5JCLA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
432
structure length
429
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPAPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFYSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Oxidoreductase
molecule keywords Os09g0567300 protein
total genus 136
structure length 429
sequence length 432
chains with identical sequence B
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jclA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jclA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jclA02
3CNPA 3CNTA 3NRNA 4BK1A 4A6NA 3G5RA 2WP9A 3CGDA 3AEDA 2VVLA 4EIPA 3QFBA 4AP1A 1GTEA 3EANA 4ZCCA 2GQFA 3BHKA 2XVIA 1CC2A 3AD7B 3AWIA 5M10A 2YVGA 3ICSA 2GR3A 3LZXA 4OPLA 4A65A 4P9SA 4B69A 1NENA 1DOCA 1GPEA 3COXA 2XCGA 4FK1C 4EQSA 4AT2A 3DJDA 1H84A 4B66A 5L46A 3AEBA 1E1MA 2BCPA 1JRYA 3CNSA 3CGBA 3SM8A 1S2QA 4UDPA 1P2HA 2YLRA 3NG7X 2BC1A 4IVOB 4UDQA 2NVKX 3NN6X 3GD4A 1FEAA 1DOEA 2YLWA 3CGEA 3RNMA 1V59A 1BWCA 3UTGA 3OC4A 3SFDA 2WQYA 1N4WA 4YSXA 1B4VA 4H2PA 2BS2A 4AOXA 3RP7A 1Q9IA 5FMHA 4Z2TA 2YAUA 2V61A 3VR9A 2B9YA 2YG3A 4CNJA 5J7XA 1HYUA 2BS4A 2WEUA 3ZYXA 1D5TA 1JNRA 1H81A 5JCNA 4CRTA 3E1TA 5KXJA 2J3NA 3UKLA 2C73A 3IHMA 2Z5YA 1Y56B 2GAGB 1QO8A 3GRSA 4J31A 3UTHA 4JQ9A 5JCLA 2GEWA 4Z43A 5BULA 1PXAA 2FJAA 4WX1A 4U8NA 1ZY8A 2BCGG 3ICRA 3S5WA 2A89A 3NGCX 4Y4LA 3B6DA 3AE8A 1XHCA 4APNA 3NKSA 3GDNA 3CGCA 3DK9A 1LJ1A 4YTNA 1B8SA 1K0LA 1E7PA 4YSYA 4H2NA 1CL0A 1N1PA 5EOWA 4B67A 1L9DA 2WETA 1MO9A 4RG3A 3CN8A 1OJTA 1XPQA 1PBFA 3AD8B 3KU9A 3QVPA 3UP5A 1JU2A 2GMJA 4UDRA 3QFAA 1Y56A 5EBKA 3GWFA 4REKA 4YT0A 2XVFA 1Z6LA 3AXBA 4NTEA 4K22A 3RP8A 2APGA 2RGHA 4EM3A 2H89A 3ADAB 1PBBA 5KVHA 4NEWA 3ATRA 4K5RA 2OLNA 4B64A 2WDRA 4BK2A 5CKUA 2C65A 2WDVA 4CBQA 4YXDA 1IJHA 2YLSA 1EL5A 3M12A 2BXSA 4JNAA 1GEUA 2RGJA 1H7WA 2B76A 3UKKA 3KPFA 2VRLA 3AYIA 4ZCDA 2IVDA 1D4CA 4C77A 1VG9A 2BABA 3AE4A 4TM0A 3D1CA 3L8KA 2V5ZA 3NYCA 4H4SA 4OPUA 5TR3A 1OJDA 2C72A 4K8DA 3AE7A 1JOAA 3UP4A 1DOBA 2X8CA 2C75A 2GH5A 3QSSA 3GYIA 2YQUA 4X4JA 2WOIA 3S61A 2FJDA 4OPGA 3AE1A 1L0VA 3F8RA 2WOWA 3H8IA 2DKIA 4NEVA 2GMHA 2PHHA 2YG6A 1CJCA 4GUVA 4LIIA 2WP6A 2XLRA 1BKWA 2R9ZA 2WPEA 5HY5A 1E1LA 1PBEA 2E4GA 3V76A 5JCKA 4I58A 2YG4A 3QSMA 1RYIA 4FDCB 1F8WA 4U8OA 5U25A 3GYJA 3HZLA 1IUSA 2Q0KA 2R45A 1KNPA 2VVLG 1IUWA 1CJ3A 2VRMA 3FBSA 2PYXA 3NK1X 2ZZBA 1KFYA 3LZWA 3BHFA 5GSNA 4AT0A 5FS9A 2X3NA 3UTEA 1NEKA 2NPXA 1L9CA 2YM2A 4NZHA 1ZP0A 5KRQA 4GDEA 1RSGA 3AEGA 4B65A 4C5OA 1KF6A 1CC6A 2C3CA 3CNDA 1ZK7A 2Z5XA 4H7UA 2XLPA 3UCLA 4WCTA 1D7LA 3IC9A 1EL9A 5BUKA 3Q6JA 1CF3A 4H4ZA 4GR1A 4E0VA 4H4YA 4JN9A 3DJJA 4H4XA 5FS6A 5LV9A 1Q1RA 4KPRA 5FS8A 4N9XA 3NYFA 3KVEA 4UP3A 3VQRA 5KOWA 3GMCA 2FBWA 4OPCA 1TDOA 4EMWA 1YKJA 2XLTA 2YLTA 2C7GA 3II4A 3CNJA 3NYEA 2VVMA 3DK4A 4IV9A 1E39A 2X50A 2WBAA 1PBDA 4AOSA 2RABA 1DNCA 2JKCA 4Y4NA 1F3PA 3P9UA 1EBDA 4YSZA 1NDAA 3BI4A 2BC0A 2FJBA 2VQ7A 1BF3A 3AE2A 4H4VA 4CCQA 2B9XA 1FEBA 3M0OA 2GF3A 3P4QA 1D4DA 2GR0A 4GF7A 2C67A 2R4JA 1PBCA 3F8DA 2JB3A 3UKAA 1F6MA 2AQJA 2YG7A 4BV6A 3UOXA 2R0PA 2A8XA 1GTHA 4EQWA 1GRFA 2BA9A 3C4NA 2OA1A 3VRBA 2UZZA 1ONFA 3AEEA 3H4KA 3WE0A 1GETA 3NNEA 4BK3A 1OJ9A 1TDKA 3BI2A 4A9WA 2ZBWA 4DNAA 4TLZA 3QJ4A 4USQA 1LTXR 4CCRA 2TPRA 4J2WA 3ALLA 1LVLA 4U8JA 1TYPA 2JB2A 1GV4A 1KNRA 2WU2A 3QVRA 4B63A 2ZZ0A 1VRQB 1NHSA 3SFEA 3C96A 4O5QA 2YR6A 3D8XA 2V3AA 2AAQA 1GSNA 4J57A 2RGOA 3FG2P 1PS9A 2WDQA 3ABVA 3LJPA 2Q7VA 2XFNA 1O94A 2CFYA 4JY2A 1JEHA 2R4EA 1F8RA 1PXCA 4A5LA 2WP5A 3Q9TA 1NPXA 1ZOVA 1H82A 2BYBA 3VR8A 3P4SA 3RHAA 4JNQA 2WU5A 4XWRA 1GRBA 4K2XA 4RSLA 1PN0A 3ZDNA 3ISHA 2YWLA 2GV8A 4YSHA 5ER0A 2OLOA 2C3DA 3KLJA 3DGHA 1N4VA 2C64A 4H4QA 1M6IA 4C74A 1GESA 3VRDB 3DH9A 1GOSA 1FL2A 4IVMB 2FJEA 3NK2X 4IA6A 1IUTA 2O9ZA 2GR2A 1E6EA 4RG4A 4Z2UA 1QJDA 5HHFA 3GD3A 3UOVA 1GRAA 1X31B 3EAOA 2QA1A 2GQWA 3NH3X 1PXBA 3AE3A 2XVHA 2B7RA 2Q6UA 4OCGA 2YR5A 3CTYA 3AEFA 3EF6A 1ZDLA 3PVCA 4FK1A 3O0HA 4TM1A 4X9MA 3AE6A 1NHRA 4A6NB 2VOUA 5M0ZA 4Z24A 4Y4MA 1M64A 1PJ7A 2H88A 3ALJA 1QLBA 2YLZA 4JY3A 4Z2RA 4H4PA 1AOGA 5IPYA 3NT6A 2YVJA 2OALA 4HA6A 3IWAA 4X9NA 4C3XA 2XVEA 1LQTA 2C76A 1MXTA 5J60A 4U2LA 3V3OA 4Z26A 1GERA 4TM3A 2V60A 3G5SA 4KX6A 2Y6QA 1PDHA 4XWZA 1H86A 2GB0A 3JSKA 1CC4A 5EB4A 3ATQA 3OZ2A 4PAAA 2TMDA 3G5QA 1ZMCA 2XYOA 4ADWA 3L1RA 1H83A 4H4UA 4J56A 3C4AA 2BK3A 3UKPA 3V3NA 2V3BA 2XDOA 3LADA 1ZOYA 2XFPA 1CBOA 2C70A 1VG0A 4I59A 2YG5A 4IA5A 3AYLA 3DK8A 4NTDA 2WS3A 4YKGA 1H7XA 1H6VA 1GT8A 4GRTA 3URHA 4GCMA 2B9WA 1YQZA 1O95A 3ITJA 1GALA 1KSSA 2WPFA 3M13A 3BI5A 3ALMA 3SGLA 1F8SA 4EMJA 4JDRA 4DSHA 5DBJA 1LV0A 2EQ8A 1S2YA 4HB9A 4OPDA 4BJYA 1LQUA 2X8GA 2BK4A 5U63A 2C66A 3CPHG 4U8MA 2JK6A 2WOVA 3K7QX 4AP3A 2ACZA 3AD9B 3IF9A 4C3YA 2GR1A 3B3RA 3BNUA 4O5UA 1XDIA 4U8PA 1CJ4A 1KSUA 3LOVA 3AEAA 1K0IA 2CVJA 1K4QA 3UOZA 4OPTA 4TM4A 1K0JA 1D4EA 3KKJA 1GRGA 4NTCA 2ARDA 5BVAA 1ZMDA 4GDPA 1PJ6A 3FIMB 2JBVA 5KOXA 2HQMA 1CJ2A 1CHUA 3AE9A 1O5WA 1MOKA 2I0ZA 5FS7A 3T37A 1ZKQA 3EPTA 4YTPA 4H4RA 4U8IA 3K7MX 2WPCA 5C3JA 1TDNA 2IVEA 2QCUA 4YKFA 2BACA 2WHDA 1B5QA 3GDPA 2R46A 3KD9A 1NG3A 4H4TA 2BXRA 3UOYA 1FECA 2XFUA 1RP0A 4J33A 3LB8A 4D04A 1TDEA 1TYTA 2GRTA 4H50A 1EL8A 2GVCA 3VRAA 1TDFA 3UKFA 2YLXA 1W4XA 4H2RA 4H4WA 2R0CA 1REOA 3F8PA 3RP6A 4A7AA 1E1NA 4K7ZA 4MJWA 4U2SA 1GRTA 4U8LA 1GNDA 4M52A 2XLUA 5HYMA 4EMIA 1BZLA 2CULA 2JB1A 4EIQA 5JCMA 1PJ5A 1E1KA 3NHOX 5HXIA 4EM4A 1DJQA 3UTFA 1D7YA 2EQ9A 4A79A 3GSIA 3IHGA 2VZ2A 3CIRA 2X99A 4BURA 2W0HA 3AECA 3GMBA 1NHQA 5GRTA 1IUVA 3DJGX 3DJEA 3PO7A 2XLSA 2DKHA 1FCDA 4DSGA 3KA7A 4U8KA 2A87A 2CDUA 2YM1A 1GREA 4YWOA 3SQPA 2EQ6A 5JCIA 1DXLA 4OPIA 5IQ1A 3R9UA 2X8HA 1Q1WA 4ICYA 3H8LA 2QAEA 3CPIG 3LXDA 5CQFA 2V6OA 4EQRA 3NTAA 5U1OA 1JRZA 1BGNA 1P2EA 1LPFA 3FMWA 1FOHA 4OVIA 3BNMA 3NIXA 3I3LA 4ZN0A 1ZX9A 3AYJA 2WESA 1BGJA 4Z44A 1VQWA 2BS3A 2IIDA 3QSEA 4PABA 1GXFA 2AR8A 4B68A 1IUXA 3ICTA 1S3EA 4YTMA 1L9EA 4TLXA 1ELIA 2XFOA 4CNKA 1N4UA 5BRTA 3P1WA 4EQXA 1VDCA 1PHHA 4A99A 4CY8A 2YVFA 1UKVG 1GRHA 4USRA 2Q0LA 2XVJA 4LA1A 2QA2A 1OJCA 3FPZA 4DGKA 2EQ7A 4Z25A 3NTDA 1NG4A 3AB1A 1TRBA 1NAAA 3CPJG 2OAMA 3GWDA 4ECHA 1KDGA 2YR4A 3DA1A 1COYA 4J36A 4XXGA 4CY6A 1DJNA 1YY5A 3K7TA 3NN0X 4BJZA 1XANA 2E5VA 2JAEA 1YQ3A 3AE5A 2ZZCA 3NLCA 1B37A 2BK5A 3UKQA 2Y6RA 2B7SA 5KWFA 1IUUA 5KVIA 2VQBA 3DGZA 4U2TA 5C2TA 2F5ZA 4K5SA 1JNZA 2XFQA 4B1BA 3DMEA 1SEZA 1NHPA 4FX9A 3UKHA 3NK0X 3P4PA 3K30A 1Y0PA 1YQ4A 3PS9A 1OJAA 4J34A 1S3BA 1JRXA 2GAHB 3I6DA 3REDA 3GRTA 2E1MA 4H2QA 4D03A 5EB5A 1DODA 1EL7A 2R0GA 4LU6A 5IQ4A 3P4RA
chains in the Genus database with same CATH superfamily
