5KVHA

Crystal structure of human apoptosis-inducing factor with w196a mutation
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
487
structure length
438
Chain Sequence
b'DKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQANGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Defining NADH-Driven Allostery Regulating Apoptosis-Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 139
structure length 438
sequence length 487
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5kvhA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kvhA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kvhA01
3AEEA 1DXLA 4EMJA 3DK8A 2JAEA 1P2EA 3PO7A 3BHFA 3H8LA 2BYBA 3DK9A 2C72A 3AE9A 1AOGA 1IUWA 4CY6A 4Z2UA 1E39A 2C66A 3ICRA 2X8HA 1KFYA 1XANA 1YQ3A 2B9YA 3NTDA 1JRXA 1F3PA 3GMBA 3P9UA 1B4VA 3SFDA 3CGEA 3GWFA 4EMIA 4DSGA 2IVDA 2W0HA 4B66A 4B69A 1GPEA 3BHKA 3AE2A 4LIIA 2PHHA 3V3NA 4NZHA 4PABA 2EQ7A 3DJGX 2C73A 3ALMA 3IHGA 4X4JA 3PVCA 1PN0A 4Z2RA 3GD4A 1B37A 1N4WA 2F5ZA 3ADAB 5GRTA 3DH9A 1KNPA 4H4VA 3D8XA 1JEHA 2YLTA 2GVCA 1K0JA 2OALA 2VZ2A 2WS3A 3NNEA 3P4RA 5CQFA 4D03A 1TDKA 2YLZA 2YLRA 1XHCA 2OLNA 3F8RA 4DSHA 5IPYA 3AE3A 3EANA 3ZYXA 2XVIA 3UP4A 2FBWA 4A9WA 2J3NA 2XFQA 2XFOA 2YVGA 1K0IA 3NGCX 1NPXA 1UKVG 2YG3A 3KLJA 1NDAA 4U2TA 1FL2A 4H7UA 2BACA 3II4A 4H4RA 1D4DA 4YTMA 3KVEA 2TMDA 5C3JA 4IVMB 2EQ9A 4C3YA 4H4YA 3AB1A 4X9NA 1FECA 1DJQA 1NHSA 1K0LA 2JK6A 1Y0PA 2GR0A 3L8KA 4U8LA 2BA9A 3CTYA 2E5VA 5FMHA 2V3BA 3ALLA 5ER0A 2R9ZA 2GF3A 4YKFA 5BUKA 1MXTA 1O5WA 2ARDA 1NEKA 1XDIA 1NHPA 4OPGA 2GR1A 1PJ7A 2WDQA 3BI5A 3UKAA 3D1CA 2FJAA 4WX1A 4KPRA 2XLTA 2R4JA 3K30A 3SM8A 2B9WA 2E1MA 2BCPA 4USRA 4J36A 2OLOA 2AAQA 2YLWA 3AE8A 5FS8A 4J2WA 3VRDB 5M10A 5EB5A 4O5UA 4GUVA 4U2LA 1OJAA 3ATRA 2VOUA 1SEZA 3VRAA 1GTEA 5U25A 1COYA 3CNDA 3UP5A 2YG5A 2C3DA 4TLXA 1VRQB 3KU9A 4OPIA 4EQWA 2DKHA 1H7WA 2Q7VA 4U8IA 3NHOX 2WESA 5HHFA 3S5WA 1GRAA 2Y6QA 1CJCA 2GB0A 3CNPA 3CPJG 2GAGB 1LPFA 2WOVA 1ZKQA 4H50A 2Z5YA 3JSKA 2JB1A 1MO9A 3UTEA 1GREA 4FX9A 4A7AA 3CGBA 5EBKA 2XLRA 4BK1A 1ZY8A 1ZMCA 2YG4A 2WDRA 3EF6A 3LJPA 3T37A 3UCLA 1JNRA 1N4VA 2FJEA 4J31A 2C70A 1BGJA 4K7ZA 4YSYA 2QAEA 1F8RA 2JB2A 3E1TA 4C77A 1IUTA 1LJ1A 4U8NA 3P4SA 1EL7A 2VVLG 2YR5A 1S2YA 5KXJA 2WP9A 2BABA 3KD9A 4B1BA 3UKFA 4CNKA 2VRMA 1GALA 2BXSA 1TYTA 4GRTA 3RP6A 3LB8A 4U8PA 3RP8A 2XYOA 1OJTA 3M12A 4N9XA 2ZZBA 3REDA 4AOSA 3NKSA 5KVIA 1CC6A 3UTGA 1BWCA 3FPZA 2A8XA 2XFNA 1TDFA 4HB9A 1YQ4A 4AOXA 3G5SA 4A79A 2YG7A 4M52A 2Q0KA 2GQWA 1Y56A 4B68A 3M13A 3ICTA 1TDOA 4JN9A 4UDQA 3CGCA 2WPCA 1GRHA 4TM3A 5JCNA 1NHRA 1D4CA 1QO8A 5KVHA 5HXIA 4K22A 4OPCA 3C4NA 4EQXA 3CGDA 2R46A 4YTNA 4OCGA 2C3CA 1F8SA 2XVHA 3R9UA 5KWFA 1LTXR 1GEUA 3GYIA 1H83A 3KPFA 3B6DA 1PJ5A 4H4SA 2WDVA 5TR3A 4NEWA 4BURA 2BCGG 1PBFA 2B76A 2CDUA 3UOYA 1E1KA 3AE7A 4U8KA 4GDPA 2RGJA 1F8WA 1O95A 2YLXA 3HZLA 1V59A 2H88A 3QSSA 3BI4A 2BC0A 3CN8A 3NK1X 2Z5XA 1BGNA 3NG7X 2C67A 1JOAA 1Y56B 1CF3A 4AP3A 3P1WA 1W4XA 3GYJA 4AT0A 1DODA 4LA1A 2GEWA 1JU2A 4A6NA 4UP3A 3NRNA 4H4TA 3QJ4A 1M6IA 2QA1A 1NENA 1GERA 2OA1A 2YWLA 3DJEA 3KKJA 1ZDLA 1MOKA 5FS6A 2WP6A 1H7XA 2B7SA 1IUVA 2YM1A 4XWZA 4E0VA 4IA6A 1FCDA 4TM4A 2BS4A 3BNUA 2C7GA 4TM0A 1GNDA 1PXCA 1PXBA 3CNSA 1KDGA 4Z26A 2GAHB 4C5OA 2YQUA 4BJZA 1KSSA 1GRTA 4BK3A 1RYIA 4Z2TA 1VG9A 3AEFA 2BS2A 3GWDA 1NG3A 5KRQA 2IVEA 2NVKX 3AXBA 3UKLA 4YSXA 3KA7A 3SQPA 3SGLA 1GOSA 4OPDA 3QFBA 2XLPA 4U8MA 3C4AA 4A6NB 2ZZCA 3ALJA 3FBSA 4A65A 1Q1RA 5U1OA 2XDOA 2WU5A 1DOBA 1YY5A 2XLSA 3CIRA 1VQWA 5U63A 4YWOA 4EIPA 3UTFA 3PS9A 5KOWA 2WBAA 1DOEA 1ZMDA 2XFPA 2R4EA 1REOA 2WU2A 3VQRA 2ZZ0A 3ATQA 2AR8A 2JBVA 3V76A 2YG6A 4U8OA 4ZCDA 2B7RA 4UDRA 1BF3A 1E7PA 2XVJA 4ZCCA 3NN0X 2GH5A 5JCMA 3NYCA 4K5RA 2DKIA 3IWAA 3ZDNA 1GRFA 2WPFA 4YTPA 1NG4A 2ACZA 4USQA 2V3AA 4B67A 4BJYA 1GRBA 3VR9A 2R45A 2R0PA 2VQBA 4H4ZA 1O94A 1PBCA 1ZOVA 4JDRA 2Y6RA 2FJDA 3QVPA 4WCTA 2VVMA 1L9DA 1E1LA 4IV9A 2BK5A 1ZK7A 4GR1A 2VVLA 1FEBA 4NTCA 5DBJA 5FS7A 3UKQA 2GR2A 2CVJA 3CNJA 4H4XA 1CL0A 1H82A 4H2PA 4DNAA 1H84A 3ICSA 4ICYA 1KF6A 3DMEA 4JNAA 3GRTA 3UKPA 4ECHA 1D7LA 2BK3A 2Q0LA 4JNQA 1D7YA 1RSGA 1GRGA 3NN6X 2UZZA 2GMHA 4GDEA 2X8CA 4H2QA 3UOVA 1KSUA 4Y4MA 1GTHA 1OJCA 3NIXA 3DGZA 4OPLA 1PXAA 3K7TA 3UKHA 4BV6A 1PHHA 1ZX9A 4EM3A 4ADWA 4YT0A 4H2RA 2XCGA 3AEDA 3AE1A 3AD9B 4J57A 2YM2A 3I6DA 4A99A 4TM1A 2WHDA 1BZLA 3AEGA 5HYMA 1IUSA 1EL5A 3Q9TA 3IHMA 3S61A 4B63A 1JRZA 4GCMA 2YVJA 2BK4A 3G5QA 3NT6A 1CC4A 3QSEA 4Z24A 1HYUA 1NHQA 1YQZA 5EB4A 4UDPA 4P9SA 4B65A 3O0HA 5FS9A 3AE4A 2BC1A 1D5TA 4EMWA 3NYFA 1JRYA 1ZOYA 3GDPA 2WPEA 1CHUA 1Q9IA 3DA1A 1EBDA 5HY5A 3B3RA 4CBQA 2R0GA 1NAAA 5L46A 1K4QA 2V6OA 1PBDA 4GF7A 2YVFA 3COXA 1GXFA 1D4EA 2IIDA 2QA2A 3CPIG 1S3EA 2OAMA 2HQMA 3L1RA 1ELIA 3NH3X 3P4QA 2C64A 4C74A 3H8IA 2V60A 1CJ4A 3RP7A 2X8GA 3NK0X 4Z44A 2TPRA 4JY2A 2C65A 2V61A 2X99A 1OJDA 4Y4NA 4I59A 1TDEA 2RGHA 3CPHG 2GQFA 1PS9A 3AYLA 3GD3A 4JY3A 4Z43A 3G5RA 4EIQA 3AEBA 1CJ2A 1H86A 5J7XA 3OZ2A 3BI2A 3WE0A 3RNMA 2C76A 4AT2A 4RSLA 2XVEA 1GT8A 3ABVA 4HA6A 5M0ZA 1RP0A 1PDHA 2A87A 4OVIA 4APNA 2Q6UA 4CRTA 3URHA 4REKA 3OC4A 3AWIA 3AYIA 3GDNA 1TYPA 2R0CA 1GESA 2BXRA 3NLCA 3UKKA 3GMCA 2H89A 2BS3A 3LXDA 1LQUA 3LOVA 4FK1A 3LADA 1IJHA 4OPUA 5BVAA 1E1MA 2QCUA 2WQYA 4JQ9A 1ONFA 3UOZA 1LV0A 4J56A 1CC2A 3ISHA 4Y4LA 2RGOA 2I0ZA 3K7QX 4A5LA 1S3BA 2NPXA 4FK1C 4O5QA 3H4KA 3QFAA 1Q1WA 1YKJA 3SFEA 4KX6A 5LV9A 4FDCB 2VQ7A 2EQ6A 4U2SA 1LVLA 4CNJA 2B9XA 1ZP0A 2RABA 4PAAA 1GSNA 2YR4A 3AE5A 4I58A 4YSHA 4CCRA 5BULA 1H81A 3DJJA 1DNCA 1XPQA 3RHAA 4H4PA 4H4WA 5IQ4A 2JB3A 4XWRA 1PBEA 3LZWA 2WEUA 3GSIA 3F8PA 1BKWA 1B5QA 4NEVA 2APGA 1B8SA 3NK2X 2XFUA 1IUXA 3CNTA 4DGKA 2X3NA 1DOCA 1LQTA 3F8DA 2O9ZA 4CY8A 3M0OA 2YR6A 4ZN0A 3LZXA 4IVOB 3P4PA 2YAUA 2GV8A 4YXDA 4EQSA 2V5ZA 4K2XA 1Z6LA 5JCLA 2GMJA 1FEAA 4EQRA 4RG4A 4AP1A 4X9MA 4J34A 4C3XA 4YSZA 4NTEA 3IF9A 2CFYA 2WP5A 4RG3A 4B64A 2JKCA 1OJ9A 1VG0A 3VRBA 4LU6A 3QVRA 1P2HA 4CCQA 3AE6A 4H4QA 3AD8B 5J60A 4U8JA 3DK4A 1EL9A 3EAOA 1TRBA 1EL8A 3ITJA 3FIMB 2ZBWA 5BRTA 1E1NA 1JNZA 1CBOA 2A89A 3C96A 1GETA 1S2QA 1DJNA 2GR3A 3AEAA 3I3LA 4MJWA 3QSMA 1QLBA 4TLZA 5IQ1A 2WOWA 4K8DA 2AQJA 1IUUA 2WETA 1KNRA 2EQ8A 2GRTA 2E4GA 2FJBA 3AYJA 3GRSA 5CKUA 5EOWA 4YKGA 1H6VA 1PJ6A 2X50A 3FMWA 2WOIA 1X31B 2XVFA 4XXGA 4D04A 4NTDA 4OPTA 4H2NA 1N4UA 2VRLA 3NTAA 5JCKA 1CJ3A 3FG2P 2CULA 2PYXA 3K7MX 3DGHA 5C2TA 3UTHA 4IA5A 3EPTA 3VR8A 1GV4A 1FOHA 4H4UA 1L0VA 3DJDA 4Z25A 1E6EA 3NYEA 2C75A 3AECA 1VDCA 1QJDA 1F6MA 1N1PA 4BK2A 3V3OA 2YLSA 3IC9A 5JCIA 1L9EA 5GSNA 3UOXA 4EM4A 3Q6JA 1M64A 4K5SA 1L9CA 1PBBA 5KOXA 3AD7B 1TDNA 3BNMA 2XLUA 4J33A
chains in the Genus database with same CATH superfamily
