5JCKA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
432
structure length
432
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFYSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVANIEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
molecule keywords Os09g0567300 protein
total genus 140
structure length 432
sequence length 432
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jckA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jckA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jckA02
5JCIA 2APGA 3BNUA 1JRYA 3ZYXA 1N4VA 2W0HA 5IQ4A 3QSMA 5BULA 1B37A 2YR6A 3GYIA 4YTMA 4H4RA 1TYPA 2XYOA 3VR9A 2XLUA 3D1CA 5KRQA 4J56A 4K8DA 3KKJA 4GR1A 4XWZA 2WBAA 4AOSA 4H4SA 3AE3A 2XLRA 4Z43A 4GRTA 2BK5A 1D4DA 2YVFA 2XVJA 2GF3A 2R45A 4JN9A 2FJBA 2BABA 4CY8A 3CGBA 1CJ3A 2AQJA 2B9WA 2YG3A 3L1RA 3UP4A 2BA9A 3GSIA 3UTGA 3URHA 2OLNA 3FPZA 1GRTA 4AT2A 2QAEA 4BV6A 4Z2RA 2ZZBA 2Q6UA 3FBSA 3I6DA 4EMJA 4NTEA 1GXFA 3UKHA 1FEAA 2OLOA 3UCLA 4A65A 5FMHA 2R0PA 2UZZA 2YG5A 3AYLA 3BHKA 1FL2A 3H8LA 1H82A 4O5QA 3KLJA 3F8PA 4H4VA 3UOXA 2GMHA 1KF6A 4C3YA 1Z6LA 1NEKA 3ATQA 1BZLA 2JB1A 2NPXA 4DNAA 1F8RA 3EANA 2WP5A 1VDCA 3AE7A 3QVPA 2WS3A 1S2YA 4AOXA 4A7AA 1PJ7A 2XCGA 4OPCA 1K0IA 2BS4A 2Z5XA 4U8LA 1JEHA 4NEVA 1GERA 2WP6A 3AE4A 2GR2A 1H7WA 4J33A 4CNJA 3PO7A 4FK1C 1CL0A 2YAUA 4IA5A 5IPYA 1VG9A 2BS2A 2X8HA 2TPRA 5FS6A 4YXDA 4H4ZA 2XLPA 1UKVG 2YG6A 3M0OA 4J34A 2GV8A 2X50A 3SM8A 2J3NA 3UKAA 2VRMA 3AEEA 3DJGX 3EAOA 4U2LA 1GEUA 1GV4A 2EQ8A 3VRAA 2AAQA 2GR3A 2C72A 1K0LA 4U8IA 1GTEA 3AE5A 1KNPA 2E4GA 3AE2A 5J7XA 4XWRA 3SFDA 5C2TA 2H89A 3L8KA 3AXBA 5GRTA 1JNRA 3DJJA 2XFUA 1D7YA 3LB8A 1S3EA 2YLZA 4ICYA 4Y4MA 4EIPA 2BXRA 3UOVA 5KWFA 1ZP0A 3NLCA 1L9DA 1OJDA 4PAAA 4TM0A 3CGEA 1REOA 1D4EA 1LQUA 4FX9A 1D4CA 3ICTA 3GD4A 4U8PA 3NYCA 1GRAA 3GDPA 3UTFA 1TRBA 1PBBA 2WQYA 2FJDA 2YQUA 3JSKA 2HQMA 3GD3A 3NGCX 4OPLA 4YT0A 5FS8A 2QCUA 1D7LA 1JU2A 2PYXA 5EBKA 3NK0X 4BJYA 4C5OA 1PBCA 3C4NA 3BI4A 1OJTA 2C76A 2WU2A 2YLSA 3CPJG 1N4UA 3VRDB 3GWDA 1PXCA 1X31B 2XFQA 2YLRA 3G5SA 3F8DA 4UDRA 1DOBA 1B4VA 4J31A 3AECA 4BJZA 3H4KA 2V3BA 4B64A 1VQWA 4U8OA 4C77A 1K4QA 5ER0A 3DK4A 1DJQA 4I58A 3QFAA 1PJ5A 1W4XA 4YSYA 4K22A 3DJEA 2X3NA 2XVFA 2YLTA 5HY5A 1L9EA 2JK6A 2V60A 1GRBA 1GPEA 1TDKA 1N4WA 4CY6A 1HYUA 4H4TA 4BURA 2EQ7A 3BI2A 2R0CA 4OPDA 2VZ2A 3RHAA 3VR8A 4EMIA 1JNZA 3S5WA 4B65A 4FDCB 3EF6A 2GVCA 3QFBA 2C65A 2GAGB 1MXTA 1OJ9A 3LZWA 2WOWA 2PHHA 1E1NA 1TDFA 2VVLA 2C64A 1GREA 3UTHA 1IJHA 1NHQA 1LTXR 2JKCA 5KOXA 1S2QA 3P1WA 1JRXA 4IVOB 3V3OA 1LQTA 4REKA 2C3CA 5KVHA 1B5QA 3M13A 2WHDA 3AE8A 1EL8A 3UKKA 1JOAA 3DK8A 1L0VA 2H88A 3UKFA 4A6NA 1DNCA 2X8GA 3B6DA 3BHFA 4HA6A 4KPRA 4RG3A 2WOVA 4H4WA 4YSXA 3CNPA 1DXLA 1ZOVA 3QSEA 3CNJA 5HXIA 2FJEA 3VQRA 2GR1A 4YWOA 1B8SA 3CGCA 4B1BA 4U8NA 1L9CA 3GRSA 1DODA 1TDOA 2DKIA 4U2TA 1CBOA 1CJ4A 3ALMA 3OZ2A 1NG4A 2OALA 1NPXA 4K7ZA 1PHHA 5JCNA 4Z24A 3H8IA 3NT6A 4OCGA 3NTDA 2Y6QA 5JCLA 4GCMA 1OJAA 2C67A 2IVEA 3S61A 2ZZCA 1GRFA 1VG0A 3NN6X 3DK9A 1Q1RA 4ADWA 2BXSA 1KSUA 3RP8A 2GR0A 2BCPA 1DOCA 2WP9A 2XDOA 4A6NB 1Q1WA 2R4EA 2GRTA 3IC9A 2JAEA 3KVEA 1LJ1A 1H6VA 1PBEA 4EM4A 1CC6A 3NK2X 4EQXA 3COXA 2C73A 3DMEA 4KX6A 4GDPA 1N1PA 2WU5A 4Z25A 1EL9A 2B9XA 1S3BA 4M52A 1EL5A 1LVLA 1XDIA 3AD8B 3NK1X 3QJ4A 4B68A 1COYA 4OPUA 3RP6A 3GWFA 2CVJA 3NTAA 3ISHA 4EQRA 3Q6JA 1O94A 2BACA 4U8MA 5C3JA 4C3XA 2XFOA 2XLTA 4ECHA 1QJDA 1LV0A 4H4PA 2B76A 3P4QA 2DKHA 2V6OA 3HZLA 4TM4A 2JB2A 1TYTA 1F8SA 2FBWA 4H2QA 1E1LA 1PXBA 4RSLA 5BUKA 2XLSA 2YM2A 2XFPA 4J2WA 3R9UA 5KXJA 4H4UA 2GAHB 4JNQA 2WPCA 5KOWA 2C66A 4YKFA 1IUXA 5TR3A 4O5UA 1FEBA 2I0ZA 1F3PA 1D5TA 1YKJA 4H2NA 3UKPA 4J57A 4A99A 4CCRA 3AYIA 1FECA 2GB0A 3KPFA 2VOUA 1IUSA 2NVKX 1RSGA 1YQ4A 3NH3X 3FG2P 2JBVA 2YLWA 4X9NA 4BK3A 1F8WA 1H86A 2WDQA 1GSNA 4B69A 3P4SA 1CHUA 2AR8A 2BYBA 2ZBWA 4Y4NA 4ZN0A 4DSHA 1CC2A 2JB3A 3NYFA 5U63A 1TDEA 2O9ZA 4EMWA 4UDQA 3NKSA 1DOEA 3AEGA 1NENA 1CC4A 2C3DA 4YKGA 2IVDA 3UOYA 2Q0KA 1IUVA 2GH5A 3NRNA 2OA1A 3DGZA 3VRBA 2VQ7A 3BNMA 5HHFA 4AP3A 1E1KA 1Q9IA 4Z26A 1RP0A 4RG4A 2OAMA 3LZXA 3F8RA 5BVAA 2WOIA 3UP5A 4DSGA 1GRHA 3FMWA 2B7SA 4BK2A 1YQ3A 2BK3A 2VQBA 2YM1A 3M12A 1KDGA 3BI5A 3NIXA 3K7TA 5EOWA 4YSZA 1XANA 4USRA 3LXDA 1RYIA 4USQA 4GUVA 2C70A 3NN0X 1FOHA 5J60A 2A87A 5FS7A 1F6MA 1V59A 3II4A 2YG7A 3AYJA 4Z2UA 5U25A 5U1OA 2BS3A 4TM1A 3CPHG 5DBJA 2BC1A 3CNDA 2Z5YA 1E6EA 3PS9A 1BGJA 4ZCDA 5LV9A 3O0HA 3AB1A 2E1MA 4EM3A 3G5RA 1GALA 4OPIA 1BWCA 1Y56B 1ELIA 4XXGA 1IUTA 1DJNA 4FK1A 4B67A 2WESA 4IV9A 2WPEA 5FS9A 1PBFA 3V3NA 5JCKA 1ZMDA 2V5ZA 4Y4LA 4K2XA 4IVMB 3P4PA 4EQSA 3NHOX 4U8KA 3CPIG 2CDUA 3AEAA 4OPGA 2B7RA 1PS9A 1ONFA 1KSSA 3NYEA 5M0ZA 4AT0A 4H2RA 4JQ9A 3AE1A 1NDAA 3AD7B 3GMCA 1GOSA 5GSNA 2RGJA 4NEWA 2YWLA 1QLBA 2ZZ0A 2XVIA 3ITJA 4AP1A 2Q0LA 1PXAA 1ZDLA 2YVGA 3Q9TA 4ZCCA 2A8XA 4OVIA 2ARDA 1TDNA 4UP3A 3WE0A 4Z2TA 3IWAA 1Y0PA 4NZHA 1ZX9A 5CQFA 4H50A 4N9XA 1ZOYA 4I59A 4JY2A 3IHMA 4K5SA 1P2HA 1CF3A 1ZK7A 3CNTA 1AOGA 2QA2A 5HYMA 2B9YA 3G5QA 2TMDA 3SFEA 2YR4A 1H84A 3D8XA 1O5WA 3I3LA 2YR5A 2C7GA 1OJCA 3AWIA 1EL7A 3OC4A 5CKUA 4A79A 3C4AA 5BRTA 4GF7A 5L46A 2IIDA 1GT8A 3CN8A 1XPQA 2V61A 4A5LA 4B66A 2YLXA 4TLZA 2XVHA 3QSSA 2X99A 1E7PA 2Y6RA 4CCQA 4D03A 3AE9A 1NHSA 2FJAA 2RABA 1XHCA 3UKLA 1E1MA 3GDNA 3KU9A 4WCTA 3ICSA 2X8CA 4H4QA 4E0VA 1NG3A 2GEWA 3SGLA 3CTYA 4YTNA 1K0JA 4WX1A 3NG7X 2YVJA 4LIIA 4K5RA 3ZDNA 4JY3A 2XFNA 2R4JA 3AD9B 2GMJA 3ICRA 3QVRA 1E39A 2VVMA 3PVCA 3V76A 4NTCA 3KD9A 2RGOA 1M6IA 2VVLG 3P4RA 4LU6A 2A89A 4X4JA 1ZMCA 3LJPA 3AEFA 3ALLA 3IF9A 1NHPA 1NHRA 1BKWA 1GETA 1CJ2A 3GYJA 4GDEA 4HB9A 5EB5A 4C74A 1MO9A 2BC0A 2EQ9A 3CGDA 2QA1A 2WDRA 1KFYA 4BK1A 4CBQA 4X9MA 2F5ZA 1PDHA 2V3AA 1EBDA 4H2PA 3K30A 4CRTA 1M64A 1PBDA 2VRLA 4EQWA 2CFYA 3K7QX 2E5VA 3K7MX 3DGHA 1PN0A 4YSHA 3UKQA 2CULA 3C96A 3EPTA 3T37A 3LOVA 5M10A 5EB4A 1QO8A 3GRTA 3RP7A 1Y56A 2EQ6A 1NAAA 1MOKA 3AE6A 3E1TA 2WETA 3B3RA 4JDRA 3AEDA 4MJWA 4APNA 1H7XA 3ATRA 2WDVA 2R9ZA 1O95A 3RNMA 3ABVA 4YTPA 4OPTA 3NNEA 3REDA 1BF3A 4H4XA 4TM3A 3FIMB 2RGHA 1H83A 3DH9A 1JRZA 1IUUA 3GMBA 4A9WA 2ACZA 4TLXA 1IUWA 2BK4A 2R0GA 1LPFA 3LADA 4H7UA 3ADAB 2GQWA 1YY5A 4EIQA 1VRQB 5JCMA 4D04A 4JNAA 2R46A 3DJDA 3UTEA 3IHGA 1ZY8A 1CJCA 1GTHA 4U2SA 4B63A 2WEUA 4LA1A 1GRGA 3SQPA 1PJ6A 3P9UA 4IA6A 4NTDA 4DGKA 1P2EA 1FCDA 4P9SA 2YG4A 1ZKQA 2BCGG 3ALJA 5KVIA 1GESA 1SEZA 4H4YA 2GQFA 4U8JA 5IQ1A 2XVEA 1BGNA 3CIRA 3KA7A 2C75A 1H81A 3UOZA 1GNDA 2Q7VA 4J36A 1KNRA 4PABA 4UDPA 1YQZA 4Z44A 4CNKA 2WPFA 3CNSA 3AEBA 3DA1A
chains in the Genus database with same CATH superfamily
