2QJNA

Crystal structure of d-mannonate dehydratase from novosphingobium aromaticivorans complexed with mg and 2-keto-3-deoxy-d-gluconate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
402
structure length
385
Chain Sequence
MKITAARVIITCPGRNFVTLKIETDQGVYGIGDATLNGRELSVVAYLQEHVAPCLIGMDPRRIEDIWQYVYRGAYWRRGPVTMRAIAAVDMALWDIKAKMAGMPLYQLLGGRSRDGIMVYGHANGSDIAETVEAVGHYIDMGYKAIRAQTGVPGIASLPSVTGWDTRKALNYVPKLFEELRKTYGFDHHLLHDGHHRYTPQEAANLGKMLEPYQLFWLEDCTPAENQEAFRLVRQHTVTPLAVGEIFNTIWDAKDLIQNQLIDYIRATVVGAGGLTHLRRIADLASLYQVRTGCHGATDLSPVTMGCALHFDTWVPNFGIQEYMRHTEETDAVFPHDYWFEKGELFVGETPGHGVDIDEELAAKYPYKPAYLPVARLEDGTMWNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of enzymatic activities in the enolase superfamily: D-Mannonate dehydratase from Novosphingobium aromaticivorans.
pubmed doi rcsb
source organism Novosphingobium aromaticivorans
molecule tags Lyase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
total genus 141
structure length 385
sequence length 402
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2007-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2qjnA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2qjnA01
3TWBA 1WUEA 1MRAA 3DEQA 4HYRA 4IL2A 3RO6A 1WUFA 4GISA 4H83A 3V4BA 4HN8A 3DERA 3SQSA 2OZTA 4DXKA 4E8GA 3IJQA 3ZLGA 5FJPA 3GC2A 3H7VA 3HPFA 3N4EA 3B97A 3BOXA 2XH0A 4J1OA 3TWAA 4ZA0A 4HCHA 3DG3A 4H19A 2QQ6A 2OO6A 3NXLA 1P48A 3UJRA 1JPMA 4A3RA 3DIPA 3H8AA 1TZZA 4M6UA 2ONEA 4EWJA 4IZGA 3MSYA 3QLDA 3DGBA 2PA6A 4IHCA 1YEYA 1EC8A 2QVHA 3SN4A 3S5SA 4FP1A 1E9IA 3TOYA 3I6EA 4HPNA 3CT2A 3RITA 3RCYA 4E6MA 2PTXA 3FJ4A 2QDDA 2GDQA 2HZGA 2PU1A 4DN1A 3K1GA 2AKZA 3PWGA 1W6TA 2OQYA 2GL5A 2P8CA 1MDLA 2FYMA 3R0KA 4ENLA 3R10A 1F9CA 3N4FA 3TW9A 3NFUA 1EBGA 3FCPA 2QGYA 3UJFA 2PMQA 3STPA 4A35A 4F4RA 1BKHA 3RGTA 5IDZA 2P88A 4DWDA 3U4FA 3TCSA 2QJMA 4KT2A 3R11A 4H2HA 3BJSA 4E4UA 3SSZA 3BSMA 2HXUA 4HNCA 3MZNA 1XS2A 1PDYA 2GGJA 1MUCA 1EC7A 4G8TA 4MGGA 3MWCA 2PP1A 2XH2A 2AL2B 2O56A 1DTNA 1ONEA 4KWSA 2OPJA 3SN1A 3VFCA 3ENLA 2OLAA 1IYXA 2GGHA 2XGZA 4H1ZA 2PODA 1P43A 3MY9A 2MUCA 2ZC8A 1ECQA 3Q4DA 3V5CA 1OEPA 3UXLA 1SJAA 2OFJA 2DW7A 2OG9A 2OVLA 3ZVHB 4DHGA 1KKOA 3FYYA 3VC5A 2PCEA 4GMEA 3DFHA 1R6WA 2XH4A 4G7FA 4GYPC 4E5TA 4GGHA 3NO1A 4Z1YA 1RVKA 2OZ8A 2HNEA 2MNRA 3UJSA 1JDFA 3ES8A 3OPSA 2QJJA 4K2SA 1FHUA 4K1WA 4FI4A 3I4KA 2PGWA 3QPEA 2GGEA 2OZ3A 3N6JA 3DG6A 3TJIA 2GSHA 3CK5A 3OP2A 1EC9A 3GO2A 2PU0A 3EKGA 4Z17A 1ELSA 1L8PA 2AKMA 2P8BA 4E4FA 4J3ZA 2PSNA 3CB3A 1R0MA 3Q45A 3ES7A 4GIRA 5BOFA 3KUMA 4IP4A 3CAWA 3VCCA 3H12A 4HCDA 2I5QA 3UJ2A 2PTYA 3EEZA 2OX4A 3ZVHA 1KD0A 3THUA 3T8QA 3DESA 3FXGA 1SJDA 3SJNA 3GD6A 1KCZA 2XSXA 4IL0A 3N6HA 2PPGA 3R1ZA 4IT1A 4KPLA 7ENLA 5ENLA 1KKRA 4MKSA 3IJLA 3OZMA 3JW7A 3T9PA 2PP0A 3VC6A 3V3WA 3I6TA 3H70A 3OZYA 2NQLA 4ZCWA 3UGVA 3VCNA 3FV9A 3VDGA 2QJNA 1TE6A 3CXOA 2GGGA 3MUCA 3R0UA 3PFRA 4JN7A 3V5FA 5J04A 2FKPA 5EU9A 3MKCA 1JPDX 3UCCA 2P3ZA 3SN0A 1PDZA 4HNLA 3P3BA 4DYEA 3ZLFA 4GFIA 3ZLHA 3NZGA 1XPYA 5FJUA 4YWSA 3CYJA 1SJCA 2RDXA 2POZA 2QDEA 4GGBA 3P93A 3R25A 2HXTA 1MNSA 4GYPA 6ENLA 1FHVA 2PGEA 2P0IA 3OTRA 3RRAA 2ZADA 3P0WA 4K8GA 1BQGA 3JVAA 3QKEA 5FJOA 1NU5A 4DX3A 3RR1A 3TJ4A 4JHMA 3DFYA 3JZUA 3VA8A 4IP5A 1MDRA 3DDMA 4ROPA 3PWIA 3QTPA 2DW6A 3PK7A 4A6GA 3GY1A 5FJRA 3T4WA 3TTEA 3IK4A 1TKKA 2AL1A 1EBHA 4X2PA 3ZVIA 5BOEA 4KEMA 3D47A 4M0XA 3T6CA 2PTWA 4MMWA 2OKTA 2XH7A 1JCTA 3IJIA 1NELA 3OW1A 2OQHA 2PS2A 2PP3A 4JN8A 2AL2A 3S47A 2CHRA 1SJBA 3U9IA 5FJTA 2GGIA 3UCDA 3QN3A 3UXKA 3FVDA 3MQTA 3SBFA 3D46A 4HCLA 3DG7A 3TQPA 3UJEA 2PTZA
chains in the Genus database with same CATH superfamily
2WZHA 1ZDLA 2XINA 4KRUA 5A1AA 3VKAA 5C0QA 2ZRVA 3W81A 3MJYA 4XTDA 3AIWA 4JTEA 4QEHA 3K30A 3WLTA 5DY3A 2PE4A 3LV6A 5ABHA 2DT1A 1GJUA 3W75A 1NF0A 4PBFA 4YS1A 3S1WA 1YTDA 3EA1A 1NOWA 3ZLGA 2BMBA 5DO8A 2CBVA 2X42A 2CZVA 3ZZ1A 3DC8A 4FLQA 3H21A 3BDKA 2OT0A 3IIOA 3T2QA 1GYNA 3W26A 3UWUA 4EM3A 5I02A 4J1OA 3UPBA 3R8RA 1EH9A 4WF7A 4NZFA 4NZ5A 3LXAA 1WNOA 2HRWA 1Q63A 3OU8A 4PC8A 3FAWA 2W91A 1PXGA 1GRTA 3NQ7A 4X9SA 1DIDA 3W07A 4GJ1A 1H49A 2BDQA 3T44A 5AC6A 3LHZA 4N6FA 5DRCA 1XHGA 1G01A 1UASA 4IHCA 2AQWA 1WZKA 1MYRA 4ZSUA 1XIFA 1EJ7L 5CPOA 2GR2A 3NZPA 2WXDM 4CCZA 3WF2A 2CW6A 5KZ6A 5KVHA 4BHYA 4HPNA 3OVGA 1YE4A 3UY8A 2O9RA 2HZGA 1GHSA 2FGBA 5D9MA 2PWDA 5A6SA 1T40A 4QX4A 4M6PA 3NO5A 1UR4A 1UWIA 1FCUA 1VR6A 3BMXA 3LHTA 1K1DA 2Y4SA 1FH8A 4MYXA 3CIWA 1J0JA 2ZZBA 2GSEA 1W5NA 3JZEA 2WMFA 3KCLA 3CV2A 5C71A 3CL6A 1ADSA 1HN1A 1OSEA 3D5HA 3QV6A 3IIXA 4IMGA 3ZT5A 1QFEA 1JCXA 3IC9A 1W1PA 2OTDA 1WXJA 3VNYA 4KCUA 3W2KA 9CGTA 3LPGA 1OFOA 3G0SA 3WENA 3AC0A 3NZQA 4EF8A 4MDOA 3QF0A 4JFTA 1QNSA 4RXFA 3L4UA 2O92A 4FX9A 5KTLA 2ZCGA 1K9FA 2R1KA 1ONEA 5G2WA 4KWSA 1PHQA 3B4UA 3UXDA 2HEJA 3QOMA 4MWAC 1JZ6A 3KTCA 3IJ9A 3B8DA 2ZUUA 3B8VA 4YWOA 1Q6QA 4JCLA 1ME9A 4X2RA 5AN7A 1WB0A 1FTXA 3V5CA 1XDLA 2A3EA 2CDUA 1LOSA 3EKZA 1HT6A 5DFAA 2VCAA 5T9CE 2PCEA 4W93A 5CG0A 4X22A 5HNNA 2JGQA 2J8GA 4Z2KA 1GPFA 3C86A 2ZUWA 4JYFA 3TX9A 5HNRA 3TU9A 4I5XA 4NVTA 1YW1A 1QOXA 1QPQA 3IJ7A 4PCTA 3S5OA 3SFKA 5DXYA 2QJJA 4JTCA 4WIWA 3QQ1A 2NSOA 4O19A 2Z1BA 4TR9A 2OODA 