5JCLA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
432
structure length
429
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPAPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFYSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
total genus 136
structure length 429
sequence length 432
chains with identical sequence B
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jclA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jclA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jclA02
4AOSA 2AR8A 3AE1A 4J2WA 2GR1A 3K7TA 2GEWA 4RG3A 5U63A 1PBEA 3QSSA 4FDCB 3DJJA 3NN0X 3GD4A 4H4TA 2BYBA 1H86A 2Q0KA 1ZP0A 1FEAA 2R4EA 2VQBA 2VOUA 1ZK7A 2GRTA 2OAMA 1TDNA 1DOCA 1JRXA 3NK1X 1O94A 2FJBA 3UKHA 2RGJA 3OZ2A 1LTXR 4TM0A 5GSNA 5C2TA 2X3NA 2UZZA 3RP6A 3VRBA 1CBOA 3VRDB 4YXDA 4OPTA 4CY6A 4DGKA 2B76A 2C67A 4X4JA 4A79A 4AT0A 2VQ7A 1YKJA 3KKJA 3EF6A 2IVDA 4X9NA 4XXGA 4CY8A 2YG4A 1GTHA 4J33A 4BJYA 5IPYA 1NEKA 3CNJA 2APGA 3SGLA 2JB1A 1YQ3A 2WU5A 4B65A 2BS4A 2BK4A 1S2YA 5L46A 2ACZA 3LZWA 3B3RA 4ZN0A 2WP5A 4HB9A 2C7GA 3LOVA 1F8SA 1ZOVA 1XHCA 3GDPA 4ECHA 4LIIA 1L9DA 3DK4A 2JB3A 4A6NB 1P2HA 2X50A 3AE7A 1IUTA 4U8JA 3UKLA 2CFYA 1EL5A 1BKWA 2YAUA 2B7SA 2XCGA 2YLSA 5FS8A 3G5SA 4NTCA 1CJ2A 1KNPA 1N4UA 2GQFA 2C3CA 2RGHA 3DK8A 1HYUA 1PJ5A 1NENA 1TYPA 4BURA 1QO8A 4YKGA 1JNRA 2GH5A 2C76A 4P9SA 3M12A 4RSLA 1F8RA 2CVJA 2YQUA 4U2TA 1D7LA 2XVFA 4DSHA 1FEBA 5U1OA 4J57A 5JCKA 4N9XA 3UKPA 2BC1A 4DSGA 4K5RA 3QSMA 4TLZA 4U8MA 3UKKA 1IUWA 1COYA 4NTEA 4U2SA 1GREA 3CNPA 5EOWA 4YSHA 3LXDA 3NHOX 3LADA 1LJ1A 4HA6A 5KXJA 2W0HA 4Z24A 1B4VA 5DBJA 3ZDNA 4YWOA 4B68A 4CRTA 1GRTA 4JDRA 3CNTA 2C3DA 3M0OA 4Y4LA 2BA9A 4H4VA 4UDQA 4USQA 1KFYA 2EQ7A 1E1LA 3AECA 2I0ZA 2Z5XA 3GWDA 3DMEA 3NTAA 3IC9A 4Z26A 2YLXA 5TR3A 4Y4NA 1YQZA 2C70A 3KA7A 4KPRA 3S61A 1V59A 3IHGA 5M10A 4H2RA 4BK3A 4FK1C 1GSNA 4D04A 2R0GA 3AB1A 4U8NA 4NEWA 2H89A 4YSYA 1OJCA 3CTYA 3BHFA 4ICYA 4PAAA 3KD9A 2YG3A 3F8RA 2F5ZA 3H8IA 1E7PA 4BK1A 1KNRA 1PS9A 2BXSA 4UDRA 4A5LA 3GSIA 3AD7B 1GRBA 1GXFA 2WDQA 1KF6A 4BV6A 3ISHA 4IA5A 1GPEA 2GR3A 1Y56A 2WOVA 3AD9B 2E4GA 4J36A 2C73A 4H50A 4H4QA 1CL0A 2O9ZA 3Q9TA 4NZHA 4H4UA 1GTEA 1KSUA 1S3EA 3CN8A 3GD3A 4CNKA 3EPTA 3GYIA 2BK3A 1QLBA 1BWCA 3JSKA 2YVJA 4PABA 3CNSA 1W4XA 3P9UA 1GRAA 4O5QA 4AOXA 3NG7X 3P1WA 5HHFA 4E0VA 1TDOA 1CC2A 3AE9A 3LJPA 1OJ9A 1D4EA 3V76A 3VR8A 4AP1A 5BRTA 3ALLA 1L0VA 1ZX9A 2VRLA 2JBVA 4EIQA 2Y6QA 3IF9A 3AE8A 3QVRA 3UTHA 2AAQA 2XYOA 3GRSA 1GNDA 2BXRA 1ZMCA 4ZCCA 4UDPA 5HXIA 2EQ6A 5KWFA 1PXBA 3ITJA 3KU9A 4IVOB 4CBQA 3UOZA 4H4ZA 3FMWA 2EQ8A 2Q7VA 1GRFA 2RABA 3NH3X 4XWRA 2WPEA 2XFPA 1E1NA 1CC6A 1GOSA 1CJCA 4AT2A 3UP5A 3CGEA 4Z2RA 1YY5A 2X8HA 4O5UA 1DOEA 3K7QX 1M64A 2CULA 3M13A 3G5RA 3FIMB 3AYIA 1OJDA 5GRTA 1JU2A 3LB8A 2OLNA 4K2XA 3REDA 2GR2A 1ZOYA 3NK2X 3AE3A 2Q6UA 2R45A 2V3AA 3DGHA 2V61A 2YM2A 2HQMA 2YLWA 3BI4A 3AE4A 4OCGA 2R4JA 2YLZA 4Y4MA 1H6VA 4CCQA 1BZLA 3EAOA 5IQ4A 1GRHA 3AEBA 4J56A 5FS7A 1JOAA 3ICTA 3CGCA 1KSSA 2Y6RA 4YTMA 1RP0A 3GYJA 5FS9A 2X8GA 3PS9A 2WDRA 3CIRA 3NN6X 1YQ4A 3FG2P 3NGCX 3AYLA 2BS2A 2XLRA 4NTDA 3PVCA 2ZZCA 2PHHA 1MO9A 2VVMA 3RHAA 2A89A 1ONFA 3AWIA 4Z2TA 1DNCA 5HYMA 1N4VA 1B8SA 2YWLA 3GWFA 3URHA 4U2LA 2XFQA 2XFUA 3UTFA 1NPXA 2A87A 2ZZBA 2GMHA 4A6NA 3H4KA 1LQUA 2YR4A 4BK2A 1CF3A 4IV9A 4CCRA 4A65A 3IHMA 2GVCA 2GB0A 4H4RA 1Q1RA 2EQ9A 5BUKA 2XLPA 3NYEA 4EMWA 2IVEA 2OLOA 4IA6A 3ALJA 1TRBA 2GMJA 4H4YA 1D5TA 2FJDA 4C5OA 3CPIG 1H81A 1NG3A 2BK5A 4YTPA 1VDCA 2XDOA 3AEGA 4OVIA 4H2PA 4TLXA 2GV8A 3DH9A 2JAEA 1FECA 1O95A 4I59A 4H4WA 5BULA 2E1MA 1GESA 4WX1A 5JCMA 3GDNA 1F8WA 3UOXA 3NIXA 3E1TA 1E39A 3NNEA 1PDHA 2YR5A 3F8PA 1TDFA 4YKFA 3NKSA 4REKA 4A9WA 5EBKA 4AP3A 3CPHG 3D8XA 1PBBA 3DJDA 2QA1A 1RYIA 3UKQA 3CGBA 2BC0A 2PYXA 1D4CA 4LA1A 1E6EA 4C3YA 2Q0LA 3DGZA 3AYJA 2WS3A 5C3JA 1XANA 3V3NA 4EQWA 1REOA 4ZCDA 1EL7A 3VRAA 1Y56B 3C4NA 3SM8A 4EMJA 1K4QA 3GRTA 2XFOA 5KOWA 1GETA 2X8CA 3CGDA 1EBDA 1TYTA 2YLRA 4X9MA 2X99A 1OJAA 2WP6A 4EQSA 2YG7A 2NPXA 1ZMDA 2XVJA 5U25A 1BF3A 3AEDA 3C4AA 2BCGG 4C3XA 2GR0A 3VR9A 4OPUA 3NYFA 1BGJA 3SFEA 4GRTA 5IQ1A 4B67A 2OALA 3K7MX 1GERA 2V6OA 1NAAA 3AEAA 4RG4A 1H83A 4H7UA 2JK6A 2VVLG 1D7YA 1GV4A 4I58A 2BACA 1S3BA 2QAEA 2ZBWA 3PO7A 5HY5A 4EM4A 2GF3A 1QJDA 1H7WA 3BNMA 1VG9A 1ZDLA 2YVFA 3V3OA 3AEEA 1PXCA 3UKFA 1SEZA 4UP3A 3RP7A 1ZY8A 3II4A 4YT0A 3L1RA 3H8LA 1TDEA 2GAHB 1JNZA 4XWZA 4KX6A 2WBAA 4LU6A 3KLJA 1CJ4A 2WU2A 1MOKA 1L9CA 1TDKA 2BABA 3C96A 1GALA 2C64A 2QA2A 4GDEA 1EL8A 3ICRA 3SFDA 4YSXA 4ADWA 1EL9A 1K0JA 1IUUA 1NHRA 1UKVG 5KRQA 4J34A 5JCNA 1K0LA 3BI5A 4MJWA 5J60A 1AOGA 3NRNA 4GUVA 2B7RA 1DJNA 3AE6A 2WP9A 2B9YA 3SQPA 1OJTA 2C65A 3K30A 5KVHA 3CPJG 4TM1A 4BJZA 4H4SA 4YTNA 1IUXA 3ABVA 4C74A 2YG6A 1N1PA 2RGOA 2XFNA 1KDGA 4DNAA 5BVAA 1E1KA 2R9ZA 2C66A 4H2QA 2DKIA 1GRGA 3KPFA 1PBCA 2R46A 2FJEA 2XLSA 4B1BA 2C75A 1NHSA 2VRMA 4U8OA 2JB2A 3D1CA 2XVEA 3ZYXA 2TMDA 3L8KA 1F3PA 3GMBA 1DJQA 3NK0X 4B64A 1ZKQA 4EM3A 3DK9A 3F8DA 5J7XA 4IVMB 4A7AA 4EMIA 2B9XA 1LVLA 2WHDA 4JNAA 2WOWA 1IUSA 2WESA 4Z43A 2WEUA 3AEFA 3CNDA 3ALMA 5M0ZA 3NLCA 4USRA 1L9EA 3UCLA 1Q1WA 1E1MA 1H82A 4GR1A 4J31A 2WETA 1JEHA 2J3NA 1K0IA 4JY3A 3G5QA 3B6DA 2YG5A 1CC4A 4EIPA 4GDPA 1RSGA 3HZLA 2WPFA 3NTDA 2JKCA 2E5VA 3O0HA 2YVGA 3DJGX 4OPGA 2V5ZA 1NG4A 1Y0PA 2FBWA 1DXLA 3GMCA 1XPQA 2QCUA 4Z44A 3NT6A 4TM4A 4K22A 5ER0A 5FMHA 1PN0A 3I3LA 3BNUA 1NHQA 3OC4A 2WDVA 1Z6LA 4Z2UA 3UKAA 4H4PA 4TM3A 1XDIA 3QSEA 5KOXA 4OPCA 3BHKA 3RNMA 1PJ6A 3IWAA 3NYCA 4K5SA 2V60A 4U8LA 2GQWA 1P2EA 3UOYA 2VVLA 5JCIA 1IUVA 2Z5YA 2TPRA 1BGNA 1H7XA 1CHUA 2BCPA 1JRZA 3ATRA 1FCDA 1F6MA 4JQ9A 1S2QA 1GT8A 1ELIA 2C72A 3AD8B 1DODA 3LZXA 3P4RA 2CDUA 4GF7A 1LQTA 4C77A 2YLTA 4M52A 2R0PA 3DJEA 3FPZA 2B9WA 4OPDA 1FOHA 1PBFA 2AQJA 4U8KA 3UTGA 5CQFA 4YSZA 3Q6JA 2GAGB 1MXTA 3T37A 4H2NA 4JN9A 3VQRA 1NDAA 1JRYA 4D03A 3AXBA 1IJHA 4K7ZA 1DOBA 3P4SA 4A99A 1H84A 2YM1A 4B66A 3BI2A 2A8XA 4B69A 3UTEA 1FL2A 1X31B 2XVIA 5EB5A 2DKHA 4B63A 4Z25A 5CKUA 4OPLA 1VG0A 3KVEA 2R0CA 3UP4A 5KVIA 5JCLA 3AE5A 2XVHA 1GEUA 2XLUA 2YR6A 4FX9A 2ARDA 4EQRA 1N4WA 1VRQB 3I6DA 4OPIA 4NEVA 3R9UA 1Q9IA 3S5WA 4K8DA 2WQYA 3ICSA 5EB4A 3QJ4A 3P4PA 4EQXA 1O5WA 1PHHA 4CNJA 3WE0A 2V3BA 4WCTA 5FS6A 2XLTA 4H4XA 3FBSA 3QFBA 4GCMA 1D4DA 1B37A 3ADAB 1NHPA 1LPFA 1LV0A 3P4QA 3AE2A 3UOVA 2H88A 4APNA 2IIDA 2WOIA 3QFAA 2NVKX 1PXAA 1PJ7A 3QVPA 2BS3A 3ATQA 2OA1A 4U8IA 1PBDA 4U8PA 4JNQA 4JY2A 2WPCA 2FJAA 1VQWA 3RP8A 2ZZ0A 1M6IA 3DA1A 1B5QA 1CJ3A 3COXA 2VZ2A 3EANA 5LV9A 4FK1A
chains in the Genus database with same CATH superfamily
