4K8GA

Crystal structure of d-mannonate dehydratase from novosphingobium aromaticivorans mutant (v161a, r163a, k165g, l166a, y167g, y168a, e169g)
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
403
structure length
386
Chain Sequence
b'HMKITAARVIITCPGRNFVTLKIETDQGVYGIGDATLNGRELSVVAYLQEHVAPCLIGMDPRRIEDIWQYVYRGAYWRRGPVTMRAIAAVDMALWDIKAKMAGMPLYQLLGGRSRDGIMVYGHANGSDIAETVEAVGHYIDMGYKAIRAQTGVPGIKSLPSVTGWDTRKALNYVPKLFEELRKTYGFDHHLLHDGHHRYTPQEAANLGKMLEPYQLFWLEDCTPAENQEAFRLVRQHTVTPLAVGEIFNTIWDAKDLIQNQLIDYIRATVVGAGGLTHLRRIADLASLYQVRTGCHGATDLSPVTMGCALHFDTWVPNFGIQEYMRHTEETDAVFPHDYWFEKGELFVGETPGHGVDIDEELAAKYPYKPAYLPVARLEDGTMWNW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme, N-terminal d
publication title Crystal structure of D-Mannonate dehydratase from Novosphingobium aromaticivorans mutant (V161A, R163A, K165G, L166A, Y167G, Y168A, E169G)
rcsb
source organism Novosphingobium aromaticivorans
molecule tags Metal binding protein
total genus 142
structure length 386
sequence length 403
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4k8gA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4k8gA01
3R0UA 2QGYA 3FYYA 3HPFA 2OO6A 3ZVHA 4J3ZA 2OG9A 2PCEA 3S47A 4IP5A 2PP0A 1DTNA 5FJUA 4IL2A 2QVHA 1MDRA 2RDXA 2PSNA 4YWSA 3MSYA 3FV9A 1PDZA 3R0KA 4ZA0A 3R10A 3FCPA 3ZVIA 2ZADA 3TTEA 5FJPA 2HNEA 3UJEA 3H8AA 3RITA 2AKMA 3DEQA 3OP2A 3GD6A 2OFJA 1WUFA 3PWIA 3DG6A 4M6UA 4A6GA 3UJFA 3CT2A 4E4UA 2P8CA 4E4FA 4KT2A 3VCNA 1OEPA 3FXGA 3I4KA 2GSHA 1SJAA 4GYPA 3UGVA 4HPNA 2PP3A 3NO1A 3V5FA 3DGBA 2DW7A 2FKPA 4K1WA 1XPYA 3U4FA 3JW7A 3PK7A 4ZCWA 4HN8A 3K1GA 3SJNA 3R25A 5BOFA 1FHUA 1EBHA 4DN1A 2OQYA 4H19A 3SQSA 2QJMA 3TJ4A 1MDLA 3DERA 5BOEA 4GISA 2OX4A 2P88A 4IP4A 3RCYA 3VA8A 2POZA 3P3BA 3V4BA 3MQTA 2I5QA 1TZZA 1R0MA 3RRAA 1TKKA 3Q4DA 4IHCA 7ENLA 3IJQA 3QLDA 3GC2A 3UCDA 1P43A 4G8TA 2OZTA 4JN8A 3DIPA 3IK4A 2PU1A 2P0IA 3MY9A 4ENLA 5J04A 3TWAA 3ZLGA 3H70A 3CXOA 2QDEA 4E6MA 1IYXA 2PMQA 2PGEA 3DFHA 3QPEA 3DDMA 3IJIA 4GFIA 3STPA 1W6TA 3RGTA 4KEMA 3ZLHA 2QJJA 5FJOA 2PPGA 3VFCA 4Z17A 2PTZA 4H83A 3ENLA 1EBGA 1BKHA 4IL0A 3CK5A 4E5TA 1MUCA 1KCZA 3MUCA 2ONEA 4G7FA 4GGHA 2XSXA 1F9CA 3ZLFA 3BOXA 3T6CA 3VC6A 3TQPA 3TCSA 3OZYA 2MUCA 3UJRA 4X2PA 1NELA 3QTPA 3R1ZA 3RR1A 3PWGA 3MKCA 4JHMA 3UCCA 2NQLA 1ECQA 1EC8A 2OVLA 4A35A 3T8QA 3QKEA 2GGGA 3I6TA 3DESA 3VCCA 2ZC8A 3H12A 4HNLA 3EEZA 6ENLA 4HCDA 4H2HA 2P3ZA 3EKGA 4H1ZA 3SN4A 3N6JA 3THUA 3Q45A 2HXTA 1ELSA 1E9IA 2AKZA 1L8PA 3ES7A 4HYRA 1MRAA 3T9PA 4GMEA 1KKRA 3MWCA 2AL1A 1JDFA 4MGGA 2GGJA 2PTXA 4FI4A 2PTWA 1KKOA 2OKTA 2PP1A 4DYEA 3SN1A 3V3WA 4IZGA 2QQ6A 3UXLA 3D46A 3I6EA 2XGZA 2DW6A 3RO6A 3DFYA 2OPJA 3S5SA 4K8GA 4MKSA 3UXKA 2XH4A 1R6WA 1EC9A 3DG7A 2HXUA 3UJSA 4DHGA 1NU5A 1RVKA 3H7VA 4K2SA 4A3RA 1FHVA 4KWSA 2PU0A 2GGIA 4HCLA 4DWDA 2AL2A 2CHRA 1JCTA 4J1OA 4GIRA 3KUMA 1SJBA 4DX3A 3R11A 1KD0A 4JN7A 3CB3A 3JVAA 2PS2A 5ENLA 2OQHA 3NZGA 2GGEA 3JZUA 3NXLA 4GYPC 2QDDA 3BJSA 2GL5A 5FJTA 3P0WA 4FP1A 3B97A 3N4EA 1ONEA 3UJ2A 2PA6A 2PGWA 3VDGA 4E8GA 2AL2B 2PODA 3ES8A 3P93A 3MZNA 4DXKA 4ROPA 1XS2A 2FYMA 3N6HA 3VC5A 4F4RA 3ZVHB 3SBFA 3NFUA 1YEYA 3SN0A 1SJCA 3GY1A 3FVDA 3U9IA 1JPMA 1WUEA 3CAWA 3OZMA 4KPLA 2XH7A 3DG3A 3TJIA 4HNCA 3TWBA 2P8BA 3IJLA 1TE6A 3PFRA 3D47A 1EC7A 4GGBA 1SJDA 1JPDX 4M0XA 3OTRA 3OPSA 3CYJA 1PDYA 2MNRA 5IDZA 1P48A 3N4FA 5FJRA 2O56A 4HCHA 3BSMA 2GGHA 3T4WA 5EU9A 3TOYA 3SSZA 3FJ4A 3TW9A 2XH2A 1MNSA 2OZ8A 2GDQA 3OW1A 2OZ3A 2HZGA 4Z1YA 3GO2A 3V5CA 1BQGA 2QJNA 3QN3A 4MMWA 2OLAA 4IT1A 2XH0A 4EWJA 2PTYA
chains in the Genus database with same CATH superfamily
3RIKA 3ZVHA 3V5OA 1MQRA 3STGA 3MSGA 4D6DA 1FECA 4LUSB 4AWSA 3DFOA 5AOUA 2FIQA 4EMWA 4DWSC 1KLZA 1XRVA 1IT0A 3WLLA 4BI5A 4J35A 3DGZA 3GD4A 4GJIA 2PCQA 2CZEA 4WSJA 2PGRA 4LANA 4L5ZA 4JX4A 3URHA 3M5XA 3U2OA 2EPOA 1XBXA 2BFGA 3Q2DA 3DG6A 4GNJA 1IWAA 1W3NA 2XSAA 1TUXA 4LCRA 1OEPA 3LA4A 2ZUMA 3DUGA 3UGVA 5BU9A 4BI7A 3S8HA 4C90A 3EAUA 3UU0A 5HMSA 1QJWA 2Y89A 1RVGA 1VPXA 1ZCCA 1JZ7A 1XLBA 3AUJA 4U2YA 7XIMA 3EKZA 1LBLA 1JCYA 5BW6A 1NP0A 3MSRA 4JEJA 3KRZA 3C2FA 4G9PA 3WDJA 3SUWA 4JKKA 4C6BA 3ITCA 2IKJA 5E0CA 3VD3A 4EKJA 1J4EA 2X41A 5CH9A 4M5PA 4UTKA 3RCNA 4J4KA 3IIVA 5A6MA 3IRDA 5AC4A 4O8AA 4IJCA 2Q3RA 4AIBA 2CLHA 4B4FA 4AIUA 1BF2A 2TPRA 4MYAA 3G2GA 2TPSA 4ADSA 2XN2A 4GYFA 3W22A 2VVSA 1RY0A 2V5DA 4YL2A 5D32A 2X8RA 4WJ8A 3TTQA 1YX1A 2DFAA 3VD7A 4AVFA 2VFDA 1BVWA 1QPQA 3SJ3A 4UMAA 1QPNA 2IXVA 1JZ8A 1LQ0A 4RV3A 1JFHA 4TX8A 4PMYA 4O0KA 3N9SA 3BJFA 1EBGA 2DZBA 1B30A 1UMYA 5DN1A 4LOCA 4O1AA 1GRTA 1F76A 3OYXA 2YDQA 4H8VA 2D23A 4TO8A 1GRFA 2XSXA 3SCQA 1FWBC 4ZSTA 4E2VA 3T6CA 4AIOA 3OVRA 1GJWA 1O5KA 2VJXA 3IJ8A 1N2VA 3KOYA 4HVXA 4U3AA 3D6NA 3W23A 1ZP4A 5F4SA 1QMLA 2WW5A 2XFYA 3NPXA 3USBA 1DVJA 2NQLA 5FACA 1G67A 4U10A 3MTWA 3S5OA 1GOQA 1GWJA 1TCDA 1SR9A 4TMBA 2X0SA 5GNZA 4JIHA 3VOIA 2WMKA 4LVDA 1NHQA 1T41A 2OOFA 4KQNA 1P7TB 3H4XA 1KM4A 1X2HA 3DYOA 4JQ1A 3MO4A 2P3ZA 4NYYA 3TR2A 3OJGA 3R5EA 4U31A 3IARA 2PD5A 3BARA 1C9WA 1FUYA 1CGXA 3G1RA 5AYBA 5CSSA 1Q1WA 2V67A 1Q6OA 2HPIA 1GW1A 4BQ4A 2E9LA 3QZEA 2CFFA 4WY0F 4OZOA 4JTQA 1RQHA 2AL1A 2PBOA 3NXFA 3WD0A 2DGAA 