1LPFA

Three-dimensional structure of lipoamide dehydrogenase from pseudomonas fluorescens at 2.8 angstroms resolution. analysis of redox and thermostability properties
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
472
structure length
472
Chain Sequence
SQKFDVVVIGAGPGGYVAAIRAAQLGLKTACIEKYIGKEGKVALGGTCLNVGCIPSKALLDSSYKYHEAKEAFKVHGIEAKGVTIDVPAMVARKANIVKNLTGGIATLFKANGVTSFEGHGKLLANKQVEVTGLDGKTQVLEAENVIIASGSRPVEIPPAPLSDDIIVDSTGALEFQAVPKKLGVIGAGVIGLELGSVWARLGAEVTVLEALDKFLPAADEQIAKEALKVLTKQGLNIRLGARVTASEVKKKQVTVTFTDANGEQKETFDKLIVAVGRRPVTTDLLAADSGVTLDERGFIYVDDHCKTSVPGVFAIGDVVRGAMLAHKASEEGVMVAERIAGHKAQMNYDLIPSVIYTHPEIAWVGKTEQTLKAEGVEVNVGTFPFAASGRAMAANDTTGLVKVIADAKTDRVLGVHVIGPSAAELVQQGAIGMEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGHAIHIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROLIPOAMIDE DEHYDROGENASE
publication title Three-dimensional structure of lipoamide dehydrogenase from Pseudomonas fluorescens at 2.8 A resolution. Analysis of redox and thermostability properties.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Oxidoreductase
total genus 150
structure length 472
sequence length 472
chains with identical sequence B
ec nomenclature ec 1.8.1.4: Dihydrolipoyl dehydrogenase.
pdb deposition date 1992-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1lpfA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1lpfA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1lpfA02
4YKFA 2XDOA 4Z26A 1BGNA 1OJDA 4A9WA 1MOKA 3F8PA 4YT0A 1GRAA 2WOIA 2WPEA 4J56A 4K2XA 3CGEA 2BXRA 4B68A 2WOWA 1BKWA 3HZLA 4P9SA 3H8LA 1CC4A 2AR8A 3AB1A 3D1CA 3LJPA 1M64A 3UKQA 3NKSA 4J33A 4ECHA 3IC9A 4EIPA 3NLCA 4OVIA 4H4TA 3IHGA 2I0ZA 3AEBA 3I3LA 1GXFA 1BWCA 3H8IA 3KPFA 4H4ZA 2BC0A 2JK6A 1H7WA 4RG3A 3Q9TA 3ICRA 2WEUA 4B64A 1OJCA 2YAUA 2BS2A 1PBDA 2GF3A 1V59A 4K8DA 3ALLA 2GVCA 2YG7A 2E1MA 1NENA 1SEZA 1Y56B 3V3OA 1DJNA 3P1WA 1NG3A 1M6IA 1ZY8A 2BK4A 4BV6A 2XVIA 3AE6A 1DODA 1GALA 1X31B 1N1PA 2YM1A 3CPHG 2EQ6A 4AP3A 3Q6JA 4JQ9A 2YLTA 1OJ9A 1ZP0A 3G5SA 2YQUA 4TM0A 4DSHA 5M0ZA 3GWDA 1COYA 1PHHA 2XFUA 1PXAA 2XFQA 4J36A 3K7QX 4J2WA 1Y0PA 4GRTA 3DA1A 3DJEA 5LV9A 2X99A 3NN6X 4H4YA 3AE5A 3ZDNA 4EMWA 1QJDA 5KVIA 3ZYXA 4OPTA 1H84A 1PXBA 2XVEA 1QLBA 4JDRA 1BZLA 3AYIA 5KRQA 2YR6A 5BRTA 3QSSA 1GPEA 2V6OA 2WQYA 1ZMDA 4H4RA 2R4JA 4KPRA 4BJYA 5HXIA 2WPCA 3NIXA 3FMWA 3G5RA 3SM8A 1S3BA 1ZOYA 3NN0X 4PAAA 2GR3A 4ADWA 1TDKA 3RP7A 1LPFA 1D4CA 3DK9A 2YVJA 2VOUA 4B63A 2V3BA 4FDCB 3ABVA 1GSNA 1NPXA 4DGKA 4YWOA 3IF9A 2DKIA 1GERA 1LQTA 1GTHA 1W4XA 1N4UA 2VRLA 1YKJA 5KOWA 4IVOB 4LU6A 5EOWA 2VQBA 2AAQA 2BXSA 1O5WA 2YWLA 3M12A 3NNEA 3LZXA 2FJBA 5DBJA 1OJAA 2CDUA 2V61A 4EM4A 4XWRA 2JB2A 3DJDA 1Y56A 3EANA 3ATQA 2QAEA 3PS9A 1TDOA 2R0PA 3DGHA 4H4UA 4ZN0A 3P4SA 4EQXA 2RGOA 3AE7A 1H86A 3F8DA 4OPUA 1PS9A 2VRMA 3P9UA 1O95A 3URHA 3ADAB 4YSZA 3RP6A 1YQZA 5FMHA 4H4XA 5IPYA 5TR3A 3QSEA 4DSGA 3UOYA 4U8LA 1FEBA 1IUUA 2V3AA 2IIDA 2YG5A 2EQ7A 4U2LA 3UP4A 3VQRA 1NHPA 4USQA 5GSNA 2XYOA 2XFOA 2WS3A 3NK2X 4H7UA 4TLZA 1F8SA 4U8KA 3UTEA 1IJHA 2YLRA 3GD3A 1DOCA 4A6NB 1GOSA 4E0VA 2CFYA 1NAAA 4KX6A 2E5VA 4H4SA 3B3RA 4EMIA 2GRTA 5JCKA 2NPXA 4NTDA 2J3NA 1FOHA 4C3YA 2OAMA 1JU2A 4YXDA 2WDRA 3EF6A 2WP9A 3CN8A 3AD9B 5FS8A 1CF3A 2C65A 3RP8A 4A5LA 1JRXA 1VG9A 2C66A 5EB5A 1IUXA 1Q1RA 5M10A 2WP6A 1PBEA 5HHFA 2ZZBA 5C3JA 3ITJA 3K7TA 1YY5A 4U2SA 4Y4MA 1ZKQA 2Y6RA 1E1KA 1MO9A 2C3CA 2X8CA 4EMJA 3NRNA 4BK2A 2Q6UA 3VRBA 3AE3A 4WX1A 4GDPA 3DJJA 1LVLA 2A87A 2YVGA 4OPIA 2R4EA 3AD7B 3UKAA 1PDHA 4H4WA 5ER0A 1EBDA 2GR1A 3CNTA 1K0LA 1B4VA 2JAEA 5C2TA 3FG2P 1E7PA 1LV0A 3SQPA 4TM4A 1Z6LA 1ZK7A 5GRTA 3UOZA 5U25A 4CCRA 2BC1A 4IVMB 4LIIA 4REKA 3WE0A 2JBVA 4B65A 3CGBA 3DMEA 4CBQA 4MJWA 1H81A 3I6DA 4GR1A 2WPFA 1XPQA 2Z5YA 5L46A 3UOVA 2GMJA 3AXBA 3M13A 4U8MA 3CIRA 1H83A 2R0CA 1FEAA 3B6DA 3UKLA 1GRGA 1OJTA 1K0JA 3AE2A 4K22A 1K0IA 4GF7A 3FPZA 2WESA 4C74A 1NHQA 4D04A 3OZ2A 4NTCA 1KF6A 2Q0LA 4YTPA 3IWAA 2B76A 2GAHB 1KSSA 3BNUA 1IUSA 4UP3A 2WOVA 4NEVA 1GEUA 3E1TA 1HYUA 2XVJA 2A8XA 3KA7A 3PVCA 4K5SA 3CGDA 4OPDA 4TM3A 5IQ4A 4H50A 1D4DA 4I59A 1GRTA 4EQWA 1PN0A 3LXDA 2QA2A 1E1MA 4OCGA 5CQFA 4AT2A 3QFBA 5FS7A 1PXCA 3UOXA 3UKFA 3UTGA 3CPJG 3L8KA 1NEKA 1O94A 4H2RA 2GR0A 2YLZA 2BYBA 1L9EA 4XWZA 2OA1A 1E39A 4IV9A 3EPTA 4H4PA 4C77A 3ALJA 4JNQA 3ATRA 1GRHA 1B5QA 2XFNA 1GTEA 5FS6A 1YQ4A 1B37A 2Q7VA 2Y6QA 3NGCX 4N9XA 4CY8A 3COXA 1CJ2A 1D4EA 1E1LA 1S3EA 2ZBWA 1TDEA 3RHAA 3LADA 3NHOX 4K5RA 3NT6A 2QCUA 2WHDA 4U8PA 3BHKA 1UKVG 4H4QA 2BABA 4H2QA 2H88A 3K7MX 1LJ1A 5JCNA 4B66A 1KNPA 3P4RA 4U8JA 4U8IA 2XFPA 4FK1A 3F8RA 3AE9A 4RSLA 3DH9A 4U2TA 1PJ5A 3T37A 2YR4A 1DOEA 3QFAA 1CC6A 2B9YA 2BA9A 2BS3A 4OPCA 1KNRA 4USRA 3VRAA 2YG4A 3O0HA 3AWIA 1TYPA 3FBSA 4AT0A 4YSYA 3NK1X 3LB8A 2VQ7A 4C3XA 5KXJA 3H4KA 2B9WA 3GD4A 5JCLA 3UKKA 2FJAA 4D03A 1H82A 3SFDA 3KU9A 1CJCA 1PJ6A 1VDCA 1GESA 3QJ4A 2Q0KA 3S5WA 1GNDA 3KVEA 1ZX9A 2GH5A 2GB0A 3NTAA 2XLSA 3GYJA 4A65A 4LA1A 2PYXA 4U8NA 2C67A 3FIMB 3GRSA 4BURA 4J34A 1DJQA 4C5OA 2F5ZA 3CPIG 3AEDA 1L9CA 5HYMA 1Q1WA 2RGJA 2PHHA 3CNPA 3DGZA 1L9DA 1JRZA 3C4AA 4TM1A 4XXGA 4OPGA 2R45A 4X9NA 1CBOA 1ZDLA 2AQJA 1D5TA 1ELIA 4BK1A 5U63A 1TRBA 3AE8A 1B8SA 3GDNA 1ONFA 4H2NA 2FBWA 3SGLA 1CJ4A 2VZ2A 1VRQB 3LOVA 1D7LA 3UTFA 1S2YA 4I58A 2YG6A 1RSGA 3UKPA 1NDAA 2WETA 2X8GA 1JNRA 3UTHA 2WBAA 4H4VA 1AOGA 2C73A 1VQWA 2YR5A 2ACZA 4A79A 3NYEA 1JNZA 4K7ZA 1DOBA 3NG7X 2OLOA 2V60A 1NHRA 1IUTA 4EM3A 2XLUA 2ZZ0A 2C7GA 1CJ3A 1TDFA 5KVHA 3NTDA 1GT8A 5U1OA 2GQFA 2GQWA 1IUVA 2APGA 4O5QA 3GWFA 4J31A 4YSXA 2GV8A 2C72A 1PJ7A 1KSUA 4PABA 2EQ9A 2BCPA 2CULA 4UDQA 1F3PA 5HY5A 5J7XA 3LZWA 3QVRA 5JCMA 3CNJA 2Z5XA 4B67A 4X9MA 3CNSA 2BK3A 4UDRA 1PBCA 4JNAA 2R9ZA 2VVMA 3ALMA 3GMCA 4JY3A 4O5UA 4A99A 4Z2RA 1K4QA 2X3NA 2GMHA 2YLXA 1LQUA 2C3DA 4AOSA 2C76A 5BVAA 3KLJA 3AECA 2GR2A 3C96A 3RNMA 4B69A 3II4A 2QA1A 2YLWA 3P4PA 4GUVA 1JEHA 2GAGB 3JSKA 2WP5A 1TYTA 1FCDA 4A7AA 3K30A 2TPRA 2C64A 3BNMA 5IQ1A 2B9XA 4EQSA 2B7SA 1ZOVA 1MXTA 4A6NA 3M0OA 4UDPA 3VR9A 2ARDA 4DNAA 4CCQA 2H89A 4BK3A 3V76A 4CY6A 3GYIA 1KDGA 3UCLA 4JY2A 3NH3X 2YLSA 3AYLA 3DK4A 2XVHA 4AP1A 1EL7A 1H6VA 3CGCA 1EL9A 2IVEA 4JN9A 1H7XA 4X4JA 1IUWA 4ICYA 2X8HA 4Z2UA 1BGJA 3UP5A 1LTXR 1DNCA 4H2PA 5BULA 1NG4A 4HA6A 5JCIA 2JKCA 1XHCA 5KWFA 3C4NA 3GMBA 4NTEA 1P2HA 3BI4A 3PO7A 1BF3A 3VRDB 2WU2A 3VR8A 1GREA 2W0HA 2YVFA 3GDPA 4Y4NA 3AEEA 4Z2TA 3GRTA 1XANA 4M52A 4ZCDA 2R46A 3SFEA 3BHFA 3R9UA 2X50A 2R0GA 1EL8A 4Z44A 2RABA 4CNJA 2WDQA 4YSHA 3ICTA 3ISHA 2CVJA 3BI5A 4FK1C 3OC4A 2XLPA 3AD8B 3EAOA 1GRFA 1EL5A 2XLTA 2WDVA 1DXLA 3AEAA 5BUKA 3CTYA 2HQMA 2V5ZA 4Y4LA 4ZCCA 1CL0A 2GEWA 1QO8A 3QVPA 2E4GA 2EQ8A 4CRTA 4EQRA 2BK5A 2DKHA 2YM2A 4U8OA 4B1BA 4HB9A 3AYJA 1F8RA 2JB3A 1N4VA 4GCMA 2BACA 3REDA 2WU5A 4YTMA 2ZZCA 2O9ZA 5J60A 1FL2A 4CNKA 3CNDA 4EIQA 1NHSA 1RP0A 3NYCA 1XDIA 1ZMCA 2YG3A 3BI2A 3NK0X 1GRBA 1REOA 4BJZA 2BCGG 3IHMA 3AEGA 1GV4A 3G5QA 5KOXA 1Q9IA 1F6MA 1VG0A 1E6EA 2JB1A 4TLXA 5FS9A 3DK8A 4Z25A 2XVFA 3GSIA 2XCGA 4IA5A 1PBBA 1PBFA 5EBKA 4GDEA 2VVLA 3S61A 1JOAA 1GETA 4Z43A 2RGHA 2FJEA 1CHUA 4J57A 1N4WA 3KD9A 5EB4A 4FX9A 1KFYA 1TDNA 2C70A 3AE1A 1FECA 3DJGX 1RYIA 4NZHA 5CKUA 4Z24A 2UZZA 3AEFA 4NEWA 4APNA 2FJDA 3KKJA 4WCTA 4OPLA 1F8WA 4RG4A 2B7RA 2OLNA 2A89A 2VVLG 4AOXA 2OALA 2XLRA 4IA6A 4YKGA 3UKHA 2NVKX 2TMDA 3QSMA 1L0VA 3AE4A 1JRYA 3ICSA 4YTNA 3V3NA 2BS4A 3D8XA 1CC2A 3L1RA 2IVDA 2C75A 1P2EA 3NYFA 3P4QA 1E1NA 1S2QA 1YQ3A 1D7YA
