2QJNA

Crystal structure of d-mannonate dehydratase from novosphingobium aromaticivorans complexed with mg and 2-keto-3-deoxy-d-gluconate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
402
structure length
385
Chain Sequence
MKITAARVIITCPGRNFVTLKIETDQGVYGIGDATLNGRELSVVAYLQEHVAPCLIGMDPRRIEDIWQYVYRGAYWRRGPVTMRAIAAVDMALWDIKAKMAGMPLYQLLGGRSRDGIMVYGHANGSDIAETVEAVGHYIDMGYKAIRAQTGVPGIASLPSVTGWDTRKALNYVPKLFEELRKTYGFDHHLLHDGHHRYTPQEAANLGKMLEPYQLFWLEDCTPAENQEAFRLVRQHTVTPLAVGEIFNTIWDAKDLIQNQLIDYIRATVVGAGGLTHLRRIADLASLYQVRTGCHGATDLSPVTMGCALHFDTWVPNFGIQEYMRHTEETDAVFPHDYWFEKGELFVGETPGHGVDIDEELAAKYPYKPAYLPVARLEDGTMWNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Evolution of enzymatic activities in the enolase superfamily: D-Mannonate dehydratase from Novosphingobium aromaticivorans.
pubmed doi rcsb
source organism Novosphingobium aromaticivorans
total genus 141
structure length 385
sequence length 402
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2007-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2qjnA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2qjnA01
2P0IA 3GC2A 3I6TA 4YWSA 3CT2A 2RDXA 4DN1A 2GGIA 2GGEA 4HCHA 2HNEA 3UJ2A 2OZ3A 3V3WA 4GMEA 3IJLA 4GYPA 4E6MA 3B97A 2HXTA 2I5QA 4HCDA 3RRAA 4MGGA 2PTXA 1KD0A 1E9IA 3N4EA 4JN8A 3RCYA 1ECQA 3DFHA 2PMQA 3OZYA 4H19A 3SJNA 2PP3A 1SJBA 1F9CA 2AL1A 2XH7A 2PPGA 1WUEA 1FHVA 2OPJA 3Q45A 2PGWA 3CK5A 4FI4A 3VDGA 3R0UA 3TJIA 3TWAA 3FXGA 4ZCWA 3ZLHA 1L8PA 3P3BA 3PWIA 4IT1A 1MNSA 3V4BA 4E8GA 4H2HA 3R10A 3H70A 3HPFA 2XH4A 4K2SA 1R0MA 3RR1A 3RO6A 5FJTA 2OQHA 3ZLFA 4E4UA 1EBHA 1KKOA 1RVKA 2ZC8A 1SJAA 4J1OA 5IDZA 4H83A 1ONEA 3DERA 3DG3A 2FKPA 2AKZA 3CAWA 1MUCA 1EC8A 3T4WA 3FJ4A 3EEZA 2DW6A 4JHMA 2QQ6A 1JDFA 3TW9A 2OQYA 3ENLA 3UXKA 4IHCA 2OX4A 2GDQA 2QDDA 3DESA 3FCPA 4E4FA 3H8AA 3UJRA 3UGVA 2XH0A 3FVDA 3TOYA 3CXOA 1EC7A 1MDLA 5EU9A 4K8GA 4FP1A 3DFYA 1KKRA 1BQGA 3V5FA 4MKSA 3SSZA 5FJPA 1JPDX 3RITA 3TCSA 7ENLA 4KEMA 2AL2B 1OEPA 3R11A 2PODA 3S47A 3ES7A 3OPSA 2PP0A 3OTRA 5ENLA 3N4FA 4G8TA 3R25A 4J3ZA 1IYXA 3VFCA 2PP1A 2POZA 3ZVIA 1P48A 4A35A 1ELSA 3MY9A 3GD6A 4DYEA 1EC9A 2PTZA 3SN4A 2OZTA 3DIPA 4GGBA 4DWDA 4KPLA 4HPNA 5FJOA 2OO6A 3I6EA 3VC5A 1MDRA 2DW7A 3V5CA 3QTPA 5BOEA 3VA8A 3TJ4A 3SN0A 2PTWA 3KUMA 2P88A 3QN3A 2HXUA 3MKCA 3NXLA 2PS2A 4GIRA 3ES8A 1TE6A 3BJSA 3IJIA 3IK4A 4DHGA 4ZA0A 1NELA 3CYJA 2QJMA 2QGYA 2P8BA 3PWGA 4DXKA 4HNLA 1FHUA 4M0XA 3UJSA 5J04A 4A3RA 3FV9A 2QJJA 2CHRA 3QLDA 2GGGA 2PCEA 4KWSA 3NO1A 1DTNA 4IZGA 3Q4DA 3UXLA 2OFJA 2MUCA 2OKTA 3K1GA 3VCCA 5BOFA 4Z17A 3U9IA 1MRAA 2OZ8A 3QKEA 4G7FA 4HYRA 3DEQA 4GGHA 2QDEA 3CB3A 2ONEA 3STPA 4GYPC 3T6CA 4IL0A 1WUFA 3VC6A 3U4FA 2PU0A 2PGEA 2AKMA 1JPMA 3THUA 4JN7A 3DGBA 4DX3A 2ZADA 3NZGA 3PK7A 1NU5A 3DG7A 1TZZA 3SQSA 2XH2A 3SN1A 3N6HA 4E5TA 2O56A 4GFIA 3DG6A 3MZNA 4M6UA 4EWJA 4K1WA 2OLAA 3D47A 4HCLA 3N6JA 3RGTA 1PDZA 6ENLA 5FJRA 4IP4A 2QVHA 2OVLA 2XGZA 3OW1A 3P0WA 4A6GA 2PA6A 3R1ZA 3UCDA 3NFUA 2MNRA 2GSHA 1SJDA 1R6WA 3SBFA 3TQPA 3ZVHA 3GY1A 4ENLA 3T9PA 3JZUA 3VCNA 3ZLGA 3EKGA 3FYYA 3TTEA 4KT2A 3UJEA 2PSNA 2GGHA 2PTYA 1PDYA 1P43A 4HN8A 3TWBA 3R0KA 4MMWA 3BOXA 2P3ZA 1KCZA 1XS2A 4X2PA 2P8CA 3ZVHB 3D46A 3UCCA 3QPEA 1EBGA 1YEYA 2XSXA 3DDMA 4GISA 3MQTA 3T8QA 1BKHA 4IP5A 2NQLA 3MUCA 1W6TA 3H12A 4ROPA 1SJCA 2HZGA 3IJQA 4HNCA 5FJUA 2GL5A 3JVAA 3S5SA 1XPYA 3GO2A 3OZMA 3MSYA 3BSMA 2AL2A 2OG9A 3UJFA 4F4RA 4Z1YA 4H1ZA 3OP2A 3P93A 1JCTA 4IL2A 3PFRA 2QJNA 2GGJA 2FYMA 1TKKA 3MWCA 3JW7A 2PU1A 3H7VA 3I4KA
chains in the Genus database with same CATH superfamily
5AYIA 3SM0A 4DLFA 5EBUA 2E6AA 4H41A 4N4PA 3L65A 3PAJA 4RUBA 1XM3A 4GUGA 3WUFA 3M0ZA 4E8CA 3NAVA 2ZQ0A 3KLJA 3LPGA 2J8FA 1JVNA 3VNLA 4F48A 5CPTA 3WNPA 3KLKA 1GXFA 4MJMA 3WLQA 5FIPA 2PTXA 1NWTA 4QEHA 2OSWA 4I7UA 1THFD 4C6PA 1RJPA 5CPLA 1SJBA 4MJ2A 2QKFA 3AIRA 2DSWA 3DH9A 4QDWA 4K1GA 4KIEA 4MWAA 3QH2A 1A3XA 5TAOA 3KCLA 3TJIA 1W1A1 3TWAA 3WQFA 3WDPP 1Q63A 1T7LA 1FEBA 2Y7GA 2W27A 3QGAC 3O8AA 1Q8JA 5EY5A 3HPFA 2XH4A 3VIOA 1GEHA 2Y7DA 4IXXA 3GXMA 3RR1A 2PC8A 4IPPA 3ZWTA 2YDSA 4Q4RA 1O5RA 4M1RA 1W37A 2R14A 4IPIA 3LADA 1GVEA 2I17A 3TROA 1OGGA 1MEIA 4S3DA 1RY8A 3UWVA 1H60A 2ZUVA 2GYIA 3M0MA 4D2JA 3AMKA 1O95A 3W37A 1NJJA 1RQHA 1H51A 3N04A 3THAA 1HZYA 2OX4A 1MYRA 3B0VC 1C8VA 1M6IA 2NT0A 3DESA 3LYEA 5DT5A 3REQA 3HQ1A 1AFSA 3TN3A 5A6BA 4Y90A 2PDHA 2Z28A 3KVLA 5F2LA 3RMJA 4BV6A 3W83A 5MF5A 3ITTA 3JS3A 5LXXA 4A3YA 4HHMA 2NWSA 6XIMA 3V5FA 4EXQA 2QUVA 4BF5A 1S38A 3TVAA 3QW4B 4EK7A 4Z2GA 1W1IE 2R8WA 1C91A 2J24A 2CESA 3QXBA 2YVFA 4IXHA 3N9SA 3HA1A 4ADWA 4J2PA 3KXQA 2DZSA 4DJDD 1U5VA 1FWGC 3QYQA 3BAWA 2ZC1A 1YXCA 2ZUUA 4MZ1A 3W2UA 2G8ZA 3N4FA 4D8LA 1F3XA 1QK0A 4RX0A 1IYXA 3D3FA 1NP0A 3QSRA 1LLWA 4PB5A 2PDBA 4ZGYA 1W31A 2QCFA 3BE7A 1ZCCA 4O10A 3RN6A 5CCZA 4PUEA 5ABFB 4GGBA 5D37A 5BRPA 3SCNA 5I5RA 2ZUMA 1EF2A 3FXYA 5EMMA 3PJTA 3QY6A 4U33A 3URBA 2EPOA 1LWJA 1H09A 4GQRA 1A5UA 2J3NA 5BOEA 2YXGA 1QBAA 4B3LA 2QZRA 3OGSA 5IM51 4RV8A 1CENA 4HNOA 2P10A 1GORA 1ZK7A 4MWAD 3UP8A 1PIIA 1FWDC 1QI5A 4UQCA 3WNMA 3MUY1 4NI8A 2P50A 1UWQA 2XWEA 4KGJA 3NQGA 2QJMA 2P8BA 3SFWA 3W2KA 3G0XA 3TXZA 3E0IA 