1J11A 2VTFA 1BHGA 3Q94A 4MYXA 1R30A 3SRKA 4DB7A 3V35A 3KFTA 1G4PA 5BXTA 3D46A 4OOUA 3I6EA 2WSPA 1L2QA 3DFYA 2I17A 4DYKA 3WQ6A 3C3NA 4WX2A 4A3YA 3PBYA 5TD4A 3NVZB 1HQTA 1YW1A 2H9AA 2HXUA 3EX1A 4B5VA 4LGXA 4PMOA 5EMMA 4KEZA 1FVPA 3RPTA 3CL7A 2V81A 2GGIA 4IMGA 3T2QA 2NLYA 4NAFB 2RGMA 1UPPA 2ZX8A 3VIFA 3IAPA 3WDHA 4ZENA 1DXEA 1SJBA 4N6FA 4DBUA 2VO5A 4D6FA 1OK6A 4ZQMA 1Q4NX 1A5OC 4LEQA 2ZZ5A 4H4TA 4GXWA 3BVJA 3FSUA 3TJXA 3LGGA 3PG9A 1I1XA 3TQVA 2GVEA 3WO8A 4WHBA 1M7JA 2PDCA 5HWNA 3CLWA 4FP1A 3NQMA 4J2PA 1ONEA 3EWZA 5LKYA 5AHIA 3AICA 4N4PA 1EH9A 4MNLA 1EZ2A 3BLEA 3SY5A 6REQB 3TSMA 2R1KA 5GNXA 3W1RA 4GIAA 3CHDA 1J5TA 1DHPA 3RN6A 1QNPA 2ZRVA 4GBDA 3QMTA 3HM7A 2CFYA 1JXKA 2PWGA 2J78A 1E51A 4C1NA 3UXDA 4XO6A 5DFAA 1CCWB 2DPEA 4PUUA 2RGLA 2GJLA 3EPNA 4W88A 4AF0B 2Z2BA 1RUSA 1XGEA 1OFQA 4XQ6A 4GJJA 1ODZA 4OTKA 1VCFA 1TV3A 1B3WA 1K7FA 3LI1A 4W5ZA 4AZHA 4MADA 5AYXA 4ZOBA 3VVGA 3SCUA 3WH8A 2PWEA 3AWOA 3L5LA 1PE1A 2CKSA 1VLWA 3H24A 2VCBA 1ZJAA 4QG6A 1EO7A 3JZEA 1DQXA 3EZ4A 9XIMA 3G5EA 3CM4A 1GKPA 4D6JA 1K8YA 4NJJA 1IEQA 1MRQA 4LAKA 3RF9A 3L9CA 1QASA 3MP5A 1AQ0A 4LW7A 1FY6A 2YLAA 2F84A 2XH0A 1OT1A 2YVGA 2A5HA 3PJUA 1UG6A 3T78A 4B3KA 1XYFA 3WIJA 2D24A 2WC3A 4F0MA 2JALA 1JUBA 3W37A 2FMOA 1K4HA 1WYGA 1T6MA 4RXFA 3FV9A 3W7MA 2ACUA 3B8TA 3E2QA 4W7UA 2CWNA 3NDYA 2W3ZA 1AZ1A 1RA5A 4UZUA 1Z89A 5BXPA 4KWVA 1TYGA 1MEWA 3BQ5A 4PL1A 4GACA 3OG3A 4L1GA 3DYPA 2OFJA 4QNWA 2ZE3A 1U1JA 3ZT6A 3OG2A 1BTMA 2D0HA 3BE7A 4C5ZA 4HPHA 2GQ9A 3FDKA 2P5NA 5I3FA 1R85A 4L6DA 3GHTA 3PZMA 2DW7A 1N7KA 2B7OA 2QF8A 1XPYA 3AXMA 2YCJA 2PB1A 3PK7A 4KRTA 1VEMA 1DJGA 5EMYA 4US5A 2IUZA 5HAOA 3EOEA 1OCNA 2YSWA 1TWSA 3TROA 5GRTA 1EBHA 3VK5A 3PS7A 1OCBA 5ECVA 3LGEA 3PSVA 4MSSA 3M0IA 3PPHA 4XTIA 1W1YA 2W62A 4PUJA 1GTHA 1MXDA 2SFPA 4KWWA 2BS9A 5RUBA 3A3XA 4XKMA 2NVCA 4L4PA 1PIFA 2FHFA 4GPNA 1OSEA 2FQIA 1IEXA 3KVJA 3EYPA 1EDTA 1H2JA 3GG8A 5CSYA 1EKOA 4Q4KA 1K4QA 1NEYA 3THCA 3N9KA 1C91A 1WZMA 2A7NA 1F4AA 1RCQA 1V0LA 5HQMA 2WPCA 4QTGA 1L6GA 3ZXWA 2VUYA 4H01A 4BQ3A 3CXOA 4AYSA 2PDWA 1VQTA 1YDNA 3PWAA 3VDCA 1K3UA 4DJEA 1FX6A 1RPKA 1CB7B 3IJIA 4U28A 4UTTA 3AM9A 1VHNA 4CD4A 4EWND 3C4UA 1XUUA 1XP3A 3ZLHA 2FTYA 4PB3A 4LYPA 3DFQA 5DCBA 3ENLA 3UZZA 3ZZ1A 1CX9A 4PUEA 1TV8A 3GNNA 3KRSA 1QNSA 4P2VA 4Z1CA 1NDAA 2OYKA 2HVNA 2FGLA 2CBIA 1O1HA 2FB3A 1WKEA 4FS9A 5H8MA 1GKRA 1TPEA 2ACSA 3MUAA 1EIXA 4Q8VA 1E73M 1TPUA 2J8FA 2Z2UA 3TDFA 4BEUA 1CNVA 3ZR4A 5LGXA 1QNOA 3U48A 1Q65A 1MQQA 5BZAA 1ZXIC 4P7RA 1M3UA 3U7VA 3E1F1 3C8NA 5A6BD 2D2GA 3CV1A 5A6BA 3S4TA 1O60A 1B3YA 4M1RA 1I2NA 2F5ZA 3ANUA 3COTA 4HZ7A 3N6JA 2XZ7A 2YBUA 4UFMA 1F3WA 4JTJA 1HVQA 3TC3A 3AIVA 3L21A 3EOSA 8CGTA 3IWPA 1CZ1A 1W91A 4I7WA 1M65A 1GXFA 4O8RA 4AC7C 3S9YA 2D0FA 4RW5A 2Z7GA 3VOFA 4WKHA 3PBMA 1TE1A 1VRXA 4Q6JA 1OGBA 4HHLA 2OT1A 3SN1A 1UJQA 5H1WA 3HGOA 3B8SA 4J7RA 5IFPA 4CEUC 2Z7KA 3UVAA 4AISA 3G1VA 1S2CA 3TX9A 1P4CA 1SO5A 4Q4PA 3M0VA 3PBUA 3UJSA 3WDPP 5D2WA 3WY1A 5DELA 2ISFA 5CBBA 4GI6A 1GVRA 3O6DA 3RO8A 1OADA 3NVTA 3FEQA 3NCOA 1GRAA 4DZIA 1GREA 2QCDA 4AYGA 2C14A 3GHSA 4PMRA 5LIKX 1DWHM 1UQYA 3CHCA 4G1NA 4JTFA 1RLDA 5E5CA 4AD5A 1KD0A 3II4A 2DT2A 4S3CA 2PE4A 5EGRA 3GW3A 2O9OA 4G2DA 4IIGA 2Y0FA 2HSAA 1LWHA 2YDSA 2BXZA 5LA1A 3B05A 3L5MA 3W2JA 1KRBC 1B0IA 3LHYA 1FWIC 4TV6A 1I6NA 3O0KA 3BMVA 2BXYA 3SIMA 5HNNA 1AH3A 4X22A 3B8DA 5HJYA 4D1IA 4DXKA 4ROPA 4BFAA 3R8HA 5BYWA 1QNRA 4MHBA 3NO3A 3A3WA 4H9YA 4C6IA 3HF3A 2ZXAA 3M64A 4RDZA 4LIIA 4JX5A 3NFUA 3GNPA 3BAWA 4IUOA 5REQB 1XIBA 1PX4A 3TZNA 5HNTA 3BJTA 1ZGDA 1WXJA 5JIWA 4W4QA 4RZBA 3GK0A 3OVPA 4NNBA 4IIHA 3G0UA 1GEUA 1ITXA 3T0AA 4IH3A 4IF2A 4G1KA 4G6CA 4RX0A 3BDKA 3GTFA 1M41A 1AODA 4S2BA 4U33A 3SY1A 3VE7A 1E9ZB 5CGTA 4ZFCA 2YGYA 4NEWA 1XICA 1RP8A 1QOPA 2J7BA 5C54A 1IHIA 2J7DA 4RCXA 3MJMA 2ZWZA 2H3BA 3GYEA 3HBLA 5HJLA 1DWGM 1P48A 2ACRA 1BFNA 1UWSA 4ZBCA 3W28A 1LJYA 1AVAA 3WLKX 4DM2A 1NFPA 3IJ7A 5FJIA 1NDYA 1F3TA 3MS8A 4JTCA 1KXTA 1P6CA 4PODA 1W8SA 1FWRA 3SSZA 2UBPC 1E4NA 3BURA 3TA6A 1OIMA 1L6SA 1MNSA 3W73A 1A5NC 3N9RA 3OW1A 2XIIA 3A5FA 3O7UA 3IGXA 3NQFA 4Z1YA 5DO8A 5JBDA 2DEPA 1BQGA 3EMQA 4IG2B 5G2IA 3TTSA 1UR4A 2WCSA 1OFAA 5AHFA 4S23A 4O1BA 3LUTA 2OLAA 2PTYA 3DGRA 1XLDA 4H4WA 3AIRA 3B8IA 2V2CA 1O68A 4JL1A 2VZOA 2J8TA 1JL8A 1HXJA 1TIMA 3MUY1 2E5BA 1MO0A 1TR9A 3WF0A 3ID7A 1RM6B 4D8AA 3CZLA 1D8WA 3UR2A 3KP0A 4ML4A 1IEIA 3VXGA 2C19A 1H7WA 5I2UA 3S5ZA 2GPTA 3R10A 2W67A 3URNA 1W2PA 4V1XA 1QW7A 1UMLA 4UOZA 1GRHA 3KAOA 4J57A 2D3NA 1SMDA 2CZDA 4L4OA 3F4NA 4IIDA 2P8CA 2FPYA 4KT2A 3UW6A 5H6HA 1PZ1A 4DLFA 4GYPA 2Z27A 5FL1A 2P0OA 3KBMA 2WPBA 3S6TA 5G1TA 4WY0A 1OGSA 4NZCA 2GVYA 1ZY8A 3M9YA 2Z1VA 2DVUA 4QROA 5BOFA 1NAL1 2YLLA 4TV5A 4NI3A 3SQSA 2CITA 2WC4A 3W7RA 1J2WA 5HDRA 5MKGA 1A0EA 4L9YA 4BA0A 3KCJA 3VKBA 1OINA 4BY3A 4UCGA 3MQTA 1S5MA 2I5QA 4ERAA 1BLIA 1HG3A 2IXUA 4NNAA 1BAGA 2FZMA 4GNVA 1P43A 4HT3A 3ZO9A 1QHZA 4LY8A 3M07A 2JIWA 3EMCA 5T9CE 1SW7A 4LA1A 3QF0A 1CI1A 4Q4OA 1TPWA 3NDZA 3L4ZA 3BZJA 3EPOA 3R79A 2GK1B 3WLJA 1W1TA 1LROA 3BUVA 1F07A 1N61C 3GU2A 4JN6A 4UC5A 4ZTYA 5ABTA 4NHVA 1GSNA 2X0HA 4XSMA 2J6XA 4GINA 3W2MA 1X39A 1OF8A 3EX3A 1K77A 3TZFA 1QNVA 2OR2A 3NRZB 4KCVA 3ZLFA 3BOXA 2BC1A 