3ZYXA 3RGTA 2PTXA 3AN1A 3NS1B 2YR6A 4H4RA 3CYJA 3GYXA 3KKJA 4HYRA 2OFJA 2BK5A 2XVJA 2BABA 2YG3A 3GSIA 3URHA 2QAEA 2MNRA 1GXFA 1FEAA 3H12A 3MKCA 1FL2A 3F8PA 2HXUA 3DFHA 1N63C 4C3YA 1NEKA 1F8RA 3UJ2A 2XCGA 3TOYA 2BS4A 2Z5XA 3GD6A 1ECQA 3N6HA 2GR2A 4CNJA 3PO7A 3HRDC 2BS2A 4MGGA 4G7FA 5FS6A 4H4ZA 2YG6A 4J34A 2X50A 3SM8A 3FCPA 1MDLA 1GEUA 1GV4A 2AAQA 1MDRA 3H70A 3R0KA 1GTEA 5J7XA 3SFDA 5C2TA 3L8KA 3R1ZA 3DJJA 1JNRA 4ICYA 1FIQB 4IP4A 4Y4MA 3CGEA 4U8PA 1TRBA 3IK4A 4IL2A 3GD3A 2PTWA 2AL2A 3NK0X 1PBCA 3CT2A 1N4UA 3VRDB 2OG9A 4GGBA 1PXCA 1X31B 2YLRA 2QJMA 1N61C 1DOBA 1B4VA 4J31A 3H4KA 1R0MA 1VQWA 5ER0A 3DK4A 1DJQA 4GFIA 2XVFA 1L9EA 2JK6A 1GRBA 1EC8A 4BURA 2EQ7A 4ZCWA 4EMIA 4B65A 3QFBA 3PG6A 2C65A 1OJ9A 3LZWA 3S47A 1GREA 5KOXA 4IVOB 2NQLA 3ENLA 1B5QA 2GGIA 3DEQA 4IZGA 4M0XA 3ZVIA 1L0VA 3BHFA 3B6DA 5KMQA 2MUCA 1DXLA 1ZOVA 2PU0A 3OPSA 4YWOA 3SBFA 4GGHA 4GIRA 4U8NA 3FV9A 1TDOA 2DKIA 4U2TA 3ALMA 1NPXA 4K7ZA 5JCNA 3NT6A 2Y6QA 2C4CA 3S61A 1GRFA 2W55A 3NN6X 1Q1RA 4E8GA 1KSUA 2GR0A 3DG6A 2WP9A 1STZA 1JPMA 3COXA 3DMEA 3MUCA 4KX6A 2B9XA 5J04A 4M52A 1EL5A 3ZLGA 1XDIA 4U8MA 2XLTA 1QJDA 1LV0A 2DKHA 4TM4A 1TYTA 2FBWA 4H2QA 3VCNA 4RSLA 1MNSA 2XLSA 2XFPA 5KOWA 2WPCA 3T2YA 1NU5A 3EUB3 1IUXA 4O5UA 2I0ZA 4H2NA 1YKJA 3N6JA 1FECA 4BK3A 1GSNA 3I4KA 3NKSA 3MSYA 2C3DA 3UOYA 1IUVA 2OA1A 3RCYA 4Z26A 4RG4A 1EBHA 2OAMA 3FMWA 4A3RA 5EOWA 2PU1A 1RYIA 3VC5A 2C70A 3DG7A 4HNCA 4J1OA 2BS3A 1BGJA 5LV9A 3O0HA 2E1MA 2WESA 3V3NA 4DN1A 4EQSA 3NHOX 3CPIG 2B7RA 1ONFA 5M0ZA 4JQ9A 1NDAA 3GMCA 2RGJA 1QLBA 2XVIA 3ITJA 4A35A 3T4WA 4ZCCA 4OVIA 3OZMA 4NZHA 1ZX9A 4N9XA 2P8BA 1ZOYA 4JY2A 4MKSA 3IHMA 4K5SA 1AOGA 3D8XA 3IJIA 3QPEA 2YR5A 3AWIA 1EL7A 5CKUA 4A79A 5KMPA 3C4AA 1GT8A 3CN8A 1XPQA 2V61A 2XVHA 2Y6RA 1JCTA 1NHSA 3RR1A 1E1MA 3KU9A 3ICSA 4E0VA 2GEWA 4WX1A 3NG7X 2YVJA 4LIIA 3AD9B 3QVRA 1TKKA 2GL5A 1T3QC 1E39A 3GY1A 1EBGA 1MRAA 1M6IA 3P4RA 1OEPA 1ZMCA 1NHRA 1BKWA 1PDZA 3UJSA 4X9MA 2F5ZA 3K7QX 3T0KA 3DGHA 4GAVA 3EPTA 2EQ6A 1MOKA 2WETA 4JDRA 4KWSA 4APNA 3UJFA 1H7XA 5IDZA 2R9ZA 1O95A 3ABVA 4OPTA 4H4XA 1H83A 1JRZA 1RVKA 4TLXA 1IUWA 2BK4A 4H7UA 2OZ8A 1VRQB 5JCMA 2QJJA 3UTEA 3IHGA 4B63A 3P9UA 2QGYA 4P9SA 3SSZA 2OZ3A 1GESA 5IQ1A 2FYMA 2C75A 3QLDA 1KNRA 4Z44A 3NVZB 3BNUA 1KN0A 1N4VA 2W0HA 3GO2A 5FJPA 3QSMA 5BULA 3GYIA 4YTMA 2XYOA 3VR9A 2XLUA 3D1CA 5KRQA 3SYIA 2O56A 4XWZA 2WBAA 1BKHA 2XLRA 4Z43A 3UCCA 1D4DA 3B9JB 4CY8A 3RITA 3CGBA 1CJ3A 2B9WA 2CHRA 4ZA0A 3FVDA 1GRTA 4EMJA 3UKHA 2UZZA 3AYLA 3H8LA 3UOXA 2GMHA 4TVYA 4HN8A 1Z6LA 3ATQA 2JB1A 3QVPA 3AE7A 3EANA 2WP5A 2WS3A 3TTEA 1PJ7A 3AE4A 3V3WA 1H7WA 4J33A 2GSHA 4FK1C 1P48A 2XH4A 2YAUA 2GV8A 3AEEA 3DJGX 3EAOA 1N60C 2EQ8A 1K0LA 3AE5A 2E4GA 3AE2A 2H89A 2GGEA 5FJTA 3JZUA 3UOVA 5KWFA 3NLCA 1L9DA 4PAAA 3NYCA 3UTFA 2WQYA 3JSKA 3NGCX 5FS8A 3C4NA 2PPGA 2WU2A 3TW9A 2YLSA 3CPJG 3GWDA 1SJDA 3F8DA 1L8PA 4UDRA 4BJZA 3AECA 4C77A 1W4XA 3DJEA 2V60A 1TDKA 5JRBA 2PODA 4H4TA 3RHAA 3VR8A 2R0CA 4FDCB 2PHHA 3P1WA 1JRXA 1LQTA 4REKA 2C3CA 3VC6A 1WUFA 3UKKA 1JOAA 1FHUA 2H88A 4A6NA 2X8GA 3CNJA 5HXIA 3VQRA 2BRAA 3V4BA 3GRSA 1L9CA 2GGHA 1XPYA 1DODA 3R11A 1CBOA 3OTRA 4OCGA 3NTDA 1WUEA 5JCLA 2ZZCA 1VG0A 3DK9A 3RP8A 2XDOA 4A6NB 2GRTA 2POZA 1LJ1A 3DESA 3AMZA 3NK2X 2C73A 4GDPA 3GC2A 1WYGA 1LVLA 1COYA 1FHVA 3NTAA 2XFOA 1IYXA 3HZLA 2V6OA 1F8SA 1PXBA 2OX4A 2YM2A 3R9UA 4ENLA 1FEBA 4A99A 4CCRA 3HPFA 1IUSA 1YQ4A 3FG2P 2JBVA 4B69A 3CK5A 2AL2B 1CHUA 3D9XA 2ZBWA 4ZN0A 1CC2A 2JB3A 2XH0A 3SJNA 3NYFA 4G6GA 3SN0A 3UCDA 1NENA 2Q0KA 2XGZA 3DGZA 1RP0A 3LZXA 3F8RA 3UP5A 1GRHA 1YQ3A 3BI5A 3NIXA 3K7TA 4USRA 2OPJA 1FOHA 2A87A 1F6MA 1V59A 2YG7A 5U25A 5U1OA 5DBJA 2BC1A 3TJIA 3PS9A 1GALA 3VDGA 4G9KA 1ELIA 4E5TA 1IUTA 4B67A 5JCKA 3CXOA 2V5ZA 4Y4LA 4K2XA 4IT1A 4U8KA 3RO6A 2AL1A 3AEAA 1S7MA 1KSSA 1YEYA 3NVYB 2OKTA 4IP5A 1PDYA 3A7AA 5GSNA 2Q0LA 3T8QA 6ENLA 1ZDLA 2RDXA 1TDNA 1TZZA 3IWAA 5CQFA 4H50A 3CNTA 2TMDA 1JPDX 3I3LA 1SJCA 5ENLA 1OJCA 1N5WC 3OC4A 1KKRA 4GF7A 3SQSA 2IIDA 3NVVB 2X99A 4FP1A 1E7PA 4CCQA 2FJAA 4WCTA 2X8CA 1NG3A 3TCSA 3CTYA 1K0JA 4DX3A 1RM6B 2XFNA 2PS2A 2XH7A 5G5GB 2OO6A 4NTCA 3KD9A 4LU6A 3T6CA 4X4JA 3LJPA 5FJRA 3ALLA 1NHPA 3GYJA 3CGDA 2QA1A 4CRTA 1M64A 2VRLA 2CFYA 4KT2A 2E5VA 1SJBA 4YSHA 3UKQA 2OVLA 3LOVA 3ZLHA 5EB4A 1QO8A 3RP7A 3EEZA 1NAAA 3B3RA 3ZVHA 4MJWA 2WDVA 3SZ0A 3REDA 1BF3A 3TWAA 4TM3A 2RGHA 2ACZA 2R0GA 1LPFA 3ADAB 2GQWA 1YY5A 4D04A 4JNAA 1KKOA 3P93A 4YWSA 3PWGA 1ZY8A 4U2SA 1GTHA 2OQYA 3SQPA 1PJ6A 4IA6A 4DGKA 4NTDA 1P2EA 2BCGG 3ALJA 4HNLA 4H4YA 1SB3B 3KA7A 1BGNA 1H81A 2W3SA 1GNDA 3SN4A 1YQZA 4CNKA 3AEBA 1B37A 3K1GA 4HPNA 4K8DA 4K1WA 4H4SA 3AE3A 4X2PA 4GRTA 2YVFA 2R45A 5EU9A 2FJBA 3SN1A 3UGVA 3UP4A 3UTGA 1X2GA 3FPZA 4Z2RA 4H83A 4BV6A 3I6DA 4NTEA 4FI4A 3UCLA 4A65A 5FMHA 4O5QA 4H4VA 1KF6A 3JVAA 3VA8A 1VDCA 3OP2A 1DTNA 1S2YA 4AOXA 1JEHA 1GERA 2WP6A 4GAPA 1CL0A 5IPYA 2X8HA 2TPRA 3NZGA 2XLPA 3M0OA 3UKAA 2PTYA 3VRAA 3S5SA 4U8IA 2I5QA 2PP1A 1KNPA 3AXBA 1D7YA 2YLZA 4EIPA 2BXRA 4TM0A 1REOA 1D4EA 2HZGA 1GRAA 3GDPA 2FJDA 2YQUA 3R25A 1ONEA 4BJYA 4C5OA 1OJTA 3QN3A 2XFQA 4U8OA 4I58A 3QFAA 1PJ5A 4YSYA 4K22A 2X3NA 2PMQA 4CY6A 1HYUA 3BI2A 2VZ2A 1JNZA 3S5WA 3EF6A 1MXTA 1E1NA 2VVLA 3UTHA 1IJHA 2JKCA 1S2QA 3DGBA 3V3OA 4NWZA 2FKPA 4KEMA 3M13A 2GGJA 2WHDA 1EL8A 3TQPA 3DK8A 3UKFA 4YSXA 2W3RA 3IJQA 5FJOA 3QSEA 2FJEA 1B8SA 4B1BA 1CJ4A 3KPKA 1NG4A 2OALA 1PHHA 4GCMA 2C67A 2IVEA 2P8CA 2PSNA 4ADWA 2BXSA 1ZXIC 2BCPA 1DOCA 4M6UA 3VFCA 1Q1WA 4IHCA 3TJ4A 3R0UA 4EQXA 1F9CA 2WU5A 1EL9A 3D46A 1S3BA 1TE6A 3AD8B 3QJ4A 4OPUA 3GWFA 3ISHA 3I6EA 4EQRA 3I6TA 3Q6JA 2BACA 4ROPA 5C3JA 4C3XA 4G6HA 4H4PA 3P4QA 3ES7A 5BUKA 1E1LA 3U9IA 3CB3A 4HCLA 2GAHB 2QDDA 2C66A 3Q45A 5TR3A 3CMMA 1F3PA 1D5TA 4J57A 3KPFA 2NVKX 1RSGA 3NH3X 3U4FA 1F8WA 3P4SA 2AR8A 5U63A 1TDEA 4GISA 4EMWA 4UDQA 3AEGA 3R07C 1CC4A 4YKGA 2IVDA 3NRNA 4GYPA 3VRBA 2P3ZA 2VQ7A 3BNMA 1EC9A 1Q9IA 3PK7A 2WOIA 2PTZA 4BK2A 2YM1A 1XANA 4USQA 3CAWA 4GUVA 5J60A 3II4A 1FO4A 3CPHG 3CNDA 2OZTA 4ZCDA 3AB1A 1VQZA 3G5RA 4OPIA 1BWCA 1Y56B 2DW7A 4IV9A 2WPEA 5FS9A 3NFUA 2CDUA 3NYEA 1MUCA 4AT0A 3AD7B 3CXBA 2YWLA 1PXAA 2HNEA 2XH2A 4F4RA 2A8XA 2ARDA 3SZFA 4UP3A 4Z2TA 2W54A 1FFUC 1ZK7A 1CF3A 2QA2A 3SXIA 2B9YA 2HXTA 3FJ4A 3SFEA 4KPLA 2YR4A 1O5WA 3FXGA 1VDVA 3MZNA 2C7GA 1KD0A 1JDFA 4HCHA 4B66A 2YLXA 4TLZA 4D03A 1XHCA 3UKLA 2QDEA 4K5RA 4JY3A 3QTPA 2GMJA 3MY9A 2VVMA 3PVCA 3L5OA 3A7RA 2A89A 4ZOHB 1CJ2A 1GETA 5EB5A 4C74A 4GYPC 2EQ9A 2WDRA 4CBQA 2E3TA 1PDHA 4H2PA 1PBDA 4EQWA 3K7MX 2CULA 3C96A 2ZADA 4K8GA 3P0WA 1X2HA 3VCCA 3RNMA 3NNEA 4A9WA 4II2A 2GGGA 2DW6A 3UJEA 1CJCA 4LA1A 1GRGA 3UJRA 1ZKQA 3DIPA 5KVIA 1SEZA 2GQFA 4U8JA 2XVEA 4G73A 4DWDA 2P0IA 2Q7VA 4PABA 5KNLA 3BSMA 3DA1A 4HB9A 3P3BA 5FJUA 5JCIA 2APGA 1JRYA 1XS2A 5IQ4A 3A7UA 1TYPA 4J56A 4GR1A 4AOSA 3R10A 2GF3A 4JN9A 4HCDA 3NVWB 2AQJA 4Z17A 3L1RA 2BA9A 4GMEA 2OLNA 2AKMA 4AT2A 2ZZBA 2Q6UA 3FBSA 3T14A 2OLOA 2R0PA 2YG5A 