5KVHA

Crystal structure of human apoptosis-inducing factor with w196a mutation
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
487
structure length
438
Chain Sequence
DKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQANGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Defining NADH-Driven Allostery Regulating Apoptosis-Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 139
structure length 438
sequence length 487
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5kvhA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kvhA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kvhA01
1XHCA 2Q7VA 1IUXA 1GETA 1ELIA 2C72A 3FMWA 3P4QA 1EBDA 5FS6A 2E1MA 2WOWA 2JBVA 4NTCA 4H4VA 3AE5A 3GMBA 3SGLA 1PBDA 2X99A 3S61A 1NG3A 3M0OA 2IVEA 1L0VA 3IWAA 4H2QA 2YG4A 1CHUA 3NGCX 4LA1A 4DGKA 5J60A 4UDQA 1PBFA 4E0VA 3VRAA 1RP0A 1TDFA 4JNAA 3AYIA 4CCQA 3C4AA 3QVRA 2Z5YA 1LVLA 4U2TA 1Y56A 4BK1A 4YKFA 2JB2A 1E7PA 2XFNA 4H2PA 4OPGA 5BUKA 3GDNA 2YVJA 5EBKA 3G5QA 4EQSA 3NK1X 3LJPA 1K0LA 3ALLA 4OPTA 4D03A 1F3PA 3NN6X 1K0JA 2GV8A 2WDQA 1O95A 2FJBA 5KRQA 5JCNA 4USRA 5C2TA 4KX6A 2AQJA 1BF3A 3ITJA 4YSHA 1PBCA 1TRBA 3L8KA 2A87A 3OZ2A 3AD8B 3SM8A 4A6NA 2FJAA 2XLUA 1E1KA 1NAAA 2GR0A 4OPLA 1NDAA 4GR1A 1D5TA 1FOHA 4JN9A 1REOA 1PN0A 1HYUA 3EF6A 3LZXA 2GR1A 3BHFA 1LJ1A 3RP6A 3VRDB 1B4VA 4A99A 2ZZBA 2Z5XA 2QA1A 1XPQA 5FS9A 2WDVA 4NEWA 2V61A 4DSGA 2JK6A 1D4DA 4A9WA 2BK5A 5FS8A 3ZDNA 1S2QA 2BACA 1CJ2A 2BK4A 5JCKA 3UOXA 4LIIA 2WU5A 3H8IA 4EQRA 5KVIA 1OJCA 3F8RA 2XVHA 1BWCA 2VZ2A 1OJ9A 2OA1A 4TM3A 3O0HA 4B69A 5BVAA 1CBOA 1E6EA 2YR4A 1S2YA 1YQ3A 2Y6QA 4XWRA 4AP3A 3GYJA 2WDRA 3QSSA 2X50A 3D1CA 1Q1RA 4EIPA 2RGJA 2NVKX 2VVMA 1GRHA 1NPXA 2PHHA 3DGZA 2FJEA 1LQUA 4EMJA 1YKJA 3H8LA 4B65A 2RGHA 3CNPA 1TDOA 1H86A 4REKA 5IQ1A 1DJQA 3R9UA 1TYTA 4AT2A 1P2EA 2JB3A 3P1WA 3CTYA 4YXDA 3ZYXA 3AE7A 4Z25A 3NIXA 5JCLA 3C96A 1FEBA 1L9DA 2YLSA 4O5UA 4A7AA 4ZCCA 5BULA 3URHA 2B9WA 4TLXA 3LZWA 4C3YA 1H82A 2GB0A 3DJJA 3AD9B 4YSYA 3RP8A 1H81A 1S3EA 3AEGA 1CC2A 5IQ4A 4Y4LA 2WBAA 3GD3A 4H7UA 2R0CA 1QJDA 1ZOYA 4FK1C 1NHQA 2WOIA 3QSEA 5J7XA 3UKLA 4Z26A 3P4RA 1CC6A 3DK9A 4K8DA 5KOXA 1ZKQA 2FBWA 4BK2A 4EQWA 2RGOA 4K2XA 2WP9A 2QAEA 1GPEA 3ICRA 1KSUA 3Q9TA 4EM4A 1F6MA 1TDEA 3NRNA 3FBSA 3WE0A 1MO9A 2IIDA 2WHDA 3CGCA 3COXA 3GYIA 4XWZA 4UDPA 3AEDA 1BGNA 2CVJA 1KFYA 3AECA 4H4PA 1OJTA 3L1RA 1FECA 1GRBA 2ARDA 4YTPA 1IUUA 2BYBA 3CPJG 4K5RA 4OPCA 3QJ4A 1GALA 3AYLA 3K7TA 1PJ5A 1ZY8A 1FEAA 3G5RA 1F8RA 4U8MA 2CULA 5DBJA 5FS7A 4OPDA 3UKPA 3EANA 4APNA 4NZHA 5KWFA 2BS3A 2APGA 3LOVA 3BNMA 3IHGA 3K7QX 1GEUA 1B37A 3P4SA 3NLCA 3QSMA 4CY6A 3AE3A 2C66A 5HY5A 2GAGB 1JEHA 2OLNA 2V6OA 1BKWA 3UTGA 3ATQA 1E1LA 2VRLA 1JNZA 1PHHA 2C75A 4K5SA 2XVFA 3IHMA 2GR3A 4M52A 3DJGX 1N4WA 3B6DA 3ABVA 3VQRA 2NPXA 3AYJA 3CNTA 3DMEA 2X8HA 3P9UA 4B64A 1EL8A 5JCMA 2YG6A 4U2SA 4CNJA 2WP5A 4H50A 2R46A 1TDKA 4AP1A 4GDPA 3I6DA 2C67A 3UKFA 1O5WA 3RHAA 5FMHA 3VRBA 1D7LA 1DOEA 2A8XA 4YSZA 1DXLA 1COYA 1GSNA 1QO8A 2WU2A 3V3NA 2XFQA 4J56A 2XVJA 2VRMA 1GRTA 1E1MA 5EB4A 2ACZA 3LADA 2H89A 3UCLA 3DGHA 4YSXA 3DJEA 4NEVA 1CC4A 1BGJA 4RG4A 4FK1A 4U8JA 3ALMA 4ZCDA 3UTFA 2EQ6A 2GQWA 4BURA 2TPRA 2TMDA 2BS2A 2YG5A 4AOXA 2YVFA 3CNJA 4CRTA 1SEZA 4UP3A 2GRTA 4Z43A 2X8GA 2V60A 4KPRA 4FDCB 4EQXA 1EL7A 1ZMDA 3AXBA 2GF3A 3PS9A 2WOVA 5HXIA 5KVHA 2H88A 2BXRA 3NTAA 1DOBA 1KF6A 2GQFA 4K22A 2GVCA 2PYXA 4JQ9A 4Y4MA 3NYCA 3GSIA 3NYFA 3AEAA 3M12A 3NYEA 1OJAA 4K7ZA 2YVGA 3UKKA 3KKJA 4YKGA 1N1PA 2YR5A 2YR6A 2VQ7A 1KDGA 2E4GA 4BK3A 2FJDA 3BI5A 4OPUA 4WX1A 1N4VA 1D7YA 1TYPA 2GEWA 2VVLA 4C5OA 1ZK7A 4J31A 4U8KA 4AOSA 2WS3A 1Q1WA 3NN0X 1VRQB 3H4KA 4J2WA 5EOWA 4OPIA 2XDOA 1LTXR 1Y56B 2YAUA 1UKVG 4Z2RA 1IUSA 1F8WA 1GOSA 2X8CA 1PDHA 1JRYA 2YLXA 1H6VA 4ICYA 3AD7B 1IUVA 3IF9A 4H4ZA 2WETA 4U8OA 4H2NA 2YLZA 4FX9A 4H4XA 5U63A 2XLSA 1VDCA 3EPTA 1VQWA 2C70A 5KOWA 2J3NA 2C3DA 4BJYA 3FG2P 4A6NB 3ICTA 2XLRA 3II4A 1RSGA 1M6IA 3UKAA 1MXTA 4C74A 2B9YA 2YWLA 1GESA 3F8DA 2R0PA 1V59A 4NTEA 3CPHG 5GRTA 1F8SA 1X31B 2Q0LA 2XYOA 3KPFA 4AT0A 1PJ7A 4XXGA 4GDEA 1D4EA 2WPFA 4X9NA 1GREA 1GTHA 1Q9IA 3AE1A 4TLZA 1XANA 3BHKA 2YM2A 3AE2A 4D04A 2C76A 4A5LA 2B7RA 3P4PA 1L9EA 3ISHA 3KD9A 3LB8A 2OLOA 1GRGA 2WPCA 1LQTA 3BI4A 4B66A 3GRTA 1DNCA 2XFOA 1DJNA 2R45A 2HQMA 1ONFA 3UOYA 3NK0X 3VR9A 4B68A 2DKIA 1DOCA 1CF3A 2VVLG 4JDRA 1CJCA 1QLBA 3QFAA 2AR8A 2A89A 1JRXA 3F8PA 4Z2UA 4CBQA 3ATRA 3UKHA 4H4TA 2V3AA 3JSKA 1O94A 2ZZ0A 2F5ZA 2QCUA 3UKQA 4EIQA 4U8LA 4CCRA 5IPYA 2E5VA 4J36A 2GMHA 2YG7A 2W0HA 1PBBA 3HZLA 4I58A 1KNPA 1MOKA 1H7WA 3AE4A 3LXDA 3AE8A 4Y4NA 4GCMA 4HB9A 3FIMB 4IVMB 3KLJA 5EB5A 4I59A 2R4EA 3V3OA 5KXJA 2C3CA 2B76A 2B7SA 4H4RA 5CQFA 2VQBA 2YLWA 3QFBA 4TM4A 4ADWA 1GT8A 1NHPA 2BABA 2C7GA 5JCIA 3DJDA 4YTNA 3DH9A 2WPEA 1D4CA 3VR8A 4GF7A 3CN8A 2Y6RA 1GRFA 2GR2A 3AEEA 4JY2A 1ZOVA 1GV4A 1ZP0A 5M0ZA 3EAOA 2UZZA 5C3JA 1PXAA 1PXCA 1B5QA 4Z2TA 3RNMA 2OALA 4H4SA 1YQZA 1NHSA 2BCPA 1IUWA 2JKCA 3NTDA 1B8SA 4BV6A 2V3BA 3AB1A 1JOAA 3CGDA 2R4JA 3NNEA 3CPIG 3UTEA 3T37A 2XLPA 1KSSA 2XLTA 4P9SA 1NENA 4PABA 4DNAA 1JU2A 3UP4A 4MJWA 4H4QA 2XVEA 3PVCA 3IC9A 2C65A 3ADAB 3UOZA 2WEUA 2BCGG 2QA2A 3UOVA 4ZN0A 2CFYA 2EQ9A 2GAHB 2C73A 4IV9A 2IVDA 1S3BA 2EQ7A 1VG0A 1K4QA 1LV0A 2XFPA 4TM0A 1M64A 1Z6LA 4GRTA 1GXFA 2ZZCA 5BRTA 3GWFA 2JB1A 1E39A 3SFDA 2Q6UA 3UP5A 3ALJA 3GD4A 1OJDA 1FL2A 4C77A 2YG3A 3GDPA 3KA7A 1ZX9A 1GNDA 4JNQA 3Q6JA 3UTHA 4O5QA 2B9XA 2BK3A 4U2LA 2CDUA 1CL0A 2WQYA 2WP6A 1CJ3A 2XCGA 3QVPA 4A79A 4N9XA 2DKHA 4DSHA 1BZLA 1PXBA 2BC1A 4WCTA 4RSLA 1PJ6A 1YY5A 4EMIA 1AOGA 3DK4A 3AEBA 3BNUA 5GSNA 4H4YA 3GRSA 3AEFA 1K0IA 3OC4A 3E1TA 4EM3A 4HA6A 1PS9A 1NEKA 1VG9A 4IVOB 2YM1A 1E1NA 2BS4A 3KU9A 2Q0KA 4JY3A 4Z24A 1NHRA 2YLRA 3NHOX 2BA9A 1JRZA 3C4NA 1LPFA 3CGBA 3D8XA 2XFUA 3CGEA 1IJHA 2BXSA 3NG7X 4U8PA 1CJ4A 1H84A 5LV9A 1FCDA 2YLTA 4LU6A 1GRAA 1ZMCA 3BI2A 2XVIA 4OVIA 4OCGA 4ECHA 3K30A 3GWDA 2I0ZA 1P2HA 3AWIA 4TM1A 2YQUA 3DA1A 1JNRA 4YTMA 3G5SA 4EMWA 5HHFA 5ER0A 5L46A 5U1OA 2WESA 3K7MX 4GUVA 2GMJA 2EQ8A 5CKUA 4B1BA 4PAAA 2JAEA 4H4UA 4A65A 3NT6A 4Z44A 1H7XA 4J33A 4B67A 2RABA 3GMCA 3I3LA 4H2RA 3NK2X 4U8IA 3S5WA 4IA6A 4J34A 1ZDLA 3SQPA 3RP7A 2GH5A 1W4XA 3AE6A 1TDNA 3M13A 4U8NA 1XDIA 4X4JA 1IUTA 4CNKA 1Y0PA 3ICSA 5HYMA 1H83A 2V5ZA 4USQA 2O9ZA 1RYIA 5M10A 3FPZA 4YT0A 1NG4A 4J57A 3CNSA 2R9ZA 5TR3A 3V76A 4H4WA 4YWOA 2C64A 2ZBWA 3DK8A 2R0GA 2BC0A 3B3RA 3NH3X 4IA5A 3REDA 1EL5A 3CNDA 4RG3A 1L9CA 3AE9A 3KVEA 1YQ4A 1N4UA 4NTDA 1GERA 1DODA 1PBEA 2X3NA 2OAMA 3NKSA 3PO7A 4BJZA 4C3XA 4B63A 3CIRA 4X9MA 2VOUA 4UDRA 1KNRA 1EL9A 3SFEA 2AAQA 4CY8A 1GTEA 5U25A
chains in the Genus database with same CATH superfamily