2GR1A 4RG3A 1PBEA 2PU0A 2R4EA 1FEAA 1SJDA 1ZK7A 4GIRA 3UKHA 4TM0A 2UZZA 3NRZB 4OPTA 4CY6A 4G9KA 2C67A 5IPYA 4H19A 3SGLA 2JB1A 1YQ3A 3ZVHA 2BK4A 1S2YA 2BS4A 3LZWA 3GC2A 4ZN0A 4ECHA 4LIIA 2JB3A 4A6NB 1P2HA 2X50A 4U8JA 2QJMA 2CFYA 2B7SA 2YLSA 5FS8A 1KNPA 1N4UA 3DK8A 3QPEA 1TYPA 4BURA 2GH5A 2C76A 1N60C 3M12A 4RSLA 2PSNA 3PWGA 2XVFA 5U1OA 2BC1A 4K5RA 4X2PA 1IUWA 1SJAA 4NTEA 4U2SA 3T4WA 4MMWA 4TVWA 1LJ1A 4HA6A 4CRTA 4YWSA 3ZDNA 1GRTA 3CNTA 2C3DA 2BA9A 4UDQA 4USQA 4II3A 3GWDA 2I0ZA 3IC9A 2YLXA 5TR3A 1YQZA 3FCPA 3R0UA 4FK1C 3CB3A 3AB1A 4U8NA 1OJCA 2XGZA 1PS9A 4A5LA 4HCDA 2WDQA 1JPDX 4MKSA 4IA5A 2GR3A 2WOVA 3AD9B 2E4GA 4J36A 4H4UA 1S3EA 3GD3A 3P9UA 1GRAA 3NG7X 5HHFA 1D4EA 3ALLA 3IK4A 3UTHA 2AAQA 2XYOA 1GNDA 1ZMCA 3UOZA 4GAPA 3FMWA 1GRFA 3NH3X 4AT2A 3UP5A 3K7QX 1M64A 2CULA 3G5RA 3AYIA 1OJDA 2OLNA 4K2XA 3REDA 2V3AA 2V61A 3DGHA 2YM2A 4OCGA 4Y4MA 2C4CA 2NQLA 5FS9A 3SZCA 3TWAA 2BS2A 2XLRA 3A7UA 3RHAA 1N4VA 3URHA 4U2LA 2GMHA 4A6NA 1LQUA 4BK2A 4IV9A 4CCRA 2ZADA 4DX3A 3ZLFA 2GVCA 2GB0A 4H4RA 2PODA 2XLPA 4EMWA 1SJCA 2OLOA 3ALJA 2GMJA 2FJDA 4C5OA 2HNEA 2XDOA 4OVIA 2GGEA 4H4WA 3EUB3 1F8WA 3UOXA 4YKFA 4A9WA 3FXGA 3D8XA 3DJDA 2QA1A 1D4CA 2PGEA 4C3YA 3V3NA 3TJIA 5KNLA 4EQWA 1K4QA 3GRTA 5KOWA 3GO2A 3R25A 2XSXA 4DN1A 4G6GA 3TCSA 4GAVA 1BF3A 3AEDA 2W3RA 3C4AA 2BCGG 1BGJA 1NAAA 2V6OA 4H7UA 2JK6A 1GV4A 2ZBWA 4EM4A 3DGBA 1VG9A 3AEEA 3CYJA 5KMPA 1TDEA 3D46A 4XWZA 4KX6A 3KLJA 1CJ4A 3T14A 3C96A 3QTPA 2QA2A 4GDEA 1EL8A 2W3SA 1EL9A 3BI5A 4MJWA 4G74A 2P8BA 4G8TA 2B7RA 2WP9A 1MDRA 3CPJG 4BJZA 3SX6A 3KPKA 4ROPA 1N1PA 5BVAA 1E1KA 1GRGA 3KPFA 1PBCA 3JZUA 2VRMA 4J3ZA 3MWCA 3T6CA 1F3PA 3GMBA 3OPSA 4A7AA 3DDMA 5J7XA 2WOWA 1R6WA 3SSZA 1H82A 4GR1A 3MY9A 5G5GB 4FI4A 1V97A 3B6DA 3N4EA 2JKCA 4OPGA 1NG4A 1DXLA 3AM9A 3NT6A 5ER0A 3TWBA 3I3LA 1Z6LA 4HCLA 3UKAA 3BHKA 3RNMA 1PJ6A 3IWAA 3NYCA 2V60A 4U8LA 2GQWA 1IUVA 1S2QA 4G6HA 3AD8B 3T2KA 4GF7A 3FPZA 3UGVA 4HYRA 3Q6JA 3VFCA 1TZZA 4H2NA 1JRYA 4K7ZA 3P4SA 4A99A 4B69A 3BI2A 2A8XA 4GFIA 3UTEA 2GSHA 4B63A 2DKHA 5CKUA 1VG0A 2R0CA 1ELSA 5JCLA 1GEUA 1MNSA 3AN1A 3I6DA 1Q9IA 3UJEA 5EB4A 3MQTA 1N5WC 4H4XA 1NHPA 1LV0A 3UOVA 3QFAA 2NVKX 4U8IA 4U8PA 2FJAA 2ZZ0A 1B5QA 3COXA 1FIQB 3EANA 3AE1A 5U63A 3U9IA 3DJJA 3R07C 3NN0X 3H70A 1H86A 2BYBA 4J1OA 2ONEA 2VQBA 5KMSA 2VOUA 2MUCA 2OAMA 1JRXA 1LTXR 5C2TA 7ENLA 3VRDB 5FJTA 1YKJA 3KKJA 4CY8A 2YG4A 1GTHA 2APGA 1IYXA 2WU5A 3BJSA 5L46A 3RGTA 3B3RA 3JVAA 3T8QA 3AE7A 3BSMA 1BKWA 2QVHA 1RVKA 3G5SA 4NTCA 3I6TA 1CJ2A 2C3CA 1HYUA 1JNRA 4P9SA 2CVJA 4JHMA 1DTNA 4J57A 4N9XA 2PS2A 3OP2A 3QSMA 2XH7A 3UJFA 4K8GA 2AKMA 3CMMA 5EOWA 2QJJA 3NS1B 1JDFA 3LADA 3SR6B 4B68A 2OQHA 4YWOA 4JDRA 1KFYA 2EQ7A 1E1LA 3AECA 2Z5XA 3DMEA 4Z26A 3S61A 1V59A 3IHGA 4H2RA 4BK3A 2R0GA 3UCDA 3BHFA 4PAAA 3F8RA 2BXSA 3AD7B 1GXFA 1KF6A 4IT1A 4H50A 1CL0A 3Q9TA 4IHCA 5IDZA 3Q45A 1KSUA 4CNKA 1JRPA 3HRDC 3VCNA 4PABA 2ZC8A 3CNSA 3LJPA 3MSYA 2VRLA 2P0IA 3UCCA 2Y6QA 3CXOA 4GISA 2OVLA 3GRSA 4GYPC 5KWFA 4IVOB 4NNJA 4G73A 1XPYA 2GDQA 2RABA 3UXLA 4XWRA 5KMRA 4M0XA 2XFPA 4Z2RA 1YY5A 1WYGA 1DOEA 3M13A 2AL1A 3DG7A 3EEZA 1JU2A 2GR2A 1ZOYA 3AE3A 2Q6UA 2YLWA 3AE4A 4KEMA 1BZLA 1TKKA 4J56A 3ICTA 3PK7A 3CGCA 1KSSA 4E8GA 3CIRA 1YQ4A 4NTDA 3PVCA 2PHHA 4TVYA 2VVMA 2A89A 4Z2TA 1B8SA 2YWLA 2XFQA 1NPXA 2A87A 3H4KA 2YR4A 2QJNA 2EQ9A 3NYEA 2AL2A 4IA6A 1TRBA 3DFYA 3NFUA 4EWJA 3CPIG 1NG3A 2BK5A 1VDCA 3AEGA 1NELA 4H2PA 4TLXA 3UJSA 3P93A 1GESA 5JCMA 5FJPA 3NNEA 1PDHA 1TDFA 3NKSA 4REKA 2GGHA 3CPHG 1RYIA 2PYXA 2W54A 1E6EA 2Q0LA 3T9PA 1XANA 4ZCDA 1EL7A 2OX4A 1Y56B 3C4NA 3SM8A 2XFOA 2X8CA 1TE6A 1TYTA 4X9MA 1OJAA 3SZWA 2WP6A 4EQSA 3DERA 4E4UA 3VR9A 4GRTA 4H2HA 3AEAA 2VVLG 1D7YA 2BACA 2QAEA 1SJBA 1KCZA 4MGGA 3DEQA 2YVFA 4DXKA 1PXCA 3DG6A 3UKFA 4YT0A 1ZY8A 5JRBA 4M6UA 4GMEA 3ZLGA 2BABA 2FKPA 3PG6A 3SFDA 1NHRA 1UKVG 1WUEA 5KRQA 1VQZA 3R0KA 4KT2A 2C65A 3QN3A 4TM1A 4C74A 3ABVA 3V5CA 2RGOA 2QQ6A 1XS2A 1FFVC 2R46A 4B1BA 4U8OA 3VDGA 2JB2A 2XVEA 2TMDA 1DJQA 4B64A 1ZKQA 4EM3A 3DK9A 4EMIA 2B9XA 4JNAA 1IUSA 2WESA 2O56A 3ALMA 3HPFA 2WETA 1JEHA 4JY3A 3G5QA 1KKRA 4GDPA 1RSGA 3HZLA 2E5VA 3T2ZA 3DJGX 1F9CA 3ZVIA 1Y0PA 3GMCA 1XPQA 4TM4A 3BNUA 2WDVA 2PP3A 4H4PA 3RITA 5JCIA 2DW7A 1BGNA 3T0KA 1CHUA 5G5HB 3ATRA 1F6MA 3QKEA 5J04A 3AMZA 1LQTA 2R0PA 4IL2A 3DJEA 2AQJA 2GAGB 1ECQA 3SJNA 3T37A 3FVDA 3AXBA 1H84A 5EB5A 5KVIA 3AE5A 2XVHA 4FX9A 3HYVA 1N4WA 3S5WA 3ICSA 3B9JB 3P4PA 1O5WA 1PHHA 3WE0A 2PU1A 4GCMA 3ADAB 1B37A 3I4KA 2CHRA 2IIDA 4HNCA 2PMQA 3ATQA 4KPLA 2OA1A 4JNQA 3VC5A 3RP8A 4FK1A 4J2WA 1N5XA 4E6MA 4FDCB 3MZNA 1BQGA 2Q0KA 2QDDA 1TDNA 2FJBA 2RGJA 3OZ2A 2PPGA 3TOYA 3ENLA 3MKCA 3RP6A 1CBOA 4YXDA 4DGKA 2B76A 4HCHA 4A79A 2VQ7A 2OLAA 3EF6A 4XXGA 3B97A 4BJYA 4B65A 4IL0A 2WP5A 4HB9A 2C7GA 1XHCA 2QGYA 1L9DA 4JN8A 3DK4A 1H2IA 1IUTA 2YAUA 2XCGA 2RGHA 4HN8A 1PJ5A 4YKGA 1F8RA 1X2HA 4DSHA 3UKPA 2P88A 1ZXIC 1FHVA 1GREA 4YSHA 3LXDA 3NHOX 5KXJA 2W0HA 4Z24A 5DBJA 3M0OA 4Y4LA 4H4VA 3OZMA 3FJ4A 3L5OA 3NTAA 3Q4DA 1P48A 1R0MA 4Y4NA 3UXKA 1GSNA 4NEWA 2H89A 4YSYA 4ICYA 3KD9A 4BK1A 1EC8A 1KNRA 4UDRA 1EC9A 4BV6A 2OQYA 3S47A 4IP4A 2C73A 2O9ZA 4NZHA 3P1WA 2JBVA 1S7MA 2BXRA 2E3TA 5HXIA 2EQ6A 3ZLHA 1PXBA 4CBQA 4H4ZA 2EQ8A 3HW2A 2Q7VA 1JPMA 3TTEA 3SZFA 1VDVA 2PTYA 2X8HA 1ONEA 4O5UA 3FIMB 3ZVHB 3STPA 1L8PA 2HQMA 2YLZA 1H6VA 4CCQA 5IQ4A 2XH2A 1GRHA 3OZYA 2Y6RA 3V3WA 4ZOHB 3A7RA 3FG2P 3NGCX 3GD6A 1MO9A 1ONFA 5HYMA 3NVZB 3GWFA 3SY4A 4H1ZA 2XFUA 3ETRB 3D47A 4A3RA 1CF3A 3VCCA 4A65A 1Q1RA 5BUKA 2IVEA 4GGHA 2PTXA 4H4YA 1H81A 4YTPA 2JAEA 3SYIA 5BULA 3CAWA 4WX1A 3NIXA 3E1TA 3TQPA 2YR5A 4DYEA 3CGBA 2BC0A 4Z1YA 1MDLA 3RO6A 4LA1A 3AYJA 3VRAA 4EMJA 1GETA 4GGBA 1MUCA 3VC6A 5KMQA 2GGGA 1ZMDA 2XVJA 4C3XA 3NYFA 3SFEA 2OALA 3K7MX 1GERA 4RG4A 1H83A 4I58A 3PO7A 5HY5A 2GF3A 1QJDA 3BNMA 1OEPA 1ZDLA 3N6HA 5FJUA 4UP3A 3D9XA 3NVVB 3N4FA 3RP7A 1JNZA 2WBAA 1MOKA 1L9CA 2OKTA 4HNLA 1GALA 3TW9A 2PCEA 1IUUA 5J60A 3NRNA 3AE6A 4Z17A 2B9YA 2I5QA 3SQPA 1OJTA 5KVHA 3V5FA 2POZA 2OPJA 4DNAA 2BRYA 4H2QA 1KN0A 2FJEA 2XLSA 4II2A 2C75A 1NHSA 1X2GA 3ZYXA 3NK0X 3F8DA 4H83A 4IVMB 1LVLA 4Z43A 5FJOA 4ENLA 3NLCA 2PTZA 2PP1A 4J31A 4EIPA 1CC4A 1NU5A 3GYXA 1JCTA 2YVGA 3SN1A 3SQSA 4K22A 3IJLA 5FMHA 1PN0A 3OC4A 1EC7A 3QSEA 5KOXA 2OO6A 4K5SA 3UOYA 1P2EA 1N62C 2Z5YA 1H7XA 1FCDA 1GT8A 1ELIA 1DODA 3LZXA 4C77A 2YLTA 2PA6A 4OPDA 4U8KA 1PBFA 5CQFA 1N63C 1MXTA 3H12A 3ES7A 1NDAA 2PGWA 2XVIA 4Z25A 1T3QC 1PDYA 4HPNA 4EQRA 4OPIA 4NEVA 3R9UA 1N61C 3RR1A 2V3BA 2XLTA 2OZ8A 1D4DA 2WOIA 3U4FA 1PXAA 3R10A 3QVPA 2BS3A 1JROA 2WPCA 2XH4A 1M6IA 1BKHA 5LV9A 4AOSA 2AR8A 3K7TA 2GEWA 3QSSA 2OZ3A 3NVWB 3GD4A 4H4TA 1ZP0A 2GRTA 1DOCA 3NK1X 1O94A 5GSNA 2X3NA 3VRBA 4AT0A 4X4JA 2IVDA 2BRAA 4X9NA 4J33A 1NEKA 3CNJA 5ENLA 2ACZA 4A6GA 3LOVA 1F8SA 1ZOVA 3MUCA 3GDPA 3T2YA 3BOXA 3UKLA 1EL5A 3S5SA 4GYPA 2FYMA 2GQFA 2OZTA 1NENA 1QO8A 4FP1A 2YQUA 4U2TA 1D7LA 3CT2A 1WUFA 3NO1A 1W6TA 1FEBA 5JCKA 4DSGA 