1LPFA

Three-dimensional structure of lipoamide dehydrogenase from pseudomonas fluorescens at 2.8 angstroms resolution. analysis of redox and thermostability properties
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
472
structure length
472
Chain Sequence
SQKFDVVVIGAGPGGYVAAIRAAQLGLKTACIEKYIGKEGKVALGGTCLNVGCIPSKALLDSSYKYHEAKEAFKVHGIEAKGVTIDVPAMVARKANIVKNLTGGIATLFKANGVTSFEGHGKLLANKQVEVTGLDGKTQVLEAENVIIASGSRPVEIPPAPLSDDIIVDSTGALEFQAVPKKLGVIGAGVIGLELGSVWARLGAEVTVLEALDKFLPAADEQIAKEALKVLTKQGLNIRLGARVTASEVKKKQVTVTFTDANGEQKETFDKLIVAVGRRPVTTDLLAADSGVTLDERGFIYVDDHCKTSVPGVFAIGDVVRGAMLAHKASEEGVMVAERIAGHKAQMNYDLIPSVIYTHPEIAWVGKTEQTLKAEGVEVNVGTFPFAASGRAMAANDTTGLVKVIADAKTDRVLGVHVIGPSAAELVQQGAIGMEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGHAIHIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DIHYDROLIPOAMIDE DEHYDROGENASE
publication title Three-dimensional structure of lipoamide dehydrogenase from Pseudomonas fluorescens at 2.8 A resolution. Analysis of redox and thermostability properties.
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 150
structure length 472
sequence length 472
chains with identical sequence B
ec nomenclature ec 1.8.1.4: Dihydrolipoyl dehydrogenase.
pdb deposition date 1992-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1lpfA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1lpfA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1lpfA02
1TDNA 2UZZA 3WE0A 1E1LA 3GWFA 3LXDA 3QFAA 3RNMA 3HZLA 1CF3A 3GWDA 4I59A 1H86A 2GR3A 1YKJA 2RABA 5TR3A 1Z6LA 3NG7X 2BXSA 5ER0A 1V59A 1DOEA 4CY6A 2Z5XA 2A87A 2Z5YA 3CGEA 1LJ1A 2ACZA 2YG7A 1GOSA 3LZXA 4Z24A 1D7LA 2FJDA 1F8SA 4JNAA 5KXJA 4HB9A 3DK8A 3NK0X 4P9SA 4GCMA 3URHA 4U2TA 3NK2X 4USQA 2C7GA 5J60A 4H4XA 2X8HA 4H4TA 3NYCA 3CNDA 3S5WA 2EQ7A 2BCGG 1VRQB 5CKUA 1B4VA 4U8MA 1LTXR 2AAQA 4LU6A 5FS7A 2GVCA 2XFUA 4YTMA 4B64A 5KWFA 1DOBA 1NAAA 1LVLA 2YR4A 3AYIA 1KSUA 3DGHA 1ZK7A 1YQ4A 2BK4A 1EL8A 2CVJA 4EM3A 3REDA 5IQ1A 4C77A 3CIRA 1H6VA 4USRA 3GSIA 1K0JA 2YWLA 5KVIA 4CCQA 4CNJA 1O5WA 1ZMDA 2BXRA 1H7XA 4DGKA 4ZCCA 2YVFA 2GV8A 4U8JA 1PBBA 4DSGA 3L1RA 1F8RA 4CBQA 3KLJA 1KNPA 1S3BA 4RG3A 1ZDLA 3IC9A 2VVLG 1D4EA 2V3BA 2C3CA 4MJWA 3EPTA 2Y6RA 4NEWA 1GTHA 1PXBA 2FJAA 3L8KA 4J2WA 1E1NA 4GDPA 3F8PA 4CY8A 2F5ZA 1JOAA 3D8XA 2C64A 1B8SA 1GRTA 1CC2A 3SGLA 3NH3X 4AT0A 3G5QA 5IQ4A 3LB8A 5GRTA 1E6EA 3D1CA 1GRBA 2BK5A 3FIMB 2OLNA 3NNEA 4X9NA 2YG6A 4JNQA 2R0GA 4UDQA 4XWRA 4A79A 2V5ZA 4TM0A 1YQZA 3AEDA 3AECA 2R45A 1JU2A 1GXFA 2WU2A 1L0VA 3QJ4A 1NHQA 1ZMCA 2XLUA 2WP5A 4TLZA 1RSGA 3OZ2A 2BC1A 1Q9IA 1ZOVA 1CBOA 4O5UA 1GREA 4NZHA 5J7XA 1DXLA 3BNUA 3KVEA 3QFBA 3C96A 1Y56B 4U8KA 4WCTA 2XVEA 2YLWA 3II4A 3LOVA 2Q0KA 3NGCX 3GYJA 1GRHA 4B67A 3CGDA 4OPGA 3VRBA 4AP3A 2YR5A 1PS9A 3ADAB 1GPEA 2BS3A 2WBAA 5CQFA 4EMIA 3RP8A 2XLSA 1GEUA 2VRLA 4K5RA 2O9ZA 1EL7A 4EQWA 5JCMA 4EMJA 3K7TA 3UP5A 2ZZBA 3AYJA 2I0ZA 3ALMA 3NT6A 3AE6A 1RYIA 1N1PA 2CULA 2NPXA 1GT8A 3UOYA 1MXTA 2VVMA 4NTCA 3E1TA 4U2SA 3UOZA 4REKA 2OA1A 2VOUA 5BULA 3AE2A 1H84A 2TPRA 5KOWA 5U1OA 3P4PA 5M0ZA 3VQRA 3C4AA 2YG4A 3PO7A 4UP3A 3ATRA 2WPEA 1NENA 5EB4A 3UKKA 2A89A 2ZZCA 3NN0X 4KPRA 2E5VA 1ONFA 3KA7A 3DK4A 2GR0A 2BK3A 2V60A 1H81A 2BYBA 4RG4A 2GMJA 1E1MA 4ADWA 4OPTA 2B7SA 3UKFA 3BNMA 2XVHA 4EQSA 1KF6A 3NN6X 3AE9A 4H2PA 4IV9A 1PJ6A 3P1WA 3GRSA 1O95A 3VRDB 3ICSA 3VR8A 1KFYA 4U2LA 2W0HA 4GRTA 4B65A 3EANA 2GR2A 2APGA 2FBWA 2GRTA 4OCGA 4YSXA 3GDNA 3GDPA 1CJ4A 3C4NA 4IVOB 1M6IA 4M52A 1PJ7A 3SQPA 5JCIA 1NHPA 1GETA 4PABA 1IUTA 2R4EA 3S61A 2E1MA 4JN9A 2C73A 1ZY8A 1TDFA 3BHKA 3B6DA 4AOXA 3DA1A 3UOXA 3LADA 4JY3A 1LV0A 3GD4A 1JEHA 3AB1A 2WPFA 2X50A 2GB0A 1O94A 3CN8A 1NPXA 3M13A 1DODA 4H7UA 4C5OA 1PN0A 1NEKA 4C3YA 4X9MA 3NTDA 2PHHA 2BS4A 4OPUA 2ARDA 5IPYA 1CC4A 4EQXA 2WPCA 1GV4A 3FBSA 3NTAA 2WS3A 1REOA 1PXAA 1JRYA 3EAOA 1YY5A 2R0PA 3G5RA 4UDRA 4NTDA 4XXGA 3UKAA 2V6OA 3GMBA 1LQTA 4OVIA 4K7ZA 2WP6A 1PJ5A 3RP6A 3VRAA 1BZLA 4ICYA 3UTGA 1K0IA 4A6NA 5JCNA 1XPQA 2V61A 3ALLA 2RGHA 3SM8A 4JY2A 3AEBA 3V3NA 4K5SA 3AEGA 3VR9A 2GH5A 4D03A 2C67A 5HYMA 3P4SA 1IUSA 1TDOA 3CPJG 1HYUA 4H2QA 4RSLA 1YQ3A 1CC6A 4U8NA 5DBJA 3AYLA 3T37A 4A9WA 1B37A 1VQWA 2JAEA 2JB2A 1N4WA 1ELIA 3F8RA 4TM4A 4EMWA 3CNPA 2XCGA 2C3DA 1ZX9A 3K7QX 3UTHA 2XVJA 2C66A 1QJDA 1OJTA 2JK6A 3PVCA 4Y4LA 3NYEA 3UP4A 1DNCA 3CPIG 3KKJA 1PXCA 4UDPA 3UCLA 4BK2A 1KDGA 1QO8A 4EM4A 2R4JA 2WDRA 4C3XA 4YT0A 4N9XA 1ZP0A 4CRTA 5HHFA 3NRNA 4TM1A 2X99A 4YSHA 2CFYA 2WOIA 1ZKQA 3UTEA 3O0HA 2B7RA 2C76A 5FS6A 2B9XA 2C72A 5GSNA 3M0OA 3BHFA 2WDQA 1BKWA 4NEVA 1XDIA 2XVFA 4U8IA 4YTPA 3DJJA 3JSKA 1LQUA 4IA5A 4U8PA 4EIPA 4H4SA 1S2YA 2A8XA 4ECHA 3AXBA 2C70A 2JBVA 1IUWA 3ALJA 1SEZA 2QAEA 1Q1RA 1AOGA 5BVAA 4H2RA 4YTNA 3DJGX 2BS2A 3LZWA 3CGBA 5KRQA 1FEBA 4AP1A 2V3AA 3UKHA 3BI5A 4J34A 1X31B 1Q1WA 1QLBA 2WOVA 4H2NA 3GRTA 2XFQA 4YSZA 4D04A 4K2XA 4FDCB 4BK3A 5FMHA 1EL5A 1L9DA 3DJEA 4BK1A 4AOSA 3CGCA 1IUUA 2JB3A 4YKGA 1GRFA 1DJNA 2YLSA 4OPCA 4OPIA 3QVRA 1GESA 1H82A 1OJ9A 2WU5A 3LJPA 3QSEA 2YAUA 4APNA 2YLXA 1JNZA 4H4PA 2JB1A 1LPFA 4GDEA 4IA6A 3UKPA 1NHRA 3GMCA 1CL0A 3V3OA 3AE5A 4NTEA 4BV6A 3SFEA 4Y4MA 4Z44A 5FS8A 4ZN0A 2YLTA 3V76A 4Z43A 5EOWA 1GRAA 1IUXA 4TLXA 4Z2UA 2Q7VA 1GNDA 4HA6A 1COYA 4B66A 2VZ2A 4DNAA 1BF3A 1ZOYA 3DK9A 4GF7A 1PBDA 3IWAA 3RP7A 2XLRA 1VDCA 3P4RA 4IVMB 1DOCA 4A7AA 2EQ6A 2BCPA 1VG0A 3ZDNA 3NHOX 4ZCDA 1KNRA 4BJYA 5JCLA 5C3JA 2IVEA 3B3RA 1PBFA 3CNSA 2XDOA 4EQRA 3COXA 4B68A 2WP9A 3QSSA 4J36A 4PAAA 2GEWA 4Y4NA 4K8DA 3IF9A 1IJHA 4GUVA 4J33A 1Y56A 2C65A 3AE4A 3H4KA 4YXDA 2C75A 2VVLA 4A99A 1N4VA 3AE8A 2B9WA 3UKLA 3DMEA 2H89A 4A5LA 4DSHA 3IHMA 2B9YA 2TMDA 5EB5A 2XLTA 3H8LA 2GQWA 2GAGB 5C2TA 3UOVA 1VG9A 5FS9A 3NKSA 1K0LA 2WESA 2X8CA 3P9UA 3NK1X 2QCUA 2GQFA 2RGJA 4K22A 4YWOA 2WOWA 1IUVA 2Y6QA 2ZZ0A 4LIIA 2JKCA 2OLOA 1OJAA 1E1KA 4H4QA 2XYOA 3G5SA 3I6DA 1NG4A 3QVPA 1PBCA 4J57A 2Q0LA 4KX6A 3SFDA 2GF3A 2E4GA 4JDRA 2VQ7A 3AWIA 3BI2A 4B1BA 2IIDA 2YG5A 3CTYA 3R9UA 1N4UA 1OJDA 4TM3A 5BUKA 2PYXA 2WEUA 4OPDA 2FJEA 2QA1A 3KPFA 1CHUA 1NG3A 2VRMA 1GTEA 2YVJA 4OPLA 1MOKA 1MO9A 4FK1C 4Z2RA 2R46A 3DH9A 1W4XA 2DKIA 2YM2A 2NVKX 3OC4A 2OALA 1F6MA 1D4DA 1TDKA 3DJDA 4I58A 4BURA 1E39A 1FECA 2YVGA 1PDHA 2WETA 4FX9A 2YG3A 1BGJA 3AE1A 1H83A 3K7MX 3KD9A 1CJCA 4CNKA 1FOHA 1GERA 4H50A 3ISHA 1D7YA 4LA1A 3ICRA 2IVDA 2XFPA 1H7WA 1S3EA 1JNRA 1D5TA 2GR1A 5JCKA 4FK1A 2VQBA 4Z2TA 5BRTA 3AD8B 4J56A 1TRBA 5U25A 1Y0PA 2YLRA 2FJBA 1F8WA 3AD7B 2BC0A 5L46A 2R9ZA 5M10A 1NDAA 1EL9A 3AEEA 5KOXA 1K4QA 3AEAA 2XLPA 1BWCA 4H4ZA 1D4CA 1RP0A 2B76A 1FEAA 5EBKA 3ABVA 2OAMA 3FPZA 4J31A 1P2HA 3IHGA 3GYIA 4BJZA 1PHHA 1L9EA 5KVHA 3ATQA 1XANA 3AEFA 3H8IA 1FCDA 1F3PA 1TYTA 2H88A 4H4WA 3M12A 1L9CA 4XWZA 1TDEA 1OJCA 4Z26A 3Q6JA 2XFOA 1GSNA 4JQ9A 3ICTA 4Z25A 2RGOA 2WDVA 2WQYA 1TYPA 2ZBWA 2YM1A 4WX1A 3DGZA 1PBEA 3P4QA 2EQ8A 4O5QA 2YQUA 3RHAA 2X8GA 3CNJA 3F8DA 4C74A 4B63A 1M64A 1B5QA 1S2QA 5HY5A 4E0VA 3FMWA 2BABA 4GR1A 1DJQA 2WHDA 1NHSA 1XHCA 1CJ2A 1E7PA 2BA9A 4AT2A 4YSYA 1EBDA 4U8LA 3PS9A 3NYFA 4A6NB 3GD3A 4YKFA 2X3NA 3UTFA 2CDUA 3QSMA 2AR8A 1GALA 2GMHA 1GRGA 1JRXA 3AE3A 3EF6A 1FL2A 4U8OA 4EIQA 1KSSA 3AD9B 3ITJA 2YLZA 3Q9TA 2EQ9A 3BI4A 2HQMA 3NIXA 3ZYXA 5LV9A 4H4UA 1CJ3A 3I3LA 4H4RA 5HXIA 2QA2A 1UKVG 3CPHG 3KU9A 2XVIA 2DKHA 2XFNA 2J3NA 2GAHB 2AQJA 1BGNA 3AE7A 2YR6A 4CCRA 3NLCA 4A65A 2BACA 3CNTA 1JRZA 4B69A 1P2EA 3K30A 2R0CA 4H4YA 4X4JA 5U63A 3UKQA 4H4VA 3FG2P 2Q6UA
