2P0IA

Crystal structure of l-rhamnonate dehydratase from gibberella zeae
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
407
structure length
393
Chain Sequence
LSSVKDFPKIKAIRSFIIGHWLIDSDISTPASKWEQYKKSRTSWGINVLGSFLVEIEATDGTVGFATGFGGPPACWLVHQHFERFLIGADPRNTNLLFEQMYRASMFYGRKGLPIAVISVIDLALWDLLGKVRNEPVYRLIGGATKERLDFYCTGPEPTAAKAMGFWGGKVPLPFCPDDGHEGLRKNVEFLRKHREAVGPDFPIMVDCYMSLNVSYTIELVKACLDLNINWWEECLSPDDTDGFALIKRAHPTVKFTTGEHEYSRYGFRKLVEGRNLDIIQPDVMWLGGLTELLKVAALAAAYDVPVVPHASGPYSYHFQISQPNTPFQEYLANSPDGKSVLPVFGDLFIDEPIPTKGYLTTADLDKPGFGLTINPAARAKLIPSDYLFKVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of L-Rhamnonate Dehydratase from Gibberella Zeae
rcsb
source organism Gibberella zeae
molecule tags Lyase
molecule keywords L-rhamnonate dehydratase
total genus 114
structure length 393
sequence length 407
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.90: L-rhamnonate dehydratase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2p0iA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2p0iA01
3SN1A 5FJUA 4GYPA 2HZGA 1R6WA 3I6TA 4K8GA 3CYJA 3UJFA 3N4FA 3SBFA 2OPJA 3EEZA 3OZMA 4IP5A 3TOYA 2PMQA 3VC5A 3EKGA 5FJOA 2DW6A 2XH7A 1TKKA 2PA6A 2AL2B 4DX3A 1YEYA 2QJMA 1PDZA 3GC2A 3ZLGA 2I5QA 4KEMA 3VCCA 4GIRA 1MDRA 3MZNA 4GMEA 3V5CA 1TE6A 3UCDA 1ELSA 2QVHA 2PSNA 3U4FA 1MNSA 2ZC8A 3B97A 3HPFA 3TJ4A 3N6HA 1NU5A 3THUA 4YWSA 4M0XA 3UCCA 3BJSA 1EC7A 4ROPA 1BQGA 4H2HA 3QKEA 1MDLA 4K2SA 2OX4A 5FJTA 3QLDA 5FJPA 4F4RA 3N6JA 3RO6A 2PGWA 4KT2A 3QTPA 2P8BA 2OZ8A 2GL5A 2HNEA 4HCLA 2XSXA 3R0UA 3T9PA 2PTWA 2PU1A 2OO6A 3ES7A 3JZUA 4FI4A 2OZTA 4HPNA 1DTNA 3K1GA 2P0IA 2QGYA 4IT1A 1IYXA 1L8PA 3TWBA 1SJDA 3CT2A 3FCPA 3S5SA 4KPLA 4A6GA 1F9CA 3MY9A 4DWDA 1SJCA 3STPA 2PU0A 4H83A 2PTZA 1KD0A 1KKRA 3JVAA 4JN7A 3D47A 2QQ6A 4IP4A 4JN8A 3FV9A 3SN0A 2PP3A 4Z17A 1XS2A 3GY1A 3U9IA 2ONEA 3VC6A 4M6UA 3ENLA 1FHVA 4HYRA 3T8QA 3TW9A 2P8CA 2MNRA 3DEQA 3TWAA 3ZLHA 2GGIA 3FYYA 4DN1A 2PTYA 5ENLA 3IJQA 3MUCA 7ENLA 3OTRA 3FXGA 5J04A 1E9IA 3VA8A 2DW7A 2CHRA 1W6TA 3P0WA 4DYEA 4E5TA 3MSYA 3H7VA 2OFJA 3V4BA 4JHMA 2PP1A 3ZLFA 3TTEA 1R0MA 3RCYA 4IZGA 4GGHA 4K1WA 5FJRA 4FP1A 4KWSA 3NXLA 3IK4A 3I6EA 4E4FA 3UXLA 4HCDA 3TJIA 3DERA 1ONEA 2QDDA 3SQSA 1KCZA 4Z1YA 3PWIA 2P88A 2PTXA 1JPDX 2GDQA 3R25A 3V5FA 1FHUA 4J1OA 2FYMA 3NZGA 2OVLA 2PODA 3SJNA 3N4EA 1SJBA 4GYPC 3DGBA 2GGGA 1EBHA 3NFUA 3MWCA 2OKTA 1WUEA 3DIPA 3R1ZA 3D46A 4H19A 4E4UA 1TZZA 3V3WA 3VDGA 2XGZA 2O56A 2OG9A 4A3RA 4MMWA 3UJRA 4DHGA 3IJLA 2AL1A 3VCNA 3OZYA 2AL2A 2GGJA 3UXKA 3DG3A 3I4KA 3CB3A 2NQLA 2HXUA 3JW7A 1EC9A 3MQTA 4IL0A 3TQPA 3RITA 3P93A 1JDFA 2OZ3A 3S47A 3NO1A 2PPGA 4GFIA 2XH4A 2QDEA 3ES8A 3BSMA 3ZVIA 2HXTA 4ENLA 3RR1A 4A35A 3CXOA 2QJNA 2ZADA 2MUCA 3SN4A 3UJ2A 4EWJA 2POZA 3CAWA 1NELA 1OEPA 3PWGA 3DG7A 4MKSA 3R11A 3T6CA 3R10A 4GISA 3H70A 3UGVA 3T4WA 1XPYA 3ZVHA 1PDYA 4ZA0A 2GSHA 4ZCWA 1RVKA 1EBGA 4G7FA 4G8TA 3RGTA 2P3ZA 6ENLA 3MKCA 3R0KA 1MUCA 3ZVHB 2RDXA 3DG6A 2PS2A 1SJAA 2AKZA 4HNLA 3TCSA 4E6MA 1ECQA 2PGEA 1JPMA 4GGBA 3SSZA 2XH2A 3Q45A 2QJJA 2FKPA 3KUMA 1JCTA 4H1ZA 3GO2A 3DDMA 5BOEA 3QN3A 1P48A 4E8GA 3OPSA 3UJEA 3VFCA 3H12A 3H8AA 2XH0A 5BOFA 2AKMA 3DFYA 1MRAA 3DFHA 4HCHA 1EC8A 3GD6A 2PP0A 3UJSA 4IHCA 4X2PA 3FVDA 3FJ4A 5IDZA 2GGEA 2OQYA 3IJIA 4DXKA 3CK5A 4MGGA 4HNCA 4HN8A 3OP2A 3DESA 1BKHA 4IL2A 4J3ZA 1WUFA 3PK7A 2OLAA 1P43A 2OQHA 3QPEA 3BOXA 2GGHA 3OW1A 3PFRA 3RRAA 2PCEA 3Q4DA 5EU9A 1KKOA 3P3BA
chains in the Genus database with same CATH superfamily
1HJUA 5LYRA 1JCJA 2GQ8A 1XD0A 3ME3A 1FWBC 2R82A 3O3RA 3MANA 2YB4A 4NAEA 1S46A 3QFEA 1R3WA 4GXMA 3OQ8A 2BFGA 3WBEA 3SCUA 3TFCA 5HMSA 1IEQA 3GNNA 1I75A 3PZ9A 3EXTA 1GOWA 4GCAA 3EKGA 4QG8A 4V1XA 4F0SA 2WMIB 4TV6A 3WQ6A 3DYMA 4UFIA 1JGMA 4RNFA 1Q6FA 1E71M 3VE7A 4AU0A 3PP7A 4TQTA 1UWSA 5T9BG 4UNLA 4H4PA 1FDYA 3EXRA 2NQ9A 2QLYA 3FLUA 3WCZA 3ICJA 3ZR5A 3EAOA 5CPLA 2R1LA 1UBPC 4W89A 2D0HA 3L66A 4HPJA 2FVKA 1AZ2A 4GY7A 2BTMA 2IKIA 4PH6A 1X1NA 3TW7A 4EF8A 3R89A 3W01A 4R88A 2PGWA 4NASA 4QM1A 1GEHA 2E1DA 2HJPA 2PTWA 2WANA 1A5MC 1Q63A 3QFBA 4DELA 1SB3B 4AZCA 1UKSA 4UWMA 3M0IA 4FPSA 3VD3A 2Y61A 3I4EA 3D0CA 3DHUA 3MUXA 3LLDA 3SCRA 5HR7A 3SY1A 3TWBA 4EQWA 1UOZA 2OX1A 2OWXA 3AALA 3EGJA 1KBLA 3NVTA 4FMVA 1QI4A 5FD0A 4KPLA 3MP4A 1SO5A 4LCRA 3B0YA 5TF0A 5HWMA 3R4IA 4P61A 1VJZA 1OZMA 4Z08A 2DP3A 1VRXA 5JXQA 3CZKA 4LB4A 2GRTA 4M81A 3MW7A 1GOQA 1XYZA 3M0LA 3V0UA 4JFUA 3MKKA 3L5MA 3W7KA 3A4WA 3LCHA 3GUGA 7REQB 3O1NA 2D22A 3GHRA 4O8RA 4WY0F 1K8YA 1TX0A 4O0KA 1OX5A 3F2CA 3STCA 4QDPA 5ENLA 1O6IA 1ZJIA 3CH0A 4M6QA 1XLCA 5KMYA 4FO4A 4D6FA 4OKDA 2QCDB 3G1RA 1KW1A 5FF3A 2G4JA 3BLKA 5BXPA 3LRKA 5E1QA 1IT7A 3OBKA 1SZEA 1TTIA 3H7VA 3RMEA 5CZSA 1OJXA 2DT2A 1I2NA 4ACYA 1BGAA 1ZBKA 1ZFJA 2EJ1A 4BA0A 2FZBA 5HXMA 2Y8VA 3D3FA 4ZB0A 4LALA 4FAMA 4QP0A 4X22A 4Y7EA 2OLSA 4AWEA 1GXFA 5IHRA 1H7RA 3T4CA 1ZCCA 1K9DA 5HNRA 1AMYA 1W1PA 3BCDA 3ZM8A 4JQ3A 3WSUA 2GVJA 5AN7A 2WMJA 4PMJA 1FIQB 2Y63A 4GVIA 3CLMA 1DE5A 2WNNA 3GVGA 1SU5A 4IH3A 4RZBA 1QOPA 5F4SA 3VK5A 2OKTA 1DWJM 3HQOA 1QOQA 3EA2A 5D38A 3VILA 4PL2A 5HQMA 4NJJA 1G5AA 1XIBA 4MZYA 3TFXA 1FWCC 1LWJA 3VDGA 1IF2A 3BUVA 