5KVHA

Crystal structure of human apoptosis-inducing factor with w196a mutation
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
487
structure length
438
Chain Sequence
DKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQANGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defining NADH-Driven Allostery Regulating Apoptosis-Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Apoptosis-inducing factor 1, mitochondrial
total genus 139
structure length 438
sequence length 487
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5kvhA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kvhA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kvhA01
2PYXA 3KKJA 4H2PA 3REDA 4X9MA 3SFEA 1NHPA 1ZOYA 4IVOB 1GRFA 4PAAA 4H50A 4B68A 3IHMA 2YR5A 2BS4A 4B64A 3D1CA 3GYJA 1DJQA 5CKUA 3GD4A 1TDFA 3CN8A 3UKPA 1GERA 3LZWA 3QVPA 4O5UA 1H81A 4A79A 4BJZA 1PJ6A 3NYCA 4Z25A 3DK8A 1PHHA 4FK1A 4P9SA 3BHKA 1S3EA 4H4SA 3I3LA 3AE5A 1LV0A 5EBKA 1YQ3A 2C65A 2RGOA 4ICYA 1GTEA 2V6OA 4GR1A 4C3XA 4DSGA 4XWZA 3VRAA 4H2RA 2QCUA 1FEAA 2V3BA 1ONFA 2XFNA 2JAEA 1VQWA 3AYIA 3EAOA 4AOXA 1D4DA 4HA6A 3QJ4A 2ACZA 2X8HA 1GOSA 3AE4A 3COXA 1X31B 2X8CA 1TDKA 4EMIA 2YQUA 5FS6A 5C3JA 1CC4A 4Y4NA 3UOVA 3AE7A 4B67A 1OJDA 5DBJA 1O94A 4Z44A 4NTDA 4Z2RA 2YWLA 1P2HA 1RYIA 5EB4A 4JQ9A 4JNQA 2BCGG 4H4ZA 2A87A 3C4AA 4ECHA 1XANA 4AP3A 2FJDA 2WDVA 1PXBA 4K8DA 3UKHA 3K7MX 2TPRA 2WPEA 4JY3A 4XXGA 2GVCA 1AOGA 1PBCA 2GH5A 5L46A 2E1MA 2BCPA 4UP3A 4U8IA 4RG4A 1GRAA 3AEEA 2PHHA 3UKFA 3QFAA 1KFYA 1RP0A 3DJEA 4J31A 1TDOA 1EL8A 2IVDA 2B7SA 4X9NA 1Y56A 2WDRA 5J60A 3BHFA 4U2TA 1IUUA 3C4NA 2X50A 1H83A 1EL7A 3AB1A 1F8WA 3M13A 4LU6A 1EL9A 2XLTA 3OZ2A 1IJHA 4MJWA 3R9UA 5BUKA 2BC1A 1JEHA 1F8RA 2V61A 2GR3A 2XVHA 3GMBA 2E4GA 4EMJA 1XDIA 4WCTA 2WPFA 4B1BA 1MO9A 3CGDA 1M64A 3BNUA 4J34A 4A6NA 4JN9A 2GR1A 4AP1A 3K7QX 1F8SA 1HYUA 2C66A 5JCMA 3II4A 2OLNA 1JNZA 4Z43A 2R4EA 1BF3A 2YLWA 1LJ1A 3AE2A 3ALJA 4Z2UA 2YLRA 5HXIA 3LADA 1H7WA 4UDRA 2GB0A 2X99A 4CRTA 1D5TA 4TM0A 4USQA 2YAUA 2XVJA 4J57A 2B9YA 3SGLA 4C74A 3M12A 3FMWA 1PBBA 2XVEA 3UP4A 3EPTA 2WP9A 2JBVA 3DK9A 1E6EA 2XFUA 3JSKA 1E1LA 4YKFA 2WESA 1LTXR 2I0ZA 3AD8B 2OA1A 1OJAA 2V60A 4LA1A 2WU5A 2BS2A 4XWRA 1Y56B 4U8OA 5IQ1A 2C67A 3CTYA 2YR4A 3DA1A 3KPFA 3K30A 3V3NA 1W4XA 1BGNA 4FK1C 1CJ3A 3DJDA 1NPXA 5JCLA 3GRSA 4J33A 1ZY8A 2ZZBA 2WU2A 4UDQA 4YSZA 5KRQA 2Q0KA 3P9UA 1GSNA 4OPCA 2R0CA 4GDEA 4YT0A 5KVIA 3UTGA 4AOSA 2CULA 4RSLA 4YTPA 3NTAA 2WS3A 2JB2A 5KWFA 3UKKA 3RP7A 2X8GA 1GETA 2FJEA 1NENA 2GR0A 1DODA 1EL5A 1NG4A 2CVJA 1F3PA 3GYIA 5M10A 2JB3A 1PJ5A 2WP5A 3AE8A 1YQZA 2YR6A 1PXCA 1PN0A 3V3OA 4YSXA 4U8NA 3NYFA 1PBFA 1NHSA 4ADWA 2YLZA 4GDPA 2FBWA 1QLBA 3Q6JA 3QSEA 4H4RA 3NNEA 1VRQB 1GEUA 4YSHA 4NEVA 1YQ4A 3G5QA 2B76A 4GF7A 4U8PA 1E39A 1NEKA 3G5SA 2GR2A 4JDRA 2B9XA 4K2XA 1ZMCA 1KSSA 1LQTA 3D8XA 1CJ2A 1GESA 3EANA 5TR3A 5GSNA 2C75A 3GRTA 5ER0A 3H8LA 3DGHA 4EQSA 1JOAA 2WPCA 1CC2A 1GALA 3AXBA 3BI4A 4K5SA 1JRZA 1ZKQA 3CPHG 4JNAA 3AE3A 1IUTA 1P2EA 3NTDA 4Z26A 3DMEA 1FEBA 3ICSA 1ZP0A 3BNMA 2XVIA 1B5QA 1YKJA 1DJNA 1L9CA 2YG6A 2EQ7A 4EIPA 1XHCA 3GMCA 3ICTA 4BK1A 3NYEA 4C3YA 3P4QA 3ATQA 2GQFA 1O5WA 3F8DA 1ZX9A 2WHDA 4Z2TA 1COYA 5HHFA 4Y4MA 4DSHA 5KXJA 3CGCA 1CC6A 1FCDA 3HZLA 1OJCA 2YVGA 1DOEA 2XLRA 1F6MA 1FL2A 4YTNA 3DH9A 3UKLA 1TDNA 2C70A 2YLSA 2GQWA 2BK5A 1O95A 3C96A 4J56A 4TLZA 1H84A 2JKCA 3NHOX 4IVMB 4K22A 2GEWA 4OPGA 1KF6A 2BXRA 1GXFA 1MXTA 3NK2X 5EB5A 1GRBA 4H4WA 2XYOA 3UP5A 3S5WA 4FDCB 2XFPA 1DXLA 3B3RA 3VQRA 1NG3A 2GMHA 2IVEA 4GUVA 3WE0A 5GRTA 1Q9IA 1K0IA 4EQRA 4BURA 4C77A 1CHUA 2ZBWA 3M0OA 1REOA 1DOCA 2JK6A 3QFBA 1TDEA 2AAQA 1BWCA 1QJDA 1CF3A 1K4QA 1M6IA 1CJCA 3ABVA 3P4RA 4BK3A 3GWFA 5BRTA 5U1OA 2C7GA 1Q1RA 2IIDA 2YLXA 3AEFA 2TMDA 2R45A 3L1RA 3ITJA 5CQFA 1VDCA 1LPFA 1GV4A 4M52A 2EQ6A 2R9ZA 2BK3A 4OPDA 2OALA 1OJ9A 2RGJA 2YG7A 2YLTA 4EMWA 2XFQA 3GWDA 3PO7A 1D4EA 5KVHA 3AEDA 1H7XA 1V59A 1ZK7A 3DJJA 2GRTA 2H88A 3PVCA 5BULA 4B63A 4CCQA 2GAHB 2XVFA 2GF3A 3DGZA 3FPZA 5BVAA 1S2QA 2GMJA 2VVLG 2ZZ0A 2Y6QA 3P1WA 4NZHA 2XFOA 3AYJA 4GCMA 2BA9A 1FOHA 4HB9A 2C73A 3ADAB 3NN6X 4NEWA 3AEGA 3FBSA 5JCKA 2WP6A 4TLXA 1H6VA 3LB8A 3GSIA 4CY6A 1FECA 2YG5A 3I6DA 3CNDA 2UZZA 4U2LA 4IA6A 1OJTA 1JNRA 3P4PA 2R0PA 4LIIA 3ATRA 2BABA 1PBDA 3AEAA 3AEBA 3BI5A 5FS7A 1B8SA 1E1KA 3NT6A 2RABA 4EQXA 2C3DA 4B66A 1TRBA 3KU9A 4A99A 3DK4A 4GRTA 2ARDA 2Z5YA 2V5ZA 4J36A 4OPUA 3RP8A 1IUWA 1D4CA 2XCGA 3CGEA 3IHGA 4DNAA 2WOWA 2VRLA 4H2NA 4H2QA 3EF6A 4H4UA 1N4UA 1VG9A 2A8XA 4TM1A 4U8MA 1TYTA 3S61A 3GDNA 1IUSA 3URHA 3NG7X 4AT2A 1RSGA 4CNJA 4TM3A 4CBQA 3KVEA 4U2SA 3VRDB 2QA2A 3RP6A 3VR8A 4OCGA 4IA5A 3AWIA 1PJ7A 3FG2P 2Y6RA 2HQMA 1N4VA 2WEUA 4OPLA 2F5ZA 1H82A 1EBDA 2Q7VA 2VVMA 1N4WA 1MOKA 4A5LA 1NAAA 2CDUA 5HYMA 1GRTA 2DKHA 2XLUA 4H4XA 2NVKX 4H4TA 1CBOA 3CPJG 2W0HA 1LQUA 4B69A 3AE6A 4A65A 1PDHA 3SQPA 1IUXA 5J7XA 3QVRA 1B4VA 2BC0A 2XLSA 1KSUA 3O0HA 4K7ZA 4ZCCA 1XPQA 1ZMDA 4IV9A 4RG3A 1N1PA 2YG3A 3L8KA 4A9WA 1K0JA 3LJPA 1CL0A 2EQ8A 4B65A 2Z5XA 3CNPA 3LOVA 1TYPA 3SM8A 3IC9A 3OC4A 1PXAA 4OPIA 1GRHA 4USRA 2OLOA 5FS9A 3UOZA 4A6NB 1JU2A 2WQYA 4FX9A 3NK0X 3FIMB 4EM4A 4Y4LA 1K0LA 2WOVA 2O9ZA 3CIRA 4NTCA 1B37A 4YWOA 2J3NA 3NKSA 3AYLA 3F8RA 2GAGB 1CJ4A 2VQBA 5KOWA 1GT8A 4K5RA 1DNCA 4KPRA 1YY5A 3ZDNA 4CCRA 2OAMA 3KLJA 2YVFA 1GNDA 2C3CA 3GDPA 3B6DA 4YKGA 2JB1A 4J2WA 1LVLA 1DOBA 3ALMA 1IUVA 1BKWA 1L0VA 5HY5A 3CNSA 2Q0LA 1E1MA 2B7RA 4EIQA 2ZZCA 4EQWA 1L9DA 1E7PA 2FJBA 5JCIA 3F8PA 1ZDLA 3ICRA 1D7LA 2WETA 4H4VA 3KD9A 2C76A 2H89A 3NIXA 3RNMA 1ELIA 3K7TA 4NTEA 3UKAA 4BV6A 2BYBA 3NRNA 3DJGX 3VR9A 5U25A 3NN0X 1GTHA 2YVJA 2QAEA 1Z6LA 2WOIA 1KNRA 2YM1A 5FS8A 2APGA 1H86A 4N9XA 2FJAA 4I58A 1QO8A 4PABA 2QA1A 5KOXA 2WDQA 4H4PA 3H8IA 5IPYA 3CNTA 4CNKA 1VG0A 1ZOVA 5C2TA 1GRGA 3RHAA 4E0VA 3NLCA 3CPIG 4DGKA 2BACA 1GREA 3NK1X 3E1TA 3AECA 2BXSA 2WBAA 2C72A 3NH3X 1KDGA 4JY2A 5M0ZA 3LXDA 5JCNA 5IQ4A 1BGJA 2A89A 4TM4A 4H4YA 4I59A 2BS3A 1Q1WA 4UDPA 1UKVG 4OPTA 4U8LA 4A7AA 1S2YA 3AD7B 2V3AA 3IF9A 3ISHA 3UTEA 1S3BA 3LZXA 3NGCX 1SEZA 4O5QA 2VRMA 4WX1A 2DKIA 3P4SA 5EOWA 2X3NA 3VRBA 4APNA 3V76A 4EM3A 1E1NA 2VZ2A 3UOYA 1PS9A 3Q9TA 3H4KA 4U8KA 1JRYA 2BK4A 3UOXA 3UTFA 2NPXA 3ZYXA 4U8JA 4X4JA 3CGBA 4BK2A 3UTHA 3KA7A 5LV9A 2VQ7A 4AT0A 1NHRA 1JRXA 3CNJA 4BJYA 2YG4A 4REKA 4CY8A 2XLPA 1BZLA 2VOUA 3QSMA 2R4JA 4OVIA 4Z24A 4D03A 3T37A 2AQJA 2E5VA 2GV8A 2B9WA 2R46A 3AD9B 5FMHA 3BI2A 5U63A 3SFDA 4C5OA 3G5RA 4H7UA 3UKQA 3QSSA 1L9EA 4YTMA 1D7YA 3UCLA 4KX6A 2Q6UA 2RGHA 3PS9A 1NHQA 3GD3A 1Y0PA 2XDOA 2YM2A 3ALLA 1KNPA 4YXDA 1NDAA 2R0GA 3AE1A 3IWAA 4D04A 1PBEA 2CFYA 1GPEA 2VVLA 2EQ9A 4H4QA 2C64A 4YSYA 4ZCDA 2AR8A 3AE9A 4ZN0A
chains in the Genus database with same CATH superfamily