1NFBA 3BSGA 4YYCA 4GQ0A 2MUCA 4I7UA 1TPC1 1S38A 1NIUA 6TAAA 4LCQA 4V2XA 5HNUA 2NVDA 3LYEA 2JBMA 3UWUA 3W24A 4LF2A 2O55A 4KWUA 3LHVA 1A5BA 2OVLA 1HL9A 4J3VA 3UWEA 4QX4A 2IKGA 4J3SA 1VJIA 2GGGA 1DBTA 3OZPA 1W56A 1OCJA 3WJYA 1W5QA 3W84A 2WSKA 3EX4A 1FIQB 3WH9A 1X38A 1EFZA 2E5AA 4EM3A 4KWOA 3GIPA 1EYEA 3K8LA 4URIA 1OX5A 1UZ4A 3OVGA 1MSSA 3F2CA 1HTIA 5BXSA 1K9EA 3ES7A 1KXQA 2BY3A 1BRLA 1PXGA 2VCAA 5CPMA 4DBSA 4HZ6A 1DJQA 3H26A 2WHMA 1UD8A 2P50A 3GYCA 4AEFA 3AAMA 4FI4A 1ISVA 2PTWA 1XIDA 4KIRA 3L4YA 3CUIA 3S9ZA 1U1UA 2DW6A 4TUFA 2R91A 4DLMA 1IXOA 3WF4A 4BQ2A 1LYXA 1PB0A 3GW0A 2B7NA 1S3TC 3AS1A 5A5WA 4GI4A 3GTNA 5CPOA 1REQA 2CZ5A 1L6FA 4EF8A 2A2IA 1RCOB 2PURA 4UNLA 3VGGA 4QSFA 4GLEA 2EBNA 3HGSA 3E0WA 1KV8A 5IHSA 7A3HA 4C6KA 4I8YA 5AHMA 4FIRA 1SFLA 3AU6A 3GHRA 4GRTA 4W85A 2WSYA 5IFTA 5KSWA 1NPXA 3WKZA 3WUFA 2YB1A 4JQ2A 2OQHA 2IKHA 7TAAA 3LRKA 3SW6A 3GH4A 3NXLA 5JXQA 1M7XA 2INFA 4CQCA 2QDDA 4XBKA 5U7SA 2NUYA 1FWCC 4GY7A 1CGUA 1NJJA 3PZNA 4K7YA 4IQLA 3N4EA 5AYIA 2FZ8A 4U5IA 8XIAA 3E02A 1IT7A 1KM1A 2A7PA 3HPZA 1Q6RA 3GWQA 1D7FA 2E09A 3P67A 1ZAJA 4ICMA 3UYIA 4QR6A 3ITVA 3GD3A 5AYZA 1NWRA 3NVYB 4JTKA 4UFHA 3N6HA 1V51A 4OE7A 4O11A 4WJXA 3WQPA 1OG0A 1IV8A 3PPGA 1P1XA 4C1KA 2GR3A 1XPGA 3CZEA 1TQJA 2WJZA 3GY1A 4IPIA 1NVMA 4B90A 5DCEA 1J0ZA 2TYSA 3F4DA 5TR3A 2ZZ3A 3DG3A 1HKIA 3LBCA 3VOGA 1JJKA 1QT1A 5JH2A 4PB5A 3PZQA 4DJFC 3OO2A 1KM6A 3GH5A 1LOQA 1GOXA 4RL3A 5CPQA 4OUEA 4TOQA 4FK9A 4GIYA 4B5UA 3WDRA 4WCJA 3G18A 1N82A 4X9SA 3VKDA 1MW2A 4CUCA 4CEXC 3IIOA 5FEWA 3CS2A 1H7RA 5TQLA 2EG8A 4HZ8A 1RD6A 2PWDA 3W01A 1KFWA 7CGTA 1KCKA 2GSJA 2YCLA 2VFIA 2GDQA 1KXVA 2OZ3A 2WNWA 1ZAIA 3UEQA 3VUSA 3EKLA 3YPIA 2WSQA 2RDWA 4ZO7A 2Y1HA 4IT1A 5CQ1A 4XV0A 1FH8A 4LU0A 2XU2A 2FLIA 2DJLA 2ZA3A 5C0QA 1P6BA 3S9IA 4TVUA 2JEPA 1JYWA 3LRMA 4EQXA 3O9NA 2DORA 4CKQA 1XLEA 4IL2A 1XD0A 3TN3A 2BMBA 1JUEA 1B2YA 1OM0A 5AZ0A 4YWSA 2V9DA 4AZCA 3G1AA 3H21A 3GFZA 1B1YA 3FCPA 2EPHA 3QKZA 3QBUA 3AMLA 3RITA 3QGKC 1R3WA 1JCJA 6XIMA 3WQOA 1J5SA 3U4AA 4PUDA 4FHAA 3R7MA 4R85A 4PRTA 4TMCA 3CWNA 4FNQA 3WL0A 3N2TA 1P0BA 2P53A 4F9DA 1IXNA 1ZAHA 4GX9A 3LN3A 2ZQ0A 4GZIA 5HK4A 3DH7A 4LEFA 2DVTA 2BGNE 3VNDA 4NY2A 5BU6A 4ZFMA 1KCXA 5LIXX 3EOLA 3WNPA 1E1CB 3QV7A 3W02A 4YLWA 1JIBA 2J8GA 4GUFA 4GFSA 4ACZB 1GTEA 1ZP3A 1N60C 4B5NA 2FPVA 3GHUA 4RDVA 3NQEA 3VA8A 2GR1A 3P3BA 3PJWA 5AECA 1JI1A 2WQDA 1PPIA 1R0MA 4H4SA 3HMJG 2RUSA 5XIAA 3LTSA 3EB3A 1SSGA 2FJKA 3NEVA 3CGCA 1WZLA 4W8BA 1BWLA 1A4MA 1GORA 4R88A 1TPB1 5EKYA 2CERA 5TF0A 3FEMA 4H8NA 1E0XA 3RJYA 4ONVA 4LH8A 1PUDA 3QRHA 1XV8A 5CEWA 3GRTA 1QPOA 1NHPA 1KBKA 4C7DA 3KZSA 5I3JA 5IXEA 2VEMA 3DDMA 1TJRA 3PR2A 3DENA 5T91A 1Q8JA 3RGTA 2J77A 2JK2A 3L66A 5G4HC 1DIEA 3DGHA 3C2OA 1E0UA 5EY5A 2PC8A 3OLEA 3CK5A 2GJXA 4F0KA 1GCYA 3W29A 2RABA 1G7UA 2ZVIA 3BV7A 1QI5A 3KBSA 4FIQA 1MYRA 2WCGA 4M7SA 2XPKA 2ZZ4A 2DT0A 3URAA 4XK2A 3UJRA 2FVKA 4H4QA 5M5DA 3SCPA 1PAMA 1PZ3A 3LCGA 4XG1A 4Z42C 4O54A 1A0CA 3TP4A 3GDKA 5EFDA 3SECA 3GFXA 3UCCA 1W3HA 3TA9A 5BRQA 2J74A 3N19B 4J3UA 5A6KA 4IX2A 2IPWA 3M0KA 5JQ9A 3M0HA 2PEVA 5TBOA 3ABQA 1UKPA 1RK5A 3BV4A 4ILSA 3M16A 2CLLA 2A4AA 1JRPA 2OGYA 3E49A 3WBEA 3H12A 2BTMA 4X0VA 1XISA 4CN6A 2XIBA 3UWWA 1KTNA 2IPGA 2WOIA 2BVDA 1W32A 1NDZA 5AHEA 3W25A 2WP6A 2WXDM 3VGEA 3RG6A 3DBPA 3OIHA 3KDOA 4BR1A 3NL2A 5ECUA 2ACQA 2VHLA 1O94A 4XZBA 4ATLA 3RRXA 4M52A 3TEVA 2W79A 3BAYA 4O17A 4WVXA 5BOOA 1ZNNA 1GERA 1TELA 3U6WA 2Q6ZA 1LT7A 4DRSA 2ZA2A 3TYZA 4N6EA 5DX7A 4J3WA 1PYFA 1ME7A 4UNIA 4QRNA 4E4PA 3HQOA 4MG4A 1AL7A 3N2MA 3CV2A 2PWUA 1BWKA 1S2AA 4XZIA 5CZTA 1VIZA 1QFEA 4TTUA 2WKLA 2G3IA 1G4SA 3GXDA 3CWHA 3EDEA 5D9NA 1ZJHA 3PJTA 1ZY9A 1Q8AA 4H7CA 2OLSA 3LTYA 2WHKA 3P62A 5F4WA 2LLEA 2PWFA 2I16A 1ZU8A 4ZOHB 1OFPA 2QF7A 3FDGA 3R4IA 1HGWA 3Q6JA 3MA8A 4JIRA 4B9ZA 4DX3A 3B4UA 1DYSA 1GVIA 3R11A 3REQB 2JKPA 1JRCA 1H5VA 4D6GA 4BWLA 5AKQA 4GZJA 1A50A 2HCVA 4XUYA 1W9UA 3BLPX 3L65A 2CDUA 1EA9C 5D8ZA 4DF1A 1MUMA 3IACA 4Q33A 1L9WA 2QUVA 4R9OA 4N9DA 3TONA 4WJEA 2XGIA 3PTMA 4K38A 4QNEA 3L5AA 3K13A 3TC7A 2FYMA 3T55A 4ADWA 4XWUA 3RCMA 5FEPA 2XZ9A 5E93A 1G6CA 3LZ5A 1OX4B 3CL8A 4F79A 1KFJA 3DAQA 1KQZA 7ODCA 2R94A 3GXTA 3QFBA 4A3HA 3WF3A 5GJPA 2WOVA 3FVDA 2G3NA 3V36A 1A4LA 1E5NA 4FX8A 4N4QA 4FF7A 1GK8A 5KVHA 3PPFA 4HNCA 4PTDA 1ENUA 3IJLA 1OD8A 4GVIA 2I9EA 2DZVA 1EC7A 1JVNA 1XRSA 1N5WC 2QYGA 4I3GA 2WANA 3WK3A 1JZ2A 3KTCA 4UQEA 2G3MA 4WEVX 1C9DA 2A3EA 3GIQA 1E4LA 4M1BA 3O2LA 2O56A 1FBAA 3GUWA 4C1NB 1AFSA 1DE5A 4DPQA 4EIVA 3PBWA 2DZXA 1NQKA 3P74A 4K8EA 2OTDA 2HE8A 2J25A 1U5VA 4A29A 1GJUA 4MMWA 3DFNA 3NM1A 3W1PA 3N2BA 1DJXA 3M0YA 1WDDA 3NQGA 3PNZA 4YVPA 2VNCA 1WOBA 5AVHA 4FXSA 4HTYA 1W1IE 1E0TA 1UZ1A 3EPMA 1UROA 1KM5A 5FL0A 4OVXA 4R53A 2GOUA 2V3EA 4JOMA 2YBTA 3NQAA 4APNA 4KFOA 4J28A 5AY7A 3I65A 1GOMA 3AXIA 2IKIA 3LM7A 3GC4A 6ALDA 1CLKA 2D20A 4Q8UA 3ETRB 2Y8UA 1TO3A 2BOGX 2FZBA 3EWBX 1XKJA 4XD5A 1SW0A 3H2FA 1UB3A 4IXXA 1WUFA 1PEZA 3PBGA 3UJFA 3W07A 4E4UA 4Q4SA 3OQEA 5LA0A 1KC7A 2VCCA 1VZWA 4EQSA 3LQLA 4JTEA 1R3YA 2PP3A 2WM0A 4FMVA 4O0QA 4ZE4A 3G0SA 4FPSA 3IEBA 1VFTA 2HNHA 4UTWA 1Z6KA 2NQ9A 4ZTXA 1H1ZA 3GNOA 2Z29A 1DJZA 2J6VA 3NGJA 2QJMA 1G01A 4HHHA 2XIJA 