5FAJA 3GDTA 4K8EA 2DP3A 3BCDA 1NF7A 3KEHA 3LEPA 1W1PA 3GDBA 5TBOA 3IVUA 1VIWA 3KWSA 1ZY9A 3OZOA 4DZHA 1W3HA 1E4LA 3A7AA 4P61A 3WJSA 3VCCA 4RE3A 3NA8A 3AZRA 4QAIA 4QHRA 2HVNA 2B7QA 2YW3A 2ZRUA 1GK8A 2PDKA 2AMGA 4RV3A 3TA9A 2QULA 1AW1A 3P14A 3VNZA 4JL1A 3GXDA 2QJIA 3PPHA 1RD6A 5BRQA 1JCLA 2VQUA 3PTKA 3STPA 2YQUA 4TMCA 4ORIA 4XIMA 1W2VA 1GONA 1ZBWA 2ZZ5A 3KL3A 1O5XA 2QCDB 2G4JA 3DC0A 2ZUNA 1H61A 1KWGA 3ZMRA 4YTTA 4JNMA 1TRDA 4WOZA 5C7VA 4I9MA 2VFFA 2F5ZA 3VNYA 1W54A 3SURA 3FEMA 4DWSB 1OFDA 4DO7A 5E9AA 1XC6A 5HMSA 2H3BA 2VQTA 4S3BA 4A2RA 4YHGA 2OVLA 3OW1A 1O1HA 5T91A 3VI2A 3R1ZA 5I03A 4LYPA 3CO4A 2BY1A 1NQ6A 3NFUA 3OHIA 3USZA 1E15A 2Z4GA 2F38A 2FVLA 5FACA 2WK2A 1QFEA 3GW0A 1C9DA 3UA4A 1DE6A 3KS6A 3FLUA 5D33A 5CAHA 3S6OA 4PSPA 4S3KA 3BGGA 1Q6GA 4FOKA 3UJEA 4GXMA 1K8CA 3L5LA 2CXGA 1VBGA 1VZWA 5DMYA 1EP3A 5B7YA 4ZOBA 3WQ8A 5G2HA 2C18A 4R7OA 4AU0A 1NDWA 4GUIA 3O1NA 3ETRB 3CMGA 4HSHA 1VR6A 1F6KA 1JCJA 2X8RA 1Y5VA 2IPJA 2OELA 4CU6A 3GKFA 2ZZCA 4GI6A 4CCEA 2VRJA 3GNOA 1W3KA 3AYVA 4GD0A 2WPFA 1DWIM 3PPCA 1O5KA 4J28A 2XVGA 2BHYA 4ROPA 4MUZA 4UQAA 5M2FX 1UMLA 3WLJA 2BLEA 4PL2A 2PF8A 3ID7A 4FNQA 2CETA 4R7WA 4BCEA 2A3EA 2Z1KA 2V68A 2ZRYA 1UP0A 3GC5A 1K9TA 4LV9A 3CC1A 8A3HA 1E70M 3P93A 1JCTA 3O6DA 1W1ZA 1SO4A 1DORA 1C90A 2VXNA 3H55A 5ER0A 2GVJA 1KCLA 1XYFA 2ODOA 4EQWA 1KGWA 2HQAA 4KIRA 2YL8A 4PUKA 1QVBA 1YBQB 1OC6A 3NQEA 3CT2A 4BI6A 4GR1A 5CAKA 4UQDA 3ARXA 1V97A 2C7FA 1B57A 4GYPA 2QCMA 3RG6A 5J8LA 1KRMA 2BVTA 3APGA 4CQBA 5I3IA 3B06A 3R8GA 3GU9A 4F2BA 2OYLA 5CC6A 2SFPA 3BMVA 3B8SA 2GR0A 1WA3A 1YE4A 2GR1A 2FJKA 2PI6A 2PDGA 3S1VA 4B5SA 2PWEA 1UZDA 4GZIA 3EWBX 1PZ2A 1KFKA 4M81A 2QUMA 1HKKA 1KBJA 4QDPA 1V6UA 3EA1A 4HK7A 1XLAA 3MP5A 3QY8A 1SYTA 1PZ1A 4EXBA 1OYCA 1NPXA 1XG4A 4B9YA 4FB7A 4K2SA 3M9YA 3WQ6A 4UBPC 2P3EA 4FF5A 2WLYA 1MW1A 2VX4A 3VDCA 4WX2A 1RVKA 5F2IA 3SR7A 3VNMA 1SJAA 1J6PA 3POCA 5IDZA 1EYWA 5FEWA 1Q8AA 2J88A 2YDQA 3CAWA 4LTSA 4DLMA 4YTSA 2ZUWA 3BXWA 1EO5A 2DW6A 3WJXA 3AXKA 3EWUA 3P84A 3DX5A 2OQYA 3DOPA 4QSHA 3NSXA 1TTQA 4WY0B 1CGTA 2YBTA 2OU4A 3T0TA 1UJQA 8RUCA 2W0UA 4HT3A 4REQA 1M04A 1KO0A 4DJDC 3GRSA 4B3ZA 4H01A 4JEQA 1PS9A 2BVDA 1GKQA 1WYIA 1Z48A 1MDLA 4IOTA 3BSGA 3SUVA 1JQVA 4OBRA 3MMDA 4BA0A 4PMNA 3T07A 1YE6A 2XYLA 2GH5A 3W82A 1US3A 2QCEA 3RU8X 4O28A 1LCOA 2YVGA 1GJUA 2NQZA 4S3CA 5FKYA 1OCJA 1C3FA 3W6LA 5DBUA 4RNIA 3TCEA 1LQ2A 3IIPA 1BF6A 1B3OA 2KAUC 4GX8A 4FSAA 1BD0A 4QLJA 2WMFA 4XB3A 1XHGA 3BLEA 2GPTA 4MY1A 4NZJA 3WL1A 3GIQA 4QS6A 2IKJA 3FDGA 1ME8A 2Y63A 2PDUA 2QR6A 1JDDA 2WOVA 5AN7A 2ZA1A 4OTKA 3VX0A 1TJ1A 3CUHA 4RDZA 1R3RA 1OFAA 3VPLA 1JZ8A 4FR1A 2PDWA 3Q58A 1KB3A 4MB3A 5BCAA 4QP0A 2C79A 3M0LA 5H91A 4LVFA 2FHCA 1R85A 1ZSXA 4CCDA 1LVLA 2RDTA 1X1NA 2UY2A 3IRSA 3WF0A 1XDJA 4H4RA 1XFBA 3WNKA 3IUDA 4P8XA 1XLBA 2ZZ3A 4O18A 1NAL1 3TTQA 4AY1A 1XBZA 3CYJA 3QZAA 3G1FA 1QAPA 3EA2A 4HNLA 4IMFA 4RCXA 4ZO9A 2V5CA 4ACYA 2A6NA 2R94A 1ZBKA 1ISZA 1GVOA 1JROA 1TPFA 3GDKA 1OFEA 4GNJA 3WDQA 2E40A 4CD4A 1I0BA 3K1GA 2F84A 3AHZA 4Q8PA 3OLGA 4JHZA 4A05A 4YS1A 1JXJA 1C8YA 1A5OC 1A5CA 2OZ8A 3V1PA 3NRZB 4XKMA 3EDEA 2FHBA 4QLKA 1JYNA 5F2GA 2VI0A 4LUSB 4RW3A 4IIDA 3BSHA 2WC7A 1L6YA 9XIMA 2V2DA 1Q6LA 1KRAC 2OXNA 1R38A 2GDUA 3L4UA 5C71A 4CGTA 4W7UA 1E0WA 4GC4A 3AXHA 4R27A 1PTDA 2UY4A 4RK8A 3H2NA 1EA0A 4Y9MA 3DGBA 4DNAA 2PWVA 4MNKA 4B15A 3TYAA 3NDYA 4BZYA 4I5RA 4B5UA 1PTAA 3OYZA 4BF7A 4HMCA 1E5NA 4EWJA 2G4FA 1WOAA 4OOZA 2E67A 3N6JA 3UCQA 5FJRA 4EKJA 1MZHA 1Q65A 3SUUA 1YLVA 5C9UA 2WNZA 3WFZA 5E0CA 3PM6A 4ROQA 5GPRA 3LTYA 5A8QA 5HXMA 4O4WA 1SJDA 3P67A 1FRBA 4JFSA 1GVRA 4ZR8A 4LCSA 4PMVA 2GJXA 3PNZA 4PTWA 3GY1A 3NR0A 3VOFA 5K7JA 3S5OA 1EB3A 3WF3A 1SM9A 2DUAA 1RM6B 1YADA 3CMJA 1K77A 4B16A 3D9XA 3W7NA 3GBEA 4GNVA 4A3HA 2NQHA 2BHUA 2WANA 3KWXA 2QF7A 4UQBA 3QPEA 5XINA 1LYXA 1OADA 3LX9A 4GISA 4YLWA 3S2NA 1F7BA 3T2PA 4H9ZA 5JMUA 4OOUA 3SCOA 1W9UA 4DJFD 5AFDA 3VKAA 1TA3B 4EXAA 1WXYA 2EPHA 4O4VA 5FSDC 2E25A 1NWRA 1ZS2A 2NW0A 4PBFA 2WJDA 4XK2A 4H8VA 3CUGA 3IEBA 5G2IA 3LSBA 4MWAE 2L5HA 3OP2A 3K13A 1GTEA 3FFSA 1J18A 1A5LC 1PE1A 3ATZA 2W3SA 4M24A 4WDWA 1E9YB 3T0AA 1GVQA 1SZEA 4S39A 3QFAA 2WO5A 1S3TC 4AVNA 2BGNE 4NF7A 4XZLX 3AUJA 2YIHA 2BXZA 3H7RA 3WKZA 3WLPA 4F66A 1DIKA 1R3SA 1K9DA 1M7XA 4Q4SA 3GH5A 3O2LA 1D8WA 4Q3MA 3CGBA 3GS6A 4HVXA 5AYXA 4PMOA 3IJLA 3KOXA 1OFPA 6TAAA 5JH1A 1XG3A 3IVTA 2Z1VA 3LCXA 4JCMA 4WKHA 3C8NA 4WR3A 4WRHA 4XUGA 3S8HA 4JQ1A 2X1IA 4P7OA 4PCTA 1OM0A 2FZNA 3QV7A 1UD2A 4TV5A 3ERPA 2WB5A 3G1DA 4IP7A 4IQLA 3B9JB 1RVGA 5K9CA 4CU7A 3KVKA 4R34A 3BJTA 4KEZA 2O4MA 3A4JA 4LV4A 1TV4A 4EQRA 5DMMA 3EYPA 1GOXA 4LJ3A 5KITA 3MI3A 1B5TA 3AHVA 2HE8A 1MO0A 3NDZA 1CW2A 1TZ7A 3IGSA 4YVXA 3EOOA 3AIEA 3V0SA 5I3GA 4H6QA 3DERA 3NGJA 4GZEA 1IXNA 3W76A 4DWSC 3WDRA 2R9RA 4KF1A 1Q45A 3O15A 3H4WA 4PGLA 3NTYA 4H4YA 2XVLA 3CWHA 3GK0A 5LIXX 3D0CA 3QPYA 3MB9A 3UGVA 3SJ3A 3TYEA 1Q7MA 2GVYA 2E09A 4K8GA 2DPEA 5FCZA 4OQVA 3IAPA 4H7ZA 3MSDA 4GJIA 2NVKX 4QFUA 4KWOA 1IEVA 3LPFA 1EJ7L 2EBNA 1V51A 1I8JA 3APTA 1OC7A 3ES7A 3M16A 1NOFA 1K3UA 2BC1A 1ZNNA 3OTRA 3IJ6A 4NVTA 4MG4A 3R25A 2OGJA 1JOAA 2Q02A 2E6DA 3AAMA 3RR4A 2POZA 3BQ6A 2VEFA 3NZPA 4B5TA 4WVXA 1UBSA 