5JCKA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
432
structure length
432
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFYSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVANIEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
total genus 140
structure length 432
sequence length 432
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jckA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jckA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jckA02
1Q1WA 4J36A 4ZN0A 1JEHA 4ECHA 1D7LA 4FDCB 1QO8A 1N4UA 2CVJA 2PYXA 3AE1A 2YM2A 4O5QA 1H83A 4GF7A 3UKKA 4EIQA 3DK8A 5JCKA 3URHA 2GMHA 1PHHA 5IPYA 3IHMA 1PJ5A 3VRBA 2JKCA 3NK1X 5C2TA 2Q0LA 2NVKX 1H81A 1Y0PA 1CHUA 4CCRA 1CJ2A 5KOXA 4K7ZA 1PJ7A 2XLPA 4U8NA 2XYOA 1H82A 4C74A 3BI4A 1JRYA 4IV9A 1PBEA 1Y56A 4B69A 3QJ4A 1BWCA 4TLXA 1FECA 3P4QA 4K5RA 2C66A 2B7RA 4NZHA 2OALA 1LQTA 3AE6A 4UDPA 2WS3A 4J34A 2X8GA 2FBWA 3NYEA 2FJBA 1B4VA 2X8HA 1K0IA 2GF3A 4OPGA 5J7XA 5KXJA 3S5WA 1LVLA 2YR4A 2V5ZA 1DJNA 3EF6A 1E1KA 1H7WA 1DODA 4YTNA 1IUXA 5DBJA 3CGDA 3P1WA 2W0HA 4CY6A 4H4XA 3O0HA 1Q9IA 1FEBA 1GETA 3ATQA 1JRZA 4OPLA 1M6IA 1PBCA 1ZOVA 3AEDA 3I3LA 3UKAA 4EQSA 1BF3A 3GDPA 3UTGA 3CPIG 2Q0KA 3UKFA 3H4KA 1COYA 1E1LA 1N4VA 3AE8A 3VRAA 2YLZA 3L1RA 3KD9A 3Q9TA 2C65A 4U2LA 2C70A 1NAAA 5U63A 4H7UA 3SGLA 2YR5A 2YAUA 5U25A 2I0ZA 2H89A 1CL0A 1CBOA 2JB2A 3Q6JA 3AE7A 4IA6A 4B65A 1NG4A 2C7GA 4H2RA 4Z44A 4JY2A 5HXIA 1DJQA 1TRBA 2XVFA 3NTAA 4I59A 4H4QA 3UOZA 1DNCA 5GRTA 1E6EA 4OPCA 1CF3A 2WETA 4A99A 2R0PA 2JBVA 2WP9A 2HQMA 3VQRA 3F8RA 4DSHA 4EM4A 3BNMA 2OAMA 3KVEA 2WPFA 3CTYA 1LV0A 4ADWA 1IUTA 3AWIA 3BHFA 1XPQA 4N9XA 2APGA 4Z25A 4EQWA 2ZZBA 4AT0A 2GQFA 2XVJA 2RGJA 2R9ZA 2BXRA 1B5QA 1O95A 5U1OA 4Z2UA 5FS9A 4J56A 3SQPA 3GYIA 5C3JA 2YM1A 4AP1A 4JNAA 2CDUA 1QJDA 3LADA 4JN9A 4NEVA 5FMHA 4YSYA 1KSSA 2YVGA 1GESA 2RGOA 1JNZA 1ZY8A 4JQ9A 4K8DA 4IVMB 1PBDA 1DOCA 2Y6RA 2VRMA 1NDAA 3AE9A 2WDRA 1IUUA 3GRTA 2GR0A 1VG9A 4A5LA 1GRFA 2QA2A 3K7TA 4AT2A 1GSNA 3AEFA 4FK1A 1L9DA 4AOSA 2FJEA 1BKWA 3NYCA 3ICSA 1D4EA 2GB0A 4RG4A 1GV4A 4NEWA 4BV6A 3AEBA 4CBQA 2VVLG 4DGKA 3F8DA 4H4RA 1Q1RA 2YLXA 2B9YA 3ATRA 4XXGA 4IA5A 4GDPA 2BA9A 1BZLA 4YT0A 4BURA 2VOUA 3NKSA 2IVEA 1Y56B 3ICRA 2XFNA 1NPXA 3UKLA 3B6DA 3QFBA 1FOHA 4EQXA 3ISHA 3NK2X 1GRAA 1E1MA 2R4JA 3NG7X 3LJPA 1W4XA 1IUSA 2WU2A 2BCGG 1H86A 3ABVA 4OPTA 1CJ4A 1XHCA 3JSKA 3CN8A 2X50A 3DGZA 4EM3A 1KF6A 2R45A 3P4PA 2GR3A 1REOA 2YR6A 3GYJA 5J60A 4J33A 1ZDLA 2VZ2A 3P4RA 4U8MA 4TM3A 1B8SA 4CY8A 3AD8B 4U8KA 2CULA 2WHDA 5ER0A 4C5OA 4U8LA 2R0GA 3NNEA 2BS4A 2IVDA 1K0JA 1GRHA 4LA1A 1D4CA 3NN0X 3AEAA 4X9MA 4YSZA 4B1BA 4X9NA 3II4A 4H4YA 3GSIA 1N1PA 2PHHA 2X3NA 4HB9A 2GQWA 2WBAA 4JY3A 2YLWA 1TYTA 4U2SA 3SFEA 3VR8A 1O5WA 2E4GA 4JNQA 1NHPA 1ZMDA 3AYJA 4E0VA 2VVLA 4ZCDA 2C67A 4H4UA 4FX9A 4H4PA 3VRDB 2XLUA 3RNMA 3DK9A 3IWAA 5EOWA 1E7PA 3REDA 3BI5A 4AOXA 5FS7A 2V60A 3LB8A 5GSNA 4B63A 1PN0A 2Z5XA 1DOBA 4JDRA 3NN6X 2NPXA 3EANA 1RP0A 4H2QA 5IQ1A 1TDKA 1KNRA 4OCGA 3BNUA 1K0LA 1X31B 2GAHB 1GPEA 1F3PA 2WOVA 2OLNA 3G5SA 1GRTA 4PABA 1OJTA 1VDCA 3CNPA 2C64A 2Z5YA 3LOVA 2QCUA 2AAQA 3AYLA 2TPRA 3NHOX 3PO7A 4EMJA 3EAOA 2C72A 4GDEA 4YKGA 4YXDA 5M10A 3OC4A 2E5VA 2XDOA 2BK4A 1NHQA 1S2YA 4OPDA 4B66A 2GH5A 2XFQA 3ALMA 2JB1A 2XLRA 2B76A 4H2PA 3GD3A 1CJCA 1YQ3A 1LJ1A 1IUWA 5FS6A 5JCMA 3BI2A 2X8CA 3GDNA 3UCLA 4BK3A 1NHRA 2WOWA 1CC4A 1EL8A 4USQA 1TDFA 2Q7VA 1JOAA 3ITJA 4X4JA 1YQZA 3AD7B 5HHFA 3V3OA 3NIXA 3H8LA 2A89A 3CNTA 4C77A 3QSMA 2C3CA 2X99A 1VRQB 3KA7A 3ALLA 4WX1A 4J2WA 3UP5A 2YLRA 5JCNA 1D7YA 4A65A 2WESA 1GERA 2ACZA 2BK3A 1FCDA 2A87A 1E1NA 3ALJA 3NYFA 4Z2RA 4H2NA 5KWFA 2XVHA 3RHAA 2XCGA 3CGBA 4O5UA 1LQUA 1BGJA 2TMDA 2A8XA 5M0ZA 4GRTA 2WOIA 3AD9B 3UOYA 4USRA 4BK1A 1IJHA 1PXCA 2C76A 4IVOB 4BJYA 1ONFA 1PDHA 4D03A 2BABA 3UTHA 2GV8A 3UKPA 5LV9A 3QFAA 1TDNA 3S61A 3CPJG 2BXSA 1NEKA 3GD4A 4EMWA 3G5QA 4Y4LA 4Z43A 4XWZA 5CKUA 2YG7A 2GEWA 1GTEA 5EB5A 3FG2P 2AQJA 3FIMB 4H50A 1F8RA 2QAEA 5HY5A 5HYMA 3ADAB 1L0VA 1IUVA 4HA6A 3PVCA 4WCTA 1S2QA 2V61A 4GCMA 1CC2A 2V3BA 2EQ6A 3E1TA 3DJDA 1ZMCA 2DKIA 1YKJA 2BCPA 3C4AA 3I6DA 3G5RA 2E1MA 2F5ZA 4YWOA 2YG3A 3M12A 4K5SA 1FEAA 2GVCA 1N4WA 2Y6QA 3SFDA 1NENA 4MJWA 2BC1A 2JB3A 4FK1C 2GR2A 4YSXA 2R46A 5IQ4A 3D1CA 3GWDA 3NRNA 3AE3A 3CGEA 5BULA 2XFOA 1RSGA 1LTXR 1LPFA 1TYPA 1NHSA 2XLSA 3QSSA 2BK5A 1FL2A 2C75A 5KVHA 3AE4A 1VG0A 2JAEA 2EQ8A 4BJZA 2EQ7A 4KPRA 2ZBWA 1OJDA 4BK2A 2B7SA 4GUVA 4K2XA 1UKVG 3K30A 3GRSA 4PAAA 4CNKA 4EMIA 4YTPA 3AEGA 2YG6A 3B3RA 1KDGA 4H4ZA 1GOSA 2YWLA 2JK6A 1CJ3A 2YG4A 3CNSA 4H4WA 3SM8A 2ZZCA 2RABA 2VVMA 3GWFA 4GR1A 3NH3X 1GALA 1GXFA 4DNAA 1EL5A 1V59A 2GAGB 2O9ZA 5TR3A 4TLZA 3AYIA 4D04A 2BYBA 3FMWA 3DJEA 2H88A 2FJDA 3UP4A 5FS8A 3DK4A 1ZX9A 1H84A 2R0CA 2XLTA 3C4NA 4A79A 2XFPA 1XANA 5KOWA 2XVEA 3RP6A 1ZOYA 2R4EA 4U8PA 1ZKQA 3FPZA 1D5TA 1ZK7A 4Z2TA 4U8JA 4J31A 2C73A 1EL7A 3WE0A 3AEEA 4EQRA 4U8OA 1GRBA 1ELIA 3AXBA 3FBSA 1GREA 2YLTA 2VQ7A 3DH9A 1JRXA 4K22A 4Y4NA 3UOVA 1K4QA 1L9EA 1F8SA 2BS3A 1TDEA 2WDVA 3CNDA 2YVJA 5EBKA 5JCLA 1XDIA 2GR1A 2YQUA 4P9SA 3V76A 1QLBA 2C3DA 1CC6A 2XFUA 4OPIA 4YTMA 3CGCA 4EIPA 4LIIA 3NGCX 5CQFA 2WQYA 3BHKA 2WDQA 1JU2A 3UTEA 5BUKA 5KRQA 1H6VA 2YVFA 2DKHA 4NTCA 4Y4MA 3GMBA 1DXLA 1DOEA 3COXA 2WPCA 3QVRA 3CNJA 3UTFA 3KLJA 1YQ4A 4H4VA 3M0OA 4UDRA 3V3NA 4J57A 3H8IA 3UKQA 2J3NA 1OJCA 1NG3A 3M13A 1P2EA 1PBBA 3CIRA 3ZDNA 4A6NB 3ICTA 1BGNA 3OZ2A 2QA1A 3C96A 3IC9A 4LU6A 4A9WA 1F6MA 3NT6A 3RP7A 3F8PA 3EPTA 4CCQA 4ICYA 2VRLA 1KFYA 1Z6LA 1KSUA 4KX6A 2BACA 1EL9A 1KNPA 2OA1A 1MOKA 2RGHA 1MXTA 1PBFA 1VQWA 3NTDA 1YY5A 3QSEA 3DGHA 4UP3A 3LZWA 4H4TA 2IIDA 1JNRA 3P4SA 2YLSA 4I58A 2ZZ0A 4A7AA 1PXAA 2WP6A 3DMEA 1RYIA 1ZP0A 3PS9A 4DSGA 5JCIA 1PS9A 2WEUA 4U8IA 5BVAA 3UOXA 3LXDA 2UZZA 4ZCCA 1EBDA 4OPUA 1HYUA 4OVIA 4C3XA 2GRTA 3AB1A 3DJGX 4NTEA 3IHGA 1E39A 2XVIA 4B68A 1D4DA 4A6NA 1F8WA 4RG3A 3K7MX 1GEUA 1GT8A 2ARDA 4Z24A 4XWRA 2B9WA 1GNDA 3QVPA 4U2TA 2WP5A 1PXBA 2WPEA 3KU9A 4REKA 4TM4A 3T37A 5BRTA 2OLOA 1GTHA 1AOGA 3D8XA 3GMCA 4TM0A 3HZLA 3KPFA 3NLCA 3R9UA 1TDOA 4AP3A 1L9CA 4C3YA 3LZXA 1B37A 4YSHA 1SEZA 2CFYA 3KKJA 1PJ6A 5L46A 4TM1A 2BS2A 3P9UA 4NTDA 2B9XA 3AECA 3CPHG 1OJ9A 4UDQA 1MO9A 3RP8A 2VQBA 3AE2A 5EB4A 4B67A 4CNJA 1H7XA 4H4SA 5KVIA 3AE5A 2YG5A 4B64A 4Z26A 3ZYXA 3DJJA 1S3EA 1P2HA 2AR8A 3VR9A 4CRTA 3IF9A 1OJAA 2FJAA 2BC0A 2EQ9A 2V6OA 2Q6UA 2WU5A 3L8KA 3UKHA 4RSLA 4APNA 4M52A 4YKFA 1M64A 3NK0X 1GRGA 2GMJA 1S3BA 3DA1A 2V3AA 3K7QX 1O94A
chains in the Genus database with same CATH superfamily