5J04A 3PO7A 3A7UA 2C72A 1AOGA 3T0KA 3ICRA 4GIRA 3CGEA 3S47A 4M0XA 1GPEA 3IHGA 2HXTA 4X4JA 2F5ZA 4D03A 1K0JA 2GSHA 2YLRA 2AL1A 3AE3A 1FIQB 4A9WA 2J3NA 3K1GA 3SYIA 3NGCX 4E4UA 4H4RA 1NU5A 4IVMB 2QGYA 4MKSA 2JK6A 2GR0A 5FMHA 3T6CA 5KMPA 1XDIA 4OPGA 2WDQA 3SM8A 2B9WA 3OPSA 3QN3A 2QVHA 4USRA 4J36A 4GYPC 2AAQA 3AE8A 5FS8A 1OJAA 1VRQB 3NO1A 2Q7VA 4U8IA 3CNPA 3MZNA 1N5XA 4A7AA 3CGBA 2XLRA 2YG4A 3UCLA 3EF6A 3MUCA 1BGJA 1F8RA 1EL7A 4FI4A 4CNKA 3CK5A 2BXSA 3M12A 1ELSA 5KVIA 1CC6A 1BWCA 4GGHA 3SN0A 3T2ZA 4A79A 2YG7A 3R07C 4H19A 3M13A 2WPCA 4IP4A 5HXIA 2OVLA 2MUCA 3ZLFA 3C4NA 1VDVA 3BSMA 1N63C 4YTNA 4OCGA 1N60C 3CYJA 2QJJA 3UCDA 3ETRB 1PBFA 2B76A 2GDQA 1E1KA 3SN1A 3AE7A 3PWGA 2RGJA 2OQHA 3V5CA 3NK1X 5FJRA 1BGNA 1L8PA 2O56A 3SZ0A 4H4TA 1NENA 1W6TA 2W54A 2YWLA 5EU9A 2YM1A 3PFRA 4E0VA 3OTRA 2OKTA 2BS4A 2GAHB 4C5OA 4BJZA 1KSSA 1GRTA 3IJIA 4GYPA 3HYVA 2NVKX 4YSXA 3SQPA 2PTXA 1MRAA 2C4CA 2GGJA 5U63A 4YWOA 3PS9A 3N6JA 2WBAA 2XFPA 1REOA 4K2SA 3V76A 1FFVC 3L5OA 2JBVA 2YG6A 4U8OA 3T2KA 2B7RA 4ZCCA 3VCNA 5JCMA 2PU1A 4B67A 4G73A 2Y6RA 4JDRA 4WCTA 1MNSA 2BK5A 3TOYA 4NTCA 1S7MA 2GR2A 1WYGA 2P8CA 1D7LA 1GRGA 2UZZA 3UOVA 1JPMA 3UCCA 1H2IA 1R0MA 3VDGA 2OZ3A 2XCGA 3AE1A 2YM2A 2AL2A 1KD0A 1BZLA 5HYMA 1RM6B 1IUSA 3IHMA 4GCMA 2BK4A 1CC4A 3QSEA 1HYUA 1NHQA 4UDPA 3O0HA 5FS9A 4EMWA 3NYFA 1ZOYA 1EBDA 3I6TA 3B3RA 3COXA 1GXFA 3CPIG 2PMQA 1S3EA 2AL2B 2GGGA 2X99A 1OJDA 1JPDX 2GQFA 5FJUA 1KKRA 3H70A 3BI2A 3WE0A 5M0ZA 4CRTA 2A87A 2BXRA 4KT2A 3LXDA 3UXKA 3LADA 1E1MA 3SZWA 3RR1A 4J56A 1CC2A 2RGOA 2I0ZA 3K7QX 1SJCA 4FK1C 1Q1WA 1YKJA 5LV9A 4FDCB 2VQ7A 2EQ6A 4U2SA 1LVLA 4CNJA 4PAAA 1GSNA 3AE5A 4YSHA 4CCRA 5BULA 3DJJA 1XPQA 4XWRA 1E9IA 3VCCA 1BKWA 1B5QA 2APGA 1B8SA 3PWIA 1TE6A 1LQTA 1SB3B 4ZN0A 3LZXA 2YAUA 4IZGA 1Z6LA 4AP1A 1MDLA 4J34A 7ENLA 2CFYA 4LU6A 1P2HA 4CCQA 1IYXA 3AD8B 4U8JA 1EL9A 2ZBWA 5BRTA 2A89A 5IQ1A 4K8DA 1KNRA 2FJBA 3AYJA 3GRSA 4MMWA 4DYEA 2WOIA 4NTDA 1N4UA 3UJSA 3UXLA 3T31A 3VR8A 4H4UA 4Z25A 4J1OA 3SN4A 3AECA 3TJ4A 1QJDA 2W3RA 1FHUA 3V3OA 2YLSA 3STPA 1RVKA 3UOXA 1PBBA 2VVLG 1TDNA 3BNMA 3DK8A 1P2EA 3BHFA 1IUWA 4CY6A 1E39A 1KFYA 1XANA 3P9UA 1X2HA 3GWFA 1ZXIC 4LIIA 4NZHA 1JDFA 3GO2A 1JEHA 5CQFA 3NNEA 1TDKA 2OLNA 4DSHA 5IPYA 3EANA 3ENLA 3ZYXA 2FBWA 2XFOA 2YVGA 1NPXA 1UKVG 1NDAA 4U2TA 2PSNA 3II4A 4JN7A 1SJDA 3KVEA 5C3JA 4X9NA 1DJQA 1K0LA 3L8KA 4U8LA 3CTYA 2DW7A 3BOXA 2V3BA 3ALLA 3TTEA 5BUKA 1MXTA 1O5WA 2ARDA 4ZA0A 4HCDA 1PJ7A 3BI5A 3T14A 2FJAA 4WX1A 4KPRA 2R4JA 3K30A 4E5TA 4DXKA 1BKHA 2GL5A 2YLWA 3VRDB 5M10A 5EB5A 4O5UA 4GUVA 4U2LA 3VRAA 2PS2A 4OPIA 4EQWA 2DKHA 3NHOX 5HHFA 2OPJA 3CPJG 2GAGB 4K8GA 4H50A 2WOVA 3V4BA 1MO9A 4FX9A 4A3RA 5EBKA 3SJNA 4BK1A 1ZMCA 3LJPA 3FJ4A 1JNRA 3VA8A 4GAVA 3E1TA 4C77A 6ENLA 3P4SA 1S2YA 3KD9A 3UKFA 2VRMA 1TYTA 1EBHA 2HXUA 3RP6A 4U8PA 3RP8A 2ZZBA 4AOSA 3T2YA 3UTGA 3JZUA 1P48A 4HB9A 3BJSA 4M52A 2Q0KA 4MGGA 3ICTA 2ONEA 4UDQA 3CGCA 1GRHA 4TM3A 5JCNA 5KVHA 4K22A 4OPCA 3DERA 2XVHA 3R9UA 3SBFA 1GEUA 2FKPA 1PJ5A 2HNEA 2W55A 4BURA 2CDUA 3UOYA 4GDPA 1F8WA 2YLXA 3QSSA 1V59A 2BC0A 5G5GB 4AP3A 1W4XA 5FJPA 4LA1A 1M6IA 1JCTA 1GERA 3KKJA 3JW7A 4IT1A 3CT2A 3TWAA 3B9JB 4K1WA 4TM0A 1PXCA 4Z26A 3RCYA 4Z2TA 3GC2A 1NG3A 1MDRA 3SGLA 3D9XA 1GOSA 2ZZCA 5U1OA 3CIRA 3ZVHA 3CXOA 2WU2A 2E5AA 1FFUC 3FXGA 2AR8A 4GMEA 1BF3A 3NN0X 4K5RA 3OZMA 4YWSA 4G7FA 3NYCA 3ZDNA 3MKCA 4USQA 2PP1A 1TZZA 2R0PA 3I6EA 1ZOVA 2OO6A 1FEBA 5FS7A 3ZVHB 4H2PA 4DNAA 3ICSA 3VC6A 4JNAA 3GRTA 3UKPA 2POZA 4H2QA 1KSUA 2HZGA 1GTHA 1OJCA 1PXAA 1PDYA 4BV6A 4EM3A 4ADWA 4H2RA 3AEDA 2XH2A 4J57A 3I6DA 4TM1A 3UJEA 3AEGA 1X2GA 3CAWA 4Z24A 4HNLA 3NVZB 4H83A 3AE4A 2BC1A 2NQLA 3GY1A 2GGEA 3GDPA 3DA1A 1N61C 5HY5A 1K4QA 2V6OA 1PBDA 4GF7A 3PK7A 1EC9A 2QA2A 3RITA 3UGVA 3A7AA 4JHMA 4C74A 3H8AA 4Z44A 2TPRA 2V61A 4Y4NA 4I59A 1TDEA 2RGHA 3CMMA 4Z43A 3G5RA 4EIQA 3AEBA 1CJ2A 1H86A 3OZ2A 4KEMA 3RNMA 3ES7A 4AT2A 3URHA 3HYWA 3OC4A 3AYIA 3P93A 1TYPA 3UKKA 2BS3A 3LOVA 1IJHA 4JQ9A 1ONFA 4G6HA 1BQGA 3NFUA 1ZP0A 2YR4A 3OW1A 1OEPA 1DNCA 2P3ZA 4H4PA 5IQ4A 5BOFA 2WEUA 3P0WA 3CNTA 1DOCA 4F4RA 4CY8A 2PTZA 3T8QA 4YXDA 5JCLA 3QPEA 4RG4A 4C3XA 4YSZA 4B64A 2WP5A 1OJ9A 1VG0A 3T9PA 3QVRA 3DG7A 5KMRA 3FIMB 2PGEA 4YSYA 2WETA 2EQ8A 2GRTA 1H6VA 3FMWA 1X31B 2XVFA 4OPTA 4IA5A 3EPTA 1GV4A 3NYEA 2C75A 3NZGA 1F6MA 5GSNA 1DXLA 1EBGA 3NVVB 4Z2UA 4G6GA 3NTDA 1YQ3A 1F3PA 4EMIA 2OFJA 2IVDA 2W0HA 2PGWA 4B66A 1FHVA 3AE2A 4PABA 2EQ7A 4Z2RA 2QDDA 1PN0A 1B37A 1KNPA 3SSZA 2OALA 2VZ2A 3HW2A 2YLZA 5G5HB 3MSYA 2XVIA 3UP4A 2XFQA 3FVDA 1K0IA 2YG3A 3KLJA 1FL2A 4H7UA 2XGZA 4YTMA 2TMDA 2EQ9A 4C3YA 5FJOA 1FECA 1NHSA 1Y0PA 3EEZA 2BA9A 2E5VA 5ER0A 2R9ZA 2XSXA 3DFHA 3D1CA 1P43A 2XLTA 3KUMA 2E1MA 2BCPA 4J2WA 3ES8A 1N62C 3MY9A 4G74A 3ATRA 2VOUA 4KPLA 1GTEA 5U25A 3CNDA 3SXIA 1SJBA 3KU9A 1H7WA 3S5WA 1GRAA 2GB0A 1LPFA 3I4KA 2Z5YA 3UTEA 4A6GA 1GREA 2WDRA 3T37A 2FJEA 4J31A 2C70A 4HPNA 2QAEA 2JB2A 2GGHA 2YR5A 5KXJA 2WP9A 4FP1A 1XPYA 3V5FA 1GALA 3SQSA 4N9XA 3REDA 3NKSA 4II2A 3FPZA 2A8XA 4HNCA 1TDFA 1YQ4A 4AOXA 3G5SA 2XH7A 2DW6A 3NXLA 1TDOA 1NHRA 1D4CA 1QO8A 3CGDA 3UJ2A 2QQ6A 1F8SA 5KWFA 3N4EA 1H83A 3B6DA 4H4SA 2WDVA 2BCGG 5TR3A 4II3A 1R6WA 2OZTA 3CB3A 4U8KA 3CN8A 3BI4A 1JU2A 4UP3A 3NRNA 3VC5A 1VQZA 1ZDLA 1MOKA 5FS6A 3TWBA 2WP6A 1H7XA 4XWZA 3A7RA 4IA6A 3GYXA 3T4WA 1GNDA 3CNSA 1PXBA 1KDGA 2YQUA 2BS2A 3EUB3 5KRQA 2IVEA 4DX3A 3KA7A 4OPDA 4U8MA 1NELA 3C4AA 3FBSA 4A65A 1Q1RA 3Q4DA 4IL2A 2OG9A 2WU5A 1DOBA 2XLSA 1VQWA 4DN1A 4EIPA 3UTFA 1DOEA 5KNLA 1ZMDA 3ATQA 3CXBA 2OLAA 5BOEA 2WPFA 4YTPA 2QJNA 1NG4A 2ACZA 1GRBA 3VR9A 4H4ZA 1O94A 3ZVIA 1PBCA 2VVMA 1L9DA 1E1LA 4IV9A 4GR1A 4KWSA 5DBJA 2CVJA 4H4XA 1CL0A 1H82A 1H84A 1KF6A 4E8GA 2BK3A 1D7YA 1RSGA 3NN6X 2GMHA 4ZCWA 3NIXA 3DGZA 1PHHA 4YT0A 2PP3A 3AD9B 2WHDA 3Q9TA 3S61A 1JRZA 3B97A 4DWDA 5KMSA 1YQZA 5EB4A 4G8TA 1JRYA 4EWJA 3RRAA 4CBQA 1N5WC 2YVFA 1D4EA 4DHGA 4GFIA 4H1ZA 3P4QA 2XH4A 2V60A 1CJ4A 3RP7A 2X8GA 3NK0X 4JY2A 3CPHG 1PS9A 3GD3A 4JY3A 3MWCA 5J7XA 2C76A 1T3QC 4RSLA 3R25A 1GT8A 1RP0A 4OVIA 4APNA 4GGBA 4REKA 3AWIA 3GDNA 1ONEA 3TJIA 2R0CA 3FCPA 1TKKA 1LQUA 1JROA 3MQTA 2QCUA 2WQYA 4Y4LA 4E4FA 4A5LA 1S3BA 4O5QA 3ZLHA 4I58A 3R0UA 4X2PA 3TQPA 4H4WA 1PBEA 3LZWA 4NEVA 4TVYA 2XFUA 2X3NA 2O9ZA 3M0OA 1STZA 1FO4A 3FYYA 4IVOB 2GV8A 4J3ZA 2V5ZA 4K2XA 3SZFA 2GMJA 1FEAA 4X9MA 4NTEA 4RG3A 1KCZA 3AE6A 3DIPA 2P8BA 2PTYA 3U9IA 5J60A 3EAOA 3ITJA 2GGIA 1E1NA 1JNZA 1CBOA 3AN1A 3C96A 3I3LA 4TLZA 2GR3A 3AEAA 3QSMA 2WOWA 3HPFA 3NVYB 2AQJA 2E4GA 5CKUA 5EOWA 4YKGA 2X50A 2QJMA 4H2NA 2VRLA 3NTAA 2CULA 2PYXA 5FJTA 3DGHA 5C2TA 1WUEA 3UTHA 4Z1YA 3RO6A 1E6EA 1VDCA 2AKZA 2ZC8A 1N1PA 4BK2A 5ENLA 3IK4A 3Q6JA 1M64A 1PDZA 1L9CA 5KOXA 4ENLA 3AD7B 2PPGA 2XLUA 3AEEA 4EMJA 4JN8A 2QDEA 2JAEA 4HCHA 3H8LA 2BYBA 3DK9A 1MUCA 2XH0A 3AE9A 2C66A 2X8HA 2B9YA 2P0IA 1JRXA 3GMBA 4DSGA 4ZOHB 