5JCLA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
432
structure length
429
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPAPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFYSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Oxidoreductase
molecule keywords Os09g0567300 protein
total genus 136
structure length 429
sequence length 432
chains with identical sequence B
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jclA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jclA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jclA02
1N1PA 1GRHA 3KU9A 1VG9A 3NK2X 1OJAA 3AD9B 4XXGA 2BACA 3AEEA 4PABA 1GSNA 4NEVA 3FBSA 3BHFA 5IQ4A 4A79A 1K0IA 3G5SA 4GDEA 1FEBA 3AE9A 4JN9A 3GD4A 1EBDA 3NH3X 1MXTA 2WOIA 2TPRA 1E1KA 2FJAA 2XFPA 3S5WA 4A65A 1L0VA 3BI4A 3IWAA 2B9WA 1IJHA 1RSGA 3DK4A 2XFOA 3SGLA 2HQMA 3O0HA 5FS7A 3FPZA 4X9NA 3AE1A 1DXLA 4EIPA 3CNTA 3DJEA 3IC9A 4EMIA 4OPUA 3RP6A 4U8NA 1ZP0A 2GMJA 4B69A 4EMWA 1XDIA 1Y56A 4DSHA 3C4NA 2X8GA 2XFNA 2R0CA 4K2XA 2JB3A 2R0GA 4CY8A 1OJCA 3GSIA 3QSMA 4PAAA 1JRZA 2C73A 5HHFA 4CCRA 3D8XA 3CGCA 3I6DA 2YWLA 2V6OA 2C7GA 3AD8B 4BK2A 2EQ7A 1ZOYA 4JQ9A 1GTEA 1NHPA 3NG7X 2XVIA 1KF6A 1Q1WA 3AXBA 4BJYA 1XHCA 1RP0A 4BK1A 1H84A 1E1NA 3UCLA 3ICTA 4Z2RA 2C75A 4BV6A 2YG7A 1GESA 2GAGB 4B63A 2X8HA 2IVDA 1BGJA 4IA5A 3B6DA 4C77A 4YKGA 5EB4A 1GREA 3NYFA 4J34A 5U63A 1Z6LA 2R0PA 2XVHA 3DGHA 4YT0A 1FECA 3EF6A 2JB2A 2GRTA 4FX9A 4UDPA 3AEFA 1NENA 2PYXA 3NLCA 4YTNA 3S61A 2C3DA 2ZZ0A 2VRLA 3UP4A 1D4DA 2I0ZA 2GQWA 2C70A 3CPIG 3UTGA 2BXSA 1PDHA 2EQ8A 1XANA 4E0VA 2WBAA 1O5WA 5KWFA 2RGHA 4CBQA 1GNDA 2OLNA 3P9UA 2ZZBA 3RHAA 1AOGA 1ZDLA 3ZYXA 4AP1A 3URHA 3VRDB 3DGZA 2CULA 3Q9TA 3AYIA 1H82A 4EQWA 1GERA 2Y6RA 2X99A 2V3BA 4B67A 3V76A 3OZ2A 1D7YA 1JOAA 2A8XA 3LADA 1GT8A 2BS2A 4H2QA 1TDFA 2RGOA 1LTXR 3EPTA 4EQXA 1S2QA 3GMCA 5KXJA 1DOEA 5BVAA 4NEWA 2GV8A 4U8IA 1D4EA 5GSNA 1LPFA 2VQBA 2Q0KA 1GRAA 1CL0A 2O9ZA 3NGCX 4U8KA 1H7XA 1FL2A 2YQUA 4BURA 4DNAA 2FJBA 4Y4NA 3JSKA 2DKHA 2YLTA 4RG4A 4FDCB 3AEBA 1V59A 4H4YA 1B37A 3NIXA 1COYA 2C66A 4FK1C 2YVFA 4K5RA 3LOVA 3QVRA 4OPLA 2J3NA 1EL9A 3AE7A 4ICYA 2X8CA 4OVIA 3VR8A 1GETA 2BCPA 1JEHA 1NHRA 4U2TA 2XLSA 4ECHA 2YM1A 2YVJA 2WHDA 3BNUA 1LVLA 3SFEA 4YSYA 3BI5A 5IQ1A 1IUUA 4HA6A 5FS6A 4H4XA 4J31A 2ZBWA 1CJ4A 4GRTA 2XFUA 4A6NB 1N4VA 1CHUA 2XDOA 1KSSA 4OPDA 4U8OA 4RG3A 4OPGA 3IF9A 5CQFA 4D03A 2H88A 1Y0PA 4K8DA 2DKIA 1TDOA 4JY3A 4TLZA 3AE4A 3M13A 4USQA 5LV9A 2C67A 1YQ3A 3AYJA 4Z43A 1ZKQA 2WU5A 1VG0A 2BYBA 1PN0A 4JNQA 4YTPA 2YG4A 3UKFA 2WESA 2PHHA 2JB1A 2EQ9A 2WS3A 2Z5XA 4UP3A 1D7LA 1B8SA 3QJ4A 3DJGX 4EM4A 2BXRA 1L9DA 4A99A 1GV4A 5HYMA 4U8MA 2V5ZA 1F8RA 4N9XA 4YXDA 4H4PA 4Z26A 1EL7A 2FJDA 3CGBA 3FIMB 3M12A 3AEGA 4YSHA 5M0ZA 2C76A 3KD9A 4I58A 1ELIA 1F6MA 2VQ7A 3G5QA 4H4TA 4CNJA 2VVMA 1RYIA 1B4VA 4APNA 3VQRA 2Y6QA 5U25A 1E1LA 4EIQA 3NRNA 3UKPA 1TRBA 1W4XA 2B9YA 2WDQA 2X3NA 2XLPA 1BF3A 3F8DA 1H86A 3LXDA 4EM3A 3ICRA 1PBDA 1KSUA 2IIDA 3L1RA 1P2HA 4K22A 4JNAA 1NPXA 1CF3A 3AYLA 3NN6X 3M0OA 5KOXA 2BABA 1S3BA 2V3AA 4D04A 3ALJA 5KVIA 1B5QA 4WX1A 4EQRA 2JK6A 2VVLG 5JCIA 3QSSA 5M10A 2ARDA 3UKHA 4UDRA 1BZLA 4LA1A 1DODA 1FOHA 2XFQA 2E5VA 1TYPA 2GR3A 3BNMA 4H7UA 4Y4MA 2GQFA 1ZK7A 2YAUA 4A7AA 3WE0A 5TR3A 3FG2P 1BWCA 4GR1A 1H81A 1GPEA 2WQYA 4AOXA 4C3YA 2C3CA 1NHSA 2YVGA 1PBFA 2XYOA 1F8WA 5FMHA 2F5ZA 3ISHA 3RP7A 4ZCCA 2BS4A 3NYEA 3UTEA 5EBKA 3G5RA 4M52A 4Z2TA 4AOSA 1PJ5A 2GR1A 3P4PA 3D1CA 3QVPA 5DBJA 1YQ4A 3DK9A 4U8LA 2GVCA 2QA2A 3KKJA 1L9EA 4DSGA 4H4QA 1OJ9A 4RSLA 3VR9A 1ZY8A 1E39A 2R9ZA 5JCNA 2ACZA 4TM3A 3K30A 4CY6A 1TDKA 2C72A 3CTYA 2BS3A 1D4CA 1PHHA 2AQJA 4FK1A 1E6EA 2EQ6A 1GALA 4U2SA 3BHKA 4P9SA 3DJDA 1K4QA 2GB0A 3ZDNA 2GEWA 1M6IA 3LB8A 1ZX9A 5EB5A 4A5LA 2WP6A 1TDEA 4H4UA 2BC1A 1KNPA 4X9MA 5J7XA 4CCQA 1GTHA 1NG3A 1CJ2A 4GDPA 1QJDA 1MO9A 1BKWA 4TM4A 3GRSA 1ZMDA 2CDUA 1ZMCA 2YR5A 2A89A 4NZHA 1NG4A 2R45A 3IHMA 1E7PA 2WP9A 4NTDA 5BULA 2WPFA 1GRGA 4USRA 1JNZA 3K7MX 3PO7A 4H2NA 5J60A 2WETA 3AEAA 2BK5A 2Q6UA 4IA6A 4J33A 3KVEA 1CJCA 3QSEA 2CFYA 1YKJA 2JKCA 4H4SA 1EL8A 3AE2A 2XVEA 3NKSA 2WOVA 3GDPA 3GWFA 1IUSA 1JRYA 3RNMA 3V3NA 3AE6A 5IPYA 2VOUA 1F3PA 3NN0X 2APGA 2OAMA 2TMDA 3LZXA 4B65A 1JU2A 1L9CA 1PXCA 4J36A 4XWZA 1TYTA 4IVMB 1DOCA 2GH5A 3SM8A 1YY5A 3R9UA 3UP5A 1K0LA 3UTFA 3UOVA 3AWIA 4C5OA 1P2EA 4Z24A 5BUKA 2QA1A 3NYCA 4K7ZA 4A9WA 4AP3A 3GYJA 1PXAA 4YKFA 4NTEA 5KOWA 2V61A 3EANA 1BGNA 3ATQA 4B1BA 2JBVA 2E1MA 3CPJG 3HZLA 5EOWA 2B7RA 3GWDA 3NNEA 4JY2A 4TM1A 1TDNA 2VVLA 2ZZCA 1KFYA 4I59A 1Q1RA 2WDRA 1MOKA 1NAAA 1QO8A 4LIIA 4CNKA 1CJ3A 2NPXA 2H89A 4JDRA 1H6VA 1OJTA 3B3RA 3UOXA 4KPRA 2GMHA 3H4KA 4U8JA 3F8RA 3CNPA 3UOYA 4U8PA 2V60A 3K7QX 2WPCA 2YLZA 5CKUA 1KDGA 1GXFA 3GYIA 2R46A 3IHGA 1FCDA 4OCGA 3EAOA 4REKA 4BJZA 1NHQA 4OPTA 1NDAA 4J56A 1IUVA 1CBOA 2XVJA 3KA7A 2NVKX 4EQSA 4YSZA 5U1OA 2XLUA 2BC0A 3NK0X 3QFAA 4ZCDA 3L8KA 1IUWA 4H50A 4ADWA 2A87A 2WEUA 2YG6A 3DA1A 4LU6A 3SFDA 4H2RA 3UKAA 3ADAB 4IVOB 2YR4A 4EMJA 1GRFA 3SQPA 2YLXA 3PS9A 3VRAA 3AB1A 2OLOA 2QCUA 4B64A 3BI2A 2WU2A 2UZZA 1ONFA 3CNJA 4AT0A 1PBEA 2YLSA 3C96A 4C3XA 2GAHB 2BCGG 2WOWA 1GRTA 3E1TA 5FS8A 1PJ6A 3CGDA 2FJEA 3CGEA 4Y4LA 2WPEA 3ALLA 3UKQA 2AAQA 3REDA 4Z2UA 5C2TA 1XPQA 3UTHA 4YTMA 3K7TA 4XWRA 2XLTA 5JCKA 1CC4A 1IUTA 4B66A 4DGKA 4KX6A 1DNCA 1GEUA 5JCMA 2JAEA 3Q6JA 1VRQB 4H4WA 4CRTA 4YWOA 2VZ2A 1LJ1A 3FMWA 2B76A 5FS9A 3NHOX 3CN8A 3AD7B 3KLJA 2YM2A 4O5QA 4X4JA 3P1WA 2RABA 3DK8A 1Y56B 2Q7VA 3CNSA 5GRTA 1PBBA 3PVCA 4YSXA 3ICSA 5HXIA 5HY5A 1H83A 2C64A 3H8IA 1GOSA 1OJDA 3RP8A 1HYUA 3CNDA 4Z25A 2VRMA 1E1MA 1YQZA 1O95A 1F8SA 1Q9IA 2XVFA 4OPIA 2AR8A 1PXBA 1N4WA 1PJ7A 5C3JA 2BK4A 3T37A 4WCTA 2YLRA 1UKVG 3LZWA 4O5UA 2QAEA 4TM0A 1SEZA 2YLWA 1N4UA 1S2YA 2Q0LA 4H4VA 4AT2A 2OALA 1DJQA 1H7WA 3ITJA 2GF3A 4HB9A 3VRBA 2BK3A 1VQWA 1M64A 1K0JA 2E4GA 2GR0A 3CIRA 3DH9A 4J2WA 1REOA 3ATRA 3P4RA 4NTCA 3H8LA 3UKKA 3COXA 1FEAA 1PBCA 1VDCA 3CPHG 4GCMA 5BRTA 1KNRA 4K5SA 4BK3A 3II4A 3DMEA 3AE3A 4Z44A 1QLBA 5JCLA 3AE8A 1JRXA 4UDQA 2C65A 4C74A 1LQTA 3P4QA 3NT6A 4H2PA 3F8PA 1X31B 2W0HA 1JNRA 4U2LA 4ZN0A 4B68A 3QFBA 3ABVA 3KPFA 4A6NA 1O94A 4MJWA 2Z5YA 4GF7A 4H4RA 1DJNA 2BA9A 2RGJA 2CVJA 2B7SA 3AECA 3GDNA 3LJPA 2WDVA 3I3LA 3OC4A 1EL5A 2XLRA 4GUVA 3GRTA 4H4ZA 2B9XA 2YG5A 4OPCA 1LQUA 1D5TA 2YR6A 1NEKA 2FBWA 3ALMA 3AEDA 5KVHA 2WP5A 1IUXA 1DOBA 2GR2A 3AE5A 4IV9A 4TLXA 1CC6A 1CC2A 2OA1A 3V3OA 3P4SA 5L46A 3NK1X 2R4JA 3DJJA 2R4EA 1GRBA 3C4AA 1S3EA 2X50A 3NTAA 3UKLA 2YG3A 3UOZA 3GMBA 1LV0A 5KRQA 4J57A 1ZOVA 2IVEA 2XCGA 3NTDA 5ER0A 1PS9A 3GD3A
chains in the Genus database with same CATH superfamily
