4K8GA

Crystal structure of d-mannonate dehydratase from novosphingobium aromaticivorans mutant (v161a, r163a, k165g, l166a, y167g, y168a, e169g)
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
403
structure length
386
Chain Sequence
HMKITAARVIITCPGRNFVTLKIETDQGVYGIGDATLNGRELSVVAYLQEHVAPCLIGMDPRRIEDIWQYVYRGAYWRRGPVTMRAIAAVDMALWDIKAKMAGMPLYQLLGGRSRDGIMVYGHANGSDIAETVEAVGHYIDMGYKAIRAQTGVPGIKSLPSVTGWDTRKALNYVPKLFEELRKTYGFDHHLLHDGHHRYTPQEAANLGKMLEPYQLFWLEDCTPAENQEAFRLVRQHTVTPLAVGEIFNTIWDAKDLIQNQLIDYIRATVVGAGGLTHLRRIADLASLYQVRTGCHGATDLSPVTMGCALHFDTWVPNFGIQEYMRHTEETDAVFPHDYWFEKGELFVGETPGHGVDIDEELAAKYPYKPAYLPVARLEDGTMWNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Mandelate racemase/muconate lactonizing enzyme, N-terminal d
publication title Crystal structure of D-Mannonate dehydratase from Novosphingobium aromaticivorans mutant (V161A, R163A, K165G, L166A, Y167G, Y168A, E169G)
rcsb
source organism Novosphingobium aromaticivorans
total genus 142
structure length 386
sequence length 403
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4k8gA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4k8gA01
3TOYA 3UJRA 1RVKA 3VC6A 1MUCA 2XH7A 2OFJA 4HYRA 2AL2A 2GSHA 2PMQA 4A6GA 3VFCA 2AKZA 3DDMA 2PU0A 4KWSA 3N6JA 3PWIA 3H70A 3CK5A 2PP3A 3KUMA 6ENLA 2MNRA 1JPDX 4IZGA 4ENLA 4HPNA 4J1OA 3VCCA 2RDXA 3TWBA 1FHUA 2PSNA 1KKRA 3RRAA 2ONEA 1KCZA 4JN8A 3VA8A 3ZLGA 3NO1A 1NU5A 2QDDA 3ZLFA 3H7VA 1BKHA 5FJOA 2OZ8A 4DWDA 4E4UA 3DFHA 4K8GA 3DEQA 3CXOA 1MDRA 4ZA0A 2QGYA 5FJPA 4MKSA 3V5FA 3GY1A 4HCLA 3JW7A 3RO6A 4H83A 1TZZA 5FJUA 3MWCA 1E9IA 3CAWA 2P88A 3RITA 1FHVA 3ES7A 3ZVIA 2QJMA 3IK4A 3DESA 1TKKA 3SJNA 4IHCA 1DTNA 2OQHA 2AL1A 2I5QA 2OZ3A 2OQYA 3T6CA 3CYJA 4A3RA 3R1ZA 4HCHA 2GGJA 2POZA 2ZC8A 2O56A 1NELA 4E8GA 3OTRA 3DG6A 4K2SA 1W6TA 5ENLA 1F9CA 2PCEA 3BSMA 4G7FA 2FYMA 2DW6A 3MQTA 3DG3A 4M0XA 4GGBA 2HNEA 3TW9A 3I4KA 4FI4A 3Q4DA 4FP1A 4GMEA 3ENLA 3TJIA 1XS2A 3DFYA 3T4WA 2CHRA 4GYPC 1EBGA 3MUCA 1MRAA 3FYYA 2PPGA 5FJTA 3UXLA 2XH0A 3PK7A 5FJRA 3SSZA 3V3WA 3MKCA 3H12A 3DG7A 3R0KA 3PWGA 3QPEA 2PTYA 3TWAA 4HN8A 2GL5A 3ZLHA 2OPJA 1ONEA 3T9PA 4GIRA 3S47A 4M6UA 3CB3A 3IJQA 3SN1A 4IP4A 3FVDA 3N4EA 2GGGA 3EEZA 3UCCA 2PGEA 4EWJA 3OW1A 3SN4A 3DERA 3U9IA 2DW7A 1EC7A 2P8CA 4Z1YA 2OG9A 4KT2A 3R10A 2ZADA 3P93A 1SJBA 4F4RA 3THUA 2FKPA 4H1ZA 2OVLA 4K1WA 4GGHA 2QJNA 2PP0A 2PTWA 1P43A 4DN1A 2OZTA 3V4BA 1EBHA 3GO2A 3PFRA 3S5SA 3SBFA 4KEMA 1TE6A 3RCYA 1ELSA 1SJDA 1WUFA 4IT1A 4DHGA 1JDFA 3D46A 3N6HA 3P3BA 3ZVHA 3DGBA 2QDEA 4JN7A 3IJLA 3V5CA 4A35A 3I6TA 1SJCA 3B97A 3TQPA 3UJSA 7ENLA 2HZGA 3SN0A 3STPA 4HNCA 4HNLA 4MGGA 5EU9A 2PA6A 2QJJA 3OP2A 1R6WA 2AKMA 2PU1A 3TCSA 1EC9A 3TJ4A 3FV9A 3HPFA 5BOEA 1JCTA 2HXUA 1PDYA 4MMWA 4HCDA 1SJAA 4Z17A 2XH4A 3T8QA 3QTPA 3MSYA 2OLAA 4YWSA 3BOXA 3CT2A 3N4FA 2GGIA 1MNSA 3VC5A 4H2HA 1PDZA 2P3ZA 3MZNA 3MY9A 3QKEA 3GC2A 4GISA 4DYEA 3NFUA 4DXKA 2OO6A 4ROPA 4ZCWA 2HXTA 3I6EA 3FJ4A 3H8AA 3QLDA 2QQ6A 3RGTA 2NQLA 2PODA 5IDZA 2PGWA 3R0UA 4E6MA 1R0MA 5BOFA 3VDGA 3OZYA 2GGEA 4H19A 3BJSA 1P48A 1KD0A 3ZVHB 2MUCA 4IL0A 3JVAA 2QVHA 3RR1A 4IL2A 4KPLA 2PTXA 3UJEA 4IP5A 3ES8A 2XGZA 2OKTA 2GGHA 4DX3A 4G8TA 1EC8A 3EKGA 4J3ZA 2XSXA 3UXKA 1IYXA 1JPMA 2P0IA 4E4FA 3Q45A 1KKOA 2P8BA 3OPSA 5J04A 4E5TA 1XPYA 1WUEA 2GDQA 4X2PA 3UJ2A 3U4FA 3R11A 3P0WA 3FXGA 3TTEA 1L8PA 3FCPA 3IJIA 3D47A 2PTZA 4JHMA 2XH2A 3UCDA 3NXLA 3NZGA 2AL2B 3QN3A 3DIPA 3UJFA 3K1GA 4GYPA 1BQGA 1OEPA 2PS2A 3SQSA 2PP1A 1MDLA 3OZMA 4GFIA 3VCNA 3UGVA 1YEYA 3JZUA 1ECQA 3GD6A 3R25A 2OX4A
chains in the Genus database with same CATH superfamily
4JTGA 1K6AA 3SY5A 3SGZA 2YDAA 3RLHA 1O1ZA 3VC6A 3I3DA 2XH7A 2J88A 2WSYA 1A5AA 1PX8A 2CFYA 4NASA 4GI6A 2ACRA 3CGDA 1GOQA 1WYIA 1YNPA 2W61A 3H24A 3BCJA 4K68A 1VC4A 3M41A 2ZX5A 3VNIA 4OHQA 2CZEA 3KVJA 2XIMA 3GAYA 2PRHA 5LNVA 1V3LA 4ENLA 4LF1A 3GC4A 1P7TB 4D6IA 2I57A 1FBAA 3QRHA 4PL1A 1V6WA 5CSUA 3C56A 3M0ZA 3GLCA 2W3ZA 3C0JA 4RJEA 4W93A 3DFSA 4B91A 4RDVA 4MB1A 3ZLFA 3W00A 5FF4A 1RK5A 3W7HA 3DFHA 1UKOA 5E0CA 4H4UA 1UR2A 2DT2A 2PC4A 4K6AA 5ECUA 1WKEA 1AD4A 4EAYA 2WYSA 1Z42A 1DHKA 3WIJA 4QP0A 4BURA 5FF2A 1YMYA 2WK2A 1ZENA 3RITA 2RKXA 3M0HA 3ARUA 2NXHA 4F0LA 4V1YA 1IWPA 1HVQA 4QG8A 2I5GA 3CH0A 4NJGA 2C7FA 1X2GA 3UWUA 1LOSA 4LYRA 3PJWA 1CGTA 5TBOA 4DNAA 1SB3B 3O07A 4QDPA 2V67A 1R3RA 4A3RA 3KVKA 1XC4A 4JTUA 4S3CA 3IC9A 1CXKA 2V2DA 3UWZA 1EDTA 3DFTA 1YKWA 2ZUTA 1ADDA 5ENLA 1XLAA 4ZO6A 4XD5A 3I4EA 3KBJA 2VGIA 3NOEA 3HJEA 3FSUA 1FECA 4V15A 5JH2A 2NQ9A 4AH7A 1XFBA 3UZZA 1K7FA 2FTPA 3I4KA 3S4TA 1XLEA 5BCAA 4P8VA 2DDXA 3W7JA 1TPFA 2QCFA 1E55A 2Z1WA 2QNEA 4XZHA 3T4WA 1HG3A 2WC7A 1FVPA 4KWVA 3BXWA 3UYCA 3LXAA 2HBXA 1EIXA 3KS5A 5D30A 2CXGA 5CLTA 4OQVA 5XINA 5A6MA 2Z7KA 1S5WA 1VFSA 3NSMA 4KIEA 1XLBA 4PA8A 2CHOA 2GL5A 3K4AA 4CCEA 4CNOA 1UWQA 5HK4A 1QPQA 4UTWC 2V0TA 3IJQA 1XLHA 3LU2A 3FNDA 4DO4A 3M64A 1V0LA 2VX5A 2GJXB 4IQJA 1R87A 4UTUA 4DM2A 4UCGA 3NL2A 4CNUA 2YL6A 4H7CA 1A49A 1BZLA 2PGEA 4BKNA 3SN4A 4ZQOA 1OWQA 5HNUA 2V69A 5AC4A 2ZUSA 2IQ0A 4Z1YA 3L4YA 3U7VA 4MDPA 2OG9A 1WO2A 4C91A 1EJTC 4P8UA 2IPWA 4DJDC 3QV8A 2VD8A 4XSLA 1AL8A 3TX9A 1VAHA 4GGHA 3Q94A 