5JCKA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
432
structure length
432
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFYSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVANIEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
total genus 140
structure length 432
sequence length 432
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jckA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jckA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jckA02
4EQWA 3NTAA 1H86A 3E1TA 4O5QA 4D03A 2EQ7A 2Q7VA 2WQYA 2JB3A 4GUVA 1XANA 4IA5A 4YSZA 1BGNA 2WP9A 4H4WA 1X31B 3QSMA 1D4CA 2WETA 1DJNA 5GSNA 4M52A 2Y6QA 4H4SA 1TYTA 1E1MA 2GR1A 3NHOX 2UZZA 3I6DA 3PVCA 4BJZA 1PXBA 4E0VA 3UKFA 2WBAA 4U8PA 3F8DA 4Z25A 2CDUA 2JAEA 4J33A 1H6VA 3CPHG 2EQ8A 2BK5A 2V61A 2GMHA 1FECA 2GH5A 4X9NA 1Q1RA 2RGOA 3CNPA 4X9MA 5U1OA 2C67A 4NTCA 1NHSA 1W4XA 1L9CA 3FBSA 3VR8A 2YLRA 4FK1A 1LQTA 1JRYA 4TM0A 2R45A 3COXA 2GB0A 1CC6A 4FX9A 5FS6A 3RNMA 4OCGA 2YLZA 4A9WA 2CFYA 2XLTA 4C3XA 4U8KA 1D7LA 1EL9A 1QLBA 1FCDA 1DODA 3QFBA 1XPQA 3NNEA 3SFEA 2R46A 1H81A 2GR3A 3NKSA 2BXRA 1D7YA 2WOVA 3G5SA 4YKFA 1EBDA 2C3CA 4I58A 1GEUA 1CJ3A 4J56A 2YLWA 4AT0A 4BV6A 3Q6JA 3GRTA 2E1MA 2ARDA 3AE1A 1K0IA 4B64A 1IUVA 4U8NA 1ONFA 4JY3A 5BVAA 5BUKA 3CIRA 2VRLA 1IUSA 1E39A 4B69A 5JCIA 3ICSA 3KPFA 2V3BA 2YAUA 2YM2A 1PJ7A 3F8RA 4JNAA 1DJQA 4BK1A 1YKJA 1D4EA 3D1CA 5GRTA 3GDPA 2E5VA 3KD9A 4YSYA 2RGHA 5KXJA 4NTDA 1JOAA 1RP0A 1KSUA 1ZY8A 5HHFA 4AP3A 4HA6A 5JCLA 1DOBA 1BGJA 2C75A 2YR6A 3CPJG 5DBJA 4AT2A 1H7XA 3DK4A 1F8WA 4H2PA 4U8OA 1LPFA 4GF7A 5JCMA 2V60A 2XCGA 2A8XA 5BULA 1OJCA 2VOUA 2GR0A 2YR5A 3K7QX 3B6DA 4LIIA 3LB8A 4OPDA 1JNZA 4OPLA 2GRTA 1ZX9A 2E4GA 5U25A 3EANA 1N1PA 4D04A 2VVLA 2C76A 2YWLA 3DJDA 4RG4A 1PHHA 1H83A 5KWFA 3ICTA 1FOHA 2WPEA 3NYCA 1CJCA 2I0ZA 2XFUA 4J2WA 2YVFA 3DK9A 3JSKA 4OVIA 3BNUA 4CBQA 4XWZA 1ZDLA 5JCKA 3UKQA 2F5ZA 3EF6A 1S3EA 1NHRA 2RABA 2BK3A 3IHGA 2YLXA 1ZOYA 4YTNA 4BK2A 2JK6A 3BHKA 4A65A 1O95A 3GSIA 3F8PA 2B7RA 1ELIA 1RSGA 3ADAB 3G5RA 3O0HA 3LJPA 3NGCX 3CNTA 5IQ4A 4K8DA 4P9SA 1N4WA 1CJ4A 3AE2A 2IVDA 1H82A 1E7PA 4IVOB 3VQRA 2WS3A 2WOWA 3K7MX 3AD8B 4C74A 5IPYA 3AEAA 4H4RA 2OAMA 3NLCA 2WU2A 1YQ3A 5HXIA 5LV9A 1Y56B 1VQWA 1E1NA 2BA9A 1XDIA 5EB4A 1CBOA 1GREA 4K7ZA 3VR9A 1M6IA 1O94A 1F8SA 3ABVA 1NAAA 3GDNA 1NHPA 2OALA 3URHA 2XFPA 2BACA 1N4VA 3NH3X 1E6EA 3NK0X 3R9UA 3UOZA 4ZN0A 2WEUA 2QCUA 1KF6A 2YLTA 3BI4A 3AEEA 3S61A 1L9EA 4KX6A 1Y56A 2BCGG 3NN0X 4OPGA 3ISHA 3SM8A 3NT6A 3AE3A 3EPTA 3FMWA 2R0CA 1PS9A 1TYPA 4H4XA 1P2EA 2GR2A 5IQ1A 5U63A 1B4VA 4NEVA 1KNPA 1OJDA 2WESA 3LOVA 3M13A 1GTEA 4I59A 4GCMA 1JU2A 1BZLA 4Z24A 3GD3A 2FJDA 2XFNA 4Y4LA 1GETA 1D5TA 3M0OA 3SGLA 2C66A 4AP1A 3RP7A 4B67A 2Z5YA 1GRTA 3VRBA 4MJWA 1PBBA 3IF9A 2ACZA 2GVCA 3CGCA 4YTMA 1QO8A 1LJ1A 5HYMA 1IJHA 5EOWA 2XYOA 3SQPA 2NVKX 3NYFA 2WDQA 4NTEA 2BABA 2XDOA 2OA1A 1GESA 2CULA 1GPEA 1F6MA 1VRQB 3NRNA 1DNCA 3QSEA 1GSNA 1GT8A 4UDPA 4CRTA 3ITJA 4B68A 4USRA 1NHQA 3NIXA 4EIPA 3KVEA 3DH9A 1FL2A 4Y4MA 3LADA 3IHMA 2YG3A 4J31A 4XXGA 2AQJA 1SEZA 4B1BA 2GQFA 4YKGA 3AE4A 4H50A 1MO9A 1S2QA 3ATRA 1BKWA 2RGJA 3RP6A 4J36A 1FEAA 5KVHA 1TDKA 2BS2A 3KA7A 4C3YA 1B37A 2Q0KA 2VQBA 2BS4A 4GRTA 3SFDA 3UTHA 1LTXR 1IUWA 3GYJA 1BF3A 1Z6LA 3C4NA 2XVEA 2FJEA 3DJEA 4A99A 3CNDA 4U2SA 1UKVG 3DA1A 2APGA 1JNRA 1GRGA 3NN6X 3H8IA 4K2XA 1JRXA 2YVGA 4YXDA 4BJYA 1XHCA 3OZ2A 4Z2UA 1DXLA 1GERA 3RHAA 2B76A 4EIQA 2BYBA 3ZYXA 4U8JA 1KSSA 1ZP0A 1KNRA 4H7UA 4B66A 5BRTA 3FPZA 1DOEA 2YVJA 3GYIA 1EL5A 3UKHA 3AYLA 1PJ5A 4JNQA 4NZHA 1TDEA 3UTGA 2BC0A 5JCNA 2GV8A 3AE6A 4JN9A 4X4JA 4CNJA 1ZMCA 2XVIA 4H4VA 2VQ7A 2BC1A 1GRFA 3HZLA 1EL8A 4OPCA 2CVJA 2R0PA 1ZOVA 4O5UA 1GRBA 1KDGA 1BWCA 2Q6UA 3QJ4A 1PBEA 1JRZA 4Y4NA 4EMIA 2Y6RA 3AEDA 3BI2A 2B9YA 4JQ9A 1CL0A 4TM3A 2WDRA 4B65A 2XVFA 3CN8A 4H4YA 1MXTA 4YWOA 1PBDA 2GMJA 2WHDA 3LZWA 4DGKA 1RYIA 1NEKA 4ECHA 4NEWA 2XLPA 1M64A 2QA1A 2XLSA 3AEFA 3DGHA 3DJJA 2R4EA 4K5RA 5CQFA 1GALA 5HY5A 5CKUA 3D8XA 1E1LA 2BS3A 2WP6A 1NPXA 4H2NA 1D4DA 3EAOA 1O5WA 4K5SA 3ALLA 3AXBA 4WCTA 1LV0A 4A7AA 3FG2P 4FDCB 1COYA 4TLXA 2EQ6A 2IIDA 2JB2A 4IVMB 1V59A 2YG6A 2ZZ0A 1PXCA 1F8RA 4YT0A 5FS7A 3IWAA 1NG3A 3C4AA 3DJGX 2B7SA 2XVHA 2O9ZA 2XFOA 4U8MA 4EM3A 2AAQA 4Z43A 4H4QA 2BXSA 1Q1WA 3DK8A 1HYUA 3UKAA 2DKIA 2GQWA 4EMJA 2W0HA 4U8LA 3QFAA 1NG4A 5EB5A 3V3OA 3BNMA 1CF3A 1CC4A 1TRBA 5M10A 4TM4A 3VRAA 4DSHA 2AR8A 1TDNA 1ZMDA 2YM1A 2WPCA 3P9UA 2QA2A 3BHFA 1N4UA 1YY5A 2V3AA 4U2TA 4CNKA 3GWFA 3QVPA 1H7WA 4A79A 1TDOA 3ICRA 2OLNA 5FS9A 1DOCA 3CNJA 5KRQA 4HB9A 4C5OA 4IA6A 3S5WA 1PJ6A 4TLZA 1REOA 3REDA 4U2LA 3ZDNA 1OJAA 2XLUA 3AEBA 3I3LA 3Q9TA 4C77A 3GD4A 1JEHA 4EQRA 4YSHA 5J60A 3PS9A 1P2HA 1K0LA 4H2QA 1B5QA 3QSSA 3CTYA 1IUUA 3GRSA 1IUXA 5J7XA 4AOXA 2WU5A 3NTDA 4AOSA 4GDEA 3CNSA 3P1WA 3NK2X 3KKJA 4REKA 2C7GA 2R0GA 4UDQA 2JB1A 3UTEA 4J57A 2WOIA 1B8SA 5C2TA 3UOVA 1L0VA 4BK3A 4BURA 1F3PA 2X3NA 3M12A 1VG9A 3K30A 4H4ZA 3VRDB 3CPIG 2TPRA 3H4KA 1PBCA 4U8IA 5FS8A 3AD9B 1KFYA 2YG4A 3AWIA 4FK1C 3UKLA 4IV9A 4RSLA 3AE5A 3C96A 5L46A 3UCLA 5M0ZA 2BCPA 3CGEA 2NPXA 2VVLG 2X50A 4CCQA 3NG7X 4Z26A 2C73A 1ZK7A 1PBFA 1OJ9A 4EMWA 4ZCCA 2A87A 2ZZCA 1Y0PA 3PO7A 5KOWA 3BI5A 1LQUA 2FJAA 4Z2TA 4DNAA 1GV4A 3DGZA 3P4QA 4ZCDA 2C70A 2JBVA 4B63A 2WPFA 3GMBA 1AOGA 3DMEA 2R9ZA 2Z5XA 5C3JA 1YQZA 2FBWA 3AB1A 2Q0LA 3KU9A 2FJBA 2C64A 2B9XA 2JKCA 4H2RA 1GNDA 2X8HA 1L9DA 1YQ4A 4CCRA 2TMDA 1S3BA 1Q9IA 4RG3A 4YSXA 4EQXA 2ZZBA 3GWDA 3NYEA 2X99A 2A89A 5TR3A 3P4RA 4Z44A 1PN0A 3WE0A 2R4JA 2GEWA 3UOXA 4APNA 3AE9A 3LXDA 2X8CA 4H4TA 4LU6A 3UOYA 5EBKA 2C65A 2YG7A 4H4PA 1GOSA 2YR4A 1H84A 2DKHA 4XWRA 1MOKA 3V76A 3LZXA 4EM4A 1EL7A 2VRMA 1VDCA 3QVRA 4USQA 2VZ2A 2WP5A 5FMHA 4PABA 4ADWA 1S2YA 3NK1X 3OC4A 2V6OA 2H88A 5KVIA 4PAAA 1GRHA 4ICYA 4GDPA 4LA1A 1CHUA 4N9XA 2VVMA 3UKKA 1E1KA 4KPRA 3GMCA 2PYXA 4UP3A 3UTFA 4A5LA 2YLSA 4YTPA 3AEGA 1GXFA 1PXAA 4Z2RA 4CY6A 4H4UA 2BK4A 2J3NA 4JDRA 3UP5A 4A6NB 3AD7B 1GRAA 2QAEA 2XFQA 4OPUA 2HQMA 3AYJA 3IC9A 1TDFA 4J34A 2EQ9A 1K4QA 3AE7A 2GAGB 4WX1A 2XVJA 2YQUA 3AYIA 5KOXA 3P4PA 3L1RA 1NDAA 4JY2A 1OJTA 4K22A 1PDHA 3ATQA 1LVLA 2WDVA 3V3NA 1ZKQA 2C72A 4DSGA 3UKPA 3KLJA 4A6NA 3CGBA 2ZBWA 1K0JA 3FIMB 3B3RA 3ALJA 2XLRA 4UDRA 2GAHB 3T37A 5ER0A 1IUTA 3H8LA 3L8KA 2H89A 2GF3A 1NENA 1CC2A 3P4SA 4TM1A 4EQSA 2YG5A 3UP4A 3AE8A 1GTHA 3CGDA 2C3DA 2V5ZA 2X8GA 4GR1A 3K7TA 1QJDA 3ALMA 4OPIA 1FEBA 2OLOA 2PHHA 3II4A 4CY8A 1VG0A 2B9WA 3RP8A 1CJ2A 2IVEA 3G5QA 4OPTA 3AECA
chains in the Genus database with same CATH superfamily