3FVDA 1VG9A 4DXKA 3AD9B 4G9KA 3AEEA 4NEVA 1FEBA 3GD4A 1EBDA 3NH3X 3UXKA 1MXTA 2TPRA 1E1KA 4KEMA 2B9WA 1RSGA 4E4UA 5FS7A 3R25A 3CNTA 2PMQA 3IC9A 3RP6A 1WUFA 4IP4A 4B69A 3B97A 3TTEA 2R0CA 2E5AA 2R0GA 4CY8A 4K8GA 3D8XA 1EC9A 4ZOHB 3UCDA 3AD8B 4J3ZA 4JQ9A 1NHPA 1GTEA 2XVIA 3AXBA 3SYIA 1XHCA 1H84A 2C75A 3SXIA 2YG7A 1JRPA 4YKGA 3HYWA 1Z6LA 2R0PA 2W54A 3EF6A 2GRTA 3UGVA 1NENA 4YTNA 3SBFA 3S61A 3DFYA 1N5WC 3UP4A 3SN1A 2GQWA 4E0VA 5KWFA 2RGHA 1GNDA 3VRDB 1FIQB 2V3BA 4B67A 3V76A 2O56A 1JOAA 2BS2A 3TWBA 3GMCA 5KXJA 1DOEA 1FFVC 4NEWA 4U8IA 2VQBA 3IJQA 4BURA 2FJBA 3JSKA 3R07C 1COYA 4K5RA 1EL9A 3AE7A 3VR8A 1GETA 4U2TA 2XLSA 4ECHA 2YVJA 2WHDA 1LVLA 4H4XA 4GRTA 2XFUA 1W6TA 2XDOA 4OPGA 5CQFA 1TDOA 4USQA 3AYJA 4II2A 1ZKQA 4Z43A 2WESA 2OO6A 1B8SA 2POZA 2OQYA 5HYMA 2W3RA 3T2YA 4YXDA 2FJDA 3M12A 1ELIA 1ELSA 3R0UA 3FJ4A 3BSMA 1BF3A 3ICRA 2IIDA 3SX6A 3JVAA 1OEPA 2W3SA 2V3AA 4TVYA 3ALJA 1B5QA 1P43A 1BZLA 4LA1A 2XFQA 1TYPA 4Y4MA 2FYMA 4H7UA 1ZK7A 4AOXA 5BOEA 2YVGA 4A6GA 2PS2A 2BS4A 3NYEA 5EBKA 1KN0A 2QJNA 2GR1A 3D1CA 3QVPA 3KKJA 1L9EA 1OJ9A 3VR9A 2R9ZA 5JCNA 3MUCA 3STPA 1TDKA 3MZNA 3IJLA 2BRAA 3DJDA 2BC1A 2OQHA 1CJ2A 4GDPA 4E6MA 1BKWA 3GRSA 2YR5A 2A89A 1GRGA 6ENLA 4USRA 5J60A 2BK5A 3VA8A 3KVEA 1CJCA 3T37A 1WUEA 1F3PA 1T3QC 2APGA 4XWZA 3SM8A 1YY5A 3KPKA 1SJAA 4Z24A 4H19A 3T2KA 4A9WA 4AP3A 3GYJA 3MWCA 4NTEA 1BGNA 3ES7A 2E1MA 3CPJG 3GWDA 1FO4A 4JY2A 2XH4A 3V5CA 2MUCA 1Q1RA 3T8QA 1MOKA 4HN8A 1QO8A 1CJ3A 2NPXA 3B3RA 3DGBA 3CNPA 3UOYA 3RITA 2V60A 2WPCA 5CKUA 3IHGA 1GXFA 2R46A 1NHQA 4J56A 3T9PA 2NVKX 4EQSA 4YSZA 3H8AA 3QFAA 2A87A 2WEUA 4LU6A 4G73A 3ZLHA 3PS9A 3VRAA 2WU2A 2YLSA 2GAHB 2BCGG 3E1TA 2FJEA 2OKTA 1XPQA 3K7TA 3ETRB 4B66A 1X2GA 3A7UA 1GEUA 3OP2A 2VZ2A 1LJ1A 3RRAA 2OZ8A 2B76A 3CN8A 3V4BA 3T4WA 2YM2A 2QDEA 3DK8A 3PVCA 1H83A 3RP8A 4Z25A 2VRMA 1YQZA 1F8SA 3SN4A 1Q9IA 4OPIA 3ZVHA 1PXBA 2AR8A 1N4WA 2AKMA 4GIRA 2YLRA 1UKVG 3LZWA 3T2ZA 4AT2A 2OALA 3VRBA 2GF3A 4K2SA 1JDFA 1KKRA 1VDCA 1N5XA 1XS2A 4MKSA 3H12A 4BK3A 2HXTA 2OZ3A 4HCLA 5JCLA 4UDQA 4DWDA 4C74A 3P4QA 4U2LA 3OZYA 3ABVA 2Z5YA 4GF7A 4H4RA 2BA9A 2RGJA 3AECA 3LJPA 3T6CA 2WDVA 3I3LA 4H4ZA 2YG5A 3ALMA 3AEDA 3NO1A 3AE5A 2R4JA 3N4EA 3C4AA 2X50A 1ZOVA 3NTDA 5ER0A 1N1PA 3KU9A 4XXGA 4PABA 3JW7A 3FBSA 3BHFA 5IQ4A 4A79A 4GDEA 1YEYA 4JN9A 2XFPA 1H2IA 1L0VA 2DW6A 3IWAA 3DK4A 3HW2A 2XFOA 3SGLA 3O0HA 4DX3A 1XDIA 4F4RA 2JB3A 3GSIA 4PAAA 3CGCA 3NVZB 2C7GA 1ZOYA 4YWSA 1Q1WA 3GY1A 1E1NA 4BV6A 1BGJA 3B6DA 4C77A 3VCNA 4HNLA 1GREA 3NYFA 5U63A 4YT0A 4HCHA 2JB2A 4UDPA 2ZZ0A 2VRLA 2PP1A 2QGYA 3UTGA 2BXSA 5ENLA 2WBAA 1O5WA 4CBQA 4GMEA 1AOGA 4ZA0A 1KKOA 4AP1A 3DERA 3Q9TA 3AYIA 3D46A 1D7YA 3LADA 4FI4A 2RGOA 3DIPA 1WYGA 2GV8A 3NGCX 2YQUA 2YLTA 3VC6A 4RG4A 3AEBA 3R1ZA 4H4YA 2PPGA 3S47A 2YVFA 4E5TA 2C4CA 2OX4A 3QVRA 4OPLA 2J3NA 4ICYA 1EC7A 3ZVIA 2W55A 2BCPA 4IZGA 3SZCA 2YM1A 3ZLFA 3BNUA 2RDXA 5FS6A 2ZBWA 3GO2A 1SJDA 1KSSA 4U8OA 3IF9A 4D03A 2H88A 1Y0PA 2PP0A 3U4FA 3AE4A 2P8CA 1VG0A 2BYBA 3JZUA 3K1GA 5KMQA 3V3WA 3UKFA 2JB1A 2EQ9A 2Z5XA 4GGBA 4GYPA 1L9DA 4A99A 1GV4A 3I4KA 4Z26A 1EL7A 3CGBA 1PDZA 3AEGA 4HNCA 4CNJA 1X2HA 2VVMA 1VQZA 4APNA 2WDQA 1H86A 3H7VA 1BKHA 4EM3A 1PBDA 1KSUA 3L1RA 3UCCA 5KOXA 4EQRA 2JK6A 5JCIA 5M10A 2OPJA 1DODA 2E5VA 1GPEA 3R10A 1P48A 1NHSA 1PBFA 3RP7A 3UTEA 2GL5A 2PGWA 2OZTA 1YQ4A 3MKCA 4H4QA 1ZY8A 2ACZA 4G8TA 2AQJA 5FJPA 4U2SA 4P9SA 3NFUA 3AMZA 1M6IA 4A5LA 2WP6A 4GISA 3THUA 4CCQA 1NG3A 1QJDA 1MO9A 3CMMA 3SQSA 2CDUA 2R45A 3IHMA 5BULA 3BJSA 2P8BA 2QDDA 1JNZA 3EUB3 3AEAA 4J33A 3Q45A 3QSEA 2CFYA 2JKCA 4H4SA 1EL8A 2XVEA 3GDPA 3GWFA 1IUSA 3RNMA 3AE6A 2HZGA 2OAMA 2TMDA 3LZXA 1PXCA 4IVMB 2GH5A 3UTFA 3UOVA 3AWIA 4C5OA 1P2EA 2QA1A 3NYCA 4K7ZA 3EANA 4B1BA 3UXLA 3SY4A 5EOWA 4IP5A 2VVLA 3GYXA 2WDRA 3NXLA 1NAAA 3UJRA 2H89A 1BQGA 4KPRA 2GMHA 4U8JA 3UJEA 2YLZA 5BOFA 4OCGA 4REKA 3EAOA 3KA7A 5U1OA 2XLUA 3NK0X 2YG6A 4ADWA 4AT0A 3UKAA 4IVOB 2FKPA 4EMJA 3N4FA 4B64A 1ONFA 2P0IA 3C96A 1DTNA 2WOWA 5FS8A 3CGDA 4H1ZA 1VDVA 4DHGA 4KX6A 2PTYA 2JAEA 1VRQB 3FMWA 3A7AA 3AD7B 4O5QA 2Q7VA 3TOYA 5GRTA 1PBBA 3CXBA 5HY5A 3H8IA 1GOSA 2XH2A 3CNDA 1E1MA 1O95A 3L5OA 2AL2A 4WCTA 3S5SA 5FJUA 1S2YA 2Q0LA 4H4VA 4HB9A 3ITJA 1VQWA 4GYPC 2GR0A 3CIRA 3DH9A 4NTCA 1REOA 3ATRA 3UKKA 3H8LA 3COXA 1FEAA 1PBCA 4GCMA 3R0KA 2AL2B 1KNRA 3AE3A 3AE8A 2PODA 3A7RA 3RO6A 1V97A 1MDRA 4A6NA 3VFCA 4MJWA 3NVWB 2CVJA 4GUVA 3GDNA 3GRTA 1NEKA 2FBWA 4GAVA 5KVHA 2WP5A 2OA1A 3V3OA 5L46A 4DN1A 4JN8A 3DJJA 2R4EA 1GRBA 3GD6A 2YG3A 1LV0A 3OPSA 3GD3A 1GRHA 3DESA 3NK2X 3TCSA 1K0IA 3G5SA 3FCPA 3QPEA 3S5WA 3AE1A 3OZMA 4EIPA 3CYJA 3DJEA 4EMIA 4U8NA 3HYVA 1Y56A 4DSHA 2XFNA 2MNRA 1OJCA 4E4FA 5HHFA 4CCRA 2GDQA 3I6DA 4J1OA 2YWLA 2V6OA 4A3RA 2EQ7A 3EKGA 4BK1A 2QJMA 1GESA 4B63A 2X8HA 4FP1A 3QKEA 2XVHA 3FXGA 4Z1YA 4FX9A 3NLCA 3SR6B 1D4DA 2C70A 4Z17A 3MQTA 1PDHA 2EQ8A 2GSHA 2OLNA 3RHAA 3ZYXA 1ECQA 2PA6A 3DGZA 2CULA 1GERA 2X99A 2PP3A 2A8XA 2HXUA 4H2QA 1TDFA 3EPTA 4EQXA 4GGHA 1FHUA 3SN0A 5GSNA 1LPFA 4HYRA 1JROA 2Q0KA 1GRAA 1CL0A 4U8KA 3D9XA 5JRBA 4DNAA 4GAPA 4Y4NA 2DKHA 4FDCB 1B37A 2C66A 4FK1C 4OVIA 4M6UA 3SFEA 4YSYA 4HA6A 4J31A 1CJ4A 4A6NB 1N4VA 1CHUA 2DKIA 4TLZA 5LV9A 3M13A 3P3BA 2C67A 3DFHA 1YQ3A 2WU5A 3TJ4A 4JNQA 4YTPA 2PHHA 2WS3A 1D7LA 2GGIA 3QJ4A 3DJGX 3TQPA 4U8MA 4N9XA 4MMWA 5M0ZA 2OVLA 3KD9A 1F6MA 3G5QA 4H4TA 2PCEA 1RYIA 3VQRA 3UKPA 1TRBA 2X3NA 2XLPA 3F8DA 4JNAA 1NPXA 3U9IA 1CF3A 3NN6X 3ES8A 1MDLA 3VDGA 2BABA 4D04A 2VVLG 4NNJA 3UJSA 1N60C 3SJNA 2GR3A 2GQFA 3CAWA 3WE0A 1EBHA 5TR3A 1BWCA 2WQYA 3AM9A 3NRZB 4C3YA 2PGEA 2HNEA 4ZCCA 5IDZA 3G5RA 4JN7A 3N6HA 1PJ5A 5DBJA 4X2PA 4DSGA 4TM3A 3K30A 2ZC8A 4CY6A 3DG7A 1PDYA 2C72A 3CTYA 2BS3A 1PHHA 1E6EA 1TE6A 2P88A 1GALA 3BHKA 3ZDNA 2GEWA 3LB8A 1TDEA 4H4UA 1KNPA 3ENLA 1ZMDA 4KPLA 4NZHA 1NG4A 4ENLA 2WP9A 4NTDA 2WPFA 2OG9A 3PK7A 3UJFA 2WETA 2Q6UA 1YKJA 3V3NA 5IPYA 2VOUA 3SZWA 3NN0X 4B65A 1L9CA 4J36A 1TYTA 3UP5A 3R9UA 4KWSA 3FYYA 1ZXIC 4NWZA 5BUKA 1F9CA 2CHRA 5KOWA 3ATQA 2JBVA 2B7RA 3NNEA 4TM1A 3UJ2A 5FJTA 1NELA 4LIIA 4CNKA 4JDRA 1H6VA 3PWIA 3DDMA 5G5HB 3F8RA 1L8PA 4ROPA 4OPTA 2OLAA 1NDAA 1IUVA 1CBOA 2XVJA 4IT1A 1E9IA 2BC0A 2GGHA 1IUWA 3DA1A 2YR4A 1GRFA 3SQPA 2YLXA 2OLOA 2QCUA 2UZZA 4C3XA 3NZGA 3TW9A 1PJ6A 4IHCA 2WPEA 3ALLA 2AAQA 3REDA 2XLTA 1CC4A 1KD0A 4DGKA 1DNCA 2GGGA 5JCMA 3Q6JA 4CRTA 3DEQA 3CT2A 1SB3B 3KLJA 4X4JA 4G6HA 4YSXA 3ICSA 2C64A 1HYUA 2BK4A 4TM0A 3D47A 2QQ6A 1EC8A 1SEZA 1N4UA 1DJQA 1S7MA 1H7WA 2BK3A 1M64A 3T14A 3SSZA 1K0JA 2E4GA 4J2WA 3P4RA 3CPHG 5J04A 4K5SA 3II4A 1QLBA 3AN1A 4H2PA 3F8PA 4B68A 1O94A 1JPDX 2B7SA 3OC4A 4OPCA 2PU0A 2ZADA 1D5TA 2YR6A 4G6GA 4IV9A 1FFUC 1CC2A 2XSXA 4TVWA 2XH0A 3UKLA 3B9JB 3UOZA 3GMBA 5KRQA 2GGEA 2XCGA 1PS9A 1OJAA 2BACA 1GSNA 3AE9A 1TKKA 4A35A 2WOIA 1IYXA 2FJAA 1MRAA 4A65A 3BI4A 1IJHA 2HQMA 3FPZA 4X9NA 1DXLA 4OPUA 1ZP0A 2GMJA 4EMWA 5KMRA 3C4NA 2X8GA 4K2XA 