chains in the Genus database with same CATH superfamily
4I59A 3SZCA 5FJRA 2E3TA 4CY6A 1DOEA 2Z5XA 3NZGA 4GYPC 5ENLA 4E4UA 4Z24A 4G9KA 4JNAA 3DK8A 3SSZA 3NK2X 2X8HA 4H4TA 3CNDA 3S5WA 1B4VA 4G7FA 1DOBA 3ZVIA 1LVLA 3AYIA 1YQ4A 4EM3A 3VFCA 3N6JA 3CIRA 4USRA 4CNJA 2GV8A 3HPFA 4CBQA 3SJNA 4RG3A 2VVLG 1D4EA 3DIPA 2Y6RA 2FJAA 1E1NA 4GDPA 1GRTA 3SGLA 4AT0A 5IQ4A 2YG6A 2R0GA 3AEDA 3NVZB 2R45A 4K1WA 3OZMA 1RSGA 4NZHA 3KVEA 3LOVA 3II4A 2Q0KA 1GRHA 1MNSA 4EMIA 2O9ZA 3R0UA 4EQWA 2XH0A 1RYIA 2CULA 3UOYA 1MXTA 2VVMA 3IJIA 4NTCA 3UOZA 4G6HA 2OA1A 5BULA 3AE2A 3A7AA 2GGHA 2TPRA 5U1OA 3PO7A 3ATRA 4KT2A 3R10A 3H7VA 4HNLA 4II2A 3DK4A 2V60A 4RG4A 2GMJA 2POZA 3DESA 4EWJA 3AE9A 4DHGA 4IV9A 2BRAA 3GRSA 3VRDB 4GFIA 1KFYA 3EANA 1N62C 4OCGA 2GRTA 1CJ4A 4HPNA 1IUTA 4ZCWA 1FO4A 4JN9A 3UOXA 3U4FA 1LV0A 2WPFA 4K2SA 1PN0A 2P3ZA 1NEKA 5IPYA 1TKKA 4EQXA 1GV4A 3DERA 3EAOA 2QGYA 4XXGA 3DFHA 3RP6A 3VC6A 1XPQA 3ALLA 2RGHA 2QJMA 3V3NA 2GH5A 3IK4A 3RITA 2C67A 4H2QA 1YQ3A 5KNLA 2JB2A 3CNPA 2XCGA 2C3DA 1VQZA 3VCNA 3AM9A 3NYEA 1DNCA 3KKJA 3UCLA 2WDRA 4N9XA 2CFYA 2WOIA 1SJBA 1ZKQA 1F9CA 1BKWA 2PTYA 4NEVA 4YTPA 4IP4A 3DJJA 4GAPA 4H1ZA 4IA5A 4H4SA 1S2YA 1JPDX 2C70A 2JBVA 3ALJA 1SEZA 2PTZA 1Q1RA 4DN1A 5BVAA 4H2RA 4YTNA 1FEBA 3UKHA 1Q1WA 4YSZA 2XH2A 3V5CA 2OVLA 4A3RA 2ZC8A 4AOSA 2JB3A 1GRFA 3N4FA 1OJ9A 3QSEA 3R0KA 2YLXA 4IA6A 3GMCA 2QDDA 3V3OA 4NTEA 4BV6A 3V76A 3TCSA 1GRAA 5EOWA 4TLXA 4Z2UA 3DK9A 3IWAA 3RP7A 1DOCA 2W3RA 5C3JA 5JCLA 3B3RA 2PA6A 2XDOA 4EQRA 4B68A 4J36A 4K8DA 1IJHA 4FP1A 3H4KA 3AE8A 2OX4A 3DMEA 4A5LA 3HRDC 4DSHA 3IHMA 3BSMA 2B9YA 5FS9A 5FJPA 3P9UA 1IUVA 2JKCA 2OLOA 3QVPA 3TQPA 3SFDA 4J57A 3TJIA 2OG9A 2PYXA 4JN7A 4OPDA 3CAWA 1NG3A 2VRMA 1GTEA 4OPLA 1MO9A 4Z2RA 5G5GB 1PDYA 3ZVHB 4I58A 4BURA 3QKEA 2YVGA 3K7MX 4GISA 1BGJA 3KD9A 3P3BA 3T2KA 4CNKA 4GIRA 5JCKA 3DDMA 2VQBA 4Z2TA 3H12A 2BC0A 5M10A 1NDAA 3AEEA 3UJSA 3ES7A 3NRZB 4HCLA 1RP0A 3FPZA 2OFJA 2P0IA 2ONEA 3NXLA 4H4WA 3M12A 1L9CA 1JCTA 1XPYA 1TDEA 2WDVA 3P4QA 3F8DA 3SY4A 5KMPA 1B5QA 1S2QA 2WHDA 2BA9A 1E7PA 4AT2A 4YSYA 1EBDA 4JHMA 3UJEA 3SZFA 2AKMA 3GY1A 3EF6A 4U8OA 2W3SA 3VDGA 3ZYXA 1WUEA 2QA2A 3CPHG 3T8QA 3AE7A 2YR6A 4X4JA 2Q6UA 1TDNA 3GWFA 3GWDA 2GR3A 3FVDA 5TR3A 1Z6LA 3NG7X 3CGEA 1LJ1A 1GOSA 3LZXA 2FJDA 1F8SA 4P9SA 4USQA 3TW9A 3NYCA 4U8MA 1LTXR 2AAQA 2GVCA 2XFUA 4GAVA 1OEPA 1ZK7A 2BK4A 1EL8A 3VCCA 4C77A 1K0JA 2QQ6A 1O5WA 1ZMDA 1H7XA 4DGKA 2YVFA 1PBBA 3L1RA 3KLJA 1S3BA 1ZDLA 2PODA 3IC9A 4M0XA 4MJWA 1PXBA 3L8KA 3MZNA 3D8XA 2C64A 1B8SA 2BK5A 2OLNA 3NNEA 4UDQA 4TVWA 1YQZA 4IHCA 3AECA 1JU2A 3QJ4A 1ZMCA 2XLUA 2WP5A 4TLZA 1Q9IA 1GREA 1ZXIC 3QFBA 1N60C 4WCTA 2XVEA 3FYYA 3GYJA 3RRAA 3I6TA 4OPGA 4AP3A 2YR5A 1PS9A 3ADAB 2BS3A 4K5RA 2NQLA 5JCMA 3K7TA 3UP5A 3ALMA 3NT6A 3S47A 3ZVHA 1N1PA 2NPXA 3RO6A 1FHVA 3E1TA 4U2SA 1JDFA 1KD0A 3P4PA 3C4AA 4G8TA 2E5VA 1ONFA 3KA7A 1H81A 2BYBA 4ADWA 3UCDA 3UKFA 1KF6A 4H2PA 3ICSA 1WYGA 3H70A 4U2LA 4GRTA 3GDNA 7ENLA 1PJ7A 5JCIA 3OTRA 5IDZA 2E1MA 1ZY8A 2PCEA 1TDFA 3BHKA 1EBHA 4KPLA 3JZUA 3GD4A 1JEHA 3R25A 4C5OA 2C4CA 4X9MA 2PHHA 2BS4A 4OPUA 3FBSA 1N63C 2GGGA 1YY5A 2R0PA 4NTDA 1LQTA 4OVIA 4K7ZA 1K0IA 2AL1A 5JCNA 2V61A 3D46A 4GYPA 3AEBA 4A35A 4J1OA 3VR9A 4RSLA 1IUSA 1CC6A 5DBJA 1WUFA 1N4WA 3K7QX 4G74A 3UTHA 3ZLFA 2C66A 3RCYA 1OJTA 3UP4A 3MUCA 4UDPA 1PXCA 4BK2A 4C3XA 1QO8A 4EM4A 1X2GA 5HHFA 4TM1A 2X99A 4YSHA 3P93A 3UTEA 5KMSA 3BHFA 4IL0A 1FHUA 3EEZA 1LQUA 4ECHA 1IUWA 1T3QC 1R6WA 3DJGX 3LZWA 5KRQA 2V3AA 3SZ0A 1X31B 3GRTA 2XFQA 5FMHA 1L9DA 3T0KA 4BK1A 3AN1A 4OPIA 2WU5A 2YAUA 3T4WA 4GDEA 3UKPA 4J3ZA 4Y4MA 4ZN0A 5BOEA 1IUXA 3FV9A 4HA6A 3CYJA 1ZOYA 2OQYA 2XLRA 2P88A 4ZCDA 1KNRA 2XGZA 2WP9A 4HCHA 4J33A 4YXDA 2C75A 2VVLA 2B9WA 3UKLA 3TWAA 2OO6A 2TMDA 2XLTA 3I4KA 2GQWA 2GAGB 3H8LA 1VG9A 2WESA 2X8CA 4K22A 4YWOA 2Y6QA 1OJAA 1E1KA 3G5SA 4KX6A 2XSXA 3AWIA 2HXTA 4GGBA 2IIDA 3R11A 1OJDA 5BUKA 3KPFA 3KPKA 3EKGA 2R46A 3DH9A 2DKIA 3U9IA 2NVKX 3OC4A 3HYXA 1TDKA 3DJDA 1FECA 2WETA 4FX9A 1H83A 4DXKA 2PP1A 1BKHA 1D7YA 4LA1A 3ICRA 2IVDA 3TTEA 2GR1A 4G73A 4J56A 5L46A 1ELSA 2R9ZA 1P43A 1EL9A 5KOXA 5FJOA 1BWCA 3VA8A 2OAMA 1P2HA 1F3PA 1N5XA 2RGOA 3RHAA 2YQUA 2HZGA 3CNJA 4B63A 1M64A 3TJ4A 3THUA 1TZZA 4GR1A 1DJQA 2AL2A 1NHSA 1CJ2A 3AMZA 3NYFA 4E6MA 3UTFA 2CDUA 2AR8A 1GALA 1GRGA 3AE3A 2PGWA 4EIQA 3Q9TA 3IJLA 2HQMA 5LV9A 4H4RA 5HXIA 4IL2A 3KU9A 2XVIA 2DKHA 2XFNA 3UJRA 3CNTA 1IYXA 4A65A 4B69A 3V5FA 1P2EA 2R0CA 3UKQA 2UZZA 1E1LA 3HZLA 3RNMA 1H86A 1YKJA 2DW7A 4IT1A 2BXSA 5ER0A 1V59A 5JRBA 3A7RA 4X2PA 3FXGA 2A87A 2Z5YA 3D47A 4ZA0A 5KXJA 3URHA 2RDXA 2C7GA 3CK5A 2EQ7A 2BCGG 5CKUA 5FS7A 4B64A 3DGHA 1H6VA 3FCPA 3NVVB 3GSIA 5KVIA 3UXKA 4DSGA 1F8RA 1RM6B 2V3BA 3EPTA 1GTHA 4CY8A 3F8PA 2F5ZA 1JOAA 2FYMA 5GRTA 3T9PA 1E6EA 3D1CA 4XWRA 4JNQA 4A79A 3PWGA 2V5ZA 2CHRA 5BOFA 1GXFA 2WU2A 5J7XA 1DXLA 3BOXA 3BNUA 3B97A 1SJCA 2YLWA 4B67A 3RP8A 1GPEA 2WBAA 1EL7A 4EMJA 2I0ZA 2OKTA 4REKA 2OZ8A 1H84A 4UP3A 1KKOA 2WPEA 1NENA 3UKKA 2A89A 4KPRA 2GR0A 3B9JB 2PPGA 4OPTA 1ONEA 2B7SA 3BNMA 2XVHA 2XH7A 3NN6X 1PJ6A 3P1WA 1O95A 4B65A 2W0HA 2GR2A 4E8GA 2APGA 3GDPA 3C4NA 4IVOB 3N4EA 1M6IA 1EC7A 1NHPA 3PK7A 4IP5A 2R4EA 2GGIA 3S61A 4ZOHB 2C73A 3DA1A 3LADA 4JY3A 3PFRA 2X50A 3DG6A 1O94A 3CN8A 1NPXA 1DODA 3SZWA 2PGEA 1CC4A 3VC5A 3NFUA 2WPCA 3NTAA 2WS3A 4H2HA 3BJSA 3G5RA 2PS2A 1BZLA 3SM8A 4FI4A 4K5SA 3S5SA 1TDOA 3T37A 4A9WA 1B37A 4ENLA 4TM4A 2XVJA 3GD6A 3PVCA 1MDLA 4Y4LA 3SN1A 3GC2A 4E5TA 2R4JA 4YT0A 1ZP0A 4CRTA 5FJTA 5FS6A 2B9XA 2C72A 5GSNA 3M0OA 5EU9A 1XDIA 4U8IA 3MKCA 3JSKA 4EIPA 2A8XA 1AOGA 4MMWA 3D9XA 3CGBA 4II3A 4AP1A 4J34A 1QLBA 4H2NA 4D04A 3H8AA 3DJEA 1IUUA 4APNA 3HYWA 1JNZA 4H4PA 3UJFA 3AE5A 4Z44A 2YLTA 3T2YA 3V3WA 1GNDA 1COYA 4B66A 4YWSA 1VDCA 4A7AA 2BCPA 3NHOX 4BJYA 3CNSA 3COXA 3TOYA 3QSSA 2HXUA 4Y4NA 3IF9A 3TWBA 2C65A 4A99A 3GYXA 3HW2A 2GL5A 5C2TA 1K0LA 3NK1X 2QCUA 2RGJA 4NWZA 2HNEA 2QVHA 4LIIA 3I6DA 3WE0A 2Q0LA 3SN4A 4GGHA 3BI2A 4B1BA 3UCCA 3NVWB 1N4UA 4TM3A 3EUB3 2QA1A 1CHUA 1SJAA 2YVJA 1MOKA 3CXOA 4FK1C 4A6GA 1W4XA 3MSYA 1F6MA 1MRAA 1E39A 2AL2B 1PDHA 3AE1A 1CJCA 3QN3A 2XFPA 1H7WA 1S3EA 1JNRA 1D5TA 2BRYA 4FK1A 3NVYB 5BRTA 3AD8B 5U25A 1Y0PA 1KCZA 2FJBA 2PSNA 3STPA 1FFUC 3JVAA 2XLPA 4Z17A 4H4ZA 1D4CA 3SQSA 2B76A 5EBKA 4J31A 3IHGA 2XH4A 