1LPFA

Three-dimensional structure of lipoamide dehydrogenase from pseudomonas fluorescens at 2.8 angstroms resolution. analysis of redox and thermostability properties
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
472
structure length
472
Chain Sequence
SQKFDVVVIGAGPGGYVAAIRAAQLGLKTACIEKYIGKEGKVALGGTCLNVGCIPSKALLDSSYKYHEAKEAFKVHGIEAKGVTIDVPAMVARKANIVKNLTGGIATLFKANGVTSFEGHGKLLANKQVEVTGLDGKTQVLEAENVIIASGSRPVEIPPAPLSDDIIVDSTGALEFQAVPKKLGVIGAGVIGLELGSVWARLGAEVTVLEALDKFLPAADEQIAKEALKVLTKQGLNIRLGARVTASEVKKKQVTVTFTDANGEQKETFDKLIVAVGRRPVTTDLLAADSGVTLDERGFIYVDDHCKTSVPGVFAIGDVVRGAMLAHKASEEGVMVAERIAGHKAQMNYDLIPSVIYTHPEIAWVGKTEQTLKAEGVEVNVGTFPFAASGRAMAANDTTGLVKVIADAKTDRVLGVHVIGPSAAELVQQGAIGMEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGHAIHIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of lipoamide dehydrogenase from Pseudomonas fluorescens at 2.8 A resolution. Analysis of redox and thermostability properties.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Oxidoreductase
molecule keywords DIHYDROLIPOAMIDE DEHYDROGENASE
total genus 150
structure length 472
sequence length 472
chains with identical sequence B
ec nomenclature ec 1.8.1.4: Dihydrolipoyl dehydrogenase.
pdb deposition date 1992-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1lpfA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1lpfA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1lpfA02
3O0HA 1DJNA 1GRAA 1H82A 1CBOA 4K22A 2GVCA 4Z26A 3DK9A 1GRHA 2Q6UA 4JY2A 3RHAA 4NZHA 3K7QX 2R0PA 4Z24A 2NVKX 2X8CA 2QCUA 3DJJA 2JBVA 1UKVG 4EQSA 3RNMA 4NTCA 3QJ4A 4AOXA 1CJCA 3EF6A 4EQRA 2WEUA 1DOCA 4FK1C 4H4WA 1DOBA 2YM1A 1ZOYA 1GTEA 2YG6A 1Y56B 4C3YA 3COXA 4P9SA 3EANA 1NHQA 1F6MA 4H4UA 4LA1A 4N9XA 2WDQA 3GWFA 3G5QA 1KSUA 1VG9A 4J33A 4EMIA 1TYTA 4HB9A 4RSLA 4O5QA 1L9DA 3AECA 4HA6A 4ZCDA 4BK1A 4CCRA 1F8WA 1ZK7A 4XWRA 3AE1A 3LZWA 1DXLA 3K7TA 2C66A 1ZDLA 3UOXA 2BC0A 2C72A 4LIIA 5EB4A 3Q6JA 2BXSA 4AP1A 2WP9A 1EL9A 3PS9A 3IC9A 4H4TA 3BI4A 2WPCA 3GMBA 1YY5A 1E7PA 1PXAA 2VOUA 2BK3A 3FMWA 3P4PA 4U8NA 4YSZA 1BWCA 3DA1A 3AE9A 1E1NA 3C4AA 4Y4MA 5KWFA 4Z44A 2JAEA 2OA1A 3AE5A 2GQFA 4RG4A 2XVJA 5KOWA 1ZOVA 2Q7VA 3AXBA 4ADWA 3UTGA 4U2SA 4A99A 2QA1A 3AE6A 3ADAB 5U1OA 2BC1A 2APGA 3ITJA 2IVDA 1IUVA 1JU2A 3AEBA 4XWZA 1L0VA 2YG5A 2YWLA 1EBDA 4GF7A 2PYXA 1S3EA 3SFEA 2R45A 3AB1A 2OLNA 4D03A 1MOKA 1PBEA 3H8IA 1VDCA 2YVFA 2WP6A 2V61A 3GYIA 3KD9A 4B67A 3VRAA 1M64A 2B9YA 3FPZA 2W0HA 1H83A 2C3CA 5EB5A 3QSMA 3P9UA 1X31B 5LV9A 3FG2P 2GMHA 3P4RA 2X8GA 1PBCA 2C76A 3AE3A 3NKSA 4BJZA 1PHHA 2QA2A 3IHMA 4C74A 2BCPA 2R0GA 3SFDA 2WPEA 4USRA 2XDOA 4BJYA 2Y6RA 4B1BA 3K30A 3HZLA 2XVIA 1H6VA 2FJEA 2H89A 2C67A 2B7SA 4DSGA 1GRFA 1H81A 2AR8A 4Z25A 1D7YA 1NHSA 4K7ZA 1TDKA 3LOVA 3UKPA 4GRTA 5FS8A 4KX6A 4WX1A 3VR8A 2CDUA 5L46A 3BHKA 4IV9A 1PXCA 2BS2A 3H8LA 1K0IA 4J31A 4CNKA 1W4XA 4J57A 2WOWA 3PO7A 1D7LA 2ARDA 2YLRA 5IQ4A 2YVGA 4GDPA 4U2LA 3F8RA 1EL5A 2VZ2A 4YSHA 1JRXA 2XCGA 5BVAA 1F3PA 2AQJA 2I0ZA 2YLTA 4UDPA 4EIPA 4YT0A 4I58A 1NG4A 5J7XA 4TM4A 4X9NA 1GNDA 3UTEA 3CN8A 5EOWA 2RABA 2VVLA 2WU2A 3GRTA 3NYFA 1KNPA 3P4QA 4JY3A 3VRBA 3SM8A 2VQ7A 1PBFA 1E39A 1BGJA 1Y56A 2GB0A 2X3NA 4CY8A 1OJ9A 3LADA 2YM2A 1YQZA 1L9CA 3FBSA 2BCGG 2OAMA 1FCDA 2Q0KA 2X50A 3QFAA 2DKIA 2XLUA 2YLSA 3KA7A 4CBQA 1FEAA 2XYOA 3AE2A 3ZDNA 4FX9A 1PJ7A 4IA6A 3E1TA 4EM4A 1PBDA 3GYJA 2FJBA 4C77A 2XVEA 1GETA 2BABA 3GSIA 2RGHA 3BNMA 3M12A 1FEBA 4UDQA 4EQXA 3QSSA 1Z6LA 3LJPA 4XXGA 2BACA 4A5LA 3NN0X 1CC2A 2QAEA 1DJQA 3PVCA 2A87A 4H4XA 5BUKA 3EPTA 1H86A 4Y4NA 1CJ3A 1HYUA 1OJTA 2VVMA 3BHFA 4J2WA 3T37A 4BURA 4GDEA 3BI5A 4H2NA 3DH9A 4PABA 2OLOA 2XFQA 1Q9IA 2YR4A 4BK3A 1XANA 4H4PA 3B3RA 1ELIA 4TLZA 5IPYA 2C7GA 3NLCA 1BKWA 4YSYA 3ICSA 3OC4A 3NH3X 4JN9A 4Z43A 1KNRA 3CPIG 3NIXA 3R9UA 2FBWA 2EQ7A 2GR1A 1IUTA 3ICTA 2XLPA 3GD4A 4U8KA 3ISHA 3IHGA 4USQA 1GRTA 3C4NA 3S61A 3ABVA 3NTAA 1GRBA 1K0LA 1XPQA 1YQ3A 1O5WA 3P4SA 1CF3A 3GD3A 1GPEA 3CNSA 3C96A 3KPFA 4K5SA 4AP3A 4NEWA 4E0VA 2V6OA 2XLRA 3UKAA 2GMJA 5KVHA 3UTFA 3QFBA 5BULA 2WOIA 1H7XA 3VQRA 3AD8B 4A6NB 4A6NA 4UDRA 1L9EA 4NTEA 1AOGA 4TM0A 2B7RA 5HHFA 1NG3A 1RP0A 2Q0LA 4TLXA 3M0OA 3CGBA 4EQWA 2GR0A 1N1PA 4BV6A 1F8SA 3AYIA 2GRTA 2CULA 2R4JA 4U8OA 3UKFA 1KDGA 1MO9A 4H7UA 1DNCA 2XFUA 1TDFA 2OALA 3KU9A 1E1LA 3P1WA 5KRQA 2VRLA 1QO8A 4X9MA 4J34A 4UP3A 2RGJA 1CC4A 1O94A 3L1RA 1GREA 2YR6A 4K5RA 1EL7A 2WPFA 1IUSA 1TDOA 2WESA 4YWOA 4ICYA 3ICRA 3REDA 1CJ4A 1B8SA 2ZZBA 3RP7A 2YG4A 4H50A 3V3OA 4ZCCA 4YTNA 3CGCA 4ECHA 3ALJA 2CVJA 5M0ZA 3WE0A 3CTYA 3IWAA 4YTPA 5JCLA 2ZZ0A 3NRNA 3L8KA 2A89A 2XVHA 4H2PA 3NYCA 4IVOB 2E1MA 1K0JA 4OVIA 4BK2A 2WOVA 1VQWA 5EBKA 3AE4A 4YSXA 2GR2A 5KOXA 3QVRA 4CY6A 1B37A 1GALA 1FECA 3DK4A 3ATQA 1RYIA 1XDIA 2F5ZA 1D4EA 2YQUA 3II4A 3IF9A 1Q1WA 4OPUA 5FS6A 5HYMA 3SGLA 3CNDA 4H4SA 2WU5A 3D8XA 1YQ4A 3DK8A 2YAUA 3AYLA 4H4QA 2BS3A 5HY5A 1O95A 1BGNA 2GF3A 1PXBA 3UOZA 2ZZCA 3UP4A 1H84A 4Z2TA 4JNAA 1ZP0A 4DSHA 3URHA 3NGCX 4OPCA 4H4RA 2J3NA 3SQPA 2R9ZA 4JDRA 5KXJA 5C3JA 1D4DA 2E5VA 1ZKQA 2X99A 4DGKA 1LQUA 1OJAA 1TRBA 1N4UA 2C73A 3AEEA 3F8DA 4J56A 5FS7A 2CFYA 1QLBA 2B9XA 4JNQA 5DBJA 2BXRA 5IQ1A 3CPJG 5JCNA 1GXFA 3AEAA 3I3LA 1OJDA 5CKUA 1K4QA 1V59A 1NEKA 3CNJA 1BZLA 4FK1A 4A7AA 3CNPA 2R0CA 1JEHA 1GSNA 2BYBA 3CGDA 4A9WA 4CNJA 1ZY8A 5GSNA 3G5RA 2WDRA 4NTDA 1NPXA 1B5QA 5FMHA 2GQWA 1D4CA 3DMEA 3NNEA 1PDHA 3GRSA 2WP5A 1S2YA 3UTHA 2Z5XA 2PHHA 3AD9B 4AT0A 1ZX9A 1N4WA 2XFNA 2BS4A 3GWDA 2V3AA 2NPXA 2YLXA 3ATRA 2C64A 3KLJA 4EIQA 1DOEA 3K7MX 1ZMDA 3AE7A 5GRTA 3UCLA 1PJ5A 1CJ2A 1KF6A 2A8XA 2B76A 3GDPA 1DODA 2VRMA 1CL0A 3JSKA 4H2RA 4YTMA 4OPIA 2TMDA 4U8IA 4H2QA 2V60A 2YLZA 1LV0A 2E4GA 2R46A 2WS3A 3AD7B 3NG7X 4LU6A 5CQFA 5ER0A 2BK5A 2O9ZA 1PBBA 2WETA 3UOYA 3EAOA 2WHDA 4OCGA 5BRTA 1COYA 3AYJA 4J36A 4U8MA 2GAHB 3NK2X 4K8DA 4H4ZA 3F8PA 4REKA 2XFPA 2Z5YA 1Q1RA 4U8LA 3M13A 3S5WA 3UKHA 1E1KA 2YG3A 4B64A 4RG3A 1VG0A 3QSEA 4U8PA 1PJ6A 2FJDA 1BF3A 5JCIA 3DGZA 2VVLG 4OPLA 1TDEA 4D04A 3V76A 2C70A 5U63A 2EQ8A 2GV8A 1CHUA 4YKFA 2WBAA 3D1CA 4AT2A 4AOSA 4B63A 4Z2UA 2JB3A 3RP8A 2B9WA 1GESA 5JCKA 2FJAA 2JB2A 2R4EA 3BNUA 3AE8A 1F8RA 1GT8A 4OPGA 4C5OA 3LB8A 3OZ2A 4WCTA 1NENA 3UP5A 1LQTA 3RP6A 1JOAA 2BA9A 4EMJA 2XVFA 3I6DA 3NK0X 1IUXA 1LTXR 1CC6A 4CRTA 1E1MA 1M6IA 2WDVA 4OPTA 2H88A 4GR1A 3AEFA 1RSGA 3NK1X 2DKHA 4APNA 1LPFA 1LJ1A 2UZZA 4MJWA 5TR3A 1IJHA 4A65A 1ONFA 1JRYA 2GH5A 2TPRA 5M10A 3VRDB 3UOVA 1P2EA 2V3BA 3LZXA 1JRZA 3KVEA 1GOSA 3CPHG 1REOA 3FIMB 3CIRA 4YXDA 1OJCA 3CNTA 4B65A 4B69A 2Y6QA 2YLWA 4Z2RA 2JK6A 4GCMA 5JCMA 3ZYXA 5U25A 4YKGA 3NTDA 3KKJA 2X8HA 1MXTA 1S2QA 1NDAA 4I59A 1SEZA 4TM1A 3LXDA 2XFOA 2YG7A 2XLTA 2YR5A 1PN0A 4U2TA 3UKKA 1FOHA 5J60A 2JKCA 2JB1A 1LVLA 3UKQA 4TM3A 1GV4A 3DJGX 1H7WA 4IA5A 1NHPA 3DJEA 4H4YA 4K2XA 3AEDA 1QJDA 3NT6A 4IVMB 4ZN0A 4EM3A 1KSSA 1GTHA 3ALLA 2C75A 3DJDA 4C3XA 1GERA 4FDCB 5FS9A 1KFYA 1N4VA 3GMCA 4DNAA 4EMWA 1XHCA 3NYEA 4Y4LA 2GR3A 4GUVA 4PAAA 3Q9TA 2ZBWA 2YVJA 2GEWA 2GAGB 4B66A 3V3NA 4JQ9A 4X4JA 3AWIA 1P2HA 1IUUA 1TYPA 3ALMA 3QVPA 1EL8A 2ACZA 2IVEA 3NN6X 4OPDA 1YKJA 1E6EA 3AEGA 4NEVA 3VR9A 2EQ6A 4CCQA 5C2TA 5HXIA 1Y0PA 1ZMCA 1FL2A 2BK4A 1TDNA 5KVIA 2C3DA 4M52A 2AAQA 3H4KA 2HQMA 4A79A 1D5TA 4KPRA 1NAAA 1VRQB 3CGEA 4U8JA 1IUWA 1JNZA 2VQBA 3G5SA 1GEUA 2V5ZA 1GRGA 1NHRA 1B4VA 2C65A 3B6DA 3GDNA 3NHOX 3BI2A 1PS9A 2WQYA 4O5UA 4H4VA 2EQ9A 2RGOA 1S3BA 2XLSA 4B68A 1JNRA 3DGHA 3UKLA 2IIDA