1B4VA 3SFDA 2BRYA 4B69A 3BHKA 1XS2A 2PHHA 3V3NA 3DJGX 2C73A 3ALMA 3PVCA 3GD4A 1N4WA 3ADAB 5GRTA 3DH9A 3EKGA 4H4VA 3D8XA 2YLTA 2GVCA 2WS3A 3P4RA 1XHCA 3F8RA 2PCEA 4H2HA 2CHRA 3DESA 2BACA 1D4DA 5IDZA 4H4YA 3AB1A 3R10A 3V3WA 2GF3A 4YKFA 5KMQA 1NEKA 1NHPA 2ZADA 2GR1A 3UKAA 4HYRA 2OLOA 1F9CA 4Z17A 1SEZA 1COYA 3UP5A 2YG5A 2C3DA 4TLXA 2WESA 2Y6QA 3DGBA 4M6UA 1CJCA 3QKEA 2RDXA 1ZKQA 3JSKA 1EC8A 2JB1A 2PODA 3SY4A 2FYMA 1ZY8A 1N4VA 4K7ZA 4NNJA 1IUTA 1LJ1A 3N4FA 4U8NA 2E3TA 2BABA 4B1BA 4GRTA 3LB8A 4HCLA 2XYOA 1OJTA 2I5QA 3U4FA 2XFNA 2GQWA 1Y56A 4B68A 4JN9A 4GAPA 3OP2A 4EQXA 2R46A 1SJAA 2C3CA 3D47A 1LTXR 4IHCA 3GYIA 3KPFA 4NEWA 3Q45A 5JRBA 1O95A 3HZLA 2H88A 2BRAA 2PA6A 3DFYA 2Z5XA 2PU0A 3NG7X 2C67A 1JOAA 1Y56B 1CF3A 3NRZB 3P1WA 3GYJA 4AT0A 1DODA 3VFCA 2GEWA 4A6NA 3NS1B 1KKOA 3QJ4A 2QA1A 2OA1A 1DTNA 3DJEA 4ROPA 2B7SA 1IUVA 1FCDA 4TM4A 3BNUA 3H12A 2C7GA 3OZYA 4BK3A 1RYIA 1VG9A 3AEFA 3GWDA 3AXBA 3UKLA 2OZ8A 3QFBA 2XLPA 4A6NB 3ALJA 1KN0A 2XDOA 1YY5A 3DG3A 1V97A 2OQYA 2W3SA 5KOWA 2R4EA 3TCSA 3VQRA 2ZZ0A 4ZCDA 4UDRA 3PG6A 1E7PA 2XVJA 2GH5A 2DKIA 3IWAA 1GRFA 2V3AA 3H7VA 4BJYA 1YEYA 3IJLA 2R45A 2VQBA 3SR6B 2PTWA 2FJDA 3QVPA 4E6MA 1ZK7A 2VVLA 3UKQA 3AM9A 3CNJA 4ICYA 3DMEA 3JVAA 4ECHA 4JNQA 3DDMA 2Q0LA 4GDEA 2X8CA 3HRDC 3AMZA 4Y4MA 2OX4A 3D46A 3DEQA 4OPLA 3K7TA 3UKHA 1ZX9A 3P3BA 4A99A 1EL5A 4B63A 2YVJA 3G5QA 3NT6A 4P9SA 4B65A 1D5TA 4HN8A 4GISA 2WPEA 1CHUA 1Q9IA 4IP5A 2R0GA 1NAAA 5L46A 3SZCA 2IIDA 2OAMA 2HQMA 2MNRA 3L1RA 1ELIA 3NH3X 2C64A 3H8IA 2C65A 3AYLA 2PP0A 2XVEA 3ABVA 4G9KA 4HA6A 1PDHA 2Q6UA 1GESA 3NLCA 3GMCA 2H89A 4FK1A 4OPUA 5BVAA 4TVWA 3UOZA 1LV0A 3ISHA 3R1ZA 4IL0A 3KPKA 3NVWB 2NPXA 3H4KA 3QFAA 4A35A 3SFEA 4KX6A 3UJRA 2B9XA 2RABA 1H81A 1JRPA 2AKMA 3RHAA 1EC7A 2JB3A 3GSIA 3F8PA 3NK2X 1IUXA 4DGKA 3TW9A 1WUFA 3F8DA 3R0KA 2YR6A 3P4PA 3N6HA 3UJFA 4EQSA 3QTPA 3IJQA 4EQRA 3IF9A 2P88A 2JKCA 3FV9A 3VRBA 1ECQA 3DG6A 3RGTA 3R11A 3HYXA 4H4QA 4NWZA 3DK4A 1TRBA 1EL8A 1GETA 1S2QA 1DJNA 4MJWA 1QLBA 3SX6A 1IUUA 1PJ6A 4XXGA 4D04A 3QLDA 3S5SA 5JCKA 1CJ3A 3FG2P 3THUA 3K7MX 1FOHA 1L0VA 3DJDA 3IC9A 3GD6A 5JCIA 1L9EA 4EM4A 4K5SA 3ZLGA 4J33A
chains in the Genus database with same CATH topology
3AEEA 1DXLA 4EMJA 3DK8A 2JAEA 1P2EA 3PO7A 3BHFA 3H8LA 2BYBA 3DK9A 2C72A 3AE9A 1AOGA 1IUWA 3T0KA 4CY6A 4Z2UA 1E39A 2C66A 3ICRA 2X8HA 1KFYA 1XANA 1YQ3A 2B9YA 3NTDA 1JRXA 1F3PA 3GMBA 3P9UA 1B4VA 3SFDA 3CGEA 3GWFA 4EMIA 4DSGA 2IVDA 2W0HA 4B66A 2BRYA 4B69A 1GPEA 3BHKA 3AE2A 4LIIA 2PHHA 3V3NA 4NZHA 4PABA 2EQ7A 3DJGX 2C73A 3ALMA 3IHGA 4X4JA 3PVCA 1PN0A 4Z2RA 3GD4A 1B37A 4G6GA 1N4WA 2F5ZA 3ADAB 5GRTA 3DH9A 1KNPA 4H4VA 3D8XA 1JEHA 2YLTA 2GVCA 1K0JA 2OALA 2VZ2A 2WS3A 3NNEA 3P4RA 5CQFA 4D03A 1TDKA 2YLZA 2YLRA 1XHCA 2OLNA 3F8RA 4DSHA 5IPYA 3AE3A 3EANA 3ZYXA 2XVIA 3UP4A 2FBWA 4A9WA 2J3NA 2XFQA 2XFOA 2YVGA 1K0IA 3NGCX 3SYIA 1NPXA 1UKVG 2YG3A 3KLJA 1NDAA 4U2TA 1FL2A 4H7UA 2BACA 3II4A 4H4RA 1D4DA 4YTMA 3KVEA 2TMDA 5C3JA 4IVMB 2EQ9A 4C3YA 4H4YA 3AB1A 4X9NA 1FECA 1DJQA 1NHSA 1K0LA 2JK6A 1Y0PA 2GR0A 3L8KA 4U8LA 2BA9A 3CTYA 2E5VA 5FMHA 2V3BA 3ALLA 5ER0A 2R9ZA 2GF3A 4YKFA 5KMQA 5BUKA 1MXTA 1O5WA 2ARDA 1NEKA 5KMPA 1XDIA 1NHPA 4OPGA 2GR1A 1PJ7A 2WDQA 3BI5A 3UKAA 3D1CA 3T14A 2FJAA 4WX1A 4KPRA 2XLTA 2R4JA 3K30A 3SM8A 2B9WA 2E1MA 2BCPA 4USRA 4J36A 2OLOA 2AAQA 2YLWA 3AE8A 5FS8A 4J2WA 3VRDB 5M10A 5EB5A 4O5UA 4GUVA 4U2LA 4G74A 1OJAA 3ATRA 2VOUA 1SEZA 3VRAA 1GTEA 5U25A 1COYA 3CNDA 3SXIA 2YG5A 2C3DA 4TLXA 3UP5A 1VRQB 3KU9A 4OPIA 4EQWA 2DKHA 1H7WA 2Q7VA 4U8IA 3NHOX 2WESA 5HHFA 3S5WA 1GRAA 2Y6QA 1CJCA 2GB0A 3CNPA 3CPJG 2GAGB 1LPFA 2WOVA 1ZKQA 4H50A 2Z5YA 3JSKA 2JB1A 1MO9A 3UTEA 3SY4A 1GREA 4FX9A 4A7AA 3CGBA 5EBKA 2XLRA 4BK1A 1ZY8A 1ZMCA 2YG4A 2WDRA 3EF6A 3LJPA 3T37A 3UCLA 1JNRA 1N4VA 2FJEA 4J31A 2C70A 1BGJA 4K7ZA 4YSYA 2QAEA 1F8RA 2JB2A 4GAVA 4NNJA 3E1TA 4C77A 1IUTA 1LJ1A 4U8NA 3P4SA 1EL7A 2VVLG 2YR5A 1S2YA 5KXJA 2WP9A 2BABA 3KD9A 4B1BA 3UKFA 4CNKA 2VRMA 1GALA 2BXSA 1TYTA 4GRTA 3RP6A 3LB8A 4U8PA 3RP8A 2XYOA 1OJTA 3M12A 4N9XA 2ZZBA 3REDA 4AOSA 3NKSA 4II2A 5KVIA 1CC6A 3T2YA 3UTGA 1BWCA 3FPZA 2A8XA 2XFNA 3T2ZA 1TDFA 4HB9A 1YQ4A 4AOXA 3G5SA 4A79A 2YG7A 4M52A 2Q0KA 2GQWA 1Y56A 4B68A 3M13A 3ICTA 1TDOA 4JN9A 4UDQA 3CGCA 2WPCA 1GRHA 4TM3A 5JCNA 1NHRA 1D4CA 1QO8A 5KVHA 4GAPA 5HXIA 4K22A 4OPCA 3C4NA 4EQXA 3CGDA 2R46A 4YTNA 4OCGA 2C3CA 1F8SA 2XVHA 3R9UA 5KWFA 1LTXR 1GEUA 3GYIA 1H83A 3KPFA 3B6DA 1PJ5A 4H4SA 2WDVA 5TR3A 4NEWA 4BURA 2BCGG 1PBFA 2B76A 2CDUA 4II3A 3UOYA 1E1KA 3AE7A 5JRBA 4U8KA 4GDPA 2RGJA 1F8WA 1O95A 2YLXA 3HZLA 1V59A 2H88A 2BRAA 3QSSA 3BI4A 2BC0A 3CN8A 3NK1X 2Z5XA 1BGNA 3NG7X 2C67A 1JOAA 1Y56B 1CF3A 4AP3A 3P1WA 1W4XA 3GYJA 4AT0A 1DODA 4LA1A 2GEWA 1JU2A 4A6NA 4UP3A 3NRNA 3SZ0A 4H4TA 3QJ4A 1M6IA 2QA1A 1NENA 1GERA 2OA1A 2YWLA 3DJEA 3KKJA 1ZDLA 1MOKA 5FS6A 2WP6A 1H7XA 2B7SA 1IUVA 2YM1A 4XWZA 4E0VA 4IA6A 1FCDA 4TM4A 3GYXA 2BS4A 3BNUA 2C7GA 4TM0A 1GNDA 1PXCA 1PXBA 3CNSA 1KDGA 4Z26A 2GAHB 4C5OA 2YQUA 4BJZA 1KSSA 1GRTA 4BK3A 1RYIA 4Z2TA 1VG9A 3AEFA 2BS2A 3GWDA 1NG3A 5KRQA 3HYVA 2IVEA 2NVKX 3AXBA 3UKLA 4YSXA 3KA7A 3SQPA 3SGLA 3D9XA 1GOSA 4OPDA 3QFBA 2XLPA 4U8MA 3C4AA 4A6NB 2ZZCA 1KN0A 3ALJA 3FBSA 2C4CA 4A65A 1Q1RA 5U1OA 2XDOA 2WU5A 1DOBA 1YY5A 2XLSA 3CIRA 1VQWA 5U63A 4YWOA 4EIPA 3UTFA 3PS9A 5KOWA 2WBAA 1DOEA 1ZMDA 2XFPA 2R4EA 5KNLA 1REOA 2WU2A 3VQRA 2ZZ0A 3ATQA 2AR8A 2JBVA 3L5OA 3V76A 2YG6A 4U8OA 4ZCDA 3T2KA 2B7RA 4UDRA 1BF3A 3PG6A 1E7PA 2XVJA 4ZCCA 3NN0X 2GH5A 5JCMA 3NYCA 4K5RA 2DKIA 3IWAA 3ZDNA 1GRFA 2WPFA 4YTPA 1NG4A 2ACZA 4USQA 2V3AA 4B67A 4G73A 4BJYA 1GRBA 3VR9A 2R45A 2R0PA 2VQBA 4H4ZA 1O94A 1PBCA 1ZOVA 4JDRA 2Y6RA 2FJDA 3QVPA 4WCTA 2VVMA 1L9DA 1E1LA 4IV9A 2BK5A 1ZK7A 4GR1A 2VVLA 1FEBA 1S7MA 4NTCA 5DBJA 5FS7A 3UKQA 2GR2A 2CVJA 3CNJA 4H4XA 1CL0A 1H82A 4H2PA 4DNAA 1H84A 3ICSA 4ICYA 1KF6A 3DMEA 4JNAA 3GRTA 3UKPA 4ECHA 1D7LA 2BK3A 2Q0LA 4JNQA 1D7YA 1RSGA 1GRGA 3NN6X 2UZZA 2GMHA 4GDEA 2X8CA 4H2QA 3UOVA 1KSUA 4Y4MA 1GTHA 1H2IA 1OJCA 3NIXA 3DGZA 4OPLA 1PXAA 3K7TA 3UKHA 4BV6A 1PHHA 1ZX9A 4EM3A 4ADWA 4YT0A 4H2RA 2XCGA 3AEDA 3AE1A 3AD9B 4J57A 2YM2A 3I6DA 4A99A 4TM1A 2WHDA 1BZLA 3AEGA 5HYMA 1IUSA 1EL5A 3Q9TA 3IHMA 3S61A 4B63A 1JRZA 4GCMA 2YVJA 2BK4A 3G5QA 3NT6A 1CC4A 3QSEA 5KMSA 4Z24A 1HYUA 1NHQA 1YQZA 5EB4A 4UDPA 4P9SA 4B65A 3O0HA 5FS9A 3AE4A 2BC1A 1D5TA 4EMWA 3NYFA 1JRYA 1ZOYA 3GDPA 2WPEA 1CHUA 1Q9IA 3DA1A 1EBDA 5HY5A 3B3RA 4CBQA 2R0GA 1NAAA 5L46A 1K4QA 2V6OA 1PBDA 4GF7A 3SZCA 2YVFA 3COXA 1GXFA 1D4EA 2IIDA 2QA2A 3CPIG 1S3EA 2OAMA 2HQMA 3L1RA 1ELIA 3NH3X 3P4QA 2C64A 4C74A 3H8IA 2V60A 1CJ4A 3RP7A 2X8GA 3NK0X 4Z44A 2TPRA 4JY2A 2C65A 2V61A 2X99A 1OJDA 4Y4NA 4I59A 1TDEA 2RGHA 3CPHG 3CMMA 2GQFA 1PS9A 3AYLA 3GD3A 4JY3A 4Z43A 3G5RA 4EIQA 3AEBA 1CJ2A 1H86A 