5KVHA

Crystal structure of human apoptosis-inducing factor with w196a mutation
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
487
structure length
438
Chain Sequence
DKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQANGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis-inducing factor 1, mitochondrial
publication title Defining NADH-Driven Allostery Regulating Apoptosis-Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 139
structure length 438
sequence length 487
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5kvhA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kvhA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kvhA01
1VDCA 3AE7A 3CPJG 3DGZA 1VG0A 5FS7A 3KKJA 4B63A 1EBDA 1S2YA 2GQWA 1FL2A 1GT8A 3ATQA 4DNAA 4BK3A 2YG6A 2X8HA 3VR9A 2C66A 2VRMA 3NYEA 4XXGA 1PBEA 5FS8A 2WOIA 2A89A 1PXBA 4TLZA 4YT0A 3I6DA 4O5QA 1BGJA 3UOVA 3NTDA 1MOKA 4EIPA 1GRFA 3P1WA 3IWAA 3K7TA 4DGKA 1PBCA 2X50A 1KSUA 2BXRA 4NEVA 2QCUA 4U2SA 4CCRA 4Z24A 2WDQA 3K7QX 3SFDA 4CNJA 5C3JA 1ONFA 1PBDA 3R9UA 3VRAA 3CNDA 1N1PA 2O9ZA 4J34A 3NHOX 1CL0A 2B9WA 4U8IA 4YKFA 3M12A 3NN6X 4K22A 4BV6A 4ZN0A 3Q6JA 4U8NA 5KOXA 2YVFA 2YWLA 2YR6A 4C3XA 1EL8A 1JEHA 2GAHB 4K5SA 3CGCA 1OJDA 1MXTA 3ALMA 3ICSA 3NG7X 3IF9A 3CGEA 3EAOA 4DSGA 2EQ9A 4UDQA 4BK1A 2XFOA 3B3RA 3QVRA 4EQWA 5M0ZA 3GSIA 4U8PA 2B7RA 3CN8A 5JCKA 4EQXA 1M64A 2WU2A 2VZ2A 4FDCB 1NENA 2YG3A 1GRAA 3NRNA 4YWOA 3UKLA 3QSSA 1K0JA 3H8LA 4C77A 3QSEA 3KA7A 1COYA 5KWFA 2APGA 2QAEA 2C3CA 1CF3A 4B69A 1F3PA 3ISHA 4U8OA 3V3OA 2V61A 3ITJA 4K7ZA 2BABA 3BNUA 3SM8A 2B7SA 3II4A 2XFNA 2YM1A 4ADWA 1QLBA 2R46A 1PJ5A 4J56A 3SFEA 2C75A 4GF7A 4P9SA 2C76A 3AECA 1Z6LA 1LPFA 2X8GA 3BHFA 3OZ2A 3P4PA 2FJDA 4X4JA 1CC6A 1GXFA 3V76A 2VVMA 4C5OA 1KNRA 4YSXA 5EB5A 1NEKA 2Q7VA 2BYBA 5HHFA 4YTPA 1YKJA 2PHHA 2AQJA 2GAGB 3LOVA 4CRTA 3P4QA 4CBQA 3QJ4A 2BCPA 4B68A 1CHUA 2V3AA 4J31A 1GV4A 3GYIA 3KU9A 1NHSA 2DKIA 3P9UA 3G5QA 3NLCA 3E1TA 2R9ZA 5CKUA 3AEBA 1L9DA 1ZY8A 2WOVA 2ACZA 5BUKA 1OJCA 5JCLA 2GVCA 1EL9A 5FS9A 3RHAA 3NGCX 1PDHA 4ICYA 4U2LA 1CC2A 1IUSA 1N4UA 3LB8A 2H89A 4U8MA 1ZOYA 3UOZA 2XVEA 1O95A 2WEUA 4A65A 2QA1A 1GESA 4H4YA 3F8RA 3BI5A 3UTEA 4EM4A 5M10A 3ZYXA 3IHMA 4OPCA 1KNPA 3NYFA 3GDPA 2C73A 2C72A 3D8XA 3DK9A 4Y4MA 4EMWA 3CNTA 1ZDLA 1VG9A 3B6DA 4YTMA 1Q9IA 1NPXA 4AT2A 3S61A 3P4SA 4APNA 1E1KA 2E5VA 4H50A 2BK4A 4A5LA 2R0GA 4C3YA 3I3LA 2J3NA 3GDNA 1NHPA 3H4KA 3EPTA 2C67A 2AR8A 1E6EA 1MO9A 2C65A 2JAEA 1EL5A 1IJHA 2WQYA 1PN0A 1PJ7A 1RYIA 1XPQA 4JN9A 1GNDA 1H86A 4OVIA 4D04A 1E1MA 2XFQA 2B76A 4H4WA 4WX1A 2GRTA 3UKFA 2B9XA 2WU5A 3AWIA 4IA5A 4OPLA 3UOXA 4B64A 4ZCCA 4JNQA 4AP3A 3EF6A 1GRGA 3UKPA 3AEAA 1XANA 5HXIA 1YY5A 2E1MA 5HYMA 3DH9A 3V3NA 1H6VA 1CJ4A 1GERA 1DNCA 2XLRA 5IPYA 3GRTA 2F5ZA 1TDOA 1FECA 3C4AA 1GALA 3UKQA 1M6IA 3UP4A 2OALA 3CGBA 2YLXA 3AD8B 1H81A 4B66A 1F8RA 2WDRA 3KLJA 5J7XA 5U25A 3RNMA 3CNJA 2XDOA 3SGLA 1KF6A 5ER0A 5TR3A 4J33A 3AE8A 3QFAA 2ZZCA 1W4XA 1ZMCA 2BCGG 4Z26A 1D4CA 1VRQB 2W0HA 4A7AA 1HYUA 2YLZA 1IUXA 5LV9A 1NG4A 3DJEA 4H2NA 4H2QA 1GRBA 2VQ7A 3AEGA 3BI4A 4AP1A 3CIRA 2YAUA 3CNPA 1H7WA 2WDVA 4OPIA 2C3DA 1D4EA 4REKA 1DOEA 2XLSA 4I59A 2WHDA 4JQ9A 2YLWA 4TM1A 2OA1A 3PS9A 1GEUA 1LVLA 2YVJA 2JB1A 2YG7A 4H4SA 3WE0A 4Z2UA 4FK1A 1Y56B 2WOWA 2WESA 1JU2A 2R0PA 2WS3A 3VR8A 3ZDNA 2CULA 3LXDA 2BA9A 5HY5A 4J36A 3HZLA 3NKSA 4TLXA 4U2TA 5DBJA 4GCMA 1LTXR 3BHKA 3IHGA 1REOA 4K5RA 5JCNA 2H88A 3GD4A 1IUTA 4UP3A 2UZZA 3QVPA 4J57A 1L9EA 2VRLA 3C96A 4B67A 1RP0A 4TM4A 4CY8A 1P2HA 3AE2A 2XFPA 1PJ6A 2NPXA 4TM0A 1NDAA 4H4PA 4LIIA 2YG4A 4X9MA 5FS6A 1DOCA 4H4XA 2BK5A 1JNRA 4KX6A 2WPFA 4H4RA 3L8KA 2CDUA 2JK6A 1DODA 1O94A 1H7XA 4LU6A 3NK2X 4IVMB 2XVHA 1NHQA 4ECHA 2VVLA 1CC4A 2WPEA 2XCGA 2R45A 4WCTA 4YSHA 2GR1A 2V60A 2GV8A 1GETA 1GTHA 2BS4A 3AEDA 4J2WA 3NT6A 1KDGA 2GR3A 4CNKA 1D7YA 2EQ8A 1ZOVA 4CCQA 3FIMB 1FCDA 2OAMA 3NNEA 4IVOB 1X31B 4H4TA 2BC1A 2Q0KA 3L1RA 1DXLA 2BC0A 2A8XA 2XLUA 3AB1A 3M13A 1B37A 2XVIA 2WP6A 1CJ3A 2ARDA 1FEBA 2JB2A 4YSZA 4OCGA 2ZZ0A 1L9CA 5J60A 4BJYA 3SQPA 3ICTA 5KRQA 3RP6A 1DOBA 2JKCA 2RABA 2NVKX 2WBAA 2Y6RA 2GR2A 3AYLA 4N9XA 2IIDA 1YQ3A 1L0VA 3AEFA 5KXJA 1PXAA 2FJAA 4Z2RA 3UTFA 4Z43A 3DJGX 5CQFA 3BI2A 3M0OA 5EOWA 5JCIA 2TMDA 4JDRA 4H7UA 4A6NB 4RSLA 4EMIA 5GSNA 3UKKA 1E1NA 3KD9A 1ELIA 1F6MA 1DJQA 3NK0X 3VRBA 2B9YA 1E1LA 3F8DA 2IVDA 3RP8A 5BULA 2RGJA 4BURA 2XLTA 4UDRA 4EMJA 1RSGA 3ABVA 2GR0A 2C7GA 4GDPA 4U8KA 4H4VA 1PS9A 4U8JA 3S5WA 2GF3A 4H4ZA 2BS2A 4A99A 1JRZA 2R4EA 3AD7B 2YR5A 4OPTA 2R4JA 4Z2TA 5EBKA 3DK4A 4UDPA 1S2QA 1GSNA 5GRTA 3KVEA 1K0LA 1IUUA 1AOGA 1DJNA 2I0ZA 3O0HA 4AT0A 3DK8A 1GOSA 3AE1A 3UOYA 3EANA 1XHCA 1FEAA 2ZBWA 1ZMDA 3CTYA 1OJ9A 1Y56A 3AXBA 3FBSA 3LJPA 1Q1WA 1QJDA 1PHHA 2QA2A 2YVGA 2GMHA 1O5WA 4GUVA 3UTGA 1N4WA 1CJCA 2IVEA 3GRSA 4YSYA 2BK3A 3NK1X 3K30A 1H84A 3QSMA 3CPHG 3DJJA 3IC9A 3AYIA 3GWDA 1GREA 1V59A 1CBOA 3KPFA 4OPUA 4YKGA 1GTEA 2C70A 3ICRA 4YXDA 3GYJA 2C64A 1Q1RA 4NZHA 3COXA 3T37A 4TM3A 3Q9TA 1BWCA 5JCMA 1H83A 4JY2A 2GH5A 4PAAA 1JOAA 2XVJA 4H4QA 4EQSA 4D03A 3AEEA 1IUVA 1E7PA 4CY6A 4HB9A 4B65A 1JNZA 3VQRA 3GD3A 4EIQA 2V3BA 2OLOA 2V6OA 1YQ4A 4H4UA 4K8DA 4USRA 3OC4A 2VOUA 2WP9A 1NAAA 2RGOA 2XVFA 3DJDA 5U63A 5BRTA 1JRYA 1TYPA 3UCLA 4NTCA 3LADA 3NIXA 1YQZA 4XWZA 3CGDA 1NG3A 3ATRA 2YR4A 1FOHA 4H2PA 3PVCA 5U1OA 2BS3A 2EQ7A 2TPRA 2R0CA 3JSKA 2Q6UA 2CVJA 2EQ6A 4I58A 2YQUA 2A87A 2BXSA 1F8SA 1TDFA 2VVLG 2XYOA 3URHA 1TYTA 1K0IA 1OJTA 3G5SA 3PO7A 2E4GA 4RG4A 1BZLA 1B4VA 5FMHA 1BGNA 1PBBA 3DA1A 3K7MX 4JY3A 2JBVA 3UKHA 1VQWA 4Y4NA 2JB3A 1P2EA 3ALJA 4X9NA 4DSHA 5KOWA 1GRHA 1EL7A 1GPEA 2HQMA 1UKVG 4NEWA 2Z5YA 3C4NA 3NN0X 2FJBA 4C74A 2VQBA 3RP7A 3UTHA 2YM2A 3BNMA 5L46A 4AOSA 2YLTA 2X99A 2YG5A 1B8SA 1F8WA 1S3EA 3G5RA 4KPRA 1IUWA 1OJAA 4GDEA 4H2RA 3FG2P 4Y4LA 1S3BA 1SEZA 2DKHA 2CFYA 3AE4A 3UP5A 4IA6A 3F8PA 2GQFA 4B1BA 1Y0PA 4BJZA 3REDA 3GMCA 3D1CA 3NH3X 4ZCDA 4A6NA 4RG3A 1ZP0A 2YLRA 3NYCA 3GMBA 4Z44A 4GRTA 3AE3A 2PYXA 4K2XA 5KVIA 1D4DA 4OPDA 1GRTA 1D7LA 1PXCA 4FX9A 4LA1A 4BK2A 1N4VA 3LZXA 1QO8A 4GR1A 4JNAA 2GMJA 2FBWA 5C2TA 2BACA 2Q0LA 1D5TA 2FJEA 4OPGA 3AE9A 3FPZA 3NTAA 4A79A 4HA6A 4O5UA 4AOXA 3FMWA 4E0VA 2XLPA 4YTNA 2X3NA 3AYJA 4XWRA 4NTDA 4MJWA 2Y6QA 4A9WA 4Z25A 2GEWA 4IV9A 3AD9B 1BKWA 1TDEA 3H8IA 3P4RA 1H82A 5IQ1A 3VRDB 3CNSA 3ADAB 1B5QA 1E39A 1TRBA 3GWFA 1LV0A 3LZWA 4NTEA 2XFUA 3UKAA 2RGHA 1ZX9A 4M52A 1LQTA 2WETA 4PABA 2YLSA 3DMEA 1LQUA 1JRXA 1KSSA 1XDIA 1PBFA 1LJ1A 3CPIG 2WPCA 5KVHA 5IQ4A 1TDKA 1KFYA 2GB0A 2Z5XA 5BVAA 2OLNA 4FK1C 2ZZBA 1BF3A 2WP5A 1NHRA 2V5ZA 3ALLA 1ZK7A 1ZKQA 2X8CA 4EQRA 5EB4A 3DGHA 3QFBA 3AE6A 4USQA 1K4QA 4U8LA 1TDNA 4EM3A 1CJ2A 3AE5A 2AAQA
chains in the Genus database with same CATH superfamily
