1LPFA

Three-dimensional structure of lipoamide dehydrogenase from pseudomonas fluorescens at 2.8 angstroms resolution. analysis of redox and thermostability properties
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
472
structure length
472
Chain Sequence
b'SQKFDVVVIGAGPGGYVAAIRAAQLGLKTACIEKYIGKEGKVALGGTCLNVGCIPSKALLDSSYKYHEAKEAFKVHGIEAKGVTIDVPAMVARKANIVKNLTGGIATLFKANGVTSFEGHGKLLANKQVEVTGLDGKTQVLEAENVIIASGSRPVEIPPAPLSDDIIVDSTGALEFQAVPKKLGVIGAGVIGLELGSVWARLGAEVTVLEALDKFLPAADEQIAKEALKVLTKQGLNIRLGARVTASEVKKKQVTVTFTDANGEQKETFDKLIVAVGRRPVTTDLLAADSGVTLDERGFIYVDDHCKTSVPGVFAIGDVVRGAMLAHKASEEGVMVAERIAGHKAQMNYDLIPSVIYTHPEIAWVGKTEQTLKAEGVEVNVGTFPFAASGRAMAANDTTGLVKVIADAKTDRVLGVHVIGPSAAELVQQGAIGMEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGHAIHIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROLIPOAMIDE DEHYDROGENASE
publication title Three-dimensional structure of lipoamide dehydrogenase from Pseudomonas fluorescens at 2.8 A resolution. Analysis of redox and thermostability properties.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Oxidoreductase
total genus 150
structure length 472
sequence length 472
chains with identical sequence B
ec nomenclature ec 1.8.1.4: Dihydrolipoyl dehydrogenase.
pdb deposition date 1992-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1lpfA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1lpfA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1lpfA02
2GR1A 2X50A 1PBCA 3UKLA 1GALA 5HY5A 1O95A 4LA1A 4BJYA 1BGNA 1KSSA 2JKCA 3AE2A 1H6VA 1Y56A 3UKHA 3GD3A 4I59A 1LTXR 1N4VA 1K0LA 3GMBA 4DSHA 4YSXA 2H88A 3ICTA 4C77A 4YSZA 1D7LA 3K7TA 4GDEA 2YLZA 4YWOA 2WDVA 3S5WA 4H7UA 4LU6A 1CJ3A 2Q0LA 2XFNA 1D4EA 3DK8A 4A6NB 3AYLA 1S3BA 4IV9A 2OAMA 2C7GA 1TDNA 2XDOA 1RYIA 5U1OA 1GXFA 1NAAA 3GMCA 4TM3A 1RSGA 4U8MA 3GRTA 4ZCCA 5J7XA 4A5LA 3NH3X 4OPCA 3BHKA 1XDIA 5JCNA 2RABA 4A79A 3UKAA 1GEUA 2NVKX 2R0GA 1K0IA 3KLJA 3R9UA 4OPUA 5M10A 2YAUA 2WETA 1NG4A 2BS2A 1GRHA 1F8WA 2WEUA 3G5RA 3NGCX 2XLPA 4PAAA 2R0CA 3DA1A 5IPYA 1N1PA 2ARDA 4XWRA 3VR8A 4C74A 1E1KA 3G5QA 1EL7A 3NK1X 4YXDA 3URHA 4H4RA 1CJCA 4NTCA 4U8PA 2A89A 4USRA 2FJEA 3DJDA 3F8DA 4J31A 4H4VA 3UKFA 4I58A 3UOXA 1NENA 2C64A 4C3XA 1PBBA 3AECA 1PJ6A 1Y56B 3PVCA 4BV6A 2BCPA 4JN9A 2R46A 3IHMA 5HXIA 3DH9A 2XVHA 1GRBA 3ATRA 2GV8A 2BS4A 3CPIG 4K2XA 4EQSA 4Z43A 1CBOA 2AR8A 2OLOA 4FX9A 4U8KA 3QVRA 1PBFA 1CL0A 4TM0A 2BCGG 1XPQA 3KPFA 1Q9IA 3FMWA 2QAEA 1NHRA 3CGBA 1FCDA 2OA1A 1E6EA 3JSKA 4B68A 3VRBA 3LZWA 1NDAA 1NHSA 1KNRA 1IUTA 1GSNA 3AWIA 3UOYA 1ZY8A 1E1LA 2BXRA 3ZYXA 3D8XA 1PN0A 2EQ7A 3P9UA 5C3JA 1KF6A 2JAEA 2WP5A 1GV4A 1ZDLA 1N4WA 2CULA 3KKJA 4J33A 3RP7A 1PS9A 3V76A 4TM1A 2GRTA 3VR9A 2JB3A 4CRTA 4BURA 2GEWA 2VZ2A 1B37A 2YWLA 1E7PA 1YQ4A 3P1WA 1P2EA 2I0ZA 3ALMA 3M0OA 4H2QA 4B1BA 4P9SA 3OC4A 4H4PA 5ER0A 2BK3A 3K30A 3NK2X 3NN6X 3NYCA 2ZZCA 4BK3A 1JNZA 2WU2A 2IVEA 2V61A 3ADAB 3H4KA 3DJJA 2B7RA 1XHCA 2WPEA 2YLXA 4HB9A 3RHAA 1LV0A 2V3AA 2WESA 4XXGA 4IA5A 1PJ5A 2YLSA 1NPXA 2C70A 5LV9A 4AOSA 4CCRA 3LZXA 1VG0A 2XFQA 2JB2A 4H50A 2VQ7A 3IWAA 5EOWA 2WDRA 2EQ8A 4NZHA 2X99A 2BA9A 3SM8A 3HZLA 3SQPA 3GSIA 3DK4A 2GVCA 3NTDA 3M13A 4U2SA 1D7YA 1S2YA 4RG4A 3REDA 1EL8A 1L9EA 1F3PA 2WPFA 2YG7A 1D4DA 3AD9B 4KPRA 2DKHA 1SEZA 4OPLA 4Z44A 5KVHA 2WOIA 2WDQA 5KWFA 1BZLA 4TLZA 2NPXA 1CHUA 1GTEA 4UDQA 3UOZA 1GNDA 1GTHA 3AE4A 3EPTA 2XVIA 5KOXA 2GH5A 1GESA 2VRMA 1YKJA 3AEFA 1M6IA 2F5ZA 2J3NA 2R9ZA 2E5VA 4H2PA 1QJDA 3AYJA 3CPHG 3F8RA 2YG4A 3H8IA 1IUWA 3LB8A 1ZP0A 5IQ1A 2R4EA 4Z26A 2EQ6A 4TM4A 2BS3A 3GD4A 1H81A 1Q1WA 4H4WA 1V59A 1TDOA 1ZOYA 3NNEA 3AE1A 4EIPA 2V6OA 2YR5A 4AOXA 3CNDA 4ECHA 4CBQA 2BABA 2GMJA 1DOEA 1ZKQA 3CGEA 3CNSA 4J57A 4DGKA 2CVJA 3NHOX 2C3DA 1ZK7A 5JCIA 1TYPA 5M0ZA 3T37A 1H7WA 2BK5A 2CDUA 3K7QX 1TDKA 4B64A 3AEDA 1DOBA 2O9ZA 5EB5A 1LVLA 1CJ4A 2VVMA 1YQ3A 1K4QA 2PYXA 3AD8B 1KSUA 2WQYA 3E1TA 5TR3A 1MOKA 3CGCA 2GAGB 2FJAA 3S61A 1VDCA 4K22A 3L1RA 2YG3A 1PBEA 2GF3A 1PXBA 1P2HA 3AD7B 4B65A 3IF9A 2BACA 3I3LA 2GAHB 2AAQA 1O5WA 1YY5A 4CY8A 3AE6A 2X8HA 1E1MA 3AE3A 5U25A 4Z24A 4KX6A 1NEKA 2PHHA 1JEHA 3BNUA 3LADA 3QSEA 4O5UA 3UOVA 3EF6A 5HHFA 3FIMB 3NN0X 4EQWA 2H89A 4GR1A 2V3BA 2WS3A 4EQRA 4USQA 3QSMA 5JCMA 2Q6UA 2BYBA 4FDCB 2YG5A 2ZZBA 2AQJA 2BC1A 3L8KA 4CNJA 1ZMDA 2CFYA 3SFDA 1H84A 4UDRA 4GDPA 2C72A 4OPGA 3GWFA 4ZN0A 5DBJA 4RSLA 3ALJA 3QFAA 4O5QA 4MJWA 3KU9A 1M64A 4U8JA 3AXBA 2XVJA 2QA1A 4H4YA 2BXSA 1L0VA 4H4UA 2E4GA 2IVDA 1JRYA 4GRTA 2YVGA 4YTNA 5BVAA 2YVFA 1Y0PA 4YKFA 3PS9A 4EMWA 3VQRA 1TYTA 1LQUA 3K7MX 3DJEA 1W4XA 3V3NA 4LIIA 4E0VA 4YSYA 4YTPA 3UCLA 2WP6A 1Q1RA 2C67A 2OALA 4K7ZA 3GYIA 4B66A 3IHGA 1BGJA 3NLCA 3DK9A 3Q6JA 4EMIA 3F8PA 3UKQA 2XVFA 3AB1A 3AEBA 3KVEA 4B63A 5J60A 2APGA 1DODA 4NTDA 1F6MA 2YQUA 2OLNA 2V60A 4BK2A 4YT0A 3AEAA 4NEVA 2QA2A 4C5OA 2HQMA 2X3NA 4GF7A 3VRDB 4EMJA 1OJAA 3QSSA 3B3RA 1NHQA 3B6DA 3AE5A 4X4JA 3GYJA 2X8CA 1FEAA 4J2WA 3FG2P 3NT6A 3EAOA 2WPCA 3LXDA 2Z5YA 5FS8A 1S2QA 4H4SA 1GETA 1OJDA 4OPIA 4ICYA 2VQBA 4AT2A 2XVEA 1Z6LA 1JU2A 4A65A 4J34A 4JDRA 3ATQA 1TRBA 2XLSA 1TDFA 3ITJA 4H4TA 5EBKA 5JCLA 1FL2A 2C66A 3NYEA 4OCGA 3UTEA 4BJZA 3ABVA 1B5QA 2IIDA 3AE9A 4EM3A 5GSNA 4H2NA 2XFPA 4TLXA 2YM2A 3GRSA 1EBDA 2B76A 4NTEA 5L46A 1IUXA 2C76A 1GOSA 3M12A 2R0PA 2VVLG 3AEEA 3CPJG 2VRLA 4RG3A 3IC9A 1DNCA 3KA7A 4U8IA 1MXTA 2XLUA 3AYIA 1DJQA 4REKA 3ICRA 1UKVG 3NG7X 1GRFA 4EQXA 1OJCA 3SGLA 2GR2A 4U8NA 2WOWA 2WP9A 1GRTA 1LPFA 1PBDA 5BUKA 1IJHA 1JRZA 1QLBA 5KOWA 3ICSA 3UTFA 4A7AA 3NKSA 1S3EA 3BNMA 3QVPA 3EANA 1ELIA 3C96A 3H8LA 2Q0KA 3WE0A 1DXLA 2ZBWA 2JK6A 2B9WA 2C65A 1BKWA 4U8OA 4K5RA 3BI5A 5KXJA 1D4CA 3AE8A 3NRNA 3NIXA 2B7SA 4GCMA 1GRGA 4AT0A 5U63A 4N9XA 3GWDA 5CQFA 3SFEA 1H86A 3RNMA 5HYMA 1BWCA 1D5TA 4K8DA 2TPRA 1OJTA 2GQWA 4DNAA 1LQTA 1OJ9A 2FBWA 1BF3A 1H83A 1IUSA 4U8LA 3O0HA 1PJ7A 2C75A 1GREA 4ADWA 3UTGA 1B4VA 2UZZA 3ALLA 1COYA 2GB0A 2Q7VA 3UP4A 4JNQA 4Z2TA 5EB4A 2A87A 1TDEA 4HA6A 5GRTA 3NYFA 4A9WA 2DKIA 2XFUA 1DOCA 3AE7A 5FS7A 3UKKA 4IA6A 1MO9A 3RP8A 3II4A 5CKUA 3CIRA 2JBVA 3BHFA 4FK1A 3UKPA 2W0HA 4JQ9A 3CTYA 4K5SA 1AOGA 4AP1A 2YR4A 5BRTA 2E1MA 4CNKA 2X8GA 3BI4A 3ISHA 2R45A 3NTAA 4H4QA 1E39A 1FECA 4YSHA 5BULA 1E1NA 1HYUA 3CN8A 4A99A 3C4AA 3DGHA 1CC6A 1EL5A 1L9DA 3NK0X 2BC0A 1CC2A 3I6DA 3QFBA 4M52A 4IVOB 1ONFA 1VRQB 1F8SA 3GDPA 2JB1A 4AP3A 4D04A 3QJ4A 3CGDA 5KVIA 1H7XA 5IQ4A 1IUVA 4X9NA 3P4SA 1GRAA 2XLTA 3FPZA 4OPTA 4UDPA 3DJGX 3UP5A 4C3YA 1CJ2A 2YR6A 4FK1C 4CY6A 4H2RA 1NHPA 1N4UA 4Z2UA 1FEBA 1X31B 2R4JA 3COXA 4JY3A 2EQ9A 4U2TA 2GQFA 2BK4A 3AEGA 4WX1A 1L9CA 1ZMCA 5FMHA 1CF3A 4D03A 4APNA 4U2LA 1ZOVA 3CNTA 4Y4LA 1PXAA 3Q9TA 4Y4NA 2ZZ0A 5KRQA 1NG3A 2WBAA 1PXCA 4J36A 5JCKA 1QO8A 4Z25A 1CC4A 4X9MA 3KD9A 2WU5A 1K0JA 2B9YA 4IVMB 3RP6A 1RP0A 2XLRA 4WCTA 1VQWA 1GT8A 2YLTA 2RGHA 2XYOA 3C4NA 3FBSA 3VRAA 2WOVA 2B9XA 4BK1A 1O94A 1KNPA 3LJPA 1KDGA 4YTMA 2GMHA 1B8SA 2ACZA 3D1CA 3DGZA 4EM4A 2YG6A 2YLWA 3UTHA 2Z5XA 4H4ZA 2XFOA 2VVLA 1ZX9A 3P4PA 2FJBA 4EIQA 4ZCDA 2A8XA 2VOUA 3P4QA 5C2TA 3V3OA 3P4RA 1XANA 4GUVA 1JNRA 4OVIA 3LOVA 2FJDA 4A6NA 1FOHA 1KFYA 3CNPA 4Y4MA 2YLRA 1LJ1A 1VG9A 4XWZA 1GERA 2V5ZA 3G5SA 4DSGA 2RGOA 3PO7A 4H4XA 5FS6A 5FS9A 2XCGA 4B67A 1F8RA 4NEWA 1JRXA 1EL9A 2Y6QA 2QCUA 3DMEA 4JY2A 1GPEA 2YVJA 2RGJA 2GR0A 4J56A 4PABA 2C3CA 1IUUA 4OPDA 4CCQA 4Z2RA 3ZDNA 1PHHA 2TMDA 4B69A 1JOAA 1YQZA 2GR3A 2Y6RA 4UP3A 4YKGA 3CNJA 1REOA 1H82A 3BI2A 3OZ2A 2YM1A 4JNAA 3GDNA 1DJNA 2C73A 2WHDA 1PDHA
