4K8GA

Crystal structure of d-mannonate dehydratase from novosphingobium aromaticivorans mutant (v161a, r163a, k165g, l166a, y167g, y168a, e169g)
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
403
structure length
386
Chain Sequence
HMKITAARVIITCPGRNFVTLKIETDQGVYGIGDATLNGRELSVVAYLQEHVAPCLIGMDPRRIEDIWQYVYRGAYWRRGPVTMRAIAAVDMALWDIKAKMAGMPLYQLLGGRSRDGIMVYGHANGSDIAETVEAVGHYIDMGYKAIRAQTGVPGIKSLPSVTGWDTRKALNYVPKLFEELRKTYGFDHHLLHDGHHRYTPQEAANLGKMLEPYQLFWLEDCTPAENQEAFRLVRQHTVTPLAVGEIFNTIWDAKDLIQNQLIDYIRATVVGAGGLTHLRRIADLASLYQVRTGCHGATDLSPVTMGCALHFDTWVPNFGIQEYMRHTEETDAVFPHDYWFEKGELFVGETPGHGVDIDEELAAKYPYKPAYLPVARLEDGTMWNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme, N-terminal d
publication title Crystal structure of D-Mannonate dehydratase from Novosphingobium aromaticivorans mutant (V161A, R163A, K165G, L166A, Y167G, Y168A, E169G)
rcsb
source organism Novosphingobium aromaticivorans
molecule tags Metal binding protein
total genus 142
structure length 386
sequence length 403
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4k8gA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4k8gA01
6ENLA 2QDEA 1OEPA 3UCDA 2POZA 2P3ZA 4GYPC 1FHUA 1BQGA 2GGIA 3I6EA 2GDQA 3VCCA 1R0MA 2QQ6A 3DEQA 3OTRA 3SN0A 3MQTA 1W6TA 2QGYA 4ENLA 1ECQA 2GGHA 2PU0A 3ES7A 3DERA 1IYXA 4HPNA 2O56A 4KWSA 3VC5A 4DWDA 3D47A 3PWGA 2RDXA 1R6WA 3NZGA 3THUA 1PDZA 4KEMA 4ROPA 3ZVIA 2AL1A 2OZTA 2MUCA 3UJEA 3BSMA 3STPA 4K2SA 1YEYA 2OX4A 4MKSA 1EBGA 1FHVA 2XGZA 4ZCWA 2MNRA 3ES8A 3GC2A 3RITA 3DFHA 3FXGA 3TWBA 3U9IA 3JZUA 3OPSA 4HN8A 3DGBA 3DG3A 2ONEA 3UXKA 1KD0A 5FJOA 4GYPA 4E8GA 4J3ZA 3UJSA 3N6JA 3H7VA 3ZLHA 3CAWA 5FJRA 3UXLA 3PK7A 2XH2A 1NU5A 3U4FA 3CB3A 4EWJA 3GY1A 3R1ZA 4E4FA 3GD6A 3OP2A 4IZGA 2AKMA 3D46A 2QJMA 3BOXA 4FI4A 4JHMA 3FV9A 4E4UA 3TWAA 4JN8A 2ZC8A 3S47A 3VCNA 1F9CA 4HCLA 4Z1YA 5ENLA 3ENLA 3N4FA 1L8PA 3R11A 7ENLA 3MZNA 2OQHA 4GGBA 2HXUA 4H2HA 3RRAA 1MDLA 1MUCA 3R25A 3TW9A 3Q4DA 2QVHA 1ONEA 2OVLA 2FKPA 3P3BA 4G7FA 3QKEA 2P8BA 3MWCA 2HZGA 2PTWA 3JW7A 4HNLA 