chains in the Genus database with same CATH superfamily
3O0HA 1H82A 1KKRA 4K22A 4Z26A 3RHAA 1MNSA 3K7QX 2X8CA 3TCSA 1BQGA 2OQYA 2POZA 4EQSA 3QJ4A 2WEUA 4H1ZA 4FK1C 2YM1A 4A6GA 2YG6A 1Y56B 3COXA 2W3RA 4HCDA 3CT2A 3SZ0A 3GWFA 3G5QA 4J33A 4EMIA 3NZGA 1ZK7A 4XWRA 1P43A 2HNEA 2C66A 3BSMA 3VA8A 1SJDA 2WP9A 1EL9A 3IC9A 1N61C 2BK3A 3FMWA 1YEYA 3P4PA 4A3RA 1BWCA 1E1NA 3C4AA 5KWFA 4Z44A 3OW1A 2GQFA 4IP4A 3CB3A 2XVJA 3AXBA 4U2SA 2QVHA 3ITJA 3AEBA 1EBDA 3JVAA 2PYXA 1S3EA 3SFEA 1VDVA 4IZGA 1VDCA 3GYIA 1H83A 3QSMA 3P4RA 3V4BA 2X8GA 3AE3A 3NKSA 1PHHA 2QA2A 3SFDA 2XDOA 3R25A 1RVKA 2XVIA 2B7SA 1H81A 2C4CA 3NVYB 2XH0A 3NVZB 1VQZA 5FS8A 4KX6A 3BHKA 2BS2A 3H8LA 4J31A 2ARDA 4J3ZA 4GDPA 3F8RA 1EL5A 2VZ2A 4EIPA 4YT0A 3SSZA 3ETRB 4TM4A 2RABA 3P4QA 1BGJA 3SZFA 4E5TA 4CY8A 2YM2A 1YQZA 1L9CA 3QFAA 2DKIA 4II3A 3AE2A 3UXKA 4FX9A 1PJ7A 3Q45A 3GYJA 4C77A 1GETA 2QDEA 3GSIA 1FEBA 4EQXA 2BACA 2QAEA 5BUKA 4GYPC 3EPTA 1H86A 2VVMA 1OJTA 2P8CA 4ENLA 4PABA 3B3RA 2C7GA 3NLCA 1BKWA 4YSYA 3ICSA 1FIQB 5G5HB 1KNRA 3CPIG 4GIRA 3R9UA 2FBWA 2EQ7A 1IUTA 3DG3A 3ISHA 3IHGA 1N5WC 5FJOA 1K0LA 1XPQA 3OTRA 1YQ3A 2W3SA 1CF3A 3GD3A 4AP3A 2V6OA 3OP2A 5KVHA 3UTFA 5BULA 3AD8B 3RO6A 4UDRA 3NVVB 3NS1B 1P48A 1NELA 1TDFA 3KU9A 3P1WA 5KMRA 3QPEA 1QO8A 1CC4A 1O94A 2WPFA 4YTNA 3HYVA 3IWAA 2PTXA 4IVOB 2GGIA 4X2PA 1B37A 1XDIA 2F5ZA 1D4EA 5FS6A 3VDGA 3SGLA 1X2HA 3D8XA 2YAUA 1BGNA 2OPJA 4NWZA 2MNRA 3UOZA 3UP4A 4Z2TA 1ZP0A 3I6TA 4H4RA 2J3NA 5G5GB 5KXJA 2X99A 4DGKA 1N4UA 3V5FA 5DBJA 3ZLHA 1GXFA 3I3LA 4Z1YA 4FK1A 1GSNA 3CGDA 1SJBA 1B5QA 2GQWA 3SBFA 3DMEA 3SN4A 3GRSA 3UTHA 2PTYA 1N4WA 3D47A 1ZMDA 3GO2A 3AE7A 3N6JA 3TQPA 3UCLA 2B76A 2A8XA 3GDPA 3IJIA 4OPIA 3NG7X 2WETA 3EAOA 4OCGA 5BRTA 3AYJA 4J1OA 1X2GA 4GISA 4H4ZA 3UJSA 4REKA 2Z5YA 3S5WA 2YG3A 1PJ6A 3GC2A 2DW6A 2PGWA 4AT2A 4Z2UA 3RP8A 3H12A 1GESA 3DIPA 3AE8A 1F8RA 1JOAA 2BA9A 4GFIA 3I6DA 2GGJA 1E1MA 1MUCA 1RSGA 5TR3A 4A65A 1ONFA 6ENLA 3RITA 1JDFA 1JRZA 1REOA 4MMWA 1OJCA 4B65A 1ONEA 2Y6QA 2JK6A 4GCMA 4GGBA 2P0IA 3UJRA 3NTDA 4ROPA 2X8HA 1MXTA 4TM1A 1SEZA 2XFOA 5IDZA 3V3WA 2XLTA 2QGYA 4U2TA 3UKKA 2JB1A 3RGTA 1GV4A 1NHPA 4ZN0A 3AEDA 1QJDA 1GTHA 2C75A 1KFYA 1N4VA 4EMWA 3NYEA 3FVDA 2PTWA 3FCPA 3EEZA 4JQ9A 4X4JA 1P2HA 1IUUA 3UXLA 4HYRA 1TYPA 2IVEA 4CCQA 4KPLA 1FHUA 5FJTA 4A79A 4M52A 2AAQA 4HN8A 2VQBA 3PWGA 2PP0A 3G5SA 3GDNA 3NHOX 3BI2A 2WQYA 4H4VA 2RGOA 3SZWA 1GRAA 1CBOA 3DK9A 4JY2A 2R0PA 4Z24A 2QCUA 3DJJA 1KCZA 1UKVG 4AOXA 2XH7A 3EF6A 3BOXA 4H4WA 1DOBA 1GTEA 4C3YA 4HNLA 4P9SA 4H4UA 4N9XA 2WDQA 1KSUA 1VG9A 1TYTA 4HB9A 4O5QA 4BK1A 2GGGA 3UJEA 3AE1A 3LZWA 1MRAA 4HCLA 2C72A 4LIIA 2CHRA 3Q6JA 2BXSA 2OG9A 3PS9A 4H4TA 7ENLA 3HRDC 2WPCA 1YY5A 2VOUA 4U8NA 3AE9A 3AE5A 4JN8A 3R0KA 2IVDA 1L0VA 2YWLA 4KEMA 3AB1A 2XSXA 1MOKA 3H8IA 2YVFA 1M64A 3MY9A 5EB5A 3P9UA 1X31B 2GMHA 2BCPA 4USRA 1XS2A 2OLAA 5KNLA 2Y6RA 5KMPA 1PDYA 4B1BA 2C67A 4Z25A 1D7YA 3LOVA 4GRTA 4WX1A 3VR8A 2CDUA 2QJJA 4MKSA 3QTPA 2OKTA 4CNKA 1K0IA 2HXTA 3L5OA 4YSHA 3VFCA 2XCGA 1F3PA 2HXUA 4X9NA 3CN8A 3GRTA 3NYFA 3VRBA 2VQ7A 1PBFA 1E39A 3LADA 3FBSA 1FCDA 2YLSA 3ENLA 3ZDNA 1PBDA 2FJBA 3VC5A 4XXGA 3QSSA 3NN0X 1DJQA 3SXIA 4Y4NA 3BHFA 1HYUA 3T37A 3DG6A 2YR4A 2I5QA 1ELIA 4TLZA 3FJ4A 4Z43A 1ZXIC 3IJQA 2GR1A 3GD4A 1ELSA 1GRBA 3FXGA 1GPEA 4K5SA 4E0VA 2GMJA 1JCTA 2WOIA 4A6NB 1N63C 4NTEA 4KWSA 3CGBA 4EQWA 3HPFA 1N1PA 4BV6A 3AYIA 4U8OA 2GRTA 3UKFA 1MO9A 1DNCA 2XFUA 2OALA 2PP3A 4MGGA 1IUSA 3QN3A 3GYXA 3ICRA 2YG4A 4H50A 2BRAA 3CGCA 2OZ8A 1DTNA 2CVJA 3WE0A 3CTYA 1SJCA 3K1GA 3NYCA 3I4KA 3IJLA 4ZCWA 1VQWA 2AL1A 4CY6A 1GALA 4G6HA 1FECA 4K1WA 3II4A 4OPUA 5HYMA 3D9XA 5FJRA 3CNDA 4H4SA 1YQ4A 4G73A 2BS3A 3T6CA 3FV9A 3URHA 4OPCA 4JDRA 2W55A 2PA6A 1LQUA 2C73A 3F8DA 4J56A 5FS7A 1QLBA 3PG6A 2B9XA 3CPJG 3AEAA 1OJDA 5CKUA 3CNJA 4A7AA 2R0CA 1FO4A 3TWAA 5FJUA 4HCHA 5GSNA 1TKKA 3G5RA 1D4CA 4NNJA 3PWIA 3NNEA 3ZLGA 3DERA 1PDHA 3BJSA 2Z5XA 2PHHA 1ZX9A 2XFNA 3Q4DA 3K7MX 4K8GA 3JSKA 4U8IA 3SY4A 2E4GA 5CQFA 3AD7B 4LU6A 3UOYA 1COYA 4K8DA 3F8PA 1EC9A 1Q1RA 2AL2B 3UJFA 3AM9A 3DG7A 1VG0A 3QSEA 4U8PA 3ZVIA 1BF3A 1WUEA 3SX6A 2C70A 2FYMA 4YKFA 4B63A 3UJ2A 2P88A 5JCKA 1FHVA 2R4EA 2ZC8A 3BNUA 1GT8A 4OPGA 3LB8A 3OZ2A 1NENA 3KUMA 5KMSA 1LQTA 3RP6A 4EMJA 3NK0X 3MUCA 1LTXR 4CRTA 2H88A 4GR1A 3AEFA 3NK1X 3MWCA 2RDXA 1LPFA 4E8GA 3VRDB 4K2SA 2PPGA 3LZXA 4DXKA 1GOSA 3CPHG 3FIMB 3CNTA 3ZYXA 5U25A 4YKGA 4I59A 1NDAA 3LXDA 1PN0A 5J60A 2JKCA 4TM3A 3DJGX 3MQTA 4IA5A 3DJEA 2E5AA 4K2XA 3NT6A 3S5SA 3DJDA 1GERA 5FS9A 2GR3A 2AKMA 2ZBWA 2YVJA 1KN0A 1EBHA 1JRPA 3AWIA 3R10A 3QVPA 1EL8A 3NN6X 1YKJA 2OZTA 3AEGA 4DX3A 1ZMCA 3EUB3 5KVIA 4KPRA 1IUWA 1GEUA 1NHRA 3N4FA 3UKLA 2IIDA 1DJNA 2XH4A 1WYGA 3TTEA 4NZHA 1JPMA 4IL2A 2NVKX 3RNMA 4NTCA 1WUFA 1CJCA 3DEQA 3R07C 1ZOYA 3CXOA 2BRYA 3RRAA 3EANA 1F6MA 4LA1A 2OZ3A 3B9JB 4ZCDA 4CCRA 1L9DA 3AECA 4HA6A 1DXLA 2ONEA 3UOXA 2BC0A 2PS2A 3BI4A 1V97A 2E3TA 1E7PA 1PXAA 3DA1A 4Y4MA 2JAEA 2OA1A 3P0WA 4RG4A 5KOWA 2Q7VA 3UTGA 4A99A 3QKEA 3AE6A 1TE6A 1NU5A 5U1OA 2BC1A 2APGA 1IUVA 1JU2A 3JW7A 2YG5A 4GF7A 2R45A 5J04A 3T4WA 2OLNA 3A7AA 2V61A 2FKPA 2B9YA 4H2HA 4G8TA 5LV9A 3FG2P 3U9IA 2OQHA 3IHMA 3NFUA 2R0GA 4BJYA 3FYYA 2H89A 3RCYA 1GRFA 4K7ZA 3UKPA 3T31A 1EC7A 4IV9A 1PXCA 3T2YA 1W4XA 3IK4A 1F9CA 2WOWA 3PO7A 4J57A 2YLRA 4U2LA 1JRXA 2I0ZA 2YLTA 2P8BA 4I58A 5J7XA 1GNDA 5EOWA 2OFJA 2WU2A 4JY3A 1KNPA 3SM8A 2O56A 1Y56A 4GAVA 2BCGG 2Q0KA 3DESA 2PSNA 2XLUA 3KA7A 1XPYA 2XYOA 3SJNA 3BNMA 4A5LA 2A87A 3DFYA 1CJ3A 4J2WA 3T9PA 3I6EA 4BURA 3BI5A 3DH9A 3NRZB 5ENLA 2XFQA 1Q9IA 3VCCA 2PMQA 5IPYA 4GAPA 3OC4A 3NH3X 4JN9A 1BKHA 3NIXA 3ICTA 3T2ZA 2W54A 3S61A 1GRTA 3C4NA 3NTAA 3KPFA 4NEWA 3QFBA 1L8PA 1AOGA 4TM0A 3NO1A 1NG3A 1RP0A 4G9KA 2CULA 5KRQA 2VRLA 1JROA 4J34A 4UP3A 2RGJA 3L1RA 1GREA 2YR6A 4K5RA 1TDOA 2WESA 4YWOA 4G7FA 3REDA 1B8SA 4G74A 3V3OA 4ZCCA 4M0XA 4ECHA 3ALJA 4YTPA 5JCLA 2A89A 2ZADA 4H2PA 4BK2A 1K0JA 5EBKA 5KOXA 3QVRA 3DK4A 1RYIA 2YQUA 3IF9A 2WU5A 3S47A 5HY5A 1O95A 2GF3A 1PXBA 2ZZCA 4JNAA 4DSHA 5FJPA 3NGCX 2AKZA 3SQPA 1D4DA 2E5VA 1ZKQA 2OX4A 3H7VA 3GY1A 1OJAA 1TRBA 3TWBA 3AEEA 2CFYA 2PODA 4JNQA 3SZCA 2BXRA 5IQ1A 5JCNA 4DN1A 1K4QA 1NEKA 1BZLA 3JZUA 1JEHA 4A35A 2BYBA 4A9WA 4CNJA 2WDRA 1NPXA 5FMHA 1S2YA 4GMEA 3AD9B 2BS4A 2V3AA 4FI4A 4EIQA 1DOEA 