5JCLA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
432
structure length
429
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPAPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFYSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Oxidoreductase
total genus 136
structure length 429
sequence length 432
chains with identical sequence B
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jclA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jclA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jclA02
2YR6A 3P9UA 4JY3A 4KX6A 1VG9A 4PAAA 1CJCA 4OCGA 4JY2A 3RP7A 4C74A 1O5WA 4B69A 4C5OA 3UOXA 1PBCA 2OAMA 2WHDA 3KPFA 4AOXA 3P4QA 1JNRA 2GVCA 2DKIA 2Q7VA 1CBOA 4YTMA 1W4XA 1P2HA 1GTHA 5LV9A 1F8SA 1KF6A 5HXIA 4U8NA 3UKAA 3VR9A 4ECHA 4WX1A 2YAUA 4K7ZA 2EQ6A 4H4YA 3UP4A 5KOWA 1L9CA 2YG4A 2YG6A 4CCRA 1PN0A 1D7YA 3UP5A 2VQ7A 3AE9A 4H2NA 4PABA 4B66A 2WOIA 4J2WA 1VDCA 4U2SA 2GV8A 1CC4A 1L0VA 4EQWA 1LV0A 4GCMA 3H8IA 5DBJA 3AB1A 3AD9B 4YKGA 1CL0A 2PHHA 3G5SA 3NHOX 2FJAA 3QSMA 2V61A 4A65A 2ZBWA 3F8RA 3M0OA 4JDRA 4Y4NA 3C96A 1ZMCA 1D4CA 2JB2A 3LADA 2WQYA 3GRTA 1Q1WA 2XVHA 4E0VA 2GQWA 3QSSA 1EL5A 4P9SA 2GMJA 1D4EA 3ISHA 1P2EA 1ZP0A 2W0HA 5U25A 5BULA 1D5TA 3KVEA 1S3EA 2JB3A 2WDVA 2C73A 2BCPA 4H4SA 3UOYA 2XFPA 2YR4A 3B6DA 2X8CA 3QFBA 3CNPA 1CC6A 1NHSA 1B37A 2YG3A 4K22A 2X8HA 3GMBA 4U8PA 2GH5A 4TLZA 1NENA 1CJ3A 4CCQA 3I3LA 3K30A 3GYIA 2NVKX 4Z26A 2B7RA 3LOVA 3CNDA 3ZDNA 1GXFA 1JRYA 5BVAA 4ICYA 2VZ2A 3NKSA 1DODA 1NPXA 2XFNA 1ZMDA 1LJ1A 4U2TA 3S5WA 5BUKA 1VRQB 2C75A 1TDKA 3UKHA 3BI2A 3QFAA 3VQRA 2EQ8A 1JU2A 1JNZA 1GRAA 2V5ZA 4K5SA 4XWZA 3ZYXA 1PJ6A 4U8KA 3II4A 3D8XA 4IA5A 1ZY8A 1GV4A 1FCDA 4FX9A 3IF9A 1LQUA 5KOXA 3L8KA 1S2QA 4CNJA 3FPZA 3LB8A 1EL8A 1MXTA 2GR2A 1UKVG 3BHKA 1BWCA 1JRZA 4CY8A 4J57A 1D4DA 1NG3A 2C66A 2WU2A 4NTCA 2B76A 2XLTA 2OA1A 1CJ2A 1BZLA 2XVIA 4USQA 3UOVA 3ALMA 3GD4A 1NEKA 2CVJA 2JK6A 2YLRA 4D03A 2JKCA 2BACA 1TDOA 2BS4A 2WS3A 1H83A 4YWOA 3NTDA 1PJ7A 2V60A 1K4QA 1PBBA 4GF7A 1ZX9A 1PBDA 3G5RA 1LTXR 3RNMA 3VRDB 1YQZA 2QA2A 3NK2X 3UKPA 3EAOA 4HB9A 2QAEA 4TM4A 2R4EA 3CNJA 5EOWA 4USRA 4C3XA 3LXDA 1NAAA 2R0PA 1FOHA 1GEUA 2GAGB 1REOA 4H2PA 3RHAA 3NGCX 3BI5A 4D04A 4H4UA 2CFYA 3UKFA 3V3NA 1MO9A 5JCMA 2BCGG 2B7SA 3KD9A 2JBVA 4RG3A 3DK8A 4B67A 3RP8A 4IV9A 1KSUA 4YTNA 3F8DA 4BJYA 4DNAA 2WP6A 1KFYA 2A89A 2ARDA 3AE5A 1IUVA 1PXBA 4WCTA 2GMHA 2R9ZA 2A87A 2GRTA 3AEDA 3CNTA 3AWIA 4BK1A 2VRLA 4O5QA 1CJ4A 2VVLA 3BNUA 1GT8A 1S3BA 3NYCA 5CQFA 1ONFA 1H6VA 4EMJA 2BK5A 2NPXA 3NIXA 2GR1A 1K0LA 2Y6QA 3AE8A 3DJGX 4GUVA 4K2XA 4OVIA 3V3OA 1TDEA 3GMCA 2XLRA 3AXBA 4NTEA 3AEEA 1Z6LA 3CPJG 1BKWA 1E39A 1TDNA 1VQWA 3IC9A 3FIMB 5FS7A 4NEVA 1RSGA 4H4PA 4XXGA 4Z24A 5EBKA 5ER0A 2BABA 2YG7A 4AOSA 2YG5A 5KXJA 4APNA 3AEBA 2OLNA 1D7LA 4HA6A 3AEGA 2YM2A 3CPHG 1CC2A 1GSNA 5J7XA 4GDEA 1XPQA 1H81A 1BGJA 4AT2A 4Z2TA 3NYEA 1F6MA 4B64A 2RGHA 3M12A 3DGHA 2XLPA 4EM4A 2YVGA 1QJDA 3O0HA 1GETA 4OPLA 5KVIA 4H4TA 1H7WA 3AECA 3AYJA 4EMIA 1DOEA 2C70A 2C3DA 2WETA 1JRXA 1VG0A 3GD3A 2YLSA 4IVOB 4DGKA 3URHA 2VQBA 2AR8A 4IA6A 3UTGA 4YT0A 4J36A 2ZZ0A 1KNPA 1QLBA 2B9XA 3CNSA 4FDCB 4K5RA 2J3NA 2OLOA 4A79A 2EQ7A 1F8RA 4TLXA 2JB1A 3FG2P 4H2QA 1DJQA 2BC0A 2Y6RA 4J33A 1COYA 2BXRA 3K7QX 3KKJA 3NNEA 3SQPA 1NDAA 5FS8A 2V3BA 1GOSA 2XLUA 3EF6A 1LVLA 5C3JA 2YVFA 4JNQA 3NH3X 1V59A 4O5UA 1NHPA 2Z5XA 3QVPA 4U8MA 1GREA 2BXSA 2FJEA 5BRTA 2E4GA 4H4VA 1DOBA 3C4AA 4TM0A 1E1LA 3M13A 3E1TA 3IHGA 3NG7X 4GRTA 5FS9A 4H4XA 1FL2A 1H7XA 2AQJA 3NN0X 4AP1A 4U2LA 2YQUA 1B5QA 3BI4A 3NTAA 4H4RA 1GTEA 1B8SA 3NN6X 1KNRA 1EL9A 2C65A 1H86A 2C64A 2DKHA 2BK3A 3IWAA 1PXAA 4H7UA 4EQRA 4OPCA 1DNCA 1IUUA 3KA7A 1M6IA 4Y4LA 4YSHA 2IIDA 4UDQA 1OJDA 2TMDA 1XANA 2RABA 2V6OA 4ADWA 3DJDA 4BJZA 2GR0A 4JN9A 2WP9A 3SFDA 3PO7A 4B65A 4Z43A 2V3AA 1N4WA 2BS3A 2WDRA 2WPEA 4RG4A 2X99A 3T37A 1PHHA 4AT0A 1L9DA 2VVMA 3VR8A 2CDUA 1PJ5A 3RP6A 1E6EA 2VVLG 5JCLA 4CY6A 2E5VA 1RYIA 3SM8A 4YXDA 1ZK7A 1O94A 2VOUA 4UP3A 4Y4MA 1H82A 4RSLA 2BK4A 2ZZBA 4JNAA 4K8DA 3R9UA 3Q6JA 5C2TA 4U8IA 1GESA 2WDQA 2FJBA 2YR5A 3K7MX 1XHCA 5J60A 3FMWA 4Z2RA 2XVFA 5FMHA 1PDHA 3L1RA 2PYXA 4A7AA 4H50A 2C72A 1IJHA 5U63A 2EQ9A 2H89A 3ALLA 3ALJA 4X9MA 1FECA 2YWLA 3QSEA 4I58A 5HYMA 3AEAA 1GRTA 1BF3A 1E1KA 3DK9A 1K0IA 1NHRA 2C76A 2GF3A 2WBAA 1EBDA 1CHUA 2WEUA 5CKUA 3REDA 3P4SA 2TPRA 2GQFA 1Q9IA 1QO8A 2BYBA 2HQMA 4U8LA 2OALA 3AE7A 3EANA 1ELIA 3GDNA 2WU5A 3CN8A 4X9NA 2WOVA 3AE6A 4B63A 1F3PA 4H4ZA 1GERA 3NRNA 2XVEA 1MOKA 4LIIA 5M10A 2H88A 2C67A 3AD8B 3ATQA 4CNKA 3OZ2A 1OJTA 4M52A 1Y0PA 4ZCCA 4EIPA 3AE3A 3NLCA 4I59A 1E7PA 1TYTA 2XCGA 4MJWA 3WE0A 4DSGA 4YSXA 4LA1A 1K0JA 3GDPA 1AOGA 2GB0A 1JOAA 5IQ4A 4BV6A 1H84A 1GNDA 5GSNA 4N9XA 3UTHA 4C77A 2R4JA 1IUTA 4A5LA 5KRQA 4A6NA 1PXCA 1GRFA 1LQTA 3H8LA 3ABVA 5L46A 2UZZA 3DJJA 3UKQA 1X31B 2QA1A 3ATRA 3I6DA 1N4VA 3GSIA 4Z44A 4OPDA 2BS2A 4A6NB 1EL7A 1PBFA 3VRAA 1TYPA 1BGNA 3CGCA 1TRBA 2Q6UA 1N1PA 1E1NA 4GR1A 1KSSA 3GYJA 2JAEA 3DGZA 1XDIA 1O95A 2R45A 3DK4A 5JCKA 4YSZA 3CTYA 3Q9TA 1IUWA 3QJ4A 1JEHA 2YLZA 4NZHA 4EQSA 3NK1X 1HYUA 1YY5A 1GPEA 1S2YA 5JCIA 4REKA 4A9WA 4H4QA 4FK1C 4Z2UA 5TR3A 2X50A 4OPUA 4OPTA 5IQ1A 3DJEA 2Q0LA 1B4VA 1PBEA 4CRTA 3EPTA 4X4JA 2O9ZA 2BC1A 2E1MA 3KU9A 2APGA 3B3RA 3GWDA 2YLXA 1SEZA 3H4KA 5EB5A 3FBSA 2ZZCA 1KDGA 3OC4A 3DMEA 3UCLA 2XYOA 3GWFA 1PS9A 4H2RA 4OPGA 5EB4A 4YTPA 4TM1A 4EM3A 2XFUA 2Z5YA 1ZDLA 2QCUA 4NEWA 3ICTA 2X8GA 2FJDA 1IUSA 2XVJA 5JCNA 5IPYA 4EMWA 2A8XA 1LPFA 2WPCA 4ZCDA 1FEAA 1YQ3A 4JQ9A 4J34A 3AEFA 3S61A 1GRHA 2Q0KA 5KVHA 1OJAA 3AYLA 1ZOVA 4C3YA 2C3CA 4XWRA 3NK0X 4BK3A 4GDPA 4LU6A 2VRMA 2I0ZA 3AE1A 3D1CA 2X3NA 2RGJA 1NHQA 4A99A 2B9YA 1Y56A 1FEBA 2R46A 2XDOA 4BURA 1TDFA 3BNMA 2F5ZA 5FS6A 4U8JA 4UDPA 3ITJA 4EIQA 3AE4A 3CGBA 1DOCA 2WESA 1OJ9A 2GR3A 3CIRA 2YVJA 1Y56B 3SFEA 3CGEA 1YQ4A 4NTDA 1GRBA 1L9EA 3GRSA 1F8WA 2XFOA 3UTEA 4DSHA 4U8OA 5GRTA 3UKLA 3K7TA 2ACZA 3LJPA 1Q1RA 2XFQA 3BHFA 5HHFA 4J31A 2YLTA 2YM1A 2B9WA 3ICSA 3QVRA 4TM3A 4BK2A 3VRBA 4J56A 1CF3A 1YKJA 1GALA 1OJCA 3AYIA 2BA9A 4UDRA 3UTFA 4Z25A 4FK1A 1DXLA 3CGDA 3ICRA 3KLJA 1M64A 4YKFA 4IVMB 2GEWA 3SGLA 3IHMA 2IVEA 2WP5A 3DH9A 3PVCA 3DA1A 2YLWA 3PS9A 4H4WA 3C4NA 2C7GA 1NG4A 4B68A 4OPIA 3AD7B 4YSYA 2R0CA 1RP0A 2RGOA 3ADAB 3LZXA 5M0ZA 3COXA 1DJNA 4KPRA 3UKKA 3HZLA 2GAHB 4CBQA 3G5QA 3CPIG 3F8PA 1N4UA 3NT6A 3P4RA 2CULA 4ZN0A 1ZKQA 2IVDA 3P4PA 3P1WA 4B1BA 1ZOYA 3UOZA 3LZWA 3NYFA 4EQXA 2WPFA 5HY5A 1GRGA 3JSKA 1E1MA 2AAQA 2R0GA 2XLSA 1IUXA 4AP3A 2FBWA 3AE2A 3V76A 2WOWA 5U1OA 5KWFA
chains in the Genus database with same CATH superfamily