1R6WA 3DGZA 1S2YA 1FL2A 3CMMA 2GGEA 2P8BA 4G6GA 4XXGA 4TLZA 4YT0A 4O5QA 4DGKA 3SY4A 1PBDA 3GD6A 2OFJA 2O9ZA 3NHOX 4G73A 3M12A 4BV6A 4ZN0A 2YVFA 4C3XA 1EL8A 5KNLA 1S7MA 2GAHB 3JVAA 3CGCA 1OJDA 1MXTA 4GAVA 2EQ9A 4UDQA 1NELA 4U8PA 2DW7A 2GSHA 1K0JA 4C77A 1H2IA 2C3CA 3ISHA 4U8OA 2OVLA 3V3OA 3BNUA 2YM1A 4ADWA 1QLBA 2R46A 4J56A 3R25A 2C76A 3DDMA 3BHFA 1BQGA 2FYMA 1CC6A 3V76A 5HHFA 5FJRA 2PP1A 4B68A 2V3AA 3NLCA 5CKUA 5BUKA 1OJCA 1EL9A 3RHAA 1PDHA 2OZ8A 1CC2A 3LB8A 2H89A 4U8MA 3UCDA 2QA1A 4H4YA 3UTEA 4EM4A 4GIRA 5M10A 3NYFA 2C72A 3DK9A 4Y4MA 2CHRA 3B6DA 3A7RA 3P4SA 4APNA 1ZXIC 4C3YA 4GGHA 2J3NA 1NHPA 2AR8A 1E6EA 3I4KA 2WQYA 4H2HA 1H86A 3UGVA 4B64A 3HW2A 4ZCCA 3AEAA 3DH9A 2AL2B 2XLRA 1DNCA 3T14A 3IJIA 1ZMCA 2W0HA 1HYUA 1IUXA 4KEMA 4H2NA 4AP1A 2C3DA 1D4EA 3UJRA 2XLSA 4I59A 3CXOA 2OA1A 3PS9A 2JB1A 2YG7A 3WE0A 4Z2UA 2WS3A 4DHGA 4ZOHB 3H7VA 3R1ZA 2BA9A 4TLXA 5JCNA 2H88A 3GD4A 3ETRB 2VRLA 4H1ZA 2XFPA 3SQSA 4JN7A 4H4RA 2JK6A 4ZA0A 3UJSA 3ZVIA 2XCGA 3H8AA 4YSHA 2GR1A 2V60A 2GV8A 1GTHA 3AEDA 1KDGA 3H70A 1WUEA 3FIMB 3NNEA 2Q0KA 2XLUA 3RCYA 1B37A 2WP6A 1CJ3A 1FEBA 4YSZA 4OCGA 2QDDA 3Q45A 2WBAA 2GR2A 4NNJA 1YQ3A 1L0VA 3AEFA 5KXJA 1PXAA 1JDFA 3OTRA 4Z43A 1X2GA 3UKKA 3KD9A 5BOEA 3VRBA 2GGIA 4BURA 4UDRA 4U8KA 4H4VA 3S5WA 4MMWA 2YR5A 5EBKA 3NVWB 7ENLA 4DYEA 4HCDA 3T4WA 1AOGA 2I0ZA 3NRZB 1GOSA 4X2PA 2ZBWA 3EEZA 3AXBA 1QJDA 2GMHA 3TTEA 3SR6B 2I5QA 1V59A 2HXTA 4OPUA 3OW1A 3FVDA 1Q1RA 3T37A 3DFHA 5JCMA 3TQPA 1JOAA 4H4QA 2OQHA 3T9PA 3GY1A 1E7PA 4CY6A 1JNZA 3VC5A 2V3BA 3QKEA 4USRA 4K8DA 1T3QC 1NAAA 3DJDA 5U63A 1JRYA 4GISA 4NTCA 3NIXA 1YQZA 3CGDA 3QN3A 3ATRA 3PFRA 3SXIA 2BS3A 2EQ7A 2Q6UA 2XYOA 3URHA 2QDEA 1BZLA 1PBBA 4Y4NA 4DSHA 2XH7A 3BNMA 3UJFA 3IK4A 4HYRA 3FG2P 5KMQA 3UP5A 4IA6A 3NH3X 3NYCA 3AE3A 3KPKA 3DFYA 4NWZA 5KVIA 4OPDA 4FX9A 4LA1A 4GR1A 3Q4DA 2FJEA 3FPZA 3NTAA 4AOXA 4E0VA 3L5OA 2XLPA 2OZTA 4NTDA 4Z25A 4IV9A 2OZ3A 3V4BA 1TRBA 1LV0A 3LZWA 3U4FA 2WETA 3DMEA 1XDIA 5KVHA 3BOXA 3V5CA 2OLNA 2ZZBA 2WP5A 2X8CA 4DN1A 3DGHA 3AE6A 4Z1YA 1K4QA 1TDNA 3GMBA 1EBGA 3CPJG 1VG0A 3VR9A 2WOIA 2GDQA 3UOVA 3NTDA 2MNRA 1MOKA 1GRFA 3K7TA 1PBCA 2WDQA 2XGZA 3K7QX 1ONFA 3VRAA 4YKFA 4U8IA 1FFVC 3NN6X 4E6MA 4K22A 4U8NA 2YWLA 1YEYA 2PTWA 5IDZA 3STPA 3RR1A 5FJOA 3CGEA 3EAOA 4DSGA 4BK1A 6ENLA 4JHMA 5JCKA 1M64A 2WU2A 1N5XA 4YWOA 2ZC8A 3QSEA 3KA7A 3OZMA 1COYA 5KWFA 4B69A 3T0KA 2V61A 3CT2A 3HYXA 1PJ5A 3AECA 1MRAA 1LPFA 2X8GA 4TVYA 4KPLA 1GXFA 3HRDC 4C5OA 3T6CA 2Q7VA 3AN1A 3LOVA 4CRTA 3P4QA 4CBQA 3QJ4A 1CHUA 4J31A 3CB3A 1GV4A 2DKIA 3P9UA 3G5QA 3E1TA 5BOFA 1L9DA 2GVCA 5FS9A 1N4UA 2XVEA 1O95A 3ZYXA 2GL5A 3GDPA 3IJQA 3D8XA 1N63C 3CNTA 2PCEA 4IT1A 1NPXA 2O56A 1E1KA 3SZ0A 2C67A 4HCLA 1PN0A 3UXLA 3JZUA 2PGWA 1E1MA 5FJPA 2B76A 4WX1A 3UKFA 3T31A 3SN0A 3UOXA 4IA5A 3MQTA 3GO2A 2PODA 3T2ZA 5HYMA 2E1MA 1H6VA 1GERA 5IPYA 3GRTA 1TDOA 3UP4A 2QGYA 3AD8B 4B66A 2WDRA 5J7XA 3CNJA 3SGLA 3N4FA 4J33A 3AE8A 3QFAA 1N62C 3R11A 4Z26A 3BJSA 2YLZA 4H2QA 2VQ7A 3BI4A 3AEGA 2YAUA 3D46A 2WHDA 1LVLA 4H4SA 3IJLA 3B97A 4FK1A 1Y56B 5HY5A 4M6UA 5J04A 3NKSA 4U2TA 5DBJA 2P88A 3IHGA 3BHKA 3VFCA 4UP3A 1L9EA 4TM4A 4CY8A 4MKSA 4TM0A 5FS6A 1DOCA 2WPFA 2CDUA 3NS1B 3HYWA 3TJIA 4LU6A 3NK2X 2E5AA 1NHQA 4ECHA 3NVZB 3HYVA 3EUB3 2WPEA 4WCTA 3MSYA 1GETA 4J2WA 4IHCA 2QQ6A 4CNKA 3RITA 1TKKA 3RRAA 4GYPA 3QPEA 3D47A 2BC1A 3L1RA 3M13A 2XVIA 1SJDA 3BSMA 2JB2A 1L9CA 3SQPA 2IIDA 1JROA 3HPFA 4G7FA 3DJGX 2XSXA 5EOWA 4A6NB 2TMDA 4RSLA 5BULA 2IVDA 3RP8A 1RSGA 2GR0A 2C7GA 4GDPA 4U8JA 1PS9A 4H4ZA 2BS2A 4OPTA 3DK4A 4UDPA 1S2QA 3TCSA 1K0LA 1IUUA 4JN8A 5ENLA 3R10A 3UOYA 3EANA 4ZCWA 1OJ9A 1Y56A 3FBSA 3SBFA 2YVGA 4GUVA 3RGTA 1O5WA 3UTGA 1N60C 4YSYA 3S5SA 1CJCA 1R0MA 3NK1X 3QSMA 4K1WA 3DJJA 1CBOA 3D9XA 2C70A 3ICRA 4H83A 3N6JA 3COXA 3Q9TA 2XH4A 3SSZA 1PDYA 2XVJA 4EQSA 3ZLHA 1IUVA 4GGBA 4HB9A 5EU9A 2GGJA 4A3RA 2OLOA 1YQ4A 2XVFA 3NVVB 3TWBA 4XWZA 3A7AA 2YR4A 4H2PA 3PVCA 5U1OA 2TPRA 3JSKA 1TDFA 3PO7A 1TYTA 1K0IA 3K7MX 4A6GA 4X9NA 5KOWA 4G8TA 2VQBA 3UTHA 2YM2A 1KD0A 1B8SA 3G5RA 4KPRA 1OJAA 1EC8A 2GQFA 4B1BA 2PU1A 4ZCDA 4A6NA 3CXBA 1D4DA 3K1GA 1N4VA 1VQZA 2GMJA 5C2TA 2BACA 1D5TA 2AL2A 3AE9A 1EBHA 4A79A 4O5UA 3FMWA 3ZLGA 4YTNA 2X3NA 3AYJA 2OG9A 1BKWA 3H8IA 3P4RA 3TOYA 1H82A 1DTNA 1B5QA 4PABA 2YLSA 2P0IA 1LQUA 1KSSA 1PBFA 3CPIG 5IQ4A 1KFYA 3R07C 5BVAA 4FK1C 1NHRA 2V5ZA 1ZKQA 2OPJA 2W3RA 4EQRA 3QFBA 1MDLA 1STZA 4U8LA 4Z17A 3AE7A 1F9CA 3KKJA 3OZYA 3QLDA 5G5GB 2X8HA 3ES7A 3NYEA 2A89A 1PXBA 4ROPA 4EIPA 2BRYA 2X50A 1KSUA 2BXRA 4NEVA 4G6HA 4CCRA 3SFDA 5C3JA 4CNJA 1N1PA 4F4RA 4J34A 1N61C 4G74A 2GGGA 3Q6JA 2YR6A 3EKGA 4K5SA 4HNLA 3IF9A 4GYPC 3B3RA 4EQWA 2AL1A 2B7RA 3CN8A 4EQXA 3NO1A 4E5TA 1NENA 1GRAA 3NRNA 3UKLA 3QSSA 1W6TA 3AM9A 4YWSA 3GYXA 1EC9A 4HN8A 1CF3A 1F3PA 3I6TA 3ITJA 4K7ZA 2BABA 2P3ZA 2B7SA 1NU5A 2XFNA 2C75A 4GF7A 4P9SA 1Z6LA 4FP1A 3P4PA 2FJDA 3QTPA 2VVMA 5EB5A 1NEKA 4YTPA 2PHHA 2AQJA 4HCHA 3P3BA 3KU9A 1NHSA 3AEBA 2ACZA 1MNSA 2WOVA 3MZNA 5JCLA 5FJUA 4U2LA 1IUSA 1ZOYA 2QJJA 3A7UA 1GESA 3F8RA 2C73A 4EMWA 1VG9A 2PU0A 3H12A 4H50A 2BK4A 4A5LA 3I3LA 1JPMA 3GDNA 1MUCA 3H4KA 3EPTA 4II3A 2C65A 1EL5A 1PJ7A 1RYIA 4JN9A 1GNDA 4OVIA 2GRTA 2B9XA 4OPLA 4JNQA 4IP5A 4AP3A 1GRGA 3DESA 1YY5A 5HXIA 3ZVHB 3SN4A 2W3SA 1FECA 3C4AA 1GALA 2YLXA 1F8RA 5U25A 2XDOA 5ER0A 1SJCA 5TR3A 2ZZCA 1W4XA 1L8PA 2BCGG 3CYJA 1VRQB 5LV9A 4ENLA 3UJEA 3MKCA 1H7WA 2WDVA 3DGBA 1FFUC 3DERA 3VCCA 3SZCA 1GEUA 1JRPA 3FJ4A 4E8GA 1JU2A 2R0PA 3VR8A 1FHUA 3LXDA 3CK5A 1X2HA 4GCMA 1OEPA 2UZZA 3QVPA 4J57A 3C96A 3FYYA 4B67A 1P2HA 3GC2A 4GMEA 3AE2A 1PJ6A 1TZZA 4LIIA 3SN1A 4H4XA 1O94A 1H7XA 2QJMA 3JW7A 2R45A 4IL2A 3ENLA 4KT2A 5KMPA 1TE6A 4G9KA 1ZOVA 3R0KA 2OAMA 3OPSA 2PA6A 1X31B 4H4TA 2ARDA 2ZZ0A 1KCZA 4BJYA 5KRQA 3PWGA 1FIQB 2Y6RA 4N9XA 1BKHA 4HNCA 1WUFA 2FJAA 3UTFA 5CQFA 5JCIA 1E1NA 4IL0A 1F6MA 2B9YA 1E1LA 3F8DA 2RGJA 2OLAA 3I6EA 2GF3A 4A99A 1JRZA 2OX4A 5GRTA 3PWIA 3T2YA 1DJNA 1EC7A 3O0HA 4AT0A 3DK8A 1XHCA 1FEAA 1ZMDA 3CTYA 1ONEA 1Q1WA 1PHHA 2QA2A 1N4WA 2IVEA 3GRSA 1H84A 5KMRA 3GWDA 1GTEA 4J1OA 1FO4A 3ZLFA 4PAAA 4JY2A 2GH5A 3ES8A 4HPNA 2HXUA 2PP0A 4D03A 3AEEA 3UCCA 4B65A 3VQRA 3GD3A 4EIQA 4H4UA 2HZGA 3N4EA 2VOUA 4A35A 3SZFA 4H19A 2QVHA 5BRTA 3FCPA 3LADA 1FOHA 2ZADA 2R0CA 5KMSA 2CVJA 2EQ6A 2YQUA 2A87A 2BXSA 2VVLG 5M0ZA 2E4GA 2FKPA 1B4VA 5FMHA 3DA1A 4JY3A 3DG6A 2JBVA 3T2KA 1P48A 1PDZA 1P2EA 1GRHA 1GPEA 2HQMA 4NEWA 2Z5YA 3C4NA 3NN0X 4C74A 4AOSA 2YLTA 2X99A 2YG5A 4E4UA 2BRAA 1S3EA 4GDEA 4Y4LA 1JPDX 1S3BA 1SEZA 2DKHA 1V97A 4BJZA 2XH0A 3D1CA 4RG3A 1ZP0A 2YLRA 4IZGA 4Z44A 2PYXA 1D7LA 1QO8A 4JNAA 2Q0LA 4OPGA 2OO6A 3RO6A 4HA6A 3DG7A 2AKMA 4MJWA 2Y6QA 4A9WA 2GEWA 3CNSA 3ADAB 3GWFA 2XFUA 1FHVA 1ZX9A 2PP3A 4M52A 1LQTA 3CAWA 1JRXA 1TDKA 3UJ2A 1BF3A 1ZK7A 2PGEA 3NXLA 4EM3A 1CJ2A 3AE5A 1VDCA 