4TLZA 4U8MA 3UKKA 1COYA 3SZ0A 2GGIA 3CNPA 3VA8A 1B4VA 2GGJA 5EU9A 2C70A 3KA7A 4KPRA 3CXBA 5M10A 2E5AA 4D04A 3CTYA 6ENLA 2YG3A 2F5ZA 3H8IA 1E7PA 3GSIA 1GRBA 3ISHA 1GPEA 1Y56A 2MNRA 4H4QA 1GTEA 3CN8A 3NZGA 3EPTA 3GYIA 2BK3A 1QLBA 1BWCA 3JSKA 2YVJA 1W4XA 4O5QA 4AOXA 3DFHA 4E0VA 1TDOA 1CC2A 3AE9A 3VR8A 1OJ9A 4AP1A 3V76A 5BRTA 1L0VA 1ZX9A 4EIQA 3IF9A 3OW1A 3AE8A 3QVRA 3KUMA 4ZCCA 4UDPA 5BOFA 3ITJA 3H7VA 3KU9A 5FJRA 2PP0A 2WPEA 1FO4A 1E1NA 4IZGA 1CC6A 1GOSA 1CJCA 3PFRA 3N6JA 3CGEA 2QDEA 1MRAA 2HXTA 3EKGA 5GRTA 3LB8A 3NK2X 2R45A 3BI4A 2R4JA 3OTRA 4DWDA 3EAOA 2GL5A 3I6EA 3AEBA 3A7AA 5FS7A 1JOAA 4YTMA 4F4RA 1RP0A 2OFJA 1SB3B 3GYJA 2X8GA 3TJ4A 2WDRA 3PS9A 3NN6X 3AYLA 2ZZCA 3ES8A 2HXUA 3FYYA 1DNCA 3AWIA 3UTFA 2ZZBA 1P43A 2AKZA 3NVYB 4K2SA 3IHMA 3UJRA 3FV9A 1D5TA 3IJIA 2GV8A 3DH9A 1FECA 1O95A 4I59A 4KWSA 2E1MA 3GDNA 3SN0A 1E39A 3F8PA 2XH0A 5EBKA 4AP3A 1PBBA 2DW6A 3UKQA 3HYWA 3DGZA 4ZA0A 2WS3A 5C3JA 1RM6B 1REOA 3CGDA 4E4FA 1EBDA 3UJ2A 2YLRA 2X99A 3QLDA 3JW7A 2YG7A 2NPXA 5U25A 4K1WA 3DG3A 2GR0A 4OPUA 3P0WA 5IQ1A 4B67A 3GY1A 1S3BA 3SXIA 1H7WA 3PWIA 3V3OA 1SEZA 1PDZA 3II4A 3L1RA 3H8LA 2GAHB 4LU6A 2WU2A 1TDKA 2C64A 3V4BA 3ICRA 4YSXA 4ADWA 1K0JA 4J34A 5JCNA 1K0LA 1AOGA 5BOEA 4GUVA 1DJNA 3SBFA 3K30A 4H4SA 4YTNA 1IUXA 2YG6A 1STZA 3THUA 2XFNA 1KDGA 2R9ZA 2C66A 2DKIA 4A35A 2PTWA 4DHGA 3DIPA 4E5TA 3D1CA 3L8KA 3HYXA 1EBHA 3H8AA 3IJQA 3CK5A 2WHDA 1E9IA 2WEUA 3AEFA 3CNDA 5M0ZA 2HZGA 4USRA 1L9EA 3UCLA 1Q1WA 1E1MA 3R11A 2J3NA 1K0IA 2YG5A 2WPFA 3NTDA 2P3ZA 3O0HA 3R1ZA 3NXLA 2AL2B 2V5ZA 2FBWA 2QCUA 4Z44A 3SN4A 1FFUC 1NHQA 4Z2UA 4TM3A 1XDIA 2OG9A 4OPCA 1KKOA 4ZCWA 3K1GA 1YEYA 2VVLA 2TPRA 3RCYA 1FHUA 3DESA 2BCPA 1JRZA 4JQ9A 2C72A 4NWZA 3P4RA 2CDUA 4M52A 3RRAA 2B9WA 1FOHA 3UTGA 4YSZA 4JN9A 3VQRA 4D03A 1KD0A 2RDXA 1IJHA 1DOBA 4B66A 2YM1A 1FL2A 1X31B 4OPLA 3KVEA 3UP4A 2XLUA 2YR6A 2ARDA 3P3BA 1VRQB 4G7FA 4K8DA 2WQYA 3QJ4A 4EQXA 4CNJA 4WCTA 5FS6A 3FBSA 2W55A 3QFBA 4IP5A 1LPFA 3P4QA 1EBGA 3AE2A 4JN7A 2H88A 4APNA 1PJ7A 1PBDA 4JY2A 1VQWA 2P8CA 3T31A 3DA1A 1CJ3A 2VZ2A
chains in the Genus database with same CATH topology
4AOSA 2AR8A 3AE1A 4J2WA 2GR1A 3K7TA 2GEWA 4RG3A 5U63A 1PBEA 3QSSA 4FDCB 3DJJA 3NN0X 3GD4A 4H4TA 2BYBA 1H86A 2Q0KA 1ZP0A 1FEAA 2R4EA 2VQBA 5KMSA 2VOUA 1ZK7A 2GRTA 2OAMA 1TDNA 1DOCA 1JRXA 3NK1X 1O94A 2FJBA 3UKHA 2RGJA 3OZ2A 1LTXR 4TM0A 5GSNA 5C2TA 2X3NA 2UZZA 3RP6A 3VRBA 1CBOA 3VRDB 4YXDA 4OPTA 4CY6A 4DGKA 2B76A 4G9KA 2C67A 4X4JA 4A79A 4AT0A 2VQ7A 1YKJA 3KKJA 3EF6A 2BRAA 4X9NA 4XXGA 2IVDA 4CY8A 2YG4A 1GTHA 4J33A 4BJYA 5IPYA 1NEKA 3CNJA 2APGA 3SGLA 2JB1A 1YQ3A 2WU5A 4B65A 2BS4A 2BK4A 1S2YA 5L46A 2ACZA 3LZWA 3B3RA 4ZN0A 2WP5A 4HB9A 2C7GA 3LOVA 1F8SA 1ZOVA 1XHCA 3GDPA 4ECHA 4LIIA 1L9DA 3DK4A 3T2YA 2JB3A 4A6NB 1P2HA 1H2IA 2X50A 3AE7A 1IUTA 4U8JA 3UKLA 2CFYA 1EL5A 1BKWA 2YAUA 2B7SA 2XCGA 2YLSA 5FS8A 3G5SA 4NTCA 1CJ2A 1KNPA 1N4UA 2GQFA 2C3CA 2RGHA 3DK8A 1HYUA 1PJ5A 1NENA 1TYPA 4BURA 1QO8A 4YKGA 1JNRA 2GH5A 2C76A 4P9SA 3M12A 4RSLA 1F8RA 2CVJA 2YQUA 4U2TA 1D7LA 2XVFA 4DSHA 1FEBA 5U1OA 4J57A 5JCKA 4N9XA 3UKPA 2BC1A 4DSGA 4K5RA 3QSMA 4TLZA 4U8MA 3UKKA 1IUWA 1COYA 3SZ0A 4NTEA 4U2SA 3CMMA 1GREA 3CNPA 5EOWA 4YSHA 3LXDA 3NHOX 3LADA 1LJ1A 4HA6A 5KXJA 2W0HA 4Z24A 1B4VA 5DBJA 3ZDNA 4YWOA 4B68A 4CRTA 1GRTA 4JDRA 3CNTA 2C3DA 3M0OA 4Y4LA 2BA9A 4H4VA 4UDQA 4USQA 1KFYA 2EQ7A 1E1LA 4II3A 3L5OA 3AECA 2I0ZA 2Z5XA 3GWDA 3DMEA 3NTAA 3IC9A 4Z26A 2YLXA 5TR3A 4Y4NA 1YQZA 2C70A 3KA7A 4KPRA 3S61A 1V59A 3IHGA 5M10A 4H2RA 4BK3A 4FK1C 1GSNA 4D04A 2R0GA 3AB1A 4U8NA 4NEWA 2H89A 4YSYA 1OJCA 3CTYA 3BHFA 4ICYA 4PAAA 3KD9A 2YG3A 3F8RA 2F5ZA 3H8IA 1E7PA 4BK1A 1KNRA 1PS9A 2BXSA 4UDRA 4A5LA 3GSIA 3AD7B 1GRBA 1GXFA 2WDQA 1KF6A 4BV6A 3ISHA 4IA5A 1GPEA 2GR3A 1Y56A 2WOVA 3AD9B 2E4GA 4J36A 2C73A 4H50A 4H4QA 1CL0A 2O9ZA 3Q9TA 4NZHA 4H4UA 1GTEA 1KSUA 1S3EA 3CN8A 3GD3A 4CNKA 3EPTA 3GYIA 2BK3A 1QLBA 1BWCA 3JSKA 2YVJA 4PABA 3CNSA 1W4XA 3P9UA 1GRAA 4O5QA 4AOXA 3NG7X 3P1WA 5HHFA 4E0VA 1TDOA 1CC2A 3AE9A 3LJPA 1OJ9A 1D4EA 3V76A 3VR8A 4AP1A 5BRTA 3ALLA 1L0VA 1ZX9A 2VRLA 2JBVA 4EIQA 2Y6QA 3IF9A 3AE8A 3QVRA 3UTHA 1S7MA 2AAQA 2XYOA 3GRSA 1GNDA 2BXRA 1ZMCA 4ZCCA 4UDPA 5HXIA 2EQ6A 5KWFA 1PXBA 3ITJA 3KU9A 4IVOB 4NNJA 4CBQA 3UOZA 4G73A 4GAPA 4H4ZA 3FMWA 2EQ8A 2Q7VA 1GRFA 2RABA 3NH3X 3SZFA 4XWRA 2WPEA 2XFPA 1E1NA 5KMRA 1CC6A 1GOSA 1CJCA 4AT2A 3UP5A 3CGEA 4Z2RA 1YY5A 2X8HA 4O5UA 1DOEA 3K7QX 1M64A 2CULA 3M13A 3G5RA 3FIMB 3AYIA 1OJDA 5GRTA 1JU2A 3LB8A 2OLNA 4K2XA 3REDA 2GR2A 1ZOYA 3NK2X 3AE3A 2V3AA 2Q6UA 2R45A 3DGHA 2V61A 2YM2A 2HQMA 2YLWA 3BI4A 3AE4A 4OCGA 2R4JA 2YLZA 4Y4MA 1H6VA 4CCQA 1BZLA 3EAOA 5IQ4A 1GRHA 3AEBA 2C4CA 4J56A 5FS7A 1JOAA 3ICTA 3CGCA 1KSSA 2Y6RA 4YTMA 1RP0A 3GYJA 5FS9A 2X8GA 3PS9A 2WDRA 3CIRA 3NN6X 1YQ4A 3SZCA 3FG2P 3NGCX 3AYLA 2BS2A 2XLRA 4NTDA 3PVCA 2ZZCA 2PHHA 1MO9A 2VVMA 3RHAA 2A89A 1ONFA 3AWIA 4Z2TA 1DNCA 5HYMA 1N4VA 1B8SA 2YWLA 3GWFA 3SY4A 3URHA 4U2LA 2XFQA 2XFUA 3UTFA 1NPXA 2A87A 2ZZBA 2GMHA 4A6NA 3H4KA 1LQUA 2YR4A 4BK2A 1CF3A 4IV9A 4CCRA 4A65A 3IHMA 2GVCA 2GB0A 4H4RA 1Q1RA 2EQ9A 5BUKA 2XLPA 3NYEA 4EMWA 2IVEA 2OLOA 4IA6A 3ALJA 1TRBA 2GMJA 4H4YA 1D5TA 2FJDA 4C5OA 3CPIG 1H81A 1NG3A 2BK5A 4YTPA 1VDCA 2XDOA 3AEGA 4OVIA 4H2PA 4TLXA 2GV8A 3DH9A 2JAEA 1FECA 1O95A 4I59A 4H4WA 3SYIA 5BULA 2E1MA 1GESA 4WX1A 5JCMA 3GDNA 1F8WA 3UOXA 3NIXA 3E1TA 1E39A 3NNEA 1PDHA 2YR5A 3F8PA 1TDFA 4YKFA 3NKSA 4REKA 4A9WA 5EBKA 4AP3A 3CPHG 3D8XA 1PBBA 3DJDA 2QA1A 1RYIA 3UKQA 3CGBA 2BC0A 2PYXA 1D4CA 4LA1A 1E6EA 3HYWA 4C3YA 2Q0LA 3DGZA 3AYJA 2WS3A 5C3JA 1XANA 3V3NA 5KNLA 4EQWA 1REOA 4ZCDA 1EL7A 3VRAA 1Y56B 3C4NA 3SM8A 4EMJA 1K4QA 3GRTA 2XFOA 5KOWA 1GETA 2X8CA 3CGDA 1EBDA 1TYTA 2YLRA 4X9MA 2X99A 1OJAA 3SZWA 2WP6A 5KMQA 4G6GA 4EQSA 2YG7A 2NPXA 4GAVA 1ZMDA 2XVJA 5U25A 1BF3A 3AEDA 3C4AA 2BCGG 4C3XA 2GR0A 3VR9A 4OPUA 3NYFA 1BGJA 3SFEA 4GRTA 5IQ1A 4B67A 2OALA 3K7MX 1GERA 2V6OA 1NAAA 3AEAA 4RG4A 1H83A 4H7UA 2JK6A 2VVLG 1D7YA 1GV4A 4I58A 2BACA 1S3BA 2QAEA 2ZBWA 3PO7A 5HY5A 4EM4A 2GF3A 3SXIA 1QJDA 1H7WA 3BNMA 1VG9A 1ZDLA 2YVFA 3V3OA 3AEEA 1PXCA 3UKFA 1SEZA 4UP3A 3D9XA 5KMPA 3RP7A 1ZY8A 3II4A 4YT0A 3L1RA 3H8LA 5JRBA 1TDEA 1JNZA 2GAHB 4XWZA 4KX6A 2WBAA 4LU6A 3KLJA 1CJ4A 2WU2A 1MOKA 1L9CA 3T14A 1TDKA 2BABA 3C96A 1GALA 2C64A 2QA2A 4GDEA 3PG6A 1EL8A 3ICRA 3SFDA 4YSXA 4ADWA 1EL9A 1K0JA 1IUUA 1NHRA 1UKVG 5KRQA 4J34A 5JCNA 1K0LA 3BI5A 4MJWA 4G74A 5J60A 1AOGA 3NRNA 4GUVA 2B7RA 1DJNA 3AE6A 2WP9A 2B9YA 3SQPA 1OJTA 2C65A 3K30A 5KVHA 3CPJG 4TM1A 4BJZA 4H4SA 4YTNA 1IUXA 3ABVA 4C74A 2YG6A 3SX6A 3KPKA 1N1PA 2RGOA 2XFNA 1KDGA 4DNAA 5BVAA 1E1KA 2BRYA 2R9ZA 2C66A 4H2QA 2DKIA 1GRGA 3KPFA 1KN0A 1PBCA 2R46A 2FJEA 2XLSA 4II2A 2C75A 1NHSA 4B1BA 2VRMA 4U8OA 2JB2A 3D1CA 2XVEA 3ZYXA 