2YR6A 4GISA 4B69A 3UOXA 4AOXA 3IK4A 1W4XA 1EBHA 3DDMA 3S47A 1PN0A 4IT1A 4H2NA 4PABA 2WOIA 3NRZB 4K2SA 3QSMA 2FJAA 4Y4NA 1EC9A 3C96A 1ZMCA 3R10A 4P9SA 1EL5A 3NVYB 3ISHA 6ENLA 1MUCA 2DW7A 2W0HA 2QVHA 3QFBA 1CC6A 2YG3A 4U8PA 1NENA 1CJ3A 4CCQA 4Z26A 2B7RA 3Q45A 3LOVA 1GXFA 3R11A 2VZ2A 3NKSA 1R0MA 1NPXA 1DODA 1ZMDA 1LJ1A 4GAPA 5BUKA 1JNZA 4XWZA 3ZYXA 4K5SA 1JROA 1PJ6A 1JPDX 3D8XA 2QJMA 3IF9A 2P3ZA 5FJPA 4CNJA 3FPZA 2GR2A 3N4EA 3BHKA 1BWCA 4CY8A 3SN1A 3HYVA 2PODA 1NG3A 2C66A 2B76A 1CJ2A 4USQA 4EWJA 3RR1A 3FJ4A 2BACA 2BS4A 2WS3A 2PTYA 3K1GA 1ONEA 3G5RA 3VRDB 2QA2A 4HCHA 2R4EA 3CNJA 4USRA 4C3XA 3LXDA 1NAAA 2AL2A 1FOHA 4H2PA 3RHAA 3T2YA 1MO9A 3KD9A 3T14A 3DK8A 1MDRA 3JZUA 1KSUA 1KFYA 2A89A 4MKSA 2HXUA 3FCPA 1CJ4A 2VVLA 2PMQA 1ONFA 1H6VA 4EMJA 3RITA 4DWDA 2Y6QA 4ZCWA 3V3OA 1TDEA 3GMCA 3CPJG 1R6WA 3HRDC 4NEVA 4XXGA 2BABA 1KKRA 2GGGA 1D7LA 1BGJA 4Z2TA 1F6MA 3DFYA 1KKOA 2PTWA 2YVGA 1QJDA 1GETA 4OPLA 1H7WA 1DOEA 1JRXA 2YLSA 4GMEA 3URHA 2VQBA 2AR8A 3UTGA 4YT0A 4J36A 2B9XA 2J3NA 2EQ7A 2DW6A 1F8RA 4H2QA 1DJQA 2GGJA 3KKJA 3SQPA 2V3BA 3DG6A 1V59A 1NHPA 2FJEA 4H4VA 3IHGA 1H2IA 2AQJA 3BI4A 3NTAA 3B97A 1B8SA 3BOXA 1H86A 2DKHA 1ZXIC 4K8GA 3KA7A 4BJZA 4ADWA 3DJDA 2GR0A 2AKMA 3PO7A 4Z43A 2WDRA 2BS3A 3DESA 1EC8A 2WPEA 3ES7A 3VFCA 3V5FA 2E5VA 3SM8A 1FFUC 4HYRA 1ZK7A 1O94A 4UP3A 4Y4MA 2PP0A 3R9UA 4U8IA 3K7MX 5J60A 4Z2RA 3L1RA 3ZVHA 2PYXA 4H50A 5U63A 3QSEA 4I58A 1GRTA 1NHRA 2WBAA 1EBDA 2GQFA 1QO8A 3EANA 1ELIA 4X9NA 2WU5A 3CN8A 2WOVA 4B63A 1F3PA 3S5SA 3VA8A 4ZCCA 4MJWA 1E7PA 2XCGA 4YSXA 3WE0A 1L8PA 4BV6A 1H84A 5GSNA 4N9XA 2R4JA 1GRFA 3THUA 3UKQA 4E4FA 2BS2A 3VRAA 1TYPA 2JAEA 4J1OA 3DGZA 3DK4A 5JCKA 2YLZA 4EQSA 4REKA 1N5XA 4FK1C 5TR3A 3DJEA 2OZ3A 3EPTA 4X4JA 3GWDA 2BRYA 3H4KA 5EB5A 1KDGA 3TCSA 3L5OA 4EM3A 2XFUA 3D46A 4NEWA 2PGEA 1IUSA 2MUCA 2XVJA 3SZ0A 2I5QA 3UCCA 5IPYA 3KPKA 4A35A 2WPCA 4IP4A 4J34A 3AYLA 3DFHA 3NK0X 4LU6A 2I0ZA 3D1CA 1NHQA 1FEBA 3TWBA 2XDOA 1IYXA 4M0XA 3ITJA 4GAVA 2WESA 3T4WA 3T8QA 1OJ9A 2GR3A 3CIRA 1Y56B 1XS2A 1GRBA 3DERA 1JCTA 2CHRA 5EU9A 3LJPA 3BHFA 3NS1B 5HHFA 3NVWB 4J31A 3ICSA 3GO2A 4BK2A 3VRBA 5BOEA 4A3RA 4J56A 4UDRA 4Z25A 3DIPA 2BRAA 3ICRA 1M64A 4IVMB 1VQZA 3PVCA 3MUCA 2C7GA 1RP0A 3LZXA 3UKKA 3R0UA 5G5GB 2XH7A 3F8PA 1N4UA 4FI4A 3HPFA 2W55A 4MGGA 4E6MA 3LZWA 3NYFA 4EQXA 1GRGA 3AN1A 1N61C 5U1OA 3UJFA 3KUMA 3P9UA 1RM6B 1T3QC 4IP5A 1PBCA 2OAMA 1CBOA 1P2HA 1GTHA 1F8SA 1KF6A 4U8NA 3DG7A 4X2PA 1L9CA 5FJRA 3AE9A 4GFIA 4B66A 2GV8A 1L0VA 4GCMA 3H8IA 1N63C 3NHOX 1FHVA 3M0OA 3NXLA 3GRTA 2XVHA 4E0VA 3QSSA 1D5TA 1S3EA 4FP1A 2PA6A 2NVKX 3ZDNA 2XFNA 4U2TA 1VRQB 2C75A 3BI2A 2ZC8A 3VQRA 4JN7A 2EQ8A 1GRAA 4II3A 3SZCA 3II4A 4A6GA 1LQUA 1MXTA 1EL8A 2QGYA 4J57A 1D4DA 3PG6A 2XLTA 2OA1A 2XVIA 2JK6A 3I6EA 2JKCA 1TDOA 3NTDA 1H83A 2V60A 1K4QA 1PBBA 4GYPA 3RNMA 1YQZA 3NK2X 3IJQA 2QAEA 4TM4A 2OLAA 3SBFA 2R0PA 2GL5A 3NGCX 4H4UA 3AM9A 2JBVA 4YTNA 3PK7A 4IZGA 2WP6A 3AE5A 1IUVA 2GMHA 2E5AA 3CNTA 1ELSA 2VRLA 4O5QA 3BNUA 1S3BA 3JW7A 5CQFA 2NPXA 2PU0A 3AE8A 3DJGX 4K2XA 4OVIA 1BKWA 1VQWA 5G5HB 5FS7A 3DEQA 5ER0A 4AOSA 5KXJA 4APNA 3AEGA 1P43A 1CC2A 1XPQA 4K1WA 2RGHA 3M12A 3DGHA 3O0HA 3TJIA 3OPSA 4DGKA 2ZZ0A 3CNSA 4A79A 3GY1A 2JB1A 2PGWA 4J33A 1COYA 2BXRA 3K7QX 5FS8A 1KN0A 2OVLA 5C3JA 3NH3X 2Z5XA 1GREA 1DOBA 2GGEA 1FL2A 1H7XA 3NN0X 3N4FA 4H4RA 1EL9A 2C64A 2BK3A 1PXAA 4EQRA 4OPCA 4G74A 2IIDA 4G6HA 1OJDA 2TMDA 3PWGA 1XANA 2RABA 4NWZA 2V6OA 2V3AA 2GSHA 1PHHA 2P0IA 3QLDA 1E6EA 5JCLA 3FVDA 1RYIA 2OPJA 4GIRA 4RSLA 2ZZBA 4K8DA 3Q6JA 5KMQA 1XHCA 3V5CA 2QJJA 3FMWA 5FMHA 1PDHA 4A7AA 2EQ9A 2H89A 3ALJA 1FECA 3AEAA 3DK9A 3FXGA 5IDZA 2BYBA 2C4CA 2HQMA 3HYWA 4U8LA 2OALA 3DGBA 3GDNA 1NELA 1GERA 1P48A 2H88A 4CNKA 1Y0PA 4TVWA 3Q4DA 3NLCA 4ROPA 4I59A 1K0JA 1AOGA 1JOAA 3UTHA 3B9JB 3CAWA 1EC7A 4M6UA 1PXCA 1LQTA 3H8LA 2AL1A 5J04A 2QA1A 3ATRA 3GSIA 3I6DA 4Z44A 4A6NB 1E1NA 4GR1A 3PFRA 1PDZA 1X2GA 3GD6A 3VC5A 2R45A 5FJUA 2OZ8A 1IUWA 2XH0A 3NK1X 1YY5A 1S2YA 2X50A 4OPUA 4OPTA 1W6TA 2Q0LA 3RRAA 4CRTA 2O9ZA 2APGA 3B3RA 2ZZCA 3T6CA 3DMEA 3UCLA 3STPA 4OPGA 2FYMA 2X8GA 3NFUA 4EMWA 3QPEA 3P0WA 3S61A 1OJAA 2C3CA 3MY9A 4BK3A 3ZLHA 2B9YA 1Y56A 2R46A 1TDFA 3BNMA 2F5ZA 4U8JA 4UDPA 4EIQA 4DXKA 4ZA0A 1YQ4A 2XFOA 3MSYA 3CB3A 4U8OA 3UKLA 2ACZA 1Q1RA 2XFQA 1FO4A 2YLTA 3QVRA 3T2ZA 3AYIA 1OJCA 3SGLA 3IHMA 2RDXA 3DA1A 2YLWA 3QKEA 4H4WA 4YSYA 2RGOA 3ADAB 5M0ZA 1DJNA 1TKKA 4CBQA 3CPIG 3UJRA 2HZGA 4B1BA 1SJDA 1ZOYA 3UOZA 5HY5A 1E1MA 2AAQA 2R0GA 4AP3A 5FJOA 3V76A 2WOWA 5KWFA 4JY3A 3HW2A 1VG9A 4JY2A 3P4QA 2DKIA 2OKTA 3UKAA 3VR9A 4ECHA 4WX1A 4K7ZA 2EQ6A 4H4YA 2YG4A 2YG6A 1D7YA 3OZMA 1CC4A 4EQWA 4GYPC 3AD9B 2PHHA 3VC6A 4A65A 2ZBWA 1D4CA 2XH2A 2WQYA 1Q1WA 1MRAA 2GQWA 2GMJA 1P2EA 1ZP0A 5U25A 2PTZA 2JB3A 2WDVA 2BCPA 4H4SA 2XFPA 2YR4A 3CNPA 2X8CA 1NHSA 4Z17A 3R0KA 3A7UA 2GH5A 3K30A 3CNDA 4ICYA 4Z1YA 3UKHA 3CXBA 2V5ZA 4JN8A 3CXOA 4IA5A 1GV4A 1ZY8A 1N60C 1FCDA 5KOXA 3L8KA 1S2QA 3MZNA 1UKVG 1JRZA 3OP2A 2WU2A 1RVKA 3ALMA 3IJIA 3GD4A 2CVJA 2YLRA 3BJSA 3R1ZA 1ZX9A 1LTXR 1FFVC 3H70A 5EOWA 1GEUA 1REOA 4D04A 2CFYA 1SJAA 3UKFA 5JCMA 3V3NA 2BCGG 3HYXA 3SN0A 4RG3A 4B67A 4IV9A 3CT2A 3F8DA 3UXKA 4BJYA 2ARDA 1PXBA 4WCTA 2R9ZA 3AWIA 3NYCA 2BK5A 1K0LA 3DG3A 2XLRA 3AXBA 3AEEA 1Z6LA 1E39A 1TDNA 3FIMB 1RSGA 3I6TA 4H4PA 4Z24A 3N6HA 5EBKA 2YG7A 2YG5A 2OO6A 3AEBA 2OLNA 4G7FA 2YM2A 1GSNA 3H12A 3SY4A 5J7XA 4GDEA 1F9CA 4B64A 2XLPA 5KVIA 4H4TA 3AECA 3AYJA 2C70A 2WETA 1VG0A 3MQTA 3TTEA 1KNPA 4K5RA 3OZYA 4FDCB 2OLOA 3UXLA 3FG2P 2Y6RA 1NDAA 1GOSA 5FJTA 2XLUA 3EF6A 3SQSA 3SX6A 2YVFA 4JNQA 4O5UA 2E4GA 1DTNA 3C4AA 3M13A 3E1TA 3NG7X 4GRTA 5FS9A 4H4XA 4AP1A 1WYGA 2YQUA 4G6GA 1KNRA 4ENLA 4H7UA 4KEMA 4ZOHB 3MKCA 4Y4LA 3TOYA 4UDQA 3SR6B 3UJSA 4IL2A 2WP9A 3SFDA 4RG4A 4JHMA 4AT0A 1L9DA 3VR8A 2CDUA 1PJ5A 3RP6A 2VVLG 4DN1A 4YXDA 2OZTA 1KCZA 2BK4A 4JNAA 5C2TA 1GESA 1VDVA 2PTXA 2C72A 2E3TA 5KNLA 5HYMA 4H83A 2XGZA 1BF3A 1E1KA 1TE6A 2C76A 2GF3A 5CKUA 1CHUA 2TPRA 1Q9IA 3MWCA 3AE6A 3TWAA 1MOKA 4LIIA 2C67A 3ATQA 2QJNA 1MNSA 4DSGA 4LA1A 1N62C 2GB0A 4C77A 1GNDA 5KRQA 4A6NA 4G8TA 2UZZA 3NVVB 2PP3A 1N4VA 4OPDA 1PDYA 1EL7A 4E8GA 1PBFA 3D9XA 1BGNA 3CGCA 1TRBA 1N1PA 1KSSA 3GYJA 3T9PA 1O95A 5KMSA 3CTYA 1JEHA 4H1ZA 1HYUA 1GPEA 5JCIA 3GYXA 5IQ1A 1B4VA 1PBEA 3N6JA 2E1MA 3KU9A 2YLXA 2ONEA 3OC4A 1PS9A 4H2RA 2Z5YA 1ZDLA 2QCUA 2FJDA 2A8XA 1LPFA 1FEAA 1YQ3A 3AEFA 1GRHA 2Q0KA 1WUEA 5KVHA 1ZOVA 2PS2A 2PU1A 2ZADA 2VRMA 3AE1A 2X3NA 3P3BA 2OQHA 4YWSA 3OTRA 4BURA 5FS6A 3AE4A 3CGBA 1DOCA 4H2HA 3CGEA 4NTDA 2QQ6A 1L9EA 3ENLA 3GRSA 1F8WA 3VDGA 3K7TA 4G9KA 2YM1A 4TM3A 1CF3A 1YKJA 1GALA 4KWSA 4YKFA 3CGDA 3KLJA 3SZFA 2IVEA 4G73A 2WP5A 3DH9A 4IHCA 5KMRA 2R0CA 3QN3A 3COXA 2GAHB 3NT6A 2CULA 1SB3B 2IVDA 3RCYA 4E4UA 3NZGA 3UCDA 2WPFA 2XLSA 2FBWA 4TVYA 4HNCA 3D47A 3QTPA 4KX6A 4PAAA 3RP7A 1CJCA 4OCGA 4C74A 1O5WA 4C5OA 2WHDA 3KPFA 3CMMA 1JNRA 2GVCA 3NVZB 2Q7VA 4YTMA 4HCLA 