3CNPA 3CB3A 4AP1A 4ZCCA 2GQFA 2PGWA 4OPLA 1DOCA 4AT2A 5L46A 1JRYA 2NVKX 5ENLA 3CGEA 3UTGA 4YSXA 1N4WA 4H2PA 4AOXA 1Q9IA 5FMHA 1PDZA 2E3TA 2YG3A 3ZYXA 1D5TA 2OO6A 4CRTA 3UKLA 3MUCA 3IHMA 2Z5YA 3UTHA 5JCLA 2BCGG 1K0LA 4H2NA 1N1PA 5EOWA 1DTNA 1MO9A 4DHGA 4UDRA 3GWFA 4YT0A 3D47A 3R11A 3AXBA 4NTEA 3RP8A 2APGA 2RGHA 4B64A 2PTZA 4KEMA 2P8BA 1X2HA 3V4BA 2QJJA 3DG6A 1IJHA 2YLSA 3M12A 2BXSA 3Q4DA 1H7WA 1D4CA 1VG9A 4H1ZA 4H4SA 2HXUA 2C75A 3QSSA 4DXKA 4X4JA 3S61A 2FJDA 2PGEA 3SN0A 4H19A 2E5AA 2P3ZA 2GMHA 4E4FA 3TJIA 1PBEA 1F8WA 3I6TA 4U8OA 1IUSA 3SN1A 2VVLG 3V5FA 4MKSA 1CJ3A 2VRMA 3NK1X 3LZWA 5FS9A 2X3NA 2AL2A 1NEKA 4HCDA 2XH4A 3QPEA 5KRQA 4B65A 4WCTA 1D7LA 2POZA 3HRDC 1EL9A 5FJUA 3DJJA 1N5XA 5FS8A 4J3ZA 2GGIA 3VFCA 1EBDA 3ES7A 2VQ7A 4H4VA 2PA6A 1FEBA 2R4JA 2OFJA 1SJBA 3UXKA 2AQJA 2YG7A 3UJRA 1GTHA 3Q45A 2PP3A 3C4NA 3AEEA 3H4KA 2GGHA 4BK3A 1VQZA 4CCRA 4J2WA 1LVLA 4U8JA 1P43A 1KNRA 2WU2A 3SFEA 2DW7A 3C96A 2ZC8A 2RGOA 1PS9A 2WDQA 3ABVA 1JEHA 2R4EA 4A5LA 1H82A 3P4SA 4XWRA 2NQLA 3MQTA 3ISHA 2OLOA 2C3DA 3KLJA 2XH7A 4ZOHB 4C74A 3DH9A 1GOSA 2FJEA 3JZUA 4Z2UA 3EAOA 4IL0A 2XVHA 3CTYA 4K2SA 3AEFA 3FVDA 3PVCA 4X9MA 3DDMA 4Y4MA 1M64A 4Z2RA 3ALJA 1QLBA 5IPYA 3I6EA 2YVJA 4C3XA 5J60A 3V3OA 3AMZA 4KX6A 2Y6QA 4XWZA 1H86A 2GB0A 4M0XA 4PAAA 2XYOA 2PMQA 1MDLA 4G8TA 2ONEA 1CBOA 3QN3A 4I59A 3ZLFA 4YKGA 1H6VA 1TZZA 3URHA 2WPFA 1LV0A 2EQ8A 4BJYA 4HYRA 2C66A 4U8MA 2JK6A 3IF9A 2GR1A 3B3RA 2OX4A 3HYWA 1K0IA 4G6HA 3UOZA 4OPTA 1D4EA 3RCYA 5BVAA 1CJ2A 1MRAA 2XSXA 3T37A 3EPTA 2WPCA 5C3JA 4YKFA 4KPLA 2BXRA 1FECA 1EL8A 4E6MA 4H2RA 4H4WA 2R0CA 5KMRA 3F8PA 4MJWA 3ZLHA 1GNDA 3V5CA 4EMIA 1PJ5A 1E1KA 4EM4A 1D7YA 4GYPC 3GSIA 3CIRA 2W0HA 3GC2A 3NVVB 2QJMA 3DJGX 2XLSA 3HPFA 1FHUA 1DXLA 3R9UA 4ICYA 3CPIG 3LXDA 1JRZA 1BGNA 1P2EA 4OVIA 3NXLA 1ZX9A 1BGJA 1GXFA 4B68A 4YTMA 2OQYA 2PP0A 3UJ2A 4TLXA 2C4CA 1VDCA 3T4WA 4KT2A 3FPZA 2EQ7A 2PTXA 2OAMA 2HNEA 3AN1A 2YR4A 4XXGA 4CY6A 1DJNA 1YY5A 1XANA 2AL1A 1B37A 2B7SA 2F5ZA 4K5SA 2XFQA 1OEPA 3I6DA 1BKHA 2GAHB 3GRTA 4H2QA 2R0GA 2QDDA 5IQ4A 3CNTA 3NRNA 4BK1A 5JRBA 2VVLA 1GTEA 3EANA 3BHKA 2OG9A 3B9JB 2GR3A 4P9SA 3DJDA 3S47A 2BCPA 3CGBA 1S2QA 2YLRA 4IVOB 1FEAA 1DOEA 3GYXA 3HYVA 3RNMA 2OQHA 4ENLA 1E9IA 3OC4A 3SFDA 1B4VA 2YAUA 3VA8A 5J7XA 1HYUA 2BS4A 2WEUA 1JNRA 1H81A 5JCNA 5KMQA 2J3NA 4ZCWA 2C73A 2GAGB 1QO8A 4Z43A 4J31A 3T9PA 5BULA 4WX1A 3ICRA 2A89A 3CT2A 3NGCX 4Y4LA 3AE8A 4GAPA 4APNA 1KN0A 3NKSA 3DK9A 1LJ1A 3P0WA 4YTNA 4YSYA 4B67A 3CN8A 3AD8B 3UP5A 1Y56A 2XVFA 5G5GB 3U9IA 4FI4A 4EM3A 3ADAB 2OLNA 4K8GA 1RVKA 3VC5A 3UCCA 3TTEA 1EL5A 2OPJA 1GEUA 2RGJA 3UKKA 3AM9A 5KMPA 2VRLA 3AYIA 3T0KA 5TR3A 3DG3A 4II2A 3UP4A 2GH5A 1WUFA 1L0VA 3F8RA 3KPKA 2WOWA 3H8IA 2MUCA 4NEVA 3H70A 2YG6A 3UJFA 3K1GA 2WP6A 4GUVA 4F4RA 2XLRA 2R9ZA 1E1LA 5JCKA 4K1WA 5J04A 3HZLA 2Q0KA 3NRZB 1KNPA 2PYXA 4IT1A 2ZZBA 1KFYA 4AT0A 2NPXA 1ZP0A 6ENLA 1SJDA 3BJSA 3JW7A 1RSGA 1KF6A 1ZK7A 3SZCA 3Q6JA 1CF3A 3S5SA 4H4ZA 4H4YA 4JN9A 4H4XA 3SZFA 2PTYA 3VQRA 5KOWA 2FBWA 1YKJA 2I5QA 2VVMA 1E39A 2RABA 1DNCA 2JKCA 1F3PA 3P9UA 1NDAA 3D46A 1BF3A 3AE2A 2B9XA 2GF3A 3P4QA 3UKAA 2GGGA 1GRFA 3MKCA 3VRBA 2UZZA 3WE0A 3DERA 4A9WA 2ZBWA 4DNAA 3QJ4A 4USQA 2TPRA 4GFIA 2JB2A 3TJ4A 4G9KA 3N6HA 4J57A 3FG2P 3T2ZA 1WYGA 2Q7VA 2CFYA 3Q9TA 1NPXA 3VR8A 3RHAA 1PN0A 3ZDNA 2YWLA 1ZXIC 5ER0A 2C64A 4H4QA 1GESA 1KCZA 3VRDB 1FL2A 3NK2X 4IA6A 2GR2A 5HHFA 1X31B 2GGEA 2B7RA 4GGBA 2Q6UA 4OCGA 3UJEA 3EF6A 4MMWA 4TM1A 1NHRA 5M0ZA 4Z24A 4H4PA 3PG6A 1LQTA 4U2LA 3DFYA 4TM3A 2V60A 2PTWA 3SYIA 1N60C 3JSKA 1CC4A 5EB4A 1JROA 1ZMCA 4ADWA 2BK3A 3V3NA 2V3BA 1JRPA 3LADA 1ZOYA 3AYLA 3DGBA 2WS3A 1H7XA 4GRTA 4DWDA 1O95A 3ITJA 1KSSA 3M13A 3DESA 4DSHA 5DBJA 4HB9A 2X8GA 3CPHG 2WOVA 1XDIA 4U8PA 3NVWB 3AEAA 2CVJA 1K0JA 3GD6A 3TW9A 2ARDA 1PJ6A 2HQMA 3AE9A 1MOKA 3MZNA 5FS7A 1ZKQA 4H4RA 3K7MX 1N62C 2QCUA 3T31A 3R25A 3UOYA 2XFUA 5BOEA 1TDEA 1TYTA 2GRTA 4H50A 2GVCA 4GYPA 1TDFA 1REOA 3RP6A 1XS2A 1E1NA 4U2SA 2XLUA 2CULA 3SR6B 5HXIA 2EQ9A 2X99A 4BURA 3THUA 3RRAA 3QLDA 4DSGA 3KA7A 4U8KA 1BQGA 2A87A 1GREA 1Q1WA 3ZVHB 5CQFA 3NTAA 5U1OA 1LPFA 4HCLA 2PS2A 1FO4A 3JVAA 3AYJA 2WESA 3KUMA 3A7AA 4PABA 2HXTA 2AR8A 3ICTA 2XFOA 4CNKA 1SB3B 4A99A 1UKVG 2XVJA 2QA2A 3CPJG 3GWDA 1ELSA 2PP1A 3K7TA 3SX6A 1IYXA 3NLCA 2ZZCA 2Y6RA 1IUUA 4II3A 3U4FA 4U2TA 4TVWA 4B1BA 1SEZA 1NHPA 3UKHA 3UGVA 1YQ4A 2PU0A 1JRXA 4D03A 3UOVA 4LU6A 3P4RA 5BOFA 4A6NA 1MDRA 1N63C 3CGDA 2WP9A 4EIPA 3QFBA 4GISA 1FHVA 2XVIA 1CC2A 3AD7B 2YVGA 3CK5A 4B69A 3COXA 2XCGA 4FK1C 4EQSA 4B66A 1H84A 3CNSA 3SM8A 1P2HA 4UDQA 3NN6X 2O56A 3I4KA 3ENLA 4TVYA 3VCCA 1V59A 1BWCA 2BS2A 2QVHA 2B9YA 4CNJA 5KXJA 1Y56B 3GRSA 1KD0A 2GEWA 1PXAA 2FJAA 1ZY8A 1FIQB 1XHCA 3CGCA 1B8SA 2GL5A 3PFRA 3KU9A 3QVPA 3TOYA 4ROPA 3QFAA 1Z6LA 2H89A 4BK2A 3NVZB 2C65A 4CBQA 4YXDA 3R1ZA 1EC9A 4JNAA 2B76A 4C77A 4ZCDA 2BABA 3AE4A 3D1CA 3L8KA 2V5ZA 4OPUA 2C72A 4K8DA 1JOAA 2PPGA 3FXGA 4DN1A 3GYIA 4ZA0A 2DKIA 3ES8A 1CJCA 3BOXA 2WPEA 2E4GA 3V76A 4FDCB 5U25A 3GYJA 2R45A 4HNLA 4H2HA 2YM2A 4NZHA 1CC6A 1EC8A 5EU9A 3CNDA 2QQ6A 3DG7A 2Z5XA 2XLPA 3IC9A 3RO6A 3FCPA 1YEYA 3RGTA 1FFVC 4GR1A 1TKKA 4E0VA 5LV9A 3N4EA 4KPRA 4UP3A 1PDYA 3KVEA 3GMCA 2GDQA 4OPCA 1TDOA 2XLTA 3IJQA 3NYEA 3II4A 3PWIA 4AOSA 2AKMA 4YSZA 1WUEA 1EC7A 4A6GA 4CCQA 2OVLA 2PU1A 4J1OA 3UXLA 1W6TA 2C67A 4HCHA 2JB3A 2P8CA 3CAWA 1F6MA 3CMMA 4FP1A 4BV6A 2A8XA 7ENLA 3ETRB 3ZVHA 2BA9A 5KNLA 3NNEA 1OJ9A 3ZVIA 3N6JA 1LTXR 1TYPA 3SJNA 2W3RA 3QVRA 4B63A 1NHSA 1N5WC 4IP5A 2YR6A 3D8XA 2V3AA 3H12A 3DFHA 1O94A 1KKRA 2WP5A 5FJOA 1ZOVA 4JNQA 3MSYA 2WU5A 1GRBA 4RSLA 2GV8A 3SSZA 4YSHA 3T6CA 5FJTA 1EBGA 1JPDX 2FYMA 4IVMB 1E6EA 4RG4A 1QJDA 3NH3X 1MUCA 1JDFA 1ZDLA 3P3BA 3AE6A 4A6NB 4JY3A 2W54A 1PJ7A 3A7RA 3NT6A 4HA6A 3IWAA 2ZADA 2XVEA 2C76A 4IHCA 3OZ2A 2TMDA 3G5QA 1H83A 4H4UA 4J56A 3CYJA 3C4AA 4MGGA 3UKPA 3FYYA 3T2YA 4EWJA 3RITA 4NWZA 1VG0A 2YG5A 4NTDA 1GT8A 4GCMA 2B9WA 1GALA 3BI5A 3SGLA 1H2IA 1F8SA 4EMJA 3EKGA 3IK4A 1LQUA 5U63A 3TCSA 4AP3A 3K7QX 2ACZA 3AD9B 3OZYA 3BNUA 3R07C 1K4QA 4TM4A 3KKJA 1GRGA 3FIMB 2JBVA 5KOXA 1CHUA 2I0ZA 4YTPA 1V97A 2BACA 1B5QA 3GDPA 3KD9A 1NG3A 3DIPA 1SJCA 4J33A 4D04A 4GAVA 2YLXA 1W4XA 4A7AA 4K7ZA 1EBHA 1GRTA 5HYMA 1BZLA 3OPSA 3D9XA 2OZ8A 3NHOX 1N61C 3UTFA 4A79A 4E4UA 2VZ2A 3GMBA 1NHQA 5GRTA 1IUVA 3DJEA 3R10A 1FCDA 4G7FA 2CHRA 4YWOA 3SQPA 5JCIA 4OPIA 3T8QA 2X8HA 3UJSA 4DX3A 4Z17A 3SQSA 3FMWA 3BNMA 3EUB3 3GY1A 2BRAA 3I3LA 3NIXA 4ZN0A 4Z44A 1VQWA 2IIDA 3QSEA 1ELIA 1TE6A 1PHHA 4CY8A 2YVFA 2Q0LA 4HN8A 4A3RA 4Z25A 4H83A 4NNJA 1NG4A 3AB1A 3DA1A 4J36A 1STZA 3IJLA 3NN0X 1NU5A 4JN8A 2E5VA 2JAEA 1YQ3A 4G74A 3UKQA 2P88A 5KVIA 2W55A 3DGZA 3ZLGA 3DMEA 1ONEA 3H8AA 3P4PA 1Y0PA 3PS9A 4J34A 2E1MA 5EB5A 1L8PA 3QKEA 3G5RA 3AEDA 2HZGA 5M10A 4Z1YA 3AWIA 3ICSA 4HPNA 3LZXA 4A65A 1NENA 1GPEA 2PODA 4JN7A 3AEBA 1E1MA 2GSHA 4UDPA 3NG7X 2BC1A 3GD4A 2YLWA 2WQYA 