4D03A 2EQ7A 2C4CA 2WP9A 1DJNA 5GSNA 1E1MA 2UZZA 3PVCA 2WBAA 3T2ZA 3F8DA 2OX4A 4Z25A 1T3QC 2JAEA 3A7RA 4GGBA 1Q1RA 1IYXA 1NHSA 1P43A 3VR8A 4FK1A 4TM0A 2R45A 3T31A 3RNMA 3NRZB 2AKZA 2MUCA 3RRAA 3STPA 2WOVA 3G5SA 1PDZA 3MZNA 4BV6A 2E1MA 3UCDA 3ZLFA 1IUVA 4U8NA 4JY3A 1IUSA 3AN1A 2YAUA 1D4EA 2GGIA 2RGHA 1JOAA 4HCLA 1RP0A 4HA6A 2C75A 4E4UA 5DBJA 4AT2A 4EWJA 5JCMA 2V60A 3R10A 2XCGA 2OQYA 2VOUA 2YR5A 2GR0A 4H83A 3K7QX 5FJOA 4OPLA 1JNZA 3V5CA 2C76A 4RG4A 3DJDA 1PHHA 2WPEA 1CJCA 2YVFA 3UKQA 5KMRA 4MMWA 1S3EA 1OEPA 2BK3A 5FJTA 3F8PA 2B7RA 3N4FA 4IVOB 3VQRA 2WOWA 3SSZA 3SXIA 5HXIA 1E1NA 2BA9A 5EB4A 1CBOA 1GREA 4K7ZA 2PP3A 3ABVA 1NAAA 4E8GA 3MSYA 1E6EA 1DTNA 3QN3A 5BOFA 2QCUA 3UJFA 1ELSA 3AEEA 3NN0X 3ISHA 2W55A 3SM8A 1TYPA 4H4XA 1KNPA 2WESA 3SGLA 2C66A 4AP1A 3L5OA 1PBBA 4DXKA 2ACZA 1IJHA 5EOWA 3OZYA 3SQPA 3PK7A 2XDOA 3VFCA 4UDPA 3ENLA 4B68A 3SYIA 4ZCWA 4B1BA 3RP6A 2P0IA 1FEAA 5KVHA 2BS4A 1IUWA 3GYJA 3C4NA 2FJEA 2ZC8A 4DHGA 2OZ3A 4Z2UA 5BRTA 3FPZA 3GYIA 3UKHA 4NZHA 3UTGA 5JCNA 3AE6A 4CNJA 4JN9A 1EL8A 4OPCA 3T9PA 4O5UA 2Q6UA 1PBEA 3I4KA 1CL0A 2WDRA 1KN0A 3JVAA 1PBDA 2WHDA 3S47A 2XLSA 3KUMA 3AEFA 3DGHA 5CQFA 1GALA 5HY5A 3VDGA 5CKUA 1E1LA 3NXLA 1D4DA 3EAOA 1O5WA 4TLXA 4GAPA 1PXCA 5FS7A 1NG3A 2XFOA 4H4QA 3DK8A 1HYUA 3UKAA 1RVKA 2DKIA 2GQWA 2W0HA 3QFAA 1CF3A 1L8PA 4DYEA 5M10A 1RM6B 3NZGA 1TDNA 4GMEA 2V3AA 1SJCA 3N4EA 3QVPA 3ICRA 5KRQA 4HB9A 4C5OA 4IA6A 3S5WA 3CYJA 1REOA 3GD4A 2GGHA 3A7UA 3CTYA 2DW6A 3GRSA 3NTDA 3CNSA 3AMZA 2R0GA 4UDQA 2JB1A 3UTEA 3UOVA 3SN0A 4BK3A 1VG9A 1EC8A 3Q4DA 4IV9A 4ZOHB 3C96A 5KMSA 2X50A 4CCQA 2C73A 4ZCCA 1ECQA 2XGZA 1MDRA 2C70A 3FCPA 2FBWA 3AB1A 3H12A 4JHMA 2B9XA 3P3BA 3QKEA 4CCRA 1Q9IA 2ZZBA 3GWDA 5TR3A 3P4RA 3CXBA 3WE0A 4G8TA 2GEWA 3VC5A 3AE9A 3EUB3 4H1ZA 2X8CA 5EBKA 3OTRA 2C65A 1GOSA 2P88A 4XWRA 3TJIA 3T2KA 4PABA 4ADWA 3NK1X 3OC4A 1GRHA 4LA1A 1CHUA 3GMCA 1GXFA 2OPJA 1PXAA 1GRAA 2XFQA 4OPUA 3AYJA 3P93A 1K4QA 2GAGB 2XVJA 3P4PA 3L1RA 3V3NA 1LVLA 2OQHA 2WDVA 1ZKQA 3UXKA 3QLDA 3B3RA 5ER0A 1N61C 1NENA 1YEYA 4TM1A 3UP4A 2X8GA 2PU1A 3KPKA 4OPIA 2PSNA 1H86A 4GUVA 4IA5A 4YSZA 3QSMA 3ZVHA 4ROPA 4H4SA 2GR1A 2W3RA 1N62C 4BJZA 3T8QA 3CXOA 4J33A 3CPHG 1NELA 2BK5A 2V61A 3SZ0A 2GH5A 1WYGA 3CAWA 4FX9A 1N63C 4G74A 2XLTA 1D7LA 1EL9A 5FJRA 3NNEA 2XH0A 2C3CA 4AT0A 3ETRB 3GRTA 2OO6A 3CIRA 3ICSA 3KPFA 2V3BA 2YM2A 4GYPC 3D1CA 3GDPA 4YSYA 2E5VA 5KXJA 4IL2A 5JCLA 3BJSA 1BGJA 1F8WA 4U8OA 1LPFA 2A8XA 3CB3A 5BULA 3B6DA 3LB8A 2GRTA 1ZX9A 5U25A 3EANA 2YWLA 4KEMA 2XFUA 3DK9A 4OVIA 3NO1A 3BNUA 4XWZA 3EF6A 3IHGA 2JK6A 1ELIA 3CNTA 4K8DA 4P9SA 1CJ4A 2IVDA 4MGGA 1H82A 4C74A 3AD8B 5IPYA 4H4RA 3MUCA 3I6TA 3PG6A 5LV9A 1XDIA 2W54A 1F8SA 4A3RA 2XFPA 4GIRA 2BACA 3UOZA 4HPNA 3R9UA 1FHUA 2YLTA 3BI4A 4KX6A 1Y56A 3D9XA 4E6MA 4OPGA 3NT6A 4M0XA 3EPTA 3RITA 5IQ1A 5U63A 1B4VA 3LOVA 4I59A 1BZLA 4Z24A 1D5TA 3RP7A 4B67A 1GRTA 3IF9A 3CGCA 3TW9A 5HYMA 2XYOA 4YWSA 2OKTA 3DESA 1GPEA 1VRQB 3SZCA 3NRNA 3FV9A 3ITJA 6ENLA 3MQTA 3DH9A 3SR6B 4Y4MA 3UXLA 2AQJA 1SEZA 4H50A 1MO9A 1S2QA 3ATRA 1BKWA 2RGJA 4J36A 2BS2A 2VQBA 2QVHA 1EBHA 4A99A 3UJRA 4U2SA 3UGVA 1JNRA 1N5WC 1SJDA 3NN6X 3H8IA 2AL2A 1E9IA 2PTYA 3SZWA 3RHAA 3OZMA 4H7UA 4IP5A 1DOEA 1EL5A 2NQLA 2OFJA 1P48A 1ZMCA 2XVIA 4H4VA 2BC1A 1GRFA 3HZLA 1KDGA 3QJ4A 3SZFA 2GL5A 2Y6RA 3AEDA 3TJ4A 1EBGA 4B65A 4H4YA 2GMJA 1RYIA 4NEWA 2XLPA 1M64A 3SBFA 3DJJA 3S5SA 2BS3A 2WP6A 1XS2A 3NVWB 3ALLA 4DN1A 3AXBA 1LV0A 4A7AA 2OZTA 3FG2P 4FDCB 2JB2A 4IVMB 1V59A 2ZZ0A 4YT0A 3IWAA 3VCNA 2B7SA 1JCTA 2XVHA 4U8MA 2AAQA 4Z43A 2BXSA 1Q1WA 4NWZA 4U8LA 1R6WA 3VRAA 2AR8A 1ZMDA 3DDMA 2YM1A 2QA2A 1N4UA 4U2TA 4CNKA 3VA8A 4A79A 1TDOA 2OLNA 1DOCA 3CNJA 4IL0A 4TLZA 4U2LA 3OPSA 3ZDNA 3AEBA 3I3LA 5KNLA 1JEHA 1P2HA 1K0LA 4H2QA 3TOYA 4GDEA 3EKGA 1B8SA 2X3NA 3QPEA 4ZA0A 3VRDB 1PBCA 2GSHA 3AD9B 3BSMA 5L46A 3UCLA 1ONEA 2BCPA 2XH7A 3HW2A 5FJUA 1ZK7A 4EMWA 2A87A 3PO7A 5G5HB 2FJAA 1GV4A 4ZCDA 3NFUA 2WPFA 1AOGA 3DEQA 2OZ8A 2HNEA 2Q0LA 4H2RA 4E4FA 1L9DA 4RG3A 4EQXA 3R07C 2R4JA 3UOYA 3RCYA 3V76A 3LZXA 1EL7A 2VRMA 3QVRA 3DGBA 5FMHA 2H88A 4ICYA 5BOEA 2I5QA 3UTFA 2YLSA 3B9JB 4CY6A 4H4UA 2J3NA 4JDRA 3UP5A 3SX6A 3IC9A 1TDFA 3AYIA 3JW7A 4GGHA 1PDHA 3ATQA 1R0MA 4DSGA 4A6NA 3CGBA 1K0JA 3T37A 3L8KA 2H89A 4EQSA 3AE8A 3CGDA 2C3DA 3K7TA 3ALMA 1FEBA 3ZVHB 2OLOA 3II4A 1VG0A 2P8CA 2IVEA 3G5QA 4OPTA 4EQWA 3NTAA 3HYWA 3NS1B 5JRBA 2Q7VA 2PTZA 4H4WA 5EU9A 1JDFA 4M52A 1BKHA 3UKFA 4G7FA 4FP1A 1FECA 2GMHA 4X9NA 2RGOA 4X9MA 3CNPA 5U1OA 2C67A 1L9CA 2YLRA 1LQTA 4HCDA 3COXA 5FS6A 2YLZA 4A9WA 2CFYA 1QLBA 1FCDA 1XPQA 2GR3A 3SN1A 4I58A 1GEUA 3RR1A 2OVLA 1CJ3A 4J56A 4B64A 1ONFA 3UCCA 1E39A 1FIQB 1MUCA 1PJ7A 3DG6A 4JNAA 2PTXA 1TKKA 1WUFA 5GRTA 1KSUA 1ZY8A 5HHFA 4AP3A 3GC2A 1DOBA 2YR6A 3CPJG 3UJSA 2QGYA 2CHRA 4H2PA 1OJCA 2AL1A 4LIIA 4OPDA 2E5AA 3R11A 4J2WA 5JCKA 4G9KA 2RABA 4GISA 4BK2A 1RSGA 3FJ4A 3O0HA 3LJPA 3NGCX 1N4WA 2GGEA 1X2HA 3CK5A 3K7MX 3DG7A 1YQ3A 1Y56B 1VQWA 1FHVA 1M6IA 2MNRA 3ZVIA 3NH3X 1N4VA 3NK0X 4ZN0A 4J1OA 2WEUA 3S61A 1L9EA 3FVDA 3AE3A 3MKCA 3SY4A 1P2EA 4NEVA 4A6GA 1JU2A 1KKOA 1S7MA 2XFNA 3M0OA 1ZXIC 2Z5YA 3VRBA 4MJWA 4YTMA 1PDYA 2NVKX 3NYFA 2WDQA 4NTEA 2BABA 2OA1A 4GFIA 2CULA 3I6EA 3QSEA 2QDDA 1GT8A 1NHQA 1TE6A 2AKMA 1MRAA 3LADA 4J31A 3AE4A 1TZZA 4K2SA 2AL2B 4C3YA 2Q0KA 1LTXR 1BF3A 3IJQA 1UKVG 3THUA 2XSXA 2APGA 1GRGA 3A7AA 1JRXA 4YXDA 3IJLA 1XHCA 4GYPA 1DXLA 1GERA 3ZYXA 4B66A 1KNRA 3NVYB 3CMMA 3OP2A 3AYLA 4DWDA 1TDEA 3T6CA 2BC0A 2PP0A 1ZOVA 1BWCA 3RGTA 3VCCA 4Y4NA 3PFRA 4EMIA 3T14A 4TM3A 3CN8A 1MXTA 4DGKA 3NVVB 4ECHA 3ZLGA 4JN8A 2QA1A 2R4EA 3DFHA 1NPXA 4K5SA 4WCTA 1VDVA 3VC6A 3AM9A 3R0UA 2DW7A 1SJBA 1F8RA 2PP1A 3DJGX 2O9ZA 4EM3A 2XH4A 1TRBA 2ZADA 1JPMA 3P9UA 2QJNA 4J3ZA 3K1GA 1H7WA 3REDA 4MKSA 3Q9TA 4C77A 3DG3A 4EQRA 5J60A 2E3TA 1IUUA 5J7XA 2OG9A 4KWSA 2WU5A 4AOXA 3RO6A 3P1WA 3NK2X 4REKA 5C2TA 4BURA 3M12A 1VQZA 3CPIG 2TPRA 3H4KA 4U8IA 5FS8A 1KFYA 2YG4A 3AWIA 4FK1C 3UKLA 3JZUA 4HYRA 3AE5A 5KMQA 5M0ZA 3CGEA 3PWGA 2VVLG 3NG7X 4KPLA 1PBFA 1EC7A 4HNLA 2ZZCA 5KOWA 3BI5A 3DGZA 3TTEA 3P4QA 3TWAA 5C3JA 2PGWA 3FXGA 2RDXA 2JKCA 2X8HA 1YQ4A 2TMDA 2PCEA 3R1ZA 4Z44A 4IP4A 2HZGA 1PN0A 2PS2A 4HCHA 1W6TA 4H2HA 3LXDA 4HNCA 4LU6A 2YG7A 4H4PA 2HXTA 2YR4A 4EM4A 4DX3A 1XPYA 2QJJA 5J04A 2WP5A 1S2YA 2V6OA 5KVIA 3HYVA 4GDPA 2BRAA 3ES8A 2PYXA 4UP3A 4YTPA 3AEGA 2BK4A 4A6NB 2QAEA 2HQMA 2EQ9A 3AE7A 3SQSA 3GYXA 5KOXA 1X2GA 1OJTA 1SJAA 3IK4A 3FIMB 3B97A 2XLRA 1IUTA 1MDLA 3H70A 2GF3A 3N6JA 3GO2A 1CC2A 2QQ6A 3P4SA 2P3ZA 5FJPA 1GTHA 3TCSA 2ONEA 4GR1A 4X2PA 2PHHA 4CY8A 2B9WA 3RP8A 1JPDX 3E1TA 4TVWA 4O5QA 3UJ2A 2WQYA 2JB3A 1XANA 1BGNA 2PPGA 1X31B 1D4CA 2WETA 3V3WA 2Y6QA 1TYTA 3NHOX 3T0KA 3I6DA 1PXBA 4E0VA 3HRDC 4U8PA 2GDQA 2CDUA 1H6VA 2EQ8A 4NTCA 1W4XA 1MNSA 3FBSA 3OW1A 1JRYA 2GB0A 3R0KA 1CC6A 4C3XA 4OCGA 4U8KA 1DODA 3QFBA 3SFEA 2R46A 1H81A 3NKSA 2BXRA 1D7YA 4YKFA 1EBDA 4G73A 2YLWA 3Q6JA 2BRYA 2ARDA 3AE1A 1K0IA 4JN7A 5BVAA 5BUKA 