5JCLA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
432
structure length
429
Chain Sequence
b'EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPAPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFYSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVEELKKEGLQFASKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Oxidoreductase
total genus 136
structure length 429
sequence length 432
chains with identical sequence B
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jclA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jclA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jclA02
3K30A 1PHHA 3RHAA 4X9MA 3VRDB 1D4EA 3CPIG 4A79A 4Z26A 2QCUA 4H4XA 2PHHA 3P1WA 4GF7A 3F8PA 3QVPA 4UDRA 3NYFA 1CF3A 4B67A 3GRTA 2YLRA 3SGLA 3P4PA 2C67A 5DBJA 1JNRA 3AD8B 2JAEA 3UTFA 1OJAA 2B7SA 2PYXA 3P4QA 4YTPA 3AD7B 3QFAA 2Q0KA 2WPFA 1NHPA 2GV8A 1KNRA 5JCLA 1PBBA 3SM8A 2WEUA 3II4A 1VDCA 3QJ4A 1DOCA 4FK1C 3LADA 4E0VA 1BF3A 1DOBA 2R0GA 4EMJA 4U8MA 3IWAA 1F3PA 1S3EA 3K7MX 2B9XA 3AE2A 4EMWA 1PBFA 2WDVA 3CNJA 1ZMDA 4Y4NA 4B63A 4PAAA 4H4YA 3UKAA 1CC2A 3C4NA 3ZDNA 4EIQA 4RG4A 2AR8A 4AP3A 4FK1A 2ARDA 1RP0A 1BGJA 2B7RA 4H4UA 4AOSA 5KVIA 3UOVA 3AYLA 3ADAB 4H4WA 2WOIA 3KPFA 1GSNA 3DJDA 3KVEA 1O94A 1TYPA 4P9SA 3HZLA 5C3JA 3H8LA 1PJ7A 3K7QX 2WDQA 2Y6RA 3DJGX 2WHDA 1ZP0A 3AWIA 3ISHA 3AD9B 2VQ7A 2DKHA 2C3CA 1H7XA 2QA1A 3COXA 2JB1A 3L8KA 5JCNA 3QSMA 4CY6A 3AYIA 3AE6A 1LVLA 4LA1A 4REKA 4NTCA 2YVFA 1GRGA 1DJNA 3CGBA 2BABA 4U8KA 5HY5A 1YKJA 1OJDA 2YAUA 4EQSA 2BS4A 2BA9A 1PJ5A 4YSHA 4H2NA 3O0HA 2JK6A 2XDOA 3KLJA 1CJCA 2ZZBA 1VG0A 3UOXA 3PVCA 1JEHA 3KU9A 4EIPA 4GR1A 2APGA 3V3OA 1GTEA 3GWDA 4BK3A 1NHSA 3QSSA 1F6MA 1IUTA 2GR1A 1V59A 5U25A 4A6NA 4ZCCA 4Y4MA 2BK4A 2VRLA 2X3NA 1DNCA 2GR3A 2O9ZA 1XHCA 2Y6QA 2R0PA 4N9XA 1TRBA 1YQ4A 2C64A 3NNEA 3UOYA 4A99A 2BCGG 2YR4A 2C72A 1D7YA 1XPQA 3BHFA 2NVKX 2IVEA 4TLZA 1TYTA 2QAEA 1W4XA 3P9UA 2W0HA 1S2QA 4I59A 3RP7A 1N4VA 2XLTA 4ICYA 1TDNA 4H7UA 2YVJA 3IF9A 4JN9A 2XCGA 1RYIA 2FBWA 3P4RA 3NYEA 1Q1RA 1D7LA 4EQXA 3GSIA 1E1LA 3NRNA 5LV9A 4K5SA 3AXBA 5J7XA 1B37A 4GCMA 3AEEA 2E5VA 3ZYXA 1K4QA 3V3NA 1CJ3A 1LJ1A 1PDHA 2OA1A 5EBKA 4ZN0A 2BK5A 3KKJA 4D04A 1BWCA 4B69A 1D5TA 4BJYA 2A87A 3T37A 3BI2A 1ELIA 1XANA 2RGHA 3AE4A 1DOEA 3KD9A 1RSGA 3NT6A 3UCLA 1GESA 1TDFA 3M0OA 4IVOB 4K8DA 4ADWA 3PS9A 4M52A 3DK4A 1DODA 4USQA 4J56A 1GETA 1PBEA 4OPCA 4A6NB 2BC1A 2BS3A 1NHQA 2C7GA 2XLRA 1EL7A 2GMHA 1F8WA 1Y56A 2YLSA 4J34A 4AT2A 4B1BA 3LXDA 2IIDA 4Z43A 3URHA 3UKFA 3E1TA 4OCGA 4TM1A 1DJQA 1BZLA 1PXBA 3VQRA 4IVMB 5IQ4A 1VRQB 4K2XA 2DKIA 1H86A 2R9ZA 2X8CA 2WESA 3FG2P 1GTHA 2AQJA 2OLOA 2XFQA 4OVIA 2WPCA 3I6DA 4GDEA 4O5QA 4U2LA 4BV6A 1YY5A 3UTEA 4YXDA 2GB0A 2R46A 3BI5A 2YVGA 3CIRA 5GSNA 2BS2A 1K0LA 5U1OA 2EQ6A 1IUSA 4C3XA 1FCDA 5FS9A 4JY2A 1P2HA 1PS9A 3LJPA 4A5LA 2C73A 2EQ7A 4ECHA 3Q6JA 5TR3A 1IUVA 4B66A 4OPDA 2F5ZA 1MO9A 1CC6A 3WE0A 1FOHA 3VR9A 1KNPA 3RP6A 3KA7A 4H2QA 3ALJA 1E1NA 1TDOA 3GYJA 4FDCB 2XVJA 3DA1A 1KDGA 1CHUA 3GMBA 3AE8A 4BK2A 5CKUA 4C74A 1HYUA 3UKLA 4J31A 2WDRA 3AE5A 3ICTA 1LPFA 4NZHA 4GRTA 1Y56B 4KX6A 1ZX9A 2GAHB 2GR2A 4CCQA 1UKVG 2YLZA 3SFDA 3NTDA 3CGDA 3OC4A 4CCRA 3LZWA 5C2TA 3UOZA 1ZKQA 4NTEA 3B3RA 3NN0X 1PXAA 5CQFA 4RSLA 4YSZA 3ATQA 1S2YA 2XFOA 2C65A 3OZ2A 3UTHA 4K7ZA 5HXIA 1KSSA 2UZZA 1LQTA 4CY8A 4YSYA 1H81A 3CTYA 4XWRA 4A9WA 2GAGB 3AEDA 3UP4A 4AOXA 1IUWA 1JNZA 4Z25A 1L9EA 2BXRA 3IHGA 4DGKA 1E7PA 1Q9IA 3REDA 3FPZA 1SEZA 2XLPA 1LTXR 3F8RA 3DMEA 4IV9A 2WBAA 1GALA 1QO8A 2V3AA 4HA6A 4K5RA 2YG7A 4OPLA 2VOUA 2YG6A 4Z24A 3GD3A 2XFUA 1B8SA 4KPRA 4AT0A 5BVAA 3DH9A 2GEWA 4XXGA 3NKSA 2I0ZA 3LOVA 5GRTA 2ZZ0A 1M6IA 3UKPA 1Q1WA 4YT0A 4JDRA 3NK1X 1N4WA 2C70A 1JU2A 4J33A 2WP5A 2Q0LA 2V5ZA 1GRBA 1E39A 5HYMA 1JRZA 4C5OA 4Z2UA 3DK9A 2WETA 2E4GA 3GDPA 4LU6A 4UDQA 4XWZA 3VRBA 4A65A 2WU2A 3UP5A 3AE3A 4A7AA 2BC0A 1KSUA 5KOWA 1KFYA 2C66A 4EMIA 3AEBA 1L9CA 2ZBWA 1Y0PA 1XDIA 2GVCA 1YQ3A 2NPXA 1DXLA 4LIIA 1EL5A 4APNA 1REOA 2R0CA 4U8LA 3BI4A 1L9DA 2XVHA 5FMHA 1M64A 2XYOA 1H84A 3CN8A 1D4CA 2R45A 3NH3X 2B9WA 2HQMA 2AAQA 3RNMA 2WQYA 3K7TA 3NLCA 2X8HA 3DGZA 3AYJA 1MOKA 5FS8A 4YWOA 2VVLG 3UKQA 4H4VA 1PN0A 5IQ1A 2Q7VA 3CNDA 3AEAA 5KOXA 1NPXA 1IUXA 4YKGA 1CBOA 2YG5A 4H4RA 3ICRA 1MXTA 3PO7A 3BHKA 3RP8A 3FBSA 3S61A 5KVHA 1FL2A 3B6DA 3AEGA 4GDPA 1IUUA 4TM3A 4C77A 5KWFA 4YSXA 3JSKA 2GQWA 4JNQA 5KRQA 3EF6A 3SQPA 4U8PA 3SFEA 3V76A 2EQ8A 3GMCA 1PBCA 4HB9A 1D4DA 3CNTA 3Q9TA 4U2SA 3G5RA 1TDKA 2BCPA 3AE9A 3NGCX 4BK1A 3DK8A 2E1MA 3DJJA 4EM4A 2JBVA 2OALA 1B5QA 3M12A 2XVFA 2EQ9A 3NK2X 2J3NA 4B65A 1L0VA 2ACZA 2VZ2A 1FEBA 3NHOX 4YKFA 3GDNA 1PXCA 1ZY8A 1ZMCA 3H4KA 4NEVA 2WS3A 3GYIA 5EB4A 1OJTA 2B9YA 4ZCDA 4MJWA 2X99A 3LB8A 2GF3A 2C3DA 3NK0X 1H82A 3NYCA 2FJDA 4GUVA 3R9UA 2GR0A 2B76A 3D1CA 5FS6A 2JB3A 1VG9A 1GERA 4IA5A 2GRTA 1PBDA 1O95A 1GXFA 4H4QA 2XFPA 4USRA 4WCTA 5J60A 4J36A 4Z44A 2VQBA 2BYBA 4CNKA 1EL9A 1F8RA 2GH5A 3LZXA 2YG4A 3S5WA 4H4TA 4X9NA 2C76A 4OPUA 2YLWA 3DGHA 1GRHA 3ABVA 2XLSA 4JY3A 2V6OA 2H89A 2GMJA 2XVIA 2VRMA 4J2WA 4UP3A 1H6VA 1H83A 2YG3A 5JCMA 5BRTA 3AB1A 4C3YA 3M13A 2JB2A 4D03A 2VVLA 5FS7A 2CULA 4U8JA 3EPTA 1AOGA 2YM2A 4H2RA 1GNDA 2WOWA 1EBDA 4I58A 4CBQA 4U8IA 4DSHA 1QLBA 2CDUA 1NDAA 2CFYA 2ZZCA 2YWLA 5M10A 1LV0A 1X31B 2Z5YA 3AE7A 1FEAA 4EQRA 1P2EA 3CGEA 1GEUA 4B64A 1K0JA 4IA6A 1N4UA 4OPGA 3AECA 3AEFA 4YTMA 4FX9A 1GRAA 1ZK7A 4YTNA 4DSGA 1CC4A 4RG3A 5KXJA 1NG3A 4OPTA 4DNAA 1NHRA 3EAOA 1N1PA 1GRTA 3ICSA 1JRYA 3F8DA 4WX1A 1YQZA 1NENA 1S3BA 4JNAA 4TM4A 4EQWA 2A8XA 3BNMA 5U63A 4JQ9A 1H7WA 4Z2TA 4BURA 3GRSA 4H50A 4NTDA 4H2PA 1CJ2A 2FJBA 4U8NA 5L46A 2YM1A 3ITJA 4K22A 4Z2RA 4OPIA 1EL8A 5IPYA 3VRAA 1Z6LA 1GT8A 1ONFA 5JCIA 3NN6X 4X4JA 1E6EA 5ER0A 1CL0A 1NAAA 1OJ9A 3FMWA 4AP1A 2TPRA 1O5WA 4TM0A 4UDPA 3CPHG 3UKKA 3DJEA 2R4EA 2V3BA 3AE1A 5EOWA 2IVDA 1GPEA 2WOVA 4J57A 2CVJA 2RABA 3QFBA 1OJCA 1VQWA 1GRFA 2FJAA 2R4JA 3P4SA 2YLXA 2WP9A 2TMDA 2Z5XA 4O5UA 2JKCA 1BGNA 4TLXA 3ALLA 2X50A 1F8SA 3H8IA 2V60A 3CNSA 1PJ6A 1B4VA 3G5QA 3QVRA 4H4PA 1ZDLA 2XFNA 2BXSA 2RGJA 2WP6A 2WU5A 2BK3A 4EM3A 1GREA 1FECA 1ZOYA 1NG4A 1GOSA 2C75A 4BJZA 1GV4A 3D8XA 5BULA 2H88A 3I3LA 3IHMA 4U2TA 3UKHA 2Q6UA 3GWFA 3CGCA 3NTAA 3C96A 3IC9A 1CJ4A 4U8OA 5EB5A 1KF6A 3UTGA 2VVMA 3ALMA 5BUKA 3CPJG 3GD4A 2YR6A 2YLTA 2YR5A 5M0ZA 1JRXA 4B68A 2OLNA 2GQFA 3FIMB 2BACA 2WPEA 1BKWA 1NEKA 2QA2A 1ZOVA 4H4SA 3NIXA 3VR8A 3G5SA 4CNJA 4NEWA 1E1KA 3EANA 2OAMA 2XVEA 1LQUA 1IJHA 1QJDA 4H4ZA 2FJEA 3C4AA 3L1RA 5HHFA 3BNUA 3QSEA 1COYA 2A89A 1TDEA 3CNPA 4PABA 5JCKA 1E1MA 2RGOA 2YQUA 1K0IA 3ATRA 3NG7X 4CRTA 1JOAA 4Y4LA 2X8GA 2V61A 2XLUA
chains in the Genus database with same CATH superfamily