3OP2A 3RP7A 3UCDA 4E5TA 4Z2TA 2V61A 3VR9A 1F9CA 3MWCA 3E1TA 4JQ9A 2QJNA 5G5HB 4U8NA 3S5WA 3B6DA 3GDNA 1E7PA 1CL0A 1L9DA 2WETA 2XH0A 4RG3A 3R0KA 1OJTA 1XPQA 1PBFA 1JU2A 2GMJA 4X2PA 3EEZA 4REKA 5EBKA 4GIRA 4K22A 1X2GA 1PBBA 5KVHA 4NEWA 3ATRA 4K5RA 2WDRA 5CKUA 3CXOA 1FFUC 2WDVA 3SZWA 3KPFA 2IVDA 2MNRA 4TM0A 3NYCA 3MY9A 1OJDA 1R6WA 3N4FA 3AE7A 1DOBA 3SY4A 2X8CA 4IL2A 2YQUA 3RR1A 5IDZA 3TQPA 3HYXA 2WOIA 4OPGA 2PSNA 3AE1A 4GMEA 2PHHA 4LIIA 3FV9A 1BKWA 5HY5A 3NFUA 1R0MA 3TWAA 4I58A 2YG4A 3QSMA 1RYIA 2FKPA 1P48A 1IUWA 3FBSA 3BHFA 5GSNA 3UTEA 1L9CA 3T2KA 4GDEA 3AEGA 4C5OA 3VC6A 2C3CA 4H7UA 3UCLA 2QGYA 5BUKA 5FS6A 1Q1RA 4N9XA 2AL2B 3NYFA 3CNJA 4EMWA 2YLTA 2C7GA 3DK4A 4IV9A 2X50A 2WBAA 1PBDA 2OZ3A 4Y4NA 3BI4A 2BC0A 2FJBA 2P0IA 3M0OA 1D4DA 2GR0A 3SZ0A 4GF7A 1JCTA 1PBCA 3F8DA 2W3SA 3NZGA 3UOXA 4JHMA 2R0PA 4EQWA 3CXBA 2OA1A 1ONFA 1GETA 3BI2A 1TDKA 4TLZA 3SXIA 3ALLA 2XH2A 1GV4A 2PCEA 2ZZ0A 1VRQB 3T14A 4O5QA 2AAQA 1GSNA 3LJPA 2XFNA 4JY2A 1F8RA 2OKTA 1PXCA 2BYBA 2XGZA 2QDEA 4K2XA 3DGHA 1N4VA 1M6IA 4IP4A 1IUTA 2O9ZA 3A7UA 3GD3A 1GRAA 3V3WA 2QA1A 2GQWA 1PXBA 3AE3A 2YR5A 1NELA 2OLAA 4FK1A 3O0HA 2VOUA 2H88A 3H7VA 2YLZA 1AOGA 2OALA 4X9NA 2AKZA 1MXTA 4Z26A 1GERA 3G5SA 1PDHA 4HNCA 1KKOA 3ATQA 3PWGA 3L1RA 2XDOA 2XFPA 2C70A 4IA5A 3DK8A 5FJPA 3PK7A 1YQZA 2BRYA 3ALMA 3GO2A 3HW2A 3L5OA 3QTPA 3FJ4A 4JDRA 1S2YA 4OPDA 2BK4A 3SN4A 4C3YA 3DEQA 4O5UA 1CJ4A 1KSUA 3LOVA 3NVYB 4GGHA 4YWSA 4NTCA 1ZMDA 4GDPA 1S7MA 2OZTA 2RDXA 1O5WA 3TWBA 4U8IA 1TDNA 2IVEA 2WHDA 2R46A 4H4TA 4IZGA 1RP0A 1SJAA 3LB8A 3VRAA 3UKFA 1MNSA 3P93A 1ECQA 4U8LA 4M52A 4EIQA 2JB1A 1RM6B 5JCMA 3NS1B 1JPMA 4G6GA 1VDVA 1DJQA 3OTRA 3B97A 3IHGA 3VCNA 3R0UA 3AECA 1T3QC 3PO7A 2DKHA 3SBFA 2CDUA 2YM1A 2GGJA 2EQ6A 3VDGA 4KWSA 5IQ1A 4M6UA 3OZMA 3H8LA 2QAEA 3NO1A 4DYEA 2V6OA 4EQRA 1FOHA 2DW6A 2BS3A 4E8GA 3IJIA 1IUXA 1S3EA 1L9EA 1N4UA 5KMSA 5BRTA 3P1WA 4EQXA 4A35A 1GRHA 4USRA 4LA1A 3BSMA 1OJCA 4DGKA 3NTDA 1TRBA 1NAAA 4ECHA 1KDGA 1COYA 4BJZA 3STPA 3AE5A 2BK5A 1XPYA 5KWFA 2VQBA 5C2TA 1JNZA 5FJRA 4FX9A 3NK0X 3OW1A 3K30A 1OJAA 1S3BA 3REDA 1DODA 4G73A 1EL7A
chains in the Genus database with same CATH topology
3CNPA 3CNTA 3NRNA 4BK1A 4A6NA 3G5RA 2WP9A 3CGDA 5JRBA 2VVLA 3AEDA 3QFBA 4AP1A 4EIPA 1GTEA 3EANA 4ZCCA 2GQFA 3BHKA 2XVIA 1CC2A 3AD7B 3AWIA 5M10A 2YVGA 3ICSA 2GR3A 3LZXA 4OPLA 4A65A 4P9SA 4B69A 1NENA 1DOCA 1GPEA 3COXA 2XCGA 4FK1C 4EQSA 4AT2A 3DJDA 1H84A 4B66A 5L46A 3AEBA 1E1MA 2BCPA 1JRYA 3CNSA 3CGBA 3SM8A 1S2QA 4UDPA 1P2HA 2YLRA 3NG7X 2BC1A 4IVOB 4UDQA 2NVKX 3NN6X 3GD4A 1FEAA 1DOEA 3GYXA 2YLWA 3CGEA 3HYVA 3RNMA 1V59A 1BWCA 3UTGA 3OC4A 3SFDA 2WQYA 1N4WA 4YSXA 1B4VA 4H2PA 2BS2A 4AOXA 3RP7A 1Q9IA 5FMHA 4Z2TA 2YAUA 2V61A 3VR9A 2B9YA 2YG3A 4C77A 4CNJA 5J7XA 1HYUA 2BS4A 2WEUA 3ZYXA 1D5TA 1JNRA 1H81A 5JCNA 5KMQA 4CRTA 3E1TA 5KXJA 2J3NA 3UKLA 2C73A 3IHMA 2Z5YA 1Y56B 2GAGB 1QO8A 3GRSA 4J31A 3UTHA 4JQ9A 5JCLA 2GEWA 4Z43A 5BULA 1PXAA 2FJAA 4WX1A 4U8NA 1ZY8A 2BCGG 3ICRA 3S5WA 2A89A 3NGCX 4Y4LA 3B6DA 3AE8A 1XHCA 4GAPA 4APNA 1KN0A 3NKSA 3GDNA 3CGCA 3DK9A 1LJ1A 4YTNA 1B8SA 1K0LA 1E7PA 4YSYA 4H2NA 1CL0A 1N1PA 5EOWA 4B67A 1L9DA 2WETA 1MO9A 4RG3A 3CN8A 1OJTA 1XPQA 1PBFA 3AD8B 3KU9A 3QVPA 3UP5A 1JU2A 2GMJA 4UDRA 3QFAA 1Y56A 5EBKA 3GWFA 4REKA 4YT0A 2XVFA 1Z6LA 3AXBA 4NTEA 4K22A 3RP8A 2APGA 2RGHA 4EM3A 2H89A 3ADAB 1PBBA 5KVHA 4NEWA 3ATRA 4K5RA 2OLNA 4B64A 2WDRA 4BK2A 5CKUA 2C65A 2WDVA 4CBQA 4YXDA 1IJHA 2YLSA 1EL5A 3M12A 2BXSA 4JNAA 1GEUA 2RGJA 1H7WA 2B76A 3SZWA 3UKKA 3KPFA 5KMPA 2VRLA 3AYIA 4ZCDA 2IVDA 1D4CA 3T0KA 1VG9A 2BABA 3AE4A 4TM0A 3D1CA 3L8KA 2V5ZA 3NYCA 4H4SA 4OPUA 5TR3A 1OJDA 2C72A 4K8DA 3AE7A 1JOAA 4II2A 3UP4A 1DOBA 3SY4A 2X8CA 2C75A 2GH5A 3QSSA 3GYIA 2YQUA 3HYXA 4X4JA 2WOIA 3S61A 2FJDA 4OPGA 3AE1A 1L0VA 3F8RA 3KPKA 2WOWA 3H8IA 2DKIA 4NEVA 2GMHA 2PHHA 2YG6A 1CJCA 4GUVA 4LIIA 2WP6A 2XLRA 1BKWA 2R9ZA 2WPEA 5HY5A 1E1LA 1PBEA 2E4GA 3V76A 5JCKA 4I58A 2YG4A 3QSMA 1RYIA 4FDCB 1F8WA 4U8OA 5U25A 3GYJA 3HZLA 1IUSA 2Q0KA 2R45A 1KNPA 2VVLG 1IUWA 1CJ3A 2VRMA 3FBSA 2PYXA 3NK1X 2ZZBA 1KFYA 3LZWA 3BHFA 5GSNA 4AT0A 5FS9A 2X3NA 3UTEA 1NEKA 2NPXA 1L9CA 2YM2A 4NZHA 1ZP0A 5KRQA 3T2KA 4GDEA 1RSGA 3AEGA 4B65A 4C5OA 1KF6A 1CC6A 2C3CA 3CNDA 1ZK7A 2Z5XA 4H7UA 2XLPA 3UCLA 4WCTA 1D7LA 3IC9A 3SZCA 1EL9A 5BUKA 3Q6JA 1CF3A 4H4ZA 4GR1A 4E0VA 4H4YA 4JN9A 3DJJA 4H4XA 5FS6A 5LV9A 1Q1RA 4KPRA 5FS8A 4N9XA 3NYFA 3KVEA 4UP3A 3SZFA 3VQRA 5KOWA 3GMCA 2FBWA 4OPCA 1TDOA 4EMWA 1YKJA 2XLTA 2YLTA 2C7GA 3II4A 3CNJA 3NYEA 2VVMA 3DK4A 4IV9A 1E39A 2X50A 2WBAA 1PBDA 4AOSA 2RABA 1DNCA 2JKCA 4Y4NA 1F3PA 3P9UA 1EBDA 4YSZA 1NDAA 3BI4A 2BC0A 2FJBA 2VQ7A 1BF3A 3AE2A 4H4VA 4CCQA 2B9XA 1FEBA 3M0OA 2GF3A 3P4QA 1D4DA 2GR0A 3SZ0A 4GF7A 2C67A 2R4JA 1PBCA 3F8DA 2JB3A 3UKAA 1F6MA 2AQJA 3CMMA 2YG7A 4BV6A 3UOXA 2R0PA 2A8XA 1GTHA 4EQWA 1GRFA 2BA9A 3C4NA 2OA1A 3VRBA 2UZZA 1ONFA 3AEEA 3H4KA 3WE0A 1GETA 3NNEA 5KNLA 4BK3A 1OJ9A 1TDKA 3BI2A 4A9WA 2ZBWA 4DNAA 4TLZA 3QJ4A 4USQA 3SXIA 1LTXR 4CCRA 2TPRA 4J2WA 3ALLA 1LVLA 4U8JA 1TYPA 2JB2A 1GV4A 1KNRA 2WU2A 3QVRA 4B63A 2ZZ0A 1VRQB 4G9KA 1NHSA 3SFEA 3C96A 3T14A 4O5QA 2YR6A 3D8XA 2V3AA 2AAQA 1GSNA 4J57A 2RGOA 3FG2P 3T2ZA 1PS9A 2WDQA 3ABVA 3LJPA 2Q7VA 2XFNA 1O94A 2CFYA 4JY2A 1JEHA 2R4EA 1F8RA 1PXCA 4A5LA 2WP5A 3Q9TA 1NPXA 1ZOVA 1H82A 2BYBA 3VR8A 3P4SA 3RHAA 4JNQA 2WU5A 4XWRA 1GRBA 4K2XA 4RSLA 1PN0A 3ZDNA 3ISHA 2YWLA 2GV8A 4YSHA 5ER0A 2OLOA 2C3DA 3KLJA 3DGHA 1N4VA 2C64A 4H4QA 1M6IA 4C74A 1GESA 3VRDB 3DH9A 1GOSA 1FL2A 4IVMB 2FJEA 3NK2X 4IA6A 1IUTA 2O9ZA 2GR2A 1E6EA 4RG4A 4Z2UA 1QJDA 5HHFA 3GD3A 3UOVA 1GRAA 1X31B 3EAOA 2QA1A 2GQWA 3NH3X 1PXBA 3AE3A 2XVHA 2B7RA 2Q6UA 4OCGA 2YR5A 3CTYA 3AEFA 3EF6A 1ZDLA 3PVCA 4FK1A 3O0HA 4TM1A 4X9MA 3AE6A 1NHRA 4A6NB 2VOUA 5M0ZA 4Z24A 4Y4MA 1M64A 1PJ7A 2H88A 3ALJA 1QLBA 2YLZA 4JY3A 4Z2RA 4H4PA 1AOGA 5IPYA 3NT6A 2YVJA 2OALA 4HA6A 3IWAA 4X9NA 4C3XA 2XVEA 3PG6A 1LQTA 1MXTA 2C76A 5J60A 4U2LA 3V3OA 4Z26A 1GERA 4TM3A 2V60A 3G5SA 4KX6A 2Y6QA 1PDHA 3SYIA 4XWZA 1H86A 2GB0A 3JSKA 1CC4A 5EB4A 3ATQA 3OZ2A 4PAAA 2TMDA 3G5QA 1ZMCA 2XYOA 4ADWA 3L1RA 1H83A 4H4UA 4J56A 3C4AA 2BK3A 3UKPA 3V3NA 3T2YA 2V3BA 2XDOA 3LADA 1ZOYA 2XFPA 1CBOA 2C70A 1VG0A 4I59A 2YG5A 4IA5A 3AYLA 4NWZA 3DK8A 4NTDA 2WS3A 4YKGA 1H7XA 1H6VA 1GT8A 4GRTA 3URHA 4GCMA 2B9WA 1YQZA 1O95A 3ITJA 1GALA 1KSSA 2BRYA 2WPFA 3M13A 3BI5A 3ALMA 3L5OA 1H2IA 3SGLA 1F8SA 4EMJA 4JDRA 4DSHA 5DBJA 1LV0A 2EQ8A 1S2YA 4HB9A 4OPDA 4BJYA 1LQUA 2X8GA 2BK4A 5U63A 2C66A 3CPHG 4U8MA 2JK6A 2WOVA 3K7QX 4AP3A 2ACZA 3AD9B 3IF9A 4C3YA 2GR1A 3B3RA 3BNUA 4O5UA 1XDIA 4U8PA 1CJ4A 1KSUA 3LOVA 3AEAA 3HYWA 1K0IA 2CVJA 4G6HA 1K4QA 3UOZA 4OPTA 4TM4A 1K0JA 1D4EA 3KKJA 1GRGA 4NTCA 2ARDA 5BVAA 1ZMDA 4GDPA 1S7MA 1PJ6A 3FIMB 2JBVA 5KOXA 2HQMA 