3TR9A 1ISWA 1ZBCA 2W3ZA 3HW2A 3H7UA 3WQPA 4LVAA 1X1ZA 2DT0A 1RP8A 2XFRA 3W00A 4A8LA 1TELA 1RJRA 3ZO9A 3NPVA 4JTTA 3F4DA 2C71A 1GV4A 2E8ZA 3TJ4A 3W1TA 1UH2A 1R7OA 1L6WA 4AYSA 2AQOA 2ISFA 4FXFA 3AIVA 4L9ZA 2HXUA 2A2IA 2J47A 3DENA 4UOZA 4AX7A 3VINA 1SMDA 1LBFA 1VFMA 3PBYA 3NIYA 3Q94A 4CD8A 3THCA 1EJRC 4XD6A 2X7WA 4HMNA 4TVDA 4X2RA 4E2DA 5G5IA 3OBAA 4QISA 1JCMP 4R9XA 1ONRA 3QFEA 4OV4A 1HJUA 2V69A 2DZPA 1K6WA 5FF4A 5DCEA 4IZGA 1LT7A 3GG1A 3RF9A 2DEPA 2Y88A 3H24A 2PB1A 3UZZA 2OKTA 5IFPA 1GRAA 3LQGA 1EHNA 3T0BA 4DRSA 1P6BA 4GO8A 2CXEA 4NI3A 3UZ5A 5CPQA 1RQBA 1ITCA 4D6EA 1H7NA 1R9XA 3I7QA 4JS3A 3URNA 3CB3A 4XAPA 3S1WA 3GR8A 4NZCA 2WOQA 4GIYA 4NAEA 3T44A 3G6MA 1Y7VA 4H4VA 4EPDC 1TQXA 2XN1A 1C93A 1FWHC 2PZ0A 3CUZA 5JBEA 2G5WA 3WQ4A 1MVYA 2E5AA 3BW4A 2V5BA 4DX3A 3V35A 3VU2A 1XGDA 1KRBC 3TMQA 2CLHA 2XH2A 4GA8A 4OV9A 4WSHA 4LB3A 4XKYA 3O6AA 5ABTA 1KM6A 1NFPA 4M29A 2BHZA 3L67A 4K1WA 4PMYA 4GNKB 4C6CA 3A22A 1JFXA 1HIZA 1S7MA 3AN1A 1KTCA 1EYEA 4Q8VA 1T0OA 1V08A 1GCYA 2YDRA 4I5XA 4MM1A 1PIGA 2QVNA 3GFZA 4I6VA 3WF1A 4P2VA 1I75A 4MADA 2D2GA 1R6WA 3CYVA 2CZEA 1T8XA 2IXVA 3TQPA 5AC4A 4ENLA 5J5RA 1OY0A 3O05A 3TSBA 3AU2A 1TIMA 3I10A 1EWEA 4BEUA 1PDYA 1DYSA 3VGGA 4DO6A 4QTGA 3SRFA 5H6HA 2G37A 4DJFC 2ZRWA 3ZJKA 3UEQA 1KCZA 3R4IA 3CB8A 1XKYA 1E55A 3AI0A 2XHYA 5LNVA 1V79A 2O55A 2OEJA 5HULA 3DKLA 1UUQA 5H8MA 3GDMA 4PC8A 1Z9AA 3DI1A 2CCRA 2FHFA 3LGEA 2ZX9A 3SCQA 2NUYA 3QFBA 3GW3A 2PDPA 3MQTA 3LXAA 5EMKA 4LYQA 2ZXQA 2YKKA 4IP5A 3VZXA 2HEJA 2WHLA 3DI0A 5D8ZA 1SJCA 2C3ZA 5G4HC 5FEXA 1IZJA 5HINA 2E4TA 3EANA 3BSMA 1F3TA 1OINA 1JPHA 2IQTA 2OG9A 1CLVA 4IH3A 4PMQA 3V0UA 2EQ7A 1V03A 2GGJA 1DXEA 4L9XA 3K5XA 1C8QA 2W67A 3A4XA 3TDFA 3IGUA 3PUEA 2J6VA 3WDHA 3WLHA 3U5UA 2WKGA 2BVYA 1GSNA 2OX1A 2V5JA 2C19A 3KTCA 1DHKA 2VVSA 3DH7A 3TIMA 2VUNA 1F4AA 3B97A 5LGZA 3WFLA 4MSSA 3TV8A 3UPBA 3N4EA 1AJ0A 5C55A 2W61A 3SJNA 1A4LA 2OOGA 4Q7NA 4R9OA 4DBUA 2BODX 3RCNA 1WUEA 2Q3RA 3PWAA 1GQKA 4DZAA 2ACQA 1FH8A 4N4QA 3L23A 4GY0A 1B3WA 4E2OA 3THDA 1VBHA 1UWTA 4H9VA 1R5YA 1FQ0A 4ZCWA 2OTDA 3WIJA 1GJWA 4D6IA 3C2OA 3N12A 1K6AA 1TJPA 1WPCA 4JFTA 1XYMA 1B3YA 5L9FA 4KETA 3G77A 3W7LA 1XFCA 1KKOA 2BASA 3ZR5A 3GYEA 3NZRA 3E74A 3VIFA 3MVIA 3LHTA 1AZ2A 2G96A 1FOBA 4H83A 3EF6A 1UKSA 1M7OA 1V0NA 3CTLA 1ZP3A 1FXQA 3KS5A 5F1VA 1G69A 4LANA 2WNNA 2PF0A 1OFRA 2ZCGA 4OIFA 2QAPA 4K6AA 1Q66A 2V3FA 4L1GA 3MBFA 1BQGA 1G94A 4RZ6A 3W23A 3RITA 3TCSA 1QW9A 2YYUA 4LFYA 3PULA 3E2SA 1XL9A 3HMJG 1U22A 3GH7A 2XIMA 2PDLA 1VYRA 2PBOA 3FJNA 2R9ZA 5A94A 3IGXA 4G8TA 4M82A 1BYCA 2UV8G 5I3FA 1T99A 3NEHA 3NSMA 3ZIZA 4PUNA 4NX5A 1KBBA 3WH6A 3VOGA 2YFOA 1J0IA 1WV2A 1BHGA 4NZ5A 1P48A 3GVVA 3FVMA 4H4WA 4F2TA 3FJ6A 4PRTA 1KM0A 3QPZA 3MDUA 3D6NA 2UY3A 4QE1A 3GX9A 1A5SA 5GNZA 3WMCA 2HQMA 2Z1XA 5KZ6A 1F4HA 1YTDA 1Z8AA 2VZVA 2O9TA 2HV5A 5KMYA 4QBXA 9RUBA 4NASA 1I2PA 3V5CA 5FS8A 4PB3A 4PRRA 5L6UA 3GFYA 1GESA 4YTRA 4L6OA 1C9WA 3AQUA 1M68A 4JIPA 9XIAA 1ADDA 2A0NA 1BXNA 4H4ZA 1CDGA 3N15A 4LVGA 2VHLA 2GVGA 2DSUA 4NAFA 3DGHA 1J11A 5M17A 3KOWA 3VKBA 4EPKA 5HUOA 5EPDA 3GVGA 3CMFA 2D20A 4ATDA 3WEZA 4A3RA 1VHNA 1BF2A 1UZ1A 3FOKA 4R53A 4B5XA 1YNQA 2OWXA 3PBWA 2R1NA 4KWSA 4D6HA 4AZBA 4GY7A 4QJ4B 4H8UA 2D3NA 4LY8A 1US2A 2OGYA 4TXEA 5A6JA 1UD5A 5LA2A 3GM8A 4C6MA 4ACZA 2ZRVA 3OBKA 1YPIA 2A79A 4V15A 1Q6RA 3GG0A 2YLLA 3BG9A 4REQB 2FPTA 4C60A 1YPXA 1DWGM 1K8ZA 3GIPA 3ARSA 3SRKA 1PCWA 2ON3A 3H23A 3M0KA 2FDMA 3ORWA 3AZSA 5CSUA 3KCJA 1XLMA 2OCZA 3RMEA 1UHVA 5D09A 3PK7A 4DUVA 4IMGA 2J9XA 1XLJA 1ZCOA 4AD2A 3UZXA 3N6HA 2Y6ZA 1K1DA 3LI1A 1KR0A 2O56A 3E9AA 1XRVA 2A8XA 2HVOA 4L5ZA 1ME7A 2J79A 1M03A 2YFNA 3MZNA 1Z89A 1VRDA 4HPXA 3D47A 1R3QA 3PVFA 3T8LA 4AIOA 4UFJA 1A0EA 2IPFA 2DDXA 1BGGA 3JR2A 2WMIB 4OJYA 1E4IA 1H5YA 2HCVA 1M7PA 1F61A 4RW5A 1EQPA 5EA9A 3S5NA 1PPIA 1DP0A 3RJXA 4ERIA 2ABAA 2C91A 4G7EA 4GIAA 1HQTA 2V6AA 1VFUA 4YIWA 3VCNA 1RA5A 3H2AA 1DE5A 2YYTA 3FYYA 5T26A 4J56A 1XANA 4URIA 4WJXA 1BXCA 3BTNA 4C1KA 3WQVA 3S83A 3BW3A 2PGFA 4K7YA 1XSJA 4D6DA 2P8CA 3W2MA 4EF9A 4IISA 3QJAA 3HZ3A 3W70A 4LAMA 3DYMA 1CXEA 1SFJA 2WZTA 1FWNA 1JDEA 2XSXA 1ZUAX 4ZFMA 4J57A 2RDUA 4F0SA 2RAGA 3W1UA 4TX9A 1YMYA 1PHQA 4ZOEA 1R30A 1BWLA 4LCRA 3DFTA 4M19A 3DYPA 4PUWA 2RFGA 1B9ZA 4HNCA 5FJUA 2Z1BA 4NXKA 1DWHM 1VHCA 4FF7A 4JL2A 1MUMA 1IF2A 3KX6A 3W7GA 1UKPA 2QDGA 4I9AA 3L9CA 5A8PA 1BTMA 3TFCA 2E9MA 4ES4A 7ODCA 1NM9A 3UWWA 1TKKA 1G4SA 3VX1A 1AZ1A 1KXTA 3S6DA 5HQEA 3S9YA 1VFOA 4MVAA 1EJVC 2QF8A 3W1LA 5ECUA 2BZNA 4IG2A 3KBMA 4JTRA 4UTWA 3VNIA 2NX9A 2VCCA 3A9BA 1XIJA 5BXPA 1RZMA 4XZIA 3U3HA 3IK2A 2ZICA 3GIYA 2W9MA 1V3HA 3EAUA 3RCYA 4LUTA 1KWKA 5LGXA 1IR2A 1N8IA 1K7EA 3WQGA 2QLYA 5BWFA 1KQZA 4RNJA 2E5CA 1U1HA 2YZ5A 1TTIA 5CG0A 3FY1A 1OVDA 3CPRA 3F4CA 2CFFA 3CK5A 2G41A 3W1PA 1FFUC 3SY5A 3KBJA 2KX9A 2VEMA 4PCSA 3H2CA 1CNVA 3CQJA 1F05A 3V18A 1D8CA 1EJTC 3U2ZA 1R0MA 3TJLA 4IX0A 2GJXB 3FDKA 4HTBA 2X8CA 2FGLA 4WOQA 3PPGA 3OODA 2X1UA 1TREA 2CYGA 4AEEA 1U5JA 3U57A 1YW1A 2FKPA 3VD9A 4ECLA 3GAKA 2XM2A 2FGBA 4Q8UA 4JHMA 4AH7A 2PWGA 1JDFA 5XIAA 5E5CA 2ZDSA 2VP8A 3SDOA 1UD4A 5BXSA 4Q8TA 3JRKA 3BH4A 4PTMA 3WBXA 1S3HA 1XGZA 2FFIA 3GNXA 3DBPA 2XH0A 4DUWA 2QYGA 3VOCA 