chains in the Genus database with same CATH superfamily
2XDOA 4Z26A 1OJDA 4YT0A 1GRAA 2PP3A 3CGEA 2BXRA 2W54A 3SR6B 3D1CA 3UKQA 1M64A 3IC9A 4EIPA 3NLCA 4OVIA 4H4TA 3VDGA 3KPFA 2BC0A 2JK6A 1H7WA 4RG3A 4GYPA 3A7AA 3ICRA 3EKGA 2YAUA 3NO1A 2BS2A 3UGVA 1PBDA 2GF3A 3ALLA 2GVCA 3V3OA 1TZZA 3R0KA 1DODA 1GALA 1X31B 1N1PA 4AP3A 3Q6JA 4JQ9A 2GGJA 1OJ9A 3OP2A 4G7FA 3GWDA 2XFUA 1SB3B 3K7QX 3DJEA 1FHUA 3AE5A 4OPTA 1PXBA 3AYIA 5KRQA 2YR6A 5BRTA 5BOFA 3PWGA 4JHMA 4GIRA 3SSZA 4KPRA 5HXIA 2WPCA 3G5RA 3SM8A 1S3BA 2GR3A 1TDKA 4B63A 4FDCB 3FCPA 1NPXA 3IF9A 2DKIA 2VRLA 1YKJA 4DX3A 3LZXA 2V61A 4XWRA 1Y56A 1TDOA 3JW7A 2R0PA 1FFUC 1X2GA 4ZN0A 5KMSA 4OPUA 2XSXA 1YQZA 1H2IA 1NHPA 5GSNA 2XYOA 4H7UA 1F8SA 4U8KA 3UTEA 1IJHA 1EBGA 2CFYA 1NAAA 4KX6A 3HRDC 4NTDA 3RCYA 4E4FA 1XPYA 1ELSA 1JU2A 3T2YA 2WDRA 2HZGA 3EF6A 4A5LA 1JRXA 3CK5A 1Q1RA 2DW7A 2WP6A 1SJDA 4U2SA 4Y4MA 1ZKQA 1MO9A 3NRNA 3VRBA 1KCZA 2A87A 1WUEA 2R4EA 3AD7B 5FJPA 4IL2A 2JAEA 5C2TA 3FG2P 1E7PA 1LV0A 3B9JB 2BC1A 4IVMB 4LIIA 4REKA 4EWJA 3I6DA 2WPFA 3M13A 3SBFA 3B6DA 3UKLA 4GF7A 3FPZA 1TKKA 3OZ2A 1KSSA 2NQLA 3E1TA 5KMQA 1JPDX 5IQ4A 4H50A 1GRTA 4EQWA 1E1MA 5G5GB 1VDVA 1BKHA 3OW1A 2YLZA 4XWZA 2OA1A 1SJAA 4IV9A 1YEYA 3EPTA 3ATRA 2XFNA 4X2PA 1YQ4A 1B37A 1TE6A 3NZGA 3COXA 1TDEA 1KKRA 3LADA 4K5RA 2WHDA 2ZADA 4U8PA 3OZMA 4B66A 4MGGA 2P8BA 4U2TA 3A7RA 3VRAA 4YSYA 3LB8A 4C3XA 5KXJA 2AL2A 3GD4A 3S5WA 4YWSA 4A65A 2PYXA 3NS1B 4BURA 3CPIG 3AEDA 1Q1WA 3CNPA 4XXGA 4OPGA 4DXKA 1FIQB 1ELIA 3SGLA 1CJ4A 1AOGA 2QDEA 1VQWA 3NYEA 1JNZA 1DOBA 2OLOA 1NHRA 1IUTA 3TWBA 2GQFA 4O5QA 2C72A 1KSUA 2BCPA 4UDQA 3LZWA 3QVRA 5JCMA 4II3A 3TCSA 2R9ZA 2VVMA 3DGBA 2GMHA 3DDMA 5BVAA 4GGBA 3RNMA 4B69A 3Q45A 3P4PA 1TYTA 4A7AA 1JPMA 2B9XA 4A6NA 3NVYB 3UCLA 3NH3X 1EL7A 1LTXR 5BULA 4HA6A 4HYRA 1EC7A 1XHCA 4A35A 5JRBA 4NTEA 1P2HA 4Y4NA 4Z2TA 4M52A 4ZCDA 4CNJA 3NXLA 2CVJA 3BI5A 3EAOA 3ZVIA 2WDVA 4J3ZA 3AN1A 2V5ZA 1CL0A 1MDLA 2YM2A 4HB9A 4G6GA 1F8RA 1FFVC 2BACA 1FL2A 3CNDA 5EU9A 2YG3A 3BI2A 1REOA 3MZNA 1Q9IA 3MKCA 1P43A 3S47A 2RDXA 5FS9A 3PWIA 3GSIA 2QJMA 2HXTA 3S61A 4Z43A 2AKZA 2GDQA 3BSMA 4HCHA 5KMPA 4FX9A 1TDNA 2C70A 5BOEA 2OQHA 2UZZA 4OPLA 2B7RA 2VVLG 2OALA 4IA6A 4YTNA 2AKMA 3V3NA 1YQ3A 1BGNA 2W3RA 2WOIA 3HZLA 2HXUA 2E3TA 3A7UA 1CC4A 3H8LA 2AR8A 4ECHA 3NKSA 4J33A 3R25A 3HYVA 4G6HA 4GGHA 3IJLA 3ENLA 1BWCA 4H4ZA 3Q9TA 4K8DA 1NG3A 1M6IA 1ZY8A 2XVIA 3AE6A 1MUCA 2XH4A 2YLTA 3H8AA 1ZP0A 5M0ZA 1COYA 1PXAA 1SJCA 4J2WA 4GRTA 2X99A 3ZYXA 3ZDNA 4EMWA 5KVIA 3UJSA 2QGYA 1ZMDA 2R4JA 4BJYA 3FMWA 1LPFA 4KWSA 2YVJA 2VOUA 2PPGA 2OZTA 3ABVA 1GSNA 3FYYA 1GERA 1GTHA 4H19A 1W4XA 1N4UA 2E5AA 4IVOB 2VQBA 2FJBA 5G5HB 2JB2A 3DJDA 3EANA 3B97A 3R10A 3P4SA 3AE7A 1PS9A 3PFRA 5TR3A 3QSEA 1N62C 2YG5A 2IIDA 3N6JA 4USQA 2XFOA 4TLZA 3GD3A 1GOSA 3T14A 4EMIA 2GRTA 2J3NA 1FOHA 4YXDA 3ETRB 3RR1A 3RP8A 1CF3A 1PBEA 5HHFA 2ZZBA 5C3JA 3ITJA 1YY5A 4Z1YA 2X8CA 2C3CA 4EMJA 4GDPA 1LVLA 5FJTA 1N60C 3RITA 2OZ8A 1Z6LA 1ZK7A 2PTWA 3SZCA 3WE0A 2JBVA 3DMEA 4MJWA 1H81A 4GR1A 2Z5YA 3HYXA 4U8MA 1NELA 3SZFA 1FEAA 2QDDA 1K0JA 1K0IA 1NHQA 4D04A 2OZ3A 2Q0LA 3IWAA 3TQPA 2B76A 2QVHA 3BNUA 3UCDA 2WOVA 3KA7A 1GEUA 1HYUA 2XVJA 4OPDA 1D4DA 2XH2A 1PN0A 4AT2A 4FI4A 1PXCA 3NVVB 3DG7A 3OPSA 3UTGA 2PTXA 4H2RA 3VCNA 3RRAA 4C77A 3ALJA 1GTEA 2P8CA 2XGZA 5FS6A 2Q7VA 3SYIA 1CJ2A 1E1LA 3D47A 2QCUA 3BHKA 4IT1A 3T2ZA 3K7MX 5JCNA 2O56A 1RVKA 1KNPA 4NNJA 3AE9A 3ZLGA 3SZWA 1DOEA 2BA9A 4USRA 2YG4A 3FBSA 4H1ZA 3H4KA 2B9WA 2FJAA 1H82A 3SFDA 1CJCA 2Q0KA 3TW9A 3KVEA 2GH5A 4LA1A 4U8NA 4J34A 1DJQA 3R1ZA 1L9CA 4M0XA 3JZUA 2PHHA 3QLDA 5J04A 2R45A 2OO6A 2AQJA 1D5TA 5U63A 1TRBA 3DFYA 3FV9A 4H2NA 2VZ2A 1X2HA 1S2YA 1RSGA 3UKPA 1NDAA 2WETA 2X8GA 2OLAA 1JNRA 3UTHA 2ACZA 4A79A 1V97A 2ZZ0A 1CJ3A 1TDFA 5KVHA 3NTDA 4E4UA 3GWFA 2GV8A 3PK7A 4B67A 3VA8A 2Z5XA 4X9MA 2BK3A 3EEZA 4UDRA 2ZC8A 3GMCA 4Z2RA 2OFJA 1K4QA 2X3NA 1LQUA 2C3DA 3KLJA 3AECA 3II4A 2QQ6A 3T6CA 3K30A 4EQSA 4KPLA 2ARDA 4CCQA 4BK3A 4CY6A 1DTNA 4JY2A 3AYLA 3ZVHA 1RM6B 3CGCA 1KKOA 4Z2UA 1BGJA 1WUFA 4MMWA 1DNCA 4H2PA 5JCIA 2JKCA 4ZA0A 3RO6A 3C4NA 3BI4A 1BF3A 1XANA 3SFEA 3R9UA 3ISHA 1JROA 4FK1C 3TJ4A 1EL5A 2HQMA 4Y4LA 4ZCCA 5ENLA 3QVPA 2E4GA 1L8PA 2BK5A 3SXIA 4B1BA 1SJBA 3REDA 2WU5A 4YTMA 1OEPA 2O9ZA 4CNKA 4EIQA 3UXKA 3NK0X 1GRBA 3G5QA 1E6EA 2JB1A 4KEMA 4TLXA 3DK8A 4Z25A 4A3RA 3GD6A 4IA5A 1PBBA 1PBFA 3NRZB 4GDEA 3SN1A 3N4EA 3ZLFA 3SX6A 4J57A 1N4WA 1FECA 4H2HA 3DJGX 1RYIA 3DFHA 3KKJA 4NEWA 4APNA 4ROPA 4JN7A 2PA6A 3QKEA 2A89A 4AOXA 3T8QA 2XLRA 2AL1A 2NVKX 2TMDA 1L0VA 3AE4A 2BS4A 3D8XA 3L1RA 2C75A 1P2EA 3K1GA 4J56A 4B68A 1BKWA 4P9SA 1VQZA 2CHRA 3LJPA 3R11A 4KT2A 2WEUA 1OJCA 3KPKA 3FJ4A 3CAWA 1V59A 1MDRA 2YG7A 2E1MA 2PGWA 1NENA 2BRAA 1DJNA 3P1WA 2BK4A 4BV6A 5FJOA 3CB3A 2EQ6A 2QJJA 3G5SA 2YQUA 4DSHA 4FP1A 1PHHA 2XFQA 3MUCA 4IP4A 3VC5A 3ZLHA 3NN6X 1QJDA 4ZCWA 1H84A 1GPEA 2V6OA 2WQYA 3CYJA 1ZOYA 3NN0X 3RP7A 4ADWA 1D4CA 3U4FA 4HN8A 3T2KA 3IK4A 3QTPA 5KOWA 2AAQA 2BXSA 1O5WA 2YWLA 3M12A 5DBJA 3KUMA 1E9IA 3TWAA 3ATQA 3DGHA 4H4UA 1PDZA 1H86A 4G74A 2GGEA 3BOXA 3ADAB 4YSZA 3RP6A 4H4XA 1NU5A 3QPEA 3UOYA 4DSGA 4U8LA 1FEBA 2V3AA 3VQRA 3T0KA 1DOCA 4A6NB 4E0VA 4H4SA 3B3RA 2HNEA 2NPXA 3V5FA 4C3YA 3GY1A 3BJSA 3N6HA 3CN8A 3V4BA 4A6GA 3AD9B 2FYMA 4TVYA 3K7TA 4HNCA 2P88A 1E1KA 3AE3A 4WX1A 3DJJA 2YVGA 4GYPC 4OPIA 1EBDA 1K0LA 1B4VA 2P0IA 4K8GA 3NVZB 2GL5A 2PU0A 4TM4A 5GRTA 3UOZA 4E6MA 4CBQA 1XPQA 5L46A 3UOVA 2GMJA 3AXBA 4JN8A 1H83A 2R0CA 1OJTA 4K22A 3H12A 4E5TA 4NTCA 3DG6A 1KF6A 4YTPA 1IUSA 4UP3A 4NEVA 3PVCA 4TM3A 3CGDA 2PSNA 1PDYA 4G73A 3QFBA 3UOXA 3UKFA 3L8KA 1NEKA 1L9EA 2P3ZA 4H4PA 4JNQA 1B5QA 2Y6QA 1S3EA 2ZBWA 3RHAA 3NHOX 3NT6A 1UKVG 4H4QA 4H2QA 3UCCA 2OVLA 3P4RA 4U8JA 2XFPA 3TOYA 2BRYA 3F8RA 3VC6A 2OKTA 1PJ5A 3QFAA 1CC6A 2B9YA 4TVWA 4OPCA 3O0HA 1TYPA 3NK1X 3JVAA 3THUA 3DESA 5JCLA 3UKKA 4D03A 2PU1A 3KU9A 1PJ6A 1GESA 3QJ4A 1GNDA 3NTAA 2XLSA 3GYJA 1ZXIC 3GRSA 2F5ZA 5HYMA 3DGZA 1JRZA 4TM1A 1ZDLA 4BK1A 3FVDA 3AE8A 1B8SA 2I5QA 1D7LA 3UTFA 2GGHA 2YG6A 3STPA 2WBAA 4H4VA 4K7ZA 2V60A 3GC2A 1XS2A 4GAVA 4EM3A 2C7GA 1GT8A 5U1OA 2GQWA 2APGA 4YSXA 4GMEA 3GYXA 1N5XA 3T4WA 1PJ7A 4PABA 2PP1A 1F3PA 5HY5A 5J7XA 2PTYA 3ALMA 4JY3A 4O5UA 4H83A 4AOSA 3QN3A 2GR2A 3C96A 4J1OA 2QA1A 2YLWA 