3QPEA

Crystal structure of galacturonate dehydratase from geobacillus sp. complexed with d-galacturonate and 5-keto-4-deoxy-d-galacturonate
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
385
structure length
385
Chain Sequence
LNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title Crystal structure of Galacturonate Dehydratase from GEOBACILLUS SP. complexed with D-Galacturonate and 5-keto-4-deoxy-D-Galacturonate
rcsb
source organism Paenibacillus sp.
total genus 134
structure length 385
sequence length 385
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3qpeA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3qpeA01
3UJEA 2PTWA 1EC9A 1L8PA 3KUMA 3DG7A 3RO6A 3OW1A 4ZCWA 1EC7A 1EBGA 2QJJA 3SN4A 3V3WA 1ECQA 3OP2A 5BOEA 3FVDA 2FYMA 5FJRA 4KPLA 2PGWA 3EEZA 4DXKA 3MQTA 3I6TA 4M0XA 2MUCA 3CK5A 4E8GA 4HN8A 3DIPA 4JHMA 3QN3A 1JCTA 3QKEA 3D46A 3ZLFA 4DX3A 3DDMA 3QLDA 3ZVIA 3THUA 2AL2B 3S47A 3MKCA 2PODA 6ENLA 4K2SA 5FJOA 1YEYA 3U4FA 2OQHA 5IDZA 4M6UA 3VCCA 3IK4A 3OZYA 4JN8A 1P43A 3R25A 1JPDX 2GL5A 3H12A 1SJCA 3NO1A 2PP1A 3IJIA 2PPGA 3VA8A 3VC6A 3ZLHA 4ZA0A 3Q45A 2PA6A 1RVKA 2OPJA 2ZADA 3UCDA 3OZMA 3JZUA 3UJRA 1TKKA 3N6HA 4DYEA 1SJBA 3MSYA 1F9CA 2OZ3A 5ENLA 2QGYA 3NZGA 3V5FA 1MDRA 2CHRA 3MY9A 3VFCA 2O56A 2QVHA 4H83A 4J3ZA 1IYXA 3RR1A 3UXLA 3RGTA 4DWDA 3FV9A 3BJSA 4GYPC 3U9IA 2XH0A 1XS2A 3SJNA 3VCNA 3UGVA 4MMWA 3TWAA 4EWJA 3N4EA 2QJMA 4FP1A 3R0KA 3CXOA 3QTPA 3H70A 5J04A 2PTXA 1XPYA 3CYJA 2OVLA 3NFUA 1W6TA 1R0MA 3SSZA 3MWCA 4IP5A 3PK7A 4Z17A 3BSMA 2MNRA 2HXTA 4MGGA 4KT2A 3HPFA 3CT2A 3SQSA 2P0IA 3T6CA 1KKOA 4HCDA 4E6MA 4H1ZA 4A3RA 4IHCA 3P0WA 3JVAA 1R6WA 3FXGA 2OX4A 3JW7A 1ELSA 2OFJA 3N6JA 1ONEA 4A35A 4IL0A 1DTNA 1KCZA 4IL2A 3SN0A 4KEMA 3R1ZA 4GFIA 3UJSA 3T4WA 3Q4DA 3OTRA 2OLAA 4DN1A 4HYRA 3R11A 3MUCA 2AKZA 1E9IA 4HCHA 2OQYA 4ENLA 3TTEA 3DG6A 3MZNA 3GY1A 2P8CA 1WUEA 2PMQA 3TCSA 4HNLA 1NELA 3UCCA 4J1OA 2PS2A 3TJIA 3ZVHA 3IJQA 3ZLGA 3FYYA 4HCLA 3UJ2A 3QPEA 3VC5A 4IP4A 3I4KA 2OZ8A 1KKRA 3RRAA 3B97A 3RITA 2OKTA 2P88A 3FJ4A 4K1WA 2OO6A 4K8GA 4HPNA 2GGGA 3ES8A 3T9PA 1FHVA 2XSXA 3DESA 2QDDA 3H8AA 3EKGA 1MDLA 4X2PA 3R10A 3I6EA 1JPMA 4E4FA 2DW7A 3UXKA 3UJFA 3H7VA 4KWSA 4GGBA 4GYPA 2PP3A 2DW6A 2AL1A 2ONEA 2QQ6A 1MRAA 3TJ4A 3STPA 2POZA 1EBHA 3CAWA 3D47A 3PWGA 1WUFA 3TOYA 3GO2A 3DGBA 1P48A 3ENLA 4FI4A 4MKSA 2GGJA 2PU0A 3V5CA 2QDEA 4G7FA 2GDQA 2XH7A 4G8TA 5FJTA 2GGHA 2HNEA 2PP0A 3OPSA 3IJLA 2PGEA 3N4FA 4GISA 2PTZA 4F4RA 2P8BA 4HNCA 1MUCA 1SJAA 1EC8A 1TZZA 3FCPA 4IT1A 3ES7A 2AKMA 3RCYA 3P93A 3TW9A 3DERA 4H2HA 5FJUA 3DFHA 3S5SA 4A6GA 3CB3A 1JDFA 2HXUA 3PWIA 2HZGA 3ZVHB 2AL2A 2PU1A 3TWBA 4JN7A 5FJPA 3T8QA 2XH4A 7ENLA 3DFYA 4H19A 2OG9A 3GD6A 2PCEA 2GGIA 2NQLA 3GC2A 3VDGA 4Z1YA 1PDZA 2PTYA 1BKHA 2PSNA 1TE6A 1KD0A 3V4BA 2FKPA 4GMEA 2GGEA 4IZGA 3BOXA 3PFRA 1BQGA 1FHUA 2QJNA 1SJDA 4GGHA 4YWSA 4ROPA 2P3ZA 2ZC8A 3DEQA 2XH2A 4GIRA 4E5TA 3SN1A 3K1GA 4E4UA 2OZTA 3SBFA 1MNSA 5BOFA 3DG3A 4DHGA 3NXLA 1OEPA 2GSHA 2XGZA 3TQPA 2RDXA 2I5QA 3P3BA 3R0UA 5EU9A 1PDYA 1NU5A
chains in the Genus database with same CATH superfamily
3LCLA 1JYXA 4WJ8A 2V63A 3P0XA 3PNUA 2W63A 1EJTC 1TPVA 3PZVA 1HN1A 1FP9A 1EC7A 3G1XA 4C7DA 3SN4A 3P7YA 3GH5A 3QMTA 5ECVA 3QY7A 3S6TA 1XKYA 3DGRA 1EKOA 4DXKA 1BYBA 3KAOA 3O6AA 4HPGA 4ZQPA 3ARVA 2YJQA 3CK5A 4GZIA 5LNVA 5EL1A 4RDWA 4GYJA 1JCTA 4H04A 3QKEA 4DPQA 4PUWA 3O6CA 1GQNA 5FL0A 4IG2B 1RD5A 1XGDA 2WQDA 2R24A 3GKAA 5IDZA 1TREA 1Q6FA 1JYVA 1VBRA 2VDHA 3K8KA 4IJCA 1XM3A 3VCCA 4CNSA 2P10A 1FWHC 3IS4A 2L5HA 2BG5A 3U2ZA 1ZAIA 3S8HA 4Z1BA 3WK2A 3EX1A 2ZZ6A 4H8NA 1UWSA 2A7RA 2PPGA 2V69A 5CBIA 3VZZA 3B0UX 1GJPA 1GKPA 4UTJA 2E3TA 3F5LA 3U7VA 1OINA 4NUWA 3C2RA 1J12A 2X30A 5AKQA 1EJSC 5CPSA 5FL1A 1GW9A 2IPGA 4S3GA 1Z6KA 1VS1A 1RCXB 4N02A 1I2RA 2O7SA 5C71A 1XYFA 3SADA 5FEXA 2YOCA 4WGHA 2W66A 3QV8A 4MB1A 3ARUA 1S1RA 2G97A 3WBEA 6XIAA 2QCMA 3W6MA 3TNOA 2XFFA 4MVAA 2DVTA 2ZICA 4WDTA 3A4XA 1T99A 4NKCA 4BURA 4WJXA 3BJFA 3WBAA 4AEEA 1MXGA 3L4TA 2PF8A 1R3SA 4NAEA 3A6OA 1A53A 4R7WA 1KWKA 3O06A 2TYSA 3GU1A 1EZ2A 2ZWYA 1GRTA 4UTWC 2CU0A 3PUOA 5GJPA 2WKLA 5CJMA 5J04A 1KTBA 1MO9A 4L5ZA 1EPVA 3TTOA 4B9YA 4WDUA 5JCMA 1TYTA 5C9ZA 5ER0A 4GQGA 4N42A 4PR4A 4RNIA 3AICA 3PTMA 3UZJA 1H62A 2FVLA 5C8BB 4K68A 1FWRA 2C14A 3HPFA 3W2UA 3APGA 1CXFA 4Q4SA 4C6QA 1SFSA 3GZ3A 4IM4A 1J0ZA 5A8MA 3JVAA 4HZ6A 4O1AA 3W7HA 1N82A 1TPFA 1S3TC 3QH2A 1GVYA 2VOTA 1V02E 5BROA 8RUCA 1W3NA 2CLKA 3KLJA 1R46A 3DKLA 5LZLA 4C6FA 4O50A 1QO2A 3TN3A 4J3SA 1NFGA 3OTRA 3BURA 1HX0A 5D2YA 2VGFA 4A2SA 3B8WA 1QWKA 4MJZA 2ZZ5A 2DJLA 4GG9A 2RHGA 4IMFA 1M03A 3HA1A 1TJPA 2EGZA 1PAMA 2HROA 1JGMA 4LVDA 3TJIA 3URAA 1HUVA 2AQVA 3ONBA 4IJBA 2RKXA 4KEZA 2QCLA 3VC5A 1SO4A 4GBUA 4QM1A 3MSDA 2IKGA 3QC3A 5I24A 3CGEA 1I0DA 5GPRA 3FJ4A 1S2WA 1WKYA 2P50A 1P0EA 5CZJA 1ZGDA 1QJWA 1XLJA 2PAJA 4JFSA 3TV8A 3CAQA 3R8GA 1WE5A 2JGQA 1SB3B 4QS6A 4MDOA 2F6KA 2I57A 1S1PA 5A6KA 3EB2A 1NWSA 4RZ5A 7ODCA 4D6CA 3UJFA 1EL3A 4EQXA 4A8RA 3CL7A 2GQAA 2XVGA 4DZIA 3BLDA 3W1NA 1YX1A 2DW6A 2UY4A 3ZXWA 1H4PA 4TVDA 3T1GA 1UZ1A 3THCA 3O8AA 1WZMA 3FVMA 4B3KA 