5FS7A 4GAPA 4B63A 1EBDA 4DXKA 2GQWA 1GT8A 3ATQA 4DNAA 4BK3A 2OKTA 2YG6A 2C66A 2VRMA 1ECQA 1PBEA 5FS8A 3I6DA 1BGJA 2PS2A 3P1WA 3IWAA 4U2SA 2QCUA 4Z24A 1WYGA 3R9UA 3CNDA 1CL0A 2B9WA 3DG3A 5KOXA 2RDXA 1JEHA 3MY9A 3NG7X 3ALMA 3ICSA 2PTZA 3V3WA 2XFOA 3QVRA 2W54A 3GSIA 2VZ2A 4FDCB 2YG3A 3SX6A 3H8LA 1E9IA 2APGA 2QAEA 2C4CA 2HNEA 3SM8A 3V5FA 3II4A 3SZWA 3SFEA 4X4JA 3OZ2A 4MGGA 1KNRA 4YSXA 2BYBA 1YKJA 2GAGB 2BCPA 4KWSA 3GYIA 2R9ZA 1VDVA 3P0WA 4K8GA 1IYXA 1KKOA 1ZY8A 3NGCX 4ICYA 4EWJA 3UOZA 2WEUA 4A65A 3BI5A 3IHMA 4OPCA 1KNPA 1ZDLA 4YTMA 1Q9IA 4AT2A 3S61A 2E5VA 3S47A 2R0GA 4E4FA 3N6HA 1MO9A 2JAEA 1IJHA 3R0UA 1XPQA 4D04A 2XFQA 4H4WA 5JRBA 2WU5A 3AWIA 3EF6A 3UKPA 1XANA 4J3ZA 1P43A 3V3NA 1XPYA 1CJ4A 3MUCA 2F5ZA 3UKQA 1M6IA 3PK7A 2OALA 3CGBA 1H81A 3KLJA 3RNMA 1KF6A 3NFUA 1D4CA 1KN0A 5G5HB 4A7AA 3AMZA 1XS2A 4GFIA 1NG4A 3DJEA 1GRBA 2NQLA 3FV9A 3CIRA 3CNPA 4OPIA 4REKA 1DOEA 4JQ9A 2YLWA 4TM1A 3VDGA 2YVJA 3KUMA 3PG6A 2WOWA 2WESA 3ZDNA 2CULA 4M0XA 4J36A 3HZLA 5FJTA 1LTXR 1REOA 4K5RA 4II2A 3VA8A 3TWAA 1IUTA 2GGHA 2PMQA 4TVWA 4K2SA 1RP0A 2OQYA 3OP2A 3UXKA 3VC6A 2NPXA 1NDAA 4H4PA 2YG4A 4X9MA 2BK5A 1JNRA 4KX6A 3L8KA 1DODA 1SB3B 4IVMB 2XVHA 2VVLA 2QJNA 1CC4A 2BS4A 3NT6A 2GR3A 1D7YA 2EQ8A 4CCQA 1FCDA 4IVOB 3NVYB 1DXLA 2BC0A 2A8XA 3AB1A 5J60A 2PSNA 3ICTA 4FI4A 1DOBA 2JKCA 3RP6A 2RABA 2NVKX 3AYLA 2DW6A 4Z2RA 3BI2A 3M0OA 4H7UA 4JDRA 4EMIA 5GSNA 1ELIA 1DJQA 3NK0X 1RVKA 2XLTA 4EMJA 3ABVA 3DEQA 2R4EA 3AD7B 2R4JA 4Z2TA 2MUCA 1JCTA 1GSNA 3KVEA 3THUA 1SJAA 3AE1A 3LJPA 2POZA 3SJNA 3P93A 2BK3A 3K30A 3U9IA 3CPHG 3IC9A 3AYIA 1GREA 3KPFA 3TJ4A 2P8CA 4YKGA 3DIPA 4YXDA 3GYJA 2C64A 4NZHA 1SJBA 2PPGA 4DWDA 4DX3A 4TM3A 1BWCA 2ONEA 1MDRA 1H83A 2V6OA 3OC4A 2WP9A 2RGOA 3TW9A 1TYPA 3UCLA 3B9JB 1RM6B 1NG3A 2PTYA 3SYIA 4I58A 1F8SA 3G5SA 1OJTA 4RG4A 1BGNA 3UKHA 1VQWA 3VCNA 2JB3A 3ALJA 1EL7A 1UKVG 2XH2A 2FJBA 3RP7A 4IP4A 5L46A 2W55A 1ELSA 1F8WA 1IUWA 4H2RA 2CFYA 3AE4A 3F8PA 1Y0PA 3REDA 3GMCA 3FXGA 4GRTA 3MWCA 4K2XA 1GRTA 2E3TA 1PXCA 4BK2A 1N5WC 3LZXA 2FBWA 3ZVHA 4XWRA 3AD9B 1TDEA 5IQ1A 3NZGA 3VRDB 1E39A 4NTEA 3UKAA 3T8QA 2RGHA 1KKRA 2PTXA 1LJ1A 2WPCA 2GB0A 2Z5XA 2AKZA 3ALLA 5EB4A 4USQA 2AAQA
chains in the Genus database with same CATH topology
1VDCA 3AE7A 3CPJG 3DGZA 1VG0A 5FS7A 3KKJA 4GAPA 1EBDA 1S2YA 4B63A 2GQWA 1FL2A 1GT8A 3CMMA 3ATQA 4DNAA 4BK3A 2YG6A 2X8HA 3VR9A 2C66A 2VRMA 3NYEA 4G6GA 4XXGA 1PBEA 5FS8A 2WOIA 2A89A 1PXBA 4TLZA 4YT0A 3I6DA 4O5QA 1BGJA 3UOVA 3NTDA 1MOKA 4EIPA 1GRFA 3P1WA 2BRYA 3IWAA 3K7TA 4DGKA 1PBCA 2X50A 3SY4A 1KSUA 2BXRA 4NEVA 2QCUA 4G6HA 4U2SA 4Z24A 4CCRA 2WDQA 3K7QX 3SFDA 4CNJA 5C3JA 1ONFA 1PBDA 3R9UA 3VRAA 3CNDA 1N1PA 2O9ZA 4J34A 3NHOX 1CL0A 2B9WA 4G73A 4U8IA 4YKFA 4G74A 3M12A 3NN6X 4K22A 4BV6A 4ZN0A 3Q6JA 4U8NA 5KOXA 2YVFA 2YWLA 2YR6A 4C3XA 1EL8A 5KNLA 1JEHA 1S7MA 2GAHB 4K5SA 3CGCA 1OJDA 1MXTA 3ALMA 3ICSA 3NG7X 3IF9A 3CGEA 4GAVA 3EAOA 4DSGA 2EQ9A 4UDQA 4BK1A 2XFOA 3B3RA 3QVRA 4EQWA 5M0ZA 3GSIA 4U8PA 2B7RA 3CN8A 5JCKA 4EQXA 1M64A 2WU2A 2VZ2A 4FDCB 1NENA 2YG3A 1GRAA 3NRNA 3SX6A 4YWOA 3UKLA 3QSSA 1K0JA 3H8LA 4C77A 3QSEA 3KA7A 1H2IA 1COYA 5KWFA 2APGA 2QAEA 3GYXA 2C3CA 1CF3A 4B69A 1F3PA 2C4CA 3T0KA 3ISHA 4U8OA 3V3OA 2V61A 3ITJA 4K7ZA 2BABA 3BNUA 3SM8A 2B7SA 3II4A 2XFNA 2YM1A 4ADWA 3HYXA 1QLBA 2R46A 1PJ5A 4J56A 3SFEA 3SZWA 2C75A 4GF7A 4P9SA 2C76A 3AECA 1Z6LA 1LPFA 2X8GA 3BHFA 3OZ2A 3P4PA 2FJDA 4X4JA 1CC6A 1GXFA 3V76A 2VVMA 4C5OA 1KNRA 4YSXA 5EB5A 1NEKA 2Q7VA 2BYBA 5HHFA 4YTPA 1YKJA 2PHHA 2AQJA 2GAGB 3LOVA 4CRTA 3P4QA 4CBQA 3QJ4A 2BCPA 4B68A 1CHUA 2V3AA 4J31A 1GV4A 3GYIA 3KU9A 1NHSA 2DKIA 3P9UA 3G5QA 3NLCA 3E1TA 2R9ZA 5CKUA 3AEBA 1L9DA 1ZY8A 2WOVA 2ACZA 5BUKA 1OJCA 5JCLA 2GVCA 1EL9A 5FS9A 3RHAA 3NGCX 1PDHA 4ICYA 4U2LA 1CC2A 1IUSA 1N4UA 3LB8A 2H89A 4U8MA 1ZOYA 3UOZA 2XVEA 1O95A 2WEUA 4A65A 2QA1A 1GESA 4H4YA 3F8RA 3BI5A 3UTEA 4EM4A 5M10A 3ZYXA 3IHMA 4OPCA 1KNPA 3NYFA 3GDPA 2C73A 2C72A 3D8XA 3DK9A 4Y4MA 4EMWA 3CNTA 1ZDLA 1VG9A 3B6DA 4YTMA 1Q9IA 1NPXA 4AT2A 3S61A 3P4SA 4APNA 1E1KA 2E5VA 4H50A 3SZ0A 2BK4A 4A5LA 2R0GA 4C3YA 3I3LA 2J3NA 3GDNA 1NHPA 3H4KA 3EPTA 2C67A 4II3A 2AR8A 1E6EA 1MO9A 2C65A 2JAEA 1EL5A 1IJHA 2WQYA 1PN0A 1PJ7A 1RYIA 1XPQA 4JN9A 1GNDA 1H86A 4OVIA 4D04A 1E1MA 2XFQA 2B76A 4H4WA 4WX1A 2GRTA 3UKFA 3T31A 5JRBA 2B9XA 2WU5A 3AWIA 4IA5A 4OPLA 3UOXA 4B64A 4ZCCA 4JNQA 4AP3A 3EF6A 1GRGA 3UKPA 3AEAA 1XANA 3T2ZA 5HXIA 1YY5A 2E1MA 5HYMA 3DH9A 3V3NA 1H6VA 1CJ4A 1GERA 1DNCA 2XLRA 5IPYA 3T14A 3GRTA 2F5ZA 1TDOA 1FECA 3C4AA 1GALA 3UKQA 1M6IA 3UP4A 2OALA 3CGBA 2YLXA 3AD8B 1H81A 4B66A 1F8RA 2WDRA 3KLJA 5J7XA 5U25A 3RNMA 3CNJA 2XDOA 3SGLA 1KF6A 5ER0A 5TR3A 4J33A 3AE8A 3QFAA 2ZZCA 1W4XA 1ZMCA 2BCGG 4Z26A 1D4CA 1KN0A 1VRQB 2W0HA 4A7AA 1HYUA 2YLZA 1IUXA 5LV9A 1NG4A 3DJEA 4H2NA 4H2QA 1GRBA 2VQ7A 3AEGA 3BI4A 4AP1A 3CIRA 2YAUA 3CNPA 1H7WA 2WDVA 4OPIA 2C3DA 1D4EA 4REKA 1DOEA 2XLSA 4I59A 2WHDA 4JQ9A 2YLWA 4TM1A 3SZCA 2OA1A 3PS9A 1GEUA 1LVLA 2YVJA 2JB1A 2YG7A 4H4SA 3WE0A 4Z2UA 4FK1A 3PG6A 1Y56B 2WOWA 2WESA 1JU2A 2R0PA 2WS3A 3VR8A 3ZDNA 2CULA 3LXDA 2BA9A 5HY5A 4J36A 3HZLA 3NKSA 4TLXA 4U2TA 5DBJA 4GCMA 1LTXR 3BHKA 3IHGA 1REOA 4K5RA 5JCNA 2H88A 4II2A 3GD4A 1IUTA 4UP3A 2UZZA 3QVPA 4J57A 1L9EA 2VRLA 3C96A 4B67A 1RP0A 4TM4A 4CY8A 1P2HA 3AE2A 2XFPA 1PJ6A 2NPXA 4TM0A 1NDAA 4H4PA 4LIIA 2YG4A 4X9MA 5FS6A 1DOCA 4H4XA 2BK5A 1JNRA 4KX6A 2WPFA 4H4RA 3L8KA 2CDUA 2JK6A 1DODA 3HYWA 1O94A 1H7XA 4LU6A 3NK2X 4IVMB 2XVHA 1NHQA 4ECHA 3HYVA 2VVLA 1CC4A 2WPEA 2XCGA 2R45A 4WCTA 4YSHA 2GR1A 2V60A 2GV8A 1GETA 1GTHA 2BS4A 3AEDA 4J2WA 5KMPA 3NT6A 1KDGA 2GR3A 4CNKA 4G9KA 1D7YA 2EQ8A 1ZOVA 4CCQA 3FIMB 1FCDA 2OAMA 3NNEA 4IVOB 1X31B 4H4TA 2BC1A 2Q0KA 3L1RA 1DXLA 2BC0A 2A8XA 2XLUA 3AB1A 3M13A 1B37A 2XVIA 2WP6A 1CJ3A 2ARDA 1FEBA 2JB2A 4YSZA 4OCGA 2ZZ0A 1L9CA 5J60A 4BJYA 3SQPA 3ICTA 5KRQA 3RP6A 1DOBA 2JKCA 2RABA 2NVKX 2WBAA 2Y6RA 2GR2A 3AYLA 4N9XA 4NNJA 2IIDA 1YQ3A 1L0VA 3AEFA 5KXJA 1PXAA 2FJAA 4Z2RA 3UTFA 4Z43A 3DJGX 5CQFA 3BI2A 3M0OA 5EOWA 5JCIA 2TMDA 4JDRA 4H7UA 4A6NB 4RSLA 4EMIA 5GSNA 3UKKA 1E1NA 3KD9A 1ELIA 1F6MA 1DJQA 3NK0X 3VRBA 2B9YA 1E1LA 3F8DA 2IVDA 3RP8A 5BULA 2RGJA 4BURA 2XLTA 4UDRA 4EMJA 1RSGA 3ABVA 2GR0A 2C7GA 4GDPA 4U8KA 4H4VA 1PS9A 4U8JA 3S5WA 2GF3A 4H4ZA 2BS2A 4A99A 1JRZA 2R4EA 3AD7B 2YR5A 4OPTA 2R4JA 4Z2TA 5EBKA 3DK4A 4UDPA 1S2QA 1GSNA 5GRTA 3KVEA 1K0LA 1IUUA 3T2YA 1AOGA 1DJNA 2I0ZA 3O0HA 4AT0A 3DK8A 1GOSA 3AE1A 3UOYA 3EANA 1XHCA 1FEAA 2ZBWA 1ZMDA 3CTYA 1OJ9A 1Y56A 3AXBA 3FBSA 3LJPA 1Q1WA 1QJDA 1PHHA 2QA2A 2YVGA 2GMHA 1O5WA 4GUVA 3UTGA 1N4WA 1CJCA 2IVEA 3GRSA 4YSYA 2BK3A 3NK1X 3K30A 1H84A 3QSMA 3CPHG 5KMRA 3DJJA 3IC9A 3AYIA 3GWDA 1GREA 1V59A 1CBOA 3KPFA 4OPUA 4YKGA 1GTEA 3D9XA 2C70A 3ICRA 4YXDA 3GYJA 2C64A 1Q1RA 4NZHA 3COXA 3T37A 