5KVHA

Crystal structure of human apoptosis-inducing factor with w196a mutation
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
487
structure length
438
Chain Sequence
DKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQANGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defining NADH-Driven Allostery Regulating Apoptosis-Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Apoptosis-inducing factor 1, mitochondrial
total genus 139
structure length 438
sequence length 487
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5kvhA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kvhA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kvhA01
2ACZA 3GWFA 2GR3A 4FX9A 2C64A 2R45A 4EMWA 3VRAA 1DNCA 2J3NA 3CN8A 5TR3A 4NTCA 3REDA 4D03A 1Q1RA 1PBFA 4LA1A 4Z43A 3G5RA 2YLXA 4YKFA 4XWZA 3II4A 4J33A 3FPZA 4Z2UA 2GF3A 1NG3A 3AE1A 1H7XA 1PDHA 3DMEA 4YTMA 3K7TA 1DJQA 5KXJA 4H4WA 2JKCA 2V61A 2OLOA 2RGHA 1GESA 4Z2RA 2B7SA 5JCLA 1PHHA 1UKVG 3FMWA 1K0LA 1DXLA 2JB3A 2RABA 4I58A 3C4AA 4RG4A 4YTPA 1CJ3A 4U8PA 3BI2A 2FJBA 1L0VA 1L9EA 1OJDA 4DGKA 1H6VA 4DNAA 4B1BA 2GAHB 2XFPA 4H4PA 2BC0A 1OJTA 1GERA 2H89A 3D8XA 4C5OA 2QA1A 3S5WA 4REKA 1V59A 3BHKA 3H4KA 4OPLA 2ZBWA 3S61A 1GV4A 4AP3A 4MJWA 3HZLA 1GRAA 5KVIA 2GQWA 1GALA 1TDNA 1H81A 2XVJA 2EQ6A 1BF3A 1D4CA 1N4VA 4CRTA 2CULA 1KF6A 2R0GA 3UKPA 1JU2A 3UTFA 2H88A 3LXDA 3GMBA 4CCQA 1S3EA 3AE9A 2XCGA 4B67A 1ZKQA 2A89A 1P2EA 4AOSA 5IPYA 2WS3A 4GRTA 2BXSA 1CL0A 1ZDLA 2YVJA 1VG0A 2GEWA 2X3NA 3QJ4A 3B3RA 4NTDA 4U8LA 4A65A 2VRLA 5JCKA 2WQYA 3R9UA 2Q7VA 3CIRA 3CPJG 1NENA 1N4UA 4WX1A 2Z5YA 4RSLA 1YY5A 2YWLA 3OC4A 3KU9A 3CNPA 4FK1C 4EMJA 3OZ2A 5C2TA 1DODA 1F8SA 4DSHA 3P1WA 4ADWA 3KVEA 3P4RA 4H50A 2B9WA 3UKKA 3ICTA 3FG2P 4K22A 5GRTA 3GD4A 3M0OA 4AOXA 3DH9A 3QSSA 4TM1A 1Y56A 1CJ2A 3IF9A 1E1KA 1OJ9A 2YR5A 1BWCA 3NGCX 2QCUA 3PVCA 3SFDA 1ONFA 4X9NA 5KVHA 2JK6A 2YG3A 4Z25A 4BK1A 1YKJA 3AYLA 4U8IA 4TM0A 5BUKA 2NPXA 4EIQA 4YSXA 1LQTA 1ZMDA 1PBDA 3AECA 1DOCA 2Y6QA 4J31A 3AWIA 1N4WA 1E1MA 1CC4A 2WU5A 3B6DA 1D5TA 1CC2A 2WOVA 3IC9A 1BKWA 1GRBA 2XFOA 3NG7X 4J2WA 3UKHA 3UP4A 3AE8A 2NVKX 2B7RA 1NPXA 3LZXA 3AEAA 4UDQA 5EB4A 1Q1WA 3M12A 3L8KA 4H4UA 3RP6A 3E1TA 4AP1A 3CGCA 3QFAA 3NTDA 3BI5A 2BK4A 3GRSA 4IVMB 2C67A 4BV6A 1NG4A 2YLTA 1DJNA 1KSSA 1GREA 1NHQA 4YSYA 3URHA 4JN9A 4H2RA 1KFYA 1LJ1A 2X50A 1F3PA 4H4YA 3AE3A 3AE4A 3DJDA 3NHOX 3NN0X 2VQ7A 4Y4NA 2CDUA 3DK9A 1L9DA 3GWDA 4BURA 5HHFA 4NZHA 1LV0A 2YG4A 3UKQA 4U8KA 2ARDA 2R4EA 3PO7A 4J56A 4U2TA 3I3LA 1O5WA 4U8OA 1MXTA 2BS2A 4H4VA 3RNMA 2WOWA 5KRQA 2QAEA 1NHRA 1PBCA 2FJAA 2I0ZA 2B9XA 4OVIA 4A5LA 1YQZA 4UDRA 4NTEA 2GRTA 5M0ZA 3KKJA 5FS9A 4HB9A 3DK8A 3AEEA 4Y4LA 1F8WA 1PS9A 1FECA 4EQXA 4JY2A 4EIPA 3NTAA 2ZZBA 1M6IA 3AE6A 1Q9IA 2YAUA 3NH3X 2JB1A 3COXA 1F6MA 2YM2A 4GR1A 4Z44A 5BRTA 2FJDA 3UKLA 2YLSA 5KOWA 2GR0A 2YLZA 4CCRA 3GRTA 2WPFA 1D7YA 3CPIG 2XVFA 4RG3A 1IUSA 4XWRA 5DBJA 3QFBA 2B9YA 2X8CA 4OPGA 5U63A 5JCNA 1D7LA 2O9ZA 4J57A 2C72A 1ZOYA 2WOIA 2XLRA 1TYPA 2YG6A 3EPTA 5ER0A 3DGZA 2BACA 1GSNA 4M52A 3ADAB 1H86A 3EAOA 2EQ8A 3CGEA 2WP9A 3AE2A 3AXBA 4BJZA 3KLJA 1XANA 1PXBA 1P2HA 4YXDA 1PJ7A 1IUTA 2VZ2A 2VVLA 1IJHA 2CVJA 4J36A 3QSEA 3UCLA 4H2QA 3LB8A 1KSUA 5L46A 2BXRA 1TRBA 2BYBA 4OPCA 4WCTA 3WE0A 3C4NA 3UKFA 4J34A 2WDQA 4A79A 4YT0A 2TMDA 1GT8A 1Z6LA 3RHAA 3UTEA 4Z24A 1FCDA 5CKUA 2ZZ0A 1O94A 3F8DA 2JAEA 3BI4A 3IHGA 3QSMA 1JNRA 4X4JA 4H4TA 3VR9A 4B66A 1H82A 5BULA 4EM3A 3G5QA 1FOHA 1GRGA 4USRA 1IUUA 3NK0X 4C74A 3NLCA 1K0JA 1E7PA 1TDKA 4IA5A 2TPRA 3F8PA 4CY6A 3CNTA 4ICYA 2R0CA 2XLPA 1VRQB 2BK5A 1IUVA 2FJEA 4BK2A 2RGOA 4ECHA 2QA2A 4U8JA 2WP5A 2B76A 4YSZA 4YKGA 1W4XA 5U1OA 4HA6A 1SEZA 4AT2A 3IHMA 1OJAA 1LQUA 1GRFA 2XLTA 1Y56B 2GB0A 2Z5XA 1EL9A 2WDRA 2IIDA 1KNRA 3DA1A 3Q9TA 3GYIA 2IVDA 3DJEA 4GCMA 3CGDA 2VOUA 4N9XA 2VVMA 3P4SA 3AD7B 4CNJA 1JOAA 1GEUA 1IUWA 1D4DA 2BK3A 2XFNA 4GF7A 5EB5A 1N1PA 4O5UA 2AAQA 4DSGA 4GDEA 3UOYA 5M10A 3DJJA 4JNAA 2JBVA 2PHHA 3AD8B 1DOBA 1LPFA 1E6EA 1PXAA 2GMJA 2YLRA 3SM8A 3NRNA 2OA1A 3RP7A 2VQBA 1EL8A 1NDAA 4U8MA 1BGNA 3SGLA 3FBSA 1CJ4A 4EM4A 1TDOA 3K30A 4EQWA 2Q0LA 3UP5A 4PABA 1JEHA 3AYJA 1GOSA 2VVLG 3CNJA 5J60A 2YQUA 4B68A 3VRDB 1RYIA 2C70A 3C96A 2GR1A 3P4PA 1QJDA 2E5VA 4C3YA 4Y4MA 2X8GA 4OPTA 1FEBA 2C75A 5GSNA 1EBDA 3GDPA 3EF6A 3NYFA 3AE5A 2WBAA 2YVGA 2GQFA 4H4SA 1DOEA 1E39A 1CC6A 2C7GA 3K7MX 4H2NA 4YSHA 4H4QA 2A8XA 3Q6JA 4K5SA 3G5SA 3ICSA 2DKIA 2F5ZA 1PN0A 4H2PA 3UTGA 3UOXA 1VG9A 1MO9A 2WEUA 2AR8A 4U2LA 3VQRA 3EANA 1B8SA 3NK1X 5IQ1A 1S3BA 4NEWA 4GUVA 1D4EA 4Z26A 3V3OA 4H4XA 3AEFA 3NK2X 5KWFA 2EQ9A 4CY8A 1H83A 1COYA 1NEKA 2WETA 4K7ZA 2X99A 1VDCA 4K5RA 1ELIA 1KNPA 1LTXR 2XDOA 5IQ4A 2GV8A 1NHPA 3ABVA 2X8HA 3ICRA 5BVAA 4TM3A 4ZCDA 3CNSA 4D04A 1NAAA 4E0VA 1GTEA 2CFYA 4FDCB 1GXFA 1GNDA 4UDPA 4YWOA 4ZCCA 3UOZA 2BC1A 2GR2A 3UKAA 2Q6UA 3UTHA 3BNUA 1QO8A 4UP3A 4TM4A 4A7AA 3DK4A 1LVLA 1XHCA 1CJCA 2WP6A 4EQSA 3NT6A 4U2SA 2FBWA 4OPIA 1JRXA 1PJ6A 3L1RA 4JDRA 2XFQA 2XFUA 3M13A 1EL7A 4A6NB 2WPEA 1JRYA 1IUXA 2C3CA 1E1NA 1CF3A 2XVIA 2Y6RA 3AE7A 1Y0PA 1B37A 2WDVA 4ZN0A 4OPDA 1ZX9A 2WPCA 4GDPA 4KPRA 4APNA 3BNMA 3NKSA 3LJPA 2OLNA 2Q0KA 4C77A 4XXGA 1H7WA 2OALA 1TDFA 4K2XA 2YR6A 2APGA 3T37A 2R9ZA 2BCPA 5EBKA 1ZMCA 4U8NA 4TLXA 5JCIA 5KOXA 4B63A 5LV9A 2YG7A 1X31B 4TLZA 1PBEA 1S2YA 3LADA 2YG5A 4EQRA 3JSKA 3DJGX 4PAAA 3ITJA 4C3XA 2HQMA 1KDGA 1K4QA 2OAMA 3GYJA 3RP8A 3ZYXA 3F8RA 2BS4A 2WHDA 2GAGB 2YVFA 4FK1A 2XVEA 2C3DA 2V60A 2C76A 1H84A 4JNQA 2R4JA 3NNEA 1S2QA 3SFEA 4CBQA 5JCMA 1B4VA 2ZZCA 3PS9A 1TYTA 1PJ5A 5FS7A 2YM1A 3AB1A 3H8LA 4KX6A 4OPUA 5CQFA 4LIIA 2R46A 1K0IA 2A87A 1O95A 1VQWA 2DKHA 5HYMA 1EL5A 1ZOVA 1BZLA 1ZP0A 2GMHA 4LU6A 4H4ZA 3ATQA 1GTHA 2V3BA 1NHSA 3ISHA 2V6OA 2V3AA 3AD9B 3H8IA 2UZZA 4JY3A 3QVPA 4X9MA 2BCGG 5FMHA 2YR4A 3D1CA 1JRZA 5J7XA 4P9SA 4K8DA 2E1MA 2V5ZA 1E1LA 2WESA 1BGJA 4AT0A 1B5QA 1GETA 1ZK7A 1GPEA 4I59A 2C65A 1M64A 2WU2A 4Z2TA 4YTNA 2IVEA 1FEAA 2AQJA 4NEVA 3VRBA 4IV9A 5FS6A 1MOKA 3I6DA 3V3NA 1GRTA 3AEDA 4A9WA 1RP0A 3KA7A 1QLBA 3GSIA 3ATRA 1JNZA 2YLWA 3AYIA 3CPHG 2BABA 3O0HA 3ALJA 4H4RA 3LZWA 3V76A 4A6NA 4B64A 4JQ9A 2E4GA 3SQPA 3P9UA 3UOVA 2PYXA 3FIMB 2W0HA 3NYCA 5FS8A 2EQ7A 2XLUA 2VRMA 3NYEA 4H7UA 1REOA 2BS3A 2JB2A 1PBBA 3KPFA 4OCGA 3CTYA 4IVOB 1YQ4A 1F8RA 3LOVA 3NN6X 1YQ3A 3DGHA 4B69A 4BJYA 1TDEA 3ZDNA 1XDIA 5HY5A 1FL2A 4EMIA 2XLSA 3GD3A 2GVCA 4IA6A 1CBOA 1OJCA 1PXCA 3QVRA 4O5QA 2R0PA 3K7QX 3CGBA 4CNKA 3CNDA 5C3JA 5U25A 3KD9A 3ALLA 2RGJA 1L9CA 3IWAA 3AEGA 1XPQA 3NIXA 2BA9A 1HYUA 3BHFA 3GMCA 4USQA 1AOGA 3ALMA 1RSGA 4A99A 4BK3A 3GDNA 5EOWA 4B65A 2C66A 3AEBA 1CHUA 5HXIA 1ZY8A 2GH5A 3P4QA 2XVHA 2XYOA 1GRHA 3VR8A 2C73A
chains in the Genus database with same CATH superfamily
