2QJNA

Crystal structure of d-mannonate dehydratase from novosphingobium aromaticivorans complexed with mg and 2-keto-3-deoxy-d-gluconate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
402
structure length
385
Chain Sequence
MKITAARVIITCPGRNFVTLKIETDQGVYGIGDATLNGRELSVVAYLQEHVAPCLIGMDPRRIEDIWQYVYRGAYWRRGPVTMRAIAAVDMALWDIKAKMAGMPLYQLLGGRSRDGIMVYGHANGSDIAETVEAVGHYIDMGYKAIRAQTGVPGIASLPSVTGWDTRKALNYVPKLFEELRKTYGFDHHLLHDGHHRYTPQEAANLGKMLEPYQLFWLEDCTPAENQEAFRLVRQHTVTPLAVGEIFNTIWDAKDLIQNQLIDYIRATVVGAGGLTHLRRIADLASLYQVRTGCHGATDLSPVTMGCALHFDTWVPNFGIQEYMRHTEETDAVFPHDYWFEKGELFVGETPGHGVDIDEELAAKYPYKPAYLPVARLEDGTMWNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Evolution of enzymatic activities in the enolase superfamily: D-Mannonate dehydratase from Novosphingobium aromaticivorans.
pubmed doi rcsb
source organism Novosphingobium aromaticivorans
molecule tags Lyase
total genus 141
structure length 385
sequence length 402
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2007-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2qjnA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2qjnA01
3FCPA 3U9IA 2I5QA 3UJFA 4IZGA 3TTEA 2PA6A 3FJ4A 3I4KA 2OZ8A 4KPLA 4ZCWA 4IL0A 4K8GA 2OVLA 3SQSA 3TJIA 3VC5A 1EC7A 3OP2A 2ZADA 2GL5A 4E4FA 2OZTA 3ENLA 4IL2A 5IDZA 3Q45A 3SN1A 1JPDX 2XH4A 3UJRA 3V3WA 3DG6A 1WUFA 1P43A 2DW7A 2XSXA 3SSZA 4ZA0A 4JHMA 3GO2A 2GDQA 2PS2A 3ZLGA 3QN3A 2PMQA 4YWSA 1TE6A 3ZVHB 3D47A 2PGEA 2P8CA 3GY1A 3U4FA 3B97A 3DGBA 3DG3A 4IP5A 4JN7A 6ENLA 2MUCA 1FHVA 2PGWA 1MNSA 2PSNA 3TWAA 3DERA 4M6UA 3FXGA 3STPA 4DYEA 4GGHA 3R11A 2DW6A 1SJCA 4HN8A 3ES8A 3MSYA 3DG7A 2O56A 3OW1A 2AL1A 3DIPA 1E9IA 3QTPA 4MKSA 2AL2B 3MKCA 3SBFA 4M0XA 3UJ2A 2QJMA 2FKPA 3DFHA 1BKHA 3JVAA 2OO6A 1EBHA 2QJNA 1BQGA 3OPSA 2XH0A 3R1ZA 4H83A 3I6TA 3IJLA 3EKGA 2OQYA 4G7FA 2QDDA 1XPYA 3NFUA 2PU1A 4DWDA 4K1WA 3SJNA 3HPFA 4HCLA 4DXKA 2XH2A 2OQHA 2GGIA 5BOFA 1R0MA 3FV9A 3MWCA 4X2PA 5EU9A 1R6WA 5FJOA 2GGEA 2PP0A 3H8AA 2OZ3A 1ONEA 4HYRA 4H1ZA 3UXKA 4F4RA 1EBGA 3R0UA 3RO6A 4KWSA 3CK5A 3GD6A 3TOYA 3MZNA 5J04A 3UJEA 2PU0A 3RITA 3RCYA 4E5TA 4Z17A 3TCSA 3NZGA 3TW9A 1WUEA 2PODA 4GMEA 1TZZA 4GGBA 4MGGA 3MUCA 3BJSA 2FYMA 2HNEA 3THUA 1SJDA 3TWBA 3OZMA 1L8PA 3QKEA 3N6HA 4H19A 3RRAA 2P0IA 3UGVA 4GYPA 5BOEA 4ROPA 3GC2A 3IJQA 3CAWA 2HXTA 2AKMA 5FJTA 2AKZA 3FVDA 4K2SA 2OKTA 3N6JA 2P8BA 1KKOA 4FP1A 3OTRA 3PWGA 3R25A 4ENLA 3N4EA 3JZUA 3VDGA 1YEYA 4HCHA 3P0WA 2XH7A 4DHGA 1NELA 2OLAA 4GYPC 4GIRA 4J3ZA 2GGJA 3EEZA 3UJSA 3OZYA 3RR1A 2RDXA 2QDEA 3IK4A 3VCNA 2ZC8A 3QLDA 4G8TA 3V4BA 1ELSA 3PFRA 1MDLA 3IJIA 4KT2A 3SN4A 3Q4DA 1EC9A 3VC6A 3V5CA 2QQ6A 1NU5A 5FJUA 3BSMA 3PWIA 2QGYA 4GISA 5FJPA 2PPGA 1EC8A 3CT2A 3DEQA 3P93A 3P3BA 3CB3A 3BOXA 5FJRA 4EWJA 4IHCA 1OEPA 3VFCA 1FHUA 2POZA 2OG9A 3TQPA 3UCDA 4IT1A 4E4UA 3I6EA 3CXOA 4A3RA 1XS2A 2OPJA 2PTXA 3MQTA 7ENLA 1KD0A 1W6TA 3PK7A 3KUMA 4E6MA 1PDZA 3VCCA 2QJJA 4DX3A 2NQLA 2PTWA 1JDFA 3VA8A 4GFIA 3TJ4A 2HXUA 4HCDA 3QPEA 1MRAA 2GGHA 3R0KA 1F9CA 1RVKA 2P3ZA 3ES7A 3ZVIA 2P88A 3N4FA 3S5SA 1KCZA 2OFJA 2HZGA 2ONEA 4HPNA 4Z1YA 4A6GA 3ZVHA 3UXLA 2PTYA 1SJBA 4E8GA 3T8QA 4IP4A 1PDYA 4MMWA 2PTZA 3H70A 2GGGA 2QVHA 3NXLA 1JPMA 4A35A 3DESA 2MNRA 4J1OA 4FI4A 3S47A 3JW7A 3R10A 1SJAA 3H7VA 4KEMA 1MUCA 4HNCA 3MY9A 4HNLA 3CYJA 3UCCA 3FYYA 3T4WA 3DFYA 2PP3A 1MDRA 3D46A 3V5FA 3ZLFA 1DTNA 4H2HA 4DN1A 3DDMA 3ZLHA 3RGTA 3H12A 3NO1A 2XGZA 1TKKA 2PCEA 2CHRA 2GSHA 1ECQA 2AL2A 4JN8A 3K1GA 3T6CA 1KKRA 5ENLA 2PP1A 1JCTA 2OX4A 1IYXA 1P48A 3T9PA 3SN0A
chains in the Genus database with same CATH superfamily
1PJ9A 3ABZA 3FOKA 2PWFA 5DT5A 4XAYA 1Q6RA 1TMHA 2VELA 5DEZA 4I6VA 5F4WA 1NDAA 4TO8A 2V6AA 5CSRA 2J7CA 3EWDA 4N9BA 3FGCB 3MWAA 3W01A 4PBGA 5IRPA 3N6QA 5BXSA 2GL5A 3AHVA 5GPRA 3UXIA 2WPFA 3WLQA 2AAQA 3P61A 4HB7A 4ROQA 3VKCA 1GRGA 1TR1A 4GO9A 3UJRA 4AFYA 4G1KA 3VYLA 1RM6B 4C7DA 2OSYA 1VC4A 1I9CB 3ANYA 2ZZBA 4LTSA 3O6CA 4O12A 3R6IA 4QSHA 2E6DA 1CXLA 1TE6A 3B9EA 1OABA 4DUOA 3OBKA 3VDBA 1BHGA 1FEBA 2OXNA 3GS6A 3RJYA 4P5UA 5G1MA 4GACA 3C2VA 4EPBC 4F0RA 4RV3A 3B8SA 5D33A 1UWUA 1UWAA 1PX3A 4H8NA 4OHQA 4AHOA 4A8NA 3M4HA 2YXXA 2QNEA 3SUWA 1J4EA 2EPKX 4JTFA 5IHSA 3MYPA 3WH5A 1ZY8A 2D22A 1DE5A 4Z2IA 1ZL1A 5E09A 1XH1A 1WZKA 3K1DA 4NRRA 3UWWA 3TK7A 4ZOEA 4QG6A 3SCSA 1B9ZA 2QKFA 1EBHA 2QJNA 1H11A 4CVWA 4GABA 1FCVA 1S1RA 4XWUA 2ZE3A 4TVUA 4UXDA 4I9TA 1AW1A 1W54A 2OQYA 5JH2A 3H2OA 4U2ZA 1PIIA 3WF3A 4J3TA 1FVPA 2I1OA 4IGSA 1H63A 5A2CA 4R7JA 3A7RA 2ZZ7A 1KRMA 4DXKA 1XYCA 2GGIA 2PRHA 2QIIA 4Q8NA 2GJPA 2ZUTA 4V1XA 4X2PA 3N4AA 2GUYA 1T6MA 3BLOA 1DTUA 4C6JA 3NDZA 4UNKA 1S39A 2BS9A 1XV8A 2PE4A 3T05A 1RP8A 3LHVA 3TV8A 4MDOA 4DO4A 1F8MA 2IKJA 1VRXA 2J7DA 1ZHAA 2I56A 3SR6B 2DT2A 4YN5A 2NVCA 3AMCA 4JKKA 5JU6A 2XFYA 5ABTA 3EX6A 3CMGA 2YCLB 3AYVA 1W9VA 1L2QA 2PURA 5I00A 4AD5A 4HTYA 2TPRA 2IKHA 1HVQA 1XG3A 3S1VA 2Y5EA 2WANA 1TZZA 1K4QA 4F48A 3KVJA 3L4WA 4CNNA 1X39A 3BJSA 1OK4A 4NJKA 1O94A 2X30A 1FWGC 3KXQA 3EOEA 2P50A 5HDRA 1JEHA 1NP2A 3UZ5A 2YXOA 3ARSA 4JN6A 3GC2A 3GNXA 3L0KA 2ZFAA 1OF8A 4S3FA 5D2XA 3W25A 4KKXA 3H24A 2AKMA 3SFWA 2D3LA 3CH0A 5FA5A 4QLJA 5CC3A 3IAPA 2ZZ2A 