2BFGA 4NY2A 3R07C 3C86A 3CM4A 4YYFA 4KEMA 4N2YA 4ZEPA 3UY7A 2WW5A 4Q7BA 5J5DA 5HMDA 2GJRA 3PANA 5M5DA 1J01A 4RE0A 1QOQA 2PP0A 4ZOHB 3CO8A 5LSMA 2ZZ2A 4KQNA 4QIUA 5B80A 1GRHA 3WNOA 1VPXA 1XDIA 4J3WA 3S42A 3KRZA 4GJJA 3TKFA 3E02A 1A5MC 1E6QM 1BYBA 4ADTA 3QKZA 2VRQA 1KV8A 1V3KA 1JGMA 3PY2A 1ADSA 4MIMA 2F6KA 2YZRA 5A8OA 4LEQA 1CXLA 4ZOCA 1LQ0A 1TCMA 2C14A 2J7BA 3W1MA 1MFUA 2V63A 1K4GA 1P0KA 3W1RA 3VC5A 4NG3A 1VPYA 3MZ2A 2FJUB 5LNWA 1G67A 4HHLA 3ITGA 3L4ZA 4U5KA 3UR7A 4Y2WA 1QNRA 2PS2A 3IIOA 4FNPA 1K7XA 3GTIA 2QDHA 3QOKA 4A8IA 3CQKA 5KEZA 3L68A 1ZBVA 3ZSTA 4J3XA 3HIJA 2FFCA 3W7IA 3IGHX 1OG0A 1P5BA 5A2CA 4DUXA 2NVAA 3B0XA 4DXKA 4PE8A 5C9WA 1X2HA 3RXZA 4XVDA 3UXAA 3FKRA 3DHUA 1CGWA 1D3HA 3AS2A 3CLWA 4GOAA 3F2BA 3QEZA 3MV01 2OFJA 3HJZA 3CXBA 1EJUC 1RQEA 2VX6A 1NDZA 3BK0A 5BOFA 4C7GA 1VBUA 4GVFA 4Q4QA 5CBIA 4PTVA 4TO8A 4MZYA 3HGSA 3NQBA 5KTLA 1EZ2A 2DZVA 3WK1A 2QDEA 4A22A 4NIRA 3S2JA 3CHVA 3ZT7A 1GHRA 4YWIA 3C4UA 4IL0A 1W1B1 1UWSA 3KBWA 1ENUA 5CSYA 2F8QA 3LXDA 1IGWA 1M3UA 4D6CA 3WQWA 5LNRA 3RM9A 1XH0A 1PL9A 1UPMB 2VCBA 2NXIA 2I16A 4L80A 4IMDA 3G0SA 1IWPA 4X0VA 4B3KA 2X7VA 4H9TA 1NH6A 1HTIA 5BZAA 4H2CA 3W7KA 3WD1A 1SU5A 1N60C 1AD1A 1G5AA 3A9IA 3G1SA 2AOSA 3LXBA 4DPPA 2X99A 2JK2A 2WC3A 3SAZA 3RLUA 4LC8A 1JZ2A 2JF7A 1SFSA 4UFLA 4M6QA 3LLFA 4GCAA 1C7TA 3Q6JA 2GSHA 4EAMA 2WBKA 4GYJA 2AQWA 2W92A 3UA3A 1FECA 3BCJA 1GW1A 2Y89A 2J74A 3AJ7A 1RLDA 2B4GA 1XYZA 3CS2A 3E2RA 4WEVX 2BBFA 4LOCA 4RZ5A 2VFEA 3TTEA 3C0QA 3EDDA 3LHYA 2GGHA 4PCFA 3UWUA 3AYSA 3NPXA 1UG6A 4MNLA 1B9BA 1QK2A 5AZ0A 3GFXA 4PRWA 4JDYA 1MQRA 3SI9A 2NQ9A 3VIGA 2C1IA 2VEIA 3AMGA 3KBNA 3EPNA 4BQ4A 2HNHA 4B5VA 4UMCA 3T4CA 3C0SA 4L7ZA 3AYTA 3R58A 4F9JA 2DT2A 1OGSA 2DQWA 1TR9A 3LNMA 1TYPA 2FIQA 3FJLA 2G3NA 4JY9A 4WDXA 4ASTA 2CKSA 1F76A 1V8EA 1WYGA 1HUVA 3W7RA 3TMLA 3GXIA 3DXIA 1VFLA 1GZ1A 1DQWA 5T8GA 1XPYA 3C8FA 1XRSA 3U5YA 5G5HB 2E1WA 3MMTA 3GTHA 4Z2HA 3P5ZA 5A69A 1G9HA 3MCNA 2WHJA 4LPCA 1EDGA 2Y62A 2DVUA 5HJXA 3EKZA 1ZJAA 4OU1A 2E6FA 2WKJA 3MWCA 4XTIA 2VDHA 5C70A 2PU1A 7A3HA 4UWMA 2GSEA 2J7FA 1OX5A 2V38A 3FA4A 1ZAHA 1NDVA 1ITUA 4QG6A 4F0MA 2QXWA 2V2CA 4P5UA 2GGIA 1VRXA 4NAEB 5FJJA 3R8HA 1FCBA 4GQBA 1TV3A 3EXRA 1SQ7A 4KWWA 5GRTA 2QHAA 1BYAA 3BPWA 4IJBA 3MBDA 1E4MM 4UOJA 1KXVA 2I5QA 3IAQA 3KW3A 4I9TA 1K03A 2PDMA 3MJYA 3MO4A 3UERA 4GO9A 3WD0A 1WO2A 2PP3A 5U1OA 1BZLA 2YAUA 3MO7A 1L0PA 1T41A 3VIJA 3W1AA 4OE7A 4UFHA 3A7RA 5DLCA 1NDYA 2VD9A 3VD5A 4KWUA 2Z2AA 3QSTA 3Q45A 3F5JA 2EQ8A 2G97A 1JR1A 4GQQA 3B0UX 2DJLA 3NCOA 2ISDA 4Q6JA 1PKNA 4E8GA 5HBFA 3AMLA 3KVJA 4HA3A 4U28A 1GYNA 2Y61A 3C2FA 5HJLA 5SWUA 4S2CA 4J5NA 4BQ5A 1JCYA 1EPVA 4Q33A 2EGZA 2PD5A 3UPMA 2ZC8A 3K1DA 3WLMA 1LT8A 4GI9A 3WDIA 4ZO7A 3TW6A 4N0RA 1EH9A 4NNCA 1HVXA 3BJFA 3LM3A 2Z6JA 4XWUA 4DXVA 4AHPA 3TW9A 3SEPA 2R82A 4EACA 1ZB5A 3FS2A 1P7TB 3F5KA 2D0GA 1E56A 4M8UA 2PCQA 4TQTA 3CZ8A 4E3TA 4BEQA 3ZR6A 1BVNP 2FB3A 2ZFAA 2TYSA 2FMNA 1LL7A 4C5ZA 2ZZ0A 1JCNA 4LB4A 3EWXA 2CPUA 1K4HA 3IUIA 3IV3A 1DOSA 1PX4A 4IGSA 3W71A 3Q65A 4MNJA 4AXKA 2VR2A 2GWGA 4H04A 2BTMA 4IF2A 2BX7A 3PB0A 1WZLA 5D9PA 3C52A 2JIWA 4A2SA 4IFOA 1EKOA 2VFDA 4M5PA 1AODA 3RPMA 2GR3A 3HG4A 1MOKA 1UZ4A 2F2KA 2WYSA 3VZZA 1J12A 1YRRA 1G4TA 5G1TA 3W72A 3WBEA 2P76A 1WAUA 3BLOA 3NZ1A 1CEOA 2J78A 1FXPA 2E77A 4D1IA 2BMBA 1Z7AA 2DZUA 4FR6A 3ME3A 1GVFA 5HMFA 1J9YA 3HGRA 1HJSA 3UZYA 2A7PA 3EWDA 1Y5XA 2C15A 5LYRA 3VCRA 3RDKA 3EEGA 3OO2A 1W5OA 4KCWA 3TFXA 5HJYA 2PLCA 4UTLA 3SN0A 3MTWA 3V1HA 5REQA 4TX6A 1ZJBA 3LERA 3P81A 3MMUA 1PTGA 1KBLA 6CGTA 3ES8A 3O63A 1UP3A 1TWIA 1FO4A 4FZIA 1CBGA 3W6MA 1XR2A 5FSEC 4WKAA 4QAWA 1M53A 1A3WA 1KCKA 5DY3A 4UR7A 2XWDA 2VZOA 3WSUA 1QUMA 4GVIA 4KEVA 4JOMA 5J04A 1VJZA 3BLIA 4DZIA 3A7UA 1QI0A 4HD5A 2OZ0A 1YNPA 3Q4DA 3SQMA 3CZKA 4MF4A 4DO5A 1UR3M 2NX3A 4MKNA 1YX1A 2HBVA 3WJYA 1UR0A 3WO8A 4DELA 3T05A 4AISA 2OQLA 3BLLA 3GG7A 3TU9A 4LIIA 3QBUA 3NURA 3NWRA 2DH3A 1O6IA 4UXDA 5TIMA 4ZVJA 4JQ2A 4I90A 1SZFA 1E6ZA 2VOTA 4EPEC 1JZ7A 2NPXA 4ONVA 3HPZA 3WMLA 4HNNA 1OCBA 2Y8VA 3B8VA 4NZFA 3CLMA 3CAKA 3W87A 2E5DA 4RZBA 3SN1A 4IJCA 5CLTA 4B5NA 4XV0A 1TMQA 3VKJA 2B81A 4HCLA 4U2ZA 3NQ6A 4X0NA 2DVTA 2QVHA 4KMQA 5CEWA 2VKZG 4LA1A 2J7CA 3TA6A 3UCDA 4KH2A 2WPCA 1ZP4A 3DFOA 5EKYA 5DX7A 4MAZA 1RHCA 1KCXA 3W27A 3NL2A 3ZVHA 5C2GA 3ZLGA 2VENA 2H8ZA 3I3BA 3L4VA 3GUWA 4JTGA 3G6LA 4KT2A 4QCEA 2FZ8A 2IMRA 3VMPA 5CBBA 4PTDA 4GC3A 3RAOA 4AG0A 1T6MA 4HJFA 1FCVA 3AS0A 3FYPA 3ITYA 2CU0A 3WLLA 4U31A 1IEIA 4DJED 2WOIA 5DFAA 3D46A 3QZEA 3CQHA 3R8RA 4IIBA 2X2GA 3FEQA 2OYKA 1LTDA 5GJPA 4NAFB 4OBSA 3FW6A 1G7UA 3LB8A 3TC3A 1VJIA 2X8GA 3WFAA 1Q4WA 1RY0A 3WLRA 3PZMA 4JKLA 3JVAA 2OO0A 3GO2A 1GGOA 1JYXA 3WH9A 1XIHA 3UJFA 1WZKA 2I7GA 2Z6IA 5A95A 4K36A 3EPOA 3TEVA 3C56A 1CGVA 1D9EA 4M6PA 4IL2A 4C6FA 4G6CA 2VEKA 1HL9A 4R88A 5HNNA 6A3HA 1VKFA 3I3EA 1K8YA 1W5NA 3ECQA 3ICJA 1QDSA 1LRNA 3AHTA 4PUMA 5ABGA 4ACZB 4X63A 1DJHA 1IZKA 4GACA 2W79A 3I4KA 2W66A 4L61A 1HJXA 4H8HA 2OR2A 3I6TA 3HU7A 4W5UA 2G95A 5XIMA 1ZTVA 1KGUA 4IMCA 1TTJA 3MVTA 1PO9A 2KZHA 1V0MA 1MMFA 5K4ZA 3PN8A 3P2VA 1NHSA 1H6VA 5C9XA 3ZJ6A 1EX1A 1ECQA 3QFWA 3RU6A 3N25A 3SIZA 4MYAA 1C92A 1LRTA 3VKKA 4DI9A 3ITLA 1W3JA 