4TM3A 3Q9TA 1BWCA 5JCMA 1H83A 4JY2A 2GH5A 4PAAA 1JOAA 2XVJA 4H4QA 4EQSA 4D03A 3AEEA 1IUVA 1E7PA 4CY6A 4HB9A 4B65A 1JNZA 3VQRA 3GD3A 4EIQA 2V3BA 2OLOA 2V6OA 1YQ4A 4H4UA 4K8DA 4USRA 3SZFA 3OC4A 2VOUA 2WP9A 1NAAA 2RGOA 2XVFA 3DJDA 5U63A 5BRTA 1JRYA 1TYPA 3UCLA 4NTCA 3LADA 3NIXA 1YQZA 4XWZA 3CGDA 1NG3A 3ATRA 2YR4A 1FOHA 4H2PA 3PVCA 5U1OA 3SXIA 2BS3A 2EQ7A 2TPRA 2R0CA 3JSKA 5KMSA 2Q6UA 2CVJA 2EQ6A 4I58A 3SYIA 2YQUA 2A87A 2BXSA 1F8SA 1TDFA 2VVLG 2XYOA 3URHA 1TYTA 1K0IA 1OJTA 3G5SA 3PO7A 2E4GA 4RG4A 1BZLA 1B4VA 5FMHA 1BGNA 1PBBA 3DA1A 3K7MX 4JY3A 2JBVA 3T2KA 3UKHA 1VQWA 4Y4NA 2JB3A 1P2EA 3ALJA 4X9NA 4DSHA 5KOWA 1GRHA 1EL7A 1GPEA 2HQMA 1UKVG 4NEWA 2Z5YA 3C4NA 3NN0X 2FJBA 4C74A 2VQBA 3RP7A 3UTHA 2YM2A 3BNMA 5L46A 4AOSA 2YLTA 2X99A 2YG5A 1B8SA 1F8WA 1S3EA 2BRAA 4KPRA 1IUWA 1OJAA 3G5RA 4GDEA 4H2RA 3FG2P 4Y4LA 1S3BA 1SEZA 2DKHA 2CFYA 3AE4A 5KMQA 3UP5A 4IA6A 3F8PA 2GQFA 4B1BA 1Y0PA 4BJZA 3REDA 3GMCA 3D1CA 3NH3X 4ZCDA 4A6NA 4RG3A 1ZP0A 2YLRA 3NYCA 3GMBA 4Z44A 4GRTA 3AE3A 2PYXA 3KPKA 4K2XA 4NWZA 5KVIA 1D4DA 4OPDA 1GRTA 1D7LA 1PXCA 4FX9A 4LA1A 4BK2A 1N4VA 3LZXA 1QO8A 4GR1A 4JNAA 2GMJA 2FBWA 5C2TA 2BACA 2Q0LA 1D5TA 2FJEA 4OPGA 3AE9A 3FPZA 3NTAA 4A79A 4HA6A 4O5UA 4AOXA 3FMWA 4E0VA 3L5OA 2XLPA 4YTNA 2X3NA 3AYJA 4XWRA 4NTDA 4MJWA 2Y6QA 4A9WA 4Z25A 2GEWA 4IV9A 3AD9B 1BKWA 1TDEA 3H8IA 3P4RA 1H82A 5IQ1A 3VRDB 3CNSA 3ADAB 1B5QA 1E39A 1TRBA 3GWFA 1LV0A 3LZWA 4NTEA 2XFUA 3UKAA 2RGHA 1ZX9A 4M52A 1LQTA 2WETA 4PABA 2YLSA 3DMEA 1LQUA 1JRXA 1KSSA 1XDIA 1PBFA 1LJ1A 3CPIG 2WPCA 5KVHA 5IQ4A 1TDKA 1KFYA 2GB0A 2Z5XA 5BVAA 2OLNA 4FK1C 2ZZBA 1BF3A 2WP5A 1NHRA 2V5ZA 3ALLA 1ZK7A 1ZKQA 2X8CA 4EQRA 5EB4A 3DGHA 3QFBA 3AE6A 4USQA 1K4QA 4U8LA 1TDNA 4EM3A 1CJ2A 3AE5A 2AAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDC A;  3AE7 A;  3CPJ G;  3DGZ A;  1VG0 A;  5FS7 A;  3KKJ A;  4B63 A;  1EBD A;  1S2Y A;  2GQW A;  1FL2 A;  1GT8 A;  3ATQ A;  4DNA A;  4BK3 A;  2YG6 A;  2X8H A;  3VR9 A;  2C66 A;  2VRM A;  3NYE A;  4XXG A;  1PBE A;  5FS8 A;  2WOI A;  2A89 A;  1PXB A;  4TLZ A;  4YT0 A;  3I6D A;  4O5Q A;  1BGJ A;  3UOV A;  3NTD A;  1MOK A;  4EIP A;  1GRF A;  3P1W A;  3IWA A;  3K7T A;  4DGK A;  1PBC A;  2X50 A;  1KSU A;  2BXR A;  4NEV A;  2QCU A;  4U2S A;  4CCR A;  4Z24 A;  2WDQ A;  3K7Q X;  3SFD A;  4CNJ A;  5C3J A;  1ONF A;  1PBD A;  3R9U A;  3VRA A;  3CND A;  1N1P A;  2O9Z A;  4J34 A;  3NHO X;  1CL0 A;  2B9W A;  4U8I A;  4YKF A;  3M12 A;  3NN6 X;  4K22 A;  4BV6 A;  4ZN0 A;  3Q6J A;  4U8N A;  5KOX A;  2YVF A;  2YWL A;  2YR6 A;  4C3X A;  1EL8 A;  1JEH A;  2GAH B;  4K5S A;  3CGC A;  1OJD A;  1MXT A;  3ALM A;  3ICS A;  3NG7 X;  3IF9 A;  3CGE A;  3EAO A;  4DSG A;  2EQ9 A;  4UDQ A;  4BK1 A;  2XFO A;  3B3R A;  3QVR A;  4EQW A;  5M0Z A;  3GSI A;  4U8P A;  2B7R A;  3CN8 A;  5JCK A;  4EQX A;  1M64 A;  2WU2 A;  2VZ2 A;  4FDC B;  1NEN A;  2YG3 A;  1GRA A;  3NRN A;  4YWO A;  3UKL A;  3QSS A;  1K0J A;  3H8L A;  4C77 A;  3QSE A;  3KA7 A;  1COY A;  5KWF A;  2APG A;  2QAE A;  2C3C A;  1CF3 A;  4B69 A;  1F3P A;  3ISH A;  4U8O A;  3V3O A;  2V61 A;  3ITJ A;  4K7Z A;  2BAB A;  3BNU A;  3SM8 A;  2B7S A;  3II4 A;  2XFN A;  2YM1 A;  4ADW A;  1QLB A;  2R46 A;  1PJ5 A;  4J56 A;  3SFE A;  2C75 A;  4GF7 A;  4P9S A;  2C76 A;  3AEC A;  1Z6L A;  1LPF A;  2X8G A;  3BHF A;  3OZ2 A;  3P4P A;  2FJD A;  4X4J A;  1CC6 A;  1GXF A;  3V76 A;  2VVM A;  4C5O A;  1KNR A;  4YSX A;  5EB5 A;  1NEK A;  2Q7V A;  2BYB A;  5HHF A;  4YTP A;  1YKJ A;  2PHH A;  2AQJ A;  2GAG B;  3LOV A;  4CRT A;  3P4Q A;  4CBQ A;  3QJ4 A;  2BCP A;  4B68 A;  1CHU A;  2V3A A;  4J31 A;  1GV4 A;  3GYI A;  3KU9 A;  1NHS A;  2DKI A;  3P9U A;  3G5Q A;  3NLC A;  3E1T A;  2R9Z A;  5CKU A;  3AEB A;  1L9D A;  1ZY8 A;  2WOV A;  2ACZ A;  5BUK A;  1OJC A;  5JCL A;  2GVC A;  1EL9 A;  5FS9 A;  3RHA A;  3NGC X;  1PDH A;  4ICY A;  4U2L A;  1CC2 A;  1IUS A;  1N4U A;  3LB8 A;  2H89 A;  4U8M A;  1ZOY A;  3UOZ A;  2XVE A;  1O95 A;  2WEU A;  4A65 A;  2QA1 A;  1GES A;  4H4Y A;  3F8R A;  3BI5 A;  3UTE A;  4EM4 A;  5M10 A;  3ZYX A;  3IHM A;  4OPC A;  1KNP A;  3NYF A;  3GDP A;  2C73 A;  2C72 A;  3D8X A;  3DK9 A;  4Y4M A;  4EMW A;  3CNT A;  1ZDL A;  1VG9 A;  3B6D A;  4YTM A;  1Q9I A;  1NPX A;  4AT2 A;  3S61 A;  3P4S A;  4APN A;  1E1K A;  2E5V A;  4H50 A;  2BK4 A;  4A5L A;  2R0G A;  4C3Y A;  3I3L A;  2J3N A;  3GDN A;  1NHP A;  3H4K A;  3EPT A;  2C67 A;  2AR8 A;  1E6E A;  1MO9 A;  2C65 A;  2JAE A;  1EL5 A;  1IJH A;  2WQY A;  1PN0 A;  1PJ7 A;  1RYI A;  1XPQ A;  4JN9 A;  1GND A;  1H86 A;  4OVI A;  4D04 A;  1E1M A;  2XFQ A;  2B76 A;  4H4W A;  4WX1 A;  2GRT A;  3UKF A;  2B9X A;  2WU5 A;  3AWI A;  4IA5 A;  4OPL A;  3UOX A;  4B64 A;  4ZCC A;  4JNQ A;  4AP3 A;  3EF6 A;  1GRG A;  3UKP A;  3AEA A;  1XAN A;  5HXI A;  1YY5 A;  2E1M A;  5HYM A;  3DH9 A;  3V3N A;  1H6V A;  1CJ4 A;  1GER A;  1DNC A;  2XLR A;  5IPY A;  3GRT A;  2F5Z A;  1TDO A;  1FEC A;  3C4A A;  1GAL A;  3UKQ A;  1M6I A;  3UP4 A;  2OAL A;  3CGB A;  2YLX A;  3AD8 B;  1H81 A;  4B66 A;  1F8R A;  2WDR A;  3KLJ A;  5J7X A;  5U25 A;  3RNM A;  3CNJ A;  2XDO A;  3SGL A;  1KF6 A;  5ER0 A;  5TR3 A;  4J33 A;  3AE8 A;  3QFA A;  2ZZC A;  1W4X A;  1ZMC A;  2BCG G;  4Z26 A;  1D4C A;  1VRQ B;  2W0H A;  4A7A A;  1HYU A;  2YLZ A;  1IUX A;  5LV9 A;  1NG4 A;  3DJE A;  4H2N A;  4H2Q A;  1GRB A;  2VQ7 A;  3AEG A;  3BI4 A;  4AP1 A;  3CIR A;  2YAU A;  3CNP A;  1H7W A;  2WDV A;  4OPI A;  2C3D A;  1D4E A;  4REK A;  1DOE A;  2XLS A;  4I59 A;  2WHD A;  4JQ9 A;  2YLW A;  4TM1 A;  2OA1 A;  3PS9 A;  1GEU A;  1LVL A;  2YVJ A;  2JB1 A;  2YG7 A;  4H4S A;  3WE0 A;  4Z2U A;  4FK1 A;  1Y56 B;  2WOW A;  2WES A;  1JU2 A;  2R0P A;  2WS3 A;  3VR8 A;  3ZDN A;  2CUL A;  3LXD A;  2BA9 A;  5HY5 A;  4J36 A;  3HZL A;  3NKS A;  4TLX A;  4U2T A;  5DBJ A;  4GCM A;  1LTX R;  3BHK A;  3IHG A;  1REO A;  4K5R A;  5JCN A;  2H88 A;  3GD4 A;  1IUT A;  4UP3 A;  2UZZ A;  3QVP A;  4J57 A;  1L9E A;  2VRL A;  3C96 A;  4B67 A;  1RP0 A;  4TM4 A;  4CY8 A;  1P2H A;  3AE2 A;  2XFP A;  1PJ6 A;  2NPX A;  4TM0 A;  1NDA A;  4H4P A;  4LII A;  2YG4 A;  4X9M A;  5FS6 A;  1DOC A;  4H4X A;  2BK5 A;  1JNR A;  4KX6 A;  2WPF A;  4H4R A;  3L8K A;  2CDU A;  2JK6 A;  1DOD A;  1O94 A;  1H7X A;  4LU6 A;  3NK2 X;  4IVM B;  2XVH A;  1NHQ A;  4ECH A;  2VVL A;  1CC4 A;  2WPE A;  2XCG A;  2R45 A;  4WCT A;  4YSH A;  2GR1 A;  2V60 A;  2GV8 A;  1GET A;  1GTH A;  2BS4 A;  3AED A;  4J2W A;  3NT6 A;  1KDG A;  2GR3 A;  4CNK A;  1D7Y A;  2EQ8 A;  1ZOV A;  4CCQ A;  3FIM B;  1FCD A;  2OAM A;  3NNE A;  4IVO B;  1X31 B;  4H4T A;  2BC1 A;  2Q0K A;  3L1R A;  1DXL A;  2BC0 A;  2A8X A;  2XLU A;  3AB1 A;  3M13 A;  1B37 A;  2XVI A;  2WP6 A;  1CJ3 A;  2ARD