4JXCA 3TOYA 3NEVA 1KTNA 2VZTA 2G4JA 3LTPA 1V3MA 3RUBL 1FWFC 4L56A 3K8LA 5CCZA 1JAKA 3GBDA 3N34A 4G8TA 3W74A 5K3VA 4XD6A 2CLLA 4Z42C 1W32A 3WMCA 1EJWC 2HVMA 3KL5A 2O0TA 3GVVA 3KP0A 1KN0A 2HVOA 1M5WA 3WJSA 3W83A 3PJTA 3WEMA 2I56A 4X0VA 1HGYA 3QR1A 3OVGA 1V3HA 1WPCA 2YDAA 1X8FA 3R58A 5GQBA 3KS5A 2ZYFA 1DJHA 4KQNA 3GH7A 4BV6A 2Z6JA 4M81A 7ENLA 1YNYA 5FEZA 3WNKA 2X1TA 2PCEA 4UTTC 1IQ8A 4EXBA 5GRTA 1CGUA 1E1FA 4KGJA 4GZ7A 4H6QA 3I7RA 1BKHA 3HPAA 4UCGA 4ROQA 3WUFA 4NRSA 1VEMA 3PFRA 2QLYA 3W2KA 3MYOA 2VFHA 4NAEB 3VIMA 3TYAA 2HK1A 2P3ZA 3C0LA 2EPHA 2YZ5A 4GNVA 4MADA 5GJMA 4GINA 5EA9A 3UD6A 4BEQA 1OFRA 1JXJA 1H61A 1Q2SA 2WCSA 1FFVC 4Q8MA 3M9YA 3NCOA 1UMYA 3ATYA 4MWAE 3W84A 2EO7A 1HVXA 2VEGA 1KO0A 4FSAA 2Z29A 3DK4A 1OGBA 4FK9A 1HT6A 3VX0A 3PPCA 5KVHA 3G0UA 5HR7A 1PCKA 5E6YA 3JU2A 4CNUA 2XVPA 3S2CA 3MUXA 2PDWA 1JUBA 4EP8C 1EX1A 1ISXA 1ICQA 4K6AA 4NXSA 1TVLA 3B9OA 1O60A 4A8LA 4UNLA 3MB9A 3M5XA 1YQ2A 1F6YA 1F5ZA 5I23A 3T0DA 1HKIA 3TIMA 1LL7A 4FX6M 4O19A 3D46A 3NYDA 3RK8A 4WY0A 1TTIA 2CETA 4H4PA 3UNTA 4K2SA 1NEYA 2A3HA 4JX6A 1JZ7A 1FH8A 3PNZA 5ABTA 3RDKA 4GCXA 3LI0A 2PZNA 4YWOA 3TN4A 1DL3A 3C2FA 1SM9A 2PDHA 3KWXA 2NUXA 1UQZA 4LRSA 2OLHA 1DXIA 1GERA 3LCIA 3GYCA 2PP1A 3SCPA 1XDJA 3WL0A 4FLRA 3G3DA 4V15A 5J5RA 3NQGA 3TH6A 5CG0A 2GLKA 4AD5A 1RK6A 3R43A 3AYVA 4XZNX 4Q8PA 3CMFA 4FNSA 4AIEA 2OYLA 1D7YA 3SW6A 3DN5A 2IQTA 4IP7A 2WV8A 5U7SA 3MYPA 4C90A 2EAWA 5K9DA 2YDRA 5D2VA 3ARSA 3GH4A 3MY9A 1PJ9A 3ISIX 3BC9A 4OIFA 2REQB 4IFRA 4M5PA 4YL2A 5K2ZA 4I90A 2OKOA 4JL2A 4BQ5A 4ZFMA 3DBNA 3H2MA 3F2BA 4DJFD 4M19A 5AYXA 2E3ZA 1FDJA 3PF3A 2Y7EA 2X41A 1US3A 4JIRA 1X1NA 1AK5A 5G5IA 3LNPA 1QO5A 3BLKA 1GVIA 1ZJIA 4Q8VA 3WFAA 1YPXA 4UXDA 4GIEA 3R0KA 5D02A 3GWQA 4JR5A 1W5PA 1SR9A 3V1HA 2OVLA 2VC5A 2A6LA 2ALDA 4XZHA 1R0MA 3KLLA 4DQWA 1ZRQA 2VDIA 3EWYA 1GHRA 3QM3A 1HW6A 1Q4WA 3Q65A 2V5CA 3OLDA 4UFJA 2OZ0A 4B91A 3QFEA 1GVSA 4A3QA 1ZX9A 4KIRA 4PN2A 3SRKA 3VGGA 9XIAA 1A4LA 3FXGA 3TTQA 4FHAA 5EB8A 2PDFA 3M0HA 3W1UA 4JYFA 3OEXA 2O7QA 3WF0A 2WZMA 4US5A 2PEVA 7XIMA 2QR6A 2VXNA 2GSEA 4CQBA 3R11A 4U5IA 3T42A 3W27A 3CQIA 4DELA 3BG3A 3MZ2A 3PJUA 2VR4A 3AUOA 4V33A 1K9TA 5BRBA 1CI1A 4BZYA 3UCCA 1R7OA 4GABA 4YN5A 2RJGA 1R8LA 2Y89A 3O2LA 4W89A 4OT7A 4DJFC 1JZ5A 1KXHA 4I6VA 3U0HA 4AH7A 3L4XA 3RRAA 3B97A 2JALA 3LXCA 4HOWA 3ITXA 4ACZB 3PG9A 5G1YA 4F0KA 1K9DA 1KXQA 2W3SA 2J47A 2QT3A 3LPGA 3R10A 3ZSTA 1JPMA 4UIOA 1RY8A 3P8JA 3RN6A 1J96A 2QCFA 3OZPA 3UCQA 4OV9A 1XINA 1SW3A 1GZ1A 3XIMA 1T40A 1QR7A 4GIYA 3CZEA 1HKMA 3W7KA 2CZDA 2J13A 1FWSA 1IWBA 4GJJA 2BMBA 4H41A 3BVJA 3OGRA 1SUXA 4JY9A 3UWQA 3CAWA 3SGGA 4ZSUA 2QV5A 3HURA 1BEUA 3PZUA 5CQ1A 2J8FA 4PUDA 4Z2KA 4LY4A 3T55A 2G5WA 4HSNA 4LH8A 3CU2A 3ZR5A 3BLPX 2ZUTA 1ADSA 3TLLA 1STZA 3LN3A 1BWKA 1E4LA 1R2RA 4AD4A 4EXQA 3O7UA 1BKSA 4Q8UA 1J6PA 3L68A 4O57A 3T08A 4AUBA 4EQSA 3GU2A 1DP0A 3GFYA 4P8WA 4A8NA 1XKJA 1E6ZA 1KFKA 2J6XA 3GNPA 2X8RA 2FVKA 3QXBA 3RM8A 3C0JA 3NL2A 3RX3A 1AD4A 4I5XA 2HXUA 4Q7BA 5C7VA 1JPKA 3LS9A 1FX6A 2O9OA 4WY0F 2Q01A 1TV5A 5M5DA 2BVTA 4JGDA 2R1NA 3M6DA 3BMXA 4NZJA 3W7DA 3BARA 4M56A 4C6EA 2F6XA 3DFQA 3A9BA 1JYNA 1QHOA 4PODA 4QAWA 5L9FA 1KD0A 3H53A 5C70A 4M8UA 1NDZA 5AC4A 1FHUA 1J0IA 3CHCA 1ZPTA 1Z3NA 5C54A 3AU2A 2QUUA 2HBVA 3LRKA 1P6WA 3B8TA 3IGXA 4FAMA 1ENUA 3URBA 1M7XA 4GE8A 3PY2A 4FLSA 3WF1A 5BZAA 2XGZA 5C9WA 2RDXA 4I5UA 1BG9A 2ZUUA 3P3BA 1LJYA 1O5KA 4XX6A 4ZQMA 1UD3A 2WZEA 1ZFJA 2PTWA 2DP3A 3DG7A 3HIJA 3NQFA 2VZVA 2WSRA 1X39A 4TOQA 4U5KA 3HPSA 1JEHA 3EWBX 1OT2A 2V2HA 1WKDA 4KPLA 1ODZA 3RCNA 4YTQA 1L8NA 3GAKA 1VC4A 3UP8A 3VMPA 4WIWA 2ALRA 2INFA 2J9XA 4POCA 3TQVA 1SZNA 2W91A 2J7DA 1GORA 1ALDA 4JX4A 3DIPA 3IUDA 1CZ1A 1XH0A 3GZAA 4Z2GA 1ZTVA 1UKPA 2HQMA 3KOWA 1I0BA 1AH4A 1VAHA 1VPYA 4OWGA 1WBHA 5CAKA 3B9EA 3UEQA 3FSUA 2BXYA 3LSBA 4JQAA 2C8NA 4JTEA 1QNPA 4PGLA 5A6AA 2GL5A 2PD9A 1W31A 2RFGA 3OBKA 5EMJA 4J3XA 4EF8A 5I3DA 3VD5A 4NNCA 1U5VA 3WD1A 1AQ0A 3BQ6A 4PBFA 4XAFA 3IIXA 1GVFA 5HK4A 4A4AA 4QNEA 5A8QA 4PA8A 1TJ1A 4ERAA 1RVKA 4LEQA 4HJFA 1VD6A 1YDOA 1TR9A 4H8VA 1UD4A 1TPDA 1B4EA 1G67A 3UESA 2V3FA 3WIJA 3ZT6A 1M65A 3BSHA 1J5TA 4PB4A 1IZKA 1RCQA 3H2NA 1GREA 2VZSA 3CJPA 4A2RA 4L1WA 3URHA 3CLWA 4LOCA 1BYAA 3S1UA 1XLIA 3DHFA 3QOMA 4PH6A 3VIHA 1K6WA 1OFBA 3WQ6A 4YTSA 1LLOA 2OLSA 3RGTA 1ISVA 1KM2A 5H2ZA 2O9RA 3TJXA 2GYIA 1B2YA 1Q6DA 3OVRA 3CZ8A 2J88A 3MA8A 1EYEA 4LCRA 3DK9A 4AZBA 1HFBA 1QHZA 2X8GA 1YDVA 1R38A 3CS2A 3TEVA 3GRTA 4HK6A 5I3KA 1IE7C 2XVNA 2GK1B 3G1DA 2HXTA 1NTHA 1KNWA 2CZFA 1XIGA 4RE0A 4Q6XA 3SQSA 5AC8A 4EIVA 2VQUA 1GQKA 2E4TA 2PCQA 3SO7A 3LV6A 4IUOA 1Q3NA 2BDQA 5EBUA 5C2GA 3WDJA 2ACSA 4N4PA 1TCDA 1NOFA 1NSJA 1YMYA 4QJ3B 1SMAA 2ANUA 3GHSA 3G1HA 5XIMA 3KOFA 4AYSA 2V6OA 3A4JA 1KLYA 5KEZA 2C0HA 2WMKA 3KOYA 1XJBA 2B81A 3CT7A 3QHNA 1E43A 3PUDA 3QHOA 4GO9A 2OLAA 1I2OA 1FWBC 5JUVA 2Y61A 3UT0A 1E9YB 1F7BA 4HCHA 4FF5A 2XN1A 3QYSA 6XIMA 5LNWA 4NT0A 2QCGA 3T0CA 4HNLA 4IOTA 5F1UA 1NELA 3A3XA 4J1OA 2PDNA 4YVVA 3CXBA 3PBGA 3ZZ1A 3GAYA 5E9AA 1GCYA 4IX2A 4KETA 2EQDA 4AX7A 1XUUA 5CGTA 5CZ0A 3E2SA 4LB3A 1DBTA 2AGTA 2OKTA 5M3WA 1FECA 4IMDA 1XANA 4QHRA 1V6XA 