chains in the Genus database with same CATH superfamily
3K1GA 4LA1A 1BGNA 5FJOA 2ZC8A 3GMBA 3QN3A 1D7LA 4YWOA 2GGGA 1CJ3A 2XFNA 1D4EA 4A6NB 2OAMA 2C7GA 2I5QA 1GXFA 1RVKA 2GDQA 3UKAA 2R0GA 3PFRA 4E4UA 2WETA 4II3A 2P0IA 2R0CA 3DA1A 5IPYA 1N1PA 3VR8A 4C74A 3SJNA 1EL7A 3SN1A 1CJCA 3MY9A 4USRA 3DJDA 3F8DA 1NENA 3AECA 1Y56B 3NVYB 4JN9A 3U9IA 4H1ZA 4Z43A 2AR8A 1CL0A 1XPQA 3FMWA 1NHRA 1MDLA 1NHSA 1E1LA 3D8XA 3A7RA 1KF6A 2WP5A 1N4WA 4K1WA 3RP7A 2GRTA 3SZCA 2GEWA 1B37A 2XH2A 2I0ZA 4P9SA 2BK3A 4H4PA 4BK3A 3RR1A 3ADAB 2YLXA 4HB9A 4IA5A 1PJ5A 1NPXA 2C70A 1VG0A 2XFQA 3IWAA 3SBFA 4NZHA 2FYMA 2OFJA 2OQHA 3GSIA 2GVCA 3UJRA 3ZVHB 3CMMA 3HW2A 1SEZA 4OPLA 4Z44A 5KVHA 5KWFA 4TLZA 1CHUA 4KT2A 1GNDA 1DTNA 2P88A 3EKGA 3ZVIA 3AE4A 2HXUA 3CT2A 2GH5A 1GESA 2F5ZA 2R9ZA 1QJDA 3AYJA 3LB8A 1ZP0A 2EQ6A 4TM4A 3DG6A 2BS3A 1H81A 4H4WA 2O56A 2V6OA 3CNDA 4ECHA 2GMJA 4MMWA 1WUEA 3TJIA 3VCNA 2PS2A 1ZK7A 1H7WA 1P48A 3K7QX 3SY4A 3KUMA 1K4QA 3GY1A 2GAGB 1MOKA 2FJAA 3UCCA 5J04A 3UCDA 3L1RA 1SJAA 1O5WA 1YY5A 2X8HA 3AE3A 1NEKA 1JEHA 2OKTA 3I6EA 3FIMB 3NN0X 4GIRA 3DESA 4USQA 5JCMA 2YG5A 4CNJA 1ZMDA 4OPGA 4ZN0A 4O5QA 4MJWA 3KU9A 1M64A 3AXBA 2IVDA 1JRYA 3VA8A 4YKFA 3VQRA 1W4XA 4LIIA 2OG9A 5FJPA 2WP6A 2PU0A 2AKZA 3GYIA 3HRDC 4GMEA 4EMIA 3AB1A 3KVEA 5J60A 2OLNA 2V60A 4C5OA 2X3NA 4EMJA 1XS2A 3B3RA 3D46A 4J2WA 5G5GB 3FG2P 2XH7A 3EAOA 3NFUA 1S2QA 4OPIA 2HNEA 4A65A 4DHGA 1TDFA 3ITJA 5JCLA 5EBKA 1B5QA 1FHUA 2XFPA 3QLDA 2P8BA 1IUXA 1JDFA 2C76A 2VVLG 3CPJG 2VRLA 2W55A 3AYIA 1UKVG 3SGLA 2PP3A 2WP9A 1IJHA 1QLBA 3UTFA 4Z1YA 2PODA 2Q0KA 3TWBA 3SQSA 2C65A 1D4CA 1GRGA 4N9XA 5CQFA 3DERA 2GQWA 5G5HB 4DNAA 1LQTA 1GREA 1B4VA 1COYA 4Z2TA 5FJRA 2A87A 1TDEA 2MUCA 2DKIA 1MO9A 3CIRA 2W0HA 3CTYA 3NTAA 3BI4A 1FECA 4YSHA 5JRBA 3C4AA 1CC6A 3NVWB 3NVZB 3OP2A 2W3RA 3BSMA 3PWIA 4IVOB 3QJ4A 5KVIA 4M0XA 1IUVA 4X9NA 1CJ2A 2OQYA 2BRYA 4DX3A 1NHPA 1FEBA 1X31B 4U2TA 3AEGA 4WX1A 1L9CA 1ZMCA 1CF3A 2QVHA 4APNA 4U2LA 3Q4DA 2W54A 4J36A 4Z25A 2XLRA 2YLTA 2XYOA 3TW9A 3C4NA 3GO2A 3LJPA 4YTMA 1B8SA 4EM4A 2YLWA 2AL2B 1ZX9A 1STZA 2FJBA 3P4RA 4A6GA 4ROPA 4A6NA 4MGGA 3CNPA 3SN0A 2YLRA 4XWZA 1GERA 3G5SA 3AN1A 1F8RA 4NEWA 1IYXA 1EL9A 4JY2A 2GR0A 4J56A 3T2KA 4NWZA 1IUUA 2TMDA 4B69A 1JOAA 2Y6RA 3CNJA 2OZ8A 3BI2A 3OZ2A 1DJNA 3JVAA 2PGWA 2GR1A 2X50A 1PBCA 1GALA 1O95A 2XSXA 3N6HA 4BJYA 1KSSA 1Y56A 3N6JA 1KKOA 1N4VA 1MRAA 1K0LA 4C77A 4YSZA 2YLZA 4YWSA 4H7UA 2Q0LA 3DK8A 1S3BA 4IV9A 1ECQA 1V97A 4IP5A 2XDOA 4TM3A 1NAAA 3GMCA 4U8MA 4A5LA 4A79A 2RABA 3OZMA 3MZNA 1GEUA 1H2IA 3DGBA 1NG4A 1F8WA 2GGIA 1EC8A 2OVLA 2XLPA 4PAAA 3G5QA 2PCEA 3NK1X 4YXDA 3URHA 2A89A 3VCCA 3UKFA 3UOXA 4G6GA 4C3XA 3S47A 2BCPA 3IHMA 2XVHA 2BS4A 3CPIG 3SSZA 2PGEA 4EQSA 4H2HA 3TJ4A 3QVRA 2QAEA 3EEZA 3UJSA 3JSKA 1NDAA 4J3ZA 3UOYA 3ZYXA 1PN0A 3P9UA 2JAEA 3KKJA 1ZDLA 2CULA 4DN1A 3VR9A 2XH4A 1E7PA 1YQ4A 3P1WA 3M0OA 4KPLA 3RGTA 3VDGA 3K30A 3D47A 3NYCA 2ZZCA 4GGBA 2OZ3A 3DFHA 2WU2A 3DJJA 2B7RA 1XHCA 2WPEA 2MNRA 3PK7A 5LV9A 1N5WC 3OZYA 3LZXA 2EQ8A 3HZLA 3SQPA 4U2SA 3Q45A 4H83A 1PDZA 2YG7A 1D4DA 3DDMA 2PU1A 1BZLA 2NPXA 1GTEA 2POZA 3DIPA 4GAVA 4ZCWA 3T2ZA 5KOXA 3AEFA 2E5VA 2J3NA 3CPHG 3F8RA 5BOFA 4KEMA 2QJMA 4NNJA 1E9IA 1W6TA 1ZOYA 3IJLA 3P93A 4M6UA 2YR5A 2OZTA 5KMSA 3VC5A 1ZKQA 3CNSA 4DGKA 2C3DA 3T37A 2CDUA 1TDKA 4B64A 5KMPA 1YEYA 5EB5A 3SX6A 1CJ4A 2PYXA 1KSUA 1KN0A 3E1TA 2DW6A 3B97A 3S61A 2YG3A 3AD7B 4B65A 3IF9A 3I3LA 3UOVA 3BNUA 3QSEA 5HHFA 2V3BA 1S7MA 2BYBA 3MKCA 4UDRA 4U8JA 2XVJA 2QA1A 2BXSA 2E4GA 3L5OA 4GRTA 2PTXA 3T8QA 1LQUA 3DJEA 3V3NA 4E0VA 4YTPA 3UCLA 1Q1RA 4B66A 3NLCA 3DK9A 2XVFA 3R1ZA 4B63A 2APGA 3NRZB 4NTDA 4YT0A 3NO1A 2QA2A 4GF7A 3QSSA 1NHQA 4X4JA 3AE5A 3R0KA 2Z5YA 1N5XA 1OJDA 4ICYA 1Z6LA 1JU2A 3I6TA 4J34A 3ATQA 2XLSA 4GISA 2C66A 3NYEA 5GSNA 3GRSA 1EBDA 2B76A 4NTEA 3TOYA 1FFUC 3M12A 4GGHA 1MXTA 4G73A 1DJQA 4E5TA 3ICRA 3NG7X 1GRFA 1N60C 2GR2A 3R10A 1GRTA 3H8AA 1JRZA 3ICSA 3NKSA 1MNSA 1EBHA 2JK6A 1BKWA 4G9KA 3P0WA 3AE8A 3NRNA 2GGHA 5U63A 3SN4A 3THUA 2CHRA 3SFEA 1H86A 3RNMA 5HYMA 1BQGA 4KWSA 4U8LA 3PWGA 3UP4A 4JNQA 1L8PA 1VQZA 5GRTA 2NQLA 3NYFA 4A9WA 1DOCA 5FS7A 2JBVA 3UKPA 5BRTA 4ZOHB 3ISHA 3NS1B 2R45A 5BULA 3CN8A 1EL5A 1L9DA 2BC0A 1CC2A 5ENLA 4DXKA 1JRPA 3I6DA 3QFBA 1ONFA 1F8SA 2AL2A 2JB1A 4D04A 1H7XA 3P4SA 2XLTA 3FPZA 3U4FA 2YR6A 4Z2UA 3CYJA 3SZ0A 3FYYA 3RCYA 4F4RA 4IZGA 3QKEA 5IDZA 3TQPA 5KRQA 1PXCA 4HNLA 1CC4A 1SJBA 4WCTA 1KNPA 2AKMA 2ACZA 3UTHA 4IL0A 2XFOA 2VOUA 4GUVA 3LOVA 1FOHA 3JZUA 1VG9A 2RGOA 5FJTA 3PO7A 5FS6A 3SYIA 1T3QC 2QCUA 3V4BA 2GR3A 4UP3A 1REOA 4JNAA 3UKLA 1WUFA 3V3WA 2BRAA 3UKHA 3GD3A 4DSHA 2H88A 5KMQA 1JPMA 3S5WA 3AYLA 1TDNA 4AP3A 1RYIA 5U1OA 2C4CA 4ZCCA 4FP1A 3NH3X 3BHKA 1BKHA 3KLJA 4OPUA 2GL5A 2BS2A 1GRHA 1R0MA 2WEUA 3G5RA 3NGCX 2ARDA 3SR6B 3S5SA 3B9JB 2FJEA 4J31A 4I58A 2C64A 4TVWA 3PVCA 1FIQB 3TWAA 1TZZA 3DH9A 3ATRA 1GRBA 3DFYA 4HN8A 2GV8A 1RM6B 1JROA 4U8KA 3KPFA 2W3SA 3QPEA 3CGBA 2OA1A 3VRBA 3CB3A 3SXIA 3LZWA 1KNRA 3UXLA 1GSNA 1IUTA 1ZY8A 2BXRA 3ZLHA 2EQ7A 5C3JA 1GV4A 1NELA 3V76A 2OX4A 3HYWA 3ETRB 4CRTA 3GC2A 2YWLA 5EU9A 3ALMA 4B1BA 5ER0A 3NN6X 3HYVA 3NK2X 2HZGA 1R6WA 2V3AA 1X2GA 2WESA 4HCLA 3T6CA 2YLSA 2JB2A 2VQ7A 5EOWA 2WDRA 2X99A 3SM8A 3DK4A 3NTDA 1EBGA 1S2YA 4RG4A 1EL8A 2WPFA 3EPTA 3SZWA 3FCPA 1YKJA 3NXLA 2R4EA 4Z26A 3EUB3 3GD4A 1Q1WA 1TDOA 1V59A 3NNEA 1EC9A 1XPYA 4CBQA 2BABA 4JHMA 4J57A 3UJEA 2CVJA 3NHOX 5M0ZA 5JCIA 1TYPA 2BK5A 1VDVA 1DOBA 3JW7A 1YQ3A 3IJQA 3AD8B 2WQYA 5TR3A 3CGCA 4H19A 1MDRA 1VDCA 1PBEA 2GF3A 1PXBA 2FKPA 2GAHB 3MWCA 4FI4A 3AE6A 1E1MA 5U25A 2PHHA 4O5UA 2PTWA 4EQWA 2H89A 3BJSA 2WS3A 4EQRA 4FDCB 5KMRA 2AQJA 3L8KA 2CFYA 3SFDA 1H84A 2C72A 3GWFA 5DBJA 4A3RA 2DW7A 3QFAA 4DWDA 4H4YA 4H4UA 4YTNA 3KPKA 1Y0PA 3PS9A 4EMWA 3K7MX 4YSYA 2C67A 3F8PA 4G7FA 1FFVC 4BK2A 3AEAA 1NU5A 2HQMA 3VRDB 1OJAA 7ENLA 2X8CA 3OW1A 1FEAA 3NT6A 2WPCA 3H7VA 4H4SA 2VQBA 4AT2A 2QDEA 1FL2A 3UTEA 4OCGA 4D03A 4EM3A 3NZGA 3VC6A 4H2NA 4TLXA 4HCHA 1GOSA 2R0PA 3AEEA 4E8GA 3KA7A 4EQXA 2WOWA 3IJIA 3UJFA 3A7AA 4A7AA 3DEQA 1S3EA 3BNMA 1P43A 3QVPA 3EANA 1ELIA 3C96A 3WE0A 5BOEA 2ZBWA 4MKSA 4X2PA 2B9WA 3NIXA 2B7SA 4AT0A 1FO4A 3GWDA 3H70A 4IHCA 3MUCA 1N61C 1OJTA 1BF3A 4GYPA 3O0HA 2C75A 4ADWA 2UZZA 2GB0A 2Q7VA 4HA6A 4ZA0A 1JCTA 