4C7FA 3RJXA 4WUIA 1AUSL 1EBHA 4H4QA 2OYMA 1R7AA 3P67A 3OVQA 3NA8A 2FPYA 3S6DA 1UG6A 3PTDA 5T9CE 1K1DA 3OG2A 3PY2A 4DLMA 2IS7A 4K1GA 4A8IA 3BG3A 2RH9A 5D2YA 3CQKA 2XIIA 4GUIA 2NX9A 5G2HA 3WX7A 4GUFA 2PLJA 3TQPA 5BXRA 1M68A 1ZHAA 2I5IA 1DL3A 1WBJA 3RHGA 1R47A 4UBPC 3UWVA 3FEQA 2H9AA 1SVDA 1J8VA 3HGOA 2BGSA 5C2CA 3EEGA 1E0XA 2CHNA 1ADOA 1E43A 5HBFA 1VCFA 4LCSA 1E4IA 5HMFA 5D8ZA 3AYSA 1O66A 2BY1A 4A22A 5A2CA 1OX6A 3PS7A 3GWQA 3VC5A 1J0IA 1W37A 2PLCA 4RXGA 3GH7A 4GISA 4U2ZA 3GH5A 5C8BB 1M01A 2WNQA 1D2KA 4I5XA 1RM6B 4KMQA 1UPMB 3FN9A 3SCOA 3ITTA 3C5QA 2QCDA 1OYAA 5CSYA 4L9ZA 4AWSA 4IIFA 1XJBA 2AOSA 2WMIA 1Q6CA 3GG0A 4D6JA 1UD3A 5H6HA 3FAXA 4DWSB 3POHA 5GJNA 3WMBA 1JOAA 5XIAA 3OZYA 1MQPA 3O8AA 4X61A 3OB8A 4AWTA 4CQDA 1QOPA 5AC6A 4M82A 4F8XA 2J78A 2QLYA 1M7OA 3M7SA 4WIWA 2WZEA 1Z44A 4O18A 5FF7A 3U48A 3CL8A 2OX1A 2YJQA 4US6A 3APTA 3GRSA 3CZJA 3UWEA 1KCXA 1U5HA 1RY0A 1LBLA 4YYFA 2PDNA 1SPQA 3ALGA 1X8FA 4J3XA 3PAJA 4GYFA 4U10A 4G8TA 1AW5A 2GJRA 4JXCA 3ME3A 4PGLA 4W9TA 3UXKA 1TCDA 1UR8A 4HYVA 4WVXA 4L64A 3B04A 2P8BA 3OPSA 1QOXA 1M03A 1TV5A 3W82A 2YA1A 1TYPA 2WJDA 1VFLA 3SRKA 2QMJA 3C3NA 2HVNA 3I68A 2HEJA 1VFHA 5EPDA 4H9ZA 3HURA 2PTZA 1OM0A 1G4EA 2PWHA 1Q6LA 3VI2A 1IEIA 4AMAA 3BW4A 4F0KA 1BQGA 1XLLA 3GXTA 3KBVA 1T5AA 2VR4A 3MPGA 4GFIA 2VRQA 3WKZA 3K8KA 2E9BA 1MOKA 3W6LA 1N2VA 2DSUA 2TYSA 4ZEPA 2HS8A 5I6SA 3B9DA 4L6DA 1KB3A 2UY4A 1VPYA 4IPLA 3MKVA 4ERGA 4EMIA 3CUGA 4IJBA 4IM4A 2Z2BA 3GE7A 3UQNA 1RPKA 5HANA 1RD6A 1LLZA 2OLSA 3IV8A 5G4WA 2Y70A 4WHBA 4GY0A 2FZNA 3S1UA 1H51A 3JUGA 4O1FA 3TMLA 2E6YA 3NCOA 3K13A 2VL4A 3WQ6A 1G67A 4EX4A 4EM4A 1IT7A 4EXQA 2QUNA 5CGMA 3O0FA 1Q6RA 3MO4A 2TPSA 1H7XA 2NVAA 3VCCA 2PDPA 4H9VA 2IXVA 1SW3A 2XSBA 4HGXA 3HPSA 5A2BA 1Z3NA 3N2TA 4W86A 3CASA 3EOEA 1C7SA 1MQQA 5HOSA 1DXLA 2J24A 3W07A 4ZMGA 3HTWA 4H3DA 3FIGA 3WBXA 4AD3A 3CPRA 1JDAA 3PBGA 3A22A 1JPIA 2ZVIA 4MWAC 3W26A 1NF7A 1CNVA 3WFZA 2YB1A 2CLPA 2YBVA 3BURA 4H9TA 3ZWTA 5CC7A 4H8NA 4YN5A 3UF9A 3CQJA 5D2TA 1TZZA 1O5KA 1KM0A 1GUVA 3KCJA 1DJGA 3N11A 4O8AA 1KV5A 3E9AA 4O1AA 3DESA 4AB4A 1QAPA 4IHCA 1ZGDA 4JDYA 4I9JA 4UIOA 1PBGA 1OG6A 4UQBA 3F1QA 3GDBA 2QV4A 2E6DA 1E1FA 4D8LA 4QLLA 5LKYA 4ZB5A 3N6QA 3B03A 3BSMA 3U2ZA 2Y4SA 5JCMA 3MHGA 1FHDA 3TUUA 3T08A 3GB6A 4XAYA 3LRLA 2R6OA 1EOMA 4YHEA 3L4VA 2HSAA 3VGHA 4OU1A 2HDJA 3C2FA 3VTRA 2C1GA 4QITA 3ARPA 5BYWA 3TNOA 3MO7A 4NP7A 4MKVA 3SADA 3CAVA 1G1YA 1XYMA 2EQ9A 3W1MA 4LIIA 4F40A 2A1YA 4OOUA 3VUPA 3OA3A 4GX9A 4QAWA 4AWEA 5A6SA 2UZ9A 3H2EA 8CGTA 3LPPA 4QJ1A 1NQKA 2L5HA 1V77A 3IIVA 2EPHA 4UFLA 2J7HA 1GJWA 1CLXA 1GORA 3HG2A 2WMHA 3DJJA 1D7FA 1VCGA 2G3JA 4QX4A 1WDWA 3AFBA 6CGTA 3GR7A 3SN1A 3TQVA 1FWDC 1X8CA 3A4JA 4AY7A 2YB4A 1M04A 3V0SA 1EJWC 2RFGA 4REQA 1D7YA 3EEZA 1XIMA 1V8EA 2V63A 3AMCA 1L6SA 1Q7ZA 1M9HA 3DERA 2PDQA 3PFMA 2BXVA 3S3GA 3H2AA 1FRBA 1OCBA 3MI3A 3WMCA 2PD5A 1H7OA 3NURA 3H23A 3CZGA 2WCGA 3P93A 3TTOA 1ZPTA 4LAOA 1Q63A 1OJXA 2QJNA 4MJMA 3GVWA 5K4XA 1P43A 1PKNA 4PUUA 5HWMA 5ABHA 2QCNA 2H9AB 3LBMA 2OKOA 1NY1A 1S2AA 1TE6A 1E3XA 2XVNA 5D05A 1VRXA 2OYLA 4DJFA 1UKPA 2NX3A 1BVNP 2J77A 2EPLX 2FGBA 2HCVA 2GQ8A 4WJ8A 1LG2A 4E2VA 3AZTA 1YIXA 3TXVA 1QT1A 3W29A 5BNKA 1T7LA 3A4WA 5M5DA 3V5CA 4L56A 1GOOA 1K4HA 3LZ5A 5JVLA 2VXNA 3WUFA 2Q8LA 4GNVA 2YW3A 4F2BA 2HS6A 3ARQA 4KFPA 1TJ2A 4PTWA 2WMIB 1NDZA 1NVMA 3LOTA 4CEUC 2DUAA 3QY6A 2E40A 1U5JA 3UG4A 3BAJA 2OLAA 2FZBA 3WQ8A 1KBKA 3WD4A 2DT1A 3W7EA 1JXJA 2WAGA 3HQOA 4I8YA 2P3ZA 2WB5A 1H0GA 4H4PA 4O15A 3OO2A 1P6WA 4NY2A 4BQ3A 3EWXA 1LWJA 3ISIX 2E3ZA 3SW6A 3BLLA 3M0YA 2Y85A 5GPRA 3ZS4A 4M29A 4P61A 3QQWA 4LYKA 1V5XA 4MLRA 3TA6A 2NUXA 3D0CA 2J47A 3VD3A 4HJFA 2QCEA 3TAOA 3A7UA 2UY5A 4M51A 1H3GA 3FDGA 5I3GA 3F2DA 4E6MA 5D4YA 2Y61A 1DWIM 1WZLA 3O15A 2QZRA 1MW3A 1QOQA 4P2VA 2G96A 1GXFA 2CLIA 1KD0A 3O63A 1IWAA 1BLIA 2E5AA 3NL3A 3DBPA 3CB8A 1UQZA 1ISZA 4EKJA 4F0RA 1MYRA 1K77A 2PTXA 2ZTJA 3MUY1 1PTDA 3OHMB 4Z0JA 1TCMA 1RHCA 1JVNA 4LT9A 1GV4A 1K02A 2ZX9A 3K1DA 4Q4MA 1FFRA 1JPMA 1GVIA 3V0UA 3H7RA 1BAGA 5CG0A 2HBVA 1CZ1A 1K6WA 3UXAA 1V4YA 3USZA 2NX1A 4AC1X 3UJ2A 3F4CA 5M03A 4UTFA 4B5VA 3WDRA 4CKQA 3ZOAA 2VZVA 2ZKMX 3D47A 3IAQA 3UY8A 4C1LA 2VGBA 5JCLA 3IUDA 4L5ZA 2J7FA 4LVBA 3IVSA 3BTNA 4EQRA 1PZ0A 4JFWA 3CV2A 3ARRA 3PTKA 4HMDA 3H55A 3VCNA 2G3NA 1IXPA 5LIXX 4J2MA 3L0GA 3W1XA 5E9XA 2CFFA 4M1BA 3G8RA 3UXIA 4U3CA 3R25A 1MXSA 3RUBL 1M7XA 1UJQA 3T05A 5IXEA 4A8LA 1FP8A 5C7VA 1QBBA 2XIBA 4GZIA 1ITCA 1AQFA 1KXHA 2PEVA 3JU2A 3QZAA 2QKFA 3BLKA 2ACQA 3VNLA 2J9YA 1SZRA 2NV1A 2PMQA 3GU1A 3NGJA 3MS8A 4AC7C 4IJCA 3N6JA 2XU2A 3SZ8A 1SZFA 3IVTA 5E6YA 1UBSA 3ITVA 3QSRA 1JXKA 6ENLA 4FNSA 3T0BA 3IRDA 3UA4A 4HHPA 2B0MA 3PHAA 3S9ZA 3F4VA 1H11A 3O05A 1L6GA 2OWXA 1CECA 3ZXWA 2OT0A 3WNPA 2B7NA 1EX1A 3GKAA 4Z2LA 1T96A 4C6OA 1A5LC 4LS1A 4Q7BA 2V2HA 4LTSA 1P0NA 4GWEA 4XQ6A 5AVHA 4Y7EA 2OB3A 1OJTA 3LG3A 3IEBA 1TPEA 4N4QA 4BY3A 2XJ7A 2RDUA 1UWSA 2Y7FA 3AO0A 4DWDA 4XISA 4S3JA 1MZRA 3NEVA 2B4GA 4I7UA 4C60A 1CYGA 1DWFM 2RGMA 2OSXA 2NPXA 1CXFA 5LIUX 2PBOA 1Z89A 1FHLA 1LP6A 5FJUA 1QTWA 3N9SA 4HK5A 1BWVA 5I3HA 1TUXA 5GQBA 3SUWA 2NLIA 2Z7GA 2OQHA 4V27A 3H2CA 4AHOA 1SGJA 3CYJA 1D3GA 2GYIA 1BWKA 5AHFA 5GNYA 