3DEQA 2WP5A 3R07C 1FCDA 2QJNA 2TPRA 3D9XA 2C64A 5IQ1A 3I4KA 2B7SA 1ZOVA 3TJIA 3M0OA 3H7VA 3V76A 4GISA 1KDGA 3GYIA 2YLSA 2C4CA 2XVHA 2POZA 2PTZA 4AP1A 3L5OA 1H6VA 2IVEA 1EL9A 4JN9A 4ICYA 2X8HA 3CMMA 1NG4A 5KWFA 4DN1A 1R0MA 3VRDB 1EC8A 1GREA 2W0HA 3AEEA 3GRTA 2R46A 2GGGA 2X50A 2R0GA 1EL8A 4Z44A 2RABA 4G8TA 4YSHA 3ICTA 3OC4A 2XLPA 3T31A 1DXLA 1T3QC 1QO8A 3DERA 4CRTA 1JRPA 3AYJA 2JB3A 3UJEA 1RP0A 3NYCA 1XDIA 3GO2A 3HYWA 3AEGA 4ZOHB 2XVFA 3V5CA 2XCGA 4HCLA 2VVLA 2FJEA 3CXOA 5EB4A 1KFYA 3AE1A 2MNRA 4NZHA 5CKUA 3AEFA 4F4RA 2FJDA 4WCTA 4RG4A 2OLNA 3CXBA 6ENLA 3V3WA 4IP5A 4II2A 1CC2A 3NYFA 1E1NA 1S2QA 3CNJA 3MY9A 1D7YA 4YKFA 4A9WA 1MOKA 3F8PA 2WPEA 4K2XA 2GSHA 2WOWA 5KMRA 3AB1A 2XH7A 3CT2A 3RGTA 3IHGA 2I0ZA 3AEBA 3I3LA 1GXFA 3H8IA 4GAPA 1STZA 2OQYA 3ES7A 4B64A 1EC9A 2GGIA 1SEZA 1Y56B 1F9CA 4E8GA 3MWCA 3S5SA 3R0UA 3CPHG 2YM1A 3VCCA 2FKPA 1N5WC 4TM0A 3SN0A 1R6WA 4J36A 1Y0PA 4IL0A 3DA1A 5LV9A 4H4YA 2XVEA 1QLBA 4JDRA 1BZLA 1ONEA 3QSSA 3P93A 3Q4DA 1WYGA 4H4RA 1FHVA 3NIXA 4PAAA 3P0WA 3DK9A 2V3BA 4DGKA 4YWOA 3NVWB 1LQTA 3UJFA 4Z17A 4LU6A 3AM9A 5EOWA 3NNEA 1OJAA 2CDUA 4EM4A 2QAEA 3PS9A 4IHCA 3OTRA 4EQXA 2RGOA 4HPNA 3F8DA 2DW6A 2VRMA 3P9UA 3P3BA 1O95A 3URHA 5FMHA 5IPYA 1IUUA 4U2LA 2EQ7A 3UP4A 3NK2X 2WS3A 1S7MA 2YLRA 3H70A 3IJQA 2E5VA 2OG9A 5JCKA 3ZVHB 2OAMA 2MUCA 3AMZA 2WP9A 5FS8A 2C65A 1KN0A 3ES8A 1VG9A 4M6UA 3N4FA 2C66A 1IUXA 5EB5A 5M10A 1IYXA 1W6TA 2Y6RA 4BK2A 2Q6UA 1N61C 3UKAA 1PDHA 4K2SA 4H4WA 5ER0A 2GR1A 3CNTA 2PGEA 5FJUA 3TTEA 3SQPA 5U25A 4CCRA 4B65A 3CGBA 3HW2A 3CIRA 2AL2B 1GRGA 3AE2A 2WESA 4C74A 2PODA 2GAHB 2W3SA 4K5SA 4HCDA 2A8XA 1BQGA 4I59A 3LXDA 2QA2A 4OCGA 5CQFA 3SY4A 5FS7A 3CPJG 1O94A 4DYEA 3U9IA 2GR0A 2BYBA 3SQSA 1E39A 3FXGA 1KD0A 1GRHA 3NGCX 1EBHA 4CY8A 4N9XA 1D4EA 2PS2A 3SZ0A 3IJIA 2BABA 2H88A 1LJ1A 4U8IA 4FK1A 4RSLA 3DH9A 3NFUA 3T37A 4IZGA 2BS3A 2YR4A 4AT0A 1KNRA 3AWIA 4DWDA 2VQ7A 7ENLA 1VDCA 1ZX9A 2GB0A 1MRAA 2C67A 2W55A 3FIMB 4C5OA 2RGJA 1L9DA 3C4AA 4X9NA 1CBOA 2XH0A 3GDNA 1ONFA 2FBWA 3MQTA 1VRQB 3LOVA 1P48A 4I58A 2C73A 2YR5A 4HNLA 3NG7X 1MNSA 2XLUA 3UJRA 3SJNA 3EUB3 1IUVA 4J31A 1FO4A 5IDZA 2EQ9A 4ENLA 2CULA 3PG6A 1ECQA 1N63C 3CNSA 1PBCA 4JNAA 3DIPA 4A99A 2YLXA 3OZYA 4GUVA 1JEHA 2GAGB 3JSKA 3HPFA 5FJRA 3BNMA 1MXTA 4UDPA 3VR9A 4DNAA 2H89A 3DK4A 1H7XA 4X4JA 1IUWA 3UP5A 3DG3A 2PP0A 2PMQA 4MKSA 3SN4A 3GMBA 3PO7A 3D46A 1JCTA 2WU2A 3VR8A 2YVFA 3GDPA 3BHFA 2WDQA 3AD8B 1GRFA 4G9KA 2XLTA 5BUKA 3AEAA 3I6EA 3CTYA 2GEWA 2EQ8A 4EQRA 2DKHA 4U8OA 2OX4A 1N4VA 4GCMA 2ZZCA 4DHGA 1JDFA 3VFCA 5J60A 1NHSA 1ZMCA 4BJZA 2BCGG 4GFIA 3IHMA 1GV4A 5KOXA 1F6MA 1VG0A 4NWZA 2OPJA 3UJ2A 5KNLA 2ONEA 5EBKA 1JOAA 1GETA 2RGHA 3I6TA 1CHUA 3KD9A 3UXLA 4Z24A 1F8WA 3T9PA 3MSYA 4YKGA 3UKHA 3QSMA 3ICSA 4K1WA 1JRYA 2PCEA 2IVDA 3P4QA 2C76A
chains in the Genus database with same CATH topology
4YKFA 2XDOA 4Z26A 1BGNA 1OJDA 4A9WA 1MOKA 3F8PA 4YT0A 1GRAA 2WOIA 2WPEA 4J56A 4K2XA 3CGEA 2BXRA 4B68A 2WOWA 1BKWA 3HZLA 4P9SA 3H8LA 1CC4A 5KMRA 2AR8A 3AB1A 3D1CA 3LJPA 1M64A 3UKQA 3NKSA 4J33A 4ECHA 3HYVA 4G6HA 3IC9A 4EIPA 3NLCA 4OVIA 4H4TA 3IHGA 2I0ZA 3AEBA 3I3LA 1GXFA 1BWCA 3H8IA 3KPFA 4H4ZA 2BC0A 4GAPA 2JK6A 1H7WA 4RG3A 3Q9TA 3ICRA 2WEUA 4B64A 1OJCA 3KPKA 2YAUA 2BS2A 1PBDA 2GF3A 1V59A 4K8DA 3ALLA 2GVCA 2YG7A 2E1MA 1NENA 1SEZA 1Y56B 3V3OA 2BRAA 1DJNA 3P1WA 1NG3A 1M6IA 1ZY8A 2BK4A 4BV6A 2XVIA 3AE6A 1DODA 1GALA 1X31B 1N1PA 2YM1A 3CPHG 2EQ6A 4AP3A 3Q6JA 4JQ9A 2YLTA 1OJ9A 1ZP0A 3G5SA 2YQUA 4TM0A 4DSHA 5M0ZA 3GWDA 1COYA 1PHHA 2XFUA 1PXAA 2XFQA 4J36A 3K7QX 4J2WA 1Y0PA 4GRTA 3DA1A 3DJEA 5LV9A 2X99A 3NN6X 4H4YA 3AE5A 3ZDNA 4EMWA 1QJDA 5KVIA 3ZYXA 4OPTA 1H84A 1PXBA 2XVEA 1QLBA 4JDRA 1BZLA 3AYIA 5KRQA 2YR6A 5BRTA 3QSSA 1GPEA 2V6OA 2WQYA 1ZMDA 4H4RA 2R4JA 4KPRA 4BJYA 5HXIA 2WPCA 3NIXA 3FMWA 3G5RA 3SM8A 1S3BA 1ZOYA 3NN0X 4PAAA 2GR3A 4ADWA 1TDKA 3RP7A 1LPFA 1D4CA 3DK9A 2YVJA 2VOUA 4B63A 2V3BA 4FDCB 3ABVA 1GSNA 1NPXA 4DGKA 4YWOA 3IF9A 3T2KA 2DKIA 1GERA 1GTHA 1LQTA 1W4XA 1N4UA 2VRLA 1YKJA 5KOWA 4IVOB 4LU6A 5EOWA 2VQBA 2AAQA 2BXSA 1O5WA 2YWLA 3M12A 3NNEA 3LZXA 2FJBA 5DBJA 1OJAA 2CDUA 2V61A 4EM4A 4XWRA 2JB2A 3DJDA 1Y56A 3EANA 3ATQA 2QAEA 3PS9A 1TDOA 2R0PA 3DGHA 4H4UA 4ZN0A 3P4SA 4EQXA 2RGOA 3AE7A 1H86A 3F8DA 4OPUA 5KMSA 4G74A 1PS9A 2VRMA 3P9UA 1O95A 3URHA 3ADAB 4YSZA 3RP6A 1YQZA 5FMHA 4H4XA 1H2IA 5TR3A 3QSEA 4DSGA 3UOYA 5IPYA 4U8LA 1FEBA 1IUUA 2V3AA 2IIDA 2YG5A 2EQ7A 4U2LA 3UP4A 3VQRA 1NHPA 4USQA 5GSNA 2XYOA 2XFOA 2WS3A 3NK2X 4H7UA 4TLZA 1F8SA 1S7MA 4U8KA 3T0KA 3UTEA 1IJHA 2YLRA 3GD3A 1DOCA 4A6NB 1GOSA 4E0VA 2CFYA 1NAAA 4KX6A 2E5VA 4H4SA 3B3RA 3T14A 4EMIA 2GRTA 5JCKA 2NPXA 4NTDA 2J3NA 1FOHA 4C3YA 2OAMA 1JU2A 4YXDA 3T2YA 2WDRA 3EF6A 2WP9A 3CN8A 3AD9B 5FS8A 1CF3A 2C65A 1KN0A 3RP8A 4A5LA 1JRXA 1VG9A 2C66A 5EB5A 1IUXA 1Q1RA 5M10A 2WP6A 1PBEA 5HHFA 2ZZBA 5C3JA 3ITJA 3K7TA 1YY5A 4U2SA 4Y4MA 1ZKQA 2Y6RA 1E1KA 1MO9A 2C3CA 2X8CA 4EMJA 3NRNA 4BK2A 2Q6UA 3VRBA 3AE3A 4WX1A 4GDPA 3DJJA 1LVLA 2A87A 2YVGA 4OPIA 2R4EA 3AD7B 3UKAA 1PDHA 4H4WA 5ER0A 1EBDA 2GR1A 3CNTA 1K0LA 1B4VA 2JAEA 5C2TA 3FG2P 1E7PA 1LV0A 3SQPA 4TM4A 1Z6LA 1ZK7A 5GRTA 3UOZA 5U25A 3SZCA 4CCRA 2BC1A 4IVMB 4LIIA 4REKA 3WE0A 2JBVA 4B65A 3CGBA 3DMEA 4CBQA 4MJWA 1H81A 3I6DA 4GR1A 2WPFA 1XPQA 2Z5YA 5L46A 3UOVA 2GMJA 3AXBA 3HYXA 3M13A 4U8MA 3CIRA 3SZFA 1H83A 2R0CA 1FEAA 3B6DA 3UKLA 1GRGA 1OJTA 1K0JA 3AE2A 4K22A 1K0IA 4GF7A 3FPZA 2WESA 4C74A 1NHQA 4D04A 3OZ2A 4NTCA 1KF6A 2Q0LA 4YTPA 3IWAA 2B76A 2GAHB 1KSSA 3BNUA 1IUSA 4UP3A 2WOVA 4NEVA 1GEUA 3E1TA 1HYUA 2XVJA 2A8XA 3KA7A 3PVCA 4K5SA 3CGDA 4OPDA 4TM3A 5KMQA 5IQ4A 4H50A 1D4DA 4I59A 1GRTA 4EQWA 1PN0A 3LXDA 2QA2A 1E1MA 4G73A 4OCGA 5CQFA 4AT2A 3SY4A 3QFBA 5FS7A 1PXCA 3UOXA 3UKFA 3UTGA 3CPJG 3L8KA 1NEKA 1O94A 4H2RA 2GR0A 2YLZA 2BYBA 1L9EA 4XWZA 2OA1A 1E39A 4IV9A 3EPTA 4H4PA 4C77A 3ALJA 4JNQA 3ATRA 1GRHA 1B5QA 2XFNA 1GTEA 5FS6A 1YQ4A 1B37A 2Q7VA 2Y6QA 3NGCX 4N9XA 3SYIA 4CY8A 3COXA 1CJ2A 1D4EA 1E1LA 1S3EA 2ZBWA 1TDEA 3RHAA 3SZ0A 3LADA 3NHOX 4K5RA 3NT6A 2QCUA 2WHDA 4U8PA 3BHKA 1UKVG 3T2ZA 4H4QA 2BABA 4H2QA 2H88A 3K7MX 1LJ1A 5JCNA 4B66A 1KNPA 3P4RA 4U8JA 4U8IA 4NNJA 2XFPA 4FK1A 2BRYA 3F8RA 3AE9A 4RSLA 3DH9A 4U2TA 3SZWA 1PJ5A 3T37A 2YR4A 1DOEA 3QFAA 1CC6A 2B9YA 2BA9A 2BS3A 4OPCA 1KNRA 4USRA 3VRAA 2YG4A 3O0HA 3AWIA 1TYPA 3FBSA 4AT0A 4YSYA 3NK1X 3LB8A 2VQ7A 4C3XA 5KXJA 3H4KA 2B9WA 3GD4A 5JCLA 3UKKA 2FJAA 4D03A 1H82A 3SFDA 3KU9A 1CJCA 1PJ6A 1VDCA 1GESA 3QJ4A 2Q0KA 3S5WA 1GNDA 3KVEA 1ZX9A 2GH5A 2GB0A 3NTAA 2XLSA 3GYJA 4A65A 4LA1A 2PYXA 4U8NA 2C67A 3FIMB 3GRSA 4BURA 4J34A 1DJQA 4C5OA 2F5ZA 3CPIG 3AEDA 1L9CA 5HYMA 1Q1WA 2RGJA 2PHHA 3CNPA 3DGZA 1L9DA 1JRZA 3C4AA 4TM1A 4XXGA 4OPGA 2R45A 4X9NA 1CBOA 1ZDLA 2AQJA 1D5TA 1ELIA 4BK1A 5U63A 1TRBA 3AE8A 1B8SA 3GDNA 1ONFA 4H2NA 2FBWA 3SGLA 1CJ4A 2VZ2A 1VRQB 3LOVA 1D7LA 3UTFA 1S2YA 4I58A 2YG6A 1RSGA 3UKPA 1NDAA 