1PHHA 5KVHA 3ATQA 1XANA 3AEFA 1FCDA 3R07C 4G6GA 2H88A 4Z26A 2OQHA 2XFOA 1GSNA 4JQ9A 3DGZA 2EQ8A 2O56A 1NU5A 4HCDA 4C74A 4MGGA 2BABA 3KUMA 4A6NB 3GD3A 3QSMA 1FL2A 3RR1A 1KSSA 3AD9B 1N61C 2YLZA 3NIXA 1UKVG 4HNCA 1BGNA 4E4FA 1JRZA 5J04A 4H4YA 5U63A 2P8CA 2DW6A 3FG2P 6ENLA 3LXDA 3QFAA 2PP3A 1CF3A 2RABA 3ZLGA 1VDVA 3A7UA 2ACZA 2YG7A 1D7LA 2OLAA 3DEQA 4HB9A 1XS2A 3NK0X 4GCMA 4U2TA 2QJNA 3IJQA 5J60A 4H4XA 1VRQB 3NO1A 4LU6A 3T14A 4K8GA 4YTMA 3T2ZA 5KWFA 1NAAA 2YR4A 1KSUA 3REDA 2CVJA 5IQ1A 1STZA 4DYEA 2YWLA 2BXRA 1R0MA 4ZCCA 3MY9A 4U8JA 1KNPA 2C3CA 4H19A 4NEWA 1NELA 2PTXA 4J2WA 2P8BA 2PU1A 1CC2A 3NH3X 3G5QA 3LB8A 1GRBA 3FIMB 3QTPA 4X9NA 3ES8A 2ZADA 1ECQA 4TM0A 3OP2A 1L0VA 1NHQA 2GDQA 3OZ2A 2BC1A 1ZOVA 1CBOA 3SXIA 4O5UA 2W55A 3C96A 1RVKA 3DG3A 1Y56B 4U8KA 4TVYA 3NGCX 3CGDA 3VRBA 5CQFA 2XLSA 1GEUA 2VRLA 2W54A 1N5WC 2ZZBA 3AYJA 3AE6A 1GT8A 1FIQB 1W6TA 2VOUA 5KMRA 3P0WA 5KOWA 1X2HA 3VQRA 5M0ZA 2YG4A 5EB4A 2ZZCA 3NN0X 3L5OA 3SBFA 2BK3A 1E1MA 4EQSA 3VR8A 2FBWA 4YSXA 2QDEA 4M52A 3SQPA 4PABA 1GETA 1JRPA 3QLDA 3B6DA 4AOXA 4KEMA 2GB0A 3AB1A 1JROA 3M13A 4H7UA 3N6HA 4C3YA 4GMEA 3NTDA 2ARDA 1REOA 1TE6A 1PXAA 1JRYA 2E5AA 4DX3A 4UDRA 3UKAA 2V6OA 3GMBA 2WP6A 2OPJA 1PJ5A 3VRAA 4ICYA 3UTGA 3OW1A 4A6NA 4JY2A 4F4RA 3JW7A 1H2IA 3AEGA 4D03A 4Z1YA 5HYMA 3P4SA 3CPJG 1HYUA 3RGTA 4U8NA 3AYLA 1VQWA 2JAEA 1BQGA 1ELIA 3F8RA 4EMWA 1ZX9A 1KN0A 1QJDA 2JK6A 3CPIG 1KDGA 3NRNA 3O0HA 2B7RA 2PTWA 2C76A 2WDQA 2XVFA 1P48A 4U8PA 3AXBA 1EC9A 3CXBA 4IZGA 2QAEA 3ENLA 3UGVA 3UJ2A 2BS2A 3BI5A 3OZYA 2WOVA 3GO2A 2MNRA 4K2XA 4FDCB 1E9IA 4BK3A 1EL5A 3CGCA 4YKGA 5KMQA 3I6EA 1DJNA 2YLSA 4OPCA 3QVRA 1GESA 1H82A 3LJPA 2JB1A 1LPFA 1MDRA 1NHRA 1CL0A 3CMMA 1MUCA 3SFEA 5FS8A 4Z43A 1SB3B 2Q7VA 2VZ2A 4DNAA 1BF3A 4GF7A 3SR6B 2PU0A 3SN0A 1PBDA 4HN8A 1DTNA 3P4RA 2OZ3A 4IVMB 2EQ6A 4JN8A 1VG0A 3ZDNA 2IVEA 1PBFA 4PAAA 2GEWA 4GUVA 1Y56A 3AE4A 4HYRA 3Q45A 1N4VA 2H89A 2PP0A 5EB5A 3UOVA 3NKSA 5FJUA 2GQFA 2WOWA 3DGBA 2ZZ0A 2XYOA 4H4QA 4MKSA 1NG4A 1PBCA 2GF3A 2E4GA 4JDRA 4ROPA 2VQ7A 2YG5A 4NNJA 3CTYA 1PDZA 3MWCA 3R9UA 2WEUA 2FJEA 3MQTA 1EBGA 3T6CA 3ETRB 2GGJA 2YM2A 3K1GA 3UXLA 3V4BA 2OALA 1D4DA 3HYVA 2MUCA 2YG3A 1SJDA 1FOHA 1GERA 4H50A 3ISHA 5G5HB 3PG6A 3SYIA 4KWSA 1TRBA 2GGEA 2QJJA 3Q4DA 2YLRA 1F8WA 3AD7B 3T31A 4DWDA 3CT2A 1K4QA 3AEAA 3OPSA 1FEAA 3ABVA 3GYIA 4BJZA 1L9EA 3H8IA 1EC8A 1TYTA 3CB3A 1L8PA 4XWZA 1OJCA 3Q6JA 4Z25A 3ICTA 2WQYA 4WX1A 1TYPA 2ZBWA 2YM1A 4CCQA 1PBEA 4O5QA 3SX6A 2X8GA 3NS1B 3DG7A 3QPEA 5HY5A 4E0VA 3DFYA 3FMWA 1S7MA 1XHCA 1YEYA 1FFVC 3PS9A 4U8LA 4YKFA 2I5QA 2X3NA 1JPMA 2GMHA 1JRXA 2GSHA 3ITJA 2EQ9A 3BI4A 4H4UA 1CJ3A 3I3LA 1V97A 3ZLHA 2OZTA 4M6UA 3FJ4A 2J3NA 2GAHB 2AQJA 4H83A 2AKZA 4CCRA 3NLCA 2BACA 3K30A 2PMQA 2FKPA 1KKRA 4H4VA 3PWIA 3R1ZA
chains in the Genus database with same CATH topology
1TDNA 2UZZA 3WE0A 1E1LA 3GWFA 3LXDA 3QFAA 3RNMA 3HZLA 1CF3A 3GWDA 4I59A 1H86A 2GR3A 1YKJA 2RABA 5TR3A 3SZCA 1Z6LA 3NG7X 2BXSA 5ER0A 1V59A 1DOEA 4CY6A 2Z5XA 5JRBA 2A87A 2Z5YA 3CGEA 1LJ1A 2ACZA 2YG7A 1GOSA 3LZXA 4Z24A 4G9KA 1D7LA 2FJDA 1F8SA 4JNAA 5KXJA 4HB9A 3DK8A 3NK0X 4P9SA 4GCMA 3URHA 4U2TA 3NK2X 4USQA 2C7GA 5J60A 4H4XA 2X8HA 4H4TA 3NYCA 3CNDA 3S5WA 2EQ7A 2BCGG 1VRQB 5CKUA 1B4VA 4U8MA 1LTXR 2AAQA 4LU6A 5FS7A 3T14A 2GVCA 2XFUA 4YTMA 3T2ZA 4B64A 1DOBA 1NAAA 5KWFA 1LVLA 2YR4A 3AYIA 4GAVA 1KSUA 3DGHA 1ZK7A 1YQ4A 2BK4A 1EL8A 2CVJA 4EM3A 3REDA 5IQ1A 4C77A 3CIRA 1H6VA 4USRA 3GSIA 1K0JA 2YWLA 5KVIA 4CCQA 4CNJA 1O5WA 1ZMDA 2BXRA 1H7XA 4DGKA 4ZCCA 2YVFA 2GV8A 4U8JA 1PBBA 4DSGA 3L1RA 1F8RA 4CBQA 3KLJA 1KNPA 1S3BA 4RG3A 1ZDLA 3IC9A 2VVLG 1D4EA 2V3BA 2C3CA 4MJWA 3EPTA 2Y6RA 4NEWA 1GTHA 1PXBA 2FJAA 3L8KA 4J2WA 1E1NA 4GDPA 3F8PA 4CY8A 2F5ZA 1JOAA 3D8XA 2C64A 1B8SA 1GRTA 1CC2A 3SGLA 3NH3X 4AT0A 3G5QA 5IQ4A 3LB8A 5GRTA 1E6EA 3D1CA 1GRBA 2BK5A 3FIMB 2OLNA 3NNEA 4X9NA 2YG6A 4JNQA 2R0GA 4UDQA 4XWRA 4A79A 2V5ZA 4TM0A 1YQZA 3AEDA 3AECA 2R45A 1JU2A 1GXFA 2WU2A 1L0VA 3QJ4A 1NHQA 1ZMCA 2XLUA 2WP5A 4TLZA 1RSGA 3OZ2A 2BC1A 1Q9IA 1ZOVA 1CBOA 3SXIA 4O5UA 1GREA 4NZHA 5J7XA 1DXLA 3BNUA 3KVEA 3QFBA 3C96A 1Y56B 4U8KA 4WCTA 2XVEA 2YLWA 3II4A 3LOVA 2Q0KA 3NGCX 3GYJA 1GRHA 4B67A 3CGDA 4OPGA 3VRBA 4AP3A 2YR5A 1PS9A 3ADAB 1GPEA 2BS3A 2WBAA 5CQFA 4EMIA 3RP8A 2XLSA 1GEUA 2VRLA 4K5RA 2O9ZA 1EL7A 4EQWA 5JCMA 4EMJA 3K7TA 3UP5A 2ZZBA 3AYJA 2I0ZA 3ALMA 3NT6A 3AE6A 1RYIA 1N1PA 2CULA 2NPXA 1GT8A 3UOYA 1MXTA 2VVMA 4NTCA 3E1TA 4U2SA 4G6HA 3UOZA 4REKA 2OA1A 2VOUA 5BULA 3AE2A 1H84A 5KMRA 2TPRA 5KOWA 5U1OA 3P4PA 5M0ZA 3VQRA 3C4AA 2YG4A 3PO7A 4UP3A 3ATRA 2WPEA 1NENA 5EB4A 4II2A 2A89A 3UKKA 2ZZCA 3NN0X 4KPRA 2E5VA 1ONFA 3KA7A 3L5OA 3DK4A 2GR0A 2BK3A 2V60A 1H81A 2BYBA 4RG4A 2GMJA 1E1MA 4ADWA 4OPTA 2B7SA 3UKFA 3BNMA 2XVHA 4EQSA 1KF6A 3NN6X 3AE9A 4H2PA 4IV9A 1PJ6A 2BRAA 3P1WA 3GRSA 1O95A 3VRDB 3ICSA 3VR8A 1KFYA 4U2LA 2W0HA 4GRTA 4B65A 3EANA 2GR2A 2APGA 2FBWA 2GRTA 4OCGA 4YSXA 3GDNA 3GDPA 1CJ4A 3C4NA 4IVOB 1M6IA 4M52A 1PJ7A 3SQPA 5JCIA 1NHPA 1GETA 4PABA 1IUTA 2R4EA 3S61A 2E1MA 4JN9A 2C73A 1ZY8A 1TDFA 3BHKA 3B6DA 4AOXA 3DA1A 3UOXA 3LADA 4JY3A 1LV0A 3GD4A 1JEHA 3AB1A 2WPFA 2X50A 2GB0A 1O94A 3CN8A 1NPXA 3M13A 1DODA 4H7UA 3SZWA 4C5OA 1PN0A 1NEKA 2C4CA 4C3YA 4X9MA 3NTDA 2PHHA 2BS4A 4OPUA 2ARDA 5IPYA 1CC4A 4EQXA 2WPCA 1GV4A 3FBSA 3NTAA 2WS3A 1REOA 1PXAA 1JRYA 3EAOA 1YY5A 2R0PA 3G5RA 4UDRA 4NTDA 4XXGA 3UKAA 2V6OA 3GMBA 1LQTA 4OVIA 4K7ZA 2WP6A 1PJ5A 3RP6A 3VRAA 1BZLA 4ICYA 3UTGA 1K0IA 4A6NA 5JCNA 1XPQA 2V61A 3ALLA 2RGHA 3SM8A 4JY2A 3AEBA 3V3NA 4K5SA 1H2IA 3AEGA 3VR9A 2GH5A 4D03A 2C67A 5HYMA 3P4SA 1IUSA 1TDOA 3CPJG 1HYUA 4H2QA 4RSLA 1YQ3A 1CC6A 4U8NA 5DBJA 5KNLA 3AYLA 3T37A 4A9WA 1B37A 1VQWA 2JAEA 2JB2A 1N4WA 1ELIA 3F8RA 4TM4A 4EMWA 3CNPA 2XCGA 2C3DA 1ZX9A 3K7QX 4G74A 3UTHA 1KN0A 2XVJA 2C66A 1QJDA 1OJTA 2JK6A 3PVCA 4Y4LA 3NYEA 3UP4A 1DNCA 3CPIG 3KKJA 1PXCA 4UDPA 3UCLA 4BK2A 1KDGA 1QO8A 4EM4A 2R4JA 2WDRA 4C3XA 4YT0A 4N9XA 1ZP0A 4CRTA 5HHFA 3NRNA 4TM1A 2X99A 4YSHA 2CFYA 2WOIA 1ZKQA 3UTEA 3O0HA 2B7RA 2C76A 5FS6A 2B9XA 2C72A 5GSNA 3M0OA 5KMSA 3BHFA 2WDQA 1BKWA 4NEVA 1XDIA 2XVFA 4U8IA 4YTPA 3DJJA 4GAPA 3JSKA 1LQUA 4IA5A 4U8PA 4EIPA 4H4SA 1S2YA 2A8XA 4ECHA 3AXBA 2C70A 2JBVA 1IUWA 3ALJA 1SEZA 2QAEA 1Q1RA 1AOGA 5BVAA 4H2RA 4YTNA 3D9XA 3DJGX 2BS2A 3LZWA 3CGBA 5KRQA 1FEBA 4II3A 4AP1A 2V3AA 3UKHA 3BI5A 3SZ0A 4J34A 1X31B 1Q1WA 1QLBA 2WOVA 4H2NA 3GRTA 2XFQA 4YSZA 4D04A 4K2XA 4FDCB 4BK3A 5FMHA 1EL5A 1L9DA 3T0KA 3DJEA 4BK1A 4AOSA 3CGCA 1IUUA 2JB3A 4YKGA 5KMQA 1GRFA 1DJNA 2YLSA 4OPCA 4OPIA 3QVRA 1GESA 1H82A 1OJ9A 2WU5A 3LJPA 3QSEA 2YAUA 4APNA 3HYWA 2YLXA 1JNZA 4H4PA 2JB1A 1LPFA 4GDEA 4IA6A 3UKPA 1NHRA 3GMCA 1CL0A 3CMMA 3V3OA 3AE5A 4NTEA 4BV6A 3SFEA 4Y4MA 4Z44A 5FS8A 4ZN0A 2YLTA 3T2YA 3V76A 4Z43A 5EOWA 1GRAA 1IUXA 4TLXA 4Z2UA 2Q7VA 1GNDA 4HA6A 1COYA 4B66A 2VZ2A 4DNAA 1BF3A 1ZOYA 3DK9A 4GF7A 1PBDA 3IWAA 