1LPFA

Three-dimensional structure of lipoamide dehydrogenase from pseudomonas fluorescens at 2.8 angstroms resolution. analysis of redox and thermostability properties
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
472
structure length
472
Chain Sequence
SQKFDVVVIGAGPGGYVAAIRAAQLGLKTACIEKYIGKEGKVALGGTCLNVGCIPSKALLDSSYKYHEAKEAFKVHGIEAKGVTIDVPAMVARKANIVKNLTGGIATLFKANGVTSFEGHGKLLANKQVEVTGLDGKTQVLEAENVIIASGSRPVEIPPAPLSDDIIVDSTGALEFQAVPKKLGVIGAGVIGLELGSVWARLGAEVTVLEALDKFLPAADEQIAKEALKVLTKQGLNIRLGARVTASEVKKKQVTVTFTDANGEQKETFDKLIVAVGRRPVTTDLLAADSGVTLDERGFIYVDDHCKTSVPGVFAIGDVVRGAMLAHKASEEGVMVAERIAGHKAQMNYDLIPSVIYTHPEIAWVGKTEQTLKAEGVEVNVGTFPFAASGRAMAANDTTGLVKVIADAKTDRVLGVHVIGPSAAELVQQGAIGMEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGHAIHIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROLIPOAMIDE DEHYDROGENASE
publication title Three-dimensional structure of lipoamide dehydrogenase from Pseudomonas fluorescens at 2.8 A resolution. Analysis of redox and thermostability properties.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Oxidoreductase
total genus 150
structure length 472
sequence length 472
chains with identical sequence B
ec nomenclature ec 1.8.1.4: Dihydrolipoyl dehydrogenase.
pdb deposition date 1992-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1lpfA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1lpfA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1lpfA02
3CPIG 4B1BA 1NHQA 4OPCA 5KXJA 3DK9A 3GYIA 2WDQA 3H8LA 3PO7A 4YT0A 4H4SA 3D8XA 4Y4NA 3G5QA 2IIDA 5CQFA 2WU5A 4ZCDA 3BI2A 1FEAA 2C66A 1GESA 1PJ6A 2Z5YA 2GH5A 4OPUA 4D03A 4B63A 3FIMB 3FG2P 1XDIA 1GRGA 4JY3A 4TM4A 2GAGB 1KNPA 5FS7A 4XWRA 1KFYA 3LOVA 3ADAB 1HYUA 3FPZA 4PAAA 1TDEA 2R45A 2YG3A 3CNJA 4I58A 4HB9A 2JBVA 2YLWA 5EOWA 4CBQA 4ADWA 4J36A 4Z44A 4FK1A 4LIIA 5EB5A 1RSGA 5U1OA 1K0JA 4YKGA 2TPRA 1PDHA 4LU6A 1QLBA 2YAUA 2QCUA 3UP5A 2W0HA 4RG4A 1CHUA 2OLNA 1BGNA 1CJ4A 4NTCA 1PN0A 3F8DA 3WE0A 4J57A 2WESA 3VQRA 4BK3A 3NK1X 1GRHA 1OJCA 4WX1A 2IVDA 1K0IA 4U8IA 4K5SA 4H4ZA 1TYPA 4YWOA 3P4QA 3JSKA 1LQUA 1GREA 4PABA 1VQWA 3LZWA 4H2QA 4TM3A 1E1MA 4EIQA 1JU2A 4EMJA 4H2RA 2BCGG 3GWFA 1N4UA 4FK1C 1LV0A 2RABA 1W4XA 2XYOA 2Y6QA 3K7TA 4WCTA 4OPGA 4U2SA 4TLZA 3QVPA 4USQA 3CGDA 3D1CA 1D7LA 3RP7A 3NTAA 5TR3A 2BCPA 2YWLA 4GUVA 2AAQA 1COYA 3AB1A 2XVHA 4C3YA 3GRTA 2C75A 2CVJA 4YTPA 1TDOA 4K22A 4Y4LA 2RGHA 2APGA 4YSXA 2WOVA 3UKAA 3QSMA 4BJZA 1N4WA 1FEBA 5JCMA 1DXLA 2YR6A 2XFOA 1KSUA 3F8RA 1H82A 2ZZCA 3BHFA 1LQTA 2XLSA 3NK0X 4HA6A 1H6VA 1D4EA 1TRBA 1YQ4A 2FBWA 4J34A 1VG9A 3UOZA 3DGHA 1NHSA 2YLRA 3UKHA 3UTFA 3EANA 1GXFA 1EL5A 1TDFA 1D7YA 1BGJA 1PXCA 2B7SA 2FJDA 1LVLA 1EL7A 2GMJA 4H4PA 3AEDA 3M13A 3O0HA 4O5QA 2O9ZA 3AE5A 3V3OA 3KVEA 5HXIA 1XHCA 1F3PA 4FX9A 3REDA 1ZX9A 1GEUA 1E1LA 4APNA 1CBOA 3C4AA 2XFPA 3ABVA 5LV9A 5FS8A 2YLXA 3B3RA 5EB4A 3UKKA 1L9DA 4GF7A 1GPEA 2JB3A 1Y56B 4EMWA 3II4A 2I0ZA 2YG7A 2BS3A 3IC9A 2ARDA 4AT2A 2WETA 3KD9A 2X8CA 4C5OA 4CCRA 2BC1A 5FS9A 2TMDA 1GSNA 3NG7X 1DOCA 1ZOVA 1H83A 2YVFA 4H4VA 2Q0LA 2CFYA 3COXA 3KU9A 2WHDA 4TM1A 4H4YA 4LA1A 1PBCA 4CY6A 3GD4A 4EQSA 4MJWA 2XVEA 3AECA 2GRTA 3C4NA 4OPIA 2GR1A 3ALLA 2Q7VA 2OA1A 5HY5A 4H2NA 1CC6A 2C3DA 1UKVG 4I59A 2C3CA 3NT6A 4B66A 1CF3A 3CPHG 4B65A 4BURA 1PS9A 2WU2A 3CTYA 4Z43A 3AEEA 4JDRA 2R46A 1S3EA 2YM2A 2JAEA 3UTGA 4J56A 3ALJA 4GR1A 1BKWA 2BYBA 4KX6A 4AP1A 4A6NA 3CGEA 1CC2A 3DK8A 2GR2A 4EIPA 4JQ9A 5U25A 1ELIA 5M10A 3BI5A 3DMEA 4IVOB 1KDGA 2H88A 1S2YA 4P9SA 2BABA 2YLZA 4AOXA 4YSZA 2YG4A 2XLTA 3ALMA 4IA5A 3UTEA 3NN6X 1K4QA 3GD3A 4EQWA 2YLTA 3NNEA 4U8NA 4H4QA 3KA7A 2PYXA 3AYLA 5BUKA 2GV8A 2JB1A 3R9UA 3UKPA 4Z26A 2V3AA 3UOXA 3EPTA 5JCIA 5BULA 1EBDA 4Z25A 1LJ1A 3DJJA 1B37A 5HHFA 5GSNA 2EQ7A 3OZ2A 1GTHA 1DODA 4J33A 5J7XA 3SFEA 3HZLA 1YY5A 1GRTA 3GWDA 3NHOX 1NHRA 1REOA 3M12A 1X31B 2GVCA 3ISHA 1S3BA 4K7ZA 2WPEA 1NDAA 2CDUA 2X99A 1JRXA 4X9MA 4B64A 4U8MA 1OJDA 3VR9A 4A65A 5IQ1A 2J3NA 2R0CA 2WS3A 1PJ5A 2WPCA 2XFQA 1D5TA 2ZZ0A 1JNRA 1VDCA 2VRMA 3AE7A 2GF3A 1GERA 4Z2RA 3RHAA 3GYJA 2A89A 1V59A 1IUSA 2VVLA 1VG0A 4N9XA 5U63A 1B5QA 3IF9A 4FDCB 1ZMDA 5FS6A 1KSSA 1P2HA 3AYIA 3P9UA 4U8PA 1NHPA 2WP9A 2VQBA 2XVJA 4OPDA 2AR8A 1H7WA 3NRNA 4GDEA 4OCGA 4K2XA 2WBAA 1XPQA 2RGJA 1PBEA 3P4PA 1PXBA 2GQFA 4NEWA 2C73A 3K7QX 4OPLA 2JK6A 1P2EA 1KF6A 3AE9A 5JCNA 2VQ7A 1IUUA 3K30A 3CPJG 3BNMA 2VOUA 3FBSA 1YQZA 4B69A 4U2LA 3S61A 3GMCA 1BWCA 1AOGA 1M6IA 3GMBA 3RP6A 4A7AA 1ONFA 3QFBA 3P4SA 1LTXR 2Q0KA 3SGLA 2QAEA 2VZ2A 1BZLA 1PBBA 1TDNA 2V61A 4EM4A 3IHMA 4NTDA 4Z2UA 4O5UA 3I3LA 4H4WA 5KWFA 3AEBA 4IV9A 2BK4A 4K5RA 2B76A 3G5RA 5J60A 2BC0A 4DNAA 2YVJA 1Y0PA 1JRYA 5FMHA 2WP5A 4AOSA 1FECA 4U8OA 3CNDA 2DKHA 5GRTA 2XVIA 1GRAA 3AWIA 1OJ9A 4KPRA 4YSYA 1YQ3A 2YG5A 1D4CA 2YR5A 3CNTA 4GRTA 2A8XA 4J31A 2PHHA 2R4JA 1E1NA 3UKQA 5JCLA 3AYJA 1CC4A 1FCDA 4Z24A 2C76A 1TDKA 2F5ZA 2FJEA 1QO8A 3AE4A 2R0PA 2BK5A 3URHA 3OC4A 1RP0A 5KVHA 2BXSA 3AEGA 3VRAA 1Q1WA 1NG4A 1B8SA 4DSHA 2WDRA 2JB2A 2H89A 1NENA 5JCKA 2YR4A 4YTNA 1JRZA 2FJAA 1L0VA 3FMWA 4UP3A 5KOWA 2BK3A 4UDRA 3AE3A 1NPXA 1L9CA 2B7RA 4EMIA 1F8WA 2GQWA 5ER0A 4CY8A 4ECHA 2YQUA 2RGOA 4RSLA 3NYCA 4OVIA 2ZZBA 3QFAA 4H4XA 1IUVA 2R4EA 1MXTA 2BS4A 4U8LA 1E1KA 4U8JA 4JNAA 4E0VA 4BK2A 2Z5XA 1ZMCA 1CL0A 4J2WA 3BI4A 1DJNA 2WP6A 3P1WA 2X50A 1L9EA 1PBDA 4JN9A 1EL8A 3VRBA 4REKA 2E1MA 4RG3A 1F8RA 1GRFA 1TYTA 2Y6RA 2E5VA 4USRA 1CJCA 1H81A 4TM0A 3C96A 3AD8B 3ICRA 2GEWA 3CGBA 3NYFA 1NG3A 3AE2A 2OLOA 3GDNA 1MO9A 2GB0A 2C64A 3AE8A 3NK2X 2WQYA 2V5ZA 3KKJA 1FL2A 4YKFA 3K7MX 1ZP0A 2NVKX 1S2QA 3AEFA 1E6EA 4U8KA 2BA9A 4IA6A 4NTEA 3NKSA 3P4RA 1MOKA 3CNSA 2X8GA 2C70A 5HYMA 5KOXA 2WEUA 4A5LA 1B4VA 3V3NA 1NEKA 5CKUA 4C3XA 1NAAA 3DJEA 2VRLA 3PS9A 3QSSA 1M64A 4A99A 1D4DA 4EQRA 4OPTA 2BXRA 3G5SA 2C65A 3KLJA 4EM3A 1O95A 4GCMA 1GTEA 2GR3A 3SM8A 1O94A 3LADA 3CIRA 4X4JA 4CNJA 3RP8A 3NTDA 4A6NB 1E39A 4DGKA 2XFNA 2XLUA 3ICSA 1K0LA 3NGCX 1LPFA 2YG6A 2EQ9A 1ZDLA 1DJQA 1GV4A 4C74A 3M0OA 3NH3X 1IUWA 4ZCCA 1Z6LA 4H2PA 2OAMA 4ICYA 3UP4A 2Q6UA 3LXDA 2V6OA 1E7PA 4NEVA 1KNRA 1EL9A 1ZKQA 1Q1RA 3GRSA 2XLPA 1JNZA 3AXBA 3AD9B 1GOSA 3QSEA 2YVGA 2B9XA 3ATQA 3VR8A 4A79A 5KRQA 5M0ZA 3DJGX 1DOBA 2YM1A 3L8KA 4K8DA 1F8SA 2WDVA 2XDOA 1N1PA 1JEHA 3V76A 1RYIA 1O5WA 1ZOYA 1H84A 2DKIA 2XCGA 4JNQA 4UDQA 2FJBA 3ATRA 1OJAA 3B6DA 2WOIA 1SEZA 2XLRA 3LZXA 3SQPA 1Y56A 3PVCA 2EQ6A 2ZBWA 3BNUA 1IUTA 1YKJA 3DJDA 5BRTA 1IUXA 1GALA 2V60A 4YTMA 3NN0X 5C2TA 3VRDB 4GDPA 3ZYXA 1GRBA 2GMHA 3LJPA 3EF6A 4C77A 2NPXA 1QJDA 3UKFA 3NIXA 3ICTA 3DGZA 1ZY8A 2QA1A 4AT0A 2ACZA 5C3JA 2XVFA 2E4GA 1GT8A 2GAHB 3IHGA 1H7XA 2VVLG 3H8IA 2VVMA 4NZHA 2XFUA 1DNCA 1PBFA 4Z2TA 1PJ7A 3DK4A 2IVEA 1GNDA 3AEAA 3UTHA 2C7GA 3NLCA 3F8PA 3QVRA 1H86A 4B67A 4DSGA 4H4RA 4IVMB 5EBKA 3UCLA 1BF3A 4CNKA 4CRTA 2QA2A 2BS2A 1XANA 1GETA 5BVAA 3CN8A 1IJHA 4H7UA 3CNPA 3E1TA 4XWZA 3AE6A 3H4KA 2AQJA 3S5WA 4XXGA 3LB8A 3L1RA 3NYEA 4ZN0A 1N4VA 3SFDA 2X8HA 5L46A 4H4TA 3ITJA 4BJYA 3UKLA 3UOYA 1ZK7A 4M52A 2B9YA 1PXAA 3IWAA 3T37A 2X3NA 3Q9TA 1VRQB 3AD7B 2WPFA 5KVIA 4Y4MA 2OALA 1PHHA 5IPYA 2EQ8A 3KPFA 3DA1A 2BACA 4U2TA 3EAOA 2JKCA 1Q9IA 3Q6JA 1F6MA 4X9NA 5IQ4A 4UDPA 4CCQA 3GSIA 2R0GA 2YLSA 3UOVA 3ZDNA 3RNMA 2A87A 3DH9A 1DOEA 4BK1A 3CGCA 2C67A 4EQXA 2HQMA 4JY2A 3BHKA 3AE1A 2WOWA 2GR0A 3QJ4A 1CJ2A 4BV6A 2C72A 4YSHA 5DBJA 4H50A 2V3BA 4YXDA 3I6DA 4D04A 2B9WA 2UZZA 4AP3A 1CJ3A 1FOHA 3GDPA 1JOAA 2CULA 4TLXA 4A9WA 4B68A 2R9ZA 4H4UA 1OJTA
