2P0IA

Crystal structure of l-rhamnonate dehydratase from gibberella zeae
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
407
structure length
393
Chain Sequence
b'LSSVKDFPKIKAIRSFIIGHWLIDSDISTPASKWEQYKKSRTSWGINVLGSFLVEIEATDGTVGFATGFGGPPACWLVHQHFERFLIGADPRNTNLLFEQMYRASMFYGRKGLPIAVISVIDLALWDLLGKVRNEPVYRLIGGATKERLDFYCTGPEPTAAKAMGFWGGKVPLPFCPDDGHEGLRKNVEFLRKHREAVGPDFPIMVDCYMSLNVSYTIELVKACLDLNINWWEECLSPDDTDGFALIKRAHPTVKFTTGEHEYSRYGFRKLVEGRNLDIIQPDVMWLGGLTELLKVAALAAAYDVPVVPHASGPYSYHFQISQPNTPFQEYLANSPDGKSVLPVFGDLFIDEPIPTKGYLTTADLDKPGFGLTINPAARAKLIPSDYLFKVPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-rhamnonate dehydratase
publication title Crystal Structure of L-Rhamnonate Dehydratase from Gibberella Zeae
rcsb
source organism Gibberella zeae
molecule tags Lyase
total genus 114
structure length 393
sequence length 407
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.90: L-rhamnonate dehydratase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2p0iA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2p0iA01
3HPFA 4A3RA 3S47A 3K1GA 3EKGA 1MUCA 4H1ZA 2AL1A 2GSHA 1ECQA 1WUEA 3V5CA 5IDZA 3QKEA 3FVDA 4HNLA 4IL0A 2OZ8A 3UJFA 3UJSA 3RGTA 3SJNA 4KWSA 2I5QA 4K8GA 4GGHA 2P3ZA 3STPA 2PODA 4E4FA 4GYPA 2OZTA 3UJRA 3VA8A 5EU9A 3PWIA 3FCPA 4J1OA 1WUFA 3MQTA 3MZNA 2PTXA 4DYEA 3U9IA 3VCCA 4F4RA 3P3BA 3NZGA 3DFYA 5ENLA 3Q45A 3R1ZA 3DGBA 3T8QA 4MMWA 1SJAA 3MY9A 3DG3A 1FHUA 4H83A 3ZLGA 1W6TA 1OEPA 2PCEA 4HNCA 3UXLA 3GY1A 3B97A 4HCLA 4HCDA 3VC6A 1EBHA 3KUMA 2O56A 3OW1A 3TJ4A 4ZCWA 4A6GA 4ROPA 3ZLHA 3VFCA 4Z17A 5FJTA 3I6EA 3OTRA 1KD0A 3SN4A 3OP2A 1TZZA 2GGJA 3S5SA 1R0MA 2FYMA 4IHCA 3D46A 4FI4A 3P0WA 4E5TA 3MWCA 4GYPC 4M6UA 4G7FA 5BOEA 3QPEA 4ZA0A 1P48A 3I4KA 3OZMA 1JPMA 2PTYA 3PFRA 2PGEA 3R25A 4HN8A 1PDYA 3TTEA 4GFIA 1EC8A 2XH2A 2HZGA 3JZUA 3TWAA 3RO6A 1SJDA 2OG9A 3N6JA 4IP5A 2OX4A 1XS2A 3ES7A 1TKKA 1XPYA 4E4UA 3T9PA 3I6TA 1NELA 1JCTA 2FKPA 2AL2A 2ZC8A 3DDMA 2HXUA 2OO6A 2OVLA 4JN7A 2QQ6A 3THUA 4GISA 3OZYA 1DTNA 1NU5A 3QLDA 3DEQA 3ZVHA 2OPJA 3MSYA 4JN8A 1L8PA 4M0XA 2DW7A 3TJIA 3RRAA 4FP1A 4EWJA 1MDLA 4HYRA 2PP3A 2OFJA 2GGEA 3JW7A 1P43A 2XSXA 2AKZA 2QGYA 2P0IA 1KCZA 3CXOA 3V3WA 1PDZA 5FJOA 2PP1A 3R10A 3GC2A 2OQHA 3UCDA 3FYYA 3NXLA 2GGGA 3ENLA 2QVHA 2AL2B 2MUCA 3PK7A 1EC7A 3SQSA 2XGZA 2XH0A 4HPNA 4H2HA 2PPGA 3R0UA 1MDRA 3RITA 1KKOA 2PP0A 4DHGA 4A35A 1SJBA 4MGGA 3TCSA 2ZADA 4IZGA 4KPLA 2QDEA 4KEMA 3BOXA 3QTPA 3NFUA 1FHVA 3Q4DA 3SBFA 4KT2A 3TWBA 4Z1YA 3DG7A 1BKHA 4K1WA 3VCNA 2QJMA 2PMQA 3H70A 3VC5A 1RVKA 3OPSA 3MUCA 2PU1A 4E8GA 1KKRA 4HCHA 2AKMA 3N4FA 3UJ2A 3UXKA 3V4BA 2PA6A 2QJNA 2ONEA 3BJSA 2QDDA 3FJ4A 2PU0A 3U4FA 6ENLA 3UGVA 3H12A 3TQPA 4GMEA 3GO2A 3PWGA 4GGBA 3N4EA 2HNEA 3P93A 4IL2A 2XH4A 3DG6A 2PTZA 3SN0A 3ZVIA 2OLAA 3QN3A 3RCYA 3FV9A 1EBGA 3DESA 2HXTA 2RDXA 3DFHA 3UJEA 2PS2A 2XH7A 4DN1A 3IK4A 4IT1A 5FJUA 5FJPA 1ELSA 2GGHA 2P8BA 1SJCA 3T6CA 1R6WA 3H8AA 2P88A 3ZLFA 3TW9A 4GIRA 1MNSA 3CK5A 3NO1A 3D47A 4YWSA 3DERA 4J3ZA 3H7VA 3IJIA 7ENLA 2DW6A 4DWDA 3RR1A 5J04A 3CAWA 4DXKA 3SN1A 4DX3A 4JHMA 4E6MA 2GDQA 4G8TA 4MKSA 3SSZA 1ONEA 2OZ3A 4ENLA 2OKTA 2MNRA 2PSNA 3CT2A 3ZVHB 2GL5A 3DIPA 2QJJA 3VDGA 1JDFA 3UCCA 2P8CA 1JPDX 1EC9A 4X2PA 3V5FA 3EEZA 3GD6A 4IP4A 3IJLA 3MKCA 2PGWA 1F9CA 3TOYA 2OQYA 3CB3A 2CHRA 1BQGA 2POZA 5FJRA 2GGIA 3ES8A 1MRAA 3R11A 1YEYA 3T4WA 3CYJA 3JVAA 2NQLA 3IJQA 4H19A 1IYXA 3R0KA 2PTWA 3N6HA 1TE6A 5BOFA 1E9IA 3BSMA 3FXGA 4K2SA
chains in the Genus database with same CATH superfamily
4IX0A 2VZUA 3UFYA 1OFPA 4UTIA 1HIZA 3W6YA 1QXLA 3CHFA 2NQ5A 4H1ZA 4C6OA 4ATWA 2FFIA 3I3BA 3ARUA 3QKEA 4B5XA 1HZYA 4Q3MA 3IC9A 2QUNA 1P5BA 3AQUA 2ISFA 1M53A 1TIWA 3I3EA 3PUGA 5IDIA 4IUOA 4TOQA 3WMSA 3BL3A 1E9YB 3GDMA 4PUJA 4ORIA 2GR1A 2ADAA 4TMBA 1V6TA 3GC4A 5CH9A 4TIMA 3BLPX 4X0VA 1GKPA 3DC8A 1PEZA 1FWDC 4D72A 1XICA 3KP1A 2B7QA 4JN6A 2GWGA 3E9AA 3B8VA 2GJPA 3M47A 3QW4B 4HNTA 4ICMA 1OD0A 3VNDA 4NAFA 5L9FA 4PMOA 2RDUA 3TNBA 2JKEA 2BP1A 3L4TA 3UXLA 4LIIA 1R38A 2VHLA 5E0KA 2B0MA 3A9BA 1J0HA 4CNSA 3RXZA 2NQHA 4KFPA 5REQB 2P3EA 4AF0B 1DXFA 2VMFA 4BI5A 3W85A 1E1FA 3SCSA 4XIAA 3RJXA 3VFCA 1G9HA 1PBGA 1EH9A 5D9NA 2GUYA 2WAGA 2WSPA 4H4PA 1ITCA 3TK7A 1RK6A 5CPSA 3NEVA 1XX1A 5TBOA 3W7OA 5IXEA 3D46A 4AHOA 2O9RA 4B5VA 1K7FA 4TX8A 1ZFJA 3VILA 5E6YA 1E1EA 3MS8A 1ZRQA 1CYGA 3UERA 2X7WA 3W23A 3PULA 4OT7A 1S46A 2PGEA 4HOXA 3NVZB 4F0LA 2WNZA 4A3HA 3PB0A 1OCNA 4H9ZA 4JNZA 4Q4QA 3TFXA 3M64A 3EB2A 5BRBA 3URBA 1NSJA 4HU4A 5I2UA 5FEWA 4CGTA 5BXTA 5KVHA 3QW3A 3W7GA 5A6TC 3CJPA 3TLQA 1A4LA 3GXIA 1OY0A 1RLCL 1J5SA 3CL7A 1TPB1 3G24A 2BODX 2OPJA 1S38A 1V6UA 1DWJM 4JN8A 1WX0A 4BCEA 2PDUA 4UFJA 1EWDA 2V8ZA 3ARXA 3U2EA 3LXCA 4K37A 1ML1A 1O60A 1US3A 5HWJA 4LY4A 4CCCA 3O3RA 3VOJA 1MXDA 3BG3A 3G3MA 1NDAA 3LLDA 2QGYA 3SJ3A 1AQ0A 2JEPA 2NV2A 1Q7QA 3G1AA 4OECA 2OGYA 3BLOA 1DQXA 4B2DD 1XKJA 3CB8A 4Q4MA 1IR1A 4JIIX 1IF2A 4XD5A 1ZALA 1WAUA 6REQA 1CLVA 1PKLA 3C2EA 2FHCA 2CHOA 1E40A 3OQEA 4ZSTA 2WM0A 2PPGA 3R0UA 4DELA 4YS1A 3RITA 3USZA 3LMYA 4ZB0A 4OOZA 5DEZA 4A35A 3H2FA 2VCBA 5AHIA 1UBSA 4WXZA 4GC4A 4JYEA 2QJIA 4KFOA 3KBNA 1VHNA 4PMRA 1SO6A 5C5YA 