4IP5A 4GYPA 2C64A 5JRBA 4EMWA 5TR3A 4NTCA 3REDA 1PBFA 4XWZA 3II4A 3AE1A 1DJQA 2V61A 3CMMA 2B7SA 5JCLA 2W3RA 2FJBA 1L0VA 1N62C 1H6VA 4DNAA 1EC8A 4B1BA 4H4PA 3D8XA 2QA1A 4REKA 3H4KA 2MUCA 4OPLA 3S61A 3HZLA 3R10A 2EQ6A 1WYGA 3UKPA 3UTFA 3AE9A 4B67A 1ZKQA 2A89A 2WS3A 1E9IA 2YVJA 4U8LA 3THUA 4A65A 2VRLA 2Q7VA 1KKRA 1N4UA 4RSLA 3T2KA 3OC4A 3KU9A 3CNPA 3N4FA 4EMJA 5C2TA 1DODA 1ZXIC 2GGGA 3UKKA 2PTXA 4AOXA 4TM1A 3NGCX 2QCUA 3PVCA 3SFDA 3SX6A 4Z25A 4IP4A 4TM0A 5BUKA 2NPXA 3T0KA 1DOCA 2W54A 1BKWA 3SY4A 4J2WA 3UKHA 4UDQA 3L8KA 3CGCA 4HPNA 4X2PA 5G5GB 1NG4A 3SN0A 1NHQA 4F4RA 3URHA 1ELSA 4Y4NA 2CDUA 3GWDA 5HHFA 4IL2A 3UKQA 2ARDA 4E5TA 1O5WA 4U8OA 5KRQA 1NHRA 1PBCA 2FJAA 4OVIA 4A5LA 3ES8A 3PWIA 3KKJA 3V3WA 1F8WA 4EIPA 2ZZBA 3COXA 4MMWA 2YM2A 2OQHA 3HW2A 3U9IA 4CCRA 3QFBA 3ENLA 1D7LA 4J57A 2C72A 5KMSA 2I5QA 4ROPA 1H86A 3EAOA 2EQ8A 1P2HA 2PTWA 2VVLA 4J36A 3D47A 5L46A 2BXRA 2BYBA 3VCCA 1FCDA 2ZZ0A 1O94A 4B66A 5BULA 3BSMA 3D46A 3H70A 4DN1A 4IA5A 3F8PA 4CY6A 2QGYA 1IUVA 2P8CA 2OZ3A 4U8JA 2FYMA 4YKGA 1W4XA 1GRFA 6ENLA 3DA1A 2IVDA 5FJOA 2GSHA 3K1GA 3PG6A 2VVMA 4N9XA 3P4SA 4GAVA 4CNJA 1GEUA 5EB5A 3NZGA 3GD6A 4O5UA 2AAQA 4GDEA 5M10A 3AD8B 2GMJA 2YLRA 3SR6B 1NDAA 4U8MA 3FBSA 3UJEA 3CXOA 3DG7A 4EQWA 4PABA 5J60A 3CNJA 2YQUA 3VRDB 2GR1A 3IJIA 4GISA 2X8GA 4OPTA 1FEBA 2C75A 2OFJA 3FV9A 4KT2A 3GDPA 3EF6A 2WBAA 2GQFA 4H4SA 4H2NA 3V5CA 4H4QA 2A8XA 4K5SA 3RGTA 3DG3A 3CK5A 1PN0A 1MUCA 1N63C 3UOXA 1F9CA 2AR8A 3VQRA 3EANA 4YWSA 3NK1X 4H83A 4H4XA 3NK2X 5KWFA 2EQ9A 4K7ZA 1VDCA 1KNPA 1NHPA 5BVAA 4E0VA 1GTEA 2CFYA 1SJCA 3OP2A 2PU1A 4DHGA 3H7VA 3UTHA 2OQYA 3SZ0A 4UP3A 3OZYA 1N60C 4TM4A 2XGZA 1LVLA 3RO6A 1CJCA 4EQSA 2XH4A 3RCYA 1JRXA 3L1RA 3STPA 1FO4A 2XFQA 3M13A 4A6NB 2WPEA 1E1NA 1FHVA 1MNSA 1JCTA 1Y0PA 4KPRA 3ZVIA 5FJUA 1ZMCA 5KNLA 5LV9A 2YG7A 1X31B 2YG5A 3JSKA 3TCSA 4G6GA 2YVFA 2ZC8A 2PPGA 4DX3A 3R25A 1KKOA 4II3A 5JCMA 1TYTA 1PJ5A 3H8LA 5KMRA 1VDVA 1O95A 3TW9A 3NRZB 3NFUA 4ENLA 2OPJA 2V6OA 3QVPA 5FMHA 2YR4A 4K8DA 1E1LA 2WESA 4AT0A 1GETA 1ZK7A 2C65A 2WU2A 3VRBA 1MOKA 3AEDA 4A9WA 3KA7A 4DXKA 2ZADA 4H4RA 3LZWA 2GDQA 3P9UA 3UOVA 3NYEA 3T2YA 2BS3A 3R11A 4IVOB 1YQ3A 4B69A 1XDIA 3RR1A 3GD3A 4IA6A 3QVRA 4O5QA 3CNDA 3P93A 1L9CA 3AEGA 3NIXA 2BA9A 1HYUA 3GMCA 4A99A 4B65A 5HXIA 1ZY8A 2GH5A 2XYOA 3G5RA 1DNCA 2J3NA 2POZA 4J3ZA 3QN3A 2OVLA 2YLXA 4YKFA 3FPZA 5BOFA 2GF3A 1H7XA 1PDHA 3DMEA 3K7TA 4H4WA 1FFUC 4Z2RA 1K0LA 4YTPA 2RABA 3C4AA 1CJ3A 1OJDA 1FIQB 3HPFA 1OJTA 1GERA 3OW1A 3S5WA 1V59A 1N61C 3BHKA 4AP3A 3S47A 2GQWA 3DERA 1TDNA 1NELA 1H81A 2XVJA 1D4CA 4DYEA 4MKSA 2H88A 2XCGA 3I6TA 4AOSA 2OZTA 4C5OA 2BXSA 1CL0A 1VG0A 2X3NA 2GEWA 3B3RA 4NTDA 3DG6A 2WQYA 3CPJG 4GAPA 2Z5YA 1YY5A 3MKCA 3NS1B 3VFCA 4H50A 2B9WA 3M0OA 1OJ9A 2YR5A 3SN1A 2AKZA 2JK6A 3TTEA 2YG3A 1YKJA 3AYLA 4EIQA 1LQTA 1MDRA 1N4WA 3B6DA 1KN0A 2OZ8A 1CC2A 1D5TA 1FFVC 1GRBA 2XFOA 3BOXA 3AE8A 3AEAA 1H2IA 3M12A 1SJDA 3E1TA 4IZGA 5KMQA 2C67A 4H2RA 1LJ1A 2X50A 1F3PA 4H4YA 3AE3A 3DJDA 1L9DA 3NVZB 3N6JA 1LV0A 1X2GA 3PO7A 4J56A 2BS2A 3RNMA 2I0ZA 5FS9A 3DK8A 3AEEA 4EQXA 3NTAA 4G7FA 3NH3X 1N5XA 3AN1A 2GR0A 2PCEA 2GL5A 4XWRA 2X8CA 2O9ZA 2WOIA 2XLRA 2YG6A 4E4FA 5ER0A 3DGZA 1GSNA 1MDLA 3NO1A 1WUFA 2RDXA 3AXBA 4YXDA 5BOEA 4KEMA 4H2QA 3WE0A 4WCTA 4J34A 4K8GA 3QKEA 3F8DA 2JAEA 3JZUA 4H4TA 3VR9A 1H82A 1RM6B 2GGJA 1FOHA 1GRGA 3TJ4A 3I6EA 1VQZA 4ICYA 2R0CA 2XLPA 4G9KA 5U1OA 4AT2A 3Q45A 3IHMA 2XLTA 3DESA 1Y56B 2PP1A 2IIDA 3SYIA 1KNRA 3GYIA 3CGDA 2VOUA 3AD7B 1IUWA 4GF7A 1N1PA 3DJJA 2DW6A 3ZVHB 1E6EA 1PXAA 3NRNA 3RP7A 3SXIA 3SGLA 4EM4A 1TDOA 3UP5A 1JRPA 2VVLG 4B68A 1TKKA 3C96A 2PSNA 1QJDA 2E5VA 4Y4MA 5IDZA 3NVWB 3L5OA 1CC6A 3Q6JA 4M6UA 3G5SA 3IJLA 1VG9A 1MO9A 2AKMA 3PWGA 1JPDX 3FXGA 3ZLGA 4H19A 1H83A 1COYA 1NEKA 2WETA 2X99A 2GV8A 3ABVA 2X8HA 4ZCDA 4D04A 1NAAA 1GXFA 4UDPA 3UOZA 2BC1A 3FYYA 3MUCA 2HXTA 4A7AA 2HZGA 3DK4A 4HCDA 1XHCA 3QLDA 2QQ6A 4U2SA 1PJ6A 2XH7A 1P48A 1EL7A 3DIPA 3T8QA 1FHUA 2P8BA 4ZA0A 2OG9A 1L8PA 1NU5A 4APNA 3BNMA 2QDEA 3LJPA 4HYRA 2C4CA 2OLNA 3VC6A 2OALA 4K2XA 3CT2A 2QJNA 4U8NA 5JCIA 3HYWA 4C3XA 3ITJA 2W55A 3SJNA 2GAGB 2XVEA 4DWDA 2C76A 4JNQA 2AL2A 3SFEA 3DEQA 4GGBA 5CQFA 2YM1A 3P3BA 2R46A 3ZVHA 1VQWA 1EL5A 3ISHA 2V3AA 3H8IA 3AD9B 3D1CA 4P9SA 2XH0A 4YTNA 3SBFA 4E6MA 3HYXA 1JDFA 2AQJA 4NEVA 4IV9A 1RP0A 4H2HA 3O0HA 3ALJA 4EWJA 4B64A 2W0HA 3NYCA 4H7UA 4HCLA 1ONEA 3LOVA 3CB3A 5HY5A 4EMIA 1S7MA 1OJCA 3EEZA 5C3JA 4CNKA 3IWAA 2MNRA 1RSGA 5EOWA 4KPLA 3P4QA 3QSEA 2C73A 1STZA 2ACZA 3GWFA 2GR3A 4FX9A 2R45A 3VRAA 1X2HA 4D03A 4Z43A 2P88A 3PFRA 1RVKA 4ZOHB 4Z2UA 1EC7A 1NG3A 5G5HB 4YTMA 3I4KA 2OLOA 3FMWA 2JB3A 1DXLA 4RG4A 4JHMA 4U8PA 3BI2A 3UXKA 2GAHB 2XFPA 3TWBA 2ZBWA 1GV4A 1SJBA 3DDMA 5KVIA 1GALA 2PGEA 1BF3A 3T4WA 3GMBA 4CCQA 1S3EA 3B9JB 1BKHA 5IPYA 1P2EA 1EBGA 1ZDLA 3CIRA 1NENA 4TVYA 4IHCA 4FK1C 4DSHA 3A7UA 3P1WA 3JVAA 3FG2P 4K22A 3GD4A 1BWCA 3VC5A 3JW7A 5KVHA 2BRYA 3A7AA 4YSXA 2QVHA 1ZMDA 4J31A 3AWIA 3MZNA 2W3SA 4E8GA 1CC4A 2WU5A 2WOVA 3IC9A 3NG7X 3UP4A 2NVKX 2B7RA 3DGBA 1Q1WA 4H4UA 3RP6A 4AP1A 3BI5A 3GRSA 4G8TA 2YLTA 1TZZA 1KSSA 4YSYA 4JN9A 3AE4A 3PK7A 3NN0X 2VQ7A 4BURA 3S5SA 3SZWA 3CYJA 2YG4A 4U2TA 3I3LA 1MXTA 4H4VA 2WOWA 3OZMA 3TJIA 2QAEA 4K1WA 2PA6A 1YQZA 4UDRA 2GRTA 2OLAA 3UJSA 4GIRA 1FECA 1M6IA 3AE6A 2YAUA 3Q4DA 5BRTA 1F6MA 4GR1A 2CHRA 4FI4A 3H8AA 5KOWA 1SB3B 3GRTA 1D7YA 1PDZA 2XVFA 3CPIG 5DBJA 2B9YA 4OPGA 4KWSA 3D9XA 5JCNA 1ZOYA 2BACA 3HRDC 4M52A 3ADAB 3CGEA 3FCPA 3AE2A 4BJZA 1PXBA 1PJ7A 4A35A 3TWAA 1IJHA 2CVJA 3UCLA 3LB8A 1KSUA 4OPCA 3C4NA 3SZFA 3UKFA 1Z6LA 3RHAA 1MRAA 3IJQA 3QSMA 4X4JA 4EM3A 3G5QA 1XPYA 3NK0X 4USRA 3NLCA 1E7PA 1TDKA 3UCDA 3NVVB 3CNTA 4G6HA 1VRQB 2BK5A 2FJEA 2BRAA 2PMQA 2WP5A 3T2ZA 1SEZA 2GB0A 2Z5XA 2WDRA 3Q9TA 4GGHA 4GCMA 3MY9A 4FP1A 1JOAA 2BK3A 4DSGA 3UOYA 4ZCWA 2JBVA 3SM8A 1DOBA 3NVYB 1EL8A 3K30A 2Q0LA 1TE6A 1GOSA 2PTYA 4NWZA 1RYIA 1R0MA 1DTNA 3P4PA 4NZHA 1EBDA 4GMEA 2YVGA 3AE5A 3ETRB 5ENLA 1E39A 3FJ4A 3K7MX 3R07C 3ICSA 2F5ZA 4H2PA 3UTGA 4U2LA 2HNEA 5IQ1A 1S3BA 3ZLFA 5KMPA 4K5RA 1LTXR 5IQ4A 1YEYA 4TM3A 1GNDA 4M0XA 1ECQA 2Q6UA 3BNUA 1QO8A 3ZLHA 1KCZA 2WP6A 3NT6A 4JDRA 3IK4A 1CF3A 2Y6RA 3AE7A 1B37A 2WDVA 4OPDA 1ZX9A 4H1ZA 3NKSA 4Z1YA 3QPEA 2Q0KA 3KPKA 4C77A 4HN8A 2YR6A 2APGA 1PDYA 2BCPA 4TLXA 3GY1A 5KOXA 4B63A 1PBEA 4PAAA 4EQRA 3DJGX 3ZYXA 2HQMA 3SN4A 1K4QA 1KDGA 2OAMA 3GYJA 3F8RA 2BS4A 4FK1A 3RRAA 1H84A 3RITA 2ONEA 4CBQA 2ZZCA 3PS9A 3H12A 1K0IA 2A87A 1P43A 2DKHA 5HYMA 1BZLA 2QDDA 1KD0A 1ZP0A 4DGKA 4LU6A 3ATQA 1GTHA 3T14A 3B97A 1JRZA 5J7XA 4IT1A 3DFYA 5J04A 3T6CA 1GPEA 4I59A 1M64A 4Z2TA 2IVEA 1FEAA 4Z17A 4J1OA 5FS6A 3R1ZA 3I6DA 1GRTA 1QLBA 2P0IA 1JNZA 2YLWA 3AYIA 3CPHG 2BABA 3QTPA 2AL1A 3R0KA 4A6NA 4JQ9A 3SQPA 2PYXA 3FIMB 3TQPA 5FS8A 2JB2A 1PBBA 3KPFA 1F8RA 3DGHA 4BJYA 1XS2A 