5JCKA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
432
structure length
432
Chain Sequence
b'EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFYSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVANIEELKKEGLQFASKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
total genus 140
structure length 432
sequence length 432
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jckA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jckA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jckA02
4Z43A 2E1MA 1IJHA 4ECHA 1F8SA 5JCNA 2YLSA 2BS4A 3LZWA 2WDRA 3BHFA 3AE1A 1H84A 1S3EA 4Z2TA 2GB0A 3VRAA 4CCRA 3II4A 4DGKA 2WP9A 4B63A 4EQRA 4GCMA 2VZ2A 1ZKQA 3UKPA 4D04A 2A89A 2XLTA 1DOBA 3ICTA 2Q7VA 5FS8A 1PXAA 3HZLA 4OPGA 1H82A 3CN8A 3IWAA 1RSGA 2ZBWA 2XDOA 4H4UA 3M0OA 1KNRA 3GMCA 4U2TA 5KWFA 3NG7X 4B67A 4LA1A 4AOXA 2WPCA 1JRZA 3VRBA 4IVOB 4EM4A 4H7UA 4A79A 4EQXA 1OJ9A 4K5SA 1S2QA 4J36A 5IQ1A 4B66A 2YVFA 2C65A 2V3AA 3NGCX 3AXBA 4YTNA 3GRSA 1TDFA 5M10A 1PBDA 1BKWA 1CJ3A 1F3PA 3KVEA 3C4NA 2GMHA 5BRTA 2GRTA 4H2RA 1YQ4A 3NNEA 2GH5A 3ATQA 3DJJA 4D03A 1NHRA 4U8IA 4JY2A 3D1CA 4A6NA 1L9CA 2IIDA 2WDVA 4Z2UA 1OJDA 1GTEA 1LQUA 1PS9A 1GTHA 1CC4A 3DK4A 3AEAA 2VRLA 5HXIA 3NTAA 4H2NA 4AT2A 2QA2A 2BABA 4CNKA 4H4QA 1DJNA 4JNQA 4UDRA 4A5LA 1YQZA 2X3NA 2FJAA 4TLXA 2YR6A 3UP5A 3ADAB 1PHHA 1ZY8A 3V3NA 3RP8A 1VG9A 5KVIA 2XLSA 3CPIG 1GV4A 1B8SA 5ER0A 3DMEA 1SEZA 5C2TA 4C3XA 4GDPA 1PBBA 1PXCA 4AP1A 4EMIA 3GYIA 4C74A 2DKHA 4X9NA 1GERA 3ALMA 4K5RA 1P2EA 4U2LA 1S3BA 2H88A 1B37A 4REKA 1N1PA 2ZZCA 3FPZA 2XVIA 2XCGA 3BI4A 2ACZA 1NAAA 1TYPA 1QJDA 3G5SA 3AECA 3GSIA 1GXFA 3COXA 2WOWA 3AE7A 3AEFA 1CHUA 3FG2P 2TPRA 4GF7A 3UP4A 4NTEA 3SM8A 3EANA 1N4UA 3CIRA 4YSXA 1ZOYA 4ZCCA 1JRXA 1VDCA 2C67A 2YLXA 1TDKA 4N9XA 5KVHA 3CNSA 1XANA 4H4TA 3KPFA 3KLJA 3F8DA 2BCPA 1F6MA 2BACA 1NG4A 2XVHA 1QLBA 1CJ4A 3BNMA 2YVGA 5JCLA 3UOZA 2EQ9A 5FS9A 1GPEA 3H8IA 3CPHG 2AAQA 3ZDNA 2XYOA 1KSSA 3B3RA 4TLZA 3NN0X 1VQWA 3EAOA 4U2SA 1E6EA 1LPFA 1JNRA 2WP5A 3FBSA 2BYBA 2BXSA 1ZOVA 2NPXA 1GRFA 2XFOA 5JCMA 4YT0A 2Z5XA 5U1OA 3NK1X 4KX6A 3C96A 3ALLA 1LV0A 5J60A 3K7TA 1FCDA 2YAUA 3AE2A 2V61A 2CFYA 1IUXA 3CTYA 4GR1A 1NG3A 3D8XA 5GSNA 5BULA 2YG4A 1EBDA 2X8GA 4H4SA 1KDGA 3ISHA 2X8CA 3WE0A 4AT0A 2A87A 3KA7A 2XLPA 3UTFA 1H83A 4Z24A 4J33A 2JK6A 1NPXA 2C76A 2WETA 4YTMA 1H6VA 4OPIA 1IUSA 1PBCA 1X31B 3KD9A 4OPLA 4PABA 1BWCA 5L46A 3QVPA 4RG4A 2WOIA 3URHA 1TDNA 3DK8A 5U25A 3AE3A 1OJTA 2YLWA 3P4QA 3VR9A 3V3OA 2C64A 1GALA 2JB2A 1N4VA 3H4KA 1CL0A 2I0ZA 3LZXA 4HB9A 5HHFA 3GMBA 1CC6A 1LQTA 1EL7A 4H4PA 1D4EA 3NK0X 2IVDA 1E39A 4ZN0A 2GEWA 1Q9IA 3DGZA 3K7QX 4YSYA 2EQ8A 1GSNA 4B64A 2H89A 4ICYA 3GDPA 3ALJA 4CBQA 2YLRA 3BNUA 2AQJA 2WDQA 2XFUA 4HA6A 4Z26A 4JQ9A 4BJZA 3CNJA 3RP6A 2QA1A 3L8KA 3QSEA 2Q6UA 5LV9A 2YLTA 3H8LA 3GRTA 4KPRA 4O5QA 4TM3A 3DK9A 4RSLA 2YR4A 3T37A 2CVJA 1FEAA 3F8PA 3L1RA 4IA6A 1OJAA 1W4XA 2WS3A 3JSKA 3KKJA 2RGHA 2B7RA 2PYXA 3EF6A 5JCIA 5IPYA 1MXTA 4NTDA 3SGLA 3UKLA 2GR1A 1PJ7A 1AOGA 2FJEA 3O0HA 4AP3A 2WPEA 1CBOA 3PS9A 4ZCDA 4OPCA 3AE9A 2BS2A 4GUVA 1O5WA 4K22A 1IUTA 2WU5A 3NK2X 3GD4A 1GRGA 2BS3A 2A8XA 2F5ZA 3UOXA 4K8DA 5IQ4A 2YM1A 2BK4A 1PBEA 2OAMA 4OPUA 3S61A 4WCTA 4UDPA 3VQRA 1GT8A 5HY5A 4Z2RA 4IA5A 4FDCB 2BC0A 4H4XA 5FS7A 2Y6QA 4TM0A 4O5UA 1GRBA 4BJYA 1Y56A 4YWOA 1GRTA 4GDEA 2FJBA 1BGNA 1D4CA 4H4ZA 4BV6A 5EOWA 3R9UA 3G5RA 1TYTA 3UCLA 1ELIA 3LJPA 3G5QA 3CGDA 4LIIA 4YXDA 4YSZA 4UP3A 3UKHA 2B9XA 2XLRA 5C3JA 1GEUA 1E7PA 3P4RA 2JB1A 3P9UA 2WP6A 4EMWA 1JNZA 4U8LA 4J56A 2YR5A 3PVCA 2GR2A 3UTEA 1COYA 1L9DA 1PJ5A 1Q1RA 3SFEA 5CQFA 5DBJA 1D7LA 4CY8A 4RG3A 1FEBA 3QFAA 2JB3A 1VG0A 4I58A 1ZMCA 2TMDA 4XWRA 2GMJA 3NKSA 3Q6JA 2EQ6A 5GRTA 5KRQA 2CULA 4YKFA 2GVCA 2VVLG 1HYUA 4TM4A 3CNDA 3S5WA 4C3YA 2IVEA 1JRYA 1M64A 2YG7A 2GR3A 1Q1WA 4A7AA 1VRQB 4A6NB 2CDUA 2DKIA 1BZLA 2RABA 2WBAA 3E1TA 3FIMB 4NEVA 3GWFA 4H4VA 2WESA 3I6DA 3NTDA 3Q9TA 4CRTA 1CC2A 2OLOA 4YSHA 1NHQA 2YM2A 1B4VA 1DXLA 3GWDA 2WQYA 2JAEA 2Q0KA 1E1NA 2WEUA 4TM1A 2BC1A 4BK1A 2W0HA 3RNMA 1E1LA 2QCUA 1M6IA 1IUUA 2XVFA 2BK5A 3M13A 4OPTA 1BF3A 2WU2A 4BK3A 1Y56B 1IUWA 2VRMA 4Z25A 3AD8B 2B76A 3DJGX 2GR0A 1YY5A 2ZZBA 4NEWA 1KF6A 3F8RA 3NIXA 2HQMA 1RYIA 2XVJA 2V3BA 1ZDLA 2OALA 2UZZA 1FL2A 4BK2A 2NVKX 1O95A 2V5ZA 1CJ2A 2XFQA 1FECA 3OZ2A 3UOYA 4CNJA 5KOXA 2XFNA 2R0CA 2YG6A 5BUKA 2QAEA 3SFDA 3AYJA 4EQWA 2B9YA 3DA1A 1GRAA 3QFBA 2X50A 3B6DA 1NEKA 2R0GA 2Y6RA 4B65A 4K7ZA 2YVJA 3RP7A 3UKFA 3ICRA 3QVRA 4LU6A 1PDHA 2APGA 3FMWA 4H4YA 1EL9A 4YTPA 3AEBA 4P9SA 2X99A 1IUVA 3ABVA 2XLUA 1ZX9A 2E4GA 5J7XA 2Z5YA 4A65A 2BK3A 2PHHA 1PJ6A 3CNTA 3NT6A 2JKCA 4EM3A 2VVLA 4E0VA 3DJEA 4U8NA 4CCQA 4WX1A 3REDA 1H86A 4USRA 1K0LA 4OVIA 5EBKA 3AEGA 1Y0PA 2C7GA 4ADWA 4C77A 2RGJA 3M12A 4FK1C 4J2WA 4IVMB 2GAHB 1RP0A 3SQPA 3CPJG 2B7SA 3LADA 1NHPA 4FX9A 4H2PA 4B68A 3DGHA 4USQA 3AEDA 4EIQA 3C4AA 1XPQA 5CKUA 2BA9A 3UKAA 2RGOA 4J31A 2V60A 2YG3A 4EIPA 2V6OA 3P4SA 4Y4MA 3CNPA 1D4DA 1TDEA 2VQBA 3NLCA 4DSHA 1GESA 2WHDA 2GQWA 2GQFA 4JN9A 2X8HA 1YKJA 3NYEA 4XXGA 5KOWA 3CGCA 1B5QA 4DSGA 3NRNA 2XFPA 4Z44A 3AD7B 1EL8A 4JNAA 3IC9A 3IHMA 2VQ7A 1P2HA 5FMHA 4XWZA 3GDNA 1KNPA 3AWIA 5EB5A 5M0ZA 2C72A 2R4JA 2XVEA 4CY6A 1D7YA 2BXRA 1N4WA 1ONFA 4U8PA 1DNCA 1DJQA 2YG5A 3NN6X 1REOA 3NH3X 4A9WA 3NHOX 3ATRA 1FOHA 4IV9A 1LJ1A 1TDOA 4NTCA 3EPTA 3NYFA 1BGJA 1NENA 1O94A 1GETA 1D5TA 2AR8A 4B1BA 4AOSA 1S2YA 4J34A 5BVAA 2E5VA 4YKGA 2YQUA 1K0IA 3IF9A 4A99A 3GYJA 1F8RA 4U8KA 2R0PA 1YQ3A 2GV8A 2B9WA 3LXDA 4PAAA 4APNA 1K0JA 1PBFA 4OCGA 1CJCA 3DJDA 1K4QA 3UTGA 2O9ZA 3NYCA 1QO8A 4C5OA 1GNDA 2C66A 3I3LA 5KXJA 3OC4A 4NZHA 3AD9B 2VOUA 1L0VA 3LB8A 1JU2A 1KFYA 3QJ4A 3V76A 1DOEA 4H4WA 3P1WA 2OA1A 2R4EA 3AYIA 1UKVG 2ARDA 4U8JA 3AB1A 2FJDA 4JY3A 3AE4A 1LVLA 3GD3A 1KSUA 1E1KA 1GRHA 1MO9A 1CF3A 1ZP0A 4U8MA 3VRDB 3RHAA 2YLZA 3DH9A 1L9EA 4UDQA 4EMJA 2WOVA 1H81A 1PN0A 3UKKA 3UOVA 1JOAA 1EL5A 1PXBA 2BCGG 4X9MA 4U8OA 4BURA 3K30A 1XDIA 1DODA 1ZMDA 2R9ZA 3QSSA 2WPFA 2YWLA 1LTXR 2OLNA 2C3DA 2GF3A 1DOCA 3IHGA 4K2XA 3K7MX 4H4RA 3VR8A 1NHSA 2R46A 2Q0LA 3BI5A 1JEHA 3PO7A 4I59A 4MJWA 2C3CA 3LOVA 2EQ7A 2J3NA 4H2QA 5FS6A 3AE5A 3AE6A 4JDRA 4M52A 1NDAA 3AEEA 5U63A 4EQSA 1H7XA 2JBVA 3UKQA 1GREA 4H50A 4OPDA 5JCKA 1H7WA 2VVMA 4Y4NA 4GRTA 1ZK7A 3ITJA 4DNAA 1V59A 1XHCA 1F8WA 4Y4LA 3ZYXA 1MOKA 4B69A 2GAGB 3AYLA 1OJCA 4X4JA 1GOSA 2C70A 5TR3A 5EB4A 3BI2A 4FK1A 2ZZ0A 3QSMA 3CGEA 1TRBA 3BHKA 2C75A 5HYMA 1E1MA 3AE8A 3CGBA 2C73A 3P4PA 3UTHA 2R45A 2FBWA 1Z6LA 4J57A 3ICSA 3KU9A
chains in the Genus database with same CATH superfamily