4J36A 4FDCB 2PYXA 3SY4A 4EIQA 3URHA 3NK1X 1DTNA 4CCRA 1CHUA 2PMQA 1H82A 4IV9A 1Y56A 2E3TA 3QJ4A 4IT1A 3P4QA 4K5RA 4NZHA 1LQTA 3NYEA 1K0IA 3S5WA 3FCPA 2YR4A 3EF6A 3NVVB 1E1KA 1H7WA 1DODA 3R10A 3ZLGA 3U4FA 3CGDA 1FHUA 1JPDX 3UKAA 1PBCA 2OZ3A 3AEDA 3R0UA 4G6GA 3GD6A 1COYA 3GC2A 1E1LA 1N4VA 3CXBA 3RP6A 3L1RA 2H89A 1CBOA 3Q6JA 1WUFA 4A3RA 3H12A 1TRBA 4DYEA 3BOXA 4KPLA 5FJOA 1MDLA 4H4QA 5GRTA 3AMZA 1CF3A 4A99A 2R0PA 3BHFA 1IUTA 1XPQA 3IJLA 4N9XA 4EQWA 2GQFA 2RGJA 2R9ZA 2QVHA 4M6UA 5C3JA 3P93A 4AP1A 5FMHA 3T14A 3QLDA 1ZY8A 3B9JB 4K8DA 4IVMB 4ROPA 2VRMA 3UCCA 5BOFA 1IUUA 5KMQA 1VG9A 3K7TA 1GSNA 3RGTA 3NVWB 4FK1A 4E4FA 1L9DA 1JPMA 1D4EA 2GB0A 4NEWA 3T31A 3F8DA 2GGEA 4H4RA 3H70A 2YLXA 3QKEA 4YT0A 3N4EA 1NPXA 3UKLA 3NK2X 3ISHA 2R4JA 3LJPA 3SZFA 1SJDA 3JSKA 4IZGA 3T4WA 1T3QC 2QGYA 1REOA 2YR6A 5KMSA 2VZ2A 1WUEA 3DG7A 3B97A 2CULA 2BS4A 2IVDA 1K0JA 1GRHA 4B1BA 3II4A 4TVYA 1EC7A 4U2SA 3VR8A 1W6TA 2E4GA 3AYJA 3FJ4A 4ZCDA 3JW7A 4FX9A 4H4PA 3DK9A 2RDXA 2V60A 4MKSA 2Z5XA 2NPXA 1X31B 1MNSA 1GPEA 2OLNA 1GRTA 4PABA 1OJTA 2Z5YA 3LOVA 2TPRA 4IL0A 3NHOX 3PO7A 4YKGA 5M10A 2NQLA 2XDOA 2BK4A 4IL2A 1RM6B 1KN0A 3GD3A 1IUWA 5FS6A 1NHRA 1EL8A 1TDFA 4X4JA 3KUMA 3NIXA 3QSMA 4WX1A 3UP5A 2YLRA 4A65A 1GERA 2BK3A 2QQ6A 1E1NA 1X2GA 2XVHA 1BGJA 5M0ZA 1RVKA 4GRTA 4USRA 4BK1A 2C76A 3NVZB 1PDHA 4D03A 2BABA 3UKPA 1KD0A 3S61A 3UXLA 4Y4LA 1WYGA 4Z43A 4XWZA 1N62C 2YG7A 2W54A 5EB5A 3MY9A 3N4FA 3E1TA 4GYPA 1ZMCA 3ENLA 2E1MA 1MDRA 1FEAA 1JCTA 2GVCA 4II2A 1N4WA 5FJTA 7ENLA 5IQ4A 2PODA 3GWDA 3CGEA 3DG6A 1LPFA 4HCDA 2C75A 1VG0A 2B7SA 4GUVA 1UKVG 3GRSA 4YTPA 2OKTA 3B3RA 1CJ3A 3CNSA 4A35A 2QJNA 3DEQA 4DNAA 3A7RA 2PSNA 4TLZA 5FJPA 2BYBA 2FJDA 3SN4A 3FXGA 3SXIA 1ZKQA 1D5TA 1ZK7A 4U8JA 4J31A 4EQRA 4U8OA 1GRBA 3AXBA 3QPEA 3FBSA 4K22A 2OX4A 3DH9A 3SYIA 3UOVA 1IYXA 1N61C 1TDEA 5JCLA 3R11A 1QLBA 3UTEA 2YVFA 1DXLA 1DOEA 3COXA 3QVRA 1STZA 1YQ4A 3DFHA 4H4VA 4UDRA 3H8IA 3RRAA 1SJAA 3ICTA 3C96A 4LU6A 1F6MA 1KFYA 4FP1A 2OA1A 2RGHA 3TJIA 3QSEA 1PDYA 1JNRA 2YLSA 4K1WA 4A7AA 1RYIA 3PS9A 3LXDA 1EBDA 4C3XA 4NTEA 3BSMA 1E39A 4B68A 1D4DA 1F8WA 3VC6A 2B9WA 1GNDA 4U2TA 1PXBA 3KU9A 3T37A 3T9PA 2OLOA 2CHRA 3HZLA 3NLCA 1TDOA 1B37A 2PP1A 1PJ6A 2BS2A 4UDQA 4NTDA 2B9XA 3ETRB 3UJ2A 2VQBA 5EB4A 4CNJA 1H7XA 2AL1A 4H4SA 4IP4A 4B64A 4Z26A 3DJJA 1P43A 4HYRA 3VR9A 4CRTA 3IF9A 1OJAA 2BC0A 2Q6UA 2AKMA 4RSLA 4M52A 4EWJA 1GRGA 3SBFA 4ECHA 1QO8A 2PTWA 2YM2A 3DGBA 5JCKA 2GMHA 2P8CA 3IHMA 5C2TA 2NVKX 1H81A 3MZNA 3JVAA 4K7ZA 2XLPA 2XYOA 1JRYA 1FECA 2C66A 4UDPA 2OALA 4J34A 1B4VA 2X8HA 5KXJA 4OPGA 2FKPA 3TCSA 1DJNA 3OP2A 1IUXA 3SSZA 5DBJA 3P1WA 4HNCA 4DX3A 4H4XA 3O0HA 4OPLA 1M6IA 1ZOVA 1E9IA 4G74A 3RR1A 3UTGA 3CPIG 3H4KA 2YLZA 3KD9A 4H7UA 2YAUA 1CL0A 4H19A 2ZC8A 3AE7A 4Z44A 2PTXA 5HXIA 1DJQA 2XVFA 5J04A 2XH2A 2WP9A 3VQRA 3F8RA 3BNMA 2WPFA 3TQPA 4AT0A 4Z2UA 1B5QA 5FS9A 4J56A 4E4UA 3LADA 4JN9A 4NEVA 4YSYA 2YVGA 2PA6A 3R1ZA 1JNZA 3TJ4A 1DOCA 2DW7A 3GRTA 2GR0A 4A5LA 3OPSA 3MWCA 3HYWA 2W55A 2FJEA 4AOSA 3NYCA 4CBQA 3AEBA 3MSYA 1Q1RA 4NNJA 2I5QA 4XXGA 2BA9A 4BURA 1Y56B 3B6DA 3QFBA 3ZLHA 3EEZA 4HPNA 2WU2A 2BCGG 3U9IA 3AN1A 3CN8A 1KF6A 3P4PA 3GYJA 5J60A 2XH7A 3RCYA 3AD8B 3MKCA 2WHDA 4G8TA 5ER0A 4U8LA 2R0GA 4LA1A 3NN0X 4X9NA 3GSIA 3CAWA 1N1PA 2PHHA 2X3NA 2GQWA 2YLWA 1NHPA 3QTPA 4H4UA 3IWAA 5EOWA 3BI5A 4AOXA 5FS7A 3LB8A 4JDRA 1RP0A 3EANA 1TDKA 1KKRA 3TWBA 3V4BA 4OCGA 1KKOA 1F9CA 3CNPA 2C64A 2AAQA 2AKZA 2OZ8A 2QDEA 3T0KA 3UCDA 1FIQB 3EAOA 4GDEA 4YXDA 2PGEA 2AL2A 4B66A 2JB1A 2XLRA 3I6EA 2X8CA 3UCLA 1JOAA 2XH4A 1N60C 1FHVA 2OVLA 2X99A 1VRQB 3GO2A 4J2WA 3RITA 5JCNA 3AM9A 2XCGA 1LQUA 2TMDA 2A8XA 2WOIA 3HW2A 4MMWA 4BJYA 3D47A 3UTHA 3QFAA 2BXSA 3GD4A 2GEWA 1FO4A 3Q4DA 5HYMA 1MUCA 4WCTA 3A7UA 3DJDA 3K1GA 1YKJA 3G5RA 4YWOA 3UJEA 3M12A 2Y6QA 4MJWA 1LTXR 3QSSA 1NHSA 2OFJA 3AE4A 2JAEA 4BJZA 4KPRA 2ZBWA 1V97A 3CMMA 3K30A 2P0IA 3VFCA 4EMIA 2MNRA 1GOSA 3T8QA 2XH0A 4H4WA 2RABA 4NWZA 1GALA 1GXFA 1EL5A 1V59A 1X2HA 4A79A 5G5GB 1XANA 3P0WA 2XVEA 1ZOYA 3SZ0A 2C73A 3WE0A 2HNEA 3VDGA 4G7FA 2YLTA 2VQ7A 1JRXA 1K4QA 3RO6A 1L9EA 5EBKA 4P9SA 4EIPA 4KT2A 4LIIA 3NGCX 2WDQA 3T2YA 4NTCA 3ES8A 1H2IA 3M0OA 2GGHA 1OJCA 3M13A 3ZDNA 3IC9A 2PPGA 4A9WA 3SR6B 3F8PA 3EPTA 2BACA 4J1OA 4UP3A 5FJRA 3P4SA 4ZOHB 3DMEA 1ZP0A 4DSGA 5JCIA 3HYVA 1R6WA 4RG3A 2ARDA 4XWRA 4REKA 5BRTA 1L9CA 4C3YA 1BKHA 1SEZA 3KKJA 5L46A 4TM1A 3AECA 3CPHG 3VA8A 3RP8A 5KVIA 1S3EA 2FJAA 2WU5A 3L8KA 3UKHA 4GMEA 4YKFA 1M64A 5JRBA 1S3BA 3T2ZA 4ZN0A 3NVYB 1D7LA 1N4UA 2CVJA 4O5QA 1H83A 4GF7A 3DK8A 4K8GA 4JN7A 2Q0LA 3BJSA 1CJ2A 2OQYA 1N5XA 1BWCA 4TLXA 3AE6A 2WS3A 5KMRA 4H1ZA 5J7XA 4H83A 4IP5A 4YTNA 4CY6A 1FEBA 1GETA 4EQSA 3ES7A 3GDPA 1NU5A 3NFUA 3Q9TA 2I0ZA 3PWGA 4II3A 2GSHA 4B65A 4H2RA 3SN0A 3V5FA 3UOZA 1DNCA 1E6EA 4OPCA 2WETA 2XSXA 4EM4A 2OAMA 3CTYA 3DDMA 4ADWA 3AWIA 2APGA 2ZZBA 2XVJA 2BXRA 5U1OA 3SQPA 3TW9A 2YM1A 4JNAA 1GESA 4JQ9A 4E6MA 1PBDA 1NDAA 2QA2A 3UJFA 4RG4A 1GV4A 4GGHA 3ATRA 4IA5A 4GDPA 1TKKA 2QDDA 2VOUA 3R0KA 3DFYA 2XFNA 4EQXA 1GRAA 1E1MA 1W4XA 3HRDC 4OPTA 2X50A 4EM3A 2GR3A 1ZDLA 3P4RA 4C5OA 4Z1YA 1D4CA 4X9MA 2GL5A 3H8AA 4H4YA 4JY3A 2XGZA 4JNQA 2VVLA 2C67A 4TVWA 3RNMA 1E7PA 4G6HA 3TWAA 4B63A 1EBHA 3CB3A 4G73A 2PU1A 4DHGA 4H2QA 1K0LA 2GAHB 3VCNA 2PP3A 1VDCA 4HNLA 2QCUA 3AYLA 2C72A 3OC4A 2E5VA 2GDQA 4GIRA 1ZXIC 3DIPA 2GH5A 2XFQA 2MUCA 3V3WA 3ALMA 4IHCA 3I6TA 4H2PA 1CJCA 1LJ1A 5JCMA 3GDNA 4BK3A 2WOWA 1CC4A 5HHFA 3V3OA 3H8LA 2A89A 2C3CA 3KA7A 3SX6A 2POZA 2OQHA 6ENLA 4GAVA 2A87A 3ALJA 4Z2RA 4H2NA 5KWFA 1EC9A 3CGBA 4HN8A 3UOYA 1ONFA 2GV8A 3OZMA 3VCCA 1NEKA 3G5QA 3R07C 3FG2P 2AQJA 3FIMB 3EUB3 1F8RA 5HY5A 3ADAB 2ZADA 2V61A 1CC2A 2V3BA 2OG9A 2DKIA 4H2HA 2BCPA 3C4AA 3I6DA 2OO6A 1TE6A 4YSXA 3D1CA 3NRNA 2BK5A 5KVHA 4GYPC 3H7VA 4CNKA 1VDVA 2YG6A 1KDGA 4H4ZA 2YWLA 2JK6A 3N6JA 3GYXA 3SM8A 3MQTA 3NH3X 3CT2A 3NO1A 5TR3A 4D04A 1YEYA 2AL2B 1H84A 2R0CA 3C4NA 2P88A 2XFPA 5KOWA 5ENLA 1BQGA 3TTEA 4U8PA 2R4EA 4Z2TA 3AEEA 1ELIA 1GREA 3DG3A 4Y4NA 4HCLA 3CNDA 2YVJA 2GR1A 2GGGA 2YQUA 3UGVA 1XS2A 2C3DA 1CC6A 2XFUA 4OPIA 4YTMA 3TOYA 5CQFA 2WQYA 5FJUA 3T2KA 5BUKA 1H6VA 4Y4MA 4GGBA 3CNJA 1TZZA 3KLJA 2PS2A 3V3NA 2J3NA 1NG3A 1PBBA 3CIRA 4A6NB 3CYJA 2QA1A 3RP7A 1Z6LA 4KX6A 4DXKA 2DW6A 1MXTA 1VQWA 3IK4A 3DGHA 3MUCA 4H4TA 4KEMA 3DERA 4I58A 2ZZ0A 4K2SA 2WP6A 1PXAA 4M0XA 1PS9A 2UZZA 4ZCCA 4OPUA 4GAPA 4OVIA 4G9KA 3IJIA 3I4KA 1SJBA 2BRYA 3IHGA 3NRZB 2FYMA 3IJQA 4A6NA 1GEUA 1GT8A 3R25A 3PG6A 3QVPA 2P8BA 4TM4A 1GTHA 1AOGA 4AP3A 4YSHA 3AE2A 3AE5A 4J3ZA 2YG5A 3ZYXA 3NS1B 2AR8A 4APNA 3UXKA 3NK0X 3STPA 2GMJA 2V3AA 3K7QX 1Q1WA 1JEHA 3ZLFA 2C4CA 3AE1A 3UKKA 1PHHA 5IPYA 3OTRA 1PJ5A 3VRBA 4ZA0A 2JKCA 3P3BA 1L8PA 3SZCA 1Y0PA 4YWSA 2HZGA 5KOXA 2PU0A 1PJ7A 4U8NA 3HPFA 4C74A 3BI4A 1PBEA 4B69A 3Q45A 1ECQA 1JRPA 2B7RA 2X8GA 2FBWA 2FJBA 1EBGA 2GF3A 1LVLA 2V5ZA 3V5CA 3D9XA 4ENLA 4HCHA 1VQZA 2W0HA 3JZUA 1Q9IA 3SQSA 3ATQA 1JRZA 3S5SA 3I3LA 1JDFA 1BF3A 3EKGA 