3BHKA 1H82A 2PGEA 4NNJA 3KLJA 3SZCA 4TVWA 1BZLA 2OLAA 2NPXA 4DNAA 1P43A 4A7AA 4OPCA 1K0IA 4U8LA 3MQTA 4NEVA 3T9PA 4IA5A 3EKGA 1VG9A 4YXDA 1UKVG 2J3NA 2VRMA 3FYYA 2PP3A 1KCZA 4U2LA 4A6GA 2C72A 2GR3A 3IJLA 4H1ZA 3KUMA 4XWRA 5GRTA 2XFUA 3LB8A 1S3EA 1ZP0A 1JRPA 1OJDA 3RRAA 4DHGA 1LQUA 4FX9A 4JN8A 1D4CA 3ICTA 3GD4A 1PBBA 2HQMA 4OPLA 4YT0A 2QCUA 3N4FA 1D7LA 1JU2A 5EBKA 2PYXA 2QQ6A 3HYWA 3BI4A 2C76A 2QJNA 2OQHA 3G5SA 3B97A 3DFYA 2V3BA 3OW1A 3SY4A 4B64A 3V5CA 1K4QA 2YLTA 5HY5A 4DXKA 1GPEA 1N4WA 4OPDA 2PP0A 2GVCA 2GAGB 2WOWA 3Q4DA 1TDFA 2C64A 1NHQA 1LTXR 1NELA 3SZWA 5KVHA 3T31A 4K2SA 3AE8A 1N62C 3ETRB 4MMWA 4G74A 1DNCA 4HA6A 4KPRA 3N4EA 1H2IA 4RG3A 2WOVA 4H4WA 3CNPA 1E9IA 2GR1A 3CGCA 3NRZB 4IL0A 1N5XA 2AKZA 3OZ2A 4Z24A 3HYXA 3H8IA 2P88A 3OZYA 1OJAA 3NXLA 2E5AA 3SR6B 4H2HA 2R4EA 1SJAA 3IC9A 4G8TA 2JAEA 3KVEA 1H6VA 1PBEA 4EM4A 1CC6A 3ES8A 5BOFA 1N1PA 4Z25A 1JROA 3NK1X 4B68A 3RP6A 2CVJA 1O94A 4ECHA 4DYEA 2B76A 4II3A 4E4FA 2JB2A 3T2ZA 4J2WA 5KXJA 4H4UA 4JNQA 4YKFA 3UKPA 1ELSA 3AYIA 2GB0A 2VOUA 3BOXA 2YLWA 4X9NA 1H86A 2WDQA 2BYBA 4Y4NA 4DSHA 2QVHA 2O9ZA 3SX6A 3NO1A 1DOEA 3HYVA 2GH5A 4JN7A 5HHFA 4AP3A 1E1KA 4E6MA 5BVAA 5KMRA 3V5FA 4DSGA 2B7SA 7ENLA 2BK3A 4YSZA 2VQBA 3M12A 1KDGA 3LXDA 3UXKA 3NN0X 5FS7A 3AYJA 4Z2UA 4TM1A 3DG3A 2Z5YA 1E6EA 3ZLFA 4EM3A 4XXGA 1DJNA 4FK1A 4JHMA 1PBFA 3H7VA 1ZMDA 4IVMB 3P4PA 4H19A 4OPGA 1PS9A 1EC7A 3THUA 4H2RA 3AE1A 1GOSA 4NEWA 4J3ZA 2ZZ0A 3PFRA 4AP1A 3H8AA 2YVGA 3Q9TA 2BRYA 3WE0A 1Y0PA 4I59A 2ONEA 1P2HA 3D47A 5HYMA 3G5QA 1R6WA 1H84A 1V97A 3JW7A 5BRTA 1W6TA 5L46A 4A5LA 3DERA 3QSSA 1BQGA 3AE9A 2RABA 3GDNA 3DDMA 4H4QA 3SGLA 4YTNA 3ZDNA 5KMSA 2R4JA 3ICRA 3AM9A 3V76A 2RGOA 2VVLG 3AEFA 3IF9A 4GDEA 1MO9A 2BC0A 3STPA 5BOEA 1KFYA 4BK1A 3UXLA 2V3AA 1EBDA 3K30A 3BJSA 3HW2A 3PWIA 1PN0A 2PA6A 3TWBA 3T37A 3ZVHB 5M10A 2PGWA 3GRTA 4E4UA 4Z1YA 5G5HB 1Y56A 2XSXA 3E1TA 3AE6A 3AEDA 1FFVC 3ATRA 4YTPA 3FIMB 3DH9A 1IUUA 3GMBA 3LADA 4EIQA 2R46A 3DJDA 4EWJA 2WEUA 1FCDA 2YG4A 2GDQA 3CIRA 3T2KA 2ZC8A 2PCEA 3QKEA 3UOZA 4UDPA 4J36A 2WPFA 3CNSA 3MWCA
chains in the Genus database with same CATH topology
5JCIA 2APGA 3BNUA 1JRYA 3ZYXA 1KN0A 1N4VA 2W0HA 5IQ4A 3QSMA 5BULA 1B37A 2YR6A 3GYIA 4YTMA 4H4RA 1TYPA 2XYOA 3VR9A 2XLUA 3D1CA 5KRQA 3GYXA 4J56A 4K8DA 3KKJA 3SYIA 4GR1A 4XWZA 2WBAA 4AOSA 4H4SA 3AE3A 2XLRA 4Z43A 4GRTA 2BK5A 1D4DA 2YVFA 2XVJA 2GF3A 2R45A 4JN9A 2FJBA 2BABA 4CY8A 3CGBA 1CJ3A 2AQJA 2B9WA 2YG3A 3L1RA 3UP4A 2BA9A 3GSIA 3UTGA 3URHA 2OLNA 3FPZA 1GRTA 4AT2A 2QAEA 4BV6A 4Z2RA 2ZZBA 2Q6UA 3FBSA 3I6DA 4EMJA 4NTEA 1GXFA 3T14A 1FEAA 2OLOA 3UCLA 3UKHA 5FMHA 4A65A 2R0PA 2UZZA 2YG5A 3AYLA 3BHKA 1FL2A 3H8LA 1H82A 4NNJA 4O5QA 3KLJA 3F8PA 4H4VA 3UOXA 2GMHA 3SZCA 1KF6A 4C3YA 1Z6LA 1NEKA 3ATQA 1BZLA 2JB1A 2NPXA 4DNAA 1F8RA 3EANA 2WP5A 1VDCA 3AE7A 3QVPA 2WS3A 1S2YA 4AOXA 4A7AA 1PJ7A 2XCGA 4OPCA 1K0IA 2BS4A 2Z5XA 4U8LA 1JEHA 4NEVA 1GERA 2WP6A 3AE4A 2GR2A 1H7WA 4GAPA 4J33A 4CNJA 3PO7A 4FK1C 1CL0A 2YAUA 4IA5A 5IPYA 1VG9A 2BS2A 2X8HA 2TPRA 5FS6A 4YXDA 4H4ZA 2XLPA 1UKVG 2YG6A 3M0OA 4J34A 2GV8A 2X50A 3SM8A 2J3NA 3UKAA 2VRMA 3AEEA 3DJGX 3EAOA 4U2LA 1GEUA 1GV4A 2EQ8A 3VRAA 2AAQA 2GR3A 2C72A 1K0LA 4U8IA 1GTEA 3AE5A 1KNPA 2E4GA 3AE2A 5J7XA 4XWRA 3SFDA 5C2TA 2H89A 3L8KA 3AXBA 5GRTA 1JNRA 3DJJA 2XFUA 1D7YA 3LB8A 1S3EA 2YLZA 4ICYA 4Y4MA 4EIPA 2BXRA 3UOVA 5KWFA 1ZP0A 3NLCA 1L9DA 1OJDA 4PAAA 4TM0A 3CGEA 1REOA 1D4EA 1LQUA 4FX9A 1D4CA 3ICTA 3GD4A 4U8PA 3NYCA 1GRAA 3GDPA 3UTFA 1TRBA 1PBBA 2WQYA 2FJDA 2YQUA 3JSKA 2HQMA 3GD3A 3NGCX 4OPLA 4YT0A 5FS8A 2QCUA 1D7LA 1JU2A 2PYXA 5EBKA 3NK0X 4BJYA 4C5OA 1PBCA 3HYWA 3C4NA 3BI4A 1OJTA 2C76A 2WU2A 2YLSA 3CPJG 1N4UA 3VRDB 3GWDA 1PXCA 1X31B 2XFQA 2YLRA 3G5SA 3F8DA 4UDRA 1DOBA 1B4VA 4J31A 3AECA 4BJZA 3H4KA 2V3BA 3SY4A 4B64A 1VQWA 4U8OA 4C77A 1K4QA 5ER0A 3DK4A 1DJQA 4I58A 3QFAA 1PJ5A 1W4XA 4YSYA 4K22A 3DJEA 2X3NA 2XVFA 2YLTA 5HY5A 1L9EA 2JK6A 2V60A 1GRBA 1GPEA 1TDKA 1N4WA 5JRBA 4CY6A 1HYUA 4H4TA 4BURA 2EQ7A 3BI2A 2R0CA 4OPDA 2VZ2A 3RHAA 3VR8A 4EMIA 1JNZA 3S5WA 4B65A 4FDCB 3EF6A 2GVCA 3QFBA 3PG6A 2C65A 2GAGB 1MXTA 1OJ9A 3LZWA 2WOWA 2PHHA 1E1NA 1TDFA 2VVLA 2C64A 1GREA 3UTHA 1IJHA 1NHQA 1LTXR 2JKCA 5KOXA 1S2QA 3P1WA 1JRXA 4IVOB 3V3OA 3SZWA 1LQTA 4REKA 4NWZA 2C3CA 5KVHA 3T31A 1B5QA 3M13A 2WHDA 3AE8A 1EL8A 3UKKA 1JOAA 3DK8A 1L0VA 2H88A 3UKFA 4A6NA 4G74A 1DNCA 2X8GA 3B6DA 3BHFA 4HA6A 5KMQA 4KPRA 1H2IA 4RG3A 2WOVA 4H4WA 4YSXA 3CNPA 1DXLA 1ZOVA 3QSEA 3CNJA 5HXIA 2FJEA 3VQRA 2GR1A 4YWOA 1B8SA 2BRAA 3CGCA 4B1BA 4U8NA 1L9CA 3GRSA 1DODA 1TDOA 2DKIA 4U2TA 1CBOA 1CJ4A 3KPKA 3ALMA 3OZ2A 1NG4A 2OALA 1NPXA 4K7ZA 1PHHA 5JCNA 3HYXA 4Z24A 3H8IA 3NT6A 4OCGA 3NTDA 2Y6QA 5JCLA 2C4CA 4GCMA 1OJAA 2C67A 2IVEA 3S61A 2ZZCA 1GRFA 1VG0A 3NN6X 3DK9A 1Q1RA 4ADWA 2BXSA 1KSUA 3RP8A 2GR0A 2BCPA 1DOCA 2WP9A 2XDOA 4A6NB 1Q1WA 2R4EA 2GRTA 3IC9A 2JAEA 3KVEA 1LJ1A 1H6VA 1PBEA 4EM4A 1CC6A 3NK2X 4EQXA 3COXA 2C73A 3DMEA 4KX6A 4GDPA 1N1PA 2WU5A 4Z25A 1EL9A 2B9XA 1S3BA 4M52A 1EL5A 1LVLA 1XDIA 3AD8B 3NK1X 3QJ4A 4B68A 1COYA 4OPUA 3RP6A 3GWFA 2CVJA 3NTAA 3ISHA 4EQRA 3Q6JA 1O94A 2BACA 4U8MA 5C3JA 4C3XA 2XFOA 2XLTA 4ECHA 4G6HA 1QJDA 1LV0A 4H4PA 2B76A 3P4QA 2DKHA 2V6OA 3HZLA 4II3A 2JB2A 4TM4A 1TYTA 1F8SA 2FBWA 4H2QA 1E1LA 1PXBA 4RSLA 3T2ZA 5BUKA 2XLSA 2YM2A 2XFPA 4J2WA 3R9UA 5KXJA 4H4UA 2GAHB 4JNQA 2WPCA 3T2YA 2C66A 5KOWA 4YKFA 1IUXA 5TR3A 4O5UA 1FEBA 3CMMA 2I0ZA 1F3PA 1D5TA 1YKJA 4H2NA 3UKPA 4J57A 4A99A 4CCRA 3AYIA 1FECA 2GB0A 3KPFA 2VOUA 1IUSA 2NVKX 1RSGA 1YQ4A 3NH3X 3FG2P 2JBVA 2YLWA 4X9NA 4BK3A 1F8WA 1H86A 2WDQA 1GSNA 4B69A 3P4SA 1CHUA 3D9XA 2AR8A 2BYBA 2ZBWA 4Y4NA 4ZN0A 4DSHA 1CC2A 2JB3A 3NYFA 5U63A 1TDEA 2O9ZA 4EMWA 4G6GA 4UDQA 3SX6A 3NKSA 1DOEA 3AEGA 1NENA 3HYVA 1CC4A 2C3DA 4YKGA 2IVDA 3UOYA 2Q0KA 1IUVA 2GH5A 3NRNA 2OA1A 3DGZA 3VRBA 2VQ7A 3BNMA 5HHFA 4AP3A 1E1KA 1Q9IA 4Z26A 1RP0A 4RG4A 2OAMA 3LZXA 3F8RA 5BVAA 2WOIA 3UP5A 5KMRA 4DSGA 1GRHA 3FMWA 2B7SA 4BK2A 1YQ3A 2BK3A 2VQBA 2YM1A 3M12A 1KDGA 3BI5A 3NIXA 3K7TA 5EOWA 4YSZA 1XANA 4USRA 3LXDA 1RYIA 4USQA 4GUVA 2C70A 3NN0X 1FOHA 5J60A 2A87A 5FS7A 1F6MA 1V59A 3II4A 2YG7A 3AYJA 4Z2UA 5U25A 5U1OA 2BS3A 4TM1A 3CPHG 5DBJA 2BC1A 3CNDA 2Z5YA 1E6EA 3PS9A 1BGJA 4ZCDA 5LV9A 3O0HA 3AB1A 2E1MA 4EM3A 3G5RA 1GALA 4OPIA 1BWCA 1Y56B 4G9KA 1ELIA 4XXGA 1IUTA 1DJNA 4FK1A 4B67A 2WESA 4IV9A 2WPEA 5FS9A 1PBFA 3V3NA 5JCKA 1ZMDA 2V5ZA 4Y4LA 4K2XA 4IVMB 3P4PA 4EQSA 3NHOX 4U8KA 3CPIG 2CDUA 3AEAA 4OPGA 2B7RA 1PS9A 1S7MA 1ONFA 1KSSA 3NYEA 5M0ZA 4AT0A 4H2RA 4JQ9A 3AE1A 1NDAA 3AD7B 3GMCA 1GOSA 5GSNA 2RGJA 4NEWA 2YWLA 1QLBA 2ZZ0A 2XVIA 3ITJA 4AP1A 2Q0LA 1PXAA 1ZDLA 2YVGA 3Q9TA 2BRYA 4ZCCA 2A8XA 4OVIA 2ARDA 3SZFA 1TDNA 4UP3A 3WE0A 4Z2TA 3IWAA 1Y0PA 4NZHA 1ZX9A 5CQFA 4H50A 4N9XA 1ZOYA 