1XHCA 1IUXA 1ELIA 4DYEA 3T31A 5FS6A 4NTCA 3GMBA 3S61A 1T3QC 3NS1B 2YG4A 1CHUA 3NGCX 4LA1A 4DGKA 1RP0A 1TDFA 4JNAA 3B9JB 1Y56A 2JB2A 4H2PA 3GDNA 2YVJA 3G5QA 2PP1A 7ENLA 2GV8A 1XPYA 4USRA 2QJNA 3UJFA 5JRBA 2XLUA 1NDAA 4GR1A 4HCHA 1FOHA 4JN9A 4ZA0A 3S47A 2ZADA 5G5HB 2BACA 1CJ2A 2BK4A 4LIIA 2WU5A 5KVIA 3I4KA 2PP3A 3ETRB 3SZWA 1CBOA 3DG7A 2Y6QA 2OO6A 3QSSA 3TJ4A 3IJQA 4EIPA 1LQUA 1YKJA 1KKOA 2XH2A 1TDOA 1TYTA 2OQYA 3P1WA 3ZYXA 4Z25A 3D46A 3C96A 3BJSA 5IDZA 3LZWA 1KCZA 4FP1A 3SZFA 1S3EA 3GD3A 4GAPA 1FHUA 2WOIA 5J7XA 1CC6A 4K8DA 4DXKA 4BK2A 4EQWA 3IJIA 1N60C 2PMQA 3V5FA 2E5AA 3FBSA 1MO9A 2IIDA 3CGCA 3GYIA 4XWZA 4UDPA 1BGNA 1OJTA 1DTNA 2ARDA 1IUUA 4GYPA 3QJ4A 3K7TA 1PJ5A 3H7VA 1F8RA 3FV9A 4OPDA 3MQTA 5KWFA 2BS3A 4NNJA 1B37A 2XH4A 5HY5A 1BKWA 4K5SA 3DJGX 1N4WA 3HPFA 3SXIA 3UJRA 1N5XA 4CNJA 3ZLHA 2E3TA 5FMHA 3VRBA 2A8XA 2WU2A 4J56A 2VRMA 1E1MA 3LADA 2H89A 3NVZB 3H12A 3CXBA 1CC4A 4FK1A 3BOXA 1STZA 2YG5A 4DWDA 3CAWA 2GRTA 4Z43A 2X8GA 2V60A 4A6GA 3TJIA 3HYXA 3NTAA 2MNRA 2PYXA 1KKRA 3N6HA 1R0MA 4K7ZA 2RDXA 4YKGA 3D47A 2VQ7A 1KDGA 4WX1A 1N4VA 1TYPA 4C5OA 2GDQA 4J31A 1Q1WA 3NN0X 3H4KA 4OPIA 2XDOA 1Y56B 1UKVG 4Z2RA 1IUSA 1F8WA 2YLXA 2DW7A 3IF9A 4FX9A 3SSZA 1SJCA 2J3NA 3ICTA 4H2HA 4C74A 1M6IA 2YWLA 1GESA 3CPHG 1X31B 2XYOA 3ZVHA 4E4FA 1F9CA 3AE2A 2HXTA 3RCYA 1L8PA 3KD9A 2OLOA 4B66A 3GRTA 3UOYA 3NK0X 1DOCA 3GYXA 1CF3A 4JDRA 1QLBA 3KPKA 3QFAA 3P0WA 2I5QA 2QCUA 4MGGA 2GMHA 3ZLFA 2W0HA 1PBBA 1WYGA 4HNLA 3AE4A 3LXDA 3AE8A 4Y4NA 2QJJA 4M6UA 3AM9A 3V3OA 5KXJA 3QFBA 3SN4A 1YEYA 1NHPA 2BABA 2C7GA 3DJDA 4GF7A 3CN8A 3AEEA 5M0ZA 1PXAA 4Z2TA 3OZYA 3RNMA 1IUWA 3RRAA 3UTEA 1XS2A 3ES7A 4DNAA 4H4QA 2XVEA 3UOZA 4GMEA 3K1GA 3STPA 1OEPA 4FI4A 3UOVA 2C73A 1MUCA 1VG0A 3CXOA 2XFPA 2ZZCA 5BRTA 1FL2A 3KA7A 5J04A 4JNQA 2B9XA 4U2LA 1PXBA 2BC1A 1PJ6A 3DG3A 3UJ2A 3KU9A 1NHRA 2YLRA 4H83A 3NHOX 3THUA 2PCEA 2XFUA 3CGEA 3SN0A 1FIQB 1GRAA 1ZMCA 4DN1A 4ECHA 3K30A 3A7UA 2I0ZA 4A65A 3PWIA 4Z44A 1H7XA 3RITA 3GMCA 4IA6A 1SB3B 3SQPA 3M13A 3L5OA 4ZOHB 4X4JA 1IUTA 2V5ZA 4USQA 1NG4A 4J57A 5TR3A 4H4WA 1ONEA 2ZBWA 3MZNA 2HXUA 3AE9A 2PP0A 3KVEA 1YQ4A 1N4UA 4BJZA 4C3XA 3PO7A 4B63A 4DHGA 2VOUA 1KNRA 1EL9A 4CY8A 5U25A 4TVYA 2QDEA 2WOWA 3SGLA 3UXLA 2X99A 3M0OA 6ENLA 4H2QA 5J60A 4UDQA 4E0VA 1LVLA 4BK1A 1E7PA 2XFNA 2ZC8A 3LJPA 2XH7A 3NN6X 2WDQA 3ITJA 3L8KA 3SM8A 3JVAA 4A6NA 5KMQA 3QLDA 2OKTA 1R6WA 3EF6A 2GR1A 1P43A 3VRDB 1EC8A 5G5GB 2QA1A 4GYPC 3DGBA 5FS9A 2WDVA 4NEWA 2V61A 1ZXIC 3H8IA 4EQRA 2W54A 2FYMA 2XVHA 2OA1A 3O0HA 1YQ3A 1N63C 4XWRA 4AP3A 2WDRA 2X50A 2HZGA 1NPXA 2FJEA 2P8CA 3H8LA 4B65A 4TVWA 4REKA 5IQ1A 1P2EA 3FCPA 3CTYA 5KNLA 3AE7A 3NIXA 4ZCCA 5BULA 5KMSA 3ZVIA 4IL0A 3AD9B 4J3ZA 3AEGA 4IHCA 4Y4LA 2WBAA 3SZ0A 3CK5A 4FK1C 1NHQA 3QSEA 2QDDA 2RGOA 2WP9A 2QAEA 1GPEA 3Q9TA 4EM4A 5FJOA 1KFYA 4Z1YA 2BYBA 3AYLA 3T2KA 3KUMA 4KT2A 1V97A 3SZCA 3FVDA 3K7QX 1GEUA 3DFHA 4IP4A 1ECQA 2C66A 1BKHA 2V6OA 2OZ3A 2BRYA 3UTGA 3T2ZA 1W6TA 2XVFA 3IHMA 2XH0A 2GSHA 3ABVA 3VQRA 3CNTA 3DMEA 3T9PA 2OZTA 2XSXA 2W3RA 3UCDA 4YWSA 4E5TA 3SR6B 2BRAA 4H50A 4HNCA 2R46A 4AP1A 2C67A 3UKFA 1PDZA 3RHAA 1DOEA 1FHVA 3T14A 2QJMA 3R25A 4ROPA 3U4FA 3NVYB 3OP2A 3NVVB 4ZCDA 2EQ6A 2GQWA 3OW1A 3VFCA 4BURA 1H2IA 3NVWB 2TMDA 2BS2A 4CRTA 1SEZA 4KPRA 4FDCB 4EQXA 3T2YA 3PS9A 5KVHA 2PTWA 2BXRA 2AKMA 2PGWA 2GQFA 3D9XA 2GVCA 4Y4MA 3NYCA 4JN8A 3M12A 1OJAA 3UKKA 1N1PA 3GY1A 2E4GA 3BI5A 2GEWA 2VVLA 1VRQB 5EOWA 2OVLA 3MSYA 1LTXR 3AN1A 1P48A 5KOWA 4BJYA 4A6NB 2XLRA 3II4A 1MXTA 2B9YA 2R0PA 1V59A 5GRTA 3FYYA 4AT0A 3AE1A 4TLZA 4D04A 2B7RA 1L9EA 3ISHA 1LQTA 1DNCA 1DJNA 2R45A 1ONFA 3VR9A 2DKIA 2VVLG 1CJCA 2AR8A 2A89A 1JRXA 3ATRA 4H4TA 2F5ZA 4CCRA 4J36A 2YG7A 1KNPA 1MOKA 5EB5A 2C3CA 2B76A 2B7SA 4H4RA 2OFJA 1VDVA 5JCIA 1D4CA 3PWGA 1ZOVA 1ZP0A 2UZZA 2OALA 2V3BA 1TZZA 3QPEA 1EC9A 3NNEA 1NENA 5FJUA 3IC9A 2C65A 3ADAB 2OLAA 3CT2A 4DX3A 2CFYA 4IV9A 2EQ7A 4M0XA 1M64A 4GRTA 2JB1A 1NELA 1E39A 4E8GA 2AL1A 3NZGA 4C77A 2CDUA 1CL0A 3OTRA 1CJ3A 2XCGA 1BZLA 4EMIA 3I6EA 3RR1A 4GISA 3OPSA 3GRSA 3TQPA 3E1TA 4IVOB 2Q0KA 2BA9A 1JRZA 3D8XA 2P8BA 5LV9A 2YLTA 4LU6A 1TE6A 2XVIA 4OVIA 4OCGA 2FKPA 3GWDA 3GD6A 3AWIA 1JNRA 3DDMA 3G5SA 5HHFA 5ER0A 5CKUA 2JAEA 4H4UA 3EKGA 3S5WA 5KMRA 4E6MA 3RP7A 4HCLA 1TDNA 3OZMA 3S5SA 2O9ZA 1RYIA 3FPZA 2PTXA 3CNSA 2R9ZA 3NH3X 2R0GA 3REDA 2PODA 4NTDA 4HCDA 1GERA 2X3NA 2OAMA 3HYWA 3CIRA 3SFEA 2C72A 3FMWA 1WUFA 1EBDA 2E1MA 2JBVA 4H4VA 3DIPA 1NG3A 2IVEA 2GGEA 2P0IA 1PBFA 1MRAA 3VRAA 1KD0A 4CCQA 3C4AA 1SJAA 3QVRA 3VA8A 4YKFA 5EBKA 4D03A 4K8GA 3IJLA 2FJBA 5JCNA 4KX6A 2AQJA 1PBCA 1TRBA 3OZ2A 2FJAA 1E1KA 4G9KA 4OPLA 1REOA 1HYUA 3BHFA 3DFYA 1B4VA 3I6TA 3N4EA 3T0KA 2W55A 2MUCA 4DSGA 2JK6A 1D4DA 2BK5A 3A7AA 1S2QA 1JROA 1OJCA 3F8RA 2VZ2A 3R07C 4TM3A 4B69A 1E6EA 1TKKA 3GYJA 3D1CA 4JN7A 1Q1RA 2GGIA 2NVKX 2VVMA 1GRHA 2PHHA 3DGZA 3T4WA 3CNPA 3R9UA 1FFUC 4GGHA 5JCLA 1L9DA 4O5UA 4A7AA 3URHA 2B9WA 3DJJA 4YSYA 3RP8A 1CC2A 2QQ6A 3R0UA 1ZOYA 4Z26A 5KOXA 1ZKQA 2FBWA 1F6MA 3NRNA 3AEDA 1GRBA 4YTPA 3CPJG 4OPCA 4X2PA 3JZUA 3SQSA 1FEAA 3UKPA 1N5WC 4APNA 4NZHA 2APGA 3BNMA 3IHGA 3NFUA 3AE3A 5BOEA 2AL2A 2OLNA 1PHHA 2GR3A 4M52A 3B6DA 2NPXA 2X8HA 3T6CA 2POZA 4B64A 1EL8A 5JCMA 2YG6A 3VC6A 4GDPA 1O5WA 1E9IA 1DXLA 4JHMA 1COYA 3SJNA 3ZVHB 1GSNA 1QO8A 2XGZA 2XFQA 2XVJA 1GRTA 5EB4A 2ACZA 3UCLA 3DGHA 5BOFA 4YSXA 3H70A 3P3BA 1BGJA 4U8JA 1NU5A 2TPRA 3R10A 4AOXA 3CNJA 2OPJA 1ZMDA 2PSNA 2GF3A 2WOVA 2H88A 1WUEA 2GL5A 3GSIA 3NYEA 3PFRA 3JW7A 2YR5A 2YR6A 4BK3A 4OPUA 2PU1A 1D7YA 1EBGA 2WS3A 4G73A 4J2WA 4GFIA 2YAUA 5FJTA 1PDHA 3ENLA 3ES8A 1H6VA 4ICYA 3AD7B 1IUVA 4H4ZA 4U8OA 4H2NA 2YLZA 4H4XA 2XLSA 1VDCA 1X2GA 4KPLA 4II3A 3SYIA 3F8DA 2GGJA 4NTEA 2Q0LA 1PJ7A 3NXLA 3MWCA 4A35A 4GDEA 1D4EA 1GTHA 3VCNA 3BHKA 3Q45A 4H19A 3VC5A 2C76A 3LB8A 1GRGA 2PU0A 4F4RA 2XFOA 3NRZB 4CBQA 3UKHA 2V3AA 3JSKA 1O94A 2ZZ0A 3UKQA 1N61C 4EIQA 4U8LA 5IPYA 1N62C 2HNEA 3HZLA 4I58A 1H7WA 3Q4DA 4GCMA 4IVMB 3KLJA 4IP5A 4I59A 1S7MA 5CQFA 2YLWA 4YTNA 3VR8A 2Y6RA 1GRFA 3EAOA 3N4FA 1B5QA 2NQLA 5FJPA 1YQZA 2JKCA 1B8SA 4BV6A 3UXKA 3AB1A 2QVHA 2PTZA 2R4JA 4MMWA 3HYVA 4G74A 1KSSA 2XLTA 4PABA 3PVCA 2WEUA 2QA2A 1JPDX 4ZN0A 2GAHB 2EQ9A 2IVDA 1K4QA 3MUCA 4TM0A 1Z6LA 3GWFA 3SFDA 3UP5A 3UJSA 3ALJA 3GD4A 1FFVC 3CYJA 2YG3A 3GDPA 1ZX9A 3SY4A 2WQYA 2WP6A 3QVPA 4N9XA 1JCTA 2AL2B 2DW6A 4RSLA 1AOGA 3DK4A 4NWZA 5GSNA 3AEFA 1K0IA 1FO4A 4EM3A 2OG9A 1PS9A 1VG9A 2YM1A 1E1NA 4JY3A 3C4NA 1LPFA 2BXSA 1IJHA 3NG7X 3VCCA 1CJ4A 1H84A 2YQUA 3DA1A 4MKSA 4YTMA 2OX4A 4EMWA 5L46A 5U1OA 4GUVA 2GMJA 2EQ8A 1RVKA 4B67A 4GGBA 4H2RA 4U8IA 2GH5A 3AE6A 3UGVA 2P88A 4A3RA 5HYMA 4CNKA 1Y0PA 3ICSA 1SJBA 4YT0A 3V76A 4YWOA 2C64A 3DK8A 3B3RA 1EL5A 3EUB3 3CNDA 1PBEA 3NKSA 3NO1A 3H8AA 4EWJA 2AAQA 1GTEA 2Q7VA 1GETA 3P4QA 3AE5A 1PBDA 1SJDA 1L0VA 3IWAA 3VDGA 3AYIA 1X2HA 2Z5YA 4U2TA 4OPGA 5BUKA 