4Z43A 2E1MA 2AKMA 4ECHA 3VRAA 4M6UA 2WP9A 4EQRA 4B63A 1FFVC 3DDMA 3UKPA 2A89A 2XLTA 4FI4A 2Q7VA 1PXAA 1EC7A 2ZBWA 4H4UA 4F4RA 4B67A 3H70A 3ZLFA 4A79A 4EM4A 5IQ1A 4B66A 1T3QC 3GRSA 1CJ3A 1F3PA 1YQ4A 2GH5A 3DJJA 4G73A 4U8IA 3D1CA 3I4KA 1OJDA 1CC4A 3DK4A 2VRLA 4CNKA 3DEQA 1DJNA 2X3NA 3UP5A 3V3WA 3ADAB 1MNSA 1PHHA 3RP8A 4C3XA 4G8TA 4EMIA 3GYIA 4C74A 3CXBA 3ALMA 3GYXA 2H88A 4K1WA 2ZZCA 2XVIA 1NAAA 1QJDA 3AECA 5KMQA 4N9XA 3CNSA 1XANA 3KPFA 2XVHA 1GPEA 4HNLA 2AAQA 3ZDNA 4TLZA 4U2SA 1VQWA 3P3BA 1JNRA 4GIRA 2BXSA 2XFOA 4HN8A 1LV0A 1FCDA 3UJSA 3P0WA 3CTYA 5GSNA 2XH7A 4GAVA 3ISHA 1L8PA 1XPYA 4AT0A 2A87A 1XS2A 1NU5A 4Z24A 4J33A 2C76A 1F9CA 1IUSA 1PBCA 1PDYA 3KD9A 4OPLA 4PABA 5U25A 3AE3A 1MDRA 1OJTA 2YLWA 3P4QA 3N6HA 3SZ0A 3NK0X 1BKHA 2GEWA 3DGZA 3K7QX 1TZZA 1GSNA 4B64A 2H89A 4CBQA 4H1ZA 2WDQA 2XFUA 4JQ9A 4BJZA 3UJRA 3CNJA 5KMSA 4GAPA 3SX6A 3QSEA 2YLTA 3H8LA 4KPRA 2PGEA 3DK9A 4RSLA 3T37A 1FEAA 2OO6A 2B7RA 1ZXIC 3EF6A 3N4FA 3PG6A 1AOGA 2FJEA 3PS9A 4K22A 2WU5A 2W3RA 3R0KA 4Z2RA 4IA5A 5FS7A 2Y6QA 4O5UA 1GRBA 1TE6A 1GRTA 3CYJA 3EEZA 3I6EA 3G5RA 1ELIA 4UP3A 2XLRA 5C3JA 1GEUA 4J56A 1COYA 4DN1A 4CY8A 4RG3A 1FEBA 1VG0A 3TTEA 4G6HA 3U9IA 3Q6JA 2AL1A 4YKFA 2VVLG 1HYUA 3GY1A 4GYPA 2IVEA 1VRQB 3OZYA 3NTDA 2W54A 3GWFA 4H4VA 4CRTA 2OLOA 1NHQA 2YM2A 4E5TA 4MGGA 1E1NA 2OX4A 4OPTA 3AD8B 3DJGX 4NEWA 3F8RA 3NIXA 2UZZA 2V5ZA 2XFQA 3UOYA 1SJCA 4CNJA 4KEMA 1KCZA 3QVRA 4LU6A 3GO2A 4H4YA 5FJPA 4YTPA 2Z5YA 2PHHA 3EKGA 1KN0A 2PODA 4EM3A 3REDA 5EBKA 3AEGA 4ADWA 2RGJA 4FK1C 1RP0A 2E3TA 3R1ZA 1NHPA 4FX9A 2HNEA 4H2PA 2PSNA 3DGHA 3AEDA 3RR1A 1KKOA 4J31A 5EU9A 2VQBA 1RM6B 3SN1A 2GQFA 1YKJA 3NYEA 1B5QA 1EL8A 3IC9A 4TVYA 1JPDX 3GDNA 5EB5A 5M0ZA 2DW6A 2XVEA 3VC5A 3NH3X 1FOHA 1LJ1A 1TDOA 5ENLA 3EPTA 1BGJA 1GETA 3IK4A 2QJNA 4J34A 3MZNA 1K0IA 3IF9A 2GGGA 2R0PA 2B9WA 4APNA 1PBFA 2PTYA 1CJCA 3UTGA 2O9ZA 1VQZA 3AD9B 3D46A 3CMMA 3A7AA 2OA1A 2ARDA 3AE4A 1LVLA 3GD3A 1E1KA 1GRHA 4U8MA 2WOVA 1H81A 3UOVA 3MUCA 3Q4DA 3K30A 1ZMDA 4H4RA 1JEHA 4MJWA 3SQSA 4GMEA 3AE5A 3AE6A 1SJAA 5U63A 3ZLHA 3AMZA 1S7MA 1H7XA 2JBVA 1GREA 4H50A 4ENLA 4OPDA 4Y4NA 4GRTA 1ZK7A 2OFJA 1F8WA 4Y4LA 4X4JA 3TWBA 2GL5A 2C70A 3CAWA 5EB4A 3QSMA 3BHKA 5HYMA 1E1MA 3AE8A 2C73A 2R45A 2FBWA 3ICSA 5JCNA 2BS4A 3LZWA 3AE1A 1S3EA 2GB0A 4DGKA 4KWSA 4GCMA 3QN3A 1ZKQA 4D04A 5FS8A 1ELSA 3CN8A 4A6GA 4U2TA 5KWFA 3NG7X 4LA1A 2C4CA 3VRBA 4IVOB 2PTXA 4EQXA 1OJ9A 4K5SA 4J36A 2YVFA 3L5OA 3QPEA 4YTNA 1TDFA 5M10A 4MMWA 3KVEA 2GRTA 3NNEA 4GGBA 3ATQA 4D03A 1P43A 3DFHA 2P8BA 3NZGA 3TWAA 4A6NA 3AEAA 5HXIA 4AT2A 4H4QA 3FYYA 4A5LA 4TLXA 2YR6A 3V3NA 1VG9A 1IYXA 5KVIA 2XSXA 1GV4A 2PS2A 5ER0A 1PXCA 6ENLA 2QQ6A 2DKHA 4X9NA 4H19A 4U2LA 1B37A 2XCGA 3FXGA 1CHUA 4GF7A 3SM8A 1ZOYA 3S47A 4ZCCA 2W55A 5KVHA 4H4TA 3KUMA 1OEPA 3F8DA 2BACA 1NG4A 1FHVA 2O56A 1E6EA 3DG7A 1ZOVA 2NPXA 5JCMA 3D47A 3C96A 4JN7A 2HXTA 3NXLA 1R0MA 2V61A 4GR1A 3T4WA 3D8XA 5BULA 2YG4A 4H4SA 3WE0A 3ES7A 3UTFA 1H83A 1KD0A 1X31B 4RG4A 3OW1A 3DK8A 4NNJA 3VR9A 3P93A 1GALA 2JB2A 1JRPA 3H4KA 2I0ZA 5HHFA 1N5XA 4H4PA 2IVDA 3MWCA 3BSMA 1E39A 4YSYA 3GDPA 3N6JA 2AQJA 4HA6A 4Z26A 2QA1A 2Q6UA 5LV9A 4O5QA 2YR4A 2CVJA 4IA6A 1X2GA 1BQGA 1OJAA 1W4XA 3L1RA 4GISA 2ZC8A 1PJ7A 3Q45A 4OPCA 2BS2A 4X2PA 2A8XA 3DFYA 3UOXA 2BK4A 2OAMA 2ZADA 4OPUA 3S61A 4UDPA 3HYWA 1WYGA 4YWOA 3BOXA 2FJBA 1D4CA 4H4ZA 3R9UA 3UCLA 4HCHA 4Z17A 4G7FA 2B9XA 1E7PA 3P9UA 4EMWA 2YR5A 1L9DA 1Q1RA 1D7LA 1ZMCA 2GMJA 2PP0A 5FJOA 2GVCA 1JRYA 2YG7A 2GR3A 3VC6A 2CDUA 5KMRA 1BZLA 2WBAA 3FIMB 3VCNA 2WESA 1EC8A 1DXLA 2WEUA 4BK1A 2W0HA 1IUUA 2XVFA 2BK5A 3R11A 4MKSA 1BF3A 3OP2A 1IUWA 4Z25A 2BRAA 1KF6A 1N61C 3HYVA 2XVJA 2V3BA 1ZDLA 1FL2A 1O95A 1CJ2A 3OZ2A 2XFNA 2OZ3A 2YG6A 2QAEA 3TJ4A 3SFDA 3DA1A 2Y6RA 3JZUA 2YVJA 2NQLA 3UKFA 3ICRA 2PTWA 3AEBA 3ABVA 4A65A 2XLUA 2E4GA 3OPSA 2BK3A 3RCYA 2JKCA 2VVLA 3DJEA 4Z1YA 3UJFA 4CCQA 4WX1A 1H86A 3CXOA 3NO1A 4IP5A 4G6GA 2GAHB 3CPJG 3IJQA 3HRDC 4USQA 2GGHA 3C4AA 3KPKA 1XPQA 3MY9A 1EBGA 2V6OA 1TDEA 4IP4A 4JN9A 2GQWA 2OKTA 3R0UA 3TCSA 3CT2A 4GGHA 5KOWA 4DSGA 4A35A 3AD7B 4JNAA 4HNCA 1FO4A 1P2HA 4DWDA 2BRYA 3AWIA 2C72A 1JDFA 4U8PA 1DNCA 2YG5A 3NN6X 5BOEA 4IV9A 2XH4A 4NTCA 1NENA 4B1BA 3D9XA 3RRAA 5BVAA 4A99A 3V5FA 1YQ3A 2GV8A 4OCGA 1K4QA 3UCCA 3NYCA 1GNDA 3I3LA 5KXJA 2VOUA 4IL0A 1L0VA 3V76A 1KFYA 3SZCA 4H4WA 5FJTA 1SB3B 3NVWB 2R4EA 3AYIA 1UKVG 4M0XA 3NVZB 4UDQA 1JOAA 1EL5A 4U8OA 4BURA 3R10A 3QSSA 2OLNA 1N62C 2GF3A 1DOCA 3VR8A 2Q0LA 3BI5A 4I59A 2J3NA 4JDRA 3AEEA 1TKKA 3UKQA 5JCKA 1H7WA 5FJUA 1V59A 2GGIA 1XHCA 3T9PA 5TR3A 4HCDA 3CGBA 3P4PA 3VFCA 1Z6LA 2RABA 1IJHA 1F8SA 2WDRA 1H84A 3II4A 2VZ2A 2MNRA 1DOBA 3ICTA 4OPGA 1H82A 4KPLA 3IWAA 3V5CA 2XDOA 1KNRA 2WPCA 3SSZA 1YEYA 1S2QA 3DGBA 2C65A 2V3AA 3AXBA 1PBDA 3BJSA 1N60C 3C4NA 5FJRA 1NHRA 1WUEA 4JY2A 1L9CA 2IIDA 2WDVA 1GTEA 1LQUA 2W3SA 2QA2A 1YQZA 1ZY8A 3TQPA 3DMEA 1SEZA 5C2TA 4AP1A 3SYIA 3UJ2A 1P2EA 4REKA 3BI4A 4J1OA 1TYPA 3G5SA 1GXFA 3COXA 3AEFA 3GD6A 3EANA 3CIRA 3QLDA 4ZA0A 1VDCA 1JROA 3KLJA 3AM9A 2BCPA 1EC9A 2YVGA 3UOZA 5FS9A 3H8IA 3V4BA 3FJ4A 3B3RA 3EAOA 4GYPC 4YT0A 3NK1X 4KX6A 2ONEA 2YAUA 2OQYA 5BOFA 2CFYA 1IUXA 1EBHA 1EBDA 2X8CA 2FKPA 2XLPA 2JK6A 1NPXA 4YTMA 2PCEA 3ENLA 3PWIA 1BWCA 3QVPA 3TW9A 3URHA 3V3OA 3LZXA 1LQTA 1EL7A 1FFUC 4ZN0A 1V97A 4ICYA 2POZA 3ALJA 2YLRA 3BNUA 3I6TA 3L8KA 3VDGA 3GRTA 3UJEA 4TM3A 4H2HA 2I5QA 3F8PA 2WS3A 2P88A 2PYXA 5JCIA 4NTDA 3NFUA 4G74A 4AP3A 2WPEA 4ZCDA 3AE9A 4JHMA 3NK2X 4WCTA 3VQRA 2BC0A 3SZWA 4BJYA 1BGNA 1TYTA 3G5QA 3CGDA 4LIIA 4YXDA 4H83A 3UKHA 3NVYB 3JW7A 2WP6A 3SJNA 3PVCA 1PJ5A 3SFEA 5CQFA 5DBJA 1VDVA 2XH2A 2JB3A 3T2ZA 4I58A 2TMDA 3UXLA 3NKSA 5GRTA 1NELA 2PA6A 3CNDA 4C3YA 3T31A 1M64A 4A7AA 4A6NB 2DKIA 3FV9A 3E1TA 4NEVA 3I6DA 3Q9TA 3QKEA 1CC2A 3HYXA 3GWDA 2WQYA 2JAEA 2Q0KA 4IZGA 5IDZA 4TM1A 3RNMA 1SJDA 4E4UA 1M6IA 1E1LA 3M13A 2WU2A 2VRMA 2B76A 3R07C 2GR0A 1YY5A 2ZZBA 1RYIA 4E6MA 4BK2A 3CB3A 2NVKX 2GSHA 1FECA 3OTRA 5KOXA 2R0CA 3AYJA 4EQWA 4K8GA 3QFBA 2OG9A 1NEKA 4KT2A 1EL9A 4P9SA 1IUVA 3B97A 4E0VA 1K0LA 2XGZA 3HPFA 2P8CA 3SQPA 3SXIA 2B7SA 3LADA 3PWGA 4IT1A 4IL2A 1JPMA 3A7UA 3TOYA 3DG3A 3UKAA 2RGOA 2V60A 2YG3A 4EIPA 4Y4MA 1D4DA 4DSHA 2WHDA 3FVDA 4XXGA 2QJJA 3NRNA 4Z44A 3T14A 2QDEA 2BXRA 1DJQA 3H7VA 3NHOX 4J3ZA 3MQTA 2AR8A 4AOSA 3NVVB 3THUA 2YQUA 3GYJA 3LXDA 2OZ8A 1K0JA 3DJDA 4C5OA 3OC4A 1STZA 3P1WA 1PDZA 4U8JA 3T2YA 3AB1A 1H2IA 4JY3A 3SZFA 3VRDB 3RHAA 4EMJA 5KNLA 4DHGA 1PXBA 1XDIA 1DODA 2WPFA 1LTXR 2C3DA 3IHGA 4K2XA 2E5AA 1NHSA 2R46A 3PO7A 2C3CA 3LOVA 2EQ7A 5FS6A 1ECQA 4EQSA 2VVMA 3DESA 3ITJA 1MRAA 4B69A 1MOKA 3K1GA 2PMQA 2GAGB 3AYLA 1GOSA 4FK1A 2ZZ0A 3CGEA 1TRBA 2C75A 4IVMB 3EUB3 3H8AA 4GFIA 2YLSA 3BHFA 4Z2TA 3UXKA 4CCRA 4A3RA 5KMPA 2P0IA 1JCTA 3HZLA 1RSGA 3M0OA 3GMCA 4AOXA 1JRZA 4H7UA 2FYMA 3DERA 3UCDA 2PU0A 3NGCX 1BKWA 2GMHA 5BRTA 4H2RA 5JRBA 2AKZA 4E4FA 3T8QA 4DYEA 2QDDA 4Z2UA 1PS9A 1GTHA 3NTAA 4H2NA 2BABA 3B9JB 