4PBEA 5A8QA 2OWCA 5CC6A 1WDRA 2H6RA 3SUTA 4DWSC 3LZ3A 2F6KA 1XDLA 1J79A 1GOKA 4LVDA 2DW6A 1HVXA 5JCKA 4H4VA 1DE5A 2X0HA 4PTVA 5AHEA 3WEOA 3DENA 4PFMA 1R3WA 4H8UA 2ZRXA 3TSDA 3W7RA 3ENLA 5CJMA 5FAJA 3UT0A 1VEOA 3NVWB 1PIIA 2C8NA 4TUFA 1ITUA 2Z1VA 4TVYA 5E9AA 1S2VA 3HMCA 3QFEA 5CGTA 4GQQA 5KZDA 3W2NA 2VI0A 3MUAA 4PEKA 1B1YA 3L0NA 4CN1A 1E6ZA 2PTYA 1JCXA 4H9XA 5BU6A 3T9PA 1ZK7A 4RPQA 1NFGA 4JTAA 4JCMA 3UG5A 1IV8A 4B5SA 2ZX8A 4K37A 1J2BA 1UA7A 4X22A 2YIHA 4A8RA 1EYEA 2ZXDA 3UCCA 3DFPA 3L4WA 3TC3A 3WFLA 4AG0A 2GUYA 1WE5A 1BSIA 2UY3A 3ITGA 1E56A 3LSCA 4Z42C 5BMWA 2PURA 3THUA 1JYVA 3DUGA 3MW7A 4K1WA 4BQ4A 3EMQA 2DUZA 3LA4A 2OZTA 3WNKA 3W7CA 3CWNA 3WH6A 3PR2A 1P1XA 2QIIA 5DELA 4YWOA 2X09A 3SCVA 1LUCB 1TMLA 2FZ8A 3VXGA 1HGYA 1OD8A 1CBGA 4H00A 2SFPA 3WLMA 3W7KA 3GZAA 1PTGA 3P3BA 1DWGM 6PTDA 1UD6A 5BRQA 4G7EA 3W2KA 3R6IA 1QO2A 4U31A 4FIQA 3N9RA 2PDWA 4W5ZA 4LXFA 4M7SA 1N60C 3NQGA 2C3ZA 1DQXA 4S2BA 4NYYA 2G8ZA 3KTCA 2G5WA 4F9DA 4C6NA 2E3TA 3W6YA 3LM3A 1PWMA 4CCCA 1J10A 4PBGA 4FXJA 3I3EA 3EA3A 3EX6A 3N4FA 3A4AA 3SCNA 1UOKA 2JQXA 4AX7A 4OBSA 3SUUA 2EGZA 5JXQA 2XINA 4KW2A 3QZEA 2G97A 3LI0A 4DYEA 3GNPA 1E6XM 1KFJA 1Q65A 5IDIA 5KTLA 3L4TA 2VRJA 1KM5A 3AN1A 3OOQA 2OO6A 1TV4A 3MKKA 3I6EA 2CU0A 2C15A 3GTFA 2VQTA 3STFA 3R8RA 2JE8A 1UZDA 3LERA 4O1EA 3DN5A 3RPMA 3WH5A 5C55A 5CJNA 1K8YA 3WQCA 3WLLA 2B7OA 3MVIA 3VDGA 1JGMA 3V75A 2IKGA 1HN1A 4AFYA 1S39A 2V6AA 2CZVA 2VQUA 1US3A 2BCPA 3AXIA 3CHCA 5FL0A 4GA8A 3G8EA 1F07A 1NDVA 1CGUA 5BOOA 1XGZA 3GVGA 4H6KA 1PIFA 8XIAA 4JTJA 2EHHA 4BF5A 2EG6A 3FA5A 3HGRA 2YYTA 4JYDA 3N04A 4R27A 3EKGA 3EAOA 1SMAA 3SR6B 1UWTA 4Q8NA 3WUGA 4WY0F 4Q4SA 3C2YA 3NL5A 3GNRA 3NPWA 4PUJA 4HU4A 2C16A 3OQ8A 3CIVA 4YVPA 1TZ7A 5CAHA 1LBMA 3KOZA 4C6KA 5BROA 3DC8A 3G3DA 1RSCA 3UCDA 3NXLA 4M6PA 3ARYA 1GQJA 1O94A 3E74A 4UNLA 3RX4A 4MZ1A 5LIYX 1GOIA 3DCPA 1RD5A 3LN3A 3PB2A 3WJWA 4JX6A 4NX0A 4PTXA 5RUBA 3EMCA 2XTKA 3CYVA 4L4PA 3VD4A 1JR1A 3H7UA 4ZXOA 4NVTA 2DVXA 3GD6A 3KZSA 1V3IA 1AH0A 3UBPC 3W7NA 2WVVA 3F4DA 3RLUA 5E0FA 3O6DA 4BA0A 1XYCA 3P8IA 3WQGA 4EMJA 5ER0A 2AKZA 3NVTA 4AZ5A 2PU0A 2E5CA 2HROA 3B0PA 8TIMA 2W91A 3DI0A 3CK5A 3VGGA 4PUDA 4Q8QA 4ZFCA 1QJWA 1SFSA 4N9EA 5DQPA 4WF7A 3WUBA 1GVEA 1UUOA 1XLIA 4PYSA 4HA4A 2RDXA 2B7PA 4AYGA 1TE1A 3BLIA 1LPFA 4AD0A 1Q6QA 4UR8A 5I09A 1GZJA 3KOXA 1NU5A 3QVQA 2YR1A 4O54A 1B0IA 3TU9A 1BKHA 4JNZA 4J40A 2CIPA 2W62A 1P0DA 4H9MA 4HU0A 1MDRA 3MV11 4LYQA 1Z32X 4KRZA 3HIJA 5FJPA 2GR2A 2A0NA 1Y65A 1W5NA 4OJYA 1Q4NX 4IGHA 4IGSA 1UH3A 4ZOBA 4K3ZA 2ZRVA 1IGWA 3PJXA 4QXIA 5HJLA 3T4CA 4XBKA 4I6KA 9CGTA 3HFTA 5A6BD 1LOLA 1OFRA 2BWGA 3DH7A 4AU0A 4DI8A 1QI3A 1CCWB 4OUEA 1QNOA 1R9YA 5C9XA 4L80A 3KTSA 3GFXA 5AOUA 3R43A 3HFYA 1TMQA 2WMKA 1H2IA 1YBQA 1GRGA 2VVSA 4MF4A 1W6TA 5A6JA 2BVDA 2W55A 2PCEA 3K2GA 2CLMA 1UP3A 3MQTA 4M0XA 3W2UA 1JF5A 3G24A 4IIHA 1XCFA 1D7KA 3QV7A 2EQ7A 4BF7A 1HXJA 3LHUA 4GHRA 4LS0A 2REQA 4J7RA 4UFHA 2AQOA 2QAPA 2ANUA 4C65A 5CJ5A 2J25A 2X1SA 3GHTA 3MUCA 2CCRA 1CLKA 4S3AA 4RZ4A 2WZIA 2ISVA 3AMGA 1NDYA 2WSQA 1BWCA 4MOZA 3CMFA 1C92A 2BB0A 4J35A 4LQ1A 3MSGA 1AW2A 5C71A 4ZQRA 5FI8A 3T40A 2BZNA 2R9ZA 3W83A 3DGRA 3CB3A 4XAZA 3T81A 3W70A 4D72A 1JGIA 5DT7A 1OB0A 3LXCA 5AZ1A 3EDKA 2PLMA 4UTTA 5EFDA 2YVJA 3KRSA 2YZ5A 5B80A 4PMUA 1NSJA 3EOLA 4NXKA 4MNLA 4D1JA 3L5MA 1K03A 2J8GA 4HIBA 5G4HC 3MT1A 2CITA 4G7EB 1PZ2A 1J9YA 5AC7A 1JF6A 1EUNA 4RNHA 4EQSA 4WSKA 2DU2A 3UPWA 3R58A 4DN1A 1XKJA 1VGAA 1T40A 1TWDA 2EG7A 4LRSA 4MY1A 1R9XA 1UUMA 4JKKA 1BYAA 4TQTA 4AVNA 5REQA 3OQEA 4LVFA 3LBOA 3N6HA 5A3HA 5B7ZA 3E96A 3W7DA 3FDKA 5K2ZA 3LY0A 2DIKA 1GW1A 2QDEA 4ZQNA 4DLFA 2VCCA 3IJLA 1W9UA 2PWFA 1U33A 2W0UA 2PDFA 1S2TA 3IPWA 4HMNA 2HZGA 4HNLA 2EQ6A 3OZOA 4ZB2A 4LAUA 1ZQ5A 1HF6A 4E0CA 1ONXA 3DK4A 1JCTA 4PULA 1XQLA 2PUZA 1LLWA 3CO4A 2XIQA 1V3KA 2V3DA 1DHPA 2WBGA 4DZAA 2ACUA 3A12A 2Q3OA 3URBA 1VHCA 4M6VA 1EPVA 3CWHA 3QMTA 1UA3A 3ANUA 3MZNA 5J5RA 1QR7A 1BPLB 5DXXA 5CSRA 4YHGA 1KRMA 2ZDRA 1QBAA 2FH6A 3SURA 4QBXA 2A79A 7TIMA 1DWHM 2VYOA 4WY0A 4J9JA 2YX0A 4IPIA 3SUVA 1W17A 1S46A 4A3UA 3M44A 2QQ6A 2AAMA 5DCDA 1OGGA 2XIOA 4ZXLA 4IX2A 2NQLA 1HT6A 2P10A 3CGBA 2VZOA 3AU6A 4HSOA 4Y96A 1EDQA 4HK7A 4ACYA 4Y9MA 3R7MA 1FWFC 2VC7A 3BCDA 3SRHA 3ZT7A 3U3HA 1QXLA 2Z2AA 5LGZA 1XIGA 1TJ1A 3B8DA 5H8MA 3F5JA 4ZSTA 1WOBA 1U22A 4Z1BA 1ZFJA 4XG1A 4N6FA 2X1UA 2O9RA 3WQ4A 2YCEA 1TPDA 3TQKA 1VHNA 1XKYA 4XVDA 1TG7A 1V0KA 4IIGA 1TJ0A 7CGTA 4ZVJA 1XD0A 3P0WA 2WVVB 1WXZA 3Q37A 4L1XA 1KGXA 2W67A 1OF6A 3ZSSA 1E0UA 1HL9A 3NZGA 1LTDA 2XZ9A 4J57A 3UPBA 5I06A 4K39A 1D8CA 1H1ZA 1SMDA 4NNCA 1UH2A 1F76A 3H21A 3INPA 2R1PA 3HRDC 3GIPA 4HN4A 5F1UA 2ZA1A 1LRNA 2GQ3A 3LCGA 3R89A 2ISWA 4XAFA 5DEZA 1DJXA 4B4HA 4D6CA 3UGRA 4RE2A 4DJFC 4J4KA 5HPCA 1J18A 4JS3A 3EUB3 3VKCA 4LX4A 2DSWA 3TONA 1HQTA 4C5YA 1PX4A 3VOJA 1XDIA 2V8ZA 3SDOA 1C91A 4O4WA 4X3ZA 1QPKA 3BLPX 3C8FA 2BOFX 1TWZA 3M1ZA 3UR2A 2UWFA 1H50A 4UXDA 4BS0A 2WP6A 2J7EA 3K4WA 3AYVA 4ACZA 1I0DA 3QW3A 1JEZA 2I7GA 3H53A 1B4KA 3NVYB 1UR0A 3IIOA 5LZLA 1QNSA 5D9NA 1TREA 1KKRA 2D2OA 1NDWA 2DFAA 1B30A 1ZMCA 2CZFA 2VFHA 3UEQA 3LPOA 3SY1A 3QM3A 2ATSA 2JEPA 1GZ1A 1EBDA 2HPMA 2O92A 1XISA 3QKZA 1RPXA 2IPFA 4E4UA 3LEPA 