1R47A 4WF7A 3M7SA 3MMDA 2QMJA 4LF2A 2XVPA 2YXGA 5DMMA 4AIOA 4NY2A 1FWRA 3PPGA 1QVBA 1O95A 4CN6A 2Q02A 4DHGA 4H8HA 2WV8A 2C18A 5DX7A 3GXIA 3JRKA 2AL2A 5LNRA 3TTSA 1HUVA 4P8WA 3BLPX 3KP1A 1N8WA 2ON3A 4WJ8A 3RITA 3SEPA 3RF9A 4A21A 4QG9A 1S2CA 1VENA 3AXHA 4RE3A 3W87A 3EWCA 1HKJA 3TVAA 3EWBX 1OG0A 1K4GA 2ALDA 1X96A 3E49A 1PHQA 3PPCA 4PRWA 4XO6A 4CUCA 4NEWA 1YPIA 4JTHA 1TVLA 1Y5XA 2QJNA 1WPCA 4NHVA 1UD3A 1SGJA 4OU1A 2YCLB 2G0WA 5AOUA 2E5BA 4YCPA 1GQIA 2ALRA 3R10A 2VD9A 1I1WA 4LS2A 1JQXA 3VDHA 5CGMA 4MF4A 1ITUA 4A8NA 1DORA 1LBFA 4BV6A 5ABGA 4IWWA 3ZVHB 1MXDA 3LSCA 3TCSA 4O18A 3DFPA 1AJ0A 3AU2A 3E2RA 3S6DA 3CIVA 1T5AA 3M0HA 3L2IA 1MOKA 4LIIA 4YWIA 1GZGA 4LX4A 5CBBA 1KBIA 1EDQA 3CV1A 5LHEA 1OK6A 3M4HA 3KZPA 2DFAA 3MBFA 1MRAA 3DFHA 3PSVA 4HCHA 5I06A 2R9ZA 2FFCA 2WNWA 3BOFA 4YXGA 1ECEA 1TJ1A 3LB8A 1X7IA 2Z7KA 2V69A 1QASA 3HG2A 2J4GA 4S3JA 4TX8A 4JTFA 3WY1A 5HINA 1S5MA 3TR9A 4AHPA 3W70A 3BW3A 3HV9A 1VPXA 2XIJA 4JTAA 2ZFAA 4IIHA 3FA5A 4FLRA 3UESA 1FQ0A 3MCNA 3W7NA 4IFKB 3GWQA 1YADA 2WXDM 1IIGA 1D2KA 2NQZA 3NSXA 3WK0A 1OFAA 3G6LA 3G0SA 2J24A 3UG8A 2PWEA 1XGEA 3FGCA 3GAKA 3PZTA 4PB3A 3HQ1A 4H7ZA 2GJXB 3AMZA 1DWHM 1KM4A 4KRUA 3NXFA 3G5EA 1R9ZA 1TMHA 3SR7A 1CB2A 4DPPA 3MZ2A 4QISA 1TKKA 3QQWA 4UQDA 2YZRA 4DX3A 4LPCA 3KEHA 2ZZCA 1M65A 1FX6A 1PDZA 2YYTA 4MJZA 4B5NA 3URHA 5U25A 4HOWA 5FEPA 1MDRA 4WIWA 3FXYA 4JYDA 1NQ6A 3WF4A 1TE6A 3ABXA 5HK4A 2VEFA 5ER0A 3FAWA 1AK5A 1EO7A 4QS6A 1PWMA 4WKFA 5G2HA 3DHDA 3WQCA 3NOEA 2CHNA 1XLLA 3BJSA 4I7VA 3GU1A 2A5HA 1F6KA 3WNPA 4H4SA 1F73A 4RXFA 1ISYA 2HNHA 1XRFA 1EQCA 2C71A 2V3FA 4MZ1A 1VFTA 2E7FA 2PBOA 4DJFC 3EDKA 4DLFA 3S2NA 5C2CA 2IKJA 5F2MA 3RJXA 1MEIA 2V9DA 1U5JA 1JOAA 2PDPA 4MHBA 3SIZA 4QE1A 2AQVA 2IPFA 2W6RA 2XSXA 4GQQA 1DJYA 3T9PA 3ARQA 3U2ZA 5ECUA 5HDRA 4O14A 1JI1A 2FHCA 3IVUA 3USBA 4C5YA 3SW6A 3VZZA 3WLOA 4KW2A 1B4EA 3VGBA 1DJQA 3QR0A 1LRNA 4LVGA 3VOIA 5FKYA 1AQ0A 1TYGA 4Z1AA 2GQWA 5BXSA 2ADAA 1JAEA 5CPQA 2JGQA 3U5YA 3V75A 1P6WA 2XFWA 3Q67A 1KCLA 4NXSA 4RDYA 2BX7A 4WSHA 2WPFA 1NF0A 1OGSA 5K4XA 2XISA 1KKRA 3W7CA 2PDJA 4GY0A 3EDFA 1DPMA 3CAVA 1GVYA 3N19B 3BDKA 1GOOA 1WCGA 4H4IA 1Z7AA 1GWJA 5CEWA 2VCBA 3GY1A 4NL1A 4ICNA 1JL8A 3GNDA 3VM5A 5A6SA 1GOXA 2W3RA 1W9PA 1CXLA 4LAKA 4HPGA 2PTYA 3LK6A 3PPFA 3IIXA 3N2CA 1UP2A 1UMYA 4WY0A 4IXHA 5AC5A 3VKDA 2GQ3A 1X39A 3N34A 2Y8KA 1VBGA 2VGBA 1N5XA 3TC6A 4MNJA 2VMFA 3C0LA 3GX9A 1JULA 3TAKA 3G1HA 3EPMA 4KH2A 2OGJA 1OJTA 4GJ1A 2RDTA 4LYQA 4BHYA 1OSEA 2WVUA 2O4QA 5LNSA 1JCNA 3KOFA 4HZ8A 5IOBA 1CGYA 1OD0A 4M51A 1TUFA 3EWXA 1LRQA 1R3RA 3NZRA 3M0KA 1GRHA 4LEFA 2QUTA 7TAAA 4C6PA 3UWWA 4W8LA 4TMCA 1FDZA 3UWZA 5CJ5A 4JQ1A 4S3GA 2PODA 1IXQA 4Q4PA 4J2MA 3CLWA 4KRTA 4GYPC 1F3TA 1E40A 3EX2A 3W85A 4MYAA 3BZJA 6ALDA 1US3A 1RVGA 4I8DA 1DXFA 3TSDA 3UR8A 2QPUA 4U3CA 3TJLA 1ZNNA 3W7EA 1ZUAX 2ZUUA 1ZMCA 3PVFA 4LH8A 1ZALA 1RK5A 2HE8A 3DK9A 1GTHA 2CERA 3NEHA 4NU7A 1AH3A 1U5HA 4NAEB 2OG9A 3M5YA 1S2UA 4GNJA 1DQWA 3U57A 3L4VA 1KRBC 3PR2A 4JTRA 1A5NC 2IQDA 3QY6A 1V6XA 1GRBA 4AUBA 4H41A 1UD6A 4XAFA 1QPQA 1HP5A 2IMRA 1ADOA 2CZVA 2NX1A 1Q1RA 5H8PA 4O11A 3QV8A 3AO0A 1UD2A 4H6QA 2W3SA 4GKLA 1EC9A 3UZYA 1TWWA 1G69A 2IUZA 2W0UA 4GOAA 1IXOA 3P93A 3LCLA 4HB7A 3RAOA 3DCPA 1AODA 2WK2A 3KWXA 1LL6A 1IWBA 2J8FA 1J0JA 3G1VA 1PV8A 4C1KA 3ES8A 2WSKA 1XIEA 4O54A 1IGSA 3TNBA 1HJQA 4LUIA 5MKGA 3OBEA 3AS3A 4H6EA 4NIRA 1QRQA 1D8WA 5CG7A 4CD6A 1CXIA 3CV2A 4YVPA 2PE4A 1B4KA 4QSHA 4ZQCA 3MUY1 5EBKA 2X30A 3EWUA 3CL7A 4BQ2A 4DZ5A 1LUCA 1R8LA 1OYAA 2H90A 1DP0A 4G6CA 4X0VA 1YTEA 5JCIA 1UWIA 5LA1A 3HQPA 4PCNA 5EB8A 4GGBA 3FVMA 3BLLA 3WBWA 3H2FA 3I65A 1NM9A 5IBXC 3GO2A 3DDMA 3B06A 4S2CA 2D2JA 4AX7A 1A80A 2KAUC 3QN3A 3F4WA 2DORA 1A5OC 1MUMA 3PZMA 3VFCA 2DIJA 3TZNA 3LV5A 3FVDA 4HT3A 4UMCA 1VPQA 1VHNA 1EB3A 4GXWA 3TMQA 2JBMA 1UKTA 1UKPA 2DUXA 1BKHA 2BY2A 1G0CA 3VNIA 4L4OA 2WJEA 2PFHA 2E9BA 3ARXA 3F5JA 3SFWA 3RNDA 5DCBA 1HFBA 1M7JA 3VNZA 2OGYA 4M6VA 3F4CA 4DNHA 3DC8A 3IS4A 2Z1WA 2Z00A 4ATLA 3R94A 1W1VA 1CB7B 1B54A 3UF9A 2J47A 3AHTA 4JICA 2VFGA 3TH6A 4Q7NA 1T8XA 3TYBA 3NAVA 2JIWA 3WJSA 1PYMA 5FJUA 4PL1A 3VOJA 1BG9A 1CXEA 1Q6GA 3EF6A 5HQEA 1FCQA 3UBPC 3UJFA 3N4FA 3QZ6A 3NL5A 3ANVA 2ODOA 3GD3A 3OC4A 4IP5A 1E5NA 3FX4A 2UY2A 3BMXA 3WLMA 3GTFA 1CGUA 5A94A 3FK4A 2PA6A 4I5XA 5JVLA 2XSBA 4JN6A 5CZTA 4BWLC 2EG6A 4M80A 3N15A 3QBUA 1QHOA 3E5BA 1QNQA 2OT1A 5EY5A 3PUOA 4A2SA 1Z89A 1GVIA 1HKMA 2XN2A 3B97A 3QW3A 1SSDA 3JU2A 1VCVA 3UG5A 2DZUA 4Z2LA 2H9AA 1UR0A 1EC7A 3S6TA 2UY4A 2V5CA 3M43A 1GZJA 3EWYA 2YL6A 3QKEA 2CZDA 4LAZA 1FKXA 3N6QA 4GVFA 3LXCA 2OX4A 4HOXA 4LBRA 4M29A 4NQ1A 3TQKA 1XI3A 4KT2A 2IW0A 4PUEA 2VGGA 1VIZA 2AGKA 1J6OA 5C9WA 2R1NA 3D6NA 1V79A 2P5NA 1VBHA 3GDMA 3JZUA 2OZTA 2WHMA 1FP8A 1LJYA 2H6RA 3NM1A 3F03K 1VDVA 4PFMA 1OK4A 1IYXA 5FS7A 1SJDA 2V0TA 4E8DA 4IMEA 2NVCA 2Y5EA 4CCEA 2ZICA 1CX9A 5CQ1A 5HJYA 4PCTA 3Q65A 1GYNA 1OB0A 1G4EA 5D32A 1PAMA 3ITGA 3M7WA 5MKGB 2D1ZA 4XBKA 3W53A 2ISDA 3WFZA 1Z44A 3LMYA 3IV8A 2ZBTA 3N3MA 1V3IA 4XKYB 3IIPA 3CL8A 1JCMP 5A95A 4N9CA 3IJQA 3C3NA 2YW3A 2ZUWA 3KAOA 3FXGA 4L6DA 3SSJA 4L5ZA 1E9IA 1JD7A 4QEEA 4Y6GA 1NAL1 5J5DA 1W0MA 5E70A 1SR9A 1W6TA 4E5TA 1XYAA 3CQKA 