5KVHA

Crystal structure of human apoptosis-inducing factor with w196a mutation
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
487
structure length
438
Chain Sequence
DKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQANGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Defining NADH-Driven Allostery Regulating Apoptosis-Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 139
structure length 438
sequence length 487
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5kvhA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kvhA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kvhA01
2IVEA 2H88A 4YXDA 1KNPA 3CN8A 4IVMB 1D5TA 4RSLA 4TM4A 5U1OA 2OLNA 2YG3A 3BHFA 3FIMB 3S61A 5GRTA 4YSYA 3GWFA 1AOGA 3AWIA 3URHA 2YG5A 4IA6A 3NHOX 3DGHA 4H2QA 2YM1A 4EMIA 2B9XA 3HZLA 4Z44A 1GRHA 2EQ7A 2AQJA 1PN0A 2CDUA 1W4XA 4AOXA 4B67A 3VRDB 2GQFA 4Y4MA 4GDPA 1KDGA 4C5OA 4JNAA 4BJZA 2J3NA 3ABVA 4H4SA 4H50A 3F8PA 3UKKA 3H4KA 5BULA 3LZXA 1KFYA 4B1BA 2IIDA 1Y56A 4NTDA 3VQRA 1EL5A 4OCGA 3GYIA 4BJYA 3ZYXA 1OJTA 3SQPA 1BKWA 2C76A 2ZBWA 1TDKA 1D7LA 1CC2A 3KVEA 4IVOB 1ZDLA 2YR4A 1NEKA 3DJEA 3RNMA 2EQ9A 5FS8A 2VZ2A 1NENA 3PVCA 1FOHA 1UKVG 3NN6X 4I59A 1LJ1A 2XLUA 5LV9A 2WP9A 4CNJA 3P1WA 2JB2A 3EANA 1Y56B 2R0GA 4YWOA 4FDCB 2V61A 2XVHA 3UP4A 2R4EA 2CFYA 4OPDA 3M12A 4OPGA 1NHRA 2H89A 4B66A 4YKGA 2YR5A 4Z25A 5KOWA 2ACZA 1S2YA 4Z43A 2YVGA 3CIRA 1B8SA 4CCRA 1DOBA 3SFEA 1EBDA 1CHUA 4DGKA 4YSXA 5BRTA 2GQWA 3LJPA 2WBAA 4OPCA 2WEUA 1DODA 2FJAA 1OJ9A 3GD4A 5KVIA 4LIIA 1IUVA 1HYUA 4U8IA 2OLOA 1NAAA 1CJ4A 5GSNA 4K5RA 1H7XA 4OPTA 5KWFA 1P2EA 4AOSA 3AD7B 3IWAA 4EMWA 4ADWA 3V76A 4H4PA 1PXAA 3L1RA 4H4WA 3FMWA 4O5UA 2C3CA 2Q0KA 1ELIA 3UP5A 3B6DA 1D4EA 5L46A 2X3NA 4TM0A 3QSMA 2FBWA 4B64A 1LTXR 5ER0A 1K0LA 1ZP0A 2Q0LA 3ALMA 3CNTA 1E7PA 2RGHA 2ZZ0A 4K2XA 4YTNA 2YAUA 1B37A 3NKSA 3RP7A 2EQ6A 2V6OA 3AE2A 1GXFA 2NPXA 2GEWA 3F8RA 2WDRA 1Q1WA 4EIPA 2ZZCA 3F8DA 3Q6JA 3K7MX 2AAQA 2B76A 2W0HA 3ICRA 4BK2A 2R45A 1SEZA 4DSHA 4Z2TA 2X8GA 1DNCA 5KVHA 2GAGB 2BXSA 2YWLA 1H86A 2YG4A 1BF3A 4A99A 4C77A 4NEVA 2GR3A 1Q9IA 1YY5A 4UDRA 2BK3A 1F3PA 4U8LA 4A7AA 2C75A 2DKHA 4OPUA 2BC0A 2UZZA 4EQRA 1TRBA 3NGCX 1IUSA 3V3OA 4ZCCA 4CCQA 3UTEA 5IQ4A 2TMDA 3G5QA 2C3DA 1NG4A 4ZN0A 5M10A 1E1LA 1X31B 2C7GA 1DJNA 2VQBA 4H2NA 3UKHA 3UKFA 3AB1A 2YVFA 5IPYA 4Y4LA 1N1PA 3UKPA 3AXBA 5HHFA 3DK9A 3ICSA 4APNA 1F6MA 3CNDA 1FEBA 2GRTA 1O94A 2GMHA 3AEDA 4CNKA 2GV8A 4REKA 3DA1A 4X9NA 3QSSA 1S2QA 2BK5A 3AEGA 4K5SA 4EMJA 3REDA 3WE0A 1GRTA 4AT2A 1E1KA 1GV4A 3B3RA 2RGOA 3NRNA 3KD9A 3NT6A 3G5SA 3I6DA 2JB3A 1M6IA 4JN9A 2YLSA 2XVIA 5C2TA 4BK3A 3ATQA 3K7QX 4K22A 4U2LA 4Y4NA 1KNRA 3C4NA 2GB0A 3QJ4A 4CRTA 1JNRA 3RHAA 4EIQA 3Q9TA 1OJCA 5CKUA 5JCMA 5U63A 3M0OA 2QAEA 3QFAA 3H8LA 3DGZA 2BCGG 2FJBA 4A65A 4H4XA 4FX9A 3NK2X 2R9ZA 2B9WA 1DJQA 2GVCA 2YLTA 3BI2A 4N9XA 5HYMA 4LA1A 1PBEA 2VVLG 3FBSA 1GSNA 4H4YA 3AE1A 2B7SA 3DK4A 1NPXA 1GALA 2R0CA 3IHGA 1LVLA 2ARDA 1PJ7A 2XVJA 4U8NA 1ZY8A 2GMJA 2NVKX 1BGJA 2VQ7A 2BS2A 2A87A 1BZLA 4XWRA 2RABA 3ALJA 2RGJA 1ONFA 3AYJA 2A89A 1PXBA 3GD3A 3SFDA 1TYTA 4KPRA 3ICTA 3SM8A 3BNMA 1JRXA 2YLZA 4DSGA 1TYPA 1GRGA 1JRZA 4X9MA 3AE6A 3OZ2A 1Z6LA 2WOVA 3AE8A 4PABA 3PO7A 2JAEA 3FPZA 2XDOA 3GRSA 1N4VA 4JDRA 1XPQA 4YTMA 3V3NA 5FS6A 1FL2A 1ZOYA 4C3YA 1DOCA 3AECA 4BK1A 1KSSA 1VQWA 3DJJA 2C67A 4K8DA 3AE4A 3NG7X 3AD9B 2Y6QA 4LU6A 4JY2A 4FK1C 2Z5YA 2BK4A 1PHHA 4KX6A 2C72A 4H4RA 1ZK7A 3P9UA 1PBBA 5DBJA 1KSUA 2XCGA 1E39A 1IUWA 4Z24A 5KXJA 3P4SA 2XFOA 1CJ2A 4GR1A 2XFPA 4USQA 1GPEA 1GRFA 2X99A 1GESA 5TR3A 1Y0PA 2X50A 4YSHA 2YQUA 1QLBA 1ZOVA 4NTCA 3K30A 3NH3X 3NYEA 4PAAA 1F8SA 2E4GA 4OPIA 1XHCA 4CBQA 4U2SA 5FMHA 2QA1A 3UKLA 2JB1A 2WP5A 5EBKA 3GDNA 2BACA 2PHHA 4UDPA 1MOKA 1NHPA 2YVJA 4H4UA 4DNAA 1CC4A 3EAOA 2OAMA 3VRAA 3CGCA 1PBDA 4A79A 1IUTA 1H82A 2E1MA 1TDOA 1H83A 5CQFA 3D8XA 1PDHA 1PS9A 3GMBA 4IA5A 2XYOA 2R0PA 2WPEA 1LQUA 4MJWA 4Z2UA 2JK6A 3K7TA 2TPRA 5IQ1A 2GR2A 5KRQA 4AT0A 2WU5A 3NK1X 4NZHA 2V60A 1CBOA 1D4DA 2WP6A 1CL0A 1L0VA 1NG3A 2B9YA 1FEAA 2VRMA 2XFUA 1VG0A 1MO9A 4EQSA 1GRAA 3ADAB 4ECHA 3LB8A 1DXLA 3C96A 1JU2A 3UTGA 3BI5A 5EB4A 2XFQA 4U2TA 1S3EA 1O95A 4UDQA 4AP3A 5BVAA 2OA1A 3UKAA 3FG2P 2V3BA 2YLXA 2JBVA 1TDNA 1Q1RA 1H6VA 2BXRA 2WPCA 1E1MA 2X8HA 4IV9A 1GTEA 4B63A 3RP6A 4Z2RA 2YG6A 3CNJA 2GF3A 1L9DA 3DJDA 2YLRA 4GF7A 1VRQB 4OVIA 3NN0X 1IUXA 4E0VA 2Y6RA 2V3AA 2WESA 2XLSA 1F8WA 4EM3A 3NTAA 1PJ5A 4A6NA 2WETA 4USRA 3GDPA 1YQ3A 5HY5A 1E1NA 3COXA 1RSGA 4J36A 1ZKQA 3P4QA 3RP8A 3E1TA 3G5RA 5M0ZA 3NYCA 3BNUA 2VVMA 3GSIA 1COYA 1GEUA 3NLCA 1DOEA 4J31A 5JCNA 2B7RA 4O5QA 2GAHB 4J34A 4A6NB 2Z5XA 5JCKA 4HB9A 3LZWA 4XXGA 5J60A 2WQYA 1GOSA 2WDQA 3DH9A 2VOUA 1D7YA 2BA9A 3NTDA 1EL7A 2XVEA 4YKFA 4NEWA 3DK8A 2BCPA 3CGDA 3VR8A 4D03A 2WPFA 3JSKA 2YM2A 1RP0A 4TLXA 4GUVA 4C3XA 4J57A 2XLTA 3LOVA 2XLPA 4WX1A 5HXIA 1L9EA 3IHMA 3KU9A 4CY8A 2XLRA 1H81A 4JQ9A 4EM4A 1CJ3A 2QA2A 1YQZA 3CGBA 1EL9A 3KA7A 3NIXA 1H7WA 1IJHA 3UTFA 1FECA 4JNQA 4U8KA 5C3JA 1GREA 3GMCA 2CULA 1K0JA 1D4CA 4FK1A 4GRTA 1CC6A 2XFNA 4J33A 3ALLA 3EPTA 1JEHA 3P4PA 2Q7VA 2QCUA 4H2RA 2YLWA 4YT0A 2XVFA 4M52A 1LPFA 4K7ZA 2F5ZA 1LQTA 3KPFA 3IF9A 5J7XA 2C65A 2WS3A 2R4JA 1IUUA 3T37A 3D1CA 5JCIA 1EL8A 1NHQA 1JNZA 3UTHA 3DJGX 1BGNA 1NHSA 2BABA 2I0ZA 3ISHA 3LADA 4B68A 2YR6A 3NK0X 4U8OA 1GT8A 3EF6A 3ITJA 3AEEA 1B4VA 2C70A 1VG9A 3AE9A 3AE7A 3R9UA 3NYFA 1MXTA 3VR9A 3UKQA 3UOVA 3GYJA 4TM3A 3AD8B 5EB5A 2R46A 2GR1A 1VDCA 2BS3A 2O9ZA 2HQMA 3QSEA 1N4WA 3AE5A 1O5WA 3BI4A 3CTYA 4YTPA 3KKJA 4NTEA 4H4TA 3P4RA 3AYIA 2C64A 2EQ8A 3GRTA 1OJAA 1YQ4A 3ATRA 3DMEA 2WHDA 2GR0A 2VRLA 4A5LA 4D04A 4XWZA 4EQWA 1GRBA 4ZCDA 1TDEA 1ZMCA 2X8CA 1NDAA 1CF3A 4RG3A 4X4JA 1N4UA 3AYLA 3CNSA 3L8KA 3C4AA 4H4QA 3CNPA 1K0IA 4B69A 1PBFA 3CPHG 3QVRA 4JY3A 4C74A 4OPLA 4A9WA 5FS7A 1GNDA 3CPIG 5FS9A 3QVPA 1RYIA 2V5ZA 4Z26A 2FJDA 1BWCA 3SGLA 3ZDNA 2YG7A 3I3LA 5BUKA 2WDVA 4UP3A 1TDFA 3AE3A 4U8JA 1KF6A 3O0HA 2APGA 4EQXA 5U25A 3S5WA 4HA6A 4H4ZA 3UCLA 1REOA 1ZX9A 4BURA 3II4A 3NNEA 2C66A 1M64A 2Q6UA 3AEAA 5KOXA 1QJDA 2AR8A 4RG4A 2OALA 2WU2A 1GTHA 2BYBA 2JKCA 3UOXA 3QFBA 1OJDA 1K4QA 1FCDA 1JOAA 1JRYA 2DKIA 3PS9A 2WOWA 3IC9A 3BHKA 4P9SA 4U8PA 2A8XA 2BS4A 2WOIA 1GERA 1ZMDA 3LXDA 4ICYA 1V59A 2GH5A 4I58A 2VVLA 5EOWA 1CJCA 3GWDA 4H2PA 1GETA 3VRBA 1LV0A 2C73A 4U8MA 1PBCA 3UOZA 3OC4A 3AEBA 4GDEA 4H4VA 2FJEA 1PJ6A 3M13A 4H7UA 3UOYA 4YSZA 4J2WA 4B65A 2CVJA 3CGEA 1P2HA 1S3BA 1F8RA 2BC1A 1H84A 3AEFA 2ZZBA 4BV6A 5JCLA 3CPJG 1L9CA 2IVDA 4AP1A 4CY6A 4GCMA 1B5QA 3H8IA 1E6EA 1YKJA 4TM1A 2E5VA 4J56A 1XANA 1PXCA 2PYXA 4TLZA 1XDIA 1QO8A 4WCTA 3KLJA
chains in the Genus database with same CATH superfamily