1AZ1A 3QY8A 4LV9A 4JTQA 3RLGA 3CK5A 3ALFA 4DJFD 2B7NA 4HU8A 1PE1A 2CNCA 3VVGA 3VGEA 2YVJA 4ADWA 4CNUA 4C1NA 4Z2IA 5LIXX 1AQFA 4DIAA 4P5UA 3GG8A 3IJ6A 2WM1A 3ES7A 3PZNA 3TC3A 3WNPA 2EQDA 1AJ2A 5GPRA 2ZRWA 4CVUA 4BI6A 3BW2A 4BQ3A 4H9YA 2QCCA 5HMSA 4OT7A 3QXBA 1GVOA 3ZVHA 4YIWA 4XZBA 4J3SA 4UTKA 3T8QA 1QHPA 4LH8A 3SQPA 4FNQA 3KBMA 3TXZA 5KZMA 3FA4A 2VWTA 4W87A 1KGXA 2HDJA 3OLGA 5U25A 3BSGA 2WHJA 3IIVA 5DMNA 1Q7MA 5CJMA 4PYSA 4HHHA 2G95A 2I7GA 1XBYA 2X41A 1IE7C 4C60A 5CBIA 3A4WA 1XDIA 3AS3A 4HPGA 4ES4A 5LIUX 2A2IA 2YYTA 3WK2A 1HZYA 1QK2A 3VK5A 4R3UA 2VD9A 4GCXA 5AHMA 1GUVA 4MZYA 4F0HA 2CWNA 3CHDA 3STCA 2ZX7A 3B0XA 1YXCA 4FNPA 3O16A 4MY1A 3ZLHA 1G7VA 2ZXAA 1SU5A 1D8WA 1OFQA 3PUEA 1WZLA 2X8GA 1DHKA 1FHVA 1KO0A 3QZ6A 2GWGA 1VFUA 4BY3A 2QPSA 3CQ0A 1Z41A 3QY7A 4C1NB 3W7NA 3PFMA 1E55A 3B06A 3PJWA 2OYKA 3EXRA 3DDMA 1I8JA 1PCWA 1VKFA 2Z6JA 2F6UA 3ZFHA 1VIWA 1JZ3A 2CWXA 1B3XA 2VR5A 2ODOA 1C90A 1FUYA 4DLFA 3H4XA 2WW5A 2Z2UA 2PI6A 3FA3A 5K9DA 3CB8A 5FS7A 3CGDA 2WNQA 5TNVA 1FWRA 4W5ZA 1GRGA 4JL2A 4OECA 5FEZA 3BLFA 4A8NA 1FP8A 2IPGA 1ONFA 1S2VA 5PTDA 5C2CA 2Y24A 1E73M 5CZKA 2P1FA 3N2CA 4YMZA 2UWFA 1B3ZA 1VBJA 3NPUA 2WPBA 3LI1A 1FWGC 1L6FA 4BWLC 1ZHAA 3VIOA 1K4HA 5LNUA 2O4MA 4B2DA 2X1UA 1H7XA 2CLKA 2VVNA 3GKFA 4QJ1A 2WJEA 1TZ7A 1JEHA 3BGAA 3O63A 3C8FA 3OBAA 2XIJA 3HQ1A 3PANA 3PHAA 1Z9AA 4UTTC 5KMYA 1C8XA 3VMOA 3IJQA 2E25A 4PBGA 3W22A 2PCQA 3EZ4A 2ZDRA 3MVIA 3H2EA 2OSXA 2C6QA 1JYXA 3GHTA 1ZCOA 3QVQA 4I6VA 2BVTA 3B97A 1EOKA 1W9UA 3BTNA 5D2YA 4C91A 3EANA 3IEBA 4QDPA 2DQXA 1M65A 3UZZA 1O66A 3KXQA 3IPWA 3MMUA 3K46A 2G41A 1BF6A 3WN6A 4QE1A 4MWAE 4PUEA 1E9YB 4MKNA 4MNLA 4F2BA 2PLJA 5AVNA 1QBBA 4AIOA 3QZAA 1LQ0A 3TSDA 3N2OA 2OMAA 4GCAA 2ZRZA 4XBJA 3ITLA 3W7GA 5DBTA 1QXLA 2QXWA 1RHCA 1A5BA 1GQIA 3NPWA 4O1DA 3GXIA 1BHGA 3VGHA 1OG6A 2WP5A 1H62A 5LNRA 1H1ZA 2PF0A 3GNPA 4HVXA 1JYNA 4OV4A 3RCYA 1E43A 2PTXA 4LAMA 2QDDA 5IFTA 5D2WA 3D3FA 1KM6A 3MCNA 3R0DA 4H4IA 1ITUA 4W7WA 2W3RA 3GHSA 5CSUA 2C3ZA 1J96A 1WKYA 3OVRA 2P8CA 1AL8A 4I5UA 4UUIA 4GVGA 3SQMA 4XAGA 3R0KA 4U5KA 4UXDA 4LSBA 3R10A 3PTDA 5HINA 2FZNA 3S6DA 2FHFA 3U6WA 4WVXA 1MOKA 3EMZA 3AZTA 3BXWA 1FWWA 1I2RA 1Q6CA 3TCSA 3EOUA 3LM3A 4KT2A 3MCOA 4DUXA 1KRAC 4JTRA 3LB8A 1ZBKA 3DBNA 2WSPA 4KEZA 1MUCA 3RCNA 3FNDA 1US0A 4ZTXA 3UWYA 4JDRA 1NHPA 5B7YA 1A50A 4JQ2A 1HKKA 1OZMA 4L1XA 1EFZA 4U3AA 4JQAA 1KXHA 4FXFA 3LGGA 4F0RA 4H1ZA 3H6OA 1LG2A 4RZ4A 1C8YA 2NV1A 2FMNA 2Y89A 4JTKA 1HJUA 4S3DA 3ME3A 3V75A 1ZJIA 3W76A 3ELFA 2WMKA 1CPUA 2C1GA 1MZHA 1EUNA 1XF0A 1R6WA 5DMLA 4ZFCA 1EJUC 2INZA 1DEDA 1JDFA 3SUWA 1STZA 4HNUA 3UG8A 2QCMA 4QFUA 2XDFA 3NM3A 4MYAA 4LAZA 3BZJA 1TREA 1FHUA 3IAPA 4K1WA 1PWLA 3F5JA 3SRDA 1VZWA 1F76A 5BRPA 2NPXA 3GTNA 1FQ0A 4QRNA 2BVYA 1JI2A 2J7BA 5KVIA 1PTAA 1ZL1A 1Q2SA 2O9OA 2PTDA 3FFSA 3AMLA 3B0YA 2QAFA 3RLHA 4J3ZA 2V5CA 1GOMA 2QIIA 4WLCA 1Z42A 1FWSA 5A6AA 1NQKA 3KP0A 1K7EA 1Q6RA 2DDXA 3SY5A 4PUDA 4QIUA 4B3LA 3W83A 1QNVA 2F84A 3WLQA 2PTYA 2FZ9A 3LGDA 3L4WA 1JR1A 4LVFA 3UZYA 4AZ6A 4UFMA 3ANVA 2VCBA 1F4HA 1WKFA 4LBSA 3ICJA 2Z27A 4JYDA 2X30A 1T96A 4WZHA 3E0WA 3KBSA 1UKSA 3OHIA 3ZT7A 3P62A 3CAKA 3VTRA 5BYWA 4WGXA 4OJYA 5A6BD 4HPJA 2J4GA 5FSDC 4ROQA 4I3GA 4BQ5A 4K38A 1HUVA 3WEZA 4CLMA 1RBOB 1NFBA 4XZ9A 3WF3A 1TV3A 2J47A 1POKA 4NYUA 2RJHA 1OJXA 1MVYA 3IANA 5H8MA 3NL2A 1XIIA 1H50A 4RZ5A 2YLLA 5CLTA 3IGSA 3CWNA 3VIMA 1T8XA 3WQ6A 3ZLFA 4LPCA 2J8FA 3FGCB 4NX0A 2V5DA 2C0HA 1E6NA 1KCKA 1SJCA 1VLIA 4ZB5A 3HQOA 2GQ3A 1HIZA 1UWTA 3VIPA 4CQAA 2X09A 2CLPA 1DJYA 6REQA 1OK4A 2P0IA 2VEGA 3UR2A 2R94A 1UR1A 2DSZA 3W88A 2A3CA 4MIMA 4NAEA 4B9YA 1QI2A 3W84A 1DXIA 3JS3A 2F38A 3S1GA 1KBKA 2ASHA 3VNLA 2NW0A 2Y2WA 4N9DA 1NARA 3LI0A 3A7AA 1KM4A 4PN2A 4HU0A 3W87A 2DW6A 4A6GA 4DF0A 1CI1A 2NWSA 2XVPA 3QHMA 3VD9A 1VFMA 1XH1A 1TX0A 2W3ZA 3L4VA 2GJXA 1MXSA 4KEMA 2HVMA 4BI7A 3EX4A 4J28A 4GABA 1F8WA 1TWWA 4RW3A 4ZB0A 4YYCA 4ORIA 3LM7A 1KGUA 3NQDA 4KMQA 2PS2A 4MKVA 1J93A 2YJQA 1Q7QA 5G1YA 4IISA 5B7ZA 4A3UA 1XH2A 3L5AA 2ZZ2A 3MB9A 4WSHA 4V28A 2CITA 2X7WA 4GPNA 3OC4A 3GVRA 3GU1A 3WLSA 3UXKA 3KS6A 4Z42C 3KCOA 5E6YA 4H4YA 4H4XA 2J88A 4LIIA 1UG6A 1V3JA 2R14A 3RM9A 3UEQA 1CNVA 1SGJA 1FFQA 4NJKA 3MUZ1 4IL2A 2YKKA 3DFOA 4CD5A 3P14A 1DVJA 3W1RA 3E02A 3PPGA 3S5YA 3R58A 1J5SA 5DEZA 3S46A 4YTQA 1FP9A 1TIWA 5AC5A 2W63A 1FWCC 3OOQA 3TN5A 4XQ6A 4AZ5A 4ZQNA 4EXBA 4GX9A 3ECQA 4A8IA 4TMCA 2ISFA 3FYPA 4O28A 3PC0A 4WDXA 4PTWA 3T09A 4CQ8A 1P1XA 4XKYB 1PZ3A 3WFZA 3UWVA 1MFVA 3WK1A 4U4MA 3HJZA 3BG3A 3D6NA 1X38A 4GQBA 1GVYA 2DVUA 1HJWA 3SN4A 1XGDA 1FECA 4JR5A 2AMGA 3G77A 3DH7A 4WDTA 1BVWA 3FEQA 3EXSA 2D22A 2ISVA 1IT0A 4AY1A 1W37A 2BHUA 1CDGA 1CWYA 1NVMA 5KSWA 1M7JA 1Q6EA 3N9RA 5JQ9A 4JTGA 4FK9A 3TTSA 1DWGM 2AKZA 2CKSA 5HANA 3U2EA 1GG1A 4M1BA 4LS2A 3EMQA 1TJ2A 3B0UX 1Y0EA 4H8VA 4B4FA 3T08A 1OBAA 4DM1A 3WUFA 1GJWA 2Y62A 2C0AA 2ZUTA 2B7QA 3W53A 3NRZB 2GYIA 4O4WA 4CKQA 4YTSA 5FS9A 3RGTA 4Q8PA 7CGTA 3FA5A 4XD3A 3U5UA 3GWQA 5BCAA 4ADUA 5FL1A 1DNCA 3IVTA 4WEVX 2XIQA 1N61C 4Z1BA 2NQ9A 5I09A 3S4TA 2FH8A 2P5NA 2HROA 4HA1A 2OELA 4PB5A 3M0KA 5A6LA 3V1HA 2WJFA 5F4SA 3ZYZA 3L65A 3EOOA 1HKWA 3TA6A 3ARYA 3GFZA 2YVGA 3AALA 4LC6A 1B31A 4GY7A 2Z6IA 