2QJNA

Crystal structure of d-mannonate dehydratase from novosphingobium aromaticivorans complexed with mg and 2-keto-3-deoxy-d-gluconate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
402
structure length
385
Chain Sequence
MKITAARVIITCPGRNFVTLKIETDQGVYGIGDATLNGRELSVVAYLQEHVAPCLIGMDPRRIEDIWQYVYRGAYWRRGPVTMRAIAAVDMALWDIKAKMAGMPLYQLLGGRSRDGIMVYGHANGSDIAETVEAVGHYIDMGYKAIRAQTGVPGIASLPSVTGWDTRKALNYVPKLFEELRKTYGFDHHLLHDGHHRYTPQEAANLGKMLEPYQLFWLEDCTPAENQEAFRLVRQHTVTPLAVGEIFNTIWDAKDLIQNQLIDYIRATVVGAGGLTHLRRIADLASLYQVRTGCHGATDLSPVTMGCALHFDTWVPNFGIQEYMRHTEETDAVFPHDYWFEKGELFVGETPGHGVDIDEELAAKYPYKPAYLPVARLEDGTMWNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Evolution of enzymatic activities in the enolase superfamily: D-Mannonate dehydratase from Novosphingobium aromaticivorans.
pubmed doi rcsb
source organism Novosphingobium aromaticivorans
molecule tags Lyase
total genus 141
structure length 385
sequence length 402
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2007-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2qjnA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2qjnA01
1F9CA 2QDDA 3MQTA 3CT2A 4KEMA 3RITA 1FHUA 4JN7A 4KWSA 3VDGA 2XH7A 4E4UA 2HNEA 2PP1A 1SJDA 3I6EA 3TJ4A 4MMWA 1MDLA 3V4BA 3R10A 3FV9A 3ENLA 1EBHA 3UCCA 4IL0A 3UXLA 3TOYA 2AL1A 4A6GA 2ZADA 4E5TA 4GYPA 2NQLA 4ZA0A 1JPMA 4GISA 3DEQA 3DG6A 2P8CA 3TW9A 2ZC8A 7ENLA 3CB3A 2HXUA 4K2SA 2XH0A 3IK4A 2QVHA 3TJIA 3DERA 3RCYA 3V3WA 4Z1YA 3ZVHB 3FCPA 4DHGA 5EU9A 1SJAA 3OW1A 3ZLHA 1BKHA 2QJMA 1P48A 3PFRA 2MUCA 4IP5A 2QJJA 3D47A 3OP2A 3QKEA 2P8BA 5BOFA 1OEPA 3CAWA 3VC6A 3TCSA 1MDRA 3BJSA 3UGVA 1YEYA 3MZNA 2PU0A 3UJRA 3JW7A 2FKPA 4KT2A 2P88A 3UXKA 1WUFA 2MNRA 5FJOA 3B97A 4HYRA 2OQYA 1E9IA 3NZGA 4IZGA 1ELSA 3K1GA 1FHVA 3DFHA 3N4EA 3U9IA 3P0WA 1L8PA 3QLDA 3GY1A 3THUA 4A3RA 3ZVHA 1JDFA 3TWBA 2PP0A 3GD6A 4H1ZA 3N4FA 2OZ3A 2GGIA 3S5SA 1ONEA 2O56A 4HCDA 1PDYA 2AL2B 4J1OA 3SSZA 3JVAA 3FYYA 3Q45A 2PPGA 2RDXA 3SN4A 3R0KA 2OFJA 4E6MA 4A35A 3CXOA 3HPFA 2PODA 4HPNA 4DN1A 4G8TA 4HCLA 3PWIA 4IL2A 3D46A 2OVLA 3RR1A 1MNSA 2PCEA 4GIRA 3SBFA 1R0MA 3DG7A 2XH2A 3ZLFA 3MWCA 3ES8A 4GGHA 3EEZA 4K8GA 5J04A 3TQPA 4MGGA 3H70A 4DYEA 3DFYA 4ROPA 2PA6A 4DX3A 2OX4A 4HCHA 3ZLGA 4KPLA 1W6TA 1NU5A 3SN1A 5IDZA 1SJBA 3FXGA 3TWAA 2XSXA 2P3ZA 1XPYA 2AL2A 3V5CA 2PSNA 5BOEA 4M6UA 4F4RA 5FJUA 4FP1A 3UJEA 2OZ8A 2I5QA 4Z17A 3N6HA 3T6CA 4IHCA 1EC7A 3BOXA 3NFUA 3GC2A 3JZUA 3IJIA 2QJNA 3P93A 1RVKA 3CYJA 3PWGA 1DTNA 1TZZA 3VC5A 1XS2A 3NO1A 1NELA 1R6WA 4JN8A 2PGEA 2PGWA 1EC9A 2DW7A 2OPJA 2CHRA 2QDEA 4M0XA 2HXTA 3ES7A 3H12A 3UJSA 3N6JA 1TE6A 3ZVIA 1JPDX 3MUCA 3R25A 2OLAA 2OQHA 2P0IA 4X2PA 2OG9A 3RGTA 3IJLA 5FJTA 2PTZA 3DDMA 4JHMA 1IYXA 3BSMA 4GFIA 3IJQA 4GMEA 4G7FA 3OTRA 1P43A 4DWDA 2XH4A 2AKMA 3TTEA 3R0UA 4ZCWA 4HNCA 2GDQA 3PK7A 1BQGA 3V5FA 3UJFA 2POZA 3RO6A 1MRAA 4ENLA 3T8QA 1JCTA 3VCCA 3R11A 5FJPA 3MKCA 1EBGA 4IP4A 3R1ZA 4DXKA 3T9PA 2QQ6A 4MKSA 2GGJA 2PMQA 2PU1A 3I6TA 3QTPA 5FJRA 2HZGA 2GL5A 4HN8A 3DG3A 3VCNA 1MUCA 3QPEA 3RRAA 1KCZA 1TKKA 3CK5A 3NXLA 4H2HA 3SJNA 2XGZA 3T4WA 2FYMA 6ENLA 2OO6A 3DGBA 3VA8A 3FVDA 2GGHA 2PP3A 4FI4A 2PTXA 3FJ4A 3I4KA 3U4FA 1KKOA 1PDZA 3MSYA 1ECQA 3STPA 3P3BA 3DESA 2QGYA 3SQSA 4E4FA 2GGGA 4IT1A 5ENLA 4J3ZA 1EC8A 2OKTA 2GGEA 3OPSA 3SN0A 3DIPA 1WUEA 2GSHA 4YWSA 4EWJA 2PTWA 3OZYA 3QN3A 4K1WA 3H7VA 3UCDA 2OZTA 4HNLA 1SJCA 3GO2A 3OZMA 3Q4DA 2DW6A 2PS2A 2PTYA 4H83A 3S47A 3EKGA 1KKRA 4GYPC 3MY9A 4H19A 1KD0A 3VFCA 3UJ2A 4E8GA 3KUMA 3H8AA 2ONEA 2AKZA 4GGBA
chains in the Genus database with same CATH superfamily
3PAJA 4X3ZA 3AM9A 5AYXA 2Y8UA 3KHDA 4RKAA 4JN7A 2XH7A 4LV9A 1JZ5A 3SFKA 1PIFA 2HNEA 2ZZ1A 3B3DA 3PZUA 3QEZA 4RE2A 3STFA 3L9CA 4YJ5A 4UBPC 2GQAA 1C29A 2YPIA 3CMGA 1VCGA 1IV8A 5CSUA 5EFFA 1EO5A 2NQZA 4ZA0A 3TROA 3O63A 2A3LA 2EO7A 2C79A 3A9IA 4PMVA 2VELA 5IFTA 3DHFA 1EJ7L 1GQIA 3GAYA 4FX8A 2HXUA 1A5SA 2QPSA 3B0YA 3Q94A 3CQJA 2R82A 5DX7A 5I7GA 1OB0A 1RK6A 2PDPA 1E4LA 1UD4A 1YTKA 2Y8KA 4FO4A 3MUZ1 1C9DA 3TA6A 2QJMA 4AEFA 4RLIA 3M47A 5FL0A 3UXIA 1GW1A 1UH4A 1V6YA 2ZRWA 3D47A 1EJWC 3LRLA 1SSDA 1ZLPA 6TIMA 1BRLA 3NQ6A 5T9CE 2WC4A 4KW2A 4PCNA 2WP6A 1SFSA 4Q4RA 3WLQA 3HRDC 1B3ZA 4A3QA 4GUGA 1RBOB 2YCLA 3A3XA 1ITQA 2EQDA 3QV7A 3BAYA 3T2QA 1W1YA 3RUBL 2P88A 3UXKA 1EJVC 5C9RA 2E9MA 3O6CA 2Z1SA 1IEQA 2NZLA 3WD2A 1O5XA 2NQHA 4GC3A 4LUIA 4ZGYA 3DFHA 1YXYA 2YA0A 5JMUA 1F61A 1Q6QA 2ISFA 1GNXA 4A3HA 5AC6A 2CESA 2RAGA 3WFLA 5A6JA 1GEQA 3P82A 5E93A 3NQ2A 1GYNA 2D0GA 4YU1A 3LSCA 4J40A 4J1OA 1DWJM 2AMGA 3OQEA 3PPHA 2ZUUA 4JYEA 3SN4A 3G1FA 1OIFA 2H9AA 2EPLX 1LLZA 3GIQA 1JDAA 1UW9A 3W7LA 1XLDA 5BMWA 2CLKA 1V59A 1Y5WA 4FPSA 2FB3A 2C91A 4PULA 1V4YA 4MJZA 1R38A 2GVJA 4GD0A 1VRDA 2XWDA 4GC4A 3LHVA 3P2VA 3HJZA 5CSRA 1CEOA 3KBWA 2Z1WA 3ES8A 1H7RA 3MC5A 2O92A 3CHEA 2EPOA 3QZ6A 2X1UA 3UGRA 4TVDA 5CC5A 3BO9A 4TUFA 2JEQA 2ZVRA 3FK4A 5IOBA 1I45A 2VTFA 2PWEA 4CQDA 4UOQA 3D3AA 1EWEA 3CV2A 3NQBA 5JXQA 4RZ5A 3JR2A 4JQAA 1CB7B 2VFHA 4AVOA 3P62A 1RY8A 1GKQA 2I5QA 2B7QA 1K03A 1J12A 4GUFA 3P84A 1HKIA 3JZUA 1U5JA 4C6CA 1VRXA 4MNJA 4HNUA 1EL3A 3N2BA 4ZODA 1GOMA 1CENA 4IUOA 4ZMGA 3IAPA 