3QPEA

Crystal structure of galacturonate dehydratase from geobacillus sp. complexed with d-galacturonate and 5-keto-4-deoxy-d-galacturonate
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
385
structure length
385
Chain Sequence
LNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Galacturonate Dehydratase from GEOBACILLUS SP. complexed with D-Galacturonate and 5-keto-4-deoxy-D-Galacturonate
rcsb
source organism Paenibacillus sp.
molecule tags Metal binding protein
molecule keywords Mandelate racemase/muconate lactonizing protein
total genus 134
structure length 385
sequence length 385
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3qpeA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3qpeA01
2PU0A 3DEQA 3QLDA 3V5CA 4J1OA 7ENLA 2OZTA 4MKSA 3TCSA 4IP5A 3GO2A 3MY9A 1EC9A 3GC2A 4GGHA 2ZADA 4DYEA 3OTRA 3OP2A 3DG6A 3FYYA 1KCZA 2OFJA 4GYPC 3P0WA 3EEZA 2PP1A 3K1GA 3P3BA 2I5QA 3Q45A 4A35A 3U9IA 2QJNA 2XH4A 1FHUA 4X2PA 1EBHA 3R25A 3UJEA 3PK7A 3D46A 3NXLA 2GSHA 2FKPA 3RITA 3RRAA 3IK4A 2AKMA 4HCHA 2AL2B 2OQYA 4ZCWA 2PP3A 3MZNA 3SN1A 3T8QA 3OW1A 3UXLA 4DHGA 2OQHA 3UXKA 2OKTA 1NELA 2NQLA 1FHVA 4Z17A 4FP1A 4F4RA 3QPEA 3U4FA 2PTXA 4KT2A 5BOEA 3S47A 4HYRA 3DG7A 4Z1YA 3TWAA 3H12A 1MRAA 2PTZA 2GDQA 3THUA 2GGEA 2PTWA 2XGZA 3CAWA 1YEYA 3FCPA 3VCCA 3N6JA 4H2HA 1XPYA 3R10A 3NFUA 3D47A 3TW9A 2AKZA 1P48A 2OPJA 3FXGA 5J04A 3ZVHA 3TJ4A 4DXKA 3MKCA 4DWDA 1KKRA 3PWGA 3P93A 3N4FA 3I4KA 2PGWA 4G8TA 4ZA0A 3HPFA 3RGTA 1KKOA 1F9CA 3CK5A 3CB3A 2P8BA 3DG3A 3R11A 3VC5A 3BJSA 4HCLA 2P8CA 2PSNA 2XH2A 3FV9A 2POZA 3I6TA 3N6HA 2P3ZA 3H7VA 1TE6A 2QJMA 2O56A 4GGBA 2ZC8A 2HZGA 2ONEA 2CHRA 3DFHA 4GIRA 3TJIA 4GFIA 4A3RA 3NO1A 2AL1A 1TKKA 1JPMA 4J3ZA 3N4EA 3QTPA 3TOYA 2QDDA 1ONEA 3JW7A 4MGGA 1P43A 4IP4A 1MDRA 3H8AA 4K1WA 3ES7A 5FJOA 3SBFA 4M6UA 4E6MA 5FJRA 1R6WA 4MMWA 3STPA 2PTYA 3VA8A 3DDMA 1PDYA 2FYMA 3UJFA 3I6EA 3FJ4A 1DTNA 4E4UA 4JN8A 3SSZA 2MUCA 4GMEA 4IT1A 1TZZA 3ENLA 2OO6A 3JZUA 3CXOA 5BOFA 3RCYA 2PCEA 3ZVHB 1XS2A 3DGBA 1EC7A 1R0MA 1SJAA 1BKHA 3ZLFA 4FI4A 3OZYA 3VFCA 2OX4A 5IDZA 1SJCA 5FJUA 4M0XA 3UJRA 3R0KA 4E4FA 1MUCA 3OZMA 4E8GA 2OG9A 3DERA 2PP0A 2GGIA 2AL2A 2GGGA 4H19A 3B97A 4H83A 3GY1A 3T6CA 2PGEA 4K8GA 3NZGA 3IJQA 3DIPA 3SN0A 3KUMA 3PWIA 3DFYA 4EWJA 3R0UA 4K2SA 4ROPA 1MNSA 5FJPA 1W6TA 2PODA 3VC6A 5EU9A 3UCDA 3TQPA 3UGVA 3ZVIA 4KEMA 1EBGA 1EC8A 6ENLA 3RR1A 4IZGA 3UCCA 5ENLA 4YWSA 1IYXA 4A6GA 2GGJA 3QKEA 3T4WA 2QJJA 3S5SA 3IJIA 2OLAA 3ZLGA 2QDEA 2PPGA 1PDZA 2HXTA 2XH0A 4JN7A 2HNEA 4H1ZA 3VCNA 3T9PA 2DW7A 1WUFA 3DESA 3ZLHA 3CYJA 3Q4DA 1ELSA 3V5FA 3QN3A 3SN4A 1JDFA 3ES8A 3SJNA 4JHMA 3TWBA 3JVAA 1KD0A 3GD6A 5FJTA 2QGYA 1L8PA 3MQTA 2OZ8A 4KWSA 2PU1A 2GGHA 2PMQA 3MWCA 3EKGA 2HXUA 3BOXA 4ENLA 4HNCA 3PFRA 3MUCA 1NU5A 2OVLA 3V4BA 1JCTA 2PS2A 1ECQA 2OZ3A 2MNRA 1MDLA 1JPDX 2PA6A 2RDXA 1BQGA 2QQ6A 3UJSA 2XH7A 1RVKA 3FVDA 4IL2A 2P0IA 3VDGA 2QVHA 4IHCA 4HNLA 4KPLA 4GISA 3CT2A 3IJLA 1E9IA 4IL0A 1SJBA 3H70A 4GYPA 3RO6A 4HCDA 3MSYA 2P88A 3TTEA 1OEPA 2GL5A 1WUEA 4HPNA 3V3WA 3BSMA 3OPSA 1SJDA 4DX3A 2XSXA 4HN8A 3UJ2A 4G7FA 2DW6A 4E5TA 3R1ZA 4DN1A 3SQSA
chains in the Genus database with same CATH superfamily
4JIRA 3QLDA 4J1OA 3TCSA 5A2CA 3PSWA 5BMXA 2ZC1A 3OP2A 2EKGA 5ABHA 2QCLA 4GCAA 4U10A 2V81A 4ERIA 4OOZA 3GKAA 1JNEA 1JUBA 2POTA 3CPGA 4IIHA 4LOCA 3CB8A 1CENA 1IEIA 2GVYA 4LYQA 4PYSA 4C6EA 2G3FA 3VDHA 4S3AA 4LUTA 4F3HA 4PCPA 5HWJA 3EB3A 4O0KA 1NOUA 4PBEA 3OG2A 2Y1HA 4C6PA 1HN1A 3W7OA 1QT1A 4ZCWA 3GIYA 1AMYA 4IG2B 3VKJA 3BV7A 2QHAA 3T8QA 4DO6A 3UXLA 1LQAA 3O0KA 3NOEA 4US5A 2Y88A 4GQRA 3IGXA 4L64A 2A2IA 4A3YA 2PWEA 1HGYA 1OCQA 4CQCA 1Q7MA 3ME3A 4NYYA 3PJUA 1GK8A 5I7GA 4LIIA 4MM1A 2QIWA 4LUIA 4UTKA 2E68A 1TTJA 2HBXA 4AD2A 4L9XA 2PWDA 4UTWC 1LQ0A 5IDIA 2GWNA 4POCA 2WVVA 2FHCA 2XVKA 1D7KA 2V3BA 3FVMA 2PLJA 3W7IA 4U5IA 3JR2A 3UD6A 2WWCA 1J0IA 1D7FA 3W81A 3VINA 2Y7GA 3IIXA 3B9DA 3EOOA 1RCOB 1OIFA 2VVSA 4OIFA 1K9FA 3NO5A 1PCKA 3P93A 2C1GA 4P5UA 3T78A 1I2RA 2YBUA 1UMLA 3LRMA 1B3VA 4GVIA 4H6EA 2ZZBA 3AIVA 1XYCA 2HVNA 1DXIA 2V2HA 3LPPA 1XINA 2XVNA 3L4WA 2NQJA 1TX2A 3NPVA 1RQHA 2WZIA 3QR0A 2P3ZA 5CXPA 1V0NA 1ZY9A 2EHHA 3RM4A 1UWTA 2QJMA 1E3ZA 3W1LA 3HG2A 3F4WA 3AYVA 3TMLA 4EF8A 3CS2A 4O14A 1GOQA 4RZBA 1FDJA 5GRTA 1UD6A 4QIUA 4DXVA 3GU1A 1CLXA 1F8WA 5CPSA 1VHNA 5EL1A 2A79A 3H8AA 3GRSA 1A49A 1DVJA 1UBPC 1FEAA 1IXNA 2IW0A 1G69A 1CX9A 1ICPA 1BXNA 3CWNA 4EQWA 2J25A 3W3OA 1TYPA 3AQUA 5CJNA 4APNA 4BEQA 1DJGA 2QAFA 4PSPA 3PUEA 3WJZA 3SSZA 5F1VA 2OEKA 3W7GA 1B2YA 1YE6A 2WZEA 4G5DA 3GZAA 3A7UA 5A2AA 1UBSA 1WZLA 1R2TA 1QBBA 2ZVRA 2X8CA 5G5GB 1E6QM 1C7TA 5A8PA 3VZZA 2D22A 3GDRA 1CGUA 4HBKA 2QMKA 1NHRA 1T6MA 2R1LA 3K4DA 3QFWA 1V3IA 1W2VA 3ISIX 3RFAA 4O1CA 4I7VA 3WQVA 2C14A 4F48A 5A6AA 1J18A 2X1SA 3CUFA 3R43A 1L6WA 1Q4WA 4K8DA 5K9XA 2Y7DA 4RXGA 5DXYA 2ZDRA 1OFOA 4HK7A 1S2VA 1TV4A 3HTWA 1RBLA 1QK2A 2GLKA 1E73M 3IPWA 1PYMA 1LT7A 3OJGA 2GJNA 1P7TA 2REQA 3G0SA 3HRDC 2FGLA 4IMEA 4LQ1A 3AIBA 3W7CA 1EJRC 3GZ3A 4P8VA 5M03A 1KO0A 5GJMA 2X7VA 3RX4A 1FTXA 3N2BA 4Z0SA 4ATLA 1OK4A 2BMBA 3T0DA 4PMRA 1XLDA 3ZLGA 4XKMA 2J13A 