3QPEA

Crystal structure of galacturonate dehydratase from geobacillus sp. complexed with d-galacturonate and 5-keto-4-deoxy-d-galacturonate
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
385
structure length
385
Chain Sequence
LNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Galacturonate Dehydratase from GEOBACILLUS SP. complexed with D-Galacturonate and 5-keto-4-deoxy-D-Galacturonate
rcsb
source organism Paenibacillus sp.
molecule tags Metal binding protein
molecule keywords Mandelate racemase/muconate lactonizing protein
total genus 134
structure length 385
sequence length 385
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3qpeA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3qpeA01
3FVDA 2DW7A 1MRAA 4DYEA 3FJ4A 1JCTA 1TE6A 4DN1A 1R6WA 2AL2B 1KCZA 3CAWA 3SN0A 1IYXA 3DFYA 3RRAA 3UCDA 3R10A 3SN1A 3ZLHA 3OPSA 2OZTA 2OZ8A 3VA8A 3QPEA 3MQTA 3UJFA 2AKZA 1WUEA 1EC7A 4KEMA 3UJSA 2OQHA 3QTPA 4G7FA 5FJOA 4HCHA 3K1GA 2XH4A 2OVLA 3Q45A 4MKSA 1ECQA 2ZC8A 4X2PA 4A3RA 3TJ4A 2PSNA 3TCSA 1TKKA 4ZA0A 5FJUA 3ZLFA 3PFRA 1YEYA 2MNRA 3CK5A 3OP2A 3JZUA 4A6GA 3NZGA 3EKGA 4MGGA 1EBHA 3T9PA 3R0UA 3N4EA 2OKTA 3N6JA 3STPA 3FV9A 2PGWA 4HCLA 3H7VA 3V5FA 2QJNA 3ZVIA 2HXUA 3U9IA 4GGHA 3V4BA 1EC8A 3SBFA 1W6TA 5IDZA 3UGVA 4K2SA 2QVHA 4G8TA 3JW7A 2O56A 3IK4A 3I6TA 4FP1A 4IP4A 3THUA 1JDFA 4ROPA 2MUCA 5BOEA 1MDLA 3FYYA 3T8QA 1BKHA 4M6UA 3CT2A 2PCEA 4E4FA 3I4KA 5FJRA 1SJBA 3MY9A 4F4RA 3VCNA 2P88A 3TW9A 3OTRA 1JPDX 1JPMA 3DIPA 3SQSA 1PDYA 2AL2A 3S47A 4H19A 2FYMA 3ZLGA 3VC5A 6ENLA 3MKCA 3P0WA 1FHUA 1SJAA 2XGZA 4GYPA 3H8AA 3IJQA 7ENLA 3GY1A 2OZ3A 3HPFA 2OFJA 4JN8A 2CHRA 2OQYA 3ENLA 4YWSA 3FCPA 3MSYA 3P93A 2DW6A 4IL0A 3QKEA 1BQGA 2OO6A 1EC9A 1NELA 1P48A 3SJNA 2OPJA 1NU5A 4JN7A 2GSHA 3DESA 2XSXA 2GGGA 2PU0A 3DG7A 4DWDA 4DX3A 2GDQA 2QGYA 2P8CA 4M0XA 3UJRA 3DERA 3R0KA 2PTXA 3VCCA 1PDZA 3DDMA 3V5CA 1EBGA 2GGIA 3PWGA 1FHVA 1MUCA 3OW1A 5EU9A 3BJSA 3FXGA 3UXLA 3GC2A 1MNSA 1WUFA 2QJJA 4A35A 3H12A 2GGEA 4K1WA 2NQLA 4IHCA 1TZZA 3S5SA 3TQPA 3IJIA 1L8PA 1F9CA 2PA6A 4HYRA 3VDGA 2POZA 5J04A 4GFIA 3RCYA 3CB3A 3I6EA 5ENLA 4Z1YA 4H2HA 2PP3A 4K8GA 2HZGA 2P3ZA 3MUCA 2QJMA 3OZYA 1KD0A 4IP5A 4GMEA 2PMQA 3NXLA 4DHGA 1ONEA 4GGBA 3UXKA 3DGBA 3R25A 3DFHA 3QN3A 3SSZA 1DTNA 4HN8A 3B97A 3BSMA 4IL2A 3GO2A 4ENLA 2XH2A 3CYJA 3NO1A 3T4WA 2AL1A 4KT2A 1P43A 3BOXA 1SJDA 3D46A 1R0MA 2PTYA 3V3WA 2P8BA 3Q4DA 2GGHA 2GGJA 2ZADA 1XPYA 4MMWA 3QLDA 3MZNA 3VC6A 2I5QA 2PPGA 4GISA 4E8GA 3T6CA 3GD6A 3R11A 1RVKA 3U4FA 3H70A 4IZGA 2QQ6A 3TTEA 3RO6A 3UJ2A 3IJLA 3CXOA 4EWJA 2QDEA 4H83A 2OX4A 4IT1A 4E4UA 1SJCA 3OZMA 4FI4A 4H1ZA 1MDRA 5BOFA 4DXKA 5FJPA 2PTZA 3PK7A 3RR1A 2PODA 2PP1A 3EEZA 4J3ZA 4ZCWA 3RITA 2QDDA 3DEQA 2PU1A 3UJEA 3MWCA 3UCCA 1E9IA 3TWAA 3SN4A 2AKMA 2ONEA 2RDXA 3RGTA 4GYPC 2XH7A 4E6MA 3ZVHA 3DG6A 3ES7A 3N6HA 4E5TA 2PP0A 2GL5A 4HPNA 2FKPA 1KKRA 1ELSA 3R1ZA 1OEPA 4HNLA 3KUMA 5FJTA 3VFCA 3NFUA 1XS2A 3P3BA 3ES8A 4J1OA 2PS2A 2PGEA 3JVAA 4HNCA 4KWSA 2HXTA 4HCDA 3PWIA 2XH0A 3D47A 4JHMA 2OG9A 3ZVHB 3TWBA 3N4FA 3DG3A 4Z17A 1KKOA 2PTWA 2OLAA 3TJIA 2HNEA 4KPLA 3TOYA 2P0IA 4GIRA
chains in the Genus database with same CATH superfamily
1UP2A 4C5YA 3HQOA 1GKPA 1PSCA 3UT0A 3QQ0A 1V6XA 2AMGA 4PMNA 1TE6A 4ERAA 1JF6A 4PB5A 3RIKA 4AIOA 6REQA 9RUBA 2V0TA 1W5OA 4OE7A 1U30A 4MZYA 3GKAA 1X7FA 3K4DA 3BW2A 4YJ5A 3A23A 4DJDA 1VYSX 3JR2A 2E25A 4GY0A 4B9ZA 4Q8NA 3LU2A 4UOJA 1YTKA 3CHFA 4GIAA 2ALDA 1S5WA 1MZRA 2GR3A 3GXPA 2IKJA 1VBGA 1OZMA 1B9BA 1M3UA 3VUSA 4YVVA 2QCNA 4NJKA 5G4EA 4AIUA 1J0IA 3CH0A 4O15A 1H1ZA 1AQHA 4I9AA 1KC7A 3TCSA 2OOFA 1ZBCA 4GABA 3EAOA 4AYSA 2E0PA 5HJLA 3HV9A 1EX5A 3OP2A 3M0MA 3PANA 5BZAA 1EX1A 4V33A 3WK2A 4NJIA 1EP3A 1EJSC 3EX3A 3N2MA 1JGIA 1N8IA 4LUTB 2WPEA 4HYWA 4J3XA 4RXFA 3H7UA 2X30A 1CXIA 1J6PA 3LHZA 3BK0A 1XLJA 4L5ZA 5TBOA 1ZDLA 4UNLA 3QFWA 3W1TA 3L4YA 1GQJA 4HHHA 1JAEA 2VQUA 3O6DA 1WKFA 1K8ZA 2CHNA 1IT7A 2HBVA 2QT3A 1GZJA 4MZ1A 4A05A 3VKBA 2IMRA 3CMFA 2DJXA 3RX4A 4QX4A 3VIGA 2UZ9A 3WH7A 1Q1RA 3CMGA 4WKHA 3VABA 2VZOA 4M6UA 3BANA 3QZ6A 1YDOA 1P1XA 3BSHA 2E9BA 3DI0A 4ZMGA 3MHFA 2REQB 3DK4A 2A2IA 4PUWA 1O12A 1BVWA 1TWSA 1JPDX 4NIRA 5EBUA 3CUHA 4K6AA 5TNVA 3TYAA 1GW1A 6PTDA 4BY3A 4EK7A 3PVFA 3IJ7A 3VC5A 2GRTA 1R7OA 1HKKA 5E0CA 1AW5A 1CGTA 1TYPA 3BCFA 1QU4A 4DVOA 3CAKA 1C7TA 1TELA 3C2RA 3DX5A 2OYKA 2OSYA 3EOOA 1ZQ5A 3CHCA 2QPSA 4C7GA 3EMZA 1NDAA 1I2NA 5HNNA 1A4MA 4KBXA 4L6OA 2G0WA 3SCUA 4F2BA 4UTJA 2V8ZA 4D8AA 3JUGA 4AAJA 4FXFA 5D05A 3PPCA 1BAGA 4O19A 3WNPA 3T0TA 2ACQA 4KQNA 4M6PA 5I3IA 3PZTA 1UB3A 4I9JA 3VKCA 5MF5A 3FGCB 5T26A 2G96A 3OLDA 4W87A 1XG3A 4Q8QA 4RV3A 3UWUA 2PURA 4HTBA 3QPZA 1PYFA 4PMDA 3GXMA 3R7MA 2WB5A 3PPHA 1GKQA 4AX6A 2WZMA 4CD7A 5F2LA 2RUSA 4EPEC 1EIBA 4UQAA 2OO0A 2ANUA 3SCOA 1CGYA 4ZOBA 5FJIA 3CZ8A 5C54A 1ML1A 3EEGA 4QS6A 2V5JA 4DM1A 2VCBA 4LU0A 4XWUA 3OZYA 3QSRA 1E4IA 2VFDA 3RN6A 5LHEA 5HMDA 1OCBA 4N9CA 1YTEA 3T44A 1TX2A 4C6JA 1I60A 1W3KA 2QV5A 3R25A 3AHXA 3PZVA 2DORA 2VVSA 1WXYA 2TRSA 4IFOA 3BPWA 1BRLB 1DYSA 1D2KA 2TAAA 2EO7A 1LROA 1OHLA 3RG6A 3RPMA 1SU5A 2XH2A 3MI3A 1OX5A 1SPQA 3C8NA 