2IVEA 2H88A 1KNPA 3CN8A 4RSLA 4TM4A 3UXLA 3BHFA 3FIMB 4YSYA 2QQ6A 1AOGA 1MDLA 3TTEA 4H2QA 3KUMA 4Z44A 1GRHA 3MKCA 4AOXA 2CDUA 4ZOHB 2GQFA 4BJZA 4DHGA 2J3NA 3UKKA 4B1BA 3SQPA 3V3WA 2ZBWA 1NEKA 3DJEA 3RNMA 3PVCA 5LV9A 1FOHA 1UKVG 4CNJA 2R0GA 2XVHA 2CFYA 1WUFA 4E6MA 1NHRA 4JHMA 4Z25A 2ACZA 1S2YA 1B8SA 2MNRA 5G5HB 4FP1A 3LJPA 7ENLA 2FJAA 1OJ9A 3GD4A 5KVIA 1HYUA 2OLOA 4MMWA 3ETRB 1CJ4A 5GSNA 3UXKA 4OPTA 1P2EA 3IWAA 3V76A 4H4PA 1ELIA 5L46A 4JN8A 3QSMA 2OZTA 3TWAA 1E7PA 2RGHA 3MWCA 4K2XA 2YAUA 1H2IA 4E8GA 2V6OA 2QDEA 2OPJA 3JZUA 3ZLGA 3HYVA 5KVHA 2BXSA 4C77A 4A3RA 4NEVA 2GR3A 1YY5A 4U8LA 2BC0A 4EQRA 2XH7A 1TRBA 3NGCX 4ZCCA 4GGHA 4E4FA 1RM6B 3SR6B 4ZN0A 3AB1A 4G7FA 4HN8A 4APNA 1F6MA 1FEBA 2GRTA 3VFCA 1BKHA 3AEDA 2OQHA 3R10A 2FYMA 2PTXA 5FJOA 2BK5A 3AEGA 4K5SA 3REDA 1E1KA 3S5SA 4BK3A 2NQLA 4HCLA 3VC6A 1OJCA 5U63A 3M0OA 2FJBA 4H4XA 2YLTA 4LA1A 2VVLG 3FBSA 1GSNA 4DSHA 3IHGA 1LVLA 2ARDA 4ZA0A 1WUEA 4GMEA 1EC9A 2A87A 1BZLA 3ALJA 2RGJA 3RR1A 3FXGA 3MZNA 3U9IA 2A89A 1JRXA 1TYPA 3OZ2A 2WOVA 3AE8A 4PABA 3NO1A 4JDRA 1XPQA 4DWDA 3V3NA 3AECA 4BK1A 2C67A 3AE4A 2QJJA 4KX6A 2C72A 4H4RA 3SQSA 1KSUA 1IUWA 2XFPA 2X99A 3IJIA 1ZOVA 3NYEA 1XHCA 4CBQA 5EBKA 3GDNA 3V5CA 2BACA 2BRYA 1MOKA 1NHPA 3EAOA 4K8GA 1V97A 1STZA 3BOXA 2PP3A 3D8XA 1PDHA 2GL5A 3T6CA 3UJRA 3SZFA 1FIQB 2GR2A 4AT0A 1L0VA 1NG3A 4ECHA 3UJEA 2OA1A 1KKOA 3FG2P 1TDNA 4B63A 2WPCA 1GTEA 2YG6A 3CNJA 4NNJA 4OVIA 1IUXA 3K1GA 4E0VA 1F8WA 4A6NA 4H19A 1N63C 1RSGA 4E4UA 4JN7A 3D46A 3BNUA 3GSIA 1JPDX 2B7RA 3ZLHA 4O5QA 5J60A 4HB9A 3LZWA 2WQYA 2XH2A 1D7YA 3L5OA 4E5TA 3JSKA 4J57A 3RGTA 4M6UA 1L9EA 4CY8A 1H81A 2QA2A 3NIXA 1EL9A 1FECA 1N62C 2AL2A 3TJIA 2XFNA 3ENLA 4H2RA 1EL8A 4J1OA 1KN0A 2BABA 4B68A 2OX4A 2I0ZA 2P88A 3AE7A 3VR9A 3UOVA 2BS3A 2ZC8A 3QSEA 3AE5A 1JPMA 1O5WA 3RO6A 2EQ8A 4J3ZA 1GRBA 3TQPA 1JCTA 1TDEA 1N4UA 3AYLA 3L8KA 3C4AA 4JY3A 1SJBA 1GNDA 1FFVC 3GO2A 4IZGA 3NXLA 3ZDNA 3I3LA 1XPYA 4U8JA 4GISA 2APGA 4EQXA 3S5WA 4HA6A 3UCLA 1RVKA 1REOA 3NNEA 3II4A 2C66A 2Q6UA 1QJDA 2AR8A 3UOXA 3NVZB 1OJDA 1R6WA 2WOWA 3T2ZA 3CK5A 1ZMDA 3LXDA 4I58A 4KEMA 2C73A 3UCCA 3UOZA 4GDEA 1PDYA 4B65A 2CVJA 3SN0A 2IVDA 4A35A 1B5QA 4TLZA 1QO8A 4WCTA 4YXDA 4IVMB 4TVYA 3QN3A 5GRTA 4IA6A 2YG5A 4EMIA 3OZYA 2B9XA 3HZLA 4GGBA 2EQ7A 5BOFA 3FV9A 4Y4MA 3DEQA 3I4KA 3JVAA 5BULA 3LZXA 1KFYA 2IIDA 4NTDA 3VQRA 2E5AA 1ECQA 3KVEA 4Z17A 2W55A 4IVOB 3CB3A 1MDRA 1W6TA 1NELA 1LJ1A 2WP9A 2JB2A 1Y56B 4YWOA 3PWIA 4OPGA 2H89A 1NU5A 2YVGA 1DOBA 3IJQA 4OPCA 2WEUA 1DODA 2PCEA 5KNLA 3MUCA 4AOSA 3AD7B 4EMWA 4ADWA 2C3CA 2GSHA 2FKPA 2X3NA 3CAWA 2FBWA 4B64A 1LTXR 1K0LA 2Q0LA 3ZVHB 2ZZ0A 1P48A 3NKSA 1GXFA 2GEWA 3F8RA 2WDRA 4IT1A 4HCHA 1Q1WA 4EIPA 3F8DA 3K7MX 2B76A 3ICRA 4DYEA 2P3ZA 2R45A 1SEZA 1BF3A 4A99A 2OG9A 2OZ3A 1BQGA 3OTRA 4UDRA 4KPLA 2OQYA 4OPUA 3UTEA 2TMDA 5M10A 3GC2A 1DJNA 3UKHA 4H2NA 1N1PA 4DXKA 3CNDA 4CNKA 4X9NA 3DA1A 3QSSA 4EMJA 2RGOA 3KD9A 3G5SA 4JN9A 2YLSA 2XVIA 2XH4A 4M0XA 1EC7A 3K7QX 4Y4NA 3QJ4A 2GB0A 1JNRA 1N60C 3H12A 5CKUA 3DGZA 3NK2X 2GVCA 1DJQA 3N6JA 3VDGA 2OZ8A 3AE1A 3S61A 3DK4A 1NPXA 2R0CA 2XVJA 1ZY8A 1BGJA 3AYJA 1S7MA 3T2YA 3ICTA 3FJ4A 3FCPA 4DSGA 3AE6A 3I6TA 2XDOA 1N4VA 4YTMA 2O56A 5FS6A 1FL2A 5FJRA 3DJJA 4G9KA 4K8DA 1TE6A 2Y6QA 1TKKA 3VC5A 1PHHA 3CT2A 1ZK7A 3CXBA 3P9UA 2XCGA 5KXJA 1E39A 1GESA 2YQUA 4MKSA 4PAAA 1F8SA 2QA1A 2GGIA 3N6HA 3SX6A 3STPA 4H4UA 2PGEA 1IUTA 1H82A 1TDOA 1PS9A 3GMBA 4IA5A 3V4BA 2XYOA 1LQUA 1PDZA 4Z2UA 2TPRA 1P43A 4DX3A 5KRQA 3HYXA 4NZHA 1CBOA 2WP6A 3QLDA 5KMSA 2XFUA 3LB8A 3UTGA 3VCNA 4U2TA 1S3EA 3RITA 4UDQA 4AP3A 5BVAA 3UKAA 2V3BA 4HPNA 2BXRA 3RP6A 2MUCA 4GF7A 1VRQB 5HY5A 3COXA 4J36A 3P4QA 3RP8A 3TW9A 5M0ZA 3DDMA 3I6EA 3NLCA 4J31A 5JCNA 2GAHB 4XXGA 2BA9A 3U4FA 4YKFA 2OFJA 4NEWA 4D03A 3THUA 3ES7A 4TLXA 4WX1A 2XLPA 1VDVA 4IL0A 3HYWA 3R07C 4EM4A 1YQZA 3CGBA 1K0JA 4GRTA 3ALLA 3EPTA 1JEHA 3P4PA 2Q7VA 2QCUA 1LPFA 2F5ZA 1LQTA 3R25A 3IF9A 5J7XA 3T37A 1IUUA 2E3TA 3DJGX 2OVLA 4U8OA 1GT8A 3EF6A 3AEEA 1B4VA 1VG9A 3NYFA 1MXTA 1SJCA 3MSYA 3AD8B 2PTZA 2GR1A 1VDCA 3UJFA 3RRAA 2HQMA 3CYJA 3R1ZA 3GY1A 4YTPA 5FJTA 3R0KA 2C64A 1YQ4A 4A5LA 2I5QA 4EQWA 2X8CA 4RG3A 4H4QA 3JW7A 5J04A 1PBFA 2GGHA 3CPHG 5FS7A 1YEYA 3CPIG 5FS9A 4Z26A 2FJDA 1BWCA 2YG7A 5BUKA 1KF6A 4BURA 5KOXA 4RG4A 1R0MA 2PA6A 3ZLFA 1JOAA 3IC9A 3QPEA 4U8PA 3NFUA 2BS4A 2WOIA 2GH5A 1GETA 3VRBA 4U8MA 1PBCA 3OC4A 3M13A 3NS1B 2BC1A 3AEFA 3CPJG 3H8AA 3TJ4A 1ONEA 4J56A 1XANA 1PXCA 3UP5A 3SY4A 3KLJA 1D5TA 2YG3A 4K2SA 3DGHA 2YM1A 2ONEA 3DG7A 1FO4A 3B97A 1KDGA 3ABVA 4H50A 3H4KA 5FJPA 1Y56A 1EL5A 4OCGA 3ZYXA 4KWSA 1BKWA 2C76A 1CC2A 1ZDLA 3HRDC 4I59A 2XLUA 3TWBA 3EANA 4FDCB 3UP4A 2R4EA 4G73A 5KOWA 2YR5A 4IHCA 3CIRA 4CCRA 3NVWB 1CHUA 5BRTA 2WBAA 3KPKA 4IP4A 1FHUA 4U8IA 4LIIA 4HCDA 4K5RA 5KWFA 3L1RA 3D47A 4TM0A 2AKZA 1ZP0A 2XGZA 3CNTA 4YTNA 1B37A 4G8TA 2ZZCA 2W0HA 4BK2A 2X8GA 4A6GA 5G5GB 1EBHA 1SJDA 1N5XA 1Q9IA 3IJLA 2BK3A 4GAVA 4G74A 4A7AA 2AL1A 2DKHA 2UZZA 1IUSA 3V3OA 4CCQA 5IQ4A 3G5QA 3BSMA 1E1LA 1X31B 2C7GA 2VQBA 5IPYA 4Y4LA 3UKPA 4H83A 3NZGA 3NRZB 3IK4A 2GV8A 4REKA 4ROPA 3VCCA 3WE0A 4AT2A 3B3RA 3NRNA 3I6DA 2JB3A 1M6IA 3P3BA 3ATQA 2P8BA 4K22A 4U2LA 3T9PA 4CRTA 3D9XA 3T14A 4HNLA 4EIQA 5JCMA 2QAEA 3QFAA 3H8LA 2BCGG 2OLAA 4N9XA 2R9ZA 5HYMA 1PBEA 4H4YA 2B7SA 2AKMA 2VQ7A 2BS2A 4XWRA 1ONFA 3SFDA 1TYTA 4KPRA 3SM8A 3BNMA 1GRGA 4X9MA 3UJSA 3PO7A 2JAEA 3GRSA 5JRBA 1ZOYA 4C3YA 1VQWA 3NG7X 3AD9B 2AL2B 3ZVIA 4LU6A 4FK1C 2BK4A 1PBBA 5DBJA 4Z24A 3H70A 3GD6A 4GR1A 4USQA 2W54A 3K30A 4U2SA 5FMHA 3QTPA 4KT2A 2JB1A 6ENLA 2PHHA 2PTWA 2QGYA 4DNAA 1CC4A 2OAMA 1H83A 2PSNA 2WPEA 4MJWA 4H1ZA 5FJUA 3K7TA 3NK1X 2V60A 1CL0A 1FEAA 2VRMA 1VG0A 1MO9A 4EQSA 3ADAB 1DXLA 1JU2A 3BI5A 1O95A 2YLXA 2JBVA 1Q1RA 1N61C 1H6VA 1E1MA 2GF3A 3NN0X 1TZZA 2V3AA 2WESA 2XLSA 3P93A 4EM3A 1PJ5A 3E1TA 4DN1A 3G5RA 2VVMA 1COYA 1GEUA 1VQZA 1DOEA 3CXOA 2Z5XA 2QVHA 2VOUA 3AMZA 3VR8A 1JRPA 3A7AA 4GUVA 2DW7A 2XLTA 3LOVA 2BRAA 5HXIA 3KU9A 4IL2A 4Z1YA 2XLRA 1CJ3A 3KA7A 1H7WA 4U8KA 2CULA 1JROA 1D4CA 1CC6A 1N5WC 3SYIA 4K7ZA 3KPFA 3S47A 2R4JA 5JCIA 3UTHA 1JNZA 3ISHA 3LADA 1MRAA 2YR6A 3ITJA 3AE9A 3UKQA 1FFUC 3GYJA 3DESA 4TM3A 3OPSA 2O9ZA 3SN1A 3AM9A 3BI4A 3T31A 1EC8A 3T4WA 3P4RA 2ZADA 3AYIA 1OJAA 3DMEA 2WHDA 3CMMA 2GGEA 2VRLA 3R0UA 4ZCDA 1CF3A 3CNSA 4HNCA 3CNPA 1K0IA 4G6GA 2CHRA 3SZWA 3QVRA 4A9WA 3BJSA 3QVPA 4II2A 2PMQA 3T0KA 3SGLA 3DIPA 2WDVA 5BOEA 4UP3A 3SJNA 2PS2A 5U25A 1M64A 2PODA 2BYBA 2JKCA 1FCDA 1JDFA 1MUCA 2A8XA 1GERA 1KD0A 2VVLA 5EOWA 1CJCA 3GWDA 4H2PA 4EWJA 3AEBA 4H4VA 2FJEA 3UOYA 4YSZA 3T2KA 3CGEA 1P2HA 1S3BA 5JCLA 4GCMA 4TM1A 2PYXA 1F9CA 2PP0A 5U1OA 2OLNA 1SB3B 1SJAA 3GWFA 3AWIA 3URHA 3NHOX 3FVDA 1E9IA 2AQJA 4B67A 1PN0A 1W4XA 3VRDB 3Q45A 1T3QC 4GDPA 4H2HA 4C5OA 4JNAA 4YWSA 4H4SA 3F8PA 3TOYA 3GYIA 4BJYA 1OJTA 4IP5A 1XS2A 1D7LA 1TDKA 3DERA 2YR4A 