chains in the Genus database with same CATH superfamily
1NHQA 5KXJA 4HCLA 4H4SA 3D8XA 2IIDA 1FEAA 3D46A 4TM4A 1KNPA 3DEQA 3ADAB 1HYUA 3H7VA 2YG3A 2JBVA 2YLWA 2GGGA 4ADWA 3P3BA 5KMQA 3RRAA 3UJEA 5EB5A 1PDZA 1PDHA 4LU6A 1EC8A 1QLBA 1WUEA 3FXGA 2W0HA 1CHUA 3F8DA 4H2HA 4BK3A 3T2YA 4MGGA 1K0IA 4H4ZA 4YWOA 4IL2A 1LQUA 2PU1A 3IJIA 2BCGG 4DX3A 4H2RA 1N4UA 4IL0A 4GUVA 1COYA 3BOXA 1MNSA 4YWSA 1XPYA 3B97A 4Y4LA 2RGHA 4YSXA 4BJZA 1KSUA 4HA6A 4J34A 2XH0A 1SJAA 3UTFA 1GXFA 1PXCA 3DFYA 4O5QA 3MSYA 4A35A 1XHCA 1F3PA 1ZX9A 1CBOA 4K2SA 3UKKA 1L9DA 4EWJA 2JB3A 4EMWA 3II4A 3PK7A 2BS3A 3R10A 4K8GA 4CCRA 1GSNA 3NG7X 4H4VA 2CFYA 3KU9A 4TM1A 3GD4A 4EQSA 3QKEA 3ES7A 2GRTA 4TVYA 2XVEA 3DG7A 3HYXA 2C3DA 4I59A 3R0UA 3P93A 1CF3A 3CPHG 1PS9A 2WU2A 3CTYA 3CK5A 3AEEA 1MUCA 2R46A 3CXBA 3CGEA 3TJIA 4JQ9A 1ELIA 2GDQA 3QN3A 3DIPA 4FI4A 4EQWA 2YLTA 3NNEA 3K1GA 5BUKA 2V3AA 3EPTA 4E4UA 4IZGA 3SFEA 3HZLA 3SX6A 2GL5A 3FJ4A 2GVCA 3SXIA 1S3BA 4GAVA 5KMRA 2CDUA 1JRXA 3T4WA 1EC7A 3H12A 1D5TA 1V97A 3ZVHA 1GERA 2W3RA 1IUSA 2VVLA 1VG0A 4U8PA 3IF9A 3AYIA 1ZMDA 1NHPA 2VQBA 4GMEA 2XVJA 4OPDA 2P8CA 3KPKA 3AE9A 5JCNA 2VOUA 3S61A 4G7FA 3GMCA 4G74A 1BWCA 1AOGA 1X2HA 3QFBA 3OZMA 5G5HB 2Q0KA 1TDNA 3IHMA 4NTDA 3T6CA 5KWFA 4K5RA 4IV9A 2XVIA 4G73A 3GD6A 3AWIA 4KPRA 1N62C 1YQ3A 3CNTA 1E1NA 4KPLA 5ENLA 2R0PA 5KVHA 3AEGA 1R0MA 1FO4A 1Q1WA 2WDRA 2JB2A 2H89A 5KOWA 2BK3A 2GQWA 5ER0A 4CY8A 2GGJA 2RGOA 3SJNA 2XH7A 4H4XA 2PTZA 4J3ZA 3BI4A 1DJNA 1YEYA 2X50A 1L9EA 4RG3A 4NWZA 1MDLA 3SZCA 3AD8B 2GEWA 2OX4A 3GDNA 3SSZA 3N6HA 3AE8A 3NK2X 2V5ZA 4YKFA 1ZP0A 2NVKX 2MNRA 4GAPA 2BA9A 3R25A 2X8GA 2OZ8A 3DJEA 2W3SA 3QSSA 4A99A 3LADA 4X4JA 4CNJA 3NVVB 2XFNA 4FP1A 3ICSA 2YG6A 3DG6A 4C74A 1IUWA 1Z6LA 3ETRB 2Q6UA 2V6OA 1KNRA 1E7PA 3QSEA 1JNZA 3NRZB 3N4FA 2B9XA 3ATQA 3VR8A 3DJGX 3CAWA 2XDOA 3NVWB 3THUA 1ZOYA 2OG9A 2XCGA 4UDQA 1OJAA 1Y56A 1F9CA 2EQ6A 5BRTA 4YTMA 3VRDB 2GMHA 3LJPA 3EF6A 2NPXA 3ZVHB 2OZ3A 4AT0A 1GT8A 3IHGA 3DK4A 1GNDA 1SJDA 3NLCA 4H4RA 4IVMB 4HCHA 4CRTA 2BS2A 4H83A 4DWDA 1P43A 1H2IA 2AQJA 3B9JB 4H4TA 3ITJA 1ZK7A 2B9YA 2X3NA 4GGHA 4JN8A 3Q9TA 5G5GB 4U2TA 3EAOA 1F6MA 4UDPA 2HZGA 2R0GA 1IYXA 4BK1A 3CYJA 4YSHA 5DBJA 2V3BA 3GO2A 3H70A 5KNLA 1CJ3A 1FOHA 4B68A 4B1BA 3V5CA 1JROA 4ZCDA 2FYMA 1GESA 2Z5YA 4OPUA 1GRGA 2GAGB 3ENLA 4XWRA 3LOVA 3I4KA 4HB9A 4IP4A 4J36A 4Z44A 4FK1A 1RSGA 2TPRA 2OLNA 1BGNA 4NTCA 3WE0A 3NK1X 3P4QA 3Q45A 1GREA 3MWCA 1VQWA 3LZWA 4TM3A 1E1MA 4EMJA 3FV9A 3I6EA 2Y6QA 1S7MA 3AN1A 3K7TA 1D7LA 3MQTA 3VDGA 2AAQA 4C3YA 2HXTA 2C75A 3RITA 1N4WA 1FEBA 2AKMA 3VFCA 2PP0A 5BOEA 3F8RA 1H82A 2ZZCA 3BHFA 3NK0X 2XLSA 1H6VA 1YQ4A 3VCNA 2RDXA 3TW9A 1ONEA 2B7SA 1D7YA 2PU0A 2FJDA 4ZCWA 3AEDA 4H4PA 4HCDA 1PDYA 1VDVA 1E1LA 3C4AA 2XFPA 1TKKA 5FS8A 3B3RA 1Y56B 5JRBA 3STPA 2WETA 2PTXA 1RM6B 2TMDA 4G6HA 1ZOVA 1H83A 2YVFA 3COXA 4LA1A 1PBCA 3T0KA 4OPIA 2GR1A 2Q7VA 1CC6A 3NT6A 4Z17A 4JDRA 2YM2A 3NVYB 4GR1A 2XGZA 4AP1A 4A6NA 5U25A 3DMEA 4P9SA 2BABA 4YSZA 2XLTA 1K4QA 3GD3A 2OVLA 4H4QA 3CMMA 3AYLA 3P0WA 4Z26A 3UKPA 3CT2A 5JCIA 1EBDA 3ZLFA 5HHFA 5GSNA 3V3WA 2PPGA 5J7XA 3HPFA 3NHOX 2OPJA 1REOA 1X31B 3R07C 4J1OA 4U8MA 4A65A 3SZWA 5IQ1A 2J3NA 2R0CA 2WPCA 2PODA 2VRMA 2GF3A 4Z2RA 3DERA 4FDCB 1P2HA 1H7WA 3NRNA 2WBAA 4GFIA 1XPQA 2RGJA 1SJCA 2AKZA 2GQFA 2C73A 2JK6A 2HNEA 3RP6A 4H19A 2VZ2A 4EM4A 3I3LA 3VC6A 4H4WA 2OZTA 1ELSA 4DNAA 4HPNA 5FJTA 3DGBA 1OJ9A 3NFUA 4YSYA 2PHHA 2R4JA 3UKQA 1CC4A 4Z24A 3NO1A 2BXSA 4ENLA 1NG4A 1B8SA 2OKTA 4YTNA 2FJAA 1NELA 3FMWA 4UP3A 2W55A 4UDRA 3AE3A 2B7RA 3UCCA 1F8WA 3SN0A 3NYCA 4OVIA 2ZZBA 1MXTA 4U8JA 2Z5XA 2WP6A 1EL8A 4REKA 2E1MA 2AL2A 3A7UA 2E5VA 1CJCA 3V4BA 4TM0A 3C96A 3CGBA 3NYFA 3AE2A 2OLOA 1X2GA 2GB0A 2C64A 5KOXA 2WEUA 3V3NA 1NEKA 5CKUA 1BQGA 4EQRA 2C65A 4GCMA 3AMZA 3RP8A 4A6NB 1E39A 1ZXIC 3HYWA 1WYGA 1K0LA 3N6JA 2HXUA 1ZDLA 2ZADA 1WUFA 2OAMA 4ICYA 2QJNA 1EBHA 1ZKQA 1Q1RA 1L8PA 3AD9B 5KRQA 3SYIA 1F8SA 3DG3A 4II2A 2GGHA 3V76A 1RYIA 2P88A 3SN4A 1H84A 2WOIA 2XLRA 3IK4A 3SQPA 3PVCA 3SZFA 1STZA 3BNUA 4A3RA 3DJDA 1YKJA 2PGEA 2E3TA 1GRBA 1QJDA 4GIRA 3QTPA 3UKFA 2OFJA 2E4GA 2OLAA 4NZHA 2OQHA 1E9IA 3V5FA 3AEAA 2C7GA 3S47A 1H86A 4B67A 5EBKA 3ZVIA 1XANA 1GETA 4GYPC 3CN8A 1IJHA 4H7UA 4XWZA 2E5AA 3LB8A 3HRDC 1N4VA 4A6GA 2X8HA 5L46A 4K1WA 3L5OA 4BJYA 4ROPA 4M52A 3IWAA 3T37A 2FKPA 1N60C 3GY1A 1N5XA 2JKCA 3Q6JA 4KWSA 4X9NA 5IQ4A 3GSIA 3ZDNA 3RNMA 2A87A 1DOEA 1BKHA 5FJUA 4JY2A 3BHKA 3AE1A 4BV6A 2C72A 4H50A 3MKCA 3I6DA 1JOAA 2CULA 4A9WA 1KKOA 4H4UA 1OJTA 4OPCA 3DK9A 3NXLA 3PO7A 4YT0A 3G5QA 5CQFA 3BI2A 1KCZA 4D03A 4B63A 3FG2P 1XDIA 4JY3A 3ES8A 5FS7A 1KFYA 2BRYA 2R45A 2AL2B 3UGVA 4LIIA 1K0JA 4YKGA 2QCUA 3R1ZA 3UP5A 3T31A 1CJ4A 1PN0A 2WESA 3VQRA 4WX1A 2IVDA 4K5SA 1TYPA 4PABA 1JU2A 4M6UA 4FK1C 1LV0A 1DTNA 4GGBA 4U2SA 3CGDA 3D1CA 3EEZA 5TR3A 2BCPA 2PMQA 3GRTA 2CVJA 4YTPA 1TDOA 4K22A 3UKAA 3QSMA 2XFOA 1LQTA 1D4EA 1VG9A 3MUCA 3DGHA 2YLRA 4JHMA 3EANA 1EL5A 3OZ2A 4X2PA 1EL7A 2GMJA 3M13A 3O0HA 2O9ZA 2QGYA 3KVEA 3REDA 3T2ZA 1GEUA 4APNA 2GSHA 3ABVA 2YLXA 3U4FA 5EB4A 3EKGA 4GF7A 1FIQB 2I0ZA 2YG7A 1NU5A 3IC9A 3TOYA 4AT2A 3KD9A 2XSXA 2X8CA 3OPSA 4G9KA 2OQYA 2Q0LA 2POZA 4Z1YA 3AECA 3C4NA 3ALLA 2OA1A 4DYEA 4H2NA 1UKVG 2C3CA 4B66A 4BURA 3ALJA 1BKWA 3UXKA 2PTYA 2GR2A 4EIPA 7ENLA 5M10A 4KEMA 3BI5A 1SB3B 1KDGA 2H88A 1S2YA 2GGEA 3ALMA 4IA5A 3UTEA 3RR1A 4U8NA 2OO6A 1JRPA 2GV8A 3UOXA 5BOFA 3MZNA 5BULA 1B37A 1GTHA 2C4CA 1DODA 4J33A 4DN1A 3UCDA 1NHRA 3M12A 3ISHA 4K7ZA 2X99A 4B64A 1OJDA 3VR9A 4ZOHB 4KT2A 2XFQA 1JNRA 3AE7A 3TWBA 2P8BA 1V59A 5U63A 1B5QA 3P9UA 2WP9A 2AR8A 4OCGA 4K2XA 3T9PA 1PBEA 1P48A 3K7QX 4OPLA 1KF6A 2VQ7A 3K30A 3TTEA 3BNMA 3CPJG 3CXOA 1YQZA 4U2LA 5KMPA 4A7AA 3SGLA 2QAEA 3BSMA 1PBBA 5FJPA 2BK4A 5J60A 2ZC8A 3TJ4A 5J04A 2AL1A 1Y0PA 1JRYA 1FECA 4U8OA 3CNDA 3PWGA 6ENLA 2YG5A 4J31A 2A8XA 5JCLA 2FJEA 1QO8A 2P3ZA 2PP3A 3URHA 3OC4A 1RP0A 3IJQA 4DSHA 5JCKA 2YR4A 1L0VA 3PWIA 1L9CA 3T8QA 4G8TA 4ECHA 4HNLA 2R4EA 3FYYA 3EUB3 2BS4A 4U8LA 4JNAA 4BK2A 1ZMCA 1CL0A 4J2WA 1F8RA 4USRA 3NVZB 4IT1A 2PTWA 1NG3A 2P0IA 1SJBA 4HNCA 2WQYA 3KKJA 3VA8A 4NTEA 1MOKA 2C70A 5HYMA 1RVKA 4C3XA 1NAAA 1M64A 1N5WC 3QPEA 1GTEA 2GR3A 3S5SA 3RGTA 1LPFA 4JN7A 2EQ9A 1DJQA 3NH3X 4ZCCA 1ECQA 3PG6A 3LXDA 3SR6B 3GRSA 2XLPA 