5JCLA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
432
structure length
429
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPAPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFYSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Oxidoreductase
total genus 136
structure length 429
sequence length 432
chains with identical sequence B
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jclA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jclA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jclA02
3NKSA 3KPFA 4GDPA 4MJWA 5BUKA 3CNPA 5GRTA 1JNZA 3AECA 3NLCA 1QLBA 1VQWA 1O95A 2ARDA 2WQYA 4Z2UA 2J3NA 4USQA 4A6NB 2X8GA 5U1OA 4A5LA 2B9YA 1PBEA 4GUVA 4XWZA 2GEWA 3ICTA 4TM0A 4YTMA 1CC4A 3C4AA 3LJPA 2WDVA 3KVEA 1FL2A 2GVCA 5KWFA 4IVOB 2A8XA 3GSIA 1DODA 1B5QA 3K7MX 3QJ4A 3GYJA 3UOVA 4U8IA 4AOXA 4YTNA 1RYIA 1P2EA 2CVJA 2R4JA 1QJDA 2NPXA 3CPHG 3NK0X 4C5OA 5CQFA 2WETA 2CFYA 1NG4A 2FJBA 1NHRA 2XVEA 4GF7A 2C73A 1GREA 2WP5A 1LQUA 2WEUA 2XDOA 2XFOA 1H86A 1IJHA 3ISHA 4OPCA 4I58A 1NPXA 1ONFA 1OJDA 2OAMA 1L0VA 1F3PA 1GRAA 4Y4NA 4EIQA 4H2QA 4U8NA 1O94A 5C2TA 1PBCA 5GSNA 2V3AA 2AAQA 4OVIA 2A89A 3ALMA 2XVFA 3V3NA 1IUXA 1KDGA 1PJ6A 1N1PA 5KVHA 3AD8B 3DGHA 2GV8A 4KX6A 2JKCA 2WS3A 5EBKA 5FS7A 5LV9A 3QSEA 2O9ZA 2X8CA 2Q7VA 2FJDA 2V61A 3AYJA 4UDPA 5HHFA 4Z2RA 5HY5A 1O5WA 4M52A 4WCTA 4Z2TA 5FS6A 2VVMA 4NTDA 3KD9A 4U2LA 1IUSA 3BI2A 3IHGA 2CDUA 2WBAA 1PXAA 2VRMA 2R0PA 4FK1A 4OPDA 1GSNA 1NEKA 2AR8A 3IHMA 4CY6A 3RNMA 1NG3A 4H4ZA 5EB4A 1ZOVA 3BNUA 4O5UA 4H4YA 2XLSA 3F8PA 4C3XA 2WOWA 2V60A 2YLRA 2VQBA 4ADWA 1B37A 4X4JA 1XDIA 1CBOA 4PAAA 4OCGA 4OPGA 2GR0A 1N4VA 3UKPA 1DJQA 3QSSA 1D7LA 5L46A 1L9CA 1GEUA 1XPQA 3AD7B 3IC9A 1EBDA 2YLWA 5U25A 2Q6UA 3CTYA 3P4PA 2CULA 4A6NA 1Y0PA 1S2QA 4EMJA 4A7AA 1DOBA 3AE1A 4CBQA 2NVKX 4J56A 4D04A 4U8MA 1E6EA 1LJ1A 4ECHA 4Z26A 1KNPA 2XFNA 2R4EA 3LB8A 2C72A 1N4WA 3LZXA 1VRQB 4O5QA 1OJ9A 2WPEA 3NRNA 4P9SA 1GRHA 3P1WA 3UKHA 2RGHA 1BKWA 2BXSA 5HXIA 1LQTA 1ZMCA 1BF3A 1JNRA 1TDNA 1Y56B 3I3LA 3SGLA 3DK8A 3ZDNA 2B9WA 4EQXA 2EQ7A 1D4CA 3DJEA 3GD3A 2WPCA 4U8LA 4H50A 1OJAA 5J7XA 3UOYA 3AEAA 2BK4A 4H2PA 3EANA 4Z44A 3F8RA 5J60A 1DXLA 1LTXR 2RGOA 4A99A 3UTHA 4J34A 4H2RA 4KPRA 2H89A 4TLZA 2X99A 4FDCB 5FMHA 2WU5A 3K7TA 4EMWA 1TDEA 1ZK7A 4RG4A 4XXGA 4AT2A 4NEWA 3NG7X 3P9UA 5CKUA 1BWCA 2X3NA 1XANA 3BHFA 4JDRA 5BRTA 1Q1WA 2JK6A 3ALLA 4YTPA 4H7UA 3G5QA 3G5RA 4AP3A 2VVLG 3AEDA 4OPIA 2YLZA 3D1CA 4J2WA 2YVFA 3SFEA 4CNJA 3AB1A 3NT6A 4IV9A 2GR3A 2B9XA 3CNTA 1GV4A 3CGEA 4EM3A 3ALJA 2ZZ0A 4GDEA 3UKFA 1FCDA 4ZCDA 1SEZA 2YLSA 1S2YA 4NEVA 2VVLA 3COXA 4AT0A 1FECA 4B64A 3EAOA 1NENA 3CPIG 4H4PA 1LV0A 4JNAA 2XVHA 4YWOA 4HB9A 1MXTA 4CCQA 3NN6X 3UKQA 3DH9A 5BULA 3GRSA 1H82A 3NHOX 2WP9A 1D4DA 1YQ4A 4OPUA 4H4QA 3GWFA 2JB3A 2BK3A 2BC1A 1D7YA 4GR1A 2WPFA 3K7QX 4BURA 3NYEA 1CJ2A 3UTFA 3VQRA 4B65A 4BV6A 1AOGA 1EL8A 2YLXA 3M0OA 1YQ3A 2BS2A 4J36A 1YKJA 3NGCX 3PVCA 4DSGA 3AEEA 3OZ2A 1YQZA 3VR8A 2IIDA 3AWIA 3CPJG 2YG6A 2C3CA 1E1KA 1H7XA 2YWLA 2JB2A 2WOVA 3AE2A 5IQ4A 4Y4MA 2X8HA 3GD4A 2C66A 4NZHA 4YKFA 4TM1A 2AQJA 2C75A 1Y56A 3E1TA 3CIRA 4BK2A 3R9UA 2XLPA 3EF6A 2B76A 1ZP0A 3F8DA 1FEBA 4K7ZA 3DJDA 3PS9A 3UKKA 3KA7A 1Q9IA 2EQ6A 1P2HA 1PBBA 3VRAA 2QA1A 1GNDA 4EM4A 1H84A 2BXRA 3P4QA 4OPLA 2V3BA 1S3EA 3NYCA 3ATQA 3FIMB 3V76A 4OPTA 3NTDA 1CC2A 3ITJA 1JRYA 4CY8A 1PN0A 1BZLA 1Q1RA 4JY3A 4DSHA 1E1LA 2YVGA 1JU2A 4LU6A 2A87A 4J57A 2FJAA 3UCLA 4LIIA 1GTHA 4YXDA 3FPZA 1DOCA 3ICSA 1FOHA 2Z5YA 3H8LA 5JCKA 4CRTA 3CGDA 3ABVA 4JY2A 1GRFA 1MOKA 3CGBA 2XFQA 3K30A 4AOSA 3EPTA 3AE5A 1PXBA 4B69A 4YSXA 3II4A 1F8RA 3SM8A 1REOA 2RABA 3VRDB 5FS9A 2XLRA 3C96A 3GWDA 2Q0LA 4BK1A 3M12A 1F8WA 1NAAA 2XCGA 1ZKQA 2YM2A 1KSUA 4APNA 1CC6A 3AE4A 3M13A 3UKLA 2GB0A 2OA1A 1GERA 3VR9A 2H88A 2GMHA 3RP6A 3CNJA 5M10A 2EQ9A 3GDPA 4K5SA 4BJZA 4X9MA 1K0JA 2IVDA 1H7WA 4BK3A 2WDRA 2XVIA 5ER0A 2EQ8A 4YT0A 4Y4LA 1GPEA 1TDKA 4C77A 4EQWA 2BYBA 1JRZA 5BVAA 2VOUA 3UTEA 4J31A 4CNKA 1UKVG 1CJ3A 2BK5A 4EIPA 3QFAA 3AE8A 2C76A 1EL9A 2E4GA 1GTEA 3BHKA 2V5ZA 3NIXA 4JNQA 4A9WA 1LVLA 4C74A 4U8OA 2VRLA 2FBWA 3LOVA 1GXFA 4EQSA 2JB1A 2GRTA 4H4WA 3S61A 2W0HA 2C70A 2BS4A 2XYOA 2TPRA 4U8PA 2Q0KA 2BCPA 4D03A 2QCUA 3AEBA 3IWAA 4H4RA 4UDRA 4B1BA 1B4VA 1XHCA 1TDFA 4ICYA 3REDA 2R0GA 2YR6A 1IUVA 1DOEA 5KVIA 2F5ZA 3AYLA 3AEFA 3L8KA 3BI5A 5KOXA 3UOZA 4K5RA 1GRTA 1ZOYA 4UDQA 1E7PA 5KXJA 1TDOA 4NTEA 2R46A 3NH3X 2OALA 1TRBA 5KOWA 1BGJA 3Q6JA 1F6MA 2WHDA 2ZZBA 1RP0A 2XFUA 5C3JA 2Z5XA 1CL0A 4FX9A 2XFPA 1Z6LA 3GYIA 3AXBA 4YSHA 1TYPA 1PBDA 2YG3A 3T37A 2V6OA 1GRBA 5JCIA 3S5WA 2TMDA 1YY5A 2GQWA 2R9ZA 1NHPA 2YVJA 2RGJA 4YKGA 1GRGA 3DA1A 2BS3A 2GH5A 4Z25A 3URHA 4JQ9A 1CJCA 3AE3A 3H4KA 3QVPA 4H2NA 4E0VA 1IUUA 2WP6A 3V3OA 1ZX9A 1K0LA 2ZBWA 2QA2A 4Z43A 2YM1A 1OJCA 3UP5A 5IQ1A 1E39A 1JOAA 1JRXA 4TM3A 3RP8A 3ATRA 3LXDA 1GOSA 1K0IA 3BI4A 2PHHA 4Z24A 1F8SA 3GDNA 2WESA 1ZDLA 1PS9A 1N4UA 1PHHA 4PABA 4C3YA 5DBJA 1GT8A 2WDQA 3ICRA 2YLTA 2BACA 2XLTA 3AYIA 2FJEA 3L1RA 2YR5A 3P4SA 3DK9A 3NK2X 4A65A 4H4VA 5JCLA 2BCGG 2E5VA 4I59A 4XWRA 3AD9B 1H6VA 4DNAA 4JN9A 3WE0A 3KLJA 3CNSA 4X9NA 4LA1A 2GF3A 3QSMA 2DKHA 4REKA 4K8DA 2YQUA 4GRTA 5KRQA 1PJ7A 5EOWA 4RG3A 3OC4A 2XVJA 1GALA 3HZLA 1IUTA 3O0HA 3RP7A 4N9XA 3AE7A 2OLNA 2WOIA 3DMEA 3ZYXA 1K4QA 3AE9A 2DKIA 4K22A 4EQRA 2C67A 4BJYA 3AE6A 3D8XA 4A79A 2HQMA 1VDCA 2R45A 3B3RA 4IA5A 4J33A 1OJTA 1EL7A 3ADAB 3VRBA 4TLXA 3SFDA 4YSYA 3QFBA 4ZCCA 4U2SA 3UTGA 3G5SA 4B67A 1LPFA 3IF9A 2Y6RA 2GR1A 4B66A 3B6DA 4USRA 1MO9A 4IVMB 2YR4A 1B8SA 4RSLA 3I6DA 4FK1C 1JEHA 2Y6QA 2C7GA 5HYMA 2YG5A 1FEAA 1ZY8A 1KSSA 5IPYA 4UP3A 1M6IA 1H81A 3GMBA 2YG4A 1CJ4A 2BABA 2ACZA 2JAEA 3LADA 5TR3A 1VG0A 2GMJA 2B7SA 2OLOA 3KKJA 3CGCA 4U8JA 1BGNA 4ZN0A 1H83A 2BA9A 3DJGX 2VQ7A 3NK1X 3H8IA 1W4XA 4H4UA 2B7RA 5JCMA 4H4XA 5FS8A 2UZZA 3NN0X 3C4NA 5EB5A 2GAGB 2WU2A 1PBFA 4DGKA 1E1MA 1CHUA 1DJNA 4B63A 2VZ2A 1PJ5A 3FMWA 1L9DA 1HYUA 3GMCA 3DK4A 2GR2A 2ZZCA 5JCNA 2XLUA 1DNCA 2QAEA 4EMIA 2GAHB 2I0ZA 4U2TA 3NYFA 4H4SA 2R0CA 3DJJA 4NTCA 3SQPA 1COYA 2PYXA 3Q9TA 4YSZA 1S3BA 2E1MA 3JSKA 3GRTA 1X31B 1VG9A 1ELIA 4H4TA 2BC0A 1TYTA 4HA6A 1IUWA 1D4EA 4K2XA 4AP1A 1E1NA 3PO7A 3AEGA 3FBSA 4GCMA 1KNRA 1NHQA 2C3DA 1M64A 3BNMA 5M0ZA 5U63A 1GETA 3UP4A 2IVEA 3FG2P 4U8KA 3CNDA 3LZWA 1KFYA 4TM4A 4IA6A 1NDAA 2C65A 3KU9A 3NNEA 3RHAA 3DGZA 1QO8A 2C64A 4CCRA 1EL5A 1D5TA 2YAUA 1L9EA 3NTAA 2GQFA 1RSGA 1PXCA 3UKAA 1V59A 3CN8A 1KF6A 1NHSA 1PDHA 3UOXA 2X50A 2JBVA 1CF3A 3P4RA 4WX1A 4B68A 2APGA 1GESA 2YG7A 3QVRA 1ZMDA
chains in the Genus database with same CATH superfamily