5J7XA 3OZ2A 3BI2A 3WE0A 3RNMA 2C76A 4AT2A 4RSLA 2XVEA 1GT8A 3ABVA 4G9KA 4HA6A 1RP0A 1PDHA 2A87A 4OVIA 4APNA 2Q6UA 5M0ZA 4CRTA 3URHA 4REKA 3HYWA 3OC4A 3AWIA 3AYIA 3GDNA 1TYPA 2R0CA 1GESA 2BXRA 3NLCA 3UKKA 3GMCA 2H89A 2BS3A 3LXDA 1LQUA 3LOVA 4FK1A 3LADA 1IJHA 4OPUA 5BVAA 1E1MA 2QCUA 2WQYA 3SZWA 4JQ9A 1ONFA 3UOZA 1LV0A 4G6HA 4J56A 1CC2A 3ISHA 4Y4LA 3KPKA 2RGOA 2I0ZA 3K7QX 4A5LA 1S3BA 2NPXA 4FK1C 4O5QA 3H4KA 3QFAA 1Q1WA 1YKJA 3SFEA 4KX6A 5LV9A 4FDCB 2VQ7A 2EQ6A 4U2SA 1LVLA 4CNJA 2B9XA 1ZP0A 2RABA 4PAAA 1GSNA 2YR4A 3AE5A 4I58A 4YSHA 4CCRA 5BULA 1H81A 3DJJA 1DNCA 1XPQA 3RHAA 4H4PA 4H4WA 5IQ4A 2JB3A 4XWRA 1PBEA 3LZWA 2WEUA 3GSIA 3F8PA 1BKWA 1B5QA 4NEVA 2APGA 1B8SA 3NK2X 2XFUA 1IUXA 3CNTA 4DGKA 2X3NA 1DOCA 1LQTA 3F8DA 2O9ZA 4CY8A 3M0OA 2YR6A 4ZN0A 3LZXA 4IVOB 3P4PA 2YAUA 2GV8A 4YXDA 4EQSA 2V5ZA 4K2XA 1Z6LA 5JCLA 3SZFA 2GMJA 1FEAA 4EQRA 4RG4A 4AP1A 4X9MA 4J34A 4C3XA 4YSZA 4NTEA 3IF9A 2CFYA 2WP5A 4RG3A 4B64A 2JKCA 1OJ9A 1VG0A 3VRBA 4LU6A 3QVRA 1P2HA 3HYXA 4CCQA 3AE6A 4H4QA 4NWZA 3AD8B 5J60A 4U8JA 3DK4A 1EL9A 3EAOA 1TRBA 1EL8A 3ITJA 5KMRA 3FIMB 2ZBWA 5BRTA 1E1NA 1JNZA 1CBOA 2A89A 3C96A 1GETA 1S2QA 1DJNA 2GR3A 3AEAA 3I3LA 4MJWA 3QSMA 1QLBA 4TLZA 5IQ1A 2WOWA 4K8DA 2AQJA 3SX6A 1IUUA 2WETA 1KNRA 2EQ8A 2GRTA 2E4GA 2FJBA 3AYJA 3GRSA 5CKUA 5EOWA 4YKGA 1H6VA 1PJ6A 2X50A 3FMWA 2WOIA 1X31B 2XVFA 4XXGA 4D04A 4NTDA 4OPTA 4H2NA 1N4UA 2VRLA 3NTAA 5JCKA 1CJ3A 3FG2P 2CULA 2PYXA 3K7MX 3DGHA 5C2TA 3UTHA 4IA5A 3EPTA 3T31A 3VR8A 1GV4A 1FOHA 4H4UA 1L0VA 3DJDA 4Z25A 1E6EA 3NYEA 2C75A 3AECA 1VDCA 1QJDA 1F6MA 1N1PA 4BK2A 3V3OA 2YLSA 3IC9A 5JCIA 1L9EA 5GSNA 3UOXA 4EM4A 3Q6JA 1M64A 4K5SA 1L9CA 1PBBA 5KOXA 3AD7B 1TDNA 3BNMA 2XLUA 4J33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEE A;  1DXL A;  4EMJ A;  3DK8 A;  2JAE A;  1P2E A;  3PO7 A;  3BHF A;  3H8L A;  2BYB A;  3DK9 A;  2C72 A;  3AE9 A;  1AOG A;  1IUW A;  4CY6 A;  4Z2U A;  1E39 A;  2C66 A;  3ICR A;  2X8H A;  1KFY A;  1XAN A;  1YQ3 A;  2B9Y A;  3NTD A;  1JRX A;  1F3P A;  3GMB A;  3P9U A;  1B4V A;  3SFD A;  3CGE A;  3GWF A;  4EMI A;  4DSG A;  2IVD A;  2W0H A;  4B66 A;  4B69 A;  1GPE A;  3BHK A;  3AE2 A;  4LII A;  2PHH A;  3V3N A;  4NZH A;  4PAB A;  2EQ7 A;  3DJG X;  2C73 A;  3ALM A;  3IHG A;  4X4J A;  3PVC A;  1PN0 A;  4Z2R A;  3GD4 A;  1B37 A;  1N4W A;  2F5Z A;  3ADA B;  5GRT A;  3DH9 A;  1KNP A;  4H4V A;  3D8X A;  1JEH A;  2YLT A;  2GVC A;  1K0J A;  2OAL A;  2VZ2 A;  2WS3 A;  3NNE A;  3P4R A;  5CQF A;  4D03 A;  1TDK A;  2YLZ A;  2YLR A;  1XHC A;  2OLN A;  3F8R A;  4DSH A;  5IPY A;  3AE3 A;  3EAN A;  3ZYX A;  2XVI A;  3UP4 A;  2FBW A;  4A9W A;  2J3N A;  2XFQ A;  2XFO A;  2YVG A;  1K0I A;  3NGC X;  1NPX A;  1UKV G;  2YG3 A;  3KLJ A;  1NDA A;  4U2T A;  1FL2 A;  4H7U A;  2BAC A;  3II4 A;  4H4R A;  1D4D A;  4YTM A;  3KVE A;  2TMD A;  5C3J A;  4IVM B;  2EQ9 A;  4C3Y A;  4H4Y A;  3AB1 A;  4X9N A;  1FEC A;  1DJQ A;  1NHS A;  1K0L A;  2JK6 A;  1Y0P A;  2GR0 A;  3L8K A;  4U8L A;  2BA9 A;  3CTY A;  2E5V A;  5FMH A;  2V3B A;  3ALL A;  5ER0 A;  2R9Z A;  2GF3 A;  4YKF A;  5BUK A;  1MXT A;  1O5W A;  2ARD A;  1NEK A;  1XDI A;  1NHP A;  4OPG A;  2GR1 A;  1PJ7 A;  2WDQ A;  3BI5 A;  3UKA A;  3D1C A;  2FJA A;  4WX1 A;  4KPR A;  2XLT A;  2R4J A;  3K30 A;  3SM8 A;  2B9W A;  2E1M A;  2BCP A;  4USR A;  4J36 A;  2OLO A;  2AAQ A;  2YLW A;  3AE8 A;  5FS8 A;  4J2W A;  3VRD B;  5M10 A;  5EB5 A;  4O5U A;  4GUV A;  4U2L A;  1OJA A;  3ATR A;  2VOU A;  1SEZ A;  3VRA A;  1GTE A;  5U25 A;  1COY A;  3CND A;  3UP5 A;  2YG5 A;  2C3D A;  4TLX A;  1VRQ B;  3KU9 A;  4OPI A;  4EQW A;  2DKH A;  1H7W A;  2Q7V A;  4U8I A;  3NHO X;  2WES A;  5HHF A;  3S5W A;  1GRA A;  2Y6Q A;  1CJC A;  2GB0 A;  3CNP A;  3CPJ G;  2GAG B;  1LPF A;  2WOV A;  1ZKQ A;  4H50 A;  2Z5Y A;  3JSK A;  2JB1 A;  1MO9 A;  3UTE A;  1GRE A;  4FX9 A;  4A7A A;  3CGB A;  5EBK A;  2XLR A;  4BK1 A;  1ZY8 A;  1ZMC A;  2YG4 A;  2WDR A;  3EF6 A;  3LJP A;  3T37 A;  3UCL A;  1JNR A;  1N4V A;  2FJE A;  4J31 A;  2C70 A;  1BGJ A;  4K7Z A;  4YSY A;  2QAE A;  1F8R A;  2JB2 A;  3E1T A;  4C77 A;  1IUT A;  1LJ1 A;  4U8N A;  3P4S A;  1EL7 A;  2VVL G;  2YR5 A;  1S2Y A;  5KXJ A;  2WP9 A;  2BAB A;  3KD9 A;  4B1B A;  3UKF A;  4CNK A;  2VRM A;  1GAL A;  2BXS A;  1TYT A;  4GRT A;  3RP6 A;  3LB8 A;  4U8P A;  3RP8 A;  2XYO A;  1OJT A;  3M12 A;  4N9X A;  2ZZB A;  3RED A;  4AOS A;  3NKS A;  5KVI A;  1CC6 A;  3UTG A;  1BWC A;  3FPZ A;  2A8X A;  2XFN A;  1TDF A;  4HB9 A;  1YQ4 A;  4AOX A;  3G5S A;  4A79 A;  2YG7 A;  4M52 A;  2Q0K A;  2GQW A;  1Y56 A;  4B68 A;  3M13 A;  3ICT A;  1TDO A;  4JN9 A;  4UDQ A;  3CGC A;  2WPC A;  1GRH A;  4TM3 A;  5JCN A;  1NHR A;  1D4C A;  1QO8 A;  5KVH A;  5HXI A;  4K22 A;  4OPC A;  3C4N A;  4EQX A;  3CGD A;  2R46 A;  4YTN A;  4OCG A;  2C3C A;  1F8S A;  2XVH A;  3R9U A;  5KWF A;  1LTX R;  1GEU A;  3GYI A;  1H83 A;  3KPF A;  3B6D A;  1PJ5 A;  4H4S A;  2WDV A;  5TR3 A;  4NEW A;  4BUR A;  2BCG G;  1PBF A;  2B76 A;  2CDU A;  3UOY A;  1E1K A;  3AE7 A;  4U8K A;  4GDP A;  2RGJ A;  1F8W A;  1O95 A;  2YLX A;  3HZL A;  1V59 A;  2H88 A;  3QSS A;  3BI4 A;  2BC0 A;  3CN8 A;  3NK1 X;  2Z5X A;  1BGN A;  3NG7 X;  2C67 A;  1JOA A;  1Y56 B;  1CF3 A;  4AP3 A;  3P1W A;  1W4X A;  3GYJ A;  4AT0 A;  1DOD A;  4LA1 A;  2GEW A;  1JU2 A;  4A6N A;  4UP3 A;  3NRN A;  4H4T A;  3QJ4 A;  1M6I A;  2QA1 A;  1NEN A;  1GER A;  2OA1 A;  2YWL A;  3DJE A;  3KKJ A;  1ZDL A;  1MOK A;  5FS6 A;  2WP6 A;  1H7X A;  2B7S A;  1IUV A;  2YM1 A;  4XWZ A;  4E0V A;  4IA6 A;  1FCD A;  4TM4 A;  2BS4 A;  3BNU A;  2C7G A;  4TM0 A;  1GND A;  1PXC A;  1PXB A;  3CNS A;  1KDG A;  4Z26 A;  2GAH B;  4C5O A;  2YQU A;  4BJZ A;  1KSS A;  1GRT A;  4BK3 A;  1RYI A;  4Z2T A;  1VG9 A;  3AEF A;  2BS2 A;  3GWD A;  1NG3 A;  5KRQ A;  2IVE A;  2NVK X;  3AXB A;  3UKL A;  4YSX A;  3KA7 A;  3SQP A;  3SGL A;  1GOS A;  4OPD A;  3QFB A;  2XLP A;  4U8M A;  3C4A A;  4A6N B;  2ZZC A;  3ALJ A;  3FBS A;  4A65 A;  1Q1R A;  5U1O A;  2XDO A;  2WU5 A;  1DOB A;  1YY5 A;  2XLS A;  3CIR A;  1VQW A;  5U63 A;  4YWO A;  4EIP A;  3UTF A;  3PS9 A;  5KOW A;  2WBA A;  1DOE A;  1ZMD A;  2XFP A;  2R4E A;  1REO A;  2WU2 A;  3VQR A;  2ZZ0 A;  3ATQ A;  2AR8 A;  2JBV A;  3V76 A;  2YG6 A;  4U8O A;  4ZCD A;  2B7R A;  4UDR A;  1BF3 A;  1E7P A;  2XVJ A;  4ZCC A;  3NN0 X;  2GH5 A;  5JCM A;  3NYC A;  4K5R A;  2DKI A;  3IWA A;  3ZDN A;  1GRF A;  2WPF A;  4YTP A;  1NG4 A;  2ACZ A;  4USQ A;  2V3A A;  4B67 A;  4BJY A;  1GRB A;  3VR9 A;  2R45 A;  2R0P A;  2VQB A;  4H4Z A;  1O94 A;  1PBC A;  1ZOV A;  4JDR A;  2Y6R A;  2FJD A;  3QVP A;  4WCT A;  2VVM A;  1L9D A;  1E1L A;  4IV9 A;  2BK5 A;  1ZK7 A;  4GR1 A;  2VVL A;  1FEB A;  4NTC