3AXBA 1GOSA 2YVGA 2YM1A 4K8DA 2WDVA 2BRAA 4JNQA 2FJBA 3ATRA 3B6DA 1SEZA 3LZXA 2ZBWA 2I5QA 2V60A 1GALA 4GDPA 3ZYXA 3CB3A 3OTRA 3NIXA 3ICTA 3DGZA 2XVFA 4NNJA 3OP2A 2XFUA 1PJ7A 3UTHA 2MUCA 3QVRA 4DSGA 1EBGA 2QA2A 3KUMA 5BVAA 3AE6A 3H4KA 3S5WA 4XXGA 3L1RA 1TE6A 4MMWA 3UJFA 2ONEA 3UKLA 3UOYA 1PXAA 5KVIA 4Y4MA 2OALA 1PHHA 2EQ8A 3DA1A 1Q9IA 2GGIA 3R0KA 3CGCA 2C67A 2HQMA 2GR0A 1CJ2A 2PS2A 4D04A 2B9WA 2UZZA 4AP3A 1XS2A 2R9ZA 4M0XA 3CPIG 4TVWA 5KMSA 3GYIA 2WDQA 3H8LA 3PFRA 4Y4NA 3SN1A 2WU5A 2C66A 3NS1B 1PJ6A 2GH5A 3FIMB 3FPZA 3TQPA 1TDEA 4I58A 3CNJA 4PAAA 5EOWA 2XH2A 4CBQA 3SBFA 3DDMA 3OZYA 5U1OA 2YAUA 4RG4A 2QJJA 3I6TA 4J57A 1GRHA 1OJCA 4U8IA 2XH4A 3JSKA 4H2QA 4EIQA 3GWFA 2RABA 1W4XA 2XYOA 4WCTA 4OPGA 3RCYA 4TLZA 3QVPA 4USQA 3RP7A 3NTAA 2YWLA 5FJRA 3SY4A 3AB1A 2XVHA 2PGWA 2APGA 2WOVA 5JCMA 2YR6A 1DXLA 2O56A 1TRBA 2FBWA 3UOZA 1NHSA 3UKHA 2PA6A 1TDFA 1BGJA 1LVLA 3HW2A 3VCCA 3V3OA 3AE5A 4HN8A 5HXIA 2PCEA 4H1ZA 3GC2A 4FX9A 5LV9A 3RO6A 4E4FA 1GPEA 3TWAA 4E8GA 1FHVA 2ARDA 4C5OA 2BC1A 5FS9A 1JPMA 1DOCA 2WHDA 4H4YA 4CY6A 4MJWA 5HY5A 3T14A 4B65A 4Z43A 1KKRA 1S3EA 2JAEA 3UTGA 4J56A 2BYBA 4KX6A 1CC2A 3DK8A 4E5TA 3UXLA 4IVOB 2YLZA 4AOXA 2YG4A 4G6GA 3NN6X 3KA7A 2PYXA 2JB1A 3R9UA 4Z25A 1LJ1A 3DJJA 2EQ7A 1T3QC 1YY5A 1GRTA 3GWDA 1FFUC 2WPEA 1NDAA 4X9MA 2WS3A 3UJ2A 1PJ5A 2ZZ0A 3ZLHA 1FHUA 1VDCA 3D9XA 3RHAA 3GYJA 2A89A 4N9XA 2PP1A 5FS6A 1KSSA 4GDEA 3P4PA 3A7RA 1PXBA 4NEWA 2QDEA 1P2EA 1IUUA 3HYVA 3FBSA 1FFVC 4B69A 1M6IA 3GMBA 1ONFA 3P4SA 1LTXR 1BZLA 2V61A 4Z2UA 4O5UA 1KN0A 3AEBA 2NQLA 4II3A 2B76A 3G5RA 2BC0A 4GYPA 2YVJA 1TZZA 5FMHA 2WP5A 4AOSA 4IP5A 2DKHA 5GRTA 1GRAA 1D4CA 2YR5A 4GRTA 1EC9A 3AYJA 1FCDA 2DW6A 2C76A 1TDKA 2F5ZA 1N63C 5EU9A 3AE4A 2BK5A 4GISA 1JDFA 3VRAA 3A7AA 1NENA 1JRZA 4HYRA 1NPXA 4EMIA 2YQUA 4RSLA 4F4RA 1VQZA 3QFAA 1IUVA 2CHRA 1E1KA 2QVHA 3P1WA 4JN9A 1PBDA 3VRBA 1GRFA 3FVDA 1KD0A 1TYTA 2Y6RA 1JCTA 4ZA0A 1H81A 3ICRA 4IHCA 3GYXA 1MO9A 2QDDA 3R11A 3BJSA 3D47A 1FL2A 3K7MX 2QJMA 1S2QA 3AEFA 1E6EA 4U8KA 4IA6A 3NKSA 3P4RA 3CNSA 4A5LA 1B4VA 3IJLA 2VRLA 3PS9A 1MRAA 5FJOA 1D4DA 4OPTA 2BXRA 3G5SA 3KLJA 4EM3A 1O95A 3SM8A 1O94A 3CIRA 4E6MA 3NTDA 4DGKA 2XLUA 3U9IA 3NGCX 1GV4A 1W6TA 3M0OA 4H2PA 2W54A 3UP4A 4E0VA 4NEVA 1EL9A 3VC5A 4A79A 5M0ZA 1DOBA 3L8KA 1N1PA 1JEHA 1O5WA 2DKIA 5IDZA 1IUTA 1IUXA 1OEPA 3SQSA 3NN0X 3UJRA 5C2TA 4C77A 1ZY8A 2QA1A 2ACZA 5C3JA 2GAHB 1H7XA 2DW7A 2VVLG 3H8IA 2VVMA 1DNCA 1PBFA 4Z2TA 4MKSA 2IVEA 3F8PA 3OW1A 4DHGA 3UCLA 1BF3A 4CNKA 3Q4DA 3AM9A 3ZLGA 3CNPA 3E1TA 3JW7A 3UJSA 3JVAA 3N4EA 3NYEA 4ZN0A 4DXKA 3SFDA 1JPDX 3FCPA 3H8AA 3JZUA 1VRQB 3AD7B 2WPFA 2QQ6A 5IPYA 3KPFA 2BACA 4CCQA 3UOVA 2YLSA 3T2KA 3DESA 2PSNA 3DH9A 3TCSA 1N61C 4EQXA 3DFHA 2WOWA 3QJ4A 3SZ0A 3QLDA 4YXDA 3NZGA 3GDPA 4TLXA 1R6WA 3MY9A 1MDRA
chains in the Genus database with same CATH topology
3CPIG 4B1BA 1NHQA 4OPCA 5KMSA 3DK9A 5KXJA 3GYIA 2WDQA 3H8LA 3PO7A 4YT0A 4H4SA 3D8XA 4Y4NA 3G5QA 2IIDA 5CQFA 2WU5A 4ZCDA 3BI2A 1FEAA 2C66A 1GESA 1PJ6A 2Z5YA 2GH5A 4OPUA 4D03A 4B63A 3FIMB 3FG2P 1XDIA 1GRGA 4JY3A 4TM4A 2GAGB 1KNPA 5FS7A 4XWRA 1KFYA 3LOVA 3ADAB 1HYUA 3FPZA 2BRYA 1TDEA 2R45A 2YG3A 3CNJA 4I58A 4HB9A 4PAAA 2JBVA 2YLWA 5EOWA 4CBQA 4ADWA 4J36A 5KMQA 4Z44A 4FK1A 4LIIA 5EB5A 1RSGA 5U1OA 1K0JA 4YKGA 2TPRA 1PDHA 4LU6A 1QLBA 2YAUA 2QCUA 3UP5A 2W0HA 4RG4A 3T31A 1CHUA 2OLNA 1BGNA 1CJ4A 4NTCA 1PN0A 3F8DA 3WE0A 4J57A 2WESA 3VQRA 4BK3A 3T2YA 3NK1X 1GRHA 1OJCA 4WX1A 2IVDA 1K0IA 4U8IA 4K5SA 4H4ZA 1TYPA 4YWOA 3P4QA 3JSKA 1LQUA 1GREA 4PABA 1VQWA 3LZWA 4H2QA 4TM3A 1E1MA 4EIQA 1JU2A 4EMJA 4H2RA 2BCGG 3GWFA 1N4UA 4FK1C 1LV0A 2RABA 1W4XA 1S7MA 2XYOA 2Y6QA 3K7TA 4WCTA 4OPGA 4U2SA 4TLZA 3QVPA 4USQA 3CGDA 3D1CA 1D7LA 3RP7A 3NTAA 5TR3A 2BCPA 2YWLA 4GUVA 3SY4A 2AAQA 1COYA 3AB1A 2XVHA 4C3YA 3GRTA 2C75A 2CVJA 4YTPA 1TDOA 4K22A 4Y4LA 2RGHA 2APGA 4YSXA 2WOVA 3UKAA 3QSMA 4BJZA 1N4WA 1FEBA 5JCMA 1DXLA 2YR6A 2XFOA 1KSUA 3F8RA 1H82A 2ZZCA 3BHFA 1LQTA 2XLSA 3NK0X 4HA6A 1H6VA 1D4EA 1TRBA 1YQ4A 2FBWA 4J34A 1VG9A 3UOZA 3DGHA 1NHSA 2YLRA 3UKHA 3UTFA 3EANA 1GXFA 1EL5A 1TDFA 1D7YA 1BGJA 1PXCA 2B7SA 2FJDA 1LVLA 1EL7A 2GMJA 4H4PA 3AEDA 3M13A 3O0HA 4O5QA 2O9ZA 3AE5A 3V3OA 3KVEA 5HXIA 1XHCA 1F3PA 4FX9A 3REDA 3T2ZA 1ZX9A 1GEUA 1E1LA 4APNA 1CBOA 3C4AA 2XFPA 3ABVA 5LV9A 5FS8A 2YLXA 3B3RA 5EB4A 3UKKA 1L9DA 4GF7A 1GPEA 2JB3A 1Y56B 4EMWA 3II4A 2I0ZA 2YG7A 5JRBA 2BS3A 3IC9A 2ARDA 4AT2A 2WETA 3KD9A 2X8CA 4C5OA 4CCRA 2BC1A 5FS9A 2TMDA 4G9KA 4G6HA 1GSNA 3NG7X 1DOCA 1ZOVA 1H83A 2YVFA 4H4VA 2Q0LA 2CFYA 3COXA 3KU9A 2WHDA 4TM1A 4H4YA 4LA1A 1PBCA 4CY6A 3GD4A 4EQSA 4MJWA 3T0KA 2XVEA 3AECA 2GRTA 3C4NA 4OPIA 2GR1A 3HYXA 3ALLA 2Q7VA 2OA1A 5HY5A 4H2NA 1CC6A 2C3DA 1UKVG 4I59A 2C3CA 3NT6A 4B66A 1CF3A 3CPHG 3T14A 4B65A 4BURA 1PS9A 2WU2A 3CTYA 4Z43A 3AEEA 4JDRA 2R46A 1S3EA 2YM2A 2JAEA 3UTGA 4J56A 3ALJA 4GR1A 1BKWA 2BYBA 4KX6A 4AP1A 4A6NA 3CGEA 1CC2A 3DK8A 2GR2A 4EIPA 4JQ9A 5U25A 1ELIA 5M10A 3BI5A 3DMEA 4IVOB 1KDGA 2H88A 1S2YA 4P9SA 2BABA 2YLZA 4AOXA 4YSZA 2YG4A 2XLTA 3ALMA 4G6GA 4IA5A 3UTEA 3NN6X 1K4QA 3GD3A 4EQWA 2YLTA 3NNEA 4U8NA 4H4QA 3CMMA 3KA7A 2PYXA 3AYLA 5BUKA 2GV8A 2JB1A 3R9UA 3UKPA 4Z26A 2V3AA 3UOXA 3EPTA 5JCIA 5BULA 1EBDA 4Z25A 1LJ1A 3DJJA 1B37A 5HHFA 5GSNA 2EQ7A 3OZ2A 1GTHA 2C4CA 1DODA 4J33A 5J7XA 3SFEA 3HZLA 1YY5A 1GRTA 3SX6A 3GWDA 3NHOX 1NHRA 1REOA 3M12A 1X31B 2GVCA 3ISHA 3SXIA 1S3BA 4GAVA 5KMRA 4K7ZA 2WPEA 1NDAA 2CDUA 2X99A 1JRXA 4X9MA 4B64A 4U8MA 1OJDA 3VR9A 4A65A 3SZWA 5IQ1A 2J3NA 2R0CA 2WS3A 1PJ5A 2WPCA 2XFQA 1D5TA 2ZZ0A 1JNRA 1VDCA 2VRMA 3AE7A 2GF3A 1GERA 3D9XA 4Z2RA 3RHAA 3GYJA 2A89A 1V59A 1IUSA 2VVLA 1VG0A 4N9XA 5U63A 1B5QA 3IF9A 4FDCB 1ZMDA 5FS6A 1KSSA 1P2HA 3AYIA 3P9UA 4U8PA 1NHPA 2WP9A 2VQBA 2XVJA 4OPDA 2AR8A 1H7WA 3NRNA 4GDEA 4OCGA 4K2XA 2WBAA 1XPQA 2RGJA 1PBEA 3KPKA 3P4PA 1PXBA 2GQFA 4NEWA 2C73A 3K7QX 4OPLA 2JK6A 1P2EA 1KF6A 3AE9A 5JCNA 2VQ7A 1IUUA 3K30A 3CPJG 3BNMA 2VOUA 3HYVA 3FBSA 1YQZA 4B69A 4U2LA 3S61A 5KMPA 3GMCA 4G74A 1BWCA 1AOGA 1M6IA 3GMBA 3RP6A 4A7AA 1ONFA 3QFBA 3P4SA 1LTXR 2Q0KA 3SGLA 2QAEA 2VZ2A 1BZLA 1PBBA 1TDNA 2V61A 4EM4A 3IHMA 4NTDA 4Z2UA 4O5UA 3I3LA 1KN0A 4H4WA 5KWFA 3AEBA 4IV9A 2BK4A 4K5RA 4II3A 2B76A 3G5RA 5J60A 2BC0A 4DNAA 2YVJA 1Y0PA 1JRYA 5FMHA 2WP5A 4AOSA 1FECA 4U8OA 3CNDA 2DKHA 5GRTA 2XVIA 1GRAA 4G73A 3AWIA 1OJ9A 4KPRA 4YSYA 1YQ3A 2YG5A 1D4CA 2YR5A 3CNTA 4GRTA 2A8XA 4J31A 2PHHA 2R4JA 1E1NA 3UKQA 5JCLA 3AYJA 1CC4A 1FCDA 4Z24A 2C76A 1TDKA 2F5ZA 2FJEA 1QO8A 3AE4A 2R0PA 2BK5A 3URHA 3OC4A 1RP0A 5KVHA 2BXSA 3AEGA 3VRAA 1Q1WA 1NG4A 1B8SA 4DSHA 2WDRA 2JB2A 2H89A 1NENA 5JCKA 2YR4A 4YTNA 1JRZA 2FJAA 1L0VA 3FMWA 4UP3A 5KOWA 2BK3A 4UDRA 3AE3A 1NPXA 1L9CA 2B7RA 4EMIA 1F8WA 2GQWA 5ER0A 4CY8A 4ECHA 2YQUA 2RGOA 4RSLA 3NYCA 4OVIA 2ZZBA 3QFAA 4H4XA 1IUVA 2R4EA 1MXTA 2BS4A 4U8LA 1E1KA 4U8JA 4JNAA 4E0VA 4BK2A 2Z5XA 1ZMCA 1CL0A 4J2WA 3BI4A 