4YN5A 4B2DA 5C55A 2WVVB 3QPZA 1FWHC 2V5BA 4J3SA 3SJ3A 1TV5A 2GR0A 2QVNA 2B4GA 5EMMA 3QOKA 2PWHA 2A2IA 5A6LA 4E4FA 3HQNA 1W3JA 1JDDA 1E6RA 3U6WA 5DQPA 4CNUA 1V7YA 2VOMA 3N17A 4XBSA 2WPBA 3RCNA 4O1EA 4NXKA 1JPDX 2CZEA 2WPEA 5I78A 3ZT7A 3W02A 4Z1BA 5JCMA 1JYXA 3PUGA 1W3KA 4HK5A 1L0PA 2CXEA 4MTVA 4YVVA 3TTQA 4S3EA 4B3ZA 3HMCA 1XX1A 3PF3A 3SDOA 2EKCA 4HNVA 2HVOA 4OBTA 3I10A 2EKGA 3S3GA 2YL8A 1UPMB 2HVNA 2FPVA 1AMKA 3U7VA 4O0QA 1T6MA 3TIMA 3EMQA 2XGZA 1WKDA 1VEPA 4UTJA 4QHRA 3U0HA 1H5YA 3LPOA 3IAPA 5JIPA 4WLCA 1B3OA 2REQB 3S2CA 2HQAA 3LCFA 5I0DA 2P1FA 3K1DA 5HNTA 4AQLA 2QR6A 1N8FA 4F8XA 2QPSA 3QF0A 4LS0A 3P7YA 1R2RA 3AXKA 2Z6IA 1X8FA 3U3HA 1V7AA 2RAGA 3KE0A 1P0DA 4YIWA 2PDCA 3FGCB 4GUHA 3SZ8A 2XM2A 1XLBA 4QNWA 4QFUA 1TIMA 5BROA 1XINA 3CHCA 5AFDA 4KPRA 3WDPP 3PFMA 3EMCA 1XBXA 4LC6A 1A49A 2DJLA 5FOOA 3VIFA 4FXSA 1OINA 1U1HA 4ES4A 1R3TA 1G7UA 1UH2A 4EANA 3FY1A 2Z2BA 3UWQA 4L64A 3T42A 4ALDA 3GHUA 3MT1A 5BRPA 3GU2A 5HWJA 3WH7A 3C2FA 2NT1A 4E38A 1KRMA 5D04C 3GHTA 1B31A 1NIUA 2BY0A 2RH9A 1JFXA 3EWDA 3RN6A 3BLOA 2P50A 1EL3A 3GXPA 3BW2A 3VTRA 4YYCA 2VFFA 4DWSA 3GYCA 3VCRA 4CD7A 3EPOA 5D05A 2PDIA 3VGDA 1X8CA 5LSMA 4AY7A 1K9FA 3WQGA 1WZAA 2ZXBA 2CC0A 2UY3A 2YXOA 1EPVA 4C6IA 4P5UA 3DFYA 4MY1A 4X2PA 5IDZA 4DJEC 2XIQA 5J5RA 2O4MA 1V6VA 3OIXA 2GUBA 4R34A 3ARSA 4W5UA 1K9TA 5FSEC 3LXAA 2WJZA 3NM3A 4TTUA 4LS1A 1AVAA 2IKGA 1XLFA 2WNZA 2HK0A 4ZE5A 3S2JA 4P8UA 3AS2A 4KEUA 1W1TA 2W5FA 4AWUA 3ARYA 4HZ6A 1KM0A 3ARTA 1N63C 1HKVA 2XHYA 4DZIA 1MW3A 5F2LA 4D8AA 2ZZ5A 3EXSA 5HAOA 2C13A 1B9BA 3PC0A 1EEPA 3NQDA 4WSJA 4Q4OA 1W1ZA 5CPNA 2LLEA 3OGVA 3T07A 3I7SA 3TOYA 1GKRA 1O4UA 2PMQA 5GNYA 3I68A 3LI0A 4LVDA 2DSKA 3PZQA 3RO8A 3HMJG 4QROA 1NF7A 3GC2A 3VGEA 4KEZA 1I2QA 1QPKA 4PEKA 3KRBA 4CD8A 4BQ5A 4PBFA 4BZYA 4GMEA 4X60A 3WEOA 5ABHA 1XC6A 3BJTA 4JDBA 5TQLA 1HL2A 2OEKA 3NQBA 3RXZA 3MC5A 2VNCA 3VIIA 2XM1A 3CZ8A 4NZ3A 3THUA 4YWSA 3T1GA 1XYMA 2Q09A 4J40A 3VKKA 2VI0A 4QJ1A 3RK8A 4R7WA 4UB9A 5I5RA 1E1EA 2W9MA 1BWKA 4GX9A 3S42A 3WFLA 3L21A 2JK2A 1W5OA 4JL2A 4FNUA 3QTPA 1XGZA 1QJWA 1GKQA 1SYTA 2A7PA 5FJJA 5JCNA 3VX0A 3LPPA 2VOTA 4N9EA 4ADSA 3PHAA 1V0MA 4IX2A 2DZAA 2C3ZA 4FNPA 4YTSA 2I1OA 2EF9A 4JTJA 1F07A 3RHGA 2CYGA 2XTKA 1T41A 1TTPA 1SFTA 4O1AA 2PDKA 3WF2A 5A6AA 3GDKA 3JZEA 2VQUA 1E6NA 2R24A 3AC0A 3GXMA 1LBLA 4H83A 1GGOA 5A8GA 4G5DA 1GREA 4JCLA 4LY4A 4C1NB 1CYGA 2VCAA 1W5NA 1K4HA 4G2DA 2INEA 1VFLA 2KZHA 1X6NA 2WKJA 2D2OA 1FKWA 4P7RA 1GNXA 1DBTA 3S1GA 4RE4A 2W55A 4S39A 4RUBA 1J4EA 3N12A 1I0BA 3LN3A 2GLKA 3GNRA 3S2MA 1QNPA 4M1RA 4PTNA 3A7RA 4U2YA 4OE7A 4Z2IA 1AH4A 1XIGA 2B31A 5HNUA 4B3KA 2ZCGA 1O1ZA 3T2OA 3HPZA 1JR1A 3DBNA 1VLWA 3V4BA 2FZ8A 4US5A 5XIMA 1XIMA 4IIDA 4F0RA 3NPVA 2VX4A 4YVXA 4G7EB 2WO5A 2NUWA 3IARA 3AHXA 2VL4A 3WNOA 3B9JB 3V5OA 1IXPA 1HZYA 2AMGA 3VAVA 1TTJA 2Z1XA 1EP2A 3OLGA 2V6AA 4V27A 4D6DA 4AWSA 1W32A 2VC7A 1F3WA 1Y65A 2P88A 2Y6ZA 3TQ0A 4CNPA 4NAFA 1ZX9A 1GJWA 1DKWA 1V3JA 4J1OA 1B57A 2F2KA 4QXIA 3H2AA 1EKOA 3WLHA 4X63A 5CPSA 4RL3A 1BHGA 4JAWA 1QHPA 3DIPA 2VD8A 3D46A 3W7LA 2YOCA 4EK7A 4KFNA 5T9CE 1DOSA 4HA1A 2SFPA 1TPC1 4DJFA 4HYWA 1FOBA 3QR1A 4OFCA 3EOSA 2X0HA 3DN5A 4HMCA 3FOKA 5JCLA 4W7VA 3P80A 1TTQA 3KXQA 2FH6A 2MANA 1GYMA 1JPIA 2Z28A 1HKKA 2AL1A 2DUAA 2ZRVA 3BSHA 5M17A 3DG3A 4TO8A 2NQLA 2TPRA 1GTEA 2ZE3A 1RBOB 3DI0A 2VEMA 5FEZA 5AYIA 3E96A 3GC4A 3OG3A 2PDYA 3G22A 3NO1A 2B7QA 1WOAA 4LGXA 3BSGA 4JHZA 3O6DA 2CLEA 4H9VA 3PUEA 4DBEA 4OZOA 4HU3A 1HGWA 4Q8OA 1GONA 3C2OA 1JI2A 5HBFA 1ZP3A 3WUBA 1H1ZA 3CGBA 4GR1A 1CLVA 3M44A 1C8QA 2ZUSA 3CMFA 3WNKA 3WD4A 3GFZA 4W87A 1R7AA 1LYXA 4ZCWA 4FSAA 1WZLA 4CN4A 2V5LA 3ATYA 2P3ZA 3A4JA 1CECA 3SUUA 1KLZA 3SM0A 2QCFA 3PB2A 4MLJA 2VR5A 1GESA 4HNLA 4ZSUA 1XCFA 3SSZA 2DVXA 1A5UA 2PC4A 3RCMA 3RM8A 4Y9OA 3DGRA 1Q7ZA 3S5NA 2AMXA 3TC7A 2F6UA 2GVYA 1YKWA 2O7SA 1DHKA 2J74A 3UJEA 3SAZA 3YPIA 4OWGA 2F9RA 5C7HA 3IJIA 3KZSA 5CBIA 3KOWA 2I14A 3GXFA 4HN8A 1TE1A 3UNTA 5B80A 2NUYA 2W62A 3EX3A 3ABZA 1MQQA 2E5DA 2XIMA 3LY0A 3PK7A 3TX9A 2YL9A 1M9HA 4YTTA 2DH2A 2E28A 1P1XA 2H3DA 1OFRA 4BS0A 4AW7A 4AVOA 1KM6A 2CIPA 2DSUA 3XISA 1BQCA 3CAQA 1PTDA 1F8IA 2NX3A 1H61A 1STZA 3CNYA 1MXSA 4WGHA 2OYMA 3NQ8A 1JDEA 2CLPA 4GYPA 3MTWA 2YVFA 3N4AA 3G1AA 4UFMA 4EF9A 4CNTA 1OZQA 1SZNA 1HW6A 2ZA3A 3AS1A 1T8QA 3OZOA 3WLNA 2E40A 3E38A 4NZ1A 5A8PA 1TO3A 4ZFMA 4GH3A 4QE5A 3AYSA 1YTKA 4BI6A 1SW0A 2DIKA 3T0TA 4Z2GA 4OECA 2VR2A 2A3BA 1PIIA 3H26A 4ZSTA 2YVGA 1H11A 1FWWA 3SRFA 3UPBA 4YLWA 3DH7A 2ZC8A 2BXZA 4LC8A 1KQYA 1DJXA 4LYRA 4JTCA 3PJTA 4LWWA 1W3TA 1FXPA 2WZIA 4A3QA 4ZQNA 1BQGA 1PZ3A 4AZHA 2Q8ZA 4MWAD 4GQ0A 1NHQA 3DENA 2W67A 4UZUA 1Q65A 2W79A 3EX4A 1MXGA 1XYCA 3Q58A 2GL5A 4MPQA 1NEYA 2NLYA 3R0UA 3DXIA 4X0NA 2W66A 3DH9A 3MCOA 3PJWA 4HJFA 2VZSA 2BHYA 4LCQA 1G67A 3PBUA 2QDHA 3UWVA 2FZDA 2BY3A 2V2DA 4J3TA 4H9UA 3NYDA 2WQDA 4L65A 2R1MA 3SRDA 3O6AA 4IG2B 2ZUNA 4REQB 2WJDA 3AXXA 1V51A 6TIMA 4KMQA 2FQIA 4Q4QA 1EF3A 4HKPA 3M0ZA 2X7WA 2PDXA 4ML4A 4N0RA 4E3TA 2JQXA 3FG2P 3OHMB 2X50A 3CM4A 3E9AA 3OVQA 3SCPA 5E9AA 2PU0A 4DAFA 2WKGA 4QGCA 3SCNA 3WUGA 2QCNA 4AH7A 5BRBA 5IBXA 5DY3A 1S2TA 2QQ6A 1K3UA 5JRBA 1ICQA 5DMNA 3VGHA 4J3WA 5EFDA 4JNZA 