4GYPA 5GRTA 1PJ5A 5EU9A 1KF6A 1DODA 2VRMA 1IYXA 4H2RA 4YTMA 2TMDA 4M6UA 4H2QA 1N62C 2V60A 2OO6A 2YLZA 3KPKA 2BK5A 2O9ZA 1PBBA 2WHDA 4U8MA 3TW9A 2GAHB 3NK2X 3VC6A 3M13A 3UKHA 1E1KA 4RG3A 2FJDA 3DGZA 3B97A 2PU1A 1TDEA 4IL0A 1H2IA 5U63A 2EQ8A 2GV8A 2JB3A 3N4EA 3STPA 2FJAA 3SN1A 3ZVHB 4C5OA 2HZGA 4WCTA 2PTZA 3UP5A 1FFUC 1IUXA 1CC6A 2WDVA 4OPTA 2AL2A 2DKHA 1LJ1A 2UZZA 4MJWA 2GDQA 2GH5A 2TPRA 1JRYA 1P2EA 2V3BA 3CIRA 3SQSA 4B69A 3EKGA 4Z2RA 3OPSA 3R1ZA 3KKJA 3RR1A 2PP1A 3QLDA 2YG7A 5KMQA 3UKQA 3MKCA 4IVMB 4DNAA 4Y4LA 3GD6A 4PAAA 2GEWA 2P3ZA 3V3NA 3ALMA 2MUCA 4NEVA 2EQ6A 5C2TA 1Y0PA 1FL2A 2BK4A 3SYIA 3T2KA 1D5TA 1VRQB 3CGEA 1JNZA 1SB3B 1GRGA 1N60C 1B4VA 4O5UA 3OZMA 1S3BA 4B68A 1SJAA 3SR6B 4H83A 4DWDA 3H8AA 1MDLA 4ZA0A 3CXBA 4IT1A 2GVCA 1GRHA 2Q6UA 2JBVA 3AMZA 4EQRA 1DOCA 3PFRA 3HYWA 1NHQA 1W6TA 4E4FA 4RSLA 1ECQA 1F8WA 3K7TA 1ZDLA 2GSHA 4AP1A 1KKOA 4EWJA 5BOEA 4IP5A 3GMBA 4YSZA 1N5XA 4TVWA 1ZOVA 4ADWA 2QA1A 3A7RA 2GGHA 3ADAB 4XWZA 3DGBA 3NVWB 4D03A 1PBEA 3KD9A 2WP6A 3TOYA 4B67A 3VRAA 3A7UA 3FPZA 2W0HA 4JHMA 2C3CA 4JN7A 1PBCA 2C76A 4BJZA 3UCCA 4C74A 2WPEA 3K30A 3HZLA 1H6VA 2FJEA 4HPNA 4DSGA 2AR8A 3NXLA 1NHSA 2QJNA 1TDKA 2GGEA 5L46A 1KD0A 2XGZA 3V5CA 1D7LA 5IQ4A 1PDZA 2YVGA 1JPDX 5BVAA 2AQJA 4UDPA 1E9IA 1T3QC 1NG4A 4G6GA 3UTEA 2VVLA 1STZA 3UCDA 2GB0A 2X3NA 3CAWA 1OJ9A 2OAMA 2X50A 3OZYA 4CBQA 1FEAA 1MDRA 4IA6A 1S7MA 4EM4A 3E1TA 2XVEA 5EB4A 2BABA 2RGHA 2QJMA 3M12A 4UDQA 1Z6LA 3LJPA 3SN0A 1CC2A 3PVCA 3CMMA 4H4XA 2GL5A 4GDEA 4H2NA 3HW2A 2OLOA 4BK3A 1XANA 4H4PA 4DHGA 2XLPA 4U8KA 4USQA 3ABVA 1O5WA 3P4SA 1EC8A 3ES7A 4H19A 3C96A 3CNSA 2XLRA 3UKAA 1TZZA 1H7XA 3VQRA 4A6NA 1L9EA 2B7RA 5HHFA 3DFHA 2Q0LA 3T8QA 4TLXA 3M0OA 2GR0A 2OVLA 4Z17A 1F8SA 2R4JA 1KDGA 4H7UA 3DDMA 3MSYA 1E1LA 4X9MA 3P3BA 1EL7A 4ICYA 3P93A 1CJ4A 2ZZBA 3RP7A 2PGEA 4YWSA 5M0ZA 3AN1A 2ZZ0A 3NRNA 3L8KA 2XVHA 2E1MA 4OVIA 2WOVA 3AE4A 4YSXA 2GR2A 3ZLFA 1R0MA 3ATQA 1Q1WA 3DK8A 3AYLA 4H4QA 4ZOHB 4DYEA 3PK7A 3D46A 1H84A 4II2A 4F4RA 2PU0A 2R9ZA 3THUA 5C3JA 3T14A 3TJIA 1V59A 3CNPA 4KT2A 1ZY8A 4TVYA 4NTDA 3R11A 2WP5A 4AT0A 3GWDA 3ATRA 2NPXA 2YLXA 2C64A 3KLJA 2QQ6A 1CJ2A 3T0KA 2PCEA 1CL0A 3VCNA 1OEPA 1LV0A 2R46A 2WS3A 5ER0A 3R0UA 2QDDA 4J36A 4GGHA 2XFPA 4U8LA 4B64A 5JCIA 2VVLG 2DW7A 4OPLA 4D04A 3V76A 4E4UA 3ES8A 1CHUA 2WBAA 3D1CA 4AOSA 2B9WA 2NQLA 4HNCA 5BOFA 2JB2A 3U4FA 4E6MA 3N6HA 2XVFA 1M6IA 4APNA 3UGVA 1IJHA 3CK5A 5M10A 3UOVA 3TJ4A 3KVEA 4IHCA 4YXDA 2YLWA 5JCMA 1RM6B 1S2QA 2XH2A 3H70A 2YR5A 1FOHA 3HYXA 1LVLA 1H7WA 4H4YA 4EM3A 1EBGA 1KSSA 3ALLA 4C3XA 4FDCB 3GMCA 1XHCA 4GUVA 3Q9TA 2GAGB 4B66A 2ACZA 4OPDA 5JRBA 1E6EA 3ZVHA 3VR9A 5HXIA 1FFVC 1R6WA 3MZNA 3CYJA 1TDNA 2C3DA 3H4KA 2HQMA 1NAAA 4FP1A 4U8JA 2V5ZA 2C65A 3B6DA 1PS9A 2EQ9A 2XLSA 1JNRA 3DGHA
chains in the Genus database with same CATH topology
3O0HA 1DJNA 1GRAA 1H82A 1CBOA 4K22A 2GVCA 4Z26A 3DK9A 1GRHA 2Q6UA 4JY2A 3RHAA 4NZHA 3K7QX 2R0PA 4Z24A 2NVKX 2X8CA 2QCUA 3DJJA 2JBVA 1UKVG 4EQSA 3RNMA 4NTCA 3QJ4A 4AOXA 1CJCA 3EF6A 4EQRA 2WEUA 1DOCA 4FK1C 4H4WA 1DOBA 2YM1A 1ZOYA 1GTEA 2YG6A 3HYWA 2BRYA 1Y56B 4C3YA 3COXA 4P9SA 3EANA 1NHQA 1F6MA 4H4UA 4LA1A 4N9XA 3SZ0A 2WDQA 3GWFA 3G5QA 1KSUA 1VG9A 4J33A 4EMIA 1TYTA 4HB9A 4RSLA 4O5QA 1L9DA 3AECA 4HA6A 4ZCDA 4BK1A 4CCRA 1F8WA 1ZK7A 4XWRA 3AE1A 3LZWA 1DXLA 3K7TA 2C66A 1ZDLA 3UOXA 2BC0A 2C72A 4LIIA 5EB4A 3Q6JA 2BXSA 4AP1A 2WP9A 1EL9A 3PS9A 3IC9A 4H4TA 3BI4A 2WPCA 3GMBA 1YY5A 1E7PA 1PXAA 2VOUA 2BK3A 3FMWA 3P4PA 4U8NA 4YSZA 1BWCA 3DA1A 3AE9A 1E1NA 3C4AA 4Y4MA 5KWFA 4Z44A 2JAEA 2OA1A 3AE5A 2GQFA 4RG4A 2XVJA 5KOWA 1ZOVA 2Q7VA 3AXBA 4ADWA 3UTGA 4U2SA 4A99A 2QA1A 3AE6A 3ADAB 5U1OA 2BC1A 2APGA 3ITJA 2IVDA 1IUVA 1JU2A 3AEBA 4XWZA 1L0VA 2YG5A 2YWLA 1EBDA 4GF7A 2PYXA 1S3EA 3SFEA 2R45A 3AB1A 2OLNA 4D03A 1MOKA 1PBEA 3H8IA 1VDCA 2YVFA 2WP6A 2V61A 3GYIA 3KD9A 4B67A 3VRAA 1M64A 2B9YA 3FPZA 2W0HA 1H83A 2C3CA 5EB5A 3QSMA 3P9UA 1X31B 5LV9A 3FG2P 2GMHA 3P4RA 2X8GA 1PBCA 2C76A 3AE3A 3NKSA 4BJZA 1PHHA 2QA2A 3IHMA 4C74A 2BCPA 2R0GA 3SFDA 2WPEA 4USRA 2XDOA 4BJYA 5KNLA 2Y6RA 5KMPA 4B1BA 3K30A 3HZLA 2XVIA 1H6VA 2FJEA 2H89A 2C67A 2B7SA 4DSGA 1GRFA 1H81A 2AR8A 2C4CA 4Z25A 1D7YA 1NHSA 4K7ZA 1TDKA 3LOVA 3UKPA 3T31A 4GRTA 5FS8A 4KX6A 4WX1A 3VR8A 2CDUA 5L46A 3BHKA 4IV9A 1PXCA 2BS2A 3H8LA 1K0IA 4J31A 3T2YA 4CNKA 1W4XA 4J57A 2WOWA 3PO7A 1D7LA 2ARDA 2YLRA 5IQ4A 3L5OA 2YVGA 4GDPA 4U2LA 3F8RA 1EL5A 2VZ2A 4YSHA 1JRXA 2XCGA 5BVAA 1F3PA 2AQJA 2I0ZA 2YLTA 4UDPA 4EIPA 4YT0A 4I58A 1NG4A 5J7XA 4G6GA 4TM4A 1GNDA 4X9NA 3UTEA 3CN8A 5EOWA 2RABA 2VVLA 2WU2A 3GRTA 3NYFA 1KNPA 3P4QA 4JY3A 3VRBA 3SM8A 2VQ7A 1PBFA 1E39A 1BGJA 1Y56A 2GB0A 2X3NA 3SZFA 4CY8A 4GAVA 1OJ9A 3LADA 2YM2A 1YQZA 1L9CA 3FBSA 2BCGG 2OAMA 1FCDA 2Q0KA 2X50A 3QFAA 2DKIA 2XLUA 2YLSA 4II3A 3KA7A 4CBQA 1FEAA 2XYOA 3AE2A 3ZDNA 4FX9A 1PJ7A 4IA6A 1S7MA 4EM4A 1PBDA 3E1TA 2FJBA 3GYJA 2XVEA 4C77A 1GETA 2BABA 3GSIA 2RGHA 3BNMA 3M12A 1FEBA 4UDQA 4EQXA 3QSSA 1Z6LA 3LJPA 4XXGA 2BACA 4A5LA 3NN0X 1CC2A 2QAEA 1DJQA 3CMMA 3PVCA 2A87A 4H4XA 5BUKA 3EPTA 3SXIA 1H86A 4Y4NA 1CJ3A 1HYUA 1OJTA 2VVMA 3BHFA 4J2WA 3T37A 4BURA 4GDEA 3BI5A 4H2NA 3DH9A 4PABA 2OLOA 2XFQA 1Q9IA 2YR4A 4BK3A 1XANA 4H4PA 3B3RA 1ELIA 4TLZA 5IPYA 2C7GA 3NLCA 4GAPA 1BKWA 4YSYA 3ICSA 3OC4A 3NH3X 4JN9A 4Z43A 1KNRA 3CPIG 3NIXA 3R9UA 2FBWA 2EQ7A 2GR1A 1IUTA 3ICTA 2XLPA 3GD4A 4U8KA 3ISHA 3IHGA 4USQA 1GRTA 3C4NA 3S61A 3T2ZA 3ABVA 3NTAA 1GRBA 1K0LA 1XPQA 1YQ3A 1O5WA 3P4SA 1CF3A 3GD3A 1GPEA 3CNSA 3C96A 3KPFA 4K5SA 4AP3A 4NEWA 4E0VA 2V6OA 2XLRA 3UKAA 2GMJA 5KVHA 3UTFA 3QFBA 5BULA 2WOIA 1H7XA 3VQRA 3AD8B 4A6NB 4A6NA 4UDRA 1L9EA 4NTEA 1AOGA 4TM0A 2B7RA 5HHFA 1NG3A 1RP0A 2Q0LA 4G9KA 4TLXA 3M0OA 3CGBA 4EQWA 2GR0A 1N1PA 4BV6A 1F8SA 3AYIA 2GRTA 2CULA 2R4JA 4U8OA 3UKFA 1KDGA 1MO9A 4H7UA 1DNCA 2XFUA 1TDFA 2OALA 3KU9A 1E1LA 3P1WA 5KRQA 2VRLA 5KMRA 1QO8A 4X9MA 4J34A 4UP3A 2RGJA 5CQFA 1CC4A 1O94A 3L1RA 1GREA 2YR6A 4K5RA 1EL7A 2WPFA 1IUSA 1TDOA 2WESA 4YWOA 4ICYA 3GYXA 3ICRA 3REDA 1CJ4A 1B8SA 2ZZBA 3RP7A 2YG4A 4H50A 4G74A 2BRAA 3V3OA 4ZCCA 3HYVA 4YTNA 3CGCA 4ECHA 3ALJA 2CVJA 5M0ZA 3WE0A 3CTYA 3IWAA 4YTPA 5JCLA 2ZZ0A 3NRNA 3L8KA 2A89A 2XVHA 4H2PA 3NYCA 4IVOB 2E1MA 1K0JA 4OVIA 4BK2A 2WOVA 1VQWA 5EBKA 3AE4A 4YSXA 2GR2A 5KOXA 3QVRA 4CY6A 1B37A 1GALA 4G6HA 1FECA 3DK4A 3ATQA 1RYIA 1XDIA 2F5ZA 1D4EA 2YQUA 3II4A 3IF9A 1Q1WA 4OPUA 5FS6A 5HYMA 3D9XA 3SGLA 3CNDA 4H4SA 2WU5A 3D8XA 1YQ4A 3DK8A 2YAUA 3AYLA 4H4QA 2BS3A 4G73A 5HY5A 1O95A 1BGNA 2GF3A 4NWZA 1PXBA 3UOZA 2ZZCA 3UP4A 4II2A 1H84A 4Z2TA 4JNAA 1ZP0A 4DSHA 3URHA 3NGCX 4OPCA 4H4RA 2J3NA 3SQPA 2R9ZA 4JDRA 5KXJA 5C3JA 1D4DA 2E5VA 1ZKQA 2X99A 4DGKA 1LQUA 1OJAA 1TRBA 1N4UA 3T14A 2C73A 3AEEA 3F8DA 4J56A 5FS7A 2CFYA 1QLBA 3PG6A 2B9XA 4JNQA 5DBJA 2BXRA 5IQ1A 3CPJG 3SZCA 5JCNA 1GXFA 3AEAA 3I3LA 1OJDA 5CKUA 1K4QA 1V59A 1NEKA 3CNJA 1BZLA 4FK1A 4A7AA 3CNPA 