3REDA 1ZOYA 1GRFA 4MKSA 1TDFA 3UKPA 3ZLHA 2FYMA 4O5UA 4A3RA 3BHKA 4H4SA 4G73A 2C65A 2RGOA 3DDMA 4DSGA 4XWZA 3VRAA 4H2RA 3AYIA 4AOXA 2JAEA 4G6HA 3KPKA 3QJ4A 1DTNA 2QVHA 5ENLA 3GYXA 2YQUA 3AE7A 4Z2RA 1RYIA 2BCGG 2A87A 3C4AA 2TPRA 3B97A 4YWSA 1AOGA 1PBCA 4RG4A 2PHHA 1KFYA 1TDOA 1N5XA 4GMEA 2WDRA 4U2TA 1IUUA 3L5OA 1H83A 4LU6A 2XLTA 3OZ2A 1IJHA 4MJWA 1JEHA 4EMJA 1XDIA 3NVZB 3BNUA 3CGDA 2GR1A 1HYUA 4Z43A 4JHMA 3AE2A 2YLRA 4CRTA 4TM0A 4USQA 2XVJA 2AL2A 2B9YA 3SGLA 3HRDC 1WUEA 3FMWA 3EPTA 2XFUA 1E1LA 1N63C 2OA1A 1FFVC 2V60A 3D47A 2WU5A 2BS2A 4XWRA 1N61C 1W4XA 1CJ3A 1NPXA 5JCLA 2PS2A 1ZY8A 4YSZA 1GSNA 1JCTA 5KVIA 4RSLA 3NTAA 3UKKA 2X8GA 1GETA 2GR0A 3P93A 5M10A 2JB3A 3TCSA 1N5WC 2PP1A 4U8NA 4TVYA 3Q4DA 3Q6JA 3QSEA 1VRQB 1JRPA 3G5QA 4E5TA 1KSSA 3DGBA 2C75A 3DGHA 4EQSA 1JOAA 1GALA 3R10A 3CPHG 3AE3A 1IUTA 3NTDA 5KNLA 3EUB3 2XVIA 1YKJA 1L9CA 4EIPA 4GAPA 1XHCA 3ICTA 2GQFA 3F8DA 2OPJA 4DSHA 5KXJA 1JROA 3HZLA 1FL2A 1O95A 2GEWA 2W54A 2XYOA 3UP5A 3S5WA 4FDCB 3B3RA 1NG3A 2PTYA 3WE0A 5IDZA 1Q9IA 5EU9A 3M0OA 4IP4A 3QFBA 1M6IA 1CJCA 2OG9A 3GWFA 2OQHA 2IIDA 3SZ0A 2R45A 5CQFA 1VDCA 1GV4A 2R9ZA 3D9XA 4EMWA 3TW9A 1ZK7A 2H88A 2W3RA 4B63A 2XVFA 2GF3A 2VVLG 2ZZ0A 1SJDA 5FJTA 3N6HA 3P1WA 1EC7A 4A6GA 2XFOA 3UJSA 3RCYA 4HB9A 7ENLA 3ADAB 3UJ2A 2WP6A 4TLXA 3GSIA 3I6DA 2UZZA 4IA6A 2PTZA 4GGHA 2GL5A 1BQGA 2C3DA 3DFYA 3DK4A 2ARDA 1IUWA 4H19A 3CGEA 4H2NA 3UJRA 4GISA 4H4UA 2A8XA 2CHRA 1P43A 1IUSA 3URHA 4G8TA 3SY4A 4TM3A 2E5AA 2QA2A 3VR8A 3FG2P 3UGVA 3DFHA 3RRAA 2GSHA 2F5ZA 1H82A 2VVMA 1NAAA 1GRTA 4H4TA 2W0HA 4X2PA 4ZA0A 1IUXA 2PGEA 4ZCCA 3O0HA 4K7ZA 3PG6A 1K0JA 3LJPA 2PCEA 2EQ8A 4B65A 2Z5XA 3CNPA 4KWSA 4NWZA 2OLOA 5FS9A 1JU2A 3NK0X 4Y4LA 2WOVA 4GFIA 1B37A 2GGEA 3HYXA 4FI4A 1GT8A 4K5RA 1GNDA 1P48A 3B6DA 3DEQA 1IUVA 1BKWA 5HY5A 1E1MA 3IK4A 5KMRA 2P88A 2ZZCA 1ZDLA 2HXUA 3KD9A 2C76A 4NTEA 4BV6A 3NN0X 2FJAA 4G9KA 3CB3A 2RDXA 2WDQA 2OLAA 2QGYA 4HCHA 1XS2A 1VG0A 3RHAA 3NK1X 3E1TA 4IL2A 3NH3X 5M0ZA 2A89A 4A7AA 1Q1WA 1UKVG 2GDQA 1S2YA 3FXGA 3UTEA 3ISHA 1SEZA 2DKIA 3UOYA 3Q9TA 3UOXA 1R6WA 3SJNA 2BRAA 4MGGA 3CGBA 3MY9A 4CY8A 2YG4A 5FJUA 2R4JA 5FMHA 5U63A 4C5OA 3G5RA 4H7UA 4H1ZA 3QSSA 3QPEA 3UCLA 1KKRA 3AE1A 3NFUA 4D04A 2EQ9A 4H4QA 4ZCDA 3AE9A 5KMQA 2PYXA 3KKJA 2DW6A 4X9MA 3UXLA 4PAAA 3IHMA 2YR5A 3GYJA 3SZWA 4A79A 4BJZA 3NYCA 4Z25A 2OX4A 4FK1A 1S3EA 3I3LA 3GO2A 3AMZA 3AE5A 2V6OA 4GR1A 2QCUA 1FEAA 2V3BA 2XFNA 3PFRA 3RO6A 3SSZA 5KMPA 1X31B 2X8CA 5C3JA 4K1WA 2YWLA 5EB4A 4JNQA 2XH0A 4ECHA 3HYVA 2WDVA 1PXBA 2WPEA 3PWGA 3QLDA 3T0KA 2GH5A 5L46A 2E1MA 1GRAA 2IVDA 2B7SA 5J60A 3BHFA 2X50A 5BUKA 2V61A 2OQYA 2POZA 1M64A 4J34A 3K7QX 2C66A 1E9IA 2OLNA 1JNZA 1BF3A 3ALJA 5HXIA 2P8BA 3LADA 1H7WA 4UDRA 2X99A 1D5TA 4J57A 1S7MA 3M12A 3UP4A 2WP9A 2JBVA 1E6EA 2WESA 3AD8B 4DHGA 1JPMA 4LA1A 3OW1A 4U8OA 3FV9A 2OKTA 2BRYA 2GGHA 3K30A 1KKOA 3DJDA 3R0KA 4J33A 2PTXA 2WU2A 4UDQA 5KRQA 3P9UA 4OPCA 3UTGA 4YTPA 3D46A 2JB2A 3RP7A 1NENA 4MMWA 1PJ5A 1IYXA 3V3OA 2XH2A 4ADWA 4GDPA 2PU0A 4YSHA 4NEVA 4U8PA 2GGIA 1EBHA 3A7UA 3T8QA 2MUCA 3CMMA 1ZKQA 3HW2A 4H83A 4JNAA 1P2EA 3SQSA 3ICSA 3NS1B 2ZC8A 2EQ7A 3P4QA 3TTEA 3ATQA 2GGGA 4J1OA 2WHDA 4Z2TA 5HHFA 3MZNA 3T2ZA 2PPGA 4Y4MA 1EC9A 3T4WA 1CC6A 1FCDA 1OJCA 2YVGA 3UXKA 3GC2A 3SBFA 4EWJA 2C70A 2GQWA 2HNEA 3A7RA 3MUCA 4TLZA 3NHOX 4K22A 4IT1A 2BXRA 1GXFA 4H4WA 2GMHA 2PSNA 4GUVA 1K0IA 4KPLA 1CHUA 2ZBWA 3OZMA 1REOA 3TOYA 3CT2A 2JK6A 2XH7A 1QJDA 1FFUC 1CF3A 3ABVA 4BK3A 1NELA 3THUA 2TMDA 3N4FA 3L1RA 4OPDA 2BK3A 2HZGA 4TVWA 2YLTA 3CYJA 1V59A 2QDDA 3DJJA 3RR1A 4CCQA 2GAHB 4Z17A 1S2QA 3CXBA 2Y6QA 3ENLA 1KCZA 3NN6X 4NEWA 3AEGA 3FBSA 2DW7A 4IZGA 1FECA 3QN3A 3CNDA 3R07C 4U2LA 1JNRA 3AEAA 1B8SA 3NT6A 2RABA 3VA8A 4M6UA 2XCGA 4DNAA 1RM6B 2VRLA 4H2QA 3Q45A 3T14A 1TYTA 4G7FA 4AT2A 4CNJA 3VRDB 3KUMA 3RP6A 1PJ7A 4OPLA 1MOKA 3SZCA 4A5LA 4H4XA 1CBOA 1LQUA 4A65A 3VCNA 3QVRA 2BC0A 1X2GA 3OTRA 3OC4A 1PXAA 4USRA 3UOZA 4A6NB 1OEPA 1K0LA 2O9ZA 4NTCA 1BKHA 1FHUA 1CJ4A 2OAMA 2C3CA 3B9JB 1MNSA 3ALMA 1TKKA 2Q0LA 4EIQA 4KT2A 2FJBA 4DXKA 3T2KA 3T2YA 3NIXA 1XPYA 3VR9A 1Z6LA 5G5HB 2APGA 3SN4A 4DYEA 4H4PA 2C4CA 3SZFA 2MNRA 1ZOVA 3NLCA 1GREA 3VDGA 1SJAA 2PODA 2WBAA 1KDGA 5JRBA 1X2HA 5IQ4A 1BGJA 2PTWA 4TM4A 4H4YA 2BS3A 4UDPA 4U8LA 2I5QA 3AD7B 5BOEA 1S3BA 3LZXA 1N62C 3NGCX 4O5QA 4WX1A 4NNJA 3BOXA 4EM3A 1E1NA 2VZ2A 1PS9A 3RGTA 3R0UA 4U8JA 3TJIA 3KA7A 2VQ7A 1NHRA 3CNJA 2XLPA 1BZLA 4E4FA 2VOUA 3EKGA 4E8GA 4OVIA 4D03A 2AQJA 2R46A 3AM9A 2P3ZA 2HXTA 1L9EA 1D7YA 1PDYA 4II2A 4KX6A 2Q6UA 3HPFA 1NHQA 1Y0PA 2XDOA 3NZGA 2AR8A 3NXLA 5J04A 3SFEA 4IVOB 4IL0A 4ENLA 2BS4A 4B64A 3D1CA 5CKUA 3GD4A 1GERA 3DESA 3BJSA 2W55A 3DK8A 4P9SA 3RITA 3NRZB 2QJJA 3OZYA 1LV0A 4ICYA 1GTEA 4C3XA 3A7AA 4E6MA 1ONFA 1VQWA 3EAOA 3NO1A 1D4DA 2X8HA 3AE4A 4EMIA 2OZ8A 3UOVA 4B67A 5DBJA 1O94A 4Z44A 4NTDA 1P2HA 4JQ9A 2OFJA 4K8DA 3K7MX 4JY3A 4XXGA 3AN1A 4UP3A 3QFAA 3DJEA 1EL8A 4X9NA 1Y56A 1EL7A 2OZ3A 3SN0A 3M13A 1T3QC 4F4RA 3R9UA 2BC1A 2XVHA 2GR3A 3GMBA 2E4GA 4WCTA 2WPFA 4B1BA 1MO9A 5KMSA 2ZADA 4A6NA 1F9CA 4AP1A 4HPNA 3FVDA 5JCMA 3T6CA 1LJ1A 3MKCA 4Z2UA 3QTPA 2GB0A 2YAUA 4ZCWA 3HYWA 4C74A 1PBBA 2XVEA 3H12A 4YKFA 2XGZA 2I0ZA 2PP0A 1OJAA 2XSXA 5IQ1A 2W3SA 2C67A 3CTYA 3K1GA 4FK1C 3GRSA 4GDEA 4AOSA 2CULA 5KWFA 3ZLGA 3GYIA 1NG4A 3UCDA 1F3PA 3N6JA 1RVKA 1YQZA 4YSXA 2YLZA 2OZTA 1QLBA 3SN1A 2O56A 1YQ4A 2B76A 5FJOA 3G5SA 2B9XA 1ZMCA 3DG7A 1CJ2A 1GESA 3EANA 5GSNA 3GRTA 5ER0A 3H8LA 5FJPA 4HNLA 1JRZA 3DMEA 1FEBA 1TE6A 1DJNA 3IJLA 3GMCA 1MRAA 3NYEA 2FKPA 3JW7A 1ZX9A 3DERA 3H70A 3T9PA 1DOEA 4YTNA 1TDNA 3C96A 4IVMB 4J3ZA 1MXTA 1GRBA 3VQRA 4GGBA 3NVWB 5GRTA 4EQRA 4BURA 4C77A 1DOCA 1TDEA 2AAQA 1BWCA 1K4QA 2ONEA 3GY1A 2C7GA 1Q1RA 2YLXA 3AEFA 3ITJA 4M52A 2EQ6A 4H2HA 1OJ9A 2OALA 2RGJA 2XFQA 4K8GA 3PO7A 4KEMA 1H7XA 2GRTA 5BULA 1VDVA 3FPZA 4NZHA 2BA9A 1FOHA 2C73A 3R1ZA 3DG3A 4CY6A 1H6VA 2YG5A 1OJTA 2R0PA 1PBDA 3AEBA 1E1KA 3DG6A 4FP1A 4EQXA 3ES7A 3S47A 3KU9A 3VFCA 4A99A 4GRTA 2Z5YA 4OPUA 4J36A 3RP8A 3IHGA 3U9IA 1VG9A 1N4UA 4U8MA 2QJNA 3S61A 1MDLA 3NG7X 4CBQA 3KVEA 4OCGA 3AWIA 2Y6RA 2HQMA 1N4VA 2WEUA 2CDUA 2XLUA 3CPJG 2PU1A 3AE6A 3SQPA 1TZZA 2XLSA 1XPQA 4IV9A 1EBGA 1N1PA 3H8AA 1TYPA 3QKEA 4A35A 4JN7A 3SM8A 4ROPA 4FX9A 3NVYB 4DX3A 3CIRA 3TQPA 4YWOA 2J3NA 3T31A 3NKSA 3F8RA 1JDFA 2VQBA 1DNCA 3ZDNA 4CCRA 3MQTA 1WYGA 2JB1A 4J2WA 3OP2A 3ZLFA 3CNSA 3ICRA 2WETA 4H4VA 3PWIA 2H89A 3FJ4A 3K7TA 3UKAA 3NRNA 2QAEA 3ZVIA 2OVLA 2WOIA 2YM1A 4N9XA 3N4EA 1QO8A 4PABA 5KOXA 3JZUA 3H8IA 4IHCA 2BACA 2AKZA 2BXSA 5JCNA 4OPTA 2V3AA 3IF9A 2VRMA 3P4SA 3VRBA 2X3NA 5EOWA 4APNA 3V76A 1KD0A 3H4KA 4U8KA 3UTFA 2NPXA 3VC6A 4BK2A 3UTHA 2PA6A 4BJYA 1PDZA 1R0MA 2GV8A 2B9WA 3SXIA 3SFDA 3UKQA 4YTMA 2AKMA 2R0GA 1GPEA 1PBEA 1ELSA 4DWDA 4ZN0A 2GGJA 4H2PA 3U4FA 4M0XA 1NHPA 4H50A 4B68A 