1DJNA 2WP6A 3P1WA 2X50A 1L9EA 1PBDA 4JN9A 1EL8A 3VRBA 4REKA 2E1MA 4RG3A 1F8RA 1GRFA 4NWZA 1TYTA 2Y6RA 2E5VA 4USRA 1CJCA 3SZCA 1H81A 4TM0A 3C96A 3AD8B 3ICRA 2GEWA 3CGBA 3NYFA 1NG3A 3AE2A 2OLOA 3GDNA 3GYXA 1MO9A 2GB0A 2C64A 3AE8A 3NK2X 2WQYA 2V5ZA 3KKJA 1FL2A 4YKFA 3K7MX 1ZP0A 2NVKX 1S2QA 3AEFA 1E6EA 4GAPA 4U8KA 2BA9A 4IA6A 4NTEA 3NKSA 3P4RA 1MOKA 3CNSA 2X8GA 2C70A 5HYMA 5KOXA 2WEUA 4A5LA 1B4VA 3V3NA 1NEKA 5CKUA 4C3XA 1NAAA 3DJEA 2VRLA 3PS9A 3QSSA 1M64A 4A99A 1D4DA 4EQRA 4OPTA 2BXRA 3G5SA 2C65A 3KLJA 4EM3A 1O95A 4GCMA 1GTEA 2GR3A 3SM8A 1O94A 3LADA 3CIRA 4X4JA 4CNJA 3RP8A 3NTDA 4A6NB 1E39A 4DGKA 3HYWA 2XFNA 2XLUA 3ICSA 1K0LA 3NGCX 1LPFA 2YG6A 2EQ9A 1ZDLA 1DJQA 1GV4A 4C74A 3M0OA 3NH3X 1IUWA 4ZCCA 1Z6LA 4H2PA 2OAMA 4ICYA 3UP4A 2Q6UA 3PG6A 3LXDA 2V6OA 1E7PA 4NEVA 1KNRA 1EL9A 1ZKQA 1Q1RA 3GRSA 2XLPA 1JNZA 3AXBA 3AD9B 1GOSA 3QSEA 2YVGA 2B9XA 3ATQA 3VR8A 4A79A 5KRQA 5M0ZA 3SYIA 3DJGX 1DOBA 2YM1A 3L8KA 4K8DA 1F8SA 2WDVA 2XDOA 1N1PA 4II2A 1JEHA 2BRAA 3V76A 1RYIA 1O5WA 1ZOYA 1H84A 2DKIA 2XCGA 4JNQA 4UDQA 2FJBA 3ATRA 1OJAA 3B6DA 2WOIA 1SEZA 2XLRA 3LZXA 3SQPA 1Y56A 3PVCA 2EQ6A 3SZFA 2ZBWA 3BNUA 1IUTA 1YKJA 3DJDA 5BRTA 1IUXA 1GALA 2V60A 4YTMA 3NN0X 5C2TA 3VRDB 4GDPA 3ZYXA 1GRBA 2GMHA 3LJPA 3EF6A 4C77A 2NPXA 1QJDA 3UKFA 3NIXA 3ICTA 3DGZA 1ZY8A 2QA1A 4AT0A 2ACZA 5C3JA 2XVFA 2E4GA 4NNJA 1GT8A 2GAHB 3IHGA 1H7XA 2VVLG 3H8IA 2VVMA 4NZHA 2XFUA 1DNCA 1PBFA 4Z2TA 1PJ7A 3DK4A 2IVEA 1GNDA 3AEAA 3UTHA 2C7GA 3NLCA 3F8PA 3QVRA 1H86A 4B67A 4DSGA 4H4RA 4IVMB 5EBKA 3UCLA 1BF3A 4CNKA 4CRTA 2QA2A 2BS2A 1XANA 1GETA 5BVAA 3CN8A 1IJHA 4H7UA 3CNPA 3E1TA 1H2IA 4XWZA 3AE6A 3H4KA 2AQJA 3S5WA 4XXGA 3LB8A 3L1RA 3NYEA 4ZN0A 1N4VA 3SFDA 2X8HA 5L46A 3L5OA 4H4TA 3ITJA 4BJYA 3UKLA 3UOYA 1ZK7A 4M52A 2B9YA 1PXAA 3IWAA 3T37A 2X3NA 3Q9TA 1VRQB 3AD7B 2WPFA 5KVIA 4Y4MA 2OALA 1PHHA 5IPYA 2EQ8A 3KPFA 3DA1A 2BACA 4U2TA 3EAOA 2JKCA 1Q9IA 3Q6JA 1F6MA 4X9NA 5IQ4A 4UDPA 4CCQA 3GSIA 2R0GA 2YLSA 3T2KA 3UOVA 3RNMA 2A87A 3ZDNA 3DH9A 1DOEA 4BK1A 3CGCA 2C67A 4EQXA 2HQMA 4JY2A 3BHKA 3AE1A 2WOWA 2GR0A 3QJ4A 3SZ0A 1CJ2A 4BV6A 2C72A 4YSHA 5DBJA 4H50A 2V3BA 4YXDA 3I6DA 4D04A 2B9WA 2UZZA 4AP3A 5KNLA 1CJ3A 1FOHA 3GDPA 1JOAA 2CULA 4TLXA 4A9WA 4B68A 2R9ZA 4H4UA 1OJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPI G;  4B1B A;  1NHQ A;  4OPC A;  5KXJ A;  3DK9 A;  3GYI A;  2WDQ A;  3H8L A;  3PO7 A;  4YT0 A;  4H4S A;  3D8X A;  4Y4N A;  3G5Q A;  2IID A;  5CQF A;  2WU5 A;  4ZCD A;  3BI2 A;  1FEA A;  2C66 A;  1GES A;  1PJ6 A;  2Z5Y A;  2GH5 A;  4OPU A;  4D03 A;  4B63 A;  3FIM B;  3FG2 P;  1XDI A;  1GRG A;  4JY3 A;  4TM4 A;  2GAG B;  1KNP A;  5FS7 A;  4XWR A;  1KFY A;  3LOV A;  3ADA B;  1HYU A;  3FPZ A;  4PAA A;  1TDE A;  2R45 A;  2YG3 A;  3CNJ A;  4I58 A;  4HB9 A;  2JBV A;  2YLW A;  5EOW A;  4CBQ A;  4ADW A;  4J36 A;  4Z44 A;  4FK1 A;  4LII A;  5EB5 A;  1RSG A;  5U1O A;  1K0J A;  4YKG A;  2TPR A;  1PDH A;  4LU6 A;  1QLB A;  2YAU A;  2QCU A;  3UP5 A;  2W0H A;  4RG4 A;  1CHU A;  2OLN A;  1BGN A;  1CJ4 A;  4NTC A;  1PN0 A;  3F8D A;  3WE0 A;  4J57 A;  2WES A;  3VQR A;  4BK3 A;  3NK1 X;  1GRH A;  1OJC A;  4WX1 A;  2IVD A;  1K0I A;  4U8I A;  4K5S A;  4H4Z A;  1TYP A;  4YWO A;  3P4Q A;  3JSK A;  1LQU A;  1GRE A;  4PAB A;  1VQW A;  3LZW A;  4H2Q A;  4TM3 A;  1E1M A;  4EIQ A;  1JU2 A;  4EMJ A;  4H2R A;  2BCG G;  3GWF A;  1N4U A;  4FK1 C;  1LV0 A;  2RAB A;  1W4X A;  2XYO A;  2Y6Q A;  3K7T A;  4WCT A;  4OPG A;  4U2S A;  4TLZ A;  3QVP A;  4USQ A;  3CGD A;  3D1C A;  1D7L A;  3RP7 A;  3NTA A;  5TR3 A;  2BCP A;  2YWL A;  4GUV A;  2AAQ A;  1COY A;  3AB1 A;  2XVH A;  4C3Y A;  3GRT A;  2C75 A;  2CVJ A;  4YTP A;  1TDO A;  4K22 A;  4Y4L A;  2RGH A;  2APG A;  4YSX A;  2WOV A;  3UKA A;  3QSM A;  4BJZ A;  1N4W A;  1FEB A;  5JCM A;  1DXL A;  2YR6 A;  2XFO A;  1KSU A;  3F8R A;  1H82 A;  2ZZC A;  3BHF A;  1LQT A;  2XLS A;  3NK0 X;  4HA6 A;  1H6V A;  1D4E A;  1TRB A;  1YQ4 A;  2FBW A;  4J34 A;  1VG9 A;  3UOZ A;  3DGH A;  1NHS A;  2YLR A;  3UKH A;  3UTF A;  3EAN A;  1GXF A;  1EL5 A;  1TDF A;  1D7Y A;  1BGJ A;  1PXC A;  2B7S A;  2FJD A;  1LVL A;  1EL7 A;  2GMJ A;  4H4P A;  3AED A;  3M13 A;  3O0H A;  4O5Q A;  2O9Z A;  3AE5 A;  3V3O A;  3KVE A;  5HXI A;  1XHC A;  1F3P A;  4FX9 A;  3RED A;  1ZX9 A;  1GEU A;  1E1L A;  4APN A;  1CBO A;  3C4A A;  2XFP A;  3ABV A;  5LV9 A;  5FS8 A;  2YLX A;  3B3R A;  5EB4 A;  3UKK A;  1L9D A;  4GF7 A;  1GPE A;  2JB3 A;  1Y56 B;  4EMW A;  3II4 A;  2I0Z A;  2YG7 A;  2BS3 A;  3IC9 A;  2ARD A;  4AT2 A;  2WET A;  3KD9 A;  2X8C A;  4C5O A;  4CCR A;  2BC1 A;  5FS9 A;  2TMD A;  1GSN A;  3NG7 X;  1DOC A;  1ZOV A;  1H83 A;  2YVF A;  4H4V A;  2Q0L A;  2CFY A;  3COX A;  3KU9 A;  2WHD A;  4TM1 A;  4H4Y A;  4LA1 A;  1PBC A;  4CY6 A;  3GD4 A;  4EQS A;  4MJW A;  2XVE A;  3AEC A;  2GRT A;  3C4N A;  4OPI A;  2GR1 A;  3ALL A;  2Q7V A;  2OA1 A;  5HY5 A;  4H2N A;  1CC6 A;  2C3D A;  1UKV G;  4I59 A;  2C3C A;  3NT6 A;  4B66 A;  1CF3 A;  3CPH G;  4B65 A;  4BUR A;  1PS9 A;  2WU2 A;  3CTY A;  4Z43 A;  3AEE A;  4JDR A;  2R46 A;  1S3E A;  2YM2 A;  2JAE A;  3UTG A;  4J56 A;  3ALJ A;  4GR1 A;  1BKW A;  2BYB A;  4KX6 A;  4AP1 A;  4A6N A;  3CGE A;  1CC2 A;  3DK8 A;  2GR2 A;  4EIP A;  4JQ9 A;  5U25 A;  1ELI A;  5M10 A;  3BI5 A;  3DME A;  4IVO B;  1KDG A;  2H88 A;  1S2Y A;  4P9S A;  2BAB A;  2YLZ A;  4AOX A;  4YSZ A;  2YG4 A;  2XLT A;  3ALM A;  4IA5 A;  3UTE A;  3NN6 X;  1K4Q A;  3GD3 A;  4EQW A;  2YLT A;  3NNE A;  4U8N A;  4H4Q A;  3KA7 A;  2PYX A;  3AYL A;  5BUK A;  2GV8 A;  2JB1 A;  3R9U A;  3UKP A;  4Z26 A;  2V3A A;  3UOX A;  3EPT A;  5JCI A;  5BUL A;  1EBD A;  4Z25 A;  1LJ1 A;  3DJJ A;  1B37 A;  5HHF A;  5GSN A;  2EQ7 A;  3OZ2 A;  1GTH A;  1DOD A;  4J33 A;  5J7X A;  3SFE A;  3HZL A;  1YY5 A;  1GRT A;  3GWD A;  3NHO X;  1NHR A;  1REO A;  3M12 A;  1X31 B;  2GVC A;  3ISH A;  1S3B A;  4K7Z A;  2WPE A;  1NDA A;  2CDU A;  2X99 A;  1JRX A;  4X9M A;  4B64 A;  4U8M A;  1OJD A;  3VR9 A;  4A65 A;  5IQ1 A;  2J3N A;  2R0C A;  2WS3 A;  1PJ5 A;  2WPC A;  2XFQ A;  1D5T A;  2ZZ0 A;  1JNR A;  1VDC A;  2VRM A;  3AE7 A;  2GF3 A;  1GER A;  4Z2R A;  3RHA A;  3GYJ A;  2A89 A;  1V59 A;  1IUS A;  2VVL A;  1VG0 A;  4N9X A;  5U63 A;  1B5Q A;  3IF9 A;  4FDC B;  1ZMD A;  5FS6 A;  1KSS A;  1P2H A;  3AYI A;  3P9U A;  4U8P A;  1NHP A;  2WP9 A;  2VQB A;  2XVJ A;  4OPD A;  2AR8 A;  1H7W A;  3NRN A;  4GDE A;  4OCG A;  4K2X A;  2WBA A;  1XPQ A;  2RGJ A;  1PBE A;  3P4P A;  1PXB A;  2GQF A;  4NEW A;  2C73 A;  3K7Q X;  4OPL A;  2JK6 A;  1P2E A;  1KF6 A;  3AE9 A;  5JCN A;  2VQ7 A;  1IUU A;  3K30 A;  3CPJ G;  3BNM A;  2VOU A;  3FBS A;  1YQZ A;  4B69 A;  4U2L A;  3S61 A;  3GMC A;  1BWC A;  1AOG A;  1M6I A;  3GMB A;  3RP6 A;  4A7A A;  1ONF A;  3QFB A;  3P4S A;  1LTX R;  2Q0K A;  3SGL A;  2QAE A;  2VZ2 