3RP7A 2XLRA 1VDCA 3P4RA 4IVMB 1DOCA 4A7AA 2EQ6A 2BCPA 1VG0A 3ZDNA 3NHOX 4ZCDA 1KNRA 4BJYA 5JCLA 5C3JA 2IVEA 3B3RA 1PBFA 3CNSA 2XDOA 4EQRA 3COXA 4B68A 2WP9A 3QSSA 4J36A 4PAAA 2GEWA 4Y4NA 4K8DA 3IF9A 1IJHA 4GUVA 4J33A 1Y56A 2C65A 3AE4A 3H4KA 4YXDA 2C75A 2VVLA 4A99A 1N4VA 3AE8A 2B9WA 3UKLA 3DMEA 3GYXA 2H89A 4A5LA 4DSHA 3IHMA 2B9YA 2TMDA 5EB5A 2XLTA 3H8LA 2GQWA 2GAGB 5C2TA 3UOVA 1VG9A 5FS9A 3NKSA 1K0LA 2WESA 2X8CA 3P9UA 3NK1X 2QCUA 2GQFA 2RGJA 4K22A 4NWZA 4YWOA 2WOWA 1IUVA 2Y6QA 2ZZ0A 4LIIA 2JKCA 2OLOA 1OJAA 1E1KA 4H4QA 2XYOA 3G5SA 3I6DA 1NG4A 3QVPA 1PBCA 4J57A 2Q0LA 4KX6A 3SFDA 2GF3A 2E4GA 4JDRA 2VQ7A 3AWIA 3BI2A 4B1BA 2IIDA 2YG5A 4NNJA 3CTYA 3R9UA 1N4UA 1OJDA 4TM3A 5BUKA 2PYXA 2WEUA 4OPDA 2FJEA 2QA1A 3KPFA 1CHUA 1NG3A 2VRMA 1GTEA 2YVJA 4OPLA 1MOKA 3KPKA 1MO9A 4FK1C 4Z2RA 2R46A 3DH9A 1W4XA 2DKIA 2YM2A 2NVKX 3OC4A 2OALA 1F6MA 3HYXA 1D4DA 1TDKA 3DJDA 3HYVA 4I58A 4BURA 1E39A 1FECA 2YVGA 1PDHA 2WETA 4FX9A 2YG3A 1BGJA 3AE1A 1H83A 3K7MX 3KD9A 1CJCA 3T2KA 4CNKA 1FOHA 1GERA 4H50A 3ISHA 1D7YA 4LA1A 3ICRA 2IVDA 2XFPA 3PG6A 1H7WA 1S3EA 1JNRA 1D5TA 2GR1A 5JCKA 2BRYA 4FK1A 3SYIA 2VQBA 4G73A 4Z2TA 5BRTA 3AD8B 4J56A 1TRBA 5U25A 1Y0PA 2YLRA 2FJBA 1F8WA 3AD7B 2BC0A 3T31A 5L46A 2R9ZA 5M10A 1NDAA 1EL9A 3AEEA 5KOXA 1K4QA 3AEAA 2XLPA 1BWCA 4H4ZA 1D4CA 1RP0A 2B76A 1FEAA 5EBKA 3ABVA 2OAMA 3FPZA 4J31A 1P2HA 3IHGA 3GYIA 4BJZA 1PHHA 1L9EA 5KVHA 3ATQA 1XANA 3AEFA 3H8IA 1FCDA 1F3PA 1TYTA 4G6GA 2H88A 4H4WA 3M12A 1L9CA 4XWZA 1TDEA 1OJCA 4Z26A 3Q6JA 2XFOA 1GSNA 4JQ9A 3ICTA 4Z25A 2RGOA 2WDVA 2WQYA 1TYPA 2ZBWA 2YM1A 4WX1A 3DGZA 1PBEA 3P4QA 2EQ8A 4O5QA 2YQUA 3RHAA 3SX6A 2X8GA 3CNJA 3F8DA 4C74A 3SY4A 4B63A 5KMPA 1M64A 1B5QA 1S2QA 5HY5A 4E0VA 3FMWA 2BABA 4GR1A 1DJQA 1S7MA 2WHDA 1NHSA 1XHCA 1CJ2A 1E7PA 2BA9A 4AT2A 4YSYA 1EBDA 4U8LA 3PS9A 3NYFA 4A6NB 3GD3A 3SZFA 4YKFA 2X3NA 3UTFA 2CDUA 3QSMA 2AR8A 1GALA 2GMHA 1GRGA 1JRXA 3AE3A 3EF6A 1FL2A 4U8OA 4EIQA 1KSSA 3AD9B 3ITJA 2YLZA 3Q9TA 2EQ9A 3BI4A 2HQMA 3NIXA 3ZYXA 5LV9A 4H4UA 1CJ3A 3I3LA 4H4RA 5HXIA 2QA2A 1UKVG 3CPHG 3KU9A 2XVIA 2DKHA 2XFNA 2J3NA 2GAHB 2AQJA 1BGNA 3AE7A 2YR6A 4CCRA 3NLCA 4A65A 2BACA 3CNTA 1JRZA 4B69A 1P2EA 3K30A 2R0CA 4H4YA 4X4JA 5U63A 3UKQA 4H4VA 3FG2P 2Q6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TDN A;  2UZZ A;  3WE0 A;  1E1L A;  3GWF A;  3LXD A;  3QFA A;  3RNM A;  3HZL A;  1CF3 A;  3GWD A;  4I59 A;  1H86 A;  2GR3 A;  1YKJ A;  2RAB A;  5TR3 A;  1Z6L A;  3NG7 X;  2BXS A;  5ER0 A;  1V59 A;  1DOE A;  4CY6 A;  2Z5X A;  2A87 A;  2Z5Y A;  3CGE A;  1LJ1 A;  2ACZ A;  2YG7 A;  1GOS A;  3LZX A;  4Z24 A;  1D7L A;  2FJD A;  1F8S A;  4JNA A;  5KXJ A;  4HB9 A;  3DK8 A;  3NK0 X;  4P9S A;  4GCM A;  3URH A;  4U2T A;  3NK2 X;  4USQ A;  2C7G A;  5J60 A;  4H4X A;  2X8H A;  4H4T A;  3NYC A;  3CND A;  3S5W A;  2EQ7 A;  2BCG G;  1VRQ B;  5CKU A;  1B4V A;  4U8M A;  1LTX R;  2AAQ A;  4LU6 A;  5FS7 A;  2GVC A;  2XFU A;  4YTM A;  4B64 A;  5KWF A;  1DOB A;  1NAA A;  1LVL A;  2YR4 A;  3AYI A;  1KSU A;  3DGH A;  1ZK7 A;  1YQ4 A;  2BK4 A;  1EL8 A;  2CVJ A;  4EM3 A;  3RED A;  5IQ1 A;  4C77 A;  3CIR A;  1H6V A;  4USR A;  3GSI A;  1K0J A;  2YWL A;  5KVI A;  4CCQ A;  4CNJ A;  1O5W A;  1ZMD A;  2BXR A;  1H7X A;  4DGK A;  4ZCC A;  2YVF A;  2GV8 A;  4U8J A;  1PBB A;  4DSG A;  3L1R A;  1F8R A;  4CBQ A;  3KLJ A;  1KNP A;  1S3B A;  4RG3 A;  1ZDL A;  3IC9 A;  2VVL G;  1D4E A;  2V3B A;  2C3C A;  4MJW A;  3EPT A;  2Y6R A;  4NEW A;  1GTH A;  1PXB A;  2FJA A;  3L8K A;  4J2W A;  1E1N A;  4GDP A;  3F8P A;  4CY8 A;  2F5Z A;  1JOA A;  3D8X A;  2C64 A;  1B8S A;  1GRT A;  1CC2 A;  3SGL A;  3NH3 X;  4AT0 A;  3G5Q A;  5IQ4 A;  3LB8 A;  5GRT A;  1E6E A;  3D1C A;  1GRB A;  2BK5 A;  3FIM B;  2OLN A;  3NNE A;  4X9N A;  2YG6 A;  4JNQ A;  2R0G A;  4UDQ A;  4XWR A;  4A79 A;  2V5Z A;  4TM0 A;  1YQZ A;  3AED A;  3AEC A;  2R45 A;  1JU2 A;  1GXF A;  2WU2 A;  1L0V A;  3QJ4 A;  1NHQ A;  1ZMC A;  2XLU A;  2WP5 A;  4TLZ A;  1RSG A;  3OZ2 A;  2BC1 A;  1Q9I A;  1ZOV A;  1CBO A;  4O5U A;  1GRE A;  4NZH A;  5J7X A;  1DXL A;  3BNU A;  3KVE A;  3QFB A;  3C96 A;  1Y56 B;  4U8K A;  4WCT A;  2XVE A;  2YLW A;  3II4 A;  3LOV A;  2Q0K A;  3NGC X;  3GYJ A;  1GRH A;  4B67 A;  3CGD A;  4OPG A;  3VRB A;  4AP3 A;  2YR5 A;  1PS9 A;  3ADA B;  1GPE A;  2BS3 A;  2WBA A;  5CQF A;  4EMI A;  3RP8 A;  2XLS A;  1GEU A;  2VRL A;  4K5R A;  2O9Z A;  1EL7 A;  4EQW A;  5JCM A;  4EMJ A;  3K7T A;  3UP5 A;  2ZZB A;  3AYJ A;  2I0Z A;  3ALM A;  3NT6 A;  3AE6 A;  1RYI A;  1N1P A;  2CUL A;  2NPX A;  1GT8 A;  3UOY A;  1MXT A;  2VVM A;  4NTC A;  3E1T A;  4U2S A;  3UOZ A;  4REK A;  2OA1 A;  2VOU A;  5BUL A;  3AE2 A;  1H84 A;  2TPR A;  5KOW A;  5U1O A;  3P4P A;  5M0Z A;  3VQR A;  3C4A A;  2YG4 A;  3PO7 A;  4UP3 A;  3ATR A;  2WPE A;  1NEN A;  5EB4 A;  3UKK A;  2A89 A;  2ZZC A;  3NN0 X;  4KPR A;  2E5V A;  1ONF A;  3KA7 A;  3DK4 A;  2GR0 A;  2BK3 A;  2V60 A;  1H81 A;  2BYB A;  4RG4 A;  2GMJ A;  1E1M A;  4ADW A;  4OPT A;  2B7S A;  3UKF A;  3BNM A;  2XVH A;  4EQS A;  1KF6 A;  3NN6 X;  3AE9 A;  4H2P A;  4IV9 A;  1PJ6 A;  3P1W A;  3GRS A;  1O95 A;  3VRD B;  3ICS A;  3VR8 A;  1KFY A;  4U2L A;  2W0H A;  4GRT A;  4B65 A;  3EAN A;  2GR2 A;  2APG A;  2FBW A;  2GRT A;  4OCG A;  4YSX A;  3GDN A;  3GDP A;  1CJ4 A;  3C4N A;  4IVO B;  1M6I A;  4M52 A;  1PJ7 A;  3SQP A;  5JCI A;  1NHP A;  1GET A;  4PAB A;  1IUT A;  2R4E A;  3S61 A;  2E1M A;  4JN9 A;  2C73 A;  1ZY8 A;  1TDF A;  3BHK A;  3B6D A;  4AOX A;  3DA1 A;  3UOX A;  3LAD A;  4JY3 A;  1LV0 A;  3GD4 A;  1JEH A;  3AB1 A;  2WPF A;  2X50 A;  2GB0 A;  1O94 A;  3CN8 A;  1NPX A;  3M13 A;  1DOD A;  4H7U A;  4C5O A;  1PN0 A;  1NEK A;  4C3Y A;  4X9M A;  3NTD A;  2PHH A;  2BS4 A;  4OPU A;  2ARD A;  5IPY A;  1CC4 A;  4EQX A;  2WPC A;  1GV4 A;  3FBS A;  3NTA A;  2WS3 A;  1REO A;  1PXA A;  1JRY A;  3EAO A;  1YY5 A;  2R0P A;  3G5R A;  4UDR A;  4NTD A;  4XXG A;  3UKA A;  2V6O A;  3GMB A;  1LQT A;  4OVI A;  4K7Z A;  2WP6 A;  1PJ5 A;  3RP6 A;  3VRA A;  1BZL A;  4ICY A;  3UTG A;  1K0I A;  4A6N A;  5JCN A;  1XPQ A;  2V61 A;  3ALL A;  2RGH A;  3SM8 A;  4JY2 A;  3AEB A;  3V3N A;  4K5S A;  3AEG A;  3VR9 A;  2GH5 A;  4D03 A;  2C67 A;  5HYM A;  3P4S A;  1IUS A;  1TDO A;  3CPJ G;  1HYU A;  4H2Q A;  4RSL A;  1YQ3 A;  1CC6 A;  4U8N A;  5DBJ A;  3AYL A;  3T37 A;  4A9W A;  1B37 A;  1VQW A;  2JAE A;  2JB2 A;  1N4W A;  1ELI A;  3F8R A;  4TM4 A;  4EMW A;  3CNP A;  2XCG A;  2C3D A;  1ZX9 A;  3K7Q X;  3UTH A;  2XVJ A;  2C66 A;  1QJD A;  1OJT A;  2JK6 A;  3PVC A;  4Y4L A;  3NYE A;  3UP4 A;  1DNC A;  3CPI G;  3KKJ A;  1PXC A;  4UDP A;  3UCL A;  4BK2 A;  1KDG A;  1QO8 A;  4EM4 A;  2R4J A;  2WDR A;  4C3X A;  4YT0 A;  4N9X A;  1ZP0 A;  4CRT A;  5HHF A;  3NRN A;  4TM1 A;  2X99 A;  4YSH A;  2CFY A;  2WOI A;  1ZKQ A;  3UTE A;  3O0H