3QSMA 1JRZA 4ZCWA 2C73A 4MGGA 5G5GB 7ENLA 4BK2A 3NG7X 1KF6A 4BJYA 1RP0A 3UCLA 3ICTA 4Z2RA 2GAGB 2IVDA 1ONEA 4IA5A 5EB4A 4J34A 2I5QA 3DGHA 1FECA 3AEFA 4IL2A 1N63C 3N6JA 2PYXA 2C3DA 2I0ZA 3CPIG 1XANA 3P9UA 2ZZBA 3CXOA 4KT2A 1ZDLA 3T31A 3URHA 3DG6A 1H82A 4EQWA 2Y6RA 3CK5A 3RGTA 3OZ2A 1GT8A 4G74A 3NS1B 1LTXR 5EU9A 1S2QA 3ZLGA 1XPYA 5BVAA 1NU5A 4K1WA 3KUMA 1D4EA 3OW1A 2O9ZA 1FL2A 1H7XA 1V59A 3NIXA 3DG3A 3LOVA 2X8CA 2PTWA 1JEHA 1NHRA 3BI5A 1SJCA 5IQ1A 2OFJA 1IUUA 4OPDA 4RG3A 3HYXA 4JY3A 4K8DA 1PN0A 2YG4A 4UP3A 4EM4A 2PU1A 2BXRA 2V5ZA 1F8RA 4H4PA 3FIMB 4YSHA 2C76A 4I58A 2VQ7A 1B4VA 5FJOA 2Y6QA 5U25A 1E1LA 4EIQA 2BRYA 2PTXA 3NRNA 1W4XA 2B9YA 3OTRA 3LXDA 1MUCA 1P2HA 4K22A 3PWGA 3AYLA 3Q4DA 3M0OA 1STZA 3PG6A 1S3BA 5KVIA 4WX1A 3QSSA 2ARDA 3UKHA 4UDRA 4EWJA 2XH7A 3NVVB 2QVHA 1FOHA 3BNMA 1RVKA 2YAUA 4A7AA 3FG2P 4G7FA 4GR1A 1H81A 2C3CA 2XYOA 1F8WA 5FMHA 2F5ZA 3ISHA 2AL1A 4M0XA 4M52A 4Z2TA 4AOSA 3P4PA 3QTPA 4U8LA 3DK9A 2GVCA 1RM6B 2QA2A 4RSLA 1E39A 3H70A 3QN3A 5KMPA 1D4CA 4FK1A 2EQ6A 3QLDA 1K4QA 2GB0A 3PFRA 3T0KA 1ZX9A 5EB5A 1N61C 3MSYA 4X9MA 3GC2A 5J7XA 1GTHA 4II3A 4E8GA 4TM4A 4H2HA 1ZMCA 2QJJA 3VC5A 1E7PA 3K7MX 3PO7A 4H2NA 3NKSA 4IA6A 3AE2A 4GFIA 4DYEA 2WOVA 3NVYB 1JRYA 1JU2A 3TWAA 1DOCA 1K0LA 3IK4A 1R6WA 1PXAA 4YKFA 2V61A 5KMSA 3HZLA 3EEZA 4HPNA 1TDNA 2ZZCA 1KFYA 4I59A 3SZFA 1JPMA 3HPFA 1OJTA 3UOXA 2PSNA 3I6EA 3H4KA 4U8PA 3K7QX 3SZ0A 2GGJA 1KDGA 3GYIA 1FCDA 4BJZA 3P93A 1MNSA 3R11A 1EBGA 4ZCDA 3L8KA 3SFDA 4H50A 4HCDA 4H2RA 3ADAB 3AB1A 3BI2A 3CNJA 1PBEA 1GRTA 5FJRA 3CGEA 4Y4LA 3UKQA 4Z2UA 5C2TA 3UTHA 4YTMA 4XWRA 1N62C 5JCKA 1IUTA 3MY9A 3CB3A 4H4WA 4YWOA 1KCZA 2DW7A 3NHOX 5FS9A 3ZVHB 3TJIA 3P1WA 2RABA 1FHVA 1Y56B 3CNSA 5HXIA 3P0WA 3FV9A 2PTZA 3I6TA 1OJDA 3RR1A 2XVFA 1PJ7A 5C3JA 1JCTA 4O5UA 2QAEA 2YLWA 3BOXA 4IL0A 5BRTA 3RCYA 3DMEA 4Z44A 1JRXA 2C65A 3V5FA 1LQTA 3NT6A 1TZZA 1R0MA 1X31B 2W0HA 1JNRA 4ZN0A 4JHMA 1SJBA 4H83A 3QFBA 2P3ZA 3KPFA 1DJNA 2NQLA 3VCCA 3HRDC 1EL5A 2XLRA 2B9XA 1LQUA 5KNLA 1IUXA 1DOBA 2GR2A 2E3TA 4TLXA 3IJIA 1CC6A 3P4SA 3NK1X 2ONEA 2XGZA 1S3EA 3NTAA 2AKZA 4J57A 2IVEA
chains in the Genus database with same CATH topology
1N1PA 1GRHA 3KU9A 1VG9A 3NK2X 1OJAA 3AD9B 4G9KA 4XXGA 2BACA 3AEEA 4PABA 1GSNA 4NEVA 3FBSA 3BHFA 5IQ4A 4A79A 1K0IA 3G5SA 4GDEA 1FEBA 3AE9A 4JN9A 3GD4A 1EBDA 3NH3X 1MXTA 2WOIA 2TPRA 1E1KA 2FJAA 2XFPA 3S5WA 4A65A 1H2IA 1L0VA 3BI4A 3IWAA 2B9WA 1IJHA 1RSGA 3DK4A 2XFOA 3SGLA 2HQMA 3O0HA 5FS7A 3FPZA 4X9NA 3AE1A 1DXLA 4EIPA 3CNTA 3DJEA 3IC9A 4EMIA 4OPUA 3RP6A 4U8NA 1ZP0A 2GMJA 4B69A 4EMWA 3HYVA 1XDIA 5KMRA 1Y56A 4DSHA 3C4NA 2X8GA 2XFNA 2R0CA 4K2XA 2JB3A 2R0GA 4CY8A 1OJCA 3GSIA 3QSMA 4PAAA 1JRZA 2C73A 5HHFA 4CCRA 3D8XA 3CGCA 3I6DA 2YWLA 2V6OA 2C7GA 3AD8B 4BK2A 2EQ7A 1ZOYA 4JQ9A 1GTEA 1NHPA 3NG7X 2XVIA 1KF6A 1Q1WA 3AXBA 3SYIA 1XHCA 1RP0A 4BJYA 4BK1A 1H84A 1E1NA 3UCLA 3ICTA 4Z2RA 2C75A 4BV6A 3SXIA 2YG7A 1GESA 2GAGB 4B63A 2X8HA 2IVDA 1BGJA 4IA5A 3B6DA 4C77A 4YKGA 5EB4A 1GREA 3NYFA 4J34A 5U63A 3HYWA 1Z6LA 2R0PA 2XVHA 3DGHA 4YT0A 1FECA 3EF6A 2JB2A 2GRTA 4FX9A 4UDPA 3AEFA 1NENA 2PYXA 3NLCA 4YTNA 3S61A 2C3DA 2ZZ0A 2VRLA 3UP4A 1D4DA 2I0ZA 2GQWA 2C70A 3CPIG 3UTGA 2BXSA 1PDHA 2EQ8A 1XANA 4E0VA 2WBAA 1O5WA 5KWFA 2RGHA 4CBQA 1GNDA 2OLNA 3P9UA 2ZZBA 3RHAA 1AOGA 1ZDLA 3T31A 3ZYXA 4AP1A 3URHA 3VRDB 3DGZA 2CULA 3Q9TA 3AYIA 1H82A 4EQWA 1GERA 2Y6RA 2X99A 2V3BA 4B67A 3V76A 3OZ2A 1D7YA 1JOAA 2A8XA 3LADA 1GT8A 4G74A 2BS2A 4H2QA 1TDFA 2RGOA 1LTXR 3EPTA 4EQXA 1S2QA 3GMCA 5KXJA 1DOEA 5BVAA 4NEWA 2GV8A 4U8IA 1D4EA 5GSNA 1LPFA 2VQBA 2Q0KA 1GRAA 1CL0A 2O9ZA 3NGCX 4U8KA 1FL2A 1H7XA 3D9XA 2YQUA 4BURA 5JRBA 4DNAA 2FJBA 4GAPA 4Y4NA 3JSKA 2DKHA 2YLTA 4RG4A 4FDCB 3AEBA 1V59A 4H4YA 1B37A 3NIXA 1COYA 2C66A 4FK1C 2YVFA 2C4CA 3LOVA 3QVRA 4K5RA 4OPLA 2J3NA 1EL9A 3AE7A 4ICYA 2X8CA 4OVIA 3VR8A 1GETA 2BCPA 1JEHA 1NHRA 4U2TA 2XLSA 3SZCA 4ECHA 2YM1A 2YVJA 2WHDA 3BNUA 1LVLA 3SFEA 4YSYA 3BI5A 5IQ1A 1IUUA 4HA6A 5FS6A 4H4XA 4J31A 2ZBWA 1CJ4A 4GRTA 2XFUA 4A6NB 1N4VA 1CHUA 2XDOA 1KSSA 4OPDA 4U8OA 4RG3A 4OPGA 3IF9A 5CQFA 4D03A 2H88A 1Y0PA 4K8DA 2DKIA 1TDOA 3HYXA 4JY3A 3AE4A 3M13A 4TLZA 4USQA 5LV9A 2C67A 1YQ3A 3AYJA 4II2A 1ZKQA 4Z43A 2WU5A 1VG0A 2BYBA 1PN0A 4JNQA 3SFDA 4YTPA 5KMQA 2YG4A 3UKFA 2WESA 2PHHA 2JB1A 2EQ9A 2WS3A 2Z5XA 4UP3A 1D7LA 1B8SA 3QJ4A 3DJGX 4EM4A 2BXRA 1L9DA 4A99A 1GV4A 5HYMA 4U8MA 2V5ZA 1F8RA 3T2YA 4N9XA 4YXDA 4H4PA 4Z26A 1EL7A 2FJDA 3CGBA 3FIMB 3M12A 3AEGA 4YSHA 5M0ZA 2C76A 3KD9A 4I58A 1ELIA 1F6MA 2VQ7A 3G5QA 4H4TA 4CNJA 2VVMA 1RYIA 1B4VA 4APNA 3VQRA 2Y6QA 5U25A 1E1LA 4EIQA 2BRYA 3NRNA 3UKPA 1TRBA 1W4XA 2B9YA 2WDQA 2X3NA 2XLPA 1BF3A 3F8DA 1H86A 3LXDA 4EM3A 3ICRA 1PBDA 1KSUA 2IIDA 3L1RA 3SX6A 1P2HA 4K22A 4JNAA 1NPXA 1CF3A 3AYLA 3NN6X 3M0OA 5KOXA 3PG6A 2BABA 2V3AA 1S3BA 4D04A 3ALJA 5KVIA 1B5QA 4WX1A 4EQRA 2JK6A 2VVLG 5JCIA 3QSSA 4NNJA 2ARDA 5M10A 3UKHA 4UDRA 1BZLA 4LA1A 1DODA 1FOHA 2XFQA 2E5VA 1TYPA 2GR3A 3BNMA 4H7UA 4Y4MA 2GQFA 1ZK7A 2YAUA 4A7AA 3WE0A 5TR3A 3FG2P 1BWCA 4GR1A 1H81A 1GPEA 2WQYA 4AOXA 4C3YA 2C3CA 1NHSA 2YVGA 1PBFA 2XYOA 1F8WA 5FMHA 2F5ZA 3ISHA 3RP7A 4ZCCA 2BS4A 3NYEA 3UTEA 5EBKA 1KN0A 3G5RA 4M52A 4Z2TA 4AOSA 1PJ5A 2GR1A 3P4PA 3D1CA 3QVPA 5DBJA 1YQ4A 3DK9A 4U8LA 2GVCA 2QA2A 3KKJA 1L9EA 4DSGA 4H4QA 1OJ9A 4RSLA 3VR9A 1ZY8A 1E39A 2R9ZA 5JCNA 2ACZA 4TM3A 3K30A 4CY6A 1TDKA 2C72A 3CTYA 2BS3A 5KMPA 1D4CA 1PHHA 2AQJA 2BRAA 4FK1A 1E6EA 2EQ6A 1GALA 4U2SA 3BHKA 4P9SA 3DJDA 1K4QA 2GB0A 3ZDNA 2GEWA 1M6IA 3LB8A 3T0KA 1ZX9A 5EB5A 4A5LA 2WP6A 1TDEA 4H4UA 2BC1A 1KNPA 4X9MA 5J7XA 4CCQA 1GTHA 1NG3A 1CJ2A 4GDPA 1QJDA 4II3A 1MO9A 1BKWA 4TM4A 3CMMA 3GRSA 1ZMDA 2CDUA 1ZMCA 2YR5A 2A89A 4NZHA 1NG4A 2R45A 3IHMA 1E7PA 2WP9A 4NTDA 5BULA 2WPFA 1GRGA 4USRA 1JNZA 3K7MX 3PO7A 4H2NA 5J60A 2WETA 3AEAA 2BK5A 2Q6UA 4IA6A 4J33A 3KVEA 1CJCA 3QSEA 2CFYA 1YKJA 2JKCA 4H4SA 1EL8A 3AE2A 2XVEA 3NKSA 2WOVA 3GDPA 3GWFA 1IUSA 1JRYA 3RNMA 3V3NA 3AE6A 5IPYA 2VOUA 1F3PA 3SZWA 3NN0X 2APGA 2OAMA 2TMDA 3LZXA 4B65A 1JU2A 1L9CA 1PXCA 4J36A 4XWZA 1TYTA 4IVMB 1DOCA 2GH5A 3SM8A 1YY5A 3R9UA 3UP5A 1K0LA 3UTFA 3KPKA 3UOVA 3AWIA 4C5OA 1P2EA 4NWZA 4Z24A 5BUKA 2QA1A 3NYCA 3T2KA 4K7ZA 4A9WA 4AP3A 3GYJA 1PXAA 4YKFA 4NTEA 5KOWA 2V61A 3EANA 1BGNA 3ATQA 4B1BA 2JBVA 3SY4A 2E1MA 3CPJG 3HZLA 5EOWA 5KMSA 2B7RA 3GWDA 3NNEA 4JY2A 4TM1A 1TDNA 2VVLA 2ZZCA 3GYXA 1KFYA 4I59A 1Q1RA 2WDRA 1MOKA 1NAAA 1QO8A 4LIIA 3SZFA 4CNKA 1CJ3A 2NPXA 2H89A 4JDRA 1H6VA 1OJTA 3B3RA 3UOXA 4KPRA 2GMHA 3H4KA 4U8JA 3F8RA 3CNPA 3UOYA 4U8PA 2V60A 3K7QX 2WPCA 2YLZA 5CKUA 3SZ0A 1KDGA 1GXFA 3GYIA 2R46A 3IHGA 1FCDA 4OCGA 3EAOA 4REKA 4BJZA 1NHQA 4OPTA 1NDAA 4J56A 1IUVA 1CBOA 2XVJA 3KA7A 2NVKX 4EQSA 4YSZA 5U1OA 2XLUA 2BC0A 3NK0X 3QFAA 4ZCDA 3L8KA 1IUWA 4H50A 4ADWA 2A87A 