5LV9A 5HXIA 3EKGA 2YAUA 5KOWA 3UP4A 4CCRA 1TZZA 3UP5A 2VQ7A 1WUFA 4J2WA 1VDCA 4U2SA 5KMPA 1LV0A 3OW1A 3SZWA 5DBJA 3AB1A 4YKGA 1CL0A 3G5SA 3I4KA 2V61A 3JVAA 3F8RA 1V97A 4JDRA 2OX4A 2JB2A 3LADA 1SJCA 2W54A 1D4EA 5BULA 3VCNA 3KVEA 4DHGA 2C73A 3UOYA 3B6DA 1B37A 4K22A 4E5TA 2X8HA 3NO1A 3GMBA 3V4BA 4TLZA 3UGVA 3I3LA 3GYIA 3BSMA 1JRYA 5BVAA 3S5WA 1TDKA 3QFAA 2AKZA 1JU2A 2XSXA 4U8KA 4FX9A 4HPNA 2PP1A 3LB8A 3SSZA 3PWIA 4NTCA 2POZA 3EUB3 1BZLA 3UOVA 2GDQA 1NEKA 4D03A 3ETRB 4HCDA 4YWOA 1PJ7A 1E9IA 4GF7A 1PBDA 4HN8A 1YEYA 3UKPA 3EAOA 4HB9A 3T2KA 3RGTA 2GAGB 3R07C 5ENLA 3BI5A 2B7SA 3TW9A 3FV9A 3TQPA 1ECQA 3RP8A 2AL2B 4DNAA 3P93A 2A87A 2GRTA 3AEDA 1SJBA 2OG9A 4BK1A 1GT8A 3AMZA 3NIXA 2MNRA 2GR1A 1NU5A 2P8BA 4GUVA 4NTEA 1KD0A 3CYJA 3IC9A 1OEPA 4HA6A 3SXIA 3CPHG 1BKHA 1H81A 4AT2A 3U4FA 1XPYA 3NYEA 3ZLGA 4EM4A 2P88A 2O56A 4EMIA 2C3DA 3GD3A 4IVOB 4F4RA 4IA6A 1JPMA 1QLBA 4NNJA 4J3ZA 4TLXA 2BC0A 3NNEA 2OQYA 3SYIA 1LVLA 1MDLA 3QVPA 4U8MA 5BRTA 2BXSA 3V3WA 4TM0A 1E1LA 4U2LA 1B5QA 4KT2A 1BQGA 1GTEA 3NN6X 2C65A 3IWAA 1FHUA 3UJ2A 2GGIA 1DNCA 1IUUA 1M6IA 4YSHA 3SN4A 4JN9A 4B65A 1N4WA 2X99A 3SJNA 3T37A 2VVMA 1JDFA 4CY6A 1N5WC 2VOUA 1H82A 3ZVIA 2OFJA 2WDQA 2FJBA 2YR5A 1X2HA 5BOFA 2QDDA 2XVFA 3H8AA 1IJHA 3ALLA 4X9MA 2YWLA 1K0IA 2WEUA 3EEZA 3ZVHB 2P8CA 3FYYA 3REDA 3P4SA 2HXTA 1FIQB 3AE7A 1JRPA 4H4ZA 3R25A 2W3RA 3NRNA 2XVEA 5M10A 3AD8B 3OZ2A 1OJTA 4M52A 4EIPA 3AE3A 1TYTA 3GDPA 5IQ4A 3GC2A 1IUTA 4A5LA 3ABVA 5L46A 3DJJA 1X31B 4GGHA 2FKPA 2NQLA 3T31A 2Q6UA 3A7AA 1S7MA 7ENLA 1XDIA 3H7VA 2HNEA 2QDEA 4YSZA 3Q9TA 3QJ4A 4NZHA 4A9WA 2W3SA 4H4QA 4Z2UA 2BC1A 1SEZA 3FBSA 2XYOA 3GWFA 3A7RA 4IL0A 5EB4A 4YTPA 4TM1A 2PCEA 3ICTA 4GGBA 3UJEA 1EBGA 5JCNA 4DX3A 4ZCDA 2GGHA 4JQ9A 4C3YA 3CK5A 4II2A 4XWRA 4GDPA 2RGJA 2PSNA 4A99A 3VCCA 2XH4A 2YVJA 4DYEA 3SFEA 3ZLFA 4HNLA 3IJLA 3UTEA 4DSHA 4MMWA 4KPLA 5GRTA 2B9WA 4H19A 3UTFA 2BA9A 4FK1A 1DXLA 2GEWA 3RO6A 3PS9A 1STZA 3C4NA 4B68A 1NG4A 3TJ4A 4OPIA 3AD7B 3U9IA 4KPRA 3HZLA 3G5QA 3P4RA 4ZN0A 5JRBA 1ZKQA 3P4PA 3P1WA 3T0KA 3ES8A 2PPGA 3JSKA 1IUXA 3AE2A
chains in the Genus database with same CATH topology
2YR6A 3P9UA 4JY3A 4KX6A 1VG9A 4PAAA 1CJCA 4OCGA 4JY2A 3RP7A 4C74A 1O5WA 4B69A 4C5OA 3UOXA 1PBCA 2OAMA 2WHDA 3KPFA 3CMMA 4AOXA 3P4QA 1JNRA 2GVCA 2DKIA 2Q7VA 1CBOA 4YTMA 1W4XA 1P2HA 1GTHA 5LV9A 1F8SA 1KF6A 5HXIA 4U8NA 3UKAA 3VR9A 4ECHA 4WX1A 2YAUA 4K7ZA 2EQ6A 4H4YA 3UP4A 5KOWA 1L9CA 2YG4A 2YG6A 4CCRA 1PN0A 1D7YA 3UP5A 2VQ7A 3AE9A 4H2NA 4PABA 4B66A 2WOIA 4J2WA 1VDCA 4U2SA 5KMPA 2GV8A 1CC4A 1L0VA 4EQWA 1LV0A 4GCMA 3H8IA 3SZWA 5DBJA 3AB1A 3AD9B 4YKGA 1CL0A 2PHHA 3G5SA 3NHOX 2FJAA 3QSMA 2V61A 4A65A 2ZBWA 3F8RA 3M0OA 4JDRA 4Y4NA 3C96A 1ZMCA 1D4CA 2JB2A 3LADA 2WQYA 3GRTA 1Q1WA 2XVHA 4E0VA 2GQWA 3QSSA 1EL5A 4P9SA 2GMJA 1D4EA 3ISHA 1P2EA 1ZP0A 2W0HA 5U25A 5BULA 1D5TA 3KVEA 1S3EA 2JB3A 2WDVA 2C73A 2BCPA 4H4SA 3UOYA 2XFPA 2YR4A 3B6DA 2X8CA 3QFBA 3CNPA 1CC6A 1NHSA 1B37A 2YG3A 4K22A 2X8HA 3GMBA 4U8PA 2GH5A 4TLZA 1NENA 1CJ3A 4CCQA 3I3LA 3K30A 3GYIA 2NVKX 4Z26A 2B7RA 3LOVA 3CNDA 3ZDNA 1GXFA 1JRYA 5BVAA 4ICYA 2VZ2A 3NKSA 1DODA 1NPXA 2XFNA 1ZMDA 1LJ1A 4GAPA 4U2TA 3S5WA 1VRQB 2C75A 1TDKA 3UKHA 5BUKA 3BI2A 3QFAA 3VQRA 2EQ8A 1JU2A 1JNZA 1GRAA 2V5ZA 4K5SA 4II3A 4XWZA 1PJ6A 3ZYXA 4U8KA 3SZCA 3II4A 3D8XA 4IA5A 1ZY8A 1GV4A 1FCDA 4FX9A 3IF9A 1LQUA 5KOXA 3L8KA 1S2QA 4CNJA 3FPZA 3LB8A 1EL8A 1MXTA 2GR2A 1UKVG 3BHKA 1BWCA 1JRZA 4CY8A 4J57A 3HYVA 1D4DA 1NG3A 2C66A 2WU2A 4NTCA 3PG6A 2B76A 2XLTA 2OA1A 1CJ2A 1BZLA 2XVIA 4USQA 3UOVA 3ALMA 3GD4A 1NEKA 2CVJA 2JK6A 2YLRA 4D03A 2JKCA 2BACA 1TDOA 2BS4A 2WS3A 1H83A 4YWOA 3NTDA 1PJ7A 2V60A 1K4QA 1PBBA 4GF7A 1ZX9A 1PBDA 3G5RA 1LTXR 3RNMA 3VRDB 1YQZA 2QA2A 3NK2X 3UKPA 3EAOA 4HB9A 3T2KA 2QAEA 4TM4A 2R4EA 3CNJA 5EOWA 4USRA 4C3XA 3LXDA 1NAAA 2R0PA 1FOHA 1GEUA 2GAGB 1REOA 4H2PA 3RHAA 3T2YA 3NGCX 3BI5A 4D04A 4H4UA 2CFYA 3UKFA 3V3NA 1MO9A 5JCMA 2BCGG 2B7SA 3KD9A 2JBVA 3HYXA 3T14A 4RG3A 3DK8A 4B67A 3RP8A 4IV9A 1KSUA 4YTNA 3F8DA 4BJYA 4DNAA 2WP6A 1KFYA 2A89A 2ARDA 3AE5A 1IUVA 1PXBA 4WCTA 2GMHA 2R9ZA 2A87A 2GRTA 3AEDA 3CNTA 3AWIA 4BK1A 2VRLA 4O5QA 1CJ4A 2VVLA 3BNUA 1GT8A 1S3BA 3NYCA 5CQFA 1ONFA 1H6VA 4EMJA 2BK5A 2NPXA 3NIXA 2GR1A 1K0LA 2Y6QA 3AE8A 3DJGX 4GUVA 4K2XA 4OVIA 3V3OA 1TDEA 3GMCA 2XLRA 3AXBA 4NTEA 3AEEA 1Z6LA 3CPJG 1BKWA 1E39A 1TDNA 1VQWA 3IC9A 3FIMB 5FS7A 4NEVA 1RSGA 4H4PA 4XXGA 4Z24A 5EBKA 5ER0A 2BABA 2YG7A 4AOSA 2YG5A 5KXJA 4APNA 3AEBA 2OLNA 1D7LA 4HA6A 3AEGA 2YM2A 3SXIA 3CPHG 1CC2A 1GSNA 3SY4A 5J7XA 4GDEA 1XPQA 1H81A 1BGJA 4AT2A 4Z2TA 3NYEA 1F6MA 4B64A 2RGHA 3M12A 3DGHA 2XLPA 4EM4A 2YVGA 1QJDA 3O0HA 1GETA 4OPLA 5KVIA 4H4TA 1H7WA 3AECA 3AYJA 4EMIA 1DOEA 2C70A 2C3DA 2WETA 1JRXA 1VG0A 3GD3A 2YLSA 4IVOB 4DGKA 3URHA 2VQBA 2AR8A 4IA6A 3UTGA 4YT0A 4J36A 2ZZ0A 1KNPA 1QLBA 2B9XA 3CNSA 4FDCB 4K5RA 4NNJA 2J3NA 2OLOA 4A79A 2EQ7A 1F8RA 4TLXA 2JB1A 3FG2P 4H2QA 1DJQA 2BC0A 2Y6RA 4J33A 5KNLA 1COYA 2BXRA 3K7QX 3KKJA 3NNEA 3SQPA 1NDAA 5FS8A 1KN0A 3SYIA 2V3BA 1GOSA 2XLUA 3EF6A 1LVLA 5C3JA 3SX6A 2YVFA 4JNQA 3NH3X 1V59A 4O5UA 1NHPA 2Z5XA 3QVPA 4U8MA 1GREA 2BXSA 2FJEA 5BRTA 2E4GA 4H4VA 1DOBA 3C4AA 4TM0A 1E1LA 3M13A 3E1TA 3IHGA 3NG7X 1H2IA 4GRTA 4H4XA 5FS9A 1FL2A 1H7XA 2AQJA 3NN0X 4U2LA 4AP1A 2YQUA 4G6GA 1B5QA 3BI4A 3NTAA 4H4RA 1GTEA 1B8SA 3NN6X 1KNRA 1EL9A 2C65A 1H86A 2C64A 2DKHA 2BK3A 3IWAA 1PXAA 4H7UA 4EQRA 4OPCA 4G74A 1DNCA 1IUUA 3KA7A 1M6IA 4Y4LA 4YSHA 2IIDA 4G6HA 1OJDA 4UDQA 2TMDA 1XANA 2RABA 2V6OA 4ADWA 3DJDA 4NWZA 4BJZA 2GR0A 4JN9A 2WP9A 3SFDA 3PO7A 4B65A 4Z43A 2V3AA 1N4WA 2BS3A 2WDRA 2WPEA 4RG4A 2X99A 3T37A 1PHHA 4AT0A 1L9DA 2VVMA 3VR8A 2CDUA 1PJ5A 3RP6A 1E6EA 2VVLG 5JCLA 4CY6A 2E5VA 1RYIA 3SM8A 4YXDA 1ZK7A 1O94A 2VOUA 4UP3A 4Y4MA 1H82A 4RSLA 2BK4A 2ZZBA 4JNAA 4K8DA 3R9UA 3Q6JA 5C2TA 4U8IA 1GESA 2WDQA 2FJBA 2YR5A 3K7MX 5KMQA 1XHCA 5J60A 3FMWA 4Z2RA 2XVFA 5FMHA 1PDHA 3L1RA 2PYXA 4A7AA 4H50A 2C72A 1IJHA 5U63A 2EQ9A 2H89A 3ALLA 3ALJA 4X9MA 1FECA 2YWLA 3QSEA 4I58A 5HYMA 3AEAA 1GRTA 1BF3A 1E1KA 3DK9A 1K0IA 1NHRA 2C76A 2GF3A 2WBAA 1EBDA 1CHUA 2WEUA 5CKUA 3REDA 3P4SA 2TPRA 2GQFA 1Q9IA 1QO8A 2BYBA 2C4CA 2HQMA 3HYWA 4U8LA 2OALA 3AE7A 3EANA 1ELIA 3GDNA 2WU5A 3CN8A 4X9NA 2WOVA 3AE6A 4B63A 1F3PA 4H4ZA 1GERA 3NRNA 2XVEA 1MOKA 4LIIA 5M10A 2H88A 2C67A 3AD8B 3ATQA 4CNKA 3OZ2A 1OJTA 4M52A 1Y0PA 4ZCCA 4EIPA 3AE3A 3NLCA 4I59A 1E7PA 1TYTA 2XCGA 4MJWA 3WE0A 4DSGA 4YSXA 4LA1A 1K0JA 3GDPA 1AOGA 2GB0A 1JOAA 5IQ4A 4BV6A 1H84A 1GNDA 5GSNA 4N9XA 3UTHA 4C77A 2R4JA 1IUTA 4A5LA 5KRQA 4A6NA 1PXCA 1GRFA 1LQTA 3H8LA 3ABVA 5L46A 2UZZA 3DJJA 3UKQA 1X31B 2QA1A 3ATRA 3I6DA 1N4VA 3GSIA 4Z44A 4OPDA 2BS2A 4A6NB 1EL7A 1PBFA 3VRAA 1TYPA 3D9XA 1BGNA 3CGCA 1TRBA 2Q6UA 3T31A 1N1PA 1E1NA 4GR1A 1KSSA 3GYJA 