A;  1FEB A;  2JB2 A;  4YSZ A;  4OCG A;  2ZZ0 A;  1L9C A;  5J60 A;  4BJY A;  3SQP A;  3ICT A;  5KRQ A;  3RP6 A;  1DOB A;  2JKC A;  2RAB A;  2NVK X;  2WBA A;  2Y6R A;  2GR2 A;  3AYL A;  4N9X A;  2IID A;  1YQ3 A;  1L0V A;  3AEF A;  5KXJ A;  1PXA A;  2FJA A;  4Z2R A;  3UTF A;  4Z43 A;  3DJG X;  5CQF A;  3BI2 A;  3M0O A;  5EOW A;  5JCI A;  2TMD A;  4JDR A;  4H7U A;  4A6N B;  4RSL A;  4EMI A;  5GSN A;  3UKK A;  1E1N A;  3KD9 A;  1ELI A;  1F6M A;  1DJQ A;  3NK0 X;  3VRB A;  2B9Y A;  1E1L A;  3F8D A;  2IVD A;  3RP8 A;  5BUL A;  2RGJ A;  4BUR A;  2XLT A;  4UDR A;  4EMJ A;  1RSG A;  3ABV A;  2GR0 A;  2C7G A;  4GDP A;  4U8K A;  4H4V A;  1PS9 A;  4U8J A;  3S5W A;  2GF3 A;  4H4Z A;  2BS2 A;  4A99 A;  1JRZ A;  2R4E A;  3AD7 B;  2YR5 A;  4OPT A;  2R4J A;  4Z2T A;  5EBK A;  3DK4 A;  4UDP A;  1S2Q A;  1GSN A;  5GRT A;  3KVE A;  1K0L A;  1IUU A;  1AOG A;  1DJN A;  2I0Z A;  3O0H A;  4AT0 A;  3DK8 A;  1GOS A;  3AE1 A;  3UOY A;  3EAN A;  1XHC A;  1FEA A;  2ZBW A;  1ZMD A;  3CTY A;  1OJ9 A;  1Y56 A;  3AXB A;  3FBS A;  3LJP A;  1Q1W A;  1QJD A;  1PHH A;  2QA2 A;  2YVG A;  2GMH A;  1O5W A;  4GUV A;  3UTG A;  1N4W A;  1CJC A;  2IVE A;  3GRS A;  4YSY A;  2BK3 A;  3NK1 X;  3K30 A;  1H84 A;  3QSM A;  3CPH G;  3DJJ A;  3IC9 A;  3AYI A;  3GWD A;  1GRE A;  1V59 A;  1CBO A;  3KPF A;  4OPU A;  4YKG A;  1GTE A;  2C70 A;  3ICR A;  4YXD A;  3GYJ A;  2C64 A;  1Q1R A;  4NZH A;  3COX A;  3T37 A;  4TM3 A;  3Q9T A;  1BWC A;  5JCM A;  1H83 A;  4JY2 A;  2GH5 A;  4PAA A;  1JOA A;  2XVJ A;  4H4Q A;  4EQS A;  4D03 A;  3AEE A;  1IUV A;  1E7P A;  4CY6 A;  4HB9 A;  4B65 A;  1JNZ A;  3VQR A;  3GD3 A;  4EIQ A;  2V3B A;  2OLO A;  2V6O A;  1YQ4 A;  4H4U A;  4K8D A;  4USR A;  3OC4 A;  2VOU A;  2WP9 A;  1NAA A;  2RGO A;  2XVF A;  3DJD A;  5U63 A;  5BRT A;  1JRY A;  1TYP A;  3UCL A;  4NTC A;  3LAD A;  3NIX A;  1YQZ A;  4XWZ A;  3CGD A;  1NG3 A;  3ATR A;  2YR4 A;  1FOH A;  4H2P A;  3PVC A;  5U1O A;  2BS3 A;  2EQ7 A;  2TPR A;  2R0C A;  3JSK A;  2Q6U A;  2CVJ A;  2EQ6 A;  4I58 A;  2YQU A;  2A87 A;  2BXS A;  1F8S A;  1TDF A;  2VVL G;  2XYO A;  3URH A;  1TYT A;  1K0I A;  1OJT A;  3G5S A;  3PO7 A;  2E4G A;  4RG4 A;  1BZL A;  1B4V A;  5FMH A;  1BGN A;  1PBB A;  3DA1 A;  3K7M X;  4JY3 A;  2JBV A;  3UKH A;  1VQW A;  4Y4N A;  2JB3 A;  1P2E A;  3ALJ A;  4X9N A;  4DSH A;  5KOW A;  1GRH A;  1EL7 A;  1GPE A;  2HQM A;  1UKV G;  4NEW A;  2Z5Y A;  3C4N A;  3NN0 X;  2FJB A;  4C74 A;  2VQB A;  3RP7 A;  3UTH A;  2YM2 A;  3BNM A;  5L46 A;  4AOS A;  2YLT A;  2X99 A;  2YG5 A;  1B8S A;  1F8W A;  1S3E A;  3G5R A;  4KPR A;  1IUW A;  1OJA A;  4GDE A;  4H2R A;  3FG2 P;  4Y4L A;  1S3B A;  1SEZ A;  2DKH A;  2CFY A;  3AE4 A;  3UP5 A;  4IA6 A;  3F8P A;  2GQF A;  4B1B A;  1Y0P A;  4BJZ A;  3RED A;  3GMC A;  3D1C A;  3NH3 X;  4ZCD A;  4A6N A;  4RG3 A;  1ZP0 A;  2YLR A;  3NYC A;  3GMB A;  4Z44 A;  4GRT A;  3AE3 A;  2PYX A;  4K2X A;  5KVI A;  1D4D A;  4OPD A;  1GRT A;  1D7L A;  1PXC A;  4FX9 A;  4LA1 A;  4BK2 A;  1N4V A;  3LZX A;  1QO8 A;  4GR1 A;  4JNA A;  2GMJ A;  2FBW A;  5C2T A;  2BAC A;  2Q0L A;  1D5T A;  2FJE A;  4OPG A;  3AE9 A;  3FPZ A;  3NTA A;  4A79 A;  4HA6 A;  4O5U A;  4AOX A;  3FMW A;  4E0V A;  2XLP A;  4YTN A;  2X3N A;  3AYJ A;  4XWR A;  4NTD A;  4MJW A;  2Y6Q A;  4A9W A;  4Z25 A;  2GEW A;  4IV9 A;  3AD9 B;  1BKW A;  1TDE A;  3H8I A;  3P4R A;  1H82 A;  5IQ1 A;  3VRD B;  3CNS A;  3ADA B;  1B5Q A;  1E39 A;  1TRB A;  3GWF A;  1LV0 A;  3LZW A;  4NTE A;  2XFU A;  3UKA A;  2RGH A;  1ZX9 A;  4M52 A;  1LQT A;  2WET A;  4PAB A;  2YLS A;  3DME A;  1LQU A;  1JRX A;  1KSS A;  1XDI A;  1PBF A;  1LJ1 A;  3CPI G;  2WPC A;  5KVH A;  5IQ4 A;  1TDK A;  1KFY A;  2GB0 A;  2Z5X A;  5BVA A;  2OLN A;  4FK1 C;  2ZZB A;  1BF3 A;  2WP5 A;  1NHR A;  2V5Z A;  3ALL A;  1ZK7 A;  1ZKQ A;  2X8C A;  4EQR A;  5EB4 A;  3DGH A;  3QFB A;  3AE6 A;  4USQ A;  1K4Q A;  4U8L A;  1TDN A;  4EM3 A;  1CJ2 A;  3AE5 A;  2AAQ A; 
#chains in the Genus database with same CATH topology
 1R6W A;  3DGZ A;  1S2Y A;  1FL2 A;  3CMM A;  2GGE A;  2P8B A;  4G6G A;  4XXG A;  4TLZ A;  4YT0 A;  4O5Q A;  4DGK A;  3SY4 A;  1PBD A;  3GD6 A;  2OFJ A;  2O9Z A;  3NHO X;  4G73 A;  3M12 A;  4BV6 A;  4ZN0 A;  2YVF A;  4C3X A;  1EL8 A;  5KNL A;  1S7M A;  2GAH B;  3JVA A;  3CGC A;  1OJD A;  1MXT A;  4GAV A;  2EQ9 A;  4UDQ A;  1NEL A;  4U8P A;  2DW7 A;  2GSH A;  1K0J A;  4C77 A;  1H2I A;  2C3C A;  3ISH A;  4U8O A;  2OVL A;  3V3O A;  3BNU A;  2YM1 A;  4ADW A;  1QLB A;  2R46 A;  4J56 A;  3R25 A;  2C76 A;  3DDM A;  3BHF A;  1BQG A;  2FYM A;  1CC6 A;  3V76 A;  5HHF A;  5FJR A;  2PP1 A;  4B68 A;  2V3A A;  3NLC A;  5CKU A;  5BUK A;  1OJC A;  1EL9 A;  3RHA A;  1PDH A;  2OZ8 A;  1CC2 A;  3LB8 A;  2H89 A;  4U8M A;  3UCD A;  2QA1 A;  4H4Y A;  3UTE A;  4EM4 A;  4GIR A;  5M10 A;  3NYF A;  2C72 A;  3DK9 A;  4Y4M A;  2CHR A;  3B6D A;  3A7R A;  3P4S A;  4APN A;  1ZXI C;  4C3Y A;  4GGH A;  2J3N A;  1NHP A;  2AR8 A;  1E6E A;  3I4K A;  2WQY A;  4H2H A;  1H86 A;  3UGV A;  4B64 A;  3HW2 A;  4ZCC A;  3AEA A;  3DH9 A;  2AL2 B;  2XLR A;  1DNC A;  3T14 A;  3IJI A;  1ZMC A;  2W0H A;  1HYU A;  1IUX A;  4KEM A;  4H2N A;  4AP1 A;  2C3D A;  1D4E A;  3UJR A;  2XLS A;  4I59 A;  3CXO A;  2OA1 A;  3PS9 A;  2JB1 A;  2YG7 A;  3WE0 A;  4Z2U A;  2WS3 A;  4DHG A;  4ZOH B;  3H7V A;  3R1Z A;  2BA9 A;  4TLX A;  5JCN A;  2H88 A;  3GD4 A;  3ETR B;  2VRL A;  4H1Z A;  2XFP A;  3SQS A;  4JN7 A;  4H4R A;  2JK6 A;  4ZA0 A;  3UJS A;  3ZVI A;  2XCG A;  3H8A A;  4YSH A;  2GR1 A;  2V60 A;  2GV8 A;  1GTH A;  3AED A;  1KDG A;  3H70 A;  1WUE A;  3FIM B;  3NNE A;  2Q0K A;  2XLU A;  3RCY A;  1B37 A;  2WP6 A;  1CJ3 A;  1FEB A;  4YSZ A;  4OCG A;  2QDD A;  3Q45 A;  2WBA A;  2GR2 A;  4NNJ A;  1YQ3 A;  1L0V A;  3AEF A;  5KXJ A;  1PXA A;  1JDF A;  3OTR A;  4Z43 A;  1X2G A;  3UKK A;  3KD9 A;  5BOE A;  3VRB A;  2GGI A;  4BUR A;  4UDR A;  4U8K A;  4H4V A;  3S5W A;  4MMW A;  2YR5 A;  5EBK A;  3NVW B;  7ENL A;  4DYE A;  4HCD A;  3T4W A;  1AOG A;  2I0Z A;  3NRZ B;  1GOS A;  4X2P A;  2ZBW A;  3EEZ A;  3AXB A;  1QJD A;  2GMH A;  3TTE A;  3SR6 B;  2I5Q A;  1V59 A;  2HXT A;  4OPU A;  3OW1 A;  3FVD A;  1Q1R A;  3T37 A;  3DFH A;  5JCM A;  3TQP A;  1JOA A;  4H4Q A;  2OQH A;  3T9P A;  3GY1 A;  1E7P A;  4CY6 A;  1JNZ A;  3VC5 A;  2V3B A;  3QKE A;  4USR A;  4K8D A;  1T3Q C;  1NAA A;  3DJD A;  5U63 A;  1JRY A;  4GIS A;  4NTC A;  3NIX A;  1YQZ A;  3CGD A;  3QN3 A;  3ATR A;  3PFR A;  3SXI A;  2BS3 A;  2EQ7 A;  2Q6U A;  2XYO A;  3URH A;  2QDE A;  1BZL A;  1PBB A;  4Y4N A;  4DSH A;  2XH7 A;  3BNM A;  3UJF A;  3IK4 A;  4HYR A;  3FG2 P;  5KMQ A;  3UP5 A;  4IA6 A;  3NH3 X;  3NYC A;  3AE3 A;  3KPK