4JNQA 4UDRA 2OLAA 2FJAA 3PFRA 3QTPA 2XLSA 1R6WA 3CPIG 1B8SA 4GDPA 1PBBA 3IJIA 1W6TA 3T2KA 1GERA 4K5RA 1MUCA 1ONEA 1S3BA 2GDQA 1N1PA 2HZGA 3FPZA 2ACZA 4NWZA 3GSIA 3ES8A 1N5WC 2WOWA 3AE7A 4DX3A 5J04A 3FG2P 2TPRA 3UP4A 4NTEA 3DIPA 1N4UA 4YSXA 2HXUA 1JRXA 2C67A 2YLXA 1TDKA 4K2SA 3SR6B 1F6MA 1WUFA 1QLBA 1CJ4A 3BNMA 5JCLA 2EQ9A 3CPHG 2XYOA 1KSSA 3NN0X 1RVKA 1LPFA 3FBSA 2WP5A 2OPJA 2BYBA 1GRFA 5G5GB 2Z5XA 5U1OA 3ALLA 5J60A 3S5SA 3K7TA 4FP1A 3AE2A 1NG3A 2X8GA 1KDGA 2QVHA 3KA7A 4ROPA 2WETA 1H6VA 4OPIA 4II3A 5L46A 2WOIA 1TDNA 1X2HA 2C64A 1N4VA 1CL0A 4HB9A 3GMBA 3AN1A 1CC6A 1D4EA 3UGVA 3VA8A 3RO6A 4EWJA 1Q9IA 2EQ8A 3HW2A 1N63C 3ZLGA 3RP6A 2OVLA 3FCPA 3JSKA 3KKJA 2RGHA 4YWSA 5IPYA 4ZCWA 3STPA 2OQHA 1MXTA 3SGLA 3UKLA 2GR1A 3O0HA 1CBOA 2AL2A 4GUVA 1O5WA 1IUTA 7ENLA 3GD4A 1GRGA 2BS3A 5IQ4A 2F5ZA 4K8DA 2YM1A 1PBEA 5HY5A 1GT8A 4FDCB 2GGJA 4H4XA 4TM0A 1Y56A 4GDEA 4BV6A 5EOWA 1FIQB 3LJPA 4YSZA 3P4RA 2JB1A 3SN0A 1JNZA 4U8LA 2DW7A 2GR2A 3UTEA 2OZTA 4DXKA 3QFAA 4XWRA 4E8GA 2EQ6A 5KRQA 2CULA 4TM4A 3S5WA 1Q1WA 2AL2B 3SN4A 3U4FA 4YSHA 1B4VA 2BC1A 1E9IA 2QCUA 2PU1A 3CK5A 4BK3A 1Y56B 1DTNA 3ZVIA 2HQMA 2OALA 3RGTA 2RDXA 3ETRB 3PK7A 5BUKA 2B9YA 1GRAA 2X50A 3B6DA 2R0GA 4B65A 4K7ZA 3RP7A 1PDHA 2APGA 3VCCA 3FMWA 3N4EA 2X99A 5J7XA 1ZX9A 2MUCA 1PJ6A 3CNTA 3NT6A 4U8NA 3MSYA 4USRA 4JN8A 4OVIA 1Y0PA 2C7GA 1SJBA 4C77A 3M12A 4J2WA 1MDLA 4B68A 4HPNA 4EIQA 5CKUA 2BA9A 3GC2A 3RITA 4IHCA 3P4SA 4TVWA 3H12A 3CNPA 3DG6A 3T0KA 3NLCA 1GESA 2X8HA 2PGWA 3R25A 3CGCA 3T6CA 2XFPA 3OZMA 2PPGA 3IHMA 2VQ7A 2CHRA 5FMHA 4XWZA 4ZOHB 2PP3A 4HCLA 1KNPA 3ZVHA 2R4JA 2P3ZA 2XH0A 4CY6A 1D7YA 4G9KA 3NS1B 1N4WA 1ONFA 1REOA 4A9WA 3SBFA 3ATRA 2QJMA 2GGEA 3NYFA 1O94A 1D5TA 1S2YA 3NRZB 2E5VA 4YKGA 2QGYA 1F8RA 1KKRA 4U8KA 3A7RA 4PAAA 1QO8A 2C66A 4NZHA 3LB8A 1JU2A 3QJ4A 1DOEA 1P48A 2FJDA 1KSUA 1MO9A 1CF3A 1ZP0A 2YLZA 3DH9A 1L9EA 3ZVHB 2PTZA 3UKKA 1PN0A 2PP1A 4II2A 3SY4A 2BCGG 4X9MA 1FHUA 2R9ZA 2YWLA 3K7MX 3IJLA 4HYRA 3MKCA 4H2QA 4M52A 1NDAA 3JVAA 3TJIA 4DNAA 3ZYXA 1OJCA 3BI2A 5G5HB 3UTHA 4J57A 3KU9A
chains in the Genus database with same CATH topology
4Z43A 2E1MA 1IJHA 4ECHA 1F8SA 5JCNA 2YLSA 2BS4A 3LZWA 2WDRA 3BHFA 3AE1A 1H84A 1S3EA 4Z2TA 2GB0A 3VRAA 4CCRA 3II4A 4DGKA 2WP9A 4B63A 4EQRA 4GCMA 5KMPA 2VZ2A 1ZKQA 3UKPA 4D04A 2A89A 2XLTA 1DOBA 3ICTA 2Q7VA 5FS8A 1PXAA 3HZLA 4OPGA 1H82A 3CN8A 3IWAA 1RSGA 2ZBWA 2XDOA 4H4UA 3M0OA 1KNRA 3GMCA 4U2TA 5KWFA 3NG7X 4B67A 4LA1A 4AOXA 2C4CA 2WPCA 1JRZA 3VRBA 4IVOB 4EM4A 4H7UA 4A79A 4EQXA 1OJ9A 4K5SA 1S2QA 4J36A 5IQ1A 4B66A 2YVFA 3L5OA 2C65A 2V3AA 3NGCX 3AXBA 4YTNA 3GRSA 1TDFA 5M10A 1PBDA 1BKWA 1CJ3A 1F3PA 3KVEA 3C4NA 2GMHA 5BRTA 2GRTA 5JRBA 1YQ4A 3NNEA 4H2RA 2GH5A 3ATQA 3DJJA 4D03A 4G73A 1NHRA 4U8IA 4JY2A 3D1CA 4A6NA 1L9CA 2IIDA 2WDVA 4Z2UA 1OJDA 1GTEA 1LQUA 1PS9A 1GTHA 1CC4A 3DK4A 3AEAA 2VRLA 5HXIA 3NTAA 4H2NA 4AT2A 2QA2A 2BABA 4CNKA 4H4QA 1DJNA 4JNQA 4UDRA 4A5LA 1YQZA 2X3NA 2FJAA 4TLXA 2YR6A 3UP5A 3ADAB 1PHHA 1ZY8A 3V3NA 3RP8A 1VG9A 5KVIA 2XLSA 3CPIG 1GV4A 1B8SA 5ER0A 3DMEA 1SEZA 5C2TA 4C3XA 4GDPA 1PBBA 1PXCA 4AP1A 4EMIA 3GYIA 4C74A 3T2KA 2DKHA 4X9NA 3SYIA 1GERA 3ALMA 3GYXA 4K5RA 1P2EA 4U2LA 1S3BA 2H88A 1B37A 4REKA 1N1PA 2ZZCA 3FPZA 2XVIA 2XCGA 3BI4A 2ACZA 1NAAA 1TYPA 1QJDA 3G5SA 4NWZA 3AECA 3GSIA 1GXFA 3COXA 2WOWA 3AE7A 3AEFA 1CHUA 3FG2P 2TPRA 4GF7A 3UP4A 4NTEA 3SM8A 3EANA 1N4UA 3CIRA 4YSXA 1ZOYA 5KMQA 4ZCCA 1JRXA 1VDCA 2C67A 2YLXA 1TDKA 4N9XA 5KVHA 3CNSA 1XANA 4H4TA 3KPFA 3KLJA 3F8DA 2BCPA 1F6MA 2BACA 1NG4A 2XVHA 1QLBA 1CJ4A 3BNMA 2YVGA 5JCLA 3UOZA 2EQ9A 5FS9A 1GPEA 3H8IA 3CPHG 2AAQA 3ZDNA 2XYOA 1KSSA 3B3RA 4TLZA 3NN0X 1VQWA 3EAOA 4U2SA 1E6EA 1LPFA 1JNRA 2WP5A 3FBSA 2BYBA 2BXSA 1ZOVA 2NPXA 1GRFA 2XFOA 5JCMA 4YT0A 2Z5XA 5U1OA 3NK1X 4KX6A 3C96A 3ALLA 1LV0A 5J60A 3K7TA 1FCDA 2YAUA 3AE2A 2V61A 2CFYA 1IUXA 3CTYA 4GR1A 1NG3A 3D8XA 5GSNA 5BULA 2YG4A 1EBDA 4GAVA 2X8GA 4H4SA 1KDGA 3ISHA 2X8CA 3WE0A 4AT0A 2A87A 3KA7A 2XLPA 3UTFA 1H83A 4Z24A 4J33A 2JK6A 1NPXA 2C76A 2WETA 4YTMA 1H6VA 4OPIA 1IUSA 1PBCA 1X31B 3KD9A 4II3A 4OPLA 4PABA 1BWCA 5L46A 3QVPA 4RG4A 2WOIA 3URHA 1TDNA 3DK8A 5U25A 3AE3A 1OJTA 2YLWA 3P4QA 4NNJA 3V3OA 3VR9A 2C64A 1GALA 2JB2A 1N4VA 3H4KA 1CL0A 2I0ZA 3LZXA 4HB9A 5HHFA 3GMBA 1CC6A 1LQTA 3SZ0A 1EL7A 4H4PA 1D4EA 3NK0X 2IVDA 1E39A 4ZN0A 2GEWA 1Q9IA 3DGZA 3K7QX 4YSYA 2EQ8A 1GSNA 4B64A 2H89A 4ICYA 3GDPA 3ALJA 4CBQA 2YLRA 3BNUA 2AQJA 2WDQA 2XFUA 4HA6A 4Z26A 4JQ9A 4BJZA 3CNJA 5KMSA 4GAPA 3RP6A 2QA1A 3SX6A 3L8KA 3QSEA 2Q6UA 5LV9A 2YLTA 3H8LA 3GRTA 4KPRA 4O5QA 4TM3A 3DK9A 4RSLA 2YR4A 3T37A 2CVJA 1FEAA 3F8PA 3L1RA 4IA6A 1OJAA 1W4XA 2WS3A 3JSKA 3KKJA 2RGHA 2B7RA 2PYXA 3EF6A 5JCIA 5IPYA 1MXTA 4NTDA 3SGLA 3UKLA 2GR1A 1PJ7A 3PG6A 1AOGA 2FJEA 3O0HA 4G74A 4AP3A 2WPEA 1CBOA 3PS9A 4ZCDA 4OPCA 3AE9A 2BS2A 4GUVA 1O5WA 4K22A 1IUTA 2WU5A 3NK2X 3GD4A 1GRGA 2BS3A 2A8XA 2F5ZA 3UOXA 4K8DA 5IQ4A 2YM1A 2BK4A 1PBEA 2OAMA 4OPUA 3S61A 4WCTA 4UDPA 3VQRA 1GT8A 5HY5A 4Z2RA 4IA5A 4FDCB 2BC0A 3HYWA 4H4XA 5FS7A 2Y6QA 4TM0A 4O5UA 1GRBA 3SZWA 4BJYA 1Y56A 4YWOA 1GRTA 4GDEA 2FJBA 1BGNA 1D4CA 4H4ZA 4BV6A 5EOWA 3R9UA 3G5RA 1TYTA 3UCLA 1ELIA 3LJPA 3G5QA 3CGDA 4LIIA 4YXDA 4YSZA 4UP3A 3UKHA 2B9XA 2XLRA 5C3JA 1GEUA 1E7PA 3P4RA 2JB1A 3P9UA 2WP6A 4EMWA 1JNZA 4U8LA 4J56A 2YR5A 3PVCA 2GR2A 3UTEA 1COYA 1L9DA 1PJ5A 1Q1RA 3SFEA 5CQFA 5DBJA 1D7LA 4CY8A 4RG3A 1FEBA 3QFAA 2JB3A 3T2ZA 1VG0A 4I58A 1ZMCA 2TMDA 4XWRA 4G6HA 2GMJA 3NKSA 3Q6JA 2EQ6A 5GRTA 5KRQA 2CULA 4YKFA 2GVCA 2VVLG 1HYUA 4TM4A 3CNDA 3S5WA 4C3YA 3T31A 2IVEA 1JRYA 1M64A 2YG7A 2GR3A 1Q1WA 4A7AA 1VRQB 4A6NB 2CDUA 5KMRA 2DKIA 1BZLA 2RABA 2WBAA 3E1TA 3FIMB 4NEVA 3GWFA 4H4VA 2WESA 3I6DA 3NTDA 3Q9TA 4CRTA 1CC2A 2OLOA 3HYXA 4YSHA 1NHQA 2YM2A 1B4VA 1DXLA 3GWDA 2WQYA 2JAEA 2Q0KA 1E1NA 2WEUA 4TM1A 2BC1A 4BK1A 2W0HA 3RNMA 1E1LA 2QCUA 1M6IA 1IUUA 2XVFA 2BK5A 3M13A 4OPTA 1BF3A 2WU2A 4BK3A 1Y56B 1IUWA 2VRMA 4Z25A 3AD8B 2B76A 2BRAA 3DJGX 2GR0A 1YY5A 2ZZBA 4NEWA 1KF6A 3F8RA 3NIXA 2HQMA 3HYVA 1RYIA 2XVJA 2V3BA 1ZDLA 2OALA 2UZZA 1FL2A 4BK2A 2NVKX 1O95A 2V5ZA 1CJ2A 2XFQA 1FECA 3OZ2A 3UOYA 4CNJA 5KOXA 2XFNA 2R0CA 2YG6A 5BUKA 2QAEA 3SFDA 3AYJA 4EQWA 2B9YA 3DA1A 1GRAA 3QFBA 2X50A 3B6DA 1NEKA 2R0GA 2Y6RA 4B65A 4K7ZA 2YVJA 3RP7A 3UKFA 3ICRA 3QVRA 4LU6A 1PDHA 2APGA 3FMWA 4H4YA 1EL9A 4YTPA 3AEBA 4P9SA 2X99A 1IUVA 3ABVA 2XLUA 1ZX9A 2E4GA 5J7XA 2Z5YA 4A65A 2BK3A 2PHHA 1PJ6A 3CNTA 3NT6A 1KN0A 2JKCA 4EM3A 2VVLA 4E0VA 3DJEA 4U8NA 4CCQA 4WX1A 3REDA 1H86A 4USRA 1K0LA 4OVIA 5EBKA 3AEGA 1Y0PA 2C7GA 4ADWA 4C77A 2RGJA 3M12A 4FK1C 4J2WA 4G6GA 4IVMB 2GAHB 1RP0A 3SQPA 3CPJG 3SXIA 2B7SA 3LADA 1NHPA 4FX9A 4H2PA 4B68A 3DGHA 4USQA 3AEDA 4EIQA 3C4AA 3KPKA 1XPQA 5CKUA 2BA9A 3UKAA 2RGOA 4J31A 2V60A 2YG3A 4EIPA 2V6OA 