4GDPA 3CNPA 1KKOA 3NLCA 2OQHA 1QLBA 1O95A 2ARDA 4Z2UA 2J3NA 3OTRA 4TM0A 4YTMA 4K1WA 2PS2A 2WDVA 2PPGA 5KNLA 3KVEA 5KWFA 4IVOB 1DODA 1QJDA 3NRZB 1NHRA 2XVEA 3R0KA 4GF7A 1GREA 4GAPA 1IJHA 3GO2A 1GRAA 4Y4NA 4EIQA 5BOFA 1O94A 2V3AA 2RDXA 1KDGA 5KMRA 3AD8B 3DGHA 4KX6A 3QSEA 3EKGA 2Q7VA 2V61A 3AYJA 5HY5A 2AL2B 2QQ6A 3FXGA 1KD0A 4G6GA 1MNSA 1GSNA 4M0XA 4H4ZA 1NG3A 5EB4A 3BNUA 2V60A 2VQBA 4ADWA 1X2HA 4X4JA 1CBOA 4OPGA 3UKPA 1D7LA 2Q6UA 1Y0PA 1S2QA 3SZCA 3AE1A 4J56A 1SJCA 4ECHA 1KNPA 3RO6A 3SN0A 5KMSA 4HNCA 3B9JB 1JPMA 2C72A 1N4WA 2WPEA 4P9SA 1GRHA 2XH2A 1NELA 3P1WA 3UKHA 5HXIA 1ZMCA 1BF3A 3SGLA 2B9WA 4EQXA 3TCSA 3ZVHB 2BK4A 3UTHA 4TLZA 4J34A 4KPRA 5FMHA 2WU5A 4EMWA 1ZK7A 4RG4A 4E8GA 3NG7X 3P9UA 2OZ8A 5CKUA 2AL2A 2X3NA 1XANA 5BRTA 2JK6A 3GY1A 5EU9A 3ALLA 3G5QA 2VVLG 3AEDA 3SFEA 3H12A 4ZCWA 4DYEA 2B9XA 3CGEA 3UKFA 3CXOA 4ZCDA 2YLSA 1S2YA 4NEVA 3COXA 1FECA 1LV0A 4JNAA 2QJMA 4HB9A 5BULA 3T6CA 3GWFA 2JB3A 4H1ZA 1YKJA 3PVCA 3AEEA 3OZ2A 3NZGA 3VR8A 1FO4A 3T31A 1H7XA 2ONEA 2C66A 1H2IA 3E1TA 4BK2A 1IYXA 4DHGA 3F8DA 3PS9A 3ZVHA 3KA7A 1P2HA 3STPA 1STZA 3ITJA 1JRYA 3AMZA 3DERA 4JY3A 1E1LA 4J57A 3CMMA 1WYGA 2W3RA 3ICSA 2Z5YA 5JCKA 4JY2A 4DXKA 3CGBA 3K30A 3EPTA 1PXBA 1EC7A 3N6HA 4YSXA 3SM8A 3S47A 1REOA 2RABA 5FS9A 3GWDA 1R6WA 3NVYB 1CC6A 3M13A 2GB0A 2OA1A 5M10A 2GMHA 1V97A 3PG6A 2EQ8A 1NU5A 1KCZA 3JW7A 1JRZA 2VOUA 3UTEA 4J31A 3ES8A 3BHKA 3V4BA 1VQZA 2VRLA 2GRTA 3S61A 2W0HA 4U8PA 2BCPA 2QCUA 3IWAA 1ECQA 4H4RA 5FJRA 4B1BA 1XHCA 4ICYA 3REDA 3DG3A 2YR6A 1IUVA 3BI5A 4K5RA 3TQPA 1GRTA 1P43A 4NTEA 3NH3X 3IK4A 2WHDA 3Q45A 2ZZBA 2XFUA 5C3JA 2PODA 6ENLA 4FX9A 1CL0A 1PBDA 2YG3A 2HXTA 2AL1A 1GRBA 3VDGA 4DWDA 3NXLA 4IL2A 1CJCA 3AE3A 1TE6A 3NS1B 4E0VA 1K0LA 4Z43A 1JROA 2YM1A 3SJNA 5IQ1A 1E39A 3RP8A 1K0IA 1GOSA 1F8SA 3GDNA 2WESA 1ELSA 3I6TA 3ICRA 2FJEA 4A65A 2BCGG 2E5VA 2OO6A 4GFIA 3WE0A 3KLJA 4X9NA 4LA1A 4GRTA 4G7FA 1FIQB 2XVJA 1GALA 3RP7A 1EL7A 2PP0A 3SFDA 4YSYA 3QFBA 2PGWA 4U2SA 3G5SA 1LPFA 4B66A 3I6DA 4ROPA 1FEAA 1KSSA 3DFHA 2JAEA 3LADA 1VG0A 3VA8A 4ZN0A 1N63C 1PDZA 3THUA 3NK1X 1N61C 1W4XA 5JCMA 4HYRA 3HRDC 2UZZA 3ES7A 2WU2A 5G5GB 3QLDA 1JRPA 4U2TA 5JCNA 2QAEA 3N6JA 4EMIA 3NYFA 4H4SA 2PSNA 4IHCA 4YSZA 3JSKA 3GRTA 5M0ZA 2BC0A 3SSZA 2C3DA 3RGTA 2PTWA 3FG2P 3CNDA 4IA6A 2C65A 3RHAA 4NNJA 3UKAA 2APGA 5J04A 3QVRA 4GMEA 4MJWA 3DG6A 4USQA 4A6NB 4A5LA 2B9YA 2GEWA 3A7UA 3SXIA 3OZYA 2GVCA 3K7MX 3QJ4A 3P93A 1RYIA 2NPXA 3NK0X 4C5OA 2WETA 4JN7A 1LQUA 2XFOA 2XDOA 3ISHA 4I58A 2E3TA 4H2QA 4IP4A 5C2TA 3P0WA 2A89A 1YEYA 1N1PA 3SN4A 2GV8A 2JKCA 3R10A 2WS3A 3BOXA 5FS7A 2O9ZA 2X8CA 1O5WA 4WCTA 1N62C 2XH4A 1IUSA 3IHGA 2CDUA 4DN1A 1PXAA 4OPDA 5JRBA 2R0PA 2MNRA 3VCNA 3IHMA 4CY6A 1F9CA 1ZOVA 3CT2A 3MSYA 2WOWA 3RR1A 3EEZA 3R1ZA 1XDIA 3QN3A 4KEMA 1R0MA 3UXLA 1EBDA 1RM6B 5U25A 3D46A 4A6NA 4EMJA 1DOBA 1WUEA 3T14A 1E6EA 3DDMA 3CAWA 2XFNA 2PA6A 2R4EA 4O5QA 2P0IA 3I6EA 2AKMA 2RGHA 4IT1A 2BXSA 1LQTA 1Y56B 1TDNA 3I3LA 2PTXA 2EQ7A 1D4CA 3DJEA 4H50A 3UOYA 3EANA 4Z44A 4A6GA 1DXLA 3NFUA 2X99A 1BQGA 2E5AA 3UJEA 1TDEA 3ZLFA 4NEWA 3IJQA 4MKSA 3NVVB 3OP2A 3ZVIA 4YTPA 4OPIA 2YLZA 4J2WA 3NT6A 4IV9A 1GV4A 3ALJA 3T2ZA 4C3YA 4KWSA 4K2SA 4YWOA 3NN6X 3DH9A 3GRSA 1H82A 4OPUA 4B65A 5KMPA 1CJ2A 3UTFA 2OZTA 4G73A 4J1OA 4MGGA 2IIDA 2JB2A 5IQ4A 4Y4MA 2X8HA 4YKFA 1Y56A 3CIRA 1ZP0A 4J3ZA 4K7ZA 3TJ4A 1PBBA 1GNDA 3P4QA 2V3BA 3K1GA 4OPTA 3OPSA 3NTDA 1CC2A 4CY8A 1PN0A 1BZLA 4DSHA 3GC2A 2YVGA 3FYYA 3UCLA 1GTHA 4YXDA 3FPZA 3ABVA 4G6HA 3ZLGA 1FHVA 3IJIA 5FJPA 1W6TA 5IDZA 2YM2A 1KSUA 3AE4A 3HW2A 3CNJA 4A35A 3GDPA 3NVWB 1K0JA 2IVDA 1JCTA 2WDRA 3R25A 1PDYA 4Y4LA 1TDKA 3PWIA 4C77A 3I4KA 5BVAA 4CNKA 1CJ3A 3AE8A 4H2HA 1GTEA 1T3QC 4JNQA 1GXFA 2P8CA 3TWAA 2Q0KA 4M6UA 4UDRA 3V5CA 1TDFA 1EBGA 3UOZA 1E7PA 3T0KA 3FCPA 2P8BA 1TRBA 5KOWA 1BGJA 3Q6JA 3GD6A 2Z5XA 2XFPA 5G5HB 1TYPA 3T37A 1XPYA 1SB3B 5JCIA 4II2A 3S5WA 2TMDA 2R9ZA 3HYVA 1OEPA 3UJFA 2BS3A 2GH5A 5ENLA 3URHA 4JQ9A 3H4KA 4MMWA 4H2NA 1IUUA 3V3OA 1ZX9A 3D47A 2ZBWA 2QA2A 1OJCA 3UP5A 1JOAA 4TM3A 3ZLHA 3H8AA 3ATRA 4Z24A 1GT8A 4KPLA 1FFVC 3P4SA 3Q4DA 2YR5A 3NK2X 4H4VA 5JCLA 3U4FA 4JN9A 3CNSA 4ENLA 3QSMA 2YQUA 1MUCA 2PTZA 1IUTA 2WOIA 3ZYXA 1K4QA 2QJNA 2C67A 1MDLA 1KN0A 2DW6A 4IA5A 3VRBA 1OJTA 3HYWA 3UTGA 3IF9A 4IVMB 1EC8A 5IPYA 1M6IA 1H81A 3GMBA 2YG4A 1CJ4A 3KKJA 2ACZA 5TR3A 2XGZA 2B7SA 2OLOA 2GMJA 3OZMA 2PGEA 5FS8A 3NN0X 3C4NA 5EB5A 4B63A 2GGJA 3FMWA 1DNCA 2OFJA 3SQPA 4LU6A 4K2XA 1D4EA 3AEGA 1KNRA 3BNMA 5U63A 3DESA 1KFYA 3DEQA 4HPNA 3DGZA 2C64A 1D5TA 1L9EA 3NTAA 1PXCA 1PDHA 1CF3A 4WX1A 4B68A 1GESA 1N4VA 3NKSA 3VFCA 2ZC8A 5GRTA 1JNZA 3HPFA 1VQWA 2O56A 3N4FA 3ETRB 4JHMA 1PBEA 3T8QA 1FL2A 4GISA 2A8XA 3GSIA 3UOVA 4YTNA 4U8IA 2R4JA 3CPHG 2XH0A 5CQFA 1NG4A 2C73A 2WP5A 2WEUA 1H86A 7ENLA 1OJDA 3A7RA 1F3PA 2HXUA 3H70A 4U8NA 2OQYA 3FJ4A 4OVIA 3V3NA 2XVFA 3IJLA 1DTNA 4Z2RA 4UDPA 5HHFA 4HNLA 1JPDX 4M52A 1FHUA 3MQTA 4Z2TA 2VVMA 4NTDA 4U2LA 3BI2A 4A3RA 2WBAA 4FK1A 2AR8A 1NEKA 3RNMA 4O5UA 3F8PA 4E6MA 4OCGA 5L46A 1GEUA 1XPQA 3AD7B 3IC9A 2YLWA 3CTYA 3P4PA 2CULA 4DX3A 4CBQA 4D04A 4G8TA 4Z26A 3SZ0A 1VRQB 2XSXA 3PK7A 3NRNA 2PP3A 4HCDA 2HZGA 3ENLA 1BKWA 2W54A 4G9KA 3DK8A 2GSHA 2PU1A 1OJAA 5J7XA 3AEAA 2H89A 3B97A 1JDFA 4GGHA 1BWCA 3BHFA 4JDRA 4H7UA 2GL5A 2OVLA 3G5RA 2YVFA 4CNJA 3AB1A 2GR3A 4EM3A 2ZZ0A 1EBHA 3QPEA 1FCDA 1SEZA 4AT0A 4B64A 3CPIG 4H4PA 2XVHA 2GGGA 1MXTA 2WP9A 3EUB3 2PU0A 3AM9A 1D7YA 3K7QX 2WPFA 3SR6B 4BV6A 1AOGA 3UCCA 2YLXA 3R11A 3M0OA 1YQ3A 4J36A 1YQZA 3AWIA 3CPJG 4GIRA 2C3CA 1E1KA 2YWLA 4HCHA 2QVHA 4NZHA 4TM1A 3UXKA 2C75A 3R9UA 1SJBA 2XLPA 2OLAA 1FEBA 1N5XA 3DJDA 3CXBA 3VRAA 2QA1A 2BXRA 4OPLA 4K8GA 3NYCA 3ATQA 3UGVA 3JVAA 1Q1RA 2A87A 3NO1A 4LIIA 1RVKA 3H8LA 4CRTA 2OKTA 2QDDA 2GGIA 3SQSA 1GRFA 1MOKA 4AOSA 3UJ2A 4Z1YA 3VRDB 1N60C 4BK1A 3M12A 1NAAA 1ZKQA 3VR9A 3UKLA 3DG7A 3RP6A 2EQ9A 4K5SA 4BJZA 1H7WA 2XVIA 2OX4A 4YT0A 2CHRA 1GPEA 3N4EA 2OZ3A 3RRAA 4EIPA 1EL9A 2FKPA 4A9WA 3S5SA 1LVLA 4C74A 2QGYA 1TKKA 2JB1A 2BS4A 2XYOA 3SBFA 1ONEA 4IL0A 2R0GA 3KUMA 5KVIA 2F5ZA 3L8KA 1ZOYA 5KXJA 1TDOA 1P48A 3TOYA 1F6MA 1RP0A 2GGHA 3GYIA 3AXBA 1YY5A 3SY4A 2GQWA 1NHPA 2RGJA 2POZA 3QVPA 2WP6A 1JRXA 3D9XA 2PHHA 4PABA 2QDEA 1N4UA 2BACA 3AYIA 3DK9A 3MUCA 4FI4A 3P3BA 4Z17A 4K8DA 5KRQA 2OG9A 5FJTA 3DMEA 3AE9A 2DKIA 2BRAA 3AE6A 1VDCA 2R45A 3B3RA 4J33A 3ADAB 3AN1A 4ZCCA 4B67A 2YR4A 4RSLA 4FK1C 2Y6QA 5HYMA 2YG5A 1ZY8A 3NVZB 3PFRA 4IP5A 1BGNA 3CYJA 4HN8A 2BA9A 3DJGX 2VQ7A 3H8IA 2XH7A 4H4UA 2B7RA 2PP1A 4ZOHB 3V3WA 4EWJA 1DJNA 1CHUA 2VZ2A 1PJ5A 1HYUA 2XLUA 2GR2A 2GAHB 2I0ZA 2R0CA 4NTCA 3JZUA 4TVYA 2PYXA 2BRYA 3UJRA 4HA6A 4XWRA 1VG9A 1ELIA 4DSGA 1E1NA 3PO7A 3FBSA 3BJSA 3UP4A 3L5OA 3DIPA 3U9IA 4CCRA 1EL5A 2YAUA 3CB3A 1RSGA 3UOXA 3CN8A 1NHSA 2X50A 3T9PA 3P4RA 1MDRA 3R07C 2PMQA 3KPFA 3CK5A 2P88A 3DFYA 5BUKA 3AECA 4HCLA 2WQYA 2X8GA 5U1OA 4GUVA 4XWZA 3ICTA 1CC4A 3C4AA 3LJPA 1N5WC 1VDVA 1B5QA 