2PSNA 2XFUA 1PDYA 2QDDA 3AMZA 3AE7A 3UKKA 3II4A 3BOXA 3BHFA 4FK1A 3R07C 4JQ9A 4K5SA 1AOGA 4AP1A 3T31A 4CNKA 2X8GA 3FVDA 4H4QA 1E39A 4GFIA 1E1NA 3VFCA 3DGHA 3NK0X 3AM9A 3MQTA 1VRQB 5IQ4A 3CXBA 3UP5A 3DJGX 1JPDX 1N4UA 2R4JA 4JY3A 2EQ9A 2BK4A 5FMHA 3P3BA 3FJ4A 4HNCA 1ZOVA 3CNTA 4Y4LA 2E5AA 2GSHA 2ZZ0A 1NG3A 4HCDA 5JCKA 3T14A 3KD9A 2WU5A 1GT8A 1ELSA 3FBSA 4TVYA 1KDGA 2GMHA 3D1CA 3DGZA 3D9XA 2Z5XA 3P4PA 4ZCDA 3V3OA 4OVIA 2FJDA 1KFYA 3OTRA 4Y4MA 6ENLA 1LJ1A 3UJ2A 5FS9A 5HXIA 3DMEA 1SB3B 1GPEA 3UGVA 2HXTA 2RGJA 2E3TA 4CCQA 3IK4A 4YKGA 2YM1A 2FBWA 5HY5A 2JKCA 3AE2A 1H6VA 4I59A 1LTXR 4YSXA 3ICTA 3K7TA 4GDEA 2WDVA 4LU6A 1RSGA 2ONEA 3GRTA 5J7XA 4OPCA 1XDIA 5JCNA 3T4WA 2NVKX 3GD6A 1K0IA 3R9UA 5M10A 2YAUA 4XWRA 4E6MA 1E1KA 3ZLGA 3DG3A 4H4RA 4NTCA 4U8PA 5KNLA 3V5FA 4H4VA 2QJJA 1PBBA 5FJUA 1PJ6A 4BV6A 1WYGA 2R46A 3T0KA 4EWJA 4K2XA 3SZFA 1ONEA 1CBOA 2OLOA 4FX9A 1PBFA 4TM0A 2BCGG 1Q9IA 1FCDA 4JN8A 1E6EA 4B68A 1F9CA 3AWIA 4K8GA 3MSYA 4J33A 1PS9A 4TM1A 3UXKA 2JB3A 1TKKA 4BURA 2VZ2A 1P2EA 4H2QA 3OC4A 1EC7A 4A35A 1JNZA 2IVEA 2V61A 3H4KA 3RHAA 1LV0A 4XXGA 4AOSA 4CCRA 3NVVB 4H50A 2BA9A 3DG7A 3M13A 1D7YA 3REDA 1L9EA 2PMQA 1F3PA 3AD9B 4KPRA 2DKHA 3HYXA 2WOIA 2WDQA 4UDQA 3UOZA 1GTHA 3RO6A 2XVIA 3OPSA 3R0UA 2VRMA 1M6IA 4H2PA 3R25A 2YG4A 3H8IA 1IUWA 3QTPA 3ENLA 5IQ1A 2PTZA 3H12A 3AE1A 4EIPA 4AOXA 1OEPA 3V5CA 1DOEA 3HPFA 3CGEA 3AEDA 2O9ZA 1LVLA 2VVMA 2PPGA 3GYXA 3RRAA 3ES7A 4K22A 2OLAA 1P2HA 2BACA 2AAQA 4CY8A 4Z24A 4KX6A 2PA6A 3LADA 3EF6A 2QJNA 4GR1A 3N4EA 3QSMA 2Q6UA 1N63C 4GAPA 2ZZBA 2BC1A 4GDPA 4RSLA 2QGYA 3ALJA 1TE6A 1L0VA 3CK5A 2YVGA 5BVAA 2YVFA 1TYTA 2OALA 4K7ZA 3IHGA 1SJCA 1BGJA 3Q6JA 3UKQA 3AEBA 3ES8A 2PP0A 2PP1A 1DODA 1F6MA 2YQUA 4NEVA 3B6DA 3GYJA 2P8CA 3LXDA 5FS8A 1GETA 2XVEA 3N4FA 4JDRA 4G8TA 1TRBA 4H4TA 1KD0A 4BJZA 3ABVA 3AE9A 2IIDA 1SJDA 2YM2A 4HPNA 5L46A 4II2A 3T9PA 4RG3A 3IC9A 1DNCA 4U8IA 2XLUA 4REKA 1OJCA 4U8NA 1LPFA 1PBDA 5BUKA 2GGEA 2XH0A 5KOWA 3A7UA 3H8LA 4ENLA 3CAWA 1DXLA 2ZADA 4U8OA 4K5RA 1MUCA 3BI5A 5KXJA 4GCMA 1X2HA 2QQ6A 1BWCA 1D5TA 4K8DA 2TPRA 1OJ9A 4JN7A 1H83A 1KCZA 1IUSA 1PJ7A 3UTGA 3PG6A 3ALLA 3STPA 5EB4A 4IT1A 3TTEA 2AL1A 4G6HA 4IA6A 3RP8A 3I4KA 5CKUA 4HYRA 2YR4A 3T2YA 2E1MA 4DYEA 2OO6A 2RDXA 1ZXIC 1HYUA 3CXOA 4GYPC 4A99A 4M52A 3GDPA 3CGDA 1GRAA 4OPTA 4UDPA 4C3YA 2PTYA 4FK1C 4CY6A 3TCSA 4H2RA 3COXA 3ZVHA 2GQFA 2XGZA 1PXAA 3Q9TA 4Y4NA 4E4FA 2WBAA 3FXGA 1QO8A 4X9MA 1K0JA 2B9YA 2GGJA 4IVMB 3RP6A 3RITA 1RP0A 3ZLFA 1VQWA 1N62C 2RGHA 3VRAA 2WOVA 2B9XA 4BK1A 1O94A 4G74A 3R11A 2OPJA 2YG6A 4H4ZA 2VVLA 1FHVA 4EIQA 2A8XA 3P4QA 1KKRA 5C2TA 1XANA 1JNRA 2P3ZA 4Z17A 3FV9A 4K2SA 2V5ZA 4DSGA 4H4XA 4B67A 2XCGA 1JRXA 2Y6QA 4IP4A 4J1OA 2YVJA 4PABA 2C3CA 4OPDA 4Z2RA 3ZDNA 1PHHA 4IL2A 1YQZA 1H82A 3GDNA 2C73A 2WHDA 1PDHA
chains in the Genus database with same CATH topology
2GR1A 2X50A 1PBCA 3UKLA 1GALA 5HY5A 1O95A 4LA1A 4BJYA 1BGNA 2BRAA 1KSSA 2JKCA 3AE2A 1H6VA 1Y56A 3UKHA 3GD3A 4I59A 1LTXR 1N4VA 1K0LA 3GMBA 4DSHA 4YSXA 2H88A 3ICTA 4C77A 4YSZA 5KMQA 1D7LA 3K7TA 4GDEA 2YLZA 4YWOA 2WDVA 3S5WA 4H7UA 4LU6A 1CJ3A 2Q0LA 2XFNA 1D4EA 3DK8A 4A6NB 3AYLA 1S3BA 4IV9A 2OAMA 2C7GA 1TDNA 2XDOA 1RYIA 5U1OA 1GXFA 1NAAA 2C4CA 3GMCA 1RSGA 4TM3A 3GRTA 4U8MA 4ZCCA 5J7XA 4A5LA 3NH3X 4OPCA 3BHKA 1XDIA 5JCNA 2RABA 4A79A 3UKAA 1GEUA 2NVKX 2R0GA 1K0IA 1H2IA 3KLJA 3R9UA 4OPUA 5M10A 2YAUA 2WETA 1NG4A 2BS2A 1GRHA 4II3A 1F8WA 2WEUA 3G5RA 3NGCX 2XLPA 4PAAA 2R0CA 3DA1A 5IPYA 1N1PA 2ARDA 4XWRA 3VR8A 4C74A 1E1KA 3G5QA 1EL7A 3NK1X 4YXDA 3URHA 4H4RA 1CJCA 4NTCA 4U8PA 2A89A 4USRA 5KNLA 2FJEA 3DJDA 3F8DA 4J31A 4H4VA 3UKFA 4I58A 3UOXA 4G6GA 1NENA 2C64A 4C3XA 1PBBA 3AECA 1PJ6A 1Y56B 3PVCA 4BV6A 2BCPA 4JN9A 2R46A 3IHMA 3T0KA 3DH9A 5HXIA 2XVHA 1GRBA 3ATRA 2GV8A 2BS4A 3CPIG 4K2XA 4EQSA 3SZFA 4Z43A 1CBOA 2AR8A 2OLOA 4FX9A 4U8KA 3QVRA 1PBFA 1CL0A 4TM0A 2BCGG 1XPQA 3KPFA 1Q9IA 3FMWA 2QAEA 1NHRA 3CGBA 1FCDA 2OA1A 1E6EA 3JSKA 4B68A 3VRBA 3SXIA 3LZWA 1NDAA 1NHSA 1KNRA 1IUTA 1GSNA 3AWIA 3UOYA 1ZY8A 1E1LA 2BXRA 3ZYXA 3D8XA 1PN0A 2EQ7A 3P9UA 5C3JA 1KF6A 2JAEA 2WP5A 1GV4A 1ZDLA 1N4WA 2CULA 3KKJA 4J33A 3RP7A 1PS9A 3V76A 3HYWA 2GRTA 4TM1A 3SZCA 3VR9A 2JB3A 4CRTA 4BURA 2GEWA 2VZ2A 1B37A 2YWLA 1E7PA 1YQ4A 3P1WA 1P2EA 2I0ZA 3ALMA 3M0OA 4H2QA 4B1BA 4P9SA 3OC4A 4H4PA 5ER0A 2BK3A 3HYVA 3K30A 3NK2X 3NN6X 3NYCA 2ZZCA 4BK3A 1JNZA 2WU2A 2IVEA 2V61A 3ADAB 3H4KA 3DJJA 2B7RA 1XHCA 2WPEA 2YLXA 4HB9A 3RHAA 2V3AA 1LV0A 2WESA 4XXGA 4IA5A 1PJ5A 2YLSA 1NPXA 2C70A 5LV9A 4AOSA 4CCRA 3LZXA 1VG0A 2XFQA 2JB2A 4H50A 2VQ7A 3IWAA 5EOWA 2WDRA 2EQ8A 4NZHA 2X99A 2BA9A 3SM8A 3HZLA 3SQPA 3GSIA 3DK4A 2GVCA 3NTDA 3M13A 4U2SA 3CMMA 1D7YA 1S2YA 4RG4A 3REDA 1EL8A 1L9EA 1F3PA 2WPFA 2YG7A 1D4DA 3AD9B 4KPRA 2DKHA 1SEZA 4OPLA 4Z44A 5KVHA 2WOIA 2WDQA 3HYXA 1BZLA 4TLZA 5KWFA 2NPXA 1CHUA 1GTEA 4UDQA 3UOZA 1GNDA 1GTHA 3AE4A 4GAVA 3EPTA 3SZWA 3T2ZA 2XVIA 5KOXA 2GH5A 1GESA 2VRMA 1YKJA 3AEFA 1M6IA 2F5ZA 2J3NA 2R9ZA 2E5VA 4H2PA 1QJDA 3AYJA 3CPHG 3F8RA 2YG4A 3H8IA 1IUWA 3LB8A 1ZP0A 5IQ1A 2R4EA 4Z26A 2EQ6A 4TM4A 4NNJA 2BS3A 3GD4A 1H81A 1Q1WA 4H4WA 1V59A 1TDOA 1ZOYA 3NNEA 3AE1A 4EIPA 2V6OA 2YR5A 4AOXA 3CNDA 4ECHA 5KMSA 4CBQA 2BABA 2GMJA 1DOEA 1ZKQA 3CGEA 3CNSA 4J57A 4DGKA 2CVJA 3NHOX 2C3DA 1ZK7A 5JCIA 1TYPA 5M0ZA 3T37A 1H7WA 2BK5A 2CDUA 3K7QX 1TDKA 4B64A 5KMPA 3AEDA 3SY4A 1DOBA 2O9ZA 5EB5A 1LVLA 3SX6A 1CJ4A 2VVMA 1YQ3A 1K4QA 2PYXA 3AD8B 1KSUA 3GYXA 1KN0A 2WQYA 3E1TA 5TR3A 1MOKA 3CGCA 2GAGB 2FJAA 3S61A 1VDCA 4K22A 3L1RA 2YG3A 1PBEA 2GF3A 1PXBA 1P2HA 3AD7B 4B65A 3IF9A 2BACA 3I3LA 2GAHB 2AAQA 1O5WA 1YY5A 4CY8A 3AE6A 2X8HA 1E1MA 3AE3A 5U25A 4Z24A 4KX6A 1NEKA 2PHHA 1JEHA 3BNUA 3LADA 3QSEA 4O5UA 3UOVA 3EF6A 5HHFA 3FIMB 3NN0X 4EQWA 2H89A 4GR1A 2V3BA 2WS3A 1S7MA 4EQRA 4USQA 3QSMA 5JCMA 2Q6UA 2BYBA 4FDCB 2YG5A 5KMRA 4GAPA 2ZZBA 2AQJA 2BC1A 3L8KA 4CNJA 1ZMDA 2CFYA 3SFDA 1H84A 4UDRA 4GDPA 2C72A 4OPGA 3GWFA 4ZN0A 5DBJA 4RSLA 3ALJA 3QFAA 4O5QA 4MJWA 3KU9A 1M64A 4U8JA 3AXBA 2XVJA 2QA1A 4H4YA 2BXSA 1L0VA 4H4UA 2E4GA 2IVDA 3L5OA 1JRYA 4GRTA 2YVGA 4YTNA 3KPKA 5BVAA 2YVFA 1Y0PA 4YKFA 3PS9A 4EMWA 3VQRA 1TYTA 1LQUA 3K7MX 3DJEA 1W4XA 3V3NA 4LIIA 4E0VA 4YSYA 4YTPA 3UCLA 2WP6A 1Q1RA 2C67A 2OALA 4K7ZA 3GYIA 4B66A 3IHGA 1BGJA 3NLCA 3DK9A 3Q6JA 4EMIA 3F8PA 3UKQA 2XVFA 3AB1A 3AEBA 3KVEA 4B63A 5J60A 2APGA 1DODA 4NTDA 1F6MA 2YQUA 2OLNA 2V60A 4BK2A 4YT0A 3AEAA 4NEVA 2QA2A 4C5OA 2HQMA 2X3NA 4GF7A 3VRDB 4EMJA 1OJAA 3QSSA 3B3RA 1NHQA 3B6DA 3AE5A 4X4JA 3GYJA 2X8CA 1FEAA 4J2WA 3FG2P 3NT6A 3EAOA 2WPCA 3LXDA 2Z5YA 5FS8A 1S2QA 4H4SA 1GETA 1OJDA 4OPIA 4ICYA 2VQBA 4AT2A 2XVEA 1Z6LA 1JU2A 4A65A 4J34A 4JDRA 3ATQA 1TRBA 2XLSA 1TDFA 3ITJA 4H4TA 5EBKA 5JCLA 1FL2A 2C66A 3NYEA 4OCGA 3UTEA 4BJZA 3ABVA 1B5QA 2IIDA 3AE9A 4EM3A 5GSNA 4H2NA 2XFPA 4TLXA 2YM2A 3GRSA 1EBDA 2B76A 4NTEA 5L46A 1IUXA 4II2A 2C76A 1GOSA 3M12A 2R0PA 2VVLG 