5D2VA 3GIPA 3F5KA 3M7WA 3NXFA 2DZBA 2J6VA 1H49A 4FIRA 4ZEPA 2DQWA 3URHA 3C3NA 4HZ6A 3DENA 3W6LA 1Z3NA 1ZJHA 3B9NA 1KC7A 2QULA 4BQ3A 4F79A 3K5XA 3ZT7A 4HT3A 4CEXC 1XLGA 4XAYA 4JTTA 1RA5A 3KWXA 4GMEA 2GR0A 3CUXA 4B5UA 4CVUA 2KZHA 3E49A 5FS7A 4ZR8A 1PKLA 4C6NA 7A3HA 2AQWA 1ZALA 2BVDA 3IC9A 5A6BA 3I65A 3N25A 1JCTA 3LLXA 2FTPA 4C91A 5JIWA 3A7UA 3HG5A 3NQDA 3I6TA 2A7NA 3A9BA 3B0UX 4O11A 1R9YA 3DXIA 1S2AA 4NAFA 3IEBA 3LM7A 1AOGA 3B06A 4WSJA 1DE5A 2Y2WA 3LG3A 4N4QA 4EMJA 1YE4A 3S1XA 4JY8A 3FDKA 1V0MA 1LQAA 3WELA 3ZYZA 3W28A 3LXDA 3VD9A 1S5NA 3NO5A 2NX9A 6ENLA 1UHVA 3R2GA 5XIMA 3QQ0A 2Y7EA 3I7SA 2QXWA 4LJ3A 1TTJA 1QNRA 2B4GA 1EQCA 4GG9A 2G97A 4OOZA 2QAEA 5AYYA 1VB9A 1UQYA 4WDTA 3P3BA 4CD5A 2BLEA 1LWIA 4L65A 4RUBA 4W88A 4IT1A 1XQLA 4C7GA 1H2JA 3AMDA 4LV4A 4N9CA 2V30A 1WKDA 1N5XA 2DJLA 3WLKX 5REQB 1STZA 3KZPA 4I8DA 3SIZA 2ZDSA 3LRKA 4NX0A 2CWNA 3WD4A 3GO2A 4FF5A 3TQKA 4S3GA 3O2LA 1M7PA 1HKMA 3AIWA 3CEPA 1TJPA 4XZBA 3TYAA 5HOSA 1C9WA 4U28A 4ZQMA 4AISA 4EMWA 2AKZA 2H3DA 1F9CA 3G77A 2Z2UA 2O7SA 4CNSA 3O15A 4LPCA 4J9JA 3WQDA 4UFIA 3ORWA 3M1ZA 3TA9A 3VDGA 3V0SA 3W6MA 2GJXA 4U10A 1ONWA 1O60A 1NDAA 4IGSA 3F4VA 3MVIA 3V4BA 1QO5A 3DKJA 1FCVA 1R3VA 1RXOB 3W2NA 1XLAA 3GXPA 3ZJKA 4BWLA 1M3UA 1RPKA 2VRJA 2C6QA 1HT6A 3URQA 5BYWA 1RK5A 1XIJA 2DZAA 3E9AA 2CLLA 1TV8A 1K9EA 1N55A 5KZ6A 3MUIA 1PTDA 1Z7AA 1KTCA 4XD3A 2QDHA 4LFYA 5AC5A 2QUVA 4GY0A 2Z1VA 2Z7KA 3KEHA 2NVCA 2H8XA 1VIZA 3F5JA 3O7UA 3TQVA 1K02A 1IEWA 2NV1A 1EDQA 1BF2A 4TOQA 2QEZA 4FIQA 2V5CA 1GHSA 2XZ7A 8TIMA 2NVKX 2INEA 4HB7A 4PE8A 3B8UA 2XYLA 3G3MA 4LVAA 4R88A 2C16A 3BXWA 4IMEA 2YX0A 1YLVA 3EX6A 2P10A 4H8UA 3N2MA 3CBWA 3BW2A 4NNAA 4PN2A 4MSSA 4DO7A 1D3GA 2CEQA 4CLMA 3SQPA 1OFQA 4AD0A 1J2WA 2OWXA 3BLEA 7REQA 1PS9A 1P0BA 1GREA 1KWGA 4S1FA 1BG4A 1GPFA 3BLPX 5BOOA 1CGYA 1PSCA 1DJWA 1BVZA 1RUSA 3IACA 4J5NA 3THUA 4MM1A 4M1RA 1K9TA 4DYKA 1M9HA 1XC4A 3GBDA 2PWGA 3FS2A 1XCWA 4H1ZA 2BP1A 1SR9A 1Q6OA 1ZBWA 1P0NA 1H7WA 5DLCA 2DJXA 4PTWA 3F4WA 1WOAA 3ZIZA 3BL3A 4HTYA 4RW5A 2ZE0A 1T96A 2P50A 1VD6A 3PBWA 2QIWA 3TYDA 4UTLA 1PPIA 4H04A 3RX3A 1G4EA 4F8XA 1UWIA 2YL8A 3W53A 2E4TA 3MMDA 1TZ7A 4FXJA 4I3GA 4ADTA 4CN4A 3MWCA 5KITA 2NLIA 2J74A 2QYGA 3HG2A 2HCVA 1Q7QA 2PZNA 2WMIA 3L23A 5D04C 3KTSA 4MZ1A 5HK4A 1H4PA 2NXHA 4PUJA 3AISA 4W87A 1KR1A 3ZLGA 3MMWA 4ZO6A 4GH3A 4AAJA 2A79A 1SJBA 1JF6A 2DQXA 5I0DA 1NOUA 1UWSA 4GZJA 3PHAA 2ZX5A 3V5CA 2I7GA 1W5OA 1XD0A 1W1A1 5BU9A 1FFVC 3H7RA 3W4RA 3PUEA 3E2SA 4AYSA 1NEYA 4D2JA 3NFUA 2BNJA 1K9FA 1XH2A 3EDEA 3UWUA 4NYUA 4GR1A 2QF7A 3P74A 4N6EA 5AECA 2VUYA 1FEBA 2VOTA 5HNNA 3RXZA 2ZXAA 5EMKA 3T0CA 4RE0A 2BXVA 4D1JA 3G1HA 4JFTA 3RPMA 3L67A 2XN2A 3UA3A 3OLGA 1QU4A 1XYAA 4C6FA 4O12A 2J7EA 3HM7A 4Q4KA 4RE3A 1PKYA 2PB1A 4B4HA 1GPWA 1PO9A 3UPWA 3ARWA 1W9VA 4DXXA 2PDBA 4QGCA 2ZVIA 1DWFM 2YW3A 5I79A 4BI5A 2Y70A 1NTHA 3TSBA 4S3BA 4EX4A 5A3HA 1UZHA 4M5PA 4JHMA 1X7FA 1ZMCA 1UKPA 3GUGA 1ZHAA 1J18A 1IXNA 2DPEA 2XH4A 3VI2A 4G9PA 4E4PA 5DBUA 4UTUA 3TTEA 4QITA 4A05A 3A4WA 4I90A 2VEMA 4UTKA 2JALA 2ZA3A 1BXBA 4L56A 1VFTA 5C54A 4GY1A 1XIFA 3UJFA 1W1VA 1HP5A 1KN0A 1EBGA 1MI3A 3LBCA 3UYCA 1X98A 3T9PA 4MKSA 4AX6A 3NZPA 1V7YA 1B30A 1A80A 3AHYA 2EJ1A 3RJYA 4HN8A 3GDRA 1M1BA 4H4QA 2FJUB 3QPEA 4Z08A 3W88A 5CJMA 1KCZA 4XAGA 1KRAC 4UCGA 3T81A 1KQZA 3WQOA 2IKHA 3FEMA 1I75A 2XGZA 3AICA 2G4JA 4RE4A 3AAMA 1V8EA 2X41A 4KGJA 4NU7A 2ZX8A 3USZA 1J8VA 4APNA 3KFTA 2BOEX 4XZLX 1GYMA 1J4EA 3K8MA 3RG6A 3WJXA 1TV3A 4NASA 1VH7A 2UY2A 5EMYA 4HNVA 3H6OA 1Q6GA 1RPXA 1P1XA 3E0LA 5U7SA 3H7VA 4GOAA 3W3OA 5PTDA 1M65A 1SZRA 1W3JA 3ZJ6A 2BY0A 4EM4A 1ZENA 4LAUA 3MU7A 2CZFA 3GC4A 1EXPA 2B31A 3CMJA 4HZ7A 3MTWA 3M0XA 3MZ2A 3RM8A 1WYIA 1KGXA 3UFYA 2FZDA 1Q6RA 1NFGA 3CM4A 2X0SA 4Q22A 1XD1A 1TIWA 3GRSA 3S9YA 2J8GA 3KDOA 1X6UA 3TYUA 4E4UA 1HKJA 3W01A 1A5BA 1XDIA 1W3KA 4JX6A 2A5HA 3ABOA 1NP0A 2VC6A 3AYTA 2BBFA 1S2CA 5A95A 3F2CA 3P60A 5DRIA 5KEZA 4UTMA 4YTSA 5E0KA 5HBFA 5E09A 4DAIA 2QAFA 3WL0A 1FWAC 2NQLA 3N34A 2PLJA 3KLLA 1X6NA 1KFWA 3PSWA 2E67A 1W9XA 4IF2A 2XGIA 3HQ1A 1UP2A 2XH0A 2VFIA 4AWTA 4I5RA 4Q6JA 4Y9OA 4OJYA 3WNLA 2WPFA 4L61A 4FSAA 2D20A 2Z4GA 3O1NA 5CZKA 1MSSA 3GZAA 1CLVA 3HOJA 4KCWA 3MJYA 2YA2A 3W1QA 4QLKA 1K6WA 1LP6A 4ERGA 2GVGA 3QKEA 2DDXA 1XC6A 1RJQA 4N6FA 3W1UA 3U5UA 1WDRA 1G67A 1JQVA 2Q71A 2UY4A 1YDOA 4M3PA 4WY0B 2WLZA 3P81A 1Q2RA 2PD9A 2GSEA 4C7FA 1S39A 3GHTA 4BI7A 3GVRA 3CWHA 3TYZA 3W24A 3B0VC 3SRDA 4PTXA 2O9PA 1ICQA 1VQTA 3UEQA 3PUDA 5KINA 3BLKA 4HNTA 4IIDA 4JZ5A 5ER0A 1X39A 1KTNA 2V82A 3CZJA 1ZBVA 2V5KA 1FP9A 3AROA 1FDJA 2GUUA 3W6YA 3V7PA 3E2QA 1S2VA 3BLOA 4I5XA 1C8QA 1GOOA 2EJAA 1XSIA 2DZUA 2PC4A 2EPNA 2GR2A 3ZQ9A 1AQ0A 3CIVA 1C8YA 3ATYA 3B0PA 2YXOA 3APGA 1DYSA 3AXHA 3ITOA 1J0JA 4BQ4A 1QPRA 1XIIA 2NQ9A 4YCOA 2OZ0A 4IL2A 1Z41A 2Q8XA 1W9DM 2F5ZA 4HYVA 2VFDA 2AMXA 4MOZA 2QJIA 3PSVA 1QI3A 4AIOA 3W76A 5J04A 1CPUA 3IIPA 4U5KA 4AU0A 2PA6A 4M81A 1MNZA 1P0KA 4HCHA 1AA1B 4HIBA 4BEQA 2H3BA 2QCEA 2YXGA 3C2FA 3MVTA 3LXAA 3LB8A 4LCRA 5HNRA 3O07A 2Y5SA 3OGVA 3TWAA 4GX9A 3KRZA 1V6UA 1FWFC 3ZO9A 1LUCB 3UZJA 1H61A 2DVUA 2FZNA 4PEEA 4FP1A 2OYMA 4PMRA 2PDNA 1OC6A 4AD2A 1Z42A 5CAKA 2C3ZA 3E96A 1E6XM 3GC2A 3PPFA 