5DXYA 4GUJA 5AC5A 1E6SM 7TAAA 1ZL1A 4DUXA 4CCDA 1ZAIA 3TTYA 4GRTA 1SR0A 4B3KA 5MKGB 3EWZA 4AVOA 1Z69A 1Q1WA 1DKWA 3V5FA 1B31A 4D71A 2J74A 3AIEA 3B8IA 4D8AA 1KLYA 2FTYA 4IOTA 2GDVA 1YHTA 2REQB 1RCQA 1KLZA 1KBLA 3W7LA 2QYGA 3USBA 4HNNA 1GQNA 3UETA 5FKYA 2ODOA 1S2CA 1ICPA 3R1ZA 2W5FA 2GGJA 2V30A 3RILA 1NELA 1YDYA 3ZZ1A 1TV2A 5FS8A 2OGJA 2EXOA 3AWNA 1L2UA 2ON3A 1HP4A 4HK6A 3GUWA 1BGAA 5K3VA 1LZOA 2R24A 3HG5A 5A95A 1T3QC 1E5NA 1VLIA 4NIRA 1HJVA 2E1WA 4E3TA 4MY9A 1NIUA 2J27A 1MQRA 4M56A 1JDCA 2FVLA 1G0CA 1TIWA 2IPJA 1I45A 5A6AA 4KQNA 1EBGA 3EDJA 1PV8A 4S3FA 3QGKC 3PBVA 3PZQA 2QUUA 2DT3A 2KAUC 2CBJA 4PUNA 4JHZA 1JYWA 4LSBA 1XW8A 4XKMA 4HU8A 3VFLA 4M6QA 1QW8A 3RIKA 4P7QA 3CHFA 2ZDSA 3ZLHA 3LGEA 4M6UA 3GTXA 3FJLA 3PP7A 1J0YA 4MWAD 2WOWA 4PMRA 2OU4A 4US5D 1MXGA 3AXKA 4AYSA 1PB0A 4LNYA 1CGVA 1L9WA 1NFBA 3IJ8A 4DF1A 1XUZA 2PF8A 4LEQA 3U9IA 1Z8AA 2C1IA 4JD4A 5JBFA 6A3HA 1R85A 1QK2A 1ZX9A 1KR0A 4W88A 1WKYA 1WB0A 4MNJA 3V5OA 2F8QA 3NZQA 4PUWA 1VEMA 2A3HA 3GNXA 3NTYA 3QC0A 3BARA 5D33A 4BZYA 5A5WA 1OIFA 4O1DA 2ZUNA 5JCNA 1KW1A 1KA9F 1QCWA 4UQAA 1DPMA 3L8KA 4O1CA 1E9LA 1U1UA 2WBAA 1SZGA 3WQPA 2W54A 5LHEA 3SGGA 5HMDA 4JIEA 3P60A 4FK9A 4UQCA 3W6MA 2Y88A 4IIBA 4O1BA 1WZKA 2VFFA 2WSPA 1J4EA 1UC5A 2DJXA 2OO0A 3ITYA 3QTGA 4NILA 3C0QA 3PULA 3C3UA 1SJCA 4W7VA 5DFAA 3WBEA 2E28A 2GJLA 4PCPA 4EE9A 2X41A 1V08A 2PI6A 4FXSA 3E49A 2YQUA 2DPEA 4GIAA 4Y9PA 4IGMA 4WY0B 3QFWA 4LS2A 3TCSA 4X2RA 4MM1A 2CNCA 3H22A 3VINA 3R4IA 4OT7A 4J27A 3GVRA 3SCTA 5CPQA 4QM1A 4UOJA 5EY5A 4XSMA 1GG1A 5I0DA 2QVNA 3MI6A 3KDOA 1PDZA 3S5YA 2XSAA 3WQ5A 2PWGA 4AWUA 4RNFA 3N2OA 3TYEA 1I2QA 4IQEA 2ZUUA 1ICSA 1YRRA 1JI1A 1CGWA 2ZCGA 1W0MA 4TVDA 1XIBA 4LC6A 3LLDA 4I7WA 4A8NA 1XSIA 3P74A 5JU6A 4DJDA 1ZU8A 3CMGA 3A9IA 1ZNNA 3KOFA 3BJSA 2IKHA 2NQZA 2Y5SA 3KLKA 1GGOA 3CIXA 1F3TA 2QVHA 3KM8A 1XBYA 3ITXA 1A5BA 3CL7A 1XBZA 4Q8TA 2A3AA 1W9VA 3WDHA 2X1TA 3LMZA 2D3LA 2ZXAA 2ATMA 1E5JA 3NXFA 2WC4A 3VE7A 2VJXA 1E4NA 3ZJKA 2ABAA 1HP5A 2GSEA 2X2GA 1OSEA 4AZCA 3Q45A 2OELA 3OJGA 4OTKA 3A24A 5EGRA 3W73A 2X1IA 3MMDA 2QPXA 4X9SA 3OYXA 2NXIA 3TTEA 4BR1A 3IAPA 1YLVA 1I1WA 3SAZA 3PBWA 1T41A 3FG2P 1TVNA 2ZBTA 3NPVA 4ZE5A 1KGWA 5JIPA 1Q13A 3WJYA 3HGJA 1F6KA 1RAKA 3MSRA 3WSUA 3COTA 2FGZA 2DGAA 2R91A 2E5DA 4WXYA 3V18A 3UGVA 3KW3A 1A3WA 1ISXA 5CC3A 1M65A 4IQDA 4MADA 4KEZA 4NYUA 1GEQA 3TN6A 1YNQA 1KN0A 2Y8VA 1JCLA 4XZBA 3QHNA 3M47A 4P7OA 2J62A 4KWSA 4B3LA 5DF0A 5M3WA 5AY7A 2YXGA 1ZP3A 4F2TA 4NSBA 5DCBA 3V0TA 4J1OA 2J7BA 1A5NC 4MIMA 1B9BA 3P61A 4AZ6A 2VM8A 3W1TA 1XLDA 2BXZA 1CEOA 1G4TA 2XGBA 4WRHA 3OU8A 2F2KA 2OLHA 3RRAA 1KCZA 1LL6A 3KBNA 3AU2A 2YVFA 4L6OA 1GRHA 4EIVA 1RUSA 3B40A 3KP0A 4AEEA 5T26A 4UTMA 2D24A 4WEVX 4UMAA 1KTBA 4UTKA 4I9TA 3DEQA 1HTIA 4P7RA 1UWUA 2TODA 1WA3A 4WSHA 4TVUA 3NDYA 3O3RA 3GXNA 3LB0A 3AS3A 1XHCA 4JDRA 1LQAA 1VBUA 1NHQA 4NRSA 4GXMA 1LLOA 4K7ZA 3ZR6A 1K9DA 3KRBA 3B8WA 1J6OA 4B9ZA 1B2YA 1R2SA 1J2WA 1ZP4A 2OZ3A 4WOZA 1MVYA 3M0LA 4NAEA 4AD1A 2V3GA 4NEWA 2O56A 3CZEA 1VIWA 4AD2A 2VFDA 3BAYA 1FUYA 3W37A 3DG3A 3HG3A 4ZBCA 1MSSA 3CT7A 4GRSA 1CGXA 4LA1A 1AOGA 3QW4B 5FS6A 1A53A 3UYIA 3VDBA 1JIBA 2XUCA 4PB3A 5LSMA 1H63A 5D03A 3GC5A 3GXMA 3WD0A 4B2DA 1S5VA 3TYZA 4V1XA 3G22A 3GUGA 5I24A 3ARSA 1V6YA 4O52A 2E7FA 1HFBA 1ME7A 4UQEA 1DOSA 4APNA 3TIMA 2BY3A 1PKMA 4CD8A 3OGVA 2OR2A 1JYNA 3RYSA 3DG7A 2PFHA 4XZ9A 3UR7A 3PWGA 4OWGA 2FMNA 4LC8A 4AMCA 3LK6A 4HN8A 3RPDA 2D2JA 1ISVA 1VFFA 4HOZA 3KCLA 4GIRA 1OX5A 4RW5A 4LUIA 4PSPA 4JTIA 1Q2RA 4JX5A 3VILA 3N4EA 1XSKA 2WPBA 2GVEA 4H6EA 1JDEA 4ASTA 1NOWA 3V1HA 1WPCA 3W0KA 2Y7GA 4QS5A 2XPKA 4PMVA 1F3EA 3CTTA 4ZTYA 3DHUA 3WBYA 3MP3A 1ZZMA 4CU6A 4ZSUA 1S2UA 2NXGA 4TVWA 2FDSA 1OG0A 4XV0A 4Y8EA 3NVVB 4GOAA 3V4BA 4K8DA 3GO2A 3WJSA 5FCZA 4LAKA 3AISA 4DWSD 4ZO9A 1XIFA 1YDVA 6ALDA 4DUWA 3SRFA 3PZMA 3MYPA 4Q22A 5EMLA 2YDRA 4QROA 3PTMA 3UZXA 1JDFA 1V3MA 4GLEA 1J93A 4BJHA 3ZVHA 3KCOA 2F6XA 5K9XA 4Z2GA 3WEZA 5KZMA 5AN7A 2UY2A 2YCLB 4A35A 3AZRA 3BSHA 4PMDA 2X8GA 3IWPA 3B9JB 1M1BA 3UJSA 3FHQA 1CB2A 1UROA 2DSZA 4MHBA 4R34A 3IUHA 3OP2A 1TV7A 4B15A 2C1HA 3FK4A 2YLLA 2FB3A 3FGCB 1VYSX 1GNXA 1KR1A 1UWRA 2YCKX 1K8CA 5CAKA 3HPAA 3SECA 1GKQA 3MSYA 3OHIA 5TD4A 5LNSA 3VDAA 3ABZA 1UKSA 2O7QA 1QK0A 3WUEA 3CXBA 1M7PA 3SQLA 3M43A 3VGFA 5G5GB 4D6EA 3WJXA 4LFYA 5JRBA 5TAOA 3S6TA 3RM9A 3F4WA 3H8AA 3BMWA 3XISA 3GDRA 3WCZA 1RBLA 1OK6A 1I2NA 3WBWA 5CBBA 3T07A 3K8MA 1UD8A 4IG2A 2E9LA 3QOMA 5LNUA 1KCKA 4O53A 2QMKA 4W89A 4MAZA 3VMNA 5TIMA 2WCAA 3LXDA 3MA8A 1IEXA 2VO5A 1AW1A 3LD5A 2W66A 2QF8A 2VZTA 3NRZB 4G2DA 1B3YA 3LDVA 4GACA 1CENA 4LUSB 4JGDA 1SQ7A 3WNNA 2V3FA 2XGZA 4ATDA 2AGKA 4UB9A 2WOVA 1ZS2A 1XI3A 1ESWA 2BOEX 2YDQA 3DKJA 1X6UA 2NUYA 2XFWA 2EPOA 3UY7A 5E5CA 4GVGA 1PHQA 2D0FA 3H54A 5FEXA 2ZXBA 4IPPA 4DAFA 5I5RA 5JBDA 1ITXA 4HJWA 4LUTA 2P0IA 3W24A 5E70A 1TX2A 3DAQA 4GQRA 1N82A 3GDKA 4OBRA 1W56A 5DT5A 3MCMA 3RO8A 3PPGA 1JG9A 4M3PA 5GNZA 4S3GA 3OZPA 4Q8UA 3SIMA 1HW6A 5KVHA 1H1YA 4WOQA 3RM4A 3NQVA 1H7WA 3VU2A 3K5XA 4IFOA 1YE4A 4GYPA 4CN6A 3BLOA 4JAWA 2Y5EA 1XGDA 1XP3A 1S7MA 4DYJA 2DIJA 3POCA 4UQDA 1YEYA 1ECQA 4LALA 5JBEA 1B3XA 4H4WA 3GFYA 4GH1A 1N7KA 2G0WA 2Z24A 1LG1A 2IXUA 3CC1A 