3P4SA 4Y4MA 3CNPA 1D4DA 1TDEA 2VQBA 3NLCA 3T0KA 1GESA 2WHDA 2GQWA 2GQFA 4JN9A 4DSHA 2X8HA 1YKJA 3NYEA 4XXGA 5KOWA 3CGCA 1B5QA 4DSGA 3NRNA 2XFPA 4Z44A 3AD7B 1EL8A 4JNAA 3IC9A 3IHMA 2VQ7A 1P2HA 5FMHA 4XWZA 2BRYA 3GDNA 1KNPA 3AWIA 5EB5A 5M0ZA 2C72A 2R4JA 2XVEA 3T14A 4CY6A 1D7YA 4G9KA 2BXRA 1N4WA 1ONFA 4U8PA 1DNCA 1DJQA 2YG5A 3NN6X 1REOA 3NH3X 4A9WA 3NHOX 3ATRA 1FOHA 4IV9A 1LJ1A 1TDOA 4NTCA 3EPTA 3NYFA 1BGJA 1NENA 1O94A 1GETA 1D5TA 2AR8A 4B1BA 4AOSA 1S2YA 4J34A 3D9XA 5BVAA 2E5VA 4YKGA 2YQUA 1K0IA 3IF9A 4A99A 3GYJA 1F8RA 4U8KA 2R0PA 1YQ3A 2GV8A 2B9WA 3LXDA 4PAAA 4APNA 1K0JA 1PBFA 4OCGA 1CJCA 3DJDA 1K4QA 3UTGA 2O9ZA 3NYCA 1QO8A 4C5OA 1GNDA 2C66A 3I3LA 5KXJA 3OC4A 4NZHA 3AD9B 2VOUA 1L0VA 3CMMA 3LB8A 1JU2A 1KFYA 3QJ4A 3SZCA 3V76A 1DOEA 4H4WA 3P1WA 2OA1A 2R4EA 3AYIA 1UKVG 2ARDA 4U8JA 3T2YA 3AB1A 1H2IA 2FJDA 4JY3A 3AE4A 1LVLA 3GD3A 1KSUA 1E1KA 3SZFA 1GRHA 1MO9A 1CF3A 1ZP0A 4U8MA 3VRDB 3RHAA 2YLZA 3DH9A 1L9EA 4UDQA 4EMJA 5KNLA 2WOVA 1H81A 1PN0A 3UKKA 3UOVA 1JOAA 4II2A 1EL5A 1PXBA 2BCGG 4X9MA 4U8OA 4BURA 3K30A 1XDIA 3SY4A 1DODA 1ZMDA 2R9ZA 3QSSA 2WPFA 2YWLA 1LTXR 2OLNA 2C3DA 2GF3A 1DOCA 3IHGA 4K2XA 3K7MX 4H4RA 3VR8A 1NHSA 2R46A 2Q0LA 3BI5A 1JEHA 3PO7A 4I59A 4MJWA 2C3CA 3LOVA 2EQ7A 2J3NA 4H2QA 5FS6A 3AE5A 3AE6A 4JDRA 4M52A 1NDAA 3AEEA 5U63A 4EQSA 1S7MA 1H7XA 2JBVA 3UKQA 1GREA 4H50A 4OPDA 5JCKA 1H7WA 2VVMA 4Y4NA 4GRTA 1ZK7A 3ITJA 4DNAA 1V59A 1XHCA 1F8WA 4Y4LA 3ZYXA 1MOKA 4B69A 2GAGB 3AYLA 1OJCA 4X4JA 1GOSA 2C70A 5TR3A 5EB4A 3BI2A 4FK1A 2ZZ0A 3QSMA 3CGEA 1TRBA 3BHKA 2C75A 5HYMA 1E1MA 3AE8A 3CGBA 2C73A 3P4PA 3UTHA 2R45A 2FBWA 1Z6LA 4J57A 3ICSA 3KU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z43 A;  2E1M A;  1IJH A;  4ECH A;  1F8S A;  5JCN A;  2YLS A;  2BS4 A;  3LZW A;  2WDR A;  3BHF A;  3AE1 A;  1H84 A;  1S3E A;  4Z2T A;  2GB0 A;  3VRA A;  4CCR A;  3II4 A;  4DGK A;  2WP9 A;  4B63 A;  4EQR A;  4GCM A;  2VZ2 A;  1ZKQ A;  3UKP A;  4D04 A;  2A89 A;  2XLT A;  1DOB A;  3ICT A;  2Q7V A;  5FS8 A;  1PXA A;  3HZL A;  4OPG A;  1H82 A;  3CN8 A;  3IWA A;  1RSG A;  2ZBW A;  2XDO A;  4H4U A;  3M0O A;  1KNR A;  3GMC A;  4U2T A;  5KWF A;  3NG7 X;  4B67 A;  4LA1 A;  4AOX A;  2WPC A;  1JRZ A;  3VRB A;  4IVO B;  4EM4 A;  4H7U A;  4A79 A;  4EQX A;  1OJ9 A;  4K5S A;  1S2Q A;  4J36 A;  5IQ1 A;  4B66 A;  2YVF A;  2C65 A;  2V3A A;  3NGC X;  3AXB A;  4YTN A;  3GRS A;  1TDF A;  5M10 A;  1PBD A;  1BKW A;  1CJ3 A;  1F3P A;  3KVE A;  3C4N A;  2GMH A;  5BRT A;  2GRT A;  4H2R A;  1YQ4 A;  3NNE A;  2GH5 A;  3ATQ A;  3DJJ A;  4D03 A;  1NHR A;  4U8I A;  4JY2 A;  3D1C A;  4A6N A;  1L9C A;  2IID A;  2WDV A;  4Z2U A;  1OJD A;  1GTE A;  1LQU A;  1PS9 A;  1GTH A;  1CC4 A;  3DK4 A;  3AEA A;  2VRL A;  5HXI A;  3NTA A;  4H2N A;  4AT2 A;  2QA2 A;  2BAB A;  4CNK A;  4H4Q A;  1DJN A;  4JNQ A;  4UDR A;  4A5L A;  1YQZ A;  2X3N A;  2FJA A;  4TLX A;  2YR6 A;  3UP5 A;  3ADA B;  1PHH A;  1ZY8 A;  3V3N A;  3RP8 A;  1VG9 A;  5KVI A;  2XLS A;  3CPI G;  1GV4 A;  1B8S A;  5ER0 A;  3DME A;  1SEZ A;  5C2T A;  4C3X A;  4GDP A;  1PBB A;  1PXC A;  4AP1 A;  4EMI A;  3GYI A;  4C74 A;  2DKH A;  4X9N A;  1GER A;  3ALM A;  4K5R A;  1P2E A;  4U2L A;  1S3B A;  2H88 A;  1B37 A;  4REK A;  1N1P A;  2ZZC A;  3FPZ A;  2XVI A;  2XCG A;  3BI4 A;  2ACZ A;  1NAA A;  1TYP A;  1QJD A;  3G5S A;  3AEC A;  3GSI A;  1GXF A;  3COX A;  2WOW A;  3AE7 A;  3AEF A;  1CHU A;  3FG2 P;  2TPR A;  4GF7 A;  3UP4 A;  4NTE A;  3SM8 A;  3EAN A;  1N4U A;  3CIR A;  4YSX A;  1ZOY A;  4ZCC A;  1JRX A;  1VDC A;  2C67 A;  2YLX A;  1TDK A;  4N9X A;  5KVH A;  3CNS A;  1XAN A;  4H4T A;  3KPF A;  3KLJ A;  3F8D A;  2BCP A;  1F6M A;  2BAC A;  1NG4 A;  2XVH A;  1QLB A;  1CJ4 A;  3BNM A;  2YVG A;  5JCL A;  3UOZ A;  2EQ9 A;  5FS9 A;  1GPE A;  3H8I A;  3CPH G;  2AAQ A;  3ZDN A;  2XYO A;  1KSS A;  3B3R A;  4TLZ A;  3NN0 X;  1VQW A;  3EAO A;  4U2S A;  1E6E A;  1LPF A;  1JNR A;  2WP5 A;  3FBS A;  2BYB A;  2BXS A;  1ZOV A;  2NPX A;  1GRF A;  2XFO A;  5JCM A;  4YT0 A;  2Z5X A;  5U1O A;  3NK1 X;  4KX6 A;  3C96 A;  3ALL A;  1LV0 A;  5J60 A;  3K7T A;  1FCD A;  2YAU A;  3AE2 A;  2V61 A;  2CFY A;  1IUX A;  3CTY A;  4GR1 A;  1NG3 A;  3D8X A;  5GSN A;  5BUL A;  2YG4 A;  1EBD A;  2X8G A;  4H4S A;  1KDG A;  3ISH A;  2X8C A;  3WE0 A;  4AT0 A;  2A87 A;  3KA7 A;  2XLP A;  3UTF A;  1H83 A;  4Z24 A;  4J33 A;  2JK6 A;  1NPX A;  2C76 A;  2WET A;  4YTM A;  1H6V A;  4OPI A;  1IUS A;  1PBC A;  1X31 B;  3KD9 A;  4OPL A;  4PAB A;  1BWC A;  5L46 A;  3QVP A;  4RG4 A;  2WOI A;  3URH A;  1TDN A;  3DK8 A;  5U25 A;  3AE3 A;  1OJT A;  2YLW A;  3P4Q A;  3VR9 A;  3V3O A;  2C64 A;  1GAL A;  2JB2 A;  1N4V A;  3H4K A;  1CL0 A;  2I0Z A;  3LZX A;  4HB9 A;  5HHF A;  3GMB A;  1CC6 A;  1LQT A;  1EL7 A;  4H4P A;  1D4E A;  3NK0 X;  2IVD A;  1E39 A;  4ZN0 A;  2GEW A;  1Q9I A;  3DGZ A;  3K7Q X;  4YSY A;  2EQ8 A;  1GSN A;  4B64 A;  2H89 A;  4ICY A;  3GDP A;  3ALJ A;  4CBQ A;  2YLR A;  3BNU A;  2AQJ A;  2WDQ A;  2XFU A;  4HA6 A;  4Z26 A;  4JQ9 A;  4BJZ A;  3CNJ A;  3RP6 A;  2QA1 A;  3L8K A;  3QSE A;  2Q6U A;  5LV9 A;  2YLT A;  3H8L A;  3GRT A;  4KPR A;  4O5Q A;  4TM3 A;  3DK9 A;  4RSL A;  2YR4 A;  3T37 A;  2CVJ A;  1FEA A;  3F8P A;  3L1R A;  4IA6 A;  1OJA A;  1W4X A;  2WS3 A;  3JSK A;  3KKJ A;  2RGH A;  2B7R A;  2PYX A;  3EF6 A;  5JCI A;  5IPY A;  1MXT A;  4NTD A;  3SGL A;  3UKL A;  2GR1 A;  1PJ7 A;  1AOG A;  2FJE A;  3O0H A;  4AP3 A;  2WPE A;  1CBO A;  3PS9 A;  4ZCD A;  4OPC A;  3AE9 A;  2BS2 A;  4GUV A;  1O5W A;  4K22 A;  1IUT A;  2WU5 A;  3NK2 X;  3GD4 A;  1GRG A;  2BS3 A;  2A8X A;  2F5Z A;  3UOX A;  4K8D A;  5IQ4 A;  2YM1 A;  2BK4 A;  1PBE A;  2OAM A;  4OPU A;  3S61 A;  4WCT A;  4UDP A;  3VQR A;  1GT8 A;  5HY5 A;  4Z2R A;  4IA5 A;  4FDC B;  2BC0 A;  4H4X A;  5FS7 A;  2Y6Q A;  4TM0 A;  4O5U A;  1GRB A;  4BJY A;  1Y56 A;  4YWO A;  1GRT A;  4GDE A;  2FJB A;  1BGN A;  1D4C A;  4H4Z A;  4BV6 A;  5EOW A;  3R9U A;  3G5R A;  1TYT A;  3UCL A;  1ELI A;  3LJP A;  3G5Q A;  3CGD A;  4LII A;  4YXD A;  4YSZ A;  4UP3 A;  3UKH A;  2B9X A;  2XLR A;  5C3J A;  1GEU A;  1E7P A;  3P4R A;  2JB1 A;  3P9U A;  2WP6 A;  4EMW A;  1JNZ A;  4U8L A;  4J56 A;  2YR5 A;  3PVC A;  2GR2 A;  3UTE A;  1COY A;  1L9D A;  1PJ5 A;  1Q1R A;  3SFE A;  5CQF A;  5DBJ A;  1D7L A;  4CY8 A;  4RG3 A;  1FEB A;  3QFA A;  2JB3 A;  1VG0 A;  4I58 A;  1ZMC A;  2TMD A;  4XWR A;  2GMJ A;  3NKS A;  3Q6J A;  2EQ6 A;  5GRT A;  5KRQ A;  2CUL A;  4YKF A;  2GVC A;  2VVL G;  1HYU A;  4TM4 A;  3CND A;  3S5W A;  4C3Y A;  2IVE A;  1JRY A;  1M64 A;  2YG7 A;  2GR3 A;  1Q1W A;  4A7A A;  1VRQ B;  4A6N B;  2CDU A;  2DKI A;  1BZL A;  2RAB A;  2WBA A;  3E1T A;  3FIM B;  4NEV A;  