1FL2A 5FJTA 2GVCA 1CBOA 2R0PA 3K7QX 3CGBA 5U25A 3KD9A 2XSXA 4USQA 3DFHA 4BK3A 2C66A 2XVHA 2XLSA 1GRHA 3GC2A 3CN8A 4K2SA 1Q1RA 4LA1A 4J33A 4II2A 4HNLA 2QJJA 4HCHA 5KXJA 2JKCA 2RGHA 1GESA 3ES7A 1PHHA 1UKVG 2GGHA 4I58A 1BQGA 3N6HA 1L9EA 1EC9A 2BC0A 2H89A 3UJRA 4MJWA 1GRAA 3GDNA 1N4VA 2PP3A 4G74A 4CRTA 2GGEA 2CULA 1T3QC 1KF6A 2R0GA 4GYPC 1JU2A 3LXDA 4GRTA 3V4BA 3QJ4A 5JCKA 3R9UA 4WX1A 2YWLA 3OZ2A 1F8SA 4ADWA 3KVEA 3P4RA 1JROA 3ICTA 5GRTA 3MSYA 3DH9A 3QSSA 1Y56A 1CJ2A 3IF9A 1E1KA 1ONFA 3BJSA 4X9NA 3CXBA 3VA8A 4BK1A 3N4EA 4U8IA 2PODA 3KUMA 1PBDA 3AECA 2Y6QA 2PP0A 1E1MA 1WUEA 1NPXA 3LZXA 5EB4A 3QFAA 2OKTA 3UJFA 3NTDA 2BK4A 2PGWA 4IVMB 4BV6A 1DJNA 1GREA 1KFYA 2O56A 3NHOX 3DK9A 2HXUA 3A7RA 4U8KA 2R4EA 2B9XA 1SJAA 4NTEA 1N5WC 5M0ZA 3VCNA 4HB9A 4Y4LA 1PS9A 4JY2A 1Q9IA 2JB1A 4Z44A 3EKGA 2FJDA 3GO2A 3UKLA 2YLSA 3R0UA 2YLZA 2OO6A 2WPFA 4RG3A 1IUSA 5U63A 3P0WA 1TYPA 3EPTA 3AM9A 2WP9A 3GYXA 1R6WA 3EUB3 3KLJA 1XANA 3FVDA 4JN7A 1IYXA 1IUTA 1W6TA 2VZ2A 4IL0A 1TRBA 2WDQA 4A79A 4YT0A 2TMDA 1GT8A 3UTEA 4Z24A 5CKUA 3IHGA 3UCCA 3BI4A 1JNRA 1JPMA 3T9PA 1IUUA 3HYVA 4C74A 1K0JA 2TPRA 4BK2A 2RGOA 4ECHA 2QA2A 2FKPA 2B76A 4YSZA 4HA6A 1OJAA 2QJMA 1LQUA 1EL9A 3DJEA 3OPSA 3SQSA 3UGVA 2XH2A 1D4DA 2XFNA 2E5AA 4HNCA 4JNAA 2PHHA 1LPFA 3SZCA 2OA1A 2VQBA 1BGNA 1CJ4A 1JEHA 3AYJA 2E3TA 3SSZA 2C70A 4C3YA 2NQLA 5GSNA 3NYFA 1DOEA 4E4UA 2C7GA 4YSHA 2PU0A 3AMZA 2DKIA 2WEUA 1B8SA 3VDGA 5FJPA 4NEWA 4GUVA 1D4EA 4Z26A 3V3OA 3AEFA 4CY8A 7ENLA 1ELIA 2XDOA 3ICRA 2OX4A 5FJRA 3CNSA 4FDCB 3MQTA 4YWOA 4ZCCA 2GR2A 3UKAA 3TOYA 2FBWA 4OPIA 3UXLA 2XFUA 1JRYA 1IUXA 2C3CA 2XVIA 2GGIA 4ZN0A 2WPCA 4A6GA 4GDPA 4XXGA 1H7WA 3NXLA 1TDFA 3T37A 2R9ZA 5EBKA 3MWCA 4TLZA 1S2YA 3LADA 3RP8A 2WHDA 4A3RA 2C3DA 2V60A 5EU9A 4GFIA 2R4JA 3NNEA 3UJ2A 1S2QA 1B4VA 4JN8A 3AB1A 5FS7A 4KX6A 4OPUA 4LIIA 1ZOVA 3OTRA 2GMHA 4H4ZA 2V3BA 1NHSA 4JY3A 4X9MA 2UZZA 2BCGG 2E1MA 2V5ZA 1BGJA 1B5QA 3V5FA 4NNJA 1OEPA 4G73A 3U4FA 3V3NA 3GSIA 3ATRA 4MGGA 2PTZA 1EBHA 3V76A 2P3ZA 2E4GA 4TVWA 2EQ7A 2XLUA 2VRMA 1REOA 4OCGA 3CTYA 1YQ4A 3NN6X 3CAWA 1TDEA 3ZDNA 2AL2B 2PS2A 1PXCA 3ALLA 2RGJA 1XPQA 3BHFA 1AOGA 1V97A 2DW7A 3AEBA 3T31A 1CHUA 3ALMA 3VR8A
chains in the Genus database with same CATH topology
2ACZA 3GWFA 2GR3A 4FX9A 2C64A 5JRBA 4EMWA 2R45A 1DNCA 3VRAA 2J3NA 3CN8A 5TR3A 4NTCA 3REDA 4D03A 1Q1RA 1PBFA 4LA1A 4Z43A 3G5RA 2YLXA 4YKFA 4XWZA 3II4A 4J33A 3FPZA 4II2A 4Z2UA 2GF3A 1NG3A 3AE1A 1H7XA 1PDHA 3DMEA 4YTMA 3K7TA 1DJQA 5KXJA 4H4WA 2JKCA 2V61A 2OLOA 2RGHA 1GESA 4Z2RA 3CMMA 2B7SA 5JCLA 1PHHA 1UKVG 3FMWA 1K0LA 1DXLA 2JB3A 2RABA 4I58A 3C4AA 4RG4A 4YTPA 1CJ3A 4U8PA 3BI2A 2FJBA 1L0VA 1L9EA 1OJDA 4DGKA 1H6VA 4DNAA 4B1BA 2GAHB 2XFPA 4H4PA 2BC0A 1OJTA 1GERA 2H89A 3D8XA 4C5OA 2QA1A 3S5WA 4REKA 1V59A 3BHKA 3H4KA 4OPLA 2ZBWA 3S61A 1GV4A 4AP3A 4MJWA 3HZLA 1GRAA 5KVIA 2GQWA 1GALA 1TDNA 1H81A 2XVJA 2EQ6A 1BF3A 1D4CA 1N4VA 4G74A 4CRTA 2CULA 1KF6A 2R0GA 3UKPA 1JU2A 3UTFA 2H88A 3LXDA 3GMBA 4CCQA 1S3EA 3AE9A 2XCGA 4B67A 1ZKQA 2A89A 1P2EA 4AOSA 5IPYA 2WS3A 4GRTA 2BXSA 1CL0A 1ZDLA 2YVJA 1VG0A 2GEWA 2X3NA 3QJ4A 3B3RA 4NTDA 4U8LA 4A65A 2VRLA 5JCKA 2WQYA 3R9UA 2Q7VA 3CIRA 3CPJG 1NENA 1N4UA 4GAPA 4WX1A 2Z5YA 4RSLA 1YY5A 2YWLA 3T2KA 3OC4A 3KU9A 3CNPA 4FK1C 4EMJA 3OZ2A 5C2TA 1DODA 1F8SA 4DSHA 3P1WA 4ADWA 3KVEA 3P4RA 4H50A 2B9WA 3UKKA 3ICTA 3FG2P 4K22A 5GRTA 3GD4A 3M0OA 4AOXA 3DH9A 3QSSA 4TM1A 1Y56A 1CJ2A 3IF9A 1E1KA 1OJ9A 2YR5A 1BWCA 3NGCX 2QCUA 3PVCA 3SFDA 1ONFA 4X9NA 5KVHA 3SX6A 2JK6A 2YG3A 4Z25A 4BK1A 1YKJA 3AYLA 4U8IA 4TM0A 2BRYA 2NPXA 5BUKA 4EIQA 4YSXA 1LQTA 3T0KA 1ZMDA 1PBDA 3AECA 1DOCA 2Y6QA 4J31A 3AWIA 1N4WA 1E1MA 1CC4A 2WU5A 3B6DA 1KN0A 1CC2A 1D5TA 2WOVA 3IC9A 1BKWA 3SY4A 1GRBA 2XFOA 3NG7X 4J2WA 3UKHA 3UP4A 3AE8A 2NVKX 2B7RA 1NPXA 3LZXA 3AEAA 1H2IA 4UDQA 5EB4A 1Q1WA 3M12A 3L8KA 4H4UA 3RP6A 3E1TA 4AP1A 3CGCA 3QFAA 3NTDA 3BI5A 2BK4A 3GRSA 4IVMB 5KMQA 2C67A 4BV6A 1NG4A 2YLTA 1DJNA 1KSSA 1GREA 1NHQA 4YSYA 3URHA 4JN9A 4H2RA 1KFYA 1LJ1A 2X50A 1F3PA 4H4YA 3AE3A 3AE4A 3DJDA 3NHOX 3NN0X 2VQ7A 4Y4NA 2CDUA 3DK9A 1L9DA 3GWDA 4BURA 5HHFA 4NZHA 1LV0A 3SZWA 2YG4A 3UKQA 4U8KA 2ARDA 2R4EA 3PO7A 4J56A 4U2TA 3I3LA 1O5WA 4U8OA 1MXTA 2BS2A 4H4VA 3RNMA 2WOWA 5KRQA 2QAEA 1NHRA 1PBCA 2FJAA 2I0ZA 2B9XA 4OVIA 4A5LA 1YQZA 4UDRA 4NTEA 2GRTA 5M0ZA 3KKJA 5FS9A 4HB9A 3DK8A 3AEEA 4Y4LA 1F8WA 1PS9A 1FECA 4EQXA 4JY2A 4EIPA 3NTAA 2ZZBA 1M6IA 3AE6A 1Q9IA 2YAUA 3NH3X 2JB1A 3COXA 1F6MA 2YM2A 4GR1A 4Z44A 5BRTA 2FJDA 3UKLA 2YLSA 5KOWA 2GR0A 2YLZA 4CCRA 3GRTA 2WPFA 1D7YA 3CPIG 2XVFA 4RG3A 1IUSA 4XWRA 5DBJA 3QFBA 2B9YA 2X8CA 4OPGA 3D9XA 5JCNA 1D7LA 2O9ZA 4J57A 2C72A 5U63A 5KMSA 1ZOYA 2WOIA 2XLRA 1TYPA 2YG6A 3EPTA 5ER0A 3DGZA 2BACA 1GSNA 4M52A 3ADAB 1H86A 3EAOA 2EQ8A 3CGEA 2WP9A 3GYXA 3AE2A 3AXBA 4BJZA 3KLJA 1XANA 1PXBA 1P2HA 4YXDA 1PJ7A 1IUTA 2VZ2A 2VVLA 1IJHA 2CVJA 4J36A 3QSEA 3UCLA 4H2QA 3LB8A 1KSUA 5L46A 2BXRA 1TRBA 2BYBA 4OPCA 4WCTA 3WE0A 3C4NA 3SZFA 3UKFA 4J34A 2WDQA 4A79A 4YT0A 2TMDA 1GT8A 1Z6LA 3RHAA 3UTEA 4Z24A 1FCDA 5CKUA 2ZZ0A 1O94A 3F8DA 2JAEA 3BI4A 3IHGA 3QSMA 1JNRA 4X4JA 4H4TA 3VR9A 4B66A 1H82A 5BULA 4EM3A 3G5QA 1FOHA 1GRGA 4CNJA 4USRA 1IUUA 3HYVA 3NK0X 4C74A 3NLCA 1K0JA 1E7PA 1TDKA 4IA5A 2TPRA 3F8PA 4CY6A 3CNTA 4G6HA 4ICYA 2R0CA 2XLPA 1VRQB 2BK5A 1IUVA 2FJEA 4BK2A 2RGOA 2BRAA 4ECHA 4G9KA 2QA2A 4U8JA 2WP5A 2B76A 4YSZA 3T2ZA 1W4XA 4YKGA 5U1OA 4HA6A 1SEZA 4AT2A 3IHMA 1OJAA 1LQUA 1GRFA 2XLTA 1Y56B 2GB0A 2Z5XA 1EL9A 2WDRA 2IIDA 3SYIA 1KNRA 3DA1A 3Q9TA 3GYIA 2IVDA 3DJEA 4GCMA 3CGDA 2VOUA 3PG6A 2VVMA 4N9XA 3P4SA 3AD7B 4GAVA 1JOAA 1GEUA 1IUWA 1D4DA 2BK3A 2XFNA 4GF7A 5EB5A 1N1PA 4O5UA 2AAQA 4DSGA 4GDEA 3UOYA 5M10A 3DJJA 4JNAA 2JBVA 2PHHA 3AD8B 1DOBA 1LPFA 1E6EA 1PXAA 2GMJA 2YLRA 3SM8A 3NRNA 2OA1A 3RP7A 3SZCA 3SXIA 2VQBA 1EL8A 1NDAA 4U8MA 1BGNA 3SGLA 3FBSA 1CJ4A 4EM4A 1TDOA 3K30A 4EQWA 2Q0LA 3UP5A 4PABA 1JEHA 3AYJA 1GOSA 2VVLG 3CNJA 5J60A 2YQUA 4B68A 4NWZA 3VRDB 1RYIA 2C70A 3C96A 2GR1A 3P4PA 1QJDA 2E5VA 4C3YA 4Y4MA 2X8GA 4OPTA 1FEBA 2C75A 5GSNA 1EBDA 3GDPA 3EF6A 3NYFA 3AE5A 2WBAA 2YVGA 2GQFA 4H4SA 1DOEA 3L5OA 1E39A 1CC6A 2C7GA 3K7MX 4H2NA 4YSHA 4H4QA 2A8XA 3Q6JA 4K5SA 3G5SA 3ICSA 2DKIA 2F5ZA 1PN0A 4H2PA 3UTGA 3UOXA 1VG9A 1MO9A 2WEUA 2AR8A 4U2LA 3VQRA 3EANA 1B8SA 3NK1X 5IQ1A 1S3BA 4NEWA 4GUVA 1D4EA 4Z26A 3V3OA 4H4XA 3AEFA 3NK2X 5KWFA 5KMPA 2EQ9A 4CY8A 1H83A 1COYA 1NEKA 2WETA 4K7ZA 2X99A 1VDCA 4K5RA 1ELIA 1KNPA 1LTXR 2XDOA 5IQ4A 2GV8A 1NHPA 3ABVA 2X8HA 3ICRA 5BVAA 4TM3A 4ZCDA 3CNSA 4D04A 1NAAA 4E0VA 1GTEA 2CFYA 4FDCB 1GXFA 1GNDA 4UDPA 4YWOA 4ZCCA 3UOZA 2BC1A 2GR2A 3UKAA 2Q6UA 3UTHA 3BNUA 3SZ0A 1QO8A 4UP3A 4TM4A 4A7AA 3DK4A 1LVLA 1XHCA 1CJCA 2WP6A 4EQSA 3NT6A 4U2SA 2FBWA 4OPIA 1JRXA 1PJ6A 3L1RA 4JDRA 2XFQA 2XFUA 3M13A 1EL7A 