1S7MA 2JAEA 3DGZA 1XDIA 1O95A 2R45A 3DK4A 5JCKA 4YSZA 3CTYA 3Q9TA 1IUWA 5KMSA 3QJ4A 1JEHA 2YLZA 4NZHA 4EQSA 3NK1X 1HYUA 1YY5A 1GPEA 1S2YA 5JCIA 4REKA 4A9WA 4H4QA 4FK1C 4Z2UA 5TR3A 2X50A 4OPUA 4OPTA 3GYXA 5IQ1A 3DJEA 2Q0LA 1B4VA 1PBEA 4CRTA 3EPTA 4X4JA 2O9ZA 2BC1A 2E1MA 3KU9A 2APGA 3B3RA 3GWDA 2YLXA 2BRYA 1SEZA 3H4KA 5EB5A 3FBSA 2ZZCA 1KDGA 3OC4A 3DMEA 3UCLA 2XYOA 3GWFA 1PS9A 4H2RA 4OPGA 5EB4A 3L5OA 4YTPA 4TM1A 4EM3A 2XFUA 2Z5YA 1ZDLA 2QCUA 4NEWA 3ICTA 2X8GA 2FJDA 1IUSA 2XVJA 3SZ0A 5JCNA 5IPYA 4EMWA 2A8XA 3KPKA 1LPFA 2WPCA 4ZCDA 1FEAA 1YQ3A 4JQ9A 4J34A 3AEFA 3S61A 1GRHA 2Q0KA 5KVHA 1OJAA 3AYLA 1ZOVA 4C3YA 4II2A 2C3CA 4XWRA 3NK0X 4BK3A 4GDPA 4LU6A 2VRMA 2I0ZA 3AE1A 3D1CA 2X3NA 2RGJA 1NHQA 4A99A 2B9YA 1Y56A 1FEBA 2R46A 2XDOA 4BURA 1TDFA 3BNMA 2F5ZA 5FS6A 4U8JA 4UDPA 3ITJA 4EIQA 3AE4A 4GAVA 3CGBA 1DOCA 2WESA 1OJ9A 2GR3A 3CIRA 2YVJA 1Y56B 3SFEA 3CGEA 1YQ4A 4NTDA 1GRBA 1L9EA 3GRSA 1F8WA 2XFOA 3UTEA 4DSHA 4U8OA 5GRTA 3UKLA 3K7TA 2ACZA 3LJPA 1Q1RA 2XFQA 3BHFA 5HHFA 4G9KA 4J31A 2YLTA 2YM1A 2B9WA 3ICSA 3QVRA 4TM3A 4BK2A 3VRBA 3T2ZA 4J56A 1CF3A 1YKJA 1GALA 1OJCA 3AYIA 2BA9A 4UDRA 3UTFA 4Z25A 4FK1A 1DXLA 3CGDA 2BRAA 3KLJA 1M64A 3ICRA 4IVMB 4YKFA 2GEWA 3SGLA 3IHMA 3SZFA 2IVEA 4G73A 2WP5A 3DH9A 3PVCA 3DA1A 2YLWA 3PS9A 4H4WA 3C4NA 2C7GA 1NG4A 4B68A 5KMRA 4OPIA 3AD7B 4YSYA 2R0CA 1RP0A 2RGOA 3ADAB 3LZXA 5M0ZA 3COXA 1DJNA 4KPRA 3UKKA 3HZLA 2GAHB 4CBQA 3G5QA 3CPIG 3F8PA 1N4UA 3NT6A 3P4RA 2CULA 4ZN0A 5JRBA 1ZKQA 2IVDA 3P4PA 3P1WA 4B1BA 1ZOYA 3UOZA 3LZWA 3T0KA 3NYFA 4EQXA 2WPFA 5HY5A 1GRGA 3JSKA 1E1MA 2AAQA 2R0GA 2XLSA 1IUXA 4AP3A 2FBWA 3AE2A 3V76A 2WOWA 5U1OA 5KWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YR6 A;  3P9U A;  4JY3 A;  4KX6 A;  1VG9 A;  4PAA A;  1CJC A;  4OCG A;  4JY2 A;  3RP7 A;  4C74 A;  1O5W A;  4B69 A;  4C5O A;  3UOX A;  1PBC A;  2OAM A;  2WHD A;  3KPF A;  4AOX A;  3P4Q A;  1JNR A;  2GVC A;  2DKI A;  2Q7V A;  1CBO A;  4YTM A;  1W4X A;  1P2H A;  1GTH A;  5LV9 A;  1F8S A;  1KF6 A;  5HXI A;  4U8N A;  3UKA A;  3VR9 A;  4ECH A;  4WX1 A;  2YAU A;  4K7Z A;  2EQ6 A;  4H4Y A;  3UP4 A;  5KOW A;  1L9C A;  2YG4 A;  2YG6 A;  4CCR A;  1PN0 A;  1D7Y A;  3UP5 A;  2VQ7 A;  3AE9 A;  4H2N A;  4PAB A;  4B66 A;  2WOI A;  4J2W A;  1VDC A;  4U2S A;  2GV8 A;  1CC4 A;  1L0V A;  4EQW A;  1LV0 A;  4GCM A;  3H8I A;  5DBJ A;  3AB1 A;  3AD9 B;  4YKG A;  1CL0 A;  2PHH A;  3G5S A;  3NHO X;  2FJA A;  3QSM A;  2V61 A;  4A65 A;  2ZBW A;  3F8R A;  3M0O A;  4JDR A;  4Y4N A;  3C96 A;  1ZMC A;  1D4C A;  2JB2 A;  3LAD A;  2WQY A;  3GRT A;  1Q1W A;  2XVH A;  4E0V A;  2GQW A;  3QSS A;  1EL5 A;  4P9S A;  2GMJ A;  1D4E A;  3ISH A;  1P2E A;  1ZP0 A;  2W0H A;  5U25 A;  5BUL A;  1D5T A;  3KVE A;  1S3E A;  2JB3 A;  2WDV A;  2C73 A;  2BCP A;  4H4S A;  3UOY A;  2XFP A;  2YR4 A;  3B6D A;  2X8C A;  3QFB A;  3CNP A;  1CC6 A;  1NHS A;  1B37 A;  2YG3 A;  4K22 A;  2X8H A;  3GMB A;  4U8P A;  2GH5 A;  4TLZ A;  1NEN A;  1CJ3 A;  4CCQ A;  3I3L A;  3K30 A;  3GYI A;  2NVK X;  4Z26 A;  2B7R A;  3LOV A;  3CND A;  3ZDN A;  1GXF A;  1JRY A;  5BVA A;  4ICY A;  2VZ2 A;  3NKS A;  1DOD A;  1NPX A;  2XFN A;  1ZMD A;  1LJ1 A;  4U2T A;  3S5W A;  5BUK A;  1VRQ B;  2C75 A;  1TDK A;  3UKH A;  3BI2 A;  3QFA A;  3VQR A;  2EQ8 A;  1JU2 A;  1JNZ A;  1GRA A;  2V5Z A;  4K5S A;  4XWZ A;  3ZYX A;  1PJ6 A;  4U8K A;  3II4 A;  3D8X A;  4IA5 A;  1ZY8 A;  1GV4 A;  1FCD A;  4FX9 A;  3IF9 A;  1LQU A;  5KOX A;  3L8K A;  1S2Q A;  4CNJ A;  3FPZ A;  3LB8 A;  1EL8 A;  1MXT A;  2GR2 A;  1UKV G;  3BHK A;  1BWC A;  1JRZ A;  4CY8 A;  4J57 A;  1D4D A;  1NG3 A;  2C66 A;  2WU2 A;  4NTC A;  2B76 A;  2XLT A;  2OA1 A;  1CJ2 A;  1BZL A;  2XVI A;  4USQ A;  3UOV A;  3ALM A;  3GD4 A;  1NEK A;  2CVJ A;  2JK6 A;  2YLR A;  4D03 A;  2JKC A;  2BAC A;  1TDO A;  2BS4 A;  2WS3 A;  1H83 A;  4YWO A;  3NTD A;  1PJ7 A;  2V60 A;  1K4Q A;  1PBB A;  4GF7 A;  1ZX9 A;  1PBD A;  3G5R A;  1LTX R;  3RNM A;  3VRD B;  1YQZ A;  2QA2 A;  3NK2 X;  3UKP A;  3EAO A;  4HB9 A;  2QAE A;  4TM4 A;  2R4E A;  3CNJ A;  5EOW A;  4USR A;  4C3X A;  3LXD A;  1NAA A;  2R0P A;  1FOH A;  1GEU A;  2GAG B;  1REO A;  4H2P A;  3RHA A;  3NGC X;  3BI5 A;  4D04 A;  4H4U A;  2CFY A;  3UKF A;  3V3N A;  1MO9 A;  5JCM A;  2BCG G;  2B7S A;  3KD9 A;  2JBV A;  4RG3 A;  3DK8 A;  4B67 A;  3RP8 A;  4IV9 A;  1KSU A;  4YTN A;  3F8D A;  4BJY A;  4DNA A;  2WP6 A;  1KFY A;  2A89 A;  2ARD A;  3AE5 A;  1IUV A;  1PXB A;  4WCT A;  2GMH A;  2R9Z A;  2A87 A;  2GRT A;  3AED A;  3CNT A;  3AWI A;  4BK1 A;  2VRL A;  4O5Q A;  1CJ4 A;  2VVL A;  3BNU A;  1GT8 A;  1S3B A;  3NYC A;  5CQF A;  1ONF A;  1H6V A;  4EMJ A;  2BK5 A;  2NPX A;  3NIX A;  2GR1 A;  1K0L A;  2Y6Q A;  3AE8 A;  3DJG X;  4GUV A;  4K2X A;  4OVI A;  3V3O A;  1TDE A;  3GMC A;  2XLR A;  3AXB A;  4NTE A;  3AEE A;  1Z6L A;  3CPJ G;  1BKW A;  1E39 A;  1TDN A;  1VQW A;  3IC9 A;  3FIM B;  5FS7 A;  4NEV A;  1RSG A;  4H4P A;  4XXG A;  4Z24 A;  5EBK A;  5ER0 A;  2BAB A;  2YG7 A;  4AOS A;  2YG5 A;  5KXJ A;  4APN A;  3AEB A;  2OLN A;  1D7L A;  4HA6 A;  3AEG A;  2YM2 A;  3CPH G;  1CC2 A;  1GSN A;  5J7X A;  4GDE A;  1XPQ A;  1H81 A;  1BGJ A;  4AT2 A;  4Z2T A;  3NYE A;  1F6M A;  4B64 A;  2RGH A;  3M12 A;  3DGH A;  2XLP A;  4EM4 A;  2YVG A;  1QJD A;  3O0H A;  1GET A;  4OPL A;  5KVI A;  4H4T A;  1H7W A;  3AEC A;  3AYJ A;  4EMI A;  1DOE A;  2C70 A;  2C3D A;  2WET A;  1JRX A;  1VG0 A;  3GD3 A;  2YLS A;  4IVO B;  4DGK A;  3URH A;  2VQB A;  2AR8 A;  4IA6 A;  3UTG A;  4YT0 A;  4J36 A;  2ZZ0 A;  1KNP A;  1QLB A;  2B9X A;  3CNS A;  4FDC B;  4K5R A;  2J3N A;  2OLO A;  4A79 A;  2EQ7 A;  1F8R A;  4TLX A;  2JB1 A;  3FG2 P;  4H2Q A;  1DJQ A;  2BC0 A;  2Y6R A;  4J33 A;  1COY A;  2BXR A;  3K7Q X;  3KKJ A;  3NNE A;  3SQP A;  1NDA A;  5FS8 A;  2V3B A;  1GOS A;  2XLU A;  3EF6 A;  1LVL A;  5C3J A;  2YVF A;  4JNQ A;  3NH3 X;  1V59 A;  4O5U A;  1NHP A;  2Z5X A;  3QVP A;  4U8M A;  1GRE A;  2BXS A;  2FJE A;  5BRT A;  2E4G A;  4H4V A;  1DOB A;  3C4A A;  4TM0 A;  1E1L A;  3M13 A;  3E1T A;  3IHG A;  3NG7 X;  4GRT A;  5FS9 A;  4H4X A;  1FL2 A;  1H7X A;  2AQJ A;  3NN0 X;  4AP1 A;  4U2L A;  2YQU A;  1B5Q A;  3BI4 A;  3NTA A;  4H4R A;  1GTE A;  1B8S A;  3NN6 X;  1KNR A;  1EL9 A;  2C65 A;  1H86 A;  2C64 A;  2DKH A;  2BK3 A;  3IWA A;  1PXA A;  4H7U A;  4EQR A;  4OPC A;  1DNC A;  1IUU A;  3KA7 A;  1M6I A;  4Y4L A;  4YSH A;  2IID A;  4UDQ A;  1OJD A;  2TMD A;  1XAN A;  2RAB A;  2V6O A;  4ADW A;  3DJD A;  4BJZ A;  2GR0 A;  4JN9 A;  2WP9 A;  3SFD A;  3PO7 A;  4B65 A;  4Z43 A;  2V3A A;  1N4W A;  2BS3 A;  2WDR A;  2WPE A;  4RG4 A;  2X99 A;  3T37 A;  1PHH A;  4AT0 A;  1L9D A;  2VVM A;  3VR8 A;  2CDU A;  1PJ5 A;  