3OP2A 1PHHA 4X9MA 4A79A 3F8PA 1EBGA 3GRTA 4GAVA 4HN8A 2JAEA 2OPJA 2WPFA 3PG6A 2GV8A 3QJ4A 1DOCA 4U8MA 3IWAA 3K7MX 1ZMDA 3T0KA 3UKAA 3ZDNA 1CC2A 2PTWA 4AP3A 4FK1A 2HXTA 4AOSA 3R25A 3UOVA 3AYLA 4H1ZA 1FHVA 5C3JA 3K7QX 1H7XA 2QA1A 3QSMA 3L8KA 3IJQA 2BABA 1OJDA 4EQSA 4II2A 1PJ5A 4YSHA 3QLDA 1CJCA 1VG0A 1JEHA 3DESA 4EIPA 3HW2A 2APGA 3GWDA 1KKOA 2PPGA 3QSSA 5U25A 3UCCA 4Y4MA 2BK4A 1TZZA 1XHCA 2MUCA 1TRBA 2C64A 2ZADA 2GGEA 2YR4A 1SB3B 1TYTA 2W0HA 4JN9A 1RYIA 2FBWA 4EQXA 2QDEA 3QKEA 1E1LA 3NRNA 3AEEA 2E5VA 1JPDX 4Z17A 3V3NA 4E8GA 2OA1A 4D04A 1JRPA 1ELIA 2RGHA 1DOEA 1STZA 4G7FA 4KT2A 3SY4A 3I6TA 4J56A 3ETRB 4HCDA 1PBEA 2XLRA 2YLSA 4AT2A 4Z43A 3NVWB 3E1TA 1BZLA 4A35A 4K2XA 2HNEA 3FV9A 4OVIA 3CMMA 3I6DA 3DGBA 3ENLA 4M6UA 1YY5A 5IDZA 3UTEA 3CIRA 4ZOHB 3NO1A 1IUSA 2C73A 4ROPA 4K1WA 2F5ZA 2OQYA 4GGHA 3H7VA 3DFYA 1TDOA 3GYJA 2XVJA 1CHUA 3ICTA 1SJDA 5FJOA 3OC4A 3LZWA 1ZKQA 4YSZA 2XFOA 3OZ2A 1LQTA 1H81A 4A9WA 2BXRA 4M0XA 4DGKA 3REDA 2XLPA 2V3AA 4HA6A 2YG7A 2HXUA 4GMEA 3A7RA 5KMPA 4Z24A 2XFUA 1B8SA 5BVAA 2C70A 1JU2A 2WP5A 1JRZA 3TJ4A 1MUCA 3DK9A 1TE6A 4TVYA 3QTPA 4UDQA 1JCTA 2OX4A 2PU1A 1KSUA 1L9CA 2GVCA 1XDIA 1REOA 2R0CA 4U8LA 1L9DA 2OFJA 4H19A 3H12A 3T4WA 2WQYA 3K7TA 3DGZA 5FS8A 2VVLG 3DFHA 3EEZA 3CNDA 5KOXA 1IUXA 4H4RA 5KMSA 3BHKA 4TM3A 4C77A 3T9PA 3SFEA 3R0KA 2EQ8A 3GMCA 1PBCA 4HB9A 3VC6A 3Q9TA 1TDKA 3MUCA 2OALA 3R11A 3TW9A 2J3NA 2O56A 4YKFA 2AKZA 1PXCA 3GYIA 2WS3A 1OJTA 4MJWA 2GF3A 4HNLA 1MDRA 1VG9A 4USRA 4J36A 2BYBA 4HNCA 4CNKA 1F8RA 3S5WA 3SJNA 3NVVB 2YLWA 3ABVA 1GRHA 3BOXA 2GGIA 2YG3A 3CT2A 3OPSA 5FS7A 3CXOA 3EPTA 1EBDA 2YWLA 3V5CA 2Z5YA 4EQRA 1P2EA 3CGEA 1GEUA 3UJFA 4YTNA 3TWBA 4DNAA 1NHRA 1GRTA 3F8DA 4JNAA 2A8XA 4DX3A 2XH0A 3GRSA 1FHUA 4H2PA 5L46A 1OEPA 3N6JA 2YM1A 3A7UA 1EL8A 3VRAA 1YEYA 3FMWA 4AP1A 2W55A 2GGGA 4GAPA 3RR1A 4TM0A 4UDPA 2V3BA 1GPEA 4J57A 1GRFA 2Z5XA 4O5UA 3AM9A 4ZA0A 3H8IA 4DN1A 4H4PA 4ZCWA 3R07C 2XFNA 2WP6A 3CGCA 2OVLA 3NTAA 3H70A 1CJ4A 5BUKA 3Q4DA 2GL5A 2W54A 3FIMB 1H2IA 2QA2A 3G5SA 5KNLA 5JRBA 2PMQA 3L1RA 2FJEA 3ZLFA 3ZVHA 2A89A 3JVAA 3NG7X 2YQUA 1K0IA 3DERA 4Y4LA 2X8GA 2V61A 3K30A 3VRDB 4Z26A 2QCUA 3QVPA 3CXBA 4UDRA 1CF3A 1R0MA 2C67A 3AD8B 3UTFA 2B7SA 3P4QA 4YTPA 3AD7B 3QFAA 1L8PA 2BRAA 1PBBA 1VDCA 4FK1C 3LADA 3FXGA 1S3EA 3AE2A 3GY1A 3PWGA 3T2KA 3C4NA 3UJEA 4RG4A 3TWAA 3U4FA 4K8GA 1RP0A 1BGJA 3UJ2A 2B7RA 2GGHA 3ADAB 2WOIA 1TYPA 4P9SA 3OTRA 5KMRA 1PJ7A 4FI4A 3DJGX 1ZP0A 3AWIA 3AD9B 3SXIA 1SJBA 4IP5A 2P8CA 1MNSA 3COXA 1N60C 5JCNA 3AYIA 1N62C 2AL2A 1DJNA 4U8KA 2YAUA 1SJCA 2BA9A 2GSHA 1ECQA 2JK6A 2XDOA 3KLJA 3UOXA 3KU9A 1EC8A 5BOEA 4IL2A 4H2HA 1F6MA 1IUTA 3D47A 4A6NA 4ZCCA 2VRLA 2X3NA 2GR3A 4A99A 2R0PA 1YQ4A 3B9JB 2BCGG 1D7YA 4JN7A 4I59A 1TDNA 2E3TA 3MQTA 5LV9A 5FJTA 5J7XA 1B37A 1E9IA 1K4QA 3FYYA 5EBKA 3KKJA 4B69A 1D5TA 2A87A 3SZFA 1XANA 1RSGA 3UCLA 1TDFA 1N5XA 4K8DA 3DK4A 4USQA 1FO4A 2BC1A 2BS3A 1EL7A 2GMHA 1F8WA 4J1OA 1Y56A 1ONEA 4J34A 4TM1A 1DJQA 4IVMB 1H86A 2WESA 2WPCA 4GDEA 3TCSA 4U2LA 3GYXA 3VCCA 1PDYA 3BI5A 2EQ6A 5FS9A 1P2HA 3SSZA 4ECHA 5TR3A 1IUVA 4B66A 1CC6A 3WE0A 2QGYA 3KA7A 3SR6B 4FDCB 3GMBA 4BK2A 3UKLA 4J31A 2WDRA 1LPFA 4NZHA 3GD6A 3VC5A 2GR2A 4CCQA 1UKVG 3SFDA 3NTDA 1KN0A 4CCRA 3NN0X 3ATQA 1S2YA 2C65A 3UTHA 1WYGA 1KSSA 4NWZA 4YSYA 3CTYA 4KWSA 3DG3A 3UP4A 3U9IA 5FJRA 1JNZA 3T2ZA 1RVKA 1E7PA 3F8RA 4IV9A 1GALA 4DHGA 2VOUA 1IYXA 4KPRA 4XXGA 2ZZ0A 3RGTA 3UKPA 4JDRA 3NK1X 1N4WA 4J33A 1EC7A 4C5OA 4Z2UA 2E4GA 4KEMA 4A65A 2WU2A 3AE3A 2C66A 2ZBWA 4GYPA 4LIIA 1EL5A 3NH3X 3CN8A 1D4CA 2R45A 2HQMA 3NLCA 1MOKA 4H4VA 2Q7VA 3AEAA 3I6EA 1SJAA 1NPXA 4YKGA 2YG5A 3ICRA 3RP8A 1MDLA 4FP1A 5KWFA 3A7AA 3JSKA 5KRQA 4U8PA 3AE9A 4ENLA 4IT1A 4B65A 2ACZA 2VZ2A 1ZY8A 3H4KA 4NEVA 5EB4A 3CYJA 2X99A 2QJJA 3NK0X 3NYCA 4GUVA 3D1CA 3Q45A 1VDVA 1O95A 1P43A 5J60A 4KPLA 4MMWA 3N4EA 3UGVA 2XLSA 4JY3A 2XVIA 3SBFA 5JCMA 3AB1A 3IJLA 2JB2A 2PP0A 3M13A 4D03A 2VVLA 4U8JA 1AOGA 2WOWA 1QLBA 2CFYA 2ZZCA 5M10A 1LV0A 1FEAA 1FIQB 1K0JA 3VDGA 3AEFA 2OQHA 4YTMA 4FX9A 2PU0A 4DSGA 4EWJA 5KXJA 4OPTA 1JRYA 1YQZA 1NENA 4TM4A 4EQWA 3BNMA 5U63A 4JQ9A 1H7WA 4HCHA 1CJ2A 4G6GA 3ITJA 4K22A 5IPYA 1N5WC 1T3QC 1Z6LA 1GT8A 5ER0A 1CL0A 1NAAA 4DYEA 1O5WA 3UKKA 2R4EA 5EOWA 3AE1A 2PCEA 3QFBA 1OJCA 1VQWA 2FJAA 3D46A 2YLXA 2TMDA 2JKCA 4TLXA 2BXSA 2WU5A 2BK3A 4K2SA 4BJZA 1NG4A 1VQZA 5BULA 3SN0A 5EU9A 2H88A 3AMZA 4U2TA 3UKHA 4HCLA 3GWFA 2POZA 1S7MA 2YLTA 5M0ZA 2GQFA 1E1KA 2W3SA 3EANA 1LQUA 1QJDA 3C4AA 3QSEA 3CNPA 2PGEA 1E1MA 3HYWA 2XLUA 3RHAA 1D4EA 3CPIG 4GF7A 3P1WA 2OKTA 2PA6A 2XH4A 3SGLA 1JNRA 2PYXA 2Q0KA 1NHPA 3SN4A 1KNRA 5JCLA 3R10A 3SM8A 2WEUA 4E0VA 3T8QA 3R0UA 1DOBA 2R0GA 3THUA 1PBFA 2WDVA 4B63A 4H4YA 1ELSA 5KVIA 4H4WA 2P0IA 1GSNA 3DJDA 1O94A 3ZLHA 3HZLA 4GFIA 3CB3A 2WHDA 3ISHA 4CY6A 3AE6A 4LA1A 5HY5A 1YKJA 2P88A 2BS4A 3UJRA 5G5GB 4H2NA 3PVCA 2PGWA 4GR1A 2AL1A 3V3OA 1GTEA 1NHSA 1V59A 1DNCA 2O9ZA 2Y6QA 3DG7A 4N9XA 2XH7A 3P3BA 3PFRA 4JHMA 1XPQA 3RP7A 2XSXA 1S2QA 2XLTA 4H7UA 3IF9A 2XCGA 3NYEA 1Q1RA 4MGGA 3GSIA 3ZYXA 4GIRA 4ZN0A 1BWCA 5ENLA 3BI2A 3SYIA 3KD9A 1GESA 3M0OA 4IVOB 1PDZA 3NRZB 3PS9A 4M52A 3OZYA 4IP4A 4GISA 1NHQA 1MRAA 4B1BA 3URHA 1PXBA 2PSNA 2DKIA 2R9ZA 3FG2P 2OLOA 4O5QA 3V5FA 3FCPA 4IHCA 1EC9A 2W3RA 2GB0A 2YVGA 1K0LA 3DG6A 4C3XA 1PS9A 3LJPA 4A5LA 2EQ7A 3Q6JA 4OPDA 1FOHA 3VR9A 1KNPA 3RP6A 4H2QA 3AE8A 4C74A 1HYUA 3ES8A 2OZ8A 2PP3A 5FJUA 2GAHB 2FYMA 2YLZA 1BQGA 3CGDA 2NQLA 1FFVC 5C2TA 4F4RA 4NTEA 3B3RA 1PXAA 3UXLA 2UZZA 4CY8A 4XWRA 2GAGB 3AEDA 3RO6A 4Z25A 3T14A 3FPZA 2WBAA 4K5RA 3RRAA 4OPLA 5FJPA 2AKMA 3GD3A 4AT0A 3DH9A 3PK7A 3AN1A 1Q1WA 4YT0A 4YWSA 3CAWA 3RCYA 4GYPC 2Q0LA 1E39A 1DTNA 4JN8A 2WETA 3B97A 3GDPA 4LU6A 4XWZA 3VRBA 3JZUA 2BC0A 3R1ZA 3HYVA 2RDXA 1KFYA 1N63C 3AEBA 1YQ3A 5FMHA 1M64A 1H84A 2B9WA 2AAQA 3RNMA 3AYJA 3UKQA 4J3ZA 3TJIA 1CBOA 3DEQA 3NFUA 3PO7A 3JW7A 4E5TA 3AEGA 1IUUA 4YSXA 1NELA 4JNQA 3SQPA 3V76A 3CNTA 4U2SA 4BK1A 3DK8A 4EM4A 2JBVA 1B5QA 2BRYA 3M12A 2XVFA 2EQ9A 3GDNA 2B9YA 1ZXIC 1H82A 2JB3A 2PTYA 4IA5A 2GRTA 1PBDA 1GXFA 4H4QA 2XFPA 4Z44A 2VQBA 4II3A 1EL9A 3NZGA 2GH5A 2YG4A 4H4TA 3BSMA 2C76A 4OPUA 3N4FA 4J2WA 3NVYB 1H6VA 5BRTA 4C3YA 2CULA 4H2RA 3KUMA 4G8TA 4I58A 4CBQA 4DSHA 4U8IA 2CDUA 3ES7A 4IA6A 1N4UA 1KCZA 1GRAA 1ZK7A 3TQPA 1CC4A 2XGZA 1X2HA 3ICSA 4WX1A 3S5SA 2QQ6A 4Z2TA 4BURA 4NTDA 5BOFA 4U8NA 1JDFA 2QDDA 4OPIA 4A3RA 4G73A 1ONFA 5JCIA 2P8BA 1E6EA 1W6TA 1EBHA 2TPRA 2OZTA 3NS1B 3N6HA 3S47A 2R4JA 4X2PA 2WP9A 1BGNA 3ALLA 2V60A 3CNSA 3QVRA 1B4VA 2PODA 2RGJA 1FECA 1ZOYA 1GOSA 2Q6UA 4HYRA 3IC9A 3UJSA 3UTGA 2VVMA 3SX6A 1P48A 3CPJG 2YR6A 2YR5A 4H83A 1JRXA 4B68A 2OLNA 2BACA 2WPEA 3OZMA 1NEKA 1ZOVA 4H4SA 4NEWA 2OAMA 2XVEA 4H4ZA 5HHFA 3BNUA 1TDEA 3SQSA 4PABA 4E6MA 1JOAA 4H4XA 2PHHA 3NYFA 3TTEA 4B67A 2YLRA 3P4PA 5DBJA 1OJAA 3II4A 1BF3A 4EMJA 1F3PA 2B9XA 4EMWA 3CNJA 