4GIYA 2GJXB 4NZ3A 2VMFA 3GNDA 5EA9A 3SRHA 2WKGA 1UH2A 1FXPA 4TU1A 2CWXA 2GQ3A 4ATDA 1A5MC 3K8KA 1OZMA 1NY1A 1GKPA 1KB3A 3EDJA 2X1IA 4X9YA 3UY7A 3SY5A 3LTYA 1IIHA 3GWQA 3PNUA 3HO8A 5G1MA 3TYBA 1AW1A 2BY1A 3WIJA 3G18A 3ITCA 3AYVA 3QR1A 1Q63A 3B40A 4WR3A 3T78A 3H22A 3PULA 2BODX 4D71A 4X2PA 1KGUA 3KDNA 4R9OA 4ZO7A 3SJ3A 3BAJA 3CGCA 3EXSA 3BG5A 3WNOA 8XIAA 5I09A 1I2PA 1TE1A 3O3RA 2X8RA 4J27A 1Z32X 1UR8A 4NZ5A 1Z48A 1N8FA 1REQA 2E9BA 2QPXA 3T0BA 4DJDC 3PK7A 3LHZA 3WK0A 2CZVA 4FB7A 4Q4MA 3OLEA 4JN6A 1F73A 3G5EA 5LNWA 3PJXA 4WJXA 1W91A 2WCSA 3ITLA 2G3IA 1EX5A 4YMZA 3K1DA 4BJHA 2G5WA 3HPXA 4XISA 1DWIM 3F4CA 3LCGA 4ACZB 1Y8BA 7REQB 1EJSC 1XRTA 3EOSA 4AWEA 3MP3A 3T7VA 3FAWA 1DJNA 1OC5A 1MUCA 5LXEA 1SO4A 1WZLA 2X05A 4XG1A 1GTHA 4ZTXA 3IV8A 3S2JA 1KM2A 1A5CA 4EXAA 4FR1A 5DT5A 1T99A 4D1IA 4KGLA 4EQRA 4N42A 3AS1A 1AMKA 4IIBA 4KWVA 4XTDA 3GG7A 1AODA 3IJ7A 1CXLA 4US5D 4DJFC 3EBVA 3NQ8A 4H4IA 3B8TA 2V5JA 3RX4A 2WPEA 1QPOA 4O54A 3GDTA 4V28A 3UG5A 4FLOA 5FAGA 3LPPA 1WAWA 1VEOA 3NL2A 4NILA 1WUEA 3QMRA 3MKKA 4AZBA 1Q85A 1PEZA 2PWHA 5HXMA 4AB4A 2E09A 2QCFA 1DL3A 3CTTA 3NO3A 1ZQ5A 3W1LA 2PBOA 3NQEA 4O15A 1R2SA 3NVZB 3DBPA 3C8NA 1QI2A 5D02A 2G3NA 4NXSA 2JGYA 1XLLA 4Q6XA 4AFYA 1OINA 4Q8NA 1A3WA 1FH7A 4KEZA 5D8WA 1XWYA 2R1MA 1XIHA 3LOTA 2OU4A 5LIUX 1ICSA 1IHIA 4XD4A 7CGTA 3R10A 4QDWA 3SSJA 4LVBA 3QSTA 1WDQA 1OD8A 4RZ4A 1D7KA 3WQGA 2WO5A 2D2OA 1I2QA 3HV8A 3NM3A 3SCNA 1GRBA 5H6HA 4W7WA 1AW5A 2GJRA 2XDFA 3H7UA 3CAQA 4CQ8A 1XUZA 2Z00A 1KBLA 2VJXA 5BXTA 4S23A 1E70M 4DHGA 1E55A 2J9ZA 4FHAA 3S6OA 1JRPA 3BW3A 2W0UA 3O0KA 2WNZA 1JD9A 4QHRA 1BKHA 1W5NA 3HV9A 4JTKA 3IIVA 1A4MA 4MKVA 5EBUA 5E6YA 3WNPA 4DJFD 2V5DA 1K1DA 1W5QA 4O28A 1XR2A 1MDRA 1IE7C 3H55A 4L4OA 2R1PA 4R9XA 2A7RA 1UH3A 4PMOA 5CPMA 2ZTJA 3EMQA 2W91A 1JJKA 1TV5A 4AHOA 2VX6A 3JW7A 4GJJA 4C60A 2R1LA 2VCAA 1T7LA 4NNBA 5G1YA 4REQA 3M64A 4RDWA 4GLEA 2R91A 4WUIA 2DIEA 4YWIA 4S2BA 3WK1A 3P0WA 1RZMA 1E0XA 3AIUA 3CZGA 4GNVA 3G1DA 4AEOA 4A3RA 5GQBA 4O57A 1UPMB 1WE5A 1L6WA 4JFWA 4N9DA 3I3EA 3RU8X 1AUSL 3C4UA 1XH0A 1YBQB 1UROA 2XPKA 4AIUA 3S1GA 3TNBA 5DXXA 3T08A 3MSRA 1C7SA 3WQEA 3YPIA 2Z28A 2E5CA 5HINA 3GW0A 4HPNA 3IUIA 4HCLA 1RALA 1X97A 3MYPA 3AHZA 2HBXA 3DGZA 3B03A 1FWCC 1H2IA 4IMGA 1GKRA 1XRVA 4KWUA 3H23A 3U7VA 1B1YA 4NKCA 3H70A 2YBVA 4MUZA 1JRCA 4PMUA 4O17A 4TVWA 3WF2A 5U4NA 4UB9A 4MHBA 5F2GA 5C2GA 3CNYA 1W8GA 5KVIA 1XBXA 3R13A 2YIHA 3AIVA 1NU5A 2ABAA 3BE7A 5K3VA 1K8XA 3H2AA 5LNRA 2XIIA 2VX4A 4KCVA 1UQZA 4MWAC 5DCEA 1D9EA 3EX4A 3L0GA 3NS1B 2QV4A 2WJFA 1PHQA 4UFJA 3GTHA 4QG6A 2GZXA 4IHCA 2NLYA 4NJJA 3OG3A 4XSMA 1L2UA 1TMQA 4LAZA 2PGRA 3ZWSA 4JEJA 1DTNA 4WDXA 3IUHA 1FDYA 4O1FA 1PCKA 3BDKA 1US3A 1R6WA 1VJZA 2C0HA 1IXQA 2V2CA 2BTMA 4H3DA 1N63C 3VD4A 4PODA 4B9ZA 3NEHA 2RKXA 4GK8A 2GYIA 2QDEA 2E5BA 2Y88A 3ZT6A 4IFRA 2P76A 3T55A 1TE6A 1ZPTA 4HHLA 3S6DA 3PF3A 2FH8A 5F2IA 4AHQA 1G94A 3OVQA 2Y0FA 2X50A 3N17A 1ZB5A 1XRSA 3R79A 5G5IA 4RNIA 1UPPA 2WPBA 4HSNA 3UR5A 4LYQA 3ABZA 2ZRXA 2OT0A 1JCNA 2B7NA 4FX7A 4P8WA 1X2GA 1E6NA 3LMYA 4HZ8A 4DNMA 1MFVA 3BV4A 3VX0A 3ARRA 4FNUA 2POZA 1V02A 1VFSA 3BSGA 4GIEA 4TIMA 4LSBA 3DYPA 2J9XA 4IMFA 2RFGA 2VDHA 4A29A 3ARPA 5DELA 1EJUC 3ITXA 5DCBA 3TCEA 1LQ0A 2G0WA 2HZGA 4LUYA 1DJYA 3DFSA 3QLLA 1YPIA 3BOFA 4OE7A 2HS6A 1HIZA 1LROA 2CHNA 4PCTA 3PAOA 1T41A 1DQUA 4O53A 2I56A 3DYMA 3R4IA 3LERA 5FMHA 2GWGA 3TZNA 3WDJA 2X09A 1TPFA 4MWAD 1AW2A 3CUFA 2OO6A 1NJJA 3DGBA 4UNIA 4N2YA 4RNJA 2XFRA 3EWUA 1H63A 4YL2A 2HPIA 2ISSA 3GLCA 4QE4A 2QCLA 1ADOA 5F4WA 3ZMRA 4WD0A 1M04A 5EB8A 3TTYA 1YTDA 2G37A 4PCFA 4B90A 3IJDA 4N0RA 3PBVA 1JZ7A 2A4AA 4P7OA 1Q5MA 1MFUA 2B7PA 3CHFA 5AC7A 3HGSA 1EC8A 2F8QA 4LB4A 1KBBA 4QEEA 3IGHX 4W7VA 5LZLA 3ANVA 1V0KA 3SGUA 3FXYA 3IUDA 4WOZA 2D24A 4ZQCA 4KPRA 3DBNA 4MAVA 3UVIA 1VAHA 4K8EA 3TV8A 3S47A 5FF2A 4XZNX 3AS2A 1U1HA 4A4AA 2OODA 2NWRA 1ZY9A 3OVRA 1VFHA 1HF6A 4Q8PA 1F2JA 2A3CA 3LY0A 1V97A 1DOSA 3CT2A 2FZBA 4KRTA 3WJZA 3OB8A 1MO9A 3I4EA 4XZIA 5G4WA 1DIKA 3WK3A 2YSWA 3WLHA 4OBRA 3UXLA 1FWJC 1GYLA 4B16A 4PBEA 2WMFA 2PAJA 1E1EA 3B8WA 4WLCA 4IFOA 1GVOA 3CU2A 3HN3A 1DJXA 4H7VA 4F2UA 2A3BA 2F2KA 3S1UA 5CBIA 2ACQA 3VM7A 2NXGA 4ILSA 4XVDA 2BY3A 4J3UA 2ZRUA 3WEOA 1Y5XA 2EG6A 3E12A 1DXLA 2ATMA 3LEPA 4E38A 1PV8A 4MFDA 4Z1AA 1GRFA 3LCXA 3W1RA 2VEKA 3ARZA 3C2YA 2XIJA 2P8BA 1X8FA 3M0IA 1JOAA 3R7MA 1PHWA 4Q8VA 1YEYA 4CGTA 4QAIA 4W86A 1V0LA 2BGNE 1CGTA 3B04A 4FNQA 3WQ5A 1ISXA 4EPBC 2YZ5A 4Q7NA 2YDRA 2C1IA 5CCZA 4Z42C 1A3HA 4HHHA 2ZXDA 3B97A 2J47A 2OQYA 3CMFA 3AJXA 4UR9A 5E9AA 3VNZA 2UY3A 3N4EA 4C6OA 2GK1B 5D38A 3VU2A 4Q32A 1SW3A 1JZ6A 1I60A 1XP3A 2WMKA 2JKAA 3WNNA 4Y9MA 1NIUA 3N4FA 3ZWTA 5A6KA 4QG9A 1ISVA 4BQ5A 3C2EA 2QCDB 2FHCA 4JCLA 4PUWA 1O94A 3H53A 3WDIA 1H1ZA 4GO9A 4QCEA 2GPTA 3UR8A 1M7OA 3CPRA 4WZHA 3AXXA 2VFGA 4M19A 5CZ0A 4UC5A 2BVYA 4M6PA 1C90A 1WOBA 4A8LA 2OVLA 3RR1A 3ZR6A 2W54A 1VYPX 4KFOA 4Y96A 3W7CA 3DG7A 4QS6A 1OFOA 4P8VA 2TRSA 2WQDA 3TR2A 4H7ZA 4NNCA 1LRTA 5C9ZA 1JXJA 1WDWA 4MWAB 4LIIA 3CQKA 3A3HA 1UMYA 2D22A 5BRBA 4K39A 2CZ5A 2OX4A 4R53A 2G50A 2CNCA 7TAAA 2QCGA 4UMBA 5E70A 1A47A 4JTSA 3QPYA 2D1ZA 4AZ7A 3RNMA 3PR2A 2ZE3A 4AD5A 1JCYA 5CXPA 2GOKA 