4A6NB 2WPEA 1JRYA 1IUXA 2C3CA 1E1NA 1CF3A 2XVIA 2Y6RA 3AE7A 1Y0PA 1B37A 2WDVA 4ZN0A 4OPDA 1ZX9A 2WPCA 4GDPA 4KPRA 4APNA 3BNMA 3NKSA 3LJPA 2C4CA 2OLNA 2Q0KA 3KPKA 4C77A 4XXGA 1H7WA 2OALA 1TDFA 4K2XA 2YR6A 2APGA 3T37A 2R9ZA 2BCPA 5EBKA 1ZMCA 4U8NA 4TLXA 5JCIA 5KNLA 5KOXA 4B63A 5LV9A 2YG7A 3HYWA 1X31B 4TLZA 1PBEA 1S2YA 3LADA 2YG5A 4EQRA 3JSKA 3DJGX 4PAAA 3ITJA 4C3XA 2HQMA 1KDGA 1K4QA 2OAMA 3GYJA 3RP8A 3ZYXA 3F8RA 4G6GA 2BS4A 2WHDA 2GAGB 2YVFA 4FK1A 2XVEA 2C3DA 2V60A 2C76A 1H84A 4JNQA 2R4JA 3NNEA 1S2QA 4II3A 3SFEA 4CBQA 5JCMA 1B4VA 2ZZCA 3PS9A 1TYTA 1PJ5A 5FS7A 2YM1A 3AB1A 3H8LA 4KX6A 4OPUA 5CQFA 5KMRA 4LIIA 2R46A 1K0IA 2A87A 1O95A 1VQWA 2DKHA 5HYMA 1EL5A 1ZOVA 1BZLA 1ZP0A 2GMHA 4LU6A 4H4ZA 3ATQA 2V3BA 1GTHA 1NHSA 3ISHA 2V3AA 2V6OA 3AD9B 3H8IA 2UZZA 4JY3A 3QVPA 4X9MA 3T14A 2BCGG 5FMHA 2YR4A 3D1CA 1JRZA 5J7XA 4P9SA 4K8DA 2E1MA 2V5ZA 1E1LA 2WESA 1BGJA 4AT0A 1B5QA 1GETA 1ZK7A 1GPEA 4I59A 2C65A 1M64A 2WU2A 4Z2TA 4YTNA 2IVEA 1FEAA 3HYXA 4NNJA 2AQJA 4NEVA 3VRBA 4IV9A 5FS6A 1MOKA 3I6DA 4G73A 3V3NA 1GRTA 3AEDA 4A9WA 1RP0A 3KA7A 1QLBA 3GSIA 3ATRA 1JNZA 2YLWA 3AYIA 3CPHG 2BABA 3O0HA 3ALJA 4H4RA 3LZWA 3V76A 4A6NA 4B64A 4JQ9A 2E4GA 3SQPA 3P9UA 3UOVA 2PYXA 3FIMB 2W0HA 3NYCA 5FS8A 2EQ7A 2XLUA 2VRMA 3NYEA 4H7UA 3T2YA 1REOA 2BS3A 2JB2A 1PBBA 3KPFA 4OCGA 3CTYA 4IVOB 1YQ4A 1F8RA 3LOVA 3NN6X 1YQ3A 3DGHA 4B69A 4BJYA 1TDEA 3ZDNA 1XDIA 5HY5A 1FL2A 4EMIA 2XLSA 3GD3A 2GVCA 1S7MA 4IA6A 1CBOA 1OJCA 1PXCA 3QVRA 4O5QA 2R0PA 3K7QX 3CGBA 4CNKA 3CNDA 5C3JA 5U25A 3KD9A 3ALLA 2RGJA 1L9CA 3IWAA 3AEGA 1XPQA 3NIXA 2BA9A 1HYUA 3BHFA 3GMCA 4USQA 1AOGA 3ALMA 1RSGA 4A99A 4BK3A 3GDNA 5EOWA 4B65A 2C66A 3AEBA 3T31A 1CHUA 5HXIA 1ZY8A 2GH5A 3P4QA 2XVHA 2XYOA 1GRHA 3VR8A 2C73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ACZ A;  3GWF A;  2GR3 A;  4FX9 A;  2C64 A;  2R45 A;  4EMW A;  3VRA A;  1DNC A;  2J3N A;  3CN8 A;  5TR3 A;  4NTC A;  3RED A;  4D03 A;  1Q1R A;  1PBF A;  4LA1 A;  4Z43 A;  3G5R A;  2YLX A;  4YKF A;  4XWZ A;  3II4 A;  4J33 A;  3FPZ A;  4Z2U A;  2GF3 A;  1NG3 A;  3AE1 A;  1H7X A;  1PDH A;  3DME A;  4YTM A;  3K7T A;  1DJQ A;  5KXJ A;  4H4W A;  2JKC A;  2V61 A;  2OLO A;  2RGH A;  1GES A;  4Z2R A;  2B7S A;  5JCL A;  1PHH A;  1UKV G;  3FMW A;  1K0L A;  1DXL A;  2JB3 A;  2RAB A;  4I58 A;  3C4A A;  4RG4 A;  4YTP A;  1CJ3 A;  4U8P A;  3BI2 A;  2FJB A;  1L0V A;  1L9E A;  1OJD A;  4DGK A;  1H6V A;  4DNA A;  4B1B A;  2GAH B;  2XFP A;  4H4P A;  2BC0 A;  1OJT A;  1GER A;  2H89 A;  3D8X A;  4C5O A;  2QA1 A;  3S5W A;  4REK A;  1V59 A;  3BHK A;  3H4K A;  4OPL A;  2ZBW A;  3S61 A;  1GV4 A;  4AP3 A;  4MJW A;  3HZL A;  1GRA A;  5KVI A;  2GQW A;  1GAL A;  1TDN A;  1H81 A;  2XVJ A;  2EQ6 A;  1BF3 A;  1D4C A;  1N4V A;  4CRT A;  2CUL A;  1KF6 A;  2R0G A;  3UKP A;  1JU2 A;  3UTF A;  2H88 A;  3LXD A;  3GMB A;  4CCQ A;  1S3E A;  3AE9 A;  2XCG A;  4B67 A;  1ZKQ A;  2A89 A;  1P2E A;  4AOS A;  5IPY A;  2WS3 A;  4GRT A;  2BXS A;  1CL0 A;  1ZDL A;  2YVJ A;  1VG0 A;  2GEW A;  2X3N A;  3QJ4 A;  3B3R A;  4NTD A;  4U8L A;  4A65 A;  2VRL A;  5JCK A;  2WQY A;  3R9U A;  2Q7V A;  3CIR A;  3CPJ G;  1NEN A;  1N4U A;  4WX1 A;  2Z5Y A;  4RSL A;  1YY5 A;  2YWL A;  3OC4 A;  3KU9 A;  3CNP A;  4FK1 C;  4EMJ A;  3OZ2 A;  5C2T A;  1DOD A;  1F8S A;  4DSH A;  3P1W A;  4ADW A;  3KVE A;  3P4R A;  4H50 A;  2B9W A;  3UKK A;  3ICT A;  3FG2 P;  4K22 A;  5GRT A;  3GD4 A;  3M0O A;  4AOX A;  3DH9 A;  3QSS A;  4TM1 A;  1Y56 A;  1CJ2 A;  3IF9 A;  1E1K A;  1OJ9 A;  2YR5 A;  1BWC A;  3NGC X;  2QCU A;  3PVC A;  3SFD A;  1ONF A;  4X9N A;  5KVH A;  2JK6 A;  2YG3 A;  4Z25 A;  4BK1 A;  1YKJ A;  3AYL A;  4U8I A;  4TM0 A;  5BUK A;  2NPX A;  4EIQ A;  4YSX A;  1LQT A;  1ZMD A;  1PBD A;  3AEC A;  1DOC A;  2Y6Q A;  4J31 A;  3AWI A;  1N4W A;  1E1M A;  1CC4 A;  2WU5 A;  3B6D A;  1D5T A;  1CC2 A;  2WOV A;  3IC9 A;  1BKW A;  1GRB A;  2XFO A;  3NG7 X;  4J2W A;  3UKH A;  3UP4 A;  3AE8 A;  2NVK X;  2B7R A;  1NPX A;  3LZX A;  3AEA A;  4UDQ A;  5EB4 A;  1Q1W A;  3M12 A;  3L8K A;  4H4U A;  3RP6 A;  3E1T A;  4AP1 A;  3CGC A;  3QFA A;  3NTD A;  3BI5 A;  2BK4 A;  3GRS A;  4IVM B;  2C67 A;  4BV6 A;  1NG4 A;  2YLT A;  1DJN A;  1KSS A;  1GRE A;  1NHQ A;  4YSY A;  3URH A;  4JN9 A;  4H2R A;  1KFY A;  1LJ1 A;  2X50 A;  1F3P A;  4H4Y A;  3AE3 A;  3AE4 A;  3DJD A;  3NHO X;  3NN0 X;  2VQ7 A;  4Y4N A;  2CDU A;  3DK9 A;  1L9D A;  3GWD A;  4BUR A;  5HHF A;  4NZH A;  1LV0 A;  2YG4 A;  3UKQ A;  4U8K A;  2ARD A;  2R4E A;  3PO7 A;  4J56 A;  4U2T A;  3I3L A;  1O5W A;  4U8O A;  1MXT A;  2BS2 A;  4H4V A;  3RNM A;  2WOW A;  5KRQ A;  2QAE A;  1NHR A;  1PBC A;  2FJA A;  2I0Z A;  2B9X A;  4OVI A;  4A5L A;  1YQZ A;  4UDR A;  4NTE A;  2GRT A;  5M0Z A;  3KKJ A;  5FS9 A;  4HB9 A;  3DK8 A;  3AEE A;  4Y4L A;  1F8W A;  1PS9 A;  1FEC A;  4EQX A;  4JY2 A;  4EIP A;  3NTA A;  2ZZB A;  1M6I A;  3AE6 A;  1Q9I A;  2YAU A;  3NH3 X;  2JB1 A;  3COX A;  1F6M A;  2YM2 A;  4GR1 A;  4Z44 A;  5BRT A;  2FJD A;  3UKL A;  2YLS A;  5KOW A;  2GR0 A;  2YLZ A;  4CCR A;  3GRT A;  2WPF A;  1D7Y A;  3CPI G;  2XVF A;  4RG3 A;  1IUS A;  4XWR A;  5DBJ A;  3QFB A;  2B9Y A;  2X8C A;  4OPG A;  5U63 A;  5JCN A;  1D7L A;  2O9Z A;  4J57 A;  2C72 A;  1ZOY A;  2WOI A;  2XLR A;  1TYP A;  2YG6 A;  3EPT A;  5ER0 A;  3DGZ A;  2BAC A;  1GSN A;  4M52 A;  3ADA B;  1H86 A;  3EAO A;  2EQ8 A;  3CGE A;  2WP9 A;  3AE2 A;  3AXB A;  4BJZ A;  3KLJ A;  1XAN A;  1PXB A;  1P2H A;  4YXD A;  1PJ7 A;  1IUT A;  2VZ2 A;  2VVL A;  1IJH A;  2CVJ A;  4J36 A;  3QSE A;  3UCL A;  4H2Q A;  3LB8 A;  1KSU A;  5L46 A;  2BXR A;  1TRB A;  2BYB A;  4OPC A;  4WCT A;  3WE0 A;  3C4N A;  3UKF A;  4J34 A;  2WDQ A;  4A79 A;  4YT0 A;  2TMD A;  1GT8 A;  1Z6L A;  3RHA A;  3UTE A;  4Z24 A;  1FCD A;  5CKU A;  2ZZ0 A;  1O94 A;  3F8D A;  2JAE A;  3BI4 A;  3IHG A;  3QSM A;  1JNR A;  4X4J A;  4H4T A;  3VR9 A;  4B66 A;  1H82 A;  5BUL A;  4EM3 A;  3G5Q A;  1FOH A;  1GRG A;  4USR A;  1IUU A;  3NK0 X;  4C74 A;  3NLC A;  1K0J A;  1E7P A;  1TDK A;  4IA5 A;  2TPR A;  3F8P A;  4CY6 A;  3CNT A;  4ICY A;  2R0C A;  2XLP A;  1VRQ B;  2BK5 A;  1IUV A;  2FJE A;  4BK2 A;  2RGO A;  4ECH A;  2QA2 A;  4U8J A;  2WP5 A;  2B76 A;  4YSZ A;  4YKG A;  1W4X A;  5U1O A;  4HA6 A;  1SEZ A;  4AT2 A;  3IHM A;  1OJA A;  1LQU A;  1GRF A;  2XLT A;  1Y56 B;  2GB0 A;  2Z5X A;  1EL9 A;  2WDR A;  2IID A;  1KNR A;  3DA1 A;  3Q9T A;  3GYI A;  2IVD A;  3DJE A;  4GCM A;  3CGD A;  2VOU A;  4N9X A;  2VVM A;  3P4S A;  3AD7 B;  4CNJ A;  1JOA A;  1GEU A;  1IUW A;  1D4D A;  2BK3 A;  2XFN A;  4GF7 A;  5EB5 A;  1N1P A;  4O5U A;  2AAQ A;  4DSG A;  4GDE A;  3UOY A;  5M10 A;  3DJJ A;  4JNA A;  2JBV A;  2PHH A;  3AD8 B;  1DOB A;  1LPF A;  1E6E