2VRLA 4B69A 5JCIA 3F8RA 1DJQA 4BK1A 1YKJA 1KD0A 1N5XA 3KD9A 4NTDA 3U4FA 3HPFA 3TQPA 4G6HA 1H7XA 3DK4A 4GF7A 1F9CA 2PMQA 2PTWA 2P8BA 4F4RA 3D46A 2E4GA 1N1PA 4D04A 3DERA 2VVLA 1H83A 5KWFA 3ICTA 1FOHA 4FI4A 3U9IA 3MY9A 3NYCA 2I0ZA 3JSKA 3HYXA 4CBQA 1FFUC 1ZDLA 2F5ZA 1NHRA 2YLXA 1ZOYA 4YTNA 3BHKA 4A65A 1O95A 3GSIA 1EC9A 4K8GA 3ADAB 3G5RA 5IQ4A 4HN8A 3AE2A 1E7PA 2WS3A 3AEAA 3NLCA 2OAMA 3ES7A 2WU2A 3V4BA 3VR9A 1O94A 3GDNA 3GD6A 1NHPA 2OALA 3URHA 1KF6A 2BCGG 3FMWA 2R0CA 1PS9A 2GR2A 2W3SA 1OJDA 3M13A 1GTEA 4GAVA 4GCMA 3GD3A 2FJDA 3Q45A 4Y4LA 1GETA 3DFYA 3T4WA 2GVCA 1QO8A 3R25A 1LJ1A 1KKRA 5KMPA 2HXUA 1GESA 4H19A 1F6MA 1DNCA 1GSNA 3T2YA 4CRTA 1FFVC 4USRA 1STZA 3NIXA 4EIPA 3EEZA 3KVEA 1FL2A 3IHMA 2YG3A 4XXGA 2GQFA 4YKGA 4A35A 5G5GB 2FYMA 4II2A 3BOXA 1TDKA 3KA7A 1B37A 4Z1YA 4GRTA 3SFDA 3UTHA 1Z6LA 2GGJA 2XVEA 3DJEA 3CNDA 3DA1A 4K2XA 2YVGA 1FO4A 4BJYA 3OZ2A 3SN4A 2B76A 4EIQA 1V97A 2BYBA 2PA6A 1KSSA 1ZP0A 4U8JA 2YVJA 1PJ5A 4II3A 4JNQA 2POZA 2GV8A 4X4JA 2VQ7A 2CVJA 2R0PA 4KT2A 1GRBA 1JRZA 4TVYA 2PU0A 3BI2A 2B9YA 4JQ9A 2XVFA 3H8AA 4YWOA 3LZWA 3GY1A 1NEKA 1JRPA 4K5RA 4IT1A 3D8XA 2QDEA 3CT2A 4H2NA 1N60C 1COYA 2EQ6A 2IIDA 2YG6A 3UJEA 3C4AA 2FKPA 4EMJA 5EB5A 3V3OA 1NG4A 3BNMA 1CC4A 4TM4A 4DSHA 2WPCA 3BHFA 1YY5A 3GWFA 4K1WA 4IZGA 4Z17A 5FS9A 1SB3B 1PJ6A 1OJAA 2XLUA 1JROA 4YSHA 3PS9A 1B5QA 3N6HA 3QSSA 4E5TA 1IUXA 4AOSA 3KKJA 2C7GA 3H7VA 4J57A 2WOIA 3SJNA 1L0VA 7ENLA 1F3PA 3K30A 4H4ZA 4ENLA 2OLAA 4IHCA 3D47A 3MWCA 3FYYA 2XH2A 4RSLA 3PWIA 2PGEA 2NPXA 4Z26A 1OJ9A 1Y0PA 1LQUA 4Z2TA 4DNAA 4B63A 2JBVA 3GMBA 3DMEA 2R9ZA 3ZLHA 2Z5XA 1YQZA 1KCZA 3KU9A 2FJBA 2PODA 2C64A 3NVZB 1GNDA 3QTPA 1S3BA 4YSXA 1BQGA 3NYEA 2X99A 2A89A 3P0WA 3UOXA 4APNA 3TWBA 4H4TA 5IDZA 1H84A 2DKHA 1MOKA 1H2IA 1VDCA 4USQA 4G6GA 2VZ2A 2QJMA 4PAAA 4N9XA 1NU5A 2GGGA 2VVMA 3UKKA 1E1KA 4KPRA 4A5LA 4M6UA 4Z2RA 3AD7B 4J34A 3IJIA 4WX1A 2YQUA 3DIPA 4JY2A 1NDAA 4K22A 4NNJA 2C72A 3UKPA 3KLJA 2O56A 2ZBWA 3ALJA 4UDRA 2GAHB 1WUEA 3H8LA 2YG5A 5ENLA 3V5FA 2V5ZA 1QJDA 1CJ2A 3AECA
chains in the Genus database with same CATH topology
4EQWA 3NTAA 3HYWA 1H86A 3E1TA 4O5QA 4D03A 5JRBA 2EQ7A 2Q7VA 2WQYA 2JB3A 4GUVA 1XANA 2C4CA 4IA5A 4YSZA 1BGNA 2WP9A 4H4WA 1X31B 3QSMA 1D4CA 2WETA 1DJNA 5GSNA 4M52A 2Y6QA 4H4SA 1TYTA 1E1MA 2GR1A 3NHOX 3T0KA 2UZZA 3I6DA 3PVCA 4BJZA 1PXBA 4E0VA 3UKFA 2WBAA 3T2ZA 4U8PA 3F8DA 4Z25A 2CDUA 2JAEA 4J33A 1H6VA 3CPHG 2EQ8A 2BK5A 2V61A 2GMHA 1FECA 2GH5A 4X9NA 1Q1RA 2RGOA 3CNPA 4X9MA 5U1OA 2C67A 4NTCA 1NHSA 1W4XA 1L9CA 3FBSA 3VR8A 2YLRA 4FK1A 1LQTA 1JRYA 4TM0A 2R45A 3COXA 2GB0A 1CC6A 4FX9A 3T31A 5FS6A 3RNMA 4G74A 2YLZA 4OCGA 2CFYA 2XLTA 4A9WA 4C3XA 4U8KA 1D7LA 1EL9A 1QLBA 1FCDA 1DODA 3QFBA 1XPQA 3NNEA 3SFEA 2R46A 1H81A 2GR3A 3NKSA 2BXRA 1D7YA 2WOVA 3G5SA 4YKFA 1EBDA 2C3CA 4G73A 1GEUA 4I58A 1CJ3A 4J56A 2YLWA 4AT0A 4BV6A 3Q6JA 3GRTA 2BRYA 2ARDA 2E1MA 3AE1A 1K0IA 4B64A 1IUVA 4U8NA 1ONFA 4JY3A 5BVAA 5BUKA 3CIRA 2VRLA 1IUSA 1E39A 4B69A 5JCIA 3ICSA 3KPFA 2V3BA 2YAUA 2YM2A 1PJ7A 3F8RA 4JNAA 1DJQA 4BK1A 1YKJA 1D4EA 3D1CA 5GRTA 3GDPA 2E5VA 3KD9A 4YSYA 2RGHA 5KXJA 4NTDA 1JOAA 1RP0A 1KSUA 1ZY8A 5HHFA 4AP3A 4HA6A 5JCLA 1DOBA 1BGJA 2C75A 2YR6A 3CPJG 5DBJA 4G6HA 4AT2A 1H7XA 3DK4A 1F8WA 4H2PA 4U8OA 1LPFA 4GF7A 5JCMA 2V60A 2XCGA 2A8XA 5BULA 3SZ0A 1OJCA 2VOUA 2GR0A 2YR5A 3K7QX 3B6DA 4LIIA 3LB8A 4OPDA 1JNZA 4OPLA 2GRTA 1ZX9A 2E4GA 5U25A 3EANA 1N1PA 4D04A 2VVLA 2C76A 2YWLA 3DJDA 4RG4A 1PHHA 1H83A 5KWFA 3ICTA 1FOHA 2WPEA 3NYCA 1CJCA 2I0ZA 2XFUA 4J2WA 2YVFA 3DK9A 3JSKA 4OVIA 3HYXA 3BNUA 4CBQA 4XWZA 1ZDLA 5JCKA 4G9KA 2F5ZA 3UKQA 3EF6A 5KMRA 1S3EA 1NHRA 2RABA 2BK3A 3IHGA 2YLXA 1ZOYA 4YTNA 4BK2A 2JK6A 3BHKA 4A65A 1O95A 3GSIA 3F8PA 2B7RA 1ELIA 1RSGA 3ADAB 3G5RA 3O0HA 3LJPA 3NGCX 3CNTA 5IQ4A 4K8DA 4P9SA 1N4WA 1CJ4A 3AE2A 2IVDA 1H82A 1E7PA 4IVOB 3VQRA 2WS3A 2WOWA 3K7MX 3AD8B 4C74A 5IPYA 3AEAA 4H4RA 2OAMA 3NLCA 2WU2A 3PG6A 3SXIA 1YQ3A 5HXIA 5LV9A 1Y56B 1VQWA 1E1NA 2BA9A 1XDIA 5EB4A 1CBOA 1GREA 4K7ZA 3VR9A 1M6IA 1O94A 1F8SA 3ABVA 1NAAA 3GDNA 1NHPA 2OALA 3URHA 2XFPA 2BACA 1N4VA 3NH3X 1E6EA 3NK0X 3R9UA 3UOZA 4ZN0A 2WEUA 2QCUA 1KF6A 2YLTA 3BI4A 3AEEA 3S61A 1L9EA 4KX6A 1Y56A 3D9XA 2BCGG 3NN0X 4OPGA 3ISHA 3SM8A 3NT6A 3AE3A 3EPTA 3FMWA 2R0CA 1PS9A 1TYPA 3SY4A 4H4XA 1P2EA 2GR2A 5IQ1A 5U63A 1B4VA 4NEVA 1KNPA 1OJDA 2WESA 3LOVA 3M13A 1GTEA 4GAVA 4I59A 4GCMA 1JU2A 1BZLA 4Z24A 1S7MA 3GD3A 2FJDA 2XFNA 4Y4LA 1GETA 1D5TA 3M0OA 3SGLA 2C66A 4AP1A 3L5OA 3RP7A 4B67A 2Z5YA 1GRTA 3VRBA 4MJWA 1PBBA 3IF9A 2ACZA 2GVCA 3CGCA 4YTMA 1QO8A 1LJ1A 5HYMA 1IJHA 5EOWA 2XYOA 3SQPA 2NVKX 5KMPA 3NYFA 2WDQA 4NTEA 2BABA 2XDOA 2OA1A 1GESA 2CULA 1GPEA 1F6MA 1VRQB 3SZCA 3NRNA 1DNCA 3QSEA 1GSNA 1GT8A 4UDPA 3T2YA 4CRTA 3ITJA 4B68A 4USRA 1NHQA 3NIXA 3SYIA 4EIPA 3KVEA 3DH9A 1FL2A 4Y4MA 3LADA 3IHMA 2YG3A 4J31A 4XXGA 2AQJA 1SEZA 4B1BA 2GQFA 4YKGA 3AE4A 4H50A 1MO9A 1S2QA 3ATRA 1BKWA 2RGJA 3RP6A 4J36A 1FEAA 4II2A 5KVHA 1TDKA 2BS2A 3KA7A 4C3YA 1B37A 2Q0KA 2VQBA 2BS4A 4GRTA 3SFDA 3UTHA 1LTXR 1IUWA 3GYJA 1BF3A 1Z6LA 3C4NA 2XVEA 2FJEA 3DJEA 4A99A 3CNDA 4U2SA 1UKVG 3DA1A 2APGA 1JNRA 1GRGA 3NN6X 3H8IA 4K2XA 1JRXA 2YVGA 4YXDA 4BJYA 1XHCA 3SZWA 3OZ2A 4Z2UA 1DXLA 1GERA 3RHAA 2B76A 4EIQA 2BYBA 3ZYXA 4U8JA 1KSSA 1ZP0A 1KNRA 4H7UA 4B66A 5BRTA 3FPZA 1DOEA 2YVJA 3GYIA 1EL5A 3UKHA 3CMMA 3AYLA 1PJ5A 4II3A 4JNQA 4NZHA 1TDEA 3UTGA 2BC0A 5JCNA 2GV8A 3AE6A 4JN9A 4X4JA 4CNJA 1ZMCA 2XVIA 4H4VA 2VQ7A 2BC1A 1GRFA 3HZLA 1EL8A 4OPCA 2CVJA 2R0PA 1ZOVA 4O5UA 1GRBA 1KDGA 1BWCA 2Q6UA 3QJ4A 1PBEA 1JRZA 3SZFA 4Y4NA 3T14A 4EMIA 2Y6RA 3AEDA 3BI2A 2B9YA 4JQ9A 1CL0A 4TM3A 2WDRA 4B65A 2XVFA 3CN8A 4H4YA 1KN0A 1MXTA 4YWOA 1PBDA 2GMJA 2WHDA 3LZWA 4DGKA 1RYIA 1NEKA 4ECHA 4NEWA 2XLPA 1M64A 2QA1A 2XLSA 3AEFA 3DGHA 3DJJA 2R4EA 4K5RA 5CQFA 1GALA 5HY5A 5CKUA 3D8XA 1E1LA 2BS3A 2WP6A 1NPXA 4H2NA 1D4DA 3EAOA 1O5WA 4K5SA 3ALLA 3AXBA 4WCTA 1LV0A 4A7AA 3FG2P 4FDCB 1COYA 4TLXA 2EQ6A 2IIDA 2JB2A 4GAPA 4IVMB 1V59A 2YG6A 2ZZ0A 1PXCA 1F8RA 4YT0A 5FS7A 3IWAA 1NG3A 3C4AA 3DJGX 2B7SA 2XVHA 2O9ZA 2XFOA 4U8MA 4EM3A 2AAQA 4Z43A 4H4QA 2BXSA 1Q1WA 3DK8A 1HYUA 3UKAA 4NWZA 2DKIA 2GQWA 4EMJA 2W0HA 4U8LA 3QFAA 1NG4A 5EB5A 3V3OA 3BNMA 1CF3A 1CC4A 1TRBA 5M10A 4TM4A 3VRAA 4DSHA 2AR8A 1TDNA 1ZMDA 2YM1A 2WPCA 3P9UA 2QA2A 3BHFA 2V3AA 1N4UA 1YY5A 4U2TA 4CNKA 3GWFA 3QVPA 1H7WA 4A79A 1TDOA 3ICRA 2OLNA 5FS9A 1DOCA 3CNJA 5KRQA 4HB9A 4C5OA 4IA6A 3S5WA 1PJ6A 4TLZA 1REOA 3REDA 4U2LA 3ZDNA 1OJAA 2XLUA 3AEBA 3I3LA 3Q9TA 5KNLA 4C77A 3GD4A 1JEHA 4EQRA 4YSHA 5J60A 3PS9A 1P2HA 1K0LA 4H2QA 1B5QA 3QSSA 3CTYA 1IUUA 3GRSA 1IUXA 5J7XA 4AOXA 2WU5A 3NTDA 4AOSA 4GDEA 3CNSA 3P1WA 3NK2X 3KKJA 4REKA 2C7GA 2R0GA 4UDQA 2JB1A 3UTEA 4J57A 2WOIA 1B8SA 5C2TA 3UOVA 1L0VA 4BK3A 4BURA 