3GYJA 4AOXA 3T2YA 1P2EA 2CVJA 4GGBA 3FVDA 2CFYA 2DW7A 2FJBA 4OPCA 3V5FA 1NPXA 1ONFA 2OAMA 1L0VA 4ZA0A 1PBCA 5GSNA 2AAQA 3ALMA 1IUXA 1PJ6A 5KVHA 5EBKA 5LV9A 2FJDA 3MKCA 1ZXIC 2GDQA 5FS6A 3KD9A 2W55A 2VRMA 4H4YA 2XLSA 4C3XA 2YLRA 4E4FA 1B37A 4PAAA 2PCEA 2GR0A 2MUCA 1DJQA 3QSSA 1L9CA 1SJDA 4GYPA 3T4WA 4E4UA 4A7AA 2NVKX 2NQLA 4U8MA 1LJ1A 5BOEA 3T2KA 3LB8A 2HNEA 3LZXA 1OJ9A 4H83A 3VCCA 3HYXA 1JNRA 3TW9A 3ZDNA 3GD3A 3H7VA 2WPCA 4U8LA 5KMQA 4H2PA 3UJSA 3TWBA 3F8RA 5J60A 3TTEA 2RGOA 1LTXR 4A99A 4H2RA 3RCYA 4FDCB 3K7TA 3OW1A 4XXGA 4AT2A 4X2PA 1Q1WA 2PTYA 2I5QA 4AP3A 3UCDA 4E5TA 3D1CA 3CNTA 4GDEA 2VVLA 3EAOA 1NENA 4NWZA 2FYMA 4CCQA 3UKQA 3NHOX 1D4DA 1YQ4A 4H4QA 2BK3A 2BC1A 4GR1A 3NYEA 4BURA 3VQRA 2ZADA 1EL8A 3MZNA 2BS2A 3NGCX 2YG6A 2WOVA 3FV9A 3AE2A 2C4CA 3GD4A 4TVWA 2AQJA 3EF6A 2B76A 3UKKA 1Q9IA 2EQ6A 1L8PA 4EM4A 1H84A 3R0UA 3MWCA 1S3EA 3VC5A 3FIMB 3V76A 3BSMA 1JU2A 2FJAA 1EC9A 4FP1A 1DOCA 1FOHA 3CGDA 3GYXA 2W3SA 2XFQA 1TZZA 3AE5A 4B69A 3II4A 1F8RA 2XLRA 3C96A 2Q0LA 1F8WA 2XCGA 4APNA 1GERA 2H88A 4X9MA 4BK3A 5ER0A 3TJIA 4EQWA 2BYBA 1FFUC 1UKVG 2BK5A 3QFAA 2C76A 2E4GA 2V5ZA 3NIXA 4U8OA 2FBWA 3LOVA 4EQSA 4H4WA 2C70A 4F4RA 2TPRA 4D03A 3SZFA 3AEBA 1B4VA 5FJUA 1DOEA 3AYLA 3AEFA 1E9IA 5KOXA 4UDQA 4YWSA 2R46A 2OALA 1Z6LA 4YSHA 2V6OA 2YVJA 4YKGA 1MRAA 1GRGA 3DA1A 2GGEA 4Z25A 4II3A 3QTPA 2AKZA 3SX6A 3LXDA 4G74A 3BI4A 1ZDLA 1PS9A 1PHHA 5DBJA 2WDQA 2YLTA 2XLTA 3L1RA 4I59A 3AD9B 1H6VA 4DNAA 2GF3A 2DKHA 4REKA 4H19A 1BKHA 1PJ7A 1WUFA 5EOWA 4RG3A 3OC4A 3HZLA 3O0HA 4N9XA 3AE7A 2OLNA 4JN8A 3SN1A 1S7MA 3QKEA 3VC6A 4K22A 3A7AA 4EQRA 4BJYA 3D8XA 4A79A 2HQMA 3KPKA 4TLXA 2Y6RA 2GR1A 1XS2A 3RITA 3B6DA 4USRA 1MO9A 1B8SA 3SZWA 1JEHA 2C7GA 4UP3A 2BABA 4U8JA 3CGCA 1H83A 4KT2A 2QJJA 1KKRA 4H4XA 1X2GA 2GAGB 3DGBA 3MY9A 4GYPC 3SYIA 1PBFA 4DGKA 1E1MA 1L9DA 3GMCA 3DK4A 2ZZCA 5FJOA 3DJJA 1COYA 3Q9TA 1S3BA 2E1MA 1X31B 4H4TA 4AP1A 1TYTA 1IUWA 4GCMA 2OPJA 1NHQA 1M64A 1GETA 4IZGA 2IVEA 2P3ZA 4U8KA 3LZWA 4TM4A 1NDAA 3PWGA 3KU9A 3NNEA 1QO8A 4GAVA 1SJAA 2GQFA 1V59A 1KF6A 2JBVA 2YG7A 1ZMDA
chains in the Genus database with same CATH topology
3NKSA 3KPFA 4GDPA 4MJWA 5BUKA 3CNPA 5GRTA 1JNZA 3AECA 3NLCA 1QLBA 1VQWA 1O95A 2ARDA 2WQYA 4Z2UA 2J3NA 4USQA 4A6NB 2X8GA 5U1OA 4A5LA 2B9YA 1PBEA 4GUVA 4XWZA 2GEWA 3ICTA 4TM0A 4YTMA 3SXIA 1CC4A 3C4AA 3LJPA 2WDVA 5KNLA 3KVEA 1FL2A 2GVCA 5KWFA 4IVOB 2A8XA 3GSIA 1DODA 1B5QA 3K7MX 3QJ4A 3GYJA 3UOVA 4U8IA 4AOXA 4YTNA 1RYIA 3T2YA 1P2EA 2CVJA 2R4JA 1QJDA 2NPXA 3CPHG 3NK0X 4C5OA 5CQFA 2WETA 2CFYA 1NG4A 2FJBA 1NHRA 2XVEA 4GF7A 2C73A 1GREA 2WP5A 1LQUA 2WEUA 2XDOA 2XFOA 4GAPA 1H86A 1IJHA 3ISHA 4OPCA 4I58A 1NPXA 1ONFA 1OJDA 2OAMA 1L0VA 1F3PA 1GRAA 4Y4NA 4EIQA 4H2QA 4U8NA 1O94A 5C2TA 1PBCA 5GSNA 2V3AA 2AAQA 4OVIA 2A89A 3ALMA 2XVFA 3V3NA 1IUXA 1KDGA 1PJ6A 5KMRA 1N1PA 5KVHA 3AD8B 3DGHA 2GV8A 4KX6A 2JKCA 2WS3A 5EBKA 5FS7A 5LV9A 3QSEA 2O9ZA 2X8CA 2Q7VA 2FJDA 2V61A 3AYJA 4UDPA 5HHFA 4Z2RA 5HY5A 1O5WA 4M52A 4WCTA 4Z2TA 5FS6A 2VVMA 4NTDA 4G6GA 3KD9A 4U2LA 1IUSA 3BI2A 3IHGA 2CDUA 2WBAA 1PXAA 2VRMA 5JRBA 2R0PA 4FK1A 4OPDA 1GSNA 1NEKA 2AR8A 3IHMA 4CY6A 3RNMA 1NG3A 4H4ZA 5EB4A 1ZOVA 3BNUA 4O5UA 4H4YA 2XLSA 3F8PA 4C3XA 2WOWA 2V60A 2YLRA 2VQBA 4ADWA 1B37A 4X4JA 1XDIA 1CBOA 4PAAA 4OCGA 4OPGA 2GR0A 1N4VA 3UKPA 1DJQA 3QSSA 1D7LA 5L46A 1L9CA 1GEUA 1XPQA 3AD7B 3IC9A 1EBDA 2YLWA 5U25A 2Q6UA 3CTYA 3P4PA 2CULA 4A6NA 1Y0PA 1S2QA 4EMJA 3SZCA 4A7AA 1DOBA 3AE1A 4CBQA 2NVKX 4J56A 3T14A 4U8MA 4D04A 1E6EA 1LJ1A 4ECHA 4Z26A 1KNPA 2XFNA 3SZ0A 3T2KA 5KMSA 2R4EA 3LB8A 2C72A 1N4WA 3LZXA 1VRQB 4O5QA 1OJ9A 2WPEA 3NRNA 4P9SA 1GRHA 3HYXA 3P1WA 3UKHA 2RGHA 1BKWA 2BXSA 5HXIA 1LQTA 1ZMCA 1BF3A 1JNRA 1TDNA 1Y56B 3I3LA 4G9KA 3SGLA 3DK8A 3ZDNA 2B9WA 4EQXA 2EQ7A 1D4CA 3DJEA 3GD3A 2WPCA 4U8LA 4H50A 1OJAA 3VRBA 5J7XA 5KMQA 3AEAA 2BK4A 4H2PA 3EANA 3UOYA 4Z44A 3F8RA 5J60A 1DXLA 1LTXR 2RGOA 4A99A 3UTHA 4J34A 4H2RA 4KPRA 2H89A 4TLZA 2X99A 4FDCB 5FMHA 2WU5A 3K7TA 4EMWA 1TDEA 1ZK7A 4RG4A 4XXGA 4AT2A 4NEWA 3NG7X 3P9UA 5CKUA 1BWCA 2X3NA 1XANA 3BHFA 4JDRA 5BRTA 1Q1WA 2JK6A 3ALLA 4YTPA 4H7UA 3G5QA 3G5RA 4AP3A 2VVLG 3AEDA 4OPIA 2YLZA 3D1CA 4J2WA 2YVFA 3SFEA 4CNJA 3AB1A 3NT6A 4IV9A 2GR3A 2B9XA 3CNTA 1GV4A 3CGEA 4EM3A 3ALJA 2ZZ0A 4GDEA 3UKFA 3T2ZA 1FCDA 4ZCDA 1SEZA 2YLSA 1S2YA 4NEVA 2VVLA 3COXA 4AT0A 1FECA 4B64A 3EAOA 1NENA 3CPIG 4H4PA 1LV0A 4NWZA 4JNAA 2XVHA 4YWOA 4HB9A 1MXTA 4CCQA 3NN6X 3UKQA 3DH9A 5BULA 3GRSA 1H82A 3NHOX 2WP9A 1D4DA 1YQ4A 4OPUA 4H4QA 3GWFA 2JB3A 2BK3A 2BC1A 1D7YA 4GR1A 2WPFA 3K7QX 4BURA 3NYEA 1CJ2A 3UTFA 3VQRA 4B65A 5KMPA 4BV6A 1AOGA 1EL8A 2YLXA 4G73A 3M0OA 1YQ3A 2BS2A 4J36A 1YKJA 3NGCX 3PVCA 4DSGA 3AEEA 3OZ2A 1YQZA 3VR8A 2IIDA 3AWIA 3CPJG 2YG6A 3T31A 2C3CA 1E1KA 1H7XA 2YWLA 2JB2A 2WOVA 3AE2A 2C4CA 5IQ4A 4Y4MA 2X8HA 3GD4A 2C66A 4NZHA 4YKFA 4TM1A 1H2IA 2AQJA 2C75A 1Y56A 3E1TA 3CIRA 4BK2A 3R9UA 2XLPA 3EF6A 2B76A 1ZP0A 3F8DA 1FEBA 4K7ZA 3DJDA 3PS9A 3UKKA 3KA7A 1Q9IA 2EQ6A 1P2HA 1PBBA 3VRAA 2QA1A 1GNDA 4EM4A 1H84A 2BXRA 3P4QA 4OPLA 2V3BA 1S3EA 3NYCA 3ATQA 3FIMB 3V76A 4OPTA 3NTDA 1CC2A 3ITJA 1JRYA 4CY8A 1PN0A 1BZLA 1Q1RA 4JY3A 4DSHA 1E1LA 2YVGA 1JU2A 4LU6A 2A87A 4J57A 2FJAA 3UCLA 4LIIA 1GTHA 3CMMA 4YXDA 3FPZA 1DOCA 3ICSA 1FOHA 2Z5YA 3H8LA 5JCKA 4CRTA 3CGDA 3ABVA 3GYXA 4JY2A 4G6HA 1GRFA 1MOKA 3CGBA 2XFQA 3K30A 4AOSA 3EPTA 3AE5A 1PXBA 4B69A 4YSXA 3II4A 1F8RA 3SM8A 1REOA 2RABA 3VRDB 5FS9A 2XLRA 3C96A 3GWDA 2Q0LA 4BK1A 3M12A 1F8WA 1NAAA 2XCGA 1ZKQA 2YM2A 1KSUA 4APNA 1CC6A 3AE4A 3M13A 3UKLA 2GB0A 2OA1A 1GERA 3VR9A 2H88A 2GMHA 3RP6A 3CNJA 5M10A 2EQ9A 3GDPA 4K5SA 4BJZA 4X9MA 3PG6A 1K0JA 1H7WA 2IVDA 4BK3A 2WDRA 2XVIA 5ER0A 2EQ8A 4YT0A 4Y4LA 1GPEA 1TDKA 4C77A 4EQWA 2BYBA 1JRZA 5BVAA 2VOUA 3UTEA 4J31A 4CNKA 1UKVG 1CJ3A 2BK5A 4EIPA 3QFAA 3AE8A 2C76A 1EL9A 2E4GA 1GTEA 3BHKA 2V5ZA 3NIXA 4JNQA 4A9WA 1LVLA 4C74A 4U8OA 2VRLA 2FBWA 3LOVA 1GXFA 4EQSA 2JB1A 2GRTA 4H4WA 3S61A 2W0HA 2C70A 2BS4A 2XYOA 2TPRA 4U8PA 2Q0KA 2BCPA 4D03A 3SZFA 2QCUA 3AEBA 3IWAA 4H4RA 4UDRA 4B1BA 1B4VA 1XHCA 1TDFA 4ICYA 3REDA 2R0GA 2YR6A 1IUVA 1DOEA 5KVIA 2F5ZA 3AYLA 3AEFA 3L8KA 3BI5A 5KOXA 3UOZA 4K5RA 1GRTA 1ZOYA 4UDQA 1E7PA 5KXJA 3T0KA 1TDOA 4NTEA 2R46A 3NH3X 2OALA 1TRBA 5KOWA 1BGJA 3Q6JA 1F6MA 2WHDA 2ZZBA 1RP0A 2XFUA 5C3JA 2Z5XA 1CL0A 4FX9A 2XFPA 1Z6LA 3GYIA 3AXBA 4YSHA 1TYPA 1PBDA 2YG3A 3T37A 2V6OA 1GRBA 5JCIA 4II2A 3S5WA 2TMDA 1YY5A 3SY4A 2GQWA 2R9ZA 1NHPA 2YVJA 3HYVA 2RGJA 4YKGA 1GRGA 3DA1A 2BS3A 2GH5A 4Z25A 3URHA 4II3A 4JQ9A 1CJCA 3AE3A 3H4KA 3QVPA 4H2NA 4E0VA 1IUUA 2WP6A 3V3OA 1ZX9A 3SX6A 1K0LA 2ZBWA 2QA2A 4Z43A 2YM1A 1OJCA 3UP5A 5IQ1A 1E39A 1JOAA 1JRXA 4TM3A 3RP8A 3ATRA 3LXDA 3D9XA 1GOSA 1K0IA 3BI4A 4G74A 2PHHA 4Z24A 1F8SA 3GDNA 2WESA 1ZDLA 1PS9A 1N4UA 