4I59A 4JY2A 3IHMA 4K5SA 1P2HA 1CF3A 1ZK7A 3CNTA 1AOGA 2QA2A 3SXIA 5HYMA 2B9YA 3G5QA 2TMDA 3SFEA 2YR4A 1H84A 3D8XA 1O5WA 3I3LA 2YR5A 2C7GA 1OJCA 3AWIA 1EL7A 3OC4A 5CKUA 4A79A 5KMPA 3C4AA 5BRTA 4GF7A 5L46A 2IIDA 1GT8A 3CN8A 1XPQA 2V61A 4A5LA 4B66A 2YLXA 4TLZA 2XVHA 3QSSA 2X99A 1E7PA 2Y6RA 4CCQA 4D03A 3AE9A 1NHSA 2FJAA 2RABA 1XHCA 3UKLA 1E1MA 3GDNA 3KU9A 4WCTA 3ICSA 2X8CA 4H4QA 4E0VA 1NG3A 2GEWA 3SGLA 3CTYA 4YTNA 1K0JA 4WX1A 3NG7X 2YVJA 4LIIA 4K5RA 3ZDNA 4JY3A 2XFNA 5KMSA 2R4JA 3AD9B 2GMJA 3ICRA 3QVRA 1E39A 2VVMA 3PVCA 3V76A 3L5OA 4NTCA 3KD9A 2RGOA 1M6IA 2VVLG 3P4RA 4LU6A 2A89A 4X4JA 1ZMCA 3LJPA 3AEFA 3ALLA 3IF9A 1NHPA 1NHRA 1BKWA 1GETA 1CJ2A 3GYJA 4GDEA 4HB9A 5EB5A 4C74A 1MO9A 2BC0A 2EQ9A 3CGDA 2QA1A 2WDRA 1KFYA 4BK1A 4CBQA 4X9MA 2F5ZA 1PDHA 2V3AA 1EBDA 4H2PA 3K30A 4CRTA 1M64A 1PBDA 2VRLA 4EQWA 2CFYA 3K7QX 3T0KA 2E5VA 3K7MX 3DGHA 1PN0A 4YSHA 4GAVA 3UKQA 2CULA 3C96A 3EPTA 3T37A 3LOVA 5M10A 5EB4A 1QO8A 3GRTA 3RP7A 1Y56A 2EQ6A 1NAAA 1MOKA 3AE6A 3E1TA 2WETA 3B3RA 4JDRA 3AEDA 4MJWA 4APNA 1H7XA 3ATRA 2WDVA 3SZ0A 2R9ZA 1O95A 3RNMA 3ABVA 4YTPA 4OPTA 3NNEA 3REDA 1BF3A 4H4XA 4TM3A 3FIMB 2RGHA 1H83A 3DH9A 1JRZA 1IUUA 3GMBA 4A9WA 2ACZA 4TLXA 1IUWA 2BK4A 2R0GA 1LPFA 3LADA 4H7UA 3ADAB 2GQWA 1YY5A 4II2A 4EIQA 1VRQB 5JCMA 4D04A 4JNAA 2R46A 3DJDA 3UTEA 3IHGA 1ZY8A 1CJCA 1GTHA 4U2SA 4B63A 2WEUA 4LA1A 1GRGA 3SQPA 1PJ6A 3P9UA 4IA6A 4NTDA 4DGKA 1P2EA 1FCDA 4P9SA 2YG4A 1ZKQA 2BCGG 3ALJA 5KVIA 1GESA 1SEZA 4H4YA 2GQFA 4U8JA 5IQ1A 2XVEA 1BGNA 3CIRA 3KA7A 4G73A 3T2KA 2C75A 1H81A 3UOZA 1GNDA 2Q7VA 4J36A 1KNRA 4PABA 4UDPA 5KNLA 1YQZA 4Z44A 4CNKA 2WPFA 3CNSA 3AEBA 3DA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JCI A;  2APG A;  3BNU A;  1JRY A;  3ZYX A;  1N4V A;  2W0H A;  5IQ4 A;  3QSM A;  5BUL A;  1B37 A;  2YR6 A;  3GYI A;  4YTM A;  4H4R A;  1TYP A;  2XYO A;  3VR9 A;  2XLU A;  3D1C A;  5KRQ A;  4J56 A;  4K8D A;  3KKJ A;  4GR1 A;  4XWZ A;  2WBA A;  4AOS A;  4H4S A;  3AE3 A;  2XLR A;  4Z43 A;  4GRT A;  2BK5 A;  1D4D A;  2YVF A;  2XVJ A;  2GF3 A;  2R45 A;  4JN9 A;  2FJB A;  2BAB A;  4CY8 A;  3CGB A;  1CJ3 A;  2AQJ A;  2B9W A;  2YG3 A;  3L1R A;  3UP4 A;  2BA9 A;  3GSI A;  3UTG A;  3URH A;  2OLN A;  3FPZ A;  1GRT A;  4AT2 A;  2QAE A;  4BV6 A;  4Z2R A;  2ZZB A;  2Q6U A;  3FBS A;  3I6D A;  4EMJ A;  4NTE A;  1GXF A;  3UKH A;  1FEA A;  2OLO A;  3UCL A;  4A65 A;  5FMH A;  2R0P A;  2UZZ A;  2YG5 A;  3AYL A;  3BHK A;  1FL2 A;  3H8L A;  1H82 A;  4O5Q A;  3KLJ A;  3F8P A;  4H4V A;  3UOX A;  2GMH A;  1KF6 A;  4C3Y A;  1Z6L A;  1NEK A;  3ATQ A;  1BZL A;  2JB1 A;  2NPX A;  4DNA A;  1F8R A;  3EAN A;  2WP5 A;  1VDC A;  3AE7 A;  3QVP A;  2WS3 A;  1S2Y A;  4AOX A;  4A7A A;  1PJ7 A;  2XCG A;  4OPC A;  1K0I A;  2BS4 A;  2Z5X A;  4U8L A;  1JEH A;  4NEV A;  1GER A;  2WP6 A;  3AE4 A;  2GR2 A;  1H7W A;  4J33 A;  4CNJ A;  3PO7 A;  4FK1 C;  1CL0 A;  2YAU A;  4IA5 A;  5IPY A;  1VG9 A;  2BS2 A;  2X8H A;  2TPR A;  5FS6 A;  4YXD A;  4H4Z A;  2XLP A;  1UKV G;  2YG6 A;  3M0O A;  4J34 A;  2GV8 A;  2X50 A;  3SM8 A;  2J3N A;  3UKA A;  2VRM A;  3AEE A;  3DJG X;  3EAO A;  4U2L A;  1GEU A;  1GV4 A;  2EQ8 A;  3VRA A;  2AAQ A;  2GR3 A;  2C72 A;  1K0L A;  4U8I A;  1GTE A;  3AE5 A;  1KNP A;  2E4G A;  3AE2 A;  5J7X A;  4XWR A;  3SFD A;  5C2T A;  2H89 A;  3L8K A;  3AXB A;  5GRT A;  1JNR A;  3DJJ A;  2XFU A;  1D7Y A;  3LB8 A;  1S3E A;  2YLZ A;  4ICY A;  4Y4M A;  4EIP A;  2BXR A;  3UOV A;  5KWF A;  1ZP0 A;  3NLC A;  1L9D A;  1OJD A;  4PAA A;  4TM0 A;  3CGE A;  1REO A;  1D4E A;  1LQU A;  4FX9 A;  1D4C A;  3ICT A;  3GD4 A;  4U8P A;  3NYC A;  1GRA A;  3GDP A;  3UTF A;  1TRB A;  1PBB A;  2WQY A;  2FJD A;  2YQU A;  3JSK A;  2HQM A;  3GD3 A;  3NGC X;  4OPL A;  4YT0 A;  5FS8 A;  2QCU A;  1D7L A;  1JU2 A;  2PYX A;  5EBK A;  3NK0 X;  4BJY A;  4C5O A;  1PBC A;  3C4N A;  3BI4 A;  1OJT A;  2C76 A;  2WU2 A;  2YLS A;  3CPJ G;  1N4U A;  3VRD B;  3GWD A;  1PXC A;  1X31 B;  2XFQ A;  2YLR A;  3G5S A;  3F8D A;  4UDR A;  1DOB A;  1B4V A;  4J31 A;  3AEC A;  4BJZ A;  3H4K A;  2V3B A;  4B64 A;  1VQW A;  4U8O A;  4C77 A;  1K4Q A;  5ER0 A;  3DK4 A;  1DJQ A;  4I58 A;  3QFA A;  1PJ5 A;  1W4X A;  4YSY A;  4K22 A;  3DJE A;  2X3N A;  2XVF A;  2YLT A;  5HY5 A;  1L9E A;  2JK6 A;  2V60 A;  1GRB A;  1GPE A;  1TDK A;  1N4W A;  4CY6 A;  1HYU A;  4H4T A;  4BUR A;  2EQ7 A;  3BI2 A;  2R0C A;  4OPD A;  2VZ2 A;  3RHA A;  3VR8 A;  4EMI A;  1JNZ A;  3S5W A;  4B65 A;  4FDC B;  3EF6 A;  2GVC A;  3QFB A;  2C65 A;  2GAG B;  1MXT A;  1OJ9 A;  3LZW A;  2WOW A;  2PHH A;  1E1N A;  1TDF A;  2VVL A;  2C64 A;  1GRE A;  3UTH A;  1IJH A;  1NHQ A;  1LTX R;  2JKC A;  5KOX A;  1S2Q A;  3P1W A;  1JRX A;  4IVO B;  3V3O A;  1LQT A;  4REK A;  2C3C A;  5KVH A;  1B5Q A;  3M13 A;  2WHD A;  3AE8 A;  1EL8 A;  3UKK A;  1JOA A;  3DK8 A;  1L0V A;  2H88 A;  3UKF A;  4A6N A;  1DNC A;  2X8G A;  3B6D A;  3BHF A;  4HA6 A;  4KPR A;  4RG3 A;  2WOV A;  4H4W A;  4YSX A;  3CNP A;  1DXL A;  1ZOV A;  3QSE A;  3CNJ A;  5HXI A;  2FJE A;  3VQR A;  2GR1 A;  4YWO A;  1B8S A;  3CGC A;  4B1B A;  4U8N A;  1L9C A;  3GRS A;  1DOD A;  1TDO A;  2DKI A;  4U2T A;  1CBO A;  1CJ4 A;  3ALM A;  3OZ2 A;  1NG4 A;  2OAL A;  1NPX A;  4K7Z A;  1PHH A;  5JCN A;  4Z24 A;  3H8I A;  3NT6 A;  4OCG A;  3NTD A;  2Y6Q A;  5JCL A;  4GCM A;  1OJA A;  2C67 A;  2IVE A;  3S61 A;  2ZZC A;  1GRF A;  1VG0 A;  3NN6 X;  3DK9 A;  1Q1R A;  4ADW A;  2BXS A;  1KSU A;  3RP8 A;  2GR0 A;  2BCP A;  1DOC A;  2WP9 A;  2XDO A;  4A6N B;  1Q1W A;  2R4E A;  2GRT A;  3IC9 A;  2JAE A;  3KVE A;  1LJ1 A;  1H6V A;  1PBE A;  4EM4 A;  1CC6 A;  3NK2 X;  4EQX A;  3COX A;  2C73 A;  3DME A;  4KX6 A;  4GDP A;  1N1P A;  2WU5 A;  4Z25 A;  1EL9 A;  2B9X A;  1S3B A;  4M52 A;  1EL5 A;  1LVL A;  1XDI A;  3AD8 B;  3NK1 X;  3QJ4 A;  4B68 A;  1COY A;  4OPU A;  3RP6 A;  3GWF A;  2CVJ A;  3NTA A;  3ISH A;  4EQR A;  3Q6J A;  1O94 A;  2BAC A;  4U8M A;  5C3J A;  4C3X A;  2XFO A;  2XLT A;  4ECH A;  1QJD A;  1LV0 A;  4H4P A;  2B76 A;  3P4Q A;  2DKH A;  2V6O A;  3HZL A;  4TM4 A;  2JB2 A;  1TYT A;  1F8S A;  2FBW A;  4H2Q A;  1E1L A;  1PXB A;  4RSL A;  5BUK A;  2XLS A;  2YM2 A;  2XFP A;  4J2W A;  3R9U A;  5KXJ A;  4H4U A;  2GAH B;  4JNQ A;  2WPC A;  5KOW A;  2C66 A;  4YKF A;  1IUX A;  5TR3 A;  4O5U A;  1FEB A;  2I0Z A;  1F3P A;  1D5T A;  1YKJ A;  4H2N A;  3UKP A;  4J57 A;  4A99 A;  4CCR A;  3AYI A;  1FEC A;  2GB0 A;  3KPF A;  2VOU A;  1IUS A;  2NVK X;  1RSG A;  1YQ4 A;  3NH3 X;  3FG2 P;  2JBV A;  2YLW A;  4X9N A;  4BK3 A;  1F8W A;  1H86 A;  2WDQ A;  1GSN A;  4B69 A;  3P4S A;  1CHU A;  2AR8 A;  2BYB A;  2ZBW A;  4Y4N A;  4ZN0 A;  4DSH A;  1CC2 A;  2JB3 A;  3NYF A;  5U63 A;  1TDE