3AEEA 3CPJG 2VRLA 4RG3A 3IC9A 1DNCA 3KA7A 4U8IA 1MXTA 2XLUA 3AYIA 1DJQA 4G73A 4REKA 3ICRA 1UKVG 3NG7X 1GRFA 4EQXA 1OJCA 3SGLA 2GR2A 4U8NA 2WOWA 2WP9A 1GRTA 1LPFA 1PBDA 5BUKA 1IJHA 1JRZA 1QLBA 5KOWA 3ICSA 3UTFA 4A7AA 3NKSA 1S3EA 3BNMA 3QVPA 3EANA 1ELIA 3C96A 3H8LA 2Q0KA 3WE0A 1DXLA 2ZBWA 2JK6A 2B9WA 2C65A 1BKWA 4U8OA 4K5RA 3BI5A 4G9KA 5KXJA 1D4CA 3AE8A 3NRNA 3NIXA 2B7SA 4GCMA 1GRGA 4AT0A 5U63A 4N9XA 3GWDA 5CQFA 3SFEA 1H86A 3RNMA 5HYMA 1BWCA 1D5TA 4K8DA 2TPRA 1OJTA 2GQWA 4DNAA 1LQTA 1OJ9A 2FBWA 1BF3A 1H83A 1IUSA 4U8LA 3O0HA 1PJ7A 2C75A 1GREA 4ADWA 3UTGA 1B4VA 2UZZA 3PG6A 1COYA 2GB0A 2Q7VA 3ALLA 4JNQA 3UP4A 5EB4A 4Z2TA 2A87A 1TDEA 4HA6A 5GRTA 3NYFA 4A9WA 2DKIA 2XFUA 1DOCA 3AE7A 4G6HA 5FS7A 3UKKA 4IA6A 1MO9A 3RP8A 3II4A 5CKUA 3CIRA 2JBVA 3BHFA 4FK1A 3UKPA 2W0HA 4JQ9A 3CTYA 4K5SA 1AOGA 4AP1A 2YR4A 5BRTA 3T2YA 2E1MA 3T31A 2X8GA 3BI4A 3ISHA 2R45A 3NTAA 4CNKA 4H4QA 1E39A 1FECA 4YSHA 5BULA 1E1NA 1HYUA 5JRBA 3CN8A 4A99A 3C4AA 3DGHA 1CC6A 1EL5A 1L9DA 3NK0X 2BC0A 1CC2A 3I6DA 3QFBA 4M52A 4IVOB 1ONFA 1VRQB 1F8SA 3GDPA 2JB1A 4AP3A 4D04A 3QJ4A 3CGDA 5KVIA 1H7XA 5IQ4A 1IUVA 4X9NA 3P4SA 1GRAA 2XLTA 3FPZA 4OPTA 4UDPA 3DJGX 3UP5A 4C3YA 1CJ2A 2BRYA 2YR6A 4FK1C 4CY6A 4H2RA 1NHPA 1N4UA 4Z2UA 1FEBA 1X31B 2R4JA 3COXA 4JY3A 2EQ9A 4U2TA 2GQFA 2BK4A 3AEGA 3SZ0A 4WX1A 1L9CA 1ZMCA 5FMHA 1CF3A 4D03A 4APNA 4U2LA 1ZOVA 3CNTA 4Y4LA 1PXAA 3Q9TA 4Y4NA 2ZZ0A 5KRQA 1NG3A 2WBAA 1PXCA 4J36A 5JCKA 1QO8A 4Z25A 3T14A 1CC4A 4X9MA 3KD9A 2WU5A 1K0JA 2B9YA 4IVMB 3RP6A 1RP0A 2XLRA 4WCTA 1VQWA 1GT8A 2YLTA 2RGHA 2XYOA 3C4NA 3FBSA 3VRAA 2WOVA 2B9XA 4BK1A 1O94A 1KNPA 3LJPA 1KDGA 4G74A 4YTMA 2GMHA 1B8SA 2ACZA 3D1CA 3DGZA 4EM4A 2YG6A 2YLWA 3UTHA 3D9XA 2Z5XA 4H4ZA 2XFOA 2VVLA 1ZX9A 3P4PA 2FJBA 4EIQA 4ZCDA 2A8XA 2VOUA 3P4QA 5C2TA 3V3OA 3P4RA 1XANA 4GUVA 1JNRA 4OVIA 3LOVA 2FJDA 4A6NA 1FOHA 1KFYA 3CNPA 4Y4MA 2YLRA 1LJ1A 1VG9A 4XWZA 1GERA 2V5ZA 3G5SA 4DSGA 2RGOA 3PO7A 4H4XA 5FS6A 3SYIA 5FS9A 2XCGA 4B67A 1F8RA 4NEWA 1JRXA 1EL9A 2Y6QA 2QCUA 3DMEA 4JY2A 1GPEA 2YVJA 2RGJA 2GR0A 4J56A 4PABA 3T2KA 4NWZA 2C3CA 1IUUA 4OPDA 4CCQA 4Z2RA 3ZDNA 1PHHA 2TMDA 4B69A 1JOAA 1YQZA 2GR3A 2Y6RA 4UP3A 4YKGA 3CNJA 1REOA 1H82A 3BI2A 3OZ2A 2YM1A 4JNAA 3GDNA 1DJNA 2C73A 2WHDA 1PDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GR1 A;  2X50 A;  1PBC A;  3UKL A;  1GAL A;  5HY5 A;  1O95 A;  4LA1 A;  4BJY A;  1BGN A;  1KSS A;  2JKC A;  3AE2 A;  1H6V A;  1Y56 A;  3UKH A;  3GD3 A;  4I59 A;  1LTX R;  1N4V A;  1K0L A;  3GMB A;  4DSH A;  4YSX A;  2H88 A;  3ICT A;  4C77 A;  4YSZ A;  1D7L A;  3K7T A;  4GDE A;  2YLZ A;  4YWO A;  2WDV A;  3S5W A;  4H7U A;  4LU6 A;  1CJ3 A;  2Q0L A;  2XFN A;  1D4E A;  3DK8 A;  4A6N B;  3AYL A;  1S3B A;  4IV9 A;  2OAM A;  2C7G A;  1TDN A;  2XDO A;  1RYI A;  5U1O A;  1GXF A;  1NAA A;  3GMC A;  4TM3 A;  1RSG A;  4U8M A;  3GRT A;  4ZCC A;  5J7X A;  4A5L A;  3NH3 X;  4OPC A;  3BHK A;  1XDI A;  5JCN A;  2RAB A;  4A79 A;  3UKA A;  1GEU A;  2NVK X;  2R0G A;  1K0I A;  3KLJ A;  3R9U A;  4OPU A;  5M10 A;  2YAU A;  2WET A;  1NG4 A;  2BS2 A;  1GRH A;  1F8W A;  2WEU A;  3G5R A;  3NGC X;  2XLP A;  4PAA A;  2R0C A;  3DA1 A;  5IPY A;  1N1P A;  2ARD A;  4XWR A;  3VR8 A;  4C74 A;  1E1K A;  3G5Q A;  1EL7 A;  3NK1 X;  4YXD A;  3URH A;  4H4R A;  1CJC A;  4NTC A;  4U8P A;  2A89 A;  4USR A;  2FJE A;  3DJD A;  3F8D A;  4J31 A;  4H4V A;  3UKF A;  4I58 A;  3UOX A;  1NEN A;  2C64 A;  4C3X A;  1PBB A;  3AEC A;  1PJ6 A;  1Y56 B;  3PVC A;  4BV6 A;  2BCP A;  4JN9 A;  2R46 A;  3IHM A;  5HXI A;  3DH9 A;  2XVH A;  1GRB A;  3ATR A;  2GV8 A;  2BS4 A;  3CPI G;  4K2X A;  4EQS A;  4Z43 A;  1CBO A;  2AR8 A;  2OLO A;  4FX9 A;  4U8K A;  3QVR A;  1PBF A;  1CL0 A;  4TM0 A;  2BCG G;  1XPQ A;  3KPF A;  1Q9I A;  3FMW A;  2QAE A;  1NHR A;  3CGB A;  1FCD A;  2OA1 A;  1E6E A;  3JSK A;  4B68 A;  3VRB A;  3LZW A;  1NDA A;  1NHS A;  1KNR A;  1IUT A;  1GSN A;  3AWI A;  3UOY A;  1ZY8 A;  1E1L A;  2BXR A;  3ZYX A;  3D8X A;  1PN0 A;  2EQ7 A;  3P9U A;  5C3J A;  1KF6 A;  2JAE A;  2WP5 A;  1GV4 A;  1ZDL A;  1N4W A;  2CUL A;  3KKJ A;  4J33 A;  3RP7 A;  1PS9 A;  3V76 A;  4TM1 A;  2GRT A;  3VR9 A;  2JB3 A;  4CRT A;  4BUR A;  2GEW A;  2VZ2 A;  1B37 A;  2YWL A;  1E7P A;  1YQ4 A;  3P1W A;  1P2E A;  2I0Z A;  3ALM A;  3M0O A;  4H2Q A;  4B1B A;  4P9S A;  3OC4 A;  4H4P A;  5ER0 A;  2BK3 A;  3K30 A;  3NK2 X;  3NN6 X;  3NYC A;  2ZZC A;  4BK3 A;  1JNZ A;  2WU2 A;  2IVE A;  2V61 A;  3ADA B;  3H4K A;  3DJJ A;  2B7R A;  1XHC A;  2WPE A;  2YLX A;  4HB9 A;  3RHA A;  1LV0 A;  2V3A A;  2WES A;  4XXG A;  4IA5 A;  1PJ5 A;  2YLS A;  1NPX A;  2C70 A;  5LV9 A;  4AOS A;  4CCR A;  3LZX A;  1VG0 A;  2XFQ A;  2JB2 A;  4H50 A;  2VQ7 A;  3IWA A;  5EOW A;  2WDR A;  2EQ8 A;  4NZH A;  2X99 A;  2BA9 A;  3SM8 A;  3HZL A;  3SQP A;  3GSI A;  3DK4 A;  2GVC A;  3NTD A;  3M13 A;  4U2S A;  1D7Y A;  1S2Y A;  4RG4 A;  3RED A;  1EL8 A;  1L9E A;  1F3P A;  2WPF A;  2YG7 A;  1D4D A;  3AD9 B;  4KPR A;  2DKH A;  1SEZ A;  4OPL A;  4Z44 A;  5KVH A;  2WOI A;  2WDQ A;  5KWF A;  1BZL A;  4TLZ A;  2NPX A;  1CHU A;  1GTE A;  4UDQ A;  3UOZ A;  1GND A;  1GTH A;  3AE4 A;  3EPT A;  2XVI A;  5KOX A;  2GH5 A;  1GES A;  2VRM A;  1YKJ A;  3AEF A;  1M6I A;  2F5Z A;  2J3N A;  2R9Z A;  2E5V A;  4H2P A;  1QJD A;  3AYJ A;  3CPH G;  3F8R A;  2YG4 A;  3H8I A;  1IUW A;  3LB8 A;  1ZP0 A;  5IQ1 A;  2R4E A;  4Z26 A;  2EQ6 A;  4TM4 A;  2BS3 A;  3GD4 A;  1H81 A;  1Q1W A;  4H4W A;  1V59 A;  1TDO A;  1ZOY A;  3NNE A;  3AE1 A;  4EIP A;  2V6O A;  2YR5 A;  4AOX A;  3CND A;  4ECH A;  4CBQ A;  2BAB A;  2GMJ A;  1DOE A;  1ZKQ A;  3CGE A;  3CNS A;  4J57 A;  4DGK A;  2CVJ A;  3NHO X;  2C3D A;  1ZK7 A;  5JCI A;  1TYP A;  5M0Z A;  3T37 A;  1H7W A;  2BK5 A;  2CDU A;  3K7Q X;  1TDK A;  4B64 A;  3AED A;  1DOB A;  2O9Z A;  5EB5 A;  1LVL A;  1CJ4 A;  2VVM A;  1YQ3 A;  1K4Q A;  2PYX A;  3AD8 B;  1KSU A;  2WQY A;  3E1T A;  5TR3 A;  1MOK A;  3CGC A;  2GAG B;  2FJA A;  3S61 A;  1VDC A;  4K22 A;  3L1R A;  2YG3 A;  1PBE A;  2GF3 A;  1PXB A;  1P2H A;  3AD7 B;  4B65 A;  3IF9 A;  2BAC A;  3I3L A;  2GAH B;  2AAQ A;  1O5W A;  1YY5 A;  4CY8 A;  3AE6 A;  2X8H A;  1E1M A;  3AE3 A;  5U25 A;  4Z24 A;  4KX6 A;  1NEK A;  2PHH A;  1JEH A;  3BNU A;  3LAD A;  3QSE A;  4O5U A;  3UOV A;  3EF6 A;  5HHF A;  3FIM B;  3NN0 X;  4EQW A;  2H89 A;  4GR1 A;  2V3B A;  2WS3 A;  4EQR A;  4USQ A;  3QSM A;  5JCM A;  2Q6U A;  2BYB A;  4FDC B;  2YG5 A;  2ZZB A;  2AQJ A;  2BC1 A;  3L8K A;  4CNJ A;  1ZMD A;  2CFY A;  3SFD A;  1H84 A;  4UDR A;  4GDP A;  2C72 A;  4OPG A;  3GWF A;  4ZN0 A;  5DBJ A;  4RSL A;  3ALJ A;  3QFA A;  4O5Q A;  4MJW A;  3KU9 A;  1M64 A;  4U8J A;  3AXB A;  2XVJ A;  2QA1 A;  4H4Y A;  2BXS A;  1L0V A;  4H4U A;  2E4G A;  2IVD A;  1JRY A;  4GRT A;  2YVG A;  4YTN A;  5BVA A;  2YVF A;  1Y0P A;  