4G74A 2PMQA 1DJQA 4GYPC 3CN8A 3LZWA 3QVPA 1H81A 1PJ6A 3FYYA 1PHHA 4HCDA 2P0IA 5EBKA 1YQ3A 2QDEA 2NQLA 4HA6A 2ACZA 1GOSA 3COXA 1TDKA 3UJFA 5FS6A 1CC4A 4Y4NA 3IJQA 1OJDA 3SX6A 4H4ZA 5FJRA 1XANA 4AP3A 4HYRA 2FJDA 4K2SA 1ECQA 3UKHA 2GVCA 4Z1YA 2BCPA 4U8IA 3AEEA 3UKFA 1RP0A 4J31A 3FCPA 5G5GB 3EEZA 3C4NA 2AL2B 3ZVHA 3AB1A 1F8WA 1FO4A 1EL9A 1F8RA 3V5FA 4JN9A 1F8SA 1SJCA 3II4A 2R4EA 2YLWA 3UCCA 3V5CA 3S5SA 3DK9A 3JSKA 1LTXR 1VQZA 1Y56B 2YR4A 3DA1A 3KPFA 3V3NA 1BGNA 4GYPA 2ZZBA 2Q0KA 2R0CA 4YT0A 3I6TA 2WS3A 1EC8A 2FJEA 1EL5A 1DODA 2CVJA 2WP5A 3AE8A 2YR6A 1PXCA 1PN0A 3NYFA 4HN8A 1PBFA 1NHSA 1MUCA 2FBWA 3P0WA 3I6EA 4H4RA 3NNEA 1GEUA 4GF7A 1E39A 1NEKA 2GR2A 4JDRA 4K2XA 1LQTA 3D8XA 5TR3A 3AXBA 2WPCA 1CC2A 3BI4A 4K5SA 4Z26A 3ZVHB 1ZP0A 3V4BA 3BNMA 3CK5A 1B5QA 3STPA 2YG6A 3CXOA 4BK1A 4C3YA 1YEYA 1O5WA 3BSMA 1COYA 3CGCA 3SR6B 2XLRA 1F6MA 3DH9A 3UKLA 2YLSA 2BK5A 4J56A 1H84A 2JKCA 4G6GA 4OPGA 1KF6A 3NK2X 5EB5A 2AL1A 2XFPA 1DXLA 3V3WA 2IVEA 3OPSA 3P4RA 3NVVB 5BRTA 5U1OA 3JVAA 1LPFA 3GWDA 2YG7A 1D4EA 5KVHA 3AEDA 3UJEA 3PVCA 3PK7A 3DGZA 5BVAA 2GMJA 3R25A 6ENLA 4GCMA 3AYJA 3CAWA 3H7VA 2QJMA 5JCKA 3LB8A 1N60C 3P4PA 3ATRA 4LIIA 2BABA 1FHVA 3BI5A 5FS7A 3ES8A 1MDRA 4JN8A 1TRBA 2OO6A 2PP3A 2V5ZA 1D4CA 1SJBA 2WOWA 3EF6A 4TM1A 1H2IA 3TWBA 3GDNA 1RSGA 3GD6A 4U2SA 1NU5A 1FIQB 4IA5A 1ZXIC 2Q7VA 1EBDA 1N4WA 5HYMA 2DKHA 2NVKX 1ONEA 4B69A 1PDHA 5J7XA 1B4VA 1KSUA 4HNCA 1ZMDA 4RG3A 3DIPA 2YG3A 3L8KA 4A9WA 1CL0A 3LOVA 3IC9A 1V97A 4OPIA 1GRHA 3TJ4A 2WQYA 3FIMB 4EM4A 4DN1A 3AYLA 2GAGB 5KOWA 3VC5A 4KPRA 1YY5A 3KLJA 2YVFA 3GDPA 3MWCA 3TWAA 4II3A 4YKGA 1LVLA 1DOBA 1L0VA 2P8CA 2B7RA 4ZOHB 4EQWA 1L9DA 4HCLA 1E7PA 5JCIA 3F8PA 1D7LA 3ETRB 1SB3B 3RNMA 1ELIA 5BOFA 4E4UA 2BYBA 1STZA 3DJGX 5U25A 1GTHA 2YVJA 1KNRA 5FS8A 1H86A 4I58A 2QA1A 5IPYA 1L8PA 3CNTA 4CNKA 1W6TA 5C2TA 1GRGA 4E0VA 3CPIG 4DGKA 3AECA 2C72A 3I4KA 4JY2A 3LXDA 1KN0A 4I59A 3VCCA 2E3TA 1JPDX 4GIRA 4IP5A 1JRYA 2BK4A 3ZYXA 4X4JA 3MSYA 1WUFA 3SYIA 5LV9A 4AT0A 1JRXA 4GAVA 4REKA 3QSMA 3P3BA 4Z24A 3T37A 2E5VA 3AD9B 3BI2A 2PGWA 2XH4A 3R11A 3PS9A 2RGHA 3GD3A 2YM2A 3ALLA 4YXDA 3IJIA 1KNPA 1NDAA 3IWAA 2CFYA 2VVLA 2C64A 4YSYA 4B66A 2QQ6A
chains in the Genus database with same CATH topology
2PYXA 3KKJA 4H2PA 3REDA 4X9MA 3SFEA 1NHPA 1ZOYA 4IVOB 1GRFA 4PAAA 4H50A 4B68A 3IHMA 2YR5A 2BS4A 4B64A 3D1CA 4G74A 3GYJA 3SZWA 1DJQA 5CKUA 3GD4A 1TDFA 3CN8A 3UKPA 1GERA 3LZWA 3QVPA 4O5UA 1H81A 4A79A 4BJZA 1PJ6A 3NYCA 4Z25A 3DK8A 1PHHA 4FK1A 4P9SA 3BHKA 1S3EA 4H4SA 3I3LA 4G73A 3AE5A 1LV0A 5EBKA 1YQ3A 2C65A 2RGOA 4ICYA 1GTEA 2V6OA 4GR1A 4C3XA 4DSGA 4XWZA 3VRAA 4H2RA 2QCUA 1FEAA 2V3BA 1ONFA 2XFNA 2JAEA 1VQWA 3AYIA 3EAOA 4AOXA 4G6HA 1D4DA 3KPKA 3QJ4A 2ACZA 4HA6A 2X8HA 1GOSA 3AE4A 3COXA 5KMPA 1X31B 2X8CA 1TDKA 3GYXA 4EMIA 2YQUA 5FS6A 5C3JA 1CC4A 4Y4NA 3UOVA 3AE7A 4B67A 1OJDA 5DBJA 3SX6A 1O94A 4Z44A 4NTDA 4Z2RA 2YWLA 1P2HA 1RYIA 5EB4A 4JQ9A 4JNQA 2BCGG 4H4ZA 2A87A 3C4AA 4ECHA 1XANA 4AP3A 2FJDA 3HYVA 2WDVA 1PXBA 4K8DA 3UKHA 3K7MX 2TPRA 2WPEA 4JY3A 4XXGA 2GVCA 1AOGA 3T0KA 1PBCA 2GH5A 5L46A 2E1MA 2BCPA 4UP3A 4U8IA 4RG4A 1GRAA 3AEEA 2PHHA 3UKFA 3QFAA 1KFYA 1RP0A 3DJEA 4J31A 1TDOA 1EL8A 2IVDA 2B7SA 4X9NA 1Y56A 2WDRA 5J60A 3BHFA 4U2TA 1IUUA 3C4NA 3L5OA 2X50A 1H83A 1EL7A 3AB1A 1F8WA 3M13A 4LU6A 1EL9A 2XLTA 3OZ2A 1IJHA 4MJWA 3R9UA 5BUKA 2BC1A 1JEHA 1F8RA 2V61A 2GR3A 2XVHA 3GMBA 2E4GA 4EMJA 1XDIA 4WCTA 2WPFA 4B1BA 1MO9A 3CGDA 1M64A 3BNUA 4J34A 4A6NA 5KMSA 4JN9A 2GR1A 4AP1A 3K7QX 1F8SA 1HYUA 2C66A 5JCMA 3II4A 2OLNA 1JNZA 4Z43A 2R4EA 1BF3A 2YLWA 1LJ1A 3AE2A 3ALJA 4Z2UA 2YLRA 5HXIA 3LADA 1H7WA 4UDRA 2GB0A 2X99A 4CRTA 1D5TA 4TM0A 4USQA 2YAUA 2XVJA 3HYWA 4J57A 1S7MA 2B9YA 3SGLA 4C74A 3M12A 3FMWA 1PBBA 2XVEA 3UP4A 3EPTA 2WP9A 2JBVA 3DK9A 1E6EA 2XFUA 3JSKA 1E1LA 4YKFA 2WESA 1LTXR 2I0ZA 3AD8B 2OA1A 1OJAA 2V60A 4LA1A 2WU5A 2BS2A 4XWRA 1Y56B 4U8OA 5IQ1A 2BRYA 2C67A 3CTYA 2YR4A 3DA1A 3KPFA 3K30A 3V3NA 1W4XA 1BGNA 4FK1C 1CJ3A 3DJDA 1NPXA 5JCLA 3GRSA 4J33A 1ZY8A 2ZZBA 2WU2A 4UDQA 4YSZA 5KRQA 2Q0KA 3P9UA 1GSNA 4OPCA 2R0CA 4GDEA 4YT0A 5KVIA 3UTGA 4AOSA 2CULA 4RSLA 4YTPA 3NTAA 2WS3A 2JB2A 5KWFA 3UKKA 3RP7A 2X8GA 1GETA 2FJEA 1NENA 2GR0A 1DODA 1EL5A 1NG4A 2CVJA 1F3PA 3GYIA 5M10A 2JB3A 1PJ5A 2WP5A 3AE8A 1YQZA 2YR6A 1PXCA 1PN0A 3V3OA 4YSXA 4U8NA 3NYFA 1PBFA 1NHSA 4ADWA 2YLZA 4GDPA 2FBWA 1QLBA 3Q6JA 3QSEA 4H4RA 3NNEA 1VRQB 1GEUA 4YSHA 4NEVA 1YQ4A 3G5QA 2B76A 4GF7A 4U8PA 1E39A 1NEKA 3G5SA 2GR2A 4JDRA 2B9XA 4K2XA 1ZMCA 1KSSA 1LQTA 3D8XA 1CJ2A 1GESA 3EANA 5TR3A 5GSNA 2C75A 3GRTA 5ER0A 3H8LA 3DGHA 4EQSA 1JOAA 2WPCA 1CC2A 1GALA 3AXBA 3BI4A 3CMMA 4K5SA 1JRZA 1ZKQA 3CPHG 4JNAA 3AE3A 1IUTA 1P2EA 3NTDA 4Z26A 3DMEA 1FEBA 3ICSA 5KNLA 1ZP0A 3BNMA 2XVIA 1B5QA 1YKJA 1DJNA 1L9CA 2YG6A 2EQ7A 4GAPA 4EIPA 1XHCA 3GMCA 3ICTA 4BK1A 3NYEA 4C3YA 3P4QA 3ATQA 2GQFA 1O5WA 3F8DA 1ZX9A 2WHDA 4Z2TA 1COYA 5HHFA 3T2ZA 4Y4MA 4DSHA 5KXJA 3CGCA 1CC6A 1FCDA 3HZLA 1OJCA 2YVGA 1DOEA 2XLRA 1F6MA 1FL2A 4YTNA 3DH9A 3UKLA 1TDNA 2C70A 2YLSA 2GQWA 2BK5A 1O95A 3C96A 4J56A 4TLZA 1H84A 2JKCA 3NHOX 4IVMB 4K22A 2GEWA 4G6GA 4OPGA 1KF6A 2BXRA 1GXFA 1MXTA 3NK2X 5EB5A 1GRBA 4H4WA 2XYOA 3UP5A 3S5WA 4FDCB 2XFPA 1DXLA 3B3RA 3VQRA 1NG3A 2GMHA 2IVEA 4GUVA 3WE0A 5GRTA 1Q9IA 1K0IA 4EQRA 4BURA 4C77A 1CHUA 2ZBWA 3M0OA 1REOA 1DOCA 2JK6A 3QFBA 1TDEA 2AAQA 1BWCA 1QJDA 1CF3A 1K4QA 1M6IA 1CJCA 3ABVA 3P4RA 4BK3A 3GWFA 5BRTA 5U1OA 2C7GA 1Q1RA 2IIDA 2YLXA 3SZ0A 3AEFA 2TMDA 2R45A 3L1RA 3ITJA 5CQFA 1VDCA 1LPFA 1GV4A 4M52A 2EQ6A 2R9ZA 2BK3A 4OPDA 3D9XA 1OJ9A 2OALA 2RGJA 2YG7A 4EMWA 2XFQA 2YLTA 3GWDA 3PO7A 1D4EA 5KVHA 3AEDA 1H7XA 1V59A 1ZK7A 3DJJA 2GRTA 2H88A 3PVCA 5BULA 4B63A 4CCQA 2GAHB 2XVFA 2GF3A 3DGZA 3FPZA 5BVAA 1S2QA 2GMJA 2VVLG 2ZZ0A 2Y6QA 3P1WA 4NZHA 2XFOA 3AYJA 4GCMA 2BA9A 1FOHA 4HB9A 2C73A 3ADAB 3NN6X 4NEWA 3AEGA 3FBSA 5JCKA 2WP6A 4TLXA 1H6VA 3LB8A 3GSIA 4CY6A 1FECA 2YG5A 3I6DA 3CNDA 2UZZA 4U2LA 4IA6A 1OJTA 1JNRA 3P4PA 2R0PA 4LIIA 3ATRA 2BABA 1PBDA 3AEAA 3AEBA 3BI5A 5FS7A 1B8SA 1E1KA 3NT6A 2RABA 4EQXA 2C3DA 4B66A 1TRBA 3KU9A 4A99A 3DK4A 4GRTA 2ARDA 2Z5YA 2V5ZA 4J36A 4OPUA 3RP8A 1IUWA 1D4CA 2XCGA 3CGEA 3IHGA 4DNAA 2WOWA 2VRLA 4H2NA 4H2QA 3EF6A 4H4UA 1N4UA 1VG9A 2A8XA 1H2IA 4TM1A 4U8MA 3T14A 1TYTA 3S61A 3GDNA 1IUSA 3URHA 3NG7X 4AT2A 1RSGA 3SY4A 4CNJA 4TM3A 4CBQA 3KVEA 4U2SA 3VRDB 2QA2A 3RP6A 3VR8A 4OCGA 4IA5A 3AWIA 1PJ7A 3FG2P 2Y6RA 2HQMA 1N4VA 2WEUA 4OPLA 2F5ZA 1H82A 1EBDA 2Q7VA 2VVMA 1N4WA 1MOKA 3SZCA 4A5LA 1NAAA 2CDUA 5HYMA 1GRTA 2DKHA 2XLUA 4H4XA 2NVKX 4H4TA 1CBOA 3CPJG 2W0HA 1LQUA 4B69A 3AE6A 4A65A 1PDHA 3SQPA 1IUXA 5J7XA 3QVRA 1B4VA 2BC0A 2XLSA 1KSUA 3O0HA 4K7ZA 4ZCCA 1XPQA 1ZMDA 4IV9A 4RG3A 1N1PA 2YG3A 3L8KA 4A9WA 3PG6A 1K0JA 3LJPA 1CL0A 2EQ8A 4B65A 2Z5XA 3CNPA 3LOVA 