3UKFA 2Q0KA 3SN1A 3AE8A 3VRAA 4U2LA 5U63A 2C65A 3SGLA 2C70A 1NAAA 2YR5A 5U25A 2JB2A 3SZWA 1SB3B 4IA6A 4JHMA 1NG4A 2C7GA 4JY2A 3ZVHB 3NTAA 4FI4A 4I59A 2JBVA 2HQMA 4DSHA 3KVEA 1LV0A 2GGJA 2PCEA 4E8GA 4Z25A 1O95A 3GYIA 2CDUA 1QJDA 3S47A 1KSSA 2RGOA 1MRAA 1R0MA 2Y6RA 3AE9A 2WDRA 3ZVHA 4AT2A 1GRFA 3AEFA 1NELA 1BKWA 4GISA 3ICSA 4BV6A 2VVLG 1SJCA 4DGKA 2B9YA 1BZLA 3NKSA 3FYYA 2IVEA 3ICRA 1FOHA 1N63C 1FFUC 3NG7X 3CXOA 1IUSA 1H86A 3ABVA 1CJ4A 1XHCA 2E5AA 3DGZA 2R45A 4J33A 4U8MA 4TM3A 3N6HA 1B8SA 4CY8A 4U8KA 3NNEA 3AEAA 4YSZA 4A6GA 2W3RA 4HB9A 2WBAA 3SFEA 1TYTA 1EC8A 1O5WA 3HYXA 1ZMDA 4E0VA 3VRDB 2XLUA 3REDA 5GSNA 4F4RA 1PN0A 1DOBA 3NN6X 5IQ1A 4KWSA 4X2PA 1KNRA 3BNUA 2ONEA 1F3PA 2WOVA 3G5SA 2HXTA 1FFVC 3NXLA 3QN3A 4EMJA 1NHQA 1S2YA 4OPDA 2B76A 1YQ3A 3BI2A 3A7AA 4USQA 2Q7VA 3ITJA 1YQZA 3OW1A 3AD7B 3PK7A 5G5HB 3CNTA 4C77A 2OZTA 4ZCWA 3ALLA 1D7YA 2WESA 2ACZA 1FCDA 3NYFA 3RHAA 3VC5A 2O56A 4O5UA 3KPKA 3AD9B 1IJHA 1PXCA 4IVOB 3FVDA 2OPJA 5LV9A 1TDNA 3CPJG 4EMWA 5CKUA 1GTEA 4H50A 2QAEA 1L0VA 1IUVA 4HA6A 3PVCA 1S2QA 3UJRA 4GCMA 1JROA 2EQ6A 2GGIA 2YG3A 2F5ZA 1ONEA 4E5TA 4K5SA 3PWIA 3SFDA 1NENA 2BC1A 2HXUA 2JB3A 2GR2A 4FK1C 2R46A 3UJSA 3AE3A 5BULA 2XFOA 1RSGA 2XLSA 1TYPA 1KCZA 1FL2A 2EQ8A 2EQ7A 1OJDA 4BK2A 4DWDA 4K2XA 1S7MA 2OLAA 4PAAA 3AEGA 1P48A 2YG4A 2ZZCA 2VVMA 3GWFA 4GR1A 5KNLA 4JN8A 5KMPA 2GAGB 2O9ZA 3AYIA 5EU9A 3FMWA 3DJEA 3CK5A 2H88A 3UP4A 3D46A 5FS8A 3DK4A 1ZX9A 4DN1A 2XLTA 1N5WC 3FPZA 2BRAA 2PP0A 1EL7A 2P3ZA 1OEPA 1F8SA 2BS3A 2WDVA 1XDIA 2W3SA 3V76A 3ZVIA 3GY1A 3CGCA 5IDZA 1XPYA 3BHKA 3OZYA 1JU2A 5KRQA 2DKHA 3L5OA 3GMBA 2WPCA 3UTFA 2PTYA 4Z17A 4J57A 2PTZA 3UKQA 1P2EA 1BGNA 3OZ2A 3NT6A 3T6CA 4CCQA 4ICYA 2VRLA 1KSUA 1EL9A 1KNPA 1MOKA 2QJJA 1PBFA 3NZGA 1YY5A 5BOEA 3LZWA 2IIDA 3SJNA 2WEUA 4U8IA 5BVAA 4GFIA 3UOXA 1HYUA 2GRTA 3AB1A 3DJGX 3THUA 2XVIA 3FV9A 3K7MX 4Z24A 4MGGA 3PFRA 2WP5A 2WPEA 3D8XA 3DESA 3GMCA 4TM0A 3KPFA 3R9UA 3LZXA 2CFYA 1ELSA 3P9UA 1OJ9A 1MO9A 4B67A 2PGWA 1P2HA 2EQ9A 2V6OA 2QJMA 1PDZA 3DA1A 3NTDA 1O94A
chains in the Genus database with same CATH topology
1Q1WA 4J36A 4ZN0A 1JEHA 4ECHA 1D7LA 4FDCB 2C4CA 1QO8A 1N4UA 2CVJA 2PYXA 3AE1A 3SY4A 2YM2A 4O5QA 1H83A 4GF7A 3UKKA 4EIQA 3DK8A 5JCKA 3URHA 2GMHA 1PHHA 5IPYA 3IHMA 1PJ5A 3VRBA 2JKCA 3NK1X 5C2TA 2Q0LA 2NVKX 3SZCA 1H81A 1Y0PA 1CHUA 4CCRA 1CJ2A 5KOXA 4K7ZA 1PJ7A 2XLPA 4U8NA 2XYOA 1H82A 4C74A 3BI4A 1JRYA 4IV9A 1PBEA 1Y56A 4B69A 3QJ4A 1BWCA 4TLXA 1FECA 3P4QA 4K5RA 2C66A 2B7RA 4NZHA 2OALA 1LQTA 3AE6A 4UDPA 2WS3A 4J34A 2X8GA 2FBWA 3NYEA 2FJBA 5KMRA 1B4VA 2X8HA 1K0IA 2GF3A 4OPGA 5J7XA 5KXJA 3S5WA 1LVLA 2YR4A 2V5ZA 1DJNA 3EF6A 1E1KA 1H7WA 1DODA 3D9XA 4YTNA 1IUXA 5DBJA 3CGDA 3P1WA 2W0HA 4CY6A 4H4XA 3O0HA 1Q9IA 1FEBA 1GETA 3ATQA 1JRZA 4OPLA 1M6IA 1PBCA 1ZOVA 3AEDA 3I3LA 3UKAA 4EQSA 4G6GA 1BF3A 4G74A 3GDPA 3UTGA 3CPIG 2Q0KA 3UKFA 3H4KA 1COYA 1E1LA 1N4VA 3AE8A 3VRAA 2YLZA 3L1RA 3KD9A 3Q9TA 2C65A 4U2LA 2C70A 1NAAA 5U63A 4H7UA 3SGLA 2YR5A 2YAUA 5U25A 2I0ZA 2H89A 1CL0A 1CBOA 2JB2A 4II3A 3SZWA 3Q6JA 3AE7A 4IA6A 4B65A 1NG4A 2C7GA 4H2RA 4Z44A 4JY2A 5HXIA 1DJQA 1TRBA 2XVFA 3NTAA 4I59A 4H4QA 3UOZA 1DNCA 5GRTA 1E6EA 4OPCA 1CF3A 2WETA 4A99A 2R0PA 2JBVA 2WP9A 2HQMA 3VQRA 3F8RA 4DSHA 4EM4A 3BNMA 2OAMA 3KVEA 2WPFA 3CTYA 1LV0A 4ADWA 1IUTA 3AWIA 3BHFA 1XPQA 4N9XA 2APGA 4Z25A 4EQWA 2ZZBA 4AT0A 2GQFA 2XVJA 2RGJA 2R9ZA 2BXRA 1B5QA 1O95A 5U1OA 4Z2UA 5FS9A 4J56A 3SQPA 3GYIA 5C3JA 2YM1A 4AP1A 4JNAA 2CDUA 1QJDA 3LADA 4JN9A 4NEVA 5FMHA 4YSYA 1KSSA 2YVGA 1GESA 2RGOA 3T14A 1JNZA 1ZY8A 4JQ9A 4K8DA 4IVMB 1PBDA 1DOCA 2Y6RA 2VRMA 1NDAA 3AE9A 2WDRA 1IUUA 3GRTA 2GR0A 1VG9A 5KMQA 4A5LA 1GRFA 2QA2A 3K7TA 4AT2A 1GSNA 3AEFA 4FK1A 1L9DA 3HYWA 2FJEA 4AOSA 1BKWA 3NYCA 3ICSA 1D4EA 2GB0A 4RG4A 1GV4A 4NEWA 4BV6A 3AEBA 4CBQA 2VVLG 3T31A 4DGKA 3F8DA 4H4RA 1Q1RA 4NNJA 2YLXA 2B9YA 3ATRA 4XXGA 4IA5A 4GDPA 2BA9A 1BZLA 4YT0A 4BURA 2VOUA 3NKSA 2IVEA 1Y56B 3ICRA 2XFNA 1NPXA 3UKLA 3B6DA 3QFBA 1FOHA 4EQXA 3ISHA 3NK2X 1GRAA 1E1MA 2R4JA 3NG7X 3LJPA 1W4XA 3SZFA 1IUSA 2WU2A 2BCGG 1H86A 3ABVA 4OPTA 1CJ4A 1XHCA 3JSKA 3CN8A 2X50A 3DGZA 4EM3A 1KF6A 2R45A 3P4PA 2GR3A 1REOA 2YR6A 3GYJA 5J60A 5KMSA 4J33A 1ZDLA 2VZ2A 3P4RA 4U8MA 4TM3A 1B8SA 4CY8A 3AD8B 4U8KA 2CULA 2WHDA 5ER0A 4C5OA 4U8LA 2R0GA 3NNEA 2BS4A 2IVDA 1K0JA 1GRHA 4LA1A 1D4CA 3NN0X 3AEAA 4X9MA 4YSZA 4B1BA 4X9NA 3II4A 4H4YA 3GSIA 1N1PA 2PHHA 2X3NA 4HB9A 2GQWA 2WBAA 4JY3A 2YLWA 1TYTA 4U2SA 3SFEA 3VR8A 1O5WA 2E4GA 4JNQA 1NHPA 3HYXA 1ZMDA 3AYJA 4E0VA 2VVLA 4ZCDA 2C67A 4H4UA 4FX9A 4H4PA 3VRDB 2XLUA 3RNMA 3DK9A 3IWAA 5EOWA 1E7PA 3REDA 4G6HA 3BI5A 4AOXA 5FS7A 2V60A 3LB8A 5GSNA 4B63A 1PN0A 2Z5XA 1DOBA 4JDRA 3NN6X 2NPXA 3EANA 1RP0A 4G73A 4H2QA 5IQ1A 1TDKA 3T2ZA 1KNRA 4OCGA 3BNUA 1K0LA 1X31B 2GAHB 1GPEA 1F3PA 2WOVA 2OLNA 3G5SA 1GRTA 4PABA 1OJTA 1VDCA 3CNPA 2C64A 2Z5YA 3LOVA 2QCUA 2AAQA 3AYLA 2TPRA 3T0KA 3NHOX 3PO7A 4EMJA 3EAOA 2C72A 4GDEA 4YKGA 4YXDA 5M10A 3OC4A 2E5VA 2XDOA 2BK4A 1NHQA 1S2YA 4OPDA 4B66A 2GH5A 2XFQA 3ALMA 2JB1A 1KN0A 2XLRA 2B76A 4H2PA 3GD3A 1CJCA 1YQ3A 1LJ1A 1IUWA 5FS6A 5JCMA 3BI2A 2X8CA 3GDNA 3UCLA 4BK3A 1NHRA 2WOWA 1CC4A 1EL8A 4USQA 1TDFA 2Q7VA 1JOAA 3ITJA 4X4JA 1YQZA 3AD7B 5HHFA 3V3OA 3NIXA 3H8LA 2A89A 3CNTA 4C77A 3QSMA 2C3CA 2X99A 1VRQB 3KA7A 3ALLA 4WX1A 4J2WA 3SX6A 3UP5A 2YLRA 5JCNA 1D7YA 4A65A 2WESA 1GERA 2ACZA 2BK3A 4GAVA 1FCDA 2A87A 1E1NA 3ALJA 3NYFA 4Z2RA 4H2NA 5KWFA 2XVHA 3RHAA 2XCGA 3CGBA 4O5UA 1LQUA 1BGJA 2TMDA 2A8XA 5M0ZA 3KPKA 4GRTA 2WOIA 3AD9B 3UOYA 4USRA 4BK1A 1IJHA 1PXCA 2C76A 4IVOB 4BJYA 1ONFA 1PDHA 4D03A 2BABA 3UTHA 2GV8A 3UKPA 5LV9A 3QFAA 1TDNA 3S61A 3CPJG 2BXSA 1NEKA 3GD4A 4EMWA 3G5QA 4Y4LA 4Z43A 4XWZA 5CKUA 2YG7A 2GEWA 1GTEA 5EB5A 3FG2P 2AQJA 3FIMB 4H50A 1F8RA 2QAEA 5HY5A 5HYMA 3ADAB 1L0VA 1IUVA 4HA6A 3PVCA 4WCTA 1S2QA 2V61A 4GCMA 1CC2A 2V3BA 2EQ6A 3E1TA 3DJDA 1ZMCA 2DKIA 1YKJA 2BCPA 3C4AA 3I6DA 3G5RA 2E1MA 2F5ZA 4YWOA 2YG3A 3M12A 4K5SA 1FEAA 2GVCA 4II2A 1N4WA 2Y6QA 3SFDA 1NENA 4MJWA 2BC1A 2JB3A 4FK1C 2GR2A 4YSXA 2R46A 5IQ4A 3D1CA 3GWDA 3NRNA 3AE3A 3CGEA 5BULA 2XFOA 1RSGA 1LTXR 1LPFA 1TYPA 1NHSA 2XLSA 3QSSA 2BK5A 1FL2A 2C75A 5KVHA 3AE4A 1VG0A 2JAEA 2EQ8A 4BJZA 2EQ7A 4KPRA 2ZBWA 1OJDA 4BK2A 2B7SA 4GUVA 4K2XA 3CMMA 1UKVG 3K30A 1S7MA 3GRSA 4PAAA 4CNKA 4EMIA 4YTPA 3AEGA 2YG6A 3B3RA 1KDGA 4H4ZA 1GOSA 2YWLA 2JK6A 1CJ3A 3GYXA 2YG4A 3CNSA 4H4WA 3SM8A 2ZZCA 2RABA 2VVMA 3GWFA 4GR1A 5KNLA 3NH3X 4NWZA 5KMPA 1GALA 1GXFA 4DNAA 1EL5A 1V59A 2GAGB 2O9ZA 5TR3A 4TLZA 3AYIA 4D04A 2BYBA 3FMWA 3DJEA 2H88A 2FJDA 3UP4A 5FS8A 3DK4A 1ZX9A 1H84A 2R0CA 2XLTA 3C4NA 4A79A 2XFPA 1XANA 3SXIA 5KOWA 2XVEA 3RP6A 1ZOYA 2R4EA 4U8PA 1ZKQA 3FPZA 1D5TA 1ZK7A 4Z2TA 4U8JA 2BRAA 4J31A 3SZ0A 2C73A 1EL7A 3WE0A 3AEEA 4EQRA 