2FVKA 2E9MA 2Z6JA 5E5CA 1HKIA 2ZXDA 1GQKA 3D6NA 4QRNA 1BWVA 1BZLA 5AB3A 2X7VA 3GU9A 1M5WA 3W29A 1XCWA 4E8GA 1EEPA 4Y6GA 4DUXA 2VNCA 1EGZA 1YW1A 1ZZMA 3DUGA 5TF0A 3RO6A 2J8GA 3ZIZA 3GTHA 2QDEA 3LV6A 5E0KA 3MMWA 1B3VA 4BK9A 4FI4A 3TLQA 1MDRA 2CWXA 5CH9A 3DYOA 3G3DA 2B7NA 3RR1A 1DXEA 2CBUA 1QNQA 3RITA 2DVXA 3QFEA 1E55A 3D9XA 1DOSA 3M7WA 4J4KA 3VX0A 4QAIA 1BD0A 1XIGA 3B05A 2WMFA 4AEEA 4TTGA 4HU4A 3GXFA 1K8CA 4M1BA 4WGXA 1XH2A 1QMLA 4GVIA 3EDFA 3PNZA 1LOSA 2XSAA 4CNSA 3ES7A 1F3XA 3LLFA 4FOKA 2FJUB 1VYRA 2VOMA 3C0QA 1RPKA 5BWAA 3W25A 2ZICA 3OJGA 3TW6A 4U2ZA 1NVMA 2EQ9A 2DDXA 5G5IA 4WXYA 1FWIC 5FS6A 1W9VA 1ECEA 5AC6A 3A4JA 3FDKA 3D47A 4QJ3B 3F4NA 1DJXA 2VX7A 5GJMA 1X97A 1PVNA 1XIHA 1NHSA 4CUCA 4Z17A 5CZ0A 2OLAA 3R8GA 4KPLA 3GXTA 3LSCA 4NY2A 1LWHA 2VRQA 1ISYA 3OGVA 1CZ1A 4WY0A 5K3VA 1Q66A 3B0YA 1JXJA 3RLVA 1CLVA 1U5VA 2Y0FA 1JL8A 5CPSA 3KDOA 4S3BA 2CZDA 4DF2A 3RRAA 4HMNA 1US3A 2BODX 1FCUA 4UXDA 3VZZA 3ZLHA 1TTJA 3VNJA 3O06A 4MB4A 4G6CA 1TPB1 4KW2A 3U57A 1SZEA 1WUEA 1PXGA 3RJXA 3AHYA 2CZFA 3FXYA 5BOOA 1DWAM 4JQ4A 5B7ZA 1GWJA 3K1GA 1V5XA 2OVLA 2ZC8A 4A3RA 2WJDA 1B3YA 4YTRA 3CTTA 2QJGA 2SFPA 1M04A 5HXMA 2GFTA 4F0MA 1ZRQA 4GH1A 4MNJA 3LRLA 5LA0A 5F2MA 3CQ0A 2GQ9A 3JS3A 4PN2A 3G22A 1LOLA 3R0UA 3L65A 3LQLA 5JVLA 4LBRA 3WQCA 3I65A 1DBTA 2WNZA 1GESA 1R86A 2E6DA 3V5FA 5KZMA 5C2GA 3MCMA 4EPKA 1XBYA 2HXUA 4ZQPA 1UWTA 3LXAA 3SFWA 3U9IA 5CSSA 1MO9A 1B4EA 3RR4A 3CBWA 3IAQA 4H7ZA 4MFEA 3U48A 3B8TA 5REQB 2HVNA 3WH5A 4MJ4A 1GOQA 3G1XA 4P7LA 1K6AA 3M0VA 2V5BA 5FACA 4RPQA 1DPMA 4LY8A 5CG0A 3KFTA 1UD3A 3F2DA 4Z1CA 1V6YA 4W7VA 1KFLA 4WKFA 4DM2A 1FWBC 3IJ8A 4QQUA 1U83A 3GBEA 1VHNA 3CB8A 3W1LA 2PDNA 2P53A 5F2IA 1ZTVA 4GIEA 5HQEA 2I5GA 1VJIA 2F9RA 2FYMA 2YBVA 5EPDA 1WOBA 3MKCA 3TQVA 2C6QA 3PBVA 1VRDA 3NL2A 4LVGA 4NQ1A 1ZHAA 2HS6A 2EEXA 2V30A 3DBNA 3HZ3A 1VC4A 4ACZB 4FALA 3W1MA 5AHFA 3CZJA 5DCBA 5REQA 1W31A 1E56A 1M1BA 3KX6A 3HPAA 4O1EA 2DW6A 3QKEA 1HGYA 1BQGA 4KH2A 2PRHA 3FAWA 1JNDA 1XWYA 4O1FA 1TPC1 1NU5A 3UW6A 1F8IA 4ZO7A 2GSEA 1B9ZA 3M07A 3VO0A 2O9OA 3G1YA 5C9XA 2DU2A 4MAZA 3EDEA 3VAVA 4ZO6A 3R07C 4ZOAA 2I57A 4H6QA 4GJJA 3ONCA 2R1LA 2Y8VA 3KP1A 4PEKA 2JQXA 3TAKA 1TJ1A 3GWQA 1HW6A 1QATA 4D1IA 1LL7A 4AWEA 4MNMA 1JYVA 1ZFJA 2VR5A 2ZX5A 3UERA 1VKFA 3C0JA 5FS8A 1S46A 5I6SA 4HPGA 1ZP3A 1EYWA 4M6VA 4ZSTA 4YHGA 5HPOA 3LERA 4K7YA 4M3PA 1YBQA 1WUFA 2XZ9A 4RDWA 1NWUA 3QH2A 4DY1A 1WXJA 1RCOB 1O60A 1I2QA 4PUDA 3M47A 3TC7A 5J5RA 4JTFA 2PE4A 2Z29A 4JNMA 4MZ8A 4J35A 3N2TA 1J11A 3A9BA 4KFOA 5CZKA 4JR5A 3BXWA 1FWNA 4INFA 4HSOA 1C92A 4EXQA 2NWRA 3BZJA 3QYSA 4CVWA 2YAUA 4JDBA 2INZA 1S5MA 5E0FA 1QVBA 5KSWA 1VFSA 2ZA2A 4GUFA 4DI9A 4CGTA 2AAQA 2A3BA 4GQGA 1TV5A 1FWRA 4UQCA 3H53A 2V69A 4QQ3A 1IT8A 5AY7A 4JL2A 1ZAHA 1FWTA 3E2SA 3BUVA 4D9PA 1HVXA 3LADA 3A3WA 2PDIA 5CLTA 3PSVA 3NSMA 1K1DA 1IXPA 2FLIA 3EDJA 3VDHA 1S2UA 2P8BA 4JTJA 3QHOA 5FSEC 3MYOA 5DQPA 5AYIA 1ZU8A 1XRFA 2OT1A 2BMBA 4EF8A 1P5BA 2Z7GA 3NPVA 3FJNA 3QW4B 3VOIA 2O7QA 3BWWA 3TU9A 3A64A 4B90A 4O53A 3OBEA 3VNIA 3B0VC 1ONRA 2BNJA 1RVKA 1NP0A 1UIPA 1NPXA 5DBTA 4XZBA 3CXOA 3LMZA 4UFJA 1XDJA 5EYWA 1PCKA 1X8CA 4Q7BA 2GJLA 4E4UA 3O8AA 3XISA 3NQ2A 4F3HA 2OEKA 4NNCA 2QEZA 1XIIA 3ABXA 3VDAA 3DEQA 4W8LA 2FPVA 1O5QA 4LEFA 5T9CE 3TWAA 1OGSA 4WLCA 4H4YA 1E3ZA 4S1FA 2BBFA 4XAYA 5CC7A 4ILSA 4Q7IA 4IFKA 1EJ7L 1VPYA 1OFBA 4JTSA 5BMXA 4MB5A 1EA0A 3OYZA 3GUGA 2WM0A 4I9TA 3WJYA 3TZFA 3W26A 2UY3A 3L0KA 1SFSA 3WQ4A 3BLEA 1ZSXA 2E8YA 1EXBA 4LXFA 3GXNA 4FPSA 4JIIX 2PC8A 4UTTC 4HNCA 5JU6A 1A49A 2V3FA 5TIMA 1XF0A 3A13A 1GRBA 2Z4GA 4B5VA 6ALDA 3C8FA 2BG5A 4JHMA 1B3OA 1PS9A 4R53A 1K7XA 5DEZA 4F0LA 3K2GA 1UWIA 5EA9A 1U5HA 3B40A 3MVTA 4IOTA 1P7TB 5FOOA 3WIJA 2WXDM 3E0IA 4U10A 1MZHA 4LAMA 2H8ZA 3T07A 2RGMA 4FXRA 1F2JA 3W2NA 3EPMA 1RR2A 1F7BA 4IH3A 4PTVA 3W0KA 3A5FA 4LB3A 1OVDA 4GVGA 4U3AA 3VD7A 4ACYA 1LG1A 4AIBA 3ABZA 1IYXA 1V6WA 3F4VA 1TJPA 3EYPA 1GVYA 3ZR4A 4J3WA 1EYEA 4XZLX 2EKGA 1R3WA 4LCQA 3M4HA 1FDZA 2ALRA 3G1AA 4HOXA 4P7RA 1R9XA 2YA0A 1VENA 2VTFA 3UY7A 3UPWA 3OVPA 4QLJA 1EC7A 4IUOA 1KBIA 4CEXC 3UJSA 3SUSA 5H91A 2OQHA 3G5EA 5IBXA 1F61A 2UY5A 3C2YA 4X22A 3M46A 2TYSA 5C5YA 3TJ4A 5AVHA 3GFZA 2VT0A 1FTXA 2YVGA 1EL3A 2A85A 3WL0A 3W1AA 4C90A 3LBOA 1ZJAA 3HF3A 3AISA 5A8QA 4YPJA 2ICSA 1DIOA 3EKGA 4LAZA 3KWXA 3MKKA 2ZRYA 4S39A 2PBOA 4AD5A 3LHUA 3MSGA 1G4EA 5A6SA 1DJHA 1E70M 5DMMA 1C8VA 4KIEA 4MF4A 3WNKA 1WCGA 2YQUA 3VGBA 1Q6CA 4OTKA 3HW2A 2PB1A 3AS3A 3UQNA 4DWSC 4Q6XA 4Z2IA 5CXPA 1GHRA 3NA8A 1SSGA 3UGVA 5FL0A 2QVHA 1H62A 1OJTA 1LUCA 3GH4A 4MNKA 1SO6A 4GWEA 4HOZA 2YL5A 5JMUA 3FYYA 1H6VA 3EB2A 3WQVA 5JCNA 1H1NA 3U2CA 4C60A 2RKXA 3N2BA 3A21A 3L67A 5JXQA 5M5DA 4B3KA 4GZIA 4QTGA 2BGSA 4ALDA 5JCIA 4G5DA 3GZ3A 5AHIA 4DJFD 1WE5A 1KN0A 3ZLGA 3VVGA 2ZUWA 3W37A 3CUXA 1QI2A 3WQ8A 2BXYA 4UQBA 4B3LA 3HPFA 4JN8A 2O9RA 2PDQA 3RILA 4UNIA 3VOCA 1YNYA 1FRBA 3WUBA 1H63A 2P3EA 2E1DA 3B8SA 2WVVA 1EEXA 2BZNA 3NURA 3QW3A 3REQB 1UG6A 3YPIA 3SJNA 3PN8A 3R13A 3NS1B 1IXQA 1XG4A 4H4IA 1W9BM 1I1XA 1I0BA 3CPUA 1AH4A 4JY9A 1FWGC 3FVMA 3KOWA 1FXPA 1FWHC 2KAUC 4K68A 1C90A 1U1JA 4PCTA 1SR9A 1Q6RA 1TRDA 4LV4A 