3QPEA

Crystal structure of galacturonate dehydratase from geobacillus sp. complexed with d-galacturonate and 5-keto-4-deoxy-d-galacturonate
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
385
structure length
385
Chain Sequence
b'LNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title Crystal structure of Galacturonate Dehydratase from GEOBACILLUS SP. complexed with D-Galacturonate and 5-keto-4-deoxy-D-Galacturonate
rcsb
source organism Paenibacillus sp.
molecule tags Metal binding protein
total genus 134
structure length 385
sequence length 385
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3qpeA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3qpeA01
3V4BA 1BQGA 3FYYA 3JVAA 2GGIA 3I6TA 1WUEA 4GYPC 3RR1A 3S5SA 2XGZA 5IDZA 3MWCA 2PP0A 4H1ZA 2ZC8A 3N4FA 4IZGA 1MDRA 5FJUA 5FJOA 2P0IA 1XPYA 3UJFA 3K1GA 2PTZA 2OPJA 2PTWA 4JN7A 2ONEA 2OFJA 3JW7A 4MGGA 5FJTA 3TJIA 2QDEA 2MNRA 2QGYA 4DX3A 4IL2A 3OZYA 3RRAA 3MQTA 3UJSA 3TWBA 3QN3A 3H12A 3SN1A 5BOFA 2OO6A 1P43A 3D46A 2AL2A 3DFHA 1WUFA 3MSYA 1JDFA 1NU5A 3NO1A 1F9CA 2XH2A 3DDMA 4MKSA 2XH4A 1JPDX 4HYRA 4IL0A 4HCHA 4M0XA 2OQYA 2O56A 2PODA 3VCNA 4HPNA 3TW9A 3SQSA 4JHMA 3D47A 3I4KA 2PSNA 2PMQA 2OZTA 3R11A 1FHVA 2QQ6A 3JZUA 3FV9A 3DG7A 3PWIA 3QTPA 2GL5A 1P48A 3GO2A 3MKCA 4HN8A 4DWDA 2OQHA 1SJDA 3TWAA 2GSHA 3DIPA 2PS2A 3ZVHB 2PGWA 3QKEA 7ENLA 4IP5A 3PWGA 2DW6A 1XS2A 1ONEA 3IK4A 4E8GA 3UJ2A 1SJBA 2P8CA 4HCLA 4F4RA 4G8TA 2GGGA 3VC6A 3DFYA 2QVHA 3IJQA 4ZCWA 5J04A 4ROPA 4K1WA 2PA6A 1MUCA 3GD6A 3T4WA 3RO6A 3SBFA 4DN1A 3P93A 2OVLA 1W6TA 4HCDA 1DTNA 1EC9A 4KEMA 2XH7A 2OZ3A 4H83A 3TOYA 3ES8A 4IHCA 3IJLA 3OTRA 2RDXA 3I6EA 2OG9A 1KD0A 3NZGA 3PK7A 4FP1A 3VCCA 3QLDA 4K2SA 5FJPA 4KPLA 2GGJA 3H70A 1R6WA 2AKMA 3N6JA 4GGHA 3ES7A 4ZA0A 2PPGA 2DW7A 1SJAA 1OEPA 3FXGA 2PU1A 3R0UA 1NELA 3Q4DA 4HNLA 2HNEA 3FVDA 3SSZA 1MNSA 3VA8A 2QJMA 1TZZA 3ZLFA 3CB3A 3OW1A 4E4UA 2POZA 2OKTA 3THUA 2GGEA 3UJEA 3DGBA 2XH0A 5FJRA 2PTYA 3H8AA 3CXOA 3CYJA 3OP2A 4J3ZA 1TKKA 4KWSA 2HZGA 1L8PA 2OLAA 1MRAA 4M6UA 3MUCA 2I5QA 3BJSA 3STPA 3NFUA 3V5FA 3T6CA 3UXKA 1RVKA 4Z1YA 3KUMA 2QJJA 4GMEA 3UJRA 1PDYA 4A35A 2CHRA 2PP3A 1KCZA 3DEQA 4K8GA 1ECQA 3DG6A 3GY1A 3T9PA 4MMWA 5EU9A 1E9IA 3SN0A 2NQLA 1BKHA 2P88A 4Z17A 1EBHA 3UCCA 4ENLA 4HNCA 3SN4A 1EC8A 3ZVHA 3S47A 2XSXA 1JPMA 3ZLHA 4GFIA 2HXTA 4GIRA 3VDGA 5BOEA 3R0KA 1R0MA 3V5CA 2OZ8A 3GC2A 3NXLA 3R25A 3RCYA 3P0WA 2GGHA 3OZMA 3QPEA 4GYPA 2ZADA 3N6HA 3TCSA 2GDQA 4GISA 1ELSA 3MZNA 2P3ZA 3MY9A 3DERA 3RGTA 3ZLGA 2PTXA 3R10A 1SJCA 1IYXA 3VFCA 4E4FA 4JN8A 3UXLA 2OX4A 1MDLA 4A6GA 3BOXA 2AL1A 3R1ZA 2PGEA 2AL2B 3EEZA 3CK5A 4E5TA 2AKZA 3U9IA 4GGBA 1KKRA 3U4FA 3UGVA 3T8QA 3DG3A 1JCTA 4EWJA 3N4EA 1FHUA 3H7VA 3SJNA 3DESA 3PFRA 3Q45A 3BSMA 4IP4A 2FKPA 3UCDA 3TJ4A 3P3BA 4E6MA 3FJ4A 3TTEA 4FI4A 3V3WA 3HPFA 4DYEA 4X2PA 6ENLA 4DXKA 3B97A 1YEYA 3FCPA 2PP1A 4G7FA 1PDZA 3OPSA 2PCEA 3CAWA 3RITA 2FYMA 4H19A 4J1OA 4KT2A 2QDDA 2MUCA 3ENLA 4H2HA 3CT2A 4YWSA 1EC7A 5ENLA 3EKGA 2HXUA 1KKOA 3IJIA 4DHGA 1TE6A 3ZVIA 1EBGA 3TQPA 3VC5A 2P8BA 2PU0A 4A3RA 4IT1A 2QJNA
chains in the Genus database with same CATH superfamily
2RGMA 3WG6A 5FEPA 3NR0A 2JGQA 3HFTA 4H04A 4S3DA 1X7IA 2EO7A 1QNPA 3WNKA 2XGZA 5FI8A 1TR9A 2YCLA 4ACYA 4KBXA 4NEVA 1W3NA 4Q4SA 2OOGA 2P0IA 4MFEA 3UJFA 1F74A 4IQLA 1G0CA 2PTWA 1HKWA 3GE7A 4B16A 4EACA 3E0VA 3Q67A 1MZRA 2VM8A 2W0UA 2EQDA 1K9FA 2WNQA 3RDKA 1EIBA 3GIQA 3GIPA 5CG7A 2FQIA 4AIEA 4K8HA 3Q65A 4FXFA 2ZRZA 5DBTA 5AYXA 1YNPA 2EQ9A 1AH3A 1HVXA 4QEHA 4C1LA 4L56A 4ZFCA 4LW7A 2Z2AA 3VGHA 4ATWA 5GJPA 9XIAA 5J5RA 1HJVA 3NCOA 4CNSA 5D38A 1K1DA 1MQPA 2GR0A 1DV7A 4ZTYA 4YTRA 1K4HA 4HCHA 1XJBA 4M0XA 1GZ1A 1ZRQA 3KCJA 1UMYA 3GHSA 1KBLA 3FLUA 3SQSA 3P7YA 3RR4A 3I4KA 3LTSA 3KRZA 3M6YA 1EF2A 4C65A 1OJTA 3PZ9A 1GZJA 1FHVA 2FHFA 3RAOA 3WLTA 3DG7A 1XD0A 1TMQA 2PLMA 1SZNA 2WKJA 2PDCA 3OGRA 1FP8A 1EJTC 4XISA 1CLVA 5F4XA 3SSJA 4ERIA 2VEMA 2Z4GA 1VRDA 3EXTA 5D33A 3R4IA 4M82A 4Z42C 3ITCA 3M07A 1SZRA 3UWYA 3QQ1A 4FIQA 3MS8A 3LRLA 2GSEA 4PGLA 5I09A 2BXVA 1PTAA 1AQHA 4UZSA 1VGAA 4I6KA 2G50A 4LWWA 2IMRA 1HJUA 1XLMA 4CEXC 1S2CA 3PY2A 2DZXA 2E68A 1E0UA 2W63A 4R53A 3CTLA 4GY1A 4A3YA 3VKDA 1VRXA 2NXHA 1MUCA 1HJWA 3W1MA 4Y9MA 5D4YA 4CQCA 1OYAA 2ZX7A 5HOSA 1BKSA 1LROA 2HQAA 1E9YB 2JKAA 1V7AA 2PDHA 3AXXA 4KEMA 1TV4A 3NQ2A 4LC6A 4PB5A 3KOYA 1M7OA 2QPSA 5DELA 2YXOA 4B5VA 3HPAA 4IIHA 4R7WA 1DXLA 2IQTA 3USBA 4K2SA 2RH9A 3CZ8A 3W1NA 3CUZA 4JL2A 4JIIX 3II1A 1XLAA 1IWAA 3IJ9A 2PPGA 2YDQA 5FSEC 2ASHA 1YPXA 4CNUA 3VIJA 5XIMA 4DJDA 2BODX 1GHRA 4MZYA 1GEUA 1VC4A 1A5BA 4JTAA 1YIXA 1YHTA 1US2A 3JZEA 4LYRA 1W3IA 2GYIA 2YL9A 4FXSA 1W9BM 1A0CA 1DXIA 1M65A 3GD4A 3CXOA 3W2LA 3BLIA 1JI1A 2E1DA 4NSBA 2ESCA 3PZVA 1RQBA 4TX9A 1CEOA 1EZ2A 1LT7A 2A3AA 1OCQA 1FOBA 3UJRA 2KZHA 3MSRA 3W6LA 3TN5A 4C7GA 1XL9A 3KLLA 4Y96A 4OQVA 4QCFA 4HU8A 1H51A 1QW7A 4ML9A 2AAMA 3VGEA 3M9YA 5KVIA 5CC6A 3CZLA 6A3HA 2BY0A 1GTHA 3UG8A 1PTDA 2WLZA 1EA9C 3KS5A 3ARQA 3MMWA 1R0MA 4RNHA 1H7RA 2TPRA 2NVKX 1UW9A 2X16A 4NAFA 1T8QA 3NXLA 3MI2A 1A4LA 4LCRA 1J12A 2YZ5A 1JZ5A 2F61A 4GUFA 3HG3A 3WH8A 