3RP6 A;  1E6E A;  2VVL G;  5JCL A;  4CY6 A;  2E5V A;  1RYI A;  3SM8 A;  4YXD A;  1ZK7 A;  1O94 A;  2VOU A;  4UP3 A;  4Y4M A;  1H82 A;  4RSL A;  2BK4 A;  2ZZB A;  4JNA A;  4K8D A;  3R9U A;  3Q6J A;  5C2T A;  4U8I A;  1GES A;  2WDQ A;  2FJB A;  2YR5 A;  3K7M X;  1XHC A;  5J60 A;  3FMW A;  4Z2R A;  2XVF A;  5FMH A;  1PDH A;  3L1R A;  2PYX A;  4A7A A;  4H50 A;  2C72 A;  1IJH A;  5U63 A;  2EQ9 A;  2H89 A;  3ALL A;  3ALJ A;  4X9M A;  1FEC A;  2YWL A;  3QSE A;  4I58 A;  5HYM A;  3AEA A;  1GRT A;  1BF3 A;  1E1K A;  3DK9 A;  1K0I A;  1NHR A;  2C76 A;  2GF3 A;  2WBA A;  1EBD A;  1CHU A;  2WEU A;  5CKU A;  3RED A;  3P4S A;  2TPR A;  2GQF A;  1Q9I A;  1QO8 A;  2BYB A;  2HQM A;  4U8L A;  2OAL A;  3AE7 A;  3EAN A;  1ELI A;  3GDN A;  2WU5 A;  3CN8 A;  4X9N A;  2WOV A;  3AE6 A;  4B63 A;  1F3P A;  4H4Z A;  1GER A;  3NRN A;  2XVE A;  1MOK A;  4LII A;  5M10 A;  2H88 A;  2C67 A;  3AD8 B;  3ATQ A;  4CNK A;  3OZ2 A;  1OJT A;  4M52 A;  1Y0P A;  4ZCC A;  4EIP A;  3AE3 A;  3NLC A;  4I59 A;  1E7P A;  1TYT A;  2XCG A;  4MJW A;  3WE0 A;  4DSG A;  4YSX A;  4LA1 A;  1K0J A;  3GDP A;  1AOG A;  2GB0 A;  1JOA A;  5IQ4 A;  4BV6 A;  1H84 A;  1GND A;  5GSN A;  4N9X A;  3UTH A;  4C77 A;  2R4J A;  1IUT A;  4A5L A;  5KRQ A;  4A6N A;  1PXC A;  1GRF A;  1LQT A;  3H8L A;  3ABV A;  5L46 A;  2UZZ A;  3DJJ A;  3UKQ A;  1X31 B;  2QA1 A;  3ATR A;  3I6D A;  1N4V A;  3GSI A;  4Z44 A;  4OPD A;  2BS2 A;  4A6N B;  1EL7 A;  1PBF A;  3VRA A;  1TYP A;  1BGN A;  3CGC A;  1TRB A;  2Q6U A;  1N1P A;  1E1N A;  4GR1 A;  1KSS A;  3GYJ A;  2JAE A;  3DGZ A;  1XDI A;  1O95 A;  2R45 A;  3DK4 A;  5JCK A;  4YSZ A;  3CTY A;  3Q9T A;  1IUW A;  3QJ4 A;  1JEH A;  2YLZ A;  4NZH A;  4EQS A;  3NK1 X;  1HYU A;  1YY5 A;  1GPE A;  1S2Y A;  5JCI A;  4REK A;  4A9W A;  4H4Q A;  4FK1 C;  4Z2U A;  5TR3 A;  2X50 A;  4OPU A;  4OPT A;  5IQ1 A;  3DJE A;  2Q0L A;  1B4V A;  1PBE A;  4CRT A;  3EPT A;  4X4J A;  2O9Z A;  2BC1 A;  2E1M A;  3KU9 A;  2APG A;  3B3R A;  3GWD A;  2YLX A;  1SEZ A;  3H4K A;  5EB5 A;  3FBS A;  2ZZC A;  1KDG A;  3OC4 A;  3DME A;  3UCL A;  2XYO A;  3GWF A;  1PS9 A;  4H2R A;  4OPG A;  5EB4 A;  4YTP A;  4TM1 A;  4EM3 A;  2XFU A;  2Z5Y A;  1ZDL A;  2QCU A;  4NEW A;  3ICT A;  2X8G A;  2FJD A;  1IUS A;  2XVJ A;  5JCN A;  5IPY A;  4EMW A;  2A8X A;  1LPF A;  2WPC A;  4ZCD A;  1FEA A;  1YQ3 A;  4JQ9 A;  4J34 A;  3AEF A;  3S61 A;  1GRH A;  2Q0K A;  5KVH A;  1OJA A;  3AYL A;  1ZOV A;  4C3Y A;  2C3C A;  4XWR A;  3NK0 X;  4BK3 A;  4GDP A;  4LU6 A;  2VRM A;  2I0Z A;  3AE1 A;  3D1C A;  2X3N A;  2RGJ A;  1NHQ A;  4A99 A;  2B9Y A;  1Y56 A;  1FEB A;  2R46 A;  2XDO A;  4BUR A;  1TDF A;  3BNM A;  2F5Z A;  5FS6 A;  4U8J A;  4UDP A;  3ITJ A;  4EIQ A;  3AE4 A;  3CGB A;  1DOC A;  2WES A;  1OJ9 A;  2GR3 A;  3CIR A;  2YVJ A;  1Y56 B;  3SFE A;  3CGE A;  1YQ4 A;  4NTD A;  1GRB A;  1L9E A;  3GRS A;  1F8W A;  2XFO A;  3UTE A;  4DSH A;  4U8O A;  5GRT A;  3UKL A;  3K7T A;  2ACZ A;  3LJP A;  1Q1R A;  2XFQ A;  3BHF A;  5HHF A;  4J31 A;  2YLT A;  2YM1 A;  2B9W A;  3ICS A;  3QVR A;  4TM3 A;  4BK2 A;  3VRB A;  4J56 A;  1CF3 A;  1YKJ A;  1GAL A;  1OJC A;  3AYI A;  2BA9 A;  4UDR A;  3UTF A;  4Z25 A;  4FK1 A;  1DXL A;  3CGD A;  3ICR A;  3KLJ A;  1M64 A;  4YKF A;  4IVM B;  2GEW A;  3SGL A;  3IHM A;  2IVE A;  2WP5 A;  3DH9 A;  3PVC A;  3DA1 A;  2YLW A;  3PS9 A;  4H4W A;  3C4N A;  2C7G A;  1NG4 A;  4B68 A;  4OPI A;  3AD7 B;  4YSY A;  2R0C A;  1RP0 A;  2RGO A;  3ADA B;  3LZX A;  5M0Z A;  3COX A;  1DJN A;  4KPR A;  3UKK A;  3HZL A;  2GAH B;  4CBQ A;  3G5Q A;  3CPI G;  3F8P A;  1N4U A;  3NT6 A;  3P4R A;  2CUL A;  4ZN0 A;  1ZKQ A;  2IVD A;  3P4P A;  3P1W A;  4B1B A;  1ZOY A;  3UOZ A;  3LZW A;  3NYF A;  4EQX A;  2WPF A;  5HY5 A;  1GRG A;  3JSK A;  1E1M A;  2AAQ A;  2R0G A;  2XLS A;  1IUX A;  4AP3 A;  2FBW A;  3AE2 A;  3V76 A;  2WOW A;  5U1O A;  5KWF A; 
#chains in the Genus database with same CATH topology
 2YR6 A;  4GIS A;  4B69 A;  3UOX A;  4AOX A;  3IK4 A;  1W4X A;  1EBH A;  3DDM A;  3S47 A;  1PN0 A;  4IT1 A;  4H2N A;  4PAB A;  2WOI A;  3NRZ B;  4K2S A;  3QSM A;  2FJA A;  4Y4N A;  1EC9 A;  3C96 A;  1ZMC A;  3R10 A;  4P9S A;  1EL5 A;  3NVY B;  3ISH A;  6ENL A;  1MUC A;  2DW7 A;  2W0H A;  2QVH A;  3QFB A;  1CC6 A;  2YG3 A;  4U8P A;  1NEN A;  1CJ3 A;  4CCQ A;  4Z26 A;  2B7R A;  3Q45 A;  3LOV A;  1GXF A;  3R11 A;  2VZ2 A;  3NKS A;  1R0M A;  1NPX A;  1DOD A;  1ZMD A;  1LJ1 A;  4GAP A;  5BUK A;  1JNZ A;  4XWZ A;  3ZYX A;  4K5S A;  1JRO A;  1PJ6 A;  1JPD X;  3D8X A;  2QJM A;  3IF9 A;  2P3Z A;  5FJP A;  4CNJ A;  3FPZ A;  2GR2 A;  3N4E A;  3BHK A;  1BWC A;  4CY8 A;  3SN1 A;  3HYV A;  2POD A;  1NG3 A;  2C66 A;  2B76 A;  1CJ2 A;  4USQ A;  4EWJ A;  3RR1 A;  3FJ4 A;  2BAC A;  2BS4 A;  2WS3 A;  2PTY A;  3K1G A;  1ONE A;  3G5R A;  3VRD B;  2QA2 A;  4HCH A;  2R4E A;  3CNJ A;  4USR A;  4C3X A;  3LXD A;  1NAA A;  2AL2 A;  1FOH A;  4H2P A;  3RHA A;  3T2Y A;  1MO9 A;  3KD9 A;  3T14 A;  3DK8 A;  1MDR A;  3JZU A;  1KSU A;  1KFY A;  2A89 A;  4MKS A;  2HXU A;  3FCP A;  1CJ4 A;  2VVL A;  2PMQ A;  1ONF A;  1H6V A;  4EMJ A;  3RIT A;  4DWD A;  2Y6Q A;  4ZCW A;  3V3O A;  1TDE A;  3GMC A;  3CPJ G;  1R6W A;  3HRD C;  4NEV A;  4XXG A;  2BAB A;  1KKR A;  2GGG A;  1D7L A;  1BGJ A;  4Z2T A;  1F6M A;  3DFY A;  1KKO A;  2PTW A;  2YVG A;  1QJD A;  1GET A;  4OPL A;  1H7W A;  1DOE A;  1JRX A;  2YLS A;  4GME A;  3URH A;  2VQB A;  2AR8 A;  3UTG A;  4YT0 A;  4J36 A;  2B9X A;  2J3N A;  2EQ7 A;  2DW6 A;  1F8R A;  4H2Q A;  1DJQ A;  2GGJ A;  3KKJ A;  3SQP A;  2V3B A;  3DG6 A;  1V59 A;  1NHP A;  2FJE A;  4H4V A;  3IHG A;  1H2I A;  2AQJ A;  3BI4 A;  3NTA A;  3B97 A;  1B8S A;  3BOX A;  1H86 A;  2DKH A;  1ZXI C;  4K8G A;  3KA7 A;  4BJZ A;  4ADW A;  3DJD A;  2GR0 A;  2AKM A;  3PO7 A;  4Z43 A;  2WDR A;  2BS3 A;  3DES A;  1EC8 A;  2WPE A;  3ES7 A;  3VFC A;  3V5F A;  2E5V A;  3SM8 A;  1FFU C;  4HYR A;  1ZK7 A;  1O94 A;  4UP3 A;  4Y4M A;  2PP0 A;  3R9U A;  4U8I A;  3K7M X;  5J60 A;  4Z2R A;  3L1R A;  3ZVH A;  2PYX A;  4H50 A;  5U63 A;  3QSE A;  4I58 A;  1GRT A;  1NHR A;  2WBA A;  1EBD A;  2GQF A;  1QO8 A;  3EAN A;  1ELI A;  4X9N A;  2WU5 A;  3CN8 A;  2WOV A;  4B63 A;  1F3P A;  3S5S A;  3VA8 A;  4ZCC A;  4MJW A;  1E7P A;  2XCG A;  4YSX A;  3WE0 A;  1L8P A;  4BV6 A;  1H84 A;  5GSN A;  4N9X A;  2R4J A;  1GRF A;  3THU A;  3UKQ A;  4E4F A;  2BS2 A;  3VRA A;  1TYP A;  2JAE A;  4J1O A;  3DGZ A;  3DK4 A;  5JCK A;  2YLZ A;  4EQS A;  4REK A;  1N5X A;  4FK1 C;  5TR3 A;  3DJE A;  2OZ3 A;  3EPT A;  4X4J A;  3GWD A;  2BRY A;  3H4K A;  5EB5 A;  1KDG A;  3TCS A;  3L5O A;  4EM3 A;  2XFU A;  3D46 A;  4NEW A;  2PGE A;  1IUS A;  