1NJJA 4ZOAA 4GJJA 1XWYA 2DPEA 2VENA 3WFAA 4S23A 3QMTA 4YWOA 3ARVA 3BLDA 1EUNA 4K1GA 1OHLA 4IM4A 2EGZA 1C9WA 2GGIA 2YA1A 3LTYA 5I00A 4IQJA 3ONBA 2O55A 1O5KA 5FF2A 1EIXA 1BD0A 2VRQA 3RNMA 1OCNA 4IJBA 1S38A 3CUHA 4O1FA 3LHVA 4N6FA 1EDTA 1ALDA 1GT8A 1YNPA 4FNRA 2X7VA 3OJGA 4ZODA 1S5TA 1A5BA 1RV8A 3L2LA 3RCYA 3GLCA 2YZ5A 2Q8LA 4XZNX 4TIMA 4DUOA 2ZX5A 3HU7A 1G01A 2PB1A 2UWFA 4AD0A 1O1HA 4LU0A 1RP9A 3PZNA 3UR5A 3TTYA 4ZQPA 1ZBCA 1AA1B 4IUOA 4D1JA 2E9MA 1ITXA 1E9LA 1AW1A 3ABQA 2G4FA 3GG8A 1XKJA 1G4PA 1TWDA 2QUVA 3VINA 4IQEA 2NVDA 4PTMA 3T8LA 5DO8A 4PR4A 6REQB 3NFUA 4B16A 2X1IA 1WUEA 4LAMA 3ZJ8A 5EPDA 2VEKA 3CUGA 3ZSTA 3U8GA 3H2MA 5EMJA 4AZ6A 4MUZA 1TJ2A 1H62A 1QCWA 3B0PA 4W8BA 1HXJA 1T99A 1E6PA 3MCMA 4H4XA 4QDMA 3MHFA 3HG4A 1XW8A 1NDAA 2Y7GA 2RUSA 3LHZA 4JIRA 3WDQA 4K68A 5IFTA 5EFFA 3S83A 1H1YA 3DYPA 3P62A 3D9XA 3WMBA 4OUIA 1W3IA 3CB3A 1X7FA 1EPXA 1THFD 2HXUA 4RLIA 2PWDA 4GIYA 3G0XA 1XLMA 3BLEA 3AMCA 3A4AA 3FJNA 4JBRA 1TPUA 3W4RA 3WBYA 4EPDC 3WJXA 2WSYA 2OZ0A 1XRSA 2PPGA 2XH4A 2HSAA 3ARZA 5F7UA 1MEHA 3E0VA 4LANA 4N02A 3SCOA 5ABFA 2VURA 5AKQA 2FPYA 2XN1A 1PTAA 3UZ5A 2WMGA 4EM3A 1R85A 2PDNA 2E09A 2F84A 4GISA 1CI1A 1U83A 3BWWA 3S1WA 4CD4A 1XPYA 1A5CA 4LUTB 1UR3M 1HG3A 1QWGA 2NT0A 3KL0A 4QNEA 4ZO6A 2IXUA 1MUCA 4MIMA 5I03A 2C1GA 3SGGA 4FOJA 1FO4A 2I9UA 3QH2A 3T0AA 1LTDA 2BVDA 2GFTA 4PUUA 3KTXA 3T7VA 2XH2A 3K13A 3HB9A 2DT1A 2GK1B 4H1ZA 4C6QA 1DQXA 4JIQA 2OODA 4O57A 1P48A 5G1MA 3RMJA 2WP5A 4V1YA 3BARA 1MNZA 4GZJA 2HWGA 5C8BB 3HBLA 3N18A 4XVDA 4BF9A 4DXKA 2PLJA 4J57A 4Y96A 3BG3A 4HSOA 4Y9NA 4FDCB 1PXGA 1QBAA 1GZ1A 1ZCOA 4L9YA 3GRTA 3W6MA 1XG4A 4O52A 1KWKA 4XV0A 5CC3A 4KESA 1YXYA 3F1QA 1KR0A 2PF8A 1ZGDA 1TJ0A 1BSIA 1Z41A 4O0ZA 4E4PA 2X41A 4UR8A 1KTCA 2VP8A 3DKLA 3M0JA 4BF7A 4EXBA 2FJUB 3HZ3A 4MNLA 1Z48A 4G1NA 1Q7MA 1TUXA 2PCEA 1F74A 3HFTA 5EU9A 2ANUA 4ROQA 3DHPA 5BCAA 5EMYA 3K8KA 3FHQA 3TLQA 2Z2AA 1QI5A 2F6KA 3KX6A 3R2GA 1TCMA 3SN1A 2CLIA 4JFTA 4S3CA 1ZJBA 2W4XA 1GVOA 2V6OA 2A1YA 3C2EA 2Z27A 3KBSA 2DV0A 4NZFA 3IC9A 2X05A 1PIFA 1MW0A 3GVQA 1H7OA 2CNCA 3VD4A 1YE4A 2ASHA 1SFJA 5AHMA 4KETA 4EXQA 3O7UA 3N9RA 4Z0JA 2QJMA 1KV8A 2I5QA 1UKQA 3S5YA 1DTUA 4KIRA 2DY3A 3TOPA 3CHDA 1E1CB 2ZRZA 6TAAA 3VMNA 4FXRA 3NGJA 3QFWA 1UJPA 5C2GA 3FJLA 3UCCA 1I6NA 3G1YA 5FACA 4ROPA 4U10A 2BGSA 4RPPA 3SRKA 4K2SA 2R14A 3CV7A 3N04A 1REQA 2JF6A 2RFGA 4HA0A 3N6JA 1PKNA 3BGGA 3KRUA 2PZ0A 3H4XA 3L4TA 1NHRA 2ZX8A 9RUBA 2G8ZA 3LERA 4GVHA 4M7TA 1RA0A 3HJEA 1C3FA 1FCVA 1ONWA 3CEPA 2YDAA 3KW3A 1G94A 3TNOA 2NLIA 4MADA 1ZTVA 3EB3A 2QGYA 2Z1VA 4MDPA 4MB1A 5CGQA 4WQ6A 4FK9A 4AXKA 1XR2A 1ME9A 3F4NA 1H7NA 5G5IA 1YYAA 3B8TA 3DFOA 3DJGX 1E6ZA 1SJCA 2RGMA 4J9JA 3PJXA 1E9YB 2YPIA 3OQEA 1GVQA 4XAPA 4NX0A 4ZMGA 3GTXA 1UJQA 4NUWA 2PLMA 1UR2A 1BF6A 1GOMA 3NG3A 3TKFA 4EAYA 5KEZA 1EJTC 1US2A 2FHBA 4MWAC 4C6DA 2CW6A 3U9IA 2ONEA 3ORWA 3P5ZA 1DYSA 4K8EA 4DLMA 1QATA 2P8CA 3SGUA 1KBKA 2A6NA 5I23A 2NX9A 3FYYA 3Q2DA 2PWVA 4HZ7A 2WLZA 1EIBA 2DZXA 2Z1KA 3MUCA 4OBRA 5H8MA 1UA7A 1XRVA 1ZBVA 2DVTA 2BOGX 4I8YA 4D6JA 3VIKA 2V38A 3KBMA 1EDGA 3IIOA 2E5AA 5HR6A 2IQ0A 2C0HA 4Y9PA 4I5RA 4DJFD 2OFJA 1XLGA 2OYKA 3W1PA 2D3LA 3KVKA 2PDMA 5HMFA 2X8GA 4QE4A 4E2VA 3AISA 1BYBA 2X8RA 4PMOA 3O6YX 4IZGA 3L8KA 4GABA 5C6MA 2R91A 5FJRA 3OG2A 1TV2A 4F79A 1XHCA 3N2MA 4D8LA 1WNOA 3UXLA 1R30A 4GQBA 2ZRUA 1ONEA 1ZPTA 1RUSA 3KBVA 3W9ZA 1GERA 2FVMA 4ZVJA 4C7FA 1K8CA 4XTDA 4XKMA 4IF2A 1FHUA 2I57A 3HM7A 1OM0A 3FA3A 5JMUA 3VKAA 3EAUA 3L7RA 3QM3A 3TXVA 1JZ6A 2QULA 4JL1A 4NRSA 1J0KA 1Y5WA 2E3ZA 2EJAA 2RGLA 4EE9A 1ZAIA 4K39A 1QU4A 2J7CA 2PRMA 3VZYA 3NDYA 4R3UA 4H4VA 4Q4SA 3IJ9A 1OFQA 1DJHA 2YCEA 3KDOA 3UR2A 3BCFA 4R7JA 1F8WA 3G18A 1TELA 2CDUA 3T09A 2YBVA 3VFLA 1SZFA 3M6DA 3KOZA 4A4AA 1J9YA 3E74A 2G3JA 4IPJA 3GRIA 3WNNA 1Z69A 1WP6A 5HJXA 5KSWA 1QNOA 3JW7A 4GLEA 1TPWA 3AZSA 2R94A 2YJQA 1QO2A 2QCGA 3EEGA 3E12A 3G1FA 1YDVA 3GDBA 3TCEA 3MVTA 4ZZ9A 3NGFA 3HPAA 4B91A 1YIXA 4PMQA 5BRQA 2NVAA 2C19A 4LBSA 4KFOA 4E8CA 4HNUA 1UB3A 2X40A 1DJNA 4LNYA 2POZA 4NJGA 4QJ3B 2IKHA 2AOSA 4O1DA 1YBQB 5ABEA 4IIEA 4TMBA 3B05A 5FAGA 2PWGA 5ABTA 5G4HC 4JHOA 5AVHA 3EB4A 3U2OA 1W56A 2E0PA 1MMFA 4YS1A 5AYXA 1L2QA 1W3LA 4KWVA 1RY0A 1QTWA 3URBA 4US6A 4DXVA 1KA9F 5D8ZA 3AM9A 2NXIA 4ZBCA 3L9CA 5D09A 2PS2A 5LIYX 1TZ7A 5GPRA 1LLOA 4NNAA 1M1BA 1OG6A 3O2LA 1ECQA 4JTEA 3EOLA 1Y5VA 1IT0A 4LEQA 4AD3A 2G3FA 1DJZA 5H8UA 4UTIA 3DI1A 3RPMA 5BOEA 3LDVA 3M5VA 3TK7A 1LWHA 5CPMA 1CWYA 3RU8X 3QGKC 3EMZA 3A64A 4GE8A 2PDWA 3FIGA 3PN8A 2Y5JA 4JNMA 3L4UA 3AUOA 1OX4A 1B9ZA 1GPWA 3N9SA 1H7XA 5K3VA 1W2PA 2GVEA 2BMBA 1HJXA 4IJRA 3KFTA 1IEIA 2XU2A 4F48A 4YTRA 4IQLA 3LHTA 1HKWA 1PB0A 4D72A 1TSIA 2GUYA 2XVLA 1EGMA 3AYRA 3U48A 1P7TA 1QNRA 3H2NA 3KS5A 2DSWA 2VRJA 5C9ZA 1V02A 3A21A 3B8UA 4LUTA 3R8RA 3RM9A 2QS8A 2QEZA 4O28A 3BURA 2QW5A 3Q4DA 3WD0A 4CQDA 3QXBA 3WKZA 2Y24A 2H9AB 3BAXA 5I3FA 3UXAA 3HFYA 1H50A 1QHZA 2HZGA 2YYUA 3HW2A 4ZFCA 4PMZA 5G1TA 1N60C 1FHDA 3TJXA 3MB9A 3ERPA 2HK1A 3NO3A 2VGFA 3MJYA 3BO9A 3QSTA 1LF1A 3GDTA 3R5EA 5I3GA 1XUZA 2ABAA 3I3EA 2AL2B 3EOEA 1B3VA 1M3UA 3E0IA 3W7HA 4RNJA 3P8IA 4JX5A 3ZZ1A 1GV4A 1S39A 4YYFA 3UCDA 1PL9A 1UA3A 3U2EA 1HX0A 