1ELSA 3OVQA 1AJ2A 2CLKA 2Y24A 4FEZA 4TTGA 2P3ZA 2DSKA 5DMLA 4MWAB 2X99A 1V5XA 3IJ7A 2C14A 3LHTA 1GXFA 4PCFA 4NP7A 4H4SA 6TAAA 3LCLA 4OHQA 2V5CA 2HPMA 4GIAA 2P3EA 3TW7A 4KFOA 4NX5A 3UFYA 5M3WA 3TYBA 3VAVA 1Z7AA 2YL5A 3T2OA 4NT0A 4HKPA 2FPYA 3NPUA 1K8XA 2YYUA 2GOUA 3N4EA 2NSXA 3BOFA 1XIJA 2W6RA 4YU1A 1FHUA 1JFXA 2OB3A 4B2DD 4FIRA 4C5YA 4N9BA 2VCCA 3TYCA 2V3AA 2J8FA 3WKZA 1RK5A 2A3HA 3CV1A 1C29A 4U4MA 1VS1A 3IRDA 4EKJA 4K6AA 2GZXA 1IWPA 3FCPA 1DIEA 1LRTA 2IKJA 2X8CA 3UPMA 1PDZA 3OBAA 7CGTA 4YPJA 3PZQA 4A21A 2O9RA 3TMQA 1QI3A 4KWVA 4KT2A 2Y8VA 4CGTA 4LUTA 4TTUA 3EAOA 2HTMA 4QJ4B 1RHCA 2HJPA 1JR1A 1Q8AA 1J6OA 1XSJA 3MUAA 1HGYA 1KNWA 3V35A 1BRLA 3V4BA 2QAFA 2DZSA 4AWTA 2VENA 1R8LA 4EVZA 3R5EA 2ZC1A 1V3MA 2E0PA 4PULA 4R33A 3VPLA 1KM1A 2X8GA 4IPNB 2OEMA 1E4IA 3ARPA 3APYA 1J8VA 2WPFA 4ZB5A 2Z7GA 2VTFA 4PUEA 5C9UA 5BW6A 1XFCA 1FWEC 1ZFJA 3OYZA 3LADA 3C2VA 1AH4A 3H7RA 2ONEA 4JEJA 3BDKA 1RCOB 3EPOA 2YDRA 1IT0A 2BY2A 3S6TA 2QS8A 4L1GA 4LCQA 4B5WA 2XN2A 1X1ZA 3G1RA 1G7UA 1HP4A 1A0EA 5FACA 4BQ3A 1ZBCA 3B9NA 4QP0A 1ITUA 2CFFA 3RNMA 4M24A 1AJZA 1GJWA 4HNNA 3SR7A 3VDCA 4GABA 3UXIA 4CCEA 2X30A 1PZ1A 1BFNA 3EX6A 3T2QA 1VHNA 1XIMA 4R7JA 3RIKA 1SFJA 1NEYA 1HFBA 1PHWA 2XVKA 4XVEA 1T6MA 3PPHA 3CGBA 2WSQA 1NHPA 1RLCL 3TFCA 3HPXA 1Y7VA 3OZOA 1F3TA 4GWEA 1M53A 4JYDA 1TV7A 2J8TA 7REQB 3TMLA 3A64A 3UWQA 1WB0A 1QDSA 3NM3A 3GX9A 3NEHA 1A5CA 4ZEPA 2NUWA 1X6NA 1QI4A 4D2JA 4CQDA 3R43A 1ZTVA 3A3WA 4I7WA 2P8CA 1V6XA 1X96A 3LQGA 4D9PA 4L9XA 3IJQA 2ZQ0A 5BYWA 5DCBA 2CFYA 1R3SA 1ADOA 1QOQA 2WP6A 1RBLA 3M0IA 4DJFC 4EQRA 3SBFA 1LQ2A 2PE4A 3T05A 2V3GA 5KEZA 1N63C 1CXLA 3ZR6A 1OM0A 3AU2A 1BEUA 1TVPA 2XH7A 2OZ3A 1CZ1A 4QBXA 1HJSA 3ES8A 2YVGA 3U5YA 4UIOA 3CTTA 5BXSA 3A12A 2WJZA 3TU9A 1MEIA 3VNYA 3NZGA 4LYQA 1ESWA 4QS6A 4FP1A 4GIEA 3QLDA 1DIKA 1YTDA 3WF0A 1OSEA 4NASA 4QR6A 3B0UX 4NYUA 3MP3A 1O95A 2E6DA 2RAGA 3W70A 3U2EA 2E5AA 4ZA0A 1OEPA 3BMWA 4MFDA 4IJCA 1FWTA 3OA3A 2FVKA 1TZ9A 2P53A 3KCLA 4IGHA 5IRPA 1IEXA 2H6RA 2YVJA 2XM1A 1Y65A 3GW3A 4IWWA 3OW1A 1A5AA 3TNOA 4REQA 3NQ6A 3WD4A 4WDXA 2XYLA 4YXGA 5AB3A 1LF1A 1HJXA 3ITOA 1PB0A 5FJRA 1JZ2A 1SFTA 1PZ2A 4PTDA 1KM3A 2A7NA 3GQYA 1SZFA 2WW5A 4KWSA 2NW0A 1MFVA 1KB3A 3EX3A 3DFTA 3E2SA 6REQB 1V0LA 2X05A 1OG6A 1FWNA 5TR3A 1TMHA 4RR4A 3SCQA 2TAAA 4HHHA 3DEQA 3WNMA 2D2JA 5AYYA 3PZTA 1ITCA 4HGXA 4Z2GA 2BY1A 1AMYA 3HURA 1P0NA 2PZNA 3GNRA 4A8IA 3RFAA 5CGTA 4NUWA 3C4UA 3QMSA 1XUUA 1PYFA 4IQDA 2CERA 1I2NA 2H9AB 3SCSA 1UR2A 4G1KA 4DAFA 3WCZA 4GFIA 5REQA 4DF0A 2QCDB 5LA2A 2ZUVA 4F3HA 3QZ6A 3G0XA 1OABA 3S0CA 3R0KA 1W32A 3GC2A 2DGAA 3EA3A 2PF0A 3GXMA 1GOIA 4BEUA 3BH4A 1GREA 3WL0A 1CNVA 4HOZA 5XIAA 1HKJA 4Y6GA 2GDQA 2DP3A 1P4CA 2TRSA 3M46A 5CC7A 1H2IA 1FQ0A 4JZ5A 1YKWA 3AJ7A 3R10A 1XGDA 4WXZA 3P0XA 3DZ1A 1NFGA 4W8BA 3UZZA 2QMKA 4J3WA 3M0ZA 3EMCA 1F4HA 2W3ZA 1PIGA 1HKIA 1QI0A 1JCMP 4W7VA 4IQJA 3PPCA 4X9YA 3FKKA 5HPCA 4UNLA 4PMUA 2EG6A 4CD8A 4FX8A 1AVAA 4GG9A 4GBDA 1A3XA 4UOZA 1PUDA 3I6RA 5TQLA 2NQ9A 1MI3A 3WDRA 4UQEA 1FFQA 3PFRA 5DCDA 2GJNA 2AGKA 1J11A 3P81A 5A5WA 4P7RA 5I79A 3W9ZA 3A9BA 1OD8A 4N7QA 3CB8A 2E77A 1KBBA 3C6CA 3PZUA 1JDEA 1OINA 4MYAA 3DOPA 2QKFA 4S38A 2IXVA 3VD9A 2BY3A 5FEWA 4Y2WA 4J56A 1TTPA 5CPTA 4NXSA 3FA5A 4L4PA 1BZLA 1WPCA 1QUMA 1VH7A 1S1PA 1TQXA 4JTSA 1BF2A 4A3UA 5GNYA 1X8CA 1F2JA 3WX7A 4Q8WA 8XIMA 4IIGA 4MYXA 1R7OA 4YWIA 5CAHA 3GDTA 4ZE5A 4WRHA 2D23A 1SSGA 2Y2WA 1ICPA 4GYJA 4MOZA 3POCA 1PKYA 1T0OA 3REQA 5BRPA 4HSHA 3TYDA 1KBJA 1W31A 3LA4A 2GGIA 3W7HA 1ENUA 3VX0A 4AD4A 3LHVA 2X1RA 3VNJA 1UD6A 3AALA 4OBTA 3PTKA 1UD5A 5JH1A 1MUWA 4IFKB 2TMDA 2ACRA 2GJXB 4HZMA 1GEQA 3H2OA 3NTYA 4YWOA 2XVNA 2WOIA 5KMYA 1CXIA 4H9TA 3SUWA 4FLOA 3C5QA 5FJTA 4MJMA 4HIBA 2MNRA 4J57A 1VCGA 3KTXA 3OZYA 1N82A 3FAWA 2R94A 3UJSA 1O4UA 4GZIA 1BPLB 2YR1A 3CGTA 1NVMA 2PDQA 4NL1A 4MKNA 4HTYA 3UQNA 5EMYA 2XFYA 5BWAA 3B8DA 1JF6A 4K39A 1DEDA 1K02A 5L6UA 4J3VA 5EY5A 3MSDA 5CZTA 1M03A 1JPDX 2KAUC 4QS5A 4TOQA 4Q32A 5FL1A 4XBJA 3WMBA 1DJWA 2ZX9A 3M44A 2WKGA 5A6MA 3CHFA 3EWCA 1UZ4A 1VFTA 3HJZA 4AZHA 3NWRA 2GK1A 5FS6A 2HS6A 2QQ6A 3BQ6A 5LA0A 2G4JA 3W2NA 1S5MA 4CD7A 3KBWA 4PSRA 3VM5A 4LNCA 3IACA 2B81A 3C2EA 1RJQA 3SGUA 1GONA 2VC6A 4FLRA 1P6WA 4LBSA 1J0JA 4LBUA 2CDUA 1UKOA 2PS2A 2RUSA 2PGWA 2FGZA 3MJMA 2F8QA 3FN9A 1KLZA 3UG5A 2WMFA 3LGDA 3OBKA 3UJ2A 2G96A 4G8TA 2GGGA 3PJTA 4US5D 3A3HA 3MW7A 2DZBA 2QVHA 3IGHX 5AZ0A 3CV6A 5A8MA 4AVOA 1EHAA 4TMCA 3M0XA 1EEXA 4FLQA 3ZMRA 4GLEA 1OK6A 2VYOA 5AYZA 3NXFA 4MNMA 2WMGA 2QAEA 3A13A 3WLLA 3WK0A 5I78A 2UY5A 2B7OA 2NWRA 1M6IA 3U8GA 4JOMA 3VK5A 1E40A 3A4AA 4H8VA 1XYMA 3GG0A 1LBMA 2PBGA 4AEFA 1G94A 1OYCA 2C3ZA 4JKKA 3NO5A 3PK7A 4H4PA 3RX4A 5I6SA 2OT0A 1OK4A 5AC6A 4DWSC 5F1VA 2V3BA 1S2WA 4GGHA 3LY0A 3NDOA 4E2VA 2X0SA 4I9AA 1LQ0A 4PTNA 4CD5A 1ZSXA 2GQ8A 5HANA 1TPWA 3O3RA 3VUPA 2EPNA 1Q6FA 5EB8A 3USZA 3U3HA 4F0HA 4I3GA 4JKLA 1GEHA 4YVVA 4OKDA 4YVXA 3THUA 1W3JA 1XDJA 4C6BA 4KRZA 3NQBA 2XHYA 3NM1A 1U2YA 4CCDA 4URIA 4HSOA 2XVLA 1FKWA 5HMDA 5U4NA 2VGGA 1TV5A 3BAIA 2X1SA 3G3MA 4JTRA 2OOFA 1WDQA 4M5PA 3WUGA 3T6CA 3UXKA 1Z9AA 3KUMA 1PDYA 4ZQRA 1SB3B 4FALA 3BW4A 5ABGA 