1PHHA 4PABA 4C3YA 5DBJA 1GT8A 2WDQA 3ICRA 2YLTA 2BACA 2XLTA 3AYIA 2FJEA 3L1RA 2YR5A 3P4SA 3DK9A 3NK2X 4A65A 4H4VA 5JCLA 2BCGG 2E5VA 4I59A 4XWRA 3AD9B 1H6VA 4DNAA 4JN9A 3WE0A 3KLJA 3CNSA 4X9NA 4LA1A 2GF3A 3QSMA 2DKHA 4REKA 4K8DA 2YQUA 4GRTA 5KRQA 1PJ7A 5EOWA 4RG3A 3OC4A 2XVJA 1GALA 3HZLA 1IUTA 3O0HA 3RP7A 4N9XA 3AE7A 2OLNA 2WOIA 3DMEA 1S7MA 3ZYXA 1K4QA 3AE9A 2DKIA 4K22A 2BRAA 4EQRA 2C67A 4BJYA 1KN0A 3AE6A 3D8XA 4A79A 2HQMA 1VDCA 2R45A 3B3RA 4IA5A 3KPKA 1OJTA 1EL7A 3ADAB 4J33A 4TLXA 3SFDA 3HYWA 3QFBA 4ZCCA 4U2SA 3UTGA 4YSYA 3G5SA 4B67A 1LPFA 3IF9A 2Y6RA 2GR1A 4B66A 3B6DA 4USRA 1MO9A 4IVMB 2YR4A 1B8SA 3SZWA 4RSLA 3I6DA 4FK1C 1JEHA 2Y6QA 2C7GA 5HYMA 2YG5A 1FEAA 1ZY8A 1KSSA 5IPYA 4UP3A 1M6IA 1H81A 3GMBA 2YG4A 1CJ4A 2BABA 2ACZA 2JAEA 3LADA 5TR3A 1VG0A 2GMJA 2B7SA 2OLOA 3KKJA 3CGCA 4U8JA 1BGNA 4ZN0A 1H83A 2BA9A 3DJGX 2VQ7A 3NK1X 3H8IA 1W4XA 4H4UA 2B7RA 5JCMA 4H4XA 5FS8A 2UZZA 3NN0X 3C4NA 5EB5A 2GAGB 2WU2A 3SYIA 1PBFA 4DGKA 1E1MA 1CHUA 1DJNA 4B63A 2VZ2A 1PJ5A 3FMWA 1L9DA 1HYUA 3GMCA 3DK4A 2GR2A 2ZZCA 5JCNA 2XLUA 1DNCA 2QAEA 4EMIA 2GAHB 2I0ZA 4U2TA 3NYFA 4H4SA 2R0CA 3DJJA 4NTCA 3SQPA 1COYA 2PYXA 3Q9TA 2BRYA 4YSZA 1S3BA 2E1MA 3JSKA 3GRTA 1X31B 1VG9A 1ELIA 4H4TA 2BC0A 1TYTA 4HA6A 1IUWA 1D4EA 4K2XA 4AP1A 1E1NA 3PO7A 3AEGA 3FBSA 4GCMA 1KNRA 1NHQA 2C3DA 1M64A 3BNMA 5M0ZA 5U63A 1GETA 3UP4A 2IVEA 3FG2P 4U8KA 3CNDA 3LZWA 1KFYA 4TM4A 4IA6A 1NDAA 3L5OA 2C65A 3KU9A 3NNEA 3RHAA 3DGZA 1QO8A 2C64A 4CCRA 1EL5A 4NNJA 1D5TA 2YAUA 1L9EA 3NTAA 4GAVA 2GQFA 1RSGA 1PXCA 3UKAA 1V59A 3CN8A 1KF6A 1NHSA 1PDHA 3UOXA 2X50A 2JBVA 1CF3A 3P4RA 4WX1A 4B68A 2APGA 1GESA 2YG7A 3QVRA 1ZMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NKS A;  3KPF A;  4GDP A;  4MJW A;  5BUK A;  3CNP A;  5GRT A;  1JNZ A;  3AEC A;  3NLC A;  1QLB A;  1VQW A;  1O95 A;  2ARD A;  2WQY A;  4Z2U A;  2J3N A;  4USQ A;  4A6N B;  2X8G A;  5U1O A;  4A5L A;  2B9Y A;  1PBE A;  4GUV A;  4XWZ A;  2GEW A;  3ICT A;  4TM0 A;  4YTM A;  1CC4 A;  3C4A A;  3LJP A;  2WDV A;  3KVE A;  1FL2 A;  2GVC A;  5KWF A;  4IVO B;  2A8X A;  3GSI A;  1DOD A;  1B5Q A;  3K7M X;  3QJ4 A;  3GYJ A;  3UOV A;  4U8I A;  4AOX A;  4YTN A;  1RYI A;  1P2E A;  2CVJ A;  2R4J A;  1QJD A;  2NPX A;  3CPH G;  3NK0 X;  4C5O A;  5CQF A;  2WET A;  2CFY A;  1NG4 A;  2FJB A;  1NHR A;  2XVE A;  4GF7 A;  2C73 A;  1GRE A;  2WP5 A;  1LQU A;  2WEU A;  2XDO A;  2XFO A;  1H86 A;  1IJH A;  3ISH A;  4OPC A;  4I58 A;  1NPX A;  1ONF A;  1OJD A;  2OAM A;  1L0V A;  1F3P A;  1GRA A;  4Y4N A;  4EIQ A;  4H2Q A;  4U8N A;  1O94 A;  5C2T A;  1PBC A;  5GSN A;  2V3A A;  2AAQ A;  4OVI A;  2A89 A;  3ALM A;  2XVF A;  3V3N A;  1IUX A;  1KDG A;  1PJ6 A;  1N1P A;  5KVH A;  3AD8 B;  3DGH A;  2GV8 A;  4KX6 A;  2JKC A;  2WS3 A;  5EBK A;  5FS7 A;  5LV9 A;  3QSE A;  2O9Z A;  2X8C A;  2Q7V A;  2FJD A;  2V61 A;  3AYJ A;  4UDP A;  5HHF A;  4Z2R A;  5HY5 A;  1O5W A;  4M52 A;  4WCT A;  4Z2T A;  5FS6 A;  2VVM A;  4NTD A;  3KD9 A;  4U2L A;  1IUS A;  3BI2 A;  3IHG A;  2CDU A;  2WBA A;  1PXA A;  2VRM A;  2R0P A;  4FK1 A;  4OPD A;  1GSN A;  1NEK A;  2AR8 A;  3IHM A;  4CY6 A;  3RNM A;  1NG3 A;  4H4Z A;  5EB4 A;  1ZOV A;  3BNU A;  4O5U A;  4H4Y A;  2XLS A;  3F8P A;  4C3X A;  2WOW A;  2V60 A;  2YLR A;  2VQB A;  4ADW A;  1B37 A;  4X4J A;  1XDI A;  1CBO A;  4PAA A;  4OCG A;  4OPG A;  2GR0 A;  1N4V A;  3UKP A;  1DJQ A;  3QSS A;  1D7L A;  5L46 A;  1L9C A;  1GEU A;  1XPQ A;  3AD7 B;  3IC9 A;  1EBD A;  2YLW A;  5U25 A;  2Q6U A;  3CTY A;  3P4P A;  2CUL A;  4A6N A;  1Y0P A;  1S2Q A;  4EMJ A;  4A7A A;  1DOB A;  3AE1 A;  4CBQ A;  2NVK X;  4J56 A;  4D04 A;  4U8M A;  1E6E A;  1LJ1 A;  4ECH A;  4Z26 A;  1KNP A;  2XFN A;  2R4E A;  3LB8 A;  2C72 A;  1N4W A;  3LZX A;  1VRQ B;  4O5Q A;  1OJ9 A;  2WPE A;  3NRN A;  4P9S A;  1GRH A;  3P1W A;  3UKH A;  2RGH A;  1BKW A;  2BXS A;  5HXI A;  1LQT A;  1ZMC A;  1BF3 A;  1JNR A;  1TDN A;  1Y56 B;  3I3L A;  3SGL A;  3DK8 A;  3ZDN A;  2B9W A;  4EQX A;  2EQ7 A;  1D4C A;  3DJE A;  3GD3 A;  2WPC A;  4U8L A;  4H50 A;  1OJA A;  5J7X A;  3UOY A;  3AEA A;  2BK4 A;  4H2P A;  3EAN A;  4Z44 A;  3F8R A;  5J60 A;  1DXL A;  1LTX R;  2RGO A;  4A99 A;  3UTH A;  4J34 A;  4H2R A;  4KPR A;  2H89 A;  4TLZ A;  2X99 A;  4FDC B;  5FMH A;  2WU5 A;  3K7T A;  4EMW A;  1TDE A;  1ZK7 A;  4RG4 A;  4XXG A;  4AT2 A;  4NEW A;  3NG7 X;  3P9U A;  5CKU A;  1BWC A;  2X3N A;  1XAN A;  3BHF A;  4JDR A;  5BRT A;  1Q1W A;  2JK6 A;  3ALL A;  4YTP A;  4H7U A;  3G5Q A;  3G5R A;  4AP3 A;  2VVL G;  3AED A;  4OPI A;  2YLZ A;  3D1C A;  4J2W A;  2YVF A;  3SFE A;  4CNJ A;  3AB1 A;  3NT6 A;  4IV9 A;  2GR3 A;  2B9X A;  3CNT A;  1GV4 A;  3CGE A;  4EM3 A;  3ALJ A;  2ZZ0 A;  4GDE A;  3UKF A;  1FCD A;  4ZCD A;  1SEZ A;  2YLS A;  1S2Y A;  4NEV A;  2VVL A;  3COX A;  4AT0 A;  1FEC A;  4B64 A;  3EAO A;  1NEN A;  3CPI G;  4H4P A;  1LV0 A;  4JNA A;  2XVH A;  4YWO A;  4HB9 A;  1MXT A;  4CCQ A;  3NN6 X;  3UKQ A;  3DH9 A;  5BUL A;  3GRS A;  1H82 A;  3NHO X;  2WP9 A;  1D4D A;  1YQ4 A;  4OPU A;  4H4Q A;  3GWF A;  2JB3 A;  2BK3 A;  2BC1 A;  1D7Y A;  4GR1 A;  2WPF A;  3K7Q X;  4BUR A;  3NYE A;  1CJ2 A;  3UTF A;  3VQR A;  4B65 A;  4BV6 A;  1AOG A;  1EL8 A;  2YLX A;  3M0O A;  1YQ3 A;  2BS2 A;  4J36 A;  1YKJ A;  3NGC X;  3PVC A;  4DSG A;  3AEE A;  3OZ2 A;  1YQZ A;  3VR8 A;  2IID A;  3AWI A;  3CPJ G;  2YG6 A;  2C3C A;  1E1K A;  1H7X A;  2YWL A;  2JB2 A;  2WOV A;  3AE2 A;  5IQ4 A;  4Y4M A;  2X8H A;  3GD4 A;  2C66 A;  4NZH A;  4YKF A;  4TM1 A;  2AQJ A;  2C75 A;  1Y56 A;  3E1T A;  3CIR A;  4BK2 A;  3R9U A;  2XLP A;  3EF6 A;  2B76 A;  1ZP0 A;  3F8D A;  1FEB A;  4K7Z A;  3DJD A;  3PS9 A;  3UKK A;  3KA7 A;  1Q9I A;  2EQ6 A;  1P2H A;  1PBB A;  3VRA A;  2QA1 A;  1GND A;  4EM4 A;  1H84 A;  2BXR A;  3P4Q A;  4OPL A;  2V3B A;  1S3E A;  3NYC A;  3ATQ A;  3FIM B;  3V76 A;  4OPT A;  3NTD A;  1CC2 A;  3ITJ A;  1JRY A;  4CY8 A;  1PN0 A;  1BZL A;  1Q1R A;  4JY3 A;  4DSH A;  1E1L A;  2YVG A;  1JU2 A;  4LU6 A;  2A87 A;  4J57 A;  2FJA A;  3UCL A;  4LII A;  1GTH A;  4YXD A;  3FPZ A;  1DOC A;  3ICS A;  1FOH A;  2Z5Y A;  3H8L A;  5JCK A;  4CRT A;  3CGD A;  3ABV A;  4JY2 A;  1GRF A;  1MOK A;  3CGB A;  2XFQ A;  3K30 A;  4AOS A;  3EPT A;  3AE5 A;  1PXB A;  4B69 A;  4YSX A;  3II4 A;  1F8R A;  3SM8 A;  1REO A;  2RAB A;  3VRD B;  5FS9 A;  2XLR A;  3C96 A;  3GWD A;  2Q0L A;  4BK1 A;  3M12 A;  1F8W A;  1NAA A;  2XCG A;  1ZKQ A;  2YM2 A;  1KSU A;  4APN A;  1CC6 A;  3AE4 A;  3M13 A;  3UKL A;  2GB0 A;  2OA1 A;  1GER A;  3VR9 A;  2H88 A;  2GMH A;  3RP6 A;  3CNJ A;  5M10 A;  2EQ9 A;  3GDP A;  4K5S A;  4BJZ A;  4X9M A;  1K0J A;  2IVD A;  1H7W A;  4BK3 A;  2WDR A;  2XVI A;  5ER0 A;  2EQ8 A;  