2CHOA 2P88A 2HMCA 3BW3A 2ZXDA 4GRSA 4D72A 4CNTA 2C7FA 1V08A 4A3QA 4GXMA 3ITGA 3LCXA 4ZXLA 5K7JA 2V2HA 4ZB2A 3ONCA 2FTPA 3MPGA 4NUWA 1GJPA 2WMHA 4QITA 1OC5A 2PLKA 2P0IA 3KLJA 3ITOA 5J04A 3ZLGA 1MEHA 1PZ2A 1UPMB 3MW7A 3LPPA 2PGEA 1SU5A 3WLOA 3NZPA 4BF7A 2JKEA 4O15A 4GO8A 2BBFA 4IGNA 1IGWA 3CJPA 3VNKA 3CYVA 4IFKA 3V18A 4HJWA 2WJFA 1N55A 4MZ8A 1T8XA 3AHYA 3LENA 1HL8A 1Q7ZA 4H9VA 4JFWA 5C8BB 4UTLA 4DBEA 3DU0A 3HG3A 3VDAA 3T0DA 2HWGA 5KZ6A 3FJLA 4YNGA 3QFAA 3BXWA 4MWAB 3PWGA 5U1OA 2Z26A 2C3CA 1X6NA 1UH2A 1ECQA 3F4WA 1EXPA 2F38A 4Q8MA 3A9IA 5FOOA 3CUXA 1TMLA 5EA9A 2X2GA 2UY4A 1GETA 4MJMA 1J18A 1OD0A 3VINA 1HVXA 2FDMA 3FY1A 1F3XA 5FF0A 3MHUA 2UV8G 4HK7A 4HCDA 4RZ4A 5ABFA 2QCMA 3MT1A 4W7VA 4HNNA 4A3UA 2YR1A 3PULA 1YTDA 1ELSA 2G97A 4Q4RA 2QUMA 2QUUA 2ZUVA 3ARXA 4AX7A 3WMBA 5BROA 3ZSSA 4X9YA 3SZ8A 4Q4MA 1YDVA 3G0XA 3N2XA 1V6UA 4PCPA 2DUXA 4I9MA 3VGHA 3WJZA 3TNOA 3GM8A 1BGGA 4JIQA 2NV9A 3WQWA 1F6YA 3EXRA 1EUAA 5GJMA 3O8AA 3DXIA 2V63A 1RLCL 4RK8A 3GE7A 5F4XA 3KBVA 3UR8A 3UXKA 1L2UA 3DG7A 2JF7A 3BL3A 3VNMA 1E6SM 4IIFA 5C2XA 3AIWA 4UMCA 3AJ7A 2DZPA 1JUKA 3P0XA 3BLLA 4JNZA 3LHWA 4KWSA 2QULA 1XBVA 3BW2A 4HCLA 1EHAA 1VYRA 1P0EA 5F2MA 1DNCA 3LOTA 1C29A 1QR7A 4YPJA 4BK9A 1LT8A 3C0QA 3GXNA 1S1PA 3HPAA 4JFSA 2NW0A 3UPWA 3VD9A 1B54A 5AFDA 3SI9A 2WMFA 3NSXA 4ZE5A 1ZHAA 4O1FA 4MPQA 4XAFA 1MUWA 2CLOA 3B8UA 3GH7A 4LWWA 4D6EA 1GESA 3WBAA 1H3GA 5D37A 2B7PA 3KVMA 4YWIA 1R3SA 2V3GA 1XDIA 4R7WA 5EMUA 3G8RA 3MP4A 3UXIA 4K6AA 1XRFA 1YMYA 5C9UA 1OYCA 4JTAA 1AK5A 4H6QA 4I5XA 3I7RA 2VL4A 2G41A 2A1YA 1WNOA 2WBGA 2F8QA 2E5DA 1H09A 2ZCGA 1UWIA 5I78A 3D9XA 2QCDB 3AIQA 2BSLA 4GE8A 3MZNA 1GG0A 5K4XA 3BAKA 2W55A 3VDBA 2CCRA 4J5NA 3UWQA 4KBXA 1R9YA 1YADA 3FAXA 5HR7A 3PG6A 1YQZA 2VWSA 3AIEA 3CV6A 4C6OA 1SJCA 4X3ZA 1K8CA 3W6LA 2R24A 1QRQA 4JFTA 2ZX6A 2Z1XA 1A5UA 1J6OA 3D3AA 1QTWA 1W5PA 1JFXA 5I00A 4S39A 1P0KA 3CTLA 3VZYA 2C16A 3L4TA 5JH1A 2RDUA 1O5QA 1QW9A 1QPRA 3W1UA 1JPDX 3VKCA 3RX3A 1XSJA 1V3LA 4UB9A 3HQ1A 4IQDA 3AYTA 5IDZA 4PGLA 5KMYA 4NKCA 3T4WA 3FA4A 3DFPA 3CHFA 5FS7A 2F6XA 3WLIA 4N9BA 2CYGA 3CBWA 1K1DA 1LL4A 2VEIA 2Q3OA 1UKOA 3GO2A 4C7FA 3T0TA 1YBQA 1OQFA 3W9ZA 3AXXA 3N3TA 4ZB5A 4YTUA 4I6VA 4EWJA 3WBWA 4CNNA 1S2TA 3FYYA 1KFLA 3L0NA 3ZYZA 2I9UA 3EOOA 1HN1A 3LMZA 2EQ6A 3WN6A 1AG1O 1ZJIA 9XIAA 2Z0IA 3LXBA 1UOZA 2WNQA 3KBJA 4WKAA 2VQUA 1ML1A 1XFCA 3DC0A 3W85A 3SO7A 4ZO6A 1ICQA 4I7VA 3KL5A 2OXNA 3BWWA 2B7QA 3RM9A 5D03A 3IANA 1VIWA 1BEUA 3WELA 1FEAA 1AJ0A 4JTHA 1JZ6A 4D8ZA 4V28A 1KB3A 3RM4A 3QMRA 4B2DD 4PN2A 3SQPA 1MZRA 3FXGA 4JIIX 2WMJA 4PEEA 2I1OA 3P5YA 1F61A 2AQOA 4PMUA 3TQ0A 4K1WA 2BNJA 3JW7A 1B57A 4HQVA 1X8FA 4GQGA 2UY3A 1K7XA 4ADUA 2J13A 3F4CA 4BV6A 2Z6JA 1OX6A 3BOLA 2YB4A 1M1BA 2VOMA 3QV6A 2VEPA 1ADOA 1EWDA 3VO0A 4MWAC 1XXXA 2GVGA 3MCMA 4NZ4A 4DJEC 4REQA 4XZHA 4C1LA 3GX9A 4UTTC 4OV9A 3SUVA 4V33A 2HEJA 4M80A 4HK5A 1TKKA 1TB3A 2HE5A 4QCEA 4JS3A 4BF9A 3TKFA 4ZO8A 3RU6A 1FQ0A 1GYNA 5HXMA 1MZHA 1YDOA 5FMHA 2NVKX 2QDEA 4YIWA 2QV5A 1QW8A 1AJ2A 3BCDA 4ZOCA 2Q8ZA 3AJXA 1TYTA 1KCLA 1ONXA 3STPA 1NH6A 4FAMA 5MKGB 2XFFA 3ALGA 5M17A 2QJJA 3H2NA 1YTEA 4PMZA 4EF9A 1GVSA 1LWJA 3LXCA 3W2UA 1UASA 5F2LA 3GBDA 3HO8A 2OJPA 1CGWA 4YVXA 3EDFA 4MWAE 1SGJA 1XF0A 3BMXA 3MUCA 2YCIX 4KFNA 1VCVA 1LLWA 3M47A 2W6RA 2DVXA 4O10A 2GRTA 1AL8A 1US0A 2XG9A 4C6CA 1LBFA 1HKMA 3PZUA 2ZTKA 2ATMA 4DJDA 2WWCA 3I7SA 3FA3A 3R1ZA 1EUNA 3WZ0E 5C6MA 4QAIA 3UZ5A 3M4HA 1F4HA 3MVTA 4LC8A 1ICPA 3VI2A 3KTSA 3E5BA 3VOHA 3WJWA 1JGMA 2WZIA 4DWSD 3W86A 1TWZA 2F6KA 1P0NA 3CPGA 1A3XA 3UETA 4WDTA 4IFOA 2ZUNA 4NJGA 3S2NA 2HXTA 2F61A 5K2ZA 2CLMA 4HMCA 1A49A 3GXFA 2X99A 4XIMA 1B31A 7TIMA 4EPKA 5F2GA 4AY7A 4LNYA 3TV8A 4CU6A 2ZOXA 1ICSA 2QCFA 3EAOA 3TXVA 1JDFA 3OLDA 2EF9A 1UZHA 1KGUA 1POKA 4FO4A 1GPWA 1VFUA 1WBJA 3N29A 2OKTA 1M6JA 5JCNA 3RYSA 4IZGA 3K8MA 2EG6A 4YN5A 1ZCOA 3E5PA 2OZ0A 5A6TC 4HPJA 4LV4A 3GR7A 3A4JA 5A69A 4LVFA 4Q7IA 3XISA 2WMIB 1VRDA 1JG9A 1BRLB 4GO9A 4Q8PA 2P10A 4H9ZA 1WOAA 4JYFA 3SR7A 1B3OA 2VKZG 1Y8BA 5FD0A 2YZRA 1E72M 1E15A 1QK0A 2Y2WA 2Y7FA 4FF5A 3P14A 3N6QA 1SYTA 4LSBA 1R38A 3TJLA 3CB3A 1JF6A 3ITYA 3LK6A 3WLPA 1LUCB 3SRHA 1SFTA 1PYMA 5CPSA 4O53A 4QDWA 1NWUA 4TTGA 2QAFA 3B40A 4DELA 5LXXA 3CIWA 4FX7A 1UBPC 1KFKA 2Z00A 3W72A 5FJJA 1LPFA 3O07A 2DSUA 3TUUA 1VENA 2ZYFA 3LADA 4LUTA 2BHUA 1MQPA 4XISA 1XS2A 4I5UA 3TW6A 1HFBA 5D04C 2DY3A 4UCFA 4MB1A 4FR6A 5I06A 4H4ZA 3SBFA 2DZSA 2HV5A 2J7HA 4HNUA 4ZQPA 5FIPA 2R1MA 1XW8A 1PX3A 1OF6A 4EPDC 1UD5A 2OSWA 3T08A 3U57A 1UP3A 1DXFA 1JPMA 1MVYA 4KPLA 4EMIA 2A6NA 4GI8A 5HWMA 1CW2A 3GVGA 4BI6A 4H7ZA 3VKJA 2E67A 4NZFA 1CEOA 5DY2A 4PMJA 4JFUA 3PUOA 1ZK7A 3A4AA 3TMLA 2DZWA 5EL1A 5LNVA 1BTCA 3WG6A 3Q65A 4JCLA 2QR6A 4DO7A 1PDYA 1FHDA 3CUHA 2A79A 1UIPA 4QS5A 3UG5A 3ABZA 1G1YA 2GFTA 1ZBKA 1GQLA 2XISA 3ONBA 4RNJA 1US3A 1MW1A 3VABA 4WSKA 1LBMA 2ZRWA 3MYPA 2PDLA 2J7GA 2QCGA 4GX8A 4OBSA 4LRSA 2QGYA 1LRQA 2WPFA 1TWDA 2YXXA 3M43A 2ZZ1A 1E6RA 3S47A 1CXIA 3H23A 4JTDA 1JPHA 4H04A 5H2ZA 4JHZA 5ABGA 1MDRA 1RJPA 1IZCA 3B3DA 2NV1A 2BY1A 1PDZA 4AU0A 4W8LA 1VBUA 2YCLB 2ZADA 3WD3A 3IK2A 4MTVA 5G5GB 1V4YA 5K9XA 3NPUA 5HMFA 6TIMA 1KRMA 1UQZA 1EIBA 5D8WA 5D2TA 3PWIA 5F1UA 2WO5A 