4GLEA 3PBWA 4AEFA 4RZBA 1BXNA 3HZ3A 3Q4DA 3N3TA 2CWNA 3TR2A 3SBFA 1P1XA 5DCBA 1GOWA 5FACA 1TV2A 3BV4A 1I2QA 4GZJA 1JEZA 1S5TA 4NRRA 3E1F1 4URIA 3TN4A 1O1ZA 5FIPA 4CU8A 4R34A 1XIMA 4XKYA 1THFD 4PRWA 4RDZA 1MEWA 1HKKA 3NGJA 3POCA 2J79A 4WOZA 4HHHA 1D7YA 4FX7A 1KFJA 3TX9A 3UETA 4HTYA 5J5RA 4NYUA 3DI0A 1CB2A 1ZENA 4YYCA 1WZKA 2JIWA 5KZDA 1O5QA 3FAWA 1KFCA 4JTAA 3KFTA 4LVGA 3DFQA 3S1UA 5E6ZA 3G1XA 1X97A 3UXDA 4OBRA 4KF1A 4O16A 2BVTA 2F2KA 1SGJA 1W2VA 5K4ZA 3WMCA 3OIHA 3QN3A 4BS0A 1OBAA 1VP5A 2CZ5A 3E0LA 1C8VA 3BAYA 4YL2A 4K3ZA 3B0YA 5EFDA 5CBBA 5C9ZA 1AMYA 3FAXA 3LRMA 4HJFA 3SQPA 2CZEA 3NUKA 2GJRA 3WBWA 4WR3A 3ZLFA 3DFOA 3UY8A 1M41A 4AH7A 5XIAA 1V3KA 1UP3A 3B9EA 2BOGX 2V5KA 1ZAIA 1GSNA 4J3ZA 1IGWA 3M0XA 5FI8A 2R82A 3CTLA 3W74A 3UY7A 1RJQA 1W5QA 2WZTA 2JQXA 3RG6A 3COTA 2OWWA 2VOMA 3S5ZA 1GKQA 2XFWA 3DK4A 3SUVA 4I7UA 2XU2A 4CU7A 3GTIA 3NEHA 1V3LA 4AZIA 4RZ4A 2WC7A 2Z1SA 3UCCA 1XSJA 1H09A 1RR2A 1J5TA 4IXHA 1N61C 2CLFA 3L4VA 2DU2A 4H8NA 4ZQNA 3NVTA 3AHXA 1PHWA 2VD8A 1I0BA 4TO8A 2ABBA 4AHPA 4JKLA 4X2RA 3BSGA 4L6OA 2FJKA 2Q01A 2NQZA 4AX7A 1PCWA 3H7UA 1VFLA 1HF6A 3OA5A 3GZAA 3PR2A 1JG9A 5D4YA 1JFXA 2KX9A 3T55A 3W7JA 1HJWA 4H19A 3VIGA 2BY0A 1BSLA 1YPXA 4AIOA 2QEZA 1AA1B 1NWTA 1XBVA 1Z9AA 4GBUA 2DP3A 1NDYA 3BSMA 3DU0A 1IT7A 3TFCA 5IHRA 2E9MA 1JYWA 1KRBC 4O50A 2TPRA 1MVYA 3U0HA 4X3ZA 2FGZA 2WVTA 4REQB 3T08A 3WNOA 3BXWA 4P8UA 1XDLA 1NP2A 3UU0A 1BYAA 4C7DA 3DBPA 4FEZA 2BBFA 1L6WA 4N7QA 4XD6A 2XVLA 2OEMA 5XINA 1WO2A 2VP8A 1Y65A 3CGDA 3OVGA 3B8UA 3JS3A 1YDVA 1TPH1 4GUFA 5J5DA 1ADSA 1OX4A 1QHOA 4K8GA 4C90A 4IH3A 2CC0A 1W1A1 2PDLA 1R7AA 3I6RA 1BXBA 4J3TA 2Q3RA 3R5EA 4I9JA 2AGKA 4FIQA 4DYEA 4UFHA 4F2BA 4PEEA 4YHEA 1EOMA 2WMFA 5A8GA 4XQ6A 1NJJA 3H4KA 1S2WA 1HX0A 3BLKA 1V3HA 3C0JA 3E2RA 2ZZ6A 4BF9A 4GY0A 1S39A 2GQWA 1VFMA 4U5KA 3O63A 4C6QA 1K8XA 4HNCA 4L64A 3GY1A 4LNYA 1ODUA 2NUWA 3EX3A 2GJNA 4W5ZA 1TPFA 3WD0A 3OW1A 3SO7A 2F6XA 3AIVA 4LUYA 1E71M 3PSVA 1FFUC 4C1NB 3LYEA 4TVWA 1XH2A 4LOCA 2ZZ4A 3SRFA 3VKJA 4PTWA 2AQOA 4C6KA 3U48A 5IFPA 2GJXA 4JYFA 2VWTA 4HA0A 4HNVA 2F61A 4ZXOA 2C1HA 4G7EA 1XQLA 4O1EA 2FLIA 3UZXA 3GLCA 1BPLB 1O7AA 2GQ3A 3BAIA 4POCA 2B31A 2BXVA 4A3QA 1I60A 1WKFA 2GVYA 4MFDA 2Z24A 3TXVA 3BDKA 3KP0A 1J96A 3L68A 1KBIA 3W1XA 4MF4A 1OF8A 4RK8A 5FSEC 3TTEA 2E6AA 4JIEA 5GJPA 4GE8A 3CUIA 4M19A 3EOOA 1X6UA 2VRJA 3QYQA 4LB4A 1FWWA 3P67A 3TIMA 2EJAA 1RPKA 2VI0A 4ZBCA 3VPLA 3GM8A 3MJMA 5DXXA 3TN3A 2HE8A 1SZFA 4WUIA 1NELA 2W62A 1PX8A 3SDOA 1OGBA 3P80A 2H9AA 5FL1A 1JULA 3KOFA 1R2TA 5CC5A 1P0DA 2W0HA 1FVPA 1GTEA 4EE9A 4ZSUA 3DAQA 2YFNA 1CLXA 3G8RA 4D1JA 4W9TA 1LL7A 1ODZA 4Q7NA 2PP3A 5A8MA 3PZIA 3AHYA 3GNDA 2REQA 4GVFA 2XVPA 3VDBA 3KZPA 5T9CE 1TPWA 3V3WA 3QVQA 3W2LA 3DOPA 2HV5A 4UQCA 5AHEA 3K46A 3LHVA 3T2PA 5JIWA 3TSDA 1PKNA 1P6CA 2QVHA 3BGAA 3DZ1A 2ICSA 5JVLA 2ZRVA 1L6FA 1NVMA 1MW3A 4TU1A 1EUNA 1YE4A 4J4KA 1E1CA 3HGRA 5LNUA 3S9IA 4XZHA 2VZVA 1UHVA 3T40A 4JICA 1GRFA 1SJBA 2WSKA 3W83A 2X8GA 3UZ5A 1ZDLA 4J2PA 1QMLA 3B4UA 4UTUA 4K36A 1W3NA 1F3TA 2BDQA 2ZFAA 3FS2A 3PSWA 5AYZA 3MJYA 3EEGA 3QOMA 1EGMA 1HJVA 3H2MA 4ZOAA 4AWUA 3DHFA 3W2JA 4DZIA 1FKXA 2PFHA 4B9YA 3VCNA 4NAFB 3FNDA 4NVTA 4Q8UA 3CXBA 2XHYA 3ITTA 1UP0A 4YMZA 2WCSA 1ICSA 3UVAA 4JTHA 5C0QA 2FIQA 4MY1A 2ZKMX 1NF7A 2QDDA 3ABSA 3L7RA 3U4FA 4M3PA 1EJUC 3TQPA 3NURA 4GGBA 2HNEA 2EQ9A 1TJPA 5LIYX 3AWOA 3W82A 1TPEA 5LGXA 3BLIA 4Q8VA 1SMDA 2RDXA 1ZLPA 3CEUA 3I4EA 4YVVA 3TTOA 3GNOA 1HN1A 1UR2A 2CEQA 2RHGA 2GVGA 1S1RA 4H4VA 5FF0A 2Q6ZA 1YPIA 4PH6A 2P88A 4EQSA 4DRSA 1D8WA 3I7QA 3GDLA 3KVLA 1HL8A 3LCWA 1XFCA 2A4AA 3PG6A 3AAMA 1LF1A 1XLMA 4X22A 1FH7A 3GW3A 4GXMA 2WBAA 1LTDA 2CWXA 2HNHA 4AHQA 1GG0A 2Y61A 1H50A 2VZOA 1SSDA 4WY0F 5I3KA 4JHMA 2G95A 1J6PA 4FXJA 3FJLA 3M43A 2DZXA 4PMUA 4RE2A 1LORA 7A3HA 1JDDA 7CGTA 4IGSA 2A3AA 2WVUA 2YXXA 1BLIA 1XWYA 4MWAC 4DXVA 2OCZA 5F2MA 1ZMCA 5FESA 1C7TA 2QCFA 1ISXA 3U5YA 3N34A 4GC3A 3MTWA 1K9TA 3KWXA 2GQ9A 4QLKA 2BG5A 1NDZA 4G2DA 3VE7A 3VNIA 3G77A 1E6NA 1AD4A 2GR2A 1I0DA 1XI3A 1E15A 1W3TA 2A6LA 2XSAA 3WNNA 3F5LA 4PFHA 4UTLA 3PUEA 5F2GA 3C5QA 1JAEA 3D0CA 4JR5A 5T91A 5FS9A 2CKRA 3A7UA 2ZUUA 4M29A 4NZ1A 5LYRA 4Z42C 5H8PA 3PJUA 1NFPA 4Q4PA 1W56A 1NHPA 1MW2A 2HDJA 2X0HA 2V5BA 1LJYA 1TYPA 3LPGA 4JFWA 4H7CA 3VDHA 1QJWA 1AW5A 3WJYA 2WHMA 2V2CA 1BAGA 2CBIA 2J6VA 1US2A 1MUCA 2HBXA 4XWUA 3C2YA 4I8YA 1IR2A 4R9XA 2V82A 1CPUA 5HJLA 4ES4A 4FIRA 3N2OA 4H8VA 4INFA 4NZ3A 1A3XA 4CD8A 3RGTA 1GTHA 1PCKA 2CITA 1Z3NA 4KCVA 4N42A 4B5WA 4GX8A 2V5DA 1K77A 3F5JA 2P3ZA 1NFGA 3ARZA 5FCZA 1LLOA 4BQ4A 3A3HA 4WDTA 4PMYA 3PWIA 2A85A 5D32A 3MQTA 2PTXA 3GX9A 3VCCA 4DZHA 3CZLA 4NILA 1MO0A 2EPKX 4IPLA 3N18A 4QR6A 5CG7A 3T44A 1PX4A 1D3GA 1B0IA 2NV9A 4YN5A 5A6BA 1KGXA 3IIOA 3HJZA 4YWIA 1BG4A 4JKKA 2BASA 1GOIA 3OGVA 2OSWA 1OEPA 1XYAA 2VQUA 3HQOA 1OIMA 4KQNA 4X60A 5BROA 4AD2A 4Z1DA 3XISA 3KUMA 1YPFA 1VIZA 2X0SA 2QJHA 1DHKA 3W84A 2Q8ZA 3P14A 2FZDA 4HPXA 1XF0A 1RPXA 2VFGA 1GHRA 4O17A 4W7UA 1RK5A 3A64A 1F3WA 3VFLA 3K4DA 1GQLA 1QNQA 3WF2A 2EF9A 1MXSA 3KZSA 3B0PA 1S5MA 1R8LA 3FA4A 3PJWA 3LV5A 1P48A 3W25A 5CPTA 4YIWA 3B8SA 1JCLA 1BF6A 2FQIA 3A4JA 5G4WA 2NUYA 4M7TA 3SUSA 4D6HA 2UY3A 4WX2A 