1CJ2A 1CHUA 3AE9A 1O5WA 1MOKA 2I0ZA 5FS7A 3T37A 1ZKQA 3EPTA 4YTPA 4H4RA 4U8IA 3K7MX 2WPCA 5C3JA 1TDNA 2IVEA 2QCUA 4YKFA 2BACA 2WHDA 1B5QA 3GDPA 2R46A 3T31A 3KD9A 1NG3A 4H4TA 2BXRA 3UOYA 1FECA 2XFUA 1RP0A 4J33A 3LB8A 4D04A 1TDEA 1TYTA 2GRTA 4H50A 1EL8A 2GVCA 4GAVA 3VRAA 1TDFA 3UKFA 2YLXA 1W4XA 4H2RA 4H4WA 2R0CA 1REOA 3F8PA 3RP6A 4A7AA 5KMRA 1E1NA 4K7ZA 4MJWA 4U2SA 1GRTA 4U8LA 1GNDA 4M52A 2XLUA 5HYMA 4EMIA 1BZLA 2CULA 2JB1A 4EIQA 5JCMA 3D9XA 1PJ5A 4G6GA 1E1KA 3NHOX 5HXIA 4EM4A 1DJQA 3UTFA 1D7YA 2EQ9A 4A79A 3GSIA 3IHGA 2VZ2A 3CIRA 2X99A 4BURA 2W0HA 3AECA 3GMBA 1NHQA 5GRTA 1IUVA 3DJGX 3DJEA 3PO7A 2XLSA 2DKHA 1FCDA 4DSGA 3KA7A 4U8KA 2A87A 2CDUA 2YM1A 1GREA 4YWOA 3SQPA 2EQ6A 5JCIA 1DXLA 4OPIA 5IQ1A 3R9UA 2X8HA 1Q1WA 4ICYA 3H8LA 2QAEA 3CPIG 3LXDA 5CQFA 2V6OA 4EQRA 3NTAA 5U1OA 1JRZA 1BGNA 1P2EA 1LPFA 3FMWA 1FOHA 4OVIA 3BNMA 2BRAA 3I3LA 3NIXA 4ZN0A 1ZX9A 3AYJA 2WESA 1BGJA 4Z44A 1VQWA 2BS3A 2IIDA 3QSEA 4PABA 1GXFA 2AR8A 4B68A 1IUXA 3ICTA 1S3EA 4YTMA 1L9EA 4TLXA 1ELIA 2XFOA 4CNKA 1N4UA 2C4CA 5KMSA 5BRTA 3P1WA 4EQXA 1VDCA 1PHHA 4A99A 4CY8A 2YVFA 1UKVG 1GRHA 4USRA 2Q0LA 2XVJA 4LA1A 2QA2A 1OJCA 3FPZA 4DGKA 2EQ7A 4Z25A 4NNJA 3NTDA 1NG4A 3AB1A 1TRBA 1NAAA 3CPJG 2OAMA 3GWDA 4ECHA 1KDGA 2YR4A 3DA1A 1COYA 4J36A 4XXGA 4CY6A 3SX6A 1DJNA 1YY5A 3K7TA 3NN0X 4BJZA 1XANA 2E5VA 2JAEA 1YQ3A 3AE5A 2ZZCA 3NLCA 4G74A 1B37A 2BK5A 3UKQA 2Y6RA 2B7SA 5KWFA 1IUUA 4II3A 5KVIA 2VQBA 3DGZA 4U2TA 5C2TA 2F5ZA 4K5SA 1JNZA 2XFQA 4B1BA 3DMEA 1SEZA 1NHPA 4FX9A 3UKHA 3NK0X 3P4PA 3K30A 1Y0PA 1YQ4A 3PS9A 1OJAA 4J34A 1S3BA 1JRXA 2GAHB 3I6DA 3REDA 3GRTA 2E1MA 4H2QA 4D03A 5EB5A 1DODA 4G73A 1EL7A 2R0GA 4LU6A 5IQ4A 3P4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CNP A;  3CNT A;  3NRN A;  4BK1 A;  4A6N A;  3G5R A;  2WP9 A;  3CGD A;  3AED A;  2VVL A;  4EIP A;  3QFB A;  4AP1 A;  1GTE A;  3EAN A;  4ZCC A;  2GQF A;  3BHK A;  2XVI A;  1CC2 A;  3AD7 B;  3AWI A;  5M10 A;  2YVG A;  3ICS A;  2GR3 A;  3LZX A;  4OPL A;  4A65 A;  4P9S A;  4B69 A;  1NEN A;  1DOC A;  1GPE A;  3COX A;  2XCG A;  4FK1 C;  4EQS A;  4AT2 A;  3DJD A;  1H84 A;  4B66 A;  5L46 A;  3AEB A;  1E1M A;  2BCP A;  1JRY A;  3CNS A;  3CGB A;  3SM8 A;  1S2Q A;  4UDP A;  1P2H A;  2YLR A;  3NG7 X;  2BC1 A;  4IVO B;  4UDQ A;  2NVK X;  3NN6 X;  3GD4 A;  1FEA A;  1DOE A;  2YLW A;  3CGE A;  3RNM A;  1V59 A;  1BWC A;  3UTG A;  3OC4 A;  3SFD A;  2WQY A;  1N4W A;  4YSX A;  1B4V A;  4H2P A;  2BS2 A;  4AOX A;  3RP7 A;  1Q9I A;  5FMH A;  4Z2T A;  2YAU A;  2V61 A;  3VR9 A;  2B9Y A;  2YG3 A;  4CNJ A;  5J7X A;  1HYU A;  2BS4 A;  2WEU A;  3ZYX A;  1D5T A;  1JNR A;  1H81 A;  5JCN A;  4CRT A;  3E1T A;  5KXJ A;  2J3N A;  3UKL A;  2C73 A;  3IHM A;  2Z5Y A;  1Y56 B;  2GAG B;  1QO8 A;  3GRS A;  4J31 A;  3UTH A;  4JQ9 A;  5JCL A;  2GEW A;  4Z43 A;  5BUL A;  1PXA A;  2FJA A;  4WX1 A;  4U8N A;  1ZY8 A;  2BCG G;  3ICR A;  3S5W A;  2A89 A;  3NGC X;  4Y4L A;  3B6D A;  3AE8 A;  1XHC A;  4APN A;  3NKS A;  3GDN A;  3CGC A;  3DK9 A;  1LJ1 A;  4YTN A;  1B8S A;  1K0L A;  1E7P A;  4YSY A;  4H2N A;  1CL0 A;  1N1P A;  5EOW A;  4B67 A;  1L9D A;  2WET A;  1MO9 A;  4RG3 A;  3CN8 A;  1OJT A;  1XPQ A;  1PBF A;  3AD8 B;  3KU9 A;  3QVP A;  3UP5 A;  1JU2 A;  2GMJ A;  4UDR A;  3QFA A;  1Y56 A;  5EBK A;  3GWF A;  4REK A;  4YT0 A;  2XVF A;  1Z6L A;  3AXB A;  4NTE A;  4K22 A;  3RP8 A;  2APG A;  2RGH A;  4EM3 A;  2H89 A;  3ADA B;  1PBB A;  5KVH A;  4NEW A;  3ATR A;  4K5R A;  2OLN A;  4B64 A;  2WDR A;  4BK2 A;  5CKU A;  2C65 A;  2WDV A;  4CBQ A;  4YXD A;  1IJH A;  2YLS A;  1EL5 A;  3M12 A;  2BXS A;  4JNA A;  1GEU A;  2RGJ A;  1H7W A;  2B76 A;  3UKK A;  3KPF A;  2VRL A;  3AYI A;  4ZCD A;  2IVD A;  1D4C A;  4C77 A;  1VG9 A;  2BAB A;  3AE4 A;  4TM0 A;  3D1C A;  3L8K A;  2V5Z A;  3NYC A;  4H4S A;  4OPU A;  5TR3 A;  1OJD A;  2C72 A;  4K8D A;  3AE7 A;  1JOA A;  3UP4 A;  1DOB A;  2X8C A;  2C75 A;  2GH5 A;  3QSS A;  3GYI A;  2YQU A;  4X4J A;  2WOI A;  3S61 A;  2FJD A;  4OPG A;  3AE1 A;  1L0V A;  3F8R A;  2WOW A;  3H8I A;  2DKI A;  4NEV A;  2GMH A;  2PHH A;  2YG6 A;  1CJC A;  4GUV A;  4LII A;  2WP6 A;  2XLR A;  1BKW A;  2R9Z A;  2WPE A;  5HY5 A;  1E1L A;  1PBE A;  2E4G A;  3V76 A;  5JCK A;  4I58 A;  2YG4 A;  3QSM A;  1RYI A;  4FDC B;  1F8W A;  4U8O A;  5U25 A;  3GYJ A;  3HZL A;  1IUS A;  2Q0K A;  2R45 A;  1KNP A;  2VVL G;  1IUW A;  1CJ3 A;  2VRM A;  3FBS A;  2PYX A;  3NK1 X;  2ZZB A;  1KFY A;  3LZW A;  3BHF A;  5GSN A;  4AT0 A;  5FS9 A;  2X3N A;  3UTE A;  1NEK A;  2NPX A;  1L9C A;  2YM2 A;  4NZH A;  1ZP0 A;  5KRQ A;  4GDE A;  1RSG A;  3AEG A;  4B65 A;  4C5O A;  1KF6 A;  1CC6 A;  2C3C A;  3CND A;  1ZK7 A;  2Z5X A;  4H7U A;  2XLP A;  3UCL A;  4WCT A;  1D7L A;  3IC9 A;  1EL9 A;  5BUK A;  3Q6J A;  1CF3 A;  4H4Z A;  4GR1 A;  4E0V A;  4H4Y A;  4JN9 A;  3DJJ A;  4H4X A;  5FS6 A;  5LV9 A;  1Q1R A;  4KPR A;  5FS8 A;  4N9X A;  3NYF A;  3KVE A;  4UP3 A;  3VQR A;  5KOW A;  3GMC A;  2FBW A;  4OPC A;  1TDO A;  4EMW A;  1YKJ A;  2XLT A;  2YLT A;  2C7G A;  3II4 A;  3CNJ A;  3NYE A;  2VVM A;  3DK4 A;  4IV9 A;  1E39 A;  2X50 A;  2WBA A;  1PBD A;  4AOS A;  2RAB A;  1DNC A;  2JKC A;  4Y4N A;  1F3P A;  3P9U A;  1EBD A;  4YSZ A;  1NDA A;  3BI4 A;  2BC0 A;  2FJB A;  2VQ7 A;  1BF3 A;  3AE2 A;  4H4V A;  4CCQ A;  2B9X A;  1FEB A;  3M0O A;  2GF3 A;  3P4Q A;  1D4D A;  2GR0 A;  4GF7 A;  2C67 A;  2R4J A;  1PBC A;  3F8D A;  2JB3 A;  3UKA A;  1F6M A;  2AQJ A;  2YG7 A;  4BV6 A;  3UOX A;  2R0P A;  2A8X A;  1GTH A;  4EQW A;  1GRF A;  2BA9 A;  3C4N A;  2OA1 A;  3VRB A;  2UZZ A;  1ONF A;  3AEE A;  3H4K A;  3WE0 A;  1GET A;  3NNE A;  4BK3 A;  1OJ9 A;  1TDK A;  3BI2 A;  4A9W A;  2ZBW A;  4DNA A;  4TLZ A;  3QJ4 A;  4USQ A;  1LTX R;  4CCR A;  2TPR A;  4J2W A;  3ALL A;  1LVL A;  4U8J A;  1TYP A;  2JB2 A;  1GV4 A;  1KNR A;  2WU2 A;  3QVR A;  4B63 A;  2ZZ0 A;  1VRQ B;  1NHS A;  3SFE A;  3C96 A;  4O5Q A;  2YR6 A;  3D8X A;  2V3A A;  2AAQ A;  1GSN A;  4J57 A;  2RGO A;  3FG2 P;  1PS9 A;  2WDQ A;  3ABV A;  3LJP A;  2Q7V A;  2XFN A;  1O94 A;  2CFY A;  4JY2 A;  1JEH A;  2R4E A;  1F8R A;  1PXC A;  4A5L A;  2WP5 A;  3Q9T A;  1NPX A;  1ZOV A;  1H82 A;  2BYB A;  3VR8 A;  3P4S A;  3RHA A;  4JNQ A;  2WU5 A;  4XWR A;  1GRB A;  4K2X A;  4RSL A;  1PN0 A;  3ZDN A;  3ISH A;  2YWL A;  2GV8 A;  4YSH A;  5ER0 A;  2OLO A;  2C3D A;  3KLJ A;  3DGH A;  1N4V A;  2C64 A;  4H4Q A;  1M6I A;  4C74 A;  1GES A;  3VRD B;  3DH9 A;  1GOS A;  1FL2 A;  4IVM B;  2FJE A;  3NK2 X;  4IA6 A;  1IUT A;  2O9Z A;  2GR2 A;  1E6E A;  4RG4 A;  4Z2U A;  1QJD A;  5HHF A;  3GD3 A;  3UOV A;  1GRA A;  1X31 B;  3EAO A;  2QA1 A;  2GQW A;  3NH3 X;  1PXB A;  3AE3 A;  2XVH A;  2B7R A;  2Q6U A;  4OCG A;  