2J9XA 3SAZA 2PGRA 3S2NA 4JS3A 1W8GA 3P82A 3U2OA 5I00A 1AMKA 1MUCA 1PHQA 4JQAA 1WKDA 1TV7A 4PUMA 2O55A 4NILA 2EBNA 4MM1A 3GC2A 3CEPA 4P61A 4A35A 2QJIA 3LTPA 3HG5A 3ELFA 1LCOA 1QTWA 4MWAC 3I3DA 4PTMA 4H4PA 3ONBA 3N04A 4KWWA 3EWCA 2C1GA 2RJGA 3AFBA 4JX4A 3ARPA 1M7JA 5CPNA 2HK1A 1RD6A 3NQDA 4D6DA 2BLEA 2FDMA 2YDRA 3H4GA 2QIIA 1B3ZA 1YPFA 2IKGA 1EIXA 3KOYA 5G1YA 2NVAA 3P67A 4TR9A 4IP5A 4LB4A 3NXLA 4G56A 1A0DA 1O1HA 2J25A 1LOQA 1BVNP 5D4YA 3NQMA 2EAWA 4IICA 3W88A 5DT5A 4Z1AA 5CPMA 1SW7A 2FPYA 2VR4A 3IUDA 3SSJA 2J13A 1R2RA 2IKIA 2PDXA 3MA8A 4GZEA 1FX6A 2HE5A 4GQRA 3N12A 4IMCA 2J47A 4QBXA 1FDJA 1SFJA 4TO8A 4QCEA 3PBWA 4N02A 1J12A 2WPGA 4LUTA 3UF9A 2P5NA 1EF2A 2A3CA 1MXSA 2ABBA 2WVSA 3NQAA 3CUJA 3HPSA 3QV7A 2XG9A 1KFBA 3BMVA 1UZDA 5K9DA 3IJLA 2WANA 4R7OA 1SYTA 2F6XA 4WJ8A 3QMTA 3N2XA 3ITGA 3AZRA 3TA6A 4H00A 1AD4A 3GDKA 4AVOA 1W9DM 2PDYA 1H7XA 4NNAA 5D2WA 4K36A 4ACZA 2JIWA 4OT7A 1WZMA 1I2OA 1FKWA 1Q13A 1CENA 4UOQA 3N9RA 4I7WA 4LT9A 3VKDA 3WJWA 4AQLA 2OWXA 2VZTA 3IUIA 2D2GA 2AGTA 3IVSA 4DWSA 2Z2BA 3O63A 1OY0A 4QITA 4XUYA 3QPYA 4M7SA 1RY0A 3LLDA 1ZP4A 2DVTA 4L4OA 4IGNA 3GG0A 1HJWA 3P5ZA 4UTUA 4FX9A 2PS2A 1PIGA 3QV8A 3RX3A 4KWSA 2HXTA 4HCDA 1RUSA 3D3AA 2XYLA 5H8PA 2OG9A 1WDDA 3VNZA 1G4PA 2C16A 1N62C 1GRFA 3VUPA 2V68A 1GOOA 4GI6A 3ITXA 1YBQB 2QLYA 3UU0A 4RK8A 5DX7A 1NWRA 4JTKA 2D3LA 2X8RA 3KBMA 2EPMX 3E2VA 4G1NA 4C6EA 3AAMA 1KCZA 2G95A 3TAOA 5I02A 3S8HA 3TTQA 1CGUA 4MHBA 5B80A 4GC4A 2POTA 3BARA 3TYBA 2IQ0A 1XM3A 3NQVA 5E70A 4EQWA 2BB0A 2ZRXA 3MC5A 4GY1A 4LWWA 1UD6A 1J8VA 2BDQA 2VHLA 4OIFA 3QPEA 2J75A 3CZLA 1V0KA 2QCGA 3UWQA 3B9OA 4JGDA 3NYDA 4LRSA 3QTPA 4R27A 4G7FA 1ZY9A 1HKWA 2X42A 2ZOXA 3HQPA 4XZNX 4BJHA 1FEBA 1EPXA 3FOKA 4CCCA 3AROA 3WQDA 2MNRA 4IXHA 1KQZA 3QRHA 1LBMA 2CPUA 4PYSA 1E0VA 1H0GA 1XLIA 1PWMA 3UVAA 4PB4A 1V0MA 3MANA 4PCPA 1UZ4A 1D8WA 4DXVA 1N8WA 1NDZA 3GG8A 2CKSA 2DSKA 3NZPA 2NUYA 1G69A 3N13A 3QQWA 5HUOA 1OINA 3OHMB 3WLRA 5I2UA 1J10A 1UKTA 2ZZ2A 1KFCA 3M44A 4O14A 5C9UA 2W54A 4XD3A 4C6QA 1V6UA 5H8MA 2J88A 1PBGA 1OIFA 3CT2A 3WDQA 2HVMA 5HJXA 4BWLA 2W0UA 3NM3A 4F4RA 3EBVA 4F66A 2JF7A 7CGTA 4UTWA 5CJMA 1YKWA 6XIMA 2IUZA 4AHPA 3OTRA 4DZAA 2INEA 1W1A1 3E9AA 1OG6A 3SY8A 2W63A 2ISDA 3TJLA 3MW7A 1WPCA 4H8NA 2NXIA 1W3JA 3ABQA 2CERA 1IEWA 5FF3A 4OOZA 5GJNA 2TSYA 5FMHA 1C9WA 2I1OA 3VKAA 3DENA 4R5EA 3WEMA 2C15A 1SFLA 3IJQA 3GY1A 2OZ3A 3E5PA 4EACA 4RLIA 2IS7A 3AS2A 4C1LA 3MPGA 1RPXA 1EBDA 3KL0A 1NARA 4UUIA 4L56A 1J96A 2BV9A 4LEQA 1EJUC 1JFHA 1EUAA 3LCIA 1JDAA 3DESA 1FWWA 3A5VA 3UG3A 4UB9A 3C4UA 1H7NA 1IXOA 3FSUA 1QPRA 1C9DA 3BV4A 5C9RA 1F07A 2CZEA 1ZMCA 2VC6A 4H4RA 3T2OA 4ML4A 1ADOA 2A21A 2YLLA 3DI1A 1BYDA 2YL6A 4U28A 1P0EA 1LL6A 1FH8A 3UWYA 4AD0A 4IWWA 3WF1A 1UD5A 3WQFA 2OSXA 1V6TA 1XKJA 5LIWX 1REQB 1WDWA 3DKLA 1VCFA 3BSGA 4Q32A 1A5AA 4ATDA 5A94A 1OYAA 4Y2WA 1FXQA 3VMOA 1H7PA 1PO9A 5JH2A 5ABGA 2X0HA 3VD4A 3UZZA 3EXRA 5AHNA 1F74A 1UYQA 5FAJA 5J04A 4EM3A 3RCYA 3CB3A 3I6EA 4IQDA 4GBDA 2DIJA 1QFEA 4ZO9A 4IIBA 3Q6JA 4H8VA 4B5UA 2IPGA 2OU4A 4PMXA 3PBUA 1OJXA 1EHAA 1PTAA 3ZT5A 4HU0A 3PWAA 1E9ZB 1CWYA 4C1NB 5D09A 1RK5A 3NL5A 1O5KA 2NV2A 3DFHA 3TR2A 5SWUA 3IGHX 4ECLA 1Q3NA 3BSMA 3GO2A 2ZZ1A 4M5PA 1UR9A 4ENLA 4HYVA 4KT2A 2XN1A 4UTMA 4JQ2A 3F5LA 2HTMA 2PTYA 1PV8A 1HUVA 2CESA 1MW2A 3KRBA 3LZ5A 1B31A 1XPYA 4PCSA 1KLZA 1UH3A 3OA5A 1GVFA 3MZNA 1NIUA 3G0UA 2D73A 2XWDA 3MMUA 1LBFA 3NSNA 1ZALA 1US2A 4AY1A 4P2VA 2B31A 3WLKX 5LIYX 3B0UX 3EX6A 4HHLA 2QQ6A 3ETRB 3VOJA 1GVEA 3DH7A 2CEQA 2XTKA 2XM1A 4H4UA 1DJYA 4GK8A 3VMNA 3A9IA 1J5TA 3ZJ8A 2O9TA 2JKEA 4X9SA 1Q45A 5CJNA 2OGJA 4X0NA 1H3GA 1LT7A 1W8SA 2GPTA 3GHSA 1GRTA 3M0XA 3N73A 5BRQA 2QDDA 3AHVA 3N11A 1ME9A 4Z2HA 4AC7C 4J56A 1Q6DA 2VEPA 3BGJA 4O0QA 4N6FA 4TXEA 4E6MA 1TCMA 3ZVHA 2BVWA 3DN5A 3AYVA 2PDMA 1CNVA 3TFXA 4YLWA 1KKRA 3RF9A 3UNDA 1RP8A 3KRUA 3FG2P 2J27A 3PBGA 1LRTA 1H5YA 2RFGA 5A5WA 1WBJA 4DRSA 1T8XA 4PL1A 1BPLB 4OJYA 5EMUA 4GI8A 3W82A 1YHTA 4O54A 4DYKA 3HU7A 4IUGA 1FVPA 1QNPA 1R5YA 2F5ZA 4WGHA 8XIAA 2P0IA 1TPDA 1R47A 1GTHA 3OZPA 5AFDA 1XRTA 4RNFA 3URHA 1GOXA 2DUAA 4NHVA 2PDGA 3F5KA 4YHEA 3AN1A 1NF7A 1GVIA 1NOFA 4H3DA 1ZNNA 1Q63A 4J3TA 3HGRA 4KERA 1R6WA 1SO3A 4D1JA 3CAWA 4NZ1A 2PWVA 4GY7A 1W1VA 4KWVA 1Z6KA 3A3XA 4HNVA 1JZ7A 3EZ4A 3HRDC 2A3AA 2ASHA 3SN1A 4DBWA 3PZGA 2WCAA 4XTIA 4AW7A 4XAZA 4R3UA 1G01A 3C0LA 3W6YA 1I6NA 1LVLA 4JIRA 2WZIA 3GC4A 1BG4A 4NEVA 4Q4PA 1DKWA 3QXBA 1TVNA 3AXIA 1PIFA 4MKSA 4RDVA 4AD1A 1P0KA 5A2CA 3B3DA 4GH3A 3NDYA 3RK8A 1NJJA 5CKSA 5H6HA 2CLKA 1EGVA 1LQ2A 4YIWA 1FP9A 3F4DA 2AMXA 4WIWA 2XIOA 1QWKA 3KOZA 3S46A 4S3CA 4MGGA 4C6FA 5ECVA 1GVSA 3H26A 3ZQ9A 2FQIA 1W9UA 3CUZA 3GDMA 3H4WA 3GDTA 3ZVIA 2X41A 3LPPA 3W87A 4JTAA 4NRRA 2J6XA 2BC1A 5CPQA 5EGRA 3UWVA 5CC3A 1ZX9A 4JFTA 1UASA 3WKZA 1UP3A 1VBUA 1ICQA 2W62A 1T3QC 3QSTA 3LXBA 3HFTA 3WD0A 1ME7A 4LGXA 3I6TA 3THUA 4ADTA 2WC7A 3IANA 2CFYA 3CMJA 4GOAA 2Y7GA 3LY0A 2GOKA 3ECQA 4H6RA 1GXFA 5F1VA 4GNKB 1GEUA 2OWCA 5GRTA 5LGZA 3MY9A 4CQAA 3VDCA 4DUWA 1OM0A 1H4PA 1JRBA 1YIXA 5I3DA 2VRKA 3SIMA 2ZZ3A 1EQCA 3ABRA 3UXAA 2VWTA 1W0MA 3E3HA 3PZMA 4DPQA 1K4GA 2BTMA 1ESWA 4QROA 