2QJNA

Crystal structure of d-mannonate dehydratase from novosphingobium aromaticivorans complexed with mg and 2-keto-3-deoxy-d-gluconate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
402
structure length
385
Chain Sequence
MKITAARVIITCPGRNFVTLKIETDQGVYGIGDATLNGRELSVVAYLQEHVAPCLIGMDPRRIEDIWQYVYRGAYWRRGPVTMRAIAAVDMALWDIKAKMAGMPLYQLLGGRSRDGIMVYGHANGSDIAETVEAVGHYIDMGYKAIRAQTGVPGIASLPSVTGWDTRKALNYVPKLFEELRKTYGFDHHLLHDGHHRYTPQEAANLGKMLEPYQLFWLEDCTPAENQEAFRLVRQHTVTPLAVGEIFNTIWDAKDLIQNQLIDYIRATVVGAGGLTHLRRIADLASLYQVRTGCHGATDLSPVTMGCALHFDTWVPNFGIQEYMRHTEETDAVFPHDYWFEKGELFVGETPGHGVDIDEELAAKYPYKPAYLPVARLEDGTMWNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of enzymatic activities in the enolase superfamily: D-Mannonate dehydratase from Novosphingobium aromaticivorans.
pubmed doi rcsb
source organism Novosphingobium aromaticivorans
molecule tags Lyase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
total genus 141
structure length 385
sequence length 402
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2007-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2qjnA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2qjnA01
4HCDA 1EBHA 4HPNA 4K1WA 4G8TA 3RR1A 3OTRA 4E4FA 1R6WA 1KKOA 3RO6A 3DFYA 4DX3A 3OW1A 1NELA 3R10A 3GY1A 3DG6A 2OG9A 1JPMA 3OZYA 4IP5A 5FJOA 2FYMA 3UXLA 3N4FA 2P8CA 4IT1A 4IZGA 2ZADA 3V5FA 3TQPA 1MNSA 2CHRA 4HCLA 2AKMA 4HYRA 3ES8A 3R1ZA 3VA8A 1MRAA 3FJ4A 3GC2A 1OEPA 2PTWA 5FJTA 1JCTA 3TTEA 4IHCA 3FYYA 2OX4A 3I6TA 2PGEA 3TOYA 4H83A 3VCNA 2PSNA 1NU5A 1IYXA 3FVDA 4MMWA 1EBGA 2GGEA 3ZVIA 3UJFA 4HN8A 4G7FA 4IP4A 2PMQA 3DEQA 1TE6A 3CYJA 4A35A 3ENLA 3BSMA 5BOFA 4E8GA 2OVLA 3P0WA 3OP2A 3S5SA 3K1GA 3V5CA 4DWDA 3T8QA 3H12A 1W6TA 1R0MA 3MY9A 1MUCA 2XH4A 1MDRA 3SN4A 2DW7A 3PWGA 3T4WA 1KKRA 5J04A 1SJAA 4M6UA 4GMEA 3QKEA 1F9CA 6ENLA 1YEYA 4GGHA 2HXTA 2AL2A 4DHGA 3H70A 3UJSA 1PDYA 3H8AA 4JN8A 4YWSA 3UCDA 3RRAA 4H19A 2GDQA 3EEZA 4GFIA 2QGYA 3NZGA 3JVAA 4KEMA 2P8BA 2RDXA 3SN0A 3JW7A 2OZTA 3N4EA 3I4KA 1ELSA 3CK5A 1WUEA 3TWAA 3U4FA 3V4BA 3UCCA 2GGJA 3R11A 2GL5A 3UJEA 2GGGA 2QDEA 5FJRA 2HZGA 3VC5A 2OLAA 2XH7A 2OZ8A 1EC9A 4IL0A 1XS2A 3MQTA 3TW9A 3BOXA 2PTXA 1EC8A 3UJ2A 3QTPA 3R0KA 4IL2A 3IK4A 2QJNA 5ENLA 1E9IA 3TWBA 2GSHA 3BJSA 2P88A 3PK7A 1FHVA 3TCSA 3ZLGA 3NFUA 1SJCA 5IDZA 3ZVHB 2XSXA 4HNCA 2QDDA 2P3ZA 1BKHA 3Q4DA 3SSZA 5FJUA 3DGBA 1FHUA 2POZA 1TZZA 3UJRA 4ZCWA 3VC6A 4A6GA 3PFRA 3FCPA 2XH0A 1JPDX 3SJNA 2XH2A 3TJIA 4HNLA 2PTYA 3D46A 3MKCA 3ZLFA 4GYPA 2AKZA 2HNEA 5FJPA 4K2SA 3DG7A 4GIRA 7ENLA 4DN1A 3SQSA 1KD0A 3MZNA 2PU0A 2PODA 2PGWA 2P0IA 4ROPA 3NO1A 2QQ6A 1SJDA 1BQGA 1ECQA 1ONEA 3ZLHA 1L8PA 4J3ZA 3DG3A 5BOEA 1P48A 2O56A 2PA6A 4GISA 2OQHA 2PPGA 3VFCA 3QPEA 3OZMA 2DW6A 2FKPA 4K8GA 3VCCA 3T6CA 4MKSA 3SBFA 4Z17A 2NQLA 2QJMA 3IJLA 2OZ3A 3CXOA 4FP1A 3V3WA 4A3RA 3R25A 4FI4A 3DESA 4Z1YA 1WUFA 2PP3A 3DDMA 4DYEA 4GGBA 4MGGA 3JZUA 1TKKA 1JDFA 4E6MA 2QVHA 1RVKA 2PS2A 4H2HA 3UXKA 4JHMA 2XGZA 4ENLA 4ZA0A 2I5QA 3MWCA 4HCHA 1SJBA 3DFHA 3CAWA 4KWSA 3R0UA 4JN7A 3FV9A 3I6EA 1P43A 2PTZA 3S47A 3MUCA 3GO2A 4H1ZA 2OKTA 3H7VA 3NXLA 1DTNA 1PDZA 2MNRA 2PP1A 2AL2B 2ZC8A 3STPA 3IJIA 2PCEA 3T9PA 3DIPA 4F4RA 2PP0A 4GYPC 4DXKA 2GGIA 3VDGA 3EKGA 3FXGA 4KPLA 4X2PA 3CT2A 4E5TA 3N6HA 4EWJA 3DERA 3P3BA 3ES7A 4M0XA 3CB3A 3U9IA 3TJ4A 3HPFA 3B97A 2AL1A 2GGHA 3IJQA 3QLDA 3Q45A 2OPJA 3SN1A 4E4UA 4KT2A 2HXUA 3N6JA 1XPYA 1MDLA 2OO6A 3RCYA 2QJJA 3THUA 3MSYA 5EU9A 3RGTA 3QN3A 2OFJA 1KCZA 4J1OA 3D47A 2PU1A 3UGVA 2ONEA 3P93A 2MUCA 3PWIA 3OPSA 1EC7A 3GD6A 3ZVHA 3KUMA 3RITA 2OQYA
chains in the Genus database with same CATH superfamily
3KEHA 4NYUA 1OC6A 1PTDA 2V3GA 1LCOA 3LTPA 1P7TA 1EDTA 1JRCA 3W26A 3RNMA 3AIQA 2XSAA 3H22A 4IIEA 1GYMA 3NDZA 5B7ZA 5SWUA 3UXLA 3VKKA 2GR3A 1F6YA 1R3VA 2FZBA 3NQBA 3KS5A 3V5FA 2C1GA 2LLEA 4CD7A 3T0DA 2GVEA 1FWEC 2PD9A 2QR6A 4Q6XA 3RJYA 1W9UA 3VNDA 3HQPA 3FXYA 3OIXA 4RUBA 5BYWA 3WBYA 3C56A 3LSCA 4UNKA 3CZLA 4P8UA 2Q01A 2P50A 1KRMA 1LL4A 1H0IA 1M04A 3IWPA 1I2RA 5KSWA 3RMEA 3B8DA 1NF0A 2V6AA 3V5OA 1KGWA 3TN3A 1X97A 2VRJA 5LIXX 2IPGA 4MY8A 1CXEA 3DFTA 3EXSA 4MAZA 3U7BA 1PVNA 1J0YA 1YYAA 2GWGA 3DJGX 2CWNA 3WDPP 1ADSA 1AH3A 2YCLA 4GVIA 2TMDA 4H8NA 4N6EA 1CIUA 4XVDA 1P0NA 5E1QA 4BEUA 5JU6A 4UOQA 4ZOHB 2IKJA 1XCXA 4C6OA 3WLJA 3VU2A 2C1IA 2JF6A 2YKKA 3GVQA 4CCZA 2G8ZA 3A4XA 3MSRA 3SN4A 4HB7A 2C15A 1KKRA 4O1FA 1G4PA 4PRTA 5AC6A 1UIOA 3VDHA 4S3AA 3TP4A 4FO4A 3T2OA 4IP7A 4LCRA 3TIMA 4WY0B 2DSVA 3NR0A 3NUKA 1C8VA 5LA1A 1BXNA 3UJSA 3WEMA 1Q6RA 2Q02A 4JN8A 1D7YA 1VBGA 3IS4A 1WDRA 4GFIA 1DWJM 1FWJC 1EJVC 3W37A 4ZQPA 3KBVA 4NEWA 4WXZA 2CBIA 1GVRA 1ECEA 4DJDD 2YA2A 2V0TA 3L0KA 4F40A 4MDPA 4ADSA 1KM3A 1RLCL 2PDIA 4PRWA 1KTNA 1XFBA 3AMGA 1K9EA 2ZA1A 2FZDA 2PWDA 1EC8A 1DJGA 1YRRA 1OCBA 1NP2A 3THAA 3TUUA 4PUEA 3RF9A 2HVNA 1MW3A 5BU9A 3PG6A 3S6OA 1A5LC 1EP2A 5I3IA 2CBVA 3F7JA 2WOVA 2R14A 4A29A 1V03A 1CXFA 4LEFA 5I6SA 4H9YA 4IMCA 2PDCA 2RH9A 3PUGA 3QQ0A 4TTUA 2J6XA 3SCPA 3UVIA 2J6VA 4HNOA 3BVJA 4HOZA 5BOOA 5GJMA 4J35A 2Y7EA 3DKJA 4LCSA 3VOGA 3MANA 1E9YB 3B06A 3A6OA 4EF8A 3HW2A 4H4ZA 3STFA 3NPUA 2PTYA 2GOUA 4OUEA 1QOQA 3Q58A 4D6EA 