2R0CA 1JEHA 1GSNA 2BYBA 3CGDA 4A9WA 4CNJA 1ZY8A 5GSNA 3G5RA 2WDRA 4NTDA 1NPXA 1B5QA 5FMHA 2GQWA 1D4CA 3DMEA 4NNJA 3NNEA 1PDHA 3GRSA 2WP5A 1S2YA 3UTHA 2Z5XA 2PHHA 3AD9B 4AT0A 1ZX9A 1N4WA 2XFNA 2BS4A 3GWDA 2V3AA 2NPXA 2YLXA 3ATRA 2C64A 3KLJA 4EIQA 1DOEA 3K7MX 1ZMDA 3AE7A 5GRTA 3UCLA 1CJ2A 1KF6A 1PJ5A 2A8XA 2B76A 3T0KA 3GDPA 1DODA 2VRMA 1CL0A 3JSKA 4H2RA 4YTMA 4OPIA 2TMDA 4U8IA 4H2QA 3SY4A 2V60A 2YLZA 1LV0A 2E4GA 2R46A 2WS3A 3AD7B 3KPKA 3NG7X 4LU6A 5ER0A 2BK5A 2O9ZA 1PBBA 2WETA 3UOYA 3EAOA 2WHDA 4OCGA 5BRTA 1COYA 3AYJA 4J36A 4U8MA 2GAHB 3NK2X 4K8DA 4H4ZA 3F8PA 4REKA 2XFPA 2Z5YA 1Q1RA 4U8LA 3M13A 3S5WA 3UKHA 1E1KA 2YG3A 4B64A 4RG3A 1VG0A 3QSEA 4U8PA 1PJ6A 2FJDA 1BF3A 5JCIA 3DGZA 2VVLG 4OPLA 1TDEA 4D04A 3V76A 3SX6A 2C70A 1H2IA 5U63A 2EQ8A 2GV8A 1CHUA 4YKFA 2WBAA 3D1CA 4AT2A 4AOSA 4B63A 4Z2UA 2JB3A 3RP8A 2B9WA 1GESA 5JCKA 2FJAA 2JB2A 2R4EA 3BNUA 3AE8A 1F8RA 1GT8A 4OPGA 4C5OA 3LB8A 3OZ2A 4WCTA 1NENA 3UP5A 5KMSA 1LQTA 3RP6A 1JOAA 2BA9A 4EMJA 2XVFA 3I6DA 3NK0X 1IUXA 1LTXR 1CC6A 4CRTA 1E1MA 1M6IA 2WDVA 4OPTA 2H88A 4GR1A 3AEFA 1RSGA 3NK1X 2DKHA 4APNA 1LPFA 1LJ1A 2UZZA 4MJWA 5TR3A 1IJHA 4A65A 1ONFA 1JRYA 2GH5A 2TPRA 5M10A 3VRDB 3UOVA 1P2EA 2V3BA 3LZXA 1JRZA 3KVEA 1GOSA 3CPHG 1REOA 3FIMB 3CIRA 4YXDA 1OJCA 3CNTA 4B65A 4B69A 2Y6QA 2YLWA 4Z2RA 2JK6A 4GCMA 5JCMA 3ZYXA 5U25A 4YKGA 3NTDA 3KKJA 2X8HA 1MXTA 1S2QA 1NDAA 4I59A 1SEZA 4TM1A 3LXDA 2XFOA 2YG7A 2XLTA 2YR5A 1PN0A 4U2TA 3UKKA 1FOHA 5KMQA 5J60A 2JKCA 2JB1A 3HYXA 1LVLA 3UKQA 4TM3A 1GV4A 3DJGX 1H7WA 4IA5A 1NHPA 3DJEA 4H4YA 4K2XA 3AEDA 1QJDA 3NT6A 4IVMB 4ZN0A 4EM3A 1KSSA 1GTHA 3ALLA 2C75A 3DJDA 4C3XA 1GERA 4FDCB 5FS9A 1KFYA 1N4VA 3GMCA 4DNAA 4EMWA 1XHCA 3NYEA 4Y4LA 2GR3A 4GUVA 4PAAA 3Q9TA 2ZBWA 2YVJA 1KN0A 2GEWA 2GAGB 4B66A 3V3NA 4JQ9A 4X4JA 3AWIA 1P2HA 1IUUA 1TYPA 3ALMA 3QVPA 1EL8A 2ACZA 2IVEA 3NN6X 5JRBA 4OPDA 1YKJA 1E6EA 3AEGA 4NEVA 3VR9A 2EQ6A 4CCQA 5C2TA 5HXIA 1Y0PA 1ZMCA 1FL2A 2BK4A 3SYIA 1TDNA 5KVIA 2C3DA 4M52A 2AAQA 3H4KA 2HQMA 4A79A 1D5TA 4KPRA 1NAAA 1VRQB 3CGEA 4U8JA 1IUWA 1JNZA 2VQBA 3T2KA 3G5SA 1GEUA 2V5ZA 1GRGA 1NHRA 1B4VA 2C65A 3B6DA 3GDNA 3NHOX 3BI2A 1PS9A 2WQYA 4O5UA 4H4VA 2EQ9A 2RGOA 1S3BA 2XLSA 4B68A 1JNRA 3SZWA 3DGHA 3UKLA 2IIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O0H A;  1DJN A;  1GRA A;  1H82 A;  1CBO A;  4K22 A;  2GVC A;  4Z26 A;  3DK9 A;  1GRH A;  2Q6U A;  4JY2 A;  3RHA A;  4NZH A;  3K7Q X;  2R0P A;  4Z24 A;  2NVK X;  2X8C A;  2QCU A;  3DJJ A;  2JBV A;  1UKV G;  4EQS A;  3RNM A;  4NTC A;  3QJ4 A;  4AOX A;  1CJC A;  3EF6 A;  4EQR A;  2WEU A;  1DOC A;  4FK1 C;  4H4W A;  1DOB A;  2YM1 A;  1ZOY A;  1GTE A;  2YG6 A;  1Y56 B;  4C3Y A;  3COX A;  4P9S A;  3EAN A;  1NHQ A;  1F6M A;  4H4U A;  4LA1 A;  4N9X A;  2WDQ A;  3GWF A;  3G5Q A;  1KSU A;  1VG9 A;  4J33 A;  4EMI A;  1TYT A;  4HB9 A;  4RSL A;  4O5Q A;  1L9D A;  3AEC A;  4HA6 A;  4ZCD A;  4BK1 A;  4CCR A;  1F8W A;  1ZK7 A;  4XWR A;  3AE1 A;  3LZW A;  1DXL A;  3K7T A;  2C66 A;  1ZDL A;  3UOX A;  2BC0 A;  2C72 A;  4LII A;  5EB4 A;  3Q6J A;  2BXS A;  4AP1 A;  2WP9 A;  1EL9 A;  3PS9 A;  3IC9 A;  4H4T A;  3BI4 A;  2WPC A;  3GMB A;  1YY5 A;  1E7P A;  1PXA A;  2VOU A;  2BK3 A;  3FMW A;  3P4P A;  4U8N A;  4YSZ A;  1BWC A;  3DA1 A;  3AE9 A;  1E1N A;  3C4A A;  4Y4M A;  5KWF A;  4Z44 A;  2JAE A;  2OA1 A;  3AE5 A;  2GQF A;  4RG4 A;  2XVJ A;  5KOW A;  1ZOV A;  2Q7V A;  3AXB A;  4ADW A;  3UTG A;  4U2S A;  4A99 A;  2QA1 A;  3AE6 A;  3ADA B;  5U1O A;  2BC1 A;  2APG A;  3ITJ A;  2IVD A;  1IUV A;  1JU2 A;  3AEB A;  4XWZ A;  1L0V A;  2YG5 A;  2YWL A;  1EBD A;  4GF7 A;  2PYX A;  1S3E A;  3SFE A;  2R45 A;  3AB1 A;  2OLN A;  4D03 A;  1MOK A;  1PBE A;  3H8I A;  1VDC A;  2YVF A;  2WP6 A;  2V61 A;  3GYI A;  3KD9 A;  4B67 A;  3VRA A;  1M64 A;  2B9Y A;  3FPZ A;  2W0H A;  1H83 A;  2C3C A;  5EB5 A;  3QSM A;  3P9U A;  1X31 B;  5LV9 A;  3FG2 P;  2GMH A;  3P4R A;  2X8G A;  1PBC A;  2C76 A;  3AE3 A;  3NKS A;  4BJZ A;  1PHH A;  2QA2 A;  3IHM A;  4C74 A;  2BCP A;  2R0G A;  3SFD A;  2WPE A;  4USR A;  2XDO A;  4BJY A;  2Y6R A;  4B1B A;  3K30 A;  3HZL A;  2XVI A;  1H6V A;  2FJE A;  2H89 A;  2C67 A;  2B7S A;  4DSG A;  1GRF A;  1H81 A;  2AR8 A;  4Z25 A;  1D7Y A;  1NHS A;  4K7Z A;  1TDK A;  3LOV A;  3UKP A;  4GRT A;  5FS8 A;  4KX6 A;  4WX1 A;  3VR8 A;  2CDU A;  5L46 A;  3BHK A;  4IV9 A;  1PXC A;  2BS2 A;  3H8L A;  1K0I A;  4J31 A;  4CNK A;  1W4X A;  4J57 A;  2WOW A;  3PO7 A;  1D7L A;  2ARD A;  2YLR A;  5IQ4 A;  2YVG A;  4GDP A;  4U2L A;  3F8R A;  1EL5 A;  2VZ2 A;  4YSH A;  1JRX A;  2XCG A;  5BVA A;  1F3P A;  2AQJ A;  2I0Z A;  2YLT A;  4UDP A;  4EIP A;  4YT0 A;  4I58 A;  1NG4 A;  5J7X A;  4TM4 A;  4X9N A;  1GND A;  3UTE A;  3CN8 A;  5EOW A;  2RAB A;  2VVL A;  2WU2 A;  3GRT A;  3NYF A;  1KNP A;  3P4Q A;  4JY3 A;  3VRB A;  3SM8 A;  2VQ7 A;  1PBF A;  1E39 A;  1BGJ A;  1Y56 A;  2GB0 A;  2X3N A;  4CY8 A;  1OJ9 A;  3LAD A;  2YM2 A;  1YQZ A;  1L9C A;  3FBS A;  2BCG G;  2OAM A;  1FCD A;  2Q0K A;  2X50 A;  3QFA A;  2DKI A;  2XLU A;  2YLS A;  3KA7 A;  4CBQ A;  1FEA A;  2XYO A;  3AE2 A;  3ZDN A;  4FX9 A;  1PJ7 A;  4IA6 A;  3E1T A;  4EM4 A;  1PBD A;  3GYJ A;  2FJB A;  4C77 A;  2XVE A;  1GET A;  2BAB A;  3GSI A;  2RGH A;  3BNM A;  3M12 A;  1FEB A;  4UDQ A;  4EQX A;  3QSS A;  1Z6L A;  3LJP A;  4XXG A;  2BAC A;  4A5L A;  3NN0 X;  1CC2 A;  2QAE A;  1DJQ A;  3PVC A;  2A87 A;  4H4X A;  5BUK A;  3EPT A;  1H86 A;  4Y4N A;  1CJ3 A;  1HYU A;  1OJT A;  2VVM A;  3BHF A;  4J2W A;  3T37 A;  4BUR A;  4GDE A;  3BI5 A;  4H2N A;  3DH9 A;  4PAB A;  2OLO A;  2XFQ A;  1Q9I A;  2YR4 A;  4BK3 A;  1XAN A;  4H4P A;  3B3R A;  1ELI A;  4TLZ A;  5IPY A;  2C7G A;  3NLC A;  1BKW A;  4YSY A;  3ICS A;  3OC4 A;  3NH3 X;  4JN9 A;  4Z43 A;  1KNR A;  3CPI G;  3NIX A;  3R9U A;  2FBW A;  2EQ7 A;  2GR1 A;  1IUT A;  3ICT A;  2XLP A;  3GD4 A;  4U8K A;  3ISH A;  3IHG A;  4USQ A;  1GRT A;  3C4N A;  3S61 A;  3ABV A;  3NTA A;  1GRB A;  1K0L A;  1XPQ A;  1YQ3 A;  1O5W A;  3P4S A;  1CF3 A;  3GD3 A;  1GPE A;  3CNS A;  3C96 A;  3KPF A;  4K5S A;  4AP3 A;  4NEW A;  4E0V A;  2V6O A;  2XLR A;  3UKA A;  2GMJ A;  5KVH A;  3UTF A;  3QFB A;  5BUL A;  2WOI A;  1H7X A;  3VQR A;  3AD8 B;  4A6N B;  4A6N A;  4UDR A;  1L9E A;  4NTE A;  1AOG A;  4TM0 A;  2B7R A;  5HHF A;  1NG3 A;  1RP0 A;  2Q0L A;  4TLX A;  3M0O A;  3CGB A;  4EQW A;  2GR0 A;  1N1P A;  4BV6 A;  1F8S A;  3AYI A;  2GRT A;  2CUL A;  2R4J A;  4U8O A;  3UKF A;  1KDG A;  1MO9 A;  4H7U A;  1DNC A;  2XFU A;  1TDF A;  2OAL A;  3KU9 A;  1E1L A;  3P1W A;  5KRQ A;  2VRL A;  1QO8 A;  4X9M A;  4J34 A;  4UP3 A;  2RGJ A;  1CC4 A;  1O94 A;  3L1R A;  1GRE A;  2YR6 A;  4K5R A;  1EL7 A;  2WPF A;  1IUS A;  1TDO A;  2WES A;  4YWO A;  4ICY A;  3ICR A;  3RED A;  1CJ4 A;  1B8S A;  2ZZB A;  3RP7 A;  2YG4 A;  4H50 