3WK3A 5F7UA 2QCEA 2OOGA 4FO4A 2ZWZA 1ZL1A 3LRMA 5HDRA 4Q8OA 1R30A 3PJUA 1F3PA 2E1WA 4YWSA 3BQ6A 3W2KA 2YCKX 4U31A 5D9MA 1CLXA 1VFHA 2X1UA 3MDWA 5AZ1A 3QZEA 4PGLA 4Z42C 4HB7A 4AB4A 3TNOA 3RLGA 1PKMA 3WMSA 1GHSA 3VIFA 3GX9A 2IQDA 3G3MA 1VD6A 3EA3A 2NT1A 4XZIA 3PY2A 2CKRA 1KFJA 1KM4A 2PTXA 2OX1A 1YXYA 1ZLPA 1V3LA 4FX7A 5J5DA 3W01A 1F3TA 3GRTA 2ISVA 3SIZA 3N9KA 1BGAA 5FIPA 4DO6A 1GRHA 5HNRA 2F38A 3V36A 3KCJA 3VGGA 4AZ7A 1K7EA 3W7MA 3TQPA 4M81A 2Y6ZA 5D03A 4HPHA 3LPGA 4ZE4A 1UA7A 2QGHA 1W2VA 1L0PA 2QJMA 4BZYA 2Y7DA 3EB3A 1F6PA 3EA1A 4M24A 2CLEA 3VE9A 4D8ZA 5MKGB 1UC5A 1HZYA 1YTDA 4NZFA 5CPLA 2QCDB 1W1B1 2BHZA 1JCLA 4KEUA 2YCEA 3NGFA 1PKLA 3PAOA 4WSKA 5FSDC 1PPIA 5A8OA 1AA1B 2G8ZA 4QHRA 1H11A 2DH3A 4JOMA 3WK0A 1VBRA 2J62A 3PUEA 2E09A 1XYFA 4JD4A 3P81A 3N6QA 3QYQA 4AH7A 3SY5A 2AL1A 2IXUA 3UY8A 1E1CA 3D46A 3ABSA 4A21A 3VXGA 1G5AA 3TEVA 1J01A 4EANA 5A8PA 3VNKA 4CU8A 1RALA 2OZ0A 1CB2A 2QAFA 2ZADA 4FXSA 3PZQA 4Z2GA 4MMWA 3VILA 4AY7A 4F2TA 2XVPA 3G0XA 3L0GA 2D2HA 3BZGA 2I5QA 4UZSA 3HMCA 4BQ4A 4KEZA 4UQ9A 2FZNA 4FEZA 2DZSA 4U5IA 3AJ7A 2YYTA 3GS6A 3G1HA 1XIBA 2FHBA 4P8VA 3LA4A 3IAPA 3EKZA 3CWHA 4MNLA 4CNNA 5A6KA 1CXFA 1VCGA 4P8XA 3LB0A 2PP1A 1BYCA 1OF8A 1EDGA 1IF2A 1D8CA 5CQ1A 4DO5A 3OOQA 2XVGA 2EQ7A 2VCAA 4Q4RA 1ICSA 1OX4A 1UWAA 5I5RA 2YGYA 2R9RA 1BWLA 3PULA 4GR1A 2X1IA 1Y5XA 3R89A 1JAKA 2BASA 4JTLA 1UR3M 2QCFA 4S2BA 4J5NA 4RX0A 2G50A 1AH0A 1VLIA 3LXDA 3QKZA 2NX9A 1H5VA 2QCHA 1GYLA 3FHAA 1VFTA 2CU0A 5A2BA 2E3TA 4FF5A 3BGAA 3JVAA 4W8AA 5LGXA 3K1DA 3KZSA 4UR7A 2WSYA 2XFWA 1FWFC 3EWYA 3W28A 2PWDA 3HN3A 5EMLA 2XISA 5BROA 2J8TA 3I3EA 1C3FA 2BSLA 1D3CA 3DYMA 2A0NA 4EVZA 3N3TA 2I14A 4ZENA 4P5UA 4EAMA 3H7RA 4HU8A 4WSHA 4E8DA 1XYBA 2Z26A 1J79A 4QSHA 3NZQA 2YX0A 1IE7C 4FX6M 2QAEA 2V9DA 3LSBA 4XSLA 5GNXA 2PDUA 3R6IA 2FZMA 3ZT7A 3QV9A 2VEGA 1C93A 1BSLA 1DXIA 1JZ4A 2X05A 4L9ZA 1IQ8A 1US0A 1Q6LA 3IIOA 3BAYA 3ZJ7A 2ZXBA 4KEMA 1GEQA 4PFHA 1Y0EA 2V5KA 3GXIA 4MVAA 1PZ1A 1KM5A 4OUIA 4G7EA 2Y5JA 5C9WA 3FYOA 5TQLA 2HJPA 3J7HA 3LTSA 3I7QA 1AQMA 2ZXAA 4TVWA 1XLAA 1DWGM 3O0KA 2V5LA 3AHTA 3CLWA 3TVAA 1BSIA 3JZUA 4IQEA 4Q4MA 4A6GA 2VFEA 4UR9A 1GJPA 3T9PA 4X60A 2RGLA 4JZ5A 4LW7A 5D8WA 2PEVA 1EJRC 4Q6JA 3SGGA 4ZTXA 1OCJA 1GONA 5CLWA 5EL1A 1KTNA 3DC0A 1UD2A 1JQXA 4UFHA 2PDCA 3QHMA 3VGDA 2YXXA 3URQA 4FLRA 1JZ6A 1GG0A 3OHIA 3W1RA 3ATYA 1B3WA 2ZTJA 4PR4A 4AYGA 1XYZA 2PZ0A 5HR6A 4MFDA 4CKQA 3GTFA 4DAFA 3HGSA 1V4YA 2C1HA 4J2PA 4EPDC 5KVHA 5H1WA 4K37A 4E4FA 5IOBA 1WA3A 1E6RA 5IBXC 4B5SA 5FJRA 4PTNA 1CGXA 2X0YA 3I7RA 4M7TA 5FF4A 4MAVA 4OOUA 4J28A 1VZWA 1PDYA 2VX6A 3WDHA 3DECA 4GLEA 1ZUAX 4JPGA 4JN6A 1EJVC 2EG6A 3SCQA 4OBTA 6ENLA 1HFBA 4IPNB 2C1IA 1FHUA 1YDNA 4CQDA 3S4TA 3H8AA 4Q7NA 1A5BA 1QHOA 3W6LA 2WJZA 3FCPA 2FB2A 5HMEA 2Z1WA 4W7UA 4A8LA 1UUOA 1RCQA 1MUMA 6REQB 3LXCA 4GX9A 4D2JA 5LIKX 3SGUA 2E9LA 2XSXA 2HWGA 3NYZA 1CX9A 4JIHA 1EJXC 1KM3A 1L2QA 1KM6A 3BAXA 3TDFA 1IEVA 4BEQA 1TVLA 4E2DA 2IXVA 1O68A 1O5XA 3P62A 3ITCA 2DZXA 1JR1A 4H6EA 2PUZA 4Z2JA 3VCCA 3R4IA 2BX7A 3NQ8A 1RJQA 3PWGA 2WWDA 3BLDA 4QS5A 5G2IA 4PMJA 1BYAA 3I10A 3Q67A 4LYRA 8RUCA 1LORA 4PMQA 4KIRA 3R0DA 1MNSA 2QJJA 3GW0A 3HFYA 2BOEX 4A4AA 1T99A 2E4TA 4W86A 4E8CA 1XFBA 5BWFA 3THAA 2E5AA 1TRIA 3P0XA 3S0CA 4MLJA 3UFYA 1E51A 4IF2A 4C6MA 2GJXB 1TUFA 4Y8FA 4XO7A 1RQHA 1J18A 4J27A 2D20A 4UIOA 4YS1A 4KWUA 2GQAA 1QOPA 4LF2A 1TZ9A 4A8IA 2VZUA 4WJEA 1W1ZA 5DMNA 4Z0JA 3VK5A 1A3XA 1EQPA 3QGKC 3MJYA 1FWEC 1XSIA 3TLLA 1H51A 2I5IA 2H90A 4DHGA 4TVYA 1ONEA 4M80A 3L5OA 4NP7A 4H9MA 1IEXA 3DGBA 2ZZBA 1P7TA 5AHMA 3WELA 3AUJA 2YL8A 3SECA 4DAIA 2WQDA 4I7UA 2PFHA 4MJ2A 3WYZA 3IJ9A 1DIKA 1HJXA 1K9DA 4ZGYA 4WKAA 1AH3A 4HD5A 4W89A 3WQEA 3UNTA 2QCDA 3ZT6A 2PRMA 3B9JB 4JTQA 3HTWA 5EBAA 1A5NC 3D0CA 1EGMA 5C0QA 1YYAA 4IFKB 3PHAA 1VHCA 3WD3A 2GJXA 2GGHA 2ISFA 4AWTA 2NW0A 4DF1A 4XZ9A 1JPKA 4PRRA 3S6OA 1WQ5A 4UMCA 1QI0A 1KXQA 3QLLA 4O0KA 5BXRA 4NJGA 4MWAE 1SJCA 4O4VA 1L6GA 1JIBA 3ZWSA 1LTDA 2VYOA 1WDQA 2WVUA 2PODA 2WSQA 3MUZ1 3LQGA 3DAQA 1XI3A 2ESCA 4JCMA 4OHQA 2Y70A 2WZHA 3LCHA 2FGLA 1TWIA 1W17A 1V7AA 1GPWA 1OX4B 1OFDA 4N6EA 3FJLA 4LX4A 4QJ4B 1R7AA 4WEVX 4Y90A 3FGCA 4UMAA 1BXCA 2X09A 4E5TA 2VD9A 4CU7A 1TCDA 3OG3A 1Q7MA 4H9UA 4NZCA 2A3EA 3MHGA 4I5RA 3R1ZA 3RFAA 4M29A 3VFCA 3NVYB 1ONFA 4BR1A 1PAMA 5FS7A 1V03A 3PP7A 3T55A 2GH5A 4AZHA 1XJBA 4LAUA 2EKCA 1ONWA 1BXBA 4S23A 4ATLA 3R79A 1NWTA 2XH0A 1KWKA 1GOKA 3PB2A 1RQEA 4H8HA 2F2HA 1WO2A 3TWBA 1NH6A 4I5XA 1T96A 5HWMA 5DBUA 4BKNA 2NLIA 3L0NA 3AZSA 4R85A 2PTWA 1LM1A 3BVJA 3N2CA 3CGBA 1TMHA 3O6AA 3GDBA 7PTDA 3BJFA 3FVDA 3GHTA 2PDPA 1XBZA 3M0IA 3ZSSA 1QNVA 1E1CB 1NDVA 5BU9A 1OFPA 2TPRA 2W4XA 5MKGA 3BG9A 4CD8A 3KP0A 2G4FA 1QPQA 1E0UA 1HKJA 4A8NA 1OB0A 3EWXA 3WDJA 1TV3A 1BYBA 5BW6A 2J74A 3PF3A 5XINA 3QM3A 4I6KA 2X1SA 4A2RA 3AIBA 3GG1A 4JFWA 3ZSTA 4UCFA 1YLVA 5I3JA 1DHKA 5DN1A 1WZAA 1NHRA 2OEJA 5FL1A 3SADA 1B1YA 3WLLA 2YCLB 3MUY1 3OVQA 2ZZ6A 4CQBA 2WBGA 5D8ZA 3Q45A 5HR7A 4H41A 4O8RA 4E38A 3BOLA 5CPOA 1OD0A 4NUWA 3ZLFA 2DSWA 3TFCA 4MYXA 5CZTA 2ACUA 4TMBA 2WPBA 1RJRA 3WQPA 1FCBA 1F76A 3R2GA 2ZTKA 1JI2A 2DY3A 2PGWA 3U5YA 3SEPA 2D0FA 4IPPA 