22A 1ZP4A 3W07A 1GOKA 2Y63A 3B0UX 4IIBA 4KT2A 2VCCA 3V7PA 1I2NA 4M6UA 4D72A 3IAQA 3AZRA 4MWAC 2AAAA 4H83A 3S2NA 3PZQA 1KBLA 1REQB 3QV8A 1B3YA 1Q6GA 2WXDM 4JEJA 1W5QA 5LNRA 1UR1A 4RXFA 3IIVA 4JD4A 4J3TA 5C9UA 3ABSA 2RABA 2C6QA 3L5MA 4GY7A 2A3AA 3QY6A 2EPHA 4MB4A 3WD3A 4TVCA 2OX1A 3AM9A 4ZE5A 1E70M 2HWGA 1VKFA 1H49A 3FJNA 1TPWA 1BYAA 1EUNA 2Q8XA 1P4CA 3OHMB 1D3CA 1UR9A 4JTTA 3TA6A 1G6CA 4DJDC 3K8LA 2NQJA 4JHOA 4RPQA 1KM1A 2GDQA 3OLDA 1MUCA 1OX5A 3H4XA 2C79A 3S0CA 5FACA 3WLOA 3DFHA 3LSBA 2X8RA 1V7AA 3R12A 2NXIA 3FYOA 4QLJA 4I8DA 4US5D 3WLKX 2QJIA 2UY2A 2NUWA 4IICA 4AVFA 3KS6A 1NELA 3SQPA 1FWFC 5HR6A 1YNPA 3RCMA 1W9XA 4M6QA 1AVAA 1F8IA 2H8ZA 3F03K 3MWCA 4NZ5A 3SY5A 3T0AA 3VE7A 5DT5A 4MY8A 1FVPA 5HNUA 3A3HA 1PWLA 1OX4A 4DI9A 4YLWA 3UR5A 2JBMA 2CFYA 3SAZA 3AN1A 1ZUAX 2Q3OA 4U33A 4M6PA 5BOEA 1I2OA 4EQRA 4O1CA 4N7QA 4ICMA 3HG4A 4RCXA 4PMRA 2A21A 3QKZA 4TTGA 1GRFA 3OA3A 3TYEA 4ALDA 3ZVHB 4EE9A 3TAKA 3CL7A 1OYCA 3B04A 3UXDA 2DZWA 1A0EA 1PZ2A 2YCLB 4DF1A 1G69A 2HXUA 3EDDA 2AL2A 3WLPA 1KM2A 4IUGA 2QMKA 2ISSA 3YPIA 1JYXA 4M24A 3O07A 3IVSA 1LL7A 1CPUA 3H24A 3BOFA 4QLLA 3AZTA 3BZJA 2PD9A 4E6MA 3KS5A 4WDWA 5FSEC 5EMLA 2H9AB 3W7GA 2G3MA 3MYPA 3CTLA 1P1MA 3BSMA 1TTPA 4NXKA 4ZB0A 3WDRA 1JYNA 3EDEA 4I90A 4IFKA 2PDUA 1DJZA 3IJIA 3O0HA 4UR9A 3UWUA 3P3BA 2ZC8A 4N42A 1EJ7L 3MA8A 2E67A 5TIMA 5DCBA 1H1YA 2HJPA 4GK8A 5IM51 2F38A 1TV5A 2VRJA 1ISZA 3UY8A 4NI8A 3CV7A 1KA9F 1DXEA 4XD6A 3O1NA 1V0MA 3VIHA 1C8YA 2F5ZA 1C9WA 5D9MA 1AQFA 4LAOA 1F4AA 1VFTA 3WJSA 3B9OA 4E2VA 3TROA 1X8CA 1TWZA 3WYZA 4LPCA 5BWAA 1LWHA 2PCEA 2BHZA 3LUTA 1QO2A 1KW1A 3STGA 4O8AA 3HV9A 1B30A 4GUIA 3NQCA 3UVIA 3VABA 3TVAA 1HUVA 2PGEA 4TVYA 4HT3A 4DELA 1UP2A 4P7QA 1V3LA 3THAA 1XGDA 2WNWA 3O15A 1PSCA 3N4EA 2VR4A 2WPEA 2PWVA 3QLDA 4UTIA 4IJRA 4FNSA 2VM8A 1KCXA 4D6CA 2WVSA 5JU6A 1UKTA 1UD8A 4XWUA 4MYAA 3TCEA 1C92A 3TZNA 2WWCA 3ONBA 3N13A 1O68A 4K7YA 1RJRA 4O1DA 3T78A 1DWIM 1YXCA 3GW0A 3H22A 3MDUA 1U5JA 4ASTA 4YS1A 3L67A 2GGHA 5B7YA 4QJ3B 2RDTA 2HZGA 4JICA 3MKKA 1ZL1A 3LRKA 4DJED 4UR8A 4S38A 3I4KA 4CQAA 3N73A 2PFHA 2DDXA 4XZWA 2AL1A 1JYWA 1BRLB 4A22A 1K8CA 2G95A 5DX7A 7TAAA 4M0XA 1J6OA 3HQ1A 1LG1A 4JQ2A 2XISA 1NPXA 3VFCA 5CGTA 4AAJA 3WBAA 2PTZA 4FXRA 3K4AA 5G4WA 4LY8A 4HSNA 3UWQA 4M8UA 1QOPA 1QVBA 2NSOA 4PTXA 2E1DA 4ENLA 3B05A 3SQLA 4H7VA 1YYAA 2J4GA 4LB3A 2XWEA 4ATWA 2Z2AA 1JZ6A 4YVPA 4RNIA 2DSWA 1EGMA 3BQ6A 3SCVA 3VIIA 3QY7A 1XINA 3MT1A 4HB7A 4LS0A 3W6LA 4XTDA 1TPH1 1LJYA 5J8LA 3LNMA 1ZDLA 2XIBA 3W26A 2Z1BA 4GC4A 2FB3A 3PR2A 1FECA 4J7RA 3OPSA 2PZNA 2EQ6A 2V63A 3S2MA 3IJ8A 3R2GA 4HOZA 3RDKA 3VNMA 5U1OA 5JRBA 4JDYA 3U4FA 4JDRA 1FHUA 2J74A 3EF6A 3FXGA 1X6NA 2X99A 4D1JA 4AMAA 1TWDA 3R79A 4BEUA 1E15A 2VHLA 2NX1A 1XANA 5BXPA 1P6BA 1D3GA 1ME9A 1GCYA 3L2IA 1JJKA 1US0A 1UOKA 5LXXA 1H41A 3OLIA 3WMSA 3BLEA 4DXKA 2J9YA 1U5VA 4AZBA 4C6CA 1K4QA 2G3NA 6CGTA 5IFTA 4RW3A 2DVUA 1HKIA 4KPRA 2V3GA 3QC3A 1LQ2A 2C1GA 9CGTA 5EU9A 3GD3A 3QGKC 1EJUC 1Q45A 1GOIA 2YVGA 3F4WA 4X61A 1EPVA 2F6KA 2OU4A 4BS0A 4JBRA 4WKHA 1I1XA 2ISVA 3NZRA 1WZMA 4GH1A 4K36A 2W63A 1YQ2A 3T40A 1IGSA 3WQOA 3GBDA 1Z3NA 3SEPA 3S5OA 4UTHA 8XIAA 4EXQA 5A6AA 3RITA 4ZQCA 3WNNA 3N04A 2FVKA 1BFNA 1QOXA 3GAKA 3C3UA 1GZ1A 3RNDA 4O15A 1CNVA 3HG5A 2H8XA 3OLGA 1W9BM 1P0EA 4NIRA 5FF3A 1MSSA 1JCXA 4F2UA 3G77A 4ZMGA 2YCJA 4CQCA 1VHCA 1ZHAA 4GWEA 1TJPA 1X97A 4IFOA 3BLOA 1EJWC 2BHYA 1E0UA 4IJCA 2IPFA 1VDVA 3S6OA 3E0IA 1O1ZA 4RR4A 2XDFA 1GSNA 4IGHA 4GIRA 4JL2A 1GWJA 4HNUA 3CGDA 1QBBA 2WSQA 4Y9OA 4LU0A 3REQA 2O7QA 1HO1A 2UY3A 3LK6A 3Q4DA 3UVAA 3W4RA 3LY0A 5GNXA 4RUBA 4ERGA 3FYPA 3RLGA 4MY9A 1VFOA 3M0MA 3TE9A 3T05A 1ZJIA 4H4YA 4K7VA 3WUEA 5CXPA 4K8GA 1RQBA 6TAAA 4CCEA 2FHBA 3N14A 1OG6A 1A3XA 1FFRA 4Z1BA 1B3WA 3WQ5A 3PBWA 3WLRA 2GQWA 1X38A 4RZ4A 2XWDA 3E0WA 2I16A 1PO9A 4L64A 4Y6GA 2VEGA 4Z08A 1OFAA 2C7FA 3OIHA 4R88A 4KWUA 4J1OA 1NHRA 3WUFA 5G2HA 5JIWA 3VIKA 4FALA 4MNJA 9XIMA 5HQMA 3MJMA 1OX4B 1I2PA 3E38A 1ISWA 4HTYA 3WNMA 3WJWA 1DJQA 2PRHA 1BTCA 5DY3A 4EM4A 2VZOA 3G6LA 3QMSA 3JZEA 4HPJA 4C6OA 1VBJA 3SRKA 1VEPA 1TRIA 3LU2A 2QGHA 1RK5A 1M6JA 4E4UA 2QUUA 3OQ8A 5D32A 4KFPA 2AGKA 3JVAA 3H2EA 2OZ3A 4AWUA 2Y6ZA 4BWLA 2WPCA 3M5XA 1IEXA 1UASA 4D6FA 1XSIA 3NDZA 