A;  3V3O A;  4ZCC A;  4YTN A;  3CGC A;  4ECH A;  3ALJ A;  2CVJ A;  5M0Z A;  3WE0 A;  3CTY A;  3IWA A;  4YTP A;  5JCL A;  2ZZ0 A;  3NRN A;  3L8K A;  2A89 A;  2XVH A;  4H2P A;  3NYC A;  4IVO B;  2E1M A;  1K0J A;  4OVI A;  4BK2 A;  2WOV A;  1VQW A;  5EBK A;  3AE4 A;  4YSX A;  2GR2 A;  5KOX A;  3QVR A;  4CY6 A;  1B37 A;  1GAL A;  1FEC A;  3DK4 A;  3ATQ A;  1RYI A;  1XDI A;  2F5Z A;  1D4E A;  2YQU A;  3II4 A;  3IF9 A;  1Q1W A;  4OPU A;  5FS6 A;  5HYM A;  3SGL A;  3CND A;  4H4S A;  2WU5 A;  3D8X A;  1YQ4 A;  3DK8 A;  2YAU A;  3AYL A;  4H4Q A;  2BS3 A;  5HY5 A;  1O95 A;  1BGN A;  2GF3 A;  1PXB A;  3UOZ A;  2ZZC A;  3UP4 A;  1H84 A;  4Z2T A;  4JNA A;  1ZP0 A;  4DSH A;  3URH A;  3NGC X;  4OPC A;  4H4R A;  2J3N A;  3SQP A;  2R9Z A;  4JDR A;  5KXJ A;  5C3J A;  1D4D A;  2E5V A;  1ZKQ A;  2X99 A;  4DGK A;  1LQU A;  1OJA A;  1TRB A;  1N4U A;  2C73 A;  3AEE A;  3F8D A;  4J56 A;  5FS7 A;  2CFY A;  1QLB A;  2B9X A;  4JNQ A;  5DBJ A;  2BXR A;  5IQ1 A;  3CPJ G;  5JCN A;  1GXF A;  3AEA A;  3I3L A;  1OJD A;  5CKU A;  1K4Q A;  1V59 A;  1NEK A;  3CNJ A;  1BZL A;  4FK1 A;  4A7A A;  3CNP A;  2R0C A;  1JEH A;  1GSN A;  2BYB A;  3CGD A;  4A9W A;  4CNJ A;  1ZY8 A;  5GSN A;  3G5R A;  2WDR A;  4NTD A;  1NPX A;  1B5Q A;  5FMH A;  2GQW A;  1D4C A;  3DME A;  3NNE A;  1PDH A;  3GRS A;  2WP5 A;  1S2Y A;  3UTH A;  2Z5X A;  2PHH A;  3AD9 B;  4AT0 A;  1ZX9 A;  1N4W A;  2XFN A;  2BS4 A;  3GWD A;  2V3A A;  2NPX A;  2YLX A;  3ATR A;  2C64 A;  3KLJ A;  4EIQ A;  1DOE A;  3K7M X;  1ZMD A;  3AE7 A;  5GRT A;  3UCL A;  1PJ5 A;  1CJ2 A;  1KF6 A;  2A8X A;  2B76 A;  3GDP A;  1DOD A;  2VRM A;  1CL0 A;  3JSK A;  4H2R A;  4YTM A;  4OPI A;  2TMD A;  4U8I A;  4H2Q A;  2V60 A;  2YLZ A;  1LV0 A;  2E4G A;  2R46 A;  2WS3 A;  3AD7 B;  3NG7 X;  4LU6 A;  5CQF A;  5ER0 A;  2BK5 A;  2O9Z A;  1PBB A;  2WET A;  3UOY A;  3EAO A;  2WHD A;  4OCG A;  5BRT A;  1COY A;  3AYJ A;  4J36 A;  4U8M A;  2GAH B;  3NK2 X;  4K8D A;  4H4Z A;  3F8P A;  4REK A;  2XFP A;  2Z5Y A;  1Q1R A;  4U8L A;  3M13 A;  3S5W A;  3UKH A;  1E1K A;  2YG3 A;  4B64 A;  4RG3 A;  1VG0 A;  3QSE A;  4U8P A;  1PJ6 A;  2FJD A;  1BF3 A;  5JCI A;  3DGZ A;  2VVL G;  4OPL A;  1TDE A;  4D04 A;  3V76 A;  2C70 A;  5U63 A;  2EQ8 A;  2GV8 A;  1CHU A;  4YKF A;  2WBA A;  3D1C A;  4AT2 A;  4AOS A;  4B63 A;  4Z2U A;  2JB3 A;  3RP8 A;  2B9W A;  1GES A;  5JCK A;  2FJA A;  2JB2 A;  2R4E A;  3BNU A;  3AE8 A;  1F8R A;  1GT8 A;  4OPG A;  4C5O A;  3LB8 A;  3OZ2 A;  4WCT A;  1NEN A;  3UP5 A;  1LQT A;  3RP6 A;  1JOA A;  2BA9 A;  4EMJ A;  2XVF A;  3I6D A;  3NK0 X;  1IUX A;  1LTX R;  1CC6 A;  4CRT A;  1E1M A;  1M6I A;  2WDV A;  4OPT A;  2H88 A;  4GR1 A;  3AEF A;  1RSG A;  3NK1 X;  2DKH A;  4APN A;  1LPF A;  1LJ1 A;  2UZZ A;  4MJW A;  5TR3 A;  1IJH A;  4A65 A;  1ONF A;  1JRY A;  2GH5 A;  2TPR A;  5M10 A;  3VRD B;  3UOV A;  1P2E A;  2V3B A;  3LZX A;  1JRZ A;  3KVE A;  1GOS A;  3CPH G;  1REO A;  3FIM B;  3CIR A;  4YXD A;  1OJC A;  3CNT A;  4B65 A;  4B69 A;  2Y6Q A;  2YLW A;  4Z2R A;  2JK6 A;  4GCM A;  5JCM A;  3ZYX A;  5U25 A;  4YKG A;  3NTD A;  3KKJ A;  2X8H A;  1MXT A;  1S2Q A;  1NDA A;  4I59 A;  1SEZ A;  4TM1 A;  3LXD A;  2XFO A;  2YG7 A;  2XLT A;  2YR5 A;  1PN0 A;  4U2T A;  3UKK A;  1FOH A;  5J60 A;  2JKC A;  2JB1 A;  1LVL A;  3UKQ A;  4TM3 A;  1GV4 A;  3DJG X;  1H7W A;  4IA5 A;  1NHP A;  3DJE A;  4H4Y A;  4K2X A;  3AED A;  1QJD A;  3NT6 A;  4IVM B;  4ZN0 A;  4EM3 A;  1KSS A;  1GTH A;  3ALL A;  2C75 A;  3DJD A;  4C3X A;  1GER A;  4FDC B;  5FS9 A;  1KFY A;  1N4V A;  3GMC A;  4DNA A;  4EMW A;  1XHC A;  3NYE A;  4Y4L A;  2GR3 A;  4GUV A;  4PAA A;  3Q9T A;  2ZBW A;  2YVJ A;  2GEW A;  2GAG B;  4B66 A;  3V3N A;  4JQ9 A;  4X4J A;  3AWI A;  1P2H A;  1IUU A;  1TYP A;  3ALM A;  3QVP A;  1EL8 A;  2ACZ A;  2IVE A;  3NN6 X;  4OPD A;  1YKJ A;  1E6E A;  3AEG A;  4NEV A;  3VR9 A;  2EQ6 A;  4CCQ A;  5C2T A;  5HXI A;  1Y0P A;  1ZMC A;  1FL2 A;  2BK4 A;  1TDN A;  5KVI A;  2C3D A;  4M52 A;  2AAQ A;  3H4K A;  2HQM A;  4A79 A;  1D5T A;  4KPR A;  1NAA A;  1VRQ B;  3CGE A;  4U8J A;  1IUW A;  1JNZ A;  2VQB A;  3G5S A;  1GEU A;  2V5Z A;  1GRG A;  1NHR A;  1B4V A;  2C65 A;  3B6D A;  3GDN A;  3NHO X;  3BI2 A;  1PS9 A;  2WQY A;  4O5U A;  4H4V A;  2EQ9 A;  2RGO A;  1S3B A;  2XLS A;  4B68 A;  1JNR A;  3DGH A;  3UKL A;  2IID A; 
#chains in the Genus database with same CATH topology
 3O0H A;  1H82 A;  1KKR A;  4K22 A;  4Z26 A;  3RHA A;  1MNS A;  3K7Q X;  2X8C A;  3TCS A;  1BQG A;  2OQY A;  2POZ A;  4EQS A;  3QJ4 A;  2WEU A;  4H1Z A;  4FK1 C;  2YM1 A;  4A6G A;  2YG6 A;  1Y56 B;  3COX A;  2W3R A;  4HCD A;  3CT2 A;  3SZ0 A;  3GWF A;  3G5Q A;  4J33 A;  4EMI A;  3NZG A;  1ZK7 A;  4XWR A;  1P43 A;  2HNE A;  2C66 A;  3BSM A;  3VA8 A;  1SJD A;  2WP9 A;  1EL9 A;  3IC9 A;  1N61 C;  2BK3 A;  3FMW A;  1YEY A;  3P4P A;  4A3R A;  1BWC A;  1E1N A;  3C4A A;  5KWF A;  4Z44 A;  3OW1 A;  2GQF A;  4IP4 A;  3CB3 A;  2XVJ A;  3AXB A;  4U2S A;  2QVH A;  3ITJ A;  3AEB A;  1EBD A;  3JVA A;  2PYX A;  1S3E A;  3SFE A;  1VDV A;  4IZG A;  1VDC A;  3GYI A;  1H83 A;  3QSM A;  3P4R A;  3V4B A;  2X8G A;  3AE3 A;  3NKS A;  1PHH A;  2QA2 A;  3SFD A;  2XDO A;  3R25 A;  1RVK A;  2XVI A;  2B7S A;  1H81 A;  2C4C A;  3NVY B;  2XH0 A;  3NVZ B;  1VQZ A;  5FS8 A;  4KX6 A;  3BHK A;  2BS2 A;  3H8L A;  4J31 A;  2ARD A;  4J3Z A;  4GDP A;  3F8R A;  1EL5 A;  2VZ2 A;  4EIP A;  4YT0 A;  3SSZ A;  3ETR B;  4TM4 A;  2RAB A;  3P4Q A;  1BGJ A;  3SZF A;  4E5T A;  4CY8 A;  2YM2 A;  1YQZ A;  1L9C A;  3QFA A;  2DKI A;  4II3 A;  3AE2 A;  3UXK A;  4FX9 A;  1PJ7 A;  3Q45 A;  3GYJ A;  4C77 A;  1GET A;  2QDE A;  3GSI A;  1FEB A;  4EQX A;  2BAC A;  2QAE A;  5BUK A;  4GYP C;  3EPT A;  1H86 A;  2VVM A;  1OJT A;  2P8C A;  4ENL A;  4PAB A;  3B3R A;  2C7G A;  3NLC A;  1BKW A;  4YSY A;  3ICS A;  1FIQ B;  5G5H B;  1KNR A;  3CPI G;  4GIR A;  3R9U A;  2FBW A;  2EQ7 A;  1IUT A;  3DG3 A;  3ISH A;  3IHG A;  1N5W C;  5FJO A;  1K0L A;  1XPQ A;  3OTR A;  1YQ3 A;  2W3S A;  1CF3 A;  3GD3 A;  4AP3 A;  2V6O A;  3OP2 A;  5KVH A;  3UTF A;  5BUL A;  3AD8 B;  3RO6 A;  4UDR A;  3NVV B;  3NS1 B;  1P48 A;  1NEL A;  1TDF A;  3KU9 A;  3P1W A;  5KMR A;  3QPE A;  1QO8 A;  1CC4 A;  1O94 A;  2WPF A;  4YTN A;  3HYV A;  3IWA A;  2PTX A;  4IVO B;  2GGI A;  4X2P A;  1B37 A;  1XDI A;  2F5Z A;  1D4E A;  5FS6 A;  3VDG A;  3SGL A;  1X2H A;  3D8X A;  2YAU A;  1BGN A;  2OPJ A;  4NWZ A;  2MNR A;  3UOZ A;  3UP4 A;  4Z2T A;  1ZP0 A;  3I6T A;  4H4R A;  2J3N A;  5G5G B;  5KXJ A;  2X99 A;  4DGK A;  1N4U A;  3V5F A;  5DBJ A;  3ZLH A;  1GXF A;  3I3L A;  4Z1Y A;  4FK1 A;  1GSN A;  3CGD A;  1SJB A;  1B5Q A;  2GQW A;  3SBF A;  3DME A;  3SN4 A;  3GRS A;  3UTH A;  2PTY A;  1N4W A;  3D47 A;  1ZMD A;  3GO2 A;  3AE7 A;  3N6J A;  3TQP A;  