4U8OA 1GRBA 1ELIA 3AXBA 3FBSA 1GREA 2YLTA 2VQ7A 3DH9A 1JRXA 4K22A 4Y4NA 3SYIA 3UOVA 1K4QA 1L9EA 1F8SA 2BS3A 1TDEA 2WDVA 3CNDA 2YVJA 5EBKA 5JCLA 1XDIA 2GR1A 2YQUA 4P9SA 3V76A 1QLBA 2C3DA 1CC6A 2XFUA 4OPIA 4YTMA 3CGCA 4EIPA 4LIIA 3NGCX 5CQFA 2WQYA 3BHKA 2WDQA 1JU2A 3T2KA 3UTEA 5BUKA 5KRQA 1H6VA 2YVFA 2DKHA 3T2YA 4NTCA 4Y4MA 3L5OA 3GMBA 1DXLA 1DOEA 3COXA 2WPCA 3QVRA 3CNJA 3UTFA 3KLJA 1H2IA 1YQ4A 4H4VA 3M0OA 4UDRA 3V3NA 4J57A 3H8IA 3UKQA 2J3NA 1OJCA 1NG3A 3M13A 1P2EA 1PBBA 3CIRA 3ZDNA 4A6NB 3ICTA 1BGNA 3OZ2A 2QA1A 3C96A 3IC9A 4LU6A 4A9WA 1F6MA 3NT6A 3RP7A 3F8PA 3EPTA 4CCQA 4ICYA 2VRLA 1KFYA 1Z6LA 1KSUA 4KX6A 2BACA 1EL9A 1KNPA 2OA1A 1MOKA 2RGHA 1MXTA 1PBFA 1VQWA 3NTDA 1YY5A 3QSEA 3DGHA 4UP3A 3LZWA 4H4TA 2IIDA 1JNRA 3P4SA 2YLSA 4I58A 2ZZ0A 4A7AA 1PXAA 2WP6A 3DMEA 1RYIA 1ZP0A 3PS9A 4DSGA 5JCIA 1PS9A 2WEUA 4U8IA 5BVAA 3UOXA 3LXDA 2UZZA 4ZCCA 1EBDA 4OPUA 1HYUA 4GAPA 4OVIA 2GRTA 3AB1A 4C3XA 3DJGX 4G9KA 3HYVA 3IHGA 4NTEA 1E39A 2BRYA 2XVIA 4B68A 1D4DA 4A6NA 1F8WA 4RG3A 3K7MX 1GEUA 1GT8A 2ARDA 4Z24A 4XWRA 2B9WA 1GNDA 3PG6A 3QVPA 4U2TA 2WP5A 1PXBA 2WPEA 3KU9A 4REKA 4TM4A 3T37A 5BRTA 2OLOA 1GTHA 1AOGA 3D8XA 3GMCA 4TM0A 3HZLA 3KPFA 3NLCA 3R9UA 1TDOA 4AP3A 1L9CA 4C3YA 3LZXA 1B37A 4YSHA 1SEZA 2CFYA 3KKJA 1PJ6A 5L46A 4TM1A 2BS2A 3P9UA 4NTDA 2B9XA 3AECA 3CPHG 1OJ9A 4UDQA 1MO9A 3RP8A 2VQBA 3AE2A 5EB4A 4B67A 4CNJA 1H7XA 4H4SA 5KVIA 3AE5A 2YG5A 4B64A 4Z26A 3ZYXA 3DJJA 1S3EA 1P2HA 2AR8A 3VR9A 4CRTA 3IF9A 1OJAA 2FJAA 2BC0A 2EQ9A 2V6OA 2Q6UA 2WU5A 3L8KA 3UKHA 4RSLA 4APNA 4M52A 4YKFA 1M64A 3NK0X 5JRBA 1GRGA 2GMJA 1S3BA 3DA1A 2V3AA 3K7QX 1O94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q1W A;  4J36 A;  4ZN0 A;  1JEH A;  4ECH A;  1D7L A;  4FDC B;  1QO8 A;  1N4U A;  2CVJ A;  2PYX A;  3AE1 A;  2YM2 A;  4O5Q A;  1H83 A;  4GF7 A;  3UKK A;  4EIQ A;  3DK8 A;  5JCK A;  3URH A;  2GMH A;  1PHH A;  5IPY A;  3IHM A;  1PJ5 A;  3VRB A;  2JKC A;  3NK1 X;  5C2T A;  2Q0L A;  2NVK X;  1H81 A;  1Y0P A;  1CHU A;  4CCR A;  1CJ2 A;  5KOX A;  4K7Z A;  1PJ7 A;  2XLP A;  4U8N A;  2XYO A;  1H82 A;  4C74 A;  3BI4 A;  1JRY A;  4IV9 A;  1PBE A;  1Y56 A;  4B69 A;  3QJ4 A;  1BWC A;  4TLX A;  1FEC A;  3P4Q A;  4K5R A;  2C66 A;  2B7R A;  4NZH A;  2OAL A;  1LQT A;  3AE6 A;  4UDP A;  2WS3 A;  4J34 A;  2X8G A;  2FBW A;  3NYE A;  2FJB A;  1B4V A;  2X8H A;  1K0I A;  2GF3 A;  4OPG A;  5J7X A;  5KXJ A;  3S5W A;  1LVL A;  2YR4 A;  2V5Z A;  1DJN A;  3EF6 A;  1E1K A;  1H7W A;  1DOD A;  4YTN A;  1IUX A;  5DBJ A;  3CGD A;  3P1W A;  2W0H A;  4CY6 A;  4H4X A;  3O0H A;  1Q9I A;  1FEB A;  1GET A;  3ATQ A;  1JRZ A;  4OPL A;  1M6I A;  1PBC A;  1ZOV A;  3AED A;  3I3L A;  3UKA A;  4EQS A;  1BF3 A;  3GDP A;  3UTG A;  3CPI G;  2Q0K A;  3UKF A;  3H4K A;  1COY A;  1E1L A;  1N4V A;  3AE8 A;  3VRA A;  2YLZ A;  3L1R A;  3KD9 A;  3Q9T A;  2C65 A;  4U2L A;  2C70 A;  1NAA A;  5U63 A;  4H7U A;  3SGL A;  2YR5 A;  2YAU A;  5U25 A;  2I0Z A;  2H89 A;  1CL0 A;  1CBO A;  2JB2 A;  3Q6J A;  3AE7 A;  4IA6 A;  4B65 A;  1NG4 A;  2C7G A;  4H2R A;  4Z44 A;  4JY2 A;  5HXI A;  1DJQ A;  1TRB A;  2XVF A;  3NTA A;  4I59 A;  4H4Q A;  3UOZ A;  1DNC A;  5GRT A;  1E6E A;  4OPC A;  1CF3 A;  2WET A;  4A99 A;  2R0P A;  2JBV A;  2WP9 A;  2HQM A;  3VQR A;  3F8R A;  4DSH A;  4EM4 A;  3BNM A;  2OAM A;  3KVE A;  2WPF A;  3CTY A;  1LV0 A;  4ADW A;  1IUT A;  3AWI A;  3BHF A;  1XPQ A;  4N9X A;  2APG A;  4Z25 A;  4EQW A;  2ZZB A;  4AT0 A;  2GQF A;  2XVJ A;  2RGJ A;  2R9Z A;  2BXR A;  1B5Q A;  1O95 A;  5U1O A;  4Z2U A;  5FS9 A;  4J56 A;  3SQP A;  3GYI A;  5C3J A;  2YM1 A;  4AP1 A;  4JNA A;  2CDU A;  1QJD A;  3LAD A;  4JN9 A;  4NEV A;  5FMH A;  4YSY A;  1KSS A;  2YVG A;  1GES A;  2RGO A;  1JNZ A;  1ZY8 A;  4JQ9 A;  4K8D A;  4IVM B;  1PBD A;  1DOC A;  2Y6R A;  2VRM A;  1NDA A;  3AE9 A;  2WDR A;  1IUU A;  3GRT A;  2GR0 A;  1VG9 A;  4A5L A;  1GRF A;  2QA2 A;  3K7T A;  4AT2 A;  1GSN A;  3AEF A;  4FK1 A;  1L9D A;  4AOS A;  2FJE A;  1BKW A;  3NYC A;  3ICS A;  1D4E A;  2GB0 A;  4RG4 A;  1GV4 A;  4NEW A;  4BV6 A;  3AEB A;  4CBQ A;  2VVL G;  4DGK A;  3F8D A;  4H4R A;  1Q1R A;  2YLX A;  2B9Y A;  3ATR A;  4XXG A;  4IA5 A;  4GDP A;  2BA9 A;  1BZL A;  4YT0 A;  4BUR A;  2VOU A;  3NKS A;  2IVE A;  1Y56 B;  3ICR A;  2XFN A;  1NPX A;  3UKL A;  3B6D A;  3QFB A;  1FOH A;  4EQX A;  3ISH A;  3NK2 X;  1GRA A;  1E1M A;  2R4J A;  3NG7 X;  3LJP A;  1W4X A;  1IUS A;  2WU2 A;  2BCG G;  1H86 A;  3ABV A;  4OPT A;  1CJ4 A;  1XHC A;  3JSK A;  3CN8 A;  2X50 A;  3DGZ A;  4EM3 A;  1KF6 A;  2R45 A;  3P4P A;  2GR3 A;  1REO A;  2YR6 A;  3GYJ A;  5J60 A;  4J33 A;  1ZDL A;  2VZ2 A;  3P4R A;  4U8M A;  4TM3 A;  1B8S A;  4CY8 A;  3AD8 B;  4U8K A;  2CUL A;  2WHD A;  5ER0 A;  4C5O A;  4U8L A;  2R0G A;  3NNE A;  2BS4 A;  2IVD A;  1K0J A;  1GRH A;  4LA1 A;  1D4C A;  3NN0 X;  3AEA A;  4X9M A;  4YSZ A;  4B1B A;  4X9N A;  3II4 A;  4H4Y A;  3GSI A;  1N1P A;  2PHH A;  2X3N A;  4HB9 A;  2GQW A;  2WBA A;  4JY3 A;  2YLW A;  1TYT A;  4U2S A;  3SFE A;  3VR8 A;  1O5W A;  2E4G A;  4JNQ A;  1NHP A;  1ZMD A;  3AYJ A;  4E0V A;  2VVL A;  4ZCD A;  2C67 A;  4H4U A;  4FX9 A;  4H4P A;  3VRD B;  2XLU A;  3RNM A;  3DK9 A;  3IWA A;  5EOW A;  1E7P A;  3RED A;  3BI5 A;  4AOX A;  5FS7 A;  2V60 A;  3LB8 A;  5GSN A;  4B63 A;  1PN0 A;  2Z5X A;  1DOB A;  4JDR A;  3NN6 X;  2NPX A;  3EAN A;  1RP0 A;  4H2Q A;  5IQ1 A;  1TDK A;  1KNR A;  4OCG A;  3BNU A;  1K0L A;  1X31 B;  2GAH B;  1GPE A;  1F3P A;  2WOV A;  2OLN A;  3G5S A;  1GRT A;  4PAB A;  1OJT A;  1VDC A;  3CNP A;  2C64 A;  2Z5Y A;  3LOV A;  2QCU A;  2AAQ A;  3AYL A;  2TPR A;  3NHO X;  3PO7 A;  4EMJ A;  3EAO A;  2C72 A;  4GDE A;  4YKG A;  4YXD A;  5M10 A;  3OC4 A;  2E5V A;  2XDO A;  2BK4 A;  1NHQ A;  1S2Y A;  4OPD A;  4B66 A;  2GH5 A;  2XFQ A;  3ALM A;  2JB1 A;  2XLR A;  2B76 A;  4H2P A;  3GD3 A;  1CJC A;  1YQ3 A;  1LJ1 A;  1IUW A;  5FS6 A;  5JCM A;  3BI2 A;  2X8C A;  3GDN A;  3UCL A;  4BK3 A;  1NHR A;  2WOW A;  1CC4 A;  1EL8 A;  4USQ A;  1TDF A;  2Q7V A;  1JOA A;  3ITJ A;  4X4J A;  1YQZ A;  3AD7 B;  5HHF A;  3V3O A;  3NIX A;  3H8L A;  2A89 A;  3CNT A;  4C77 A;  3QSM A;  2C3C A;  2X99 A;  1VRQ B;  3KA7 A;  3ALL A;  4WX1 A;  4J2W A;  3UP5 A;  2YLR A;  5JCN A;  1D7Y A;  4A65 A;  2WES A;  1GER A;  2ACZ A;  2BK3 A;  1FCD A;  2A87 A;  1E1N A;  3ALJ A;  3NYF A;  4Z2R A;  4H2N A;  5KWF A;  2XVH A;  3RHA A;  2XCG A;  3CGB A;  4O5U A;  1LQU A;  1BGJ A;  2TMD A;  2A8X A;  5M0Z A;  4GRT A;  2WOI A;  3AD9 B;  3UOY A;  4USR A;  4BK1 A;  1IJH A;  1PXC A;  2C76 A;  4IVO B;  4BJY A;  1ONF A;  1PDH A;  4D03 A;  2BAB A;  3UTH A;  2GV8 A;  3UKP A;  5LV9 A;  3QFA A;  1TDN A;  3S61 A;  3CPJ G;  2BXS