4LVAA 5HMDA 3C5QA 1IZCA 3G24A 1OCBA 3UCQA 1WOBA 4R7WA 1Z69A 2Z1XA 3A5FA 1KM5A 5G1YA 4KCUA 4EPEC 1V02A 3CWOX 2ABBA 2YVJA 4UC5A 1GW1A 3II4A 2ZVIA 3B4UA 1GTEA 2ISDA 2QJJA 2X30A 3SCTA 3V5CA 1E72M 4O53A 2GOKA 2NSXA 1JG9A 4H6EA 1M7OA 4F66A 4U5IA 4NU7A 1O95A 5EL1A 5CQ1A 1PKYA 1KFWA 2PDIA 4QAWA 5FF0A 1HF6A 3EKLA 4ZENA 2CC0A 4W5ZA 4HMCA 4F48A 4L1WA 1FHDA 1Q6QA 2HK1A 4NUWA 2X50A 1H7NA 4S3GA 3ITCA 4PN2A 4OUEA 1F3PA 3AMLA 3HPZA 5I23A 2BC1A 2VC7A 4H4TA 1IEWA 2DSVA 2W5FA 3TSDA 1VCGA 1V77A 4EKJA 4DZAA 3EKGA 4MMWA 4W85A 3BE7A 5ECUA 1JDCA 2HROA 5DCEA 2YDQA 2WK2A 5ABFB 2AGTA 3D46A 4NZ4A 3QW4B 3BH4A 4MADA 3GR4A 3BOLA 3QHNA 3L4UA 5CZKA 2EF9A 2HVOA 2JKAA 3G1XA 1M65A 3OO2A 1JD9A 4L65A 2WKJA 4IMAA 2VENA 4LGXA 4PE8A 3PZMA 5DXXA 1DL3A 1V02E 1POJA 3K30A 2YCIX 3R1ZA 1GV4A 4IMGA 1K8XA 4ML4A 1ZJHA 3HGOA 4G8TA 1RAKA 3ABRA 2RDWA 5CCZA 3EXRA 1BG9A 4KFNA 4GG9A 4MWAD 4ZO8A 3KZPA 3PUDA 5CSSA 2FGLA 4ZO6A 3GC2A 3SCPA 4NX0A 1P6CA 3H70A 1BSLA 4XKMA 3LB8A 2OT0A 1FWDC 1EFZA 1VPYA 4HU3A 1JUBA 3LN3A 1FXQA 1FFUC 4K3ZA 1D7FA 1DWHM 1EX5A 4HJFA 4IX2A 3SZ8A 2ZRWA 4LYPA 4DVOA 4XZ9A 5A6TC 2J7GA 1HKVA 4WF7A 3MS8A 4EMIA 3KTXA 1TE6A 2JFEX 1ITQA 1W3IA 4O54A 2JGQA 1Q6EA 1Q66A 4POCA 2W0UA 1K70A 1L6WA 2RFGA 1CECA 1XLCA 3LCWA 4PMXA 1RBOB 4LOCA 4K39A 3FVDA 5H6HA 2WJZA 4JX4A 1FXPA 3SECA 3OVRA 4CQBA 2WWDA 3GDMA 4PFHA 2D3LA 3NO3A 3AWNA 1H6VA 4ZB5A 3C52A 1PX3A 2V5BA 1UYQA 4WXZA 1WUEA 1G4PA 4R5EA 3E6EA 1MI3A 2ZBTA 4W8BA 4XZBA 4CNOA 1Q3NA 1NF0A 4LXFA 1VIZA 5JCMA 2JF6A 2YDSA 1I60A 2WB5A 5I3JA 4ZOCA 4GXMA 1NHPA 2QV5A 4AXNA 4AF0B 5LKYA 3GDKA 4QEHA 4JKMA 5FAGA 2VO5A 3R10A 1CX9A 2XIIA 1J79A 4WXYA 1UKPA 3GNNA 3LA4A 1XD1A 3DFYA 4CU7A 4HIBA 4BK9A 1AH0A 1WDPA 4W4QA 3RPDA 3TC3A 4REQB 3TYDA 4NT0A 3S3GA 1F05A 3IVTA 1LLOA 5I3HA 4HHPA 4A8RA 4CCCA 1QI2A 1IXOA 2Y2WA 1AODA 3VKJA 4Z2JA 1Z6KA 1H7WA 1QK2A 3C8NA 1GQNA 4D6EA 4AZ6A 5FF4A 3WH7A 2HBXA 1IHIA 1I75A 3D9XA 4RV8A 1EEXA 4UCFA 2XGBA 4HA0A 4W86A 1XDMA 1RY8A 3KW3A 4EQWA 3NPUA 4LJ3A 3PF3A 3VOHA 5G1TA 1CB2A 1ECQA 3EDKA 2GH5A 3A22A 2X0SA 3NRZB 4H50A 4J2MA 2VC5A 2XGZA 1MRAA 3STPA 4D6HA 3LQGA 1XV8A 1RVKA 3SGUA 1HNYA 1BVZA 3QLLA 3WG6A 1IT7A 3SCWA 4XZLX 1FCUA 1LVLA 3W70A 3M16A 1XI3A 3KVJA 4KEVA 2CLOA 1US2A 4WIWA 2TMDA 4DO7A 4AQLA 3KOXA 1KRCC 1JZ4A 3QHOA 2FGZA 1ELSA 1EP2A 1E1CA 4S3BA 2E4TA 1TPUA 3LLXA 2CBUA 1ZFJA 5FOOA 2EJ1A 4WZHA 1WZKA 2GVJA 4DO5A 3DKJA 4XX6A 3CEPA 2WZIA 2ZRVA 1Z48A 4UNLA 3UPMA 2QAPA 1VEMA 4IIFA 1XC4A 1QHPA 2B7OA 2R1NA 1SMDA 1JCTA 4J3ZA 3W7LA 1V93A 2W6RA 1I0DA 4EMJA 4C1KA 3C0SA 3FGCA 3L5LA 4AD1A 3VIJA 1J9YA 4AWSA 5FEWA 1KGWA 5DMMA 2E1WA 4NAEB 3GC4A 1N62C 1VQTA 4KW2A 3UY7A 3CHDA 4MNLA 4L1XA 2CLPA 5ABFA 2IXUA 3WQWA 3F4NA 5LA1A 3AMCA 3G3DA 2IW0A 2ODOA 1S38A 4HMEA 1Q2RA 1W1ZA 3ZS4A 4MAZA 4GO8A 3CYVA 3W23A 3W29A 3R11A 4M6VA 4ZFMA 3GIYA 3SCNA 1QW9A 3LHWA 4IHCA 4AVNA 4Z42C 3MC5A 2GQ3A 3RM9A 3EKZA 1LL6A 1W91A 3T55A 3AI0A 1A5MC 1N61C 4I6KA 3GUGA 1XLEA 2CPUA 4ILSA 4UFHA 2XJ7A 1FDJA 1NF7A 4PUDA 3WBYA 6ALDA 1R2TA 1V6WA 4CU6A 4IPIA 3B03A 1PPIA 3SUTA 2J88A 4P8VA 4A2SA 4DQWA 1L6GA 1XH1A 1J11A 1T96A 2FFCA 3NZPA 3M0VA 1ITUA 5LNVA 4QG9A 1WYGA 4PTDA 3LM3A 4GO9A 3AIWA 1H2IA 5HWMA 3N3MA 4MNMA 3WQFA 3G8EA 3GXIA 3TYUA 5HNTA 5J04A 2VFIA 1R3VA 1RVGA 3LNPA 1ZP3A 4HPXA 4Z1AA 1GVFA 1UR4A 3KLJA 3K46A 3NS1B 4AB4A 2V2HA 5JCLA 1RCOB 1KQYA 3G18A 1S7MA 1E0TA 3GDLA 3S4TA 4HOWA 3MY9A 2YR1A 5CKSA 3L4VA 3KBNA 1HT6A 2WYSA 2ZRZA 1Z8AA 2AAMA 3M0ZA 1Q6DA 4HK7A 4ACYA 3ZSTA 2MUCA 5AZ1A 2BP1A 3GAYA 3CAKA 2DT2A 2QDGA 4AUBA 4H19A 4YWIA 3KFTA 2FHFA 2X7VA 4QCEA 3S5ZA 3E0FA 1J0YA 2Z1KA 1PUDA 4AHOA 3H4GA 4N9BA 5LYRA 3QZAA 1F74A 1OD8A 3VCNA 2VL4A 4PYSA 2X1RA 3MO7A 4RKAA 1GW9A 3EB2A 3NQDA 1C90A 4XVEA 1QI5A 4HU8A 2ZZ4A 1B90A 3QGAC 4PB5A 4YU1A 2DZBA 3B4YA 3AYSA 2WMKA 1IQ8A 1H5VA 4G9PA 1OYAA 1FRBA 3KOFA 4IQJA 4FNPA 1TYPA 1N63C 3IUDA 2X1SA 5D2TA 2V67A 3E96A 2PU0A 3ONCA 2J62A 3FN9A 2J77A 4WSJA 4NAFA 1K6WA 2F84A 2YA2A 2ZXQA 4ROQA 3SRHA 1NARA 1TR1A 4TX6A 4RE0A 3WD1A 1F5ZA 4I7UA 3ICJA 1VFSA 1JNDA 1WO2A 1BAGA 1QI3A 3WY1A 4I9AA 1CT5A 3QXBA 4I5XA 3GRSA 3CWHA 2W91A 2QJHA 2JALA 4PBGA 1XIIA 2QDHA 3TWBA 3V35A 3PUOA 3W1QA 3A7AA 1G01A 4DJEC 4OIFA 4Y8FA 5FL0A 3VIPA 4KWSA 1MUMA 2GWNA 3GU1A 1P43A 2QGYA 1XSJA 