3M07A 3BO9A 1BTCA 4JTLA 1VENA 4UTFA 4F0HA 1GOQA 1AH0A 4L4OA 2DH2A 4AD0A 4NJHA 1M5WA 3FAWA 4NP7A 1MNSA 3HQPA 1X38A 5C6MA 2PLJA 3WELA 4I3GA 3W3OA 4GIEA 5BMWA 2FH6A 4QJ5B 3S1XA 1BVZA 5A3HA 1MEHA 1C29A 3ZLFA 3WLKX 4G2DA 3FHQA 1K02A 4GUJA 2YLAA 2Y0FA 4XIAA 1N61C 4PUDA 1KBIA 2HJPA 3BG5A 1E6XM 1V6TA 2IS7A 3A21A 3NZQA 4C1LA 1GT8A 1MZRA 1I2RA 4ZQPA 1PYMA 2A6LA 3H4GA 3W07A 3LRMA 3LPPA 3UXKA 4O13A 2W54A 2YB4A 4LAOA 1FWAC 1Z32X 1GPWA 2YBUA 4JBRA 2XJ7A 3CGCA 3OVPA 4JTAA 3H53A 2XIBA 4H7VA 3SCTA 2P0OA 3PZ9A 2NLIA 3SGZA 4IWWA 4TV6A 1AQ0A 2JKEA 1NF0A 3E49A 3TYDA 4CQ8A 1H5VA 3VKDA 4W4QA 1T40A 3UYCA 1UPPA 2WSPA 1OEPA 4FS9A 4PB4A 1EOMA 1XDLA 3FIGA 8TIMA 4I6KA 3R89A 5K3VA 4FPSA 3M47A 1PXGA 4MKVA 2PLKA 4Q4KA 1JI1A 2CC0A 3CHCA 5A6LA 5D2TA 2CBJA 4GRSA 5K9DA 1HP5A 2PP1A 3NSNA 4QCFA 2EJ1A 3U4AA 1ELSA 1WZAA 2WV8A 5CPNA 1VFSA 1BEUA 4IG2B 5EMYA 3NUKA 1S5VA 4HOXA 2CZ5A 1XIBA 1VPQA 2J8TA 4YNGA 4IFRA 3OBEA 4ZQRA 1ZXIC 2XIIA 3W2LA 2GJNA 3ARQA 3R6IA 4IICA 2NWRA 1MDRA 2BXYA 4ALDA 5LA0A 3UG4A 3CWOX 3EOSA 3CH0A 1JAKA 4LVDA 3VM7A 3RRXA 3LGGA 2VR4A 3QN3A 4ZQNA 3MKCA 4GIRA 2EXOA 3N9KA 4GWEA 5F4SA 4KEUA 3ZWSA 3HFTA 4JTEA 5A6TC 4O1DA 7TIMA 4ZA0A 2HK0A 4XBSA 1UMYA 3HG3A 2Z26A 6XIAA 4N6FA 3NG3A 5C7HA 3M44A 1YXYA 4CN6A 2AGKA 4H4QA 3BLPX 1N2VA 1KFBA 3LTSA 4Z1DA 3LZ5A 2TAAA 2P5NA 1LDCA 2VGGA 4NJJA 3N2XA 1O12A 2BWGA 2D2HA 4AZGA 1CXHA 5AYYA 3T78A 4BF9A 4IM4A 4JTJA 1MRAA 4O57A 1IXQA 4CVUA 1K70A 2Y8UA 1B3XA 3OQ8A 4WXYA 1SVDA 1AQMA 2PDNA 3ZXWA 4YXGA 3V7PA 4P8VA 4B5WA 1VAHA 1ZPTA 2G3FA 4HKPA 2IPGA 4B92A 4B4HA 4DJDA 2ZADA 3S9IA 4ZXOA 1NU5A 3EDJA 1XLEA 3BAKA 3CV1A 4DPQA 1RK6A 5AHNA 3SQSA 4CCCA 3EMQA 4IUGA 1PB0A 4GXWA 4DM1A 4QR6A 1L8NA 3EA3A 3KDOA 4AZCA 5DANA 3LHZA 5E9XA 4IQDA 4HHPA 6ENLA 3EX4A 3TNOA 4AAJA 4RDWA 4DAIA 1A0CA 1KM4A 3DGZA 3T42A 3HJEA 4C6NA 1QBBA 3CH9A 1DL3A 4U3CA 4CLMA 5CJ5A 4DJEC 5HOSA 1IWBA 1VEMA 5FS9A 1I45A 4JDBA 3GE7A 4N02A 2QUNA 3T9PA 4RZ4A 1FCQA 4V1XA 2CW6A 1IR1A 1XKJA 4OGZA 2RGLA 2ZX5A 1AK5A 3BARA 3SIMA 4AX6A 4JTIA 1QI2A 4RPQA 3VMOA 2ZE3A 3V75A 3GHRA 4CN1A 1XF0A 1OFOA 2ABBA 1KN0A 3VXGA 4C5YA 2ZZ1A 3UCCA 1KBKA 1H11A 1STZA 4GPNA 1V02A 2XVPA 5A2BA 2GFTA 4R85A 2AAQA 1KQYA 1IQ8A 3DAQA 3CEPA 4IIFA 5HMEA 3IJQA 3MCMA 1POKA 1TMLA 3S5SA 4ZB0A 1MWOA 4QX4A 1XSKA 3T55A 4Z2KA 3SY1A 3BAXA 2JEPA 5TD4A 5FOOA 4AWTA 3C2YA 3W81A 1ZAIA 2I56A 3UZWA 1JD9A 4JFVA 4PCNA 3JW7A 3IWPA 3PSWA 4DIAA 4JR5A 3C2VA 1AD4A 2GK1A 1SO3A 5BW6A 2E9LA 3W7QA 2WMJA 1UYQA 4JTKA 4XX6A 3UR8A 2GGEA 4GUFA 3EKLA 1Y0EA 1TR1A 3UJ2A 4L64A 3INPA 1TJ0A 1T3QC 1VJSA 1J6OA 1A4MA 4M56A 2VGBA 4H6KA 4F40A 1NVMA 2EQDA 2WVSA 4DVOA 2ESCA 3LNPA 3IPWA 1A0DA 3BZJA 2WAGA 5E93A 1PWMA 5D8WA 5LIUX 3RUBL 2E8YA 1OFBA 4UZSA 2BOEX 1LUCA 1JG9A 1FHDA 1W56A 1ECEA 1QR7A 1JD7A 3N3TA 3JU2A 3VO0A 1QT1A 1PAMA 4EMJA 4C1NB 3FSTA 1GPFA 3LXCA 3A5FA 4JKKA 2WZMA 4IT1A 4XZ9A 1VD6A 1OGBA 3LCLA 4APNA 1REQA 1DJZA 4NEWA 1S39A 4MOZA 3DK4A 1B4KA 3IACA 1MUWA 1R46A 3CZGA 4Z2LA 3G5EA 5FJTA 5G4WA 1V59A 2I1OA 1B31A 4LVBA 4QDMA 3LHUA 2XIQA 2RJHA 2GSJA 3PPFA 1FY6A 3NXFA 2X42A 3CT7A 2P53A 3N9RA 2JBMA 5AB3A 4GQ0A 5JCMA 4XAYA 3AUOA 2ADAA 3M0IA 1FTXA 4JYFA 1XLHA 4OHQA 3WQCA 1IT8A 5D04C 3RO8A 3SCRA 1LOQA 3LY0A 3QGVA 1KM3A 4PCPA 2GUYA 5K2ZA 1XCWA 1S2TA 1S5WA 4ZTXA 3FCPA 2QPUA 3VDAA 1GG0A 3NEVA 4LEFA 3LI0A 1M41A 3DFYA 1HP4A 3B04A 1H1YA 4JEJA 4U4MA 4YVVA 4GRTA 2ZTJA 3KTXA 1R87A 7ENLA 4GHRA 4YJ5A 3B8IA 4JTDA 1KTNA 1O94A 3A47A 3QR1A 5CZKA 1JCXA 3ARPA 3BWWA 4MFEA 3S2LA 3SCWA 2EG7A 1BG4A 1CB2A 1PKMA 3FGCB 4WJ8A 4C6IA 3TLLA 5BXTA 3E6EA 1OIMA 4RNFA 4MLRA 2EPLX 3W7DA 1Q6FA 3NL3A 3SFKA 4AXNA 4FLSA 3KBSA 4XO7A 3TZFA 3F4WA 4J3TA 2ALDA 2ACSA 1GQLA 1YTKA 1WDRA 1OT2A 3KRSA 4ZO8A 5B7ZA 2JK6A 2PTZA 1QPOA 3PZNA 4WXZA 3KTSA 3WK0A 3AXXA 3F4VA 3HF3A 2A3LA 4JTFA 3S2MA 2UBPC 1FWEC 3SB0A 4WQ6A 4HYVA 3QTPA 3EXSA 1A50A 1RPXA 2A21A 1S2WA 1R9ZA 4WJEA 2YA1A 3LMYA 3NXLA 1HJVA 3VTRA 3OVGA 4XVEA 4W88A 2RH9A 1KFJA 1J2BA 1XLKA 1GRGA 3IJIA 4QXIA 3CPUA 1BKSA 1KFEA 1LQAA 1E3ZA 4LNCA 1TX2A 7REQB 2WSRA 3W24A 2XGIA 1JDCA 3L4XA 4ZMGA 2WKLA 3SZ8A 3C0JA 3S5ZA 4ZE5A 1VCVA 2QCHA 2HDJA 2PCEA 3T09A 2TPRA 2VZUA 1R3WA 1QNVA 1NP2A 2A7RA 1UBPC 5F4XA 2ZXAA 1VC4A 4MY9A 3DHPA 2C6QA 2PUZA 1JUKA 2VD8A 2PDFA 2QCDA 5A6KA 2EO7A 2WNWA 4PMJA 2J25A 3WK3A 4Y6GA 4MB4A 4ZSTA 4V33A 4G7FA 1FKXA 3DU0A 3M6DA 3CQIA 4TX8A 4LH8A 3PUGA 4PUUA 4DWSA 4Q32A 3VC6A 4JQ9A 3AS1A 1SZRA 1I6NA 2FVMA 4XISA 1UC5A 1IXPA 4W8BA 4ZBCA 1IT7A 3EZ4A 2GZXA 2ZX6A 4GZ7A 2J75A 3NZGA 4JIHA 4QG8A 1QHZA 4HU4A 1XBXA 3L5MA 3PNUA 3WJZA 2OT1A 3MWAA 1LBMA 3OJGA 2CLIA 4AIEA 4MDOA 4MTVA 2MANA 4JCLA 5RUBA 1J2WA 5CPSA 1PDZA 2C16A 4C6KA 2YCLA 1XIFA 4L4LA 1PX8A 4N9EA 4Z0JA 3M5ZA 4S3JA 3P0WA 1XLLA 3G8RA 2W0HA 4GXPA 1TPC1 4WCJA 3WNNA 3WMSA 2X40A 1XD1A 1J5TA 1R3VA 4ORMA 5H1WA 3OGVA 1ML1A 5KZEA 1LP6A 2B7OA 1BVWA 1H4PA 3EKGA 4HYWA 1QU4A 3UT0A 1TPDA 4UTIA 4RKAA 3EAOA 3OA3A 1HFBA 3BZGA 4IX2A 3WDJA 3ALGA 2YCIX 5F7UA 4Y8FA 4O53A 5REQB 1GQJA 4WHBA 4FX7A 1GWJA 1VLWA 3G3MA 4FMVA 1FWTA 3CGDA 2TRSA 3CHDA 5BWAA 4S1FA 5FF2A 1B54A 1YEYA 3W0KA 4CNOA 4W93A 3DFQA 3T8QA 1I60A 1M6JA 4V1YA 4GUHA 3O6CA 5CKSA 1ZMCA 2NUXA 2HROA 3WCZA 1Q6CA 3NM3A 3UETA 1A53A 1JF5A 3U48A 