3DGZA 3POCA 2V3EA 4Q22A 3TTSA 4FIRA 3AMCA 3VIHA 3V4BA 4IMFA 4N42A 3GD4A 2C0HA 3PAJA 4DJEC 2V2HA 4GXPA 1U2YA 3NQ7A 1ZAIA 2IKHA 1BWKA 3CGTA 2C8NA 3ME3A 5DMYA 3VU2A 4GJIA 1Z32X 5HUPA 1K4HA 4QE4A 1MDLA 1E71M 1KM1A 5C8BB 3V1HA 3GFXA 1SSDA 4FR6A 4AZ5A 5ABFA 1IR2A 3G18A 4FX8A 5I0DA 1CECA 2P10A 1Q7ZA 3CQHA 1WZLA 2NQ5A 1R8LA 3TW9A 3WNOA 1E72M 4H4SA 1NOWA 3W7QA 2DT0A 3CV6A 3L2IA 4LTSA 1GUVA 1A3WA 3CL8A 1H1YA 3GVVA 2WMGA 3IIZA 3VGHA 1PKYA 4I8DA 3RRXA 1M6JA 3EXSA 3AU2A 1ZJIA 2L5HA 3A4AA 3E2RA 2ZIDA 5L9FA 4DJED 3G1FA 1ZB5A 1N55A 1KV8A 2WKJA 1AQFA 3MSDA 1N60C 2WJEA 1LQAA 3DCPA 3SRHA 1P48A 4KGJA 4ATWA 5I77A 5D02A 2EPNA 3OGSA 3H2EA 2FH8A 2QUNA 2XFFA 1IR1A 1JD9A 1ALDA 4XAFA 5I3KA 4TVDA 4LA1A 3TROA 4XAGA 3GRSA 1L6FA 5D04C 5KZ6A 4LF1A 3UYIA 5K2ZA 1LP6A 2X2YA 3KAOA 4H8UA 3CH9A 3N15A 1GVQA 3M5XA 3TZNA 2WOIA 2XFYA 4MUZA 2PLKA 5EU9A 2VO5A 3W7JA 3ITTA 4IGHA 3W7GA 4LH8A 3LDVA 4K1WA 3U2ZA 4TMCA 3M16A 4MSSA 4S3JA 1S39A 2OB3A 3PC0A 3TIMA 1FHLA 4NAFB 5IHSA 1E4NA 2BOFX 2JEQA 1X1ZA 5LNVA 1J9YA 4L80A 4GUIA 1LT8A 4JTIA 4DWSB 2HZGA 2P3ZA 3BLLA 1KO0A 3TQ0A 3N25A 2YW3A 5D30A 1CTNA 3JZEA 1F8WA 2R1NA 1DJZA 1W32A 4QNEA 3W76A 2PDFA 1XYLA 4REQA 5DLCA 3RUBL 3IIPA 3SI9A 5ABHA 3MDUA 5A6TC 3FN9A 4ERIA 2WSRA 2KX9A 4LVAA 5BRBA 5K4ZA 1OGBA 2E5DA 2DZVA 2B81A 2YB4A 4Q8VA 3EMCA 1GERA 3NPWA 2I9EA 4UTHA 3HG4A 4LFYA 3M64A 3IS4A 1R0MA 4C6OA 3PPGA 3HPZA 3W1XA 4B5TA 3SCNA 2EGZA 4G1KA 3Q4DA 3T40A 4ZEPA 2Z1XA 3KM8A 3SURA 4DPPA 1M03A 4YTTA 3GSMA 4F8XA 4JFUA 5F1UA 3DHDA 4XKYB 2Y24A 1E0TA 1QPNA 2X40A 1OFRA 1VJZA 4TVCA 4ZR8A 2EJAA 1XR2A 3ALFA 2E5CA 4PMRA 3H70A 2PZNA 1BTCA 4ML9A 3ARQA 5AC5A 5EFDA 3EWDA 2BGNE 3T0CA 4CNUA 3BL3A 3GAYA 4H1ZA 3NAVA 3CIXA 4NRSA 3UBPC 3G1DA 3ITYA 4DXKA 2Q3RA 2D1ZA 2PTZA 5FF7A 1ZCCA 5I24A 1Z3NA 4AZCA 1C7SA 1LRNA 3DHUA 5CJ5A 3CC1A 2UY2A 4WUIA 2E6YA 1XDLA 3OZOA 4QAWA 2RDXA 3BJTA 2DQWA 2CDUA 3L5AA 1HTIA 2ZC1A 4QE5A 1F4HA 1K6WA 4JEJA 4HK6A 2WV8A 1WDSA 1JRCA 2TPSA 2PP0A 2GL5A 3VNYA 2VC9A 4V27A 1F6KA 3NQBA 1CT5A 3UG4A 4C6IA 1V51A 1E15A 1PX3A 3B4YA 1XDMA 1P0NA 3W84A 1LG2A 4CN4A 1CB7B 2J4GA 2NUXA 2PGEA 2Y85A 1SZRA 3TH6A 1YE6A 3RU6A 1ITCA 5CAHA 1ZS2A 4Z2KA 4P8WA 1DJNA 4Q33A 2E40A 3O0FA 3PNUA 4Y9PA 3QR0A 1WYGA 1FCQA 2CZ5A 4FIQA 2PAJA 1ZBVA 3CZEA 3MKVA 1QXLA 3IC9A 2V63A 2HROA 4ICMA 1VEPA 2DW7A 2J66A 1UWQA 3W7PA 1JCTA 2WBAA 3UVIA 4GO8A 4AF0B 3MV11 3GIPA 1OC5A 4XUGA 4LIIA 3ANVA 2C18A 3PZUA 3LZ3A 2Y88A 3GR4A 1FIQB 4GYJA 3WNMA 4CQCA 3MQTA 3GM8A 2P76A 3MHUA 1RCXB 3TW7A 4K38A 1PX4A 1H7OA 2AKZA 1E6XM 1BG9A 1QPKA 2J78A 5CSUA 1GQNA 4GO9A 2BC0A 1RH9A 1WDPA 2DSUA 3SQLA 3I4EA 2YFOA 4O12A 5M3WA 3NXFA 1DJGA 1HXJA 2VVNA 2XIQA 3L2MA 4R88A 2PDKA 4KWOA 1CXLA 3GKFA 3W22A 3UETA 4DIAA 2Y61A 2OMAA 2ABAA 4S3AA 3HMJG 4KCVA 4HJWA 3PM6A 1IZCA 4WHBA 3STFA 3M5YA 1FOBA 2NSXA 1W5NA 2PBGA 2Y7EA 4DWSD 4KETA 3DFOA 2QJNA 1OG0A 4MJZA 2W9MA 3RLHA 2ZUNA 4CU6A 5LNUA 1TMQA 4MY8A 2WVTA 3CT7A 1W1TA 1XCXA 1XANA 4DB7A 5AVNA 9CGTA 4DO7A 3V0SA 4ROPA 1MEIA 5HWNA 1BKHA 2ZUVA 2DZPA 5G1MA 4CNTA 1BTMA 4UTFA 1UR4A 8CGTA 3CGEA 2V5DA 2QS8A 4BQ2A 3LHYA 1ZY8A 3UWWA 5EY5A 1LJYA 3CYVA 2ZKMX 4KRZA 3KDNA 4GUJA 2NQJA 3WL1A 3GTNA 3BH4A 1DQXA 2JIEA 1NSJA 3COTA 3LHVA 4LUYA 3NL6A 4US6A 4DBEA 1T7LA 1WV2A 3PTQA 1RP9A 3CQIA 1ISVA 5A6JA 1K9FA 1GK8A 1VIZA 4UBPC 1TPH1 2OFJA 3G24A 3NZRA 4ZVJA 1DWFM 1TJRA 1QUMA 1S5TA 3ENLA 3EA2A 3M43A 2Q09A 5CC6A 4EQXA 5ABEA 2OPJA 3IIXA 5A1AA 1SB3B 2NPXA 1UOKA 1HJUA 4UNKA 3L4VA 4MY9A 2GGGA 4K8DA 2CYGA 4LYKA 3GR7A 3DG7A 4QG9A 1UMYA 4U4MA 3IIVA 4ZQNA 4DX3A 4TQTA 4DI8A 4NZ3A 1PE1A 1Z41A 1R3QA 4KMQA 3KVJA 1VAHA 3GK0A 3QC3A 3MVIA 4XISA 3VNDA 5A69A 1JZ5A 4AXKA 1FEAA 1KGWA 1RVGA 3DDMA 3WH9A 5D2YA 1E43A 4WR3A 4B4HA 3C3UA 4IIEA 4S3FA 3WQ5A 3NZ1A 3FA4A 2A7RA 3LYEA 5FF2A 4DF0A 4I5UA 4C7FA 2VRJA 5IDIA 3Q2DA 2QCCA 1Z42A 1FHDA 3W7LA 2ZBTA 4MB3A 1TPFA 2H3BA 3WQWA 3OA3A 1QRQA 2VX4A 4HYRA 3CPGA 2NZLA 3RNMA 4QG8A 3EWWA 3Q58A 2J7BA 3NQEA 2F6UA 2PP3A 1AOGA 2V2DA 2X50A 3W7CA 2XWEA 2W3RA 1UWRA 1E40A 4J3VA 4GRTA 3E0VA 2ZXQA 1RBOB 3EXTA 5AYZA 3CJPA 2FFIA 4WOQA 1UKPA 4R7WA 4POCA 2JEPA 3LB8A 4REQB 2AQOA 2BY0A 1XX1A 3DU0A 4CQ9A 4QSFA 3OG2A 4HNUA 4G7EB 1AJ0A 4IMGA 1XPGA 1H60A 4NSBA 4Z1DA 4BA0A 2REQA 3K8MA 4IL2A 4P7NA 4LSBA 4JICA 3L12A 2OYMA 3VD9A 1FECA 1OYBA 2F2KA 5BNKA 1RLDA 4P7QA 3CL6A 1MMFA 3BG5A 3USBA 4BFAA 2RAGA 3W7KA 1G4SA 1KFEA 3VM7A 5LA2A 5DCDA 4O17A 3G8RA 2GGJA 2A6LA 1EUNA 1OK4A 3EOUA 4O1CA 1AZ2A 3A4WA 1XLHA 3KXQA 3IJDA 4DJFA 4JX5A 2A7NA 1V7YA 5DMLA 4H9YA 1HKMA 3EAUA 1M7PA 1A5OC 4LS0A 2VP8A 3TP4A 1K4QA 3F4WA 2OT0A 5BOFA 2EHHA 1KBKA 3N18A 3DH9A 4DUVA 2XVLA 2D69A 3KOFA 4TVUA 3S2CA 3W2JA 3I3BA 2FB3A 3BC9A 1TTQA 4IGMA 3G2GA 5F4XA 5JCMA 2FZDA 4TX6A 3AQUA 4UQEA 2AKMA 3KRZA 2BY3A 3HJEA 4NT0A 3C2OA 4TIMA 3ISIX 1XLCA 3DG6A 3IVTA 4XVEA 4IQJA 1T41A 4IPIA 1V0NA 3H22A 4HPNA 3S6DA 4V1YA 1KLYA 5AOUA 1UKOA 1JDEA 4H50A 4X63A 2Y8UA 1RAKA 1XGZA 1YNQA 4XKMA 4RZBA 1LLOA 3MJMA 4DQWA 3LCWA 1HVQA 4IJRA 4MUPA 1TYTA 1UZ1A 3PWIA 2CLPA 4MTVA 1T0OA 4TOQA 1Q6GA 2VMFA 5DANA 4J3UA 3DG3A 3CWNA 4ZZ9A 4JYDA 4O1DA 4XBJA 3IUHA 3K4AA 1GW9A 2X0SA 1UBPC 2FPTA 1YXDA 5GQBA 3RLUA 3LN3A 1N61C 