A;  3DFY A;  4NWZ A;  5KVI A;  4OPD A;  4FX9 A;  4LA1 A;  4GR1 A;  3Q4D A;  2FJE A;  3FPZ A;  3NTA A;  4AOX A;  4E0V A;  3L5O A;  2XLP A;  2OZT A;  4NTD A;  4Z25 A;  4IV9 A;  2OZ3 A;  3V4B A;  1TRB A;  1LV0 A;  3LZW A;  3U4F A;  2WET A;  3DME A;  1XDI A;  5KVH A;  3BOX A;  3V5C A;  2OLN A;  2ZZB A;  2WP5 A;  2X8C A;  4DN1 A;  3DGH A;  3AE6 A;  4Z1Y A;  1K4Q A;  1TDN A;  3GMB A;  1EBG A;  3CPJ G;  1VG0 A;  3VR9 A;  2WOI A;  2GDQ A;  3UOV A;  3NTD A;  2MNR A;  1MOK A;  1GRF A;  3K7T A;  1PBC A;  2WDQ A;  2XGZ A;  3K7Q X;  1ONF A;  3VRA A;  4YKF A;  4U8I A;  1FFV C;  3NN6 X;  4E6M A;  4K22 A;  4U8N A;  2YWL A;  1YEY A;  2PTW A;  5IDZ A;  3STP A;  3RR1 A;  5FJO A;  3CGE A;  3EAO A;  4DSG A;  4BK1 A;  6ENL A;  4JHM A;  5JCK A;  1M64 A;  2WU2 A;  1N5X A;  4YWO A;  2ZC8 A;  3QSE A;  3KA7 A;  3OZM A;  1COY A;  5KWF A;  4B69 A;  3T0K A;  2V61 A;  3CT2 A;  3HYX A;  1PJ5 A;  3AEC A;  1MRA A;  1LPF A;  2X8G A;  4TVY A;  4KPL A;  1GXF A;  3HRD C;  4C5O A;  3T6C A;  2Q7V A;  3AN1 A;  3LOV A;  4CRT A;  3P4Q A;  4CBQ A;  3QJ4 A;  1CHU A;  4J31 A;  3CB3 A;  1GV4 A;  2DKI A;  3P9U A;  3G5Q A;  3E1T A;  5BOF A;  1L9D A;  2GVC A;  5FS9 A;  1N4U A;  2XVE A;  1O95 A;  3ZYX A;  2GL5 A;  3GDP A;  3IJQ A;  3D8X A;  1N63 C;  3CNT A;  2PCE A;  4IT1 A;  1NPX A;  2O56 A;  1E1K A;  3SZ0 A;  2C67 A;  4HCL A;  1PN0 A;  3UXL A;  3JZU A;  2PGW A;  1E1M A;  5FJP A;  2B76 A;  4WX1 A;  3UKF A;  3T31 A;  3SN0 A;  3UOX A;  4IA5 A;  3MQT A;  3GO2 A;  2POD A;  3T2Z A;  5HYM A;  2E1M A;  1H6V A;  1GER A;  5IPY A;  3GRT A;  1TDO A;  3UP4 A;  2QGY A;  3AD8 B;  4B66 A;  2WDR A;  5J7X A;  3CNJ A;  3SGL A;  3N4F A;  4J33 A;  3AE8 A;  3QFA A;  1N62 C;  3R11 A;  4Z26 A;  3BJS A;  2YLZ A;  4H2Q A;  2VQ7 A;  3BI4 A;  3AEG A;  2YAU A;  3D46 A;  2WHD A;  1LVL A;  4H4S A;  3IJL A;  3B97 A;  4FK1 A;  1Y56 B;  5HY5 A;  4M6U A;  5J04 A;  3NKS A;  4U2T A;  5DBJ A;  2P88 A;  3IHG A;  3BHK A;  3VFC A;  4UP3 A;  1L9E A;  4TM4 A;  4CY8 A;  4MKS A;  4TM0 A;  5FS6 A;  1DOC A;  2WPF A;  2CDU A;  3NS1 B;  3HYW A;  3TJI A;  4LU6 A;  3NK2 X;  2E5A A;  1NHQ A;  4ECH A;  3NVZ B;  3HYV A;  3EUB 3;  2WPE A;  4WCT A;  3MSY A;  1GET A;  4J2W A;  4IHC A;  2QQ6 A;  4CNK A;  3RIT A;  1TKK A;  3RRA A;  4GYP A;  3QPE A;  3D47 A;  2BC1 A;  3L1R A;  3M13 A;  2XVI A;  1SJD A;  3BSM A;  2JB2 A;  1L9C A;  3SQP A;  2IID A;  1JRO A;  3HPF A;  4G7F A;  3DJG X;  2XSX A;  5EOW A;  4A6N B;  2TMD A;  4RSL A;  5BUL A;  2IVD A;  3RP8 A;  1RSG A;  2GR0 A;  2C7G A;  4GDP A;  4U8J A;  1PS9 A;  4H4Z A;  2BS2 A;  4OPT A;  3DK4 A;  4UDP A;  1S2Q A;  3TCS A;  1K0L A;  1IUU A;  4JN8 A;  5ENL A;  3R10 A;  3UOY A;  3EAN A;  4ZCW A;  1OJ9 A;  1Y56 A;  3FBS A;  3SBF A;  2YVG A;  4GUV A;  3RGT A;  1O5W A;  3UTG A;  1N60 C;  4YSY A;  3S5S A;  1CJC A;  1R0M A;  3NK1 X;  3QSM A;  4K1W A;  3DJJ A;  1CBO A;  3D9X A;  2C70 A;  3ICR A;  4H83 A;  3N6J A;  3COX A;  3Q9T A;  2XH4 A;  3SSZ A;  1PDY A;  2XVJ A;  4EQS A;  3ZLH A;  1IUV A;  4GGB A;  4HB9 A;  5EU9 A;  2GGJ A;  4A3R A;  2OLO A;  1YQ4 A;  2XVF A;  3NVV B;  3TWB A;  4XWZ A;  3A7A A;  2YR4 A;  4H2P A;  3PVC A;  5U1O A;  2TPR A;  3JSK A;  1TDF A;  3PO7 A;  1TYT A;  1K0I A;  3K7M X;  4A6G A;  4X9N A;  5KOW A;  4G8T A;  2VQB A;  3UTH A;  2YM2 A;  1KD0 A;  1B8S A;  3G5R A;  4KPR A;  1OJA A;  1EC8 A;  2GQF A;  4B1B A;  2PU1 A;  4ZCD A;  4A6N A;  3CXB A;  1D4D A;  3K1G A;  1N4V A;  1VQZ A;  2GMJ A;  5C2T A;  2BAC A;  1D5T A;  2AL2 A;  3AE9 A;  1EBH A;  4A79 A;  4O5U A;  3FMW A;  3ZLG A;  4YTN A;  2X3N A;  3AYJ A;  2OG9 A;  1BKW A;  3H8I A;  3P4R A;  3TOY A;  1H82 A;  1DTN A;  1B5Q A;  4PAB A;  2YLS A;  2P0I A;  1LQU A;  1KSS A;  1PBF A;  3CPI G;  5IQ4 A;  1KFY A;  3R07 C;  5BVA A;  4FK1 C;  1NHR A;  2V5Z A;  1ZKQ A;  2OPJ A;  2W3R A;  4EQR A;  3QFB A;  1MDL A;  1STZ A;  4U8L A;  4Z17 A;  3AE7 A;  1F9C A;  3KKJ A;  3OZY A;  3QLD A;  5G5G B;  2X8H A;  3ES7 A;  3NYE A;  2A89 A;  1PXB A;  4ROP A;  4EIP A;  2BRY A;  2X50 A;  1KSU A;  2BXR A;  4NEV A;  4G6H A;  4CCR A;  3SFD A;  5C3J A;  4CNJ A;  1N1P A;  4F4R A;  4J34 A;  1N61 C;  4G74 A;  2GGG A;  3Q6J A;  2YR6 A;  3EKG A;  4K5S A;  4HNL A;  3IF9 A;  4GYP C;  3B3R A;  4EQW A;  2AL1 A;  2B7R A;  3CN8 A;  4EQX A;  3NO1 A;  4E5T A;  1NEN A;  1GRA A;  3NRN A;  3UKL A;  3QSS A;  1W6T A;  3AM9 A;  4YWS A;  3GYX A;  1EC9 A;  4HN8 A;  1CF3 A;  1F3P A;  3I6T A;  3ITJ A;  4K7Z A;  2BAB A;  2P3Z A;  2B7S A;  1NU5 A;  2XFN A;  2C75 A;  4GF7 A;  4P9S A;  1Z6L A;  4FP1 A;  3P4P A;  2FJD A;  3QTP A;  2VVM A;  5EB5 A;  1NEK A;  4YTP A;  2PHH A;  2AQJ A;  4HCH A;  3P3B A;  3KU9 A;  1NHS A;  3AEB A;  2ACZ A;  1MNS A;  2WOV A;  3MZN A;  5JCL A;  5FJU A;  4U2L A;  1IUS A;  1ZOY A;  2QJJ A;  3A7U A;  1GES A;  3F8R A;  2C73 A;  4EMW A;  1VG9 A;  2PU0 A;  3H12 A;  4H50 A;  2BK4 A;  4A5L A;  3I3L A;  1JPM A;  3GDN A;  1MUC A;  3H4K A;  3EPT A;  4II3 A;  2C65 A;  1EL5 A;  1PJ7 A;  1RYI A;  4JN9 A;  1GND A;  4OVI A;  2GRT A;  2B9X A;  4OPL A;  4JNQ A;  4IP5 A;  4AP3 A;  1GRG A;  3DES A;  1YY5 A;  5HXI A;  3ZVH B;  3SN4 A;  2W3S A;  1FEC A;  3C4A A;  1GAL A;  2YLX A;  1F8R A;  5U25 A;  2XDO A;  5ER0 A;  1SJC A;  5TR3 A;  2ZZC A;  1W4X A;  1L8P A;  2BCG G;  3CYJ A;  1VRQ B;  5LV9 A;  4ENL A;  3UJE A;  3MKC A;  1H7W A;  2WDV A;  3DGB A;  1FFU C;  3DER A;  3VCC A;  3SZC A;  1GEU A;  1JRP A;  3FJ4 A;  4E8G A;  1JU2 A;  2R0P A;  3VR8 A;  1FHU A;  3LXD A;  3CK5 A;  1X2H A;  4GCM A;  1OEP A;  2UZZ A;  3QVP A;  4J57 A;  3C96 A;  3FYY A;  4B67 A;  1P2H A;  3GC2 A;  4GME A;  3AE2 A;  1PJ6 A;  1TZZ A;  4LII A;  3SN1 A;  4H4X A;  1O94 A;  1H7X A;  2QJM A;  3JW7 A;  2R45 A;  4IL2 A;  3ENL A;  4KT2 A;  5KMP A;  1TE6 A;  4G9K A;  1ZOV A;  3R0K A;  2OAM A;  3OPS A;  2PA6 A;  1X31 B;  4H4T A;  2ARD A;  2ZZ0 A;  1KCZ A;  4BJY A;  5KRQ A;  3PWG A;  1FIQ B;  2Y6R A;  4N9X A;  1BKH A;  4HNC A;  1WUF A;  2FJA A;  3UTF A;  5CQF A;  5JCI A;  1E1N A;  4IL0 A;  1F6M A;  2B9Y A;  1E1L A;  3F8D A;  2RGJ A;  2OLA A;  3I6E A;  2GF3 A;  4A99 A;  1JRZ A;  2OX4 A;  5GRT A;  3PWI A;  3T2Y A;  1DJN A;  1EC7 A;  3O0H A;  4AT0 A;  3DK8 A;  1XHC A;  1FEA A;  1ZMD A;  3CTY A;  1ONE A;  1Q1W A;  1PHH A;  2QA2 A;  1N4W A;  2IVE A;  3GRS A;  1H84 A;  5KMR A;  3GWD A;  1GTE A;  4J1O A;  1FO4 A;  3ZLF A;  4PAA A;  4JY2 A;  2GH5 A;  3ES8 A;  4HPN A;  2HXU A;  2PP0 A;  4D03 A;  3AEE A;  3UCC A;  4B65 A;  3VQR A;  3GD3 A;  4EIQ A;  4H4U A;  2HZG A;  3N4E A;  2VOU A;  4A35 A;  3SZF A;  4H19 A;  2QVH A;  5BRT A;  3FCP A;  3LAD A;  1FOH A;  2ZAD A;  2R0C A;  5KMS A;  2CVJ A;  2EQ6 A;  2YQU A;  2A87 A;  2BXS A;  2VVL G;  5M0Z A;  2E4G A;  2FKP A;  1B4V