1F3PA 2X3NA 3M12A 1VG9A 3K30A 4H4ZA 3VRDB 3CPIG 2TPRA 3H4KA 1PBCA 4U8IA 5FS8A 3AD9B 1KFYA 2YG4A 3AWIA 4FK1C 3UKLA 4IV9A 4RSLA 3AE5A 3C96A 5L46A 3UCLA 5KMQA 5M0ZA 5KMSA 2BCPA 3CGEA 2NPXA 2VVLG 2X50A 4CCQA 3NG7X 4Z26A 2C73A 1ZK7A 1PBFA 1OJ9A 4EMWA 4ZCCA 2A87A 2ZZCA 1Y0PA 3PO7A 5KOWA 3BI5A 1LQUA 2FJAA 4Z2TA 4DNAA 1GV4A 3DGZA 3P4QA 4ZCDA 2C70A 2JBVA 4B63A 2WPFA 3GMBA 1AOGA 3DMEA 2R9ZA 2Z5XA 5C3JA 1YQZA 2FBWA 3AB1A 2Q0LA 3KU9A 2FJBA 2C64A 2B9XA 2JKCA 4H2RA 1GNDA 2X8HA 1L9DA 1YQ4A 4CCRA 2TMDA 1S3BA 1Q9IA 4RG3A 4YSXA 4EQXA 2ZZBA 3GWDA 3NYEA 2X99A 2A89A 5TR3A 3P4RA 4Z44A 1PN0A 3WE0A 2R4JA 2GEWA 3UOXA 4APNA 3AE9A 3LXDA 2X8CA 4H4TA 4LU6A 3UOYA 5EBKA 2C65A 2YG7A 4H4PA 1GOSA 2YR4A 1H84A 2DKHA 4XWRA 1MOKA 3V76A 3LZXA 4EM4A 1EL7A 1H2IA 2VRMA 1VDCA 3QVRA 3T2KA 4USQA 4G6GA 2VZ2A 2WP5A 5FMHA 4PABA 4ADWA 1S2YA 3NK1X 3OC4A 2V6OA 2H88A 5KVIA 4PAAA 1GRHA 4ICYA 3HYVA 4GDPA 4LA1A 1CHUA 4N9XA 2VVMA 2BRAA 3UKKA 1E1KA 4KPRA 3GMCA 2PYXA 4UP3A 3UTFA 4A5LA 2YLSA 4YTPA 3AEGA 1GXFA 1PXAA 4Z2RA 4CY6A 4H4UA 2BK4A 2J3NA 4JDRA 3UP5A 4A6NB 3AD7B 1GRAA 2QAEA 2XFQA 3SX6A 4OPUA 2HQMA 3AYJA 3IC9A 1TDFA 4J34A 2EQ9A 1K4QA 3AE7A 2GAGB 3GYXA 4WX1A 2XVJA 2YQUA 3AYIA 5KOXA 3P4PA 3L1RA 1NDAA 4JY2A 1OJTA 4K22A 1PDHA 3ATQA 1LVLA 2WDVA 3V3NA 1ZKQA 4NNJA 2C72A 4DSGA 3UKPA 3KLJA 4A6NA 3CGBA 2ZBWA 1K0JA 3FIMB 3B3RA 3ALJA 2XLRA 4UDRA 2GAHB 3T37A 5ER0A 1IUTA 3H8LA 3L8KA 2H89A 2GF3A 1NENA 1CC2A 3P4SA 4TM1A 4EQSA 2YG5A 3UP4A 3AE8A 1GTHA 3CGDA 2C3DA 2V5ZA 2X8GA 4GR1A 3K7TA 1QJDA 3ALMA 3KPKA 4OPIA 1FEBA 2OLOA 2PHHA 3II4A 4CY8A 1VG0A 2B9WA 3RP8A 1CJ2A 2IVEA 3G5QA 4OPTA 3AECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQW A;  3NTA A;  1H86 A;  3E1T A;  4O5Q A;  4D03 A;  2EQ7 A;  2Q7V A;  2WQY A;  2JB3 A;  4GUV A;  1XAN A;  4IA5 A;  4YSZ A;  1BGN A;  2WP9 A;  4H4W A;  1X31 B;  3QSM A;  1D4C A;  2WET A;  1DJN A;  5GSN A;  4M52 A;  2Y6Q A;  4H4S A;  1TYT A;  1E1M A;  2GR1 A;  3NHO X;  2UZZ A;  3I6D A;  3PVC A;  4BJZ A;  1PXB A;  4E0V A;  3UKF A;  2WBA A;  4U8P A;  3F8D A;  4Z25 A;  2CDU A;  2JAE A;  4J33 A;  1H6V A;  3CPH G;  2EQ8 A;  2BK5 A;  2V61 A;  2GMH A;  1FEC A;  2GH5 A;  4X9N A;  1Q1R A;  2RGO A;  3CNP A;  4X9M A;  5U1O A;  2C67 A;  4NTC A;  1NHS A;  1W4X A;  1L9C A;  3FBS A;  3VR8 A;  2YLR A;  4FK1 A;  1LQT A;  1JRY A;  4TM0 A;  2R45 A;  3COX A;  2GB0 A;  1CC6 A;  4FX9 A;  5FS6 A;  3RNM A;  4OCG A;  2YLZ A;  4A9W A;  2CFY A;  2XLT A;  4C3X A;  4U8K A;  1D7L A;  1EL9 A;  1QLB A;  1FCD A;  1DOD A;  3QFB A;  1XPQ A;  3NNE A;  3SFE A;  2R46 A;  1H81 A;  2GR3 A;  3NKS A;  2BXR A;  1D7Y A;  2WOV A;  3G5S A;  4YKF A;  1EBD A;  2C3C A;  4I58 A;  1GEU A;  1CJ3 A;  4J56 A;  2YLW A;  4AT0 A;  4BV6 A;  3Q6J A;  3GRT A;  2E1M A;  2ARD A;  3AE1 A;  1K0I A;  4B64 A;  1IUV A;  4U8N A;  1ONF A;  4JY3 A;  5BVA A;  5BUK A;  3CIR A;  2VRL A;  1IUS A;  1E39 A;  4B69 A;  5JCI A;  3ICS A;  3KPF A;  2V3B A;  2YAU A;  2YM2 A;  1PJ7 A;  3F8R A;  4JNA A;  1DJQ A;  4BK1 A;  1YKJ A;  1D4E A;  3D1C A;  5GRT A;  3GDP A;  2E5V A;  3KD9 A;  4YSY A;  2RGH A;  5KXJ A;  4NTD A;  1JOA A;  1RP0 A;  1KSU A;  1ZY8 A;  5HHF A;  4AP3 A;  4HA6 A;  5JCL A;  1DOB A;  1BGJ A;  2C75 A;  2YR6 A;  3CPJ G;  5DBJ A;  4AT2 A;  1H7X A;  3DK4 A;  1F8W A;  4H2P A;  4U8O A;  1LPF A;  4GF7 A;  5JCM A;  2V60 A;  2XCG A;  2A8X A;  5BUL A;  1OJC A;  2VOU A;  2GR0 A;  2YR5 A;  3K7Q X;  3B6D A;  4LII A;  3LB8 A;  4OPD A;  1JNZ A;  4OPL A;  2GRT A;  1ZX9 A;  2E4G A;  5U25 A;  3EAN A;  1N1P A;  4D04 A;  2VVL A;  2C76 A;  2YWL A;  3DJD A;  4RG4 A;  1PHH A;  1H83 A;  5KWF A;  3ICT A;  1FOH A;  2WPE A;  3NYC A;  1CJC A;  2I0Z A;  2XFU A;  4J2W A;  2YVF A;  3DK9 A;  3JSK A;  4OVI A;  3BNU A;  4CBQ A;  4XWZ A;  1ZDL A;  5JCK A;  3UKQ A;  2F5Z A;  3EF6 A;  1S3E A;  1NHR A;  2RAB A;  2BK3 A;  3IHG A;  2YLX A;  1ZOY A;  4YTN A;  4BK2 A;  2JK6 A;  3BHK A;  4A65 A;  1O95 A;  3GSI A;  3F8P A;  2B7R A;  1ELI A;  1RSG A;  3ADA B;  3G5R A;  3O0H A;  3LJP A;  3NGC X;  3CNT A;  5IQ4 A;  4K8D A;  4P9S A;  1N4W A;  1CJ4 A;  3AE2 A;  2IVD A;  1H82 A;  1E7P A;  4IVO B;  3VQR A;  2WS3 A;  2WOW A;  3K7M X;  3AD8 B;  4C74 A;  5IPY A;  3AEA A;  4H4R A;  2OAM A;  3NLC A;  2WU2 A;  1YQ3 A;  5HXI A;  5LV9 A;  1Y56 B;  1VQW A;  1E1N A;  2BA9 A;  1XDI A;  5EB4 A;  1CBO A;  1GRE A;  4K7Z A;  3VR9 A;  1M6I A;  1O94 A;  1F8S A;  3ABV A;  1NAA A;  3GDN A;  1NHP A;  2OAL A;  3URH A;  2XFP A;  2BAC A;  1N4V A;  3NH3 X;  1E6E A;  3NK0 X;  3R9U A;  3UOZ A;  4ZN0 A;  2WEU A;  2QCU A;  1KF6 A;  2YLT A;  3BI4 A;  3AEE A;  3S61 A;  1L9E A;  4KX6 A;  1Y56 A;  2BCG G;  3NN0 X;  4OPG A;  3ISH A;  3SM8 A;  3NT6 A;  3AE3 A;  3EPT A;  3FMW A;  2R0C A;  1PS9 A;  1TYP A;  4H4X A;  1P2E A;  2GR2 A;  5IQ1 A;  5U63 A;  1B4V A;  4NEV A;  1KNP A;  1OJD A;  2WES A;  3LOV A;  3M13 A;  1GTE A;  4I59 A;  4GCM A;  1JU2 A;  1BZL A;  4Z24 A;  3GD3 A;  2FJD A;  2XFN A;  4Y4L A;  1GET A;  1D5T A;  3M0O A;  3SGL A;  2C66 A;  4AP1 A;  3RP7 A;  4B67 A;  2Z5Y A;  1GRT A;  3VRB A;  4MJW A;  1PBB A;  3IF9 A;  2ACZ A;  2GVC A;  3CGC A;  4YTM A;  1QO8 A;  1LJ1 A;  5HYM A;  1IJH A;  5EOW A;  2XYO A;  3SQP A;  2NVK X;  3NYF A;  2WDQ A;  4NTE A;  2BAB A;  2XDO A;  2OA1 A;  1GES A;  2CUL A;  1GPE A;  1F6M A;  1VRQ B;  3NRN A;  1DNC A;  3QSE A;  1GSN A;  1GT8 A;  4UDP A;  4CRT A;  3ITJ A;  4B68 A;  4USR A;  1NHQ A;  3NIX A;  4EIP A;  3KVE A;  3DH9 A;  1FL2 A;  4Y4M A;  3LAD A;  3IHM A;  2YG3 A;  4J31 A;  4XXG A;  2AQJ A;  1SEZ A;  4B1B A;  2GQF A;  4YKG A;  3AE4 A;  4H50 A;  1MO9 A;  1S2Q A;  3ATR A;  1BKW A;  2RGJ A;  3RP6 A;  4J36 A;  1FEA A;  5KVH A;  1TDK A;  2BS2 A;  3KA7 A;  4C3Y A;  1B37 A;  2Q0K A;  2VQB A;  2BS4 A;  4GRT A;  3SFD A;  3UTH A;  1LTX R;  1IUW A;  3GYJ A;  1BF3 A;  1Z6L A;  3C4N A;  2XVE A;  2FJE A;  3DJE A;  4A99 A;  3CND A;  4U2S A;  1UKV G;  3DA1 A;  2APG A;  1JNR A;  1GRG A;  3NN6 X;  3H8I A;  4K2X A;  1JRX A;  2YVG A;  4YXD A;  4BJY A;  1XHC A;  3OZ2 A;  4Z2U A;  1DXL A;  1GER A;  3RHA A;  2B76 A;  4EIQ A;  2BYB A;  3ZYX A;  4U8J A;  1KSS A;  1ZP0 A;  1KNR A;  4H7U A;  4B66 A;  5BRT A;  3FPZ A;  1DOE A;  2YVJ A;  3GYI A;  1EL5 A;  3UKH A;  3AYL A;  1PJ5 A;  4JNQ A;  4NZH A;  1TDE A;  3UTG A;  2BC0 A;  5JCN A;  2GV8 A;  3AE6 A;  4JN9 A;  4X4J A;  4CNJ A;  1ZMC A;  2XVI A;  4H4V A;  2VQ7 A;  2BC1 A;  1GRF A;  3HZL A;  1EL8 A;  4OPC A;  2CVJ A;  2R0P A;  1ZOV A;  4O5U A;  1GRB A;  1KDG A;  1BWC A;  2Q6U A;  3QJ4 A;  1PBE A;  1JRZ A;  4Y4N A;  4EMI A;  2Y6R A;  3AED A;  3BI2 A;  2B9Y A;  4JQ9 A;  1CL0 A;  4TM3 A;  2WDR A;  4B65 A;  2XVF A;  3CN8 A;  4H4Y A;  1MXT A;  4YWO A;  1PBD A;  2GMJ A;  2WHD