4Y4NA 4PAAA 2ZC8A 4EIQA 2AR8A 2XH2A 2ARDA 2GDQA 3ZVHB 2DW6A 4H4UA 3KPFA 3KVEA 4MKSA 3H8LA 2WDQA 2Y6RA 4DWDA 3OW1A 2VQ7A 2DKHA 2C3CA 3ZLGA 2JB1A 1LVLA 4REKA 4NTCA 2YVFA 1GRGA 3CGBA 5KMQA 3V4BA 3NVZB 3O0HA 2OO6A 2ZZBA 1X2GA 4BK3A 3VA8A 1WUFA 2GR1A 2I5QA 4E4UA 1TKKA 1XS2A 3NNEA 3UOYA 2C72A 1JPMA 3P0WA 3BHFA 2NVKX 1R6WA 2IVEA 4TLZA 2QAEA 1W4XA 3P9UA 1N4VA 4ICYA 2YVJA 1N61C 3P4RA 3SN1A 1D7LA 3STPA 2AL2B 2OZ3A 3AXBA 4GCMA 1CJ3A 3FVDA 1LJ1A 1PDHA 4IZGA 3NXLA 2BK5A 4BJYA 3T37A 3MZNA 3AE4A 3NT6A 4ADWA 4E4FA 1DODA 3L5OA 1GETA 4OPCA 3T31A 4A6NB 2C7GA 2GGJA 2P3ZA 1WUEA 3LXDA 2IIDA 4G9KA 3UKFA 4OCGA 3VQRA 5IQ4A 1VRQB 2X8CA 1GTHA 2XFQA 2AQJA 3GC2A 2PTZA 4BV6A 5G5HB 4YXDA 4G6HA 2R46A 3CK5A 5GSNA 2BS2A 5U1OA 4Z1YA 3TOYA 1FCDA 4JY2A 1BKHA 1MO9A 1KKRA 5J04A 2FKPA 2C4CA 3ALJA 1E1NA 3DA1A 1KDGA 5CKUA 2HZGA 3AE5A 4GRTA 1Y56B 4KX6A 1ZX9A 3UOZA 3MWCA 4RSLA 5CQFA 4K7ZA 5HXIA 4AOXA 1IUWA 1L9EA 3IHGA 1Q9IA 1RM6B 1SEZA 1LTXR 3DMEA 3KPKA 1QO8A 2YG6A 1NU5A 2GEWA 3NKSA 2I0ZA 3LOVA 5GRTA 2QJMA 1M6IA 3FJ4A 2ONEA 2V5ZA 1GRBA 5HYMA 3P93A 3MY9A 2PTXA 3UP5A 3GO2A 4A7AA 5KOWA 3T6CA 4EMIA 1Y0PA 2NPXA 1DXLA 3BJSA 4APNA 3BI4A 2XVHA 2XYOA 3MKCA 4K5SA 4G74A 2X8HA 4NNJA 4YWOA 1PN0A 7ENLA 5IQ1A 1JROA 1MXTA 3FBSA 3S61A 5KVHA 1FL2A 3B6DA 3UXKA 4IL0A 4GDPA 3MSYA 2GQWA 1F9CA 3EF6A 1D4DA 3G5RA 2BCPA 3NGCX 2E1MA 3DJJA 3NK2X 1L0VA 1FEBA 3NHOX 1ZMCA 4ZCDA 3LB8A 2C3DA 3IJIA 2FJDA 3R9UA 2GR0A 2B76A 5FS6A 1GERA 1KD0A 4WCTA 3SZCA 3LZXA 3ZVIA 3HRDC 2CHRA 4X9NA 2OLAA 3DGHA 2V6OA 2H89A 2GMJA 2VRMA 4UP3A 3K1GA 1H83A 4GGBA 3UCDA 6ENLA 1V97A 4HPNA 2YM2A 2PS2A 1GNDA 3DIPA 2OG9A 1NDAA 1X31B 3T2YA 3AE7A 2E5AA 3IK4A 4B64A 4OPGA 3AECA 3QPEA 1XPYA 3SZWA 4RG3A 2QJNA 1NG3A 1N1PA 3EAOA 1S3BA 2QVHA 4H50A 3RITA 2FJBA 1FFUC 2DW7A 3V3WA 4Z2RA 3VFCA 3PWIA 4DXKA 4TVWA 2MNRA 3NN6X 4X4JA 1OJ9A 3SZ0A 3CPHG 3DJEA 2IVDA 2WOVA 2CVJA 2RABA 3P4SA 3DDMA 2X50A 1F8SA 1PJ6A 3G5QA 3EKGA 1ZDLA 2PP1A 4EM3A 1GREA 2C75A 1GV4A 3D8XA 3D9XA 3I3LA 3HPFA 3IHMA 3C96A 4U8OA 5EB5A 1KF6A 3ALMA 3GD4A 3QN3A 3VCNA 1BKWA 3HYXA 3VR8A 3NIXA 4CNJA 3I4KA 3H8AA 1IJHA 4A6GA 1COYA 3EUB3 5JCKA 4CRTA 2RGOA 3ATRA
chains in the Genus database with same CATH topology
3K30A 1PHHA 3RHAA 4X9MA 3VRDB 1D4EA 3CPIG 4A79A 4Z26A 2QCUA 4H4XA 2PHHA 3P1WA 4GF7A 3F8PA 3QVPA 4UDRA 3NYFA 1CF3A 4B67A 3GRTA 2YLRA 3SGLA 3P4PA 2C67A 4GAVA 1JNRA 3AD8B 5DBJA 2JAEA 3UTFA 1OJAA 2B7SA 2PYXA 3P4QA 4YTPA 3AD7B 3QFAA 2Q0KA 2WPFA 1NHPA 3PG6A 2GV8A 2BRAA 1KNRA 5JCLA 1PBBA 3SM8A 2WEUA 3II4A 1VDCA 3QJ4A 1DOCA 4FK1C 3LADA 4E0VA 1BF3A 1DOBA 2R0GA 4EMJA 4U8MA 3IWAA 1F3PA 1S3EA 3K7MX 2B9XA 3AE2A 4EMWA 1PBFA 2WDVA 3CNJA 1ZMDA 4Y4NA 3T0KA 4PAAA 4H4YA 3T2KA 1CC2A 3C4NA 3UKAA 3ZDNA 4B63A 4EIQA 4RG4A 2AR8A 4AP3A 4FK1A 2ARDA 1RP0A 1BGJA 2B7RA 4H4UA 4AOSA 5KVIA 3UOVA 3AYLA 3ADAB 4H4WA 2WOIA 3KPFA 1GSNA 3DJDA 3KVEA 1O94A 1TYPA 4P9SA 3HZLA 5C3JA 5KMRA 3H8LA 1PJ7A 3K7QX 2WDQA 2Y6RA 3DJGX 2WHDA 1ZP0A 3AWIA 3ISHA 3AD9B 3SXIA 2VQ7A 2DKHA 2C3CA 1H7XA 2QA1A 3COXA 2JB1A 3L8KA 5JCNA 3QSMA 4CY6A 3AYIA 3AE6A 1LVLA 4LA1A 4REKA 4NTCA 2YVFA 1GRGA 1DJNA 3CGBA 2BABA 4U8KA 5HY5A 1YKJA 1OJDA 2YAUA 4EQSA 2BS4A 2BA9A 4II2A 5KMQA 1PJ5A 4YSHA 4H2NA 3O0HA 2JK6A 2XDOA 3KLJA 1CJCA 2ZZBA 1VG0A 3UOXA 3PVCA 1JEHA 3KU9A 4EIPA 4GR1A 2APGA 3V3OA 1GTEA 3GWDA 4BK3A 1NHSA 3QSSA 1F6MA 1IUTA 2GR1A 1V59A 5U25A 4A6NA 4ZCCA 4Y4MA 2BK4A 2VRLA 2X3NA 1DNCA 2GR3A 2O9ZA 1XHCA 2Y6QA 2R0PA 4N9XA 1TRBA 1YQ4A 2C64A 3NNEA 3UOYA 4A99A 2BCGG 2YR4A 2C72A 1D7YA 1XPQA 3BHFA 2NVKX 2IVEA 4TLZA 1TYTA 2QAEA 1W4XA 3P9UA 2W0HA 1S2QA 4I59A 3RP7A 1N4VA 2XLTA 4ICYA 1TDNA 4H7UA 2YVJA 3IF9A 4JN9A 2XCGA 1RYIA 2FBWA 3P4RA 3NYEA 1Q1RA 1D7LA 4EQXA 3GSIA 1E1LA 3NRNA 5LV9A 4K5SA 3AXBA 5J7XA 1B37A 4GCMA 3AEEA 2E5VA 3ZYXA 1K4QA 3V3NA 1CJ3A 1LJ1A 1PDHA 2OA1A 5EBKA 4ZN0A 2BK5A 3KKJA 4D04A 1BWCA 4B69A 1D5TA 4BJYA 2A87A 3T37A 3BI2A 1ELIA 3SYIA 3SZFA 1XANA 2RGHA 3AE4A 1DOEA 3KD9A 1RSGA 3NT6A 3UCLA 1GESA 1TDFA 3M0OA 4IVOB 3SY4A 4K8DA 4ADWA 3PS9A 4M52A 3DK4A 1DODA 4USQA 4J56A 3L5OA 1GETA 1PBEA 4OPCA 3T31A 4A6NB 2BC1A 2BS3A 1NHQA 2C7GA 2XLRA 1EL7A 2GMHA 1F8WA 1Y56A 2YLSA 4J34A 4AT2A 4B1BA 3LXDA 2IIDA 4Z43A 3URHA 4G9KA 3UKFA 3E1TA 4OCGA 4TM1A 1DJQA 1BZLA 1PXBA 3VQRA 4IVMB 5IQ4A 1VRQB 4K2XA 2DKIA 1H86A 2R9ZA 2X8CA 2WESA 3FG2P 1GTHA 2AQJA 2OLOA 2XFQA 4OVIA 2WPCA 3CMMA 3I6DA 4GDEA 4O5QA 4U2LA 4BV6A 1YY5A 3GYXA 3UTEA 4YXDA 2GB0A 2R46A 4G6HA 3BI5A 2YVGA 3CIRA 5GSNA 2BS2A 1K0LA 5U1OA 2EQ6A 1IUSA 4C3XA 1FCDA 5FS9A 4JY2A 1P2HA 1PS9A 3LJPA 4A5LA 2C73A 2EQ7A 4ECHA 3Q6JA 5TR3A 1IUVA 4B66A 4OPDA 2F5ZA 1MO9A 1CC6A 3WE0A 1FOHA 3VR9A 1KNPA 3RP6A 3KA7A 4H2QA 2C4CA 3ALJA 1E1NA 1TDOA 3GYJA 4FDCB 2XVJA 3DA1A 1KDGA 1CHUA 3GMBA 3AE8A 4BK2A 5CKUA 4C74A 1HYUA 3UKLA 4J31A 2WDRA 3AE5A 3ICTA 1LPFA 4NZHA 4GRTA 1Y56B 4KX6A 1ZX9A 2GAHB 2GR2A 4CCQA 1UKVG 2YLZA 3SFDA 3NTDA 3CGDA 3OC4A 1KN0A 4CCRA 3LZWA 5C2TA 3UOZA 1ZKQA 4NTEA 3B3RA 3NN0X 1PXAA 5CQFA 4RSLA 4YSZA 3ATQA 1S2YA 2XFOA 2C65A 3OZ2A 3UTHA 4K7ZA 5HXIA 1KSSA 2UZZA 1LQTA 4NWZA 4CY8A 1H81A 3CTYA 4YSYA 4XWRA 4A9WA 2GAGB 3AEDA 3UP4A 4AOXA 1IUWA 1JNZA 4Z25A 1L9EA 2BXRA 3T2ZA 3IHGA 4DGKA 1E7PA 1Q9IA 3REDA 3T14A 3FPZA 1SEZA 2XLPA 1LTXR 3F8RA 3DMEA 3KPKA 4IV9A 2V3AA 2WBAA 1GALA 1QO8A 4HA6A 4K5RA 2YG7A 4OPLA 2VOUA 5KMPA 2YG6A 4Z24A 3GD3A 2XFUA 1B8SA 4KPRA 4AT0A 5BVAA 3DH9A 2GEWA 4XXGA 3NKSA 2I0ZA 3LOVA 5GRTA 2ZZ0A 1M6IA 3UKPA 1Q1WA 4YT0A 4JDRA 3NK1X 1N4WA 2C70A 1JU2A 4J33A 2WP5A 2Q0LA 2V5ZA 1GRBA 1E39A 5HYMA 1JRZA 4C5OA 4Z2UA 3DK9A 2WETA 2E4GA 3GDPA 4LU6A 4UDQA 4XWZA 3VRBA 4A65A 2WU2A 3UP5A 3AE3A 4A7AA 2BC0A 1KSUA 3HYVA 5KOWA 1KFYA 2C66A 4EMIA 3AEBA 1L9CA 2ZBWA 1Y0PA 1XDIA 2GVCA 1YQ3A 2NPXA 1DXLA 4LIIA 1EL5A 4APNA 1REOA 2R0CA 4U8LA 3BI4A 1L9DA 2XVHA 5FMHA 1M64A 2XYOA 1H84A 3CN8A 1D4CA 2R45A 3NH3X 2B9WA 2HQMA 2AAQA 3RNMA 2WQYA 3K7TA 3NLCA 2X8HA 3DGZA 3AYJA 4NNJA 1MOKA 5FS8A 4YWOA 2VVLG 3UKQA 4H4VA 1PN0A 5IQ1A 2Q7VA 3CNDA 3AEAA 5KOXA 1NPXA 1IUXA 4YKGA 1CBOA 2YG5A 4H4RA 3ICRA 5KMSA 1MXTA 3PO7A 3BHKA 3RP8A 3FBSA 3S61A 5KVHA 1FL2A 3B6DA 3AEGA 4GDPA 1IUUA 4TM3A 4C77A 5KWFA 4YSXA 3JSKA 2GQWA 4JNQA 5KRQA 3EF6A 3SQPA 4U8PA 3SFEA 3V76A 2EQ8A 3GMCA 1PBCA 4G74A 4HB9A 1D4DA 3CNTA 3Q9TA 4U2SA 3G5RA 1TDKA 2BCPA 3AE9A 3NGCX 4BK1A 3DK8A 2E1MA 3DJJA 4EM4A 2JBVA 2OALA 1B5QA 2BRYA 3M12A 2XVFA 2EQ9A 3NK2X 2J3NA 4B65A 1L0VA 2ACZA 2VZ2A 1FEBA 3NHOX 4YKFA 3GDNA 1PXCA 1ZY8A 1ZMCA 3H4KA 4NEVA 2WS3A 3GYIA 5EB4A 1OJTA 2B9YA 4ZCDA 4MJWA 2X99A 3LB8A 2GF3A 2C3DA 3NK0X 1H82A 3NYCA 2FJDA 4GUVA 3R9UA 2GR0A 2B76A 3D1CA 5FS6A 2JB3A 1VG9A 1GERA 4IA5A 2GRTA 1PBDA 1O95A 1GXFA 4H4QA 2XFPA 4USRA 4WCTA 5J60A 4J36A 4Z44A 2VQBA 4II3A 2BYBA 3SZCA 4CNKA 1EL9A 1F8RA 2GH5A 3LZXA 2YG4A 3S5WA 4H4TA 4X9NA 2C76A 4OPUA 2YLWA 