1OX4A 1PKMA 1NM9A 1A5AA 4RDZA 1K8CA 5BZAA 4M51A 3W29A 2WVUA 1Q8AA 1JULA 4O14A 2VZVA 1TUXA 1EBDA 2ZXQA 1W3HA 1GJWA 3AFBA 4JAWA 4POCA 3IJIA 3S5OA 1X1ZA 4WIWA 2R9RA 2WW5A 1RVKA 4L80A 1UG6A 3HZ3A 2R6OA 1E0UA 3OEXA 2Y4SA 1BYDA 2VKZG 1R7OA 4N9EA 4NAEB 1U5VA 4PCSA 4DPPA 2YAUA 2E8ZA 3VGHA 3E1F1 3S2LA 1EYEA 1RJRA 3UG4A 1E1CA 1FWWA 4C6QA 1HVQA 2DUXA 4ICNA 4U31A 2BCPA 4RZBA 1WXYA 1ML1A 4O52A 2D73A 1HX0A 2HE8A 3QV8A 1J0KA 2J7BA 1JDCA 3BCDA 2QCMA 4PUMA 4LBSA 3RGTA 2CCRA 4M1BA 2BMBA 1GQLA 1NHRA 1Y65A 3S83A 4F48A 4DO5A 3BSMA 3CH0A 3H54A 1DHKA 2VYOA 4ML4A 3NIYA 3N6QA 3OLIA 2F38A 3PS7A 4FNRA 4YCPA 2HJPA 1T8XA 2JQXA 3UZWA 1BQGA 4WY0F 2ODOA 4S3CA 3W74A 4LVFA 5FS6A 1WKFA 2J7CA 3NJ3A 4LNCA 3WLOA 4W84A 2WWDA 2A2IA 3QYSA 4EOUA 1BAGA 4P2VA 3O0FA 5A1AA 1YX1A 1OYBA 5BMXA 4ZOBA 3WN6A 1VC4A 1P7TA 3VIMA 4DF0A 6XIAA 2I16A 1NHSA 1DJIA 4C6EA 4REQB 3DG3A 1TJRA 5GNZA 4WF7A 3G1RA 3VOIA 3KX6A 2VVSA 4MNKA 5CC6A 1F74A 3CK5A 2C71A 2J6XA 3QMSA 4ZB0A 3WZ0E 3AS3A 3SJNA 2QCNA 1OGSA 3CJPA 2W61A 4FAMA 4U5IA 3MO7A 3LV5A 1XIDA 3R8HA 4BY3A 2ZA2A 2YFNA 5G2IA 1O6IA 3KRUA 1IT0A 1CLXA 5ECVA 1GGOA 1JRBA 4FALA 1JZ3A 4GQRA 3MSYA 1PX3A 1NAL1 3A12A 4TMCA 5JBFA 1XW8A 3WF4A 1XBZA 5FEXA 2EPHA 4X22A 4GKLA 1S46A 1K9DA 2GGEA 5EMJA 3DHUA 4V27A 4DWSC 4A3UA 4AQLA 4BZYA 1MZHA 1NQ6A 4KESA 4XIAA 4H6RA 3U3HA 3BZGA 3MUXA 4Z0SA 3GH5A 1QNSA 1MXDA 4XO6A 5D03A 2PDWA 1ZTVA 1XLKA 3OZMA 5A5WA 3AHVA 2O4QA 1VIWA 3KBNA 3EKGA 3SQMA 3WH9A 3PJUA 1V3JA 6TAAA 4WOQA 1B31A 3KUMA 1Z89A 3CT7A 1QAPA 2OJPA 1TWDA 4EVZA 3BLIA 4I7UA 4KEUA 3SCRA 4W85A 1SW7A 5CQ1A 3C2OA 3I6EA 2G3MA 2EQ7A 2NV9A 5AHEA 4QJ1A 3EYPA 4O1EA 3P8IA 4BF7A 5I3JA 3RF9A 2D23A 4NZFA 4A6GA 4OBTA 5A8GA 3VKBA 3U6WA 4IQLA 3W71A 2DZTA 4GYPA 1TTPA 3QOMA 1HG3A 3BGGA 2XU2A 5D9NA 4ERAA 5TBOA 1KFKA 1ZCCA 3DG6A 1HO4A 1RD5A 3M43A 3NPUA 4EE9A 5U1OA 2FLIA 4AD1A 4GFSA 4LEFA 3PZQA 4GPNA 3EWDA 1WDDA 1KRCC 3QZAA 3TN6A 3CHVA 1EHNA 4HK7A 2NWSA 3L0NA 3R0DA 4MDPA 3SO7A 5DF0A 4KEVA 3RU6A 1TPC1 1TR9A 3WFZA 8CGTA 2RHGA 3MA8A 4ZOAA 2XVLA 2BVWA 3OIXA 2WSYA 3MP4A 3CZEA 5CBJA 4OHQA 3WH7A 3WF0A 4GQQA 2DFAA 2D2JA 4IFKB 4TVYA 3GU1A 5I3KA 3GVWA 1ITUA 4B15A 4DO4A 5D33A 1NWSA 4L6OA 3NAVA 4DM2A 3IJ9A 1OJTA 1SFLA 4ZFMA 2FKPA 1SB3B 4DWSD 5HATA 3I10A 4MF4A 4ECLA 4DJEA 5BXPA 3S8HA 4KF1A 1V79A 2ZZ4A 3OQ8A 2ZRYA 4BFAA 1GWJA 1JPHA 2OKOA 1GVSA 2CBJA 3ISIX 1CXHA 2GR1A 2V6OA 4DNHA 4H01A 1GUVA 4HYWA 4WSKA 3GFXA 3O6DA 1J93A 2F6UA 1L8PA 1BF6A 3WD0A 5TD4A 2OSXA 2CBUA 2ZUVA 1KM4A 1N61C 1BG9A 4J56A 4B5WA 3TTOA 1BFNA 2OZ3A 2EQ8A 4AZHA 4GUIA 1FVPA 1J0HA 2ATSA 2J25A 5K9DA 1SO3A 4L1WA 4Q8OA 3EA3A 2VRQA 4TMBA 1OYAA 3R0KA 4IGHA 4LS2A 4ZQOA 1RCQA 4HU3A 3GNRA 4PCPA 5AVNA 1GVEA 2BG5A 3WDRA 4B3ZA 1CGXA 2FZ8A 3DFTA 2D69A 3VOGA 3ZSSA 3AU6A 1OF6A 5EPDA 4DYJA 4J57A 3FOKA 3RYSA 4K8GA 4OGZA 1H5YA 3MCNA 3KE0A 1GQJA 3DFYA 5JH2A 1HQTA 4JTUA 5M03A 1GOKA 1E15A 3NZRA 3TYCA 3A5VA 4KH2A 3VNKA 1V7AA 1NDVA 4X63A 1I2RA 4EACA 2E77A 3CV1A 8XIMA 4M7SA 4Z2LA 4IISA 4GXMA 2V63A 4I7VA 2DT0A 1Z8AA 1HGWA 4GCAA 3WUBA 4ZB5A 3VNJA 1CIUA 2Q3OA 1CDGA 3W38A 3IGXA 1TVPA 2RJHA 4AW7A 1A3XA 3DZ1A 4W8LA 1B9BA 3R12A 3CYJA 3PWGA 1WKYA 3UVAA 5ABEA 2Q8LA 1LRNA 4UZUA 4WKFA 1OF8A 3DU0A 1VGAA 2VO5A 3ARTA 1CXEA 3CUJA 2VT0A 3HPAA 3KL0A 2DW7A 2QMKA 3WQ8A 3RJXA 3W25A 2OSWA 2XVNA 3EOEA 1QT1A 2YW4A 4WDWA 1SFTA 5LGXA 1S2WA 4OECA 1KXHA 4GI9A 4UTTA 2DV0A 5LSMA 1KW1A 3QGAC 2TPRA 1YNQA 1ZU8A 2H8ZA 1RP9A 1A5LC 1FWSA 4KWOA 1X1NA 5DO8A 3TW6A 4AXNA 3VE9A 3ZJ8A 2JEPA 1RVGA 3POCA 5H91A 1NSJA 1DWGM 4GFIA 3K4AA 1B4EA 4XIMA 3LADA 3HMCA 3RPDA 3W0KA 7ODCA 3W7PA 1SSGA 2GOUA 2GDQA 4HK5A 4PB4A 2ZOXA 5HAOA 3UNTA 3NPWA 3NEVA 1XI3A 1QCWA 3BCFA 4ATWA 3EB2A 3KWSA 2QJGA 1AMYA 3C5QA 3T8QA 1KCLA 1BD0A 3R11A 5FJPA 4I9JA 1VLWA 5JH1A 4IP4A 2YYTA 2YBTA 2X8HA 3L5AA 3FJLA 3L2MA 1KRMA 2L5HA 3QFBA 1IXOA 2PLCA 3CGBA 2WBAA 2VGGA 1UR0A 2WJEA 1OFAA 3LYEA 2ICSA 1B3XA 3DCPA 3O05A 4JTDA 5CC7A 2JFEX 2FYMA 4Y9NA 1GZ1A 2DT2A 3MHGA 4B4FA 3AXIA 5JVLA 1UKSA 1WX0A 1KM6A 4DWSB 3CEUA 1T40A 1QMLA 3I4KA 1Q8JA 4M80A 1PDZA 1IR1A 1A50A 3UZYA 1CZ1A 4UIOA 6REQB 1TA3B 1HL9A 3WLRA 4E4FA 3W26A 3GHUA 2KAUC 4PMJA 2Z2AA 4Q8TA 2ZWYA 1T5AA 4PC8A 3EA2A 1R3TA 3QGVA 4MPKA 4GRSA 3A6OA 2OZTA 1J2BA 3NTYA 1DE6A 3WQVA 3L4WA 1TUFA 2Z29A 2HK0A 3EWCA 4HA1A 5D2XA 3P7YA 1PAMA 3QY8A 2QVNA 3W23A 3SZ8A 2J9YA 3HB9A 1TB3A 1TPEA 4E8GA 4KIRA 1M6IA 3EKZA 2HQMA 3EZ4A 1OX4B 1PWLA 4NT0A 4C1NA 1MW0A 3HPZA 3QV9A 5HQEA 2VR4A 4ZSUA 4ICMA 4HSOA 2XN0A 3FA3A 2OEMA 1LBFA 5AHIA 2WJDA 4IJRA 5CPQA 3CQ0A 4IX0A 1XH1A 3W2JA 1MXGA 1OCNA 1NDZA 2WM0A 2WSKA 3M0ZA 3WLMA 3PTKA 2Y85A 3QV6A 3W37A 1RBLA 4UZSA 1IGSA 5REQA 1GRAA 4OWGA 1XINA 1MO0A 5LIWX 2XINA 3CLMA 5C6MA 2BHZA 3AIBA 1EUAA 7ENLA 4DZ5A 3LCHA 4W4QA 3IK4A 1R3SA 3CASA 3ZVHB 3F5LA 2W92A 3NA8A 2VWTA 3THDA 1G0CA 3QR3A 3BAIA 4PUDA 4KQNA 3ZLHA 3PBGA 2WSRA 1O68A 1BQCA 4QQUA 5HR7A 1N60C 4IP5A 1AL8A 1QO2A 3GG8A 4JL2A 4C1LA 3COTA 4BF9A 3JU2A 1R3YA 4DZIA 2YGYA 5D32A 1V08A 4UOZA 1R46A 4K3ZA 5B80A 5CG0A 3ABXA 4XKYA 3BARA 4WVXA 4GH1A 2ZZ6A 3TDFA 3C0JA 4D6JA 2VRKA 4O4VA 2IPJA 4MB1A 4HD5A 1QFEA 1ONRA 5FJOA 4YTTA 2RDTA 1JZ4A 3W73A 4WGHA 3C3UA 2XTKA 4EXQA 2UV8G 4CUCA 4AC1X 2GFTA 1F76A 3PZOA 3C0SA 