3UCL A;  2B76 A;  2A8X A;  3GDP A;  3IJI A;  4OPI A;  3NG7 X;  2WET A;  3EAO A;  4OCG A;  5BRT A;  3AYJ A;  4J1O A;  1X2G A;  4GIS A;  4H4Z A;  3UJS A;  4REK A;  2Z5Y A;  3S5W A;  2YG3 A;  1PJ6 A;  3GC2 A;  2DW6 A;  2PGW A;  4AT2 A;  4Z2U A;  3RP8 A;  3H12 A;  1GES A;  3DIP A;  3AE8 A;  1F8R A;  1JOA A;  2BA9 A;  4GFI A;  3I6D A;  2GGJ A;  1E1M A;  1MUC A;  1RSG A;  5TR3 A;  4A65 A;  1ONF A;  6ENL A;  3RIT A;  1JDF A;  1JRZ A;  1REO A;  4MMW A;  1OJC A;  4B65 A;  1ONE A;  2Y6Q A;  2JK6 A;  4GCM A;  4GGB A;  2P0I A;  3UJR A;  3NTD A;  4ROP A;  2X8H A;  1MXT A;  4TM1 A;  1SEZ A;  2XFO A;  5IDZ A;  3V3W A;  2XLT A;  2QGY A;  4U2T A;  3UKK A;  2JB1 A;  3RGT A;  1GV4 A;  1NHP A;  4ZN0 A;  3AED A;  1QJD A;  1GTH A;  2C75 A;  1KFY A;  1N4V A;  4EMW A;  3NYE A;  3FVD A;  2PTW A;  3FCP A;  3EEZ A;  4JQ9 A;  4X4J A;  1P2H A;  1IUU A;  3UXL A;  4HYR A;  1TYP A;  2IVE A;  4CCQ A;  4KPL A;  1FHU A;  5FJT A;  4A79 A;  4M52 A;  2AAQ A;  4HN8 A;  2VQB A;  3PWG A;  2PP0 A;  3G5S A;  3GDN A;  3NHO X;  3BI2 A;  2WQY A;  4H4V A;  2RGO A;  3SZW A;  1GRA A;  1CBO A;  3DK9 A;  4JY2 A;  2R0P A;  4Z24 A;  2QCU A;  3DJJ A;  1KCZ A;  1UKV G;  4AOX A;  2XH7 A;  3EF6 A;  3BOX A;  4H4W A;  1DOB A;  1GTE A;  4C3Y A;  4HNL A;  4P9S A;  4H4U A;  4N9X A;  2WDQ A;  1KSU A;  1VG9 A;  1TYT A;  4HB9 A;  4O5Q A;  4BK1 A;  2GGG A;  3UJE A;  3AE1 A;  3LZW A;  1MRA A;  4HCL A;  2C72 A;  4LII A;  2CHR A;  3Q6J A;  2BXS A;  2OG9 A;  3PS9 A;  4H4T A;  7ENL A;  3HRD C;  2WPC A;  1YY5 A;  2VOU A;  4U8N A;  3AE9 A;  3AE5 A;  4JN8 A;  3R0K A;  2IVD A;  1L0V A;  2YWL A;  4KEM A;  3AB1 A;  2XSX A;  1MOK A;  3H8I A;  2YVF A;  1M64 A;  3MY9 A;  5EB5 A;  3P9U A;  1X31 B;  2GMH A;  2BCP A;  4USR A;  1XS2 A;  2OLA A;  5KNL A;  2Y6R A;  5KMP A;  1PDY A;  4B1B A;  2C67 A;  4Z25 A;  1D7Y A;  3LOV A;  4GRT A;  4WX1 A;  3VR8 A;  2CDU A;  2QJJ A;  4MKS A;  3QTP A;  2OKT A;  4CNK A;  1K0I A;  2HXT A;  3L5O A;  4YSH A;  3VFC A;  2XCG A;  1F3P A;  2HXU A;  4X9N A;  3CN8 A;  3GRT A;  3NYF A;  3VRB A;  2VQ7 A;  1PBF A;  1E39 A;  3LAD A;  3FBS A;  1FCD A;  2YLS A;  3ENL A;  3ZDN A;  1PBD A;  2FJB A;  3VC5 A;  4XXG A;  3QSS A;  3NN0 X;  1DJQ A;  3SXI A;  4Y4N A;  3BHF A;  1HYU A;  3T37 A;  3DG6 A;  2YR4 A;  2I5Q A;  1ELI A;  4TLZ A;  3FJ4 A;  4Z43 A;  1ZXI C;  3IJQ A;  2GR1 A;  3GD4 A;  1ELS A;  1GRB A;  3FXG A;  1GPE A;  4K5S A;  4E0V A;  2GMJ A;  1JCT A;  2WOI A;  4A6N B;  1N63 C;  4NTE A;  4KWS A;  3CGB A;  4EQW A;  3HPF A;  1N1P A;  4BV6 A;  3AYI A;  4U8O A;  2GRT A;  3UKF A;  1MO9 A;  1DNC A;  2XFU A;  2OAL A;  2PP3 A;  4MGG A;  1IUS A;  3QN3 A;  3GYX A;  3ICR A;  2YG4 A;  4H50 A;  2BRA A;  3CGC A;  2OZ8 A;  1DTN A;  2CVJ A;  3WE0 A;  3CTY A;  1SJC A;  3K1G A;  3NYC A;  3I4K A;  3IJL A;  4ZCW A;  1VQW A;  2AL1 A;  4CY6 A;  1GAL A;  4G6H A;  1FEC A;  4K1W A;  3II4 A;  4OPU A;  5HYM A;  3D9X A;  5FJR A;  3CND A;  4H4S A;  1YQ4 A;  4G73 A;  2BS3 A;  3T6C A;  3FV9 A;  3URH A;  4OPC A;  4JDR A;  2W55 A;  2PA6 A;  1LQU A;  2C73 A;  3F8D A;  4J56 A;  5FS7 A;  1QLB A;  3PG6 A;  2B9X A;  3CPJ G;  3AEA A;  1OJD A;  5CKU A;  3CNJ A;  4A7A A;  2R0C A;  1FO4 A;  3TWA A;  5FJU A;  4HCH A;  5GSN A;  1TKK A;  3G5R A;  1D4C A;  4NNJ A;  3PWI A;  3NNE A;  3ZLG A;  3DER A;  1PDH A;  3BJS A;  2Z5X A;  2PHH A;  1ZX9 A;  2XFN A;  3Q4D A;  3K7M X;  4K8G A;  3JSK A;  4U8I A;  3SY4 A;  2E4G A;  5CQF A;  3AD7 B;  4LU6 A;  3UOY A;  1COY A;  4K8D A;  3F8P A;  1EC9 A;  1Q1R A;  2AL2 B;  3UJF A;  3AM9 A;  3DG7 A;  1VG0 A;  3QSE A;  4U8P A;  3ZVI A;  1BF3 A;  1WUE A;  3SX6 A;  2C70 A;  2FYM A;  4YKF A;  4B63 A;  3UJ2 A;  2P88 A;  5JCK A;  1FHV A;  2R4E A;  2ZC8 A;  3BNU A;  1GT8 A;  4OPG A;  3LB8 A;  3OZ2 A;  1NEN A;  3KUM A;  5KMS A;  1LQT A;  3RP6 A;  4EMJ A;  3NK0 X;  3MUC A;  1LTX R;  4CRT A;  2H88 A;  4GR1 A;  3AEF A;  3NK1 X;  3MWC A;  2RDX A;  1LPF A;  4E8G A;  3VRD B;  4K2S A;  2PPG A;  3LZX A;  4DXK A;  1GOS A;  3CPH G;  3FIM B;  3CNT A;  3ZYX A;  5U25 A;  4YKG A;  4I59 A;  1NDA A;  3LXD A;  1PN0 A;  5J60 A;  2JKC A;  4TM3 A;  3DJG X;  3MQT A;  4IA5 A;  3DJE A;  2E5A A;  4K2X A;  3NT6 A;  3S5S A;  3DJD A;  1GER A;  5FS9 A;  2GR3 A;  2AKM A;  2ZBW A;  2YVJ A;  1KN0 A;  1EBH A;  1JRP A;  3AWI A;  3R10 A;  3QVP A;  1EL8 A;  3NN6 X;  1YKJ A;  2OZT A;  3AEG A;  4DX3 A;  1ZMC A;  3EUB 3;  5KVI A;  4KPR A;  1IUW A;  1GEU A;  1NHR A;  3N4F A;  3UKL A;  2IID A;  1DJN A;  2XH4 A;  1WYG A;  3TTE A;  4NZH A;  1JPM A;  4IL2 A;  2NVK X;  3RNM A;  4NTC A;  1WUF A;  1CJC A;  3DEQ A;  3R07 C;  1ZOY A;  3CXO A;  2BRY A;  3RRA A;  3EAN A;  1F6M A;  4LA1 A;  2OZ3 A;  3B9J B;  4ZCD A;  4CCR A;  1L9D A;  3AEC A;  4HA6 A;  1DXL A;  2ONE A;  3UOX A;  2BC0 A;  2PS2 A;  3BI4 A;  1V97 A;  2E3T A;  1E7P A;  1PXA A;  3DA1 A;  4Y4M A;  2JAE A;  2OA1 A;  3P0W A;  4RG4 A;  5KOW A;  2Q7V A;  3UTG A;  4A99 A;  3QKE A;  3AE6 A;  1TE6 A;  1NU5 A;  5U1O A;  2BC1 A;  2APG A;  1IUV A;  1JU2 A;  3JW7 A;  2YG5 A;  4GF7 A;  2R45 A;  5J04 A;  3T4W A;  2OLN A;  3A7A A;  2V61 A;  2FKP A;  2B9Y A;  4H2H A;  4G8T A;  5LV9 A;  3FG2 P;  3U9I A;  2OQH A;  3IHM A;  3NFU A;  2R0G A;  4BJY A;  3FYY A;  2H89 A;  3RCY A;  1GRF A;  4K7Z A;  3UKP A;  3T31 A;  1EC7 A;  4IV9 A;  1PXC A;  3T2Y A;  1W4X A;  3IK4 A;  1F9C A;  2WOW A;  3PO7 A;  4J57 A;  2YLR A;  4U2L A;  1JRX A;  2I0Z A;  2YLT A;  2P8B A;  4I58 A;  5J7X A;  1GND A;  5EOW A;  2OFJ A;  2WU2 A;  4JY3 A;  1KNP A;  3SM8 A;  2O56 A;  1Y56 A;  4GAV A;  2BCG G;  2Q0K A;  3DES A;  2PSN A;  2XLU A;  3KA7 A;  1XPY A;  2XYO A;  3SJN A;  3BNM A;  4A5L A;  2A87 A;  3DFY A;  1CJ3 A;  4J2W A;  3T9P A;  3I6E A;  4BUR A;  3BI5 A;  3DH9 A;  3NRZ B;  5ENL A;  2XFQ A;  1Q9I A;  3VCC A;  2PMQ A;  5IPY A;  4GAP A;  3OC4 A;  3NH3 X;  4JN9 A;  1BKH A;  3NIX A;  3ICT A;  3T2Z A;  2W54 A;  3S61 A;  1GRT A;  3C4N A;  3NTA A;  3KPF A;  4NEW A;  3QFB A;  1L8P A;  1AOG A;  4TM0 A;  3NO1 A;  1NG3 A;  1RP0 A;  4G9K A;  2CUL A;  5KRQ A;  2VRL A;  1JRO A;  4J34 A;  4UP3 A;  2RGJ A;  3L1R A;  1GRE A;  2YR6 A;  4K5R A;  1TDO A;  2WES A;  4YWO A;  4G7F A;  3RED A;  1B8S A;  4G74 A;  3V3O A;  4ZCC A;  4M0X A;  4ECH A;  3ALJ A;  4YTP A;  5JCL A;  2A89 A;  2ZAD A;  4H2P A;  4BK2 A;  1K0J A;  5EBK A;  5KOX A;  3QVR A;  3DK4 A;  1RYI A;  2YQU A;  3IF9 A;  2WU5 A;  3S47 A;  5HY5 A;  1O95 A;  2GF3 A;  1PXB A;  2ZZC A;  4JNA A;  4DSH A;  5FJP A;  3NGC X;  2AKZ A;  3SQP A;  1D4D A;  2E5V A;  1ZKQ A;  2OX4 A;  3H7V A;  3GY1 A;  1OJA A;  1TRB A;  3TWB A;  3AEE A;  2CFY A;  2POD A;  4JNQ A;  3SZC A;  2BXR A;  5IQ1 A;  5JCN A;  4DN1 A;  1K4Q A;  1NEK A;  1BZL A;  3JZU A;  1JEH A;  4A35 A;  2BYB A;  4A9W A;  4CNJ A;  2WDR A;  1NPX A;  5FMH A;  1S2Y A;  4GME A;  3AD9 B;  2BS4 A;  