4YT0 A;  4Y4L A;  1GPE A;  1TDK A;  4C77 A;  4EQW A;  2BYB A;  1JRZ A;  5BVA A;  2VOU A;  3UTE A;  4J31 A;  4CNK A;  1UKV G;  1CJ3 A;  2BK5 A;  4EIP A;  3QFA A;  3AE8 A;  2C76 A;  1EL9 A;  2E4G A;  1GTE A;  3BHK A;  2V5Z A;  3NIX A;  4JNQ A;  4A9W A;  1LVL A;  4C74 A;  4U8O A;  2VRL A;  2FBW A;  3LOV A;  1GXF A;  4EQS A;  2JB1 A;  2GRT A;  4H4W A;  3S61 A;  2W0H A;  2C70 A;  2BS4 A;  2XYO A;  2TPR A;  4U8P A;  2Q0K A;  2BCP A;  4D03 A;  2QCU A;  3AEB A;  3IWA A;  4H4R A;  4UDR A;  4B1B A;  1B4V A;  1XHC A;  1TDF A;  4ICY A;  3RED A;  2R0G A;  2YR6 A;  1IUV A;  1DOE A;  5KVI A;  2F5Z A;  3AYL A;  3AEF A;  3L8K A;  3BI5 A;  5KOX A;  3UOZ A;  4K5R A;  1GRT A;  1ZOY A;  4UDQ A;  1E7P A;  5KXJ A;  1TDO A;  4NTE A;  2R46 A;  3NH3 X;  2OAL A;  1TRB A;  5KOW A;  1BGJ A;  3Q6J A;  1F6M A;  2WHD A;  2ZZB A;  1RP0 A;  2XFU A;  5C3J A;  2Z5X A;  1CL0 A;  4FX9 A;  2XFP A;  1Z6L A;  3GYI A;  3AXB A;  4YSH A;  1TYP A;  1PBD A;  2YG3 A;  3T37 A;  2V6O A;  1GRB A;  5JCI A;  3S5W A;  2TMD A;  1YY5 A;  2GQW A;  2R9Z A;  1NHP A;  2YVJ A;  2RGJ A;  4YKG A;  1GRG A;  3DA1 A;  2BS3 A;  2GH5 A;  4Z25 A;  3URH A;  4JQ9 A;  1CJC A;  3AE3 A;  3H4K A;  3QVP A;  4H2N A;  4E0V A;  1IUU A;  2WP6 A;  3V3O A;  1ZX9 A;  1K0L A;  2ZBW A;  2QA2 A;  4Z43 A;  2YM1 A;  1OJC A;  3UP5 A;  5IQ1 A;  1E39 A;  1JOA A;  1JRX A;  4TM3 A;  3RP8 A;  3ATR A;  3LXD A;  1GOS A;  1K0I A;  3BI4 A;  2PHH A;  4Z24 A;  1F8S A;  3GDN A;  2WES A;  1ZDL A;  1PS9 A;  1N4U A;  1PHH A;  4PAB A;  4C3Y A;  5DBJ A;  1GT8 A;  2WDQ A;  3ICR A;  2YLT A;  2BAC A;  2XLT A;  3AYI A;  2FJE A;  3L1R A;  2YR5 A;  3P4S A;  3DK9 A;  3NK2 X;  4A65 A;  4H4V A;  5JCL A;  2BCG G;  2E5V A;  4I59 A;  4XWR A;  3AD9 B;  1H6V A;  4DNA A;  4JN9 A;  3WE0 A;  3KLJ A;  3CNS A;  4X9N A;  4LA1 A;  2GF3 A;  3QSM A;  2DKH A;  4REK A;  4K8D A;  2YQU A;  4GRT A;  5KRQ A;  1PJ7 A;  5EOW A;  4RG3 A;  3OC4 A;  2XVJ A;  1GAL A;  3HZL A;  1IUT A;  3O0H A;  3RP7 A;  4N9X A;  3AE7 A;  2OLN A;  2WOI A;  3DME A;  3ZYX A;  1K4Q A;  3AE9 A;  2DKI A;  4K22 A;  4EQR A;  2C67 A;  4BJY A;  3AE6 A;  3D8X A;  4A79 A;  2HQM A;  1VDC A;  2R45 A;  3B3R A;  4IA5 A;  4J33 A;  1OJT A;  1EL7 A;  3ADA B;  3VRB A;  4TLX A;  3SFD A;  4YSY A;  3QFB A;  4ZCC A;  4U2S A;  3UTG A;  3G5S A;  4B67 A;  1LPF A;  3IF9 A;  2Y6R A;  2GR1 A;  4B66 A;  3B6D A;  4USR A;  1MO9 A;  4IVM B;  2YR4 A;  1B8S A;  4RSL A;  3I6D A;  4FK1 C;  1JEH A;  2Y6Q A;  2C7G A;  5HYM A;  2YG5 A;  1FEA A;  1ZY8 A;  1KSS A;  5IPY A;  4UP3 A;  1M6I A;  1H81 A;  3GMB A;  2YG4 A;  1CJ4 A;  2BAB A;  2ACZ A;  2JAE A;  3LAD A;  5TR3 A;  1VG0 A;  2GMJ A;  2B7S A;  2OLO A;  3KKJ A;  3CGC A;  4U8J A;  1BGN A;  4ZN0 A;  1H83 A;  2BA9 A;  3DJG X;  2VQ7 A;  3NK1 X;  3H8I A;  1W4X A;  4H4U A;  2B7R A;  5JCM A;  4H4X A;  5FS8 A;  2UZZ A;  3NN0 X;  3C4N A;  5EB5 A;  2GAG B;  2WU2 A;  1PBF A;  4DGK A;  1E1M A;  1CHU A;  1DJN A;  4B63 A;  2VZ2 A;  1PJ5 A;  3FMW A;  1L9D A;  1HYU A;  3GMC A;  3DK4 A;  2GR2 A;  2ZZC A;  5JCN A;  2XLU A;  1DNC A;  2QAE A;  4EMI A;  2GAH B;  2I0Z A;  4U2T A;  3NYF A;  4H4S A;  2R0C A;  3DJJ A;  4NTC A;  3SQP A;  1COY A;  2PYX A;  3Q9T A;  4YSZ A;  1S3B A;  2E1M A;  3JSK A;  3GRT A;  1X31 B;  1VG9 A;  1ELI A;  4H4T A;  2BC0 A;  1TYT A;  4HA6 A;  1IUW A;  1D4E A;  4K2X A;  4AP1 A;  1E1N A;  3PO7 A;  3AEG A;  3FBS A;  4GCM A;  1KNR A;  1NHQ A;  2C3D A;  1M64 A;  3BNM A;  5M0Z A;  5U63 A;  1GET A;  3UP4 A;  2IVE A;  3FG2 P;  4U8K A;  3CND A;  3LZW A;  1KFY A;  4TM4 A;  4IA6 A;  1NDA A;  2C65 A;  3KU9 A;  3NNE A;  3RHA A;  3DGZ A;  1QO8 A;  2C64 A;  4CCR A;  1EL5 A;  1D5T A;  2YAU A;  1L9E A;  3NTA A;  2GQF A;  1RSG A;  1PXC A;  3UKA A;  1V59 A;  3CN8 A;  1KF6 A;  1NHS A;  1PDH A;  3UOX A;  2X50 A;  2JBV A;  1CF3 A;  3P4R A;  4WX1 A;  4B68 A;  2APG A;  1GES A;  2YG7 A;  3QVR A;  1ZMD A; 
#chains in the Genus database with same CATH topology
 4GDP A;  3CNP A;  1KKO A;  3NLC A;  2OQH A;  1QLB A;  1O95 A;  2ARD A;  4Z2U A;  2J3N A;  3OTR A;  4TM0 A;  4YTM A;  4K1W A;  2PS2 A;  2WDV A;  2PPG A;  5KNL A;  3KVE A;  5KWF A;  4IVO B;  1DOD A;  1QJD A;  3NRZ B;  1NHR A;  2XVE A;  3R0K A;  4GF7 A;  1GRE A;  4GAP A;  1IJH A;  3GO2 A;  1GRA A;  4Y4N A;  4EIQ A;  5BOF A;  1O94 A;  2V3A A;  2RDX A;  1KDG A;  5KMR A;  3AD8 B;  3DGH A;  4KX6 A;  3QSE A;  3EKG A;  2Q7V A;  2V61 A;  3AYJ A;  5HY5 A;  2AL2 B;  2QQ6 A;  3FXG A;  1KD0 A;  4G6G A;  1MNS A;  1GSN A;  4M0X A;  4H4Z A;  1NG3 A;  5EB4 A;  3BNU A;  2V60 A;  2VQB A;  4ADW A;  1X2H A;  4X4J A;  1CBO A;  4OPG A;  3UKP A;  1D7L A;  2Q6U A;  1Y0P A;  1S2Q A;  3SZC A;  3AE1 A;  4J56 A;  1SJC A;  4ECH A;  1KNP A;  3RO6 A;  3SN0 A;  5KMS A;  4HNC A;  3B9J B;  1JPM A;  2C72 A;  1N4W A;  2WPE A;  4P9S A;  1GRH A;  2XH2 A;  1NEL A;  3P1W A;  3UKH A;  5HXI A;  1ZMC A;  1BF3 A;  3SGL A;  2B9W A;  4EQX A;  3TCS A;  3ZVH B;  2BK4 A;  3UTH A;  4TLZ A;  4J34 A;  4KPR A;  5FMH A;  2WU5 A;  4EMW A;  1ZK7 A;  4RG4 A;  4E8G A;  3NG7 X;  3P9U A;  2OZ8 A;  5CKU A;  2AL2 A;  2X3N A;  1XAN A;  5BRT A;  2JK6 A;  3GY1 A;  5EU9 A;  3ALL A;  3G5Q A;  2VVL G;  3AED A;  3SFE A;  3H12 A;  4ZCW A;  4DYE A;  2B9X A;  3CGE A;  3UKF A;  3CXO A;  4ZCD A;  2YLS A;  1S2Y A;  4NEV A;  3COX A;  1FEC A;  1LV0 A;  4JNA A;  2QJM A;  4HB9 A;  5BUL A;  3T6C A;  3GWF A;  2JB3 A;  4H1Z A;  1YKJ A;  3PVC A;  3AEE A;  3OZ2 A;  3NZG A;  3VR8 A;  1FO4 A;  3T31 A;  1H7X A;  2ONE A;  2C66 A;  1H2I A;  3E1T A;  4BK2 A;  1IYX A;  4DHG A;  3F8D A;  3PS9 A;  3ZVH A;  3KA7 A;  1P2H A;  3STP A;  1STZ A;  3ITJ A;  1JRY A;  3AMZ A;  3DER A;  4JY3 A;  1E1L A;  4J57 A;  3CMM A;  1WYG A;  2W3R A;  3ICS A;  2Z5Y A;  5JCK A;  4JY2 A;  4DXK A;  3CGB A;  3K30 A;  3EPT A;  1PXB A;  1EC7 A;  3N6H A;  4YSX A;  3SM8 A;  3S47 A;  1REO A;  2RAB A;  5FS9 A;  3GWD A;  1R6W A;  3NVY B;  1CC6 A;  3M13 A;  2GB0 A;  2OA1 A;  5M10 A;  2GMH A;  1V97 A;  3PG6 A;  2EQ8 A;  1NU5 A;  1KCZ A;  3JW7 A;  1JRZ A;  2VOU A;  3UTE A;  4J31 A;  3ES8 A;  3BHK A;  3V4B A;  1VQZ A;  2VRL A;  2GRT A;  3S61 A;  2W0H A;  4U8P A;  2BCP A;  2QCU A;  3IWA A;  1ECQ A;  4H4R A;  5FJR A;  4B1B A;  1XHC A;  4ICY A;  3RED A;  3DG3 A;  2YR6 A;  1IUV A;  3BI5 A;  4K5R A;  3TQP A;  1GRT A;  1P43 A;  4NTE A;  3NH3 X;  3IK4 A;  2WHD A;  3Q45 A;  2ZZB A;  2XFU A;  5C3J A;  2POD A;  6ENL A;  4FX9 A;  1CL0 A;  1PBD A;  2YG3 A;  2HXT A;  2AL1 A;  1GRB A;  3VDG A;  4DWD A;  3NXL A;  4IL2 A;  1CJC A;  3AE3 A;  1TE6 A;  3NS1 B;  4E0V A;  1K0L A;  4Z43 A;  1JRO A;  2YM1 A;  3SJN A;  5IQ1 A;  1E39 A;  3RP8 A;  1K0I A;  1GOS A;  1F8S A;  3GDN A;  2WES A;  1ELS A;  3I6T A;  