4EQSA 3NK1X 4Z17A 1K0LA 3ALLA 4OPTA 1F3PA 1K0JA 1O95A 5KRQA 3QN3A 2P3ZA 3SBFA 5C2TA 1BF3A 4YSHA 2A87A 3AD8B 1NAAA 2GR0A 1D5TA 1PN0A 3LZXA 3EEZA 1LJ1A 3RP6A 4A99A 2ZZBA 2Z5XA 1XPQA 4A9WA 5FS8A 3ZDNA 3QKEA 5JCKA 3UOXA 3U9IA 3UCCA 1BWCA 3MY9A 1OJ9A 5BVAA 2YR4A 1S2YA 3CMMA 3HRDC 5EU9A 2PS2A 2RGJA 4HPNA 4EMJA 2RGHA 1H86A 1DJQA 4AT2A 4H1ZA 2JB3A 4YXDA 2GGGA 3QTPA 2PTYA 3DG6A 1FEBA 2YLSA 1EC7A 4TLXA 4C3YA 1H82A 2GB0A 1H81A 1BQGA 5IQ4A 1ELSA 4H7UA 4GAVA 2R0CA 4E4UA 3TWAA 1QJDA 4K1WA 3UKLA 3P4RA 3DK9A 1RM6B 4K2XA 3ICRA 1KSUA 1TDEA 3WE0A 2QGYA 2WHDA 3DEQA 3SX6A 3COXA 2CVJA 3AECA 4H4PA 4G8TA 3L1RA 1FECA 2PPGA 4KEMA 4K5RA 1GALA 1ZY8A 3IK4A 3G5RA 4U8MA 2CULA 5DBJA 5FS7A 3EANA 3R11A 3LOVA 3GC2A 4ENLA 3P4SA 3R0KA 3NLCA 3QSMA 4CY6A 3DESA 2GAGB 1JEHA 3ATQA 1E1LA 2VRLA 4G6HA 1JNZA 2C75A 3AYJA 3P9UA 3MKCA 3P93A 3UJEA 4U2SA 2WP5A 3RO6A 1TDKA 3I6DA 1D7LA 4YSZA 3FJ4A 3V3NA 2W3SA 3HW2A 3DJEA 4NEVA 4RG4A 3ALMA 3UTFA 3BSMA 2YVFA 4UP3A 4ZCWA 4HN8A 1EL7A 3AXBA 2OZ8A 5HXIA 1DOBA 1KF6A 4K22A 4JQ9A 3NYFA 3AEAA 2YVGA 3KKJA 3AMZA 2FJDA 1ZK7A 4U8KA 4AOSA 3CB3A 2PGEA 3T8QA 1GOSA 2X8CA 4K2SA 1JRYA 3TOYA 2WETA 5U63A 3EPTA 1KN0A 1VQWA 2C70A 2C3DA 3FG2P 1RSGA 3UKAA 3ZLGA 1F8SA 3KPFA 4KWSA 1MDRA 4XXGA 2WPFA 4X9NA 1GREA 1Q9IA 1XANA 2YM2A 2PA6A 4A5LA 3P4PA 1PDYA 2WPCA 3V5CA 3BI4A 4GIRA 2HQMA 4B68A 1JPMA 3FXGA 3F8PA 4Z2UA 3TW9A 1MDLA 2E5VA 3GO2A 3PK7A 4HB9A 3FIMB 2R4EA 2VQBA 4TM4A 4ADWA 1GT8A 3DH9A 2WPEA 3TCSA 3V4BA 2ONEA 4HYRA 2GR2A 4JY2A 1GV4A 5C3JA 4IL2A 1PXCA 2O56A 2C4CA 4H4SA 1NHSA 2BCPA 3V3WA 3TTEA 3NTDA 2CHRA 1JOAA 3CGDA 3CPIG 3T37A 2XLPA 4P9SA 1JU2A 3UP4A 4MJWA 4II2A 3RGTA 2BCGG 1JDFA 1S3BA 3A7RA 1LV0A 1JRPA 4G6GA 1GXFA 2AKZA 4IT1A 2Q6UA 1OJDA 1GNDA 3Q6JA 3UTHA 4O5QA 2BK3A 5FJRA 4A79A 3SN1A 2DKHA 1VQZA 3TWBA 4DSHA 4WCTA 1YY5A 3AEBA 3BNUA 4H4YA 3OC4A 3DERA 4HA6A 1NEKA 2BS4A 4Z24A 3CGBA 2GGHA 4U8PA 3B97A 1FCDA 3BI2A 4J1OA 5ENLA 1P2HA 4TM1A 2WESA 3K7MX 4B1BA 1EBHA 4PAAA 3NT6A 4J33A 2RABA 3I3LA 3R1ZA 3NK2X 4J34A 1ZDLA 1W4XA 4G7FA 4U8NA 5KMPA 1MNSA 1XDIA 1H83A 5M10A 3PG6A 4IZGA 4IA5A 2BC0A 4RG3A 1L9CA 1IYXA 1DODA 4X9MA 4UDRA 2OQHA 3N6JA
chains in the Genus database with same CATH topology
1XHCA 2Q7VA 1IUXA 1GETA 1ELIA 2C72A 3FMWA 3P4QA 3T31A 1EBDA 5FS6A 2E1MA 2WOWA 2JBVA 4NTCA 4H4VA 3AE5A 3GMBA 3SGLA 1PBDA 2X99A 3S61A 1NG3A 3M0OA 2IVEA 1L0VA 3IWAA 4H2QA 2YG4A 1CHUA 3NGCX 4LA1A 4DGKA 5J60A 4UDQA 1PBFA 4E0VA 3VRAA 1RP0A 1TDFA 4JNAA 3AYIA 4CCQA 3C4AA 3QVRA 2Z5YA 1LVLA 4U2TA 1Y56A 4BK1A 4YKFA 2JB2A 1E7PA 2XFNA 4H2PA 4OPGA 5BUKA 3GDNA 2YVJA 5EBKA 3G5QA 4EQSA 3NK1X 3LJPA 1K0LA 3ALLA 4OPTA 4D03A 1F3PA 3NN6X 1K0JA 2GV8A 2WDQA 1O95A 2FJBA 5KRQA 5JCNA 4USRA 5C2TA 4KX6A 2AQJA 1BF3A 3ITJA 4YSHA 1PBCA 1TRBA 3L8KA 2A87A 3OZ2A 5JRBA 3AD8B 3SM8A 4A6NA 2FJAA 5KMQA 2XLUA 1E1KA 4G9KA 1NAAA 2GR0A 4OPLA 1NDAA 4GR1A 1D5TA 1FOHA 4JN9A 1REOA 1PN0A 1HYUA 3EF6A 3LZXA 2GR1A 3BHFA 1LJ1A 3RP6A 3VRDB 1B4VA 4A99A 2ZZBA 2Z5XA 2QA1A 1XPQA 3T0KA 5FS9A 2WDVA 4NEWA 2V61A 4DSGA 2JK6A 1D4DA 4A9WA 2BK5A 5FS8A 3ZDNA 1S2QA 2BACA 1CJ2A 2BK4A 5JCKA 3UOXA 4LIIA 2WU5A 3H8IA 4EQRA 5KVIA 1OJCA 3F8RA 2XVHA 1BWCA 2VZ2A 3SZWA 1OJ9A 2OA1A 4TM3A 3O0HA 4B69A 5BVAA 1CBOA 1E6EA 2YR4A 1S2YA 1YQ3A 2Y6QA 4XWRA 4AP3A 3CMMA 2WDRA 3GYJA 3QSSA 2X50A 3D1CA 1Q1RA 4EIPA 2RGJA 2NVKX 2VVMA 1GRHA 1NPXA 2PHHA 3DGZA 2FJEA 1LQUA 4EMJA 1YKJA 3H8LA 4B65A 2RGHA 3CNPA 1TDOA 1H86A 4REKA 5IQ1A 1DJQA 3R9UA 1TYTA 4AT2A 1P2EA 2JB3A 3P1WA 3CTYA 4YXDA 3ZYXA 3AE7A 4Z25A 3NIXA 5KNLA 5JCLA 3C96A 1FEBA 1L9DA 2YLSA 4O5UA 4A7AA 4ZCCA 5BULA 3URHA 2B9WA 5KMSA 4TLXA 3LZWA 4C3YA 1H82A 2GB0A 3DJJA 3AD9B 3SZFA 4YSYA 3RP8A 1H81A 1S3EA 3AEGA 1CC2A 5IQ4A 4Y4LA 2WBAA 3GD3A 4H7UA 3SZ0A 4GAVA 2R0CA 1QJDA 1ZOYA 4FK1C 1NHQA 2WOIA 3QSEA 4GAPA 5J7XA 3UKLA 4Z26A 3P4RA 1CC6A 3DK9A 4K8DA 5KOXA 1ZKQA 2FBWA 4BK2A 4EQWA 2RGOA 4K2XA 2WP9A 2QAEA 1GPEA 3ICRA 1KSUA 3Q9TA 4EM4A 1F6MA 1TDEA 3NRNA 3FBSA 3WE0A 1MO9A 2IIDA 2WHDA 3CGCA 3SX6A 3COXA 3GYIA 4XWZA 4UDPA 3AEDA 1BGNA 2CVJA 1KFYA 3AECA 4H4PA 1OJTA 3L1RA 1FECA 1GRBA 2ARDA 4YTPA 1IUUA 2BYBA 3CPJG 4K5RA 4OPCA 3QJ4A 1GALA 3AYLA 3K7TA 1PJ5A 1ZY8A 1FEAA 3G5RA 3T2KA 1F8RA 4U8MA 2CULA 5DBJA 5FS7A 4OPDA 3UKPA 3EANA 4APNA 4NZHA 5KWFA 2BS3A 3SZCA 2APGA 3LOVA 3BNMA 3IHGA 4NNJA 3K7QX 1GEUA 1B37A 3P4SA 3NLCA 3QSMA 4CY6A 3AE3A 2C66A 5HY5A 2GAGB 1JEHA 2OLNA 2V6OA 1BKWA 2BRYA 3UTGA 3ATQA 1E1LA 2VRLA 3T2ZA 4G6HA 1JNZA 1PHHA 2C75A 4K5SA 2XVFA 3IHMA 2GR3A 4M52A 3DJGX 1N4WA 3B6DA 3ABVA 3VQRA 2NPXA 3AYJA 3CNTA 3DMEA 2X8HA 3P9UA 4B64A 1EL8A 5JCMA 2YG6A 3SXIA 2BRAA 4U2SA 4CNJA 2WP5A 4H50A 2R46A 1TDKA 4AP1A 4GDPA 3I6DA 2C67A 3UKFA 1O5WA 3RHAA 5FMHA 3VRBA 1D7LA 1DOEA 2A8XA 4YSZA 1DXLA 1COYA 1GSNA 3T14A 1QO8A 2WU2A 3V3NA 2XFQA 4J56A 2XVJA 2VRMA 1GRTA 1E1MA 5EB4A 2ACZA 3LADA 2H89A 3UCLA 3DGHA 4YSXA 3DJEA 4NEVA 1CC4A 1BGJA 4RG4A 4FK1A 4U8JA 3ALMA 4ZCDA 3UTFA 2EQ6A 2GQWA 4BURA 1H2IA 2TPRA 2TMDA 2BS2A 2YG5A 4AOXA 2YVFA 3CNJA 4CRTA 1SEZA 4UP3A 2GRTA 4Z43A 2X8GA 2V60A 4KPRA 4FDCB 4EQXA 1EL7A 1ZMDA 3T2YA 3AXBA 2GF3A 3PS9A 2WOVA 5HXIA 5KVHA 2H88A 2BXRA 3HYXA 3NTAA 1DOBA 1KF6A 2GQFA 4K22A 3D9XA 2GVCA 2PYXA 4JQ9A 4Y4MA 3NYCA 3GSIA 3NYFA 3AEAA 3M12A 3NYEA 1OJAA 4K7ZA 2YVGA 3UKKA 3KKJA 4YKGA 1N1PA 2YR5A 2YR6A 2VQ7A 1KDGA 2E4GA 4BK3A 2FJDA 3BI5A 4OPUA 4WX1A 1N4VA 1D7YA 1TYPA 2GEWA 2VVLA 4C5OA 1ZK7A 4J31A 4U8KA 4AOSA 2WS3A 4G73A 1Q1WA 3NN0X 1VRQB 3H4KA 4J2WA 5EOWA 4OPIA 2XDOA 1LTXR 1Y56B 2YAUA 1UKVG 4Z2RA 1IUSA 1F8WA 1GOSA 2X8CA 1PDHA 1JRYA 2YLXA 1H6VA 4ICYA 3AD7B 1IUVA 3IF9A 4H4ZA 2WETA 4U8OA 4H2NA 2YLZA 4FX9A 4H4XA 5U63A 2XLSA 1VDCA 1KN0A 1VQWA 2C70A 3EPTA 5KOWA 2J3NA 2C3DA 4BJYA 3FG2P 4A6NB 3ICTA 2XLRA 3II4A 1RSGA 1M6IA 3UKAA 1MXTA 4C74A 2B9YA 2YWLA 4II3A 1GESA 3SYIA 3F8DA 2R0PA 1V59A 4NTEA 3CPHG 5GRTA 1F8SA 1X31B 2Q0LA 2XYOA 3KPFA 4AT0A 1PJ7A 4XXGA 4GDEA 1D4EA 2WPFA 4X9NA 1GREA 1GTHA 1Q9IA 3AE1A 4TLZA 1XANA 3BHKA 2YM2A 3AE2A 4D04A 2C76A 4A5LA 2B7RA 3P4PA 1L9EA 3ISHA 3KD9A 3LB8A 2OLOA 1GRGA 2WPCA 1LQTA 3BI4A 4B66A 3GRTA 1DNCA 2XFOA 1DJNA 2R45A 2HQMA 1ONFA 3UOYA 3NK0X 3VR9A 4B68A 2DKIA 1DOCA 3GYXA 1CF3A 2VVLG 4JDRA 1CJCA 1QLBA 3QFAA 2AR8A 3KPKA 2A89A 1JRXA 3F8PA 4Z2UA 4CBQA 3ATRA 3UKHA 4H4TA 2V3AA 3JSKA 1O94A 2ZZ0A 2F5ZA 2QCUA 3UKQA 4EIQA 4U8LA 4CCRA 5IPYA 2E5VA 4J36A 2GMHA 2YG7A 2W0HA 1PBBA 3HZLA 4I58A 1KNPA 1MOKA 1H7WA 3AE4A 3LXDA 3AE8A 4Y4NA 4GCMA 4HB9A 3FIMB 4IVMB 3KLJA 5EB5A 4I59A 2R4EA 3V3OA 1S7MA 5KXJA 2C3CA 2B76A 2B7SA 4H4RA 5CQFA 2VQBA 2YLWA 3QFBA 4TM4A 4ADWA 1GT8A 1NHPA 2BABA 2C7GA 5JCIA 3DJDA 4YTNA 3DH9A 2WPEA 1D4CA 3VR8A 4GF7A 3CN8A 2Y6RA 1GRFA 2GR2A 3AEEA 4JY2A 1ZOVA 1GV4A 1ZP0A 5M0ZA 3EAOA 2UZZA 5C3JA 1PXAA 1PXCA 1B5QA 4Z2TA 3RNMA 2C4CA 4H4SA 2OALA 1YQZA 1NHSA 2BCPA 1IUWA 2JKCA 3NTDA 1B8SA 4BV6A 2V3BA 3AB1A 1JOAA 3CGDA 2R4JA 3NNEA 3CPIG 3HYVA 4G74A 3UTEA 3T37A 2XLPA 1KSSA 2XLTA 4P9SA 1NENA 4PABA 4DNAA 1JU2A 3UP4A 4MJWA 4H4QA 2XVEA 3PVCA 3IC9A 2C65A 3ADAB 4II2A 2WEUA 3UOZA 2BCGG 2QA2A 3UOVA 4ZN0A 2CFYA 2EQ9A 2GAHB 2C73A 4IV9A 2IVDA 1S3BA 2EQ7A 1VG0A 1K4QA 1LV0A 2XFPA 4TM0A 1M64A 1Z6LA 4G6GA 4GRTA 1GXFA 2ZZCA 5BRTA 3GWFA 2JB1A 1E39A 3SFDA 2Q6UA 3UP5A 3ALJA 3GD4A 1OJDA 1FL2A 4C77A 2YG3A 3GDPA 3KA7A 1ZX9A 1GNDA 4JNQA 3Q6JA 3UTHA 4O5QA 3SY4A 2B9XA 2BK3A 4U2LA 2CDUA 1CL0A 2WQYA 2WP6A 1CJ3A 2XCGA 3QVPA 4A79A 4N9XA 2DKHA 4DSHA 1BZLA 1PXBA 2BC1A 4WCTA 4RSLA 1PJ6A 1YY5A 4EMIA 1AOGA 3DK4A 3AEBA 3BNUA 4NWZA 4H4YA 5GSNA 3GRSA 3AEFA 1K0IA 3OC4A 3E1TA 4EM3A 4HA6A 1PS9A 1NEKA 1VG9A 4IVOB 2YM1A 1E1NA 2BS4A 3KU9A 2Q0KA 4JY3A 4Z24A 1NHRA 2YLRA 3NHOX 2BA9A 1JRZA 3C4NA 1LPFA 3CGBA 3D8XA 2XFUA 3CGEA 1IJHA 2BXSA 3NG7X 4U8PA 1CJ4A 1H84A 5LV9A 1FCDA 2YLTA 4LU6A 1GRAA 1ZMCA 3BI2A 2XVIA 4OVIA 4OCGA 4ECHA 3K30A 3GWDA 2I0ZA 1P2HA 3AWIA 4TM1A 2YQUA 3DA1A 1JNRA 4YTMA 3G5SA 4EMWA 5HHFA 5ER0A 5L46A 5U1OA 2WESA 3K7MX 4GUVA 2GMJA 2EQ8A 5CKUA 4B1BA 4PAAA 2JAEA 4H4UA 4A65A 3NT6A 4Z44A 1H7XA 4J33A 4B67A 2RABA 3GMCA 3I3LA 4H2RA 3NK2X 4U8IA 3S5WA 4IA6A 4J34A 5KMRA 1ZDLA 3SQPA 3RP7A 2GH5A 1W4XA 3AE6A 1TDNA 3M13A 4U8NA 3L5OA 5KMPA 1XDIA 4X4JA 1IUTA 4CNKA 1Y0PA 3ICSA 5HYMA 1H83A 2V5ZA 4USQA 2O9ZA 1RYIA 5M10A 3FPZA 4YT0A 3PG6A 1NG4A 4J57A 3CNSA 2R9ZA 5TR3A 3V76A 4H4WA 4YWOA 2C64A 2ZBWA 3DK8A 2R0GA 2BC0A 3B3RA 3NH3X 4IA5A 3REDA 1EL5A 3CNDA 4RG3A 1L9CA 3AE9A 3KVEA 1YQ4A 1N4UA 4NTDA 1GERA 1DODA 1PBEA 2X3NA 2OAMA 3NKSA 3PO7A 4BJZA 4C3XA 4B63A 3HYWA 3CIRA 4X9MA 2VOUA 4UDRA 1KNRA 1EL9A 3SFEA 2AAQA 4CY8A 1GTEA 5U25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHC A;  2Q7V A;  1IUX A;  1GET A;  1ELI A;  2C72 A;  3FMW A;  3P4Q A;  1EBD A;  5FS6 A;  2E1M A;  2WOW A;  2JBV A;  4NTC A;  4H4V A;  3AE5 A;  3GMB A;  3SGL A;  1PBD A;  2X99 A;  3S61 A;  1NG3 A;  3M0O A;  2IVE A;  1L0V A;  3IWA A;  4H2Q A;  2YG4 A;  1CHU A;  3NGC X;  4LA1 A;  4DGK A;  5J60 A;  4UDQ A;  1PBF A;  4E0V A;  3VRA A;  1RP0 A;  1TDF A;  4JNA A;  3AYI A;  4CCQ A;  3C4A A;  3QVR A;  2Z5Y A;  1LVL A;  4U2T A;  1Y56 A;  4BK1 A;  4YKF A;  2JB2 A;  1E7P A;  2XFN A;  4H2P A;  4OPG A;  5BUK A;  3GDN A;  2YVJ A;  5EBK A;  3G5Q A;  4EQS A;  3NK1 X;  3LJP A;  1K0L A;  3ALL A;  4OPT A;  4D03 A;  1F3P A;  3NN6 X;  1K0J A;  2GV8 A;  2WDQ A;  1O95 A;  2FJB A;  5KRQ A;  5JCN A;  4USR A;  5C2T A;  4KX6 A;  2AQJ A;  1BF3 A;  3ITJ A;  4YSH A;  1PBC A;  1TRB A;  3L8K A;  2A87 A;  3OZ2 A;  3AD8 B;  3SM8 A;  4A6N A;  2FJA A;  2XLU A;  1E1K A;  1NAA A;  2GR0 A;  4OPL A;  1NDA A;  4GR1 A;  1D5T A;  1FOH A;  4JN9 A;  1REO A;  1PN0 A;  1HYU A;  3EF6 A;  3LZX A;  2GR1 A;  3BHF A;  1LJ1 A;  3RP6 A;  3VRD B;  1B4V A;  4A99 A;  2ZZB A;  2Z5X A;  2QA1 A;  1XPQ A;  5FS9 A;  2WDV A;  4NEW A;  2V61 A;  4DSG A;  2JK6 A;  1D4D A;  4A9W A;  2BK5 A;  5FS8 A;  3ZDN A;  1S2Q A;  2BAC A;  1CJ2 A;  2BK4 A;  5JCK A;  3UOX A;  4LII A;  2WU5 A;  3H8I A;  4EQR A;  5KVI A;  1OJC A;  3F8R A;  2XVH A;  1BWC A;  2VZ2 A;  1OJ9 A;  2OA1 A;  4TM3 A;  3O0H A;  4B69 A;  5BVA A;  1CBO A;  1E6E A;  2YR4 A;  1S2Y A;  1YQ3 A;  2Y6Q A;  4XWR A;  4AP3 A;  3GYJ A;  2WDR A;  3QSS A;  2X50 A;  3D1C A;  1Q1R A;  4EIP A;  2RGJ A;  2NVK X;  2VVM A;  1GRH A;  1NPX A;  2PHH A;  3DGZ A;  2FJE A;  1LQU A;  4EMJ A;  1YKJ A;  3H8L A;  4B65 A;  2RGH A;  3CNP A;  1TDO A;  1H86 A;  4REK A;  5IQ1 A;  1DJQ A;  3R9U A;  1TYT A;  4AT2 A;  1P2E A;  2JB3 A;  3P1W A;  3CTY A;  4YXD A;  3ZYX A;  3AE7 A;  4Z25 A;  3NIX A;  5JCL A;  3C96 A;  1FEB A;  1L9D A;  2YLS A;  4O5U A;  4A7A A;  4ZCC A;  5BUL A;  3URH A;  2B9W A;  4TLX A;  3LZW A;  4C3Y A;  1H82 A;  2GB0 A;  3DJJ A;  3AD9 B;  4YSY A;  3RP8 A;  1H81 A;  1S3E A;  3AEG A;  1CC2 A;  5IQ4 A;  4Y4L A;  2WBA A;  3GD3 A;  4H7U A;  2R0C A;  1QJD A;  1ZOY A;  4FK1 C;  1NHQ A;  2WOI A;  3QSE A;  5J7X A;  3UKL A;  4Z26 A;  3P4R A;  1CC6 A;  3DK9 A;  4K8D A;  5KOX A;  1ZKQ A;  2FBW A;  4BK2 A;  4EQW A;  2RGO A;  4K2X A;  2WP9 A;  2QAE A;  1GPE A;  3ICR A;  1KSU A;  3Q9T A;  4EM4 A;  1F6M A;  1TDE A;  3NRN A;  3FBS A;  3WE0 A;  1MO9 A;  2IID A;  2WHD A;  3CGC A;  3COX A;  3GYI A;  4XWZ A;  4UDP A;  3AED A;  1BGN A;  2CVJ A;  1KFY A;  3AEC A;  4H4P A;  1OJT A;  3L1R A;  1FEC A;  1GRB A;  2ARD A;  4YTP A;  1IUU A;  2BYB A;  3CPJ G;  4K5R A;  4OPC A;  3QJ4 A;  1GAL A;  3AYL A;  3K7T A;  1PJ5 A;  1ZY8 A;  1FEA A;  3G5R A;  1F8R A;  4U8M A;  2CUL A;  5DBJ A;  5FS7 A;  4OPD A;  3UKP A;  3EAN A;  4APN A;  4NZH A;  5KWF A;  2BS3 A;  2APG A;  3LOV A;  3BNM A;  3IHG A;  3K7Q X;  1GEU A;  1B37 A;  3P4S A;  3NLC A;  3QSM A;  4CY6 A;  3AE3 A;  2C66 A;  5HY5 A;  2GAG B;  1JEH A;  2OLN A;  2V6O A;  1BKW A;  3UTG A;  3ATQ A;  1E1L A;  2VRL A;  1JNZ A;  1PHH A;  2C75 A;  4K5S A;  2XVF A;  3IHM A;  2GR3 A;  4M52 A;  3DJG X;  1N4W A;  3B6D A;  3ABV A;  3VQR A;  2NPX A;  3AYJ A;  3CNT A;  3DME A;  2X8H A;  3P9U A;  4B64 A;  1EL8 A;  5JCM A;  2YG6 A;  4U2S A;  4CNJ A;  2WP5 A;  4H50 A;  2R46 A;  1TDK A;  4AP1 A;  4GDP A;  3I6D A;  2C67 A;  3UKF A;  1O5W A;  3RHA A;  5FMH A;  3VRB A;  1D7L A;  1DOE A;  2A8X A;  4YSZ A;  1DXL A;  1COY A;  1GSN A;  1QO8 A;  2WU2 A;  3V3N A;  2XFQ A;  4J56 A;  2XVJ A;  2VRM A;  1GRT A;  1E1M A;  5EB4 A;  2ACZ A;  3LAD A;  2H89 A;  3UCL A;  3DGH A;  4YSX A;  3DJE A;  4NEV A;  1CC4 A;  1BGJ A;  4RG4 A;  4FK1 A;  4U8J A;  3ALM A;  4ZCD A;  3UTF A;  2EQ6 A;  2GQW A;  4BUR A;  2TPR A;  2TMD A;  2BS2 A;  2YG5 A;  4AOX A;  2YVF A;  3CNJ A;  4CRT A;  1SEZ A;  4UP3 A;  2GRT A;  4Z43 A;  2X8G A;  2V60 A;  4KPR A;  4FDC B;  4EQX A;  1EL7 A;  1ZMD A;  3AXB A;  2GF3 A;  3PS9 A;  2WOV A;  5HXI A;  5KVH A;  2H88 A;  2BXR A;  3NTA A;  1DOB A;  1KF6 A;  2GQF A;  4K22 A;  2GVC A;  2PYX A;  4JQ9 A;  4Y4M A;  3NYC A;  3GSI A;  3NYF A;  3AEA A;  3M12 A;  3NYE A;  1OJA A;  4K7Z A;  2YVG A;  3UKK A;  3KKJ A;  4YKG A;  1N1P A;  2YR5 A;  2YR6 A;  2VQ7 A;  1KDG A;  2E4G A;  4BK3 A;  2FJD A;  3BI5 A;  4OPU A;  4WX1 A;  1N4V A;  1D7Y A;  1TYP A;  2GEW A;  2VVL A;  4C5O A;  1ZK7 A;  4J31 A;  4U8K A;  4AOS A;  2WS3 A;  1Q1W A;  3NN0 X;  1VRQ B;  3H4K A;  4J2W A;  5EOW A;  4OPI A;  2XDO A;  1LTX R;  1Y56 B;  2YAU A;  1UKV G;  4Z2R A;  1IUS A;  1F8W A;  1GOS A;  2X8C A;  1PDH A;  1JRY A;  2YLX A;  1H6V A;  4ICY A;  3AD7 B;  1IUV A;  3IF9 A;  4H4Z A;  2WET A;  4U8O A;  4H2N A;  2YLZ A;  4FX9 A;  4H4X A;  5U63 A;  2XLS A;  1VDC A;  3EPT A;  1VQW A;  2C70 A;  5KOW A;  2J3N A;  2C3D A;  4BJY A;  3FG2 P;  4A6N B;  3ICT A;  2XLR A;  3II4 A;  1RSG A;  1M6I A;  3UKA A;  1MXT