4V2XA 2GGGA 2WNZA 3T9PA 1IWAA 3H4XA 2DJXA 2X0YA 2XSXA 1GOQA 1O5RA 1TWSA 5E0FA 3CWOX 4FNTA 3EPMA 1ME7A 2Z2UA 2NZLA 1TV8A 3BLOA 5KITA 4XWUA 4F0LA 1IT0A 3ALGA 1G7UA 4B4FA 1ICSA 3CPRA 1J93A 3TYEA 3ATZA 1ZZMA 4UB9A 3TAOA 4RW5A 1R2TA 4KWVA 4UUIA 2P0OA 4IMGA 4XUYA 2X8CA 1UKTA 1UW9A 3NAVA 3W7OA 4ADSA 3H55A 3TC3A 2BP1A 3IACA 4S1FA 3GBEA 4NL1A 3TYZA 3VUSA 2QULA 3GW3A 1PX3A 1V97A 4PMJA 4ZTXA 4NJKA 2F61A 4PCNA 4FNUA 4HYWA 3L0KA 1A5KC 2IKHA 3MTWA 4O1DA 1JI2A 2V3GA 1G6CA 1YXDA 3N4FA 4BWLA 3GDBA 3QY6A 3EWUA 3I65A 3WELA 1JCMP 3SCSA 3CV1A 3TW9A 4QISA 3SSJA 1HXJA 4N4QA 3APYA 1K7EA 3OA3A 4A6GA 1L2UA 2ZOXA 5AYBA 3KZSA 2GH5A 3TSBA 7CGTA 2IXUA 3FXYA 2X50A 3SURA 1EFZA 1YXCA 1DHKA 2XH4A 1E72M 4PRWA 4H4QA 3SCQA 3EPOA 1WDRA 4K8EA 2OG9A 4FB7A 3OLIA 3I7QA 4JIPA 1QW8A 4IIDA 4S23A 1EIBA 1POKA 1YDYA 1I2QA 4Z1YA 3W71A 3DUGA 1ECEA 3WSUA 3M0ZA 3VMNA 4P2VA 1I45A 5CBBA 1CBGA 5GJNA 3SEPA 1KM0A 2YDSA 2D73A 3M0MA 1OD8A 1AH0A 3PZOA 3SJ3A 3ABRA 5I5RA 4LUIA 2ZRXA 1FEBA 3T0AA 3CL6A 3A22A 4Q3MA 1HQTA 3MO4A 3SBFA 1OG0A 1K8ZA 2W27A 1QT1A 2WJEA 1OEPA 3O0FA 1V59A 1S5WA 3O16A 2CERA 1EDTA 1R85A 3W26A 2YXXA 2DZTA 3LCGA 2E9MA 1MMFA 1Z89A 5DEZA 1F07A 1KCKA 1M53A 1Q5MA 4JTDA 2WKJA 3DFNA 3ERPA 3VD3A 1VCVA 2I1OA 1DJQA 2J62A 3OW1A 3BCJA 1KRAC 4R3UA 1ZMCA 4IH3A 4HNTA 4UQEA 1K4HA 3S3GA 4CN6A 3WQVA 4QEHA 1GQIA 2JFEX 5A8GA 1K7XA 3WH7A 3DBPA 2V82A 2WZTA 3AXXA 2YVJA 1JQVA 2TSYA 3C61A 3OHIA 4MSSA 4WCJA 3LDVA 3MKKA 1O7AA 4CD6A 4J57A 2YLLA 3B8UA 2WMIB 3W3OA 5FF7A 1RK5A 4YYFA 4XBJA 1M04A 1QK2A 4P7OA 3KTCA 4H4WA 3R07C 3EUB3 2ZVIA 4EAYA 2IUZA 2PWEA 1Z9AA 1E6PA 3QW3A 1NFBA 1P43A 3MP3A 5HATA 3E2RA 4AU0A 4UOQA 4FIQA 3EKLA 3LD5A 3UXAA 3RLVA 2WNWA 4JYDA 1KWGA 2FJKA 3L4ZA 1SMDA 3MS8A 1NOUA 4KF1A 2ACRA 1IIHA 2CHOA 2GJLA 4TQTA 4JAWA 4XZ9A 2C3ZA 5FF3A 2R6OA 2XIIA 1ZNNA 1ONFA 3GLCA 1LUCA 1XCXA 3UWZA 2Q71A 1H0GA 4WGXA 4NVTA 3HGOA 3W72A 5HWMA 1AVAA 4AC7C 1GKRA 3WQDA 2CBIA 3VFCA 1EUAA 2WBKA 1O1HA 4I8YA 3FYOA 1I75A 2OEJA 3WQFA 1EDGA 3CC1A 4S3JA 5DMNA 1FEAA 3UXLA 3ICJA 2CHNA 1B54A 1XX1A 3FN9A 2ZTJA 1GRAA 4M3PA 2G3MA 1MRQA 3CMGA 5HNUA 1TJ2A 3AHTA 1IEXA 3DC0A 3WDHA 1RQHA 2FTYA 4LUYA 4MMWA 5DQPA 3FDGA 2DSWA 2VENA 1A5MC 3SY1A 3WZ0E 3U3HA 2FPTA 3IANA 3MJMA 2NLYA 1PYFA 4YWIA 4GVFA 1AW2A 4LJ3A 3W7RA 2WPFA 3VOIA 1MXDA 4UCFA 2G41A 3VVGA 1T8XA 3WLPA 3CIVA 4D72A 3A4WA 1TJRA 3EB3A 4OE7A 5HOSA 4QG9A 4H1ZA 4IHCA 1DKWA 3M64A 4GPNA 4ICNA 2JKPA 1UD2A 2F84A 4PCPA 1ELSA 2OFJA 3BPWA 1D2KA 4LUJA 2VCAA 4GFIA 1WCGA 3EBVA 5CC3A 3VOFA 1OVDA 3NM3A 1VR6A 3B0YA 5I77A 2EKCA 1H7NA 3ARRA 4GK8A 3I3DA 3G0SA 1YW1A 4FLOA 5HWNA 2ESCA 2WANA 1H60A 1V0NA 1YRRA 4JTGA 1PYMA 2ZUSA 1JPIA 2Y2WA 3TR9A 1UKQA 2C71A 3N9RA 3N2BA 1XLMA 4HCLA 3UJ2A 5FF0A 1MUWA 1LOSA 4LQ1A 3PC0A 1L6FA 2Q8ZA 1KFLA 4W4QA 2VM8A 1X6NA 2P88A 3AISA 2DT3A 1O4UA 2RDTA 3E38A 1Q6CA 4GOAA 1TV3A 4EAMA 3GKFA 1EZWA 3WJXA 1TPH1 2CPUA 5LSMA 2PLJA 1FCQA 4FNPA 4CD4A 5B7YA 1IXNA 4FX8A 1SZEA 1YHTA 4KWSA 4LWWA 1TCMA 2ZE3A 3HPXA 4GQRA 4DO6A 3CTTA 3PZNA 3VGFA 3T78A 4W87A 4EMWA 4W93A 3L0GA 1P6CA 1EQCA 1EHNA 1C9DA 3ITGA 1E5JA 4GZJA 3FFSA 1SR0A 4RXFA 1LVLA 2GDQA 2R1PA 1SGJA 1BQCA 3W2NA 4R27A 3XINA 1MQPA 2GQ3A 5I3IA 3EWCA 3PUGA 3ELFA 4B5WA 1OYCA 1S46A 1J4EA 1WDWA 3MWAA 5XINA 3SAZA 1XIDA 5DANA 3L67A 3AMCA 4HHMA 1NHPA 2D0GA 1TWIA 1EC8A 4PMOA 4DUVA 5A6BA 3ES7A 5JXQA 4DZHA 1UWUA 3EOLA 2C1GA 1EJVC 3QGVA 2QPSA 5FJUA 3EEGA 5HAOA 1EJ7L 3PWIA 3HQOA 4KWUA 5E1QA 1GEQA 1FDZA 2AL2A 1K3UA 3LADA 3VNMA 2ATMA 4K7VA 4V1YA 3B06A 4R53A 1ZUAX 2ABAA 4JX5A 3VDGA 3GUWA 4PMRA 3S9YA 2BY1A 2YL6A 4G1KA 2V9DA 2W4XA 3LX9A 4M7TA 1KRBC 5HQEA 1YQZA 2GOUA 4H9YA 3PS7A 4DJEA 3ZJKA 2FKPA 2NUYA 2EG7A 1XG3A 4EKJA 4P8UA 3WJYA 4JTKA 3UERA 1JIBA 2YXOA 1MNSA 4ADUA 3DG3A 4YU1A 3H6OA 4DAFA 1LWHA 1RR2A 4PL1A 2ACUA 3VZYA 2B7NA 1PUDA 3RLHA 3M0KA 3KHJA 3O07A 2X42A 1OM0A 4JTJA 3E74A 3CV6A 1KR1A 1CDGA 1HP4A 3EXSA 2WPGA 3AO0A 3KUMA 4OVXA 3W2MA 5BU9A 4N9EA 2QJJA 4IQLA 3V3WA 2VX5A 3B9JB 4XBKA 1QRQA 4INFA 2WJZA 1BSIA 1VFTA 2F38A 3KDOA 4MY8A 4QG8A 4FLQA 3B8DA 4G7EB 3ABOA 2I9UA 1B0IA 5GNZA 2CW6A 4F0SA 1OK6A 2X7WA 2Z1BA 2YIHA 1JD7A 3CQHA 5CZSA 3GXIA 3W1MA 2XINA 4JHMA 4QBXA 1U1JA 3F5KA 3KRUA 1EJUC 1F05A 1KFEA 4QEEA 4ZGYA 3WQOA 3M5YA 4PRTA 4HU4A 4MB4A 2YBTA 2OGYA 4MOZA 2R14A 5LHFA 3BG9A 1A0EA 2C6QA 1EXPA 4WDXA 1V03A 2CIPA 3DFOA 2G3IA 4LUTB 3CUGA 1LPFA 2PGFA 3W87A 2FFCA 4NQ1A 1OFOA 3N3MA 4DXVA 3REQB 3IJ9A 1BWCA 3IJIA 2B4GA 3OIHA 2BY0A 3VGBA 3CMJA 2XFRA 1H7WA 4H4YA 3M5ZA 3A5FA 5FJJA 1CYGA 2WHKA 1S5VA 4Q4PA 1ITXA 3LNMA 1A49A 4A22A 1E71M 4ZENA 4X0NA 3AIRA 3A9IA 3JZUA 3K13A 4Q32A 1TKKA 1L6GA 4HU8A 2A0NA 3TU9A 2J75A 1IZCA 2YSWA 1A5OC 1ZP4A 1KBBA 5G5HB 5JCLA 2ATSA 1W1A1 1HJUA 3IUIA 3LZ5A 4JTLA 1GONA 5EGRA 5EMKA 3NGJA 6PTDA 3GHUA 4I9TA 1ISYA 2OJPA 4HA3A 3QEZA 1B3ZA 1S38A 3KDNA 4W88A 2BWGA 1XRTA 3U9IA 4L7ZA 1FCUA 3DXIA 3QQ0A 4O8AA 4DWSB 5LIWX 1HKVA 1KA9F 1KW1A 3VIFA 3NJ3A 7PTDA 1TTQA 4W86A 4H7VA 3VOCA 3NZPA 3WF3A 3IVTA 3W1QA 4XZLX 4GI4A 1ZCCA 3WFZA 3WK1A 4MLRA 4PMQA 3PUEA 2YGYA 5REQA 1KLZA 2FZNA 2XUCA 4DY1A 2BVYA 2DZPA 3LGDA 1GVQA 1PVNA 1TPEA 4OOZA 2QUMA 3KTXA 2PWHA 3DENA 3PTQA 