3QPEA

Crystal structure of galacturonate dehydratase from geobacillus sp. complexed with d-galacturonate and 5-keto-4-deoxy-d-galacturonate
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
385
structure length
385
Chain Sequence
LNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title Crystal structure of Galacturonate Dehydratase from GEOBACILLUS SP. complexed with D-Galacturonate and 5-keto-4-deoxy-D-Galacturonate
rcsb
source organism Paenibacillus sp.
molecule tags Metal binding protein
total genus 134
structure length 385
sequence length 385
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3qpeA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3qpeA01
4DWDA 3GY1A 3ZVIA 2I5QA 4J1OA 4MMWA 2PTYA 2XH0A 3H70A 4G8TA 4A6GA 2GGEA 3GO2A 3TW9A 4FP1A 4JN7A 3FCPA 4H1ZA 1P43A 3UJFA 5BOFA 2OZTA 1YEYA 4GGBA 4MKSA 4X2PA 2NQLA 3I6EA 1BQGA 3ZVHB 2QDDA 4MGGA 3MWCA 3IK4A 3R0KA 2OFJA 4GFIA 2GL5A 3U9IA 2AL2A 3D46A 2PMQA 2QQ6A 3SBFA 3MY9A 2XH7A 2GDQA 4IL0A 3T9PA 3VA8A 1WUEA 2XGZA 3JVAA 2PGEA 3DIPA 3R1ZA 2AL1A 3BJSA 4E4FA 1DTNA 3ZLHA 4E6MA 3UJEA 2ZADA 2AKZA 5BOEA 4HNCA 2HXTA 2XH2A 4GISA 4ROPA 1EC8A 3VC5A 4HNLA 3UXKA 4IP4A 4E5TA 2PODA 4G7FA 4K1WA 3DESA 2OZ3A 2GGHA 4JHMA 1JPMA 3SQSA 1JDFA 1MDLA 4IHCA 5FJTA 1L8PA 5FJPA 3I4KA 3STPA 3FXGA 3P3BA 3SSZA 2PPGA 1MUCA 4ZA0A 2QJJA 4H83A 3OZMA 1BKHA 1RVKA 5EU9A 3DGBA 3DEQA 3H8AA 3QKEA 4DX3A 3N4EA 3MKCA 3I6TA 2DW6A 2PTZA 3CB3A 4J3ZA 2XSXA 4GYPC 3JZUA 2PA6A 1EC9A 3Q45A 3CYJA 3DG3A 3SJNA 3R25A 2XH4A 3MSYA 4JN8A 1ELSA 3KUMA 4Z1YA 3RRAA 3H7VA 3CXOA 2OG9A 3SN1A 4E4UA 2ONEA 2P0IA 3R11A 2PS2A 3NXLA 4HPNA 3CAWA 3T4WA 4EWJA 2PGWA 3N6JA 4HCDA 3ZLGA 3CT2A 2OO6A 3EKGA 3U4FA 5ENLA 1F9CA 3S47A 1KD0A 1IYXA 4KT2A 2QGYA 2GGJA 1ONEA 3OP2A 4GGHA 1PDZA 4HYRA 3RO6A 4YWSA 1KCZA 4IZGA 3NFUA 3Q4DA 4DN1A 3ZVHA 3VFCA 2P88A 3R0UA 1TE6A 2FKPA 4A3RA 3TJ4A 7ENLA 2MNRA 2QJNA 4ZCWA 3T8QA 2OZ8A 3VCNA 3DDMA 3QN3A 3PK7A 1XS2A 3RGTA 3UJRA 3UCCA 2P8BA 4IL2A 3T6CA 4Z17A 2FYMA 1W6TA 2QJMA 1JCTA 3UJSA 5FJRA 4M6UA 3RITA 3ZLFA 1OEPA 2P3ZA 2PTXA 3UJ2A 3NZGA 2OQHA 4KEMA 1XPYA 2PU0A 3BSMA 5FJUA 3CK5A 3IJIA 3V3WA 1MNSA 4H19A 3ES7A 1PDYA 2PTWA 1EC7A 1EBGA 2PCEA 3QTPA 4H2HA 3DFYA 4FI4A 3ES8A 1KKOA 4KWSA 2PP0A 1R0MA 3PFRA 2O56A 4GMEA 1NELA 3ENLA 1TZZA 1ECQA 4GIRA 4DXKA 3VDGA 3OW1A 1FHVA 1JPDX 3IJQA 3FVDA 2OQYA 4E8GA 3GC2A 3VC6A 6ENLA 4DYEA 4M0XA 2GGIA 2AKMA 3QLDA 3N4FA 4HCHA 3UCDA 2HNEA 4IT1A 3RCYA 3B97A 3TOYA 3MUCA 2OX4A 3MQTA 1MDRA 1R6WA 2HZGA 3FJ4A 3OPSA 3S5SA 1TKKA 3V5CA 3DERA 1EBHA 3HPFA 3GD6A 4F4RA 3DG6A 3OZYA 2OLAA 3TCSA 1FHUA 3PWIA 4GYPA 2AL2B 5FJOA 4IP5A 3RR1A 2ZC8A 1E9IA 3JW7A 3TWAA 2PP1A 4K2SA 3QPEA 3VCCA 2PP3A 3P0WA 3TJIA 2PU1A 2GSHA 3TTEA 3UGVA 3R10A 2PSNA 3OTRA 3TQPA 2POZA 5IDZA 3K1GA 4HN8A 2OPJA 3MZNA 3N6HA 4A35A 2OKTA 3PWGA 4DHGA 4ENLA 1SJAA 3SN0A 3DFHA 1MRAA 3EEZA 2OVLA 3NO1A 4K8GA 1SJCA 2QDEA 1WUFA 2P8CA 3SN4A 2DW7A 3V5FA 2RDXA 3BOXA 2CHRA 4KPLA 1SJBA 3H12A 2HXUA 2MUCA 5J04A 3D47A 3V4BA 3UXLA 3DG7A 1NU5A 3FYYA 1P48A 3IJLA 3TWBA 3P93A 2QVHA 3THUA 1SJDA 1KKRA 4HCLA 2GGGA 3FV9A
chains in the Genus database with same CATH superfamily
4DWDA 3DFPA 2G96A 3BLKA 4DPPA 4GXWA 1G7UA 1DQWA 4FX9A 3M47A 3B0PA 3L5OA 2CWXA 3GO2A 1W3LA 2PRHA 1BWVA 3C8FA 2WWDA 1IWAA 3QZ6A 5AC8A 3VM7A 5AC5A 5FESA 2CW6A 3WYZA 4YL2A 2ZCGA 2YX0A 1K4QA 2VGIA 3TH6A 4P7NA 1W9BM 1PIIA 2BY2A 5D2VA 2R1KA 2YBTA 1NFBA 4MGGA 4LBRA 3FKRA 3SFKA 3W01A 1JCJA 5T9BG 2NLYA 4X0VA 3UVIA 3NIYA 4FNQA 2QQ6A 4D6CA 3SBFA 9XIMA 1I45A 2ZX5A 4LC8A 3EWZA 1F4HA 5E70A 3W38A 3W76A 3VDHA 4S3DA 3WCZA 4BQ5A 5AN7A 4UOJA 4O19A 1PPIA 1FO4A 3GAKA 3KBJA 1PTDA 1R2SA 3CL8A 4K8HA 2QCEA 3BJSA 4I5XA 1FWCC 4O16A 1J4EA 2WJEA 2WQPA 2ZUMA 4DO4A 1ZBKA 4QRNA 3UT0A 4H04A 3AYSA 1J0KA 3LD5A 5AB3A 1XL9A 3DESA 2FGLA 2C1IA 1NDWA 1MQRA 1QPNA 3L4VA 4BZYA 4DJED 3QRHA 4YXGA 4YCPA 1Q4NX 4DUOA 3STPA 1B3YA 4IFRA 5AC7A 2GUBA 3BZJA 3PTKA 3DX5A 3GDKA 4IIHA 4R9XA 1GQJA 3ZT6A 2GUUA 4Q32A 3W22A 3O9NA 2GQ9A 4HYWA 1K8ZA 3DJJA 3M7SA 3VFLA 4A8LA 1QBAA 1OCJA 3ABRA 1HVQA 1V3MA 2G3IA 4W89A 3AYTA 5JXQA 3KOZA 1DIEA 1SO6A 2ABBA 3HPXA 4C6FA 1BG9A 1WDQA 2V5KA 4ATDA 3XIMA 3TYAA 1EJTC 3TYZA 1W1ZA 3TSBA 3WDJA 5KZEA 1UD5A 3BV4A 1OFQA 1XRVA 3OLIA 5A6LA 3B9JB 2ZFAA 3PPCA 1JRPA 4ZMGA 1EO5A 1VCFA 5FACA 4PMQA 4CQ9A 4HOZA 2I14A 2RJHA 1K4HA 4DJEA 2YAUA 2PDHA 4DN1A 1XICA 3SIZA 4HZ7A 1RPXA 1FWNA 2DEPA 2PWHA 4WVXA 4JDBA 3ZZ1A 4MUZA 3R8GA 1G9HA 1TJ0A 3KCJA 1YRRA 5CZSA 1WBJA 4DZHA 2GSJA 1C29A 4JQAA 4D1JA 3GVGA 3CB8A 3WBAA 5TBOA 3W1NA 3DYMA 3BLLA 5I3HA 4GUGA 3EAUA 3B8UA 4Q8QA 1CGVA 4ADUA 3S1WA 1XCWA 3T78A 4BR1A 3M0JA 3LNPA 5CSYA 3RCMA 2CZEA 4XVDA 1JAEA 3G0SA 1MO9A 3W87A 4G9PA 3FS2A 3RPDA 3T08A 3VIOA 2YVGA 3I3EA 2CNCA 2QCHA 3CQIA 4PMJA 4FNPA 1O1HA 4HU0A 3BGGA 4DBSA 4V1YA 4UMAA 4DJFD 1KBKA 2OQHA 4AU0A 5TD4A 1JPKA 2IMRA 3O6YX 3AS0A 2X8GA 1P7TA 4DVOA 1DBTA 3WBEA 3V3WA 2FHCA 1DWIM 2KX9A 5G5IA 4A3HA 4M52A 4GQBA 2NZLA 1JGIA 3FY1A 4ZO8A 3F2BA 1KR1A 1M3UA 3E74A 1NFGA 3ZT7A 3FEMA 4CU8A 2GQ3A 3A3XA 3ISIX 4G56A 3KVKA 4I8DA 4GI9A 1F7BA 3MI2A 4M0XA 1FP9A 3WQFA 3NQVA 4I7VA 2HNEA 1WCGA 1T41A 