4OBSA 4DZHA 2GVYA 4UTTA 3GE7A 3N4AA 3KOFA 4LX4A 3DYMA 4PCFA 4Z0JA 1JI1A 5LNSA 3V7PA 4QM1A 2ZZBA 1BQGA 2GJRA 3RCNA 1GKRA 1AA1B 1VFSA 1VH7A 1QHOA 4Q8WA 3V1HA 2XINA 1HKJA 2NW0A 1X96A 3VGEA 4CEUC 2YLAA 4JEJA 3W72A 2ZRXA 4WQ6A 4PC8A 1D8CA 3AS3A 4GISA 2TYSA 3MUZ1 1H11A 4DM2A 1B57A 3WD4A 1SFJA 1GVSA 3C8FA 2VZVA 4DLFA 1VFTA 1ZP4A 1XR2A 2C8NA 3UXAA 2QJHA 3P84A 3F4CA 2A79A 2VC5A 3W29A 4JX6A 3V3WA 3M0JA 2FGZA 3OZPA 1VEMA 1E6SM 2VTFA 4WVXA 1ML1A 5A2CA 4DUXA 1RLDA 4OZOA 1M53A 3PBYA 3JZUA 3GAYA 4RNIA 3W88A 1TVPA 4NZ4A 3N2XA 1Q4WA 1TJPA 1QW7A 3TKFA 4BV6A 4KEVA 1DJHA 3BAXA 1RVKA 1Y7VA 3A21A 4H7VA 1LQAA 3HGOA 2YZRA 3UXKA 3TSBA 4UQBA 8TIMA 2PTDA 3V18A 2QDHA 1D3CA 3T44A 4GVFA 3FK4A 5DXYA 3OGRA 3NRZB 3AM9A 1VYRA 3RLUA 1TVNA 3WK2A 3HRDC 5AHEA 1BXBA 5AVNA 5FOOA 1GESA 1CB2A 4PR4A 5CPQA 4DXKA 5KETA 2ZUSA 2ZE0A 3FFSA 1DE6A 1AD4A 4OBTA 4W9TA 2OX1A 3WMCA 3L0NA 1AG1O 3CB3A 1UWIA 1GVYA 4JAWA 1NHQA 4KWVA 1EPVA 2V8ZA 1D3GA 2VZTA 3CZJA 3WDQA 4L1XA 1IXPA 1XRFA 2GDVA 2BX7A 3AFBA 1LQ0A 2VDHA 2Y7GA 1UUQA 4DJEA 1AFSA 2CHNA 3GDMA 2Z7GA 5TNVA 3UPBA 2BFGA 2BODX 1CLKA 1JEZA 5FJIA 4C6BA 3OTRA 1ZS2A 1PIFA 1EGMA 3RO6A 1C7SA 1W0MA 2QV4A 3R10A 3GY1A 1ZX9A 2VEMA 1DIKA 5C9WA 2P5NA 4MUPA 1FXQA 1W3KA 5FACA 1JD9A 4ES4A 1UZDA 3UETA 1HL9A 4JFVA 4EVZA 1ZNNA 3OLDA 5DY2A 1XKJA 2XVPA 4QLKA 4WZHA 2WSQA 3ZSTA 1AOGA 4M56A 1ZALA 4O57A 4BI5A 1XLFA 1H5YA 3B40A 4M52A 3GG0A 4BQ2A 1HN1A 2OGYA 1K1DA 1H2JA 3KBJA 1UUMA 1GYNA 5AVHA 3SQLA 2AQVA 3WMLA 2WWDA 1FWNA 1K9TA 2PLCA 5C71A 3U2EA 1RA5A 4LUYA 4GK8A 3V1PA 3DFPA 1ZMDA 3CAVA 2VQUA 3TEVA 3CYJA 1WZKA 3BMVA 1E73M 1O5KA 3DK9A 4KH2A 1E6ZA 3C8NA 1QVBA 3KRBA 2WPCA 3SIMA 3GDKA 4IUGA 4B9ZA 3ZR5A 3H12A 3NSNA 4UFIA 2H3BA 3K5XA 3VTRA 3ALGA 1O60A 1QHPA 1M7XA 4JIPA 3U3HA 4NAFA 4MKVA 4NZ1A 3AYTA 3UNDA 4UFMA 1LRTA 3NZRA 4R53A 3LS9A 2HVMA 1UWAA 3BOLA 4S39A 4H8UA 7PTDA 4Y7EA 4HA4A 1XRTA 2V68A 4N4PA 3CUFA 3LBCA 5DF0A 1ISXA 1W8GA 2OELA 4ZVJA 1WCGA 2P3EA 4MG4A 5C6MA 3O7UA 5IBXC 1FFUC 1KM5A 2A85A 3E2QA 3BW3A 2YBUA 4XQ6A 3V4BA 1VP5A 1VQTA 3UY7A 1R3TA 4M19A 1BHGA 1JRBA 3IAPA 1F07A 3QV9A 1MI3A 1V0NA 2L5HA 3G18A 3W7RA 4YJ5A 1S7MA 4QCFA 3W7CA 4WX2A 3NQGA 1EXPA 1A5OC 4NIRA 3O0KA 4Y9PA 4HMDA 1W3IA 1QDSA 2VFIA 3WNOA 4K1GA 3FGCB 1I4NA 2IPFA 3COTA 1PZ0A 4YCOA 3CV2A 2X8GA 3V16A 2VT0A 5FEZA 4BJHA 1IWBA 2POTA 2R1NA 4CN6A 1SJCA 3UZZA 3ZR4A 1OFPA 1HP5A 4P7LA 2EQ8A 5JQ9A 4Y9OA 5BMXA 4HYVA 2AGKA 4A6GA 4Q8NA 3PZOA 4OU1A 2W3RA 4UTWA 4BWLA 4RPQA 4UB9A 3O63A 1TV3A 2DZVA 2RGMA 2UY2A 4RV3A 3NEVA 1A3WA 2P53A 4K2SA 4GOAA 1O6IA 4LEQA 2YVJA 5TIMA 2EJ1A 3S1VA 1QHZA 5CGTA 3B03A 3K13A 3OQEA 4CNNA 1Z41A 3RNDA 3O05A 1KC7A 3P62A 3NGJA 3CAKA 1XANA 4J3VA 3KM8A 4IF2A 3ME3A 4Q3MA 4YHGA 2D2HA 3EMQA 1XD1A 3LXDA 2YX0A 5AB3A 4D6CA 3UWEA 2FPVA 4EPEC 1ONRA 3MHFA 2DQWA 1XD0A 2YOCA 3B8SA 3VFCA 3F2DA 3QPEA 1GVFA 3JUGA 4K36A 3LRKA 3E1F1 4LYKA 3BAJA 1G9HA 4KGJA 1EFZA 5AC4A 1WUFA 5FS7A 1TCDA 4DYEA 3G6MA 4PMQA 3VGGA 3WNLA 4E8CA 5JCKA 3FA3A 3GXNA 2X7VA 4C90A 1G94A 4O19A 3NM1A 4AWUA 1BEUA 3CH0A 2F2KA 2WC3A 4C6MA 3S9IA 1H51A 1GTHA 1CXKA 3AXIA 4ADTA 2WJDA 1JG9A 4NZFA 4PB5A 1R85A 1VFUA 3R13A 5CG7A 4W93A 5LGZA 2QLYA 2W0HA 2X09A 4TVUA 1SJBA 1ZJIA 1QK0A 3E12A 1NVMA 1TZ7A 4ATWA 2YW4A 5DEZA 1RQHA 1G5AA 4K6AA 2Z6JA 1PDZA 1ZENA 3VNYA 4AAJA 2A6NA 3HV8A 3AHZA 3QZ6A 3SCSA 2UBPC 2AQWA 4FNPA 1G7UA 2ALRA 3MYOA 2NVDA 1XFCA 2I57A 3VDGA 2H90A 1SFTA 4PMOA 2DVXA 4HMNA 3CH9A 3L23A 3RJXA 3UEQA 1XV8A 5HR6A 5HK4A 2Y8KA 4PB3A 4PCPA 4H4UA 3HMJG 3UZXA 2INEA 4CQ8A 4XAYA 3EOLA 5LXEA 3HG2A 1NDZA 5T8GA 1WB0A 1QO2A 2DJXA 1RR2A 2PWUA 3LLXA 2Q6ZA 4DO5A 2YXGA 4UFJA 1HL8A 4OGZA 4HNUA 1YW1A 3CMFA 1MQQA 3SFKA 5M2FX 3TTSA 2VI0A 3AMCA 3UXDA 1VIWA 1LLZA 4IPPA 3N15A 2PU1A 3RPTA 1PKLA 4CCEA 3N04A 3BLFA 4W8AA 2PDKA 3TH6A 1E4NA 1UMYA 3W2MA 3NXFA 3H7UA 5A1AA 1FX6A 2FVMA 3EWWA 3FYOA 1EHNA 1WKYA 2X1UA 3UYIA 3A5VA 4DBDA 3EA1A 1QBBA 4GO9A 2WBAA 5K4XA 1PIGA 1QASA 4GC4A 1AJ0A 1OZQA 1XLGA 2OG9A 1BSLA 4TVYA 2PE4A 2VEFA 4AX6A 5JBFA 1YTEA 2PZNA 3LM7A 3W1TA 2PDFA 1DKWA 4ZOEA 1PL9A 2V67A 1SMDA 1T0OA 4XKYB 1IEWA 3GS6A 4C5ZA 3R1ZA 1MO9A 3WLMA 1O5XA 4XSMA 4EXBA 3KFTA 1HZYA 1W31A 5HUOA 4LUTA 2V6OA 2A3BA 2ZZ1A 3XIMA 5FJTA 2J79A 3PJWA 3VK5A 1F73A 4DRSA 2DUZA 3TTEA 1E0UA 3GX9A 4H4VA 3Q67A 3TR9A 1EGZA 2CCRA 4GNKB 1EJRC 1DEDA 1VHNA 3OU8A 2V2HA 3ITOA 2R82A 3UJFA 1J5TA 4KPRA 4ZQNA 4S1FA 4OWGA 1UZ1A 1DXLA 3ENLA 2WCAA 2BGSA 3P14A 3NVVB 5LA2A 3LGDA 1R3YA 2G0WA 5AYBA 5CC7A 5FCZA 2O4MA 2DT2A 4L4OA 3SRHA 3OP2A 1B9BA 3O2LA 4GI9A 4WJEA 4ERGA 1CECA 1R0MA 4US5A 3DYOA 2XH4A 3VD3A 4TOQA 5HQLA 1FWRA 1A53A 1IR2A 4M6UA 2X40A 2WLZA 3FHAA 4LOCA 3EDDA 2WJZA 4V1YA 2WP5A 5GQBA 4AUBA 4UTWC 3E38A 3CUIA 4AF0A 3G8EA 3PWAA 2QHAA 1UC4A 5B80A 3LTYA 2G4FA 3SGUA 5FSEC 1OADA 3T0CA 1ZCOA 3MJMA 1MXSA 3O16A 1GONA 1XG3A 4XZBA 4H4YA 4LVGA 3AOFA 4PTMA 2W55A 3LN3A 1KFJA 2VC9A 1LOLA 1A5BA 2W62A 3R43A 3PHAA 1O5RA 2Z6IA 2G96A 4ZFMA 1POJA 2RUSA 3DAQA 5FJRA 1LOQA 3EBVA 2DIJA 1XC4A 3BXWA 2HS8A 5K9DA 2F84A 1IZJA 3L2MA 1RVGA 4UTUA 3DX5A 1Q4NX 3BOXA 1P1MA 1UD4A 3GNOA 3GXDA 3G1RA 4S3DA 2YDAA 2QS8A 3EX4A 1G69A 1XL9A 2JK6A 3G2GA 4C6NA 1RA0A 2J7HA 3CT7A 4XO7A 3SCTA 1U1JA 1WPCA 5C9XA 3XISA 3KLJA 4JTDA 