3HU7A 3I3DA 1AD1A 3PB0A 4TVDA 1P0DA 1J4EA 4JN7A 2XISA 4BCEA 1JZ3A 1I75A 1VYPX 2YLLA 3ZMRA 2ZKMX 5AHIA 3UPWA 1C8XA 3WK0A 5EGRA 1X6UA 4UFLA 1B5TA 4FXJA 3MHUA 3V5FA 1OD0A 3SSJA 1ISZA 1KGWA 4DAIA 1D3GA 2ESCA 3A9BA 1KD0A 2ACSA 1V79A 1A0DA 1QNPA 1KFKA 2OZ8A 3M4HA 3CTLA 2PU1A 5AYYA 1B3WA 3O1NA 5DQPA 2IPGA 3BPWA 2VZTA 3W37A 2C71A 1L6SA 3CUZA 4JTJA 4TTUA 4C91A 5AYXA 1SSDA 2BXVA 1XIMA 3I10A 2A3BA 4BEUA 2CLIA 3EOEA 4QNEA 4XAFA 4EIVA 4B2DD 2X8HA 1KV8A 3E2SA 3DC0A 2OSWA 1KM4A 1F5ZA 1RQBA 1W5PA 2XH7A 3DFOA 3FVDA 4IIGA 1H62A 2PCQA 1MSSA 3R5EA 2X99A 1L2UA 4GZIA 2VZUA 3U5YA 4R7OA 1UW9A 2D1ZA 1JYXA 3LTPA 4U33A 4S3GA 2Y7EA 5DX7A 3GW0A 4GISA 3WD4A 3CT2A 4DI9A 1E9IA 3AOFA 4NAFB 3KEHA 3UG4A 3WH8A 4C1LA 1ZNNA 5LNRA 1KM2A 3ARWA 2XIMA 2RJHA 4JEJA 3N12A 4E0CA 4KWUA 4Y7EA 2X30A 4PMXA 3VDBA 1I1WA 4G7FA 1ZCOA 4G56A 2P76A 3LERA 3V5CA 1FQ0A 3SZ8A 2E6FA 4HPJA 1AJZA 5DANA 1BEUA 1FXQA 2E1WA 1NPXA 2ZADA 4Z2HA 3SADA 1XLIA 3KVJA 1XRFA 4E3TA 3BAXA 1V7YA 3ORWA 3G18A 4QQUA 2WNWA 4IXXA 2WBGA 3SCOA 2J6XA 4QLJA 5MHBA 5ABEA 1Q85A 4JNMA 2OB3A 4AZHA 1A5LC 5D4YA 4WDWA 2C91A 2AOSA 1P6CA 2ZXBA 2WYSA 2YCLA 5AVNA 1TWIA 3KLKA 3CO8A 3PTKA 3S1WA 2QUMA 1Q2RA 1FHVA 1PS9A 4UQCA 4GH1A 3DFTA 4BKNA 2EQDA 1QTWA 5I3KA 2ZUMA 4KKXA 3SUUA 1LDCA 2XGIA 1GT8A 2C8NA 4MWAC 4FEZA 1WDPA 2W63A 1WZKA 2IXUA 4HP5A 2XGZA 3B03A 4WDXA 1G67A 3UNDA 1TYTA 1K4HA 3LHTA 2XFYA 4INFA 4JZ5A 4H9TA 1E4MM 3BE7A 1B1YA 5KINA 2J88A 3PPFA 4PFMA 3RR4A 2BODX 4DUXA 1UQZA 1LP6A 2YXGA 2Y63A 2HNHA 4XIAA 1B90A 4O50A 2VRJA 2C1HA 2J9ZA 3IRSA 2DZSA 3H2OA 4REQB 3DGRA 4L56A 4AZ7A 4DUVA 2FZ9A 3PZQA 3HPZA 2VP8A 4LGXA 3TCEA 1O5KA 2F2KA 2DT1A 4P7RA 2BGQA 3M0XA 4GQBA 4MF4A 3M6DA 3ITOA 4DELA 3E0IA 3GIPA 4PB3A 4HHHA 4HT3A 3A12A 4B2DA 3C8FA 3WUEA 4LRSA 4ACZB 1K70A 4TR9A 3LX9A 3BOFA 5LNSA 4TUFA 3NQVA 4AEOA 4WLCA 1MI3A 3H7VA 1TE6A 2E8ZA 1S2AA 4GI6A 4O8RA 3PM6A 3DFHA 1BXCA 5JH1A 3MKVA 3S1VA 3NO1A 2Q3RA 1CECA 2GJXA 3S8HA 1HX0A 4JNYA 2CLKA 3NL3A 2AGKA 1PWLA 3VK5A 4M7TA 3GRIA 5DY2A 4GNJA 1UZ1A 4FX7A 4K1WA 3VOCA 4RKAA 1XLMA 4ALDA 1F3TA 2C15A 1GKQA 4REQA 1STZA 3WMBA 3EWUA 4MNJA 3APYA 4HK6A 4S2CA 3TAOA 3A3XA 3H7UA 1UR0A 4DPPA 1FCBA 2OWCA 1NVMA 1PDYA 2DJXA 3QGAC 1VD6A 4KFNA 2OX1A 2CCRA 3CMGA 1LCOA 3FYPA 3QC3A 1Y8BA 4HPXA 1EEPA 5A8QA 4KWOA 4ERAA 1OFBA 3WUBA 2GSEA 8XIAA 4F66A 3DYMA 3NZPA 2GPTA 3CEUA 3DI1A 3R0DA 4PBFA 4YN5A 4XTDA 1RV8A 3LGDA 4O4VA 3S1XA 2UWFA 3PG6A 4ZO9A 3DK4A 3KRBA 4WSHA 1LWJA 1VFLA 4EOUA 3KRUA 3L0GA 1LLZA 5LNWA 1X96A 1S5MA 3KOYA 1SO4A 1D9EA 3IVTA 1ZX9A 4H8VA 3DFYA 1Q6LA 4HNNA 3F5LA 1HJSA 3EWYA 2BASA 4JHZA 3H26A 3ZJ8A 1AMKA 2YR1A 4TMCA 3GG0A 3MW7A 2IUZA 3PBGA 3BCFA 4CNUA 1PE1A 3ARRA 1RJRA 1YDNA 1GVOA 1R87A 2QV4A 2Z1WA 4RZ6A 4S38A 1W8GA 3BMVA 3FW6A 4LJ3A 4IZGA 1GEUA 2PWFA 1TQXA 1AA1B 2Z6JA 4P7OA 3W82A 3FK4A 3MC5A 1B57A 3S5SA 2HEJA 4AEEA 4NG3A 1VDVA 3DK9A 4PFHA 2QDEA 4IMAA 2HXTA 2YOCA 4HZ6A 5H6HA 4DQWA 3MMUA 1WDSA 2GR2A 2W54A 1AH4A 1SFJA 4QP0A 1K77A 2XSAA 2JF7A 1WKFA 4GIAA 1JCJA 4I8YA 2B7PA 7A3HA 3R94A 1VENA 4LC6A 4MB5A 1VH7A 2YJQA 4GI8A 3ES8A 1BHGA 4C90A 2D69A 1BG9A 1M5WA 1SU5A 1K9TA 3GD6A 1YX1A 2VDHA 3F2BA 3KBJA 3IJ9A 4KWSA 2O4QA 2FPVA 3HPAA 1KRBC 1POJA 1BGAA 4YTQA 4GYJA 3P0XA 3G5EA 4Q4OA 1VF8A 4BF7A 1OFPA 3MUCA 4O11A 5FF2A 4GKTA 1H1NA 4FMVA 2R94A 1PKMA 1QJWA 4B5SA 1EDGA 2OYKA 1QNOA 2WLYA 1Q13A 1LRNA 3TH6A 5D32A 2WKGA 5DEZA 5HXMA 4NASA 4XAZA 4IL2A 3I3EA 3TW6A 3VE7A 1YMYA 2A6LA 3IIVA 2D2HA 4QG9A 4ZR8A 3WNOA 1EJXC 3WLNA 4IHCA 1PHQA 4KPLA 1OFQA 2W9MA 4RPPA 4A29A 5E5CA 3VE9A 3C3NA 2OEJA 3TTEA 1CPUA 3SUTA 4EXAA 3Q65A 1XFCA 2X7WA 1KGXA 1RP9A 3UWQA 1K8YA 3UJ2A 5BRBA 4N9BA 5HMEA 4GYKA 4NAFA 3VKBA 2WSKA 1SZNA 2OOFA 4G2DA 4MKSA 2RKXA 3TV8A 3MWAA 3S9ZA 1EDQA 5FD0A 1BYBA 4O4WA 4E8CA 4IF2A 2YB4A 1DNCA 5D2WA 1XYAA 4LU0A 1J0JA 3MI2A 3VGEA 3NXLA 3TZNA 3AU2A 1H2JA 3EGJA 4EPDC 1DBTA 1QNRA 3W76A 3WN6A 1UZDA 3RRAA 4TO8A 1LL7A 1X8CA 1WDWA 1D3HA 4R53A 4RNIA 2ZRZA 5LIWX 2DUXA 1J0KA 4YTRA 3WQWA 4HOZA 2PD9A 2R82A 4M82A 5HDRA 4AD0A 1I2OA 3BCDA 1NHSA 1PX8A 4LH8A 4PMVA 2QCGA 1BWKA 1TSIA 3VKCA 4GZEA 3GIQA 2VWSA 4MVAA 5LA1A 4Z17A 2D2OA 1HGWA 4KETA 4O13A 4FAMA 1ICQA 2V2CA 3R12A 2A5HA 4XBSA 4O52A 3M07A 4X22A 3OVGA 3EDDA 2UY5A 4IIBA 3WH5A 1W37A 3NM1A 4YWIA 4IJRA 3UZYA 4EXBA 4K8EA 3CAWA 3FDKA 2XGBA 3CPRA 2IPJA 1VEOA 2HS8A 4K7YA 1CLVA 1CGYA 1GQJA 2VDGA 4QSFA 3TJLA 3TW9A 1GRBA 1P48A 4XO7A 3RJYA 2OPJA 5C9ZA 3LSBA 1GOOA 4J40A 4B5NA 1RP8A 1EP3A 2FTWA 4D72A 1EA0A 1V08A 1WE5A 3A5VA 2ZXDA 3HPSA 2VX6A 4S3BA 4H9UA 4DZ5A 3BW2A 2HWGA 3EOSA 7TIMA 2OR2A 3VC5A 3TN5A 3QGKC 1XP3A 1HF6A 1EOKA 4JKLA 3AI0A 3W7JA 3GC5A 3VO0A 4FLOA 2C0AA 3AM9A 4TXEA 4RDWA 4RK8A 1VFMA 5C9WA 2DT3A 2PDHA 1Q5MA 2HS6A 3I68A 1KRCC 1EBDA 3EX2A 4H4UA 4Q8MA 4CLMA 4GFIA 1BZLA 1WKEA 1KN0A 3GYCA 2FTYA 4KFPA 4FNSA 4UFJA 4HKPA 1ZAHA 5E6ZA 3AHTA 4FX6M 4XSLA 3K30A 3UG3A 1ONEA 3CNYA 4DJEA 1YQZA 1NWUA 3PUGA 1UR4A 4A3UA 4F40A 1GYNA 3HGJA 5ABGA 3USZA 3ZYZA 1XIFA 3WF0A 1BRLB 1IEXA 3PJXA 4ADTA 2VJXA 2VT0A 3T7VA 4H9VA 4BI6A 2PB1A 1KBKA 4QM1A 4RV3A 1YXYA 1CT5A 4YYFA 3BWWA 4GQ0A 1ZFJA 3U7BA 1UKSA 3GTHA 3BLDA 3H4XA 3SQMA 3WDIA 1DTNA 2QVNA 4AD3A 4ML9A 