2YR5 A;  3CTY A;  3AEF A;  3EF6 A;  1ZDL A;  3PVC A;  4FK1 A;  3O0H A;  4TM1 A;  4X9M A;  3AE6 A;  1NHR A;  4A6N B;  2VOU A;  5M0Z A;  4Z24 A;  4Y4M A;  1M64 A;  1PJ7 A;  2H88 A;  3ALJ A;  1QLB A;  2YLZ A;  4JY3 A;  4Z2R A;  4H4P A;  1AOG A;  5IPY A;  3NT6 A;  2YVJ A;  2OAL A;  4HA6 A;  3IWA A;  4X9N A;  4C3X A;  2XVE A;  1LQT A;  2C76 A;  1MXT A;  5J60 A;  4U2L A;  3V3O A;  4Z26 A;  1GER A;  4TM3 A;  2V60 A;  3G5S A;  4KX6 A;  2Y6Q A;  1PDH A;  4XWZ A;  1H86 A;  2GB0 A;  3JSK A;  1CC4 A;  5EB4 A;  3ATQ A;  3OZ2 A;  4PAA A;  2TMD A;  3G5Q A;  1ZMC A;  2XYO A;  4ADW A;  3L1R A;  1H83 A;  4H4U A;  4J56 A;  3C4A A;  2BK3 A;  3UKP A;  3V3N A;  2V3B A;  2XDO A;  3LAD A;  1ZOY A;  2XFP A;  1CBO A;  2C70 A;  1VG0 A;  4I59 A;  2YG5 A;  4IA5 A;  3AYL A;  3DK8 A;  4NTD A;  2WS3 A;  4YKG A;  1H7X A;  1H6V A;  1GT8 A;  4GRT A;  3URH A;  4GCM A;  2B9W A;  1YQZ A;  1O95 A;  3ITJ A;  1GAL A;  1KSS A;  2WPF A;  3M13 A;  3BI5 A;  3ALM A;  3SGL A;  1F8S A;  4EMJ A;  4JDR A;  4DSH A;  5DBJ A;  1LV0 A;  2EQ8 A;  1S2Y A;  4HB9 A;  4OPD A;  4BJY A;  1LQU A;  2X8G A;  2BK4 A;  5U63 A;  2C66 A;  3CPH G;  4U8M A;  2JK6 A;  2WOV A;  3K7Q X;  4AP3 A;  2ACZ A;  3AD9 B;  3IF9 A;  4C3Y A;  2GR1 A;  3B3R A;  3BNU A;  4O5U A;  1XDI A;  4U8P A;  1CJ4 A;  1KSU A;  3LOV A;  3AEA A;  1K0I A;  2CVJ A;  1K4Q A;  3UOZ A;  4OPT A;  4TM4 A;  1K0J A;  1D4E A;  3KKJ A;  1GRG A;  4NTC A;  2ARD A;  5BVA A;  1ZMD A;  4GDP A;  1PJ6 A;  3FIM B;  2JBV A;  5KOX A;  2HQM A;  1CJ2 A;  1CHU A;  3AE9 A;  1O5W A;  1MOK A;  2I0Z A;  5FS7 A;  3T37 A;  1ZKQ A;  3EPT A;  4YTP A;  4H4R A;  4U8I A;  3K7M X;  2WPC A;  5C3J A;  1TDN A;  2IVE A;  2QCU A;  4YKF A;  2BAC A;  2WHD A;  1B5Q A;  3GDP A;  2R46 A;  3KD9 A;  1NG3 A;  4H4T A;  2BXR A;  3UOY A;  1FEC A;  2XFU A;  1RP0 A;  4J33 A;  3LB8 A;  4D04 A;  1TDE A;  1TYT A;  2GRT A;  4H50 A;  1EL8 A;  2GVC A;  3VRA A;  1TDF A;  3UKF A;  2YLX A;  1W4X A;  4H2R A;  4H4W A;  2R0C A;  1REO A;  3F8P A;  3RP6 A;  4A7A A;  1E1N A;  4K7Z A;  4MJW A;  4U2S A;  1GRT A;  4U8L A;  1GND A;  4M52 A;  2XLU A;  5HYM A;  4EMI A;  1BZL A;  2CUL A;  2JB1 A;  4EIQ A;  5JCM A;  1PJ5 A;  1E1K A;  3NHO X;  5HXI A;  4EM4 A;  1DJQ A;  3UTF A;  1D7Y A;  2EQ9 A;  4A79 A;  3GSI A;  3IHG A;  2VZ2 A;  3CIR A;  2X99 A;  4BUR A;  2W0H A;  3AEC A;  3GMB A;  1NHQ A;  5GRT A;  1IUV A;  3DJG X;  3DJE A;  3PO7 A;  2XLS A;  2DKH A;  1FCD A;  4DSG A;  3KA7 A;  4U8K A;  2A87 A;  2CDU A;  2YM1 A;  1GRE A;  4YWO A;  3SQP A;  2EQ6 A;  5JCI A;  1DXL A;  4OPI A;  5IQ1 A;  3R9U A;  2X8H A;  1Q1W A;  4ICY A;  3H8L A;  2QAE A;  3CPI G;  3LXD A;  5CQF A;  2V6O A;  4EQR A;  3NTA A;  5U1O A;  1JRZ A;  1BGN A;  1P2E A;  1LPF A;  3FMW A;  1FOH A;  4OVI A;  3BNM A;  3NIX A;  3I3L A;  4ZN0 A;  1ZX9 A;  3AYJ A;  2WES A;  1BGJ A;  4Z44 A;  1VQW A;  2BS3 A;  2IID A;  3QSE A;  4PAB A;  1GXF A;  2AR8 A;  4B68 A;  1IUX A;  3ICT A;  1S3E A;  4YTM A;  1L9E A;  4TLX A;  1ELI A;  2XFO A;  4CNK A;  1N4U A;  5BRT A;  3P1W A;  4EQX A;  1VDC A;  1PHH A;  4A99 A;  4CY8 A;  2YVF A;  1UKV G;  1GRH A;  4USR A;  2Q0L A;  2XVJ A;  4LA1 A;  2QA2 A;  1OJC A;  3FPZ A;  4DGK A;  2EQ7 A;  4Z25 A;  3NTD A;  1NG4 A;  3AB1 A;  1TRB A;  1NAA A;  3CPJ G;  2OAM A;  3GWD A;  4ECH A;  1KDG A;  2YR4 A;  3DA1 A;  1COY A;  4J36 A;  4XXG A;  4CY6 A;  1DJN A;  1YY5 A;  3K7T A;  3NN0 X;  4BJZ A;  1XAN A;  2E5V A;  2JAE A;  1YQ3 A;  3AE5 A;  2ZZC A;  3NLC A;  1B37 A;  2BK5 A;  3UKQ A;  2Y6R A;  2B7S A;  5KWF A;  1IUU A;  5KVI A;  2VQB A;  3DGZ A;  4U2T A;  5C2T A;  2F5Z A;  4K5S A;  1JNZ A;  2XFQ A;  4B1B A;  3DME A;  1SEZ A;  1NHP A;  4FX9 A;  3UKH A;  3NK0 X;  3P4P A;  3K30 A;  1Y0P A;  1YQ4 A;  3PS9 A;  1OJA A;  4J34 A;  1S3B A;  1JRX A;  2GAH B;  3I6D A;  3RED A;  3GRT A;  2E1M A;  4H2Q A;  4D03 A;  5EB5 A;  1DOD A;  1EL7 A;  2R0G A;  4LU6 A;  5IQ4 A;  3P4R A; 
#chains in the Genus database with same CATH topology
 3CNP A;  3CB3 A;  4AP1 A;  4ZCC A;  2GQF A;  2PGW A;  4OPL A;  1DOC A;  4AT2 A;  5L46 A;  1JRY A;  2NVK X;  5ENL A;  3CGE A;  3UTG A;  4YSX A;  1N4W A;  4H2P A;  4AOX A;  1Q9I A;  5FMH A;  1PDZ A;  2E3T A;  2YG3 A;  3ZYX A;  1D5T A;  2OO6 A;  4CRT A;  3UKL A;  3MUC A;  3IHM A;  2Z5Y A;  3UTH A;  5JCL A;  2BCG G;  1K0L A;  4H2N A;  1N1P A;  5EOW A;  1DTN A;  1MO9 A;  4DHG A;  4UDR A;  3GWF A;  4YT0 A;  3D47 A;  3R11 A;  3AXB A;  4NTE A;  3RP8 A;  2APG A;  2RGH A;  4B64 A;  2PTZ A;  4KEM A;  2P8B A;  1X2H A;  3V4B A;  2QJJ A;  3DG6 A;  1IJH A;  2YLS A;  3M12 A;  2BXS A;  3Q4D A;  1H7W A;  1D4C A;  1VG9 A;  4H1Z A;  4H4S A;  2HXU A;  2C75 A;  3QSS A;  4DXK A;  4X4J A;  3S61 A;  2FJD A;  2PGE A;  3SN0 A;  4H19 A;  2E5A A;  2P3Z A;  2GMH A;  4E4F A;  3TJI A;  1PBE A;  1F8W A;  3I6T A;  4U8O A;  1IUS A;  3SN1 A;  2VVL G;  3V5F A;  4MKS A;  1CJ3 A;  2VRM A;  3NK1 X;  3LZW A;  5FS9 A;  2X3N A;  2AL2 A;  1NEK A;  4HCD A;  2XH4 A;  3QPE A;  5KRQ A;  4B65 A;  4WCT A;  1D7L A;  2POZ A;  3HRD C;  1EL9 A;  5FJU A;  3DJJ A;  1N5X A;  5FS8 A;  4J3Z A;  2GGI A;  3VFC A;  1EBD A;  3ES7 A;  2VQ7 A;  4H4V A;  2PA6 A;  1FEB A;  2R4J A;  2OFJ A;  1SJB A;  3UXK A;  2AQJ A;  2YG7 A;  3UJR A;  1GTH A;  3Q45 A;  2PP3 A;  3C4N A;  3AEE A;  3H4K A;  2GGH A;  4BK3 A;  1VQZ A;  4CCR A;  4J2W A;  1LVL A;  4U8J A;  1P43 A;  1KNR A;  2WU2 A;  3SFE A;  2DW7 A;  3C96 A;  2ZC8 A;  2RGO A;  1PS9 A;  2WDQ A;  3ABV A;  1JEH A;  2R4E A;  4A5L A;  1H82 A;  3P4S A;  4XWR A;  2NQL A;  3MQT A;  3ISH A;  2OLO A;  2C3D A;  3KLJ A;  2XH7 A;  4ZOH B;  4C74 A;  3DH9 A;  1GOS A;  2FJE A;  3JZU A;  4Z2U A;  3EAO A;  4IL0 A;  2XVH A;  3CTY A;  4K2S A;  3AEF A;  3FVD A;  3PVC A;  4X9M A;  3DDM A;  4Y4M A;  1M64 A;  4Z2R A;  3ALJ A;  1QLB A;  5IPY A;  3I6E A;  2YVJ A;  4C3X A;  5J60 A;  3V3O A;  3AMZ A;  4KX6 A;  2Y6Q A;  4XWZ A;  1H86 A;  2GB0 A;  4M0X A;  4PAA A;  2XYO A;  2PMQ A;  1MDL A;  4G8T A;  2ONE A;  1CBO A;  3QN3 A;  4I59 A;  3ZLF A;  4YKG A;  1H6V A;  1TZZ A;  3URH A;  2WPF A;  1LV0 A;  2EQ8 A;  4BJY A;  4HYR A;  2C66 A;  4U8M A;  2JK6 A;  3IF9 A;  2GR1 A;  3B3R A;  2OX4 A;  3HYW A;  1K0I A;  4G6H A;  3UOZ A;  4OPT A;  1D4E A;  3RCY A;  5BVA A;  1CJ2 A;  1MRA A;  2XSX A;  3T37 A;  3EPT A;  2WPC A;  5C3J A;  4YKF A;  4KPL A;  2BXR A;  1FEC A;  1EL8 A;  4E6M A;  4H2R A;  4H4W A;  2R0C A;  5KMR A;  3F8P A;  4MJW A;  3ZLH A;  1GND A;  3V5C A;  4EMI A;  1PJ5 A;  1E1K A;  4EM4 A;  1D7Y A;  4GYP C;  3GSI A;  3CIR A;  2W0H A;  3GC2 A;  3NVV B;  2QJM A;  3DJG X;  2XLS A;  3HPF A;  1FHU A;  1DXL A;  3R9U A;  4ICY A;  3CPI G;  3LXD A;  1JRZ A;  1BGN A;  1P2E A;  4OVI A;  3NXL A;  1ZX9 A;  1BGJ A;  1GXF A;  4B68 A;  4YTM A;  2OQY A;  2PP0 A;  3UJ2 A;  4TLX A;  2C4C A;  1VDC A;  3T4W A;  4KT2 A;  3FPZ A;  2EQ7 A;  2PTX A;  2OAM A;  2HNE A;  3AN1 A;  2YR4 A;  4XXG A;  4CY6 A;  1DJN A;  1YY5 A;  1XAN A;  2AL1 A;  1B37 A;  2B7S A;  2F5Z A;  4K5S A;  2XFQ A;  1OEP A;  3I6D A;  1BKH A;  2GAH B;  3GRT A;  4H2Q A;  2R0G A;  2QDD A;  5IQ4 A;  3CNT A;  3NRN A;  4BK1 A;  5JRB A;  2VVL A;  1GTE A;  3EAN A;  3BHK A;  2OG9 A;  3B9J B;  2GR3 A;  4P9S A;  3DJD A;  3S47 A;  2BCP A;  3CGB A;  1S2Q A;  2YLR A;  4IVO B;  1FEA A;  1DOE A;  3GYX A;  3HYV A;  3RNM A;  2OQH A;  4ENL A;  1E9I A;  3OC4 A;  3SFD A;  1B4V A;  2YAU A;  3VA8 A;  5J7X A;  1HYU A;  2BS4 A;  2WEU A;  1JNR A;  1H81 A;  5JCN A;  5KMQ A;  2J3N A;  4ZCW A;  2C73 A;  2GAG B;  1QO8 A;  4Z43 A;  4J31 A;  3T9P A;  5BUL A;  4WX1 A;  3ICR A;  2A89 A;  3CT2 A;  3NGC X;  4Y4L A;  3AE8 A;  4GAP A;  4APN A;  1KN0 A;  3NKS A;  3DK9 A;  1LJ1 A;  3P0W A;  4YTN A;  4YSY A;  4B67 A;  3CN8 A;  3AD8 B;  3UP5 A;  1Y56 A;  2XVF A;  5G5G B;  3U9I A;  4FI4 A;  4EM3 A;  3ADA B;  2OLN A;  4K8G A;  1RVK A;  3VC5 A;  3UCC A;  3TTE A;  1EL5 A;  2OPJ A;  1GEU A;  2RGJ A;  3UKK A;  3AM9 A;  5KMP A;  2VRL A;  3AYI A;  3T0K A;  5TR3 A;  3DG3 A;  4II2 A;  3UP4 A;  2GH5 A;  1WUF A;  1L0V A;  3F8R A;  3KPK A;  2WOW A;  3H8I A;  2MUC A;  4NEV A;  3H70 A;  2YG6 A;  3UJF A;  3K1G A;  2WP6 A;  4GUV A;  4F4R A;  2XLR A;  2R9Z A;  1E1L A;  5JCK A;  4K1W A;  5J04 A;  3HZL A;  2Q0K A;  3NRZ B;  1KNP A;  2PYX A;  4IT1 A;  2ZZB A;  1KFY A;  4AT0 A;  2NPX A;  1ZP0 A;  6ENL A;  1SJD A;  3BJS A;  3JW7 A;  1RSG A;  1KF6 A;  1ZK7 A;  3SZC A;  3Q6J A;  1CF3 A;  3S5S A;  4H4Z A;  4H4Y A;  4JN9 A;  4H4X A;  3SZF A;  2PTY A;  3VQR A;  5KOW A;  2FBW A;  1YKJ A;  2I5Q A;  2VVM A;  1E39 A;  2RAB A;  1DNC A;  2JKC A;  1F3P A;  3P9U A;  1NDA A;  3D46 A;  1BF3 A;  3AE2 A;  2B9X A;  2GF3 A;  3P4Q A;  3UKA A;  2GGG A;  1GRF A;  3MKC A;  3VRB A;  2UZZ A;  3WE0 A;  3DER A;  4A9W A;  2ZBW A;  4DNA A;  3QJ4 A;  4USQ A;  2TPR A;  4GFI A;  2JB2 A;  3TJ4 A;  4G9K A;  3N6H A;  4J57 A;  3FG2 P;  3T2Z A;  1WYG A;  2Q7V A;  2CFY A;  3Q9T A;  1NPX A;  3VR8 A;  3RHA A;  1PN0 A;  3ZDN A;  2YWL A;  1ZXI C;  5ER0 A;  2C64 A;  4H4Q A;  1GES A;  1KCZ A;  3VRD B;  1FL2 A;  3NK2 X;  4IA6 A;  2GR2 A;  5HHF A;  1X31 B;  2GGE A;  2B7R A;  4GGB A;  2Q6U A;  4OCG A;  3UJE A;  3EF6 A;  4MMW A;  4TM1 A;  1NHR A;  5M0Z A;  4Z24 A;  4H4P A;  3PG6 A;  1LQT A;  4U2L A;  3DFY A;  4TM3 A;  2V60 A;  2PTW A;  3SYI A;  1N60 C;  3JSK A;  1CC4 A;  5EB4 A;  1JRO A;  1ZMC A;  4ADW A;  2BK3 A;  3V3N A;  2V3B A;  1JRP A;  3LAD A;  1ZOY A;  3AYL A;  3DGB A;  2WS3 A;  1H7X A;  4GRT A;  4DWD A;  1O95 A;  3ITJ A;  1KSS A;  3M13 A;  3DES A;  4DSH A;  5DBJ A;  4HB9 A;  2X8G A;  3CPH G;  2WOV A;  1XDI A;  4U8P A;  3NVW B;  3AEA A;  2CVJ A;  1K0J A;  3GD6 A;  3TW9 A;  2ARD A;  1PJ6 A;  2HQM A;  3AE9 A;  1MOK A;  3MZN A;  5FS7 A;  1ZKQ A;  4H4R A;  3K7M X;  1N62 C;  2QCU A;  3T31 A;  3R25 A;  3UOY A;  2XFU A;  5BOE A;  1TDE A;  1TYT A;  2GRT A;  4H50 A;  2GVC A;  4GYP A;  1TDF A;  1REO A;  3RP6 A;  1XS2 A;  1E1N A;  4U2S A;  2XLU A;  2CUL A;  3SR6 B;  5HXI A;  2EQ9 A;  2X99 A;  4BUR A;  3THU A;  3RRA A;  3QLD A;  4DSG A;  3KA7 A;  4U8K A;  1BQG A;  2A87 A;  1GRE A;  1Q1W A;  3ZVH B;  5CQF A;  3NTA A;  5U1O A;  1LPF A;  4HCL A;  2PS2 A;  1FO4 A;  3JVA A;  3AYJ A;  2WES A;  3KUM A;  3A7A A;  4PAB A;  2HXT A;  2AR8 A;  3ICT A;  2XFO A;  4CNK A;  1SB3 B;  4A99 A;  1UKV G;  2XVJ A;  2QA2 A;  3CPJ G;  3GWD A;  1ELS A;  2PP1 A;  3K7T A;  3SX6 A;  1IYX A;  3NLC A;  2ZZC A;  2Y6R A;  1IUU A;  4II3 A;  3U4F A;  4U2T A;  4TVW A;  4B1B A;  1SEZ A;  1NHP A;  3UKH A;  3UGV A;  1YQ4 A;  2PU0 A;  1JRX A;  4D03 A;  3UOV A;  4LU6 A;  3P4R A;  5BOF A;  4A6N A;  1MDR A;  1N63 C;  3CGD A;  2WP9 A;  4EIP A;  3QFB A;  4GIS A;  1FHV A;  2XVI A;  1CC2 A;  3AD7 B;  2YVG A;  3CK5 A;  4B69 A;  3COX A;  2XCG A;  4FK1 C;  4EQS A;  4B66 A;  1H84 A;  3CNS A;  3SM8 A;  1P2H A;  4UDQ A;  3NN6 X;  2O56 A;  3I4K A;  3ENL A;  4TVY A;  3VCC A;  1V59 A;  1BWC A;  2BS2 A;  2QVH A;  2B9Y A;  4CNJ A;  5KXJ A;  1Y56 B;  3GRS A;  1KD0 A;  2GEW A;  1PXA A;  2FJA A;  1ZY8 A;  1FIQ B;  1XHC A;  3CGC A;  1B8S A;  2GL5 A;  3PFR A;  3KU9 A;  3QVP A;  3TOY A;  4ROP A;  3QFA A;  1Z6L A;  2H89 A;  4BK2 A;  3NVZ B;  2C65 A;  4CBQ A;  4YXD A;  3R1Z A;  1EC9 A;  4JNA A;  2B76 A;  4C77 A;  4ZCD A;  2BAB A;  3AE4 A;  3D1C A;  3L8K A;  2V5Z A;  4OPU A;  2C72 A;  4K8D A;  1JOA A;  2PPG A;  3FXG A;  4DN1 A;  3GYI A;  4ZA0 A;  2DKI A;  3ES8 A;  1CJC A;  3BOX A;  2WPE A;  2E4G A;  3V76 A;  4FDC B;  5U25 A;  3GYJ A;  2R45 A;  4HNL A;  4H2H A;  2YM2 A;  4NZH A;  1CC6 A;  1EC8 A;  5EU9 A;  3CND A;  2QQ6 A;  3DG7 A;  2Z5X A;  2XLP A;  3IC9 A;  3RO6 A;  3FCP A;  1YEY A;  3RGT A;  1FFV C;  4GR1 A;  1TKK A;  4E0V A;  5LV9 A;  3N4E A;  4KPR A;  4UP3 A;  1PDY A;  3KVE A;  3GMC A;  2GDQ A;  4OPC A;  1TDO A;  2XLT A;  3IJQ A;  3NYE A;  3II4 A;  3PWI A;  4AOS A;  2AKM A;  4YSZ A;  1WUE A;  1EC7 A;  4A6G A;  4CCQ A;  2OVL A;  2PU1 A;  4J1O A;  3UXL A;  1W6T A;  2C67 A;  4HCH A;  2JB3 A;  2P8C A;  3CAW A;  1F6M A;  3CMM A;  4FP1 A;  4BV6 A;  2A8X A;  7ENL A;  3ETR B;  3ZVH A;  2BA9 A;  5KNL A;  3NNE A;  1OJ9 A;  3ZVI A;  3N6J A;  1LTX R;  1TYP A;  3SJN A;  2W3R A;  3QVR A;  4B63 A;  1NHS A;  1N5W C;  4IP5 A;  2YR6 A;  3D8X A;  2V3A A;  3H12 A;  3DFH A;  1O94 A;  1KKR A;  2WP5 A;  5FJO A;  1ZOV A;  4JNQ A;  3MSY A;  2WU5 A;  1GRB A;  4RSL A;  2GV8 A;  3SSZ A;  4YSH A;  3T6C A;  5FJT A;  1EBG A;  1JPD X;  2FYM A;  4IVM B;  1E6E A;  4RG4 A;  1QJD A;  3NH3 X;  1MUC A;  1JDF A;  1ZDL A;  3P3B A;  3AE6 A;  4A6N B;  4JY3 A;  2W54 A;  1PJ7 A;  3A7R A;  3NT6 A;  4HA6 A;  3IWA A;  2ZAD A;  2XVE A;  2C76 A;  4IHC A;  3OZ2 A;  2TMD A;  3G5Q A;  1H83 A;  4H4U A;  4J56 A;  3CYJ A;  3C4A A;  4MGG A;  3UKP A;  3FYY A;  3T2Y A;  4EWJ A;  3RIT A;  4NWZ A;  1VG0 A;  2YG5 A;  4NTD A;  1GT8 A;  4GCM A;  2B9W A;  1GAL A;  3BI5 A;  3SGL A;  1H2I A;  1F8S A;  4EMJ A;  3EKG A;  3IK4 A;  1LQU A;  5U63 A;  3TCS A;  4AP3 A;  3K7Q X;  2ACZ A;  3AD9 B;  3OZY A;  3BNU A;  3R07 C;  1K4Q A;  4TM4 A;  3KKJ A;  1GRG A;  3FIM B;  2JBV A;  5KOX A;  1CHU A;  2I0Z A;  4YTP A;  1V97 A;  2BAC A;  1B5Q A;  3GDP A;  3KD9 A;  1NG3 A;  3DIP A;  1SJC A;  4J33 A;  4D04 A;  4GAV A;  2YLX A;  1W4X A;  4A7A A;  4K7Z A;  1EBH A;  1GRT A;  5HYM A;  1BZL A;  3OPS A;  3D9X A;  2OZ8 A;  3NHO X;  1N61 C;  3UTF A;  4A79 A;  4E4U A;  2VZ2 A;  3GMB A;  1NHQ A;  5GRT A;  1IUV A;  3DJE A;  3R10 A;  1FCD A;  4G7F A;  2CHR A;  4YWO A;  