A;  2B7R A;  2C76 A;  5FS6 A;  2B9X A;  2C72 A;  5GSN A;  3M0O A;  3BHF A;  2WDQ A;  1BKW A;  4NEV A;  1XDI A;  2XVF A;  4U8I A;  4YTP A;  3DJJ A;  3JSK A;  1LQU A;  4IA5 A;  4U8P A;  4EIP A;  4H4S A;  1S2Y A;  2A8X A;  4ECH A;  3AXB A;  2C70 A;  2JBV A;  1IUW A;  3ALJ A;  1SEZ A;  2QAE A;  1Q1R A;  1AOG A;  5BVA A;  4H2R A;  4YTN A;  3DJG X;  2BS2 A;  3LZW A;  3CGB A;  5KRQ A;  1FEB A;  4AP1 A;  2V3A A;  3UKH A;  3BI5 A;  4J34 A;  1X31 B;  1Q1W A;  1QLB A;  2WOV A;  4H2N A;  3GRT A;  2XFQ A;  4YSZ A;  4D04 A;  4K2X A;  4FDC B;  4BK3 A;  5FMH A;  1EL5 A;  1L9D A;  3DJE A;  4BK1 A;  4AOS A;  3CGC A;  1IUU A;  2JB3 A;  4YKG A;  1GRF A;  1DJN A;  2YLS A;  4OPC A;  4OPI A;  3QVR A;  1GES A;  1H82 A;  1OJ9 A;  2WU5 A;  3LJP A;  3QSE A;  2YAU A;  4APN A;  2YLX A;  1JNZ A;  4H4P A;  2JB1 A;  1LPF A;  4GDE A;  4IA6 A;  3UKP A;  1NHR A;  3GMC A;  1CL0 A;  3V3O A;  3AE5 A;  4NTE A;  4BV6 A;  3SFE A;  4Y4M A;  4Z44 A;  5FS8 A;  4ZN0 A;  2YLT A;  3V76 A;  4Z43 A;  5EOW A;  1GRA A;  1IUX A;  4TLX A;  4Z2U A;  2Q7V A;  1GND A;  4HA6 A;  1COY A;  4B66 A;  2VZ2 A;  4DNA A;  1BF3 A;  1ZOY A;  3DK9 A;  4GF7 A;  1PBD A;  3IWA A;  3RP7 A;  2XLR A;  1VDC A;  3P4R A;  4IVM B;  1DOC A;  4A7A A;  2EQ6 A;  2BCP A;  1VG0 A;  3ZDN A;  3NHO X;  4ZCD A;  1KNR A;  4BJY A;  5JCL A;  5C3J A;  2IVE A;  3B3R A;  1PBF A;  3CNS A;  2XDO A;  4EQR A;  3COX A;  4B68 A;  2WP9 A;  3QSS A;  4J36 A;  4PAA A;  2GEW A;  4Y4N A;  4K8D A;  3IF9 A;  1IJH A;  4GUV A;  4J33 A;  1Y56 A;  2C65 A;  3AE4 A;  3H4K A;  4YXD A;  2C75 A;  2VVL A;  4A99 A;  1N4V A;  3AE8 A;  2B9W A;  3UKL A;  3DME A;  2H89 A;  4A5L A;  4DSH A;  3IHM A;  2B9Y A;  2TMD A;  5EB5 A;  2XLT A;  3H8L A;  2GQW A;  2GAG B;  5C2T A;  3UOV A;  1VG9 A;  5FS9 A;  3NKS A;  1K0L A;  2WES A;  2X8C A;  3P9U A;  3NK1 X;  2QCU A;  2GQF A;  2RGJ A;  4K22 A;  4YWO A;  2WOW A;  1IUV A;  2Y6Q A;  2ZZ0 A;  4LII A;  2JKC A;  2OLO A;  1OJA A;  1E1K A;  4H4Q A;  2XYO A;  3G5S A;  3I6D A;  1NG4 A;  3QVP A;  1PBC A;  4J57 A;  2Q0L A;  4KX6 A;  3SFD A;  2GF3 A;  2E4G A;  4JDR A;  2VQ7 A;  3AWI A;  3BI2 A;  4B1B A;  2IID A;  2YG5 A;  3CTY A;  3R9U A;  1N4U A;  1OJD A;  4TM3 A;  5BUK A;  2PYX A;  2WEU A;  4OPD A;  2FJE A;  2QA1 A;  3KPF A;  1CHU A;  1NG3 A;  2VRM A;  1GTE A;  2YVJ A;  4OPL A;  1MOK A;  1MO9 A;  4FK1 C;  4Z2R A;  2R46 A;  3DH9 A;  1W4X A;  2DKI A;  2YM2 A;  2NVK X;  3OC4 A;  2OAL A;  1F6M A;  1D4D A;  1TDK A;  3DJD A;  4I58 A;  4BUR A;  1E39 A;  1FEC A;  2YVG A;  1PDH A;  2WET A;  4FX9 A;  2YG3 A;  1BGJ A;  3AE1 A;  1H83 A;  3K7M X;  3KD9 A;  1CJC A;  4CNK A;  1FOH A;  1GER A;  4H50 A;  3ISH A;  1D7Y A;  4LA1 A;  3ICR A;  2IVD A;  2XFP A;  1H7W A;  1S3E A;  1JNR A;  1D5T A;  2GR1 A;  5JCK A;  4FK1 A;  2VQB A;  4Z2T A;  5BRT A;  3AD8 B;  4J56 A;  1TRB A;  5U25 A;  1Y0P A;  2YLR A;  2FJB A;  1F8W A;  3AD7 B;  2BC0 A;  5L46 A;  2R9Z A;  5M10 A;  1NDA A;  1EL9 A;  3AEE A;  5KOX A;  1K4Q A;  3AEA A;  2XLP A;  1BWC A;  4H4Z A;  1D4C A;  1RP0 A;  2B76 A;  1FEA A;  5EBK A;  3ABV A;  2OAM A;  3FPZ A;  4J31 A;  1P2H A;  3IHG A;  3GYI A;  4BJZ A;  1PHH A;  1L9E A;  5KVH A;  3ATQ A;  1XAN A;  3AEF A;  3H8I A;  1FCD A;  1F3P A;  1TYT A;  2H88 A;  4H4W A;  3M12 A;  1L9C A;  4XWZ A;  1TDE A;  1OJC A;  4Z26 A;  3Q6J A;  2XFO A;  1GSN A;  4JQ9 A;  3ICT A;  4Z25 A;  2RGO A;  2WDV A;  2WQY A;  1TYP A;  2ZBW A;  2YM1 A;  4WX1 A;  3DGZ A;  1PBE A;  3P4Q A;  2EQ8 A;  4O5Q A;  2YQU A;  3RHA A;  2X8G A;  3CNJ A;  3F8D A;  4C74 A;  4B63 A;  1M64 A;  1B5Q A;  1S2Q A;  5HY5 A;  4E0V A;  3FMW A;  2BAB A;  4GR1 A;  1DJQ A;  2WHD A;  1NHS A;  1XHC A;  1CJ2 A;  1E7P A;  2BA9 A;  4AT2 A;  4YSY A;  1EBD A;  4U8L A;  3PS9 A;  3NYF A;  4A6N B;  3GD3 A;  4YKF A;  2X3N A;  3UTF A;  2CDU A;  3QSM A;  2AR8 A;  1GAL A;  2GMH A;  1GRG A;  1JRX A;  3AE3 A;  3EF6 A;  1FL2 A;  4U8O A;  4EIQ A;  1KSS A;  3AD9 B;  3ITJ A;  2YLZ A;  3Q9T A;  2EQ9 A;  3BI4 A;  2HQM A;  3NIX A;  3ZYX A;  5LV9 A;  4H4U A;  1CJ3 A;  3I3L A;  4H4R A;  5HXI A;  2QA2 A;  1UKV G;  3CPH G;  3KU9 A;  2XVI A;  2DKH A;  2XFN A;  2J3N A;  2GAH B;  2AQJ A;  1BGN A;  3AE7 A;  2YR6 A;  4CCR A;  3NLC A;  4A65 A;  2BAC A;  3CNT A;  1JRZ A;  4B69 A;  1P2E A;  3K30 A;  2R0C A;  4H4Y A;  4X4J A;  5U63 A;  3UKQ A;  4H4V A;  3FG2 P;  2Q6U A; 
#chains in the Genus database with same CATH topology
 4I59 A;  3SZC A;  5FJR A;  2E3T A;  4CY6 A;  1DOE A;  2Z5X A;  3NZG A;  4GYP C;  5ENL A;  4E4U A;  4Z24 A;  4G9K A;  4JNA A;  3DK8 A;  3SSZ A;  3NK2 X;  2X8H A;  4H4T A;  3CND A;  3S5W A;  1B4V A;  4G7F A;  1DOB A;  3ZVI A;  1LVL A;  3AYI A;  1YQ4 A;  4EM3 A;  3VFC A;  3N6J A;  3CIR A;  4USR A;  4CNJ A;  2GV8 A;  3HPF A;  4CBQ A;  3SJN A;  4RG3 A;  2VVL G;  1D4E A;  3DIP A;  2Y6R A;  2FJA A;  1E1N A;  4GDP A;  1GRT A;  3SGL A;  4AT0 A;  5IQ4 A;  2YG6 A;  2R0G A;  3AED A;  3NVZ B;  2R45 A;  4K1W A;  3OZM A;  1RSG A;  4NZH A;  3KVE A;  3LOV A;  3II4 A;  2Q0K A;  1GRH A;  1MNS A;  4EMI A;  2O9Z A;  3R0U A;  4EQW A;  2XH0 A;  1RYI A;  2CUL A;  3UOY A;  1MXT A;  2VVM A;  3IJI A;  4NTC A;  3UOZ A;  4G6H A;  2OA1 A;  5BUL A;  3AE2 A;  3A7A A;  2GGH A;  2TPR A;  5U1O A;  3PO7 A;  3ATR A;  4KT2 A;  3R10 A;  3H7V A;  4HNL A;  4II2 A;  3DK4 A;  2V60 A;  4RG4 A;  2GMJ A;  2POZ A;  3DES A;  4EWJ A;  3AE9 A;  4DHG A;  4IV9 A;  2BRA A;  3GRS A;  3VRD B;  4GFI A;  1KFY A;  3EAN A;  1N62 C;  4OCG A;  2GRT A;  1CJ4 A;  4HPN A;  1IUT A;  4ZCW A;  1FO4 A;  4JN9 A;  3UOX A;  3U4F A;  1LV0 A;  2WPF A;  4K2S A;  1PN0 A;  2P3Z A;  1NEK A;  5IPY A;  1TKK A;  4EQX A;  1GV4 A;  3DER A;  3EAO A;  2QGY A;  4XXG A;  3DFH A;  3RP6 A;  3VC6 A;  1XPQ A;  3ALL A;  2RGH A;  2QJM A;  3V3N A;  2GH5 A;  3IK4 A;  3RIT A;  2C67 A;  4H2Q A;  1YQ3 A;  5KNL A;  2JB2 A;  3CNP A;  2XCG A;  2C3D A;  1VQZ A;  3VCN A;  3AM9 A;  3NYE A;  1DNC A;  3KKJ A;  3UCL A;  2WDR A;  4N9X A;  2CFY A;  2WOI A;  1SJB A;  1ZKQ A;  1F9C A;  1BKW A;  2PTY A;  4NEV A;  4YTP A;  4IP4 A;  3DJJ A;  4GAP A;  4H1Z A;  4IA5 A;  4H4S A;  1S2Y A;  1JPD X;  2C70 A;  2JBV A;  3ALJ A;  1SEZ A;  2PTZ A;  1Q1R A;  4DN1 A;  5BVA A;  4H2R A;  4YTN A;  1FEB A;  3UKH A;  1Q1W A;  4YSZ A;  2XH2 A;  3V5C A;  2OVL A;  4A3R A;  2ZC8 A;  4AOS A;  2JB3 A;  1GRF A;  3N4F A;  1OJ9 A;  3QSE A;  3R0K A;  2YLX A;  4IA6 A;  3GMC A;  2QDD A;  3V3O A;  4NTE A;  4BV6 A;  3V76 A;  3TCS A;  1GRA A;  5EOW A;  4TLX A;  4Z2U A;  3DK9 A;  3IWA A;  3RP7 A;  1DOC A;  2W3R A;  5C3J A;  5JCL A;  3B3R A;  2PA6 A;  2XDO A;  4EQR A;  4B68 A;  4J36 A;  4K8D A;  1IJH A;  4FP1 A;  3H4K A;  3AE8 A;  2OX4 A;  3DME A;  4A5L A;  3HRD C;  4DSH A;  3IHM A;  3BSM A;  2B9Y A;  5FS9 A;  5FJP A;  3P9U A;  1IUV A;  2JKC A;  2OLO A;  3QVP A;  3TQP A;  3SFD