2WEUA 2YG6A 3DA1A 4G73A 4LU6A 4H2RA 3UKAA 3ADAB 4IVOB 2YR4A 4EMJA 1GRFA 3SQPA 2YLXA 3PS9A 3VRAA 3AB1A 2OLOA 2QCUA 4B64A 3BI2A 2WU2A 2UZZA 1ONFA 3CNJA 4AT0A 1PBEA 2YLSA 3C96A 4C3XA 2GAHB 2BCGG 2WOWA 1GRTA 3E1TA 5FS8A 1PJ6A 3CGDA 2FJEA 3CGEA 4Y4LA 2WPEA 3ALLA 3UKQA 2AAQA 3REDA 4Z2UA 5C2TA 1XPQA 3UTHA 4YTMA 3K7TA 4XWRA 2XLTA 5JCKA 1CC4A 1IUTA 4B66A 4DGKA 4KX6A 1DNCA 1GEUA 5JCMA 2JAEA 3Q6JA 1VRQB 4H4WA 4CRTA 4YWOA 2VZ2A 1LJ1A 3FMWA 2B76A 5FS9A 3NHOX 3CN8A 3AD7B 3KLJA 2YM2A 4O5QA 4X4JA 3P1WA 2RABA 3DK8A 1Y56B 2Q7VA 3CNSA 4G6HA 5GRTA 1PBBA 3PVCA 4YSXA 3ICSA 5HXIA 5HY5A 1H83A 2C64A 3H8IA 1GOSA 1OJDA 3RP8A 1HYUA 3CNDA 4Z25A 2VRMA 1E1MA 1YQZA 1O95A 3L5OA 1F8SA 1Q9IA 2XVFA 4OPIA 2AR8A 1PXBA 1N4WA 1PJ7A 5C3JA 2BK4A 3T37A 4WCTA 2YLRA 1UKVG 3LZWA 4O5UA 2QAEA 4TM0A 1SEZA 2YLWA 3T2ZA 1N4UA 1S2YA 2Q0LA 4H4VA 4AT2A 2OALA 1DJQA 1S7MA 1H7WA 2GF3A 3ITJA 4HB9A 2BK3A 1VQWA 3VRBA 1M64A 3T14A 1K0JA 2E4GA 2GR0A 3CIRA 3DH9A 4J2WA 1REOA 3ATRA 3P4RA 4NTCA 3H8LA 3UKKA 3COXA 1FEAA 1PBCA 1VDCA 3CPHG 4GCMA 5BRTA 1KNRA 4K5SA 4BK3A 3II4A 3DMEA 3AE3A 4Z44A 1QLBA 5JCLA 3AE8A 1JRXA 4UDQA 2C65A 4C74A 1LQTA 3P4QA 3NT6A 4H2PA 3F8PA 1X31B 2W0HA 1JNRA 4U2LA 4ZN0A 4B68A 3QFBA 3ABVA 3KPFA 4A6NA 1O94A 4MJWA 2Z5YA 4GF7A 4H4RA 1DJNA 2BA9A 2RGJA 2CVJA 2B7SA 3AECA 3GDNA 3LJPA 2WDVA 3I3LA 3OC4A 1EL5A 2XLRA 4GUVA 3GRTA 4H4ZA 2B9XA 2YG5A 4OPCA 1LQUA 1D5TA 2YR6A 4G6GA 1NEKA 2FBWA 3ALMA 3AEDA 4GAVA 5KNLA 5KVHA 2WP5A 1IUXA 1DOBA 2GR2A 3AE5A 4IV9A 4TLXA 1CC6A 1CC2A 2OA1A 3V3OA 3P4SA 5L46A 3NK1X 2R4JA 3DJJA 2R4EA 1GRBA 3C4AA 1S3EA 2X50A 3NTAA 3UKLA 2YG3A 3UOZA 3GMBA 1LV0A 5KRQA 4J57A 1ZOVA 2IVEA 2XCGA 3NTDA 5ER0A 1PS9A 3GD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N1P A;  1GRH A;  3KU9 A;  1VG9 A;  3NK2 X;  1OJA A;  3AD9 B;  4XXG A;  2BAC A;  3AEE A;  4PAB A;  1GSN A;  4NEV A;  3FBS A;  3BHF A;  5IQ4 A;  4A79 A;  1K0I A;  3G5S A;  4GDE A;  1FEB A;  3AE9 A;  4JN9 A;  3GD4 A;  1EBD A;  3NH3 X;  1MXT A;  2WOI A;  2TPR A;  1E1K A;  2FJA A;  2XFP A;  3S5W A;  4A65 A;  1L0V A;  3BI4 A;  3IWA A;  2B9W A;  1IJH A;  1RSG A;  3DK4 A;  2XFO A;  3SGL A;  2HQM A;  3O0H A;  5FS7 A;  3FPZ A;  4X9N A;  3AE1 A;  1DXL A;  4EIP A;  3CNT A;  3DJE A;  3IC9 A;  4EMI A;  4OPU A;  3RP6 A;  4U8N A;  1ZP0 A;  2GMJ A;  4B69 A;  4EMW A;  1XDI A;  1Y56 A;  4DSH A;  3C4N A;  2X8G A;  2XFN A;  2R0C A;  4K2X A;  2JB3 A;  2R0G A;  4CY8 A;  1OJC A;  3GSI A;  3QSM A;  4PAA A;  1JRZ A;  2C73 A;  5HHF A;  4CCR A;  3D8X A;  3CGC A;  3I6D A;  2YWL A;  2V6O A;  2C7G A;  3AD8 B;  4BK2 A;  2EQ7 A;  1ZOY A;  4JQ9 A;  1GTE A;  1NHP A;  3NG7 X;  2XVI A;  1KF6 A;  1Q1W A;  3AXB A;  4BJY A;  1XHC A;  1RP0 A;  4BK1 A;  1H84 A;  1E1N A;  3UCL A;  3ICT A;  4Z2R A;  2C75 A;  4BV6 A;  2YG7 A;  1GES A;  2GAG B;  4B63 A;  2X8H A;  2IVD A;  1BGJ A;  4IA5 A;  3B6D A;  4C77 A;  4YKG A;  5EB4 A;  1GRE A;  3NYF A;  4J34 A;  5U63 A;  1Z6L A;  2R0P A;  2XVH A;  3DGH A;  4YT0 A;  1FEC A;  3EF6 A;  2JB2 A;  2GRT A;  4FX9 A;  4UDP A;  3AEF A;  1NEN A;  2PYX A;  3NLC A;  4YTN A;  3S61 A;  2C3D A;  2ZZ0 A;  2VRL A;  3UP4 A;  1D4D A;  2I0Z A;  2GQW A;  2C70 A;  3CPI G;  3UTG A;  2BXS A;  1PDH A;  2EQ8 A;  1XAN A;  4E0V A;  2WBA A;  1O5W A;  5KWF A;  2RGH A;  4CBQ A;  1GND A;  2OLN A;  3P9U A;  2ZZB A;  3RHA A;  1AOG A;  1ZDL A;  3ZYX A;  4AP1 A;  3URH A;  3VRD B;  3DGZ A;  2CUL A;  3Q9T A;  3AYI A;  1H82 A;  4EQW A;  1GER A;  2Y6R A;  2X99 A;  2V3B A;  4B67 A;  3V76 A;  3OZ2 A;  1D7Y A;  1JOA A;  2A8X A;  3LAD A;  1GT8 A;  2BS2 A;  4H2Q A;  1TDF A;  2RGO A;  1LTX R;  3EPT A;  4EQX A;  1S2Q A;  3GMC A;  5KXJ A;  1DOE A;  5BVA A;  4NEW A;  2GV8 A;  4U8I A;  1D4E A;  5GSN A;  1LPF A;  2VQB A;  2Q0K A;  1GRA A;  1CL0 A;  2O9Z A;  3NGC X;  4U8K A;  1H7X A;  1FL2 A;  2YQU A;  4BUR A;  4DNA A;  2FJB A;  4Y4N A;  3JSK A;  2DKH A;  2YLT A;  4RG4 A;  4FDC B;  3AEB A;  1V59 A;  4H4Y A;  1B37 A;  3NIX A;  1COY A;  2C66 A;  4FK1 C;  2YVF A;  4K5R A;  3LOV A;  3QVR A;  4OPL A;  2J3N A;  1EL9 A;  3AE7 A;  4ICY A;  2X8C A;  4OVI A;  3VR8 A;  1GET A;  2BCP A;  1JEH A;  1NHR A;  4U2T A;  2XLS A;  4ECH A;  2YM1 A;  2YVJ A;  2WHD A;  3BNU A;  1LVL A;  3SFE A;  4YSY A;  3BI5 A;  5IQ1 A;  1IUU A;  4HA6 A;  5FS6 A;  4H4X A;  4J31 A;  2ZBW A;  1CJ4 A;  4GRT A;  2XFU A;  4A6N B;  1N4V A;  1CHU A;  2XDO A;  1KSS A;  4OPD A;  4U8O A;  4RG3 A;  4OPG A;  3IF9 A;  5CQF A;  4D03 A;  2H88 A;  1Y0P A;  4K8D A;  2DKI A;  1TDO A;  4JY3 A;  4TLZ A;  3AE4 A;  3M13 A;  4USQ A;  5LV9 A;  2C67 A;  1YQ3 A;  3AYJ A;  4Z43 A;  1ZKQ A;  2WU5 A;  1VG0 A;  2BYB A;  1PN0 A;  4JNQ A;  4YTP A;  2YG4 A;  3UKF A;  2WES A;  2PHH A;  2JB1 A;  2EQ9 A;  2WS3 A;  2Z5X A;  4UP3 A;  1D7L A;  1B8S A;  3QJ4 A;  3DJG X;  4EM4 A;  2BXR A;  1L9D A;  4A99 A;  1GV4 A;  5HYM A;  4U8M A;  2V5Z A;  1F8R A;  4N9X A;  4YXD A;  4H4P A;  4Z26 A;  1EL7 A;  2FJD A;  3CGB A;  3FIM B;  3M12 A;  3AEG A;  4YSH A;  5M0Z A;  2C76 A;  3KD9 A;  4I58 A;  1ELI A;  1F6M A;  2VQ7 A;  3G5Q A;  4H4T A;  4CNJ A;  2VVM A;  1RYI A;  1B4V A;  4APN A;  3VQR A;  2Y6Q A;  5U25 A;  1E1L A;  4EIQ A;  3NRN A;  3UKP A;  1TRB A;  1W4X A;  2B9Y A;  2WDQ A;  2X3N A;  2XLP A;  1BF3 A;  3F8D A;  1H86 A;  3LXD A;  4EM3 A;  3ICR A;  1PBD A;  1KSU A;  2IID A;  3L1R A;  1P2H A;  4K22 A;  4JNA A;  1NPX A;  1CF3 A;  3AYL A;  3NN6 X;  3M0O A;  5KOX A;  2BAB A;  1S3B A;  2V3A A;  4D04 A;  3ALJ A;  5KVI A;  1B5Q A;  4WX1 A;  4EQR A;  2JK6 A;  2VVL G;  5JCI A;  3QSS A;  5M10 A;  2ARD A;  3UKH A;  4UDR A;  1BZL A;  4LA1 A;  1DOD A;  1FOH A;  2XFQ A;  2E5V A;  1TYP A;  2GR3 A;  3BNM A;  4H7U A;  4Y4M A;  2GQF A;  1ZK7 A;  2YAU A;  4A7A A;  3WE0 A;  5TR3 A;  3FG2 P;  1BWC A;  4GR1 A;  1H81 A;  1GPE A;  2WQY A;  4AOX A;  4C3Y A;  2C3C A;  1NHS A;  2YVG A;  1PBF A;  2XYO A;  1F8W A;  5FMH A;  2F5Z A;  3ISH A;  3RP7 A;  4ZCC A;  2BS4 A;  3NYE A;  3UTE A;  5EBK A;  3G5R A;  4M52 A;  4Z2T A;  4AOS A;  1PJ5 A;  2GR1 A;  3P4P A;  3D1C A;  3QVP A;  5DBJ A;  1YQ4 A;  3DK9 A;  4U8L A;  2GVC A;  2QA2 A;  3KKJ A;  1L9E A;  4DSG A;  4H4Q A;  1OJ9 A;  4RSL A;  3VR9 A;  1ZY8 A;  1E39 A;  2R9Z A;  5JCN A;  2ACZ A;  4TM3 A;  3K30 A;  4CY6 A;  1TDK A;  2C72 A;  3CTY A;  2BS3 A;  1D4C A;  1PHH A;  2AQJ A;  4FK1 A;  1E6E A;  2EQ6 A;  1GAL A;  4U2S A;  3BHK A;  4P9S A;  3DJD A;  1K4Q A;  2GB0 A;  3ZDN A;  2GEW A;  1M6I A;  3LB8 A;  1ZX9 A;  5EB5 A;  4A5L A;  2WP6 A;  1TDE A;  4H4U A;  2BC1 A;  1KNP A;  4X9M A;  5J7X A;  4CCQ A;  1GTH A;  1NG3 A;  1CJ2 A;  4GDP A;  1QJD A;  1MO9 A;  1BKW A;  4TM4 A;  3GRS A;  1ZMD A;  2CDU A;  1ZMC A;  2YR5 A;  2A89 A;  4NZH A;  1NG4 A;  2R45 A;  3IHM A;  1E7P A;  