1PKNA 3IIOA 5L6UA 3B8TA 1XRSA 2VC7A 4GZJA 4Q4RA 3G1SA 3MV11 4ZOEA 3BXWA 3DENA 3W7IA 2WNWA 4JCLA 3KWXA 1X1ZA 3GD6A 4M1BA 2ZX7A 2YBUA 4YLWA 2XHYA 1WYGA 3EB4A 1N8FA 1AFSA 1F61A 4JY9A 5DELA 2DZSA 4UQDA 1TSIA 1Y5WA 2O4MA 1VFLA 4F79A 3AHXA 4GH1A 1KWKA 3H2MA 4YWOA 3ID7A 4UTIA 4U4MA 4YJ5A 1OABA 1WKDA 1S3HA 5I3DA 1DJGA 3E0IA 1MXGA 4GC3A 3NQFA 5I02A 3R79A 1I8JA 2ZWZA 1XRTA 3UWWA 2P76A 4KEUA 3BARA 2V3AA 1GVEA 1NHQA 3N6HA 1AUSL 1EJXC 4S3EA 1K4GA 1FBAA 3IUIA 3S5NA 2DT0A 3LV6A 5A6BA 2WO5A 2GR1A 3WEOA 1E72M 3G22A 3A9BA 2F6UA 1PB0A 3UNDA 3E5BA 2Q71A 3NDOA 4GE8A 3P67A 3LCIA 1ZGDA 4IGMA 1E4NA 4AY1A 5U25A 3GD3A 1CEOA 1UH2A 4BF5A 3IIVA 4HNVA 3L21A 3W02A 5BNKA 2FB2A 2YFOA 1D3GA 1PO9A 4U28A 3AHZA 2YFNA 4F66A 5CC3A 1Z69A 4LAMA 1DXEA 3G1HA 2HXUA 3AXKA 3E2SA 3ONBA 4WF7A 2XVLA 4ZTYA 1PBGA 3UA3A 2VD8A 7REQA 4WD0A 1DJZA 3VKDA 1GYMA 3BH4A 3T05A 4QAWA 3A24A 3ABXA 3IVUA 3SCNA 2ZBTA 4ADWA 2XFRA 3U8GA 1QFEA 2FQIA 5C8BB 1ZJHA 3JRKA 3CEPA 1PKLA 2PBGA 3ZWSA 3EXRA 2E5AA 4JN7A 4DO7A 4UFMA 4URIA 3T1GA 2J62A 3E38A 4UR9A 2NW0A 1EJUC 1R3QA 3MT1A 3UGRA 2QPSA 3N19B 4GD0A 3WD2A 2Z6IA 1EQCA 4UOZA 1YADA 3OQ8A 3IK4A 3OGSA 1JXKA 3SUTA 5DANA 3U9IA 1UCWA 3K46A 4IFKA 4LOCA 1J6PA 1E43A 1Q7QA 4ZXLA 4ALDA 3BCJA 1AH3A 2QCDA 2WMIB 4JXCA 3E0FA 4C6OA 3C2VA 3CHVA 4U2ZA 1R3RA 3G18A 4EX4A 3WBYA 3PZVA 1ZZMA 3C52A 2CDUA 2QAPA 1TVLA 2WMFA 4CCDA 1TE1A 2RHGA 3ZR5A 1O5RA 3ZLHA 3CZGA 2BVWA 5HATA 3VNMA 1FWTA 3AYRA 4GISA 3W74A 4MG4A 2NQJA 3FEQA 1H7XA 4B5TA 4CNSA 4QEEA 1NHPA 4WRHA 1E6RA 3PAJA 2GDVA 4BQ3A 3QR3A 3TONA 5D2YA 2FH8A 1XANA 4DZ5A 4XZIA 1OFEA 4XAZA 3O6CA 4M7SA 5D05A 1ZRQA 3W1XA 1BKHA 1A5KC 2WAGA 4IFOA 1HUVA 1DJYA 3H8AA 1H1YA 2DT3A 4L65A 4DIAA 3W1MA 4UFLA 4GNVA 1CWYA 1TIMA 4JX5A 1L6SA 2WZIA 2Z00A 2V3EA 4QNWA 2OB3A 2R8WA 4Z1YA 1UR1A 3T81A 3EB2A 4ZOAA 8TIMA 3O07A 2BGSA 3H53A 3CPRA 2YCKX 3G3MA 1A4LA 2NWRA 2BHUA 2WW5A 4LCQA 1G4EA 3U2CA 4EQRA 2J7BA 3M64A 4HK6A 3T42A 1XV8A 2ZUSA 4D8AA 4O52A 2VVSA 4YVPA 1F9CA 4B3LA 3S47A 1Y5XA 2Y8UA 1H7NA 3O3RA 3W7NA 2DZVA 3W0KA 7A3HA 3L5LA 4YWSA 4L1XA 4Z1CA 1UZ1A 2ZC1A 3U0HA 3UR8A 4LUYA 4GR1A 1UQZA 2DJXA 4EWND 3L0KA 4AXKA 4E2BA 3BQ6A 1V6WA 3WNOA 3CUGA 3G1VA 4ICCX 1XIJA 2V6OA 4IISA 4PFMA 3UJRA 4AD4A 3B8SA 3SCRA 1IE7C 3LTSA 1WYIA 5HINA 2R82A 3W7KA 1X6UA 3N34A 3GAYA 1WOAA 4Z0SA 2W66A 4LVFA 1XISA 4FX7A 4MJ4A 4TU1A 2VC9A 1LL7A 4TXEA 3A22A 5FJRA 1OINA 2IS7A 3EDKA 3LRLA 2GPTA 2IW0A 2WVUA 4IG2B 1YDNA 2HWGA 3ATZA 2ZXQA 1GYNA 5FJIA 3NGJA 4E0CA 3LCLA 4FIRA 4ZE4A 2YR1A 2VFFA 3DC0A 2KZHA 3DK9A 2OSXA 1CXEA 3S1XA 1AK5A 3WUEA 4UTJA 1EBGA 4XZ9A 3OZOA 1S2CA 2QW5A 3LCHA 3TC6A 1KKOA 4LVAA 1NSJA 1BYBA 2Y7DA 4MJMA 5K9XA 3R8RA 4DXKA 1A3XA 5JCIA 1CB7B 4KWOA 2BXVA 2H6RA 2WC7A 1IXNA 4EAYA 4WY0B 1BWKA 4FOJA 4O4WA 2E4TA 1VLIA 3M0IA 4RJEA 1LOLA 2D73A 2W63A 2OGYA 4FF7A 3VMPA 1HKIA 2YYTA 4MKNA 4YCOA 4IIBA 3VNLA 2BCPA 1LWJA 1VBGA 1AODA 5CKSA 5GVJA 1WX0A 3H4GA 4F0MA 4ERGA 2C79A 2EG7A 1UUQA 2J9XA 3JUGA 1JPIA 3TNOA 1TUXA 3MV01 2D2OA 5LZLA 2XU2A 2VWTA 6ALDA 3N14A 1UKSA 3FHAA 4AZIA 2ZC8A 3JU2A 3JW7A 3CS2A 3N9RA 2WANA 2VMFA 4Q8VA 4GQQA 2Y0FA 3KE0A 3STEA 3VGFA 1SZGA 3BJFA 3Q2DA 2QMJA 1RY8A 1ZMDA 3WJZA 4M8UA 3D9XA 3D5HA 3ETRB 3MU7A 4WDTA 2WPCA 4ZZ9A 3LSBA 3URAA 1R7OA 2X50A 2YDSA 5IDZA 4NXKA 2ZZ7A 1P0DA 2OPJA 1CXIA 3PWGA 2UY5A 1GTHA 3PJUA 3EMQA 4XKYB 3SQLA 1NIUA 3PZIA 3WMCA 1VYPX 3TV8A 1KFLA 3CC1A 3TZFA 2J13A 3WQPA 3KLLA 1X97A 3NO1A 2VVNA 3ARWA 2DIJA 2PDXA 2PDUA 1EP2A 3LMZA 4CVUA 1A5CA 1GZJA 1CI1A 1G4SA 4HZ6A 6XIMA 4U5KA 4J28A 4K39A 3VGDA 1HKWA 4L6DA 1SJBA 5A6TC 3H12A 1A5MC 4LEQA 4NY2A 3TW7A 4N0RA 4L1GA 3D47A 3KP1A 4H4YA 2ZE0A 2R24A 4NG3A 2ZA1A 3URNA 3TWBA 3UBPC 5I24A 1OJTA 4AQLA 1YNPA 4V28A 3SY1A 1FWWA 1SJDA 1EPVA 1PTAA 3CIWA 4W86A 3REQB 1E73M 3MBFA 4DPQA 3ZSSA 4O50A 3W27A 3MZ2A 1QCWA 3W7JA 2C14A 1H63A 2PTYA 4HPGA 2PDGA 4Z2LA 5E0CA 4PCFA 2NVAA 1FWGC 1WP6A 3E96A 3RRXA 5D9MA 4FP1A 4H9UA 1K8CA 1XBVA 2FMNA 3T7VA 1YE6A 4ZQOA 1PVNA 4PRRA 4AZ5A 3MJMA 1XIFA 1QO5A 3L4TA 1TV2A 5M17A 2EPNA 2FZDA 4GRTA 1FWFC 3SEPA 5EPDA 3DGHA 4LAZA 3MWCA 3KCLA 2YYUA 4GFIA 2FZBA 4E3TA 5IHRA 4DWSB 4PUJA 1QO2A 4MOZA 2EPLX 4CUCA 4AH7A 3EDJA 4EPDC 3MMTA 1SSDA 4H4XA 2WXDM 2RFGA 4NAFA 1WUEA 5F7UA 1JFHA 3W71A 4B9YA 1GNXA 1KB3A 4TOQA 1CGYA 1V0KA 1DTNA 3QW4B 2P5NA 1MMFA 2VOTA 2XH2A 1LQ0A 3QLLA 3OA3A 3WH9A 3IJ8A 1AH0A 4NZ1A 4IHCA 5FL0A 5FJTA 3IACA 3VOIA 3B9AA 4FF5A 4J9JA 4UBPC 1AZ2A 4HA1A 1Z44A 3D3AA 4LPCA 1HXJA 3B8VA 3S1UA 4UB9A 3EOUA 5AYBA 3DGBA 3DEQA 1RD6A 1XLEA 4DX3A 3VUPA 1RH9A 1QW7A 3BAJA 2AMGA 2VJXA 5D04C 1L6WA 4U10A 3QM3A 3I68A 2XFYA 3T0TA 3MUZ1 4LX4A 4IJCA 2YW3A 2EKCA 3SI9A 1YLVA 1Z32X 1R85A 4C65A 3ITYA 2HJPA 3SY8A 4WY0F 4PMYA 4NAEB 3P84A 2OR2A 1VC4A 1KA9F 3ANUA 2Y7FA 2A3CA 3EKGA 4C6DA 1WXZA 1WKYA 4NILA 3W28A 2PDYA 4KMQA 2W55A 2PLKA 3KTCA 3W25A 4Z1BA 1S38A 2GGJA 1ONEA 4E4PA 4D6HA 5CPQA 1ICPA 1OCNA 1C8YA 1ZL1A 4CQ8A 1UD4A 3GNPA 4MY9A 3ZVHA 5D2XA 1EJWC 1FH9A 1O5KA 2CLHA 4H4PA 3W7RA 3AHYA 1NY1A 3C86A 3IGSA 7ENLA 4OHQA 1J79A 1EGMA 2ZUVA 1RUSA 3EPOA 1N61C 1VPYA 4JHOA 3L4ZA 3QJAA 8XIMA 3RGTA 3RFAA 1J0HA 3TQVA 1TPUA 1B30A 2XIBA 5HNRA 3CV6A 1DWGM 1SB3B 