1XDIA 3R5EA 2H9AB 4BF9A 5D33A 2XIJA 1XBVA 4QDPA 4GNJA 1XLBA 3NVVB 1VDVA 4JTRA 2QYGA 4QE1A 3WLPA 5FESA 4O18A 3DFYA 3WLJA 4A3UA 2EQ8A 3DJGX 3QY6A 3IARA 2WSPA 1YRRA 2C91A 1Z89A 1IWPA 3DJJA 3MP5A 2W27A 4H9ZA 4RNJA 1Y5VA 4LVBA 1JNEA 2OZ8A 5C2XA 3LNMA 4CD6A 4QJ5B 2XPKA 3M5ZA 5HINA 3R8HA 1TX0A 1GNXA 4HMCA 5CGQA 3VD3A 4HSHA 4ZTYA 2VGGA 1MVYA 3S9YA 4ADWA 2PDJA 5JRBA 4I9MA 5C70A 4NXKA 1FWDC 3IV3A 4A2SA 4B5WA 4PE8A 3AXHA 1E73M 4TV6A 1B54A 3MMTA 3W7DA 4LYQA 4XBSA 4YNGA 2CXGA 4N0RA 1CLKA 3O6YX 3B9NA 5RUBA 3G0SA 3ARZA 5JBFA 1E4MM 1UUMA 4R9XA 3LENA 4PSRA 3RDKA 3AYSA 3QR1A 3SBFA 1XLFA 2CC0A 1HP4A 1DWIM 1XQLA 5I07A 3EANA 3TYUA 3FEMA 4U33A 1NQKA 3BTNA 4C5ZA 3FJ6A 3SUUA 4QLLA 2R14A 4CN6A 5I3FA 3S1WA 5H2ZA 2Y2WA 4HMEA 3BAWA 8A3HA 3JU2A 3ZJ6A 2FTWA 5EMKA 1GRAA 1I1WA 4YVPA 1LWIA 3U0HA 4CN1A 4TV5A 5AC8A 1JPMA 4A29A 1JYWA 1W3TA 1HJSA 2EG7A 3VIJA 4NI3A 4H19A 3RM4A 5D38A 2OYLA 1GEHA 4JQ1A 2RHGA 4OFCA 4XZMX 1MWOA 2XINA 2E68A 1E0WA 2D2OA 2GK1A 3ICJA 4QG6A 2NSOA 4GG9A 2BP1A 2XZ7A 1S5VA 4FNTA 4B2DD 1J0ZA 4W7WA 3P93A 2A5HA 4MPKA 3GZAA 4B92A 3IEBA 4GACA 4JTGA 1EC9A 1Y8BA 3C2FA 1SMDA 1C8QA 4CD5A 3T2QA 3GRIA 4BWLC 1TTPA 1Z7AA 3P8IA 3W27A 3BGGA 1ZK7A 2PWGA 5KITA 2DEPA 3OVRA 1JEHA 4YYCA 4LY4A 3PZ9A 2PTDA 4M0XA 3BQ5A 4HPJA 3UCQA 1OFQA 2HPMA 3PSWA 1QPOA 3FS2A 2X16A 2ACSA 4H01A 3S1XA 3QHNA 1PDZA 3CGCA 4FSAA 4U3CA 2P50A 4K7ZA 1IV8A 1TPVA 2IW0A 3FXGA 1XUZA 2QDGA 1TUXA 4HNNA 2YBUA 4XV0A 1JPIA 1T5AA 2OXNA 3S5SA 4XTDA 4BS0A 3WX7A 1TZ7A 5HBFA 2AQVA 1ZAJA 2PA6A 1TA3A 3VDGA 1KB3A 3AIWA 5D2XA 3FIGA 4RW5A 2ODOA 2QULA 4FAMA 4HA1A 3AMGA 3NRZB 2ISSA 4L6HA 1QCWA 4L1XA 4Y96A 4MYAA 4AXNA 1TE1A 3QMSA 4WDTA 2ZRUA 4MLRA 2YDAA 5LYRA 4HGXA 2FJKA 4Q4QA 3VZYA 2RDUA 1FDYA 3WF4A 3KOXA 1MXDA 2G37A 1NFGA 2JKPA 3CNYA 2WKGA 5FEXA 3WH6A 1Z8AA 1AJZA 5U1OA 1XH0A 3N1AA 4A3YA 3U7BA 2CITA 2VKZG 5BYWA 2FMNA 2ZWYA 3W1PA 3NQGA 4GVFA 2YOCA 2HRWA 5A95A 3VIMA 1HG3A 3K4WA 3VC6A 4WCJA 1V8EA 1PKNA 5AN7A 4B91A 1XIJA 4O4WA 3S5NA 4D6IA 4LCRA 4AG0A 3UJ2A 2F61A 1HL9A 3O6CA 4DZIA 2P0OA 3M0KA 4M6QA 3TN3A 5CGMA 1GJWA 4L1GA 1ADDA 4JKMA 1EPVA 2WOWA 3BE7A 3FAXA 3U3HA 1E9IA 5LSMA 3W74A 2G3FA 3UWZA 4H4WA 2GJNA 1UMLA 4URIA 4LV9A 1WKEA 4RDYA 4DLMA 4F0SA 3UEQA 1A4LA 1U1HA 3Q94A 1XHGA 3KUMA 3L21A 2OR2A 2WJFA 3HQNA 4HA3A 1X6NA 1KGUA 2G97A 4L9YA 2HNHA 5CZSA 4CNPA 2QDHA 1DQWA 1V79A 4XX6A 5T9BG 4JX6A 4YTSA 3TMQA 3E6EA 3AIQA 3N4FA 1E5JA 5A6BA 4JBRA 4CCDA 2XU2A 4HKPA 2O4MA 1E4LA 2E5BA 1MOKA 3NVZB 4O13A 3WBXA 1W3LA 1W1YA 4EF9A 1MSSA 5MHBA 1I8JA 1R85A 3W2UA 1I9CB 3NTYA 2FZBA 1OBAA 1QNRA 3PJTA 1UD8A 4K8EA 3WMBA 4DYEA 2GZXA 3A47A 1LWJA 3MI2A 1AFSA 2AL2B 4LCSA 2OSWA 3VGFA 4BQ3A 1KCKA 3TYCA 4LC6A 5KMYA 3TN6A 4ZOEA 4FMVA 1J2WA 3VPLA 4FDCB 1HX0A 3P14A 5M03A 3VA8A 2LLEA 2VI0A 4CCZA 3F2CA 5FF0A 3BW3A 1XH1A 1NQ6A 1WYIA 1QHZA 1I4NA 1R3VA 4A22A 4W88A 3P84A 1RBAA 4EPBC 2YB1A 1VS1A 4YCOA 2PGFA 2WNWA 4OKDA 2DH2A 1S3TC 3HGJA 4RNHA 3ARTA 2A1YA 1NDYA 2A3HA 2EPOA 3NCOA 2W67A 3QY7A 4V1XA 4H4XA 5EB8A 4NYUA 1E1FA 3WO8A 4NI8A 3S5ZA 4FB7A 2NVKX 3S1UA 5HAOA 2Q6ZA 4JCLA 4C7DA 3LBMA 4W93A 4KCUA 4QGCA 2D23A 3S5YA 2Q8XA 3N6JA 2HQAA 4IIGA 1EWEA 1AVAA 2ZZ5A 3H54A 1R9YA 1QW9A 4X2RA 3F7JA 1W1IE 1VF8A 1H7WA 4HU3A 1W2PA 4G9PA 2J7GA 1QW7A 1UA3A 4AVFA 5IDZA 4L4PA 4Q8TA 3CGDA 4UFMA 2YLAA 4IIDA 3S6TA 2IPFA 4G8TA 4Y9MA 2QIWA 6TAAA 4MKNA 1JCXA 4MIMA 2C3DA 3T05A 1SR0A 4U5KA 3UZXA 2ZZCA 3UR8A 1PIIA 3WQ6A 1CBGA 4IX0A 5HULA 1B2YA 3M6YA 1YNPA 3FA5A 4WVXA 3EWZA 3LGEA 5HPCA 4F48A 1EZ2A 1TIMA 5I79A 1SM9A 4C6CA 3HOJA 3SQSA 1X96A 3QTGA 3S47A 1CXKA 3BCJA 2V82A 3MSRA 4UWMA 4OUEA 3KW3A 2E7FA 2RDWA 3ITOA 2YJQA 7ENLA 4RV8A 2GR0A 2FGBA 1QBBA 3N17A 1E0XA 4UTWC 3OLGA 4HOWA 2CHOA 3NOYA 3ZWTA 3LI0A 1JCNA 2BY2A 4EWND 4GZ7A 2VQTA 4A3QA 2A6NA 3FKRA 3RNDA 2GSHA 3GXDA 3MWAA 4LNCA 2DV0A 4N4QA 3LOTA 3B8UA 4FLOA 2QHAA 1PJ9A 2GDQA 4B5NA 2P8CA 4RR4A 3WD4A 3GNDA 3LX9A 2XN0A 1A5CA 2GVLA 3GFYA 4ZL1A 3KRSA 3M9YA 3DFPA 2W0HA 4L4LA 4L9XA 3WJZA 2X2GA 1F6YA 2E6FA 5HQLA 4NEWA 2IPWA 2PD9A 4BCEA 5CBJA 3R94A 5EMMA 4AZ6A 5T91A 3BJSA 2Y89A 1QR7A 3OODA 3AHZA 2J24A 4ONVA 1GSNA 1XL9A 2NQLA 1PHWA 1XLDA 4JFSA 3EOEA 3GVQA 2ISWA 2FZ9A 2JGYA 4HNOA 1IGSA 2Z2AA 3QY8A 1KQYA 2WHMA 1W1PA 1X98A 1GREA 3LBCA 1YXCA 2CWNA 3BOFA 1SW3A 3FYPA 2VDHA 4LAKA 4ZB0A 2YYUA 1XBXA 4I8YA 1RJPA 4K8GA 1IEIA 4Z08A 4UTKA 1JYNA 4HPXA 5JCLA 1U22A 2YVJA 1MEHA 1B4KA 2Q71A 1R9ZA 3W7OA 4DNMA 4IJCA 1A5LC 3WMCA 1D9EA 3UXKA 5E1QA 1JPHA 4DJFC 3T0BA 1VEOA 1FY6A 1DTNA 2WAGA 1Q5MA 1UHVA 1H2IA 4APNA 3UESA 4PRTA 3AYTA 1L6WA 3BMWA 1SW0A 4B2DA 3P80A 3EX2A 1QOQA 3EPNA 2PF0A 4GHRA 4V2XA 3WMLA 3L9CA 3AMZA 3HV8A 1M7OA 2FMOA 2VURA 3H2FA 5CSYA 1L6SA 4JAWA 2OCZA 3NO3A 3TN4A 3AI0A 4ZQOA 1ITUA 1W56A 1KRCC 4BI7A 2PPGA 3ORWA 2BOGX 2CETA 1AD1A 2V3AA 4GZJA 3CV2A 4JHOA 1P0BA 1XIDA 2R1MA 4ROQA 1TPWA 3QZAA 3HJZA 3BG3A 1R3RA 3FKKA 5ECUA 4X0VA 5DY2A 1EXPA 4WSJA 1VJSA 2WSKA 2VEMA 1IXNA 1Q2RA 2WVVB 3H55A 2BVYA 5HA7A 4AMAA 2ZDRA 2GWGA 3KS6A 3E49A 3BO9A 3G77A 2V67A 3OIHA 2YXOA 3BLKA 1CGWA 2DP3A 1TR9A 1PWLA 3CIVA 3D3FA 4ERGA 1LZOA 3H23A 1FH7A 4KF1A 3QOMA 4K1GA 2W55A 3CEUA 2WLYA 1JROA 3V0UA 4BHYA 1PZ2A 3SCVA 