A;  1NEK A;  3GD4 A;  4EMW A;  3G5Q A;  4Y4L A;  4Z43 A;  4XWZ A;  5CKU A;  2YG7 A;  2GEW A;  1GTE A;  5EB5 A;  3FG2 P;  2AQJ A;  3FIM B;  4H50 A;  1F8R A;  2QAE A;  5HY5 A;  5HYM A;  3ADA B;  1L0V A;  1IUV A;  4HA6 A;  3PVC A;  4WCT A;  1S2Q A;  2V61 A;  4GCM A;  1CC2 A;  2V3B A;  2EQ6 A;  3E1T A;  3DJD A;  1ZMC A;  2DKI A;  1YKJ A;  2BCP A;  3C4A A;  3I6D A;  3G5R A;  2E1M A;  2F5Z A;  4YWO A;  2YG3 A;  3M12 A;  4K5S A;  1FEA A;  2GVC A;  1N4W A;  2Y6Q A;  3SFD A;  1NEN A;  4MJW A;  2BC1 A;  2JB3 A;  4FK1 C;  2GR2 A;  4YSX A;  2R46 A;  5IQ4 A;  3D1C A;  3GWD A;  3NRN A;  3AE3 A;  3CGE A;  5BUL A;  2XFO A;  1RSG A;  1LTX R;  1LPF A;  1TYP A;  1NHS A;  2XLS A;  3QSS A;  2BK5 A;  1FL2 A;  2C75 A;  5KVH A;  3AE4 A;  1VG0 A;  2JAE A;  2EQ8 A;  4BJZ A;  2EQ7 A;  4KPR A;  2ZBW A;  1OJD A;  4BK2 A;  2B7S A;  4GUV A;  4K2X A;  1UKV G;  3K30 A;  3GRS A;  4PAA A;  4CNK A;  4EMI A;  4YTP A;  3AEG A;  2YG6 A;  3B3R A;  1KDG A;  4H4Z A;  1GOS A;  2YWL A;  2JK6 A;  1CJ3 A;  2YG4 A;  3CNS A;  4H4W A;  3SM8 A;  2ZZC A;  2RAB A;  2VVM A;  3GWF A;  4GR1 A;  3NH3 X;  1GAL A;  1GXF A;  4DNA A;  1EL5 A;  1V59 A;  2GAG B;  2O9Z A;  5TR3 A;  4TLZ A;  3AYI A;  4D04 A;  2BYB A;  3FMW A;  3DJE A;  2H88 A;  2FJD A;  3UP4 A;  5FS8 A;  3DK4 A;  1ZX9 A;  1H84 A;  2R0C A;  2XLT A;  3C4N A;  4A79 A;  2XFP A;  1XAN A;  5KOW A;  2XVE A;  3RP6 A;  1ZOY A;  2R4E A;  4U8P A;  1ZKQ A;  3FPZ A;  1D5T A;  1ZK7 A;  4Z2T A;  4U8J A;  4J31 A;  2C73 A;  1EL7 A;  3WE0 A;  3AEE A;  4EQR A;  4U8O A;  1GRB A;  1ELI A;  3AXB A;  3FBS A;  1GRE A;  2YLT A;  2VQ7 A;  3DH9 A;  1JRX A;  4K22 A;  4Y4N A;  3UOV A;  1K4Q A;  1L9E A;  1F8S A;  2BS3 A;  1TDE A;  2WDV A;  3CND A;  2YVJ A;  5EBK A;  5JCL A;  1XDI A;  2GR1 A;  2YQU A;  4P9S A;  3V76 A;  1QLB A;  2C3D A;  1CC6 A;  2XFU A;  4OPI A;  4YTM A;  3CGC A;  4EIP A;  4LII A;  3NGC X;  5CQF A;  2WQY A;  3BHK A;  2WDQ A;  1JU2 A;  3UTE A;  5BUK A;  5KRQ A;  1H6V A;  2YVF A;  2DKH A;  4NTC A;  4Y4M A;  3GMB A;  1DXL A;  1DOE A;  3COX A;  2WPC A;  3QVR A;  3CNJ A;  3UTF A;  3KLJ A;  1YQ4 A;  4H4V A;  3M0O A;  4UDR A;  3V3N A;  4J57 A;  3H8I A;  3UKQ A;  2J3N A;  1OJC A;  1NG3 A;  3M13 A;  1P2E A;  1PBB A;  3CIR A;  3ZDN A;  4A6N B;  3ICT A;  1BGN A;  3OZ2 A;  2QA1 A;  3C96 A;  3IC9 A;  4LU6 A;  4A9W A;  1F6M A;  3NT6 A;  3RP7 A;  3F8P A;  3EPT A;  4CCQ A;  4ICY A;  2VRL A;  1KFY A;  1Z6L A;  1KSU A;  4KX6 A;  2BAC A;  1EL9 A;  1KNP A;  2OA1 A;  1MOK A;  2RGH A;  1MXT A;  1PBF A;  1VQW A;  3NTD A;  1YY5 A;  3QSE A;  3DGH A;  4UP3 A;  3LZW A;  4H4T A;  2IID A;  1JNR A;  3P4S A;  2YLS A;  4I58 A;  2ZZ0 A;  4A7A A;  1PXA A;  2WP6 A;  3DME A;  1RYI A;  1ZP0 A;  3PS9 A;  4DSG A;  5JCI A;  1PS9 A;  2WEU A;  4U8I A;  5BVA A;  3UOX A;  3LXD A;  2UZZ A;  4ZCC A;  1EBD A;  4OPU A;  1HYU A;  4OVI A;  4C3X A;  2GRT A;  3AB1 A;  3DJG X;  4NTE A;  3IHG A;  1E39 A;  2XVI A;  4B68 A;  1D4D A;  4A6N A;  1F8W A;  4RG3 A;  3K7M X;  1GEU A;  1GT8 A;  2ARD A;  4Z24 A;  4XWR A;  2B9W A;  1GND A;  3QVP A;  4U2T A;  2WP5 A;  1PXB A;  2WPE A;  3KU9 A;  4REK A;  4TM4 A;  3T37 A;  5BRT A;  2OLO A;  1GTH A;  1AOG A;  3D8X A;  3GMC A;  4TM0 A;  3HZL A;  3KPF A;  3NLC A;  3R9U A;  1TDO A;  4AP3 A;  1L9C A;  4C3Y A;  3LZX A;  1B37 A;  4YSH A;  1SEZ A;  2CFY A;  3KKJ A;  1PJ6 A;  5L46 A;  4TM1 A;  2BS2 A;  3P9U A;  4NTD A;  2B9X A;  3AEC A;  3CPH G;  1OJ9 A;  4UDQ A;  1MO9 A;  3RP8 A;  2VQB A;  3AE2 A;  5EB4 A;  4B67 A;  4CNJ A;  1H7X A;  4H4S A;  5KVI A;  3AE5 A;  2YG5 A;  4B64 A;  4Z26 A;  3ZYX A;  3DJJ A;  1S3E A;  1P2H A;  2AR8 A;  3VR9 A;  4CRT A;  3IF9 A;  1OJA A;  2FJA A;  2BC0 A;  2EQ9 A;  2V6O A;  2Q6U A;  2WU5 A;  3L8K A;  3UKH A;  4RSL A;  4APN A;  4M52 A;  4YKF A;  1M64 A;  3NK0 X;  1GRG A;  2GMJ A;  1S3B A;  3DA1 A;  2V3A A;  3K7Q X;  1O94 A; 
#chains in the Genus database with same CATH topology
 4J36 A;  4FDC B;  2PYX A;  3SY4 A;  4EIQ A;  3URH A;  3NK1 X;  1DTN A;  4CCR A;  1CHU A;  2PMQ A;  1H82 A;  4IV9 A;  1Y56 A;  2E3T A;  3QJ4 A;  4IT1 A;  3P4Q A;  4K5R A;  4NZH A;  1LQT A;  3NYE A;  1K0I A;  3S5W A;  3FCP A;  2YR4 A;  3EF6 A;  3NVV B;  1E1K A;  1H7W A;  1DOD A;  3R10 A;  3ZLG A;  3U4F A;  3CGD A;  1FHU A;  1JPD X;  3UKA A;  1PBC A;  2OZ3 A;  3AED A;  3R0U A;  4G6G A;  3GD6 A;  1COY A;  3GC2 A;  1E1L A;  1N4V A;  3CXB A;  3RP6 A;  3L1R A;  2H89 A;  1CBO A;  3Q6J A;  1WUF A;  4A3R A;  3H12 A;  1TRB A;  4DYE A;  3BOX A;  4KPL A;  5FJO A;  1MDL A;  4H4Q A;  5GRT A;  3AMZ A;  1CF3 A;  4A99 A;  2R0P A;  3BHF A;  1IUT A;  1XPQ A;  3IJL A;  4N9X A;  4EQW A;  2GQF A;  2RGJ A;  2R9Z A;  2QVH A;  4M6U A;  5C3J A;  3P93 A;  4AP1 A;  5FMH A;  3T14 A;  3QLD A;  1ZY8 A;  3B9J B;  4K8D A;  4IVM B;  4ROP A;  2VRM A;  3UCC A;  5BOF A;  1IUU A;  5KMQ A;  1VG9 A;  3K7T A;  1GSN A;  3RGT A;  3NVW B;  4FK1 A;  4E4F A;  1L9D A;  1JPM A;  1D4E A;  2GB0 A;  4NEW A;  3T31 A;  3F8D A;  2GGE A;  4H4R A;  3H70 A;  2YLX A;  3QKE A;  4YT0 A;  3N4E A;  1NPX A;  3UKL A;  3NK2 X;  3ISH A;  2R4J A;  3LJP A;  3SZF A;  1SJD A;  3JSK A;  4IZG A;  3T4W A;  1T3Q C;  2QGY A;  1REO A;  2YR6 A;  5KMS A;  2VZ2 A;  1WUE A;  3DG7 A;  3B97 A;  2CUL A;  2BS4 A;  2IVD A;  1K0J A;  1GRH A;  4B1B A;  3II4 A;  4TVY A;  1EC7 A;  4U2S A;  3VR8 A;  1W6T A;  2E4G A;  3AYJ A;  3FJ4 A;  4ZCD A;  3JW7 A;  4FX9 A;  4H4P A;  3DK9 A;  2RDX A;  2V60 A;  4MKS A;  2Z5X A;  2NPX A;  1X31 B;  1MNS A;  1GPE A;  2OLN A;  1GRT A;  4PAB A;  1OJT A;  2Z5Y A;  3LOV A;  2TPR A;  4IL0 A;  3NHO X;  3PO7 A;  4YKG A;  5M10 A;  2NQL A;  2XDO A;  2BK4 A;  4IL2 A;  1RM6 B;  1KN0 A;  3GD3 A;  1IUW A;  5FS6 A;  1NHR A;  1EL8 A;  1TDF A;  4X4J A;  3KUM A;  3NIX A;  3QSM A;  4WX1 A;  3UP5 A;  2YLR A;  4A65 A;  1GER A;  2BK3 A;  2QQ6 A;  1E1N A;  1X2G A;  2XVH A;  1BGJ A;  5M0Z A;  1RVK A;  4GRT A;  4USR A;  4BK1 A;  2C76 A;  3NVZ B;  1PDH A;  4D03 A;  2BAB A;  3UKP A;  1KD0 A;  3S61 A;  3UXL A;  4Y4L A;  1WYG A;  4Z43 A;  4XWZ A;  1N62 C;  2YG7 A;  2W54 A;  5EB5 A;  3MY9 A;  3N4F A;  3E1T A;  4GYP A;  1ZMC A;  3ENL A;  2E1M A;  1MDR A;  1FEA A;  1JCT A;  2GVC A;  4II2 A;  1N4W A;  5FJT A;  7ENL A;  5IQ4 A;  2POD A;  3GWD A;  3CGE A;  3DG6 A;  1LPF A;  4HCD A;  2C75 A;  1VG0 A;  2B7S A;  4GUV A;  1UKV G;  3GRS A;  4YTP A;  2OKT A;  3B3R A;  1CJ3 A;  3CNS A;  4A35 A;  2QJN A;  3DEQ A;  4DNA A;  3A7R A;  2PSN A;  4TLZ A;  5FJP A;  2BYB A;  2FJD A;  3SN4 A;  3FXG A;  3SXI A;  1ZKQ A;  1D5T A;  1ZK7 A;  4U8J A;  4J31 A;  4EQR A;  4U8O A;  1GRB A;  3AXB A;  3QPE A;  3FBS A;  4K22 A;  2OX4 A;  3DH9 A;  3SYI A;  3UOV A;  1IYX A;  1N61 C;  1TDE A;  