1OSEA 1DWAM 2ZA1A 1MUWA 4WKFA 3FKKA 1FWNA 4DEFA 1Z7AA 4C65A 2DUAA 3UZWA 1V3KA 3M5VA 4MSSA 5KTLA 2GQ3A 1XKJA 3WDJA 3ANVA 1TJ1A 1DV7A 3LTSA 3E0FA 3UJRA 3OA5A 2P1FA 3RLUA 3TQKA 1VCGA 3P74A 3SCRA 2OG9A 1F3EA 5E70A 1WBHA 1UR1A 5GNYA 3CQJA 3QMSA 1W1A1 2GGIA 2V82A 1XIIA 4JFUA 4KF1A 3MVTA 3WFLA 3IJQA 3KUMA 2EPHA 3CHDA 3IWPA 3EA1A 4IXHA 1ZB5A 3KS5A 1UKQA 1UYQA 4YTTA 2F2HA 1FWTA 3GC4A 3S1UA 3AFBA 3UCDA 3L4TA 4HSHA 3W38A 5E93A 1A5UA 4ZOHB 3BAIA 3GWQA 4GZJA 1UP2A 5EMKA 2PDFA 1DJQA 4ZENA 4LT9A 4JXCA 1JDDA 4TQTA 2GRTA 1K8XA 4DUWA 3RMJA 1NARA 4GOAA 3W86A 3CEPA 3GFZA 2BHYA 1NOWA 1O5XA 4JL2A 4M81A 2YDQA 4WSJA 2CFYA 2YVFA 3QYQA 1GVFA 1EUNA 5BXTA 4DO5A 3BV4A 1K8ZA 2GUBA 4S3CA 1Z48A 3DU0A 2YYUA 4E38A 1J5SA 4HHMA 3YPIA 4XVEA 3ARUA 1K6AA 1RZMA 3LLDA 2OCZA 3L5MA 3OLGA 1RK6A 3ITCA 1CXIA 1Z32X 1W91A 3TYEA 5FCZA 1F6YA 5D30A 2WVUA 4N9CA 2GGHA 1UR9A 3BAKA 1ZLPA 1A5SA 1TVPA 1LRQA 2YCEA 1ZJIA 4GI9A 4ENLA 5AC4A 2ISVA 2ZRXA 3CHEA 1BPLB 2WZHA 1GZJA 3LD5A 4JQ3A 4DJFD 1Q6OA 1LQ2A 2Q6ZA 4Z1BA 2VCCA 2WOWA 1JUKA 3UWVA 4KFOA 4LUTB 2Q71A 4LUSA 4C6KA 3ZWSA 1UB3A 1CGXA 4XBJA 3LQLA 3LRLA 2X1IA 2D0HA 2G95A 1TPWA 3G24A 4IICA 5K2ZA 3L5LA 2AGTA 2W5FA 4DB7A 4LYRA 4O17A 4CU8A 4AU0A 2RH9A 4U28A 3MCMA 3CUHA 2IXVA 5G4EA 1GUVA 1T8QA 4B5XA 2QVHA 3A7AA 4FR1A 1H49A 1LL6A 2RGMA 3G1YA 4IL0A 4AHPA 3W7NA 3ZR6A 3AXMA 1NP2A 5E0FA 1XXXA 1PHWA 1XLLA 3ABXA 2WSPA 3P60A 2WNQA 4LBUA 3NDOA 3SCSA 4HN8A 4GJJA 4JX6A 3IV8A 2PDCA 1KXTA 1V3LA 2XYLA 1BLIA 7ENLA 3ICJA 3RJXA 3IEBA 2JGYA 1ZP4A 3AHXA 4GGHA 2BG5A 3GQYA 1H0GA 1GPFA 1MEIA 1TG7A 3GHSA 1KW1A 1G6CA 2ACUA 2FGBA 4PN2A 3CJPA 3H54A 4WKHA 3K1GA 4Z42C 1OZMA 2LLEA 1ADSA 5M17A 1N2VA 1VPXA 3AAMA 4GC4A 3N2CA 4RW5A 2DV0A 1RD5A 3GXPA 1QI2A 3ITVA 1QOQA 3F1QA 4M1BA 1US0A 4QLKA 3G1SA 3SQPA 5G5IA 1Z42A 5H8MA 2A7NA 1E0WA 4P7LA 3WDHA 3ABOA 4RZ5A 1JGIA 1VJZA 2G5WA 2ABAA 4X61A 1UD5A 4IM4A 2GVEA 5HMFA 3T08A 1XYZA 3VCCA 5TAOA 2B7OA 3VNYA 3ARPA 2J78A 2HK1A 3R10A 3LBMA 4MUPA 2Z7GA 4JFTA 4B4HA 3B8DA 3WLHA 3VVGA 3PR2A 2DGAA 3VIGA 1SVDA 3UPBA 5LIYX 2GVLA 2ZWZA 1OINA 1TPB1 1SO6A 1KKRA 4GI4A 1RPKA 3OHMB 4PRRA 4G8TA 5DCDA 3NQAA 3VOGA 3WQDA 3UG8A 5FEPA 4GFSA 3CB3A 2V3FA 2D2GA 3WNMA 2QF8A 4AVNA 3R7MA 1M1BA 4C6MA 4PMZA 1BF6A 3BQ5A 1I45A 3QZ6A 3FKRA 3MCOA 1PYFA 1CXKA 2O9PA 2VTFA 5A6BD 3H2FA 2HVMA 2O56A 1ISXA 1GG1A 3A7RA 3G1AA 1GVRA 1RAKA 3AC0A 3ZXWA 3S1GA 5CPQA 2X0SA 5A6KA 3PUDA 1TKKA 3QV6A 4WJXA 2ZRVA 1TR9A 2ZTKA 4X60A 1H0IA 4AW7A 4Z08A 4XWUA 1ZBWA 1VQTA 4AF0A 1EJVC 5CZSA 1Q1WA 4AWSA 4QDWA 2DZAA 3HQNA 3B9OA 4OUEA 1IIHA 1R46A 2EPNA 3EDKA 1F07A 2E8YA 1XLGA 3DDMA 3LM7A 4O1FA 5HQMA 1K8CA 3HB9A 1I2QA 3OBEA 1E4LA 4JTDA 3N17A 3UP8A 2AAQA 5J8LA 5HAOA 4TX6A 3EPOA 3G8EA 2BHUA 5BOFA 3SRFA 1E1CA 2PZ0A 3WIJA 3HZ3A 2GSJA 3L21A 3ZLFA 5CC7A 4J3UA 2PDUA 2YW4A 2W27A 3STEA 4UZSA 3DAQA 4CGTA 5T91A 2UBPC 1JROA 2GYIA 1MUCA 2ADAA 2F5ZA 1P0NA 1WZMA 1PZ0A 3VIFA 2C0HA 1FO4A 5H2ZA 2BOFX 3C3UA 1T40A 4GJIA 2QPUA 1DJNA 2CEQA 1UD2A 4LY8A 2F6XA 5BNKA 3BVJA 3KP0A 1VBJA 1FCUA 3PWIA 4MYXA 3CIWA 5FIPA 4EWJA 4GPNA 1FVPA 4DUOA 3LV5A 1NJJA 2E3TA 4QJ1A 1W6TA 2Y62A 3K5XA 2J79A 5C2XA 1V0KA 1R3VA 1O1ZA 4IMDA 3TQPA 4YJ5A 4QX4A 2A4AA 2Z4GA 1X2GA 2VX7A 4O1DA 4MY8A 1UP3A 3NM3A 3VKKA 5E9AA 1XLKA 3APGA 1D8WA 1MO0A 1Q4NX 1B4EA 5MF5A 2O0TA 3IS4A 1X38A 3ZS4A 4DJFC 5REQB 3KCJA 1K03A 1IEVA 3MP5A 5A94A 3I7SA 3WMCA 3INPA 5DELA 1GVSA 4K7VA 4O1AA 1HO4A 3ABZA 2DW7A 2VQUA 3URAA 3WSUA 3OOQA 4U3AA 3RUBL 1J2BA 4N0RA 3S2NA 3VIKA 4DYKA 4Q8QA 1V3MA 3PFMA 2B0MA 3A9IA 1IHIA 5GNZA 3N14A 2QCNA 4PB5A 3TN3A 2GH5A 3WBEA 5CKSA 3AUJA 1L8PA 1LTDA 2PTDA 3UY7A 1UP0A 3I4EA 3WQCA 1SQ7A 4HJWA 1J79A 2AQVA 4HGXA 1AH3A 4JOMA 1TMLA 4OOUA 1IWBA 2ZUTA 2CKSA 5EMJA 2CLMA 3JRKA 1RK5A 4D1IA 3GBEA 5CJMA 5TR3A 1F2JA 4PEEA 2C16A 5C8BB 3LB0A 5CH9A 1WXZA 2VRKA 1DWGM 1KFBA 3BCJA 3PAOA 3HQOA 3PNUA 3R8RA 3NQ8A 4PMOA 4AX6A 5LKYA 1Q66A 1ME7A 3BAWA 1PO9A 4BI7A 2J4GA 5DF0A 2W3SA 4WDUA 3RN6A 4LNCA 2PE4A 1CXFA 4RV8A 4UZUA 3LDVA 4PB4A 2PDYA 5A95A 2QNEA 3BK0A 4HPNA 4MNMA 2ZZ0A 4OZOA 1UPPA 3ARQA 3OPSA 3RO8A 3L4UA 1SO5A 1FP8A 1XWYA 4I90A 4E5TA 2J8GA 3WQ4A 3LCHA 3C0QA 4HOWA 1YDYA 5CPMA 3LU2A 3MY9A 5EBUA 3RPMA 1EP1A 2NW0A 2INZA 4CEUC 3UESA 3P2VA 3UG5A 1XYMA 3AIUA 3FSUA 5G5HB 4GCXA 1M3UA 3F4DA 4Q8TA 2KZHA 3CZKA 3Q45A 1MOKA 4X2PA 2VMFA 2NXGA 2DVXA 4AWEA 3AS0A 3ARTA 4HHPA 3MI6A 2YFOA 1F3XA 4UMAA 3HM7A 1DE5A 5HNUA 5D2XA 2W3ZA 3FLUA 1VRDA 4FLQA 3CXBA 1AL8A 1KBIA 3LXAA 1GW1A 1FKWA 1PTGA 4NX5A 4QJ5B 5EFFA 3HJZA 2FHBA 3OGSA 3NO3A 1I8JA 4NQ1A 4I9TA 3B8IA 4NZ3A 1ZP3A 3S47A 3VFLA 1UASA 4LC8A 1Q3NA 1XIGA 1VGAA 2J7BA 2J75A 1R47A 4AX7A 1JZ2A 3W1XA 2WW5A 3M0HA 6PTDA 4LW7A 4LALA 3N9KA 2E67A 2XFWA 2QUTA 3FCPA 2NVKX 3GG7A 1A4MA 2UY3A 1OT2A 4IFOA 2V5CA 2ZX6A 3VNMA 4A22A 1GV4A 1GOWA 2E1DA 4FNQA 1B3OA 2B81A 2O55A 3W07A 3KOFA 4XZBA 1QO2A 1V3HA 4JDYA 5G4WA 1CTNA 2BBFA 1QVBA 1V93A 5K9CA 1EL3A 3WEZA 1K7EA 3M16A 5A6JA 4FIRA 4DO4A 4LVFA 1ISYA 1KKOA 1F9CA 3UWWA 2RAGA 3RMEA 2Y61A 2GJXB 3CGDA 1H5YA 2DSVA 1S1RA 1M04A 3H21A 5HATA 2D3NA 1K6WA 3WQ6A 3BICA 4GABA 1L6FA 4JFWA 3TW7A 4DVOA 2CDUA 4V15A 4WZHA 4PRWA 3UR7A 5CPNA 4JR5A 1CLKA 2H8ZA 