3LTPA 1E15A 1KCZA 4UFLA 4GC4A 5D2YA 4LRTA 1UBSA 4OWGA 2NQLA 5CPQA 3MV11 3VO0A 1VEMA 5A6BD 1D2KA 4WJ8A 3WLNA 1YE6A 4DUOA 3KDOA 4H41A 2DORA 1BVWA 3W6YA 4KFNA 1CGTA 2XFRA 3HFYA 4QE1A 1ECEA 4CVUA 1DBTA 3WQFA 2ZBTA 3H2AA 3ZR4A 2X2GA 1GQIA 1AMKA 1FCBA 3OZMA 3MMTA 1BYBA 1PX8A 5K9CA 3DHFA 3TLQA 3ZJ8A 5CPNA 4DJED 2PDJA 3MZNA 3DJJA 3BTNA 3EB3A 3QFEA 4CKQA 4L64A 4TX6A 4JGDA 5F2MA 3UPWA 1WQ5A 2D3NA 4MWAE 1X38A 3OZPA 1MDLA 1JPKA 3KFTA 1EWDA 3G3DA 1IEQA 4Z08A 1Q6OA 2I1OA 3IV8A 3STCA 2GJRA 3TC6A 3DJGX 4FR1A 1W2PA 3HPZA 3TR2A 1NWTA 4W9TA 3MO7A 4B90A 4AYSA 4O18A 3ARTA 1KKRA 4B9ZA 2PBOA 1DXFA 1HKVA 3BURA 2W3SA 3UGVA 1FWRA 3VXGA 3VI2A 4NRRA 5CZJA 4C90A 1QBAA 3L68A 7TIMA 4PMOA 3PBVA 5CJ5A 4R88A 1KFWA 4Z2LA 3M16A 3C0QA 3K30A 3H2MA 1ODUA 1RJPA 1DJIA 5CPLA 4LNYA 3BSMA 4KH2A 3RK8A 1VIZA 1FWJC 5JU6A 4Q7BA 2V6OA 1ICSA 1ME8A 2G3NA 4V1YA 1EGZA 3CUFA 1B4KA 3LPGA 1XIIA 4P8XA 4JFWA 4F0LA 4GINA 3WELA 1NPXA 3ZS4A 1QPNA 1GETA 4TVCA 2XZ9A 4MDOA 1WDPA 3ITGA 3RITA 2FYMA 4UTLA 1S7MA 3CWOX 3QR3A 2QDDA 4X0NA 2FB2A 3C2YA 1JVNA 3AOFA 2O92A 5LHFA 1EB3A 2ZUUA 4JIRA 3APGA 5A6TC 3ZWSA 1W1PA 5CC5A 1JDCA 4V28A 4DHGA 1ZMCA 1L6SA 3M64A 2BGSA 4BA0A 5C7VA 2C71A 2WOQA 3STFA 4WIWA 2DIKA 1TG7A 3RLUA 3GYEA 5DXYA 3MCMA 1NHRA 3W7LA 1YTKA 4FNQA 2JF7A 3BL3A 2GR2A 3M0JA 2DY3A 1OT2A 3GRIA 4LVFA 2FMOA 3C0LA 4H2CA 1LL4A 1XPYA 1F6YA 4PSPA 1U1JA 2B31A 4G2DA 3VIPA 1IIHA 1YADA 2OWXA 3GDBA 3PG6A 3CL7A 3M7SA 5CSYA 1J18A 3IGUA 3W7CA 2FTPA 5F4WA 1XLEA 2QGYA 3HTWA 2CHOA 1ZY8A 2NX9A 4GX8A 1A49A 2YBVA 3D0CA 4DZ5A 5HWJA 4IPLA 1U5HA 5CEWA 4DJDC 3FNDA 1O60A 3A7RA 1CGVA 3VGFA 4ERGA 3W7OA 4RV8A 4OUEA 2R24A 3WQPA 1NU5A 3NO1A 2HEJA 2WSPA 1MNZA 3WLRA 4MLRA 4TUFA 1G6CA 4PMJA 1M1BA 3MJYA 4YTQA 2EG8A 2O56A 4HPNA 1U1UA 3STEA 3ERPA 2PD9A 4GOAA 4D1IA 4GQRA 5EGRA 1IXPA 3R11A 4S2BA 1LP6A 1RY8A 2FPVA 1R87A 1EEPA 7A3HA 1WDSA 4DWSD 4PMRA 4S3AA 3S2MA 3UU0A 4JR5A 3HMCA 4UQDA 4UQAA 4HN8A 3W75A 1P6CA 5I77A 1HT6A 1VCVA 2V6AA 3W72A 4EQSA 5GQBA 2HMCA 3S1UA 3LDVA 1OX6A 3WSUA 2A21A 5G2WA 2F38A 5HBFA 1ZP4A 1Q6RA 3BW2A 1E4LA 1JEZA 1Q1RA 4KEVA 1DIDA 1VZWA 4WOZA 3GVVA 3WF1A 1VPQA 4JTUA 1GG0A 3DYMA 1PE1A 4LAMA 3FEQA 1J01A 1P1XA 5I0DA 1MXDA 2OTDA 2VZSA 3L12A 4K1WA 5G5HB 2H3DA 4DZAA 3RO6A 1CT5A 3MCNA 4JTLA 4G9PA 1TA3A 5KZDA 4O13A 1POJA 3NZQA 1E0WA 4A8NA 2RJGA 2HRWA 3CNYA 4H83A 4J2PA 4OECA 1XRTA 2CBUA 4ZQNA 4NQ1A 1TUFA 4O8RA 3VOIA 1VQTA 3B9JB 2RGLA 1KD0A 2CBVA 3VU2A 5BMWA 1RALA 4MUZA 5F2GA 3ARXA 3JS3A 3GNOA 3URHA 3TIMA 3WQ8A 1EPVA 5A95A 1FH7A 1R6WA 3BO9A 2NPXA 1BVZA 4KWUA 1H1YA 3WUBA 3R79A 3I4EA 4BY3A 5D05A 2INEA 1UCWA 3VKCA 4IJBA 1XRFA 4PBGA 4XAGA 5JBDA 4UTTC 1PJ9A 1QPQA 3TQ0A 1TCDA 2PGRA 4LH8A 3VA8A 3THQA 2EBNA 2QJHA 1GOQA 2E5CA 1TZZA 5TNVA 4S3FA 2OKOA 3LLXA 3M5XA 3QGKC 2YJQA 3P5ZA 1HUVA 1CXEA 3R12A 3HGRA 4H01A 3CYJA 3WLMA 4MZ8A 3E0LA 3OQEA 4U33A 3BICA 4A3HA 4P7NA 3CAQA 4UOQA 4DEFA 1M7PA 4NYYA 2QJJA 2H3BA 4YTSA 2QDGA 2CHRA 2GQAA 1UJQA 4ZB2A 1UH2A 3WJWA 1XX1A 3TA9A 1OF8A 3T9PA 4O14A 5H8MA 2EQ8A 1ZXIC 3HQOA 1PIFA 4IPJA 4HMEA 8A3HA 3LBOA 2P88A 1KCKA 4GQQA 3QKZA 1EC8A 1THFD 4AYGA 4GX9A 4GYKA 4HA0A 3W1LA 3UY7A 3WNPA 3VIHA 3SUUA 2FJUB 3SY1A 4Q6JA 4L6DA 5AHFA 4U3AA 2F2KA 5C55A 2QUNA 5GPRA 4XSLA 1EGMA 3ALFA 1K6WA 5HMEA 5H2ZA 4CNTA 1YW1A 1IQ8A 2E40A 1UUMA 3GC5A 3PFMA 1LDCA 3WFAA 2CW6A 1GGOA 2XM2A 3GUWA 4M7SA 1UA7A 3E9AA 4DQWA 1YDVA 3GWQA 3ZLGA 4LV9A 4IIFA 3H26A 4QAIA 2V2HA 3GNXA 3DFOA 3B3DA 3NNTA 2W27A 1FUYA 4L7ZA 1O94A 4NI3A 1F73A 4J27A 3RX3A 3FYPA 5EMJA 4NJIA 3RM8A 4OOUA 3WFZA 3STGA 1AZ2A 3AMGA 2P0OA 1XD1A 3IGSA 2QV4A 4ONVA 4EANA 4GUHA 3AWOA 5EA9A 1BSLA 2QCEA 3POHA 4LTSA 3LXBA 3NVVB 3WF2A 3E74A 1ZX9A 2ZRVA 5TIMA 1QHOA 1VCFA 3E1F1 2ZOXA 2WQPA 1CB2A 2BOGX 3QVQA 3ZWTA 1W91A 4QLLA 5HR7A 1BQCA 1UWUA 3IVTA 5EKYA 5IHSA 3BLFA 3B8VA 1XBVA 3AZTA 2FTYA 1XWYA 4EF9A 4MJZA 4U2ZA 3TTEA 4W89A 1XI3A 1YDNA 2TYSA 1FRBA 2W55A 4ICMA 5AHLA 3B97A 1DWJM 3ZO9A 4WGHA 3R6IA 1DJZA 4DJDD 3L4ZA 4OJYA 2VFIA 2CLHA 3LMYA 3LB0A 5DF0A 4HNOA 1JZ3A 5IFPA 5C9WA 1Y0EA 3V0SA 4G6CA 3KZSA 4QM1A 4MB1A 2MUCA 2V30A 5H6HA 1L8NA 2WC3A 4AZGA 4AZ7A 4G56A 4OBSA 1AW5A 1TE6A 3TQPA 3EXSA 3LPOA 1NOUA 1X97A 1Q4WA 2BLEA 1Z6KA 5AZ1A 1VFSA 4O19A 3PG8A 3RR1A 2R82A 2QZRA 1V6VA 1LPFA 2PP0A 2OYKA 2OX1A 3KHJA 4Y8FA 3N4FA 1R3WA 2DIJA 5EMUA 3VIKA 1GESA 2XIIA 1DIOA 3MMUA 4JD4A 5C2GA 1XBZA 3PF3A 3CZEA 1W37A 3U5UA 1DJNA 3W22A 1XH0A 2Z24A 2ACQA 2X8RA 1E5NA 1KWKA 5B80A 3HPSA 1EPXA 2QAPA 4MWAA 1P0EA 2O7QA 3AM9A 3IVUA 5FJJA 4Q4KA 4B5NA 2OO6A 2A6NA 5I02A 3THDA 3W1PA 4UTKA 3S2CA 1Y5XA 1JDFA 4ROQA 4JDBA 2PRHA 4NZ3A 3CL6A 4HT3A 1GVFA 5D09A 3PJUA 4IFRA 1AZ1A 4AZBA 4C6IA 3S1XA 3D47A 1EJVC 3S2NA 3TK7A 1GJPA 5E0KA 1XG4A 2OZTA 3WQGA 2W79A 1EL3A 4QX4A 1J79A 2V5BA 4H4RA 2C8NA 1E6XM 2O9TA 4XKYB 2PRMA 1AD4A 3TFXA 2V3DA 3ABSA 4E0CA 4HZ7A 1IT8A 3VIOA 4R85A 5EBKA 3LPFA 4YCPA 1UR0A 3FOKA 2PFHA 3N2XA 4XSMA 4BJHA 5K9XA 1BXCA 4R5EA 1KA9F 2XFFA 2CLOA 3TZNA 5RUBA 2DPEA 3RXZA 1SUXA 2IKIA 3AYRA 1FWWA 3LZ5A 1QPRA 4I7VA 3NZPA 3PANA 2DW6A 3IK4A 3WDHA 1UASA 3M0MA 4RNJA 1TPFA 3GHTA 3VC6A 3UY8A 3F4NA 2E9BA 1F8WA 4LIIA 4WK9A 1NF0A 2PCQA 2ISWA 4MSSA 3TZFA 