4PB4A 2ZUVA 5L9FA 1VFOA 3UD6A 2ZC1A 3KCJA 1Y8BA 3XINA 2G95A 1E15A 2OWWA 4PSRA 5CLTA 4K7VA 1XKYA 1NDZA 4F4RA 3UA4A 4JDYA 1YRRA 5K9XA 1FWGC 3I7RA 4D9PA 3W2KA 2ABBA 3RPTA 1DNCA 3ABRA 4U3AA 3NIYA 4ERIA 4GUFA 3TN5A 3W73A 3G8RA 1XGDA 2BXYA 1ML1A 1OFBA 3SUVA 1J2WA 1E4LA 1KFWA 5CJMA 1V0LA 1QUMA 3BGAA 2G3MA 3C61A 1Q45A 5J8LA 4Q22A 4NG3A 1N2VA 1D3GA 2QIWA 3SFKA 3CQJA 4M19A 3VO0A 1UR8A 3ITYA 3W24A 4DWDA 3AZTA 3A9BA 1IZJA 3A6OA 3UW6A 4DI8A 2VXNA 2A7NA 3STPA 1FWTA 4KERA 3W3OA 3EDDA 3VABA 3T0BA 3ZJ7A 3B3DA 3NA8A 1FUYA 5FL1A 3GKFA 4HGXA 1MO0A 1TV3A 2XUCA 3M1ZA 4WOZA 1WXYA 4PYSA 3B9EA 1M6IA 3AOFA 2O9OA 2A3LA 1P4CA 3TE9A 3A7UA 1U1JA 1S3HA 1H1NA 4CD5A 2BGQA 2MNRA 4AB4A 4DNAA 2BODX 3P84A 1GCYA 5IRPA 1UWQA 1MYRA 3UNDA 3AAMA 1JZ7A 3GB6A 2WNQA 4DWSB 3WDHA 2ZQ0A 3A5FA 5FJIA 1VBUA 4W88A 2C14A 4MKVA 4QITA 4H9MA 3KLLA 2BY1A 1KV5A 3NXLA 1C8VA 1GW9A 2D0FA 3DK4A 4B4FA 2VKZG 2GJNA 2OSXA 4FF7A 3SGZA 1KWGA 3BV4A 2YCJA 3NQGA 4F3HA 5H2ZA 3H6OA 4RV3A 4GYFA 4UTLA 2OWCA 3VXGA 2E4TA 1S7MA 1DJGA 2A3HA 1TV7A 3R25A 3QC3A 4N9DA 3V5FA 1C90A 2AQOA 1KGXA 5T26A 1J79A 1TWSA 5LA0A 1SQ7A 4H4WA 3W22A 1TFVA 4AVNA 1Z6KA 3CL6A 3P74A 1NWUA 1EA9C 1SMAA 4CGTA 3MUZ1 3QVQA 5CSUA 1BAGA 3WJWA 2Q8XA 1GW1A 5EL1A 2CLOA 3R1ZA 3VVGA 3CO4A 2YDQA 3RX2A 4UMBA 1E6QM 1B30A 1UZHA 3VD7A 4DJED 3B9AA 1YW1A 3W23A 5DMLA 4AMCA 3H4WA 2QNEA 3SY8A 2XINA 3L68A 2A85A 4JQ2A 5TIMA 5AHFA 2VELA 5IHSA 3UWEA 3AYVA 1EH9A 2R1PA 3NL6A 1BXNA 3E2VA 3GSMA 3A4XA 4IL0A 3TQPA 3O6CA 3LS9A 1JCYA 3UFYA 1W5QA 1WO2A 1RBAA 4ZOHB 4HNTA 1JUBA 2Z29A 5HPOA 4DM1A 1VFHA 3G8EA 1M7PA 5G1YA 3XIMA 2YBUA 2QDEA 3BSMA 1HN1A 1O68A 1YHTA 4QBXA 3U7BA 1E73M 3T55A 3UJ2A 4OGZA 4WDUA 4A3YA 1Q8AA 2EQ9A 1TVPA 1ZHAA 1TVNA 2C8NA 3WIJA 3LB0A 3P14A 3T4WA 4DQWA 1V4YA 4W93A 1YLVA 1JEHA 1DL3A 1XG3A 4RXGA 3WQ4A 3U4AA 3PULA 2ZTKA 1Q6CA 3EDEA 1Q2SA 2OTDA 1BG4A 1CXHA 3KTSA 1LBMA 1DE6A 1EO5A 1VFSA 2NPXA 2VDGA 4GRSA 2WVVA 1B2YA 1FRBA 2XYLA 3NTYA 2I17A 2W54A 3SADA 3WN6A 1F6PA 1GORA 2VX5A 3RPDA 1OFOA 1MFUA 1V97A 4U2ZA 1Q6DA 2BVTA 3WDRA 3F7JA 3AIUA 2FJKA 2WSQA 1E0VA 2AKMA 3FYOA 2BOEX 3SR6B 5LKYA 1GK8A 3FEQA 3VIGA 4KWUA 4BF5A 3LEPA 3GRSA 4XKYA 4CN1A 1B3ZA 1B3XA 1J2BA 4OOUA 4CQ8A 5M2FX 3BOXA 2CXGA 3LHWA 3TA6A 3WQDA 3LQLA 1SMDA 3PTMA 5EBUA 2VX6A 1LM1A 4FX7A 3U2CA 5AHEA 2VEGA 3C3UA 3KVLA 4M56A 1VCFA 4HHPA 1O66A 3NPUA 3CGEA 3ETRB 1OF8A 3PANA 3W0KA 3CQ0A 5EGRA 3DKJA 4GO8A 3APGA 2YCLA 1PIGA 3KP0A 4PGLA 3O05A 3O0FA 4HD5A 5D2TA 5IDIA 3AROA 1OWQA 4GYJA 3LM3A 1JNDA 5AHNA 2VVSA 4ZR8A 3OZMA 3MSRA 4I7WA 4HHHA 5D8WA 4PBEA 2PDQA 1W37A 4GG9A 5LNUA 4MNMA 4H8UA 4AYGA 5CXPA 2JEPA 2GWNA 5A2BA 4JX6A 4ASTA 1CW2A 3GFYA 5FIPA 1YNYA 1ELSA 3ITVA 3ZT6A 3UCQA 3NJ3A 1UR1A 4ZOCA 2QAEA 1CLKA 3O06A 3E02A 1XH1A 3LRMA 1VEMA 3KL3A 3KLJA 1YDNA 2PLKA 1RD6A 2G37A 4AZGA 4FEZA 1X6LA 2VRKA 1MRQA 4V2XA 1BF2A 1X2HA 2EXOA 2YCIX 3T40A 3G3MA 3B03A 3GYEA 1TPH1 1ZENA 4YHEA 3QV6A 2NW0A 3NVYB 2VDIA 1IWPA 4LVAA 3F5LA 3B04A 1ZAJA 1YDOA 6XIMA 1GVSA 2NWSA 1XDIA 4AMAA 1FH7A 1H09A 4F9DA 2W61A 1XV8A 4AY1A 1UCWA 1OCQA 2WSPA 4LNCA 4JR5A 4UC5A 4YMZA 1BVWA 3WQWA 3NVDA 2GVGA 3K1GA 1MVYA 2QCMA 1J5TA 2GR2A 4R9XA 1EJXC 1IXNA 2P76A 2BSLA 3WLQA 5KZ6A 1A50A 1QAPA 8A3HA 1KCXA 3ANUA 4PTVA 3NDZA 4DZHA 3PAOA 5G4EA 4A6GA 1WZKA 1IV8A 1XBZA 1YXDA 1BZLA 1TQJA 3CBWA 3PBWA 3L23A 3A23A 3FN9A 3RR4A 1LL7A 3D47A 3GHSA 4JN8A 4JPGA 2PDBA 1Q7QA 1F2JA 2I9EA 3CHFA 4DIAA 1I2RA 1P6CA 4JEQA 4FX6M 1LG2A 3LCWA 4JX4A 4XX6A 1J11A 3WD3A 3AHYA 2I56A 5KINA 3LM7A 2QCEA 4MOZA 4NI3A 1OADA 2YX0A 3CWHA 1Q85A 5CC7A 3TAOA 4GNKB 2ICSA 4NF7A 4S3FA 3PS7A 4LFYA 1NQKA 2INZA 1ONFA 3BCJA 1NOWA 5PTDA 1JZ5A 4AFYA 2YFNA 3WK2A 4HHMA 1Q2RA 3W1XA 4DYJA 4MWAB 1TWIA 1A0EA 1O7AA 1LQ0A 3CXBA 1XSIA 1J8VA 3A3XA 3E6EA 4PODA 1XJBA 3D3AA 4C1NA 4J5NA 3APYA 3W2UA 1VCGA 5ECVA 4GQGA 5K7JA 3LGDA 4U5KA 3NUKA 4CQCA 3VDCA 1VS1A 3CZLA 4K1WA 4KWSA 4AVFA 3NYZA 1C8YA 4H9TA 4ZL1A 3GUWA 2VQTA 5A2CA 5HMEA 4A05A 3S8HA 5JBEA 1RQEA 1Q3NA 3P2VA 4WEVX 3LG3A 3LNPA 3W84A 1C91A 1XQLA 3GKAA 5M3WA 1E4MM 2PURA 4AD2A 4QLJA 4A22A 1SSGA 4RR4A 4I9TA 2CLHA 1H63A 4Q4RA 1VLIA 1F5ZA 4H8NA 3C56A 5DXXA 4LUYA 2Y70A 4C1LA 4EWND 3L4XA 3MWCA 3II1A 1W91A 4CU6A 2INFA 5TAOA 4Q7BA 1MQPA 4C6JA 1EX5A 2P0OA 4H19A 3V3WA 4B2DD 3IIZA 1ZL1A 1UP3A 2HPIA 3P82A 1WDQA 2EHHA 3QPYA 4P7NA 3GNOA 1EZWA 3SCQA 4N7QA 5I24A 2QGHA 2D3NA 3UQNA 1J12A 3UPWA 1QR7A 1OVDA 3BAIA 4PTWA 4PMVA 3M46A 4XUYA 4HMEA 2PF0A 2ISVA 1E0TA 4I3GA 4GNVA 1KM3A 2FZNA 3CASA 2H8ZA 4YCOA 1QOXA 1PCWA 3FSUA 4EMJA 4DI9A 4LYPA 1PKLA 4GZ7A 4BEUA 5AZ0A 3OHIA 2OZ3A 1JQVA 2E8ZA 2VFHA 3S47A 1AH0A 1NWSA 4KQNA 1EXBA 4L6HA 1JZ8A 4H6KA 4HN4A 3AWNA 1OQFA 2HXTA 1KM5A 3HF3A 3LBOA 3M0XA 1LWIA 5A8NA 5HNNA 4EPKA 1NELA 4K7ZA 7REQA 1H3GA 2CLLA 1SZGA 5E0KA 1LLWA 1BWLA 3VNKA 4AZIA 6CGTA 3H70A 3WH8A 4P2VA 1UWRA 5HA7A 1HO1A 3IUDA 4FALA 1V3HA 2WYSA 4DM2A 1W9XA 4ZA0A 3N2BA 4R5EA 4W86A 1RVKA 4ZB2A 1QI0A 2YDRA 3GR8A 1FWDC 4K8HA 2WZMA 1GEUA 4H4TA 3CEUA 3KL5A 3W1UA 3QZAA 3GH7A 4EQSA 3TMLA 3EPNA 1WDDA 2YA2A 3W88A 3CTTA 1KTBA 3DK8A 4E0CA 3IIVA 3BXWA 2V67A 1XIJA 3VNJA 4EOUA 2J7DA 3P6LA 3OYXA 4A8RA 2ZXDA 4YPJA 3PZUA 1XLIA 3UJSA 2WVSA 5KETA 3I3BA 1TPDA 4TV5A 3PUDA 4D6CA 