A;  5FMH A;  3DA1 A;  4JY3 A;  3DG6 A;  2JBV A;  3T2K A;  1P48 A;  1PDZ A;  1P2E A;  1GRH A;  1GPE A;  2HQM A;  4NEW A;  2Z5Y A;  3C4N A;  3NN0 X;  4C74 A;  4AOS A;  2YLT A;  2X99 A;  2YG5 A;  4E4U A;  2BRA A;  1S3E A;  4GDE A;  4Y4L A;  1JPD X;  1S3B A;  1SEZ A;  2DKH A;  1V97 A;  4BJZ A;  2XH0 A;  3D1C A;  4RG3 A;  1ZP0 A;  2YLR A;  4IZG A;  4Z44 A;  2PYX A;  1D7L A;  1QO8 A;  4JNA A;  2Q0L A;  4OPG A;  2OO6 A;  3RO6 A;  4HA6 A;  3DG7 A;  2AKM A;  4MJW A;  2Y6Q A;  4A9W A;  2GEW A;  3CNS A;  3ADA B;  3GWF A;  2XFU A;  1FHV A;  1ZX9 A;  2PP3 A;  4M52 A;  1LQT A;  3CAW A;  1JRX A;  1TDK A;  3UJ2 A;  1BF3 A;  1ZK7 A;  2PGE A;  3NXL A;  4EM3 A;  1CJ2 A;  3AE5 A;  1VDC A;  5FS7 A;  4GAP A;  4B63 A;  1EBD A;  4DXK A;  2GQW A;  1GT8 A;  3ATQ A;  4DNA A;  4BK3 A;  2OKT A;  2YG6 A;  2C66 A;  2VRM A;  1ECQ A;  1PBE A;  5FS8 A;  3I6D A;  1BGJ A;  2PS2 A;  3P1W A;  3IWA A;  4U2S A;  2QCU A;  4Z24 A;  1WYG A;  3R9U A;  3CND A;  1CL0 A;  2B9W A;  3DG3 A;  5KOX A;  2RDX A;  1JEH A;  3MY9 A;  3NG7 X;  3ALM A;  3ICS A;  2PTZ A;  3V3W A;  2XFO A;  3QVR A;  2W54 A;  3GSI A;  2VZ2 A;  4FDC B;  2YG3 A;  3SX6 A;  3H8L A;  1E9I A;  2APG A;  2QAE A;  2C4C A;  2HNE A;  3SM8 A;  3V5F A;  3II4 A;  3SZW A;  3SFE A;  4X4J A;  3OZ2 A;  4MGG A;  1KNR A;  4YSX A;  2BYB A;  1YKJ A;  2GAG B;  2BCP A;  4KWS A;  3GYI A;  2R9Z A;  1VDV A;  3P0W A;  4K8G A;  1IYX A;  1KKO A;  1ZY8 A;  3NGC X;  4ICY A;  4EWJ A;  3UOZ A;  2WEU A;  4A65 A;  3BI5 A;  3IHM A;  4OPC A;  1KNP A;  1ZDL A;  4YTM A;  1Q9I A;  4AT2 A;  3S61 A;  2E5V A;  3S47 A;  2R0G A;  4E4F A;  3N6H A;  1MO9 A;  2JAE A;  1IJH A;  3R0U A;  1XPQ A;  4D04 A;  2XFQ A;  4H4W A;  5JRB A;  2WU5 A;  3AWI A;  3EF6 A;  3UKP A;  1XAN A;  4J3Z A;  1P43 A;  3V3N A;  1XPY A;  1CJ4 A;  3MUC A;  2F5Z A;  3UKQ A;  1M6I A;  3PK7 A;  2OAL A;  3CGB A;  1H81 A;  3KLJ A;  3RNM A;  1KF6 A;  3NFU A;  1D4C A;  1KN0 A;  5G5H B;  4A7A A;  3AMZ A;  1XS2 A;  4GFI A;  1NG4 A;  3DJE A;  1GRB A;  2NQL A;  3FV9 A;  3CIR A;  3CNP A;  4OPI A;  4REK A;  1DOE A;  4JQ9 A;  2YLW A;  4TM1 A;  3VDG A;  2YVJ A;  3KUM A;  3PG6 A;  2WOW A;  2WES A;  3ZDN A;  2CUL A;  4M0X A;  4J36 A;  3HZL A;  5FJT A;  1LTX R;  1REO A;  4K5R A;  4II2 A;  3VA8 A;  3TWA A;  1IUT A;  2GGH A;  2PMQ A;  4TVW A;  4K2S A;  1RP0 A;  2OQY A;  3OP2 A;  3UXK A;  3VC6 A;  2NPX A;  1NDA A;  4H4P A;  2YG4 A;  4X9M A;  2BK5 A;  1JNR A;  4KX6 A;  3L8K A;  1DOD A;  1SB3 B;  4IVM B;  2XVH A;  2VVL A;  2QJN A;  1CC4 A;  2BS4 A;  3NT6 A;  2GR3 A;  1D7Y A;  2EQ8 A;  4CCQ A;  1FCD A;  4IVO B;  3NVY B;  1DXL A;  2BC0 A;  2A8X A;  3AB1 A;  5J60 A;  2PSN A;  3ICT A;  4FI4 A;  1DOB A;  2JKC A;  3RP6 A;  2RAB A;  2NVK X;  3AYL A;  2DW6 A;  4Z2R A;  3BI2 A;  3M0O A;  4H7U A;  4JDR A;  4EMI A;  5GSN A;  1ELI A;  1DJQ A;  3NK0 X;  1RVK A;  2XLT A;  4EMJ A;  3ABV A;  3DEQ A;  2R4E A;  3AD7 B;  2R4J A;  4Z2T A;  2MUC A;  1JCT A;  1GSN A;  3KVE A;  3THU A;  1SJA A;  3AE1 A;  3LJP A;  2POZ A;  3SJN A;  3P93 A;  2BK3 A;  3K30 A;  3U9I A;  3CPH G;  3IC9 A;  3AYI A;  1GRE A;  3KPF A;  3TJ4 A;  2P8C A;  4YKG A;  3DIP A;  4YXD A;  3GYJ A;  2C64 A;  4NZH A;  1SJB A;  2PPG A;  4DWD A;  4DX3 A;  4TM3 A;  1BWC A;  2ONE A;  1MDR A;  1H83 A;  2V6O A;  3OC4 A;  2WP9 A;  2RGO A;  3TW9 A;  1TYP A;  3UCL A;  3B9J B;  1RM6 B;  1NG3 A;  2PTY A;  3SYI A;  4I58 A;  1F8S A;  3G5S A;  1OJT A;  4RG4 A;  1BGN A;  3UKH A;  1VQW A;  3VCN A;  2JB3 A;  3ALJ A;  1EL7 A;  1UKV G;  2XH2 A;  2FJB A;  3RP7 A;  4IP4 A;  5L46 A;  2W55 A;  1ELS A;  1F8W A;  1IUW A;  4H2R A;  2CFY A;  3AE4 A;  3F8P A;  1Y0P A;  3RED A;  3GMC A;  3FXG A;  4GRT A;  3MWC A;  4K2X A;  1GRT A;  2E3T A;  1PXC A;  4BK2 A;  1N5W C;  3LZX A;  2FBW A;  3ZVH A;  4XWR A;  3AD9 B;  1TDE A;  5IQ1 A;  3NZG A;  3VRD B;  1E39 A;  4NTE A;  3UKA A;  3T8Q A;  2RGH A;  1KKR A;  2PTX A;  1LJ1 A;  2WPC A;  2GB0 A;  2Z5X A;  2AKZ A;  3ALL A;  5EB4 A;  4USQ A;  2AAQ A; 
#chains in the Genus database with same CATH homology
 1VDC A;  3AE7 A;  3CPJ G;  3DGZ A;  1VG0 A;  5FS7 A;  3KKJ A;  4GAP A;  1EBD A;  1S2Y A;  4B63 A;  2GQW A;  1FL2 A;  1GT8 A;  3CMM A;  3ATQ A;  4DNA A;  4BK3 A;  2YG6 A;  2X8H A;  3VR9 A;  2C66 A;  2VRM A;  3NYE A;  4G6G A;  4XXG A;  1PBE A;  5FS8 A;  2WOI A;  2A89 A;  1PXB A;  4TLZ A;  4YT0 A;  3I6D A;  4O5Q A;  1BGJ A;  3UOV A;  3NTD A;  1MOK A;  4EIP A;  1GRF A;  3P1W A;  2BRY A;  3IWA A;  3K7T A;  4DGK A;  1PBC A;  2X50 A;  3SY4 A;  1KSU A;  2BXR A;  4NEV A;  2QCU A;  4G6H A;  4U2S A;  4Z24 A;  4CCR A;  2WDQ A;  3K7Q X;  3SFD A;  4CNJ A;  5C3J A;  1ONF A;  1PBD A;  3R9U A;  3VRA A;  3CND A;  1N1P A;  2O9Z A;  4J34 A;  3NHO X;  1CL0 A;  2B9W A;  4G73 A;  4U8I A;  4YKF A;  4G74 A;  3M12 A;  3NN6 X;  4K22 A;  4BV6 A;  4ZN0 A;  3Q6J A;  4U8N A;  5KOX A;  2YVF A;  2YWL A;  2YR6 A;  4C3X A;  1EL8 A;  5KNL A;  1JEH A;  1S7M A;  2GAH B;  4K5S A;  3CGC A;  1OJD A;  1MXT A;  3ALM A;  3ICS A;  3NG7 X;  3IF9 A;  3CGE A;  4GAV A;  3EAO A;  4DSG A;  2EQ9 A;  4UDQ A;  4BK1 A;  2XFO A;  3B3R A;  3QVR A;  4EQW A;  5M0Z A;  3GSI A;  4U8P A;  2B7R A;  3CN8 A;  5JCK A;  4EQX A;  1M64 A;  2WU2 A;  2VZ2 A;  4FDC B;  1NEN A;  2YG3 A;  1GRA A;  3NRN A;  3SX6 A;  4YWO A;  3UKL A;  3QSS A;  1K0J A;  3H8L A;  4C77 A;  3QSE A;  3KA7 A;  1H2I A;  1COY A;  5KWF A;  2APG A;  2QAE A;  3GYX A;  2C3C A;  1CF3 A;  4B69 A;  1F3P A;  2C4C A;  3T0K A;  3ISH A;  4U8O A;  3V3O A;  2V61 A;  3ITJ A;  4K7Z A;  2BAB A;  3BNU A;  3SM8 A;  2B7S A;  3II4 A;  2XFN A;  2YM1 A;  4ADW A;  3HYX A;  1QLB A;  2R46 A;  1PJ5 A;  4J56 A;  3SFE A;  3SZW A;  2C75 A;  4GF7 A;  4P9S A;  2C76 A;  3AEC A;  1Z6L A;  1LPF A;  2X8G A;  3BHF A;  3OZ2 A;  3P4P A;  2FJD A;  4X4J A;  1CC6 A;  1GXF A;  3V76 A;  2VVM A;  4C5O A;  1KNR A;  4YSX A;  5EB5 A;  1NEK A;  2Q7V A;  2BYB A;  5HHF A;  4YTP A;  1YKJ A;  2PHH A;  2AQJ A;  2GAG B;  3LOV A;  4CRT A;  3P4Q A;  4CBQ A;  3QJ4 A;  2BCP A;  4B68 A;  1CHU A;  2V3A A;  4J31 A;  1GV4 A;  3GYI A;  3KU9 A;  1NHS A;  2DKI A;  3P9U A;  3G5Q A;  3NLC A;  3E1T A;  2R9Z A;  5CKU A;  3AEB A;  1L9D A;  1ZY8 A;  2WOV A;  2ACZ A;  5BUK A;  1OJC A;  5JCL A;  2GVC A;  1EL9 A;  5FS9 A;  3RHA A;  3NGC X;  1PDH A;  4ICY A;  4U2L A;  1CC2 A;  1IUS A;  1N4U A;  3LB8 A;  2H89 A;  4U8M A;  1ZOY A;  3UOZ A;  2XVE A;  1O95 A;  2WEU A;  4A65 A;  2QA1 A;  1GES A;  4H4Y A;  3F8R A;  3BI5 A;  3UTE A;  4EM4 A;  5M10 A;  3ZYX A;  3IHM A;  4OPC A;  1KNP A;  3NYF A;  3GDP A;  2C73 A;  2C72 A;  3D8X A;  3DK9 A;  4Y4M A;  4EMW A;  3CNT A;  1ZDL A;  1VG9 A;  3B6D A;  4YTM A;  1Q9I A;  1NPX A;  4AT2 A;  3S61 A;  3P4S A;  4APN A;  1E1K A;  2E5V