2WETA 2X8GA 1JNRA 3UTHA 2WBAA 4H4VA 1AOGA 2C73A 1VQWA 2YR5A 2ACZA 4A79A 3NYEA 1JNZA 4K7ZA 1DOBA 3NG7X 2OLOA 2V60A 1NHRA 4GAVA 1IUTA 4EM3A 2XLUA 2ZZ0A 2C7GA 1CJ3A 1TDFA 5KVHA 3NTDA 1GT8A 5U1OA 2GQFA 2GQWA 1IUVA 2APGA 4O5QA 3GWFA 4J31A 4YSXA 2GV8A 3GYXA 2C72A 1PJ7A 1KSUA 4PABA 2EQ9A 2BCPA 2CULA 4UDQA 1F3PA 5HY5A 5J7XA 3LZWA 3PG6A 3QVRA 5JCMA 3CNJA 2Z5XA 4B67A 4X9MA 4II3A 3CNSA 2BK3A 4UDRA 1PBCA 4JNAA 2R9ZA 2VVMA 3ALMA 3GMCA 4JY3A 4O5UA 4A99A 4Z2RA 1K4QA 2X3NA 2GMHA 2YLXA 1LQUA 2C3DA 4AOSA 2C76A 5BVAA 3KLJA 3AECA 2GR2A 3C96A 3RNMA 4B69A 3II4A 2QA1A 2YLWA 3P4PA 4GUVA 1JEHA 2GAGB 3JSKA 2WP5A 1TYTA 1FCDA 4A7AA 3K30A 2TPRA 3D9XA 2C64A 3BNMA 5IQ1A 2B9XA 4EQSA 2B7SA 1ZOVA 1MXTA 4A6NA 3M0OA 4UDPA 3VR9A 2ARDA 4DNAA 4CCQA 2H89A 4BK3A 3V76A 4CY6A 3GYIA 1KDGA 3UCLA 4JY2A 3NH3X 2YLSA 3AYLA 3DK4A 2C4CA 2XVHA 4AP1A 1EL7A 3L5OA 1H6VA 3CGCA 1EL9A 2IVEA 4JN9A 1H7XA 4X4JA 1IUWA 4ICYA 2X8HA 4Z2UA 1BGJA 3CMMA 3UP5A 1LTXR 1DNCA 4H2PA 5BULA 1NG4A 4HA6A 5JCIA 2JKCA 1XHCA 5KWFA 3C4NA 5JRBA 3GMBA 4NTEA 1P2HA 3BI4A 3PO7A 1BF3A 3VRDB 2WU2A 3VR8A 1GREA 2W0HA 2YVFA 3GDPA 4Y4NA 3AEEA 4Z2TA 3GRTA 1XANA 4M52A 4ZCDA 2R46A 3SFEA 3BHFA 3R9UA 2X50A 2R0GA 1EL8A 4Z44A 2RABA 4CNJA 2WDQA 4YSHA 3ICTA 3ISHA 2CVJA 3BI5A 4FK1C 3OC4A 2XLPA 3AD8B 3EAOA 1GRFA 4G9KA 1EL5A 2XLTA 2WDVA 1DXLA 3AEAA 3T31A 5BUKA 3CTYA 2HQMA 2V5ZA 4Y4LA 4ZCCA 1CL0A 2GEWA 1QO8A 3QVPA 2E4GA 2EQ8A 4CRTA 4EQRA 2BK5A 2DKHA 2YM2A 4U8OA 3SXIA 4B1BA 4HB9A 3AYJA 4G6GA 1F8RA 2JB3A 1N4VA 4GCMA 2BACA 3REDA 2WU5A 4YTMA 2ZZCA 2O9ZA 5J60A 1FL2A 4CNKA 3CNDA 4EIQA 1NHSA 1RP0A 3NYCA 1XDIA 1ZMCA 2YG3A 3BI2A 3HYWA 3NK0X 1GRBA 1REOA 4BJZA 2BCGG 3IHMA 3AEGA 1GV4A 3G5QA 5KOXA 1Q9IA 1F6MA 1VG0A 4NWZA 1E6EA 2JB1A 4TLXA 5FS9A 5KNLA 3DK8A 4Z25A 2XVFA 3GSIA 2XCGA 4IA5A 1PBBA 1PBFA 5EBKA 4GDEA 2VVLA 3S61A 1JOAA 1GETA 4Z43A 2RGHA 2FJEA 5KMPA 3SX6A 1CHUA 4J57A 1N4WA 3KD9A 5EB4A 4FX9A 1KFYA 1TDNA 2C70A 3AE1A 1FECA 3DJGX 1RYIA 4NZHA 5CKUA 4Z24A 2UZZA 3AEFA 4NEWA 4APNA 2FJDA 3KKJA 4WCTA 4OPLA 1F8WA 4RG4A 2B7RA 2OLNA 2A89A 2VVLG 4AOXA 2OALA 2XLRA 4IA6A 4YKGA 3UKHA 2NVKX 2TMDA 3QSMA 1L0VA 3AE4A 1JRYA 3ICSA 4YTNA 3V3NA 2BS4A 3D8XA 1CC2A 4II2A 3L1RA 2IVDA 2C75A 1P2EA 3NYFA 3P4QA 1E1NA 1S2QA 1YQ3A 1D7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YKF A;  2XDO A;  4Z26 A;  1BGN A;  1OJD A;  4A9W A;  1MOK A;  3F8P A;  4YT0 A;  1GRA A;  2WOI A;  2WPE A;  4J56 A;  4K2X A;  3CGE A;  2BXR A;  4B68 A;  2WOW A;  1BKW A;  3HZL A;  4P9S A;  3H8L A;  1CC4 A;  2AR8 A;  3AB1 A;  3D1C A;  3LJP A;  1M64 A;  3UKQ A;  3NKS A;  4J33 A;  4ECH A;  3IC9 A;  4EIP A;  3NLC A;  4OVI A;  4H4T A;  3IHG A;  2I0Z A;  3AEB A;  3I3L A;  1GXF A;  1BWC A;  3H8I A;  3KPF A;  4H4Z A;  2BC0 A;  2JK6 A;  1H7W A;  4RG3 A;  3Q9T A;  3ICR A;  2WEU A;  4B64 A;  1OJC A;  2YAU A;  2BS2 A;  1PBD A;  2GF3 A;  1V59 A;  4K8D A;  3ALL A;  2GVC A;  2YG7 A;  2E1M A;  1NEN A;  1SEZ A;  1Y56 B;  3V3O A;  1DJN A;  3P1W A;  1NG3 A;  1M6I A;  1ZY8 A;  2BK4 A;  4BV6 A;  2XVI A;  3AE6 A;  1DOD A;  1GAL A;  1X31 B;  1N1P A;  2YM1 A;  3CPH G;  2EQ6 A;  4AP3 A;  3Q6J A;  4JQ9 A;  2YLT A;  1OJ9 A;  1ZP0 A;  3G5S A;  2YQU A;  4TM0 A;  4DSH A;  5M0Z A;  3GWD A;  1COY A;  1PHH A;  2XFU A;  1PXA A;  2XFQ A;  4J36 A;  3K7Q X;  4J2W A;  1Y0P A;  4GRT A;  3DA1 A;  3DJE A;  5LV9 A;  2X99 A;  3NN6 X;  4H4Y A;  3AE5 A;  3ZDN A;  4EMW A;  1QJD A;  5KVI A;  3ZYX A;  4OPT A;  1H84 A;  1PXB A;  2XVE A;  1QLB A;  4JDR A;  1BZL A;  3AYI A;  5KRQ A;  2YR6 A;  5BRT A;  3QSS A;  1GPE A;  2V6O A;  2WQY A;  1ZMD A;  4H4R A;  2R4J A;  4KPR A;  4BJY A;  5HXI A;  2WPC A;  3NIX A;  3FMW A;  3G5R A;  3SM8 A;  1S3B A;  1ZOY A;  3NN0 X;  4PAA A;  2GR3 A;  4ADW A;  1TDK A;  3RP7 A;  1LPF A;  1D4C A;  3DK9 A;  2YVJ A;  2VOU A;  4B63 A;  2V3B A;  4FDC B;  3ABV A;  1GSN A;  1NPX A;  4DGK A;  4YWO A;  3IF9 A;  2DKI A;  1GER A;  1LQT A;  1GTH A;  1W4X A;  1N4U A;  2VRL A;  1YKJ A;  5KOW A;  4IVO B;  4LU6 A;  5EOW A;  2VQB A;  2AAQ A;  2BXS A;  1O5W A;  2YWL A;  3M12 A;  3NNE A;  3LZX A;  2FJB A;  5DBJ A;  1OJA A;  2CDU A;  2V61 A;  4EM4 A;  4XWR A;  2JB2 A;  3DJD A;  1Y56 A;  3EAN A;  3ATQ A;  2QAE A;  3PS9 A;  1TDO A;  2R0P A;  3DGH A;  4H4U A;  4ZN0 A;  3P4S A;  4EQX A;  2RGO A;  3AE7 A;  1H86 A;  3F8D A;  4OPU A;  1PS9 A;  2VRM A;  3P9U A;  1O95 A;  3URH A;  3ADA B;  4YSZ A;  3RP6 A;  1YQZ A;  5FMH A;  4H4X A;  5IPY A;  5TR3 A;  3QSE A;  4DSG A;  3UOY A;  4U8L A;  1FEB A;  1IUU A;  2V3A A;  2IID A;  2YG5 A;  2EQ7 A;  4U2L A;  3UP4 A;  3VQR A;  1NHP A;  4USQ A;  5GSN A;  2XYO A;  2XFO A;  2WS3 A;  3NK2 X;  4H7U A;  4TLZ A;  1F8S A;  4U8K A;  3UTE A;  1IJH A;  2YLR A;  3GD3 A;  1DOC A;  4A6N B;  1GOS A;  4E0V A;  2CFY A;  1NAA A;  4KX6 A;  2E5V A;  4H4S A;  3B3R A;  4EMI A;  2GRT A;  5JCK A;  2NPX A;  4NTD A;  2J3N A;  1FOH A;  4C3Y A;  2OAM A;  1JU2 A;  4YXD A;  2WDR A;  3EF6 A;  2WP9 A;  3CN8 A;  3AD9 B;  5FS8 A;  1CF3 A;  2C65 A;  3RP8 A;  4A5L A;  1JRX A;  1VG9 A;  2C66 A;  5EB5 A;  1IUX A;  1Q1R A;  5M10 A;  2WP6 A;  1PBE A;  5HHF A;  2ZZB A;  5C3J A;  3ITJ A;  3K7T A;  1YY5 A;  4U2S A;  4Y4M A;  1ZKQ A;  2Y6R A;  1E1K A;  1MO9 A;  2C3C A;  2X8C A;  4EMJ A;  3NRN A;  4BK2 A;  2Q6U A;  3VRB A;  3AE3 A;  4WX1 A;  4GDP A;  3DJJ A;  1LVL A;  2A87 A;  2YVG A;  4OPI A;  2R4E A;  3AD7 B;  3UKA A;  1PDH A;  4H4W A;  5ER0 A;  1EBD A;  2GR1 A;  3CNT A;  1K0L A;  1B4V A;  2JAE A;  5C2T A;  3FG2 P;  1E7P A;  1LV0 A;  3SQP A;  4TM4 A;  1Z6L A;  1ZK7 A;  5GRT A;  3UOZ A;  5U25 A;  4CCR A;  2BC1 A;  4IVM B;  4LII A;  4REK A;  3WE0 A;  2JBV A;  4B65 A;  3CGB A;  3DME A;  4CBQ A;  4MJW A;  1H81 A;  3I6D A;  4GR1 A;  2WPF A;  1XPQ A;  2Z5Y A;  5L46 A;  3UOV A;  2GMJ A;  3AXB A;  3M13 A;  4U8M A;  3CIR A;  1H83 A;  2R0C A;  1FEA A;  3B6D A;  3UKL A;  1GRG A;  1OJT A;  1K0J A;  3AE2 A;  4K22 A;  1K0I A;  4GF7 A;  3FPZ A;  2WES A;  4C74 A;  1NHQ A;  4D04 A;  3OZ2 A;  4NTC A;  1KF6 A;  2Q0L A;  4YTP A;  3IWA A;  2B76 A;  2GAH B;  1KSS A;  3BNU A;  1IUS A;  4UP3 A;  2WOV A;  4NEV A;  1GEU A;  3E1T A;  1HYU A;  2XVJ A;  2A8X A;  3KA7 A;  3PVC A;  4K5S A;  3CGD A;  4OPD A;  4TM3 A;  5IQ4 A;  4H50 A;  1D4D A;  4I59 A;  1GRT A;  4EQW A;  1PN0 A;  3LXD A;  2QA2 A;  1E1M A;  4OCG A;  5CQF A;  4AT2 A;  3QFB A;  5FS7 A;  1PXC A;  3UOX A;  3UKF A;  3UTG A;  3CPJ G;  3L8K A;  1NEK A;  1O94 A;  4H2R A;  2GR0 A;  2YLZ A;  2BYB A;  1L9E A;  4XWZ A;  2OA1 A;  1E39 A;  4IV9 A;  3EPT A;  4H4P A;  4C77 A;  3ALJ A;  4JNQ A;  3ATR A;  1GRH A;  1B5Q A;  2XFN A;  1GTE A;  5FS6 A;  1YQ4 A;  1B37 A;  2Q7V A;  2Y6Q A;  3NGC X;  4N9X A;  4CY8 A;  3COX A;  1CJ2 A;  1D4E A;  1E1L A;  1S3E A;  2ZBW A;  1TDE A;  3RHA A;  3LAD A;  3NHO X;  4K5R A;  3NT6 A;  2QCU A;  2WHD A;  4U8P A;  3BHK A;  