2WP9 A;  4NTD A;  5BUL A;  2WPF A;  1GRG A;  4USR A;  1JNZ A;  3K7M X;  3PO7 A;  4H2N A;  5J60 A;  2WET A;  3AEA A;  2BK5 A;  2Q6U A;  4IA6 A;  4J33 A;  3KVE A;  1CJC A;  3QSE A;  2CFY A;  1YKJ A;  2JKC A;  4H4S A;  1EL8 A;  3AE2 A;  2XVE A;  3NKS A;  2WOV A;  3GDP A;  3GWF A;  1IUS A;  1JRY A;  3RNM A;  3V3N A;  3AE6 A;  5IPY A;  2VOU A;  1F3P A;  3NN0 X;  2APG A;  2OAM A;  2TMD A;  3LZX A;  4B65 A;  1JU2 A;  1L9C A;  1PXC A;  4J36 A;  4XWZ A;  1TYT A;  4IVM B;  1DOC A;  2GH5 A;  3SM8 A;  1YY5 A;  3R9U A;  3UP5 A;  1K0L A;  3UTF A;  3UOV A;  3AWI A;  4C5O A;  1P2E A;  4Z24 A;  5BUK A;  2QA1 A;  3NYC A;  4K7Z A;  4A9W A;  4AP3 A;  3GYJ A;  1PXA A;  4YKF A;  4NTE A;  5KOW A;  2V61 A;  3EAN A;  1BGN A;  3ATQ A;  4B1B A;  2JBV A;  2E1M A;  3CPJ G;  3HZL A;  5EOW A;  2B7R A;  3GWD A;  3NNE A;  4JY2 A;  4TM1 A;  1TDN A;  2VVL A;  2ZZC A;  1KFY A;  4I59 A;  1Q1R A;  2WDR A;  1MOK A;  1NAA A;  1QO8 A;  4LII A;  4CNK A;  1CJ3 A;  2NPX A;  2H89 A;  4JDR A;  1H6V A;  1OJT A;  3B3R A;  3UOX A;  4KPR A;  2GMH A;  3H4K A;  4U8J A;  3F8R A;  3CNP A;  3UOY A;  4U8P A;  2V60 A;  3K7Q X;  2WPC A;  2YLZ A;  5CKU A;  1KDG A;  1GXF A;  3GYI A;  2R46 A;  3IHG A;  1FCD A;  4OCG A;  3EAO A;  4REK A;  4BJZ A;  1NHQ A;  4OPT A;  1NDA A;  4J56 A;  1IUV A;  1CBO A;  2XVJ A;  3KA7 A;  2NVK X;  4EQS A;  4YSZ A;  5U1O A;  2XLU A;  2BC0 A;  3NK0 X;  3QFA A;  4ZCD A;  3L8K A;  1IUW A;  4H50 A;  4ADW A;  2A87 A;  2WEU A;  2YG6 A;  3DA1 A;  4LU6 A;  3SFD A;  4H2R A;  3UKA A;  3ADA B;  4IVO B;  2YR4 A;  4EMJ A;  1GRF A;  3SQP A;  2YLX A;  3PS9 A;  3VRA A;  3AB1 A;  2OLO A;  2QCU A;  4B64 A;  3BI2 A;  2WU2 A;  2UZZ A;  1ONF A;  3CNJ A;  4AT0 A;  1PBE A;  2YLS A;  3C96 A;  4C3X A;  2GAH B;  2BCG G;  2WOW A;  1GRT A;  3E1T A;  5FS8 A;  1PJ6 A;  3CGD A;  2FJE A;  3CGE A;  4Y4L A;  2WPE A;  3ALL A;  3UKQ A;  2AAQ A;  3RED A;  4Z2U A;  5C2T A;  1XPQ A;  3UTH A;  4YTM A;  3K7T A;  4XWR A;  2XLT A;  5JCK A;  1CC4 A;  1IUT A;  4B66 A;  4DGK A;  4KX6 A;  1DNC A;  1GEU A;  5JCM A;  2JAE A;  3Q6J A;  1VRQ B;  4H4W A;  4CRT A;  4YWO A;  2VZ2 A;  1LJ1 A;  3FMW A;  2B76 A;  5FS9 A;  3NHO X;  3CN8 A;  3AD7 B;  3KLJ A;  2YM2 A;  4O5Q A;  4X4J A;  3P1W A;  2RAB A;  3DK8 A;  1Y56 B;  2Q7V A;  3CNS A;  5GRT A;  1PBB A;  3PVC A;  4YSX A;  3ICS A;  5HXI A;  5HY5 A;  1H83 A;  2C64 A;  3H8I A;  1GOS A;  1OJD A;  3RP8 A;  1HYU A;  3CND A;  4Z25 A;  2VRM A;  1E1M A;  1YQZ A;  1O95 A;  1F8S A;  1Q9I A;  2XVF A;  4OPI A;  2AR8 A;  1PXB A;  1N4W A;  1PJ7 A;  5C3J A;  2BK4 A;  3T37 A;  4WCT A;  2YLR A;  1UKV G;  3LZW A;  4O5U A;  2QAE A;  4TM0 A;  1SEZ A;  2YLW A;  1N4U A;  1S2Y A;  2Q0L A;  4H4V A;  4AT2 A;  2OAL A;  1DJQ A;  1H7W A;  3ITJ A;  2GF3 A;  4HB9 A;  3VRB A;  2BK3 A;  1VQW A;  1M64 A;  1K0J A;  2E4G A;  2GR0 A;  3CIR A;  3DH9 A;  4J2W A;  1REO A;  3ATR A;  3P4R A;  4NTC A;  3H8L A;  3UKK A;  3COX A;  1FEA A;  1PBC A;  1VDC A;  3CPH G;  4GCM A;  5BRT A;  1KNR A;  4K5S A;  4BK3 A;  3II4 A;  3DME A;  3AE3 A;  4Z44 A;  1QLB A;  5JCL A;  3AE8 A;  1JRX A;  4UDQ A;  2C65 A;  4C74 A;  1LQT A;  3P4Q A;  3NT6 A;  4H2P A;  3F8P A;  1X31 B;  2W0H A;  1JNR A;  4U2L A;  4ZN0 A;  4B68 A;  3QFB A;  3ABV A;  3KPF A;  4A6N A;  1O94 A;  4MJW A;  2Z5Y A;  4GF7 A;  4H4R A;  1DJN A;  2BA9 A;  2RGJ A;  2CVJ A;  2B7S A;  3AEC A;  3GDN A;  3LJP A;  2WDV A;  3I3L A;  3OC4 A;  1EL5 A;  2XLR A;  4GUV A;  3GRT A;  4H4Z A;  2B9X A;  2YG5 A;  4OPC A;  1LQU A;  1D5T A;  2YR6 A;  1NEK A;  2FBW A;  3ALM A;  3AED A;  5KVH A;  2WP5 A;  1IUX A;  1DOB A;  2GR2 A;  3AE5 A;  4IV9 A;  4TLX A;  1CC6 A;  1CC2 A;  2OA1 A;  3V3O A;  3P4S A;  5L46 A;  3NK1 X;  2R4J A;  3DJJ A;  2R4E A;  1GRB A;  3C4A A;  1S3E A;  2X50 A;  3NTA A;  3UKL A;  2YG3 A;  3UOZ A;  3GMB A;  1LV0 A;  5KRQ A;  4J57 A;  1ZOV A;  2IVE A;  2XCG A;  3NTD A;  5ER0 A;  1PS9 A;  3GD3 A; 
#chains in the Genus database with same CATH topology
 3FVD A;  1VG9 A;  4DXK A;  3AD9 B;  4G9K A;  3AEE A;  4NEV A;  1FEB A;  3GD4 A;  1EBD A;  3NH3 X;  3UXK A;  1MXT A;  2TPR A;  1E1K A;  4KEM A;  2B9W A;  1RSG A;  4E4U A;  5FS7 A;  3R25 A;  3CNT A;  2PMQ A;  3IC9 A;  3RP6 A;  1WUF A;  4IP4 A;  4B69 A;  3B97 A;  3TTE A;  2R0C A;  2E5A A;  2R0G A;  4CY8 A;  4K8G A;  3D8X A;  1EC9 A;  4ZOH B;  3UCD A;  3AD8 B;  4J3Z A;  4JQ9 A;  1NHP A;  1GTE A;  2XVI A;  3AXB A;  3SYI A;  1XHC A;  1H84 A;  2C75 A;  3SXI A;  2YG7 A;  1JRP A;  4YKG A;  3HYW A;  1Z6L A;  2R0P A;  2W54 A;  3EF6 A;  2GRT A;  3UGV A;  1NEN A;  4YTN A;  3SBF A;  3S61 A;  3DFY A;  1N5W C;  3UP4 A;  3SN1 A;  2GQW A;  4E0V A;  5KWF A;  2RGH A;  1GND A;  3VRD B;  1FIQ B;  2V3B A;  4B67 A;  3V76 A;  2O56 A;  1JOA A;  2BS2 A;  3TWB A;  3GMC A;  5KXJ A;  1DOE A;  1FFV C;  4NEW A;  4U8I A;  2VQB A;  3IJQ A;  4BUR A;  2FJB A;  3JSK A;  3R07 C;  1COY A;  4K5R A;  1EL9 A;  3AE7 A;  3VR8 A;  1GET A;  4U2T A;  2XLS A;  4ECH A;  2YVJ A;  2WHD A;  1LVL A;  4H4X A;  4GRT A;  2XFU A;  1W6T A;  2XDO A;  4OPG A;  5CQF A;  1TDO A;  4USQ A;  3AYJ A;  4II2 A;  1ZKQ A;  4Z43 A;  2WES A;  2OO6 A;  1B8S A;  2POZ A;  2OQY A;  5HYM A;  2W3R A;  3T2Y A;  4YXD A;  2FJD A;  3M12 A;  1ELI A;  1ELS A;  3R0U A;  3FJ4 A;  3BSM A;  1BF3 A;  3ICR A;  2IID A;  3SX6 A;  3JVA A;  1OEP A;  2W3S A;  2V3A A;  4TVY A;  3ALJ A;  1B5Q A;  1P43 A;  1BZL A;  4LA1 A;  2XFQ A;  1TYP A;  4Y4M A;  2FYM A;  4H7U A;  1ZK7 A;  4AOX A;  5BOE A;  2YVG A;  4A6G A;  2PS2 A;  2BS4 A;  3NYE A;  5EBK A;  1KN0 A;  2QJN A;  2GR1 A;  3D1C A;  3QVP A;  3KKJ A;  1L9E A;  1OJ9 A;  3VR9 A;  2R9Z A;  5JCN A;  3MUC A;  3STP A;  1TDK A;  3MZN A;  3IJL A;  2BRA A;  3DJD A;  2BC1 A;  2OQH A;  1CJ2 A;  4GDP A;  4E6M A;  1BKW A;  3GRS A;  2YR5 A;  2A89 A;  1GRG A;  6ENL A;  4USR A;  5J60 A;  2BK5 A;  3VA8 A;  3KVE A;  1CJC A;  3T37 A;  1WUE A;  1F3P A;  1T3Q C;  2APG A;  4XWZ A;  3SM8 A;  1YY5 A;  3KPK A;  1SJA A;  4Z24 A;  4H19 A;  3T2K A;  4A9W A;  4AP3 A;  3GYJ A;  3MWC A;  4NTE A;  1BGN A;  3ES7 A;  2E1M A;  3CPJ G;  3GWD A;  1FO4 A;  4JY2 A;  2XH4 A;  3V5C A;  2MUC A;  1Q1R A;  3T8Q A;  1MOK A;  4HN8 A;  1QO8 A;  1CJ3 A;  2NPX A;  3B3R A;  3DGB A;  3CNP A;  3UOY A;  3RIT A;  2V60 A;  2WPC A;  5CKU A;  3IHG A;  1GXF A;  2R46 A;  1NHQ A;  4J56 A;  3T9P A;  2NVK X;  4EQS A;  4YSZ A;  3H8A A;  3QFA A;  2A87 A;  2WEU A;  4LU6 A;  4G73 A;  3ZLH A;  3PS9 A;  3VRA A;  2WU2 A;  2YLS A;  2GAH B;  2BCG G;  3E1T A;  2FJE A;  2OKT A;  1XPQ A;  3K7T A;  3ETR B;  4B66 A;  1X2G A;  3A7U A;  1GEU A;  3OP2 A;  2VZ2 A;  1LJ1 A;  3RRA A;  2OZ8 A;  2B76 A;  3CN8 A;  3V4B A;  3T4W A;  2YM2 A;  2QDE A;  3DK8 A;  3PVC A;  1H83 