5AHIA 4QJ4B 3CEPA 4PMNA 1RVKA 1Q6FA 1O1HA 4ADSA 1OFAA 2WLZA 2LLEA 5IM51 1XFCA 3QQ1A 5EBAA 3OG3A 4GKTA 2A5HA 2E68A 4PMXA 2B7QA 1AVAA 1EUAA 1JQVA 2DIEA 4X63A 2QR6A 2BGNE 4DO6A 1PYFA 4O14A 4GG9A 4KETA 2J4GA 3W7QA 2E77A 5C0QA 3LHTA 3OA5A 3MMUA 1GTEA 3EDDA 2VUYA 4M8UA 3WLOA 5C7HA 4R9XA 2W4XA 1RBAA 3NO5A 1QO5A 4F48A 1J0ZA 3FKRA 4TIMA 5AYBA 2Q3RA 1XH0A 1XSJA 4NAEB 2BBFA 4YYCA 3OGSA 2FFIA 5BXSA 1JJKA 4UR7A 1R3QA 3VK5A 3ZR5A 4TMBA 3M46A 4JL1A 1XLMA 3HGSA 3WLRA 4B90A 1WZAA 1GKPA 5G2IA 5KVIA 1SO5A 2G50A 3UZWA 1H09A 3TP4A 1X96A 1EL3A 4LY4A 3MUXA 2YCJA 5CPMA 3WLTA 2ZRYA 2ADAA 3NQ7A 1PTAA 2AL1A 5EBUA 3UG8A 5FEPA 1DJYA 4LEFA 1K4QA 1EXBA 1NP0A 3DGZA 3A5VA 3M4HA 2BV9A 3EGJA 3B0VC 2DQXA 4XO7A 3AHYA 4G6CA 1UH4A 3LV5A 1JZ4A 3PSWA 5FJIA 2F7FA 1IIGA 2ZZ6A 5HPOA 5FOOA 4GXPA 3O6YX 1DJHA 2INZA 4L1GA 1MXDA 3JR2A 5D37A 4TOQA 3EAUA 4RUBA 5D32A 3QHOA 2XVGA 5CXPA 4CVUA 4RXFA 2CHRA 3EB3A 3EXTA 3GHSA 4P8WA 3DZ1A 3TROA 5KMYA 3VNZA 1OVDA 4YTQA 3EWYA 2W27A 3H4WA 1XBXA 3S2CA 1FQ0A 3OIXA 1OFDA 3P0XA 4ZOHB 2QUVA 3WD1A 4N0RA 3SM0A 2PDGA 3W22A 4AUBA 4YPJA 5C2GA 1TTJA 2QT3A 4KEUA 5E93A 1KM4A 3WLPA 1MEHA 3AIUA 1TV3A 1RP9A 1SR9A 3HB9A 4O16A 3GVQA 3AICA 5SWUA 1ME8A 2V5DA 3N29A 1C8QA 4N9BA 1OFEA 2OCZA 3BAWA 2ZUMA 3WEMA 2P8CA 1EDGA 1YE6A 3LCHA 1W1A1 4A3YA 1IR2A 4GI8A 3GXDA 3CUXA 3WLIA 4WDWA 4M81A 4Q8MA 3SO7A 3NQEA 2X2YA 3CUZA 1J96A 4O8RA 3LUTA 1E4MM 2UBPC 1LRTA 3ITLA 3W27A 3BK0A 2ZICA 1X7IA 1MEIA 3E02A 4W4QA 2FH8A 3DI1A 3WJZA 5CPNA 5BMXA 4BI5A 4NUWA 3H2OA 1MUWA 1TYGA 3BLEA 4JZ5A 4UZUA 1JFXA 1L6WA 2CW6A 3HV8A 1SUXA 3GNNA 1KNWA 5F4WA 3H4GA 3L4UA 1I0BA 3IK2A 3STPA 1NAL1 5TNVA 4UR9A 1EC9A 1HJSA 5F2IA 1XHGA 2VP8A 2Z25A 3HPFA 3E0IA 4OOZA 2P5NA 5C70A 3TW7A 4DB7A 3SFWA 1AG1O 5T8GA 1PKYA 4IG2B 2FVMA 5T91A 2HK0A 1FH9A 1ZBKA 2QGHA 3QY8A 5H91A 4JDBA 1XRVA 4NXSA 2TAAA 4LGXA 4V33A 1F3XA 1H61A 4LBSA 4ZTXA 1QPOA 4WKHA 1C9WA 3TE9A 5AHNA 3W76A 1V7AA 2Z1KA 4LVAA 3S2JA 2OEKA 1F2JA 3N12A 4PTMA 4HMCA 1XX1A 4LF2A 1EPXA 2PODA 5DLCA 4LUTB 4H9UA 1C8YA 4NZ3A 4QHRA 3M5XA 3TSBA 4LPCA 3B8SA 3O16A 4GH3A 4XD3A 5K7JA 4O57A 4OV4A 3H4XA 1A4MA 2FPTA 1S5NA 1H7NA 2HE8A 3IS4A 4UFJA 4CN4A 2XHYA 2D22A 1PSCA 4NQ1A 4FX7A 1SO6A 8RUCA 4KPLA 1XCWA 3LNMA 2QCCA 4IP5A 2WZMA 1FDYA 1BQCA 3WYZA 5C9ZA 1QVBA 3C2RA 4O13A 3BQ5A 4IUOA 2C91A 3AYTA 4A05A 3W7IA 4JTQA 1YX1A 3L2MA 3WQEA 3NIYA 1W3HA 5A6BA 4DZIA 1BYBA 1TX0A 3KLJA 4TVCA 4X2PA 3CUFA 1UPPA 2VC5A 1JFHA 4GUGA 1XV8A 4ZB0A 3FCPA 3IJIA 3W74A 2DZXA 4C7DA 4E8DA 5IRPA 2WOIA 1U30A 1OYCA 1IZKA 1YXDA 4KPRA 2HMCA 1C9DA 3VZYA 3K1GA 1JQXA 3HF3A 3NZPA 1KRCC 2Y8UA 5ECVA 3S9IA 3E5BA 3BVJA 4KGJA 4M7TA 1HO4A 2GOUA 3FAWA 1ODZA 2DZTA 3IUIA 3N2MA 4LV9A 1BGGA 1KFWA 2J13A 2Q02A 3W1RA 1MEWA 3MHFA 3SR7A 4XUGA 1UWIA 1LM1A 4ECLA 3THDA 4Z2HA 2PDJA 5I03A 3MDUA 3LYEA 4QAIA 1XWYA 4HNOA 4UTIA 2V68A 3DYOA 1ZB5A 4A3QA 1VBJA 2FZDA 4DI9A 1W1PA 2OOFA 3KHDA 2GUBA 2WKGA 1EO7A 3Q65A 4LBUA 1IZJA 1G6CA 4BWLC 4Q8OA 3T0TA 4PSRA 4ML4A 1X97A 1U1HA 1WCGA 1TTQA 4IWWA 2XFRA 1FHUA 2VKZG 5IFTA 3N2XA 1A3XA 2WSRA 1K7EA 4UFIA 5LGXA 1UCWA 1M3UA 2I56A 2CKRA 1BSLA 1B57A 2YGYA 3MCNA 2QDDA 3VIPA 1Z9AA 2PDCA 2ZZ0A 4WSJA 2ZX6A 3W75A 3GD4A 4QE5A 4DBUA 5ABFA 3GTNA 1KFBA 1KTNA 1P1MA 1XXXA 5AC8A 5HWJA 3BGJA 5DY3A 2VR2A 5C2XA 2WSKA 3W2LA 4ADUA 1LWIA 4FLOA 3KRZA 3BANA 4C90A 1FDJA 3MWCA 4JIIX 2BODX 2P88A 1CXHA 1YTEA 2PDXA 5BWFA 4P7NA 3EA2A 4OUIA 3IK4A 2JK6A 4KERA 1KQZA 3M0VA 4K36A 1E4LA 2BG5A 3UW6A 3HA1A 4XVEA 2ZTKA 2H8XA 3NL6A 1ZKQA 2EPKX 2DJLA 3OEXA 4EF8A 3TR9A 1KM1A 1TRIA 4JFTA 2FJUB 2ZC8A 4DM1A 1V6UA 4IPNB 5HNTA 5JCIA 4MNMA 3SIZA 1JEHA 4JTKA 1JRPA 1U1JA 5EMUA 3MYOA 4P7LA 2CLLA 4HPJA 1NHSA 4NI8A 5EKYA 4F9JA 1XRSA 1XS2A 4Q6XA 1TPVA 4L4MA 1JL8A 3A7AA 1S3HA 3N14A 5FS7A 1KM2A 4HU3A 1TUFA 3FYYA 2PPGA 2GVLA 2GR0A 3K46A 2P76A 3SSZA 2CBIA 1FXPA 2D2HA 5F1VA 3S5OA 4GBDA 3BO9A 4D1IA 2WZTA 2FLIA 1JPKA 3TWAA 1UD2A 2Z1XA 4FIRA 4Y6GA 2CDUA 1ONEA 1CT5A 4N4PA 1QI2A 1QHPA 1H41A 2FTWA 3STGA 4IP4A 4PCNA 1ZRQA 2QJIA 2A6LA 3U7BA 3VOGA 1E51A 3STCA 4AY8A 1DP0A 3NJ3A 1FP9A 4O17A 1NOFA 1GW9A 5MHBA 2P50A 1VBHA 3H6OA 4QE4A 4EQWA 2J3NA 3RCNA 1T8QA 3WDQA 3R10A 2Z6JA 2PCQA 2RUSA 5IBXA 4D6HA 4KWOA 2FKPA 2XVKA 4N42A 3FA4A 4H1ZA 3HV9A 4FEZA 2OVLA 1J0KA 1X1NA 2X40A 1Q7QA 1GYMA 4EF9A 1TQJA 1FTXA 1ITQA 4O0ZA 4BF9A 2ZZ5A 3LQGA 4JIRA 1ELSA 3AALA 2J7DA 1TJRA 2POTA 3NPUA 3REQB 4OGZA 3BJTA 1UC4A 4GVIA 4PEEA 4G5DA 1RH9A 1I2OA 4Q7NA 2J8FA 5AECA 5G1MA 3O2LA 1WAUA 1TYTA 2QW5A 2PZNA 1YXCA 3B97A 1YYAA 1MW1A 3EWUA 1ZJBA 3TCEA 4MGGA 1F7BA 5C9WA 1C8XA 2OJPA 4IFRA 2GR3A 1LOQA 3RPTA 2WP5A 5BOEA 2HTMA 3RK8A 1AK5A 3CS2A 3N2CA 1DJZA 4PMYA 1VZWA 4Z17A 3QTPA 4BI6A 4OZOA 2P53A 1H49A 1A5SA 3H2MA 3VIGA 3GR8A 4H2HA 4MJZA 3EWWA 4P5UA 3MY9A 4C6IA 1TR1A 1VFTA 3N15A 1X39A 5K9DA 3MV01 1F61A 4R7JA 4QQ3A 5LA2A 4GY1A 5EBKA 3FVMA 3KAOA 2DZVA 2WXDM 1I9CB 2A7RA 4M1RA 3HM7A 3R0UA 3UVAA 3MI2A 4X0NA 4KF1A 1UQYA 1DWAM 1E73M 4QJ3B 4AVFA 1K9FA 1V3HA 2HRWA 3T2PA 3TTQA 2D20A 1UKTA 2WNWA 3TSMA 4RLIA 3W1LA 3EANA 2X7WA 2BXYA 3F4NA 4LJ3A 3IIZA 4QCFA 1V79A 1FCBA 2ZXQA 2OKTA 1OC7A 5E1QA 2ZRUA 1RQBA 3WLJA 1UMLA 5I23A 2IKJA 2VWTA 5FD0A 1IYXA 1HJQA 3ARVA 3O06A 3F7JA 2A7PA 4RE4A 1OC6A 4PL2A 