3NOEA 1A5NC 4PZVA 2NSOA 3W86A 1QDSA 4FNTA 1AW5A 3CPUA 2HPIA 2E8YA 2ACRA 4DF2A 2ISVA 3N3MA 1B5TA 5HJXA 4J57A 1GORA 2BASA 1PCWA 2GVGA 4QQ3A 4JICA 4O1DA 1VYRA 4DNMA 3ZQ9A 1ZP4A 1UP2A 2Y2WA 3L2LA 2BGNE 3BSMA 3CK5A 3GUWA 5I3JA 1LOQA 1MNSA 5HOSA 4MPQA 4IJRA 4FK9A 4C6KA 3F03K 5C2GA 4JTRA 2DUAA 2QJGA 4IH3A 5HNTA 4FX6M 1PZ2A 5H8UA 1TTIA 4REQB 2FLIA 1H2IA 3R07C 3SGGA 4ZENA 2ZZBA 3FAWA 4PRTA 4JTGA 1GQIA 3OG2A 3U2EA 3NQ6A 3SR7A 1TV3A 5G4HC 4DYEA 3U6WA 5C9WA 3RIKA 4M5PA 1KTCA 1TMLA 1GONA 1WBHA 3GU1A 5C2XA 2YLAA 4I3GA 2GFTA 4H3DA 3MKVA 4R53A 4DF0A 1TV8A 5XIAA 4HA4A 3H21A 1U2YA 4IX0A 1WOBA 3FJ4A 4NNAA 4CD7A 3V16A 2PDWA 2PDIA 1BQCA 1SO4A 4QSFA 4P8XA 4FLSA 1KW1A 1QU4A 3GNNA 1CIUA 1IF2A 1A5SA 1FWSA 1WXJA 1VHCA 3DH7A 3AALA 5I0DA 1JF5A 3KW3A 4PMDA 3TWAA 2A4AA 3NQ2A 3D3FA 1WNOA 2PZNA 5KZMA 3VCCA 4HIBA 4HBKA 4HSHA 4EMJA 2G3JA 5BU9A 3DOPA 3HGOA 3ARYA 4KH2A 2C15A 5BZAA 2QDHA 1XLIA 2E28A 2SFPA 1ZAHA 5GQBA 3MHUA 2NXHA 1MXSA 4ZSUA 4FX8A 4WKFA 4BI6A 1LL6A 3E0VA 1OX6A 4ZO6A 1AJ0A 4EK7A 2XVPA 1RZMA 3NTYA 3VGHA 4XVEA 2PB1A 3SRDA 3QHMA 3AYVA 1V3HA 1F3XA 2EPMX 4EANA 4KEVA 2A6LA 1TA3A 1HW6A 4GVFA 2HBXA 1XF0A 4J7RA 3GVQA 3W53A 1R87A 3EA2A 3CTTA 2MUCA 1QW8A 3V4BA 3BAXA 4EM4A 3UXIA 1JYNA 2VZUA 3F5JA 3GIQA 5CG0A 2Y5EA 3CU2A 5D02A 1OG6A 4GUIA 5FS9A 3NQBA 2DZWA 5KZDA 3FV9A 1EEXA 4JQ1A 1KWGA 1W1IE 1S3TC 3WELA 1ISXA 1S5MA 3ABQA 3A7RA 2PD9A 2WSQA 5LIKX 1F76A 3AIQA 3WQ4A 4C6EA 2BWGA 3G0UA 2Q01A 2R91A 2XWDA 4Q7BA 1QNPA 3TXZA 4P7QA 4WXYA 1Q66A 2JBMA 3W1QA 3T09A 1F05A 3BLDA 2R9ZA 1E0UA 2I1OA 4GBDA 3L0GA 2QDDA 3QGAC 2XIJA 3UZ5A 4YHEA 4IMFA 1VCGA 3HQPA 2HPMA 1BGAA 4NL1A 3IVSA 4Y9AA 1JCYA 2A3BA 3EWYA 4QCEA 1M7XA 2J7DA 2VHLA 2VR5A 2IQDA 3L65A 5HNUA 1TPEA 2E0PA 2E5DA 3EWDA 2Z1BA 3C3UA 4KIRA 1FA2A 4X0NA 4F0SA 4QJ1A 3EF6A 3R1ZA 3WL1A 1YDOA 5C54A 3ARVA 2ZYFA 1D7KA 3MC5A 3EDEA 5DY3A 1QPOA 5CAHA 4AIUA 3TSDA 1TRDA 3N04A 4D2JA 5EMKA 4DXVA 1I9CB 4D8LA 4C6LA 1XYAA 3UXKA 2NXGA 4GY0A 1T5AA 1Q45A 4G7FA 1C90A 1JPMA 1JDFA 1P0NA 1QVBA 1JDEA 3UWQA 3QKZA 4KRTA 4EACA 2E3TA 3TCEA 1L0PA 4H83A 1TMHA 1P7TB 2YCLA 1RVKA 2DJLA 2YLLA 1JD9A 4WJEA 3QKEA 5F2LA 4BURA 2AAAA 3SCOA 3CH9A 4ZQCA 4J3ZA 1AL8A 4PGLA 2HV5A 3RN6A 3CYJA 4ML4A 3DFSA 4HHPA 1Z3NA 1KM0A 2I5GA 4OECA 4RX0A 3LLFA 4JGDA 2ZUNA 2O92A 1HL2A 3WQCA 2ZXBA 3W88A 3VZXA 1R5YA 1Q6QA 4J3WA 1W9VA 3AUOA 1MQPA 1YXYA 3ARPA 3S42A 2DT2A 3RR4A 4B91A 1AZ1A 4DELA 3GIYA 2J79A 3LTYA 4PTVA 4PFHA 2Z1SA 3SM0A 3WQWA 4HNNA 1KD0A 2QPXA 2TPSA 2FZNA 4KT2A 2J7CA 1PTGA 3BGAA 2R6OA 3A3HA 3AMZA 3M41A 3AIEA 1XLFA 1ZNNA 4L64A 1TG7A 4HQVA 3HU7A 4H00A 1HKVA 4JHZA 1CLXA 3LCXA 1BG4A 1VHNA 1KTBA 4H4WA 3QFWA 4HA0A 3WQ8A 3NPUA 4TR9A 4CEUC 1C7TA 5L9FA 2DUZA 3NJ3A 3M46A 3T6CA 1KCLA 3UG3A 5FEXA 2E1DA 4EOUA 1UR0A 4JQ3A 4CNPA 3KX6A 4IMAA 3S46A 3UWZA 4J4KA 4Q4KA 3PTDA 1KFWA 2DH2A 3M5VA 1QOXA 3LOTA 4HA3A 2Y7GA 2YW4A 3KL0A 3VIPA 1LZOA 3NXFA 5HMFA 2CZVA 2CBUA 2PBOA 3AMKA 5DO8A 4IPPA 3ATYA 2D3NA 4GZIA 2X1TA 4CD8A 1GG0A 2TMDA 2BG5A 4K7ZA 4R88A 7REQB 1PYMA 4NSBA 3ZSTA 5F4WA 5LGZA 3BURA 3ENLA 3GG7A 1HL8A 1FHLA 3S6DA 1J2BA 4MDOA 4JL1A 5J5RA 4NX5A 3EA1A 3FW6A 1OD8A 3IIXA 4HZ8A 2C8NA 3BLFA 3CWHA 1SVDA 4HHHA 3WF2A 1W17A 4B5SA 4HYVA 2CZDA 2WJFA 4YIWA 4LH8A 4H8NA 4HSOA 3TX9A 1B3VA 1UD3A 3HZ3A 3MQTA 3HIJA 3KL5A 3MO4A 2BOGX 2LLEA 4H8UA 4LALA 3IIZA 2CITA 1W8GA 2IQTA 3QGKC 1ICSA 1EPXA 4XK2A 1QK0A 3NQCA 1Q85A 5A8NA 1FHUA 1LM1A 3GFZA 1KO0A 4O10A 4OE7A 4IFKB 5AHIA 3RR1A 1FFRA 1OG0A 2WBKA 5D9OA 4LJ3A 2QCDB 4KFNA 1XINA 1IZKA 2BVYA 1IXOA 5J5DA 3PBUA 4WXZA 2VGFA 3CZJA 3ITGA 1K9TA 1K7EA 1Q6OA 2XGBA 1WDDA 1MOKA 4GXMA 1TCMA 1GKRA 5D33A 1BAGA 5AHFA 1ODZA 1OBAA 1T96A 2W62A 3FLUA 3S2MA 4AWEA 1OFRA 4A35A 1JYWA 1J96A 3B3DA 4ENLA 4KW2A 4LQ1A 5GJMA 4WDXA 3SRFA 1W3NA 4P8VA 2YCIX 4FZIA 4NU7A 2OVLA 3LK6A 2ABAA 2QYGA 4QXIA 4M24A 3QC3A 3QPZA 3PZGA 4AHPA 2DW7A 2QAFA 4JS3A 3W1TA 1M9HA 3HTWA 4HTYA 4N6EA 4B3ZA 1OFOA 3V7PA 1FDJA 1RCOB 4ORMA 3W2NA 5CCZA 4J27A 5A8MA 1TPWA 2BGQA 3GHUA 2FJUB 3UXLA 3DG7A 4QJ5B 2OQLA 5I5RA 5FCZA 3NZRA 1O66A 2E5BA 5JU6A 1KRCC 4HPXA 2HVNA 2X1UA 2XM1A 1VB9A 3WFLA 2X41A 1FDZA 4L4MA 2GGGA 3G6MA 1U5HA 1B2YA 3M16A 3BLIA 4GJIA 2XH0A 5DX7A 3FG2P 3DHDA 4TX8A 3MO7A 4RZBA 1MXDA 1GEQA 2H8ZA 5TF0A 5BXSA 3E12A 2PZ0A 1P43A 1EGZA 3L5MA 3JZEA 2E09A 2PDPA 2Z29A 4S39A 3WKZA 1MVYA 2QUNA 1HKKA 3C2YA 2GJNA 2W61A 3W2KA 3GK0A 1DJHA 3OLDA 3PZTA 1OX4A 3OHIA 2CLMA 3HPSA 4JYEA 3A5VA 1KXQA 3M5XA 4N9EA 1PX8A 1VFOA 1OF6A 2DSKA 3CHDA 5U4NA 4GVIA 1JVNA 1HO4A 3IUHA 2Z2AA 1OK6A 1EDTA 2PGEA 5CJNA 2ZZCA 4RZ6A 3FA3A 1MFVA 1OYCA 1BLIA 1X96A 4X3ZA 3RLHA 3KLJA 1UR3M 3WNKA 2AKZA 5CBJA 4KPRA 5LXXA 3C56A 3PBWA 4I7WA 2H8XA 4LB4A 3MHFA 2ZDSA 1W5OA 4HB7A 2NXIA 1N7KA 5BRBA 4JHMA 4RV3A 1LPFA 1GG1A 1UWSA 5GRTA 1MDLA 1J0ZA 1E4LA 3FXGA 3P3BA 3SSZA 1XKYA 2XFFA 3IRSA 5CQ1A 1TTJA 3NM1A 2JIEA 2GOKA 3P82A 3ZYZA 4NX0A 1W1TA 3I6TA 5FJJA 4QBXA 4ICMA 3U7BA 4KF1A 3GW3A 5FA5A 2FFCA 1UPPA 3S2JA 1OFDA 3VABA 3XISA 3UD6A 5DXYA 2VFHA 3BSGA 5DCBA 3T0CA 3SN1A 3R0DA 1WXYA 5CZTA 4Q8TA 1SUXA 2GH5A 3ABSA 2YKKA 1OC5A 5I3GA 3M0VA 3R12A 1QXLA 1XSKA 3S8HA 1VFSA 2Z1WA 1MO0A 3IJ7A 1W9UA 1W56A 2P3EA 1EKOA 