5MKGA 3PSVA 1ZENA 1MVYA 1V5XA 5D9PA 2HJPA 1KTCA 3FX4A 2ZFAA 1UOZA 3HMJG 2FB3A 3GIYA 4DF2A 4ATWA 1WOAA 4YHEA 4FZIA 2QPXA 2YL8A 4TX6A 3WCZA 3AAMA 2A6NA 3IK2A 1H0IA 4IL0A 3BW4A 2DT2A 4DWSD 1E73M 1VIWA 1UOKA 3W7CA 3DYOA 4ZTYA 3CEUA 4GVGA 5C55A 1BXBA 1VZWA 4H6KA 4C6JA 1I6NA 3MMUA 1V3LA 5DFAA 3ITLA 4E2VA 1WA3A 3LGEA 3DX5A 3TSDA 2Y5SA 1DWIM 1E1CB 4BEUA 1CGVA 1DV7A 3AMKA 4KWWA 1CT5A 2GFTA 1LQ0A 4HNUA 4UTHA 2UWFA 2WKGA 4AAJA 2XIQA 1ZP3A 1SZGA 1JL8A 4GD0A 2WHJA 3MCOA 4OECA 1XIBA 4B16A 4W8LA 4AHOA 8TIMA 4V28A 3T4CA 2QDDA 4B5XA 3EKGA 1X96A 2PDXA 1Q13A 2JIWA 1V51A 3EMCA 4MAVA 1QI3A 1K4QA 4PMNA 1V7YA 2NX3A 1XIIA 1TRDA 2I16A 2CDUA 3UW6A 4W7UA 3LQLA 3RLUA 1LRQA 1H41A 4S3AA 5FS8A 1AZ2A 3SB0A 4Y9OA 2GUUA 2WC4A 1OGGA 1R7AA 5D8ZA 3WLHA 1TRIA 5AECA 2XVLA 1LBMA 4UNIA 3U4AA 2JKEA 1TQXA 1P48A 3L5LA 3EWWA 4DWSC 5F4XA 1E0UA 1JZ8A 3S2JA 1CNVA 3PN8A 1J01A 2D1ZA 1P1XA 4RZ4A 2FH6A 2V67A 2JEPA 3BUVA 1BVNP 3CPGA 3AIUA 4AHPA 3FCPA 1FTXA 4E8DA 4JTHA 3BOLA 3H2OA 3RCYA 2PLMA 1I9CB 1W3KA 5AHLA 3KBMA 1RJRA 3S5SA 4WK9A 5JMUA 2UZ9A 1Y5VA 3C2VA 3NQ7A 4WRHA 1B3VA 1RQBA 1L6YA 1OZMA 3NDYA 4F8XA 2EG6A 2FQIA 4PCFA 5JRBA 2XIJA 4HP5A 3E0FA 2AAAA 3GXPA 2ZWZA 1BTMA 4F0RA 5AYZA 1M7PA 1VJSA 4U3AA 4R33A 1GVRA 2H3BA 1NDVA 3WLSA 2WYSA 4DJEC 4D1IA 1Z32X 4OGZA 1PB0A 3QW4B 4M6VA 4MKVA 2V5LA 3DFTA 4L61A 2G3NA 3A7AA 1GRHA 3V4BA 1IEWA 1R87A 3BOXA 1QU4A 2GSJA 1FIQB 4DBDA 3F4DA 4LVAA 4MUZA 3ZOAA 4DZ5A 1G1YA 1BYCA 2G96A 4FEZA 4NYYA 3K4AA 2VMFA 2CLMA 5D37A 2FGBA 4RNJA 4LU0A 2WZHA 2NQ9A 1XW8A 2CXEA 4I7WA 1PBGA 1VLIA 1NU5A 5H8MA 2QPUA 5IBXC 4ZE4A 1DJXA 2DZUA 5MKGB 3AIBA 2Z1SA 3LXBA 1A5AA 2FIQA 2Y8VA 2VX4A 3TW7A 1MW0A 5HNTA 1HL2A 4C1NB 4HBKA 4ADWA 1C29A 4JHOA 1OCBA 1W91A 3NM1A 4GO8A 4LSBA 3VIJA 3LTSA 4M0XA 4I7VA 1LP6A 1N7KA 4QJ5B 3TYUA 5LGZA 1GEHA 3G24A 2QCEA 4MNJA 2D24A 4GKTA 3B0PA 4RPQA 5LIUX 2YPIA 5JQ9A 2KZHA 4G6CA 2V8ZA 3PG6A 3N14A 2J3NA 1G0CA 1ONRA 1SSDA 1REQB 4IPPA 3KM8A 4RNHA 3KLKA 1R3VA 1E4MM 1XBZA 3DZ1A 1YYAA 2DSVA 3GXMA 4KH2A 3K5XA 1UZ4A 2OO0A 3KVMA 3VX1A 5ABFA 3T07A 1FHDA 1JI1A 3AZRA 2XHYA 3E6EA 4DVOA 4LBUA 1B3WA 4Y6GA 3GHRA 2GQ9A 4LCSA 2HRWA 4CU8A 5DRCA 3GC5A 4NX5A 4BCEA 1E70M 2XWEA 4IIGA 5GNYA 2RUSA 4DBWA 2P1FA 4C6BA 2WPEA 4HSOA 4UTLA 4XAZA 1CLKA 3KCJA 5MF5A 2DH3A 1XYZA 4GKLA 2O9PA 4AY8A 3TP4A 2GQ8A 2FH8A 4LGXA 1SVDA 4UFKA 3W02A 1LL4A 4CN1A 2G3JA 3STFA 4MTVA 3SCTA 4DWDA 1PTAA 1P4CA 1TQJA 4LA1A 2I7GA 1UKOA 2BOGX 2EJ1A 3C2OA 4F9JA 4IIFA 1OF8A 3BMVA 5EMUA 3WD2A 3BH4A 1JZ2A 1K02A 4O11A 2O4MA 4O16A 1OX4A 5CBJA 1KBLA 1HZYA 1UUMA 4URIA 3AWOA 4WSHA 4NY2A 3RU6A 2ODOA 2GJPA 1HTIA 3B8SA 3LXDA 4X3ZA 2BOFX 5A8PA 2TPRA 1UR3M 4PTNA 4LW7A 3G1VA 3L23A 3A3HA 1CLVA 4O14A 1VYPX 3W86A 5HXMA 2CYGA 4I9AA 1QI0A 1SFLA 1EQPA 4O0KA 5I07A 4B2DD 3AC0A 1DTNA 2JQXA 3SN0A 3T05A 1R5YA 2D20A 2QCHA 4L9YA 1XGZA 4HU3A 4PRRA 1W3JA 4CLMA 2VZOA 4JKMA 4J40A 2AKZA 3SUWA 3WQGA 1A4MA 4ENLA 2F2KA 3QOKA 2HSAA 4C6LA 1IF2A 5HPOA 2VFDA 3CQ0A 4IIBA 5HQLA 1XRFA 2Q8LA 2WWDA 4DPPA 1VRDA 3FYYA 6REQB 3VM7A 3AYSA 3TJLA 1W9VA 3GM8A 1G4PA 3TTSA 1B9ZA 1D9EA 1TUFA 2CBJA 2VOMA 5FEWA 3CPUA 4AY7A 4UMCA 8CGTA 3UG5A 4M24A 4YYCA 5BRPA 1SYTA 5SWUA 3L65A 3LHTA 3UFYA 1Q7ZA 1N5WC 1XRSA 2WPBA 2CLFA 1EGVA 1U1HA 4J3WA 2QZRA 1E4NA 3IWPA 1YE6A 2TAAA 1EGMA 3LLFA 4LX4A 1TV7A 1PPIA 2Z1WA 1CXLA 5D05A 1R86A 3W9ZA 3SGZA 2GR0A 1Y65A 2WHLA 3WMBA 3WK0A 1A5CA 3H4GA 1EBHA 5D09A 4RDVA 4QP0A 3IARA 2ZXQA 2PDGA 2E5DA 3AYTA 3VO0A 4EOUA 4REQB 3AMZA 4GH3A 3M4HA 2WCGA 2NUWA 2WQPA 3TQKA 4PB3A 1VH7A 3GR8A 1AZ1A 3ITYA 2YYUA 1GRFA 4LYRA 4GYKA 1LOLA 1EEPA 1GG1A 3GDMA 3OPSA 5TF0A 4IGSA 4R88A 5A6MA 3CUHA 4FR1A 4IPIA 3OBAA 2Y63A 1A3HA 1SO3A 1XL9A 4LF2A 3R4IA 3BW3A 2Z1KA 1CLXA 2OR2A 5DO8A 1PHQA 5ABFB 3UY7A 3TC6A 4ADTA 3NO5A 2D23A 4HTBA 4ZBCA 3GXDA 3VE9A 2QHAA 1LT8A 1G5AA 3TE9A 3TYCA 3ZVHB 1GQLA 4YMZA 1KGXA 2QF7A 3VPLA 2QUTA 1F61A 1E3ZA 1YDNA 3UF9A 3M44A 1TR1A 1GYLA 4X22A 3B0VC 3EZ4A 3M41A 4H9XA 4PZVA 1DEDA 1G4SA 5BYWA 5FOOA 3SCNA 5FS7A 1CECA 4L9XA 3CH9A 1TE6A 1H7OA 1FXQA 4ZOEA 1X6LA 3GU9A 2HVNA 3LRLA 4K7YA 1MSSA 3RAOA 3VAVA 3VOGA 4D6IA 1JULA 4AZCA 4QROA 4LF1A 2ZC8A 2XH2A 1O1ZA 2YCLA 4E5TA 4OZOA 3RYSA 3OLEA 4JQ9A 4DHGA 3DJJA 5J5DA 5KTLA 3ZJ8A 3O1NA 1BG4A 3IV3A 3KW3A 2Z4GA 3V0SA 2V38A 1R47A 4ZQCA 3WK3A 3E2VA 4ASTA 3E1F1 3WJZA 5I06A 2C1IA 4HOXA 5FAGA 1H3GA 1X1ZA 3USBA 1NQKA 1F76A 4CGTA 1CX9A 1XIFA 1DTUA 4KCWA 1X97A 1US2A 5F4SA 1TO3A 1A5SA 3OODA 1IZJA 5HA7A 4ZB2A 4GUHA 3MVIA 4HU0A 1MWOA 3DHUA 3NQEA 1RQEA 4WXZA 2VJXA 3MQTA 4EPDC 3AHZA 1W3HA 3PPHA 3THAA 1KC7A 2EBNA 3EX3A 4CUCA 1TUXA 1N8WA 5AN7A 3S2NA 1M6IA 3KRSA 1W5QA 1C8VA 5H8UA 2WSYA 3QLDA 4JEJA 2OTDA 5HR6A 5KMYA 4GNKB 3S47A 5A5WA 2ADAA 3RR4A 3O0HA 1P7TB 3MHGA 5G2HA 2OELA 1GVEA 4FXFA 1PX8A 5L6UA 1EA0A 3O9NA 1ITUA 5A6JA 4LYQA 3WL1A 4NAFB 1DXLA 4YS1A 5A6SA 1JPDX 2D69A 1ZB5A 1TV4A 1XHGA 1BGAA 2WBAA 3B9NA 1B1YA 4H2CA 2V2CA 3DHPA 3R5EA 1A0DA 4E2DA 3KTSA 3C8NA 1D7KA 2DZAA 4CEUC 2PBOA 3MPGA 4TV6A 4FXSA 2NX1A 4GYFA 3L4WA 3SQPA 4YTTA 1TA3B 4BHYA 3WDPP 3BJTA 3H54A 4W7VA 3QQ1A 4DRSA 2WNNA 5IHRA 1QVBA 2OOGA 1WAUA 4TX9A 4L1GA 2JF6A 1GRGA 5CGMA 1V7AA 1I1WA 3H2EA 