3RM9A 3QR3A 3WLTA 4Y9MA 1LWHA 2Y5EA 4FOKA 3S46A 1WKFA 3ZJ8A 6TAAA 3PFRA 1RP8A 1MXGA 2NXHA 3GFYA 3WH6A 3SQPA 1NWRA 1HKIA 5C8BB 1JYNA 2UY5A 1LQ2A 2ZRVA 4HD5A 5IBXA 3UQNA 2IMRA 1YNPA 2ON3A 3CIWA 3UW6A 3IGSA 2QKFA 1K9FA 1S2CA 2F6XA 3ARXA 4GNJA 5U1OA 1VFLA 2PI6A 1REQA 1Q6CA 3ZLHA 3WYZA 2VEPA 1LVLA 2ZXAA 4FK9A 3WQGA 4XKMA 2PAJA 1VKFA 4L65A 5FA5A 2DDXA 4DJFC 4O4VA 1ME8A 3S1UA 1IF2A 4C60A 3OQ8A 3TMLA 4A8NA 2O92A 4QGCA 3PZ9A 3ICJA 4W8BA 1NHPA 5AHIA 3KS6A 2PF0A 3TCEA 2GWNA 3SBFA 4D71A 5EMJA 1J0ZA 3OGVA 1OK6A 2EG8A 4AYGA 2DZWA 4QNEA 1F74A 3D3FA 3W6LA 3AMZA 1GG0A 2D2JA 5G4EA 2CFYA 3H21A 1A5AA 5JBDA 4CNTA 3QGKC 2CW6A 4Q32A 1SVDA 1U5JA 3BGJA 1M03A 5D04C 3LQLA 4LWWA 3W73A 5CCZA 2BOFX 4O11A 1K6AA 1UPPA 3FV9A 3BLKA 4PTXA 4L80A 1WYIA 3GU1A 3GO2A 3DXIA 2XN2A 3WLKX 4I6VA 2E68A 3A4JA 1JFXA 4RE3A 4MY9A 3A7UA 5ABGA 4UTIA 1FQ0A 3MI6A 4NJHA 3EDFA 3BSGA 2ZXDA 2CBJA 2JF7A 1E9LA 3A9IA 1NQ6A 5XINA 3E0IA 2PP0A 3TC7A 2J77A 3HPSA 4AEOA 2VCCA 3F03K 3WQ8A 1ISVA 2VRKA 3O6YX 4EMJA 1DIOA 2VX7A 4F0MA 3CT2A 4GVGA 3TNOA 4UTMA 2OEJA 1J12A 2WK2A 4I6KA 2FPYA 3W1PA 1X6UA 5G2HA 2GDUA 2PUZA 3TJ4A 2QT3A 1DL3A 2NX3A 1PUDA 5D9PA 2GGHA 4TXEA 4R9OA 1L6SA 1HX0A 5HJYA 3UG5A 5I03A 3HPAA 1E6RA 3Q45A 1LUCA 4U2YA 4XUYA 2WHMA 2OO6A 6TIMA 3AU6A 3NVDA 5FF4A 4DF0A 1DWHM 1ICSA 1EA0A 3K8KA 5H2ZA 1O68A 1GZJA 1XLJA 4UTJA 2OB3A 1Z42A 2YB4A 4Q33A 2ALDA 2ZDRA 1J4EA 3GD6A 3CGTA 4XK2A 1BD0A 1MZRA 1TWSA 6XIAA 3W86A 1JUEA 3TXZA 2QULA 2GVJA 4ZOBA 1E6NA 1GWJA 4YWOA 1KKOA 1XLCA 2CZEA 4AZ7A 2XN0A 1BG4A 5DBUA 4MOZA 1FCBA 2NUYA 3DGZA 2IKGA 3OZYA 5FJOA 2X05A 4LV4A 2WNNA 3QW4B 3TLLA 3N4FA 3CLWA 2ZXQA 3GNXA 1EL3A 4HCLA 2GQ3A 4MNMA 1AUSL 4UNIA 4YWIA 4I9JA 4HMCA 5A6TC 5HQMA 3BLEA 5C9UA 4O4WA 4X60A 4F2UA 4WIWA 1UH4A 2PDHA 1NY1A 1JD7A 2GJNA 1JCTA 2FZMA 1GZGA 1OY0A 3UYCA 4GVHA 1LL6A 4D6DA 4PMYA 1JXKA 2OX4A 1P0KA 4E0CA 2CZ5A 4EM4A 4WJ8A 2IPWA 3SCWA 5RUBA 4JKLA 2WMGA 3ZVIA 3MSGA 3BAWA 3FDGA 5JVLA 3EWZA 1J96A 5M3WA 1HJVA 3QFBA 3L5MA 1J0IA 3E02A 4DF2A 4QQ3A 4MTVA 5BOFA 2JEQA 4PULA 4E8GA 1KV8A 1E6PA 3W71A 3NA8A 3RLHA 3N3TA 2FLIA 2B7PA 1MXDA 2PURA 3G1HA 3RX2A 4AY7A 1W6TA 4O10A 2A0NA 2FZNA 2Z28A 3WCZA 5CLWA 1M3UA 3GLCA 4I7WA 2V9DA 4LVFA 4KRTA 3F4NA 1YXDA 3DYPA 5BXSA 1I1WA 2E1WA 4UQDA 3SY1A 1PZ3A 5K9CA 3L4ZA 1YE4A 3VIMA 4LAZA 1D2KA 1IV8A 4JKKA 1EQPA 4UR9A 1PDYA 1QNOA 2Z24A 3KOYA 4WY0A 2ZYFA 2IW0A 3WF0A 2A3CA 3TZFA 4UCGA 4JIEA 2BXVA 3CPGA 1XI3A 1OHLA 3L4VA 2GOKA 4D6IA 5CLTA 5A6JA 2J7GA 1LORA 3PTMA 1GERA 3R11A 4M81A 3LBMA 4US5D 4PL1A 3GTFA 2PD5A 3CUXA 3MTWA 3R7MA 1XHCA 1XBZA 2XH7A 1TELA 3AIVA 5BU6A 2YL8A 1D3HA 1T40A 2YBVA 1TMLA 3VNJA 4ZE4A 4JFWA 3WELA 5ENLA 2ZWZA 2BVDA 3W81A 1E40A 4DUWA 3ABZA 3BJSA 3CYVA 4JHZA 5BWFA 1VQZA 2VGIA 4IX0A 2E9LA 3GH7A 1ICPA 4PUKA 2VZUA 2Y0FA 2GUYA 1MUWA 4QFUA 3QSRA 4Z1DA 3THDA 5A5WA 4EF9A 4JNZA 5AZ1A 2H8XA 5D02A 3W4RA 1OF6A 3W1AA 3WQVA 5G5IA 2Y7FA 3HFTA 1SZFA 3VGHA 1JPDX 2H9AA 2BHUA 3LRLA 2R1MA 1QO5A 2A8XA 2BVYA 1W2VA 1CWYA 2PLMA 4UFHA 1OFRA 3G1FA 4GUJA 1Q3NA 1RY0A 1NHRA 1O5QA 4ZGYA 4XAFA 3PZIA 4C7DA 4FXJA 2G5WA 1IE7C 3SEPA 1GOKA 4DI9A 1QTWA 2DSUA 3CLMA 2XWEA 1W54A 4M6PA 1VRXA 3QY7A 4IGMA 5T9BG 5DCBA 1NIUA 4J3ZA 2NQ9A 4PTDA 4FHAA 3WG6A 2OODA 2X41A 3K4AA 3B0VC 4FLSA 1KFCA 3T7VA 1EOMA 5REQB 1CW2A 1FP9A 2BBFA 5DX7A 3H4GA 3S1XA 4MKSA 1HJWA 2VEGA 5FJJA 1MW0A 2GQ8A 2EJAA 3USBA 3WLIA 2X8HA 4PFHA 3LU2A 4AX7A 1SB3B 5BMWA 3WUEA 3FN9A 4CNPA 1EJSC 1HW6A 1WA3A 2ZUWA 4GRSA 5IRPA 1R30A 1CZ1A 2IKIA 4B92A 2KZHA 3BLOA 4OT7A 2YCLB 3BGAA 4N6FA 5I0DA 3W3OA 2BZNA 3LYEA 2V3EA 1S5TA 1KR1A 1XYZA 1XUZA 3APGA 1ZJHA 3GTNA 3VABA 1VFMA 4W89A 1C29A 3MA8A 3PJXA 5KZEA 1NSJA 3JS3A 3ABXA 3H2AA 4LAOA 4FEZA 3DFOA 1NDYA 1ZY9A 2EPMX 3NXLA 1JPIA 2PP1A 1J2WA 3N13A 3U2CA 3W1LA 5HMDA 4V1XA 3U48A 1G6CA 4N9DA 4NZ3A 1AW2A 2V82A 3NQ6A 3FJNA 1R7OA 3NDOA 1JCJA 4MY1A 1GQIA 1YPIA 4GKLA 2Y6ZA 4X61A 1GW1A 1RJPA 3C6CA 3SDOA 2HROA 1B3ZA 3SB0A 4XD3A 5E6YA 5DMYA 2I16A 1XWYA 1RHCA 1ZSXA 3NOEA 2FVLA 4XZLX 1H63A 4TX8A 1LJYA 1W2PA 3IUDA 4ROQA 4GYKA 1BRLB 4MB3A 1VYPX 3LADA 1TQJA 5DELA 3ZT6A 1F8MA 1FKWA 1E1CB 3C2YA 4UZSA 2X16A 3MUY1 1A5KC 3AAMA 3G3MA 1QWGA 1DWGM 1B90A 4QG6A 3KUMA 1CGWA 2IS7A 3QHOA 3A4AA 4D72A 1YXYA 2O9PA 1GJPA 1K8CA 3VOJA 3ID7A 1NF7A 1J5SA 1XDLA 4PL2A 4K1WA 1EEPA 3FYPA 1SO4A 3CWNA 2JKEA 4E4FA 2GK1A 4D8AA 1NELA 3PB0A 1O4UA 2A5HA 3PPHA 4Q8UA 2D3NA 3H26A 5CGQA 3T05A 1VEPA 2YXOA 4DXXA 1KGUA 4ALDA 3ECQA 3BQ5A 1V7AA 3O6DA 4U2ZA 4LH8A 3AXMA 1W1TA 3EX1A 1F3EA 4BFAA 5A8PA 3QLLA 4G2DA 1KNWA 2ISWA 2CERA 1FRBA 3VA8A 4REQB 2PRHA 3KBNA 1K8YA 5EKYA 1WZAA 2C0HA 5EYWA 3GW3A 1K7FA 1Q85A 3GYEA 4F0SA 1TZ9A 4TO8A 3LV6A 1PKYA 5AY7A 3KHDA 1PO9A 3W76A 1W91A 4O16A 4DY1A 2FH6A 3GHTA 3KWXA 4Y96A 1V6WA 3GDLA 3PBWA 3JR2A 3AICA 3ZXWA 4CQ9A 5K4ZA 4HN8A 1FWAC 3OVQA 1XBVA 1M7OA 1GXFA 3UG8A 1UWQA 3PN8A 4F79A 1W1B1 1G1YA 3SURA 4KKXA 3QOKA 1IEIA 1T99A 2R24A 3BPWA 2IKHA 2Z2BA 3K8LA 4AZGA 1D9EA 4NAEB 3RUBL 1O95A 3N2TA 1GRTA 1EBDA 2SFPA 4HN4A 3REQA 2Q3RA 3I3BA 3II1A 4QJ3B 5CEWA 3MVTA 1SJAA 3OLIA 2ESCA 1HKKA 5LNWA 1QNPA 5F1VA 1F9CA 5I78A 1B54A 4HT3A 3QRHA 3BGGA 3KP0A 4ZB0A 3ARTA 2ZZ7A 3VM7A 1V6UA 4BKNA 1MQRA 3N9RA 1M5WA 1HKVA 1DORA 3MMUA 4CQDA 4HNNA 