3GWF A;  4H4V A;  2WES A;  3I6D A;  3NTD A;  3Q9T A;  4CRT A;  1CC2 A;  2OLO A;  4YSH A;  1NHQ A;  2YM2 A;  1B4V A;  1DXL A;  3GWD A;  2WQY A;  2JAE A;  2Q0K A;  1E1N A;  2WEU A;  4TM1 A;  2BC1 A;  4BK1 A;  2W0H A;  3RNM A;  1E1L A;  2QCU A;  1M6I A;  1IUU A;  2XVF A;  2BK5 A;  3M13 A;  4OPT A;  1BF3 A;  2WU2 A;  4BK3 A;  1Y56 B;  1IUW A;  2VRM A;  4Z25 A;  3AD8 B;  2B76 A;  3DJG X;  2GR0 A;  1YY5 A;  2ZZB A;  4NEW A;  1KF6 A;  3F8R A;  3NIX A;  2HQM A;  1RYI A;  2XVJ A;  2V3B A;  1ZDL A;  2OAL A;  2UZZ A;  1FL2 A;  4BK2 A;  2NVK X;  1O95 A;  2V5Z A;  1CJ2 A;  2XFQ A;  1FEC A;  3OZ2 A;  3UOY A;  4CNJ A;  5KOX A;  2XFN A;  2R0C A;  2YG6 A;  5BUK A;  2QAE A;  3SFD A;  3AYJ A;  4EQW A;  2B9Y A;  3DA1 A;  1GRA A;  3QFB A;  2X50 A;  3B6D A;  1NEK A;  2R0G A;  2Y6R A;  4B65 A;  4K7Z A;  2YVJ A;  3RP7 A;  3UKF A;  3ICR A;  3QVR A;  4LU6 A;  1PDH A;  2APG A;  3FMW A;  4H4Y A;  1EL9 A;  4YTP A;  3AEB A;  4P9S A;  2X99 A;  1IUV A;  3ABV A;  2XLU A;  1ZX9 A;  2E4G A;  5J7X A;  2Z5Y A;  4A65 A;  2BK3 A;  2PHH A;  1PJ6 A;  3CNT A;  3NT6 A;  2JKC A;  4EM3 A;  2VVL A;  4E0V A;  3DJE A;  4U8N A;  4CCQ A;  4WX1 A;  3RED A;  1H86 A;  4USR A;  1K0L A;  4OVI A;  5EBK A;  3AEG A;  1Y0P A;  2C7G A;  4ADW A;  4C77 A;  2RGJ A;  3M12 A;  4FK1 C;  4J2W A;  4IVM B;  2GAH B;  1RP0 A;  3SQP A;  3CPJ G;  2B7S A;  3LAD A;  1NHP A;  4FX9 A;  4H2P A;  4B68 A;  3DGH A;  4USQ A;  3AED A;  4EIQ A;  3C4A A;  1XPQ A;  5CKU A;  2BA9 A;  3UKA A;  2RGO A;  4J31 A;  2V60 A;  2YG3 A;  4EIP A;  2V6O A;  3P4S A;  4Y4M A;  3CNP A;  1D4D A;  1TDE A;  2VQB A;  3NLC A;  4DSH A;  1GES A;  2WHD A;  2GQW A;  2GQF A;  4JN9 A;  2X8H A;  1YKJ A;  3NYE A;  4XXG A;  5KOW A;  3CGC A;  1B5Q A;  4DSG A;  3NRN A;  2XFP A;  4Z44 A;  3AD7 B;  1EL8 A;  4JNA A;  3IC9 A;  3IHM A;  2VQ7 A;  1P2H A;  5FMH A;  4XWZ A;  3GDN A;  1KNP A;  3AWI A;  5EB5 A;  5M0Z A;  2C72 A;  2R4J A;  2XVE A;  4CY6 A;  1D7Y A;  2BXR A;  1N4W A;  1ONF A;  4U8P A;  1DNC A;  1DJQ A;  2YG5 A;  3NN6 X;  1REO A;  3NH3 X;  4A9W A;  3NHO X;  3ATR A;  1FOH A;  4IV9 A;  1LJ1 A;  1TDO A;  4NTC A;  3EPT A;  3NYF A;  1BGJ A;  1NEN A;  1O94 A;  1GET A;  1D5T A;  2AR8 A;  4B1B A;  4AOS A;  1S2Y A;  4J34 A;  5BVA A;  2E5V A;  4YKG A;  2YQU A;  1K0I A;  3IF9 A;  4A99 A;  3GYJ A;  1F8R A;  4U8K A;  2R0P A;  1YQ3 A;  2GV8 A;  2B9W A;  3LXD A;  4PAA A;  4APN A;  1K0J A;  1PBF A;  4OCG A;  1CJC A;  3DJD A;  1K4Q A;  3UTG A;  2O9Z A;  3NYC A;  1QO8 A;  4C5O A;  1GND A;  2C66 A;  3I3L A;  5KXJ A;  3OC4 A;  4NZH A;  3AD9 B;  2VOU A;  1L0V A;  3LB8 A;  1JU2 A;  1KFY A;  3QJ4 A;  3V76 A;  1DOE A;  4H4W A;  3P1W A;  2OA1 A;  2R4E A;  3AYI A;  1UKV G;  2ARD A;  4U8J A;  3AB1 A;  2FJD A;  4JY3 A;  3AE4 A;  1LVL A;  3GD3 A;  1KSU A;  1E1K A;  1GRH A;  1MO9 A;  1CF3 A;  1ZP0 A;  4U8M A;  3VRD B;  3RHA A;  2YLZ A;  3DH9 A;  1L9E A;  4UDQ A;  4EMJ A;  2WOV A;  1H81 A;  1PN0 A;  3UKK A;  3UOV A;  1JOA A;  1EL5 A;  1PXB A;  2BCG G;  4X9M A;  4U8O A;  4BUR A;  3K30 A;  1XDI A;  1DOD A;  1ZMD A;  2R9Z A;  3QSS A;  2WPF A;  2YWL A;  1LTX R;  2OLN A;  2C3D A;  2GF3 A;  1DOC A;  3IHG A;  4K2X A;  3K7M X;  4H4R A;  3VR8 A;  1NHS A;  2R46 A;  2Q0L A;  3BI5 A;  1JEH A;  3PO7 A;  4I59 A;  4MJW A;  2C3C A;  3LOV A;  2EQ7 A;  2J3N A;  4H2Q A;  5FS6 A;  3AE5 A;  3AE6 A;  4JDR A;  4M52 A;  1NDA A;  3AEE A;  5U63 A;  4EQS A;  1H7X A;  2JBV A;  3UKQ A;  1GRE A;  4H50 A;  4OPD A;  5JCK A;  1H7W A;  2VVM A;  4Y4N A;  4GRT A;  1ZK7 A;  3ITJ A;  4DNA A;  1V59 A;  1XHC A;  1F8W A;  4Y4L A;  3ZYX A;  1MOK A;  4B69 A;  2GAG B;  3AYL A;  1OJC A;  4X4J A;  1GOS A;  2C70 A;  5TR3 A;  5EB4 A;  3BI2 A;  4FK1 A;  2ZZ0 A;  3QSM A;  3CGE A;  1TRB A;  3BHK A;  2C75 A;  5HYM A;  1E1M A;  3AE8 A;  3CGB A;  2C73 A;  3P4P A;  3UTH A;  2R45 A;  2FBW A;  1Z6L A;  4J57 A;  3ICS A;  3KU9 A; 
#chains in the Genus database with same CATH topology
 4Z43 A;  2E1M A;  2AKM A;  4ECH A;  3VRA A;  4M6U A;  2WP9 A;  4EQR A;  4B63 A;  1FFV C;  3DDM A;  3UKP A;  2A89 A;  2XLT A;  4FI4 A;  2Q7V A;  1PXA A;  1EC7 A;  2ZBW A;  4H4U A;  4F4R A;  4B67 A;  3H70 A;  3ZLF A;  4A79 A;  4EM4 A;  5IQ1 A;  4B66 A;  1T3Q C;  3GRS A;  1CJ3 A;  1F3P A;  1YQ4 A;  2GH5 A;  3DJJ A;  4G73 A;  4U8I A;  3D1C A;  3I4K A;  1OJD A;  1CC4 A;  3DK4 A;  2VRL A;  4CNK A;  3DEQ A;  1DJN A;  2X3N A;  3UP5 A;  3V3W A;  3ADA B;  1MNS A;  1PHH A;  3RP8 A;  4C3X A;  4G8T A;  4EMI A;  3GYI A;  4C74 A;  3CXB A;  3ALM A;  3GYX A;  2H88 A;  4K1W A;  2ZZC A;  2XVI A;  1NAA A;  1QJD A;  3AEC A;  5KMQ A;  4N9X A;  3CNS A;  1XAN A;  3KPF A;  2XVH A;  1GPE A;  4HNL A;  2AAQ A;  3ZDN A;  4TLZ A;  4U2S A;  1VQW A;  3P3B A;  1JNR A;  4GIR A;  2BXS A;  2XFO A;  4HN8 A;  1LV0 A;  1FCD A;  3UJS A;  3P0W A;  3CTY A;  5GSN A;  2XH7 A;  4GAV A;  3ISH A;  1L8P A;  1XPY A;  4AT0 A;  2A87 A;  1XS2 A;  1NU5 A;  4Z24 A;  4J33 A;  2C76 A;  1F9C A;  1IUS A;  1PBC A;  1PDY A;  3KD9 A;  4OPL A;  4PAB A;  5U25 A;  3AE3 A;  1MDR A;  1OJT A;  2YLW A;  3P4Q A;  3N6H A;  3SZ0 A;  3NK0 X;  1BKH A;  2GEW A;  3DGZ A;  3K7Q X;  1TZZ A;  1GSN A;  4B64 A;  2H89 A;  4CBQ A;  4H1Z A;  2WDQ A;  2XFU A;  4JQ9 A;  4BJZ A;  3UJR A;  3CNJ A;  5KMS A;  4GAP A;  3SX6 A;  3QSE A;  2YLT A;  3H8L A;  4KPR A;  2PGE A;  3DK9 A;  4RSL A;  3T37 A;  1FEA A;  2OO6 A;  2B7R A;  1ZXI C;  3EF6 A;  3N4F A;  3PG6 A;  1AOG A;  2FJE A;  3PS9 A;  4K22 A;  2WU5 A;  2W3R A;  3R0K A;  4Z2R A;  4IA5 A;  5FS7 A;  2Y6Q A;  4O5U A;  1GRB A;  1TE6 A;  1GRT A;  3CYJ A;  3EEZ A;  3I6E A;  3G5R A;  1ELI A;  4UP3 A;  2XLR A;  5C3J A;  1GEU A;  4J56 A;  1COY A;  4DN1 A;  4CY8 A;  4RG3 A;  1FEB A;  1VG0 A;  3TTE A;  4G6H A;  3U9I A;  3Q6J A;  2AL1 A;  4YKF A;  2VVL G;  1HYU A;  3GY1 A;  4GYP A;  2IVE A;  1VRQ B;  3OZY A;  3NTD A;  2W54 A;  3GWF A;  4H4V A;  4CRT A;  2OLO A;  1NHQ A;  2YM2 A;  4E5T A;  4MGG A;  1E1N A;  2OX4 A;  4OPT A;  3AD8 B;  3DJG X;  4NEW A;  3F8R A;  3NIX A;  2UZZ A;  2V5Z A;  2XFQ A;  3UOY A;  1SJC A;  4CNJ A;  4KEM A;  1KCZ A;  3QVR A;  4LU6 A;  3GO2 A;  4H4Y A;  5FJP A;  4YTP A;  2Z5Y A;  2PHH A;  3EKG A;  1KN0 A;  2POD A;  4EM3 A;  3RED A;  5EBK A;  3AEG A;  4ADW A;  2RGJ A;  4FK1 C;  1RP0 A;  2E3T A;  3R1Z A;  1NHP A;  4FX9 A;  2HNE A;  4H2P A;  2PSN A;  3DGH A;  3AED A;  3RR1 A;  1KKO A;  4J31 A;  5EU9 A;  2VQB A;  1RM6 B;  3SN1 A;  2GQF A;  1YKJ A;  3NYE A;  1B5Q A;  1EL8 A;  3IC9 A;  4TVY A;  1JPD X;  3GDN A;  5EB5 A;  5M0Z A;  2DW6 A;  2XVE A;  3VC5 A;  3NH3 X;  1FOH A;  1LJ1 A;  1TDO A;  5ENL A;  3EPT A;  1BGJ A;  1GET A;  3IK4 A;  2QJN A;  4J34 A;  3MZN A;  1K0I A;  3IF9 A;  2GGG A;  2R0P A;  