A;  5DBJ A;  5FS7 A;  3UKQ A;  2GR2 A;  2CVJ A;  3CNJ A;  4H4X A;  1CL0 A;  1H82 A;  4H2P A;  4DNA A;  1H84 A;  3ICS A;  4ICY A;  1KF6 A;  3DME A;  4JNA A;  3GRT A;  3UKP A;  4ECH A;  1D7L A;  2BK3 A;  2Q0L A;  4JNQ A;  1D7Y A;  1RSG A;  1GRG A;  3NN6 X;  2UZZ A;  2GMH A;  4GDE A;  2X8C A;  4H2Q A;  3UOV A;  1KSU A;  4Y4M A;  1GTH A;  1OJC A;  3NIX A;  3DGZ A;  4OPL A;  1PXA A;  3K7T A;  3UKH A;  4BV6 A;  1PHH A;  1ZX9 A;  4EM3 A;  4ADW A;  4YT0 A;  4H2R A;  2XCG A;  3AED A;  3AE1 A;  3AD9 B;  4J57 A;  2YM2 A;  3I6D A;  4A99 A;  4TM1 A;  2WHD A;  1BZL A;  3AEG A;  5HYM A;  1IUS A;  1EL5 A;  3Q9T A;  3IHM A;  3S61 A;  4B63 A;  1JRZ A;  4GCM A;  2YVJ A;  2BK4 A;  3G5Q A;  3NT6 A;  1CC4 A;  3QSE A;  4Z24 A;  1HYU A;  1NHQ A;  1YQZ A;  5EB4 A;  4UDP A;  4P9S A;  4B65 A;  3O0H A;  5FS9 A;  3AE4 A;  2BC1 A;  1D5T A;  4EMW A;  3NYF A;  1JRY A;  1ZOY A;  3GDP A;  2WPE A;  1CHU A;  1Q9I A;  3DA1 A;  1EBD A;  5HY5 A;  3B3R A;  4CBQ A;  2R0G A;  1NAA A;  5L46 A;  1K4Q A;  2V6O A;  1PBD A;  4GF7 A;  2YVF A;  3COX A;  1GXF A;  1D4E A;  2IID A;  2QA2 A;  3CPI G;  1S3E A;  2OAM A;  2HQM A;  3L1R A;  1ELI A;  3NH3 X;  3P4Q A;  2C64 A;  4C74 A;  3H8I A;  2V60 A;  1CJ4 A;  3RP7 A;  2X8G A;  3NK0 X;  4Z44 A;  2TPR A;  4JY2 A;  2C65 A;  2V61 A;  2X99 A;  1OJD A;  4Y4N A;  4I59 A;  1TDE A;  2RGH A;  3CPH G;  2GQF A;  1PS9 A;  3AYL A;  3GD3 A;  4JY3 A;  4Z43 A;  3G5R A;  4EIQ A;  3AEB A;  1CJ2 A;  1H86 A;  5J7X A;  3OZ2 A;  3BI2 A;  3WE0 A;  3RNM A;  2C76 A;  4AT2 A;  4RSL A;  2XVE A;  1GT8 A;  3ABV A;  4HA6 A;  5M0Z A;  1RP0 A;  1PDH A;  2A87 A;  4OVI A;  4APN A;  2Q6U A;  4CRT A;  3URH A;  4REK A;  3OC4 A;  3AWI A;  3AYI A;  3GDN A;  1TYP A;  2R0C A;  1GES A;  2BXR A;  3NLC A;  3UKK A;  3GMC A;  2H89 A;  2BS3 A;  3LXD A;  1LQU A;  3LOV A;  4FK1 A;  3LAD A;  1IJH A;  4OPU A;  5BVA A;  1E1M A;  2QCU A;  2WQY A;  4JQ9 A;  1ONF A;  3UOZ A;  1LV0 A;  4J56 A;  1CC2 A;  3ISH A;  4Y4L A;  2RGO A;  2I0Z A;  3K7Q X;  4A5L A;  1S3B A;  2NPX A;  4FK1 C;  4O5Q A;  3H4K A;  3QFA A;  1Q1W A;  1YKJ A;  3SFE A;  4KX6 A;  5LV9 A;  4FDC B;  2VQ7 A;  2EQ6 A;  4U2S A;  1LVL A;  4CNJ A;  2B9X A;  1ZP0 A;  2RAB A;  4PAA A;  1GSN A;  2YR4 A;  3AE5 A;  4I58 A;  4YSH A;  4CCR A;  5BUL A;  1H81 A;  3DJJ A;  1DNC A;  1XPQ A;  3RHA A;  4H4P A;  4H4W A;  5IQ4 A;  2JB3 A;  4XWR A;  1PBE A;  3LZW A;  2WEU A;  3GSI A;  3F8P A;  1BKW A;  1B5Q A;  4NEV A;  2APG A;  1B8S A;  3NK2 X;  2XFU A;  1IUX A;  3CNT A;  4DGK A;  2X3N A;  1DOC A;  1LQT A;  3F8D A;  2O9Z A;  4CY8 A;  3M0O A;  2YR6 A;  4ZN0 A;  3LZX A;  4IVO B;  3P4P A;  2YAU A;  2GV8 A;  4YXD A;  4EQS A;  2V5Z A;  4K2X A;  1Z6L A;  5JCL A;  2GMJ A;  1FEA A;  4EQR A;  4RG4 A;  4AP1 A;  4X9M A;  4J34 A;  4C3X A;  4YSZ A;  4NTE A;  3IF9 A;  2CFY A;  2WP5 A;  4RG3 A;  4B64 A;  2JKC A;  1OJ9 A;  1VG0 A;  3VRB A;  4LU6 A;  3QVR A;  1P2H A;  4CCQ A;  3AE6 A;  4H4Q A;  3AD8 B;  5J60 A;  4U8J A;  3DK4 A;  1EL9 A;  3EAO A;  1TRB A;  1EL8 A;  3ITJ A;  3FIM B;  2ZBW A;  5BRT A;  1E1N A;  1JNZ A;  1CBO A;  2A89 A;  3C96 A;  1GET A;  1S2Q A;  1DJN A;  2GR3 A;  3AEA A;  3I3L A;  4MJW A;  3QSM A;  1QLB A;  4TLZ A;  5IQ1 A;  2WOW A;  4K8D A;  2AQJ A;  1IUU A;  2WET A;  1KNR A;  2EQ8 A;  2GRT A;  2E4G A;  2FJB A;  3AYJ A;  3GRS A;  5CKU A;  5EOW A;  4YKG A;  1H6V A;  1PJ6 A;  2X50 A;  3FMW A;  2WOI A;  1X31 B;  2XVF A;  4XXG A;  4D04 A;  4NTD A;  4OPT A;  4H2N A;  1N4U A;  2VRL A;  3NTA A;  5JCK A;  1CJ3 A;  3FG2 P;  2CUL A;  2PYX A;  3K7M X;  3DGH A;  5C2T A;  3UTH A;  4IA5 A;  3EPT A;  3VR8 A;  1GV4 A;  1FOH A;  4H4U A;  1L0V A;  3DJD A;  4Z25 A;  1E6E A;  3NYE A;  2C75 A;  3AEC A;  1VDC A;  1QJD A;  1F6M A;  1N1P A;  4BK2 A;  3V3O A;  2YLS A;  3IC9 A;  5JCI A;  1L9E A;  5GSN A;  3UOX A;  4EM4 A;  3Q6J A;  1M64 A;  4K5S A;  1L9C A;  1PBB A;  5KOX A;  3AD7 B;  1TDN A;  3BNM A;  2XLU A;  4J33 A; 
#chains in the Genus database with same CATH topology
 5J04 A;  3PO7 A;  3A7U A;  2C72 A;  1AOG A;  3T0K A;  3ICR A;  4GIR A;  3CGE A;  3S47 A;  4M0X A;  1GPE A;  3IHG A;  2HXT A;  4X4J A;  2F5Z A;  4D03 A;  1K0J A;  2GSH A;  2YLR A;  2AL1 A;  3AE3 A;  1FIQ B;  4A9W A;  2J3N A;  3K1G A;  3SYI A;  3NGC X;  4E4U A;  4H4R A;  1NU5 A;  4IVM B;  2QGY A;  4MKS A;  2JK6 A;  2GR0 A;  5FMH A;  3T6C A;  5KMP A;  1XDI A;  4OPG A;  2WDQ A;  3SM8 A;  2B9W A;  3OPS A;  3QN3 A;  2QVH A;  4USR A;  4J36 A;  4GYP C;  2AAQ A;  3AE8 A;  5FS8 A;  1OJA A;  1VRQ B;  3NO1 A;  2Q7V A;  4U8I A;  3CNP A;  3MZN A;  1N5X A;  4A7A A;  3CGB A;  2XLR A;  2YG4 A;  3UCL A;  3EF6 A;  3MUC A;  1BGJ A;  1F8R A;  1EL7 A;  4FI4 A;  4CNK A;  3CK5 A;  2BXS A;  3M12 A;  1ELS A;  5KVI A;  1CC6 A;  1BWC A;  4GGH A;  3SN0 A;  3T2Z A;  4A79 A;  2YG7 A;  3R07 C;  4H19 A;  3M13 A;  2WPC A;  4IP4 A;  5HXI A;  2OVL A;  2MUC A;  3ZLF A;  3C4N A;  1VDV A;  3BSM A;  1N63 C;  4YTN A;  4OCG A;  1N60 C;  3CYJ A;  2QJJ A;  3UCD A;  3ETR B;  1PBF A;  2B76 A;  2GDQ A;  1E1K A;  3SN1 A;  3AE7 A;  3PWG A;  2RGJ A;  2OQH A;  3V5C A;  3NK1 X;  5FJR A;  1BGN A;  1L8P A;  2O56 A;  3SZ0 A;  4H4T A;  1NEN A;  1W6T A;  2W54 A;  2YWL A;  5EU9 A;  2YM1 A;  3PFR A;  4E0V A;  3OTR A;  2OKT A;  2BS4 A;  2GAH B;  4C5O A;  4BJZ A;  1KSS A;  1GRT A;  3IJI A;  4GYP A;  3HYV A;  2NVK X;  4YSX A;  3SQP A;  2PTX A;  1MRA A;  2C4C A;  2GGJ A;  5U63 A;  4YWO A;  3PS9 A;  3N6J A;  2WBA A;  2XFP A;  1REO A;  4K2S A;  3V76 A;  1FFV C;  3L5O A;  2JBV A;  2YG6 A;  4U8O A;  3T2K A;  2B7R A;  4ZCC A;  3VCN A;  5JCM A;  2PU1 A;  4B67 A;  4G73 A;  2Y6R A;  4JDR A;  4WCT A;  1MNS A;  2BK5 A;  3TOY A;  4NTC A;  1S7M A;  2GR2 A;  1WYG A;  2P8C A;  1D7L A;  1GRG A;  2UZZ A;  3UOV A;  1JPM A;  3UCC A;  1H2I A;  1R0M A;  3VDG A;  2OZ3 A;  2XCG A;  3AE1 A;  2YM2 A;  2AL2 A;  1KD0 A;  1BZL A;  5HYM A;  1RM6 B;  1IUS A;  3IHM A;  4GCM A;  2BK4 A;  1CC4 A;  3QSE A;  1HYU A;  1NHQ A;  4UDP A;  3O0H A;  5FS9 A;  4EMW A;  3NYF A;  1ZOY A;  1EBD A;  3I6T A;  3B3R A;  3COX A;  1GXF A;  3CPI G;  2PMQ A;  1S3E A;  2AL2 B;  2GGG A;  2X99 A;  1OJD A;  1JPD X;  2GQF A;  5FJU A;  1KKR A;  3H70 A;  3BI2 A;  3WE0 A;  5M0Z A;  4CRT A;  2A87 A;  2BXR A;  4KT2 A;  3LXD A;  3UXK A;  3LAD A;  1E1M A;  3SZW A;  3RR1 A;  4J56 A;  1CC2 A;  2RGO A;  2I0Z A;  3K7Q X;  1SJC A;  4FK1 C;  1Q1W A;  1YKJ A;  5LV9 A;  4FDC B;  2VQ7 A;  2EQ6 A;  4U2S A;  1LVL A;  4CNJ A;  4PAA A;  1GSN A;  3AE5 A;  4YSH A;  4CCR A;  5BUL A;  3DJJ A;  1XPQ A;  4XWR A;  1E9I A;  3VCC A;  1BKW A;  1B5Q A;  2APG A;  1B8S A;  3PWI A;  1TE6 A;  1LQT A;  1SB3 B;  4ZN0 A;  3LZX A;  2YAU A;  4IZG A;  1Z6L A;  4AP1 A;  1MDL A;  4J34 