3POCA 4W7WA 2E77A 1E1FA 4LUYA 3VGFA 3VIPA 2FKPA 3K5XA 2VDGA 2Q71A 3PZVA 2C3ZA 2F7FA 3R25A 1VAHA 3GVVA 4C6QA 4NJKA 4UQBA 5BOEA 2R1LA 1GOKA 1UYQA 2XJ7A 1CT5A 4PE8A 2YFNA 2GSEA 3LSBA 3V4BA 1CXFA 4XKYA 4M8UA 5CG7A 1D3GA 5FF7A 2ANUA 1XYBA 3IIZA 4RDWA 3HQPA 1R2RA 1U5JA 4Z2LA 7ENLA 3BC9A 3QLDA 1HKVA 4EOUA 5SWUA 4UQAA 4WDUA 2PGFA 1X8CA 3VIMA 5I02A 4MAVA 1I45A 1ZUAX 4R7OA 4GC4A 4CNUA 4TVWA 1KXHA 5H91A 1F8MA 1AA1B 1KGXA 3GDRA 1RBLA 1SZNA 1V3KA 2RDTA 1CXKA 1QHPA 3ZJKA 5LNUA 2VFFA 3GBEA 2R14A 3CTTA 1UOKA 5G4WA 4BEQA 5KZEA 1H7OA 1BF6A 1UCWA 3MUZ1 1XQKA 2D2HA 2X1UA 5C5YA 3G1FA 4D1JA 3SAZA 3EX6A 4XD4A 1E0VA 2AAQA 2XFRA 1BWVA 5TNVA 1XM3A 1D7KA 1R3QA 3SUSA 1S3HA 1SZEA 2ODOA 4A21A 1T96A 3UXAA 4MKVA 1DE6A 2VRKA 3FW6A 4D2JA 4MKNA 3O3RA 4PTWA 3VD4A 3MKCA 4MM1A 4O52A 3GXIA 2EPNA 4ADTA 1H7PA 1KA9F 3MWAA 4JTRA 3AYRA 1V7YA 4R34A 5DMYA 1SO6A 1TV5A 2PWVA 2W0UA 4DO4A 4OIFA 4Y8FA 2W92A 1IXQA 3BOFA 2GJXB 1E4IA 1YQ2A 5E70A 4LQ1A 5DCDA 2R9RA 2G3FA 1GRBA 2A3AA 1EXBA 1Q6EA 1GYLA 3KBWA 4RW3A 4TQTA 1QATA 1XHGA 4C6PA 1OFRA 2OWXA 3UVIA 3P8IA 1BVZA 2YW4A 3LSCA 3THDA 1B9BA 3UWYA 3GRSA 4ZSUA 1XQLA 3UNDA 1KBJA 2OX1A 5J5DA 2GGJA 2QPUA 2HVMA 4MUZA 2ZXQA 4R5EA 2ZZBA 3W71A 4EXQA 2BB0A 2PDXA 2ZKMX 4P8XA 4F66A 4LJ3A 3UNTA 3T05A 2ZZ0A 4H4PA 1P5BA 5D2XA 1Q6CA 1TPVA 3FG2P 2NXGA 5CSUA 4TR9A 5CC3A 1EJXC 4PULA 4S3GA 5I7GA 2ZFAA 4RE2A 3POHA 4HJFA 4B5TA 3WDIA 2MANA 3UQNA 3OQ8A 3KUMA 1JEHA 3IVTA 1C93A 1GQJA 1ITUA 2EPMX 3F03K 2DDXA 3L4VA 3GQYA 4C6MA 1KQYA 4IP7A 2C0HA 3B9EA 4HZMA 1TJ1A 5A2CA 1FCBA 3QR1A 4M3PA 3RJXA 3PZIA 3A23A 1WKFA 3GVWA 4Q3MA 3BGAA 1UBSA 5I07A 3B97A 4A2RA 1QCWA 2X42A 1V79A 1WO2A 5DANA 3A9BA 3APYA 2D22A 3G8EA 1HO1A 1BXBA 1JXJA 4MDPA 1TV7A 4WR3A 2G37A 3I3DA 3M6DA 3ARZA 2UWFA 4ECLA 3VC5A 4ROQA 1D7YA 3GR4A 4IMDA 5L9FA 1VS1A 1YEYA 3B0XA 3W53A 1JNEA 3LQGA 2CLKA 6PTDA 3HRDC 4IUGA 3WF1A 3VX1A 1JDEA 2OMAA 1WUEA 4C6LA 3PANA 1LP6A 3PG8A 4PCSA 1I0BA 1E56A 4KETA 1NOUA 4UIOA 4WGHA 2VX5A 2RHGA 3BG5A 2PBGA 4IFRA 5AC5A 3QC3A 1EJWC 3EWYA 4GGBA 1H2IA 1RQBA 1K4GA 3K4WA 4S3BA 4DNAA 5CPNA 2CETA 4XSLA 3UR5A 5CC7A 5EFFA 3N4FA 3WCZA 5FJRA 4IISA 3C52A 3HZ3A 3QV9A 3TH6A 3BZGA 3K46A 4IPNB 1AH0A 4C5YA 4NQ1A 4FLSA 2WOQA 3W1AA 2GVLA 3KRUA 6REQA 1TREA 4M51A 1OCQA 1GQIA 1OHLA 1B3ZA 4CLMA 2BY2A 1TSIA 5M1TA 2UY5A 1HJUA 4DBDA 3R0UA 4EANA 3A7AA 4J3ZA 4OQVA 4PCNA 4JNMA 4HA0A 3S1GA 2E6AA 3PM6A 5A3HA 1QI3A 4IMAA 4OWGA 4PMDA 3TTOA 3N13A 1W5OA 1XBZA 4FNUA 2PSNA 5HMDA 4IX0A 2WJEA 3W81A 4C60A 4AF0A 2Y4SA 1IGSA 3FKRA 3R0KA 2WPEA 1Z42A 3MU7A 3L2MA 4ZQCA 4ZA0A 4N9CA 1LG1A 5B7ZA 1VFHA 2QUNA 4F3HA 2OEMA 1E0WA 3D0CA 4NXSA 3NAVA 3AWNA 1FWHC 3IGSA 3O0FA 4FLRA 4A6GA 3WFLA 3GRIA 4C65A 3PJXA 2JF6A 3M5YA 3EXSA 5HQLA 2HQMA 2VZUA 3AZTA 1SSDA 1V0KA 3NG3A 1W1B1 1QOQA 1JCLA 4XVEA 3AO0A 2NSOA 2YA0A 1CXEA 3B03A 4GCAA 2WYSA 4WOZA 3A4WA 2X05A 1F74A 3AMGA 3FK4A 3L67A 1IR1A 4QIUA 3WBYA 4KCUA 4UBPC 1J0IA 4L4LA 1BQCA 3WQFA 1FHUA 2VGIA 3KM8A 4QDMA 1V7AA 2OQYA 4AZGA 4Q8NA 4TXEA 2YZ5A 2AMGA 3PZ9A 3AFBA 5FF3A 4G7EB 2P3EA 2INEA 1MXSA 5CPTA 2UY2A 2CBVA 1ME8A 3FXYA 3U0HA 2I5IA 3CQHA 1LCOA 4Q8QA 1W1VA 4QQ3A 4HBKA 5I23A 1XWYA 3EUB3 3NPWA 3L2IA 1Z44A 1VLIA 1C7TA 3B9NA 3SCVA 4HNVA 4C6EA 1RQEA 4DBWA 2DQXA 1ZFJA 3MO7A 3QQ0A 1CIUA 1WPCA 2XFWA 1FDYA 3QPEA 2PDIA 1FWTA 4RPQA 3STFA 2JGQA 3RLHA 2B4GA 3TN5A 1Y65A 1R9XA 2E3ZA 3TYAA 5D9OA 1TA3B 1GVQA 5FJOA 1WP6A 4H83A 4I90A 1RBOB 1BKHA 2OWCA 1FWFC 4OECA 3UGRA 4JYEA 3CEPA 4GUGA 2ONEA 1WCGA 1GZJA 3IV3A 3SGGA 1KBLA 3M5VA 3AXHA 2I56A 3QTGA 4X2PA 3P6LA 1FKXA 1XLKA 2WZMA 2GH5A 2BWGA 3G6LA 1CECA 2VEGA 4X60A 3RR1A 5LIYX 4EAYA 4MLRA 4BZYA 4GHRA 5F7UA 1X1OA 4XAZA 4GYJA 1A5SA 1KLYA 2JIEA 1A80A 1E1EA 1SFJA 1HJXA 4MOZA 1VBGA 3I6TA 4N7QA 2H8ZA 3I68A 3ERPA 3WENA 3BCJA 1UHVA 5AHNA 4IFKB 5M3WA 3EA2A 4XB3A 2Z24A 3V0TA 1IF2A 3AHVA 4EXAA 1EPVA 2JE8A 3UCQA 5A6AA 3QFWA 4NILA 1VPQA 4J40A 3IUDA 2Z1SA 4K3ZA 4H4UA 2XYLA 3A7RA 4XVDA 1WDRA 4ATDA 5B7YA 3N18A 4MNMA 4WLCA 1XH0A 5CZ0A 3R0DA 2E7FA 4QDPA 2WLYA 1GEQA 2FZ9A 2V5LA 2OT0A 3MI2A 1J10A 1HJWA 3NNTA 4B3ZA 3F2DA 3B9OA 1F3EA 1EOKA 3WF2A 4UTUA 3MZ2A 3LZ3A 4AEOA 5JIPA 4BWLC 4HB7A 3UG3A 3MBDA 2WPGA 2ZE0A 2PDHA 3T09A 4RPPA 4MFEA 3H53A 1C90A 5HPCA 3A22A 3GS6A 1OYBA 3EGJA 1F8WA 5D2VA 3HQNA 4DWDA 4S3JA 3EX2A 2WVSA 4KFPA 3KEHA 4S38A 4MJ4A 3VTRA 1WX0A 4JDYA 4QE1A 1YYAA 5CZSA 2BDQA 2X2YA 2GOKA 1UWUA 3VNYA 1EHNA 4GQQA 3NL3A 3CL6A 3CQIA 1SQ7A 4CNPA 2PS2A 1VCGA 4D71A 3UERA 3PTDA 3QGAC 3WH7A 1XIMA 1CLVA 2CLPA 3BPWA 2GL5A 5EMKA 3KVLA 5J5RA 4A8LA 3UJ2A 2V3FA 2PA6A 2J47A 3PUDA 4YHEA 3Q37A 3CT7A 4MY8A 3W7CA 3M46A 2QDGA 2VX6A 3MI6A 3CZJA 3N1AA 3KCOA 1X6LA 2OOGA 3DBNA 1SB3B 1ZL1A 2PAJA 4L7ZA 3M44A 4IJBA 4HNTA 1Q6GA 5G5HB 3KS6A 2R1PA 2J9XA 1EF3A 5CZJA 3WNLA 3EOUA 3WFAA 2EG7A 4NASA 3QLLA 3C0JA 1PWMA 3W7GA 5HBFA 2OU4A 4KCTA 1TE6A 3G1SA 3PFRA 5DBTA 4I8DA 8RUCA 1VDVA 3CPUA 5HA7A 3DK4A 3QHMA 1DWFM 2VR4A 4W5UA 4YS1A 3BTNA 4A22A 1UUOA 1JD7A 3W7DA 3PNUA 2ZIDA 3GTXA 4IPLA 3QV8A 1PO9A 3BSMA 4NSBA 3KOWA 1Q13A 5JCKA 1KM0A 2VC6A 3QMSA 3UZXA 3N73A 1HX0A 5HUOA 3MI3A 2GR2A 4KH2A 4MB5A 1S5WA 1Q6FA 1XUZA 3HIJA 2NQZA 2BHYA 3V5CA 3EXTA 2VC9A 1NTHA 1XYZA 1U30A 1IR2A 4H8UA 3HG4A 3DKJA 3W2KA 