3HGSA 5TAOA 4KEMA 2VUNA 4TQTA 3CT2A 5HJYA 1XRTA 4YWSA 2YDRA 1EBGA 4Q4OA 5U4NA 4H4IA 2NX9A 3P14A 3FSUA 1GG0A 1GHRA 4UTTA 3HMCA 4J2PA 1FY6A 2ZA2A 5BWFA 3CGTA 4ADUA 1TPDA 4DWSD 1EUAA 4DLFA 3RJXA 3WQCA 4ZQPA 3GTFA 4P7OA 3VNJA 3SSJA 2C91A 3UWWA 3R07C 1KTCA 5AC6A 1EA0A 4ES4A 1UBSA 4DYJA 3PTQA 3DYOA 3FIGA 3AMZA 4DNHA 3CZKA 1OM0A 4H2CA 3DH7A 3HGRA 1W6TA 1K8ZA 1O12A 2E25A 1ZPTA 3W75A 4JAWA 4WRHA 4S3KA 1V0LA 1NHSA 1AOGA 4Q8TA 2E40A 3JZUA 1KTBA 1IR1A 5FS7A 4BI5A 3OVGA 4K1GA 2OELA 1OX6A 2PWGA 5DF0A 4FLSA 8A3HA 1DIDA 1H5YA 1WYIA 4D71A 1YW1A 1QK0A 2ZADA 1R85A 2HV5A 5E93A 3GD6A 5CSUA 1AQMA 2FH8A 4B15A 5FF2A 3KTCA 2Z7GA 3GO2A 4C6FA 3SUSA 3SY8A 3F7JA 5I79A 4IT1A 3NFUA 1YXDA 5LIYX 1RHCA 3U57A 3WIJA 1UZHA 5ER0A 5JXQA 3BVJA 1Q13A 2IXVA 3WMLA 2ZX5A 4H00A 2PWDA 2E9LA 3CUHA 4NX5A 1GRBA 5FMHA 4D9PA 2WSPA 4FEZA 3EXSA 4M52A 5I6SA 4Z2KA 4H8HA 5C70A 3EYPA 4RE4A 4KGLA 4RK8A 3H4KA 3IAPA 2A79A 2PAJA 3TTOA 4IP5A 3RN6A 1XLIA 3H2OA 5CBJA 1W9VA 1S3HA 4H4RA 3MUCA 3R8GA 2DVXA 2H3DA 3GW3A 1GHSA 4UQDA 5A6KA 5FEZA 3FEMA 3S2JA 4H4WA 3NPVA 3VNDA 6REQA 4PRWA 2QCMA 5CPMA 3NQ6A 1T99A 1GOQA 4GPNA 1E71M 3EAOA 1TV7A 2PMQA 3WUGA 1E9LA 2YL9A 3I3EA 4JNZA 1ZBCA 1ZBKA 2CCRA 4QSHA 4CD8A 2C71A 1E1CB 1OFRA 4HYRA 2G37A 2GL5A 3LLDA 2DH3A 2R14A 3ZQ9A 1NDYA 4KBXA 1BF6A 1G1YA 2Z28A 5I0DA 1UBPC 2CLIA 1DJHA 1CGYA 2I56A 3R5EA 4XG1A 2PWUA 3TA9A 1SFLA 1R3RA 1J5SA 3P60A 2XSXA 4MUPA 3OLEA 3HQOA 4G1KA 4W5UA 2EG7A 3OYZA 1XPGA 6A3HA 1SR0A 4U5KA 4TVUA 3AZSA 4F2TA 1EF2A 2J8FA 3TN4A 3BV7A 1ZMCA 4LAZA 5C9RA 1H0GA 3QYSA 5FI8A 1XIBA 1D7YA 3L0KA 3NSMA 2QR6A 3E74A 4O11A 2EKGA 3KDNA 4OBRA 1H1NA 4HJWA 2A7PA 2CLLA 4PRTA 4EWND 4TV5A 4GGHA 1KM6A 3OG3A 1XDJA 4UR7A 4GCXA 2QPXA 4GMEA 4B2DA 2OGYA 3BOXA 1ADSA 4LT9A 2PDPA 1BWKA 4GKTA 1DIKA 5LHEA 3QPZA 1XLJA 1XBZA 1ITXA 5KZ6A 7REQA 1MZRA 2PTWA 3AS2A 4WJ8A 1GEQA 3H2FA 1PE1A 2Y4SA 2QS8A 2C1HA 1KCLA 4GY1A 1F8WA 2EG8A 3APYA 2Q02A 3G1RA 1I2QA 3WBWA 3OQEA 4Q4SA 1W1B1 1S46A 1P0DA 5I07A 1S5NA 4GY0A 5FEPA 1PB0A 1Q6FA 2VZTA 2WOQA 3N25A 3VMOA 3JW7A 3UWEA 5LIKX 3CUFA 2BMBA 4GABA 3EPMA 1QPRA 2XIQA 3GD4A 3KWXA 5AECA 3VD7A 3E02A 1CZ1A 3WD2A 4DZIA 1TZ7A 4AZ5A 2FZBA 3ABOA 3L4TA 1V03A 3DGRA 3GNDA 1WKFA 2EAWA 1F6PA 5IRPA 3CGBA 2FVMA 3NOYA 4H6KA 1YNQA 1CGUA 1TYGA 3STFA 4Q8UA 3MTWA 2B7QA 5DFAA 5HA7A 1LOLA 2I9EA 4XZMX 2V3DA 1UR3M 1TSIA 3LG3A 5K9DA 2G4FA 2WCAA 1SO6A 1B3ZA 2O4MA 3O0KA 1SQ7A 1KFEA 3H8AA 1VBRA 2BGNE 1IWAA 4NZCA 4KQNA 1MEIA 3BGJA 2X1UA 3MI3A 3F5KA 3VKDA 3B40A 5M5DA 3OC4A 4H4SA 1V3IA 3A9IA 5F4XA 4KEZA 3KP1A 5HOSA 3O6AA 4YYFA 4XUYA 3VGEA 2ALRA 3GTNA 1XFCA 3SBFA 1IZKA 3B8SA 1V0KA 2V5DA 4OHQA 1OC6A 2GUYA 1CTNA 3B8WA 4WEVX 1I2RA 3RLVA 4W87A 4L4LA 2I5QA 5A8GA 4P7NA 3DHDA 1IV8A 1QPNA 3Q6JA 3KUMA 3RXZA 5LHFA 4US6A 2KZHA 1GEHA 2O9TA 3VXGA 1MMFA 3CT7A 3GDRA 2WBAA 1TA3A 4W7VA 1WKDA 5M17A 3S1XA 4LVBA 1EC7A 1XQLA 5CBIA 1QI0A 1Q1RA 1LBMA 2OODA 2W54A 2F61A 4DO4A 1N82A 1Z89A 4H41A 3RIKA 1P7TB 3NTYA 1BHGA 3VK5A 2G5WA 3P62A 2PTXA 4AWTA 5HATA 1EBDA 3H6OA 3HGJA 1WXYA 4EX4A 2A3EA 1XH0A 2QCLA 4F2BA 1G5AA 1C9DA 3L7RA 3BCFA 3DC0A 2R1MA 3VYLA 1TIMA 1LUCA 3PZNA 5IFPA 4F0RA 3SJNA 1X7FA 1NWUA 3CUGA 1L6YA 4UTFA 1Q85A 1HKWA 1LQAA 3F1QA 4QS5A 3VDHA 2G50A 4C7FA 3VX1A 3ANVA 1WXJA 4PCNA 1G4EA 1ZAHA 3PWAA 1EHNA 4Z0JA 2NX3A 4FNRA 2YB1A 4OTKA 2OWXA 3ARYA 3ZSSA 2IPGA 1RJPA 2D3NA 4A3RA 1EL3A 1PS9A 3ARUA 2ON3A 5E6ZA 3B06A 4IX0A 1J2WA 3W2KA 4NZJA 2V69A 1TJ2A 2QCHA 2TPSA 3C2FA 5EBKA 1TB3A 1ZJBA 2GJXA 1O66A 1KWKA 4A29A 2OEMA 1UZ4A 3T0CA 3WDPP 1GXFA 4IPNB 1HFBA 3NA8A 1XXXA 3M6DA 2GJPA 4PBFA 3WQ8A 3FOKA 3G1HA 4HNOA 1UOZA 4K1WA 2A0NA 4CNTA 3AXIA 3NQEA 2GDUA 3CL8A 1LQ0A 2J7FA 1TMLA 3WEOA 1XF0A 2BS9A 2ZTJA 3KBSA 3DHUA 1E1FA 4PH6A 1EEPA 4NJIA 3QZ6A 1KXTA 1KR0A 4XK2A 3W7JA 5I3KA 1VPXA 3TNOA 4JR5A 3QM3A 4CEUC 4C6NA 4ZE4A 4WY0A 4DXXA 3S46A 1GREA 2YPIA 1W0MA 4H9TA 5HUOA 4UMAA 3PJWA 3SO7A 3KDOA 5HR7A 3WLNA 3MSGA 5A6LA 3HM7A 3OU8A 3KL5A 4OGZA 4UZUA 1R3TA 2EXOA 1AJZA 2VVNA 5CZ0A 1W32A 3W83A 3EWBX 1K6AA 3CLMA 4RW5A 2E8YA 4FP1A 4UZSA 1U33A 3GBEA 1E6ZA 5HQLA 4GJJA 5H8MA 3GM8A 3G5EA 1V4YA 4MKNA 1EYEA 1KRMA 3FKRA 1Q4NX 5ABGA 1DXIA 1JAEA 3HTWA 3S5SA 4IL0A 1N8FA 1PDYA 1MOKA 1Q6CA 1HKKA 3CK5A 1IZJA 1GRGA 3WSUA 1V7YA 3WK3A 1BKHA 