3N4EA 3O05A 3QTPA 3II4A 4MFDA 4CCCA 4DPQA 1FWEC 5T9CE 3V0UA 2VVNA 4GUHA 4EP8C 4C6OA 1RSCA 1CW2A 4Q7BA 4F0MA 4Q8NA 5BU9A 1GRAA 3CZ8A 1H09A 3OHIA 2GWGA 3ZIZA 3MPGA 4F9DA 1F4HA 3GXIA 3KP1A 3QV9A 1PWMA 3SY8A 4UR7A 1PZ2A 2X40A 4M6VA 4Z1CA 5JCKA 3CGEA 3IUHA 1EZWA 4Y90A 4NT0A 2MUCA 2BNJA 2W66A 3N6QA 1U1HA 1R3WA 2CZ5A 3QVQA 3SCNA 3QSRA 2E7FA 3DGBA 2FHFA 2P10A 2PDNA 4FI4A 3OZYA 1YDVA 1UIPA 1Y65A 4LAOA 4G9PA 1KFCA 1EYEA 2WAGA 4CD8A 2FJKA 4H9YA 3CUXA 4X2RA 4AYGA 4Z2JA 2W3RA 3GFXA 4XAGA 2ZE0A 4LUJA 1U2YA 1XGEA 4M80A 1E1FA 5IBXA 1C8VA 3E5PA 3ARVA 1FY6A 2X2YA 3KBVA 4JYFA 3SY1A 2HE5A 4GINA 4PTDA 3HV8A 3WFAA 1I60A 3LI1A 4OBSA 3UY8A 4G7EA 1S3TC 5GQBA 4ROPA 5FJPA 2G3NA 3BSGA 1VP5A 2FZBA 1CNVA 3GU9A 2ZTJA 2I9EA 1TVLA 1H7PA 1GHRA 4F0KA 2ZVIA 1AQFA 1OC7A 4LFYA 2VX4A 4BHYA 3ZVIA 1EBGA 2B4GA 4YL2A 2NQ9A 5HMSA 3ZR4A 2C19A 4ZOAA 3CIVA 4LVDA 4EM4A 1LBFA 3FY1A 2DORA 4O53A 4NRRA 2NV1A 5AHLA 2E5CA 4QS5A 3UETA 3L68A 1X8FA 2Z25A 3P8JA 2W92A 4QFUA 5HINA 3MHGA 2X1RA 3GVVA 3KBMA 3NVDA 2QCCA 2ZUSA 4AY1A 1DJXA 1FOBA 1ZUAX 4J9JA 4BK9A 3ZLHA 2ATSA 4AYSA 3QV8A 5EBKA 2XPKA 4C1NB 4Q3MA 3L66A 4GWEA 3WJWA 2QIIA 3NZ1A 1KQYA 1KCXA 1OF6A 3SJNA 2J27A 3IGHX 3TWBA 2FVKA 3KOWA 1W1TA 1Q6EA 3BJTA 3WF2A 1A80A 4DJED 3ELFA 1DOSA 3LHZA 4D9PA 4OQVA 3W85A 3IVSA 2AMXA 3M41A 3AXHA 3VUPA 3E0WA 4YXGA 4L1XA 1PKNA 3T42A 4KEUA 5CCZA 4V1YA 3RCNA 3S6OA 2PS2A 3SRDA 3SURA 5IFTA 1X2HA 5GJPA 4B5VA 2DEPA 4XV0A 2PDPA 1POKA 1JPDX 1W1YA 2PDQA 4L1GA 2ZICA 4JYEA 5H1WA 4MY1A 3L4XA 4AZBA 2RDXA 4GXMA 5HNTA 1ME9A 1XKYA 1IIGA 2CLLA 1YXDA 4UWMA 2WC4A 3MJYA 1J96A 3QZEA 3QYSA 5XIMA 1IZJA 1W9PA 1UA3A 5LGXA 3VDGA 3JS3A 4NKCA 3MDUA 1XIEA 2CLEA 4XB3A 4HNLA 3GTFA 4MDPA 2FVLA 2QW5A 1XH1A 3GAYA 2PURA 3DCPA 4MWAD 4NILA 3G8RA 1K9EA 4WD0A 2DT2A 4YVXA 3FHAA 3BSMA 3B0VC 2G37A 2EJ1A 2J7FA 1HZYA 3VD9A 3GAKA 3WYZA 3TNBA 3ZSSA 1OADA 4FOJA 3PZOA 1NDZA 1EC9A 3K13A 3DBPA 3RPDA 2XWEA 2XG9A 3LRKA 4I5RA 1OBAA 1WPCA 3N3MA 1H7WA 3E1F1 1KCKA 2PP1A 2WHJA 4ZSTA 2QCDA 1TTPA 4R7JA 1NDAA 3S4TA 1P6BA 1QATA 2BXYA 3DENA 1P7TB 3NL2A 1XICA 2R24A 4OBTA 4UQAA 5C70A 1UH2A 2Y6ZA 4O15A 3L8KA 3T0CA 2PP3A 4KW2A 3COTA 1GRGA 2V3AA 1S7MA 2O7QA 4AWTA 2RFGA 2WMIB 3CC1A 4ONVA 4BWLC 1W1B1 1QHOA 4JTKA 2WMHA 1QOPA 5HBFA 1N5WC 1NAL1 2VGGA 1SGJA 4WXYA 2J7CA 4ROQA 3RRXA 3VXGA 1IT7A 1JXJA 3BW3A 4M6QA 1GXFA 4M5PA 4IG2A 4JY9A 4Z1YA 2GQ9A 1HJUA 2VZVA 3QBUA 1JCMP 1XBXA 1NHQA 4JX4A 2WMFA 1M41A 2GDUA 1W54A 3V36A 3N9SA 2QR6A 3VM7A 1B9BA 3MUZ1 4RDVA 3N6JA 3ALFA 4WY0A 5D2TA 2DU2A 1JAEA 2I57A 3WDQA 1DL3A 3W1PA 4J56A 3QRHA 1U5JA 4XZNX 2OSYA 1O94A 3LS9A 3O6DA 3QQ0A 1ZQ5A 2G50A 2NLIA 1EFZA 4IPPA 1F76A 2X0YA 3G0UA 5CQ1A 4KWWA 4MNKA 3SCWA 4M8UA 2RABA 1W3TA 2Y0FA 4UR8A 3GR8A 1VFSA 4WGXA 1MZRA 3BJSA 3F7JA 4IIEA 2CKRA 4RUBA 4MKNA 2PSNA 1JFXA 1OC5A 2CERA 2BOGX 3VOFA 2YLAA 4PL1A 3WNNA 2EPMX 1TJRA 3NS1B 1SM9A 3LEPA 4IX0A 2B31A 2C1IA 1A50A 2NUXA 3PBMA 3KRSA 2HJPA 4C7FA 1Q65A 1PKYA 3NQ7A 3SCUA 3CL6A 4NNCA 2Z29A 5D9OA 4ZOBA 3V35A 3GYEA 4JCMA 4EAMA 2VFFA 2YSWA 1QR7A 5C9UA 3GDKA 4W8BA 8RUCA 2CBUA 1K7XA 4I9MA 4AZCA 4IMFA 4M6UA 3APTA 3WY1A 2GOUA 1BXBA 3V1PA 4AXNA 3EAOA 2OELA 5EMMA 3L9CA 2PDBA 3MBDA 3M46A 4NZ1A 3IJ7A 1P0EA 1TPDA 4J3TA 2X05A 1MXGA 4QHRA 3PG8A 1TZZA 1CGWA 2WM0A 3T2OA 5AZ1A 3KBSA 1TVNA 4S39A 1VC4A 3KBNA 3NGJA 2Q8LA 3UR8A 3UZ5A 1V0MA 1XD0A 1SJAA 3NVTA 4UC5A 3VM5A 1ZMCA 3KM8A 1MQRA 3WENA 1KBLA 5IDZA 4I6KA 1SJCA 3WBAA 4D6IA 4RDZA 3R0KA 1GZ1A 1JULA 3NVWB 3CQHA 4FXFA 3WLPA 1KM6A 1DWHM 3OGRA 4CUCA 1TELA 4W7VA 3OLIA 3S2MA 3CZEA 1LL4A 3W84A 1XDIA 4GVHA 1S5TA 2DQXA 4H83A 3T6CA 3GY1A 3PUOA 3E02A 4LB4A 4OT7A 4E4PA 4PODA 1ME8A 3WF1A 2EPKX 3HPXA 1YBQB 2EPLX 4J2MA 4V1XA 1WXYA 2A7PA 2CYGA 3SEPA 3SI9A 4Q7NA 1PEZA 1BD0A 4AISA 4ADUA 5DMYA 4C6NA 1F8MA 1H5VA 2ZZCA 5L6UA 1L6GA 3DH9A 5C7VA 3DKJA 3M7SA 3FN9A 4CEXC 2DJLA 3LCGA 1S5VA 5HR7A 4F2BA 5EFDA 1KTCA 2GGJA 2CZVA 2BB0A 3J7HA 3GK0A 2QCDB 2WZMA 1TV8A 1IEWA 2ISSA 4D2JA 3P14A 1UHVA 4DLFA 3R2GA 1W5NA 3N29A 1NWSA 3GXFA 2DZTA 2AQWA 1E0XA 1WCGA 3WNLA 4MYAA 4WR3A 2I5IA 1G9HA 3B40A 4RW3A 3Q4DA 3QFEA 4JTTA 1DJHA 3VD5A 1XBYA 2F7FA 4JYDA 5E0KA 1G0CA 2FGZA 3G1DA 3CHFA 1ZBKA 4M19A 3UBPC 1VIZA 3ZSTA 4LV9A 2X41A 4N2YA 1XLEA 2VRQA 5B7ZA 3M6YA 4UCGA 2F6KA 4TVCA 3A21A 3W1TA 5A6TC 2NX9A 1AW5A 3CASA 1VJSA 1SR9A 1V0LA 3H2EA 1UJQA 4KH2A 2WPBA 1FWGC 2VEMA 2AAAA 1SMDA 4AAJA 3VNKA 5JIWA 1XQLA 4IPIA 3W75A 4YCPA 3U2CA 4B91A 4Q22A 5T8GA 1PXGA 2VD8A 4U5KA 5MKGA 2A3HA 4TVYA 2OLSA 3QMRA 2WKLA 5U7SA 3L65A 5BXSA 2OKOA 2H9AB 1JZ5A 2QQ6A 4QCFA 2QULA 3UJSA 3M44A 4LAKA 1THFD 2WJFA 3W7DA 2ISFA 4B15A 2PI6A 3DXIA 3WG6A 2VHLA 3PNZA 3PPGA 1G7UA 1FDZA 2UZ9A 3EWCA 1VAHA 4E2OA 5DXXA 4GA8A 3TXZA 2SFPA 3HG3A 5T9BG 3MUIA 1RY0A 2P88A 1ZPTA 4GVGA 3W6YA 2GL5A 4XD5A 5K4XA 2XN0A 3LK6A 4YPJA 3V3WA 4L4LA 5EMUA 3BLEA 3W9ZA 1Q6GA 1P6WA 3H53A 3PB2A 3XIMA 1EB3A 3OO2A 1LROA 1TV3A 4LAUA 5G4HC 1S2WA 1FUYA 2ZE3A 1YIXA 1RHCA 2HVOA 1R3YA 3EWZA 2RDTA 3ABRA 4JTHA 2Y5SA 1WKYA 4HMCA 1EWDA 3RYSA 2VEIA 2XVLA 4AXKA 4ZB2A 3RNMA 1J2WA 2EKCA 4BFAA 3GTIA 3ZQ9A 3RK8A 3H4WA 2AKMA 4E2VA 2YDAA 3PS7A 2W0UA 3G1HA 1YPIA 3ZT5A 2QF7A 3MTWA 4CCEA 1O60A 1E72M 