3U9IA 1HJUA 3AALA 1PBGA 3GY1A 2I5GA 2WSQA 1EX1A 2CLEA 4GI8A 2E7FA 1JDFA 5I2UA 1X1OA 1TV4A 1U1UA 4NJKA 4NUWA 2GGIA 5C55A 3E38A 3KOFA 4Q33A 2PD5A 3QKZA 2INFA 3WG6A 1GERA 2RDXA 2FTWA 4NXKA 5I03A 2YDQA 1GESA 4A35A 5EBKA 4H4SA 4A21A 1MW1A 3GW3A 4D6HA 2PODA 3VKDA 2QNEA 1E0WA 4TQTA 4BURA 3CAVA 3CYVA 2PZ0A 3ARYA 5TQLA 1ZP4A 1RD6A 2PFHA 4ADWA 5D05A 4LAKA 1B0IA 1RSCA 3NOEA 2ZXBA 1M5WA 4G7EB 4WCJA 3E74A 4UTHA 2WBGA 1TIMA 2QR6A 4CCDA 4HOWA 4F40A 4ZSTA 2ZBTA 4ROPA 1CB2A 2WB5A 3AHTA 5T26A 3R8RA 3M5XA 4C5ZA 4FNSA 3SI9A 3GE7A 2C7FA 3DK8A 4BK9A 1LRQA 3U5YA 1LM1A 1JYWA 3S6TA 5FF3A 2V3BA 1VPQA 2YCKX 1JFHA 2QIIA 1W37A 3W2MA 1C93A 1WZMA 1JZ2A 1GQKA 2QAPA 1NHPA 4L9ZA 3L5MA 1WB0A 5AOUA 1M6JA 4C6DA 1OCJA 3WMBA 5JIPA 4TO8A 4PRTA 1W0MA 1R86A 1TZZA 2VZTA 5DY3A 3W7GA 2ZZBA 1Q6DA 1NELA 3PTMA 1OFEA 1U1JA 3E0WA 4O19A 1EC9A 3SM0A 1UP0A 4AZ6A 6CGTA 4EQSA 3ECQA 2HNHA 1O66A 4QSHA 5E5CA 2HVNA 1FP8A 5C70A 2ZZ7A 5FS9A 1J10A 3IARA 3M07A 5IHSA 3LU2A 3RILA 4XB3A 1JIBA 1XSJA 3RCNA 4WX2A 1DEDA 1PWMA 3SIMA 5F7UA 3H2FA 5EMUA 1GCYA 2CZEA 2C14A 1MMFA 2HEJA 3R25A 1AH4A 3WF3A 4LF1A 3EPNA 4C6JA 1KFEA 3P14A 1FEAA 3O16A 2IKJA 3TAKA 1AZ2A 4HA4A 1SZNA 3R5EA 4QROA 4FOUA 3GXMA 4LU0A 1EIBA 4BCEA 2R8WA 4NYYA 5B7ZA 3I3DA 1G01A 1R5YA 4YTUA 3LQGA 3KRBA 4W8BA 1OGBA 3NVDA 4FLRA 1ZMDA 3HGRA 4CQAA 3QTPA 1VFLA 4QS5A 4XBKA 4QNEA 1VS1A 3KBVA 3U7BA 2A7PA 4JQ3A 4D8ZA 5AYIA 4MZYA 3L2IA 3KRSA 3MP5A 4H9VA 2O4MA 5KSWA 3CUGA 3FSUA 5JRBA 4CEUC 4RV8A 3DK9A 3AYRA 3ID7A 3QM3A 3VIKA 1D2KA 3ANYA 5EKYA 3T07A 3BICA 2E3TA 1JGIA 3NYDA 3KOWA 1W1ZA 1VYSX 1UASA 5JU6A 2V67A 1V6TA 3GM8A 5MKGB 3GRIA 3MUY1 2WOWA 4ZE5A 1WZKA 1DXFA 4NHVA 3LXBA 4ZOHB 2VXNA 2XVPA 4CD8A 4UTWC 1MOKA 1XLIA 3UWZA 4ZQRA 3NGFA 3DIPA 3UT0A 1ZL1A 4EWJA 3NVVB 3EKLA 3AS0A 4H2CA 3QN3A 4MDOA 3A3WA 7XIMA 1HUVA 5C71A 1W8SA 2VCBA 5E1QA 1SJCA 2VUNA 3CZ8A 3KOYA 2EXOA 2FHBA 1OG6A 3W07A 3LCLA 5CBBA 2EQ9A 3P5YA 4IWWA 1F6KA 5M1TA 3G6MA 4EF9A 1FWHC 2PWVA 4H19A 8RUCA 1AJ2A 4IQJA 3ABSA 4KCTA 4F0RA 3KS6A 2QDDA 4HSHA 4U3AA 3GDKA 2DIKA 4KWSA 3ARVA 1Q6FA 2PDFA 4NZCA 2FH6A 2YVJA 1SJDA 3O8AA 1ZK7A 3BAKA 3L12A 2F2HA 1PZ2A 5IM51 3MS8A 5T91A 3WX7A 3F03K 1ME8A 5KZEA 1V3KA 4PBGA 4RDYA 1GOIA 2Y6ZA 3L4YA 1UR3M 1ZDLA 4WJ8A 4DLMA 3VD3A 1DKWA 3A22A 2DSUA 2Y24A 3NL3A 1PIGA 3V18A 1TPB1 1JPMA 2IPWA 4CQCA 1JG9A 3GXNA 2ZUMA 3V1PA 4GY7A 5FF0A 1E9ZB 2VZSA 1R3QA 1EJRC 1GSNA 2QVHA 3S1WA 1U33A 2DUAA 3E0FA 4GABA 1DORA 1TJ2A 4ZO9A 3IRDA 3FKKA 5I3HA 4HA0A 4IIHA 3VUPA 2G4FA 2VI0A 1KFCA 1XG3A 3RDKA 2IMRA 3BC9A 2WZTA 4UQ9A 5E0CA 1IEVA 1QRQA 1QHPA 3PFRA 1UR4A 1ZP3A 3EX1A 3OP2A 3UYIA 3KOXA 3H2MA 2DZXA 2YDAA 1KM1A 4R27A 4V1XA 2ALDA 2H6RA 5KZMA 2GJLA 1CBGA 3UGVA 4LUTB 2QMJA 1W54A 1CT5A 1U5HA 2FZMA 4H4YA 3EWXA 3U2OA 1LOSA 4KT2A 1WUFA 1FWIC 2Y7GA 3TN4A 3N15A 1PYMA 4JHOA 3T09A 1M53A 3BPWA 1VCVA 3APTA 3GNPA 3IJ8A 1XIBA 4G6CA 4KETA 3VNMA 2JF6A 3BURA 2GVYA 3DI1A 2YDSA 2PDHA 4KRZA 1ITCA 3HQNA 1UD6A 5G2HA 1OX5A 3TWBA 3ONCA 3OVPA 1SMAA 2PP0A 4H6KA 4L1GA 4B3LA 4DUVA 4QE5A 4Y6GA 1RP8A 2HSAA 2IXVA 3S5SA 4HCDA 1QXLA 3UWQA 1XL9A 3EGJA 2XFFA 2VZOA 2PPGA 3K2GA 2C19A 4J3XA 2DT3A 3TYEA 2Q02A 1QUMA 1TPDA 5K9CA 3F1QA 2E6AA 3WEZA 5C0QA 3SB0A 3WSUA 1WXZA 3HGOA 2CXEA 4IXHA 1WQ5A 4DNAA 4MYXA 3MPGA 4WY0A 5CPNA 2UY5A 4GQ0A 1F6PA 3NQFA 4UWMA 5I02A 3WBXA 3KP0A 5CGQA 2C3CA 2XVGA 3EEZA 4TTGA 1XLMA 3MKVA 4LB3A 4DZAA 2PC8A 1LG1A 1BGGA 2HK1A 3GR7A 2ZUNA 3W9ZA 5GJMA 1XQKA 3NZ1A 1LL6A 3ETRB 3W7KA 2NVDA 1R47A 3FXGA 1LT7A 3HA1A 2YLLA 1QPNA 1JCJA 3ICJA 1OYCA 4F4RA 4CNPA 4IMDA 4GWEA 4LVDA 1A5UA 2QKFA 4NI3A 1Q13A 3K4WA 3FG2P 3BH4A 3AWOA 2J62A 4C1NB 3RPTA 3QQWA 2V0TA 3CIWA 1L9WA 4JIRA 3P93A 3N9SA 1Q1WA 2CKRA 3RIKA 2DORA 4GO8A 3FJNA 2EQ6A 1D8WA 3KL3A 4JIHA 3CGEA 4GX8A 3W70A 4MG4A 2VX7A 3VFLA 3ALFA 2OT1A 3F2DA 1W3TA 1EDTA 2CHRA 1SM9A 1LLWA 3L4ZA 2EPMX 3CWOX 4NY2A 3UERA 1IZCA 4LUSB 4L4LA 3URBA 5FEWA 1NDWA 1KV8A 1XSKA 4LNYA 4L1XA 4AUBA 4EKJA 5I3FA 3RR4A 1XF0A 4PGLA 1C3FA 3RNDA 3ITGA 1L0PA 3CQIA 4LALA 3TLQA 1RLDA 1LUCA 2QCHA 3UZXA 1C8XA 4LAOA 5AC4A 3OYZA 5IXEA 2E40A 2NPXA 1VP5A 3GG0A 2PWDA 2ZUTA 3M5VA 4A22A 1EP1A 1FO4A 3KAOA 3A21A 4C6BA 2OOFA 1JNEA 4M52A 3HURA 1B90A 2Z24A 1S3TC 1HL2A 5HMEA 3KBMA 1KBIA 4HA3A 4XKYB 1VBGA 1A0EA 1L6GA 1RV8A 3LSBA 2BY2A 2GSJA 1W2VA 2E1WA 1DJZA 3GR4A 1NF7A 2FTYA 2YFOA 9RUBA 1XDMA 1QWGA 1KQYA 2ESCA 2GL5A 1QBAA 1OK4A 4JTLA 2FVMA 5BWAA 1GOXA 4J2PA 3GHRA 2TAAA 5H8PA 1UBSA 2Z6IA 4HHPA 5JBEA 4HNOA 2F9RA 3T4WA 1XRFA 3WH6A 1XPGA 1FWTA 3L68A 2CHOA 1YRRA 3LK6A 5JUVA 4JXCA 1VPXA 4FNPA 3G22A 3AIRA 4Z0JA 2PRLA 4GJ1A 4QSFA 2WV8A 2WYSA 3DC0A 1XJBA 3R07C 1PZ0A 1ECQA 4AD4A 2DH3A 2IQTA 2QGYA 1LQ2A 5C5YA 5TNVA 1J6PA 3WLJA 2OGYA 3SN0A 3VIGA 4YWSA 4PRRA 3H4GA 3QPZA 3EX3A 3G8RA 4N9BA 3LB0A 1E1FA 4ACZA 4XAFA 3PY2A 2VR2A 3EX2A 3LV6A 1VBUA 1QI5A 1EPXA 1KFJA 4Z2HA 4OBSA 2J27A 5BU6A 3U2CA 1VEPA 2OMAA 1EA9C 4B5XA 3ALGA 3G1VA 3L7RA 1UIOA 5HULA 2WVVB 2NT0A 4I6VA 1TVNA 4XQ6A 4PSRA 4YIWA 4JTAA 2NUWA 3ARSA 4S39A 2PP1A 2BHUA 4M24A 2YVFA 3AZTA 2AOSA 3S2CA 1E43A 3H2OA 4PUUA 3MT1A 1XYMA 5TF0A 1BVWA 4RW3A 1W2PA 5CG7A 1W32A 2PDUA 1BYAA 4IL0A 3ZR5A 2Z1BA 3M7SA 2F61A 3HU7A 3ZT5A 2C13A 4HU8A 5ABHA 4Y7EA 5EMMA 2C3DA 