3ES8A 2EQ9A 5FS8A 2VZ2A 1NENA 3NN6X 2PGWA 3P1WA 2V61A 4OPDA 3EEZA 3M12A 4ZCWA 4B66A 4YKGA 4K1WA 2C4CA 4Z43A 3DG3A 3SFEA 1EBDA 4DGKA 4YSXA 4GAPA 2GQWA 1IUVA 5EU9A 3OZMA 1NAAA 1H7XA 1PXAA 4H4WA 3FMWA 4O5UA 2Q0KA 3B6DA 1D4EA 4FI4A 5ER0A 3ALMA 2HXUA 3RP7A 2EQ6A 3AE2A 2NPXA 2GGJA 1KCZA 5ENLA 3Q6JA 2AAQA 1IYXA 3SBFA 3RCYA 3A7RA 4Z2TA 1DNCA 2YWLA 2GAGB 1H86A 2YG4A 3R11A 3B9JB 1F3PA 2C75A 5KMQA 1L8PA 2C3DA 3AN1A 1NG4A 3UKFA 2YVFA 2PTYA 3PWGA 3AXBA 5HHFA 2QDDA 5KMPA 3DK9A 3ICSA 1MNSA 3QKEA 4GFIA 1O94A 2GMHA 2PU1A 1S2QA 3T8QA 1GRTA 3DGBA 1GV4A 3MY9A 3NT6A 5C2TA 2PP1A 1KNRA 3C4NA 2QJMA 3NVVB 3RHAA 3SN4A 3Q9TA 4A65A 2HNEA 4FX9A 2B9WA 3BI2A 3UGVA 4II3A 1GALA 4U8NA 1PJ7A 2GMJA 2NVKX 3DG6A 3HPFA 2RABA 3UJ2A 1PXBA 3GD3A 4HYRA 1KKRA 2YLZA 1JRZA 1Z6LA 3FPZA 1DOCA 4G6HA 1KSSA 1WYGA 2DW6A 1X2HA 4JY2A 2Z5YA 2PPGA 3ZVHA 3P4SA 2XFOA 1CJ2A 1GPEA 1GRFA 5TR3A 1Y0PA 2X50A 4X2PA 1QLBA 4YSHA 4F4RA 4NTCA 3NH3X 2E4GA 4OPIA 3UKLA 3PFRA 2WP5A 2XH0A 4UDPA 2YVJA 3VA8A 3EKGA 3VRAA 3CGCA 1PBDA 4A79A 2E1MA 3GYXA 5CQFA 2R0PA 2JK6A 5IQ1A 2WU5A 1D4DA 2B9YA 1ELSA 3PG6A 1GRAA 3C96A 1DTNA 5EB4A 2XFQA 4ENLA 3SZ0A 3PK7A 2W3RA 4IV9A 2X8HA 4Z2RA 2HZGA 3DJDA 1L9DA 2YLRA 2Y6RA 3NTAA 2WETA 4USRA 3GDPA 1YQ3A 1E1NA 1EBGA 1ZKQA 3P0WA 3NYCA 4J34A 4A6NB 5JCKA 1GOSA 2WDQA 3DH9A 4GYPA 3NTDA 3A7UA 1EL7A 2XVEA 2BCPA 3CGDA 3DK8A 3N4EA 2WPFA 2YM2A 1RP0A 4C3XA 3HW2A 3IHMA 4NWZA 4JQ9A 3UTFA 5C3JA 1IJHA 4JNQA 1GREA 4GYPC 3GMCA 3SZCA 4FK1A 4J33A 1X2GA 2PU0A 2YLWA 4YT0A 2XVFA 4M52A 2C65A 2WS3A 3D1CA 2GDQA 1NHQA 3TCSA 1BGNA 1NHSA 3NK0X 2C70A 3R9UA 2OKTA 5EB5A 2R46A 2W3SA 1FHVA 1N4WA 3Q4DA 3CTYA 2POZA 3DFYA 3DFHA 3KKJA 4NTEA 3FYYA 4H4TA 3ATRA 3GRTA 3OW1A 2GR0A 4D04A 4XWZA 3SSZA 3OP2A 1ZMCA 1NDAA 4X4JA 2OO6A 4GIRA 4TVWA 4B69A 2QJNA 4C74A 3NVYB 4OPLA 3H7VA 1RYIA 2V5ZA 5KMRA 1TDFA 4MGGA 3AE3A 3V5FA 3O0HA 2HXTA 2GGGA 4H4ZA 1ZX9A 3N4FA 3AEAA 2OALA 2WU2A 1GTHA 3QFBA 1K4QA 5IDZA 1OEPA 1JRYA 2DKIA 3PS9A 3MQTA 3BHKA 4P9SA 1ZXIC 4ICYA 1V59A 3UCDA 1LV0A 2P8CA 4H7UA 2P0IA 1PJ6A 3SXIA 3EUB3 4J2WA 1F8RA 1H84A 2ZZBA 4BV6A 4AP1A 4CY6A 1L9CA 3H8IA 1E6EA 1YKJA 2E5VA 1XDIA 2XSXA 2RDXA
chains in the Genus database with same CATH topology
2IVEA 2H88A 4YXDA 1KNPA 3CN8A 4IVMB 1D5TA 4RSLA 4TM4A 5U1OA 2OLNA 2YG3A 3BHFA 3FIMB 3S61A 5GRTA 4YSYA 3GWFA 1AOGA 3AWIA 3URHA 2YG5A 4IA6A 3NHOX 3DGHA 4H2QA 2YM1A 4EMIA 2B9XA 3HZLA 4Z44A 1GRHA 2EQ7A 2AQJA 1PN0A 2CDUA 1W4XA 4AOXA 4B67A 3VRDB 2GQFA 4Y4MA 4GDPA 1KDGA 4C5OA 4JNAA 4BJZA 2J3NA 3ABVA 4H4SA 4H50A 3F8PA 3UKKA 3H4KA 5BULA 3LZXA 1KFYA 4B1BA 2IIDA 1Y56A 4NTDA 3VQRA 1EL5A 4OCGA 3GYIA 4BJYA 3ZYXA 1OJTA 3SQPA 1BKWA 2C76A 2ZBWA 1TDKA 1D7LA 1CC2A 3KVEA 4IVOB 1ZDLA 2YR4A 1NEKA 3DJEA 3RNMA 2EQ9A 5FS8A 2VZ2A 1NENA 3PVCA 1FOHA 1UKVG 3NN6X 4I59A 1LJ1A 2XLUA 5LV9A 2WP9A 4CNJA 3P1WA 2JB2A 3EANA 1Y56B 2R0GA 4YWOA 4FDCB 2V61A 2XVHA 3UP4A 2R4EA 2CFYA 4OPDA 3M12A 4OPGA 1NHRA 2H89A 4G73A 4B66A 2YR5A 4YKGA 4Z25A 2ACZA 1S2YA 5KOWA 2C4CA 4Z43A 2YVGA 3CIRA 1B8SA 4CCRA 1DOBA 3SFEA 1EBDA 1CHUA 4DGKA 4YSXA 4GAPA 5BRTA 2GQWA 3LJPA 2WBAA 3KPKA 4OPCA 2WEUA 1DODA 2FJAA 1OJ9A 3GD4A 5KVIA 4LIIA 1IUVA 1HYUA 4U8IA 2OLOA 1NAAA 1CJ4A 5GSNA 4K5RA 5KNLA 1H7XA 4OPTA 5KWFA 1P2EA 4AOSA 3AD7B 3IWAA 4EMWA 4ADWA 3V76A 4H4PA 1PXAA 3L1RA 4H4WA 3FMWA 4O5UA 2C3CA 2Q0KA 1ELIA 3UP5A 3B6DA 1D4EA 5L46A 2X3NA 4TM0A 3QSMA 2FBWA 4B64A 1LTXR 5ER0A 1K0LA 1ZP0A 2Q0LA 3ALMA 3CNTA 1E7PA 2RGHA 2ZZ0A 4K2XA 4YTNA 1H2IA 2YAUA 1B37A 3NKSA 3RP7A 2EQ6A 2V6OA 3AE2A 1GXFA 2NPXA 2GEWA 3F8RA 2WDRA 1Q1WA 4EIPA 2ZZCA 3F8DA 3Q6JA 3K7MX 2AAQA 2B76A 2W0HA 3ICRA 3HYVA 4BK2A 2R45A 1SEZA 4DSHA 4Z2TA 2X8GA 1DNCA 5KVHA 2GAGB 2BXSA 2YWLA 1H86A 2YG4A 1BF3A 4A99A 4C77A 4NEVA 2GR3A 1Q9IA 1YY5A 4UDRA 2BK3A 1F3PA 4GAVA 4G74A 4U8LA 4A7AA 2C75A 2DKHA 4OPUA 5KMQA 2BC0A 2UZZA 4EQRA 1TRBA 3NGCX 1IUSA 3V3OA 4ZCCA 4CCQA 3UTEA 5IQ4A 2TMDA 3G5QA 2C3DA 1NG4A 4ZN0A 5M10A 1E1LA 1X31B 2C7GA 1DJNA 2VQBA 4H2NA 3UKHA 3UKFA 3AB1A 2YVFA 5IPYA 4Y4LA 1N1PA 3UKPA 3AXBA 5HHFA 5KMPA 3DK9A 3ICSA 4APNA 1F6MA 3CNDA 1FEBA 2GRTA 1O94A 2GMHA 3AEDA 4CNKA 2GV8A 4REKA 3DA1A 4X9NA 3QSSA 1S2QA 2BK5A 3AEGA 4K5SA 4EMJA 3REDA 3WE0A 1GRTA 4AT2A 1E1KA 1GV4A 3B3RA 2RGOA 3NRNA 3KD9A 3NT6A 3G5SA 3I6DA 2JB3A 1M6IA 4JN9A 2YLSA 4II3A 2XVIA 5C2TA 4BK3A 3ATQA 3K7QX 4K22A 4U2LA 4Y4NA 1KNRA 3C4NA 2GB0A 3QJ4A 4CRTA 3D9XA 3T14A 1JNRA 3RHAA 4EIQA 3Q9TA 1OJCA 5CKUA 5JCMA 5U63A 3M0OA 2QAEA 3QFAA 3H8LA 3DGZA 2BCGG 2FJBA 4A65A 4H4XA 4FX9A 3NK2X 2R9ZA 2B9WA 1DJQA 2GVCA 2YLTA 3BI2A 4N9XA 5HYMA 4LA1A 1PBEA 2VVLG 3FBSA 1GSNA 4H4YA 3AE1A 2B7SA 3DK4A 1NPXA 1GALA 2R0CA 3IHGA 1LVLA 2ARDA 1PJ7A 2XVJA 4U8NA 1ZY8A 2GMJA 2NVKX 1BGJA 2VQ7A 2BS2A 2A87A 1BZLA 4XWRA 2RABA 3ALJA 2RGJA 1ONFA 3AYJA 2A89A 1S7MA 1PXBA 3GD3A 3T2YA 3SFDA 1TYTA 4KPRA 3ICTA 3SM8A 3BNMA 1JRXA 2YLZA 4DSGA 1TYPA 1GRGA 1JRZA 4X9MA 3AE6A 3OZ2A 1Z6LA 2WOVA 3AE8A 4PABA 3PO7A 2JAEA 3FPZA 2XDOA 3GRSA 1N4VA 4JDRA 1XPQA 4YTMA 3V3NA 5FS6A 5JRBA 1FL2A 1ZOYA 1DOCA 4C3YA 3AECA 4G6HA 1KSSA 4BK1A 1VQWA 3DJJA 4G9KA 2C67A 4K8DA 3AE4A 3NG7X 3AD9B 2Y6QA 4LU6A 4JY2A 4FK1C 2Z5YA 2BK4A 1PHHA 4KX6A 2C72A 4H4RA 1ZK7A 3P9UA 1PBBA 5DBJA 1KSUA 2XCGA 1E39A 1IUWA 4Z24A 5KXJA 3P4SA 2XFOA 1CJ2A 4GR1A 2XFPA 4USQA 1GPEA 1GRFA 2X99A 1GESA 5TR3A 1Y0PA 2X50A 4YSHA 2YQUA 1QLBA 1ZOVA 4NTCA 3K30A 3NH3X 3NYEA 4PAAA 1F8SA 2E4GA 4OPIA 1XHCA 4CBQA 4U2SA 5FMHA 2QA1A 3UKLA 2JB1A 2WP5A 5EBKA 3GDNA 2BACA 2BRYA 3SX6A 2PHHA 4UDPA 1MOKA 1NHPA 2YVJA 4H4UA 4DNAA 1CC4A 3EAOA 2OAMA 3VRAA 3CGCA 1PBDA 4A79A 1IUTA 1H82A 2E1MA 1TDOA 3GYXA 1H83A 5CQFA 3D8XA 1PDHA 1PS9A 3GMBA 4IA5A 2XYOA 2R0PA 2WPEA 1LQUA 4MJWA 3SZFA 4Z2UA 2JK6A 3K7TA 2TPRA 5IQ1A 3SY4A 2GR2A 5KRQA 4AT0A 2WU5A 3HYXA 3NK1X 4NZHA 2V60A 1CBOA 1D4DA 2WP6A 1CL0A 1L0VA 1NG3A 2B9YA 1FEAA 5KMSA 2VRMA 2XFUA 1VG0A 3PG6A 1MO9A 4EQSA 1GRAA 3ADAB 4ECHA 3LB8A 1DXLA 3C96A 1JU2A 3UTGA 3BI5A 5EB4A 2XFQA 4U2TA 1S3EA 1O95A 4UDQA 4AP3A 5BVAA 3SZ0A 2OA1A 3UKAA 2V3BA 3FG2P 2YLXA 2JBVA 1TDNA 1Q1RA 1H6VA 2BXRA 2WPCA 1E1MA 2X8HA 4IV9A 1GTEA 4B63A 3RP6A 4Z2RA 2YG6A 3CNJA 2GF3A 1L9DA 3DJDA 4NNJA 2YLRA 4GF7A 1VRQB 4OVIA 3NN0X 1IUXA 4E0VA 2Y6RA 2V3AA 2WESA 2XLSA 1F8WA 4EM3A 3NTAA 1PJ5A 4A6NA 2WETA 4USRA 3GDPA 1YQ3A 5HY5A 1E1NA 3COXA 1RSGA 4J36A 1ZKQA 3P4QA 3RP8A 3E1TA 3G5RA 5M0ZA 3NYCA 3BNUA 2VVMA 3GSIA 1COYA 1GEUA 3NLCA 1DOEA 4J31A 5JCNA 2B7RA 4O5QA 2GAHB 4J34A 4A6NB 2Z5XA 5JCKA 4HB9A 3LZWA 4XXGA 5J60A 2WQYA 1GOSA 2WDQA 3DH9A 2VOUA 1D7YA 2BA9A 3L5OA 3NTDA 1EL7A 2XVEA 4YKFA 4NEWA 3DK8A 2BCPA 3CGDA 3VR8A 4D03A 2WPFA 3JSKA 2YM2A 1RP0A 4TLXA 4GUVA 4C3XA 4J57A 2XLTA 3LOVA 2XLPA 2BRAA 4WX1A 5HXIA 3HYWA 1L9EA 3IHMA 3KU9A 4NWZA 4CY8A 2XLRA 1H81A 4JQ9A 4EM4A 1CJ3A 2QA2A 1YQZA 3CGBA 1EL9A 3KA7A 3NIXA 1H7WA 1IJHA 