3WH8A 3FW6A 1TYGA 5F2GA 4GJ1A 4EQSA 6XIAA 3RU8X 3AXXA 1LUCB 1AL7A 2VM8A 4K3ZA 3ZVHB 2OGYA 2NLYA 2HMCA 3LMYA 2J8FA 4AEOA 2HNEA 2X1TA 3W24A 3TOYA 3W23A 1RV8A 4DEFA 2FGZA 3WJSA 2VFIA 1I2PA 4JIQA 2XJ7A 1HL8A 4I6VA 1OABA 1HGWA 3L66A 1CI1A 3NEHA 3ALGA 4RE4A 3LI1A 3T81A 2WP5A 2ZVIA 2FIQA 4DJDD 4KCWA 2GJPA 4O11A 1AQ0A 4JL1A 2CIPA 2VC5A 3L8KA 3RPDA 1N5WC 3URBA 1VCVA 4RW3A 3G1SA 5HK4A 4OBSA 2ZA3A 3F5JA 5CG7A 1N5XA 1ZBWA 1BEUA 5J8LA 3PZNA 4JKLA 1H50A 1QI3A 3WUFA 4M82A 3REQA 4H7CA 3QGAC 2BWGA 3AMDA 1WBHA 1TQJA 3MBFA 1A80A 3ARVA 1EWDA 4FA3A 1WAUA 2HDJA 2C19A 2YIHA 3W7RA 1K9EA 1YQZA 1TKKA 5CEWA 3ARWA 2VZVA 5E09A 2XGIA 3ARRA 4M19A 3M0JA 4EE9A 4PULA 4AY8A 3NZGA 3C56A 3ZXWA 1EBHA 2Z25A 4NX0A 3MB9A 3M1ZA 2OKTA 3VX1A 3STPA 2V2CA 3CQKA 3F1QA 3P6LA 4HCLA 3NGJA 3TOPA 4MG4A 1KRBC 2BHYA 4GUHA 5I23A 3TTYA 3L2LA 4MWAB 2I16A 3DK8A 2VFHA 4RCXA 1KA9F 3KL3A 3H4XA 4LYPA 2PLJA 4KFNA 1S3HA 2X1RA 3MP4A 4NU7A 1Q6FA 3W1UA 3GNOA 4LBUA 1UBSA 1QOXA 3L4XA 1H2JA 3B0PA 4FP1A 3U6WA 1VFLA 5A6BD 3DKJA 5AYXA 4JYEA 3PG6A 3B0XA 9XIMA 4NZ5A 1ONXA 3UYCA 2X8HA 2ATMA 3KCOA 4JQ3A 1XSKA 1JZ2A 4AUBA 2PDBA 2YPIA 3V1PA 1ITQA 4PA8A 2AL2A 1GVOA 4EXAA 3CZKA 3HQ1A 4AX7A 3C6CA 2NQ9A 3EGJA 1WXZA 3P0WA 1BQCA 2B7PA 2OJPA 2UV8G 3ANUA 1JJKA 1XISA 1UR0A 1EDTA 1D7KA 3E12A 3NEVA 1QI5A 3IVUA 1BHGA 3F4CA 3WJXA 3K8KA 1ITXA 3LGDA 4MB1A 3E38A 3RX2A 4O10A 3OEXA 2R8WA 1AZ1A 3CQJA 3WLIA 1J0YA 1DVJA 2DVUA 4H9XA 3WLTA 3F03K 1PYMA 4GKLA 3M0LA 3G8EA 1V0LA 4M51A 1J93A 2DSVA 3PZIA 3H6OA 2BY1A 3H2NA 1UUQA 1TV4A 4CNOA 1KNWA 2ADAA 1T8QA 3N29A 4KFPA 2YW4A 2RDTA 5M17A 4QDMA 4PUNA 3CS2A 3V5CA 5K4XA 2G3NA 4TX8A 4WXZA 4WRHA 4AVNA 4AZGA 3WLMA 3PR2A 3B04A 4C1KA 3BLOA 3OVGA 4IFRA 4O16A 4RZ4A 1V08A 1K7FA 3MUXA 3NPXA 2YL9A 2FFCA 4HHMA 4C91A 1JF5A 4FR1A 1FWSA 4A8RA 5EBKA 3GLCA 2Q02A 3IGSA 1UPPA 1WP6A 5IFPA 2OLHA 4AD2A 2DZAA 3NO5A 4CVUA 3VDBA 3S2LA 3H2OA 3WFAA 2AOSA 4L1WA 1BF2A 2ATSA 4FS9A 3UZYA 2NVDA 2TODA 4PUKA 4PCFA 4ADUA 4HHPA 3A24A 4D8LA 1NF0A 3W7EA 1V3JA 2GOUA 1VEMA 4D6EA 5IXEA 3GIQA 1NM9A 1HJQA 2Y63A 8TIMA 2A79A 4LBSA 1XRVA 3LHWA 4W5UA 2ZRZA 2A7PA 3GNPA 4O8AA 5I3HA 1SJDA 9XIAA 5F4WA 1KFKA 4ORIA 4ZSUA 1B3XA 2PWFA 4IISA 4D6JA 2FVLA 4L61A 2G3IA 4N4PA 3A7AA 5E6YA 1A0CA 1VIWA 5ABTA 1XHCA 4DZ5A 4LAOA 2VXNA 5AC4A 4WJXA 3KBWA 5LKYA 2O7SA 1STZA 2ZX7A 3DBPA 3WD1A 3WFZA 4CEUC 5CCZA 1GPFA 1ZPTA 5C6MA 2OTDA 2VGFA 1IZJA 1KTBA 2C14A 4EWJA 3AO0A 1B90A 1YDYA 4FLSA 2OX4A 3NQFA 3OZMA 7TAAA 4YXGA 1DL3A 3SR7A 2ZRWA 1FO4A 4XK2A 2ZZ7A 4DBSA 4Y8EA 3W75A 1S1PA 2ZUMA 3AIRA 1MQQA 5U7SA 2J7EA 3FEQA 1R3SA 1D7FA 4TUFA 4WDUA 4ZOCA 2ZYFA 3NDZA 3UXIA 1P6CA 1TFVA 2ONEA 1LBLA 2C71A 1TVPA 3T78A 1BF6A 3NDOA 1XLMA 4LUIA 2HBXA 2H8XA 2IPJA 1R87A 3O7UA 2FKPA 3LM3A 1PEZA 3UP8A 1KR0A 5FJTA 1QJWA 1KFWA 3MO4A 2KZHA 2Y62A 3NUKA 4ZFMA 4JQ9A 1DEDA 2C7FA 4O0ZA 1RHCA 2J79A 3KBNA 4S3KA 4DLFA 4KRTA 1O5RA 3FLUA 1I45A 2NX3A 3VNMA 5FEWA 4D6GA 3UXDA 2BVTA 3SJ3A 3E2QA 2FTYA 1UH4A 2B7QA 1GTEA 4IMAA 2CBVA 4Y9AA 1U5JA 1L2UA 2DPEA 4DNHA 4AD4A 1G4TA 3CV7A 4GIRA 4NNBA 4E3TA 1HJVA 3T42A 1I75A 4YMZA 3GG7A 2GDVA 4IIHA 3KE0A 5C71A 5LNSA 1MW1A 3CZGA 3MZ2A 4PBEA 3ABOA 3W71A 3T09A 3SY1A 1PX8A 4GI4A 5M1TA 4XG1A 1P6WA 3T1GA 4C1NA 1ENUA 4TX9A 4I7VA 3EOLA 1BVZA 1MYRA 1RXOB 2OZTA 1VGAA 4EX4A 1M9HA 5CBIA 2GSJA 3KLJA 2EPHA 1NY1A 2WCGA 1S1RA 3AIEA 2YCLA 1J0JA 5CGTA 1K9TA 4NL1A 4B4FA 2J7DA 3CTLA 2WHKA 4X2PA 2WMHA 5D2VA 3E0LA 3KZPA 4UR8A 3P7YA 4FOJA 3II1A 3EKLA 4KCTA 3PFRA 1GRGA 1XP3A 3LTYA 4QXIA 3DZ1A 1JVNA 3WENA 2GVEA 1UOZA 1UKSA 1UQYA 3S5OA 5G1TA 3S1VA 1UWSA 3B9AA 1ZGDA 3HPXA 2DJLA 3CASA 2C0AA 4F40A 4IMEA 1M65A 3WZ0E 5G2HA 3PUOA 1JZ8A 4FK9A 4MDOA 1OX6A 2NQZA 4EP8C 3HBLA 1W54A 1XIFA 2NX1A 2PCQA 1JULA 2B4GA 3O9NA 4EQRA 5LIUX 1B30A 2GR2A 3SRDA 1XKYA 1TWZA 1OYCA 2JE8A 4UTIA 2EJ1A 4ZODA 3GDRA 1GQIA 1SFTA 2WMIB 2MUCA 3EPOA 3T8QA 5HJYA 4W85A 3SUTA 2YR1A 3H24A 3S9ZA 3L7RA 3I4KA 2DZUA 5DRCA 3VCNA 3LG3A 5JBEA 3TYEA 2ZA1A 4HIBA 1OFEA 1GZ1A 3TYDA 4JIEA 5DO8A 1S2AA 4WK9A 4DJDC 3U5UA 4WQ6A 3TR9A 2VR2A 3UG8A 4AC1X 1ZXIC 1J4EA 2H9AA 2FHCA 3E1F1 4GYPA 2V38A 3NQ6A 1JYXA 2HEJA 7REQB 2XIMA 5HANA 1O95A 3CUFA 1IZKA 5LZLA 1J0HA 5KZDA 3WLQA 2YA1A 1WKYA 5C7HA 4X3ZA 2OO6A 3RJYA 4FNQA 1GT8A 4IG2B 1IEQA 1NTHA 5FD0A 3GYEA 3FSTA 1R2TA 4C6DA 5EFFA 1TTIA 1KRAC 1LLZA 4LVDA 1DV7A 1TIWA 3BURA 1JDDA 4HMDA 3TYZA 5CAKA 2Y5EA 4JYFA 2VEIA 2J6VA 3KTXA 2D24A 3R0KA 1E6PA 1Q65A 2WWCA 1MQRA 4PMVA 1V77A 3MI6A 3SCPA 3K30A 2AAAA 2JGQA 3VM5A 1RM6B 2CLFA 3S83A 4E2OA 2D0HA 1DWHM 1W9XA 3V7PA 1R46A 3DGHA 5FJJA 5EMYA 4HN4A 2V6AA 3VZXA 2QCMA 1OFAA 2GJRA 2WPCA 3EX4A 3C0SA 4F9DA 4N7QA 3PS7A 3AM9A 1E6QM 1OWQA 3KVKA 3V0TA 3K46A 5I7GA 5HMFA 2J9YA 4HVXA 5LNWA 2WP6A 3O1NA 3UR5A 5JH1A 4H2HA 1V02E 3LCGA 5GPRA 1ZMDA 4HT3A 5T8GA 2BS9A 2E3ZA 5AYBA 5D37A 3I68A 1DORA 4JHZA 5K9CA 3CPRA 2DQXA 4KRUA 3A22A 4GMEA 3B06A 3T0AA 3OYXA 1VPXA 1YADA 5ER0A 1Q1WA 4BF5A 1A5UA 3WY1A 1CXEA 1CXHA 2XIBA 3R8RA 3B8WA 4J7RA 2WLZA 4H2CA 3HA1A 1QK0A 4H9VA 5I09A 5ABFB 4PUEA 4HZ6A 4I90A 4H9TA 1PB0A 3CYJA 1Y5WA 4PEEA 3TSDA 3URNA 3WQOA 1HO4A 3BLPX 3Q65A 5AZ0A 1QHPA 3DGRA 4JTUA 4DJEA 2NV1A 2QAPA 5K7JA 4GIYA 2VEFA 