1UKV G;  4H4Q A;  2BAB A;  4H2Q A;  2H88 A;  3K7M X;  1LJ1 A;  5JCN A;  4B66 A;  1KNP A;  3P4R A;  4U8J A;  4U8I A;  2XFP A;  4FK1 A;  3F8R A;  3AE9 A;  4RSL A;  3DH9 A;  4U2T A;  1PJ5 A;  3T37 A;  2YR4 A;  1DOE A;  3QFA A;  1CC6 A;  2B9Y A;  2BA9 A;  2BS3 A;  4OPC A;  1KNR A;  4USR A;  3VRA A;  2YG4 A;  3O0H A;  3AWI A;  1TYP A;  3FBS A;  4AT0 A;  4YSY A;  3NK1 X;  3LB8 A;  2VQ7 A;  4C3X A;  5KXJ A;  3H4K A;  2B9W A;  3GD4 A;  5JCL A;  3UKK A;  2FJA A;  4D03 A;  1H82 A;  3SFD A;  3KU9 A;  1CJC A;  1PJ6 A;  1VDC A;  1GES A;  3QJ4 A;  2Q0K A;  3S5W A;  1GND A;  3KVE A;  1ZX9 A;  2GH5 A;  2GB0 A;  3NTA A;  2XLS A;  3GYJ A;  4A65 A;  4LA1 A;  2PYX A;  4U8N A;  2C67 A;  3FIM B;  3GRS A;  4BUR A;  4J34 A;  1DJQ A;  4C5O A;  2F5Z A;  3CPI G;  3AED A;  1L9C A;  5HYM A;  1Q1W A;  2RGJ A;  2PHH A;  3CNP A;  3DGZ A;  1L9D A;  1JRZ A;  3C4A A;  4TM1 A;  4XXG A;  4OPG A;  2R45 A;  4X9N A;  1CBO A;  1ZDL A;  2AQJ A;  1D5T A;  1ELI A;  4BK1 A;  5U63 A;  1TRB A;  3AE8 A;  1B8S A;  3GDN A;  1ONF A;  4H2N A;  2FBW A;  3SGL A;  1CJ4 A;  2VZ2 A;  1VRQ B;  3LOV A;  1D7L A;  3UTF A;  1S2Y A;  4I58 A;  2YG6 A;  1RSG A;  3UKP A;  1NDA A;  2WET A;  2X8G A;  1JNR A;  3UTH A;  2WBA A;  4H4V A;  1AOG A;  2C73 A;  1VQW A;  2YR5 A;  2ACZ A;  4A79 A;  3NYE A;  1JNZ A;  4K7Z A;  1DOB A;  3NG7 X;  2OLO A;  2V60 A;  1NHR A;  1IUT A;  4EM3 A;  2XLU A;  2ZZ0 A;  2C7G A;  1CJ3 A;  1TDF A;  5KVH A;  3NTD A;  1GT8 A;  5U1O A;  2GQF A;  2GQW A;  1IUV A;  2APG A;  4O5Q A;  3GWF A;  4J31 A;  4YSX A;  2GV8 A;  2C72 A;  1PJ7 A;  1KSU A;  4PAB A;  2EQ9 A;  2BCP A;  2CUL A;  4UDQ A;  1F3P A;  5HY5 A;  5J7X A;  3LZW A;  3QVR A;  5JCM A;  3CNJ A;  2Z5X A;  4B67 A;  4X9M A;  3CNS A;  2BK3 A;  4UDR A;  1PBC A;  4JNA A;  2R9Z A;  2VVM A;  3ALM A;  3GMC A;  4JY3 A;  4O5U A;  4A99 A;  4Z2R A;  1K4Q A;  2X3N A;  2GMH A;  2YLX A;  1LQU A;  2C3D A;  4AOS A;  2C76 A;  5BVA A;  3KLJ A;  3AEC A;  2GR2 A;  3C96 A;  3RNM A;  4B69 A;  3II4 A;  2QA1 A;  2YLW A;  3P4P A;  4GUV A;  1JEH A;  2GAG B;  3JSK A;  2WP5 A;  1TYT A;  1FCD A;  4A7A A;  3K30 A;  2TPR A;  2C64 A;  3BNM A;  5IQ1 A;  2B9X A;  4EQS A;  2B7S A;  1ZOV A;  1MXT A;  4A6N A;  3M0O A;  4UDP A;  3VR9 A;  2ARD A;  4DNA A;  4CCQ A;  2H89 A;  4BK3 A;  3V76 A;  4CY6 A;  3GYI A;  1KDG A;  3UCL A;  4JY2 A;  3NH3 X;  2YLS A;  3AYL A;  3DK4 A;  2XVH A;  4AP1 A;  1EL7 A;  1H6V A;  3CGC A;  1EL9 A;  2IVE A;  4JN9 A;  1H7X A;  4X4J A;  1IUW A;  4ICY A;  2X8H A;  4Z2U A;  1BGJ A;  3UP5 A;  1LTX R;  1DNC A;  4H2P A;  5BUL A;  1NG4 A;  4HA6 A;  5JCI A;  2JKC A;  1XHC A;  5KWF A;  3C4N A;  3GMB A;  4NTE A;  1P2H A;  3BI4 A;  3PO7 A;  1BF3 A;  3VRD B;  2WU2 A;  3VR8 A;  1GRE A;  2W0H A;  2YVF A;  3GDP A;  4Y4N A;  3AEE A;  4Z2T A;  3GRT A;  1XAN A;  4M52 A;  4ZCD A;  2R46 A;  3SFE A;  3BHF A;  3R9U A;  2X50 A;  2R0G A;  1EL8 A;  4Z44 A;  2RAB A;  4CNJ A;  2WDQ A;  4YSH A;  3ICT A;  3ISH A;  2CVJ A;  3BI5 A;  4FK1 C;  3OC4 A;  2XLP A;  3AD8 B;  3EAO A;  1GRF A;  1EL5 A;  2XLT A;  2WDV A;  1DXL A;  3AEA A;  5BUK A;  3CTY A;  2HQM A;  2V5Z A;  4Y4L A;  4ZCC A;  1CL0 A;  2GEW A;  1QO8 A;  3QVP A;  2E4G A;  2EQ8 A;  4CRT A;  4EQR A;  2BK5 A;  2DKH A;  2YM2 A;  4U8O A;  4B1B A;  4HB9 A;  3AYJ A;  1F8R A;  2JB3 A;  1N4V A;  4GCM A;  2BAC A;  3RED A;  2WU5 A;  4YTM A;  2ZZC A;  2O9Z A;  5J60 A;  1FL2 A;  4CNK A;  3CND A;  4EIQ A;  1NHS A;  1RP0 A;  3NYC A;  1XDI A;  1ZMC A;  2YG3 A;  3BI2 A;  3NK0 X;  1GRB A;  1REO A;  4BJZ A;  2BCG G;  3IHM A;  3AEG A;  1GV4 A;  3G5Q A;  5KOX A;  1Q9I A;  1F6M A;  1VG0 A;  1E6E A;  2JB1 A;  4TLX A;  5FS9 A;  3DK8 A;  4Z25 A;  2XVF A;  3GSI A;  2XCG A;  4IA5 A;  1PBB A;  1PBF A;  5EBK A;  4GDE A;  2VVL A;  3S61 A;  1JOA A;  1GET A;  4Z43 A;  2RGH A;  2FJE A;  1CHU A;  4J57 A;  1N4W A;  3KD9 A;  5EB4 A;  4FX9 A;  1KFY A;  1TDN A;  2C70 A;  3AE1 A;  1FEC A;  3DJG X;  1RYI A;  4NZH A;  5CKU A;  4Z24 A;  2UZZ A;  3AEF A;  4NEW A;  4APN A;  2FJD A;  3KKJ A;  4WCT A;  4OPL A;  1F8W A;  4RG4 A;  2B7R A;  2OLN A;  2A89 A;  2VVL G;  4AOX A;  2OAL A;  2XLR A;  4IA6 A;  4YKG A;  3UKH A;  2NVK X;  2TMD A;  3QSM A;  1L0V A;  3AE4 A;  1JRY A;  3ICS A;  4YTN A;  3V3N A;  2BS4 A;  3D8X A;  1CC2 A;  3L1R A;  2IVD A;  2C75 A;  1P2E A;  3NYF A;  3P4Q A;  1E1N A;  1S2Q A;  1YQ3 A;  1D7Y A; 
#chains in the Genus database with same CATH topology
 2XDO A;  4Z26 A;  1OJD A;  4YT0 A;  1GRA A;  2PP3 A;  3CGE A;  2BXR A;  2W54 A;  3SR6 B;  3D1C A;  3UKQ A;  1M64 A;  3IC9 A;  4EIP A;  3NLC A;  4OVI A;  4H4T A;  3VDG A;  3KPF A;  2BC0 A;  2JK6 A;  1H7W A;  4RG3 A;  4GYP A;  3A7A A;  3ICR A;  3EKG A;  2YAU A;  3NO1 A;  2BS2 A;  3UGV A;  1PBD A;  2GF3 A;  3ALL A;  2GVC A;  3V3O A;  1TZZ A;  3R0K A;  1DOD A;  1GAL A;  1X31 B;  1N1P A;  4AP3 A;  3Q6J A;  4JQ9 A;  2GGJ A;  1OJ9 A;  3OP2 A;  4G7F A;  3GWD A;  2XFU A;  1SB3 B;  3K7Q X;  3DJE A;  1FHU A;  3AE5 A;  4OPT A;  1PXB A;  3AYI A;  5KRQ A;  2YR6 A;  5BRT A;  5BOF A;  3PWG A;  4JHM A;  4GIR A;  3SSZ A;  4KPR A;  5HXI A;  2WPC A;  3G5R A;  3SM8 A;  1S3B A;  2GR3 A;  1TDK A;  4B63 A;  4FDC B;  3FCP A;  1NPX A;  3IF9 A;  2DKI A;  2VRL A;  1YKJ A;  4DX3 A;  3LZX A;  2V61 A;  4XWR A;  1Y56 A;  1TDO A;  3JW7 A;  2R0P A;  1FFU C;  1X2G A;  4ZN0 A;  5KMS A;  4OPU A;  2XSX A;  1YQZ A;  1H2I A;  1NHP A;  5GSN A;  2XYO A;  4H7U A;  1F8S A;  4U8K A;  3UTE A;  1IJH A;  1EBG A;  2CFY A;  1NAA A;  4KX6 A;  3HRD C;  4NTD A;  3RCY A;  4E4F A;  1XPY A;  1ELS A;  1JU2 A;  3T2Y A;  2WDR A;  2HZG A;  3EF6 A;  4A5L A;  1JRX A;  3CK5 A;  1Q1R A;  2DW7 A;  2WP6 A;  1SJD A;  4U2S A;  4Y4M A;  1ZKQ A;  1MO9 A;  3NRN A;  3VRB A;  1KCZ A;  2A87 A;  1WUE A;  2R4E A;  3AD7 B;  5FJP A;  4IL2 A;  2JAE A;  5C2T A;  3FG2 P;  1E7P A;  1LV0 A;  3B9J B;  2BC1 A;  4IVM B;  4LII A;  4REK A;  4EWJ A;  3I6D A;  2WPF A;  3M13 A;  3SBF A;  3B6D A;  3UKL A;  4GF7 A;  3FPZ A;  1TKK A;  3OZ2 A;  1KSS A;  2NQL A;  3E1T A;  5KMQ A;  1JPD X;  5IQ4 A;  4H50 A;  1GRT A;  4EQW A;  1E1M A;  5G5G B;  1VDV A;  1BKH A;  3OW1 A;  2YLZ A;  4XWZ A;  2OA1 A;  1SJA A;  4IV9 A;  1YEY A;  3EPT A;  3ATR A;  2XFN A;  4X2P A;  1YQ4 A;  1B37 A;  1TE6 A;  3NZG A;  3COX A;  1TDE A;  1KKR A;  3LAD A;  4K5R A;  2WHD A;  2ZAD A;  4U8P A;  3OZM A;  4B66 A;  4MGG A;  2P8B A;  4U2T A;  3A7R A;  3VRA A;  4YSY A;  3LB8 A;  4C3X A;  5KXJ A;  2AL2 A;  3GD4 A;  3S5W A;  4YWS A;  4A65 A;  2PYX A;  3NS1 B;  4BUR A;  3CPI G;  3AED A;  1Q1W A;  3CNP A;  4XXG A;  4OPG A;  4DXK A;  1FIQ B;  1ELI A;  3SGL A;  1CJ4 A;  1AOG A;  2QDE A;  1VQW A;  3NYE A;  1JNZ A;  1DOB A;  2OLO A;  1NHR A;  1IUT A;  3TWB A;  2GQF A;  4O5Q A;  2C72 A;  1KSU A;  2BCP A;  4UDQ A;  3LZW A;  3QVR A;  5JCM A;  4II3 A;  3TCS A;  2R9Z A;  