A;  4C74 A;  2B9Y A;  2YWL A;  1GES A;  3F8D A;  2R0P A;  1V59 A;  4NTE A;  3CPH G;  5GRT A;  1F8S A;  1X31 B;  2Q0L A;  2XYO A;  3KPF A;  4AT0 A;  1PJ7 A;  4XXG A;  4GDE A;  1D4E A;  2WPF A;  4X9N A;  1GRE A;  1GTH A;  1Q9I A;  3AE1 A;  4TLZ A;  1XAN A;  3BHK A;  2YM2 A;  3AE2 A;  4D04 A;  2C76 A;  4A5L A;  2B7R A;  3P4P A;  1L9E A;  3ISH A;  3KD9 A;  3LB8 A;  2OLO A;  1GRG A;  2WPC A;  1LQT A;  3BI4 A;  4B66 A;  3GRT A;  1DNC A;  2XFO A;  1DJN A;  2R45 A;  2HQM A;  1ONF A;  3UOY A;  3NK0 X;  3VR9 A;  4B68 A;  2DKI A;  1DOC A;  1CF3 A;  2VVL G;  4JDR A;  1CJC A;  1QLB A;  3QFA A;  2AR8 A;  2A89 A;  1JRX A;  3F8P A;  4Z2U A;  4CBQ A;  3ATR A;  3UKH A;  4H4T A;  2V3A A;  3JSK A;  1O94 A;  2ZZ0 A;  2F5Z A;  2QCU A;  3UKQ A;  4EIQ A;  4U8L A;  4CCR A;  5IPY A;  2E5V A;  4J36 A;  2GMH A;  2YG7 A;  2W0H A;  1PBB A;  3HZL A;  4I58 A;  1KNP A;  1MOK A;  1H7W A;  3AE4 A;  3LXD A;  3AE8 A;  4Y4N A;  4GCM A;  4HB9 A;  3FIM B;  4IVM B;  3KLJ A;  5EB5 A;  4I59 A;  2R4E A;  3V3O A;  5KXJ A;  2C3C A;  2B76 A;  2B7S A;  4H4R A;  5CQF A;  2VQB A;  2YLW A;  3QFB A;  4TM4 A;  4ADW A;  1GT8 A;  1NHP A;  2BAB A;  2C7G A;  5JCI A;  3DJD A;  4YTN A;  3DH9 A;  2WPE A;  1D4C A;  3VR8 A;  4GF7 A;  3CN8 A;  2Y6R A;  1GRF A;  2GR2 A;  3AEE A;  4JY2 A;  1ZOV A;  1GV4 A;  1ZP0 A;  5M0Z A;  3EAO A;  2UZZ A;  5C3J A;  1PXA A;  1PXC A;  1B5Q A;  4Z2T A;  3RNM A;  2OAL A;  4H4S A;  1YQZ A;  1NHS A;  2BCP A;  1IUW A;  2JKC A;  3NTD A;  1B8S A;  4BV6 A;  2V3B A;  3AB1 A;  1JOA A;  3CGD A;  2R4J A;  3NNE A;  3CPI G;  3UTE A;  3T37 A;  2XLP A;  1KSS A;  2XLT A;  4P9S A;  1NEN A;  4PAB A;  4DNA A;  1JU2 A;  3UP4 A;  4MJW A;  4H4Q A;  2XVE A;  3PVC A;  3IC9 A;  2C65 A;  3ADA B;  3UOZ A;  2WEU A;  2BCG G;  2QA2 A;  3UOV A;  4ZN0 A;  2CFY A;  2EQ9 A;  2GAH B;  2C73 A;  4IV9 A;  2IVD A;  1S3B A;  2EQ7 A;  1VG0 A;  1K4Q A;  1LV0 A;  2XFP A;  4TM0 A;  1M64 A;  1Z6L A;  4GRT A;  1GXF A;  2ZZC A;  5BRT A;  3GWF A;  2JB1 A;  1E39 A;  3SFD A;  2Q6U A;  3UP5 A;  3ALJ A;  3GD4 A;  1OJD A;  1FL2 A;  4C77 A;  2YG3 A;  3GDP A;  3KA7 A;  1ZX9 A;  1GND A;  4JNQ A;  3Q6J A;  3UTH A;  4O5Q A;  2B9X A;  2BK3 A;  4U2L A;  2CDU A;  1CL0 A;  2WQY A;  2WP6 A;  1CJ3 A;  2XCG A;  3QVP A;  4A79 A;  4N9X A;  2DKH A;  4DSH A;  1BZL A;  1PXB A;  2BC1 A;  4WCT A;  4RSL A;  1PJ6 A;  1YY5 A;  4EMI A;  1AOG A;  3DK4 A;  3AEB A;  3BNU A;  5GSN A;  4H4Y A;  3GRS A;  3AEF A;  1K0I A;  3OC4 A;  3E1T A;  4EM3 A;  4HA6 A;  1PS9 A;  1NEK A;  1VG9 A;  4IVO B;  2YM1 A;  1E1N A;  2BS4 A;  3KU9 A;  2Q0K A;  4JY3 A;  4Z24 A;  1NHR A;  2YLR A;  3NHO X;  2BA9 A;  1JRZ A;  3C4N A;  1LPF A;  3CGB A;  3D8X A;  2XFU A;  3CGE A;  1IJH A;  2BXS A;  3NG7 X;  4U8P A;  1CJ4 A;  1H84 A;  5LV9 A;  1FCD A;  2YLT A;  4LU6 A;  1GRA A;  1ZMC A;  3BI2 A;  2XVI A;  4OVI A;  4OCG A;  4ECH A;  3K30 A;  3GWD A;  2I0Z A;  1P2H A;  3AWI A;  4TM1 A;  2YQU A;  3DA1 A;  1JNR A;  4YTM A;  3G5S A;  4EMW A;  5HHF A;  5ER0 A;  5L46 A;  5U1O A;  2WES A;  3K7M X;  4GUV A;  2GMJ A;  2EQ8 A;  5CKU A;  4B1B A;  4PAA A;  2JAE A;  4H4U A;  4A65 A;  3NT6 A;  4Z44 A;  1H7X A;  4J33 A;  4B67 A;  2RAB A;  3GMC A;  3I3L A;  4H2R A;  3NK2 X;  4U8I A;  3S5W A;  4IA6 A;  4J34 A;  1ZDL A;  3SQP A;  3RP7 A;  2GH5 A;  1W4X A;  3AE6 A;  1TDN A;  3M13 A;  4U8N A;  1XDI A;  4X4J A;  1IUT A;  4CNK A;  1Y0P A;  3ICS A;  5HYM A;  1H83 A;  2V5Z A;  4USQ A;  2O9Z A;  1RYI A;  5M10 A;  3FPZ A;  4YT0 A;  1NG4 A;  4J57 A;  3CNS A;  2R9Z A;  5TR3 A;  3V76 A;  4H4W A;  4YWO A;  2C64 A;  2ZBW A;  3DK8 A;  2R0G A;  2BC0 A;  3B3R A;  3NH3 X;  4IA5 A;  3RED A;  1EL5 A;  3CND A;  4RG3 A;  1L9C A;  3AE9 A;  3KVE A;  1YQ4 A;  1N4U A;  4NTD A;  1GER A;  1DOD A;  1PBE A;  2X3N A;  2OAM A;  3NKS A;  3PO7 A;  4BJZ A;  4C3X A;  4B63 A;  3CIR A;  4X9M A;  2VOU A;  4UDR A;  1KNR A;  1EL9 A;  3SFE A;  2AAQ A;  4CY8 A;  1GTE A;  5U25 A; 
#chains in the Genus database with same CATH topology
 1XHC A;  1IUX A;  1ELI A;  4DYE A;  3T31 A;  5FS6 A;  4NTC A;  3GMB A;  3S61 A;  1T3Q C;  3NS1 B;  2YG4 A;  1CHU A;  3NGC X;  4LA1 A;  4DGK A;  1RP0 A;  1TDF A;  4JNA A;  3B9J B;  1Y56 A;  2JB2 A;  4H2P A;  3GDN A;  2YVJ A;  3G5Q A;  2PP1 A;  7ENL A;  2GV8 A;  1XPY A;  4USR A;  2QJN A;  3UJF A;  5JRB A;  2XLU A;  1NDA A;  4GR1 A;  4HCH A;  1FOH A;  4JN9 A;  4ZA0 A;  3S47 A;  2ZAD A;  5G5H B;  2BAC A;  1CJ2 A;  2BK4 A;  4LII A;  2WU5 A;  5KVI A;  3I4K A;  2PP3 A;  3ETR B;  3SZW A;  1CBO A;  3DG7 A;  2Y6Q A;  2OO6 A;  3QSS A;  3TJ4 A;  3IJQ A;  4EIP A;  1LQU A;  1YKJ A;  1KKO A;  2XH2 A;  1TDO A;  1TYT A;  2OQY A;  3P1W A;  3ZYX A;  4Z25 A;  3D46 A;  3C96 A;  3BJS A;  5IDZ A;  3LZW A;  1KCZ A;  4FP1 A;  3SZF A;  1S3E A;  3GD3 A;  4GAP A;  1FHU A;  2WOI A;  5J7X A;  1CC6 A;  4K8D A;  4DXK A;  4BK2 A;  4EQW A;  3IJI A;  1N60 C;  2PMQ A;  3V5F A;  2E5A A;  3FBS A;  1MO9 A;  2IID A;  3CGC A;  3GYI A;  4XWZ A;  4UDP A;  1BGN A;  1OJT A;  1DTN A;  2ARD A;  1IUU A;  4GYP A;  3QJ4 A;  3K7T A;  1PJ5 A;  3H7V A;  1F8R A;  3FV9 A;  4OPD A;  3MQT A;  5KWF A;  2BS3 A;  4NNJ A;  1B37 A;  2XH4 A;  5HY5 A;  1BKW A;  4K5S A;  3DJG X;  1N4W A;  3HPF A;  3SXI A;  3UJR A;  1N5X A;  4CNJ A;  3ZLH A;  2E3T A;  5FMH A;  3VRB A;  2A8X A;  2WU2 A;  4J56 A;  2VRM A;  1E1M A;  3LAD A;  2H89 A;  3NVZ B;  3H12 A;  3CXB A;  1CC4 A;  4FK1 A;  3BOX A;  1STZ A;  2YG5 A;  4DWD A;  3CAW A;  2GRT A;  4Z43 A;  2X8G A;  2V60 A;  4A6G A;  3TJI A;  3HYX A;  3NTA A;  2MNR A;  2PYX A;  1KKR A;  3N6H A;  1R0M A;  4K7Z A;  2RDX A;  4YKG A;  3D47 A;  2VQ7 A;  1KDG A;  4WX1 A;  1N4V A;  1TYP A;  4C5O A;  2GDQ A;  4J31 A;  1Q1W A;  3NN0 X;  3H4K A;  4OPI A;  2XDO A;  1Y56 B;  1UKV G;  4Z2R A;  1IUS A;  1F8W A;  2YLX A;  2DW7 A;  3IF9 A;  4FX9 A;  3SSZ A;  1SJC A;  2J3N A;  3ICT A;  4H2H A;  4C74 A;  1M6I A;  2YWL A;  1GES A;  3CPH G;  1X31 B;  2XYO A;  3ZVH A;  4E4F A;  1F9C A;  3AE2 A;  2HXT A;  3RCY A;  1L8P A;  3KD9 A;  2OLO A;  4B66 A;  3GRT A;  3UOY A;  3NK0 X;  1DOC A;  3GYX A;  1CF3 A;  4JDR A;  1QLB A;  3KPK A;  3QFA A;  3P0W A;  2I5Q A;  2QCU A;  4MGG A;  2GMH A;  3ZLF A;  2W0H A;  1PBB A;  1WYG A;  4HNL A;  3AE4 A;  3LXD A;  3AE8 A;  4Y4N A;  2QJJ A;  4M6U A;  3AM9 A;  3V3O A;  5KXJ A;  3QFB A;  3SN4 A;  1YEY A;  1NHP A;  2BAB A;  2C7G A;  3DJD A;  4GF7 A;  3CN8 A;  3AEE A;  5M0Z A;  1PXA A;  4Z2T A;  3OZY A;  3RNM A;  1IUW A;  3RRA A;  3UTE A;  1XS2 A;  3ES7 A;  4DNA A;  4H4Q A;  2XVE A;  3UOZ A;  4GME A;  3K1G A;  3STP A;  1OEP A;  4FI4 A;  3UOV A;  2C73 A;  1MUC A;  1VG0 A;  3CXO A;  2XFP A;  2ZZC A;  5BRT A;  1FL2 A;  3KA7 A;  5J04 A;  4JNQ A;  2B9X A;  4U2L