4X60A 2XN0A 3AIRA 4HU3A 2FPYA 1V0KA 4J3SA 3RXZA 1GYLA 2NQZA 1JZ8A 1FFRA 1FA2A 2J79A 3VZZA 2VR5A 1FH8A 2XFRA 4XZMX 2XISA 4OV4A 5JRBA 1BTMA 4W5UA 3VDGA 2ANUA 1K03A 4JY9A 3TH6A 5I24A 4NRSA 2PDCA 3KHDA 2IMRA 3SUTA 4UOQA 4TV5A 4K8DA 3M5ZA 4B5VA 1T96A 3RR1A 1NWSA 1IEXA 3UG3A 4CEXC 3ZJ7A 5AYYA 1MDLA 2EG6A 3SN4A 3R07C 1OHLA 1QR7A 2WOIA 1E0VA 1O66A 1ME9A 2E7FA 3N1AA 1IGWA 2C3CA 1EC8A 3FX4A 4B9ZA 4DWSB 3OIHA 1GG1A 3QFAA 1FHUA 1OCJA 1OZQA 4FXJA 3C8FA 4AF0B 1F3XA 1Q1RA 3UZJA 3GRSA 4IT1A 3G1YA 1U1UA 3CXOA 4HZ6A 1XS2A 1B3VA 1I6NA 1ONWA 2WPGA 4FLOA 4JIIX 3CAVA 4H4IA 1N2VA 1PDZA 1CGXA 2H3BA 1W2VA 2NQLA 1XBXA 4S2BA 2W9MA 4DAFA 1ISVA 2C14A 2UY5A 8XIMA 2DFAA 1H7WA 2AAAA 4A8LA 2FHCA 1EJ7L 1GVIA 5LXEA 2FZBA 3T0TA 1GCYA 1E1FA 1I2QA 3NQ8A 3HURA 2P88A 4D6FA 4WR3A 1D3HA 2IPJA 5HNTA 3EB3A 3SUVA 4KEUA 1I0BA 1EJTC 2ZDRA 4CNOA 3M0YA 3GHTA 2CBVA 3AIWA 4MTVA 5F4SA 4W5ZA 2HRWA 2VRJA 1A5UA 4IFKB 3NXLA 1W9BM 2DT0A 2WZIA 3WIJA 1IZCA 1JPMA 3ETRB 1J2BA 2OZ0A 3WQ5A 2W6RA 4GI8A 3AWOA 3H7VA 2F38A 3PZTA 4FK9A 4FLQA 4W87A 3TKFA 4BFAA 3BOFA 1DVJA 1WX0A 3I65A 1D7KA 4PCPA 4OUIA 1GZJA 4GRSA 4Z0JA 4UZUA 3VOCA 5H2ZA 3V5FA 2JGYA 3M7WA 3N9RA 2F7FA 1QI4A 2J7BA 3TJXA 4PSPA 4GUIA 5HAOA 3RGTA 4WCJA 1UIOA 4GZIA 3WBXA 5FAGA 1UUOA 1XHGA 2HVOA 4JDYA 2VCBA 1B4EA 9XIMA 1POJA 1V0LA 3KRUA 2E3TA 3PVFA 3U9IA 3UJFA 1XIGA 3QSTA 3I4KA 1EDQA 4DJFA 4H6EA 4X61A 2P1FA 3PSVA 2GPTA 4KQNA 3HPZA 5A8MA 1W1VA 4C6PA 4I9AA 4FS9A 2X8GA 3HU7A 4AMAA 4FPSA 2VHLA 1SUXA 1D8WA 3N13A 3F5JA 3GWQA 3UZWA 1BXNA 2VUYA 4AW7A 1S2CA 2DW7A 2Y8UA 1K1DA 3WMSA 3HIJA 3DENA 2WVVA 3U3HA 1FXPA 1UQZA 1A5AA 3WMLA 4DJED 3LPGA 4V27A 1M6JA 1OYCA 1GSNA 1XGZA 4XKYB 4HPJA 5BXPA 2CFFA 5EMKA 2WSKA 3U48A 4AWUA 2J7EA 3KM8A 2BB0A 3HMCA 4X63A 5J5RA 4R7WA 1J79A 3R11A 3VE7A 4L5ZA 4H9XA 2CHNA 3NVVB 4NL1A 4WY0F 1TR9A 4M7SA 4XTDA 1Y7VA 2J66A 1OCNA 4GK8A 4RE3A 1RA0A 3ARQA 5HK4A 1JD7A 1BVWA 2W91A 1FP8A 3TROA 1YADA 1NVMA 4AB4A 1BQGA 5KETA 1S5VA 8RUCA 2BGQA 1TUXA 1KBLA 1X96A 1RLDA 4M6PA 3PANA 4MSSA 2BHUA 4PCFA 2NWSA 2WLZA 3GNRA 1XPYA 3BZGA 3NL6A 3B9JB 1Y65A 1X1ZA 3AS2A 3VINA 3OLDA 5B80A 3LEPA 1GKPA 4LC8A 2BHZA 2WSYA 3E2QA 2OU4A 3EKLA 1GW1A 2E77A 1WQ5A 4QJ4B 5D9MA 1VJZA 5CSSA 1Q6LA 1KR1A 3UZYA 2W4XA 2VC7A 2KZHA 4UFIA 4LYKA 2CC0A 3CZGA 5IBXC 5AYIA 4L4PA 3TN4A 3U6WA 2WHLA 4NJIA 1UD5A 1ZJIA 2GJXA 3TOYA 4PUDA 3GVQA 1TQXA 3URNA 3NL5A 3CLMA 1VFUA 3P5YA 4E5TA 4L64A 1RY8A 1KLZA 3NSNA 3TAKA 1N5XA 1W31A 1W8GA 3KZPA 3O05A 1N82A 2VX5A 2X8CA 4QEEA 1WV2A 3DAQA 3TSBA 4YU1A 2MANA 4W7WA 3ARUA 5ABEA 2F6KA 2Y8VA 3QFBA 4O0QA 1UASA 1OIMA 1IWAA 4REQB 2VRQA 3K8KA 4GZJA 1CT5A 1JROA 1OFPA 3LTSA 4S23A 3FN9A 3ONBA 2VFDA 1SZNA 3M07A 1XI3A 1E1CB 3H4GA 5CZTA 2GFTA 2OKTA 5D32A 3KEHA 4OBTA 1HP4A 2WP5A 4FP1A 1DWGM 5AECA 4M6QA 2Y61A 2YPIA 4PFHA 2QCLA 3IV3A 4IG2B 5BMXA 4LIIA 1D2KA 2BC0A 2VENA 1XYMA 2QV5A 3BLFA 4V28A 2O9PA 1F76A 4PMVA 3N2OA 4RNIA 3A4JA 2ZA3A 2PB1A 2ZRWA 4Q8WA 3TP4A 3S6TA 3ITOA 4K7VA 2Q71A 1Q85A 1YDNA 1N63C 1HJUA 1TMQA 2Z7GA 1ELSA 1V79A 4H4WA 3NPVA 5BCAA 3FLUA 2FB2A 1GERA 4PN2A 1FY6A 3B8IA 4GNKB 1FHDA 4MY9A 5ECUA 1M7JA 4NF7A 5FJUA 4A8RA 4XUGA 5CSYA 3MVTA 5JQ9A 5E6ZA 3N17A 1UCWA 3CB3A 4C6DA 1GQNA 3O0FA 1ODZA 1NQ6A 2FB3A 4GJIA 1JF6A 3FA5A 3BH4A 1Q4NX 3L8KA 3ICJA 4RDYA 4AG0A 4WF7A 4YYCA 2OG9A 3DJJA 2Y2WA 3GG7A 3QMRA 3LHWA 3S3GA 4B5UA 3L0NA 2ZUNA 4C1NB 2DSVA 3FGCA 3VGGA 4AYSA 3BWWA 2VGGA 3KOXA 3S4TA 2R9RA 1W9XA 1TJ2A 4J56A 4PTXA 3BOLA 1KA9F 3NQVA 1PTDA 4WD0A 1QAPA 3WNKA 2CPUA 1LP6A 3QPEA 3C8NA 1OVDA 2E3ZA 5HMEA 2A6LA 2EJAA 2VTFA 4MYAA 3ZSTA 1ZY9A 4K36A 1G4EA 5EFDA 4PEEA 2OGJA 3CPGA 1Z3NA 1SJBA 1GVFA 2H6RA 1BZLA 4MMWA 2CLPA 3IGSA 2ZVIA 1ZMCA 1FWDC 2YCIX 2ZVRA 2B81A 5TQLA 4QQ3A 4Z2LA 1OFOA 1I60A 1PWMA 2VNCA 2B4GA 3MMDA 1FH9A 5HOSA 3R2GA 3T4WA 1LOSA 1MDRA 2A8XA 4WZHA 5I6SA 1AZ1A 2Y70A 3KOFA 4LBUA 2YOCA 3W7HA 2GK1B 3MUZ1 1GK8A 1W32A 3LI1A 4JN8A 1F6PA 1KKRA 2E28A 2TYSA 3CL8A 3BCFA 5GJMA 4DYJA 5C5YA 1BYBA 5CJNA 5A2AA 2WHJA 4C6CA 2PD9A 3JS3A 4FZIA 2OZ8A 4H50A 4C7FA 3TN5A 4LALA 3XIMA 2BGSA 3RAOA 1GRHA 4V15A 1Q6FA 4NNAA 5HBFA 1HL9A 2DT1A 1E6QM 4IL2A 4G56A 5FKYA 1EL3A 1IF2A 4F79A 4LBSA 4HGXA 3K2GA 5EMUA 5A69A 1HKMA 3QFEA 5KEZA 4APNA 3EX1A 3N19B 1MOKA 1V59A 2W3RA 1KCKA 2QULA 1V6XA 1N55A 4DJDA 3E12A 3D47A 3WK2A 3W1MA 1RH9A 1ZQ5A 1Q6CA 4OQVA 4O57A 1Z8AA 3B97A 3DG3A 1CGUA 1D3CA 3S5OA 1OBAA 2DSKA 3G0XA 1IXOA 4GQBA 4LUIA 4A05A 5JCIA 2YCLA 1JJKA 3VOGA 4ATWA 1T41A 3E5PA 2I5IA 1FDYA 3EEGA 1G0CA 4P7QA 2GQAA 4DM1A 3ZT5A 5G5GB 3RF9A 3BARA 3FHQA 4UTMA 5DQPA 5U4NA 1WO2A 3WYZA 2QJHA 4AX7A 4B3KA 3M9YA 2X0HA 4Z2JA 3N25A 4TV6A 2WMIB 3KBVA 3G18A 4M0XA 1FCBA 1JDAA 4PRWA 1UHVA 4HPXA 1XICA 4AUBA 2G5WA 1TV8A 4JL2A 1E73M 3RG6A 3D5HA 3O63A 5KZ6A 4H00A 3E0WA 5IBXA 2IQTA 1AH3A 1K8XA 1I1WA 1Q5MA 2QUMA 4G6CA 3G1XA 1M01A 2VFIA 1JNDA 3GDKA 4I8DA 1XHCA 1UPMB 4U5IA 3AXKA 3RNDA 4DWDA 4TVCA 5F1VA 2DDXA 4MNLA 3HRDC 5F4XA 4DF0A 1WYIA 3E1F1 4D72A 3L4XA 4K6AA 3T07A 3MP3A 1E6PA 1CENA 1LRNA 3MWCA 2AGTA 1B9BA 3WLMA 1YDVA 4OZOA 2HS8A 3ZIZA 4NU7A 3IJDA 3VGEA 1ONEA 3PZUA 3GDTA 2Z25A 4NSBA 1S2AA 3ARXA 2V81A 2PGRA 3WQ4A 3KTSA 1GVQA 1RXOB 3N2XA 3RO6A 3CGEA 2X2GA 3CK5A 5F2MA 3R12A 1SSDA 3IACA 4I7UA 