2OO6A 2PI6A 4JX6A 2NUXA 2OG9A 3THAA 5K3VA 1JOAA 2FH8A 1DIOA 3ZJ6A 1QBAA 4R33A 3SCSA 1CGTA 4NEVA 4KEUA 2QVHA 4UR7A 4Y7EA 3C6CA 1EJ7L 1AD1A 1AZ2A 5J8LA 1DIKA 2WVVB 2J7CA 1A5KC 2GQWA 1BYDA 4RNIA 5FJPA 3PY2A 8TIMA 2QIWA 5MHBA 2QV4A 1H61A 4HNOA 3ABSA 3MC5A 2RKXA 5A8PA 3DEQA 4MNJA 1DKWA 1V3JA 4OFCA 5CLTA 2VEFA 2XM2A 3CUFA 4A8RA 3F5LA 3E12A 4WDXA 3LCFA 1K9DA 3QW4B 5DMLA 1KWGA 3L12A 3GTHA 3NO1A 3BO9A 4DXVA 1V3HA 1NY1A 1X97A 2PDQA 3F5KA 2J79A 3SJNA 5A1AA 1WV2A 2NWRA 2EEXA 1FHLA 4G56A 5HULA 1QDSA 1FTXA 3JS3A 4HIBA 4D9PA 7REQB 1FFRA 3B4YA 4V15A 3V75A 3LPGA 4O16A 5C2CA 3IS4A 3PUGA 1TZZA 3W82A 2WK2A 4QGCA 1KBIA 5AC8A 1IQ8A 3OYZA 2X1TA 2BOEX 3LBMA 3O6AA 3BGGA 2FFCA 3DC8A 1PCWA 1VKFA 3OVQA 2Y8VA 1YPXA 2PTDA 1XRTA 1CDGA 1EX1A 3EDKA 1H50A 4DJFD 2PMQA 4ERGA 3WFZA 1XLAA 3B9AA 3DN5A 2NXIA 4FX6M 3RLVA 2A3CA 4ICNA 5C9ZA 4REQB 2PDPA 3J7HA 2DJXA 2X0YA 2PRHA 4JQAA 4Y9NA 1YIXA 3QHNA 4CU8A 2C71A 1VEPA 2JEQA 3S2JA 5E09A 1L8NA 4AD1A 2C8NA 4XBJA 1TTJA 3CGTA 4Q8TA 4H4YA 3P8JA 3VC6A 3TQPA 2DIJA 1JZ3A 3L4UA 1TJPA 4HPGA 3QTPA 2NWSA 1FWGC 3GUGA 4LYQA 2NV2A 1K9FA 3RK8A 1R8LA 1EA0A 2EGZA 1VFOA 1YXYA 3PZTA 2WCAA 5CBJA 1EL3A 2FTWA 4LB3A 1E6QM 4H2HA 1ADDA 4H00A 3S42A 4DZ5A 2QJGA 2EPLX 4IXHA 3GG1A 1ZDLA 3WEOA 4AHPA 4DUVA 2TRSA 4B4HA 3G1DA 1XBYA 4HYRA 3UT0A 1BYAA 1RH9A 5U4NA 3VPLA 2YDRA 3S1XA 4GKTA 4R7JA 4AG0A 3NIYA 2O4QA 3DFTA 3ZS4A 4W87A 2ON3A 1W3LA 4JKMA 1E6PA 1H0IA 2Y85A 3CUGA 1J8VA 2NXHA 4S1FA 3V1PA 4CD5A 1QBBA 4L4MA 3UA4A 2ZUSA 2ZZ6A 1XI3A 2CC0A 4PBFA 2IMRA 3T4CA 2V5BA 2D3LA 4OBRA 5C9XA 4H9TA 1UJPA 3RO6A 1TG7A 2YYTA 4LUIA 1UP2A 2EPKX 4LVAA 2EKGA 5AC6A 5DT5A 4CD7A 5M03A 3QZAA 3R58A 4DIAA 1R6WA 1S5NA 1UH3A 3KW3A 5K9DA 4DHGA 4E0CA 4H41A 1XLLA 2ZZCA 1WKYA 2NT1A 3SCTA 1UA3A 1GHRA 3O63A 1V02A 3TYCA 4NG3A 2AL2A 4UMBA 5A94A 4O1EA 3GB6A 3IUIA 1O1ZA 3UESA 3AYVA 5EPDA 4NU7A 2X40A 3HG5A 3EB4A 1NDVA 2Y24A 3UFYA 4NXKA 4AW7A 1VBJA 1X1NA 2O9PA 1F2JA 3ITLA 4DF2A 3NZGA 2QNEA 3SR6B 3N2OA 3T07A 3BJSA 1HT6A 3TLQA 1PBGA 1K6AA 1LWIA 2V69A 2VI0A 1W2VA 2G4FA 1X98A 2EJ1A 1N5XA 2V0TA 3A13A 4E8GA 1FFVC 2XHYA 1I2RA 1FRBA 4GR1A 1W8GA 2A0NA 1I8JA 4FOUA 3C2EA 2V2DA 3WLMA 1VFMA 3QYSA 2VC7A 4F4RA 2HTMA 1G4EA 1DL3A 3TYDA 4OBTA 1HF6A 4RR4A 1RPXA 4EQRA 3G24A 4H8HA 1SZRA 3FNDA 1TRDA 4MLJA 1XC4A 4XZMX 1OBAA 3OA3A 1K03A 4L56A 5E9AA 4K8HA 4PC8A 1BWCA 4J27A 3SADA 3CMGA 2VGBA 4GUIA 4Z08A 4JDRA 1ZQ5A 3DX5A 2V30A 4P8WA 1YE4A 2DU2A 3AMDA 4LAOA 2YVJA 1GT8A 2H90A 4M0XA 4UTMA 3CB8A 2V8ZA 5TIMA 3VIJA 3OHIA 3C5QA 1UKQA 5DRIA 1I2OA 3LRLA 4MFDA 1HKJA 2ZRYA 4YVVA 4GYKA 1ZZMA 3S2CA 4DO5A 3TOYA 1ZBVA 4ZEPA 3FJ4A 3S83A 3CLMA 4HHMA 4C6NA 3LERA 4R9XA 4PBGA 4L61A 3I6RA 2WVTA 3BICA 3GKAA 4ZVJA 2EO7A 1F3PA 1TX2A 3QGVA 4RNFA 1XIEA 1E43A 1T0OA 5FAGA 4YCOA 1UR3M 3ARYA 5G2HA 2YDAA 2ZRUA 3WNKA 4H4VA 3CU2A 1ZS2A 4YHGA 2X09A 5JU6A 4HOZA 4AX6A 3DI1A 3TIMA 1DIDA 1U83A 1YNQA 3SQLA 1Z7AA 3STCA 4JDBA 5BMXA 3H8AA 4PMQA 2BP1A 1XLHA 1C8QA 3QJAA 1YHTA 2INZA 3VMPA 1VB9A 5AVNA 3S2LA 4NRRA 3VD5A 2ZC1A 5E6YA 4FEZA 4PTNA 2VENA 3CAVA 4A8IA 3MMDA 3M41A 1P0DA 2Y5EA 5CJMA 4I6KA 2GSHA 2A3HA 3WQGA 2WB5A 4HU0A 5HWJA 2J7EA 3AMCA 4ZR8A 3W7HA 1J12A 3MKVA 3P81A 3GDLA 2OYMA 3H4KA 3TW7A 1NSJA 3S6OA 2ZUUA 1DV7A 3UWVA 1G4TA 4Y8EA 4DN1A 4PUNA 4JIEA 3G1YA 2GJPA 3TYBA 1C3FA 2VQTA 4AWEA 4O12A 4UNKA 2POZA 1ZBWA 4M6VA 4RXGA 1FCUA 1AQHA 3MJYA 3KTXA 1NOFA 3I3BA 1BYBA 3I3EA 1R5YA 4S3FA 2BVTA 1XIIA 2BOFX 3C56A 3DHFA 4M24A 4BURA 3R43A 5E0FA 2OZTA 3N12A 4A4AA 1RK6A 4B9YA 4YCPA 4GUHA 3ZWSA 5BCAA 4O4WA 4NAEB 2V38A 4UTIA 4DJDC 4E6MA 3FN9A 2QCEA 4PTXA 4UWMA 4HGXA 3W7QA 4Y9PA 3Q67A 4MY1A 4MY9A 2NX3A 5HINA 1GVOA 1Q63A 4PSRA 2OYLA 4XKYB 1OZQA 3LHTA 1RJRA 4S2CA 2QVNA 3QYQA 4FALA 4JIPA 2XVGA 2ISDA 2PZ0A 1PHWA 4AY8A 1E1CA 3DHDA 4GGHA 3WQVA 4ACZA 3FOKA 3MANA 3SRFA 3P80A 1B4KA 4EPBC 3OZYA 4ZXOA 3W1QA 2NPXA 1VC4A 2WLZA 4K1GA 3MMUA 3W76A 3W1TA 4B15A 3KRBA 1JR1A 4E3VA 4A35A 3ANYA 1B90A 1FXPA 2DIKA 3CGBA 4WIWA 1ISZA 4NIRA 3DESA 4W89A 4HNLA 2CNCA 4RE0A 1J79A 3WEZA 3LG3A 2XM1A 1EJTC 1F7BA 3THUA 1SMAA 1ECEA 1EJUC 4HP5A 1E9IA 5D05A 3DHUA 3DYMA 4NL1A 3ARRA 1UW9A 2ABAA 3WQDA 2NLIA 2EXOA 2OKOA 1M6IA 1EP2A 1KKRA 3CZGA 1V3MA 2VRJA 3DJGX 3MWCA 1XG4A 3AZSA 4CQAA 3S3GA 2CBJA 2GZXA 1F6PA 2Y61A 5BNKA 4GNKB 2XVPA 2QZRA 1HNYA 4O50A 2VOTA 2QQ6A 1W9PA 4CQDA 3K30A 3FGCA 5FSDC 3WUGA 1T5AA 2OPJA 4PUMA 1FWJC 1ONWA 1UD6A 2OEKA 3ABRA 3LLFA 2CBUA 1U33A 2KAUC 3GC5A 1D8CA 5CXPA 1YKWA 1Q7MA 1FA2A 5T26A 1DEDA 1PTAA 5XIMA 5A2AA 2A7RA 3LPOA 3M6YA 4H3DA 4UQCA 3W87A 4KRZA 4NVTA 1GONA 3PTKA 3M0LA 1CB2A 2OCZA 1LOLA 1ZX9A 1XSKA 3N34A 2YXOA 1E6NA 1DJIA 3SCRA 4ZODA 4U2ZA 2I14A 5DXYA 1HP5A 3QEZA 4DXXA 1VJSA 4CD8A 4UFLA 3LS9A 3P0WA 3AMKA 2CU0A 3HV8A 3TAOA 3E0IA 4NF7A 5BRBA 3NUKA 4F2BA 1AQFA 1KN0A 2PGWA 1UIOA 3TSBA 3SFWA 1OYAA 4GY0A 2BZNA 3VDGA 2XIMA 1EP1A 1JULA 2DZTA 1HGYA 5G2WA 4Z2JA 1ITQA 2XIOA 2YL5A 1EO5A 1ZENA 3H22A 1AMKA 1DXLA 4ZO9A 1NQ6A 1IT8A 3G3DA 2DSVA 3ZVHB 4RUBA 2DSWA 2BG5A 2FHCA 4PZVA 3QOKA 1V0MA 3LTPA 4NYUA 4BS0A 4FA3A 2Z6IA 4GA8A 4JEQA 5D30A 3W1LA 1JDCA 2F2KA 3QQ1A 4LAMA 4GJ1A 4DZHA 2G4JA 2IQ0A 4M82A 1BG4A 2IPFA 2I57A 4NP7A 3R12A 3BMWA 4LBUA 1SM9A 3D47A 1V03A 1Y5XA 4UFJA 4LNCA 