A;  4H50 A;  3SZ0 A;  2BK4 A;  4A5L A;  2R0G A;  4C3Y A;  3I3L A;  2J3N A;  3GDN A;  1NHP A;  3H4K A;  3EPT A;  2C67 A;  4II3 A;  2AR8 A;  1E6E A;  1MO9 A;  2C65 A;  2JAE A;  1EL5 A;  1IJH A;  2WQY A;  1PN0 A;  1PJ7 A;  1RYI A;  1XPQ A;  4JN9 A;  1GND A;  1H86 A;  4OVI A;  4D04 A;  1E1M A;  2XFQ A;  2B76 A;  4H4W A;  4WX1 A;  2GRT A;  3UKF A;  3T31 A;  5JRB A;  2B9X A;  2WU5 A;  3AWI A;  4IA5 A;  4OPL A;  3UOX A;  4B64 A;  4ZCC A;  4JNQ A;  4AP3 A;  3EF6 A;  1GRG A;  3UKP A;  3AEA A;  1XAN A;  3T2Z A;  5HXI A;  1YY5 A;  2E1M A;  5HYM A;  3DH9 A;  3V3N A;  1H6V A;  1CJ4 A;  1GER A;  1DNC A;  2XLR A;  5IPY A;  3T14 A;  3GRT A;  2F5Z A;  1TDO A;  1FEC A;  3C4A A;  1GAL A;  3UKQ A;  1M6I A;  3UP4 A;  2OAL A;  3CGB A;  2YLX A;  3AD8 B;  1H81 A;  4B66 A;  1F8R A;  2WDR A;  3KLJ A;  5J7X A;  5U25 A;  3RNM A;  3CNJ A;  2XDO A;  3SGL A;  1KF6 A;  5ER0 A;  5TR3 A;  4J33 A;  3AE8 A;  3QFA A;  2ZZC A;  1W4X A;  1ZMC A;  2BCG G;  4Z26 A;  1D4C A;  1KN0 A;  1VRQ B;  2W0H A;  4A7A A;  1HYU A;  2YLZ A;  1IUX A;  5LV9 A;  1NG4 A;  3DJE A;  4H2N A;  4H2Q A;  1GRB A;  2VQ7 A;  3AEG A;  3BI4 A;  4AP1 A;  3CIR A;  2YAU A;  3CNP A;  1H7W A;  2WDV A;  4OPI A;  2C3D A;  1D4E A;  4REK A;  1DOE A;  2XLS A;  4I59 A;  2WHD A;  4JQ9 A;  2YLW A;  4TM1 A;  3SZC A;  2OA1 A;  3PS9 A;  1GEU A;  1LVL A;  2YVJ A;  2JB1 A;  2YG7 A;  4H4S A;  3WE0 A;  4Z2U A;  4FK1 A;  3PG6 A;  1Y56 B;  2WOW A;  2WES A;  1JU2 A;  2R0P A;  2WS3 A;  3VR8 A;  3ZDN A;  2CUL A;  3LXD A;  2BA9 A;  5HY5 A;  4J36 A;  3HZL A;  3NKS A;  4TLX A;  4U2T A;  5DBJ A;  4GCM A;  1LTX R;  3BHK A;  3IHG A;  1REO A;  4K5R A;  5JCN A;  2H88 A;  4II2 A;  3GD4 A;  1IUT A;  4UP3 A;  2UZZ A;  3QVP A;  4J57 A;  1L9E A;  2VRL A;  3C96 A;  4B67 A;  1RP0 A;  4TM4 A;  4CY8 A;  1P2H A;  3AE2 A;  2XFP A;  1PJ6 A;  2NPX A;  4TM0 A;  1NDA A;  4H4P A;  4LII A;  2YG4 A;  4X9M A;  5FS6 A;  1DOC A;  4H4X A;  2BK5 A;  1JNR A;  4KX6 A;  2WPF A;  4H4R A;  3L8K A;  2CDU A;  2JK6 A;  1DOD A;  3HYW A;  1O94 A;  1H7X A;  4LU6 A;  3NK2 X;  4IVM B;  2XVH A;  1NHQ A;  4ECH A;  3HYV A;  2VVL A;  1CC4 A;  2WPE A;  2XCG A;  2R45 A;  4WCT A;  4YSH A;  2GR1 A;  2V60 A;  2GV8 A;  1GET A;  1GTH A;  2BS4 A;  3AED A;  4J2W A;  5KMP A;  3NT6 A;  1KDG A;  2GR3 A;  4CNK A;  4G9K A;  1D7Y A;  2EQ8 A;  1ZOV A;  4CCQ A;  3FIM B;  1FCD A;  2OAM A;  3NNE A;  4IVO B;  1X31 B;  4H4T A;  2BC1 A;  2Q0K A;  3L1R A;  1DXL A;  2BC0 A;  2A8X A;  2XLU A;  3AB1 A;  3M13 A;  1B37 A;  2XVI A;  2WP6 A;  1CJ3 A;  2ARD A;  1FEB A;  2JB2 A;  4YSZ A;  4OCG A;  2ZZ0 A;  1L9C A;  5J60 A;  4BJY A;  3SQP A;  3ICT A;  5KRQ A;  3RP6 A;  1DOB A;  2JKC A;  2RAB A;  2NVK X;  2WBA A;  2Y6R A;  2GR2 A;  3AYL A;  4N9X A;  4NNJ A;  2IID A;  1YQ3 A;  1L0V A;  3AEF A;  5KXJ A;  1PXA A;  2FJA A;  4Z2R A;  3UTF A;  4Z43 A;  3DJG X;  5CQF A;  3BI2 A;  3M0O A;  5EOW A;  5JCI A;  2TMD A;  4JDR A;  4H7U A;  4A6N B;  4RSL A;  4EMI A;  5GSN A;  3UKK A;  1E1N A;  3KD9 A;  1ELI A;  1F6M A;  1DJQ A;  3NK0 X;  3VRB A;  2B9Y A;  1E1L A;  3F8D A;  2IVD A;  3RP8 A;  5BUL A;  2RGJ A;  4BUR A;  2XLT A;  4UDR A;  4EMJ A;  1RSG A;  3ABV A;  2GR0 A;  2C7G A;  4GDP A;  4U8K A;  4H4V A;  1PS9 A;  4U8J A;  3S5W A;  2GF3 A;  4H4Z A;  2BS2 A;  4A99 A;  1JRZ A;  2R4E A;  3AD7 B;  2YR5 A;  4OPT A;  2R4J A;  4Z2T A;  5EBK A;  3DK4 A;  4UDP A;  1S2Q A;  1GSN A;  5GRT A;  3KVE A;  1K0L A;  1IUU A;  3T2Y A;  1AOG A;  1DJN A;  2I0Z A;  3O0H A;  4AT0 A;  3DK8 A;  1GOS A;  3AE1 A;  3UOY A;  3EAN A;  1XHC A;  1FEA A;  2ZBW A;  1ZMD A;  3CTY A;  1OJ9 A;  1Y56 A;  3AXB A;  3FBS A;  3LJP A;  1Q1W A;  1QJD A;  1PHH A;  2QA2 A;  2YVG A;  2GMH A;  1O5W A;  4GUV A;  3UTG A;  1N4W A;  1CJC A;  2IVE A;  3GRS A;  4YSY A;  2BK3 A;  3NK1 X;  3K30 A;  1H84 A;  3QSM A;  3CPH G;  5KMR A;  3DJJ A;  3IC9 A;  3AYI A;  3GWD A;  1GRE A;  1V59 A;  1CBO A;  3KPF A;  4OPU A;  4YKG A;  1GTE A;  3D9X A;  2C70 A;  3ICR A;  4YXD A;  3GYJ A;  2C64 A;  1Q1R A;  4NZH A;  3COX A;  3T37 A;  4TM3 A;  3Q9T A;  1BWC A;  5JCM A;  1H83 A;  4JY2 A;  2GH5 A;  4PAA A;  1JOA A;  2XVJ A;  4H4Q A;  4EQS A;  4D03 A;  3AEE A;  1IUV A;  1E7P A;  4CY6 A;  4HB9 A;  4B65 A;  1JNZ A;  3VQR A;  3GD3 A;  4EIQ A;  2V3B A;  2OLO A;  2V6O A;  1YQ4 A;  4H4U A;  4K8D A;  4USR A;  3SZF A;  3OC4 A;  2VOU A;  2WP9 A;  1NAA A;  2RGO A;  2XVF A;  3DJD A;  5U63 A;  5BRT A;  1JRY A;  1TYP A;  3UCL A;  4NTC A;  3LAD A;  3NIX A;  1YQZ A;  4XWZ A;  3CGD A;  1NG3 A;  3ATR A;  2YR4 A;  1FOH A;  4H2P A;  3PVC A;  5U1O A;  3SXI A;  2BS3 A;  2EQ7 A;  2TPR A;  2R0C A;  3JSK A;  5KMS A;  2Q6U A;  2CVJ A;  2EQ6 A;  4I58 A;  3SYI A;  2YQU A;  2A87 A;  2BXS A;  1F8S A;  1TDF A;  2VVL G;  2XYO A;  3URH A;  1TYT A;  1K0I A;  1OJT A;  3G5S A;  3PO7 A;  2E4G A;  4RG4 A;  1BZL A;  1B4V A;  5FMH A;  1BGN A;  1PBB A;  3DA1 A;  3K7M X;  4JY3 A;  2JBV A;  3T2K A;  3UKH A;  1VQW A;  4Y4N A;  2JB3 A;  1P2E A;  3ALJ A;  4X9N A;  4DSH A;  5KOW A;  1GRH A;  1EL7 A;  1GPE A;  2HQM A;  1UKV G;  4NEW A;  2Z5Y A;  3C4N A;  3NN0 X;  2FJB A;  4C74 A;  2VQB A;  3RP7 A;  3UTH A;  2YM2 A;  3BNM A;  5L46 A;  4AOS A;  2YLT A;  2X99 A;  2YG5 A;  1B8S A;  1F8W A;  1S3E A;  2BRA A;  4KPR A;  1IUW A;  1OJA A;  3G5R A;  4GDE A;  4H2R A;  3FG2 P;  4Y4L A;  1S3B A;  1SEZ A;  2DKH A;  2CFY A;  3AE4 A;  5KMQ A;  3UP5 A;  4IA6 A;  3F8P A;  2GQF A;  4B1B A;  1Y0P A;  4BJZ A;  3RED A;  3GMC A;  3D1C A;  3NH3 X;  4ZCD A;  4A6N A;  4RG3 A;  1ZP0 A;  2YLR A;  3NYC A;  3GMB A;  4Z44 A;  4GRT A;  3AE3 A;  2PYX A;  3KPK A;  4K2X A;  4NWZ A;  5KVI A;  1D4D A;  4OPD A;  1GRT A;  1D7L A;  1PXC A;  4FX9 A;  4LA1 A;  4BK2 A;  1N4V A;  3LZX A;  1QO8 A;  4GR1 A;  4JNA A;  2GMJ A;  2FBW A;  5C2T A;  2BAC A;  2Q0L A;  1D5T A;  2FJE A;  4OPG A;  3AE9 A;  3FPZ A;  3NTA A;  4A79 A;  4HA6 A;  4O5U A;  4AOX A;  3FMW A;  4E0V A;  3L5O A;  2XLP A;  4YTN A;  2X3N A;  3AYJ A;  4XWR A;  4NTD A;  4MJW A;  2Y6Q A;  4A9W A;  4Z25 A;  2GEW A;  4IV9 A;  3AD9 B;  1BKW A;  1TDE A;  3H8I A;  3P4R A;  1H82 A;  5IQ1 A;  3VRD B;  3CNS A;  3ADA B;  1B5Q A;  1E39 A;  1TRB A;  3GWF A;  1LV0 A;  3LZW A;  4NTE A;  2XFU A;  3UKA A;  2RGH A;  1ZX9 A;  4M52 A;  1LQT A;  2WET A;  4PAB A;  2YLS A;  3DME A;  1LQU A;  1JRX A;  1KSS A;  1XDI A;  1PBF A;  1LJ1 A;  3CPI G;  2WPC A;  5KVH A;  5IQ4 A;  1TDK A;  1KFY A;  2GB0 A;  2Z5X A;  5BVA A;  2OLN A;  4FK1 C;  2ZZB A;  1BF3 A;  2WP5 A;  1NHR A;  2V5Z A;  3ALL A;  1ZK7 A;  1ZKQ A;  2X8C A;  4EQR A;  5EB4 A;  3DGH A;  3QFB A;  3AE6 A;  4USQ A;  1K4Q A;  4U8L A;  1TDN A;  4EM3 A;  1CJ2 A;  3AE5 A;  2AAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...