3ICR A;  2FJE A;  4A65 A;  2BCG G;  2E5V A;  2OO6 A;  4GFI A;  3WE0 A;  3KLJ A;  4X9N A;  4LA1 A;  4GRT A;  4G7F A;  1FIQ B;  2XVJ A;  1GAL A;  3RP7 A;  1EL7 A;  2PP0 A;  3SFD A;  4YSY A;  3QFB A;  2PGW A;  4U2S A;  3G5S A;  1LPF A;  4B66 A;  3I6D A;  4ROP A;  1FEA A;  1KSS A;  3DFH A;  2JAE A;  3LAD A;  1VG0 A;  3VA8 A;  4ZN0 A;  1N63 C;  1PDZ A;  3THU A;  3NK1 X;  1N61 C;  1W4X A;  5JCM A;  4HYR A;  3HRD C;  2UZZ A;  3ES7 A;  2WU2 A;  5G5G B;  3QLD A;  1JRP A;  4U2T A;  5JCN A;  2QAE A;  3N6J A;  4EMI A;  3NYF A;  4H4S A;  2PSN A;  4IHC A;  4YSZ A;  3JSK A;  3GRT A;  5M0Z A;  2BC0 A;  3SSZ A;  2C3D A;  3RGT A;  2PTW A;  3FG2 P;  3CND A;  4IA6 A;  2C65 A;  3RHA A;  4NNJ A;  3UKA A;  2APG A;  5J04 A;  3QVR A;  4GME A;  4MJW A;  3DG6 A;  4USQ A;  4A6N B;  4A5L A;  2B9Y A;  2GEW A;  3A7U A;  3SXI A;  3OZY A;  2GVC A;  3K7M X;  3QJ4 A;  3P93 A;  1RYI A;  2NPX A;  3NK0 X;  4C5O A;  2WET A;  4JN7 A;  1LQU A;  2XFO A;  2XDO A;  3ISH A;  4I58 A;  2E3T A;  4H2Q A;  4IP4 A;  5C2T A;  3P0W A;  2A89 A;  1YEY A;  1N1P A;  3SN4 A;  2GV8 A;  2JKC A;  3R10 A;  2WS3 A;  3BOX A;  5FS7 A;  2O9Z A;  2X8C A;  1O5W A;  4WCT A;  1N62 C;  2XH4 A;  1IUS A;  3IHG A;  2CDU A;  4DN1 A;  1PXA A;  4OPD A;  5JRB A;  2R0P A;  2MNR A;  3VCN A;  3IHM A;  4CY6 A;  1F9C A;  1ZOV A;  3CT2 A;  3MSY A;  2WOW A;  3RR1 A;  3EEZ A;  3R1Z A;  1XDI A;  3QN3 A;  4KEM A;  1R0M A;  3UXL A;  1EBD A;  1RM6 B;  5U25 A;  3D46 A;  4A6N A;  4EMJ A;  1DOB A;  1WUE A;  3T14 A;  1E6E A;  3DDM A;  3CAW A;  2XFN A;  2PA6 A;  2R4E A;  4O5Q A;  2P0I A;  3I6E A;  2AKM A;  2RGH A;  4IT1 A;  2BXS A;  1LQT A;  1Y56 B;  1TDN A;  3I3L A;  2PTX A;  2EQ7 A;  1D4C A;  3DJE A;  4H50 A;  3UOY A;  3EAN A;  4Z44 A;  4A6G A;  1DXL A;  3NFU A;  2X99 A;  1BQG A;  2E5A A;  3UJE A;  1TDE A;  3ZLF A;  4NEW A;  3IJQ A;  4MKS A;  3NVV B;  3OP2 A;  3ZVI A;  4YTP A;  4OPI A;  2YLZ A;  4J2W A;  3NT6 A;  4IV9 A;  1GV4 A;  3ALJ A;  3T2Z A;  4C3Y A;  4KWS A;  4K2S A;  4YWO A;  3NN6 X;  3DH9 A;  3GRS A;  1H82 A;  4OPU A;  4B65 A;  5KMP A;  1CJ2 A;  3UTF A;  2OZT A;  4G73 A;  4J1O A;  4MGG A;  2IID A;  2JB2 A;  5IQ4 A;  4Y4M A;  2X8H A;  4YKF A;  1Y56 A;  3CIR A;  1ZP0 A;  4J3Z A;  4K7Z A;  3TJ4 A;  1PBB A;  1GND A;  3P4Q A;  2V3B A;  3K1G A;  4OPT A;  3OPS A;  3NTD A;  1CC2 A;  4CY8 A;  1PN0 A;  1BZL A;  4DSH A;  3GC2 A;  2YVG A;  3FYY A;  3UCL A;  1GTH A;  4YXD A;  3FPZ A;  3ABV A;  4G6H A;  3ZLG A;  1FHV A;  3IJI A;  5FJP A;  1W6T A;  5IDZ A;  2YM2 A;  1KSU A;  3AE4 A;  3HW2 A;  3CNJ A;  4A35 A;  3GDP A;  3NVW B;  1K0J A;  2IVD A;  1JCT A;  2WDR A;  3R25 A;  1PDY A;  4Y4L A;  1TDK A;  3PWI A;  4C77 A;  3I4K A;  5BVA A;  4CNK A;  1CJ3 A;  3AE8 A;  4H2H A;  1GTE A;  1T3Q C;  4JNQ A;  1GXF A;  2P8C A;  3TWA A;  2Q0K A;  4M6U A;  4UDR A;  3V5C A;  1TDF A;  1EBG A;  3UOZ A;  1E7P A;  3T0K A;  3FCP A;  2P8B A;  1TRB A;  5KOW A;  1BGJ A;  3Q6J A;  3GD6 A;  2Z5X A;  2XFP A;  5G5H B;  1TYP A;  3T37 A;  1XPY A;  1SB3 B;  5JCI A;  4II2 A;  3S5W A;  2TMD A;  2R9Z A;  3HYV A;  1OEP A;  3UJF A;  2BS3 A;  2GH5 A;  5ENL A;  3URH A;  4JQ9 A;  3H4K A;  4MMW A;  4H2N A;  1IUU A;  3V3O A;  1ZX9 A;  3D47 A;  2ZBW A;  2QA2 A;  1OJC A;  3UP5 A;  1JOA A;  4TM3 A;  3ZLH A;  3H8A A;  3ATR A;  4Z24 A;  1GT8 A;  4KPL A;  1FFV C;  3P4S A;  3Q4D A;  2YR5 A;  3NK2 X;  4H4V A;  5JCL A;  3U4F A;  4JN9 A;  3CNS A;  4ENL A;  3QSM A;  2YQU A;  1MUC A;  2PTZ A;  1IUT A;  2WOI A;  3ZYX A;  1K4Q A;  2QJN A;  2C67 A;  1MDL A;  1KN0 A;  2DW6 A;  4IA5 A;  3VRB A;  1OJT A;  3HYW A;  3UTG A;  3IF9 A;  4IVM B;  1EC8 A;  5IPY A;  1M6I A;  1H81 A;  3GMB A;  2YG4 A;  1CJ4 A;  3KKJ A;  2ACZ A;  5TR3 A;  2XGZ A;  2B7S A;  2OLO A;  2GMJ A;  3OZM A;  2PGE A;  5FS8 A;  3NN0 X;  3C4N A;  5EB5 A;  4B63 A;  2GGJ A;  3FMW A;  1DNC A;  2OFJ A;  3SQP A;  4LU6 A;  4K2X A;  1D4E A;  3AEG A;  1KNR A;  3BNM A;  5U63 A;  3DES A;  1KFY A;  3DEQ A;  4HPN A;  3DGZ A;  2C64 A;  1D5T A;  1L9E A;  3NTA A;  1PXC A;  1PDH A;  1CF3 A;  4WX1 A;  4B68 A;  1GES A;  1N4V A;  3NKS A;  3VFC A;  2ZC8 A;  5GRT A;  1JNZ A;  3HPF A;  1VQW A;  2O56 A;  3N4F A;  3ETR B;  4JHM A;  1PBE A;  3T8Q A;  1FL2 A;  4GIS A;  2A8X A;  3GSI A;  3UOV A;  4YTN A;  4U8I A;  2R4J A;  3CPH G;  2XH0 A;  5CQF A;  1NG4 A;  2C73 A;  2WP5 A;  2WEU A;  1H86 A;  7ENL A;  1OJD A;  3A7R A;  1F3P A;  2HXU A;  3H70 A;  4U8N A;  2OQY A;  3FJ4 A;  4OVI A;  3V3N A;  2XVF A;  3IJL A;  1DTN A;  4Z2R A;  4UDP A;  5HHF A;  4HNL A;  1JPD X;  4M52 A;  1FHU A;  3MQT A;  4Z2T A;  2VVM A;  4NTD A;  4U2L A;  3BI2 A;  4A3R A;  2WBA A;  4FK1 A;  2AR8 A;  1NEK A;  3RNM A;  4O5U A;  3F8P A;  4E6M A;  4OCG A;  5L46 A;  1GEU A;  1XPQ A;  3AD7 B;  3IC9 A;  2YLW A;  3CTY A;  3P4P A;  2CUL A;  4DX3 A;  4CBQ A;  4D04 A;  4G8T A;  4Z26 A;  3SZ0 A;  1VRQ B;  2XSX A;  3PK7 A;  3NRN A;  2PP3 A;  4HCD A;  2HZG A;  3ENL A;  1BKW A;  2W54 A;  4G9K A;  3DK8 A;  2GSH A;  2PU1 A;  1OJA A;  5J7X A;  3AEA A;  2H89 A;  3B97 A;  1JDF A;  4GGH A;  1BWC A;  3BHF A;  4JDR A;  4H7U A;  2GL5 A;  2OVL A;  3G5R A;  2YVF A;  4CNJ A;  3AB1 A;  2GR3 A;  4EM3 A;  2ZZ0 A;  1EBH A;  3QPE A;  1FCD A;  1SEZ A;  4AT0 A;  4B64 A;  3CPI G;  4H4P A;  2XVH A;  2GGG A;  1MXT A;  2WP9 A;  3EUB 3;  2PU0 A;  3AM9 A;  1D7Y A;  3K7Q X;  2WPF A;  3SR6 B;  4BV6 A;  1AOG A;  3UCC A;  2YLX A;  3R11 A;  3M0O A;  1YQ3 A;  4J36 A;  1YQZ A;  3AWI A;  3CPJ G;  4GIR A;  2C3C A;  1E1K A;  2YWL A;  4HCH A;  2QVH A;  4NZH A;  4TM1 A;  3UXK A;  2C75 A;  3R9U A;  1SJB A;  2XLP A;  2OLA A;  1FEB A;  1N5X A;  3DJD A;  3CXB A;  3VRA A;  2QA1 A;  2BXR A;  4OPL A;  4K8G A;  3NYC A;  3ATQ A;  3UGV A;  3JVA A;  1Q1R A;  2A87 A;  3NO1 A;  4LII A;  1RVK A;  3H8L A;  4CRT A;  2OKT A;  2QDD A;  2GGI A;  3SQS A;  1GRF A;  1MOK A;  4AOS A;  3UJ2 A;  4Z1Y A;  3VRD B;  1N60 C;  4BK1 A;  3M12 A;  1NAA A;  1ZKQ A;  3VR9 A;  3UKL A;  3DG7 A;  3RP6 A;  2EQ9 A;  4K5S A;  4BJZ A;  1H7W A;  2XVI A;  2OX4 A;  4YT0 A;  2CHR A;  1GPE A;  3N4E A;  2OZ3 A;  3RRA A;  4EIP A;  1EL9 A;  2FKP A;  4A9W A;  3S5S A;  1LVL A;  4C74 A;  2QGY A;  1TKK A;  2JB1 A;  2BS4 A;  2XYO A;  3SBF A;  1ONE A;  4IL0 A;  2R0G A;  3KUM A;  5KVI A;  2F5Z A;  3L8K A;  1ZOY A;  5KXJ A;  1TDO A;  1P48 A;  3TOY A;  1F6M A;  1RP0 A;  2GGH A;  3GYI A;  3AXB A;  1YY5 A;  3SY4 A;  2GQW A;  1NHP A;  2RGJ A;  2POZ A;  3QVP A;  2WP6 A;  1JRX A;  3D9X A;  2PHH A;  4PAB A;  2QDE A;  1N4U A;  2BAC A;  3AYI A;  3DK9 A;  3MUC A;  4FI4 A;  3P3B A;  4Z17 A;  4K8D A;  5KRQ A;  2OG9 A;  5FJT A;  3DME A;  3AE9 A;  2DKI A;  2BRA A;  3AE6 A;  1VDC A;  2R45 A;  3B3R A;  4J33 A;  3ADA B;  3AN1 