4ZCWA 3CASA 4KCWA 4MWAE 5AHEA 5HNNA 5ABHA 3HO8A 4C5ZA 4DZHA 1DJWA 2V81A 2W4XA 4GVFA 1YADA 1HIZA 4U2YA 1DP0A 5DMLA 1NU5A 3WL1A 3WLHA 1FUYA 3CMGA 1JCJA 3GFZA 3MDWA 2FB2A 3CZGA 1M04A 1FFVC 4P2VA 3E2VA 1ZTVA 1NOUA 5G4HC 4IPPA 1E1EA 3APTA 4J5NA 1MRQA 1XRFA 4NRSA 2CHRA 1KGXA 2XH4A 4UFJA 1RA5A 4PBEA 3HPXA 4MG4A 1G9HA 3W7MA 5H1WA 4LV9A 2C8NA 1Z7AA 2ATMA 4OKDA 1GQLA 2WMFA 3PJUA 4S3CA 2ICSA 4EP8C 4EOUA 4DBSA 3GFYA 1PIFA 3NSXA 3MI2A 3IGSA 2ISWA 2UV8G 4FSAA 2PLKA 1YQZA 4PMUA 5AYZA 5D05A 1TV4A 2HBVA 3HW2A 3H23A 3RFAA 3A4XA 1RV8A 1VRDA 4LS1A 1MNZA 1SR9A 1UWIA 1SJBA 4M56A 3W7HA 2QCDA 3ITVA 4W7WA 4JN8A 4TMBA 3KP0A 3UJEA 7CGTA 3NYZA 4GYPA 2GJLA 3OP2A 1U22A 4MPQA 4PCSA 4WUIA 2V38A 4QISA 1YDYA 3VKKA 4JCMA 1MQRA 4TX9A 2HQAA 4H1ZA 1EZWA 2VQUA 5D30A 1HW6A 4JYDA 3RR4A 1UD6A 1XLGA 3E9AA 1XISA 3H7RA 4B5XA 2CESA 4IQEA 3K4WA 1BXBA 4EVZA 2PLMA 4UFKA 2AL2B 1ZB5A 3DG3A 4UMCA 5A2CA 2CZEA 3VOJA 5FSDC 2Y1HA 3W3OA 4HBKA 3IIPA 4XB3A 1CLKA 1EPXA 4PB4A 4WQ6A 4H7ZA 3U9IA 3APGA 3RM8A 3V3WA 4XIAA 1VYRA 3PZOA 4ECLA 2G3FA 1MDRA 1VQZA 3CMFA 1RD6A 3EX6A 1M03A 3IPWA 3WN6A 3U2EA 4GIYA 4DWSC 4X2RA 4KIEA 4IH3A 1S2AA 3IJLA 3M0LA 2R24A 1TX2A 5C71A 3HJEA 4J57A 2ZRXA 1XGZA 2PTDA 4JTCA 3N9RA 2PODA 3UWYA 3OB8A 3GH7A 1R87A 4FXJA 2YZ5A 2XVGA 3W82A 3M0JA 3TX9A 1K7EA 3A4WA 1HP4A 3NVYB 1G67A 3DOPA 1WDQA 2P10A 1J0JA 1QW8A 4LNYA 4MOZA 3TMLA 5CAKA 4RDVA 3UXAA 2BOFX 3WF3A 3W7RA 1UWTA 4FX6M 3QR0A 4FIRA 3WQGA 3NJ3A 2EO7A 4JTKA 1S1RA 4O16A 4PUWA 1UD3A 5I7GA 4MPKA 3UQNA 1VFMA 1RA0A 4O1AA 3QGVA 4QQUA 1ECEA 4WDXA 5HINA 3W7NA 2GJXB 2V5KA 4P8UA 2C3DA 2ZA3A 2J79A 3LTPA 1BXNA 3VIGA 2ZZBA 1JR1A 1LOQA 4B92A 1EZ2A 3ENLA 2VI0A 4Q4RA 3V0UA 5E0CA 1FH7A 4GX9A 1GEUA 1PZ1A 3VD9A 1PEZA 4MJ2A 3EDJA 4DJDA 4FOUA 1UWAA 4AD2A 3V4BA 4C7DA 3UBPC 1ISVA 3ARWA 2FIQA 3TJ4A 3SFWA 1MUWA 3W6MA 4KF1A 3RUBL 3BCJA 3SW6A 1QUMA 3LCFA 3RX4A 1I6NA 3TJIA 3DEQA 1CXEA 4NYYA 1DBTA 4WOQA 3A3XA 1S5MA 1LROA 1BWVA 3ZJ7A 3OEXA 2E5CA 3OG2A 2UY5A 3K8KA 3ARZA 4ZSTA 4LCRA 1FWEC 2O92A 1K7FA 4DWDA 3CAWA 2QAEA 4Z2HA 4PCPA 3Q45A 1Q63A 5AB3A 3DFQA 5BNKA 4YTQA 1IEIA 4U2ZA 4GI6A 1OEPA 3HOJA 1TZ9A 3QBUA 3LBOA 4B4HA 1JXKA 3L4WA 1VJSA 1BVNP 4PC8A 4I6VA 4ZOEA 2BSLA 2X0YA 4LUTA 3GZAA 3L4YA 3W2UA 3LXDA 4DAFA 1OC7A 1Y5XA 2Z27A 4LNCA 4FPSA 2DV0A 2QXWA 3UPWA 3POCA 4ERAA 1JI2A 5FCZA 3AS1A 3UERA 2JIWA 3QKEA 3AXXA 4J4KA 4QG8A 1NTHA 3HG3A 3MHGA 1VZWA 1FCQA 3UJRA 3AFBA 1E3ZA 1RBLA 2Q09A 3S1UA 4FHAA 3SURA 3LCHA 2OSXA 3EEZA 3FYYA 2FZDA 2A3HA 3MW7A 1JRCA 3T08A 1SJCA 3A47A 2FFIA 2XH7A 5LGXA 3NUKA 3D47A 1CENA 2HCVA 2Q71A 2O9OA 3BAYA 1FIQB 1UP0A 2HVNA 3AXKA 1UIPA 3NQAA 2Z2UA 3IVUA 3TQPA 1SJDA 4PTVA 1KFLA 5DO8A 5REQB 4PSRA 1P7TA 4OECA 1L9WA 4Q8QA 4WCJA 1YBQB 1IYXA 2BY0A 2DT1A 3G8RA 3S5NA 4GACA 2X42A 4O14A 2CBJA 5LIWX 3N17A 3T2QA 3UXIA 1SW3A 1MO9A 3ZWTA 4BI6A 2FH6A 3HPFA 4QBXA 1TJ1A 5K9CA 1F4HA 4JTEA 3GVVA 4FOJA 3EEGA 1E51A 3ATYA 3USBA 4Q4PA 3KRSA 3KLKA 5MF5A 1S1PA 4NASA 3I65A 1OADA 1M6IA 3W73A 4G1NA 2VX4A 4EF8A 2ZX8A 1WXZA 1DQUA 5CPLA 1JROA 2I57A 1BG4A 2CLHA 3CNYA 3BLFA 5BW6A 2Y70A 4F0HA 2INEA 5G5HB 7PTDA 4O4VA 3F2BA 1ZU8A 2XVNA 5A2BA 2QCCA 1YPIA 4CN6A 2XVPA 1D8CA 3KXQA 2AKZA 4NKCA 1A53A 3TIMA 3EGJA 4M51A 4NJJA 1A5LC 3O63A 4PUJA 1V6YA 1CW2A 2X16A 1XH2A 1QCWA 3SIMA 1E4LA 2GDVA 3W76A 3WELA 2C14A 1FWCC 4EPBC 4KWVA 1AH3A 2D0HA 4Q6JA 1GGOA 2I5IA 5AKQA 1N8WA 1YDOA 1R7AA 2VQTA 3BDKA 3DU0A 4JTIA 1JZ5A 3L65A 3H7UA 4YXGA 4MZ1A 1QNQA 1IE7C 2A3CA 2PRLA 2Z25A 3C4UA 3PB2A 4RDZA 2EQ8A 3GHSA 1BGAA 1OGBA 2WHKA 3NDYA 1O60A 1G4TA 4IP7A 4HVXA 2PDMA 1RK6A 1Y65A 4IPJA 1A4LA 1JULA 2W3RA 1BPLB 2X1IA 4PEEA 4JTFA 4NNCA 4G5DA 2QMJA 3CUXA 4M29A 1SM9A 3VPLA 3EMQA 2QT3A 3TAOA 5FJTA 3GYEA 3P0XA 4U3CA 3ABXA 1MXGA 1XD0A 2XH2A 2OO6A 1RPKA 2YB4A 5B80A 4AX6A 4ZGYA 2DIJA 3NQGA 2R94A 3HRDC 4H8UA 1K9FA 1OFQA 4PEKA 4OBSA 5FJIA 4JY9A 1HJVA 1V3MA 5I5RA 5LIXX 1L6FA 1TTJA 2NUYA 2XM2A 3GKAA 3MHUA 5CBBA 2ABAA 1CI1A 4JQ1A 1GESA 2RGMA 4U3AA 3BAXA 2YFOA 1YDVA 2W9MA 3T81A 1DXFA 3EB4A 4MJMA 3CXOA 1GRTA 2YXXA 2X40A 1YTEA 2FVLA 2QJMA 4JYFA 1OC5A 4PL2A 1RBAA 3MU7A 1OJXA 3E0VA 4E3VA 4KKXA 3FG2P 2WHLA 1TV2A 4GYFA 4ZZ9A 3C0LA 2VVSA 2V0TA 3GTXA 2VURA 3N29A 4RDYA 3WNKA 2QV4A 4Q4KA 3SI9A 2OJPA 3TTEA 2C1IA 4A8IA 2NXGA 