2V3A A;  4FI4 A;  4EIQ A;  1DOE A;  4GYP A;  5GRT A;  1PJ5 A;  5EU9 A;  1KF6 A;  1DOD A;  2VRM A;  1IYX A;  4H2R A;  4YTM A;  2TMD A;  4M6U A;  4H2Q A;  1N62 C;  2V60 A;  2OO6 A;  2YLZ A;  3KPK A;  2BK5 A;  2O9Z A;  1PBB A;  2WHD A;  4U8M A;  3TW9 A;  2GAH B;  3NK2 X;  3VC6 A;  3M13 A;  3UKH A;  1E1K A;  4RG3 A;  2FJD A;  3DGZ A;  3B97 A;  2PU1 A;  1TDE A;  4IL0 A;  1H2I A;  5U63 A;  2EQ8 A;  2GV8 A;  2JB3 A;  3N4E A;  3STP A;  2FJA A;  3SN1 A;  3ZVH B;  4C5O A;  2HZG A;  4WCT A;  2PTZ A;  3UP5 A;  1FFU C;  1IUX A;  1CC6 A;  2WDV A;  4OPT A;  2AL2 A;  2DKH A;  1LJ1 A;  2UZZ A;  4MJW A;  2GDQ A;  2GH5 A;  2TPR A;  1JRY A;  1P2E A;  2V3B A;  3CIR A;  3SQS A;  4B69 A;  3EKG A;  4Z2R A;  3OPS A;  3R1Z A;  3KKJ A;  3RR1 A;  2PP1 A;  3QLD A;  2YG7 A;  5KMQ A;  3UKQ A;  3MKC A;  4IVM B;  4DNA A;  4Y4L A;  3GD6 A;  4PAA A;  2GEW A;  2P3Z A;  3V3N A;  3ALM A;  2MUC A;  4NEV A;  2EQ6 A;  5C2T A;  1Y0P A;  1FL2 A;  2BK4 A;  3SYI A;  3T2K A;  1D5T A;  1VRQ B;  3CGE A;  1JNZ A;  1SB3 B;  1GRG A;  1N60 C;  1B4V A;  4O5U A;  3OZM A;  1S3B A;  4B68 A;  1SJA A;  3SR6 B;  4H83 A;  4DWD A;  3H8A A;  1MDL A;  4ZA0 A;  3CXB A;  4IT1 A;  2GVC A;  1GRH A;  2Q6U A;  2JBV A;  3AMZ A;  4EQR A;  1DOC A;  3PFR A;  3HYW A;  1NHQ A;  1W6T A;  4E4F A;  4RSL A;  1ECQ A;  1F8W A;  3K7T A;  1ZDL A;  2GSH A;  4AP1 A;  1KKO A;  4EWJ A;  5BOE A;  4IP5 A;  3GMB A;  4YSZ A;  1N5X A;  4TVW A;  1ZOV A;  4ADW A;  2QA1 A;  3A7R A;  2GGH A;  3ADA B;  4XWZ A;  3DGB A;  3NVW B;  4D03 A;  1PBE A;  3KD9 A;  2WP6 A;  3TOY A;  4B67 A;  3VRA A;  3A7U A;  3FPZ A;  2W0H A;  4JHM A;  2C3C A;  4JN7 A;  1PBC A;  2C76 A;  4BJZ A;  3UCC A;  4C74 A;  2WPE A;  3K30 A;  3HZL A;  1H6V A;  2FJE A;  4HPN A;  4DSG A;  2AR8 A;  3NXL A;  1NHS A;  2QJN A;  1TDK A;  2GGE A;  5L46 A;  1KD0 A;  2XGZ A;  3V5C A;  1D7L A;  5IQ4 A;  1PDZ A;  2YVG A;  1JPD X;  5BVA A;  2AQJ A;  4UDP A;  1E9I A;  1T3Q C;  1NG4 A;  4G6G A;  3UTE A;  2VVL A;  1STZ A;  3UCD A;  2GB0 A;  2X3N A;  3CAW A;  1OJ9 A;  2OAM A;  2X50 A;  3OZY A;  4CBQ A;  1FEA A;  1MDR A;  4IA6 A;  1S7M A;  4EM4 A;  3E1T A;  2XVE A;  5EB4 A;  2BAB A;  2RGH A;  2QJM A;  3M12 A;  4UDQ A;  1Z6L A;  3LJP A;  3SN0 A;  1CC2 A;  3PVC A;  3CMM A;  4H4X A;  2GL5 A;  4GDE A;  4H2N A;  3HW2 A;  2OLO A;  4BK3 A;  1XAN A;  4H4P A;  4DHG A;  2XLP A;  4U8K A;  4USQ A;  3ABV A;  1O5W A;  3P4S A;  1EC8 A;  3ES7 A;  4H19 A;  3C96 A;  3CNS A;  2XLR A;  3UKA A;  1TZZ A;  1H7X A;  3VQR A;  4A6N A;  1L9E A;  2B7R A;  5HHF A;  3DFH A;  2Q0L A;  3T8Q A;  4TLX A;  3M0O A;  2GR0 A;  2OVL A;  4Z17 A;  1F8S A;  2R4J A;  1KDG A;  4H7U A;  3DDM A;  3MSY A;  1E1L A;  4X9M A;  3P3B A;  1EL7 A;  4ICY A;  3P93 A;  1CJ4 A;  2ZZB A;  3RP7 A;  2PGE A;  4YWS A;  5M0Z A;  3AN1 A;  2ZZ0 A;  3NRN A;  3L8K A;  2XVH A;  2E1M A;  4OVI A;  2WOV A;  3AE4 A;  4YSX A;  2GR2 A;  3ZLF A;  1R0M A;  3ATQ A;  1Q1W A;  3DK8 A;  3AYL A;  4H4Q A;  4ZOH B;  4DYE A;  3PK7 A;  3D46 A;  1H84 A;  4II2 A;  4F4R A;  2PU0 A;  2R9Z A;  3THU A;  5C3J A;  3T14 A;  3TJI A;  1V59 A;  3CNP A;  4KT2 A;  1ZY8 A;  4TVY A;  4NTD A;  3R11 A;  2WP5 A;  4AT0 A;  3GWD A;  3ATR A;  2NPX A;  2YLX A;  2C64 A;  3KLJ A;  2QQ6 A;  1CJ2 A;  3T0K A;  2PCE A;  1CL0 A;  3VCN A;  1OEP A;  1LV0 A;  2R46 A;  2WS3 A;  5ER0 A;  3R0U A;  2QDD A;  4J36 A;  4GGH A;  2XFP A;  4U8L A;  4B64 A;  5JCI A;  2VVL G;  2DW7 A;  4OPL A;  4D04 A;  3V76 A;  4E4U A;  3ES8 A;  1CHU A;  2WBA A;  3D1C A;  4AOS A;  2B9W A;  2NQL A;  4HNC A;  5BOF A;  2JB2 A;  3U4F A;  4E6M A;  3N6H A;  2XVF A;  1M6I A;  4APN A;  3UGV A;  1IJH A;  3CK5 A;  5M10 A;  3UOV A;  3TJ4 A;  3KVE A;  4IHC A;  4YXD A;  2YLW A;  5JCM A;  1RM6 B;  1S2Q A;  2XH2 A;  3H70 A;  2YR5 A;  1FOH A;  3HYX A;  1LVL A;  1H7W A;  4H4Y A;  4EM3 A;  1EBG A;  1KSS A;  3ALL A;  4C3X A;  4FDC B;  3GMC A;  1XHC A;  4GUV A;  3Q9T A;  2GAG B;  4B66 A;  2ACZ A;  4OPD A;  5JRB A;  1E6E A;  3ZVH A;  3VR9 A;  5HXI A;  1FFV C;  1R6W A;  3MZN A;  3CYJ A;  1TDN A;  2C3D A;  3H4K A;  2HQM A;  1NAA A;  4FP1 A;  4U8J A;  2V5Z A;  2C65 A;  3B6D A;  1PS9 A;  2EQ9 A;  2XLS A;  1JNR A;  3DGH A; 
#chains in the Genus database with same CATH homology
 3O0H A;  1DJN A;  1GRA A;  1H82 A;  1CBO A;  4K22 A;  2GVC A;  4Z26 A;  3DK9 A;  1GRH A;  2Q6U A;  4JY2 A;  3RHA A;  4NZH A;  3K7Q X;  2R0P A;  4Z24 A;  2NVK X;  2X8C A;  2QCU A;  3DJJ A;  2JBV A;  1UKV G;  4EQS A;  3RNM A;  4NTC A;  3QJ4 A;  4AOX A;  1CJC A;  3EF6 A;  4EQR A;  2WEU A;  1DOC A;  4FK1 C;  4H4W A;  1DOB A;  2YM1 A;  1ZOY A;  1GTE A;  2YG6 A;  3HYW A;  2BRY A;  1Y56 B;  4C3Y A;  3COX A;  4P9S A;  3EAN A;  1NHQ A;  1F6M A;  4H4U A;  4LA1 A;  4N9X A;  3SZ0 A;  2WDQ A;  3GWF A;  3G5Q A;  1KSU A;  1VG9 A;  4J33 A;  4EMI A;  1TYT A;  4HB9 A;  4RSL A;  4O5Q A;  1L9D A;  3AEC A;  4HA6 A;  4ZCD A;  4BK1 A;  4CCR A;  1F8W A;  1ZK7 A;  4XWR A;  3AE1 A;  3LZW A;  1DXL A;  3K7T A;  2C66 A;  1ZDL A;  3UOX A;  2BC0 A;  2C72 A;  4LII A;  5EB4 A;  3Q6J A;  2BXS A;  4AP1 A;  2WP9 A;  1EL9 A;  3PS9 A;  3IC9 A;  4H4T A;  3BI4 A;  2WPC A;  3GMB A;  1YY5 A;  1E7P A;  1PXA A;  2VOU A;  2BK3 A;  3FMW A;  3P4P A;  4U8N A;  4YSZ A;  1BWC A;  3DA1 A;  3AE9 A;  1E1N A;  3C4A A;  4Y4M A;  5KWF A;  4Z44 A;  2JAE A;  2OA1 A;  3AE5 A;  2GQF A;  4RG4 A;  2XVJ A;  5KOW A;  1ZOV A;  2Q7V A;  3AXB A;  4ADW A;  3UTG A;  4U2S A;  4A99 A;  2QA1 A;  3AE6 A;  3ADA B;  5U1O A;  2BC1 A;  2APG A;  3ITJ A;  2IVD A;  1IUV A;  1JU2 A;  3AEB A;  4XWZ A;  1L0V A;  2YG5 A;  2YWL A;  1EBD A;  4GF7 A;  2PYX A;  1S3E A;  3SFE A;  2R45 A;  3AB1 A;  2OLN A;  4D03 A;  1MOK A;  1PBE A;  3H8I A;  1VDC A;  2YVF A;  2WP6 A;  2V61 A;  3GYI A;  3KD9 A;  4B67 A;  3VRA A;  1M64 A;  2B9Y A;  3FPZ A;  2W0H A;  1H83 A;  2C3C A;  5EB5 A;  3QSM A;  3P9U A;  1X31 B;  5LV9 A;  3FG2 P;  2GMH A;  3P4R A;  2X8G A;  1PBC A;  2C76 A;  3AE3 A;  3NKS A;  4BJZ A;  1PHH A;  2QA2 A;  3IHM A;  4C74 A;  2BCP A;  2R0G A;  3SFD A;  2WPE A;  4USR A;  2XDO A;  4BJY A;  5KNL A;  2Y6R A;  5KMP A;  4B1B A;  3K30 A;  3HZL A;  2XVI A;  1H6V A;  2FJE A;  2H89 A;  2C67 A;  2B7S A;  4DSG A;  1GRF A;  1H81 A;  2AR8 A;  2C4C A;  4Z25 A;  1D7Y A;  1NHS A;  4K7Z A;  1TDK A;  3LOV A;  3UKP A;  3T31 A;  4GRT A;  5FS8 A;  4KX6 A;  4WX1 A;  3VR8 A;  2CDU A;  5L46 A;  3BHK A;  4IV9 A;  1PXC A;  2BS2 A;  3H8L A;  1K0I A;  4J31 A;  3T2Y A;  4CNK A;  1W4X A;  4J57 A;  2WOW A;  3PO7 A;  1D7L A;  2ARD A;  2YLR A;  5IQ4 A;  3L5O A;  2YVG A;  4GDP A;  4U2L A;  3F8R A;  1EL5 A;  2VZ2 A;  4YSH A;  1JRX A;  2XCG A;  5BVA A;  1F3P A;  2AQJ A;  2I0Z A;  2YLT A;  4UDP A;  4EIP A;  4YT0 A;  4I58 A;  1NG4 A;  5J7X A;  4G6G A;  4TM4 A;  1GND A;  4X9N A;  3UTE A;  3CN8 A;  5EOW A;  2RAB A;  2VVL A;  2WU2 