3IEBA 4WHBA 3QYQA 3R8GA 5KITA 1VYPX 4GC4A 4IL2A 4J3ZA 1P43A 4GZEA 3W7PA 3VIMA 4DXXA 5KZDA 3H54A 3LPGA 4OJYA 2GGHA 3WBAA 4FLQA 2GDVA 4UXDA 4L9XA 1TMQA 5BZAA 3NQ2A 3OLIA 2ZZ1A 4QAWA 4ZOEA 2OT0A 5D2WA 4QR6A 1RCQA 3UY8A 2CFFA 4C6KA 1Q13A 1KKOA 4L4PA 2HTMA 4Q3MA 1TWZA 1ZAHA 3MDUA 4JCMA 3IUHA 4KCVA 4JTQA 1GVRA 5MF5A 4QAIA 1DVJA 1UIPA 4UQEA 1JYNA 1N82A 3C6CA 1GEQA 3GNPA 1Q4WA 1D8CA 1ZQ5A 3VX1A 3F4VA 4LY8A 4ZQMA 3UWYA 1ESWA 1P5BA 1NFBA 3QJAA 4P8XA 3VKJA 2DW6A 3RILA 2WJFA 3TZFA 4BEQA 2VFDA 1J6PA 1Q6EA 3TEVA 3Q37A 1EUAA 1RY8A 2FH8A 3VCCA 4UNIA 1OIFA 3T78A 1WKYA 3VNLA 3MUAA 4CU7A 3TJ4A 1NU5A 1LROA 1JZ2A 4HMNA 3LD5A 1RA5A 1F4AA 1KBJA 1OGGA 3TYAA 5I3IA 4MJ4A 3GS6A 4JFSA 3MP5A 2CU0A 3PBGA 3UXDA 1XH2A 2O9PA 3KRZA 3PM6A 4O17A 2GWGA 3PTKA 3WQPA 3FS2A 1VZWA 1XIFA 1XSJA 4B90A 5BXRA 3FYPA 4E2BA 1ZS2A 4HCLA 4ACZA 2VT0A 3DGHA 2GR3A 1KCKA 2EPMX 3AIRA 1Q6RA 3TC3A 2Q6ZA 4KCWA 2ZXAA 4XD5A 4ZO7A 2ZKMX 4DNMA 4B5XA 1NPXA 5CSSA 1C92A 5EMKA 1N62C 4XZHA 2X2YA 1PS9A 3W6LA 4ADUA 3LHUA 5LIXX 2EQ7A 3NZ1A 2BBFA 4MUPA 3ZWSA 1BFNA 3KRSA 2QIIA 1F9CA 1TPB1 4ORMA 3W1LA 1FFQA 5DANA 2VYOA 4NP7A 4PZVA 1VP5A 4M82A 3GG7A 4B5TA 1RQHA 4LV9A 3H4KA 3VDBA 4QS5A 1UP0A 5JBFA 1QK2A 3DOPA 3WELA 2ZWYA 2Q3OA 3GBEA 3SY5A 3FDKA 1W8GA 2HCVA 4JKMA 3CPGA 3AIBA 4POCA 3TYCA 1AUSL 3GXTA 3K46A 1JFHA 5IM51 4V28A 3TW9A 3OOQA 2TPSA 2IPJA 2J9YA 4U33A 1GG0A 3A22A 2XGIA 2GJLA 4Z2KA 3CQHA 3KS6A 2GH5A 4XWUA 1H41A 2Z1SA 5CCZA 3O15A 1I4NA 5A6BA 2CHRA 4DRSA 2OOFA 1A4LA 3W7GA 1ICSA 4W7UA 2WC3A 3GR4A 4CEXC 4M5PA 1NHPA 1E3ZA 4XTIA 3EYPA 4JHMA 2E1WA 1XQKA 4P7QA 1R0MA 1UWTA 4JYFA 1W9DM 2DT3A 2BWGA 1UHVA 3VIPA 1EJ7L 2A21A 1OABA 2DZVA 3AQUA 3D5HA 3TJIA 4D71A 1SW7A 3N2OA 1D7KA 1JVNA 3NOYA 3H7RA 4MB5A 1KCZA 1EFZA 2E9LA 4AYSA 3NNTA 3E0FA 3MYPA 4JTUA 2PDFA 2F7FA 1QI2A 2X42A 5BU9A 1E3XA 1F05A 3W00A 2B7OA 4O1CA 4UCFA 3MS8A 1LOQA 3POCA 3CMGA 4XSLA 4CQAA 2OXNA 1FEBA 4V33A 2NUXA 5LIUX 4UTMA 4OQVA 1PEZA 1HJWA 4CLMA 1RR2A 2QUMA 3BQ6A 1EBHA 1LL4A 5C5YA 1FWSA 4ZENA 4UZSA 1J0IA 2PCQA 3H23A 3F4DA 4H00A 1TPVA 1EJVC 3NQFA 1F3PA 2Y1HA 5HQLA 3ARPA 3FAXA 3BPWA 5GJNA 1JZ4A 2GPTA 3NS1B 4Q4KA 1BTMA 1QBBA 2VEPA 3QW4B 3GW3A 4DEFA 2X8HA 1XLDA 4GBUA 1E51A 4GACA 1VKFA 3TUUA 4AIBA 2J79A 5DFAA 3IGXA 5C9RA 3A3HA 4OTKA 2C1HA 2GGJA 4A3HA 3SECA 3L0GA 2L5HA 3EKZA 3I4KA 3VIHA 1TG7A 1W9VA 1XDLA 3W1RA 3NZPA 3OVPA 5AC8A 3AIWA 4GIEA 2WW5A 1U22A 1A47A 2GSEA 1JDFA 3VIOA 4PMYA 3N3TA 4DO6A 4H4UA 5LA2A 2WOIA 4H6RA 3MA8A 1ZMDA 3MI2A 5C54A 2EQ8A 2TMDA 3PSWA 3OB8A 4HPHA 2XZ9A 2C3DA 4XK2A 4DBWA 5A5WA 4AD4A 4XUGA 5D4YA 1XD1A 4N4QA 3CAWA 3EUB3 1OEPA 5H6HA 2Y88A 4P7OA 1CIUA 4XAGA 4BCEA 4RZ4A 1K7FA 4C65A 1JYVA 1WV2A 3C2YA 3LYEA 1FCBA 3ZVHA 2QKFA 1FA2A 1M7XA 1V3MA 2NVKX 5A6MA 3M5ZA 5I3HA 4EQRA 8RUCA 3WLTA 3VUSA 5ABFB 1VR6A 2CBUA 3TLLA 5FEWA 3TYDA 2E77A 4J7RA 1L9WA 1A5SA 1OFDA 4Q6JA 1P1MA 1R87A 1C29A 1A3XA 3W7MA 3OVRA 1XLKA 3EWZA 4WVXA 1N61C 5FAJA 3POHA 3W7DA 3L5OA 3C5QA 3GD6A 3JS3A 4C6OA 3KVMA 4I5UA 3E5PA 2UZ9A 1BGGA 2ISWA 2JIEA 3LRLA 3QQ1A 4FNTA 2HPMA 1LRTA 3S6OA 4Y90A 2OLAA 1UH4A 1ZB5A 3W7QA 1JUEA 1Q6OA 3GZAA 1WKEA 4PN2A 4Z2JA 5DCDA 3IJ7A 4QQUA 1RHCA 4UTKA 1RD5A 3PG9A 1VIWA 4X61A 4ONVA 4IOTA 4DJDA 4REQA 3S0CA 2QMKA 5AZ1A 2J77A 3BZGA 1WAUA 2XWEA 1MSSA 3U5UA 4H4YA 5LHFA 1M41A 4WKHA 4QSFA 1DWFM 3OIHA 3T2PA 2W3ZA 2G96A 5U7SA 4GRTA 3EKLA 4O13A 3SBFA 2EPNA 2XG9A 4NT0A 4UTWA 2YR1A 1OFPA 3USZA 2G3NA 3N29A 5EA9A 3VPLA 4I9JA 4MFEA 1FWNA 3HV8A 1D9EA 4KEMA 1E5JA 2ZRYA 2OELA 4NRRA 3THDA 3UZJA 2JKEA 1XLJA 2QVHA 2O9TA 4NJHA 1KFKA 3UA3A 1NVMA 1LVLA 2QJIA 2J66A 1DQUA 3EBVA 4WGXA 2F38A 1NDVA 4CCZA 4H04A 4JQ4A 5FF7A 3LCGA 3DU0A 5DF0A 2V3EA 4YTQA 3EX6A 1ADSA 3S1VA 5RUBA 1S1PA 3QRHA 4EMWA 4PA8A 8XIAA 1XICA 2OZ8A 4JD4A 1V59A 1WDWA 2UY5A 1RPKA 1XYBA 5M5DA 2ZA1A 3WMCA 5I79A 4L56A 1BXCA 3RX3A 5I3DA 3NSNA 3FJ6A 3GFXA 4WXYA 1F7BA 4N6EA 2WZEA 4HPNA 4LV4A 3W74A 1AOGA 5E0CA 4E2DA 4JYEA 1XYLA 2P0IA 5I02A 4N4PA 4IT1A 4GUGA 2ZX9A 4AY8A 2R6OA 4KGJA 3TN6A 4XQ6A 3EWWA 2J88A 4AG0A 1VQZA 4K38A 1GRFA 4PEEA 2CKRA 4FNSA 2Y7FA 1T3QC 1TJRA 1PHWA 2Z26A 2E6AA 5REQA 1G4TA 4MPKA 4IP4A 1R3SA 4WKAA 3H2CA 2DGAA 5DY2A 4M3PA 4MLRA 3FDGA 2GOKA 2A7RA 1MUWA 3TTOA 1FHVA 3T8QA 2HE5A 1ADDA 4ICMA 3H7UA 4LF1A 1LQAA 1BVZA 4IPNB 1UR4A 2J62A 3UG4A 1HL9A 2XSAA 1VBRA 4JXCA 4M52A 1WYGA 5D2VA 3CB8A 5I3KA 3AI0A 4HU0A 1VB9A 4PMDA 4KGLA 2XIBA 2BB0A 2R9RA 1NDYA 3LENA 4NYUA 2FHFA 1H49A 4GC3A 4JGDA 3R6IA 4US5D 4AZ7A 3S1XA 1U5VA 3QLLA 2QAPA 1FFVC 3CH9A 3S9IA 3W25A 2NQJA 1EHAA 3CZEA 4NNBA 3T05A 1IR2A 1CXKA 2PGRA 3UXIA 3AZRA 4FB7A 1EBDA 3LZ5A 5DCEA 2GDQA 1Q5MA 3ARWA 1XP3A 1GPFA 2JE8A 2FYMA 3WUEA 4ZQOA 4LSBA 4LUSA 1UUQA 1ZP4A 2ZX7A 1V08A 1L6WA 4GK8A 3C4UA 4AXNA 4FZIA 3KTCA 4UNKA 4JTDA 4O50A 3REQB 3RM4A 5G5GB 4YNGA 3QHMA 2IPWA 1JF6A 4IQDA 2YB1A 3CC1A 1GRGA 1IZKA 4AIEA 5JCKA 4BWLA 3CJPA 3PTDA 3R07C 2V81A 2RKXA 3GC5A 1AQHA 3UXKA 3VKCA 1CEOA 1SPQA 3WH5A 1BWVA 3N11A 2V3AA 3FKRA 2ZZ4A 2QYGA 2V30A 4Q8QA 2XDFA 2E25A 1J5SA 3OVGA 1KC7A 6A3HA 3MKVA 4S3DA 4URIA 1JDAA 1DXLA 1NTHA 3ZVIA 4L6OA 5BW6A 4ZO8A 3C0JA 4J2PA 3SN4A 5F2IA 1VBJA 4NZ5A 4C90A 1JCLA 1UW9A 2PUZA 1FXQA 4CNNA 3W72A 3WG6A 4RX0A 1OX6A 4DJDD 3FFSA 