3LRLA 4IMGA 2GOKA 4I6VA 3LA4A 3DYMA 3WKZA 1Q13A 1TMHA 4FR1A 1PX3A 1HL2A 1GRTA 2W66A 4PUUA 1OX5A 4H4QA 4GA8A 1XIDA 3KVMA 2FMOA 2W61A 3E2VA 4M24A 4Q8WA 4RNIA 4GUJA 3IEBA 1A0EA 3W28A 1U5HA 3OU8A 3LXBA 1WPCA 2GDVA 3T81A 2I5IA 3KBMA 1UYQA 4J28A 1WZMA 3GYCA 8XIAA 3PWAA 3IUIA 3M9YA 2FDSA 3LRKA 3DHUA 4W8AA 3W0KA 1KC7A 2W63A 1BWLA 1REQA 4GWEA 3RRAA 3RU6A 5LA0A 3OVRA 4JGDA 2OFJA 2DQWA 2WKLA 4DAIA 1UKPA 3MMDA 3S3GA 4MJMA 1PPIA 1D3CA 1W2PA 5LXEA 2ACUA 3C56A 4MZ1A 1OCQA 1R3VA 4Q7IA 1KNWA 2DQXA 1HJQA 2GH5A 4EXBA 2OEJA 3NXLA 3QMRA 3C2RA 3D3AA 4QHRA 3URHA 4XKMA 4DO6A 4OUIA 2OX1A 1EGVA 4PGLA 2EEXA 4AFYA 2NUXA 3CWNA 2YYTA 1S1PA 1OX4B 3KRZA 4PB5A 2L5HA 1G5AA 4XO6A 3CHVA 1BD0A 1J4EA 3OGSA 4J3VA 2VELA 1SYTA 4GK8A 5CGQA 1QTWA 4AYGA 3HQNA 3BOXA 3QTPA 3NFUA 2DZPA 5D02A 3GG0A 5GNYA 1R3TA 4NJKA 3ARVA 1G69A 4IIEA 2TYSA 2XGBA 3APYA 3GXMA 1XLGA 5JIPA 4TTGA 1E9ZB 1XANA 3LN3A 3ZXWA 4LVDA 2AAMA 3OPSA 3MUCA 1HKMA 3M0JA 3E96A 3GYEA 1XYBA 5LIUX 4AWEA 3UJ2A 3OLGA 3PAJA 3UXKA 1EDTA 2PA6A 4CVWA 1QCWA 2P50A 1XCWA 1E6SM 2QVNA 3E3HA 1W1IE 5JCKA 3BJSA 1CI1A 4XZLX 3TC6A 4AXKA 5F1UA 4IPNB 4LANA 4KRTA 2V30A 3SN0A 3U57A 2GJXB 1GVFA 1YIXA 3ZT5A 4OKDA 3F2DA 2E5BA 2C0AA 5A8QA 1ZPTA 2JK6A 1TCMA 1ISWA 1HO4A 5CZ0A 3IIPA 2DZSA 1V5XA 4IG2A 2Z28A 2QCDA 3BAJA 3OOQA 5EBAA 2Y5JA 3W4RA 3KL5A 2H8ZA 4GIAA 4KWVA 2OWCA 3B9DA 4PRTA 3R2GA 4JTGA 1IZCA 5LZLA 2RDTA 3LADA 2A2IA 2FMNA 4Q8OA 5HK4A 3BCDA 2J7DA 3G1DA 2OEKA 2W5FA 4J27A 5LA1A 2WNNA 5BW6A 3PZUA 4JIRA 4GCAA 4UOJA 4ECLA 1CX9A 2W3RA 3HOJA 4H2CA 1UOKA 3A13A 2XIBA 3G18A 2IMRA 4EF9A 3SSZA 2H9AB 1ONEA 3WQWA 4WVXA 1VBUA 4LUSA 3UWUA 1TMQA 2E8YA 1NPXA 3VMNA 4FNSA 4L4LA 3JUGA 4QM1A 3O6AA 4GZIA 2C3CA 2A7RA 3FJNA 9XIAA 2BSLA 1OYBA 1WZLA 4K8EA 2PZNA 3BAXA 3GG1A 1F5ZA 3IWPA 2PDCA 5C70A 3A4AA 2ZUMA 4HU8A 4BFAA 4D6JA 1BTCA 1F9CA 3DGZA 4L7ZA 4QE5A 5FJRA 4O52A 3LXAA 5CGMA 1OC5A 1EIXA 1WXJA 4R7WA 3WCZA 1DJIA 4NJGA 1VBGA 3KLLA 2H90A 3OG2A 3T0BA 2D3NA 3VKBA 1R46A 3ZSSA 1UKQA 1MW0A 1X6LA 3O0FA 1E1CB 1QASA 5CJMA 2V3DA 3NRZB 5HMDA 2INFA 1RH9A 4Z2LA 3PVFA 4KGLA 1DQUA 3GW0A 1E0UA 1MUWA 4HPGA 5CZKA 1X96A 1FWNA 1M7PA 5D05A 3N2BA 4MDPA 3EMCA 5I5RA 2ISDA 3NYDA 3PN8A 3ANVA 1WQ5A 3KW3A 4L5ZA 3TA6A 2PZ0A 3T05A 2PODA 1L6GA 1JDEA 1H0GA 5C54A 1AUSL 4QG6A 2CZDA 2VJXA 3FGCB 1IV8A 3OHMB 2CKSA 1LQ2A 1V6XA 1CW2A 1E3ZA 4PL1A 1NOUA 1ZZMA 4JTTA 3RCMA 4FLRA 4NXSA 1WDRA 3LQGA 1VBJA 1EDGA 3ZLGA 2WK2A 4AZCB 3PNZA 4WK9A 4HCLA 3E02A 2CU0A 3AZTA 1EF2A 2VC6A 4WGHA 3CU2A 2EPHA 1JGIA 2OB3A 2YVGA 1KFEA 3PG9A 1Q8JA 3LV6A 3ARQA 4NP7A 4DNHA 3RK8A 3TYDA 3OP2A 5CLTA 3I65A 3IIVA 4DJEA 1B9BA 1E72M 4PTXA 1GT8A 1B5TA 3OBAA 4UC5A 4CD4A 1UWRA 3QPEA 5D8WA 1Q1WA 3UZYA 1RZMA 3AZRA 1DJNA 4N6EA 2J88A 2NVKX 1PIIA 4NKCA 4KMQA 5D09A 3ERPA 3W1QA 1J2BA 2GWNA 3RPTA 2R6OA 4GFIA 2PDNA 1EOKA 3H4XA 4AY7A 2PDIA 6ALDA 1XP3A 1V3IA 1VHCA 2OG9A 5TR3A 3F7JA 1FBAA 4CD5A 1JI2A 4BI6A 1GEUA 3QBUA 4EP8C 3WD3A 2XTKA 4EOUA 1RJRA 2DVUA 3TH6A 3S2LA 3OC4A 2WKGA 5JCLA 2VX5A 3VNYA 1YLVA 3SCPA 3VU2A 5G2IA 3CAVA 4YLWA 3NCOA 1B30A 4TMCA 3U8GA 2J25A 3FKKA 1VFOA 3GAKA 1EQPA 4QS6A 4BK9A 4CNUA 3GXDA 3APGA 3Q65A 3P81A 1A5MC 4S3KA 5ABGA 2ZXBA 3MP4A 3WJXA 4JTEA 1O5RA 1TELA 4PA8A 4MAZA 4CQDA 4EQXA 1EJRC 4C1LA 4GQGA 4AYSA 1A3HA 4LS0A 1QR7A 2BXZA 5TF0A 4TX6A 3U7VA 5HULA 2NVAA 3NA8A 3S2NA 2EG8A 2WSRA 3WQEA 2F2HA 1MDRA 2E9LA 3KRSA 1XXXA 3V16A 4Q6XA 5CPNA 4XD4A 2XDFA 1UUOA 4LFYA 3QZEA 1NOFA 3A7AA 1PTGA 3W72A 3BK0A 3KL3A 5CCZA 5LHFA 1EBDA 2PLJA 4MSSA 3M0KA 3IS4A 1XPGA 1KM3A 1TJ2A 5HJYA 3MT1A 1BKHA 3T2OA 2UY4A 1W9UA 4H04A 3TSMA 1VCGA 2DZVA 3M7SA 3PTKA 4NI8A 1HFBA 3N4FA 3T0DA 1EJVC 2PWVA 3IGXA 4WSKA 4LYRA 1XIIA 1FUYA 2PRMA 1F6KA 4O1FA 2TODA 3WL0A 2WW5A 4BI7A 3AMDA 3MPGA 5G4EA 2ZX9A 3P61A 2WMGA 1QK0A 3EWDA 3QR1A 3EOLA 4YTTA 3NPXA 4NNAA 1GQNA 1NQ6A 3STFA 3MKVA 5FJUA 4H6EA 3VGBA 2NXHA 4OBTA 3KBSA 3GC5A 3IJ7A 1GPFA 3BLEA 2GGHA 3FHQA 3CV7A 3QEZA 1W1VA 3AUOA 4GIRA 3EXTA 1Q4NX 2ISSA 3CK5A 1SB3B 3THQA 3NO1A 3CPUA 4HQVA 4LTSA 4AG0A 3WH7A 2CW6A 3G3DA 4EMIA 1UCWA 4NZCA 2VGGA 4QDWA 3WEMA 1IQ8A 1DIOA 5D9OA 4C6JA 2J8TA 3E0IA 4MYXA 4XV0A 4M1RA 3AXIA 2F84A 5D2YA 4ADSA 3W9ZA 3WO8A 2GDQA 1E6RA 3CQIA 4Z0JA 2VDIA 3CNYA 4I3GA 4LALA 2YXGA 2J9YA 1N8IA 1IEXA 4TTUA 1UQYA 4AVOA 2A8XA 2FPVA 1Q6RA 1A5UA 3U4AA 1LT8A 2V3EA 4KCTA 2DORA 2G3MA 3QV9A 1JAKA 3B04A 3ITXA 1E4NA 4IJBA 2D20A 4BKNA 3S5OA 2W0UA 2VM8A 5JU6A 2UZ9A 4X9SA 1AG1O 1VRDA 2QAEA 4QCEA 4PUWA 4NJIA 3VOIA 2VENA 3G1RA 3FXGA 4QS5A 1NHQA 4MB1A 2BGQA 2VO5A 2VRQA 3LMZA 2WWDA 3CQHA 2YA1A 1OT2A 4L1XA 4LAKA 1DWGM 2B7NA 1YX1A 4CNNA 1BZLA 1RD6A 1EZ2A 2B4GA 3W29A 3AJ7A 3LZ3A 1XCFA 1O5KA 2HBVA 2XSBA 4DI8A 5I0DA 1G4SA 1I4NA 4AZBA 4K7ZA 1ZHAA 1JRBA 3NAVA 4MLJA 4Q32A 5D9MA 3WFLA 5C8BB 3MUIA 1W37A 4CN1A 1G4EA 4EPDC 4QXIA 5U4NA 3TTQA 4DPPA 3S6OA 1EL3A 2PWUA 3GFXA 4J1OA 1UH3A 4DBUA 1XW8A 4W84A 3T0TA 3HJEA 2PWDA 3WH8A 1XM3A 2PAJA 3ELFA 2DVTA 3NZGA 3DFYA 4O1CA 4H00A 4HP5A 2PCQA 2DEPA 1E55A 1PYMA 1ZY9A 1NWRA 3VE9A 3IRDA 4GYJA 3W7PA 4IG2B 2FH6A 1TWWA 2R1LA 4J7RA 5FAJA 3REQA 1C91A 3B97A 3AO0A 1Q6GA 4UZUA 4ICCX 4HPHA 2F9RA 3IAPA 4AEOA 4MUZA 4GY1A 4HA1A 3QSTA 2V81A 3OVQA 5F1VA 1C8QA 1XL9A 4E2DA 2X1SA 