2B9W A;  4APN A;  1PBF A;  2PTY A;  1CJC A;  3UTG A;  2O9Z A;  1VQZ A;  3AD9 B;  3D46 A;  3CMM A;  3A7A A;  2OA1 A;  2ARD A;  3AE4 A;  1LVL A;  3GD3 A;  1E1K A;  1GRH A;  4U8M A;  2WOV A;  1H81 A;  3UOV A;  3MUC A;  3Q4D A;  3K30 A;  1ZMD A;  4H4R A;  1JEH A;  4MJW A;  3SQS A;  4GME A;  3AE5 A;  3AE6 A;  1SJA A;  5U63 A;  3ZLH A;  3AMZ A;  1S7M A;  1H7X A;  2JBV A;  1GRE A;  4H50 A;  4ENL A;  4OPD A;  4Y4N A;  4GRT A;  1ZK7 A;  2OFJ A;  1F8W A;  4Y4L A;  4X4J A;  3TWB A;  2GL5 A;  2C70 A;  3CAW A;  5EB4 A;  3QSM A;  3BHK A;  5HYM A;  1E1M A;  3AE8 A;  2C73 A;  2R45 A;  2FBW A;  3ICS A;  5JCN A;  2BS4 A;  3LZW A;  3AE1 A;  1S3E A;  2GB0 A;  4DGK A;  4KWS A;  4GCM A;  3QN3 A;  1ZKQ A;  4D04 A;  5FS8 A;  1ELS A;  3CN8 A;  4A6G A;  4U2T A;  5KWF A;  3NG7 X;  4LA1 A;  2C4C A;  3VRB A;  4IVO B;  2PTX A;  4EQX A;  1OJ9 A;  4K5S A;  4J36 A;  2YVF A;  3L5O A;  3QPE A;  4YTN A;  1TDF A;  5M10 A;  4MMW A;  3KVE A;  2GRT A;  3NNE A;  4GGB A;  3ATQ A;  4D03 A;  1P43 A;  3DFH A;  2P8B A;  3NZG A;  3TWA A;  4A6N A;  3AEA A;  5HXI A;  4AT2 A;  4H4Q A;  3FYY A;  4A5L A;  4TLX A;  2YR6 A;  3V3N A;  1VG9 A;  1IYX A;  5KVI A;  2XSX A;  1GV4 A;  2PS2 A;  5ER0 A;  1PXC A;  6ENL A;  2QQ6 A;  2DKH A;  4X9N A;  4H19 A;  4U2L A;  1B37 A;  2XCG A;  3FXG A;  1CHU A;  4GF7 A;  3SM8 A;  1ZOY A;  3S47 A;  4ZCC A;  2W55 A;  5KVH A;  4H4T A;  3KUM A;  1OEP A;  3F8D A;  2BAC A;  1NG4 A;  1FHV A;  2O56 A;  1E6E A;  3DG7 A;  1ZOV A;  2NPX A;  5JCM A;  3D47 A;  3C96 A;  4JN7 A;  2HXT A;  3NXL A;  1R0M A;  2V61 A;  4GR1 A;  3T4W A;  3D8X A;  5BUL A;  2YG4 A;  4H4S A;  3WE0 A;  3ES7 A;  3UTF A;  1H83 A;  1KD0 A;  1X31 B;  4RG4 A;  3OW1 A;  3DK8 A;  4NNJ A;  3VR9 A;  3P93 A;  1GAL A;  2JB2 A;  1JRP A;  3H4K A;  2I0Z A;  5HHF A;  1N5X A;  4H4P A;  2IVD A;  3MWC A;  3BSM A;  1E39 A;  4YSY A;  3GDP A;  3N6J A;  2AQJ A;  4HA6 A;  4Z26 A;  2QA1 A;  2Q6U A;  5LV9 A;  4O5Q A;  2YR4 A;  2CVJ A;  4IA6 A;  1X2G A;  1BQG A;  1OJA A;  1W4X A;  3L1R A;  4GIS A;  2ZC8 A;  1PJ7 A;  3Q45 A;  4OPC A;  2BS2 A;  4X2P A;  2A8X A;  3DFY A;  3UOX A;  2BK4 A;  2OAM A;  2ZAD A;  4OPU A;  3S61 A;  4UDP A;  3HYW A;  1WYG A;  4YWO A;  3BOX A;  2FJB A;  1D4C A;  4H4Z A;  3R9U A;  3UCL A;  4HCH A;  4Z17 A;  4G7F A;  2B9X A;  1E7P A;  3P9U A;  4EMW A;  2YR5 A;  1L9D A;  1Q1R A;  1D7L A;  1ZMC A;  2GMJ A;  2PP0 A;  5FJO A;  2GVC A;  1JRY A;  2YG7 A;  2GR3 A;  3VC6 A;  2CDU A;  5KMR A;  1BZL A;  2WBA A;  3FIM B;  3VCN A;  2WES A;  1EC8 A;  1DXL A;  2WEU A;  4BK1 A;  2W0H A;  1IUU A;  2XVF A;  2BK5 A;  3R11 A;  4MKS A;  1BF3 A;  3OP2 A;  1IUW A;  4Z25 A;  2BRA A;  1KF6 A;  1N61 C;  3HYV A;  2XVJ A;  2V3B A;  1ZDL A;  1FL2 A;  1O95 A;  1CJ2 A;  3OZ2 A;  2XFN A;  2OZ3 A;  2YG6 A;  2QAE A;  3TJ4 A;  3SFD A;  3DA1 A;  2Y6R A;  3JZU A;  2YVJ A;  2NQL A;  3UKF A;  3ICR A;  2PTW A;  3AEB A;  3ABV A;  4A65 A;  2XLU A;  2E4G A;  3OPS A;  2BK3 A;  3RCY A;  2JKC A;  2VVL A;  3DJE A;  4Z1Y A;  3UJF A;  4CCQ A;  4WX1 A;  1H86 A;  3CXO A;  3NO1 A;  4IP5 A;  4G6G A;  2GAH B;  3CPJ G;  3IJQ A;  3HRD C;  4USQ A;  2GGH A;  3C4A A;  3KPK A;  1XPQ A;  3MY9 A;  1EBG A;  2V6O A;  1TDE A;  4IP4 A;  4JN9 A;  2GQW A;  2OKT A;  3R0U A;  3TCS A;  3CT2 A;  4GGH A;  5KOW A;  4DSG A;  4A35 A;  3AD7 B;  4JNA A;  4HNC A;  1FO4 A;  1P2H A;  4DWD A;  2BRY A;  3AWI A;  2C72 A;  1JDF A;  4U8P A;  1DNC A;  2YG5 A;  3NN6 X;  5BOE A;  4IV9 A;  2XH4 A;  4NTC A;  1NEN A;  4B1B A;  3D9X A;  3RRA A;  5BVA A;  4A99 A;  3V5F A;  1YQ3 A;  2GV8 A;  4OCG A;  1K4Q A;  3UCC A;  3NYC A;  1GND A;  3I3L A;  5KXJ A;  2VOU A;  4IL0 A;  1L0V A;  3V76 A;  1KFY A;  3SZC A;  4H4W A;  5FJT A;  1SB3 B;  3NVW B;  2R4E A;  3AYI A;  1UKV G;  4M0X A;  3NVZ B;  4UDQ A;  1JOA A;  1EL5 A;  4U8O A;  4BUR A;  3R10 A;  3QSS A;  2OLN A;  1N62 C;  2GF3 A;  1DOC A;  3VR8 A;  2Q0L A;  3BI5 A;  4I59 A;  2J3N A;  4JDR A;  3AEE A;  1TKK A;  3UKQ A;  5JCK A;  1H7W A;  5FJU A;  1V59 A;  2GGI A;  1XHC A;  3T9P A;  5TR3 A;  4HCD A;  3CGB A;  3P4P A;  3VFC A;  1Z6L A;  2RAB A;  1IJH A;  1F8S A;  2WDR A;  1H84 A;  3II4 A;  2VZ2 A;  2MNR A;  1DOB A;  3ICT A;  4OPG A;  1H82 A;  4KPL A;  3IWA A;  3V5C A;  2XDO A;  1KNR A;  2WPC A;  3SSZ A;  1YEY A;  1S2Q A;  3DGB A;  2C65 A;  2V3A A;  3AXB A;  1PBD A;  3BJS A;  1N60 C;  3C4N A;  5FJR A;  1NHR A;  1WUE A;  4JY2 A;  1L9C A;  2IID A;  2WDV A;  1GTE A;  1LQU A;  2W3S A;  2QA2 A;  1YQZ A;  1ZY8 A;  3TQP A;  3DME A;  1SEZ A;  5C2T A;  4AP1 A;  3SYI A;  3UJ2 A;  1P2E A;  4REK A;  3BI4 A;  4J1O A;  1TYP A;  3G5S A;  1GXF A;  3COX A;  3AEF A;  3GD6 A;  3EAN A;  3CIR A;  3QLD A;  4ZA0 A;  1VDC A;  1JRO A;  3KLJ A;  3AM9 A;  2BCP A;  1EC9 A;  2YVG A;  3UOZ A;  5FS9 A;  3H8I A;  3V4B A;  3FJ4 A;  3B3R A;  3EAO A;  4GYP C;  4YT0 A;  3NK1 X;  4KX6 A;  2ONE A;  2YAU A;  2OQY A;  5BOF A;  2CFY A;  1IUX A;  1EBH A;  1EBD A;  2X8C A;  2FKP A;  2XLP A;  2JK6 A;  1NPX A;  4YTM A;  2PCE A;  3ENL A;  3PWI A;  1BWC A;  3QVP A;  3TW9 A;  3URH A;  3V3O A;  3LZX A;  1LQT A;  1EL7 A;  1FFU C;  4ZN0 A;  1V97 A;  4ICY A;  2POZ A;  3ALJ A;  2YLR A;  3BNU A;  3I6T A;  3L8K A;  3VDG A;  3GRT A;  3UJE A;  4TM3 A;  4H2H A;  2I5Q A;  3F8P A;  2WS3 A;  2P88 A;  2PYX A;  5JCI A;  4NTD A;  3NFU A;  4G74 A;  4AP3 A;  2WPE A;  4ZCD A;  3AE9 A;  4JHM A;  3NK2 X;  4WCT A;  3VQR A;  2BC0 A;  3SZW A;  4BJY A;  1BGN A;  1TYT A;  3G5Q A;  3CGD A;  4LII A;  4YXD A;  4H83 A;  3UKH A;  3NVY B;  3JW7 A;  2WP6 A;  3SJN A;  3PVC A;  1PJ5 A;  3SFE A;  5CQF A;  5DBJ A;  1VDV A;  2XH2 A;  2JB3 A;  3T2Z A;  4I58 A;  2TMD A;  3UXL A;  3NKS A;  5GRT A;  1NEL A;  2PA6 A;  3CND A;  4C3Y A;  3T31 A;  1M64 A;  4A7A A;  4A6N B;  2DKI A;  3FV9 A;  3E1T A;  4NEV A;  3I6D A;  3Q9T A;  3QKE A;  1CC2 A;  3HYX A;  3GWD A;  2WQY A;  2JAE A;  2Q0K A;  4IZG A;  5IDZ A;  4TM1 A;  3RNM A;  1SJD A;  4E4U A;  1M6I A;  1E1L A;  3M13 A;  2WU2 A;  2VRM A;  2B76 A;  3R07 C;  2GR0 A;  1YY5 A;  2ZZB A;  1RYI A;  4E6M A;  4BK2 A;  3CB3 A;  2NVK X;  2GSH A;  1FEC A;  3OTR A;  5KOX A;  2R0C A;  3AYJ A;  4EQW A;  4K8G A;  3QFB A;  2OG9 A;  1NEK A;  4KT2 A;  1EL9 A;  4P9S A;  1IUV A;  3B97 A;  4E0V A;  1K0L A;  2XGZ A;  3HPF A;  2P8C A;  3SQP A;  3SXI A;  2B7S A;  3LAD A;  3PWG A;  4IT1 A;  4IL2 A;  1JPM A;  3A7U A;  3TOY A;  3DG3 A;  3UKA A;  2RGO A;  2V60 A;  2YG3 A;  4EIP A;  4Y4M A;  1D4D A;  4DSH A;  2WHD A;  3FVD A;  4XXG A;  2QJJ A;  3NRN A;  4Z44 A;  3T14 A;  2QDE A;  2BXR A;  1DJQ A;  3H7V A;  3NHO X;  4J3Z A;  3MQT A;  2AR8 A;  4AOS A;  3NVV B;  3THU A;  2YQU A;  3GYJ A;  3LXD A;  2OZ8 A;  1K0J A;  3DJD A;  4C5O A;  3OC4 