3MKCA 3B97A 3PFRA 2AL2A 3DFYA 3P0WA 3SQSA 3MUCA 2PTXA 4HCHA 3QN3A 4H1ZA 4IT1A 2PTYA 4JN7A 3R0KA 2XH4A 3RCYA 3RGTA 1MRAA 3K1GA 3EEZA 3P93A 4GIRA 2XH0A 3SJNA 2GL5A 3CYJA 3QPEA 3IJQA 4M6UA 2ZADA 2CHRA 3T4WA 1EC8A 4GFIA 2AKZA 5EU9A 3TTEA 3DDMA 4IHCA 2PPGA 2DW6A 2PSNA 1EC9A 3QTPA 2PODA 2OPJA 4DXKA 2HNEA 1JPMA 3FCPA 4J1OA 1EC7A 2NQLA 5FJUA 4GISA 3V3WA 3HPFA 3SBFA 2OO6A 4E5TA 3V4BA 4FP1A 2PTZA 2AL2B 3H70A 3RR1A 1DTNA 2OQYA 3FYYA 3R0UA 2P88A 3UGVA 3RO6A 4E6MA 5BOEA 3FJ4A 2P8CA 3EKGA 3ZVHA 3S5SA 3V5FA 3IJLA 4IL2A 4HNCA 3ZLFA 2QDDA 1KCZA 1XPYA 1EBHA 2PGEA 3UJFA 3T8QA 3T6CA 3DESA 1ELSA 3ZLGA 4K8GA 4KPLA 3VC6A 4DYEA 1KKRA 1RVKA 4A3RA 3OZYA 3H12A 1KKOA 3V5CA 3DG6A 1NELA 2PGWA 3VDGA 1JDFA 1E9IA 3KUMA 2PA6A 1WUFA 5FJPA 2OZ3A 5J04A 1WUEA 2HXTA 3SN4A 4K1WA 4H83A 3SSZA 4DX3A 4MMWA 3TQPA 2OZ8A 2GGGA 3JVAA 3TCSA 2OLAA 3NFUA 3TJ4A 3DIPA 1SJBA 4M0XA 2OFJA 3T9PA 4MGGA 3DG7A 2P0IA 3Q45A 2FYMA 3SN1A 2PMQA 3TJIA 4GMEA 3VA8A 3GO2A 1SJDA 3NXLA 3ZVHB 2PS2A 3I4KA 3UJ2A 3H8AA 4F4RA 4IP5A 4DHGA 1TE6A 1JPDX 4IL0A 1JCTA 2DW7A 3CXOA 3VFCA 2GGEA 1P43A 2OKTA 1MNSA 4DN1A 3IJIA 4HCDA 3R10A 3UCCA 3N6HA 2PP1A 2XH7A 3CT2A 3I6TA 4YWSA 4ZA0A 2XSXA 1TZZA 4G8TA 3N4EA 1XS2A 2I5QA 3FVDA 3QLDA 3CK5A 2QJNA 4A6GA 2PU1A 4HYRA 4A35A 5FJTA 3UJRA 4GGHA 3OZMA 4H19A 3MSYA 1PDYA 3BJSA 1MDRA 1P48A 1SJCA 2PP0A 2OG9A 5BOFA 4IP4A 2PP3A 2QJJA 3PWIA 4X2PA 3OW1A 2PCEA 3MY9A 2GSHA 5IDZA 1BKHA 2GGJA 1TKKA 3IK4A 3NO1A 4Z17A 1SJAA 4KT2A 3TOYA
chains in the Genus database with same CATH superfamily
3MHFA 4JDRA 2BSLA 3FA3A 1CDGA 3OQEA 4LH8A 2Z28A 3T55A 3DJJA 7CGTA 1QUMA 2J75A 3N29A 1OG0A 3FAWA 2GQ9A 1R0MA 3OLEA 4LXFA 3W00A 4RXGA 1Q6EA 1POJA 2GUYA 3MQTA 5AYBA 3TQ0A 1ECQA 4NEVA 3O6AA 3KZPA 1FCBA 2GK1B 1XCXA 1GVEA 4ZQMA 3VGFA 3S9YA 3CQHA 2VEMA 4LAZA 5CJNA 2GVYA 3VXGA 4IQDA 1CGTA 3CUHA 3C2YA 4N4PA 1GJWA 4ONVA 1S1PA 4AF0B 5CC7A 1OY0A 1TV7A 1RJRA 1UBPC 3QH2A 4JTTA 1UR1A 3N6QA 4LVBA 4NZ5A 3MB9A 3TP4A 2D20A 4PB5A 3JRKA 3O6YX 4H7VA 5I23A 3G2GA 4AH7A 3T78A 4FOJA 1KGXA 1MYRA 4GNJA 3ITCA 1OSEA 1IT0A 2DH3A 3TROA 5FF2A 