4PGLA 1JZ7A 4OFCA 4WLCA 4PMOA 5CSYA 3P5ZA 3DHFA 4O18A 3ZM8A 4UQAA 4HHMA 2XYLA 1H51A 2UBPC 4MF4A 3LCIA 1HTIA 3IJDA 1CGTA 5D8WA 3C2RA 2Q8ZA 4JHZA 1QNPA 3V0SA 1A0CA 1UQYA 2CU0A 3UZWA 3VOGA 4Q4QA 3K4DA 2YZRA 1K4HA 2PU1A 1QATA 2WBGA 3LMZA 4ZB2A 3ES8A 4H9MA 2PDJA 3LS9A 2PGRA 1VFUA 3IIXA 4ZEPA 2P76A 2A85A 2ZUWA 1B5TA 4N9CA 2TYSA 2G97A 4UIOA 4GXPA 4DBUA 5T8GA 1VGAA 1OT1A 3BAKA 5TNVA 1JI1A 4HGXA 2CZFA 4AFYA 2J7EA 3PZGA 4S3AA 4ZOBA 1KCKA 2ZXBA 4OZOA 2VELA 3H2NA 3WKZA 5LNUA 3CGEA 3GX9A 3BSHA 3C2OA 3ZMRA 3DAQA 1XKJA 1SZEA 5LA0A 3URNA 4CUCA 1PWMA 4G7EA 4LA1A 3WEZA 3KHDA 5JQ9A 1F6YA 1Y5VA 3FEQA 5GPRA 3LRMA 4I9JA 2QUVA 1RALA 4O57A 2W92A 1TCDA 1XQKA 1KTNA 4QM1A 4UOZA 3UETA 2YCKX 4LBUA 3QRHA 1VFHA 1ZZMA 1NIUA 2A1YA 3HPAA 4CLMA 3V0TA 1Y7VA 3GK0A 1GJPA 3LXCA 4UMBA 3T6CA 3NQ2A 1S3TC 2CEQA 4LAKA 2DSKA 3ARQA 1UP3A 2HNHA 3WDJA 3T7VA 2VWTA 5AYYA 4TOQA 4IUOA 4UTUA 5HXMA 1SFJA 3W6YA 2ZQ0A 1B1YA 2TAAA 5M2FX 3UT0A 2G96A 3K5XA 2V3AA 2F6UA 2J75A 1LDCA 3O7UA 3GVWA 3RJYA 4M1BA 1S39A 2WV8A 4LUIA 1NHQA 1I45A 1R47A 3VOIA 4L56A 4DN1A 1KFBA 3UA3A 1H7PA 3VIFA 1E4NA 1Z9AA 4QP0A 1V6TA 1EIXA 4G7EB 1QNRA 3IRDA 4M80A 3WX7A 5D09A 2DY3A 1PVNA 5CZTA 4BWLC 2D24A 2QPSA 1POKA 2CETA 1HJUA 3DBNA 3U48A 5BZAA 4HCHA 3NL3A 4PCFA 2NLIA 1KCZA 2WJEA 5I03A 2QEZA 4IMDA 3GHUA 1P0KA 5K7JA 4DJEA 4MNKA 5I3IA 1DTUA 2FMNA 3WBXA 5D37A 3TZFA 3L5OA 4HA3A 1KBBA 4Q7BA 1ISXA 2Y61A 3NVWB 3BJFA 3O06A 3VNLA 1GERA 3CUZA 1G7VA 2VOTA 3DHPA 1E9ZB 3W7PA 2ADAA 4PUMA 1E3XA 3WK0A 4A3YA 3U5YA 1TUFA 4GRTA 2WC3A 3NGFA 2DW7A 2VDHA 1GKPA 1JQXA 4GE8A 5E70A 1XX1A 1UC5A 3VGDA 3LXBA 1X2HA 4B5VA 3TNBA 3AUJA 1B31A 2E3TA 4NZ1A 1GYNA 2OT1A 4V1YA 2WCSA 2XFYA 5IHSA 1EC8A 2V2CA 3FNDA 5FJUA 3MUXA 3VZYA 2YX0A 3C86A 3VDBA 3GG0A 1UPMB 1T6MA 3DH9A 3CPRA 2Z1VA 5A8OA 2WVVB 1UUOA 4JTDA 7REQB 5BMWA 1X1ZA 1XWYA 4MTVA 5FKYA 5BMXA 3AHVA 5KITA 7A3HA 4CU8A 3UFYA 1SZRA 4TVWA 3RILA 4GYPC 5D2XA 5GNYA 1KBKA 2YGYA 3O9NA 3PWGA 3UEQA 4ZO7A 1GOOA 3F4DA 1L8NA 4X60A 1JXJA 1IF2A 4W8AA 1W1VA 4RNHA 1I0BA 2VNCA 1A5AA 2DEPA 3TEVA 4HYVA 3RU6A 4L9ZA 1EF3A 4REQA 3PS7A 1Q2SA 1ZNNA 1QASA 3VD4A 3KZSA 4XVDA 1PX8A 3HBLA 3IS4A 1GQIA 4P8WA 4JQ4A 1JDDA 4DBDA 5LGZA 5EFFA 4GXWA 3MSRA 2GGIA 2NWSA 4FOKA 1ME8A 4J3VA 4Z2GA 2XH0A 3PP7A 1XHGA 3W85A 3CWNA 3W86A 1E43A 1GTHA 3AUOA 3O8AA 4AMCA 5BXSA 1FKXA 3B9DA 2IUZA 4GNVA 1LG2A 2ESCA 3GDBA 3ZVHA 3R8RA 3N6JA 1SSDA 4Y9AA 4LYKA 1TWSA 4N9DA 1EDTA 3NVTA 2YA1A 1AUSL 5LSMA 3EZ4A 3VX0A 3QSRA 4AVOA 3BG5A 1LRTA 4S2BA 3PC0A 3CMJA 4MB5A 2BGQA 1W1IE 4ZOAA 1ICSA 4AZCA 1JPDX 4JPGA 1MFVA 1XIFA 2JQXA 4HNCA 4ZQNA 3VOFA 4A05A 2PDBA 3NEHA 4XZNX 3U3HA 5F4SA 1W3HA 1ZALA 3W7EA 5BXRA 3T9PA 3ANUA 2JK2A 3MMUA 4BV6A 3TK7A 4P8XA 2J27A 1U1HA 4IF2A 1IEQA 4UNKA 3S8HA 3CB8A 5DRIA 1AQ0A 2XTKA 4QS6A 3FFSA 4AH7A 5JBEA 3C2YA 3E3HA 4U28A 3CZLA 2B0MA 4JTRA 4P5UA 2XGIA 1IIGA 5RUBA 3T8QA 3DFOA 2PDLA 1DJYA 1N8IA 1Q7QA 3DECA 3VA8A 3RO6A 3BMVA 3RRAA 4C6KA 4B4FA 2WZMA 1CXLA 4HOXA 2BV9A 4HCLA 4HU0A 1LBFA 2AKMA 3EOUA 2YBUA 3PTMA 1HG3A 1B3OA 2OMAA 3KBVA 2DUZA 1UUMA 4JFWA 2X09A 3S9IA 1IEVA 3L23A 3MBDA 2XINA 3H55A 2F8QA 1O1HA 1GOWA 1KFCA 1XYMA 1RXOB 4FR6A 3LX9A 4A2RA 2XVKA 4MGGA 3TYAA 2B81A 5A6BD 1OHLA 3ANYA 4C1NA 3SCQA 3EANA 1K03A 1UWSA 4X0NA 4XV0A 1DVJA 1XLMA 3KOYA 4IIHA 4LUJA 3RK8A 1H7XA 3NNTA 4I9MA 5EBAA 2KX9A 1TIWA 2OZTA 5GJMA 2ZUMA 4XBKA 5FF7A 5BU6A 1TQXA 3I7RA 2GR1A 5JUVA 1KNWA 3QFAA 1WX0A 5TQLA 3A3WA 3FCPA 2YBTA 3MP3A 4O0ZA 5HWNA 3P67A 3BLDA 3EX3A 3SQMA 3IANA 4Z2LA 1LWJA 2PDQA 3AHZA 4QE5A 3W01A 5PTDA 1TJ0A 2OO0A 3GRTA 4KRUA 1UA7A 3H2AA 3DFPA 4LW7A 4KH2A 4Y9PA 5TF0A 4ORMA 3QR1A 5GRTA 4UFLA 3QHMA 4RJEA 1G4SA 1Q5MA 1V59A 1FEBA 4O0KA 2V30A 4D6JA 2HS8A 4UBPC 1DNCA 1NOWA 2BY2A 6XIMA 1JEZA 2IKIA 1ONWA 3A7UA 4RDWA 2YLLA 1H4PA 5E1QA 1US3A 3VUSA 1MQQA 1UH2A 3O16A 1EOMA 3W71A 4OVXA 1V51A 2WKGA 2C3ZA 5KZMA 4GI4A 3LOTA 1RQEA 3MZNA 1NDWA 4L80A 3TU9A 4APNA 5FD0A 3H4WA 1YDNA 3WDIA 4JFVA 2Y85A 3HN3A 5XIMA 2WNQA 2ZRYA 1BGGA 3W37A 3AO0A 3BAWA 2PDYA 1DJNA 4E3TA 5I02A 2DUXA 3D5HA 2ZZ3A 3SSZA 3BJSA 4JX5A 1V5XA 3CIVA 1XLHA 2RKXA 2Z6JA 1D9EA 3U2OA 4DJFA 3R58A 3IIZA 3M7SA 2O9RA 3QQWA 1MW3A 3MCMA 5IBXC 2PD5A 1XDIA 1OFOA 2DQWA 3CYJA 1HJXA 1T40A 1FWAC 1XLLA 1OK4A 4E2OA 2ZWZA 