3DGZA 1TE1A 3D3AA 3WJZA 2NQJA 3UA4A 4H4TA 2BLEA 2YCEA 3QGKC 1OM0A 1CT5A 3CU2A 1IWBA 4QTGA 4ZL1A 3WJXA 3NYDA 1ECQA 1POJA 2FFIA 4IX0A 3GDKA 1YPIA 1W9VA 4E3TA 3APTA 1V3HA 3HMCA 3AZSA 1GT8A 4GG9A 5DXXA 1OCNA 3EDFA 1CGXA 3TW6A 4NJHA 3GZAA 4K1GA 3EDEA 3CHFA 1YMYA 3UR8A 4XSLA 4XB3A 5XINA 4OE7A 3WQEA 2VL4A 2GK1A 2RDUA 1QK0A 2Q6ZA 4A05A 1DJXA 1E5NA 6XIMA 4NI8A 1U22A 5J8LA 4N02A 3FW6A 1MI3A 2GR0A 1TUXA 4LVAA 4MOZA 1CX9A 4NUWA 5K4ZA 3AS0A 3RNDA 3AHXA 3NOYA 4AHQA 5ABGA 1KTCA 4QITA 1TMLA 2J3NA 4JN6A 3CB3A 1R0MA 4K36A 3UY7A 5FL0A 4ZODA 2Y8KA 2VYOA 1UZHA 2PRMA 5XIMA 3H12A 4MB5A 1OD8A 3CHVA 2O7QA 1Q2RA 1S2CA 4PUWA 4BF5A 4M3PA 3KDNA 5SWUA 4GI4A 2X7VA 3MYPA 1T41A 1OYCA 3KEHA 4JX4A 1K6WA 4QDWA 3WMCA 1LL6A 3URAA 2E40A 7ENLA 1LOLA 1JJKA 3VKBA 3MVTA 2PP0A 3KW3A 1A3HA 3AHVA 1ZBWA 1Q1WA 3NQFA 1YNYA 3MBFA 4FNRA 3GDLA 2G96A 3N12A 3WO8A 3WLLA 3M43A 3H2MA 5A94A 2W92A 2ZZCA 2HPIA 5LHEA 3QHOA 1XLAA 2QUTA 4C6BA 1DQWA 2W0HA 3UP8A 4QS5A 3ATZA 1CTNA 4D6HA 2Q8ZA 4CD8A 3EWBX 1GW9A 1EZWA 1HVXA 1VBGA 2GDUA 1JZ8A 1BWCA 4GYPA 3ALGA 3ZSTA 1REQB 1BQCA 4C6DA 4DJDD 4NAFB 2WC4A 4JCMA 3KFTA 1KBBA 1SPQA 3NSXA 5CGMA 4DX3A 1O1HA 4MLJA 4HD5A 1US2A 4P2VA 2PF8A 3VGBA 3WMSA 3PJUA 1OC6A 1N63C 1QNRA 2BB0A 4E2BA 1W1A1 3TTEA 3GDRA 5CPNA 3M0IA 3NVTA 2UY3A 2REQA 4US6A 1K9DA 4A21A 4Q8NA 2CZFA 4PMUA 3OG2A 5H8PA 4JX5A 1N82A 4M0XA 1GK8A 1W54A 3TYUA 3GNDA 5REQA 4B5XA 1FH7A 3DHUA 3KBWA 2FTPA 3S47A 4KGLA 3PPFA 5DQPA 1R9XA 3NR0A 4HYWA 3XISA 4ATWA 4D6IA 1PKLA 1SZRA 2YL8A 4L6DA 1BYCA 1XRSA 2C71A 4JNZA 2QCDB 2DZVA 3D46A 1KQZA 4A3QA 3DG7A 2NSXA 4FR6A 5AC4A 3EOLA 4PMDA 1XIBA 1AMYA 1WCGA 3W74A 1VGAA 3C3UA 2TPSA 1W8SA 3GFYA 3A9IA 3V4BA 5D2VA 4B5UA 5HNTA 3ITOA 3VDAA 3W7PA 3O0HA 1PKMA 1UZ1A 2YCJA 3VMNA 1RD5A 3W7JA 4NAEB 3WH6A 4H4WA 3GUGA 4DB7A 3WLMA 1XLBA 1TIMA 3BUVA 5D4YA 4Y7EA 4UTFA 1XLLA 1BKSA 1VEPA 2VX5A 4GIYA 5A8MA 1THFD 2VOMA 4ZA0A 3W72A 5I5RA 4XAFA 4AC7C 5G4WA 3DJJA 1E4MM 4H19A 4WHBA 4FLOA 1VJZA 4LYPA 2BCPA 3TXVA 4K7VA 3KHDA 2BXVA 3LMZA 2IXVA 4PRWA 3GAYA 2WC7A 5IFPA 3AAMA 4JTDA 3VE9A 1CGTA 4JEJA 2V2DA 2VQTA 4CQDA 1WAWA 5D32A 1NWUA 4UWMA 4UQBA 4U33A 4M56A 3VU2A 3W85A 1JYWA 1KLYA 3W24A 5A8NA 2CZEA 4L9ZA 1YQ2A 4ICMA 3BVJA 2GDQA 2EG6A 4AMAA 1ZRQA 3GC4A 1IHIA 2ZZ5A 1LG1A 2R91A 2VJXA 2QW5A 3GXFA 5MHBA 4H4UA 1TCDA 1WZAA 4AWUA 4XVEA 1GSNA 1TQXA 1YQZA 4LFYA 3TR2A 1Q4WA 4KIEA 1JCMP 2J78A 4TVYA 4LB3A 4RNJA 5G5HB 3WH8A 1IEIA 1EJXC 2CETA 1EL3A 4OOZA 2PUZA 1C92A 5IDZA 3HPXA 2P0OA 4PTDA 3HOJA 5CC5A 2W4XA 2E77A 3RDKA 1Q85A 1XICA 4LRTA 1NSJA 4AD0A 1FCBA 3EDDA 4ONVA 3E5BA 2GOKA 4H4VA 1I2OA 2A21A 5EA9A 1V6YA 5E9XA 2VC7A 2FJKA 3S9YA 4H9UA 1SFTA 1UR0A 1AJZA 1OQFA 1XHCA 2AL2B 3T2PA 2O56A 1DTNA 3AHTA 1UKPA 3WLJA 4Q8VA 1XBVA 4GYKA 2GR1A 3DI0A 3BZGA 3W1QA 4REQA 1UOZA 1AUSL 2XN1A 1A5MC 2WHLA 1OFRA 3CS2A 1I2NA 3WDIA 4HN4A 1H7NA 4LUTA 2GRTA 2G3MA 3R8HA 3ZVHB 1K03A 3VC5A 4X0VA 1UCWA 4AY8A 4E5TA 2PDFA 5BMXA 1B9ZA 3SDOA 2DUZA 4KESA 1RK5A 3W3OA 3LCIA 3EGJA 3N3TA 4K8EA 2CZ5A 4MJ4A 3VM5A 1QATA 2PGWA 4PL2A 3IV8A 4U5IA 2GGEA 3CTTA 1LWJA 3DG6A 1T0OA 2ATMA 2O0TA 4UTWA 3R07C 1C9DA 3SR7A 5I79A 2KZHA 3OLDA 1W5MA 3NEHA 2P8BA 1HO1A 3B9AA 2NUWA 2G4JA 3TAKA 2J9ZA 4A8LA 4DJFA 2UV8G 1MW3A 4W7VA 3VUSA 2Z1VA 3EX1A 1OYAA 3LXBA 1F3PA 4AX6A 3USZA 3THUA 5A8PA 3I4EA 1QNOA 3UQNA 3GD6A 3CHEA 4HMDA 1G6CA 1WKDA 2CBJA 2CFYA 4NT0A 4GQ0A 3THCA 5I3GA 4PMVA 4KPLA 3QR1A 3W2JA 3HM7A 4MFDA 3LHVA 1M53A 3KLLA 4AWTA 4L80A 1VYRA 1Y8BA 3KL5A 2NX1A 2NQLA 3C3NA 3VCNA 1CLXA 3TN3A 1EPVA 1LPFA 1MMFA 4YTRA 4BKNA 4MB4A 1A49A 1P0BA 3MV01 4DZAA 3EX2A 4XBSA 3UNDA 2IKIA 1BG4A 3L4ZA 4R88A 1O5QA 2IQ0A 3H2AA 5JRBA 4Q4OA 2G3IA 1KC7A 3CWHA 1HJSA 3E1F1 5GVJA 1P6CA 4H6RA 2RDXA 2WNWA 1TWDA 1C9WA 4I9MA 1N60C 4JQ9A 2YCLA 3UZXA 3PR2A 1QPOA 3GXPA 3N2XA 3MTWA 5A69A 1GRAA 2FH6A 1BQGA 4RNIA 5JBFA 1MSSA 2GFTA 4GYFA 5XIAA 3C5QA 3PZVA 2ZTKA 3GNRA 3K4DA 1E6PA 4FIRA 4Z2HA 3VIJA 3U4AA 3WQOA 2GOUA 1B0IA 1KXVA 1E1FA 5LGXA 4XO7A 1RM6B 2FHCA 3NURA 1WBHA 1XSIA 1H60A 5BMWA 4XUYA 2FDMA 1V6WA 1IIGA 2PLMA 1EBHA 2J77A 5GJMA 3ZO9A 5LIKX 5HR7A 4HA4A 2WOWA 3H26A 2XH7A 4YHGA 1UMYA 2VZOA 1NELA 1HFBA 2ZX9A 3M44A 2WKGA 1IIHA 3W1MA 5GNZA 5LKYA 5MKGB 5FAJA 4IWWA 2EG7A 3T05A 3I7SA 2CHRA 1BWLA 1YKWA 1HNYA 4IOTA 4JPGA 2HK1A 3KVLA 4DY1A 1UKOA 2PDWA 3TDFA 2OEMA 1ONWA 3HF3A 3HBLA 3MQTA 1DOSA 3A23A 4HZ8A 1R3YA 2FB3A 3WFLA 4C6JA 3FJ6A 3SSJA 2WMIA 1DWIM 3KRZA 3W7QA 4HN8A 1TMHA 1XC4A 3AS1A 3EXTA 5EBAA 2OZTA 3HA1A 3CEPA 2Q3OA 3PB2A 5FSEC 3DAQA 3AWNA 3WH9A 4FF5A 2OX1A 3O6AA 4NY2A 4J27A 1I60A 4G1NA 5M1TA 3N3MA 1PIFA 5C9XA 1VCGA 4N6EA 4MNMA 4JIQA 2WHKA 1S2AA 4HHLA 4MWAB 4B5VA 5CEWA 2E6DA 3T0DA 1ZJBA 2V3EA 4W7UA 1YIXA 4XZMX 4Y8FA 2PDQA 1P48A 1KRBC 1NHSA 3OZOA 4TMBA 1W91A 4E4PA 2EG8A 3E0LA 2ESCA 2E09A 3TTOA 1XYMA 1IXOA 3O15A 1KB3A 1GVIA 2QGHA 1DBTA 3LZ5A 3WLHA 2YL9A 2B31A 4PB4A 1T99A 4FP1A 2WQPA 1VF8A 1E9IA 3BARA 2WNZA 3ATYA 1S3TC 1TSIA 2DZAA 1GGOA 4X60A 3SB0A 5FA5A 1SSDA 2WZIA 5BXRA 4I6KA 3QR3A 1N8FA 1WZMA 5MF5A 1BSIA 1W6TA 1LJYA 3SUUA 3UYCA 1S1RA 5A8QA 3FY1A 4EX4A 2PDKA 4ML9A 4AZ7A 4C1LA 2CHNA 1BXNA 2H8ZA 5G1TA 3R94A 1GVSA 1CW2A 3W7CA 4H2CA 4ZO9A 3ZJ7A 4HJWA 4R33A 4RK8A 3Q67A 3AROA 3GX9A 1NIUA 4LCSA 