A;  3LZW A;  4DGK A;  1RYI A;  1NEK A;  4ECH A;  4NEW A;  2XLP A;  1M64 A;  2QA1 A;  2XLS A;  3AEF A;  3DGH A;  3DJJ A;  2R4E A;  4K5R A;  5CQF A;  1GAL A;  5HY5 A;  5CKU A;  3D8X A;  1E1L A;  2BS3 A;  2WP6 A;  1NPX A;  4H2N A;  1D4D A;  3EAO A;  1O5W A;  4K5S A;  3ALL A;  3AXB A;  4WCT A;  1LV0 A;  4A7A A;  3FG2 P;  4FDC B;  1COY A;  4TLX A;  2EQ6 A;  2IID A;  2JB2 A;  4IVM B;  1V59 A;  2YG6 A;  2ZZ0 A;  1PXC A;  1F8R A;  4YT0 A;  5FS7 A;  3IWA A;  1NG3 A;  3C4A A;  3DJG X;  2B7S A;  2XVH A;  2O9Z A;  2XFO A;  4U8M A;  4EM3 A;  2AAQ A;  4Z43 A;  4H4Q A;  2BXS A;  1Q1W A;  3DK8 A;  1HYU A;  3UKA A;  2DKI A;  2GQW A;  4EMJ A;  2W0H A;  4U8L A;  3QFA A;  1NG4 A;  5EB5 A;  3V3O A;  3BNM A;  1CF3 A;  1CC4 A;  1TRB A;  5M10 A;  4TM4 A;  3VRA A;  4DSH A;  2AR8 A;  1TDN A;  1ZMD A;  2YM1 A;  2WPC A;  3P9U A;  2QA2 A;  3BHF A;  1N4U A;  1YY5 A;  2V3A A;  4U2T A;  4CNK A;  3GWF A;  3QVP A;  1H7W A;  4A79 A;  1TDO A;  3ICR A;  2OLN A;  5FS9 A;  1DOC A;  3CNJ A;  5KRQ A;  4HB9 A;  4C5O A;  4IA6 A;  3S5W A;  1PJ6 A;  4TLZ A;  1REO A;  3RED A;  4U2L A;  3ZDN A;  1OJA A;  2XLU A;  3AEB A;  3I3L A;  3Q9T A;  4C77 A;  3GD4 A;  1JEH A;  4EQR A;  4YSH A;  5J60 A;  3PS9 A;  1P2H A;  1K0L A;  4H2Q A;  1B5Q A;  3QSS A;  3CTY A;  1IUU A;  3GRS A;  1IUX A;  5J7X A;  4AOX A;  2WU5 A;  3NTD A;  4AOS A;  4GDE A;  3CNS A;  3P1W A;  3NK2 X;  3KKJ A;  4REK A;  2C7G A;  2R0G A;  4UDQ A;  2JB1 A;  3UTE A;  4J57 A;  2WOI A;  1B8S A;  5C2T A;  3UOV A;  1L0V A;  4BK3 A;  4BUR A;  1F3P A;  2X3N A;  3M12 A;  1VG9 A;  3K30 A;  4H4Z A;  3VRD B;  3CPI G;  2TPR A;  3H4K A;  1PBC A;  4U8I A;  5FS8 A;  3AD9 B;  1KFY A;  2YG4 A;  3AWI A;  4FK1 C;  3UKL A;  4IV9 A;  4RSL A;  3AE5 A;  3C96 A;  5L46 A;  3UCL A;  5M0Z A;  2BCP A;  3CGE A;  2NPX A;  2VVL G;  2X50 A;  4CCQ A;  3NG7 X;  4Z26 A;  2C73 A;  1ZK7 A;  1PBF A;  1OJ9 A;  4EMW A;  4ZCC A;  2A87 A;  2ZZC A;  1Y0P A;  3PO7 A;  5KOW A;  3BI5 A;  1LQU A;  2FJA A;  4Z2T A;  4DNA A;  1GV4 A;  3DGZ A;  3P4Q A;  4ZCD A;  2C70 A;  2JBV A;  4B63 A;  2WPF A;  3GMB A;  1AOG A;  3DME A;  2R9Z A;  2Z5X A;  5C3J A;  1YQZ A;  2FBW A;  3AB1 A;  2Q0L A;  3KU9 A;  2FJB A;  2C64 A;  2B9X A;  2JKC A;  4H2R A;  1GND A;  2X8H A;  1L9D A;  1YQ4 A;  4CCR A;  2TMD A;  1S3B A;  1Q9I A;  4RG3 A;  4YSX A;  4EQX A;  2ZZB A;  3GWD A;  3NYE A;  2X99 A;  2A89 A;  5TR3 A;  3P4R A;  4Z44 A;  1PN0 A;  3WE0 A;  2R4J A;  2GEW A;  3UOX A;  4APN A;  3AE9 A;  3LXD A;  2X8C A;  4H4T A;  4LU6 A;  3UOY A;  5EBK A;  2C65 A;  2YG7 A;  4H4P A;  1GOS A;  2YR4 A;  1H84 A;  2DKH A;  4XWR A;  1MOK A;  3V76 A;  3LZX A;  4EM4 A;  1EL7 A;  2VRM A;  1VDC A;  3QVR A;  4USQ A;  2VZ2 A;  2WP5 A;  5FMH A;  4PAB A;  4ADW A;  1S2Y A;  3NK1 X;  3OC4 A;  2V6O A;  2H88 A;  5KVI A;  4PAA A;  1GRH A;  4ICY A;  4GDP A;  4LA1 A;  1CHU A;  4N9X A;  2VVM A;  3UKK A;  1E1K A;  4KPR A;  3GMC A;  2PYX A;  4UP3 A;  3UTF A;  4A5L A;  2YLS A;  4YTP A;  3AEG A;  1GXF A;  1PXA A;  4Z2R A;  4CY6 A;  4H4U A;  2BK4 A;  2J3N A;  4JDR A;  3UP5 A;  4A6N B;  3AD7 B;  1GRA A;  2QAE A;  2XFQ A;  4OPU A;  2HQM A;  3AYJ A;  3IC9 A;  1TDF A;  4J34 A;  2EQ9 A;  1K4Q A;  3AE7 A;  2GAG B;  4WX1 A;  2XVJ A;  2YQU A;  3AYI A;  5KOX A;  3P4P A;  3L1R A;  1NDA A;  4JY2 A;  1OJT A;  4K22 A;  1PDH A;  3ATQ A;  1LVL A;  2WDV A;  3V3N A;  1ZKQ A;  2C72 A;  4DSG A;  3UKP A;  3KLJ A;  4A6N A;  3CGB A;  2ZBW A;  1K0J A;  3FIM B;  3B3R A;  3ALJ A;  2XLR A;  4UDR A;  2GAH B;  3T37 A;  5ER0 A;  1IUT A;  3H8L A;  3L8K A;  2H89 A;  2GF3 A;  1NEN A;  1CC2 A;  3P4S A;  4TM1 A;  4EQS A;  2YG5 A;  3UP4 A;  3AE8 A;  1GTH A;  3CGD A;  2C3D A;  2V5Z A;  2X8G A;  4GR1 A;  3K7T A;  1QJD A;  3ALM A;  4OPI A;  1FEB A;  2OLO A;  2PHH A;  3II4 A;  4CY8 A;  1VG0 A;  2B9W A;  3RP8 A;  1CJ2 A;  2IVE A;  3G5Q A;  4OPT A;  3AEC A; 
#chains in the Genus database with same CATH topology
 4D03 A;  2EQ7 A;  2C4C A;  2WP9 A;  1DJN A;  5GSN A;  1E1M A;  2UZZ A;  3PVC A;  2WBA A;  3T2Z A;  3F8D A;  2OX4 A;  4Z25 A;  1T3Q C;  2JAE A;  3A7R A;  4GGB A;  1Q1R A;  1IYX A;  1NHS A;  1P43 A;  3VR8 A;  4FK1 A;  4TM0 A;  2R45 A;  3T31 A;  3RNM A;  3NRZ B;  2AKZ A;  2MUC A;  3RRA A;  3STP A;  2WOV A;  3G5S A;  1PDZ A;  3MZN A;  4BV6 A;  2E1M A;  3UCD A;  3ZLF A;  1IUV A;  4U8N A;  4JY3 A;  1IUS A;  3AN1 A;  2YAU A;  1D4E A;  2GGI A;  2RGH A;  1JOA A;  4HCL A;  1RP0 A;  4HA6 A;  2C75 A;  4E4U A;  5DBJ A;  4AT2 A;  4EWJ A;  5JCM A;  2V60 A;  3R10 A;  2XCG A;  2OQY A;  2VOU A;  2YR5 A;  2GR0 A;  4H83 A;  3K7Q X;  5FJO A;  4OPL A;  1JNZ A;  3V5C A;  2C76 A;  4RG4 A;  3DJD A;  1PHH A;  2WPE A;  1CJC A;  2YVF A;  3UKQ A;  5KMR A;  4MMW A;  1S3E A;  1OEP A;  2BK3 A;  5FJT A;  3F8P A;  2B7R A;  3N4F A;  4IVO B;  3VQR A;  2WOW A;  3SSZ A;  3SXI A;  5HXI A;  1E1N A;  2BA9 A;  5EB4 A;  1CBO A;  1GRE A;  4K7Z A;  2PP3 A;  3ABV A;  1NAA A;  4E8G A;  3MSY A;  1E6E A;  1DTN A;  3QN3 A;  5BOF A;  2QCU A;  3UJF A;  1ELS A;  3AEE A;  3NN0 X;  3ISH A;  2W55 A;  3SM8 A;  1TYP A;  4H4X A;  1KNP A;  2WES A;  3SGL A;  2C66 A;  4AP1 A;  3L5O A;  1PBB A;  4DXK A;  2ACZ A;  1IJH A;  5EOW A;  3OZY A;  3SQP A;  3PK7 A;  2XDO A;  3VFC A;  4UDP A;  3ENL A;  4B68 A;  3SYI A;  4ZCW A;  4B1B A;  3RP6 A;  2P0I A;  1FEA A;  5KVH A;  2BS4 A;  1IUW A;  3GYJ A;  3C4N A;  2FJE A;  2ZC8 A;  4DHG A;  2OZ3 A;  4Z2U A;  5BRT A;  3FPZ A;  3GYI A;  3UKH A;  4NZH A;  3UTG A;  5JCN A;  3AE6 A;  4CNJ A;  4JN9 A;  1EL8 A;  4OPC A;  3T9P A;  4O5U A;  2Q6U A;  1PBE A;  3I4K A;  1CL0 A;  2WDR A;  1KN0 A;  3JVA A;  1PBD A;  2WHD A;  3S47 A;  2XLS A;  3KUM A;  3AEF A;  3DGH A;  5CQF A;  1GAL A;  5HY5 A;  3VDG A;  5CKU A;  1E1L A;  3NXL A;  1D4D A;  3EAO A;  1O5W A;  4TLX A;  4GAP A;  1PXC A;  5FS7 A;  1NG3 A;  2XFO A;  4H4Q A;  3DK8 A;  1HYU A;  3UKA A;  1RVK A;  2DKI A;  2GQW A;  2W0H A;  3QFA A;  1CF3 A;  1L8P A;  4DYE A;  5M10 A;  1RM6 B;  3NZG A;  1TDN A;  4GME A;  2V3A A;  1SJC A;  3N4E A;  3QVP A;  3ICR A;  5KRQ A;  4HB9 A;  4C5O A;  4IA6 A;  3S5W A;  3CYJ A;  1REO A;  3GD4 A;  2GGH A;  3A7U A;  3CTY A;  2DW6 A;  3GRS A;  3NTD A;  3CNS A;  3AMZ A;  2R0G A;  4UDQ A;  2JB1 A;  3UTE A;  3UOV A;  3SN0 A;  4BK3 A;  1VG9 A;  1EC8 A;  3Q4D A;  4IV9 A;  4ZOH B;  3C96 A;  5KMS A;  2X50 A;  4CCQ A;  2C73 A;  4ZCC A;  1ECQ A;  2XGZ A;  1MDR A;  2C70 A;  3FCP A;  2FBW A;  3AB1 A;  3H12 A;  4JHM A;  2B9X A;  3P3B A;  3QKE A;  4CCR A;  1Q9I A;  2ZZB A;  3GWD A;  5TR3 A;  3P4R A;  3CXB A;  3WE0 A;  4G8T A;  2GEW A;  3VC5 A;  3AE9 A;  3EUB 3;  4H1Z A;  2X8C A;  5EBK A;  3OTR A;  2C65 A;  1GOS A;  2P88 A;  4XWR A;  3TJI A;  3T2K A;  