3FAWA 4FA3A 1V6VA 5IDZA 4Q4MA 2WQDA 4US5A 1WZAA 4ZBCA 1F8MA 1V8EA 1Z44A 1M3UA 3IV8A 4QR6A 2ZE0A 5JIPA 2E5DA 1U2YA 5D38A 3ZT5A 3TUUA 3VVGA 3IACA 1VJZA 4L9XA 3VKBA 3KBWA 4H9VA 3P82A 1WP6A 3QV7A 5LNWA 1T41A 3SN1A 4V2XA 3KOZA 2V6OA 1E56A 1TUXA 2OSYA 3VO0A 1CIUA 3T09A 3K2GA 4MIMA 3HFYA 2NT1A 1Q4WA 5A8MA 4D6GA 2FTWA 3A5VA 3MANA 5CZJA 2QF7A 5A2AA 2GQAA 4OQVA 2FJUB 1HL9A 3LV6A 4IGNA 2PRMA 4WY0F 3FSTA 1RD5A 1M9HA 2YXOA 1ZCOA 3LLFA 1HVQA 4C6QA 3GHTA 1VR6A 1LT7A 3S2CA 3TC7A 5C7HA 1SJAA 5FS6A 1SW7A 4Y96A 1FDZA 1CWYA 4EK7A 4NJHA 5GNZA 2PDCA 2WZTA 1X8FA 4R7JA 1MXDA 2NXHA 2WNNA 3BANA 4IMFA 4JTSA 4O52A 4XD3A 1KLZA 4A4AA 3UNTA 8RUCA 1GQKA 4RL3A 2FMOA 3U8GA 3EX4A 4HNTA 3CM4A 3AIQA 2WZHA 4Q8VA 4GFIA 3M6YA 4O4WA 3M07A 3E2RA 5BRBA 3CO8A 1B2YA 2X2YA 3UR8A 3U0HA 4H4UA 2OLSA 3UWVA 4LBRA 5CPSA 4N0RA 5IBXA 4B9ZA 3ZR4A 4O19A 1VLIA 1WZLA 2I9UA 3PZTA 3UNDA 3PHAA 3GH4A 3VUPA 4EACA 2DJLA 2HNEA 3N12A 3N18A 4DPQA 3ZR5A 1JZ2A 2VZVA 3UG5A 3LCGA 3GWQA 3LD5A 1V6UA 3KCJA 1L2QA 1NDAA 3TC6A 5AFDA 3M7WA 5A8PA 3OZOA 3PM6A 3W2LA 2NVCA 1YE4A 3P7YA 4LEFA 1ME7A 2PP3A 1UWUA 2ZUSA 2DZVA 3S5YA 1KLYA 1JDFA 2VD9A 4BQ5A 2CBVA 1T0OA 3FW6A 1R5YA 1TO3A 2NUXA 4JNMA 1R9YA 4O10A 2R9RA 2VEMA 3SR7A 1LRNA 3DESA 3M41A 2Z29A 4LRTA 4UNIA 2QW5A 2IPJA 3ZXWA 1FWHC 2GGGA 1DOSA 4GI9A 5AC5A 2DIKA 1DQXA 4XO7A 2EHHA 1O4UA 1X1OA 4A35A 1TVNA 1OG0A 3PN8A 3RO8A 2X8CA 3LHTA 4RX0A 1L0PA 1QNOA 2P5NA 4C6EA 4RE3A 3TQ0A 4N2YA 4O13A 4IP4A 2J25A 4H7CA 1TELA 3W84A 1CB7B 1MYRA 3PG6A 2FYMA 3DBPA 2QUMA 1UKOA 1JFXA 1XM3A 3TOYA 3VILA 4Q3MA 4AHPA 1WNOA 1V08A 1O5KA 1OFDA 5T91A 5C2XA 3MBFA 4YIWA 2GVEA 4HYWA 4HNNA 5ECVA 3OBEA 4XTIA 4PMZA 4G6CA 2WM0A 1C29A 5BXTA 5I77A 3HFTA 2PSNA 4QJ1A 3LMYA 3T1GA 1SGJA 2X7WA 3B0XA 3T8LA 1QPOA 5FL1A 1J12A 2VJXA 4PUNA 2GGEA 1U1JA 2XPKA 2V5JA 3TSBA 3I6RA 2QUNA 4IMEA 3LBCA 3EOLA 1QWKA 2OB3A 1CXIA 4BHYA 3BMWA 5D9PA 1R8LA 1J5TA 3VAVA 1P5BA 3CQKA 3ERPA 1ZS2A 5JBFA 4I5UA 1ONRA 4I7VA 1JUEA 1S2UA 2BXZA 3FA5A 4IZGA 2JF7A 4MHBA 3DG7A 4J35A 5LIUX 3QH2A 5C2GA 3MWAA 3G6MA 3HZ3A 1ISYA 3NWRA 4P7LA 3W53A 4U10A 3FX4A 2WHMA 1ZBVA 4XAPA 3TONA 4M7SA 1J8VA 3A9BA 1YE6A 1XC6A 2VFHA 4J27A 3W02A 2QPUA 1B3VA 2AAQA 3TLLA 2Z1SA 1IGWA 5GVJA 3OZYA 1HGWA 4MJZA 4UCGA 1F3EA 3WF1A 4JQAA 4O1BA 3R13A 5D8ZA 4FK9A 4GRSA 2CHOA 3C61A 5FIPA 5CJ5A 3MMDA 1T7LA 5ENLA 5DEZA 2OR2A 4HZ7A 3URHA 5HDRA 2FTPA 4OE7A 3BC9A 1THFD 4XBJA 4NG3A 3PSVA 4N6EA 2FTYA 2ACQA 4PSPA 3DN5A 4W84A 3MCOA 1E55A 2BY1A 2QCEA 1JAKA 4CN4A 3G1SA 4ORIA 3QVQA 3I3BA 3L8KA 2CZDA 2V82A 4GI8A 4R34A 4AIUA 4DRSA 2EG6A 1G94A 1AD4A 1TG7A 1ZAJA 2J13A 2Z4GA 1OSEA 2KAUC 3HQPA 3WD4A 1GVRA 4DF2A 3TTSA 3NZQA 1AW2A 1V79A 1X7IA 5EYWA 2BHUA 1EC9A 1QMLA 3W1PA 4FR1A 1UB3A 1BTMA 1GRAA 3EWDA 3T4CA 3AQUA 4KEUA 2BVYA 3VGHA 2B7NA 4O12A 1BD0A 4AD0A 4GQBA 1JCLA 1Q8AA 4JS3A 4JFUA 1ZY9A 4ZVJA 4HTBA 1TV8A 3L12A 4L4OA 3TDFA 1Q7ZA 3B3DA 4F0KA 1ICQA 2A5HA 1J6PA 3KVLA 1UWRA 3C3NA 4XQ6A 3E12A 4O1FA 2VCBA 4HNVA 1TFVA 4FNQA 5C7VA 2YJQA 3BICA 3T0TA 3RNMA 2D73A 2FZMA 2R1PA 1R46A 3ITTA 3UA4A 1H62A 1W9PA 2XZ7A 4GZJA 1NDVA 1A5UA 4E8CA 1RM6B 3VM5A 1DHPA 3RX3A 5M1TA 4KGJA 5CJNA 2R8WA 3EWXA 1UROA 1UD2A 2O55A 2R82A 4FF7A 1F3WA 1OGGA 1UWQA 4LUYA 3WQEA 1H60A 4FNTA 1UQZA 3NYDA 3B8TA 2VEKA 1PAMA 2ZZ0A 4C65A 3BAJA 3VU2A 1RCXB 3F4CA 3NQMA 4IQLA 3AJXA 1GVSA 3I4EA 1DXLA 3ZJ8A 2VDGA 5CC5A 4GKLA 3GR8A 4DM2A 2TRSA 1LBLA 3B9EA 2OEKA 1XLDA 5BRPA 1BVWA 4QXIA 1PKMA 3ZT7A 4OOUA 2CLEA 4D6DA 1NWSA 3N4AA 4UOQA 3OJGA 4LS2A 2QJNA 5CZSA 2O7SA 2PEVA 4RXGA 2YSWA 2J3NA 3LTYA 2H3BA 3Q58A 4WK9A 4HA1A 1JZ8A 4RZBA 3W1XA 4OUIA 3REQB 1XS2A 4JYEA 4GLEA 1Q1WA 1ZKQA 4KRZA 1FWJC 5KVHA 2YCLA 1H7RA 2EQ9A 1N55A 5F1UA 3LPPA 3NZ1A 3DI0A 2OXNA 1ZCCA 5EKYA 4QDPA 1JOAA 2BDQA 3DGBA 5FS8A 3PSWA 1A5OC 4H9YA 5AN7A 3HG2A 3O6YX 4AZHA 3B0YA 3MP5A 3NO1A 2ZZCA 3BAIA 4ZL1A 2WO5A 3SADA 4H4VA 4IXXA 1LRQA 1KM3A 1MW1A 4LCSA 4QGCA 3U7VA 4DUXA 3G1DA 2PDGA 2FZ9A 3EPOA 4Q33A 3P6LA 3D3FA 4S3JA 3GDTA 2A7NA 3MUAA 4AD3A 1FCBA 2WPBA 1FH9A 4PTNA 3BURA 4PMNA 3EWUA 1ZQ5A 3ETRB 2XZ9A 1F07A 5DQPA 2BB0A 5FEXA 4X63A 4YCPA 3N2BA 1UD4A 3EA2A 4LVDA 3W87A 2E28A 1HO4A 3VZZA 4H4QA 2QVHA 5HPCA 1K9EA 3M46A 1Z41A 1QWGA 4V33A 1HX0A 3DKLA 3FJ6A 2P8CA 3USZA 4LC6A 4L6OA 3A13A 3LGGA 