3UPWA 2IMRA 3R11A 4E4UA 3VD4A 3LCXA 1QHZA 4C6QA 2V6OA 2E6FA 4QISA 1JVNA 1VJIA 4AU0A 1EC7A 4JHZA 5A6KA 3UXAA 4OBSA 2GJLA 3GBDA 1DIOA 4K37A 4AVNA 3GIPA 5I06A 1UH2A 3W37A 5LNWA 3KOXA 4A3HA 4WSJA 1LDCA 1TTJA 1JQVA 3VCRA 1IWPA 3TMLA 4JIHA 4APNA 3GE7A 1BSLA 1R3VA 3GNOA 1PIIA 1W9XA 3WD2A 5M2FX 3MP3A 3Q4DA 1LL4A 1L8NA 2WOQA 5L9FA 1IWAA 1D2KA 3ID7A 4XD5A 3LUTA 1OCJA 1P4CA 1VRDA 2FGLA 2JKEA 2RGMA 4UQCA 1JF5A 1K8XA 4GGHA 2MANA 2X2YA 1NEYA 5HMDA 3F4DA 3GTIA 4ZGYA 2E1WA 4IJBA 3TFXA 3DKJA 1V02E 4X61A 1KBIA 4NNBA 1BVNP 2PLKA 3W71A 1IT8A 3VO0A 1E6RA 1H0GA 5D9PA 1BG9A 3QPEA 1T3QC 2POTA 1YBQA 3S2CA 4XSMA 2H6RA 2E8YA 1UD3A 4E2DA 3GYCA 1NQ6A 2VGFA 3L8KA 4WR3A 3SY1A 2VR2A 1P7TB 2WB5A 3E0FA 4AB4A 4PTXA 1FX6A 1JAEA 4AXNA 4PE8A 4TO8A 1YDVA 2F61A 1Z44A 5HMFA 4H9MA 2XFFA 1A47A 1V6TA 1QI4A 3BLLA 3BOLA 3TN6A 1Z48A 4GXMA 5F2MA 2X1SA 4Q33A 4GUFA 5CPSA 4WKHA 2XSXA 4IQLA 5E9AA 3I10A 4P7OA 1JPKA 4UTIA 3GXMA 3P67A 3RNMA 1JQXA 1DL3A 3MUAA 3UYIA 2FDSA 4CUCA 1TRDA 4AD3A 5LZLA 4Y90A 1FWAC 3BL3A 1JOAA 3I65A 3NQGA 4WK9A 2UY5A 3UGVA 2ZRYA 3LPPA 1TE6A 2XZ9A 3SCNA 8TIMA 2HE8A 3R0UA 3EB2A 3PZIA 3O0FA 2Y85A 2XGIA 2P3ZA 5DRIA 4NU7A 4KKXA 1VAHA 3B9OA 5T9BG 4M80A 4Q4KA 4DO6A 3T7VA 4LQ1A 4EK7A 1GYLA 3VOCA 2XM2A 3NL3A 1XC6A 2BFGA 2UY2A 2E5DA 3JR2A 3DCPA 3LERA 2JKPA 3AQUA 3CZLA 4AYSA 2Z1KA 1XSKA 4XAYA 3KAOA 4V1YA 1VH7A 4HNTA 1OJTA 3HGJA 1P6BA 2YDSA 4JY9A 1M5WA 3CUIA 1IGWA 3L66A 4DO7A 5C6MA 3PK7A 4ZOAA 4PMZA 4M52A 2Q71A 4PZVA 3T4WA 1TKKA 4LNYA 2ZBTA 2DT3A 4LC8A 3R2GA 2ZKMX 1V7YA 1YLVA 4DUWA 4L56A 2V5JA 1SZEA 3LK6A 3LSBA 4KWWA 1I0DA 3IK2A 3QFBA 3TQVA 1UB3A 1KQYA 2X16A 2NT1A 1G4SA 2PEVA 1F4AA 1K9TA 1VC4A 4Q4QA 4ICCX 1RR2A 4JTIA 4QR6A 1E6SM 3ARRA 4HOZA 5FJTA 3A3WA 2GGIA 1FDZA 2WZMA 4EQSA 4JX6A 3CLWA 4KGJA 1AK5A 1IXPA 4S3CA 3GG1A 4EVZA 3NG3A 3RO6A 1H0IA 3FDGA 1X8FA 3EX3A 3VOFA 1QVBA 3RHGA 2ON3A 2P50A 3DERA 1QU4A 2DP3A 5HUOA 4H9TA 3AXKA 1VENA 4A2RA 2CXEA 2NUYA 3VX0A 3F4VA 1GV4A 1PTGA 2AAQA 4PUMA 3XIMA 1E72M 3EWZA 3EBVA 2EJAA 3MA8A 1TPFA 3A5FA 1YHTA 4WY0A 4MPQA 4NASA 1DJIA 2HBXA 2HQAA 3K2GA 3W23A 4HCHA 3GU2A 2RAGA 1VCVA 4LCRA 1A5UA 4H8UA 3UZ5A 4D6CA 4M5PA 2V2CA 1LWIA 4E0CA 2BSLA 3WQ5A 3GM8A 1TJRA 3M46A 4NNCA 3LRMA 3CPUA 1KM5A 2E0PA 1I4NA 1O95A 3WD4A 2D69A 4U10A 3B4YA 1EEPA 4TTGA 3REQB 1H4PA 3T0AA 1WX0A 4NF7A 4J35A 4BA0A 2XISA 1FWDC 2VDHA 1UKTA 5E1QA 1JGMA 1P7TA 3R12A 2PDBA 2VFDA 4HK6A 1CXEA 3C2RA 3RU6A 4F8XA 3QM3A 3TK7A 3WDRA 2BP1A 4N2YA 4RCXA 3ONBA 1DJGA 4OUIA 5F4WA 3BV7A 2GL5A 4UOJA 3LGEA 1ZY9A 3GB6A 3R6IA 7A3HA 1QASA 5JVLA 4FMVA 4BURA 2AQOA 4XAPA 1W5QA 1UP3A 3H2NA 4UB9A 2OEJA 1U5VA 4FALA 3CC1A 5GJNA 2V8ZA 2VX7A 1F9CA 1DE5A 3N4FA 4XV0A 1S7MA 3M4HA 1EP1A 3NFUA 1E9ZB 3FCPA 1GZGA 2QGYA 4EE9A 1UUOA 3V0UA 1XW8A 2P88A 1DJZA 4KS0A 4TOQA 2GQAA 3UG5A 3DH9A 2AQVA 4DO4A 2PD9A 1SQ7A 4ZO8A 1KFEA 1PYMA 2YZ5A 4MJZA 4N9BA 2QKFA 4EPEC 3AOFA 1LROA 1W5PA 2XIMA 2VGIA 2VWSA 4G8TA 5A2CA 2BC0A 3T1GA 3MI2A 2R1PA 3LCHA 1ITQA 3BLPX 4QS6A 5FOOA 3AO0A 2NV9A 5GNXA 5D38A 2C3CA 3CBWA 4GZJA 1DE6A 2OPJA 2FQIA 3H24A 5F2LA 2I5GA 3T40A 1C8VA 1ZTVA 3VFCA 4S3BA 2EEXA 4FX6M 1F7BA 3QOKA 1NM9A 2VX4A 3WEMA 5F1VA 4JD4A 3VD3A 3LEPA 5LSMA 1WYIA 4CNNA 1WXYA 4JICA 2JEQA 1A5NC 3UWEA 1NDZA 3QQ0A 1ZS2A 4GI9A 5KITA 1A80A 3LENA 5M17A 4WJ8A 1JD9A 1DQXA 3APGA 1OZQA 4NSBA 1KFCA 5FD0A 2WVVB 4G1KA 4ZOCA 4EF9A 1OT1A 1Z69A 1X1OA 1ONXA 1EA0A 3UWQA 1A4LA 2VRJA 4H41A 1XIGA 3G18A 4YHEA 4K2SA 1F74A 1UH3A 4JXCA 5JU6A 4DI9A 4HU4A 2X0YA 3I4KA 3CIVA 4AZCB 2I1OA 3BAIA 3AI0A 1AD4A 2EKGA 3QLLA 4NZ3A 2OLHA 2Q8LA 3VIFA 4UTUA 2PDMA 4G7EB 2XM1A 1AVAA 3EKGA 1MUWA 3L4XA 4GVIA 3HGRA 3LOTA 4GHRA 4PMYA 3EKLA 1Q6DA 3GH4A 4NJIA 4IP4A 5AOUA 1YDOA 3VCCA 3RYSA 5DBUA 1QTWA 5CAHA 5FF2A 4OU1A 3V36A 1UW9A 1VFFA 4Q32A 1GOKA 2ZZ4A 2Z24A 4FDCB 1HJQA 1UWUA 2DVXA 2WBKA 3KL3A 1BXBA 2W27A 3TCEA 3RRXA 2W79A 2QULA 3WQPA 4GI8A 4IICA 1GKQA 1R86A 1VJSA 3K4WA 2W61A 3I6TA 2G97A 4Z08A 1VQZA 3BLEA 4GIAA 2WCSA 2WBGA 3FV9A 2V0TA 3EDKA 3M64A 2PDXA 5DANA 3TUUA 1I6NA 2V3BA 4WKFA 1I75A 2D2JA 1E0VA 4IG2B 2VFIA 5U7SA 2OB3A 4LGXA 3UF9A 1SW0A 1IQ8A 1GZ1A 1LLOA 3W2UA 1W9DM 1EF2A 2POZA 4FXRA 3WNKA 2EF9A 4Y2WA 3RPTA 3TYCA 5HPOA 1CEOA 1LLWA 1KR1A 1ICPA 1ZAJA 3CUXA 3FVMA 3LRKA 4HQVA 5ABEA 3K1DA 3ABOA 1GQLA 3S0CA 4LANA 3G5EA 1JXJA 3UESA 5M3WA 3VA8A 3U2CA 1NH6A 3TKFA 2UZ9A 5FMHA 3NTYA 2BY2A 2QCHA 3PWIA 3VNDA 1RBLA 3EEGA 2V3AA 1LP6A 1P0EA 2JFEX 3R7MA 4CU6A 1TG7A 5I3HA 2VHLA 1MO0A 5AZ0A 4B5SA 1EKOA 1V79A 1KM0A 1YTEA 1UR9A 3GVVA 4H4PA 4WKAA 2GK1B 4IIHA 2OQHA 1HW6A 4CD4A 3WLNA 2CLOA 3MKVA 4N4PA 5IXEA 2NVAA 4LB4A 3PPHA 1GEHA 2D20A 3U9IA 4IFKA 1GTHA 1RA5A 1J10A 1GRFA 4IPLA 3C0LA 2PTZA 3HQPA 4XG1A 5AVHA 2RABA 5C54A 3BCFA 1FWBC 4RDWA 1JF6A 2ZICA 1DJQA 2HS8A 1FIQB 4AFYA 5CSSA 1YTKA 4MNJA 4F2UA 1P1MA 2WV8A 4MFEA 2E5CA 1A3WA 4O13A 5CC6A 3CQIA 4XIMA 4QHRA 1DYSA 4BFAA 3GC2A 8XIAA 6PTDA 3QSRA 3O9NA 5IBXA 3A4AA 2TAAA 2Y7GA 1GQKA 1RBAA 3TC7A 1JNDA 1QPRA 4FR1A 1UD5A 3SUVA 2VEIA 2WC3A 3G3DA 3HQNA 2GQWA 4KERA 4A3RA 3C4UA 3LCFA 4IMAA 1UIPA 4H00A 5U1OA 3E3HA 4KW2A 1FDYA 3MHUA 3PSWA 4M1RA 5BWAA 2Y7EA 2NVDA 3LV5A 1TTQA 3PZMA 4O10A 1M04A 3THDA 3ARXA 3RITA 5EFDA 1XIDA 3DFQA 1DIEA 4AXKA 4WOQA 