3DGHA 1GRHA 3ABVA 2XLSA 4JY3A 2V6OA 2H89A 2GMJA 2XVIA 2VRMA 4J2WA 4UP3A 1H6VA 1H83A 2YG3A 5JCMA 5BRTA 3AB1A 4C3YA 3M13A 2JB2A 4D03A 2VVLA 5FS7A 2CULA 4U8JA 3EPTA 1AOGA 2YM2A 4H2RA 4Y4LA 1GNDA 2WOWA 1EBDA 4I58A 4CBQA 4U8IA 4DSHA 1QLBA 2CDUA 1NDAA 2CFYA 2ZZCA 2YWLA 5M10A 1LV0A 1X31B 2Z5YA 3T2YA 3AE7A 1FEAA 4EQRA 1P2EA 3CGEA 1GEUA 4B64A 1K0JA 4IA6A 1N4UA 4OPGA 3AECA 3AEFA 4YTMA 4FX9A 1GRAA 1ZK7A 4YTNA 4DSGA 1CC4A 3SZWA 4RG3A 5KXJA 1NG3A 4OPTA 4DNAA 1NHRA 3EAOA 1N1PA 1GRTA 3ICSA 1JRYA 3F8DA 4WX1A 1YQZA 1NENA 1S3BA 4JNAA 4TM4A 4EQWA 2A8XA 3BNMA 5U63A 4JQ9A 1H7WA 4Z2TA 4BURA 3GRSA 4H50A 4NTDA 4H2PA 1CJ2A 2FJBA 4U8NA 5L46A 4G6GA 2YM1A 3ITJA 4K22A 4Z2RA 4OPIA 1EL8A 5IPYA 3VRAA 1Z6LA 1GT8A 4G73A 1ONFA 5JCIA 3NN6X 4X4JA 1E6EA 5ER0A 1CL0A 1NAAA 1OJ9A 3FMWA 3SZ0A 4AP1A 2TPRA 1O5WA 4GAPA 4TM0A 4UDPA 3CPHG 3UKKA 3DJEA 2R4EA 2V3BA 3AE1A 5EOWA 2IVDA 1GPEA 2WOVA 4J57A 2CVJA 2RABA 3QFBA 1OJCA 1VQWA 1GRFA 2FJAA 2R4JA 3P4SA 2YLXA 2WP9A 2TMDA 2Z5XA 4O5UA 2JKCA 1BGNA 4TLXA 3ALLA 2X50A 1F8SA 3H8IA 2V60A 3CNSA 1PJ6A 1B4VA 3G5QA 3QVRA 4H4PA 1ZDLA 2XFNA 2BXSA 2RGJA 2WP6A 2WU5A 2BK3A 4EM3A 1GREA 1FECA 1ZOYA 1NG4A 1GOSA 2C75A 4BJZA 1GV4A 3D8XA 5BULA 3D9XA 2H88A 3I3LA 3IHMA 4U2TA 3UKHA 2Q6UA 3GWFA 3CGCA 3NTAA 3C96A 3IC9A 1CJ4A 4U8OA 5EB5A 1KF6A 3UTGA 2VVMA 3SX6A 3ALMA 5BUKA 1S7MA 3CPJG 3GD4A 2YR6A 2YLTA 2YR5A 5M0ZA 1JRXA 4B68A 2OLNA 2GQFA 3FIMB 1H2IA 2WPEA 1BKWA 1NEKA 2BACA 1ZOVA 4H4SA 2QA2A 3HYXA 3G5SA 3NIXA 3VR8A 4NEWA 4CNJA 5KNLA 1E1KA 3EANA 5JRBA 2OAMA 2XVEA 1LQUA 1IJHA 1QJDA 4H4ZA 2FJEA 3C4AA 3L1RA 5HHFA 3BNUA 3QSEA 1COYA 2A89A 1TDEA 3CNPA 4PABA 5JCKA 1E1MA 2RGOA 2YQUA 1K0IA 3ATRA 3NG7X 4CRTA 1JOAA 3HYWA 2X8GA 2V61A 2XLUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K30 A;  1PHH A;  3RHA A;  4X9M A;  3VRD B;  1D4E A;  3CPI G;  4A79 A;  4Z26 A;  2QCU A;  4H4X A;  2PHH A;  3P1W A;  4GF7 A;  3F8P A;  3QVP A;  4UDR A;  3NYF A;  1CF3 A;  4B67 A;  3GRT A;  2YLR A;  3SGL A;  3P4P A;  2C67 A;  5DBJ A;  1JNR A;  3AD8 B;  2JAE A;  3UTF A;  1OJA A;  2B7S A;  2PYX A;  3P4Q A;  4YTP A;  3AD7 B;  3QFA A;  2Q0K A;  2WPF A;  1NHP A;  2GV8 A;  1KNR A;  5JCL A;  1PBB A;  3SM8 A;  2WEU A;  3II4 A;  1VDC A;  3QJ4 A;  1DOC A;  4FK1 C;  3LAD A;  4E0V A;  1BF3 A;  1DOB A;  2R0G A;  4EMJ A;  4U8M A;  3IWA A;  1F3P A;  1S3E A;  3K7M X;  2B9X A;  3AE2 A;  4EMW A;  1PBF A;  2WDV A;  3CNJ A;  1ZMD A;  4Y4N A;  4B63 A;  4PAA A;  4H4Y A;  3UKA A;  1CC2 A;  3C4N A;  3ZDN A;  4EIQ A;  4RG4 A;  2AR8 A;  4AP3 A;  4FK1 A;  2ARD A;  1RP0 A;  1BGJ A;  2B7R A;  4H4U A;  4AOS A;  5KVI A;  3UOV A;  3AYL A;  3ADA B;  4H4W A;  2WOI A;  3KPF A;  1GSN A;  3DJD A;  3KVE A;  1O94 A;  1TYP A;  4P9S A;  3HZL A;  5C3J A;  3H8L A;  1PJ7 A;  3K7Q X;  2WDQ A;  2Y6R A;  3DJG X;  2WHD A;  1ZP0 A;  3AWI A;  3ISH A;  3AD9 B;  2VQ7 A;  2DKH A;  2C3C A;  1H7X A;  2QA1 A;  3COX A;  2JB1 A;  3L8K A;  5JCN A;  3QSM A;  4CY6 A;  3AYI A;  3AE6 A;  1LVL A;  4LA1 A;  4REK A;  4NTC A;  2YVF A;  1GRG A;  1DJN A;  3CGB A;  2BAB A;  4U8K A;  5HY5 A;  1YKJ A;  1OJD A;  2YAU A;  4EQS A;  2BS4 A;  2BA9 A;  1PJ5 A;  4YSH A;  4H2N A;  3O0H A;  2JK6 A;  2XDO A;  3KLJ A;  1CJC A;  2ZZB A;  1VG0 A;  3UOX A;  3PVC A;  1JEH A;  3KU9 A;  4EIP A;  4GR1 A;  2APG A;  3V3O A;  1GTE A;  3GWD A;  4BK3 A;  1NHS A;  3QSS A;  1F6M A;  1IUT A;  2GR1 A;  1V59 A;  5U25 A;  4A6N A;  4ZCC A;  4Y4M A;  2BK4 A;  2VRL A;  2X3N A;  1DNC A;  2GR3 A;  2O9Z A;  1XHC A;  2Y6Q A;  2R0P A;  4N9X A;  1TRB A;  1YQ4 A;  2C64 A;  3NNE A;  3UOY A;  4A99 A;  2BCG G;  2YR4 A;  2C72 A;  1D7Y A;  1XPQ A;  3BHF A;  2NVK X;  2IVE A;  4TLZ A;  1TYT A;  2QAE A;  1W4X A;  3P9U A;  2W0H A;  1S2Q A;  4I59 A;  3RP7 A;  1N4V A;  2XLT A;  4ICY A;  1TDN A;  4H7U A;  2YVJ A;  3IF9 A;  4JN9 A;  2XCG A;  1RYI A;  2FBW A;  3P4R A;  3NYE A;  1Q1R A;  1D7L A;  4EQX A;  3GSI A;  1E1L A;  3NRN A;  5LV9 A;  4K5S A;  3AXB A;  5J7X A;  1B37 A;  4GCM A;  3AEE A;  2E5V A;  3ZYX A;  1K4Q A;  3V3N A;  1CJ3 A;  1LJ1 A;  1PDH A;  2OA1 A;  5EBK A;  4ZN0 A;  2BK5 A;  3KKJ A;  4D04 A;  1BWC A;  4B69 A;  1D5T A;  4BJY A;  2A87 A;  3T37 A;  3BI2 A;  1ELI A;  1XAN A;  2RGH A;  3AE4 A;  1DOE A;  3KD9 A;  1RSG A;  3NT6 A;  3UCL A;  1GES A;  1TDF A;  3M0O A;  4IVO B;  4K8D A;  4ADW A;  3PS9 A;  4M52 A;  3DK4 A;  1DOD A;  4USQ A;  4J56 A;  1GET A;  1PBE A;  4OPC A;  4A6N B;  2BC1 A;  2BS3 A;  1NHQ A;  2C7G A;  2XLR A;  1EL7 A;  2GMH A;  1F8W A;  1Y56 A;  2YLS A;  4J34 A;  4AT2 A;  4B1B A;  3LXD A;  2IID A;  4Z43 A;  3URH A;  3UKF A;  3E1T A;  4OCG A;  4TM1 A;  1DJQ A;  1BZL A;  1PXB A;  3VQR A;  4IVM B;  5IQ4 A;  1VRQ B;  4K2X A;  2DKI A;  1H86 A;  2R9Z A;  2X8C A;  2WES A;  3FG2 P;  1GTH A;  2AQJ A;  2OLO A;  2XFQ A;  4OVI A;  2WPC A;  3I6D A;  4GDE A;  4O5Q A;  4U2L A;  4BV6 A;  1YY5 A;  3UTE A;  4YXD A;  2GB0 A;  2R46 A;  3BI5 A;  2YVG A;  3CIR A;  5GSN A;  2BS2 A;  1K0L A;  5U1O A;  2EQ6 A;  1IUS A;  4C3X A;  1FCD A;  5FS9 A;  4JY2 A;  1P2H A;  1PS9 A;  3LJP A;  4A5L A;  2C73 A;  2EQ7 A;  4ECH A;  3Q6J A;  5TR3 A;  1IUV A;  4B66 A;  4OPD A;  2F5Z A;  1MO9 A;  1CC6 A;  3WE0 A;  1FOH A;  3VR9 A;  1KNP A;  3RP6 A;  3KA7 A;  4H2Q A;  3ALJ A;  1E1N A;  1TDO A;  3GYJ A;  4FDC B;  2XVJ A;  3DA1 A;  1KDG A;  1CHU A;  3GMB A;  3AE8 A;  4BK2 A;  5CKU A;  4C74 A;  1HYU A;  3UKL A;  4J31 A;  2WDR A;  3AE5 A;  3ICT A;  1LPF A;  4NZH A;  4GRT A;  1Y56 B;  4KX6 A;  1ZX9 A;  2GAH B;  2GR2 A;  4CCQ A;  1UKV G;  2YLZ A;  3SFD A;  3NTD A;  3CGD A;  3OC4 A;  4CCR A;  3LZW A;  5C2T A;  3UOZ A;  1ZKQ A;  4NTE A;  3B3R A;  3NN0 X;  1PXA A;  5CQF A;  4RSL A;  4YSZ A;  3ATQ A;  1S2Y A;  2XFO A;  2C65 A;  3OZ2 A;  3UTH A;  4K7Z A;  5HXI A;  1KSS A;  2UZZ A;  1LQT A;  4CY8 A;  4YSY A;  1H81 A;  3CTY A;  4XWR A;  4A9W A;  2GAG B;  3AED A;  3UP4 A;  4AOX A;  1IUW A;  1JNZ A;  4Z25 A;  1L9E A;  2BXR A;  3IHG A;  4DGK A;  1E7P A;  1Q9I A;  3RED A;  3FPZ A;  1SEZ A;  2XLP A;  1LTX R;  3F8R A;  3DME A;  4IV9 A;  2WBA A;  1GAL A;  1QO8 A;  2V3A A;  4HA6 A;  4K5R A;  2YG7 A;  4OPL A;  2VOU A;  2YG6 A;  4Z24 A;  3GD3 A;  2XFU A;  1B8S A;  4KPR A;  4AT0 A;  5BVA A;  3DH9 A;  2GEW A;  4XXG A;  3NKS A;  2I0Z A;  3LOV A;  5GRT A;  2ZZ0 A;  1M6I A;  3UKP A;  1Q1W A;  4YT0 A;  4JDR A;  3NK1 X;  1N4W A;  2C70 A;  1JU2 A;  4J33 A;  2WP5 A;  2Q0L A;  2V5Z A;  1GRB A;  1E39 A;  5HYM A;  1JRZ A;  4C5O A;  4Z2U A;  3DK9 A;  2WET A;  2E4G A;  3GDP A;  4LU6 A;  4UDQ A;  4XWZ A;  3VRB A;  4A65 A;  2WU2 A;  3UP5 A;  3AE3 A;  4A7A A;  2BC0 A;  1KSU A;  5KOW A;  1KFY A;  2C66 A;  4EMI A;  3AEB A;  1L9C A;  2ZBW A;  1Y0P A;  1XDI A;  2GVC A;  1YQ3 A;  2NPX A;  1DXL A;  4LII