3SQP A;  5JCI A;  4OPI A;  3T8Q A;  2X8H A;  3UJS A;  4DX3 A;  4Z17 A;  3SQS A;  3FMW A;  3BNM A;  3EUB 3;  3GY1 A;  2BRA A;  3I3L A;  3NIX A;  4ZN0 A;  4Z44 A;  1VQW A;  2IID A;  3QSE A;  1ELI A;  1TE6 A;  1PHH A;  4CY8 A;  2YVF A;  2Q0L A;  4HN8 A;  4A3R A;  4Z25 A;  4H83 A;  4NNJ A;  1NG4 A;  3AB1 A;  3DA1 A;  4J36 A;  1STZ A;  3IJL A;  3NN0 X;  1NU5 A;  4JN8 A;  2E5V A;  2JAE A;  1YQ3 A;  4G74 A;  3UKQ A;  2P88 A;  5KVI A;  2W55 A;  3DGZ A;  3ZLG A;  3DME A;  1ONE A;  3H8A A;  3P4P A;  1Y0P A;  3PS9 A;  4J34 A;  2E1M A;  5EB5 A;  1L8P A;  3QKE A;  3G5R A;  3AED A;  2HZG A;  5M10 A;  4Z1Y A;  3AWI A;  3ICS A;  4HPN A;  3LZX A;  4A65 A;  1NEN A;  1GPE A;  2POD A;  4JN7 A;  3AEB A;  1E1M A;  2GSH A;  4UDP A;  3NG7 X;  2BC1 A;  3GD4 A;  2YLW A;  2WQY A;  3OP2 A;  3RP7 A;  3UCD A;  4E5T A;  4Z2T A;  2V61 A;  3VR9 A;  1F9C A;  3MWC A;  3E1T A;  4JQ9 A;  2QJN A;  5G5H B;  4U8N A;  3S5W A;  3B6D A;  3GDN A;  1E7P A;  1CL0 A;  1L9D A;  2WET A;  2XH0 A;  4RG3 A;  3R0K A;  1OJT A;  1XPQ A;  1PBF A;  1JU2 A;  2GMJ A;  4X2P A;  3EEZ A;  4REK A;  5EBK A;  4GIR A;  4K22 A;  1X2G A;  1PBB A;  5KVH A;  4NEW A;  3ATR A;  4K5R A;  2WDR A;  5CKU A;  3CXO A;  1FFU C;  2WDV A;  3SZW A;  3KPF A;  2IVD A;  2MNR A;  4TM0 A;  3NYC A;  3MY9 A;  1OJD A;  1R6W A;  3N4F A;  3AE7 A;  1DOB A;  3SY4 A;  2X8C A;  4IL2 A;  2YQU A;  3RR1 A;  5IDZ A;  3TQP A;  3HYX A;  2WOI A;  4OPG A;  2PSN A;  3AE1 A;  4GME A;  2PHH A;  4LII A;  3FV9 A;  1BKW A;  5HY5 A;  3NFU A;  1R0M A;  3TWA A;  4I58 A;  2YG4 A;  3QSM A;  1RYI A;  2FKP A;  1P48 A;  1IUW A;  3FBS A;  3BHF A;  5GSN A;  3UTE A;  1L9C A;  3T2K A;  4GDE A;  3AEG A;  4C5O A;  3VC6 A;  2C3C A;  4H7U A;  3UCL A;  2QGY A;  5BUK A;  5FS6 A;  1Q1R A;  4N9X A;  2AL2 B;  3NYF A;  3CNJ A;  4EMW A;  2YLT A;  2C7G A;  3DK4 A;  4IV9 A;  2X50 A;  2WBA A;  1PBD A;  2OZ3 A;  4Y4N A;  3BI4 A;  2BC0 A;  2FJB A;  2P0I A;  3M0O A;  1D4D A;  2GR0 A;  3SZ0 A;  4GF7 A;  1JCT A;  1PBC A;  3F8D A;  2W3S A;  3NZG A;  3UOX A;  4JHM A;  2R0P A;  4EQW A;  3CXB A;  2OA1 A;  1ONF A;  1GET A;  3BI2 A;  1TDK A;  4TLZ A;  3SXI A;  3ALL A;  2XH2 A;  1GV4 A;  2PCE A;  2ZZ0 A;  1VRQ B;  3T14 A;  4O5Q A;  2AAQ A;  1GSN A;  3LJP A;  2XFN A;  4JY2 A;  1F8R A;  2OKT A;  1PXC A;  2BYB A;  2XGZ A;  2QDE A;  4K2X A;  3DGH A;  1N4V A;  1M6I A;  4IP4 A;  1IUT A;  2O9Z A;  3A7U A;  3GD3 A;  1GRA A;  3V3W A;  2QA1 A;  2GQW A;  1PXB A;  3AE3 A;  2YR5 A;  1NEL A;  2OLA A;  4FK1 A;  3O0H A;  2VOU A;  2H88 A;  3H7V A;  2YLZ A;  1AOG A;  2OAL A;  4X9N A;  2AKZ A;  1MXT A;  4Z26 A;  1GER A;  3G5S A;  1PDH A;  4HNC A;  1KKO A;  3ATQ A;  3PWG A;  3L1R A;  2XDO A;  2XFP A;  2C70 A;  4IA5 A;  3DK8 A;  5FJP A;  3PK7 A;  1YQZ A;  2BRY A;  3ALM A;  3GO2 A;  3HW2 A;  3L5O A;  3QTP A;  3FJ4 A;  4JDR A;  1S2Y A;  4OPD A;  2BK4 A;  3SN4 A;  4C3Y A;  3DEQ A;  4O5U A;  1CJ4 A;  1KSU A;  3LOV A;  3NVY B;  4GGH A;  4YWS A;  4NTC A;  1ZMD A;  4GDP A;  1S7M A;  2OZT A;  2RDX A;  1O5W A;  3TWB A;  4U8I A;  1TDN A;  2IVE A;  2WHD A;  2R46 A;  4H4T A;  4IZG A;  1RP0 A;  1SJA A;  3LB8 A;  3VRA A;  3UKF A;  1MNS A;  3P93 A;  1ECQ A;  4U8L A;  4M52 A;  4EIQ A;  2JB1 A;  1RM6 B;  5JCM A;  3NS1 B;  1JPM A;  4G6G A;  1VDV A;  1DJQ A;  3OTR A;  3B97 A;  3IHG A;  3VCN A;  3R0U A;  3AEC A;  1T3Q C;  3PO7 A;  2DKH A;  3SBF A;  2CDU A;  2YM1 A;  2GGJ A;  2EQ6 A;  3VDG A;  4KWS A;  5IQ1 A;  4M6U A;  3OZM A;  3H8L A;  2QAE A;  3NO1 A;  4DYE A;  2V6O A;  4EQR A;  1FOH A;  2DW6 A;  2BS3 A;  4E8G A;  3IJI A;  1IUX A;  1S3E A;  1L9E A;  1N4U A;  5KMS A;  5BRT A;  3P1W A;  4EQX A;  4A35 A;  1GRH A;  4USR A;  4LA1 A;  3BSM A;  1OJC A;  4DGK A;  3NTD A;  1TRB A;  1NAA A;  4ECH A;  1KDG A;  1COY A;  4BJZ A;  3STP A;  3AE5 A;  2BK5 A;  1XPY A;  5KWF A;  2VQB A;  5C2T A;  1JNZ A;  5FJR A;  4FX9 A;  3NK0 X;  3OW1 A;  3K30 A;  1OJA A;  1S3B A;  3RED A;  1DOD A;  4G73 A;  1EL7 A; 
#chains in the Genus database with same CATH homology
 3CNP A;  3CNT A;  3NRN A;  4BK1 A;  4A6N A;  3G5R A;  2WP9 A;  3CGD A;  5JRB A;  2VVL A;  3AED A;  3QFB A;  4AP1 A;  4EIP A;  1GTE A;  3EAN A;  4ZCC A;  2GQF A;  3BHK A;  2XVI A;  1CC2 A;  3AD7 B;  3AWI A;  5M10 A;  2YVG A;  3ICS A;  2GR3 A;  3LZX A;  4OPL A;  4A65 A;  4P9S A;  4B69 A;  1NEN A;  1DOC A;  1GPE A;  3COX A;  2XCG A;  4FK1 C;  4EQS A;  4AT2 A;  3DJD A;  1H84 A;  4B66 A;  5L46 A;  3AEB A;  1E1M A;  2BCP A;  1JRY A;  3CNS A;  3CGB A;  3SM8 A;  1S2Q A;  4UDP A;  1P2H A;  2YLR A;  3NG7 X;  2BC1 A;  4IVO B;  4UDQ A;  2NVK X;  3NN6 X;  3GD4 A;  1FEA A;  1DOE A;  3GYX A;  2YLW A;  3CGE A;  3HYV A;  3RNM A;  1V59 A;  1BWC A;  3UTG A;  3OC4 A;  3SFD A;  2WQY A;  1N4W A;  4YSX A;  1B4V A;  4H2P A;  2BS2 A;  4AOX A;  3RP7 A;  1Q9I A;  5FMH A;  4Z2T A;  2YAU A;  2V61 A;  3VR9 A;  2B9Y A;  2YG3 A;  4C77 A;  4CNJ A;  5J7X A;  1HYU A;  2BS4 A;  2WEU A;  3ZYX A;  1D5T A;  1JNR A;  1H81 A;  5JCN A;  5KMQ A;  4CRT A;  3E1T A;  5KXJ A;  2J3N A;  3UKL A;  2C73 A;  3IHM A;  2Z5Y A;  1Y56 B;  2GAG B;  1QO8 A;  3GRS A;  4J31 A;  3UTH A;  4JQ9 A;  5JCL A;  2GEW A;  4Z43 A;  5BUL A;  1PXA A;  2FJA A;  4WX1 A;  4U8N A;  1ZY8 A;  2BCG G;  3ICR A;  3S5W A;  2A89 A;  3NGC X;  4Y4L A;  3B6D A;  3AE8 A;  1XHC A;  4GAP A;  4APN A;  1KN0 A;  3NKS A;  3GDN A;  3CGC A;  3DK9 A;  1LJ1 A;  4YTN A;  1B8S A;  1K0L A;  1E7P A;  4YSY A;  4H2N A;  1CL0 A;  1N1P A;  5EOW A;  4B67 A;  1L9D A;  2WET A;  1MO9 A;  4RG3 A;  3CN8 A;  1OJT A;  1XPQ A;  1PBF A;  3AD8 B;  3KU9 A;  3QVP A;  3UP5 A;  1JU2 A;  2GMJ A;  4UDR A;  3QFA A;  1Y56 A;  5EBK A;  3GWF A;  4REK A;  4YT0 A;  2XVF A;  1Z6L A;  3AXB A;  4NTE A;  4K22 A;  3RP8 A;  2APG A;  2RGH A;  4EM3 A;  2H89 A;  3ADA B;  1PBB A;  5KVH A;  4NEW A;  3ATR A;  4K5R A;  2OLN A;  4B64 A;  2WDR A;  4BK2 A;  5CKU A;  2C65 A;  2WDV A;  4CBQ A;  4YXD A;  1IJH A;  2YLS A;  1EL5 A;  3M12 A;  2BXS A;  4JNA A;  1GEU A;  2RGJ A;  1H7W A;  2B76 A;  3SZW A;  3UKK A;  3KPF A;  5KMP A;  2VRL A;  3AYI A;  4ZCD A;  2IVD A;  1D4C A;  3T0K A;  1VG9 A;  2BAB A;  3AE4 A;  4TM0 A;  3D1C A;  3L8K A;  2V5Z A;  3NYC A;  4H4S A;  4OPU A;  5TR3 A;  1OJD A;  2C72 A;  4K8D A;  3AE7 A;  1JOA A;  4II2 A;  3UP4 A;  1DOB A;  3SY4 A;  2X8C A;  2C75 A;  2GH5 A;  3QSS A;  3GYI A;  2YQU A;  3HYX A;  4X4J A;  2WOI A;  3S61 A;  2FJD A;  4OPG A;  3AE1 A;  1L0V A;  3F8R A;  3KPK A;  2WOW A;  3H8I A;  2DKI A;  4NEV A;  2GMH A;  2PHH A;  2YG6 A;  1CJC A;  4GUV A;  4LII A;  2WP6 A;  2XLR A;  1BKW A;  2R9Z A;  2WPE A;  5HY5 A;  1E1L A;  1PBE A;  2E4G A;  3V76 A;  5JCK A;  4I58 A;  2YG4 A;  3QSM A;  1RYI A;  4FDC B;  1F8W A;  4U8O A;  