2DZPA 1H61A 2WM0A 3NNTA 1U83A 4JGDA 1XI3A 1FOBA 1M01A 3KZSA 4ZOHB 3EAOA 1SR9A 3KRUA 2WZTA 5EB8A 3AHZA 5DCBA 1QBAA 1UUMA 2WCAA 5BNKA 4I9TA 4CU7A 2J6VA 1UJQA 1V4YA 2H9AA 3MS8A 4FLSA 3KLKA 4LYKA 3G22A 3HRDC 4JTAA 1D3HA 2PMQA 1E1CA 3POHA 4F4RA 4DZHA 2ALRA 1JAKA 3E38A 3EB3A 5JCKA 4JIPA 1G7UA 4DWDA 5KETA 4O16A 1RALA 2FTWA 2W9MA 2F6KA 4QCFA 4TV5A 3WDHA 3BSMA 1TR1A 3K13A 3WZ0E 2DH3A 1A53A 3MZNA 3AN1A 2Y7DA 1ZP3A 3K5XA 4FNSA 5DMMA 4AF0B 1SB3B 3GXTA 3ZR5A 1FKWA 4PEKA 5A5WA 2I56A 1GKPA 3QY6A 1KM1A 3W00A 4PCNA 2QVNA 3CH0A 2PP1A 1CGUA 2RH9A 2RHGA 3QMTA 4GD0A 3MI6A 3FDKA 4JTFA 1R3QA 4PMQA 4IQJA 3VE7A 3VUPA 2Y8VA 4HZ6A 1W2PA 1C29A 1FWFC 1NP2A 2ZC1A 2ZC8A 4O15A 2VUNA 2VO5A 1LORA 1GORA 3BK0A 2F5ZA 4Z1DA 4D2JA 2A6NA 3F2DA 4ZB2A 4H7ZA 2OVLA 1NDVA 3QGVA 3W6YA 4JHOA 3F4NA 4P7QA 1K9EA 4LVBA 4JNMA 3NO1A 4MF4A 3E5PA 2A7PA 3WD3A 5IDIA 2E68A 1R46A 4IF2A 3MJMA 4L65A 4NJGA 5JUVA 1Y7VA 4ML4A 1UBSA 2DIJA 3BGGA 1X6LA 3OVPA 3GQYA 3O2LA 1V6XA 4TVCA 2ACRA 4N42A 3N6JA 1UBPC 2HVNA 1GNXA 5C55A 4ZO6A 3MI3A 2E3TA 3SGUA 1ELSA 1L8PA 3MO4A 1S46A 1JRBA 4H4SA 1CXLA 5AYZA 1MNZA 1JFHA 3MZ2A 3HV8A 4GX8A 5CC7A 3TTYA 1JZ5A 5CSRA 1F3EA 2G8ZA 4O0QA 2WANA 4RDVA 2DZBA 4UC5A 1QJWA 3BAYA 3VIGA 4C6KA 3H4KA 3VD7A 3CGBA 4AEEA 3HV9A 2HE5A 4S3JA 1XD1A 3OA5A 4Q8OA 2XSAA 3UFYA 5LA0A 3LPOA 1XQKA 1R85A 1CGWA 2IW0A 1E0WA 1RJRA 3TYEA 3HMJG 3DN5A 2DGAA 3R79A 1N5XA 1G4TA 4O52A 3T9PA 3VC6A 1EJRC 2DSKA 4Q4MA 5ER0A 4F2TA 4MUPA 1MQRA 1RP9A 1JDDA 2BY3A 4D6DA 3EDJA 3GXDA 4HSNA 2E4TA 4HT3A 3CXOA 2ALDA 3CO4A 1GPWA 3V35A 2WYSA 4JN7A 4JBRA 1LL7A 4ZO7A 1MW2A 1HKJA 3QFWA 4M8UA 1J9YA 3ARWA 4B16A 1AH0A 3CAVA 3T78A 4MLRA 1CECA 1PL9A 4R27A 2DJLA 1T5AA 1Q5MA 3I3EA 4AD1A 1DXEA 2GJNA 3DYOA 2BGSA 3QBUA 3SURA 3NQMA 2NT0A 2DSVA 4GBDA 3LD5A 4PULA 1PJ9A 4MY9A 2V3FA 4XZLX 1VPYA 1CCWB 3QV8A 1YPXA 3FYOA 1RQHA 1SVDA 2PGEA 3W7KA 5IRPA 1JDEA 3OTRA 1XYZA 3P0WA 3ARPA 1K7FA 4DPPA 4GQQA 2BVWA 3KE0A 5D2XA 4F48A 2WMIB 1ENUA 1EWEA 1R8LA 3KOYA 2E6YA 1V7AA 5G4EA 2QDHA 4R7WA 2Y61A 3RAOA 2PC8A 3WBAA 3N11A 4GY1A 4GWEA 4K7ZA 4IIBA 1B5TA 1WP6A 3QZEA 3CUZA 3WK0A 1W1TA 2GUUA 5J5RA 2NQZA 3SAZA 2HISA 2QMJA 3NQAA 2PDNA 4HA3A 4N9EA 4H04A 3L68A 4K3ZA 1BAGA 1DTUA 4MNKA 1ZPTA 1HGWA 2QJGA 1RD6A 1MXDA 1TV4A 1GWJA 4NYYA 3OYXA 2VVSA 4BS0A 4UFKA 1V59A 3SBFA 3FLUA 4O8RA 3PWAA 4XD6A 1FXQA 3BMWA 3PBUA 4PB3A 4TTUA 5CG7A 3AJXA 4IIDA 2B81A 3TWBA 3AXXA 4WOZA 1LZOA 1F3WA 2Y88A 4HYRA 3F4CA 3QV7A 3GLCA 4GISA 4C7GA 1OG0A 4B5NA 1AZ2A 3DECA 4PSPA 3TLQA 5IHSA 1FH9A 1JZ4A 1DJWA 1SFJA 3LDVA 3DHDA 2PWGA 3W1LA 5LIWX 2B4GA 2F8QA 1E4NA 4D1JA 3GNNA 4QAWA 5H1WA 2X50A 1ISWA 3N34A 1TRIA 3AJ7A 4BEQA 3P5ZA 1LUCB 3LXCA 1EZ2A 3CUFA 1S38A 1M7PA 3IIZA 3VILA 1Y65A 2Z25A 4ZE4A 2YXOA 1KFLA 2H90A 1TPWA 4NKCA 1JZ2A 1EDQA 1PO9A 1TMQA 3NWRA 1KBJA 2QZRA 3SRHA 2OSYA 3E6EA 4J3WA 2XG9A 3S2JA 4HIBA 3DYPA 3RIKA 4AG0A 1ZJAA 5HWNA 3NQ6A 3ITCA 1EHAA 2O4QA 3DIPA 1PAMA 3NDZA 4CCCA 4M6UA 2ONEA 1TZ9A 4CCEA 1US3A 3A7RA 2QUUA 3MSYA 3DGBA 3GU9A 3ZJ8A 3GH7A 1EQCA 5B80A 5CH9A 4AC1X 3CQHA 1SO5A 3TNBA 1XG4A 4LEFA 2W0UA 3KVMA 5C9UA 4ZFMA 2XU2A 1WOAA 3SRFA 3WDJA 3W6LA 3AFBA 2REQB 2PU1A 3PB0A 5C70A 1Z6KA 3AYSA 1AMKA 1UD6A 3H7RA 1PIGA 4WD0A 2FVLA 2HV5A 3KOFA 3V16A 4AD2A 5I0DA 4Q6XA 1ISZA 1O1ZA 4PGLA 1DWFM 3ABZA 4DXVA 3LMYA 3FHAA 2PDUA 4U31A 1B2YA 3UJFA 2YL5A 1E71M 1VDVA 1PKYA 5BXTA 3N1AA 4C65A 4QEEA 3ZT6A 3SJ3A 5HOSA 1B57A 4DF1A 3LG3A 3HO8A 4HNCA 3FN9A 3LQLA 5BRBA 4QCEA 2XVKA 1J01A 3VKDA 3O0KA 2F7FA 5HQLA 4MGGA 3N2BA 2C18A 3S8HA 2BC1A 2J74A 1JIBA 4XTIA 1Q6LA 4R85A 4DZIA 1WOBA 1UUQA 2GZXA 1RK6A 3VNJA 5CC3A 2JBMA 4TVUA 3NS1B 1IXQA 3B8WA 5G5GB 2BX7A 5LA1A 3EPOA 4FS9A 4C6MA 3BICA 4TX8A 4ATLA 2WK2A 4D6FA 3KBJA 4WJXA 1NFPA 3WQFA 1XH0A 1XDMA 3AU6A 2ZX8A 3CZGA 4LUYA 4P7NA 5CZTA 1EBDA 4HU3A 1V3IA 1RVKA 3LCLA 4Y9MA 7TAAA 4EP8C 4O0KA 2FJUB 5BROA 3VNMA 4CNSA 2C79A 1QT1A 1TA3A 2YYUA 4LJ3A 2YIHA 3MCMA 3WL1A 3WMLA 5FESA 4JNYA 1QCWA 2Y8UA 3S5NA 4AW7A 1E6QM 3AYRA 3I7QA 4B91A 1C8QA 4LUSB 3NVWB 4IMCA 2W62A 1XIEA 4RL3A 1TX2A 3CGEA 2ZQ0A 1M6JA 4UCGA 3C2FA 3P8IA 4U3CA 4K8HA 5BOFA 1RCXB 3FKRA 1FEBA 5TBOA 2QT3A 4NRRA 1FWHC 4UFJA 4WCJA 1F8IA 5FS8A 1GXFA 3VDBA 4XO6A 3DESA 3CZJA 4O14A 4CNPA 5A2AA 1V6UA 1TYPA 2X1IA 3AMCA 2BGNE 4QG6A 3XINA 4C6CA 3MBDA 3NQBA 3P82A 3SCQA 4C7DA 2BY0A 2OWWA 4F9JA 5TIMA 6A3HA 3GR7A 4MKSA 3ZSSA 4KBXA 3CGCA 3OZMA 2EKCA 4LS1A 1R7OA 1B30A 4PR4A 2OOFA 2OZ0A 7REQB 4FEZA 3T42A 2PB1A 3BMVA 4N9CA 3TEVA 1Y5XA 4OZOA 2OXNA 5TF0A 1VFHA 4ZTYA 4Z0JA 3NQVA 3NL6A 2PLCA 3AZRA 2QAPA 2X0HA 3O07A 5EU9A 2BNJA 2C19A 3K8KA 7TIMA 3QMRA 5BRQA 1PDZA 5D8ZA 1DQUA 3FHQA 5D2TA 1FHLA 3AIUA 3CV1A 5FJUA 1GOWA 2QHAA 3MUY1 1WDSA 4AIUA 4S3KA 5HBFA 5D9NA 3VNZA 4I5RA 1BWVA 2QDGA 1MXGA 1KXQA 1PZ2A 2DZUA 4A8RA 2B7OA 2J7HA 2EO7A 4H7VA 4HBKA 2CESA 1S1PA 1RJPA 3D9XA 3ZR4A 3U8GA 3KZPA 1JYVA 2YQUA 2HSAA 3SRKA 2ZUMA 3QTPA 2DT0A 4JTSA 3S42A 2NUXA 3ZVIA 3W1NA 4CCDA 4CEUC 1HKMA 4HNVA 4D72A 3VNIA 3S1UA 2IKJA 1GETA 4UQAA 3TYAA 2PP3A 1RJQA 4ZXLA 4GYJA 3UU0A 3KTSA 1XV8A 1AOGA 4NJJA 3M7WA 4ZR8A 3HURA 3PS7A 4L9XA 2JE8A 3FEMA 2GVEA 1ZQ5A 5FF7A 1BD0A 1ODUA 3WBWA 2ACUA 4DRSA 4XKYA 5I24A 1CXHA 3VGGA 1E51A 1ZBCA 3NZ1A 5G4HC 3WUGA 4KRTA 3QH2A 