4YJ5A 1D8WA 5DRIA 4UCGA 1LLOA 5KZMA 1US0A 3LSBA 3FIGA 3IGXA 4ES4A 1UOZA 5LIYX 1AL7A 1W5PA 3IJLA 1V3HA 4X22A 5IBXA 4HU3A 1Q85A 3RUBL 3MV01 3I7QA 4E8CA 3L4YA 4DLFA 2FFIA 3DYOA 1IZJA 4O1FA 3BSGA 5A8OA 4GVGA 4Q8MA 4PR4A 1W5NA 2PWFA 5HULA 3ME3A 1K9DA 4KPLA 1BGGA 1F3XA 2P10A 4HHMA 2VFGA 2HVMA 4WOQA 2AKMA 1UWAA 2CKRA 1WV2A 1RP9A 1LBLA 1AQMA 3OGVA 1QNSA 3GU9A 2ADAA 4MIMA 1MXGA 2HNEA 3O6DA 3SSZA 1RBOB 1ZJIA 8CGTA 2VURA 4IMFA 3UZ5A 5D9NA 4DO5A 1ZS2A 1O7AA 4AHOA 4MY1A 4LS2A 3NL2A 3QW4B 2QJGA 3AS3A 5CLWA 3UW6A 5C9RA 5IFTA 1KR0A 4HD5A 5FOOA 5CQ1A 1H1NA 2C6QA 4UTFA 2WOWA 1TKKA 2OT1A 4BWLA 3UT0A 3KVLA 4H7VA 3MUCA 3HJEA 3N04A 4YVPA 1FCQA 1QVBA 2PDFA 1FEBA 3BJFA 2WC4A 4BKNA 3NYDA 1ME9A 2GLKA 2V9DA 1V3LA 3TYZA 3PN8A 1JAKA 2E09A 4LAKA 1TREA 7REQA 1FDJA 3DENA 3AZSA 2R1MA 1KXHA 5K3VA 1XCFA 1B0IA 1E56A 3ZSSA 1J0HA 4FF7A 5K4XA 2VC7A 3PG9A 3ZLHA 3RPTA 4R34A 1BD0A 3I65A 3NOEA 4AXNA 3GRSA 3B40A 4H4UA 2QF8A 1AW1A 2WCSA 1I2QA 4ICNA 3BG9A 1FFVC 2D20A 2GGHA 1ZZMA 1A5NC 4JTCA 1KTNA 5ABTA 1WOAA 1KCLA 3QOKA 3MDUA 4HHLA 5A3HA 3QZAA 4YNGA 3KZPA 3E5BA 4TQTA 3AYVA 4GNJA 4XX6A 1SJCA 4K3ZA 3EWDA 1B3VA 3VFCA 4RE2A 3UYIA 2YIHA 1FWSA 2PZ0A 1OX4A 2XG9A 1R3VA 4CN1A 3EEZA 3N73A 3HOJA 5HPOA 4QG9A 1V6WA 4W8AA 4NJGA 1SZGA 4JY9A 4U10A 4HZ8A 4TVUA 1JCTA 2PDYA 3OYXA 3R8GA 4HK5A 4B5SA 4XB3A 5EPDA 3SCOA 2D0GA 4BHYA 4AHPA 3DESA 4AAJA 4I5XA 3L4WA 3LXCA 3WLKX 4NHVA 3Q45A 2Y85A 3UCDA 4O0KA 2D22A 1IXQA 2C0AA 4E6MA 3S6OA 3KBJA 4WHBA 3N2BA 3ELFA 2BZNA 3ZZ1A 1S2AA 3RRXA 1JDDA 1YEYA 1XLLA 1B54A 1LG1A 1UR4A 2H8ZA 4R9OA 4ATLA 1X2HA 4M7TA 1BHGA 3D3FA 5FS7A 1O68A 3QQ0A 5DY3A 3ARRA 2V81A 6REQA 5M1TA 5A6KA 3GG7A 3AS1A 5IDIA 4C60A 4TX8A 5JCLA 1RAKA 2AGTA 3K2GA 1EBDA 2NQ5A 1E9LA 3W24A 4TR9A 4IT1A 4IOTA 3ZJ7A 1MOKA 4V33A 3CIXA 3HQ1A 3VIMA 3LXDA 1B3XA 2H9AA 2J66A 3GZ3A 5M03A 3LZ3A 2Y6ZA 5D30A 3S5SA 3BMVA 2DUZA 4GVFA 1KM5A 4FXRA 2QCDA 3F4VA 4MB4A 3WQOA 2VNCA 3B4YA 3PTMA 3P80A 4RZBA 3DCPA 4GC3A 4XZNX 1FWBC 1DWAM 3K1GA 5T8GA 2HISA 2PTZA 2YXXA 2CZ5A 1Q3NA 2A79A 4NZFA 2VC5A 3CEPA 1T96A 4J3SA 3QQWA 4ERAA 1S2VA 2PC4A 3FJ6A 5MKGB 1KN0A 4CNPA 1WXJA 2ZUMA 1VR6A 1XC4A 4D6CA 2A8XA 7TAAA 4BS0A 3TONA 3H12A 2CLMA 5CC3A 3W00A 3W7MA 4Z0JA 3D46A 4PTWA 3OLEA 1GZGA 3DFHA 2J4GA 3S6DA 3L5MA 4LCSA 2WHLA 3P74A 2PDGA 2XH2A 1B2YA 4AUBA 1ISXA 1XKYA 1W9DM 3UG3A 2VQUA 3FKRA 3SY8A 1W54A 1NHSA 3N1AA 3IIOA 3AHXA 3T55A 2QCNA 1V6TA 2BHZA 4BV6A 4LU0A 1V93A 5HQEA 2RDTA 3I7RA 4D6FA 3WDPP 3GTNA 3JR2A 4X0VA 3QC3A 4AX6A 3NQGA 4UTUA 3R8RA 3QFBA 4S3CA 4B5TA 4HB7A 4AC1X 3W1RA 3KOZA 4Q4OA 3UWVA 3LHZA 2I9EA 1LVLA 2VGBA 3ZVHB 4N6EA 4TO8A 2HE8A 2VI0A 3BV4A 3IRSA 3WIJA 3CAKA 3MBFA 3QEZA 3EX4A 3S5YA 4EXAA 1A50A 4G5DA 1K3UA 1OGGA 1JPIA 3DHUA 2OSWA 2BC1A 2G97A 2X2YA 4DN1A 3RPDA 1NQ6A 2OEKA 3A22A 3EOLA 3K5XA 1OBAA 3PS7A 3WK2A 4AB4A 1RLDA 1DTNA 3I3DA 4PC8A 3EEGA 2V8ZA 3HF3A 1RCQA 3RX2A 5BZAA 4AU0A 1E55A 4LEQA 2R1LA 5KINA 1NDVA 4IUGA 2ZZ3A 4YS1A 2QW5A 3GNPA 3SRHA 3WBAA 1FWFC 4L1XA 4B15A 4TXEA 1PO9A 3UF9A 1KWGA 2XDFA 2VDGA 4DBWA 3E5PA 2P1FA 2GJXA 3TTYA 4CLMA 4H00A 5LNRA 1FIQB 2GQ9A 4JFTA 2A2IA 1W9XA 3DK4A 2CZEA 2GR3A 3FXGA 3U57A 2YL8A 1Z3NA 3TSBA 1K77A 3W37A 8RUCA 3PBMA 5D8ZA 4O8AA 1A0DA 4XIAA 1AODA 2QJMA 2Y7GA 3VOFA 2EPKX 2V69A 1ZGDA 4QIUA 4KWWA 4L65A 1UUOA 1NWRA 3PPGA 1VDVA 2PTYA 1CWYA 1W5OA 1KM6A 4P2VA 1YRRA 2D0FA 4J3ZA 3XISA 1JXJA 4UCFA 2ISVA 3G1SA 3O15A 3C56A 4O50A 4UMAA 1MRAA 4UTWC 1CGWA 1LORA 2V5LA 1QNOA 1GG1A 3ALGA 1K9EA 2OXNA 1JNEA 1I2PA 1ECQA 2E5DA 7ODCA 2DUXA 2Z2BA 3MANA 2IKGA 3NPVA 4WCJA 4NVTA 1H50A 2J88A 3S4TA 4F66A 1WAWA 1EDGA 5C70A 5AHIA 2BSLA 4Z17A 1PPIA 1HJQA 3W38A 2DU2A 4ZOHB 5C9ZA 3TN3A 3C52A 2ZICA 5BOOA 4H4IA 4JX5A 2BOFX 1Q63A 4H4TA 3WUEA 4GZEA 3NJ3A 1WOBA 1UKQA 2F2HA 1J10A 2WVSA 1A47A 2Z26A 5G4EA 2BOEX 1OT1A 1ZQ5A 2WVTA 2OYMA 1PX3A 1NOWA 2PLKA 4Q7NA 4QSHA 4ADSA 2GOKA 2E7FA 2J75A 4JTEA 3MY9A 3W85A 2X50A 1CX9A 1GW9A 3B06A 3CU2A 2GR1A 2OO0A 1KRMA 5JVLA 1IWBA 1LL7A 1BWCA 2DSZA 2VHLA 4M6PA 1T8XA 2DT0A 1NF7A 3TN6A 3LCIA 4O1EA 3AYSA 4WXYA 3WLQA 3Q37A 3LN3A 3CASA 3DG3A 4O52A 4H4XA 3GXFA 2PWHA 1CDGA 1S5NA 3BGAA 1L6YA 4V27A 3TXZA 2J7CA 2J9YA 2JIWA 3THCA 4PUWA 2J9XA 3WEMA 1FHDA 1EHNA 3NUKA 1TR1A 2UY2A 5JCNA 3RILA 3W29A 4DRSA 4TVWA 3H4GA 4IPIA 1HO1A 2VP8A 4O15A 1KV5A 3D6NA 1SSDA 9CGTA 1W9UA 1H41A 2VR4A 1TQJA 4XTIA 3RJYA 2EQ7A 3VMOA 4DYEA 2A85A 4GCAA 3W7EA 3ABRA 4DXKA 2EPMX 4LB4A 1O5RA 1ISYA 3L66A 4RE3A 2ZDRA 4C91A 1IIGA 3IS4A 1SZEA 1B9ZA 3BLKA 5U7SA 1NP2A 4Q7IA 4M81A 3UNTA 4RZ6A 4LS1A 1UPMB 2ZXBA 4QXIA 4GJJA 2QUMA 2D2GA 4ZXLA 1XLFA 1EC7A 3AIEA 1EJRC 3FA3A 5XINA 5ENLA 3EKGA 2V63A 1YXCA 4AC7C 4XO6A 4F9DA 3F1QA 5ER0A 3VC5A 2P8BA 5I3DA 2PU0A 4HA1A 1AOGA 5DRCA 2EHHA 4M56A 3JVAA 3W87A 4XAPA 1C9WA 2QPUA 5LGZA 1H7PA 1LUCB 5M5DA 1ICQA 1XIGA 4DM2A 2ZTJA 2GSJA 2VXNA 4M29A 2UV8G 3RCNA 3FVMA 3DBPA 3UZXA 3W7GA 2ATMA 1E6NA 2A6LA 3WJSA 3RHGA 4JN7A 4Z2IA 2VELA 1GYLA 3Q58A 1A5UA 1N7KA 1BWLA 1TVLA 2AQOA 3S9YA 5BMXA 3W1UA 2C3DA 5E9AA 3H4XA 2QPXA 5FA5A 1NY1A 2PD5A 2X0HA 3PP7A 3VNZA 1Z41A 1UZHA 3QY8A 4UQ9A 5FF4A 1OADA 2HBVA 3KVMA 1B3WA 3WF3A 4L6OA 1RJRA 4PZVA 1XYZA 3EBVA 5IHRA 3TC3A 