2C3DA 3EA3A 3PP7A 2C91A 1TQXA 3REQA 2HS6A 3BQ6A 3DZ1A 1CTNA 4O18A 2VD9A 4H9UA 2MNRA 3BG9A 3TSDA 3ICJA 3NEHA 3URBA 4JTIA 2GGHA 4DO6A 3VM5A 2X7VA 4GD0A 5F2IA 2VUNA 1A3HA 3C2RA 2WBAA 1OJXA 3V16A 1GZ1A 3DH9A 3PAOA 2O7QA 3I10A 5IBXC 2BCPA 2YFOA 4QHRA 2PDGA 3I7QA 4YMZA 4I9AA 4FOJA 1GQKA 5A8NA 4GH1A 3E2SA 5AB3A 1OJTA 4LC6A 2VFGA 2CWXA 4AZ5A 4YXGA 4EVZA 4Y90A 3T7VA 1OX4A 2JQXA 2YKKA 1H11A 4OT7A 1CENA 2EKCA 3LEPA 3IJ6A 4B5XA 4JY9A 3U2CA 1XH2A 1GUVA 3OLGA 4HKPA 1G94A 3WQEA 1W31A 4PSPA 4POCA 1M04A 3GAYA 1XL9A 1PV8A 1CXHA 1EEXA 1TUFA 3ZVIA 4ASTA 1TYPA 3L23A 4K7VA 3VMNA 3MCNA 3LMYA 2PDNA 4IOTA 4FLOA 1ZB5A 3LD5A 5DRCA 1PSCA 3E0LA 1I75A 1JCXA 1X7FA 3B04A 2ZX5A 3QH2A 1KFEA 3OP2A 2J7FA 3M7WA 1JAEA 2J62A 1M01A 1UD3A 4JYDA 3UA3A 3UYCA 1Z69A 5CJNA 3CT2A 5F1VA 3VUPA 4JNYA 3FSTA 1T40A 3I4KA 3OA5A 1PKYA 4MIMA 3DGBA 2VZTA 1V77A 4GZEA 2DZAA 5JBFA 5EBAA 2YL9A 5DT7A 1ME9A 4YTSA 2XVKA 1XKYA 1XYAA 3SY8A 2Y62A 4O1DA 4F40A 1THFD 3NOEA 1XYLA 2Q02A 3VZZA 3M0MA 4H19A 1Z9AA 4E8DA 4JXCA 2J3NA 5KINA 3NVVB 1J6PA 3O1NA 1KFCA 3KWSA 4GY1A 4TVDA 3B0UX 3BK0A 1POJA 2WNNA 5FS6A 3HJEA 2DH2A 3P82A 3HTWA 3NURA 4DI8A 2Y6ZA 4CN1A 1DP0A 3IK4A 3VMOA 3QVQA 2BV9A 3MY9A 4ZQNA 1JYXA 1DQWA 3H70A 5A6LA 1OC7A 2VD8A 4HTBA 1JRBA 3RHGA 1V6VA 3GU9A 3D3FA 3WNOA 2FDSA 2GUBA 2O4MA 3DFHA 4WUIA 1RAKA 3CGDA 2BASA 2DT1A 2GWGA 2ZWYA 3PBVA 1NHSA 4U4MA 1M53A 3VIHA 1YXDA 2CPUA 1FOBA 1JYVA 1DORA 4KEVA 1DXIA 3NQBA 3VILA 2IPJA 4IL0A 4CNOA 4E5TA 5CBIA 4CCDA 1EF2A 1SR0A 3GNRA 2TAAA 2Z4GA 3N4AA 5EBUA 4J2MA 1U1HA 3PUEA 3D5HA 1OC6A 4LAUA 1RV8A 3W3OA 1O6IA 4KERA 3LU2A 2REQA 2E8ZA 2OWWA 3LX9A 3LHUA 4IMCA 1UUQA 5H8PA 3WQCA 3DK9A 4CN4A 3OBKA 1QNQA 1XG3A 1UC4A 2WZTA 1J01A 1GYMA 1C7SA 2FZDA 2H9AB 2WBKA 1D3HA 4ZGYA 4JHMA 1GOOA 2X50A 2Y63A 1S5VA 2QPXA 1UWQA 4F2TA 3W7EA 3T8QA 4OOZA 1QVBA 1RY8A 3PF3A 3VCCA 3CGEA 3EEZA 2FHBA 1AW5A 4US5D 4UOQA 1JAKA 3KBNA 1WDSA 1OT2A 4LUJA 3TYUA 4KESA 3RPDA 2UZ9A 1SFSA 3TU9A 4NNCA 1WAWA 3A24A 3CO8A 2V3AA 1PKLA 4QLJA 4FXFA 5BWAA 3VFLA 1Q3NA 1RA0A 1YNPA 4F0LA 2ZUTA 3QR3A 3HU7A 4HMDA 4IPPA 3M0JA 3RX4A 4KCWA 4MGGA 2GVJA 3O05A 2OEJA 2H3DA 5CCZA 1WZKA 3ZR5A 3NJ3A 4X61A 3QY6A 4DYEA 4W8AA 3ZJ8A 1ZBCA 4A8NA 3UPBA 3DJJA 2QMJA 1GEHA 1SO3A 1TJ2A 3EWCA 4IGHA 4ZB0A 1UR9A 4N02A 1XGDA 1RSCA 1R86A 1J93A 4MWAD 3BAJA 4MWAA 1XLCA 4P7OA 5C70A 4TX9A 4M29A 3OZOA 4DJED 1NF0A 1TR1A 4A3RA 3UWZA 1LLOA 2PU0A 3CHVA 2KX9A 2CHRA 3FYOA 1S2VA 4J1OA 4LS2A 3WQ5A 5CC5A 1XSIA 4EK7A 1SPQA 2XGBA 3KOXA 1XLMA 4W93A 1EQPA 1H7NA 3U5UA 5LHFA 1GNXA 2GGEA 4M6QA 4U5KA 2KZHA 4O19A 3NWRA 5A6JA 4LRTA 3KLLA 3PB0A 5FJTA 3W26A 2QAPA 3NPVA 5I03A 3ATZA 4A05A 3HN3A 1DJHA 4QSHA 4XUGA 3WLHA 5AZ1A 2I5GA 2HPMA 5JCIA 1XGZA 2W63A 4EXBA 3H2EA 2V3BA 2W54A 2PODA 2DSZA 4EP8C 3P93A 2YIHA 3NZQA 5I3HA 2ISSA 2X1IA 2QAEA 2IW0A 2WVUA 3SN0A 3PZOA 4TIMA 3ARSA 1KM2A 3THQA 1HL2A 3S2MA 3EB2A 1RHCA 4INFA 3PZGA 1FWNA 1K6WA 5D33A 3TXZA 3ARPA 1A3WA 1H62A 1GVEA 4IMFA 4E38A 3HFYA 1FP8A 1H1YA 3M0XA 5C7HA 3OEXA 3RU8X 1N62C 1WDWA 5KZDA 1JEZA 3WLNA 4WRHA 2IQTA 1PKMA 2G50A 1M7OA 3TOPA 3SURA 5EU9A 4MF4A 3TAKA 5CAKA 3O15A 2PDYA 3TW9A 2XH2A 2G3JA 4Q8WA 1A53A 3PC0A 2QGHA 3KHJA 3L0GA 4GVGA 4NZ3A 1E4MM 3IJDA 3FYPA 3QPYA 5KTLA 2VC5A 3IGUA 1V8EA 3FX4A 2BGSA 4FNRA 3NTYA 1EX5A 2E6FA 1OFEA 3PPCA 3H2MA 3K4AA 3NR0A 3LBOA 2HJPA 3WD2A 2GDVA 3LCHA 4XX6A 4IP5A 5CJ5A 1Y5WA 3A7UA 4OGZA 3GVQA 1IWPA 1H1NA 4H50A 3CV7A 1NARA 5CSRA 4WK9A 3OODA 2O92A 3VNIA 1CWYA 3H2OA 4IIBA 4ICCX 4HPXA 1YRRA 4EQWA 2HNEA 2DZUA 1LORA 2RAGA 4QEEA 4D8LA 4NX5A 3NGFA 4RKAA 3SFKA 1ONRA 4JBRA 3V1HA 2HK0A 1CPUA 2JGYA 1K70A 3V5FA 4M7TA 5D9MA 4PRWA 3STEA 4GQRA 3N11A 4IQEA 3KZPA 3N25A 4AD4A 2C1GA 4PB4A 1S46A 4XTDA 3CQ0A 5I79A 1HUVA 5E1QA 5FEXA 1MDLA 1DJYA 3OIXA 4AFYA 2TMDA 2OX4A 1C8VA 4V27A 3R2GA 3FLUA 4N42A 1YXCA 2QS8A 3LPFA 4PFHA 3CAQA 2POTA 1TWWA 1R87A 3GXMA 3W6YA 4ACYA 3IJQA 2WC7A 3GC2A 1AD4A 4LS0A 3S1WA 3LGDA 1DWAM 3RM8A 1O95A 2W3SA 3R07C 2YBVA 3F7JA 4M81A 4AHQA 1WYIA 2GUYA 2QKFA 3BAXA 4H9XA 3NSNA 4XZLX 3GG7A 3ZWTA 1IYXA 5LIWX 3VYLA 1I0DA 2XN1A 2A3LA 2RJHA 3NL5A 4Z2IA 3L5OA 2WSRA 3WLQA 1LVLA 4I5RA 5I5RA 2PPGA 3VFCA 4Z17A 1UR8A 3DFSA 4IMEA 5LXEA 1HJVA 4GK8A 1WZAA 4FOKA 1UD4A 4GVHA 1OVDA 3BSHA 1TTPA 3CASA 3FIGA 3AHTA 4LY4A 1EJSC 4ML9A 5LZLA 2XWDA 3WUEA 1MFVA 3L0KA 3G77A 1R7OA 3V0UA 2G5WA 4DPPA 5I0DA 1B4EA 4E3TA 1HJSA 2AQVA 3WH6A 1YPIA 1EC8A 4E2OA 2QPSA 5JCLA 2BY0A 2FH6A 3CC1A 3QKEA 4BKNA 1E6XM 2BODX 4BQ5A 4L1XA 5HJXA 1EGZA 3NO5A 2A3BA 2ZC8A 1IEWA 4L80A 3MCOA 1GV4A 3LHZA 2V6AA 3A47A 3CMJA 1JDAA 1TVLA 4IPJA 4OV4A 1V97A 5KETA 1VYSX 3Q45A 4YTQA 2WM1A 2X1SA 4LVGA 2AKZA 4AB4A 3TFXA 4FXJA 1TCMA 1MRAA 3O6CA 5HNRA 2O7SA 3BH4A 3RILA 1TTIA 1OB0A 3T9PA 4JCMA 4MJ2A 4KMQA 2Y7GA 5L6UA 1JROA 4UTHA 4JAWA 4S3AA 1NFGA 4KPRA 3IUHA 3N2CA 4B5SA 5CKSA 2PTXA 3VOJA 4HYVA 1K02A 1TMHA 3CEUA 2WWDA 3UXLA 3WH5A 3TR9A 2BX7A 4F48A 1SVDA 1LG2A 3AUOA 1EYWA 1JGIA 1FP9A 3GVRA 1JCMP 1FWSA 1VFSA 5IM51 5A95A 4UOJA 1Z32X 1VFLA 4QS6A 4B91A 3WMCA 5KEZA 4ES4A 2YAUA 9RUBA 1RVKA 3CUJA 5EMJA 1OZMA 2P1FA 4AMAA 4QFUA 1I2QA 5FS8A 1WE5A 3WMLA 5HANA 3L2LA 2YXGA 3T0CA 3LY0A 1OWQA 5D09A 4MB3A 4IM4A 4JQ4A 2VGFA 4DNMA 3EDJA 3GKFA 3IIXA 3NQCA 2Y5SA 