A;  4J57 A;  3TJI A;  2OG9 A;  2PYX A;  4JN7 A;  4OPD A;  3CAW A;  1NG3 A;  2VRM A;  1GTE A;  4OPL A;  1MO9 A;  4Z2R A;  5G5G B;  1PDY A;  3ZVH B;  4I58 A;  4BUR A;  3QKE A;  2YVG A;  3K7M X;  4GIS A;  1BGJ A;  3KD9 A;  3P3B A;  3T2K A;  4CNK A;  4GIR A;  5JCK A;  3DDM A;  2VQB A;  4Z2T A;  3H12 A;  2BC0 A;  5M10 A;  1NDA A;  3AEE A;  3UJS A;  3ES7 A;  3NRZ B;  4HCL A;  1RP0 A;  3FPZ A;  2OFJ A;  2P0I A;  2ONE A;  3NXL A;  4H4W A;  3M12 A;  1L9C A;  1JCT A;  1XPY A;  1TDE A;  2WDV A;  3P4Q A;  3F8D A;  3SY4 A;  5KMP A;  1B5Q A;  1S2Q A;  2WHD A;  2BA9 A;  1E7P A;  4AT2 A;  4YSY A;  1EBD A;  4JHM A;  3UJE A;  3SZF A;  2AKM A;  3GY1 A;  3EF6 A;  4U8O A;  2W3S A;  3VDG A;  3ZYX A;  1WUE A;  2QA2 A;  3CPH G;  3T8Q A;  3AE7 A;  2YR6 A;  4X4J A;  2Q6U A;  1TDN A;  3GWF A;  3GWD A;  2GR3 A;  3FVD A;  5TR3 A;  1Z6L A;  3NG7 X;  3CGE A;  1LJ1 A;  1GOS A;  3LZX A;  2FJD A;  1F8S A;  4P9S A;  4USQ A;  3TW9 A;  3NYC A;  4U8M A;  1LTX R;  2AAQ A;  2GVC A;  2XFU A;  4GAV A;  1OEP A;  1ZK7 A;  2BK4 A;  1EL8 A;  3VCC A;  4C77 A;  1K0J A;  2QQ6 A;  1O5W A;  1ZMD A;  1H7X A;  4DGK A;  2YVF A;  1PBB A;  3L1R A;  3KLJ A;  1S3B A;  1ZDL A;  2POD A;  3IC9 A;  4M0X A;  4MJW A;  1PXB A;  3L8K A;  3MZN A;  3D8X A;  2C64 A;  1B8S A;  2BK5 A;  2OLN A;  3NNE A;  4UDQ A;  4TVW A;  1YQZ A;  4IHC A;  3AEC A;  1JU2 A;  3QJ4 A;  1ZMC A;  2XLU A;  2WP5 A;  4TLZ A;  1Q9I A;  1GRE A;  1ZXI C;  3QFB A;  1N60 C;  4WCT A;  2XVE A;  3FYY A;  3GYJ A;  3RRA A;  3I6T A;  4OPG A;  4AP3 A;  2YR5 A;  1PS9 A;  3ADA B;  2BS3 A;  4K5R A;  2NQL A;  5JCM A;  3K7T A;  3UP5 A;  3ALM A;  3NT6 A;  3S47 A;  3ZVH A;  1N1P A;  2NPX A;  3RO6 A;  1FHV A;  3E1T A;  4U2S A;  1JDF A;  1KD0 A;  3P4P A;  3C4A A;  4G8T A;  2E5V A;  1ONF A;  3KA7 A;  1H81 A;  2BYB A;  4ADW A;  3UCD A;  3UKF A;  1KF6 A;  4H2P A;  3ICS A;  1WYG A;  3H70 A;  4U2L A;  4GRT A;  3GDN A;  7ENL A;  1PJ7 A;  5JCI A;  3OTR A;  5IDZ A;  2E1M A;  1ZY8 A;  2PCE A;  1TDF A;  3BHK A;  1EBH A;  4KPL A;  3JZU A;  3GD4 A;  1JEH A;  3R25 A;  4C5O A;  2C4C A;  4X9M A;  2PHH A;  2BS4 A;  4OPU A;  3FBS A;  1N63 C;  2GGG A;  1YY5 A;  2R0P A;  4NTD A;  1LQT A;  4OVI A;  4K7Z A;  1K0I A;  2AL1 A;  5JCN A;  2V61 A;  3D46 A;  4GYP A;  3AEB A;  4A35 A;  4J1O A;  3VR9 A;  4RSL A;  1IUS A;  1CC6 A;  5DBJ A;  1WUF A;  1N4W A;  3K7Q X;  4G74 A;  3UTH A;  3ZLF A;  2C66 A;  3RCY A;  1OJT A;  3UP4 A;  3MUC A;  4UDP A;  1PXC A;  4BK2 A;  4C3X A;  1QO8 A;  4EM4 A;  1X2G A;  5HHF A;  4TM1 A;  2X99 A;  4YSH A;  3P93 A;  3UTE A;  5KMS A;  3BHF A;  4IL0 A;  1FHU A;  3EEZ A;  1LQU A;  4ECH A;  1IUW A;  1T3Q C;  1R6W A;  3DJG X;  3LZW A;  5KRQ A;  2V3A A;  3SZ0 A;  1X31 B;  3GRT A;  2XFQ A;  5FMH A;  1L9D A;  3T0K A;  4BK1 A;  3AN1 A;  4OPI A;  2WU5 A;  2YAU A;  3T4W A;  4GDE A;  3UKP A;  4J3Z A;  4Y4M A;  4ZN0 A;  5BOE A;  1IUX A;  3FV9 A;  4HA6 A;  3CYJ A;  1ZOY A;  2OQY A;  2XLR A;  2P88 A;  4ZCD A;  1KNR A;  2XGZ A;  2WP9 A;  4HCH A;  4J33 A;  4YXD A;  2C75 A;  2VVL A;  2B9W A;  3UKL A;  3TWA A;  2OO6 A;  2TMD A;  2XLT A;  3I4K A;  2GQW A;  2GAG B;  3H8L A;  1VG9 A;  2WES A;  2X8C A;  4K22 A;  4YWO A;  2Y6Q A;  1OJA A;  1E1K A;  3G5S A;  4KX6 A;  2XSX A;  3AWI A;  2HXT A;  4GGB A;  2IID A;  3R11 A;  1OJD A;  5BUK A;  3KPF A;  3KPK A;  3EKG A;  2R46 A;  3DH9 A;  2DKI A;  3U9I A;  2NVK X;  3OC4 A;  3HYX A;  1TDK A;  3DJD A;  1FEC A;  2WET A;  4FX9 A;  1H83 A;  4DXK A;  2PP1 A;  1BKH A;  1D7Y A;  4LA1 A;  3ICR A;  2IVD A;  3TTE A;  2GR1 A;  4G73 A;  4J56 A;  5L46 A;  1ELS A;  2R9Z A;  1P43 A;  1EL9 A;  5KOX A;  5FJO A;  1BWC A;  3VA8 A;  2OAM A;  1P2H A;  1F3P A;  1N5X A;  2RGO A;  3RHA A;  2YQU A;  2HZG A;  3CNJ A;  4B63 A;  1M64 A;  3TJ4 A;  3THU A;  1TZZ A;  4GR1 A;  1DJQ A;  2AL2 A;  1NHS A;  1CJ2 A;  3AMZ A;  3NYF A;  4E6M A;  3UTF A;  2CDU A;  2AR8 A;  1GAL A;  1GRG A;  3AE3 A;  2PGW A;  4EIQ A;  3Q9T A;  3IJL A;  2HQM A;  5LV9 A;  4H4R A;  5HXI A;  4IL2 A;  3KU9 A;  2XVI A;  2DKH A;  2XFN A;  3UJR A;  3CNT A;  1IYX A;  4A65 A;  4B69 A;  3V5F A;  1P2E A;  2R0C A;  3UKQ A;  2UZZ A;  1E1L A;  3HZL A;  3RNM A;  1H86 A;  1YKJ A;  2DW7 A;  4IT1 A;  2BXS A;  5ER0 A;  1V59 A;  5JRB A;  3A7R A;  4X2P A;  3FXG A;  2A87 A;  2Z5Y A;  3D47 A;  4ZA0 A;  5KXJ A;  3URH A;  2RDX A;  2C7G A;  3CK5 A;  2EQ7 A;  2BCG G;  5CKU A;  5FS7 A;  4B64 A;  3DGH A;  1H6V A;  3FCP A;  3NVV B;  3GSI A;  5KVI A;  3UXK A;  4DSG A;  1F8R A;  1RM6 B;  2V3B A;  3EPT A;  1GTH A;  4CY8 A;  3F8P A;  2F5Z A;  1JOA A;  2FYM A;  5GRT A;  3T9P A;  1E6E A;  3D1C A;  4XWR A;  4JNQ A;  4A79 A;  3PWG A;  2V5Z A;  2CHR A;  5BOF A;  1GXF A;  2WU2 A;  5J7X A;  1DXL A;  3BOX A;  3BNU A;  3B97 A;  1SJC A;  2YLW A;  4B67 A;  3RP8 A;  1GPE A;  2WBA A;  1EL7 A;  4EMJ A;  2I0Z A;  2OKT A;  4REK A;  2OZ8 A;  1H84 A;  4UP3 A;  1KKO A;  2WPE A;  1NEN A;  3UKK A;  2A89 A;  4KPR A;  2GR0 A;  3B9J B;  2PPG A;  4OPT A;  1ONE A;  2B7S A;  3BNM A;  2XVH A;  2XH7 A;  3NN6 X;  1PJ6 A;  3P1W A;  1O95 A;  4B65 A;  2W0H A;  2GR2 A;  4E8G A;  2APG A;  3GDP A;  3C4N A;  4IVO B;  3N4E A;  1M6I A;  1EC7 A;  1NHP A;  3PK7 A;  4IP5 A;  2R4E A;  2GGI A;  3S61 A;  4ZOH B;  2C73 A;  3DA1 A;  3LAD A;  4JY3 A;  3PFR A;  2X50 A;  3DG6 A;  1O94 A;  3CN8 A;  1NPX A;  1DOD A;  3SZW A;  2PGE A;  1CC4 A;  3VC5 A;  3NFU A;  2WPC A;  3NTA A;  2WS3 A;  4H2H A;  3BJS A;  3G5R A;  2PS2 A;  1BZL A;  3SM8 A;  4FI4 A;  4K5S A;  3S5S A;  1TDO A;  3T37 A;  4A9W A;  1B37 A;  4ENL A;  4TM4 A;  2XVJ A;  3GD6 A;  3PVC A;  1MDL A;  4Y4L A;  3SN1 A;  3GC2 A;  4E5T A;  2R4J A;  4YT0 A;  1ZP0 A;  4CRT A;  5FJT A;  5FS6 A;  2B9X A;  2C72 A;  5GSN A;  3M0O A;  5EU9 A;  1XDI A;  4U8I A;  3MKC A;  3JSK A;  4EIP A;  2A8X A;  1AOG A;  4MMW A;  3D9X A;  3CGB A;  4II3 A;  4AP1 A;  4J34 A;  1QLB A;  4H2N A;  4D04 A;  3H8A A;  3DJE A;  1IUU A;  4APN A;  3HYW A;  1JNZ A;  4H4P A;  3UJF A;  3AE5 A;  4Z44 A;  2YLT A;  3T2Y A;  3V3W A;  1GND A;  1COY A;  4B66 A;  4YWS A;  1VDC A;  4A7A A;  2BCP A;  3NHO X;  4BJY A;  3CNS A;  3COX A;  3TOY A;  3QSS A;  2HXU A;  4Y4N A;  3IF9 A;  3TWB A;  2C65 A;  4A99 A;  3GYX A;  3HW2 A;  2GL5 A;  5C2T A;  1K0L A;  3NK1 X;  2QCU A;  2RGJ A;  4NWZ A;  2HNE A;  2QVH A;  4LII A;  3I6D A;  3WE0 A;  2Q0L A;  3SN4 A;  4GGH A;  3BI2 A;  4B1B A;  3UCC A;  3NVW B;  1N4U A;  4TM3 A;  3EUB 3;  2QA1 A;  1CHU A;  1SJA A;  2YVJ A;  1MOK A;  3CXO A;  4FK1 C;  4A6G A;  1W4X A;  3MSY A;  1F6M A;  1MRA A;  1E39 A;  2AL2 B;  1PDH A;  3AE1 A;  1CJC A;  3QN3 A;  2XFP A;  1H7W A;  1S3E A;  1JNR A;  1D5T A;  2BRY A;  4FK1 A;  3NVY B;  5BRT A;  3AD8 B;  5U25 A;  1Y0P A;  1KCZ A;  2FJB A;  2PSN A;  3STP A;  1FFU C;  3JVA A;  2XLP A;  4Z17 A;  4H4Z A;  1D4C A;  3SQS A;  2B76 A;  