3GDMA 1R3QA 2G8ZA 3QHNA 4N0RA 3EKLA 3W3OA 3MDWA 2PMQA 2TPSA 1QAPA 4GXPA 4AWEA 2C13A 3OQ8A 4U5IA 1LOLA 5LZLA 3F2CA 3RU8X 3AXHA 3G8EA 3OHIA 3GO2A 1E71M 3T07A 3W28A 3QGVA 1LLWA 1DJHA 1IEIA 2VWSA 3OODA 4BI7A 1A5LC 1YE4A 1KC7A 3OOQA 1A4MA 2ZCGA 5A69A 3QKEA 1G4EA 2BVYA 1RPKA 3QC0A 3TUUA 3T4CA 4POCA 1MYRA 2QVNA 3EOOA 2G3MA 2B4GA 4RUBA 3CGDA 5G5IA 2WP5A 4U2YA 1EOMA 2VEGA 4AVNA 3W76A 1V3JA 2RHGA 2W66A 3HGOA 5HA7A 4RKAA 5D9OA 1XXXA 1XIEA 3ZSTA 3CPUA 5AKQA 3P67A 2WK2A 1X6LA 2XINA 4LB3A 1GRBA 6PTDA 1EJXC 3M0VA 2WWCA 5CBBA 3P62A 4FF5A 1KTCA 1ADSA 2RDXA 4P7OA 1M01A 1BWKA 3I6EA 4AVFA 3NQ7A 1U83A 2WXDM 3I68A 2ZYFA 1J2WA 2J25A 2ZUWA 2C15A 2Z28A 3GH5A 5DANA 3IEBA 3CM4A 4RNFA 3AS0A 1TZ7A 1GQNA 4GPNA 4IPPA 4I5UA 1ZAIA 4AD5A 4HJWA 4IMEA 4B3KA 3EOEA 4ZOCA 3H24A 4ORIA 1ZHAA 1XYCA 2QIIA 2DSUA 3O63A 4B92A 2NT0A 3PBUA 2W0HA 1NELA 3NVWB 3LLFA 4JIEA 5FJIA 3NL6A 2ZFAA 1UYQA 1HF6A 2WCGA 4GFSA 3OG2A 1EP1A 3R0DA 1JRCA 2VX6A 3KRSA 3W1TA 3CB3A 3RPMA 5HWMA 1RK6A 3W7KA 4MUPA 3WDJA 3E3HA 3OLIA 3QFWA 3OVPA 2V2DA 1H11A 3CGEA 4RDZA 1DKWA 5D9PA 5BRQA 4MJ4A 2EJ1A 2Q3OA 3HQPA 5E6ZA 5T9BG 4DF1A 4F40A 3TOPA 3W1AA 2I5QA 1EUAA 4NJJA 4EK7A 1TFVA 3G1YA 1WO2A 4J5NA 2YQUA 1G67A 1JUEA 4MTVA 3L0NA 4PBFA 3GXPA 1GKRA 3TSMA 4MMWA 1QRQA 2F5ZA 1V7YA 3M0KA 3N15A 3ARZA 3B0XA 5JCKA 2OELA 3BGGA 2WB5A 3DC0A 2LLEA 1Y5VA 2ZA1A 3WDIA 4IQEA 1EKOA 1P7TB 4AZIA 3L21A 4IMAA 1YQ2A 3PAOA 1AA1B 4C6MA 3HV9A 5EYWA 2XIJA 2X41A 4MPQA 4ZOEA 5K2ZA 1XLIA 2NZLA 1XYLA 3C2RA 4EX4A 3WD0A 2FH8A 3H55A 2O4MA 1I9CB 2ZRYA 1BSIA 3RLHA 4BEQA 1NDAA 3W0KA 4PUKA 1SFSA 3GU1A 4HNTA 1JYXA 1IYXA 1EX1A 3SQLA 1FWDC 3BK0A 3L4XA 3L5AA 2WNNA 3A5VA 3AFBA 1WBJA 3IC9A 3NQEA 5FAJA 1ZY9A 1QTWA 4JYEA 3M0LA 1OHLA 4L4LA 2WAGA 4DO7A 4KQNA 4OUIA 3Q2DA 3WLHA 1CENA 3WN6A 2CYGA 1EP3A 4OZOA 4LUIA 2VKZG 3QTGA 1DQWA 1XLGA 1FHLA 3HGSA 3G1DA 3IAPA 1V6UA 3UZYA 1XISA 4GACA 5D2XA 3RG6A 5EBUA 2A3CA 5MHBA 4KF1A 5EMMA 1GOXA 2CLIA 4EQXA 1UWTA 1Y5WA 4KKXA 3VYLA 2JGYA 1UB3A 4Q4MA 3BAKA 3ECQA 4I9JA 3DFPA 2NV9A 3GFXA 3LI1A 3N11A 3QLLA 5LNWA 1VJZA 2YFNA 1HIZA 1NARA 1GRGA 4DZHA 2QULA 2Y63A 4UB9A 2E9LA 1STZA 2CBJA 3EWBX 4OVXA 1JZ6A 3NL5A 1DP0A 1X98A 3RF9A 3BAXA 3ITYA 2C3CA 4WSJA 5K9DA 3TYEA 2FHCA 4MLJA 2BXYA 4CQ8A 5KETA 4MHBA 1JGMA 1E4MM 2Y7FA 4AW7A 1W2VA 1SGJA 3EDDA 1IR2A 2R14A 3KOXA 1BQGA 1S5VA 1VQZA 3VIFA 4NEWA 3CWNA 2A7PA 2I57A 5IBXC 1BG9A 2VT0A 3WQDA 1JJKA 5D2WA 5BXRA 2D3LA 1R3RA 2XVPA 1JQXA 5CPSA 1NOFA 3DK9A 5CJNA 4IZGA 2BVDA 1MDRA 3AROA 3W23A 3MUIA 1TRDA 2PWGA 4OBRA 1TTJA 3MVTA 3LK6A 1LT8A 2ZVRA 5I24A 1CB7B 3TR9A 5JBFA 3GYCA 4MGGA 5C0QA 3H21A 1D8CA 3WDQA 4F0SA 4XIMA 4AIOA 3AYTA 1E1CB 2DZTA 1UP0A 3FYOA 2YKKA 3TQVA 3IIXA 5C7HA 1DHPA 1I2RA 4DI9A 4CUCA 4Y9OA 4BK9A 3T8LA 1WKDA 3UWWA 2DZUA 1FO4A 2B0MA 1J0ZA 5DXXA 3EB2A 4QG6A 3PTQA 4W8LA 1F9CA 3PJXA 1OB0A 2DVTA 4S3EA 3UYCA 4XUGA 2R9RA 3H6OA 3EOSA 3E02A 3VNKA 1TSIA 1XR2A 1PTGA 2CNCA 4NX0A 3MKKA 3WK3A 1X39A 1DNCA 4PCTA 4OV4A 1RM6B 1JAEA 1PWMA 3IIPA 3L9CA 3B8TA 2RJHA 1AQ0A 3RMJA 2CBIA 1PCKA 4E2BA 1P48A 4YN5A 5F4SA 3W2JA 1XIDA 3QYSA 3BG5A 1J0IA 3WYZA 1EF3A 2YDSA 4IJRA 3DUGA 4B3ZA 2XWDA 1L6FA 2WMIB 3VTRA 3I7SA 4UBPC 2DIEA 4IGMA 3VGDA 3B0VC 4PUMA 3NQCA 2FZDA 4PA8A 2CXGA 4ZTXA 1H7WA 3ORWA 2POTA 1Q6GA 1JD7A 4ZQCA 3BCFA 3C0JA 4XTDA 1I0DA 3T4WA 1MW3A 3HIJA 3K8LA 3A21A 3GVQA 1V6YA 2NX3A 4KFPA 1ALDA 5D9MA 1OFEA 4QQUA 4UQBA 3GC4A 1R9XA 1I1WA 4M80A 4PB3A 1KW1A 1UROA 3I3BA 1QXLA 1T41A 3SRKA 4AG0A 3VOJA 1WXZA 2V5JA 4LF2A 4FOUA 4CEUC 5CPMA 2YAUA 2PWUA 4HSNA 4Q4RA 1PKMA 4K68A 3J7HA 4WKAA 3T81A 2YZRA 5AC5A 1J5SA 3QPYA 3LSCA 3O7UA 5HNTA 3WQ5A 1C8VA 1VFHA 3QGAC 3TJXA 1N8IA 3ABZA 1PCWA 2DV0A 5HNUA 2ZZ5A 2EG7A 1AD1A 3H2CA 1WZKA 3OVRA 1V02E 3VNIA 1W1IE 4GYFA 2GRTA 3URAA 1MWOA 4CNOA 2OKTA 3WLPA 4MWAD 2WNZA 3H54A 2NQHA 1VJIA 3K13A 4KW2A 2OSXA 3T44A 2QV5A 1L8PA 1JCLA 2WMJA 3WY1A 5HJYA 4XZHA 4XKYA 2HE5A 3I3EA 3K1DA 4AY7A 4HZ6A 3B8IA 3H4WA 3BV7A 3GY1A 5DQPA 3QYQA 4BFAA 3SN0A 4JQ3A 5AVNA 3L67A 1S46A 1S38A 2BS9A 3WLJA 3LNPA 2VX4A 3WMCA 3S42A 1T3QC 2Q71A 1SO6A 1TYGA 2PLCA 3BCDA 2XSXA 1F8MA 2PAJA 3K4DA 2RDWA 2VOMA 4WKFA 3ZR5A 3B9EA 3DYPA 2OZ8A 2DUAA 3B8WA 3UVIA 4GY7A 3W27A 3M0HA 1KO0A 4I9MA 2Q3RA 2EPLX 5JCIA 2BVWA 2DZWA 4UFMA 2V38A 1TPDA 1A5MC 4GIYA 3V36A 1FFUC 4RE0A 4HPGA 1H5VA 5FSDC 3E96A 1GRAA 4K8EA 4NNCA 1TPEA 2C16A 6CGTA 4S3JA 3NQVA 3SIZA 1GERA 2UY4A 3TTQA 3VDHA 1KFKA 4GJIA 3GG1A 4WDUA 5AOUA 3ZXWA 3MB9A 4Z0SA 4O1DA 1EXPA 4Q4PA 2OMAA 1AH0A 3T7VA 3G1AA 3CC1A 2IPJA 1OCJA 3IIVA 3ITVA 1D3GA 1LRQA 3R58A 3NQMA 3VDBA 3U2OA 2Z29A 2WWDA 1FDYA 4NNBA 5CJMA 2NV2A 1W0MA 3EA2A 4XUYA 3VD7A 2IPGA 3M5YA 1GRHA 1HQTA 4XD3A 1GVEA 1WKEA 4QDMA 2VCBA 2ZXDA 4L6HA 3PNUA 3OG3A 3O06A 1NSJA 4CN6A 1HTIA 1Q66A 2HNHA 2BV9A 1H7XA 3F5LA 1YNQA 4NZCA 5JIPA 4ADUA 1HL2A 3CAWA 2OZ0A 3N9KA 1I8JA 2C79A 4FXJA 4W86A 4KCUA 4HPHA 2IQ0A 3QR0A 5D2VA 3IJIA 4PRRA 2PDIA 3PNZA 4DUVA 1W9PA 3MUXA 4A3RA 2QJNA 1ZJHA 4AMAA 4H3DA 3GDRA 3QV6A 4DBEA 4D6IA 3DK8A 4QGCA 1JZ7A 4LSBA 1F3EA 5FF7A 3SFWA 1WUEA 5A6JA 4GYPC 4HPXA 1XHCA 3G24A 1OWQA 5IDZA 4GQBA 5DMNA 1OFAA 4DBSA 3TP4A 1JRPA 3MI6A 1GKQA 3SFKA 2Q8XA 4H6EA 