2TMDA 3L8KA 1F3PA 3GMBA 3HYXA 1DJQA 3NK0X 4B64A 1ZKQA 4EM3A 3DK9A 3F8DA 5J7XA 4IVMB 4A7AA 4EMIA 2B9XA 1LVLA 2WHDA 4JNAA 2WOWA 1IUSA 2WESA 4Z43A 2WEUA 3AEFA 3CNDA 3ALMA 5M0ZA 3NLCA 4USRA 1L9EA 3UCLA 1Q1WA 1E1MA 1H82A 4GR1A 4J31A 2WETA 1JEHA 2J3NA 1K0IA 4JY3A 3G5QA 3B6DA 2YG5A 1CC4A 4EIPA 4GDPA 1RSGA 3HZLA 3GYXA 2WPFA 3NTDA 2JKCA 2E5VA 3O0HA 3T2ZA 2YVGA 3DJGX 4OPGA 2V5ZA 1NG4A 1Y0PA 2FBWA 1DXLA 3GMCA 1XPQA 2QCUA 4Z44A 3NT6A 4TM4A 4K22A 5ER0A 5FMHA 1PN0A 3I3LA 3BNUA 1NHQA 3OC4A 2WDVA 1Z6LA 4Z2UA 3UKAA 4H4PA 4TM3A 1XDIA 3QSEA 5KOXA 4OPCA 3BHKA 3RNMA 1PJ6A 3IWAA 3NYCA 4K5SA 2V60A 4U8LA 2GQWA 1P2EA 3UOYA 2VVLA 5JCIA 1IUVA 2Z5YA 2TPRA 1BGNA 1H7XA 3T0KA 1CHUA 2BCPA 1JRZA 3ATRA 1FCDA 1F6MA 4JQ9A 1S2QA 4G6HA 1GT8A 1ELIA 2C72A 3AD8B 3T2KA 4NWZA 1DODA 3LZXA 3P4RA 2CDUA 4GF7A 1LQTA 4C77A 2YLTA 4M52A 2R0PA 3DJEA 3FPZA 2B9WA 4OPDA 1FOHA 1PBFA 2AQJA 4U8KA 3UTGA 5CQFA 4YSZA 3Q6JA 2GAGB 1MXTA 3T37A 4H2NA 4JN9A 3VQRA 1NDAA 1JRYA 4D03A 3AXBA 1IJHA 4K7ZA 1DOBA 3P4SA 4A99A 1H84A 2YM1A 4B66A 3BI2A 2A8XA 4B69A 3UTEA 1FL2A 1X31B 2XVIA 5EB5A 2DKHA 4B63A 4Z25A 5CKUA 4OPLA 1VG0A 3KVEA 2R0CA 3UP4A 5KVIA 5JCLA 3AE5A 2XVHA 1GEUA 2XLUA 2YR6A 4FX9A 3HYVA 2ARDA 4EQRA 1N4WA 1VRQB 3I6DA 4OPIA 4NEVA 3R9UA 1Q9IA 3S5WA 4K8DA 2WQYA 3ICSA 5EB4A 3QJ4A 3P4PA 4EQXA 1O5WA 1PHHA 4CNJA 3WE0A 2V3BA 4WCTA 5FS6A 2XLTA 4H4XA 3FBSA 3QFBA 4GCMA 1D4DA 1B37A 3ADAB 1NHPA 1LPFA 1LV0A 3P4QA 3AE2A 3UOVA 2H88A 4APNA 2IIDA 2WOIA 3QFAA 2NVKX 1PXAA 1PJ7A 3QVPA 2BS3A 3ATQA 2OA1A 4U8IA 1PBDA 4U8PA 4JNQA 4JY2A 2WPCA 2FJAA 1VQWA 3RP8A 3T31A 2ZZ0A 1M6IA 3DA1A 1B5QA 1CJ3A 3COXA 2VZ2A 3EANA 5LV9A 4FK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AOS A;  2AR8 A;  3AE1 A;  4J2W A;  2GR1 A;  3K7T A;  2GEW A;  4RG3 A;  5U63 A;  1PBE A;  3QSS A;  4FDC B;  3DJJ A;  3NN0 X;  3GD4 A;  4H4T A;  2BYB A;  1H86 A;  2Q0K A;  1ZP0 A;  1FEA A;  2R4E A;  2VQB A;  2VOU A;  1ZK7 A;  2GRT A;  2OAM A;  1TDN A;  1DOC A;  1JRX A;  3NK1 X;  1O94 A;  2FJB A;  3UKH A;  2RGJ A;  3OZ2 A;  1LTX R;  4TM0 A;  5GSN A;  5C2T A;  2X3N A;  2UZZ A;  3RP6 A;  3VRB A;  1CBO A;  3VRD B;  4YXD A;  4OPT A;  4CY6 A;  4DGK A;  2B76 A;  2C67 A;  4X4J A;  4A79 A;  4AT0 A;  2VQ7 A;  1YKJ A;  3KKJ A;  3EF6 A;  2IVD A;  4X9N A;  4XXG A;  4CY8 A;  2YG4 A;  1GTH A;  4J33 A;  4BJY A;  5IPY A;  1NEK A;  3CNJ A;  2APG A;  3SGL A;  2JB1 A;  1YQ3 A;  2WU5 A;  4B65 A;  2BS4 A;  2BK4 A;  1S2Y A;  5L46 A;  2ACZ A;  3LZW A;  3B3R A;  4ZN0 A;  2WP5 A;  4HB9 A;  2C7G A;  3LOV A;  1F8S A;  1ZOV A;  1XHC A;  3GDP A;  4ECH A;  4LII A;  1L9D A;  3DK4 A;  2JB3 A;  4A6N B;  1P2H A;  2X50 A;  3AE7 A;  1IUT A;  4U8J A;  3UKL A;  2CFY A;  1EL5 A;  1BKW A;  2YAU A;  2B7S A;  2XCG A;  2YLS A;  5FS8 A;  3G5S A;  4NTC A;  1CJ2 A;  1KNP A;  1N4U A;  2GQF A;  2C3C A;  2RGH A;  3DK8 A;  1HYU A;  1PJ5 A;  1NEN A;  1TYP A;  4BUR A;  1QO8 A;  4YKG A;  1JNR A;  2GH5 A;  2C76 A;  4P9S A;  3M12 A;  4RSL A;  1F8R A;  2CVJ A;  2YQU A;  4U2T A;  1D7L A;  2XVF A;  4DSH A;  1FEB A;  5U1O A;  4J57 A;  5JCK A;  4N9X A;  3UKP A;  2BC1 A;  4DSG A;  4K5R A;  3QSM A;  4TLZ A;  4U8M A;  3UKK A;  1IUW A;  1COY A;  4NTE A;  4U2S A;  1GRE A;  3CNP A;  5EOW A;  4YSH A;  3LXD A;  3NHO X;  3LAD A;  1LJ1 A;  4HA6 A;  5KXJ A;  2W0H A;  4Z24 A;  1B4V A;  5DBJ A;  3ZDN A;  4YWO A;  4B68 A;  4CRT A;  1GRT A;  4JDR A;  3CNT A;  2C3D A;  3M0O A;  4Y4L A;  2BA9 A;  4H4V A;  4UDQ A;  4USQ A;  1KFY A;  2EQ7 A;  1E1L A;  3AEC A;  2I0Z A;  2Z5X A;  3GWD A;  3DME A;  3NTA A;  3IC9 A;  4Z26 A;  2YLX A;  5TR3 A;  4Y4N A;  1YQZ A;  2C70 A;  3KA7 A;  4KPR A;  3S61 A;  1V59 A;  3IHG A;  5M10 A;  4H2R A;  4BK3 A;  4FK1 C;  1GSN A;  4D04 A;  2R0G A;  3AB1 A;  4U8N A;  4NEW A;  2H89 A;  4YSY A;  1OJC A;  3CTY A;  3BHF A;  4ICY A;  4PAA A;  3KD9 A;  2YG3 A;  3F8R A;  2F5Z A;  3H8I A;  1E7P A;  4BK1 A;  1KNR A;  1PS9 A;  2BXS A;  4UDR A;  4A5L A;  3GSI A;  3AD7 B;  1GRB A;  1GXF A;  2WDQ A;  1KF6 A;  4BV6 A;  3ISH A;  4IA5 A;  1GPE A;  2GR3 A;  1Y56 A;  2WOV A;  3AD9 B;  2E4G A;  4J36 A;  2C73 A;  4H50 A;  4H4Q A;  1CL0 A;  2O9Z A;  3Q9T A;  4NZH A;  4H4U A;  1GTE A;  1KSU A;  1S3E A;  3CN8 A;  3GD3 A;  4CNK A;  3EPT A;  3GYI A;  2BK3 A;  1QLB A;  1BWC A;  3JSK A;  2YVJ A;  4PAB A;  3CNS A;  1W4X A;  3P9U A;  1GRA A;  4O5Q A;  4AOX A;  3NG7 X;  3P1W A;  5HHF A;  4E0V A;  1TDO A;  1CC2 A;  3AE9 A;  3LJP A;  1OJ9 A;  1D4E A;  3V76 A;  3VR8 A;  4AP1 A;  5BRT A;  3ALL A;  1L0V A;  1ZX9 A;  2VRL A;  2JBV A;  4EIQ A;  2Y6Q A;  3IF9 A;  3AE8 A;  3QVR A;  3UTH A;  2AAQ A;  2XYO A;  3GRS A;  1GND A;  2BXR A;  1ZMC A;  4ZCC A;  4UDP A;  5HXI A;  2EQ6 A;  5KWF A;  1PXB A;  3ITJ A;  3KU9 A;  4IVO B;  4CBQ A;  3UOZ A;  4H4Z A;  3FMW A;  2EQ8 A;  2Q7V A;  1GRF A;  2RAB A;  3NH3 X;  4XWR A;  2WPE A;  2XFP A;  1E1N A;  1CC6 A;  1GOS A;  1CJC A;  4AT2 A;  3UP5 A;  3CGE A;  4Z2R A;  1YY5 A;  2X8H A;  4O5U A;  1DOE A;  3K7Q X;  1M64 A;  2CUL A;  3M13 A;  3G5R A;  3FIM B;  3AYI A;  1OJD A;  5GRT A;  1JU2 A;  3LB8 A;  2OLN A;  4K2X A;  3RED A;  2GR2 A;  1ZOY A;  3NK2 X;  3AE3 A;  2Q6U A;  2R45 A;  2V3A A;  3DGH A;  2V61 A;  2YM2 A;  2HQM A;  2YLW A;  3BI4 A;  3AE4 A;  4OCG A;  2R4J A;  2YLZ A;  4Y4M A;  1H6V A;  4CCQ A;  1BZL A;  3EAO A;  5IQ4 A;  1GRH A;  3AEB A;  4J56 A;  5FS7 A;  1JOA A;  3ICT A;  3CGC A;  1KSS A;  2Y6R A;  4YTM A;  1RP0 A;  3GYJ A;  5FS9 A;  2X8G A;  3PS9 A;  2WDR A;  3CIR A;  3NN6 X;  1YQ4 A;  3FG2 P;  3NGC X;  3AYL A;  2BS2 A;  2XLR A;  4NTD A;  3PVC A;  2ZZC A;  2PHH A;  1MO9 A;  2VVM A;  3RHA A;  2A89 A;  1ONF A;  3AWI A;  4Z2T A;  1DNC A;  5HYM A;  1N4V A;  1B8S A;  2YWL A;  3GWF A;  3URH A;  4U2L A;  2XFQ A;  2XFU A;  3UTF A;  1NPX A;  2A87 A;  2ZZB A;  2GMH A;  4A6N A;  3H4K A;  1LQU A;  2YR4 A;  4BK2 A;  1CF3 A;  4IV9 A;  4CCR A;  4A65 A;  3IHM A;  2GVC A;  2GB0 A;  4H4R A;  1Q1R A;  2EQ9 A;  5BUK A;  2XLP A;  3NYE A;  4EMW A;  2IVE A;  2OLO A;  4IA6 A;  3ALJ A;  1TRB A;  2GMJ A;  4H4Y A;  1D5T A;  2FJD A;  4C5O A;  3CPI G;  1H81 A;  1NG3 A;  2BK5 A;  4YTP A;  1VDC A;  2XDO A;  3AEG A;  4OVI A;  4H2P A;  4TLX A;  2GV8 A;  3DH9 A;  2JAE A;  1FEC A;  1O95 A;  4I59 A;  4H4W A;  5BUL A;  2E1M A;  1GES A;  4WX1 A;  5JCM A;  3GDN A;  1F8W A;  3UOX A;  3NIX A;  3E1T A;  1E39 A;  3NNE A;  1PDH A;  2YR5 A;  3F8P A;  1TDF A;  4YKF A;  3NKS A;  4REK A;  4A9W A;  5EBK A;  4AP3 A;  3CPH G;  3D8X A;  1PBB A;  3DJD A;  2QA1 A;  1RYI A;  3UKQ A;  3CGB A;  2BC0 A;  2PYX A;  1D4C A;  4LA1 A;  1E6E A;  4C3Y A;  2Q0L A;  3DGZ A;  3AYJ A;  2WS3 A;  5C3J A;  1XAN A;  3V3N A;  4EQW A;  1REO A;  4ZCD A;  1EL7 A;  3VRA A;  1Y56 B;  3C4N A;  