3EOUA 4DUOA 5M1TA 4Z17A 3EUB3 3I3DA 3SN4A 3GG8A 3VNMA 4MB5A 4LUJA 3ME3A 3TN6A 3ITLA 4F48A 1GYLA 3WK0A 2WP5A 5DMLA 1TA3A 2YA2A 1W31A 3N4AA 4LUSB 4LW7A 4LYPA 3C4UA 1GNXA 4RDWA 1ESWA 2DT2A 3GXNA 1GW1A 1XRSA 2ZTJA 3RO6A 2E0PA 3WUGA 2PLKA 2IXVA 2J75A 4B9ZA 1RBLA 3OBKA 5ABHA 5GJNA 1TKKA 4CLMA 2TRSA 4XUGA 3QY7A 4ZQCA 2AL2A 2V5JA 3DK8A 1GOOA 3MCOA 5I00A 2ALDA 1ITQA 2WMJA 1NU5A 3DEQA 5DMYA 4PR4A 2ZE3A 4EIVA 3R07C 4F8XA 3HBLA 2Y5EA 4N4PA 3WJZA 4AY1A 1GZ1A 1KM0A 3PUDA 2HROA 2WOVA 4H9VA 1OFRA 3VUSA 1RBOB 4XSLA 5A6AA 4DB7A 3CXOA 4UTTC 5HA7A 3VKAA 5FJOA 1W5OA 1LRTA 5DF0A 3CYVA 3TU9A 2QGHA 2GJLA 2D2HA 4IP7A 1XYFA 3P7YA 2E8ZA 3F4CA 3PFMA 5DLCA 3H2OA 3LHTA 4IIHA 4HGXA 4UUIA 1XR2A 2VEMA 5G2WA 3L2IA 3B8IA 1JCNA 3G1VA 1UD3A 3JR2A 4EANA 5AC4A 1ADOA 4X63A 4MG4A 2NQJA 4HU3A 3T42A 1XLAA 4UB9A 1XBYA 2DJXA 3KOWA 1NHSA 4C5ZA 2XN1A 5G4HC 2O92A 1J8VA 4O0ZA 1H1NA 4HSHA 2W67A 3MSGA 2AKMA 1KWGA 4AC7C 1R47A 5AHMA 1XLEA 2VVNA 4UMCA 3SB0A 3TTSA 3I10A 3WQ8A 1BTMA 4DJDD 2PRLA 3SGZA 4YTSA 3ZQ9A 2QCNA 6ENLA 3CLMA 4KFNA 1NY1A 3UGVA 4UQBA 4LC8A 4GVGA 3N4EA 1Z7AA 2CETA 4MZ8A 4K39A 2VYOA 4HZ6A 1HVXA 4MY9A 5KTLA 3DECA 2ACQA 2VFIA 4GABA 4NYYA 1UWSA 3C8NA 3CWOX 3AIRA 2GVLA 2J7CA 3LG3A 1BWKA 2ZTKA 1UG6A 4FXRA 3GK0A 2ZA1A 5AKQA 1XYLA 1QFEA 2J7BA 3H8AA 3FA3A 1K9FA 5I7GA 5H8MA 3E74A 4HK6A 3FDGA 2RABA 1JGMA 8RUCA 2OODA 1VPYA 5AYIA 4LBSA 2WPCA 4S3BA 2E67A 2J78A 2DH2A 4DWDA 1VFFA 4LAOA 4RNJA 1GREA 1CIUA 5M5DA 1EJSC 3P5ZA 3SRKA 1KA9F 1UWUA 4RPPA 2J9ZA 3ZMRA 4M52A 3OA3A 4ENLA 3WEZA 1TJRA 2MNRA 2Y8KA 1W1YA 5G1TA 3LBOA 3QOKA 5FJIA 1DXEA 4YVXA 2ZUSA 4X0NA 3CV1A 5A2CA 4X2PA 1J9YA 4LX4A 1TE1A 4M6PA 3M07A 2VFEA 4DF2A 3P2VA 1X7IA 4QJ4B 1FP8A 2XZ7A 3LM3A 5CQ1A 2OQYA 5ECUA 1RSCA 4PC8A 3W75A 5AVHA 1N62C 3PZNA 3TYUA 2YPIA 1PTAA 3NZ1A 1ZJBA 4GIEA 4QDMA 7ODCA 1E6XM 3M46A 4PULA 2YBVA 1Y5VA 2YXOA 1TE6A 3GDRA 4JCMA 1XLHA 4KWWA 4C7GA 4MVAA 3P74A 1NDVA 3AYTA 5BXRA 3MI6A 4I8DA 4PMZA 4GI8A 3RNDA 4EKJA 2ZA2A 2WJEA 1O66A 3UYCA 4XAFA 4H01A 2GSEA 3BG5A 2WBGA 3S6TA 1GOKA 3F2CA 2R9RA 4UTMA 3QSRA 1V0NA 1C9WA 3RM8A 1M7XA 3DYOA 4JQ9A 4DJFA 5HAOA 2AGTA 3FK4A 4WZHA 1RJPA 3QR0A 1M1BA 3VNLA 4JIHA 4O4WA 2I14A 4O57A 4NJJA 1OF6A 4MKNA 4TX9A 1WUFA 4L61A 1KXQA 3TC3A 2EQ8A 1C3FA 3GFYA 1N8WA 4NT0A 1RA0A 4RE4A 3W76A 1B4KA 2UY2A 2E6YA 2X30A 2ZUTA 2Q09A 2X42A 2XN2A 4GQBA 4PUEA 3BQ5A 3IJ6A 1XBZA 1EGZA 4NU7A 4LNCA 1EP3A 3LCHA 1FWRA 3K2GA 3EPMA 1RBAA 4RV3A 2Y0FA 3B0UX 4UMAA 1KRMA 3O6DA 4KWOA 2EPLX 3OO2A 3TXZA 4DNAA 4JX6A 2YLAA 4GJ1A 1BVNP 1RD5A 3VMPA 4DQWA 4CEUC 2WPBA 4H4YA 2QPSA 4BQ5A 3W53A 3GBEA 5D04C 4XIMA 4BEQA 2RGMA 3WQVA 1YKWA 1M9HA 3QV6A 4QRNA 1R0MA 7REQA 1GVOA 3A12A 4U28A 1JUEA 4E5TA 4GYPC 1QOQA 2VGIA 1KRAC 3VGHA 4GJJA 3A4WA 3WLIA 2PDQA 2HK1A 5CAKA 1BWVA 5CSUA 2J77A 4RDVA 1R87A 4H9YA 4UQEA 2OJPA 3EGJA 1QDSA 1JZ4A 1N5WC 2PRHA 2Z1BA 4L1WA 2ZXAA 1KBBA 3KX6A 3LSCA 2PWFA 1SJDA 4V1YA 1MUMA 3VNKA 4LCSA 5HJXA 5A3HA 4DNMA 4IP5A 2VCCA 2DH3A 3Q67A 3ZJKA 2X1RA 3ARPA 3WQCA 2WOIA 3IIXA 1SU5A 4IJRA 1JCTA 1WDDA 5CJ5A 4WDUA 1EP1A 1WYIA 3VDCA 3IUHA 4DVOA 5A69A 1QNRA 4XZBA 2ZRUA 2KZHA 1UASA 4RCXA 4P8WA 4IX2A 2FZBA 2CNCA 2FFCA 2PDJA 2V3FA 1GG1A 3NOEA 3EWXA 4FP1A 1WDSA 1LDCA 2X7VA 3KEHA 4QISA 4ADUA 3CZGA 3ABQA 3ZR4A 3NL2A 4HYRA 3EWWA 4QFUA 1JYVA 4I7VA 4B5SA 3W37A 2AKZA 2YZRA 4YTQA 5D37A 2DV0A 1CGYA 4U33A 3QY6A 4JL2A 2Z6IA 3H2AA 4P7LA 1AH3A 3DENA 2IW0A 3CZJA 3KL0A 4JQAA 3CZEA 4XZMX 3SQSA 1YRRA 2X8CA 2XH0A 3Q6JA 2VEIA 4FF7A 3AN1A 2I57A 1ZP4A 3S2MA 2HWGA 2VDHA 4CNTA 2WHKA 2Q02A 2WOWA 1KV5A 4KEMA 1GVSA 1XDIA 1UR8A 4PCFA 5JH2A 3EX1A 3W2MA 1CXEA 4QAIA 4N6FA 3WUBA 3CUHA 3RU8X 3VYLA 3TSBA 2RH9A 2E6FA 3L5MA 4H6RA 4W4QA 3REQB 1ECEA 4FNPA 1HVQA 1DQWA 1TG7A 2W92A 1E51A 2OQLA 3HGJA 1BSIA 3PPCA 3D9XA 4J5NA 3WK2A 1A5KC 1KQZA 3O6CA 4QP0A 5FF4A 1F74A 1TV8A 4GMEA 1HO1A 4IFOA 1M6IA 3NJ3A 5EGRA 4GVHA 5F4XA 1H4PA 2PTZA 3NPVA 4ZVJA 1YTEA 3VGDA 3RCYA 3F5KA 3H22A 3W1LA 3R79A 1XINA 1OFDA 1LROA 2NXIA 1TA3B 5BCAA 5IFTA 4DM2A 2OELA 2QV4A 1UR3M 2QS8A 1MXGA 4MJ4A 2RUSA 2EQ6A 5FA5A 4D6CA 1GW9A 4YU1A 1OFOA 3MU7A 3D47A 2NWRA 2R1KA 1JPIA 1T5AA 1AW1A 3HQPA 1A3WA 2C16A 3SCNA 7ENLA 2ZX7A 4DY1A 4IMEA 3AS2A 3GTFA 1MRQA 4NNCA 5EL1A 2TMDA 3CHEA 4HZMA 4DX3A 4OVXA 1H49A 3S8HA 3F03K 5HUPA 4G8TA 3SCTA 1UIPA 1S2TA 2IS7A 5A94A 4O14A 3R94A 3GKAA 1TTQA 4GO9A 3BARA 1H2JA 2F8QA 4HNNA 3O15A 4BURA 1KXTA 2HS8A 4TXEA 5KMYA 3P5YA 2GL5A 5C2GA 1FQ0A 5KVIA 1WKDA 3HFTA 2QIWA 4OUEA 1NF0A 4AD0A 1ITUA 1B3WA 1JPDX 1R2RA 2NVDA 4RW3A 3AIUA 1X1ZA 4ALDA 1M3UA 3WMBA 5JCMA 4NY2A 2DZAA 4EMWA 4M7SA 1LZOA 1FTXA 2GUUA 3IJ9A 2GGIA 3QGVA 4D6GA 2DUAA 1LLZA 1GRAA 1AH4A 3EA1A 4AIBA 2YDQA 5K9XA 3JVAA 3ITGA 3M5VA 3ZWTA 4GPNA 1DL3A 1DHPA 4PMDA 4KCWA 1EO5A 4Y9NA 3L0NA 3PBUA 4EK7A 4JQ1A 5KZMA 2E28A 3E2SA 1GZGA 4GZEA 1Y0EA 4WKAA 3NQMA 5IBXA 4ZXLA 3FIGA 4WRHA 2XFFA 1TIMA 2WQPA 4E0CA 1WUEA 1T8XA 5AECA 1JL8A 1SUXA 5CGTA 1JDCA 4RPQA 5HMEA 4HNLA 4DF0A 4A22A 3NQBA 3OVPA 4FOJA 2DT0A 2XM2A 1OB0A 4XZWA 1R30A 3QPZA 2J24A 3FEMA 1CGUA 1TJ0A 3BCJA 2AAQA 4NASA 4H6QA 2VX7A 5G5GB 5LNSA 2XFYA 4DWSA 4OV4A 4E4FA 2I7GA 3BOFA 4H8HA 5F4SA 3KHJA 1YMYA 1EYWA 1HP5A 1SW0A 3BJFA 5CSYA 4FSAA 3GTNA 3WFAA 4BA0A 