1Y5WA 2ZA2A 3DHDA 1YBQA 1BPLB 1LWIA 3W7IA 2XN0A 2P3EA 2HPMA 2WMJA 4GFSA 5A95A 5LIXX 4IJRA 4MFDA 1CWYA 3UVAA 1GPFA 4QJ1A 2HISA 3KBJA 4J27A 3TDFA 2JF7A 3T2PA 3W70A 2ZZ7A 1PZ0A 1ZAHA 4MKNA 4I7UA 4F0HA 4JCLA 3N2CA 3VCNA 1JNDA 1V02A 4Y8EA 2ZUMA 3B04A 1NOWA 3OQ8A 3OQEA 3N4EA 5T91A 2VR2A 3QTPA 2PDLA 3H70A 4L64A 3IAQA 8A3HA 1L6WA 2OXNA 1XWYA 1Z8AA 5GNXA 1FDYA 3SSZA 1AA1B 5BMWA 1OJXA 1DYSA 2Y8KA 2ZUWA 2PLCA 2FGLA 3NL6A 5AZ1A 1DIOA 3Q6JA 2UY5A 4UFMA 5JCKA 1OG6A 2C91A 2GZXA 3ZJ7A 3W85A 4HT3A 1VFOA 3AQUA 2VRQA 2XM2A 3GTFA 1UZDA 2A4AA 4Z0SA 1IWPA 3NGFA 3MMWA 2VEFA 2P53A 2NT1A 2JK6A 1V77A 4PYSA 3O0KA 3R1ZA 1LBLA 3SCUA 1H11A 1F3EA 3FGCA 4EF9A 1ONXA 4PTMA 4MYAA 4FS9A 3AOFA 2XU2A 1OY0A 1W1TA 1WUEA 2YCLB 1W2PA 3THQA 1V6TA 1M6JA 3WENA 4AG0A 1MFVA 1UMLA 3AM9A 2J7FA 2D2HA 1D3CA 2C3CA 5AB3A 4JTSA 3QGKC 5A8NA 1XUZA 4BKNA 2OU4A 2ZZ2A 3WQEA 3W7JA 1J6OA 2V5KA 2CLPA 2EPOA 1FHVA 3D3FA 3W73A 1BF6A 1DHPA 4HZMA 1PHWA 4EMJA 2ZUVA 2AAQA 3N2XA 3H8AA 1UKSA 2X16A 3NOYA 2R94A 5HULA 2BHZA 2H8XA 3VIOA 4J2MA 4Q8TA 2Q02A 5PTDA 3KBVA 4OQVA 3G77A 1IT7A 2VDGA 2FGZA 4O1CA 4QRNA 3G8RA 3BTNA 4JNZA 4UR7A 2J24A 2ISVA 1J9YA 3I4EA 1WP6A 2XFWA 4O15A 5KZMA 4TMCA 3CAKA 2RDUA 1P0NA 3P14A 4H4SA 1X8CA 3UZWA 3CM4A 1C90A 4H6RA 4S3EA 3L2MA 4XZBA 5FCZA 3COTA 4WKFA 5FA5A 4IMEA 4TTUA 4DLFA 1F4AA 3AIWA 3EX6A 7REQA 3LK6A 4HMDA 2VFGA 2V6AA 4RE2A 3PWAA 3N2MA 4W85A 3NTYA 1V08A 2BXZA 2E77A 1N8FA 2HNEA 1F3PA 2YA1A 4GI6A 4HPHA 1B30A 3AHVA 1IEVA 1TPC1 3VNYA 4CD8A 4R7JA 4K3ZA 4KRUA 4AF0A 2NQJA 1AD1A 4H2HA 1XDLA 3FW6A 4MB5A 1GXFA 1C93A 4AEOA 1VYRA 1D8WA 3OVPA 3QHMA 4NF7A 1EF3A 1RH9A 1KM6A 1VCFA 2BBFA 3FA3A 4CNPA 4MWAA 3II4A 2EG8A 3ZSSA 4D8ZA 2J6VA 2W67A 3QMRA 4RNFA 1KQYA 3SFKA 2VTFA 2NWRA 4ZMGA 3AMLA 2YR1A 3UG3A 3R7MA 2OX1A 3A24A 2BOEX 1YIXA 1H7XA 2C18A 1THFD 4ZL1A 3FS2A 3WLRA 3K4DA 2E68A 3JRKA 3PAJA 3TNBA 4UQDA 1QNOA 4IZGA 3MMDA 4ICCX 1ZLPA 1Y7VA 1N55A 4ROPA 4HA1A 2FVMA 3G1SA 3VD4A 5F2LA 3K4WA 1OF6A 3NQMA 3AMDA 4J3UA 3S5YA 4US6A 1OCNA 3APTA 4ZXLA 2BSLA 1HNYA 1ZSXA 5DELA 2VX6A 4WR3A 2PDBA 1DJWA 3TZFA 3BOFA 3LZ3A 3QKZA 1UR1A 2ZVRA 2J9ZA 2VUYA 3NDZA 4UMAA 1QPRA 5LYRA 1V6YA 3F4CA 5E6ZA 4M52A 2YYTA 3VIGA 2BS9A 2GWGA 2ZXBA 3E96A 5FJIA 2VI0A 4O1FA 4IQEA 4A3HA 4XD4A 3URNA 2HK0A 3UVIA 2QCCA 4IFKA 2AOSA 3KE0A 4HMCA 1UR4A 4HPXA 3G0XA 1BF2A 3WNLA 3WLNA 1OYBA 4FNRA 6ENLA 5T9BG 3B9DA 4TVUA 4I3GA 4JKKA 3W37A 1EOMA 1C3FA 3U4FA 3UETA 1XYBA 4GVIA 4M6UA 1DWAM 1F6PA 4JN8A 3QVQA 3MBDA 4AXNA 3BAWA 2YKKA 4LC8A 4NP7A 4V1XA 1SJCA 2DVXA 3WBYA 3GNOA 1GGOA 4KIEA 2VX7A 1GOWA 1R3WA 4PULA 3GB6A 4IPNB 2XGIA 4NZFA 4HKPA 2E5CA 1VKFA 5I79A 3H2AA 2VD9A 3EDDA 3GD4A 2Q6ZA 4C6OA 5ABEA 1DQWA 4QAIA 1CPUA 1VFSA 4GC4A 3OZMA 1LYXA 4MG4A 4NZ4A 2VFEA 2HTMA 3G6MA 2X1UA 3EWDA 1RBOB 1WB0A 2VO5A 5E93A 3SFWA 4OJYA 1MEHA 4PMDA 1DNCA 4DF0A 3NVZB 3BE7A 2BXVA 3SUSA 2YB4A 4LUSA 1HJSA 3NQCA 1QAPA 4J3ZA 1HG3A 2DIEA 1E51A 3CZGA 5AC6A 4GI8A 3FV9A 1HVQA 4R5EA 4GYPC 4XAPA 4X61A 5B7ZA 3SJNA 3BO9A 1XDIA 1NH6A 3M16A 1QNQA 1Q45A 5CAHA 3TCEA 2E09A 1JCJA 1QW9A 3G3MA 4DJDD 1OGSA 4KKXA 3LG3A 3R94A 2W5FA 2J79A 4AF0B 3EMQA 3B8VA 2HBXA 8XIMA 1UWQA 5K7JA 4F2TA 1UB3A 3RM9A 5BMXA 4L4OA 3L5MA 2VEKA 1DIDA 5KZDA 1S2AA 3U57A 4B92A 4E6MA 4RXGA 5KETA 1AJ0A 4WHBA 4WZHA 3FOKA 3L7RA 3RPMA 4J2PA 1G01A 4IWWA 2WXDM 4BA0A 2WC7A 1TSIA 2X2GA 4PTXA 3P6LA 3MI3A 2WOVA 4DI8A 4KEMA 3KRZA 4G9PA 1RA5A 3ABQA 3PULA 1JD9A 5G2WA 5HUPA 3MUY1 2FLIA 1Q8AA 5FAJA 4ATLA 1LQAA 4YTRA 3IGUA 2TODA 3NPWA 3MZNA 2PMQA 5G4EA 3W7PA 2Z26A 2Z0IA 4AWSA 1RPKA 4GUGA 1CGTA 1TELA 1Q4NX 5F2IA 3QPEA 4Q4QA 1FKWA 1W9XA 4PFHA 1FHLA 3W29A 4QIUA 2Y8UA 3EWZA 3MO7A 3UA4A 1C8YA 3CAVA 5TIMA 4GCAA 4QE4A 3LTYA 2B7PA 1Q7MA 4K37A 3D9XA 1OB0A 4DJDC 2NX9A 4DM1A 4JOMA 1NFPA 4Z2JA 5DRIA 4LV9A 3VGDA 4OOUA 3SY8A 1E6QM 2DW7A 1HL8A 4IFKB 1W37A 3OIXA 4AX6A 3NUKA 4TVYA 1VQZA 1S2UA 1UJQA 1ZBCA 2PWVA 3CNYA 3V1PA 2BZNA 1BAGA 4OBRA 4IQDA 4JL1A 2INEA 5AFDA 1P0DA 2CCRA 4B3LA 3HW2A 1FO4A 4MZYA 1DPMA 3AIEA 3B05A 2FB2A 5JCIA 3ZR4A 1W3IA 2POTA 3LCFA 3WMLA 1AFSA 4ZQRA 1FFUC 4Y90A 2WLYA 2O4QA 4WVXA 3ZR6A 2FZDA 3WNMA 1XIEA 1QBBA 1OT1A 5CPTA 2ISSA 1UP0A 2IKIA 3IRSA 4WKHA 1AMKA 3VOJA 1GVOA 3AXIA 1BFNA 1LOQA 3VCRA 3TLQA 1BZLA 3EYPA 1PTDA 1UC5A 2ZDSA 4M1BA 4RPPA 3WLJA 4CEXC 4H9VA 1SO6A 4RE3A 2VC6A 4O0QA 4C1LA 1G69A 3JR2A 5HNNA 1LL6A 2FDMA 2XM1A 4GXWA 3PBMA 5D30A 1OQFA 1HJQA 4BK9A 2BX7A 5C9RA 1PKLA 4ZSTA 1VJIA 4M29A 2NQLA 1UWTA 1GPWA 2FPYA 3VINA 3VE7A 4LUSB 3DKJA 3FA5A 2A8XA 2DIKA 4U10A 1K9EA 1NWTA 3GTNA 4H50A 2BCPA 1KFJA 2XG9A 5M2FX 4GGHA 4LANA 1MQRA 1VFHA 1A5NC 3WQPA 2C15A 4APNA 2D22A 4Q4OA 4PSPA 3A3WA 4H8HA 1E3XA 1I8JA 3QJAA 1Y5XA 3BLFA 1BWVA 4PUNA 1ZHAA 3TQPA 3NPUA 4H8UA 3KRBA 3LU2A 1VDVA 4W7WA 1NPXA 5TBOA 3EWXA 4FOKA 2INZA 2VRKA 1QPKA 1E40A 3N11A 1JZ4A 5F2MA 4D6JA 2WVVA 4O8RA 1GG0A 5JBFA 2FHBA 3R0DA 1E55A 5D2WA 2X8HA 5EBKA 3HFTA 1WBJA 4YPJA 3I6TA 2CWXA 3RNDA 3M0JA 4JYEA 3N6QA 2Z6IA 2VZUA 4LS0A 2PBGA 4E3TA 4PEKA 4IMCA 3QSRA 2PDUA 2R82A 1VBUA 3THUA 1XSJA 1H51A 2BGQA 1QI4A 1PZ2A 2Q3RA 1DJGA 1NHQA 2VCCA 4XK2A 5G1TA 1E5NA 4D9PA 3MVTA 4OUIA 2E8YA 3GNXA 3NRZB 4HOZA 4EM4A 4X9SA 