3P84A 1PVNA 3VDCA 4DNMA 1PZ3A 3QEZA 2DVTA 3CV7A 4XZHA 5CLWA 1Q6DA 3TLLA 3GE7A 4QJ4B 1HJVA 2JKEA 5D33A 1Q63A 4N7QA 2V5LA 1VPQA 3UYCA 5FF4A 2EBNA 3OODA 4DBWA 4M6PA 2GDQA 4FB7A 1F7BA 4EM3A 3TN4A 4XVDA 3E6EA 1OHLA 3QW4B 3P67A 5I06A 4KIRA 4QLLA 3B9JB 3LPOA 2HDJA 4UTIA 3OB8A 1UG6A 2ATMA 5DRCA 1HNYA 2F84A 4ADWA 3TJ4A 5M5DA 2QJHA 3I3BA 1RCQA 1Q1RA 3CWHA 1PL9A 2C6QA 2Z1BA 1DWFM 5I79A 2ZBTA 2A3CA 3A4JA 3TC3A 1KLZA 4KEVA 3S5OA 4B5UA 5DCEA 4KEZA 2WPCA 1W56A 4NY2A 4GK8A 4XZMX 4UTTC 4HYVA 4BV6A 3LSCA 1QPKA 2CHRA 4O1BA 5H91A 5HPOA 4GO8A 3PBYA 2CITA 4XIMA 1WBJA 3C52A 1KQZA 1XRVA 2V69A 1LOLA 4H8NA 4Y96A 2QGHA 3WH7A 6CGTA 1A5CA 2QDDA 4AIOA 3QR3A 3RAOA 4BURA 3L2MA 3WQOA 3VIHA 1L6YA 1FECA 5FJOA 2JK2A 2CXGA 3M0KA 2XVPA 4W8AA 1EPXA 3EXTA 4GVFA 4K3ZA 4L4PA 1HG3A 3M9YA 1ZRQA 3F2DA 4WY0F 4P2VA 2Y2WA 3NIYA 4H4QA 3TDFA 3ENLA 5FKYA 4AZIA 4M51A 4CQ8A 3IACA 3K8LA 3NWRA 5C55A 3LMYA 3W2MA 3DBNA 2WNZA 1EGMA 1HL9A 4AQLA 4H04A 2G4FA 5FS6A 3SQLA 1KFEA 1R3TA 4I6VA 5I3JA 4E4FA 3C0JA 1KV5A 1GHSA 2J7EA 3ABSA 1KM1A 3L2IA 3MUAA 1ZAIA 3R07C 2GQ8A 5DMMA 1GJWA 1TUFA 1SMAA 2AL2A 4KIEA 3GNRA 2ZFAA 1XCXA 4JQ9A 4Q8PA 3AYSA 1F61A 4XZLX 3AHVA 4H7VA 2J3NA 1T0OA 1T5AA 1EGVA 4K2SA 2DH3A 2Z00A 1H7XA 3T4CA 1VB9A 3C4UA 1MW1A 4LEFA 2H9AA 3NSMA 1RCXB 3EB2A 3VDAA 1E0TA 4AFYA 3NQ6A 1FH8A 3W2NA 3OVPA 3LCLA 3MS8A 4J35A 3TUUA 4XG1A 1J6OA 3S5YA 3CIXA 1BYCA 1UIOA 1XYLA 1V3JA 3BUVA 1KFWA 5C2CA 3W7EA 1EGZA 2HNEA 4LYKA 5DMNA 3SECA 1WUFA 2J7GA 1TTIA 3DUGA 1JYNA 2HQMA 1QXLA 1L9WA 3TYCA 2NXHA 2CBVA 5CZKA 5AYBA 3QZAA 2V9DA 3VX0A 5BRQA 1ZENA 4DWSB 2EJAA 2O92A 4ZFCA 3IC9A 4LS2A 2VKZG 3POCA 4DF0A 3O63A 1OVDA 3D3FA 3B8SA 4HB7A 3DHDA 2XFFA 4QSHA 3NAVA 3BOXA 4Z1AA 4WKAA 1LPFA 1G1YA 3CBWA 4H4WA 1V02E 1N8WA 3F5KA 3ID7A 3GSMA 4H8HA 4IJCA 3SIZA 3D6NA 6TAAA 3M1ZA 3ONBA 4BZYA 1ECQA 3EZ4A 3CAQA 3KW3A 3WK2A 5AC6A 4DNAA 1MDLA 4XZ9A 4XZWA 4H4IA 4EWND 3BLIA 3AU6A 2PWHA 3GNDA 1OT1A 3MV01 3E0LA 1J12A 3WJXA 1RVKA 1AZ1A 1BKSA 1GTEA 4UOJA 1UWUA 4W88A 3NDZA 2Y89A 3GVGA 1BG4A 1E6SM 7REQB 2WJZA 2CBIA 2ALRA 1YPXA 2JKPA 3AXXA 3ZM8A 5A6LA 2PFHA 3WKZA 2PDJA 4WF7A 4WRHA 3RO6A 4EPKA 3N2MA 3VD3A 4IMGA 4D6CA 4Y9MA 3BLKA 3SGUA 4H4YA 1QWKA 3MU7A 4JBRA 2YKKA 5AHEA 3N15A 3CZLA 5G2HA 2PAJA 3RG6A 3A4AA 1HKKA 1LBLA 2ACRA 4OV4A 3RLGA 2I7GA 1CIUA 3AZSA 3AZTA 4ZE5A 2AAMA 3TKFA 3GNOA 5HOSA 2J74A 2VCBA 4LVAA 4J3SA 1SSGA 2DY3A 1IXOA 3BMWA 2NLYA 2NUWA 4ILSA 5JU6A 4ZOEA 1R9XA 4W84A 1JQXA 2Y8VA 1UWRA 4NX0A 1NF0A 1YHTA 3T07A 5J5RA 3EWBX 2GSHA 3EAUA 3GXMA 2DSWA 4WDTA 3IK4A 4PRTA 1ZDLA 3MMDA 1X98A 2WQPA 4EK7A 4UTMA 4UMBA 3HG4A 3V1HA 3AXIA 3EX6A 2AMGA 4M7SA 5BW6A 2J9YA 1Q45A 2XIOA 4LVGA 4UOZA 1N60C 2V5JA 3HW2A 1GG0A 3H24A 3O6AA 1FH7A 1XLJA 3B4UA 4K6AA 3QPEA 4KT2A 4A8LA 4HOXA 5BOEA 3HURA 4HYRA 2BTMA 5A3HA 4EANA 1KFLA 4NSBA 2I17A 5I78A 5I5RA 2E4TA 1TV5A 3TYZA 2V67A 3PZIA 4N4PA 1JZ7A 3HQ1A 4QS6A 2CLFA 2EG6A 5GJNA 4OE7A 3NFUA 2AKZA 1MEHA 3GB6A 3WJYA 4CN6A 1ZU8A 1DTUA 4DXKA 4Q7IA 3MKCA 4KCWA 4UFIA 1TCMA 4N02A 2PGWA 1XF0A 3B0PA 2Z7KA 5U1OA 1YTEA 4ZA0A 5TD4A 1GYLA 2B7QA 2E6AA 1OG0A 5CJ5A 3QF0A 2YZRA 2CWXA 1N5XA 3P82A 3R11A 1PIIA 2W67A 1XYBA 2IS7A 4HSOA 1HKVA 1HO1A 2GVGA 1R30A 4Y9OA 4CQDA 5BOOA 5HNRA 3H2CA 1TX0A 1QI3A 3C2OA 1E0UA 3S2LA 2XU2A 1QPRA 1HKWA 2ZC8A 2R14A 1XG3A 3NL5A 1Z3NA 2JE8A 4FNUA 1KM0A 1YNQA 4FR6A 2AL1A 3SR6B 4J3ZA 1CXHA 4MNLA 2D20A 3TTYA 2OYMA 2WMGA 4LX4A 3SM0A 4AZCB 4PUWA 5I77A 3U57A 3Q67A 2QMJA 2GJRA 3AMCA 4UTHA 1QBAA 3SCTA 1E15A 3VCRA 2ZWYA 1DJIA 2Z6IA 4Q4PA 5DO8A 5LYRA 1H6VA 5JCMA 1DIEA 1M9HA 3FYOA 1BWLA 3BZGA 2FYMA 1N62C 1QUMA 4NU7A 4H50A 4KWVA 1B3XA 1XBZA 2CPUA 2DUZA 1OX5A 3L0NA 5LIXX 3JZUA 5KVIA 3NQMA 2VNCA 1C8QA 5BMWA 1EC7A 1P1MA 1N63C 3C8NA 2YX0A 1QO5A 1S1PA 1GOXA 8CGTA 1NY1A 4CN1A 4UQEA 1MFVA 3UPMA 1KR0A 1V6XA 1GVEA 4HK5A 4H8UA 5FJJA 1W3LA 4KGLA 1DPMA 2W0HA 4CNTA 3MBFA 4MB4A 1JEHA 5CC3A 1A5OC 1EX5A 3VD7A 4DNHA 1B30A 1VEPA 1NFPA 3LBOA 1N8FA 1TYGA 2WOQA 2WHMA 2Z2BA 2FZ8A 1H4PA 1ML1A 5D8WA 2WP6A 4R9XA 3GX9A 5JUVA 1ZBCA 1W1IE 4GBDA 3E49A 4HNOA 3ZJKA 3LPFA 2VR5A 1XRSA 1A5BA 3B0UX 4O8AA 2PODA 2F61A 4FDCB 2FQIA 3GLCA 3UEQA 1UMYA 3QW3A 3KE0A 3O16A 4PTNA 1JOAA 1ONRA 4KEMA 3TSMA 2IKJA 3NGFA 3UCCA 1OFAA 2WV8A 4X0NA 4EPBC 5REQA 5LA2A 2IQDA 3OC4A 3T4WA 4TU1A 2UV8G 4O1EA 2VWTA 2QCFA 4QE1A 4EAYA 2OLAA 1C7SA 4JDBA 4ORMA 2ZUNA 1WO2A 3PZVA 4TVWA 1MFUA 2V6AA 4BQ5A 3UYIA 3AMLA 3T9PA 1YTDA 3WMSA 2CLHA 3OQ8A 1I0BA 3CYJA 4UNKA 1UA7A 4QG6A 4NIRA 5CSRA 2VOMA 3F2CA 1F73A 1YE4A 3N13A 2FPYA 1ZGDA 5CSSA 3WJSA 5FF7A 1E55A 2IKGA 1XPGA 3IJ6A 4FXRA 4MHBA 3KL5A 1AUSL 4WOZA 4K1GA 3M43A 3WNKA 1PZ1A 3WLJA 1HVQA 4B9YA 1UUOA 1QRQA 3RLVA 1JR1A 1OFRA 2XSBA 4MG4A 3NQ2A 4Q8VA 3NVYB 2PZNA 3OG3A 2D0GA 1OYCA 3GTNA 4ZVJA 2YBVA 5CSYA 2JALA 2OVLA 1WDRA 5HMDA 1HJXA 1WOAA 1AJ2A 3CV1A 1EZ2A 1FDYA 2PLCA 4ZO7A 2GZXA 3QKZA 2PA6A 5KVHA 1R38A 3MSDA 2P50A 1EA9C 2REQB 4DRSA 3RNDA 2PRLA 2W6RA 4S1FA 4IFKB 3U2OA 1XV8A 2ZZ3A 1A3XA 1O6IA 2Y4SA 2HTMA 3VIJA 3MANA 4DJEC 3GS6A 4GX8A 4GRSA 3H70A 3WL1A 2ZZ5A 2XIQA 4H7ZA 1OEPA 1BQCA 1E4NA 4AIEA 3ARZA 1SJDA 7PTDA 3W87A 1VFHA 1SFLA 2VFDA 1RLCL 1A5NC 5DLCA 2OZTA 2EO7A 2E6DA 