3K13A 1U1UA 2Q01A 3W74A 4IPLA 1W17A 3DK8A 2EJAA 2P88A 4EWJA 2ALDA 3PZ9A 1E6PA 3QFEA 4QDMA 4GQGA 1UG6A 4FX7A 4N02A 3STEA 4J56A 2EPLX 3MVIA 2FKPA 2DGAA 1DJGA 5FAJA 1QPQA 2HDJA 4KWWA 1UZ1A 3RGTA 2VRKA 2J7HA 1LT8A 2A4AA 1P6WA 4MSSA 1MQPA 3BMXA 3P81A 4P61A 1J93A 5C55A 4O28A 2BXVA 1LLZA 3ITXA 5C9WA 2C15A 3GVQA 2E6DA 3H2CA 2Z7KA 5F4WA 3SCUA 4BY3A 1YKWA 3W24A 5GQBA 7ENLA 4Y8EA 4J9JA 2ZICA 4ZOHB 2Y88A 2BOEX 3IWPA 3FJLA 4QHRA 5LNSA 1YTKA 1H1ZA 4AW7A 1NEYA 2YA0A 3EWWA 5J5RA 1LM1A 4JTGA 3B0PA 3GE7A 1XBXA 3LZ3A 2QCGA 2WSRA 1FKWA 2ZYFA 3TN5A 3W7QA 1DHKA 3KHJA 1UJQA 1B9ZA 1JPMA 3W81A 2IS7A 2Y89A 3OYXA 4IIEA 3LDVA 1PZ3A 2GPTA 4H6RA 4JTUA 4QQ3A 3WEMA 1IWPA 4K7ZA 3A24A 3GC5A 1LF1A 1MEWA 1XYCA 2VT0A 1B0IA 3N19B 4NL1A 3GXDA 4R27A 3BLPX 1PTDA 4PUUA 1EYWA 4WX2A 2XVLA 3SN4A 3O2LA 3VM7A 4ATDA 5CEWA 3UG8A 3MMTA 2DJXA 1LP6A 3A12A 2GVGA 3WLTA 1CGWA 2WM1A 1A5SA 1TTIA 2XN0A 4UOJA 5IHRA 1TZZA 1EJTC 2E6YA 1WDSA 3WMCA 2NV9A 4GNJA 1XIJA 1ESWA 4ZQMA 2DW6A 3UCCA 4XZHA 4FS9A 2HQMA 5AY7A 1F7BA 3DX5A 3FVMA 3OIXA 4FLRA 1CGVA 3N34A 3ZLGA 2UWFA 3KVKA 1AG1O 1EXBA 3GY1A 2NWRA 4GIAA 3KM8A 4GBDA 1J0KA 3EPNA 1M41A 4UTWC 4UQCA 5C9ZA 1H3GA 4GA8A 4AEEA 3WO8A 4NQ1A 3W1AA 4BEQA 1KFKA 3ABZA 3N9SA 3W1RA 1DWJM 4PMYA 2ATSA 3N2OA 2QDEA 1W8GA 1LPFA 3ITLA 3NQ7A 2Y0FA 1J01A 1VAHA 3NXLA 4YYCA 3FJ4A 2VEPA 1LTDA 4LX4A 3VI2A 3PPHA 1OF6A 4XUGA 2ZA1A 3QV9A 1BLIA 1WAWA 3THUA 2VUYA 3CBWA 1AW5A 1W9UA 4IG2B 4HK6A 4C7GA 1MO0A 2FLIA 3W0KA 3PB0A 1HL8A 3URAA 4PFMA 4JIQA 3W7DA 1VYSX 4LBSA 1SFTA 4Q32A 7XIMA 4F0LA 4DF0A 4EM3A 3B9NA 4H9XA 3OGSA 4DWSA 1NVMA 1E0WA 3VZXA 2BX7A 3WNPA 5DBUA 3TW9A 2WHJA 3PBYA 3VMPA 3A4AA 1X98A 3UGRA 2ZCGA 2CWNA 4R33A 2Z1WA 2WLZA 4WGXA 2Q3RA 1TTQA 1SZFA 3A23A 2VWSA 4KIRA 4J28A 2JEPA 2PWFA 3W22A 1W2PA 1BXCA 2OVLA 3LM7A 1LL4A 3T2OA 1LZOA 1Q65A 2VX6A 2RAGA 2ZUVA 2GVYA 5KZEA 2PC8A 5IDIA 3H12A 5DN1A 2W67A 3ZZ1A 3DUGA 3MYOA 5CLWA 1JQVA 1I9CB 1B57A 5EBUA 3WK2A 4DLMA 1ZAIA 2PUZA 4IMCA 3K8MA 4GR1A 2JE8A 3F5JA 5BOOA 4K8DA 1RUSA 1QO5A 4QG6A 4TVDA 4BQ3A 2TODA 2OGJA 1KKOA 2Q8LA 1FWBC 1J0ZA 4AC1X 1HGYA 1VCFA 4Y7EA 3DGHA 4UTJA 1A5KC 1KKRA 2VZUA 3CXBA 1DE5A 4RZ5A 1VFLA 3TMQA 1VEOA 1UCWA 4ZR8A 1UW9A 4H8NA 1WCGA 1XICA 4Q8MA 2DZPA 2RHGA 1OVDA 1OT2A 3RX2A 2F9RA 1PDZA 2E0PA 4IGSA 5DT7A 4WR3A 2FZNA 4L61A 3UZYA 2YDAA 1HQTA 3RCNA 2PP1A 3TFXA 3WFAA 1VC4A 3AMGA 1RCQA 3B8UA 3KCLA 2TSYA 1XBVA 2WVTA 2P3EA 3NQBA 3D3AA 3P74A 2WOVA 4BURA 5I3DA 3CS2A 5H8PA 3CZ8A 3R4IA 4ML9A 5BOFA 1N5WC 2I14A 4CD5A 1XIDA 1XRVA 4TIMA 4EF9A 1PBGA 3UYIA 4FMVA 5D03A 1GPFA 4PMVA 2YKKA 4B9YA 1L2UA 4Y90A 1K7XA 3PFMA 5AHNA 4YCOA 5JBDA 1Q7MA 3D0CA 3BW3A 2BY3A 4BJHA 2EGZA 1OF8A 2J78A 2ZZ7A 3LV5A 3ELFA 3F2DA 1EJVC 2WJDA 3TW6A 3SCRA 1WQ5A 1GONA 1FWRA 1NWTA 2YBVA 4RNFA 3ZLFA 1KR1A 2IPWA 5DY2A 3RAOA 4LC8A 1AJ0A 1DYSA 1EQCA 3U2CA 1PXGA 5G1MA 1DIEA 4AIEA 2BNJA 3QR3A 3IGUA 4EAYA 1G7UA 4IIDA 3SRFA 3SQSA 3SJ3A 1R2RA 2ZFAA 2PLCA 3AIEA 2F6XA 4KPLA 2QYGA 4TTUA 2NW0A 3PAJA 3URBA 4B3ZA 4JFSA 2VEFA 1YIXA 1H61A 4FI4A 3CTTA 3TOPA 1M7PA 2OOGA 1EX1A 3FDKA 3I6TA 1H0IA 2HRWA 3GXTA 2YL8A 3AHYA 3V18A 4Z1YA 2XG9A 4UB9A 1D3HA 3PJTA 3ISIX 1E40A 3QV6A 3R0KA 2V2DA 3SDOA 3VFLA 1BSIA 3UESA 4QFUA 3UR2A 2C3CA 4FXSA 3U5UA 3OW1A 2GQ8A 4IM4A 5D9OA 2CIPA 4RE2A 3LEPA 1JRPA 4B5SA 3QOKA 3KE0A 3RR1A 2XFWA 1P1XA 3NL2A 4AZGA 4K6AA 4K38A 3TJXA 1JUKA 2GR0A 1XBYA 1VYPX 5AYIA 4AY8A 3VKCA 4MM1A 1L8PA 3WJXA 1WV2A 4XZIA 1FP8A 2HS6A 4Z2IA 5CC6A 2QHAA 2QQ6A 1EDGA 5EB8A 4TV6A 5MHBA 1ADOA 5LZLA 4Y9NA 2W3ZA 2W79A 2YYTA 5C2CA 3LBMA 1R86A 4UTTC 2Y8UA 2VC9A 4XD5A 2VRQA 4Q7IA 1F3TA 1QFEA 4DY1A 3MV01 4OV9A 5I2UA 4C6PA 3PZUA 2OZ0A 1C3FA 1YEYA 4LB4A 4CD6A 4S23A 1TPEA 1QHZA 1OYBA 2ACSA 3GXFA 2GLKA 4HQVA 1W37A 3IV3A 1U5HA 2REQB 3WQVA 4OT7A 4Q6XA 1E5JA 4F40A 3WQDA 4K8HA 2VFGA 5JCIA 1RPXA 2P3ZA 4L5ZA 4HPHA 2ZC1A 1XIMA 4PB3A 4UQ9A 1W5OA 4JCLA 3ZR6A 1NH6A 1CBGA 1M01A 1XCXA 4V27A 2VC6A 5AYXA 3Q2DA 4DUOA 2Y7FA 2V68A 1JYVA 3UU0A 1GQJA 3TN3A 1TPC1 1TR9A 1FBAA 4NAEA 5TD4A 1NOFA 2VZSA 5K4ZA 1XIGA 1C93A 1H63A 3GTHA 1YPXA 2PGFA 3OZPA 4CCDA 5A6BA 1N2VA 2Y5SA 4B5NA 2ASHA 1IT0A 2BLEA 3CU2A 3OGRA 3PG9A 2V3FA 1O7AA 2QKFA 2C16A 4J3SA 4S3EA 1F2JA 4IFKB 4J40A 4B5UA 4ACZB 4ZSUA 4FLQA 3OGVA 2NVKX 3GXNA 1J18A 