5JCL A;  3R11 A;  1QLB A;  3UTE A;  2YVF A;  1DXL A;  1DOE A;  3COX A;  3QVR A;  1STZ A;  1YQ4 A;  3DFH A;  4H4V A;  4UDR A;  3H8I A;  3RRA A;  1SJA A;  3ICT A;  3C96 A;  4LU6 A;  1F6M A;  1KFY A;  4FP1 A;  2OA1 A;  2RGH A;  3TJI A;  3QSE A;  1PDY A;  1JNR A;  2YLS A;  4K1W A;  4A7A A;  1RYI A;  3PS9 A;  3LXD A;  1EBD A;  4C3X A;  4NTE A;  3BSM A;  1E39 A;  4B68 A;  1D4D A;  1F8W A;  3VC6 A;  2B9W A;  1GND A;  4U2T A;  1PXB A;  3KU9 A;  3T37 A;  3T9P A;  2OLO A;  2CHR A;  3HZL A;  3NLC A;  1TDO A;  1B37 A;  2PP1 A;  1PJ6 A;  2BS2 A;  4UDQ A;  4NTD A;  2B9X A;  3ETR B;  3UJ2 A;  2VQB A;  5EB4 A;  4CNJ A;  1H7X A;  2AL1 A;  4H4S A;  4IP4 A;  4B64 A;  4Z26 A;  3DJJ A;  1P43 A;  4HYR A;  3VR9 A;  4CRT A;  3IF9 A;  1OJA A;  2BC0 A;  2Q6U A;  2AKM A;  4RSL A;  4M52 A;  4EWJ A;  1GRG A;  3SBF A;  4ECH A;  1QO8 A;  2PTW A;  2YM2 A;  3DGB A;  5JCK A;  2GMH A;  2P8C A;  3IHM A;  5C2T A;  2NVK X;  1H81 A;  3MZN A;  3JVA A;  4K7Z A;  2XLP A;  2XYO A;  1JRY A;  1FEC A;  2C66 A;  4UDP A;  2OAL A;  4J34 A;  1B4V A;  2X8H A;  5KXJ A;  4OPG A;  2FKP A;  3TCS A;  1DJN A;  3OP2 A;  1IUX A;  3SSZ A;  5DBJ A;  3P1W A;  4HNC A;  4DX3 A;  4H4X A;  3O0H A;  4OPL A;  1M6I A;  1ZOV A;  1E9I A;  4G74 A;  3RR1 A;  3UTG A;  3CPI G;  3H4K A;  2YLZ A;  3KD9 A;  4H7U A;  2YAU A;  1CL0 A;  4H19 A;  2ZC8 A;  3AE7 A;  4Z44 A;  2PTX A;  5HXI A;  1DJQ A;  2XVF A;  5J04 A;  2XH2 A;  2WP9 A;  3VQR A;  3F8R A;  3BNM A;  2WPF A;  3TQP A;  4AT0 A;  4Z2U A;  1B5Q A;  5FS9 A;  4J56 A;  4E4U A;  3LAD A;  4JN9 A;  4NEV A;  4YSY A;  2YVG A;  2PA6 A;  3R1Z A;  1JNZ A;  3TJ4 A;  1DOC A;  2DW7 A;  3GRT A;  2GR0 A;  4A5L A;  3OPS A;  3MWC A;  3HYW A;  2W55 A;  2FJE A;  4AOS A;  3NYC A;  4CBQ A;  3AEB A;  3MSY A;  1Q1R A;  4NNJ A;  2I5Q A;  4XXG A;  2BA9 A;  4BUR A;  1Y56 B;  3B6D A;  3QFB A;  3ZLH A;  3EEZ A;  4HPN A;  2WU2 A;  2BCG G;  3U9I A;  3AN1 A;  3CN8 A;  1KF6 A;  3P4P A;  3GYJ A;  5J60 A;  2XH7 A;  3RCY A;  3AD8 B;  3MKC A;  2WHD A;  4G8T A;  5ER0 A;  4U8L A;  2R0G A;  4LA1 A;  3NN0 X;  4X9N A;  3GSI A;  3CAW A;  1N1P A;  2PHH A;  2X3N A;  2GQW A;  2YLW A;  1NHP A;  3QTP A;  4H4U A;  3IWA A;  5EOW A;  3BI5 A;  4AOX A;  5FS7 A;  3LB8 A;  4JDR A;  1RP0 A;  3EAN A;  1TDK A;  1KKR A;  3TWB A;  3V4B A;  4OCG A;  1KKO A;  1F9C A;  3CNP A;  2C64 A;  2AAQ A;  2AKZ A;  2OZ8 A;  2QDE A;  3T0K A;  3UCD A;  1FIQ B;  3EAO A;  4GDE A;  4YXD A;  2PGE A;  2AL2 A;  4B66 A;  2JB1 A;  2XLR A;  3I6E A;  2X8C A;  3UCL A;  1JOA A;  2XH4 A;  1N60 C;  1FHV A;  2OVL A;  2X99 A;  1VRQ B;  3GO2 A;  4J2W A;  3RIT A;  5JCN A;  3AM9 A;  2XCG A;  1LQU A;  2TMD A;  2A8X A;  2WOI A;  3HW2 A;  4MMW A;  4BJY A;  3D47 A;  3UTH A;  3QFA A;  2BXS A;  3GD4 A;  2GEW A;  1FO4 A;  3Q4D A;  5HYM A;  1MUC A;  4WCT A;  3A7U A;  3DJD A;  3K1G A;  1YKJ A;  3G5R A;  4YWO A;  3UJE A;  3M12 A;  2Y6Q A;  4MJW A;  1LTX R;  3QSS A;  1NHS A;  2OFJ A;  3AE4 A;  2JAE A;  4BJZ A;  4KPR A;  2ZBW A;  1V97 A;  3CMM A;  3K30 A;  2P0I A;  3VFC A;  4EMI A;  2MNR A;  1GOS A;  3T8Q A;  2XH0 A;  4H4W A;  2RAB A;  4NWZ A;  1GAL A;  1GXF A;  1EL5 A;  1V59 A;  1X2H A;  4A79 A;  5G5G B;  1XAN A;  3P0W A;  2XVE A;  1ZOY A;  3SZ0 A;  2C73 A;  3WE0 A;  2HNE A;  3VDG A;  4G7F A;  2YLT A;  2VQ7 A;  1JRX A;  1K4Q A;  3RO6 A;  1L9E A;  5EBK A;  4P9S A;  4EIP A;  4KT2 A;  4LII A;  3NGC X;  2WDQ A;  3T2Y A;  4NTC A;  3ES8 A;  1H2I A;  3M0O A;  2GGH A;  1OJC A;  3M13 A;  3ZDN A;  3IC9 A;  2PPG A;  4A9W A;  3SR6 B;  3F8P A;  3EPT A;  2BAC A;  4J1O A;  4UP3 A;  5FJR A;  3P4S A;  4ZOH B;  3DME A;  1ZP0 A;  4DSG A;  5JCI A;  3HYV A;  1R6W A;  4RG3 A;  2ARD A;  4XWR A;  4REK A;  5BRT A;  1L9C A;  4C3Y A;  1BKH A;  1SEZ A;  3KKJ A;  5L46 A;  4TM1 A;  3AEC A;  3CPH G;  3VA8 A;  3RP8 A;  5KVI A;  1S3E A;  2FJA A;  2WU5 A;  3L8K A;  3UKH A;  4GME A;  4YKF A;  1M64 A;  5JRB A;  1S3B A;  3T2Z A;  4ZN0 A;  3NVY B;  1D7L A;  1N4U A;  2CVJ A;  4O5Q A;  1H83 A;  4GF7 A;  3DK8 A;  4K8G A;  4JN7 A;  2Q0L A;  3BJS A;  1CJ2 A;  2OQY A;  1N5X A;  1BWC A;  4TLX A;  3AE6 A;  2WS3 A;  5KMR A;  4H1Z A;  5J7X A;  4H83 A;  4IP5 A;  4YTN A;  4CY6 A;  1FEB A;  1GET A;  4EQS A;  3ES7 A;  3GDP A;  1NU5 A;  3NFU A;  3Q9T A;  2I0Z A;  3PWG A;  4II3 A;  2GSH A;  4B65 A;  4H2R A;  3SN0 A;  3V5F A;  3UOZ A;  1DNC A;  1E6E A;  4OPC A;  2WET A;  2XSX A;  4EM4 A;  2OAM A;  3CTY A;  3DDM A;  4ADW A;  3AWI A;  2APG A;  2ZZB A;  2XVJ A;  2BXR A;  5U1O A;  3SQP A;  3TW9 A;  2YM1 A;  4JNA A;  1GES A;  4JQ9 A;  4E6M A;  1PBD A;  1NDA A;  2QA2 A;  3UJF A;  4RG4 A;  1GV4 A;  4GGH A;  3ATR A;  4IA5 A;  4GDP A;  1TKK A;  2QDD A;  2VOU A;  3R0K A;  3DFY A;  2XFN A;  4EQX A;  1GRA A;  1E1M A;  1W4X A;  3HRD C;  4OPT A;  2X50 A;  4EM3 A;  2GR3 A;  1ZDL A;  3P4R A;  4C5O A;  4Z1Y A;  1D4C A;  4X9M A;  2GL5 A;  3H8A A;  4H4Y A;  4JY3 A;  2XGZ A;  4JNQ A;  2VVL A;  2C67 A;  4TVW A;  3RNM A;  1E7P A;  4G6H A;  3TWA A;  4B63 A;  1EBH A;  3CB3 A;  4G73 A;  2PU1 A;  4DHG A;  4H2Q A;  1K0L A;  2GAH B;  3VCN A;  2PP3 A;  1VDC A;  4HNL A;  2QCU A;  3AYL A;  2C72 A;  3OC4 A;  2E5V A;  2GDQ A;  4GIR A;  1ZXI C;  3DIP A;  2GH5 A;  2XFQ A;  2MUC A;  3V3W A;  3ALM A;  4IHC A;  3I6T A;  4H2P A;  1CJC A;  1LJ1 A;  5JCM A;  3GDN A;  4BK3 A;  2WOW A;  1CC4 A;  5HHF A;  3V3O A;  3H8L A;  2A89 A;  2C3C A;  3KA7 A;  3SX6 A;  2POZ A;  2OQH A;  6ENL A;  4GAV A;  2A87 A;  3ALJ A;  4Z2R A;  4H2N A;  5KWF A;  1EC9 A;  3CGB A;  4HN8 A;  3UOY A;  1ONF A;  2GV8 A;  3OZM A;  3VCC A;  1NEK A;  3G5Q A;  3R07 C;  3FG2 P;  2AQJ A;  3FIM B;  3EUB 3;  1F8R A;  5HY5 A;  3ADA B;  2ZAD A;  2V61 A;  1CC2 A;  2V3B A;  2OG9 A;  2DKI A;  4H2H A;  2BCP A;  3C4A A;  3I6D A;  2OO6 A;  1TE6 A;  4YSX A;  3D1C A;  3NRN A;  2BK5 A;  5KVH A;  4GYP C;  3H7V A;  4CNK A;  1VDV A;  2YG6 A;  1KDG A;  4H4Z A;  2YWL A;  2JK6 A;  3N6J A;  3GYX A;  3SM8 A;  3MQT A;  3NH3 X;  3CT2 A;  3NO1 A;  5TR3 A;  4D04 A;  1YEY A;  2AL2 B;  1H84 A;  2R0C A;  3C4N A;  2P88 A;  2XFP A;  5KOW A;  5ENL A;  1BQG A;  3TTE A;  4U8P A;  2R4E A;  4Z2T A;  3AEE A;  1ELI A;  1GRE A;  3DG3 A;  4Y4N A;  4HCL A;  3CND A;  2YVJ A;  2GR1 A;  2GGG A;  2YQU A;  3UGV A;  1XS2 A;  2C3D A;  1CC6 A;  2XFU A;  4OPI A;  4YTM A;  3TOY A;  5CQF A;  2WQY A;  5FJU A;  3T2K A;  5BUK A;  1H6V A;  4Y4M A;  4GGB A;  3CNJ A;  1TZZ A;  3KLJ A;  2PS2 A;  3V3N A;  2J3N A;  1NG3 A;  1PBB A;  3CIR A;  4A6N B;  3CYJ A;  2QA1 A;  3RP7 A;  1Z6L A;  4KX6 A;  4DXK A;  2DW6 A;  1MXT A;  1VQW A;  3IK4 A;  3DGH A;  3MUC A;  4H4T A;  4KEM A;  3DER A;  4I58 A;  2ZZ0 A;  4K2S A;  2WP6 A;  1PXA A;  4M0X A;  1PS9 A;  2UZZ A;  4ZCC