4DZ5A 2UY3A 3GHRA 4YTRA 5ABTA 3ZM8A 3KL3A 3A4WA 2Y5JA 3GH5A 2XHYA 4KEMA 3BUVA 3KHJA 1RALA 5HPCA 1XLKA 5ABFA 1J6PA 2JIEA 1B4EA 3N17A 5BNKA 1V6YA 1Y5WA 4L4PA 4MKNA 2OTDA 1U30A 3NQ7A 2GL5A 1P1XA 4YS1A 2FJKA 4XIAA 5I3HA 3ITXA 1KA9F 1MZHA 1UQZA 3TYCA 4TUFA 1FFRA 1UB3A 1WXJA 3FNDA 1XS2A 1JUBA 4IJRA 3LPPA 2QJNA 1KXVA 4B5SA 1CGXA 3GG7A 1OM0A 3E3HA 3VDCA 2ZZ4A 4IIDA 1T8XA 4S2BA 4D1IA 3CZGA 1RUSA 4I9AA 3Q4DA 1I6NA 4LC8A 5JH2A 3WQ4A 4NT0A 3URHA 3TFCA 3CQ0A 4GXWA 2O4QA 5LIUX 1PKMA 3EAOA 3PVFA 2CKSA 4JTHA 1H6VA 4HNLA 3G1DA 3NPXA 4RZ4A 1W1IE 1KRBC 2D2GA 1F6PA 4IM4A 2CLFA 2WJFA 2HJPA 5TAOA 5A8QA 3WLQA 9XIMA 1QNVA 3M6YA 5H1WA 2QAEA 3FS2A 1M6JA 1J6OA 3B8UA 4B4HA 1YMYA 4IWWA 3T08A 2YA0A 3QM3A 4EPBC 2RGLA 3QC0A 5T9CE 2QUUA 1O66A 1E55A 1SJDA 4L4LA 4HJFA 4AWTA 1R3SA 2V5BA 3UNTA 1GZ1A 4AY1A 2ODOA 5ABHA 2QNEA 5A94A 2WOIA 1HIZA 2O56A 1OT2A 4O54A 5M1TA 1WV2A 4KFOA 1C7TA 4F2TA 2WHJA 4FNRA 3R07C 4E2DA 1EKOA 4N4QA 3KOWA 2FKPA 1Q65A 1Q7ZA 4NEVA 5I24A 3ABOA 5DXXA 4Z17A 1PHWA 5AZ0A 1WDQA 1XIBA 3FX4A 3IJLA 2YSWA 4N7QA 2Q09A 1GQNA 2WSPA 1A5UA 3NVYB 1BKSA 3B0XA 4B15A 3VNZA 3RLVA 5AYYA 2WV8A 3TC6A 1S2VA 1OK4A 1FY6A 1JGIA 4Y2WA 3SR6B 1BYDA 5A8OA 3AXHA 1XW8A 3NVWB 4MLJA 1GPWA 4D8ZA 3SI9A 4J4KA 1H60A 2BY0A 4KEZA 3WBAA 1WOBA 4JDRA 4S3KA 3GDTA 3OA5A 4H6RA 4J3SA 3TYUA 3TAOA 4WGHA 3W2LA 1ZTVA 1ALDA 4UOJA 4L9YA 4FNSA 4KWSA 4XZIA 3MMWA 1ZGDA 4G9PA 3UZJA 2E5AA 2HV5A 1N60C 3GUGA 1DQXA 1P0BA 1J11A 3OVGA 1LUCB 3C52A 2ZQ0A 3H7VA 5HJXA 4HSOA 3CQHA 3WJXA 3TN6A 3AZTA 1SFSA 3ZYZA 4LC6A 3LMZA 3AMKA 3N2OA 4F4RA 2NXIA 1KFEA 2X50A 4HTBA 3SADA 2Z7KA 3S0CA 4NXKA 7A3HA 3OEXA 4YLWA 3VKCA 3ITYA 1XIJA 4WDTA 3WK1A 2GK1B 4C91A 3WQFA 3OZOA 3M0VA 4EWJA 3ORWA 4NX5A 2A3EA 4P8WA 4OJYA 3EXRA 1XIMA 2QUVA 3OA3A 1GRFA 2RDWA 4JS3A 4ATLA 1IIGA 1F3WA 1ESWA 1CEOA 1ZDLA 4KT2A 2OXNA 2EG7A 2F6KA 3WO8A 4IH3A 4ADUA 3QTGA 1TE1A 3CIXA 2QGHA 3PP7A 6XIMA 4GCAA 2EKGA 2PWHA 3PSVA 4XD6A 1KV5A 2PDYA 1EC7A 3MCMA 5C54A 2XYLA 1VR6A 5HMFA 1YBQB 3IIPA 3CL6A 4W88A 1XM3A 3G1YA 1NOWA 1LF1A 4TU1A 3MBDA 3DN5A 3HMCA 3ATYA 4DZAA 2Y4SA 1AW1A 3QPYA 1GRAA 3W7PA 1T41A 4F9JA 1S38A 3P8IA 3O0FA 1R2RA 3KL0A 1FHDA 1O12A 4FZIA 4U5IA 4EANA 2G3FA 1EB3A 1EIBA 2A7PA 3A47A 1XYLA 2GSEA 4C6PA 4B3ZA 2HCVA 3W38A 2ZTJA 1W9BM 4IMGA 3GHUA 3VGBA 4ERIA 1V02E 3LRMA 3LHUA 2ICSA 3MUIA 2Z4GA 4GCXA 3W22A 4DLMA 4UMAA 3D5HA 2BHYA 3TOYA 2PSNA 1Z48A 1IYXA 2NV2A 4AISA 1V77A 1B2YA 3GTIA 5C9ZA 1JROA 1TUFA 3HG5A 2JGQA 3G1VA 4IJBA 1BF6A 4MFDA 4HGXA 2BVTA 2XZ9A 1JRPA 3IJ9A 2F8QA 2X8RA 3PFMA 3L0GA 3KVJA 3NNTA 3C5QA 1HQTA 4PFMA 4HKPA 4JL1A 2YVFA 2Q71A 1SZRA 4LSBA 3WQEA 2BV9A 1J2BA 1SSDA 2O7SA 1C92A 2G4JA 3FW6A 1S3TC 4LNYA 3QQWA 3WLHA 3B9DA 2VP8A 1KGXA 3PF3A 1MUCA 4JTQA 2VURA 2YDRA 2DW7A 2ZDSA 3PWGA 1R9XA 3M6DA 4LPCA 2V2DA 2NV1A 1C91A 1MEWA 1GVIA 2WSRA 2F6UA 4TX9A 3IGUA 4IFRA 4GJJA 1C9DA 3SO7A 3UGRA 2EBNA 3N9KA 3F2CA 1UR9A 4H6EA 1PCKA 1PPIA 4ZQRA 3RRAA 4RX0A 2GDQA 4AVOA 2RABA 1XIEA 4UCFA 2DZSA 3PULA 1QWKA 3W84A 3QV6A 5F4SA 5FKYA 1EJXC 1UZ4A 3VGDA 3JW7A 2W91A 2W54A 5JMUA 1NFPA 3TWAA 4PMXA 3K46A 3H4WA 4UTHA 1V4YA 5IHSA 4R85A 1GNXA 4PEKA 5DO8A 3AJXA 4W5ZA 2ZE3A 3LXCA 4RE2A 4QG8A 2H9AB 4HU0A 2QDEA 5XIAA 2OLAA 4D1JA 1NWSA 4MZYA 2AOSA 1FECA 3VYLA 4H4XA 3HFYA 5I3GA 1DNCA 4GUFA 2PTXA 2Y5SA 1DQUA 1BGAA 1M1BA 4O1EA 4QEEA 2WVUA 3W2JA 3VKBA 4URIA 3PK7A 3Q2DA 3KRZA 1NOFA 3HIJA 3C61A 1KWGA 2W66A 4I5UA 1K6WA 4L1WA 2QF8A 2OKOA 1TZZA 4D6FA 2DEPA 5A6BD 4WRHA 2UY4A 3P5ZA 4G1KA 3ABRA 3AI0A 3TA9A 4CCCA 2XM1A 2BC1A 3P60A 4DJED 1ZK7A 4B9YA 3N11A 4DJDA 2VRQA 1OCQA 1HJQA 3L4WA 1UD5A 1V3KA 4K68A 5FEPA 1KRCC 4RJEA 1EJUC 1F7BA 3LLFA 3UWWA 3WN6A 4C6CA 1EP3A 1TYPA 1ONEA 2ACRA 4MZ8A 4ILSA 5BCAA 4S3CA 1FWBC 2F38A 4KWUA 3FG2P 1FWWA 2YCKX 2Z1SA 1EXBA 4XUGA 1QNQA 1IXNA 4PBFA 3AIUA 3A23A 3WX7A 5D09A 1NWUA 5HANA 1WOAA 1P6BA 4Q8OA 5A3HA 3VOIA 2B7OA 1Q5MA 1LT7A 2Z00A 3R25A 1BYAA 1QI5A 1MWOA 3E5BA 2CIPA 3LB8A 3CL8A 3WLPA 2P10A 5GNYA 3ZS4A 1H5VA 2ZICA 2JE8A 3C2FA 5TF0A 1I8JA 1UH2A 3TU9A 4UBPC 4E6MA 6PTDA 5I02A 1A47A 1XUUA 1TSIA 2CBUA 2G3MA 2JEPA 1US3A 5A2BA 4JEQA 3T1GA 3W2NA 3H6OA 4PH6A 2ABAA 4B16A 4D6JA 3FVMA 2JIWA 3CAWA 2VX6A 1B3OA 4CD4A 1PJ9A 3VINA 3QF0A 5HINA 1OX5A 4GBDA 1KLYA 2VR5A 1TR1A 1C3FA 1BPLB 5A95A 5D9OA 1GQLA 4I9MA 4H1ZA 3CQIA 1W5MA 1TTPA 1Z89A 3CM4A 2ZC8A 2ZBTA 3EOEA 3DFNA 5F2IA 4U31A 4F0KA 3B9OA 2F61A 3TA6A 3UF9A 3W83A 4F8XA 3T42A 4BQ4A 1LROA 2XGBA 4HA1A 2DT3A 1F5ZA 1O1ZA 1VIZA 1QT1A 1KB3A 2TAAA 3E0FA 1TPVA 2WCGA 1KBBA 4NXSA 4H7ZA 3B97A 4FLRA 2ISVA 2HTMA 1POKA 3H4XA 1XYMA 4HZ8A 3SW6A 4BWLC 3HU7A 4YN5A 2OPJA 3APYA 3W85A 2BNJA 2DZBA 4M8UA 4MUZA 1DJZA 4ICCX 3GTXA 4R27A 4NAEA 3O06A 1ZY8A 4O1BA 5E70A 1E0TA 4JTFA 2NQHA 4LU0A 1OFAA 1PYFA 3MS8A 1QR7A 4Q8TA 3KTSA 1Q2SA 4KFPA 3ZSSA 3WH5A 1XKYA 3BDKA 3PBUA 3WBWA 3TYAA 4DNMA 1ITUA 2FJUB 4J56A 4HSNA 2QPUA 3AO0A 1ODUA 4PBEA 2V5LA 1R6WA 5CC5A 1RCQA 1ZXIC 1Q8AA 3UD6A 1NPXA 4G56A 3MP4A 5I77A 1G4EA 4PMNA 2CWXA 2ZADA 1CI1A 4GR1A 1PCWA 4HYRA 4B2DA 3K1DA 1N7KA 4AU0A 2VELA 1B9ZA 1PBGA 1SSGA 4UIOA 2E09A 1OQFA 3PTDA 4W7WA 1XLBA 1KM0A 4O14A 3GXFA 4JCLA 3H54A 4H3DA 4LY8A 5HWNA 4J28A 3AIWA 3GZ3A 4AHQA 2WJEA 3DU0A 4XB3A 2VD8A 3ZQ9A 1OVDA 