5DXXA 3S2JA 3UA4A 2XIQA 2ZBTA 4LW7A 3LG3A 3W7LA 4DWSA 1RVGA 3PTQA 4HOZA 5CG7A 2PDIA 4XB3A 4Z17A 1B3XA 4HJFA 1FIQB 5M2FX 4EK7A 2WMJA 4AF0A 2V6OA 3PBYA 3PM6A 4PMDA 3MVIA 4QTGA 4EQWA 1O95A 2FMOA 3LSCA 5FCZA 1KO0A 3A5VA 4H7CA 2ALRA 1FWCC 4RJEA 3SUUA 4YS1A 2PDKA 1LRTA 3STGA 3YPIA 3E5BA 1LBMA 3MHGA 4JQ4A 1JZ7A 3CAWA 4A4AA 1U1JA 2BP1A 5BZAA 2EHHA 4ORMA 1VR6A 1ZNNA 1H50A 3AAMA 4GI4A 1R3YA 4B2DD 2J78A 3P82A 4M52A 3S1WA 1VFSA 2D2OA 3EYPA 1KN0A 4AD4A 3DI0A 4TX8A 3GHRA 3IVTA 4KCUA 4IFKA 2HV5A 1QU4A 1KM0A 2Q8ZA 4B4HA 2WVUA 5C71A 1RBAA 1LG2A 5G4WA 3CBWA 4C6NA 4PTDA 3U0HA 3EEZA 1X6UA 4PMOA 1TMLA 3WLTA 3C0JA 1EP1A 3PUGA 2ZRZA 2F6XA 2HCVA 3VC6A 3A24A 2QQ6A 3EDKA 1AG1O 3EWZA 3PWIA 2J7GA 4D6DA 5FJPA 4IJBA 3ATZA 3IUHA 1XG4A 3ARRA 4JY8A 3F4WA 4WJ8A 3LV6A 2DSUA 3PY2A 5FIPA 2OX1A 3ZO9A 1H62A 4GD0A 5G1YA 1ZUAX 2E09A 2NX3A 3P6LA 1JCNA 1X8CA 4A3RA 1QPNA 1A53A 1UA7A 4HU4A 3S1GA 1NFGA 4QNWA 3E2SA 4XIAA 3WQ8A 3QW3A 3NZQA 1P4CA 3NYZA 3RCMA 1QFEA 2X8RA 4QE1A 3ZJ8A 3WQEA 2WJDA 5JIWA 3VA8A 2OWWA 2UY3A 2INEA 2HXUA 4HCDA 2WJZA 2D2JA 3VMOA 1CXFA 3LRMA 1G69A 3Q37A 1TCDA 1OGGA 1QNSA 4DI9A 3ZVIA 2DORA 3H2NA 1FWRA 2HS6A 1AJ0A 4QCEA 3WD2A 3E0LA 3UXAA 1A5NC 1PXGA 1XIJA 4IP4A 1V6WA 1FX6A 2GLKA 2VL4A 1WYGA 4XKYA 5FOOA 1VBHA 4PL1A 3LI0A 2HSAA 2MNRA 3GVVA 4NG3A 2HQAA 3SRHA 2V3BA 1RPXA 1YHTA 3O16A 3ZXWA 1IIGA 2W61A 4PCSA 4OFCA 4LS0A 2QGHA 2X05A 3D46A 2E8YA 3ZLFA 1U33A 2PDYA 1ZLPA 3CV7A 5C8BB 3RX3A 1EBDA 1WPCA 1S5NA 2JK2A 3NPXA 1V3KA 4E38A 5I3IA 2EGZA 2GJRA 3WJZA 1SO3A 3T42A 4ZXLA 2DZVA 3WBAA 4MWAB 4CU7A 4NKCA 3LQGA 4S3EA 3IAQA 3SN0A 2VX4A 3F4VA 1UR0A 3BQ6A 3GTHA 2VDGA 5I09A 4LEQA 4EAMA 2NVKX 5GQBA 1TJ1A 3AO0A 3W82A 3WG6A 2XWDA 1UZDA 4Q33A 4J2MA 1JDEA 1J8VA 5LKYA 4J35A 3BCJA 2W5FA 5TIMA 3FEMA 4UFKA 1EJWC 5IDZA 3C86A 3BL3A 1XISA 4ATLA 4HA4A 3GBEA 4MB3A 3VKDA 1RY0A 9RUBA 3TYUA 2ZA2A 1HGWA 4GXMA 1S3HA 1RK5A 4ZL1A 4D6HA 4EACA 2Y7FA 1UIPA 2GDQA 2BWGA 2OKOA 4YWSA 3ZVHB 3E0FA 2O4QA 2P8CA 4POCA 3I3DA 2Q6ZA 1DORA 3HFTA 1MQRA 2H90A 2QV4A 2I16A 3GDRA 1X97A 1QW8A 2D20A 5A5WA 4NZJA 1OJTA 4GGHA 2JBMA 1UR9A 2WSRA 4GNVA 4R9XA 1LT7A 1ZU8A 2VX6A 4LNCA 2FTPA 3CUFA 3AHXA 3AJXA 3TA9A 3VXGA 1EXPA 3IV8A 4AVNA 5C2XA 3IJ6A 2BBFA 3WNMA 3GR8A 3DIPA 3SY8A 1XLDA 1MQPA 1M5WA 1SMAA 3FJ6A 3UG5A 4REQA 3UNTA 3HQNA 4A3YA 1E1CA 3MMUA 3LXCA 3A3HA 1OSEA 4KCVA 3OB8A 1R85A 4RPPA 3RN6A 1RJQA 4Q8OA 4BWLA 3LCGA 3S6DA 2W55A 3CLWA 3A9IA 4IG2A 4K37A 3NFUA 1WXYA 4RLIA 2J25A 3UPBA 2XVPA 1THFD 3CJPA 1X8FA 3IIOA 1FH7A 3ABSA 1GVRA 1AOGA 2W62A 2I57A 2GQ9A 3OOQA 1OADA 1UP2A 1EZWA 1P0BA 1HZYA 1W3JA 4H4TA 3CQKA 3EB2A 3P5ZA 3PG6A 3WZ0E 3PWAA 4N9EA 4WSJA 4DM2A 3QH2A 4MJ4A 4FR6A 2OTDA 1K9FA 4A21A 2CCRA 4YMZA 4J3WA 3WQ6A 3W7NA 2J8GA 3K13A 4R5EA 1DJNA 1R3TA 3A12A 4GGBA 4MGGA 1IR1A 4MZ1A 2HNEA 2ZWZA 2V30A 2HJPA 2BVTA 1DHKA 3WDHA 1TRIA 4YTRA 4YHGA 1DBTA 1JFXA 4AY7A 3ZR5A 4C1NA 2X42A 1RA5A 3ECQA 4UIOA 4PB5A 3A3XA 1TPVA 3TDFA 2V69A 1P6CA 2ACQA 2OWXA 5G5IA 4AEFA 1MW1A 1EP3A 1QNRA 1EZ2A 4CN1A 4Y9OA 4MWAE 1ISZA 5G4EA 1OFEA 1ZBKA 2GVJA 2F8QA 2XU2A 1X6NA 3AISA 4PL2A 3GXDA 1XLGA 4PMQA 2Y24A 1GYMA 4ALDA 1IWPA 1OX5A 2Z28A 4KWOA 3KOYA 1BF2A 4TU1A 1AFSA 2PBOA 2QCFA 1J11A 3HM7A 1HQTA 2DIKA 3TTOA 1NAL1 1O5RA 2L5HA 1ITCA 3VKBA 1L6GA 4IPLA 3RM9A 3ABXA 7CGTA 1H5VA 1NDZA 2V3DA 4NYYA 1AQMA 1GEUA 3PZIA 3WQPA 2BG5A 1W17A 2OLSA 1EC9A 2CLFA 2J24A 1GOIA 3LTYA 1H2JA 3HN3A 1NU5A 3CEPA 4WGXA 5E6YA 3TE9A 6PTDA 4FXSA 4MPKA 2GK1A 2V5CA 3PJTA 2PPGA 4A3UA 1R38A 2EPHA 3HPXA 4L4LA 4JNYA 5AZ1A 2OMAA 2BX7A 2YVJA 1IEQA 2V5KA 5DMLA 5LSMA 2TMDA 1KGXA 3R4IA 2XIMA 1GNXA 3DX5A 2C3ZA 2C16A 4PB4A 3W7DA 4L4OA 2KAUC 3BLDA 3RM8A 5CGMA 1SQ7A 4GZEA 1A4LA 1NARA 2XGIA 2I7GA 4V2XA 4JTQA 4NZ4A 1UR4A 2RAGA 3OGVA 1N62C 1REQB 1GVOA 1TV4A 1XYFA 2FVKA 3LHZA 4XK2A 3VCCA 2QJJA 3EX2A 3FKKA 3VZYA 1XC6A 2Z1KA 3M0XA 4DX3A 4ZFCA 3HPAA 4UTWC 3W2LA 2OODA 1BXBA 1V02E 5DANA 3CWOX 1WP6A 1AD4A 1FWIC 3QC0A 2VEMA 4UC5A 4O19A 2VGIA 3S5SA 1BF6A 1QI0A 2VI0A 1BAGA 3WH9A 1DJWA 3AFBA 2X50A 4F0HA 3T8QA 1I45A 3ISIX 4CQ8A 1RZMA 5AHFA 4EXQA 4OUEA 2AQWA 2YIHA 3MCNA 4H9TA 2GVGA 1NF0A 3ITXA 3L68A 3IJ8A 4A35A 4QAIA 2XIJA 3N2BA 2PLJA 4DZ5A 1KFBA 3WQCA 1ZTVA 3NG3A 1X98A 2I5GA 4WQ6A 1HUVA 2JQXA 5HUOA 4C7GA 1VPQA 5KTLA 3T81A 4YCPA 1ZK7A 6A3HA 1FOBA 1QOQA 1UG6A 4X0VA 1KM1A 3DHDA 3A9BA 2WMIA 2WHMA 2HNHA 3UVIA 1V0MA 3FDGA 4AAJA 1SVDA 4GIAA 3E02A 4YPJA 4LUYA 2V5DA 3L67A 1EWEA 2E8ZA 3QW4B 1O68A 3T9PA 2PDBA 4GQGA 1JZ3A 4Q4QA 1GWJA 3FJ4A 1POKA 5CAHA 3THCA 3L21A 4ZCWA 3OJGA 4EF8A 4NT0A 5E9XA 5HJXA 2G4FA 2D2HA 3VIOA 3VNLA 1CLXA 3OP2A 1AL7A 1W5QA 4E4FA 2J7FA 3HB9A 2JEQA 3TX9A 4QIUA 1PWLA 3UETA 1B2YA 3WLRA 4C6KA 1YQ2A 3FAXA 2XJ7A 3E74A 5EB8A 3RLUA 4QQUA 4O50A 4ZA0A 1F8WA 1OX6A 3ZWTA 2QUUA 3VX0A 3POCA 1W5NA 3CZJA 1GQIA 5E0CA 4C6MA 3W0KA 1AA1B 1LM1A 1OK6A 4AY8A 4GBUA 3GTXA 3GU1A 4O28A 4GI9A 1TPDA 1JL8A 5I3HA 4Q8UA 4EPKA 4R7OA 3BLEA 4BQ5A 4AU0A 3DC8A 2YQUA 2FLIA 2QPXA 5DCEA 5K3VA 3AUOA 2QVNA 4LFYA 1GHSA 3ZYZA 3HO8A 4KCTA 1TTQA 1RP9A 3OW1A 5I3FA 3IGUA 1R5YA 4MJZA 1LL6A 1U83A 2VD8A 1H61A 4YHEA 1GPWA 1VENA 5LIYX 4JICA 2O7QA 3VOFA 3KFTA 3ANUA 3OPSA 3SSJA 4ZVJA 1UD3A 3W28A 2H8XA 5CLWA 6XIMA 5I06A 1TQJA 