A;  3GRT A;  3NYF A;  1KNP A;  3P4Q A;  4JY3 A;  3VRB A;  3SM8 A;  2VQ7 A;  1PBF A;  1E39 A;  1BGJ A;  1Y56 A;  2GB0 A;  2X3N A;  3SZF A;  4CY8 A;  4GAV A;  1OJ9 A;  3LAD A;  2YM2 A;  1YQZ A;  1L9C A;  3FBS A;  2BCG G;  2OAM A;  1FCD A;  2Q0K A;  2X50 A;  3QFA A;  2DKI A;  2XLU A;  2YLS A;  4II3 A;  3KA7 A;  4CBQ A;  1FEA A;  2XYO A;  3AE2 A;  3ZDN A;  4FX9 A;  1PJ7 A;  4IA6 A;  1S7M A;  4EM4 A;  1PBD A;  3E1T A;  2FJB A;  3GYJ A;  2XVE A;  4C77 A;  1GET A;  2BAB A;  3GSI A;  2RGH A;  3BNM A;  3M12 A;  1FEB A;  4UDQ A;  4EQX A;  3QSS A;  1Z6L A;  3LJP A;  4XXG A;  2BAC A;  4A5L A;  3NN0 X;  1CC2 A;  2QAE A;  1DJQ A;  3CMM A;  3PVC A;  2A87 A;  4H4X A;  5BUK A;  3EPT A;  3SXI A;  1H86 A;  4Y4N A;  1CJ3 A;  1HYU A;  1OJT A;  2VVM A;  3BHF A;  4J2W A;  3T37 A;  4BUR A;  4GDE A;  3BI5 A;  4H2N A;  3DH9 A;  4PAB A;  2OLO A;  2XFQ A;  1Q9I A;  2YR4 A;  4BK3 A;  1XAN A;  4H4P A;  3B3R A;  1ELI A;  4TLZ A;  5IPY A;  2C7G A;  3NLC A;  4GAP A;  1BKW A;  4YSY A;  3ICS A;  3OC4 A;  3NH3 X;  4JN9 A;  4Z43 A;  1KNR A;  3CPI G;  3NIX A;  3R9U A;  2FBW A;  2EQ7 A;  2GR1 A;  1IUT A;  3ICT A;  2XLP A;  3GD4 A;  4U8K A;  3ISH A;  3IHG A;  4USQ A;  1GRT A;  3C4N A;  3S61 A;  3T2Z A;  3ABV A;  3NTA A;  1GRB A;  1K0L A;  1XPQ A;  1YQ3 A;  1O5W A;  3P4S A;  1CF3 A;  3GD3 A;  1GPE A;  3CNS A;  3C96 A;  3KPF A;  4K5S A;  4AP3 A;  4NEW A;  4E0V A;  2V6O A;  2XLR A;  3UKA A;  2GMJ A;  5KVH A;  3UTF A;  3QFB A;  5BUL A;  2WOI A;  1H7X A;  3VQR A;  3AD8 B;  4A6N B;  4A6N A;  4UDR A;  1L9E A;  4NTE A;  1AOG A;  4TM0 A;  2B7R A;  5HHF A;  1NG3 A;  1RP0 A;  2Q0L A;  4G9K A;  4TLX A;  3M0O A;  3CGB A;  4EQW A;  2GR0 A;  1N1P A;  4BV6 A;  1F8S A;  3AYI A;  2GRT A;  2CUL A;  2R4J A;  4U8O A;  3UKF A;  1KDG A;  1MO9 A;  4H7U A;  1DNC A;  2XFU A;  1TDF A;  2OAL A;  3KU9 A;  1E1L A;  3P1W A;  5KRQ A;  2VRL A;  5KMR A;  1QO8 A;  4X9M A;  4J34 A;  4UP3 A;  2RGJ A;  5CQF A;  1CC4 A;  1O94 A;  3L1R A;  1GRE A;  2YR6 A;  4K5R A;  1EL7 A;  2WPF A;  1IUS A;  1TDO A;  2WES A;  4YWO A;  4ICY A;  3GYX A;  3ICR A;  3RED A;  1CJ4 A;  1B8S A;  2ZZB A;  3RP7 A;  2YG4 A;  4H50 A;  4G74 A;  2BRA A;  3V3O A;  4ZCC A;  3HYV A;  4YTN A;  3CGC A;  4ECH A;  3ALJ A;  2CVJ A;  5M0Z A;  3WE0 A;  3CTY A;  3IWA A;  4YTP A;  5JCL A;  2ZZ0 A;  3NRN A;  3L8K A;  2A89 A;  2XVH A;  4H2P A;  3NYC A;  4IVO B;  2E1M A;  1K0J A;  4OVI A;  4BK2 A;  2WOV A;  1VQW A;  5EBK A;  3AE4 A;  4YSX A;  2GR2 A;  5KOX A;  3QVR A;  4CY6 A;  1B37 A;  1GAL A;  4G6H A;  1FEC A;  3DK4 A;  3ATQ A;  1RYI A;  1XDI A;  2F5Z A;  1D4E A;  2YQU A;  3II4 A;  3IF9 A;  1Q1W A;  4OPU A;  5FS6 A;  5HYM A;  3D9X A;  3SGL A;  3CND A;  4H4S A;  2WU5 A;  3D8X A;  1YQ4 A;  3DK8 A;  2YAU A;  3AYL A;  4H4Q A;  2BS3 A;  4G73 A;  5HY5 A;  1O95 A;  1BGN A;  2GF3 A;  4NWZ A;  1PXB A;  3UOZ A;  2ZZC A;  3UP4 A;  4II2 A;  1H84 A;  4Z2T A;  4JNA A;  1ZP0 A;  4DSH A;  3URH A;  3NGC X;  4OPC A;  4H4R A;  2J3N A;  3SQP A;  2R9Z A;  4JDR A;  5KXJ A;  5C3J A;  1D4D A;  2E5V A;  1ZKQ A;  2X99 A;  4DGK A;  1LQU A;  1OJA A;  1TRB A;  1N4U A;  3T14 A;  2C73 A;  3AEE A;  3F8D A;  4J56 A;  5FS7 A;  2CFY A;  1QLB A;  3PG6 A;  2B9X A;  4JNQ A;  5DBJ A;  2BXR A;  5IQ1 A;  3CPJ G;  3SZC A;  5JCN A;  1GXF A;  3AEA A;  3I3L A;  1OJD A;  5CKU A;  1K4Q A;  1V59 A;  1NEK A;  3CNJ A;  1BZL A;  4FK1 A;  4A7A A;  3CNP A;  2R0C A;  1JEH A;  1GSN A;  2BYB A;  3CGD A;  4A9W A;  4CNJ A;  1ZY8 A;  5GSN A;  3G5R A;  2WDR A;  4NTD A;  1NPX A;  1B5Q A;  5FMH A;  2GQW A;  1D4C A;  3DME A;  4NNJ A;  3NNE A;  1PDH A;  3GRS A;  2WP5 A;  1S2Y A;  3UTH A;  2Z5X A;  2PHH A;  3AD9 B;  4AT0 A;  1ZX9 A;  1N4W A;  2XFN A;  2BS4 A;  3GWD A;  2V3A A;  2NPX A;  2YLX A;  3ATR A;  2C64 A;  3KLJ A;  4EIQ A;  1DOE A;  3K7M X;  1ZMD A;  3AE7 A;  5GRT A;  3UCL A;  1CJ2 A;  1KF6 A;  1PJ5 A;  2A8X A;  2B76 A;  3T0K A;  3GDP A;  1DOD A;  2VRM A;  1CL0 A;  3JSK A;  4H2R A;  4YTM A;  4OPI A;  2TMD A;  4U8I A;  4H2Q A;  3SY4 A;  2V60 A;  2YLZ A;  1LV0 A;  2E4G A;  2R46 A;  2WS3 A;  3AD7 B;  3KPK A;  3NG7 X;  4LU6 A;  5ER0 A;  2BK5 A;  2O9Z A;  1PBB A;  2WET A;  3UOY A;  3EAO A;  2WHD A;  4OCG A;  5BRT A;  1COY A;  3AYJ A;  4J36 A;  4U8M A;  2GAH B;  3NK2 X;  4K8D A;  4H4Z A;  3F8P A;  4REK A;  2XFP A;  2Z5Y A;  1Q1R A;  4U8L A;  3M13 A;  3S5W A;  3UKH A;  1E1K A;  2YG3 A;  4B64 A;  4RG3 A;  1VG0 A;  3QSE A;  4U8P A;  1PJ6 A;  2FJD A;  1BF3 A;  5JCI A;  3DGZ A;  2VVL G;  4OPL A;  1TDE A;  4D04 A;  3V76 A;  3SX6 A;  2C70 A;  1H2I A;  5U63 A;  2EQ8 A;  2GV8 A;  1CHU A;  4YKF A;  2WBA A;  3D1C A;  4AT2 A;  4AOS A;  4B63 A;  4Z2U A;  2JB3 A;  3RP8 A;  2B9W A;  1GES A;  5JCK A;  2FJA A;  2JB2 A;  2R4E A;  3BNU A;  3AE8 A;  1F8R A;  1GT8 A;  4OPG A;  4C5O A;  3LB8 A;  3OZ2 A;  4WCT A;  1NEN A;  3UP5 A;  5KMS A;  1LQT A;  3RP6 A;  1JOA A;  2BA9 A;  4EMJ A;  2XVF A;  3I6D A;  3NK0 X;  1IUX A;  1LTX R;  1CC6 A;  4CRT A;  1E1M A;  1M6I A;  2WDV A;  4OPT A;  2H88 A;  4GR1 A;  3AEF A;  1RSG A;  3NK1 X;  2DKH A;  4APN A;  1LPF A;  1LJ1 A;  2UZZ A;  4MJW A;  5TR3 A;  1IJH A;  4A65 A;  1ONF A;  1JRY A;  2GH5 A;  2TPR A;  5M10 A;  3VRD B;  3UOV A;  1P2E A;  2V3B A;  3LZX A;  1JRZ A;  3KVE A;  1GOS A;  3CPH G;  1REO A;  3FIM B;  3CIR A;  4YXD A;  1OJC A;  3CNT A;  4B65 A;  4B69 A;  2Y6Q A;  2YLW A;  4Z2R A;  2JK6 A;  4GCM A;  5JCM A;  3ZYX A;  5U25 A;  4YKG A;  3NTD A;  3KKJ A;  2X8H A;  1MXT A;  1S2Q A;  1NDA A;  4I59 A;  1SEZ A;  4TM1 A;  3LXD A;  2XFO A;  2YG7 A;  2XLT A;  2YR5 A;  1PN0 A;  4U2T A;  3UKK A;  1FOH A;  5KMQ A;  5J60 A;  2JKC A;  2JB1 A;  3HYX A;  1LVL A;  3UKQ A;  4TM3 A;  1GV4 A;  3DJG X;  1H7W A;  4IA5 A;  1NHP A;  3DJE A;  4H4Y A;  4K2X A;  3AED A;  1QJD A;  3NT6 A;  4IVM B;  4ZN0 A;  4EM3 A;  1KSS A;  1GTH A;  3ALL A;  2C75 A;  3DJD A;  4C3X A;  1GER A;  4FDC B;  5FS9 A;  1KFY A;  1N4V A;  3GMC A;  4DNA A;  4EMW A;  1XHC A;  3NYE A;  4Y4L A;  2GR3 A;  4GUV A;  4PAA A;  3Q9T A;  2ZBW A;  2YVJ A;  1KN0 A;  2GEW A;  2GAG B;  4B66 A;  3V3N A;  4JQ9 A;  4X4J A;  3AWI A;  1P2H A;  1IUU A;  1TYP A;  3ALM A;  3QVP A;  1EL8 A;  2ACZ A;  2IVE A;  3NN6 X;  5JRB A;  4OPD A;  1YKJ A;  1E6E A;  3AEG A;  4NEV A;  3VR9 A;  2EQ6 A;  4CCQ A;  5C2T A;  5HXI A;  1Y0P A;  1ZMC A;  1FL2 A;  2BK4 A;  3SYI A;  1TDN A;  5KVI A;  2C3D A;  4M52 A;  2AAQ A;  3H4K A;  2HQM A;  4A79 A;  1D5T A;  4KPR A;  1NAA A;  1VRQ B;  3CGE A;  4U8J A;  1IUW A;  1JNZ A;  2VQB A;  3T2K A;  3G5S A;  1GEU A;  2V5Z A;  1GRG A;  1NHR A;  1B4V A;  2C65 A;  3B6D A;  3GDN A;  3NHO X;  3BI2 A;  1PS9 A;  2WQY A;  4O5U A;  4H4V A;  2EQ9 A;  2RGO A;  1S3B A;  2XLS A;  4B68 A;  1JNR A;  3SZW A;  3DGH A;  3UKL A;  2IID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...