A;  1BZL A;  1PBB A;  1TDN A;  2V61 A;  4EM4 A;  3IHM A;  4NTD A;  4Z2U A;  4O5U A;  3I3L A;  4H4W A;  5KWF A;  3AEB A;  4IV9 A;  2BK4 A;  4K5R A;  2B76 A;  3G5R A;  5J60 A;  2BC0 A;  4DNA A;  2YVJ A;  1Y0P A;  1JRY A;  5FMH A;  2WP5 A;  4AOS A;  1FEC A;  4U8O A;  3CND A;  2DKH A;  5GRT A;  2XVI A;  1GRA A;  3AWI A;  1OJ9 A;  4KPR A;  4YSY A;  1YQ3 A;  2YG5 A;  1D4C A;  2YR5 A;  3CNT A;  4GRT A;  2A8X A;  4J31 A;  2PHH A;  2R4J A;  1E1N A;  3UKQ A;  5JCL A;  3AYJ A;  1CC4 A;  1FCD A;  4Z24 A;  2C76 A;  1TDK A;  2F5Z A;  2FJE A;  1QO8 A;  3AE4 A;  2R0P A;  2BK5 A;  3URH A;  3OC4 A;  1RP0 A;  5KVH A;  2BXS A;  3AEG A;  3VRA A;  1Q1W A;  1NG4 A;  1B8S A;  4DSH A;  2WDR A;  2JB2 A;  2H89 A;  1NEN A;  5JCK A;  2YR4 A;  4YTN A;  1JRZ A;  2FJA A;  1L0V A;  3FMW A;  4UP3 A;  5KOW A;  2BK3 A;  4UDR A;  3AE3 A;  1NPX A;  1L9C A;  2B7R A;  4EMI A;  1F8W A;  2GQW A;  5ER0 A;  4CY8 A;  4ECH A;  2YQU A;  2RGO A;  4RSL A;  3NYC A;  4OVI A;  2ZZB A;  3QFA A;  4H4X A;  1IUV A;  2R4E A;  1MXT A;  2BS4 A;  4U8L A;  1E1K A;  4U8J A;  4JNA A;  4E0V A;  4BK2 A;  2Z5X A;  1ZMC A;  1CL0 A;  4J2W A;  3BI4 A;  1DJN A;  2WP6 A;  3P1W A;  2X50 A;  1L9E A;  1PBD A;  4JN9 A;  1EL8 A;  3VRB A;  4REK A;  2E1M A;  4RG3 A;  1F8R A;  1GRF A;  1TYT A;  2Y6R A;  2E5V A;  4USR A;  1CJC A;  1H81 A;  4TM0 A;  3C96 A;  3AD8 B;  3ICR A;  2GEW A;  3CGB A;  3NYF A;  1NG3 A;  3AE2 A;  2OLO A;  3GDN A;  1MO9 A;  2GB0 A;  2C64 A;  3AE8 A;  3NK2 X;  2WQY A;  2V5Z A;  3KKJ A;  1FL2 A;  4YKF A;  3K7M X;  1ZP0 A;  2NVK X;  1S2Q A;  3AEF A;  1E6E A;  4U8K A;  2BA9 A;  4IA6 A;  4NTE A;  3NKS A;  3P4R A;  1MOK A;  3CNS A;  2X8G A;  2C70 A;  5HYM A;  5KOX A;  2WEU A;  4A5L A;  1B4V A;  3V3N A;  1NEK A;  5CKU A;  4C3X A;  1NAA A;  3DJE A;  2VRL A;  3PS9 A;  3QSS A;  1M64 A;  4A99 A;  1D4D A;  4EQR A;  4OPT A;  2BXR A;  3G5S A;  2C65 A;  3KLJ A;  4EM3 A;  1O95 A;  4GCM A;  1GTE A;  2GR3 A;  3SM8 A;  1O94 A;  3LAD A;  3CIR A;  4X4J A;  4CNJ A;  3RP8 A;  3NTD A;  4A6N B;  1E39 A;  4DGK A;  2XFN A;  2XLU A;  3ICS A;  1K0L A;  3NGC X;  1LPF A;  2YG6 A;  2EQ9 A;  1ZDL A;  1DJQ A;  1GV4 A;  4C74 A;  3M0O A;  3NH3 X;  1IUW A;  4ZCC A;  1Z6L A;  4H2P A;  2OAM A;  4ICY A;  3UP4 A;  2Q6U A;  3LXD A;  2V6O A;  1E7P A;  4NEV A;  1KNR A;  1EL9 A;  1ZKQ A;  1Q1R A;  3GRS A;  2XLP A;  1JNZ A;  3AXB A;  3AD9 B;  1GOS A;  3QSE A;  2YVG A;  2B9X A;  3ATQ A;  3VR8 A;  4A79 A;  5KRQ A;  5M0Z A;  3DJG X;  1DOB A;  2YM1 A;  3L8K A;  4K8D A;  1F8S A;  2WDV A;  2XDO A;  1N1P A;  1JEH A;  3V76 A;  1RYI A;  1O5W A;  1ZOY A;  1H84 A;  2DKI A;  2XCG A;  4JNQ A;  4UDQ A;  2FJB A;  3ATR A;  1OJA A;  3B6D A;  2WOI A;  1SEZ A;  2XLR A;  3LZX A;  3SQP A;  1Y56 A;  3PVC A;  2EQ6 A;  2ZBW A;  3BNU A;  1IUT A;  1YKJ A;  3DJD A;  5BRT A;  1IUX A;  1GAL A;  2V60 A;  4YTM A;  3NN0 X;  5C2T A;  3VRD B;  4GDP A;  3ZYX A;  1GRB A;  2GMH A;  3LJP A;  3EF6 A;  4C77 A;  2NPX A;  1QJD A;  3UKF A;  3NIX A;  3ICT A;  3DGZ A;  1ZY8 A;  2QA1 A;  4AT0 A;  2ACZ A;  5C3J A;  2XVF A;  2E4G A;  1GT8 A;  2GAH B;  3IHG A;  1H7X A;  2VVL G;  3H8I A;  2VVM A;  4NZH A;  2XFU A;  1DNC A;  1PBF A;  4Z2T A;  1PJ7 A;  3DK4 A;  2IVE A;  1GND A;  3AEA A;  3UTH A;  2C7G A;  3NLC A;  3F8P A;  3QVR A;  1H86 A;  4B67 A;  4DSG A;  4H4R A;  4IVM B;  5EBK A;  3UCL A;  1BF3 A;  4CNK A;  4CRT A;  2QA2 A;  2BS2 A;  1XAN A;  1GET A;  5BVA A;  3CN8 A;  1IJH A;  4H7U A;  3CNP A;  3E1T A;  4XWZ A;  3AE6 A;  3H4K A;  2AQJ A;  3S5W A;  4XXG A;  3LB8 A;  3L1R A;  3NYE A;  4ZN0 A;  1N4V A;  3SFD A;  2X8H A;  5L46 A;  4H4T A;  3ITJ A;  4BJY A;  3UKL A;  3UOY A;  1ZK7 A;  4M52 A;  2B9Y A;  1PXA A;  3IWA A;  3T37 A;  2X3N A;  3Q9T A;  1VRQ B;  3AD7 B;  2WPF A;  5KVI A;  4Y4M A;  2OAL A;  1PHH A;  5IPY A;  2EQ8 A;  3KPF A;  3DA1 A;  2BAC A;  4U2T A;  3EAO A;  2JKC A;  1Q9I A;  3Q6J A;  1F6M A;  4X9N A;  5IQ4 A;  4UDP A;  4CCQ A;  3GSI A;  2R0G A;  2YLS A;  3UOV A;  3ZDN A;  3RNM A;  2A87 A;  3DH9 A;  1DOE A;  4BK1 A;  3CGC A;  2C67 A;  4EQX A;  2HQM A;  4JY2 A;  3BHK A;  3AE1 A;  2WOW A;  2GR0 A;  3QJ4 A;  1CJ2 A;  4BV6 A;  2C72 A;  4YSH A;  5DBJ A;  4H50 A;  2V3B A;  4YXD A;  3I6D A;  4D04 A;  2B9W A;  2UZZ A;  4AP3 A;  1CJ3 A;  1FOH A;  3GDP A;  1JOA A;  2CUL A;  4TLX A;  4A9W A;  4B68 A;  2R9Z A;  4H4U A;  1OJT A; 
#chains in the Genus database with same CATH topology
 1NHQ A;  5KXJ A;  4HCL A;  4H4S A;  3D8X A;  2IID A;  1FEA A;  3D46 A;  4TM4 A;  1KNP A;  3DEQ A;  3ADA B;  1HYU A;  3H7V A;  2YG3 A;  2JBV A;  2YLW A;  2GGG A;  4ADW A;  3P3B A;  5KMQ A;  3RRA A;  3UJE A;  5EB5 A;  1PDZ A;  1PDH A;  4LU6 A;  1EC8 A;  1QLB A;  1WUE A;  3FXG A;  2W0H A;  1CHU A;  3F8D A;  4H2H A;  4BK3 A;  3T2Y A;  4MGG A;  1K0I A;  4H4Z A;  4YWO A;  4IL2 A;  1LQU A;  2PU1 A;  3IJI A;  2BCG G;  4DX3 A;  4H2R A;  1N4U A;  4IL0 A;  4GUV A;  1COY A;  3BOX A;  1MNS A;  4YWS A;  1XPY A;  3B97 A;  4Y4L A;  2RGH A;  4YSX A;  4BJZ A;  1KSU A;  4HA6 A;  4J34 A;  2XH0 A;  1SJA A;  3UTF A;  1GXF A;  1PXC A;  3DFY A;  4O5Q A;  3MSY A;  4A35 A;  1XHC A;  1F3P A;  1ZX9 A;  1CBO A;  4K2S A;  3UKK A;  1L9D A;  4EWJ A;  2JB3 A;  4EMW A;  3II4 A;  3PK7 A;  2BS3 A;  3R10 A;  4K8G A;  4CCR A;  1GSN A;  3NG7 X;  4H4V A;  2CFY A;  3KU9 A;  4TM1 A;  3GD4 A;  4EQS A;  3QKE A;  3ES7 A;  2GRT A;  4TVY A;  2XVE A;  3DG7 A;  3HYX A;  2C3D A;  4I59 A;  3R0U A;  3P93 A;  1CF3 A;  3CPH G;  1PS9 A;  2WU2 A;  3CTY A;  3CK5 A;  3AEE A;  1MUC A;  2R46 A;  3CXB A;  3CGE A;  3TJI A;  4JQ9 A;  1ELI A;  2GDQ A;  3QN3 A;  3DIP A;  4FI4 A;  4EQW A;  2YLT A;  3NNE A;  3K1G A;  5BUK A;  2V3A A;  3EPT A;  4E4U A;  4IZG A;  3SFE A;  3HZL A;  3SX6 A;  2GL5 A;  3FJ4 A;  2GVC A;  3SXI A;  1S3B A;  4GAV A;  5KMR A;  2CDU A;  1JRX A;  3T4W A;  1EC7 A;  3H12 A;  1D5T A;  1V97 A;  3ZVH A;  1GER A;  2W3R A;  1IUS A;  2VVL A;  1VG0 A;  4U8P A;  3IF9 A;  3AYI A;  1ZMD A;  1NHP A;  2VQB A;  4GME A;  2XVJ A;  4OPD A;  2P8C A;  3KPK A;  3AE9 A;  5JCN A;  2VOU A;  3S61 A;  4G7F A;  3GMC A;  4G74 A;  1BWC A;  1AOG A;  1X2H A;  3QFB A;  3OZM A;  5G5H B;  2Q0K A;  1TDN A;  3IHM A;  4NTD A;  3T6C A;  5KWF A;  4K5R A;  4IV9 A;  2XVI A;  4G73 A;  3GD6 A;  3AWI A;  4KPR A;  1N62 C;  1YQ3 A;  3CNT A;  1E1N A;  4KPL A;  5ENL A;  2R0P A;  5KVH A;  3AEG A;  1R0M A;  1FO4 A;  1Q1W A;  2WDR A;  2JB2 A;  2H89 A;  5KOW A;  2BK3 A;  2GQW A;  5ER0 A;  4CY8 A;  2GGJ A;  2RGO A;  3SJN A;  2XH7 A;  4H4X A;  2PTZ A;  4J3Z A;  3BI4 A;  1DJN A;  1YEY A;  2X50 A;  1L9E A;  4RG3 A;  4NWZ A;  1MDL A;  3SZC A;  3AD8 B;  2GEW A;  2OX4 A;  3GDN A;  3SSZ A;  3N6H A;  3AE8 A;  3NK2 X;  2V5Z A;  4YKF A;  1ZP0 A;  2NVK X;  2MNR A;  4GAP A;  2BA9 A;  3R25 A;  2X8G A;  2OZ8 A;  3DJE A;  2W3S A;  3QSS A;  