A;  4OPU A;  4GAP A;  4OVI A;  4G9K A;  3IJI A;  3I4K A;  1SJB A;  2BRY A;  3IHG A;  3NRZ B;  2FYM A;  3IJQ A;  4A6N A;  1GEU A;  1GT8 A;  3R25 A;  3PG6 A;  3QVP A;  2P8B A;  4TM4 A;  1GTH A;  1AOG A;  4AP3 A;  4YSH A;  3AE2 A;  3AE5 A;  4J3Z A;  2YG5 A;  3ZYX A;  3NS1 B;  2AR8 A;  4APN A;  3UXK A;  3NK0 X;  3STP A;  2GMJ A;  2V3A A;  3K7Q X;  1Q1W A;  1JEH A;  3ZLF A;  2C4C A;  3AE1 A;  3UKK A;  1PHH A;  5IPY A;  3OTR A;  1PJ5 A;  3VRB A;  4ZA0 A;  2JKC A;  3P3B A;  1L8P A;  3SZC A;  1Y0P A;  4YWS A;  2HZG A;  5KOX A;  2PU0 A;  1PJ7 A;  4U8N A;  3HPF A;  4C74 A;  3BI4 A;  1PBE A;  4B69 A;  3Q45 A;  1ECQ A;  1JRP A;  2B7R A;  2X8G A;  2FBW A;  2FJB A;  1EBG A;  2GF3 A;  1LVL A;  2V5Z A;  3V5C A;  3D9X A;  4ENL A;  4HCH A;  1VQZ A;  2W0H A;  3JZU A;  1Q9I A;  3SQS A;  3ATQ A;  1JRZ A;  3S5S A;  3I3L A;  1JDF A;  1BF3 A;  3EKG A;  3UKF A;  2Q0K A;  3SN1 A;  3AE8 A;  3VRA A;  4U2L A;  5U63 A;  2C65 A;  3SGL A;  2C70 A;  1NAA A;  2YR5 A;  5U25 A;  2JB2 A;  3SZW A;  1SB3 B;  4IA6 A;  4JHM A;  1NG4 A;  2C7G A;  4JY2 A;  3ZVH B;  3NTA A;  4FI4 A;  4I59 A;  2JBV A;  2HQM A;  4DSH A;  3KVE A;  1LV0 A;  2GGJ A;  2PCE A;  4E8G A;  4Z25 A;  1O95 A;  3GYI A;  2CDU A;  1QJD A;  3S47 A;  1KSS A;  2RGO A;  1MRA A;  1R0M A;  2Y6R A;  3AE9 A;  2WDR A;  3ZVH A;  4AT2 A;  1GRF A;  3AEF A;  1NEL A;  1BKW A;  4GIS A;  3ICS A;  4BV6 A;  2VVL G;  1SJC A;  4DGK A;  2B9Y A;  1BZL A;  3NKS A;  3FYY A;  2IVE A;  3ICR A;  1FOH A;  1N63 C;  1FFU C;  3NG7 X;  3CXO A;  1IUS A;  1H86 A;  3ABV A;  1CJ4 A;  1XHC A;  2E5A A;  3DGZ A;  2R45 A;  4J33 A;  4U8M A;  4TM3 A;  3N6H A;  1B8S A;  4CY8 A;  4U8K A;  3NNE A;  3AEA A;  4YSZ A;  4A6G A;  2W3R A;  4HB9 A;  2WBA A;  3SFE A;  1TYT A;  1EC8 A;  1O5W A;  3HYX A;  1ZMD A;  4E0V A;  3VRD B;  2XLU A;  3RED A;  5GSN A;  4F4R A;  1PN0 A;  1DOB A;  3NN6 X;  5IQ1 A;  4KWS A;  4X2P A;  1KNR A;  3BNU A;  2ONE A;  1F3P A;  2WOV A;  3G5S A;  2HXT A;  1FFV C;  3NXL A;  3QN3 A;  4EMJ A;  1NHQ A;  1S2Y A;  4OPD A;  2B76 A;  1YQ3 A;  3BI2 A;  3A7A A;  4USQ A;  2Q7V A;  3ITJ A;  1YQZ A;  3OW1 A;  3AD7 B;  3PK7 A;  5G5H B;  3CNT A;  4C77 A;  2OZT A;  4ZCW A;  3ALL A;  1D7Y A;  2WES A;  2ACZ A;  1FCD A;  3NYF A;  3RHA A;  3VC5 A;  2O56 A;  4O5U A;  3KPK A;  3AD9 B;  1IJH A;  1PXC A;  4IVO B;  3FVD A;  2OPJ A;  5LV9 A;  1TDN A;  3CPJ G;  4EMW A;  5CKU A;  1GTE A;  4H50 A;  2QAE A;  1L0V A;  1IUV A;  4HA6 A;  3PVC A;  1S2Q A;  3UJR A;  4GCM A;  1JRO A;  2EQ6 A;  2GGI A;  2YG3 A;  2F5Z A;  1ONE A;  4E5T A;  4K5S A;  3PWI A;  3SFD A;  1NEN A;  2BC1 A;  2HXU A;  2JB3 A;  2GR2 A;  4FK1 C;  2R46 A;  3UJS A;  3AE3 A;  5BUL A;  2XFO A;  1RSG A;  2XLS A;  1TYP A;  1KCZ A;  1FL2 A;  2EQ8 A;  2EQ7 A;  1OJD A;  4BK2 A;  4DWD A;  4K2X A;  1S7M A;  2OLA A;  4PAA A;  3AEG A;  1P48 A;  2YG4 A;  2ZZC A;  2VVM A;  3GWF A;  4GR1 A;  5KNL A;  4JN8 A;  5KMP A;  2GAG B;  2O9Z A;  3AYI A;  5EU9 A;  3FMW A;  3DJE A;  3CK5 A;  2H88 A;  3UP4 A;  3D46 A;  5FS8 A;  3DK4 A;  1ZX9 A;  4DN1 A;  2XLT A;  1N5W C;  3FPZ A;  2BRA A;  2PP0 A;  1EL7 A;  2P3Z A;  1OEP A;  1F8S A;  2BS3 A;  2WDV A;  1XDI A;  2W3S A;  3V76 A;  3ZVI A;  3GY1 A;  3CGC A;  5IDZ A;  1XPY A;  3BHK A;  3OZY A;  1JU2 A;  5KRQ A;  2DKH A;  3L5O A;  3GMB A;  2WPC A;  3UTF A;  2PTY A;  4Z17 A;  4J57 A;  2PTZ A;  3UKQ A;  1P2E A;  1BGN A;  3OZ2 A;  3NT6 A;  3T6C A;  4CCQ A;  4ICY A;  2VRL A;  1KSU A;  1EL9 A;  1KNP A;  1MOK A;  2QJJ A;  1PBF A;  3NZG A;  1YY5 A;  5BOE A;  3LZW A;  2IID A;  3SJN A;  2WEU A;  4U8I A;  5BVA A;  4GFI A;  3UOX A;  1HYU A;  2GRT A;  3AB1 A;  3DJG X;  3THU A;  2XVI A;  3FV9 A;  3K7M X;  4Z24 A;  4MGG A;  3PFR A;  2WP5 A;  2WPE A;  3D8X A;  3DES A;  3GMC A;  4TM0 A;  3KPF A;  3R9U A;  3LZX A;  2CFY A;  1ELS A;  3P9U A;  1OJ9 A;  1MO9 A;  4B67 A;  2PGW A;  1P2H A;  2EQ9 A;  2V6O A;  2QJM A;  1PDZ A;  3DA1 A;  3NTD A;  1O94 A; 
#chains in the Genus database with same CATH homology
 1Q1W A;  4J36 A;  4ZN0 A;  1JEH A;  4ECH A;  1D7L A;  4FDC B;  2C4C A;  1QO8 A;  1N4U A;  2CVJ A;  2PYX A;  3AE1 A;  3SY4 A;  2YM2 A;  4O5Q A;  1H83 A;  4GF7 A;  3UKK A;  4EIQ A;  3DK8 A;  5JCK A;  3URH A;  2GMH A;  1PHH A;  5IPY A;  3IHM A;  1PJ5 A;  3VRB A;  2JKC A;  3NK1 X;  5C2T A;  2Q0L A;  2NVK X;  3SZC A;  1H81 A;  1Y0P A;  1CHU A;  4CCR A;  1CJ2 A;  5KOX A;  4K7Z A;  1PJ7 A;  2XLP A;  4U8N A;  2XYO A;  1H82 A;  4C74 A;  3BI4 A;  1JRY A;  4IV9 A;  1PBE A;  1Y56 A;  4B69 A;  3QJ4 A;  1BWC A;  4TLX A;  1FEC A;  3P4Q A;  4K5R A;  2C66 A;  2B7R A;  4NZH A;  2OAL A;  1LQT A;  3AE6 A;  4UDP A;  2WS3 A;  4J34 A;  2X8G A;  2FBW A;  3NYE A;  2FJB A;  5KMR A;  1B4V A;  2X8H A;  1K0I A;  2GF3 A;  4OPG A;  5J7X A;  5KXJ A;  3S5W A;  1LVL A;  2YR4 A;  2V5Z A;  1DJN A;  3EF6 A;  1E1K A;  1H7W A;  1DOD A;  3D9X A;  4YTN A;  1IUX A;  5DBJ A;  3CGD A;  3P1W A;  2W0H A;  4CY6 A;  4H4X A;  3O0H A;  1Q9I A;  1FEB A;  1GET A;  3ATQ A;  1JRZ A;  4OPL A;  1M6I A;  1PBC A;  1ZOV A;  3AED A;  3I3L A;  3UKA A;  4EQS A;  4G6G A;  1BF3 A;  4G74 A;  3GDP A;  3UTG A;  3CPI G;  2Q0K A;  3UKF A;  3H4K A;  1COY A;  1E1L A;  1N4V A;  3AE8 A;  3VRA A;  2YLZ A;  3L1R A;  3KD9 A;  3Q9T A;  2C65 A;  4U2L A;  2C70 A;  1NAA A;  5U63 A;  4H7U A;  3SGL A;  2YR5 A;  2YAU A;  5U25 A;  2I0Z A;  2H89 A;  1CL0 A;  1CBO A;  2JB2 A;  4II3 A;  3SZW A;  3Q6J A;  3AE7 A;  4IA6 A;  4B65 A;  1NG4 A;  2C7G A;  4H2R A;  4Z44 A;  4JY2 A;  5HXI A;  1DJQ A;  1TRB A;  2XVF A;  3NTA A;  4I59 A;  4H4Q A;  3UOZ A;  1DNC A;  5GRT A;  1E6E A;  4OPC A;  1CF3 A;  2WET A;  4A99 A;  2R0P A;  2JBV A;  2WP9 A;  2HQM A;  3VQR A;  3F8R A;  4DSH A;  4EM4 A;  3BNM A;  2OAM A;  3KVE A;  2WPF A;  3CTY A;  1LV0 A;  4ADW A;  1IUT A;  3AWI A;  3BHF A;  1XPQ A;  4N9X A;  2APG A;  4Z25 A;  4EQW A;  2ZZB A;  4AT0 A;  2GQF A;  2XVJ A;  2RGJ A;  2R9Z A;  2BXR A;  1B5Q A;  1O95 A;  5U1O A;  4Z2U A;  5FS9 A;  4J56 A;  3SQP A;  3GYI A;  5C3J A;  2YM1 A;  4AP1 A;  4JNA A;  2CDU A;  1QJD A;  3LAD A;  4JN9 A;  4NEV A;  5FMH A;  4YSY A;  1KSS A;  2YVG A;  1GES A;  2RGO A;  3T14 A;  1JNZ A;  1ZY8 A;  4JQ9 A;  4K8D A;  4IVM B;  1PBD A;  1DOC A;  2Y6R A;  2VRM A;  1NDA A;  3AE9 A;  2WDR A;  1IUU A;  3GRT A;  2GR0 A;  1VG9 A;  5KMQ A;  4A5L A;  1GRF A;  2QA2 A;  3K7T A;  4AT2 A;  1GSN A;  3AEF A;  4FK1 A;  1L9D A;  3HYW A;  2FJE A;  4AOS A;  1BKW A;  3NYC A;  3ICS A;  1D4E A;  2GB0 A;  4RG4 A;  1GV4 A;  4NEW A;  4BV6 A;  3AEB A;  4CBQ A;  2VVL G;  3T31 A;  4DGK A;  3F8D A;  4H4R A;  1Q1R A;  4NNJ A;  2YLX A;  2B9Y A;  3ATR A;  4XXG A;  4IA5 A;  4GDP A;  2BA9 A;  1BZL A;  4YT0 A;  4BUR A;  2VOU A;  