1TYPA 4NWZA 3IC9A 3SM8A 3OC4A 1PXAA 4OPIA 1GRHA 4USRA 2OLOA 5FS9A 3UOZA 4A6NB 1JU2A 2WQYA 4FX9A 3NK0X 3FIMB 4EM4A 4Y4LA 1K0LA 2WOVA 2O9ZA 3CIRA 4NTCA 1B37A 3HYXA 4YWOA 2J3NA 3T31A 3NKSA 3AYLA 3F8RA 2GAGB 1CJ4A 2VQBA 5KOWA 1GT8A 4K5RA 1DNCA 4KPRA 1YY5A 3ZDNA 4CCRA 2OAMA 3KLJA 2YVFA 1GNDA 2C3CA 3GDPA 3B6DA 4II3A 4YKGA 2JB1A 4J2WA 1LVLA 1DOBA 3ALMA 1IUVA 1BKWA 1L0VA 5HY5A 3CNSA 2Q0LA 1E1MA 2B7RA 4EIQA 5KMRA 2ZZCA 4EQWA 1L9DA 1E7PA 2FJBA 5JCIA 3F8PA 1ZDLA 3ICRA 1D7LA 2WETA 3T2KA 4H4VA 3T2YA 3KD9A 2C76A 2H89A 3NIXA 3RNMA 1ELIA 3K7TA 4NTEA 3UKAA 4BV6A 2BYBA 3NRNA 3DJGX 3VR9A 5U25A 3NN0X 1GTHA 2YVJA 2QAEA 1Z6LA 2WOIA 1KNRA 2YM1A 5FS8A 2APGA 1H86A 4N9XA 2FJAA 4G9KA 4I58A 1QO8A 4PABA 2QA1A 5KOXA 2WDQA 4H4PA 3H8IA 2C4CA 5IPYA 3CNTA 3SZFA 4CNKA 1VG0A 1ZOVA 5C2TA 1GRGA 3RHAA 4E0VA 3NLCA 3CPIG 4DGKA 2BACA 1GREA 3NK1X 3E1TA 3AECA 2BXSA 2WBAA 2C72A 3NH3X 1KDGA 4JY2A 5JRBA 5M0ZA 3LXDA 5JCNA 1KN0A 1BGJA 5IQ4A 2A89A 4TM4A 4H4YA 4I59A 2BS3A 1Q1WA 4UDPA 1UKVG 4OPTA 4U8LA 4A7AA 1S2YA 3AD7B 2V3AA 3IF9A 3ISHA 3UTEA 1S3BA 3LZXA 3NGCX 1SEZA 4O5QA 2VRMA 4WX1A 2DKIA 3P4SA 4NNJA 5EOWA 2X3NA 3VRBA 4APNA 3V76A 4EM3A 1E1NA 2VZ2A 3UOYA 1PS9A 3Q9TA 3H4KA 4U8KA 1JRYA 2BK4A 3UOXA 3UTFA 2NPXA 2BRAA 3ZYXA 4U8JA 4X4JA 3CGBA 3SYIA 3UTHA 3KA7A 4BK2A 5LV9A 2VQ7A 4AT0A 1NHRA 1JRXA 3CNJA 4GAVA 4BJYA 2YG4A 4REKA 4CY8A 2XLPA 1BZLA 2VOUA 3QSMA 2R4JA 4OVIA 4Z24A 4D03A 3T37A 2AQJA 2E5VA 2GV8A 4ZN0A 2B9WA 2R46A 3AD9B 5FMHA 3BI2A 5U63A 3SFDA 3SXIA 4C5OA 3G5RA 4H7UA 3UKQA 3QSSA 1L9EA 4YTMA 1D7YA 4II2A 3UCLA 4KX6A 2Q6UA 2RGHA 3PS9A 1NHQA 3GD3A 1Y0PA 2XDOA 2YM2A 3ALLA 1KNPA 4YXDA 1NDAA 2R0GA 3AE1A 3IWAA 4D04A 1PBEA 2CFYA 1GPEA 2VVLA 2EQ9A 4H4QA 2C64A 4YSYA 4ZCDA 2AR8A 3AE9A 5KMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYX A;  3KKJ A;  4H2P A;  3RED A;  4X9M A;  3SFE A;  1NHP A;  1ZOY A;  4IVO B;  1GRF A;  4PAA A;  4H50 A;  4B68 A;  3IHM A;  2YR5 A;  2BS4 A;  4B64 A;  3D1C A;  3GYJ A;  1DJQ A;  5CKU A;  3GD4 A;  1TDF A;  3CN8 A;  3UKP A;  1GER A;  3LZW A;  3QVP A;  4O5U A;  1H81 A;  4A79 A;  4BJZ A;  1PJ6 A;  3NYC A;  4Z25 A;  3DK8 A;  1PHH A;  4FK1 A;  4P9S A;  3BHK A;  1S3E A;  4H4S A;  3I3L A;  3AE5 A;  1LV0 A;  5EBK A;  1YQ3 A;  2C65 A;  2RGO A;  4ICY A;  1GTE A;  2V6O A;  4GR1 A;  4C3X A;  4DSG A;  4XWZ A;  3VRA A;  4H2R A;  2QCU A;  1FEA A;  2V3B A;  1ONF A;  2XFN A;  2JAE A;  1VQW A;  3AYI A;  3EAO A;  4AOX A;  1D4D A;  4HA6 A;  3QJ4 A;  2ACZ A;  2X8H A;  1GOS A;  3AE4 A;  3COX A;  1X31 B;  2X8C A;  1TDK A;  4EMI A;  2YQU A;  5FS6 A;  5C3J A;  1CC4 A;  4Y4N A;  3UOV A;  3AE7 A;  4B67 A;  1OJD A;  5DBJ A;  1O94 A;  4Z44 A;  4NTD A;  4Z2R A;  2YWL A;  1P2H A;  1RYI A;  5EB4 A;  4JQ9 A;  4JNQ A;  2BCG G;  4H4Z A;  2A87 A;  3C4A A;  4ECH A;  1XAN A;  4AP3 A;  2FJD A;  2WDV A;  1PXB A;  4K8D A;  3UKH A;  3K7M X;  2TPR A;  2WPE A;  4JY3 A;  4XXG A;  2GVC A;  1AOG A;  1PBC A;  2GH5 A;  5L46 A;  2E1M A;  2BCP A;  4UP3 A;  4U8I A;  4RG4 A;  1GRA A;  3AEE A;  2PHH A;  3UKF A;  3QFA A;  1KFY A;  1RP0 A;  3DJE A;  4J31 A;  1TDO A;  1EL8 A;  2IVD A;  2B7S A;  4X9N A;  1Y56 A;  2WDR A;  5J60 A;  3BHF A;  4U2T A;  1IUU A;  3C4N A;  2X50 A;  1H83 A;  1EL7 A;  3AB1 A;  1F8W A;  3M13 A;  4LU6 A;  1EL9 A;  2XLT A;  3OZ2 A;  1IJH A;  4MJW A;  3R9U A;  5BUK A;  2BC1 A;  1JEH A;  1F8R A;  2V61 A;  2GR3 A;  2XVH A;  3GMB A;  2E4G A;  4EMJ A;  1XDI A;  4WCT A;  2WPF A;  4B1B A;  1MO9 A;  3CGD A;  1M64 A;  3BNU A;  4J34 A;  4A6N A;  4JN9 A;  2GR1 A;  4AP1 A;  3K7Q X;  1F8S A;  1HYU A;  2C66 A;  5JCM A;  3II4 A;  2OLN A;  1JNZ A;  4Z43 A;  2R4E A;  1BF3 A;  2YLW A;  1LJ1 A;  3AE2 A;  3ALJ A;  4Z2U A;  2YLR A;  5HXI A;  3LAD A;  1H7W A;  4UDR A;  2GB0 A;  2X99 A;  4CRT A;  1D5T A;  4TM0 A;  4USQ A;  2YAU A;  2XVJ A;  4J57 A;  2B9Y A;  3SGL A;  4C74 A;  3M12 A;  3FMW A;  1PBB A;  2XVE A;  3UP4 A;  3EPT A;  2WP9 A;  2JBV A;  3DK9 A;  1E6E A;  2XFU A;  3JSK A;  1E1L A;  4YKF A;  2WES A;  1LTX R;  2I0Z A;  3AD8 B;  2OA1 A;  1OJA A;  2V60 A;  4LA1 A;  2WU5 A;  2BS2 A;  4XWR A;  1Y56 B;  4U8O A;  5IQ1 A;  2C67 A;  3CTY A;  2YR4 A;  3DA1 A;  3KPF A;  3K30 A;  3V3N A;  1W4X A;  1BGN A;  4FK1 C;  1CJ3 A;  3DJD A;  1NPX A;  5JCL A;  3GRS A;  4J33 A;  1ZY8 A;  2ZZB A;  2WU2 A;  4UDQ A;  4YSZ A;  5KRQ A;  2Q0K A;  3P9U A;  1GSN A;  4OPC A;  2R0C A;  4GDE A;  4YT0 A;  5KVI A;  3UTG A;  4AOS A;  2CUL A;  4RSL A;  4YTP A;  3NTA A;  2WS3 A;  2JB2 A;  5KWF A;  3UKK A;  3RP7 A;  2X8G A;  1GET A;  2FJE A;  1NEN A;  2GR0 A;  1DOD A;  1EL5 A;  1NG4 A;  2CVJ A;  1F3P A;  3GYI A;  5M10 A;  2JB3 A;  1PJ5 A;  2WP5 A;  3AE8 A;  1YQZ A;  2YR6 A;  1PXC A;  1PN0 A;  3V3O A;  4YSX A;  4U8N A;  3NYF A;  1PBF A;  1NHS A;  4ADW A;  2YLZ A;  4GDP A;  2FBW A;  1QLB A;  3Q6J A;  3QSE A;  4H4R A;  3NNE A;  1VRQ B;  1GEU A;  4YSH A;  4NEV A;  1YQ4 A;  3G5Q A;  2B76 A;  4GF7 A;  4U8P A;  1E39 A;  1NEK A;  3G5S A;  2GR2 A;  4JDR A;  2B9X A;  4K2X A;  1ZMC A;  1KSS A;  1LQT A;  3D8X A;  1CJ2 A;  1GES A;  3EAN A;  5TR3 A;  5GSN A;  2C75 A;  3GRT A;  5ER0 A;  3H8L A;  3DGH A;  4EQS A;  1JOA A;  2WPC A;  1CC2 A;  1GAL A;  3AXB A;  3BI4 A;  4K5S A;  1JRZ A;  1ZKQ A;  3CPH G;  4JNA A;  3AE3 A;  1IUT A;  1P2E A;  3NTD A;  4Z26 A;  3DME A;  1FEB A;  3ICS A;  1ZP0 A;  3BNM A;  2XVI A;  1B5Q A;  1YKJ A;  1DJN A;  1L9C A;  2YG6 A;  2EQ7 A;  4EIP A;  1XHC A;  3GMC A;  3ICT A;  4BK1 A;  3NYE A;  4C3Y A;  3P4Q A;  3ATQ A;  2GQF A;  1O5W A;  3F8D A;  1ZX9 A;  2WHD A;  4Z2T A;  1COY A;  5HHF A;  4Y4M A;  4DSH A;  5KXJ A;  3CGC A;  1CC6 A;  1FCD A;  3HZL A;  1OJC A;  2YVG A;  1DOE A;  2XLR A;  1F6M A;  1FL2 A;  4YTN A;  3DH9 A;  3UKL A;  1TDN A;  2C70 A;  2YLS A;  2GQW A;  2BK5 A;  1O95 A;  3C96 A;  4J56 A;  4TLZ A;  1H84 A;  2JKC A;  3NHO X;  4IVM B;  4K22 A;  2GEW A;  4OPG A;  1KF6 A;  2BXR A;  1GXF A;  1MXT A;  3NK2 X;  5EB5 A;  1GRB A;  4H4W A;  2XYO A;  3UP5 A;  3S5W A;  4FDC B;  2XFP A;  1DXL A;  3B3R A;  3VQR A;  1NG3 A;  2GMH A;  2IVE A;  4GUV A;  3WE0 A;  5GRT A;  1Q9I A;  1K0I A;  4EQR A;  4BUR A;  4C77 A;  1CHU A;  2ZBW A;  3M0O A;  1REO A;  1DOC A;  2JK6 A;  3QFB A;  1TDE A;  2AAQ A;  1BWC A;  1QJD A;  1CF3 A;  1K4Q A;  1M6I A;  1CJC A;  3ABV A;  3P4R A;  4BK3 A;  3GWF A;  5BRT A;  5U1O A;  2C7G A;  1Q1R A;  2IID A;  2YLX A;  3AEF A;  2TMD A;  2R45 A;  3L1R A;  3ITJ A;  5CQF A;  1VDC A;  1LPF A;  1GV4 A;  4M52 A;  2EQ6 A;  2R9Z A;  2BK3 A;  4OPD A;  2OAL A;  1OJ9 A;  2RGJ A;  2YG7 A;  2YLT A;  4EMW A;  2XFQ A;  3GWD A;  3PO7 A;  1D4E A;  5KVH A;  3AED A;  1H7X A;  1V59 A;  1ZK7 A;  3DJJ A;  2GRT A;  2H88 A;  3PVC A;  5BUL A;  4B63 A;  4CCQ A;  2GAH B;  2XVF A;  2GF3 