A;  7ENL A;  2CFY A;  4LU6 A;  1P2H A;  4CCQ A;  1IYX A;  3AD8 B;  4U8J A;  1EL9 A;  2ZBW A;  5BRT A;  2A89 A;  5IQ1 A;  4K8D A;  1KNR A;  2FJB A;  3AYJ A;  3GRS A;  4MMW A;  4DYE A;  2WOI A;  4NTD A;  1N4U A;  3UJS A;  3UXL A;  3T31 A;  3VR8 A;  4H4U A;  4Z25 A;  4J1O A;  3SN4 A;  3AEC A;  3TJ4 A;  1QJD A;  2W3R A;  1FHU A;  3V3O A;  2YLS A;  3STP A;  1RVK A;  3UOX A;  1PBB A;  2VVL G;  1TDN A;  3BNM A;  3DK8 A;  1P2E A;  3BHF A;  1IUW A;  4CY6 A;  1E39 A;  1KFY A;  1XAN A;  3P9U A;  1X2H A;  3GWF A;  1ZXI C;  4LII A;  4NZH A;  1JDF A;  3GO2 A;  1JEH A;  5CQF A;  3NNE A;  1TDK A;  2OLN A;  4DSH A;  5IPY A;  3EAN A;  3ENL A;  3ZYX A;  2FBW A;  2XFO A;  2YVG A;  1NPX A;  1UKV G;  1NDA A;  4U2T A;  2PSN A;  3II4 A;  4JN7 A;  1SJD A;  3KVE A;  5C3J A;  4X9N A;  1DJQ A;  1K0L A;  3L8K A;  4U8L A;  3CTY A;  2DW7 A;  3BOX A;  2V3B A;  3ALL A;  3TTE A;  5BUK A;  1MXT A;  1O5W A;  2ARD A;  4ZA0 A;  4HCD A;  1PJ7 A;  3BI5 A;  3T14 A;  2FJA A;  4WX1 A;  4KPR A;  2R4J A;  3K30 A;  4E5T A;  4DXK A;  1BKH A;  2GL5 A;  2YLW A;  3VRD B;  5M10 A;  5EB5 A;  4O5U A;  4GUV A;  4U2L A;  3VRA A;  2PS2 A;  4OPI A;  4EQW A;  2DKH A;  3NHO X;  5HHF A;  2OPJ A;  3CPJ G;  2GAG B;  4K8G A;  4H50 A;  2WOV A;  3V4B A;  1MO9 A;  4FX9 A;  4A3R A;  5EBK A;  3SJN A;  4BK1 A;  1ZMC A;  3LJP A;  3FJ4 A;  1JNR A;  3VA8 A;  4GAV A;  3E1T A;  4C77 A;  6ENL A;  3P4S A;  1S2Y A;  3KD9 A;  3UKF A;  2VRM A;  1TYT A;  1EBH A;  2HXU A;  3RP6 A;  4U8P A;  3RP8 A;  2ZZB A;  4AOS A;  3T2Y A;  3UTG A;  3JZU A;  1P48 A;  4HB9 A;  3BJS A;  4M52 A;  2Q0K A;  4MGG A;  3ICT A;  2ONE A;  4UDQ A;  3CGC A;  1GRH A;  4TM3 A;  5JCN A;  5KVH A;  4K22 A;  4OPC A;  3DER A;  2XVH A;  3R9U A;  3SBF A;  1GEU A;  2FKP A;  1PJ5 A;  2HNE A;  2W55 A;  4BUR A;  2CDU A;  3UOY A;  4GDP A;  1F8W A;  2YLX A;  3QSS A;  1V59 A;  2BC0 A;  5G5G B;  4AP3 A;  1W4X A;  5FJP A;  4LA1 A;  1M6I A;  1JCT A;  1GER A;  3KKJ A;  3JW7 A;  4IT1 A;  3CT2 A;  3TWA A;  3B9J B;  4K1W A;  4TM0 A;  1PXC A;  4Z26 A;  3RCY A;  4Z2T A;  3GC2 A;  1NG3 A;  1MDR A;  3SGL A;  3D9X A;  1GOS A;  2ZZC A;  5U1O A;  3CIR A;  3ZVH A;  3CXO A;  2WU2 A;  2E5A A;  1FFU C;  3FXG A;  2AR8 A;  4GME A;  1BF3 A;  3NN0 X;  4K5R A;  3OZM A;  4YWS A;  4G7F A;  3NYC A;  3ZDN A;  3MKC A;  4USQ A;  2PP1 A;  1TZZ A;  2R0P A;  3I6E A;  1ZOV A;  2OO6 A;  1FEB A;  5FS7 A;  3ZVH B;  4H2P A;  4DNA A;  3ICS A;  3VC6 A;  4JNA A;  3GRT A;  3UKP A;  2POZ A;  4H2Q A;  1KSU A;  2HZG A;  1GTH A;  1OJC A;  1PXA A;  1PDY A;  4BV6 A;  4EM3 A;  4ADW A;  4H2R A;  3AED A;  2XH2 A;  4J57 A;  3I6D A;  4TM1 A;  3UJE A;  3AEG A;  1X2G A;  3CAW A;  4Z24 A;  4HNL A;  3NVZ B;  4H83 A;  3AE4 A;  2BC1 A;  2NQL A;  3GY1 A;  2GGE A;  3GDP A;  3DA1 A;  1N61 C;  5HY5 A;  1K4Q A;  2V6O A;  1PBD A;  4GF7 A;  3PK7 A;  1EC9 A;  2QA2 A;  3RIT A;  3UGV A;  3A7A A;  4JHM A;  4C74 A;  3H8A A;  4Z44 A;  2TPR A;  2V61 A;  4Y4N A;  4I59 A;  1TDE A;  2RGH A;  3CMM A;  4Z43 A;  3G5R A;  4EIQ A;  3AEB A;  1CJ2 A;  1H86 A;  3OZ2 A;  4KEM A;  3RNM A;  3ES7 A;  4AT2 A;  3URH A;  3HYW A;  3OC4 A;  3AYI A;  3P93 A;  1TYP A;  3UKK A;  2BS3 A;  3LOV A;  1IJH A;  4JQ9 A;  1ONF A;  4G6H A;  1BQG A;  3NFU A;  1ZP0 A;  2YR4 A;  3OW1 A;  1OEP A;  1DNC A;  2P3Z A;  4H4P A;  5IQ4 A;  5BOF A;  2WEU A;  3P0W A;  3CNT A;  1DOC A;  4F4R A;  4CY8 A;  2PTZ A;  3T8Q A;  4YXD A;  5JCL A;  3QPE A;  4RG4 A;  4C3X A;  4YSZ A;  4B64 A;  2WP5 A;  1OJ9 A;  1VG0 A;  3T9P A;  3QVR A;  3DG7 A;  5KMR A;  3FIM B;  2PGE A;  4YSY A;  2WET A;  2EQ8 A;  2GRT A;  1H6V A;  3FMW A;  1X31 B;  2XVF A;  4OPT A;  4IA5 A;  3EPT A;  1GV4 A;  3NYE A;  2C75 A;  3NZG A;  1F6M A;  5GSN A;  1DXL A;  1EBG A;  3NVV B;  4Z2U A;  4G6G A;  3NTD A;  1YQ3 A;  1F3P A;  4EMI A;  2OFJ A;  2IVD A;  2W0H A;  2PGW A;  4B66 A;  1FHV A;  3AE2 A;  4PAB A;  2EQ7 A;  4Z2R A;  2QDD A;  1PN0 A;  1B37 A;  1KNP A;  3SSZ A;  2OAL A;  2VZ2 A;  3HW2 A;  2YLZ A;  5G5H B;  3MSY A;  2XVI A;  3UP4 A;  2XFQ A;  3FVD A;  1K0I A;  2YG3 A;  3KLJ A;  1FL2 A;  4H7U A;  2XGZ A;  4YTM A;  2TMD A;  2EQ9 A;  4C3Y A;  5FJO A;  1FEC A;  1NHS A;  1Y0P A;  3EEZ A;  2BA9 A;  2E5V A;  5ER0 A;  2R9Z A;  2XSX A;  3DFH A;  3D1C A;  1P43 A;  2XLT A;  3KUM A;  2E1M A;  2BCP A;  4J2W A;  3ES8 A;  1N62 C;  3MY9 A;  4G74 A;  3ATR A;  2VOU A;  4KPL A;  1GTE A;  5U25 A;  3CND A;  3SXI A;  1SJB A;  3KU9 A;  1H7W A;  3S5W A;  1GRA A;  2GB0 A;  1LPF A;  3I4K A;  2Z5Y A;  3UTE A;  4A6G A;  1GRE A;  2WDR A;  3T37 A;  2FJE A;  4J31 A;  2C70 A;  4HPN A;  2QAE A;  2JB2 A;  2GGH A;  2YR5 A;  5KXJ A;  2WP9 A;  4FP1 A;  1XPY A;  3V5F A;  1GAL A;  3SQS A;  4N9X A;  3RED A;  3NKS A;  4II2 A;  3FPZ A;  2A8X A;  4HNC A;  1TDF A;  1YQ4 A;  4AOX A;  3G5S A;  2XH7 A;  2DW6 A;  3NXL A;  1TDO A;  1NHR A;  1D4C A;  1QO8 A;  3CGD A;  3UJ2 A;  2QQ6 A;  1F8S A;  5KWF A;  3N4E A;  1H83 A;  3B6D A;  4H4S A;  2WDV A;  2BCG G;  5TR3 A;  4II3 A;  1R6W A;  2OZT A;  3CB3 A;  4U8K A;  3CN8 A;  3BI4 A;  1JU2 A;  4UP3 A;  3NRN A;  3VC5 A;  1VQZ A;  1ZDL A;  1MOK A;  5FS6 A;  3TWB A;  2WP6 A;  1H7X A;  4XWZ A;  3A7R A;  4IA6 A;  3GYX A;  3T4W A;  1GND A;  3CNS A;  1PXB A;  1KDG A;  2YQU A;  2BS2 A;  3EUB 3;  5KRQ A;  2IVE A;  4DX3 A;  3KA7 A;  4OPD A;  4U8M A;  1NEL A;  3C4A A;  3FBS A;  4A65 A;  1Q1R A;  3Q4D A;  4IL2 A;  2OG9 A;  2WU5 A;  1DOB A;  2XLS A;  1VQW A;  4DN1 A;  4EIP A;  3UTF A;  1DOE A;  5KNL A;  1ZMD A;  3ATQ A;  3CXB A;  2OLA A;  5BOE A;  2WPF A;  4YTP A;  2QJN A;  1NG4 A;  2ACZ A;  1GRB A;  3VR9 A;  4H4Z A;  1O94 A;  3ZVI A;  1PBC A;  2VVM A;  1L9D A;  1E1L A;  4IV9 A;  4GR1 A;  4KWS A;  5DBJ A;  2CVJ A;  4H4X A;  1CL0 A;  1H82 A;  1H84 A;  1KF6 A;  4E8G A;  2BK3 A;  1D7Y A;  1RSG A;  3NN6 X;  2GMH A;  4ZCW A;  3NIX A;  3DGZ A;  1PHH A;  4YT0 A;  2PP3 A;  3AD9 B;  2WHD A;  3Q9T A;  3S61 A;  1JRZ A;  3B97 A;  4DWD A;  5KMS A;  1YQZ A;  5EB4 A;  4G8T A;  1JRY A;  4EWJ A;  3RRA A;  4CBQ A;  1N5W C;  2YVF A;  1D4E A;  4DHG A;  4GFI A;  4H1Z A;  3P4Q A;  2XH4 A;  2V60 A;  1CJ4 A;  3RP7 A;  2X8G A;  3NK0 X;  4JY2 A;  3CPH G;  1PS9 A;  3GD3 A;  4JY3 A;  3MWC A;  5J7X A;  2C76 A;  1T3Q C;  4RSL A;  3R25 A;  1GT8 A;  1RP0 A;  4OVI A;  4APN A;  4GGB A;  4REK A;  3AWI A;  3GDN A;  1ONE A;  3TJI A;  2R0C A;  3FCP A;  1TKK A;  1LQU A;  1JRO A;  3MQT A;  2QCU A;  2WQY A;  4Y4L A;  4E4F A;  4A5L A;  1S3B A;  4O5Q A;  3ZLH A;  4I58 A;  3R0U A;  4X2P A;  3TQP A;  4H4W A;  1PBE A;  3LZW A;  4NEV A;  4TVY A;  2XFU A;  2X3N A;  2O9Z A;  3M0O A;  1STZ A;  1FO4 A;  3FYY A;  4IVO B;  2GV8 A;  4J3Z A;  2V5Z A;  4K2X A;  3SZF A;  2GMJ A;  1FEA A;  4X9M A;  4NTE A;  