2VVM A;  3DGB A;  2GMH A;  3DDM A;  5BVA A;  4GGB A;  3RNM A;  4B69 A;  3Q45 A;  3P4P A;  1TYT A;  4A7A A;  1JPM A;  2B9X A;  4A6N A;  3NVY B;  3UCL A;  3NH3 X;  1EL7 A;  1LTX R;  5BUL A;  4HA6 A;  4HYR A;  1EC7 A;  1XHC A;  4A35 A;  5JRB A;  4NTE A;  1P2H A;  4Y4N A;  4Z2T A;  4M52 A;  4ZCD A;  4CNJ A;  3NXL A;  2CVJ A;  3BI5 A;  3EAO A;  3ZVI A;  2WDV A;  4J3Z A;  3AN1 A;  2V5Z A;  1CL0 A;  1MDL A;  2YM2 A;  4HB9 A;  4G6G A;  1F8R A;  1FFV C;  2BAC A;  1FL2 A;  3CND A;  5EU9 A;  2YG3 A;  3BI2 A;  1REO A;  3MZN A;  1Q9I A;  3MKC A;  1P43 A;  3S47 A;  2RDX A;  5FS9 A;  3PWI A;  3GSI A;  2QJM A;  2HXT A;  3S61 A;  4Z43 A;  2AKZ A;  2GDQ A;  3BSM A;  4HCH A;  5KMP A;  4FX9 A;  1TDN A;  2C70 A;  5BOE A;  2OQH A;  2UZZ A;  4OPL A;  2B7R A;  2VVL G;  2OAL A;  4IA6 A;  4YTN A;  2AKM A;  3V3N A;  1YQ3 A;  1BGN A;  2W3R A;  2WOI A;  3HZL A;  2HXU A;  2E3T A;  3A7U A;  1CC4 A;  3H8L A;  2AR8 A;  4ECH A;  3NKS A;  4J33 A;  3R25 A;  3HYV A;  4G6H A;  4GGH A;  3IJL A;  3ENL A;  1BWC A;  4H4Z A;  3Q9T A;  4K8D A;  1NG3 A;  1M6I A;  1ZY8 A;  2XVI A;  3AE6 A;  1MUC A;  2XH4 A;  2YLT A;  3H8A A;  1ZP0 A;  5M0Z A;  1COY A;  1PXA A;  1SJC A;  4J2W A;  4GRT A;  2X99 A;  3ZYX A;  3ZDN A;  4EMW A;  5KVI A;  3UJS A;  2QGY A;  1ZMD A;  2R4J A;  4BJY A;  3FMW A;  1LPF A;  4KWS A;  2YVJ A;  2VOU A;  2PPG A;  2OZT A;  3ABV A;  1GSN A;  3FYY A;  1GER A;  1GTH A;  4H19 A;  1W4X A;  1N4U A;  2E5A A;  4IVO B;  2VQB A;  2FJB A;  5G5H B;  2JB2 A;  3DJD A;  3EAN A;  3B97 A;  3R10 A;  3P4S A;  3AE7 A;  1PS9 A;  3PFR A;  5TR3 A;  3QSE A;  1N62 C;  2YG5 A;  2IID A;  3N6J A;  4USQ A;  2XFO A;  4TLZ A;  3GD3 A;  1GOS A;  3T14 A;  4EMI A;  2GRT A;  2J3N A;  1FOH A;  4YXD A;  3ETR B;  3RR1 A;  3RP8 A;  1CF3 A;  1PBE A;  5HHF A;  2ZZB A;  5C3J A;  3ITJ A;  1YY5 A;  4Z1Y A;  2X8C A;  2C3C A;  4EMJ A;  4GDP A;  1LVL A;  5FJT A;  1N60 C;  3RIT A;  2OZ8 A;  1Z6L A;  1ZK7 A;  2PTW A;  3SZC A;  3WE0 A;  2JBV A;  3DME A;  4MJW A;  1H81 A;  4GR1 A;  2Z5Y A;  3HYX A;  4U8M A;  1NEL A;  3SZF A;  1FEA A;  2QDD A;  1K0J A;  1K0I A;  1NHQ A;  4D04 A;  2OZ3 A;  2Q0L A;  3IWA A;  3TQP A;  2B76 A;  2QVH A;  3BNU A;  3UCD A;  2WOV A;  3KA7 A;  1GEU A;  1HYU A;  2XVJ A;  4OPD A;  1D4D A;  2XH2 A;  1PN0 A;  4AT2 A;  4FI4 A;  1PXC A;  3NVV B;  3DG7 A;  3OPS A;  3UTG A;  2PTX A;  4H2R A;  3VCN A;  3RRA A;  4C77 A;  3ALJ A;  1GTE A;  2P8C A;  2XGZ A;  5FS6 A;  2Q7V A;  3SYI A;  1CJ2 A;  1E1L A;  3D47 A;  2QCU A;  3BHK A;  4IT1 A;  3T2Z A;  3K7M X;  5JCN A;  2O56 A;  1RVK A;  1KNP A;  4NNJ A;  3AE9 A;  3ZLG A;  3SZW A;  1DOE A;  2BA9 A;  4USR A;  2YG4 A;  3FBS A;  4H1Z A;  3H4K A;  2B9W A;  2FJA A;  1H82 A;  3SFD A;  1CJC A;  2Q0K A;  3TW9 A;  3KVE A;  2GH5 A;  4LA1 A;  4U8N A;  4J34 A;  1DJQ A;  3R1Z A;  1L9C A;  4M0X A;  3JZU A;  2PHH A;  3QLD A;  5J04 A;  2R45 A;  2OO6 A;  2AQJ A;  1D5T A;  5U63 A;  1TRB A;  3DFY A;  3FV9 A;  4H2N A;  2VZ2 A;  1X2H A;  1S2Y A;  1RSG A;  3UKP A;  1NDA A;  2WET A;  2X8G A;  2OLA A;  1JNR A;  3UTH A;  2ACZ A;  4A79 A;  1V97 A;  2ZZ0 A;  1CJ3 A;  1TDF A;  5KVH A;  3NTD A;  4E4U A;  3GWF A;  2GV8 A;  3PK7 A;  4B67 A;  3VA8 A;  2Z5X A;  4X9M A;  2BK3 A;  3EEZ A;  4UDR A;  2ZC8 A;  3GMC A;  4Z2R A;  2OFJ A;  1K4Q A;  2X3N A;  1LQU A;  2C3D A;  3KLJ A;  3AEC A;  3II4 A;  2QQ6 A;  3T6C A;  3K30 A;  4EQS A;  4KPL A;  2ARD A;  4CCQ A;  4BK3 A;  4CY6 A;  1DTN A;  4JY2 A;  3AYL A;  3ZVH A;  1RM6 B;  3CGC A;  1KKO A;  4Z2U A;  1BGJ A;  1WUF A;  4MMW A;  1DNC A;  4H2P A;  5JCI A;  2JKC A;  4ZA0 A;  3RO6 A;  3C4N A;  3BI4 A;  1BF3 A;  1XAN A;  3SFE A;  3R9U A;  3ISH A;  1JRO A;  4FK1 C;  3TJ4 A;  1EL5 A;  2HQM A;  4Y4L A;  4ZCC A;  5ENL A;  3QVP A;  2E4G A;  1L8P A;  2BK5 A;  3SXI A;  4B1B A;  1SJB A;  3RED A;  2WU5 A;  4YTM A;  1OEP A;  2O9Z A;  4CNK A;  4EIQ A;  3UXK A;  3NK0 X;  1GRB A;  3G5Q A;  1E6E A;  2JB1 A;  4KEM A;  4TLX A;  3DK8 A;  4Z25 A;  4A3R A;  3GD6 A;  4IA5 A;  1PBB A;  1PBF A;  3NRZ B;  4GDE A;  3SN1 A;  3N4E A;  3ZLF A;  3SX6 A;  4J57 A;  1N4W A;  1FEC A;  4H2H A;  3DJG X;  1RYI A;  3DFH A;  3KKJ A;  4NEW A;  4APN A;  4ROP A;  4JN7 A;  2PA6 A;  3QKE A;  2A89 A;  4AOX A;  3T8Q A;  2XLR A;  2AL1 A;  2NVK X;  2TMD A;  1L0V A;  3AE4 A;  2BS4 A;  3D8X A;  3L1R A;  2C75 A;  1P2E A;  3K1G A;  4J56 A;  4B68 A;  1BKW A;  4P9S A;  1VQZ A;  2CHR A;  3LJP A;  3R11 A;  4KT2 A;  2WEU A;  1OJC A;  3KPK A;  3FJ4 A;  3CAW A;  1V59 A;  1MDR A;  2YG7 A;  2E1M A;  2PGW A;  1NEN A;  2BRA A;  1DJN A;  3P1W A;  2BK4 A;  4BV6 A;  5FJO A;  3CB3 A;  2EQ6 A;  2QJJ A;  3G5S A;  2YQU A;  4DSH A;  4FP1 A;  1PHH A;  2XFQ A;  3MUC A;  4IP4 A;  3VC5 A;  3ZLH A;  3NN6 X;  1QJD A;  4ZCW A;  1H84 A;  1GPE A;  2V6O A;  2WQY A;  3CYJ A;  1ZOY A;  3NN0 X;  3RP7 A;  4ADW A;  1D4C A;  3U4F A;  4HN8 A;  3T2K A;  3IK4 A;  3QTP A;  5KOW A;  2AAQ A;  2BXS A;  1O5W A;  2YWL A;  3M12 A;  5DBJ A;  3KUM A;  1E9I A;  3TWA A;  3ATQ A;  3DGH A;  4H4U A;  1PDZ A;  1H86 A;  4G74 A;  2GGE A;  3BOX A;  3ADA B;  4YSZ A;  3RP6 A;  4H4X A;  1NU5 A;  3QPE A;  3UOY A;  4DSG A;  4U8L A;  1FEB A;  2V3A A;  3VQR A;  3T0K A;  1DOC A;  4A6N B;  4E0V A;  4H4S A;  3B3R A;  2HNE A;  2NPX A;  3V5F A;  4C3Y A;  3GY1 A;  3BJS A;  3N6H A;  3CN8 A;  3V4B A;  4A6G A;  3AD9 B;  2FYM A;  4TVY A;  3K7T A;  4HNC A;  2P88 A;  1E1K A;  3AE3 A;  4WX1 A;  3DJJ A;  2YVG A;  4GYP C;  4OPI A;  1EBD A;  1K0L A;  1B4V A;  2P0I A;  4K8G A;  3NVZ B;  2GL5 A;  2PU0 A;  4TM4 A;  5GRT A;  3UOZ A;  4E6M A;  4CBQ A;  1XPQ A;  5L46 A;  3UOV A;  2GMJ A;  3AXB A;  4JN8 A;  1H83 A;  2R0C A;  1OJT A;  4K22 A;  3H12 A;  4E5T A;  4NTC A;  3DG6 A;  1KF6 A;  4YTP A;  1IUS A;  4UP3 A;  4NEV A;  3PVC A;  4TM3 A;  3CGD A;  2PSN A;  1PDY A;  4G73 A;  3QFB A;  3UOX A;  3UKF A;  3L8K A;  1NEK A;  1L9E A;  2P3Z A;  4H4P A;  4JNQ A;  1B5Q A;  2Y6Q A;  1S3E A;  2ZBW A;  3RHA A;  3NHO X;  3NT6 A;  1UKV G;  4H4Q A;  4H2Q A;  3UCC A;  2OVL A;  3P4R A;  4U8J A;  2XFP A;  3TOY A;  2BRY A;  3F8R A;  3VC6 A;  2OKT A;  1PJ5 A;  3QFA A;  1CC6 A;  2B9Y A;  4TVW A;  4OPC A;  3O0H A;  1TYP A;  3NK1 X;  3JVA A;  3THU A;  3DES A;  5JCL A;  3UKK A;  4D03 A;  2PU1 A;  3KU9 A;  1PJ6 A;  1GES A;  3QJ4 A;  1GND A;  3NTA A;  2XLS A;  3GYJ A;  1ZXI C;  3GRS A;  2F5Z A;  5HYM A;  3DGZ A;  1JRZ A;  4TM1 A;  1ZDL A;  4BK1 A;  3FVD A;  3AE8 A;  1B8S A;  2I5Q A;  1D7L A;  3UTF A;  2GGH A;  2YG6 A;  3STP A;  2WBA A;  4H4V A;  4K7Z A;  2V60 A;  3GC2 A;  1XS2 A;  4GAV A;  4EM3 A;  2C7G A;  1GT8 A;  5U1O A;  2GQW A;  2APG A;  4YSX A;  4GME A;  3GYX A;  1N5X A;  3T4W A;  1PJ7 A;  4PAB A;  2PP1 A;  1F3P A;  5HY5 A;  5J7X A;  2PTY A;  3ALM A;  4JY3 A;  4O5U A;  4H83 A;  4AOS A;  3QN3 A;  2GR2 A;  3C96 A;  4J1O A;  2QA1 