A;  3DGZ A;  3FPZ A;  5BVA A;  1S2Q A;  2GMJ A;  2VVL G;  2ZZ0 A;  2Y6Q A;  3P1W A;  4NZH A;  2XFO A;  3AYJ A;  4GCM A;  2BA9 A;  1FOH A;  4HB9 A;  2C73 A;  3ADA B;  3NN6 X;  4NEW A;  3AEG A;  3FBS A;  5JCK A;  2WP6 A;  4TLX A;  1H6V A;  3LB8 A;  3GSI A;  4CY6 A;  1FEC A;  2YG5 A;  3I6D A;  3CND A;  2UZZ A;  4U2L A;  4IA6 A;  1OJT A;  1JNR A;  3P4P A;  2R0P A;  4LII A;  3ATR A;  2BAB A;  1PBD A;  3AEA A;  3AEB A;  3BI5 A;  5FS7 A;  1B8S A;  1E1K A;  3NT6 A;  2RAB A;  4EQX A;  2C3D A;  4B66 A;  1TRB A;  3KU9 A;  4A99 A;  3DK4 A;  4GRT A;  2ARD A;  2Z5Y A;  2V5Z A;  4J36 A;  4OPU A;  3RP8 A;  1IUW A;  1D4C A;  2XCG A;  3CGE A;  3IHG A;  4DNA A;  2WOW A;  2VRL A;  4H2N A;  4H2Q A;  3EF6 A;  4H4U A;  1N4U A;  1VG9 A;  2A8X A;  4TM1 A;  4U8M A;  1TYT A;  3S61 A;  3GDN A;  1IUS A;  3URH A;  3NG7 X;  4AT2 A;  1RSG A;  4CNJ A;  4TM3 A;  4CBQ A;  3KVE A;  4U2S A;  3VRD B;  2QA2 A;  3RP6 A;  3VR8 A;  4OCG A;  4IA5 A;  3AWI A;  1PJ7 A;  3FG2 P;  2Y6R A;  2HQM A;  1N4V A;  2WEU A;  4OPL A;  2F5Z A;  1H82 A;  1EBD A;  2Q7V A;  2VVM A;  1N4W A;  1MOK A;  4A5L A;  1NAA A;  2CDU A;  5HYM A;  1GRT A;  2DKH A;  2XLU A;  4H4X A;  2NVK X;  4H4T A;  1CBO A;  3CPJ G;  2W0H A;  1LQU A;  4B69 A;  3AE6 A;  4A65 A;  1PDH A;  3SQP A;  1IUX A;  5J7X A;  3QVR A;  1B4V A;  2BC0 A;  2XLS A;  1KSU A;  3O0H A;  4K7Z A;  4ZCC A;  1XPQ A;  1ZMD A;  4IV9 A;  4RG3 A;  1N1P A;  2YG3 A;  3L8K A;  4A9W A;  1K0J A;  3LJP A;  1CL0 A;  2EQ8 A;  4B65 A;  2Z5X A;  3CNP A;  3LOV A;  1TYP A;  3SM8 A;  3IC9 A;  3OC4 A;  1PXA A;  4OPI A;  1GRH A;  4USR A;  2OLO A;  5FS9 A;  3UOZ A;  4A6N B;  1JU2 A;  2WQY A;  4FX9 A;  3NK0 X;  3FIM B;  4EM4 A;  4Y4L A;  1K0L A;  2WOV A;  2O9Z A;  3CIR A;  4NTC A;  1B37 A;  4YWO A;  2J3N A;  3NKS A;  3AYL A;  3F8R A;  2GAG B;  1CJ4 A;  2VQB A;  5KOW A;  1GT8 A;  4K5R A;  1DNC A;  4KPR A;  1YY5 A;  3ZDN A;  4CCR A;  2OAM A;  3KLJ A;  2YVF A;  1GND A;  2C3C A;  3GDP A;  3B6D A;  4YKG A;  2JB1 A;  4J2W A;  1LVL A;  1DOB A;  3ALM A;  1IUV A;  1BKW A;  1L0V A;  5HY5 A;  3CNS A;  2Q0L A;  1E1M A;  2B7R A;  4EIQ A;  2ZZC A;  4EQW A;  1L9D A;  1E7P A;  2FJB A;  5JCI A;  3F8P A;  1ZDL A;  3ICR A;  1D7L A;  2WET A;  4H4V A;  3KD9 A;  2C76 A;  2H89 A;  3NIX A;  3RNM A;  1ELI A;  3K7T A;  4NTE A;  3UKA A;  4BV6 A;  2BYB A;  3NRN A;  3DJG X;  3VR9 A;  5U25 A;  3NN0 X;  1GTH A;  2YVJ A;  2QAE A;  1Z6L A;  2WOI A;  1KNR A;  2YM1 A;  5FS8 A;  2APG A;  1H86 A;  4N9X A;  2FJA A;  4I58 A;  1QO8 A;  4PAB A;  2QA1 A;  5KOX A;  2WDQ A;  4H4P A;  3H8I A;  5IPY A;  3CNT A;  4CNK A;  1VG0 A;  1ZOV A;  5C2T A;  1GRG A;  3RHA A;  4E0V A;  3NLC A;  3CPI G;  4DGK A;  2BAC A;  1GRE A;  3NK1 X;  3E1T A;  3AEC A;  2BXS A;  2WBA A;  2C72 A;  3NH3 X;  1KDG A;  4JY2 A;  5M0Z A;  3LXD A;  5JCN A;  5IQ4 A;  1BGJ A;  2A89 A;  4TM4 A;  4H4Y A;  4I59 A;  2BS3 A;  1Q1W A;  4UDP A;  1UKV G;  4OPT A;  4U8L A;  4A7A A;  1S2Y A;  3AD7 B;  2V3A A;  3IF9 A;  3ISH A;  3UTE A;  1S3B A;  3LZX A;  3NGC X;  1SEZ A;  4O5Q A;  2VRM A;  4WX1 A;  2DKI A;  3P4S A;  5EOW A;  2X3N A;  3VRB A;  4APN A;  3V76 A;  4EM3 A;  1E1N A;  2VZ2 A;  3UOY A;  1PS9 A;  3Q9T A;  3H4K A;  4U8K A;  1JRY A;  2BK4 A;  3UOX A;  3UTF A;  2NPX A;  3ZYX A;  4U8J A;  4X4J A;  3CGB A;  4BK2 A;  3UTH A;  3KA7 A;  5LV9 A;  2VQ7 A;  4AT0 A;  1NHR A;  1JRX A;  3CNJ A;  4BJY A;  2YG4 A;  4REK A;  4CY8 A;  2XLP A;  1BZL A;  2VOU A;  3QSM A;  2R4J A;  4OVI A;  4Z24 A;  4D03 A;  3T37 A;  2AQJ A;  2E5V A;  2GV8 A;  2B9W A;  2R46 A;  3AD9 B;  5FMH A;  3BI2 A;  5U63 A;  3SFD A;  4C5O A;  3G5R A;  4H7U A;  3UKQ A;  3QSS A;  1L9E A;  4YTM A;  1D7Y A;  3UCL A;  4KX6 A;  2Q6U A;  2RGH A;  3PS9 A;  1NHQ A;  3GD3 A;  1Y0P A;  2XDO A;  2YM2 A;  3ALL A;  1KNP A;  4YXD A;  1NDA A;  2R0G A;  3AE1 A;  3IWA A;  4D04 A;  1PBE A;  2CFY A;  1GPE A;  2VVL A;  2EQ9 A;  4H4Q A;  2C64 A;  4YSY A;  4ZCD A;  2AR8 A;  3AE9 A;  4ZN0 A; 
#chains in the Genus database with same CATH topology
 3RED A;  1ZOY A;  1GRF A;  4MKS A;  1TDF A;  3UKP A;  3ZLH A;  2FYM A;  4O5U A;  4A3R A;  3BHK A;  4H4S A;  4G73 A;  2C65 A;  2RGO A;  3DDM A;  4DSG A;  4XWZ A;  3VRA A;  4H2R A;  3AYI A;  4AOX A;  2JAE A;  4G6H A;  3KPK A;  3QJ4 A;  1DTN A;  2QVH A;  5ENL A;  3GYX A;  2YQU A;  3AE7 A;  4Z2R A;  1RYI A;  2BCG G;  2A87 A;  3C4A A;  2TPR A;  3B97 A;  4YWS A;  1AOG A;  1PBC A;  4RG4 A;  2PHH A;  1KFY A;  1TDO A;  1N5X A;  4GME A;  2WDR A;  4U2T A;  1IUU A;  3L5O A;  1H83 A;  4LU6 A;  2XLT A;  3OZ2 A;  1IJH A;  4MJW A;  1JEH A;  4EMJ A;  1XDI A;  3NVZ B;  3BNU A;  3CGD A;  2GR1 A;  1HYU A;  4Z43 A;  4JHM A;  3AE2 A;  2YLR A;  4CRT A;  4TM0 A;  4USQ A;  2XVJ A;  2AL2 A;  2B9Y A;  3SGL A;  3HRD C;  1WUE A;  3FMW A;  3EPT A;  2XFU A;  1E1L A;  1N63 C;  2OA1 A;  1FFV C;  2V60 A;  3D47 A;  2WU5 A;  2BS2 A;  4XWR A;  1N61 C;  1W4X A;  1CJ3 A;  1NPX A;  5JCL A;  2PS2 A;  1ZY8 A;  4YSZ A;  1GSN A;  1JCT A;  5KVI A;  4RSL A;  3NTA A;  3UKK A;  2X8G A;  1GET A;  2GR0 A;  3P93 A;  5M10 A;  2JB3 A;  3TCS A;  1N5W C;  2PP1 A;  4U8N A;  4TVY A;  3Q4D A;  3Q6J A;  3QSE A;  1VRQ B;  1JRP A;  3G5Q A;  4E5T A;  1KSS A;  3DGB A;  2C75 A;  3DGH A;  4EQS A;  1JOA A;  1GAL A;  3R10 A;  3CPH G;  3AE3 A;  1IUT A;  3NTD A;  5KNL A;  3EUB 3;  2XVI A;  1YKJ A;  1L9C A;  4EIP A;  4GAP A;  1XHC A;  3ICT A;  2GQF A;  3F8D A;  2OPJ A;  4DSH A;  5KXJ A;  1JRO A;  3HZL A;  1FL2 A;  1O95 A;  2GEW A;  2W54 A;  2XYO A;  3UP5 A;  3S5W A;  4FDC B;  3B3R A;  1NG3 A;  2PTY A;  3WE0 A;  5IDZ A;  1Q9I A;  5EU9 A;  3M0O A;  4IP4 A;  3QFB A;  1M6I A;  1CJC A;  2OG9 A;  3GWF A;  2OQH A;  2IID A;  3SZ0 A;  2R45 A;  5CQF A;  1VDC A;  1GV4 A;  2R9Z A;  3D9X A;  4EMW A;  3TW9 A;  1ZK7 A;  2H88 A;  2W3R A;  4B63 A;  2XVF A;  2GF3 A;  2VVL G;  2ZZ0 A;  1SJD A;  5FJT A;  3N6H A;  3P1W A;  1EC7 A;  4A6G A;  2XFO A;  3UJS A;  3RCY A;  4HB9 A;  7ENL A;  3ADA B;  3UJ2 A;  2WP6 A;  4TLX A;  3GSI A;  3I6D A;  2UZZ A;  4IA6 A;  2PTZ A;  4GGH A;  2GL5 A;  1BQG A;  2C3D A;  3DFY A;  3DK4 A;  2ARD A;  1IUW A;  4H19 A;  3CGE A;  4H2N A;  3UJR A;  4GIS A;  4H4U A;  2A8X A;  2CHR A;  1P43 A;  1IUS A;  3URH A;  4G8T A;  3SY4 A;  4TM3 A;  2E5A A;  2QA2 A;  3VR8 A;  3FG2 P;  3UGV A;  3DFH A;  3RRA A;  2GSH A;  2F5Z A;  1H82 A;  2VVM A;  1NAA A;  1GRT A;  4H4T A;  2W0H A;  4X2P A;  4ZA0 A;  1IUX A;  2PGE A;  4ZCC A;  3O0H A;  4K7Z A;  3PG6 A;  1K0J A;  3LJP A;  2PCE A;  2EQ8 A;  4B65 A;  2Z5X A;  3CNP A;  4KWS A;  4NWZ A;  2OLO A;  5FS9 A;  1JU2 A;  3NK0 X;  4Y4L A;  2WOV A;  4GFI A;  1B37 A;  2GGE A;  3HYX A;  4FI4 A;  1GT8 A;  4K5R A;  1GND A;  1P48 A;  3B6D A;  3DEQ A;  1IUV