A;  1PXB A;  2BC1 A;  1PJ6 A;  3DG3 A;  3UJ2 A;  3KU9 A;  1NHR A;  2YLR A;  4H83 A;  3NHO X;  3THU A;  2PCE A;  2XFU A;  3CGE A;  3SN0 A;  1FIQ B;  1GRA A;  1ZMC A;  4DN1 A;  4ECH A;  3K30 A;  3A7U A;  2I0Z A;  4A65 A;  3PWI A;  4Z44 A;  1H7X A;  3RIT A;  3GMC A;  4IA6 A;  1SB3 B;  3SQP A;  3M13 A;  3L5O A;  4ZOH B;  4X4J A;  1IUT A;  2V5Z A;  4USQ A;  1NG4 A;  4J57 A;  5TR3 A;  4H4W A;  1ONE A;  2ZBW A;  3MZN A;  2HXU A;  3AE9 A;  2PP0 A;  3KVE A;  1YQ4 A;  1N4U A;  4BJZ A;  4C3X A;  3PO7 A;  4B63 A;  4DHG A;  2VOU A;  1KNR A;  1EL9 A;  4CY8 A;  5U25 A;  4TVY A;  2QDE A;  2WOW A;  3SGL A;  3UXL A;  2X99 A;  3M0O A;  6ENL A;  4H2Q A;  5J60 A;  4UDQ A;  4E0V A;  1LVL A;  4BK1 A;  1E7P A;  2XFN A;  2ZC8 A;  3LJP A;  2XH7 A;  3NN6 X;  2WDQ A;  3ITJ A;  3L8K A;  3SM8 A;  3JVA A;  4A6N A;  5KMQ A;  3QLD A;  2OKT A;  1R6W A;  3EF6 A;  2GR1 A;  1P43 A;  3VRD B;  1EC8 A;  5G5G B;  2QA1 A;  4GYP C;  3DGB A;  5FS9 A;  2WDV A;  4NEW A;  2V61 A;  1ZXI C;  3H8I A;  4EQR A;  2W54 A;  2FYM A;  2XVH A;  2OA1 A;  3O0H A;  1YQ3 A;  1N63 C;  4XWR A;  4AP3 A;  2WDR A;  2X50 A;  2HZG A;  1NPX A;  2FJE A;  2P8C A;  3H8L A;  4B65 A;  4TVW A;  4REK A;  5IQ1 A;  1P2E A;  3FCP A;  3CTY A;  5KNL A;  3AE7 A;  3NIX A;  4ZCC A;  5BUL A;  5KMS A;  3ZVI A;  4IL0 A;  3AD9 B;  4J3Z A;  3AEG A;  4IHC A;  4Y4L A;  2WBA A;  3SZ0 A;  3CK5 A;  4FK1 C;  1NHQ A;  3QSE A;  2QDD A;  2RGO A;  2WP9 A;  2QAE A;  1GPE A;  3Q9T A;  4EM4 A;  5FJO A;  1KFY A;  4Z1Y A;  2BYB A;  3AYL A;  3T2K A;  3KUM A;  4KT2 A;  1V97 A;  3SZC A;  3FVD A;  3K7Q X;  1GEU A;  3DFH A;  4IP4 A;  1ECQ A;  2C66 A;  1BKH A;  2V6O A;  2OZ3 A;  2BRY A;  3UTG A;  3T2Z A;  1W6T A;  2XVF A;  3IHM A;  2XH0 A;  2GSH A;  3ABV A;  3VQR A;  3CNT A;  3DME A;  3T9P A;  2OZT A;  2XSX A;  2W3R A;  3UCD A;  4YWS A;  4E5T A;  3SR6 B;  2BRA A;  4H50 A;  4HNC A;  2R46 A;  4AP1 A;  2C67 A;  3UKF A;  1PDZ A;  3RHA A;  1DOE A;  1FHV A;  3T14 A;  2QJM A;  3R25 A;  4ROP A;  3U4F A;  3NVY B;  3OP2 A;  3NVV B;  4ZCD A;  2EQ6 A;  2GQW A;  3OW1 A;  3VFC A;  4BUR A;  1H2I A;  3NVW B;  2TMD A;  2BS2 A;  4CRT A;  1SEZ A;  4KPR A;  4FDC B;  4EQX A;  3T2Y A;  3PS9 A;  5KVH A;  2PTW A;  2BXR A;  2AKM A;  2PGW A;  2GQF A;  3D9X A;  2GVC A;  4Y4M A;  3NYC A;  4JN8 A;  3M12 A;  1OJA A;  3UKK A;  1N1P A;  3GY1 A;  2E4G A;  3BI5 A;  2GEW A;  2VVL A;  1VRQ B;  5EOW A;  2OVL A;  3MSY A;  1LTX R;  3AN1 A;  1P48 A;  5KOW A;  4BJY A;  4A6N B;  2XLR A;  3II4 A;  1MXT A;  2B9Y A;  2R0P A;  1V59 A;  5GRT A;  3FYY A;  4AT0 A;  3AE1 A;  4TLZ A;  4D04 A;  2B7R A;  1L9E A;  3ISH A;  1LQT A;  1DNC A;  1DJN A;  2R45 A;  1ONF A;  3VR9 A;  2DKI A;  2VVL G;  1CJC A;  2AR8 A;  2A89 A;  1JRX A;  3ATR A;  4H4T A;  2F5Z A;  4CCR A;  4J36 A;  2YG7 A;  1KNP A;  1MOK A;  5EB5 A;  2C3C A;  2B76 A;  2B7S A;  4H4R A;  2OFJ A;  1VDV A;  5JCI A;  1D4C A;  3PWG A;  1ZOV A;  1ZP0 A;  2UZZ A;  2OAL A;  2V3B A;  1TZZ A;  3QPE A;  1EC9 A;  3NNE A;  1NEN A;  5FJU A;  3IC9 A;  2C65 A;  3ADA B;  2OLA A;  3CT2 A;  4DX3 A;  2CFY A;  4IV9 A;  2EQ7 A;  4M0X A;  1M64 A;  4GRT A;  2JB1 A;  1NEL A;  1E39 A;  4E8G A;  2AL1 A;  3NZG A;  4C77 A;  2CDU A;  1CL0 A;  3OTR A;  1CJ3 A;  2XCG A;  1BZL A;  4EMI A;  3I6E A;  3RR1 A;  4GIS A;  3OPS A;  3GRS A;  3TQP A;  3E1T A;  4IVO B;  2Q0K A;  2BA9 A;  1JRZ A;  3D8X A;  2P8B A;  5LV9 A;  2YLT A;  4LU6 A;  1TE6 A;  2XVI A;  4OVI A;  4OCG A;  2FKP A;  3GWD A;  3GD6 A;  3AWI A;  1JNR A;  3DDM A;  3G5S A;  5HHF A;  5ER0 A;  5CKU A;  2JAE A;  4H4U A;  3EKG A;  3S5W A;  5KMR A;  4E6M A;  3RP7 A;  4HCL A;  1TDN A;  3OZM A;  3S5S A;  2O9Z A;  1RYI A;  3FPZ A;  2PTX A;  3CNS A;  2R9Z A;  3NH3 X;  2R0G A;  3RED A;  2POD A;  4NTD A;  4HCD A;  1GER A;  2X3N A;  2OAM A;  3HYW A;  3CIR A;  3SFE A;  2C72 A;  3FMW A;  1WUF A;  1EBD A;  2E1M A;  2JBV A;  4H4V A;  3DIP A;  1NG3 A;  2IVE A;  2GGE A;  2P0I A;  1PBF A;  1MRA A;  3VRA A;  1KD0 A;  4CCQ A;  3C4A A;  1SJA A;  3QVR A;  3VA8 A;  4YKF A;  5EBK A;  4D03 A;  4K8G A;  3IJL A;  2FJB A;  5JCN A;  4KX6 A;  2AQJ A;  1PBC A;  1TRB A;  3OZ2 A;  2FJA A;  1E1K A;  4G9K A;  4OPL A;  1REO A;  1HYU A;  3BHF A;  3DFY A;  1B4V A;  3I6T A;  3N4E A;  3T0K A;  2W55 A;  2MUC A;  4DSG A;  2JK6 A;  1D4D A;  2BK5 A;  3A7A A;  1S2Q A;  1JRO A;  1OJC A;  3F8R A;  2VZ2 A;  3R07 C;  4TM3 A;  4B69 A;  1E6E A;  1TKK A;  3GYJ A;  3D1C A;  4JN7 A;  1Q1R A;  2GGI A;  2NVK X;  2VVM A;  1GRH A;  2PHH A;  3DGZ A;  3T4W A;  3CNP A;  3R9U A;  1FFU C;  4GGH A;  5JCL A;  1L9D A;  4O5U A;  4A7A A;  3URH A;  2B9W A;  3DJJ A;  4YSY A;  3RP8 A;  1CC2 A;  2QQ6 A;  3R0U A;  1ZOY A;  4Z26 A;  5KOX A;  1ZKQ A;  2FBW A;  1F6M A;  3NRN A;  3AED A;  1GRB A;  4YTP A;  3CPJ G;  4OPC A;  4X2P A;  3JZU A;  3SQS A;  1FEA A;  3UKP A;  1N5W C;  4APN A;  4NZH A;  2APG A;  3BNM A;  3IHG A;  3NFU A;  3AE3 A;  5BOE A;  2AL2 A;  2OLN A;  1PHH A;  2GR3 A;  4M52 A;  3B6D A;  2NPX A;  2X8H A;  3T6C A;  2POZ A;  4B64 A;  1EL8 A;  5JCM A;  2YG6 A;  3VC6 A;  4GDP A;  1O5W A;  1E9I A;  1DXL A;  4JHM A;  1COY A;  3SJN A;  3ZVH B;  1GSN A;  1QO8 A;  2XGZ A;  2XFQ A;  2XVJ A;  1GRT A;  5EB4 A;  2ACZ A;  3UCL A;  3DGH A;  5BOF A;  4YSX A;  3H70 A;  3P3B A;  1BGJ A;  4U8J A;  1NU5 A;  2TPR A;  3R10 A;  4AOX A;  3CNJ A;  2OPJ A;  1ZMD A;  2PSN A;  2GF3 A;  2WOV A;  2H88 A;  1WUE A;  2GL5 A;  3GSI A;  3NYE A;  3PFR A;  3JW7 A;  2YR5 A;  2YR6 A;  4BK3 A;  4OPU A;  2PU1 A;  1D7Y A;  1EBG A;  2WS3 A;  4G73 A;  4J2W A;  4GFI A;  2YAU A;  5FJT A;  1PDH A;  3ENL A;  3ES8 A;  1H6V A;  4ICY A;  3AD7 B;  1IUV A;  4H4Z A;  4U8O A;  4H2N A;  2YLZ A;  4H4X A;  2XLS A;  1VDC A;  1X2G A;  4KPL A;  4II3 A;  3SYI A;  3F8D A;  2GGJ A;  4NTE A;  2Q0L A;  1PJ7 A;  3NXL A;  3MWC A;  4A35 A;  4GDE A;  1D4E A;  1GTH A;  3VCN A;  3BHK A;  3Q45 A;  4H19 A;  3VC5 A;  2C76 A;  3LB8 A;  1GRG A;  2PU0 A;  4F4R A;  2XFO A;  3NRZ B;  4CBQ A;  3UKH A;  2V3A A;  3JSK A;  1O94 A;  2ZZ0 A;  3UKQ A;  1N61 C;  4EIQ A;  4U8L A;  5IPY A;  1N62 C;  2HNE A;  3HZL A;  4I58 A;  1H7W A;  3Q4D A;  4GCM A;  4IVM B;  3KLJ A;  4IP5 A;  4I59 A;  1S7M A;  5CQF A;  2YLW A;  4YTN A;  3VR8 A;  2Y6R A;  1GRF A;  3EAO A;  3N4F A;  1B5Q A;  2NQL A;  5FJP A;  1YQZ A;  2JKC A;  1B8S A;  4BV6 A;  3UXK A;  3AB1 A;  2QVH A;  2PTZ A;  2R4J A;  4MMW A;  3HYV A;  4G74 A;  1KSS A;  2XLT A;  4PAB A;  3PVC A;  2WEU A;  2QA2 A;  1JPD X;  4ZN0 A;  2GAH B;  2EQ9 A;  2IVD A;  1K4Q A;  3MUC A;  4TM0 A;  1Z6L A;  3GWF A;  3SFD A;  3UP5 A;  3UJS A;  3ALJ A;  3GD4 A;  1FFV C;  3CYJ A;  2YG3 A;  3GDP A;  1ZX9 A;  3SY4 A;  2WQY A;  2WP6 A;  3QVP A;  4N9X A;  1JCT A;  2AL2 B;  