3MP5A 3CUGA 1CT5A 2VC9A 3NSNA 4PSPA 1FWCC 3SY8A 1FWFC 3ZSTA 4JY8A 1DOSA 1Q85A 1FCVA 4RV8A 1HGYA 1IEWA 2VC5A 2QCHA 5PTDA 3PBYA 3LGDA 2J62A 1L2UA 1JYXA 3AU6A 3U6WA 1FOBA 2EGZA 4PTVA 4GI6A 1G67A 3PBMA 4DBDA 5I3IA 3GVRA 4RLIA 4K1GA 1VFUA 4GUHA 1YNPA 2EPMX 3L67A 1Q63A 2OLHA 2QR6A 3AUJA 5CJNA 3W1RA 3ATYA 2Z00A 5F4WA 3WFZA 2YKKA 1FY6A 3IVUA 5A6SA 3VKDA 3QYSA 4JEQA 5BWAA 3P0WA 3LI1A 4JZ5A 3AWNA 4MOZA 2FVLA 1DWAM 1XFBA 4U4MA 4MADA 4JAWA 4M6UA 1UKSA 3BZJA 3EB3A 4A4AA 2WNQA 3MVTA 4YTRA 3QMSA 2E4TA 2Y7GA 3HPXA 3WQFA 4MAVA 5DQPA 2WZIA 1V08A 3EOSA 1ONXA 3AMZA 2YW4A 2PTYA 3EZ4A 3PFRA 3UWVA 4AD1A 4HPJA 3DFNA 3L5AA 1FIQB 2UY5A 1HNYA 3O05A 2Y7EA 5LA2A 3W1MA 3L2MA 2WBKA 3KS6A 3W1AA 4NZFA 2D2GA 3CL6A 2J7HA 1ENUA 4FDCB 2JKAA 1D3HA 1S2UA 4OQVA 1UMYA 3QZ6A 1K8YA 1K4HA 1HT6A 2FKPA 3QQ1A 1OYCA 3LI0A 2QQ6A 5ABFB 3LUTA 1TUFA 2ZX6A 1DIEA 3RMJA 1JFHA 2HE5A 2V6OA 4GISA 3L8KA 5AYBA 2Y62A 1V3MA 4J3SA 3PZOA 3S9ZA 4X61A 2VX6A 3GTHA 1JD9A 3VUPA 4E3VA 5HBFA 2IUZA 3W7RA 2Z1KA 5CC6A 3LB0A 3TDFA 1NIUA 2NPXA 2Z6JA 3VNJA 3MMWA 1RVGA 4MNLA 1LLWA 1QI4A 2VKZG 3GNPA 4O1AA 4PMXA 3FYYA 1SFJA 5B7ZA 1K1DA 3LK6A 4DBWA 2XN0A 2ACRA 4GXPA 4H3DA 2Y6ZA 4V33A 2XGZA 4Z2KA 4HPNA 3N15A 1F4AA 3USBA 1X8FA 1RP8A 4KETA 1IZKA 3PZQA 1B3XA 1OFQA 4IGHA 4UFKA 4JFSA 4W87A 1P0BA 3SZ8A 2IKHA 5GJMA 2AQWA 1AQFA 2QDEA 3V75A 1TYGA 4XZIA 4KT2A 3RJYA 4RNFA 4XBJA 2NX3A 3ISIX 3NDZA 3PBGA 3WLSA 2PMQA 1M68A 4IICA 4KEZA 2ZUNA 1UR0A 4IFRA 3SRDA 1G4TA 4R85A 3V4BA 3WH5A 4AXNA 1W1ZA 1JCYA 3LTPA 1YXYA 4W7WA 4DUXA 2ONEA 4C6LA 4O4VA 1PAMA 1U30A 4LWWA 1JZ8A 1LG2A 2HTMA 4FA3A 3WBYA 3PWGA 4HMNA 3GZ3A 3QKZA 2CLPA 4D8LA 3WY1A 2R9ZA 1DJQA 2PGRA 9XIMA 3CO8A 3MHUA 3WQGA 7REQB 6TIMA 4B2DA 4H50A 1EJXC 4US5D 1QK2A 4DPQA 1GVEA 1KLZA 2NT0A 1ME7A 4R5EA 2P0OA 1ELSA 3BH4A 1SW7A 2FHFA 1GOQA 3EMZA 1V3JA 3M7WA 1XIHA 4MB3A 4S3CA 4YWSA 1JIBA 1T40A 2G3FA 1HXJA 4P7OA 3IJIA 3GDKA 3DKLA 4P61A 3GNXA 4KESA 1M04A 1GVQA 1EO7A 1B54A 3MWAA 2R91A 5D2WA 3QY8A 3SN1A 4AZ6A 1TREA 3ZR6A 3L66A 1KR1A 1M7JA 2C3DA 1F73A 2A21A 1VZWA 1H0IA 1JQVA 5I09A 1YBQA 2QF7A 3HPAA 4QBXA 2KAUC 2IPGA 1BYBA 1M01A 3DC0A 3URNA 4BR1A 4H9XA 3RX4A 2FTPA 4JFVA 3VD5A 1KTNA 5C2CA 3CMJA 3SCUA 1KW1A 1FWBC 2Z2BA 3RLGA 5K2ZA 1NP0A 3EWZA 2XPKA 3SI9A 4DYKA 4E2BA 4L65A 4YNGA 2VD9A 3PAOA 3W7NA 3TYEA 3VABA 1OG0A 2CHRA 1BQGA 3PANA 3GNRA 4DO4A 3G6LA 1Q6EA 1U2YA 1H61A 2ZZ1A 1HKWA 4WJ8A 1IYXA 2YCLA 1XH1A 1JCXA 4RE3A 2C13A 2O7QA 2PDMA 5D03A 5E9AA 2WV8A 1OHLA 3B9AA 3S47A 3MUAA 4LV4A 4UBPC 3AM9A 4PFMA 4PZVA 1OG6A 4NUWA 2FZNA 2Q8XA 3Q2DA 2GSHA 1KFLA 4GHRA 2G4FA 3PPGA 4CU6A 1SQ7A 5DO8A 3CT7A 4PBEA 1Q4WA 2HPIA 4Y8EA 2BX7A 3NL6A 3H7RA 5JXQA 4Q8TA 3RHGA 3SCOA 2OXNA 4Q4OA 4FNRA 3W2KA 2A7PA 4J2MA 5ECVA 5I3JA 3W2NA 3KXQA 4MTVA 3UG4A 2QHAA 2PGFA 3A6OA 1PZ3A 3B8DA 4QJ3B 1F2JA 4Q4RA 3J7HA 2IKIA 2AAAA 4ZO8A 2PI6A 1E56A 3VINA 3WLNA 1GONA 4CQ8A 2F7FA 3LZ5A 2Y2WA 1R9ZA 3MHFA 3O8AA 1CCWB 1CGVA 3FW6A 3PBVA 3T0AA 2HVOA 3M41A 4JX4A 4ATLA 4AWTA 1NWUA 3V36A 3QHMA 3V18A 2PB1A 4GQ0A 4GUGA 2WJDA 2XYLA 5BOOA 1K9EA 4MWAD 2Y70A 1UW9A 3AOFA 4GKTA 1L9WA 3TAKA 2NVCA 1I75A 1EUAA 3OIXA 4LSBA 5JQ9A 3KE0A 2C0HA 5KZEA 5FJTA 4Y9PA 1FWEC 1GVIA 2WMIB 3KM8A 4W88A 3M0VA 4RJEA 1F8MA 2IKJA 3RFAA 3JRKA 4NG3A 3AIQA 3LXDA 3QC0A 4JS3A 1KM5A 1UOZA 4JDRA 4RDYA 1C9DA 2IPFA 4EX4A 1A49A 3GVQA 4HN8A 3AZSA 3S1VA 1V79A 1UR1A 3W7EA 1BXCA 4LAZA 3CIXA 1DPMA 5KZ6A 3N6JA 3A4XA 5TIMA 1B9ZA 1DIKA 5AN7A 3UZJA 1LBFA 3VIMA 4A29A 5E9XA 4PBGA 1TQJA 3UQNA 3ARYA 3HTWA 4LVBA 2CYGA 3WNPA 2SFPA 1TWZA 3ONBA 3M1ZA 3MO7A 3WQOA 3AROA 2E77A 3MO4A 5HDRA 5FSDC 4E8DA 4H4TA 4P8VA 1UKTA 2ZRYA 3WF1A 2PWEA 4FNUA 4RE0A 3R0DA 1H62A 1SMAA 3SGGA 3H23A 3SUWA 4H7VA 4W8BA 1GCYA 4D1IA 2OT1A 2EO7A 1C8XA 4W93A 3PZMA 3VIJA 5FD0A 1HKIA 4AISA 1QOPA 3JW7A 3P6LA 4N02A 1H63A 2Y8VA 1K8CA 1ZGDA 3T1GA 5H2ZA 1TV5A 3CBWA 3NQ2A 3S9YA 5CC7A 3P60A 3UPBA 2HVNA 1JR1A 1TWSA 3C86A 3UG8A 1JEHA 3HGSA 3GIPA 1DEDA 5H91A 4EPBC 4O54A 2ZZ2A 1KFBA 3S4TA 1IZJA 3TLLA 2CLLA 3QV7A 3O07A 3RMEA 4I90A 3CZ8A 4NAEA 4DWSB 2QF8A 1A5CA 6TAAA 1MW1A 2BGNE 2VUNA 3PZTA 4YWOA 2FGBA 1DE5A 1TMLA 1FEBA 4Y8FA 2R1NA 3CUZA 2YR1A 1Y5WA 4XG1A 3MHGA 2H6RA 4JY9A 4K1WA 4PUDA 4XZ9A 3EF6A 1VD6A 2W54A 2QCLA 4HK7A 1VFHA 1XLIA 5FL0A 3C6CA 2PLMA 2W9MA 3N11A 1C7SA 1V02E 2FVKA 3UWQA 3BQ6A 2C1GA 3QGKC 3NQ6A 2QCCA 2P76A 1XV8A 2PC4A 1AFSA 3UWWA 5JBFA 1JZ3A 3ZOAA 1TWIA 3UWEA 3ZVIA 2X1TA 3M4HA 4GYFA 4BF5A 4MJZA 3DCPA 3IK4A 3RNMA 4DJEC 4L1GA 5HNRA 3ALGA 1T3QC 4K8HA 1OZMA 3A24A 3IACA 1LUCA 1R6WA 1BHGA 5TQLA 4FHAA 1EDQA 2DZUA 1AK5A 5CSSA 3A7RA 2QMKA 1IE7C 3DERA 3A22A 4CQ9A 1S5VA 3NYZA 2NZLA 3Q58A 3RCNA 2EHHA 1W5NA 3FY1A 5J04A 3NZRA 1W3KA 3WDPP 1VRXA 3W81A 1E4LA 3CQ0A 4GACA 4JTRA 2PDWA 1W3HA 4R88A 4MKSA 2ANUA 3ANYA 1JZ2A 3EWCA 2OKTA 3LOTA 1QW7A 3EX6A 2FPTA 2PURA 1QW9A 4GNJA 3HG2A 4UQDA 5HQMA 5A8NA 4UTWC 4LBRA 5CBJA 4H4ZA 2J7GA 4ML4A 4RXGA 5E5CA 3FOKA 2P8CA 2VEFA 1VEOA 3N25A 1FWTA 4P7NA 4A8RA 1VIWA 5JRBA 1DJZA 1UWTA 4DF1A 2GQ8A 3THAA 1B3OA 1R5YA 4UOZA 1UB3A 3LHZA 4M51A 4JTSA 4QEHA 2POZA 1FCBA 1XIGA 2VCAA 3TV8A 3T4WA 1J0JA 4Q8PA 3PHAA 4E2VA 2ZRZA 4O1BA 2HK0A 2CLMA 3F4VA 5CBIA 4HA3A 1JYNA 2YL9A 3AIBA 2Y7DA 4FNTA 