2A3AA 5LGZA 3BMWA 2ONEA 2D73A 1NDVA 3TX9A 1LT8A 5FD0A 1XG3A 1EGMA 3M7WA 1YTEA 3WN6A 4F66A 1FDJA 4CQ9A 3ZR5A 2NQ9A 5FIPA 3NTYA 1RA5A 3WLMA 2DV0A 3N6JA 2I5GA 4BEUA 4R7WA 4GI9A 3QGKC 5BRQA 2BHZA 3ID7A 1EP1A 1QI4A 3QMSA 3CB3A 3FDGA 3WLRA 3PB2A 2X09A 1A5NC 1BXNA 4QITA 1UCWA 5FACA 3A4AA 1D3HA 1RBOB 4HOXA 2AOSA 5AHNA 5ENLA 4ZFMA 1L8PA 2FGZA 2DIKA 3R11A 2XZ7A 1Q2RA 1MUCA 2YX0A 3CL8A 4U31A 4GQBA 5A6LA 1FTXA 5I07A 2BFGA 1DP0A 3P3BA 1XCFA 4X9YA 4GJIA 4HNLA 3JW7A 3DI0A 3TONA 3C2OA 1UWTA 4N02A 4UC5A 2X2YA 4RJEA 2NQHA 4C6LA 3FXYA 3MUCA 1GRGA 9CGTA 3S8HA 4H4YA 2IMRA 2VX7A 1V0NA 3B40A 1A5AA 1H7OA 1QNVA 2NX3A 2ZRWA 1XSIA 2Y8KA 4LV9A 1A3WA 1W9BM 5G2IA 3E0IA 1XIIA 3ZFHA 3STEA 1MRAA 3SQMA 5C7VA 4R7OA 2XH0A 4HSHA 3UY8A 1HF6A 2C1IA 3K8KA 1C9DA 3CIWA 1UR2A 3EX4A 3N2OA 3BV7A 1XRFA 4GUGA 1EXBA 3ZOAA 3O06A 5DMNA 3TZFA 5I09A 1UR8A 4GFIA 1S1RA 2QDGA 1TV2A 3VM7A 1PCKA 4B16A 2WKGA 1YBQB 1QBBA 4YNGA 4H4VA 4D8LA 3MVIA 1VBRA 1XGZA 4GIEA 3RHGA 3ME3A 1DHPA 2BC0A 3SY1A 5FJIA 3KVKA 2VZSA 2YL6A 3V3WA 2HSAA 3OLGA 4WJEA 3W4RA 1A80A 1HJQA 6A3HA 4GE8A 2G0WA 4PTMA 4JTKA 4LS0A 1KTBA 4YXGA 2YBTA 1Y5WA 2QJHA 3HGRA 1E9ZB 3K30A 1DQXA 4PCTA 2UY4A 5IDIA 2A7PA 2WZEA 2X0YA 4AZ5A 4E2BA 2O92A 1HQTA 1ME9A 3UJFA 4REQB 4AAJA 3N2BA 3LU2A 5DT5A 4EM4A 4C7DA 4KPLA 5A69A 2BTMA 4QSHA 3IGHX 2HPMA 3HURA 3NCOA 1KKOA 3BZGA 2OSYA 4CD6A 1H1ZA 5G5HB 1UH2A 3HOJA 4HZ7A 3TFCA 1E9IA 2OWXA 3BAWA 3KOWA 2D2OA 3WDHA 3ANUA 2C19A 1U30A 4JTSA 3G3DA 4JKMA 1KGWA 4AIOA 2XIBA 1TELA 5BMWA 5ABGA 3P14A 2ACRA 2P5NA 2FZDA 3WLKX 4IJCA 3APTA 1RCXB 3S1XA 3L5AA 1IR2A 4IPPA 4K6AA 3PTDA 2C8NA 3CUJA 1VFHA 3P0XA 4L1GA 3F03K 4DAIA 4GUHA 2GDVA 4LIIA 4HHMA 2QCDA 3MO4A 2FYMA 4QDWA 5CC5A 5CZ0A 4I5UA 3IEBA 2DZAA 5A6BA 5FCZA 3IAPA 3I4KA 2PEVA 4Y7EA 3VZZA 5JBDA 3VPLA 4QDPA 5I5RA 3KEHA 3STGA 4DUVA 4UTMA 1OZQA 3LB8A 3PG8A 3CXOA 2GR1A 3ANYA 1NTHA 3FIGA 1VC4A 3ARXA 5JCLA 1AZ2A 2ZZ5A 4TMCA 3W1TA 3WIJA 1LUCB 4CCDA 2E6DA 4QAWA 5F2MA 4V28A 4YWSA 4C6JA 3G1RA 2CHNA 1ICPA 5HWJA 2CXGA 4KFNA 3B8IA 4HSNA 4D6FA 2PDIA 4NI8A 2QJNA 7ODCA 1G6CA 2Z25A 3HQPA 2JGYA 