3M0YA 1MRAA 2GVGA 3RX2A 3U3HA 1V3KA 1YE6A 4HSOA 4I7WA 1GOIA 2ZX5A 4JFWA 3NYZA 1C91A 3TV8A 3L4YA 4CEXC 2J6XA 3E49A 3L9CA 4A3YA 1BYBA 2YW4A 1WDRA 4Q7IA 5C8BB 2JGYA 1EP2A 3BLKA 2VEFA 4S2CA 1FXPA 5BOOA 4H3DA 3HJEA 1SZGA 2YBVA 4L4MA 1TPVA 1J11A 3GSMA 4E8DA 5I2UA 5AHFA 3MT1A 2GSJA 2QQ6A 1JG9A 3ZQ9A 4KWVA 4LRSA 1A0CA 4S1FA 3NGJA 1X7FA 4ZQMA 4HJFA 1HO4A 2P3EA 5FS6A 1E3XA 1XJBA 1WKEA 3EYPA 3PBGA 4TV6A 4I7VA 4AH7A 3A3XA 2QPUA 2CKRA 3UZWA 4B92A 2BHYA 2A3AA 1V97A 2H3BA 1Q8JA 3PAOA 1PKNA 3I3BA 2ZFAA 3CT2A 5AHNA 1XKJA 1VHCA 3LSCA 3M6YA 2ISWA 3TZFA 1Z89A 4JKKA 3LB0A 1X6NA 3ARTA 3MW7A 4WY0F 3H53A 2YXGA 1OIFA 1RH9A 5TAOA 4AZIA 2GUYA 5BU6A 2A79A 2GJPA 4ICNA 4QGCA 5T8GA 1NF7A 4IQEA 4AHOA 1Z7AA 1XLKA 4QDMA 2QLYA 3W0KA 1TV8A 2YDRA 3NQEA 1PV8A 3C6CA 3HPZA 4A35A 3URQA 5EPDA 1GYMA 1GQNA 1GOOA 2WVVA 3TN4A 2VRQA 3O8AA 1B54A 4AZBA 3T0CA 4XVDA 1VP5A 4C6EA 4DBWA 2BXYA 2E5AA 4ATDA 2DIEA 3PY2A 2DT2A 1OF6A 5J5DA 4W88A 9XIAA 1VEOA 2JK6A 1FKXA 1F6YA 2JQXA 4GZIA 3RXZA 2A6LA 4F3HA 2XH2A 1B1YA 3MMTA 4UTMA 1N5WC 3KCJA 3RUBL 3N9SA 2VI0A 4GC3A 2VFGA 2RUSA 2FPYA 2OWXA 1L6SA 2XUCA 1V93A 2XGZA 2I5IA 4DZ5A 1UD2A 3MY9A 4TVDA 4J9JA 4PODA 3UXLA 5E70A 4PEEA 4QG9A 1VBHA 5A2BA 2EBNA 2XIOA 3UW6A 1ITCA 4UNLA 4Z1YA 3FIGA 1P0KA 5AYBA 5HATA 3P7YA 4NZ4A 4U2ZA 1UROA 1AQHA 2IPFA 3A24A 3GHRA 4JEQA 5I07A 2QYGA 4FF7A 2CLLA 1ZJHA 4QJ4B 2B0MA 2CXGA 4L4OA 2NXIA 2NXHA 3L0GA 1OC7A 2HWGA 4M81A 2BOEX 4G5DA 4JTHA 1IXNA 3LNMA 4AUBA 1XIJA 2OZ3A 4IXXA 4ALDA 1L2UA 2CLMA 4YTTA 3UT0A 1UMLA 3E9AA 1LQAA 3FOKA 1LF1A 2GVJA 5K9XA 1H2IA 4Z17A 5C7VA 2B7PA 2V38A 4E4FA 5FIPA 3NJ3A 2EAWA 3UWWA 1OVDA 1R30A 4LXFA 3MSDA 3K8LA 4G9PA 3WLRA 4LAKA 1TVNA 5LNSA 2J7EA 2PDIA 4Q4SA 1C7SA 1V3LA 2W66A 4AYGA 2NX3A 3A7UA 4FIQA 3A21A 4F0KA 5TQLA 1S2UA 3PN8A 1UP0A 3OZPA 1FRBA 3B3DA 1AG1O 1D3GA 4BF7A 3NO3A 4P7RA 4C6PA 2Z29A 2GPTA 2A7RA 5AB3A 4Q8TA 1K6AA 3AMKA 1XYFA 4WJEA 5ENLA 3SO7A 3PJXA 2G3NA 3IJLA 4DJED 5IBXC 4O11A 1OWQA 3CWOX 2GVLA 2UBPC 4QLJA 4H8NA 4WSKA 3WJSA 4UFIA 2Y70A 1KW1A 3L23A 1YADA 3CJPA 5EL1A 5BZAA 2OJPA 5J04A 1IF2A 2X99A 2QUVA 2R1NA 1OFPA 5LA2A 5EYWA 2J9XA 3O7UA 3SN0A 4LAUA 1XUUA 3AIRA 3P3BA 4Y9NA 5FF3A 4XBKA 2VQUA 4HTBA 1H7RA 3PAJA 2WZEA 5BW6A 3M5VA 1TTPA 3UA3A 4W86A 1FWTA 2ZWZA 3CYJA 4F79A 3CL8A 1UQYA 2ZVRA 1MEWA 1LTDA 4M24A 3WJYA 3DX5A 4RW5A 1QI0A 2CIPA 1EO7A 1H6VA 1OHLA 1W3JA 1V0KA 2OSWA 2ZADA 3RO8A 4N0RA 3E0VA 1MEHA 3HG5A 4MG4A 1KNWA 3V0TA 3GG0A 3NQCA 4IP5A 3QV9A 3T0BA 1HQTA 1QWKA 2JIWA 1GONA 1JROA 3ZM8A 2NVKX 3NPXA 4HB7A 3N15A 2V63A 1W3NA 2ZYFA 1J0YA 5L6UA 3URBA 1XLJA 2OT1A 1XCWA 3JU2A 4RZ6A 1D7FA 2PTWA 3GW3A 3IUDA 1N62C 3CM4A 2YXXA 3BW4A 1RLCL 1UR3M 5CGTA 1W3HA 3WELA 1EJWC 1UWAA 3H2OA 4MUZA 4JDYA 4ZSTA 4G7EA 2WNNA 3KRBA 1Q13A 2C7FA 2FVMA 4R7JA 4UTJA 3QN3A 3PBVA 3BE7A 1TTIA 4RXGA 4YVPA 4ADTA 4HHPA 3CUJA 3U57A 2Q01A 2A3LA 3RX3A 1EDGA 3DEQA 3BAKA 1V5XA 1ZNNA 2G3JA 3L12A 3W70A 1WUFA 5H2ZA 1H1YA 3NDYA 3HG4A 2CPUA 4H83A 3PM6A 3II4A 2GLKA 1R87A 3THQA 4DI8A 4DF2A 3W02A 3STGA 3NEVA 1ZCCA 3NIYA 5JCNA 4JY8A 3JRKA 3O6DA 2PBGA 1QDSA 2VRKA 4YJ5A 1H1NA 2FZMA 1MW1A 4M29A 3TA9A 2PDCA 2ZZ1A 3BOXA 3WH7A 3T0TA 2IS7A 1E40A 3RX4A 1OGBA 4IMEA 2DZTA 3WF0A 1GOQA 4KQNA 3GNXA 3W9ZA 5BXPA 1BLIA 4UMAA 1VRXA 1TV2A 2QF7A 3PF3A 2Z1SA 4O1CA 1JCJA 1WQ5A 5G2IA 5GQBA 4W84A 4D71A 3PUOA 4PTNA 1JGIA 4IZGA 1TVLA 1IV8A 4UIOA 3USBA 4H4ZA 4DO5A 3RPDA 4RKAA 4S3EA 1DHPA 3IGUA 1A3XA 3F7JA 3SCTA 1EXBA 1V6VA 2CU0A 3GG7A 1DWJM 3TR9A 1A5SA 3E2RA 1XWYA 3IRSA 3LXDA 3FJ4A 4I9AA 3G1YA 2A3HA 1UZDA 1W1VA 2IPJA 3WQ8A 3ITYA 3KTXA 3WK3A 1OX6A 1K8YA 3TP4A 2ZZ7A 4F0LA 1LVLA 3NOEA 4XWUA 3EOEA 3L2IA 1NAL1 2J7DA 4FNUA 4MPKA 5D09A 3AIVA 1UJPA 3QKZA 4XX6A 3ARVA 4IFRA 4NQ1A 1P0NA 4Y6GA 1V03A 5DLCA 4GKLA 3OYZA 1MQQA 4QG8A 4DJEC 3KX6A 4Y9PA 4YN5A 1KA9F 2R82A 1SFSA 1XLIA 2QJMA 3BJSA 4ZQOA 4JDBA 1YNQA 4RE3A 2VT0A 1TQJA 3GW0A 4Q8WA 1XS2A 1X97A 5CPQA 1VYPX 2OEKA 2YCKX 2YA2A 3RM4A 3T2OA 1OYBA 1HG3A 4FOJA 4LUTB 2D2HA 5LGZA 1CGYA 2D0GA 1P0DA 3MWCA 3RF9A 3N17A 4ACZA 4O0ZA 4AIBA 4PCPA 3PULA 4GH3A 5HULA 1ZSXA 1UR8A 4XUGA 5MKGA 2V3GA 4X9YA 4NP7A 1V08A 4MZ8A 3VFLA 2G37A 4UQ9A 5HQMA 1EIXA 3AHYA 4J5NA 3V0SA 1ZFJA 4IIFA 2CLEA 3AICA 1OEPA 2V5LA 1W9BM 5C2XA 1BFNA 2FPTA 3KBNA 4DHGA 3FYYA 1LLZA 3OLEA 3ITGA 3CAQA 3OEXA 2OYLA 3W7DA 2PDJA 4GYPC 3LU2A 1RY8A 1V51A 1W56A 1PZ0A 1XQLA 1FDJA 2XVGA 1ML1A 3RMEA 2O9TA 1FO4A 3HG3A 4J7RA 2Y5EA 1BYDA 2ZE0A 1NHQA 4NHVA 1QPKA 1QPNA 3HGOA 4J4KA 1A5OC 2D0FA 2Q3RA 3OB8A 5FEPA 3J7HA 1EQPA 1M68A 2PDYA 2OGJA 1QW8A 1XPGA 1AJ0A 1E1CB 3ZWSA 1ISXA 2PSNA 4GO9A 3Q45A 1V0NA 3WQCA 4PMRA 4BI5A 5FEXA 9XIMA 7XIMA 4B4HA 3ZJ6A 3WD1A 4X63A 6TAAA 1NY1A 5I3JA 5FAGA 2VZUA 4Y9AA 1X98A 2YDQA 1PPIA 4RE4A 3CZEA 3SGGA 5JMUA 1AFSA 3SJNA 1KCZA 3ETRB 1O5RA 2DZWA 4HZ7A 3R1ZA 3T8LA 1Q65A 3TC6A 2A0NA 4W89A 4QE5A 2PDLA 2ZXQA 1LT7A 1YPFA 1XINA 3D0CA 5CCZA 1TPEA 4GKTA 5CBJA 3IV3A 3IGXA 1A0EA 1XYLA 4V27A 2FKPA 3HFTA 4IJCA 1X2GA 1JPDX 1ZXIC 3QTGA 3UCCA 1QNPA 3W6MA 5A6MA 1TCMA 4HNLA 4PMJA 2ZTJA 1BRLB 3UBPC 4A4AA 3CGTA 2EPLX 4I7UA 1KV5A 8CGTA 3G1FA 4W5UA 3GR4A 3C2VA 5D9OA 1WBJA 5CBBA 2VM8A 5AKQA 1PX8A 4QSFA 3W7IA 3S9ZA 2ZA2A 3ERPA 4FX7A 2ZA3A 1LBFA 4BQ2A 4CQCA 3HPAA 