1RVGA 3AMCA 1OX4B 6XIAA 4UTHA 5ECVA 2VOTA 5ABEA 1C7TA 1DHKA 2ODOA 1TX0A 4PB4A 2VGIA 2NUXA 4KWOA 2WNWA 4IL2A 1K8YA 4GHRA 3EDJA 3GVRA 5CSSA 1HVQA 3WQ6A 4GQGA 3WBYA 4PBEA 1JD9A 4HNUA 1FX6A 3B8SA 5U1OA 1GYMA 1T5AA 2IPFA 1D7FA 3AAMA 1GW1A 1TYTA 3SURA 3MSYA 3LCHA 4M1BA 3EMZA 4I6VA 3DDMA 1E6SM 3R07C 3PZIA 4WX2A 3EDFA 1SMDA 3WUFA 5FKYA 4MB3A 3OVGA 4H9VA 3CBWA 2AQVA 1KFJA 3V1PA 1TRIA 5HDRA 1KGXA 3DGHA 3GAYA 3T0BA 2OWWA 5H8PA 1SW0A 4KCVA 3ZT5A 3PZGA 3B4UA 1H49A 4DPPA 4ZSTA 5G1TA 1FWGC 3WH5A 4KESA 1QO5A 2QCGA 1EX5A 3GVGA 2VUYA 2NVAA 2VD8A 1TB3A 3PVFA 3SR6B 3C0SA 5T91A 3C8FA 1TJ2A 4F8XA 2FZ8A 4H8NA 2HQMA 1ONEA 3IANA 1OZQA 1X8FA 1H7OA 4ZQOA 5HMFA 4QJ5B 4PFHA 2BMBA 3GKAA 2L5HA 4Z2HA 3GLCA 3AMDA 3LD5A 2G95A 1BGAA 4ROPA 4HU4A 5LIUX 3IJDA 1WDWA 2XISA 1E73M 1S1RA 1PAMA 1VB9A 1KBKA 3MTWA 4A3QA 3A4WA 2NT1A 2VEKA 2VFEA 2A0NA 1JUBA 4X63A 3N2CA 3BUVA 5LXEA 4A22A 1KGUA 3DI1A 3M0YA 2NUYA 1KRBC 1ZL1A 4AXKA 1GORA 3UWZA 3FA4A 4GVIA 1HKKA 2PDWA 1JYNA 3WH6A 1A3HA 1I60A 4J40A 3DI0A 1UQYA 4JTQA 4LAOA 4AF0B 5G4HC 3DHPA 5BNKA 4AH7A 4PEEA 2P5NA 4PMYA 2BVTA 5MKGA 1P5BA 4FNPA 3QM3A 2AAAA 3TN4A 4HNLA 3SUSA 4DXVA 2ZXAA 4MZ1A 4BF5A 2W3RA 1YQZA 1BF6A 1I1XA 2Y5EA 1M04A 1KRCC 1JF5A 3CZKA 1FWHC 3AIWA 2JEPA 1ZJBA 1E70M 5GJMA 4AEOA 4C6KA 5FF2A 2F7FA 2DFAA 1IV8A 1XH2A 4Q3MA 4DYJA 5HUOA 3QMTA 1BG4A 2DDXA 4B3LA 1WYIA 4H7ZA 1O5XA 2PUZA 1OY0A 1Q13A 4DO6A 5A2CA 4QNWA 2Z1VA 3ZT6A 3UZJA 7XIMA 2CXEA 1LWIA 3FFSA 1NWUA 4DJEC 3SCWA 2XWEA 1TPB1 5EU9A 3ZM8A 4DLMA 1HZYA 1S3TC 2R1PA 3YPIA 4XBKA 2PDXA 1BKHA 2Y62A 2X0YA 4B9YA 4QDPA 1RUSA 3ZVHA 1QHPA 4WLCA 4DYKA 4MG4A 3GR7A 3LNMA 3GTIA 5CPOA 2HXTA 2V68A 1IGWA 4HQVA 3V5CA 3WMSA 2D24A 1I2OA 3N9SA 1M41A 1E51A 2WSYA 2Y5SA 4S23A 3LM7A 4GUJA 3P0WA 4L4MA 2XFWA 3WJXA 2ISSA 4ZQPA 1EZWA 3AIBA 3H22A 3N18A 3RU6A 3O8AA 3QH2A 4HA3A 2FFCA 1QATA 3T2PA 2W54A 4N6FA 4RL3A 1M6JA 4CU7A 4LUSB 4C6JA 3BOXA 4XZWA 1Q7ZA 1ZNNA 2QGHA 2PGEA 1N62C 1J9YA 3HG5A 3AISA 3CH0A 4H6KA 1QI5A 2BWGA 4IGSA 1Z48A 4JQAA 5DFAA 1HGWA 4OFCA 1C8YA 1RQHA 2DT1A 4M19A 1MRQA 3N29A 4DY1A 4AFYA 1MO9A 2AOSA 3ABQA 2Z00A 4AWUA 4IGNA 1Z44A 3F2BA 4ILSA 1RY0A 4S3GA 3UA3A 3K46A 1D7KA 5JRBA 1V0NA 1OVDA 4JEQA 1XCWA 4I5RA 1V02A 4EM4A 1QPOA 3TAOA 5DY2A 4BI5A 1L2UA 5C2XA 3P3BA 3R8HA 3NSXA 2Z6JA 1H6VA 3V1HA 4J35A 2XUCA 4I7UA 5AC7A 6ENLA 4NAEB 1B5TA 1Q45A 3EWYA 1H09A 5CZKA 2I14A 4GO8A 1SPQA 2Y7EA 3HMJG 4GH1A 1NDYA 1Q7MA 3QMRA 5C5YA 3N4AA 1XANA 2DT2A 3CEUA 3EA1A 1W9VA 4ACZB 2EKGA 3KEHA 4UQCA 2ZZ1A 1S5TA 4H4QA 4EAMA 1E6ZA 1X2GA 1T99A 3ABOA 3ZVIA 2B7PA 4UNKA 1J0YA 4PRWA 4PCPA 2ZRWA 3BE7A 5DO8A 1EQCA 2GQWA 4LY8A 2CC0A 3BLLA 3W81A 1V03A 1WA3A 3A9IA 3BC9A 1JUKA 1XDMA 5GJNA 4GZ7A 2OR2A 3HGJA 1UR8A 1OCNA 4H1ZA 4P7LA 3CWHA 1EO5A 4UFKA 1W56A 3UP8A 2C7FA 5FAGA 2HV5A 5A8QA 4C5ZA 3TC7A 4DNAA 1FTXA 3TJLA 5HNNA 3W07A 2JEQA 2J9ZA 3OC4A 2YLAA 3RN6A 3SDOA 1OFDA 5D02A 3TJIA 3OLGA 1N5XA 1XQKA 2EPOA 1R2RA 1RSCA 4DX3A 3EDEA 4ZGYA 2ZVIA 1LOSA 3C2OA 4DBUA 3IARA 1BLIA 4GI4A 3ANUA 4W4QA 2D69A 2PGFA 2ABAA 2BGQA 4D6JA 3MBDA 2X7WA 3GUGA 5FEXA 5KTLA 5HUPA 4GA8A 4UC5A 3V0TA 4O54A 3BAWA 2QHAA 4BURA 3AWNA 3PAJA 4PMZA 1UC5A 5CG0A 2BTMA 4C6CA 1X7FA 2CPUA 4QLJA 1KM4A 4M6QA 3MHUA 3KWXA 2BHUA 1EGVA 1GT8A 1JYVA 1TCMA 2DJLA 2YX0A 3G5EA 1SW7A 2FDSA 4IH3A 4RZ5A 3VDAA 4H6RA 2E25A 4UFIA 3S1GA 1KFEA 3G6MA 2WPEA 4NF7A 4HOWA 4CU6A 1TVNA 3AC0A 4EMWA 1ZAJA 4C7FA 2FZBA 1TYPA 4ATDA 4W87A 3SQPA 5KSWA 4IIBA 4AIUA 4XBSA 2E3TA 2O9PA 3DIPA 3U7VA 3CUHA 5D32A 4FA3A 1OFPA 1MQQA 5A8GA 2QT3A 4CD6A 4UZUA 3OIXA 3AHVA 3FSTA 3BW3A 3DU0A 5JUVA 2Z1XA 2ZKMX 4LEFA 3CQJA 3WD1A 2E28A 1A80A 2ZE3A 2PA6A 3GD6A 1XG3A 1PX4A 3TDFA 3V75A 1XLCA 3NPWA 5K4ZA 3DFQA 3VILA 3URQA 4TV5A 1JCXA 4GVHA 5DCEA 2Y89A 3CUIA 1NFBA 4LUYA 1LUCA 4J3UA 4YLWA 4U31A 3NQ8A 3NL3A 3BZJA 5A6LA 1CXHA 5FESA 1VYPX 4FNTA 3QR1A 2J7EA 4P7QA 4B5XA 2FPTA 1JI2A 1TELA 4NZJA 4PUDA 2QYGA 4QHRA 1EIXA 3VZZA 1RXOB 4Q8QA 1HX0A 3RM4A 3CXBA 1V3KA 2DW7A 2A3EA 4JCLA 1O12A 3SIMA 1M3UA 3RLGA 1P0KA 3L8KA 3FVDA 1GCYA 4JQ9A 1KCXA 3TTOA 2H8XA 2VVSA 1W1A1 3N2OA 3MSGA 4MNLA 3L5OA 3V7PA 2E5BA 4ZFMA 4M51A 1KXVA 2XTKA 3EPNA 4O28A 1F5ZA 3UETA 2OQLA 4WQ6A 2C1HA 4K7ZA 2VUNA 3R2GA 2R1KA 4JBRA 3H8AA 4C6LA 2A5HA 2HZGA 1V97A 1F8IA 2JK2A 3LS9A 1ZAHA 4HN4A 3NGFA 1MMFA 4I90A 6TIMA 2J7FA 3TCEA 4IMCA 4ZL1A 3W53A 2WZMA 1TIMA 2FZMA 1VFMA 1UOKA 3BJTA 1O1HA 1SMAA 3E2QA 3OGSA 4K7VA 1KFCA 1R9ZA 5T9CE 1E9IA 2J13A 4YHGA 1OGSA 1QR7A 4Y7EA 2JFEX 3F4CA 4JHOA 3DFNA 1YBQB 3MP5A 4KERA 4ORMA 4NZ5A 4C6NA 3LRKA 3AI0A 2YBUA 4JNZA 5JCMA 5LA1A 2GJPA 1XIHA 4GIRA 4LQ1A 3VDGA 3P6LA 3A7UA 1TPH1 1V08A 1GSNA 2ZX5A 3AUOA 4X60A 3ONCA 3DKLA 4N9DA 1SR9A 3N14A 4RV3A 3LQLA 3CL8A 3BQ5A 3BG3A 1Q2RA 4EQWA 2JKEA 4JTHA 2X1UA 3DBNA 4GXWA 4FOKA 2PDBA 1JROA 4K36A 3T40A 3LYEA 4KRUA 4AZCB 3IIZA 9RUBA 2JBMA 3W6MA 3AICA 3BANA 3AMKA 3UXLA 4YYFA 4OU1A 1K03A 2NX1A 3VCRA 4Z1AA 5HQMA 1HO4A 3W84A 3ETRB 3IWPA 4ZBCA 4E5TA 1ZJAA 1EUNA 5FS9A 1S3HA 3LHUA 3TROA 4QROA 1LYXA 3CZGA 1LWHA 3C61A 3P14A 4Y9PA 4G7EB 3OIHA 3TA6A 4FZIA 2YGYA 4N42A 1PEZA 4JTGA 2VQTA 3E0IA 4OOZA 3SUVA 3PB0A 2VRKA 1XCXA 4HJFA 5LKYA 5U25A 1U1HA 3CUJA 2EPHA 