1H50A 1ALDA 1PSCA 3E5BA 3TFXA 3NL6A 1W8SA 2V5KA 3FYYA 5A6MA 4MJMA 4PUNA 3O7UA 4LAZA 4IWWA 1FHUA 4EQSA 1HKMA 4ORIA 1EIXA 3HFTA 2YXOA 2ZX7A 2WVTA 4O54A 4JD4A 2P5NA 1WX0A 2J8TA 4HCHA 2G96A 2OQYA 1OJTA 3G2GA 4CQBA 2HROA 4A8RA 1EP2A 1D2KA 1DIKA 1C93A 2PF8A 3S5NA 3N04A 4IQLA 5G2WA 1NELA 2D3LA 1AJ0A 2FB3A 1HT6A 5FS8A 1N7KA 4X3ZA 1OB0A 1PBGA 4NRSA 1CEOA 1AK5A 3G1XA 3G3MA 2WOVA 1XYFA 2FTPA 2PTXA 5HQEA 1FWHC 4IISA 3G6MA 3DG7A 3L12A 4F0SA 2QAPA 2OEMA 1A4LA 1OIMA 3TYBA 3O07A 3WH6A 4Y9PA 3NXFA 1V59A 4NUWA 3H2NA 2V3DA 1N61C 3QPYA 1XLFA 1GGOA 1F3PA 1OCBA 4WOQA 1PX3A 3QHMA 4M24A 4C6BA 4MWAA 3DFSA 4UUIA 4MJZA 1UD8A 4DWDA 5F7UA 1E9LA 4IX2A 3PWGA 3KTSA 5XINA 4ICMA 4H4TA 1FP9A 4JIHA 2HSAA 1E6ZA 1KRMA 2P8BA 4AB4A 4AWUA 1DIDA 4GQGA 3T44A 2VURA 1UWSA 2J24A 4AC1X 3H2MA 5D09A 3BLPX 2HPMA 4P7NA 2ZXQA 4R34A 4PTVA 3DGHA 4DJDA 1WAUA 1E9ZB 3DECA 2WPGA 3GH5A 3W6MA 4ZEPA 4GIRA 5AHMA 1I9CB 5LIUX 3TU9A 2XINA 1NEYA 1UH4A 2ZA2A 1PB0A 1WXJA 1O12A 3H4KA 1XLAA 1JCYA 1AW1A 1MW3A 4ZBCA 3KX6A 1PUDA 1GZGA 3ES7A 4DO7A 5DCBA 4E6MA 2FFCA 3QMTA 1VJIA 4U4MA 5LHEA 1HXJA 1M53A 1Q7QA 3EDJA 3QQ1A 4GBUA 3ITYA 3P5YA 1ITQA 2ISDA 3DGZA 1IEQA 3VIIA 1HKJA 3HF3A 2FZMA 1ZJHA 4O57A 2VEPA 4JTCA 1DXFA 3CXOA 3MJMA 4YCOA 1OY0A 3GW3A 3P62A 3TE9A 3PZUA 4LCRA 1R0MA 1BTCA 5F2IA 2YXXA 3C86A 3UWZA 3PSVA 4EMJA 3SGZA 3IANA 4M0XA 4YYCA 5L9FA 1DJWA 1QMLA 2QS8A 3KCOA 3RM9A 4OHQA 4KBXA 4KRTA 1YRRA 1F6KA 2J77A 3BGAA 5JBDA 1Q7ZA 8TIMA 5A2BA 2YAUA 4WHBA 4X9SA 4UNLA 2JQXA 1VRXA 4G1NA 9XIAA 4EVZA 4WK9A 1DKWA 4M56A 2FJUB 3DIPA 2PWGA 2UY4A 4PZVA 5TQLA 2G3MA 4F0HA 3IUIA 2NV2A 4UB9A 4GC3A 3PZGA 4NJKA 7REQA 5D02A 3BAYA 3WUGA 2ZX8A 3L4ZA 2VR2A 3VGFA 4ZQNA 3RX2A 1EPVA 3TR2A 1QFEA 4Q4KA 3THQA 3M0MA 4TX9A 3R13A 1NQKA 1KFJA 4D8ZA 1NWTA 1QCWA 4A2SA 4BJHA 1FHDA 4L9YA 1ZJBA 4C6LA 6A3HA 2QAEA 1L2QA 4NL1A 3EX4A 3IJIA 3T0TA 3TNOA 1BF2A 5FS9A 1YDOA 4JTEA 5AN7A 1XFBA 4UFMA 3EWWA 2RUSA 4Q4MA 9XIMA 3MSRA 4PA8A 3FNDA 3UZJA 1H41A 4S3FA 3LPGA 4H4VA 3LUTA 5BCAA 3AWNA 4EMWA 5KSWA 1C92A 4PMQA 5I02A 1XUUA 2ZZ4A 4E8DA 1NDVA 1REQB 5JVLA 1GOIA 2Y8KA 4FO4A 3CGTA 4IMCA 2BSLA 3VGHA 4RPQA 4WVXA 4RCXA 3OIXA 4BA0A 1Q6RA 4FX8A 1KWGA 1CCWB 5FEZA 3TK7A 1ZK7A 1TJPA 3ANUA 1UROA 4F2TA 1FEBA 2XFRA 3M7WA 3HV9A 4Q8WA 1GPWA 1MUMA 4UFHA 3U4AA 5EKYA 2Y5EA 3WLIA 4CD5A 3HGSA 3DC8A 4N42A 4O16A 3CGBA 2FH8A 1UPMB 1GVQA 1KB3A 2H3DA 1JF6A 1TV2A 1K3UA 3XISA 4IIDA 4L4OA 2PRHA 4DBUA 4GY7A 2OU4A 1ITCA 2Y7FA 3G0XA 5A8NA 2Q8ZA 2ZUVA 4KCTA 3BLOA 2DQWA 5F4XA 2GUUA 1QPNA 3CZGA 4ZL1A 3UF9A 2CW6A 4Y2WA 5D05A 5C9XA 4NEWA 4DF2A 2TODA 3CQ0A 4LTSA 4JQ4A 3GR4A 3M0ZA 3S46A 1X1OA 3GR7A 4NZFA 4JIIX 3SFKA 1EKOA 3LHYA 3IIZA 3B9NA 3C0SA 2NZLA 4F79A 1E43A 3QY8A 8XIMA 1ZHAA 4Z2IA 5H8PA 3EWDA 3TA6A 2DZUA 4RNHA 2C7FA 5HUOA 1XSJA 1UCWA 3I7RA 4JDRA 3R1ZA 1KXQA 2PU0A 4CQ9A 2QXWA 2ANUA 4GD0A 2TPSA 3GO2A 2V30A 3KRZA 3AS1A 5EMYA 2BS9A 2INEA 3WBWA 4WEVX 3NQBA 4RR4A 3T0AA 3GXNA 1KBJA 4YVVA 1GRFA 4WJ8A 2I5QA 2NSXA 3C2VA 1T99A 3QY7A 3OIHA 3UJEA 3PK7A 1UKOA 3RITA 1JVNA 1V77A 3QFBA 4OFCA 5BXPA 3LYEA 3VMNA 1SZEA 3LA4A 1T7LA 1LJYA 4KCVA 3P6LA 2FZNA 4C6CA 3M0YA 3Q37A 3P61A 3SN1A 3T2PA 5KITA 3PULA 1JDAA 3STCA 2ISWA 4UR9A 1BGGA 3QTGA 4AVFA 1VCVA 1E6RA 2WHLA 1C91A 1XC4A 1W17A 2R6OA 2WWDA 3O0HA 2YGYA 1GONA 1SZFA 3TWAA 1S2UA 3UERA 4N9DA 1FIQB 4B90A 2GGEA 3AIRA 3C2YA 2BY0A 2KX9A 2PDKA 3BG9A 3BJFA 3S5ZA 4YS1A 4ACYA 3N1AA 5M1TA 3GRTA 4DM2A 3CZJA 3UNTA 1A5AA 4U31A 1GETA 4LA1A 2Y8UA 1XQKA 1G4EA 1NFGA 3B0YA 1OQFA 3A3HA 3TSDA 3A24A 1JD9A 4LCQA 3EDFA 1UC5A 5BWFA 2WOIA 2NWRA 1XR2A 2JEQA 3HMCA 2NV9A 4UIOA 2WSQA 3NQFA 3NYDA 3PWAA 1MRQA 3BSHA 4HZ8A 3FJLA 1KGUA 4JS3A 4TOQA 3RGTA 4IPJA 3GG8A 1TE1A 2VELA 3TSBA 1TA3A 3ZOAA 3CQKA 1R9ZA 1EJUC 1R7AA 4IUGA 4K39A 3H2AA 1UR8A 3WK1A 3MZ2A 2VX5A 3V0SA 2A8XA 3N6HA 4R3UA 2VC7A 2DIKA 1QU4A 4A8IA 5I3HA 2HZGA 2G8ZA 3W27A 1XGDA 1OGGA 3LM3A 2O4MA 1TCDA 2HMCA 2IQTA 3IJDA 4GY1A 1ZSXA 2BFGA 3B8VA 4G1KA 3JW7A 5CG0A 1UR3M 1FH9A 1U5HA 3ARSA 1K1DA 4JL1A 4A05A 2FVMA 4UTJA 4Y9NA 1QW8A 3CLWA 4W7WA 3VKAA 5FESA 3POHA 1J0HA 1GREA 3H23A 3VMPA 4ZQMA 3STPA 2EG7A 2C3DA 3PJTA 4C6IA 2CIPA 5CPLA 5AHNA 2DP3A 1PJ9A 3CL8A 4QJ3B 4RDYA 2RJGA 3ZT6A 2J7DA 1WNOA 5JH2A 3NQDA 2CZFA 1US2A 1H7OA 2BGSA 3RHGA 1B4KA 3N18A 4U3CA 4EE9A 2NT0A 1F6PA 3UR2A 1XRTA 2FMNA 1B31A 3AHYA 3UWUA 1GKRA 1ECEA 5A1AA 3TN6A 3HFYA 5AC5A 3URQA 4AC7C 1TPUA 3ATYA 4QE5A 3OZMA 4E8GA 3UFYA 3R8GA 3AALA 3WQFA 3VKDA 1XCWA 1VZWA 3L4YA 3GXDA 1EX1A 2XTKA 3KHDA 3FG2P 4TIMA 1MVYA 4H19A 3TLQA 1QHPA 3B97A 1E3XA 5I00A 2WJDA 1MNSA 2BLEA 3BANA 4D8AA 1QAPA 4UTFA 3VC6A 2C79A 2VFHA 1R8LA 3LTYA 4RZ4A 4MIMA 5PTDA 5CZTA 4JEQA 1Z6KA 4LS1A 4OBRA 2EQ9A 5C6MA 5U25A 1O4UA 3KBWA 4NNAA 1JIBA 3UGVA 1RJQA 1Y5VA 3VAVA 1EC8A 3MA8A 2QDGA 2VZOA 4KS0A 3FX4A 2BC1A 3EMQA 2EXOA 1EF3A 2BHZA 5DT5A 2QJJA 3LMZA 4AUBA 2R1KA 3L5OA 4KMQA 2Z1XA 3EANA 4IOTA 4WQ6A 3N73A 2NQZA 3CAVA 3CUGA 1GNXA 4Z2LA 1SFSA 4PC8A 3GHRA 2A3AA 5CBJA 4Q6JA 3ALGA 2INFA 2OJPA 1VYSX 2ZQ0A 4QDPA 3VABA 1W32A 3KTXA 4ACZA 3PF3A 3DKLA 4FNRA 3FEQA 1QI4A 3SW6A 2V63A 2FH6A 1YLVA 3W2LA 1HJWA 3MQTA 4A4AA 3W2JA 3EYPA 3PY2A 2ZX5A 1SR0A 4ZQOA 2NVDA 