2MUC A;  2XVJ A;  3SZ0 A;  2I5Q A;  3UCC A;  5IPY A;  3KPK A;  4A35 A;  2WPC A;  4IP4 A;  4J34 A;  3AYL A;  3DFH A;  3NK0 X;  4LU6 A;  2I0Z A;  3D1C A;  1NHQ A;  1FEB A;  3TWB A;  2XDO A;  1IYX A;  4M0X A;  3ITJ A;  4GAV A;  2WES A;  3T4W A;  3T8Q A;  1OJ9 A;  2GR3 A;  3CIR A;  1Y56 B;  1XS2 A;  1GRB A;  3DER A;  1JCT A;  2CHR A;  5EU9 A;  3LJP A;  3BHF A;  3NS1 B;  5HHF A;  3NVW B;  4J31 A;  3ICS A;  3GO2 A;  4BK2 A;  3VRB A;  5BOE A;  4A3R A;  4J56 A;  4UDR A;  4Z25 A;  3DIP A;  2BRA A;  3ICR A;  1M64 A;  4IVM B;  1VQZ A;  3PVC A;  3MUC A;  2C7G A;  1RP0 A;  3LZX A;  3UKK A;  3R0U A;  5G5G B;  2XH7 A;  3F8P A;  1N4U A;  4FI4 A;  3HPF A;  2W55 A;  4MGG A;  4E6M A;  3LZW A;  3NYF A;  4EQX A;  1GRG A;  3AN1 A;  1N61 C;  5U1O A;  3UJF A;  3KUM A;  3P9U A;  1RM6 B;  1T3Q C;  4IP5 A;  1PBC A;  2OAM A;  1CBO A;  1P2H A;  1GTH A;  1F8S A;  1KF6 A;  4U8N A;  3DG7 A;  4X2P A;  1L9C A;  5FJR A;  3AE9 A;  4GFI A;  4B66 A;  2GV8 A;  1L0V A;  4GCM A;  3H8I A;  1N63 C;  3NHO X;  1FHV A;  3M0O A;  3NXL A;  3GRT A;  2XVH A;  4E0V A;  3QSS A;  1D5T A;  1S3E A;  4FP1 A;  2PA6 A;  2NVK X;  3ZDN A;  2XFN A;  4U2T A;  1VRQ B;  2C75 A;  3BI2 A;  2ZC8 A;  3VQR A;  4JN7 A;  2EQ8 A;  1GRA A;  4II3 A;  3SZC A;  3II4 A;  4A6G A;  1LQU A;  1MXT A;  1EL8 A;  2QGY A;  4J57 A;  1D4D A;  3PG6 A;  2XLT A;  2OA1 A;  2XVI A;  2JK6 A;  3I6E A;  2JKC A;  1TDO A;  3NTD A;  1H83 A;  2V60 A;  1K4Q A;  1PBB A;  4GYP A;  3RNM A;  1YQZ A;  3NK2 X;  3IJQ A;  2QAE A;  4TM4 A;  2OLA A;  3SBF A;  2R0P A;  2GL5 A;  3NGC X;  4H4U A;  3AM9 A;  2JBV A;  4YTN A;  3PK7 A;  4IZG A;  2WP6 A;  3AE5 A;  1IUV A;  2GMH A;  2E5A A;  3CNT A;  1ELS A;  2VRL A;  4O5Q A;  3BNU A;  1S3B A;  3JW7 A;  5CQF A;  2NPX A;  2PU0 A;  3AE8 A;  3DJG X;  4K2X A;  4OVI A;  1BKW A;  1VQW A;  5G5H B;  5FS7 A;  3DEQ A;  5ER0 A;  4AOS A;  5KXJ A;  4APN A;  3AEG A;  1P43 A;  1CC2 A;  1XPQ A;  4K1W A;  2RGH A;  3M12 A;  3DGH A;  3O0H A;  3TJI A;  3OPS A;  4DGK A;  2ZZ0 A;  3CNS A;  4A79 A;  3GY1 A;  2JB1 A;  2PGW A;  4J33 A;  1COY A;  2BXR A;  3K7Q X;  5FS8 A;  1KN0 A;  2OVL A;  5C3J A;  3NH3 X;  2Z5X A;  1GRE A;  1DOB A;  2GGE A;  1FL2 A;  1H7X A;  3NN0 X;  3N4F A;  4H4R A;  1EL9 A;  2C64 A;  2BK3 A;  1PXA A;  4EQR A;  4OPC A;  4G74 A;  2IID A;  4G6H A;  1OJD A;  2TMD A;  3PWG A;  1XAN A;  2RAB A;  4NWZ A;  2V6O A;  2V3A A;  2GSH A;  1PHH A;  2P0I A;  3QLD A;  1E6E A;  5JCL A;  3FVD A;  1RYI A;  2OPJ A;  4GIR A;  4RSL A;  2ZZB A;  4K8D A;  3Q6J A;  5KMQ A;  1XHC A;  3V5C A;  2QJJ A;  3FMW A;  5FMH A;  1PDH A;  4A7A A;  2EQ9 A;  2H89 A;  3ALJ A;  1FEC A;  3AEA A;  3DK9 A;  3FXG A;  5IDZ A;  2BYB A;  2C4C A;  2HQM A;  3HYW A;  4U8L A;  2OAL A;  3DGB A;  3GDN A;  1NEL A;  1GER A;  1P48 A;  2H88 A;  4CNK A;  1Y0P A;  4TVW A;  3Q4D A;  3NLC A;  4ROP A;  4I59 A;  1K0J A;  1AOG A;  1JOA A;  3UTH A;  3B9J B;  3CAW A;  1EC7 A;  4M6U A;  1PXC A;  1LQT A;  3H8L A;  2AL1 A;  5J04 A;  2QA1 A;  3ATR A;  3GSI A;  3I6D A;  4Z44 A;  4A6N B;  1E1N A;  4GR1 A;  3PFR A;  1PDZ A;  1X2G A;  3GD6 A;  3VC5 A;  2R45 A;  5FJU A;  2OZ8 A;  1IUW A;  2XH0 A;  3NK1 X;  1YY5 A;  1S2Y A;  2X50 A;  4OPU A;  4OPT A;  1W6T A;  2Q0L A;  3RRA A;  4CRT A;  2O9Z A;  2APG A;  3B3R A;  2ZZC A;  3T6C A;  3DME A;  3UCL A;  3STP A;  4OPG A;  2FYM A;  2X8G A;  3NFU A;  4EMW A;  3QPE A;  3P0W A;  3S61 A;  1OJA A;  2C3C A;  3MY9 A;  4BK3 A;  3ZLH A;  2B9Y A;  1Y56 A;  2R46 A;  1TDF A;  3BNM A;  2F5Z A;  4U8J A;  4UDP A;  4EIQ A;  4DXK A;  4ZA0 A;  1YQ4 A;  2XFO A;  3MSY A;  3CB3 A;  4U8O A;  3UKL A;  2ACZ A;  1Q1R A;  2XFQ A;  1FO4 A;  2YLT A;  3QVR A;  3T2Z A;  3AYI A;  1OJC A;  3SGL A;  3IHM A;  2RDX A;  3DA1 A;  2YLW A;  3QKE A;  4H4W A;  4YSY A;  2RGO A;  3ADA B;  5M0Z A;  1DJN A;  1TKK A;  4CBQ A;  3CPI G;  3UJR A;  2HZG A;  4B1B A;  1SJD A;  1ZOY A;  3UOZ A;  5HY5 A;  1E1M A;  2AAQ A;  2R0G A;  4AP3 A;  5FJO A;  3V76 A;  2WOW A;  5KWF A;  4JY3 A;  3HW2 A;  1VG9 A;  4JY2 A;  3P4Q A;  2DKI A;  2OKT A;  3UKA A;  3VR9 A;  4ECH A;  4WX1 A;  4K7Z A;  2EQ6 A;  4H4Y A;  2YG4 A;  2YG6 A;  1D7Y A;  3OZM A;  1CC4 A;  4EQW A;  4GYP C;  3AD9 B;  2PHH A;  3VC6 A;  4A65 A;  2ZBW A;  1D4C A;  2XH2 A;  2WQY A;  1Q1W A;  1MRA A;  2GQW A;  2GMJ A;  1P2E A;  1ZP0 A;  5U25 A;  2PTZ A;  2JB3 A;  2WDV A;  2BCP A;  4H4S A;  2XFP A;  2YR4 A;  3CNP A;  2X8C A;  1NHS A;  4Z17 A;  3R0K A;  3A7U A;  2GH5 A;  3K30 A;  3CND A;  4ICY A;  4Z1Y A;  3UKH A;  3CXB A;  2V5Z A;  4JN8 A;  3CXO A;  4IA5 A;  1GV4 A;  1ZY8 A;  1N60 C;  1FCD A;  5KOX A;  3L8K A;  1S2Q A;  3MZN A;  1UKV G;  1JRZ A;  3OP2 A;  2WU2 A;  1RVK A;  3ALM A;  3IJI A;  3GD4 A;  2CVJ A;  2YLR A;  3BJS A;  3R1Z A;  1ZX9 A;  1LTX R;  1FFV C;  3H70 A;  5EOW A;  1GEU A;  1REO A;  4D04 A;  2CFY A;  1SJA A;  3UKF A;  5JCM A;  3V3N A;  2BCG G;  3HYX A;  3SN0 A;  4RG3 A;  4B67 A;  4IV9 A;  3CT2 A;  3F8D A;  3UXK A;  4BJY A;  2ARD A;  1PXB A;  4WCT A;  2R9Z A;  3AWI A;  3NYC A;  2BK5 A;  1K0L A;  3DG3 A;  2XLR A;  3AXB A;  3AEE A;  1Z6L A;  1E39 A;  1TDN A;  3FIM B;  1RSG A;  3I6T A;  4H4P A;  4Z24 A;  3N6H A;  5EBK A;  2YG7 A;  2YG5 A;  2OO6 A;  3AEB A;  2OLN A;  4G7F A;  2YM2 A;  1GSN A;  3H12 A;  3SY4 A;  5J7X A;  4GDE A;  1F9C A;  4B64 A;  2XLP A;  5KVI A;  4H4T A;  3AEC A;  3AYJ A;  2C70 A;  2WET A;  1VG0 A;  3MQT A;  3TTE A;  1KNP A;  4K5R A;  3OZY A;  4FDC B;  2OLO A;  3UXL A;  3FG2 P;  2Y6R A;  1NDA A;  1GOS A;  5FJT A;  2XLU A;  3EF6 A;  3SQS A;  3SX6 A;  2YVF A;  4JNQ A;  4O5U A;  2E4G A;  1DTN A;  3C4A A;  3M13 A;  3E1T A;  3NG7 X;  4GRT A;  5FS9 A;  4H4X A;  4AP1 A;  1WYG A;  2YQU A;  4G6G A;  1KNR A;  4ENL A;  4H7U A;  4KEM A;  4ZOH B;  3MKC A;  4Y4L A;  3TOY A;  4UDQ A;  3SR6 B;  3UJS A;  4IL2 A;  2WP9 A;  3SFD A;  4RG4 A;  4JHM A;  4AT0 A;  1L9D A;  3VR8 A;  2CDU A;  1PJ5 A;  3RP6 A;  2VVL G;  4DN1 A;  4YXD A;  2OZT A;  1KCZ A;  2BK4 A;  4JNA A;  5C2T A;  1GES A;  1VDV A;  2PTX A;  2C72 A;  2E3T A;  5KNL A;  5HYM A;  4H83 A;  2XGZ A;  1BF3 A;  1E1K A;  1TE6 A;  2C76 A;  2GF3 A;  5CKU A;  1CHU A;  2TPR A;  1Q9I A;  3MWC A;  3AE6 A;  3TWA A;  1MOK A;  4LII A;  2C67 A;  3ATQ A;  2QJN A;  1MNS A;  4DSG A;  4LA1 A;  1N62 C;  2GB0 A;  4C77 A;  1GND A;  5KRQ A;  4A6N A;  4G8T A;  2UZZ A;  3NVV B;  2PP3 A;  1N4V A;  4OPD A;  1PDY A;  1EL7 A;  4E8G A;  1PBF A;  3D9X A;  1BGN A;  3CGC A;  1TRB A;  1N1P A;  1KSS A;  3GYJ A;  3T9P A;  1O95 A;  5KMS A;  3CTY A;  1JEH A;  4H1Z A;  1HYU A;  1GPE A;  5JCI A;  3GYX A;  5IQ1 A;  1B4V A;  1PBE A;  3N6J A;  2E1M A;  3KU9 A;  2YLX A;  2ONE A;  3OC4 A;  1PS9 A;  4H2R A;  2Z5Y A;  1ZDL A;  2QCU A;  2FJD