4JD4A 1SR9A 2C7FA 3GC4A 3WD3A 3MI3A 1QK2A 3WL0A 2NSOA 4C5YA 2J6XA 2QPUA 3W7CA 3R79A 1HKWA 4FIRA 2B0MA 4F0KA 4WDUA 3DFQA 2FH8A 5I02A 2INFA 2PGFA 2VT0A 2VMFA 2AQOA 3HPFA 3DGHA 3WFLA 4L4MA 4TXEA 3VKKA 4EE9A 4IIGA 4US6A 2CLEA 4QLLA 2ZTKA 3MS8A 4EQRA 4MLJA 3G1RA 4YVXA 4ICCX 2V68A 4CLMA 3CO4A 3R58A 2PP0A 1RJPA 3RHGA 5JXQA 3WFZA 1VYRA 2Y5SA 2ZXQA 4IWWA 4UNLA 4Z1CA 4LAMA 3UWEA 4LA1A 1NHRA 2DUZA 1VF8A 3TN6A 2C15A 2VZSA 5HNNA 4I5XA 1P0DA 5H8UA 4FNPA 1B0IA 1LRQA 3DFOA 2Q3OA 2PU0A 1YTDA 2PDHA 3DUGA 5LIWX 4ONVA 1SO6A 3WH8A 3SGUA 3TW9A 4AWSA 1LZOA 4U4MA 3ARPA 2QMJA 3AMDA 3W1NA 4AZ5A 1ZAHA 5LHEA 3NS1B 3OQ8A 5EA9A 3GNPA 2VC6A 3B8TA 3M64A 3H2FA 4IJRA 4ZB2A 5HPOA 2YXGA 3GE7A 3KS5A 3OIXA 4JHOA 3CGDA 5SWUA 4CCCA 3MV11 1BYDA 4DF1A 1FWBC 1UH3A 4NHVA 3SQMA 4NAFB 3S2MA 2V2CA 3I3EA 3G2GA 3PWGA 5FACA 3AUJA 3TW7A 1P0NA 1W5PA 4ENLA 4GOAA 1M53A 5IHRA 2PDNA 2BGNE 3W88A 1OFAA 3ZQ9A 3HG5A 3BICA 4IX0A 1R9XA 4XBJA 3CHVA 4O53A 2XH7A 3AS0A 1GW9A 1I2PA 1VLWA 2D1ZA 5E5CA 3PBGA 3B3DA 1WE5A 1MSSA 1DXLA 4PMXA 2QDEA 3LZ3A 1NIUA 2Z7KA 2A1YA 2A7PA 2WK2A 1ZS2A 4FX7A 2X8HA 4NZCA 5M03A 2QDGA 2E1WA 4ZQRA 3W2MA 4O54A 3TMQA 2DSZA 2ZYFA 3NQEA 1QI2A 3GZ3A 4NI8A 4ZQPA 1XF0A 5LHFA 1LL7A 4EOUA 4MWAA 1ZB5A 1KBJA 1Z6KA 3LHUA 4RNFA 1AJ2A 1BSLA 1WKFA 3WNLA 3GUGA 3HGJA 1R47A 4C1LA 5AC4A 2C71A 4JZ5A 5GNYA 4H4UA 1KFCA 4GJ1A 3OLIA 4UFLA 1UD6A 2D3NA 3LCIA 1JZ2A 3CHCA 4XG1A 2PEVA 4YCOA 3MBDA 5CGQA 5D04C 2W3SA 1MZHA 1WDSA 1J2WA 3TC3A 4GFIA 4NX5A 9CGTA 3TXZA 3LHYA 1Z7AA 3PG9A 1EJRC 3ITTA 1C7TA 3IIXA 4CD8A 2G4JA 4WKFA 1D7YA 2E68A 2R8WA 3HG2A 2VZOA 2G50A 2E6YA 3ZVHA 4GLEA 2TODA 5I3DA 2WM1A 3AS1A 4IM4A 4NVTA 1ITQA 2PTZA 4AHPA 1JF5A 1NPXA 4AY1A 3ZOAA 1NEYA 3UWYA 3L4YA 4OBRA 3JW7A 4F40A 5K9CA 4K3ZA 1F73A 1ADOA 4HNCA 1FWWA 1NFBA 1RPKA 1U5JA 2XUCA 3C2RA 2WPEA 3RNMA 4NEVA 2DV0A 1BLIA 1LL4A 1UWRA 1FWFC 4U2YA 1YYAA 2WCGA 3ITCA 1UZ1A 1V7AA 3NO1A 2AAMA 4MM1A 1L6SA 4YYFA 1ECQA 4R9OA 3GG8A 3WUGA 4L6HA 4JTGA 1K9TA 1UH2A 1XRFA 5ENLA 1UWIA 2PZNA 3WBEA 1IHIA 4P8WA 1SFJA 1V02A 2GWGA 1J5TA 3SGGA 4GVFA 4KFNA 4GQ0A 1XLHA 3I4EA 3SCRA 2ZXAA 4NJGA 3W74A 2NZLA 5FS6A 1GT8A 2WW5A 1VH7A 1A3WA 3OEXA 3MTWA 4O14A 1XLIA 2D0FA 1QW9A 4INFA 1CCWB 4Y9MA 2VEPA 2HMCA 1J10A 2CLMA 4NX0A 1TSIA 2R1MA 3PF3A 3W27A 5G5HB 1F2JA 3LB8A 2A3AA 4JTRA 5AHEA 3N2MA 2X1UA 2C18A 5EMYA 1K8YA 4AZ6A 5IFTA 4JQ1A 1EUAA 3VTRA 2Q02A 2PMQA 2ZZ1A 1WZLA 4RZ6A 3RX4A 1GZ1A 2F2HA 4N4PA 5I78A 1W5MA 5FEXA 3OA5A 4UQEA 7A3HA 1L9WA 1R3WA 1ICSA 4IP5A 3B05A 4S3KA 1Q63A 1N5WC 4MLRA 1CBGA 2ZE0A 2ZZCA 4UTKA 5DMNA 2FDMA 5BU6A 1HG3A 4PZVA 4H7VA 3RPMA 3BVJA 5A6AA 1OC5A 4CU8A 1AK5A 4MNJA 2DZSA 4HZ7A 1E70M 4OECA 4W86A 4BEQA 4Q8TA 1M41A 1KTNA 3ZJKA 4DI8A 2HTMA 1EJXC 3MCMA 3F5KA 3GH7A 2Q3RA 2F61A 3MKCA 2D73A 2FKPA 2KX9A 4HA3A 4OV9A 3UFYA 4ICNA 4O10A 3EDFA 4WVXA 2VGFA 3RU6A 3G8EA 3QQ1A 1ITUA 4LCQA 1VYSX 5KZDA 4MWAD 1W3NA 3G1AA 4HK5A 4DLMA 1BGGA 2E6FA 5PTDA 1LLZA 1JCLA 4QXIA 4K1WA 5AHNA 3SY1A 2XFWA 2ZX6A 4QNEA 3GK0A 2FPTA 1EFZA 1JCYA 1UKQA 4NXKA 3TYZA 3GLCA 2HK0A 3CHDA 1PTAA 3AYSA 4BQ4A 5D30A 5HNUA 1SZEA 3W72A 1RD6A 2G3JA 3L4VA 2CLIA 3SRDA 5T9BG 2REQB 4FX8A 3UXKA 4B90A 1IIHA 4BKNA 4IIBA 4EM3A 2PD5A 3E2RA 1JVNA 2IUZA 3PR2A 4N4QA 1S5MA 1W8SA 3URHA 1H0IA 3TU9A 1JULA 3FNDA 5BW6A 5J04A 5I3JA 2CZEA 5LNSA 1DJQA 3HTWA 5CJMA 4PUMA 3TTQA 1C29A 1A80A 1KBIA 1HL8A 2ASHA 1UD8A 4JDRA 1EYEA 4AIBA 3THUA 1SFTA 1NOWA 4GJJA 1LOQA 4MUZA 4DPPA 4S3DA 3CQJA 3FYPA 2NSXA 1REQA 3CV6A 4MB4A 5FEPA 1P0EA 3GIQA 1ZP4A 3H2AA 3K5XA 4US5D 4RZ5A 3ARVA 6TAAA 2HQMA 3GYEA 1Z42A 4PC8A 2E5DA 4CCEA 1JEZA 3G5EA 3H26A 4YNGA 4I7VA 5F2GA 2CZ5A 2XVLA 1P1XA 1DKWA 2IPFA 3GQYA 4S39A 3APGA 3QY6A 1TPC1 3QHMA 1HVXA 3JZUA 4LAUA 4ZQCA 4H7ZA 1CPUA 4KF1A 1Z44A 4AWTA 5MHBA 1UWQA 2ZCGA 2NLIA 2JF6A 2YSWA 1NELA 2NV9A 4UZSA 4UCGA 3V75A 2CESA 2PDGA 4DIAA 3W1UA 1JOAA 1V6YA 2XFFA 1VZWA 2GR0A 4G8TA 4L56A 1JRBA 1A0DA 5HWMA 3GG0A 5DXYA 1CIUA 1ISXA 4HU0A 4FOUA 1NJJA 1ML1A 4KRUA 5AYBA 1B3ZA 4H6KA 4QJ1A 1MEHA 2V8ZA 1TVPA 1US3A 2VO5A 3LXAA 3U7VA 3FAWA 4BEUA 1V3LA 3GW3A 3AMLA 5I79A 3VABA 2A3HA 4U31A 5AOUA 1UW9A 2QPSA 2EQ7A 4JQ2A 2RJHA 3HOJA 4G5DA 3DK8A 4GH1A 2DUXA 3UXDA 4QGCA 2JK6A 2VR4A 4AD3A 1C9DA 3RK8A 3KUMA 4HHHA 4X0NA 1SZRA 1GQJA 3LYEA 3V1HA 1QNPA 3QBUA 3HV8A 5GJNA 3T7VA 3PAJA 4OTKA 3NZRA 3ITYA 3JU2A 4PBFA 2BVWA 3O06A 3B9NA 1JCXA 4UTLA 4TX9A 1H5YA 3WDIA 4Q4PA 3BSHA 3ALGA 3W7OA 2YFOA 1DWHM 3WJYA 1XLMA 1E9ZB 4DUVA 5T8GA 3IWPA 3ITLA 4XZBA 4F3HA 1LUCB 2ZZ4A 3ZT7A 1OC6A 5DN1A 2Y6ZA 1V5XA 1A0CA 3HZ3A 4WOZA 3UCCA 2PLKA 3S1XA 5EKYA 2VOMA 3EKZA 3UY7A 4J5NA 4AQLA 1LTDA 1EX5A 1L8NA 3PTDA 3W02A 3UERA 3G1VA 1IE7C 2XINA 1OT1A 3DDMA 2XZ9A 4JOMA 3ZLHA 2CYGA 3FJNA 2EBNA 3ZT6A 1CTNA 1QASA 2X7VA 4NJHA 1AQ0A 1ENUA 4HHLA 3S2CA 1TVNA 2CBJA 1WAWA 1X7FA 5F1UA 3UW6A 3T44A 4EM4A 3KLJA 1XGEA 5AC7A 4H9ZA 3TYAA 4IZGA 3TTEA 4J40A 4K7ZA 3WK3A 1IV8A 4QITA 2RGLA 2G3NA 4W7VA 5I0DA 3JZEA 3MT1A 4LNYA 1HKIA 3W1AA 4TVDA 1SFLA 2OZTA 2WVSA 4GWEA 4O13A 5FF3A 4WUIA 3OZPA 2C13A 1R2SA 1XBYA 1JPDX 5AVHA 3INPA 5CPMA 1Z9AA 3MUXA 4AZCB 2YAUA 2FGLA 1K6WA 4JHMA 3DOPA 4F0LA 1W56A 3W2NA 4FEZA 2EXOA 3EX3A 4C6EA 3QC3A 1M65A 1R2TA 1AJZA 4ZQMA 3U4FA 2H9AB 3NL3A 3EPNA 