3UG8A 3VIHA 4C1KA 4K1GA 3MANA 3LPGA 2EHHA 3L4XA 3MW7A 4L5ZA 5GNYA 3H4KA 3NDYA 1Z6KA 1XBYA 5I24A 1N82A 3GU2A 5CZSA 3A47A 2C8NA 3FHQA 2OO0A 3FCPA 4EPDC 3SQLA 4NRRA 2Q01A 1KXQA 4U3CA 5ABGA 5D2WA 2FVKA 3V35A 4XZ9A 2FMOA 3TUUA 4HK6A 5FOOA 2WM1A 2NX1A 5CGTA 3NPXA 2CYGA 2OELA 3TQ0A 3VC6A 1MEWA 3TCSA 1GVIA 5A8MA 1R85A 3IAQA 3P61A 3S9ZA 1VFOA 3UY8A 3VDHA 1XYLA 4ZXOA 1MQRA 3GB6A 2VC5A 1XX1A 2HMCA 3UU0A 2RABA 1Q7ZA 2J88A 1N62C 5H2ZA 1ZNNA 2E1DA 1J9YA 1EGVA 2Z2BA 2VQTA 3NDZA 5FIPA 3SY1A 4LAMA 1THFD 3VNYA 3W7MA 4YS1A 1KXTA 3LENA 5HJYA 1H7OA 4TV6A 1UWAA 1AD4A 1FH9A 3QGKC 4C6MA 1ZRQA 3VVGA 5D2YA 3O06A 3MDUA 3IGUA 1M7XA 3WH5A 4J3VA 2HWGA 2YXXA 1VFFA 1W1PA 4JQ4A 3CXOA 4CNTA 1SW0A 1WP6A 4NSBA 4G8TA 5FEPA 3NG3A 3HF3A 3VX1A 4L64A 3VXGA 1R2RA 3VM5A 3LHUA 3WJSA 4WGXA 4F0MA 2C1GA 2YBUA 5FCZA 2XH2A 3TX9A 4KFPA 1KFLA 3CUHA 1JL8A 1P6WA 4MJ2A 1UCWA 3VKKA 2ABBA 1NH6A 4K7VA 3WBYA 1GK8A 2GR3A 2B81A 5FS8A 1G4PA 1TSIA 3TH6A 1W6TA 2OYKA 1E4MM 3NQ7A 5JCIA 3RLVA 5I3DA 5DMLA 4H9ZA 2GH5A 1YBQA 4ASTA 3LNPA 1WCGA 1AK5A 2Y62A 1CGWA 2OZ8A 1SU5A 4Q8WA 4Z17A 2V38A 3I6RA 5LHEA 4E2VA 4EP8C 4UMAA 3VIJA 4LYPA 1EIXA 4AZCA 2O9RA 3QW4B 4PL1A 1K7XA 5I78A 2GQWA 3QFWA 4AD3A 1DP0A 2Y61A 3WQWA 5FJJA 1XYCA 1ZBKA 1I8JA 3P5ZA 5L6UA 1T3QC 3WKZA 4QNWA 2D3NA 4S3DA 3BV7A 5C7HA 3EXTA 3GFYA 2JIWA 1GHRA 2ZTKA 2A6NA 4GNKB 2WZMA 4HPXA 2NUYA 3F7JA 2R1NA 1TPUA 4US5A 4IIGA 3WNKA 3WLSA 2IXUA 1F8MA 3MUCA 4B2DD 2VDGA 3LTSA 2W6RA 2OLAA 4ICCX 1HJVA 1UZ4A 1ALDA 4JTFA 3U2ZA 1ICPA 2PLMA 1K7EA 3IJQA 4G7FA 1H6VA 3DFPA 3OTRA 5AKQA 1LOQA 1P43A 2O7QA 3ZOAA 2O9OA 4GZ7A 1X8CA 3EWWA 3RO8A 1B4KA 1QNOA 3M0LA 2OWCA 5KTLA 4JR5A 3KCOA 5HWMA 1POKA 3TKFA 3V5FA 2VWSA 5F1VA 4F0LA 1UZDA 4X9SA 3NQGA 4WDUA 2C15A 4L9XA 3MKCA 1G7UA 4IPPA 3VIOA 4GBDA 3S9IA 2HBVA 4HGXA 2FQIA 1R87A 1W3LA 3KCJA 1S2UA 4YVVA 3VCNA 3TSDA 2PRHA 2BXZA 1C7TA 2W5FA 4IGNA 3RN6A 2BC0A 1R7AA 3NXLA 3ZS4A 3REQA 3SR7A 5DRCA 1KA9F 4KFNA 1AZ1A 3KL5A 4MNLA 3IWPA 2X40A 3WL1A 1I1XA 2WCAA 1PIIA 3H4WA 3U0HA 3L4TA 1HO1A 1K7FA 1H0GA 2PP3A 1DXIA 3MI6A 4FXRA 4HNNA 4R33A 3MO4A 3LCIA 2WMHA 4F66A 3EA1A 4XBJA 3W83A 2OLHA 2FFIA 4CU7A 1P0EA 1RCOB 3OBAA 3W22A 1GRHA 3AXKA 1X96A 5GRTA 1HW6A 1HTIA 2VFEA 3HTWA 4F3HA 4EK7A 3D0CA 4B5VA 4JL1A 4I9TA 2MANA 3OZPA 1XGDA 2GSHA 2OQLA 5K9XA 1EA0A 4FMVA 4O50A 3UCDA 1VDVA 3KTXA 4HNLA 5M2FX 4PUKA 2WVTA 2ACRA 5CJ5A 4DJFA 1CI1A 5SWUA 2OGJA 4RNHA 3PG8A 4UTJA 4D6FA 1BTCA 2I14A 2GVEA 3LTPA 1IZJA 1HZYA 1FA2A 4JYFA 3INPA 3M41A 1LG2A 4KEMA 1GVQA 4AX7A 5G5GB 3POHA 5HUPA 1PX8A 4QM1A 3TTSA 5LHFA 4NEVA 1ODUA 1CYGA 2WMGA 1L6YA 5CPTA 1H1NA 2VCCA 4N7QA 2VX5A 4LEQA 1OFBA 3N13A 1VBRA 5DY2A 5AHFA 5KZDA 2Z27A 3RCMA 3FN9A 4HU4A 1KFBA 4YXGA 1ISYA 5I5RA 1ZBCA 2CLFA 4JQ9A 3VTRA 3OA5A 5KMYA 3QY7A 2ZRZA 4UQBA 2VOMA 5KETA 3QBUA 4D6GA 4GCXA 1XM3A 2NXIA 1QI0A 3ZXWA 4GYKA 4NZ4A 2IUZA 4XZHA 3LHTA 2A6LA 1A4LA 1NWTA 2V3AA 2PDKA 2INZA 4Z1YA 3XIMA 3EAUA 3CB8A 2WJZA 4IJCA 3ITTA 3PP7A 4LGXA 5BXSA 3VNIA 1HJSA 3VOJA 1OJXA 2ISVA 3BAXA 1I0DA 2Y1HA 1OFDA 5EGRA 4AMAA 4WQ6A 3FHAA 2PDMA 5ABFB 1G1YA 3B4YA 4XUGA 1JVNA 1DVJA 3SR6B 3CS2A 4DBDA 4QBXA 3TFXA 2A3HA 6A3HA 3BLLA 3FGCB 4HZMA 3WFAA 4Z2JA 4HMNA 1YQZA 2WPCA 1NP2A 3S5ZA 9CGTA 1TTQA 3TSMA 3LXCA 1QPQA 3TU9A 3N1AA 3LPFA 2J75A 2MNRA 1YTEA 1DHPA 4I9MA 1GJUA 4IOTA 1A53A 1UWUA 4RPPA 1W5MA 2VVNA 3NGJA 3WBEA 3NZGA 3U8GA 1TVLA 4S38A 4UFLA 4FS9A 3N19B 1T8QA 1GVFA 3GD6A 4FK9A 3D3FA 2NVAA 4IM4A 2GUBA 1ONEA 1M03A 1ZSXA 3DK4A 3THAA 4CN6A 2VM8A 1E73M 3QXBA 2GWNA 4X61A 2CERA 3NL6A 2FB2A 2WKJA 2VD8A 3HPFA 2O0TA 4KCUA 1FWDC 4W5UA 2Z7GA 2A21A 3VNLA 4H4TA 3MHFA 2AQVA 3H26A 1Y0EA 4LS1A 5JBDA 3QFEA 1M41A 1EEPA 2PDIA 2CFYA 3RRXA 1X2HA 3HJEA 1F4AA 1PX4A 1TX0A 2GK1A 5EFDA 1NDYA 3CL8A 2P1FA 3W81A 3RLGA 2FIQA 7PTDA 1VLIA 4HVXA 5HA7A 2P3ZA 1GXFA 4E3TA 3ZR4A 3LI1A 4O8RA 4PB3A 4U4MA 2Y8VA 4FXFA 1H3GA 4J4KA 2QCDA 3I7QA 4Y9AA 3W2KA 4D6DA 1EC7A 4HMCA 2J77A 4JDYA 1I4NA 1W3NA 2ADAA 3TR9A 3CUZA 2BS9A 1OG0A 5JCKA 3TNOA 3GTIA 3W7IA 1HGYA 3II4A 2V3DA 3GNOA 3R8GA 3T0DA 4IQDA 1S5VA 4QJ3B 1XLJA 2D2HA 3OJGA 1FXQA 4GXWA 1AVAA 1E6SM 5HMDA 1SMDA 4MWAA 1LBMA 3M6DA 1AG1O 3E0VA 4FLQA 1P6CA 1JUBA 1R9ZA 1FCQA 1QW9A 3DECA 3I68A 1V6XA 3UR7A 2VD9A 1JPDX 2Z26A 4QLLA 1E6PA 1I6NA 5HWJA 2OG9A 1W9BM 3IIOA 3DDMA 3UWVA 3UPMA 1BWVA 4P61A 5LA0A 3L65A 3QC0A 1JAEA 5ECUA 3H2CA 4GNJA 4NL1A 1H7PA 3P80A 2WC3A 2DP3A 2V3EA 3EXRA 4YVPA 3I3BA 3SCPA 4W5ZA 1FWEC 2FPVA 4EWND 1JYVA 5D2TA 1KO0A 4DJDD 2P5NA 3WBAA 2WK2A 2ZFAA 3BGJA 3AXMA 4F9JA 2WWCA 2XIOA 1DQXA 1QR7A 1RAKA 1K3UA 2BHYA 4NAEA 3AO0A 2HE5A 1VFMA 4W93A 3NZQA 2ZDRA 4GYFA 1HFBA 1YPXA 3NNTA 4U2YA 3WDQA 2PDXA 1GORA 1JF5A 1BWKA 3G3DA 1E9LA 5FF4A 3RRAA 4H9MA 3LCWA 2O9TA 3EDKA 2E28A 3GDLA 2VGIA 4WKHA 1U83A 1DWHM 1LWHA 4DO6A 1R2TA 5AHLA 1MEIA 3FVDA 3TMQA 4K37A 4K8HA 9XIAA 3M46A 4D72A 3LDVA 3W85A 3C52A 5AYBA 5E6ZA 3C86A 3UBPC 3DOPA 1XIMA 2ZICA 4XAPA 2W4XA 2XSBA 3NVWB 3TMLA 4TTUA 1M7JA 3RMEA 3A7AA 2E9LA 3NQMA 5EL1A 1VF8A 3N9RA 2WLYA 1OK6A 3WLLA 4DIAA 5D09A 3OYXA 1RJPA 1VBHA 1VPYA 1JR1A 3OPSA 2RH9A 2PE4A 2BB0A 2YQUA 3FLUA 1UC5A 1E51A 3KP1A 3T1GA 1OM0A 3BZJA 1LL7A 1N5WC 1EKOA 2DT1A 4QRNA 4Y8FA 3W1AA 1JEHA 5JCMA 1W31A 5HJLA 3PZTA 