3SM8 A;  4EMJ A;  1K4Q A;  3GRT A;  2XFO A;  5KOW A;  1GET A;  2X8C A;  3CGD A;  1EBD A;  1TYT A;  2YLR A;  4X9M A;  2X99 A;  1OJA A;  2WP6 A;  4EQS A;  2YG7 A;  2NPX A;  1ZMD A;  2XVJ A;  5U25 A;  1BF3 A;  3AED A;  3C4A A;  2BCG G;  4C3X A;  2GR0 A;  3VR9 A;  4OPU A;  3NYF A;  1BGJ A;  3SFE A;  4GRT A;  5IQ1 A;  4B67 A;  2OAL A;  3K7M X;  1GER A;  2V6O A;  1NAA A;  3AEA A;  4RG4 A;  1H83 A;  4H7U A;  2JK6 A;  2VVL G;  1D7Y A;  1GV4 A;  4I58 A;  2BAC A;  1S3B A;  2QAE A;  2ZBW A;  3PO7 A;  5HY5 A;  4EM4 A;  2GF3 A;  1QJD A;  1H7W A;  3BNM A;  1VG9 A;  1ZDL A;  2YVF A;  3V3O A;  3AEE A;  1PXC A;  3UKF A;  1SEZ A;  4UP3 A;  3RP7 A;  1ZY8 A;  3II4 A;  4YT0 A;  3L1R A;  3H8L A;  1TDE A;  2GAH B;  1JNZ A;  4XWZ A;  4KX6 A;  2WBA A;  4LU6 A;  3KLJ A;  1CJ4 A;  2WU2 A;  1MOK A;  1L9C A;  1TDK A;  2BAB A;  3C96 A;  1GAL A;  2C64 A;  2QA2 A;  4GDE A;  1EL8 A;  3ICR A;  3SFD A;  4YSX A;  4ADW A;  1EL9 A;  1K0J A;  1IUU A;  1NHR A;  1UKV G;  5KRQ A;  4J34 A;  5JCN A;  1K0L A;  3BI5 A;  4MJW A;  5J60 A;  1AOG A;  3NRN A;  4GUV A;  2B7R A;  1DJN A;  3AE6 A;  2WP9 A;  2B9Y A;  3SQP A;  1OJT A;  2C65 A;  3K30 A;  5KVH A;  3CPJ G;  4TM1 A;  4BJZ A;  4H4S A;  4YTN A;  1IUX A;  3ABV A;  4C74 A;  2YG6 A;  1N1P A;  2RGO A;  2XFN A;  1KDG A;  4DNA A;  5BVA A;  1E1K A;  2R9Z A;  2C66 A;  4H2Q A;  2DKI A;  1GRG A;  3KPF A;  1PBC A;  2R46 A;  2FJE A;  2XLS A;  4B1B A;  2C75 A;  1NHS A;  2VRM A;  4U8O A;  2JB2 A;  3D1C A;  2XVE A;  3ZYX A;  2TMD A;  3L8K A;  1F3P A;  3GMB A;  1DJQ A;  3NK0 X;  4B64 A;  1ZKQ A;  4EM3 A;  3DK9 A;  3F8D A;  5J7X A;  4IVM B;  4A7A A;  4EMI A;  2B9X A;  1LVL A;  2WHD A;  4JNA A;  2WOW A;  1IUS A;  2WES A;  4Z43 A;  2WEU A;  3AEF A;  3CND A;  3ALM A;  5M0Z A;  3NLC A;  4USR A;  1L9E A;  3UCL A;  1Q1W A;  1E1M A;  1H82 A;  4GR1 A;  4J31 A;  2WET A;  1JEH A;  2J3N A;  1K0I A;  4JY3 A;  3G5Q A;  3B6D A;  2YG5 A;  1CC4 A;  4EIP A;  4GDP A;  1RSG A;  3HZL A;  2WPF A;  3NTD A;  2JKC A;  2E5V A;  3O0H A;  2YVG A;  3DJG X;  4OPG A;  2V5Z A;  1NG4 A;  1Y0P A;  2FBW A;  1DXL A;  3GMC A;  1XPQ A;  2QCU A;  4Z44 A;  3NT6 A;  4TM4 A;  4K22 A;  5ER0 A;  5FMH A;  1PN0 A;  3I3L A;  3BNU A;  1NHQ A;  3OC4 A;  2WDV A;  1Z6L A;  4Z2U A;  3UKA A;  4H4P A;  4TM3 A;  1XDI A;  3QSE A;  5KOX A;  4OPC A;  3BHK A;  3RNM A;  1PJ6 A;  3IWA A;  3NYC A;  4K5S A;  2V60 A;  4U8L A;  2GQW A;  1P2E A;  3UOY A;  2VVL A;  5JCI A;  1IUV A;  2Z5Y A;  2TPR A;  1BGN A;  1H7X A;  1CHU A;  2BCP A;  1JRZ A;  3ATR A;  1FCD A;  1F6M A;  4JQ9 A;  1S2Q A;  1GT8 A;  1ELI A;  2C72 A;  3AD8 B;  1DOD A;  3LZX A;  3P4R A;  2CDU A;  4GF7 A;  1LQT A;  4C77 A;  2YLT A;  4M52 A;  2R0P A;  3DJE A;  3FPZ A;  2B9W A;  4OPD A;  1FOH A;  1PBF A;  2AQJ A;  4U8K A;  3UTG A;  5CQF A;  4YSZ A;  3Q6J A;  2GAG B;  1MXT A;  3T37 A;  4H2N A;  4JN9 A;  3VQR A;  1NDA A;  1JRY A;  4D03 A;  3AXB A;  1IJH A;  4K7Z A;  1DOB A;  3P4S A;  4A99 A;  1H84 A;  2YM1 A;  4B66 A;  3BI2 A;  2A8X A;  4B69 A;  3UTE A;  1FL2 A;  1X31 B;  2XVI A;  5EB5 A;  2DKH A;  4B63 A;  4Z25 A;  5CKU A;  4OPL A;  1VG0 A;  3KVE A;  2R0C A;  3UP4 A;  5KVI A;  5JCL A;  3AE5 A;  2XVH A;  1GEU A;  2XLU A;  2YR6 A;  4FX9 A;  2ARD A;  4EQR A;  1N4W A;  1VRQ B;  3I6D A;  4OPI A;  4NEV A;  3R9U A;  1Q9I A;  3S5W A;  4K8D A;  2WQY A;  3ICS A;  5EB4 A;  3QJ4 A;  3P4P A;  4EQX A;  1O5W A;  1PHH A;  4CNJ A;  3WE0 A;  2V3B A;  4WCT A;  5FS6 A;  2XLT A;  4H4X A;  3FBS A;  3QFB A;  4GCM A;  1D4D A;  1B37 A;  3ADA B;  1NHP A;  1LPF A;  1LV0 A;  3P4Q A;  3AE2 A;  3UOV A;  2H88 A;  4APN A;  2IID A;  2WOI A;  3QFA A;  2NVK X;  1PXA A;  1PJ7 A;  3QVP A;  2BS3 A;  3ATQ A;  2OA1 A;  4U8I A;  1PBD A;  4U8P A;  4JNQ A;  4JY2 A;  2WPC A;  2FJA A;  1VQW A;  3RP8 A;  2ZZ0 A;  1M6I A;  3DA1 A;  1B5Q A;  1CJ3 A;  3COX A;  2VZ2 A;  3EAN A;  5LV9 A;  4FK1 A; 
#chains in the Genus database with same CATH topology
 2GR1 A;  4RG3 A;  1PBE A;  2PU0 A;  2R4E A;  1FEA A;  1SJD A;  1ZK7 A;  4GIR A;  3UKH A;  4TM0 A;  2UZZ A;  3NRZ B;  4OPT A;  4CY6 A;  4G9K A;  2C67 A;  5IPY A;  4H19 A;  3SGL A;  2JB1 A;  1YQ3 A;  3ZVH A;  2BK4 A;  1S2Y A;  2BS4 A;  3LZW A;  3GC2 A;  4ZN0 A;  4ECH A;  4LII A;  2JB3 A;  4A6N B;  1P2H A;  2X50 A;  4U8J A;  2QJM A;  2CFY A;  2B7S A;  2YLS A;  5FS8 A;  1KNP A;  1N4U A;  3DK8 A;  3QPE A;  1TYP A;  4BUR A;  2GH5 A;  2C76 A;  1N60 C;  3M12 A;  4RSL A;  2PSN A;  3PWG A;  2XVF A;  5U1O A;  2BC1 A;  4K5R A;  4X2P A;  1IUW A;  1SJA A;  4NTE A;  4U2S A;  3T4W A;  4MMW A;  4TVW A;  1LJ1 A;  4HA6 A;  4CRT A;  4YWS A;  3ZDN A;  1GRT A;  3CNT A;  2C3D A;  2BA9 A;  4UDQ A;  4USQ A;  4II3 A;  3GWD A;  2I0Z A;  3IC9 A;  2YLX A;  5TR3 A;  1YQZ A;  3FCP A;  3R0U A;  4FK1 C;  3CB3 A;  3AB1 A;  4U8N A;  1OJC A;  2XGZ A;  1PS9 A;  4A5L A;  4HCD A;  2WDQ A;  1JPD X;  4MKS A;  4IA5 A;  2GR3 A;  2WOV A;  3AD9 B;  2E4G A;  4J36 A;  4H4U A;  1S3E A;  3GD3 A;  3P9U A;  1GRA A;  3NG7 X;  5HHF A;  1D4E A;  3ALL A;  3IK4 A;  3UTH A;  2AAQ A;  2XYO A;  1GND A;  1ZMC A;  3UOZ A;  4GAP A;  3FMW A;  1GRF A;  3NH3 X;  4AT2 A;  3UP5 A;  3K7Q X;  1M64 A;  2CUL A;  3G5R A;  3AYI A;  1OJD A;  2OLN A;  4K2X A;  3RED A;  2V3A A;  2V61 A;  3DGH A;  2YM2 A;  4OCG A;  4Y4M A;  2C4C A;  2NQL A;  5FS9 A;  3SZC A;  3TWA A;  2BS2 A;  2XLR A;  3A7U A;  3RHA A;  1N4V A;  3URH A;  4U2L A;  2GMH A;  4A6N A;  1LQU A;  4BK2 A;  4IV9 A;  4CCR A;  2ZAD A;  4DX3 A;  3ZLF A;  2GVC A;  2GB0 A;  4H4R A;  2POD A;  2XLP A;  4EMW A;  1SJC A;  2OLO A;  3ALJ A;  2GMJ A;  2FJD A;  4C5O A;  2HNE A;  2XDO A;  4OVI A;  2GGE A;  4H4W A;  3EUB 3;  1F8W A;  3UOX A;  4YKF A;  4A9W A;  3FXG A;  3D8X A;  3DJD A;  2QA1 A;  1D4C A;  2PGE A;  4C3Y A;  3V3N A;  3TJI A;  5KNL A;  4EQW A;  1K4Q A;  3GRT A;  5KOW A;  3GO2 A;  3R25 A;  2XSX A;  4DN1 A;  4G6G A;  3TCS A;  4GAV A;  1BF3 A;  3AED A;  2W3R A;  3C4A A;  2BCG G;  1BGJ A;  1NAA A;  2V6O A;  4H7U A;  2JK6 A;  1GV4 A;  2ZBW A;  4EM4 A;  3DGB A;  1VG9 A;  3AEE A;  3CYJ A;  5KMP A;  1TDE A;  3D46 A;  4XWZ A;  4KX6 A;  3KLJ A;  1CJ4 A;  3T14 A;  3C96 A;  3QTP A;  2QA2 A;  4GDE A;  1EL8 A;  2W3S A;  1EL9 A;  3BI5 A;  4MJW A;  4G74 A;  2P8B A;  4G8T A;  2B7R A;  2WP9 A;  1MDR A;  3CPJ G;  4BJZ A;  3SX6 A;  3KPK A;  4ROP A;  1N1P A;  5BVA A;  1E1K A;  1GRG A;  3KPF A;  1PBC A;  3JZU A;  2VRM A;  4J3Z A;  3MWC A;  3T6C A;  1F3P A;  3GMB A;  3OPS A;  4A7A A;  3DDM A;  5J7X A;  2WOW A;  1R6W A;  3SSZ A;  1H82 A;  4GR1 A;  3MY9 A;  5G5G B;  4FI4 A;  1V97 A;  3B6D A;  3N4E A;  2JKC A;  4OPG A;  1NG4 A;  1DXL A;  3AM9 A;  3NT6 A;  5ER0 A;  3TWB A;  3I3L A;  1Z6L A;  4HCL A;  3UKA