3NM1A 4ZMGA 2VFGA 1XJBA 2Q01A 3S2NA 4LUTB 1G7VA 3F2DA 3GVGA 5DY3A 1C92A 4QE4A 3L12A 4M6UA 1B4KA 2VP8A 2WCAA 5EBKA 1BWCA 3W23A 3G1HA 3M46A 4H8VA 3BZJA 3G1DA 4MVAA 4WX2A 2HISA 4Z2HA 3GKAA 1OG6A 1E0TA 2EKCA 3PUOA 4M81A 4C1KA 1EJSC 5CPLA 1KW1A 3B06A 4JQ9A 3K46A 4L1GA 2QDHA 1OC7A 4ZE4A 3LNPA 3KVKA 1UZ4A 3BUVA 4H83A 4MOZA 4NAFA 3EOSA 1NOUA 1ZXIC 1TA3B 4QDPA 3EKGA 3H7UA 3RJXA 4IXHA 5I3GA 4CEUC 1MWOA 4X3ZA 4A29A 5L9FA 1YNYA 4IH3A 1Q45A 4H4PA 5KITA 1TRDA 2ACSA 4IGNA 1NSJA 1ZJHA 1FCUA 2Z00A 1EJVC 4DUXA 1BG9A 2XM2A 3OVGA 2ADAA 4MFDA 3TUUA 1YKWA 3MSRA 1GQLA 3TNOA 4DJEC 3SQPA 4HD5A 1Q3NA 3WMBA 3LSBA 4M6VA 4F4RA 4EF9A 4FX9A 2WSQA 1SB3B 3AZSA 4MNKA 4JQ3A 2YDAA 5D02A 1EDGA 1TPFA 3LLXA 2C8NA 1F4AA 3IARA 3L4TA 1HIZA 1D8CA 3B0UX 3EWCA 2YW4A 4GO8A 2ZUMA 1J9YA 3O6YX 4GUFA 4WDXA 1LWIA 4XBKA 3GXPA 4FLRA 1MZRA 2PODA 3TONA 3W2KA 3V7PA 3VMNA 4FF5A 3HW2A 1UMLA 2BVDA 1DQWA 4EMIA 4A3QA 3I6RA 3BLKA 3QKEA 4PUJA 1YX1A 4XQ6A 3UEQA 4LS1A 4IQJA 3TTYA 2QUVA 3W24A 3L65A 4IUOA 1CI1A 4YIWA 3UGVA 3CO8A 3UR8A 1O5KA 3LPFA 4LVGA 1J12A 3UWUA 4AVFA 3H4KA 4DBEA 3ALFA 3VIHA 4G2DA 3TLQA 4EPEC 1YQZA 1KC7A 3U7BA 4GUGA 2Q09A 1IGSA 3PJWA 1E6RA 1MEWA 4AC1X 1VFLA 1ONRA 2BY2A 3GDLA 1OZMA 4KIEA 5BU9A 1LCOA 5HINA 3E6EA 1E9YB 3N4EA 1KV5A 1OGSA 1C90A 3N2TA 4X22A 3U4AA 4D8ZA 4W84A 1FWAC 5C55A 2ZUVA 3HMJG 3WJWA 2VD9A 3EXSA 3QLLA 3VUPA 3I68A 3DHUA 2EF9A 1N61C 3EA2A 4GYPC 5A3HA 3UJSA 2W66A 1S2TA 3EGJA 4E4PA 4O15A 1JIBA 3VAVA 2CITA 3V4BA 2PDXA 3RPTA 2YLLA 4BV6A 4KT2A 1GTEA 4QG8A 1UJPA 3T0CA 3NSXA 1C3FA 6ALDA 4IQDA 1NDWA 2EO7A 1PZ2A 2QCEA 3FA4A 1UB3A 2V3AA 4QRNA 1LT8A 4AXKA 1KR0A 3L23A 5ABGA 4PH6A 1AH0A 3B4YA 4GX9A 4DZHA 4NEWA 2Z1WA 3GIPA 1S5TA 4G9PA 4LS2A 4H4RA 1KRCC 4B5TA 2ZX5A 3AQUA 4RL3A 3TYDA 2EKGA 2QCGA 2EPLX 1C8VA 4KFOA 1VS1A 1H2IA 3CZKA 4N42A 5DBUA 3SRKA 4KPRA 4AEEA 3L5MA 4RDWA 3QY7A 1XSIA 3CUJA 2PTWA 4HIBA 2Q8XA 3Q2DA 4AD0A 3W7KA 4IF2A 1VEOA 3RILA 5H1WA 1F9CA 2JALA 3KX6A 4DJFC 4YLWA 1J0ZA 3N4FA 3W07A 1Q8JA 3IK2A 4UOZA 4PTNA 2GQ3A 3CS2A 2HZGA 3W87A 4DLFA 1RQEA 5D2YA 3T4CA 3QTGA 1LVLA 3QJAA 3GDBA 3RO8A 4O0KA 4GQRA 1DIEA 4KCWA 1QWGA 2ABBA 5U25A 3TLLA 1XDLA 5FSEC 4DZIA 1G7UA 4PFMA 4XBSA 2X1TA 4M80A 3MMTA 1SJAA 4MAZA 5CPQA 3HF3A 4MFEA 1WKEA 3R13A 3G24A 3Q6JA 3H21A 2A85A 3UA3A 3DFSA 1UP0A 1E6NA 3FDKA 1N8WA 1DTNA 3WKZA 5I77A 4RZ4A 3WBWA 4Q22A 4O17A 1KWGA 3BQ5A 4JPGA 4HT3A 3CUHA 2XZ7A 2PCQA 1XRVA 2WHKA 3WQOA 2CZDA 2V2HA 2OCZA 2VYOA 1E72M 3GU9A 4I5RA 4FAMA 3BTNA 4YL2A 1D7FA 2A3EA 5AFDA 3APTA 2V82A 4AZHA 3Q67A 4B15A 1ZPTA 1S46A 3C3NA 3MP4A 5FF4A 3QGVA 4A2SA 4TIMA 3DFPA 1VFFA 5FS9A 3DECA 3KP1A 5LA0A 4O11A 3ITGA 5H8PA 2HE8A 3GHUA 1PZ0A 1E5JA 4HMNA 1UROA 4LVBA 1PL9A 1XQKA 5DLCA 2R1KA 4GVIA 3ELFA 3QYSA 4NXSA 4R88A 5GNZA 1WUFA 3EXRA 3VM7A 2XSXA 4HNTA 1F6KA 2WMFA 3NEVA 4O0ZA 1PHWA 3T08A 4JKLA 2PS2A 4EMWA 3BW4A 1SW3A 3H6OA 2REQA 2PWUA 3P7YA 4LV4A 1OF6A 2JGQA 3WNOA 1ZJBA 4AH7A 4HVXA 2BV9A 2DPEA 1UQYA 3AIBA 4GX8A 1XDJA 3B9AA 5JBDA 4GFSA 1VIWA 4JTJA 1VKFA 1EWDA 1HJWA 4DXVA 3T0BA 2DSWA 5D2TA 2YL9A 1W3HA 5CC7A 4FSAA 3S0CA 3LUTA 1WBHA 1DIDA 3R7MA 3P60A 3THAA 3WDRA 2YBUA 1OB0A 5D38A 4CVUA 1SJCA 2X1SA 4C6FA 4CD4A 1GRTA 2YLAA 3DG7A 1TPEA 2ZRUA 2X40A 3RMJA 4XV0A 3CZEA 2ESCA 3VX1A 4PSRA 2CHOA 4DJEA 3NYDA 1T8XA 4JL1A 3MKVA 3MYOA 3HQPA 1CW2A 2WLYA 1VHNA 2RHGA 1XSKA 4RDZA 5IDIA 1XBVA 4MY8A 3WY1A 3E38A 3EA1A 3NGJA 4GIYA 1HJVA 3BURA 4PCNA 2PU1A 2E5BA 3UWZA 3UNDA 4K8HA 4LT9A 1GESA 1V6UA 2UZ9A 1HJXA 1U5VA 4UQ9A 3RUBL 1O6IA 1YXCA 1JAEA 4IP7A 1BFNA 2JIWA 4TVYA 3NO5A 4CNSA 1V3JA 4LPCA 2FIQA 3E0VA 3CGBA 4QG9A 5BXTA 4A22A 3MUIA 5FJOA 1X1NA 4G1NA 3DN5A 2EQ8A 1CXIA 2WZEA 3WX7A 3W6LA 3BAWA 4E2BA 5DT7A 1KCLA 4QS6A 1TIMA 3WMCA 3TQ0A 3AM9A 3I3BA 4JR5A 4X9YA 1CDGA 4EP8C 3EXTA 3O7UA 2PI6A 4BF7A 5AHIA 1DJGA 2XSBA 3RCYA 4FDCB 3R89A 1I4NA 1EKOA 3ZR6A 3K8LA 1WUEA 3UGRA 1YBQB 5DMYA 1CLKA 3PC0A 1WA3A 4AVOA 1QXLA 3N9KA 4I9JA 1UBPC 2YCEA 4GYPA 3IJQA 3SCWA 1TELA 1UR8A 2WVTA 5FD0A 2CEQA 3GVWA 3G0UA 2ZRXA 4JX6A 5T91A 1LWJA 4GIEA 3UPWA 4WY0B 5FJIA 1VEPA 3VIJA 5IM51 1K8CA 4H9VA 3S46A 3K30A 4ICMA 1NHQA 5CPSA 3ABQA 3C6CA 2NX1A 4OVXA 4C6QA 3EWYA 2FJUB 2Z24A 1PB0A 2X1IA 3SCQA 2G95A 4D6EA 4IMFA 1SZGA 1WXZA 4IQLA 5A6BD 3QMSA 1W3TA 1LLWA 4I7WA 1LUCA 3L5AA 3GH5A 1KFLA 4LOCA 3QSRA 3NUKA 5XINA 5GVJA 3RYSA 3KS6A 2HPMA 2DZXA 3EANA 3GTIA 2POTA 2IS7A 4AZBA 2VEIA 4JTTA 2FFIA 1E51A 3OLGA 2PDUA 4DO5A 3OLEA 3IGHX 3U2EA 3CT2A 2FTWA 1PPIA 2YFNA 4OE7A 3CWNA 3O8AA 5LA2A 5I23A 3QY8A 4EMJA 1KM5A 1TV5A 2H3DA 4ZE5A 3VFCA 2DH3A 3WJXA 3W6YA 1TX0A 3VGBA 1HKKA 3KLLA 2E25A 3B8UA 4E4UA 4QAWA 2YR1A 2IPWA 1F07A 5CG0A 4UMCA 3SCUA 4QR6A 3B9OA 2YBTA 1HKJA 3H4WA 4IMDA 3EB4A 3TR9A 3LPOA 3LS9A 4AZCA 4UB9A 2J88A 6XIAA 1GOXA 4MF4A 4CKQA 2PDFA 1PV8A 1RK6A 2JEPA 3C5QA 2CBUA 3OYZA 3ORWA 3STFA 4P8VA 5A8NA 2PFHA 1PSCA 1XSJA 2OO0A 3L2MA 3C3UA 4XAFA 2XPKA 1O1HA 4AWEA 1G67A 4KGLA 2DZAA 2I14A 1EP2A 4GH3A 3WN6A 2H9AA 2Z1VA 1FECA 2QCCA 2B7PA 2GH5A 4LUTA 2X16A 4KH2A 3UT0A 4URIA 4UTFA 1E1EA 4KEMA 1YXDA 3GVRA 3HFYA 4KRZA 1HJSA 4ZGYA 4DBDA 4DJDC 1EXBA 1RR2A 1VB9A 4IPPA 1TREA 3CZ8A 2QZRA 2QXWA 3EMCA 2ABAA 4TOQA 1V97A 3Q58A 5I3KA 2BTMA 4DEFA 1BGAA 1GONA 4L61A 