2V5LA 1FH7A 1TTIA 4YTUA 3XIMA 3U4FA 5A6TC 4CLMA 4TX8A 1OFQA 1EP3A 3N18A 3PAOA 5H8PA 1OFOA 1XLJA 3R5EA 4UZSA 3LPGA 3P2VA 4AX6A 1JZ7A 3MMTA 4O11A 1TWWA 1M53A 3L2LA 3MJMA 4PMOA 2BHYA 3UJFA 3WFAA 3D9XA 1A0EA 5EA9A 3LCLA 1BXCA 2ZRWA 1SFJA 4K7VA 4LCQA 4Q3MA 1BYCA 3HU7A 4GYKA 3TN4A 1GQLA 3LSBA 2Z4GA 2VC9A 2CZDA 3NWRA 4QNEA 4MUPA 1C8VA 1DEDA 3TYBA 1CXLA 1Q8AA 2YKKA 3B9AA 4PE8A 1UP0A 2BVYA 3ANVA 2NT1A 4MAVA 2HWGA 2IMRA 1F4AA 1I60A 3P14A 3PWIA 1EHAA 1SSDA 1YQ2A 1EZWA 3TC7A 3WK0A 4JTCA 3RJYA 3VABA 5ABFB 1PZ3A 4UNKA 3DBNA 3IVUA 3CLWA 4BK9A 2H8ZA 1S2WA 5D09A 4KWUA 4S38A 1H5VA 3TVAA 4ZGYA 3B4YA 3QY7A 5CSSA 3VNJA 2XZ7A 1OCNA 1Z6KA 1DVJA 2VFGA 1S1RA 2WQDA 3TK7A 1PE1A 3E6EA 3ITCA 1VBGA 3G2GA 2H3DA 1XDJA 3VM7A 3LS9A 4XBJA 4YU1A 3BG9A 3T09A 1RJPA 3W7PA 2F38A 4LOCA 2QGYA 2XG9A 4CVWA 3NEHA 3E12A 1QDSA 4PUEA 4H83A 1NWSA 2GUUA 2D0HA 1M41A 1WOAA 3ZVIA 1TKKA 5HDRA 3EB2A 3IV3A 5EL1A 1DTNA 4C6LA 3U4AA 2GQ9A 1D3CA 4AF0B 5CPLA 5A8MA 1PHWA 4AIEA 4LANA 4BQ2A 4PRTA 2ISSA 1V59A 4CU7A 5ABEA 1GK8A 3S2NA 1JNDA 1M6IA 3W87A 2Z6IA 4HQVA 1R3SA 4S2CA 3QGVA 2YLAA 3ZWSA 5AYYA 2EKCA 1TZ9A 1AZ1A 3UVIA 3VKJA 2NV2A 3KBMA 4FI4A 1F8MA 2ZZ7A 4FP1A 1TWSA 1GVRA 1LUCA 1E40A 2O9TA 4S39A 2PF0A 4Y9AA 4H6QA 4GYPC 3T2QA 5FJTA 1KCLA 4HA1A 4PB5A 5FF3A 2Y24A 3E3HA 1IF2A 2OYKA 2XH0A 1AMKA 3PZTA 3OBEA 4GFSA 3NQBA 7REQA 1QW9A 3SRDA 3P5YA 3V35A 1XF0A 1EJSC 5KETA 4WZHA 4C1NB 1O5QA 4GINA 4MTVA 3EKZA 1FA2A 5BZAA 4QRNA 2E4TA 5LNRA 3GM8A 1XYAA 3U6WA 1EEXA 3B9NA 1UR3M 1O95A 2QPSA 1XG3A 4LAZA 4PCTA 3W71A 2XVLA 1NQ6A 1XQKA 3YPIA 3S8HA 1REQB 3BOLA 3QLLA 2D3NA 1GVSA 3AOFA 1ZJHA 4HD5A 3P84A 3WNOA 5A8PA 3W88A 4E2OA 3UFYA 1XRFA 1L6YA 1O12A 3QV6A 3WELA 2PP0A 2WV8A 1OY0A 4GCXA 4H41A 3S2MA 9XIAA 2EO7A 4W8LA 4W7UA 4N2YA 3SBFA 1QW7A 4CD7A 1SJDA 4O0KA 4BEQA 1XLGA 1OFPA 3NSNA 5TR3A 2I1OA 4GXWA 2YAUA 2Z27A 4ADWA 4Z1DA 1CW2A 4JQ9A 4QISA 1H62A 2NLYA 4N02A 4NI3A 1J0JA 2DORA 3W86A 1FWAC 3F2CA 1EB3A 1MFVA 2FHCA 2BS9A 2J6XA 3TYCA 4JKLA 4KEVA 2PA6A 1R6WA 2GVYA 2JF7A 1EOKA 1I2RA 1B5TA 1OHLA 3TZNA 4PUMA 3ORWA 3RMEA 4C1KA 5KITA 3BGAA 1TR9A 2WJZA 1FFVC 3FKKA 3P6LA 2PWVA 5JH1A 2VEPA 3OYZA 3M6DA 2ZE3A 2GGIA 3B0XA 4QNWA 4E4PA 3A4XA 4H8HA 4UOQA 2NVDA 3GZ3A 3GC2A 3D3AA 4FNQA 2PWDA 1N62C 3D5HA 4W8AA 4EPEC 4ROPA 3VIHA 3D3FA 1FWCC 2ASHA 1A0CA 2HXTA 3EPOA 4LYPA 4ROQA 3VDHA 2A3BA 5AYIA 2BLEA 1FH8A 3RU6A 1CLVA 2GFTA 4RV8A 1O60A 3A23A 4FMVA 3FFSA 4WKFA 5IDZA 4DUVA 4EVZA 1LBFA 2CERA 4KWWA 2DP3A 1R0MA 3QQ0A 4NJKA 1E70M 3W7GA 1CGYA 1OX4A 1UJPA 3FX4A 4UFKA 2CEQA 1S3TC 4W7WA 4D8ZA 1EF3A 3LTYA 2ZZ2A 2I14A 1VKFA 2H90A 4PUKA 3URNA 4CD4A 2ABBA 3M0JA 1OIMA 1VD6A 3PVFA 1K3UA 1QUMA 1NDAA 2BX7A 3NQ2A 4DX3A 3BMXA 1KFEA 1E1CA 1OZQA 3CV7A 1FDZA 4U4MA 3GS6A 4FOKA 1UD4A 3BV7A 5J04A 1ZY8A 4DVOA 1GVQA 4ICNA 2V82A 3GIQA 1KWKA 5H2ZA 4OFCA 4JN6A 5HJXA 1L8PA 1IHIA 1XL9A 3WQDA 3BZJA 5BXTA 4LUJA 3T0DA 4NG3A 1ZUAX 4NZ1A 3KFTA 4JIHA 3IIXA 3G6LA 1TRDA 3QHMA 3HQ1A 2G4FA 1FEBA 1VYRA 1XD1A 3OODA 4BCEA 4GABA 4FLQA 1ZLPA 3OZMA 4MLJA 3UZYA 5LA1A 4UTLA 2FQIA 1WNOA 3EX1A 4JQ3A 1IXOA 2QJGA 4S1FA 1R38A 1LDCA 3TOYA 2PGFA 3VD7A 1Q6OA 4I7VA 1OT2A 3MSDA 2W63A 2DV0A 1FIQB 5FSEC 4ALDA 3TZFA 1T6MA 3PC0A 2HNHA 3SGUA 2VZSA 4EPKA 4S3DA 3H70A 5LYRA 1UZHA 1KRBC 1A47A 5HULA 4WCJA 2DY3A 3WG6A 4IZGA 4ORMA 4FXFA 4QR6A 3WZ0E 3BC9A 3R07C 3AHTA 3LGGA 1QPRA 1L2QA 4K38A 1PCWA 3MB9A 3DYPA 3SI9A 3E0LA 3TWBA 3OLEA 4Q7IA 3I7QA 3CZLA 2YCIX 3B05A 4NJJA 3O7UA 2XFFA 1KXVA 3G0UA 3ZLGA 4CU8A 5TF0A 3NO1A 1PVNA 3IJ9A 4ZENA 3WL1A 3G3MA 4MZ8A 3VKBA 2E8YA 1T8XA 2HQMA 3B9OA 3T78A 4DBDA 4UMCA 4TV5A 1W5OA 1EFZA 3FSTA 3CXOA 1WDSA 3VKKA 5IHRA 3I3BA 3N17A 2PDKA 2R82A 3L5OA 1ZY9A 2W9MA 3EPNA 4HCLA 2CBVA 3HPXA 1F3PA 1FHVA 2JALA 4AEFA 3ES7A 4TO8A 3AHZA 1QFEA 4U5KA 2PDMA 1SM9A 4URIA 3W01A 3L0KA 2I5QA 2XISA 1GQIA 4IIEA 2PB1A 1VJZA 3GVVA 3TR2A 1EYWA 5GJPA 4B3ZA 3DG6A 1OYBA 4YIWA 7REQB 4KRTA 3BOFA 4F0SA 4HZ6A 3LCWA 4HZ8A 2YW4A 3IJ7A 1YTKA 2QULA 3L66A 3TW9A 1V7YA 4QG9A 2ESCA 2NSXA 4DUOA 4GC3A 1WKDA 5HUPA 1Q6DA 2C18A 1KXQA 5I77A 3TJLA 3NDOA 3UXDA 3W84A 1GREA 5LXXA 4DYKA 1RA5A 4NZ4A 1EKOA 3T44A 4NJHA 4F79A 3L12A 4PMJA 1G5AA 1TELA 3SY8A 3Q67A 2QPUA 1EZ2A 2FB2A 3W1UA 2JGYA 2NZLA 5FJRA 4PMZA 3GHUA 2WHJA 4JYEA 4Q8VA 2BASA 3TC6A 1WYGA 2YYUA 2OPJA 1YPXA 1GCYA 1H6VA 4H6RA 2EAWA 3MDWA 4XKYA 5D2XA 1GONA 3BMVA 3S6OA 4CUCA 3PZNA 2GGGA 4EANA 4UTHA 4CQ8A 3NUKA 1RY8A 5GRTA 4KCWA 1XLKA 3PUGA 1JYXA 1Q5MA 1JI2A 4KFOA 4OVXA 2VELA 1KM6A 3UNDA 1E6QM 4PZVA 5J5DA 1FO4A 4FNRA 2GWNA 3WENA 3VO0A 3ZT5A 4IUGA 4AHQA 1GTHA 3VOCA 1FWRA 1W2PA 1BD0A 3KXQA 1US2A 2D2GA 3PFRA 3MMWA 2C6QA 1I2PA 4CNPA 4K8EA 1HUVA 4D9PA 5CPSA 3PB0A 4IT1A 2TSYA 4A29A 3UP8A 3SQPA 2J75A 1SSGA 3QF0A 3R79A 1P6CA 3MTWA 2XVPA 4ORIA 2V6OA 5L9FA 5DMLA 5KSWA 3WF0A 3DGBA 1AH4A 2OODA 2CKSA 4DPQA 4GY7A 3KVLA 1BTCA 1BF2A 3W38A 4A3HA 4HOWA 2Y6ZA 4XB3A 3AS2A 1Z41A 4FB7A 4DO7A 4NZJA 3LTPA 3V36A 2Y5JA 1NWTA 2WWCA 3BE7A 3GTIA 1IEWA 2C79A 2R9RA 2BY2A 3EXRA 3LLFA 2W3RA 3PJUA 1FKWA 3AQUA 3QJAA 1UKQA 3M7WA 4DZ5A 1Y0EA 4FNPA 4ZL1A 1B3ZA 3R8HA 3OGRA 2CWNA 3VYLA 3RG6A 2E1DA 2VEKA 3CUJA 4JNYA 1OX4B 4GZ7A 5HQMA 4RR4A 3H4KA 5FL1A 4L7ZA 4X9YA 3HO8A 1FCVA 1NM9A 4GPNA 1XLFA 5I02A 