A;  1BKW A;  5HY5 A;  1E1M A;  3IK4 A;  5KMR A;  2P88 A;  2ZZC A;  1ZDL A;  2HXU A;  3KD9 A;  2C76 A;  4NTE A;  4BV6 A;  3NN0 X;  2FJA A;  4G9K A;  3CB3 A;  2RDX A;  2WDQ A;  2OLA A;  2QGY A;  4HCH A;  1XS2 A;  1VG0 A;  3RHA A;  3NK1 X;  3E1T A;  4IL2 A;  3NH3 X;  5M0Z A;  2A89 A;  4A7A A;  1Q1W A;  1UKV G;  2GDQ A;  1S2Y A;  3FXG A;  3UTE A;  3ISH A;  1SEZ A;  2DKI A;  3UOY A;  3Q9T A;  3UOX A;  1R6W A;  3SJN A;  2BRA A;  4MGG A;  3CGB A;  3MY9 A;  4CY8 A;  2YG4 A;  5FJU A;  2R4J A;  5FMH A;  5U63 A;  4C5O A;  3G5R A;  4H7U A;  4H1Z A;  3QSS A;  3QPE A;  3UCL A;  1KKR A;  3AE1 A;  3NFU A;  4D04 A;  2EQ9 A;  4H4Q A;  4ZCD A;  3AE9 A;  5KMQ A;  2PYX A;  3KKJ A;  2DW6 A;  4X9M A;  3UXL A;  4PAA A;  3IHM A;  2YR5 A;  3GYJ A;  3SZW A;  4A79 A;  4BJZ A;  3NYC A;  4Z25 A;  2OX4 A;  4FK1 A;  1S3E A;  3I3L A;  3GO2 A;  3AMZ A;  3AE5 A;  2V6O A;  4GR1 A;  2QCU A;  1FEA A;  2V3B A;  2XFN A;  3PFR A;  3RO6 A;  3SSZ A;  5KMP A;  1X31 B;  2X8C A;  5C3J A;  4K1W A;  2YWL A;  5EB4 A;  4JNQ A;  2XH0 A;  4ECH A;  3HYV A;  2WDV A;  1PXB A;  2WPE A;  3PWG A;  3QLD A;  3T0K A;  2GH5 A;  5L46 A;  2E1M A;  1GRA A;  2IVD A;  2B7S A;  5J60 A;  3BHF A;  2X50 A;  5BUK A;  2V61 A;  2OQY A;  2POZ A;  1M64 A;  4J34 A;  3K7Q X;  2C66 A;  1E9I A;  2OLN A;  1JNZ A;  1BF3 A;  3ALJ A;  5HXI A;  2P8B A;  3LAD A;  1H7W A;  4UDR A;  2X99 A;  1D5T A;  4J57 A;  1S7M A;  3M12 A;  3UP4 A;  2WP9 A;  2JBV A;  1E6E A;  2WES A;  3AD8 B;  4DHG A;  1JPM A;  4LA1 A;  3OW1 A;  4U8O A;  3FV9 A;  2OKT A;  2BRY A;  2GGH A;  3K30 A;  1KKO A;  3DJD A;  3R0K A;  4J33 A;  2PTX A;  2WU2 A;  4UDQ A;  5KRQ A;  3P9U A;  4OPC A;  3UTG A;  4YTP A;  3D46 A;  2JB2 A;  3RP7 A;  1NEN A;  4MMW A;  1PJ5 A;  1IYX A;  3V3O A;  2XH2 A;  4ADW A;  4GDP A;  2PU0 A;  4YSH A;  4NEV A;  4U8P A;  2GGI A;  1EBH A;  3A7U A;  3T8Q A;  2MUC A;  3CMM A;  1ZKQ A;  3HW2 A;  4H83 A;  4JNA A;  1P2E A;  3SQS A;  3ICS A;  3NS1 B;  2ZC8 A;  2EQ7 A;  3P4Q A;  3TTE A;  3ATQ A;  2GGG A;  4J1O A;  2WHD A;  4Z2T A;  5HHF A;  3MZN A;  3T2Z A;  2PPG A;  4Y4M A;  1EC9 A;  3T4W A;  1CC6 A;  1FCD A;  1OJC A;  2YVG A;  3UXK A;  3GC2 A;  3SBF A;  4EWJ A;  2C70 A;  2GQW A;  2HNE A;  3A7R A;  3MUC A;  4TLZ A;  3NHO X;  4K22 A;  4IT1 A;  2BXR A;  1GXF A;  4H4W A;  2GMH A;  2PSN A;  4GUV A;  1K0I A;  4KPL A;  1CHU A;  2ZBW A;  3OZM A;  1REO A;  3TOY A;  3CT2 A;  2JK6 A;  2XH7 A;  1QJD A;  1FFU C;  1CF3 A;  3ABV A;  4BK3 A;  1NEL A;  3THU A;  2TMD A;  3N4F A;  3L1R A;  4OPD A;  2BK3 A;  2HZG A;  4TVW A;  2YLT A;  3CYJ A;  1V59 A;  2QDD A;  3DJJ A;  3RR1 A;  4CCQ A;  2GAH B;  4Z17 A;  1S2Q A;  3CXB A;  2Y6Q A;  3ENL A;  1KCZ A;  3NN6 X;  4NEW A;  3AEG A;  3FBS A;  2DW7 A;  4IZG A;  1FEC A;  3QN3 A;  3CND A;  3R07 C;  4U2L A;  1JNR A;  3AEA A;  1B8S A;  3NT6 A;  2RAB A;  3VA8 A;  4M6U A;  2XCG A;  4DNA A;  1RM6 B;  2VRL A;  4H2Q A;  3Q45 A;  3T14 A;  1TYT A;  4G7F A;  4AT2 A;  4CNJ A;  3VRD B;  3KUM A;  3RP6 A;  1PJ7 A;  4OPL A;  1MOK A;  3SZC A;  4A5L A;  4H4X A;  1CBO A;  1LQU A;  4A65 A;  3VCN A;  3QVR A;  2BC0 A;  1X2G A;  3OTR A;  3OC4 A;  1PXA A;  4USR A;  3UOZ A;  4A6N B;  1OEP A;  1K0L A;  2O9Z A;  4NTC A;  1BKH A;  1FHU A;  1CJ4 A;  2OAM A;  2C3C A;  3B9J B;  1MNS A;  3ALM A;  1TKK A;  2Q0L A;  4EIQ A;  4KT2 A;  2FJB A;  4DXK A;  3T2K A;  3T2Y A;  3NIX A;  1XPY A;  3VR9 A;  1Z6L A;  5G5H B;  2APG A;  3SN4 A;  4DYE A;  4H4P A;  2C4C A;  3SZF A;  2MNR A;  1ZOV A;  3NLC A;  1GRE A;  3VDG A;  1SJA A;  2POD A;  2WBA A;  1KDG A;  5JRB A;  1X2H A;  5IQ4 A;  1BGJ A;  2PTW A;  4TM4 A;  4H4Y A;  2BS3 A;  4UDP A;  4U8L A;  2I5Q A;  3AD7 B;  5BOE A;  1S3B A;  3LZX A;  1N62 C;  3NGC X;  4O5Q A;  4WX1 A;  4NNJ A;  3BOX A;  4EM3 A;  1E1N A;  2VZ2 A;  1PS9 A;  3RGT A;  3R0U A;  4U8J A;  3TJI A;  3KA7 A;  2VQ7 A;  1NHR A;  3CNJ A;  2XLP A;  1BZL A;  4E4F A;  2VOU A;  3EKG A;  4E8G A;  4OVI A;  4D03 A;  2AQJ A;  2R46 A;  3AM9 A;  2P3Z A;  2HXT A;  1L9E A;  1D7Y A;  1PDY A;  4II2 A;  4KX6 A;  2Q6U A;  3HPF A;  1NHQ A;  1Y0P A;  2XDO A;  3NZG A;  2AR8 A;  3NXL A;  5J04 A;  3SFE A;  4IVO B;  4IL0 A;  4ENL A;  2BS4 A;  4B64 A;  3D1C A;  5CKU A;  3GD4 A;  1GER A;  3DES A;  3BJS A;  2W55 A;  3DK8 A;  4P9S A;  3RIT A;  3NRZ B;  2QJJ A;  3OZY A;  1LV0 A;  4ICY A;  1GTE A;  4C3X A;  3A7A A;  4E6M A;  1ONF A;  1VQW A;  3EAO A;  3NO1 A;  1D4D A;  2X8H A;  3AE4 A;  4EMI A;  2OZ8 A;  3UOV A;  4B67 A;  5DBJ A;  1O94 A;  4Z44 A;  4NTD A;  1P2H A;  4JQ9 A;  2OFJ A;  4K8D A;  3K7M X;  4JY3 A;  4XXG A;  3AN1 A;  4UP3 A;  3QFA A;  3DJE A;  1EL8 A;  4X9N A;  1Y56 A;  1EL7 A;  2OZ3 A;  3SN0 A;  3M13 A;  1T3Q C;  4F4R A;  3R9U A;  2BC1 A;  2XVH A;  2GR3 A;  3GMB A;  2E4G A;  4WCT A;  2WPF A;  4B1B A;  1MO9 A;  5KMS A;  2ZAD A;  4A6N A;  1F9C A;  4AP1 A;  4HPN A;  3FVD A;  5JCM A;  3T6C A;  1LJ1 A;  3MKC A;  4Z2U A;  3QTP A;  2GB0 A;  2YAU A;  4ZCW A;  3HYW A;  4C74 A;  1PBB A;  2XVE A;  3H12 A;  4YKF A;  2XGZ A;  2I0Z A;  2PP0 A;  1OJA A;  2XSX A;  5IQ1 A;  2W3S A;  2C67 A;  3CTY A;  3K1G A;  4FK1 C;  3GRS A;  4GDE A;  4AOS A;  2CUL A;  5KWF A;  3ZLG A;  3GYI A;  1NG4 A;  3UCD A;  1F3P A;  3N6J A;  1RVK A;  1YQZ A;  4YSX A;  2YLZ A;  2OZT A;  1QLB A;  3SN1 A;  2O56 A;  1YQ4 A;  2B76 A;  5FJO A;  3G5S A;  2B9X A;  1ZMC A;  3DG7 A;  1CJ2 A;  1GES A;  3EAN A;  5GSN A;  3GRT A;  5ER0 A;  3H8L A;  5FJP A;  4HNL A;  1JRZ A;  3DME A;  1FEB A;  1TE6 A;  1DJN A;  3IJL A;  3GMC A;  1MRA A;  3NYE A;  2FKP A;  3JW7 A;  1ZX9 A;  3DER A;  3H70 A;  3T9P A;  1DOE A;  4YTN A;  1TDN A;  3C96 A;  4IVM B;  4J3Z A;  1MXT A;  1GRB A;  3VQR A;  4GGB A;  3NVW B;  5GRT A;  4EQR A;  4BUR A;  4C77 A;  1DOC A;  1TDE A;  2AAQ A;  1BWC A;  1K4Q A;  2ONE A;  3GY1 A;  2C7G A;  1Q1R A;  2YLX A;  3AEF A;  3ITJ A;  4M52 A;  2EQ6 A;  4H2H A;  1OJ9 A;  2OAL A;  2RGJ A;  2XFQ A;  4K8G A;  3PO7 A;  4KEM A;  1H7X A;  2GRT A;  5BUL A;  1VDV A;  3FPZ A;  4NZH A;  2BA9 A;  1FOH A;  2C73 A;  3R1Z A;  3DG3 A;  4CY6 A;  1H6V A;  2YG5 A;  1OJT A;  2R0P A;  1PBD A;  3AEB A;  1E1K A;  3DG6 A;  4FP1 A;  4EQX A;  3ES7 A;  3S47 A;  3KU9 A;  3VFC A;  4A99 A;  4GRT A;  2Z5Y A;  4OPU A;  4J36 A;  3RP8 A;  3IHG A;  3U9I A;  1VG9 A;  1N4U A;  4U8M A;  2QJN A;  3S61 A;  1MDL A;  3NG7 X;  4CBQ A;  3KVE A;  4OCG A;  3AWI A;  2Y6R A;  2HQM A;  1N4V A;  2WEU A;  2CDU A;  2XLU A;  3CPJ G;  2PU1 A;  3AE6 A;  3SQP A;  1TZZ A;  2XLS A;  1XPQ A;  4IV9 A;  1EBG A;  1N1P A;  3H8A A;  1TYP A;  3QKE A;  4A35 A;  4JN7 A;  3SM8 A;  4ROP A;  4FX9 A;  3NVY B;  4DX3 A;  3CIR A;  3TQP A;  4YWO A;  2J3N A;  3T31 A;  3NKS A;  3F8R A;  1JDF A;  2VQB A;  1DNC A;  3ZDN A;  4CCR