2BC1A 4H3DA 4PE8A 3KCLA 1CECA 2XGZA 1TKKA 1RJRA 2VCAA 2EEXA 3QOKA 3OC4A 1XP3A 4OOZA 5K2ZA 1DJHA 5E1QA 2VR2A 4U3CA 1V0NA 1TJRA 1TA3A 4FIQA 1GRFA 1XYLA 4K8GA 4CNUA 2V5LA 4BI6A 3W1QA 2XG9A 4BURA 2OLHA 5AY7A 4JX4A 1WAUA 5A2BA 1A5MC 2QUNA 7PTDA 3ENLA 4E2DA 1QK0A 5LNUA 2JKEA 3SN1A 1WZMA 2XH4A 3CV2A 5E70A 1UKOA 1T3QC 1B54A 2YYTA 2GJNA 3M44A 3DH9A 2UV8G 5IFPA 1EDTA 4RE0A 2VQUA 1T0OA 1XH0A 3QN3A 3E96A 4C65A 3COTA 1QJWA 1W9UA 1BKSA 2NV1A 2PGEA 3KCJA 1US2A 1H49A 1TWZA 4DY1A 3A23A 3N11A 3EOUA 1FP9A 3B0YA 2YA0A 3OG3A 1ZENA 1DHPA 5LNWA 4JN7A 1K02A 2ZXDA 1A47A 1EIXA 1M1BA 4J3XA 4HYWA 3AZRA 4O1EA 2PSNA 1Q1WA 2BHYA 3SO7A 4DYEA 2G37A 1OX4B 3DJGX 3PJXA 1FWSA 4HN8A 1IT7A 3JR2A 2J74A 3SW6A 3WF4A 2G0WA 3M7SA 1E9IA 3RIKA 2AL2B 1EEPA 2R91A 3MC5A 2NPXA 4DWSC 3IUIA 4HMDA 3IANA 1ZBWA 4NYUA 1OINA 2XIBA 3VK5A 2FHBA 4ACZB 4P2VA 2XM1A 1S2UA 4UFHA 3ONCA 4LY8A 2W92A 3BGGA 3ZM8A 2DUAA 3O15A 4ZODA 2VRKA 4H04A 3VGDA 1SSGA 3P8JA 4FNQA 4QCFA 5A6SA 2QJGA 1XANA 1B90A 3SJNA 1M68A 2PC8A 1CB7B 2I9EA 2H8ZA 2A3LA 5F2IA 3IRDA 3M43A 3W2UA 2QMKA 3DU0A 3HGSA 2WP6A 1R0MA 3FV9A 3G6LA 4P61A 5JH1A 2RFGA 1B3YA 3QV7A 2DVUA 2FZNA 3G6MA 4WJEA 4NILA 2GGEA 3H8AA 3O07A 4H1ZA 1W2PA 4C6OA 3DKJA 3NXFA 4QSFA 2CIPA 2ZX9A 3CT7A 3M47A 4N9DA 5HANA 4AZ7A 5C70A 1PX8A 3CUGA 2WOWA 1YW1A 2RGMA 3WENA 1XPGA 4JX5A 4FMVA 1N7KA 3EDEA 3KBNA 3A7AA 4J57A 3UWQA 2WSPA 4JBRA 1SJDA 3TCEA 1XH2A 2BVYA 3TWBA 3AXXA 1UZHA 3AN1A 2C0AA 1QPQA 1BWLA 1B31A 2WPCA 4Y7EA 3SAZA 3WCZA 5M3WA 3S8HA 4B5SA 3OZOA 3EAUA 2VVSA 4ES4A 1DE6A 3F4DA 1AW2A 4NNCA 4BS0A 5JBFA 3QZEA 3PNUA 4RZBA 2Z27A 5B7ZA 4YTQA 4PCTA 2OB3A 2AKZA 4K2SA 4JAWA 1CXEA 3ZJ6A 2WKJA 3N6JA 3MUY1 1W9DM 3KWSA 4WRHA 3VNIA 4ZB0A 1OCBA 4HP5A 1VBUA 4G7EB 1I2NA 2ACRA 3LY0A 5E93A 2C0HA 3UP8A 3I7RA 3N3TA 5HJLA 2XVGA 3NDOA 3OQEA 3CQIA 3CUXA 2C1GA 3T0DA 4WIWA 4HNNA 3SIMA 2F84A 4UNIA 3QV9A 4UTJA 1G4TA 4XVEA 4FLSA 1C8YA 2E67A 4LEFA 1Q6GA 1O5QA 2QLYA 3QLDA 3URQA 2CETA 2RH9A 3PFRA 3IJIA 1VJIA 4LV9A 1XCFA 1WB0A 1OCQA 2CU0A 2QUTA 1K70A 2QAEA 1IXQA 4CCDA 3QFWA 1KGUA 3TTSA 4B2DA 3NZ1A 3FEQA 4UTUA 3LDVA 2QR6A 5C9RA 2NQ9A 1WDDA 1VBJA 3I7SA 1Q8AA 2E9MA 2DVXA 4EWJA 4IFOA 1XR2A 4HNUA 3A5FA 4IISA 1BTCA 2Q8LA 4LU0A 1CEOA 1UUQA 4JTDA 3CAQA 4FO4A 1QHPA 1KXVA 4QDMA 2OPJA 4EXAA 3LBCA 1ZKQA 3GD3A 2DQWA 1K3UA 3GXMA 5CJ5A 1ZRQA 1A0EA 2WAGA 2GR2A 4EIVA 4M7TA 2GVEA 3DKLA 3OHIA 1GVSA 3NVTA 1PS9A 1JXKA 1EO7A 5AYXA 3F4NA 1KTCA 2OYMA 3HJZA 2V9DA 4UQBA 3R0KA 5L6UA 4YWOA 4PR4A 3TA6A 1N8IA 1U2YA 4D71A 1PE1A 4R3UA 3UPMA 8XIAA 3GH4A 4IMGA 4EPDC 1JPKA 5LIKX 4E8GA 3B40A 3XINA 3H70A 1W0MA 2C1IA 1QVBA 1LROA 3RLGA 3LBOA 1F74A 3P67A 4D6JA 4FALA 4J1OA 4PRRA 3W7IA 4O8AA 1EHNA 1TUFA 3CWHA 4U3AA 2GYIA 1WKYA 3SM0A 3EPOA 3DFYA 5DO8A 3VOJA 3UCQA 3KCOA 2PUZA 2BXYA 4H2HA 2YA1A 3P62A 1H09A 3TW6A 5E0KA 1TTPA 4B3ZA 3MSGA 8A3HA 3FHAA 5CXPA 2W79A 4H9MA 1OT2A 1YNQA 2R94A 3STCA 3EOLA 2FTYA 5HNRA 1XW8A 1EOMA 2OX4A 3H53A 1SZFA 3VMPA 7REQB 5G4HC 4ZO6A 3FCPA 3LLFA 3S42A 3C0QA 1V8EA 5FAJA 4GR1A 4ADTA 4HZMA 2Y8KA 5EPDA 3TC6A 3T1GA 2J62A 3NAVA 1OQFA 3CMFA 4UBPC 4AIUA 1Y0EA 1CGYA 4DNAA 1EB3A 4WXYA 2P10A 2A3CA 3M6DA 4ADUA 1KCXA 3GYCA 2IPGA 2GSEA 3SSZA 4OGZA 1QCWA 1R30A 4BWLC 5CZKA 4Q4SA 2G8ZA 3M0JA 1VCFA 1HO1A 3L2LA 3V35A 3CL6A 3BAIA 3P81A 4Y6GA 1X2GA 4D1JA 1W1ZA 2WC7A 3WQFA 3VIFA 7TIMA 4U28A 2DT3A 5BWFA 3T2PA 3DBPA 4ZO7A 2C6QA 5DMMA 2A21A 4HOXA 3MCOA 4MIMA 3AMGA 1FTXA 3BW3A 2C3DA 1YBQA 2YCJA 4FA3A 1DXEA 3BAKA 2CLKA 3UZZA 3NVZB 3ES8A 3MSYA 1O4UA 2X1RA 1TJPA 3UVAA 2C19A 2X0YA 3HV9A 3QOMA 2E9LA 4JNMA 1P7TB 1F61A 1VDVA 2QJMA 3N73A 3S9ZA 3BLPX 1ZCOA 4UFMA 1UPPA 1MNZA 2CDUA 1DOSA 2XH0A 2NQ5A 2ZXBA 3R1ZA 4NZFA 4WY0A 5HQEA 2X7WA 4PTVA 4Q8MA 2V3EA 3PULA 1BSIA 8CGTA 1EGVA 1F3PA 2XYLA 3ZZ1A 3M5YA 2VEFA 2VFEA 4LYRA 1YDYA 1AZ2A 1UC5A 4M3PA 1HGYA 1LQ0A 5EBAA 1RBLA 5D8WA 5BOFA 1H1ZA 2QF7A 1C8XA 1EO5A 3W7JA 3TC7A 3U2CA 1AD1A 4Y96A 3LXDA 4UQDA 4LF2A 6REQB 2PZ0A 4HMEA 1CB2A 3VIMA 2X99A 3CB8A 4ACYA 1UKSA 3PBWA 3KW3A 3PP7A 5AC6A 1F05A 3BAYA 1JUEA 3QRHA 1ISYA 3R0UA 4Z1AA 2P53A 1L6YA 3UJEA 5LNRA 5CZ0A 1JNEA 3H54A 2O92A 1K7XA 4JKMA 3UD6A 3HG4A 1H6VA 3WLSA 2P3EA 3ARTA 3OVRA 4AD2A 4GMEA 1E71M 3NQCA 4L6OA 3AXMA 3BPWA 2Z2UA 3MHUA 3PG8A 1XIMA 3LRLA 3H4XA 3HA1A 1KWKA 1L8PA 2O9TA 5AYZA 1QPRA 1SO5A 4H19A 2GVLA 2JFEX 4QX4A 1GQKA 2GUUA 3EX4A 4B5WA 4P8UA 4P7RA 1B30A 1PEZA 4QS5A 1GV4A 3CGTA 4ML9A 2ZWYA 1GHRA 3A22A 4AIEA 4M29A 4GRTA 3AXHA 2E40A 5K7JA 2F2KA 1DWJM 3VD3A 5I5RA 2A7NA 3NCOA 4H6QA 3OG2A 3QF0A 2G97A 3LLDA 1BPLB 4U10A 1E5NA 4MDPA 2XVNA 2ZC1A 3LXBA 1JRCA 5TAOA 4UR8A 2CZFA 4PA8A 2PRLA 3TSDA 3P80A 2JKAA 1EF2A 5C2GA 4L9XA 1AVAA 3CQ0A 3W7EA 4FOKA 4AD1A 3MKKA 1H7PA 3SY5A 1FDZA 4Z2KA 3LA4A 1E4MM 1PO9A 4XIMA 4J3ZA 1Q7QA 5EY5A 4NY2A 4BCEA 3EOOA 3F4CA 2ZRVA 3NR0A 4MZYA 3O9NA 1KFEA 1WDQA 3U2OA 3W75A 1ITXA 2YA2A 2WBKA 3GU2A 3UYCA 3VI2A 5HUPA 1K6AA 3NPWA 3WLHA 4H8HA 1WKDA 2DQXA 4RE2A 1JYXA 4BQ2A 1R2RA 3WK1A 4I5UA 5GRTA 3VOIA 4XSMA 2FHFA 2F9RA 4W8LA 1G01A 1OEPA 4FNSA 4N9CA 2BNJA 1JGIA 2POZA 1UD2A 5AB3A 1OYAA 3S83A 3G3DA 2GQ8A 1PIFA 1E56A 1O12A 4D2JA 1M3UA 3EMZA 2GDUA 1P6WA 2X0SA 2DVTA 3VD4A 3MANA 1VD6A 3IJ7A 2WKLA 3W7MA 1PHQA 4JTCA 2NXGA 3TJ4A 