1MEHA 3WSUA 1EWDA 5LNWA 4IZGA 4LEFA 3CQ0A 1RCQA 3WLOA 3Q4DA 3OLEA 4DUWA 1GZ1A 3WF4A 1PEZA 3NWRA 3R0UA 1L8NA 2PLJA 3GZAA 4DUVA 2PFHA 1VBJA 5JQ9A 2INEA 1BFNA 1SZEA 2E6FA 2OZ8A 3GR8A 4M29A 3L4XA 3DDMA 1YDYA 1GOWA 3ZJ8A 1EZWA 3N2MA 4X9SA 3RM9A 1TPB1 4ATWA 3N2XA 4UQ9A 3LLDA 2HVOA 2BX7A 2FYMA 1XLDA 1NDYA 1RCXB 1QRQA 1OC6A 2GJXA 4XZLX 2DSUA 3PPHA 4JNZA 1XIIA 1OCBA 2E68A 1MEIA 4NVTA 3RITA 1JD7A 3ZLFA 1F3TA 1SYTA 1LLWA 2O9OA 4UNKA 2WHKA 5JCNA 4AD0A 3WH8A 5BMWA 5FF3A 2NX3A 4YU1A 5CZ0A 3RK8A 4AZCA 4R9OA 4AYSA 1EA9C 1X2HA 2ISSA 3EBVA 3EX3A 1GQKA 1NF7A 3GKFA 2ADAA 4AEFA 2YOCA 4H8VA 1V7YA 5FL1A 4RCXA 3VNJA 2YSWA 4U3AA 3GUGA 3LV5A 4FI4A 1QNOA 2Q09A 1UC5A 1GXFA 1YIXA 2QXWA 1YDVA 1KXVA 2VFGA 2G4FA 1BXCA 1J9YA 1ECQA 4GIRA 2NQHA 1FHVA 2FVLA 1F6PA 4J56A 1NTHA 1CCWB 3QMTA 4GOAA 1N63C 3PPFA 4S3BA 2WSKA 1KM2A 4IIDA 2IPJA 1Y0EA 3FA4A 3LMYA 3SCTA 3EOSA 4FXFA 1US3A 4UFIA 3B06A 1CTNA 1S5WA 3R89A 4O18A 8RUCA 2QEZA 4ZB5A 1TYTA 2HZGA 3L8KA 3B8WA 3VAVA 1LQAA 5U1OA 1QJWA 1LG2A 4HMNA 1F8WA 3DERA 2ALDA 1BF6A 1S2WA 2V5CA 1H5VA 3ARSA 1ZS2A 3R58A 4JCMA 4PEKA 5FJOA 1W1A1 1YMYA 1T7LA 1E9IA 1R46A 3UU0A 2OWCA 4E3VA 3KBVA 4DY1A 2VEIA 4S2BA 3TTOA 5CJMA 1GOMA 4PBFA 4NAFB 2H90A 3WK1A 2PEVA 3UZJA 3RLGA 4B3KA 3N4AA 3T2OA 1PS9A 5EB8A 1Q6RA 4M56A 3VKBA 1TYGA 1IWPA 4NRRA 4ECLA 3W6YA 3CTLA 5EMJA 2XIOA 1KRAC 3PG8A 1GW9A 1Z6KA 5AY7A 2Y88A 3ITLA 4PUDA 2JKAA 1VCVA 1LP6A 4RDZA 2E6YA 1YKWA 2H3DA 1GEHA 1JEZA 1GUVA 1G67A 4MNKA 1XYZA 1DIOA 2VP8A 2D0FA 1EX1A 2V5LA 1AW1A 4XSMA 3SN4A 4AZGA 4IPJA 1DHPA 3DU0A 2C18A 3VIJA 1HJQA 3CL7A 1XDLA 3AS3A 3TTSA 4H4RA 4WSKA 3AIWA 2WOQA 3CQJA 3QTGA 2VEGA 4C7DA 4UTTA 2VZOA 1BYCA 4R7OA 3PJTA 3HPZA 2ZUUA 5EFFA 2VRQA 5HWJA 1QI0A 4L9ZA 4DWSC 1UG6A 3CGCA 3I7QA 3FYPA 3R6IA 3YPIA 3EPNA 4QEHA 3RXZA 3THUA 1RA5A 1ZB5A 3OGRA 3KM8A 1J10A 4WK9A 3M0ZA 2DIKA 1WZLA 2DZTA 4MM1A 3AZRA 5GJNA 1VJSA 3L66A 2PWUA 4K38A 5JIWA 5HJLA 4IIGA 1FKWA 1ZHAA 3BPWA 1YPIA 2ACQA 4XQ6A 1THFD 4UTLA 4KRZA 1UR8A 4IX2A 3E2RA 3MYPA 1VQZA 2R14A 4HU4A 2V3FA 1WQ5A 4AVFA 3ZVHB 2V0TA 3QC0A 4LYQA 1K70A 2J47A 1SR9A 1CW2A 2IKGA 2DFAA 2FH6A 3LBOA 1OYBA 3MKKA 4IGHA 4UCFA 3MDUA 2ZX9A 4W84A 3V0SA 1VPQA 2QVNA 4IL0A 4UQEA 1SGJA 1IEWA 2XGZA 4XAFA 4ZO9A 5I07A 1W2VA 4ZE5A 2IQ0A 4CN1A 1QMLA 1XH2A 5XINA 3EX6A 1YPXA 4A8RA 5E9AA 1P1MA 3P80A 3VD7A 1K6AA 3HOJA 1RQHA 3CGBA 1D3CA 4RE0A 2X05A 1C93A 3VC5A 1R9YA 1KCKA 2DVUA 4XUYA 1N8IA 4FMVA 1I75A 3GZ3A 4KCUA 3W1UA 2OZ3A 3LENA 1B3ZA 5FF7A 4UQBA 2JE8A 4M51A 4JIEA 3MANA 1MW0A 4JIPA 3T0DA 3HGSA 4C6QA 3FIGA 4YTSA 5KEZA 2Z1VA 4P2VA 6TAAA 1UQYA 4D6EA 1MYRA 2W91A 5F4XA 3RNMA 4NP7A 3W26A 1GREA 4EMWA 5G2WA 3UVAA 5CJ5A 1VH7A 3CHCA 4OUEA 3II4A 2XN1A 3JZUA 4PMUA 1JAKA 3A4WA 3S9IA 4X9YA 1WZKA 3QY7A 3MSYA 4Z08A 5C55A 1DJQA 4RNJA 4YPJA 3LQLA 2FMOA 1LJYA 2NQZA 3LX9A 4HPNA 4QG6A 1BF2A 3P0XA 5JUVA 4OZOA 3KCOA 4Y7EA 4UMCA 3WNMA 2E5CA 4AZ7A 3VNKA 2HBVA 2XM2A 3QF0A 1TZ7A 4BCEA 3LCFA 1E1FA 1ZJIA 1TRIA 5AOUA 7CGTA 3H6OA 1M04A 4JIQA 5A6KA 3F4CA 6REQA 1V79A 1F74A 1KCZA 4PUUA 1WDSA 4O57A 4QS5A 1KFBA 2E9LA 3T4CA 3THQA 3N11A 1W31A 1I1XA 2BLEA 3MI6A 1O94A 3TN3A 4HMEA 1OY0A 3UWUA 5GNXA 4DBEA 1WKFA 2YL5A 5JIPA 1ADOA 2MNRA 4M3PA 2I16A 1W5PA 3GXMA 4UTWA 5EY5A 1E15A 1NHRA 2CESA 4HJFA 3T07A 3DHUA 3VX0A 5C6MA 3S83A 4F2BA 1XDJA 1KFCA 1JZ5A 3ARTA 3OVRA 1ML1A 4JTCA 2C0HA 3TOPA 4LWWA 2BY0A 3H2OA 1XFCA 1JCTA 2JK2A 3RM4A 3QZEA 5F2GA 1K77A 1O5QA 3KRZA 3IV3A 3C4UA 2FFIA 1VFMA 2A3LA 3WN6A 3WDHA 4JIIX 3TDFA 1V6VA 4HOXA 1I0DA 4AIEA 2GUYA 1Y65A 2JQXA 1R3VA 2C13A 4WSHA 2CBIA 3BG3A 1K8XA 1X98A 3KVMA 1TA3B 2OELA 2X7WA 1G6CA 3PWAA 4JEJA 3URHA 1DQUA 1XQLA 1NWRA 1ZSXA 3DHPA 3AMGA 3MSRA 3PUGA 2WOVA 1KGXA 3UEQA 3FDGA 1EDQA 2WSPA 4EPBC 2AGKA 1M68A 2VXNA 2CLPA 4FSAA 3PFMA 3OB8A 1AD4A 3NAVA 3AI0A 4IMEA 1SMDA 3P61A 3IUDA 4PCNA 1ZAIA 4PUWA 2WVVA 3UCDA 3M07A 1TX0A 3W73A 2WHMA 4GG9A 3B97A 2BZNA 3MP5A 2OX4A 3UCQA 3IGHX 1UWRA 3DFNA 1XPGA 2Q3OA 5FMHA 2VOMA 3B0XA 1WV2A 1XIEA 2ZZ4A 1EBHA 1K9FA 1VQTA 3DG6A 4OFCA 1ONWA 2V2CA 3WLPA 4O0ZA 1QW9A 4MB1A 3NPXA 5D2TA 1Q7MA 3GDTA 4F0KA 4UTHA 1VAHA 4A21A 3P8IA 4MYXA 1QI3A 3RX4A 5I6SA 1WZMA 1JCXA 1A5UA 1XRFA 4BEUA 4JBRA 5CC5A 3TJLA 2OTDA 3CEUA 4BKNA 4J3UA 1L6YA 3CGEA 3CLMA 2PU1A 3H7RA 1EHNA 1GRTA 1DWJM 3R10A 4PE8A 3L4YA 4KFOA 4LVGA 2NLIA 1OFAA 1QOPA 4I9TA 5A6MA 3MZNA 3ITCA 4J3XA 2OKTA 2EEXA 2ACSA 2DV0A 3AMLA 2EPOA 2INFA 3FOKA 1RXOB 1F3PA 2VEFA 3WLLA 3EGJA 1BTCA 5HR7A 2YCLB 1JZ2A 1GVOA 1CPUA 4M7TA 2D1ZA 3F2CA 4UZUA 2CHRA 1HVXA 2CHNA 4Z2HA 4DWSD 3PSWA 4HPHA 2W92A 3WK2A 4MDPA 8A3HA 3W7GA 1W5NA 4KEZA 5FIPA 2E8ZA 4TIMA 3GE7A 5LHEA 4Z2KA 3QR0A 2OODA 5HMEA 3FYYA 4P8WA 3QVQA 5KINA 3WY1A 3T55A 3K13A 4MNMA 1KRMA 4WSJA 4E38A 2BP1A 1KKRA 2E9BA 4W88A 3OJGA 1JCMP 1V4YA 1ZJAA 1DIDA 3PN8A 4Y9MA 7XIMA 1KNWA 3EXTA 4QE1A 1RY0A 2VD9A 3WDIA 1LT8A 3NURA 2CIPA 4GUFA 3TW9A 1CZ1A 3GDMA 1GPWA 1L2UA 4R27A 2NUYA 3BQ5A 2DIEA 2I9UA 2OZTA 4H9TA 4XSLA 2BY1A 4QS6A 4V1XA 5IFTA 1UP0A 1KLYA 5G5GB 4UC5A 2EF9A 3OIHA 1QAPA 4UUIA 3GBDA 1ZALA 5HULA 3W6LA 3NZQA 3E9AA 1E56A 2WMJA 4DO6A 2F5ZA 1UIOA 3OHMB 3GU9A 1NQ6A 2QUUA 2PD5A 5C7VA 1C8XA 1D9EA 1K1DA 3CZLA 