3KVKA 3HM7A 4UWMA 3V0SA 4E3TA 1LYXA 2VGFA 5CPQA 3WZ0E 4IPPA 2GYIA 4JTKA 1PHQA 3RF9A 2AL1A 5AHNA 2BMBA 5FEZA 3NWRA 2OGJA 4GRSA 1UA7A 4MNMA 4N9EA 3BGJA 9CGTA 1NARA 2X8RA 1US0A 2VXNA 4RZ5A 2PF0A 3E6EA 3NPWA 1SZNA 1ADDA 3M44A 7XIMA 2BC1A 1QOXA 4AF0A 1EPXA 1TCDA 1HJSA 4LRTA 4EAYA 4L4OA 3UJRA 1BKSA 2WXDM 3M16A 4S38A 4S2BA 2X16A 3APTA 4IGMA 3QHOA 3A3WA 3ARSA 2XUCA 2BV9A 4JCLA 5HOSA 1V03A 3NPUA 1SM9A 3B4YA 1GERA 4EWND 3UESA 3BANA 3QFWA 3OBEA 1DORA 3BAWA 3CPGA 1Q8AA 5DN1A 1XLJA 1W6TA 1IHIA 3ITYA 4HIBA 2WP6A 3AYVA 3VZZA 3W73A 3GKFA 2HISA 4AW7A 1EBHA 5GNXA 3QR3A 1WAWA 1HQTA 2QZRA 3WDHA 2V3GA 3O6YX 4A6GA 3AI0A 3THCA 1N63C 3FG2P 2BXYA 1TV7A 1SPQA 1T99A 1K8ZA 2PBGA 1HKJA 1G7UA 3IUDA 1LBMA 1B3YA 4G1KA 1EXPA 3HMCA 3UW6A 4KEVA 2QIIA 2GDUA 4ZR8A 2FYMA 4XSMA 3S42A 2FPYA 3NQVA 3NOYA 3NZPA 4TV5A 2EPNA 3V0TA 1Q1RA 5A6JA 1JPMA 1YBQB 3TR9A 2O9TA 4TQTA 2ACSA 3CHCA 4LEQA 4Q8QA 4GJIA 3QRHA 3EX4A 1RHCA 1WDPA 2GZXA 2B7OA 1FH8A 1F6YA 1V02A 3TE9A 4DIAA 2G8ZA 4H4RA 3QLLA 3WLTA 3FHAA 4QG9A 3GG7A 1KFWA 4OZOA 4I9AA 3GR8A 3IANA 1QPKA 4DUVA 4E4UA 3MC5A 3M0MA 1ONFA 2P5NA 4CCEA 2OO6A 5HR6A 2NT1A 1G6CA 1BF2A 2E5DA 2QUMA 1K6WA 3KOYA 3URQA 2OTDA 3U2CA 1R3QA 1CGXA 3K5XA 4AZHA 3OGRA 4LXFA 3LS9A 3Q37A 5C71A 2EG7A 4ROQA 4C6FA 4EWJA 2OSXA 2D0GA 4HOZA 1FDJA 3IAQA 5GQBA 3U2ZA 1RAKA 2NW0A 1H7OA 2OYLA 3U2OA 1JXKA 2IPWA 4O0QA 4A3YA 4JQ2A 4CVUA 1OFBA 3B3DA 3E5BA 1FDZA 1VH7A 1W1B1 4ZOEA 3AIWA 2V63A 3NR0A 3KS5A 4AD5A 3CAQA 1WNOA 4LCRA 4C6BA 4ZO9A 1A50A 1LT7A 3UR8A 1RP9A 3VOHA 1IWPA 2PP0A 1E6ZA 4F2TA 2GK1A 1S3HA 2CXEA 3FSTA 1G94A 2J9XA 3MP3A 4PE8A 2ZADA 5A6LA 5G1YA 4UIOA 1VDVA 3GE7A 2YYUA 4PUMA 4LVAA 1VEMA 1S3TC 3SW6A 2VDGA 3HV8A 5LHEA 4Z1YA 3BMVA 1Q65A 4IF2A 3RN6A 1QVBA 4NJHA 4HK5A 3VC5A 1RVKA 1S5WA 1H5YA 4AD3A 3IGHX 2HVMA 2NLYA 2WYSA 3DHDA 4K7VA 5DXYA 4KIRA 2X2YA 6REQB 2FGLA 3ZYZA 3TZFA 3PY2A 3O0KA 3W88A 4OIFA 4V15A 4V2XA 2V6AA 4YVPA 2V2HA 3C0SA 1FKWA 2F38A 1XH0A 5KETA 4DLMA 3TYAA 1CXKA 3P0XA 1QU4A 1W1TA 3LGGA 3M0IA 3EWBX 1XLKA 3N9RA 3FV9A 5I03A 2B7PA 4ZODA 4IT1A 9RUBA 4IOTA 3W7DA 1QI3A 4NZJA 2JEQA 1GXFA 5JCNA 1R3RA 3S2CA 4U3AA 3LPFA 2TSYA 3RLHA 4XKYB 3TAOA 1MNSA 5EMYA 1H7NA 3AYRA 3VD9A 2D69A 1GRBA 1TO3A 3YPIA 4TVUA 2IQTA 2DT1A 4ZL1A 4HN4A 4Q4KA 1F8WA 1IT8A 4R7JA 1VAHA 3U7BA 2DW6A 1FA2A 2QLYA 1K3UA 4O19A 3VGEA 2C7FA 2W91A 3CMGA 4AB4A 1OQFA 3G1HA 1RXOB 1IGSA 4OGZA 2D2OA 4LYKA 1H7XA 1AL8A 1P6BA 1Q66A 4IMCA 5AYXA 1LWHA 4TVYA 1W3JA 5BU6A 4JQ4A 4WSHA 5U7SA 5BZAA 4ILSA 2X09A 1LP6A 3II1A 3L9CA 3HG4A 4L4MA 4PMQA 1UUQA 4O10A 3VX0A 2YLLA 4PCPA 4AMAA 3OG3A 1DJGA 3IJLA 2ZRWA 3GAYA 3FJ6A 4HOWA 4K8DA 1IXPA 4JPGA 1LBLA 3PZVA 2AOSA 3VZXA 4OOUA 3IJQA 3E0WA 2ZA3A 3NVYB 1TVNA 4Q4SA 4K2SA 5IM51 1VPXA 2WZMA 1TTIA 1U22A 4Z08A 4K38A 4IUGA 5I3FA 1P0NA 2JE8A 4LB3A 3V5CA 1VQZA 1AODA 3WF0A 3MKKA 1X6NA 3UJFA 3OLIA 4ZE5A 5G1MA 2H3BA 3AHZA 4PCNA 4LGXA 3SCQA 1LL4A 3DK9A 4ZQPA 4QDPA 2VGBA 4G5DA 2CPUA 1E9LA 3STGA 1DJWA 4ZTYA 5DANA 3D3FA 3KTSA 3PB2A 1JZ6A 3WLKX 3SECA 4BWLA 4DI9A 4QLJA 4W7VA 3GUGA 3EA2A 3RLUA 4S39A 3CIVA 1F6PA 2POTA 4MMWA 1QNVA 2OYMA 4YJ5A 4GG9A 3ZO9A 1VJSA 5DBTA 3GXTA 4ZE4A 4WOQA 1UWQA 4B3ZA 3EDFA 1BG9A 1M5WA 5JBEA 5MF5A 1CLKA 4DO7A 2OOFA 2A3HA 1TUXA 1J11A 4B4FA 2ODOA 3EDKA 1OC7A 2NXGA 2WOQA 2Z29A 4MNKA 5HR7A 5E09A 3S5SA 4ZMGA 2GVEA 3PTMA 4FI4A 2ZC1A 1TFVA 1L8NA 3S2JA 3BO9A 1K03A 3BLDA 1W5MA 2DPEA 1YXDA 2XIOA 3ONCA 1XC6A 1ZJAA 1A0CA 1A5BA 3P8JA 3ICJA 3GD4A 3W2UA 1JD7A 2Q71A 1X1NA 1A53A 4UTTA 3R25A 4OHQA 2XJ7A 1PDYA 3WF3A 2LLEA 5K4XA 3TJLA 3BVJA 3VTRA 2PDFA 5GRTA 2WCGA 2HRWA 4GRTA 1KBKA 1K02A 3H54A 3NS1B 3IJDA 3UR2A 1CGWA 1FHDA 1OZQA 3W7HA 5AZ0A 1EFZA 2ZWYA 3W01A 3TW6A 3F4DA 4RKAA 1Q45A 3S1GA 1VBHA 3DDMA 3IV3A 4IIGA 4G7EB 3QXBA 3R8RA 3PF3A 1DTNA 2ZXQA 3VNZA 1PXGA 2VFFA 1DXLA 3GHRA 1JF6A 5C9XA 1J0YA 1SR9A 1YTKA 1T8QA 4D9PA 1ZCCA 4HHPA 4FX6M 2G37A 5FEPA 3W1PA 4TVDA 1MZRA 4FF5A 3EWUA 3UCQA 1ZSXA 2X1IA 1DWIM 3NQFA 3LQLA 4IMDA 4LT9A 5LIXX 2G3IA 1DWFM 1PDZA 1XLCA 1VENA 2OQHA 3URAA 4JNMA 7TIMA 3PM6A 2J7EA 3AS0A 2ZZ5A 5BWFA 2ABAA 1EJWC 1BYDA 3NTYA 3VM5A 3OODA 3P82A 2MUCA 3MANA 1XBXA 2H8XA 5T26A 1P4CA 2VX4A 1UZ1A 2R1MA 1H5VA 1PSCA 4FLQA 3RDKA 4HD5A 3AYSA 2XIMA 4DJFC 1OGGA 2QCGA 1IWAA 2WLZA 4NL1A 1XIBA 2EPOA 3GSMA 4S3DA 4UNKA 1JPKA 4MGGA 5A8OA 4WJEA 4MNJA 4UR8A 5CZJA 3LSBA 1EPVA 1FHVA 2IKGA 4FOKA 2REQB 2YBTA 4DM1A 2Y88A 2C8NA 3P84A 3DG7A 5ER0A 4JIQA 2VFHA 3T2QA 4LBUA 1UPMB 4PUKA 1FEAA 2XIIA 3FYOA 1UKOA 4CNOA 3UPMA 1QHZA 5B7YA 4AWSA 3M6YA 3T09A 1BVZA 2E40A 2G4JA 5MKGA 5HXMA 5AC8A 3GH4A 1XLDA 2YVJA 1PS9A 1LRQA 3FEQA 1Y7VA 3LHYA 5JCIA 4O1DA 3RPDA 3O1NA 4KGJA 3CS2A 5DMNA 3OB8A 5EBKA 1WBJA 4WCJA 1J12A 1KFKA 3CC1A 3M5YA 3TW7A 1KLYA 3DESA 1VBRA 3L4UA 3BURA 1STZA 3LX9A 4HNUA 3U3HA 4D71A 4IPIA 1UBPC 3KTCA 3HA1A 1UWIA 4WKFA 3R8HA 4S23A 1VFSA 2P8BA 4N4QA 4YTUA 4PB3A 1NDWA 2JGQA 4M56A 5C9RA 3WBAA 3MMTA 5HNTA 1TPC1 1BRLA 4CQAA 2C18A 3WQ4A 4DXKA 4PN2A 1V97A 2X99A 3SUUA 2CLOA 3L23A 1LOQA 3E0VA 2YVFA 1UZ4A 1XLFA 3DKJA 1LM1A 3IVTA 1V6VA 3HN3A 2Z1WA 4HT3A 2DSKA 1EJTC 1NH6A 3AMGA 1V8EA 2QPXA 1GRHA 5A6MA 1G7VA 1VJZA 2GLKA 1JUKA 4O13A 1A5NC 1UPPA 2Z26A 2ZZ3A 4H4UA 2CLHA 3MKCA 4AZ5A 1NHRA 