3N29A 5CSUA 4AMAA 4A3UA 3UXDA 2E25A 1KBJA 3BGGA 3NO1A 1GK8A 2PWFA 4WOZA 2GVGA 3FIGA 1AODA 4AQLA 2FZ8A 4HQVA 4UQBA 1M68A 1XLCA 1WDSA 3BGAA 3SUVA 1GTHA 4B5TA 4IF2A 4QNWA 1KBKA 4R85A 2VURA 3LQGA 2WVSA 1NHRA 1Q6OA 1XYMA 1E0VA 4F0MA 2ZADA 4XB3A 4J7RA 3H22A 2VGBA 1FP8A 3SQMA 2QXWA 1WDDA 3QPYA 5DMMA 3N6HA 5AHIA 1H2IA 1M41A 4D6GA 3QZEA 1Z48A 1OWQA 4IQJA 4M82A 2QIWA 4UTMA 1ZMDA 3NZGA 4TUFA 3HM7A 3UPWA 3UZ5A 3TMLA 3N04A 3FHQA 1EYWA 3CIXA 3L4VA 2ZC1A 5BU6A 5U1OA 4KWOA 1TV2A 3L66A 5HANA 4RDYA 1FKXA 1IR2A 3L2IA 3AS0A 1QUMA 3QV7A 3S5ZA 1K1DA 2ISDA 2OSYA 1XFCA 4Q22A 1PWLA 3W75A 3VUPA 1A3XA 2QJMA 2OT1A 4C6CA 4DNMA 3CUXA 4XKYA 1LLWA 4PMXA 4QX4A 4WY0B 4Z2IA 4N9DA 3EDJA 3E9AA 4FXRA 4IIHA 2AMGA 2DUAA 3C6CA 1V79A 3NG3A 1V8EA 3MWCA 1R3TA 4Z17A 2E1WA 3WD3A 2W6RA 2A2IA 2OWWA 3VYLA 1T5AA 1X38A 4AVNA 4AIOA 1ZBWA 2P0IA 3AIQA 4AD1A 2J7EA 4I9MA 3IJDA 4HCDA 4JTIA 3OG2A 3LPOA 3P0WA 5D9OA 4ZQOA 4GHRA 2QNEA 2P5NA 3JW7A 2E9LA 4FX9A 2VGGA 4K39A 5HMEA 1G4EA 3E0LA 3NWRA 2Z2AA 4OFCA 5HUOA 3RHGA 1NWRA 4R7OA 1OIFA 3G6LA 4CU7A 1XI3A 1VEPA 2PZ0A 3WNPA 4CVUA 4DN1A 1O12A 4U28A 3ITCA 2ASHA 2Z28A 4P7LA 2E40A 1FA2A 2XJ7A 1EPXA 2X09A 1DE5A 5F1VA 1X7FA 5IM51 2G37A 5FACA 3HQPA 5K9CA 4GJ1A 1Q66A 3GDTA 2DUXA 6TAAA 1XQLA 2OZ8A 2PC8A 4XUGA 3RITA 3PG8A 1UWIA 1CIUA 1FQ0A 4CCCA 1IIGA 3LBMA 2PDQA 4NJIA 3MHFA 3GVWA 3OZOA 2W0HA 1J5SA 2YLAA 2I5IA 3DESA 1Q6RA 3IRDA 1L2QA 2UV8G 3AU6A 1VPXA 2PURA 3CGTA 3VKKA 3RO8A 4X2PA 1ZXIC 4Y9AA 3PB2A 3DU0A 3I7SA 1M3UA 2PFHA 5T9CE 5HQMA 4FF7A 3ZMRA 4EQRA 3CWHA 2YVGA 4CKQA 4PMYA 1E6XM 3PBWA 3V18A 3V0TA 4TX8A 3WQWA 2ONEA 3W2JA 4L65A 1V3IA 3QGAC 3E5BA 2W3ZA 4XD5A 5C5YA 4WXYA 3B40A 3E3HA 7A3HA 1C7SA 3LHVA 3UA3A 3OU8A 2GVEA 3THDA 1NDYA 4P8XA 1H49A 3ONCA 2CWNA 3UY8A 3WUBA 1RVGA 2VFFA 1UPPA 4RR4A 3SUTA 1VENA 4PCTA 1UG6A 4ZO7A 5U4NA 4JDRA 2G0WA 5DXXA 1SJAA 4IT1A 5C9XA 2H8ZA 3VKBA 2O55A 1K8YA 1TZ7A 4DXXA 3KWSA 4MYXA 3FY1A 2HZGA 3IJ8A 2YCKX 3L12A 4TIMA 1EDQA 4IG2A 3GG8A 2J25A 4JN7A 5FJPA 3EANA 3OVQA 2OEKA 1WYGA 4GQ0A 5DCDA 3LEPA 4QE1A 2C13A 2ZXAA 1V6UA 4FXJA 3NVTA 2ZTKA 2JGYA 1EF2A 1DWHM 3HO8A 1V0LA 4IISA 1SZFA 1UBPC 3GG0A 4F3HA 3AWNA 4ZE5A 1QOQA 4US5D 2GGEA 3RF9A 1XR2A 4ORMA 1BQGA 2V3EA 4L6DA 5FD0A 3BGJA 1L6SA 1OFPA 3CUZA 4JQ4A 4RLIA 2DFAA 1CXIA 3DEQA 2A3EA 2OZTA 4NNAA 3BAYA 5BOFA 3V35A 3LHWA 4XKYB 3WBWA 3SIMA 3NXLA 2BC0A 1HO1A 2QV4A 2GSHA 4Z1DA 1FWIC 1VFLA 3E5PA 4DM2A 1IGWA 3NR0A 2NWSA 1QFEA 4ZR8A 2EQ6A 3O6YX 4GY7A 3OYXA 5I3JA 3EA2A 4ZOCA 3AXKA 1N2VA 4LBRA 1F2JA 3VNKA 2WSKA 1AUSL 4GA8A 3RILA 1ICPA 1NQ6A 1H2JA 1UIPA 1XRVA 5BOEA 3IVSA 1UWRA 4M7SA 3VILA 1HGWA 3FDKA 4EXAA 3LI1A 5D2TA 3NQ6A 2WC3A 3VFLA 4MY9A 2NSOA 1VYSX 2XDFA 4GQQA 2Y88A 4Q4KA 3W7LA 3RIKA 1DJYA 4UTUA 1LRTA 5D9NA 2HCVA 3WH9A 1Z7AA 2PUZA 3CUIA 2NVAA 1J0HA 1ME9A 2GJXA 4TU1A 1KV8A 4BF9A 9CGTA 4UC5A 3IIPA 3CZKA 1CCWB 1GW1A 3OZYA 4WF7A 4IUGA 4JQ3A 1JQXA 1RPXA 1U83A 3PZTA 3BZJA 1W3LA 2G3FA 3M0LA 3V7PA 2GDUA 1E6NA 3SGUA 5CLWA 4MNMA 4JTAA 4EACA 3EA3A 1H09A 3LLDA 4S3KA 4I5RA 4TVCA 2VC7A 2PDMA 1VHCA 3GNRA 4F48A 3I6RA 1ITQA 3BLEA 4JY8A 3FNDA 3EX2A 5TQLA 3SZ8A 5AY7A 2PDPA 4TXEA 1EHAA 4IXXA 4NIRA 2EQ8A 1SJBA 2WP5A 4ZFCA 3S2LA 3N9SA 3MSYA 3ZT7A 2Z1XA 2GUBA 4ZVJA 4KESA 2B31A 3M0VA 2OB3A 2CHRA 2YL5A 2YX0A 3NQ8A 1MNZA 1LM1A 3DI0A 2F2HA 1KM1A 2QVHA 3EA1A 3PPFA 1HP5A 1WNOA 1KRCC 1JROA 1YTEA 2YQUA 2QGHA 1VRXA 4DUXA 3BJSA 1ZL1A 2W61A 4KEUA 3P80A 1OADA 3GG1A 6CGTA 1JZ3A 3BDKA 1UUOA 3CHEA 3LGGA 4CQ9A 5EYWA 2I14A 1NHSA 3VM5A 2WMGA 2HPIA 3IPWA 4EPKA 5DT5A 2PTXA 1CENA 3LRMA 4XTDA 4XVDA 6ALDA 1CXEA 1SPQA 1EBDA 3PK7A 1M7JA 3BSMA 4C60A 3ETRB 4IPJA 3VMOA 4W8BA 1K7FA 4LY8A 3UR5A 3QC0A 5BXTA 2XIMA 5JIWA 3UWEA 1GRBA 3UZYA 4B15A 3SCVA 2NVDA 1EB3A 3FA4A 1J11A 3MW7A 4A3RA 2UY2A 4KMQA 3PZGA 5G2IA 2MANA 1XH2A 2W92A 2WBGA 1KCLA 3W00A 1BTCA 3A12A 4YCPA 4NX0A 4A35A 3L4YA 3VGEA 2PLKA 4DO5A 4O53A 3GDLA 5BRQA 1W1VA 4CQDA 2NW0A 5C2XA 5EFFA 1AG1O 3GR4A 2UBPC 4FOJA 3KL3A 5CEWA 4GY1A 3GFXA 4JD4A 2D2JA 3CGBA 3L4UA 4PC8A 5FF4A 5EFDA 3B8IA 1K4GA 2ZUNA 4CCZA 4H4VA 4IP4A 3I4KA 4E8CA 3JUGA 2IXVA 4N7QA 4WD0A 1G7VA 2XIBA 2ZCGA 4S2CA 5E0KA 2E67A 2CKRA 1WV2A 4ILSA 3W1AA 2AQOA 4K8GA 3ES8A 1G9HA 3RLGA 3Q67A 1GEUA 1S5MA 4OBSA 4RX0A 4RV8A 4W84A 3P5YA 3WO8A 4NU7A 3ITTA 1NWUA 4IGNA 1WXJA 3L8KA 3HMCA 3PBYA 3HB9A 4MIMA 1UR8A 1RJPA 1JPHA 4QQUA 4HTYA 1JUKA 3BANA 3F5JA 1JAEA 2ZKMX 4HMNA 1QW7A 1VGAA 1NDWA 5F7UA 2YW3A 4H01A 3TJ4A 5BNKA 3CLMA 3VABA 2POZA 2WM1A 1AW1A 5DBTA 5CPMA 2VRJA 2GJXB 4LB4A 3GRIA 5FF2A 1XLHA 1EO7A 3Q58A 4G7FA 4L9ZA 4CCEA 2XH7A 3NEHA 2IQDA 3ZO9A 3W24A 1U5HA 3QV6A 4JTCA 5E5CA 3PBUA 1R9XA 1QI5A 4D71A 4Q4MA 2WLZA 2PGEA 2PTZA 1RD6A 3VKAA 3IIZA 4WUIA 4A3YA 1GESA 3DH7A 3PM6A 5D04C 2ZA1A 4MJMA 4N9BA 5FESA 3NSNA 5KVIA 3KX6A 4NZ3A 5AOUA 3TN5A 2NXGA 3GYEA 5ABHA 2E1DA 3FKRA 5MHBA 3HN3A 3HGSA 2VYOA 3MUIA 1PIFA 4FX7A 1LLZA 3O3RA 3GQYA 3LYEA 2R1LA 2DEPA 3C0QA 4Q8OA 2Y62A 3NZ1A 3UU0A 3TW6A 2F8QA 1KR0A 3TROA 3W1RA 1XIMA 3VDBA 4IGMA 2YXGA 3LXAA 4CQ8A 1XBXA 2GUYA 4CNOA 1TIWA 1N60C 3Q94A 2NXHA 2BTMA 2PTYA 4GUFA 4EQWA 1M1BA 2PSNA 5IXEA 4RK8A 4A21A 1DJZA 1Q8JA 3AUJA 1IR1A 1YE4A 