4YKF A;  3PS9 A;  4EMW A;  3VQR A;  1TYT A;  1LQU A;  3K7M X;  3DJE A;  1W4X A;  3V3N A;  4LII A;  4E0V A;  4YSY A;  4YTP A;  3UCL A;  2WP6 A;  1Q1R A;  2C67 A;  2OAL A;  4K7Z A;  3GYI A;  4B66 A;  3IHG A;  1BGJ A;  3NLC A;  3DK9 A;  3Q6J A;  4EMI A;  3F8P A;  3UKQ A;  2XVF A;  3AB1 A;  3AEB A;  3KVE A;  4B63 A;  5J60 A;  2APG A;  1DOD A;  4NTD A;  1F6M A;  2YQU A;  2OLN A;  2V60 A;  4BK2 A;  4YT0 A;  3AEA A;  4NEV A;  2QA2 A;  4C5O A;  2HQM A;  2X3N A;  4GF7 A;  3VRD B;  4EMJ A;  1OJA A;  3QSS A;  3B3R A;  1NHQ A;  3B6D A;  3AE5 A;  4X4J A;  3GYJ A;  2X8C A;  1FEA A;  4J2W A;  3FG2 P;  3NT6 A;  3EAO A;  2WPC A;  3LXD A;  2Z5Y A;  5FS8 A;  1S2Q A;  4H4S A;  1GET A;  1OJD A;  4OPI A;  4ICY A;  2VQB A;  4AT2 A;  2XVE A;  1Z6L A;  1JU2 A;  4A65 A;  4J34 A;  4JDR A;  3ATQ A;  1TRB A;  2XLS A;  1TDF A;  3ITJ A;  4H4T A;  5EBK A;  5JCL A;  1FL2 A;  2C66 A;  3NYE A;  4OCG A;  3UTE A;  4BJZ A;  3ABV A;  1B5Q A;  2IID A;  3AE9 A;  4EM3 A;  5GSN A;  4H2N A;  2XFP A;  4TLX A;  2YM2 A;  3GRS A;  1EBD A;  2B76 A;  4NTE A;  5L46 A;  1IUX A;  2C76 A;  1GOS A;  3M12 A;  2R0P A;  2VVL G;  3AEE A;  3CPJ G;  2VRL A;  4RG3 A;  3IC9 A;  1DNC A;  3KA7 A;  4U8I A;  1MXT A;  2XLU A;  3AYI A;  1DJQ A;  4REK A;  3ICR A;  1UKV G;  3NG7 X;  1GRF A;  4EQX A;  1OJC A;  3SGL A;  2GR2 A;  4U8N A;  2WOW A;  2WP9 A;  1GRT A;  1LPF A;  1PBD A;  5BUK A;  1IJH A;  1JRZ A;  1QLB A;  5KOW A;  3ICS A;  3UTF A;  4A7A A;  3NKS A;  1S3E A;  3BNM A;  3QVP A;  3EAN A;  1ELI A;  3C96 A;  3H8L A;  2Q0K A;  3WE0 A;  1DXL A;  2ZBW A;  2JK6 A;  2B9W A;  2C65 A;  1BKW A;  4U8O A;  4K5R A;  3BI5 A;  5KXJ A;  1D4C A;  3AE8 A;  3NRN A;  3NIX A;  2B7S A;  4GCM A;  1GRG A;  4AT0 A;  5U63 A;  4N9X A;  3GWD A;  5CQF A;  3SFE A;  1H86 A;  3RNM A;  5HYM A;  1BWC A;  1D5T A;  4K8D A;  2TPR A;  1OJT A;  2GQW A;  4DNA A;  1LQT A;  1OJ9 A;  2FBW A;  1BF3 A;  1H83 A;  1IUS A;  4U8L A;  3O0H A;  1PJ7 A;  2C75 A;  1GRE A;  4ADW A;  3UTG A;  1B4V A;  2UZZ A;  3ALL A;  1COY A;  2GB0 A;  2Q7V A;  3UP4 A;  4JNQ A;  4Z2T A;  5EB4 A;  2A87 A;  1TDE A;  4HA6 A;  5GRT A;  3NYF A;  4A9W A;  2DKI A;  2XFU A;  1DOC A;  3AE7 A;  5FS7 A;  3UKK A;  4IA6 A;  1MO9 A;  3RP8 A;  3II4 A;  5CKU A;  3CIR A;  2JBV A;  3BHF A;  4FK1 A;  3UKP A;  2W0H A;  4JQ9 A;  3CTY A;  4K5S A;  1AOG A;  4AP1 A;  2YR4 A;  5BRT A;  2E1M A;  4CNK A;  2X8G A;  3BI4 A;  3ISH A;  2R45 A;  3NTA A;  4H4Q A;  1E39 A;  1FEC A;  4YSH A;  5BUL A;  1E1N A;  1HYU A;  3CN8 A;  4A99 A;  3C4A A;  3DGH A;  1CC6 A;  1EL5 A;  1L9D A;  3NK0 X;  2BC0 A;  1CC2 A;  3I6D A;  3QFB A;  4M52 A;  4IVO B;  1ONF A;  1VRQ B;  1F8S A;  3GDP A;  2JB1 A;  4AP3 A;  4D04 A;  3QJ4 A;  3CGD A;  5KVI A;  1H7X A;  5IQ4 A;  1IUV A;  4X9N A;  3P4S A;  1GRA A;  2XLT A;  3FPZ A;  4OPT A;  4UDP A;  3DJG X;  3UP5 A;  4C3Y A;  1CJ2 A;  2YR6 A;  4FK1 C;  4CY6 A;  4H2R A;  1NHP A;  1N4U A;  4Z2U A;  1FEB A;  1X31 B;  2R4J A;  3COX A;  4JY3 A;  2EQ9 A;  4U2T A;  2GQF A;  2BK4 A;  3AEG A;  4WX1 A;  1L9C A;  1ZMC A;  5FMH A;  1CF3 A;  4D03 A;  4APN A;  4U2L A;  1ZOV A;  3CNT A;  4Y4L A;  1PXA A;  3Q9T A;  4Y4N A;  2ZZ0 A;  5KRQ A;  1NG3 A;  2WBA A;  1PXC A;  4J36 A;  5JCK A;  1QO8 A;  4Z25 A;  1CC4 A;  4X9M A;  3KD9 A;  2WU5 A;  1K0J A;  2B9Y A;  4IVM B;  3RP6 A;  1RP0 A;  2XLR A;  4WCT A;  1VQW A;  1GT8 A;  2YLT A;  2RGH A;  2XYO A;  3C4N A;  3FBS A;  3VRA A;  2WOV A;  2B9X A;  4BK1 A;  1O94 A;  1KNP A;  3LJP A;  1KDG A;  4YTM A;  2GMH A;  1B8S A;  2ACZ A;  3D1C A;  3DGZ A;  4EM4 A;  2YG6 A;  2YLW A;  3UTH A;  2Z5X A;  4H4Z A;  2XFO A;  2VVL A;  1ZX9 A;  3P4P A;  2FJB A;  4EIQ A;  4ZCD A;  2A8X A;  2VOU A;  3P4Q A;  5C2T A;  3V3O A;  3P4R A;  1XAN A;  4GUV A;  1JNR A;  4OVI A;  3LOV A;  2FJD A;  4A6N A;  1FOH A;  1KFY A;  3CNP A;  4Y4M A;  2YLR A;  1LJ1 A;  1VG9 A;  4XWZ A;  1GER A;  2V5Z A;  3G5S A;  4DSG A;  2RGO A;  3PO7 A;  4H4X A;  5FS6 A;  5FS9 A;  2XCG A;  4B67 A;  1F8R A;  4NEW A;  1JRX A;  1EL9 A;  2Y6Q A;  2QCU A;  3DME A;  4JY2 A;  1GPE A;  2YVJ A;  2RGJ A;  2GR0 A;  4J56 A;  4PAB A;  2C3C A;  1IUU A;  4OPD A;  4CCQ A;  4Z2R A;  3ZDN A;  1PHH A;  2TMD A;  4B69 A;  1JOA A;  1YQZ A;  2GR3 A;  2Y6R A;  4UP3 A;  4YKG A;  3CNJ A;  1REO A;  1H82 A;  3BI2 A;  3OZ2 A;  2YM1 A;  4JNA A;  3GDN A;  1DJN A;  2C73 A;  2WHD A;  1PDH A; 
#chains in the Genus database with same CATH topology
 3K1G A;  4LA1 A;  1BGN A;  5FJO A;  2ZC8 A;  3GMB A;  3QN3 A;  1D7L A;  4YWO A;  2GGG A;  1CJ3 A;  2XFN A;  1D4E A;  4A6N B;  2OAM A;  2C7G A;  2I5Q A;  1GXF A;  1RVK A;  2GDQ A;  3UKA A;  2R0G A;  3PFR A;  4E4U A;  2WET A;  4II3 A;  2P0I A;  2R0C A;  3DA1 A;  5IPY A;  1N1P A;  3VR8 A;  4C74 A;  3SJN A;  1EL7 A;  3SN1 A;  1CJC A;  3MY9 A;  4USR A;  3DJD A;  3F8D A;  1NEN A;  3AEC A;  1Y56 B;  3NVY B;  4JN9 A;  3U9I A;  4H1Z A;  4Z43 A;  2AR8 A;  1CL0 A;  1XPQ A;  3FMW A;  1NHR A;  1MDL A;  1NHS A;  1E1L A;  3D8X A;  3A7R A;  1KF6 A;  2WP5 A;  1N4W A;  4K1W A;  3RP7 A;  2GRT A;  3SZC A;  2GEW A;  1B37 A;  2XH2 A;  2I0Z A;  4P9S A;  2BK3 A;  4H4P A;  4BK3 A;  3RR1 A;  3ADA B;  2YLX A;  4HB9 A;  4IA5 A;  1PJ5 A;  1NPX A;  2C70 A;  1VG0 A;  2XFQ A;  3IWA A;  3SBF A;  4NZH A;  2FYM A;  2OFJ A;  2OQH A;  3GSI A;  2GVC A;  3UJR A;  3ZVH B;  3CMM A;  3HW2 A;  1SEZ A;  4OPL A;  4Z44 A;  5KVH A;  5KWF A;  4TLZ A;  1CHU A;  4KT2 A;  1GND A;  1DTN A;  2P88 A;  3EKG A;  3ZVI A;  3AE4 A;  2HXU A;  3CT2 A;  2GH5 A;  1GES A;  2F5Z A;  2R9Z A;  1QJD A;  3AYJ A;  3LB8 A;  1ZP0 A;  2EQ6 A;  4TM4 A;  3DG6 A;  2BS3 A;  1H81 A;  4H4W A;  2O56 A;  2V6O A;  3CND A;  4ECH A;  2GMJ A;  4MMW A;  1WUE A;  3TJI A;  3VCN A;  2PS2 A;  1ZK7 A;  1H7W A;  1P48 A;  3K7Q X;  3SY4 A;  3KUM A;  1K4Q A;  3GY1 A;  2GAG B;  1MOK A;  2FJA A;  3UCC A;  5J04 A;  3UCD A;  3L1R A;  1SJA A;  1O5W A;  1YY5 A;  2X8H A;  3AE3 A;  1NEK A;  1JEH A;  2OKT A;  3I6E A;  3FIM B;  3NN0 X;  4GIR A;  3DES A;  4USQ A;  5JCM A;  2YG5 A;  4CNJ A;  1ZMD A;  4OPG A;  4ZN0 A;  4O5Q A;  4MJW A;  3KU9 A;  1M64 A;  3AXB A;  2IVD A;  1JRY A;  3VA8 A;  4YKF A;  3VQR A;  1W4X A;  4LII A;  2OG9 A;  5FJP A;  2WP6 A;  2PU0 A;  2AKZ A;  3GYI A;  3HRD C;  4GME A;  4EMI A;  3AB1 A;  3KVE A;  5J60 A;  2OLN A;  2V60 A;  4C5O A;  2X3N A;  4EMJ A;  1XS2 A;  3B3R A;  3D46 A;  4J2W A;  5G5G B;  3FG2 P;  2XH7 A;  3EAO A;  3NFU A;  1S2Q A;  4OPI A;  2HNE A;  4A65 A;  4DHG A;  1TDF A;  3ITJ A;  5JCL A;  5EBK A;  1B5Q A;  1FHU A;  2XFP A;  3QLD A;  2P8B A;  1IUX A;  1JDF A;  2C76 A;  2VVL G;  3CPJ G;  2VRL A;  2W55 A;  3AYI A;  1UKV G;  3SGL A;  2PP3 A;  2WP9 A;  1IJH A;  1QLB A;  3UTF A;  4Z1Y A;  2POD A;  2Q0K A;  3TWB A;  3SQS A;  2C65 A;  1D4C A;  1GRG A;  4N9X A;  5CQF A;  3DER A;  2GQW A;  5G5H B;  4DNA