A;  4ZCC A;  4B67 A;  2YR4 A;  4RSL A;  4FK1 C;  2Y6Q A;  5HYM A;  2YG5 A;  1ZY8 A;  3NVZ B;  3PFR A;  4IP5 A;  1BGN A;  3CYJ A;  4HN8 A;  2BA9 A;  3DJG X;  2VQ7 A;  3H8I A;  2XH7 A;  4H4U A;  2B7R A;  2PP1 A;  4ZOH B;  3V3W A;  4EWJ A;  1DJN A;  1CHU A;  2VZ2 A;  1PJ5 A;  1HYU A;  2XLU A;  2GR2 A;  2GAH B;  2I0Z A;  2R0C A;  4NTC A;  3JZU A;  4TVY A;  2PYX A;  2BRY A;  3UJR A;  4HA6 A;  4XWR A;  1VG9 A;  1ELI A;  4DSG A;  1E1N A;  3PO7 A;  3FBS A;  3BJS A;  3UP4 A;  3L5O A;  3DIP A;  3U9I A;  4CCR A;  1EL5 A;  2YAU A;  3CB3 A;  1RSG A;  3UOX A;  3CN8 A;  1NHS A;  2X50 A;  3T9P A;  3P4R A;  1MDR A;  3R07 C;  2PMQ A;  3KPF A;  3CK5 A;  2P88 A;  3DFY A;  5BUK A;  3AEC A;  4HCL A;  2WQY A;  2X8G A;  5U1O A;  4GUV A;  4XWZ A;  3ICT A;  1CC4 A;  3C4A A;  3LJP A;  1N5W C;  1VDV A;  1B5Q A;  3GYJ A;  4AOX A;  3T2Y A;  1P2E A;  2CVJ A;  4GGB A;  3FVD A;  2CFY A;  2DW7 A;  2FJB A;  4OPC A;  3V5F A;  1NPX A;  1ONF A;  2OAM A;  1L0V A;  4ZA0 A;  1PBC A;  5GSN A;  2AAQ A;  3ALM A;  1IUX A;  1PJ6 A;  5KVH A;  5EBK A;  5LV9 A;  2FJD A;  3MKC A;  1ZXI C;  2GDQ A;  5FS6 A;  3KD9 A;  2W55 A;  2VRM A;  4H4Y A;  2XLS A;  4C3X A;  2YLR A;  4E4F A;  1B37 A;  4PAA A;  2PCE A;  2GR0 A;  2MUC A;  1DJQ A;  3QSS A;  1L9C A;  1SJD A;  4GYP A;  3T4W A;  4E4U A;  4A7A A;  2NVK X;  2NQL A;  4U8M A;  1LJ1 A;  5BOE A;  3T2K A;  3LB8 A;  2HNE A;  3LZX A;  1OJ9 A;  4H83 A;  3VCC A;  3HYX A;  1JNR A;  3TW9 A;  3ZDN A;  3GD3 A;  3H7V A;  2WPC A;  4U8L A;  5KMQ A;  4H2P A;  3UJS A;  3TWB A;  3F8R A;  5J60 A;  3TTE A;  2RGO A;  1LTX R;  4A99 A;  4H2R A;  3RCY A;  4FDC B;  3K7T A;  3OW1 A;  4XXG A;  4AT2 A;  4X2P A;  1Q1W A;  2PTY A;  2I5Q A;  4AP3 A;  3UCD A;  4E5T A;  3D1C A;  3CNT A;  4GDE A;  2VVL A;  3EAO A;  1NEN A;  4NWZ A;  2FYM A;  4CCQ A;  3UKQ A;  3NHO X;  1D4D A;  1YQ4 A;  4H4Q A;  2BK3 A;  2BC1 A;  4GR1 A;  3NYE A;  4BUR A;  3VQR A;  2ZAD A;  1EL8 A;  3MZN A;  2BS2 A;  3NGC X;  2YG6 A;  2WOV A;  3FV9 A;  3AE2 A;  2C4C A;  3GD4 A;  4TVW A;  2AQJ A;  3EF6 A;  2B76 A;  3UKK A;  1Q9I A;  2EQ6 A;  1L8P A;  4EM4 A;  1H84 A;  3R0U A;  3MWC A;  1S3E A;  3VC5 A;  3FIM B;  3V76 A;  3BSM A;  1JU2 A;  2FJA A;  1EC9 A;  4FP1 A;  1DOC A;  1FOH A;  3CGD A;  3GYX A;  2W3S A;  2XFQ A;  1TZZ A;  3AE5 A;  4B69 A;  3II4 A;  1F8R A;  2XLR A;  3C96 A;  2Q0L A;  1F8W A;  2XCG A;  4APN A;  1GER A;  2H88 A;  4X9M A;  4BK3 A;  5ER0 A;  3TJI A;  4EQW A;  2BYB A;  1FFU C;  1UKV G;  2BK5 A;  3QFA A;  2C76 A;  2E4G A;  2V5Z A;  3NIX A;  4U8O A;  2FBW A;  3LOV A;  4EQS A;  4H4W A;  2C70 A;  4F4R A;  2TPR A;  4D03 A;  3SZF A;  3AEB A;  1B4V A;  5FJU A;  1DOE A;  3AYL A;  3AEF A;  1E9I A;  5KOX A;  4UDQ A;  4YWS A;  2R46 A;  2OAL A;  1Z6L A;  4YSH A;  2V6O A;  2YVJ A;  4YKG A;  1MRA A;  1GRG A;  3DA1 A;  2GGE A;  4Z25 A;  4II3 A;  3QTP A;  2AKZ A;  3SX6 A;  3LXD A;  4G74 A;  3BI4 A;  1ZDL A;  1PS9 A;  1PHH A;  5DBJ A;  2WDQ A;  2YLT A;  2XLT A;  3L1R A;  4I59 A;  3AD9 B;  1H6V A;  4DNA A;  2GF3 A;  2DKH A;  4REK A;  4H19 A;  1BKH A;  1PJ7 A;  1WUF A;  5EOW A;  4RG3 A;  3OC4 A;  3HZL A;  3O0H A;  4N9X A;  3AE7 A;  2OLN A;  4JN8 A;  3SN1 A;  1S7M A;  3QKE A;  3VC6 A;  4K22 A;  3A7A A;  4EQR A;  4BJY A;  3D8X A;  4A79 A;  2HQM A;  3KPK A;  4TLX A;  2Y6R A;  2GR1 A;  1XS2 A;  3RIT A;  3B6D A;  4USR A;  1MO9 A;  1B8S A;  3SZW A;  1JEH A;  2C7G A;  4UP3 A;  2BAB A;  4U8J A;  3CGC A;  1H83 A;  4KT2 A;  2QJJ A;  1KKR A;  4H4X A;  1X2G A;  2GAG B;  3DGB A;  3MY9 A;  4GYP C;  3SYI A;  1PBF A;  4DGK A;  1E1M A;  1L9D A;  3GMC A;  3DK4 A;  2ZZC A;  5FJO A;  3DJJ A;  1COY A;  3Q9T A;  1S3B A;  2E1M A;  1X31 B;  4H4T A;  4AP1 A;  1TYT A;  1IUW A;  4GCM A;  2OPJ A;  1NHQ A;  1M64 A;  1GET A;  4IZG A;  2IVE A;  2P3Z A;  4U8K A;  3LZW A;  4TM4 A;  1NDA A;  3PWG A;  3KU9 A;  3NNE A;  1QO8 A;  4GAV A;  1SJA A;  2GQF A;  1V59 A;  1KF6 A;  2JBV A;  2YG7 A;  1ZMD A; 
#chains in the Genus database with same CATH homology
 3NKS A;  3KPF A;  4GDP A;  4MJW A;  5BUK A;  3CNP A;  5GRT A;  1JNZ A;  3AEC A;  3NLC A;  1QLB A;  1VQW A;  1O95 A;  2ARD A;  2WQY A;  4Z2U A;  2J3N A;  4USQ A;  4A6N B;  2X8G A;  5U1O A;  4A5L A;  2B9Y A;  1PBE A;  4GUV A;  4XWZ A;  2GEW A;  3ICT A;  4TM0 A;  4YTM A;  3SXI A;  1CC4 A;  3C4A A;  3LJP A;  2WDV A;  5KNL A;  3KVE A;  1FL2 A;  2GVC A;  5KWF A;  4IVO B;  2A8X A;  3GSI A;  1DOD A;  1B5Q A;  3K7M X;  3QJ4 A;  3GYJ A;  3UOV A;  4U8I A;  4AOX A;  4YTN A;  1RYI A;  3T2Y A;  1P2E A;  2CVJ A;  2R4J A;  1QJD A;  2NPX A;  3CPH G;  3NK0 X;  4C5O A;  5CQF A;  2WET A;  2CFY A;  1NG4 A;  2FJB A;  1NHR A;  2XVE A;  4GF7 A;  2C73 A;  1GRE A;  2WP5 A;  1LQU A;  2WEU A;  2XDO A;  2XFO A;  4GAP A;  1H86 A;  1IJH A;  3ISH A;  4OPC A;  4I58 A;  1NPX A;  1ONF A;  1OJD A;  2OAM A;  1L0V A;  1F3P A;  1GRA A;  4Y4N A;  4EIQ A;  4H2Q A;  4U8N A;  1O94 A;  5C2T A;  1PBC A;  5GSN A;  2V3A A;  2AAQ A;  4OVI A;  2A89 A;  3ALM A;  2XVF A;  3V3N A;  1IUX A;  1KDG A;  1PJ6 A;  5KMR A;  1N1P A;  5KVH A;  3AD8 B;  3DGH A;  2GV8 A;  4KX6 A;  2JKC A;  2WS3 A;  5EBK A;  5FS7 A;  5LV9 A;  3QSE A;  2O9Z A;  2X8C A;  2Q7V A;  2FJD A;  2V61 A;  3AYJ A;  4UDP A;  5HHF A;  4Z2R A;  5HY5 A;  1O5W A;  4M52 A;  4WCT A;  4Z2T A;  5FS6 A;  2VVM A;  4NTD A;  4G6G A;  3KD9 A;  4U2L A;  1IUS A;  3BI2 A;  3IHG A;  2CDU A;  2WBA A;  1PXA A;  2VRM A;  5JRB A;  2R0P A;  4FK1 A;  4OPD A;  1GSN A;  1NEK A;  2AR8 A;  3IHM A;  4CY6 A;  3RNM A;  1NG3 A;  4H4Z A;  5EB4 A;  1ZOV A;  3BNU A;  4O5U A;  4H4Y A;  2XLS A;  3F8P A;  4C3X A;  2WOW A;  2V60 A;  2YLR A;  2VQB A;  4ADW A;  1B37 A;  4X4J A;  1XDI A;  1CBO A;  4PAA A;  4OCG A;  4OPG A;  2GR0 A;  1N4V A;  3UKP A;  1DJQ A;  3QSS A;  1D7L A;  5L46 A;  1L9C A;  1GEU A;  1XPQ A;  3AD7 B;  3IC9 A;  1EBD A;  2YLW A;  5U25 A;  2Q6U A;  3CTY A;  3P4P A;  2CUL A;  4A6N A;  1Y0P A;  1S2Q A;  4EMJ A;  3SZC A;  4A7A A;  1DOB A;  3AE1 A;  4CBQ A;  2NVK X;  4J56 A;  3T14 A;  4U8M A;  4D04 A;  1E6E A;  1LJ1 A;  4ECH A;  4Z26 A;  1KNP A;  2XFN A;  3SZ0 A;  3T2K A;  5KMS A;  2R4E A;  3LB8 A;  2C72 A;  1N4W A;  3LZX A;  1VRQ B;  4O5Q A;  1OJ9 A;  2WPE A;  3NRN A;  4P9S A;  1GRH A;  3HYX A;  3P1W A;  3UKH A;  2RGH A;  1BKW A;  2BXS A;  5HXI A;  1LQT A;  1ZMC A;  1BF3 A;  1JNR A;  1TDN A;  1Y56 B;  3I3L A;  4G9K A;  3SGL A;  3DK8 A;  3ZDN A;  2B9W A;  4EQX A;  2EQ7 A;  1D4C A;  3DJE A;  3GD3 A;  2WPC A;  4U8L A;  4H50 A;  1OJA A;  3VRB A;  5J7X A;  5KMQ A;  3AEA A;  2BK4 A;  4H2P A;  3EAN A;  3UOY A;  4Z44 A;  3F8R A;  5J60 A;  1DXL A;  1LTX R;  2RGO A;  4A99 A;  3UTH A;  4J34 A;  4H2R A;  4KPR A;  2H89 A;  4TLZ A;  2X99 