4F48A 1QCWA 1YLVA 1D7YA 2E6YA 4C6DA 4AY1A 2BC0A 3VX1A 1XQLA 4IIEA 3LV6A 3HPFA 4YCOA 4F9JA 3COTA 4X2PA 3KW3A 1JQVA 1QOPA 1GRTA 1G01A 2GVYA 1N8WA 4W93A 1NIUA 2A3LA 1S39A 1QNVA 2ANUA 1FWAC 3G1FA 3FDKA 3W7NA 4BQ5A 3BAYA 3M41A 2ZWYA 2PCEA 3IK2A 4XG1A 3CLWA 2WBAA 1SO3A 2B7QA 3BMXA 3O2LA 4H2HA 3EWZA 5GVJA 2Q6ZA 2JQXA 1KKOA 3DN5A 5DEZA 1OJXA 1DE6A 3LGEA 5CLTA 1EBGA 1JL8A 1OC7A 3L65A 2J47A 3UESA 2NXIA 4WZHA 1RCXB 3FYYA 1ISZA 4H9YA 4QCEA 1UH4A 5HQLA 4UMCA 3GXNA 1P7TA 3VIIA 3TKFA 3E49A 2VO5A 3WNOA 1GOMA 1OD0A 5F2IA 5FJUA 5DX7A 4RXGA 3GNDA 3MT1A 5C54A 2TODA 4H4WA 1QNQA 1GV4A 3M5VA 3TLLA 5AYBA 5G2HA 2QXWA 1DYSA 4JNYA 3UERA 1UC4A 3HO8A 1CXKA 2XSBA 3CHCA 1VEOA 3B04A 4HNVA 4L1WA 3N17A 4XZLX 2IPWA 3P84A 1EP2A 4GO9A 2W67A 1VPYA 2INZA 5DLCA 5I3GA 1JNDA 3LENA 2VR2A 4C1KA 1CI1A 3GW0A 2XJ7A 1DVJA 3PULA 3AU6A 3BAJA 4NG3A 1MW2A 1E1FA 1FH9A 4ML4A 4MKSA 2XH4A 4ZZ9A 2NLIA 4DB7A 4RDYA 4H8HA 1P0DA 1Q8JA 2OQYA 5JQ9A 1O66A 4UTTA 1O6IA 2O7SA 4DVOA 1YNYA 2D2OA 5TF0A 4BZYA 2X42A 3L4VA 4CU8A 4Q6XA 2YDAA 1D3HA 3HV8A 1T40A 1Z42A 3FV9A 1UQZA 1F61A 2BNJA 1VBJA 5ECUA 3UGRA 2EEXA 2F6XA 1PYMA 2EKCA 3O05A 2W9MA 1GJUA 4JN6A 1RR2A 1IF2A 1W17A 2J7GA 5AC4A 1XIBA 1SJDA 2RKXA 3ZJKA 3KDNA 1C90A 3K4WA 2I17A 2FJKA 3EDKA 3WQ4A 5CGQA 4WSHA 3PUDA 3AQUA 4UTMA 1NAL1 3WF4A 1LM1A 2WSRA 4OT7A 1XHGA 3NZRA 1XDLA 3QXBA 4US6A 3ANVA 2WZHA 4O11A 4DXXA 1A5SA 2I7GA 3S5ZA 3UWUA 1H2JA 4TIMA 5B7ZA 1EDTA 3MYOA 4PYSA 3SGZA 3TXVA 3F5JA 1VIWA 4AMCA 1ZDLA 1H62A 2NSOA 1NP0A 4NKCA 4LT9A 1EC9A 3PZMA 1DWHM 3ZFHA 2IUZA 4X3ZA 2W92A 3F5KA 2G4FA 4TU1A 3AXKA 4NNAA 4WY0A 4Q22A 3IAQA 4ZXOA 5G4WA 1GVQA 1UR3M 4A05A 4I8YA 4IG2B 3E6EA 2ZA3A 1JCYA 2PLJA 4RNIA 3M5ZA 2NQJA 1J93A 3FDGA 4W85A 3S1VA 4DI8A 2OU4A 2Z0IA 1XSIA 3ES7A 1Z69A 4OE7A 3UR5A 1W8GA 4LJ3A 4LVAA 1E1CA 2QCHA 2GUYA 2REQB 2GFTA 3M43A 3FGCB 2PF8A 1JPHA 2WMHA 5BU6A 4XD5A 1POKA 3B9AA 1LG2A 4TVYA 1CGXA 1TE1A 3U4AA 1R3TA 1UZDA 1F05A 3QHOA 2OLAA 4JYFA 1YXDA 2WJDA 5GNZA 3STPA 1GK8A 1FWIC 4KIEA 4A35A 2G3FA 2Z2UA 5I3IA 4BI6A 3C2FA 1REQA 2Y7DA 2BFGA 1S5WA 4HHPA 1BWVA 1EYWA 3G8RA 4W5UA 4GRTA 1GQJA 1PHQA 1PZ0A 2WMIA 3ZT7A 2OJPA 2D1ZA 3BSHA 5AVHA 3WQEA 5BXPA 5LSMA 2YSWA 3RO8A 4XAFA 5CH9A 3PBGA 4EXQA 3R13A 1WZAA 4JTDA 1VKFA 4FX7A 2SFPA 2QIWA 3O0KA 3NVYB 5HR6A 1YTEA 1J0KA 1DJXA 3N6HA 1FWCC 4ZSUA 4DBDA 4UR9A 1WX0A 3SI9A 4MF4A 1VBGA 3KVKA 2WV8A 1OIFA 2ISFA 5G1YA 3CQIA 4E4FA 1V51A 3W1XA 1N2VA 4A6GA 5G5GB 1JG9A 1KFBA 3LHYA 4ZO7A 2AMXA 2AL2B 3A3XA 5K7JA 3M4HA 1SVDA 2E67A 3KX6A 3DHDA 4P8UA 1Z89A 2D2HA 4Z1BA 1XLBA 4H6QA 3H4KA 4MJ2A 1UKPA 2P50A 2VMFA 4MY9A 5BRBA 2Z1BA 3BOLA 3QFAA 3T8QA 2GVEA 4D1JA 2YW4A 1CGUA 5HJLA 6ALDA 4WY0F 1WXYA 3SEPA 1MW0A 1R46A 3O07A 2RDUA 1UD3A 1HL9A 2V5KA 4TMBA 5H1WA 1E5JA 4QSFA 2INFA 3KL3A 1ITXA 4KCTA 4XD4A 1HNYA 3FJLA 2FKPA 3W7RA 2HS8A 4WEVX 3IUDA 1OZMA 3AHTA 2XGBA 2YLLA 2Z6IA 4GBUA 2C1IA 3VD5A 1ZBVA 1QWGA 4LFYA 4A4AA 5A1AA 2G37A 3WBEA 1XRSA 4WJXA 1WKFA 4S3KA 2ZUSA 3FJNA 1OFQA 2BASA 4G7FA 4AY8A 3L2LA 3OPSA 4MAZA 1H60A 1AW2A 3HN3A 5ABFB 2FVLA 3UD6A 4LA1A 4J1OA 1WP6A 2ALDA 1HW6A 3B9DA 4AIBA 5PTDA 4JQ1A 3R89A 3W83A 3KE0A 4KS0A 4O10A 4D8ZA 1XLHA 3CZJA 2Z1KA 4GZJA 4LF1A 3OBEA 1N55A 3D5HA 3EX1A 3L4TA 2ICSA 1UG6A 1GTEA 2BX7A 3S5OA 3T78A 1OCBA 2E4TA 2V2CA 2J74A 3IJ8A 1PVNA 1H1ZA 1OX5A 3I6TA 2VR5A 2VZVA 3ZYZA 3NRZB 5KZ6A 2Y70A 1E6RA 3UA4A 2WMKA 4XWUA 4K8DA 5CBIA 2WHKA 8XIAA 3K8KA 3IUIA 4GI8A 4UUIA 4AZ5A 4KCWA 4MKVA 4ZO6A 5FJOA 3S2LA 3NIYA 2F6KA 1CCWB 3LCGA 4KEZA 3GHUA 4H9ZA 3KCOA 2IKHA 4LVBA 4JIQA 1A5OC 3DFSA 1YDOA 2QDEA 1CTNA 2ALRA 1RA0A 3T0TA 4LC8A 3N3MA 5CBJA 1W3LA 3H23A 4JXCA 2C91A 1KTBA 3WK1A 3MU7A 2EQ6A 5BOFA 3TSDA 3SRDA 1P43A 2GWGA 3KLKA 3P2VA 4JIHA 4LOCA 3NS1B 3G6LA 4P8VA 3IV3A 4YHEA 3PSVA 4Z1CA 1ZMDA 4O1CA 2QMJA 3WFLA 4LYKA 4GD0A 1BYCA 3AUJA 3KL0A 2ACUA 5E09A 2OEJA 4NU7A 4BF9A 2GH5A 3INPA 5D37A 1OG0A 1RA5A 5A2AA 3FXYA 3JZUA 2E8YA 4EP8C 2UZ9A 4ZQMA 2CCRA 1B1YA 3PUOA 1V77A 1OFBA 3MCOA 3QTPA 4PFMA 3UXAA 5DBUA 4I9TA 3T0DA 3MKCA 4DWDA 3LCWA 3VIGA 3QV7A 3CUGA 4D71A 2ZZ2A 1EXBA 4IISA 3TWAA 2Z7KA 3AXIA 1W3HA 1UPPA 4ZO9A 1PSCA 4JS3A 1W5MA 3BVJA 4FOJA 3PWGA 1QBBA 1G7VA 1XS2A 4D72A 1UR1A 2PDLA 4LAZA 4E8GA 3LI0A 2HK1A 2J6VA 3ZIZA 3DFYA 3NYZA 4ZCWA 4FNUA 4A8LA 1ISVA 3S8HA 4O0ZA 3P93A 2OGYA 3KOWA 2OVLA 5TD4A 4IFOA 4U5KA 4CQ9A 1W1YA 5A6SA 5E5CA 1O1ZA 4JTKA 3TOYA 3WEZA 1RBAA 4PTXA 3SCPA 3KXQA 1XYBA 3AJXA 3F4DA 4K1GA 2AMGA 3CPRA 1G9HA 3PR2A 4R9XA 4N9CA 3W7DA 3N2TA 4N02A 3W25A 5E0CA 2FGBA 3MYPA 2QUTA 1GVSA 1XYFA 3HG4A 1OFRA 1VYRA 4J28A 4PTVA 2GGJA 1EH9A 4ICCX 1CXFA 4DJFD 1F3PA 2Y5JA 3UBPC 4D6HA 4R3UA 5IM51 2JK6A 3N6JA 1OF6A 3W2UA 1UUQA 1YX1A 4CD4A 1X6UA 4O1AA 3CIWA 2CEQA 3I10A 3VVGA 3R0UA 4J4KA 3Q4DA 2J7BA 4Z1DA 3ITTA 3WLSA 3E0FA 3FHAA 3PUGA 2QEZA 3AIUA 1XBYA 3CMJA 1BYDA 3A47A 3GKFA 2EGZA 3KTCA 2V3FA 3WENA 2J3NA 1K4QA 1BAGA 2QDHA 3KBNA 3T0CA 2WO5A 3H2EA 2Q01A 2V5DA 4JDYA 1Q65A 4PCNA 1EO7A 2WPBA 1IHIA 4CQAA 5KZEA 3NSMA 2YXGA 4N2YA 1B90A 3EWWA 4C6EA 3RJXA 3XINA 3KBMA 3BJSA 3ISIX 1Q4NX 4F0KA 1EJWC 1VFOA 3D9XA 4GMEA 1G4TA 3DC8A 5I00A 5HWNA 3SCRA 3N12A 4W7WA 5LIKX 4MADA 5C8BB 3DG6A 1C8QA 