A;  1PXA A;  2GMJ A;  2YLR A;  3SM8 A;  3NRN A;  2OA1 A;  3RP7 A;  2VQB A;  1EL8 A;  1NDA A;  4U8M A;  1BGN A;  3SGL A;  3FBS A;  1CJ4 A;  4EM4 A;  1TDO A;  3K30 A;  4EQW A;  2Q0L A;  3UP5 A;  4PAB A;  1JEH A;  3AYJ A;  1GOS A;  2VVL G;  3CNJ A;  5J60 A;  2YQU A;  4B68 A;  3VRD B;  1RYI A;  2C70 A;  3C96 A;  2GR1 A;  3P4P A;  1QJD A;  2E5V A;  4C3Y A;  4Y4M A;  2X8G A;  4OPT A;  1FEB A;  2C75 A;  5GSN A;  1EBD A;  3GDP A;  3EF6 A;  3NYF A;  3AE5 A;  2WBA A;  2YVG A;  2GQF A;  4H4S A;  1DOE A;  1E39 A;  1CC6 A;  2C7G A;  3K7M X;  4H2N A;  4YSH A;  4H4Q A;  2A8X A;  3Q6J A;  4K5S A;  3G5S A;  3ICS A;  2DKI A;  2F5Z A;  1PN0 A;  4H2P A;  3UTG A;  3UOX A;  1VG9 A;  1MO9 A;  2WEU A;  2AR8 A;  4U2L A;  3VQR A;  3EAN A;  1B8S A;  3NK1 X;  5IQ1 A;  1S3B A;  4NEW A;  4GUV A;  1D4E A;  4Z26 A;  3V3O A;  4H4X A;  3AEF A;  3NK2 X;  5KWF A;  2EQ9 A;  4CY8 A;  1H83 A;  1COY A;  1NEK A;  2WET A;  4K7Z A;  2X99 A;  1VDC A;  4K5R A;  1ELI A;  1KNP A;  1LTX R;  2XDO A;  5IQ4 A;  2GV8 A;  1NHP A;  3ABV A;  2X8H A;  3ICR A;  5BVA A;  4TM3 A;  4ZCD A;  3CNS A;  4D04 A;  1NAA A;  4E0V A;  1GTE A;  2CFY A;  4FDC B;  1GXF A;  1GND A;  4UDP A;  4YWO A;  4ZCC A;  3UOZ A;  2BC1 A;  2GR2 A;  3UKA A;  2Q6U A;  3UTH A;  3BNU A;  1QO8 A;  4UP3 A;  4TM4 A;  4A7A A;  3DK4 A;  1LVL A;  1XHC A;  1CJC A;  2WP6 A;  4EQS A;  3NT6 A;  4U2S A;  2FBW A;  4OPI A;  1JRX A;  1PJ6 A;  3L1R A;  4JDR A;  2XFQ A;  2XFU A;  3M13 A;  1EL7 A;  4A6N B;  2WPE A;  1JRY A;  1IUX A;  2C3C A;  1E1N A;  1CF3 A;  2XVI A;  2Y6R A;  3AE7 A;  1Y0P A;  1B37 A;  2WDV A;  4ZN0 A;  4OPD A;  1ZX9 A;  2WPC A;  4GDP A;  4KPR A;  4APN A;  3BNM A;  3NKS A;  3LJP A;  2OLN A;  2Q0K A;  4C77 A;  4XXG A;  1H7W A;  2OAL A;  1TDF A;  4K2X A;  2YR6 A;  2APG A;  3T37 A;  2R9Z A;  2BCP A;  5EBK A;  1ZMC A;  4U8N A;  4TLX A;  5JCI A;  5KOX A;  4B63 A;  5LV9 A;  2YG7 A;  1X31 B;  4TLZ A;  1PBE A;  1S2Y A;  3LAD A;  2YG5 A;  4EQR A;  3JSK A;  3DJG X;  4PAA A;  3ITJ A;  4C3X A;  2HQM A;  1KDG A;  1K4Q A;  2OAM A;  3GYJ A;  3RP8 A;  3ZYX A;  3F8R A;  2BS4 A;  2WHD A;  2GAG B;  2YVF A;  4FK1 A;  2XVE A;  2C3D A;  2V60 A;  2C76 A;  1H84 A;  4JNQ A;  2R4J A;  3NNE A;  1S2Q A;  3SFE A;  4CBQ A;  5JCM A;  1B4V A;  2ZZC A;  3PS9 A;  1TYT A;  1PJ5 A;  5FS7 A;  2YM1 A;  3AB1 A;  3H8L A;  4KX6 A;  4OPU A;  5CQF A;  4LII A;  2R46 A;  1K0I A;  2A87 A;  1O95 A;  1VQW A;  2DKH A;  5HYM A;  1EL5 A;  1ZOV A;  1BZL A;  1ZP0 A;  2GMH A;  4LU6 A;  4H4Z A;  3ATQ A;  1GTH A;  2V3B A;  1NHS A;  3ISH A;  2V6O A;  2V3A A;  3AD9 B;  3H8I A;  2UZZ A;  4JY3 A;  3QVP A;  4X9M A;  2BCG G;  5FMH A;  2YR4 A;  3D1C A;  1JRZ A;  5J7X A;  4P9S A;  4K8D A;  2E1M A;  2V5Z A;  1E1L A;  2WES A;  1BGJ A;  4AT0 A;  1B5Q A;  1GET A;  1ZK7 A;  1GPE A;  4I59 A;  2C65 A;  1M64 A;  2WU2 A;  4Z2T A;  4YTN A;  2IVE A;  1FEA A;  2AQJ A;  4NEV A;  3VRB A;  4IV9 A;  5FS6 A;  1MOK A;  3I6D A;  3V3N A;  1GRT A;  3AED A;  4A9W A;  1RP0 A;  3KA7 A;  1QLB A;  3GSI A;  3ATR A;  1JNZ A;  2YLW A;  3AYI A;  3CPH G;  2BAB A;  3O0H A;  3ALJ A;  4H4R A;  3LZW A;  3V76 A;  4A6N A;  4B64 A;  4JQ9 A;  2E4G A;  3SQP A;  3P9U A;  3UOV A;  2PYX A;  3FIM B;  2W0H A;  3NYC A;  5FS8 A;  2EQ7 A;  2XLU A;  2VRM A;  3NYE A;  4H7U A;  1REO A;  2BS3 A;  2JB2 A;  1PBB A;  3KPF A;  4OCG A;  3CTY A;  4IVO B;  1YQ4 A;  1F8R A;  3LOV A;  3NN6 X;  1YQ3 A;  3DGH A;  4B69 A;  4BJY A;  1TDE A;  3ZDN A;  1XDI A;  5HY5 A;  1FL2 A;  4EMI A;  2XLS A;  3GD3 A;  2GVC A;  4IA6 A;  1CBO A;  1OJC A;  1PXC A;  3QVR A;  4O5Q A;  2R0P A;  3K7Q X;  3CGB A;  4CNK A;  3CND A;  5C3J A;  5U25 A;  3KD9 A;  3ALL A;  2RGJ A;  1L9C A;  3IWA A;  3AEG A;  1XPQ A;  3NIX A;  2BA9 A;  1HYU A;  3BHF A;  3GMC A;  4USQ A;  1AOG A;  3ALM A;  1RSG A;  4A99 A;  4BK3 A;  3GDN A;  5EOW A;  4B65 A;  2C66 A;  3AEB A;  1CHU A;  5HXI A;  1ZY8 A;  2GH5 A;  3P4Q A;  2XVH A;  2XYO A;  1GRH A;  3VR8 A;  2C73 A; 
#chains in the Genus database with same CATH topology
 4IP5 A;  4GYP A;  2C64 A;  5JRB A;  4EMW A;  5TR3 A;  4NTC A;  3RED A;  1PBF A;  4XWZ A;  3II4 A;  3AE1 A;  1DJQ A;  2V61 A;  3CMM A;  2B7S A;  5JCL A;  2W3R A;  2FJB A;  1L0V A;  1N62 C;  1H6V A;  4DNA A;  1EC8 A;  4B1B A;  4H4P A;  3D8X A;  2QA1 A;  4REK A;  3H4K A;  2MUC A;  4OPL A;  3S61 A;  3HZL A;  3R10 A;  2EQ6 A;  1WYG A;  3UKP A;  3UTF A;  3AE9 A;  4B67 A;  1ZKQ A;  2A89 A;  2WS3 A;  1E9I A;  2YVJ A;  4U8L A;  3THU A;  4A65 A;  2VRL A;  2Q7V A;  1KKR A;  1N4U A;  4RSL A;  3T2K A;  3OC4 A;  3KU9 A;  3CNP A;  3N4F A;  4EMJ A;  5C2T A;  1DOD A;  1ZXI C;  2GGG A;  3UKK A;  2PTX A;  4AOX A;  4TM1 A;  3NGC X;  2QCU A;  3PVC A;  3SFD A;  3SX6 A;  4Z25 A;  4IP4 A;  4TM0 A;  5BUK A;  2NPX A;  3T0K A;  1DOC A;  2W54 A;  1BKW A;  3SY4 A;  4J2W A;  3UKH A;  4UDQ A;  3L8K A;  3CGC A;  4HPN A;  4X2P A;  5G5G B;  1NG4 A;  3SN0 A;  1NHQ A;  4F4R A;  3URH A;  1ELS A;  4Y4N A;  2CDU A;  3GWD A;  5HHF A;  4IL2 A;  3UKQ A;  2ARD A;  4E5T A;  1O5W A;  4U8O A;  5KRQ A;  1NHR A;  1PBC A;  2FJA A;  4OVI A;  4A5L A;  3ES8 A;  3PWI A;  3KKJ A;  3V3W A;  1F8W A;  4EIP A;  2ZZB A;  3COX A;  4MMW A;  2YM2 A;  2OQH A;  3HW2 A;  3U9I A;  4CCR A;  3QFB A;  3ENL A;  1D7L A;  4J57 A;  2C72 A;  5KMS A;  2I5Q A;  4ROP A;  1H86 A;  3EAO A;  2EQ8 A;  1P2H A;  2PTW A;  2VVL A;  4J36 A;  3D47 A;  5L46 A;  2BXR A;  2BYB A;  3VCC A;  1FCD A;  2ZZ0 A;  1O94 A;  4B66 A;  5BUL A;  3BSM A;  3D46 A;  3H70 A;  4DN1 A;  4IA5 A;  3F8P A;  4CY6 A;  2QGY A;  1IUV A;  2P8C A;  2OZ3 A;  4U8J A;  2FYM A;  4YKG A;  1W4X A;  1GRF A;  6ENL A;  3DA1 A;  2IVD A;  5FJO A;  2GSH A;  3K1G A;  3PG6 A;  2VVM A;  4N9X A;  3P4S A;  4GAV A;  4CNJ A;  1GEU A;  5EB5 A;  3NZG A;  3GD6 A;  4O5U A;  2AAQ A;  4GDE A;  5M10 A;  3AD8 B;  2GMJ A;  2YLR A;  3SR6 B;  1NDA A;  4U8M A;  3FBS A;  3UJE A;  3CXO A;  3DG7 A;  4EQW A;  4PAB A;  5J60 A;  3CNJ A;  2YQU A;  3VRD B;  2GR1 A;  3IJI A;  4GIS A;  2X8G A;  4OPT A;  1FEB A;  2C75 A;  2OFJ A;  3FV9 A;  4KT2 A;  3GDP A;  3EF6 A;  2WBA A;  2GQF A;  4H4S A;  4H2N A;  3V5C A;  4H4Q A;  2A8X A;  4K5S A;  3RGT A;  3DG3 A;  3CK5 A;  1PN0 A;  1MUC A;  1N63 C;  3UOX A;  1F9C A;  2AR8 A;  3VQR A;  3EAN A;  4YWS A;  3NK1 X;  4H83 A;  4H4X A;  3NK2 X;  5KWF A;  2EQ9 A;  4K7Z A;  1VDC A;  1KNP A;  1NHP A;  5BVA A;  4E0V A;  1GTE A;  2CFY A;  1SJC A;  3OP2 A;  2PU1 A;  4DHG A;  3H7V A;  3UTH A;  2OQY A;  3SZ0 A;  4UP3 A;  3OZY A;  1N60 C;  4TM4 A;  2XGZ A;  1LVL A;  3RO6 A;  1CJC A;  4EQS A;  2XH4 A;  3RCY A;  1JRX A;  3L1R A;  3STP A;  1FO4 A;  2XFQ A;  3M13 A;  4A6N B;  2WPE A;  1E1N A;  1FHV A;  1MNS A;  1JCT A;  1Y0P A;  4KPR A;  3ZVI