4ZCWA 4RZ5A 1FCUA 2ZZCA 3PG6A 1W3LA 3VIIA 3G1FA 3CUIA 3GXFA 3RXZA 1F8WA 4HA3A 1E1CB 3S5ZA 2C0AA 3DHFA 3V7PA 2Z0IA 2PGWA 2CC0A 5CKSA 4RCXA 3E0VA 1HO1A 3LRMA 3AMDA 1Q85A 3LTSA 5F2LA 1A80A 3EBVA 2WM0A 4WQ6A 1CPUA 1JUKA 4FPSA 3VOFA 4LAMA 1H7RA 1J11A 1JAEA 5A8GA 3PBUA 4QLJA 3L5AA 1GVYA 3ES8A 3NNTA 3RRXA 2PZ0A 4UWMA 5D04C 3T55A 4GK8A 1W1ZA 4PRRA 5G5IA 4ONVA 1B4EA 1G94A 1RXOB 4WX2A 2NWRA 2FZMA 4ERIA 1JCYA 4MG4A 3VE9A 3DXIA 4XZMX 1UW9A 4RNJA 1AL7A 3AC0A 1JZ5A 4ZFMA 2OZ0A 3AJXA 4NL1A 2GR1A 3SB0A 2RDTA 3PG8A 3QMRA 1K7XA 2PDHA 5HA7A 5IBXC 2ZA2A 3T0AA 4B92A 5PTDA 1W3IA 4U5IA 1W9PA 4FX8A 3GAKA 3W25A 1OFBA 4AZ7A 4AHPA 1AODA 3ANYA 2J9XA 4Z2KA 1EWDA 5MKGA 4ES4A 1N8IA 4EAMA 2BHUA 3GIYA 2VENA 4KS0A 5CZSA 3BAIA 4ZQPA 1NJJA 1FWSA 4X0VA 3FW6A 3ARXA 3SCRA 2JBMA 2PC8A 1GHSA 3NVDA 5AYZA 3RLGA 2KX9A 2WNZA 3P8JA 2AL2A 2VMFA 3AJ7A 3GW3A 1EEPA 3M5VA 4JOMA 3L7RA 1TA3A 2Q8XA 5AHMA 4WJEA 2GWGA 2JIEA 1GOWA 1JPDX 1NWRA 3M07A 1O4UA 1OGSA 1KC7A 3WH7A 3A21A 3P80A 2ZZ1A 5DO8A 1EJUC 3RF9A 4QJ5B 1AD1A 4PCSA 4DJEA 5D9OA 1A5UA 2EJ1A 3VA8A 2A4AA 2ZZ4A 5HMEA 3LADA 1TJPA 1PIGA 3ZM8A 3Q2DA 2I17A 1GKRA 1XYFA 4QE1A 2FHFA 1AQHA 4R7OA 4NZ5A 2CYGA 3CZKA 1KO0A 4Q8PA 2PDYA 3AAMA 3NM1A 3MC5A 1ZJIA 1TPH1 1E3ZA 4PR4A 2ZZBA 3TEVA 3JW7A 3N34A 2WW5A 2YSWA 4U3AA 1NHRA 4M52A 1PX3A 2YL8A 2C3DA 4EPBC 2INEA 5LIKX 1QI0A 2J7GA 4FSAA 3KX6A 4GR1A 2QJMA 3APYA 4XD4A 4JQAA 4PBFA 2WLYA 4IISA 1H0IA 4V2XA 2OQLA 2OQYA 3T6CA 2XIJA 3OVRA 5EMYA 2Q71A 3C2OA 1V97A 3AMLA 4JPGA 3D6NA 2POZA 1PCKA 1R86A 3QV9A 3WN6A 4O10A 3FYPA 3LHYA 3W85A 4G7FA 3TXZA 1TWIA 3V16A 3IRSA 2JGQA 1HL2A 1NPXA 5CZTA 1ZAJA 5CBIA 1W31A 1MNZA 5CC5A 1F73A 3G1XA 3LXBA 3PANA 2Y1HA 4XX6A 3L2IA 3DC0A 3GXPA 4J3UA 2QV5A 3MHUA 3AIQA 1R2RA 4XKYB 3MVTA 5EYWA 1ZTVA 4CCZA 1CXIA 1BYDA 1SO4A 1MRAA 4MJ2A 4Q33A 2ZOXA 3UU0A 2XFYA 4XZWA 3BLDA 4E8CA 1G69A 2I16A 1G7VA 5BW6A 4DZHA 3IGSA 3V3WA 3MKCA 1EQPA 4K8HA 4OV9A 3LCXA 1GJUA 3DHPA 3H12A 4JNMA 3RU8X 4YWIA 3R0KA 1ECEA 2J66A 3C86A 3QPEA 2WKLA 3TLQA 3NYDA 2NT0A 1MFUA 1TPC1 4H9YA 3S47A 4NF7A 3WLQA 5K9CA 1XUUA 2WWDA 3AI0A 5E6ZA 3ZQ9A 3WO8A 4DJDD 1V02A 4RK8A 3G1YA 3LCIA 4O50A 1GRAA 3OLGA 5M1TA 3LHVA 1BHGA 1G9HA 4DO5A 4MZYA 3AXXA 2V5KA 3U5UA 3RX2A 1TPUA 2E0PA 5A69A 4ZQCA 4Z2JA 3PN8A 4KT2A 3CPGA 1UBPC 1KXTA 1JCMP 3L67A 2CLOA 3MJYA 4KFNA 5JMUA 2BP1A 3GTHA 3MCOA 2HV5A 4J3SA 1EGVA 3W23A 1V6XA 1VP5A 1VEPA 3P62A 3DJGX 4DXXA 1TTPA 5KZ6A 4EWND 3P82A 1PS9A 8A3HA 1GWJA 3C0LA 4V28A 1OQFA 4Z0SA 3N73A 3LX9A 1MUMA 2E9MA 1LT8A 2JKEA 2NSOA 3I6TA 5LXEA 3ABSA 4MNKA 3VKAA 3O6AA 1I75A 3QH2A 3LM7A 1ZCCA 2INFA 1PEZA 1A50A 1LYXA 2AKMA 3TJ4A 3N19B 1CX9A 1K4GA 4FHAA 5G2WA 3UWWA 2RAGA 1Q3NA 4UTJA 3RX3A 3FYOA 1L0PA 2DH2A 2VT0A 3W4RA 4NU7A 1XGEA 1JZ3A 3EA1A 4C6BA 2GPTA 5F7UA 1DBTA 1PKLA 1MNSA 2D73A 1HL8A 1FWTA 2V2CA 4W8BA 3BDKA 3NFUA 2AAAA 3NG3A 5A2AA 2CWXA 3VOHA 1YTDA 3T1GA 1HNYA 3ABOA 3EWDA 3GH4A 1VIZA 4S3BA 2NW0A 5DMMA 4J28A 1WKFA 1EH9A 4ZOAA 3GR4A 1XLCA 3C8NA 3BAXA 1BFNA 3WBAA 3W1PA 4HNTA 3ARWA 4XD6A 1B3OA 1HJXA 1P48A 2PE4A 3S83A 5H8UA 2BNJA 3ERPA 4MPQA 5I3IA 4TTUA 3K8LA 4WR3A 3ZIZA 4G9PA 2V5JA 3J7HA 4NEVA 1XYBA 3N3MA 2BSLA 2TPRA 3BW3A 4GQ0A 4L1WA 3CGEA 3CGCA 1PWLA 2FDMA 3EPMA 1V3JA 4RE3A 2YA0A 4TX9A 3DX5A 5FMHA 1W1VA 3F2BA 1R3VA 5LHFA 2PDBA 3RDKA 3AIVA 4B5TA 4Q32A 1LQ0A 2AL2B 2WMGA 3R12A 3CO8A 5CZJA 3RNMA 1U2YA 5D9PA 1TA3B 3G5EA 2QCDB 3KBWA 1LQ2A 3QYQA 3KZPA 4IPJA 3PPHA 3GDTA 3SFKA 1DIDA 4GQBA 2RGLA 2GLKA 3NQFA 1DXFA 1Y8BA 1HKMA 2O9OA 4P8XA 1DTUA 1V51A 5XIMA 3UJRA 4B2DD 3S0CA 1UD5A 1FKXA 1I4NA 1CB7B 7ODCA 3QZ6A 1RP8A 2X0SA 1X6NA 3WH9A 4HYRA 3WQWA 2GSHA 1T99A 2G41A 3UR5A 4A6GA 3W28A 3C4UA 1IXNA 1FWIC 4GUHA 4LNCA 2EQ8A 1NP2A 1N8FA 3B8TA 4IXHA 4GZEA 1LORA 3BUVA 3E0FA 4RKAA 2MNRA 4JTLA 4YXGA 5HMSA 3UA3A 3ABRA 2VTFA 3CWOX 4QS6A 1G4PA 3T2OA 3UG3A 3QYSA 3H2FA 3PNUA 4FOUA 1B54A 3WK3A 2ALRA 2PLKA 2O4MA 3ARZA 1C29A 2QCGA 1FWJC 4CQAA 3HZ3A 1XH2A 1V0MA 2ONEA 1VLWA 4LU0A 3QEZA 1VFMA 4HNVA 2GDUA 3OBKA 3G1HA 4H7ZA 1A5MC 3CPUA 1HX0A 1V02E 1R8LA 4Z2IA 4UC5A 2UV8G 4JKMA 3R13A 4G1KA 3S5NA 2O7SA 3L4XA 4ZA0A 1WDPA 1VYPX 2PBGA 4HYWA 3LLXA 3TFCA 3TN5A 4GJIA 3LHWA 3IGUA 4LBRA 1TQXA 3EOSA 4UOZA 5A1AA 1N8WA 3BH4A 3ZFHA 4FF5A 3C52A 4FO4A 4H8VA 2ZFAA 4NJIA 3AUOA 3FXYA 3BQ6A 3NAVA 3ZJ6A 2WHMA 3O1NA 3UWYA 2WJEA 1EF2A 3BW2A 4FOJA 3A7RA 1UIOA 3FLUA 2VNCA 4CGTA 3WQVA 4ZZ9A 4MFDA 3CV1A 3A3HA 1IT8A 1GERA 3VIFA 4PMQA 4E2DA 3QBUA 4FXRA 4DY1A 2WPGA 3PUOA 3C2VA 1VS1A 1YPIA 1VBRA 2HNEA 1W8SA 4EK7A 3PPFA 3GYEA 5JUVA 2IKIA 3LMYA 4Q8WA 3F5KA 1CDGA 1W3TA 4JCLA 3THCA 4H4SA 2ISFA 3TJIA 3MBDA 1UHVA 4JBRA 5ABGA 3GFZA 1UMYA 4BWLA 2R14A 1GEHA 2QF7A 3PF3A 3KS6A 2E25A 1ONWA 3GBDA 5G1TA 2W92A 5HXMA 3HQPA 3PK7A 2YCLA 5ABTA 1BVZA 1EA9C 2F61A 4JFSA 5M17A 1XANA 4QQUA 3VKDA 1ZCOA 3EWCA 1JPHA 1US0A 2VGFA 3FGCA 4JQ2A 1Q1RA 3GRTA 1DQWA 3LV6A 1RV8A 2H3BA 5DBTA 1W5MA 2FFCA 2XYLA 1AJZA 3E2SA 3M0XA 3SCWA 2G3MA 2DVUA 2DW7A 3GSMA 1XYZA 3HG4A 4R53A 1RLDA 1DXIA 4RPPA 2Q8ZA 3CTLA 3FS2A 1TSIA 1SW0A 4GZJA 5BXPA 4XZNX 3PUDA 2OT1A 4YLWA 1NF0A 2QUMA 1E71M 1VQTA 2CESA 3BZGA 4QLKA 4KEMA 1ML1A 3WNLA 1PL9A 1QI4A 3EX4A 4JTHA 5CZ0A 5D2VA 5FJJA 3LQLA 1Z7AA 2CZ5A 2FVKA 3A3XA 5DRIA 