A;  1STZ A;  3P1W A;  1PDZ A;  4U8J A;  3T2Y A;  3AB1 A;  1H2I A;  4JY3 A;  3SZF A;  3VRD B;  3RHA A;  4EMJ A;  5KNL A;  4DHG A;  1PXB A;  1XDI A;  1DOD A;  2WPF A;  1LTX R;  2C3D A;  3IHG A;  4K2X A;  2E5A A;  1NHS A;  2R46 A;  3PO7 A;  2C3C A;  3LOV A;  2EQ7 A;  5FS6 A;  1ECQ A;  4EQS A;  2VVM A;  3DES A;  3ITJ A;  1MRA A;  4B69 A;  1MOK A;  3K1G A;  2PMQ A;  2GAG B;  3AYL A;  1GOS A;  4FK1 A;  2ZZ0 A;  3CGE A;  1TRB A;  2C75 A;  4IVM B;  3EUB 3;  3H8A A;  4GFI A;  2YLS A;  3BHF A;  4Z2T A;  3UXK A;  4CCR A;  4A3R A;  5KMP A;  2P0I A;  1JCT A;  3HZL A;  1RSG A;  3M0O A;  3GMC A;  4AOX A;  1JRZ A;  4H7U A;  2FYM A;  3DER A;  3UCD A;  2PU0 A;  3NGC X;  1BKW A;  2GMH A;  5BRT A;  4H2R A;  5JRB A;  2AKZ A;  4E4F A;  3T8Q A;  4DYE A;  2QDD A;  4Z2U A;  1PS9 A;  1GTH A;  3NTA A;  4H2N A;  2BAB A;  3B9J B;  4JNQ A;  4UDR A;  2OLA A;  2FJA A;  3PFR A;  3QTP A;  2XLS A;  1R6W A;  3CPI G;  1B8S A;  4GDP A;  1PBB A;  3IJI A;  1W6T A;  3T2K A;  1GER A;  4K5R A;  1MUC A;  1ONE A;  1S3B A;  2GDQ A;  1N1P A;  2HZG A;  3FPZ A;  2ACZ A;  4NWZ A;  3GSI A;  3ES8 A;  1N5W C;  2WOW A;  3AE7 A;  4DX3 A;  5J04 A;  3FG2 P;  2TPR A;  3UP4 A;  4NTE A;  3DIP A;  1N4U A;  4YSX A;  2HXU A;  1JRX A;  2C67 A;  2YLX A;  1TDK A;  4K2S A;  3SR6 B;  1F6M A;  1WUF A;  1QLB A;  1CJ4 A;  3BNM A;  5JCL A;  2EQ9 A;  3CPH G;  2XYO A;  1KSS A;  3NN0 X;  1RVK A;  1LPF A;  3FBS A;  2WP5 A;  2OPJ A;  2BYB A;  1GRF A;  5G5G B;  2Z5X A;  5U1O A;  3ALL A;  5J60 A;  3S5S A;  3K7T A;  4FP1 A;  3AE2 A;  1NG3 A;  2X8G A;  1KDG A;  2QVH A;  3KA7 A;  4ROP A;  2WET A;  1H6V A;  4OPI A;  4II3 A;  5L46 A;  2WOI A;  1TDN A;  1X2H A;  2C64 A;  1N4V A;  1CL0 A;  4HB9 A;  3GMB A;  3AN1 A;  1CC6 A;  1D4E A;  3UGV A;  3VA8 A;  3RO6 A;  4EWJ A;  1Q9I A;  2EQ8 A;  3HW2 A;  1N63 C;  3ZLG A;  3RP6 A;  2OVL A;  3FCP A;  3JSK A;  3KKJ A;  2RGH A;  4YWS A;  5IPY A;  4ZCW A;  3STP A;  2OQH A;  1MXT A;  3SGL A;  3UKL A;  2GR1 A;  3O0H A;  1CBO A;  2AL2 A;  4GUV A;  1O5W A;  1IUT A;  7ENL A;  3GD4 A;  1GRG A;  2BS3 A;  5IQ4 A;  2F5Z A;  4K8D A;  2YM1 A;  1PBE A;  5HY5 A;  1GT8 A;  4FDC B;  2GGJ A;  4H4X A;  4TM0 A;  1Y56 A;  4GDE A;  4BV6 A;  5EOW A;  1FIQ B;  3LJP A;  4YSZ A;  3P4R A;  2JB1 A;  3SN0 A;  1JNZ A;  4U8L A;  2DW7 A;  2GR2 A;  3UTE A;  2OZT A;  4DXK A;  3QFA A;  4XWR A;  4E8G A;  2EQ6 A;  5KRQ A;  2CUL A;  4TM4 A;  3S5W A;  1Q1W A;  2AL2 B;  3SN4 A;  3U4F A;  4YSH A;  1B4V A;  2BC1 A;  1E9I A;  2QCU A;  2PU1 A;  3CK5 A;  4BK3 A;  1Y56 B;  1DTN A;  3ZVI A;  2HQM A;  2OAL A;  3RGT A;  2RDX A;  3ETR B;  3PK7 A;  5BUK A;  2B9Y A;  1GRA A;  2X50 A;  3B6D A;  2R0G A;  4B65 A;  4K7Z A;  3RP7 A;  1PDH A;  2APG A;  3VCC A;  3FMW A;  3N4E A;  2X99 A;  5J7X A;  1ZX9 A;  2MUC A;  1PJ6 A;  3CNT A;  3NT6 A;  4U8N A;  3MSY A;  4USR A;  4JN8 A;  4OVI A;  1Y0P A;  2C7G A;  1SJB A;  4C77 A;  3M12 A;  4J2W A;  1MDL A;  4B68 A;  4HPN A;  4EIQ A;  5CKU A;  2BA9 A;  3GC2 A;  3RIT A;  4IHC A;  3P4S A;  4TVW A;  3H12 A;  3CNP A;  3DG6 A;  3T0K A;  3NLC A;  1GES A;  2X8H A;  2PGW A;  3R25 A;  3CGC A;  3T6C A;  2XFP A;  3OZM A;  2PPG A;  3IHM A;  2VQ7 A;  2CHR A;  5FMH A;  4XWZ A;  4ZOH B;  2PP3 A;  4HCL A;  1KNP A;  3ZVH A;  2R4J A;  2P3Z A;  2XH0 A;  4CY6 A;  1D7Y A;  4G9K A;  3NS1 B;  1N4W A;  1ONF A;  1REO A;  4A9W A;  3SBF A;  3ATR A;  2QJM A;  2GGE A;  3NYF A;  1O94 A;  1D5T A;  1S2Y A;  3NRZ B;  2E5V A;  4YKG A;  2QGY A;  1F8R A;  1KKR A;  4U8K A;  3A7R A;  4PAA A;  1QO8 A;  2C66 A;  4NZH A;  3LB8 A;  1JU2 A;  3QJ4 A;  1DOE A;  1P48 A;  2FJD A;  1KSU A;  1MO9 A;  1CF3 A;  1ZP0 A;  2YLZ A;  3DH9 A;  1L9E A;  3ZVH B;  2PTZ A;  3UKK A;  1PN0 A;  2PP1 A;  4II2 A;  3SY4 A;  2BCG G;  4X9M A;  1FHU A;  2R9Z A;  2YWL A;  3K7M X;  3IJL A;  4HYR A;  3MKC A;  4H2Q A;  4M52 A;  1NDA A;  3JVA A;  3TJI A;  4DNA A;  3ZYX A;  1OJC A;  3BI2 A;  5G5H B;  3UTH A;  4J57 A;  3KU9 A; 
#chains in the Genus database with same CATH homology
 4Z43 A;  2E1M A;  1IJH A;  4ECH A;  1F8S A;  5JCN A;  2YLS A;  2BS4 A;  3LZW A;  2WDR A;  3BHF A;  3AE1 A;  1H84 A;  1S3E A;  4Z2T A;  2GB0 A;  3VRA A;  4CCR A;  3II4 A;  4DGK A;  2WP9 A;  4B63 A;  4EQR A;  4GCM A;  5KMP A;  2VZ2 A;  1ZKQ A;  3UKP A;  4D04 A;  2A89 A;  2XLT A;  1DOB A;  3ICT A;  2Q7V A;  5FS8 A;  1PXA A;  3HZL A;  4OPG A;  1H82 A;  3CN8 A;  3IWA A;  1RSG A;  2ZBW A;  2XDO A;  4H4U A;  3M0O A;  1KNR A;  3GMC A;  4U2T A;  5KWF A;  3NG7 X;  4B67 A;  4LA1 A;  4AOX A;  2C4C A;  2WPC A;  1JRZ A;  3VRB A;  4IVO B;  4EM4 A;  4H7U A;  4A79 A;  4EQX A;  1OJ9 A;  4K5S A;  1S2Q A;  4J36 A;  5IQ1 A;  4B66 A;  2YVF A;  3L5O A;  2C65 A;  2V3A A;  3NGC X;  3AXB A;  4YTN A;  3GRS A;  1TDF A;  5M10 A;  1PBD A;  1BKW A;  1CJ3 A;  1F3P A;  3KVE A;  3C4N A;  2GMH A;  5BRT A;  2GRT A;  5JRB A;  1YQ4 A;  3NNE A;  4H2R A;  2GH5 A;  3ATQ A;  3DJJ A;  4D03 A;  4G73 A;  1NHR A;  4U8I A;  4JY2 A;  3D1C A;  4A6N A;  1L9C A;  2IID A;  2WDV A;  4Z2U A;  1OJD A;  1GTE A;  1LQU A;  1PS9 A;  1GTH A;  1CC4 A;  3DK4 A;  3AEA A;  2VRL A;  5HXI A;  3NTA A;  4H2N A;  4AT2 A;  2QA2 A;  2BAB A;  4CNK A;  4H4Q A;  1DJN A;  4JNQ A;  4UDR A;  4A5L A;  1YQZ A;  2X3N A;  2FJA A;  4TLX A;  2YR6 A;  3UP5 A;  3ADA B;  1PHH A;  1ZY8 A;  3V3N A;  3RP8 A;  1VG9 A;  5KVI A;  2XLS A;  3CPI G;  1GV4 A;  1B8S A;  5ER0 A;  3DME A;  1SEZ A;  5C2T A;  4C3X A;  4GDP A;  1PBB A;  1PXC A;  4AP1 A;  4EMI A;  3GYI A;  4C74 A;  3T2K A;  2DKH A;  4X9N A;  3SYI A;  1GER A;  3ALM A;  3GYX A;  4K5R A;  1P2E A;  4U2L A;  1S3B A;  2H88 A;  1B37 A;  4REK A;  1N1P A;  2ZZC A;  3FPZ A;  2XVI A;  2XCG A;  3BI4 A;  2ACZ A;  1NAA A;  1TYP A;  1QJD A;  3G5S A;  4NWZ A;  3AEC A;  3GSI A;  1GXF A;  3COX A;  2WOW A;  3AE7 A;  3AEF A;  1CHU A;  3FG2 P;  2TPR A;  4GF7 A;  3UP4 A;  4NTE A;  3SM8 A;  3EAN A;  1N4U A;  3CIR A;  4YSX A;  1ZOY A;  5KMQ A;  4ZCC A;  1JRX A;  1VDC A;  2C67 A;  2YLX A;  1TDK A;  4N9X A;  5KVH A;  3CNS A;  1XAN A;  4H4T A;  3KPF A;  3KLJ A;  3F8D A;  2BCP A;  1F6M A;  2BAC A;  1NG4 A;  2XVH A;  1QLB A;  1CJ4 A;  3BNM A;  2YVG A;  5JCL A;  3UOZ A;  2EQ9 A;  5FS9 A;  1GPE A;  3H8I A;  3CPH G;  2AAQ A;  3ZDN A;  2XYO A;  1KSS A;  3B3R A;  4TLZ A;  3NN0 X;  1VQW A;  3EAO A;  4U2S A;  1E6E A;  1LPF A;  1JNR A;  2WP5 A;  3FBS A;  2BYB A;  2BXS A;  1ZOV A;  2NPX A;  1GRF A;  2XFO A;  5JCM A;  4YT0 A;  2Z5X A;  5U1O A;  3NK1 X;  4KX6 A;  3C96 A;  3ALL A;  1LV0 A;  5J60 A;  3K7T A;  1FCD A;  2YAU A;  3AE2 A;  2V61 A;  2CFY A;  1IUX A;  3CTY A;  4GR1 A;  1NG3 A;  3D8X A;  5GSN A;  5BUL A;  2YG4 A;  1EBD A;  4GAV A;  2X8G A;  4H4S A;  1KDG A;  3ISH A;  2X8C