3UTFA 1FECA 4JNQA 4U8KA 5C3JA 1GREA 3GMCA 3SZCA 2CULA 1K0JA 1D4CA 4FK1A 4GRTA 1CC6A 2XFNA 4J33A 3ALLA 3EPTA 1JEHA 3P4PA 2Q7VA 2QCUA 4H2RA 3SYIA 2YLWA 4YT0A 2XVFA 4M52A 1LPFA 4K7ZA 2F5ZA 1LQTA 3KPFA 3IF9A 5J7XA 2C65A 2WS3A 2R4JA 1IUUA 3T37A 3D1CA 5JCIA 1EL8A 1NHQA 1JNZA 3UTHA 1KN0A 3DJGX 1BGNA 1NHSA 2BABA 2I0ZA 3ISHA 3LADA 4B68A 2YR6A 3NK0X 4U8OA 1GT8A 3EF6A 3ITJA 3AEEA 1B4VA 2C70A 1VG9A 3AE9A 3AE7A 3R9UA 3NYFA 1MXTA 3VR9A 3UKQA 3UOVA 3GYJA 4TM3A 3AD8B 5EB5A 2R46A 2GR1A 1VDCA 2BS3A 2O9ZA 2HQMA 3QSEA 1N4WA 3AE5A 1O5WA 3BI4A 3CTYA 4YTPA 3KKJA 3T31A 4NTEA 4H4TA 3P4RA 3AYIA 2C64A 2EQ8A 3GRTA 1OJAA 1YQ4A 3ATRA 3DMEA 2WHDA 3CMMA 2GR0A 2VRLA 4A5LA 4D04A 4XWZA 4EQWA 1GRBA 4ZCDA 1TDEA 1ZMCA 2X8CA 1NDAA 1CF3A 4RG3A 4X4JA 1N4UA 3AYLA 3CNSA 3L8KA 3C4AA 4H4QA 3CNPA 1K0IA 4G6GA 4B69A 3SZWA 1PBFA 3CPHG 3QVRA 4JY3A 4C74A 4OPLA 4A9WA 5FS7A 1GNDA 3CPIG 5FS9A 3QVPA 1RYIA 2V5ZA 4II2A 4Z26A 2FJDA 3T0KA 1BWCA 3SGLA 3ZDNA 2YG7A 3I3LA 5BUKA 2WDVA 5KMRA 4UP3A 1TDFA 3AE3A 4U8JA 1KF6A 3O0HA 2APGA 4EQXA 5U25A 3S5WA 4HA6A 4H4ZA 3UCLA 1REOA 1ZX9A 4BURA 3II4A 3NNEA 2C66A 1M64A 2Q6UA 3AEAA 5KOXA 1QJDA 2AR8A 4RG4A 2OALA 2WU2A 1GTHA 2BYBA 2JKCA 3UOXA 3QFBA 1OJDA 1K4QA 1FCDA 1JOAA 1JRYA 2DKIA 3PS9A 2WOWA 3IC9A 3BHKA 4P9SA 4U8PA 2A8XA 3T2ZA 2BS4A 2WOIA 1GERA 1ZMDA 3LXDA 4ICYA 1V59A 2GH5A 4I58A 2VVLA 5EOWA 1CJCA 3GWDA 4H2PA 1GETA 3VRBA 1LV0A 2C73A 4U8MA 1PBCA 3UOZA 3OC4A 3AEBA 4GDEA 4H4VA 2FJEA 1PJ6A 3M13A 4H7UA 3SXIA 3UOYA 4YSZA 4J2WA 3T2KA 4B65A 2CVJA 3CGEA 1P2HA 1S3BA 1F8RA 2BC1A 1H84A 3AEFA 2ZZBA 4BV6A 5JCLA 3CPJG 1L9CA 2IVDA 4AP1A 4CY6A 4GCMA 1B5QA 3H8IA 1E6EA 1YKJA 4TM1A 2E5VA 4J56A 1XANA 1PXCA 2PYXA 4TLZA 1XDIA 1QO8A 4WCTA 3KLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IVE A;  2H88 A;  4YXD A;  1KNP A;  3CN8 A;  4IVM B;  1D5T A;  4RSL A;  4TM4 A;  5U1O A;  2OLN A;  2YG3 A;  3BHF A;  3FIM B;  3S61 A;  5GRT A;  4YSY A;  3GWF A;  1AOG A;  3AWI A;  3URH A;  2YG5 A;  4IA6 A;  3NHO X;  3DGH A;  4H2Q A;  2YM1 A;  4EMI A;  2B9X A;  3HZL A;  4Z44 A;  1GRH A;  2EQ7 A;  2AQJ A;  1PN0 A;  2CDU A;  1W4X A;  4AOX A;  4B67 A;  3VRD B;  2GQF A;  4Y4M A;  4GDP A;  1KDG A;  4C5O A;  4JNA A;  4BJZ A;  2J3N A;  3ABV A;  4H4S A;  4H50 A;  3F8P A;  3UKK A;  3H4K A;  5BUL A;  3LZX A;  1KFY A;  4B1B A;  2IID A;  1Y56 A;  4NTD A;  3VQR A;  1EL5 A;  4OCG A;  3GYI A;  4BJY A;  3ZYX A;  1OJT A;  3SQP A;  1BKW A;  2C76 A;  2ZBW A;  1TDK A;  1D7L A;  1CC2 A;  3KVE A;  4IVO B;  1ZDL A;  2YR4 A;  1NEK A;  3DJE A;  3RNM A;  2EQ9 A;  5FS8 A;  2VZ2 A;  1NEN A;  3PVC A;  1FOH A;  1UKV G;  3NN6 X;  4I59 A;  1LJ1 A;  2XLU A;  5LV9 A;  2WP9 A;  4CNJ A;  3P1W A;  2JB2 A;  3EAN A;  1Y56 B;  2R0G A;  4YWO A;  4FDC B;  2V61 A;  2XVH A;  3UP4 A;  2R4E A;  2CFY A;  4OPD A;  3M12 A;  4OPG A;  1NHR A;  2H89 A;  4B66 A;  4YKG A;  2YR5 A;  4Z25 A;  5KOW A;  2ACZ A;  1S2Y A;  4Z43 A;  2YVG A;  3CIR A;  1B8S A;  4CCR A;  1DOB A;  3SFE A;  1EBD A;  1CHU A;  4DGK A;  4YSX A;  5BRT A;  2GQW A;  3LJP A;  2WBA A;  4OPC A;  2WEU A;  1DOD A;  2FJA A;  1OJ9 A;  3GD4 A;  5KVI A;  4LII A;  1IUV A;  1HYU A;  4U8I A;  2OLO A;  1NAA A;  1CJ4 A;  5GSN A;  4K5R A;  1H7X A;  4OPT A;  5KWF A;  1P2E A;  4AOS A;  3AD7 B;  3IWA A;  4EMW A;  4ADW A;  3V76 A;  4H4P A;  1PXA A;  3L1R A;  4H4W A;  3FMW A;  4O5U A;  2C3C A;  2Q0K A;  1ELI A;  3UP5 A;  3B6D A;  1D4E A;  5L46 A;  2X3N A;  4TM0 A;  3QSM A;  2FBW A;  4B64 A;  1LTX R;  5ER0 A;  1K0L A;  1ZP0 A;  2Q0L A;  3ALM A;  3CNT A;  1E7P A;  2RGH A;  2ZZ0 A;  4K2X A;  4YTN A;  2YAU A;  1B37 A;  3NKS A;  3RP7 A;  2EQ6 A;  2V6O A;  3AE2 A;  1GXF A;  2NPX A;  2GEW A;  3F8R A;  2WDR A;  1Q1W A;  4EIP A;  2ZZC A;  3F8D A;  3Q6J A;  3K7M X;  2AAQ A;  2B76 A;  2W0H A;  3ICR A;  4BK2 A;  2R45 A;  1SEZ A;  4DSH A;  4Z2T A;  2X8G A;  1DNC A;  5KVH A;  2GAG B;  2BXS A;  2YWL A;  1H86 A;  2YG4 A;  1BF3 A;  4A99 A;  4C77 A;  4NEV A;  2GR3 A;  1Q9I A;  1YY5 A;  4UDR A;  2BK3 A;  1F3P A;  4U8L A;  4A7A A;  2C75 A;  2DKH A;  4OPU A;  2BC0 A;  2UZZ A;  4EQR A;  1TRB A;  3NGC X;  1IUS A;  3V3O A;  4ZCC A;  4CCQ A;  3UTE A;  5IQ4 A;  2TMD A;  3G5Q A;  2C3D A;  1NG4 A;  4ZN0 A;  5M10 A;  1E1L A;  1X31 B;  2C7G A;  1DJN A;  2VQB A;  4H2N A;  3UKH A;  3UKF A;  3AB1 A;  2YVF A;  5IPY A;  4Y4L A;  1N1P A;  3UKP A;  3AXB A;  5HHF A;  3DK9 A;  3ICS A;  4APN A;  1F6M A;  3CND A;  1FEB A;  2GRT A;  1O94 A;  2GMH A;  3AED A;  4CNK A;  2GV8 A;  4REK A;  3DA1 A;  4X9N A;  3QSS A;  1S2Q A;  2BK5 A;  3AEG A;  4K5S A;  4EMJ A;  3RED A;  3WE0 A;  1GRT A;  4AT2 A;  1E1K A;  1GV4 A;  3B3R A;  2RGO A;  3NRN A;  3KD9 A;  3NT6 A;  3G5S A;  3I6D A;  2JB3 A;  1M6I A;  4JN9 A;  2YLS A;  2XVI A;  5C2T A;  4BK3 A;  3ATQ A;  3K7Q X;  4K22 A;  4U2L A;  4Y4N A;  1KNR A;  3C4N A;  2GB0 A;  3QJ4 A;  4CRT A;  1JNR A;  3RHA A;  4EIQ A;  3Q9T A;  1OJC A;  5CKU A;  5JCM A;  5U63 A;  3M0O A;  2QAE A;  3QFA A;  3H8L A;  3DGZ A;  2BCG G;  2FJB A;  4A65 A;  4H4X A;  4FX9 A;  3NK2 X;  2R9Z A;  2B9W A;  1DJQ A;  2GVC A;  2YLT A;  3BI2 A;  4N9X A;  5HYM A;  4LA1 A;  1PBE A;  2VVL G;  3FBS A;  1GSN A;  4H4Y A;  3AE1 A;  2B7S A;  3DK4 A;  1NPX A;  1GAL A;  2R0C A;  3IHG A;  1LVL A;  2ARD A;  1PJ7 A;  2XVJ A;  4U8N A;  1ZY8 A;  2GMJ A;  2NVK X;  1BGJ A;  2VQ7 A;  2BS2 A;  2A87 A;  1BZL A;  4XWR A;  2RAB A;  3ALJ A;  2RGJ A;  1ONF A;  3AYJ A;  2A89 A;  1PXB A;  3GD3 A;  3SFD A;  1TYT A;  4KPR A;  3ICT A;  3SM8 A;  3BNM A;  1JRX A;  2YLZ A;  4DSG A;  1TYP A;  1GRG A;  1JRZ A;  4X9M A;  3AE6 A;  3OZ2 A;  1Z6L A;  2WOV A;  3AE8 A;  4PAB A;  3PO7 A;  2JAE A;  3FPZ A;  2XDO A;  3GRS A;  1N4V A;  4JDR A;  1XPQ A;  4YTM A;  3V3N A;  5FS6 A;  1FL2 A;  1ZOY A;  4C3Y A;  1DOC A;  3AEC A;  4BK1 A;  1KSS A;  1VQW A;  3DJJ A;  2C67 A;  4K8D A;  3AE4 A;  3NG7 X;  3AD9 B;  2Y6Q A;  4LU6 A;  4JY2 A;  4FK1 C;  2Z5Y A;  2BK4 A;  1PHH A;  4KX6 A;  2C72 A;  4H4R A;  1ZK7 A;  3P9U A;  1PBB A;  5DBJ A;  1KSU A;  2XCG A;  1E39 A;  1IUW A;  4Z24 A;  5KXJ A;  3P4S A;  2XFO A;  1CJ2 A;  4GR1 A;  2XFP A;  4USQ A;  1GPE A;  1GRF A;  2X99 A;  1GES A;  5TR3 A;  1Y0P A;  2X50 A;  4YSH A;  2YQU A;  1QLB A;  1ZOV A;  4NTC A;  3K30 A;  3NH3 X;  3NYE A;  4PAA A;  1F8S A;  2E4G A;  4OPI A;  1XHC A;  4CBQ A;  4U2S A;  5FMH A;  2QA1 A;  3UKL A;  2JB1 A;  2WP5 A;  5EBK A;  3GDN A;  2BAC A;  2PHH A;  4UDP A;  1MOK A;  1NHP A;  2YVJ A;  4H4U A;  4DNA A;  1CC4 A;  3EAO A;  2OAM A;  3VRA A;  3CGC A;  1PBD A;  4A79 A;  1IUT A;  1H82 A;  2E1M A;  1TDO A;  1H83 A;  5CQF A;  3D8X A;  1PDH A;  1PS9 A;  3GMB A;  4IA5 A;  2XYO A;  2R0P A;  2WPE A;  1LQU A;  4MJW A;  4Z2U A;  2JK6 A;  3K7T A;  2TPR A;  5IQ1 A;  2GR2 A;  5KRQ A;  4AT0 A;  2WU5 A;  3NK1 X;  4NZH A;  2V60 A;  1CBO A;  1D4D A;  2WP6 A;  1CL0 A;  1L0V A;  1NG3 A;  2B9Y A;  1FEA A;  2VRM A;  2XFU A;  1VG0 A;  1MO9 A;  4EQS A;  1GRA A;  3ADA B;  4ECH A;  3LB8 A;  1DXL A;  3C96 A;  1JU2 A;  3UTG A;  3BI5 A;  5EB4 A;  2XFQ A;  4U2T A;  1S3E A;  1O95 A;  4UDQ A;  4AP3 A;  5BVA A;  2OA1 A;  3UKA A;  3FG2 P;  2V3B A;  2YLX A;  2JBV A;  1TDN A;  1Q1R A;  1H6V A;  2BXR A;  2WPC A;  1E1M A;  2X8H A;  4IV9 A;  1GTE A;  4B63 A;  3RP6 A;  4Z2R A;  2YG6 A;  3CNJ A;  2GF3 A;  1L9D A;  3DJD A;  2YLR A;  4GF7 A;  1VRQ B;  4OVI A;  3NN0 X;  1IUX A;  4E0V A;  2Y6R A;  2V3A A;  2WES A;  2XLS A;  1F8W A;  4EM3 A;  3NTA A;  1PJ5 A;  4A6N A;  2WET A;  4USR A;  3GDP A;  1YQ3 A;  5HY5 A;  1E1N A;  3COX A;  1RSG A;  4J36 A;  1ZKQ A;  3P4Q A;  3RP8 A;  3E1T A;  3G5R A;  5M0Z A;  3NYC A;  3BNU A;  2VVM A;  3GSI A;  1COY A;  1GEU A;  3NLC A;  1DOE A;  4J31 A;  5JCN A;  2B7R A;  4O5Q A;  2GAH B;  4J34 A;  4A6N B;  2Z5X A;  5JCK A;  4HB9 A;  3LZW A;  4XXG A;  5J60 A;  2WQY A;  1GOS A;  2WDQ A;  3DH9 A;  2VOU A;  1D7Y A;  2BA9 A;  3NTD A;  1EL7 A;  2XVE A;  4YKF A;  4NEW A;  3DK8 A;  2BCP A;  3CGD A;  3VR8 A;  4D03 A;  2WPF A;  3JSK A;  2YM2 A;  1RP0 A;  4TLX A;  4GUV A;  4C3X A;  4J57 A;  2XLT A;  3LOV A;  2XLP A;  4WX1 A;  5HXI A;  1L9E A;  3IHM A;  3KU9 A;  4CY8 A;  2XLR A;  1H81 A;  4JQ9 A;  4EM4 A;  1CJ3 A;  2QA2 A;  1YQZ A;  3CGB A;  1EL9 A;  3KA7 A;  3NIX A;  1H7W A;  1IJH A;  3UTF A;  1FEC A;  4JNQ A;  4U8K A;  5C3J A;  1GRE A;  3GMC A;  2CUL A;  1K0J A;  1D4C A;  4FK1 A;  4GRT A;  1CC6 A;  2XFN A;  4J33 A;  3ALL A;  3EPT A;  1JEH A;  3P4P A;  2Q7V A;  2QCU A;  4H2R A;  2YLW A;  4YT0 A;  2XVF A;  4M52 A;  1LPF A;  4K7Z A;  2F5Z A;  1LQT A;  3KPF A;  3IF9 A;  5J7X A;  2C65 A;  2WS3 A;  2R4J A;  1IUU A;  3T37 A;  3D1C A;  5JCI A;  1EL8 A;  1NHQ A;  1JNZ A;  3UTH A;  3DJG X;  1BGN A;  1NHS A;  2BAB A;  2I0Z A;  3ISH A;  3LAD A;  4B68 A;  2YR6 A;  3NK0 X;  4U8O A;  1GT8 A;  3EF6 A;  3ITJ A;  3AEE A;  1B4V A;  2C70 A;  1VG9 A;  3AE9 A;  3AE7 A;  3R9U A;  3NYF A;  1MXT A;  3VR9 A;  3UKQ A;  3UOV A;  3GYJ A;  4TM3 A;  3AD8 B;  5EB5 A;  2R46 A;  2GR1 A;  1VDC A;  2BS3 A;  2O9Z A;  2HQM A;  3QSE A;  1N4W A;  3AE5 A;  1O5W A;  3BI4 A;  3CTY A;  4YTP A;  3KKJ A;  4NTE A;  4H4T A;  3P4R A;  3AYI A;  2C64 A;  2EQ8 A;  3GRT A;  1OJA A;  1YQ4 A;  3ATR A;  3DME A;  2WHD A;  2GR0 A;  2VRL A;  4A5L A;  4D04 A;  4XWZ A;  4EQW A;  1GRB A;  4ZCD A;  1TDE A;  1ZMC A;  2X8C A;  1NDA A;  1CF3 A;  4RG3 A;  4X4J A;  1N4U A;  3AYL A;  3CNS A;  3L8K A;  3C4A A;  4H4Q A;  3CNP A;  1K0I A;  4B69 A;  1PBF A;  3CPH G;  3QVR A;  4JY3 A;  4C74 A;  4OPL A;  4A9W A;  5FS7 A;  1GND A;  3CPI G;  5FS9 A;  3QVP A;  1RYI A;  2V5Z A;  4Z26 A;  2FJD A;  1BWC A;  3SGL A;  3ZDN A;  2YG7 A;  3I3L A;  5BUK A;  2WDV A;  4UP3 A;  1TDF A;  3AE3 A;  4U8J A;  1KF6 A;  3O0H A;  2APG A;  4EQX A;  5U25 A;  3S5W A;  4HA6 A;  4H4Z A;  3UCL A;  1REO A;  1ZX9 A;  4BUR A;  3II4 A;  3NNE A;  2C66 A;  1M64 A;  2Q6U A;  3AEA A;  5KOX A;  1QJD A;  2AR8 A;  4RG4 A;  2OAL A;  2WU2 A;  1GTH A;  2BYB A;  2JKC A;  3UOX A;  3QFB A;  1OJD A;  1K4Q A;  1FCD A;  1JOA A;  1JRY A;  2DKI A;  3PS9 A;  2WOW A;  3IC9 A;  3BHK A;  4P9S A;  4U8P A;  2A8X A;  2BS4 A;  2WOI A;  1GER A;  1ZMD A;  3LXD A;  4ICY A;  1V59 A;  2GH5 A;  4I58 A;  2VVL A;  5EOW A;  1CJC A;  3GWD A;  4H2P A;  1GET A;  3VRB A;  1LV0 A;  2C73 A;  4U8M A;  1PBC A;  3UOZ A;  3OC4 A;  3AEB A;  4GDE A;  4H4V A;  2FJE A;  1PJ6 A;  3M13 A;  4H7U A;  3UOY A;  4YSZ A;  4J2W A;  4B65 A;  2CVJ A;  3CGE A;  1P2H A;  1S3B A;  1F8R A;  2BC1 A;  1H84 A;  3AEF A;  2ZZB A;  4BV6 A;  5JCL A;  3CPJ G;  1L9C A;  2IVD A;  4AP1 A;  4CY6 A;  4GCM A;  1B5Q A;  3H8I A;  1E6E A;  1YKJ A;  4TM1 A;  2E5V A;  4J56 A;  1XAN A;  1PXC A;  2PYX A;  4TLZ A;  1XDI A;  1QO8 A;  4WCT A;  3KLJ A; 
#chains in the Genus database with same CATH topology
 2IVE A;  2H88 A;  1KNP A;  3CN8 A;  4RSL A;  4TM4 A;  3UXL A;  3BHF A;  3FIM B;  4YSY A;  2QQ6 A;  1AOG A;  1MDL A;  3TTE A;  4H2Q A;  3KUM A;  4Z44 A;  1GRH A;  3MKC A;  4AOX A;  2CDU A;  4ZOH B;  2GQF A;  4BJZ A;  4DHG A;  2J3N A;  3UKK A;  4B1B A;  3SQP A;  3V3W A;  2ZBW A;  1NEK A;  3DJE A;  3RNM A;  3PVC A;  5LV9 A;  1FOH A;  1UKV G;  4CNJ A;  2R0G A;  2XVH A;  2CFY A;  1WUF A;  4E6M A;  1NHR A;  4JHM A;  4Z25 A;  2ACZ A;  1S2Y A;  1B8S A;  2MNR A;  5G5H B;  4FP1 A;  3LJP A;  7ENL A;  2FJA A;  1OJ9 A;  3GD4 A;  5KVI A;  1HYU A;  2OLO A;  4MMW A;  3ETR B;  1CJ4 A;  5GSN A;  3UXK A;  4OPT A;  1P2E A;  3IWA A;  3V76 A;  4H4P A;  1ELI A;  5L46 A;  4JN8 A;  3QSM A;  2OZT A;  3TWA A;  1E7P A;  2RGH A;  3MWC A;  4K2X A;  2YAU A;  1H2I A;  4E8G A;  2V6O A;  2QDE A;  2OPJ A;  3JZU A;  3ZLG A;  3HYV A;  5KVH A;  2BXS A;  4C77 A;  4A3R A;  4NEV A;  2GR3 A;  1YY5 A;  4U8L A;  2BC0 A;  4EQR A;  2XH7 A;  1TRB A;  3NGC X;  4ZCC A;  4GGH A;  4E4F A;  1RM6 B;  3SR6 B;  4ZN0 A;  3AB1 A;  4G7F A;  4HN8 A;  4APN A;  1F6M A;  1FEB A;  2GRT A;  3VFC A;  1BKH A;  3AED A;  2OQH A;  3R10 A;  2FYM A;  2PTX A;  5FJO A;  2BK5 A;  3AEG A;  4K5S A;  3RED A;  1E1K A;  3S5S A;  4BK3 A;  2NQL A;  4HCL A;  3VC6 A;  1OJC A;  5U63 A;  3M0O A;  2FJB A;  4H4X A;  2YLT A;  4LA1 A;  2VVL G;  3FBS A;  1GSN A;  4DSH A;  3IHG A;  1LVL A;  2ARD A;  4ZA0 A;  1WUE A;  4GME A;  1EC9 A;  2A87 A;  1BZL A;  3ALJ A;  2RGJ A;  3RR1 A;  3FXG A;  3MZN A;  3U9I A;  2A89 A;  1JRX A;  1TYP A;  3OZ2 A;  2WOV A;  3AE8 A;  4PAB A;  3NO1 A;  4JDR A;  1XPQ A;  4DWD A;  3V3N A;  3AEC A;  4BK1 A;  2C67 A;  3AE4 A;  2QJJ A;  4KX6 A;  2C72 A;  4H4R A;  3SQS A;  1KSU A;  1IUW A;  2XFP A;  2X99 A;  3IJI A;  1ZOV A;  3NYE A;  1XHC A;  4CBQ A;  5EBK A;  3GDN A;  3V5C A;  2BAC A;  2BRY A;  1MOK A;  1NHP A;  3EAO A;  4K8G A;  1V97 A;  1STZ A;  3BOX A;  2PP3 A;  3D8X A;  1PDH A;  2GL5 A;  3T6C A;  3UJR A;  3SZF A;  1FIQ B;  2GR2 A;  4AT0 A;  1L0V A;  1NG3 A;  4ECH A;  3UJE A;  2OA1 A;  1KKO A;  3FG2 P;  1TDN A;  4B63 A;  2WPC A;  1GTE A;  2YG6 A;  3CNJ A;  4NNJ A;  4OVI A;  1IUX A;  3K1G A;  4E0V A;  1F8W A;  4A6N A;  4H19 A;  1N63 C;  1RSG A;  4E4U A;  4JN7 A;  3D46 A;  3BNU A;  3GSI A;  1JPD X;  2B7R A;  3ZLH A;  4O5Q A;  5J60 A;  4HB9 A;  3LZW A;  2WQY A;  2XH2 A;  1D7Y A;  3L5O A;  4E5T A;  3JSK A;  4J57 A;  3RGT A;  4M6U A;  1L9E A;  4CY8 A;  1H81 A;  2QA2 A;  3NIX A;  1EL9 A;  1FEC A;  1N62 C;  2AL2 A;  3TJI A;  2XFN A;  3ENL A;  4H2R A;  1EL8 A;  4J1O A;  1KN0 A;  2BAB A;  4B68 A;  2OX4 A;  2I0Z A;  2P88 A;  3AE7 A;  3VR9 A;  3UOV A;  2BS3 A;  2ZC8 A;  3QSE A;  3AE5 A;  1JPM A;  1O5W