3STCA 3APTA 1XP3A 4ZQMA 1N8WA 2RDUA 4GVHA 2VDHA 4E4FA 4GHRA 3DN5A 3PANA 2OOGA 1QOQA 3PJWA 3GDRA 4ZOHB 4ROPA 3OU8A 5E0KA 3SDOA 3NDYA 4J3SA 2X7VA 2NT1A 3NR0A 2VYOA 2ZZ1A 3G1YA 3MI3A 2VUNA 2CLFA 2HDJA 4NHVA 5I23A 1MW2A 2A7PA 2UBPC 2GQAA 1ENUA 4L9XA 5AHEA 1W3IA 2OLHA 2WHLA 1H7OA 1VENA 4GUJA 4Z1AA 5M2FX 4B92A 2HEJA 3SUSA 2ZRYA 1KBLA 3N4EA 1GW1A 1TJ2A 1MI3A 4LYKA 4DXXA 2OOFA 3CB3A 4GABA 1HJUA 3W85A 3B9NA 2FPYA 2B81A 2YCJA 1TREA 2WJZA 4YMZA 1M41A 5C2CA 2WMHA 2X42A 3DG3A 3QSRA 1TCDA 3K4DA 2ZE3A 4LY8A 1UC4A 2FTYA 5DT7A 4HNTA 3W37A 1LYXA 1GPFA 4TVDA 3QHOA 1SO5A 4A8IA 1Q8AA 3S5YA 4G6CA 3FVMA 3B05A 3NZPA 4HN4A 4C6IA 2XN0A 1IT8A 4A2RA 1JQVA 1UH4A 3GXDA 1AL7A 2PF0A 3ZWTA 1KCXA 3GKAA 3IARA 1Q2SA 2XUCA 3UZYA 5LIUX 1V3KA 1B3WA 1OFPA 3GNOA 3SADA 2V3BA 2XVKA 2XGIA 3R5EA 2Q6ZA 3GD4A 3GRSA 1XX1A 3KWSA 4GI6A 4H9XA 2VI0A 3CO8A 2FKPA 2PGFA 1NJJA 1I2PA 3TLLA 3GXNA 1VEMA 4OOZA 4MPKA 1ITXA 2QULA 3KOYA 3KBNA 4GCXA 2J8GA 2Q8XA 4G5DA 4KCVA 3VD4A 3OYXA 3SY5A 4LS2A 4O14A 1YX1A 3KZSA 3A5FA 3SURA 3GC5A 2XFWA 3NRZB 3DZ1A 3GHTA 3W72A 3C0QA 1T40A 3KOXA 2B4GA 3B0UX 2V63A 4MJ2A 3V1HA 2P3ZA 3K4WA 2XZ7A 3KBWA 2WC3A 2FB3A 4LFYA 4XBSA 4KEMA 1XPYA 2I5IA 2QGHA 3M0HA 1ONRA 2PF8A 4IMGA 3PNUA 1PDYA 5G4EA 1VDVA 3GDLA 2IUZA 4MNLA 2WYSA 3DFYA 4QP0A 3AS1A 1V5XA 3B4UA 4XO6A 3SCPA 3KRBA 1Q1WA 1BSLA 3BG5A 3QBUA 5HJYA 2BS9A 4C90A 3UG8A 4LAUA 1LBFA 2O56A 3B04A 4H6EA 1QR7A 4LU0A 3PUDA 1VFFA 5F4SA 2CFYA 3M44A 1JPDX 3P81A 2QDGA 3GYEA 1G0CA 4FR1A 1XLAA 4M6QA 3ARXA 4O8AA 5DLCA 1FH7A 3N4FA 1UKPA 4JQ9A 2H9AA 3UW6A 1BYAA 4QG9A 3RHGA 3RCYA 2WPFA 3AXXA 3M1ZA 1DJIA 2PDCA 4RNHA 3W6MA 1R6WA 3T2QA 1OK4A 3WH5A 4B4FA 1Q5MA 3HPFA 3LPPA 1KBIA 2G41A 1TZ9A 2OEKA 3BSHA 4AD2A 4ADTA 1EP1A 1WAWA 3CAQA 3P5YA 4ICNA 2CLLA 1OX4B 1MRQA 1ZBWA 4GH3A 3BLPX 1G4PA 1TV4A 1VYSX 5CEWA 4GY1A 4H41A 1Q7ZA 4MJZA 3V75A 1B3XA 5KSWA 3WQGA 1ZU8A 5I3IA 1UUMA 4US5D 3DAQA 3EKZA 5KMYA 1UZHA 3HG3A 2QLYA 4MB4A 4QE4A 1CXFA 2PC4A 2FDMA 1R38A 2VEMA 3CT7A 1JZ7A 5DT5A 1I4NA 3MCMA 2E6AA 3EAOA 4O12A 1QBBA 1JUEA 5C0QA 4C1KA 1P0EA 1XLGA 2WPBA 2D2HA 4M80A 1UZDA 3WDPP 3AZTA 4MHBA 3WFAA 2WCAA 1GWJA 2E1WA 3SCUA 3K1DA 2VFDA 1TUFA 4KPLA 4EQXA 2C3DA 3KEHA 3GR4A 3A47A 2EO7A 3GWQA 1IXPA 2J4GA 4K7YA 3EWWA 1BXBA 4JNYA 2I56A 4GWEA 3GXPA 3WK3A 3UG5A 3C0SA 5IBXA 1IWBA 4CLMA 4NZCA 1FCUA 1NARA 2EGZA 4US5A 1E40A 3DYOA 3TROA 4IQLA 1EJ7L 4APNA 3U7VA 4W8LA 3W7OA 1RP9A 1FHDA 3PM6A 2CBVA 2ZXAA 2GWGA 2GWNA 1VRDA 4W9TA 1LBMA 3HRDC 1R3YA 4QLJA 3MHGA 5H1WA 2ANUA 3OODA 4XZBA 3NQ7A 4AVNA 4MKSA 3RX2A 1HKMA 3P8JA 3S6OA 3W07A 3KXQA 1BQGA 4QM1A 3LN3A 4AEEA 4E2DA 5ABTA 4TVCA 2XVGA 3O16A 4ACZA 3WIJA 1S39A 1HFBA 2PDBA 2XIMA 5HWNA 2EQ9A 1OB0A 4O1BA 2OT0A 5I79A 3VKCA 3K2GA 2B7NA 1K7XA 2EXOA 4XZHA 3FSTA 3TIMA 1XCXA 4MUPA 4J40A 4XV0A 3WQDA 1G5AA 4PCTA 2OYLA 2BBFA 3CJPA 1W8SA 2HMCA 5A3HA 2GJXB 4E6MA 1X2GA 3NVDA 3CZ8A 1EGVA 3GBEA 3WLNA 1EC8A 4QDWA 3TMQA 4GJJA 5TNVA 2QCNA 5DBUA 4GI4A 4LSBA 2J8FA 4DB7A 1Q6DA 4WJXA 3WLHA 3C2EA 1GVFA 1V77A 3S9ZA 4AZCB 2YJQA 3KHJA 3HMJG 1GEUA 1KM1A 4Y90A 1Y5VA 2YDRA 1W9DM 3ICJA 3LXCA 1AMKA 4KCWA 4QG8A 1M6JA 2R1NA 2P53A 3IIPA 2XSXA 2X40A 3LY0A 2UY2A 1V51A 1T8QA 4K1GA 1KGWA 1F5ZA 5F1VA 3NQGA 1V7AA 2ISWA 1G1YA 2CC0A 4M82A 1KV5A 4CN6A 3TU9A 2IXUA 4DQWA 4KGJA 2QKFA 5CGTA 2VCAA 1XLKA 1UJQA 3CT2A 4XB3A 5A6BD 1IR1A 2GJPA 4TO8A 1BSIA 3A4XA 4FXJA 3QV6A 5E9XA 3BW2A 3H2CA 3TN6A 1XR2A 3MVIA 3NEVA 1V0MA 3E0LA 1MSSA 4BK9A 3C5QA 2WNQA 5LIWX 2W5FA 1DPMA 4R7WA 1EJVC 4DI9A 1ADDA 3I10A 1TE6A 2E40A 3PBYA 4UXDA 2QJHA 4HOWA 4A3RA 3NQDA 1OX5A 2J78A 3VDBA 4YTTA 6PTDA 4A2SA 1CT5A 1XHGA 5H8PA 2YL9A 3CUXA 5BXRA 1OT1A 3H23A 3NZ1A 4XD5A 4S23A 4OTKA 2GR0A 3LNMA 1AVAA 3HO8A 2C6QA 4JZ5A 4CNNA 3ANVA 7ODCA 2QZRA 3A12A 2AQOA 3VOCA 1N62C 3LLXA 3KRUA 3WENA 3FAXA 3IAPA 3NO5A 3I7SA 4FEZA 4C6JA 2B0MA 3H24A 2JKPA 3PBGA 3V18A 3A4AA 4JTUA 3VGBA 1JPHA 4R33A 1OM0A 5BRQA 4P61A 5E0FA 4NF7A 4NEWA 1ISWA 2E3ZA 3DKJA 3ZFHA 2Z26A 5REQA 5I06A 1JDAA 2ZOXA 4GYFA 1U5JA 1AH4A 3NVYB 5I00A 4AISA 1BVZA 4KWVA 2B7PA 3GVVA 1XDMA 3A23A 2OQYA 4E8GA 4W7WA 4H7ZA 2OX1A 1O4UA 3TAOA 4F0LA 4DBWA 2DZPA 2DT1A 4JKLA 5K7JA 1VJIA 1IT0A 1EJSC 4IGNA 5LNUA 3CM4A 2Q8LA 2PWVA 3S5OA 1ME7A 3F7JA 2E6DA 1XSJA 3LCWA 4M1RA 4Y8EA 4RDWA 1KGUA 3S5SA 2EAWA 1HNYA 2ZZ6A 3R13A 2WWCA 2BY3A 4B90A 2GJRA 2EJAA 3OZYA 4WGHA 1GTEA 3LBCA 4GYPA 4CQDA 3IAQA 4GPNA 3W2UA 1REQA 1RJRA 3PZOA 3QQ0A 1KXHA 1PE1A 4HK5A 3C6CA 2PP1A 1W9XA 4PUKA 3QPEA 2ZWYA 3RMJA 2ZRZA 3VKAA 3P0WA 1KFJA 4NASA 1RBAA 3A4JA 4BF9A 3SECA 2EG6A 4LVDA 4LAKA 1NFPA 2CXEA 2XISA 2W0HA 2RJGA 1W9PA 3NNTA 1HJWA 1M6IA 4UTMA 3VGEA 1K7FA 1CGTA 1MW3A 4ZO7A 2EG8A 4XBKA 5FAJA 1UOZA 1FP8A 1FWBC 2WK2A 3KL3A 4H50A 4NI8A 4AWSA 1K9DA 1LG1A 3DFQA 2F8QA 4K3ZA 4RPQA 4OU1A 2JF6A 4BEQA 4ERAA 4RXGA 1EOKA 1HKJA 1A5BA 4DF1A 3G1FA 3PF3A 2GZXA 3WMLA 5I3FA 3GG0A 2C1GA 1V59A 1GERA 3A7UA 2VM8A 5KTLA 5HDRA 1UKTA 5EKYA 4KBXA 4IP7A 3IJLA 1TWWA 4PMRA 1NF0A 3IVTA 4L6OA 4PUEA 3CV1A 1LLZA 1QATA 1EX5A 1WO2A 2EQDA 3EOLA 1FEBA 1UKOA 5DY2A 1W3HA 4TTUA 3HPAA 1A53A 4NZFA 3N1AA 4N9DA 2PDKA 4RR4A 3KS6A 4G8TA 2Z1KA 5LA0A 4A6GA 1DKWA 2C3ZA 4LBSA 4FHAA 