4FMVA 4WY0A 3AXKA 1FXQA 3EPNA 3ITCA 2PDKA 4IPJA 4QE4A 2BS9A 4AUBA 1SFTA 4FXFA 1AW2A 4F0HA 3NZQA 2INEA 1W3IA 1BFNA 1MQPA 1PYFA 6XIMA 3WSUA 1KBJA 3VIIA 1XLBA 2OR2A 1OT1A 1TV3A 3HPFA 3FDKA 4A3RA 4GX9A 4BEUA 1S7MA 2GK1B 4PRRA 3ATZA 2Z7KA 5BXPA 1LWIA 4AVFA 3W7MA 3MDUA 4C5YA 3WH9A 1Z42A 5EMLA 1G4PA 2E7FA 1MMFA 1XD0A 5CSRA 1CXHA 4H9TA 5L6UA 3O7UA 1ICPA 3HO8A 4Y96A 4P7RA 3PUOA 1JUBA 3DUGA 4OBSA 1H11A 4ZEPA 1LQAA 2FJUB 2PDGA 3MZ2A 4OFCA 4JTJA 5EMMA 4GYPA 3SY1A 1RM6B 4B5TA 4WDXA 4FPSA 2FH8A 3C3UA 1K6AA 3SEPA 1FXPA 1JZ7A 2DIKA 3LENA 5ENLA 1Z44A 3DGBA 3QPYA 1B3ZA 2NSOA 3T8QA 1U83A 5G5HB 3MY9A 2IXUA 1A5LC 5C7HA 2A79A 3ABRA 1NFBA 5AYYA 1XRTA 3QFEA 1UD8A 1IWBA 1DJHA 2C6QA 1H60A 1CENA 1TQXA 1IEVA 5ABTA 1VYPX 4Q8MA 4S3EA 2V2DA 3LBMA 1ITXA 2JF7A 4ZB2A 4QE1A 4UOQA 2GPTA 3TJ4A 1UP2A 1GORA 3ZWSA 3XIMA 1GOMA 4U2YA 3LCXA 3ZLHA 2NX1A 4JFUA 3O9NA 2EBNA 2WVSA 2CZVA 2CHNA 3GRTA 4FLOA 1UZHA 1YQZA 6CGTA 2GGJA 4HU0A 1GPWA 3LHUA 2WHLA 3B9JB 2ATMA 3QZAA 3AS3A 4BY3A 2WM1A 1BGAA 2VZSA 3PJTA 5C55A 1T0OA 1WDWA 4RNHA 3WJSA 3CGTA 3I4KA 4H8UA 4NX0A 4QNEA 1ZJHA 2WSYA 5DRCA 3GDTA 4Q33A 1KB3A 3IGSA 3CH9A 4EPKA 1UC4A 5H6HA 4IQLA 1EC8A 2BLEA 3N29A 3LCLA 4R27A 5DCEA 3TQ0A 1SFSA 1OFEA 4U2ZA 4JTFA 2CBJA 4Y90A 2CDUA 3QF0A 1RUSA 1IIGA 1U1HA 2WJFA 3TQVA 1ZK7A 2J8GA 5A2BA 3G0UA 3WDIA 3MUY1 5HWNA 2DFAA 3QLDA 3ZVHA 4Z2IA 2VQTA 1UD2A 3LM7A 1DWHM 1OINA 1V6YA 4S3GA 4YCPA 1L8PA 2INZA 3W86A 4S3JA 2W79A 2E68A 1GYNA 1R7OA 4LF2A 4A2RA 3N19B 4MPKA 4MYAA 3GHSA 3LD5A 1P43A 1S2AA 1WKYA 2E25A 3WUEA 1JDAA 2ISVA 3IK2A 2ZRXA 2PDPA 2D1ZA 3KCOA 2PP1A 1NOWA 1XDMA 3GC2A 4JFTA 4XTIA 5IBXC 1MFUA 3FKRA 1NM9A 3G8EA 4H4XA 2YZ5A 3UT0A 3C0LA 4GFSA 1WXYA 2JALA 3WK3A 2O0TA 3B9OA 4FALA 1AL7A 1QW8A 5DCDA 3GIQA 3SCWA 5AC6A 1MQRA 1FCQA 3MV11 2WHJA 4LS1A 3PPHA 1OCBA 3IARA 4PMJA 2WLYA 5D8ZA 2QULA 2J3NA 1DNCA 3ZT7A 1IT0A 1REQB 2VNCA 3UA3A 1OFAA 1X38A 4DWSC 1QWKA 3II4A 2GFTA 2R94A 1XISA 4EQWA 1M7OA 4CN4A 1SZEA 1VCFA 5FF7A 4QLLA 3NVWB 2YCEA 3WLPA 3N73A 5EMUA 3IVSA 4ZO7A 1B57A 2DGAA 3WD4A 6A3HA 3WDQA 1OC6A 1KXHA 5KSWA 2UV8G 2ZVIA 2Z2AA 3VMOA 2JFEX 1YNQA 2Q3OA 1VGAA 1VQTA 5TD4A 1EEXA 3BE7A 3BW4A 1R9YA 4LAMA 3MYOA 1ZBWA 3LHWA 1GOXA 2BOEX 2XH4A 1KM4A 2BY2A 1AD1A 4IMFA 5LIWX 2DSUA 2HXTA 3BCFA 4GINA 2P1FA 3WLJA 4IIDA 4B91A 3G2GA 2VRKA 4LJ3A 4W8LA 1F76A 4AZGA 3UBPC 4A21A 1NQKA 3PTDA 3POHA 4Z1AA 1GGOA 3NQEA 1P0EA 3VOCA 2G3NA 4N0RA 3NQ8A 3THDA 4Y7EA 4RW5A 2AQVA 3L5LA 1JNEA 4ZQRA 5I79A 3W6LA 1FH9A 1V7YA 4FB7A 1OJTA 3DH7A 1H41A 4JNYA 2HJPA 1WCGA 3UG3A 3WLLA 1Z8AA 3LPPA 1QNOA 1TPVA 1AZ1A 1TR1A 1A5OC 1E0VA 4JX5A 4A8IA 4A2SA 4OJYA 4EXQA 3AISA 2QCDB 1NAL1 1LOSA 2HQAA 4FX8A 4UTJA 4DJDA 1XLLA 2G0WA 4HMCA 1MI3A 1YYAA 1UJQA 2GOUA 4CQBA 4XAYA 3ARTA 1XIEA 2QUTA 3HU7A 1KXVA 5M17A 4QJ5B 1SW3A 3OYZA 1U5JA 2WCAA 4H4WA 5CXPA 1UWAA 4UTKA 3TQKA 2PGWA 4IQEA 2V5CA 3CB3A 3BZGA 3ZJ6A 4AX6A 3WELA 1N2VA 4QTGA 1PKYA 4L9ZA 1VPQA 5FOOA 2Y4SA 3BV7A 3WLRA 3R0KA 1AH0A 3I68A 3K30A 1QI5A 1UUMA 4AY8A 4WXYA 5AHLA 3WLHA 5D30A 5F2LA 3H2CA 4JD4A 3FGCA 1EA9C 1E0TA 1V6WA 1EJ7L 3EKGA 3XINA 3P8IA 5CKSA 1CWYA 3M6DA 2Q8LA 1E6PA 5TAOA 4C7FA 2J66A 2CERA 3VIOA 3WBXA 3HFYA 1P7TA 2CLKA 3AHVA 3DX5A 2BB0A 4AZCA 3BMWA 4G6CA 4IL0A 1GV4A 2WC3A 3MCNA 3SQMA 3FX4A 3WF4A 3UJSA 4H6KA 3WNKA 4J9JA 2QKFA 3EOEA 4CD7A 3NSMA 5BU9A 2J74A 4KWSA 2I5QA 4M81A 3WIJA 3QH2A 2IQ0A 2F6UA 4B5NA 3CTTA 4J57A 1VYRA 4IMAA 2PTDA 1MFVA 2WVVA 2BY3A 5MKGB 2A0NA 1XUZA 2DY3A 2PLCA 5EU9A 4Y9OA 3I7RA 1LG1A 3UD6A 3AXXA 2HS6A 4RZ6A 2V3AA 4F4RA 4C65A 3P3BA 4HYVA 3HRDC 1TJ1A 2VR4A 3F4WA 4ACYA 4F0MA 5DBUA 4N9CA 4QJ1A 1OK6A 3ABOA 3NSXA 5E0FA 3DG3A 3H4GA 5EPDA 3DFPA 3W6MA 1A5SA 4XB3A 4C6DA 1VEPA 2ZBTA 3H53A 2ZZCA 2XVNA 4LF1A 1E3XA 1VFTA 4AQLA 2CESA 3VO0A 3G5EA 1I45A 4ROPA 2DVXA 1JI1A 3B9NA 3O16A 2J8FA 1PTDA 2JF6A 3I6EA 5IHSA 4KKXA 4HMDA 3HG3A 1BRLB 4U10A 5I6SA 1NWSA 2VFDA 4PBFA 1SZRA 3OZOA 3SFKA 3RLVA 1I1WA 1XYZA 1ZKQA 3C2FA 2QDHA 4PEKA 3MWCA 3EDEA 3IGUA 2RJHA 4AEEA 4HSNA 4B15A 1PV8A 3CWHA 1DBTA 3RRXA 2VOTA 4UR7A 4S3AA 4GQRA 3KCLA 1ZMDA 3GR7A 3F1QA 1E6QM 3W22A 1J6OA 4IXXA 5FKYA 2XH2A 1LCOA 4N9BA 1UD4A 2ZIDA 4EVZA 2YCJA 2NV1A 3L65A 2XVKA 3WLQA 4GOAA 3W1UA 1RCXB 3GR4A 3ANUA 3DFSA 1WB0A 5I3HA 3I6TA 2YDRA 4J40A 4WY0B 3STCA 2HXUA 2HEJA 4I6KA 2E6DA 2OVLA 1HKVA 2ZZ0A 1EYEA 1J0IA 1E43A 3HG5A 1H2IA 5CPLA 3BMXA 5E1QA 1OJXA 1YQ2A 2R14A 5LNWA 3RX3A 3H24A 4DZ5A 2X0YA 4QITA 1XKYA 1LPFA 2HMCA 5FS6A 3MDWA 2Y63A 4GVIA 5M2FX 1U1JA 4S3FA 3MSDA 1PJ9A 3ZS4A 1DVJA 1OYAA 2X2GA 1UH4A 4M1BA 5T9BG 2D73A 4GH1A 2PBOA 3R10A 5D9PA 3EANA 4QX4A 1W9XA 4KBXA 2Z0IA 3CIWA 1ME8A 3VGGA 1HP4A 2GGGA 2Z1VA 3OQ8A 5BYWA 3SFWA 5BRPA 3TZNA 4FS9A 2QYGA 4LS2A 4HA4A 2D0FA 5DELA 3HURA 2XFRA 4H2HA 4XISA 5SWUA 3NDYA 1KKOA 3TUUA 1XHGA 3CQKA 2TPSA 1ZBKA 3LPOA 3MA8A 3W24A 1QRQA 1GQJA 5DY3A 2JGYA 3CV6A 1TVLA 3S0CA 2V5LA 3E5PA 3TKFA 2V9DA 1IEIA 1TV4A 4WGXA 4UNLA 2D2JA 3TP4A 4MDOA 2WJZA 3GBDA 3TNOA 2C91A 1R9XA 2FDMA 2VT0A 3B0VC 2E1DA 6XIAA 2VEGA 3BC9A 2QPUA 1T41A 2I56A 5HWMA 4JHOA 2DZWA 3KLJA 2CBVA 3TROA 3VK5A 1O5XA 5HPOA 4CUCA 1J2WA 3UWZA 4H41A 1WXZA 4B4HA 2V0TA 3KTXA 5D33A 2VVSA 3H12A 2NX9A 1XGZA 5CEWA 4AMCA 3P93A 5AY7A 4UTFA 