A;  1EL5 A;  4APN A;  1REO A;  2R0C A;  4U8L A;  3BI4 A;  1L9D A;  2XVH A;  5FMH A;  1M64 A;  2XYO A;  1H84 A;  3CN8 A;  1D4C A;  2R45 A;  3NH3 X;  2B9W A;  2HQM A;  2AAQ A;  3RNM A;  2WQY A;  3K7T A;  3NLC A;  2X8H A;  3DGZ A;  3AYJ A;  1MOK A;  5FS8 A;  4YWO A;  2VVL G;  3UKQ A;  4H4V A;  1PN0 A;  5IQ1 A;  2Q7V A;  3CND A;  3AEA A;  5KOX A;  1NPX A;  1IUX A;  4YKG A;  1CBO A;  2YG5 A;  4H4R A;  3ICR A;  1MXT A;  3PO7 A;  3BHK A;  3RP8 A;  3FBS A;  3S61 A;  5KVH A;  1FL2 A;  3B6D A;  3AEG A;  4GDP A;  1IUU A;  4TM3 A;  4C77 A;  5KWF A;  4YSX A;  3JSK A;  2GQW A;  4JNQ A;  5KRQ A;  3EF6 A;  3SQP A;  4U8P A;  3SFE A;  3V76 A;  2EQ8 A;  3GMC A;  1PBC A;  4HB9 A;  1D4D A;  3CNT A;  3Q9T A;  4U2S A;  3G5R A;  1TDK A;  2BCP A;  3AE9 A;  3NGC X;  4BK1 A;  3DK8 A;  2E1M A;  3DJJ A;  4EM4 A;  2JBV A;  2OAL A;  1B5Q A;  3M12 A;  2XVF A;  2EQ9 A;  3NK2 X;  2J3N A;  4B65 A;  1L0V A;  2ACZ A;  2VZ2 A;  1FEB A;  3NHO X;  4YKF A;  3GDN A;  1PXC A;  1ZY8 A;  1ZMC A;  3H4K A;  4NEV A;  2WS3 A;  3GYI A;  5EB4 A;  1OJT A;  2B9Y A;  4ZCD A;  4MJW A;  2X99 A;  3LB8 A;  2GF3 A;  2C3D A;  3NK0 X;  1H82 A;  3NYC A;  2FJD A;  4GUV A;  3R9U A;  2GR0 A;  2B76 A;  3D1C A;  5FS6 A;  2JB3 A;  1VG9 A;  1GER A;  4IA5 A;  2GRT A;  1PBD A;  1O95 A;  1GXF A;  4H4Q A;  2XFP A;  4USR A;  4WCT A;  5J60 A;  4J36 A;  4Z44 A;  2VQB A;  2BYB A;  4CNK A;  1EL9 A;  1F8R A;  2GH5 A;  3LZX A;  2YG4 A;  3S5W A;  4H4T A;  4X9N A;  2C76 A;  4OPU A;  2YLW A;  3DGH A;  1GRH A;  3ABV A;  2XLS A;  4JY3 A;  2V6O A;  2H89 A;  2GMJ A;  2XVI A;  2VRM A;  4J2W A;  4UP3 A;  1H6V A;  1H83 A;  2YG3 A;  5JCM A;  5BRT A;  3AB1 A;  4C3Y A;  3M13 A;  2JB2 A;  4D03 A;  2VVL A;  5FS7 A;  2CUL A;  4U8J A;  3EPT A;  1AOG A;  2YM2 A;  4H2R A;  1GND A;  2WOW A;  1EBD A;  4I58 A;  4CBQ A;  4U8I A;  4DSH A;  1QLB A;  2CDU A;  1NDA A;  2CFY A;  2ZZC A;  2YWL A;  5M10 A;  1LV0 A;  1X31 B;  2Z5Y A;  3AE7 A;  1FEA A;  4EQR A;  1P2E A;  3CGE A;  1GEU A;  4B64 A;  1K0J A;  4IA6 A;  1N4U A;  4OPG A;  3AEC A;  3AEF A;  4YTM A;  4FX9 A;  1GRA A;  1ZK7 A;  4YTN A;  4DSG A;  1CC4 A;  4RG3 A;  5KXJ A;  1NG3 A;  4OPT A;  4DNA A;  1NHR A;  3EAO A;  1N1P A;  1GRT A;  3ICS A;  1JRY A;  3F8D A;  4WX1 A;  1YQZ A;  1NEN A;  1S3B A;  4JNA A;  4TM4 A;  4EQW A;  2A8X A;  3BNM A;  5U63 A;  4JQ9 A;  1H7W A;  4Z2T A;  4BUR A;  3GRS A;  4H50 A;  4NTD A;  4H2P A;  1CJ2 A;  2FJB A;  4U8N A;  5L46 A;  2YM1 A;  3ITJ A;  4K22 A;  4Z2R A;  4OPI A;  1EL8 A;  5IPY A;  3VRA A;  1Z6L A;  1GT8 A;  1ONF A;  5JCI A;  3NN6 X;  4X4J A;  1E6E A;  5ER0 A;  1CL0 A;  1NAA A;  1OJ9 A;  3FMW A;  4AP1 A;  2TPR A;  1O5W A;  4TM0 A;  4UDP A;  3CPH G;  3UKK A;  3DJE A;  2R4E A;  2V3B A;  3AE1 A;  5EOW A;  2IVD A;  1GPE A;  2WOV A;  4J57 A;  2CVJ A;  2RAB A;  3QFB A;  1OJC A;  1VQW A;  1GRF A;  2FJA A;  2R4J A;  3P4S A;  2YLX A;  2WP9 A;  2TMD A;  2Z5X A;  4O5U A;  2JKC A;  1BGN A;  4TLX A;  3ALL A;  2X50 A;  1F8S A;  3H8I A;  2V60 A;  3CNS A;  1PJ6 A;  1B4V A;  3G5Q A;  3QVR A;  4H4P A;  1ZDL A;  2XFN A;  2BXS A;  2RGJ A;  2WP6 A;  2WU5 A;  2BK3 A;  4EM3 A;  1GRE A;  1FEC A;  1ZOY A;  1NG4 A;  1GOS A;  2C75 A;  4BJZ A;  1GV4 A;  3D8X A;  5BUL A;  2H88 A;  3I3L A;  3IHM A;  4U2T A;  3UKH A;  2Q6U A;  3GWF A;  3CGC A;  3NTA A;  3C96 A;  3IC9 A;  1CJ4 A;  4U8O A;  5EB5 A;  1KF6 A;  3UTG A;  2VVM A;  3ALM A;  5BUK A;  3CPJ G;  3GD4 A;  2YR6 A;  2YLT A;  2YR5 A;  5M0Z A;  1JRX A;  4B68 A;  2OLN A;  2GQF A;  3FIM B;  2BAC A;  2WPE A;  1BKW A;  1NEK A;  2QA2 A;  1ZOV A;  4H4S A;  3NIX A;  3VR8 A;  3G5S A;  4CNJ A;  4NEW A;  1E1K A;  3EAN A;  2OAM A;  2XVE A;  1LQU A;  1IJH A;  1QJD A;  4H4Z A;  2FJE A;  3C4A A;  3L1R A;  5HHF A;  3BNU A;  3QSE A;  1COY A;  2A89 A;  1TDE A;  3CNP A;  4PAB A;  5JCK A;  1E1M A;  2RGO A;  2YQU A;  1K0I A;  3ATR A;  3NG7 X;  4CRT A;  1JOA A;  4Y4L A;  2X8G A;  2V61 A;  2XLU A; 
#chains in the Genus database with same CATH topology
 3OP2 A;  1PHH A;  4X9M A;  4A79 A;  3F8P A;  1EBG A;  3GRT A;  4GAV A;  4HN8 A;  2JAE A;  2OPJ A;  2WPF A;  3PG6 A;  2GV8 A;  3QJ4 A;  1DOC A;  4U8M A;  3IWA A;  3K7M X;  1ZMD A;  3T0K A;  3UKA A;  3ZDN A;  1CC2 A;  2PTW A;  4AP3 A;  4FK1 A;  2HXT A;  4AOS A;  3R25 A;  3UOV A;  3AYL A;  4H1Z A;  1FHV A;  5C3J A;  3K7Q X;  1H7X A;  2QA1 A;  3QSM A;  3L8K A;  3IJQ A;  2BAB A;  1OJD A;  4EQS A;  4II2 A;  1PJ5 A;  4YSH A;  3QLD A;  1CJC A;  1VG0 A;  1JEH A;  3DES A;  4EIP A;  3HW2 A;  2APG A;  3GWD A;  1KKO A;  2PPG A;  3QSS A;  5U25 A;  3UCC A;  4Y4M A;  2BK4 A;  1TZZ A;  1XHC A;  2MUC A;  1TRB A;  2C64 A;  2ZAD A;  2GGE A;  2YR4 A;  1SB3 B;  1TYT A;  2W0H A;  4JN9 A;  1RYI A;  2FBW A;  4EQX A;  2QDE A;  3QKE A;  1E1L A;  3NRN A;  3AEE A;  2E5V A;  1JPD X;  4Z17 A;  3V3N A;  4E8G A;  2OA1 A;  4D04 A;  1JRP A;  1ELI A;  2RGH A;  1DOE A;  1STZ A;  4G7F A;  4KT2 A;  3SY4 A;  3I6T A;  4J56 A;  3ETR B;  4HCD A;  1PBE A;  2XLR A;  2YLS A;  4AT2 A;  4Z43 A;  3NVW B;  3E1T A;  1BZL A;  4A35 A;  4K2X A;  2HNE A;  3FV9 A;  4OVI A;  3CMM A;  3I6D A;  3DGB A;  3ENL A;  4M6U A;  1YY5 A;  5IDZ A;  3UTE A;  3CIR A;  4ZOH B;  3NO1 A;  1IUS A;  2C73 A;  4ROP A;  4K1W A;  2F5Z A;  2OQY A;  4GGH A;  3H7V A;  3DFY A;  1TDO A;  3GYJ A;  2XVJ A;  1CHU A;  3ICT A;  1SJD A;  5FJO A;  3OC4 A;  3LZW A;  1ZKQ A;  4YSZ A;  2XFO A;  3OZ2 A;  1LQT A;  1H81 A;  4A9W A;  2BXR A;  4M0X A;  4DGK A;  3RED A;  2XLP A;  2V3A A;  4HA6 A;  2YG7 A;  2HXU A;  4GME A;  3A7R A;  5KMP A;  4Z24 A;  2XFU A;  1B8S A;  5BVA A;  2C70 A;  1JU2 A;  2WP5 A;  1JRZ A;  3TJ4 A;  1MUC A;  3DK9 A;  1TE6 A;  4TVY A;  3QTP A;  4UDQ A;  1JCT A;  2OX4 A;  2PU1 A;  1KSU A;  1L9C A;  2GVC A;  1XDI A;  1REO A;  2R0C A;  4U8L A;  1L9D A;  2OFJ A;  4H19 A;  3H12 A;  3T4W A;  2WQY A;  3K7T A;  3DGZ A;  5FS8 A;  2VVL G;  3DFH A;  3EEZ A;  3CND A;  5KOX A;  1IUX A;  4H4R A;  5KMS A;  3BHK A;  4TM3 A;  4C77 A;  3T9P A;  3SFE A;  3R0K A;  2EQ8 A;  3GMC A;  1PBC A;  4HB9 A;  3VC6 A;  3Q9T A;  1TDK A;  3MUC A;  2OAL A;  3R11 A;  3TW9 A;  2J3N A;  2O56 A;  4YKF A;  2AKZ A;  1PXC A;  3GYI A;  2WS3 A;  1OJT A;  4MJW A;  2GF3 A;  4HNL A;  1MDR A;  1VG9 A;  4USR A;  4J36 A;  2BYB A;  4HNC A;  4CNK A;  1F8R A;  3S5W A;  3SJN A;  3NVV B;  2YLW A;  3ABV A;  1GRH A;  3BOX A;  2GGI A;  2YG3 A;  3CT2 A;  3OPS A;  5FS7 A;  3CXO A;  3EPT A;  1EBD A;  2YWL A;  3V5C A;  2Z5Y A;  4EQR A;  1P2E A;  3CGE A;  1GEU A;  3UJF A;  4YTN A;  3TWB A;  4DNA A;  1NHR A;  1GRT A;  3F8D A;  4JNA A;  2A8X A;  4DX3 A;  2XH0 A;  3GRS A;  1FHU A;  4H2P A;  5L46 A;  1OEP A;  3N6J A;  2YM1 A;  3A7U A;  1EL8 A;  3VRA A;  1YEY A;  3FMW A;  4AP1 A;  2W55 A;  2GGG A;  4GAP A;  3RR1 A;  4TM0 A;  4UDP A;  2V3B A;  1GPE A;  4J57 A;  1GRF A;  2Z5X A;  4O5U A;  3AM9 A;  4ZA0 A;  3H8I A;  4DN1 A;  4H4P A;  4ZCW A;  3R07 C;  2XFN A;  2WP6 A;  3CGC A;  2OVL A;  3NTA A;  3H70 A;  1CJ4 A;  5BUK A;  3Q4D A;  2GL5 A;  2W54 A;  3FIM B;  1H2I A;  2QA2 A;  3G5S A;  5KNL A;  5JRB A;  2PMQ A;  3L1R A;  2FJE A;  3ZLF A;  3ZVH A;  2A89 A;  3JVA A;  3NG7 X;  2YQU A;  1K0I A;  3DER A;  4Y4L A;  2X8G A;  2V61 A;  3K30 A;  3VRD B;  4Z26 A;  2QCU A;  3QVP A;  3CXB A;  4UDR A;  1CF3 A;  1R0M A;  2C67 A;  3AD8 B;  3UTF A;  2B7S A;  3P4Q A;  4YTP A;  3AD7 B;  3QFA A;  1L8P A;  2BRA A;  1PBB A;  1VDC A;  4FK1 C;  3LAD A;  3FXG A;  1S3E A;  3AE2 A;  3GY1 A;  3PWG A;  3T2K A;  3C4N A;  3UJE A;  4RG4 A;  3TWA A;  3U4F A;  4K8G A;  1RP0 A;  1BGJ A;  3UJ2 A;  2B7R A;  2GGH A;  3ADA B;  2WOI A;  1TYP A;  4P9S A;  3OTR A;  5KMR A;  1PJ7 A;  4FI4 A;  3DJG X;  1ZP0 A;  3AWI A;  3AD9 B;  3SXI A;  1SJB A;  4IP5 A;  2P8C A;  1MNS A;  3COX A;  1N60 C;  5JCN A;  3AYI A;  1N62 C;  2AL2 A;  1DJN A;  4U8K A;  2YAU A;  1SJC A;  2BA9 A;  2GSH A;  1ECQ A;  2JK6 A;  2XDO A;  3KLJ A;  3UOX A;  3KU9 A;  1EC8 A;  5BOE A;  4IL2 A;  4H2H A;  1F6M A;  1IUT A;  3D47 A;  4A6N A;  4ZCC A;  2VRL A;  2X3N A;  2GR3 A;  4A99 A;  2R0P A;  1YQ4 A;  3B9J B;  2BCG G;  1D7Y A;  4JN7 A;  4I59 A;  1TDN A;  2E3T A;  3MQT A;  5LV9 A;  5FJT A;  5J7X A;  1B37 A;  1E9I A;  1K4Q A;  3FYY A;  5EBK A;  3KKJ A;  4B69 A;  1D5T A;  2A87 A;  3SZF A;  1XAN A;  1RSG A;  3UCL A;  1TDF A;  1N5X A;  4K8D A;  3DK4 A;  4USQ A;  1FO4 A;  2BC1 A;  2BS3 A;  1EL7 A;  2GMH A;  1F8W A;  4J1O A;  1Y56 A;  1ONE A;  4J34 A;  4TM1 A;  1DJQ A;  4IVM B;  1H86 A;  2WES A;  2WPC A;  4GDE A;  3TCS A;  4U2L A;  3GYX A;  3VCC A;  1PDY A;  3BI5 A;  2EQ6 A;  5FS9 A;  1P2H A;  3SSZ A;  4ECH A;  5TR3 A;  1IUV A;  4B66 A;  1CC6 A;  3WE0 A;  2QGY A;  3KA7 A;  3SR6 B;  4FDC B;  3GMB A;  4BK2 A;  3UKL A;  4J31 A;  2WDR A;  1LPF A;  4NZH A;  3GD6 A;  3VC5 A;  2GR2 A;  4CCQ A;  1UKV G;  3SFD A;  3NTD A;  1KN0 A;  4CCR A;  3NN0 X;  3ATQ A;  1S2Y A;  2C65 A;  3UTH A;  1WYG A;  1KSS A;  4NWZ A;  4YSY A;  3CTY A;  4KWS A;  3DG3 A;  3UP4 A;  3U9I A;  5FJR A;  1JNZ A;  3T2Z A;  1RVK A;  1E7P A;  3F8R A;  4IV9 A;  1GAL A;  4DHG A;  2VOU A;  1IYX A;  4KPR A;  4XXG A;  2ZZ0 A;  3RGT A;  3UKP A;  4JDR A;  3NK1 X;  1N4W A;  4J33 A;  1EC7 A;  4C5O A;  4Z2U A;  2E4G A;  4KEM A;  4A65 A;  2WU2 A;  3AE3 A;  2C66 A;  2ZBW A;  4GYP A;  4LII A;  1EL5 A;  3NH3 X;  3CN8 A;  1D4C A;  2R45 A;  2HQM A;  3NLC A;  1MOK A;  4H4V A;  2Q7V A;  3AEA A;  3I6E A;  1SJA A;  1NPX A;  4YKG A;  2YG5 A;  3ICR A;  3RP8 A;  1MDL A;  4FP1 A;  5KWF A;  3A7A A;  3JSK A;  5KRQ A;  4U8P A;  3AE9 A;  4ENL A;  4IT1 A;  4B65 A;  2ACZ A;  2VZ2 A;  1ZY8 A;  3H4K A;  4NEV A;  5EB4 A;  3CYJ A;  2X99 A;  2QJJ A;  3NK0 X;  3NYC A;  4GUV A;  3D1C A;  3Q45 A;  1VDV A;  1O95 A;  1P43 A;  5J60 A;  4KPL A;  4MMW A;  3N4E A;  3UGV A;  2XLS A;  4JY3 A;  2XVI A;  3SBF A;  5JCM A;  3AB1 A;  3IJL A;  2JB2 A;  2PP0 A;  3M13 A;  4D03 A;  2VVL A;  4U8J A;  1AOG A;  2WOW A;  1QLB A;  2CFY A;  2ZZC A;  5M10 A;  1LV0 A;  1FEA A;  1FIQ B;  1K0J A;  3VDG A;  3AEF A;  2OQH A;  4YTM A;  4FX9 A;  2PU0 A;  4DSG A;  4EWJ A;  5KXJ A;  4OPT A;  1JRY A;  1YQZ A;  1NEN A;  4TM4 A;  4EQW A;  3BNM A;  5U63 A;  4JQ9 A;  1H7W A;  4HCH A;  1CJ2 A;  4G6G A;  3ITJ A;  4K22 A;  5IPY A;  1N5W C;  1T3Q C;  1Z6L A;  1GT8 A;  5ER0 A;  1CL0 A;  1NAA A;  4DYE A;  1O5W A;  3UKK A;  2R4E A;  5EOW A;  3AE1 A;  2PCE A;  3QFB A;  1OJC A;  1VQW A;  2FJA A;  3D46 A;  2YLX A;  2TMD A;  2JKC A;  4TLX A;  2BXS A;  2WU5 A;  2BK3 A;  4K2S A;  4BJZ A;  1NG4 A;  1VQZ A;  5BUL A;  3SN0 A;  5EU9 A;  2H88 A;  3AMZ A;  4U2T A;  3UKH A;  4HCL A;  3GWF A;  2POZ A;  1S7M A;  2YLT A;  5M0Z A;  2GQF A;  1E1K A;  2W3S A;  3EAN A;  1LQU A;  1QJD A;  3C4A A;  3QSE A;  3CNP A;  2PGE A;  1E1M A;  3HYW A;  2XLU A;  3RHA A;  1D4E A;  3CPI G;  4GF7 A;  3P1W A;  2OKT A;  2PA6 A;  2XH4 A;  3SGL A;  1JNR A;  2PYX A;  2Q0K A;  1NHP A;  3SN4 A;  1KNR A;  5JCL A;  3R10 A;  3SM8 A;  2WEU A;  4E0V A;  3T8Q A;  3R0U A;  1DOB A;  2R0G A;  3THU A;  1PBF A;  2WDV A;  4B63 A;  4H4Y A;  1ELS A;  5KVI A;  4H4W A;  2P0I A;  1GSN A;  3DJD A;  1O94 A;  3ZLH A;  3HZL A;  4GFI A;  3CB3 A;  2WHD A;  3ISH A;  4CY6 A;  3AE6 A;  4LA1 A;  5HY5 A;  1YKJ A;  2P88 A;  2BS4 A;  3UJR A;  5G5G B;  4H2N A;  3PVC A;  2PGW A;  4GR1 A;  2AL1 A;  3V3O A;  1GTE A;  1NHS A;  1V59 A;  1DNC A;  2O9Z A;  2Y6Q A;  3DG7 A;  4N9X A;  2XH7 A;  3P3B A;  3PFR A;  4JHM A;  1XPQ A;  3RP7 A;  2XSX A;  1S2Q A;  2XLT A;  4H7U A;  3IF9 A;  2XCG A;  3NYE A;  1Q1R A;  4MGG A;  3GSI A;  3ZYX A;  4GIR A;  4ZN0 A;  1BWC A;  5ENL A;  3BI2 A;  3SYI A;  3KD9 A;  1GES A;  3M0O A;  4IVO B;  1PDZ A;  3NRZ B;  3PS9 A;  4M52 A;  3OZY A;  4IP4 A;  4GIS A;  1NHQ A;  1MRA A;  4B1B A;  3URH A;  1PXB A;  2PSN A;  2DKI A;  2R9Z A;  3FG2 P;  2OLO A;  4O5Q A;  3V5F A;  3FCP A;  4IHC A;  1EC9 A;  2W3R A;  2GB0 A;  2YVG A;  1K0L A;  3DG6 A;  4C3X A;  1PS9 A;  3LJP A;  4A5L A;  2EQ7 A;  3Q6J A;  4OPD A;  1FOH A;  3VR9 A;  1KNP A;  3RP6 A;  4H2Q A;  3AE8 A;  4C74 A;  1HYU A;  3ES8 A;  2OZ8 A;  2PP3 A;  5FJU A;  2GAH B;  2FYM A;  2YLZ A;  1BQG A;  3CGD A;  2NQL A;  1FFV C;  5C2T A;  4F4R A;  4NTE A;  3B3R A;  1PXA A;  3UXL A;  2UZZ A;  4CY8 A;  4XWR A;  2GAG B;  3AED A;  3RO6 A;  4Z25 A;  3T14 A;  3FPZ A;  2WBA A;  4K5R A;  3RRA A;  4OPL A;  5FJP A;  2AKM A;  3GD3 A;  4AT0 A;  3DH9 A;  3PK7 A;  3AN1 A;  1Q1W A;  4YT0 A;  4YWS A;  3CAW A;  3RCY A;  4GYP C;  2Q0L A;  1E39 A;  1DTN A;  4JN8 A;  2WET A;  3B97 A;  3GDP A;  4LU6 A;  4XWZ A;  3VRB A;  3JZU A;  2BC0 A;  3R1Z A;  3HYV A;  2RDX A;  1KFY A;  1N63 C;  3AEB A;  1YQ3 A;  5FMH A;  1M64 A;  1H84 A;  2B9W A;  2AAQ A;  3RNM A;  3AYJ A;  3UKQ A;  4J3Z A;  3TJI A;  1CBO A;  3DEQ A;  3NFU A;  3PO7 A;  3JW7 A;  4E5T A;  3AEG A;  1IUU A;  4YSX A;  1NEL A;  4JNQ A;  3SQP A;  3V76 A;  3CNT A;  4U2S A;  4BK1 A;  3DK8 A;  4EM4 A;  2JBV A;  1B5Q A;  2BRY A;  3M12 A;  2XVF A;  2EQ9 A;  3GDN A;  2B9Y A;  1ZXI C;  1H82 A;  2JB3 A;  2PTY A;  4IA5 A;  2GRT A;  1PBD A;  1GXF A;  4H4Q A;  2XFP A;  4Z44 A;  2VQB A;  4II3 A;  1EL9 A;  3NZG A;  2GH5 A;  2YG4 A;  4H4T A;  3BSM A;  2C76 A;  4OPU A;  3N4F A;  4J2W A;  3NVY B;  1H6V A;  5BRT A;  4C3Y A;  2CUL A;  4H2R A;  3KUM A;  4G8T A;  4I58 A;  4CBQ A;  4DSH A;  4U8I A;  2CDU A;  3ES7 A;  4IA6 A;  1N4U A;  1KCZ A;  1GRA A;  1ZK7 A;  3TQP A;  1CC4 A;  2XGZ A;  1X2H A;  3ICS A;  4WX1 A;  3S5S A;  2QQ6 A;  4Z2T A;  4BUR A;  