2ZUSA 4F2UA 4I9JA 2XN0A 4LUJA 4FHAA 4HB7A 1YBQA 3QC0A 3VKCA 4OUIA 2YX0A 4H1ZA 4BQ3A 2VMFA 4Z1CA 3CIVA 1QPRA 4HOWA 5CC7A 1RP9A 2DQXA 2VWSA 3B40A 3A23A 1CGUA 3W53A 4DWSD 3KM8A 4QM1A 4NZ1A 4UTTC 3H7VA 1XDMA 3O0HA 5HPOA 4FALA 4HNTA 4DN1A 3EX6A 4XD3A 1J5SA 4CKQA 3M6YA 3AMCA 1DTUA 2XN2A 5DF0A 3VK5A 4YTUA 3CQ0A 1N8WA 2Q8LA 3RRAA 3LK6A 4C6EA 2C3DA 1E9IA 4JN8A 2O9PA 1B1YA 3TUUA 1KGXA 1WQ5A 3LN3A 1EJXC 2GVLA 1W5PA 1KFCA 3UD6A 1D7KA 3IRDA 2BDQA 3E0VA 2ZYFA 5IFTA 4P7RA 3E2VA 3LA4A 2ISWA 5KSWA 5HR7A 1P0BA 4CU8A 3P3BA 4N6EA 4Q6XA 3M0JA 2XFYA 1BQCA 5AHLA 5G1MA 1XUZA 1S2CA 1OC5A 1EEPA 1R2SA 2FH8A 2NV1A 1WDPA 3BDKA 1S2VA 2H6RA 2CLEA 1V5XA 3LD5A 1GOMA 1ONFA 5E0KA 1VFTA 1TUXA 4B91A 1EGZA 1BWVA 3UXDA 4J1OA 1EGVA 5M03A 5G5GB 1E9LA 3DYOA 3TONA 2PEVA 1U83A 3IANA 2QV4A 5DRIA 5CZ0A 4DJFA 5A6SA 1TVNA 3W2NA 1JRBA 3K46A 5C0QA 4Y9PA 4FX9A 1VEPA 3NQ8A 2D0FA 2ZX8A 3ATYA 3W26A 3BMXA 1DJYA 3ZOAA 4JHOA 1PIFA 1C7SA 3TOYA 2J7EA 3BG3A 2A3AA 4JD4A 1IT0A 3W7OA 4KRTA 4D6FA 3WQEA 1V3LA 4J4KA 1F3PA 3GD3A 2X2YA 3PZTA 3TX9A 3G1AA 4XG1A 4NZ3A 4I7VA 4WY0F 3W7JA 1V0LA 4N42A 2B7PA 5HDRA 4I7WA 2EPKX 4ICNA 4PMDA 3IIZA 1E71M 2OMAA 1Z41A 1D2KA 4MNMA 4AY8A 5GNXA 4AHQA 4C6BA 3L4YA 1B30A 3F2DA 1NTHA 1XI3A 3U7BA 3BLKA 3RNMA 1GEUA 2FVKA 3M43A 4QQ3A 3KZSA 3VUSA 3HOJA 3N18A 2V8ZA 3M0VA 1SZGA 1B3ZA 4W89A 2GVEA 1VS1A 5DY2A 1ZJHA 4F79A 3MV11 1KR1A 2EKCA 2BY3A 1IXOA 3L2IA 4GI4A 5FJOA 3GU1A 4V2XA 4IUOA 3OG3A 5FA5A 1RCXB 1FP8A 4US5D 3CL7A 3KCOA 1TV5A 2W4XA 2GQ3A 3E2QA 5CC3A 1HKWA 2XUCA 2Y24A 3W7EA 4CQCA 3USBA 7XIMA 1DBTA 1OT1A 4LXFA 1N63C 4L9YA 3N11A 1W3IA 1S1RA 1TRIA 1UD3A 3A3WA 4FLQA 4LYKA 4IPNB 3HQOA 1ISYA 3OLDA 4EM3A 5DN1A 3N17A 4O11A 1PZ3A 4F0LA 3M7WA 5FI8A 2J13A 3EX2A 3NO1A 4GQGA 4KS0A 3R5EA 3MJMA 2JGYA 2ZZBA 2FMOA 4Q8MA 4NT0A 2X50A 3W84A 4PMRA 2P1FA 5EYWA 2H8XA 4FOJA 2ZE0A 1W0MA 1PX3A 3QMRA 2DJXA 3QV9A 4GGHA 3QHMA 1Y8BA 1FEAA 4MYXA 2C1GA 2VGFA 1QHPA 3TYUA 3AZTA 1O7AA 3TN6A 3VNDA 4Z2IA 4O12A 4XTDA 4WIWA 1G7VA 4UFMA 1V0KA 1XICA 4PFMA 4AW7A 4BR1A 3GH4A 1VIZA 4LNYA 3HV9A 1UZHA 4UQEA 1FH9A 3CIWA 4H8NA 1V02E 3UGRA 4M6UA 4O8RA 1XH1A 1XYCA 1QASA 1SSDA 2CLKA 4ICCX 2CDUA 2BY0A 5CH9A 3PTMA 4XAFA 3KLLA 2DZBA 3PFMA 5AC7A 1QMLA 4UZUA 3N13A 1KM1A 2PA6A 5D03A 3BLDA 3O0FA 3GLCA 4JNYA 1JFHA 4O1CA 3PJXA 2XPKA 5C54A 3TTSA 4KPRA 4XAGA 3RK8A 4G9PA 5JUVA 5JCNA 1R3TA 2ZA2A 3TOPA 1XGEA 4OT7A 1JAEA 4O1BA 4QNWA 2D73A 1OX4B 3WX7A 3P5YA 4E8DA 3T1GA 3OU8A 2PTYA 4QG9A 4RE4A 1AOGA 4GI8A 1YDOA 4CVWA 4JTHA 3GZ3A 3N29A 1DVJA 2WM1A 3WYZA 2CIPA 2WMGA 4JTCA 1WKDA 1WKYA 1TA3A 1WBJA 1TE1A 4HZ7A 2PLMA 4MLJA 4K8DA 4ATWA 2AGTA 2Y8KA 1DIEA 2Q01A 4PEEA 1NSJA 3LB0A 3AICA 1ONWA 1Q6DA 2X41A 1AMYA 3UPWA 4WDTA 3L66A 3L5OA 2YL5A 3MUIA 2X0YA 1H0IA 3AHXA 3KOFA 5HAOA 1EJWC 1W6TA 2V2HA 4LU0A 3H12A 5GJNA 3AIUA 4I8YA 1J93A 3MSRA 3CAVA 4IJRA 1QOPA 3GBDA 5I3HA 5KETA 4XZHA 2NVDA 4AC1X 3ABOA 2CZFA 2WZEA 3QYSA 3HMCA 1E1CA 1SFTA 2BXVA 2IKIA 2F6XA 1QWKA 1EWDA 2Z29A 1JEHA 2ZRZA 1J8VA 2CERA 3ZJ8A 1FUYA 2OWCA 5G2WA 5IBXC 3S1UA 4GVGA 1E51A 4I5UA 1HNYA 5A5WA 3T40A 3QQWA 3EUB3 3RM4A 1XC4A 2FPYA 4M6VA 4Y7EA 2WCSA 1ZU8A 1GETA 2RDXA 3LBMA 2VUYA 3BOFA 4IIHA 3TQVA 1FDJA 2D3LA 2Y85A 3AU6A 1H7XA 2J7HA 1H7WA 2O92A 4BK9A 4JIEA 3KVMA 1QI3A 1GVSA 3Q2DA 1JULA 4UUIA 4HCDA 1EX5A 2O9OA 3UG3A 5AHIA 4HHHA 3VVGA 1VDVA 1HO4A 2QIWA 1F74A 4JIQA 2AL1A 2D24A 1AH4A 1JUEA 2F7FA 2W6RA 4XUYA 4DY1A 3DECA 2IXUA 3N1AA 3IJ8A 1KRCC 2WCGA 3FXGA 3NPWA 2NZLA 1KW1A 3A4WA 2Q8XA 4AWEA 4B90A 1QNSA 1FWRA 1DXIA 2D2OA 3OYXA 1Y5WA 3ZR4A 2BGSA 3G2GA 4ZB5A 1JL8A 3WF2A 2HPIA 3SW6A 3BICA 4L4PA 4MWAB 1HGYA 1F73A 3WEOA 1F8IA 3VGEA 2WJFA 4TR9A 2QS8A 4JY8A 3NQ7A 4GKLA 1UJPA 3R94A 3L8KA 4O16A 2VEGA 3AYRA 3DBNA 1K9EA 1YQZA 7TAAA 2WSKA 1PEZA 1XIIA 1WKEA 4GBDA 1FFVC 3W9ZA 2XFFA 2QIIA 2OYMA 4IGMA 1RR2A 5TNVA 5K9XA 1WXJA 5FEZA 3VUPA 2VFIA 3QR3A 5A8NA 4FNSA 3E12A 1Q13A 3ARWA 2NQJA 3C3NA 3U8GA 3QHNA 2PWDA 4EQSA 2XG9A 1TWZA 1BSLA 4XSLA 3CUXA 5FJPA 1MSSA 3CASA 5AC8A 4NRRA 5EFDA 4RNHA 5A1AA 2FZMA 3AWOA 2C0HA 1ODZA 1E6PA 1KM5A 3REQB 5DRCA 2JFEX 1PKYA 5F4WA 4QQUA 2C3CA 3II4A 1HKVA 3LOTA 1KV5A 1Q6OA 3N73A 4J3ZA 2C0AA 2BC0A 5KZMA 3P82A 2ACUA 3VFCA 3BURA 3QW3A 4UNKA 2GK1B 4A35A 3NL5A 1WP6A 1V3MA 3HG2A 3MHUA 1GRBA 4EAYA 5U7SA 3WQDA 4EMIA 4LBSA 1EC9A 3ZQ9A 1FWSA 4UC5A 4LF2A 3SN4A 4L4MA 1NEYA 2BOFX 3QQ0A 3W73A 5C9ZA 4FXRA 1NFGA 5LXEA 3PSVA 2VC9A 3STGA 2EKGA 2NLYA 2C1HA 4DBDA 4XZNX 1PCKA 2Z2BA 4EOUA 4MAVA 2G0WA 3NL6A 3MUXA 3LENA 3DFNA 1LUCB 3B0YA 1WDWA 5JRBA 4E38A 2UY5A 4JAWA 5I0DA 5GVJA 4GE8A 4Y8EA 1NELA 4MZ8A 2QAFA 3MI2A 1XYLA 3F4NA 3CPGA 4A3UA 3AIQA 4X3ZA 1P0DA 5AHMA 2ZUTA 5KINA 2QMJA 3UWEA 3B8WA 2VM8A 1Q1WA 3W6YA 1Z42A 1REQB 4FXJA 3TYZA 1LF1A 1NQKA 5I06A 2NT1A 2CHRA 4Q4MA 3FG2P 3A12A 3L4WA 1U1UA 2GGGA 3PS7A 4NZ4A 1X7IA 4F0KA 2QGHA 4CN4A 5D9MA 3WUBA 5BU9A 3W86A 3OZPA 1RPKA 4WF7A 3ZYZA 3MKVA 5GQBA 1FFRA 2ZZ4A 2VX7A 4EVZA 1O5QA 3G1YA 2ZXDA 1GOWA 1V93A 4HYRA 5DT7A 1H2IA 5DO8A 3DEQA 1JJKA 3W38A 1LJYA 3N2OA 1UQYA 3PB2A 3H2FA 4MJ4A 2IUZA 3UU0A 4C65A 4TVWA 5CGQA 4H9UA 2FTYA 1JF6A 3U4FA 2XVKA 3MUZ1 4NU7A 4UNIA 1QO5A 2IKHA 3ZT5A 4LQ1A 3WUGA 3L21A 4W9TA 3IUHA 2HS6A 1IV8A 1P1MA 4W85A 2I5GA 