3WQCA 3AYRA 3C8FA 3RNMA 4DJFA 4Y9NA 4Z08A 1EWEA 2YZRA 3ANUA 3HGJA 2QJNA 4YWSA 2W62A 5AYIA 1GYNA 4UFIA 4E4UA 2E7FA 3INPA 4QQ3A 3BLIA 3VIIA 1KCXA 4FIRA 1Q85A 4IFOA 4NILA 4DYJA 3VNZA 3UYIA 4F2UA 3KL0A 1IHIA 5FS6A 3UJEA 2BY2A 1NF0A 4JNYA 2HNHA 1L8PA 2C0AA 1GOIA 1PZ1A 1ZKQA 2KX9A 3MHUA 3M43A 5DCBA 2REQA 4S39A 4LVFA 4O54A 3ID7A 2V5JA 1CGWA 1E15A 1ECQA 1ONWA 3LB8A 1W1B1 3CUJA 5FJRA 3GIQA 2PGWA 3SI9A 1GTEA 5CPOA 3HJEA 2Y4SA 3C0SA 2PRMA 2CKSA 4MZ8A 3RM4A 5CGQA 3G2GA 2OQLA 4E2OA 3T8LA 4D1JA 3T2OA 4XSMA 4DX3A 3DDMA 2VEPA 4QDPA 1V3JA 5DCEA 3FJLA 1QPOA 1S5TA 4I8DA 2ZZ3A 2DSZA 3M7WA 1ZJAA 3RPTA 4JIIX 3BAJA 2WW5A 1O95A 1W3TA 4Q8QA 5J8LA 2A1YA 1XLBA 3TONA 1OHLA 4AMCA 3POHA 3IK4A 3ABZA 3CB8A 2F5ZA 2W0UA 3R13A 3M46A 3RG6A 1YNPA 3H12A 3H26A 1ZALA 3IC9A 4JN6A 4S3CA 1EP3A 2V2DA 2AGKA 4FPSA 3VDCA 1P0BA 2JE8A 2IPWA 3LPPA 4QITA 3WQ4A 4IPLA 5M1TA 2X1RA 4LBSA 2X99A 3GX9A 3XISA 1VFUA 4WSKA 1GZGA 2DIJA 3EAUA 3CL8A 1PSCA 5E0CA 4GZEA 5D9MA 1KM5A 4J56A 2QJIA 2QEZA 1TPUA 4H4ZA 4Q33A 2HWGA 2WJDA 3F4VA 2QCDA 3P62A 1GOMA 3WDRA 4MZ1A 3W7GA 5I3GA 1F9CA 4JQ1A 3AI0A 4QSHA 1Q6GA 4LAKA 4YIWA 2QMJA 3A4AA 1W9DM 4O1EA 1PTGA 2DPEA 1YADA 2VVSA 2OSWA 4H83A 4L4PA 1FXPA 3LHZA 1RJQA 1IYXA 2VR5A 2Q09A 4NZ1A 4X60A 3T44A 3HV8A 1XSIA 2WOWA 5FI8A 4UZSA 1KXTA 9RUBA 3CGDA 1T3QC 1UHVA 4J3TA 2Y7GA 3L0NA 5HPCA 4ACZA 4M51A 5LKYA 2DQWA 3EMZA 3UGVA 1POJA 1JCNA 1I4NA 3E2QA 4GACA 2I17A 2VHLA 4JHZA 4ORIA 4UMBA 4GI9A 1W1PA 4JS3A 4U2YA 3LSCA 3PAOA 1A80A 4A29A 1J2WA 3WUEA 3WG6A 4AD0A 1IT8A 5D8WA 1BVZA 1ADOA 2F6UA 3CYJA 2JEQA 5CC7A 2W55A 2JKAA 3VNDA 2BGNE 2TPSA 3USZA 1TG7A 1W9UA 5LNRA 2E5BA 4ZEPA 4RCXA 3DI1A 1RBLA 4LTSA 3JS3A 3HG2A 4QCFA 3CT2A 2FTWA 4O28A 3E0WA 1HKJA 4BWLC 4Z1CA 3QYQA 4O4WA 4PTDA 4H9TA 1E0TA 2QJGA 4DO4A 4ZXOA 2WMFA 1QI2A 3BAKA 1XHCA 3W82A 1ZQ5A 2E6FA 4Z1AA 3NA8A 1X7IA 1FFQA 2PWDA 2ZRYA 4K8DA 3W28A 3P81A 5FSDC 2ZZ0A 2PI6A 2E0PA 2GVJA 1XLGA 1KCZA 5CJNA 4H7CA 5T8GA 3W7QA 2NLIA 4O4VA 5I3HA 4RZBA 4PB5A 2LLEA 2VD8A 1DQXA 2BB0A 4HYRA 3R8HA 1LUCB 2ZX9A 4GQBA 2P8CA 1LDCA 1VBGA 4LAMA 5JH1A 1GV4A 2V3BA 4FALA 1JDDA 1W5OA 3MV11 2Z25A 3AS1A 4KFNA 1OABA 1UPMB 3MT1A 1AJZA 1MFUA 2HV5A 3BLLA 4K38A 3ZLGA 3VK5A 2IS7A 2G8ZA 3S1VA 4D8AA 2CC0A 1NF7A 1XH1A 3BAIA 1GQJA 1V3KA 3FLUA 1C9WA 1JCXA 2CZEA 1JCLA 1U33A 1XPGA 3VXGA 1XP3A 1V6VA 3MP4A 4ERIA 1RV8A 5DY2A 1Z44A 1IXQA 3UPMA 9XIMA 2PDIA 3HU7A 1K8CA 2ZZ4A 1QTWA 3G22A 3TYDA 1OCQA 4FOUA 5LGXA 1T96A 2TRSA 3CZJA 4R9XA 1YXYA 2FFIA 2OGJA 5H91A 4X2RA 2QQ6A 1W9BM 1BGGA 4UZUA 3D47A 5H6HA 4WSJA 2BHUA 3GK0A 2NQ5A 5U25A 4DBUA 3FJNA 4JIHA 1H5VA 3NNTA 2VKZG 3DYPA 4L4MA 3VDAA 2FZ9A 4PFMA 3AHXA 4LALA 3NQ2A 2HE5A 1QCWA 1BHGA 4HHPA 3SRFA 3CIWA 4Y9PA 1RAKA 1FOBA 1JVNA 1U5JA 2PP0A 4B5NA 4R9OA 5A3HA 3F7JA 1J79A 2NQZA 5G1MA 5G4HC 2PD5A 4GC3A 5A94A 2JIEA 3FAXA 4J35A 1MUCA 2NPXA 3W22A 2DUZA 4WQ6A 2AKMA 5ABGA 3U7BA 4H9MA 1DJIA 1E6SM 3UWWA 3CB3A 2HQAA 4ONVA 1VF8A 1VBJA 2QCDB 5DY3A 1KFBA 1B4KA 4LYKA 3O15A 1CB2A 4MJ2A 1FWWA 3CBWA 4UTFA 4S3FA 2C19A 1EX5A 3M07A 3R89A 3S5OA 3P61A 1PDZA 3ARTA 2EKGA 5DMLA 4AZ6A 2PF0A 4XSLA 2ZX8A 3WQ5A 3WKZA 1AL7A 3K46A 3KVJA 3L5OA 1DOSA 3VNIA 3N15A 3W38A 3OJGA 3EAOA 5BOOA 3S1XA 2GR3A 4QJ4B 4CQAA 2A7PA 5B80A 3K1GA 5CSSA 4L80A 1Q2RA 4MB3A 4FDCB 4EMIA 3L21A 3V16A 1NP0A 2QDHA 2Y85A 3EXRA 1D3GA 2DZWA 4XVEA 2RGMA 4BS0A 3J7HA 3R12A 5LHEA 4YJ5A 3RO6A 1OC5A 4ALDA 3CUFA 3TFXA 3ZFHA 4EWND 3OP2A 1TWZA 3QLLA 3AIVA 3I3EA 1GJUA 4NJJA 3B0XA 3TA9A 2FMNA 1MW2A 3W88A 4HN8A 3P5ZA 2PC4A 3QN3A 2CZ5A 5LXEA 1JXKA 3DK8A 1OCJA 3GNDA 4AEFA 2HDJA 3B4UA 2AL2B 3A23A 3H7RA 1SFTA 2J7GA 4UFHA 5AZ0A 2GK1A 2IMRA 2OQHA 4CU6A 4AXKA 4DZAA 3H24A 3GC4A 4XO7A 4B4HA 2EQ9A 3R25A 2YBUA 1GOXA 2CESA 5HJYA 3QTGA 5JBEA 1Q63A 1DQUA 2XWDA 2J7HA 4W5ZA 4JPGA 4QDWA 2A21A 1EA9C 1PL9A 1QOXA 3VA8A 3VC6A 4M80A 4PE8A 1KGUA 3EOEA 3GR7A 4LYPA 4D6HA 1OIMA 2HEJA 3V75A 4TVWA 4UTIA 4AWEA 2DGAA 4P8VA 1R9ZA 3RMEA 4MUPA 5A6BD 2Y0FA 3BICA 3WH8A 4RL3A 3LCHA 3MI6A 1B3XA 3N3TA 1PIIA 2PWUA 3AFBA 2VGIA 2V5DA 3LMZA 4DYEA 2X0SA 1PE1A 4HGXA 3S4TA 2ZZBA 2BVWA 1WAWA 3ARXA 2OZ3A 1HKWA 3WLLA 2WP6A 4PUEA 1U2YA 5EMYA 3A47A 5M17A 4HYVA 1UC4A 5LIYX 3W0KA 1VIZA 2PB1A 1VJZA 2J7CA 3FG2P 1RZMA 3TFCA 1UR9A 3LB0A 3M0IA 4F66A 4H6EA 3K30A 4DJED 4HA0A 1VQTA 1VEOA 3QR0A 2XH0A 3UZZA 2XZ9A 5DX7A 4CNTA 4B9ZA 3CTLA 3UGRA 3HFYA 3U8GA 1XLKA 1HJWA 1RP8A 1ZDLA 4TO8A 4QSFA 3W2LA 3KFTA 3WEZA 2XPKA 4FP1A 5FSEC 3CXOA 4XAGA 1TX0A 3NXFA 3DGZA 2MNRA 3N13A 1K77A 3RX2A 1TPB1 1BSLA 4YNGA 1KGWA 1XXXA 3VKCA 5IFTA 4RDZA 3UWUA 2ICSA 2WO5A 4DF1A 1QK0A 5HINA 1DWGM 2QCNA 1W1YA 3H7UA 5AHMA 5K4ZA 4GJIA 2OT0A 1K8XA 2OX4A 3UNDA 1E1EA 3PBVA 4UWMA 3L9CA 3GVGA 4IL2A 1TYGA 4WKAA 4QS5A 3KBSA 2O9TA 4H9ZA 2D0FA 3W1TA 4MPQA 3UJSA 3F2CA 3VIPA 4UFLA 1CTNA 1LTDA 1QMLA 1ZY8A 3BW2A 3U6WA 1Q6LA 4JICA 2R9RA 3EGJA 4C5ZA 4EX4A 3EX4A 1QNSA 3SRDA 1R3RA 2PS2A 4KPRA 4DUWA 3ZIZA 1AOGA 1DIEA 1WXZA 3P74A 3M0YA 2NV9A 1J8VA 3WLKX 4JDYA 4QFUA 5I3FA 1H1NA 2EQ7A 2RGLA 4QLJA 4XIMA 2PDKA 3B03A 4UOJA 4HPNA 2OOFA 3CYVA 3LUTA 3GD3A 3FK4A 1OC7A 1PEZA 2BC1A 1EP1A 7TAAA 3DECA 4HZ7A 1U22A 4CD7A 3OGVA 4GH1A 3DFSA 1RHCA 3OOQA 