3EWBX 1ISWA 2F2HA 3EX2A 4YCOA 4OIFA 1X98A 3M0KA 3HN3A 1EGZA 2A8XA 4RDWA 4LUSA 2FJKA 2NUWA 2QAFA 4H4TA 3QGAC 1YW1A 3L68A 4HNCA 4BFAA 2WVTA 3G1VA 3CHEA 4ADTA 1JAKA 1THFD 5LA0A 5FACA 3GG1A 2X8HA 4NZCA 1T0OA 1ZBCA 4OKDA 4HSNA 4GI4A 4MMWA 1SJAA 1WXYA 5GNXA 4REQB 3UWQA 1PUDA 9XIMA 1EX5A 1O5RA 4I5UA 6TIMA 1XIDA 2VWSA 1WP6A 3O9NA 1CXEA 4WGXA 4CD6A 1ZJAA 1GETA 4MYAA 3OLIA 1KFCA 3B3DA 3NQDA 1POKA 5CG7A 4GJJA 1GSNA 1QNPA 5I00A 4Y8FA 2W0HA 3FJ4A 1HKIA 5A6LA 4AZHA 4KKXA 2NV9A 4QDMA 1A5KC 1TVLA 4AISA 1EXPA 4LRTA 2NVCA 1X1OA 3TH6A 1DIOA 3RR1A 1H5YA 4IL2A 4QTGA 4H7VA 2VCAA 1YXYA 4ZE4A 3U8GA 4DBSA 5E09A 4YMZA 3AS0A 1QNQA 5C5YA 1UR9A 1XICA 1W1YA 1BG4A 4DBEA 2BGQA 3II1A 4WDUA 4FF7A 3M16A 4ZO7A 4DNHA 4IJRA 3WK2A 1ZSXA 3V1PA 4Z1AA 4DELA 4HTBA 5FF0A 4AIBA 4OECA 4IH3A 2G37A 1QPNA 1ZBWA 1XIHA 4K7YA 4YJ5A 4JTDA 1EIBA 3GD3A 3KTXA 1GG0A 1MO0A 4YTRA 2C0HA 1LRQA 4XK2A 2JK2A 3KRUA 4JHOA 5HQEA 3KDNA 2R1KA 3FJNA 1TIMA 1DIKA 5MF5A 4S3EA 1CIUA 5I2UA 4R33A 1JD7A 4HKPA 4HPXA 4DF2A 3JZEA 4ZOCA 5D2WA 4MB4A 1ALDA 2R1LA 3DYMA 2FMOA 4KRUA 4HHMA 3GW0A 1F6YA 2VEMA 1DV7A 1XIEA 5IFPA 4H4RA 4MYXA 4R85A 4QFUA 3NR0A 1C93A 3DFQA 3F5LA 4B5WA 3EZ4A 3W81A 4PH6A 1MW0A 4N9DA 3W1NA 1DIEA 4LB4A 3KUMA 2XWDA 1U83A 3BWWA 4N6EA 3MP5A 5M2FX 2QUTA 4HPGA 4JTTA 4IFKA 3PZ9A 1L8NA 3EXSA 3VIMA 4JY8A 2B81A 5BRBA 3IACA 4PCFA 4KH2A 7A3HA 4CNSA 2C3CA 1LROA 2HVOA 5FS9A 1GZGA 4XAPA 1ZDLA 1OBAA 3NZRA 4BV6A 3A5FA 4PTNA 3WF2A 3H7VA 3UD6A 5FJOA 5HUOA 3KE0A 4IP7A 1OCJA 1S38A 3QMSA 2OWWA 4BI7A 4C6CA 3CGTA 4B5UA 3VX0A 2BC0A 2X30A 1X2HA 3U5YA 2X1RA 3ELFA 3TYAA 4FR6A 3CAQA 3SCPA 4MFEA 3DK9A 3ITOA 2WMFA 3VZXA 1C90A 3DFOA 4HA0A 3SJNA 4Q4QA 1UWAA 3ICJA 4CQBA 1WV2A 1C3FA 1PXGA 4L6HA 4L61A 2DT0A 2ZUVA 3WDPP 3ZYZA 3C0SA 2V9DA 1YADA 4HCHA 4AD4A 4RX0A 4YNGA 1U5VA 4KIRA 2DQWA 4LB3A 1F9CA 3CL6A 2WHLA 3TOPA 2O9PA 2Y0FA 3C61A 2GK1A 2TMDA 3Q4DA 1JROA 3PZVA 2AAQA 3G6MA 5D38A 3DFNA 4LV4A 1LF1A 4FALA 2Q01A 2CPUA 5I79A 2XWEA 4G56A 2WKJA 1LT7A 1JCNA 3OBAA 5A6KA 5EB8A 3QOKA 4H01A 4ZODA 2X99A 1E9YB 4XUYA 3BPWA 4FDCB 1UZ1A 3PSVA 1RALA 3URAA 3GNOA 2WZHA 3VVGA 3FVDA 2VFIA 3BSGA 3THAA 1Y5XA 4H04A 4N7QA 2YDSA 1NFPA 1EC7A 4R9OA 4A2SA 4UMBA 1MRQA 2EPMX 5DMYA 3RMJA 1NOUA 1RQEA 4MPKA 2BDQA 1V03A 4DJEC 4Y9NA 3TMQA 1CWYA 4TV6A 2PTWA 5DCEA 5CZKA 2IQDA 4JEQA 1OZMA 4CQ9A 1IR1A 1GVOA 1QMLA 3RCYA 5FSDC 1WX0A 3EF6A 3VOIA 1OD0A 2A85A 2V3BA 4ZO8A 1VH7A 1DYSA 2DEPA 1UZ4A 1TVPA 5CBJA 1B3WA 5BRPA 2CLKA 1XIIA 1YPFA 3II4A 4PRWA 3A64A 4DF0A 4JTRA 3MU7A 2QEZA 2D1ZA 1AJ0A 3CMJA 4HOXA 2VD9A 1W5PA 3SN0A 4AD5A 2F84A 3B06A 1I1XA 1PZ1A 1RZMA 3NVZB 1VPXA 4XZLX 1GESA 1ZMDA 3DOPA 3FV9A 1K8ZA 1X1ZA 4WGHA 5LIWX 3ECQA 1E6RA 3KWSA 3M5YA 4Q4KA 4IMCA 1TV8A 3MWAA 2WJFA 3AXHA 1FCQA 5AYXA 3WL0A 2Y7EA 3BOXA 3CT2A 2VC6A 3VIJA 5DX7A 1GHRA 2GRTA 3AIWA 4FS9A 2IW0A 2WMJA 3EB4A 1GEUA 4UQ9A 4JQ1A 3TAKA 5J8LA 1VPQA 2X05A 2XN0A 2NWSA 2O55A 4A4AA 3PZIA 5JQ9A 4HP5A 4H4XA 3DKLA 4E38A 3VD9A 3LPFA 4GO8A 2EBNA 1V93A 3LRKA 1KFLA 3GRIA 3KHJA 1QNVA 2QS8A 3PTQA 2WQPA 2E09A 5CLWA 2A6NA 1FFQA 2VDGA 4HVXA 1MW2A 3GK0A 3BLFA 1OCQA 2ZE0A 3SSJA 2ZA3A 2MUCA 2JIWA 3VCRA 3KL3A 1S1PA 3IJ6A 2HPIA 1A5CA 2QHAA 3W1AA 8XIMA 2XN2A 4DPPA 3S1XA 4O19A 2VX7A 2YBTA 3VNYA 3KEHA 3MUZ1 2CLFA 1DWJM 4J3ZA 2EJAA 4EQXA 1VJSA 1KKOA 5I78A 3TV8A 2QDHA 3WF1A 4E5TA 3RM8A 3AS1A 5FEWA 1SZEA 4JFVA 1V6VA 4CNTA 5F2GA 2VCBA 1F5ZA 2O4QA 3DGHA 2J79A 1ME9A 2DZAA 1N61C 4JHMA 2XH2A 4AY1A 2YL5A 4R7WA 1J01A 2YBUA 4EPDC 5C54A 4W85A 3VMPA 4DEFA 2DH3A 2PS2A 2HJPA 1G7UA 1ZBVA 2PP1A 4QIUA 4AQLA 2AMXA 3JZUA 5I3KA 5A94A 3QSTA 4I9AA 2VOMA 1VDVA 1UYQA 4HPHA 1JULA 2WANA 4X60A 3WDJA 2IUZA 3BJFA 5K4ZA 2CETA 4U2YA 3MUIA 4IFKB 1MO9A 3C2EA 2BMBA 3WMLA 1A4LA 3BG5A 4FA3A 1F8IA 1IZCA 3NQ8A 2CLHA 3HOJA 3L21A 1E0TA 2MANA 2QAEA 1HIZA 1N55A 1VCVA 1N5WC 5CEWA 1Y5WA 1AQMA 4GIYA 3U57A 3B0YA 3WNMA 1KFKA 5CGQA 2VUNA 2Z28A 4HPNA 4I9MA 3A6OA 3VX1A 4ZOEA 1P6BA 4RV3A 1KBJA 1K9EA 1JD9A 2WPFA 3RN6A 5AFDA 3MANA 4EXBA 4CNNA 5G5HB 2BOGX 1W3NA 2PDUA 3E2RA 4Z1CA 1XCXA 1ONRA 1AQ0A 1J5SA 4NZFA 1OK4A 3HBLA 4WLCA 4R3UA 3DU0A 3GU9A 3H2NA 2Y89A 3A9BA 3GXIA 5EMMA 3ATZA 3NDZA 3E2VA 3GY1A 4C6PA 4WJXA 3LGDA 4TU1A 3K4DA 2Y63A 3CM4A 4XBSA 4QG6A 3CV6A 4O4VA 3A3WA 3CAKA 3NGFA 3WLKX 1H4PA 3CBWA 2GK1B 3WF4A 5IOBA 4Q6JA 5U7SA 2X42A 1QRQA 4HZMA 3H26A 5D9MA 1I6NA 3N13A 3WK1A 4KCUA 3S2LA 4L65A 3UESA 2BTMA 3M0IA 2WC3A 3ZMRA 1NTHA 1SYTA 4E8GA 4AAJA 3OTRA 2ZYFA 3N25A 3NQMA 4K2SA 1VJIA 2D0GA 2G3IA 9RUBA 2I9EA 2C14A 4MJ4A 3S1VA 5G1YA 3N1AA 3RFAA 2HE5A 1Q8JA 4J5NA 1DXEA 2OEJA 4DBWA 1EJRC 3P5ZA 3AHXA 3Q58A 4XIMA 3UR8A 3OIHA 4GMEA 3FHAA 2QCMA 1HKVA 1QNRA 1FOBA 3DFYA 2XM2A 3REQA 1JUBA 4ILSA 2J8TA 1EP2A 1IGSA 1R2TA 3TLLA 4JEJA 2A3LA 1KBIA 1B3VA 2JFEX 1P0KA 4ZQMA 3PBYA 3PG9A 2D69A 1TPWA 2YFOA 3GQYA 3ZJ8A 2R1NA 3TYDA 2B31A 2F9RA 1BWLA 4AZBA 5HNNA 1RCOB 4DIAA 3AIRA 1AJ2A 3BV4A 1W1B1 1GPFA 3LNPA 3E0WA 1RQHA 4IQLA 2R94A 3KL0A 3OW1A 2FHBA 1VFOA 4QSHA 4M24A 1YBQB 4GE8A 3KL5A 2G3FA 1O6IA 2Q09A 3PWAA 4WDTA 4PFHA 2W6RA 5I3JA 3EX3A 2PRMA 2V5BA 2FIQA 4IMEA 2OSWA 4NNAA 1RJQA 3RAOA 4DRSA 2C71A 1MI3A 3KOYA 4LVGA 2RDWA 3TYUA 4YCPA 3I65A 1XM3A 3ABXA 1KWGA 3M0MA 3IGHX 2A2IA 3VGBA 1RK6A 4GQGA