A;  3RP8 A;  4Z25 A;  2VRM A;  1YQZ A;  1F8S A;  3SN4 A;  1Q9I A;  4OPI A;  3ZVH A;  1PXB A;  2AR8 A;  1N4W A;  2AKM A;  4GIR A;  2YLR A;  1UKV G;  3LZW A;  3T2Z A;  4AT2 A;  2OAL A;  3VRB A;  2GF3 A;  4K2S A;  1JDF A;  1KKR A;  1VDC A;  1N5X A;  1XS2 A;  4MKS A;  3H12 A;  4BK3 A;  2HXT A;  2OZ3 A;  4HCL A;  5JCL A;  4UDQ A;  4DWD A;  4C74 A;  3P4Q A;  4U2L A;  3OZY A;  3ABV A;  2Z5Y A;  4GF7 A;  4H4R A;  2BA9 A;  2RGJ A;  3AEC A;  3LJP A;  3T6C A;  2WDV A;  3I3L A;  4H4Z A;  2YG5 A;  3ALM A;  3AED A;  3NO1 A;  3AE5 A;  2R4J A;  3N4E A;  3C4A A;  2X50 A;  1ZOV A;  3NTD A;  5ER0 A;  1N1P A;  3KU9 A;  4XXG A;  4PAB A;  3JW7 A;  3FBS A;  3BHF A;  5IQ4 A;  4A79 A;  4GDE A;  1YEY A;  4JN9 A;  2XFP A;  1H2I A;  1L0V A;  2DW6 A;  3IWA A;  3DK4 A;  3HW2 A;  2XFO A;  3SGL A;  3O0H A;  4DX3 A;  1XDI A;  4F4R A;  2JB3 A;  3GSI A;  4PAA A;  3CGC A;  3NVZ B;  2C7G A;  1ZOY A;  4YWS A;  1Q1W A;  3GY1 A;  1E1N A;  4BV6 A;  1BGJ A;  3B6D A;  4C77 A;  3VCN A;  4HNL A;  1GRE A;  3NYF A;  5U63 A;  4YT0 A;  4HCH A;  2JB2 A;  4UDP A;  2ZZ0 A;  2VRL A;  2PP1 A;  2QGY A;  3UTG A;  2BXS A;  5ENL A;  2WBA A;  1O5W A;  4CBQ A;  4GME A;  1AOG A;  4ZA0 A;  1KKO A;  4AP1 A;  3DER A;  3Q9T A;  3AYI A;  3D46 A;  1D7Y A;  3LAD A;  4FI4 A;  2RGO A;  3DIP A;  1WYG A;  2GV8 A;  3NGC X;  2YQU A;  2YLT A;  3VC6 A;  4RG4 A;  3AEB A;  3R1Z A;  4H4Y A;  2PPG A;  3S47 A;  2YVF A;  4E5T A;  2C4C A;  2OX4 A;  3QVR A;  4OPL A;  2J3N A;  4ICY A;  1EC7 A;  3ZVI A;  2W55 A;  2BCP A;  4IZG A;  3SZC A;  2YM1 A;  3ZLF A;  3BNU A;  2RDX A;  5FS6 A;  2ZBW A;  3GO2 A;  1SJD A;  1KSS A;  4U8O A;  3IF9 A;  4D03 A;  2H88 A;  1Y0P A;  2PP0 A;  3U4F A;  3AE4 A;  2P8C A;  1VG0 A;  2BYB A;  3JZU A;  3K1G A;  5KMQ A;  3V3W A;  3UKF A;  2JB1 A;  2EQ9 A;  2Z5X A;  4GGB A;  4GYP A;  1L9D A;  4A99 A;  1GV4 A;  3I4K A;  4Z26 A;  1EL7 A;  3CGB A;  1PDZ A;  3AEG A;  4HNC A;  4CNJ A;  1X2H A;  2VVM A;  1VQZ A;  4APN A;  2WDQ A;  1H86 A;  3H7V A;  1BKH A;  4EM3 A;  1PBD A;  1KSU A;  3L1R A;  3UCC A;  5KOX A;  4EQR A;  2JK6 A;  5JCI A;  5M10 A;  2OPJ A;  1DOD A;  2E5V A;  1GPE A;  3R10 A;  1P48 A;  1NHS A;  1PBF A;  3RP7 A;  3UTE A;  2GL5 A;  2PGW A;  2OZT A;  1YQ4 A;  3MKC A;  4H4Q A;  1ZY8 A;  2ACZ A;  4G8T A;  2AQJ A;  5FJP A;  4U2S A;  4P9S A;  3NFU A;  3AMZ A;  1M6I A;  4A5L A;  2WP6 A;  4GIS A;  3THU A;  4CCQ A;  1NG3 A;  1QJD A;  1MO9 A;  3CMM A;  3SQS A;  2CDU A;  2R45 A;  3IHM A;  5BUL A;  3BJS A;  2P8B A;  2QDD A;  1JNZ A;  3EUB 3;  3AEA A;  4J33 A;  3Q45 A;  3QSE A;  2CFY A;  2JKC A;  4H4S A;  1EL8 A;  2XVE A;  3GDP A;  3GWF A;  1IUS A;  3RNM A;  3AE6 A;  2HZG A;  2OAM A;  2TMD A;  3LZX A;  1PXC A;  4IVM B;  2GH5 A;  3UTF A;  3UOV A;  3AWI A;  4C5O A;  1P2E A;  2QA1 A;  3NYC A;  4K7Z A;  3EAN A;  4B1B A;  3UXL A;  3SY4 A;  5EOW A;  4IP5 A;  2VVL A;  3GYX A;  2WDR A;  3NXL A;  1NAA A;  3UJR A;  2H89 A;  1BQG A;  4KPR A;  2GMH A;  4U8J A;  3UJE A;  2YLZ A;  5BOF A;  4OCG A;  4REK A;  3EAO A;  3KA7 A;  5U1O A;  2XLU A;  3NK0 X;  2YG6 A;  4ADW A;  4AT0 A;  3UKA A;  4IVO B;  2FKP A;  4EMJ A;  3N4F A;  4B64 A;  1ONF A;  2P0I A;  3C96 A;  1DTN A;  2WOW A;  5FS8 A;  3CGD A;  4H1Z A;  1VDV A;  4DHG A;  4KX6 A;  2PTY A;  2JAE A;  1VRQ B;  3FMW A;  3A7A A;  3AD7 B;  4O5Q A;  2Q7V A;  3TOY A;  5GRT A;  1PBB A;  3CXB A;  5HY5 A;  3H8I A;  1GOS A;  2XH2 A;  3CND A;  1E1M A;  1O95 A;  3L5O A;  2AL2 A;  4WCT A;  3S5S A;  5FJU A;  1S2Y A;  2Q0L A;  4H4V A;  4HB9 A;  3ITJ A;  1VQW A;  4GYP C;  2GR0 A;  3CIR A;  3DH9 A;  4NTC A;  1REO A;  3ATR A;  3UKK A;  3H8L A;  3COX A;  1FEA A;  1PBC A;  4GCM A;  3R0K A;  2AL2 B;  1KNR A;  3AE3 A;  3AE8 A;  2POD A;  3A7R A;  3RO6 A;  1V97 A;  1MDR A;  4A6N A;  3VFC A;  4MJW A;  3NVW B;  2CVJ A;  4GUV A;  3GDN A;  3GRT A;  1NEK A;  2FBW A;  4GAV A;  5KVH A;  2WP5 A;  2OA1 A;  3V3O A;  5L46 A;  4DN1 A;  4JN8 A;  3DJJ A;  2R4E A;  1GRB A;  3GD6 A;  2YG3 A;  1LV0 A;  3OPS A;  3GD3 A;  1GRH A;  3DES A;  3NK2 X;  3TCS A;  1K0I A;  3G5S A;  3FCP A;  3QPE A;  3S5W A;  3AE1 A;  3OZM A;  4EIP A;  3CYJ A;  3DJE A;  4EMI A;  4U8N A;  3HYV A;  1Y56 A;  4DSH A;  2XFN A;  2MNR A;  1OJC A;  4E4F A;  5HHF A;  4CCR A;  2GDQ A;  3I6D A;  4J1O A;  2YWL A;  2V6O A;  4A3R A;  2EQ7 A;  3EKG A;  4BK1 A;  2QJM A;  1GES A;  4B63 A;  2X8H A;  4FP1 A;  3QKE A;  2XVH A;  3FXG A;  4Z1Y A;  4FX9 A;  3NLC A;  3SR6 B;  1D4D A;  2C70 A;  4Z17 A;  3MQT A;  1PDH A;  2EQ8 A;  2GSH A;  2OLN A;  3RHA A;  3ZYX A;  1ECQ A;  2PA6 A;  3DGZ A;  2CUL A;  1GER A;  2X99 A;  2PP3 A;  2A8X A;  2HXU A;  4H2Q A;  1TDF A;  3EPT A;  4EQX A;  4GGH A;  1FHU A;  3SN0 A;  5GSN A;  1LPF A;  4HYR A;  1JRO A;  2Q0K A;  1GRA A;  1CL0 A;  4U8K A;  3D9X A;  5JRB A;  4DNA A;  4GAP A;  4Y4N A;  2DKH A;  4FDC B;  1B37 A;  2C66 A;  4FK1 C;  4OVI A;  4M6U A;  3SFE A;  4YSY A;  4HA6 A;  4J31 A;  1CJ4 A;  4A6N B;  1N4V A;  1CHU A;  2DKI A;  4TLZ A;  5LV9 A;  3M13 A;  3P3B A;  2C67 A;  3DFH A;  1YQ3 A;  2WU5 A;  3TJ4 A;  4JNQ A;  4YTP A;  2PHH A;  2WS3 A;  1D7L A;  2GGI A;  3QJ4 A;  3DJG X;  3TQP A;  4U8M A;  4N9X A;  4MMW A;  5M0Z A;  2OVL A;  3KD9 A;  1F6M A;  3G5Q A;  4H4T A;  2PCE A;  1RYI A;  3VQR A;  3UKP A;  1TRB A;  2X3N A;  2XLP A;  3F8D A;  4JNA A;  1NPX A;  3U9I A;  1CF3 A;  3NN6 X;  3ES8 A;  1MDL A;  3VDG A;  2BAB A;  4D04 A;  2VVL G;  4NNJ A;  3UJS A;  1N60 C;  3SJN A;  2GR3 A;  2GQF A;  3CAW A;  3WE0 A;  1EBH A;  5TR3 A;  1BWC A;  2WQY A;  3AM9 A;  3NRZ B;  4C3Y A;  2PGE A;  2HNE A;  4ZCC A;  5IDZ A;  3G5R A;  4JN7 A;  3N6H A;  1PJ5 A;  5DBJ A;  4X2P A;  4DSG A;  4TM3 A;  3K30 A;  2ZC8 A;  4CY6 A;  3DG7 A;  1PDY A;  2C72 A;  3CTY A;  2BS3 A;  1PHH A;  1E6E A;  1TE6 A;  2P88 A;  1GAL A;  3BHK A;  3ZDN A;  2GEW A;  3LB8 A;  1TDE A;  4H4U A;  1KNP A;  3ENL A;  1ZMD A;  4KPL A;  4NZH A;  1NG4 A;  4ENL A;  2WP9 A;  4NTD A;  2WPF A;  2OG9 A;  3PK7 A;  3UJF A;  2WET A;  2Q6U A;  1YKJ A;  3V3N A;  5IPY A;  2VOU A;  3SZW A;  3NN0 X;  4B65 A;  1L9C A;  4J36 A;  1TYT A;  3UP5 A;  3R9U A;  4KWS A;  3FYY A;  1ZXI C;  4NWZ A;  5BUK A;  1F9C A;  2CHR A;  5KOW A;  3ATQ A;  2JBV A;  2B7R A;  3NNE A;  4TM1 A;  3UJ2 A;  5FJT A;  1NEL A;  4LII A;  4CNK A;  4JDR A;  1H6V A;  3PWI A;  3DDM A;  5G5H B;  3F8R A;  1L8P A;  4ROP A;  4OPT A;  2OLA A;  1NDA A;  1IUV A;  1CBO A;  2XVJ A;  4IT1 A;  1E9I A;  2BC0 A;  2GGH A;  1IUW A;  3DA1 A;  2YR4 A;  1GRF A;  3SQP A;  2YLX A;  2OLO A;  2QCU A;  2UZZ A;  4C3X A;  3NZG A;  3TW9 A;  1PJ6 A;  4IHC A;  2WPE A;  3ALL A;  2AAQ A;  3RED A;  2XLT A;  1CC4 A;  1KD0 A;  4DGK A;  1DNC A;  2GGG A;  5JCM A;  3Q6J A;  4CRT A;  3DEQ A;  