4NTD A;  5BOF A;  4U8N A;  1JDF A;  2QDD A;  4OPI A;  4A3R A;  4G73 A;  1ONF A;  5JCI A;  2P8B A;  1E6E A;  1W6T A;  1EBH A;  2TPR A;  2OZT A;  3NS1 B;  3N6H A;  3S47 A;  2R4J A;  4X2P A;  2WP9 A;  1BGN A;  3ALL A;  2V60 A;  3CNS A;  3QVR A;  1B4V A;  2POD A;  2RGJ A;  1FEC A;  1ZOY A;  1GOS A;  2Q6U A;  4HYR A;  3IC9 A;  3UJS A;  3UTG A;  2VVM A;  3SX6 A;  1P48 A;  3CPJ G;  2YR6 A;  2YR5 A;  4H83 A;  1JRX A;  4B68 A;  2OLN A;  2BAC A;  2WPE A;  3OZM A;  1NEK A;  1ZOV A;  4H4S A;  4NEW A;  2OAM A;  2XVE A;  4H4Z A;  5HHF A;  3BNU A;  1TDE A;  3SQS A;  4PAB A;  4E6M A;  1JOA A;  4H4X A;  2PHH A;  3NYF A;  3TTE A;  4B67 A;  2YLR A;  3P4P A;  5DBJ A;  1OJA A;  3II4 A;  1BF3 A;  4EMJ A;  1F3P A;  2B9X A;  4EMW A;  3CNJ A;  4Y4N A;  4PAA A;  2ZC8 A;  4EIQ A;  2AR8 A;  2XH2 A;  2ARD A;  2GDQ A;  3ZVH B;  2DW6 A;  4H4U A;  3KPF A;  3KVE A;  4MKS A;  3H8L A;  2WDQ A;  2Y6R A;  4DWD A;  3OW1 A;  2VQ7 A;  2DKH A;  2C3C A;  3ZLG A;  2JB1 A;  1LVL A;  4REK A;  4NTC A;  2YVF A;  1GRG A;  3CGB A;  5KMQ A;  3V4B A;  3NVZ B;  3O0H A;  2OO6 A;  2ZZB A;  1X2G A;  4BK3 A;  3VA8 A;  1WUF A;  2GR1 A;  2I5Q A;  4E4U A;  1TKK A;  1XS2 A;  3NNE A;  3UOY A;  2C72 A;  1JPM A;  3P0W A;  3BHF A;  2NVK X;  1R6W A;  2IVE A;  4TLZ A;  2QAE A;  1W4X A;  3P9U A;  1N4V A;  4ICY A;  2YVJ A;  1N61 C;  3P4R A;  3SN1 A;  1D7L A;  3STP A;  2AL2 B;  2OZ3 A;  3AXB A;  4GCM A;  1CJ3 A;  3FVD A;  1LJ1 A;  1PDH A;  4IZG A;  3NXL A;  2BK5 A;  4BJY A;  3T37 A;  3MZN A;  3AE4 A;  3NT6 A;  4ADW A;  4E4F A;  1DOD A;  3L5O A;  1GET A;  4OPC A;  3T31 A;  4A6N B;  2C7G A;  2GGJ A;  2P3Z A;  1WUE A;  3LXD A;  2IID A;  4G9K A;  3UKF A;  4OCG A;  3VQR A;  5IQ4 A;  1VRQ B;  2X8C A;  1GTH A;  2XFQ A;  2AQJ A;  3GC2 A;  2PTZ A;  4BV6 A;  5G5H B;  4YXD A;  4G6H A;  2R46 A;  3CK5 A;  5GSN A;  2BS2 A;  5U1O A;  4Z1Y A;  3TOY A;  1FCD A;  4JY2 A;  1BKH A;  1MO9 A;  1KKR A;  5J04 A;  2FKP A;  2C4C A;  3ALJ A;  1E1N A;  3DA1 A;  1KDG A;  5CKU A;  2HZG A;  3AE5 A;  4GRT A;  1Y56 B;  4KX6 A;  1ZX9 A;  3UOZ A;  3MWC A;  4RSL A;  5CQF A;  4K7Z A;  5HXI A;  4AOX A;  1IUW A;  1L9E A;  3IHG A;  1Q9I A;  1RM6 B;  1SEZ A;  1LTX R;  3DME A;  3KPK A;  1QO8 A;  2YG6 A;  1NU5 A;  2GEW A;  3NKS A;  2I0Z A;  3LOV A;  5GRT A;  2QJM A;  1M6I A;  3FJ4 A;  2ONE A;  2V5Z A;  1GRB A;  5HYM A;  3P93 A;  3MY9 A;  2PTX A;  3UP5 A;  3GO2 A;  4A7A A;  5KOW A;  3T6C A;  4EMI A;  1Y0P A;  2NPX A;  1DXL A;  3BJS A;  4APN A;  3BI4 A;  2XVH A;  2XYO A;  3MKC A;  4K5S A;  4G74 A;  2X8H A;  4NNJ A;  4YWO A;  1PN0 A;  7ENL A;  5IQ1 A;  1JRO A;  1MXT A;  3FBS A;  3S61 A;  5KVH A;  1FL2 A;  3B6D A;  3UXK A;  4IL0 A;  4GDP A;  3MSY A;  2GQW A;  1F9C A;  3EF6 A;  1D4D A;  3G5R A;  2BCP A;  3NGC X;  2E1M A;  3DJJ A;  3NK2 X;  1L0V A;  1FEB A;  3NHO X;  1ZMC A;  4ZCD A;  3LB8 A;  2C3D A;  3IJI A;  2FJD A;  3R9U A;  2GR0 A;  2B76 A;  5FS6 A;  1GER A;  1KD0 A;  4WCT A;  3SZC A;  3LZX A;  3ZVI A;  3HRD C;  2CHR A;  4X9N A;  2OLA A;  3DGH A;  2V6O A;  2H89 A;  2GMJ A;  2VRM A;  4UP3 A;  3K1G A;  1H83 A;  4GGB A;  3UCD A;  6ENL A;  1V97 A;  4HPN A;  2YM2 A;  2PS2 A;  1GND A;  3DIP A;  2OG9 A;  1NDA A;  1X31 B;  3T2Y A;  3AE7 A;  2E5A A;  3IK4 A;  4B64 A;  4OPG A;  3AEC A;  3QPE A;  1XPY A;  3SZW A;  4RG3 A;  2QJN A;  1NG3 A;  1N1P A;  3EAO A;  1S3B A;  2QVH A;  4H50 A;  3RIT A;  2FJB A;  1FFU C;  2DW7 A;  3V3W A;  4Z2R A;  3VFC A;  3PWI A;  4DXK A;  4TVW A;  2MNR A;  3NN6 X;  4X4J A;  1OJ9 A;  3SZ0 A;  3CPH G;  3DJE A;  2IVD A;  2WOV A;  2CVJ A;  2RAB A;  3P4S A;  3DDM A;  2X50 A;  1F8S A;  1PJ6 A;  3G5Q A;  3EKG A;  1ZDL A;  2PP1 A;  4EM3 A;  1GRE A;  2C75 A;  1GV4 A;  3D8X A;  3D9X A;  3I3L A;  3HPF A;  3IHM A;  3C96 A;  4U8O A;  5EB5 A;  1KF6 A;  3ALM A;  3GD4 A;  3QN3 A;  3VCN A;  1BKW A;  3HYX A;  3VR8 A;  3NIX A;  4CNJ A;  3I4K A;  3H8A A;  1IJH A;  4A6G A;  1COY A;  3EUB 3;  5JCK A;  4CRT A;  2RGO A;  3ATR A; 
#chains in the Genus database with same CATH homology
 3K30 A;  1PHH A;  3RHA A;  4X9M A;  3VRD B;  1D4E A;  3CPI G;  4A79 A;  4Z26 A;  2QCU A;  4H4X A;  2PHH A;  3P1W A;  4GF7 A;  3F8P A;  3QVP A;  4UDR A;  3NYF A;  1CF3 A;  4B67 A;  3GRT A;  2YLR A;  3SGL A;  3P4P A;  2C67 A;  4GAV A;  1JNR A;  3AD8 B;  5DBJ A;  2JAE A;  3UTF A;  1OJA A;  2B7S A;  2PYX A;  3P4Q A;  4YTP A;  3AD7 B;  3QFA A;  2Q0K A;  2WPF A;  1NHP A;  3PG6 A;  2GV8 A;  2BRA A;  1KNR A;  5JCL A;  1PBB A;  3SM8 A;  2WEU A;  3II4 A;  1VDC A;  3QJ4 A;  1DOC A;  4FK1 C;  3LAD A;  4E0V A;  1BF3 A;  1DOB A;  2R0G A;  4EMJ A;  4U8M A;  3IWA A;  1F3P A;  1S3E A;  3K7M X;  2B9X A;  3AE2 A;  4EMW A;  1PBF A;  2WDV A;  3CNJ A;  1ZMD A;  4Y4N A;  3T0K A;  4PAA A;  4H4Y A;  3T2K A;  1CC2 A;  3C4N A;  3UKA A;  3ZDN A;  4B63 A;  4EIQ A;  4RG4 A;  2AR8 A;  4AP3 A;  4FK1 A;  2ARD A;  1RP0 A;  1BGJ A;  2B7R A;  4H4U A;  4AOS A;  5KVI A;  3UOV A;  3AYL A;  3ADA B;  4H4W A;  2WOI A;  3KPF A;  1GSN A;  3DJD A;  3KVE A;  1O94 A;  1TYP A;  4P9S A;  3HZL A;  5C3J A;  5KMR A;  3H8L A;  1PJ7 A;  3K7Q X;  2WDQ A;  2Y6R A;  3DJG X;  2WHD A;  1ZP0 A;  3AWI A;  3ISH A;  3AD9 B;  3SXI A;  2VQ7 A;  2DKH A;  2C3C A;  1H7X A;  2QA1 A;  3COX A;  2JB1 A;  3L8K A;  5JCN A;  3QSM A;  4CY6 A;  3AYI A;  3AE6 A;  1LVL A;  4LA1 A;  4REK A;  4NTC A;  2YVF A;  1GRG A;  1DJN A;  3CGB A;  2BAB A;  4U8K A;  5HY5 A;  1YKJ A;  1OJD A;  2YAU A;  4EQS A;  2BS4 A;  2BA9 A;  4II2 A;  5KMQ A;  1PJ5 A;  4YSH A;  4H2N A;  3O0H A;  2JK6 A;  2XDO A;  3KLJ A;  1CJC A;  2ZZB A;  1VG0 A;  3UOX A;  3PVC A;  1JEH A;  3KU9 A;  4EIP A;  4GR1 A;  2APG A;  3V3O A;  1GTE A;  3GWD A;  4BK3 A;  1NHS A;  3QSS A;  1F6M A;  1IUT A;  2GR1 A;  1V59 A;  5U25 A;  4A6N A;  4ZCC A;  4Y4M A;  2BK4 A;  2VRL A;  2X3N A;  1DNC A;  2GR3 A;  2O9Z A;  1XHC A;  2Y6Q A;  2R0P A;  4N9X A;  1TRB A;  1YQ4 A;  2C64 A;  3NNE A;  3UOY A;  4A99 A;  2BCG G;  2YR4 A;  2C72 A;  1D7Y A;  1XPQ A;  3BHF A;  2NVK X;  2IVE A;  4TLZ A;  1TYT A;  2QAE A;  1W4X A;  3P9U A;  2W0H A;  1S2Q A;  4I59 A;  3RP7 A;  1N4V A;  2XLT A;  4ICY A;  1TDN A;  4H7U A;  2YVJ A;  3IF9 A;  4JN9 A;  2XCG A;  1RYI A;  2FBW A;  3P4R A;  3NYE A;  1Q1R A;  1D7L A;  4EQX A;  3GSI A;  1E1L A;  3NRN A;  5LV9 A;  4K5S A;  3AXB A;  5J7X A;  1B37 A;  4GCM A;  3AEE A;  2E5V A;  3ZYX A;  1K4Q A;  3V3N A;  1CJ3 A;  1LJ1 A;  1PDH A;  2OA1 A;  5EBK A;  4ZN0 A;  2BK5 A;  3KKJ A;  4D04 A;  1BWC A;  4B69 A;  1D5T A;  4BJY A;  2A87 A;  3T37 A;  3BI2 A;  1ELI A;  3SYI A;  3SZF A;  1XAN A;  2RGH A;  3AE4 A;  1DOE A;  3KD9 A;  1RSG A;  3NT6 A;  3UCL A;  1GES A;  1TDF A;  3M0O A;  4IVO B;  3SY4 A;  4K8D A;  4ADW A;  3PS9 A;  4M52 