A;  2O9Z A;  4EMW A;  4UDQ A;  3NKS A;  1DOE A;  3AEG A;  1NEN A;  1CC4 A;  2C3D A;  4YKG A;  2IVD A;  3UOY A;  2Q0K A;  1IUV A;  2GH5 A;  3NRN A;  2OA1 A;  3DGZ A;  3VRB A;  2VQ7 A;  3BNM A;  5HHF A;  4AP3 A;  1E1K A;  1Q9I A;  4Z26 A;  1RP0 A;  4RG4 A;  2OAM A;  3LZX A;  3F8R A;  5BVA A;  2WOI A;  3UP5 A;  4DSG A;  1GRH A;  3FMW A;  2B7S A;  4BK2 A;  1YQ3 A;  2BK3 A;  2VQB A;  2YM1 A;  3M12 A;  1KDG A;  3BI5 A;  3NIX A;  3K7T A;  5EOW A;  4YSZ A;  1XAN A;  4USR A;  3LXD A;  1RYI A;  4USQ A;  4GUV A;  2C70 A;  3NN0 X;  1FOH A;  5J60 A;  2A87 A;  5FS7 A;  1F6M A;  1V59 A;  3II4 A;  2YG7 A;  3AYJ A;  4Z2U A;  5U25 A;  5U1O A;  2BS3 A;  4TM1 A;  3CPH G;  5DBJ A;  2BC1 A;  3CND A;  2Z5Y A;  1E6E A;  3PS9 A;  1BGJ A;  4ZCD A;  5LV9 A;  3O0H A;  3AB1 A;  2E1M A;  4EM3 A;  3G5R A;  1GAL A;  4OPI A;  1BWC A;  1Y56 B;  1ELI A;  4XXG A;  1IUT A;  1DJN A;  4FK1 A;  4B67 A;  2WES A;  4IV9 A;  2WPE A;  5FS9 A;  1PBF A;  3V3N A;  5JCK A;  1ZMD A;  2V5Z A;  4Y4L A;  4K2X A;  4IVM B;  3P4P A;  4EQS A;  3NHO X;  4U8K A;  3CPI G;  2CDU A;  3AEA A;  4OPG A;  2B7R A;  1PS9 A;  1ONF A;  1KSS A;  3NYE A;  5M0Z A;  4AT0 A;  4H2R A;  4JQ9 A;  3AE1 A;  1NDA A;  3AD7 B;  3GMC A;  1GOS A;  5GSN A;  2RGJ A;  4NEW A;  2YWL A;  1QLB A;  2ZZ0 A;  2XVI A;  3ITJ A;  4AP1 A;  2Q0L A;  1PXA A;  1ZDL A;  2YVG A;  3Q9T A;  4ZCC A;  2A8X A;  4OVI A;  2ARD A;  1TDN A;  4UP3 A;  3WE0 A;  4Z2T A;  3IWA A;  1Y0P A;  4NZH A;  1ZX9 A;  5CQF A;  4H50 A;  4N9X A;  1ZOY A;  4I59 A;  4JY2 A;  3IHM A;  4K5S A;  1P2H A;  1CF3 A;  1ZK7 A;  3CNT A;  1AOG A;  2QA2 A;  5HYM A;  2B9Y A;  3G5Q A;  2TMD A;  3SFE A;  2YR4 A;  1H84 A;  3D8X A;  1O5W A;  3I3L A;  2YR5 A;  2C7G A;  1OJC A;  3AWI A;  1EL7 A;  3OC4 A;  5CKU A;  4A79 A;  3C4A A;  5BRT A;  4GF7 A;  5L46 A;  2IID A;  1GT8 A;  3CN8 A;  1XPQ A;  2V61 A;  4A5L A;  4B66 A;  2YLX A;  4TLZ A;  2XVH A;  3QSS A;  2X99 A;  1E7P A;  2Y6R A;  4CCQ A;  4D03 A;  3AE9 A;  1NHS A;  2FJA A;  2RAB A;  1XHC A;  3UKL A;  1E1M A;  3GDN A;  3KU9 A;  4WCT A;  3ICS A;  2X8C A;  4H4Q A;  4E0V A;  1NG3 A;  2GEW A;  3SGL A;  3CTY A;  4YTN A;  1K0J A;  4WX1 A;  3NG7 X;  2YVJ A;  4LII A;  4K5R A;  3ZDN A;  4JY3 A;  2XFN A;  2R4J A;  3AD9 B;  2GMJ A;  3ICR A;  3QVR A;  1E39 A;  2VVM A;  3PVC A;  3V76 A;  4NTC A;  3KD9 A;  2RGO A;  1M6I A;  2VVL G;  3P4R A;  4LU6 A;  2A89 A;  4X4J A;  1ZMC A;  3LJP A;  3AEF A;  3ALL A;  3IF9 A;  1NHP A;  1NHR A;  1BKW A;  1GET A;  1CJ2 A;  3GYJ A;  4GDE A;  4HB9 A;  5EB5 A;  4C74 A;  1MO9 A;  2BC0 A;  2EQ9 A;  3CGD A;  2QA1 A;  2WDR A;  1KFY A;  4BK1 A;  4CBQ A;  4X9M A;  2F5Z A;  1PDH A;  2V3A A;  1EBD A;  4H2P A;  3K30 A;  4CRT A;  1M64 A;  1PBD A;  2VRL A;  4EQW A;  2CFY A;  3K7Q X;  2E5V A;  3K7M X;  3DGH A;  1PN0 A;  4YSH A;  3UKQ A;  2CUL A;  3C96 A;  3EPT A;  3T37 A;  3LOV A;  5M10 A;  5EB4 A;  1QO8 A;  3GRT A;  3RP7 A;  1Y56 A;  2EQ6 A;  1NAA A;  1MOK A;  3AE6 A;  3E1T A;  2WET A;  3B3R A;  4JDR A;  3AED A;  4MJW A;  4APN A;  1H7X A;  3ATR A;  2WDV A;  2R9Z A;  1O95 A;  3RNM A;  3ABV A;  4YTP A;  4OPT A;  3NNE A;  3RED A;  1BF3 A;  4H4X A;  4TM3 A;  3FIM B;  2RGH A;  1H83 A;  3DH9 A;  1JRZ A;  1IUU A;  3GMB A;  4A9W A;  2ACZ A;  4TLX A;  1IUW A;  2BK4 A;  2R0G A;  1LPF A;  3LAD A;  4H7U A;  3ADA B;  2GQW A;  1YY5 A;  4EIQ A;  1VRQ B;  5JCM A;  4D04 A;  4JNA A;  2R46 A;  3DJD A;  3UTE A;  3IHG A;  1ZY8 A;  1CJC A;  1GTH A;  4U2S A;  4B63 A;  2WEU A;  4LA1 A;  1GRG A;  3SQP A;  1PJ6 A;  3P9U A;  4IA6 A;  4NTD A;  4DGK A;  1P2E A;  1FCD A;  4P9S A;  2YG4 A;  1ZKQ A;  2BCG G;  3ALJ A;  5KVI A;  1GES A;  1SEZ A;  4H4Y A;  2GQF A;  4U8J A;  5IQ1 A;  2XVE A;  1BGN A;  3CIR A;  3KA7 A;  2C75 A;  1H81 A;  3UOZ A;  1GND A;  2Q7V A;  4J36 A;  1KNR A;  4PAB A;  4UDP A;  1YQZ A;  4Z44 A;  4CNK A;  2WPF A;  3CNS A;  3AEB A;  3DA1 A; 
#chains in the Genus database with same CATH topology
 3ZYX A;  3RGT A;  2PTX A;  3AN1 A;  3NS1 B;  2YR6 A;  4H4R A;  3CYJ A;  3GYX A;  3KKJ A;  4HYR A;  2OFJ A;  2BK5 A;  2XVJ A;  2BAB A;  2YG3 A;  3GSI A;  3URH A;  2QAE A;  2MNR A;  1GXF A;  1FEA A;  3H12 A;  3MKC A;  1FL2 A;  3F8P A;  2HXU A;  3DFH A;  1N63 C;  4C3Y A;  1NEK A;  1F8R A;  3UJ2 A;  2XCG A;  3TOY A;  2BS4 A;  2Z5X A;  3GD6 A;  1ECQ A;  3N6H A;  2GR2 A;  4CNJ A;  3PO7 A;  3HRD C;  2BS2 A;  4MGG A;  4G7F A;  5FS6 A;  4H4Z A;  2YG6 A;  4J34 A;  2X50 A;  3SM8 A;  3FCP A;  1MDL A;  1GEU A;  1GV4 A;  2AAQ A;  1MDR A;  3H70 A;  3R0K A;  1GTE A;  5J7X A;  3SFD A;  5C2T A;  3L8K A;  3R1Z A;  3DJJ A;  1JNR A;  4ICY A;  1FIQ B;  4IP4 A;  4Y4M A;  3CGE A;  4U8P A;  1TRB A;  3IK4 A;  4IL2 A;  3GD3 A;  2PTW A;  2AL2 A;  3NK0 X;  1PBC A;  3CT2 A;  1N4U A;  3VRD B;  2OG9 A;  4GGB A;  1PXC A;  1X31 B;  2YLR A;  2QJM A;  1N61 C;  1DOB A;  1B4V A;  4J31 A;  3H4K A;  1R0M A;  1VQW A;  5ER0 A;  3DK4 A;  1DJQ A;  4GFI A;  2XVF A;  1L9E A;  2JK6 A;  1GRB A;  1EC8 A;  4BUR A;  2EQ7 A;  4ZCW A;  4EMI A;  4B65 A;  3QFB A;  3PG6 A;  2C65 A;  1OJ9 A;  3LZW A;  3S47 A;  1GRE A;  5KOX A;  4IVO B;  2NQL A;  3ENL A;  1B5Q A;  2GGI A;  3DEQ A;  4IZG A;  4M0X A;  3ZVI A;  1L0V A;  3BHF A;  3B6D A;  5KMQ A;  2MUC A;  1DXL A;  1ZOV A;  2PU0 A;  3OPS A;  4YWO A;  3SBF A;  4GGH A;  4GIR A;  4U8N A;  3FV9 A;  1TDO A;  2DKI A;  4U2T A;  3ALM A;  1NPX A;  4K7Z A;  5JCN A;  3NT6 A;  2Y6Q A;  2C4C A;  3S61 A;  1GRF A;  2W55 A;  3NN6 X;  1Q1R A;  4E8G A;  1KSU A;  2GR0 A;  3DG6 A;  2WP9 A;  1STZ A;  1JPM A;  3COX A;  3DME A;  3MUC A;  4KX6 A;  2B9X A;  5J04 A;  4M52 A;  1EL5 A;  3ZLG A;  1XDI A;  4U8M A;  2XLT A;  1QJD A;  1LV0 A;  2DKH A;  4TM4 A;  1TYT A;  2FBW A;  4H2Q A;  3VCN A;  4RSL A;  1MNS A;  2XLS A;  2XFP A;  5KOW A;  2WPC A;  3T2Y A;  1NU5 A;  3EUB 3;  1IUX A;  4O5U A;  2I0Z A;  4H2N A;  1YKJ A;  3N6J A;  1FEC A;  4BK3 A;  1GSN A;  3I4K A;  3NKS A;  3MSY A;  2C3D A;  3UOY A;  1IUV A;  2OA1 A;  3RCY A;  4Z26 A;  4RG4 A;  1EBH A;  2OAM A;  3FMW A;  4A3R A;  5EOW A;  2PU1 A;  1RYI A;  3VC5 A;  2C70 A;  3DG7 A;  4HNC A;  4J1O A;  2BS3 A;  1BGJ A;  5LV9 A;  3O0H A;  2E1M A;  2WES A;  3V3N A;  4DN1 A;  4EQS A;  3NHO X;  3CPI G;  2B7R A;  1ONF A;  5M0Z A;  4JQ9 A;  1NDA A;  3GMC A;  2RGJ A;  1QLB A;  2XVI A;  3ITJ A;  4A35 A;  3T4W A;  4ZCC A;  4OVI A;  3OZM A;  4NZH A;  1ZX9 A;  4N9X A;  2P8B A;  1ZOY A;  4JY2 A;  4MKS A;  3IHM A;  4K5S A;  1AOG A;  3D8X A;  3IJI A;  3QPE A;  2YR5 A;  3AWI A;  1EL7 A;  5CKU A;  4A79 A;  5KMP A;  3C4A A;  1GT8 A;  3CN8 A;  1XPQ A;  2V61 A;  2XVH A;  2Y6R A;  1JCT A;  1NHS A;  3RR1 A;  1E1M A;  3KU9 A;  3ICS A;  4E0V A;  2GEW A;  4WX1 A;  3NG7 X;  2YVJ A;  4LII A;  3AD9 B;  3QVR A;  1TKK A;  2GL5 A;  1T3Q C;  1E39 A;  3GY1 A;  1EBG A;  1MRA A;  1M6I A;  3P4R A;  1OEP A;  1ZMC A;  1NHR A;  1BKW A;  1PDZ A;  3UJS A;  4X9M A;  2F5Z A;  3K7Q X;  3T0K A;  3DGH A;  4GAV A;  3EPT A;  2EQ6 A;  1MOK A;  2WET A;  4JDR A;  4KWS A;  4APN A;  3UJF A;  1H7X A;  5IDZ A;  2R9Z A;  1O95 A;  3ABV A;  4OPT A;  4H4X A;  1H83 A;  1JRZ A;  1RVK A;  4TLX A;  1IUW A;  2BK4 A;  4H7U A;  2OZ8 A;  1VRQ B;  5JCM A;  2QJJ A;  3UTE A;  3IHG A;  4B63 A;  3P9U A;  2QGY A;  4P9S A;  3SSZ A;  2OZ3 A;  1GES A;  5IQ1 A;  2FYM A;  2C75 A;  3QLD A;  1KNR A;  4Z44 A;  3NVZ B;  3BNU A;  1KN0 A;  1N4V A;  2W0H A;  3GO2 A;  5FJP A;  3QSM A;  5BUL A;  3GYI A;  4YTM A;  2XYO A;  3VR9 A;  2XLU A;  3D1C A;  5KRQ A;  3SYI A;  2O56 A;  4XWZ A;  2WBA A;  1BKH A;  2XLR A;  4Z43 A;  3UCC A;  1D4D A;  3B9J B;  4CY8 A;  3RIT A;  3CGB A;  1CJ3 A;  2B9W A;  2CHR A;  4ZA0 A;  3FVD A;  1GRT A;  4EMJ A;  3UKH A;  2UZZ A;  3AYL A;  3H8L A;  3UOX A;  2GMH A;  4TVY A;  4HN8 A;  1Z6L A;  3ATQ A;  2JB1 A;  3QVP A;  3AE7 A;  3EAN A;  2WP5 A;  2WS3 A;  3TTE A;  1PJ7 A;  3AE4 A;  3V3W A;  1H7W A;  4J33 A;  2GSH A;  4FK1 C;  1P48 A;  2XH4 A;  2YAU A;  2GV8 A;  3AEE A;  3DJG X;  3EAO A;  1N60 C;  2EQ8 A;  1K0L A;  3AE5 A;  2E4G A;  3AE2 A;  2H89 A;  2GGE A;  5FJT A;  3JZU A;  3UOV A;  5KWF A;  3NLC A;  1L9D A;  4PAA A;  3NYC A;  3UTF A;  2WQY A;  3JSK A;  3NGC X;  5FS8 A;  3C4N A;  2PPG A;  2WU2 A;  3TW9 A;  2YLS A;  3CPJ G;  3GWD A;  1SJD A;  3F8D A;  1L8P A;  4UDR A;  4BJZ A;  3AEC A;  4C77 A;  1W4X A;  3DJE A;  2V60 A;  1TDK A;  5JRB A;  2POD A;  4H4T A;  3RHA A;  3VR8 A;  2R0C A;  4FDC B;  2PHH A;  3P1W A;  1JRX A;  1LQT A;  4REK A;  2C3C A;  3VC6 A;  1WUF A;  3UKK A;  1JOA A;  1FHU A;  2H88 A;  4A6N A;  2X8G A;  3CNJ A;  5HXI A;  3VQR A;  2BRA A;  3V4B A;  3GRS A;  1L9C A;  2GGH A;  1XPY A;  1DOD A;  3R11 A;  1CBO A;  3OTR A;  4OCG A;  3NTD A;  1WUE A;  5JCL A;  2ZZC A;  1VG0 A;  3DK9 A;  3RP8 A;  2XDO A;  4A6N B;  2GRT A;  2POZ A;  1LJ1 A;  3DES A;  3AMZ A;  3NK2 X;  2C73 A;  4GDP A;  3GC2 A;  1WYG A;  1LVL A;  1COY A;  1FHV A;  3NTA A;  2XFO A;  1IYX A;  3HZL A;  2V6O A;  1F8S A;  1PXB A;  2OX4 A;  2YM2 A;  3R9U A;  4ENL A;  1FEB A;  4A99 A;  4CCR A;  3HPF A;  1IUS A;  1YQ4 A;  3FG2 P;  2JBV A;  4B69 A;  3CK5 A;  2AL2 B;  1CHU A;  3D9X A;  2ZBW A;  4ZN0 A;  1CC2 A;  2JB3 A;  2XH0 A;  3SJN A;  3NYF A;  4G6G A;  3SN0 A;  3UCD A;  1NEN A;  2Q0K A;  2XGZ A;  3DGZ A;  1RP0 A;  3LZX A;  3F8R A;  3UP5 A;  1GRH A;  1YQ3 A;  3BI5 A;  3NIX A;  3K7T A;  4USR A;  2OPJ A;  1FOH A;  2A87 A;  1F6M A;  1V59 A;  2YG7 A;  5U25 A;  5U1O A;  5DBJ A;  2BC1 A;  3TJI A;  3PS9 A;  1GAL A;  3VDG A;  4G9K A;  1ELI A;  4E5T A;  1IUT A;  4B67 A;  5JCK A;  3CXO A;  2V5Z A;  4Y4L A;  4K2X A;  4IT1 A;  4U8K A;  3RO6 A;  2AL1 A;  3AEA A;  1S7M A;  1KSS A;  1YEY A;  3NVY B;  2OKT A;  4IP5 A;  1PDY A;  3A7A A;  5GSN A;  2Q0L A;  3T8Q A;  6ENL A;  1ZDL A;  2RDX A;  1TDN A;  1TZZ A;  3IWA A;  5CQF A;  4H50 A;  3CNT A;  2TMD A;  1JPD X;  3I3L A;  1SJC A;  5ENL A;  1OJC A;  1N5W C;  3OC4 A;  1KKR A;  4GF7 A;  3SQS A;  2IID A;  3NVV B;  2X99 A;  4FP1 A;  1E7P A;  4CCQ A;  2FJA A;  4WCT A;  2X8C A;  1NG3 A;  3TCS A;  3CTY A;  1K0J A;  4DX3 A;  1RM6 B;  2XFN A;  2PS2 A;  2XH7 A;  5G5G B;  2OO6 A;  4NTC A;  3KD9 A;  4LU6 A;  3T6C A;  4X4J A;  3LJP A;  5FJR A;  3ALL A;  1NHP A;  3GYJ A;  3CGD A;  2QA1 A;  4CRT A;  1M64 A;  2VRL A;  2CFY A;  4KT2 A;  2E5V A;  1SJB A;  4YSH A;  3UKQ A;  2OVL A;  3LOV A;  3ZLH A;  5EB4 A;  1QO8 A;  3RP7 A;  3EEZ A;  1NAA A;  3B3R A;  3ZVH A;  4MJW A;  2WDV A;  3SZ0 A;  3RED A;  1BF3 A;  3TWA A;  4TM3 A;  2RGH A;  2ACZ A;  2R0G A;  1LPF A;  3ADA B;  2GQW A;  1YY5 A;  4D04 A;  4JNA A;  1KKO A;  3P93 A;  4YWS A;  3PWG A;  1ZY8 A;  4U2S A;  1GTH A;  2OQY A;  3SQP A;  1PJ6 A;  4IA6 A;  4DGK A;  4NTD A;  1P2E A;  2BCG G;  3ALJ A;  4HNL A;  4H4Y A;  1SB3 B;  3KA7 A;  1BGN A;  1H81 A;  2W3S A;  1GND A;  3SN4 A;  1YQZ A;  4CNK A;  3AEB A;  1B37 A;  3K1G A;  4HPN A;  4K8D A;  4K1W A;  4H4S A;  3AE3 A;  4X2P A;  4GRT A;  2YVF A;  2R45 A;  5EU9 A;  2FJB A;  3SN1 A;  3UGV A;  3UP4 A;  3UTG A;  1X2G A;  3FPZ A;  4Z2R A;  4H83 A;  4BV6 A;  3I6D A;  4NTE A;  4FI4 A;  3UCL A;  4A65 A;  5FMH A;  4O5Q A;  4H4V A;  1KF6 A;  3JVA A;  3VA8 A;  1VDC A;  3OP2 A;  1DTN A;  1S2Y A;  4AOX A;  1JEH A;  1GER A;  2WP6 A;  4GAP A;  1CL0 A;  5IPY A;  2X8H A;  2TPR A;  3NZG A;  2XLP A;  3M0O A;  3UKA A;  2PTY A;  3VRA A;  3S5S A;  4U8I A;  2I5Q A;  2PP1 A;  1KNP A;  3AXB A;  1D7Y A;  2YLZ A;  4EIP A;  2BXR A;  4TM0 A;  1REO A;  1D4E A;  2HZG A;  1GRA A;  3GDP A;  2FJD A;  2YQU A;  3R25 A;  1ONE A;  4BJY A;  4C5O A;  1OJT A;  3QN3 A;  2XFQ A;  4U8O A;  4I58 A;  3QFA A;  1PJ5 A;  4YSY A;  4K22 A;  2X3N A;  2PMQ A;  4CY6 A;  1HYU A;  3BI2 A;  2VZ2 A;  1JNZ A;  3S5W A;  3EF6 A;  1MXT A;  1E1N A;  2VVL A;  3UTH A;  1IJH A;  2JKC A;  1S2Q A;  3DGB A;  3V3O A;  4NWZ A;  2FKP A;  4KEM A;  3M13 A;  2GGJ A;  2WHD A;  1EL8 A;  3TQP A;  3DK8 A;  3UKF A;  4YSX A;  2W3R A;  3IJQ A;  5FJO A;  3QSE A;  2FJE A;  1B8S A;  4B1B A;  1CJ4 A;  3KPK A;  1NG4 A;  2OAL A;  1PHH A;  4GCM A;  2C67 A;  2IVE A;  2P8C A;  2PSN A;  4ADW A;  2BXS A;  1ZXI C;  2BCP A;  1DOC A;  4M6U A;  3VFC A;  1Q1W A;  4IHC A;  3TJ4 A;  3R0U A;  4EQX A;  1F9C A;  2WU5 A;  1EL9 A;  3D46 A;  1S3B A;  1TE6 A;  3AD8 B;  3QJ4 A;  4OPU A;  3GWF A;  3ISH A;  3I6E A;  4EQR A;  3I6T A;  3Q6J A;  2BAC A;  4ROP A;  5C3J A;  4C3X A;  4G6H A;  4H4P A;  3P4Q A;  3ES7 A;  5BUK A;  1E1L A;  3U9I A;  3CB3 A;  4HCL A;  2GAH B;  2QDD A;  2C66 A;  3Q45 A;  5TR3 A;  3CMM A;  1F3P A;  1D5T A;  4J57 A;  3KPF A;  2NVK X;  1RSG A;  3NH3 X;  3U4F A;  1F8W A;  3P4S A;  2AR8 A;  5U63 A;  1TDE A;  4GIS A;  4EMW A;  4UDQ A;  3AEG A;  3R07 C;  1CC4 A;  4YKG A;  2IVD A;  3NRN A;  4GYP A;  3VRB A;  2P3Z A;  2VQ7 A;  3BNM A;  1EC9 A;  1Q9I A;  3PK7 A;  2WOI A;  2PTZ A;  4BK2 A;  2YM1 A;  1XAN A;  4USQ A;  3CAW A;  4GUV A;  5J60 A;  3II4 A;  1FO4 A;  3CPH G;  3CND A;  2OZT A;  4ZCD A;  3AB1 A;  1VQZ A;  3G5R A;  4OPI A;  1BWC A;  1Y56 B;  2DW7 A;  4IV9 A;  2WPE A;  5FS9 A;  3NFU A;  2CDU A;  3NYE A;  1MUC A;  4AT0 A;  3AD7 B;  3CXB A;  2YWL A;  1PXA A;  2HNE A;  2XH2 A;  4F4R A;  2A8X A;  2ARD A;  3SZF A;  4UP3 A;  4Z2T A;  2W54 A;  1FFU C;  1ZK7 A;  1CF3 A;  2QA2 A;  3SXI A;  2B9Y A;  2HXT A;  3FJ4 A;  3SFE A;  4KPL A;  2YR4 A;  1O5W A;  3FXG A;  1VDV A;  3MZN A;  2C7G A;  1KD0 A;  1JDF A;  4HCH A;  4B66 A;  2YLX A;  4TLZ A;  4D03 A;  1XHC A;  3UKL A;  2QDE A;  4K5R A;  4JY3 