A;  4FDC B;  5FMH A;  2WU5 A;  3K7T A;  4EMW A;  1TDE A;  1ZK7 A;  4RG4 A;  4XXG A;  4AT2 A;  4NEW A;  3NG7 X;  3P9U A;  5CKU A;  1BWC A;  2X3N A;  1XAN A;  3BHF A;  4JDR A;  5BRT A;  1Q1W A;  2JK6 A;  3ALL A;  4YTP A;  4H7U A;  3G5Q A;  3G5R A;  4AP3 A;  2VVL G;  3AED A;  4OPI A;  2YLZ A;  3D1C A;  4J2W A;  2YVF A;  3SFE A;  4CNJ A;  3AB1 A;  3NT6 A;  4IV9 A;  2GR3 A;  2B9X A;  3CNT A;  1GV4 A;  3CGE A;  4EM3 A;  3ALJ A;  2ZZ0 A;  4GDE A;  3UKF A;  3T2Z A;  1FCD A;  4ZCD A;  1SEZ A;  2YLS A;  1S2Y A;  4NEV A;  2VVL A;  3COX A;  4AT0 A;  1FEC A;  4B64 A;  3EAO A;  1NEN A;  3CPI G;  4H4P A;  1LV0 A;  4NWZ A;  4JNA A;  2XVH A;  4YWO A;  4HB9 A;  1MXT A;  4CCQ A;  3NN6 X;  3UKQ A;  3DH9 A;  5BUL A;  3GRS A;  1H82 A;  3NHO X;  2WP9 A;  1D4D A;  1YQ4 A;  4OPU A;  4H4Q A;  3GWF A;  2JB3 A;  2BK3 A;  2BC1 A;  1D7Y A;  4GR1 A;  2WPF A;  3K7Q X;  4BUR A;  3NYE A;  1CJ2 A;  3UTF A;  3VQR A;  4B65 A;  5KMP A;  4BV6 A;  1AOG A;  1EL8 A;  2YLX A;  4G73 A;  3M0O A;  1YQ3 A;  2BS2 A;  4J36 A;  1YKJ A;  3NGC X;  3PVC A;  4DSG A;  3AEE A;  3OZ2 A;  1YQZ A;  3VR8 A;  2IID A;  3AWI A;  3CPJ G;  2YG6 A;  3T31 A;  2C3C A;  1E1K A;  1H7X A;  2YWL A;  2JB2 A;  2WOV A;  3AE2 A;  2C4C A;  5IQ4 A;  4Y4M A;  2X8H A;  3GD4 A;  2C66 A;  4NZH A;  4YKF A;  4TM1 A;  1H2I A;  2AQJ A;  2C75 A;  1Y56 A;  3E1T A;  3CIR A;  4BK2 A;  3R9U A;  2XLP A;  3EF6 A;  2B76 A;  1ZP0 A;  3F8D A;  1FEB A;  4K7Z A;  3DJD A;  3PS9 A;  3UKK A;  3KA7 A;  1Q9I A;  2EQ6 A;  1P2H A;  1PBB A;  3VRA A;  2QA1 A;  1GND A;  4EM4 A;  1H84 A;  2BXR A;  3P4Q A;  4OPL A;  2V3B A;  1S3E A;  3NYC A;  3ATQ A;  3FIM B;  3V76 A;  4OPT A;  3NTD A;  1CC2 A;  3ITJ A;  1JRY A;  4CY8 A;  1PN0 A;  1BZL A;  1Q1R A;  4JY3 A;  4DSH A;  1E1L A;  2YVG A;  1JU2 A;  4LU6 A;  2A87 A;  4J57 A;  2FJA A;  3UCL A;  4LII A;  1GTH A;  3CMM A;  4YXD A;  3FPZ A;  1DOC A;  3ICS A;  1FOH A;  2Z5Y A;  3H8L A;  5JCK A;  4CRT A;  3CGD A;  3ABV A;  3GYX A;  4JY2 A;  4G6H A;  1GRF A;  1MOK A;  3CGB A;  2XFQ A;  3K30 A;  4AOS A;  3EPT A;  3AE5 A;  1PXB A;  4B69 A;  4YSX A;  3II4 A;  1F8R A;  3SM8 A;  1REO A;  2RAB A;  3VRD B;  5FS9 A;  2XLR A;  3C96 A;  3GWD A;  2Q0L A;  4BK1 A;  3M12 A;  1F8W A;  1NAA A;  2XCG A;  1ZKQ A;  2YM2 A;  1KSU A;  4APN A;  1CC6 A;  3AE4 A;  3M13 A;  3UKL A;  2GB0 A;  2OA1 A;  1GER A;  3VR9 A;  2H88 A;  2GMH A;  3RP6 A;  3CNJ A;  5M10 A;  2EQ9 A;  3GDP A;  4K5S A;  4BJZ A;  4X9M A;  3PG6 A;  1K0J A;  1H7W A;  2IVD A;  4BK3 A;  2WDR A;  2XVI A;  5ER0 A;  2EQ8 A;  4YT0 A;  4Y4L A;  1GPE A;  1TDK A;  4C77 A;  4EQW A;  2BYB A;  1JRZ A;  5BVA A;  2VOU A;  3UTE A;  4J31 A;  4CNK A;  1UKV G;  1CJ3 A;  2BK5 A;  4EIP A;  3QFA A;  3AE8 A;  2C76 A;  1EL9 A;  2E4G A;  1GTE A;  3BHK A;  2V5Z A;  3NIX A;  4JNQ A;  4A9W A;  1LVL A;  4C74 A;  4U8O A;  2VRL A;  2FBW A;  3LOV A;  1GXF A;  4EQS A;  2JB1 A;  2GRT A;  4H4W A;  3S61 A;  2W0H A;  2C70 A;  2BS4 A;  2XYO A;  2TPR A;  4U8P A;  2Q0K A;  2BCP A;  4D03 A;  3SZF A;  2QCU A;  3AEB A;  3IWA A;  4H4R A;  4UDR A;  4B1B A;  1B4V A;  1XHC A;  1TDF A;  4ICY A;  3RED A;  2R0G A;  2YR6 A;  1IUV A;  1DOE A;  5KVI A;  2F5Z A;  3AYL A;  3AEF A;  3L8K A;  3BI5 A;  5KOX A;  3UOZ A;  4K5R A;  1GRT A;  1ZOY A;  4UDQ A;  1E7P A;  5KXJ A;  3T0K A;  1TDO A;  4NTE A;  2R46 A;  3NH3 X;  2OAL A;  1TRB A;  5KOW A;  1BGJ A;  3Q6J A;  1F6M A;  2WHD A;  2ZZB A;  1RP0 A;  2XFU A;  5C3J A;  2Z5X A;  1CL0 A;  4FX9 A;  2XFP A;  1Z6L A;  3GYI A;  3AXB A;  4YSH A;  1TYP A;  1PBD A;  2YG3 A;  3T37 A;  2V6O A;  1GRB A;  5JCI A;  4II2 A;  3S5W A;  2TMD A;  1YY5 A;  3SY4 A;  2GQW A;  2R9Z A;  1NHP A;  2YVJ A;  3HYV A;  2RGJ A;  4YKG A;  1GRG A;  3DA1 A;  2BS3 A;  2GH5 A;  4Z25 A;  3URH A;  4II3 A;  4JQ9 A;  1CJC A;  3AE3 A;  3H4K A;  3QVP A;  4H2N A;  4E0V A;  1IUU A;  2WP6 A;  3V3O A;  1ZX9 A;  3SX6 A;  1K0L A;  2ZBW A;  2QA2 A;  4Z43 A;  2YM1 A;  1OJC A;  3UP5 A;  5IQ1 A;  1E39 A;  1JOA A;  1JRX A;  4TM3 A;  3RP8 A;  3ATR A;  3LXD A;  3D9X A;  1GOS A;  1K0I A;  3BI4 A;  4G74 A;  2PHH A;  4Z24 A;  1F8S A;  3GDN A;  2WES A;  1ZDL A;  1PS9 A;  1N4U A;  1PHH A;  4PAB A;  4C3Y A;  5DBJ A;  1GT8 A;  2WDQ A;  3ICR A;  2YLT A;  2BAC A;  2XLT A;  3AYI A;  2FJE A;  3L1R A;  2YR5 A;  3P4S A;  3DK9 A;  3NK2 X;  4A65 A;  4H4V A;  5JCL A;  2BCG G;  2E5V A;  4I59 A;  4XWR A;  3AD9 B;  1H6V A;  4DNA A;  4JN9 A;  3WE0 A;  3KLJ A;  3CNS A;  4X9N A;  4LA1 A;  2GF3 A;  3QSM A;  2DKH A;  4REK A;  4K8D A;  2YQU A;  4GRT A;  5KRQ A;  1PJ7 A;  5EOW A;  4RG3 A;  3OC4 A;  2XVJ A;  1GAL A;  3HZL A;  1IUT A;  3O0H A;  3RP7 A;  4N9X A;  3AE7 A;  2OLN A;  2WOI A;  3DME A;  1S7M A;  3ZYX A;  1K4Q A;  3AE9 A;  2DKI A;  4K22 A;  2BRA A;  4EQR A;  2C67 A;  4BJY A;  1KN0 A;  3AE6 A;  3D8X A;  4A79 A;  2HQM A;  1VDC A;  2R45 A;  3B3R A;  4IA5 A;  3KPK A;  1OJT A;  1EL7 A;  3ADA B;  4J33 A;  4TLX A;  3SFD A;  3HYW A;  3QFB A;  4ZCC A;  4U2S A;  3UTG A;  4YSY A;  3G5S A;  4B67 A;  1LPF A;  3IF9 A;  2Y6R A;  2GR1 A;  4B66 A;  3B6D A;  4USR A;  1MO9 A;  4IVM B;  2YR4 A;  1B8S A;  3SZW A;  4RSL A;  3I6D A;  4FK1 C;  1JEH A;  2Y6Q A;  2C7G A;  5HYM A;  2YG5 A;  1FEA A;  1ZY8 A;  1KSS A;  5IPY A;  4UP3 A;  1M6I A;  1H81 A;  3GMB A;  2YG4 A;  1CJ4 A;  2BAB A;  2ACZ A;  2JAE A;  3LAD A;  5TR3 A;  1VG0 A;  2GMJ A;  2B7S A;  2OLO A;  3KKJ A;  3CGC A;  4U8J A;  1BGN A;  4ZN0 A;  1H83 A;  2BA9 A;  3DJG X;  2VQ7 A;  3NK1 X;  3H8I A;  1W4X A;  4H4U A;  2B7R A;  5JCM A;  4H4X A;  5FS8 A;  2UZZ A;  3NN0 X;  3C4N A;  5EB5 A;  2GAG B;  2WU2 A;  3SYI A;  1PBF A;  4DGK A;  1E1M A;  1CHU A;  1DJN A;  4B63 A;  2VZ2 A;  1PJ5 A;  3FMW A;  1L9D A;  1HYU A;  3GMC A;  3DK4 A;  2GR2 A;  2ZZC A;  5JCN A;  2XLU A;  1DNC A;  2QAE A;  4EMI A;  2GAH B;  2I0Z A;  4U2T A;  3NYF A;  4H4S A;  2R0C A;  3DJJ A;  4NTC A;  3SQP A;  1COY A;  2PYX A;  3Q9T A;  2BRY A;  4YSZ A;  1S3B A;  2E1M A;  3JSK A;  3GRT A;  1X31 B;  1VG9 A;  1ELI A;  4H4T A;  2BC0 A;  1TYT A;  4HA6 A;  1IUW A;  1D4E A;  4K2X A;  4AP1 A;  1E1N A;  3PO7 A;  3AEG A;  3FBS A;  4GCM A;  1KNR A;  1NHQ A;  2C3D A;  1M64 A;  3BNM A;  5M0Z A;  5U63 A;  1GET A;  3UP4 A;  2IVE A;  3FG2 P;  4U8K A;  3CND A;  3LZW A;  1KFY A;  4TM4 A;  4IA6 A;  1NDA A;  3L5O A;  2C65 A;  3KU9 A;  3NNE A;  3RHA A;  3DGZ A;  1QO8 A;  2C64 A;  4CCR A;  1EL5 A;  4NNJ A;  1D5T A;  2YAU A;  1L9E A;  3NTA A;  4GAV A;  2GQF A;  1RSG A;  1PXC A;  3UKA A;  1V59 A;  3CN8 A;  1KF6 A;  1NHS A;  1PDH A;  3UOX A;  2X50 A;  2JBV A;  1CF3 A;  3P4R A;  4WX1 A;  4B68 A;  2APG A;  1GES A;  2YG7 A;  3QVR A;  1ZMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...