A;  1LQT A;  1GRE A;  1B4V A;  1COY A;  4Z2T A;  5FJR A;  2A87 A;  1TDE A;  2MUC A;  2DKI A;  1MO9 A;  3CIR A;  2W0H A;  3CTY A;  3NTA A;  3BI4 A;  1FEC A;  4YSH A;  5JRB A;  3C4A A;  1CC6 A;  3NVW B;  3NVZ B;  3OP2 A;  2W3R A;  3BSM A;  3PWI A;  4IVO B;  3QJ4 A;  5KVI A;  4M0X A;  1IUV A;  4X9N A;  1CJ2 A;  2OQY A;  2BRY A;  4DX3 A;  1NHP A;  1FEB A;  1X31 B;  4U2T A;  3AEG A;  4WX1 A;  1L9C A;  1ZMC A;  1CF3 A;  2QVH A;  4APN A;  4U2L A;  3Q4D A;  2W54 A;  4J36 A;  4Z25 A;  2XLR A;  2YLT A;  2XYO A;  3TW9 A;  3C4N A;  3GO2 A;  3LJP A;  4YTM A;  1B8S A;  4EM4 A;  2YLW A;  2AL2 B;  1ZX9 A;  1STZ A;  2FJB A;  3P4R A;  4A6G A;  4ROP A;  4A6N A;  4MGG A;  3CNP A;  3SN0 A;  2YLR A;  4XWZ A;  1GER A;  3G5S A;  3AN1 A;  1F8R A;  4NEW A;  1IYX A;  1EL9 A;  4JY2 A;  2GR0 A;  4J56 A;  3T2K A;  4NWZ A;  1IUU A;  2TMD A;  4B69 A;  1JOA A;  2Y6R A;  3CNJ A;  2OZ8 A;  3BI2 A;  3OZ2 A;  1DJN A;  3JVA A;  2PGW A;  2GR1 A;  2X50 A;  1PBC A;  1GAL A;  1O95 A;  2XSX A;  3N6H A;  4BJY A;  1KSS A;  1Y56 A;  3N6J A;  1KKO A;  1N4V A;  1MRA A;  1K0L A;  4C77 A;  4YSZ A;  2YLZ A;  4YWS A;  4H7U A;  2Q0L A;  3DK8 A;  1S3B A;  4IV9 A;  1ECQ A;  1V97 A;  4IP5 A;  2XDO A;  4TM3 A;  1NAA A;  3GMC A;  4U8M A;  4A5L A;  4A79 A;  2RAB A;  3OZM A;  3MZN A;  1GEU A;  1H2I A;  3DGB A;  1NG4 A;  1F8W A;  2GGI A;  1EC8 A;  2OVL A;  2XLP A;  4PAA A;  3G5Q A;  2PCE A;  3NK1 X;  4YXD A;  3URH A;  2A89 A;  3VCC A;  3UKF A;  3UOX A;  4G6G A;  4C3X A;  3S47 A;  2BCP A;  3IHM A;  2XVH A;  2BS4 A;  3CPI G;  3SSZ A;  2PGE A;  4EQS A;  4H2H A;  3TJ4 A;  3QVR A;  2QAE A;  3EEZ A;  3UJS A;  3JSK A;  1NDA A;  4J3Z A;  3UOY A;  3ZYX A;  1PN0 A;  3P9U A;  2JAE A;  3KKJ A;  1ZDL A;  2CUL A;  4DN1 A;  3VR9 A;  2XH4 A;  1E7P A;  1YQ4 A;  3P1W A;  3M0O A;  4KPL A;  3RGT A;  3VDG A;  3K30 A;  3D47 A;  3NYC A;  2ZZC A;  4GGB A;  2OZ3 A;  3DFH A;  2WU2 A;  3DJJ A;  2B7R A;  1XHC A;  2WPE A;  2MNR A;  3PK7 A;  5LV9 A;  1N5W C;  3OZY A;  3LZX A;  2EQ8 A;  3HZL A;  3SQP A;  4U2S A;  3Q45 A;  4H83 A;  1PDZ A;  2YG7 A;  1D4D A;  3DDM A;  2PU1 A;  1BZL A;  2NPX A;  1GTE A;  2POZ A;  3DIP A;  4GAV A;  4ZCW A;  3T2Z A;  5KOX A;  3AEF A;  2E5V A;  2J3N A;  3CPH G;  3F8R A;  5BOF A;  4KEM A;  2QJM A;  4NNJ A;  1E9I A;  1W6T A;  1ZOY A;  3IJL A;  3P93 A;  4M6U A;  2YR5 A;  2OZT A;  5KMS A;  3VC5 A;  1ZKQ A;  3CNS A;  4DGK A;  2C3D A;  3T37 A;  2CDU A;  1TDK A;  4B64 A;  5KMP A;  1YEY A;  5EB5 A;  3SX6 A;  1CJ4 A;  2PYX A;  1KSU A;  1KN0 A;  3E1T A;  2DW6 A;  3B97 A;  3S61 A;  2YG3 A;  3AD7 B;  4B65 A;  3IF9 A;  3I3L A;  3UOV A;  3BNU A;  3QSE A;  5HHF A;  2V3B A;  1S7M A;  2BYB A;  3MKC A;  4UDR A;  4U8J A;  2XVJ A;  2QA1 A;  2BXS A;  2E4G A;  3L5O A;  4GRT A;  2PTX A;  3T8Q A;  1LQU A;  3DJE A;  3V3N A;  4E0V A;  4YTP A;  3UCL A;  1Q1R A;  4B66 A;  3NLC A;  3DK9 A;  2XVF A;  3R1Z A;  4B63 A;  2APG A;  3NRZ B;  4NTD A;  4YT0 A;  3NO1 A;  2QA2 A;  4GF7 A;  3QSS A;  1NHQ A;  4X4J A;  3AE5 A;  3R0K A;  2Z5Y A;  1N5X A;  1OJD A;  4ICY A;  1Z6L A;  1JU2 A;  3I6T A;  4J34 A;  3ATQ A;  2XLS A;  4GIS A;  2C66 A;  3NYE A;  5GSN A;  3GRS A;  1EBD A;  2B76 A;  4NTE A;  3TOY A;  1FFU C;  3M12 A;  4GGH A;  1MXT A;  4G73 A;  1DJQ A;  4E5T A;  3ICR A;  3NG7 X;  1GRF A;  1N60 C;  2GR2 A;  3R10 A;  1GRT A;  3H8A A;  1JRZ A;  3ICS A;  3NKS A;  1MNS A;  1EBH A;  2JK6 A;  1BKW A;  4G9K A;  3P0W A;  3AE8 A;  3NRN A;  2GGH A;  5U63 A;  3SN4 A;  3THU A;  2CHR A;  3SFE A;  1H86 A;  3RNM A;  5HYM A;  1BQG A;  4KWS A;  4U8L A;  3PWG A;  3UP4 A;  4JNQ A;  1L8P A;  1VQZ A;  5GRT A;  2NQL A;  3NYF A;  4A9W A;  1DOC A;  5FS7 A;  2JBV A;  3UKP A;  5BRT A;  4ZOH B;  3ISH A;  3NS1 B;  2R45 A;  5BUL A;  3CN8 A;  1EL5 A;  1L9D A;  2BC0 A;  1CC2 A;  5ENL A;  4DXK A;  1JRP A;  3I6D A;  3QFB A;  1ONF A;  1F8S A;  2AL2 A;  2JB1 A;  4D04 A;  1H7X A;  3P4S A;  2XLT A;  3FPZ A;  3U4F A;  2YR6 A;  4Z2U A;  3CYJ A;  3SZ0 A;  3FYY A;  3RCY A;  4F4R A;  4IZG A;  3QKE A;  5IDZ A;  3TQP A;  5KRQ A;  1PXC A;  4HNL A;  1CC4 A;  1SJB A;  4WCT A;  1KNP A;  2AKM A;  2ACZ A;  3UTH A;  4IL0 A;  2XFO A;  2VOU A;  4GUV A;  3LOV A;  1FOH A;  3JZU A;  1VG9 A;  2RGO A;  5FJT A;  3PO7 A;  5FS6 A;  3SYI A;  1T3Q C;  2QCU A;  3V4B A;  2GR3 A;  4UP3 A;  1REO A;  4JNA A;  3UKL A;  1WUF A;  3V3W A;  2BRA A;  3UKH A;  3GD3 A;  4DSH A;  2H88 A;  5KMQ A;  1JPM A;  3S5W A;  3AYL A;  1TDN A;  4AP3 A;  1RYI A;  5U1O A;  2C4C A;  4ZCC A;  4FP1 A;  3NH3 X;  3BHK A;  1BKH A;  3KLJ A;  4OPU A;  2GL5 A;  2BS2 A;  1GRH A;  1R0M A;  2WEU A;  3G5R A;  3NGC X;  2ARD A;  3SR6 B;  3S5S A;  3B9J B;  2FJE A;  4J31 A;  4I58 A;  2C64 A;  4TVW A;  3PVC A;  1FIQ B;  3TWA A;  1TZZ A;  3DH9 A;  3ATR A;  1GRB A;  3DFY A;  4HN8 A;  2GV8 A;  1RM6 B;  1JRO A;  4U8K A;  3KPF A;  2W3S A;  3QPE A;  3CGB A;  2OA1 A;  3VRB A;  3CB3 A;  3SXI A;  3LZW A;  1KNR A;  3UXL A;  1GSN A;  1IUT A;  1ZY8 A;  2BXR A;  3ZLH A;  2EQ7 A;  5C3J A;  1GV4 A;  1NEL A;  3V76 A;  2OX4 A;  3HYW A;  3ETR B;  4CRT A;  3GC2 A;  2YWL A;  5EU9 A;  3ALM A;  4B1B A;  5ER0 A;  3NN6 X;  3HYV A;  3NK2 X;  2HZG A;  1R6W A;  2V3A A;  1X2G A;  2WES A;  4HCL A;  3T6C A;  2YLS A;  2JB2 A;  2VQ7 A;  5EOW A;  2WDR A;  2X99 A;  3SM8 A;  3DK4 A;  3NTD A;  1EBG A;  1S2Y A;  4RG4 A;  1EL8 A;  2WPF A;  3EPT A;  3SZW A;  3FCP A;  1YKJ A;  3NXL A;  2R4E A;  4Z26 A;  3EUB 3;  3GD4 A;  1Q1W A;  1TDO A;  1V59 A;  3NNE A;  1EC9 A;  1XPY A;  4CBQ A;  2BAB A;  4JHM A;  4J57 A;  3UJE A;  2CVJ A;  3NHO X;  5M0Z A;  5JCI A;  1TYP A;  2BK5 A;  1VDV A;  1DOB A;  3JW7 A;  1YQ3 A;  3IJQ A;  3AD8 B;  2WQY A;  5TR3 A;  3CGC A;  4H19 A;  1MDR A;  1VDC A;  1PBE A;  2GF3 A;  1PXB A;  2FKP A;  2GAH B;  3MWC A;  4FI4 A;  3AE6 A;  1E1M A;  5U25 A;  2PHH A;  4O5U A;  2PTW A;  4EQW A;  2H89 A;  3BJS A;  2WS3 A;  4EQR A;  4FDC B;  5KMR A;  2AQJ A;  3L8K A;  2CFY A;  3SFD A;  1H84 A;  2C72 A;  3GWF A;  5DBJ A;  4A3R A;  2DW7 A;  3QFA A;  4DWD A;  4H4Y A;  4H4U A;  4YTN A;  3KPK A;  1Y0P A;  3PS9 A;  4EMW A;  3K7M X;  4YSY A;  2C67 A;  3F8P A;  4G7F A;  1FFV C;  4BK2 A;  3AEA A;  1NU5 A;  2HQM A;  3VRD B;  1OJA A;  7ENL A;  2X8C A;  3OW1 A;  1FEA A;  3NT6 A;  2WPC A;  3H7V A;  4H4S A;  2VQB A;  4AT2 A;  2QDE A;  1FL2 A;  3UTE A;  4OCG A;  4D03 A;  4EM3 A;  3NZG A;  3VC6 A;  4H2N A;  4TLX A;  4HCH A;  1GOS A;  2R0P A;  3AEE A;  4E8G A;  3KA7 A;  4EQX A;  2WOW A;  3IJI A;  3UJF A;  3A7A A;  4A7A A;  3DEQ A;  1S3E A;  3BNM A;  1P43 A;  3QVP A;  3EAN A;  1ELI A;  3C96 A;  3WE0 A;  5BOE A;  2ZBW A;  4MKS A;  4X2P A;  2B9W A;  3NIX A;  2B7S A;  4AT0 A;  1FO4 A;  3GWD A;  3H70 A;  4IHC A;  3MUC A;  1N61 C;  1OJT A;  1BF3 A;  4GYP A;  3O0H A;  2C75 A;  4ADW A;  2UZZ A;  2GB0 A;  2Q7V A;  4HA6 A;  4ZA0 