4C90A 2OGYA 2VX6A 1EJVC 3DFTA 2NLIA 2ATSA 2EJ1A 4JHMA 2W6RA 1TPDA 4FXSA 4MHBA 2ZZ6A 4UMBA 2O7SA 1SFLA 3PNZA 2BWGA 3IUIA 3OBEA 3BO9A 3S1XA 3H7UA 2QJHA 4J57A 2DPEA 4ZMGA 4HP5A 3F5KA 5LNVA 2AL1A 3PNUA 3Q37A 3G2GA 3R8GA 1G67A 4FA3A 1LUCA 4GI6A 4UNKA 3PBWA 4UTWC 4RE2A 1LCOA 3DFPA 1VEMA 5BXSA 1TFVA 1KR0A 1PS9A 3CXBA 3WY1A 2QMKA 3SADA 4R7OA 2PC4A 4DM2A 4JFSA 1WDDA 1GESA 5H91A 3GK0A 4KFOA 3L0NA 3DENA 1O60A 1F5ZA 5AZ1A 4RR4A 2J27A 4QAIA 2VELA 5EKYA 3K4AA 3CPGA 3C2OA 1PBGA 4PTVA 4UR9A 4GRTA 2NWRA 4OFCA 2PURA 1O5KA 2VENA 1IEQA 5EGRA 4EOUA 2QF8A 1V3MA 1EYWA 3VM7A 2GVYA 2OU4A 4H9XA 4E38A 3H2FA 1GW1A 1BXCA 4QROA 1RUSA 5JIPA 3GD4A 1RPXA 5E09A 1P6WA 4ACZB 2YFOA 4AWEA 4OUEA 4QNWA 4HKPA 2R9ZA 3LLDA 4Q4RA 1AH3A 1I45A 2GR3A 3LHWA 3H7VA 3EAUA 3FJNA 1SMAA 4L64A 4WRHA 3ZMRA 2JEPA 4X0NA 1UWQA 3MDUA 3VOGA 3EUB3 2J66A 3A22A 3QC0A 2QCGA 1E0XA 5EBKA 3RM8A 1TV5A 2EXOA 2F9RA 1GHRA 1KM2A 3GS6A 2NV2A 4RDYA 2OO6A 4W8AA 3UJRA 3SFWA 1JPMA 1L6WA 4RPQA 3G8RA 1TZZA 4KH2A 3PZUA 2XVNA 2X05A 2VR4A 3L4TA 3MP4A 4EWJA 1ZUAX 4YLWA 1AW1A 3GAKA 2QJIA 3BAWA 1J2WA 1LBMA 2R6OA 8XIMA 4K6AA 3P80A 3F5LA 4ERIA 4Y9OA 1YXYA 1X2HA 3AXIA 2AGKA 1QOPA 4UMCA 5A95A 1M7OA 4RZBA 2AGTA 3L2LA 3E2SA 1MW0A 2YCIX 2C1HA 3AMZA 2Y1HA 1S5VA 4DN1A 2EPOA 5D33A 2VNCA 3STFA 3F2CA 4J3XA 1DV7A 1PEZA 1MDLA 2Y0FA 2FYMA 4NNAA 5JBDA 4Q4PA 3TYBA 3M7SA 1D7KA 1O7AA 5AECA 1QO5A 1IEXA 4PMOA 3OODA 2TPRA 3TW9A 1G4EA 4D8LA 5AFDA 4IGHA 4GXWA 1VPXA 1UC4A 3HN3A 5HJXA 1UR2A 3DUGA 3GDTA 3CZ8A 4GBUA 3WG6A 5AC8A 1M41A 3KWSA 8A3HA 5I03A 3SCSA 4OIFA 4DUVA 3MUIA 3W2LA 5DT7A 2EHHA 4LU0A 4JQ1A 2GH5A 4Z2GA 4XISA 4P7LA 1CXIA 3OLIA 3W82A 3W2NA 3SQLA 4WXYA 3N13A 5I78A 3A5VA 4O1BA 2X8RA 4F9DA 2D1ZA 2GWNA 4US5A 3N2TA 5CPTA 4LUSA 1CZ1A 1GEQA 4XZHA 3TSBA 3GTFA 2JIEA 3GIQA 2GGHA 1W3IA 5LIYX 1H3GA 1GTEA 1ECEA 4DYJA 3F1QA 2J8TA 2PDPA 1QW9A 1J4EA 5CJ5A 4DELA 1OX4B 2VOTA 2QUNA 4REQB 1F07A 4GMEA 3GIYA 3O05A 2NXGA 2YAUA 3FJLA 5A8OA 3W38A 4F0SA 2CLHA 1KFKA 3R43A 1GOXA 1RXOB 1OINA 3UD6A 2WMGA 5GJPA 4TXEA 1H7PA 3E96A 1K70A 5EMMA 2FGZA 3TIMA 3SR6B 4DWSC 1EA9C 1ICQA 3OGVA 3Q6JA 3TJIA 4HHMA 4GQRA 1Z8AA 4J3UA 3W86A 1GERA 1TWSA 4YPJA 4DVOA 2Y7FA 2AKMA 1HTIA 3LS9A 3HU7A 4QM1A 4IJRA 3WH5A 4GIRA 3KUMA 5EMLA 3CAWA 4RLIA 2EGZA 2ICSA 3UJ2A 3B0PA 2WSRA 3GYEA 3W7OA 9RUBA 2WSKA 4BWLA 4B3KA 2X0SA 3CEUA 3FG2P 4DWSB 1EP3A 2VURA 3A4XA 3OQEA 3O6YX 2PZNA 3AIBA 1W5OA 4RPPA 4IT1A 3ONCA 1W32A 2A5HA 2A8XA 3AISA 3P8JA 4Z2LA 3EF6A 1S2TA 1JNEA 2PFHA 2J9YA 1X8CA 2INEA 2XGBA 2DORA 2WHMA 4MM1A 4OGZA 1DXFA 4LNCA 2G3FA 4ZCWA 5TD4A 2QJNA 2E9BA 3REQA 4L4LA 5FI8A 4EPKA 1EUAA 3THAA 2YB4A 3UZJA 2CHOA 3WYZA 1XBXA 4BF9A 4EMJA 3EB4A 4GJJA 1VYSX 1OF8A 3VABA 4DJEA 4D6GA 4GFIA 1ZX9A 1F8MA 4NI3A 1VBRA 4Q7BA 1S5TA 2FZBA 3BH4A 2FTYA 3NPVA 3P93A 4AX7A 2ZWYA 3N04A 4CGTA 1FWEC 1R9ZA 1SO3A 3DKLA 3VI2A 3B9DA 1YRRA 1R3RA 4JQ4A 2DZSA 3BGJA 4E8CA 1DXLA 2J13A 3ANYA 5CZJA 2E7FA 2YA0A 2TRSA 2CLFA 1XYBA 1I2PA 4AQLA 3JZUA 3ABQA 2O9PA 3CUHA 2TSYA 4AY7A 3BOFA 3QMSA 3VZXA 2AAAA 3COTA 1MZRA 3AXHA 3KOWA 3G1HA 3A13A 1IZKA 4H6KA 4ZE5A 3IARA 4HOWA 1QR7A 3AYTA 3WLKX 4YU1A 2BXZA 2WPEA 3NZRA 5KZDA 4UTHA 3GTHA 4B5TA 2GUBA 3W25A 3H54A 2ZUVA 4ZOEA 3C0JA 3TFCA 4DUOA 2FFCA 2IKHA 1ZGDA 3HFYA 1MWOA 1JRPA 3F4WA 4PCSA 2VZVA 3QJAA 1Q3NA 4LV4A 3FVDA 2D23A 1KFBA 2C91A 2E1DA 1EGMA 4HSHA 3MHGA 1R47A 3B0VC 5E0FA 4ZXOA 2R9RA 1F05A 4BQ4A 3WLPA 1FFRA 4IUGA 3HZ3A 3OG3A 1QI3A 1XX1A 3GD3A 4OOUA 1XRTA 3SCRA 1L9WA 3TQKA 3M1ZA 2HJPA 5HXMA 2Z7GA 1EHNA 4PUUA 1NWRA 4H4RA 5JCIA 2XFYA 4AZHA 4O54A 2DZXA 3HPFA 3CTLA 4HZMA 1XP3A 3W7RA 4GUJA 3S3GA 2XFWA 5AHEA 4NZ1A 3WIJA 3LPFA 3ZXWA 4AD5A 3NXFA 1MFUA 4ZBCA 4C7FA 1XBZA 5GNYA 1IZCA 4TUFA 2DEPA 4L61A 3L7RA 4UCFA 4AVOA 1W1B1 2VZTA 2VD8A 1RA0A 4WGHA 2V5KA 3S83A 3TYZA 3BQ6A 4O8AA 2HMCA 3DHPA 3P6LA 1FVPA 1YEYA 3RR4A 1D9EA 4P8XA 4GA8A 1Q45A 1UHVA 5T26A 2DY3A 3M47A 4JKMA 4LW7A 4H8HA 1KCXA 3W7HA 2XTKA 3W4RA 3BANA 2NVCA 2A7NA 4E6MA 3EWUA 3EPNA 3T81A 3U7VA 2F6XA 3N2MA 1B90A 4O4VA 4GQGA 1J6PA 3VZYA 1EIBA 2EPHA 1H5VA 2WVSA 4LT9A 1JL8A 2XN0A 3INPA 2BV9A 4LF2A 2QIWA 3BAJA 3LLFA 3U2ZA 1AW5A 3B8IA 1I2QA 3NVVB 4L9YA 2A4AA 4YTUA 3VIHA 1PSCA 3G1RA 3M0HA 3N4AA 5HQEA 4E2VA 3PZQA 1VLWA 4QJ3B 1NDAA 4UR7A 3L5OA 3L21A 4AZGA 1W8GA 1JUEA 1L6YA 2G4FA 5CKSA 2QAEA 4EM4A 2BASA 3M0XA 1C3FA 3C52A 2FB2A 2V68A 2HXUA 1BPLB 4EPBC 4IFOA 3P0XA 4K7YA 3ABRA 1ZBVA 1PDYA 3GZ3A 1GEUA 5I23A 4ZENA 3W01A 6XIAA 1OC5A 1HL2A 3UETA 3MKKA 2JKAA 5FF4A 1EF3A 4HK7A 5E5CA 3UG3A 3G6MA 5EMJA 2C16A 4OHQA 1EWDA 1B3OA 5K7JA 5A3HA 4ERAA 4KIRA 1TO3A 5D8WA 3BLDA 4XD4A 1EDTA 1PUDA 2VEMA 3GDMA 2VC6A 3GBEA 1S2WA 3SIZA 2MUCA 4XK2A 4B15A 2EQ7A 1V02A 4UR8A 5I6SA 3FK4A 2WPGA 2WAGA 4OWGA 2GJRA 2E9LA 1F6PA 2D2GA 2E67A 2J7FA 1XISA 3RJXA 4J40A 2ZRUA 1LQ2A 3WLIA 3DFHA 4DJDC 1EGZA 3WNLA 1EJSC 1KRMA 3H23A 3NDOA 1HGYA 3S5ZA 3QHNA 1R9YA 3RLUA 4KF1A 1JUBA 3TVAA 2WQDA 3MYOA 1A4MA 4Q7NA 3ITXA 4YVVA 2W5FA 1SW7A 2VDIA 2VP8A 1TJ0A 3HTWA 2CEQA 1OIMA 3KOZA 1ZMDA 3QC3A 1S3HA 3I7RA 5EMKA 2BBFA 4L6OA 3OP2A 3E0IA 2VTFA 5HWMA 1HJXA 3O3RA 7ODCA 2WKJA 2Z2BA 1W1IE 3ARZA 4LAOA 3IGHX 4D8ZA 2Q09A 3P2VA 3I3DA 3VGFA 4H9ZA 2YDAA 3QEZA 5DN1A 3TROA 3SGZA 5IOBA 1E5JA 3BW3A 