A;  3WE0 A;  4AT0 A;  2A87 A;  3KA7 A;  2XLP A;  3UTF A;  1H83 A;  4Z24 A;  4J33 A;  2JK6 A;  1NPX A;  2C76 A;  2WET A;  4YTM A;  1H6V A;  4OPI A;  1IUS A;  1PBC A;  1X31 B;  3KD9 A;  4II3 A;  4OPL A;  4PAB A;  1BWC A;  5L46 A;  3QVP A;  4RG4 A;  2WOI A;  3URH A;  1TDN A;  3DK8 A;  5U25 A;  3AE3 A;  1OJT A;  2YLW A;  3P4Q A;  4NNJ A;  3V3O A;  3VR9 A;  2C64 A;  1GAL A;  2JB2 A;  1N4V A;  3H4K A;  1CL0 A;  2I0Z A;  3LZX A;  4HB9 A;  5HHF A;  3GMB A;  1CC6 A;  1LQT A;  3SZ0 A;  1EL7 A;  4H4P A;  1D4E A;  3NK0 X;  2IVD A;  1E39 A;  4ZN0 A;  2GEW A;  1Q9I A;  3DGZ A;  3K7Q X;  4YSY A;  2EQ8 A;  1GSN A;  4B64 A;  2H89 A;  4ICY A;  3GDP A;  3ALJ A;  4CBQ A;  2YLR A;  3BNU A;  2AQJ A;  2WDQ A;  2XFU A;  4HA6 A;  4Z26 A;  4JQ9 A;  4BJZ A;  3CNJ A;  5KMS A;  4GAP A;  3RP6 A;  2QA1 A;  3SX6 A;  3L8K A;  3QSE A;  2Q6U A;  5LV9 A;  2YLT A;  3H8L A;  3GRT A;  4KPR A;  4O5Q A;  4TM3 A;  3DK9 A;  4RSL A;  2YR4 A;  3T37 A;  2CVJ A;  1FEA A;  3F8P A;  3L1R A;  4IA6 A;  1OJA A;  1W4X A;  2WS3 A;  3JSK A;  3KKJ A;  2RGH A;  2B7R A;  2PYX A;  3EF6 A;  5JCI A;  5IPY A;  1MXT A;  4NTD A;  3SGL A;  3UKL A;  2GR1 A;  1PJ7 A;  3PG6 A;  1AOG A;  2FJE A;  3O0H A;  4G74 A;  4AP3 A;  2WPE A;  1CBO A;  3PS9 A;  4ZCD A;  4OPC A;  3AE9 A;  2BS2 A;  4GUV A;  1O5W A;  4K22 A;  1IUT A;  2WU5 A;  3NK2 X;  3GD4 A;  1GRG A;  2BS3 A;  2A8X A;  2F5Z A;  3UOX A;  4K8D A;  5IQ4 A;  2YM1 A;  2BK4 A;  1PBE A;  2OAM A;  4OPU A;  3S61 A;  4WCT A;  4UDP A;  3VQR A;  1GT8 A;  5HY5 A;  4Z2R A;  4IA5 A;  4FDC B;  2BC0 A;  3HYW A;  4H4X A;  5FS7 A;  2Y6Q A;  4TM0 A;  4O5U A;  1GRB A;  3SZW A;  4BJY A;  1Y56 A;  4YWO A;  1GRT A;  4GDE A;  2FJB A;  1BGN A;  1D4C A;  4H4Z A;  4BV6 A;  5EOW A;  3R9U A;  3G5R A;  1TYT A;  3UCL A;  1ELI A;  3LJP A;  3G5Q A;  3CGD A;  4LII A;  4YXD A;  4YSZ A;  4UP3 A;  3UKH A;  2B9X A;  2XLR A;  5C3J A;  1GEU A;  1E7P A;  3P4R A;  2JB1 A;  3P9U A;  2WP6 A;  4EMW A;  1JNZ A;  4U8L A;  4J56 A;  2YR5 A;  3PVC A;  2GR2 A;  3UTE A;  1COY A;  1L9D A;  1PJ5 A;  1Q1R A;  3SFE A;  5CQF A;  5DBJ A;  1D7L A;  4CY8 A;  4RG3 A;  1FEB A;  3QFA A;  2JB3 A;  3T2Z A;  1VG0 A;  4I58 A;  1ZMC A;  2TMD A;  4XWR A;  4G6H A;  2GMJ A;  3NKS A;  3Q6J A;  2EQ6 A;  5GRT A;  5KRQ A;  2CUL A;  4YKF A;  2GVC A;  2VVL G;  1HYU A;  4TM4 A;  3CND A;  3S5W A;  4C3Y A;  3T31 A;  2IVE A;  1JRY A;  1M64 A;  2YG7 A;  2GR3 A;  1Q1W A;  4A7A A;  1VRQ B;  4A6N B;  2CDU A;  5KMR A;  2DKI A;  1BZL A;  2RAB A;  2WBA A;  3E1T A;  3FIM B;  4NEV A;  3GWF A;  4H4V A;  2WES A;  3I6D A;  3NTD A;  3Q9T A;  4CRT A;  1CC2 A;  2OLO A;  3HYX A;  4YSH A;  1NHQ A;  2YM2 A;  1B4V A;  1DXL A;  3GWD A;  2WQY A;  2JAE A;  2Q0K A;  1E1N A;  2WEU A;  4TM1 A;  2BC1 A;  4BK1 A;  2W0H A;  3RNM A;  1E1L A;  2QCU A;  1M6I A;  1IUU A;  2XVF A;  2BK5 A;  3M13 A;  4OPT A;  1BF3 A;  2WU2 A;  4BK3 A;  1Y56 B;  1IUW A;  2VRM A;  4Z25 A;  3AD8 B;  2B76 A;  2BRA A;  3DJG X;  2GR0 A;  1YY5 A;  2ZZB A;  4NEW A;  1KF6 A;  3F8R A;  3NIX A;  2HQM A;  3HYV A;  1RYI A;  2XVJ A;  2V3B A;  1ZDL A;  2OAL A;  2UZZ A;  1FL2 A;  4BK2 A;  2NVK X;  1O95 A;  2V5Z A;  1CJ2 A;  2XFQ A;  1FEC A;  3OZ2 A;  3UOY A;  4CNJ A;  5KOX A;  2XFN A;  2R0C A;  2YG6 A;  5BUK A;  2QAE A;  3SFD A;  3AYJ A;  4EQW A;  2B9Y A;  3DA1 A;  1GRA A;  3QFB A;  2X50 A;  3B6D A;  1NEK A;  2R0G A;  2Y6R A;  4B65 A;  4K7Z A;  2YVJ A;  3RP7 A;  3UKF A;  3ICR A;  3QVR A;  4LU6 A;  1PDH A;  2APG A;  3FMW A;  4H4Y A;  1EL9 A;  4YTP A;  3AEB A;  4P9S A;  2X99 A;  1IUV A;  3ABV A;  2XLU A;  1ZX9 A;  2E4G A;  5J7X A;  2Z5Y A;  4A65 A;  2BK3 A;  2PHH A;  1PJ6 A;  3CNT A;  3NT6 A;  1KN0 A;  2JKC A;  4EM3 A;  2VVL A;  4E0V A;  3DJE A;  4U8N A;  4CCQ A;  4WX1 A;  3RED A;  1H86 A;  4USR A;  1K0L A;  4OVI A;  5EBK A;  3AEG A;  1Y0P A;  2C7G A;  4ADW A;  4C77 A;  2RGJ A;  3M12 A;  4FK1 C;  4J2W A;  4G6G A;  4IVM B;  2GAH B;  1RP0 A;  3SQP A;  3CPJ G;  3SXI A;  2B7S A;  3LAD A;  1NHP A;  4FX9 A;  4H2P A;  4B68 A;  3DGH A;  4USQ A;  3AED A;  4EIQ A;  3C4A A;  3KPK A;  1XPQ A;  5CKU A;  2BA9 A;  3UKA A;  2RGO A;  4J31 A;  2V60 A;  2YG3 A;  4EIP A;  2V6O A;  3P4S A;  4Y4M A;  3CNP A;  1D4D A;  1TDE A;  2VQB A;  3NLC A;  3T0K A;  1GES A;  2WHD A;  2GQW A;  2GQF A;  4JN9 A;  4DSH A;  2X8H A;  1YKJ A;  3NYE A;  4XXG A;  5KOW A;  3CGC A;  1B5Q A;  4DSG A;  3NRN A;  2XFP A;  4Z44 A;  3AD7 B;  1EL8 A;  4JNA A;  3IC9 A;  3IHM A;  2VQ7 A;  1P2H A;  5FMH A;  4XWZ A;  2BRY A;  3GDN A;  1KNP A;  3AWI A;  5EB5 A;  5M0Z A;  2C72 A;  2R4J A;  2XVE A;  3T14 A;  4CY6 A;  1D7Y A;  4G9K A;  2BXR A;  1N4W A;  1ONF A;  4U8P A;  1DNC A;  1DJQ A;  2YG5 A;  3NN6 X;  1REO A;  3NH3 X;  4A9W A;  3NHO X;  3ATR A;  1FOH A;  4IV9 A;  1LJ1 A;  1TDO A;  4NTC A;  3EPT A;  3NYF A;  1BGJ A;  1NEN A;  1O94 A;  1GET A;  1D5T A;  2AR8 A;  4B1B A;  4AOS A;  1S2Y A;  4J34 A;  3D9X A;  5BVA A;  2E5V A;  4YKG A;  2YQU A;  1K0I A;  3IF9 A;  4A99 A;  3GYJ A;  1F8R A;  4U8K A;  2R0P A;  1YQ3 A;  2GV8 A;  2B9W A;  3LXD A;  4PAA A;  4APN A;  1K0J A;  1PBF A;  4OCG A;  1CJC A;  3DJD A;  1K4Q A;  3UTG A;  2O9Z A;  3NYC A;  1QO8 A;  4C5O A;  1GND A;  2C66 A;  3I3L A;  5KXJ A;  3OC4 A;  4NZH A;  3AD9 B;  2VOU A;  1L0V A;  3CMM A;  3LB8 A;  1JU2 A;  1KFY A;  3QJ4 A;  3SZC A;  3V76 A;  1DOE A;  4H4W A;  3P1W A;  2OA1 A;  2R4E A;  3AYI A;  1UKV G;  2ARD A;  4U8J A;  3T2Y A;  3AB1 A;  1H2I A;  2FJD A;  4JY3 A;  3AE4 A;  1LVL A;  3GD3 A;  1KSU A;  1E1K A;  3SZF A;  1GRH A;  1MO9 A;  1CF3 A;  1ZP0 A;  4U8M A;  3VRD B;  3RHA A;  2YLZ A;  3DH9 A;  1L9E A;  4UDQ A;  4EMJ A;  5KNL A;  2WOV A;  1H81 A;  1PN0 A;  3UKK A;  3UOV A;  1JOA A;  4II2 A;  1EL5 A;  1PXB A;  2BCG G;  4X9M A;  4U8O A;  4BUR A;  3K30 A;  1XDI A;  3SY4 A;  1DOD A;  1ZMD A;  2R9Z A;  3QSS A;  2WPF A;  2YWL A;  1LTX R;  2OLN A;  2C3D A;  2GF3 A;  1DOC A;  3IHG A;  4K2X A;  3K7M X;  4H4R A;  3VR8 A;  1NHS A;  2R46 A;  2Q0L A;  3BI5 A;  1JEH A;  3PO7 A;  4I59 A;  4MJW A;  2C3C A;  3LOV A;  2EQ7 A;  2J3N A;  4H2Q A;  5FS6 A;  3AE5 A;  3AE6 A;  4JDR A;  4M52 A;  1NDA A;  3AEE A;  5U63 A;  4EQS A;  1S7M A;  1H7X A;  2JBV A;  3UKQ A;  1GRE A;  4H50 A;  4OPD A;  5JCK A;  1H7W A;  2VVM A;  4Y4N A;  4GRT A;  1ZK7 A;  3ITJ A;  4DNA A;  1V59 A;  1XHC A;  1F8W A;  4Y4L A;  3ZYX A;  1MOK A;  4B69 A;  2GAG B;  3AYL A;  1OJC A;  4X4J A;  1GOS A;  2C70 A;  5TR3 A;  5EB4 A;  3BI2 A;  4FK1 A;  2ZZ0 A;  3QSM A;  3CGE A;  1TRB A;  3BHK A;  2C75 A;  5HYM A;  1E1M A;  3AE8 A;  3CGB A;  2C73 A;  3P4P A;  3UTH A;  2R45 A;  2FBW A;  1Z6L A;  4J57 A;  3ICS A;  3KU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...