A;  5FJU A;  1ZMC A;  5KNL A;  5LV9 A;  2YG7 A;  1X31 B;  2YG5 A;  3JSK A;  3TCS A;  4G6G A;  2YVF A;  2ZC8 A;  2PPG A;  4DX3 A;  3R25 A;  1KKO A;  4II3 A;  5JCM A;  1TYT A;  1PJ5 A;  3H8L A;  5KMR A;  1VDV A;  1O95 A;  3TW9 A;  3NRZ B;  3NFU A;  4ENL A;  2OPJ A;  2V6O A;  3QVP A;  5FMH A;  2YR4 A;  4K8D A;  1E1L A;  2WES A;  4AT0 A;  1GET A;  1ZK7 A;  2C65 A;  2WU2 A;  3VRB A;  1MOK A;  3AED A;  4A9W A;  3KA7 A;  4DXK A;  2ZAD A;  4H4R A;  3LZW A;  2GDQ A;  3P9U A;  3UOV A;  3NYE A;  3T2Y A;  2BS3 A;  3R11 A;  4IVO B;  1YQ3 A;  4B69 A;  1XDI A;  3RR1 A;  3GD3 A;  4IA6 A;  3QVR A;  4O5Q A;  3CND A;  3P93 A;  1L9C A;  3AEG A;  3NIX A;  2BA9 A;  1HYU A;  3GMC A;  4A99 A;  4B65 A;  5HXI A;  1ZY8 A;  2GH5 A;  2XYO A;  3G5R A;  1DNC A;  2J3N A;  2POZ A;  4J3Z A;  3QN3 A;  2OVL A;  2YLX A;  4YKF A;  3FPZ A;  5BOF A;  2GF3 A;  1H7X A;  1PDH A;  3DME A;  3K7T A;  4H4W A;  1FFU C;  4Z2R A;  1K0L A;  4YTP A;  2RAB A;  3C4A A;  1CJ3 A;  1OJD A;  1FIQ B;  3HPF A;  1OJT A;  1GER A;  3OW1 A;  3S5W A;  1V59 A;  1N61 C;  3BHK A;  4AP3 A;  3S47 A;  2GQW A;  3DER A;  1TDN A;  1NEL A;  1H81 A;  2XVJ A;  1D4C A;  4DYE A;  4MKS A;  2H88 A;  2XCG A;  3I6T A;  4AOS A;  2OZT A;  4C5O A;  2BXS A;  1CL0 A;  1VG0 A;  2X3N A;  2GEW A;  3B3R A;  4NTD A;  3DG6 A;  2WQY A;  3CPJ G;  4GAP A;  2Z5Y A;  1YY5 A;  3MKC A;  3NS1 B;  3VFC A;  4H50 A;  2B9W A;  3M0O A;  1OJ9 A;  2YR5 A;  3SN1 A;  2AKZ A;  2JK6 A;  3TTE A;  2YG3 A;  1YKJ A;  3AYL A;  4EIQ A;  1LQT A;  1MDR A;  1N4W A;  3B6D A;  1KN0 A;  2OZ8 A;  1CC2 A;  1D5T A;  1FFV C;  1GRB A;  2XFO A;  3BOX A;  3AE8 A;  3AEA A;  1H2I A;  3M12 A;  1SJD A;  3E1T A;  4IZG A;  5KMQ A;  2C67 A;  4H2R A;  1LJ1 A;  2X50 A;  1F3P A;  4H4Y A;  3AE3 A;  3DJD A;  1L9D A;  3NVZ B;  3N6J A;  1LV0 A;  1X2G A;  3PO7 A;  4J56 A;  2BS2 A;  3RNM A;  2I0Z A;  5FS9 A;  3DK8 A;  3AEE A;  4EQX A;  3NTA A;  4G7F A;  3NH3 X;  1N5X A;  3AN1 A;  2GR0 A;  2PCE A;  2GL5 A;  4XWR A;  2X8C A;  2O9Z A;  2WOI A;  2XLR A;  2YG6 A;  4E4F A;  5ER0 A;  3DGZ A;  1GSN A;  1MDL A;  3NO1 A;  1WUF A;  2RDX A;  3AXB A;  4YXD A;  5BOE A;  4KEM A;  4H2Q A;  3WE0 A;  4WCT A;  4J34 A;  4K8G A;  3QKE A;  3F8D A;  2JAE A;  3JZU A;  4H4T A;  3VR9 A;  1H82 A;  1RM6 B;  2GGJ A;  1FOH A;  1GRG A;  3TJ4 A;  3I6E A;  1VQZ A;  4ICY A;  2R0C A;  2XLP A;  4G9K A;  5U1O A;  4AT2 A;  3Q45 A;  3IHM A;  2XLT A;  3DES A;  1Y56 B;  2PP1 A;  2IID A;  3SYI A;  1KNR A;  3GYI A;  3CGD A;  2VOU A;  3AD7 B;  1IUW A;  4GF7 A;  1N1P A;  3DJJ A;  2DW6 A;  3ZVH B;  1E6E A;  1PXA A;  3NRN A;  3RP7 A;  3SXI A;  3SGL A;  4EM4 A;  1TDO A;  3UP5 A;  1JRP A;  2VVL G;  4B68 A;  1TKK A;  3C96 A;  2PSN A;  1QJD A;  2E5V A;  4Y4M A;  5IDZ A;  3NVW B;  3L5O A;  1CC6 A;  3Q6J A;  4M6U A;  3G5S A;  3IJL A;  1VG9 A;  1MO9 A;  2AKM A;  3PWG A;  1JPD X;  3FXG A;  3ZLG A;  4H19 A;  1H83 A;  1COY A;  1NEK A;  2WET A;  2X99 A;  2GV8 A;  3ABV A;  2X8H A;  4ZCD A;  4D04 A;  1NAA A;  1GXF A;  4UDP A;  3UOZ A;  2BC1 A;  3FYY A;  3MUC A;  2HXT A;  4A7A A;  2HZG A;  3DK4 A;  4HCD A;  1XHC A;  3QLD A;  2QQ6 A;  4U2S A;  1PJ6 A;  2XH7 A;  1P48 A;  1EL7 A;  3DIP A;  3T8Q A;  1FHU A;  2P8B A;  4ZA0 A;  2OG9 A;  1L8P A;  1NU5 A;  4APN A;  3BNM A;  2QDE A;  3LJP A;  4HYR A;  2C4C A;  2OLN A;  3VC6 A;  2OAL A;  4K2X A;  3CT2 A;  2QJN A;  4U8N A;  5JCI A;  3HYW A;  4C3X A;  3ITJ A;  2W55 A;  3SJN A;  2GAG B;  2XVE A;  4DWD A;  2C76 A;  4JNQ A;  2AL2 A;  3SFE A;  3DEQ A;  4GGB A;  5CQF A;  2YM1 A;  3P3B A;  2R46 A;  3ZVH A;  1VQW A;  1EL5 A;  3ISH A;  2V3A A;  3H8I A;  3AD9 B;  3D1C A;  4P9S A;  2XH0 A;  4YTN A;  3SBF A;  4E6M A;  3HYX A;  1JDF A;  2AQJ A;  4NEV A;  4IV9 A;  1RP0 A;  4H2H A;  3O0H A;  3ALJ A;  4EWJ A;  4B64 A;  2W0H A;  3NYC A;  4H7U A;  4HCL A;  1ONE A;  3LOV A;  3CB3 A;  5HY5 A;  4EMI A;  1S7M A;  1OJC A;  3EEZ A;  5C3J A;  4CNK A;  3IWA A;  2MNR A;  1RSG A;  5EOW A;  4KPL A;  3P4Q A;  3QSE A;  2C73 A;  1STZ A;  2ACZ A;  3GWF A;  2GR3 A;  4FX9 A;  2R45 A;  3VRA A;  1X2H A;  4D03 A;  4Z43 A;  2P88 A;  3PFR A;  1RVK A;  4ZOH B;  4Z2U A;  1EC7 A;  1NG3 A;  5G5H B;  4YTM A;  3I4K A;  2OLO A;  3FMW A;  2JB3 A;  1DXL A;  4RG4 A;  4JHM A;  4U8P A;  3BI2 A;  3UXK A;  2GAH B;  2XFP A;  3TWB A;  2ZBW A;  1GV4 A;  1SJB A;  3DDM A;  5KVI A;  1GAL A;  2PGE A;  1BF3 A;  3T4W A;  3GMB A;  4CCQ A;  1S3E A;  3B9J B;  1BKH A;  5IPY A;  1P2E A;  1EBG A;  1ZDL A;  3CIR A;  1NEN A;  4TVY A;  4IHC A;  4FK1 C;  4DSH A;  3A7U A;  3P1W A;  3JVA A;  3FG2 P;  4K22 A;  3GD4 A;  1BWC A;  3VC5 A;  3JW7 A;  5KVH A;  2BRY A;  3A7A A;  4YSX A;  2QVH A;  1ZMD A;  4J31 A;  3AWI A;  3MZN A;  2W3S A;  4E8G A;  1CC4 A;  2WU5 A;  2WOV A;  3IC9 A;  3NG7 X;  3UP4 A;  2NVK X;  2B7R A;  3DGB A;  1Q1W A;  4H4U A;  3RP6 A;  4AP1 A;  3BI5 A;  3GRS A;  4G8T A;  2YLT A;  1TZZ A;  1KSS A;  4YSY A;  4JN9 A;  3AE4 A;  3PK7 A;  3NN0 X;  2VQ7 A;  4BUR A;  3S5S A;  3SZW A;  3CYJ A;  2YG4 A;  4U2T A;  3I3L A;  1MXT A;  4H4V A;  2WOW A;  3OZM A;  3TJI A;  2QAE A;  4K1W A;  2PA6 A;  1YQZ A;  4UDR A;  2GRT A;  2OLA A;  3UJS A;  4GIR A;  1FEC A;  1M6I A;  3AE6 A;  2YAU A;  3Q4D A;  5BRT A;  1F6M A;  4GR1 A;  2CHR A;  4FI4 A;  3H8A A;  5KOW A;  1SB3 B;  3GRT A;  1D7Y A;  1PDZ A;  2XVF A;  3CPI G;  5DBJ A;  2B9Y A;  4OPG A;  4KWS A;  3D9X A;  5JCN A;  1ZOY A;  2BAC A;  3HRD C;  4M52 A;  3ADA B;  3CGE A;  3FCP A;  3AE2 A;  4BJZ A;  1PXB A;  1PJ7 A;  4A35 A;  3TWA A;  1IJH A;  2CVJ A;  3UCL A;  3LB8 A;  1KSU A;  4OPC A;  3C4N A;  3SZF A;  3UKF A;  1Z6L A;  3RHA A;  1MRA A;  3IJQ A;  3QSM A;  4X4J A;  4EM3 A;  3G5Q A;  1XPY A;  3NK0 X;  4USR A;  3NLC A;  1E7P A;  1TDK A;  3UCD A;  3NVV B;  3CNT A;  4G6H A;  1VRQ B;  2BK5 A;  2FJE A;  2BRA A;  2PMQ A;  2WP5 A;  3T2Z A;  1SEZ A;  2GB0 A;  2Z5X A;  2WDR A;  3Q9T A;  4GGH A;  4GCM A;  3MY9 A;  4FP1 A;  1JOA A;  2BK3 A;  4DSG A;  3UOY A;  4ZCW A;  2JBV A;  3SM8 A;  1DOB A;  3NVY B;  1EL8 A;  3K30 A;  2Q0L A;  1TE6 A;  1GOS A;  2PTY A;  4NWZ A;  1RYI A;  1R0M A;  1DTN A;  3P4P A;  4NZH A;  1EBD A;  4GME A;  2YVG A;  3AE5 A;  3ETR B;  5ENL A;  1E39 A;  3FJ4 A;  3K7M X;  3R07 C;  3ICS A;  2F5Z A;  4H2P A;  3UTG A;  4U2L A;  2HNE A;  5IQ1 A;  1S3B A;  3ZLF A;  5KMP A;  4K5R A;  1LTX R;  5IQ4 A;  1YEY A;  4TM3 A;  1GND A;  4M0X A;  1ECQ A;  2Q6U A;  3BNU A;  1QO8 A;  3ZLH A;  1KCZ A;  2WP6 A;  3NT6 A;  4JDR A;  3IK4 A;  1CF3 A;  2Y6R A;  3AE7 A;  1B37 A;  2WDV A;  4OPD A;  1ZX9 A;  4H1Z A;  3NKS A;  4Z1Y A;  3QPE A;  2Q0K A;  3KPK A;  4C77 A;  4HN8 A;  2YR6 A;  2APG A;  1PDY A;  2BCP A;  4TLX A;  3GY1 A;  5KOX A;  4B63 A;  1PBE A;  4PAA A;  4EQR A;  3DJG