4A99 A;  3LAD A;  4X4J A;  4CNJ A;  3NVV B;  2XFN A;  4FP1 A;  3ICS A;  2YG6 A;  3DG6 A;  4C74 A;  1IUW A;  1Z6L A;  3ETR B;  2Q6U A;  2V6O A;  1KNR A;  1E7P A;  3QSE A;  1JNZ A;  3NRZ B;  3N4F A;  2B9X A;  3ATQ A;  3VR8 A;  3DJG X;  3CAW A;  2XDO A;  3NVW B;  3THU A;  1ZOY A;  2OG9 A;  2XCG A;  4UDQ A;  1OJA A;  1Y56 A;  1F9C A;  2EQ6 A;  5BRT A;  4YTM A;  3VRD B;  2GMH A;  3LJP A;  3EF6 A;  2NPX A;  3ZVH B;  2OZ3 A;  4AT0 A;  1GT8 A;  3IHG A;  3DK4 A;  1GND A;  1SJD A;  3NLC A;  4H4R A;  4IVM B;  4HCH A;  4CRT A;  2BS2 A;  4H83 A;  4DWD A;  1P43 A;  1H2I A;  2AQJ A;  3B9J B;  4H4T A;  3ITJ A;  1ZK7 A;  2B9Y A;  2X3N A;  4GGH A;  4JN8 A;  3Q9T A;  5G5G B;  4U2T A;  3EAO A;  1F6M A;  4UDP A;  2HZG A;  2R0G A;  1IYX A;  4BK1 A;  3CYJ A;  4YSH A;  5DBJ A;  2V3B A;  3GO2 A;  3H70 A;  5KNL A;  1CJ3 A;  1FOH A;  4B68 A;  4B1B A;  3V5C A;  1JRO A;  4ZCD A;  2FYM A;  1GES A;  2Z5Y A;  4OPU A;  1GRG A;  2GAG B;  3ENL A;  4XWR A;  3LOV A;  3I4K A;  4HB9 A;  4IP4 A;  4J36 A;  4Z44 A;  4FK1 A;  1RSG A;  2TPR A;  2OLN A;  1BGN A;  4NTC A;  3WE0 A;  3NK1 X;  3P4Q A;  3Q45 A;  1GRE A;  3MWC A;  1VQW A;  3LZW A;  4TM3 A;  1E1M A;  4EMJ A;  3FV9 A;  3I6E A;  2Y6Q A;  1S7M A;  3AN1 A;  3K7T A;  1D7L A;  3MQT A;  3VDG A;  2AAQ A;  4C3Y A;  2HXT A;  2C75 A;  3RIT A;  1N4W A;  1FEB A;  2AKM A;  3VFC A;  2PP0 A;  5BOE A;  3F8R A;  1H82 A;  2ZZC A;  3BHF A;  3NK0 X;  2XLS A;  1H6V A;  1YQ4 A;  3VCN A;  2RDX A;  3TW9 A;  1ONE A;  2B7S A;  1D7Y A;  2PU0 A;  2FJD A;  4ZCW A;  3AED A;  4H4P A;  4HCD A;  1PDY A;  1VDV A;  1E1L A;  3C4A A;  2XFP A;  1TKK A;  5FS8 A;  3B3R A;  1Y56 B;  5JRB A;  3STP A;  2WET A;  2PTX A;  1RM6 B;  2TMD A;  4G6H A;  1ZOV A;  1H83 A;  2YVF A;  3COX A;  4LA1 A;  1PBC A;  3T0K A;  4OPI A;  2GR1 A;  2Q7V A;  1CC6 A;  3NT6 A;  4Z17 A;  4JDR A;  2YM2 A;  3NVY B;  4GR1 A;  2XGZ A;  4AP1 A;  4A6N A;  5U25 A;  3DME A;  4P9S A;  2BAB A;  4YSZ A;  2XLT A;  1K4Q A;  3GD3 A;  2OVL A;  4H4Q A;  3CMM A;  3AYL A;  3P0W A;  4Z26 A;  3UKP A;  3CT2 A;  5JCI A;  1EBD A;  3ZLF A;  5HHF A;  5GSN A;  3V3W A;  2PPG A;  5J7X A;  3HPF A;  3NHO X;  2OPJ A;  1REO A;  1X31 B;  3R07 C;  4J1O A;  4U8M A;  4A65 A;  3SZW A;  5IQ1 A;  2J3N A;  2R0C A;  2WPC A;  2POD A;  2VRM A;  2GF3 A;  4Z2R A;  3DER A;  4FDC B;  1P2H A;  1H7W A;  3NRN A;  2WBA A;  4GFI A;  1XPQ A;  2RGJ A;  1SJC A;  2AKZ A;  2GQF A;  2C73 A;  2JK6 A;  2HNE A;  3RP6 A;  4H19 A;  2VZ2 A;  4EM4 A;  3I3L A;  3VC6 A;  4H4W A;  2OZT A;  1ELS A;  4DNA A;  4HPN A;  5FJT A;  3DGB A;  1OJ9 A;  3NFU A;  4YSY A;  2PHH A;  2R4J A;  3UKQ A;  1CC4 A;  4Z24 A;  3NO1 A;  2BXS A;  4ENL A;  1NG4 A;  1B8S A;  2OKT A;  4YTN A;  2FJA A;  1NEL A;  3FMW A;  4UP3 A;  2W55 A;  4UDR A;  3AE3 A;  2B7R A;  3UCC A;  1F8W A;  3SN0 A;  3NYC A;  4OVI A;  2ZZB A;  1MXT A;  4U8J A;  2Z5X A;  2WP6 A;  1EL8 A;  4REK A;  2E1M A;  2AL2 A;  3A7U A;  2E5V A;  1CJC A;  3V4B A;  4TM0 A;  3C96 A;  3CGB A;  3NYF A;  3AE2 A;  2OLO A;  1X2G A;  2GB0 A;  2C64 A;  5KOX A;  2WEU A;  3V3N A;  1NEK A;  5CKU A;  1BQG A;  4EQR A;  2C65 A;  4GCM A;  3AMZ A;  3RP8 A;  4A6N B;  1E39 A;  1ZXI C;  3HYW A;  1WYG A;  1K0L A;  3N6J A;  2HXU A;  1ZDL A;  2ZAD A;  1WUF A;  2OAM A;  4ICY A;  2QJN A;  1EBH A;  1ZKQ A;  1Q1R A;  1L8P A;  3AD9 B;  5KRQ A;  3SYI A;  1F8S A;  3DG3 A;  4II2 A;  2GGH A;  3V76 A;  1RYI A;  2P88 A;  3SN4 A;  1H84 A;  2WOI A;  2XLR A;  3IK4 A;  3SQP A;  3PVC A;  3SZF A;  1STZ A;  3BNU A;  4A3R A;  3DJD A;  1YKJ A;  2PGE A;  2E3T A;  1GRB A;  1QJD A;  4GIR A;  3QTP A;  3UKF A;  2OFJ A;  2E4G A;  2OLA A;  4NZH A;  2OQH A;  1E9I A;  3V5F A;  3AEA A;  2C7G A;  3S47 A;  1H86 A;  4B67 A;  5EBK A;  3ZVI A;  1XAN A;  1GET A;  4GYP C;  3CN8 A;  1IJH A;  4H7U A;  4XWZ A;  2E5A A;  3LB8 A;  3HRD C;  1N4V A;  4A6G A;  2X8H A;  5L46 A;  4K1W A;  3L5O A;  4BJY A;  4ROP A;  4M52 A;  3IWA A;  3T37 A;  2FKP A;  1N60 C;  3GY1 A;  1N5X A;  2JKC A;  3Q6J A;  4KWS A;  4X9N A;  5IQ4 A;  3GSI A;  3ZDN A;  3RNM A;  2A87 A;  1DOE A;  1BKH A;  5FJU A;  4JY2 A;  3BHK A;  3AE1 A;  4BV6 A;  2C72 A;  4H50 A;  3MKC A;  3I6D A;  1JOA A;  2CUL A;  4A9W A;  1KKO A;  4H4U A;  1OJT A;  4OPC A;  3DK9 A;  3NXL A;  3PO7 A;  4YT0 A;  3G5Q A;  5CQF A;  3BI2 A;  1KCZ A;  4D03 A;  4B63 A;  3FG2 P;  1XDI A;  4JY3 A;  3ES8 A;  5FS7 A;  1KFY A;  2BRY A;  2R45 A;  2AL2 B;  3UGV A;  4LII A;  1K0J A;  4YKG A;  2QCU A;  3R1Z A;  3UP5 A;  3T31 A;  1CJ4 A;  1PN0 A;  2WES A;  3VQR A;  4WX1 A;  2IVD A;  4K5S A;  1TYP A;  4PAB A;  1JU2 A;  4M6U A;  4FK1 C;  1LV0 A;  1DTN A;  4GGB A;  4U2S A;  3CGD A;  3D1C A;  3EEZ A;  5TR3 A;  2BCP A;  2PMQ A;  3GRT A;  2CVJ A;  4YTP A;  1TDO A;  4K22 A;  3UKA A;  3QSM A;  2XFO A;  1LQT A;  1D4E A;  1VG9 A;  3MUC A;  3DGH A;  2YLR A;  4JHM A;  3EAN A;  1EL5 A;  3OZ2 A;  4X2P A;  1EL7 A;  2GMJ A;  3M13 A;  3O0H A;  2O9Z A;  2QGY A;  3KVE A;  3RED A;  3T2Z A;  1GEU A;  4APN A;  2GSH A;  3ABV A;  2YLX A;  3U4F A;  5EB4 A;  3EKG A;  4GF7 A;  1FIQ B;  2I0Z A;  2YG7 A;  1NU5 A;  3IC9 A;  3TOY A;  4AT2 A;  3KD9 A;  2XSX A;  2X8C A;  3OPS A;  4G9K A;  2OQY A;  2Q0L A;  2POZ A;  4Z1Y A;  3AEC A;  3C4N A;  3ALL A;  2OA1 A;  4DYE A;  4H2N A;  1UKV G;  2C3C A;  4B66 A;  4BUR A;  3ALJ A;  1BKW A;  3UXK A;  2PTY A;  2GR2 A;  4EIP A;  7ENL A;  5M10 A;  4KEM A;  3BI5 A;  1SB3 B;  1KDG A;  2H88 A;  1S2Y A;  2GGE A;  3ALM A;  4IA5 A;  3UTE A;  3RR1 A;  4U8N A;  2OO6 A;  1JRP A;  2GV8 A;  3UOX A;  5BOF A;  3MZN A;  5BUL A;  1B37 A;  1GTH A;  2C4C A;  1DOD A;  4J33 A;  4DN1 A;  3UCD A;  1NHR A;  3M12 A;  3ISH A;  4K7Z A;  2X99 A;  4B64 A;  1OJD A;  3VR9 A;  4ZOH B;  4KT2 A;  2XFQ A;  1JNR A;  3AE7 A;  3TWB A;  2P8B A;  1V59 A;  5U63 A;  1B5Q A;  3P9U A;  2WP9 A;  2AR8 A;  4OCG A;  4K2X A;  3T9P A;  1PBE A;  1P48 A;  3K7Q X;  4OPL A;  1KF6 A;  2VQ7 A;  3K30 A;  3TTE A;  3BNM A;  3CPJ G;  3CXO A;  1YQZ A;  4U2L A;  5KMP A;  4A7A A;  3SGL A;  2QAE A;  3BSM A;  1PBB A;  5FJP A;  2BK4 A;  5J60 A;  2ZC8 A;  3TJ4 A;  5J04 A;  2AL1 A;  1Y0P A;  1JRY A;  1FEC A;  4U8O A;  3CND A;  3PWG A;  6ENL A;  2YG5 A;  4J31 A;  2A8X A;  5JCL A;  2FJE A;  1QO8 A;  2P3Z A;  2PP3 A;  3URH A;  3OC4 A;  1RP0 A;  3IJQ A;  4DSH A;  5JCK A;  2YR4 A;  1L0V A;  3PWI A;  1L9C A;  3T8Q A;  4G8T A;  4ECH A;  4HNL A;  2R4E A;  3FYY A;  3EUB 3;  2BS4 A;  4U8L A;  4JNA A;  4BK2 A;  1ZMC A;  1CL0 A;  4J2W A;  1F8R A;  4USR A;  3NVZ B;  4IT1 A;  2PTW A;  1NG3 A;  2P0I A;  1SJB A;  4HNC A;  2WQY A;  3KKJ A;  3VA8 A;  4NTE A;  1MOK A;  2C70 A;  5HYM A;  1RVK A;  4C3X A;  1NAA A;  1M64 A;  1N5W C;  3QPE A;  1GTE A;  2GR3 A;  3S5S A;  3RGT A;  1LPF A;  4JN7 A;  2EQ9 A;  1DJQ A;  3NH3 X;  4ZCC A;  1ECQ A;  3PG6 A;  3LXD A;  3SR6 B;  3GRS