4PAB A;  4ADW A;  3NK1 X;  3OC4 A;  1GRH A;  4LA1 A;  1CHU A;  3GMC A;  1GXF A;  2OPJ A;  1PXA A;  1GRA A;  2XFQ A;  4OPU A;  3AYJ A;  3P93 A;  1K4Q A;  2GAG B;  2XVJ A;  3P4P A;  3L1R A;  3V3N A;  1LVL A;  2OQH A;  2WDV A;  1ZKQ A;  3UXK A;  3QLD A;  3B3R A;  5ER0 A;  1N61 C;  1NEN A;  1YEY A;  4TM1 A;  3UP4 A;  2X8G A;  2PU1 A;  3KPK A;  4OPI A;  2PSN A;  1H86 A;  4GUV A;  4IA5 A;  4YSZ A;  3QSM A;  3ZVH A;  4ROP A;  4H4S A;  2GR1 A;  2W3R A;  1N62 C;  4BJZ A;  3T8Q A;  3CXO A;  4J33 A;  3CPH G;  1NEL A;  2BK5 A;  2V61 A;  3SZ0 A;  2GH5 A;  1WYG A;  3CAW A;  4FX9 A;  1N63 C;  4G74 A;  2XLT A;  1D7L A;  1EL9 A;  5FJR A;  3NNE A;  2XH0 A;  2C3C A;  4AT0 A;  3ETR B;  3GRT A;  2OO6 A;  3CIR A;  3ICS A;  3KPF A;  2V3B A;  2YM2 A;  4GYP C;  3D1C A;  3GDP A;  4YSY A;  2E5V A;  5KXJ A;  4IL2 A;  5JCL A;  3BJS A;  1BGJ A;  1F8W A;  4U8O A;  1LPF A;  2A8X A;  3CB3 A;  5BUL A;  3B6D A;  3LB8 A;  2GRT A;  1ZX9 A;  5U25 A;  3EAN A;  2YWL A;  4KEM A;  2XFU A;  3DK9 A;  4OVI A;  3NO1 A;  3BNU A;  4XWZ A;  3EF6 A;  3IHG A;  2JK6 A;  1ELI A;  3CNT A;  4K8D A;  4P9S A;  1CJ4 A;  2IVD A;  4MGG A;  1H82 A;  4C74 A;  3AD8 B;  5IPY A;  4H4R A;  3MUC A;  3I6T A;  3PG6 A;  5LV9 A;  1XDI A;  2W54 A;  1F8S A;  4A3R A;  2XFP A;  4GIR A;  2BAC A;  3UOZ A;  4HPN A;  3R9U A;  1FHU A;  2YLT A;  3BI4 A;  4KX6 A;  1Y56 A;  3D9X A;  4E6M A;  4OPG A;  3NT6 A;  4M0X A;  3EPT A;  3RIT A;  5IQ1 A;  5U63 A;  1B4V A;  3LOV A;  4I59 A;  1BZL A;  4Z24 A;  1D5T A;  3RP7 A;  4B67 A;  1GRT A;  3IF9 A;  3CGC A;  3TW9 A;  5HYM A;  2XYO A;  4YWS A;  2OKT A;  3DES A;  1GPE A;  1VRQ B;  3SZC A;  3NRN A;  3FV9 A;  3ITJ A;  6ENL A;  3MQT A;  3DH9 A;  3SR6 B;  4Y4M A;  3UXL A;  2AQJ A;  1SEZ A;  4H50 A;  1MO9 A;  1S2Q A;  3ATR A;  1BKW A;  2RGJ A;  4J36 A;  2BS2 A;  2VQB A;  2QVH A;  1EBH A;  4A99 A;  3UJR A;  4U2S A;  3UGV A;  1JNR A;  1N5W C;  1SJD A;  3NN6 X;  3H8I A;  2AL2 A;  1E9I A;  2PTY A;  3SZW A;  3RHA A;  3OZM A;  4H7U A;  4IP5 A;  1DOE A;  1EL5 A;  2NQL A;  2OFJ A;  1P48 A;  1ZMC A;  2XVI A;  4H4V A;  2BC1 A;  1GRF A;  3HZL A;  1KDG A;  3QJ4 A;  3SZF A;  2GL5 A;  2Y6R A;  3AED A;  3TJ4 A;  1EBG A;  4B65 A;  4H4Y A;  2GMJ A;  1RYI A;  4NEW A;  2XLP A;  1M64 A;  3SBF A;  3DJJ A;  3S5S A;  2BS3 A;  2WP6 A;  1XS2 A;  3NVW B;  3ALL A;  4DN1 A;  3AXB A;  1LV0 A;  4A7A A;  2OZT A;  3FG2 P;  4FDC B;  2JB2 A;  4IVM B;  1V59 A;  2ZZ0 A;  4YT0 A;  3IWA A;  3VCN A;  2B7S A;  1JCT A;  2XVH A;  4U8M A;  2AAQ A;  4Z43 A;  2BXS A;  1Q1W A;  4NWZ A;  4U8L A;  1R6W A;  3VRA A;  2AR8 A;  1ZMD A;  3DDM A;  2YM1 A;  2QA2 A;  1N4U A;  4U2T A;  4CNK A;  3VA8 A;  4A79 A;  1TDO A;  2OLN A;  1DOC A;  3CNJ A;  4IL0 A;  4TLZ A;  4U2L A;  3OPS A;  3ZDN A;  3AEB A;  3I3L A;  5KNL A;  1JEH A;  1P2H A;  1K0L A;  4H2Q A;  3TOY A;  4GDE A;  3EKG A;  1B8S A;  2X3N A;  3QPE A;  4ZA0 A;  3VRD B;  1PBC A;  2GSH A;  3AD9 B;  3BSM A;  5L46 A;  3UCL A;  1ONE A;  2BCP A;  2XH7 A;  3HW2 A;  5FJU A;  1ZK7 A;  4EMW A;  2A87 A;  3PO7 A;  5G5H B;  2FJA A;  1GV4 A;  4ZCD A;  3NFU A;  2WPF A;  1AOG A;  3DEQ A;  2OZ8 A;  2HNE A;  2Q0L A;  4H2R A;  4E4F A;  1L9D A;  4RG3 A;  4EQX A;  3R07 C;  2R4J A;  3UOY A;  3RCY A;  3V76 A;  3LZX A;  1EL7 A;  2VRM A;  3QVR A;  3DGB A;  5FMH A;  2H88 A;  4ICY A;  5BOE A;  2I5Q A;  3UTF A;  2YLS A;  3B9J B;  4CY6 A;  4H4U A;  2J3N A;  4JDR A;  3UP5 A;  3SX6 A;  3IC9 A;  1TDF A;  3AYI A;  3JW7 A;  4GGH A;  1PDH A;  3ATQ A;  1R0M A;  4DSG A;  4A6N A;  3CGB A;  1K0J A;  3T37 A;  3L8K A;  2H89 A;  4EQS A;  3AE8 A;  3CGD A;  2C3D A;  3K7T A;  3ALM A;  1FEB A;  3ZVH B;  2OLO A;  3II4 A;  1VG0 A;  2P8C A;  2IVE A;  3G5Q A;  4OPT A;  4EQW A;  3NTA A;  3HYW A;  3NS1 B;  5JRB A;  2Q7V A;  2PTZ A;  4H4W A;  5EU9 A;  1JDF A;  4M52 A;  1BKH A;  3UKF A;  4G7F A;  4FP1 A;  1FEC A;  2GMH A;  4X9N A;  2RGO A;  4X9M A;  3CNP A;  5U1O A;  2C67 A;  1L9C A;  2YLR A;  1LQT A;  4HCD A;  3COX A;  5FS6 A;  2YLZ A;  4A9W A;  2CFY A;  1QLB A;  1FCD A;  1XPQ A;  2GR3 A;  3SN1 A;  4I58 A;  1GEU A;  3RR1 A;  2OVL A;  1CJ3 A;  4J56 A;  4B64 A;  1ONF A;  3UCC A;  1E39 A;  1FIQ B;  1MUC A;  1PJ7 A;  3DG6 A;  4JNA A;  2PTX A;  1TKK A;  1WUF A;  5GRT A;  1KSU A;  1ZY8 A;  5HHF A;  4AP3 A;  3GC2 A;  1DOB A;  2YR6 A;  3CPJ G;  3UJS A;  2QGY A;  2CHR A;  4H2P A;  1OJC A;  2AL1 A;  4LII A;  4OPD A;  2E5A A;  3R11 A;  4J2W A;  5JCK A;  4G9K A;  2RAB A;  4GIS A;  4BK2 A;  1RSG A;  3FJ4 A;  3O0H A;  3LJP A;  3NGC X;  1N4W A;  2GGE A;  1X2H A;  3CK5 A;  3K7M X;  3DG7 A;  1YQ3 A;  1Y56 B;  1VQW A;  1FHV A;  1M6I A;  2MNR A;  3ZVI A;  3NH3 X;  1N4V A;  3NK0 X;  4ZN0 A;  4J1O A;  2WEU A;  3S61 A;  1L9E A;  3FVD A;  3AE3 A;  3MKC A;  3SY4 A;  1P2E A;  4NEV A;  4A6G A;  1JU2 A;  1KKO A;  1S7M A;  2XFN A;  3M0O A;  1ZXI C;  2Z5Y A;  3VRB A;  4MJW A;  4YTM A;  1PDY A;  2NVK X;  3NYF A;  2WDQ A;  4NTE A;  2BAB A;  2OA1 A;  4GFI A;  2CUL A;  3I6E A;  3QSE A;  2QDD A;  1GT8 A;  1NHQ A;  1TE6 A;  2AKM A;  1MRA A;  3LAD A;  4J31 A;  3AE4 A;  1TZZ A;  4K2S A;  2AL2 B;  4C3Y A;  2Q0K A;  1LTX R;  1BF3 A;  3IJQ A;  1UKV G;  3THU A;  2XSX A;  2APG A;  1GRG A;  3A7A A;  1JRX A;  4YXD A;  3IJL A;  1XHC A;  4GYP A;  1DXL A;  1GER A;  3ZYX A;  4B66 A;  1KNR A;  3NVY B;  3CMM A;  3OP2 A;  3AYL A;  4DWD A;  1TDE A;  3T6C A;  2BC0 A;  2PP0 A;  1ZOV A;  1BWC A;  3RGT A;  3VCC A;  4Y4N A;  3PFR A;  4EMI A;  3T14 A;  4TM3 A;  3CN8 A;  1MXT A;  4DGK A;  3NVV B;  4ECH A;  3ZLG A;  4JN8 A;  2QA1 A;  2R4E A;  3DFH A;  1NPX A;  4K5S A;  4WCT A;  1VDV A;  3VC6 A;  3AM9 A;  3R0U A;  2DW7 A;  1SJB A;  1F8R A;  2PP1 A;  3DJG X;  2O9Z A;  4EM3 A;  2XH4 A;  1TRB A;  2ZAD A;  1JPM A;  3P9U A;  2QJN A;  4J3Z A;  3K1G A;  1H7W A;  3RED A;  4MKS A;  3Q9T A;  4C77 A;  3DG3 A;  4EQR A;  5J60 A;  2E3T A;  1IUU A;  5J7X A;  2OG9 A;  4KWS A;  2WU5 A;  4AOX A;  3RO6 A;  3P1W A;  3NK2 X;  4REK A;  5C2T A;  4BUR A;  3M12 A;  1VQZ A;  3CPI G;  2TPR A;  3H4K A;  4U8I A;  5FS8 A;  1KFY A;  2YG4 A;  3AWI A;  4FK1 C;  3UKL A;  3JZU A;  4HYR A;  3AE5 A;  5KMQ A;  5M0Z A;  3CGE A;  3PWG A;  2VVL G;  3NG7 X;  4KPL A;  1PBF A;  1EC7 A;  4HNL A;  2ZZC A;  5KOW A;  3BI5 A;  3DGZ A;  3TTE A;  3P4Q A;  3TWA A;  5C3J A;  2PGW A;  3FXG A;  2RDX A;  2JKC A;  2X8H A;  1YQ4 A;  2TMD A;  2PCE A;  3R1Z A;  4Z44 A;  4IP4 A;  2HZG A;  1PN0 A;  2PS2 A;  4HCH A;  1W6T A;  4H2H A;  3LXD A;  4HNC A;  4LU6 A;  2YG7 A;  4H4P A;  2HXT A;  2YR4 A;  4EM4 A;  4DX3 A;  1XPY A;  2QJJ A;  5J04 A;  2WP5 A;  1S2Y A;  2V6O A;  5KVI A;  3HYV A;  4GDP A;  2BRA A;  3ES8 A;  2PYX A;  4UP3 A;  4YTP A;  3AEG A;  2BK4 A;  4A6N