A;  1JCT A;  2PSN A;  2XFU A;  1PDY A;  2QDD A;  3AMZ A;  3AE7 A;  3UKK A;  3II4 A;  3BOX A;  3BHF A;  4FK1 A;  3R07 C;  4JQ9 A;  4K5S A;  1AOG A;  4AP1 A;  3T31 A;  4CNK A;  2X8G A;  3FVD A;  4H4Q A;  1E39 A;  4GFI A;  1E1N A;  3VFC A;  3DGH A;  3NK0 X;  3AM9 A;  3MQT A;  1VRQ B;  5IQ4 A;  3CXB A;  3UP5 A;  3DJG X;  1JPD X;  1N4U A;  2R4J A;  4JY3 A;  2EQ9 A;  2BK4 A;  5FMH A;  3P3B A;  3FJ4 A;  4HNC A;  1ZOV A;  3CNT A;  4Y4L A;  2E5A A;  2GSH A;  2ZZ0 A;  1NG3 A;  4HCD A;  5JCK A;  3T14 A;  3KD9 A;  2WU5 A;  1GT8 A;  1ELS A;  3FBS A;  4TVY A;  1KDG A;  2GMH A;  3D1C A;  3DGZ A;  3D9X A;  2Z5X A;  3P4P A;  4ZCD A;  3V3O A;  4OVI A;  2FJD A;  1KFY A;  3OTR A;  4Y4M A;  6ENL A;  1LJ1 A;  3UJ2 A;  5FS9 A;  5HXI A;  3DME A;  1SB3 B;  1GPE A;  3UGV A;  2HXT A;  2RGJ A;  2E3T A;  4CCQ A;  3IK4 A;  4YKG A;  2YM1 A;  2FBW A;  5HY5 A;  2JKC A;  3AE2 A;  1H6V A;  4I59 A;  1LTX R;  4YSX A;  3ICT A;  3K7T A;  4GDE A;  2WDV A;  4LU6 A;  1RSG A;  2ONE A;  3GRT A;  5J7X A;  4OPC A;  1XDI A;  5JCN A;  3T4W A;  2NVK X;  3GD6 A;  1K0I A;  3R9U A;  5M10 A;  2YAU A;  4XWR A;  4E6M A;  1E1K A;  3ZLG A;  3DG3 A;  4H4R A;  4NTC A;  4U8P A;  5KNL A;  3V5F A;  4H4V A;  2QJJ A;  1PBB A;  5FJU A;  1PJ6 A;  4BV6 A;  1WYG A;  2R46 A;  3T0K A;  4EWJ A;  4K2X A;  3SZF A;  1ONE A;  1CBO A;  2OLO A;  4FX9 A;  1PBF A;  4TM0 A;  2BCG G;  1Q9I A;  1FCD A;  4JN8 A;  1E6E A;  4B68 A;  1F9C A;  3AWI A;  4K8G A;  3MSY A;  4J33 A;  1PS9 A;  4TM1 A;  3UXK A;  2JB3 A;  1TKK A;  4BUR A;  2VZ2 A;  1P2E A;  4H2Q A;  3OC4 A;  1EC7 A;  4A35 A;  1JNZ A;  2IVE A;  2V61 A;  3H4K A;  3RHA A;  1LV0 A;  4XXG A;  4AOS A;  4CCR A;  3NVV B;  4H50 A;  2BA9 A;  3DG7 A;  3M13 A;  1D7Y A;  3RED A;  1L9E A;  2PMQ A;  1F3P A;  3AD9 B;  4KPR A;  2DKH A;  3HYX A;  2WOI A;  2WDQ A;  4UDQ A;  3UOZ A;  1GTH A;  3RO6 A;  2XVI A;  3OPS A;  3R0U A;  2VRM A;  1M6I A;  4H2P A;  3R25 A;  2YG4 A;  3H8I A;  1IUW A;  3QTP A;  3ENL A;  5IQ1 A;  2PTZ A;  3H12 A;  3AE1 A;  4EIP A;  4AOX A;  1OEP A;  3V5C A;  1DOE A;  3HPF A;  3CGE A;  3AED A;  2O9Z A;  1LVL A;  2VVM A;  2PPG A;  3GYX A;  3RRA A;  3ES7 A;  4K22 A;  2OLA A;  1P2H A;  2BAC A;  2AAQ A;  4CY8 A;  4Z24 A;  4KX6 A;  2PA6 A;  3LAD A;  3EF6 A;  2QJN A;  4GR1 A;  3N4E A;  3QSM A;  2Q6U A;  1N63 C;  4GAP A;  2ZZB A;  2BC1 A;  4GDP A;  4RSL A;  2QGY A;  3ALJ A;  1TE6 A;  1L0V A;  3CK5 A;  2YVG A;  5BVA A;  2YVF A;  1TYT A;  2OAL A;  4K7Z A;  3IHG A;  1SJC A;  1BGJ A;  3Q6J A;  3UKQ A;  3AEB A;  3ES8 A;  2PP0 A;  2PP1 A;  1DOD A;  1F6M A;  2YQU A;  4NEV A;  3B6D A;  3GYJ A;  2P8C A;  3LXD A;  5FS8 A;  1GET A;  2XVE A;  3N4F A;  4JDR A;  4G8T A;  1TRB A;  4H4T A;  1KD0 A;  4BJZ A;  3ABV A;  3AE9 A;  2IID A;  1SJD A;  2YM2 A;  4HPN A;  5L46 A;  4II2 A;  3T9P A;  4RG3 A;  3IC9 A;  1DNC A;  4U8I A;  2XLU A;  4REK A;  1OJC A;  4U8N A;  1LPF A;  1PBD A;  5BUK A;  2GGE A;  2XH0 A;  5KOW A;  3A7U A;  3H8L A;  4ENL A;  3CAW A;  1DXL A;  2ZAD A;  4U8O A;  4K5R A;  1MUC A;  3BI5 A;  5KXJ A;  4GCM A;  1X2H A;  2QQ6 A;  1BWC A;  1D5T A;  4K8D A;  2TPR A;  1OJ9 A;  4JN7 A;  1H83 A;  1KCZ A;  1IUS A;  1PJ7 A;  3UTG A;  3PG6 A;  3ALL A;  3STP A;  5EB4 A;  4IT1 A;  3TTE A;  2AL1 A;  4G6H A;  4IA6 A;  3RP8 A;  3I4K A;  5CKU A;  4HYR A;  2YR4 A;  3T2Y A;  2E1M A;  4DYE A;  2OO6 A;  2RDX A;  1ZXI C;  1HYU A;  3CXO A;  4GYP C;  4A99 A;  4M52 A;  3GDP A;  3CGD A;  1GRA A;  4OPT A;  4UDP A;  4C3Y A;  2PTY A;  4FK1 C;  4CY6 A;  3TCS A;  4H2R A;  3COX A;  3ZVH A;  2GQF A;  2XGZ A;  1PXA A;  3Q9T A;  4Y4N A;  4E4F A;  2WBA A;  3FXG A;  1QO8 A;  4X9M A;  1K0J A;  2B9Y A;  2GGJ A;  4IVM B;  3RP6 A;  3RIT A;  1RP0 A;  3ZLF A;  1VQW A;  1N62 C;  2RGH A;  3VRA A;  2WOV A;  2B9X A;  4BK1 A;  1O94 A;  4G74 A;  3R11 A;  2OPJ A;  2YG6 A;  4H4Z A;  2VVL A;  1FHV A;  4EIQ A;  2A8X A;  3P4Q A;  1KKR A;  5C2T A;  1XAN A;  1JNR A;  2P3Z A;  4Z17 A;  3FV9 A;  4K2S A;  2V5Z A;  4DSG A;  4H4X A;  4B67 A;  2XCG A;  1JRX A;  2Y6Q A;  4IP4 A;  4J1O A;  2YVJ A;  4PAB A;  2C3C A;  4OPD A;  4Z2R A;  3ZDN A;  1PHH A;  4IL2 A;  1YQZ A;  1H82 A;  3GDN A;  2C73 A;  2WHD A;  1PDH A; 
#chains in the Genus database with same CATH homology
 2GR1 A;  2X50 A;  1PBC A;  3UKL A;  1GAL A;  5HY5 A;  1O95 A;  4LA1 A;  4BJY A;  1BGN A;  2BRA A;  1KSS A;  2JKC A;  3AE2 A;  1H6V A;  1Y56 A;  3UKH A;  3GD3 A;  4I59 A;  1LTX R;  1N4V A;  1K0L A;  3GMB A;  4DSH A;  4YSX A;  2H88 A;  3ICT A;  4C77 A;  4YSZ A;  5KMQ A;  1D7L A;  3K7T A;  4GDE A;  2YLZ A;  4YWO A;  2WDV A;  3S5W A;  4H7U A;  4LU6 A;  1CJ3 A;  2Q0L A;  2XFN A;  1D4E A;  3DK8 A;  4A6N B;  3AYL A;  1S3B A;  4IV9 A;  2OAM A;  2C7G A;  1TDN A;  2XDO A;  1RYI A;  5U1O A;  1GXF A;  1NAA A;  2C4C A;  3GMC A;  1RSG A;  4TM3 A;  3GRT A;  4U8M A;  4ZCC A;  5J7X A;  4A5L A;  3NH3 X;  4OPC A;  3BHK A;  1XDI A;  5JCN A;  2RAB A;  4A79 A;  3UKA A;  1GEU A;  2NVK X;  2R0G A;  1K0I A;  1H2I A;  3KLJ A;  3R9U A;  4OPU A;  5M10 A;  2YAU A;  2WET A;  1NG4 A;  2BS2 A;  1GRH A;  4II3 A;  1F8W A;  2WEU A;  3G5R A;  3NGC X;  2XLP A;  4PAA A;  2R0C A;  3DA1 A;  5IPY A;  1N1P A;  2ARD A;  4XWR A;  3VR8 A;  4C74 A;  1E1K A;  3G5Q A;  1EL7 A;  3NK1 X;  4YXD A;  3URH A;  4H4R A;  1CJC A;  4NTC A;  4U8P A;  2A89 A;  4USR A;  5KNL A;  2FJE A;  3DJD A;  3F8D A;  4J31 A;  4H4V A;  3UKF A;  4I58 A;  3UOX A;  4G6G A;  1NEN A;  2C64 A;  4C3X A;  1PBB A;  3AEC A;  1PJ6 A;  1Y56 B;  3PVC A;  4BV6 A;  2BCP A;  4JN9 A;  2R46 A;  3IHM A;  3T0K A;  3DH9 A;  5HXI A;  2XVH A;  1GRB A;  3ATR A;  2GV8 A;  2BS4 A;  3CPI G;  4K2X A;  4EQS A;  3SZF A;  4Z43 A;  1CBO A;  2AR8 A;  2OLO A;  4FX9 A;  4U8K A;  3QVR A;  1PBF A;  1CL0 A;  4TM0 A;  2BCG G;  1XPQ A;  3KPF A;  1Q9I A;  3FMW A;  2QAE A;  1NHR A;  3CGB A;  1FCD A;  2OA1 A;  1E6E A;  3JSK A;  4B68 A;  3VRB A;  3SXI A;  3LZW A;  1NDA A;  1NHS A;  1KNR A;  1IUT A;  1GSN A;  3AWI A;  3UOY A;  1ZY8 A;  1E1L A;  2BXR A;  3ZYX A;  3D8X A;  1PN0 A;  2EQ7 A;  3P9U A;  5C3J A;  1KF6 A;  2JAE A;  2WP5 A;  1GV4 A;  1ZDL A;  1N4W A;  2CUL A;  3KKJ A;  4J33 A;  3RP7 A;  1PS9 A;  3V76 A;  3HYW A;  2GRT A;  4TM1 A;  3SZC A;  3VR9 A;  2JB3 A;  4CRT A;  4BUR A;  2GEW A;  2VZ2 A;  1B37 A;  2YWL A;  1E7P A;  1YQ4 A;  3P1W A;  1P2E A;  2I0Z A;  3ALM A;  3M0O A;  4H2Q A;  4B1B A;  4P9S A;  3OC4 A;  4H4P A;  5ER0 A;  2BK3 A;  3HYV A;  3K30 A;  3NK2 X;  3NN6 X;  3NYC A;  2ZZC A;  4BK3 A;  1JNZ A;  2WU2 A;  2IVE A;  2V61 A;  3ADA B;  3H4K A;  3DJJ A;  2B7R A;  1XHC A;  2WPE A;  2YLX A;  4HB9 A;  3RHA A;  2V3A A;  1LV0 A;  2WES A;  4XXG A;  4IA5 A;  1PJ5 A;  2YLS A;  1NPX A;  2C70 A;  5LV9 A;  4AOS A;  4CCR A;  3LZX A;  1VG0 A;  2XFQ A;  2JB2 A;  4H50 A;  2VQ7 A;  3IWA A;  5EOW A;  2WDR A;  2EQ8 A;  