3CGCA 1XYCA 1UD6A 3AU2A 2YBUA 4CD6A 3DFHA 3UJEA 1H1ZA 4O28A 2NWSA 5CC3A 3W00A 2EXOA 3GTXA 5EMJA 4C6NA 1YXCA 2BY1A 1UH2A 3K8MA 4CNPA 5FAGA 5AVNA 2UBPC 3O0HA 1YDOA 2ZX8A 1SO4A 3WX7A 1N8FA 4GXWA 2F5ZA 3TVAA 1V7AA 4KRZA 1HGWA 3K8LA 2C3ZA 3OYXA 3G1FA 1X39A 3W02A 4ZOHB 4UQAA 3G1SA 3TYBA 3IPWA 4DEFA 4R9OA 3CUJA 1L6YA 1S2VA 2ON3A 1IXOA 1GHSA 3WH6A 3CT2A 1ZUAX 3ZVHB 4HBKA 5DFAA 2E5AA 1GJPA 2QJJA 5EFFA 4X9YA 5A1AA 4N9DA 2YL6A 3KOXA 3M0LA 4ACZA 1EC9A 4IIBA 3NVVB 3EEZA 4QQUA 2AMXA 4QCFA 1CNVA 3VIPA 3FVMA 3LDVA 1XJBA 2E1WA 4BJHA 4F40A 1WYGA 3PS7A 4N2YA 3LY0A 1VB9A 3QQ0A 1GUVA 3UG5A 5A6BD 4JTQA 1AZ2A 3ES8A 3AFBA 2XIJA 4NI3A 2F6KA 4M6QA 2RGLA 1PE1A 3T07A 1C90A 4MKVA 5GPRA 3SURA 1T96A 2O55A 3E0FA 1CXIA 3UR5A 1V77A 3PJXA 2RFGA 4CCZA 5CLWA 1TRIA 3S5NA 2FZ9A 5EMKA 4I7WA 3F4NA 8XIMA 3MI3A 5HQEA 4E8CA 1QPOA 4BV6A 1YTDA 1GVRA 3BLFA 1TX2A 5HANA 1FWAC 3ZFHA 2Y8UA 3CASA 4RL3A 4KS0A 4K6AA 1B90A 1X98A 3ECQA 1QATA 3WJWA 4OV9A 3UZWA 1N82A 2Z1XA 4QSFA 2QJGA 3K1DA 3UVIA 1QPQA 3ETRB 3PP7A 3A5FA 1O12A 4K68A 2NSXA 1BYCA 3BLLA 3GH7A 3SJNA 1FO4A 1F3EA 3LLXA 4KCUA 1JNDA 1LQ0A 4CCDA 1CZ1A 1WBHA 1XD1A 3S6DA 1BGGA 1R3WA 2OZTA 4IIFA 1KTBA 2QAFA 4GI4A 3SY5A 3VA8A 4WF7A 1CEOA 1SO3A 2OYKA 3W27A 2OU4A 5MHBA 2D0HA 4UFLA 3U9IA 4QSHA 3SGUA 4ONVA 4YCOA 1I9CB 3H6OA 2JIEA 3GXPA 3AXHA 3GH5A 1O95A 3DJJA 3VXGA 1Q7MA 3ZJ8A 1WOBA 4B3KA 4D6FA 2PF8A 3DHPA 3NXFA 1AJ2A 4DUWA 3BGGA 1R3YA 2PCEA 1RQBA 2G41A 2VZTA 2W27A 2A5HA 3SAZA 5C2XA 1Q6LA 4DYJA 3PNUA 2O56A 5HNNA 4RUBA 3WBEA 3N04A 5FF2A 1I6NA 2WC4A 1XIJA 3SIZA 3B06A 1VLWA 4FX9A 3E49A 1WV2A 4ASTA 3WQPA 4F3HA 2MANA 3NL5A 5J8LA 3N13A 3DGHA 3KDOA 3N1AA 3OTRA 4D6DA 2C1IA 1JRCA 3QFAA 4OE7A 1GQIA 4Q22A 3RYSA 4G7FA 4ZA0A 1ZB5A 3NGFA 5G2HA 4OTKA 2EQ7A 1AJZA 2B81A 3VD4A 1A4MA 1W5PA 3AS1A 3P62A 3VCRA 3WLOA 3TWAA 4DBSA 1IEQA 3MYPA 5M03A 1RQHA 1EKOA 3WK1A 1XCXA 2ZX5A 3H55A 3W7IA 1UR4A 4KH2A 2YB4A 3GFZA 2ZOXA 2XWEA 1N55A 2D22A 1V0KA 3M5XA 4DZAA 4UQ9A 2ZC8A 1DJYA 2QDGA 1TX0A 1PIFA 2YX0A 4PODA 1L2QA 5D2XA 5I78A 4QEEA 3LCFA 5CZTA 5LSMA 5CG0A 5AC7A 2YAUA 2OMAA 1T6MA 1Z48A 3NVDA 4P2VA 3LLFA 1XHCA 4BZYA 1FHLA 3DH9A 4R7OA 2XSXA 4ZFCA 1KTCA 5CPOA 2HPMA 1ZS2A 1UJPA 1P7TB 1Z89A 4Y2WA 1HJUA 1C29A 4IM4A 3TYCA 3M0YA 2YL5A 3AJXA 3TOPA 1KWKA 4KPRA 2QUUA 3BW2A 2GUBA 1KM1A 3EPOA 1DP0A 2AL2B 3PG8A 3GB6A 1EC7A 1KR0A 3FSUA 5BXSA 2V67A 3TYZA 2YCKX 3VOFA 4FK9A 4C6IA 3VZYA 4NEWA 2WVVB 1D7FA 1HL9A 1B1YA 3CLWA 3VKKA 5U25A 4HHLA 5AB3A 1MSSA 4ZFMA 4TV6A 3TA9A 3CEPA 5HPCA 1RA5A 3A3XA 2YCIX 4LRSA 2FVMA 2OOGA 4UMBA 3KOZA 3UPWA 1F61A 2VEPA 2Z4GA 3TWBA 3ZZ1A 2ZWZA 3EKLA 1GKRA 4I9TA 4APNA 1VKFA 1Q6FA 1OK4A 3FN9A 1ZJIA 1E0XA 4L6DA 3VDAA 1BEUA 1SSGA 2QNEA 3MUZ1 4JYDA 2V68A 4FOUA 3A23A 2QJNA 3AC0A 4HKPA 3S83A 1RY8A 4R53A 3E2QA 3E12A 1Z6KA 3RIKA 3LBCA 4I5RA 2Y24A 2YGYA 4UFMA 2DSWA 4IL2A 4MUPA 3RUBL 5A2AA 2GR0A 5CZSA 4UTWA 1L0PA 1EBGA 4LPCA 4PSRA 4MWAE 2PS2A 3ALFA 3OLEA 4DN1A 3V1PA 4EM4A 4MJ2A 2DIEA 5FJPA 2WB5A 3GVGA 3WENA 1UQZA 3W3OA 3TCEA 4UFIA 5LNVA 3SM0A 4BHYA 2FZ8A 4WKHA 4AU0A 4PTDA 3BG9A 1JVNA 4M82A 4FXSA 5EBUA 3EYPA 5M3WA 1DXIA 4C91A 2ZE0A 1Q2SA 1QI2A 3H7VA 3WLMA 4GCXA 4GY7A 5BNKA 2W6RA 3T7VA 3ARWA 4YYFA 2TAAA 3B40A 4A3UA 3CAWA 3DXIA 1DYSA 1SVDA 1ZXIC 3LTYA 1VR6A 5C6MA 3B05A 1NEYA 2Y89A 4MZYA 4Z1CA 2UWFA 1HJXA 1D2KA 4UTHA 1F8IA 2PSNA 2WWCA 1GJUA 3QV8A 3DIPA 1OADA 5DX7A 4ZENA 3VIHA 1TTPA 1ZP3A 3N2XA 2ZZ7A 2XGIA 3LGEA 4Z0SA 2EKGA 1SZGA 2IQDA 1TZ7A 3EDDA 3SQLA 3R8GA 4XD3A 3GD6A 4IP4A 5FS8A 4GYKA 2ISWA 3W7LA 4GI9A 4Q7BA 1YDYA 3W7QA 1H7RA 4J3UA 1GVYA 4E38A 1AJ0A 1XIFA 3LU2A 1RV8A 4R33A 5DY2A 4US5A 3TEVA 3C2VA 3NQ7A 4GBDA 4M8UA 2PDXA 3UNDA 4C6EA 3MBDA 4KERA 3C3NA 2FHBA 4LU0A 1JCMP 3DFTA 3VD3A 4LQ1A 5GVJA 2NQLA 2A3EA 3TC7A 1W3LA 1J0ZA 5BOFA 1F3XA 3PPFA 3T78A 3OLDA 1V93A 4J3XA 3ITOA 3KRBA 4R3UA 5EYWA 1H7WA 3K1GA 2W3ZA 4XAZA 4F0KA 1GETA 1ECQA 4D8ZA 2I9UA 3ZR5A 2WPGA 4DJED 1GEQA 2YFOA 1W0MA 1BWCA 2W4XA 1R86A 3RM4A 2QAPA 1B4EA 3QQWA 2ZDSA 4FO4A 1KCKA 2CLEA 2OZ8A 4QNWA 1YNYA 1MNZA 4MB4A 1E4IA 4JTCA 4O53A 3EMQA 2C79A 4HMEA 4TUFA 1J01A 3STPA 4PB4A 3WL1A 3IV8A 1ZY8A 3N12A 3BW3A 1K70A 2XINA 1KM6A 5JBDA 1EWEA 3AMCA 4MLRA 1WDQA 2VTFA 1E73M 5HINA 1T7LA 3AMLA 1X8CA 1TWDA 2WO5A 3CUXA 4LC6A 3DI1A 4LAUA 1JXJA 3UZZA 2ZZBA 3AMKA 1SJAA 1X2GA 5ABEA 1W1PA 2A7NA 2Y1HA 3SCVA 3KDNA 2ZXDA 2X1UA 4H83A 5I24A 3VIFA 2CLIA 3ORWA 1JOAA 1M65A 3GD3A 3V7PA 4L4PA 1YDNA 1W17A 3WUFA 1X2HA 4C6MA 3C0QA 3LEPA 5HNUA 3EBVA 3NL3A 4L9YA 3M0HA 1XUUA 1UIOA 5LIKX 1EQCA 1POJA 3FXYA 4NRSA 4MIMA 2X41A 3L4ZA 2ZUVA 2FB3A 1TZZA 2ZICA 2DSZA 1B31A 3OEXA 1H3GA 2C14A 2HQMA 2I5GA 2W3SA 2HCVA 1EEPA 3VAVA 4GNVA 1G0CA 1TYTA 1JROA 3GHUA 3BWWA 3VIKA 2D3LA 1TRDA 1VF8A 3WYZA 3OZMA 5I23A 4XVDA 3EB4A 3QTGA 1V51A 4HJWA 2J6XA 2C19A 1PO9A 1P0KA 1KCXA 4L80A 2HZGA 4O8RA 1CB7B 4RXFA 4ACZB 4XAPA 3MUXA 1FX6A 4ADTA 2OX4A 4O0KA 2RDWA 3WG6A 1F4HA 1TTJA 1ISYA 3T9PA 4C6PA 4JTDA 1S5NA 5LKYA 4NIRA 4JN7A 2H3DA 4MWAA 1ALDA 3OZYA 3C2OA 4CKQA 2BVWA 2WKJA 3MSYA 5HMFA 2C71A 5EY5A 1S2CA 3UGRA 4LYQA 4ZOBA 3N17A 4B5UA 1EF3A 1MDLA 1KGUA 1E0WA 3RR4A 3L5OA 1XC4A 1KCLA 1XYMA 1Y8BA 4PCSA 2P0IA 3VKCA 3N2MA 3RO8A 2FTYA 3I7SA 3W07A 2EKCA 4D6EA