5EBK A;  4J31 A;  3IHG A;  2XH4 A;  1PHH A;  5KVH A;  3ATQ A;  1XAN A;  3AEF A;  1FCD A;  3R07 C;  4G6G A;  2H88 A;  4Z26 A;  2OQH A;  2XFO A;  1GSN A;  4JQ9 A;  3DGZ A;  2EQ8 A;  2O56 A;  1NU5 A;  4HCD A;  4C74 A;  4MGG A;  2BAB A;  3KUM A;  4A6N B;  3GD3 A;  3QSM A;  1FL2 A;  3RR1 A;  1KSS A;  3AD9 B;  1N61 C;  2YLZ A;  3NIX A;  1UKV G;  4HNC A;  1BGN A;  4E4F A;  1JRZ A;  5J04 A;  4H4Y A;  5U63 A;  2P8C A;  2DW6 A;  3FG2 P;  6ENL A;  3LXD A;  3QFA A;  2PP3 A;  1CF3 A;  2RAB A;  3ZLG A;  1VDV A;  3A7U A;  2ACZ A;  2YG7 A;  1D7L A;  2OLA A;  3DEQ A;  4HB9 A;  1XS2 A;  3NK0 X;  4GCM A;  4U2T A;  2QJN A;  3IJQ A;  5J60 A;  4H4X A;  1VRQ B;  3NO1 A;  4LU6 A;  3T14 A;  4K8G A;  4YTM A;  3T2Z A;  5KWF A;  1NAA A;  2YR4 A;  1KSU A;  3RED A;  2CVJ A;  5IQ1 A;  1STZ A;  4DYE A;  2YWL A;  2BXR A;  1R0M A;  4ZCC A;  3MY9 A;  4U8J A;  1KNP A;  2C3C A;  4H19 A;  4NEW A;  1NEL A;  2PTX A;  4J2W A;  2P8B A;  2PU1 A;  1CC2 A;  3NH3 X;  3G5Q A;  3LB8 A;  1GRB A;  3FIM B;  3QTP A;  4X9N A;  3ES8 A;  2ZAD A;  1ECQ A;  4TM0 A;  3OP2 A;  1L0V A;  1NHQ A;  2GDQ A;  3OZ2 A;  2BC1 A;  1ZOV A;  1CBO A;  3SXI A;  4O5U A;  2W55 A;  3C96 A;  1RVK A;  3DG3 A;  1Y56 B;  4U8K A;  4TVY A;  3NGC X;  3CGD A;  3VRB A;  5CQF A;  2XLS A;  1GEU A;  2VRL A;  2W54 A;  1N5W C;  2ZZB A;  3AYJ A;  3AE6 A;  1GT8 A;  1FIQ B;  1W6T A;  2VOU A;  5KMR A;  3P0W A;  5KOW A;  1X2H A;  3VQR A;  5M0Z A;  2YG4 A;  5EB4 A;  2ZZC A;  3NN0 X;  3L5O A;  3SBF A;  2BK3 A;  1E1M A;  4EQS A;  3VR8 A;  2FBW A;  4YSX A;  2QDE A;  4M52 A;  3SQP A;  4PAB A;  1GET A;  1JRP A;  3QLD A;  3B6D A;  4AOX A;  4KEM A;  2GB0 A;  3AB1 A;  1JRO A;  3M13 A;  4H7U A;  3N6H A;  4C3Y A;  4GME A;  3NTD A;  2ARD A;  1REO A;  1TE6 A;  1PXA A;  1JRY A;  2E5A A;  4DX3 A;  4UDR A;  3UKA A;  2V6O A;  3GMB A;  2WP6 A;  2OPJ A;  1PJ5 A;  3VRA A;  4ICY A;  3UTG A;  3OW1 A;  4A6N A;  4JY2 A;  4F4R A;  3JW7 A;  1H2I A;  3AEG A;  4D03 A;  4Z1Y A;  5HYM A;  3P4S A;  3CPJ G;  1HYU A;  3RGT A;  4U8N A;  3AYL A;  1VQW A;  2JAE A;  1BQG A;  1ELI A;  3F8R A;  4EMW A;  1ZX9 A;  1KN0 A;  1QJD A;  2JK6 A;  3CPI G;  1KDG A;  3NRN A;  3O0H A;  2B7R A;  2PTW A;  2C76 A;  2WDQ A;  2XVF A;  1P48 A;  4U8P A;  3AXB A;  1EC9 A;  3CXB A;  4IZG A;  2QAE A;  3ENL A;  3UGV A;  3UJ2 A;  2BS2 A;  3BI5 A;  3OZY A;  2WOV A;  3GO2 A;  2MNR A;  4K2X A;  4FDC B;  1E9I A;  4BK3 A;  1EL5 A;  3CGC A;  4YKG A;  5KMQ A;  3I6E A;  1DJN A;  2YLS A;  4OPC A;  3QVR A;  1GES A;  1H82 A;  3LJP A;  2JB1 A;  1LPF A;  1MDR A;  1NHR A;  1CL0 A;  3CMM A;  1MUC A;  3SFE A;  5FS8 A;  4Z43 A;  1SB3 B;  2Q7V A;  2VZ2 A;  4DNA A;  1BF3 A;  4GF7 A;  3SR6 B;  2PU0 A;  3SN0 A;  1PBD A;  4HN8 A;  1DTN A;  3P4R A;  2OZ3 A;  4IVM B;  2EQ6 A;  4JN8 A;  1VG0 A;  3ZDN A;  2IVE A;  1PBF A;  4PAA A;  2GEW A;  4GUV A;  1Y56 A;  3AE4 A;  4HYR A;  3Q45 A;  1N4V A;  2H89 A;  2PP0 A;  5EB5 A;  3UOV A;  3NKS A;  5FJU A;  2GQF A;  2WOW A;  3DGB A;  2ZZ0 A;  2XYO A;  4H4Q A;  4MKS A;  1NG4 A;  1PBC A;  2GF3 A;  2E4G A;  4JDR A;  4ROP A;  2VQ7 A;  2YG5 A;  4NNJ A;  3CTY A;  1PDZ A;  3MWC A;  3R9U A;  2WEU A;  2FJE A;  3MQT A;  1EBG A;  3T6C A;  3ETR B;  2GGJ A;  2YM2 A;  3K1G A;  3UXL A;  3V4B A;  2OAL A;  1D4D A;  3HYV A;  2MUC A;  2YG3 A;  1SJD A;  1FOH A;  1GER A;  4H50 A;  3ISH A;  5G5H B;  3PG6 A;  3SYI A;  4KWS A;  1TRB A;  2GGE A;  2QJJ A;  3Q4D A;  2YLR A;  1F8W A;  3AD7 B;  3T31 A;  4DWD A;  3CT2 A;  1K4Q A;  3AEA A;  3OPS A;  1FEA A;  3ABV A;  3GYI A;  4BJZ A;  1L9E A;  3H8I A;  1EC8 A;  1TYT A;  3CB3 A;  1L8P A;  4XWZ A;  1OJC A;  3Q6J A;  4Z25 A;  3ICT A;  2WQY A;  4WX1 A;  1TYP A;  2ZBW A;  2YM1 A;  4CCQ A;  1PBE A;  4O5Q A;  3SX6 A;  2X8G A;  3NS1 B;  3DG7 A;  3QPE A;  5HY5 A;  4E0V A;  3DFY A;  3FMW A;  1S7M A;  1XHC A;  1YEY A;  1FFV C;  3PS9 A;  4U8L A;  4YKF A;  2I5Q A;  2X3N A;  1JPM A;  2GMH A;  1JRX A;  2GSH A;  3ITJ A;  2EQ9 A;  3BI4 A;  4H4U A;  1CJ3 A;  3I3L A;  1V97 A;  3ZLH A;  2OZT A;  4M6U A;  3FJ4 A;  2J3N A;  2GAH B;  2AQJ A;  4H83 A;  2AKZ A;  4CCR A;  3NLC A;  2BAC A;  3K30 A;  2PMQ A;  2FKP A;  1KKR A;  4H4V A;  3PWI A;  3R1Z A; 
#chains in the Genus database with same CATH homology
 1TDN A;  2UZZ A;  3WE0 A;  1E1L A;  3GWF A;  3LXD A;  3QFA A;  3RNM A;  3HZL A;  1CF3 A;  3GWD A;  4I59 A;  1H86 A;  2GR3 A;  1YKJ A;  2RAB A;  5TR3 A;  3SZC A;  1Z6L A;  3NG7 X;  2BXS A;  5ER0 A;  1V59 A;  1DOE A;  4CY6 A;  2Z5X A;  5JRB A;  2A87 A;  2Z5Y A;  3CGE A;  1LJ1 A;  2ACZ A;  2YG7 A;  1GOS A;  3LZX A;  4Z24 A;  4G9K A;  1D7L A;  2FJD A;  1F8S A;  4JNA A;  5KXJ A;  4HB9 A;  3DK8 A;  3NK0 X;  4P9S A;  4GCM A;  3URH A;  4U2T A;  3NK2 X;  4USQ A;  2C7G A;  5J60 A;  4H4X A;  2X8H A;  4H4T A;  3NYC A;  3CND A;  3S5W A;  2EQ7 A;  2BCG G;  1VRQ B;  5CKU A;  1B4V A;  4U8M A;  1LTX R;  2AAQ A;  4LU6 A;  5FS7 A;  3T14 A;  2GVC A;  2XFU A;  4YTM A;  3T2Z A;  4B64 A;  1DOB A;  1NAA A;  5KWF A;  1LVL A;  2YR4 A;  3AYI A;  4GAV A;  1KSU A;  3DGH A;  1ZK7 A;  1YQ4 A;  2BK4 A;  1EL8 A;  2CVJ A;  4EM3 A;  3RED A;  5IQ1 A;  4C77 A;  3CIR A;  1H6V A;  4USR A;  3GSI A;  1K0J A;  2YWL A;  5KVI A;  4CCQ A;  4CNJ A;  1O5W A;  1ZMD A;  2BXR A;  1H7X A;  4DGK A;  4ZCC A;  2YVF A;  2GV8 A;  4U8J A;  1PBB A;  4DSG A;  3L1R A;  1F8R A;  4CBQ A;  3KLJ A;  1KNP A;  1S3B A;  4RG3 A;  1ZDL A;  3IC9 A;  2VVL G;  1D4E A;  2V3B A;  2C3C A;  4MJW A;  3EPT A;  2Y6R A;  4NEW A;  1GTH A;  1PXB A;  2FJA A;  3L8K A;  4J2W A;  1E1N A;  4GDP A;  3F8P A;  4CY8 A;  2F5Z A;  1JOA A;  3D8X A;  2C64 A;  1B8S A;  1GRT A;  1CC2 A;  3SGL A;  3NH3 X;  4AT0 A;  3G5Q A;  5IQ4 A;  3LB8 A;  5GRT A;  1E6E A;  3D1C A;  1GRB A;  2BK5 A;  3FIM B;  2OLN A;  3NNE A;  4X9N A;  2YG6 A;  4JNQ A;  2R0G A;  4UDQ A;  4XWR A;  4A79 A;  2V5Z A;  4TM0 A;  1YQZ A;  3AED A;  3AEC A;  2R45 A;  1JU2 A;  1GXF A;  2WU2 A;  1L0V A;  3QJ4 A;  1NHQ A;  1ZMC A;  2XLU A;  2WP5 A;  4TLZ A;  1RSG A;  3OZ2 A;  2BC1 A;  1Q9I A;  1ZOV A;  1CBO A;  3SXI A;  4O5U A;  1GRE A;  4NZH A;  5J7X A;  1DXL A;  3BNU A;  3KVE A;  3QFB A;  3C96 A;  1Y56 B;  4U8K A;  4WCT A;  2XVE A;  2YLW A;  3II4 A;  3LOV A;  2Q0K A;  3NGC X;  3GYJ A;  1GRH A;  4B67 A;  3CGD A;  4OPG A;  3VRB A;  4AP3 A;  2YR5 A;  1PS9 A;  3ADA B;  1GPE A;  2BS3 A;  2WBA A;  5CQF A;  4EMI A;  3RP8 A;  2XLS A;  1GEU A;  2VRL A;  4K5R A;  2O9Z A;  1EL7 A;  4EQW A;  5JCM A;  4EMJ A;  3K7T A;  3UP5 A;  2ZZB A;  3AYJ A;  2I0Z A;  3ALM A;  3NT6 A;  3AE6 A;  1RYI A;  1N1P A;  2CUL A;  2NPX A;  1GT8 A;  3UOY A;  1MXT A;  2VVM A;  4NTC A;  3E1T A;  4U2S A;  4G6H A;  3UOZ A;  4REK A;  2OA1 A;  2VOU A;  5BUL A;  3AE2 A;  1H84 A;  5KMR A;  2TPR A;  5KOW A;  5U1O A;  3P4P A;  5M0Z A;  3VQR A;  3C4A A;  2YG4 A;  3PO7 A;  4UP3 A;  