A;  3RO6 A;  2EQ8 A;  4J3Z A;  1GRB A;  3TQP A;  1JCT A;  1TDE A;  1N4U A;  3AYL A;  3L8K A;  3C4A A;  4JY3 A;  1SJB A;  1GND A;  1FFV C;  3GO2 A;  4IZG A;  3NXL A;  3ZDN A;  3I3L A;  1XPY A;  4U8J A;  4GIS A;  2APG A;  4EQX A;  3S5W A;  4HA6 A;  3UCL A;  1RVK A;  1REO A;  3NNE A;  3II4 A;  2C66 A;  2Q6U A;  1QJD A;  2AR8 A;  3UOX A;  3NVZ B;  1OJD A;  1R6W A;  2WOW A;  3T2Z A;  3CK5 A;  1ZMD A;  3LXD A;  4I58 A;  4KEM A;  2C73 A;  3UCC A;  3UOZ A;  4GDE A;  1PDY A;  4B65 A;  2CVJ A;  3SN0 A;  2IVD A;  4A35 A;  1B5Q A;  4TLZ A;  1QO8 A;  4WCT A;  4YXD A;  4IVM B;  4TVY A;  3QN3 A;  5GRT A;  4IA6 A;  2YG5 A;  4EMI A;  3OZY A;  2B9X A;  3HZL A;  4GGB A;  2EQ7 A;  5BOF A;  3FV9 A;  4Y4M A;  3DEQ A;  3I4K A;  3JVA A;  5BUL A;  3LZX A;  1KFY A;  2IID A;  4NTD A;  3VQR A;  2E5A A;  1ECQ A;  3KVE A;  4Z17 A;  2W55 A;  4IVO B;  3CB3 A;  1MDR A;  1W6T A;  1NEL A;  1LJ1 A;  2WP9 A;  2JB2 A;  1Y56 B;  4YWO A;  3PWI A;  4OPG A;  2H89 A;  1NU5 A;  2YVG A;  1DOB A;  3IJQ A;  4OPC A;  2WEU A;  1DOD A;  2PCE A;  5KNL A;  3MUC A;  4AOS A;  3AD7 B;  4EMW A;  4ADW A;  2C3C A;  2GSH A;  2FKP A;  2X3N A;  3CAW A;  2FBW A;  4B64 A;  1LTX R;  1K0L A;  2Q0L A;  3ZVH B;  2ZZ0 A;  1P48 A;  3NKS A;  1GXF A;  2GEW A;  3F8R A;  2WDR A;  4IT1 A;  4HCH A;  1Q1W A;  4EIP A;  3F8D A;  3K7M X;  2B76 A;  3ICR A;  4DYE A;  2P3Z A;  2R45 A;  1SEZ A;  1BF3 A;  4A99 A;  2OG9 A;  2OZ3 A;  1BQG A;  3OTR A;  4UDR A;  4KPL A;  2OQY A;  4OPU A;  3UTE A;  2TMD A;  5M10 A;  3GC2 A;  1DJN A;  3UKH A;  4H2N A;  1N1P A;  4DXK A;  3CND A;  4CNK A;  4X9N A;  3DA1 A;  3QSS A;  4EMJ A;  2RGO A;  3KD9 A;  3G5S A;  4JN9 A;  2YLS A;  2XVI A;  2XH4 A;  4M0X A;  1EC7 A;  3K7Q X;  4Y4N A;  3QJ4 A;  2GB0 A;  1JNR A;  1N60 C;  3H12 A;  5CKU A;  3DGZ A;  3NK2 X;  2GVC A;  1DJQ A;  3N6J A;  3VDG A;  2OZ8 A;  3AE1 A;  3S61 A;  3DK4 A;  1NPX A;  2R0C A;  2XVJ A;  1ZY8 A;  1BGJ A;  3AYJ A;  1S7M A;  3T2Y A;  3ICT A;  3FJ4 A;  3FCP A;  4DSG A;  3AE6 A;  3I6T A;  2XDO A;  1N4V A;  4YTM A;  2O56 A;  5FS6 A;  1FL2 A;  5FJR A;  3DJJ A;  4G9K A;  4K8D A;  1TE6 A;  2Y6Q A;  1TKK A;  3VC5 A;  1PHH A;  3CT2 A;  1ZK7 A;  3CXB A;  3P9U A;  2XCG A;  5KXJ A;  1E39 A;  1GES A;  2YQU A;  4MKS A;  4PAA A;  1F8S A;  2QA1 A;  2GGI A;  3N6H A;  3SX6 A;  3STP A;  4H4U A;  2PGE A;  1IUT A;  1H82 A;  1TDO A;  1PS9 A;  3GMB A;  4IA5 A;  3V4B A;  2XYO A;  1LQU A;  1PDZ A;  4Z2U A;  2TPR A;  1P43 A;  4DX3 A;  5KRQ A;  3HYX A;  4NZH A;  1CBO A;  2WP6 A;  3QLD A;  5KMS A;  2XFU A;  3LB8 A;  3UTG A;  3VCN A;  4U2T A;  1S3E A;  3RIT A;  4UDQ A;  4AP3 A;  5BVA A;  3UKA A;  2V3B A;  4HPN A;  2BXR A;  3RP6 A;  2MUC A;  4GF7 A;  1VRQ B;  5HY5 A;  3COX A;  4J36 A;  3P4Q A;  3RP8 A;  3TW9 A;  5M0Z A;  3DDM A;  3I6E A;  3NLC A;  4J31 A;  5JCN A;  2GAH B;  4XXG A;  2BA9 A;  3U4F A;  4YKF A;  2OFJ A;  4NEW A;  4D03 A;  3THU A;  3ES7 A;  4TLX A;  4WX1 A;  2XLP A;  1VDV A;  4IL0 A;  3HYW A;  3R07 C;  4EM4 A;  1YQZ A;  3CGB A;  1K0J A;  4GRT A;  3ALL A;  3EPT A;  1JEH A;  3P4P A;  2Q7V A;  2QCU A;  1LPF A;  2F5Z A;  1LQT A;  3R25 A;  3IF9 A;  5J7X A;  3T37 A;  1IUU A;  2E3T A;  3DJG X;  2OVL A;  4U8O A;  1GT8 A;  3EF6 A;  3AEE A;  1B4V A;  1VG9 A;  3NYF A;  1MXT A;  1SJC A;  3MSY A;  3AD8 B;  2PTZ A;  2GR1 A;  1VDC A;  3UJF A;  3RRA A;  2HQM A;  3CYJ A;  3R1Z A;  3GY1 A;  4YTP A;  5FJT A;  3R0K A;  2C64 A;  1YQ4 A;  4A5L A;  2I5Q A;  4EQW A;  2X8C A;  4RG3 A;  4H4Q A;  3JW7 A;  5J04 A;  1PBF A;  2GGH A;  3CPH G;  5FS7 A;  1YEY A;  3CPI G;  5FS9 A;  4Z26 A;  2FJD A;  1BWC A;  2YG7 A;  5BUK A;  1KF6 A;  4BUR A;  5KOX A;  4RG4 A;  1R0M A;  2PA6 A;  3ZLF A;  1JOA A;  3IC9 A;  3QPE A;  4U8P A;  3NFU A;  2BS4 A;  2WOI A;  2GH5 A;  1GET A;  3VRB A;  4U8M A;  1PBC A;  3OC4 A;  3M13 A;  3NS1 B;  2BC1 A;  3AEF A;  3CPJ G;  3H8A A;  3TJ4 A;  1ONE A;  4J56 A;  1XAN A;  1PXC A;  3UP5 A;  3SY4 A;  3KLJ A;  1D5T A;  2YG3 A;  4K2S A;  3DGH A;  2YM1 A;  2ONE A;  3DG7 A;  1FO4 A;  3B97 A;  1KDG A;  3ABV A;  4H50 A;  3H4K A;  5FJP A;  1Y56 A;  1EL5 A;  4OCG A;  3ZYX A;  4KWS A;  1BKW A;  2C76 A;  1CC2 A;  1ZDL A;  3HRD C;  4I59 A;  2XLU A;  3TWB A;  3EAN A;  4FDC B;  3UP4 A;  2R4E A;  4G73 A;  5KOW A;  2YR5 A;  4IHC A;  3CIR A;  4CCR A;  3NVW B;  1CHU A;  5BRT A;  2WBA A;  3KPK A;  4IP4 A;  1FHU A;  4U8I A;  4LII A;  4HCD A;  4K5R A;  5KWF A;  3L1R A;  3D47 A;  4TM0 A;  2AKZ A;  1ZP0 A;  2XGZ A;  3CNT A;  4YTN A;  1B37 A;  4G8T A;  2ZZC A;  2W0H A;  4BK2 A;  2X8G A;  4A6G A;  5G5G B;  1EBH A;  1SJD A;  1N5X A;  1Q9I A;  3IJL A;  2BK3 A;  4GAV A;  4G74 A;  4A7A A;  2AL1 A;  2DKH A;  2UZZ A;  1IUS A;  3V3O A;  4CCQ A;  5IQ4 A;  3G5Q A;  3BSM A;  1E1L A;  1X31 B;  2C7G A;  2VQB A;  5IPY A;  4Y4L A;  3UKP A;  4H83 A;  3NZG A;  3NRZ B;  3IK4 A;  2GV8 A;  4REK A;  4ROP A;  3VCC A;  3WE0 A;  4AT2 A;  3B3R A;  3NRN A;  3I6D A;  2JB3 A;  1M6I A;  3P3B A;  3ATQ A;  2P8B A;  4K22 A;  4U2L A;  3T9P A;  4CRT A;  3D9X A;  3T14 A;  4HNL A;  4EIQ A;  5JCM A;  2QAE A;  3QFA A;  3H8L A;  2BCG G;  2OLA A;  4N9X A;  2R9Z A;  5HYM A;  1PBE A;  4H4Y A;  2B7S A;  2AKM A;  2VQ7 A;  2BS2 A;  4XWR A;  1ONF A;  3SFD A;  1TYT A;  4KPR A;  3SM8 A;  3BNM A;  1GRG A;  4X9M A;  3UJS A;  3PO7 A;  2JAE A;  3GRS A;  5JRB A;  1ZOY A;  4C3Y A;  1VQW A;  3NG7 X;  3AD9 B;  2AL2 B;  3ZVI A;  4LU6 A;  4FK1 C;  2BK4 A;  1PBB A;  5DBJ A;  4Z24 A;  3H70 A;  3GD6 A;  4GR1 A;  4USQ A;  2W54 A;  3K30 A;  4U2S A;  5FMH A;  3QTP A;  4KT2 A;  2JB1 A;  6ENL A;  2PHH A;  2PTW A;  2QGY A;  4DNA A;  1CC4 A;  2OAM A;  1H83 A;  2PSN A;  2WPE A;  4MJW A;  4H1Z A;  5FJU A;  3K7T A;  3NK1 X;  2V60 A;  1CL0 A;  1FEA A;  2VRM A;  1VG0 A;  1MO9 A;  4EQS A;  3ADA B;  1DXL A;  1JU2 A;  3BI5 A;  1O95 A;  2YLX A;  2JBV A;  1Q1R A;  1N61 C;  1H6V A;  1E1M A;  2GF3 A;  3NN0 X;  1TZZ A;  2V3A A;  2WES A;  2XLS A;  3P93 A;  4EM3 A;  1PJ5 A;  3E1T A;  4DN1 A;  3G5R A;  2VVM A;  1COY A;  1GEU A;  1VQZ A;  1DOE A;  3CXO A;  2Z5X A;  2QVH A;  2VOU A;  3AMZ A;  3VR8 A;  1JRP A;  3A7A A;  4GUV A;  2DW7 A;  2XLT A;  3LOV A;  2BRA A;  5HXI A;  3KU9 A;  4IL2 A;  4Z1Y A;  2XLR A;  1CJ3 A;  3KA7 A;  1H7W A;  4U8K A;  2CUL A;  1JRO A;  1D4C A;  1CC6 A;  1N5W C;  3SYI A;  4K7Z A;  3KPF A;  3S47 A;  2R4J A;  5JCI A;  3UTH A;  1JNZ A;  3ISH A;  3LAD A;  1MRA A;  2YR6 A;  3ITJ A;  3AE9 A;  3UKQ A;  1FFU C;  3GYJ A;  3DES A;  4TM3 A;  3OPS A;  2O9Z A;  3SN1 A;  3AM9 A;  3BI4 A;  3T31 A;  1EC8 A;  3T4W A;  3P4R A;  2ZAD A;  3AYI A;  1OJA A;  3DME A;  2WHD A;  3CMM A;  2GGE A;  2VRL A;  3R0U A;  4ZCD A;  1CF3 A;  3CNS A;  4HNC A;  3CNP A;  1K0I A;  4G6G A;  2CHR A;  