A;  2A8X A;  1LPF A;  1FEA A;  1YQ3 A;  3AEF A;  1GRH A;  2Q0K A;  1WUE A;  5KVH A;  1ZOV A;  2PS2 A;  2PU1 A;  2ZAD A;  2VRM A;  3AE1 A;  2X3N A;  3P3B A;  2OQH A;  4YWS A;  3OTR A;  4BUR A;  5FS6 A;  3AE4 A;  3CGB A;  1DOC A;  4H2H A;  3CGE A;  4NTD A;  2QQ6 A;  1L9E A;  3ENL A;  3GRS A;  1F8W A;  3VDG A;  3K7T A;  4G9K A;  2YM1 A;  4TM3 A;  1CF3 A;  1YKJ A;  1GAL A;  4KWS A;  4YKF A;  3CGD A;  3KLJ A;  3SZF A;  2IVE A;  4G73 A;  2WP5 A;  3DH9 A;  4IHC A;  5KMR A;  2R0C A;  3QN3 A;  3COX A;  2GAH B;  3NT6 A;  2CUL A;  1SB3 B;  2IVD A;  3RCY A;  4E4U A;  3NZG A;  3UCD A;  2WPF A;  2XLS A;  2FBW A;  4TVY A;  4HNC A;  3D47 A;  3QTP A;  4KX6 A;  4PAA A;  3RP7 A;  1CJC A;  4OCG A;  4C74 A;  1O5W A;  4C5O A;  2WHD A;  3KPF A;  3CMM A;  1JNR A;  2GVC A;  3NVZ B;  2Q7V A;  4YTM A;  4HCL A;  5LV9 A;  5HXI A;  3EKG A;  2YAU A;  5KOW A;  3UP4 A;  4CCR A;  1TZZ A;  3UP5 A;  2VQ7 A;  1WUF A;  4J2W A;  1VDC A;  4U2S A;  5KMP A;  1LV0 A;  3OW1 A;  3SZW A;  5DBJ A;  3AB1 A;  4YKG A;  1CL0 A;  3G5S A;  3I4K A;  2V61 A;  3JVA A;  3F8R A;  1V97 A;  4JDR A;  2OX4 A;  2JB2 A;  3LAD A;  1SJC A;  2W54 A;  1D4E A;  5BUL A;  3VCN A;  3KVE A;  4DHG A;  2C73 A;  3UOY A;  3B6D A;  1B37 A;  4K22 A;  4E5T A;  2X8H A;  3NO1 A;  3GMB A;  3V4B A;  4TLZ A;  3UGV A;  3I3L A;  3GYI A;  3BSM A;  1JRY A;  5BVA A;  3S5W A;  1TDK A;  3QFA A;  2AKZ A;  1JU2 A;  2XSX A;  4U8K A;  4FX9 A;  4HPN A;  2PP1 A;  3LB8 A;  3SSZ A;  3PWI A;  4NTC A;  2POZ A;  3EUB 3;  1BZL A;  3UOV A;  2GDQ A;  1NEK A;  4D03 A;  3ETR B;  4HCD A;  4YWO A;  1PJ7 A;  1E9I A;  4GF7 A;  1PBD A;  4HN8 A;  1YEY A;  3UKP A;  3EAO A;  4HB9 A;  3T2K A;  3RGT A;  2GAG B;  3R07 C;  5ENL A;  3BI5 A;  2B7S A;  3TW9 A;  3FV9 A;  3TQP A;  1ECQ A;  3RP8 A;  2AL2 B;  4DNA A;  3P93 A;  2A87 A;  2GRT A;  3AED A;  1SJB A;  2OG9 A;  4BK1 A;  1GT8 A;  3AMZ A;  3NIX A;  2MNR A;  2GR1 A;  1NU5 A;  2P8B A;  4GUV A;  4NTE A;  1KD0 A;  3CYJ A;  3IC9 A;  1OEP A;  4HA6 A;  3SXI A;  3CPH G;  1BKH A;  1H81 A;  4AT2 A;  3U4F A;  1XPY A;  3NYE A;  3ZLG A;  4EM4 A;  2P88 A;  2O56 A;  4EMI A;  2C3D A;  3GD3 A;  4IVO B;  4F4R A;  4IA6 A;  1JPM A;  1QLB A;  4NNJ A;  4J3Z A;  4TLX A;  2BC0 A;  3NNE A;  2OQY A;  3SYI A;  1LVL A;  1MDL A;  3QVP A;  4U8M A;  5BRT A;  2BXS A;  3V3W A;  4TM0 A;  1E1L A;  4U2L A;  1B5Q A;  4KT2 A;  1BQG A;  1GTE A;  3NN6 X;  2C65 A;  3IWA A;  1FHU A;  3UJ2 A;  2GGI A;  1DNC A;  1IUU A;  1M6I A;  4YSH A;  3SN4 A;  4JN9 A;  4B65 A;  1N4W A;  2X99 A;  3SJN A;  3T37 A;  2VVM A;  1JDF A;  4CY6 A;  1N5W C;  2VOU A;  1H82 A;  3ZVI A;  2OFJ A;  2WDQ A;  2FJB A;  2YR5 A;  1X2H A;  5BOF A;  2QDD A;  2XVF A;  3H8A A;  1IJH A;  3ALL A;  4X9M A;  2YWL A;  1K0I A;  2WEU A;  3EEZ A;  3ZVH B;  2P8C A;  3FYY A;  3RED A;  3P4S A;  2HXT A;  1FIQ B;  3AE7 A;  1JRP A;  4H4Z A;  3R25 A;  2W3R A;  3NRN A;  2XVE A;  5M10 A;  3AD8 B;  3OZ2 A;  1OJT A;  4M52 A;  4EIP A;  3AE3 A;  1TYT A;  3GDP A;  5IQ4 A;  3GC2 A;  1IUT A;  4A5L A;  3ABV A;  5L46 A;  3DJJ A;  1X31 B;  4GGH A;  2FKP A;  2NQL A;  3T31 A;  2Q6U A;  3A7A A;  1S7M A;  7ENL A;  1XDI A;  3H7V A;  2HNE A;  2QDE A;  4YSZ A;  3Q9T A;  3QJ4 A;  4NZH A;  4A9W A;  2W3S A;  4H4Q A;  4Z2U A;  2BC1 A;  1SEZ A;  3FBS A;  2XYO A;  3GWF A;  3A7R A;  4IL0 A;  5EB4 A;  4YTP A;  4TM1 A;  2PCE A;  3ICT A;  4GGB A;  3UJE A;  1EBG A;  5JCN A;  4DX3 A;  4ZCD A;  2GGH A;  4JQ9 A;  4C3Y A;  3CK5 A;  4II2 A;  4XWR A;  4GDP A;  2RGJ A;  2PSN A;  4A99 A;  3VCC A;  2XH4 A;  2YVJ A;  4DYE A;  3SFE A;  3ZLF A;  4HNL A;  3IJL A;  3UTE A;  4DSH A;  4MMW A;  4KPL A;  5GRT A;  2B9W A;  4H19 A;  3UTF A;  2BA9 A;  4FK1 A;  1DXL A;  2GEW A;  3RO6 A;  3PS9 A;  1STZ A;  3C4N A;  4B68 A;  1NG4 A;  3TJ4 A;  4OPI A;  3AD7 B;  3U9I A;  4KPR A;  3HZL A;  3G5Q A;  3P4R A;  4ZN0 A;  5JRB A;  1ZKQ A;  3P4P A;  3P1W A;  3T0K A;  3ES8 A;  2PPG A;  3JSK A;  1IUX A;  3AE2 A; 
#chains in the Genus database with same CATH homology
 2YR6 A;  3P9U A;  4JY3 A;  4KX6 A;  1VG9 A;  4PAA A;  1CJC A;  4OCG A;  4JY2 A;  3RP7 A;  4C74 A;  1O5W A;  4B69 A;  4C5O A;  3UOX A;  1PBC A;  2OAM A;  2WHD A;  3KPF A;  3CMM A;  4AOX A;  3P4Q A;  1JNR A;  2GVC A;  2DKI A;  2Q7V A;  1CBO A;  4YTM A;  1W4X A;  1P2H A;  1GTH A;  5LV9 A;  1F8S A;  1KF6 A;  5HXI A;  4U8N A;  3UKA A;  3VR9 A;  4ECH A;  4WX1 A;  2YAU A;  4K7Z A;  2EQ6 A;  4H4Y A;  3UP4 A;  5KOW A;  1L9C A;  2YG4 A;  2YG6 A;  4CCR A;  1PN0 A;  1D7Y A;  3UP5 A;  2VQ7 A;  3AE9 A;  4H2N A;  4PAB A;  4B66 A;  2WOI A;  4J2W A;  1VDC A;  4U2S A;  5KMP A;  2GV8 A;  1CC4 A;  1L0V A;  4EQW A;  1LV0 A;  4GCM A;  3H8I A;  3SZW A;  5DBJ A;  3AB1 A;  3AD9 B;  4YKG A;  1CL0 A;  2PHH A;  3G5S A;  3NHO X;  2FJA A;  3QSM A;  2V61 A;  4A65 A;  2ZBW A;  3F8R A;  3M0O A;  4JDR A;  4Y4N A;  3C96 A;  1ZMC A;  1D4C A;  2JB2 A;  3LAD A;  2WQY A;  3GRT A;  1Q1W A;  2XVH A;  4E0V A;  2GQW A;  3QSS A;  1EL5 A;  4P9S A;  2GMJ A;  1D4E A;  3ISH A;  1P2E A;  1ZP0 A;  2W0H A;  5U25 A;  5BUL A;  1D5T A;  3KVE A;  1S3E A;  2JB3 A;  2WDV A;  2C73 A;  2BCP A;  4H4S A;  3UOY A;  2XFP A;  2YR4 A;  3B6D A;  2X8C A;  3QFB A;  3CNP A;  1CC6 A;  1NHS A;  1B37 A;  2YG3 A;  4K22 A;  2X8H A;  3GMB A;  4U8P A;  2GH5 A;  4TLZ A;  1NEN A;  1CJ3 A;  4CCQ A;  3I3L A;  3K30 A;  3GYI A;  2NVK X;  4Z26 A;  2B7R A;  3LOV A;  3CND A;  3ZDN A;  1GXF A;  1JRY A;  5BVA A;  4ICY A;  2VZ2 A;  3NKS A;  1DOD A;  1NPX A;  2XFN A;  1ZMD A;  1LJ1 A;  4GAP A;  4U2T A;  3S5W A;  1VRQ B;  2C75 A;  1TDK A;  3UKH A;  5BUK A;  3BI2 A;  3QFA A;  3VQR A;  2EQ8 A;  1JU2 A;  1JNZ A;  1GRA A;  2V5Z A;  4K5S A;  4II3 A;  4XWZ A;  1PJ6 A;  3ZYX A;  4U8K A;  3SZC A;  3II4 A;  3D8X A;  4IA5 A;  1ZY8 A;  1GV4 A;  1FCD A;  4FX9 A;  3IF9 A;  1LQU A;  5KOX A;  3L8K A;  1S2Q A;  4CNJ A;  3FPZ A;  3LB8 A;  1EL8 A;  1MXT A;  2GR2 A;  1UKV G;  3BHK A;  1BWC A;  1JRZ A;  4CY8 A;  4J57 A;  3HYV A;  1D4D A;  1NG3 A;  2C66 A;  2WU2 A;  4NTC A;  3PG6 A;  2B76 A;  2XLT A;  2OA1 A;  1CJ2 A;  1BZL A;  2XVI A;  4USQ A;  3UOV A;  3ALM A;  3GD4 A;  1NEK A;  2CVJ A;  2JK6 A;  2YLR A;  4D03 A;  2JKC A;  2BAC A;  1TDO A;  2BS4 A;  2WS3 A;  1H83 A;  4YWO A;  3NTD A;  1PJ7 A;  2V60 A;  1K4Q A;  1PBB A;  4GF7 A;  1ZX9 A;  1PBD A;  3G5R A;  1LTX R;  3RNM A;  3VRD B;  1YQZ A;  2QA2 A;  3NK2 X;  3UKP A;  3EAO A;  4HB9 A;  3T2K A;  2QAE A;  4TM4 A;  2R4E A;  3CNJ A;  5EOW A;  4USR A;  4C3X A;  3LXD A;  1NAA A;  2R0P A;  1FOH A;  1GEU A;  2GAG B;  1REO A;  4H2P A;  3RHA A;  3T2Y A;  3NGC X;  3BI5 A;  4D04 A;  4H4U A;  2CFY A;  3UKF A;  3V3N A;  1MO9 A;  5JCM A;  2BCG G;  2B7S A;  3KD9 A;  2JBV A;  3HYX