4DLFA 3FJLA 4DZAA 1S2VA 1KM3A 3NO3A 3UJFA 3WNPA 4NEVA 1V3LA 5ABFB 6REQB 3B0YA 5M03A 2EPHA 4UZSA 3NA8A 2NV1A 4PN2A 2XIIA 1N60C 1TJPA 5HAOA 1L2QA 2V5JA 1B1YA 1PX4A 4LRTA 1SFLA 1QNVA 3D46A 1GV4A 3P14A 3VX1A 4BV6A 3B4YA 4NZ4A 3N2CA 4GUHA 3ZT5A 5BWFA 3DI1A 3EEGA 1AQ0A 4DJDA 3CHEA 2W67A 5HWMA 3DIPA 3QFEA 4YS1A 1DQXA 3VZYA 3R4IA 1EDGA 3G1AA 3L68A 1OCQA 3SCSA 2ZADA 3LI0A 1JF6A 1AMYA 2B31A 3C2FA 1I2NA 3CIXA 1FUYA 5EBAA 5E93A 1P4CA 2A3EA 4E5TA 1C91A 2E9MA 4NRSA 1BWCA 3S1GA 3GM8A 3SQSA 2HROA 4H9VA 2DVXA 2X1IA 2VX7A 1UOKA 3BANA 3CL6A 2VZTA 2F2HA 2ATSA 3S5ZA 2WKGA 4RZ4A 4RV8A 1E6XM 3N18A 5AVHA 5DCEA 5JCLA 3EDFA 3SB0A 2ZZ0A 3HG2A 4O54A 3W1PA 2ISDA 4N42A 4GNJA 2XIQA 3LRMA 4AMAA 1G7VA 1LWIA 4JN8A 5JMUA 3BZGA 3K8LA 1NWTA 4U2YA 1ADSA 3WG6A 3H7VA 1AG1O 4OV9A 2D24A 2PWDA 1OYAA 2ONEA 5DRIA 3AC0A 3NGFA 5F2IA 2WVVB 3NXLA 3CAWA 3GTFA 4EWJA 5CGQA 3EX2A 3EXSA 4L9YA 1U1UA 2VGBA 3ARQA 1X7FA 1V6YA 5ENLA 1Q8JA 1GRBA 4KQNA 1AQFA 4DAFA 5A1AA 3TFCA 2F2KA 1YTKA 3TC7A 5G2IA 1PV8A 1I60A 2HK1A 3TEVA 3M6YA 4AG0A 3CAVA 4JPGA 2PC8A 1F73A 4ZVJA 3KFTA 1XFBA 3HF3A 4AXNA 3G1DA 1XHCA 3W3OA 1E51A 4HHLA 2QJNA 4QJ4B 4INFA 2W6RA 3EMCA 3TVAA 2YL8A 3AMDA 5C70A 3W2MA 2ON3A 5AYIA 1D3HA 2Z1XA 2EHHA 1AQMA 4XO7A 4YYFA 3EZ4A 1XC6A 2PUZA 3UYCA 4Z17A 2OEMA 1R3SA 3WNNA 4HVXA 1KQZA 5CPLA 3AUJA 1MFUA 1XLHA 3LGEA 5XIMA 4N4PA 5A2AA 3UNTA 1T6MA 2NVCA 1H11A 5T91A 4HJWA 1PX3A 4X60A 1XD0A 5CAKA 1S5TA 3CMFA 4A4AA 3SIMA 3IGXA 2FVMA 1I0BA 3TYBA 2Y1HA 1E0WA 2F9RA 1G94A 5MKGA 1DXFA 3LM3A 4XBJA 4YTQA 3LSCA 3L2IA 4M81A 2NX1A 3BW3A 3THDA 3O63A 4NZJA 2HS8A 2DUXA 2VL4A 5AC4A 1POKA 2TRSA 1O95A 5DFAA 3PC0A 2JEPA 3DHFA 2YDQA 1LT7A 6CGTA 2YVFA 4LYPA 3EOOA 2ZVIA 4Q22A 4Y6GA 3CZEA 2WPEA 4LNYA 4UNLA 1RVGA 4HU3A 3TK7A 2H3BA 1HJVA 2YPIA 4I9AA 5G2HA 2JEQA 3CWNA 4AF0A 4IUOA 3HW2A 1XYFA 2FTWA 1PUDA 4A3YA 4JFUA 4ADSA 2XYLA 1NOUA 3LTPA 3KDOA 4BA0A 1M1BA 4Q33A 2Q8ZA 1J8VA 5FS6A 3TOYA 2CZFA 3VOGA 4UOQA 4E2VA 3OPSA 5IOBA 1NDAA 1DTUA 3IANA 2PDMA 3V1PA 1VPXA 1H1NA 1RK5A 1XIGA 3URQA 1GRAA 3OBKA 3F4VA 1LORA 4M6PA 3QH2A 1JZ4A 4LC6A 1EH9A 1XCFA 2Y8VA 3WDRA 3GR7A 6A3HA 2NQ5A 1B57A 4BF7A 1U33A 2ASHA 2G3MA 2BVTA 4KESA 4K2SA 3DK8A 3ARZA 3VIHA 3M0KA 5LXEA 1Y8BA 2G0WA 4ZB2A 2PDQA 4LA1A 1DIKA 1MWOA 3B9OA 3R2GA 2J7HA 2Z4GA 2VRKA 4MZ8A 3TP4A 1KBJA 4H4VA 5HK4A 4JNMA 3A3WA 3K1GA 2GYIA 4HN8A 2QCCA 2VRJA 4IICA 3VTRA 3M4HA 3MA8A 3WUGA 2XG9A 1YTDA 4H8HA 3W1RA 3KLKA 1GKPA 4F9JA 5CC7A 2AQVA 1QPRA 1ZQ5A 1XC4A 1ZKQA 1P0BA 4DYKA 1XH1A 4NJKA 4AW7A 3GVRA 5CPTA 1EZ2A 1EWEA 1O68A 4MB5A 3IPWA 2JGYA 2JK6A 3IS4A 3LI1A 1WPCA 2FGBA 3WH6A 1G4TA 4HNUA 1FWHC 1BVNP 3SCVA 5AFDA 4CNOA 3AIRA 4AY8A 2Y85A 2WLZA 3G6LA 1E1EA 3W7HA 1TPFA 3NL5A 2Z2BA 4S38A 1Z9AA 4BQ4A 2HE8A 3P93A 4YYCA 3BC9A 1P6BA 2HS6A 1F2JA 4A22A 5D8ZA 1GSNA 1XYCA 3P74A 3S0CA 2J24A 1UWAA 4EMIA 1K6WA 3O8AA 1PHQA 2BHZA 4UTUA 1AW2A 3VO0A 1JG9A 1GOXA 2J9ZA 4JTDA 4RE2A 5BWAA 3GG8A 6TIMA 2WZTA 4C91A 1W1PA 1ZJBA 1C9DA 2NWSA 2QJIA 1GVYA 2I9EA 1IXQA 4AX7A 3VXGA 1HN1A 1D7FA 4GX8A 4P7LA 3WQ5A 2PDNA 3ELFA 1XG4A 1GVIA 1XUZA 1Q3NA 1N82A 2OSYA 1CDGA 4V27A 2I17A 3WX7A 1DP0A 1SFJA 5I2UA 3BW4A 4HPJA 1VF8A 1O1ZA 5DN1A 1ZPTA 4RK8A 2AL2A 1ONXA 4FALA 4EQWA 1SZFA 4LIIA 1UASA 3MY9A 1K02A 3TYUA 2NSXA 5E5CA 1E0XA 3MMWA 3PUEA 4CU7A 1V97A 3M7WA 3W2LA 1GOKA 2IPGA 1ITUA 1OGGA 3HJZA 3M0MA 3SAZA 1UBSA 4B5XA 5M5DA 2IPWA 3OYZA 1DVJA 3D0CA 3CYVA 1CBGA 4GO8A 3WD0A 3RJXA 4WGXA 4HGXA 3MUIA 5HA7A 3KTSA 4UTKA 3BLEA 4JQ2A 2O9RA 3C2OA 3DECA 4AUBA 1LLOA 2GRTA 2ZTKA 4Q4SA 1PYFA 4R5EA 2FHBA 4C6PA 1JOAA 1X1OA 3DGZA 2DGAA 2WVSA 4V33A 1HF6A 3LXBA 4Z2JA 1O5XA 4YNGA 3UR2A 1EL3A 3U2ZA 4B4HA 4PYSA 1MEWA 3NEHA 4H9MA 5DQPA 1A5OC 1LVLA 5LA1A 4QLKA 2HQAA 1QUMA 4TTGA 2C71A 4K68A 5HPOA 3DFTA 3R25A 2XH4A 3L23A 1ISYA 4O17A 2A21A 1V6TA 2OG9A 3VIKA 3UF9A 4L1WA 2P0IA 3O1NA 5K4ZA 2H9AB 2GJLA 2OKOA 1M5WA 5I7GA 5HNNA 2VQTA 4ERIA 3GTNA 1DOSA 4K8DA 4O13A 4ZGYA 1S5VA 3MUAA 1OC7A 1IYXA 1W32A 1Q6LA 4R85A 4LF1A 3L5AA 1ITCA 1TWSA 2VELA 3CAKA 3GFYA 1FXQA 2YZRA 3T40A 1ZLPA 1JEHA 1BVWA 4P5UA 4WJ8A 4BS0A 1AOGA 3TYEA 1RBOB 1NOWA 1LTDA 2EQ7A 2GR3A 2VZSA 3KVLA 4DRSA 4K6AA 3LB0A 4UCGA 1PIFA 3VCNA 3W82A 5BW6A 2OJPA 1XLMA 1ZMCA 2O9PA 3WF1A 4PRWA 4RNFA 5BOOA 3UCCA 4MWAB 4QE5A 3PG9A 4IL2A 4KGLA 1Q13A 4O28A 4I5UA 3LYEA 4AHOA 4DM1A 4UTFA 4O1CA 3E49A 4PUNA 2F38A 4JFTA 4RLIA 5DEZA 3P6LA 1IEQA 1UD8A 2UV8G 4ZTXA 3IJDA 3UA4A 1YXDA 3RYSA 5GNZA 1GGOA 2ATMA 4MAVA 4LS1A 1VKFA 1JDDA 2PE4A 4ZFMA 1KR0A 5HMDA 1QWKA 4BQ2A 3OC4A 2CETA 1RQBA 4K37A 4DEFA 4ZQRA 2GVLA 3UXAA 4HU8A 2PTWA 4KKXA 4LUSA 4B5NA 1DHKA 3PP7A 1PKYA 3FFSA 3QQWA 5CZKA 3RM8A 1EJRC 3E6EA 4J3TA 3WL0A 4OBTA 3WLKX 3MBDA 3MCNA 4POCA 2YA0A 3W23A 4XAGA 4ES4A 3KP0A 3L12A 4U31A 2W3ZA 2AKMA 3AO0A 1S2TA 3BDKA 5DBTA 3NPVA 1H3GA 3NQAA 3SGUA 3UETA 4IT1A 5TAOA 1VR6A 4CD4A 1WDWA 1EXBA 3EMZA 2V30A 5AYYA 3OBEA 4K36A 3V5CA 4XWUA 3W81A 5JH2A 5ECUA 3NVTA 4BWLA 4PTXA 4Q8PA 3RF9A 1VJZA 4NNCA 3WBWA 3VYLA 2A8XA 3STFA 3WLRA 4ACZB 3QV8A 1OF8A 2DQWA 1O12A 3ABZA 4LY4A 4FLRA 5LNRA 3RU8X 5KITA 1W1B1 2YIHA 5DF0A 1B9BA 4KS0A 3VKJA 5HQMA 4IQEA 1X6NA 4B5VA 3WLQA 8CGTA 3VI2A 1ICQA 5IHSA 