A;  3MQT A;  1WYG A;  2JB1 A;  4J2W A;  3OP2 A;  3ZLF A;  3CNS A;  3ICR A;  2WET A;  4H4V A;  3PWI A;  2H89 A;  3FJ4 A;  3K7T A;  3UKA A;  3NRN A;  2QAE A;  3ZVI A;  2OVL A;  2WOI A;  2YM1 A;  4N9X A;  3N4E A;  1QO8 A;  4PAB A;  5KOX A;  3JZU A;  3H8I A;  4IHC A;  2BAC A;  2AKZ A;  2BXS A;  5JCN A;  4OPT A;  2V3A A;  3IF9 A;  2VRM A;  3P4S A;  3VRB A;  2X3N A;  5EOW A;  4APN A;  3V76 A;  1KD0 A;  3H4K A;  4U8K A;  3UTF A;  2NPX A;  3VC6 A;  4BK2 A;  3UTH A;  2PA6 A;  4BJY A;  1PDZ A;  1R0M A;  2GV8 A;  2B9W A;  3SXI A;  3SFD A;  3UKQ A;  4YTM A;  2AKM A;  2R0G A;  1GPE A;  1PBE A;  1ELS A;  4DWD A;  4ZN0 A;  2GGJ A;  4H2P A;  3U4F A;  4M0X A;  1NHP A;  4H50 A;  4B68 A;  4G74 A;  2PMQ A;  1DJQ A;  4GYP C;  3CN8 A;  3LZW A;  3QVP A;  1H81 A;  1PJ6 A;  3FYY A;  1PHH A;  4HCD A;  2P0I A;  5EBK A;  1YQ3 A;  2QDE A;  2NQL A;  4HA6 A;  2ACZ A;  1GOS A;  3COX A;  1TDK A;  3UJF A;  5FS6 A;  1CC4 A;  4Y4N A;  3IJQ A;  1OJD A;  3SX6 A;  4H4Z A;  5FJR A;  1XAN A;  4AP3 A;  4HYR A;  2FJD A;  4K2S A;  1ECQ A;  3UKH A;  2GVC A;  4Z1Y A;  2BCP A;  4U8I A;  3AEE A;  3UKF A;  1RP0 A;  4J31 A;  3FCP A;  5G5G B;  3EEZ A;  3C4N A;  2AL2 B;  3ZVH A;  3AB1 A;  1F8W A;  1FO4 A;  1EL9 A;  1F8R A;  3V5F A;  4JN9 A;  1F8S A;  1SJC A;  3II4 A;  2R4E A;  2YLW A;  3UCC A;  3V5C A;  3S5S A;  3DK9 A;  3JSK A;  1LTX R;  1VQZ A;  1Y56 B;  2YR4 A;  3DA1 A;  3KPF A;  3V3N A;  1BGN A;  4GYP A;  2ZZB A;  2Q0K A;  2R0C A;  4YT0 A;  3I6T A;  2WS3 A;  1EC8 A;  2FJE A;  1EL5 A;  1DOD A;  2CVJ A;  2WP5 A;  3AE8 A;  2YR6 A;  1PXC A;  1PN0 A;  3NYF A;  4HN8 A;  1PBF A;  1NHS A;  1MUC A;  2FBW A;  3P0W A;  3I6E A;  4H4R A;  3NNE A;  1GEU A;  4GF7 A;  1E39 A;  1NEK A;  2GR2 A;  4JDR A;  4K2X A;  1LQT A;  3D8X A;  5TR3 A;  3AXB A;  2WPC A;  1CC2 A;  3BI4 A;  4K5S A;  4Z26 A;  3ZVH B;  1ZP0 A;  3V4B A;  3BNM A;  3CK5 A;  1B5Q A;  3STP A;  2YG6 A;  3CXO A;  4BK1 A;  4C3Y A;  1YEY A;  1O5W A;  3BSM A;  1COY A;  3CGC A;  3SR6 B;  2XLR A;  1F6M A;  3DH9 A;  3UKL A;  2YLS A;  2BK5 A;  4J56 A;  1H84 A;  2JKC A;  4G6G A;  4OPG A;  1KF6 A;  3NK2 X;  5EB5 A;  2AL1 A;  2XFP A;  1DXL A;  3V3W A;  2IVE A;  3OPS A;  3P4R A;  3NVV B;  5BRT A;  5U1O A;  3JVA A;  1LPF A;  3GWD A;  2YG7 A;  1D4E A;  5KVH A;  3AED A;  3UJE A;  3PVC A;  3PK7 A;  3DGZ A;  5BVA A;  2GMJ A;  3R25 A;  6ENL A;  4GCM A;  3AYJ A;  3CAW A;  3H7V A;  2QJM A;  5JCK A;  3LB8 A;  1N60 C;  3P4P A;  3ATR A;  4LII A;  2BAB A;  1FHV A;  3BI5 A;  5FS7 A;  3ES8 A;  1MDR A;  4JN8 A;  1TRB A;  2OO6 A;  2PP3 A;  2V5Z A;  1D4C A;  1SJB A;  2WOW A;  3EF6 A;  4TM1 A;  1H2I A;  3TWB A;  3GDN A;  1RSG A;  3GD6 A;  4U2S A;  1NU5 A;  1FIQ B;  4IA5 A;  1ZXI C;  2Q7V A;  1EBD A;  1N4W A;  5HYM A;  2DKH A;  2NVK X;  1ONE A;  4B69 A;  1PDH A;  5J7X A;  1B4V A;  1KSU A;  4HNC A;  1ZMD A;  4RG3 A;  3DIP A;  2YG3 A;  3L8K A;  4A9W A;  1CL0 A;  3LOV A;  3IC9 A;  1V97 A;  4OPI A;  1GRH A;  3TJ4 A;  2WQY A;  3FIM B;  4EM4 A;  4DN1 A;  3AYL A;  2GAG B;  5KOW A;  3VC5 A;  4KPR A;  1YY5 A;  3KLJ A;  2YVF A;  3GDP A;  3MWC A;  3TWA A;  4II3 A;  4YKG A;  1LVL A;  1DOB A;  1L0V A;  2P8C A;  2B7R A;  4ZOH B;  4EQW A;  1L9D A;  4HCL A;  1E7P A;  5JCI A;  3F8P A;  1D7L A;  3ETR B;  1SB3 B;  3RNM A;  1ELI A;  5BOF A;  4E4U A;  2BYB A;  1STZ A;  3DJG X;  5U25 A;  1GTH A;  2YVJ A;  1KNR A;  5FS8 A;  1H86 A;  4I58 A;  2QA1 A;  5IPY A;  1L8P A;  3CNT A;  4CNK A;  1W6T A;  5C2T A;  1GRG A;  4E0V A;  3CPI G;  4DGK A;  3AEC A;  2C72 A;  3I4K A;  4JY2 A;  3LXD A;  1KN0 A;  4I59 A;  3VCC A;  2E3T A;  1JPD X;  4GIR A;  4IP5 A;  1JRY A;  2BK4 A;  3ZYX A;  4X4J A;  3MSY A;  1WUF A;  3SYI A;  5LV9 A;  4AT0 A;  1JRX A;  4GAV A;  4REK A;  3QSM A;  3P3B A;  4Z24 A;  3T37 A;  2E5V A;  3AD9 B;  3BI2 A;  2PGW A;  2XH4 A;  3R11 A;  3PS9 A;  2RGH A;  3GD3 A;  2YM2 A;  3ALL A;  4YXD A;  3IJI A;  1KNP A;  1NDA A;  3IWA A;  2CFY A;  2VVL A;  2C64 A;  4YSY A;  4B66 A;  2QQ6 A; 
#chains in the Genus database with same CATH homology
 2PYX A;  3KKJ A;  4H2P A;  3RED A;  4X9M A;  3SFE A;  1NHP A;  1ZOY A;  4IVO B;  1GRF A;  4PAA A;  4H50 A;  4B68 A;  3IHM A;  2YR5 A;  2BS4 A;  4B64 A;  3D1C A;  4G74 A;  3GYJ A;  3SZW A;  1DJQ A;  5CKU A;  3GD4 A;  1TDF A;  3CN8 A;  3UKP A;  1GER A;  3LZW A;  3QVP A;  4O5U A;  1H81 A;  4A79 A;  4BJZ A;  1PJ6 A;  3NYC A;  4Z25 A;  3DK8 A;  1PHH A;  4FK1 A;  4P9S A;  3BHK A;  1S3E A;  4H4S A;  3I3L A;  4G73 A;  3AE5 A;  1LV0 A;  5EBK A;  1YQ3 A;  2C65 A;  2RGO A;  4ICY A;  1GTE A;  2V6O A;  4GR1 A;  4C3X A;  4DSG A;  4XWZ A;  3VRA A;  4H2R A;  2QCU A;  1FEA A;  2V3B A;  1ONF A;  2XFN A;  2JAE A;  1VQW A;  3AYI A;  3EAO A;  4AOX A;  4G6H A;  1D4D A;  3KPK A;  3QJ4 A;  2ACZ A;  4HA6 A;  2X8H A;  1GOS A;  3AE4 A;  3COX A;  5KMP A;  1X31 B;  2X8C A;  1TDK A;  3GYX A;  4EMI A;  2YQU A;  5FS6 A;  5C3J A;  1CC4 A;  4Y4N A;  3UOV A;  3AE7 A;  4B67 A;  1OJD A;  5DBJ A;  3SX6 A;  1O94 A;  4Z44 A;  4NTD A;  4Z2R A;  2YWL A;  1P2H A;  1RYI A;  5EB4 A;  4JQ9 A;  4JNQ A;  2BCG G;  4H4Z A;  2A87 A;  3C4A A;  4ECH A;  1XAN A;  4AP3 A;  2FJD A;  3HYV A;  2WDV A;  1PXB A;  4K8D A;  3UKH A;  3K7M X;  2TPR A;  2WPE A;  4JY3 A;  4XXG A;  2GVC A;  1AOG A;  3T0K A;  1PBC A;  2GH5 A;  5L46 A;  2E1M A;  2BCP A;  4UP3 A;  4U8I A;  4RG4 A;  1GRA A;  3AEE A;  2PHH A;  3UKF A;  3QFA A;  1KFY A;  1RP0 A;  3DJE A;  4J31 A;  1TDO A;  1EL8 A;  2IVD A;  2B7S A;  4X9N A;  1Y56 A;  2WDR A;  5J60 A;  3BHF A;  4U2T A;  1IUU A;  3C4N A;  3L5O A;  2X50 A;  1H83 A;  1EL7 A;  3AB1 A;  1F8W A;  3M13 A;  4LU6 A;  1EL9 A;  2XLT A;  3OZ2 A;  1IJH A;  4MJW A;  3R9U A;  5BUK A;  2BC1 A;  1JEH A;  1F8R A;  2V61 A;  2GR3 A;  2XVH A;  3GMB A;  2E4G A;  4EMJ A;  1XDI A;  4WCT A;  2WPF A;  4B1B A;  1MO9 A;  3CGD A;  1M64 A;  3BNU A;  4J34 A;  4A6N A;  5KMS A;  4JN9 A;  2GR1 A;  4AP1 A;  3K7Q X;  1F8S A;  1HYU A;  2C66 A;  5JCM A;  3II4 A;  2OLN A;  1JNZ A;  4Z43 A;  2R4E A;  1BF3 A;  2YLW A;  1LJ1 A;  3AE2 A;  3ALJ A;  4Z2U A;  2YLR A;  5HXI A;  3LAD A;  1H7W A;  4UDR A;  2GB0 A;  2X99 A;  4CRT A;  1D5T A;  4TM0 A;  4USQ A;  2YAU A;  2XVJ A;  3HYW A;  4J57 A;  1S7M A;  2B9Y A;  3SGL A;  4C74 A;  3M12 A;  3FMW A;  1PBB A;  2XVE A;  3UP4 A;  3EPT A;  2WP9 A;  2JBV A;  3DK9 A;  1E6E A;  2XFU A;  3JSK A;  1E1L A;  4YKF A;  2WES A;  1LTX R;  2I0Z A;  3AD8 B;  2OA1 A;  1OJA A;  2V60 A;  4LA1 A;  2WU5 A;  2BS2 A;  4XWR A;  1Y56 B;  4U8O A;  5IQ1 A;  2BRY A;  2C67 A;  3CTY A;  2YR4 A;  3DA1 A;  3KPF A;  3K30 A;  3V3N A;  1W4X A;  1BGN A;  4FK1 C;  1CJ3 A;  3DJD A;  1NPX A;  5JCL A;  3GRS A;  4J33 A;  1ZY8 A;  2ZZB A;  2WU2 A;  4UDQ A;  4YSZ A;  5KRQ A;  2Q0K A;  3P9U A;  1GSN A;  4OPC A;  2R0C A;  4GDE A;  4YT0 A;  5KVI A;  3UTG A;  4AOS A;  2CUL A;  4RSL A;  4YTP A;  3NTA A;  2WS3 A;  2JB2 A;  5KWF A;  3UKK A;  3RP7 A;  2X8G A;  1GET A;  2FJE A;  1NEN A;  2GR0 A;  1DOD A;  1EL5 A;  1NG4 A;  2CVJ A;  1F3P A;  3GYI A;  5M10 A;  2JB3 A;  1PJ5 A;  2WP5 A;  3AE8 A;  1YQZ A;  2YR6 A;  1PXC A;  1PN0 A;  3V3O A;  4YSX A;  4U8N A;  3NYF A;  1PBF A;  1NHS A;  4ADW A;  2YLZ A;  4GDP A;  2FBW A;  1QLB A;  3Q6J A;  3QSE A;  4H4R A;  3NNE A;  1VRQ B;  1GEU A;  4YSH A;  4NEV A;  1YQ4 A;  3G5Q A;  2B76 A;  4GF7 A;  4U8P A;  1E39 A;  1NEK A;  3G5S A;  2GR2 A;  4JDR A;  2B9X A;  4K2X A;  1ZMC A;  1KSS A;  1LQT A;  3D8X A;  1CJ2 A;  1GES A;  3EAN A;  5TR3 A;  5GSN A;  2C75 A;  3GRT A;  5ER0 A;  3H8L A;  3DGH A;  4EQS A;  1JOA A;  2WPC A;  1CC2 A;  1GAL A;  3AXB A;  3BI4 A;  3CMM A;  4K5S A;  1JRZ A;  1ZKQ A;  3CPH G;  4JNA A;  3AE3 A;  1IUT A;  1P2E A;  3NTD A;  4Z26 A;  3DME A;  1FEB A;  3ICS A;  5KNL A;  1ZP0 A;  3BNM A;  2XVI A;  1B5Q A;  1YKJ A;  1DJN A;  1L9C A;  2YG6 A;  2EQ7 A;  4GAP A;  4EIP A;  1XHC A;  3GMC A;  3ICT A;  4BK1 A;  3NYE A;  4C3Y A;  3P4Q A;  3ATQ A;  2GQF A;  1O5W A;  3F8D A;  1ZX9 A;  2WHD A;  4Z2T A;  1COY A;  5HHF A;  3T2Z A;  4Y4M A;  4DSH A;  5KXJ A;  3CGC A;  1CC6 A;  1FCD A;  3HZL A;  1OJC A;  2YVG A;  1DOE A;  2XLR A;  1F6M A;  1FL2 A;  4YTN A;  3DH9 A;  3UKL A;  1TDN A;  2C70 A;  2YLS A;  2GQW A;  2BK5 A;  1O95 A;  3C96 A;  4J56 A;  4TLZ A;  1H84 A;  2JKC A;  3NHO X;  4IVM B;  4K22 A;  2GEW A;  4G6G A;  4OPG A;  1KF6 A;  2BXR A;  1GXF A;  1MXT A;  3NK2 X;  5EB5 A;  1GRB A;  4H4W A;  2XYO A;  3UP5 A;  3S5W A;  4FDC B;  2XFP A;  1DXL A;  3B3R A;  3VQR A;  1NG3 A;  2GMH A;  2IVE A;  4GUV A;  3WE0 A;  5GRT A;  1Q9I A;  1K0I A;  4EQR A;  4BUR A;  4C77 A;  1CHU A;  2ZBW A;  3M0O A;  1REO A;  1DOC A;  2JK6 A;  3QFB A;  1TDE A;  2AAQ A;  1BWC A;  1QJD A;  1CF3 A;  1K4Q A;  1M6I A;  1CJC A;  3ABV A;  3P4R A;  4BK3 A;  3GWF A;  5BRT A;  5U1O A;  2C7G A;  1Q1R A;  2IID A;  2YLX A;  3SZ0 A;  3AEF A;  2TMD A;  2R45 A;  3L1R A;  3ITJ A;  5CQF A;  1VDC A;  1LPF A;  1GV4 A;  4M52 A;  2EQ6 A;  2R9Z A;  2BK3 A;  4OPD A;  3D9X A;  1OJ9 A;  2OAL A;  2RGJ A;  2YG7 A;  4EMW A;  2XFQ A;  2YLT A;  3GWD A;  3PO7 A;  1D4E A;  5KVH A;  3AED A;  1H7X A;  1V59 A;  1ZK7 A;  3DJJ A;  2GRT A;  2H88 A;  3PVC A;  5BUL A;  4B63 A;  4CCQ A;  2GAH B;  2XVF A;  2GF3 A;  3DGZ A;  3FPZ A;  5BVA A;  1S2Q A;  2GMJ A;  2VVL G;  2ZZ0 A;  2Y6Q A;  3P1W A;  4NZH A;  2XFO A;  3AYJ A;  4GCM A;  2BA9 A;  1FOH A;  4HB9 A;  2C73 A;  3ADA B;  3NN6 X;  4NEW A;  3AEG A;  3FBS A;  5JCK A;  2WP6 A;  4TLX A;  1H6V A;  3LB8 A;  3GSI A;  4CY6 A;  1FEC A;  2YG5 A;  3I6D A;  3CND A;  2UZZ A;  4U2L A;  4IA6 A;  1OJT A;  1JNR A;  3P4P A;  2R0P A;  4LII A;  3ATR A;  2BAB A;  1PBD A;  3AEA A;  3AEB A;  3BI5 A;  5FS7 A;  1B8S A;  1E1K A;  3NT6 A;  2RAB A;  4EQX A;  2C3D A;  4B66 A;  1TRB A;  3KU9 A;  4A99 A;  3DK4 A;  4GRT A;  2ARD A;  2Z5Y A;  2V5Z A;  4J36 A;  4OPU A;  3RP8 A;  1IUW A;  1D4C A;  2XCG A;  3CGE A;  3IHG A;  4DNA A;  2WOW A;  2VRL A;  4H2N A;  4H2Q A;  3EF6 A;  4H4U A;  1N4U A;  1VG9 A;  2A8X A;  1H2I A;  4TM1 A;  4U8M A;  3T14 A;  1TYT A;  3S61 A;  3GDN A;  1IUS A;  3URH A;  3NG7 X;  4AT2 A;  1RSG A;  3SY4 A;  4CNJ A;  4TM3 A;  4CBQ A;  3KVE A;  4U2S A;  3VRD B;  2QA2 A;  3RP6 A;  3VR8 A;  4OCG A;  4IA5 A;  3AWI A;  1PJ7 A;  3FG2 P;  2Y6R A;  2HQM A;  1N4V A;  2WEU A;  4OPL A;  2F5Z A;  1H82 A;  1EBD A;  2Q7V A;  2VVM A;  1N4W A;  1MOK A;  3SZC A;  4A5L A;  1NAA A;  2CDU A;  5HYM A;  1GRT A;  2DKH A;  2XLU A;  4H4X A;  2NVK X;  4H4T A;  1CBO A;  3CPJ G;  2W0H A;  1LQU A;  4B69 A;  3AE6 A;  4A65 A;  1PDH A;  3SQP A;  1IUX A;  5J7X A;  3QVR A;  1B4V A;  2BC0 A;  2XLS A;  1KSU A;  3O0H A;  4K7Z A;  4ZCC A;  1XPQ A;  1ZMD A;  4IV9 A;  4RG3 A;  1N1P A;  2YG3 A;  3L8K A;  4A9W A;  3PG6 A;  1K0J A;  3LJP A;  1CL0 A;  2EQ8 A;  4B65 A;  2Z5X A;  3CNP A;  3LOV A;  1TYP A;  4NWZ A;  3IC9 A;  3SM8 A;  3OC4 A;  1PXA A;  4OPI A;  1GRH A;  4USR A;  2OLO A;  5FS9 A;  3UOZ A;  4A6N B;  1JU2 A;  2WQY A;  4FX9 A;  3NK0 X;  3FIM B;  4EM4 A;  4Y4L A;  1K0L A;  2WOV A;  2O9Z A;  3CIR A;  4NTC A;  1B37 A;  3HYX A;  4YWO A;  2J3N A;  3T31 A;  3NKS A;  3AYL A;  3F8R A;  2GAG B;  1CJ4 A;  2VQB A;  5KOW A;  1GT8 A;  4K5R A;  1DNC A;  4KPR A;  1YY5 A;  3ZDN A;  4CCR A;  2OAM A;  3KLJ A;  2YVF A;  1GND A;  2C3C A;  3GDP A;  3B6D A;  4II3 A;  4YKG A;  2JB1 A;  4J2W A;  1LVL A;  1DOB A;  3ALM A;  1IUV A;  1BKW A;  1L0V A;  5HY5 A;  3CNS A;  2Q0L A;  1E1M A;  2B7R A;  4EIQ A;  5KMR A;  2ZZC A;  4EQW A;  1L9D A;  1E7P A;  2FJB A;  5JCI A;  3F8P A;  1ZDL A;  3ICR A;  1D7L A;  2WET A;  3T2K A;  4H4V A;  3T2Y A;  3KD9 A;  2C76 A;  2H89 A;  3NIX A;  3RNM A;  1ELI A;  3K7T A;  4NTE A;  3UKA A;  4BV6 A;  2BYB A;  3NRN A;  3DJG X;  3VR9 A;  5U25 A;  3NN0 X;  1GTH A;  2YVJ A;  2QAE A;  1Z6L A;  2WOI A;  1KNR A;  2YM1 A;  5FS8 A;  2APG A;  1H86 A;  4N9X A;  2FJA A;  4G9K A;  4I58 A;  1QO8 A;  4PAB A;  2QA1 A;  5KOX A;  2WDQ A;  4H4P A;  3H8I A;  2C4C A;  5IPY A;  3CNT A;  3SZF A;  4CNK A;  1VG0 A;  1ZOV A;  5C2T A;  1GRG A;  3RHA A;  4E0V A;  3NLC A;  3CPI G;  4DGK A;  2BAC A;  1GRE A;  3NK1 X;  3E1T A;  3AEC A;  2BXS A;  2WBA A;  2C72 A;  3NH3 X;  1KDG A;  4JY2 A;  5JRB A;  5M0Z A;  3LXD A;  5JCN A;  1KN0 A;  1BGJ A;  5IQ4 A;  2A89 A;  4TM4 A;  4H4Y A;  4I59 A;  2BS3 A;  1Q1W A;  4UDP A;  1UKV G;  4OPT A;  4U8L A;  4A7A A;  1S2Y A;  3AD7 B;  2V3A A;  3IF9 A;  3ISH A;  3UTE A;  1S3B A;  3LZX A;  3NGC X;  1SEZ A;  4O5Q A;  2VRM A;  4WX1 A;  2DKI A;  3P4S A;  4NNJ A;  5EOW A;  2X3N A;  3VRB A;  4APN A;  3V76 A;  4EM3 A;  1E1N A;  2VZ2 A;  3UOY A;  1PS9 A;  3Q9T A;  3H4K A;  4U8K A;  1JRY A;  2BK4 A;  3UOX A;  3UTF A;  2NPX A;  2BRA A;  3ZYX A;  4U8J A;  4X4J A;  3CGB A;  3SYI A;  3UTH A;  3KA7 A;  4BK2 A;  5LV9 A;  2VQ7 A;  4AT0 A;  1NHR A;  1JRX A;  3CNJ A;  4GAV A;  4BJY A;  2YG4 A;  4REK A;  4CY8 A;  2XLP A;  1BZL A;  2VOU A;  3QSM A;  2R4J A;  4OVI A;  4Z24 A;  4D03 A;  3T37 A;  2AQJ A;  2E5V A;  2GV8 A;  4ZN0 A;  2B9W A;  2R46 A;  3AD9 B;  5FMH A;  3BI2 A;  5U63 A;  3SFD A;  3SXI A;  4C5O A;  3G5R A;  4H7U A;  3UKQ A;  3QSS A;  1L9E A;  4YTM A;  1D7Y A;  4II2 A;  3UCL A;  4KX6 A;  2Q6U A;  2RGH A;  3PS9 A;  1NHQ A;  3GD3 A;  1Y0P A;  2XDO A;  2YM2 A;  3ALL A;  1KNP A;  4YXD A;  1NDA A;  2R0G A;  3AE1 A;  3IWA A;  4D04 A;  1PBE A;  2CFY A;  1GPE A;  2VVL A;  2EQ9 A;  4H4Q A;  2C64 A;  4YSY A;  4ZCD A;  2AR8 A;  3AE9 A;  5KMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...