2VHLA 5EGRA 5E9AA 1YDOA 1ODZA 1OFQA 4MADA 4UC5A 2QDGA 4XZMX 3VX1A 3NURA 1TIMA 1EGVA 2Q8XA 5CG0A 3VE9A 3DHFA 5FF2A 2NQ5A 1XIFA 4B91A 3I6RA 4BHYA 4GXMA 2VD9A 4QISA 1BWKA 3VE7A 1S2AA 3EWCA 3H2NA 4A05A 5KEZA 2OVLA 2YL5A 2YCEA 3BV7A 3PM6A 1LBMA 2GLKA 3VD7A 3K1GA 4H9TA 4AH7A 2WPFA 2XVGA 1HL2A 3BCJA 1J79A 3WKZA 2C3DA 2PDUA 3R0DA 5KZDA 2OWWA 3AALA 5CBJA 1VEOA 1QI2A 1SO3A 4KF1A 3UA4A 3WJYA 4RW5A 4DM1A 3ZWTA 3S6DA 4BQ5A 3TX9A 2FMOA 1NFGA 3RRXA 2I1OA 3ABQA 3MPGA 4BS0A 4XAPA 5K3VA 3BICA 1SFLA 3A3HA 2X2GA 4G7EA 3W7LA 3KVMA 1FIQB 2CLEA 1PSCA 3LY0A 1FDJA 2VFDA 3EEZA 3TZNA 2QGYA 3PUOA 1WAUA 3W01A 4GIYA 3GG1A 1WDWA 3EPMA 4XWUA 3CHCA 5CPTA 7XIMA 3K8MA 2NQZA 1VLWA 2JKPA 3BO9A 3UPMA 3FA5A 3RDKA 5HWMA 1UR8A 4UMBA 3I3DA 4QJ1A 1Q7QA 1GG1A 4RLIA 3OOQA 3W24A 3FY1A 5CSSA 4FMVA 4O0KA 4NQ1A 3AJ7A 3L66A 3UJ2A 3QTPA 2Z1KA 6REQA 3M0ZA 3OVPA 3QMTA 2P88A 2CYGA 2C91A 2BGNE 3ABSA 4HNCA 1MUMA 1JFHA 1F4HA 2PDLA 3VNKA 3U2OA 1J0JA 4EM3A 1BLIA 5FEXA 1GOQA 4CNOA 3I4EA 2XUCA 5F2LA 2D3LA 1OWQA 2E9BA 2VOMA 4NJJA 1AD1A 4LNCA 3N2CA 2BC0A 3WLLA 1EO7A 5HMEA 1MEIA 1FDZA 2BOGX 1V59A 2UV8G 1KD0A 3CO4A 5AHMA 3MZNA 3BG9A 9CGTA 1S1PA 2VDIA 2P0IA 1ZUAX 3GNNA 4QR6A 5IFPA 1AODA 1AW5A 3DKLA 2E5CA 2XIMA 3T40A 5AYZA 3PZGA 4O12A 4RW3A 3G1SA 3P7YA 4Z1BA 4I7UA 3UCQA 4FX8A 3EOOA 2YZ5A 1H61A 2ZRWA 4A2SA 2WQDA 1X2HA 3HM7A 3EPOA 4GXPA 1H3GA 3T6CA 5I00A 2PDQA 2BOEX 4O15A 1W3HA 4FP1A 2KAUC 1Q66A 5FF3A 3CNYA 2NLYA 2X42A 2YFOA 3IEBA 5HATA 3A5FA 1H41A 3DDMA 4AD3A 2DUAA 3HGJA 1ZRQA 3ALFA 3W07A 4M51A 3OLGA 4S3GA 4AC1X 1V3JA 3T81A 5BXPA 1WP6A 1UKPA 3TN4A 3VZXA 2W0UA 1UBPC 3RMJA 3CWOX 1JZ2A 5KITA 4EP8C 2FH8A 5D9NA 2J47A 2PDPA 1MW1A 4DBSA 5DCEA 3CGCA 2OKTA 4Q4RA 4DQWA 1BSIA 2OEKA 1PS9A 3MKVA 2QUTA 2NWSA 1W5PA 3EDEA 3OHMB 4LALA 3EA2A 3DHUA 5G1MA 3CHEA 4FNUA 3GZAA 1TV8A 1JOAA 1EA9C 3WBXA 4J2MA 4EE9A 1JNDA 3FXGA 4MWAD 4KPLA 4PMUA 3VIKA 1DJQA 3W74A 4NP7A 3WQOA 1XJBA 1T5AA 2E0PA 4DAIA 3D9XA 2WPBA 5G4WA 1U83A 2VR2A 4HK6A 3ATZA 3W1MA 4JKMA 3Q6JA 4YHEA 3IC9A 4DO6A 3N6JA 4LBUA 5LZLA 2ZA2A 1K3UA 4MB5A 2QJJA 3THUA 1O7AA 3IRDA 3S5NA 4OTKA 1LRQA 5HR7A 1QATA 3TOPA 1BRLA 5AC8A 3VOHA 3HV9A 3UWZA 5EMKA 2GPTA 3L21A 3H55A 4IXXA 1L2QA 2ONEA 3SY8A 3L7RA 3KXQA 1ZAIA 4HK7A 3VNLA 3RITA 1P7TB 5CZJA 4QNWA 2TRSA 3VOCA 3E74A 4MZ1A 3S4TA 2QCDB 3P74A 1GCYA 4FX9A 3R8GA 2XVNA 4F48A 3R6IA 1K7XA 4HNVA 1OABA 3W7GA 4IT1A 4YTSA 2R1PA 2GJPA 4Z2IA 3VM5A 3GB6A 2CLOA 3WLOA 3ES8A 3OBAA 5JUVA 3WMSA 3GC2A 1XRSA 3W70A 3STEA 1FEAA 2WPEA 5E6ZA 1BWVA 4A8IA 4A4AA 3GVRA 2WNWA 1A5CA 1UG6A 4ICMA 5LXXA 3WJWA 2PC8A 4NI3A 3DGHA 2VX4A 1UHVA 4QE4A 2PGEA 4H4PA 3GFXA 4QS6A 3FVDA 5AOUA 5F7UA 4UTTC 1Q1WA 3NG3A 3WFLA 2PDGA 4V33A 3ZJKA 5DMMA 4WSJA 2QCGA 1MEHA 2X1RA 1X6NA 3W1UA 1DWFM 5I3KA 2QPSA 4B4FA 2EO7A 2RFGA 5HA7A 2E1DA 5JCMA 2J7DA 3CJPA 4V28A 3T0TA 3V5CA 2E6DA 4YYFA 3PBVA 3EF6A 4OOZA 3AQUA 3E2SA 3EGJA 5AN7A 2E4TA 5D4YA 2OSWA 3VO0A 3SGZA 2WSYA 4DXVA 2BB0A 4PGLA 3GU9A 3EZ4A 4GMEA 4JQ4A 3TJXA 4EMIA 1EYWA 1PZ1A 3W7QA 3NIYA 1XYCA 2A7NA 4IMEA 5HULA 5TD4A 1E4MM 4O17A 4UR7A 2X30A 3OG2A 5DCDA 1TR9A 3G6LA 3LZ5A 4GRTA 5CZTA 1CXHA 3E6EA 5CZSA 4H9MA 1AQ0A 1VHCA 1VJIA 4KQNA 3R89A 3UR8A 1CENA 2GGGA 2X7WA 5D2TA 1JQXA 1QOXA 5GNZA 4WDXA 1OCNA 1FWCC 3M0MA 4BZYA 3M5XA 2HE5A 4IL0A 1VBHA 3MQTA 1XP3A 1DP0A 1H7RA 2OZ0A 5JH1A 3M7SA 3V75A 5KZMA 1XH2A 4HHPA 3UESA 1RBOB 1E5NA 1E5JA 1RBAA 2EGZA 4QX4A 3NAVA 1AMKA 3NS1B 4AWEA 3TCSA 1YDNA 3TVAA 1U22A 2NX9A 2XSXA 1V02A 3FJLA 2P3ZA 2BSLA 4LUSB 1GGOA 3GAKA 1FHUA 2DGAA 3OYXA 2CNCA 4CU8A 2EXOA 4ONVA 3GIPA 2V3BA 2ZRYA 2IQTA 4HQVA 4MJ4A 4QLJA 3OJGA 1JDDA 1GEHA 2QVNA 3TJIA 5H8MA 2J25A 4CQCA 3GR8A 1HJUA 3UPWA 1J8VA 1XYBA 4PEEA 1B3XA 1GHRA 3VDAA 5FJPA 2VZOA 3POCA 1ZBWA 7ENLA 3W87A 4M6VA 6ALDA 3WD0A 1W9PA 4AZCB 2PU0A 2PODA 3N19B 4J27A 1L9WA 2WVVA 2Q8ZA 3EOUA 4K8DA 3M44A 1KO0A 4HZ7A 4RDYA 5BZAA 1IZKA 3KCOA 3LCFA 5FL0A 5M17A 4CQAA 4XX6A 4WHBA 2GRTA 1A3XA 2WMKA 5DN1A 3KDNA 4LUSA 1FCUA 1HXJA 3CHVA 2A3LA 3G77A 5BOEA 3NVTA 3PR2A 3IIOA 3R2GA 4RNHA 4AF0B 1A0DA 3AXKA 1NDVA 2XVKA 3U57A 2WNZA 2EPLX 3WD3A 1UD8A 3A7RA 3TXVA 4LS1A 1N8FA 3KWSA 2HPIA 2NV9A 4QROA 2G3IA 3ONCA 4EQXA 3OG3A 3NZ1A 4GGBA 2HBVA 4C5YA 1KFBA 2CKRA 1JCLA 5GRTA 1JYWA 4N02A 1H1YA 3NQ2A 2PWGA 3S5YA 2WBKA 3PUDA 4PA8A 1EPXA 4IFOA 1QPKA 2BXYA 4N42A 4RZ6A 4MYXA 1YNYA 5CJNA 1CXIA 1BVWA 2PEVA 2XGZA 1TPDA 2DJLA 5A6BA 2A3HA 3DFHA 3WZ0E 1LTDA 1Q7MA 1KM1A 3SQMA 4PCTA 2VNCA 3VD9A 1OC5A 2HS6A 2XFYA 4XSLA 2HQMA 1FDYA 3PJTA 3TTQA 1SGJA 4QS5A 1OFBA 2DORA 1HFBA 3E0WA 3EA3A 3M0XA 1DHPA 3ANYA 3AIBA 1L6FA 4Z2KA 1HG3A 4H6QA 5AHLA 4S2CA 3M0KA 3ZZ1A 3DJJA 1W9VA 5G5HB 1I2OA 5CPSA 3WDJA 1XH1A 2ASHA 4NUWA 2FZ9A 1OJXA 3PSWA 1JZ3A 5LKYA 2J24A 5LIWX 1SO5A 2IUZA 2GQ9A 2VZSA 3PPFA 3N6HA 3C0LA 4OVXA 1W37A 2J88A 3DERA 1AL7A 2YPIA 3BSHA 5F1UA 2OYLA 3NO3A 1QI4A 2E3ZA 1YTDA 1KM4A 3S9YA 3BCFA 4G6CA 2VEIA 2VL4A 4LCQA 4OECA 2CDUA 3BAYA 3RYSA 3CXBA 3SN1A 3P6LA 3P80A 1NHSA 4JIQA 5HWJA 5HBFA 3LCWA 4JOMA 3AMLA 3MSYA 1R9ZA 1LYXA 3ZFHA 1U1UA 1VCVA 1E51A 3WK3A 1RZMA 2FGBA 3AMDA 3BJFA 4UXDA 5EBUA 3A3WA 4MJMA 1S3HA 1GOXA 3IANA 3LPOA 4R3UA 2FQIA 1JYXA 1FWFC 3BANA 3P93A 1F76A 3PWIA 1QNSA 3WSUA 3TV8A 2CC0A 3L2IA 1MVYA 