3NR0A 1SW0A 4L61A 2C3ZA 3OGVA 5FSDC 3CLMA 4O12A 2RGLA 3HG5A 4N6EA 3HGOA 3U5UA 2QYGA 3K4WA 3KVMA 1WYIA 4YHEA 2VC5A 2OZ3A 3PJWA 1ZY8A 2QKFA 1V6UA 1BVZA 2WP5A 4GNVA 2QCEA 5U4NA 3TTOA 2NT1A 1M6JA 4H41A 4L65A 4V2XA 3HO8A 3IUDA 1TB3A 3LV6A 4DZHA 2QCMA 2PC8A 2Q09A 5D04C 2P0IA 3FA5A 4JKKA 3UGRA 1Q8AA 1RPXA 1WV2A 5ECUA 3N11A 4JTSA 4UNIA 2Z2AA 4PL2A 3W70A 3QC0A 4RLIA 4ZB5A 5AC8A 1GJPA 3FA3A 2F6UA 3FSTA 4UXDA 5DN1A 1JDEA 2Z1SA 3FJ6A 3IIOA 1W1ZA 1JYWA 3SRHA 4ZZ9A 4DY1A 4NZ5A 1LG1A 1OCNA 1TRDA 7TAAA 4LVBA 4PMJA 1FFRA 1YTKA 1BWCA 1CBGA 4Y9AA 3RPTA 3T09A 4A3HA 4J5NA 4PGLA 1VLWA 2PWVA 2TAAA 3T40A 4NZCA 3H55A 1O7AA 1RBAA 4MUZA 2YA2A 1RQEA 4UFKA 3EEZA 3VU2A 1E56A 2ACQA 4LB3A 3DFNA 2HV5A 3U9IA 2JF6A 3OLDA 4AY7A 2JK6A 3FA4A 1G01A 3URNA 3A5FA 3NQGA 4XD6A 1QHZA 1G4SA 2R8WA 4JTGA 4ZTYA 3ECQA 3ITTA 9RUBA 1SO3A 3CMJA 1QK0A 2YA0A 1MO9A 3WX7A 3BLLA 5I23A 3GH4A 3KLLA 3VGBA 1QNSA 3QGVA 4XISA 3M47A 1QNQA 4F0LA 5I07A 3WLKX 1EHNA 5HANA 2X1UA 1J01A 5MKGB 4QNWA 1Q8JA 4DYJA 1WYGA 2YCKX 3SUVA 3EA3A 3PTMA 4WY0B 5IHSA 1HIZA 1WQ5A 4PUJA 3TONA 2Q3OA 2OQLA 3H12A 4AIBA 3CWOX 5FACA 1XCFA 1C9DA 3G1RA 3VIPA 1OFEA 3LNMA 3PC0A 1KCLA 3UZZA 4L80A 4C6FA 3S6DA 3K8KA 3PTQA 1ICSA 3WD2A 3LHUA 1XLBA 3EX3A 4L9ZA 4HJFA 4ZB0A 4JQ2A 2NVAA 1J93A 4LCSA 3DZ1A 4C6QA 3UXIA 2QV5A 3W74A 3MYOA 4HNVA 2DZXA 3VI2A 4A2RA 3AISA 1QASA 3EMCA 3N4FA 4ZQPA 4NXKA 2TRSA 1U33A 2YYTA 1M65A 4BQ2A 2C3CA 3HPFA 3CK5A 2BZNA 1UOKA 3DG3A 3TC7A 5ABFA 1FWIC 4H4XA 3WLOA 4R5EA 1VBGA 1OGSA 2WCGA 4MZ8A 4LANA 2XH2A 3LHWA 2PLKA 5CLTA 1FBAA 1CYGA 4HTBA 4D71A 3AO0A 1ZCCA 3M64A 5FJIA 3UXAA 2PGFA 1S39A 1V02A 3V7PA 5EY5A 2ZZ6A 3SCVA 1QDSA 5CBIA 3GTXA 2R9RA 1V8EA 4OWGA 4DBDA 2Y85A 4CNNA 1XIJA 1KM5A 5FJRA 1UWAA 1ONXA 4PR4A 4ZTXA 1V4YA 3TOPA 5C2GA 3O2LA 2BY2A 3W2UA 4NJGA 5EB8A 4Z0JA 3KDNA 4R85A 3U3HA 1F8IA 1OD8A 4QGCA 1SYTA 1KC7A 5I3DA 2JIWA 1VR6A 4NZJA 1BKHA 3C6CA 2PBGA 4CU7A 1E6XM 2JEPA 2WZTA 4N6FA 3CH9A 5ER0A 4IJBA 1XH0A 4J27A 1M01A 3TX9A 4D8LA 3KS6A 4PMNA 3CV2A 4QRNA 4B92A 3GVQA 2R9ZA 2HPIA 4D6EA 3W1QA 4MPKA 1IT8A 1FWCC 2VD9A 1HUVA 4M52A 4PTWA 1MMFA 1W5MA 1JDCA 3MCNA 4R7WA 3NSXA 1WA3A 1C29A 4PMYA 4AVOA 3BZJA 4K8GA 4I3GA 2P0OA 3HBLA 4Z2KA 3SN0A 3VNIA 3IJ8A 2G4JA 4JCLA 4OGZA 1LYXA 1GWJA 3PZ9A 5LXXA 3W26A 5F2MA 4MPQA 3IAQA 2PC4A 3A6OA 3A4XA 3E2VA 2YL5A 1UOZA 4FXSA 1YKWA 1VEMA 1VPYA 4MZYA 3LN3A 3Q2DA 3QM3A 3W71A 3WCZA 5CPOA 2IMRA 1E40A 3RR1A 3E12A 1QW9A 3O8AA 2GQAA 1IYXA 4JAWA 3ATZA 3EOUA 1VYRA 4L5ZA 4LUSB 3DX5A 3CHVA 3LGGA 3OYZA 1ZZMA 3LGEA 5B7YA 2WCSA 2R1PA 1PDZA 3HGRA 2XH0A 2R1MA 3C56A 5DBTA 5D9NA 4CD7A 5A69A 2Z24A 1W3HA 4H6KA 4ZQRA 3WELA 1K9DA 1K4GA 1HKIA 7ODCA 1DWJM 3WBXA 5IFPA 1ELSA 2OGJA 1P5BA 1LOSA 5K9DA 3FXYA 4IPNB 4U2YA 2ZA3A 2MANA 4UTWA 1JUEA 3DN5A 4G7EB 3TTQA 3BO9A 1PV8A 3L7RA 2QGYA 2ZZ1A 1W3JA 3CTTA 3QHOA 3UZXA 4WX2A 3SGGA 3B06A 3QQWA 4ATDA 4NAEA 4D1JA 4KGJA 1NWRA 3WD1A 4HNCA 3FOKA 2YCJA 3PPCA 4NZ4A 1QPOA 3MHFA 4UOQA 4RE2A 2MNRA 3FIGA 2VFGA 3WLTA 2YB1A 3WQ8A 4ATWA 4QEEA 2X8RA 2OMAA 2EQ8A 4CVUA 2IPWA 1TRIA 4DWSA 3B8UA 3LCFA 4RE0A 1DXEA 1KBBA 3GVRA 1Z69A 2I14A 1C90A 1I4NA 3CO4A 3ZT7A 4IPLA 5KEZA 4C1NA 1ZXIC 2QUVA 4V33A 3KFTA 4W5ZA 3NSNA 1N82A 3W28A 1AQHA 3GDMA 4JPGA 3W7HA 1ZMDA 5E1QA 2E9MA 3R79A 4WJEA 1EUAA 1XHCA 3MP4A 3REQB 2BC0A 5CEWA 2WPFA 3UWEA 1J6PA 1EO5A 1DJZA 1XJBA 4L6OA 1LG2A 2QCHA 4R27A 4L7ZA 4O18A 1W5QA 4AZ6A 4JICA 2G3JA 1HW6A 3DYPA 2WCAA 5SWUA 3T8LA 2OWWA 3NRZB 3GHUA 3E2QA 1UKPA 3R89A 4DYEA 5JCNA 3M0IA 1YNPA 3DG6A 4FIQA 4J28A 4KRZA 4GE8A 1W3IA 1KCZA 3VYLA 5I2UA 2ZUWA 3O15A 5GNXA 1V6TA 3UA4A 1Z89A 4TMBA 1CGVA 1ZBVA 1RLDA 2H6RA 1VQZA 2ZDSA 3IGSA 1J8VA 1V6YA 1XISA 2ASHA 3KL0A 2ZZ2A 5AHFA 2CWNA 3WQPA 3LXBA 3HMJG 1C8YA 2PLMA 3VD4A 4BI5A 3OW1A 2Y70A 4QTGA 1ZTVA 3BQ6A 3UXKA 4BWLA 3RDKA 3OBKA 3RU8X 1HQTA 1GKPA 5FAJA 1YXCA 1DXLA 1GEHA 2WVVB 5AZ0A 4F4RA 3AZRA 5T26A 2DIJA 1W5OA 1MNZA 3DK8A 2Q02A 3EPNA 4MFEA 1UWQA 4AIUA 4FLSA 1CDGA 4NNBA 3MO4A 1JCXA 1WB0A 5GVJA 4NP7A 2E5AA 4GLEA 2VYOA 2O9OA 1R7OA 2BX7A 3QHNA 5AKQA 1Y0EA 3SCQA 1Y7VA 1VHCA 1V97A 3G1VA 4BY3A 5J04A 2IKIA 2HE8A 3MVIA 5FEXA 3A4WA 2W62A 2YDRA 2A85A 4ZO8A 1G7VA 4LUYA 4QCEA 4A21A 4EMIA 2A0NA 3C0LA 4HD5A 3I4KA 5D8ZA 5M3WA 3EEGA 1H1YA 5AYZA 2ON3A 4Q4QA 3G77A 2ABBA 5F1UA 3QH2A 1B3YA 1BVWA 2Z1KA 4CCDA 3CM4A 5C71A 1JFHA 3CPUA 4PUMA 3GDTA 3I6TA 3R6IA 4ZMGA 1SZRA 1OX6A 2DDXA 3B05A 2E6YA 3EPMA 1ZJAA 1LBMA 1DYSA 3C2FA 2QUUA 4H9XA 1JJKA 4FF7A 5LSMA 1H11A 3QXBA 4J3XA 4ZODA 3NVVB 1JPMA 2EEXA 3G6LA 4LF2A 4K68A 5A6BA 2PDWA 1M7PA 1J5TA 1NM9A 4IP4A 4U2ZA 3GKFA 1VS1A 3EMZA 3LNPA 3TAKA 1BWVA 3P7YA 1XIBA 2E25A 1R6WA 3A13A 4IQDA 4W7UA 2V5BA 2H8XA 3D5HA 4E4UA 2NXIA 2DH2A 1J10A 3MYPA 2D24A 5FS7A 4IT1A 3RCYA 4IGHA 5G1MA 5GPRA 1E5JA 3VNJA 3V16A 2Z2UA 4LWWA 1PKLA 3PZTA 2OX4A 4LBSA 2H3BA 3DI0A 1JNDA 3HOJA 3EX1A 3W72A 1YNYA 2D2JA 3DFQA 1R85A 3BL3A 5JMUA 4XKYA 1EQCA 1T3QC 5I09A 1FCQA 1SPQA 4OTKA 2FMOA 2ZRUA 4GUJA 4FK9A 3GG1A 4OUIA 1WP6A 2OTDA 3NZQA 2XUCA 4Y8EA 3V0TA 3Q6JA 1TZ7A 4JQAA 5D9MA 2BV9A 4AZ5A 1ODUA 3SCPA 4E2DA 1V03A 1K4QA 4YTSA 5IM51 3C61A 1EHAA 3RLHA 2J8FA 5D9PA 3P8IA 1P4CA 1D3CA 4ICCX 5FMHA 1FA2A 4W5UA 