A;  3BHK A;  3RNM A;  1PJ6 A;  3IWA A;  3NYC A;  2V60 A;  4U8L A;  2GQW A;  1IUV A;  1S2Q A;  4G6H A;  3AD8 B;  3T2K A;  4GF7 A;  3FPZ A;  3UGV A;  4HYR A;  3Q6J A;  3VFC A;  1TZZ A;  4H2N A;  1JRY A;  4K7Z A;  3P4S A;  4A99 A;  4B69 A;  3BI2 A;  2A8X A;  4GFI A;  3UTE A;  2GSH A;  4B63 A;  2DKH A;  5CKU A;  1VG0 A;  2R0C A;  1ELS A;  5JCL A;  1GEU A;  1MNS A;  3AN1 A;  3I6D A;  1Q9I A;  3UJE A;  5EB4 A;  3MQT A;  1N5W C;  4H4X A;  1NHP A;  1LV0 A;  3UOV A;  3QFA A;  2NVK X;  4U8I A;  4U8P A;  2FJA A;  2ZZ0 A;  1B5Q A;  3COX A;  1FIQ B;  3EAN A;  3AE1 A;  5U63 A;  3U9I A;  3DJJ A;  3R07 C;  3NN0 X;  3H70 A;  1H86 A;  2BYB A;  4J1O A;  2ONE A;  2VQB A;  5KMS A;  2VOU A;  2MUC A;  2OAM A;  1JRX A;  1LTX R;  5C2T A;  7ENL A;  3VRD B;  5FJT A;  1YKJ A;  3KKJ A;  4CY8 A;  2YG4 A;  1GTH A;  2APG A;  1IYX A;  2WU5 A;  3BJS A;  5L46 A;  3RGT A;  3B3R A;  3JVA A;  3T8Q A;  3AE7 A;  3BSM A;  1BKW A;  2QVH A;  1RVK A;  3G5S A;  4NTC A;  3I6T A;  1CJ2 A;  2C3C A;  1HYU A;  1JNR A;  4P9S A;  2CVJ A;  4JHM A;  1DTN A;  4J57 A;  4N9X A;  2PS2 A;  3OP2 A;  3QSM A;  2XH7 A;  3UJF A;  4K8G A;  2AKM A;  3CMM A;  5EOW A;  2QJJ A;  3NS1 B;  1JDF A;  3LAD A;  3SR6 B;  4B68 A;  2OQH A;  4YWO A;  4JDR A;  1KFY A;  2EQ7 A;  1E1L A;  3AEC A;  2Z5X A;  3DME A;  4Z26 A;  3S61 A;  1V59 A;  3IHG A;  4H2R A;  4BK3 A;  2R0G A;  3UCD A;  3BHF A;  4PAA A;  3F8R A;  2BXS A;  3AD7 B;  1GXF A;  1KF6 A;  4IT1 A;  4H50 A;  1CL0 A;  3Q9T A;  4IHC A;  5IDZ A;  3Q45 A;  1KSU A;  4CNK A;  1JRP A;  3HRD C;  3VCN A;  4PAB A;  2ZC8 A;  3CNS A;  3LJP A;  3MSY A;  2VRL A;  2P0I A;  3UCC A;  2Y6Q A;  3CXO A;  4GIS A;  2OVL A;  3GRS A;  4GYP C;  5KWF A;  4IVO B;  4NNJ A;  4G73 A;  1XPY A;  2GDQ A;  2RAB A;  3UXL A;  4XWR A;  5KMR A;  4M0X A;  2XFP A;  4Z2R A;  1YY5 A;  1WYG A;  1DOE A;  3M13 A;  2AL1 A;  3DG7 A;  3EEZ A;  1JU2 A;  2GR2 A;  1ZOY A;  3AE3 A;  2Q6U A;  2YLW A;  3AE4 A;  4KEM A;  1BZL A;  1TKK A;  4J56 A;  3ICT A;  3PK7 A;  3CGC A;  1KSS A;  4E8G A;  3CIR A;  1YQ4 A;  4NTD A;  3PVC A;  2PHH A;  4TVY A;  2VVM A;  2A89 A;  4Z2T A;  1B8S A;  2YWL A;  2XFQ A;  1NPX A;  2A87 A;  3H4K A;  2YR4 A;  2QJN A;  2EQ9 A;  3NYE A;  2AL2 A;  4IA6 A;  1TRB A;  3DFY A;  3NFU A;  4EWJ A;  3CPI G;  1NG3 A;  2BK5 A;  1VDC A;  3AEG A;  1NEL A;  4H2P A;  4TLX A;  3UJS A;  3P93 A;  1GES A;  5JCM A;  5FJP A;  3NNE A;  1PDH A;  1TDF A;  3NKS A;  4REK A;  2GGH A;  3CPH G;  1RYI A;  2PYX A;  2W54 A;  1E6E A;  2Q0L A;  3T9P A;  1XAN A;  4ZCD A;  1EL7 A;  2OX4 A;  1Y56 B;  3C4N A;  3SM8 A;  2XFO A;  2X8C A;  1TE6 A;  1TYT A;  4X9M A;  1OJA A;  3SZW A;  2WP6 A;  4EQS A;  3DER A;  4E4U A;  3VR9 A;  4GRT A;  4H2H A;  3AEA A;  2VVL G;  1D7Y A;  2BAC A;  2QAE A;  1SJB A;  1KCZ A;  4MGG A;  3DEQ A;  2YVF A;  4DXK A;  1PXC A;  3DG6 A;  3UKF A;  4YT0 A;  1ZY8 A;  5JRB A;  4M6U A;  4GME A;  3ZLG A;  2BAB A;  2FKP A;  3PG6 A;  3SFD A;  1NHR A;  1UKV G;  1WUE A;  5KRQ A;  1VQZ A;  3R0K A;  4KT2 A;  2C65 A;  3QN3 A;  4TM1 A;  4C74 A;  3ABV A;  3V5C A;  2RGO A;  2QQ6 A;  1XS2 A;  1FFV C;  2R46 A;  4B1B A;  4U8O A;  3VDG A;  2JB2 A;  2XVE A;  2TMD A;  1DJQ A;  4B64 A;  1ZKQ A;  4EM3 A;  3DK9 A;  4EMI A;  2B9X A;  4JNA A;  1IUS A;  2WES A;  2O56 A;  3ALM A;  3HPF A;  2WET A;  1JEH A;  4JY3 A;  3G5Q A;  1KKR A;  4GDP A;  1RSG A;  3HZL A;  2E5V A;  3T2Z A;  3DJG X;  1F9C A;  3ZVI A;  1Y0P A;  3GMC A;  1XPQ A;  4TM4 A;  3BNU A;  2WDV A;  2PP3 A;  4H4P A;  3RIT A;  5JCI A;  2DW7 A;  1BGN A;  3T0K A;  1CHU A;  5G5H B;  3ATR A;  1F6M A;  3QKE A;  5J04 A;  3AMZ A;  1LQT A;  2R0P A;  4IL2 A;  3DJE A;  2AQJ A;  2GAG B;  1ECQ A;  3SJN A;  3T37 A;  3FVD A;  3AXB A;  1H84 A;  5EB5 A;  5KVI A;  3AE5 A;  2XVH A;  4FX9 A;  3HYV A;  1N4W A;  3S5W A;  3ICS A;  3B9J B;  3P4P A;  1O5W A;  1PHH A;  3WE0 A;  2PU1 A;  4GCM A;  3ADA B;  1B37 A;  3I4K A;  2CHR A;  2IID A;  4HNC A;  2PMQ A;  3ATQ A;  4KPL A;  2OA1 A;  4JNQ A;  3VC5 A;  3RP8 A;  4FK1 A;  4J2W A;  1N5X A;  4E6M A;  4FDC B;  3MZN A;  1BQG A;  2Q0K A;  2QDD A;  1TDN A;  2FJB A;  2RGJ A;  3OZ2 A;  2PPG A;  3TOY A;  3ENL A;  3MKC A;  3RP6 A;  1CBO A;  4YXD A;  4DGK A;  2B76 A;  4HCH A;  4A79 A;  2VQ7 A;  2OLA A;  3EF6 A;  4XXG A;  3B97 A;  4BJY A;  4B65 A;  4IL0 A;  2WP5 A;  4HB9 A;  2C7G A;  1XHC A;  2QGY A;  1L9D A;  4JN8 A;  3DK4 A;  1H2I A;  1IUT A;  2YAU A;  2XCG A;  2RGH A;  4HN8 A;  1PJ5 A;  4YKG A;  1F8R A;  1X2H A;  4DSH A;  3UKP A;  2P88 A;  1ZXI C;  1FHV A;  1GRE A;  4YSH A;  3LXD A;  3NHO X;  5KXJ A;  2W0H A;  4Z24 A;  5DBJ A;  3M0O A;  4Y4L A;  4H4V A;  3OZM A;  3FJ4 A;  3L5O A;  3NTA A;  3Q4D A;  1P48 A;  1R0M A;  4Y4N A;  3UXK A;  1GSN A;  4NEW A;  2H89 A;  4YSY A;  4ICY A;  3KD9 A;  4BK1 A;  1EC8 A;  1KNR A;  4UDR A;  1EC9 A;  4BV6 A;  2OQY A;  3S47 A;  4IP4 A;  2C73 A;  2O9Z A;  4NZH A;  3P1W A;  2JBV A;  1S7M A;  2BXR A;  2E3T A;  5HXI A;  2EQ6 A;  3ZLH A;  1PXB A;  4CBQ A;  4H4Z A;  2EQ8 A;  3HW2 A;  2Q7V A;  1JPM A;  3TTE A;  3SZF A;  1VDV A;  2PTY A;  2X8H A;  1ONE A;  4O5U A;  3FIM B;  3ZVH B;  3STP A;  1L8P A;  2HQM A;  2YLZ A;  1H6V A;  4CCQ A;  5IQ4 A;  2XH2 A;  1GRH A;  3OZY A;  2Y6R A;  3V3W A;  4ZOH B;  3A7R A;  3FG2 P;  3NGC X;  3GD6 A;  1MO9 A;  1ONF A;  5HYM A;  3NVZ B;  3GWF A;  3SY4 A;  4H1Z A;  2XFU A;  3ETR B;  3D47 A;  4A3R A;  1CF3 A;  3VCC A;  4A65 A;  1Q1R A;  5BUK A;  2IVE A;  4GGH A;  2PTX A;  4H4Y A;  1H81 A;  4YTP A;  2JAE A;  3SYI A;  5BUL A;  3CAW A;  4WX1 A;  3NIX A;  3E1T A;  3TQP A;  2YR5 A;  4DYE A;  3CGB A;  2BC0 A;  4Z1Y A;  1MDL A;  3RO6 A;  4LA1 A;  3AYJ A;  3VRA A;  4EMJ A;  1GET A;  4GGB A;  1MUC A;  3VC6 A;  5KMQ A;  2GGG A;  1ZMD A;  2XVJ A;  4C3X A;  3NYF A;  3SFE A;  2OAL A;  3K7M X;  1GER A;  4RG4 A;  1H83 A;  4I58 A;  3PO7 A;  5HY5 A;  2GF3 A;  1QJD A;  3BNM A;  1OEP A;  1ZDL A;  3N6H A;  5FJU A;  4UP3 A;  3D9X A;  3NVV B;  3N4F A;  3RP7 A;  1JNZ A;  2WBA A;  1MOK A;  1L9C A;  2OKT A;  4HNL A;  1GAL A;  3TW9 A;  2PCE A;  1IUU A;  5J60 A;  3NRN A;  3AE6 A;  4Z17 A;  2B9Y A;  2I5Q A;  3SQP A;  1OJT A;  5KVH A;  3V5F A;  2POZ A;  2OPJ A;  4DNA A;  2BRY A;  4H2Q A;  1KN0 A;  2FJE A;  2XLS A;  4II2 A;  2C75 A;  1NHS A;  1X2G A;  3ZYX A;  3NK0 X;  3F8D A;  4H83 A;  4IVM B;  1LVL A;  4Z43 A;  5FJO A;  4ENL A;  3NLC A;  2PTZ A;  2PP1 A;  4J31 A;  4EIP A;  1CC4 A;  1NU5 A;  3GYX A;  1JCT A;  2YVG A;  3SN1 A;  3SQS A;  4K22 A;  3IJL A;  5FMH A;  1PN0 A;  3OC4 A;  1EC7 A;  3QSE A;  5KOX A;  2OO6 A;  4K5S A;  3UOY A;  1P2E A;  1N62 C;  2Z5Y A;  1H7X A;  1FCD A;  1GT8 A;  1ELI A;  1DOD A;  3LZX A;  4C77 A;  2YLT A;  2PA6 A;  4OPD A;  4U8K