4F0RA 3PC0A 3PPCA 4DVOA 3OGSA 2EQ9A 4AIBA 4G8TA 2D20A 4C6FA 1E72M 3NDYA 1KXHA 3T78A 2NVAA 1Q6EA 3DH9A 1N8WA 2BDQA 2CPUA 4TVWA 1TPH1 3EWUA 3ITLA 1W1VA 5JIWA 1OINA 3H24A 3CUHA 1M01A 3VIFA 4C7FA 4I7VA 5A6AA 4NU7A 5G4HC 4AMCA 5G2IA 3FEMA 4I5RA 3GKAA 3VZZA 1ISYA 5I5RA 3DFSA 2WO5A 4S38A 1EO5A 4RV8A 4UTLA 3TQ0A 3HZ3A 2NSXA 3SUTA 4FIRA 1DIEA 1GEQA 3N14A 4F66A 3N2MA 1LDCA 3EX2A 4H83A 2DZTA 3TYEA 2DIEA 4AZIA 3EAUA 3CUJA 4FOUA 1I60A 2XZ7A 3KP1A 1LLWA 8XIMA 3C2EA 1TWDA 3S5OA 5D2WA 3KBMA 5EBKA 4QHRA 4Z2JA 4LJ3A 3ITTA 5C55A 2QCCA 3L5LA 4YL2A 3C4UA 5D05A 4ACZB 2V63A 1BWLA 3GQYA 2V3AA 1Q13A 4V27A 3WF2A 1I1XA 4AZHA 3WEZA 4AVFA 1LWIA 2AMXA 4IQJA 3GK0A 3T4WA 3ELFA 3RG6A 1S5MA 5J04A 4CNUA 5C7HA 3L5AA 3L4YA 1IEQA 3W7IA 1NWTA 3PNUA 1L6YA 1XIIA 2GJLA 4Z1CA 1WQ5A 3BLIA 3LCHA 2QXWA 1K70A 2AL2A 6REQB 4NSBA 4AW7A 4DHGA 5TBOA 1G67A 3QR0A 2Z27A 3O07A 4YWSA 1PE1A 4H19A 3MT1A 3KRSA 1TX0A 1MFVA 4LB3A 4CU6A 3QGAC 2HRWA 1Y0EA 1Z6KA 2P8BA 1DQWA 4AEEA 2OZTA 2A3AA 2VCAA 4YCPA 1FUYA 1IEXA 1ZBCA 2OOFA 2QCMA 1V3HA 1M68A 2XGIA 3NO5A 4GZIA 4M7TA 5C2CA 5D37A 1AJZA 4EXAA 2ZC1A 3C86A 4JTGA 4R7JA 4HZ6A 2HZGA 2QUNA 2WP6A 5BRQA 1DHKA 2DT1A 2C19A 1EC9A 4W7UA 3B8WA 3NSMA 1UZHA 3FGCA 3DENA 3R0KA 1T3QC 2WVVB 3DHPA 4NNAA 2R6OA 1GQJA 1F3PA 3WD1A 1W3LA 1SR0A 2Y70A 4O1CA 1BYBA 3TYZA 4E4PA 3MHGA 3VOFA 4L1GA 3GDRA 3EOSA 1E71M 4J2PA 2B0MA 4LBRA 3NQDA 3QH2A 1HJXA 2QMJA 5LGXA 2F2HA 5BWAA 3REQB 3VC6A 1R46A 2OWCA 1TPFA 5G5GB 3MI2A 1IWPA 1UC5A 1LM1A 1BVZA 3AHVA 1PV8A 4KIRA 4NJIA 5JCNA 3MWAA 1VPYA 3LXAA 1GRGA 3KE0A 1SR9A 4IIBA 3FIGA 5FESA 3OYZA 2VR4A 2XPKA 2DT0A 2OT1A 1JCNA 2FPTA 2WSKA 2PWFA 1AQFA 1F61A 4PSRA 4ROPA 1W3NA 4X2RA 5JCLA 3PNZA 3MW7A 2QQ6A 3OODA 4MDOA 4MB1A 2J27A 4R34A 1K77A 1HO1A 3QZEA 3RU8X 1WBJA 4XD4A 3UZWA 1YNQA 2JALA 1KFWA 2PRLA 2PA6A 1ZAHA 3BJTA 3HTWA 1PZ2A 4U10A 3M5VA 3W2KA 3OZMA 4OBRA 2GZXA 3WH8A 2I9EA 2REQB 2E67A 4ZQMA 2NQLA 2OZ3A 2CESA 3TYBA 2DIKA 4EWND 3IGHX 3L9CA 1GKQA 4D6GA 5EL1A 4H7CA 3AC0A 4Y9AA 3E0LA 3TK7A 4ZENA 1PWLA 3BCDA 2A4AA 3RILA 3HBLA 4M1RA 4CN4A 4HJWA 5FF7A 3G0XA 2OQLA 4UOZA 4HHHA 4UWMA 3GBDA 4ZTXA 3WNNA 5ECVA 3V0SA 2HNHA 3FSTA 2XDFA 1R3WA 5DQPA 3S47A 1QI0A 4NKCA 2C0AA 3M64A 1A49A 4GX9A 4KW2A 4H00A 4UQEA 4GC3A 4H6KA 5EMUA 1X8FA 1S5VA 1W5OA 3BW2A 1A0EA 3N6QA 3FLUA 3IJIA 1FWHC 4HNTA 4FR1A 1PX8A 3EYPA 3GHSA 4L6OA 1H0GA 1ONWA 1OX6A 4JD4A 1LT8A 2V69A 3RO8A 4GYPC 4JTJA 3T2PA 3TN5A 4BY3A 5CJ5A 2GR2A 3ITCA 4DEFA 1XGZA 4LAUA 3CIVA 4JYDA 4RZ5A 3ONBA 3VNMA 3AWOA 3N29A 2OGJA 2TPRA 2CLLA 3S1GA 3UR5A 3G22A 3S8HA 2BGQA 1GJUA 2AL1A 3T07A 1I75A 1KBKA 2AGTA 4A3HA 3F1QA 4IPJA 3QYQA 1SZEA 3W1QA 1EF2A 1Z8AA 3K30A 5HXMA 4DWSB 4ZSUA 2QIIA 1MYRA 2R91A 1Z9AA 4FX6M 2VVSA 2R9RA 4H9XA 2REQA 4GYJA 5AFDA 3LTSA 2WOWA 3LX9A 2WCSA 3UXIA 2ZVRA 3UGVA 5TQLA 1YDVA 3ZVHA 2J74A 3BC9A 4U3AA 3N12A 4GA8A 2WXDM 2BS9A 4HPNA 3OC4A 5CZKA 1TJ1A 4XV0A 2E3TA 3TSMA 3MMTA 2F9RA 2VC6A 3FAWA 1I0BA 4H8HA 1V3IA 4L9XA 4I5XA 1R38A 5EFFA 1VPQA 3E2RA 4ZXLA 1BVNP 2R1KA 1UP2A 4NRSA 5FS6A 1S5NA 5D03A 1DBTA 4PMRA 1IR1A 1XSIA 3R5EA 1QUMA 2ZZ5A 1M6IA 1MRAA 3FJ4A 2PDWA 4MNJA 1UJPA 4JHOA 5T91A 3MO7A 2OYMA 3BURA 1M41A 5CC3A 2FB2A 3F4VA 2FMNA 1KQYA 4TIMA 1OGGA 4JTEA 1YQ2A 4AXKA 3I6TA 3QOMA 3AYVA 4LA1A 3I7QA 1NU5A 1KCLA 4KEUA 2NT0A 2VM8A 1T8QA 4ZB5A 5E09A 3M41A 1FWTA 1G01A 1OG6A 2W92A 3ZJ6A 1BQCA 3G24A 2A2IA 4MJZA 1Q63A 2NUXA 4PCSA 2CEQA 2ZX6A 1A3HA 4X0VA 4P8VA 5I07A 4GKTA 1YXCA 1GVOA 1NOUA 4QSHA 1ZKQA 5CJMA 4MWAA 2EHHA 3P0WA 2FB3A 2UWFA 1B1YA 1N61C 4OHQA 3VKAA 4Q4MA 4FLOA 4MJ2A 4XO6A 3R12A 1YIXA 3WQWA 4IGHA 3PAOA 4K38A 5ECUA 4FB7A 9RUBA 2YAUA 3IVTA 3HPZA 3CO8A 1QCWA 4H2CA 4ZQCA 2WC4A 2DSWA 2WZTA 2OR2A 2HXTA 4MWAC 3WNKA 2HSAA 1TWZA 3ZIZA 4KIEA 5FMHA 2FHFA 3H70A 3T8LA 2XM2A 4ZE5A 2GH5A 1YE6A 3EB4A 4LUIA 2JK2A 2ZX9A 3NZGA 3FHQA 3SCVA 2YVGA 2O55A 4I3GA 3R58A 1MNZA 5DY3A 1ELSA 1G4SA 4JCMA 1WDSA 1BAGA 6A3HA 4XG1A 1E0XA 4WDUA 2WYSA 5FD0A 3FKKA 5FEWA 3FKRA 4K8HA 5DRCA 2WQPA 5BXTA 3WF1A 1DPMA 4HA3A 1X7FA 3W9ZA 1X98A 3NL5A 3DCPA 4M7SA 1OYBA 4EK7A 1ZL1A 1FHVA 1VF8A 3PBGA 1UOKA 1UYQA 3WLSA 3CWHA 5CZ0A 1SU5A 2NZLA 5CPLA 4RNJA 5EA9A 1N62C 3SSZA 2DU2A 4AB4A 2VX5A 5FJUA 4HYWA 4NZJA 5JBEA 2CLMA 1JAKA 1QAPA 1ISZA 2QZRA 1RCXB 3CEUA 3QKZA 3ZR6A 3AROA 1TA3B 4O8RA 3W7EA 4E2BA 3PTQA 5EY5A 3N34A 3NSXA 2WHLA 3CASA 1Q6QA 4WKAA 2E28A 2EF9A 4DPPA 2PGWA 4FXFA 1SQ7A 3EWBX 2EAWA 4YTQA 4P61A 3AS0A 3S6TA 1ECQA 4PE8A 4Q8QA 4E3VA 1TVLA 4Q8PA 4J3XA 2G3NA 1VC4A 1B0IA 2YIHA 4NHVA 2QJIA 3RK8A 5FIPA 2XFWA 4A8RA 1CDGA 3MHUA 2ZTKA 2D0HA 2PZ0A 4UZUA 4K39A 1ZLPA 4HPHA 3P5YA 3WK0A 2OWXA 2W79A 4JX5A 2D0GA 3BLLA 4HPJA 2NXGA 1B31A 1UPMB 1DV7A 2VENA 5I7GA 1Q6LA 3TROA 4YTUA 1YQZA 5F4WA 5REQA 4DJFA 4C1NB 4L6HA 4FA3A 5CPOA 1XF0A 1EDGA 4GJIA 2EQ6A 1GW9A 1XLMA 4JQAA 1MFUA 1CGTA 4JTTA 4LYPA 3L12A 1OIMA 1Z32X 1UR1A 2C3ZA 1OC7A 4JFSA 4J3TA 3MDUA 4HCHA 3STCA 4Q8MA 1EYEA 3I6EA 2CLIA 1FH7A 1JZ5A 2PBGA 3LQGA 2GVLA 4AC7C 5BXRA 4XD5A 4QLLA 1TRDA 3CMGA 3S5ZA 4N2YA 1Q2RA 1H7XA 1W5NA 4N9BA 1SMAA 1Y5VA 3SZ8A 1GJWA 4AXNA 1CXLA 3RX3A 4B5VA 1TTQA 1YBQA 4G1NA 2QAPA 1B3VA 1TX2A 1OIFA 2J13A 3URNA 4CVUA 2GGIA 4O8AA 1KM2A 4XIMA 3M47A 4HU8A 3N73A 1DJIA 3LG3A 3NPVA 