1E5NA 1QNVA 3IRDA 4QXIA 1CZ1A 5EMLA 4C60A 1EH9A 1B54A 4YWOA 1QI5A 2NQHA 1E71M 4US5D 5TBOA 3W2KA 1OGBA 3KVLA 3K8MA 4K36A 3M5ZA 1PIFA 4GUGA 1I2NA 1D7YA 2CETA 3WLRA 3EBVA 4C1KA 3DESA 4TVUA 2XN2A 3ZJ7A 5I3GA 1WKDA 1UC4A 1JDFA 3AN1A 4JFSA 1OJXA 1ADOA 3WLMA 2JKAA 3STGA 2NX1A 1U1JA 2VGFA 1U30A 1RVGA 2H90A 3H4GA 5I03A 1TFVA 1T96A 3LZ5A 3S83A 4FZIA 5A6SA 1AOGA 3EB4A 2VI0A 5JBFA 1A47A 4GXWA 4RXFA 1GQIA 4QISA 4DAFA 4JTRA 1NU5A 5BWAA 4ASTA 4F8XA 2HK0A 4PSRA 4S3EA 3GD4A 1TJ2A 3KL3A 4A8NA 1MW0A 4Q6XA 5E0CA 4EQXA 3I6RA 3LADA 3FAWA 1E4IA 3C2RA 3N2OA 3AYRA 1VBRA 2OO0A 3S2CA 3LLXA 4B9ZA 5FAGA 3RF9A 2J9XA 5XIAA 4NJIA 3VIMA 2WC3A 3CU2A 4KPRA 1OYAA 1JYVA 1G4TA 2GDVA 4JIEA 4W89A 4E3VA 2QT3A 1HTIA 5DMLA 3TROA 1J0YA 4HCDA 2YL8A 3W53A 4PMUA 1WUEA 2VGIA 1ONWA 1FHLA 2GVJA 2NX3A 4JTLA 3N2TA 4DX3A 1K02A 1RH9A 4PTMA 1TV7A 5JRBA 2FIQA 5HJLA 2WK2A 5JCLA 3SQSA 4XUGA 3IARA 3DEQA 4ZXLA 4ZO6A 2ZCGA 1UJPA 5HPCA 3LENA 4GQQA 1W1VA 1TWWA 4JN6A 2W79A 4L1WA 2X2GA 4C5ZA 3OEXA 2EG8A 2OFJA 4XKYB 3W01A 1W3NA 2A1YA 2XVGA 3HIJA 2BDQA 2VZSA 1EBHA 5IOBA 2CFFA 1XLCA 4HQVA 3D46A 2FKPA 3W02A 1JG9A 3CH0A 2CZDA 1WZAA 2X42A 4KERA 4QE4A 1YQ2A 4IH3A 1TA3B 1YYAA 4FS9A 1JRPA 3MZNA 1Z8AA 3AIQA 3W73A 3NPUA 1ODZA 1GTHA 5K3VA 3M0JA 4HA1A 1G94A 2WVSA 1VBUA 2NQLA 1C9WA 4ZQCA 3NURA 3GUGA 2V0TA 4PEKA 1V6VA 3PANA 4PH6A 3TYDA 4PCSA 1W9BM 5HNNA 5BU6A 3WH9A 1OCJA 2HISA 3U8GA 4LBRA 1DEDA 1K7FA 3NA8A 1FXPA 1FX6A 3ZR5A 4QDMA 1XIHA 1EYWA 2X1TA 4TTGA 2PTZA 5K7JA 4FOKA 2QJGA 4MLJA 1XDLA 4H9ZA 1T8XA 4HPGA 2F9RA 4MJ2A 4PTXA 4MWAE 3CYVA 2VUYA 3EKZA 4S3DA 5TF0A 3NEHA 1Q2SA 1JPKA 3OLEA 4GZ7A 2JBMA 1HJQA 4JIQA 4CCZA 1F3WA 3PHAA 3H7RA 3U0HA 4UQDA 3U48A 3CL7A 5ECVA 2Z28A 4FNPA 3H22A 3MKKA 3OZPA 2OT1A 3AIEA 1A53A 1VFFA 1LRTA 1IGWA 3M0LA 1TPC1 1ZL1A 3AJ7A 3GFYA 1MQQA 1MEWA 1ITUA 2V6OA 3ETRB 3OU8A 1LLWA 3P81A 1XGZA 1KLYA 3QJAA 1L0PA 1BVNP 5HK4A 2DZWA 2IKHA 3TJIA 4IQJA 3WFZA 5HWNA 5E6YA 1IF2A 4OJYA 3AS2A 2QUNA 2W61A 3ZZ1A 3THAA 1DJYA 1XLHA 2GUYA 1AW2A 3KZSA 2D73A 2YPIA 5FF3A 4F0RA 4CD4A 3UWYA 1YW1A 1EXBA 2J66A 2FZDA 2OT0A 3QFAA 4WXZA 3KVKA 1DWIM 1GRTA 2NPXA 4JKMA 3GNXA 4HHLA 5LNVA 1BTMA 4MMWA 4JNZA 2DSZA 2VO5A 3VA8A 3BXWA 3KZPA 2CBJA 1W2PA 3ITGA 1OG6A 4JN8A 5CAHA 5KZEA 5FF0A 1FWJC 1IWAA 2PCEA 3ZVHB 4R88A 1R3RA 3I65A 5LIKX 4PUEA 3AJXA 1OFDA 3VFCA 3N34A 4GUFA 4MADA 3CHCA 2X09A 4YHGA 2WNNA 2DFAA 3K4AA 3MV11 2WMIA 1RR2A 4JHOA 4MZ1A 2PBOA 3OZOA 1N55A 2TMDA 2E3ZA 1TIMA 1FWBC 4H9MA 5K4ZA 1A5MC 5JBEA 2BP1A 3UT0A 2VC6A 1VLIA 1W9DM 3M5XA 3B04A 2GGGA 2XDFA 1LWIA 3LCIA 3N9RA 2DSKA 2GOKA 3O6YX 1CWYA 4V28A 2PDGA 2XJ7A 1KWKA 3E3HA 1AZ2A 2V3GA 2EPOA 1LZOA 1TTQA 3WZ0E 4BR1A 1ZALA 3WK3A 1QW7A 2A6NA 3OQEA 2Q8XA 3WLQA 5D37A 3BARA 3D3AA 7XIMA 4DM1A 2PDIA 4S3KA 4JTUA 3AXKA 4QG8A 2YCLB 2QDHA 4A6GA 4PCNA 2QZRA 3UA3A 4OKDA 2P3EA 2V3EA 2P53A 2PPGA 5AVHA 1V5XA 2NVCA 1P0KA 3S0CA 3WL0A 1XUZA 5HJXA 2CLPA 6XIAA 1N8IA 3WD0A 2D23A 2Z26A 1QPQA 1BYAA 1O66A 3JUGA 4YLWA 4BF5A 4EX4A 1GOMA 2VXNA 3TA9A 1JQVA 2J62A 2WJEA 2GJLA 3JVAA 3PN8A 1KTBA 4FLRA 4HA0A 4L6DA 1REQA 2L5HA 1GRHA 1GW9A 3CAKA 4DJDD 1LF1A 3S42A 3DJJA 3S3GA 1VFTA 3VPLA 4NHVA 4EACA 3AIWA 1RUSA 1CXLA 2VOTA 3PFRA 2J6VA 3NQCA 1UKTA 6ALDA 1E6NA 1RA5A 3N25A 2FPTA 4URIA 1EJ7L 2PWUA 3SJ3A 3UXDA 4AG0A 4CNOA 3N4AA 4HPHA 1FWWA 3DYOA 3H6OA 1TZ9A 1YBQA 1MZHA 3A22A 1H63A 1H3GA 4AZGA 4Q4SA 5KZ6A 3C2EA 1BQGA 1KR1A 3G22A 2BXZA 2OSXA 4LNYA 5F2LA 4MOZA 3LI0A 3UCQA 1JI2A 3LXDA 4AH7A 2YL6A 3MO7A 4QQ3A 1O95A 1JZ8A 1Q6QA 1UH3A 2YQUA 3IJLA 1I6NA 1SJBA 4RNFA 3L4VA 1H1ZA 3WF3A 3OBAA 4IQEA 1MQPA 3MMTA 3O06A 4S3JA 2VEFA 1IR2A 2XN1A 1JGMA 2F8QA 4GH3A 4H6RA 1TUXA 3THCA 1OABA 4WUIA 4IP5A 4EKJA 4ZSUA 3VIOA 2WM1A 2XZ9A 3OTRA 4XUYA 3W1AA 3TJXA 2GJPA 3NYZA 4DJDC 4O10A 3QOKA 4K38A 4LSBA 4RJEA 3B9AA 1SFTA 2XH4A 7CGTA 5CGMA 4P8WA 1O68A 5AY7A 5EBAA 1BFNA 1AFSA 1F4AA 4YMZA 3KTCA 3G3DA 3W22A 4XD4A 4GX9A 4MJ4A 1G4PA 4GACA 3AUOA 3CGCA 3SFWA 3SAZA 2Z27A 2YVGA 2ZRWA 2YDSA 3D0CA 4D6GA 1RXOB 3KOXA 4TV5A 3N3TA 2OGYA 3NPWA 1JCNA 2FFIA 1W0MA 4UCFA 1X1ZA 1GQNA 3AMDA 2OKTA 1D8CA 1EJSC 5A5WA 1IXQA 1NTHA 4S2BA 5H8UA 4DI8A 3BC9A 4JTAA 4B3LA 2YW3A 1FFVC 1SB3B 1R2SA 1TPFA 3U4FA 4DIAA 3E2RA 1DHKA 1UD3A 9CGTA 4AD5A 3BAJA 3NQEA 2YVJA 3QV7A 2X50A 5LA0A 1W31A 3MI3A 4A3QA 3PVFA 5C0QA 2E40A 4PBGA 1J11A 4BQ4A 1R5YA 4R33A 5D2VA 3AMZA 1JL8A 4GR1A 4KCUA 2GR1A 3QLLA 3SDOA 1PAMA 1PIGA 2IPFA 1X6LA 2ZOXA 3K2GA 3BGGA 1RD6A 5D38A 3CUJA 3LCXA 3R58A 4B3ZA 1W9XA 1RJPA 1AODA 1J0ZA 3IV3A 1UWIA 3W0KA 2FDSA 3ZJ6A 2VFEA 3VILA 4HCLA 4CKQA 3WEMA 4WGHA 1P1XA 1VCFA 3WLLA 5F2GA 2POZA 4WIWA 4FALA 5HWMA 4LEQA 4GG9A 5DRIA 2XM1A 2XM2A 3ANYA 3GHTA 2XIBA 4NI3A 1NIUA 2E77A 4M3PA 4HSNA 2ONEA 2Z0IA 3V5OA 3B9EA 4H00A 3KWXA 2YZ5A 2BVYA 4PCFA 4O0ZA 4D6JA 4XBKA 3BG3A 3LCWA 5AB3A 5HUPA 4HZ7A 3Q94A 1OWQA 4AF0B 3STFA 3VNLA 1P43A 2PRMA 3T05A 2YBTA 3WDPP 1NF7A 3A64A 4LYPA 3NDYA 2HRWA 1MWOA 1WDDA 4RNJA 2A21A 3DHUA 5FL1A 4P8XA 4AHQA 3I7QA 4X0VA 4ADSA 4FPSA 1M6IA 3S9IA 3I6EA 3FJ4A 3W7RA 4O0QA 5LZLA 1E6PA 4W93A 3T81A 3RCMA 3VMOA 2QLYA 3THDA 2OO6A 2BCPA 3S6TA 2O9TA 4W9TA 1EIBA 1FRBA 1TQJA 4DLMA 2WSYA 1PTDA 4UTTA 1CXEA