A;  1PBF A;  5CQF A;  1N63 C;  1MXT A;  3H12 A;  3ES7 A;  1NDA A;  2PGW A;  2XVI A;  4Z25 A;  1T3Q C;  1PDY A;  4HPN A;  4EQR A;  4OPI A;  4NEV A;  3R9U A;  1N61 C;  3RR1 A;  2V3B A;  2XLT A;  2OZ8 A;  1D4D A;  2WOI A;  3U4F A;  1PXA A;  3R10 A;  3QVP A;  2BS3 A;  1JRO A;  2WPC A;  2XH4 A;  1M6I A;  1BKH A;  5LV9 A;  4AOS A;  2AR8 A;  3K7T A;  2GEW A;  3QSS A;  2OZ3 A;  3NVW B;  3GD4 A;  4H4T A;  1ZP0 A;  2GRT A;  1DOC A;  3NK1 X;  1O94 A;  5GSN A;  2X3N A;  3VRB A;  4AT0 A;  4X4J A;  2IVD A;  2BRA A;  4X9N A;  4J33 A;  1NEK A;  3CNJ A;  5ENL A;  2ACZ A;  4A6G A;  3LOV A;  1F8S A;  1ZOV A;  3MUC A;  3GDP A;  3T2Y A;  3BOX A;  3UKL A;  1EL5 A;  3S5S A;  4GYP A;  2FYM A;  2GQF A;  2OZT A;  1NEN A;  1QO8 A;  4FP1 A;  2YQU A;  4U2T A;  1D7L A;  3CT2 A;  1WUF A;  3NO1 A;  1W6T A;  1FEB A;  5JCK A;  4DSG A;  4TLZ A;  4U8M A;  3UKK A;  1COY A;  3SZ0 A;  2GGI A;  3CNP A;  3VA8 A;  1B4V A;  2GGJ A;  5EU9 A;  2C70 A;  3KA7 A;  4KPR A;  3CXB A;  5M10 A;  2E5A A;  4D04 A;  3CTY A;  6ENL A;  2YG3 A;  2F5Z A;  3H8I A;  1E7P A;  3GSI A;  1GRB A;  3ISH A;  1GPE A;  1Y56 A;  2MNR A;  4H4Q A;  1GTE A;  3CN8 A;  3NZG A;  3EPT A;  3GYI A;  2BK3 A;  1QLB A;  1BWC A;  3JSK A;  2YVJ A;  1W4X A;  4O5Q A;  4AOX A;  3DFH A;  4E0V A;  1TDO A;  1CC2 A;  3AE9 A;  3VR8 A;  1OJ9 A;  4AP1 A;  3V76 A;  5BRT A;  1L0V A;  1ZX9 A;  4EIQ A;  3IF9 A;  3OW1 A;  3AE8 A;  3QVR A;  3KUM A;  4ZCC A;  4UDP A;  5BOF A;  3ITJ A;  3H7V A;  3KU9 A;  5FJR A;  2PP0 A;  2WPE A;  1FO4 A;  1E1N A;  4IZG A;  1CC6 A;  1GOS A;  1CJC A;  3PFR A;  3N6J A;  3CGE A;  2QDE A;  1MRA A;  2HXT A;  3EKG A;  5GRT A;  3LB8 A;  3NK2 X;  2R45 A;  3BI4 A;  2R4J A;  3OTR A;  4DWD A;  3EAO A;  2GL5 A;  3I6E A;  3AEB A;  3A7A A;  5FS7 A;  1JOA A;  4YTM A;  4F4R A;  1RP0 A;  2OFJ A;  1SB3 B;  3GYJ A;  2X8G A;  3TJ4 A;  2WDR A;  3PS9 A;  3NN6 X;  3AYL A;  2ZZC A;  3ES8 A;  2HXU A;  3FYY A;  1DNC A;  3AWI A;  3UTF A;  2ZZB A;  1P43 A;  2AKZ A;  3NVY B;  4K2S A;  3IHM A;  3UJR A;  3FV9 A;  1D5T A;  3IJI A;  2GV8 A;  3DH9 A;  1FEC A;  1O95 A;  4I59 A;  4KWS A;  2E1M A;  3GDN A;  3SN0 A;  1E39 A;  3F8P A;  2XH0 A;  5EBK A;  4AP3 A;  1PBB A;  2DW6 A;  3UKQ A;  3HYW A;  3DGZ A;  4ZA0 A;  2WS3 A;  5C3J A;  1RM6 B;  1REO A;  3CGD A;  4E4F A;  1EBD A;  3UJ2 A;  2YLR A;  2X99 A;  3QLD A;  3JW7 A;  2YG7 A;  2NPX A;  5U25 A;  4K1W A;  3DG3 A;  2GR0 A;  4OPU A;  3P0W A;  5IQ1 A;  4B67 A;  3GY1 A;  1S3B A;  3SXI A;  1H7W A;  3PWI A;  3V3O A;  1SEZ A;  1PDZ A;  3II4 A;  3L1R A;  3H8L A;  2GAH B;  4LU6 A;  2WU2 A;  1TDK A;  2C64 A;  3V4B A;  3ICR A;  4YSX A;  4ADW A;  1K0J A;  4J34 A;  5JCN A;  1K0L A;  1AOG A;  5BOE A;  4GUV A;  1DJN A;  3SBF A;  3K30 A;  4H4S A;  4YTN A;  1IUX A;  2YG6 A;  1STZ A;  3THU A;  2XFN A;  1KDG A;  2R9Z A;  2C66 A;  2DKI A;  4A35 A;  2PTW A;  4DHG A;  3DIP A;  4E5T A;  3D1C A;  3L8K A;  3HYX A;  1EBH A;  3H8A A;  3IJQ A;  3CK5 A;  2WHD A;  1E9I A;  2WEU A;  3AEF A;  3CND A;  5M0Z A;  2HZG A;  4USR A;  1L9E A;  3UCL A;  1Q1W A;  1E1M A;  3R11 A;  2J3N A;  1K0I A;  2YG5 A;  2WPF A;  3NTD A;  2P3Z A;  3O0H A;  3R1Z A;  3NXL A;  2AL2 B;  2V5Z A;  2FBW A;  2QCU A;  4Z44 A;  3SN4 A;  1FFU C;  1NHQ A;  4Z2U A;  4TM3 A;  1XDI A;  2OG9 A;  4OPC A;  1KKO A;  4ZCW A;  3K1G A;  1YEY A;  2VVL A;  2TPR A;  3RCY A;  1FHU A;  3DES A;  2BCP A;  1JRZ A;  4JQ9 A;  2C72 A;  4NWZ A;  3P4R A;  2CDU A;  4M52 A;  3RRA A;  2B9W A;  1FOH A;  3UTG A;  4YSZ A;  4JN9 A;  3VQR A;  4D03 A;  1KD0 A;  2RDX A;  1IJH A;  1DOB A;  4B66 A;  2YM1 A;  1FL2 A;  1X31 B;  4OPL A;  3KVE A;  3UP4 A;  2XLU A;  2YR6 A;  2ARD A;  3P3B A;  1VRQ B;  4G7F A;  4K8D A;  2WQY A;  3QJ4 A;  4EQX A;  4CNJ A;  4WCT A;  5FS6 A;  3FBS A;  2W55 A;  3QFB A;  4IP5 A;  1LPF A;  3P4Q A;  1EBG A;  3AE2 A;  4JN7 A;  2H88 A;  4APN A;  1PJ7 A;  1PBD A;  4JY2 A;  1VQW A;  2P8C A;  3T31 A;  3DA1 A;  1CJ3 A;  2VZ2 A; 
#chains in the Genus database with same CATH homology
 4AOS A;  2AR8 A;  3AE1 A;  4J2W A;  2GR1 A;  3K7T A;  2GEW A;  4RG3 A;  5U63 A;  1PBE A;  3QSS A;  4FDC B;  3DJJ A;  3NN0 X;  3GD4 A;  4H4T A;  2BYB A;  1H86 A;  2Q0K A;  1ZP0 A;  1FEA A;  2R4E A;  2VQB A;  5KMS A;  2VOU A;  1ZK7 A;  2GRT A;  2OAM A;  1TDN A;  1DOC A;  1JRX A;  3NK1 X;  1O94 A;  2FJB A;  3UKH A;  2RGJ A;  3OZ2 A;  1LTX R;  4TM0 A;  5GSN A;  5C2T A;  2X3N A;  2UZZ A;  3RP6 A;  3VRB A;  1CBO A;  3VRD B;  4YXD A;  4OPT A;  4CY6 A;  4DGK A;  2B76 A;  4G9K A;  2C67 A;  4X4J A;  4A79 A;  4AT0 A;  2VQ7 A;  1YKJ A;  3KKJ A;  3EF6 A;  2BRA A;  4X9N A;  4XXG A;  2IVD A;  4CY8 A;  2YG4 A;  1GTH A;  4J33 A;  4BJY A;  5IPY A;  1NEK A;  3CNJ A;  2APG A;  3SGL A;  2JB1 A;  1YQ3 A;  2WU5 A;  4B65 A;  2BS4 A;  2BK4 A;  1S2Y A;  5L46 A;  2ACZ A;  3LZW A;  3B3R A;  4ZN0 A;  2WP5 A;  4HB9 A;  2C7G A;  3LOV A;  1F8S A;  1ZOV A;  1XHC A;  3GDP A;  4ECH A;  4LII A;  1L9D A;  3DK4 A;  3T2Y A;  2JB3 A;  4A6N B;  1P2H A;  1H2I A;  2X50 A;  3AE7 A;  1IUT A;  4U8J A;  3UKL A;  2CFY A;  1EL5 A;  1BKW A;  2YAU A;  2B7S A;  2XCG A;  2YLS A;  5FS8 A;  3G5S A;  4NTC A;  1CJ2 A;  1KNP A;  1N4U A;  2GQF A;  2C3C A;  2RGH A;  3DK8 A;  1HYU A;  1PJ5 A;  1NEN A;  1TYP A;  4BUR A;  1QO8 A;  4YKG A;  1JNR A;  2GH5 A;  2C76 A;  4P9S A;  3M12 A;  4RSL A;  1F8R A;  2CVJ A;  2YQU A;  4U2T A;  1D7L A;  2XVF A;  4DSH A;  1FEB A;  5U1O A;  4J57 A;  5JCK A;  4N9X A;  3UKP A;  2BC1 A;  4DSG A;  4K5R A;  3QSM A;  4TLZ A;  4U8M A;  3UKK A;  1IUW A;  1COY A;  3SZ0 A;  4NTE A;  4U2S A;  3CMM A;  1GRE A;  3CNP A;  5EOW A;  4YSH A;  3LXD A;  3NHO X;  3LAD A;  1LJ1 A;  4HA6 A;  5KXJ A;  2W0H A;  4Z24 A;  1B4V A;  5DBJ A;  3ZDN A;  4YWO A;  4B68 A;  4CRT A;  1GRT A;  4JDR A;  3CNT A;  2C3D A;  3M0O A;  4Y4L A;  2BA9 A;  4H4V A;  4UDQ A;  4USQ A;  1KFY A;  2EQ7 A;  1E1L A;  4II3 A;  3L5O A;  3AEC A;  2I0Z A;  2Z5X A;  3GWD A;  3DME A;  3NTA A;  3IC9 A;  4Z26 A;  2YLX A;  5TR3 A;  4Y4N A;  1YQZ A;  2C70 A;  3KA7 A;  4KPR A;  3S61 A;  1V59 A;  3IHG A;  5M10 A;  4H2R A;  4BK3 A;  4FK1 C;  1GSN A;  4D04 A;  2R0G A;  3AB1 A;  4U8N A;  4NEW A;  2H89 A;  4YSY A;  1OJC A;  3CTY A;  3BHF A;  4ICY A;  4PAA A;  3KD9 A;  2YG3 A;  3F8R A;  2F5Z A;  3H8I A;  1E7P A;  4BK1 A;  1KNR A;  1PS9 A;  2BXS A;  4UDR A;  4A5L A;  3GSI A;  3AD7 B;  1GRB A;  1GXF A;  2WDQ A;  1KF6 A;  4BV6 A;  3ISH A;  4IA5 A;  1GPE A;  2GR3 A;  1Y56 A;  2WOV A;  3AD9 B;  2E4G A;  4J36 A;  2C73 A;  4H50 A;  4H4Q A;  1CL0 A;  2O9Z A;  3Q9T A;  4NZH A;  4H4U A;  1GTE A;  1KSU A;  1S3E A;  3CN8 A;  3GD3 A;  4CNK A;  3EPT A;  3GYI A;  2BK3 A;  1QLB A;  1BWC A;  3JSK A;  2YVJ A;  4PAB A;  3CNS