5CGMA 3FXYA 2JF7A 4AB4A 1H4PA 4YVVA 1JDCA 2WM0A 3PG6A 1CGXA 4C5YA 4QAIA 4BFAA 1VBHA 1IZCA 5EBUA 3WQVA 2WLYA 2BXZA 4TVWA 1M01A 2OXNA 4CU6A 3ZXWA 2WNZA 4GZEA 4FLOA 4H2CA 1SJAA 4LUTA 1UA7A 3DFHA 3SN0A 1IZJA 3EWBX 3LUTA 3EEZA 3AJ7A 4LRSA 4TVUA 3O0HA 1H09A 1PWLA 4QISA 2EPKX 5LA2A 1MQQA 1ZXIC 3V5FA 4UQAA 1OADA 2WP6A 3APYA 1B4EA 3AMCA 5D2WA 2UWFA 4OKDA 4QROA 4HZMA 4QDMA 1E5NA 1GKQA 1JI1A 4XD3A 1W37A 1TPDA 3L4WA 3UPWA 3BVJA 4MADA 2Z0IA 1XBXA 4LCRA 5FSEC 5EBKA 1KLZA 2X16A 4EM3A 3W7DA 2OWWA 3M0XA 4CCCA 5LIYX 4BI7A 4P8UA 5B7ZA 1CX9A 1UP3A 2JGQA 5AVNA 2O7QA 2GSEA 1IV8A 1H0IA 4GCAA 1HT6A 4PMOA 2NUXA 1XGEA 2I5QA 4MMWA 3SCWA 1E6ZA 3O6AA 4PMNA 2PDLA 5JCKA 2VR2A 3FJNA 1H41A 4FNUA 3S9YA 5BOFA 1YNYA 1PZ1A 3FHQA 3RMEA 4ATLA 4DJFA 3ZJKA 4MY8A 4LXFA 2NQLA 3QOMA 1US2A 1RLCL 4Q7IA 2WOIA 2X8RA 2OFJA 2JIWA 4HSNA 4P7OA 1VD6A 1CLVA 4K7VA 4JYFA 5KETA 2ZRXA 3I65A 1F6YA 5C71A 2AGTA 4YWIA 1KC7A 1XIBA 3P60A 3T9PA 3HB9A 1E9LA 1F07A 2QUTA 1HGWA 3HFTA 1QNRA 4GI8A 1GJWA 5G1TA 3HGRA 2QCGA 4AWUA 1D7YA 1XLBA 2FPVA 1FOBA 3AIBA 3CV2A 3LRKA 2DORA 3DH9A 4ZR8A 4MNJA 4HP5A 4MVAA 2UY3A 3WD1A 1EF3A 3N2TA 4MAZA 1WZAA 3I4KA 5A2BA 1XI3A 3OO2A 1CNVA 1AD1A 1E0TA 2GVYA 2Z25A 3NQMA 2WMKA 4DBUA 2YB1A 4B16A 3OZMA 1Q2RA 4D8ZA 2DZBA 1C9WA 1IGSA 2FZ8A 2MANA 3S4TA 2J9YA 1NHSA 3W9ZA 5REQB 5BRPA 4JOMA 4LS0A 1BXNA 3W7MA 1J6OA 1FFUC 1DL3A 3LBMA 4GX9A 5CZJA 4Y8FA 1EEPA 5FI8A 5IDIA 3W1LA 1OWQA 1XLCA 3RRAA 3BAWA 1ZX9A 3CXOA 4S3CA 4N02A 1Q4WA 1UA3A 2KAUC 4OOUA 4O1EA 3VOJA 4X2RA 1KN0A 3PSVA 2CU0A 4R34A 3RO8A 4JTEA 4JTSA 3U4FA 2XSAA 5JVLA 1W5QA 3OVPA 4H4TA 1RPKA 4GGHA 4IM4A 3HQNA 1E71M 1OT2A 1R3TA 2PWEA 3QW3A 2C91A 2FIQA 2NUWA 3NFUA 3M6DA 1H6VA 1B54A 1UPMB 3VM5A 3PPGA 2DZAA 1REQB 4TQTA 1GESA 1A47A 1XYBA 4LBUA 5IM51 1J2WA 3GNRA 3KBMA 4JX4A 4ZCWA 4D1IA 1E6NA 1P1XA 2YVJA 3INPA 1R2TA 1R7AA 4IMDA 1H61A 2WZEA 3GTIA 4UTTC 4EKJA 4TX6A 3QXBA 4CN4A 1E55A 3WLTA 4C6NA 4EXQA 3LA4A 3ZIZA 3H26A 1DE6A 3G2GA 3LB8A 2TSYA 2CPUA 4LT9A 4E8DA 3KTXA 2V8ZA 3VD5A 4TV6A 3NVWB 5LKYA 4A3QA 5E6ZA 4MKVA 4UFHA 2RABA 5A94A 1XIHA 1YPFA 5T26A 3GTXA 2ODOA 3TR9A 1TPH1 3UJ2A 4UIOA 3UG4A 3GXFA 3FNDA 2Y63A 4NIRA 1UR2A 3LZ5A 3SCQA 1E6QM 3WDQA 4PB5A 3H4XA 3WF0A 3MTWA 5EMUA 1YYAA 1IT7A 3QTPA 4H2HA 1JYXA 3GXTA 3H4KA 2XZ9A 4QCFA 2VX6A 5FOOA 2AOSA 1XUUA 2A7NA 4ZFCA 5C9XA 3O15A 1GJPA 2GVEA 5GPRA 5CLWA 1E1CA 1TZZA 2WNNA 4QR6A 1P6WA 3KRSA 3II1A 2ZX6A 3IJQA 3GS6A 3FKKA 5JRBA 1B9ZA 2J7EA 3MMDA 3RNDA 4CEXC 2V2DA 2VDGA 2Q02A 3G77A 1LRQA 3E5PA 4PCPA 4RUBA 5CPMA 2R1MA 1JZ3A 3V36A 4MLJA 3WMBA 2VR4A 1OHLA 1V6XA 2X0YA 3S1VA 5LHFA 3NM3A 2AQWA 4S3GA 2Y5SA 1GRFA 3WQ6A 1T3QC 1XDIA 1UR4A 3L0NA 3T44A 2EQ8A 2HNHA 5A8GA 2OLAA 3RU6A 2ALRA 4FNSA 3SJ3A 4QLLA 1LUCA 3K8MA 4QNEA 4IMCA 2BSLA 4Z2IA 2QNEA 5HR6A 2W54A 2WKLA 4OUIA 3IEBA 1C8QA 3TJIA 2YQUA 1J01A 3C0LA 3TTEA 3ITVA 2HE5A 3W7QA 2QCFA 2WKJA 1RJPA 3QQ1A 3OQEA 2PSNA 1YQZA 4OJYA 2ZTJA 2POZA 4H6KA 1JJKA 1LQ2A 3N6QA 1A80A 2IPFA 3SRHA 5EL1A 3V5OA 4F9DA 4IPIA 1S46A 3RJYA 3W83A 4OWGA 2W3SA 2VQUA 3HQOA 3SFWA 1X38A 1TR1A 5M3WA 2X8HA 1PAMA 2YXXA 2NPXA 4PMVA 1V3IA 3KHDA 3BK0A 2P8CA 1S7MA 2Z6JA 2IXVA 3LPGA 4LV9A 1XGZA 5CPNA 5C9UA 3G24A 1ZBVA 3P5ZA 3RX3A 4DM2A 1HIZA 1GYLA 1WE5A 3GFXA 3W4RA 3RILA 1FIQB 2Z7KA 3TA9A 3VE7A 4L4LA 1Z42A 2OCZA 3NSNA 2BC1A 2YCEA 4S1FA 2GDUA 7TIMA 1F3WA 1P48A 4BY3A 2TODA 1NM9A 2TYSA 2YA1A 2QVHA 3EWXA 1SW0A 4UTWC 3WLSA 3BCDA 1RR2A 3TQ0A 2VFIA 3AN1A 4HKPA 3THAA 3R43A 1PXGA 3MW7A 1GETA 3VZZA 4G7EA 5C9ZA 1TIWA 2VO5A 4L56A 4HMCA 2OU4A 5C5YA 4NJHA 2BDQA 4C6CA 1GVSA 5FKYA 3PAOA 3A7AA 1AJ2A 1TTPA 1YEYA 3MCOA 4GGBA 1H7RA 4X2PA 4GQGA 4YHGA 3CNYA 4YTRA 2A3AA 1IIHA 5IXEA 3UZXA 1LCOA 1A3WA 1XD1A 4TX9A 4LAOA 2IKIA 3UPBA 3CGTA 4Q4PA 1K8YA 2J6XA 3VOHA 2XH7A 3LHTA 3QGVA 2REQA 2VC6A 4CQBA 1UR9A 1F3EA 4R7JA 3TN5A 4L6HA 3FX4A 1A0DA 4PEEA 3PBVA 3NL3A 3TC3A 5D09A 3WLIA 4N9CA 3TAKA 5BXPA 3L9CA 3AU2A 3L67A 1I1WA 2CLIA 5LIXX 3UJEA 3TW6A 1YW1A 1EXPA 4FXRA 1UWTA 3U57A 3I7RA 4H01A 2QUVA 1KFKA 1UH3A 2JFEX 3D6NA 1U30A 2Q3RA 4NJJA 3LHWA 2D69A 2ZUTA 4O0KA 3EA3A 3NVZB 1FKXA 4GIEA 1EB3A 3W70A 1DORA 5MKGB 2PPGA 2NX9A 2V3DA 4O1AA 3ZR6A 4PB4A 4EXAA 3AXHA 4AFYA 3RDKA 1STZA 3DJGX 5D9NA 4CD6A 1ODUA 1WB0A 2A6NA 3WO8A 2D2JA 4PTDA 1P6CA 1DE5A 2DY3A 2ZIDA 2G3FA 2QF7A 2B7OA 1JUKA 3B9EA 2EBNA 1GHRA 3SJNA 3WZ0E 1W0MA 3BMWA 4AAJA 1LOSA 2QCLA 1RAKA 1H7WA 3A13A 4AF0B 3EKLA 1TPC1 4PL1A 2E7FA 5I03A 2X8CA 2WB5A 4D6IA 1FWIC 3VUSA 1VS1A 2OO6A 3UR5A 1NP2A 4WKHA 4NUWA 3NYZA 5BXTA 1TQXA 4CKQA 1WAUA 3TN4A 4D71A 2QGYA 3OP2A 4WZHA 1KM6A 4JTJA 5CH9A 3QFAA 2Y4SA 1CXKA 2P88A 1DYSA 2NVKX 1LRNA 4GVGA 2VKZG 2OT1A 1Y7VA 3F4NA 3W00A 3S2CA 1VFHA 1VFUA 2RAGA 1F8IA 5HMSA 3N9KA 1R9ZA 5K9DA 2P8BA 3DI0A 1EA0A 1QTWA 2ZXDA 1VBUA 4Q3MA 3BMXA 5HANA 1FWAC 4M19A 1BHGA 1W6TA 1R3WA 3MB9A 1UWQA 2VEKA 2V69A 3W7LA 2HTMA 3CXBA 4QHRA 4W7UA 1OEPA 3E2VA 3AICA 1B31A 3HMCA 2DSWA 3RUBL 2WBAA 3G1XA 4ASTA 2RGLA 3I4EA 4GBUA 4AMCA 2V3GA 5DCDA 4PSPA 3VNDA 9XIAA 3CUFA 2PCEA 2FJKA 3DXIA 4CCEA 3VDAA 1Z41A 1GJUA 3CIVA 5BMXA 4GNKB 1ZTVA 3VMNA 3VDGA 4GYJA 3B40A 4ZXOA 2C1HA 5ABEA 4LGXA 3COTA 3VK5A 3PTQA 3BAYA 3QHNA 