2XFFA 2D23A 2C79A 2PDLA 8XIMA 1BSLA 4A8IA 1OC7A 5A2AA 4AWTA 3CAKA 3DG6A 1SJAA 5A6KA 3HRDC 2I7GA 4MZ8A 4JFWA 3MBDA 2PGEA 1E55A 4MYXA 4IPIA 4BK9A 1JZ3A 1JCTA 1LCOA 3FA4A 2GK1A 1S1RA 4X2RA 2Y89A 4NVTA 1D7YA 4MB4A 1VFFA 3W2LA 3P60A 2XH0A 1TPFA 1P0BA 4IHCA 3UGRA 1YXCA 4I7UA 4HNCA 1A53A 3OGSA 1LG1A 4Z42C 5LGXA 4HJWA 4WR3A 2GYIA 3W7IA 3UVIA 3QV9A 4A8LA 1FP9A 3VOFA 1AD4A 1XH0A 1YTDA 3ITXA 1FWAC 3KBWA 2PRHA 4OUEA 1Z9AA 3OW1A 3HJZA 4H7VA 2VCCA 4TVYA 5CAHA 4F66A 1GJUA 3QQ0A 4DUXA 3E0WA 3LNMA 4LVFA 4HU4A 5IFPA 4Z2HA 3W76A 3QKZA 2V68A 2Z0IA 3URAA 1IEXA 3AIVA 1VRDA 3K2GA 4N42A 2Y7DA 4B5SA 3CGDA 5E93A 1KXHA 2OPJA 2B81A 1VFMA 1R5YA 4H8VA 2XVNA 3WLPA 3UP8A 1AW5A 1QT1A 3COTA 3BJFA 2XH7A 3DX5A 5B7ZA 4XZBA 1HTIA 3VNYA 3WH9A 2HV5A 2ZZ0A 1GYLA 4FF5A 2HISA 2PRLA 3MP3A 2KX9A 1FFRA 3QC0A 1ISWA 2ZIDA 3MO7A 3C2RA 2Z25A 2OEJA 3MUIA 4IMFA 1KFBA 5LIKX 2EG8A 3TSBA 3WX7A 3CZGA 1PCKA 1UYQA 2YSWA 4HYVA 1P0KA 1NY1A 1QK0A 3AXMA 3NSMA 3NZQA 3RLHA 4YJ5A 2TSYA 5CPTA 2AAAA 3WF3A 1X6UA 2WBAA 2C3CA 4EM4A 1P7TB 2E8YA 4DF2A 1KXQA 2PBGA 1LP6A 1POJA 3G3DA 2WHJA 3A5VA 3LCIA 4ML9A 5EBAA 2W0HA 4DAIA 3CQIA 3TN4A 2HNEA 9CGTA 4WDWA 4NEVA 1UASA 4HTYA 3S9ZA 3MV01 4OOZA 2DH3A 4D6IA 2A79A 3HTWA 1WXJA 5CBJA 1CENA 1HL8A 5KVHA 2EG7A 3GNXA 4FIQA 1KO0A 4KWWA 5JBDA 1FWIC 2ZRXA 3W6YA 4J35A 4QG6A 1NFPA 2GVLA 5AECA 1LZOA 3O9NA 1WA3A 1L8PA 1AQFA 2EPOA 3INPA 1WDRA 4S38A 2C1IA 3FHAA 4IGSA 2DDXA 2CPUA 2QUUA 3M07A 2ATMA 3LXBA 5A1AA 3W27A 3BG9A 5I07A 4AF0B 1ZY9A 1YQ2A 3ZWTA 1JXJA 1PX3A 3AICA 4FNQA 1NP0A 4Y2WA 3DECA 4JN7A 2Y2WA 1CCWB 2BCPA 3ZO9A 1QI3A 9XIMA 1PZ0A 1W2VA 3NVVB 2PP3A 5A8MA 2J7GA 3C52A 4H3DA 2GUUA 4M6UA 4LVBA 3UZWA 1A0CA 4H01A 5FS6A 3QYSA 3VGGA 3BV7A 3AYTA 4J3XA 1G6CA 4XIMA 1NOFA 2FDMA 1HIZA 2VR4A 4PUWA 3W7RA 4K37A 4N2YA 2W92A 3N25A 2B0MA 1EOMA 1ONRA 2HS6A 2OB3A 2ISSA 2HBXA 3IVTA 3K30A 4UTUA 4UTHA 4PCFA 3HG3A 4GD0A 2V82A 2FTYA 4MG4A 1Z32X 3NQMA 1QNVA 1K7XA 3CIXA 1KRCC 6PTDA 1L2UA 4IG2A 1PKMA 2BVYA 2XIIA 4BI5A 1Q6LA 3R12A 4HIBA 3H22A 1F3XA 1DJIA 1NH6A 2WB5A 1XFBA 2X1TA 1NARA 2H8XA 2NWRA 4GI9A 3RG6A 3QZEA 3LBCA 2J9ZA 2DZTA 3VOCA 4GPNA 3NZGA 3THAA 5D9OA 4NJIA 2ZDSA 4GA8A 3K8MA 3WLRA 1ONXA 4WRHA 1VJSA 2VJXA 1ZXIC 3QR3A 2XJ7A 4GY1A 3QMSA 1J0YA 2OMAA 3LA4A 5HPCA 4DBSA 2JFEX 1W9BM 4WCJA 1KXVA 2IPGA 4RW3A 5JUVA 5CZKA 1GHRA 1J01A 1V3KA 2R8WA 1VH7A 3IWPA 3HPSA 3NQVA 4V15A 3GTHA 4EVZA 3BW4A 2W63A 3TW6A 4Y8EA 1YMYA 1A5AA 3WNMA 4BY3A 1CDGA 1QDSA 3ZR4A 3OYZA 4JY8A 1ZKQA 2WCAA 2ZXQA 3MQTA 1SM9A 4WSKA 2VO5A 1K8ZA 2V5KA 4Q8VA 1XBVA 1VD6A 1K9EA 2VWSA 3GG1A 1GOIA 7A3HA 3WL0A 1EWEA 3MMUA 3HGJA 4A35A 3UWUA 1JF5A 3G1SA 5REQB 3P0XA 3F2BA 1E1FA 1TZ9A 3P5YA 3PBVA 3W2JA 1QMLA 3CO8A 4FXFA 3OLDA 3AWOA 2QCLA 4D6HA 4IIGA 1PDYA 3BMVA 1Z8AA 1V03A 4FOKA 4G8TA 4K3ZA 1XLAA 2FLIA 2G5WA 1XYFA 3W75A 4JTSA 3MKCA 1CXFA 3UPMA 3OO2A 2AKZA 1JJKA 2PD9A 1J10A 3KLKA 2GSJA 3QGVA 3L4YA 3LUTA 2FKPA 2TAAA 3MMWA 1M53A 4PSPA 2D24A 1GQNA 1PX4A 1QNSA 3AIQA 1B3YA 2NSXA 1VJIA 2EPKX 2CLFA 3K4WA 5EKYA 1YE6A 1WZMA 4IGMA 2WQPA 2IS7A 3VM7A 2WOVA 1EC8A 1UC5A 2PP0A 5SWUA 4H9XA 2GGEA 2OQYA 3VIJA 1SFSA 5DLCA 5G5HB 1YPFA 2BV9A 4AC7C 4Y9AA 1U33A 4X9YA 1WUFA 4TVDA 5TNVA 3IGUA 1BXBA 2NZLA 1J96A 5AY7A 3V36A 5CAKA 3W37A 3W86A 1X98A 2GJPA 3QSRA 1HP4A 2Y85A 1W3NA 3SCWA 1JAKA 3RRAA 4GIAA 2OSWA 4EP8C 5HUOA 1CLXA 1AJZA 4GQRA 3P3BA 4PMUA 1WBHA 2OU4A 3LXDA 1ME7A 1W1A1 4UBPC 1UPPA 2HQMA 1VHCA 3SQMA 2BG5A 1OIMA 2EBNA 3B4YA 3SIMA 1W54A 3LGEA 1PVNA 5F4XA 5A3HA 1PWLA 2V63A 3PZOA 1KTNA 2TODA 5A69A 3H21A 5JH1A 4MM1A 2CZFA 1Z42A 4PCPA 5CJNA 2UBPC 4H50A 4NAFB 4PE8A 1TV8A 4YTUA 1QXLA 4IFOA 1MNSA 1ITQA 2PEVA 4MKNA 4DY1A 1GJPA 4YL2A 1VAHA 3BGJA 3N6HA 1UBSA 2J25A 3ZOAA 4I9MA 1M04A 1S2VA 2PWUA 4QJ5B 2XZ7A 2Y62A 3SCSA 1EYEA 2G50A 1A5KC 3Q6JA 3KWSA 4RDVA 4LTSA 4F2TA 1FEAA 3F2DA 2OKOA 3NURA 2FPTA 3WD1A 2QUNA 4ATWA 2B7PA 3CHVA 1AL7A 1VC4A 2ACSA 4PTDA 1FVPA 2VHLA 1C7SA 2B7NA 4JQAA 3LBMA 1C7TA 3A9IA 1CGVA 2OO6A 4CEUC 2D2HA 4HVXA 1JIBA 3NQAA 5K2ZA 1XIHA 4QRNA 3A13A 1W9UA 4NILA 3AMLA 1F61A 2GJXA 4FX8A 3VZXA 3LLXA 1EJUC 1CNVA 3BLIA 3QGAC 3ZMRA 4PRTA 3S9YA 5GJMA 3FCPA 3STFA 4GBDA 1RJQA 5LXXA 2J13A 7CGTA 4XIAA 4PMXA 1Q8JA 2GQAA 3OA5A 4B3LA 1PE1A 1AG1O 1MEWA 4XB3A 1KD0A 3BK0A 2FFIA 1V93A 2J6XA 4J28A 3QTGA 1JD9A 1IE7C 3IK2A 4ZO9A 4JDRA 4R85A 2QT3A 3SN0A 1GRTA 2EQ6A 2ZZBA 3SUTA 4GI4A 2WZHA 1UH3A 4FA3A 2PI6A 3HGRA 4OV4A 1VEOA 5DMYA 4EX4A 2V5DA 4M1BA 3VKBA 3OODA 3W38A 3DEQA 2DZPA 5DT5A 3B8SA 1N8IA 4LJ3A 4U31A 3W1AA 3LV6A 5J04A 2X8CA 1LUCB 2NXHA 2E67A 3FSTA 4AAJA 3OZPA 1M6JA 3BAKA 2YKKA 4JEJA 4C5ZA 4XBJA 1XPGA 4F0MA 3MI3A 1R46A 2FB2A 1BYCA 1V8EA 3GW0A 2YBTA 5JH2A 2C0AA 3CPUA 1L6SA 3VD9A 2OEMA 3R8HA 4FP1A 3AHVA 1J0HA 2O92A 1T40A 1ZSXA 1KM2A 2BHUA 1BRLB 1VGAA 4HNNA 5LNWA 4Z1YA 4ORIA 4ADTA 1BLIA 1FBAA 4JTTA 1O94A 4FLSA 5D2XA 4D6EA 1PSCA 1HQTA 4L80A 4RKAA 3AIEA 2C15A 4AEEA 1DIEA 2OJPA 4PB5A 2OVLA 1FWFC 4R9OA 5D30A 4UFHA 1RAKA 1DHPA 4H7CA 4DO5A 5AYZA 3DGBA 2GGGA 1XHGA 1K03A 4L1XA 2PTDA 3HO8A 1S2AA 4J4KA 1RBLA 4C6CA 3GIQA 2BC0A 4X3ZA 1SO6A 3GQYA 4AX6A 3LSBA 1TZZA 1FH8A 3AUJA 1C9DA 1X97A 1M68A 5CC5A 2XGBA 1BYDA 2PDGA 4ERAA 4XSMA 1BPLB 4A3RA 4IPLA 2WMFA 