A;  1W4X A;  3P9U A;  1GRA A;  4O5Q A;  4AOX A;  3NG7 X;  3P1W A;  5HHF A;  4E0V A;  1TDO A;  1CC2 A;  3AE9 A;  3LJP A;  1OJ9 A;  1D4E A;  3V76 A;  3VR8 A;  4AP1 A;  5BRT A;  3ALL A;  1L0V A;  1ZX9 A;  2VRL A;  2JBV A;  4EIQ A;  2Y6Q A;  3IF9 A;  3AE8 A;  3QVR A;  3UTH A;  1S7M A;  2AAQ A;  2XYO A;  3GRS A;  1GND A;  2BXR A;  1ZMC A;  4ZCC A;  4UDP A;  5HXI A;  2EQ6 A;  5KWF A;  1PXB A;  3ITJ A;  3KU9 A;  4IVO B;  4NNJ A;  4CBQ A;  3UOZ A;  4G73 A;  4GAP A;  4H4Z A;  3FMW A;  2EQ8 A;  2Q7V A;  1GRF A;  2RAB A;  3NH3 X;  3SZF A;  4XWR A;  2WPE A;  2XFP A;  1E1N A;  5KMR A;  1CC6 A;  1GOS A;  1CJC A;  4AT2 A;  3UP5 A;  3CGE A;  4Z2R A;  1YY5 A;  2X8H A;  4O5U A;  1DOE A;  3K7Q X;  1M64 A;  2CUL A;  3M13 A;  3G5R A;  3FIM B;  3AYI A;  1OJD A;  5GRT A;  1JU2 A;  3LB8 A;  2OLN A;  4K2X A;  3RED A;  2GR2 A;  1ZOY A;  3NK2 X;  3AE3 A;  2V3A A;  2Q6U A;  2R45 A;  3DGH A;  2V61 A;  2YM2 A;  2HQM A;  2YLW A;  3BI4 A;  3AE4 A;  4OCG A;  2R4J A;  2YLZ A;  4Y4M A;  1H6V A;  4CCQ A;  1BZL A;  3EAO A;  5IQ4 A;  1GRH A;  3AEB A;  2C4C A;  4J56 A;  5FS7 A;  1JOA A;  3ICT A;  3CGC A;  1KSS A;  2Y6R A;  4YTM A;  1RP0 A;  3GYJ A;  5FS9 A;  2X8G A;  3PS9 A;  2WDR A;  3CIR A;  3NN6 X;  1YQ4 A;  3SZC A;  3FG2 P;  3NGC X;  3AYL A;  2BS2 A;  2XLR A;  4NTD A;  3PVC A;  2ZZC A;  2PHH A;  1MO9 A;  2VVM A;  3RHA A;  2A89 A;  1ONF A;  3AWI A;  4Z2T A;  1DNC A;  5HYM A;  1N4V A;  1B8S A;  2YWL A;  3GWF A;  3SY4 A;  3URH A;  4U2L A;  2XFQ A;  2XFU A;  3UTF A;  1NPX A;  2A87 A;  2ZZB A;  2GMH A;  4A6N A;  3H4K A;  1LQU A;  2YR4 A;  4BK2 A;  1CF3 A;  4IV9 A;  4CCR A;  4A65 A;  3IHM A;  2GVC A;  2GB0 A;  4H4R A;  1Q1R A;  2EQ9 A;  5BUK A;  2XLP A;  3NYE A;  4EMW A;  2IVE A;  2OLO A;  4IA6 A;  3ALJ A;  1TRB A;  2GMJ A;  4H4Y A;  1D5T A;  2FJD A;  4C5O A;  3CPI G;  1H81 A;  1NG3 A;  2BK5 A;  4YTP A;  1VDC A;  2XDO A;  3AEG A;  4OVI A;  4H2P A;  4TLX A;  2GV8 A;  3DH9 A;  2JAE A;  1FEC A;  1O95 A;  4I59 A;  4H4W A;  3SYI A;  5BUL A;  2E1M A;  1GES A;  4WX1 A;  5JCM A;  3GDN A;  1F8W A;  3UOX A;  3NIX A;  3E1T A;  1E39 A;  3NNE A;  1PDH A;  2YR5 A;  3F8P A;  1TDF A;  4YKF A;  3NKS A;  4REK A;  4A9W A;  5EBK A;  4AP3 A;  3CPH G;  3D8X A;  1PBB A;  3DJD A;  2QA1 A;  1RYI A;  3UKQ A;  3CGB A;  2BC0 A;  2PYX A;  1D4C A;  4LA1 A;  1E6E A;  3HYW A;  4C3Y A;  2Q0L A;  3DGZ A;  3AYJ A;  2WS3 A;  5C3J A;  1XAN A;  3V3N A;  5KNL A;  4EQW A;  1REO A;  4ZCD A;  1EL7 A;  3VRA A;  1Y56 B;  3C4N A;  3SM8 A;  4EMJ A;  1K4Q A;  3GRT A;  2XFO A;  5KOW A;  1GET A;  2X8C A;  3CGD A;  1EBD A;  1TYT A;  2YLR A;  4X9M A;  2X99 A;  1OJA A;  3SZW A;  2WP6 A;  5KMQ A;  4G6G A;  4EQS A;  2YG7 A;  2NPX A;  4GAV A;  1ZMD A;  2XVJ A;  5U25 A;  1BF3 A;  3AED A;  3C4A A;  2BCG G;  4C3X A;  2GR0 A;  3VR9 A;  4OPU A;  3NYF A;  1BGJ A;  3SFE A;  4GRT A;  5IQ1 A;  4B67 A;  2OAL A;  3K7M X;  1GER A;  2V6O A;  1NAA A;  3AEA A;  4RG4 A;  1H83 A;  4H7U A;  2JK6 A;  2VVL G;  1D7Y A;  1GV4 A;  4I58 A;  2BAC A;  1S3B A;  2QAE A;  2ZBW A;  3PO7 A;  5HY5 A;  4EM4 A;  2GF3 A;  3SXI A;  1QJD A;  1H7W A;  3BNM A;  1VG9 A;  1ZDL A;  2YVF A;  3V3O A;  3AEE A;  1PXC A;  3UKF A;  1SEZ A;  4UP3 A;  3D9X A;  5KMP A;  3RP7 A;  1ZY8 A;  3II4 A;  4YT0 A;  3L1R A;  3H8L A;  5JRB A;  1TDE A;  1JNZ A;  2GAH B;  4XWZ A;  4KX6 A;  2WBA A;  4LU6 A;  3KLJ A;  1CJ4 A;  2WU2 A;  1MOK A;  1L9C A;  3T14 A;  1TDK A;  2BAB A;  3C96 A;  1GAL A;  2C64 A;  2QA2 A;  4GDE A;  3PG6 A;  1EL8 A;  3ICR A;  3SFD A;  4YSX A;  4ADW A;  1EL9 A;  1K0J A;  1IUU A;  1NHR A;  1UKV G;  5KRQ A;  4J34 A;  5JCN A;  1K0L A;  3BI5 A;  4MJW A;  4G74 A;  5J60 A;  1AOG A;  3NRN A;  4GUV A;  2B7R A;  1DJN A;  3AE6 A;  2WP9 A;  2B9Y A;  3SQP A;  1OJT A;  2C65 A;  3K30 A;  5KVH A;  3CPJ G;  4TM1 A;  4BJZ A;  4H4S A;  4YTN A;  1IUX A;  3ABV A;  4C74 A;  2YG6 A;  3SX6 A;  3KPK A;  1N1P A;  2RGO A;  2XFN A;  1KDG A;  4DNA A;  5BVA A;  1E1K A;  2BRY A;  2R9Z A;  2C66 A;  4H2Q A;  2DKI A;  1GRG A;  3KPF A;  1KN0 A;  1PBC A;  2R46 A;  2FJE A;  2XLS A;  4II2 A;  2C75 A;  1NHS A;  4B1B A;  2VRM A;  4U8O A;  2JB2 A;  3D1C A;  2XVE A;  3ZYX A;  2TMD A;  3L8K A;  1F3P A;  3GMB A;  3HYX A;  1DJQ A;  3NK0 X;  4B64 A;  1ZKQ A;  4EM3 A;  3DK9 A;  3F8D A;  5J7X A;  4IVM B;  4A7A A;  4EMI A;  2B9X A;  1LVL A;  2WHD A;  4JNA A;  2WOW A;  1IUS A;  2WES A;  4Z43 A;  2WEU A;  3AEF A;  3CND A;  3ALM A;  5M0Z A;  3NLC A;  4USR A;  1L9E A;  3UCL A;  1Q1W A;  1E1M A;  1H82 A;  4GR1 A;  4J31 A;  2WET A;  1JEH A;  2J3N A;  1K0I A;  4JY3 A;  3G5Q A;  3B6D A;  2YG5 A;  1CC4 A;  4EIP A;  4GDP A;  1RSG A;  3HZL A;  3GYX A;  2WPF A;  3NTD A;  2JKC A;  2E5V A;  3O0H A;  3T2Z A;  2YVG A;  3DJG X;  4OPG A;  2V5Z A;  1NG4 A;  1Y0P A;  2FBW A;  1DXL A;  3GMC A;  1XPQ A;  2QCU A;  4Z44 A;  3NT6 A;  4TM4 A;  4K22 A;  5ER0 A;  5FMH A;  1PN0 A;  3I3L A;  3BNU A;  1NHQ A;  3OC4 A;  2WDV A;  1Z6L A;  4Z2U A;  3UKA A;  4H4P A;  4TM3 A;  1XDI A;  3QSE A;  5KOX A;  4OPC A;  3BHK A;  3RNM A;  1PJ6 A;  3IWA A;  3NYC A;  4K5S A;  2V60 A;  4U8L A;  2GQW A;  1P2E A;  3UOY A;  2VVL A;  5JCI A;  1IUV A;  2Z5Y A;  2TPR A;  1BGN A;  1H7X A;  3T0K A;  1CHU A;  2BCP A;  1JRZ A;  3ATR A;  1FCD A;  1F6M A;  4JQ9 A;  1S2Q A;  4G6H A;  1GT8 A;  1ELI A;  2C72 A;  3AD8 B;  3T2K A;  4NWZ A;  1DOD A;  3LZX A;  3P4R A;  2CDU A;  4GF7 A;  1LQT A;  4C77 A;  2YLT A;  4M52 A;  2R0P A;  3DJE A;  3FPZ A;  2B9W A;  4OPD A;  1FOH A;  1PBF A;  2AQJ A;  4U8K A;  3UTG A;  5CQF A;  4YSZ A;  3Q6J A;  2GAG B;  1MXT A;  3T37 A;  4H2N A;  4JN9 A;  3VQR A;  1NDA A;  1JRY A;  4D03 A;  3AXB A;  1IJH A;  4K7Z A;  1DOB A;  3P4S A;  4A99 A;  1H84 A;  2YM1 A;  4B66 A;  3BI2 A;  2A8X A;  4B69 A;  3UTE A;  1FL2 A;  1X31 B;  2XVI A;  5EB5 A;  2DKH A;  4B63 A;  4Z25 A;  5CKU A;  4OPL A;  1VG0 A;  3KVE A;  2R0C A;  3UP4 A;  5KVI A;  5JCL A;  3AE5 A;  2XVH A;  1GEU A;  2XLU A;  2YR6 A;  4FX9 A;  3HYV A;  2ARD A;  4EQR A;  1N4W A;  1VRQ B;  3I6D A;  4OPI A;  4NEV A;  3R9U A;  1Q9I A;  3S5W A;  4K8D A;  2WQY A;  3ICS A;  5EB4 A;  3QJ4 A;  3P4P A;  4EQX A;  1O5W A;  1PHH A;  4CNJ A;  3WE0 A;  2V3B A;  4WCT A;  5FS6 A;  2XLT A;  4H4X A;  3FBS A;  3QFB A;  4GCM A;  1D4D A;  1B37 A;  3ADA B;  1NHP A;  1LPF A;  1LV0 A;  3P4Q A;  3AE2 A;  3UOV A;  2H88 A;  4APN A;  2IID A;  2WOI A;  3QFA A;  2NVK X;  1PXA A;  1PJ7 A;  3QVP A;  2BS3 A;  3ATQ A;  2OA1 A;  4U8I A;  1PBD A;  4U8P A;  4JNQ A;  4JY2 A;  2WPC A;  2FJA A;  1VQW A;  3RP8 A;  3T31 A;  2ZZ0 A;  1M6I A;  3DA1 A;  1B5Q A;  1CJ3 A;  3COX A;  2VZ2 A;  3EAN A;  5LV9 A;  4FK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...