4NZH A;  2X99 A;  2BA9 A;  3SM8 A;  3HZL A;  3SQP A;  3GSI A;  3DK4 A;  2GVC A;  3NTD A;  3M13 A;  4U2S A;  3CMM A;  1D7Y A;  1S2Y A;  4RG4 A;  3RED A;  1EL8 A;  1L9E A;  1F3P A;  2WPF A;  2YG7 A;  1D4D A;  3AD9 B;  4KPR A;  2DKH A;  1SEZ A;  4OPL A;  4Z44 A;  5KVH A;  2WOI A;  2WDQ A;  3HYX A;  1BZL A;  4TLZ A;  5KWF A;  2NPX A;  1CHU A;  1GTE A;  4UDQ A;  3UOZ A;  1GND A;  1GTH A;  3AE4 A;  4GAV A;  3EPT A;  3SZW A;  3T2Z A;  2XVI A;  5KOX A;  2GH5 A;  1GES A;  2VRM A;  1YKJ A;  3AEF A;  1M6I A;  2F5Z A;  2J3N A;  2R9Z A;  2E5V A;  4H2P A;  1QJD A;  3AYJ A;  3CPH G;  3F8R A;  2YG4 A;  3H8I A;  1IUW A;  3LB8 A;  1ZP0 A;  5IQ1 A;  2R4E A;  4Z26 A;  2EQ6 A;  4TM4 A;  4NNJ A;  2BS3 A;  3GD4 A;  1H81 A;  1Q1W A;  4H4W A;  1V59 A;  1TDO A;  1ZOY A;  3NNE A;  3AE1 A;  4EIP A;  2V6O A;  2YR5 A;  4AOX A;  3CND A;  4ECH A;  5KMS A;  4CBQ A;  2BAB A;  2GMJ A;  1DOE A;  1ZKQ A;  3CGE A;  3CNS A;  4J57 A;  4DGK A;  2CVJ A;  3NHO X;  2C3D A;  1ZK7 A;  5JCI A;  1TYP A;  5M0Z A;  3T37 A;  1H7W A;  2BK5 A;  2CDU A;  3K7Q X;  1TDK A;  4B64 A;  5KMP A;  3AED A;  3SY4 A;  1DOB A;  2O9Z A;  5EB5 A;  1LVL A;  3SX6 A;  1CJ4 A;  2VVM A;  1YQ3 A;  1K4Q A;  2PYX A;  3AD8 B;  1KSU A;  3GYX A;  1KN0 A;  2WQY A;  3E1T A;  5TR3 A;  1MOK A;  3CGC A;  2GAG B;  2FJA A;  3S61 A;  1VDC A;  4K22 A;  3L1R A;  2YG3 A;  1PBE A;  2GF3 A;  1PXB A;  1P2H A;  3AD7 B;  4B65 A;  3IF9 A;  2BAC A;  3I3L A;  2GAH B;  2AAQ A;  1O5W A;  1YY5 A;  4CY8 A;  3AE6 A;  2X8H A;  1E1M A;  3AE3 A;  5U25 A;  4Z24 A;  4KX6 A;  1NEK A;  2PHH A;  1JEH A;  3BNU A;  3LAD A;  3QSE A;  4O5U A;  3UOV A;  3EF6 A;  5HHF A;  3FIM B;  3NN0 X;  4EQW A;  2H89 A;  4GR1 A;  2V3B A;  2WS3 A;  1S7M A;  4EQR A;  4USQ A;  3QSM A;  5JCM A;  2Q6U A;  2BYB A;  4FDC B;  2YG5 A;  5KMR A;  4GAP A;  2ZZB A;  2AQJ A;  2BC1 A;  3L8K A;  4CNJ A;  1ZMD A;  2CFY A;  3SFD A;  1H84 A;  4UDR A;  4GDP A;  2C72 A;  4OPG A;  3GWF A;  4ZN0 A;  5DBJ A;  4RSL A;  3ALJ A;  3QFA A;  4O5Q A;  4MJW A;  3KU9 A;  1M64 A;  4U8J A;  3AXB A;  2XVJ A;  2QA1 A;  4H4Y A;  2BXS A;  1L0V A;  4H4U A;  2E4G A;  2IVD A;  3L5O A;  1JRY A;  4GRT A;  2YVG A;  4YTN A;  3KPK A;  5BVA A;  2YVF A;  1Y0P A;  4YKF A;  3PS9 A;  4EMW A;  3VQR A;  1TYT A;  1LQU A;  3K7M X;  3DJE A;  1W4X A;  3V3N A;  4LII A;  4E0V A;  4YSY A;  4YTP A;  3UCL A;  2WP6 A;  1Q1R A;  2C67 A;  2OAL A;  4K7Z A;  3GYI A;  4B66 A;  3IHG A;  1BGJ A;  3NLC A;  3DK9 A;  3Q6J A;  4EMI A;  3F8P A;  3UKQ A;  2XVF A;  3AB1 A;  3AEB A;  3KVE A;  4B63 A;  5J60 A;  2APG A;  1DOD A;  4NTD A;  1F6M A;  2YQU A;  2OLN A;  2V60 A;  4BK2 A;  4YT0 A;  3AEA A;  4NEV A;  2QA2 A;  4C5O A;  2HQM A;  2X3N A;  4GF7 A;  3VRD B;  4EMJ A;  1OJA A;  3QSS A;  3B3R A;  1NHQ A;  3B6D A;  3AE5 A;  4X4J A;  3GYJ A;  2X8C A;  1FEA A;  4J2W A;  3FG2 P;  3NT6 A;  3EAO A;  2WPC A;  3LXD A;  2Z5Y A;  5FS8 A;  1S2Q A;  4H4S A;  1GET A;  1OJD A;  4OPI A;  4ICY A;  2VQB A;  4AT2 A;  2XVE A;  1Z6L A;  1JU2 A;  4A65 A;  4J34 A;  4JDR A;  3ATQ A;  1TRB A;  2XLS A;  1TDF A;  3ITJ A;  4H4T A;  5EBK A;  5JCL A;  1FL2 A;  2C66 A;  3NYE A;  4OCG A;  3UTE A;  4BJZ A;  3ABV A;  1B5Q A;  2IID A;  3AE9 A;  4EM3 A;  5GSN A;  4H2N A;  2XFP A;  4TLX A;  2YM2 A;  3GRS A;  1EBD A;  2B76 A;  4NTE A;  5L46 A;  1IUX A;  4II2 A;  2C76 A;  1GOS A;  3M12 A;  2R0P A;  2VVL G;  3AEE A;  3CPJ G;  2VRL A;  4RG3 A;  3IC9 A;  1DNC A;  3KA7 A;  4U8I A;  1MXT A;  2XLU A;  3AYI A;  1DJQ A;  4G73 A;  4REK A;  3ICR A;  1UKV G;  3NG7 X;  1GRF A;  4EQX A;  1OJC A;  3SGL A;  2GR2 A;  4U8N A;  2WOW A;  2WP9 A;  1GRT A;  1LPF A;  1PBD A;  5BUK A;  1IJH A;  1JRZ A;  1QLB A;  5KOW A;  3ICS A;  3UTF A;  4A7A A;  3NKS A;  1S3E A;  3BNM A;  3QVP A;  3EAN A;  1ELI A;  3C96 A;  3H8L A;  2Q0K A;  3WE0 A;  1DXL A;  2ZBW A;  2JK6 A;  2B9W A;  2C65 A;  1BKW A;  4U8O A;  4K5R A;  3BI5 A;  4G9K A;  5KXJ A;  1D4C A;  3AE8 A;  3NRN A;  3NIX A;  2B7S A;  4GCM A;  1GRG A;  4AT0 A;  5U63 A;  4N9X A;  3GWD A;  5CQF A;  3SFE A;  1H86 A;  3RNM A;  5HYM A;  1BWC A;  1D5T A;  4K8D A;  2TPR A;  1OJT A;  2GQW A;  4DNA A;  1LQT A;  1OJ9 A;  2FBW A;  1BF3 A;  1H83 A;  1IUS A;  4U8L A;  3O0H A;  1PJ7 A;  2C75 A;  1GRE A;  4ADW A;  3UTG A;  1B4V A;  2UZZ A;  3PG6 A;  1COY A;  2GB0 A;  2Q7V A;  3ALL A;  4JNQ A;  3UP4 A;  5EB4 A;  4Z2T A;  2A87 A;  1TDE A;  4HA6 A;  5GRT A;  3NYF A;  4A9W A;  2DKI A;  2XFU A;  1DOC A;  3AE7 A;  4G6H A;  5FS7 A;  3UKK A;  4IA6 A;  1MO9 A;  3RP8 A;  3II4 A;  5CKU A;  3CIR A;  2JBV A;  3BHF A;  4FK1 A;  3UKP A;  2W0H A;  4JQ9 A;  3CTY A;  4K5S A;  1AOG A;  4AP1 A;  2YR4 A;  5BRT A;  3T2Y A;  2E1M A;  3T31 A;  2X8G A;  3BI4 A;  3ISH A;  2R45 A;  3NTA A;  4CNK A;  4H4Q A;  1E39 A;  1FEC A;  4YSH A;  5BUL A;  1E1N A;  1HYU A;  5JRB A;  3CN8 A;  4A99 A;  3C4A A;  3DGH A;  1CC6 A;  1EL5 A;  1L9D A;  3NK0 X;  2BC0 A;  1CC2 A;  3I6D A;  3QFB A;  4M52 A;  4IVO B;  1ONF A;  1VRQ B;  1F8S A;  3GDP A;  2JB1 A;  4AP3 A;  4D04 A;  3QJ4 A;  3CGD A;  5KVI A;  1H7X A;  5IQ4 A;  1IUV A;  4X9N A;  3P4S A;  1GRA A;  2XLT A;  3FPZ A;  4OPT A;  4UDP A;  3DJG X;  3UP5 A;  4C3Y A;  1CJ2 A;  2BRY A;  2YR6 A;  4FK1 C;  4CY6 A;  4H2R A;  1NHP A;  1N4U A;  4Z2U A;  1FEB A;  1X31 B;  2R4J A;  3COX A;  4JY3 A;  2EQ9 A;  4U2T A;  2GQF A;  2BK4 A;  3AEG A;  3SZ0 A;  4WX1 A;  1L9C A;  1ZMC A;  5FMH A;  1CF3 A;  4D03 A;  4APN A;  4U2L A;  1ZOV A;  3CNT A;  4Y4L A;  1PXA A;  3Q9T A;  4Y4N A;  2ZZ0 A;  5KRQ A;  1NG3 A;  2WBA A;  1PXC A;  4J36 A;  5JCK A;  1QO8 A;  4Z25 A;  3T14 A;  1CC4 A;  4X9M A;  3KD9 A;  2WU5 A;  1K0J A;  2B9Y A;  4IVM B;  3RP6 A;  1RP0 A;  2XLR A;  4WCT A;  1VQW A;  1GT8 A;  2YLT A;  2RGH A;  2XYO A;  3C4N A;  3FBS A;  3VRA A;  2WOV A;  2B9X A;  4BK1 A;  1O94 A;  1KNP A;  3LJP A;  1KDG A;  4G74 A;  4YTM A;  2GMH A;  1B8S A;  2ACZ A;  3D1C A;  3DGZ A;  4EM4 A;  2YG6 A;  2YLW A;  3UTH A;  3D9X A;  2Z5X A;  4H4Z A;  2XFO A;  2VVL A;  1ZX9 A;  3P4P A;  2FJB A;  4EIQ A;  4ZCD A;  2A8X A;  2VOU A;  3P4Q A;  5C2T A;  3V3O A;  3P4R A;  1XAN A;  4GUV A;  1JNR A;  4OVI A;  3LOV A;  2FJD A;  4A6N A;  1FOH A;  1KFY A;  3CNP A;  4Y4M A;  2YLR A;  1LJ1 A;  1VG9 A;  4XWZ A;  1GER A;  2V5Z A;  3G5S A;  4DSG A;  2RGO A;  3PO7 A;  4H4X A;  5FS6 A;  3SYI A;  5FS9 A;  2XCG A;  4B67 A;  1F8R A;  4NEW A;  1JRX A;  1EL9 A;  2Y6Q A;  2QCU A;  3DME A;  4JY2 A;  1GPE A;  2YVJ A;  2RGJ A;  2GR0 A;  4J56 A;  4PAB A;  3T2K A;  4NWZ A;  2C3C A;  1IUU A;  4OPD A;  4CCQ A;  4Z2R A;  3ZDN A;  1PHH A;  2TMD A;  4B69 A;  1JOA A;  1YQZ A;  2GR3 A;  2Y6R A;  4UP3 A;  4YKG A;  3CNJ A;  1REO A;  1H82 A;  3BI2 A;  3OZ2 A;  2YM1 A;  4JNA A;  3GDN A;  1DJN A;  2C73 A;  2WHD A;  1PDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...