5HATA 4DQWA 1CBGA 5ENLA 4KRUA 1TJ0A 2A6LA 3AROA 4JKLA 4NT0A 3OLIA 5BWFA 1X7IA 4E2BA 1E71M 4KS0A 3SGUA 3BCFA 3KDNA 5FAJA 4AWTA 2WP5A 1QI4A 3E96A 2W5FA 4KGJA 1FH7A 3HMCA 4LTSA 5FF2A 4AIEA 3ZIZA 4ZL1A 2BVYA 3LB8A 2HROA 4AZIA 3ARWA 3LXDA 1V6YA 2AL2B 1PL9A 3NS1B 4YU1A 1RZMA 3VNZA 3AXKA 3AHXA 2EQ8A 4FSAA 3USZA 1X1ZA 4B2DA 1A5LC 1G7VA 5FESA 3L4WA 3VE9A 1HKKA 3LB0A 5HOSA 4NZ1A 1J0JA 2WMIA 1WKDA 1J0KA 2CLEA 3SM0A 1NDWA 1F05A 2QMKA 3CAWA 4EACA 1G5AA 4OU1A 4JFVA 2ICSA 3W74A 3V0SA 2Y7DA 2VGGA 2AMXA 4PA8A 4X0NA 4Q22A 4ZOAA 1RALA 3JRKA 1UWRA 2PFHA 3GFYA 1EB3A 3W0KA 1GRGA 2VR5A 5D38A 4OJYA 3HURA 1W3TA 4I9TA 2CLFA 1LUCA 3CUZA 3NQDA 3S5NA 8XIMA 3RX2A 1RCXB 1XIHA 4LCSA 4PCTA 5D9PA 3CZ8A 5CPLA 2B81A 1TMQA 2V5CA 1KR0A 3NQ2A 1BGAA 2CHNA 3OBAA 3UZJA 4L64A 4XO7A 4WY0B 1JI2A 3OBEA 3W7LA 3S0CA 1HZYA 1MOKA 1XIFA 3O16A 2RH9A 2XSBA 2HVOA 4W84A 4WQ6A 3IC9A 3AHZA 4JHOA 4F0HA 4E8CA 4GKLA 3QW3A 1MWOA 3WSUA 1JDDA 2CW6A 2PP0A 5HQEA 4J9JA 4RNHA 5CGQA 4AAJA 3RAOA 1I9CB 2NVAA 4FLQA 1FWDC 3B0YA 1BD0A 3ORWA 3CH9A 4J3TA 3EF6A 4MAZA 2HRWA 3MHFA 3SUUA 3M5ZA 3U3HA 1GVFA 2YYUA 5XINA 5KITA 4UXDA 2DSKA 1FCVA 1I60A 2YW3A 3VIIA 4TU1A 3OOQA 1W3IA 3WD4A 2VP8A 3W7NA 2E5CA 3RLUA 2NUWA 2PWHA 2PLCA 2PDUA 4E4FA 4GUJA 2PZNA 3VCNA 4JGDA 1F5ZA 1NOWA 4Z0SA 3MB9A 2J9ZA 4D6IA 1BKSA 4DWSA 1S7MA 4B5WA 1X2GA 1T3QC 5KVIA 3A6OA 4UZSA 4ZQOA 5D4YA 3MDWA 2E1WA 3SQMA 4DF0A 2PDJA 3QY7A 1PX8A 2E40A 3E0FA 1F73A 2EQ7A 5JRBA 1ZMDA 1E40A 3W2LA 1GKQA 3SCOA 2ALDA 1AMYA 3F2BA 1W9DM 1EBDA 2G8ZA 4Z1BA 5DEZA 3LM3A 1N63C 1CGVA 2XVLA 3ECQA 3SDOA 5C7VA 4XD3A 2OSYA 2BC0A 1AOGA 4QM1A 4AEEA 1R46A 4CVUA 3QC0A 4G8TA 4QCFA 1U22A 4AMCA 3FS2A 1IIGA 4Z2HA 4ENLA 3ZT7A 4BF5A 1PVNA 2QCHA 3VX0A 1Y5VA 4H4IA 5FCZA 1JNDA 1M7PA 5EMLA 3KWXA 2AGTA 1G0CA 3HJZA 4QXIA 2ABBA 5AC7A 1TZ7A 2NQJA 2YQUA 4P8VA 1XH1A 3UR7A 2ASHA 3RXZA 4QJ1A 3UY7A 3SUTA 1W1PA 3UG4A 2WV8A 2GQAA 3C0SA 3WNMA 4TVYA 2GR0A 2QXWA 3W27A 2X8CA 3R13A 2TSYA 4H6RA 2Y70A 1XINA 2V5KA 4JD4A 3W00A 1TV4A 4PMVA 3AYSA 1XC6A 2PC4A 1MW0A 4L6OA 1J0YA 4AHOA 1REQB 4QJ5B 4HA3A 4LYKA 4PCFA 1AQMA 4GCXA 4AVNA 3RDKA 3QHOA 2X8GA 1E55A 3NYZA 2OQLA 1N8WA 2E4TA 3PSWA 1ITCA 4B16A 4FNPA 3W7KA 3ARUA 3APGA 1E3ZA 3DI0A 3AMZA 3ANVA 2D2JA 4F8XA 3CWOX 4EAMA 4O4VA 4AY1A 3R8RA 2YL8A 4NI8A 4ERIA 3DCPA 4GMEA 4EPEC 4H4RA 3GNDA 3TCEA 3U8GA 3LNPA 1ADSA 4RZ5A 4FDCB 4F0RA 3R94A 2WHLA 6XIAA 1GZGA 1LM1A 1O7AA 3V3WA 2PDKA 2XIQA 2ZXBA 3ZMRA 5EBKA 3DOPA 2W3RA 2E0PA 1H63A 4NZ5A 2ZRZA 3GSMA 3KS5A 4DM1A 4CQBA 2XH4A 4MJZA 4Y2WA 4KF1A 1V93A 1EC9A 4AZ7A 3ZQ9A 1E70M 1FDJA 5C9RA 3A64A 3HOJA 1XDMA 2Q09A 4PL2A 2JFEX 3FA5A 1O5XA 3FFSA 3MDUA 4RE3A 2VZVA 3C61A 1QWGA 4DYJA 4MNKA 4MZ1A 1JCTA 2F6UA 2YCEA 3KL0A 3T2PA 3W1NA 4JTSA 1A47A 5CC6A 3S5YA 4AQLA 2EHHA 1VFFA 1XJBA 4GIRA 1CXLA 5FKYA 2AOSA 4FNSA 2QIIA 3A3HA 4Z0JA 3FGCB 2VZSA 3ARVA 4W9TA 1L6WA 4B92A 5LSMA 3B0PA 3ITTA 4Z1AA 3H55A 1V02E 3Q58A 4GYPC 3CQJA 4KIEA 4UFIA 1OFOA 3W1XA 3SRDA 1ZMCA 3N04A 3T2OA 1WDPA 3FJ6A 4MUPA 2E1DA 4FX9A 2ZDSA 2IS7A 4KGLA 3SCNA 1V6WA 5A8MA 3WK0A 1H0GA 3HA1A 2VR2A 4L6HA 3RFAA 1QPKA 3KLKA 1LDCA 1Q1RA 1RR2A 2Z2AA 4R3UA 5LGZA 3W6MA 4UTJA 1XLJA 3HG2A 3NDOA 1Q4WA 2HQAA 4QJ4B 3B9JB 2BHZA 1XDJA 1HKWA 2H8XA 3W2NA 4D6HA 3WK1A 1JF5A 4AZCB 2XH7A 4IGSA 3RUBL 4P7QA 4WD0A 3VKAA 5BXRA 3KOFA 2QEZA 2TODA 2VELA 1T99A 1XX1A 3OB8A 3E74A 1DHKA 4PRRA 3NVWB 4ZQRA 3PN8A 4LUSA 2PLJA 4YTRA 3CYJA 3VAVA 1PKNA 2A85A 4N0RA 2ZTJA 3JR2A 1H41A 1VR6A 3IIPA 3LCWA 1NP2A 2J9YA 2OZ8A 4HU3A 1DWIM 1VBRA 2D69A 3TMQA 5AHLA 4AH7A 1Z8AA 1J9YA 1MFUA 4NJIA 4QP0A 4KKXA 5G5IA 5FSEC 2QJNA 3CIVA 3T1GA 3TQKA 3PB2A 1LTDA 3CMFA 1M5WA 1O4UA 2CIPA 2EQ9A 3E6EA 5I09A 4FNTA 2Z25A 3BANA 1BYCA 4G5DA 3L4XA 3KP1A 1F6KA 2PCEA 3AISA 4LF1A 5FJUA 5I77A 1KRCC 3TN6A 4NJHA 4PMNA 1G9HA 3CAKA 5IOBA 2V6OA 5PTDA 4EE9A 4CNSA 4Q7NA 3TTEA 4MPKA 3ZOAA 3GR8A 4US6A 1C8XA 2QCNA 1FKWA 1L6YA 2HISA 4H6KA 2WOWA 2PD9A 3LXAA 2F9RA 1WXZA 1Z41A 2ATSA 4LXFA 1S2WA 2J66A 3WDQA 3FVMA 3K1DA 2FJUB 3H7UA 1KR1A 1X6UA 2E9MA 3ELFA 3U4FA 2OLHA 4K37A 4AXNA 1CGYA 1SO4A 4ZCWA 1KGWA 3MV11 2YA2A 3WL1A 1SZGA 3HV9A 1FO4A 1ZSXA 3UF9A 4V1YA 1ZALA 4IIEA 2DQWA 2VX4A 4M56A 1J0HA 2DV0A 3SB0A 1S2UA 3RCYA 2O0TA 4C7GA 3L7RA 2GWNA 4LALA 1UH4A 4CCEA 1PCKA 1HW6A 1P1MA 2D0GA 1R2SA 1GHSA 3BGJA 3GLCA 3I4EA 4CVWA 3Q4DA 3UBPC 1Z3NA 3TTYA 3S6DA 2A21A 4RLIA 4XZWA 4ZZ9A 5C9WA 4XZNX 3INPA 1AJZA 4LBRA 3DIPA 2FVMA 2OSXA 4AWUA 3G22A 2PU1A 5DLCA 1SZFA 1IE7C 4UQDA 4L65A 3ZT5A 2NQHA 2XWEA 4F2UA 3HB9A 4YTTA 2NX9A 1S1RA 2HBVA 4CCZA 2PDMA 3CZKA 5EYWA 3BLFA 2W91A 4A2SA 4RJEA 4JTGA 3BW4A 1P7TA 3H6OA 1EZWA 3L8KA 1SUXA 3E9AA 3UP8A 2WMGA 3ALFA 5C55A 4G7FA 3ZSTA 1W17A 5LYRA 1H6VA 1E9LA 3C86A 2I7GA 5M2FX 1P6WA 3TCSA 4K8DA 4GOAA 1MXGA 4HSHA 4PBEA 4Z2KA 4G7EA 4HU4A 3W7PA 3VM7A 1I1WA 1IWBA 3A21A 3GDTA 2ZRXA 4AD3A 4R27A 1OFDA 1AUSL 3FHQA 2AAMA 2CXGA 4LT9A 3G6MA 1G69A 1WXYA 1JD9A 3HFTA 4LVBA 3W70A 1QWKA 2YOCA 4PTVA 2DH3A 3EKGA 3IAQA 4CGTA 3U2EA 3KCLA 1MNZA 1OIFA 3P2VA 3XIMA 2VX7A 3C8FA 4W86A 3NM3A 3NZ1A 2REQB 3R6IA 3RMJA 3JU2A 1GOIA 2J88A 1BZLA 1HJQA 4MZYA 1X96A 2ALRA 3CO4A 3WD1A 2RJGA 3ZM8A 2Z1KA 4OKDA 3K8KA 4NAFA 1TA3A 1W3JA 1S5TA 4KW2A 3HPSA 4DUOA 1B5TA 3CH0A </