4RG3 A;  1KCZ A;  3AE6 A;  3DIP A;  2P8B A;  2PTY A;  3U9I A;  5J60 A;  3EAO A;  3ITJ A;  2GGI A;  1E1N A;  1JNZ A;  1CBO A;  3AN1 A;  3C96 A;  3I3L A;  4TLZ A;  2GR3 A;  3AEA A;  3QSM A;  2WOW A;  3HPF A;  3NVY B;  2AQJ A;  2E4G A;  5CKU A;  5EOW A;  4YKG A;  2X50 A;  2QJM A;  4H2N A;  2VRL A;  3NTA A;  2CUL A;  2PYX A;  5FJT A;  3DGH A;  5C2T A;  1WUE A;  3UTH A;  4Z1Y A;  3RO6 A;  1E6E A;  1VDC A;  2AKZ A;  2ZC8 A;  1N1P A;  4BK2 A;  5ENL A;  3IK4 A;  3Q6J A;  1M64 A;  1PDZ A;  1L9C A;  5KOX A;  4ENL A;  3AD7 B;  2PPG A;  2XLU A;  3AEE A;  4EMJ A;  4JN8 A;  2QDE A;  2JAE A;  4HCH A;  3H8L A;  2BYB A;  3DK9 A;  1MUC A;  2XH0 A;  3AE9 A;  2C66 A;  2X8H A;  2B9Y A;  2P0I A;  1JRX A;  3GMB A;  4DSG A;  4ZOH B;  1B4V A;  3SFD A;  2BRY A;  4B69 A;  3BHK A;  1XS2 A;  2PHH A;  3V3N A;  3DJG X;  2C73 A;  3ALM A;  3PVC A;  3GD4 A;  1N4W A;  3ADA B;  5GRT A;  3DH9 A;  3EKG A;  4H4V A;  3D8X A;  2YLT A;  2GVC A;  2WS3 A;  3P4R A;  1XHC A;  3F8R A;  2PCE A;  4H2H A;  2CHR A;  3DES A;  2BAC A;  1D4D A;  5IDZ A;  4H4Y A;  3AB1 A;  3R10 A;  3V3W A;  2GF3 A;  4YKF A;  5KMQ A;  1NEK A;  1NHP A;  2ZAD A;  2GR1 A;  3UKA A;  4HYR A;  2OLO A;  1F9C A;  4Z17 A;  1SEZ A;  1COY A;  3UP5 A;  2YG5 A;  2C3D A;  4TLX A;  2WES A;  2Y6Q A;  3DGB A;  4M6U A;  1CJC A;  3QKE A;  2RDX A;  1ZKQ A;  3JSK A;  1EC8 A;  2JB1 A;  2POD A;  3SY4 A;  2FYM A;  1ZY8 A;  1N4V A;  4K7Z A;  4NNJ A;  1IUT A;  1LJ1 A;  3N4F A;  4U8N A;  2E3T A;  2BAB A;  4B1B A;  4GRT A;  3LB8 A;  4HCL A;  2XYO A;  1OJT A;  2I5Q A;  3U4F A;  2XFN A;  2GQW A;  1Y56 A;  4B68 A;  4JN9 A;  4GAP A;  3OP2 A;  4EQX A;  2R46 A;  1SJA A;  2C3C A;  3D47 A;  1LTX R;  4IHC A;  3GYI A;  3KPF A;  4NEW A;  3Q45 A;  5JRB A;  1O95 A;  3HZL A;  2H88 A;  2BRA A;  2PA6 A;  3DFY A;  2Z5X A;  2PU0 A;  3NG7 X;  2C67 A;  1JOA A;  1Y56 B;  1CF3 A;  3NRZ B;  3P1W A;  3GYJ A;  4AT0 A;  1DOD A;  3VFC A;  2GEW A;  4A6N A;  3NS1 B;  1KKO A;  3QJ4 A;  2QA1 A;  2OA1 A;  1DTN A;  3DJE A;  4ROP A;  2B7S A;  1IUV A;  1FCD A;  4TM4 A;  3BNU A;  3H12 A;  2C7G A;  3OZY A;  4BK3 A;  1RYI A;  1VG9 A;  3AEF A;  3GWD A;  3AXB A;  3UKL A;  2OZ8 A;  3QFB A;  2XLP A;  4A6N B;  3ALJ A;  1KN0 A;  2XDO A;  1YY5 A;  3DG3 A;  1V97 A;  2OQY A;  2W3S A;  5KOW A;  2R4E A;  3TCS A;  3VQR A;  2ZZ0 A;  4ZCD A;  4UDR A;  3PG6 A;  1E7P A;  2XVJ A;  2GH5 A;  2DKI A;  3IWA A;  1GRF A;  2V3A A;  3H7V A;  4BJY A;  1YEY A;  3IJL A;  2R45 A;  2VQB A;  3SR6 B;  2PTW A;  2FJD A;  3QVP A;  4E6M A;  1ZK7 A;  2VVL A;  3UKQ A;  3AM9 A;  3CNJ A;  4ICY A;  3DME A;  3JVA A;  4ECH A;  4JNQ A;  3DDM A;  2Q0L A;  4GDE A;  2X8C A;  3HRD C;  3AMZ A;  4Y4M A;  2OX4 A;  3D46 A;  3DEQ A;  4OPL A;  3K7T A;  3UKH A;  1ZX9 A;  3P3B A;  4A99 A;  1EL5 A;  4B63 A;  2YVJ A;  3G5Q A;  3NT6 A;  4P9S A;  4B65 A;  1D5T A;  4HN8 A;  4GIS A;  2WPE A;  1CHU A;  1Q9I A;  4IP5 A;  2R0G A;  1NAA A;  5L46 A;  3SZC A;  2IID A;  2OAM A;  2HQM A;  2MNR A;  3L1R A;  1ELI A;  3NH3 X;  2C64 A;  3H8I A;  2C65 A;  3AYL A;  2PP0 A;  2XVE A;  3ABV A;  4G9K A;  4HA6 A;  1PDH A;  2Q6U A;  1GES A;  3NLC A;  3GMC A;  2H89 A;  4FK1 A;  4OPU A;  5BVA A;  4TVW A;  3UOZ A;  1LV0 A;  3ISH A;  3R1Z A;  4IL0 A;  3KPK A;  3NVW B;  2NPX A;  3H4K A;  3QFA A;  4A35 A;  3SFE A;  4KX6 A;  3UJR A;  2B9X A;  2RAB A;  1H81 A;  1JRP A;  2AKM A;  3RHA A;  1EC7 A;  2JB3 A;  3GSI A;  3F8P A;  3NK2 X;  1IUX A;  4DGK A;  3TW9 A;  1WUF A;  3F8D A;  3R0K A;  2YR6 A;  3P4P A;  3N6H A;  3UJF A;  4EQS A;  3QTP A;  3IJQ A;  4EQR A;  3IF9 A;  2P88 A;  2JKC A;  3FV9 A;  3VRB A;  1ECQ A;  3DG6 A;  3RGT A;  3R11 A;  3HYX A;  4H4Q A;  4NWZ A;  3DK4 A;  1TRB A;  1EL8 A;  1GET A;  1S2Q A;  1DJN A;  4MJW A;  1QLB A;  3SX6 A;  1IUU A;  1PJ6 A;  4XXG A;  4D04 A;  3QLD A;  3S5S A;  5JCK A;  1CJ3 A;  3FG2 P;  3THU A;  3K7M X;  1FOH A;  1L0V A;  3DJD A;  3IC9 A;  3GD6 A;  5JCI A;  1L9E A;  4EM4 A;  4K5S A;  3ZLG A;  4J33 A; 
#chains in the Genus database with same CATH homology
 3AEE A;  1DXL A;  4EMJ A;  3DK8 A;  2JAE A;  1P2E A;  3PO7 A;  3BHF A;  3H8L A;  2BYB A;  3DK9 A;  2C72 A;  3AE9 A;  1AOG A;  1IUW A;  3T0K A;  4CY6 A;  4Z2U A;  1E39 A;  2C66 A;  3ICR A;  2X8H A;  1KFY A;  1XAN A;  1YQ3 A;  2B9Y A;  3NTD A;  1JRX A;  1F3P A;  3GMB A;  3P9U A;  1B4V A;  3SFD A;  3CGE A;  3GWF A;  4EMI A;  4DSG A;  2IVD A;  2W0H A;  4B66 A;  2BRY A;  4B69 A;  1GPE A;  3BHK A;  3AE2 A;  4LII A;  2PHH A;  3V3N A;  4NZH A;  4PAB A;  2EQ7 A;  3DJG X;  2C73 A;  3ALM A;  3IHG A;  4X4J A;  3PVC A;  1PN0 A;  4Z2R A;  3GD4 A;  1B37 A;  4G6G A;  1N4W A;  2F5Z A;  3ADA B;  5GRT A;  3DH9 A;  1KNP A;  4H4V A;  3D8X A;  1JEH A;  2YLT A;  2GVC A;  1K0J A;  2OAL A;  2VZ2 A;  2WS3 A;  3NNE A;  3P4R A;  5CQF A;  4D03 A;  1TDK A;  2YLZ A;  2YLR A;  1XHC A;  2OLN A;  3F8R A;  4DSH A;  5IPY A;  3AE3 A;  3EAN A;  3ZYX A;  2XVI A;  3UP4 A;  2FBW A;  4A9W A;  2J3N A;  2XFQ A;  2XFO A;  2YVG A;  1K0I A;  3NGC X;  3SYI A;  1NPX A;  1UKV G;  2YG3 A;  3KLJ A;  1NDA A;  4U2T A;  1FL2 A;  4H7U A;  2BAC A;  3II4 A;  4H4R A;  1D4D A;  4YTM A;  3KVE A;  2TMD A;  5C3J A;  4IVM B;  2EQ9 A;  4C3Y A;  4H4Y A;  3AB1 A;  4X9N A;  1FEC A;  1DJQ A;  1NHS A;  1K0L A;  2JK6 A;  1Y0P A;  2GR0 A;  3L8K A;  4U8L A;  2BA9 A;  3CTY A;  2E5V A;  5FMH A;  2V3B A;  3ALL A;  5ER0 A;  2R9Z A;  2GF3 A;  4YKF A;  5KMQ A;  5BUK A;  1MXT A;  1O5W A;  2ARD A;  1NEK A;  5KMP A;  1XDI A;  1NHP A;  4OPG A;  2GR1 A;  1PJ7 A;  2WDQ A;  3BI5 A;  3UKA A;  3D1C A;  3T14 A;  2FJA A;  4WX1 A;  4KPR A;  2XLT A;  2R4J A;  3K30 A;  3SM8 A;  2B9W A;  2E1M A;  2BCP A;  4USR A;  4J36 A;  2OLO A;  2AAQ A;  2YLW A;  3AE8 A;  5FS8 A;  4J2W A;  3VRD B;  5M10 A;  5EB5 A;  4O5U A;  4GUV A;  4U2L A;  4G74 A;  1OJA A;  3ATR A;  2VOU A;  1SEZ A;  3VRA A;  1GTE A;  5U25 A;  1COY A;  3CND A;  3SXI A;  2YG5 A;  2C3D A;  4TLX A;  3UP5 A;  1VRQ B;  3KU9 A;  4OPI A;  4EQW A;  2DKH A;  1H7W A;  2Q7V A;  4U8I A;  3NHO X;  2WES A;  5HHF A;  3S5W A;  1GRA A;  2Y6Q A;  1CJC A;  2GB0 A;  3CNP A;  3CPJ G;  2GAG B;  1LPF A;  2WOV A;  1ZKQ A;  4H50 A;  2Z5Y A;  3JSK A;  2JB1 A;  1MO9 A;  3UTE A;  3SY4 A;  1GRE A;  4FX9 A;  4A7A A;  3CGB A;  5EBK A;  2XLR A;  4BK1 A;  1ZY8 A;  1ZMC A;  2YG4 A;  2WDR A;  3EF6 A;  3LJP A;  3T37 A;  3UCL A;  1JNR A;  1N4V A;  2FJE A;  4J31 A;  2C70 A;  1BGJ A;  4K7Z A;  4YSY A;  2QAE A;  1F8R A;  2JB2 A;  4GAV A;  4NNJ A;  3E1T A;  4C77 A;  1IUT A;  1LJ1 A;  4U8N A;  3P4S A;  1EL7 A;  2VVL G;  2YR5 A;  1S2Y A;  5KXJ A;  2WP9 A;  2BAB A;  3KD9 A;  4B1B A;  3UKF A;  4CNK A;  2VRM A;  1GAL A;  2BXS A;  1TYT A;  4GRT A;  3RP6 A;  3LB8 A;  4U8P A;  3RP8 