3NKS A;  2IVE A;  1Y56 B;  3ICR A;  2XFN A;  1NPX A;  3UKL A;  3B6D A;  3QFB A;  1FOH A;  4EQX A;  3ISH A;  3NK2 X;  1GRA A;  1E1M A;  2R4J A;  3NG7 X;  3LJP A;  1W4X A;  3SZF A;  1IUS A;  2WU2 A;  2BCG G;  1H86 A;  3ABV A;  4OPT A;  1CJ4 A;  1XHC A;  3JSK A;  3CN8 A;  2X50 A;  3DGZ A;  4EM3 A;  1KF6 A;  2R45 A;  3P4P A;  2GR3 A;  1REO A;  2YR6 A;  3GYJ A;  5J60 A;  5KMS A;  4J33 A;  1ZDL A;  2VZ2 A;  3P4R A;  4U8M A;  4TM3 A;  1B8S A;  4CY8 A;  3AD8 B;  4U8K A;  2CUL A;  2WHD A;  5ER0 A;  4C5O A;  4U8L A;  2R0G A;  3NNE A;  2BS4 A;  2IVD A;  1K0J A;  1GRH A;  4LA1 A;  1D4C A;  3NN0 X;  3AEA A;  4X9M A;  4YSZ A;  4B1B A;  4X9N A;  3II4 A;  4H4Y A;  3GSI A;  1N1P A;  2PHH A;  2X3N A;  4HB9 A;  2GQW A;  2WBA A;  4JY3 A;  2YLW A;  1TYT A;  4U2S A;  3SFE A;  3VR8 A;  1O5W A;  2E4G A;  4JNQ A;  1NHP A;  3HYX A;  1ZMD A;  3AYJ A;  4E0V A;  2VVL A;  4ZCD A;  2C67 A;  4H4U A;  4FX9 A;  4H4P A;  3VRD B;  2XLU A;  3RNM A;  3DK9 A;  3IWA A;  5EOW A;  1E7P A;  3RED A;  4G6H A;  3BI5 A;  4AOX A;  5FS7 A;  2V60 A;  3LB8 A;  5GSN A;  4B63 A;  1PN0 A;  2Z5X A;  1DOB A;  4JDR A;  3NN6 X;  2NPX A;  3EAN A;  1RP0 A;  4G73 A;  4H2Q A;  5IQ1 A;  1TDK A;  3T2Z A;  1KNR A;  4OCG A;  3BNU A;  1K0L A;  1X31 B;  2GAH B;  1GPE A;  1F3P A;  2WOV A;  2OLN A;  3G5S A;  1GRT A;  4PAB A;  1OJT A;  1VDC A;  3CNP A;  2C64 A;  2Z5Y A;  3LOV A;  2QCU A;  2AAQ A;  3AYL A;  2TPR A;  3T0K A;  3NHO X;  3PO7 A;  4EMJ A;  3EAO A;  2C72 A;  4GDE A;  4YKG A;  4YXD A;  5M10 A;  3OC4 A;  2E5V A;  2XDO A;  2BK4 A;  1NHQ A;  1S2Y A;  4OPD A;  4B66 A;  2GH5 A;  2XFQ A;  3ALM A;  2JB1 A;  1KN0 A;  2XLR A;  2B76 A;  4H2P A;  3GD3 A;  1CJC A;  1YQ3 A;  1LJ1 A;  1IUW A;  5FS6 A;  5JCM A;  3BI2 A;  2X8C A;  3GDN A;  3UCL A;  4BK3 A;  1NHR A;  2WOW A;  1CC4 A;  1EL8 A;  4USQ A;  1TDF A;  2Q7V A;  1JOA A;  3ITJ A;  4X4J A;  1YQZ A;  3AD7 B;  5HHF A;  3V3O A;  3NIX A;  3H8L A;  2A89 A;  3CNT A;  4C77 A;  3QSM A;  2C3C A;  2X99 A;  1VRQ B;  3KA7 A;  3ALL A;  4WX1 A;  4J2W A;  3SX6 A;  3UP5 A;  2YLR A;  5JCN A;  1D7Y A;  4A65 A;  2WES A;  1GER A;  2ACZ A;  2BK3 A;  4GAV A;  1FCD A;  2A87 A;  1E1N A;  3ALJ A;  3NYF A;  4Z2R A;  4H2N A;  5KWF A;  2XVH A;  3RHA A;  2XCG A;  3CGB A;  4O5U A;  1LQU A;  1BGJ A;  2TMD A;  2A8X A;  5M0Z A;  3KPK A;  4GRT A;  2WOI A;  3AD9 B;  3UOY A;  4USR A;  4BK1 A;  1IJH A;  1PXC A;  2C76 A;  4IVO B;  4BJY A;  1ONF A;  1PDH A;  4D03 A;  2BAB A;  3UTH A;  2GV8 A;  3UKP A;  5LV9 A;  3QFA A;  1TDN A;  3S61 A;  3CPJ G;  2BXS A;  1NEK A;  3GD4 A;  4EMW A;  3G5Q A;  4Y4L A;  4Z43 A;  4XWZ A;  5CKU A;  2YG7 A;  2GEW A;  1GTE A;  5EB5 A;  3FG2 P;  2AQJ A;  3FIM B;  4H50 A;  1F8R A;  2QAE A;  5HY5 A;  5HYM A;  3ADA B;  1L0V A;  1IUV A;  4HA6 A;  3PVC A;  4WCT A;  1S2Q A;  2V61 A;  4GCM A;  1CC2 A;  2V3B A;  2EQ6 A;  3E1T A;  3DJD A;  1ZMC A;  2DKI A;  1YKJ A;  2BCP A;  3C4A A;  3I6D A;  3G5R A;  2E1M A;  2F5Z A;  4YWO A;  2YG3 A;  3M12 A;  4K5S A;  1FEA A;  2GVC A;  4II2 A;  1N4W A;  2Y6Q A;  3SFD A;  1NEN A;  4MJW A;  2BC1 A;  2JB3 A;  4FK1 C;  2GR2 A;  4YSX A;  2R46 A;  5IQ4 A;  3D1C A;  3GWD A;  3NRN A;  3AE3 A;  3CGE A;  5BUL A;  2XFO A;  1RSG A;  1LTX R;  1LPF A;  1TYP A;  1NHS A;  2XLS A;  3QSS A;  2BK5 A;  1FL2 A;  2C75 A;  5KVH A;  3AE4 A;  1VG0 A;  2JAE A;  2EQ8 A;  4BJZ A;  2EQ7 A;  4KPR A;  2ZBW A;  1OJD A;  4BK2 A;  2B7S A;  4GUV A;  4K2X A;  3CMM A;  1UKV G;  3K30 A;  1S7M A;  3GRS A;  4PAA A;  4CNK A;  4EMI A;  4YTP A;  3AEG A;  2YG6 A;  3B3R A;  1KDG A;  4H4Z A;  1GOS A;  2YWL A;  2JK6 A;  1CJ3 A;  3GYX A;  2YG4 A;  3CNS A;  4H4W A;  3SM8 A;  2ZZC A;  2RAB A;  2VVM A;  3GWF A;  4GR1 A;  5KNL A;  3NH3 X;  4NWZ A;  5KMP A;  1GAL A;  1GXF A;  4DNA A;  1EL5 A;  1V59 A;  2GAG B;  2O9Z A;  5TR3 A;  4TLZ A;  3AYI A;  4D04 A;  2BYB A;  3FMW A;  3DJE A;  2H88 A;  2FJD A;  3UP4 A;  5FS8 A;  3DK4 A;  1ZX9 A;  1H84 A;  2R0C A;  2XLT A;  3C4N A;  4A79 A;  2XFP A;  1XAN A;  3SXI A;  5KOW A;  2XVE A;  3RP6 A;  1ZOY A;  2R4E A;  4U8P A;  1ZKQ A;  3FPZ A;  1D5T A;  1ZK7 A;  4Z2T A;  4U8J A;  2BRA A;  4J31 A;  3SZ0 A;  2C73 A;  1EL7 A;  3WE0 A;  3AEE A;  4EQR A;  4U8O A;  1GRB A;  1ELI A;  3AXB A;  3FBS A;  1GRE A;  2YLT A;  2VQ7 A;  3DH9 A;  1JRX A;  4K22 A;  4Y4N A;  3SYI A;  3UOV A;  1K4Q A;  1L9E A;  1F8S A;  2BS3 A;  1TDE A;  2WDV A;  3CND A;  2YVJ A;  5EBK A;  5JCL A;  1XDI A;  2GR1 A;  2YQU A;  4P9S A;  3V76 A;  1QLB A;  2C3D A;  1CC6 A;  2XFU A;  4OPI A;  4YTM A;  3CGC A;  4EIP A;  4LII A;  3NGC X;  5CQF A;  2WQY A;  3BHK A;  2WDQ A;  1JU2 A;  3T2K A;  3UTE A;  5BUK A;  5KRQ A;  1H6V A;  2YVF A;  2DKH A;  3T2Y A;  4NTC A;  4Y4M A;  3L5O A;  3GMB A;  1DXL A;  1DOE A;  3COX A;  2WPC A;  3QVR A;  3CNJ A;  3UTF A;  3KLJ A;  1H2I A;  1YQ4 A;  4H4V A;  3M0O A;  4UDR A;  3V3N A;  4J57 A;  3H8I A;  3UKQ A;  2J3N A;  1OJC A;  1NG3 A;  3M13 A;  1P2E A;  1PBB A;  3CIR A;  3ZDN A;  4A6N B;  3ICT A;  1BGN A;  3OZ2 A;  2QA1 A;  3C96 A;  3IC9 A;  4LU6 A;  4A9W A;  1F6M A;  3NT6 A;  3RP7 A;  3F8P A;  3EPT A;  4CCQ A;  4ICY A;  2VRL A;  1KFY A;  1Z6L A;  1KSU A;  4KX6 A;  2BAC A;  1EL9 A;  1KNP A;  2OA1 A;  1MOK A;  2RGH A;  1MXT A;  1PBF A;  1VQW A;  3NTD A;  1YY5 A;  3QSE A;  3DGH A;  4UP3 A;  3LZW A;  4H4T A;  2IID A;  1JNR A;  3P4S A;  2YLS A;  4I58 A;  2ZZ0 A;  4A7A A;  1PXA A;  2WP6 A;  3DME A;  1RYI A;  1ZP0 A;  3PS9 A;  4DSG A;  5JCI A;  1PS9 A;  2WEU A;  4U8I A;  5BVA A;  3UOX A;  3LXD A;  2UZZ A;  4ZCC A;  1EBD A;  4OPU A;  1HYU A;  4GAP A;  4OVI A;  2GRT A;  3AB1 A;  4C3X A;  3DJG X;  4G9K A;  3HYV A;  3IHG A;  4NTE A;  1E39 A;  2BRY A;  2XVI A;  4B68 A;  1D4D A;  4A6N A;  1F8W A;  4RG3 A;  3K7M X;  1GEU A;  1GT8 A;  2ARD A;  4Z24 A;  4XWR A;  2B9W A;  1GND A;  3PG6 A;  3QVP A;  4U2T A;  2WP5 A;  1PXB A;  2WPE A;  3KU9 A;  4REK A;  4TM4 A;  3T37 A;  5BRT A;  2OLO A;  1GTH A;  1AOG A;  3D8X A;  3GMC A;  4TM0 A;  3HZL A;  3KPF A;  3NLC A;  3R9U A;  1TDO A;  4AP3 A;  1L9C A;  4C3Y A;  3LZX A;  1B37 A;  4YSH A;  1SEZ A;  2CFY A;  3KKJ A;  1PJ6 A;  5L46 A;  4TM1 A;  2BS2 A;  3P9U A;  4NTD A;  2B9X A;  3AEC A;  3CPH G;  1OJ9 A;  4UDQ A;  1MO9 A;  3RP8 A;  2VQB A;  3AE2 A;  5EB4 A;  4B67 A;  4CNJ A;  1H7X A;  4H4S A;  5KVI A;  3AE5 A;  2YG5 A;  4B64 A;  4Z26 A;  3ZYX A;  3DJJ A;  1S3E A;  1P2H A;  2AR8 A;  3VR9 A;  4CRT A;  3IF9 A;  1OJA A;  2FJA A;  2BC0 A;  2EQ9 A;  2V6O A;  2Q6U A;  2WU5 A;  3L8K A;  3UKH A;  4RSL A;  4APN A;  4M52 A;  4YKF A;  1M64 A;  3NK0 X;  5JRB A;  1GRG A;  2GMJ A;  1S3B A;  3DA1 A;  2V3A A;  3K7Q X;  1O94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...