3PJXA 2DT2A 4XSMA 4XVDA 3SCTA 5DT7A 2VWSA 4FNPA 4NF7A 4HZ8A 4LUSA 4O57A 1MUWA 1QWGA 3UGRA 3QLDA 3E74A 1XYAA 1E6ZA 5E6ZA 1VRXA 1DP0A 4GISA 1XQKA 3OQEA 1R3YA 1XV8A 1EJWC 1CW2A 2Z7KA 1FFVC 3U4FA 4AZIA 1NFPA 4R34A 2QCLA 4IMDA 1CEOA 5G4WA 1SGJA 3VOGA 4AISA 2OQLA 3LCLA 4H83A 2UWFA 3ZR6A 3IACA 4WDXA 4RE2A 3M0ZA 1JCMP 2GR1A 1G0CA 4UMBA 1QT1A 1E3XA 2VJXA 4QIUA 3A3HA 2G3JA 2R6OA 4ZFCA 1XLKA 1SUXA 4YN5A 4NG3A 3AC0A 4H4VA 2GWNA 2XDFA 4PFMA 1AW1A 1T6MA 4ADSA 1WX0A 3LCFA 4JIPA 3W02A 4YL2A 2ZZ4A 2CW6A 2J9ZA 5L6UA 3S2MA 4QEHA 5XIMA 3NJ3A 1W5QA 2JK2A 3URAA 4J3SA 3CWOX 1CIUA 3ZYZA 4PL2A 3FY1A 2I7GA 5LA1A 3XINA 1UQZA 4N9BA 3WBAA 2Z0IA 1VBJA 2F7FA 4NZ4A 1DXLA 3OQ8A 1V3HA 5JIPA 4O1BA 1FFRA 4JNYA 2F8QA 1PTDA 4GKTA 1VP5A 4HNTA 4QCFA 1KKOA 4ZBCA 2GQ8A 1S2WA 1XD0A 1DNCA 4GI9A 2WZTA 2JBMA 4DYJA 4PBGA 2YFNA 3WUGA 3WDIA 5FKYA 1JEZA 5HQMA 3FJ4A 2DGAA 3O2LA 4Q4OA 4JY8A 3DHPA 4LC8A 3ANYA 1PUDA 3LCXA 4UZUA 5G4HC 3SN0A 2W91A 2Z1VA 3IV8A 3THQA 3DXIA 4ZQCA 3ZM8A 3GVGA 4UFLA 3OPSA 3CIWA 3W1QA 2QF8A 1UJQA 4AWUA 2G5WA 2WM1A 5DXYA 3APGA 1GCYA 4HA4A 2JFEX 1VLWA 5FS9A 3GYCA 3OGRA 3TA9A 3W7HA 4M1RA 1VFUA 1Q4NX 1H61A 1FCVA 1E1EA 1YMYA 4PUUA 3SUWA 3OIXA 1UKQA 3OB8A 1ECQA 1S38A 3W2LA 1G7VA 1TB3A 1THFD 1FFUC 5TAOA 4XD6A 3W00A 4PUJA 3EB4A 3CHDA 4ZA0A 2Z1SA 3DYPA 3WK1A 3MCNA 1Z44A 2VC7A 2PLMA 4HBKA 1F05A 1RK6A 3MV01 3AALA 1SQ7A 3AXKA 3TSBA 3FV9A 4L65A 1JQVA 5AHEA 4L7ZA 1Q85A 2JALA 3V5OA 4JTHA 1G94A 4HZ7A 1J0KA 1U33A 3SQMA 1DIDA 2BVDA 3WLNA 3A6OA 4MPQA 1IGWA 4K2SA 3VIPA 3TK7A 3RYSA 3E0FA 1RQBA 2AGKA 3LLXA 4F9JA 3SZ8A 3JW7A 1C29A 1RSCA 4JTDA 4AD3A 1JDFA 3VD5A 3RXZA 4C65A 2J77A 1IT0A 3UZJA 2PCEA 5DELA 3INPA 3APTA 4H4TA 2WC3A 4XIMA 1OT1A 1OADA 4OWGA 1V6VA 4YU1A 2V5CA 1MNZA 5A6AA 2C3ZA 3GNRA 1QI4A 1D7YA 5C9ZA 4GYFA 3H2CA 3GIYA 3TX9A 1LLWA 3LUTA 1GZGA 2UBPC 4RKAA 1Q6OA 4RE3A 3GU1A 3W4RA 3LPFA 3M5VA 4NAEA 1JCYA 3TV8A 3MUIA 1XIEA 3DFSA 1CPUA 1NHPA 3OC4A 4KGLA 1Q8AA 2EXOA 1HQTA 3NG3A 3VE7A 1BFNA 1JG9A 3AYRA 3GU2A 2OLSA 4E3VA 3VIKA 1WZKA 1PL9A 4Q4SA 3UA4A 4UTTA 3A4XA 4HSNA 3S42A 4LS1A 4US5A 1W9PA 5A6MA 3GE7A 3QFAA 2E8ZA 3W2MA 5I3GA 4D6CA 5E9XA 2GYIA 3USZA 3L5LA 2XFRA 1FKXA 3KVLA 4DWDA 4NAEB 5GNZA 2ZX6A 2QGYA 2YCIX 3EOSA 1WAWA 3T2PA 5CBBA 2WOVA 2WW5A 2YA2A 2W66A 4OGZA 3APYA 3UJRA 3RAOA 2BHUA 1F5ZA 1VQTA 4S3GA 5LHFA 4FNRA 3TMLA 2R82A 3ARYA 4J57A 5TD4A 1EBGA 4N9DA 2INFA 1W3IA 1FHVA 2B7OA 2J7HA 2J7FA 2D2JA 3OW1A 4B16A 4M56A 4PC8A 5HNTA 4AZCB 1JGMA 1RZMA 3H12A 2GGEA 2YCJA 3THDA 3SRFA 1F3WA 4PMZA 1GOMA 1NP2A 1ME8A 4NZJA 4BI6A 4IGSA 2BXVA 5FEPA 1QNSA 2QV4A 4Y7EA 2DT3A 5AHLA 1NDWA 3RM8A 5FCZA 4IQLA 3GH5A 2W6RA 4XB3A 4GCAA 2WMIA 2GUYA 1FFQA 4ZXLA 2DZTA 2HPIA 3K5XA 1EF3A 3IPWA 3VOHA 1JDCA 1T40A 2J7CA 3T8LA 4IPLA 2W61A 4XD4A 1XW8A 1XINA 3UD6A 4LOCA 3CHEA 2QF7A 1D3HA 2PI6A 1JRPA 2Z1KA 4NYYA 5EKYA 4GGBA 1S2CA 3WEZA 4I3GA 3GVWA 1G6CA 1K3UA 2CZVA 1NAL1 4F2UA 3B03A 4EMIA 3VYLA 5LNRA 5CSRA 3K13A 3LS9A 1W3HA 1WB0A 1CYGA 2I17A 1KW1A 1WOAA 1P43A 1TQXA 2WNNA 4RUBA 2CFFA 2WQPA 1BXNA 1X6LA 3QV6A 4RNIA 3IRSA 5BCAA 3PBMA 3M0YA 4RZ6A 2GVYA 1X8FA 5IRPA 2EQ6A 2G41A 1OQFA 1ZENA 3CV1A 1EOKA 4F0HA 3MYPA 4HTYA 1LYXA 1BRLA 3TTOA 4EOUA 1A5SA 3GH7A 3W72A 4C6NA 2XVNA 4Q8PA 4A3HA 3G1VA 4XAPA 4B9YA 4NAFA 7REQA 2EG8A 1KXHA 5KZEA 1HNYA 4FXJA 1UZHA 2VCCA 5LXEA 3EEZA 3O15A 2ZDSA 3PBYA 5GVJA 3QOKA 4AWSA 5JUVA 3P8JA 3SRKA 3WBWA 1HF6A 3WD2A 3UCCA 2FTPA 4OVXA 3II4A 4GYPC 2XH7A 1KWGA 3LEPA 3VKKA 4QFUA 1H49A 3ARUA 5M2FX 4UCGA 1LDCA 1TPUA 3FDGA 2O9PA 1OEPA 1VFMA 1M01A 2GUUA 1EKOA 1YPXA 3ES8A 4J1OA 2VZSA 1CGVA 2QUVA 4J2MA 3UZ5A 3CAQA 5BMWA 3CO8A 3SO7A 3KHJA 3DC8A 5LIXX 1XLLA 1JUKA 2ZQ0A 3WN6A 3V35A 1NFBA 1S2TA 2H6RA 4GQQA 1XFCA 3TUUA 4FHAA 2WNQA 4IXXA 1UR2A 1F8MA 2YVFA 1POKA 4ZQMA 1EP1A 3WLOA 4GD0A 3CXBA 1K02A 1R3TA 4IPJA 2QZRA 4OECA 2VEKA 3FK4A 3MP3A 3DHFA 3LD5A 3CL7A 4HK7A 3PJWA 3W86A 4WF7A 1LQ0A 1EZWA 2ZE3A 3GNNA 3BDKA 3O07A 3B9DA 3GDLA 4PZVA 3KL5A 4HJFA 3NVDA 1KM0A 3JRKA 1RBLA 4WD0A 3SUVA 2VGIA 3W6MA 1GOWA 4C6KA 2QW5A 1N2VA 1W5MA 1PTGA 3D5HA 1VFFA 4QISA 1K8YA 3BCDA 1G9HA 5FJOA 3HURA 3L68A 5E9AA 3WCZA 4IIFA 1KR1A 3CLMA 3LRKA 5I06A 4C6LA 1X1NA 2F6KA 3PPFA 1OC7A 1EFZA 3L4UA 3TNBA 2Y7FA 2PDHA 3RHGA 1K03A 1YEYA 4H04A 3PUGA 3CK5A 1X2GA 4UC5A 1Q7QA 3AXMA 6TIMA 2PDLA 1HN1A 4LALA 2BFGA 3KBJA 3MUAA 4MOZA 4H7VA 1POJA 5BXTA 4ZQRA 1Q6EA 1V59A 3H7VA 3KTSA 3SQPA 3TCEA 4IX2A 1OK6A 3ZMRA 3BAKA 3LK6A 2C13A 5A8NA 7A3HA 4P8UA 4LNYA 4AFYA 4RZ5A 3AUOA 1EC8A 3W70A 1SZNA 2ZVRA 2CLLA 4B3ZA 3DK9A 1ZKQA 1XC6A 3CUGA 2J3NA 4YTUA 4PTWA 2QNEA 3PG9A 1GQLA 2HS8A 4QDWA 1MXGA 1UCWA 3IK4A 3TC3A 2D3NA 2DIKA 3RCNA 4QNWA 4OV4A 1FH9A 2CBJA 3GC5A 3ID7A 1M68A 1UR8A 1IIHA 2HK0A 1N7KA 2OWWA 1A53A 4O50A 3DOPA 5D2TA 1LF1A 4S3DA 1SJBA 3BLIA 3VNLA 2P88A 3CM4A 1HL2A 1W91A 3H4KA 4UOZA 4E4PA 4UTLA 3QR3A 3THCA 2QVNA 4XIAA 4D6HA 3G1RA 3ZFHA 4EAYA 1J5SA 1PZ0A 3MS8A 3KBVA 4DXXA 2Z00A 3STCA 4TTUA 2XGZA 2Z1BA 4X9YA 1I0DA 2CHRA 5E93A 1JFXA 3M6DA 3MSYA 2WBKA 4QEEA 3OBAA 4IL0A 1FQ0A 2WZEA 3ZR5A 1A3HA 1H09A 1GYMA 3KEHA 1ODZA 4W5ZA 2V6OA 1JCJA 1E9YB 2JF6A 1EDQA 2PC4A 2DSZA 4JTCA 4R9OA 2PRLA 3NM1A 3NSXA 4RE0A