2DW6 A;  4RSL A;  1AOG A;  3DK4 A;  4NWZ A;  5GSN A;  3AEF A;  1K0I A;  1FO4 A;  4EM3 A;  2OG9 A;  1PS9 A;  1VG9 A;  2YM1 A;  1E1N A;  4JY3 A;  3C4N A;  1LPF A;  2BXS A;  1IJH A;  3NG7 X;  3VCC A;  1CJ4 A;  1H84 A;  2YQU A;  3DA1 A;  4MKS A;  4YTM A;  2OX4 A;  4EMW A;  5L46 A;  5U1O A;  4GUV A;  2GMJ A;  2EQ8 A;  1RVK A;  4B67 A;  4GGB A;  4H2R A;  4U8I A;  2GH5 A;  3AE6 A;  3UGV A;  2P88 A;  4A3R A;  5HYM A;  4CNK A;  1Y0P A;  3ICS A;  1SJB A;  4YT0 A;  3V76 A;  4YWO A;  2C64 A;  3DK8 A;  3B3R A;  1EL5 A;  3EUB 3;  3CND A;  1PBE A;  3NKS A;  3NO1 A;  3H8A A;  4EWJ A;  2AAQ A;  1GTE A;  2Q7V A;  1GET A;  3P4Q A;  3AE5 A;  1PBD A;  1SJD A;  1L0V A;  3IWA A;  3VDG A;  3AYI A;  1X2H A;  2Z5Y A;  4U2T A;  4OPG A;  5BUK A;  4EQS A;  3NK1 X;  4Z17 A;  1K0L A;  3ALL A;  4OPT A;  1F3P A;  1K0J A;  1O95 A;  5KRQ A;  3QN3 A;  2P3Z A;  3SBF A;  5C2T A;  1BF3 A;  4YSH A;  2A87 A;  3AD8 B;  1NAA A;  2GR0 A;  1D5T A;  1PN0 A;  3LZX A;  3EEZ A;  1LJ1 A;  3RP6 A;  4A99 A;  2ZZB A;  2Z5X A;  1XPQ A;  4A9W A;  5FS8 A;  3ZDN A;  3QKE A;  5JCK A;  3UOX A;  3U9I A;  3UCC A;  1BWC A;  3MY9 A;  1OJ9 A;  5BVA A;  2YR4 A;  1S2Y A;  3CMM A;  3HRD C;  5EU9 A;  2PS2 A;  2RGJ A;  4HPN A;  4EMJ A;  2RGH A;  1H86 A;  1DJQ A;  4AT2 A;  4H1Z A;  2JB3 A;  4YXD A;  2GGG A;  3QTP A;  2PTY A;  3DG6 A;  1FEB A;  2YLS A;  1EC7 A;  4TLX A;  4C3Y A;  1H82 A;  2GB0 A;  1H81 A;  1BQG A;  5IQ4 A;  1ELS A;  4H7U A;  4GAV A;  2R0C A;  4E4U A;  3TWA A;  1QJD A;  4K1W A;  3UKL A;  3P4R A;  3DK9 A;  1RM6 B;  4K2X A;  3ICR A;  1KSU A;  1TDE A;  3WE0 A;  2QGY A;  2WHD A;  3DEQ A;  3SX6 A;  3COX A;  2CVJ A;  3AEC A;  4H4P A;  4G8T A;  3L1R A;  1FEC A;  2PPG A;  4KEM A;  4K5R A;  1GAL A;  1ZY8 A;  3IK4 A;  3G5R A;  4U8M A;  2CUL A;  5DBJ A;  5FS7 A;  3EAN A;  3R11 A;  3LOV A;  3GC2 A;  4ENL A;  3P4S A;  3R0K A;  3NLC A;  3QSM A;  4CY6 A;  3DES A;  2GAG B;  1JEH A;  3ATQ A;  1E1L A;  2VRL A;  4G6H A;  1JNZ A;  2C75 A;  3AYJ A;  3P9U A;  3MKC A;  3P93 A;  3UJE A;  4U2S A;  2WP5 A;  3RO6 A;  1TDK A;  3I6D A;  1D7L A;  4YSZ A;  3FJ4 A;  3V3N A;  2W3S A;  3HW2 A;  3DJE A;  4NEV A;  4RG4 A;  3ALM A;  3UTF A;  3BSM A;  2YVF A;  4UP3 A;  4ZCW A;  4HN8 A;  1EL7 A;  3AXB A;  2OZ8 A;  5HXI A;  1DOB A;  1KF6 A;  4K22 A;  4JQ9 A;  3NYF A;  3AEA A;  2YVG A;  3KKJ A;  3AMZ A;  2FJD A;  1ZK7 A;  4U8K A;  4AOS A;  3CB3 A;  2PGE A;  3T8Q A;  1GOS A;  2X8C A;  4K2S A;  1JRY A;  3TOY A;  2WET A;  5U63 A;  3EPT A;  1KN0 A;  1VQW A;  2C70 A;  2C3D A;  3FG2 P;  1RSG A;  3UKA A;  3ZLG A;  1F8S A;  3KPF A;  4KWS A;  1MDR A;  4XXG A;  2WPF A;  4X9N A;  1GRE A;  1Q9I A;  1XAN A;  2YM2 A;  2PA6 A;  4A5L A;  3P4P A;  1PDY A;  2WPC A;  3V5C A;  3BI4 A;  4GIR A;  2HQM A;  4B68 A;  1JPM A;  3FXG A;  3F8P A;  4Z2U A;  3TW9 A;  1MDL A;  2E5V A;  3GO2 A;  3PK7 A;  4HB9 A;  3FIM B;  2R4E A;  2VQB A;  4TM4 A;  4ADW A;  1GT8 A;  3DH9 A;  2WPE A;  3TCS A;  3V4B A;  2ONE A;  4HYR A;  2GR2 A;  4JY2 A;  1GV4 A;  5C3J A;  4IL2 A;  1PXC A;  2O56 A;  2C4C A;  4H4S A;  1NHS A;  2BCP A;  3V3W A;  3TTE A;  3NTD A;  2CHR A;  1JOA A;  3CGD A;  3CPI G;  3T37 A;  2XLP A;  4P9S A;  1JU2 A;  3UP4 A;  4MJW A;  4II2 A;  3RGT A;  2BCG G;  1JDF A;  1S3B A;  3A7R A;  1LV0 A;  1JRP A;  4G6G A;  1GXF A;  2AKZ A;  4IT1 A;  2Q6U A;  1OJD A;  1GND A;  3Q6J A;  3UTH A;  4O5Q A;  2BK3 A;  5FJR A;  4A79 A;  3SN1 A;  2DKH A;  1VQZ A;  3TWB A;  4DSH A;  4WCT A;  1YY5 A;  3AEB A;  3BNU A;  4H4Y A;  3OC4 A;  3DER A;  4HA6 A;  1NEK A;  2BS4 A;  4Z24 A;  3CGB A;  2GGH A;  4U8P A;  3B97 A;  1FCD A;  3BI2 A;  4J1O A;  5ENL A;  1P2H A;  4TM1 A;  2WES A;  3K7M X;  4B1B A;  1EBH A;  4PAA A;  3NT6 A;  4J33 A;  2RAB A;  3I3L A;  3R1Z A;  3NK2 X;  4J34 A;  1ZDL A;  1W4X A;  4G7F A;  4U8N A;  5KMP A;  1MNS A;  1XDI A;  1H83 A;  5M10 A;  3PG6 A;  4IZG A;  4IA5 A;  2BC0 A;  4RG3 A;  1L9C A;  1IYX A;  1DOD A;  4X9M A;  4UDR A;  2OQH A;  3N6J A; 
#chains in the Genus database with same CATH homology
 1XHC A;  2Q7V A;  1IUX A;  1GET A;  1ELI A;  2C72 A;  3FMW A;  3P4Q A;  3T31 A;  1EBD A;  5FS6 A;  2E1M A;  2WOW A;  2JBV A;  4NTC A;  4H4V A;  3AE5 A;  3GMB A;  3SGL A;  1PBD A;  2X99 A;  3S61 A;  1NG3 A;  3M0O A;  2IVE A;  1L0V A;  3IWA A;  4H2Q A;  2YG4 A;  1CHU A;  3NGC X;  4LA1 A;  4DGK A;  5J60 A;  4UDQ A;  1PBF A;  4E0V A;  3VRA A;  1RP0 A;  1TDF A;  4JNA A;  3AYI A;  4CCQ A;  3C4A A;  3QVR A;  2Z5Y A;  1LVL A;  4U2T A;  1Y56 A;  4BK1 A;  4YKF A;  2JB2 A;  1E7P A;  2XFN A;  4H2P A;  4OPG A;  5BUK A;  3GDN A;  2YVJ A;  5EBK A;  3G5Q A;  4EQS A;  3NK1 X;  3LJP A;  1K0L A;  3ALL A;  4OPT A;  4D03 A;  1F3P A;  3NN6 X;  1K0J A;  2GV8 A;  2WDQ A;  1O95 A;  2FJB A;  5KRQ A;  5JCN A;  4USR A;  5C2T A;  4KX6 A;  2AQJ A;  1BF3 A;  3ITJ A;  4YSH A;  1PBC A;  1TRB A;  3L8K A;  2A87 A;  3OZ2 A;  5JRB A;  3AD8 B;  3SM8 A;  4A6N A;  2FJA A;  5KMQ A;  2XLU A;  1E1K A;  4G9K A;  1NAA A;  2GR0 A;  4OPL A;  1NDA A;  4GR1 A;  1D5T A;  1FOH A;  4JN9 A;  1REO A;  1PN0 A;  1HYU A;  3EF6 A;  3LZX A;  2GR1 A;  3BHF A;  1LJ1 A;  3RP6 A;  3VRD B;  1B4V A;  4A99 A;  2ZZB A;  2Z5X A;  2QA1 A;  1XPQ A;  3T0K A;  5FS9 A;  2WDV A;  4NEW A;  2V61 A;  4DSG A;  2JK6 A;  1D4D A;  4A9W A;  2BK5 A;  5FS8 A;  3ZDN A;  1S2Q A;  2BAC A;  1CJ2 A;  2BK4 A;  5JCK A;  3UOX A;  4LII A;  2WU5 A;  3H8I A;  4EQR A;  5KVI A;  1OJC A;  3F8R A;  2XVH A;  1BWC A;  2VZ2 A;  3SZW A;  1OJ9 A;  2OA1 A;  4TM3 A;  3O0H A;  4B69 A;  5BVA A;  1CBO A;  1E6E A;  2YR4 A;  1S2Y A;  1YQ3 A;  2Y6Q A;  4XWR A;  4AP3 A;  3CMM A;  2WDR A;  3GYJ A;  3QSS A;  2X50 A;  3D1C A;  1Q1R A;  4EIP A;  2RGJ A;  2NVK X;  2VVM A;  1GRH A;  1NPX A;  2PHH A;  3DGZ A;  2FJE A;  1LQU A;  4EMJ A;  1YKJ A;  3H8L A;  4B65 A;  2RGH A;  3CNP A;  1TDO A;  1H86 A;  4REK A;  5IQ1 A;  1DJQ A;  3R9U A;  1TYT A;  4AT2 A;  1P2E A;  2JB3 A;  3P1W A;  3CTY A;  4YXD A;  3ZYX A;  3AE7 A;  4Z25 A;  3NIX A;  5KNL A;  5JCL A;  3C96 A;  1FEB A;  1L9D A;  2YLS A;  4O5U A;  4A7A A;  4ZCC A;  5BUL A;  3URH A;  2B9W A;  5KMS A;  4TLX A;  3LZW A;  4C3Y A;  1H82 A;  2GB0 A;  3DJJ A;  3AD9 B;  3SZF A;  4YSY A;  3RP8 A;  1H81 A;  1S3E A;  3AEG A;  1CC2 A;  5IQ4 A;  4Y4L A;  2WBA A;  3GD3 A;  4H7U A;  3SZ0 A;  4GAV A;  2R0C A;  1QJD A;  1ZOY A;  4FK1 C;  1NHQ A;  2WOI A;  3QSE A;  4GAP A;  5J7X A;  3UKL A;  4Z26 A;  3P4R A;  1CC6 A;  3DK9 A;  4K8D A;  5KOX A;  1ZKQ A;  2FBW A;  4BK2 A;  4EQW A;  2RGO A;  4K2X A;  2WP9 A;  2QAE A;  1GPE A;  3ICR A;  1KSU A;  3Q9T A;  4EM4 A;  1F6M A;  1TDE A;  3NRN A;  3FBS A;  3WE0 A;  1MO9 A;  2IID A;  2WHD A;  3CGC A;  3SX6 A;  3COX A;  3GYI A;  4XWZ A;  4UDP A;  3AED