A;  2XYO A;  1OJT A;  3M12 A;  4N9X A;  2ZZB A;  3RED A;  4AOS A;  3NKS A;  4II2 A;  5KVI A;  1CC6 A;  3T2Y A;  3UTG A;  1BWC A;  3FPZ A;  2A8X A;  2XFN A;  3T2Z A;  1TDF A;  4HB9 A;  1YQ4 A;  4AOX A;  3G5S A;  4A79 A;  2YG7 A;  4M52 A;  2Q0K A;  2GQW A;  1Y56 A;  4B68 A;  3M13 A;  3ICT A;  1TDO A;  4JN9 A;  4UDQ A;  3CGC A;  2WPC A;  1GRH A;  4TM3 A;  5JCN A;  1NHR A;  1D4C A;  1QO8 A;  5KVH A;  4GAP A;  5HXI A;  4K22 A;  4OPC A;  3C4N A;  4EQX A;  3CGD A;  2R46 A;  4YTN A;  4OCG A;  2C3C A;  1F8S A;  2XVH A;  3R9U A;  5KWF A;  1LTX R;  1GEU A;  3GYI A;  1H83 A;  3KPF A;  3B6D A;  1PJ5 A;  4H4S A;  2WDV A;  5TR3 A;  4NEW A;  4BUR A;  2BCG G;  1PBF A;  2B76 A;  2CDU A;  4II3 A;  3UOY A;  1E1K A;  3AE7 A;  5JRB A;  4U8K A;  4GDP A;  2RGJ A;  1F8W A;  1O95 A;  2YLX A;  3HZL A;  1V59 A;  2H88 A;  2BRA A;  3QSS A;  3BI4 A;  2BC0 A;  3CN8 A;  3NK1 X;  2Z5X A;  1BGN A;  3NG7 X;  2C67 A;  1JOA A;  1Y56 B;  1CF3 A;  4AP3 A;  3P1W A;  1W4X A;  3GYJ A;  4AT0 A;  1DOD A;  4LA1 A;  2GEW A;  1JU2 A;  4A6N A;  4UP3 A;  3NRN A;  3SZ0 A;  4H4T A;  3QJ4 A;  1M6I A;  2QA1 A;  1NEN A;  1GER A;  2OA1 A;  2YWL A;  3DJE A;  3KKJ A;  1ZDL A;  1MOK A;  5FS6 A;  2WP6 A;  1H7X A;  2B7S A;  1IUV A;  2YM1 A;  4XWZ A;  4E0V A;  4IA6 A;  1FCD A;  4TM4 A;  3GYX A;  2BS4 A;  3BNU A;  2C7G A;  4TM0 A;  1GND A;  1PXC A;  1PXB A;  3CNS A;  1KDG A;  4Z26 A;  2GAH B;  4C5O A;  2YQU A;  4BJZ A;  1KSS A;  1GRT A;  4BK3 A;  1RYI A;  4Z2T A;  1VG9 A;  3AEF A;  2BS2 A;  3GWD A;  1NG3 A;  5KRQ A;  3HYV A;  2IVE A;  2NVK X;  3AXB A;  3UKL A;  4YSX A;  3KA7 A;  3SQP A;  3SGL A;  3D9X A;  1GOS A;  4OPD A;  3QFB A;  2XLP A;  4U8M A;  3C4A A;  4A6N B;  2ZZC A;  1KN0 A;  3ALJ A;  3FBS A;  2C4C A;  4A65 A;  1Q1R A;  5U1O A;  2XDO A;  2WU5 A;  1DOB A;  1YY5 A;  2XLS A;  3CIR A;  1VQW A;  5U63 A;  4YWO A;  4EIP A;  3UTF A;  3PS9 A;  5KOW A;  2WBA A;  1DOE A;  1ZMD A;  2XFP A;  2R4E A;  5KNL A;  1REO A;  2WU2 A;  3VQR A;  2ZZ0 A;  3ATQ A;  2AR8 A;  2JBV A;  3L5O A;  3V76 A;  2YG6 A;  4U8O A;  4ZCD A;  3T2K A;  2B7R A;  4UDR A;  1BF3 A;  3PG6 A;  1E7P A;  2XVJ A;  4ZCC A;  3NN0 X;  2GH5 A;  5JCM A;  3NYC A;  4K5R A;  2DKI A;  3IWA A;  3ZDN A;  1GRF A;  2WPF A;  4YTP A;  1NG4 A;  2ACZ A;  4USQ A;  2V3A A;  4B67 A;  4G73 A;  4BJY A;  1GRB A;  3VR9 A;  2R45 A;  2R0P A;  2VQB A;  4H4Z A;  1O94 A;  1PBC A;  1ZOV A;  4JDR A;  2Y6R A;  2FJD A;  3QVP A;  4WCT A;  2VVM A;  1L9D A;  1E1L A;  4IV9 A;  2BK5 A;  1ZK7 A;  4GR1 A;  2VVL A;  1FEB A;  1S7M A;  4NTC A;  5DBJ A;  5FS7 A;  3UKQ A;  2GR2 A;  2CVJ A;  3CNJ A;  4H4X A;  1CL0 A;  1H82 A;  4H2P A;  4DNA A;  1H84 A;  3ICS A;  4ICY A;  1KF6 A;  3DME A;  4JNA A;  3GRT A;  3UKP A;  4ECH A;  1D7L A;  2BK3 A;  2Q0L A;  4JNQ A;  1D7Y A;  1RSG A;  1GRG A;  3NN6 X;  2UZZ A;  2GMH A;  4GDE A;  2X8C A;  4H2Q A;  3UOV A;  1KSU A;  4Y4M A;  1GTH A;  1H2I A;  1OJC A;  3NIX A;  3DGZ A;  4OPL A;  1PXA A;  3K7T A;  3UKH A;  4BV6 A;  1PHH A;  1ZX9 A;  4EM3 A;  4ADW A;  4YT0 A;  4H2R A;  2XCG A;  3AED A;  3AE1 A;  3AD9 B;  4J57 A;  2YM2 A;  3I6D A;  4A99 A;  4TM1 A;  2WHD A;  1BZL A;  3AEG A;  5HYM A;  1IUS A;  1EL5 A;  3Q9T A;  3IHM A;  3S61 A;  4B63 A;  1JRZ A;  4GCM A;  2YVJ A;  2BK4 A;  3G5Q A;  3NT6 A;  1CC4 A;  3QSE A;  5KMS A;  4Z24 A;  1HYU A;  1NHQ A;  1YQZ A;  5EB4 A;  4UDP A;  4P9S A;  4B65 A;  3O0H A;  5FS9 A;  3AE4 A;  2BC1 A;  1D5T A;  4EMW A;  3NYF A;  1JRY A;  1ZOY A;  3GDP A;  2WPE A;  1CHU A;  1Q9I A;  3DA1 A;  1EBD A;  5HY5 A;  3B3R A;  4CBQ A;  2R0G A;  1NAA A;  5L46 A;  1K4Q A;  2V6O A;  1PBD A;  4GF7 A;  3SZC A;  2YVF A;  3COX A;  1GXF A;  1D4E A;  2IID A;  2QA2 A;  3CPI G;  1S3E A;  2OAM A;  2HQM A;  3L1R A;  1ELI A;  3NH3 X;  3P4Q A;  2C64 A;  4C74 A;  3H8I A;  2V60 A;  1CJ4 A;  3RP7 A;  2X8G A;  3NK0 X;  4Z44 A;  2TPR A;  4JY2 A;  2C65 A;  2V61 A;  2X99 A;  1OJD A;  4Y4N A;  4I59 A;  1TDE A;  2RGH A;  3CPH G;  3CMM A;  2GQF A;  1PS9 A;  3AYL A;  3GD3 A;  4JY3 A;  4Z43 A;  3G5R A;  4EIQ A;  3AEB A;  1CJ2 A;  1H86 A;  5J7X A;  3OZ2 A;  3BI2 A;  3WE0 A;  3RNM A;  2C76 A;  4AT2 A;  4RSL A;  2XVE A;  1GT8 A;  3ABV A;  4G9K A;  4HA6 A;  1RP0 A;  1PDH A;  2A87 A;  4OVI A;  4APN A;  2Q6U A;  5M0Z A;  4CRT A;  3URH A;  4REK A;  3HYW A;  3OC4 A;  3AWI A;  3AYI A;  3GDN A;  1TYP A;  2R0C A;  1GES A;  2BXR A;  3NLC A;  3UKK A;  3GMC A;  2H89 A;  2BS3 A;  3LXD A;  1LQU A;  3LOV A;  4FK1 A;  3LAD A;  1IJH A;  4OPU A;  5BVA A;  1E1M A;  2QCU A;  2WQY A;  3SZW A;  4JQ9 A;  1ONF A;  3UOZ A;  1LV0 A;  4G6H A;  4J56 A;  1CC2 A;  3ISH A;  4Y4L A;  3KPK A;  2RGO A;  2I0Z A;  3K7Q X;  4A5L A;  1S3B A;  2NPX A;  4FK1 C;  4O5Q A;  3H4K A;  3QFA A;  1Q1W A;  1YKJ A;  3SFE A;  4KX6 A;  5LV9 A;  4FDC B;  2VQ7 A;  2EQ6 A;  4U2S A;  1LVL A;  4CNJ A;  2B9X A;  1ZP0 A;  2RAB A;  4PAA A;  1GSN A;  2YR4 A;  3AE5 A;  4I58 A;  4YSH A;  4CCR A;  5BUL A;  1H81 A;  3DJJ A;  1DNC A;  1XPQ A;  3RHA A;  4H4P A;  4H4W A;  5IQ4 A;  2JB3 A;  4XWR A;  1PBE A;  3LZW A;  2WEU A;  3GSI A;  3F8P A;  1BKW A;  1B5Q A;  4NEV A;  2APG A;  1B8S A;  3NK2 X;  2XFU A;  1IUX A;  3CNT A;  4DGK A;  2X3N A;  1DOC A;  1LQT A;  3F8D A;  2O9Z A;  4CY8 A;  3M0O A;  2YR6 A;  4ZN0 A;  3LZX A;  4IVO B;  3P4P A;  2YAU A;  2GV8 A;  4YXD A;  4EQS A;  2V5Z A;  4K2X A;  1Z6L A;  5JCL A;  3SZF A;  2GMJ A;  1FEA A;  4EQR A;  4RG4 A;  4AP1 A;  4X9M A;  4J34 A;  4C3X A;  4YSZ A;  4NTE A;  3IF9 A;  2CFY A;  2WP5 A;  4RG3 A;  4B64 A;  2JKC A;  1OJ9 A;  1VG0 A;  3VRB A;  4LU6 A;  3QVR A;  1P2H A;  3HYX A;  4CCQ A;  3AE6 A;  4H4Q A;  4NWZ A;  3AD8 B;  5J60 A;  4U8J A;  3DK4 A;  1EL9 A;  3EAO A;  1TRB A;  1EL8 A;  3ITJ A;  5KMR A;  3FIM B;  2ZBW A;  5BRT A;  1E1N A;  1JNZ A;  1CBO A;  2A89 A;  3C96 A;  1GET A;  1S2Q A;  1DJN A;  2GR3 A;  3AEA A;  3I3L A;  4MJW A;  3QSM A;  1QLB A;  4TLZ A;  5IQ1 A;  2WOW A;  4K8D A;  2AQJ A;  3SX6 A;  1IUU A;  2WET A;  1KNR A;  2EQ8 A;  2GRT A;  2E4G A;  2FJB A;  3AYJ A;  3GRS A;  5CKU A;  5EOW A;  4YKG A;  1H6V A;  1PJ6 A;  2X50 A;  3FMW A;  2WOI A;  1X31 B;  2XVF A;  4XXG A;  4D04 A;  4NTD A;  4OPT A;  4H2N A;  1N4U A;  2VRL A;  3NTA A;  5JCK A;  1CJ3 A;  3FG2 P;  2CUL A;  2PYX A;  3K7M X;  3DGH A;  5C2T A;  3UTH A;  4IA5 A;  3EPT A;  3T31 A;  3VR8 A;  1GV4 A;  1FOH A;  4H4U A;  1L0V A;  3DJD A;  4Z25 A;  1E6E A;  3NYE A;  2C75 A;  3AEC A;  1VDC A;  1QJD A;  1F6M A;  1N1P A;  4BK2 A;  3V3O A;  2YLS A;  3IC9 A;  5JCI A;  1L9E A;  5GSN A;  3UOX A;  4EM4 A;  3Q6J A;  1M64 A;  4K5S A;  1L9C A;  1PBB A;  5KOX A;  3AD7 B;  1TDN A;  3BNM A;  2XLU A;  4J33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...