B;  2QAE A;  2HQM A;  2EQ9 A;  3AE7 A;  3SQS A;  3GYX A;  5KOX A;  1X2G A;  1OJT A;  1SJA A;  3IK4 A;  3FIM B;  3B97 A;  2XLR A;  1IUT A;  1MDL A;  3H70 A;  2GF3 A;  3N6J A;  3GO2 A;  1CC2 A;  2QQ6 A;  3P4S A;  2P3Z A;  5FJP A;  1GTH A;  3TCS A;  2ONE A;  4GR1 A;  4X2P A;  2PHH A;  4CY8 A;  2B9W A;  3RP8 A;  1JPD X;  3E1T A;  4TVW A;  4O5Q A;  3UJ2 A;  2WQY A;  2JB3 A;  1XAN A;  1BGN A;  2PPG A;  1X31 B;  1D4C A;  2WET A;  3V3W A;  2Y6Q A;  1TYT A;  3NHO X;  3T0K A;  3I6D A;  1PXB A;  4E0V A;  3HRD C;  4U8P A;  2GDQ A;  2CDU A;  1H6V A;  2EQ8 A;  4NTC A;  1W4X A;  1MNS A;  3FBS A;  3OW1 A;  1JRY A;  2GB0 A;  3R0K A;  1CC6 A;  4C3X A;  4OCG A;  4U8K A;  1DOD A;  3QFB A;  3SFE A;  2R46 A;  1H81 A;  3NKS A;  2BXR A;  1D7Y A;  4YKF A;  1EBD A;  4G73 A;  2YLW A;  3Q6J A;  2BRY A;  2ARD A;  3AE1 A;  1K0I A;  4JN7 A;  5BVA A;  5BUK A;  2VRL A;  4B69 A;  5JCI A;  3F8R A;  1DJQ A;  4BK1 A;  1YKJ A;  1KD0 A;  1N5X A;  3KD9 A;  4NTD A;  3U4F A;  3HPF A;  3TQP A;  4G6H A;  1H7X A;  3DK4 A;  4GF7 A;  1F9C A;  2PMQ A;  2PTW A;  2P8B A;  4F4R A;  3D46 A;  2E4G A;  1N1P A;  4D04 A;  3DER A;  2VVL A;  1H83 A;  5KWF A;  3ICT A;  1FOH A;  4FI4 A;  3U9I A;  3MY9 A;  3NYC A;  2I0Z A;  3JSK A;  3HYX A;  4CBQ A;  1FFU C;  1ZDL A;  2F5Z A;  1NHR A;  2YLX A;  1ZOY A;  4YTN A;  3BHK A;  4A65 A;  1O95 A;  3GSI A;  1EC9 A;  4K8G A;  3ADA B;  3G5R A;  5IQ4 A;  4HN8 A;  3AE2 A;  1E7P A;  2WS3 A;  3AEA A;  3NLC A;  2OAM A;  3ES7 A;  2WU2 A;  3V4B A;  3VR9 A;  1O94 A;  3GDN A;  3GD6 A;  1NHP A;  2OAL A;  3URH A;  1KF6 A;  2BCG G;  3FMW A;  2R0C A;  1PS9 A;  2GR2 A;  2W3S A;  1OJD A;  3M13 A;  1GTE A;  4GAV A;  4GCM A;  3GD3 A;  2FJD A;  3Q45 A;  4Y4L A;  1GET A;  3DFY A;  3T4W A;  2GVC A;  1QO8 A;  3R25 A;  1LJ1 A;  1KKR A;  5KMP A;  2HXU A;  1GES A;  4H19 A;  1F6M A;  1DNC A;  1GSN A;  3T2Y A;  4CRT A;  1FFV C;  4USR A;  1STZ A;  3NIX A;  4EIP A;  3EEZ A;  3KVE A;  1FL2 A;  3IHM A;  2YG3 A;  4XXG A;  2GQF A;  4YKG A;  4A35 A;  5G5G B;  2FYM A;  4II2 A;  3BOX A;  1TDK A;  3KA7 A;  1B37 A;  4Z1Y A;  4GRT A;  3SFD A;  3UTH A;  1Z6L A;  2GGJ A;  2XVE A;  3DJE A;  3CND A;  3DA1 A;  4K2X A;  2YVG A;  1FO4 A;  4BJY A;  3OZ2 A;  3SN4 A;  2B76 A;  4EIQ A;  1V97 A;  2BYB A;  2PA6 A;  1KSS A;  1ZP0 A;  4U8J A;  2YVJ A;  1PJ5 A;  4II3 A;  4JNQ A;  2POZ A;  2GV8 A;  4X4J A;  2VQ7 A;  2CVJ A;  2R0P A;  4KT2 A;  1GRB A;  1JRZ A;  4TVY A;  2PU0 A;  3BI2 A;  2B9Y A;  4JQ9 A;  2XVF A;  3H8A A;  4YWO A;  3LZW A;  3GY1 A;  1NEK A;  1JRP A;  4K5R A;  4IT1 A;  3D8X A;  2QDE A;  3CT2 A;  4H2N A;  1N60 C;  1COY A;  2EQ6 A;  2IID A;  2YG6 A;  3UJE A;  3C4A A;  2FKP A;  4EMJ A;  5EB5 A;  3V3O A;  1NG4 A;  3BNM A;  1CC4 A;  4TM4 A;  4DSH A;  2WPC A;  3BHF A;  1YY5 A;  3GWF A;  4K1W A;  4IZG A;  4Z17 A;  5FS9 A;  1SB3 B;  1PJ6 A;  1OJA A;  2XLU A;  1JRO A;  4YSH A;  3PS9 A;  1B5Q A;  3N6H A;  3QSS A;  4E5T A;  1IUX A;  4AOS A;  3KKJ A;  2C7G A;  3H7V A;  4J57 A;  2WOI A;  3SJN A;  1L0V A;  7ENL A;  1F3P A;  3K30 A;  4H4Z A;  4ENL A;  2OLA A;  4IHC A;  3D47 A;  3MWC A;  3FYY A;  2XH2 A;  4RSL A;  3PWI A;  2PGE A;  2NPX A;  4Z26 A;  1OJ9 A;  1Y0P A;  1LQU A;  4Z2T A;  4DNA A;  4B63 A;  2JBV A;  3GMB A;  3DME A;  2R9Z A;  3ZLH A;  2Z5X A;  1YQZ A;  1KCZ A;  3KU9 A;  2FJB A;  2POD A;  2C64 A;  3NVZ B;  1GND A;  3QTP A;  1S3B A;  4YSX A;  1BQG A;  3NYE A;  2X99 A;  2A89 A;  3P0W A;  3UOX A;  4APN A;  3TWB A;  4H4T A;  5IDZ A;  1H84 A;  2DKH A;  1MOK A;  1H2I A;  1VDC A;  4USQ A;  4G6G A;  2VZ2 A;  2QJM A;  4PAA A;  4N9X A;  1NU5 A;  2GGG A;  2VVM A;  3UKK A;  1E1K A;  4KPR A;  4A5L A;  4M6U A;  4Z2R A;  3AD7 B;  4J34 A;  3IJI A;  4WX1 A;  2YQU A;  3DIP A;  4JY2 A;  1NDA A;  4K22 A;  4NNJ A;  2C72 A;  3UKP A;  3KLJ A;  2O56 A;  2ZBW A;  3ALJ A;  4UDR A;  2GAH B;  1WUE A;  3H8L A;  2YG5 A;  5ENL A;  3V5F A;  2V5Z A;  1QJD A;  1CJ2 A;  3AEC A; 
#chains in the Genus database with same CATH homology
 4EQW A;  3NTA A;  3HYW A;  1H86 A;  3E1T A;  4O5Q A;  4D03 A;  5JRB A;  2EQ7 A;  2Q7V A;  2WQY A;  2JB3 A;  4GUV A;  1XAN A;  2C4C A;  4IA5 A;  4YSZ A;  1BGN A;  2WP9 A;  4H4W A;  1X31 B;  3QSM A;  1D4C A;  2WET A;  1DJN A;  5GSN A;  4M52 A;  2Y6Q A;  4H4S A;  1TYT A;  1E1M A;  2GR1 A;  3NHO X;  3T0K A;  2UZZ A;  3I6D A;  3PVC A;  4BJZ A;  1PXB A;  4E0V A;  3UKF A;  2WBA A;  3T2Z A;  4U8P A;  3F8D A;  4Z25 A;  2CDU A;  2JAE A;  4J33 A;  1H6V A;  3CPH G;  2EQ8 A;  2BK5 A;  2V61 A;  2GMH A;  1FEC A;  2GH5 A;  4X9N A;  1Q1R A;  2RGO A;  3CNP A;  4X9M A;  5U1O A;  2C67 A;  4NTC A;  1NHS A;  1W4X A;  1L9C A;  3FBS A;  3VR8 A;  2YLR A;  4FK1 A;  1LQT A;  1JRY A;  4TM0 A;  2R45 A;  3COX A;  2GB0 A;  1CC6 A;  4FX9 A;  3T31 A;  5FS6 A;  3RNM A;  4G74 A;  2YLZ A;  4OCG A;  2CFY A;  2XLT A;  4A9W A;  4C3X A;  4U8K A;  1D7L A;  1EL9 A;  1QLB A;  1FCD A;  1DOD A;  3QFB A;  1XPQ A;  3NNE A;  3SFE A;  2R46 A;  1H81 A;  2GR3 A;  3NKS A;  2BXR A;  1D7Y A;  2WOV A;  3G5S A;  4YKF A;  1EBD A;  2C3C A;  4G73 A;  1GEU A;  4I58 A;  1CJ3 A;  4J56 A;  2YLW A;  4AT0 A;  4BV6 A;  3Q6J A;  3GRT A;  2BRY A;  2ARD A;  2E1M A;  3AE1 A;  1K0I A;  4B64 A;  1IUV A;  4U8N A;  1ONF A;  4JY3 A;  5BVA A;  5BUK A;  3CIR A;  2VRL A;  1IUS A;  1E39 A;  4B69 A;  5JCI A;  3ICS A;  3KPF A;  2V3B A;  2YAU A;  2YM2 A;  1PJ7 A;  3F8R A;  4JNA A;  1DJQ A;  4BK1 A;  1YKJ A;  1D4E A;  3D1C A;  5GRT A;  3GDP A;  2E5V A;  3KD9 A;  4YSY A;  2RGH A;  5KXJ A;  4NTD A;  1JOA A;  1RP0 A;  1KSU A;  1ZY8 A;  5HHF A;  4AP3 A;  4HA6 A;  5JCL A;  1DOB A;  1BGJ A;  2C75 A;  2YR6 A;  3CPJ G;  5DBJ A;  4G6H A;  4AT2 A;  1H7X A;  3DK4 A;  1F8W A;  4H2P A;  4U8O A;  1LPF A;  4GF7 A;  5JCM A;  2V60 A;  2XCG A;  2A8X A;  5BUL A;  3SZ0 A;  1OJC A;  2VOU A;  2GR0 A;  2YR5 A;  3K7Q X;  3B6D A;  4LII A;  3LB8 A;  4OPD A;  1JNZ A;  4OPL A;  2GRT A;  1ZX9 A;  2E4G A;  5U25 A;  3EAN A;  1N1P A;  4D04 A;  2VVL A;  2C76 A;  2YWL A;  3DJD A;  4RG4 A;  1PHH A;  1H83 A;  5KWF A;  3ICT A;  1FOH A;  2WPE A;  3NYC A;  1CJC A;  2I0Z A;  2XFU A;  4J2W A;  2YVF A;  3DK9 A;  3JSK A;  4OVI A;  3HYX A;  3BNU A;  4CBQ A;  4XWZ A;  1ZDL A;  5JCK A;  4G9K A;  2F5Z A;  3UKQ A;  3EF6 A;  5KMR A;  1S3E A;  1NHR A;  2RAB A;  2BK3 A;  3IHG A;  2YLX A;  1ZOY A;  4YTN A;  4BK2 A;  2JK6 A;  3BHK A;  4A65 A;  1O95 A;  3GSI A;  3F8P A;  2B7R A;  1ELI A;  1RSG A;  3ADA B;  3G5R A;  3O0H A;  3LJP A;  3NGC X;  3CNT A;  5IQ4 A;  4K8D A;  4P9S A;  1N4W A;  1CJ4 A;  3AE2 A;  2IVD A;  1H82 A;  1E7P A;  4IVO B;  3VQR A;  2WS3 A;  2WOW A;  3K7M X;  3AD8 B;  4C74 A;  5IPY A;  3AEA A;  4H4R A;  2OAM A;  3NLC A;  2WU2 A;  