3I6EA 1R3YA 4MF4A 4GRSA 1MEIA 2DT1A 3UXKA 2E28A 2X1IA 4GLEA 5C0QA 1DWJM 3K8MA 2SFPA 3C3UA 4UOZA 5JBDA 2X2YA 3W1LA 5REQB 2AL1A 5CH9A 1A3WA 2BGSA 2Y7DA 2I9EA 3ABXA 1GETA 2GWNA 1QOPA 5KZ6A 2X1SA 3LMYA 5C2CA 1WUFA 4NHVA 2PDJA 4ML4A 1LT7A 2E6YA 2OMAA 5LNUA 4MKSA 4PBEA 1XD0A 4O0ZA 1UP3A 4BR1A 3R6IA 3ZYZA 1TMHA 3TVAA 3QF0A 1SW7A 1A5BA 2W3RA 4UR9A 4KCVA 2BODX 4ZQNA 3UQNA 1UR2A 3EKZA 3AZSA 1QATA 2VEIA 4QGCA 3QFAA 1ZJHA 3DFHA 3KS6A 1JDFA 2G4FA 1XLEA 1XGEA 3DOPA 4GWEA 1IEQA 4TTGA 4JBRA 5AHFA 4PMZA 4MPKA 3M1ZA 2WMIA 3CHDA 3HQ1A 4BI6A 3N9KA 2A85A 5HBFA 1UD6A 5I2UA 5LNSA 2Y24A 1US0A 3SRHA 1VFMA 3GUGA 2WAGA 3FSTA 1GT8A 1F8MA 1W54A 1MXSA 4JIQA 1A5UA 1C92A 4H9UA 3GTXA 1HO4A 1LROA 1QASA 3BAXA 3U2OA 2QDGA 4GMEA 3PJXA 4X9YA 2IW0A 5CJ5A 1JRBA 2CBVA 1SJDA 3N25A 1FWEC 3NQAA 4FO4A 3SN1A 1MZRA 4GRTA 4LIIA 3EXTA 3ANYA 5EY5A 4JTUA 2GVYA 3WFLA 1TTJA 1EEXA 1XFBA 2ZZ1A 3EB4A 3S46A 2CLEA 3GFZA 1FVPA 1PDYA 3S42A 1FUYA 2V3AA 3W7NA 4YTUA 5I6SA 5I7GA 1WDPA 4JQ2A 3PR2A 4ZCWA 3WLOA 4O12A 2X7VA 4U31A 4LS2A 2J8TA 1SFJA 2H90A 1LRNA 3FVDA 4E38A 3WDIA 3WLIA 1CGYA 1QHPA 1EOKA 2D3LA 3CO4A 4DBSA 1B90A 1ISZA 4AD3A 4RZ6A 1KB3A 5F4WA 4E0CA 1C8QA 2NXIA 1JDCA 4QDMA 2VEMA 3WX7A 4AWTA 4DB7A 4AZHA 5FJOA 4IXHA 1JRPA 5I0DA 1AJ2A 1TX2A 5DT7A 3S9ZA 3KEHA 1NIUA 1PKMA 2Y5EA 4P5UA 1WYIA 5HWJA 2YBVA 2RABA 3WH5A 2WZIA 4MHBA 2Z2BA 3I68A 1XLLA 3AXHA 1F3XA 3HV9A 3VDHA 1PWMA 3N12A 1YKWA 3D0CA 4E2BA 8XIAA 2PE4A 4AZ5A 1XCFA 2OPJA 1E0WA 5DBUA 5JU6A 2QAPA 1WX0A 3UJRA 4CN4A 4BI5A 4QE5A 4YHGA 3RPDA 3NIYA 3QSTA 1MOKA 3H23A 4MAZA 2GVLA 2Q8XA 3PB0A 4QLKA 5ENLA 1TB3A 1SQ7A 4AB4A 3V5FA 3SM0A 4WLCA 1SU5A 5LA0A 4WDWA 3OYZA 1TVNA 3UBPC 3TR2A 1Q6QA 3VI2A 4J5NA 4HN4A 1NM9A 4XISA 4YXGA 2A3CA 4S2BA 4C6NA 2E6DA 5I09A 5JH2A 2CLHA 3ARQA 5D03A 1J2BA 1F8WA 3EDEA 4AY1A 5DF0A 4ZO9A 3TAKA 3LBOA 2VVNA 1RSCA 4QCEA 3HRDC 3G1YA 4LAOA 1O68A 2OODA 4EWJA 1FWGC 3WJWA 5KINA 1XICA 2ZDRA 2NT0A 2VC9A 1XPYA 4CCDA 4JDBA 2IPJA 1SZRA 3NFUA 4XZIA 4IP5A 4NRRA 3ZT5A 1HJVA 4AIUA 1DJNA 2YFNA 3M7SA 4MGGA 1W17A 4HK7A 3EOOA 5A2BA 2GPTA 3IIVA 3PZQA 1IEIA 3N18A 1TIMA 3VKDA 1KQZA 1XIJA 3NL5A 2RAGA 4OKDA 4F2BA 1X2GA 4GIAA 3TXZA 3QY8A 3BQ5A 1A0CA 4HB7A 3OC4A 1ZU8A 2GDVA 1AQFA 3PZMA 4NI8A 4U3CA 5AC5A 1XYCA 1M01A 1QBAA 3RCMA 4OTKA 1F8IA 4A8IA 4CD5A 5LIKX 3IGHX 3MUCA 3UXIA 5BXPA 2OQYA 3RXZA 4LFYA 3GY1A 2VUNA 2NSXA 3TCSA 2YVFA 2AQWA 2J66A 4HHHA 4D6DA 5BWFA 3K2GA 6A3HA 2P76A 4NZ5A 5CZKA 1HL9A 2UY3A 2ZRWA 3P60A 1B3OA 1KKRA 4KGLA 3WF4A 4JTQA 1PO9A 3U5YA 3GW0A 4XZWA 2OO6A 2C3DA 3TZNA 2QF8A 3I3BA 3U2EA 4N6FA 1FH7A 4BQ2A 3SCWA 4H7ZA 1XYAA 3WLQA 1TFVA 3LA4A 5M03A 1I1XA 4AW7A 1BRLA 4R34A 2PRHA 4ZO8A 5HJLA 1W1IE 1OX4B 3CQKA 5T26A 1O6IA 3PPGA 2H6RA 1JFHA 4GR1A 3F03K 2FHFA 4GGBA 4HK5A 4AD2A 2PP3A 1MRAA 5IRPA 3FKKA 1MYRA 1FWCC 3P67A 4L6HA 4Y7EA 3DGBA 1XLDA 3A21A 4BQ3A 2PU0A 3VIKA 2PWGA 3MUZ1 4DAIA 1TMLA 2WPCA 4Z2HA 3FYPA 3GDKA 4UQ9A 3L5AA 1TE1A 3BG5A 4BFAA 3LCWA 3TQ0A 3KOZA 1XIHA 3NQBA 3IJLA 4HZ8A 1F73A 1N62C 1NAL1 3QFBA 4G7EA 4LVGA 2CNCA 1E9LA 2P8BA 3MV01 3KBWA 2DORA 3C86A 1UBSA 4HSHA 3CASA 2E8ZA 4AWUA 3GVQA 4K8HA 3DERA 5EBAA 5GVJA 4F40A 4UQAA 1XC6A 3M0XA 4K36A 4Z2LA 3NVVB 1QXLA 3NPXA 1S7MA 3AHYA 5LA2A 4E4PA 3Q2DA 3N1AA 4WOQA 4RJEA 4MM1A 1OFEA 1FY6A 4JTRA 3VD9A 4J3VA 4MNLA 3EOSA 1UIOA 2QW5A 4LUTA 5HMSA 1YPIA 5EKYA 3LCXA 4NZCA 4C6KA 3W4RA 1HF6A 1G4TA 2QYGA 2Z7GA 3NL3A 1CW2A 4LXFA 3REQA 1M7OA 4L6OA 3WD4A 4Q6JA 4LNCA 1J0YA 4Y2WA 3M5VA 3D3AA 4BY3A 2PGRA 2BY3A 4JTFA 3BV7A 3S0CA 1KXVA 3GTHA 1H7PA 3LERA 4JFTA 1UROA 3U2CA 1L9WA 4C6PA 4NNBA 1ZK7A 5E09A 3SECA 5AYYA 1LWJA 3RRXA 3ME3A 3I10A 1DVJA 2ACQA 4H4TA 3BSGA 4O17A 1OFQA 4UNKA 3W53A 3LLXA 4Y8FA 3R0UA 1KFWA 1J0KA 4PUMA 4C6MA 2J77A 1X1OA 2HS6A 1TPWA 2DDXA 5H8PA 3UPBA 5F2GA 2QMKA 1OYAA 1OFAA 4PEEA 4FNQA 3GVRA 1IXOA 1P5BA 3OO2A 4EM3A 3WQ8A 3POCA 2QS8A 3EOUA 5BXRA 5JIPA 2B7QA 4DBEA 3AJ7A 3MMTA 4DWSA 2MUCA 3OHMB 5AVHA 3G1AA 4ZB0A 4AZGA 3QBUA 3W01A 3KVLA 5DXYA 1NVMA 1TVPA 5HMFA 4M6PA 5AC7A 4N6EA 3GSMA 3IV8A 3TUUA 2Y70A 3NVDA 1YEYA 2XN2A 2QKFA 4KCTA 1F3WA 5I02A 1UA7A 2F9RA 1RLDA 3OG3A 3W07A 1W0MA 4HNVA 4N2YA 5HJXA 4GBDA 3A7RA 4H4XA 3CV7A 1MO0A 4NSBA 1VHNA 1KBIA 1ZBVA 2EPMX 4RE4A 2CXGA 3C2YA 2R1KA 3GG7A 1ODUA 2Z00A 4AC1X 2RH9A 2ZRUA 2JBMA 2TMDA 3GXTA 2Z1VA 5BXSA 2EPLX 2EF9A 3Q45A 2J74A 4AZCB 2C79A 2DT0A 4H00A 5CSYA 3LENA 3NVYB 4DIAA 3AN1A 1BRLB 3AJXA 3M47A 2VQTA 4GXMA 1DIKA 3JZEA 1BD0A 4QG6A 3NQDA 2BFGA 2Y7FA 1PKYA 1E1CA 3FEQA 5RUBA 2VL4A 3T40A 2QGYA 3HOJA 4ZOAA 3ECQA 1MDRA 4PUJA 1IV8A 1Q65A 3IUHA 2AMXA 3IGSA 2O56A 4NEVA 4DLMA 1IGSA 1RCOB 4PMUA 3TA6A 3TKFA 3QR3A 1JGIA 4U33A 1VPQA 4EPBC 3WNOA 1KM4A 1EXBA 3HPZA 3R8RA 1W8SA 1XS2A 1E56A 1XV8A 1EH9A 1O94A 2Y6ZA 5IBXA 2BLEA 3AZTA 5LXXA 5I78A 3R2GA 1H1ZA 3G8EA 3S83A 4XIAA 3IEBA 5FEPA 3W7EA 1EO5A 4ML9A 4IIEA 1UH2A 2NVCA 4GUJA 4DEFA 4CVWA 1WKEA 1JF6A 1WZLA 1W5MA 1RA0A 4MLJA 2OEMA 2DZXA 3S9IA 3F1QA 4HNNA 4Y96A 2V3DA 2J9YA 3BMWA 1EIXA 1R2SA 4UTKA 1RUSA 1AH3A 1GWJA 3B9AA 1JOAA 1J18A 1V0MA 1RALA 3WD0A 5JCNA 1WO2A 2IKJA 3DH9A 3ARWA 5HNRA 3W6LA 5FIPA 3ARZA 1H50A 4MDPA 1R6WA 2XYLA 1PV8A 4BQ4A 3SR7A 1GYMA