1LBLA 3EEZA 4PRRA 4CQ9A 2W67A 3B05A 3OVQA 4G6CA 3SCWA 1X1ZA 3W1TA 3IJDA 2YSWA 5LYRA 4QXIA 1JI1A 2XPKA 3N6HA 1EXPA 2CERA 1KKRA 2VKZG 3TJXA 4S39A 2VMFA 1CB7B 4LEQA 3WBEA 4KEVA 4Q8MA 4AVFA 2PGRA 2VEPA 3NL5A 3VDGA 4AIEA 1YYAA 4YCPA 5LXXA 3SM0A 4NILA 2GGGA 3PFRA 4MY8A 1KLZA 2X2GA 1ZAIA 3HGSA 2AAMA 3W2MA 4PUNA 1GVRA 3S1VA 2VFFA 3LCGA 3CPRA 3WDQA 4RNHA 3NVDA 5C7HA 1XPYA 1XRFA 1PWMA 5CXPA 2IQDA 3TW7A 4S3GA 1RSCA 3G1VA 2AMXA 3QFAA 4KCWA 1J12A 5CJNA 5DF0A 3CMJA 1F2JA 1R7AA 1TPB1 2XWDA 5GRTA 4G2DA 1RAKA 1ADDA 3I6RA 4CN6A 2H9AB 1O94A 2DV0A 1CLKA 1XLEA 3QKEA 3TMQA 5D37A 1N7KA 2VXNA 3RR1A 5K4XA 3TJ4A 3MPGA 2YZRA 4V2XA 4Z2JA 1VFSA 3NA8A 1DIKA 4DWSA 3A12A 1QW7A 4J2PA 4CNOA 3UGRA 5ABTA 1W3KA 3TONA 1PCKA 4L7ZA 3WSUA 3TE9A 3LTSA 1KM3A 4GNVA 3FSUA 1E0UA 3R13A 4OVXA 4X2PA 3VX1A 3WCZA 4Q6JA 1ZY8A 1XLDA 2C15A 4NIRA 3TSMA 1J6OA 1R5YA 4MMWA 3W73A 1E1EA 2YCLB 2Z4GA 3TLLA 4JTUA 4XKMA 1IGSA 4WDWA 5EBUA 1PX4A 3BG5A 2D3NA 2AL2A 1Q8AA 3N19B 3ZJKA 4NEVA 1N8IA 2R8WA 1EX1A 3ZR6A 4V1XA 2FLIA 3VIKA 1FFUC 4DLMA 3DGRA 1WUEA 4MWAA 3P5YA 1A0DA 1Z3NA 2ZA1A 3O06A 3C2YA 2TYSA 2J25A 3WKZA 3Q2DA 2WO5A 3TJLA 1E15A 4L4PA 2QNEA 2EPNA 4E3VA 4IGMA 1GREA 1Q4NX 4YXGA 5ECUA 1JZ7A 1C7TA 2A3BA 3ZWTA 4MADA 3OJGA 2JK2A 1U1JA 2X40A 3G6LA 4GJIA 2YR1A 4POCA 4H6QA 2BTMA 3FKKA 2VGBA 2OLSA 5RUBA 4DBUA 5FJIA 4R9XA 3PTQA 3DFNA 5ECVA 4F0MA 4ILSA 4LUJA 3VYLA 3UVIA 3UPMA 4F40A 1UKQA 1WDQA 1F6KA 3VIIA 3FAXA 4BJHA 4KWOA 1W1YA 1W1ZA 2VC5A 5CGQA 3QLDA 4QLKA 2YGYA 1KWKA 1K4QA 4V15A 3BCDA 3BC9A 2WWCA 1R2SA 2VC9A 1MEIA 1UA3A 4JTJA 3NSMA 4ACYA 1TWZA 3VDHA 2YBTA 1J5TA 3TOYA 1UA7A 1W0MA 3LY0A 1LT8A 3I6EA 1BF2A 2D73A 4ECLA 3RG6A 4K68A 1R38A 2UY4A 4ASTA 4OQVA 1E3ZA 3N25A 1V0MA 2DVTA 1J0IA 1UIOA 3UWZA 4NEWA 3GVGA 2WBAA 4EPDC 3ABXA 4OTKA 2CC0A 3CH9A 3IS4A 3GRTA 2D0HA 4M7TA 2P76A 1XLHA 2DU2A 4QNEA 4GY0A 3BSHA 3MDWA 4ENLA 1SR0A 2E5BA 3PUGA 2BS9A 3MMWA 4JIRA 4GZ7A 3WF4A 4Z0SA 3W27A 1XDJA 3S6OA 5KZEA 4KCTA 3CMGA 4US5D 3U4FA 3R4IA 3GRSA 1W31A 2VGGA 2RDWA 3EOSA 2DJXA 1OD0A 2HPMA 1A5CA 2GGJA 4GH1A 2CZDA 2QV5A 4AEOA 1K8CA 4IH3A 1XGEA 2BG5A 4WUIA 2RDTA 2WSYA 3WQDA 3QSTA 2JF7A 1UP2A 3PJTA 1R3TA 2C8NA 3I68A 3LN3A 2PRHA 3VNKA 4S23A 3CV7A 3IVUA 3EWWA 3AUJA 3NAVA 3SCUA 5HUPA 3M6DA 4UQEA 1JUKA 2OFJA 3ABSA 3GDBA 4NX5A 3B04A 2Z00A 4JKLA 2PDGA 1ZP4A 4YL2A 3W1AA 1JPIA 3Q65A 1FWIC 3GTXA 3IVSA 2VEKA 4EQWA 4MTVA 3UJSA 1KV8A 1QWGA 4WY0B 1TV7A 3DK8A 2WMJA 3PG9A 3DOPA 1CGVA 4QP0A 3S6TA 4TX9A 1QOQA 3UNTA 4FI4A 4GNJA 3QW3A 2RGLA 1GZJA 1MQPA 4CVWA 5G2HA 4UTTA 5JCMA 2CBUA 5I77A 3LADA 4Y96A 3GR8A 4E2OA 3GO2A 4I8YA 4S38A 4MZ1A 4PUKA 1RCOB 4QQ3A 1CXFA 1X39A 3G3MA 4IP7A 2XSBA 1QAPA 2ZDSA 3PZTA 1VB9A 3CUGA 3YPIA 3DK4A 1RVGA 1KFWA 2OX4A 2QCFA 3QPZA 4UQDA 3CL7A 1V8EA 2BHZA 1PYFA 4P61A 3GXNA 2Y5SA 4GNKB 1KRCC 1HXJA 4DBSA 4IPJA 4YCOA 4R9OA 3WX7A 3WNMA 3B9NA 4EACA 4MWAD 3LTYA 4QLLA 2PPGA 4UOZA 2V9DA 3UR7A 4INFA 4ZZ9A 1RPKA 3WNOA 1ZU8A 6CGTA 4EMWA 1AA1B 2XZ7A 3KRSA 1IR1A 1ME8A 5C5YA 4D1IA 1T8QA 2QCNA 4H7CA 4XZWA 1DKWA 2WLYA 1U5HA 4V33A 3FS2A 3M9YA 4EAYA 4NRSA 4GUHA 4LF1A 3MUCA 1E6XM 1XXXA 4LUIA 4IG2A 3PG8A 3B40A 3MKCA 3B9JB 3EPMA 5BU9A 3MHFA 3DBPA 3CO8A 4D6JA 5C2GA 1TPUA 3DXIA 3LLXA 1UOKA 2WLZA 5FACA 1GRBA 1OADA 4YWSA 5HJYA 1VFLA 5HPCA 1NHRA 4M82A 4KCVA 2HXTA 3A6OA 3CQJA 5JH1A 4WDUA 2XYLA 3VD5A 1TUFA 1E6ZA 3ARQA 3JVAA 1UPMB 1OCQA 4PTMA 2QR6A 1E4LA 5F4XA 4BK9A 4U2YA 2OYMA 1UD8A 2PWVA 2C3DA 1ITXA 5DCEA 3KDOA 2ZZ3A 5FJRA 4PH6A 1RQEA 4Y8EA 4B2DD 3BQ5A 3E2QA 1HF6A 4JS3A 1J8VA 1W9PA 4FPSA 3HPSA 4TQTA 4W9TA 2HVOA 1D3CA 4IPIA 1OFAA 3ZS4A 3URHA 5CZSA 3SI9A 2YFNA 5FJJA 1BTCA 2DUAA 4JN8A 2WSQA 1E70M 3ARUA 4QJ5B 4ZVJA 4EWND 1ZK7A 3EMCA 1J2BA 1ME7A 3UCDA 3DU0A 2YLAA 3BPWA 4UNIA 2BVDA 1J0ZA 3SUTA 3VMPA 4AZCA 3UCQA 1H7WA 5AYIA 1K02A 4AD4A 1LM1A 4M6QA 2R1MA 3UG4A 3N18A 2P10A 1H63A 5KEZA 3AXMA 1H7OA 2HQMA 3OIHA 2DFAA 2D2OA 2A85A 3DJGX 3POCA 4C6OA 1B4EA 1BRLA 1JULA 4DBDA 2Z1XA 3E2VA 2ANUA 4E8GA 4FZIA 1ALDA 1N2VA 2DSWA 4DJFC 3LBOA 4DNHA 5JBEA 3E74A 1H5YA 3LYEA 3RJYA 1SYTA 3RMJA 1JRCA 3ISIX 4HNOA 2ZUNA 1HL8A 3N4EA 3VZZA 3LA4A 5EY5A 3ZOAA 4EQXA 4IMFA 1PVNA 3KL0A 3LNPA 4KETA 3IJ8A 3W7LA 3P61A 2QCEA 1XRVA 3BV4A 5C9ZA 2YVFA 1BGGA 1NWSA 2BZNA 4W4QA 1R2TA 4DJDA 2HCVA 3MO7A 1ZENA 1B3WA 3BURA 2E3ZA 1OX5A 2QEZA 1XGZA 5K3VA 2QCDA 1ESWA 2XWEA 1XL9A 4ZQRA 2DSUA 2INFA 3GH5A 3MU7A 1RY0A 4LBUA 1L6GA 1EB3A 1EC8A 1U5JA 1JD7A 1TWIA 2QS8A 1K77A 3P84A 1TPC1 4R53A 5HNUA 2VCCA 3CHCA 2NX9A 2OKOA 3NQ8A 2RFGA 4KFNA 2WCGA 5I00A 2Z7KA 3BCJA 4Q22A 3EWYA 5D03A 3MSGA 3F2BA 3CZKA 2H3DA 2Q02A 1K4GA 3PTKA 1EJTC 1NOFA 3PWGA 4M19A 2YX0A 4EXAA 4GE8A 3MP5A 3M0VA 1OFBA 1WYGA 3HIJA 4WXZA 4L1WA 2CYGA 2G5WA 1T6MA 4IQDA 1WA3A 1FCQA 4TIMA 1LOQA 4GOAA 3MV11 5FKYA 4O1FA 3KWXA 1J0HA 4IX2A 1BEUA 1SMDA 4MJMA 4TVWA 2WWDA 1WE5A 4AEFA 3IUHA 4C6FA 4FB7A 3RCMA 1DJNA 2W55A 1XD0A 4GR1A 3ZIZA 3G1XA 2GQ8A 1SZFA 5I3IA 4A2SA 2V6AA 1SW3A 4O1EA 4NZJA 3ORWA 4OKDA 1ZZMA 4GINA 3H22A 1CIUA 1XLCA 1A5KC 3ARSA 1KWGA 3A64A 3L5MA 4M7SA 2VFEA 5AHLA 3AU2A 3A9BA 4U28A 1R3SA 1X1NA 8RUCA 2YPIA 2KAUC 1IYXA 1HKIA 3LHUA 1P43A 3IACA 3V5OA 3WUBA 3QRHA 4D9PA 3LBMA 5REQB 5CPLA 1SJAA 4TX6A 2OG9A 1KKOA 3AYVA 2XH4A 2