X;  3ZYX A;  2HQM A;  3SN4 A;  1K4Q A;  1KDG A;  2OAM A;  3GYJ A;  3F8R A;  2BS4 A;  4FK1 A;  3RRA A;  1H84 A;  3RIT A;  2ONE A;  4CBQ A;  2ZZC A;  3PS9 A;  3H12 A;  1K0I A;  2A87 A;  1P43 A;  2DKH A;  5HYM A;  1BZL A;  2QDD A;  1KD0 A;  1ZP0 A;  4DGK A;  4LU6 A;  3ATQ A;  1GTH A;  3T14 A;  3B97 A;  1JRZ A;  5J7X A;  4IT1 A;  3DFY A;  5J04 A;  3T6C A;  1GPE A;  4I59 A;  1M64 A;  4Z2T A;  2IVE A;  1FEA A;  4Z17 A;  4J1O A;  5FS6 A;  3R1Z A;  3I6D A;  1GRT A;  1QLB A;  2P0I A;  1JNZ A;  2YLW A;  3AYI A;  3CPH G;  2BAB A;  3QTP A;  2AL1 A;  3R0K A;  4A6N A;  4JQ9 A;  3SQP A;  2PYX A;  3FIM B;  3TQP A;  5FS8 A;  2JB2 A;  1PBB A;  3KPF A;  1F8R A;  3DGH A;  4BJY A;  1XS2 A;  1FL2 A;  5FJT A;  2GVC A;  1CBO A;  2R0P A;  3K7Q X;  3CGB A;  5U25 A;  3KD9 A;  2XSX A;  4USQ A;  3DFH A;  4BK3 A;  2C66 A;  2XVH A;  2XLS A;  1GRH A;  3GC2 A;  3CN8 A;  4K2S A;  1Q1R A;  4LA1 A;  4J33 A;  4II2 A;  4HNL A;  2QJJ A;  4HCH A;  5KXJ A;  2JKC A;  2RGH A;  1GES A;  3ES7 A;  1PHH A;  1UKV G;  2GGH A;  4I58 A;  1BQG A;  3N6H A;  1L9E A;  1EC9 A;  2BC0 A;  2H89 A;  3UJR A;  4MJW A;  1GRA A;  3GDN A;  1N4V A;  2PP3 A;  4G74 A;  4CRT A;  2GGE A;  2CUL A;  1T3Q C;  1KF6 A;  2R0G A;  4GYP C;  1JU2 A;  3LXD A;  4GRT A;  3V4B A;  3QJ4 A;  5JCK A;  3R9U A;  4WX1 A;  2YWL A;  3OZ2 A;  1F8S A;  4ADW A;  3KVE A;  3P4R A;  1JRO A;  3ICT A;  5GRT A;  3MSY A;  3DH9 A;  3QSS A;  1Y56 A;  1CJ2 A;  3IF9 A;  1E1K A;  1ONF A;  3BJS A;  4X9N A;  3CXB A;  3VA8 A;  4BK1 A;  3N4E A;  4U8I A;  2POD A;  3KUM A;  1PBD A;  3AEC A;  2Y6Q A;  2PP0 A;  1E1M A;  1WUE A;  1NPX A;  3LZX A;  5EB4 A;  3QFA A;  2OKT A;  3UJF A;  3NTD A;  2BK4 A;  2PGW A;  4IVM B;  4BV6 A;  1DJN A;  1GRE A;  1KFY A;  2O56 A;  3NHO X;  3DK9 A;  2HXU A;  3A7R A;  4U8K A;  2R4E A;  2B9X A;  1SJA A;  4NTE A;  1N5W C;  5M0Z A;  3VCN A;  4HB9 A;  4Y4L A;  1PS9 A;  4JY2 A;  1Q9I A;  2JB1 A;  4Z44 A;  3EKG A;  2FJD A;  3GO2 A;  3UKL A;  2YLS A;  3R0U A;  2YLZ A;  2OO6 A;  2WPF A;  4RG3 A;  1IUS A;  5U63 A;  3P0W A;  1TYP A;  3EPT A;  3AM9 A;  2WP9 A;  3GYX A;  1R6W A;  3EUB 3;  3KLJ A;  1XAN A;  3FVD A;  4JN7 A;  1IYX A;  1IUT A;  1W6T A;  2VZ2 A;  4IL0 A;  1TRB A;  2WDQ A;  4A79 A;  4YT0 A;  2TMD A;  1GT8 A;  3UTE A;  4Z24 A;  5CKU A;  3IHG A;  3UCC A;  3BI4 A;  1JNR A;  1JPM A;  3T9P A;  1IUU A;  3HYV A;  4C74 A;  1K0J A;  2TPR A;  4BK2 A;  2RGO A;  4ECH A;  2QA2 A;  2FKP A;  2B76 A;  4YSZ A;  4HA6 A;  1OJA A;  2QJM A;  1LQU A;  1EL9 A;  3DJE A;  3OPS A;  3SQS A;  3UGV A;  2XH2 A;  1D4D A;  2XFN A;  2E5A A;  4HNC A;  4JNA A;  2PHH A;  1LPF A;  3SZC A;  2OA1 A;  2VQB A;  1BGN A;  1CJ4 A;  1JEH A;  3AYJ A;  2E3T A;  3SSZ A;  2C70 A;  4C3Y A;  2NQL A;  5GSN A;  3NYF A;  1DOE A;  4E4U A;  2C7G A;  4YSH A;  2PU0 A;  3AMZ A;  2DKI A;  2WEU A;  1B8S A;  3VDG A;  5FJP A;  4NEW A;  4GUV A;  1D4E A;  4Z26 A;  3V3O A;  3AEF A;  4CY8 A;  7ENL A;  1ELI A;  2XDO A;  3ICR A;  2OX4 A;  5FJR A;  3CNS A;  4FDC B;  3MQT A;  4YWO A;  4ZCC A;  2GR2 A;  3UKA A;  3TOY A;  2FBW A;  4OPI A;  3UXL A;  2XFU A;  1JRY A;  1IUX A;  2C3C A;  2XVI A;  2GGI A;  4ZN0 A;  2WPC A;  4A6G A;  4GDP A;  4XXG A;  1H7W A;  3NXL A;  1TDF A;  3T37 A;  2R9Z A;  5EBK A;  3MWC A;  4TLZ A;  1S2Y A;  3LAD A;  3RP8 A;  2WHD A;  4A3R A;  2C3D A;  2V60 A;  5EU9 A;  4GFI A;  2R4J A;  3NNE A;  3UJ2 A;  1S2Q A;  1B4V A;  4JN8 A;  3AB1 A;  5FS7 A;  4KX6 A;  4OPU A;  4LII A;  1ZOV A;  3OTR A;  2GMH A;  4H4Z A;  2V3B A;  1NHS A;  4JY3 A;  4X9M A;  2UZZ A;  2BCG G;  2E1M A;  2V5Z A;  1BGJ A;  1B5Q A;  3V5F A;  4NNJ A;  1OEP A;  4G73 A;  3U4F A;  3V3N A;  3GSI A;  3ATR A;  4MGG A;  2PTZ A;  1EBH A;  3V76 A;  2P3Z A;  2E4G A;  4TVW A;  2EQ7 A;  2XLU A;  2VRM A;  1REO A;  4OCG A;  3CTY A;  1YQ4 A;  3NN6 X;  3CAW A;  1TDE A;  3ZDN A;  2AL2 B;  2PS2 A;  1PXC A;  3ALL A;  2RGJ A;  1XPQ A;  3BHF A;  1AOG A;  1V97 A;  2DW7 A;  3AEB A;  3T31 A;  1CHU A;  3ALM A;  3VR8 A; 
#chains in the Genus database with same CATH homology
 2ACZ A;  3GWF A;  2GR3 A;  4FX9 A;  2C64 A;  5JRB A;  4EMW A;  2R45 A;  1DNC A;  3VRA A;  2J3N A;  3CN8 A;  5TR3 A;  4NTC A;  3RED A;  4D03 A;  1Q1R A;  1PBF A;  4LA1 A;  4Z43 A;  3G5R A;  2YLX A;  4YKF A;  4XWZ A;  3II4 A;  4J33 A;  3FPZ A;  4II2 A;  4Z2U A;  2GF3 A;  1NG3 A;  3AE1 A;  1H7X A;  1PDH A;  3DME A;  4YTM A;  3K7T A;  1DJQ A;  5KXJ A;  4H4W A;  2JKC A;  2V61 A;  2OLO A;  2RGH A;  1GES A;  4Z2R A;  3CMM A;  2B7S A;  5JCL A;  1PHH A;  1UKV G;  3FMW A;  1K0L A;  1DXL A;  2JB3 A;  2RAB A;  4I58 A;  3C4A A;  4RG4 A;  4YTP A;  1CJ3 A;  4U8P A;  3BI2 A;  2FJB A;  1L0V A;  1L9E A;  1OJD A;  4DGK A;  1H6V A;  4DNA A;  4B1B A;  2GAH B;  2XFP A;  4H4P A;  2BC0 A;  1OJT A;  1GER A;  2H89 A;  3D8X A;  4C5O A;  2QA1 A;  3S5W A;  4REK A;  1V59 A;  3BHK A;  3H4K A;  4OPL A;  2ZBW A;  3S61 A;  1GV4 A;  4AP3 A;  4MJW A;  3HZL A;  1GRA A;  5KVI A;  2GQW A;  1GAL A;  1TDN A;  1H81 A;  2XVJ A;  2EQ6 A;  1BF3 A;  1D4C A;  1N4V A;  4G74 A;  4CRT A;  2CUL A;  1KF6 A;  2R0G A;  3UKP A;  1JU2 A;  3UTF A;  2H88 A;  3LXD A;  3GMB A;  4CCQ A;  1S3E A;  3AE9 A;  2XCG A;  4B67 A;  1ZKQ A;  2A89 A;  1P2E A;  4AOS A;  5IPY A;  2WS3 A;  4GRT A;  2BXS A;  1CL0 A;  1ZDL A;  2YVJ A;  1VG0 A;  2GEW A;  2X3N A;  3QJ4 A;  3B3R A;  4NTD A;  4U8L A;  4A65 A;  2VRL A;  5JCK A;  2WQY A;  3R9U A;  2Q7V A;  3CIR A;  3CPJ G;  1NEN A;  1N4U A;  4GAP A;  4WX1 A;  2Z5Y A;  4RSL A;  1YY5 A;  2YWL A;  3T2K A;  3OC4 A;  3KU9 A;  3CNP A;  4FK1 C;  4EMJ A;  3OZ2 A;  5C2T A;  1DOD A;  1F8S A;  4DSH A;  3P1W A;  4ADW A;  3KVE A;  3P4R A;  4H50 A;  2B9W A;  3UKK A;  3ICT A;  3FG2 P;  4K22 A;  5GRT A;  3GD4 A;  3M0O A;  4AOX A;  3DH9 A;  3QSS A;  4TM1 A;  1Y56 A;  1CJ2 A;  3IF9 A;  1E1K A;  1OJ9 A;  2YR5 A;  1BWC A;  3NGC X;  2QCU A;  3PVC A;  3SFD A;  1ONF A;  4X9N A;  5KVH A;  3SX6 A;  2JK6 A;  2YG3 A;  4Z25 A;  4BK1 A;  1YKJ A;  3AYL A;  4U8I A;  4TM0 A;  2BRY A;  2NPX A;  5BUK A;  4EIQ A;  4YSX A;  1LQT A;  3T0K A;  1ZMD A;  1PBD A;  3AEC A;  1DOC A;  2Y6Q A;  4J31 A;  3AWI A;  1N4W A;  1E1M A;  1CC4 A;  2WU5 A;  3B6D A;  1KN0 A;  1CC2 A;  1D5T A;  2WOV A;  3IC9 A;  1BKW A;  3SY4 A;  1GRB A;  2XFO A;  3NG7 X;  4J2W A;  3UKH A;  3UP4 A;  3AE8 A;  2NVK X;  2B7R A;  1NPX A;  3LZX A;  3AEA A;  1H2I A;  4UDQ A;  5EB4 A;  1Q1W A;  3M12 A;  3L8K A;  4H4U A;  3RP6 A;  3E1T A;  4AP1 A;  3CGC A;  3QFA A;  3NTD A;  3BI5 A;  2BK4 A;  3GRS A;  4IVM B;  5KMQ A;  2C67 A;  4BV6 A;  1NG4 A;  2YLT A;  1DJN A;  1KSS A;  1GRE A;  1NHQ A;  4YSY A;  3URH A;  4JN9 A;  4H2R A;  1KFY A;  1LJ1 A;  2X50 A;  1F3P A;  4H4Y A;  3AE3 A;  3AE4 A;  3DJD A;  3NHO