4FX6M 1TFVA 1XIHA 2EJ1A 3C2FA 1BRLB 1H51A 4CGTA 1M6IA 5J5DA 3F03K 3CUZA 4M82A 1MW2A 3PUEA 2Y5JA 3OVPA 4HTBA 5BYWA 1K9DA 4HPNA 1EHAA 3VIKA 4TR9A 5CEWA 1ZBCA 3WUBA 1M7XA 1EGZA 3LCXA 1PDYA 2VWSA 2GGGA 3LTPA 3NEHA 3PZQA 1DNCA 1J6OA 1ESWA 3L66A 3TNBA 1TPB1 1YNPA 5I07A 1X38A 1F3EA 4KBXA 3A13A 4DUWA 1MUCA 2ZICA 1KM3A 1OX4A 1UD4A 4IFRA 3U5YA 3GD4A 4AC7C 1XRTA 4DO6A 3SADA 4PGLA 1H7RA 1S7MA 2AMGA 3NM3A 4DN1A 2O0TA 1EPXA 3LHTA 3AIEA 2YZ5A 3WO8A 4QJ5B 3B04A 1C7SA 2CHRA 2PCEA 3WNNA 3GRTA 2AL2A 4JIRA 2VEKA 1W3KA 5A8PA 3SIZA 1Z69A 2PP1A 3F2CA 4GHRA 1IEIA 1W1B1 1CXKA 2VKZG 3II4A 5CKSA 2Z6JA 1R86A 3VVGA 4ACZA 3W38A 3L5LA 4UMBA 5FF0A 3M6YA 5ER0A 4K38A 1YIXA 3SGZA 5TNVA 4LYPA 3EZ4A 2CXGA 4M1BA 1V3HA 1EA0A 1B1YA 2DZWA 2ZADA 2OYKA 5HA7A 3GR7A 3CQHA 4LVDA 2AGKA 3NQ6A 1HF6A 1GUVA 2P0OA 4XAGA 3V0TA 2OOGA 2A2IA 2EG8A 3VDCA 3CTLA 2V63A 2SFPA 2NUYA 2TAAA 3LZ5A 5E9AA 1NWUA 5D9OA 2EPMX 1ZP3A 5FEWA 1U1HA 3T09A 3NTYA 4QDWA 3DYOA 2DZPA 4DBUA 4BK9A 1S5WA 4Z1DA 2ZZ3A 4EWND 2W27A 1VPYA 2YYUA 4Q4OA 3W2JA 1T99A 3BAJA 2WNZA 1QOXA 1OJXA 4F9DA 3TWAA 1LORA 4BZYA 4M19A 5A8QA 1QMLA 1NTHA 4DXXA 3HQ1A 3TMLA 3MZ2A 3O6DA 1X7IA 2CLLA 3LGGA 5REQB 1I2OA 4XVDA 4I8YA 1MW0A 4LUJA 4CQCA 5BROA 1E55A 3MUAA 3N29A 1IEVA 1KM2A 3PB0A 4LX4A 2OYLA 3PUDA 1XLEA 5ECVA 5H6HA 3S5YA 1CGTA 2FGZA 2DZTA 1A5LC 4LXFA 4YWIA 1JRPA 1Q2SA 2WB5A 4HSOA 1FEAA 1TB3A 2EQDA 3G22A 3VD7A 3WLIA 3GNDA 3I6TA 4ZR8A 4PUWA 3U57A 2V3FA 4F0SA 4G7EA 3VGHA 3FXYA 1NOFA 4DB7A 3RLVA 1XCXA 4DF2A 3PBUA 1UC4A 6TIMA 2OQLA 1ME7A 3WEZA 1T8QA 1ME8A 3AS3A 4HOWA 4HCLA 2XH2A 1IT0A 4EQXA 2FFCA 3V18A 3WBYA 1EYWA 1UYQA 3R43A 1TX2A 2LLEA 4KEVA 3THDA 4E2OA 3LGEA 1FWEC 4Z08A 3T40A 3ERPA 1MXGA 1VBGA 4Q8QA 1KRBC 4XAZA 5A6TC 1ONFA 4EAYA 4O4VA 5G2IA 3ZFHA 1UH4A 1TTJA 3NQ7A 1A49A 4HQVA 3FKRA 2A7RA 4MB5A 1W1TA 3SZ8A 3D3AA 3VO0A 5U7SA 2Z29A 2VOTA 3I10A 1ZAJA 4Z1BA 3MV01 2NW0A 1YPXA 3RITA 1MFVA 2CKRA 1RD5A 4JQAA 1A5KC 3TCSA 8TIMA 2CKSA 3LBMA 3KBSA 5AVNA 3ABOA 1YRRA 1IZKA 5LGXA 1E6ZA 3ZWSA 3PFMA 1KNWA 1BYCA 3TZNA 3P0XA 1LYXA 1LDCA 1GRBA 1KFKA 1PKNA 2CXEA 3KBWA 4D9PA 1YE6A 2NQHA 2J13A 1JZ5A 2TPSA 1HL2A 4LVAA 1US0A 4LCSA 3PJUA 3HG3A 4MWAC 4QP0A 1GRAA 1OY0A 1T40A 2P8BA 3OTRA 3P74A 3LM3A 2WMKA 3R25A 2EQ9A 2V67A 5CLTA 4ATDA 4PMNA 4Q7IA 1W9PA 5DRIA 4N6EA 4FNTA 5T26A 4W7UA 2ZZ6A 5BWAA 3IIVA 4FXFA 3DI1A 4JGDA 4LB3A 2BCPA 1BD0A 1Z41A 2GGJA 4MKNA 4N7QA 2VC9A 4RDVA 3KRSA 1RCXB 3GBDA 5A6JA 3NQBA 3IS4A 2EG7A 1OIFA 1STZA 4IQEA 3OO2A 1L0PA 4M1RA 4DAIA 3VKAA 4KEZA 2J75A 3CH9A 4UOJA 1OD8A 5C9WA 2WPBA 1BVNP 3B0PA 4RNJA 4BF9A 1D3GA 2NV2A 2QGYA 3GNNA 3O0KA 3BG9A 5IOBA 1FHLA 3EWWA 5CCZA 1PIGA 3P93A 3N34A 1NDVA 1XUUA 4XZIA 2CLHA 4DQWA 5LYRA 3CIVA 2R1LA 2HK1A 3A47A 7REQA 1TWDA 1K77A 3MPGA 2WNWA 3WLNA 2YVGA 4KS0A 1A5SA 5FSDC 3BV4A 2WO5A 3GNOA 1CWYA 4AHQA 3BXWA 3IJ9A 3REQB 1GYNA 2CLOA 3BMWA 3QZAA 3OGSA 4HNOA 3WEMA 2Z0IA 4Y9NA 3GFYA 2IKGA 5FF7A 3W6MA 4IMEA 2JE8A 4H4VA 1VGAA 2VWTA 2GDVA 5LIXX 2X09A 1H41A 2P3ZA 4CQDA 4JTLA 1QOPA 4MJ2A 3WQWA 1GXFA 3H22A 4LCRA 3LQLA 1KCZA 1GKQA 3POHA 4JTKA 4N02A 1LJYA 3HPSA 4JFTA 3ARWA 3W73A 3UY8A 3UBPC 2QCDB 1F3WA 3QV6A 2A0NA 7ODCA 3K4DA 3LV5A 1QPKA 3VUSA 1G1YA 1P1MA 1UUMA 4DJFD 3P14A 2PDLA 1E15A 3KE0A 1M04A 1SW0A 1ZCCA 1V3IA 3MY9A 4OWGA 3IVSA 1VCVA 4R85A 1GVYA 3KWXA 4C6BA 4JFUA 3AU2A 4CUCA 1OD0A 1A5OC 2YW3A 4AYGA 4XZ9A 3STEA 1DJZA 5C6MA 4GG9A 1H7XA 1OYBA 3WNPA 3H12A 1JAKA 3AHTA 3CXBA 3FY1A 3W86A 3K1GA 1P7TA 2Y7EA 4EANA 2DH2A 3E3HA 3U8GA 3AMKA 2FZMA 2CBIA 2E9BA 5A6KA 5A95A 4RW3A 5K4ZA 1EPVA 1K4HA 3A4XA 3IGXA 1R7OA 2Z26A 2RDUA 1C9WA 3M16A 4FHAA 4IL0A 1HW6A 3BLIA 4D8AA 3TJIA 2Z2AA 4UQCA 4PUEA 2J8FA 1R9ZA 3LD5A 2FPVA 3ARYA 5GNXA 2RDWA 4XTIA 3WEOA 1V93A 3CZLA 2CFYA 3VU2A 2FH6A 3NDYA 1QDSA 3Q45A 3NIYA 1C93A 4N0RA 3DG6A 2XTKA 1BG4A 5DFAA 1P43A 4R33A 1O5XA 3WD4A 3UESA 2VJXA 1GOOA 3PBVA 3PNZA 4BA0A 4E2VA 3JRKA 3H23A 1V03A 6REQA 3LK6A 2YL8A 1EGMA 4PODA 3WF0A 2HROA 3MI2A 4DNMA 4KFPA 3KL0A 2J7HA 4Y9PA 3PHAA 2G3MA 3C0SA 2B7OA 2GQWA 1MMFA 1FHVA 3RR4A 2ON3A 2XHYA 3VNMA 1OFDA 4J2PA 2YL6A 2XIOA 5FL0A 2HDJA 3H7RA 1NF7A 1XYZA 4L65A 2NX9A 4IUGA 2DY3A 4JYEA 4RCXA 4ZOAA 2QS8A 4YVPA 2O56A 5HWNA 1RQBA 4WHBA 3A64A 2VFHA 4ZOHB 5G2HA 1UJQA 3H55A 3GKFA 4OT7A 4RR4A 3P2VA 4PTMA 4J3UA 3FSUA 1UR3M 1EH9A 1V77A 2QYGA 3DK9A 1UOKA 4PYSA 2D23A 4O18A 4BQ3A 4NAEB 2VUNA 1E40A 3M1ZA 2OELA 1ZFJA 4HK7A 1DIKA 3FK4A 1IT8A 1TWIA 3KRZA 1E3ZA 3EA3A 2OQHA 3H2CA 3PSWA 4LY4A 5DBTA 1JUKA 4O1DA 1JD9A 3VNKA 1QWKA 4IOTA 4XZNX 1F6YA 4HZ8A 1R6WA 2QW5A 2Z1XA 5BRPA 1XD0A 1QBBA 3N18A 5HATA 3FFSA 1DWAM 3BMXA 1JI1A 1J18A 1L6WA 2ZZ5A 1XIIA 1A50A 3MW7A 3F2BA 1XLFA 3TYEA 3AZTA 4KWSA 1AMYA 2VZTA 4PMRA 2QT3A 1MVYA 4QJ3B 4J4KA 3PBMA 3DBNA 3BANA 2IQDA 1J5SA 5D8ZA 4IJCA 1W1IE 2WBGA 4AZIA 3WH7A 3VNYA 1FWTA 4ERIA 2PDJA 4TVWA 2ZUUA 4EXBA 1GOQA 3GFZA 2FYMA 5CC5A 3OZMA 3QR1A 4WOQA 1VFMA 4IGMA 3M5XA 3N6HA 3RRAA 5D9PA 3W70A 1H7OA 3W71A 5U1OA 2YKKA 1U30A 5HXMA 2UY2A 1Y5WA 4JNZA 3GAYA 4IIDA 3CL7A 4RX0A 5A8OA 5C54A 2F5ZA 1BEUA 2HXTA 2Y4SA 4LAOA 3A4AA 3QEZA 5FJTA 3GX9A 3AIVA 3FVDA 1Y8BA 3V0SA 1JFHA 1BRLA 1E0XA 4GY1A 4FR1A 3AHYA 3W22A 2V38A 3APYA 3UG8A 3O6AA 1V3MA 3OHMB 3BGJA 2BY0A 