3U2ZA 1F07A 1E3ZA 3G1VA 1UP2A 3MMDA 4TV6A 1H63A 1K9TA 3QV9A 1G1YA 3N3TA 1NQKA 2CWXA 4YTUA 1VF8A 3H7UA 1NTHA 1DJGA 5A8NA 5TBOA 4LS0A 5JMUA 2YPIA 2G3JA 3MHFA 2ZE0A 3A4JA 1T7LA 2PEVA 3ONBA 3JUGA 3R25A 4H50A 3WJYA 4QRNA 2ZADA 1Q1WA 3MO4A 3G2GA 3QJAA 4GCXA 1GUVA 4JL1A 2WZIA 2R8WA 1UD2A 1VYSX 2ZUNA 2D0HA 3HU7A 1SW3A 1VD6A 2A7RA 5D8WA 3SCTA 1E0VA 1QW8A 4YIWA 2FH6A 1Z32X 2FMNA 1TMLA 1ISWA 3VINA 2ZX6A 4GH3A 3ABXA 1BVNP 4EOUA 3NOYA 4ZE4A 1OFOA 2Y8UA 3CK5A 4JNMA 4NILA 2AKZA 1WAUA 4KETA 1WDDA 2W62A 4MDPA 3SUTA 3NZ1A 3E2RA 2R91A 1YPFA 2VWTA 5AHEA 2ZRXA 4U3CA 4EWJA 4FLSA 2E3ZA 4H9XA 4EM3A 1ONXA 5FS8A 3PTDA 3UNDA 3LB8A 4GXMA 4AF0A 2BB0A 4LRSA 4RLIA 2QNEA 4P61A 5CXPA 2HBXA 4FS9A 2CIPA 1ZPTA 2GJLA 1XPGA 3P8JA 1JXKA 3KP0A 1JCJA 4C7DA 1GWJA 1UD4A 4FO4A 3GK0A 3S83A 1XYAA 3SQMA 4RJEA 2Q09A 4INFA 4H9MA 2PWDA 1H0IA 1UA3A 1Q7QA 2GUUA 2YB4A 1KLYA 2WHJA 4M52A 3CT2A 5HMSA 3L0KA 3A24A 4MVAA 4NIRA 1HXJA 1ZLPA 2QJIA 3GNNA 2WJFA 1SR0A 1TJRA 2OLHA 4C6QA 3LHWA 2WOVA 4ADWA 1TV8A 4A2SA 4XZIA 1QWKA 1QT1A 4J2MA 3AN1A 5I3FA 3GD3A 3HRDC 1E0XA 3CAVA 1O5KA 1KQYA 3MWCA 3WO8A 5I3HA 4NZ1A 1ZBWA 1ONFA 2NWSA 2Y88A 3WNNA 4Z2JA 1UBPC 3QZEA 1QI2A 3FX4A 2X09A 3FEMA 1L6WA 1R2SA 2F84A 2XSAA 3W1QA 2OPJA 2VEFA 1TJ1A 2CETA 2E9MA 3LCXA 2BHYA 3IJ6A 4JTFA 1XSKA 1J6PA 5F1UA 3KBVA 2DVXA 2DZPA 2Y1HA 3MQTA 1H7NA 3EOUA 1IT7A 5LYRA 4M3PA 4LUSA 4BCEA 1Q6QA 2GPTA 1E4NA 3K4AA 2O0TA 3LG3A 3N9RA 4HOXA 2W61A 4HP5A 4V15A 1BTCA 1WE5A 3AHYA 3LBMA 2BXZA 1US3A 1AK5A 3UR7A 2BBFA 4IL0A 4JFUA 4ZO8A 3L0GA 2PURA 3LBCA 2WHMA 1J4EA 3H2NA 5EL1A 3L7RA 3ARWA 1NJJA 1B3YA 3P5YA 2V0TA 2PDPA 3BLEA 3G0SA 3EAUA 1MUMA 1U33A 1U22A 2W4XA 1K8ZA 3PBWA 3PZOA 4LAUA 4GKTA 3LXAA 2ZX8A 3N2MA 1H61A 2WLYA 4R7OA 3BPWA 4Q8VA 1EJUC 4EMJA 3MZ2A 3EXRA 3DH9A 4PCSA 4JHZA 4UTWA 1P1MA 2GSHA 4UTJA 2BCPA 2G0WA 4NAEA 5HJXA 4Q8TA 4RZ4A 3OEXA 4FX6M 4RPPA 4RXFA 1Q6EA 5FD0A 4IP5A 1ADDA 3MP4A 2TSYA 1ZP3A 1N8FA 1FP9A 3M1ZA 1SJBA 2Q8LA 4F4RA 1YXYA 3KLJA 4Y8EA 4I8DA 4ACZA 5L9FA 2WM0A 1VBHA 3II4A 3V16A 2VZTA 4HYVA 4N4QA 3GDLA 3BLDA 3QV8A 1GOWA 1NWSA 2PC8A 2VDIA 1HKMA 2RFGA 3EB4A 3CQHA 3E12A 1GQLA 3T09A 2FDMA 1CW2A 1U30A 2WQDA 5SWUA 1TJPA 3QHMA 1JULA 3VD3A 2VX5A 2OG9A 3NURA 3NQDA 3NDYA 2J77A 5I3KA 3CV7A 4JQ4A 1UKTA 1N60C 3VCCA 1WDRA 2WBGA 3BCJA 4DWSB 4E2DA 2ZIDA 1VENA 3M6DA 1D3CA 3VE9A 2FZ9A 3O1NA 3P60A 2ZZ6A 3NVZB 4C1NB 4QJ1A 3W01A 1C91A 2VDHA 3SCVA 2ZXQA 3GM8A 3QRHA 5I06A 2AQWA 1E72M 4IP7A 1Y8BA 4UOJA 2WVUA 3ZLFA 4Y9NA 4Y90A 2GGEA 3DGBA 4HU0A 4S1FA 3WEOA 1C92A 2PDNA 2XH0A 5CGMA 5HXMA 3TNBA 8TIMA 3WBXA 5AECA 2WVVB 3F4WA 2VRQA 3MUZ1 1KV8A 1VP5A 2O9OA 4WDWA 4AEEA 1FKXA 1QK0A 1KRAC 3WMLA 2PP3A 2ZA2A 4YL2A 4GNKB 1KR1A 3H2FA 2HDJA 2J6XA 2ZUTA 2PRLA 3NA8A 4O12A 3MHGA 4IX2A 1EJ7L 1IR1A 4Q8NA 4HK7A 3UCCA 4D6GA 3OA5A 4ENLA 1GNXA 3W88A 3S5NA 3S47A 4F2UA 4AD0A 3B9OA 3PSWA 4EPKA 1R86A 4FSAA 4LV4A 2YCLB 3CUXA 5AC8A 4X2RA 2FZNA 3S9IA 1LLZA 1XW8A 3QF0A 5GNXA 3TH6A 4XVDA 1XC6A 3ARYA 2WKLA 3AIVA 3QPEA 4LVGA 2OWCA 4F0MA 2VFDA 1SO4A 4EPEC 4AISA 1TV2A 1YMYA 2J79A 2CKSA 4GUGA 1V0KA 3VNMA 3M47A 3RGTA 1K6AA 2HSAA 4LXFA 4DNMA 2GUBA 3R1ZA 2AL1A 3QBUA 2I5GA 3R7MA 3GU2A 3SRFA 2VVNA 3CQKA 1W1VA 3VZYA 3NG3A 4GGBA 1MQRA 1I75A 1K8CA 2DVUA 1A3WA 4APNA 3ARVA 4RCXA 1XH1A 1PKLA 4QAWA 2HK0A 1IZKA 1CIUA 4J9JA 3BWWA 4DIAA 1R85A 1XFBA 1CPUA 3W7PA 1F7BA 3SM0A 1ZALA 1R3YA 3GXTA 3RNDA 5E1QA 3WD2A 1W8SA 3CV2A 4CVWA 4FB7A 4FK9A 3F2DA 1ZK7A 2YCIX 4XAYA 4XKMA 5C2CA 2OGJA 1DPMA 4YYCA 1LBFA 1E3XA 1XGEA 2Y0FA 1OC6A 2DZVA 1CBGA 2Z25A 4D8LA 4U28A 2R6OA 3C3UA 3VNLA 3RM9A 4DELA 4UXDA 4ZVJA 1KXTA 5GRTA 4YWSA 2CU0A 2C1GA 4C6FA 2J24A 3KRUA 7PTDA 2BG5A 1TWZA 3UG4A 2XIQA 1SU5A 2CLEA 4WJEA 3WLIA 1FH8A 4H4VA 4PN2A 3M7WA 4X9SA 1W3TA 4WD0A 3GFYA 2GVJA 3V5OA 2YCKX 2IW0A 1F6PA 2VEPA 4F2TA 1ZCOA 4DO4A 1UKSA 1Z8AA 1YBQA 5CZ0A 3VABA 3W2MA 2UWFA 3MC5A 1VBUA 4QE4A 1RPXA 2FHBA 1TTIA 4PTMA 2ZC8A 4IIDA 2E6AA 1YYAA 1JCNA 4QTGA 3DECA 4JTTA 4HMNA 3BLOA 1GVIA 2OFJA 1Q6CA 3L2IA 3GH4A 2QR6A 4FAMA 3ATYA 1PXGA 1IXOA 3T42A 2BDQA 4AZCA 1LWJA 3S3GA 2J78A 4KMQA 3EYPA 4YMZA 3W7QA 1ZUAX 2XPKA 3KRBA 1OGBA 1IEWA 1QHZA 1WUFA 1UWRA 4HVXA 2GVLA 1QU4A 1GHSA 1FA2A 2NV1A 3W82A 3LV5A 2WYSA 2OCZA 3BLPX 3CS2A 4HYRA 1JOAA 2QUUA 3CO4A 5JBEA 1JYWA 1PL9A 4H8UA 4J7RA 1MXSA 1TIWA 4G7EA 3TW9A 2G3IA 4JHMA 1DOSA 3SO7A 2FLIA 3CLMA 5FIPA 1LTDA 1ME7A 3CQ0A 4F0RA 4S39A 3GTHA 1GPWA 3VOHA 4H9UA 4WR3A 5M2FX 4KRTA 3PWIA 1B57A 1XLDA 4DM1A 2GL5A 4XO7A 2HVOA 4FPSA 2VC9A 1BYAA 3WJZA 1TJ0A 2VFHA 2DZAA 5DN1A 3E0WA 5C71A 1B4EA 2OQHA 4JTJA 2V82A 2G41A 1DJQA 3O16A 4O4WA 1D9EA 3FY1A 5M17A 4V1XA 1KQZA 3HZ3A 4W5ZA 1VFFA 3EX2A 1GVOA 4FNRA 3RCMA 3VKKA 2GDUA 1BXBA 1E1EA 4NAFB 5T26A 3DXIA 3GBEA 4HK6A 3THAA 1CYGA 1DJYA 3LUTA 1WZLA 5J04A 2WPGA 3FSUA 1C8XA 1XUZA 4UWMA 4XAZA 3KVJA 3WZ0E 4S2CA 4GR1A 3AMZA 3VMNA 1C93A 5E70A 2VZUA 4RW3A 3TAKA 2OLSA 1X1NA 3CMGA 5DT5A 1XLJA 5CZSA 3PB2A 3GXDA 4PL2A 1IXNA 3C86A 4R27A 4ZODA 1XV8A 2CWNA 1JZ4A 3G1HA 2XN1A 4MPKA 3OTRA 1UZ1A 1CLXA 4B2DA 4H4YA 4ZMGA 2EF9A 4MWAC 1G4SA 5BROA 2PTDA 2YYTA 3LOTA 4L80A 1ITQA 4RX0A 1UIPA 3KS6A 3KL5A 2YBTA 5I3JA 2BGNE 3OO2A 1EYEA 5FJPA