A;  3DK4 A;  1DOD A;  4USQ A;  4J56 A;  3L5O A;  1GET A;  1PBE A;  4OPC A;  3T31 A;  4A6N B;  2BC1 A;  2BS3 A;  1NHQ A;  2C7G A;  2XLR A;  1EL7 A;  2GMH A;  1F8W A;  1Y56 A;  2YLS A;  4J34 A;  4AT2 A;  4B1B A;  3LXD A;  2IID A;  4Z43 A;  3URH A;  4G9K A;  3UKF A;  3E1T A;  4OCG A;  4TM1 A;  1DJQ A;  1BZL A;  1PXB A;  3VQR A;  4IVM B;  5IQ4 A;  1VRQ B;  4K2X A;  2DKI A;  1H86 A;  2R9Z A;  2X8C A;  2WES A;  3FG2 P;  1GTH A;  2AQJ A;  2OLO A;  2XFQ A;  4OVI A;  2WPC A;  3CMM A;  3I6D A;  4GDE A;  4O5Q A;  4U2L A;  4BV6 A;  1YY5 A;  3GYX A;  3UTE A;  4YXD A;  2GB0 A;  2R46 A;  4G6H A;  3BI5 A;  2YVG A;  3CIR A;  5GSN A;  2BS2 A;  1K0L A;  5U1O A;  2EQ6 A;  1IUS A;  4C3X A;  1FCD A;  5FS9 A;  4JY2 A;  1P2H A;  1PS9 A;  3LJP A;  4A5L A;  2C73 A;  2EQ7 A;  4ECH A;  3Q6J A;  5TR3 A;  1IUV A;  4B66 A;  4OPD A;  2F5Z A;  1MO9 A;  1CC6 A;  3WE0 A;  1FOH A;  3VR9 A;  1KNP A;  3RP6 A;  3KA7 A;  4H2Q A;  2C4C A;  3ALJ A;  1E1N A;  1TDO A;  3GYJ A;  4FDC B;  2XVJ A;  3DA1 A;  1KDG A;  1CHU A;  3GMB A;  3AE8 A;  4BK2 A;  5CKU A;  4C74 A;  1HYU A;  3UKL A;  4J31 A;  2WDR A;  3AE5 A;  3ICT A;  1LPF A;  4NZH A;  4GRT A;  1Y56 B;  4KX6 A;  1ZX9 A;  2GAH B;  2GR2 A;  4CCQ A;  1UKV G;  2YLZ A;  3SFD A;  3NTD A;  3CGD A;  3OC4 A;  1KN0 A;  4CCR A;  3LZW A;  5C2T A;  3UOZ A;  1ZKQ A;  4NTE A;  3B3R A;  3NN0 X;  1PXA A;  5CQF A;  4RSL A;  4YSZ A;  3ATQ A;  1S2Y A;  2XFO A;  2C65 A;  3OZ2 A;  3UTH A;  4K7Z A;  5HXI A;  1KSS A;  2UZZ A;  1LQT A;  4NWZ A;  4CY8 A;  1H81 A;  3CTY A;  4YSY A;  4XWR A;  4A9W A;  2GAG B;  3AED A;  3UP4 A;  4AOX A;  1IUW A;  1JNZ A;  4Z25 A;  1L9E A;  2BXR A;  3T2Z A;  3IHG A;  4DGK A;  1E7P A;  1Q9I A;  3RED A;  3T14 A;  3FPZ A;  1SEZ A;  2XLP A;  1LTX R;  3F8R A;  3DME A;  3KPK A;  4IV9 A;  2V3A A;  2WBA A;  1GAL A;  1QO8 A;  4HA6 A;  4K5R A;  2YG7 A;  4OPL A;  2VOU A;  5KMP A;  2YG6 A;  4Z24 A;  3GD3 A;  2XFU A;  1B8S A;  4KPR A;  4AT0 A;  5BVA A;  3DH9 A;  2GEW A;  4XXG A;  3NKS A;  2I0Z A;  3LOV A;  5GRT A;  2ZZ0 A;  1M6I A;  3UKP A;  1Q1W A;  4YT0 A;  4JDR A;  3NK1 X;  1N4W A;  2C70 A;  1JU2 A;  4J33 A;  2WP5 A;  2Q0L A;  2V5Z A;  1GRB A;  1E39 A;  5HYM A;  1JRZ A;  4C5O A;  4Z2U A;  3DK9 A;  2WET A;  2E4G A;  3GDP A;  4LU6 A;  4UDQ A;  4XWZ A;  3VRB A;  4A65 A;  2WU2 A;  3UP5 A;  3AE3 A;  4A7A A;  2BC0 A;  1KSU A;  3HYV A;  5KOW A;  1KFY A;  2C66 A;  4EMI A;  3AEB A;  1L9C A;  2ZBW A;  1Y0P A;  1XDI A;  2GVC A;  1YQ3 A;  2NPX A;  1DXL A;  4LII A;  1EL5 A;  4APN A;  1REO A;  2R0C A;  4U8L A;  3BI4 A;  1L9D A;  2XVH A;  5FMH A;  1M64 A;  2XYO A;  1H84 A;  3CN8 A;  1D4C A;  2R45 A;  3NH3 X;  2B9W A;  2HQM A;  2AAQ A;  3RNM A;  2WQY A;  3K7T A;  3NLC A;  2X8H A;  3DGZ A;  3AYJ A;  4NNJ A;  1MOK A;  5FS8 A;  4YWO A;  2VVL G;  3UKQ A;  4H4V A;  1PN0 A;  5IQ1 A;  2Q7V A;  3CND A;  3AEA A;  5KOX A;  1NPX A;  1IUX A;  4YKG A;  1CBO A;  2YG5 A;  4H4R A;  3ICR A;  5KMS A;  1MXT A;  3PO7 A;  3BHK A;  3RP8 A;  3FBS A;  3S61 A;  5KVH A;  1FL2 A;  3B6D A;  3AEG A;  4GDP A;  1IUU A;  4TM3 A;  4C77 A;  5KWF A;  4YSX A;  3JSK A;  2GQW A;  4JNQ A;  5KRQ A;  3EF6 A;  3SQP A;  4U8P A;  3SFE A;  3V76 A;  2EQ8 A;  3GMC A;  1PBC A;  4G74 A;  4HB9 A;  1D4D A;  3CNT A;  3Q9T A;  4U2S A;  3G5R A;  1TDK A;  2BCP A;  3AE9 A;  3NGC X;  4BK1 A;  3DK8 A;  2E1M A;  3DJJ A;  4EM4 A;  2JBV A;  2OAL A;  1B5Q A;  2BRY A;  3M12 A;  2XVF A;  2EQ9 A;  3NK2 X;  2J3N A;  4B65 A;  1L0V A;  2ACZ A;  2VZ2 A;  1FEB A;  3NHO X;  4YKF A;  3GDN A;  1PXC A;  1ZY8 A;  1ZMC A;  3H4K A;  4NEV A;  2WS3 A;  3GYI A;  5EB4 A;  1OJT A;  2B9Y A;  4ZCD A;  4MJW A;  2X99 A;  3LB8 A;  2GF3 A;  2C3D A;  3NK0 X;  1H82 A;  3NYC A;  2FJD A;  4GUV A;  3R9U A;  2GR0 A;  2B76 A;  3D1C A;  5FS6 A;  2JB3 A;  1VG9 A;  1GER A;  4IA5 A;  2GRT A;  1PBD A;  1O95 A;  1GXF A;  4H4Q A;  2XFP A;  4USR A;  4WCT A;  5J60 A;  4J36 A;  4Z44 A;  2VQB A;  4II3 A;  2BYB A;  3SZC A;  4CNK A;  1EL9 A;  1F8R A;  2GH5 A;  3LZX A;  2YG4 A;  3S5W A;  4H4T A;  4X9N A;  2C76 A;  4OPU A;  2YLW A;  3DGH A;  1GRH A;  3ABV A;  2XLS A;  4JY3 A;  2V6O A;  2H89 A;  2GMJ A;  2XVI A;  2VRM A;  4J2W A;  4UP3 A;  1H6V A;  1H83 A;  2YG3 A;  5JCM A;  5BRT A;  3AB1 A;  4C3Y A;  3M13 A;  2JB2 A;  4D03 A;  2VVL A;  5FS7 A;  2CUL A;  4U8J A;  3EPT A;  1AOG A;  2YM2 A;  4H2R A;  4Y4L A;  1GND A;  2WOW A;  1EBD A;  4I58 A;  4CBQ A;  4U8I A;  4DSH A;  1QLB A;  2CDU A;  1NDA A;  2CFY A;  2ZZC A;  2YWL A;  5M10 A;  1LV0 A;  1X31 B;  2Z5Y A;  3T2Y A;  3AE7 A;  1FEA A;  4EQR A;  1P2E A;  3CGE A;  1GEU A;  4B64 A;  1K0J A;  4IA6 A;  1N4U A;  4OPG A;  3AEC A;  3AEF A;  4YTM A;  4FX9 A;  1GRA A;  1ZK7 A;  4YTN A;  4DSG A;  1CC4 A;  3SZW A;  4RG3 A;  5KXJ A;  1NG3 A;  4OPT A;  4DNA A;  1NHR A;  3EAO A;  1N1P A;  1GRT A;  3ICS A;  1JRY A;  3F8D A;  4WX1 A;  1YQZ A;  1NEN A;  1S3B A;  4JNA A;  4TM4 A;  4EQW A;  2A8X A;  3BNM A;  5U63 A;  4JQ9 A;  1H7W A;  4Z2T A;  4BUR A;  3GRS A;  4H50 A;  4NTD A;  4H2P A;  1CJ2 A;  2FJB A;  4U8N A;  5L46 A;  4G6G A;  2YM1 A;  3ITJ A;  4K22 A;  4Z2R A;  4OPI A;  1EL8 A;  5IPY A;  3VRA A;  1Z6L A;  1GT8 A;  4G73 A;  1ONF A;  5JCI A;  3NN6 X;  4X4J A;  1E6E A;  5ER0 A;  1CL0 A;  1NAA A;  1OJ9 A;  3FMW A;  3SZ0 A;  4AP1 A;  2TPR A;  1O5W A;  4GAP A;  4TM0 A;  4UDP A;  3CPH G;  3UKK A;  3DJE A;  2R4E A;  2V3B A;  3AE1 A;  5EOW A;  2IVD A;  1GPE A;  2WOV A;  4J57 A;  2CVJ A;  2RAB A;  3QFB A;  1OJC A;  1VQW A;  1GRF A;  2FJA A;  2R4J A;  3P4S A;  2YLX A;  2WP9 A;  2TMD A;  2Z5X A;  4O5U A;  2JKC A;  1BGN A;  4TLX A;  3ALL A;  2X50 A;  1F8S A;  3H8I A;  2V60 A;  3CNS A;  1PJ6 A;  1B4V A;  3G5Q A;  3QVR A;  4H4P A;  1ZDL A;  2XFN A;  2BXS A;  2RGJ A;  2WP6 A;  2WU5 A;  2BK3 A;  4EM3 A;  1GRE A;  1FEC A;  1ZOY A;  1NG4 A;  1GOS A;  2C75 A;  4BJZ A;  1GV4 A;  3D8X A;  5BUL A;  3D9X A;  2H88 A;  3I3L A;  3IHM A;  4U2T A;  3UKH A;  2Q6U A;  3GWF A;  3CGC A;  3NTA A;  3C96 A;  3IC9 A;  1CJ4 A;  4U8O A;  5EB5 A;  1KF6 A;  3UTG A;  2VVM A;  3SX6 A;  3ALM A;  5BUK A;  1S7M A;  3CPJ G;  3GD4 A;  2YR6 A;  2YLT A;  2YR5 A;  5M0Z A;  1JRX A;  4B68 A;  2OLN A;  2GQF A;  3FIM B;  1H2I A;  2WPE A;  1BKW A;  1NEK A;  2BAC A;  1ZOV A;  4H4S A;  2QA2 A;  3HYX A;  3G5S A;  3NIX A;  3VR8 A;  4NEW A;  4CNJ A;  5KNL A;  1E1K A;  3EAN A;  5JRB A;  2OAM A;  2XVE A;  1LQU A;  1IJH A;  1QJD A;  4H4Z A;  2FJE A;  3C4A A;  3L1R A;  5HHF A;  3BNU A;  3QSE A;  1COY A;  2A89 A;  1TDE A;  3CNP A;  4PAB A;  5JCK A;  1E1M A;  2RGO A;  2YQU A;  1K0I A;  3ATR A;  3NG7 X;  4CRT A;  1JOA A;  3HYW A;  2X8G A;  2V61 A;  2XLU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...