A;  3QTP A;  2GMJ A;  3MY9 A;  2VVM A;  3PVC A;  3L5O A;  3A7R A;  2A89 A;  4ZOH B;  1CJ2 A;  1GET A;  5EB5 A;  4C74 A;  4GYP C;  2EQ9 A;  2WDR A;  4CBQ A;  2E3T A;  1PDH A;  4H2P A;  1PBD A;  4EQW A;  3K7M X;  2CUL A;  3C96 A;  2ZAD A;  4K8G A;  3P0W A;  1X2H A;  3VCC A;  3RNM A;  3NNE A;  4A9W A;  4II2 A;  2GGG A;  2DW6 A;  3UJE A;  1CJC A;  4LA1 A;  1GRG A;  3UJR A;  1ZKQ A;  3DIP A;  5KVI A;  1SEZ A;  2GQF A;  4U8J A;  2XVE A;  4G73 A;  4DWD A;  2P0I A;  2Q7V A;  4PAB A;  5KNL A;  3BSM A;  3DA1 A;  4HB9 A;  3P3B A;  5FJU A;  5JCI A;  2APG A;  1JRY A;  1XS2 A;  5IQ4 A;  3A7U A;  1TYP A;  4J56 A;  4GR1 A;  4AOS A;  3R10 A;  2GF3 A;  4JN9 A;  4HCD A;  3NVW B;  2AQJ A;  4Z17 A;  3L1R A;  2BA9 A;  4GME A;  2OLN A;  2AKM A;  4AT2 A;  2ZZB A;  2Q6U A;  3FBS A;  3T14 A;  2OLO A;  2R0P A;  2YG5 A;  3BHK A;  1H82 A;  2PGE A;  4NNJ A;  3KLJ A;  3SZC A;  4TVW A;  1BZL A;  2OLA A;  2NPX A;  4DNA A;  1P43 A;  4A7A A;  4OPC A;  1K0I A;  4U8L A;  3MQT A;  4NEV A;  3T9P A;  4IA5 A;  3EKG A;  1VG9 A;  4YXD A;  1UKV G;  2J3N A;  2VRM A;  3FYY A;  2PP3 A;  1KCZ A;  4U2L A;  4A6G A;  2C72 A;  2GR3 A;  3IJL A;  4H1Z A;  3KUM A;  4XWR A;  5GRT A;  2XFU A;  3LB8 A;  1S3E A;  1ZP0 A;  1JRP A;  1OJD A;  3RRA A;  4DHG A;  1LQU A;  4FX9 A;  4JN8 A;  1D4C A;  3ICT A;  3GD4 A;  1PBB A;  2HQM A;  4OPL A;  4YT0 A;  2QCU A;  3N4F A;  1D7L A;  1JU2 A;  5EBK A;  2PYX A;  2QQ6 A;  3HYW A;  3BI4 A;  2C76 A;  2QJN A;  2OQH A;  3G5S A;  3B97 A;  3DFY A;  2V3B A;  3OW1 A;  3SY4 A;  4B64 A;  3V5C A;  1K4Q A;  2YLT A;  5HY5 A;  4DXK A;  1GPE A;  1N4W A;  4OPD A;  2PP0 A;  2GVC A;  2GAG B;  2WOW A;  3Q4D A;  1TDF A;  2C64 A;  1NHQ A;  1LTX R;  1NEL A;  3SZW A;  5KVH A;  3T31 A;  4K2S A;  3AE8 A;  1N62 C;  3ETR B;  4MMW A;  4G74 A;  1DNC A;  4HA6 A;  4KPR A;  3N4E A;  1H2I A;  4RG3 A;  2WOV A;  4H4W A;  3CNP A;  1E9I A;  2GR1 A;  3CGC A;  3NRZ B;  4IL0 A;  1N5X A;  2AKZ A;  3OZ2 A;  4Z24 A;  3HYX A;  3H8I A;  2P88 A;  3OZY A;  1OJA A;  3NXL A;  2E5A A;  3SR6 B;  4H2H A;  2R4E A;  1SJA A;  3IC9 A;  4G8T A;  2JAE A;  3KVE A;  1H6V A;  1PBE A;  4EM4 A;  1CC6 A;  3ES8 A;  5BOF A;  1N1P A;  4Z25 A;  1JRO A;  3NK1 X;  4B68 A;  3RP6 A;  2CVJ A;  1O94 A;  4ECH A;  4DYE A;  2B76 A;  4II3 A;  4E4F A;  2JB2 A;  3T2Z A;  4J2W A;  5KXJ A;  4H4U A;  4JNQ A;  4YKF A;  3UKP A;  1ELS A;  3AYI A;  2GB0 A;  2VOU A;  3BOX A;  2YLW A;  4X9N A;  1H86 A;  2WDQ A;  2BYB A;  4Y4N A;  4DSH A;  2QVH A;  2O9Z A;  3SX6 A;  3NO1 A;  1DOE A;  3HYV A;  2GH5 A;  4JN7 A;  5HHF A;  4AP3 A;  1E1K A;  4E6M A;  5BVA A;  5KMR A;  3V5F A;  4DSG A;  2B7S A;  7ENL A;  2BK3 A;  4YSZ A;  2VQB A;  3M12 A;  1KDG A;  3LXD A;  3UXK A;  3NN0 X;  5FS7 A;  3AYJ A;  4Z2U A;  4TM1 A;  3DG3 A;  2Z5Y A;  1E6E A;  3ZLF A;  4EM3 A;  4XXG A;  1DJN A;  4FK1 A;  4JHM A;  1PBF A;  3H7V A;  1ZMD A;  4IVM B;  3P4P A;  4H19 A;  4OPG A;  1PS9 A;  1EC7 A;  3THU A;  4H2R A;  3AE1 A;  1GOS A;  4NEW A;  4J3Z A;  2ZZ0 A;  3PFR A;  4AP1 A;  3H8A A;  2YVG A;  3Q9T A;  2BRY A;  3WE0 A;  1Y0P A;  4I59 A;  2ONE A;  1P2H A;  3D47 A;  5HYM A;  3G5Q A;  1R6W A;  1H84 A;  1V97 A;  3JW7 A;  5BRT A;  1W6T A;  5L46 A;  4A5L A;  3DER A;  3QSS A;  1BQG A;  3AE9 A;  2RAB A;  3GDN A;  3DDM A;  4H4Q A;  3SGL A;  4YTN A;  3ZDN A;  5KMS A;  2R4J A;  3ICR A;  3AM9 A;  3V76 A;  2RGO A;  2VVL G;  3AEF A;  3IF9 A;  4GDE A;  1MO9 A;  2BC0 A;  3STP A;  5BOE A;  1KFY A;  4BK1 A;  3UXL A;  2V3A A;  1EBD A;  3K30 A;  3BJS A;  3HW2 A;  3PWI A;  1PN0 A;  2PA6 A;  3TWB A;  3T37 A;  3ZVH B;  5M10 A;  2PGW A;  3GRT A;  4E4U A;  4Z1Y A;  5G5H B;  1Y56 A;  2XSX A;  3E1T A;  3AE6 A;  3AED A;  1FFV C;  3ATR A;  4YTP A;  3FIM B;  3DH9 A;  1IUU A;  3GMB A;  3LAD A;  4EIQ A;  2R46 A;  3DJD A;  4EWJ A;  2WEU A;  1FCD A;  2YG4 A;  2GDQ A;  3CIR A;  3T2K A;  2ZC8 A;  2PCE A;  3QKE A;  3UOZ A;  4UDP A;  4J36 A;  2WPF A;  3CNS A;  3MWC A; 
#chains in the Genus database with same CATH homology
 5JCI A;  2APG A;  3BNU A;  1JRY A;  3ZYX A;  1KN0 A;  1N4V A;  2W0H A;  5IQ4 A;  3QSM A;  5BUL A;  1B37 A;  2YR6 A;  3GYI A;  4YTM A;  4H4R A;  1TYP A;  2XYO A;  3VR9 A;  2XLU A;  3D1C A;  5KRQ A;  3GYX A;  4J56 A;  4K8D A;  3KKJ A;  3SYI A;  4GR1 A;  4XWZ A;  2WBA A;  4AOS A;  4H4S A;  3AE3 A;  2XLR A;  4Z43 A;  4GRT A;  2BK5 A;  1D4D A;  2YVF A;  2XVJ A;  2GF3 A;  2R45 A;  4JN9 A;  2FJB A;  2BAB A;  4CY8 A;  3CGB A;  1CJ3 A;  2AQJ A;  2B9W A;  2YG3 A;  3L1R A;  3UP4 A;  2BA9 A;  3GSI A;  3UTG A;  3URH A;  2OLN A;  3FPZ A;  1GRT A;  4AT2 A;  2QAE A;  4BV6 A;  4Z2R A;  2ZZB A;  2Q6U A;  3FBS A;  3I6D A;  4EMJ A;  4NTE A;  1GXF A;  3T14 A;  1FEA A;  2OLO A;  3UCL A;  3UKH A;  5FMH A;  4A65 A;  2R0P A;  2UZZ A;  2YG5 A;  3AYL A;  3BHK A;  1FL2 A;  3H8L A;  1H82 A;  4NNJ A;  4O5Q A;  3KLJ A;  3F8P A;  4H4V A;  3UOX A;  2GMH A;  3SZC A;  1KF6 A;  4C3Y A;  1Z6L A;  1NEK A;  3ATQ A;  1BZL A;  2JB1 A;  2NPX A;  4DNA A;  1F8R A;  3EAN A;  2WP5 A;  1VDC A;  3AE7 A;  3QVP A;  2WS3 A;  1S2Y A;  4AOX A;  4A7A A;  1PJ7 A;  2XCG A;  4OPC A;  1K0I A;  2BS4 A;  2Z5X A;  4U8L A;  1JEH A;  4NEV A;  1GER A;  2WP6 A;  3AE4 A;  2GR2 A;  1H7W A;  4GAP A;  4J33 A;  4CNJ A;  3PO7 A;  4FK1 C;  1CL0 A;  2YAU A;  4IA5 A;  5IPY A;  1VG9 A;  2BS2 A;  2X8H A;  2TPR A;  5FS6 A;  4YXD A;  4H4Z A;  2XLP A;  1UKV G;  2YG6 A;  3M0O A;  4J34 A;  2GV8 A;  2X50 A;  3SM8 A;  2J3N A;  3UKA A;  2VRM A;  3AEE A;  3DJG X;  3EAO A;  4U2L A;  1GEU A;  1GV4 A;  2EQ8 A;  3VRA A;  2AAQ A;  2GR3 A;  2C72 A;  1K0L A;  4U8I A;  1GTE A;  3AE5 A;  1KNP A;  2E4G A;  3AE2 A;  5J7X A;  4XWR A;  3SFD A;  5C2T A;  2H89 A;  3L8K A;  3AXB A;  5GRT A;  1JNR A;  3DJJ A;  2XFU A;  1D7Y A;  3LB8 A;  1S3E A;  2YLZ A;  4ICY A;  4Y4M A;  4EIP A;  2BXR A;  3UOV A;  5KWF A;  1ZP0 A;  3NLC A;  1L9D A;  1OJD A;  4PAA A;  4TM0 A;  3CGE A;  1REO A;  1D4E A;  1LQU A;  4FX9 A;  1D4C A;  3ICT A;  3GD4 A;  4U8P A;  3NYC A;  1GRA A;  3GDP A;  3UTF A;  1TRB A;  1PBB A;  2WQY A;  2FJD A;  2YQU A;  3JSK A;  2HQM A;  3GD3 A;  3NGC X;  4OPL A;  4YT0 A;  5FS8 A;  2QCU A;  1D7L A;  1JU2 A;  2PYX A;  5EBK A;  3NK0 X;  4BJY A;  4C5O A;  1PBC A;  3HYW A;  3C4N A;  3BI4 A;  1OJT A;  2C76 A;  2WU2 A;  2YLS A;  3CPJ G;  1N4U A;  3VRD B;  3GWD A;  1PXC A;  1X31 B;  2XFQ A;  2YLR A;  3G5S A;  3F8D A;  4UDR A;  1DOB A;  1B4V A;  4J31 A;  3AEC A;  4BJZ A;  3H4K A;  2V3B A;  3SY4 A;  4B64 A;  1VQW A;  4U8O A;  4C77 A;  1K4Q A;  5ER0 A;  3DK4 A;  1DJQ A;  4I58 A;  3QFA A;  1PJ5 A;  1W4X A;  4YSY A;  4K22 A;  3DJE A;  2X3N A;  2XVF A;  2YLT A;  5HY5 A;  1L9E A;  2JK6 A;  2V60 A;  1GRB A;  1GPE A;  1TDK