A;  2XLP A;  3AXB A;  1GOS A;  2YVG A;  2YM1 A;  4K8D A;  2WDV A;  2BRA A;  4JNQ A;  2FJB A;  3ATR A;  3B6D A;  1SEZ A;  3LZX A;  2ZBW A;  2I5Q A;  2V60 A;  1GAL A;  4GDP A;  3ZYX A;  3CB3 A;  3OTR A;  3NIX A;  3ICT A;  3DGZ A;  2XVF A;  4NNJ A;  3OP2 A;  2XFU A;  1PJ7 A;  3UTH A;  2MUC A;  3QVR A;  4DSG A;  1EBG A;  2QA2 A;  3KUM A;  5BVA A;  3AE6 A;  3H4K A;  3S5W A;  4XXG A;  3L1R A;  1TE6 A;  4MMW A;  3UJF A;  2ONE A;  3UKL A;  3UOY A;  1PXA A;  5KVI A;  4Y4M A;  2OAL A;  1PHH A;  2EQ8 A;  3DA1 A;  1Q9I A;  2GGI A;  3R0K A;  3CGC A;  2C67 A;  2HQM A;  2GR0 A;  1CJ2 A;  2PS2 A;  4D04 A;  2B9W A;  2UZZ A;  4AP3 A;  1XS2 A;  2R9Z A;  4M0X A;  3CPI G;  4TVW A;  5KMS A;  3GYI A;  2WDQ A;  3H8L A;  3PFR A;  4Y4N A;  3SN1 A;  2WU5 A;  2C66 A;  3NS1 B;  1PJ6 A;  2GH5 A;  3FIM B;  3FPZ A;  3TQP A;  1TDE A;  4I58 A;  3CNJ A;  4PAA A;  5EOW A;  2XH2 A;  4CBQ A;  3SBF A;  3DDM A;  3OZY A;  5U1O A;  2YAU A;  4RG4 A;  2QJJ A;  3I6T A;  4J57 A;  1GRH A;  1OJC A;  4U8I A;  2XH4 A;  3JSK A;  4H2Q A;  4EIQ A;  3GWF A;  2RAB A;  1W4X A;  2XYO A;  4WCT A;  4OPG A;  3RCY A;  4TLZ A;  3QVP A;  4USQ A;  3RP7 A;  3NTA A;  2YWL A;  5FJR A;  3SY4 A;  3AB1 A;  2XVH A;  2PGW A;  2APG A;  2WOV A;  5JCM A;  2YR6 A;  1DXL A;  2O56 A;  1TRB A;  2FBW A;  3UOZ A;  1NHS A;  3UKH A;  2PA6 A;  1TDF A;  1BGJ A;  1LVL A;  3HW2 A;  3VCC A;  3V3O A;  3AE5 A;  4HN8 A;  5HXI A;  2PCE A;  4H1Z A;  3GC2 A;  4FX9 A;  5LV9 A;  3RO6 A;  4E4F A;  1GPE A;  3TWA A;  4E8G A;  1FHV A;  2ARD A;  4C5O A;  2BC1 A;  5FS9 A;  1JPM A;  1DOC A;  2WHD A;  4H4Y A;  4CY6 A;  4MJW A;  5HY5 A;  3T14 A;  4B65 A;  4Z43 A;  1KKR A;  1S3E A;  2JAE A;  3UTG A;  4J56 A;  2BYB A;  4KX6 A;  1CC2 A;  3DK8 A;  4E5T A;  3UXL A;  4IVO B;  2YLZ A;  4AOX A;  2YG4 A;  4G6G A;  3NN6 X;  3KA7 A;  2PYX A;  2JB1 A;  3R9U A;  4Z25 A;  1LJ1 A;  3DJJ A;  2EQ7 A;  1T3Q C;  1YY5 A;  1GRT A;  3GWD A;  1FFU C;  2WPE A;  1NDA A;  4X9M A;  2WS3 A;  3UJ2 A;  1PJ5 A;  2ZZ0 A;  3ZLH A;  1FHU A;  1VDC A;  3D9X A;  3RHA A;  3GYJ A;  2A89 A;  4N9X A;  2PP1 A;  5FS6 A;  1KSS A;  4GDE A;  3P4P A;  3A7R A;  1PXB A;  4NEW A;  2QDE A;  1P2E A;  1IUU A;  3HYV A;  3FBS A;  1FFV C;  4B69 A;  1M6I A;  3GMB A;  1ONF A;  3P4S A;  1LTX R;  1BZL A;  2V61 A;  4Z2U A;  4O5U A;  1KN0 A;  3AEB A;  2NQL A;  4II3 A;  2B76 A;  3G5R A;  2BC0 A;  4GYP A;  2YVJ A;  1TZZ A;  5FMH A;  2WP5 A;  4AOS A;  4IP5 A;  2DKH A;  5GRT A;  1GRA A;  1D4C A;  2YR5 A;  4GRT A;  1EC9 A;  3AYJ A;  1FCD A;  2DW6 A;  2C76 A;  1TDK A;  2F5Z A;  1N63 C;  5EU9 A;  3AE4 A;  2BK5 A;  4GIS A;  1JDF A;  3VRA A;  3A7A A;  1NEN A;  1JRZ A;  4HYR A;  1NPX A;  4EMI A;  2YQU A;  4RSL A;  4F4R A;  1VQZ A;  3QFA A;  1IUV A;  2CHR A;  1E1K A;  2QVH A;  3P1W A;  4JN9 A;  1PBD A;  3VRB A;  1GRF A;  3FVD A;  1KD0 A;  1TYT A;  2Y6R A;  1JCT A;  4ZA0 A;  1H81 A;  3ICR A;  4IHC A;  3GYX A;  1MO9 A;  2QDD A;  3R11 A;  3BJS A;  3D47 A;  1FL2 A;  3K7M X;  2QJM A;  1S2Q A;  3AEF A;  1E6E A;  4U8K A;  4IA6 A;  3NKS A;  3P4R A;  3CNS A;  4A5L A;  1B4V A;  3IJL A;  2VRL A;  3PS9 A;  1MRA A;  5FJO A;  1D4D A;  4OPT A;  2BXR A;  3G5S A;  3KLJ A;  4EM3 A;  1O95 A;  3SM8 A;  1O94 A;  3CIR A;  4E6M A;  3NTD A;  4DGK A;  2XLU A;  3U9I A;  3NGC X;  1GV4 A;  1W6T A;  3M0O A;  4H2P A;  2W54 A;  3UP4 A;  4E0V A;  4NEV A;  1EL9 A;  3VC5 A;  4A79 A;  5M0Z A;  1DOB A;  3L8K A;  1N1P A;  1JEH A;  1O5W A;  2DKI A;  5IDZ A;  1IUT A;  1IUX A;  1OEP A;  3SQS A;  3NN0 X;  3UJR A;  5C2T A;  4C77 A;  1ZY8 A;  2QA1 A;  2ACZ A;  5C3J A;  2GAH B;  1H7X A;  2DW7 A;  2VVL G;  3H8I A;  2VVM A;  1DNC A;  1PBF A;  4Z2T A;  4MKS A;  2IVE A;  3F8P A;  3OW1 A;  4DHG A;  3UCL A;  1BF3 A;  4CNK A;  3Q4D A;  3AM9 A;  3ZLG A;  3CNP A;  3E1T A;  3JW7 A;  3UJS A;  3JVA A;  3N4E A;  3NYE A;  4ZN0 A;  4DXK A;  3SFD A;  1JPD X;  3FCP A;  3H8A A;  3JZU A;  1VRQ B;  3AD7 B;  2WPF A;  2QQ6 A;  5IPY A;  3KPF A;  2BAC A;  4CCQ A;  3UOV A;  2YLS A;  3T2K A;  3DES A;  2PSN A;  3DH9 A;  3TCS A;  1N61 C;  4EQX A;  3DFH A;  2WOW A;  3QJ4 A;  3SZ0 A;  3QLD A;  4YXD A;  3NZG A;  3GDP A;  4TLX A;  1R6W A;  3MY9 A;  1MDR A; 
#chains in the Genus database with same CATH homology
 3CPI G;  4B1B A;  1NHQ A;  4OPC A;  5KMS A;  3DK9 A;  5KXJ A;  3GYI A;  2WDQ A;  3H8L A;  3PO7 A;  4YT0 A;  4H4S A;  3D8X A;  4Y4N A;  3G5Q A;  2IID A;  5CQF A;  2WU5 A;  4ZCD A;  3BI2 A;  1FEA A;  2C66 A;  1GES A;  1PJ6 A;  2Z5Y A;  2GH5 A;  4OPU A;  4D03 A;  4B63 A;  3FIM B;  3FG2 P;  1XDI A;  1GRG A;  4JY3 A;  4TM4 A;  2GAG B;  1KNP A;  5FS7 A;  4XWR A;  1KFY A;  3LOV A;  3ADA B;  1HYU A;  3FPZ A;  2BRY A;  1TDE A;  2R45 A;  2YG3 A;  3CNJ A;  4I58 A;  4HB9 A;  4PAA A;  2JBV A;  2YLW A;  5EOW A;  4CBQ A;  4ADW A;  4J36 A;  5KMQ A;  4Z44 A;  4FK1 A;  4LII A;  5EB5 A;  1RSG A;  5U1O A;  1K0J A;  4YKG A;  2TPR A;  1PDH A;  4LU6 A;  1QLB A;  2YAU A;  2QCU A;  3UP5 A;  2W0H A;  4RG4 A;  3T31 A;  1CHU A;  2OLN A;  1BGN A;  1CJ4 A;  4NTC A;  1PN0 A;  3F8D A;  3WE0 A;  4J57 A;  2WES A;  3VQR A;  4BK3 A;  3T2Y A;  3NK1 X;  1GRH A;  1OJC A;  4WX1 A;  2IVD A;  1K0I A;  4U8I A;  4K5S A;  4H4Z A;  1TYP A;  4YWO A;  3P4Q A;  3JSK A;  1LQU A;  1GRE A;  4PAB A;  1VQW A;  3LZW A;  4H2Q A;  4TM3 A;  1E1M A;  4EIQ A;  1JU2 A;  4EMJ A;  4H2R A;  2BCG G;  3GWF A;  1N4U A;  4FK1 C;  1LV0 A;  2RAB A;  1W4X A;  1S7M A;  2XYO A;  2Y6Q A;  3K7T A;  4WCT A;  4OPG A;  4U2S A;  4TLZ A;  3QVP A;  4USQ A;  3CGD A;  3D1C A;  1D7L A;  3RP7 A;  3NTA A;  5TR3 A;  2BCP A;  2YWL A;  4GUV A;  3SY4 A;  2AAQ A;  1COY A;  3AB1 A;  2XVH A;  4C3Y A;  3GRT A;  2C75 A;  2CVJ A;  4YTP A;  1TDO A;  4K22 A;  4Y4L A;  2RGH A;  2APG A;  4YSX A;  2WOV A;  3UKA A;  3QSM A;  4BJZ A;  1N4W A;  1FEB A;  5JCM A;  1DXL A;  2YR6 A;  2XFO A;  1KSU A;  3F8R A;  1H82 A;  2ZZC A;  3BHF A;  1LQT A;  2XLS A;  3NK0 X;  4HA6 A;  1H6V A;  1D4E A;  1TRB A;  1YQ4 A;  2FBW A;  4J34 A;  1VG9 A;  3UOZ A;  3DGH A;  1NHS A;  2YLR A;  3UKH A;  3UTF A;  3EAN A;  1GXF A;  1EL5 A;  1TDF A;  1D7Y A;  1BGJ A;  1PXC A;  2B7S A;  2FJD A;  1LVL A;  1EL7 A;  2GMJ A;  4H4P A;  3AED A;  3M13 A;  3O0H A;  4O5Q A;  2O9Z A;  3AE5 A;  3V3O A;  3KVE A;  5HXI A;  1XHC A;  1F3P A;  4FX9 A;  3RED A;  3T2Z A;  1ZX9 A;  1GEU A;  1E1L A;  4APN A;  1CBO A;  3C4A A;  2XFP A;  3ABV A;  5LV9 A;  5FS8 A;  2YLX A;  3B3R A;  5EB4 A;  3UKK A;  1L9D A;  4GF7 A;  1GPE A;  2JB3 A;  1Y56 B;  4EMW A;  3II4 A;  2I0Z A;  2YG7 A;  5JRB A;  2BS3 A;  3IC9 A;  2ARD A;  4AT2 A;  2WET A;  3KD9 A;  2X8C A;  4C5O A;  4CCR A;  2BC1 A;  5FS9 A;  2TMD A;  4G9K A;  4G6H A;  1GSN A;  3NG7 X;  1DOC A;  1ZOV A;  1H83 A;  2YVF A;  4H4V A;  2Q0L A;  2CFY A;  3COX A;  3KU9 A;  2WHD A;  4TM1 A;  4H4Y A;  4LA1 A;  1PBC A;  