3SZW A;  3QVR A;  4A9W A;  3BJS A;  3QVP A;  4II2 A;  2PMQ A;  3T0K A;  3SGL A;  3DIP A;  2WDV A;  5BOE A;  4UP3 A;  3SJN A;  2PS2 A;  5U25 A;  1M64 A;  2POD A;  2BYB A;  2JKC A;  1FCD A;  1JDF A;  1MUC A;  2A8X A;  1GER A;  1KD0 A;  2VVL A;  5EOW A;  1CJC A;  3GWD A;  4H2P A;  4EWJ A;  3AEB A;  4H4V A;  2FJE A;  3UOY A;  4YSZ A;  3T2K A;  3CGE A;  1P2H A;  1S3B A;  5JCL A;  4GCM A;  4TM1 A;  2PYX A;  1F9C A;  2PP0 A;  5U1O A;  2OLN A;  1SB3 B;  1SJA A;  3GWF A;  3AWI A;  3URH A;  3NHO X;  3FVD A;  1E9I A;  2AQJ A;  4B67 A;  1PN0 A;  1W4X A;  3VRD B;  3Q45 A;  1T3Q C;  4GDP A;  4H2H A;  4C5O A;  4JNA A;  4YWS A;  4H4S A;  3F8P A;  3TOY A;  3GYI A;  4BJY A;  1OJT A;  4IP5 A;  1XS2 A;  1D7L A;  1TDK A;  3DER A;  2YR4 A;  3ES8 A;  2EQ9 A;  5FS8 A;  2VZ2 A;  1NEN A;  3NN6 X;  2PGW A;  3P1W A;  2V61 A;  4OPD A;  3EEZ A;  3M12 A;  4ZCW A;  4B66 A;  4YKG A;  4K1W A;  2C4C A;  4Z43 A;  3DG3 A;  3SFE A;  1EBD A;  4DGK A;  4YSX A;  4GAP A;  2GQW A;  1IUV A;  5EU9 A;  3OZM A;  1NAA A;  1H7X A;  1PXA A;  4H4W A;  3FMW A;  4O5U A;  2Q0K A;  3B6D A;  1D4E A;  4FI4 A;  5ER0 A;  3ALM A;  2HXU A;  3RP7 A;  2EQ6 A;  3AE2 A;  2NPX A;  2GGJ A;  1KCZ A;  5ENL A;  3Q6J A;  2AAQ A;  1IYX A;  3SBF A;  3RCY A;  3A7R A;  4Z2T A;  1DNC A;  2YWL A;  2GAG B;  1H86 A;  2YG4 A;  3R11 A;  3B9J B;  1F3P A;  2C75 A;  5KMQ A;  1L8P A;  2C3D A;  3AN1 A;  1NG4 A;  3UKF A;  2YVF A;  2PTY A;  3PWG A;  3AXB A;  5HHF A;  2QDD A;  5KMP A;  3DK9 A;  3ICS A;  1MNS A;  3QKE A;  4GFI A;  1O94 A;  2GMH A;  2PU1 A;  1S2Q A;  3T8Q A;  1GRT A;  3DGB A;  1GV4 A;  3MY9 A;  3NT6 A;  5C2T A;  2PP1 A;  1KNR A;  3C4N A;  2QJM A;  3NVV B;  3RHA A;  3SN4 A;  3Q9T A;  4A65 A;  2HNE A;  4FX9 A;  2B9W A;  3BI2 A;  3UGV A;  4II3 A;  1GAL A;  4U8N A;  1PJ7 A;  2GMJ A;  2NVK X;  3DG6 A;  3HPF A;  2RAB A;  3UJ2 A;  1PXB A;  3GD3 A;  4HYR A;  1KKR A;  2YLZ A;  1JRZ A;  1Z6L A;  3FPZ A;  1DOC A;  4G6H A;  1KSS A;  1WYG A;  2DW6 A;  1X2H A;  4JY2 A;  2Z5Y A;  2PPG A;  3ZVH A;  3P4S A;  2XFO A;  1CJ2 A;  1GPE A;  1GRF A;  5TR3 A;  1Y0P A;  2X50 A;  4X2P A;  1QLB A;  4YSH A;  4F4R A;  4NTC A;  3NH3 X;  2E4G A;  4OPI A;  3UKL A;  3PFR A;  2WP5 A;  2XH0 A;  4UDP A;  2YVJ A;  3VA8 A;  3EKG A;  3VRA A;  3CGC A;  1PBD A;  4A79 A;  2E1M A;  3GYX A;  5CQF A;  2R0P A;  2JK6 A;  5IQ1 A;  2WU5 A;  1D4D A;  2B9Y A;  1ELS A;  3PG6 A;  1GRA A;  3C96 A;  1DTN A;  5EB4 A;  2XFQ A;  4ENL A;  3SZ0 A;  3PK7 A;  2W3R A;  4IV9 A;  2X8H A;  4Z2R A;  2HZG A;  3DJD A;  1L9D A;  2YLR A;  2Y6R A;  3NTA A;  2WET A;  4USR A;  3GDP A;  1YQ3 A;  1E1N A;  1EBG A;  1ZKQ A;  3P0W A;  3NYC A;  4J34 A;  4A6N B;  5JCK A;  1GOS A;  2WDQ A;  3DH9 A;  4GYP A;  3NTD A;  3A7U A;  1EL7 A;  2XVE A;  2BCP A;  3CGD A;  3DK8 A;  3N4E A;  2WPF A;  2YM2 A;  1RP0 A;  4C3X A;  3HW2 A;  3IHM A;  4NWZ A;  4JQ9 A;  3UTF A;  5C3J A;  1IJH A;  4JNQ A;  1GRE A;  4GYP C;  3GMC A;  3SZC A;  4FK1 A;  4J33 A;  1X2G A;  2PU0 A;  2YLW A;  4YT0 A;  2XVF A;  4M52 A;  2C65 A;  2WS3 A;  3D1C A;  2GDQ A;  1NHQ A;  3TCS A;  1BGN A;  1NHS A;  3NK0 X;  2C70 A;  3R9U A;  2OKT A;  5EB5 A;  2R46 A;  2W3S A;  1FHV A;  1N4W A;  3Q4D A;  3CTY A;  2POZ A;  3DFY A;  3DFH A;  3KKJ A;  4NTE A;  3FYY A;  4H4T A;  3ATR A;  3GRT A;  3OW1 A;  2GR0 A;  4D04 A;  4XWZ A;  3SSZ A;  3OP2 A;  1ZMC A;  1NDA A;  4X4J A;  2OO6 A;  4GIR A;  4TVW A;  4B69 A;  2QJN A;  4C74 A;  3NVY B;  4OPL A;  3H7V A;  1RYI A;  2V5Z A;  5KMR A;  1TDF A;  4MGG A;  3AE3 A;  3V5F A;  3O0H A;  2HXT A;  2GGG A;  4H4Z A;  1ZX9 A;  3N4F A;  3AEA A;  2OAL A;  2WU2 A;  1GTH A;  3QFB A;  1K4Q A;  5IDZ A;  1OEP A;  1JRY A;  2DKI A;  3PS9 A;  3MQT A;  3BHK A;  4P9S A;  1ZXI C;  4ICY A;  1V59 A;  3UCD A;  1LV0 A;  2P8C A;  4H7U A;  2P0I A;  1PJ6 A;  3SXI A;  3EUB 3;  4J2W A;  1F8R A;  1H84 A;  2ZZB A;  4BV6 A;  4AP1 A;  4CY6 A;  1L9C A;  3H8I A;  1E6E A;  1YKJ A;  2E5V A;  1XDI A;  2XSX A;  2RDX A; 
#chains in the Genus database with same CATH homology
 2IVE A;  2H88 A;  4YXD A;  1KNP A;  3CN8 A;  4IVM B;  1D5T A;  4RSL A;  4TM4 A;  5U1O A;  2OLN A;  2YG3 A;  3BHF A;  3FIM B;  3S61 A;  5GRT A;  4YSY A;  3GWF A;  1AOG A;  3AWI A;  3URH A;  2YG5 A;  4IA6 A;  3NHO X;  3DGH A;  4H2Q A;  2YM1 A;  4EMI A;  2B9X A;  3HZL A;  4Z44 A;  1GRH A;  2EQ7 A;  2AQJ A;  1PN0 A;  2CDU A;  1W4X A;  4AOX A;  4B67 A;  3VRD B;  2GQF A;  4Y4M A;  4GDP A;  1KDG A;  4C5O A;  4JNA A;  4BJZ A;  2J3N A;  3ABV A;  4H4S A;  4H50 A;  3F8P A;  3UKK A;  3H4K A;  5BUL A;  3LZX A;  1KFY A;  4B1B A;  2IID A;  1Y56 A;  4NTD A;  3VQR A;  1EL5 A;  4OCG A;  3GYI A;  4BJY A;  3ZYX A;  1OJT A;  3SQP A;  1BKW A;  2C76 A;  2ZBW A;  1TDK A;  1D7L A;  1CC2 A;  3KVE A;  4IVO B;  1ZDL A;  2YR4 A;  1NEK A;  3DJE A;  3RNM A;  2EQ9 A;  5FS8 A;  2VZ2 A;  1NEN A;  3PVC A;  1FOH A;  1UKV G;  3NN6 X;  4I59 A;  1LJ1 A;  2XLU A;  5LV9 A;  2WP9 A;  4CNJ A;  3P1W A;  2JB2 A;  3EAN A;  1Y56 B;  2R0G A;  4YWO A;  4FDC B;  2V61 A;  2XVH A;  3UP4 A;  2R4E A;  2CFY A;  4OPD A;  3M12 A;  4OPG A;  1NHR A;  2H89 A;  4G73 A;  4B66 A;  2YR5 A;  4YKG A;  4Z25 A;  2ACZ A;  1S2Y A;  5KOW A;  2C4C A;  4Z43 A;  2YVG A;  3CIR A;  1B8S A;  4CCR A;  1DOB A;  3SFE A;  1EBD A;  1CHU A;  4DGK A;  4YSX A;  4GAP A;  5BRT A;  2GQW A;  3LJP A;  2WBA A;  3KPK A;  4OPC A;  2WEU A;  1DOD A;  2FJA A;  1OJ9 A;  3GD4 A;  5KVI A;  4LII A;  1IUV A;  1HYU A;  4U8I A;  2OLO A;  1NAA A;  1CJ4 A;  5GSN A;  4K5R A;  5KNL A;  1H7X A;  4OPT A;  5KWF A;  1P2E A;  4AOS A;  3AD7 B;  3IWA A;  4EMW A;  4ADW A;  3V76 A;  4H4P A;  1PXA A;  3L1R A;  4H4W A;  3FMW A;  4O5U A;  2C3C A;  2Q0K A;  1ELI A;  3UP5 A;  3B6D A;  1D4E A;  5L46 A;  2X3N A;  4TM0 A;  3QSM A;  2FBW A;  4B64 A;  1LTX R;  5ER0 A;  1K0L A;  1ZP0 A;  2Q0L A;  3ALM A;  3CNT A;  1E7P A;  2RGH A;  2ZZ0 A;  4K2X A;  4YTN A;  1H2I A;  2YAU A;  1B37 A;  3NKS A;  3RP7 A;  2EQ6 A;  2V6O A;  3AE2 A;  1GXF A;  2NPX A;  2GEW A;  3F8R A;  2WDR A;  1Q1W A;  4EIP A;  2ZZC A;  3F8D A;  3Q6J A;  3K7M X;  2AAQ A;  2B76 A;  2W0H A;  3ICR A;  3HYV A;  4BK2 A;  2R45 A;  1SEZ A;  4DSH A;  4Z2T A;  2X8G A;  1DNC A;  5KVH A;  2GAG B;  2BXS A;  2YWL A;  1H86 A;  2YG4 A;  1BF3 A;  4A99 A;  4C77 A;  4NEV A;  2GR3 A;  1Q9I A;  1YY5 A;  4UDR A;  2BK3 A;  1F3P A;  4GAV A;  4G74 A;  4U8L A;  4A7A A;  2C75 A;  2DKH A;  4OPU A;  5KMQ A;  2BC0 A;  2UZZ A;  4EQR A;  1TRB A;  3NGC X;  1IUS A;  3V3O A;  4ZCC A;  4CCQ A;  3UTE A;  5IQ4 A;  2TMD A;  3G5Q A;  2C3D A;  1NG4 A;  4ZN0 A;  5M10 A;  1E1L A;  1X31 B;  2C7G A;  1DJN A;  2VQB A;  4H2N A;  3UKH A;  3UKF A;  3AB1 A;  2YVF A;  5IPY A;  4Y4L A;  1N1P A;  3UKP A;  