2FHCA 1N5WC 4KESA 4QDPA 5CH9A 2QCNA 4GE8A 1X7IA 3PBMA 3LUTA 4M0XA 2F5ZA 4X63A 3UR2A 2ISDA 1V08A 2VMFA 1HGYA 3QLDA 1Q6DA 2INZA 2XIOA 5MKGA 1VBUA 3CTTA 4JL2A 4EPDC 3IK2A 4BURA 1HNYA 3B4YA 1IZCA 3LPFA 1KM6A 1JPKA 1OCJA 3SECA 4KWOA 3S2CA 1XH0A 4RXGA 4FOJA 3DHDA 4UQAA 1D8WA 4GFSA 4C6LA 3L5OA 2J8TA 5BRBA 2YDQA 4GJ1A 4RE4A 1DWAM 2V5DA 1K4GA 3TQKA 1LP6A 1Z69A 2QEZA 2CU0A 2DQXA 4LT9A 4A3UA 3SUWA 2QYGA 3RX4A 3W7MA 2EG6A 4GI4A 1UKQA 4UTFA 2FYMA 2ZXBA 4U4MA 4TVCA 4C6EA 3V0TA 5FS9A 4YMZA 2B31A 3MV11 1UWRA 1W1ZA 4Q22A 2J7EA 1KCKA 3M5YA 2PCQA 4NI8A 2C1HA 3G1XA 1JAEA 1FCVA 4DJDC 5GPRA 1QW9A 3O9NA 2WAGA 3CTLA 4QITA 3ZT7A 4AFYA 1N2VA 2HK0A 2PTWA 2E6FA 3USZA 3B9EA 3ZO9A 4DWSD 4AIOA 3SCOA 4DUVA 3EX6A 4GWEA 2OT0A 2E40A 5A8GA 3VCNA 3W7KA 5LYRA 1WBHA 4MMWA 3WUBA 2XIBA 3GIYA 4ZOCA 1EBGA 2GGEA 5AYIA 2IXUA 1VJSA 3B0PA 5CXPA 4QE5A 4UUIA 3WMBA 3HB9A 3MI3A 4I8YA 4QIUA 3IRSA 3MB9A 3IAQA 4MF4A 4A35A 4OUIA 1ZPTA 1WE5A 2ZZ2A 1F4AA 2P1FA 4ORMA 1JQVA 1DXEA 5LNUA 2XIQA 3WEOA 9XIAA 4IJCA 4JIHA 1AH0A 1I9CB 3C0JA 1H2IA 4Y8FA 3TDFA 1I2PA 4XVEA 3URQA 5A6MA 4MNKA 4S23A 4DWDA 1YTKA 3T8QA 2W3ZA 3FJ6A 1JF5A 1C93A 4LAMA 6CGTA 3MY9A 4O53A 4FIQA 4X9SA 3U6WA 3TLQA 8XIAA 4NVTA 2DV0A 1JDEA 3VMOA 4X9YA 1FFQA 4KGLA 4BF5A 1Q45A 2BY1A 4C1NA 3LI0A 4JQ3A 3AIEA 4RCXA 1J93A 4AHPA 1R8LA 4K3ZA 3K4WA 1XDMA 2VWTA 4H9VA 3GVWA 1GK8A 3GD4A 1P0DA 2BP1A 4B5UA 3M16A 4A3YA 8A3HA 1XXXA 3KVLA 4S3FA 4H9ZA 4FXSA 2ACUA 2X8CA 4NG3A 1VB9A 5E0FA 3UCCA 1E4IA 3IARA 3RPDA 1TG7A 2OOGA 1K8XA 1OFOA 3LHTA 3MBFA 3AWNA 3BWWA 5CPNA 4K7ZA 2J9ZA 5H8UA 4L6DA 4PRRA 4MVAA 3GC5A 2FFIA 1OX4B 4R7WA 1FFVC 3EKZA 4L64A 2PBOA 2ZZCA 2GYIA 2VUYA 3M7WA 1TFVA 2I7GA 4XZHA 2XFRA 4HOXA 3VUPA 3UA3A 3P81A 3ZLGA 4DB7A 4JYEA 3A24A 4RK8A 4HMEA 2PDBA 4W4QA 3M0LA 2QDDA 3PZVA 1IEVA 1EUNA 2QCLA 4GD0A 1UMLA 3H2OA 3NYDA 1F8IA 4GIEA 2POZA 1UROA 2C3CA 3UJRA 3GNDA 3W6MA 2ZKMX 2YR1A 2XH0A 3EXTA 5B7YA 1PTGA 1N55A 3ZJ7A 4E2OA 3BZGA 3QYSA 3ZOAA 2FTYA 2JQXA 1V0MA 5CSYA 3NEHA 3QEZA 3UERA 3GRSA 3P61A 3E96A 1EHAA 2DVUA 3QQ1A 4L7ZA 3S1WA 1W1YA 3QY6A 3A64A 5I23A 2WM0A 3PANA 4PUMA 4GO8A 1I0DA 3SRDA 4EOUA 4UR8A 1ME7A 3LNPA 2NUWA 1CX9A 1CGYA 3GXTA 2VVNA 2WNQA 2OQHA 4MPKA 3VMNA 2PPGA 4OE7A 1Q8JA 2DW6A 4LANA 3WENA 3VCCA 2VFEA 1VPXA 3CXOA 3B3DA 4KRUA 1TJ0A 3KLKA 3PB2A 3M1ZA 2BY2A 4HPGA 5LIKX 3DESA 4Z08A 4M80A 3VX0A 5GVJA 1MRQA 4EAYA 1S2UA 1B3YA 2WW5A 4MPQA 5CPMA 3QSTA 4CCDA 4LVAA 2Y61A 3O3RA 4J3WA 5A2AA 3VIJA 4H4TA 2PS2A 3EANA 5KVHA 4H2HA 2W4XA 4RL3A 1GT8A 4TR9A 1QPOA 2Y62A 4N9CA 4M6QA 3RR4A 2CZFA 3NGFA 3PTKA 1XLHA 3F4DA 3N1AA 3LM3A 1VZWA 3QGVA 3H2EA 1XIHA 5AC7A 1X1NA 2V3DA 5FS8A 2KX9A 4JTIA 2QCHA 3KOZA 3MUCA 4V15A 3VIHA 1OBAA 4CNSA 1JZ7A 2PC4A 3TSDA 2MNRA 4O13A 2DH3A 4LYRA 3B04A 4O1DA 1R86A 4H4WA 4M29A 3HF3A 1BWCA 4WEVX 2BY3A 4GI6A 4GY7A 3ZMRA 1RJRA 4AQLA 2VC7A 3VILA 3DIPA 3LENA 4JN6A 2OYKA 3LNMA 1V3LA 4JIRA 1AL8A 4IPLA 3WUGA 4ZO6A 3LI1A 1X1ZA 4Q4KA 3A7AA 1ME9A 1XBYA 5DT5A 3FOKA 3W7HA 4B5NA 4EKJA 4TX6A 1UR0A 4JYFA 4PTNA 4MWAB 1TJRA 3IJQA 3TMQA 1KTBA 1PWMA 1JJKA 1R47A 2HXUA 3W02A 4NJKA 2J9XA 4GQ0A 3QN3A 1A50A 1KCZA 4NZCA 1RPXA 1W1PA 3T2QA 4ZEPA 2VDGA 2WMIA 5D38A 3A3XA 3P0XA 1K4HA 1TV5A 4D2JA 1UWTA 4LVDA 4H9UA 4WGXA 3NQMA 3DK8A 3LEPA 4LBSA 1Z44A 1LBFA 1JPMA 1ZJBA 1XLLA 4IP5A 2F7FA 3GYCA 4GQRA 3A22A 3O0HA 2P8CA 1TTJA 1RBLA 3NL6A 4KRZA 3B05A 1BF2A 2WC7A 3P67A 1AQHA 4OKDA 1GOMA 4M24A 1K02A 2GJXB 7REQA 1OEPA 4MHBA 1RQEA 1US2A 1W9XA 4W85A 4MYAA 1RK6A 3HG4A 1BZLA 2VGBA 4Y9NA 4UFKA 4IHCA 4UQ9A 3C2VA 2DZPA 1QXLA 2WOQA 1GOIA 3LCLA 3BAKA 4RNFA 5AHFA 2O0TA 2FTPA 5C2XA 4NILA 3SCNA 4DBUA 3KZPA 5CGMA 4G7FA 3GXIA 4IP4A 1KLZA 2PMQA 3VPLA 3CQKA 1JDAA 1TE6A 1IQ8A 4H04A 3TFXA 1DOSA 5HNRA 1R9YA 1UR2A 2DUXA 4PSPA 3I3EA 3HQOA 4RE0A 2ANUA 1C8YA 2CLKA 4EAMA 1L2UA 1QPRA 3SRFA 4LS0A 4AVNA 2GR0A 2VCBA 2QJGA 4NJGA 2D73A 3A13A 4PB4A 3NVZB 2WANA 4PMVA 4DZIA 2Y24A 1FTXA 5H6HA 3ARPA 5AYXA 4GUIA 4ERAA 3AIRA 3BH4A 1MDRA 1AK5A 4JNMA 4C6JA 3TNBA 4WOZA 1YKWA 1KQZA 1A5NC 3AS2A 4MSSA 4UMCA 4BA0A 3QKEA 1R3QA 1ICQA 4P7OA 2NSOA 1WX0A 2E6AA 3LOTA 1SUXA 3BMXA 4MB4A 1R5YA 1GREA 4ZFCA 4LRSA 3QJAA 2ADAA 1XG4A 4R9XA 4QAWA 1LL7A 3H2FA 1XIDA 5KVIA 2W6RA 3AUJA 1BG9A 4F3HA 2WMIB 3WLNA 4HOWA 2Y2WA 3CK5A 1ONFA 1W56A 3PAJA 3GUWA 3RXZA 3CB8A 3JZEA 2C18A 1IT7A 4Q6JA 1TA3A 5HNUA 2RHGA 1GRBA 2XWDA 4L56A 4IG2B 2ZWYA 3NYZA 4E38A 3LK6A 3C3UA 4PTWA 2RDTA 3EUB3 2WZIA 3HURA 1CNVA 4DO7A 1QMLA 1VAHA 2A6LA 4W84A 1OX4A 1CCWB 2E7FA 3VVGA 1B5TA 4JIIX 1ENUA 5E0CA 5CKSA 4ZO9A 2VFHA 4JFUA 1R2SA 4J5NA 2CITA 4FSAA 3QZAA 4IPNB 1TPB1 2VFGA 3A9BA 2NPXA 4IICA 4WY0F 3SFWA 2Y63A 5E5CA 3CGBA 3LHZA 3CHDA 3FCPA 3NTYA 3C3NA 3LB0A 3SJNA 3LV5A 1IT8A 3U7VA 1RP9A 8CGTA 2WZMA 3CZKA 4LB4A 3S2LA 4Z0SA 1V6XA 2AKZA 1RCOB 4WR3A 3S2NA 2GFTA 5DLCA 1H4PA 1V93A 2D23A 4G5DA 3QFEA 2YYUA 3BG5A 2ATMA 2YB1A 1V79A 3NO1A 3KLLA 3HN3A 2ZUVA 2CXEA 1WYGA 4DELA 1L8PA 4P7QA 4U3CA 2C14A 2UZ9A 5HQEA 1PTAA 2WPGA 3EEGA 5CSUA 1XCWA 1HKWA 4HZMA 3LA4A 3E5PA 3H2MA 3SR7A 1LLOA 3IJ7A 3D3AA 4L61A 3SRKA 1XDJA 5I79A 2W9MA 3PPGA 3WDHA 1THFD 2QCDA 1JYVA 4Q7NA 5G1YA 2J7FA 4FNQA 2ZX7A 3L4XA 2X1SA 1CTNA 4OV9A 1TYTA 1TPC1 3NQ8A 4QTGA 3GSMA 1T96A 2W63A 4WF7A 4Z2GA 