3ATR A;  2WPE A;  1NEN A;  5EB4 A;  4II2 A;  2A89 A;  3UKK A;  2ZZC A;  3NN0 X;  4KPR A;  2E5V A;  1ONF A;  3KA7 A;  3L5O A;  3DK4 A;  2GR0 A;  2BK3 A;  2V60 A;  1H81 A;  2BYB A;  4RG4 A;  2GMJ A;  1E1M A;  4ADW A;  4OPT A;  2B7S A;  3UKF A;  3BNM A;  2XVH A;  4EQS A;  1KF6 A;  3NN6 X;  3AE9 A;  4H2P A;  4IV9 A;  1PJ6 A;  2BRA A;  3P1W A;  3GRS A;  1O95 A;  3VRD B;  3ICS A;  3VR8 A;  1KFY A;  4U2L A;  2W0H A;  4GRT A;  4B65 A;  3EAN A;  2GR2 A;  2APG A;  2FBW A;  2GRT A;  4OCG A;  4YSX A;  3GDN A;  3GDP A;  1CJ4 A;  3C4N A;  4IVO B;  1M6I A;  4M52 A;  1PJ7 A;  3SQP A;  5JCI A;  1NHP A;  1GET A;  4PAB A;  1IUT A;  2R4E A;  3S61 A;  2E1M A;  4JN9 A;  2C73 A;  1ZY8 A;  1TDF A;  3BHK A;  3B6D A;  4AOX A;  3DA1 A;  3UOX A;  3LAD A;  4JY3 A;  1LV0 A;  3GD4 A;  1JEH A;  3AB1 A;  2WPF A;  2X50 A;  2GB0 A;  1O94 A;  3CN8 A;  1NPX A;  3M13 A;  1DOD A;  4H7U A;  3SZW A;  4C5O A;  1PN0 A;  1NEK A;  2C4C A;  4C3Y A;  4X9M A;  3NTD A;  2PHH A;  2BS4 A;  4OPU A;  2ARD A;  5IPY A;  1CC4 A;  4EQX A;  2WPC A;  1GV4 A;  3FBS A;  3NTA A;  2WS3 A;  1REO A;  1PXA A;  1JRY A;  3EAO A;  1YY5 A;  2R0P A;  3G5R A;  4UDR A;  4NTD A;  4XXG A;  3UKA A;  2V6O A;  3GMB A;  1LQT A;  4OVI A;  4K7Z A;  2WP6 A;  1PJ5 A;  3RP6 A;  3VRA A;  1BZL A;  4ICY A;  3UTG A;  1K0I A;  4A6N A;  5JCN A;  1XPQ A;  2V61 A;  3ALL A;  2RGH A;  3SM8 A;  4JY2 A;  3AEB A;  3V3N A;  4K5S A;  1H2I A;  3AEG A;  3VR9 A;  2GH5 A;  4D03 A;  2C67 A;  5HYM A;  3P4S A;  1IUS A;  1TDO A;  3CPJ G;  1HYU A;  4H2Q A;  4RSL A;  1YQ3 A;  1CC6 A;  4U8N A;  5DBJ A;  5KNL A;  3AYL A;  3T37 A;  4A9W A;  1B37 A;  1VQW A;  2JAE A;  2JB2 A;  1N4W A;  1ELI A;  3F8R A;  4TM4 A;  4EMW A;  3CNP A;  2XCG A;  2C3D A;  1ZX9 A;  3K7Q X;  4G74 A;  3UTH A;  1KN0 A;  2XVJ A;  2C66 A;  1QJD A;  1OJT A;  2JK6 A;  3PVC A;  4Y4L A;  3NYE A;  3UP4 A;  1DNC A;  3CPI G;  3KKJ A;  1PXC A;  4UDP A;  3UCL A;  4BK2 A;  1KDG A;  1QO8 A;  4EM4 A;  2R4J A;  2WDR A;  4C3X A;  4YT0 A;  4N9X A;  1ZP0 A;  4CRT A;  5HHF A;  3NRN A;  4TM1 A;  2X99 A;  4YSH A;  2CFY A;  2WOI A;  1ZKQ A;  3UTE A;  3O0H A;  2B7R A;  2C76 A;  5FS6 A;  2B9X A;  2C72 A;  5GSN A;  3M0O A;  5KMS A;  3BHF A;  2WDQ A;  1BKW A;  4NEV A;  1XDI A;  2XVF A;  4U8I A;  4YTP A;  3DJJ A;  4GAP A;  3JSK A;  1LQU A;  4IA5 A;  4U8P A;  4EIP A;  4H4S A;  1S2Y A;  2A8X A;  4ECH A;  3AXB A;  2C70 A;  2JBV A;  1IUW A;  3ALJ A;  1SEZ A;  2QAE A;  1Q1R A;  1AOG A;  5BVA A;  4H2R A;  4YTN A;  3D9X A;  3DJG X;  2BS2 A;  3LZW A;  3CGB A;  5KRQ A;  1FEB A;  4II3 A;  4AP1 A;  2V3A A;  3UKH A;  3BI5 A;  3SZ0 A;  4J34 A;  1X31 B;  1Q1W A;  1QLB A;  2WOV A;  4H2N A;  3GRT A;  2XFQ A;  4YSZ A;  4D04 A;  4K2X A;  4FDC B;  4BK3 A;  5FMH A;  1EL5 A;  1L9D A;  3T0K A;  3DJE A;  4BK1 A;  4AOS A;  3CGC A;  1IUU A;  2JB3 A;  4YKG A;  5KMQ A;  1GRF A;  1DJN A;  2YLS A;  4OPC A;  4OPI A;  3QVR A;  1GES A;  1H82 A;  1OJ9 A;  2WU5 A;  3LJP A;  3QSE A;  2YAU A;  4APN A;  3HYW A;  2YLX A;  1JNZ A;  4H4P A;  2JB1 A;  1LPF A;  4GDE A;  4IA6 A;  3UKP A;  1NHR A;  3GMC A;  1CL0 A;  3CMM A;  3V3O A;  3AE5 A;  4NTE A;  4BV6 A;  3SFE A;  4Y4M A;  4Z44 A;  5FS8 A;  4ZN0 A;  2YLT A;  3T2Y A;  3V76 A;  4Z43 A;  5EOW A;  1GRA A;  1IUX A;  4TLX A;  4Z2U A;  2Q7V A;  1GND A;  4HA6 A;  1COY A;  4B66 A;  2VZ2 A;  4DNA A;  1BF3 A;  1ZOY A;  3DK9 A;  4GF7 A;  1PBD A;  3IWA A;  3RP7 A;  2XLR A;  1VDC A;  3P4R A;  4IVM B;  1DOC A;  4A7A A;  2EQ6 A;  2BCP A;  1VG0 A;  3ZDN A;  3NHO X;  4ZCD A;  1KNR A;  4BJY A;  5JCL A;  5C3J A;  2IVE A;  3B3R A;  1PBF A;  3CNS A;  2XDO A;  4EQR A;  3COX A;  4B68 A;  2WP9 A;  3QSS A;  4J36 A;  4PAA A;  2GEW A;  4Y4N A;  4K8D A;  3IF9 A;  1IJH A;  4GUV A;  4J33 A;  1Y56 A;  2C65 A;  3AE4 A;  3H4K A;  4YXD A;  2C75 A;  2VVL A;  4A99 A;  1N4V A;  3AE8 A;  2B9W A;  3UKL A;  3DME A;  3GYX A;  2H89 A;  4A5L A;  4DSH A;  3IHM A;  2B9Y A;  2TMD A;  5EB5 A;  2XLT A;  3H8L A;  2GQW A;  2GAG B;  5C2T A;  3UOV A;  1VG9 A;  5FS9 A;  3NKS A;  1K0L A;  2WES A;  2X8C A;  3P9U A;  3NK1 X;  2QCU A;  2GQF A;  2RGJ A;  4K22 A;  4NWZ A;  4YWO A;  2WOW A;  1IUV A;  2Y6Q A;  2ZZ0 A;  4LII A;  2JKC A;  2OLO A;  1OJA A;  1E1K A;  4H4Q A;  2XYO A;  3G5S A;  3I6D A;  1NG4 A;  3QVP A;  1PBC A;  4J57 A;  2Q0L A;  4KX6 A;  3SFD A;  2GF3 A;  2E4G A;  4JDR A;  2VQ7 A;  3AWI A;  3BI2 A;  4B1B A;  2IID A;  2YG5 A;  4NNJ A;  3CTY A;  3R9U A;  1N4U A;  1OJD A;  4TM3 A;  5BUK A;  2PYX A;  2WEU A;  4OPD A;  2FJE A;  2QA1 A;  3KPF A;  1CHU A;  1NG3 A;  2VRM A;  1GTE A;  2YVJ A;  4OPL A;  1MOK A;  3KPK A;  1MO9 A;  4FK1 C;  4Z2R A;  2R46 A;  3DH9 A;  1W4X A;  2DKI A;  2YM2 A;  2NVK X;  3OC4 A;  2OAL A;  1F6M A;  3HYX A;  1D4D A;  1TDK A;  3DJD A;  3HYV A;  4I58 A;  4BUR A;  1E39 A;  1FEC A;  2YVG A;  1PDH A;  2WET A;  4FX9 A;  2YG3 A;  1BGJ A;  3AE1 A;  1H83 A;  3K7M X;  3KD9 A;  1CJC A;  3T2K A;  4CNK A;  1FOH A;  1GER A;  4H50 A;  3ISH A;  1D7Y A;  4LA1 A;  3ICR A;  2IVD A;  2XFP A;  3PG6 A;  1H7W A;  1S3E A;  1JNR A;  1D5T A;  2GR1 A;  5JCK A;  2BRY A;  4FK1 A;  3SYI A;  2VQB A;  4G73 A;  4Z2T A;  5BRT A;  3AD8 B;  4J56 A;  1TRB A;  5U25 A;  1Y0P A;  2YLR A;  2FJB A;  1F8W A;  3AD7 B;  2BC0 A;  3T31 A;  5L46 A;  2R9Z A;  5M10 A;  1NDA A;  1EL9 A;  3AEE A;  5KOX A;  1K4Q A;  3AEA A;  2XLP A;  1BWC A;  4H4Z A;  1D4C A;  1RP0 A;  2B76 A;  1FEA A;  5EBK A;  3ABV A;  2OAM A;  3FPZ A;  4J31 A;  1P2H A;  3IHG A;  3GYI A;  4BJZ A;  1PHH A;  1L9E A;  5KVH A;  3ATQ A;  1XAN A;  3AEF A;  3H8I A;  1FCD A;  1F3P A;  1TYT A;  4G6G A;  2H88 A;  4H4W A;  3M12 A;  1L9C A;  4XWZ A;  1TDE A;  1OJC A;  4Z26 A;  3Q6J A;  2XFO A;  1GSN A;  4JQ9 A;  3ICT A;  4Z25 A;  2RGO A;  2WDV A;  2WQY A;  1TYP A;  2ZBW A;  2YM1 A;  4WX1 A;  3DGZ A;  1PBE A;  3P4Q A;  2EQ8 A;  4O5Q A;  2YQU A;  3RHA A;  3SX6 A;  2X8G A;  3CNJ A;  3F8D A;  4C74 A;  3SY4 A;  4B63 A;  5KMP A;  1M64 A;  1B5Q A;  1S2Q A;  5HY5 A;  4E0V A;  3FMW A;  2BAB A;  4GR1 A;  1DJQ A;  1S7M A;  2WHD A;  1NHS A;  1XHC A;  1CJ2 A;  1E7P A;  2BA9 A;  4AT2 A;  4YSY A;  1EBD A;  4U8L A;  3PS9 A;  3NYF A;  4A6N B;  3GD3 A;  3SZF A;  4YKF A;  2X3N A;  3UTF A;  2CDU A;  3QSM A;  2AR8 A;  1GAL A;  2GMH A;  1GRG A;  1JRX A;  3AE3 A;  3EF6 A;  1FL2 A;  4U8O A;  4EIQ A;  1KSS A;  3AD9 B;  3ITJ A;  2YLZ A;  3Q9T A;  2EQ9 A;  3BI4 A;  2HQM A;  3NIX A;  3ZYX A;  5LV9 A;  4H4U A;  1CJ3 A;  3I3L A;  4H4R A;  5HXI A;  2QA2 A;  1UKV G;  3CPH G;  3KU9 A;  2XVI A;  2DKH A;  2XFN A;  2J3N A;  2GAH B;  2AQJ A;  1BGN A;  3AE7 A;  2YR6 A;  4CCR A;  3NLC A;  4A65 A;  2BAC A;  3CNT A;  1JRZ A;  4B69 A;  1P2E A;  3K30 A;  2R0C A;  4H4Y A;  4X4J A;  5U63 A;  3UKQ A;  4H4V A;  3FG2 P;  2Q6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...