3CT2 A;  1SB3 B;  3KLJ A;  4X4J A;  4G6H A;  4YSX A;  3ICS A;  2C64 A;  1HYU A;  2BK4 A;  4TM0 A;  3D47 A;  2QQ6 A;  1EC8 A;  1SEZ A;  1N4U A;  1DJQ A;  1S7M A;  1H7W A;  2BK3 A;  1M64 A;  3T14 A;  3SSZ A;  1K0J A;  2E4G A;  4J2W A;  3P4R A;  3CPH G;  5J04 A;  4K5S A;  3II4 A;  1QLB A;  3AN1 A;  4H2P A;  3F8P A;  4B68 A;  1O94 A;  1JPD X;  2B7S A;  3OC4 A;  4OPC A;  2PU0 A;  2ZAD A;  1D5T A;  2YR6 A;  4G6G A;  4IV9 A;  1FFU C;  1CC2 A;  2XSX A;  4TVW A;  2XH0 A;  3UKL A;  3B9J B;  3UOZ A;  3GMB A;  5KRQ A;  2GGE A;  2XCG A;  1PS9 A;  1OJA A;  2BAC A;  1GSN A;  3AE9 A;  1TKK A;  4A35 A;  2WOI A;  1IYX A;  2FJA A;  1MRA A;  4A65 A;  3BI4 A;  1IJH A;  2HQM A;  3FPZ A;  4X9N A;  1DXL A;  4OPU A;  1ZP0 A;  2GMJ A;  4EMW A;  5KMR A;  3C4N A;  2X8G A;  4K2X A;  3QSM A;  1JRZ A;  4ZCW A;  2C73 A;  4MGG A;  5G5G B;  7ENL A;  4BK2 A;  3NG7 X;  1KF6 A;  4BJY A;  1RP0 A;  3UCL A;  3ICT A;  4Z2R A;  2GAG B;  2IVD A;  1ONE A;  4IA5 A;  5EB4 A;  4J34 A;  2I5Q A;  3DGH A;  1FEC A;  3AEF A;  4IL2 A;  1N63 C;  3N6J A;  2PYX A;  2C3D A;  2I0Z A;  3CPI G;  1XAN A;  3P9U A;  2ZZB A;  3CXO A;  4KT2 A;  1ZDL A;  3T31 A;  3URH A;  3DG6 A;  1H82 A;  4EQW A;  2Y6R A;  3CK5 A;  3RGT A;  3OZ2 A;  1GT8 A;  4G74 A;  3NS1 B;  1LTX R;  5EU9 A;  1S2Q A;  3ZLG A;  1XPY A;  5BVA A;  1NU5 A;  4K1W A;  3KUM A;  1D4E A;  3OW1 A;  2O9Z A;  1FL2 A;  1H7X A;  1V59 A;  3NIX A;  3DG3 A;  3LOV A;  2X8C A;  2PTW A;  1JEH A;  1NHR A;  3BI5 A;  1SJC A;  5IQ1 A;  2OFJ A;  1IUU A;  4OPD A;  4RG3 A;  3HYX A;  4JY3 A;  4K8D A;  1PN0 A;  2YG4 A;  4UP3 A;  4EM4 A;  2PU1 A;  2BXR A;  2V5Z A;  1F8R A;  4H4P A;  3FIM B;  4YSH A;  2C76 A;  4I58 A;  2VQ7 A;  1B4V A;  5FJO A;  2Y6Q A;  5U25 A;  1E1L A;  4EIQ A;  2BRY A;  2PTX A;  3NRN A;  1W4X A;  2B9Y A;  3OTR A;  3LXD A;  1MUC A;  1P2H A;  4K22 A;  3PWG A;  3AYL A;  3Q4D A;  3M0O A;  1STZ A;  3PG6 A;  1S3B A;  5KVI A;  4WX1 A;  3QSS A;  2ARD A;  3UKH A;  4UDR A;  4EWJ A;  2XH7 A;  3NVV B;  2QVH A;  1FOH A;  3BNM A;  1RVK A;  2YAU A;  4A7A A;  3FG2 P;  4G7F A;  4GR1 A;  1H81 A;  2C3C A;  2XYO A;  1F8W A;  5FMH A;  2F5Z A;  3ISH A;  2AL1 A;  4M0X A;  4M52 A;  4Z2T A;  4AOS A;  3P4P A;  3QTP A;  4U8L A;  3DK9 A;  2GVC A;  1RM6 B;  2QA2 A;  4RSL A;  1E39 A;  3H70 A;  3QN3 A;  5KMP A;  1D4C A;  4FK1 A;  2EQ6 A;  3QLD A;  1K4Q A;  2GB0 A;  3PFR A;  3T0K A;  1ZX9 A;  5EB5 A;  1N61 C;  3MSY A;  4X9M A;  3GC2 A;  5J7X A;  1GTH A;  4II3 A;  4E8G A;  4TM4 A;  4H2H A;  1ZMC A;  2QJJ A;  3VC5 A;  1E7P A;  3K7M X;  3PO7 A;  4H2N A;  3NKS A;  4IA6 A;  3AE2 A;  4GFI A;  4DYE A;  2WOV A;  3NVY B;  1JRY A;  1JU2 A;  3TWA A;  1DOC A;  1K0L A;  3IK4 A;  1R6W A;  1PXA A;  4YKF A;  2V61 A;  5KMS A;  3HZL A;  3EEZ A;  4HPN A;  1TDN A;  2ZZC A;  1KFY A;  4I59 A;  3SZF A;  1JPM A;  3HPF A;  1OJT A;  3UOX A;  2PSN A;  3I6E A;  3H4K A;  4U8P A;  3K7Q X;  3SZ0 A;  2GGJ A;  1KDG A;  3GYI A;  1FCD A;  4BJZ A;  3P93 A;  1MNS A;  3R11 A;  1EBG A;  4ZCD A;  3L8K A;  3SFD A;  4H50 A;  4HCD A;  4H2R A;  3ADA B;  3AB1 A;  3BI2 A;  3CNJ A;  1PBE A;  1GRT A;  5FJR A;  3CGE A;  4Y4L A;  3UKQ A;  4Z2U A;  5C2T A;  3UTH A;  4YTM A;  4XWR A;  1N62 C;  5JCK A;  1IUT A;  3MY9 A;  3CB3 A;  4H4W A;  4YWO A;  1KCZ A;  2DW7 A;  3NHO X;  5FS9 A;  3ZVH B;  3TJI A;  3P1W A;  2RAB A;  1FHV A;  1Y56 B;  3CNS A;  5HXI A;  3P0W A;  3FV9 A;  2PTZ A;  3I6T A;  1OJD A;  3RR1 A;  2XVF A;  1PJ7 A;  5C3J A;  1JCT A;  4O5U A;  2QAE A;  2YLW A;  3BOX A;  4IL0 A;  5BRT A;  3RCY A;  3DME A;  4Z44 A;  1JRX A;  2C65 A;  3V5F A;  1LQT A;  3NT6 A;  1TZZ A;  1R0M A;  1X31 B;  2W0H A;  1JNR A;  4ZN0 A;  4JHM A;  1SJB A;  4H83 A;  3QFB A;  2P3Z A;  3KPF A;  1DJN A;  2NQL A;  3VCC A;  3HRD C;  1EL5 A;  2XLR A;  2B9X A;  1LQU A;  5KNL A;  1IUX A;  1DOB A;  2GR2 A;  2E3T A;  4TLX A;  3IJI A;  1CC6 A;  3P4S A;  3NK1 X;  2ONE A;  2XGZ A;  1S3E A;  3NTA A;  2AKZ A;  4J57 A;  2IVE A; 
#chains in the Genus database with same CATH homology
 1N1P A;  1GRH A;  3KU9 A;  1VG9 A;  3NK2 X;  1OJA A;  3AD9 B;  4G9K A;  4XXG A;  2BAC A;  3AEE A;  4PAB A;  1GSN A;  4NEV A;  3FBS A;  3BHF A;  5IQ4 A;  4A79 A;  1K0I A;  3G5S A;  4GDE A;  1FEB A;  3AE9 A;  4JN9 A;  3GD4 A;  1EBD A;  3NH3 X;  1MXT A;  2WOI A;  2TPR A;  1E1K A;  2FJA A;  2XFP A;  3S5W A;  4A65 A;  1H2I A;  1L0V A;  3BI4 A;  3IWA A;  2B9W A;  1IJH A;  1RSG A;  3DK4 A;  2XFO A;  3SGL A;  2HQM A;  3O0H A;  5FS7 A;  3FPZ A;  4X9N A;  3AE1 A;  1DXL A;  4EIP A;  3CNT A;  3DJE A;  3IC9 A;  4EMI A;  4OPU A;  3RP6 A;  4U8N A;  1ZP0 A;  2GMJ A;  4B69 A;  4EMW A;  3HYV A;  1XDI A;  5KMR A;  1Y56 A;  4DSH A;  3C4N A;  2X8G A;  2XFN A;  2R0C A;  4K2X A;  2JB3 A;  2R0G A;  4CY8 A;  1OJC A;  3GSI A;  3QSM A;  4PAA A;  1JRZ A;  2C73 A;  5HHF A;  4CCR A;  3D8X A;  3CGC A;  3I6D A;  2YWL A;  2V6O A;  2C7G A;  3AD8 B;  4BK2 A;  2EQ7 A;  1ZOY A;  4JQ9 A;  1GTE A;  1NHP A;  3NG7 X;  2XVI A;  1KF6 A;  1Q1W A;  3AXB A;  3SYI A;  1XHC A;  1RP0 A;  4BJY A;  4BK1 A;  1H84 A;  1E1N A;  3UCL A;  3ICT A;  4Z2R A;  2C75 A;  4BV6 A;  3SXI A;  2YG7 A;  1GES A;  2GAG B;  4B63 A;  2X8H A;  2IVD A;  1BGJ A;  4IA5 A;  3B6D A;  4C77 A;  4YKG A;  5EB4 A;  1GRE A;  3NYF A;  4J34 A;  5U63 A;  3HYW A;  1Z6L A;  2R0P A;  2XVH A;  3DGH A;  4YT0 A;  1FEC A;  3EF6 A;  2JB2 A;  2GRT A;  4FX9 A;  4UDP A;  3AEF A;  1NEN A;  2PYX A;  3NLC A;  4YTN A;  3S61 A;  2C3D A;  2ZZ0 A;  2VRL A;  3UP4 A;  1D4D A;  2I0Z A;  2GQW A;  2C70 A;  3CPI G;  3UTG A;  2BXS A;  1PDH A;  2EQ8 A;  1XAN A;  4E0V A;  2WBA A;  1O5W A;  5KWF A;  2RGH A;  4CBQ A;  1GND A;  2OLN A;  3P9U A;  2ZZB A;  3RHA A;  1AOG A;  1ZDL A;  3T31 A;  3ZYX A;  4AP1 A;  3URH A;  3VRD B;  3DGZ A;  2CUL A;  3Q9T A;  3AYI A;  1H82 A;  4EQW A;  1GER A;  2Y6R A;  2X99 A;  2V3B A;  4B67 A;  3V76 A;  3OZ2 A;  1D7Y A;  1JOA A;  2A8X A;  3LAD A;  1GT8 A;  4G74 A;  2BS2 A;  4H2Q A;  1TDF A;  2RGO A;  1LTX R;  3EPT A;  4EQX A;  1S2Q A;  3GMC A;  5KXJ A;  1DOE A;  5BVA A;  4NEW A;  2GV8 A;  4U8I A;  1D4E A;  5GSN A;  1LPF A;  2VQB A;  2Q0K A;  1GRA A;  1CL0 A;  2O9Z A;  3NGC X;  4U8K A;  1FL2 A;  1H7X A;  3D9X A;  2YQU A;  4BUR A;  5JRB A;  4DNA A;  2FJB A;  4GAP A;  4Y4N A;  3JSK A;  2DKH A;  2YLT A;  4RG4 A;  4FDC B;  3AEB A;  1V59 A;  4H4Y A;  1B37 A;  3NIX A;  1COY A;  2C66 A;  4FK1 C;  2YVF A;  2C4C A;  3LOV A;  3QVR A;  4K5R A;  4OPL A;  2J3N A;  1EL9 A;  3AE7 A;  4ICY A;  2X8C A;  4OVI A;  3VR8 A;  1GET A;  2BCP A;  1JEH A;  1NHR A;  4U2T A;  2XLS A;  3SZC A;  4ECH A;  2YM1 A;  2YVJ A;  2WHD A;  3BNU A;  1LVL A;  3SFE A;  4YSY A;  3BI5 A;  5IQ1 A;  1IUU A;  4HA6 A;  5FS6 A;  4H4X A;  