A;  1BGN A;  2CVJ A;  1KFY A;  3AEC A;  4H4P A;  1OJT A;  3L1R A;  1FEC A;  1GRB A;  2ARD A;  4YTP A;  1IUU A;  2BYB A;  3CPJ G;  4K5R A;  4OPC A;  3QJ4 A;  1GAL A;  3AYL A;  3K7T A;  1PJ5 A;  1ZY8 A;  1FEA A;  3G5R A;  3T2K A;  1F8R A;  4U8M A;  2CUL A;  5DBJ A;  5FS7 A;  4OPD A;  3UKP A;  3EAN A;  4APN A;  4NZH A;  5KWF A;  2BS3 A;  3SZC A;  2APG A;  3LOV A;  3BNM A;  3IHG A;  4NNJ A;  3K7Q X;  1GEU A;  1B37 A;  3P4S A;  3NLC A;  3QSM A;  4CY6 A;  3AE3 A;  2C66 A;  5HY5 A;  2GAG B;  1JEH A;  2OLN A;  2V6O A;  1BKW A;  2BRY A;  3UTG A;  3ATQ A;  1E1L A;  2VRL A;  3T2Z A;  4G6H A;  1JNZ A;  1PHH A;  2C75 A;  4K5S A;  2XVF A;  3IHM A;  2GR3 A;  4M52 A;  3DJG X;  1N4W A;  3B6D A;  3ABV A;  3VQR A;  2NPX A;  3AYJ A;  3CNT A;  3DME A;  2X8H A;  3P9U A;  4B64 A;  1EL8 A;  5JCM A;  2YG6 A;  3SXI A;  2BRA A;  4U2S A;  4CNJ A;  2WP5 A;  4H50 A;  2R46 A;  1TDK A;  4AP1 A;  4GDP A;  3I6D A;  2C67 A;  3UKF A;  1O5W A;  3RHA A;  5FMH A;  3VRB A;  1D7L A;  1DOE A;  2A8X A;  4YSZ A;  1DXL A;  1COY A;  1GSN A;  3T14 A;  1QO8 A;  2WU2 A;  3V3N A;  2XFQ A;  4J56 A;  2XVJ A;  2VRM A;  1GRT A;  1E1M A;  5EB4 A;  2ACZ A;  3LAD A;  2H89 A;  3UCL A;  3DGH A;  4YSX A;  3DJE A;  4NEV A;  1CC4 A;  1BGJ A;  4RG4 A;  4FK1 A;  4U8J A;  3ALM A;  4ZCD A;  3UTF A;  2EQ6 A;  2GQW A;  4BUR A;  1H2I A;  2TPR A;  2TMD A;  2BS2 A;  2YG5 A;  4AOX A;  2YVF A;  3CNJ A;  4CRT A;  1SEZ A;  4UP3 A;  2GRT A;  4Z43 A;  2X8G A;  2V60 A;  4KPR A;  4FDC B;  4EQX A;  1EL7 A;  1ZMD A;  3T2Y A;  3AXB A;  2GF3 A;  3PS9 A;  2WOV A;  5HXI A;  5KVH A;  2H88 A;  2BXR A;  3HYX A;  3NTA A;  1DOB A;  1KF6 A;  2GQF A;  4K22 A;  3D9X A;  2GVC A;  2PYX A;  4JQ9 A;  4Y4M A;  3NYC A;  3GSI A;  3NYF A;  3AEA A;  3M12 A;  3NYE A;  1OJA A;  4K7Z A;  2YVG A;  3UKK A;  3KKJ A;  4YKG A;  1N1P A;  2YR5 A;  2YR6 A;  2VQ7 A;  1KDG A;  2E4G A;  4BK3 A;  2FJD A;  3BI5 A;  4OPU A;  4WX1 A;  1N4V A;  1D7Y A;  1TYP A;  2GEW A;  2VVL A;  4C5O A;  1ZK7 A;  4J31 A;  4U8K A;  4AOS A;  2WS3 A;  4G73 A;  1Q1W A;  3NN0 X;  1VRQ B;  3H4K A;  4J2W A;  5EOW A;  4OPI A;  2XDO A;  1LTX R;  1Y56 B;  2YAU A;  1UKV G;  4Z2R A;  1IUS A;  1F8W A;  1GOS A;  2X8C A;  1PDH A;  1JRY A;  2YLX A;  1H6V A;  4ICY A;  3AD7 B;  1IUV A;  3IF9 A;  4H4Z A;  2WET A;  4U8O A;  4H2N A;  2YLZ A;  4FX9 A;  4H4X A;  5U63 A;  2XLS A;  1VDC A;  1KN0 A;  1VQW A;  2C70 A;  3EPT A;  5KOW A;  2J3N A;  2C3D A;  4BJY A;  3FG2 P;  4A6N B;  3ICT A;  2XLR A;  3II4 A;  1RSG A;  1M6I A;  3UKA A;  1MXT A;  4C74 A;  2B9Y A;  2YWL A;  4II3 A;  1GES A;  3SYI A;  3F8D A;  2R0P A;  1V59 A;  4NTE A;  3CPH G;  5GRT A;  1F8S A;  1X31 B;  2Q0L A;  2XYO A;  3KPF A;  4AT0 A;  1PJ7 A;  4XXG A;  4GDE A;  1D4E A;  2WPF A;  4X9N A;  1GRE A;  1GTH A;  1Q9I A;  3AE1 A;  4TLZ A;  1XAN A;  3BHK A;  2YM2 A;  3AE2 A;  4D04 A;  2C76 A;  4A5L A;  2B7R A;  3P4P A;  1L9E A;  3ISH A;  3KD9 A;  3LB8 A;  2OLO A;  1GRG A;  2WPC A;  1LQT A;  3BI4 A;  4B66 A;  3GRT A;  1DNC A;  2XFO A;  1DJN A;  2R45 A;  2HQM A;  1ONF A;  3UOY A;  3NK0 X;  3VR9 A;  4B68 A;  2DKI A;  1DOC A;  3GYX A;  1CF3 A;  2VVL G;  4JDR A;  1CJC A;  1QLB A;  3QFA A;  2AR8 A;  3KPK A;  2A89 A;  1JRX A;  3F8P A;  4Z2U A;  4CBQ A;  3ATR A;  3UKH A;  4H4T A;  2V3A A;  3JSK A;  1O94 A;  2ZZ0 A;  2F5Z A;  2QCU A;  3UKQ A;  4EIQ A;  4U8L A;  4CCR A;  5IPY A;  2E5V A;  4J36 A;  2GMH A;  2YG7 A;  2W0H A;  1PBB A;  3HZL A;  4I58 A;  1KNP A;  1MOK A;  1H7W A;  3AE4 A;  3LXD A;  3AE8 A;  4Y4N A;  4GCM A;  4HB9 A;  3FIM B;  4IVM B;  3KLJ A;  5EB5 A;  4I59 A;  2R4E A;  3V3O A;  1S7M A;  5KXJ A;  2C3C A;  2B76 A;  2B7S A;  4H4R A;  5CQF A;  2VQB A;  2YLW A;  3QFB A;  4TM4 A;  4ADW A;  1GT8 A;  1NHP A;  2BAB A;  2C7G A;  5JCI A;  3DJD A;  4YTN A;  3DH9 A;  2WPE A;  1D4C A;  3VR8 A;  4GF7 A;  3CN8 A;  2Y6R A;  1GRF A;  2GR2 A;  3AEE A;  4JY2 A;  1ZOV A;  1GV4 A;  1ZP0 A;  5M0Z A;  3EAO A;  2UZZ A;  5C3J A;  1PXA A;  1PXC A;  1B5Q A;  4Z2T A;  3RNM A;  2C4C A;  4H4S A;  2OAL A;  1YQZ A;  1NHS A;  2BCP A;  1IUW A;  2JKC A;  3NTD A;  1B8S A;  4BV6 A;  2V3B A;  3AB1 A;  1JOA A;  3CGD A;  2R4J A;  3NNE A;  3CPI G;  3HYV A;  4G74 A;  3UTE A;  3T37 A;  2XLP A;  1KSS A;  2XLT A;  4P9S A;  1NEN A;  4PAB A;  4DNA A;  1JU2 A;  3UP4 A;  4MJW A;  4H4Q A;  2XVE A;  3PVC A;  3IC9 A;  2C65 A;  3ADA B;  4II2 A;  2WEU A;  3UOZ A;  2BCG G;  2QA2 A;  3UOV A;  4ZN0 A;  2CFY A;  2EQ9 A;  2GAH B;  2C73 A;  4IV9 A;  2IVD A;  1S3B A;  2EQ7 A;  1VG0 A;  1K4Q A;  1LV0 A;  2XFP A;  4TM0 A;  1M64 A;  1Z6L A;  4G6G A;  4GRT A;  1GXF A;  2ZZC A;  5BRT A;  3GWF A;  2JB1 A;  1E39 A;  3SFD A;  2Q6U A;  3UP5 A;  3ALJ A;  3GD4 A;  1OJD A;  1FL2 A;  4C77 A;  2YG3 A;  3GDP A;  3KA7 A;  1ZX9 A;  1GND A;  4JNQ A;  3Q6J A;  3UTH A;  4O5Q A;  3SY4 A;  2B9X A;  2BK3 A;  4U2L A;  2CDU A;  1CL0 A;  2WQY A;  2WP6 A;  1CJ3 A;  2XCG A;  3QVP A;  4A79 A;  4N9X A;  2DKH A;  4DSH A;  1BZL A;  1PXB A;  2BC1 A;  4WCT A;  4RSL A;  1PJ6 A;  1YY5 A;  4EMI A;  1AOG A;  3DK4 A;  3AEB A;  3BNU A;  4NWZ A;  4H4Y A;  5GSN A;  3GRS A;  3AEF A;  1K0I A;  3OC4 A;  3E1T A;  4EM3 A;  4HA6 A;  1PS9 A;  1NEK A;  1VG9 A;  4IVO B;  2YM1 A;  1E1N A;  2BS4 A;  3KU9 A;  2Q0K A;  4JY3 A;  4Z24 A;  1NHR A;  2YLR A;  3NHO X;  2BA9 A;  1JRZ A;  3C4N A;  1LPF A;  3CGB A;  3D8X A;  2XFU A;  3CGE A;  1IJH A;  2BXS A;  3NG7 X;  4U8P A;  1CJ4 A;  1H84 A;  5LV9 A;  1FCD A;  2YLT A;  4LU6 A;  1GRA A;  1ZMC A;  3BI2 A;  2XVI A;  4OVI A;  4OCG A;  4ECH A;  3K30 A;  3GWD A;  2I0Z A;  1P2H A;  3AWI A;  4TM1 A;  2YQU A;  3DA1 A;  1JNR A;  4YTM A;  3G5S A;  4EMW A;  5HHF A;  5ER0 A;  5L46 A;  5U1O A;  2WES A;  3K7M X;  4GUV A;  2GMJ A;  2EQ8 A;  5CKU A;  4B1B A;  4PAA A;  2JAE A;  4H4U A;  4A65 A;  3NT6 A;  4Z44 A;  1H7X A;  4J33 A;  4B67 A;  2RAB A;  3GMC A;  3I3L A;  4H2R A;  3NK2 X;  4U8I A;  3S5W A;  4IA6 A;  4J34 A;  5KMR A;  1ZDL A;  3SQP A;  3RP7 A;  2GH5 A;  1W4X A;  3AE6 A;  1TDN A;  3M13 A;  4U8N A;  3L5O A;  5KMP A;  1XDI A;  4X4J A;  1IUT A;  4CNK A;  1Y0P A;  3ICS A;  5HYM A;  1H83 A;  2V5Z A;  4USQ A;  2O9Z A;  1RYI A;  5M10 A;  3FPZ A;  4YT0 A;  3PG6 A;  1NG4 A;  4J57 A;  3CNS A;  2R9Z A;  5TR3 A;  3V76 A;  4H4W A;  4YWO A;  2C64 A;  2ZBW A;  3DK8 A;  2R0G A;  2BC0 A;  3B3R A;  3NH3 X;  4IA5 A;  3RED A;  1EL5 A;  3CND A;  4RG3 A;  1L9C A;  3AE9 A;  3KVE A;  1YQ4 A;  1N4U A;  4NTD A;  1GER A;  1DOD A;  1PBE A;  2X3N A;  2OAM A;  3NKS A;  3PO7 A;  4BJZ A;  4C3X A;  4B63 A;  3HYW A;  3CIR A;  4X9M A;  2VOU A;  4UDR A;  1KNR A;  1EL9 A;  3SFE A;  2AAQ A;  4CY8 A;  1GTE A;  5U25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...