X;  3NN0 X;  2VQ7 A;  4Y4N A;  2CDU A;  3DK9 A;  1L9D A;  3GWD A;  4BUR A;  5HHF A;  4NZH A;  1LV0 A;  3SZW A;  2YG4 A;  3UKQ A;  4U8K A;  2ARD A;  2R4E A;  3PO7 A;  4J56 A;  4U2T A;  3I3L A;  1O5W A;  4U8O A;  1MXT A;  2BS2 A;  4H4V A;  3RNM A;  2WOW A;  5KRQ A;  2QAE A;  1NHR A;  1PBC A;  2FJA A;  2I0Z A;  2B9X A;  4OVI A;  4A5L A;  1YQZ A;  4UDR A;  4NTE A;  2GRT A;  5M0Z A;  3KKJ A;  5FS9 A;  4HB9 A;  3DK8 A;  3AEE A;  4Y4L A;  1F8W A;  1PS9 A;  1FEC A;  4EQX A;  4JY2 A;  4EIP A;  3NTA A;  2ZZB A;  1M6I A;  3AE6 A;  1Q9I A;  2YAU A;  3NH3 X;  2JB1 A;  3COX A;  1F6M A;  2YM2 A;  4GR1 A;  4Z44 A;  5BRT A;  2FJD A;  3UKL A;  2YLS A;  5KOW A;  2GR0 A;  2YLZ A;  4CCR A;  3GRT A;  2WPF A;  1D7Y A;  3CPI G;  2XVF A;  4RG3 A;  1IUS A;  4XWR A;  5DBJ A;  3QFB A;  2B9Y A;  2X8C A;  4OPG A;  3D9X A;  5JCN A;  1D7L A;  2O9Z A;  4J57 A;  2C72 A;  5U63 A;  5KMS A;  1ZOY A;  2WOI A;  2XLR A;  1TYP A;  2YG6 A;  3EPT A;  5ER0 A;  3DGZ A;  2BAC A;  1GSN A;  4M52 A;  3ADA B;  1H86 A;  3EAO A;  2EQ8 A;  3CGE A;  2WP9 A;  3GYX A;  3AE2 A;  3AXB A;  4BJZ A;  3KLJ A;  1XAN A;  1PXB A;  1P2H A;  4YXD A;  1PJ7 A;  1IUT A;  2VZ2 A;  2VVL A;  1IJH A;  2CVJ A;  4J36 A;  3QSE A;  3UCL A;  4H2Q A;  3LB8 A;  1KSU A;  5L46 A;  2BXR A;  1TRB A;  2BYB A;  4OPC A;  4WCT A;  3WE0 A;  3C4N A;  3SZF A;  3UKF A;  4J34 A;  2WDQ A;  4A79 A;  4YT0 A;  2TMD A;  1GT8 A;  1Z6L A;  3RHA A;  3UTE A;  4Z24 A;  1FCD A;  5CKU A;  2ZZ0 A;  1O94 A;  3F8D A;  2JAE A;  3BI4 A;  3IHG A;  3QSM A;  1JNR A;  4X4J A;  4H4T A;  3VR9 A;  4B66 A;  1H82 A;  5BUL A;  4EM3 A;  3G5Q A;  1FOH A;  1GRG A;  4CNJ A;  4USR A;  1IUU A;  3HYV A;  3NK0 X;  4C74 A;  3NLC A;  1K0J A;  1E7P A;  1TDK A;  4IA5 A;  2TPR A;  3F8P A;  4CY6 A;  3CNT A;  4G6H A;  4ICY A;  2R0C A;  2XLP A;  1VRQ B;  2BK5 A;  1IUV A;  2FJE A;  4BK2 A;  2RGO A;  2BRA A;  4ECH A;  4G9K A;  2QA2 A;  4U8J A;  2WP5 A;  2B76 A;  4YSZ A;  3T2Z A;  1W4X A;  4YKG A;  5U1O A;  4HA6 A;  1SEZ A;  4AT2 A;  3IHM A;  1OJA A;  1LQU A;  1GRF A;  2XLT A;  1Y56 B;  2GB0 A;  2Z5X A;  1EL9 A;  2WDR A;  2IID A;  3SYI A;  1KNR A;  3DA1 A;  3Q9T A;  3GYI A;  2IVD A;  3DJE A;  4GCM A;  3CGD A;  2VOU A;  3PG6 A;  2VVM A;  4N9X A;  3P4S A;  3AD7 B;  4GAV A;  1JOA A;  1GEU A;  1IUW A;  1D4D A;  2BK3 A;  2XFN A;  4GF7 A;  5EB5 A;  1N1P A;  4O5U A;  2AAQ A;  4DSG A;  4GDE A;  3UOY A;  5M10 A;  3DJJ A;  4JNA A;  2JBV A;  2PHH A;  3AD8 B;  1DOB A;  1LPF A;  1E6E A;  1PXA A;  2GMJ A;  2YLR A;  3SM8 A;  3NRN A;  2OA1 A;  3RP7 A;  3SZC A;  3SXI A;  2VQB A;  1EL8 A;  1NDA A;  4U8M A;  1BGN A;  3SGL A;  3FBS A;  1CJ4 A;  4EM4 A;  1TDO A;  3K30 A;  4EQW A;  2Q0L A;  3UP5 A;  4PAB A;  1JEH A;  3AYJ A;  1GOS A;  2VVL G;  3CNJ A;  5J60 A;  2YQU A;  4B68 A;  4NWZ A;  3VRD B;  1RYI A;  2C70 A;  3C96 A;  2GR1 A;  3P4P A;  1QJD A;  2E5V A;  4C3Y A;  4Y4M A;  2X8G A;  4OPT A;  1FEB A;  2C75 A;  5GSN A;  1EBD A;  3GDP A;  3EF6 A;  3NYF A;  3AE5 A;  2WBA A;  2YVG A;  2GQF A;  4H4S A;  1DOE A;  3L5O A;  1E39 A;  1CC6 A;  2C7G A;  3K7M X;  4H2N A;  4YSH A;  4H4Q A;  2A8X A;  3Q6J A;  4K5S A;  3G5S A;  3ICS A;  2DKI A;  2F5Z A;  1PN0 A;  4H2P A;  3UTG A;  3UOX A;  1VG9 A;  1MO9 A;  2WEU A;  2AR8 A;  4U2L A;  3VQR A;  3EAN A;  1B8S A;  3NK1 X;  5IQ1 A;  1S3B A;  4NEW A;  4GUV A;  1D4E A;  4Z26 A;  3V3O A;  4H4X A;  3AEF A;  3NK2 X;  5KWF A;  5KMP A;  2EQ9 A;  4CY8 A;  1H83 A;  1COY A;  1NEK A;  2WET A;  4K7Z A;  2X99 A;  1VDC A;  4K5R A;  1ELI A;  1KNP A;  1LTX R;  2XDO A;  5IQ4 A;  2GV8 A;  1NHP A;  3ABV A;  2X8H A;  3ICR A;  5BVA A;  4TM3 A;  4ZCD A;  3CNS A;  4D04 A;  1NAA A;  4E0V A;  1GTE A;  2CFY A;  4FDC B;  1GXF A;  1GND A;  4UDP A;  4YWO A;  4ZCC A;  3UOZ A;  2BC1 A;  2GR2 A;  3UKA A;  2Q6U A;  3UTH A;  3BNU A;  3SZ0 A;  1QO8 A;  4UP3 A;  4TM4 A;  4A7A A;  3DK4 A;  1LVL A;  1XHC A;  1CJC A;  2WP6 A;  4EQS A;  3NT6 A;  4U2S A;  2FBW A;  4OPI A;  1JRX A;  1PJ6 A;  3L1R A;  4JDR A;  2XFQ A;  2XFU A;  3M13 A;  1EL7 A;  4A6N B;  2WPE A;  1JRY A;  1IUX A;  2C3C A;  1E1N A;  1CF3 A;  2XVI A;  2Y6R A;  3AE7 A;  1Y0P A;  1B37 A;  2WDV A;  4ZN0 A;  4OPD A;  1ZX9 A;  2WPC A;  4GDP A;  4KPR A;  4APN A;  3BNM A;  3NKS A;  3LJP A;  2C4C A;  2OLN A;  2Q0K A;  3KPK A;  4C77 A;  4XXG A;  1H7W A;  2OAL A;  1TDF A;  4K2X A;  2YR6 A;  2APG A;  3T37 A;  2R9Z A;  2BCP A;  5EBK A;  1ZMC A;  4U8N A;  4TLX A;  5JCI A;  5KNL A;  5KOX A;  4B63 A;  5LV9 A;  2YG7 A;  3HYW A;  1X31 B;  4TLZ A;  1PBE A;  1S2Y A;  3LAD A;  2YG5 A;  4EQR A;  3JSK A;  3DJG X;  4PAA A;  3ITJ A;  4C3X A;  2HQM A;  1KDG A;  1K4Q A;  2OAM A;  3GYJ A;  3RP8 A;  3ZYX A;  3F8R A;  4G6G A;  2BS4 A;  2WHD A;  2GAG B;  2YVF A;  4FK1 A;  2XVE A;  2C3D A;  2V60 A;  2C76 A;  1H84 A;  4JNQ A;  2R4J A;  3NNE A;  1S2Q A;  4II3 A;  3SFE A;  4CBQ A;  5JCM A;  1B4V A;  2ZZC A;  3PS9 A;  1TYT A;  1PJ5 A;  5FS7 A;  2YM1 A;  3AB1 A;  3H8L A;  4KX6 A;  4OPU A;  5CQF A;  5KMR A;  4LII A;  2R46 A;  1K0I A;  2A87 A;  1O95 A;  1VQW A;  2DKH A;  5HYM A;  1EL5 A;  1ZOV A;  1BZL A;  1ZP0 A;  2GMH A;  4LU6 A;  4H4Z A;  3ATQ A;  2V3B A;  1GTH A;  1NHS A;  3ISH A;  2V3A A;  2V6O A;  3AD9 B;  3H8I A;  2UZZ A;  4JY3 A;  3QVP A;  4X9M A;  3T14 A;  2BCG G;  5FMH A;  2YR4 A;  3D1C A;  1JRZ A;  5J7X A;  4P9S A;  4K8D A;  2E1M A;  2V5Z A;  1E1L A;  2WES A;  1BGJ A;  4AT0 A;  1B5Q A;  1GET A;  1ZK7 A;  1GPE A;  4I59 A;  2C65 A;  1M64 A;  2WU2 A;  4Z2T A;  4YTN A;  2IVE A;  1FEA A;  3HYX A;  4NNJ A;  2AQJ A;  4NEV A;  3VRB A;  4IV9 A;  5FS6 A;  1MOK A;  3I6D A;  4G73 A;  3V3N A;  1GRT A;  3AED A;  4A9W A;  1RP0 A;  3KA7 A;  1QLB A;  3GSI A;  3ATR A;  1JNZ A;  2YLW A;  3AYI A;  3CPH G;  2BAB A;  3O0H A;  3ALJ A;  4H4R A;  3LZW A;  3V76 A;  4A6N A;  4B64 A;  4JQ9 A;  2E4G A;  3SQP A;  3P9U A;  3UOV A;  2PYX A;  3FIM B;  2W0H A;  3NYC A;  5FS8 A;  2EQ7 A;  2XLU A;  2VRM A;  3NYE A;  4H7U A;  3T2Y A;  1REO A;  2BS3 A;  2JB2 A;  1PBB A;  3KPF A;  4OCG A;  3CTY A;  4IVO B;  1YQ4 A;  1F8R A;  3LOV A;  3NN6 X;  1YQ3 A;  3DGH A;  4B69 A;  4BJY A;  1TDE A;  3ZDN A;  1XDI A;  5HY5 A;  1FL2 A;  4EMI A;  2XLS A;  3GD3 A;  2GVC A;  1S7M A;  4IA6 A;  1CBO A;  1OJC A;  1PXC A;  3QVR A;  4O5Q A;  2R0P A;  3K7Q X;  3CGB A;  4CNK A;  3CND A;  5C3J A;  5U25 A;  3KD9 A;  3ALL A;  2RGJ A;  1L9C A;  3IWA A;  3AEG A;  1XPQ A;  3NIX A;  2BA9 A;  1HYU A;  3BHF A;  3GMC A;  4USQ A;  1AOG A;  3ALM A;  1RSG A;  4A99 A;  4BK3 A;  3GDN A;  5EOW A;  4B65 A;  2C66 A;  3AEB A;  3T31 A;  1CHU A;  5HXI A;  1ZY8 A;  2GH5 A;  3P4Q A;  2XVH A;  2XYO A;  1GRH A;  3VR8 A;  2C73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...