1AUSL 2GOUA 4DF1A 3ITOA 2VZSA 3OG2A 4TVYA 3E5PA 4O1EA 3K4AA 4W7WA 4EPBC 3PUDA 4KW2A 4ILSA 4ZL1A 2UWFA 1JZ5A 2BP1A 3UBPC 3WBWA 1EXPA 4HPJA 4O0ZA 3LV6A 1OHLA 2MNRA 4RJEA 2PRHA 2WQPA 1E4NA 1Y65A 2AQVA 3WJWA 3L2LA 3HPXA 3RM8A 3T81A 3NQMA 5ABHA 3R43A 1H0GA 2A3HA 3ARUA 3ANYA 3TYCA 3K30A 4W5ZA 5CSSA 2WP5A 1LBLA 1WXZA 1YHTA 4UNLA 1LROA 3UVIA 1X8FA 1R47A 2CLFA 4NXSA 3C2EA 1IWAA 3BOLA 4O1FA 1SW7A 1ZY8A 4J7RA 1B2YA 3EX1A 3C61A 1UH4A 4WZHA 4MPQA 3B4YA 5CJNA 1LLZA 5AYBA 1VYPX 2JALA 1DV7A 3B8UA 3GXFA 3H4XA 4XQ6A 3T2QA 5A6BD 4EF8A 2ZKMX 2AL2A 4PH6A 1XH2A 4JKMA 1CB7B 4Z1YA 3B9OA 2Y2WA 5HQLA 2XZ7A 4YL2A 4HNVA 6ALDA 2ZOXA 1DEDA 1QPKA 1XYAA 4NNAA 1WDSA 1Q5MA 1H41A 3G0UA 1EL3A 4IMEA 1MO9A 2R24A 3DKJA 3SUTA 2QCGA 3S46A 4Q4OA 3CZLA 1J0YA 4PBGA 2D23A 4L1WA 4HN4A 5D2VA 1OBAA 1E0XA 3U2OA 4ZSUA 3W4RA 4Z2JA 4YU1A 4O54A 5HPCA 1S1PA 1LG2A 1SZNA 3BGAA 4P8WA 1XUUA 4ZE4A 5HNTA 1RLCL 4O0QA 3VNKA 1HKJA 3PUOA 1SPQA 3ANVA 4UR8A 1W17A 3GZAA 1BG9A 2VWTA 5LZLA 3CNYA 2JEQA 1XSIA 1MXSA 1N62C 3UQNA 1CIUA 2G3IA 2QAEA 2JE8A 2YCLB 4QITA 3HM7A 1EUAA 4HTYA 5JCLA 3W7HA 3I7SA 3WL0A 2CLLA 1O1ZA 4KFPA 1BLIA 1CLKA 1BYDA 2JF6A 3TZNA 1N5XA 3OVRA 3M0XA 2PDCA 3IS4A 5BROA 1UR2A 4PZVA 4NILA 1DJIA 3S3GA 3M41A 3PAOA 4FX8A 2I9EA 3TC7A 2V5DA 1X6UA 1H2JA 2VRKA 4E4UA 4G1NA 3TN5A 1CTNA 3WF4A 1Q3NA 1YXDA 1JEZA 2GJLA 3EGJA 4M51A 2VFGA 1UIPA 4F9DA 3T4WA 2J27A 5MHBA 3EEZA 4JPGA 5TQLA 5M1TA 3VGDA 3ENLA 4IHCA 2FQIA 4BWLC 3AC0A 1FCUA 3STFA 1SW3A 3CL8A 2CNCA 1MXGA 4QS5A 1DJQA 3RIKA 3CEUA 3AMZA 3UJRA 5I09A 3L7RA 2V30A 1QJWA 3FVDA 3XIMA 3CXOA 2DZAA 3KOYA 5EU9A 4B2DA 1JGIA 4HU3A 4DQWA 5LKYA 1RBAA 3VGBA 3RX3A 5EFFA 1NOWA 1X98A 3FN9A 5HATA 3CZJA 3DK8A 1OF8A 3FKKA 3LPOA 1YNYA 3W7CA 2Z1SA 1JNDA 4UMBA 1UUMA 4FK9A 2PRMA 3CU2A 1SFLA 3UWYA 5HWJA 2BV9A 4ZB2A 2QCNA 1CLXA 3QR0A 2WPBA 4NSBA 2XSAA 2UZ9A 2WPGA 2VL4A 3LHWA 1C8XA 2WWCA 4IPLA 3PTDA 1DKWA 1RV8A 3P7YA 2DSZA 4DUOA 1RUSA 1F5ZA 3KE0A 1JYVA 4ZTYA 2X1SA 1J0ZA 4JFUA 3MC5A 1NDAA 2A3BA 4DBWA 1H7OA 3STEA 2GJPA 5FL1A 1WOBA 3QMSA 3PBVA 4E3VA 5AOUA 3VGHA 4FOUA 5JVLA 2G3JA 3UNDA 1VCFA 1WE5A 3TR2A 5FL0A 4PODA 5D38A 3O07A 3U2EA 1QNQA 1W9BM 3W7MA 3AXIA 4HZ6A 4KCTA 1J0HA 1EUNA 4AF0A 3HGOA 3EDFA 1SO5A 1W5QA 5JBDA 4UFIA 1L9WA 1SB3B 2Z0IA 3N4AA 2QGYA 1X2GA 3BANA 4JZ5A 4U10A 2DGAA 4RXFA 3HBLA 3KRBA 1BRLA 1FFQA 3NYDA 3MA8A 4D6JA 3LRLA 1FHLA 1OIFA 1XBVA 4XBKA 1IIHA 4ML9A 1OABA 2MUCA 4DI8A 5KZDA 4HK6A 1WDQA 4JIIX 1FIQB 1L2UA 3OLIA 3A3XA 4S3FA 3GNDA 1O68A 3WH8A 2EAWA 2W63A 4CQDA 3KOZA 3U7VA 4IGHA 4D8ZA 3GDRA 4B2DD 1ZDLA 3ABQA 2YBVA 2WMIA 4O1AA 2E9BA 4ZQOA 1XCFA 4ZFCA 1ZHAA 1V4YA 4B9ZA 2I14A 2VGIA 4MWAC 1EXBA 4FAMA 1JRCA 3W29A 3TAOA 2PAJA 3KAOA 5DXYA 4JX4A 1OYAA 2Y7EA 1I4NA 5EBAA 4AIBA 2WHMA 3GB6A 3STCA 4YCPA 1I2OA 1K4QA 1PZ0A 5E1QA 2NX1A 2C8NA 3WMBA 3OB8A 1Q7ZA 1RBOB 3K8LA 5TR3A 2OODA 4BFAA 1V3IA 4QJ1A 4A8NA 2HPMA 2DZXA 3PZUA 2ZBTA 3ZFHA 3SECA 3ITXA 1H50A 2DV0A 3LGDA 2XINA 1VEOA 3CUFA 1FWBC 3M0YA 3RHGA 4AWUA 4WKFA 1JPIA 3M5YA 6TIMA 3WUEA 2WVUA 4NL1A 1LWIA 2O7SA 5EGRA 4YHEA 1QW7A 1NHQA 3EX3A 4HSOA 4KESA 4AIUA 1GQNA 4MPKA 4DNMA 3EWCA 4ZQMA 2X0SA 3DDMA 1IZCA 4J2MA 4XBJA 3N2BA 1TWWA 2ATMA 2OJPA 2G3MA 3URQA 2YJQA 1UR4A 2VC5A 3KL0A 2YVJA 3K8KA 1VQTA 4HK5A 2HZGA 3UW6A 5C9RA 1XHCA 2PZNA 2XFWA 2VVNA 1P6WA 4XSMA 3R2GA 4UOQA 4AHOA 1IE7C 2YXXA 2VELA 3DC8A 1XBYA 1CZ1A 4PULA 1E73M 4L56A 5I23A 4IGNA 1DXFA 2RABA 3NVYB 1YIXA 4WSKA 5D2YA 2FYMA 4X9SA 3SCVA 4ZXLA 3LUTA 2NSXA 3NVZB 3B4UA 3GAYA 1FVPA 3RYSA 1L6GA 1VQZA 4DF0A 1DJWA 5C2CA 1VB9A 4PUJA 4R7JA 3Q37A 1HKIA 1S5TA 2HNEA 3LBCA 4EX4A 1PSCA 1XD0A 3V3WA 2FB2A 2EPNA 2EG6A 3H2OA 1JIBA 1Q6QA 2EJAA 3ITCA 3SCSA 3O3RA 4N7QA 1N7KA 1JYWA 4PEKA 4BQ2A 3FK4A 4M52A 4AZ5A 1MFVA 1Z44A 4UCFA 3ISIX 1RD5A 3B8TA 3K4DA 3TW7A 2XH7A 2VJXA 4EE9A 1XQLA 1Q4NX 3SCUA 1FH7A 1XYBA 3GTFA 3V16A 1UWRA 2OLHA 4US6A 1G4EA 1R8LA 2OPJA 1EDTA 2BG5A 5HA7A 4H50A 3RLVA 1CI1A 3A64A 1NWSA 5ECVA 3P0XA 1WDDA 3V4BA 1LPFA 1OCNA 1UA7A 2CHOA 3R10A 2YB1A 2QPSA 1UUOA 1TUFA 1TG7A 1ZL1A 2F9RA 3QLLA 3GXPA 2BGQA 2OKOA 2W62A 3UXIA 1ZX9A 1EGMA 3NGFA 4YYCA 5GNYA 1CECA 5E0FA 1MQQA 1RJQA 2ALRA 2AKZA 1EC8A 3GU2A 3FX4A 4HA0A 1XINA 1W9DM 2QMKA 1GOKA 2QQ6A 2FLIA 4OVXA 4BY3A 5G4EA 1NHRA 1UROA 2EHHA 2WVVA 4QJ3B 2NVCA 3I3DA 4E4FA 3H8AA 2QW5A 3BAJA 4HIBA 4M3PA 3NS1B 3M7SA 3ZZ1A 1TV8A 1VH7A 1FWIC 4FP1A 1W9VA 5LIYX 1KKRA 4MKSA 1VLIA 3SSZA 4C6DA 4UTKA 1M9HA 1G4PA 4O0KA 2CBIA 1E1CB 3PG9A 4F3HA 1J10A 1EF3A 2ISVA 2O7QA 4IPJA 1GKRA 3AIWA 5AC5A 2Z2UA 3VNJA 3SRHA 3DFSA 1IGSA 3WLIA 4NYYA 4JXCA 4A3QA 2INFA 3P6LA 1B90A 5KVIA 4CD5A 3P8JA 5AYZA 1DWAM 1W1TA 2DFAA 1DQUA 4E4PA 4AUBA 2Z24A 3ABXA 3TJXA 4N9BA 1QW8A 3G24A 3LCHA 3NVDA 4ICMA 1H49A 5E6ZA 1OYBA 4LY4A 2HRWA 4HPNA 2Y5EA 2D1ZA 2OO6A 4O19A 4OWGA 4K37A 4RLIA 2PTWA 2ZXBA 3KUMA 1HG3A 3GUGA 2PDJA 4TTUA 2WXDM 2INEA 2WCAA 1AQHA 2WOWA 2EPMX 3W1XA 2GLKA 1V6WA 3M64A 2R6OA 1W9PA 3AHYA 3THQA 4S2BA 5EB8A 3GTNA 2YSWA 2O0TA 2GQ8A 2VURA 3I65A 3C6CA 4NHVA 4PR4A 5IOBA 3JZEA 1SSGA 4TTGA 2DVXA 1X39A 3AOFA 4D72A 4Y96A 5T9BG 5EL1A 3W28A 3HN3A 4C6LA 4AWSA 1X6LA 4UCGA 3C3UA 1TPB1 2OB3A 2QUUA 3I4EA 2CLMA 4UQ9A 3N2CA 4U5IA 3WG6A 3QC3A 3FV9A 3IJ7A 5KVHA 1AJZA 