3N14A 1YEYA 2C1HA 5FMHA 3ABRA 3CEUA 2IQ0A 3W7RA 4IPNB 1UWTA 3WLLA 5XIMA 1EUNA 4DHGA 2OEKA 4GIRA 1NWTA 3UYIA 3IUDA 4US5A 2VXNA 5TR3A 4BJHA 3VCNA 5H8MA 2J8TA 3AROA 4L7ZA 3CNYA 3Q4DA 4Y2WA 1TPH1 3L0GA 3LCFA 3BSMA 1W3LA 3M0ZA 2QAFA 1QO5A 3GTFA 2B7QA 1A5CA 4K8EA 3U5UA 3NOEA 3MO7A 4GCXA 2WWDA 1ZMDA 4NZ5A 5CAKA 1NHPA 2A5HA 1YTKA 4WXZA 5BXRA 1KB3A 1H4PA 4E8CA 1CNVA 2ISVA 1JQXA 5M1TA 2GVYA 3B8WA 3M41A 3G1FA 5LGZA 1RBOB 1SGJA 4IMCA 3E2VA 2EPOA 1VQZA 1S2WA 4QM1A 2OGYA 4TQTA 2V2DA 2XN1A 1PAMA 2BASA 3PN8A 3QR3A 4W85A 2GGHA 3W85A 4S38A 3TQVA 4Q4KA 4PUKA 1EEXA 2CNCA 1VEMA 5JCLA 1PZ3A 2ONEA 1DV7A 3IEBA 3UXLA 4ZZ9A 1XLJA 3GXFA 2WC3A 4M5PA 4QE5A 1UR1A 1G4SA 3CMJA 1Q7ZA 3BE7A 3N2CA 2CW6A 3SECA 3WD1A 2WWCA 4ZXOA 2WCSA 1TWWA 4HMCA 2D0HA 4AISA 1ZALA 4UWMA 2QJIA 1RSCA 1N8FA 5REQA 3KVLA 2PP3A 1NQKA 4CN6A 3WQGA 5HJYA 1TIWA 5KVHA 3PPCA 4ZOCA 3BJTA 2ZTJA 1HTIA 5JCKA 4F2UA 4Q4MA 1SPQA 4JXCA 4F8XA 1IR2A 4RUBA 4EVZA 3NZPA 3W29A 4ADWA 3QPZA 2RDTA 3T6CA 3VPLA 1JCTA 1BXCA 2ACUA 4HHPA 5JMUA 2PDPA 1MYRA 4L1WA 5AKQA 4N2YA 4DRSA 1GJPA 2TSYA 4DJDD 3QR0A 1L6FA 2WMHA 4P7OA 2VCCA 4S3CA 3KDOA 2PWVA 3GTNA 3TEVA 2WV8A 2Y0FA 3SQSA 5F7UA 4MYXA 2R1PA 1JZ6A 4BY3A 3L4UA 3D9XA 3RFAA 5F2LA 4BHYA 5HWJA 4AZGA 1JYWA 1ADSA 3TFXA 3O2LA 1GKRA 1DWIM 3V3WA 2Y85A 4TMBA 4ZENA 5JIPA 3BCDA 3VE9A 1MO9A 1WCGA 4JTUA 3A4WA 1CLVA 4ML4A 4DO7A 1QBAA 2AQVA 3ZLGA 3CIWA 4JEJA 2PDWA 5EL1A 5ABHA 4MADA 4LSBA 1H7NA 1MW3A 4EQSA 4GA8A 4HBKA 3QHOA 1VP5A 2VZVA 4TMCA 1TV2A 1LF1A 3W1PA 1VPXA 1E0WA 1VFTA 4B3LA 5MKGB 3STPA 1IXPA 3JUGA 1SM9A 5I2UA 4W8AA 3RDKA 1K7EA 2ZZ0A 2ISFA 3WK0A 3USZA 3WD0A 5LZLA 1XX1A 2AL1A 4FF7A 1LWHA 4TTUA 3SBFA 2Z4GA 1TV3A 4Y8FA 3OVQA 2GOUA 3DFHA 2YJQA 1T5AA 3RLHA 1TPWA 4H01A 4XD6A 1XFBA 3KOWA 4ZTXA 3KRBA 1QHZA 2I9UA 5CBJA 1JPHA 3R8HA 3BG5A 4ASTA 4JTIA 4UQAA 3VDHA 1RQHA 4JHZA 4RK8A 2VDHA 3GFXA 2EQ6A 3GRIA 4ZFMA 4H4XA 4DWSD 1B5TA 4LGXA 5M17A 5C9ZA 3WLJA 3T2QA 1V7YA 3EMQA 4GYFA 5TBOA 3WLOA 1TZ7A 5AZ0A 4QROA 4YTSA 4H9YA 1TE1A 2HVNA 2DZUA 2O9OA 2Z1SA 5HPCA 3PPFA 1XRSA 1LG1A 1GEQA 2E0PA 2GOKA 4KGJA 3W81A 4LRSA 3AC0A 4GZ7A 2QEZA 1E0UA 2FZ9A 1MXSA 7XIMA 4JEQA 3WUFA 2RKXA 2OOFA 3GD6A 4UTTC 4GY7A 1G5AA 1HKVA 5T9CE 3TIMA 4GUHA 2JF7A 4DBSA 2YZRA 4MPQA 4XKMA 2ZX8A 5D09A 2BXVA 1XBZA 2ZQ0A 3MMWA 4F2TA 2X2YA 3MUCA 1MI3A 5JVLA 4Q6XA 3CHEA 4Q3MA 4LRTA 3R94A 5A6MA 4JYFA 1LQ2A 1IWBA 3REQA 1M7OA 4S2CA 3NVWB 3VIIA 3UQNA 2YL5A 1A5BA 1TCMA 4KW2A 4EX4A 3QXBA 3DYPA 5BOEA 2ISDA 1KQYA 2QF8A 3T0AA 2CZVA 4H6RA 5AC5A 2R24A 1TWSA 4O8RA 1G94A 1NHSA 3UR2A 2VQTA 5AHMA 4HHMA 3DGZA 4DYKA 3Q94A 4H4QA 2BXZA 2HVMA 3QGAC 4JTAA 3W1TA 5JUVA 1FFUC 4XUYA 3CM4A 1Q65A 1WDRA 3KP0A 1NP0A 3QVQA 1Q4WA 3ID7A 4Z2GA 1FO4A 5A94A 5XIAA 1BWKA 3MB9A 4PUNA 4O1CA 1ZZMA 3C2YA 3W7GA 1PUDA 4HA1A 3W37A 2VZUA 1KTBA 3A21A 1KGWA 1PBGA 1ONXA 1OFRA 2QCDA 1W1YA 3CPUA 4Q8PA 1XIEA 4ECLA 3D0CA 3V36A 1KBBA 4Q4RA 3AIUA 3PZNA 4GBDA 3PZ9A 3KLKA 4JIEA 5DCDA 3KOZA 3IK4A 4HJWA 1V4YA 2ZC8A 3M0LA 1R3VA 4C60A 4FOJA 5GJPA 3IC9A 2BY3A 2AMXA 1FRBA 1JYVA 5CZJA 4QEHA 5IXEA 3ZMRA 1VAHA 4GISA 3EUB3 4V33A 2XGBA 5A8GA 4HPGA 3RMEA 1DJYA 2J9YA 3S6OA 3CPRA 4JFWA 2PWDA 2ZUSA 2R82A 1VFOA 3M0MA 2Y62A 3NQAA 4LH8A 1GTHA 1M03A 2HEJA 5AHLA 4XX6A 1F3TA 2HBVA 5C9XA 1RCOB 1XLKA 1YXYA 3DK4A 1GOMA 3FW6A 3GZAA 4ZSUA 7ENLA 1KD0A 3I7QA 5BOOA 4Q7BA 2G3FA 2FDSA 2QCNA 1BVZA 3RRXA 3VIGA 4Y90A 4X9SA 5DY2A 2CWXA 3QV8A 2Z1BA 4JCMA 3NL2A 2WZTA 4S3JA 1AW5A 4B92A 3S9YA 4GKTA 4S1FA 3UF9A 4B5XA 1RVKA 3MJYA 1JG9A 4IICA 2PF8A 1UKPA 2D69A 3SCOA 2J9XA 3GAKA 4MG4A 1QHOA 3TYBA 4B16A 3TFCA 1YLVA 3BSGA 3O0HA 3DESA 1R3SA 3BAXA 3KL3A 1G4PA 4ZOBA 2OT1A 1TJ0A 1QATA 1OWQA 3SURA 1W1PA 1DEDA 3LERA 1BQCA 1XFCA 3T55A 3V5OA 4J28A 1F7BA 3NOYA 3BMVA 4B5NA 5FESA 2J6VA 3L5OA 5JCMA 2XDFA 4HPHA 4Z42C 4OJYA 4ERGA 3W4RA 5TD4A 1V6VA 5KSWA 4I9MA 3AIQA 2WJEA 3VZXA 1YDOA 1Z48A 1ICQA 3TN3A 1C91A 3GM8A 2ICSA 1DXFA 1A3HA 2E6AA 4LAZA 2PA6A 1W37A 3W00A 1Q6DA 4NIRA 1R87A 1EQCA 4XD5A 4NAEA 3AALA 2OVLA 1OG0A 4QISA 4ZSTA 4D6GA 3A6OA 3BG3A 1FXQA 2BOEX 4NNBA 3RPDA 4AIOA 1CZ1A 4WSHA 3NA8A 1KRAC 4GQQA 4IIEA 2W0UA 5BMWA 2FVMA 2I17A 3TQKA 3GR4A 1PYFA 3PZGA 5CQ1A 4JTEA 3C56A 3M0IA 3EWBX 3LGDA 2WQPA 3ZSSA 2F6UA 5KVIA 2WKGA 4PTWA 4ZQNA 1XM3A 3E0IA 3QKZA 1DP0A 2JIEA 1GETA 4AEOA 4NZ1A 2OSWA 3GY1A 3DGBA 3LM7A 2B31A 3HJEA 1IQ8A 1YPIA 3QM3A 4PBEA 2DIJA 2MUCA 1XDIA 1XLCA 3C52A 4PRTA 3URBA 3PTMA 3DERA 3MDWA 2CERA 4MY1A 4Q32A 2OEMA 4RPQA 1RAKA 3MP5A 1EF3A 2DW6A 1XD1A 1B3OA 1YMYA 4GXPA 3S5NA 5LXXA 1R3RA 3UR7A 3WLKX 4GINA 1E43A 3V1PA 1T7LA 2PRMA 4JTHA 1OM0A 3LPPA 1P0KA 2O7SA 3R8GA 4MKSA 4P7LA 4FNUA 4ORIA 4AX6A 1GGOA 1KXTA 5BNKA 4YTTA 2BDQA 3LOTA 4CNPA 4IPIA 2JKPA 4NASA 3AHZA 3THQA 3QMTA 4ZB5A 5FJJA 4FXRA 3C61A 4M56A 3FJLA 3IJLA 3CGCA 4R53A 1XQLA 4UTTA 2QDDA 4WK9A 4D6CA 2PDQA 4C6LA 1W5OA 1WNOA 5JBEA 3NQFA 1VFHA 3M0VA 1QW7A 1NFPA 4UCFA 2QCHA 5CBIA 1O7AA 3GB6A 2NVDA 3TZFA 1UKTA 2VFFA 4L1XA 1JGMA 3WSUA 4LBRA 2A4AA 4JFVA 3ZR4A 2NXIA 1K4GA 1J0JA 2W67A 1B57A 4LF1A 1Q7MA 3WQVA 3A3WA 2WJFA 5ABFB 1VJSA 3KTXA 3Q65A 2Z2BA 2GUBA 2BOGX 4CQBA 3V0UA 3SCPA 4XD4A 4YVVA 3G0SA 3MZNA 1E3XA 1GJWA 3WDPP 1UR2A 1VBRA 3NPUA 4GC3A 4PMJA 3WFAA 1EX1A 4OOUA