3SGGA 4EAMA 1HJXA 1PVNA 1RBAA 3VZYA 3FYPA 3MY9A 4MB3A 1J0ZA 3MI2A 4JHZA 4Q4QA 4MPQA 1IZKA 1OFRA 1DQWA 1V93A 2RDWA 1YQ2A 1FHUA 3G8EA 3TXZA 4JTJA 3QRHA 3VYLA 4ZB2A 4AIEA 2Q8ZA 4UOJA 2EF9A 3SUSA 1ZZMA 2ZZ0A 5I77A 4AZCB 4MMWA 1VCFA 4UQAA 1TRIA 4MB4A 3OODA 2HVOA 1EOKA 3NDOA 3ZJ7A 3EB4A 3EMZA 4HPGA 4FR6A 3WD1A 1EB3A 3GD3A 3H2NA 2J24A 4HBKA 5CKSA 2I9UA 3F4NA 1IF2A 1DBTA 3GKFA 3U2EA 2P8CA 3TW9A 2PI6A 4AH7A 1G4SA 2ZC8A 4P5UA 1PZ3A 4GI4A 4OTKA 2JK2A 3AZSA 4DUXA 3CV6A 3GVGA 5CPOA 4DRSA 2G8ZA 4GI6A 3R89A 1WXJA 2YCIX 2VURA 1ODZA 2WVSA 1V77A 4PSPA 1G4TA 1W17A 3GU9A 3PB0A 5C9WA 1D3CA 4RJEA 1X7IA 5DXYA 2AGTA 1QNPA 2IPGA 4LH8A 2CC0A 1OEPA 4ZOCA 3EOUA 1K4GA 4JY9A 4CNUA 1FWGC 2W79A 4DQWA 4V1YA 2Y89A 3GDBA 4ZQPA 2OWWA 1EGZA 5A8PA 1BHGA 1BXCA 3UD6A 2WHLA 3B8SA 3N04A 4R7OA 2X42A 2CLIA 6PTDA 1YDNA 1XLFA 1XISA 5DBTA 4L9YA 3HIJA 4UNLA 1ELSA 1HKWA 4DVOA 4BHYA 4G5DA 3VABA 4OUIA 1K8ZA 3W7OA 1ZS2A 2WSPA 2NSXA 2J79A 1ECEA 4PA8A 4PTVA 3QHOA 2AL2B 3REQB 3MSDA 1I0BA 3U48A 1PL9A 2VEIA 2NW0A 3GTNA 2X2YA 3FYYA 4EQXA 1L8NA 1DJHA 3XISA 3N14A 1XICA 1IWAA 2J8FA 3P0XA 4RZ6A 1FTXA 4IFKA 3FNDA 5HR6A 4DN1A 2REQA 5A6MA 3EMCA 1HJQA 3N29A 5A6TC 3JRKA 1P0DA 2XJ7A 2ZZ5A 3FVMA 1QHZA 3KS5A 5FJIA 2C0AA 5DMMA 1D7YA 2CETA 4QP0A 3GHSA 5EBAA 1H11A 4CU6A 1PYFA 4PBFA 4PYSA 1B54A 5MF5A 4BI6A 1QTWA 4JGDA 1XCFA 3UF9A 4H4WA 2X7VA 4LY8A 3B9JB 4IICA 4OIFA 2B0MA 2GJPA 4G1NA 2YVGA 2ON3A 1TYPA 1VJIA 3TXVA 3QJAA 4XO7A 5IDZA 5BRQA 5JQ9A 4RK8A 2IQDA 1XCXA 2XSXA 2DSVA 1XPYA 5A6AA 2PSNA 3K13A 3QH2A 3WLNA 1GTEA 5AB3A 2FHFA 1TPH1 1OC7A 2Y7FA 2X7WA 4F9DA 3OC4A 4MIMA 1BXNA 4C6LA 1XG4A 2X30A 4S3FA 3UG3A 4H4UA 3WQ4A 5LA2A 4EANA 3RM4A 1XS2A 1D8CA 3SUVA 5FAJA 3L5OA 3TONA 2QUNA 5G4EA 1KR0A 4JN8A 4UQEA 2I9EA 4DUOA 1K70A 4L7ZA 3DHPA 3PWAA 3MHUA 1OT1A 2DU2A 2QLYA 4NZ1A 2OEJA 3C6CA 3HBLA 4LWWA 1V51A 5G5HB 4G2DA 4IPJA 5A8NA 2AAQA 1VEMA 4H6EA 3VIIA 3VGDA 2HVMA 4DPQA 3DFOA 1E4IA 3AMLA 4O1CA 1AQMA 3S0CA 2C18A 1FRBA 1GZGA 3KW3A 3ABQA 2D2GA 1MUMA 3Q6JA 3D6NA 4DELA 1S2TA 2WZHA 3S42A 4XD6A 2R24A 3FX4A 5AC8A 3ARXA 2AKMA 2DZVA 3GXDA 4EMIA 2G3FA 3TC6A 1ME9A 4ZENA 3SADA 4UQCA 5K2ZA 1XLBA 4YTQA 4AF0B 3SCSA 5TAOA 4DXKA 3A64A 2VEFA 2PMQA 3GNXA 3W2UA 3CC1A 2FDMA 1OSEA 4US6A 1UD8A 5BNKA 4Z1DA 1WBHA 2CLMA 3NR0A 1IEIA 1AH0A 3UWYA 1ESWA 4HMEA 3FSTA 1VHCA 2EKGA 2BOFX 5IBXA 1E72M 4P8XA 3TLLA 5JCLA 2X16A 4JTGA 3KM8A 5CSSA 2GDUA 1B57A 1JGMA 2WHMA 3NUKA 3KVJA 4O8AA 4H9XA 1I2OA 3W7EA 1OCBA 3EEGA 2PTXA 1C92A 5J5RA 3U57A 3WUEA 5D37A 3IVUA 1TFVA 2E3ZA 5CH9A 3NWRA 3DESA 3B9OA 3SQSA 4ZBCA 3GKAA 3GXIA 3HFYA 3K8LA 2X0YA 1TG7A 3URAA 1ZAIA 1VYRA 4B5SA 1Y7VA 1GVRA 2PWUA 3UESA 3W1MA 1CXIA 1JDDA 4AVFA 4LCQA 2Q6ZA 1IT7A 2Z25A 4AC7C 2I5IA 1VBJA 5A6BD 2PF0A 1FUYA 3CTLA 4BWLC 2WHKA 3Q4DA 1UR1A 1YXDA 5U25A 2Z1KA 1H0IA 4XSLA 4H9YA 2PTDA 3L5LA 1XIEA 3FJ6A 3VFCA 3NVTA 1E0TA 3E5PA 4GKTA 2RUSA 3JUGA 3MSGA 4DWSA 3W7QA 3E02A 2ASHA 1G6CA 4J35A 1BRLB 3M0JA 4AYGA 3WCZA 1JCMP 3C0LA 3N2TA 4H4PA 4FEZA 3M5ZA 5DFAA 1FFQA 3GYCA 3DGRA 1PE1A 5EY5A 6REQA 1TA3A 1KBJA 2DIJA 3Q65A 1ISWA 2YCLB 2NT1A 2ZADA 3GH7A 1EF2A 3CWNA 3WBWA 1BZLA 3OBEA 2UBPC 3R58A 4M8UA 4H4VA 4KBXA 4MADA 4JOMA 1AH3A 2DH2A 3VDBA 1W1TA 1RCXB 4H41A 4S3EA 2ZUSA 3K46A 2Z1XA 4GZEA 4ML9A 1BEUA 3V3WA 8A3HA 3BLDA 3DC8A 5AHMA 4CVWA 2GQ8A 4DF2A 3LUTA 5D9PA 3MBDA 9XIMA 5EYWA 1X6LA 4LCSA 4F2BA 1N8WA 3W1TA 3V75A 1YPFA 1CGVA 1OT2A 2H9AB 1OQFA 3VZXA 2V68A 3T0AA 3DFNA 1KRBC 3OU8A 4EIVA 1ME7A 5LXXA 1J96A 3BJSA 1GVYA 3BG3A 4C6KA 1TJ0A 5A2AA 2ZWZA 3UJRA 4FDCB 4WXZA 3NQCA 1OD0A 2IS7A 2UZ9A 3CV7A 3CHDA 1QW8A 1F7BA 4JEQA 2V2DA 4JIPA 2J78A 3WNMA 3SCWA 2CPUA 2ANUA 1OX6A 3QLDA 4KERA 4P7LA 1IIGA 3E2RA 3GTFA 3T2PA 4JTIA 4KS0A 3ZVHA 4B3KA 2ZX6A 5CLWA 4PMDA 2O56A 4DZHA 3SCVA 3SSZA 2CKSA 4LYRA 3VIFA 3T44A 3QQ1A 1JPIA 5DT7A 1GG1A 1F3TA 1KGWA 4RDVA 3E3HA 4XKMA 1OHLA 1J01A 5HMFA 2X8CA 1E6ZA 1HN1A 1FHLA 1UR2A 1JI1A 2E8YA 1BTMA 4BEUA 3LA4A 4UTFA 4I9AA 4LRSA 2YA1A 1NFBA 1SR0A 3W7RA 5AZ0A 3JS3A 4MGGA 2QUMA 3S2NA 3PJWA 2DY3A 4LS0A 3GUWA 1OFPA 3KZSA 1TWIA 1TTIA 4QIUA 1T6MA 4DY1A 3BWWA 5M3WA 2WZIA 2ZQ0A 4X0VA 4MB5A 3TZFA 1SPQA 1A0DA 4PMZA 1YMYA 4ES4A 4JX4A 1UKOA 2DZSA 4G56A 5D9OA 4O1BA 3O0HA 3DAQA 4M6VA 2F6XA 1H09A 5BW6A 3BCJA 3UZZA 3LD5A 3QFAA 2QCCA 5CEWA 4QDPA 5CJNA 3MV11 3G0SA 4NI8A 5I06A 1FWRA 1FX6A 4JD4A 2W63A 3IANA 1UMLA 1ZJAA 3AIQA 3VDCA 2PGEA 1DIOA 1EXBA 4PZVA 3D5HA 2KX9A 3NSXA 3N9KA 4G7EA 2CLOA 3KCLA 1KTBA 3UXAA 4M29A 1LOLA 3PUGA 4M0XA 2EPKX 2D0HA 4HTBA 2QS8A 1RM6B 2XUCA 1S38A 1S1PA 2ZCGA 1S5MA 3B8DA 3AHXA 4NAFB 4A3YA 1W9PA 3IV3A 1DIEA 4JNYA 3AMCA 3VAVA 3VK5A 1XFCA 1N8IA 4MJ4A 5F4XA 2J7GA 2BC1A 2P0IA 4I5UA 3FAXA 1G69A 4Q8UA 2JKEA 2NSOA 3FFSA 2IW0A 1IYXA 4DAFA 3BJTA 2ISWA 3QMTA 3A4AA 2FPTA 3M6YA 1IWPA 2PDYA 4WHBA 2HRWA 3R0UA 4V33A 5GJPA 1M68A 3S5NA 3VILA 5HQLA 3W1NA 2GJNA 4CU8A 1JEZA 1MRAA 1BYBA 3QYQA 3WUFA 1JPKA 2J4GA 3CL6A 1UBPC 1C91A 2VENA 1JAKA 3CAKA 5A2CA 3OHMB 2HS8A 2QUUA 1JZ8A 3C8FA 2UWFA 4MUPA 4ZL1A 1UP3A 1EJTC 2DUZA 2JIEA 1F8IA 3ERPA 1E56A 3XINA 3EWZA 4FF7A 4YPJA 2PURA 2G41A 2W9MA 3VCRA 2XZ9A 4QG8A 3NSNA 3VGEA 3PBYA 3LZ5A 4FOJA 3EPOA 1YKWA 4PFMA 3VA8A 2BGQA 4YLWA 1V3HA 3LI0A 3BMVA 4MYAA 