A;  2YLW A;  3DEQ A;  2WP5 A;  3R07 C;  1FCD A;  2QJN A;  2TPR A;  3D9X A;  2C64 A;  5IQ1 A;  3I4K A;  2B7S A;  1ZOV A;  3TJI A;  3M0O A;  3H7V A;  3V76 A;  4GIS A;  1KDG A;  3GYI A;  2YLS A;  2C4C A;  2XVH A;  2POZ A;  2PTZ A;  4AP1 A;  3L5O A;  1H6V A;  2IVE A;  1EL9 A;  4JN9 A;  4ICY A;  2X8H A;  3CMM A;  1NG4 A;  5KWF A;  4DN1 A;  1R0M A;  3VRD B;  1EC8 A;  1GRE A;  2W0H A;  3AEE A;  3GRT A;  2R46 A;  2GGG A;  2X50 A;  2R0G A;  1EL8 A;  4Z44 A;  2RAB A;  4G8T A;  4YSH A;  3ICT A;  3OC4 A;  2XLP A;  3T31 A;  1DXL A;  1T3Q C;  1QO8 A;  3DER A;  4CRT A;  1JRP A;  3AYJ A;  2JB3 A;  3UJE A;  1RP0 A;  3NYC A;  1XDI A;  3GO2 A;  3HYW A;  3AEG A;  4ZOH B;  2XVF A;  3V5C A;  2XCG A;  4HCL A;  2VVL A;  2FJE A;  3CXO A;  5EB4 A;  1KFY A;  3AE1 A;  2MNR A;  4NZH A;  5CKU A;  3AEF A;  4F4R A;  2FJD A;  4WCT A;  4RG4 A;  2OLN A;  3CXB A;  6ENL A;  3V3W A;  4IP5 A;  4II2 A;  1CC2 A;  3NYF A;  1E1N A;  1S2Q A;  3CNJ A;  3MY9 A;  1D7Y A;  4YKF A;  4A9W A;  1MOK A;  3F8P A;  2WPE A;  4K2X A;  2GSH A;  2WOW A;  5KMR A;  3AB1 A;  2XH7 A;  3CT2 A;  3RGT A;  3IHG A;  2I0Z A;  3AEB A;  3I3L A;  1GXF A;  3H8I A;  4GAP A;  1STZ A;  2OQY A;  3ES7 A;  4B64 A;  1EC9 A;  2GGI A;  1SEZ A;  1Y56 B;  1F9C A;  4E8G A;  3MWC A;  3S5S A;  3R0U A;  3CPH G;  2YM1 A;  3VCC A;  2FKP A;  1N5W C;  4TM0 A;  3SN0 A;  1R6W A;  4J36 A;  1Y0P A;  4IL0 A;  3DA1 A;  5LV9 A;  4H4Y A;  2XVE A;  1QLB A;  4JDR A;  1BZL A;  1ONE A;  3QSS A;  3P93 A;  3Q4D A;  1WYG A;  4H4R A;  1FHV A;  3NIX A;  4PAA A;  3P0W A;  3DK9 A;  2V3B A;  4DGK A;  4YWO A;  3NVW B;  1LQT A;  3UJF A;  4Z17 A;  4LU6 A;  3AM9 A;  5EOW A;  3NNE A;  1OJA A;  2CDU A;  4EM4 A;  2QAE A;  3PS9 A;  4IHC A;  3OTR A;  4EQX A;  2RGO A;  4HPN A;  3F8D A;  2DW6 A;  2VRM A;  3P9U A;  3P3B A;  1O95 A;  3URH A;  5FMH A;  5IPY A;  1IUU A;  4U2L A;  2EQ7 A;  3UP4 A;  3NK2 X;  2WS3 A;  1S7M A;  2YLR A;  3H70 A;  3IJQ A;  2E5V A;  2OG9 A;  5JCK A;  3ZVH B;  2OAM A;  2MUC A;  3AMZ A;  2WP9 A;  5FS8 A;  2C65 A;  1KN0 A;  3ES8 A;  1VG9 A;  4M6U A;  3N4F A;  2C66 A;  1IUX A;  5EB5 A;  5M10 A;  1IYX A;  1W6T A;  2Y6R A;  4BK2 A;  2Q6U A;  1N61 C;  3UKA A;  1PDH A;  4K2S A;  4H4W A;  5ER0 A;  2GR1 A;  3CNT A;  2PGE A;  5FJU A;  3TTE A;  3SQP A;  5U25 A;  4CCR A;  4B65 A;  3CGB A;  3HW2 A;  3CIR A;  2AL2 B;  1GRG A;  3AE2 A;  2WES A;  4C74 A;  2POD A;  2GAH B;  2W3S A;  4K5S A;  4HCD A;  2A8X A;  1BQG A;  4I59 A;  3LXD A;  2QA2 A;  4OCG A;  5CQF A;  3SY4 A;  5FS7 A;  3CPJ G;  1O94 A;  4DYE A;  3U9I A;  2GR0 A;  2BYB A;  3SQS A;  1E39 A;  3FXG A;  1KD0 A;  1GRH A;  3NGC X;  1EBH A;  4CY8 A;  4N9X A;  1D4E A;  2PS2 A;  3SZ0 A;  3IJI A;  2BAB A;  2H88 A;  1LJ1 A;  4U8I A;  4FK1 A;  4RSL A;  3DH9 A;  3NFU A;  3T37 A;  4IZG A;  2BS3 A;  2YR4 A;  4AT0 A;  1KNR A;  3AWI A;  4DWD A;  2VQ7 A;  7ENL A;  1VDC A;  1ZX9 A;  2GB0 A;  1MRA A;  2C67 A;  2W55 A;  3FIM B;  4C5O A;  2RGJ A;  1L9D A;  3C4A A;  4X9N A;  1CBO A;  2XH0 A;  3GDN A;  1ONF A;  2FBW A;  3MQT A;  1VRQ B;  3LOV A;  1P48 A;  4I58 A;  2C73 A;  2YR5 A;  4HNL A;  3NG7 X;  1MNS A;  2XLU A;  3UJR A;  3SJN A;  3EUB 3;  1IUV A;  4J31 A;  1FO4 A;  5IDZ A;  2EQ9 A;  4ENL A;  2CUL A;  3PG6 A;  1ECQ A;  1N63 C;  3CNS A;  1PBC A;  4JNA A;  3DIP A;  4A99 A;  2YLX A;  3OZY A;  4GUV A;  1JEH A;  2GAG B;  3JSK A;  3HPF A;  5FJR A;  3BNM A;  1MXT A;  4UDP A;  3VR9 A;  4DNA A;  2H89 A;  3DK4 A;  1H7X A;  4X4J A;  1IUW A;  3UP5 A;  3DG3 A;  2PP0 A;  2PMQ A;  4MKS A;  3SN4 A;  3GMB A;  3PO7 A;  3D46 A;  1JCT A;  2WU2 A;  3VR8 A;  2YVF A;  3GDP A;  3BHF A;  2WDQ A;  3AD8 B;  1GRF A;  4G9K A;  2XLT A;  5BUK A;  3AEA A;  3I6E A;  3CTY A;  2GEW A;  2EQ8 A;  4EQR A;  2DKH A;  4U8O A;  2OX4 A;  1N4V A;  4GCM A;  2ZZC A;  4DHG A;  1JDF A;  3VFC A;  5J60 A;  1NHS A;  1ZMC A;  4BJZ A;  2BCG G;  4GFI A;  3IHM A;  1GV4 A;  5KOX A;  1F6M A;  1VG0 A;  4NWZ A;  2OPJ A;  3UJ2 A;  5KNL A;  2ONE A;  5EBK A;  1JOA A;  1GET A;  2RGH A;  3I6T A;  1CHU A;  3KD9 A;  3UXL A;  4Z24 A;  1F8W A;  3T9P A;  3MSY A;  4YKG A;  3UKH A;  3QSM A;  3ICS A;  4K1W A;  1JRY A;  2PCE A;  2IVD A;  3P4Q A;  2C76 A; 
#chains in the Genus database with same CATH homology
 4YKF A;  2XDO A;  4Z26 A;  1BGN A;  1OJD A;  4A9W A;  1MOK A;  3F8P A;  4YT0 A;  1GRA A;  2WOI A;  2WPE A;  4J56 A;  4K2X A;  3CGE A;  2BXR A;  4B68 A;  2WOW A;  1BKW A;  3HZL A;  4P9S A;  3H8L A;  1CC4 A;  5KMR A;  2AR8 A;  3AB1 A;  3D1C A;  3LJP A;  1M64 A;  3UKQ A;  3NKS A;  4J33 A;  4ECH A;  3HYV A;  4G6H A;  3IC9 A;  4EIP A;  3NLC A;  4OVI A;  4H4T A;  3IHG A;  2I0Z A;  3AEB A;  3I3L A;  1GXF A;  1BWC A;  3H8I A;  3KPF A;  4H4Z A;  2BC0 A;  4GAP A;  2JK6 A;  1H7W A;  4RG3 A;  3Q9T A;  3ICR A;  2WEU A;  4B64 A;  1OJC A;  3KPK A;  2YAU A;  2BS2 A;  1PBD A;  2GF3 A;  1V59 A;  4K8D A;  3ALL A;  2GVC A;  2YG7 A;  2E1M A;  1NEN A;  1SEZ A;  1Y56 B;  3V3O A;  2BRA A;  1DJN A;  3P1W A;  1NG3 A;  1M6I A;  1ZY8 A;  2BK4 A;  4BV6 A;  2XVI A;  3AE6 A;  1DOD A;  1GAL A;  1X31 B;  1N1P A;  2YM1 A;  3CPH G;  2EQ6 A;  4AP3 A;  3Q6J A;  4JQ9 A;  2YLT A;  1OJ9 A;  1ZP0 A;  3G5S A;  2YQU A;  4TM0 A;  4DSH A;  5M0Z A;  3GWD A;  1COY A;  1PHH A;  2XFU A;  1PXA A;  2XFQ A;  4J36 A;  3K7Q X;  4J2W A;  1Y0P A;  4GRT A;  3DA1 A;  3DJE A;  5LV9 A;  2X99 A;  3NN6 X;  4H4Y A;  3AE5 A;  3ZDN A;  4EMW A;  1QJD A;  5KVI A;  3ZYX A;  4OPT A;  1H84 A;  1PXB A;  2XVE A;  1QLB A;  4JDR A;  1BZL A;  3AYI A;  5KRQ A;  2YR6 A;  5BRT A;  3QSS A;  1GPE A;  2V6O A;  2WQY A;  1ZMD A;  4H4R A;  2R4J A;  4KPR A;  4BJY A;  5HXI A;  2WPC A;  3NIX A;  3FMW A;  3G5R A;  3SM8 A;  1S3B A;  1ZOY A;  3NN0 X;  4PAA A;  2GR3 A;  4ADW A;  1TDK A;  3RP7 A;  1LPF A;  1D4C A;  3DK9 A;  2YVJ A;  2VOU A;  4B63 A;  2V3B A;  4FDC B;  3ABV A;  1GSN A;  1NPX A;  4DGK A;  4YWO A;  3IF9 A;  3T2K A;  2DKI A;  1GER A;  1GTH A;  1LQT A;  1W4X A;  1N4U A;  2VRL A;  1YKJ A;  5KOW A;  4IVO B;  4LU6 A;  5EOW A;  2VQB A;  2AAQ A;  2BXS A;  1O5W A;  2YWL A;  3M12 A;  3NNE A;  3LZX A;  2FJB A;  5DBJ A;  1OJA A;  2CDU A;  2V61 A;  4EM4 A;  4XWR A;  2JB2 A;  3DJD A;  1Y56 A;  3EAN A;  3ATQ A;  2QAE A;  3PS9 A;  1TDO A;  2R0P A;  3DGH A;  4H4U A;  4ZN0 A;  3P4S A;  4EQX A;  2RGO A;  3AE7 A;  1H86 A;  3F8D A;  4OPU A;  5KMS A;  4G74 A;  1PS9 A;  2VRM A;  3P9U A;  1O95 A;  3URH A;  3ADA B;  4YSZ A;  3RP6 A;  1YQZ A;  5FMH A;  4H4X A;  1H2I A;  5TR3 A;  3QSE A;  4DSG A;  3UOY A;  5IPY A;  4U8L A;  1FEB A;  1IUU A;  2V3A A;  2IID A;  2YG5 A;  2EQ7 A;  4U2L A;  3UP4 A;  3VQR A;  1NHP A;  4USQ A;  5GSN A;  2XYO A;  2XFO A;  2WS3 A;  3NK2 X;  4H7U A;  4TLZ A;  1F8S A;  1S7M A;  4U8K A;  3T0K A;  3UTE A;  1IJH A;  2YLR A;  3GD3 A;  1DOC A;  4A6N B;  1GOS A;  4E0V A;  2CFY A;  