2J6VA 2HSAA 1EO7A 1GORA 1FEAA 1IWBA 3PBUA 1FHLA 5FJOA 2BGSA 2WP5A 2OOFA 3KX6A 3N4FA 2WC4A 4IG2A 4DJFC 3R89A 3OVPA 2WC7A 5A6JA 1F76A 3K1DA 3FA4A 1NQKA 1BYBA 3BLKA 4DJDD 4LAUA 5CC7A 1VH7A 1WKEA 4MYXA 2V6AA 1OFBA 3WLQA 3SRDA 2B4GA 2VP8A 2PBGA 3VC6A 2GSJA 3THDA 4AZ7A 3CIXA 5AYBA 3NL5A 1YX1A 3M0KA 3NSNA 1VLWA 2YFNA 3LHUA 1I8JA 5A6SA 2VX7A 4UTLA 5IXEA 3N11A 3N9KA 1DJIA 4QX4A 2QUTA 3RU8X 3RCYA 3S2LA 3F5LA 3TXZA 3LTSA 4NYUA 4MZYA 4H8VA 1EOKA 2ZIDA 5AHFA 3R8HA 3N2MA 1QR7A 2GYIA 4HN8A 3E49A 2F7FA 3GLCA 3RMJA 3T0DA 2BWGA 3NM1A 2DPEA 4J3WA 1TVLA 1H7OA 1UIOA 3VCCA 2OQYA 1XCWA 4R9XA 2Y7GA 2FZ8A 1ONEA 3BV4A 4L6HA 1M1BA 3FV9A 5A8QA 1B3XA 2PA6A 4JQ9A 4Q7NA 4F4RA 3O05A 4E2BA 1W3KA 3LGEA 3DK4A 3MMWA 3C0QA 1SO3A 1UR8A 4NZ3A 2INFA 2E3ZA 4DAIA 3GVRA 5DCDA 4PZVA 3CLWA 4MWAB 4XSMA 1AW1A 5EMJA 1U83A 2WNZA 2H9AA 4HHLA 4D2JA 4YN5A 4AU0A 2OTDA 3V1PA 3UYCA 2PP0A 1TPB1 2BZNA 4DWSB 5HAOA 5C54A 4PMQA 4HKPA 2E9MA 3E0LA 3BARA 1PX4A 1OIFA 4W8LA 4F8XA 5EGRA 2PS2A 5KMYA 2BVWA 2CITA 3BZGA 3WQPA 1GOXA 2IKJA 4W89A 3GHRA 1XFBA 2I5GA 2Y5JA 3VNKA 3WH6A 1MDLA 1O5RA 4WVXA 3ZO9A 1FWSA 2BC0A 1W31A 3N2TA 1KM0A 5D2YA 5A69A 1A47A 1C8XA 2X2GA 1XRSA 1LORA 3P2VA 4B3LA 3VNYA 2GSEA 1CCWB 5AC8A 3ID7A 2I7GA 4BQ4A 2CBIA 3DFSA 3M47A 1IIHA 1PYFA 2WSYA 3AYRA 2ZX6A 3W72A 1CLXA 4L4PA 4N4PA 4QIUA 5I09A 2X05A 5CGMA 4MDPA 2BOGX 3UZXA 4MWAA 2BFGA 1XG3A 3BPWA 4LYRA 3Q65A 1SU5A 4JHMA 3WNLA 2WP6A 2GSHA 4MZ8A 2X8GA 3WZ0E 2QCDB 3GYCA 5K9XA 1QTWA 1RJQA 3WDQA 4CQDA 3ZT6A 1HJQA 1Y5WA 2YXGA 1SYTA 3T4WA 1AJ2A 1K1DA 4CNPA 2CHNA 4C6BA 4M82A 5XINA 5AZ0A 1CXHA 2E5AA 2PB1A 4C6DA 1W1YA 4AZCB 2O0TA 4M19A 7TIMA 1NFPA 5KVIA 3AMDA 3J7HA 3EWZA 1V97A 3EUB3 2Z6IA 1S5WA 3KBJA 4EXAA 4QROA 3PBMA 1XR2A 5D4YA 1HJSA 3SGZA 2OEJA 1OQFA 4JTLA 2GRTA 2NV1A 3M1ZA 1BYDA 3L9CA 3ARPA 3GVGA 4DYEA 3B8IA 5FA5A 3SFKA 3V1HA 2AQOA 2DZUA 3WK1A 3ALGA 5DXYA 1LUCB 2V5LA 1KV5A 1UR0A 2H90A 1W1PA 2QCNA 3AC0A 1AH4A 1VHNA 1R3YA 4N9EA 4H6QA 2DORA 2VR2A 1DIOA 4WDUA 1Y0EA 2YL5A 1GRHA 4LFYA 2YAUA 3SGGA 3P8JA 2A6LA 3BK0A 1UMYA 6ENLA 3ORWA 3IARA 5C0QA 1M7JA 4M7TA 4R9OA 3G0SA 1ENUA 4FO4A 3V5FA 3T42A 1UH4A 4WKAA 1JDEA 3G22A 3OTRA 4GYJA 4RLIA 3RHGA 1DWAM 2D20A 4JQ3A 1JD7A 1GYLA 3FAXA 1NQ6A 2WVUA 3QZEA 3S1GA 4NXSA 4TO8A 4B5TA 3KBMA 3AJ7A 3M64A 1C91A 4RNJA 1KB3A 2GR3A 5HJXA 1AA1B 4LYQA 1HL2A 2PF0A 1FDYA 1AK5A 1IR2A 1GKQA 4EPKA 4LALA 1Q8JA 3WLJA 4AC7C 3F2CA 3M5YA 2TPRA 1PHWA 3EX1A 4TMCA 4CVWA 2ZUNA 3GG8A 3L0GA 4CNNA 1V3HA 1W56A 3FXYA 1FOBA 4HK5A 3HPSA 1K3UA 1AZ1A 2GZXA 3BTNA 1FH8A 2VGIA 1ADDA 3CPUA 3KEHA 4AYSA 3DXIA 1XW8A 3T0BA 5I78A 2LLEA 1EDQA 4GUGA 3WL0A 4Z0SA 1BQGA 1MNSA 3ITOA 2BODX 2P8BA 1YHTA 1PKLA 1HVXA 4S3FA 3I7QA 4G2DA 3LPOA 1EO5A 3M4HA 2IQTA 1XKYA 4O0QA 1UA3A 3WFLA 5D04C 1WE5A 3BG9A 4E38A 3TR2A 3NO5A 3INPA 4JIHA 4CQ8A 3CC1A 5HMEA 3WFZA 3ECQA 3KRUA 3R0UA 5JH2A 3VE9A 5T26A 1W9DM 3SR6B 3QPEA 3W88A 2OWWA 2NT0A 4AWEA 3R25A 1CEOA 4Z1CA 2O4QA 1BQCA 3TV8A 3LHYA 3CZEA 1N60C 5KEZA 1IXQA 1EIBA 4D8AA 1Y8BA 1S5TA 1R3QA 1MW2A 2O56A 4RZ6A 2WOWA 4KESA 1DORA 4KS0A 3WH8A 2GK1A 3BW4A 4NI3A 1VFFA 2ANUA 2DIEA 3GQYA 3EAUA 1PCWA 3UJ2A 4C91A 1RLCL 1ZGDA 5JH1A 1I4NA 2JGYA 2EKCA 1OABA 1WAUA 3LB0A 5FESA 3HU7A 3TCSA 4DYKA 5CC3A 3QJAA 4XBSA 4Y2WA 1JCMP 1TREA 1MXSA 1A3WA 5AVNA 2A8XA 2EPMX 3CQ0A 1UPPA 5FJPA 1VENA 1S2WA 1VBHA 1F6KA 4JTJA 3S6DA 4LAMA 4W93A 1ZXIC 3W2NA 2DSUA 3B0VC 1K9TA 2FHCA 3B8DA 1MEHA 3ZJKA 1H2JA 2J9XA 6TIMA 3PPGA 1FO4A 3DG6A 3LCLA 1N5XA 2V5CA 4PMDA 1GVEA 5M03A 1PYMA 1VF8A 1R2SA 5C5YA 2ZKMX 1RH9A 4L4MA 4V15A 4L6DA 3WF2A 1E5NA 3R43A 4IL2A 3WNOA 4CD4A 2GR2A 4PR4A 2ZZ5A 1MWOA 4U4MA 1RLDA 2J66A 1UMLA 2WPGA 1GJUA 2D0GA 1WKYA 1J10A 3KVMA 3AXHA 3VGGA 1NP0A 3E2QA 3IK2A 4YPJA 4A8NA 4AEFA 2OFJA 4CN1A 4U31A 4JTQA 8XIMA 5E6YA 4AF0A 2PCQA 2E9BA 2P53A 2NQ5A 2GJNA 3FLUA 3O3RA 2W3SA 1R3WA 3QF0A 3ARRA 3RLUA 4CVUA 3BUVA 3S1VA 1YLVA 1N7KA 4C6JA 2PE4A 4HU4A 3PANA 1XLBA 4R85A 4JFTA 2EPOA 1XYBA 3LRLA 4I9TA 3CQHA 6REQB 3CV2A 3VINA 3WMBA 3VDAA 3P61A 5T9CE 4WDTA 4UFIA 2PF8A 1QJWA 3AOFA 4G7FA 4DO6A 1P0BA 3RRXA 1JEHA 3SN0A 4MFDA 1FHVA 4H01A 3L5AA 1WBHA 1DE6A 1PCKA 2PDWA 5HUPA 1PTAA 2ZZ6A 3M43A 9XIAA 4JTHA 1A5CA 1GVQA 1NWRA 1EB3A 4UWMA 4E2DA 5ABTA 5BCAA 1XP3A 1OIMA 3SCOA 3O6DA