A;  1N4W A;  5JRB A;  4CY6 A;  1HYU A;  4H4T A;  4BUR A;  2EQ7 A;  3BI2 A;  2R0C A;  4OPD A;  2VZ2 A;  3RHA A;  3VR8 A;  4EMI A;  1JNZ A;  3S5W A;  4B65 A;  4FDC B;  3EF6 A;  2GVC A;  3QFB A;  3PG6 A;  2C65 A;  2GAG B;  1MXT A;  1OJ9 A;  3LZW A;  2WOW A;  2PHH A;  1E1N A;  1TDF A;  2VVL A;  2C64 A;  1GRE A;  3UTH A;  1IJH A;  1NHQ A;  1LTX R;  2JKC A;  5KOX A;  1S2Q A;  3P1W A;  1JRX A;  4IVO B;  3V3O A;  3SZW A;  1LQT A;  4REK A;  4NWZ A;  2C3C A;  5KVH A;  3T31 A;  1B5Q A;  3M13 A;  2WHD A;  3AE8 A;  1EL8 A;  3UKK A;  1JOA A;  3DK8 A;  1L0V A;  2H88 A;  3UKF A;  4A6N A;  4G74 A;  1DNC A;  2X8G A;  3B6D A;  3BHF A;  4HA6 A;  5KMQ A;  4KPR A;  1H2I A;  4RG3 A;  2WOV A;  4H4W A;  4YSX A;  3CNP A;  1DXL A;  1ZOV A;  3QSE A;  3CNJ A;  5HXI A;  2FJE A;  3VQR A;  2GR1 A;  4YWO A;  1B8S A;  2BRA A;  3CGC A;  4B1B A;  4U8N A;  1L9C A;  3GRS A;  1DOD A;  1TDO A;  2DKI A;  4U2T A;  1CBO A;  1CJ4 A;  3KPK A;  3ALM A;  3OZ2 A;  1NG4 A;  2OAL A;  1NPX A;  4K7Z A;  1PHH A;  5JCN A;  3HYX A;  4Z24 A;  3H8I A;  3NT6 A;  4OCG A;  3NTD A;  2Y6Q A;  5JCL A;  2C4C A;  4GCM A;  1OJA A;  2C67 A;  2IVE A;  3S61 A;  2ZZC A;  1GRF A;  1VG0 A;  3NN6 X;  3DK9 A;  1Q1R A;  4ADW A;  2BXS A;  1KSU A;  3RP8 A;  2GR0 A;  2BCP A;  1DOC A;  2WP9 A;  2XDO A;  4A6N B;  1Q1W A;  2R4E A;  2GRT A;  3IC9 A;  2JAE A;  3KVE A;  1LJ1 A;  1H6V A;  1PBE A;  4EM4 A;  1CC6 A;  3NK2 X;  4EQX A;  3COX A;  2C73 A;  3DME A;  4KX6 A;  4GDP A;  1N1P A;  2WU5 A;  4Z25 A;  1EL9 A;  2B9X A;  1S3B A;  4M52 A;  1EL5 A;  1LVL A;  1XDI A;  3AD8 B;  3NK1 X;  3QJ4 A;  4B68 A;  1COY A;  4OPU A;  3RP6 A;  3GWF A;  2CVJ A;  3NTA A;  3ISH A;  4EQR A;  3Q6J A;  1O94 A;  2BAC A;  4U8M A;  5C3J A;  4C3X A;  2XFO A;  2XLT A;  4ECH A;  4G6H A;  1QJD A;  1LV0 A;  4H4P A;  2B76 A;  3P4Q A;  2DKH A;  2V6O A;  3HZL A;  4II3 A;  2JB2 A;  4TM4 A;  1TYT A;  1F8S A;  2FBW A;  4H2Q A;  1E1L A;  1PXB A;  4RSL A;  3T2Z A;  5BUK A;  2XLS A;  2YM2 A;  2XFP A;  4J2W A;  3R9U A;  5KXJ A;  4H4U A;  2GAH B;  4JNQ A;  2WPC A;  3T2Y A;  2C66 A;  5KOW A;  4YKF A;  1IUX A;  5TR3 A;  4O5U A;  1FEB A;  3CMM A;  2I0Z A;  1F3P A;  1D5T A;  1YKJ A;  4H2N A;  3UKP A;  4J57 A;  4A99 A;  4CCR A;  3AYI A;  1FEC A;  2GB0 A;  3KPF A;  2VOU A;  1IUS A;  2NVK X;  1RSG A;  1YQ4 A;  3NH3 X;  3FG2 P;  2JBV A;  2YLW A;  4X9N A;  4BK3 A;  1F8W A;  1H86 A;  2WDQ A;  1GSN A;  4B69 A;  3P4S A;  1CHU A;  3D9X A;  2AR8 A;  2BYB A;  2ZBW A;  4Y4N A;  4ZN0 A;  4DSH A;  1CC2 A;  2JB3 A;  3NYF A;  5U63 A;  1TDE A;  2O9Z A;  4EMW A;  4G6G A;  4UDQ A;  3SX6 A;  3NKS A;  1DOE A;  3AEG A;  1NEN A;  3HYV A;  1CC4 A;  2C3D A;  4YKG A;  2IVD A;  3UOY A;  2Q0K A;  1IUV A;  2GH5 A;  3NRN A;  2OA1 A;  3DGZ A;  3VRB A;  2VQ7 A;  3BNM A;  5HHF A;  4AP3 A;  1E1K A;  1Q9I A;  4Z26 A;  1RP0 A;  4RG4 A;  2OAM A;  3LZX A;  3F8R A;  5BVA A;  2WOI A;  3UP5 A;  5KMR A;  4DSG A;  1GRH A;  3FMW A;  2B7S A;  4BK2 A;  1YQ3 A;  2BK3 A;  2VQB A;  2YM1 A;  3M12 A;  1KDG A;  3BI5 A;  3NIX A;  3K7T A;  5EOW A;  4YSZ A;  1XAN A;  4USR A;  3LXD A;  1RYI A;  4USQ A;  4GUV A;  2C70 A;  3NN0 X;  1FOH A;  5J60 A;  2A87 A;  5FS7 A;  1F6M A;  1V59 A;  3II4 A;  2YG7 A;  3AYJ A;  4Z2U A;  5U25 A;  5U1O A;  2BS3 A;  4TM1 A;  3CPH G;  5DBJ A;  2BC1 A;  3CND A;  2Z5Y A;  1E6E A;  3PS9 A;  1BGJ A;  4ZCD A;  5LV9 A;  3O0H A;  3AB1 A;  2E1M A;  4EM3 A;  3G5R A;  1GAL A;  4OPI A;  1BWC A;  1Y56 B;  4G9K A;  1ELI A;  4XXG A;  1IUT A;  1DJN A;  4FK1 A;  4B67 A;  2WES A;  4IV9 A;  2WPE A;  5FS9 A;  1PBF A;  3V3N A;  5JCK A;  1ZMD A;  2V5Z A;  4Y4L A;  4K2X A;  4IVM B;  3P4P A;  4EQS A;  3NHO X;  4U8K A;  3CPI G;  2CDU A;  3AEA A;  4OPG A;  2B7R A;  1PS9 A;  1S7M A;  1ONF A;  1KSS A;  3NYE A;  5M0Z A;  4AT0 A;  4H2R A;  4JQ9 A;  3AE1 A;  1NDA A;  3AD7 B;  3GMC A;  1GOS A;  5GSN A;  2RGJ A;  4NEW A;  2YWL A;  1QLB A;  2ZZ0 A;  2XVI A;  3ITJ A;  4AP1 A;  2Q0L A;  1PXA A;  1ZDL A;  2YVG A;  3Q9T A;  2BRY A;  4ZCC A;  2A8X A;  4OVI A;  2ARD A;  3SZF A;  1TDN A;  4UP3 A;  3WE0 A;  4Z2T A;  3IWA A;  1Y0P A;  4NZH A;  1ZX9 A;  5CQF A;  4H50 A;  4N9X A;  1ZOY A;  4I59 A;  4JY2 A;  3IHM A;  4K5S A;  1P2H A;  1CF3 A;  1ZK7 A;  3CNT A;  1AOG A;  2QA2 A;  3SXI A;  5HYM A;  2B9Y A;  3G5Q A;  2TMD A;  3SFE A;  2YR4 A;  1H84 A;  3D8X A;  1O5W A;  3I3L A;  2YR5 A;  2C7G A;  1OJC A;  3AWI A;  1EL7 A;  3OC4 A;  5CKU A;  4A79 A;  5KMP A;  3C4A A;  5BRT A;  4GF7 A;  5L46 A;  2IID A;  1GT8 A;  3CN8 A;  1XPQ A;  2V61 A;  4A5L A;  4B66 A;  2YLX A;  4TLZ A;  2XVH A;  3QSS A;  2X99 A;  1E7P A;  2Y6R A;  4CCQ A;  4D03 A;  3AE9 A;  1NHS A;  2FJA A;  2RAB A;  1XHC A;  3UKL A;  1E1M A;  3GDN A;  3KU9 A;  4WCT A;  3ICS A;  2X8C A;  4H4Q A;  4E0V A;  1NG3 A;  2GEW A;  3SGL A;  3CTY A;  4YTN A;  1K0J A;  4WX1 A;  3NG7 X;  2YVJ A;  4LII A;  4K5R A;  3ZDN A;  4JY3 A;  2XFN A;  5KMS A;  2R4J A;  3AD9 B;  2GMJ A;  3ICR A;  3QVR A;  1E39 A;  2VVM A;  3PVC A;  3V76 A;  3L5O A;  4NTC A;  3KD9 A;  2RGO A;  1M6I A;  2VVL G;  3P4R A;  4LU6 A;  2A89 A;  4X4J A;  1ZMC A;  3LJP A;  3AEF A;  3ALL A;  3IF9 A;  1NHP A;  1NHR A;  1BKW A;  1GET A;  1CJ2 A;  3GYJ A;  4GDE A;  4HB9 A;  5EB5 A;  4C74 A;  1MO9 A;  2BC0 A;  2EQ9 A;  3CGD A;  2QA1 A;  2WDR A;  1KFY A;  4BK1 A;  4CBQ A;  4X9M A;  2F5Z A;  1PDH A;  2V3A A;  1EBD A;  4H2P A;  3K30 A;  4CRT A;  1M64 A;  1PBD A;  2VRL A;  4EQW A;  2CFY A;  3K7Q X;  3T0K A;  2E5V A;  3K7M X;  3DGH A;  1PN0 A;  4YSH A;  4GAV A;  3UKQ A;  2CUL A;  3C96 A;  3EPT A;  3T37 A;  3LOV A;  5M10 A;  5EB4 A;  1QO8 A;  3GRT A;  3RP7 A;  1Y56 A;  2EQ6 A;  1NAA A;  1MOK A;  3AE6 A;  3E1T A;  2WET A;  3B3R A;  4JDR A;  3AED A;  4MJW A;  4APN A;  1H7X A;  3ATR A;  2WDV A;  3SZ0 A;  2R9Z A;  1O95 A;  3RNM A;  3ABV A;  4YTP A;  4OPT A;  3NNE A;  3RED A;  1BF3 A;  4H4X A;  4TM3 A;  3FIM B;  2RGH A;  1H83 A;  3DH9 A;  1JRZ A;  1IUU A;  3GMB A;  4A9W A;  2ACZ A;  4TLX A;  1IUW A;  2BK4 A;  2R0G A;  1LPF A;  3LAD A;  4H7U A;  3ADA B;  2GQW A;  1YY5 A;  4II2 A;  4EIQ A;  1VRQ B;  5JCM A;  4D04 A;  4JNA A;  2R46 A;  3DJD A;  3UTE A;  3IHG A;  1ZY8 A;  1CJC A;  1GTH A;  4U2S A;  4B63 A;  2WEU A;  4LA1 A;  1GRG A;  3SQP A;  1PJ6 A;  3P9U A;  4IA6 A;  4NTD A;  4DGK A;  1P2E A;  1FCD A;  4P9S A;  2YG4 A;  1ZKQ A;  2BCG G;  3ALJ A;  5KVI A;  1GES A;  1SEZ A;  4H4Y A;  2GQF A;  4U8J A;  5IQ1 A;  2XVE A;  1BGN A;  3CIR A;  3KA7 A;  4G73 A;  3T2K A;  2C75 A;  1H81 A;  3UOZ A;  1GND A;  2Q7V A;  4J36 A;  1KNR A;  4PAB A;  4UDP A;  5KNL A;  1YQZ A;  4Z44 A;  4CNK A;  2WPF A;  3CNS A;  3AEB A;  3DA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...