3F1QA 3A6OA 5EMUA 4DB7A 3MCOA 2WLZA 5CLWA 4K68A 3G1HA 3LQLA 3TQKA 3GD4A 3AJXA 3NDOA 3BGJA 5FMHA 3VOIA 4HGXA 3RFAA 3L4TA 1XLFA 2E28A 4X61A 3VE9A 3CZEA 1PBGA 4AQLA 1GVYA 2NV9A 4GYPC 1QHOA 5EMJA 3T6CA 3IV8A 1GYLA 1SMAA 4Z08A 2BB0A 1UW9A 4LS1A 4RDYA 2DZWA 3KHDA 4J3SA 4U3AA 3MKKA 3QV8A 3EOUA 4JN7A 1A47A 4L6HA 5JQ9A 4ATLA 2J9YA 3PC0A 3LLDA 1PJ9A 4UTHA 1L6FA 3EOLA 2PC4A 2ISSA 3GQYA 1ODUA 4E5TA 1OG6A 1XRTA 1UD8A 3MT1A 1NOUA 1UIOA 3NVTA 4GK8A 4AEOA 4XAZA 3NQAA 2J4GA 2AAAA 2BS9A 5A6MA 1HL2A 2YW4A 4K39A 5AVHA 3GHSA 3V5OA 3PZGA 4NRSA 2OEMA 3MMWA 3D3AA 3NQVA 1GYMA 3R7MA 4AEFA 4CNSA 4A6GA 1W9XA 2CLOA 3SADA 4XKYB 1W2PA 3KDNA 1F6PA 4W7VA 2QV5A 2OWWA 3KZPA 3LRKA 3N34A 5E09A 3AM9A 1E43A 5PTDA 4HZMA 3URAA 3WEMA 1QNOA 5H2ZA 8XIAA 4KERA 3B9EA 2E68A 5I3JA 4OFCA 3DJJA 1P0EA 4H00A 1DHPA 3BUVA 3KRUA 3GYCA 3VIHA 4DBSA 1JRPA 2G50A 1JI2A 1ZJIA 2V82A 2GQ9A 1QPNA 3DUGA 3QF0A 4JFWA 5IRPA 3EB2A 6REQA 4C6JA 1GTHA 5H8UA 1CWYA 3EMCA 2BNJA 1US0A 4UMAA 4CQ9A 3UR2A 1E3XA 3E1F1 1T5AA 4UFKA 4LSBA 1FWWA 5HK4A 4LX4A 3VE7A 2NQLA 2VYOA 4B4FA 2JGQA 4KCUA 3ZS4A 3UESA 3VABA 4UR9A 3NQDA 4LAKA 5T9CE 3E3HA 1T96A 1W3NA 1XXXA 1CPUA 5C2XA 2Z7KA 3LG3A 4WK9A 1HX0A 3E38A 4JTUA 5I3DA 1H3GA 3PFRA 3LV5A 1TPUA 2ACRA 3HO8A 1OD8A 4ZZ9A 3L5AA 1RA0A 3TN4A 3D5HA 1EZWA 2YDAA 2FZ9A 2YPIA 3WN6A 4QSFA 4JIRA 3WENA 1ISXA 4GLEA 1KTBA 1RSCA 1U33A 2P0IA 3GC2A 2VT0A 3FAXA 1V6XA 2TODA 4M80A 2B31A 2WHKA 1TPH1 2A7NA 3RLHA 2NXGA 4Q4PA 2WSYA 3DHFA 4RDVA 2WNQA 4MGGA 3LU2A 2D0HA 2PGRA 2V5KA 5CBJA 4Q8WA 2WMKA 4RE2A 1A5AA 3MSGA 4H6RA 2YL6A 4XZMX 2AAMA 2RJGA 2X09A 3MW7A 1OK4A 3U0HA 3N14A 3E5BA 1FHVA 4IIEA 3DHDA 2QCLA 5AC6A 2Q09A 4BI7A 3RJYA 2HMCA 3TLQA 4FI4A 3R0UA 1R2TA 1SO6A 4BI5A 4CNPA 4S38A 1DJGA 3AALA 2A1YA 3NQ2A 4QNEA 3GR4A 4NJKA 4Z1AA 2DT1A 1S5NA 3OHMB 1GVIA 3AIBA 4O17A 2QEZA 4K7VA 3EB4A 4V28A 1H7PA 5CG7A 3H2EA 5CXPA 4P8UA 3KP1A 4DJEA 1Q1RA 1JDAA 3NM1A 1EBHA 2FDSA 1P7TA 4O50A 1F8WA 3MS8A 1CX9A 4IIGA 1B0IA 4RR4A 1W8SA 4EMWA 2PD9A 4O8AA 1ONEA 3PJWA 3N2MA 1GZJA 3W02A 1TMHA 3C2RA 2CZVA 3CJPA 1WX0A 3APYA 4Y9NA 4LWWA 1TYTA 3GNPA 4PN2A 2DSVA 3CGTA 3EPMA 4N9DA 1WB0A 1PKLA 1KLZA 3PZIA 3UF9A 1QRQA 4LRTA 1MRQA 1W8GA 3RILA 2J66A 5BNKA 3BV4A 1GUVA 2ZVRA 1I0DA 1W32A 2H9AA 4KFNA 1ZLPA 2PDQA 3LDVA 5CQ1A 3OIHA 2FTPA 2HTMA 2AL2B 1TQJA 4FNRA 4CQAA 4KRZA 3S47A 3HURA 4UTJA 4LCQA 3LM7A 3CV6A 4KGLA 1U1JA 5E6YA 4M1BA 3GHUA 5LIWX 1KFLA 4YTQA 3GVQA 2CBVA 2DU2A 1E6NA 1K9FA 5E70A 3QTGA 2VTFA 2VDGA 2Z27A 2WQDA 1BGAA 2PFHA 3AS3A 3HPAA 2A85A 3EB3A 5F1UA 1TCDA 4QE5A 5MKGA 4LT9A 1AW2A 4QEEA 5A8MA 3G3DA 3MU7A 5JBFA 2TSYA 5BYWA 3G18A 1PVNA 2H3DA 1YTEA 2FGZA 2A4AA 1XWYA 1QNPA 3TSMA 3C5QA 4PYSA 1ICSA 4PTXA 3SR6B 4A8RA 2V67A 3QHOA 2TMDA 3BJSA 3WLNA 5DXXA 1V6VA 1VBJA 1FBAA 1POJA 2PWUA 4XZWA 3UNTA 1A5NC 3WQ5A 3AXMA 4H6EA 2NQ5A 3PWGA 1GRFA 1D3CA 1FHUA 3PBMA 1MXDA 1AVAA 3O16A 3M5VA 4NNBA 3QLDA 4AVFA 1NFBA 4JX5A 4DZ5A 4XZBA 4WD0A 2E3ZA 2Q71A 1LL4A 2Q8ZA 3B9NA 5CSRA 1A3HA 3U9IA 4QROA 4AD3A 4W8AA 1LG1A 2VZTA 2ZVIA 3H21A 2CBUA 1BXBA 3O7UA 3VIMA 3AMDA 1B4EA 1OQFA 1RALA 3CL6A 3RNDA 4H7CA 4Y9OA 3BCFA 3MHGA 2VO5A 3M4HA 2ONEA 1PV8A 2QT3A 4XD5A 4EM4A 4GKTA 2WJZA 3W1NA 1TFVA 2CWNA 3FSUA 2PGEA 2AKMA 4ERGA 3BW2A 2VX5A 1TV2A 4TVCA 2QUTA 4D1JA 2NUWA 2IQDA 3S2CA 4Q8NA 3ALFA 3GVRA 2DSKA 4LS2A 3VOJA 4FDCB 4AFYA 1VGAA 5CPOA 4EP8C 1H62A 4GH3A 3RPDA 1TVPA 4NJGA 1PUDA 3UVAA 4GZJA 2VC6A 2X30A 1EP2A 3QQ1A 1R7AA 1XIMA 2WZHA 1EOKA 1FDYA 2XTKA 1J79A 1FA2A 2ZTKA 5D2WA 3UZJA 4AZHA 3F03K 1LOLA 4JTQA 3SBFA 1WKFA 3AWNA 3BLFA 2XZ9A 1HKMA 3A13A 4HZ8A 3DZ1A 3TAKA 2XIOA 3P62A 4XD4A 2CFYA 4QLLA 3GRIA 5I78A 4X60A 3O06A 1DPMA 2P3ZA 1GNXA 2V3BA 4W84A 4G7EB 4X2PA 3HG5A 1RAKA 3VD4A 4G56A 2EEXA 1Z3NA 2A3CA 2J6XA 1NARA 2JKAA 4AF0B 3DN5A 3H2MA 3ARVA 3KBVA 4MJZA 1BKHA 3MUCA 5I3KA 4H9XA 1J0JA 4EWND 1TYGA 1VFFA 3L0KA 3IVSA 3S1GA 2XM1A 3LHVA 5CZTA 4H4XA 2PDYA 3CHEA 1BRLB 2JQXA 2ZZ7A 4JQAA 2OT0A 3OZMA 3TP4A 1VFHA 1DQXA 1GJPA 2OSXA 3DCPA 4V27A 4D8AA 1DWJM 2EQ6A 1TX0A 2PRLA 1MEWA 3GHTA 4W86A 2VOMA 2I9UA 3WZ0E 1CYGA 1V3JA 2RUSA 1W1YA 1A80A 4H4IA 3WH5A 4GBUA 3QOMA 4J27A 3E0WA 3OVQA 5BXRA 1F6YA 3NVWB 3WLTA 4YWSA 3HGJA 3VOHA 3MP3A 1W3LA 1OWQA 3B3DA 4D6GA 5IXEA 3WLSA 2DZTA 1UOKA 3NOYA 4RL3A 4HCHA 1JZ3A 2V9DA 3S4TA 1AW5A 4A29A 1N55A 4GMEA 4R3UA 4F0RA 1XPGA 1QCWA 1QO2A 4E6MA 1PWLA 4Q8QA 1G01A 2H90A 3VM5A 5C8BB 4WLCA 3HPSA 3OEXA 3S5YA 1LOSA 1KD0A 4PBEA 2YGYA 2ZWYA 1EIBA 2PMQA 3OZYA 3QY7A 4YN5A 3CIXA 1DNCA 3II1A 3SUSA 4X9YA 4I8DA 1VBRA 2A5HA 4JYEA 4P7QA 4PL1A 1DIDA 1XLIA 1RK5A 3O0KA 4Q22A 3OOQA 3LMZA 3URHA 2ZX7A 5U4NA 5FD0A 3VDGA 4LYRA 1EPXA 4OUEA 1VF8A 1HJWA 4D71A 4LUTB 5M3WA 1UWIA 4AD1A 4H2HA 4LRSA 1M1BA 1RCOB 1P6CA 4HA4A 4HMEA 4TVUA 1M7JA 4L1XA 2J7GA 3ITVA 1N5WC 4Q8OA 1LWHA 2GQAA 5BMXA 3P61A 1QWGA 1S2AA 4RPPA 3FHAA 5I02A 1TIWA 3W1QA 2PBGA 7CGTA 1LLOA 5IHRA 2WSQA 4FLOA 1MUCA 1MW2A 1GEQA 2CKRA 5FF7A 4LUYA 1AMKA 3T08A 1FX6A 2GDQA 4CNNA 4C7FA 4JGDA 2PWHA 2YCJA 4TOQA 2E7FA 3TYBA 4FA3A 2HK1A 2B7NA 1OX6A 1O4UA 3MI6A 1EC7A 4DO4A 2HISA 1UR1A 4EQXA 1LZOA 1ITQA 1UASA 1UR8A 3OC4A 3PF3A 1UA3A 4HMDA 3W2JA 3T0DA 3GXNA 4DEFA 1XIEA 3ARRA 3P8IA 4CD7A 4K38A 3OPSA 1UR9A 3BAYA 1X97A