4J31 A;  2ZBW A;  1CJ4 A;  4GRT A;  2XFU A;  4A6N B;  1N4V A;  1CHU A;  2XDO A;  1KSS A;  4OPD A;  4U8O A;  4RG3 A;  4OPG A;  3IF9 A;  5CQF A;  4D03 A;  2H88 A;  1Y0P A;  4K8D A;  2DKI A;  1TDO A;  3HYX A;  4JY3 A;  3AE4 A;  3M13 A;  4TLZ A;  4USQ A;  5LV9 A;  2C67 A;  1YQ3 A;  3AYJ A;  4II2 A;  1ZKQ A;  4Z43 A;  2WU5 A;  1VG0 A;  2BYB A;  1PN0 A;  4JNQ A;  3SFD A;  4YTP A;  5KMQ A;  2YG4 A;  3UKF A;  2WES A;  2PHH A;  2JB1 A;  2EQ9 A;  2WS3 A;  2Z5X A;  4UP3 A;  1D7L A;  1B8S A;  3QJ4 A;  3DJG X;  4EM4 A;  2BXR A;  1L9D A;  4A99 A;  1GV4 A;  5HYM A;  4U8M A;  2V5Z A;  1F8R A;  3T2Y A;  4N9X A;  4YXD A;  4H4P A;  4Z26 A;  1EL7 A;  2FJD A;  3CGB A;  3FIM B;  3M12 A;  3AEG A;  4YSH A;  5M0Z A;  2C76 A;  3KD9 A;  4I58 A;  1ELI A;  1F6M A;  2VQ7 A;  3G5Q A;  4H4T A;  4CNJ A;  2VVM A;  1RYI A;  1B4V A;  4APN A;  3VQR A;  2Y6Q A;  5U25 A;  1E1L A;  4EIQ A;  2BRY A;  3NRN A;  3UKP A;  1TRB A;  1W4X A;  2B9Y A;  2WDQ A;  2X3N A;  2XLP A;  1BF3 A;  3F8D A;  1H86 A;  3LXD A;  4EM3 A;  3ICR A;  1PBD A;  1KSU A;  2IID A;  3L1R A;  3SX6 A;  1P2H A;  4K22 A;  4JNA A;  1NPX A;  1CF3 A;  3AYL A;  3NN6 X;  3M0O A;  5KOX A;  3PG6 A;  2BAB A;  2V3A A;  1S3B A;  4D04 A;  3ALJ A;  5KVI A;  1B5Q A;  4WX1 A;  4EQR A;  2JK6 A;  2VVL G;  5JCI A;  3QSS A;  4NNJ A;  2ARD A;  5M10 A;  3UKH A;  4UDR A;  1BZL A;  4LA1 A;  1DOD A;  1FOH A;  2XFQ A;  2E5V A;  1TYP A;  2GR3 A;  3BNM A;  4H7U A;  4Y4M A;  2GQF A;  1ZK7 A;  2YAU A;  4A7A A;  3WE0 A;  5TR3 A;  3FG2 P;  1BWC A;  4GR1 A;  1H81 A;  1GPE A;  2WQY A;  4AOX A;  4C3Y A;  2C3C A;  1NHS A;  2YVG A;  1PBF A;  2XYO A;  1F8W A;  5FMH A;  2F5Z A;  3ISH A;  3RP7 A;  4ZCC A;  2BS4 A;  3NYE A;  3UTE A;  5EBK A;  1KN0 A;  3G5R A;  4M52 A;  4Z2T A;  4AOS A;  1PJ5 A;  2GR1 A;  3P4P A;  3D1C A;  3QVP A;  5DBJ A;  1YQ4 A;  3DK9 A;  4U8L A;  2GVC A;  2QA2 A;  3KKJ A;  1L9E A;  4DSG A;  4H4Q A;  1OJ9 A;  4RSL A;  3VR9 A;  1ZY8 A;  1E39 A;  2R9Z A;  5JCN A;  2ACZ A;  4TM3 A;  3K30 A;  4CY6 A;  1TDK A;  2C72 A;  3CTY A;  2BS3 A;  5KMP A;  1D4C A;  1PHH A;  2AQJ A;  2BRA A;  4FK1 A;  1E6E A;  2EQ6 A;  1GAL A;  4U2S A;  3BHK A;  4P9S A;  3DJD A;  1K4Q A;  2GB0 A;  3ZDN A;  2GEW A;  1M6I A;  3LB8 A;  3T0K A;  1ZX9 A;  5EB5 A;  4A5L A;  2WP6 A;  1TDE A;  4H4U A;  2BC1 A;  1KNP A;  4X9M A;  5J7X A;  4CCQ A;  1GTH A;  1NG3 A;  1CJ2 A;  4GDP A;  1QJD A;  4II3 A;  1MO9 A;  1BKW A;  4TM4 A;  3CMM A;  3GRS A;  1ZMD A;  2CDU A;  1ZMC A;  2YR5 A;  2A89 A;  4NZH A;  1NG4 A;  2R45 A;  3IHM A;  1E7P A;  2WP9 A;  4NTD A;  5BUL A;  2WPF A;  1GRG A;  4USR A;  1JNZ A;  3K7M X;  3PO7 A;  4H2N A;  5J60 A;  2WET A;  3AEA A;  2BK5 A;  2Q6U A;  4IA6 A;  4J33 A;  3KVE A;  1CJC A;  3QSE A;  2CFY A;  1YKJ A;  2JKC A;  4H4S A;  1EL8 A;  3AE2 A;  2XVE A;  3NKS A;  2WOV A;  3GDP A;  3GWF A;  1IUS A;  1JRY A;  3RNM A;  3V3N A;  3AE6 A;  5IPY A;  2VOU A;  1F3P A;  3SZW A;  3NN0 X;  2APG A;  2OAM A;  2TMD A;  3LZX A;  4B65 A;  1JU2 A;  1L9C A;  1PXC A;  4J36 A;  4XWZ A;  1TYT A;  4IVM B;  1DOC A;  2GH5 A;  3SM8 A;  1YY5 A;  3R9U A;  3UP5 A;  1K0L A;  3UTF A;  3KPK A;  3UOV A;  3AWI A;  4C5O A;  1P2E A;  4NWZ A;  4Z24 A;  5BUK A;  2QA1 A;  3NYC A;  3T2K A;  4K7Z A;  4A9W A;  4AP3 A;  3GYJ A;  1PXA A;  4YKF A;  4NTE A;  5KOW A;  2V61 A;  3EAN A;  1BGN A;  3ATQ A;  4B1B A;  2JBV A;  3SY4 A;  2E1M A;  3CPJ G;  3HZL A;  5EOW A;  5KMS A;  2B7R A;  3GWD A;  3NNE A;  4JY2 A;  4TM1 A;  1TDN A;  2VVL A;  2ZZC A;  3GYX A;  1KFY A;  4I59 A;  1Q1R A;  2WDR A;  1MOK A;  1NAA A;  1QO8 A;  4LII A;  3SZF A;  4CNK A;  1CJ3 A;  2NPX A;  2H89 A;  4JDR A;  1H6V A;  1OJT A;  3B3R A;  3UOX A;  4KPR A;  2GMH A;  3H4K A;  4U8J A;  3F8R A;  3CNP A;  3UOY A;  4U8P A;  2V60 A;  3K7Q X;  2WPC A;  2YLZ A;  5CKU A;  3SZ0 A;  1KDG A;  1GXF A;  3GYI A;  2R46 A;  3IHG A;  1FCD A;  4OCG A;  3EAO A;  4REK A;  4BJZ A;  1NHQ A;  4OPT A;  1NDA A;  4J56 A;  1IUV A;  1CBO A;  2XVJ A;  3KA7 A;  2NVK X;  4EQS A;  4YSZ A;  5U1O A;  2XLU A;  2BC0 A;  3NK0 X;  3QFA A;  4ZCD A;  3L8K A;  1IUW A;  4H50 A;  4ADW A;  2A87 A;  2WEU A;  2YG6 A;  3DA1 A;  4G73 A;  4LU6 A;  4H2R A;  3UKA A;  3ADA B;  4IVO B;  2YR4 A;  4EMJ A;  1GRF A;  3SQP A;  2YLX A;  3PS9 A;  3VRA A;  3AB1 A;  2OLO A;  2QCU A;  4B64 A;  3BI2 A;  2WU2 A;  2UZZ A;  1ONF A;  3CNJ A;  4AT0 A;  1PBE A;  2YLS A;  3C96 A;  4C3X A;  2GAH B;  2BCG G;  2WOW A;  1GRT A;  3E1T A;  5FS8 A;  1PJ6 A;  3CGD A;  2FJE A;  3CGE A;  4Y4L A;  2WPE A;  3ALL A;  3UKQ A;  2AAQ A;  3RED A;  4Z2U A;  5C2T A;  1XPQ A;  3UTH A;  4YTM A;  3K7T A;  4XWR A;  2XLT A;  5JCK A;  1CC4 A;  1IUT A;  4B66 A;  4DGK A;  4KX6 A;  1DNC A;  1GEU A;  5JCM A;  2JAE A;  3Q6J A;  1VRQ B;  4H4W A;  4CRT A;  4YWO A;  2VZ2 A;  1LJ1 A;  3FMW A;  2B76 A;  5FS9 A;  3NHO X;  3CN8 A;  3AD7 B;  3KLJ A;  2YM2 A;  4O5Q A;  4X4J A;  3P1W A;  2RAB A;  3DK8 A;  1Y56 B;  2Q7V A;  3CNS A;  4G6H A;  5GRT A;  1PBB A;  3PVC A;  4YSX A;  3ICS A;  5HXI A;  5HY5 A;  1H83 A;  2C64 A;  3H8I A;  1GOS A;  1OJD A;  3RP8 A;  1HYU A;  3CND A;  4Z25 A;  2VRM A;  1E1M A;  1YQZ A;  1O95 A;  3L5O A;  1F8S A;  1Q9I A;  2XVF A;  4OPI A;  2AR8 A;  1PXB A;  1N4W A;  1PJ7 A;  5C3J A;  2BK4 A;  3T37 A;  4WCT A;  2YLR A;  1UKV G;  3LZW A;  4O5U A;  2QAE A;  4TM0 A;  1SEZ A;  2YLW A;  3T2Z A;  1N4U A;  1S2Y A;  2Q0L A;  4H4V A;  4AT2 A;  2OAL A;  1DJQ A;  1S7M A;  1H7W A;  2GF3 A;  3ITJ A;  4HB9 A;  2BK3 A;  1VQW A;  3VRB A;  1M64 A;  3T14 A;  1K0J A;  2E4G A;  2GR0 A;  3CIR A;  3DH9 A;  4J2W A;  1REO A;  3ATR A;  3P4R A;  4NTC A;  3H8L A;  3UKK A;  3COX A;  1FEA A;  1PBC A;  1VDC A;  3CPH G;  4GCM A;  5BRT A;  1KNR A;  4K5S A;  4BK3 A;  3II4 A;  3DME A;  3AE3 A;  4Z44 A;  1QLB A;  5JCL A;  3AE8 A;  1JRX A;  4UDQ A;  2C65 A;  4C74 A;  1LQT A;  3P4Q A;  3NT6 A;  4H2P A;  3F8P A;  1X31 B;  2W0H A;  1JNR A;  4U2L A;  4ZN0 A;  4B68 A;  3QFB A;  3ABV A;  3KPF A;  4A6N A;  1O94 A;  4MJW A;  2Z5Y A;  4GF7 A;  4H4R A;  1DJN A;  2BA9 A;  2RGJ A;  2CVJ A;  2B7S A;  3AEC A;  3GDN A;  3LJP A;  2WDV A;  3I3L A;  3OC4 A;  1EL5 A;  2XLR A;  4GUV A;  3GRT A;  4H4Z A;  2B9X A;  2YG5 A;  4OPC A;  1LQU A;  1D5T A;  2YR6 A;  4G6G A;  1NEK A;  2FBW A;  3ALM A;  3AED A;  4GAV A;  5KNL A;  5KVH A;  2WP5 A;  1IUX A;  1DOB A;  2GR2 A;  3AE5 A;  4IV9 A;  4TLX A;  1CC6 A;  1CC2 A;  2OA1 A;  3V3O A;  3P4S A;  5L46 A;  3NK1 X;  2R4J A;  3DJJ A;  2R4E A;  1GRB A;  3C4A A;  1S3E A;  2X50 A;  3NTA A;  3UKL A;  2YG3 A;  3UOZ A;  3GMB A;  1LV0 A;  5KRQ A;  4J57 A;  1ZOV A;  2IVE A;  2XCG A;  3NTD A;  5ER0 A;  1PS9 A;  3GD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...