A;  3T14 A;  4RG3 A;  3DK8 A;  4B67 A;  3RP8 A;  4IV9 A;  1KSU A;  4YTN A;  3F8D A;  4BJY A;  4DNA A;  2WP6 A;  1KFY A;  2A89 A;  2ARD A;  3AE5 A;  1IUV A;  1PXB A;  4WCT A;  2GMH A;  2R9Z A;  2A87 A;  2GRT A;  3AED A;  3CNT A;  3AWI A;  4BK1 A;  2VRL A;  4O5Q A;  1CJ4 A;  2VVL A;  3BNU A;  1GT8 A;  1S3B A;  3NYC A;  5CQF A;  1ONF A;  1H6V A;  4EMJ A;  2BK5 A;  2NPX A;  3NIX A;  2GR1 A;  1K0L A;  2Y6Q A;  3AE8 A;  3DJG X;  4GUV A;  4K2X A;  4OVI A;  3V3O A;  1TDE A;  3GMC A;  2XLR A;  3AXB A;  4NTE A;  3AEE A;  1Z6L A;  3CPJ G;  1BKW A;  1E39 A;  1TDN A;  1VQW A;  3IC9 A;  3FIM B;  5FS7 A;  4NEV A;  1RSG A;  4H4P A;  4XXG A;  4Z24 A;  5EBK A;  5ER0 A;  2BAB A;  2YG7 A;  4AOS A;  2YG5 A;  5KXJ A;  4APN A;  3AEB A;  2OLN A;  1D7L A;  4HA6 A;  3AEG A;  2YM2 A;  3SXI A;  3CPH G;  1CC2 A;  1GSN A;  3SY4 A;  5J7X A;  4GDE A;  1XPQ A;  1H81 A;  1BGJ A;  4AT2 A;  4Z2T A;  3NYE A;  1F6M A;  4B64 A;  2RGH A;  3M12 A;  3DGH A;  2XLP A;  4EM4 A;  2YVG A;  1QJD A;  3O0H A;  1GET A;  4OPL A;  5KVI A;  4H4T A;  1H7W A;  3AEC A;  3AYJ A;  4EMI A;  1DOE A;  2C70 A;  2C3D A;  2WET A;  1JRX A;  1VG0 A;  3GD3 A;  2YLS A;  4IVO B;  4DGK A;  3URH A;  2VQB A;  2AR8 A;  4IA6 A;  3UTG A;  4YT0 A;  4J36 A;  2ZZ0 A;  1KNP A;  1QLB A;  2B9X A;  3CNS A;  4FDC B;  4K5R A;  4NNJ A;  2J3N A;  2OLO A;  4A79 A;  2EQ7 A;  1F8R A;  4TLX A;  2JB1 A;  3FG2 P;  4H2Q A;  1DJQ A;  2BC0 A;  2Y6R A;  4J33 A;  5KNL A;  1COY A;  2BXR A;  3K7Q X;  3KKJ A;  3NNE A;  3SQP A;  1NDA A;  5FS8 A;  1KN0 A;  3SYI A;  2V3B A;  1GOS A;  2XLU A;  3EF6 A;  1LVL A;  5C3J A;  3SX6 A;  2YVF A;  4JNQ A;  3NH3 X;  1V59 A;  4O5U A;  1NHP A;  2Z5X A;  3QVP A;  4U8M A;  1GRE A;  2BXS A;  2FJE A;  5BRT A;  2E4G A;  4H4V A;  1DOB A;  3C4A A;  4TM0 A;  1E1L A;  3M13 A;  3E1T A;  3IHG A;  3NG7 X;  1H2I A;  4GRT A;  4H4X A;  5FS9 A;  1FL2 A;  1H7X A;  2AQJ A;  3NN0 X;  4U2L A;  4AP1 A;  2YQU A;  4G6G A;  1B5Q A;  3BI4 A;  3NTA A;  4H4R A;  1GTE A;  1B8S A;  3NN6 X;  1KNR A;  1EL9 A;  2C65 A;  1H86 A;  2C64 A;  2DKH A;  2BK3 A;  3IWA A;  1PXA A;  4H7U A;  4EQR A;  4OPC A;  4G74 A;  1DNC A;  1IUU A;  3KA7 A;  1M6I A;  4Y4L A;  4YSH A;  2IID A;  4G6H A;  1OJD A;  4UDQ A;  2TMD A;  1XAN A;  2RAB A;  2V6O A;  4ADW A;  3DJD A;  4NWZ A;  4BJZ A;  2GR0 A;  4JN9 A;  2WP9 A;  3SFD A;  3PO7 A;  4B65 A;  4Z43 A;  2V3A A;  1N4W A;  2BS3 A;  2WDR A;  2WPE A;  4RG4 A;  2X99 A;  3T37 A;  1PHH A;  4AT0 A;  1L9D A;  2VVM A;  3VR8 A;  2CDU A;  1PJ5 A;  3RP6 A;  1E6E A;  2VVL G;  5JCL A;  4CY6 A;  2E5V A;  1RYI A;  3SM8 A;  4YXD A;  1ZK7 A;  1O94 A;  2VOU A;  4UP3 A;  4Y4M A;  1H82 A;  4RSL A;  2BK4 A;  2ZZB A;  4JNA A;  4K8D A;  3R9U A;  3Q6J A;  5C2T A;  4U8I A;  1GES A;  2WDQ A;  2FJB A;  2YR5 A;  3K7M X;  5KMQ A;  1XHC A;  5J60 A;  3FMW A;  4Z2R A;  2XVF A;  5FMH A;  1PDH A;  3L1R A;  2PYX A;  4A7A A;  4H50 A;  2C72 A;  1IJH A;  5U63 A;  2EQ9 A;  2H89 A;  3ALL A;  3ALJ A;  4X9M A;  1FEC A;  2YWL A;  3QSE A;  4I58 A;  5HYM A;  3AEA A;  1GRT A;  1BF3 A;  1E1K A;  3DK9 A;  1K0I A;  1NHR A;  2C76 A;  2GF3 A;  2WBA A;  1EBD A;  1CHU A;  2WEU A;  5CKU A;  3RED A;  3P4S A;  2TPR A;  2GQF A;  1Q9I A;  1QO8 A;  2BYB A;  2C4C A;  2HQM A;  3HYW A;  4U8L A;  2OAL A;  3AE7 A;  3EAN A;  1ELI A;  3GDN A;  2WU5 A;  3CN8 A;  4X9N A;  2WOV A;  3AE6 A;  4B63 A;  1F3P A;  4H4Z A;  1GER A;  3NRN A;  2XVE A;  1MOK A;  4LII A;  5M10 A;  2H88 A;  2C67 A;  3AD8 B;  3ATQ A;  4CNK A;  3OZ2 A;  1OJT A;  4M52 A;  1Y0P A;  4ZCC A;  4EIP A;  3AE3 A;  3NLC A;  4I59 A;  1E7P A;  1TYT A;  2XCG A;  4MJW A;  3WE0 A;  4DSG A;  4YSX A;  4LA1 A;  1K0J A;  3GDP A;  1AOG A;  2GB0 A;  1JOA A;  5IQ4 A;  4BV6 A;  1H84 A;  1GND A;  5GSN A;  4N9X A;  3UTH A;  4C77 A;  2R4J A;  1IUT A;  4A5L A;  5KRQ A;  4A6N A;  1PXC A;  1GRF A;  1LQT A;  3H8L A;  3ABV A;  5L46 A;  2UZZ A;  3DJJ A;  3UKQ A;  1X31 B;  2QA1 A;  3ATR A;  3I6D A;  1N4V A;  3GSI A;  4Z44 A;  4OPD A;  2BS2 A;  4A6N B;  1EL7 A;  1PBF A;  3VRA A;  1TYP A;  3D9X A;  1BGN A;  3CGC A;  1TRB A;  2Q6U A;  3T31 A;  1N1P A;  1E1N A;  4GR1 A;  1KSS A;  3GYJ A;  1S7M A;  2JAE A;  3DGZ A;  1XDI A;  1O95 A;  2R45 A;  3DK4 A;  5JCK A;  4YSZ A;  3CTY A;  3Q9T A;  1IUW A;  5KMS A;  3QJ4 A;  1JEH A;  2YLZ A;  4NZH A;  4EQS A;  3NK1 X;  1HYU A;  1YY5 A;  1GPE A;  1S2Y A;  5JCI A;  4REK A;  4A9W A;  4H4Q A;  4FK1 C;  4Z2U A;  5TR3 A;  2X50 A;  4OPU A;  4OPT A;  3GYX A;  5IQ1 A;  3DJE A;  2Q0L A;  1B4V A;  1PBE A;  4CRT A;  3EPT A;  4X4J A;  2O9Z A;  2BC1 A;  2E1M A;  3KU9 A;  2APG A;  3B3R A;  3GWD A;  2YLX A;  2BRY A;  1SEZ A;  3H4K A;  5EB5 A;  3FBS A;  2ZZC A;  1KDG A;  3OC4 A;  3DME A;  3UCL A;  2XYO A;  3GWF A;  1PS9 A;  4H2R A;  4OPG A;  5EB4 A;  3L5O A;  4YTP A;  4TM1 A;  4EM3 A;  2XFU A;  2Z5Y A;  1ZDL A;  2QCU A;  4NEW A;  3ICT A;  2X8G A;  2FJD A;  1IUS A;  2XVJ A;  3SZ0 A;  5JCN A;  5IPY A;  4EMW A;  2A8X A;  3KPK A;  1LPF A;  2WPC A;  4ZCD A;  1FEA A;  1YQ3 A;  4JQ9 A;  4J34 A;  3AEF A;  3S61 A;  1GRH A;  2Q0K A;  5KVH A;  1OJA A;  3AYL A;  1ZOV A;  4C3Y A;  4II2 A;  2C3C A;  4XWR A;  3NK0 X;  4BK3 A;  4GDP A;  4LU6 A;  2VRM A;  2I0Z A;  3AE1 A;  3D1C A;  2X3N A;  2RGJ A;  1NHQ A;  4A99 A;  2B9Y A;  1Y56 A;  1FEB A;  2R46 A;  2XDO A;  4BUR A;  1TDF A;  3BNM A;  2F5Z A;  5FS6 A;  4U8J A;  4UDP A;  3ITJ A;  4EIQ A;  3AE4 A;  4GAV A;  3CGB A;  1DOC A;  2WES A;  1OJ9 A;  2GR3 A;  3CIR A;  2YVJ A;  1Y56 B;  3SFE A;  3CGE A;  1YQ4 A;  4NTD A;  1GRB A;  1L9E A;  3GRS A;  1F8W A;  2XFO A;  3UTE A;  4DSH A;  4U8O A;  5GRT A;  3UKL A;  3K7T A;  2ACZ A;  3LJP A;  1Q1R A;  2XFQ A;  3BHF A;  5HHF A;  4G9K A;  4J31 A;  2YLT A;  2YM1 A;  2B9W A;  3ICS A;  3QVR A;  4TM3 A;  4BK2 A;  3VRB A;  3T2Z A;  4J56 A;  1CF3 A;  1YKJ A;  1GAL A;  1OJC A;  3AYI A;  2BA9 A;  4UDR A;  3UTF A;  4Z25 A;  4FK1 A;  1DXL A;  3CGD A;  2BRA A;  3KLJ A;  1M64 A;  3ICR A;  4IVM B;  4YKF A;  2GEW A;  3SGL A;  3IHM A;  3SZF A;  2IVE A;  4G73 A;  2WP5 A;  3DH9 A;  3PVC A;  3DA1 A;  2YLW A;  3PS9 A;  4H4W A;  3C4N A;  2C7G A;  1NG4 A;  4B68 A;  5KMR A;  4OPI A;  3AD7 B;  4YSY A;  2R0C A;  1RP0 A;  2RGO A;  3ADA B;  3LZX A;  5M0Z A;  3COX A;  1DJN A;  4KPR A;  3UKK A;  3HZL A;  2GAH B;  4CBQ A;  3G5Q A;  3CPI G;  3F8P A;  1N4U A;  3NT6 A;  3P4R A;  2CUL A;  4ZN0 A;  5JRB A;  1ZKQ A;  2IVD A;  3P4P A;  3P1W A;  4B1B A;  1ZOY A;  3UOZ A;  3LZW A;  3T0K A;  3NYF A;  4EQX A;  2WPF A;  5HY5 A;  1GRG A;  3JSK A;  1E1M A;  2AAQ A;  2R0G A;  2XLS A;  1IUX A;  4AP3 A;  2FBW A;  3AE2 A;  3V76 A;  2WOW A;  5U1O A;  5KWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...