3AXB A;  5HHF A;  5KMP A;  3DK9 A;  3ICS A;  4APN A;  1F6M A;  3CND A;  1FEB A;  2GRT A;  1O94 A;  2GMH A;  3AED A;  4CNK A;  2GV8 A;  4REK A;  3DA1 A;  4X9N A;  3QSS A;  1S2Q A;  2BK5 A;  3AEG A;  4K5S A;  4EMJ A;  3RED A;  3WE0 A;  1GRT A;  4AT2 A;  1E1K A;  1GV4 A;  3B3R A;  2RGO A;  3NRN A;  3KD9 A;  3NT6 A;  3G5S A;  3I6D A;  2JB3 A;  1M6I A;  4JN9 A;  2YLS A;  4II3 A;  2XVI A;  5C2T A;  4BK3 A;  3ATQ A;  3K7Q X;  4K22 A;  4U2L A;  4Y4N A;  1KNR A;  3C4N A;  2GB0 A;  3QJ4 A;  4CRT A;  3D9X A;  3T14 A;  1JNR A;  3RHA A;  4EIQ A;  3Q9T A;  1OJC A;  5CKU A;  5JCM A;  5U63 A;  3M0O A;  2QAE A;  3QFA A;  3H8L A;  3DGZ A;  2BCG G;  2FJB A;  4A65 A;  4H4X A;  4FX9 A;  3NK2 X;  2R9Z A;  2B9W A;  1DJQ A;  2GVC A;  2YLT A;  3BI2 A;  4N9X A;  5HYM A;  4LA1 A;  1PBE A;  2VVL G;  3FBS A;  1GSN A;  4H4Y A;  3AE1 A;  2B7S A;  3DK4 A;  1NPX A;  1GAL A;  2R0C A;  3IHG A;  1LVL A;  2ARD A;  1PJ7 A;  2XVJ A;  4U8N A;  1ZY8 A;  2GMJ A;  2NVK X;  1BGJ A;  2VQ7 A;  2BS2 A;  2A87 A;  1BZL A;  4XWR A;  2RAB A;  3ALJ A;  2RGJ A;  1ONF A;  3AYJ A;  2A89 A;  1S7M A;  1PXB A;  3GD3 A;  3T2Y A;  3SFD A;  1TYT A;  4KPR A;  3ICT A;  3SM8 A;  3BNM A;  1JRX A;  2YLZ A;  4DSG A;  1TYP A;  1GRG A;  1JRZ A;  4X9M A;  3AE6 A;  3OZ2 A;  1Z6L A;  2WOV A;  3AE8 A;  4PAB A;  3PO7 A;  2JAE A;  3FPZ A;  2XDO A;  3GRS A;  1N4V A;  4JDR A;  1XPQ A;  4YTM A;  3V3N A;  5FS6 A;  5JRB A;  1FL2 A;  1ZOY A;  1DOC A;  4C3Y A;  3AEC A;  4G6H A;  1KSS A;  4BK1 A;  1VQW A;  3DJJ A;  4G9K A;  2C67 A;  4K8D A;  3AE4 A;  3NG7 X;  3AD9 B;  2Y6Q A;  4LU6 A;  4JY2 A;  4FK1 C;  2Z5Y A;  2BK4 A;  1PHH A;  4KX6 A;  2C72 A;  4H4R A;  1ZK7 A;  3P9U A;  1PBB A;  5DBJ A;  1KSU A;  2XCG A;  1E39 A;  1IUW A;  4Z24 A;  5KXJ A;  3P4S A;  2XFO A;  1CJ2 A;  4GR1 A;  2XFP A;  4USQ A;  1GPE A;  1GRF A;  2X99 A;  1GES A;  5TR3 A;  1Y0P A;  2X50 A;  4YSH A;  2YQU A;  1QLB A;  1ZOV A;  4NTC A;  3K30 A;  3NH3 X;  3NYE A;  4PAA A;  1F8S A;  2E4G A;  4OPI A;  1XHC A;  4CBQ A;  4U2S A;  5FMH A;  2QA1 A;  3UKL A;  2JB1 A;  2WP5 A;  5EBK A;  3GDN A;  2BAC A;  2BRY A;  3SX6 A;  2PHH A;  4UDP A;  1MOK A;  1NHP A;  2YVJ A;  4H4U A;  4DNA A;  1CC4 A;  3EAO A;  2OAM A;  3VRA A;  3CGC A;  1PBD A;  4A79 A;  1IUT A;  1H82 A;  2E1M A;  1TDO A;  3GYX A;  1H83 A;  5CQF A;  3D8X A;  1PDH A;  1PS9 A;  3GMB A;  4IA5 A;  2XYO A;  2R0P A;  2WPE A;  1LQU A;  4MJW A;  3SZF A;  4Z2U A;  2JK6 A;  3K7T A;  2TPR A;  5IQ1 A;  3SY4 A;  2GR2 A;  5KRQ A;  4AT0 A;  2WU5 A;  3HYX A;  3NK1 X;  4NZH A;  2V60 A;  1CBO A;  1D4D A;  2WP6 A;  1CL0 A;  1L0V A;  1NG3 A;  2B9Y A;  1FEA A;  5KMS A;  2VRM A;  2XFU A;  1VG0 A;  3PG6 A;  1MO9 A;  4EQS A;  1GRA A;  3ADA B;  4ECH A;  3LB8 A;  1DXL A;  3C96 A;  1JU2 A;  3UTG A;  3BI5 A;  5EB4 A;  2XFQ A;  4U2T A;  1S3E A;  1O95 A;  4UDQ A;  4AP3 A;  5BVA A;  3SZ0 A;  2OA1 A;  3UKA A;  2V3B A;  3FG2 P;  2YLX A;  2JBV A;  1TDN A;  1Q1R A;  1H6V A;  2BXR A;  2WPC A;  1E1M A;  2X8H A;  4IV9 A;  1GTE A;  4B63 A;  3RP6 A;  4Z2R A;  2YG6 A;  3CNJ A;  2GF3 A;  1L9D A;  3DJD A;  4NNJ A;  2YLR A;  4GF7 A;  1VRQ B;  4OVI A;  3NN0 X;  1IUX A;  4E0V A;  2Y6R A;  2V3A A;  2WES A;  2XLS A;  1F8W A;  4EM3 A;  3NTA A;  1PJ5 A;  4A6N A;  2WET A;  4USR A;  3GDP A;  1YQ3 A;  5HY5 A;  1E1N A;  3COX A;  1RSG A;  4J36 A;  1ZKQ A;  3P4Q A;  3RP8 A;  3E1T A;  3G5R A;  5M0Z A;  3NYC A;  3BNU A;  2VVM A;  3GSI A;  1COY A;  1GEU A;  3NLC A;  1DOE A;  4J31 A;  5JCN A;  2B7R A;  4O5Q A;  2GAH B;  4J34 A;  4A6N B;  2Z5X A;  5JCK A;  4HB9 A;  3LZW A;  4XXG A;  5J60 A;  2WQY A;  1GOS A;  2WDQ A;  3DH9 A;  2VOU A;  1D7Y A;  2BA9 A;  3L5O A;  3NTD A;  1EL7 A;  2XVE A;  4YKF A;  4NEW A;  3DK8 A;  2BCP A;  3CGD A;  3VR8 A;  4D03 A;  2WPF A;  3JSK A;  2YM2 A;  1RP0 A;  4TLX A;  4GUV A;  4C3X A;  4J57 A;  2XLT A;  3LOV A;  2XLP A;  2BRA A;  4WX1 A;  5HXI A;  3HYW A;  1L9E A;  3IHM A;  3KU9 A;  4NWZ A;  4CY8 A;  2XLR A;  1H81 A;  4JQ9 A;  4EM4 A;  1CJ3 A;  2QA2 A;  1YQZ A;  3CGB A;  1EL9 A;  3KA7 A;  3NIX A;  1H7W A;  1IJH A;  3UTF A;  1FEC A;  4JNQ A;  4U8K A;  5C3J A;  1GRE A;  3GMC A;  3SZC A;  2CUL A;  1K0J A;  1D4C A;  4FK1 A;  4GRT A;  1CC6 A;  2XFN A;  4J33 A;  3ALL A;  3EPT A;  1JEH A;  3P4P A;  2Q7V A;  2QCU A;  4H2R A;  3SYI A;  2YLW A;  4YT0 A;  2XVF A;  4M52 A;  1LPF A;  4K7Z A;  2F5Z A;  1LQT A;  3KPF A;  3IF9 A;  5J7X A;  2C65 A;  2WS3 A;  2R4J A;  1IUU A;  3T37 A;  3D1C A;  5JCI A;  1EL8 A;  1NHQ A;  1JNZ A;  3UTH A;  1KN0 A;  3DJG X;  1BGN A;  1NHS A;  2BAB A;  2I0Z A;  3ISH A;  3LAD A;  4B68 A;  2YR6 A;  3NK0 X;  4U8O A;  1GT8 A;  3EF6 A;  3ITJ A;  3AEE A;  1B4V A;  2C70 A;  1VG9 A;  3AE9 A;  3AE7 A;  3R9U A;  3NYF A;  1MXT A;  3VR9 A;  3UKQ A;  3UOV A;  3GYJ A;  4TM3 A;  3AD8 B;  5EB5 A;  2R46 A;  2GR1 A;  1VDC A;  2BS3 A;  2O9Z A;  2HQM A;  3QSE A;  1N4W A;  3AE5 A;  1O5W A;  3BI4 A;  3CTY A;  4YTP A;  3KKJ A;  3T31 A;  4NTE A;  4H4T A;  3P4R A;  3AYI A;  2C64 A;  2EQ8 A;  3GRT A;  1OJA A;  1YQ4 A;  3ATR A;  3DME A;  2WHD A;  3CMM A;  2GR0 A;  2VRL A;  4A5L A;  4D04 A;  4XWZ A;  4EQW A;  1GRB A;  4ZCD A;  1TDE A;  1ZMC A;  2X8C A;  1NDA A;  1CF3 A;  4RG3 A;  4X4J A;  1N4U A;  3AYL A;  3CNS A;  3L8K A;  3C4A A;  4H4Q A;  3CNP A;  1K0I A;  4G6G A;  4B69 A;  3SZW A;  1PBF A;  3CPH G;  3QVR A;  4JY3 A;  4C74 A;  4OPL A;  4A9W A;  5FS7 A;  1GND A;  3CPI G;  5FS9 A;  3QVP A;  1RYI A;  2V5Z A;  4II2 A;  4Z26 A;  2FJD A;  3T0K A;  1BWC A;  3SGL A;  3ZDN A;  2YG7 A;  3I3L A;  5BUK A;  2WDV A;  5KMR A;  4UP3 A;  1TDF A;  3AE3 A;  4U8J A;  1KF6 A;  3O0H A;  2APG A;  4EQX A;  5U25 A;  3S5W A;  4HA6 A;  4H4Z A;  3UCL A;  1REO A;  1ZX9 A;  4BUR A;  3II4 A;  3NNE A;  2C66 A;  1M64 A;  2Q6U A;  3AEA A;  5KOX A;  1QJD A;  2AR8 A;  4RG4 A;  2OAL A;  2WU2 A;  1GTH A;  2BYB A;  2JKC A;  3UOX A;  3QFB A;  1OJD A;  1K4Q A;  1FCD A;  1JOA A;  1JRY A;  2DKI A;  3PS9 A;  2WOW A;  3IC9 A;  3BHK A;  4P9S A;  4U8P A;  2A8X A;  3T2Z A;  2BS4 A;  2WOI A;  1GER A;  1ZMD A;  3LXD A;  4ICY A;  1V59 A;  2GH5 A;  4I58 A;  2VVL A;  5EOW A;  1CJC A;  3GWD A;  4H2P A;  1GET A;  3VRB A;  1LV0 A;  2C73 A;  4U8M A;  1PBC A;  3UOZ A;  3OC4 A;  3AEB A;  4GDE A;  4H4V A;  2FJE A;  1PJ6 A;  3M13 A;  4H7U A;  3SXI A;  3UOY A;  4YSZ A;  4J2W A;  3T2K A;  4B65 A;  2CVJ A;  3CGE A;  1P2H A;  1S3B A;  1F8R A;  2BC1 A;  1H84 A;  3AEF A;  2ZZB A;  4BV6 A;  5JCL A;  3CPJ G;  1L9C A;  2IVD A;  4AP1 A;  4CY6 A;  4GCM A;  1B5Q A;  3H8I A;  1E6E A;  1YKJ A;  4TM1 A;  2E5V A;  4J56 A;  1XAN A;  1PXC A;  2PYX A;  4TLZ A;  1XDI A;  1QO8 A;  4WCT A;  3KLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...