1NAA A;  4KX6 A;  2E5V A;  4H4S A;  3B3R A;  3T14 A;  4EMI A;  2GRT A;  5JCK A;  2NPX A;  4NTD A;  2J3N A;  1FOH A;  4C3Y A;  2OAM A;  1JU2 A;  4YXD A;  3T2Y A;  2WDR A;  3EF6 A;  2WP9 A;  3CN8 A;  3AD9 B;  5FS8 A;  1CF3 A;  2C65 A;  1KN0 A;  3RP8 A;  4A5L A;  1JRX A;  1VG9 A;  2C66 A;  5EB5 A;  1IUX A;  1Q1R A;  5M10 A;  2WP6 A;  1PBE A;  5HHF A;  2ZZB A;  5C3J A;  3ITJ A;  3K7T A;  1YY5 A;  4U2S A;  4Y4M A;  1ZKQ A;  2Y6R A;  1E1K A;  1MO9 A;  2C3C A;  2X8C A;  4EMJ A;  3NRN A;  4BK2 A;  2Q6U A;  3VRB A;  3AE3 A;  4WX1 A;  4GDP A;  3DJJ A;  1LVL A;  2A87 A;  2YVG A;  4OPI A;  2R4E A;  3AD7 B;  3UKA A;  1PDH A;  4H4W A;  5ER0 A;  1EBD A;  2GR1 A;  3CNT A;  1K0L A;  1B4V A;  2JAE A;  5C2T A;  3FG2 P;  1E7P A;  1LV0 A;  3SQP A;  4TM4 A;  1Z6L A;  1ZK7 A;  5GRT A;  3UOZ A;  5U25 A;  3SZC A;  4CCR A;  2BC1 A;  4IVM B;  4LII A;  4REK A;  3WE0 A;  2JBV A;  4B65 A;  3CGB A;  3DME A;  4CBQ A;  4MJW A;  1H81 A;  3I6D A;  4GR1 A;  2WPF A;  1XPQ A;  2Z5Y A;  5L46 A;  3UOV A;  2GMJ A;  3AXB A;  3HYX A;  3M13 A;  4U8M A;  3CIR A;  3SZF A;  1H83 A;  2R0C A;  1FEA A;  3B6D A;  3UKL A;  1GRG A;  1OJT A;  1K0J A;  3AE2 A;  4K22 A;  1K0I A;  4GF7 A;  3FPZ A;  2WES A;  4C74 A;  1NHQ A;  4D04 A;  3OZ2 A;  4NTC A;  1KF6 A;  2Q0L A;  4YTP A;  3IWA A;  2B76 A;  2GAH B;  1KSS A;  3BNU A;  1IUS A;  4UP3 A;  2WOV A;  4NEV A;  1GEU A;  3E1T A;  1HYU A;  2XVJ A;  2A8X A;  3KA7 A;  3PVC A;  4K5S A;  3CGD A;  4OPD A;  4TM3 A;  5KMQ A;  5IQ4 A;  4H50 A;  1D4D A;  4I59 A;  1GRT A;  4EQW A;  1PN0 A;  3LXD A;  2QA2 A;  1E1M A;  4G73 A;  4OCG A;  5CQF A;  4AT2 A;  3SY4 A;  3QFB A;  5FS7 A;  1PXC A;  3UOX A;  3UKF A;  3UTG A;  3CPJ G;  3L8K A;  1NEK A;  1O94 A;  4H2R A;  2GR0 A;  2YLZ A;  2BYB A;  1L9E A;  4XWZ A;  2OA1 A;  1E39 A;  4IV9 A;  3EPT A;  4H4P A;  4C77 A;  3ALJ A;  4JNQ A;  3ATR A;  1GRH A;  1B5Q A;  2XFN A;  1GTE A;  5FS6 A;  1YQ4 A;  1B37 A;  2Q7V A;  2Y6Q A;  3NGC X;  4N9X A;  3SYI A;  4CY8 A;  3COX A;  1CJ2 A;  1D4E A;  1E1L A;  1S3E A;  2ZBW A;  1TDE A;  3RHA A;  3SZ0 A;  3LAD A;  3NHO X;  4K5R A;  3NT6 A;  2QCU A;  2WHD A;  4U8P A;  3BHK A;  1UKV G;  3T2Z A;  4H4Q A;  2BAB A;  4H2Q A;  2H88 A;  3K7M X;  1LJ1 A;  5JCN A;  4B66 A;  1KNP A;  3P4R A;  4U8J A;  4U8I A;  4NNJ A;  2XFP A;  4FK1 A;  2BRY A;  3F8R A;  3AE9 A;  4RSL A;  3DH9 A;  4U2T A;  3SZW A;  1PJ5 A;  3T37 A;  2YR4 A;  1DOE A;  3QFA A;  1CC6 A;  2B9Y A;  2BA9 A;  2BS3 A;  4OPC A;  1KNR A;  4USR A;  3VRA A;  2YG4 A;  3O0H A;  3AWI A;  1TYP A;  3FBS A;  4AT0 A;  4YSY A;  3NK1 X;  3LB8 A;  2VQ7 A;  4C3X A;  5KXJ A;  3H4K A;  2B9W A;  3GD4 A;  5JCL A;  3UKK A;  2FJA A;  4D03 A;  1H82 A;  3SFD A;  3KU9 A;  1CJC A;  1PJ6 A;  1VDC A;  1GES A;  3QJ4 A;  2Q0K A;  3S5W A;  1GND A;  3KVE A;  1ZX9 A;  2GH5 A;  2GB0 A;  3NTA A;  2XLS A;  3GYJ A;  4A65 A;  4LA1 A;  2PYX A;  4U8N A;  2C67 A;  3FIM B;  3GRS A;  4BUR A;  4J34 A;  1DJQ A;  4C5O A;  2F5Z A;  3CPI G;  3AED A;  1L9C A;  5HYM A;  1Q1W A;  2RGJ A;  2PHH A;  3CNP A;  3DGZ A;  1L9D A;  1JRZ A;  3C4A A;  4TM1 A;  4XXG A;  4OPG A;  2R45 A;  4X9N A;  1CBO A;  1ZDL A;  2AQJ A;  1D5T A;  1ELI A;  4BK1 A;  5U63 A;  1TRB A;  3AE8 A;  1B8S A;  3GDN A;  1ONF A;  4H2N A;  2FBW A;  3SGL A;  1CJ4 A;  2VZ2 A;  1VRQ B;  3LOV A;  1D7L A;  3UTF A;  1S2Y A;  4I58 A;  2YG6 A;  1RSG A;  3UKP A;  1NDA A;  2WET A;  2X8G A;  1JNR A;  3UTH A;  2WBA A;  4H4V A;  1AOG A;  2C73 A;  1VQW A;  2YR5 A;  2ACZ A;  4A79 A;  3NYE A;  1JNZ A;  4K7Z A;  1DOB A;  3NG7 X;  2OLO A;  2V60 A;  1NHR A;  4GAV A;  1IUT A;  4EM3 A;  2XLU A;  2ZZ0 A;  2C7G A;  1CJ3 A;  1TDF A;  5KVH A;  3NTD A;  1GT8 A;  5U1O A;  2GQF A;  2GQW A;  1IUV A;  2APG A;  4O5Q A;  3GWF A;  4J31 A;  4YSX A;  2GV8 A;  3GYX A;  2C72 A;  1PJ7 A;  1KSU A;  4PAB A;  2EQ9 A;  2BCP A;  2CUL A;  4UDQ A;  1F3P A;  5HY5 A;  5J7X A;  3LZW A;  3PG6 A;  3QVR A;  5JCM A;  3CNJ A;  2Z5X A;  4B67 A;  4X9M A;  4II3 A;  3CNS A;  2BK3 A;  4UDR A;  1PBC A;  4JNA A;  2R9Z A;  2VVM A;  3ALM A;  3GMC A;  4JY3 A;  4O5U A;  4A99 A;  4Z2R A;  1K4Q A;  2X3N A;  2GMH A;  2YLX A;  1LQU A;  2C3D A;  4AOS A;  2C76 A;  5BVA A;  3KLJ A;  3AEC A;  2GR2 A;  3C96 A;  3RNM A;  4B69 A;  3II4 A;  2QA1 A;  2YLW A;  3P4P A;  4GUV A;  1JEH A;  2GAG B;  3JSK A;  2WP5 A;  1TYT A;  1FCD A;  4A7A A;  3K30 A;  2TPR A;  3D9X A;  2C64 A;  3BNM A;  5IQ1 A;  2B9X A;  4EQS A;  2B7S A;  1ZOV A;  1MXT A;  4A6N A;  3M0O A;  4UDP A;  3VR9 A;  2ARD A;  4DNA A;  4CCQ A;  2H89 A;  4BK3 A;  3V76 A;  4CY6 A;  3GYI A;  1KDG A;  3UCL A;  4JY2 A;  3NH3 X;  2YLS A;  3AYL A;  3DK4 A;  2C4C A;  2XVH A;  4AP1 A;  1EL7 A;  3L5O A;  1H6V A;  3CGC A;  1EL9 A;  2IVE A;  4JN9 A;  1H7X A;  4X4J A;  1IUW A;  4ICY A;  2X8H A;  4Z2U A;  1BGJ A;  3CMM A;  3UP5 A;  1LTX R;  1DNC A;  4H2P A;  5BUL A;  1NG4 A;  4HA6 A;  5JCI A;  2JKC A;  1XHC A;  5KWF A;  3C4N A;  5JRB A;  3GMB A;  4NTE A;  1P2H A;  3BI4 A;  3PO7 A;  1BF3 A;  3VRD B;  2WU2 A;  3VR8 A;  1GRE A;  2W0H A;  2YVF A;  3GDP A;  4Y4N A;  3AEE A;  4Z2T A;  3GRT A;  1XAN A;  4M52 A;  4ZCD A;  2R46 A;  3SFE A;  3BHF A;  3R9U A;  2X50 A;  2R0G A;  1EL8 A;  4Z44 A;  2RAB A;  4CNJ A;  2WDQ A;  4YSH A;  3ICT A;  3ISH A;  2CVJ A;  3BI5 A;  4FK1 C;  3OC4 A;  2XLP A;  3AD8 B;  3EAO A;  1GRF A;  4G9K A;  1EL5 A;  2XLT A;  2WDV A;  1DXL A;  3AEA A;  3T31 A;  5BUK A;  3CTY A;  2HQM A;  2V5Z A;  4Y4L A;  4ZCC A;  1CL0 A;  2GEW A;  1QO8 A;  3QVP A;  2E4G A;  2EQ8 A;  4CRT A;  4EQR A;  2BK5 A;  2DKH A;  2YM2 A;  4U8O A;  3SXI A;  4B1B A;  4HB9 A;  3AYJ A;  4G6G A;  1F8R A;  2JB3 A;  1N4V A;  4GCM A;  2BAC A;  3RED A;  2WU5 A;  4YTM A;  2ZZC A;  2O9Z A;  5J60 A;  1FL2 A;  4CNK A;  3CND A;  4EIQ A;  1NHS A;  1RP0 A;  3NYC A;  1XDI A;  1ZMC A;  2YG3 A;  3BI2 A;  3HYW A;  3NK0 X;  1GRB A;  1REO A;  4BJZ A;  2BCG G;  3IHM A;  3AEG A;  1GV4 A;  3G5Q A;  5KOX A;  1Q9I A;  1F6M A;  1VG0 A;  4NWZ A;  1E6E A;  2JB1 A;  4TLX A;  5FS9 A;  5KNL A;  3DK8 A;  4Z25 A;  2XVF A;  3GSI A;  2XCG A;  4IA5 A;  1PBB A;  1PBF A;  5EBK A;  4GDE A;  2VVL A;  3S61 A;  1JOA A;  1GET A;  4Z43 A;  2RGH A;  2FJE A;  5KMP A;  3SX6 A;  1CHU A;  4J57 A;  1N4W A;  3KD9 A;  5EB4 A;  4FX9 A;  1KFY A;  1TDN A;  2C70 A;  3AE1 A;  1FEC A;  3DJG X;  1RYI A;  4NZH A;  5CKU A;  4Z24 A;  2UZZ A;  3AEF A;  4NEW A;  4APN A;  2FJD A;  3KKJ A;  4WCT A;  4OPL A;  1F8W A;  4RG4 A;  2B7R A;  2OLN A;  2A89 A;  2VVL G;  4AOX A;  2OAL A;  2XLR A;  4IA6 A;  4YKG A;  3UKH A;  2NVK X;  2TMD A;  3QSM A;  1L0V A;  3AE4 A;  1JRY A;  3ICS A;  4YTN A;  3V3N A;  2BS4 A;  3D8X A;  1CC2 A;  4II2 A;  3L1R A;  2IVD A;  2C75 A;  1P2E A;  3NYF A;  3P4Q A;  1E1N A;  1S2Q A;  1YQ3 A;  1D7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...