1EO7A 1ZDLA 5BCAA 1TVNA 4RDVA 2C16A 1L6FA 1A0EA 2DP3A 4DNHA 5G5HB 3KS5A 3VNYA 5TR3A 3TUUA 4N7QA 4B5WA 2FZ9A 1MDRA 4Q8OA 3PUOA 1TKKA 3BTNA 4A05A 2WJDA 3A21A 4EAMA 3G8RA 1U22A 3BV7A 4AWTA 3PNZA 3AOFA 4PODA 3WF3A 2AL2B 1E3ZA 4IP5A 3A64A 1HGYA 3BG9A 3MYOA 2OGJA 3WBXA 1NDZA 1QHOA 1Z89A 5CBIA 2NV9A 4WDUA 5IRPA 3HJEA 3AXMA 3NDZA 1OZQA 2ZUWA 2OZ0A 4XTIA 3USBA 5AECA 3W1AA 1ZK7A 4W5ZA 1BZLA 3OA5A 3OTRA 4N4QA 3TQPA 4W8BA 1M65A 3E1F1 3IRDA 5E6YA 4ZOCA 3QEZA 1CENA 3AHVA 2BOEX 2QUMA 4EE9A 2WC4A 1EBDA 2X1RA 4XISA 4XAYA 4AD5A 3GLCA 4RPPA 1XBZA 2WHJA 4U33A 1XG3A 4LB3A 4LW7A 1WUFA 2CFFA 4GXPA 1NEYA 3IC9A 2QIWA 4XTDA 3SO7A 3N13A 1D2KA 2V67A 4EQSA 3WD4A 2DZUA 3LXAA 1NP0A 3TTYA 3BUVA 3QYSA 5J04A 4V15A 2P10A 2Z2UA 3KOWA 4FNRA 4S2CA 2B7QA 4PTWA 1ALDA 1KRBC 1RLDA 5BROA 1DXIA 1QT1A 1P5BA 4KETA 4CQCA 2OYKA 1XLJA 4QJ3B 3WQOA 1JR1A 2DVTA 3H70A 3UZWA 4AC7C 3CUIA 3Q94A 4NNBA 3GNXA 5I77A 4CCZA 5DXXA 3FCPA 3ORWA 4WX2A 1LWHA 3CGDA 3HV9A 3H2FA 3GDBA 4ROQA 4H7CA 1R2RA 4RW5A 4WEVX 5ABFA 2V2HA 2PWGA 3BMVA 5A95A 4C1NA 1OFBA 3SUWA 1JRCA 3USZA 2C19A 1GRGA 5A6SA 1RSCA 3LPFA 3UP8A 3CUHA 1C8VA 3N73A 1RALA 2CWNA 1GT8A 2BOFX 3W84A 1X39A 3RPTA 3FGCA 3E3HA 3B8DA 5C7HA 3BO9A 5B7YA 4ZODA 1SO3A 4ZL1A 1ISVA 1QI5A 4PTMA 1JCLA 3PZQA 3PULA 3JR2A 3NPWA 1PCKA 5AZ1A 5BOEA 2YA2A 5SWUA 3IGUA 1SZRA 4PBEA 2D0HA 4HNLA 2Y62A 2O9TA 4BJHA 5H2ZA 4IP4A 3QV9A 3UESA 5ABHA 4R3UA 2GGHA 1RK6A 2CCRA 3N2BA 1ME9A 1L8PA 1XKJA 2VX4A 1L6GA 2X0HA 1YBQA 3OZPA 3ALGA 1UJPA 4F2UA 2ICSA 3LDVA 3EANA 3A6OA 3SSJA 2YGYA 2E77A 5EU9A 1SMAA 1TV5A 4LUSB 4WUIA 1TJRA 3TXVA 2PWFA 1UUOA 4RDYA 4AEOA 2HISA 3CBWA 3W75A 1GOOA 4IIFA 4H4IA 5EMMA 5FS7A 5DMNA 3AZSA 1J12A 1FCBA 1VP5A 3G8EA 4AZ6A 4H4ZA 1ELSA 5DMLA 3WH7A 4K8EA 3EWCA 3TJXA 1SR0A 4IWWA 4E4UA 1WDPA 3HQ1A 2R1LA 4IXXA 1M7JA 2PS2A 3AIUA 3O05A 4MWAC 5FAGA 3M0LA 4G1KA 4MLRA 2PRMA 4HCDA 1OGBA 4OIFA 3WK0A 3BE7A 1A0CA 2QV4A 4DO5A 1US0A 2ZDRA 4E2OA 1JNEA 1B0IA 5D37A 4HYRA 2VX5A 2ESCA 3DFOA 3G5EA 1NWUA 1AJZA 5BYWA 2BTMA 2DSZA 1X1NA 2NQ9A 3SQPA 5D03A 1JZ6A 3WLJA 1W3KA 2DQXA 3HM7A 2CHOA 4EF9A 1VRXA 3HV8A 2UZ9A 3QMRA 3FJ6A 3QN3A 1G69A 4JL2A 4M6VA 2PLCA 4XIMA 4D72A 3Q67A 5ECVA 1TTQA 1C92A 1EUAA 2J6VA 5IBXC 3WUFA 1KTNA 4EPKA 3K30A 2VTFA 3GB6A 3DBNA 3LZ3A 4B2DD 4CD5A 3ZOAA 4L5ZA 5M1TA 1HJXA 5DRCA 4LUTB 4F0RA 1F8MA 3PB2A 2OEJA 1TV7A 3AWNA 1X8FA 1JFXA 1UD6A 2FPTA 3W7PA 2PTXA 5A6JA 1TWZA 3WJXA 2DZXA 4LCSA 5CG7A 3KZPA 2BNJA 2PU0A 1JL8A 3EYPA 3IJIA 1M7PA 4LUIA 1EC7A 4D6FA 1WKEA 3AQUA 4UMBA 4DLMA 2PP0A 3K4AA 5FEZA 5KVIA 4PH6A 4CNUA 1OD0A 4GMEA 4WIWA 2CZ5A 4QDPA 3J7HA 1HO1A 2R9RA 4YN5A 4JQ4A 1T99A 5FD0A 1FWJC 3W2JA 1E5JA 1H50A 1JYVA 1TWIA 3LU2A 4AX6A 2WP5A 3BJTA 3F4DA 3T0BA 1EP3A 3OGVA 3U5UA 2GK1A 2ZVRA 1N5WC 4B2DA 3SRKA 1YHTA 3GC4A 2WOWA 3VDCA 5T9CE 2OYMA 2Y6ZA 1YNQA 3RAOA 4O0QA 4RNIA 4GQRA 5E1QA 2PDJA 2QIIA 4JTIA 3O0KA 4D6GA 1F6KA 4MF4A 4ZB0A 1A49A 4N2YA 3UQNA 3G0XA 1FWEC 5FF0A 1CXLA 5CSSA 5AYXA 4J35A 3LHVA 2OSWA 2GQ8A 4TMBA 2QR6A 1ZY9A 4QFUA 2NT0A 2RUSA 1IEIA 1POJA 2GSHA 5CC6A 4Q4QA 4JFSA 1BWLA 4MY1A 4KFPA 3UWEA 2RH9A 5TIMA 1XGDA 3QYQA 5CBBA 1W5MA 3HN3A 3PB0A 1BYDA 1J11A 5J8LA 4H4QA 5U7SA 1UW9A 3PR2A 3U5YA 3PJXA 4HK7A 1IR2A 4P7RA 2F7FA 4Q4OA 5G1YA 3M9YA 1OVDA 5AKQA 4DNAA 3VILA 1V8EA 1MRAA 1Q6GA 3KBSA 5G1MA 3B8IA 4RZ5A 4H4SA 3ARUA 4CGTA 3DK4A 4FR6A 4K8GA 4B15A 2QDEA 1XWYA 5EGRA 3NSXA 4FXSA 1J93A 1Q65A 2BXYA 5DMMA 1X8CA 2RDXA 4PR4A 4HHMA 4UR7A 3GYCA 2WM1A 1ZUAX 1O6IA 3QFBA 4KRUA 3ZS4A 1V02A 3OVQA 5K2ZA 2ISFA 1E9YB 4A3UA 3EOEA 3K8KA 5ER0A 3AAMA 3QZAA 2FTPA 1W91A 2QHAA 4GA8A 2QV5A 3V0UA 1TPVA 3EX1A 4AD1A 3V0TA 3LADA 5JBFA 4GFSA 1OGSA 5H6HA 3CV7A 5LYRA 3EPMA 1UHVA 4WOQA 3GY1A 3QR1A 5A8QA 3ZVIA 4IQJA 2PRLA 9RUBA 2A0NA 3I6RA 2Y8KA 1JROA 3NCOA 2DDXA 3CMJA 1YTEA 4GKTA 2VGGA 4PSRA 2J75A 4JKKA 3PVFA 4J2PA 1HQTA 1P0KA 3DGRA 4QIUA 1BRLA 1GQLA 1Z48A 4W87A 3LEPA 4X61A 1KM4A 2EKGA 1U1HA 4IOTA 3DYPA 3ZMRA 4L4OA 3K5XA 2VEPA 2FVKA 3P62A 3TNBA 3MP4A 1GZGA 2GL5A 4AY7A 4GACA 2PMQA 4NYUA 2P0OA 4JR5A 3NVVB 1HX0A 3ALFA 1NDVA 3VKKA 3SW6A 4NKCA 1DNCA 3T2PA 1S5NA 1UBPC 1W1YA 4FB7A 3MS8A 3SUUA 2OMAA 3CQHA 2VC5A 3BAKA 1MUWA 1W1VA 4E8CA 4DAIA 3WFZA 2AAQA 4UNIA 3GTHA 1J0YA 3NYDA 4XX6A 3AWOA 3QMSA 5A8PA 4JDYA 4K1WA 2GVJA 4O4VA 1IEXA 3BLOA 3VINA 4F40A 4XKMA 2G37A 4AC1X 3GH5A 2O0TA 1V0NA 1MUCA 1U5VA 4JDRA 1ZP3A 4I5RA 3GHRA 1R8LA 1R30A 1DJXA 2PLMA 1UYQA 5F1UA 1UZ4A 2A1YA 3ITTA 4CNTA 3F2DA 4Q6XA 5C9RA 2HSAA 4UR8A 3FN9A 2QPUA 3MKCA 5I78A 4TMCA 2G3NA 4GYPC 2P1FA 1KXTA 3UPMA 3M5YA 1EC9A 3UYIA 1E1CB 1O7AA 5HPCA 1RJQA 3OVGA 4DI8A 2XINA 3H22A 4MFEA 4MWAD 2IKHA 3AFBA 3DCPA 1PSCA 3GH7A 3QOKA 3ITOA 3N12A 3A9IA 1I6NA 3VIIA 3W24A 5K9CA 2G97A 3LGGA 3L4UA 3CWOX 1FQ0A 1R86A 4ILSA 5K4XA 4WOZA 3IV8A 2VT0A 1QNSA 3C2RA 3N9SA 4H6QA 1U1JA 3B03A 3CH0A 2VENA 3VU2A 3OOQA 1YQ2A 4PMZA 4HMDA 1FY6A 3E02A 5AC6A 5H91A 4A8NA 2TPRA 3KVJA 3EB3A 3CUJA 1OIMA 1QK2A 2X2YA 3VFCA 3PS7A 2VURA 5JBEA 1LUCB 1EIXA 5EA9A 2WMGA 1T0OA 5D30A 2EJ1A 4HNOA 4QTGA 1SFSA 4JIHA 4WR3A 1YXCA 4IGSA 4X22A 3AS2A 3SQMA 4PB3A 3PZNA 3N15A 1UMYA 1SU5A 1ONFA 3CO4A 3EWUA 3C0JA 3ANYA 2WCSA 3C61A 4AIOA 2ZRWA