5U25 A;  3GYJ A;  3HZL A;  1IUS A;  2Q0K A;  2R45 A;  1KNP A;  2VVL G;  1IUW A;  1CJ3 A;  2VRM A;  3FBS A;  2PYX A;  3NK1 X;  2ZZB A;  1KFY A;  3LZW A;  3BHF A;  5GSN A;  4AT0 A;  5FS9 A;  2X3N A;  3UTE A;  1NEK A;  2NPX A;  1L9C A;  2YM2 A;  4NZH A;  1ZP0 A;  5KRQ A;  3T2K A;  4GDE A;  1RSG A;  3AEG A;  4B65 A;  4C5O A;  1KF6 A;  1CC6 A;  2C3C A;  3CND A;  1ZK7 A;  2Z5X A;  4H7U A;  2XLP A;  3UCL A;  4WCT A;  1D7L A;  3IC9 A;  3SZC A;  1EL9 A;  5BUK A;  3Q6J A;  1CF3 A;  4H4Z A;  4GR1 A;  4E0V A;  4H4Y A;  4JN9 A;  3DJJ A;  4H4X A;  5FS6 A;  5LV9 A;  1Q1R A;  4KPR A;  5FS8 A;  4N9X A;  3NYF A;  3KVE A;  4UP3 A;  3SZF A;  3VQR A;  5KOW A;  3GMC A;  2FBW A;  4OPC A;  1TDO A;  4EMW A;  1YKJ A;  2XLT A;  2YLT A;  2C7G A;  3II4 A;  3CNJ A;  3NYE A;  2VVM A;  3DK4 A;  4IV9 A;  1E39 A;  2X50 A;  2WBA A;  1PBD A;  4AOS A;  2RAB A;  1DNC A;  2JKC A;  4Y4N A;  1F3P A;  3P9U A;  1EBD A;  4YSZ A;  1NDA A;  3BI4 A;  2BC0 A;  2FJB A;  2VQ7 A;  1BF3 A;  3AE2 A;  4H4V A;  4CCQ A;  2B9X A;  1FEB A;  3M0O A;  2GF3 A;  3P4Q A;  1D4D A;  2GR0 A;  3SZ0 A;  4GF7 A;  2C67 A;  2R4J A;  1PBC A;  3F8D A;  2JB3 A;  3UKA A;  1F6M A;  2AQJ A;  3CMM A;  2YG7 A;  4BV6 A;  3UOX A;  2R0P A;  2A8X A;  1GTH A;  4EQW A;  1GRF A;  2BA9 A;  3C4N A;  2OA1 A;  3VRB A;  2UZZ A;  1ONF A;  3AEE A;  3H4K A;  3WE0 A;  1GET A;  3NNE A;  5KNL A;  4BK3 A;  1OJ9 A;  1TDK A;  3BI2 A;  4A9W A;  2ZBW A;  4DNA A;  4TLZ A;  3QJ4 A;  4USQ A;  3SXI A;  1LTX R;  4CCR A;  2TPR A;  4J2W A;  3ALL A;  1LVL A;  4U8J A;  1TYP A;  2JB2 A;  1GV4 A;  1KNR A;  2WU2 A;  3QVR A;  4B63 A;  2ZZ0 A;  1VRQ B;  4G9K A;  1NHS A;  3SFE A;  3C96 A;  3T14 A;  4O5Q A;  2YR6 A;  3D8X A;  2V3A A;  2AAQ A;  1GSN A;  4J57 A;  2RGO A;  3FG2 P;  3T2Z A;  1PS9 A;  2WDQ A;  3ABV A;  3LJP A;  2Q7V A;  2XFN A;  1O94 A;  2CFY A;  4JY2 A;  1JEH A;  2R4E A;  1F8R A;  1PXC A;  4A5L A;  2WP5 A;  3Q9T A;  1NPX A;  1ZOV A;  1H82 A;  2BYB A;  3VR8 A;  3P4S A;  3RHA A;  4JNQ A;  2WU5 A;  4XWR A;  1GRB A;  4K2X A;  4RSL A;  1PN0 A;  3ZDN A;  3ISH A;  2YWL A;  2GV8 A;  4YSH A;  5ER0 A;  2OLO A;  2C3D A;  3KLJ A;  3DGH A;  1N4V A;  2C64 A;  4H4Q A;  1M6I A;  4C74 A;  1GES A;  3VRD B;  3DH9 A;  1GOS A;  1FL2 A;  4IVM B;  2FJE A;  3NK2 X;  4IA6 A;  1IUT A;  2O9Z A;  2GR2 A;  1E6E A;  4RG4 A;  4Z2U A;  1QJD A;  5HHF A;  3GD3 A;  3UOV A;  1GRA A;  1X31 B;  3EAO A;  2QA1 A;  2GQW A;  3NH3 X;  1PXB A;  3AE3 A;  2XVH A;  2B7R A;  2Q6U A;  4OCG A;  2YR5 A;  3CTY A;  3AEF A;  3EF6 A;  1ZDL A;  3PVC A;  4FK1 A;  3O0H A;  4TM1 A;  4X9M A;  3AE6 A;  1NHR A;  4A6N B;  2VOU A;  5M0Z A;  4Z24 A;  4Y4M A;  1M64 A;  1PJ7 A;  2H88 A;  3ALJ A;  1QLB A;  2YLZ A;  4JY3 A;  4Z2R A;  4H4P A;  1AOG A;  5IPY A;  3NT6 A;  2YVJ A;  2OAL A;  4HA6 A;  3IWA A;  4X9N A;  4C3X A;  2XVE A;  3PG6 A;  1LQT A;  1MXT A;  2C76 A;  5J60 A;  4U2L A;  3V3O A;  4Z26 A;  1GER A;  4TM3 A;  2V60 A;  3G5S A;  4KX6 A;  2Y6Q A;  1PDH A;  3SYI A;  4XWZ A;  1H86 A;  2GB0 A;  3JSK A;  1CC4 A;  5EB4 A;  3ATQ A;  3OZ2 A;  4PAA A;  2TMD A;  3G5Q A;  1ZMC A;  2XYO A;  4ADW A;  3L1R A;  1H83 A;  4H4U A;  4J56 A;  3C4A A;  2BK3 A;  3UKP A;  3V3N A;  3T2Y A;  2V3B A;  2XDO A;  3LAD A;  1ZOY A;  2XFP A;  1CBO A;  2C70 A;  1VG0 A;  4I59 A;  2YG5 A;  4IA5 A;  3AYL A;  4NWZ A;  3DK8 A;  4NTD A;  2WS3 A;  4YKG A;  1H7X A;  1H6V A;  1GT8 A;  4GRT A;  3URH A;  4GCM A;  2B9W A;  1YQZ A;  1O95 A;  3ITJ A;  1GAL A;  1KSS A;  2BRY A;  2WPF A;  3M13 A;  3BI5 A;  3ALM A;  3L5O A;  1H2I A;  3SGL A;  1F8S A;  4EMJ A;  4JDR A;  4DSH A;  5DBJ A;  1LV0 A;  2EQ8 A;  1S2Y A;  4HB9 A;  4OPD A;  4BJY A;  1LQU A;  2X8G A;  2BK4 A;  5U63 A;  2C66 A;  3CPH G;  4U8M A;  2JK6 A;  2WOV A;  3K7Q X;  4AP3 A;  2ACZ A;  3AD9 B;  3IF9 A;  4C3Y A;  2GR1 A;  3B3R A;  3BNU A;  4O5U A;  1XDI A;  4U8P A;  1CJ4 A;  1KSU A;  3LOV A;  3AEA A;  3HYW A;  1K0I A;  2CVJ A;  4G6H A;  1K4Q A;  3UOZ A;  4OPT A;  4TM4 A;  1K0J A;  1D4E A;  3KKJ A;  1GRG A;  4NTC A;  2ARD A;  5BVA A;  1ZMD A;  4GDP A;  1S7M A;  1PJ6 A;  3FIM B;  2JBV A;  5KOX A;  2HQM A;  1CJ2 A;  1CHU A;  3AE9 A;  1O5W A;  1MOK A;  2I0Z A;  5FS7 A;  3T37 A;  1ZKQ A;  3EPT A;  4YTP A;  4H4R A;  4U8I A;  3K7M X;  2WPC A;  5C3J A;  1TDN A;  2IVE A;  2QCU A;  4YKF A;  2BAC A;  2WHD A;  1B5Q A;  3GDP A;  2R46 A;  3T31 A;  3KD9 A;  1NG3 A;  4H4T A;  2BXR A;  3UOY A;  1FEC A;  2XFU A;  1RP0 A;  4J33 A;  3LB8 A;  4D04 A;  1TDE A;  1TYT A;  2GRT A;  4H50 A;  1EL8 A;  2GVC A;  4GAV A;  3VRA A;  1TDF A;  3UKF A;  2YLX A;  1W4X A;  4H2R A;  4H4W A;  2R0C A;  1REO A;  3F8P A;  3RP6 A;  4A7A A;  5KMR A;  1E1N A;  4K7Z A;  4MJW A;  4U2S A;  1GRT A;  4U8L A;  1GND A;  4M52 A;  2XLU A;  5HYM A;  4EMI A;  1BZL A;  2CUL A;  2JB1 A;  4EIQ A;  5JCM A;  3D9X A;  1PJ5 A;  4G6G A;  1E1K A;  3NHO X;  5HXI A;  4EM4 A;  1DJQ A;  3UTF A;  1D7Y A;  2EQ9 A;  4A79 A;  3GSI A;  3IHG A;  2VZ2 A;  3CIR A;  2X99 A;  4BUR A;  2W0H A;  3AEC A;  3GMB A;  1NHQ A;  5GRT A;  1IUV A;  3DJG X;  3DJE A;  3PO7 A;  2XLS A;  2DKH A;  1FCD A;  4DSG A;  3KA7 A;  4U8K A;  2A87 A;  2CDU A;  2YM1 A;  1GRE A;  4YWO A;  3SQP A;  2EQ6 A;  5JCI A;  1DXL A;  4OPI A;  5IQ1 A;  3R9U A;  2X8H A;  1Q1W A;  4ICY A;  3H8L A;  2QAE A;  3CPI G;  3LXD A;  5CQF A;  2V6O A;  4EQR A;  3NTA A;  5U1O A;  1JRZ A;  1BGN A;  1P2E A;  1LPF A;  3FMW A;  1FOH A;  4OVI A;  3BNM A;  2BRA A;  3I3L A;  3NIX A;  4ZN0 A;  1ZX9 A;  3AYJ A;  2WES A;  1BGJ A;  4Z44 A;  1VQW A;  2BS3 A;  2IID A;  3QSE A;  4PAB A;  1GXF A;  2AR8 A;  4B68 A;  1IUX A;  3ICT A;  1S3E A;  4YTM A;  1L9E A;  4TLX A;  1ELI A;  2XFO A;  4CNK A;  1N4U A;  2C4C A;  5KMS A;  5BRT A;  3P1W A;  4EQX A;  1VDC A;  1PHH A;  4A99 A;  4CY8 A;  2YVF A;  1UKV G;  1GRH A;  4USR A;  2Q0L A;  2XVJ A;  4LA1 A;  2QA2 A;  1OJC A;  3FPZ A;  4DGK A;  2EQ7 A;  4Z25 A;  4NNJ A;  3NTD A;  1NG4 A;  3AB1 A;  1TRB A;  1NAA A;  3CPJ G;  2OAM A;  3GWD A;  4ECH A;  1KDG A;  2YR4 A;  3DA1 A;  1COY A;  4J36 A;  4XXG A;  4CY6 A;  3SX6 A;  1DJN A;  1YY5 A;  3K7T A;  3NN0 X;  4BJZ A;  1XAN A;  2E5V A;  2JAE A;  1YQ3 A;  3AE5 A;  2ZZC A;  3NLC A;  4G74 A;  1B37 A;  2BK5 A;  3UKQ A;  2Y6R A;  2B7S A;  5KWF A;  1IUU A;  4II3 A;  5KVI A;  2VQB A;  3DGZ A;  4U2T A;  5C2T A;  2F5Z A;  4K5S A;  1JNZ A;  2XFQ A;  4B1B A;  3DME A;  1SEZ A;  1NHP A;  4FX9 A;  3UKH A;  3NK0 X;  3P4P A;  3K30 A;  1Y0P A;  1YQ4 A;  3PS9 A;  1OJA A;  4J34 A;  1S3B A;  1JRX A;  2GAH B;  3I6D A;  3RED A;  3GRT A;  2E1M A;  4H2Q A;  4D03 A;  5EB5 A;  1DOD A;  4G73 A;  1EL7 A;  2R0G A;  4LU6 A;  5IQ4 A;  3P4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...