4JOMA 4LA1A 3VYLA 3HOJA 4JKLA 2J3NA 1SFLA 5CGTA 1BEUA 4RK8A 3OZYA 3STGA 4H4ZA 2WMIA 3LGGA 4PUKA 1XCXA 3M16A 3W7OA 3N1AA 3L5AA 2OSYA 3T2QA 2Z2UA 3B9NA 3QMRA 3NQEA 3RIKA 2NQ5A 4JIEA 1E70M 2ZVIA 3PB0A 2GZXA 3IRDA 1S5NA 5GJPA 1GRAA 4S3AA 4GH1A 2YVJA 1E6SM 3PZGA 3GIPA 3PJUA 4IUGA 5A8OA 4R53A 1PZ1A 3W82A 4LAUA 2A3AA 3WUFA 2VFIA 1QPOA 2YAUA 2HEJA 1HJSA 4D8ZA 4S3BA 4MKSA 3R11A 4UQAA 2WKLA 5LZLA 3W1QA 2PZNA 1AZ1A 2X2GA 1W1IE 2YXXA 2CBVA 3VD5A 4B9ZA 4PMRA 1U2YA 3EOOA 3CT7A 3H2EA 3R0KA 4GZIA 3QHNA 1R9XA 3RLUA 3LMZA 1JPMA 1E0UA 3E2SA 3KUMA 3C0QA 1MWOA 1WOBA 4RNHA 4JIIX 5LNVA 4TOQA 1EF2A 3L4WA 5D33A 4MAZA 3L4ZA 3H12A 4S2BA 2DEPA 3M0VA 5AB3A 3GTIA 3QY8A 2F5ZA 3N2TA 4KBXA 3UZXA 2XFYA 3ITOA 1F3EA 3L12A 3E2QA 1W8SA 2J75A 4JY9A 3DESA 4H4QA 1XLHA 2IXVA 1L6YA 3UU0A 1GETA 1P0EA 4UFLA 2DJXA 2VUYA 3O0HA 3E0LA 2ZZ6A 3T0DA 5E0FA 1WB0A 3UERA 5FL0A 3DYOA 4W84A 4NSBA 1IT8A 3BAWA 3MDWA 5DBTA 4JKKA 4DBUA 3ZXWA 4ZB5A 5BMWA 1KQZA 1OT1A 4L61A 2Q01A 4HU8A 4JQ9A 3WEZA 2BOFX 2YIHA 3ZSSA 1EYWA 1K02A 1SZRA 5EMUA 1UZDA 3MSDA 2WZTA 4YHGA 3BL3A 5FF4A 5C7VA 1SUXA 3W2MA 1D3CA 2WWCA 4HMDA 3TV8A 3DFSA 3GE7A 2X1UA 4EPEC 4WZHA 1YPXA 1Y0EA 4HZMA 3W29A 1YEYA 4PRRA 1J18A 3B8IA 4KF1A 5F1VA 2D20A 2VVNA 5KTLA 2FGLA 5T8GA 4TX9A 4EACA 1KGUA 3WQ5A 3WENA 4HP5A 3HPFA 5DBUA 3N14A 1DXIA 2ATSA 4O4WA 1KNWA 1RP8A 2WWDA 3O63A 4KFPA 3QHOA 2JKPA 5H91A 4AEFA 4EPBC 3M5XA 1UD5A 1RCOB 4AISA 5L6UA 1QO5A 4PBGA 3WLJA 5FJTA 3AHZA 3SI9A 2O7QA 4WY0B 3VUPA 2CETA 3GDLA 3NEVA 5LXEA 1O5QA 4QCEA 1RQBA 1OD8A 1B1YA 2QJGA 5I09A 4PUJA 4KKXA 2PU1A 1LT7A 5C71A 3WDIA 3ES7A 1EXPA 1VF8A 4MDOA 3BH4A 3I3DA 4NJKA 1TCDA 5I6SA 5K4ZA 4GUIA 1ZRQA 2BXVA 4IPPA 4EAMA 3LI1A 3A7AA 3TYEA 5C9XA 4RJEA 3B8VA 1VYSX 4XD3A 2QAFA 1TPEA 2ZTJA 2CWNA 3CT2A 2PGFA 2C91A 4F2BA 3NQCA 1OYCA 4L1WA 3ITLA 1EOKA 3MY9A 4IMCA 2I16A 3NL2A 4RDWA 1KXTA 4GYKA 2VEIA 1FCUA 3PTQA 1RJRA 2CCRA 2J6VA 1GVEA 2DVUA 2ACUA 3W1TA 5LGZA 3KBJA 3GVVA 4UQBA 1PYFA 5AHLA 1OYBA 4DF1A 4OBSA 1JRBA 2WPGA 4UTTA 4Z17A 1XS2A 3MPGA 4MB3A 3WLKX 1KFJA 7XIMA 4P8VA 4RE0A 1LLZA 1YDYA 1MW1A 2X1SA 3N2XA 3UR7A 2V2HA 3BANA 4I9AA 1B3WA 1ISZA 3TWAA 3DJJA 2NQHA 4DN1A 1K7EA 3L0NA 3WF1A 4WK9A 5AC4A 1S5VA 4DB7A 1HO4A 3B8DA 2PD5A 3VA8A 4UR9A 4CCCA 1WXZA 2VZUA 3P67A 4F0LA 4GXPA 5H1WA 3BC9A 3MSYA 4HBKA 4IIFA 4XD6A 6XIAA 2ZZ3A 2D0GA 1OT2A 1AL8A 1R86A 2WCGA 1PBGA 2PP1A 3TTEA 1H60A 3ZQ9A 1UR9A 3W81A 1RCXB 1ZU8A 2WC4A 2X09A 2ZOXA 1UC4A 4HK7A 4LW7A 3HGOA 1IGWA 4XISA 3TQVA 3CU2A 3DFQA 3HIJA 4HCDA 1Q1WA 2X0SA 2E3TA 3CGTA 2VC5A 1CGTA 1HT6A 1R3YA 1CGWA 5AHIA 5GRTA 4GINA 5CZJA 4B9YA 4K7YA 4LT9A 3SJNA 4NZJA 1IR1A 3CTLA 4LAOA 4OIFA 1TYPA 5C70A 2QF7A 3WQEA 1N55A 3S2LA 1ITCA 4JFVA 4QEHA 1UOKA 2AGTA 1XL9A 4E2OA 4JNYA 4IFRA 1OF6A 4ZOBA 1BWCA 3UT0A 3EA1A 4UOQA 3G1XA 3DAQA 2FZ9A 3WJZA 1XIDA 2O56A 1R2TA 2DUZA 1A3WA 4LB3A 3ECQA 4H4RA 3ZR6A 2E6YA 1SW3A 3SRHA 1A4MA 2WBGA 1V3LA 3GH5A 4G9PA 3UJRA 3AU6A 4DJEA 2VTFA 1TQXA 1HF6A 2PWFA 1TRDA 2D69A 1I60A 5E09A 4GI8A 4ZEPA 3MHGA 4Y8FA 1TB3A 2DIEA 2DQXA 4DWSD 1H0GA 2VC9A 2OCZA 3PPHA 2Z1BA 4C6BA 1ZJHA 4KCTA 5BU6A 3MMTA 3EOUA 4MJMA 2CBJA 5I7GA 1JXKA 5F2GA 3GXDA 4M6PA 1BKSA 1GOKA 3QFAA 4LXFA 2WAGA 4HPXA 1M5WA 4C6MA 1Q4NX 1KFLA 1PPIA 3WLLA 3DZ1A 2IQTA 3B9OA 2ZADA 4O10A 5BYWA 4PMNA 3EZ4A 3STEA 1GQKA 4UTFA 3AFBA 3CYVA 4UFJA 3UGVA 4F0KA 3GVRA 3M47A 1M7OA 2RJHA 4C7GA 1HGYA 4G7FA 3ALFA 2OYLA 5I3JA 3R7MA 4IMAA 1MFVA 4LRSA 4FHAA 3RRXA 6ENLA 3DC0A 4S3KA 1T96A 2XVGA 2RDXA 3O07A 4JS3A 1A0DA 1V5XA 2QCDA 1PO9A 1H2JA 3MJMA 1E0WA 4CNOA 2ZVRA 3VNMA 1XANA 4LOCA 4U5IA 4LBUA 4E3VA 4CCDA 1OX4B 2CZ5A 4LYKA 4E8GA 4GCXA 2NV9A 3PAJA 2NV1A 3H8AA 2JKAA 3CIWA 5BOFA 1I1XA 1O12A 3DHFA 2WHKA 3M0YA 4FS9A 2JF7A 4DPQA 2XIOA 4MGGA 4ADWA 1EHNA 2YW4A 3G1DA 1TA3B 1K8XA 5KZEA 4NKCA 2FDSA 4JTGA 4RZ6A 5CKSA 3RFAA 4R7OA 3ABOA 2J78A 2J7FA 5E6ZA 2FTPA 2BNJA 2XVKA 3N13A 1XISA 3IGHX 4FOUA 1S3TC 1KGWA 2ZA2A 3VGFA 4Z1DA 2J8GA 4UR7A 3VNDA 3V16A 2WP6A 4U28A 1EJRC 4Q6XA 2VM8A 4W8AA 2QJHA 1R9YA 1WKFA 1G7VA 3CPRA 3CYJA 3WQFA 3HURA 5CSYA 4NZCA 5BNKA 3S1UA 2Y5SA 1HKIA 1W3HA 4RV8A 1VFUA 2Z7GA 1ODUA 4BKNA 3ABSA 1FHLA 3KOXA 2RJGA 3NDOA 4OT7A 3ZLGA 2EEXA 1XM3A 5TR3A 4XO7A 2VX7A 1TIWA 1JDCA 1XRTA 7PTDA 3BAJA 1W5MA 4C60A 3I6RA 1DWAM 1XLEA 4IP7A 3TSMA 3A24A 3RX4A 4UFKA 3L0KA 2BLEA 3WD2A 1BTCA 1RSCA 3VU2A 4TVCA 4ZXLA 3BVJA 2HDJA 4MJ2A 2VC6A 4O16A 2ACQA 4S1FA 4WXZA 3QLDA 2P3EA 1O60A 4HQVA 2YA0A 1HVQA 4QCFA 8CGTA 1WX0A 1NHSA 2DT0A 4BI7A 1LORA 2E6FA 5E9XA 4AC1X 3HG5A 3WMSA 2HBVA 4QDWA 1CGXA 3LX9A 1UKOA 4KS0A 2A4AA 1Q6QA 2YFOA 3HA1A 3ZJKA 2DZSA 3ISIX 1W1B1 1OY0A 4U4MA 4FI4A 1ZBWA 4DO4A 4Q8WA 5CPOA 3PY2A 1X1ZA 3T0CA 1ZK7A 4F40A 3MI6A 3B0XA 2X0YA 4P7LA 1EWDA 1WDPA 1V0NA 5HANA 3T81A 1LT8A 1CT5A 2PTZA 3V0SA 3AMDA 3LCXA 3NCOA 4GJIA 4TR9A 2HVMA 5F4WA 5GQBA 4F9JA 2YQUA 1JNEA 3WLIA 4TU1A 3PG8A 4HTBA 3FNDA 4L7ZA 3BLFA 1XIIA 3J7HA 1E4NA 4XZLX 1EX1A 5FI8A 1X1OA 5C2XA 3ENLA 1TJPA 3ALGA 4CQBA 2G41A 5T91A 2G3IA 3KCLA 4ACZB 3TROA 1X38A 3VI2A 1L8NA 3G0UA 2VUNA 3W07A 1A5LC 3LOTA 2JGYA 3A3WA 3AXIA 3AJXA 4HNOA 3P0WA 5BMXA 4DYEA 1PJ9A 4NX5A 3KCOA 5HULA 4CVUA 1QW7A 1LQ2A 3VMPA 3GAYA 3UY7A 1K70A 1MZHA 3WMLA 3THCA 4J27A