3N11A 3LLDA 4XAZA 3UWEA 4V2XA 4OKDA 1FH8A 2VL4A 4O0KA 1EO7A 1KNWA 2HPMA 2PDCA 3ARUA 1AFSA 1TR1A 1P4CA 1KXVA 1HVXA 5AFDA 5J8LA 2REQB 4OV9A 1UIPA 4J3ZA 1H7NA 2OKTA 4UUIA 4BKNA 1XLHA 1VHNA 5H8UA 3LNMA 4PUNA 4UCFA 2X2GA 1TQJA 2TPSA 3AMGA 3OZOA 1WO2A 4K8DA 1UB3A 4NJIA 1FHDA 4X0NA 3IPWA 1HKVA 4NG3A 3W86A 5DQPA 2WCGA 4UFHA 3GZ3A 2YLAA 4PTDA 2PTYA 3DH9A 1TQXA 1AJZA 3GH4A 1UJQA 1H1YA 3GBEA 3NQVA 1YXCA 1NWUA 1KD0A 2OCZA 3UJ2A 4OQVA 4XZMX 4A8IA 4Y8EA 3PTQA 3ANUA 2CIPA 3L0KA 3PUOA 5GNXA 1Z69A 1TV7A 4PMYA 4FNTA 4MNMA 1XUUA 5MKGA 5FF7A 3L4UA 3AMKA 3W72A 1BGAA 4QEHA 4D6IA 1MDLA 5LNUA 1E3ZA 2PCQA 1EWDA 3FV9A 4ATLA 3SY8A 3VO0A 1O95A 3LMZA 3EWBX 2YB1A 1MZRA 4BS0A 1Q3NA 4GISA 1BSIA 4MKNA 2ZIDA 1R9XA 2DSKA 1UWRA 4K2SA 3QR0A 4NRSA 3TJIA 1JXKA 4D8LA 2QGHA 3AZRA 1J11A 3KOZA 2YOCA 2WNWA 1NQKA 3OOQA 1UJPA 3IVSA 4P7QA 1KCKA 5HJXA 3MWAA 3T40A 1QK0A 2BVTA 3CIXA 1PKNA 3PZGA 4ZZ9A 4MWAE 3DH7A 4AVNA 1PUDA 3A13A 2QJJA 3FYOA 2DVXA 1R3RA 3ABRA 4I8YA 5BOFA 3JZEA 3CAWA 3BJFA 3L66A 1NWRA 3PPGA 1XFBA 3WK2A 4JPGA 5FL1A 4YYCA 5FSEC 4OV4A 4JDRA 1R8LA 1GOWA 4XTIA 2E6DA 4HYRA 2WMIB 2X8GA 5FI8A 2Q3RA 3PBUA 4C65A 5HMSA 2TYSA 4HOXA 2VC9A 1AL7A 3HPSA 3VUSA 3QZEA 1S5WA 3SRFA 2RJGA 2YR1A 4AHPA 4K38A 5HDRA 4QAWA 1O12A 4FA3A 2X1RA 3OG2A 4R5EA 3SUUA 4BA0A 5LIXX 3BSHA 4WXYA 3TN3A 3IIXA 2PWFA 1EHAA 1PDYA 5CLTA 4ONVA 1FWBC 1P1MA 3QTGA 2PDGA 3EDFA 4YWOA 4GINA 1KM0A 5HQMA 3G6LA 3MB9A 2XG9A 4K36A 3WO8A 3THCA 1SGJA 1E3XA 1HP4A 1UC4A 4IH3A 1O5RA 4LUTA 3RK8A 4IP7A 4PFHA 2PCEA 1MQPA 4QE1A 1E5JA 4H6QA 1K6AA 1MYRA 3SCQA 4LA1A 2JBMA 2SFPA 4E8CA 3KBJA 3E2VA 1A0CA 1FFRA 2FPYA 4PH6A 4DYEA 1G7VA 4ALDA 2X0HA 3H4XA 1G5AA 1E71M 4IQEA 2JKPA 2J8TA 1YDVA 1YHTA 3G0UA 4DX3A 2G95A 2R1KA 1JDEA 2W0HA 1MEHA 2OYLA 4HP5A 4KPLA 3BMXA 3C56A 1LWJA 1LVLA 4EQWA 2FGBA 4S2CA 4AZIA 1X38A 3GRTA 3QC3A 2BOGX 1Q65A 2ZKMX 4LYKA 3DFQA 2J7HA 3SFWA 3VOHA 1EFZA 1FOBA 4Q4SA 1BPLB 2V81A 1L6FA 2CXGA 2Y5JA 2J3NA 4B92A 2YYUA 3F4DA 4IG2A 3NVYB 1V6WA 3TEVA 1RR2A 1TMLA 3EWYA 1P5BA 1W1B1 3NO1A 4GACA 3M9YA 4JKLA 4QLJA 1ZX9A 3UR2A 2E0PA 1TWSA 3W00A 3RHGA 6ALDA 3W87A 3VD5A 4WEVX 5I00A 5LYRA 2OPJA 4TX8A 5D8ZA 1JYNA 4XD5A 4JTEA 1JCLA 3V36A 3LM3A 3H12A 1W9UA 5XINA 6XIMA 1D3HA 3MMUA 4AXKA 3UETA 4B91A 1GG0A 4XWUA 3UCQA 4MY9A 3NL5A 1QNQA 3CGDA 2RGLA 3WYZA 3ZVIA 1WV2A 2XM1A 2PUZA 3SRKA 1R30A 3GTXA 4ZOEA 3N73A 4IX2A 4Z2IA 1CTNA 5XIAA 1QOPA 4ZO8A 4GBUA 4Z2GA 3A5FA 3IJLA 2PTZA 1V3LA 1EPVA 1E5NA 1S3HA 3RAOA 1PCWA 3B05A 3TJXA 1F8WA 1JQXA 1AJ0A 1SZFA 2H90A 3G1SA 1ZAHA 1QATA 1OIMA 3W7HA 2ZZ2A 4JIQA 1V3IA 2BSLA 5A8QA 4HNCA 1OABA 4XK2A 2DSWA 1HNYA 2HTMA 1XKYA 5EMLA 5LIYX 3RO6A 3P6LA 4GYJA 1ZJBA 3UW6A 4ENLA 4WRHA 1O4UA 1UYQA 1XDLA 1XV8A 3CQHA 3GQYA 1UOZA 5A8OA 3BQ5A 1CX9A 4TVUA 2QQ6A 4Z1CA 4PRWA 5M5DA 5K7JA 3LS9A 4DBUA 4AG0A 2WHJA 4LUSA 3EF6A 1OVDA 4LX4A 3Q67A 1CLKA 4GVFA 2WOVA 1POJA 3MCMA 3VKAA 3ARQA 3GSMA 2V6AA 4YHEA 3TC7A 1GEUA 2YZRA 3PN8A 3SCTA 4PMQA 4IIEA 4H2HA 4DB7A 1TPWA 1CECA 3AN1A 2D3LA 2HV5A 3AQUA 4CCZA 1LZOA 2R94A 1GRTA 3QHMA 2PDLA 2YCJA 3L4VA 5IFPA 5K4XA 2GGHA 1U22A 4K6AA 3GK0A 4E2DA 1JD7A 4LBUA 1XLEA 4CNOA 1JNDA 4PMNA 3STPA 3OVGA 4JTHA 4GHRA 1S1RA 3D9XA 2FVLA 4ROQA 3PVFA 2F84A 3STCA 2YB4A 3N3TA 5ENLA 5FACA 2AGKA 3PJTA 1KWKA 4C90A 3CZLA 5C2CA 3PBMA 2E5AA 4Y2WA 4A8NA 2AAAA 2IKGA 4JYDA 1UKQA 4JNZA 4JICA 1U30A 4U33A 5I6SA 2BASA 1YNPA 1QBBA 4QISA 4EM3A 3CXBA 2DW6A 4J2MA 4HPJA 1LBLA 1FKXA 5A2BA 4O1DA 5BXRA 1WNOA 1V02E 2BFGA 2ONEA 2G96A 5C2XA 3PZ9A 3WJYA 2YL5A 5HWNA 3MQTA 1O1HA 2QT3A 4UTWA 1NVMA 2EG8A 3E6EA 3RITA 2NX3A 4GVIA 1KV5A 2PF8A 1K4QA 3EOLA 2B7OA 4EPEC 3NPVA 3IIZA 3DUGA 2EBNA 3STEA 4C7DA 5DEZA 1Y5VA 1UUOA 5F2LA 1EZ2A 4E2BA 4H8VA 1UUQA 2W3ZA 1YDYA 2AL1A 4TV5A 1A49A 3DHDA 1FDZA 2ZYFA 1FQ0A 4LY4A 3AYSA 1XLCA 3DEQA 1EZWA 3AI0A 3RX2A 4L6HA 4UNKA 2V5LA 4W7UA 3LHYA 1Z44A 1YW1A 1VKFA 4JX5A 1DWAM 4P8UA 1CGUA 1NF0A 5EU9A 4KWWA 3S46A 3PG9A 3V0TA 5CAHA 4Q3MA 3SDOA 1WYGA 1Q4NX 5A69A 3OW1A 1ZFJA 2PBGA 2WVVA 3H21A 5G2WA 1Q7MA 1NFPA 2MUCA 3SECA 5FA5A 1T0OA 1GOQA 3W7DA 4CD4A 5K4ZA 4CN1A 3TK7A 3VKJA 2ZC1A 3LN3A 4GIAA 1F05A 3AMZA 1DJQA 2W62A 1CCWB 1NOFA 3MZNA 4IPLA 4OUEA 4JCMA 4LQ1A 5BROA 4EPKA 1E9YB 3GXTA 4RPQA 4QXIA 2WOIA 3VGFA 3PZIA 3LRMA 2TSYA 3EUB3 3VNDA 3MBFA 3CZKA 1XBVA 2DSZA 1K8YA 1D7FA 1PTAA 4EF8A 3NSMA 1DJGA 1ZAJA 3MYOA 4IMCA 2XFYA 5C8BB 3SAZA 3DJGX 4GA8A 3QOKA 2W66A 5A6LA 1KCXA 2I17A 4JQ1A 4W8AA 5H1WA 4CQBA 4H9UA 1DTUA 1Q6CA 4LVGA 3Q45A 2D0FA 4K7YA 1SO5A 1SO6A 3TJLA 3NCOA 1Q2SA 3NURA 2WPGA 3EPMA 1H7XA 2EKCA 4N02A 2VC7A 3APYA 4O18A 5LNVA 1ADDA 2YL9A 3T0TA 2XWEA 3KTCA 2CZDA 1MNSA 2GLKA 1B2YA 3TE9A 3WENA 2W55A 1YIXA 1SYTA 3OGSA 4O4WA 3IK2A 2W3RA 3UA4A 5I3GA 2HQAA 3LQLA 2ACSA 4HN4A 4DBSA 4DLFA 3QW3A 3VDAA 1MW3A 4F2TA 3WF1A 1SUXA 1P6BA 1EUNA 1LYXA 3SN1A 4IGMA 3VD7A 4DBWA 3G1XA 4H00A 3VOCA 2XIQA 4U2ZA 4BR1A 1QVBA 4F0SA 2XM2A 3MDWA 3UQNA 1VENA 1WZAA 2NQJA 1RLCL 4A2RA 4Q4OA 3GAKA 4NZJA 1H5VA 3V16A 1G9HA 3LCFA 2FMNA 4L6DA 1J79A 3CHCA 4F0KA 2VZUA 1V03A 1REQB 1UA3A 2P3EA 2ZRVA 3C61A 3EAOA 1GQNA 2VGBA 1S7MA 1RQBA 1S5TA 5IHRA 1B3YA 1PJ9A 1Q6LA 1NARA 4FOKA 5AY7A 3TC3A 1W1IE 4RCXA 3DN5A 2CU0A 3W1PA 3UPBA 2BX7A 1IQ8A 2FJKA 1GZJA