4CY6 A;  3GD4 A;  4EQS A;  4MJW A;  3T0K A;  2XVE A;  3AEC A;  2GRT A;  3C4N A;  4OPI A;  2GR1 A;  3HYX A;  3ALL A;  2Q7V A;  2OA1 A;  5HY5 A;  4H2N A;  1CC6 A;  2C3D A;  1UKV G;  4I59 A;  2C3C A;  3NT6 A;  4B66 A;  1CF3 A;  3CPH G;  3T14 A;  4B65 A;  4BUR A;  1PS9 A;  2WU2 A;  3CTY A;  4Z43 A;  3AEE A;  4JDR A;  2R46 A;  1S3E A;  2YM2 A;  2JAE A;  3UTG A;  4J56 A;  3ALJ A;  4GR1 A;  1BKW A;  2BYB A;  4KX6 A;  4AP1 A;  4A6N A;  3CGE A;  1CC2 A;  3DK8 A;  2GR2 A;  4EIP A;  4JQ9 A;  5U25 A;  1ELI A;  5M10 A;  3BI5 A;  3DME A;  4IVO B;  1KDG A;  2H88 A;  1S2Y A;  4P9S A;  2BAB A;  2YLZ A;  4AOX A;  4YSZ A;  2YG4 A;  2XLT A;  3ALM A;  4G6G A;  4IA5 A;  3UTE A;  3NN6 X;  1K4Q A;  3GD3 A;  4EQW A;  2YLT A;  3NNE A;  4U8N A;  4H4Q A;  3CMM A;  3KA7 A;  2PYX A;  3AYL A;  5BUK A;  2GV8 A;  2JB1 A;  3R9U A;  3UKP A;  4Z26 A;  2V3A A;  3UOX A;  3EPT A;  5JCI A;  5BUL A;  1EBD A;  4Z25 A;  1LJ1 A;  3DJJ A;  1B37 A;  5HHF A;  5GSN A;  2EQ7 A;  3OZ2 A;  1GTH A;  2C4C A;  1DOD A;  4J33 A;  5J7X A;  3SFE A;  3HZL A;  1YY5 A;  1GRT A;  3SX6 A;  3GWD A;  3NHO X;  1NHR A;  1REO A;  3M12 A;  1X31 B;  2GVC A;  3ISH A;  3SXI A;  1S3B A;  4GAV A;  5KMR A;  4K7Z A;  2WPE A;  1NDA A;  2CDU A;  2X99 A;  1JRX A;  4X9M A;  4B64 A;  4U8M A;  1OJD A;  3VR9 A;  4A65 A;  3SZW A;  5IQ1 A;  2J3N A;  2R0C A;  2WS3 A;  1PJ5 A;  2WPC A;  2XFQ A;  1D5T A;  2ZZ0 A;  1JNR A;  1VDC A;  2VRM A;  3AE7 A;  2GF3 A;  1GER A;  3D9X A;  4Z2R A;  3RHA A;  3GYJ A;  2A89 A;  1V59 A;  1IUS A;  2VVL A;  1VG0 A;  4N9X A;  5U63 A;  1B5Q A;  3IF9 A;  4FDC B;  1ZMD A;  5FS6 A;  1KSS A;  1P2H A;  3AYI A;  3P9U A;  4U8P A;  1NHP A;  2WP9 A;  2VQB A;  2XVJ A;  4OPD A;  2AR8 A;  1H7W A;  3NRN A;  4GDE A;  4OCG A;  4K2X A;  2WBA A;  1XPQ A;  2RGJ A;  1PBE A;  3KPK A;  3P4P A;  1PXB A;  2GQF A;  4NEW A;  2C73 A;  3K7Q X;  4OPL A;  2JK6 A;  1P2E A;  1KF6 A;  3AE9 A;  5JCN A;  2VQ7 A;  1IUU A;  3K30 A;  3CPJ G;  3BNM A;  2VOU A;  3HYV A;  3FBS A;  1YQZ A;  4B69 A;  4U2L A;  3S61 A;  5KMP A;  3GMC A;  4G74 A;  1BWC A;  1AOG A;  1M6I A;  3GMB A;  3RP6 A;  4A7A A;  1ONF A;  3QFB A;  3P4S A;  1LTX R;  2Q0K A;  3SGL A;  2QAE A;  2VZ2 A;  1BZL A;  1PBB A;  1TDN A;  2V61 A;  4EM4 A;  3IHM A;  4NTD A;  4Z2U A;  4O5U A;  3I3L A;  1KN0 A;  4H4W A;  5KWF A;  3AEB A;  4IV9 A;  2BK4 A;  4K5R A;  4II3 A;  2B76 A;  3G5R A;  5J60 A;  2BC0 A;  4DNA A;  2YVJ A;  1Y0P A;  1JRY A;  5FMH A;  2WP5 A;  4AOS A;  1FEC A;  4U8O A;  3CND A;  2DKH A;  5GRT A;  2XVI A;  1GRA A;  4G73 A;  3AWI A;  1OJ9 A;  4KPR A;  4YSY A;  1YQ3 A;  2YG5 A;  1D4C A;  2YR5 A;  3CNT A;  4GRT A;  2A8X A;  4J31 A;  2PHH A;  2R4J A;  1E1N A;  3UKQ A;  5JCL A;  3AYJ A;  1CC4 A;  1FCD A;  4Z24 A;  2C76 A;  1TDK A;  2F5Z A;  2FJE A;  1QO8 A;  3AE4 A;  2R0P A;  2BK5 A;  3URH A;  3OC4 A;  1RP0 A;  5KVH A;  2BXS A;  3AEG A;  3VRA A;  1Q1W A;  1NG4 A;  1B8S A;  4DSH A;  2WDR A;  2JB2 A;  2H89 A;  1NEN A;  5JCK A;  2YR4 A;  4YTN A;  1JRZ A;  2FJA A;  1L0V A;  3FMW A;  4UP3 A;  5KOW A;  2BK3 A;  4UDR A;  3AE3 A;  1NPX A;  1L9C A;  2B7R A;  4EMI A;  1F8W A;  2GQW A;  5ER0 A;  4CY8 A;  4ECH A;  2YQU A;  2RGO A;  4RSL A;  3NYC A;  4OVI A;  2ZZB A;  3QFA A;  4H4X A;  1IUV A;  2R4E A;  1MXT A;  2BS4 A;  4U8L A;  1E1K A;  4U8J A;  4JNA A;  4E0V A;  4BK2 A;  2Z5X A;  1ZMC A;  1CL0 A;  4J2W A;  3BI4 A;  1DJN A;  2WP6 A;  3P1W A;  2X50 A;  1L9E A;  1PBD A;  4JN9 A;  1EL8 A;  3VRB A;  4REK A;  2E1M A;  4RG3 A;  1F8R A;  1GRF A;  4NWZ A;  1TYT A;  2Y6R A;  2E5V A;  4USR A;  1CJC A;  3SZC A;  1H81 A;  4TM0 A;  3C96 A;  3AD8 B;  3ICR A;  2GEW A;  3CGB A;  3NYF A;  1NG3 A;  3AE2 A;  2OLO A;  3GDN A;  3GYX A;  1MO9 A;  2GB0 A;  2C64 A;  3AE8 A;  3NK2 X;  2WQY A;  2V5Z A;  3KKJ A;  1FL2 A;  4YKF A;  3K7M X;  1ZP0 A;  2NVK X;  1S2Q A;  3AEF A;  1E6E A;  4GAP A;  4U8K A;  2BA9 A;  4IA6 A;  4NTE A;  3NKS A;  3P4R A;  1MOK A;  3CNS A;  2X8G A;  2C70 A;  5HYM A;  5KOX A;  2WEU A;  4A5L A;  1B4V A;  3V3N A;  1NEK A;  5CKU A;  4C3X A;  1NAA A;  3DJE A;  2VRL A;  3PS9 A;  3QSS A;  1M64 A;  4A99 A;  1D4D A;  4EQR A;  4OPT A;  2BXR A;  3G5S A;  2C65 A;  3KLJ A;  4EM3 A;  1O95 A;  4GCM A;  1GTE A;  2GR3 A;  3SM8 A;  1O94 A;  3LAD A;  3CIR A;  4X4J A;  4CNJ A;  3RP8 A;  3NTD A;  4A6N B;  1E39 A;  4DGK A;  3HYW A;  2XFN A;  2XLU A;  3ICS A;  1K0L A;  3NGC X;  1LPF A;  2YG6 A;  2EQ9 A;  1ZDL A;  1DJQ A;  1GV4 A;  4C74 A;  3M0O A;  3NH3 X;  1IUW A;  4ZCC A;  1Z6L A;  4H2P A;  2OAM A;  4ICY A;  3UP4 A;  2Q6U A;  3PG6 A;  3LXD A;  2V6O A;  1E7P A;  4NEV A;  1KNR A;  1EL9 A;  1ZKQ A;  1Q1R A;  3GRS A;  2XLP A;  1JNZ A;  3AXB A;  3AD9 B;  1GOS A;  3QSE A;  2YVG A;  2B9X A;  3ATQ A;  3VR8 A;  4A79 A;  5KRQ A;  5M0Z A;  3SYI A;  3DJG X;  1DOB A;  2YM1 A;  3L8K A;  4K8D A;  1F8S A;  2WDV A;  2XDO A;  1N1P A;  4II2 A;  1JEH A;  2BRA A;  3V76 A;  1RYI A;  1O5W A;  1ZOY A;  1H84 A;  2DKI A;  2XCG A;  4JNQ A;  4UDQ A;  2FJB A;  3ATR A;  1OJA A;  3B6D A;  2WOI A;  1SEZ A;  2XLR A;  3LZX A;  3SQP A;  1Y56 A;  3PVC A;  2EQ6 A;  3SZF A;  2ZBW A;  3BNU A;  1IUT A;  1YKJ A;  3DJD A;  5BRT A;  1IUX A;  1GAL A;  2V60 A;  4YTM A;  3NN0 X;  5C2T A;  3VRD B;  4GDP A;  3ZYX A;  1GRB A;  2GMH A;  3LJP A;  3EF6 A;  4C77 A;  2NPX A;  1QJD A;  3UKF A;  3NIX A;  3ICT A;  3DGZ A;  1ZY8 A;  2QA1 A;  4AT0 A;  2ACZ A;  5C3J A;  2XVF A;  2E4G A;  4NNJ A;  1GT8 A;  2GAH B;  3IHG A;  1H7X A;  2VVL G;  3H8I A;  2VVM A;  4NZH A;  2XFU A;  1DNC A;  1PBF A;  4Z2T A;  1PJ7 A;  3DK4 A;  2IVE A;  1GND A;  3AEA A;  3UTH A;  2C7G A;  3NLC A;  3F8P A;  3QVR A;  1H86 A;  4B67 A;  4DSG A;  4H4R A;  4IVM B;  5EBK A;  3UCL A;  1BF3 A;  4CNK A;  4CRT A;  2QA2 A;  2BS2 A;  1XAN A;  1GET A;  5BVA A;  3CN8 A;  1IJH A;  4H7U A;  3CNP A;  3E1T A;  1H2I A;  4XWZ A;  3AE6 A;  3H4K A;  2AQJ A;  3S5W A;  4XXG A;  3LB8 A;  3L1R A;  3NYE A;  4ZN0 A;  1N4V A;  3SFD A;  2X8H A;  5L46 A;  3L5O A;  4H4T A;  3ITJ A;  4BJY A;  3UKL A;  3UOY A;  1ZK7 A;  4M52 A;  2B9Y A;  1PXA A;  3IWA A;  3T37 A;  2X3N A;  3Q9T A;  1VRQ B;  3AD7 B;  2WPF A;  5KVI A;  4Y4M A;  2OAL A;  1PHH A;  5IPY A;  2EQ8 A;  3KPF A;  3DA1 A;  2BAC A;  4U2T A;  3EAO A;  2JKC A;  1Q9I A;  3Q6J A;  1F6M A;  4X9N A;  5IQ4 A;  4UDP A;  4CCQ A;  3GSI A;  2R0G A;  2YLS A;  3T2K A;  3UOV A;  3RNM A;  2A87 A;  3ZDN A;  3DH9 A;  1DOE A;  4BK1 A;  3CGC A;  2C67 A;  4EQX A;  2HQM A;  4JY2 A;  3BHK A;  3AE1 A;  2WOW A;  2GR0 A;  3QJ4 A;  3SZ0 A;  1CJ2 A;  4BV6 A;  2C72 A;  4YSH A;  5DBJ A;  4H50 A;  2V3B A;  4YXD A;  3I6D A;  4D04 A;  2B9W A;  2UZZ A;  4AP3 A;  5KNL A;  1CJ3 A;  1FOH A;  3GDP A;  1JOA A;  2CUL A;  4TLX A;  4A9W A;  4B68 A;  2R9Z A;  4H4U A;  1OJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...