3PG6 A;  3SXI A;  1YQ3 A;  5HXI A;  5LV9 A;  1Y56 B;  1VQW A;  1E1N A;  2BA9 A;  1XDI A;  5EB4 A;  1CBO A;  1GRE A;  4K7Z A;  3VR9 A;  1M6I A;  1O94 A;  1F8S A;  3ABV A;  1NAA A;  3GDN A;  1NHP A;  2OAL A;  3URH A;  2XFP A;  2BAC A;  1N4V A;  3NH3 X;  1E6E A;  3NK0 X;  3R9U A;  3UOZ A;  4ZN0 A;  2WEU A;  2QCU A;  1KF6 A;  2YLT A;  3BI4 A;  3AEE A;  3S61 A;  1L9E A;  4KX6 A;  1Y56 A;  3D9X A;  2BCG G;  3NN0 X;  4OPG A;  3ISH A;  3SM8 A;  3NT6 A;  3AE3 A;  3EPT A;  3FMW A;  2R0C A;  1PS9 A;  1TYP A;  3SY4 A;  4H4X A;  1P2E A;  2GR2 A;  5IQ1 A;  5U63 A;  1B4V A;  4NEV A;  1KNP A;  1OJD A;  2WES A;  3LOV A;  3M13 A;  1GTE A;  4GAV A;  4I59 A;  4GCM A;  1JU2 A;  1BZL A;  4Z24 A;  1S7M A;  3GD3 A;  2FJD A;  2XFN A;  4Y4L A;  1GET A;  1D5T A;  3M0O A;  3SGL A;  2C66 A;  4AP1 A;  3L5O A;  3RP7 A;  4B67 A;  2Z5Y A;  1GRT A;  3VRB A;  4MJW A;  1PBB A;  3IF9 A;  2ACZ A;  2GVC A;  3CGC A;  4YTM A;  1QO8 A;  1LJ1 A;  5HYM A;  1IJH A;  5EOW A;  2XYO A;  3SQP A;  2NVK X;  5KMP A;  3NYF A;  2WDQ A;  4NTE A;  2BAB A;  2XDO A;  2OA1 A;  1GES A;  2CUL A;  1GPE A;  1F6M A;  1VRQ B;  3SZC A;  3NRN A;  1DNC A;  3QSE A;  1GSN A;  1GT8 A;  4UDP A;  3T2Y A;  4CRT A;  3ITJ A;  4B68 A;  4USR A;  1NHQ A;  3NIX A;  3SYI A;  4EIP A;  3KVE A;  3DH9 A;  1FL2 A;  4Y4M A;  3LAD A;  3IHM A;  2YG3 A;  4J31 A;  4XXG A;  2AQJ A;  1SEZ A;  4B1B A;  2GQF A;  4YKG A;  3AE4 A;  4H50 A;  1MO9 A;  1S2Q A;  3ATR A;  1BKW A;  2RGJ A;  3RP6 A;  4J36 A;  1FEA A;  4II2 A;  5KVH A;  1TDK A;  2BS2 A;  3KA7 A;  4C3Y A;  1B37 A;  2Q0K A;  2VQB A;  2BS4 A;  4GRT A;  3SFD A;  3UTH A;  1LTX R;  1IUW A;  3GYJ A;  1BF3 A;  1Z6L A;  3C4N A;  2XVE A;  2FJE A;  3DJE A;  4A99 A;  3CND A;  4U2S A;  1UKV G;  3DA1 A;  2APG A;  1JNR A;  1GRG A;  3NN6 X;  3H8I A;  4K2X A;  1JRX A;  2YVG A;  4YXD A;  4BJY A;  1XHC A;  3SZW A;  3OZ2 A;  4Z2U A;  1DXL A;  1GER A;  3RHA A;  2B76 A;  4EIQ A;  2BYB A;  3ZYX A;  4U8J A;  1KSS A;  1ZP0 A;  1KNR A;  4H7U A;  4B66 A;  5BRT A;  3FPZ A;  1DOE A;  2YVJ A;  3GYI A;  1EL5 A;  3UKH A;  3CMM A;  3AYL A;  1PJ5 A;  4II3 A;  4JNQ A;  4NZH A;  1TDE A;  3UTG A;  2BC0 A;  5JCN A;  2GV8 A;  3AE6 A;  4JN9 A;  4X4J A;  4CNJ A;  1ZMC A;  2XVI A;  4H4V A;  2VQ7 A;  2BC1 A;  1GRF A;  3HZL A;  1EL8 A;  4OPC A;  2CVJ A;  2R0P A;  1ZOV A;  4O5U A;  1GRB A;  1KDG A;  1BWC A;  2Q6U A;  3QJ4 A;  1PBE A;  1JRZ A;  3SZF A;  4Y4N A;  3T14 A;  4EMI A;  2Y6R A;  3AED A;  3BI2 A;  2B9Y A;  4JQ9 A;  1CL0 A;  4TM3 A;  2WDR A;  4B65 A;  2XVF A;  3CN8 A;  4H4Y A;  1KN0 A;  1MXT A;  4YWO A;  1PBD A;  2GMJ A;  2WHD A;  3LZW A;  4DGK A;  1RYI A;  1NEK A;  4ECH A;  4NEW A;  2XLP A;  1M64 A;  2QA1 A;  2XLS A;  3AEF A;  3DGH A;  3DJJ A;  2R4E A;  4K5R A;  5CQF A;  1GAL A;  5HY5 A;  5CKU A;  3D8X A;  1E1L A;  2BS3 A;  2WP6 A;  1NPX A;  4H2N A;  1D4D A;  3EAO A;  1O5W A;  4K5S A;  3ALL A;  3AXB A;  4WCT A;  1LV0 A;  4A7A A;  3FG2 P;  4FDC B;  1COY A;  4TLX A;  2EQ6 A;  2IID A;  2JB2 A;  4GAP A;  4IVM B;  1V59 A;  2YG6 A;  2ZZ0 A;  1PXC A;  1F8R A;  4YT0 A;  5FS7 A;  3IWA A;  1NG3 A;  3C4A A;  3DJG X;  2B7S A;  2XVH A;  2O9Z A;  2XFO A;  4U8M A;  4EM3 A;  2AAQ A;  4Z43 A;  4H4Q A;  2BXS A;  1Q1W A;  3DK8 A;  1HYU A;  3UKA A;  4NWZ A;  2DKI A;  2GQW A;  4EMJ A;  2W0H A;  4U8L A;  3QFA A;  1NG4 A;  5EB5 A;  3V3O A;  3BNM A;  1CF3 A;  1CC4 A;  1TRB A;  5M10 A;  4TM4 A;  3VRA A;  4DSH A;  2AR8 A;  1TDN A;  1ZMD A;  2YM1 A;  2WPC A;  3P9U A;  2QA2 A;  3BHF A;  2V3A A;  1N4U A;  1YY5 A;  4U2T A;  4CNK A;  3GWF A;  3QVP A;  1H7W A;  4A79 A;  1TDO A;  3ICR A;  2OLN A;  5FS9 A;  1DOC A;  3CNJ A;  5KRQ A;  4HB9 A;  4C5O A;  4IA6 A;  3S5W A;  1PJ6 A;  4TLZ A;  1REO A;  3RED A;  4U2L A;  3ZDN A;  1OJA A;  2XLU A;  3AEB A;  3I3L A;  3Q9T A;  5KNL A;  4C77 A;  3GD4 A;  1JEH A;  4EQR A;  4YSH A;  5J60 A;  3PS9 A;  1P2H A;  1K0L A;  4H2Q A;  1B5Q A;  3QSS A;  3CTY A;  1IUU A;  3GRS A;  1IUX A;  5J7X A;  4AOX A;  2WU5 A;  3NTD A;  4AOS A;  4GDE A;  3CNS A;  3P1W A;  3NK2 X;  3KKJ A;  4REK A;  2C7G A;  2R0G A;  4UDQ A;  2JB1 A;  3UTE A;  4J57 A;  2WOI A;  1B8S A;  5C2T A;  3UOV A;  1L0V A;  4BK3 A;  4BUR A;  1F3P A;  2X3N A;  3M12 A;  1VG9 A;  3K30 A;  4H4Z A;  3VRD B;  3CPI G;  2TPR A;  3H4K A;  1PBC A;  4U8I A;  5FS8 A;  3AD9 B;  1KFY A;  2YG4 A;  3AWI A;  4FK1 C;  3UKL A;  4IV9 A;  4RSL A;  3AE5 A;  3C96 A;  5L46 A;  3UCL A;  5KMQ A;  5M0Z A;  5KMS A;  2BCP A;  3CGE A;  2NPX A;  2VVL G;  2X50 A;  4CCQ A;  3NG7 X;  4Z26 A;  2C73 A;  1ZK7 A;  1PBF A;  1OJ9 A;  4EMW A;  4ZCC A;  2A87 A;  2ZZC A;  1Y0P A;  3PO7 A;  5KOW A;  3BI5 A;  1LQU A;  2FJA A;  4Z2T A;  4DNA A;  1GV4 A;  3DGZ A;  3P4Q A;  4ZCD A;  2C70 A;  2JBV A;  4B63 A;  2WPF A;  3GMB A;  1AOG A;  3DME A;  2R9Z A;  2Z5X A;  5C3J A;  1YQZ A;  2FBW A;  3AB1 A;  2Q0L A;  3KU9 A;  2FJB A;  2C64 A;  2B9X A;  2JKC A;  4H2R A;  1GND A;  2X8H A;  1L9D A;  1YQ4 A;  4CCR A;  2TMD A;  1S3B A;  1Q9I A;  4RG3 A;  4YSX A;  4EQX A;  2ZZB A;  3GWD A;  3NYE A;  2X99 A;  2A89 A;  5TR3 A;  3P4R A;  4Z44 A;  1PN0 A;  3WE0 A;  2R4J A;  2GEW A;  3UOX A;  4APN A;  3AE9 A;  3LXD A;  2X8C A;  4H4T A;  4LU6 A;  3UOY A;  5EBK A;  2C65 A;  2YG7 A;  4H4P A;  1GOS A;  2YR4 A;  1H84 A;  2DKH A;  4XWR A;  1MOK A;  3V76 A;  3LZX A;  4EM4 A;  1EL7 A;  1H2I A;  2VRM A;  1VDC A;  3QVR A;  3T2K A;  4USQ A;  4G6G A;  2VZ2 A;  2WP5 A;  5FMH A;  4PAB A;  4ADW A;  1S2Y A;  3NK1 X;  3OC4 A;  2V6O A;  2H88 A;  5KVI A;  4PAA A;  1GRH A;  4ICY A;  3HYV A;  4GDP A;  4LA1 A;  1CHU A;  4N9X A;  2VVM A;  2BRA A;  3UKK A;  1E1K A;  4KPR A;  3GMC A;  2PYX A;  4UP3 A;  3UTF A;  4A5L A;  2YLS A;  4YTP A;  3AEG A;  1GXF A;  1PXA A;  4Z2R A;  4CY6 A;  4H4U A;  2BK4 A;  2J3N A;  4JDR A;  3UP5 A;  4A6N B;  3AD7 B;  1GRA A;  2QAE A;  2XFQ A;  3SX6 A;  4OPU A;  2HQM A;  3AYJ A;  3IC9 A;  1TDF A;  4J34 A;  2EQ9 A;  1K4Q A;  3AE7 A;  2GAG B;  3GYX A;  4WX1 A;  2XVJ A;  2YQU A;  3AYI A;  5KOX A;  3P4P A;  3L1R A;  1NDA A;  4JY2 A;  1OJT A;  4K22 A;  1PDH A;  3ATQ A;  1LVL A;  2WDV A;  3V3N A;  1ZKQ A;  4NNJ A;  2C72 A;  4DSG A;  3UKP A;  3KLJ A;  4A6N A;  3CGB A;  2ZBW A;  1K0J A;  3FIM B;  3B3R A;  3ALJ A;  2XLR A;  4UDR A;  2GAH B;  3T37 A;  5ER0 A;  1IUT A;  3H8L A;  3L8K A;  2H89 A;  2GF3 A;  1NEN A;  1CC2 A;  3P4S A;  4TM1 A;  4EQS A;  2YG5 A;  3UP4 A;  3AE8 A;  1GTH A;  3CGD A;  2C3D A;  2V5Z A;  2X8G A;  4GR1 A;  3K7T A;  1QJD A;  3ALM A;  3KPK A;  4OPI A;  1FEB A;  2OLO A;  2PHH A;  3II4 A;  4CY8 A;  1VG0 A;  2B9W A;  3RP8 A;  1CJ2 A;  2IVE A;  3G5Q A;  4OPT A;  3AEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...