5ER0A 1TO3A 4JQ2A 4B5WA 1FOBA 3TONA 2FHBA 3ANVA 3TE9A 4EQWA 4MFEA 4AZ5A 2QV5A 4JN7A 2ZA3A 5E93A 3BMWA 4S3BA 5KMYA 1PAMA 1GHSA 1DXIA 5LNVA 4IXHA 1HT6A 3QPZA 1A5MC 1FCQA 3POHA 1AMYA 4H4SA 3S42A 4ECLA 3URBA 3AZRA 3F5LA 2TSYA 2AL2B 1YX1A 3DFQA 3N9SA 4RXFA 3B9JB 3STPA 3RFAA 1DTUA 1TWIA 3WFAA 3YPIA 4QJ5B 3WQDA 3URAA 3AISA 1VD6A 3AS1A 3GW0A 4H4RA 1C90A 1F05A 5IM51 1V7YA 3QC3A 2YA1A 3LSBA 3GTHA 2XSBA 4CD5A 3NQVA 3HJEA 3R4IA 3EB2A 2I14A 1W9DM 4JZ5A 2OSXA 2PB1A 4DBEA 2NWRA 4XZWA 3BE7A 4C6IA 3ITGA 3IGXA 3S2MA 1HUVA 4BCEA 4I9TA 2DPEA 3W7OA 2YDSA 1TV7A 4NAFB 5A6SA 5M5DA 3D6NA 2D2OA 2CLPA 3LHVA 4QSFA 2HVOA 1UQYA 4LAKA 3PJUA 1PKNA 3MUAA 3D47A 4E8DA 2ACSA 2WMHA 3FA4A 2XVLA 2MUCA 1KBJA 2Q8LA 2A1YA 3G5EA 2Z25A 3IPWA 3L2LA 2C7FA 4CN1A 4U28A 3BL3A 2QW5A 3CZEA 1R7AA 4IG2A 1EBHA 4WLCA 4AD2A 3ARWA 1TMQA 1TWWA 3WL1A 2CFFA 1EUAA 5L6UA 4AD1A 3D0CA 4REQA 4CU7A 2ACQA 1NM9A 2V3FA 4OIFA 4IIHA 4P8XA 2E9MA 1LZOA 3TYDA 2CZVA 1EOKA 3QXBA 3DI1A 2CHRA 1HF6A 4IIFA 3W23A 1JIBA 3UWQA 3TTOA 3G0SA 1UD2A 1UR3M 1S1RA 5IDIA 1JF6A 2JGYA 3KBWA 5GJNA 1UWSA 2NT1A 1BTCA 5F2MA 1AZ2A 1EJWC 3FYYA 4TVDA 3L67A 4G7EB 5JIPA 3BARA 1SW7A 4IQDA 1SW3A 1BGGA 7TIMA 1K9DA 1N82A 3LGGA 1JUKA 3MMDA 1Q1RA 4IX2A 3DEQA 3MC5A 4GACA 4YVPA 1QOPA 4I90A 5F2GA 3AHYA 2WKGA 4C1LA 1ITXA 3P2VA 2V5JA 3BSMA 4CQBA 2H6RA 2WBGA 3VGFA 1GEUA 1SZNA 2XN1A 1P5BA 3NOYA 2AAAA 4YYCA 5DT7A 4YVXA 4TV6A 3LLDA 2VQTA 1QFEA 3VXGA 4A3QA 2DZXA 3N3MA 4AWSA 2PDJA 3TR2A 2Z1WA 2JFEX 3GXPA 4PUWA 4F0LA 4AD0A 3AYSA 3M07A 1YEYA 2C79A 3NZPA 1NH6A 1CYGA 4NL1A 3W1XA 1JCMP 4WCJA 3QY8A 1TTIA 4S3JA 1EJ7L 3Q65A 2QAFA 2IQ0A 3DGRA 4CVWA 3CS2A 2OMAA 3PZUA 3BQ6A 1W8SA 4LRTA 4AHOA 4XTIA 3AYRA 2RJGA 4XZNX 4INFA 5U4NA 4EX4A 4ML9A 1W5QA 1X1OA 1EDQA 1UR4A 1XICA 1NQKA 3IJ6A 1EF3A 3QFAA 3UJEA 1X6LA 3INPA 5CBBA 1UD6A 1XLDA 3OIHA 1F3TA 3KCJA 3VC5A 3GWQA 4M1BA 4IGNA 1JULA 4N0RA 1QPNA 3AHXA 1W3JA 3B0UX 1GPFA 2BTMA 4NY2A 4GUGA 3GNRA 1X38A 2VEKA 4AG0A 2VWSA 5IXEA 1X2GA 1XGEA 4ZSTA 3AU2A 3EB3A 3IVSA 2E8ZA 1HTIA 2C6QA 3VFLA 4R88A 1TYGA 1Y8BA 4GINA 3QFWA 1PB0A 2A7RA 1UKTA 2ZZ0A 4QXIA 1Z3NA 2J4GA 2HDJA 3T09A 1Y5XA 3ARYA 3PS7A 3WQ6A 3RHGA 2FGLA 3VUSA 4PCNA 4HU4A 2VYOA 3D46A 2WZHA 4AZCA 4GYPA 3GC4A 2XTKA 2J7CA 4DIAA 4NZ5A 4GIRA 1VS1A 1FKXA 2WM1A 4GNVA 1GRHA 3MYPA 2Y85A 3SIZA 3GG8A 3ISIX 4H4QA 4R5EA 1ADDA 2J78A 5I06A 1V5XA 4ZTYA 1H62A 1K03A 4J9JA 3SUSA 3VD5A 4PYSA 1GYLA 2PFHA 3DG3A 5DMLA 4QAIA 2YCIX 4RKAA 1P48A 1OFDA 2Y8UA 3CGDA 2Y88A 3RM8A 1PEZA 4B2DD 3EDJA 1XYAA 5I2UA 5G1TA 1XGDA 1XIGA 1WXZA 1XLAA 4JBRA 2AQOA 1FEBA 2QUMA 3ANUA 3FDKA 1S2WA 3MV01 1RPKA 2HWGA 1GV4A 2DY3A 1GORA 2PP3A 4RPPA 3LCIA 1KBLA 1HGWA 3B8IA 1W32A 2NX1A 3Q37A 4MAVA 4HA0A 3WL0A 2PDMA 1JDFA 2ZZ3A 2V5CA 5DRIA 2WHKA 3XINA 3CV7A 3TC3A 1IGSA 2ZUUA 1TRIA 2BVWA 1T7LA 2PLKA 1L0PA 4J40A 4DWSC 2FZ8A 1XC6A 2RJHA 3JRKA 3R0UA 1QU4A 1I2QA 5HPOA 1EQCA 5LIYX 2DVTA 1OJTA 1TPWA 4LGXA 2PTZA 3SGGA 2J62A 2X99A 3AUOA 1GTEA 1PIIA 2GJXA 3CPRA 4AYSA 3B4UA 4M3PA 4APNA 4IQLA 4LW7A 4DBWA 2Z2UA 2WVTA 3MP3A 1ZHAA 5HAOA 1FO4A 4RDZA 1CLVA 3HJZA 4CLMA 1H50A 4OV4A 2PCEA 1MW2A 5HJLA 1E6QM 1XX1A 3PZNA 2RKXA 1YDYA 4Q4SA 1VFHA 3I7RA 3CU2A 1YLVA 3W1RA 1DJWA 1JI2A 3EWXA 4FF5A 4GQQA 2ZOXA 4X2PA 3VZYA 1H7OA 4E5TA 4FR6A 4W8LA 3KBSA 1M7JA 3ES7A 4JQ1A 2O9OA 3SSJA 4P5UA 3GNPA 1XISA 3DH7A 2VKZG 4GH1A 3VMPA 2R8WA 4XKYA 2DSKA 4DYJA 3B8TA 1VFOA 2W67A 1MDLA 5C7VA 1NDWA 4BI7A 3PG8A 3RGTA 3T0AA 5K9XA 7CGTA 8RUCA 3MUXA 3KL5A 3E2VA 5D9MA 3JU2A 1SW0A 3SUVA 4ML4A 3NWRA 4ZL1A 3L68A 2EPHA 5A6LA 2X1TA 4GY1A 3IIZA 2C71A 4H4IA 4HCDA 1DJNA 3MJYA 5C9RA 4D8LA 2E5BA 1WZMA 4BR1A 1GUVA 2YYTA 4J57A 2B81A 2OEMA 3H4KA 4H50A 4WOQA 1EIXA 4GZJA 2YCJA 4IIGA 3DFYA 4DX3A 2GVGA 3OW1A 3HQ1A 2OLHA 5KINA 4JTSA 4DNAA 1V6TA 2QCEA 3IVUA 2PGFA 5LHEA 3ETRB 3KW3A 1UBSA 1V0KA 1HP4A 3VD4A 4US6A 1H09A 4L9ZA 4DNHA 1OF8A 5JRBA 3WUFA 4KCVA 4ZZ9A 2JKAA 3CUGA 3L4TA 1AVAA 5FL1A 3WFZA 1GOOA 1XSKA 2WWCA 3MP5A 5HMSA 3V0UA 1FVPA 4MM1A 4JY9A 4UFLA 4IOTA 2ZUTA 3HO8A 1NAL1 4ZQOA 3SUUA 4LF2A 3GVGA 1PYMA 1OG0A 5JCIA 2WLYA 1WKEA 4WD0A 4W5UA 1GETA 3DI0A 4UQCA 4B5TA 1DWIM 3WNPA 4WJXA 1H49A 5FSDC 5HNTA 5LA0A 1WDDA 2BWGA 4QP0A 2YXXA 3B9NA 2Z29A 3L4UA 4GQBA 2V38A 4Q4PA 3M5ZA 3N2BA 3SJ3A 4JGDA 3S5SA 1WDPA 1B4KA 4FNTA 1JZ4A 1S46A 3S83A 2HMCA 4KWWA 3NM3A 4XZ9A 4ZB2A 3CGEA 4PUJA 5LHFA 1DJYA 4AIUA 1V8EA 1E4LA 3MZ2A 3QVQA 4HU3A 1VBRA 3CAQA 1V3MA 2ISSA 4PN2A 4FXRA 4ORIA 3SCQA 4DPQA 4JTLA 1TB3A 1DIDA 1KCXA 1IXOA 4Q7IA 5ABEA 4ICNA 3WNMA 2Z1XA 3ARVA 4XTDA 1JXJA 1E9ZB 4HHLA 3DC8A 1NTHA 1ZB5A 3UCDA 2YJQA 2NQJA 1V51A 3PZQA 3EX3A 1C8QA 1A4MA 1OZMA 3DC0A 2WKLA 5E0KA 3SN0A 1SPQA 2WZEA 5FF0A 1UJQA 1WUEA 3U4FA 2ZUMA 3P82A 4ACZA 1E6XM 1I45A 3MVIA 5J5DA 3AZSA 4Z1AA 3NL2A 2CXGA 3WDIA 3OLEA 4LTSA 3SAZA 3W7NA 1OYAA 4XISA 3TW9A 4U33A 1P4CA 1KWKA 2O9TA 1L6GA 4GX8A 1OT1A 2QF7A 5MKGB 4JQ9A 3GDBA 3TWBA 2MANA 2GSHA 4HK5A 4RZBA 1C8XA 2E5DA 4WK9A 5EMYA 2QIWA 3CV1A 5D8ZA 4OFCA 1ITCA 3NFUA 4FAMA 3HGSA 3ZVHB 4IPIA 1RH9A 2AAMA 1H7NA 4NF7A 2CETA 1CGUA 4Z2LA 3RU6A 4FALA 3G1AA 3CBWA 5EB8A 4ZBCA 3GH4A 4KMQA 2OU4A 4O0ZA 3W7DA 4CEXC 1UKSA 4GUHA 2FIQA 4AD5A 2XH2A 3FEQA 1OD0A 1ZJAA 3ERPA 3G0UA 2XG9A 1J01A 3LCGA 1