5C9XA 3THQA 3NGFA 1XV8A 3ABZA 3PP7A 3B9JB 4ROQA 3LI0A 1WV2A 1VKFA 5EKYA 2WO5A 3PPFA 3SCQA 1ODUA 3AICA 2PP3A 5EMJA 4X2PA 4M51A 3TW6A 3MHGA 3FY1A 1QDSA 1JAEA 3GFXA 1SZFA 2ZX5A 2QPUA 3TYAA 2F38A 4TX6A 4CQDA 1E56A 1G7VA 2TMDA 2B81A 1JUKA 4KT2A 3II1A 6ENLA 3UXDA 2DH2A 4GI4A 4A2RA 1CXHA 3KBVA 1BQGA 5TNVA 4WDTA 4QRNA 3WFLA 1JQXA 4AD2A 4OKDA 4F0KA 3C86A 2C13A 3QC3A 4O1EA 1TG7A 2PUZA 3R5EA 4NRRA 4E3TA 4LAOA 1C29A 2XPKA 4M8UA 2FJUB 2IPFA 2V3BA 3M0KA 3C8FA 4UTWC 1PZ2A 4B5VA 3ES7A 3NG3A 3NM1A 2VFIA 4FNTA 4O4VA 4O50A 4Q4MA 4UTLA 4Z42C 5BWFA 2DSWA 4JFWA 3ABQA 3BOLA 1GOXA 3QRHA 4DZIA 3QF0A 1H6VA 1AL8A 5FSEC 3WJXA 1OT2A 3L66A 1REQA 4LW7A 4PMJA 3ZVIA 3ITGA 1MEHA 3H2NA 3CUIA 5DXYA 4NASA 2EG8A 2PWDA 4W86A 2F6KA 4W5UA 4LRTA 3HGOA 2QF7A 4P7QA 2PGRA 4WHBA 3TVAA 4XAFA 3RPDA 2MNRA 3JU2A 4M7SA 4ERGA 4TVWA 4WJXA 3WEMA 2PWVA 2JK2A 1ZP4A 4AWTA 4EIVA 3VKKA 3NSXA 2VGBA 2QPSA 3T0TA 3N25A 3PG9A 4UQDA 4I6VA 3O0HA 2Y7EA 4A3UA 2R9RA 2I14A 1DNCA 3FSUA 1O5RA 2ZVIA 3D0CA 1Q6OA 1VYSX 3G22A 3W28A 4LANA 1VLWA 1I1WA 1WZAA 1UD3A 2ICSA 1W54A 1ZCOA 1J18A 3EWCA 5D2YA 4PRTA 5HBFA 4O16A 3B0XA 1MRQA 2Z4GA 2JQXA 4NAFB 1WKYA 3NZQA 1A5LC 1O68A 1U1UA 4ZXOA 3LCGA 3RN6A 4Z1YA 1EH9A 1SMAA 3VGDA 5I3DA 1QAPA 3DI1A 2XN1A 3FN9A 5CZJA 3KXQA 1LLOA 2QVHA 4O1FA 2PC8A 1FWSA 4RDZA 4JX4A 4ZL1A 2IQTA 1IXPA 1E4IA 1VR6A 1TJRA 5FEPA 5EBKA 4KS0A 1B9ZA 5C9WA 3MI3A 4E2DA 5FF4A 1LCOA 3T2OA 1I2QA 1E0VA 3ZR6A 4CN4A 3M41A 4WSKA 3WH7A 5A95A 3W1AA 3WD2A 1VEMA 1XLLA 3E2SA 4DJEC 4RUBA 5MKGA 4UCGA 3IGSA 3EOOA 4FXRA 1RHCA 4ZOHB 2PZNA 2F9RA 3W6LA 1XR2A 4EAYA 2Y61A 3H22A 4RCXA 3SDOA 2BX7A 2PDJA 4R33A 1LRQA 2VX4A 1E4MM 2GYIA 2REQB 2V3AA 3A4XA 2O4MA 2OGJA 3CPRA 3C3UA 2VP8A 3KFTA 3W75A 2XGBA 1FECA 1LP6A 3IACA 2QUMA 1FFVC 2UV8G 4QEHA 1HO4A 4M1BA 3PFMA 2OU4A 1NDWA 3GXFA 3GYEA 4Z1CA 4MY1A 3FCPA 4KEZA 3WJSA 3DYMA 4C91A 2IQDA 3GSMA 2OO6A 1US3A 5I24A 5I00A 2AGKA 1EWEA 3EBVA 4L4PA 3CLWA 2VNCA 3HFYA 2G3NA 1AA1B 2H9AB 1CXLA 5IFTA 1X38A 3R0UA 4M3PA 4BV6A 4E6MA 4A2SA 2FHBA 2I1OA 1M6IA 4M81A 2FPTA 1PX3A 1W5MA 3QLLA 2CYGA 3B8UA 1IZKA 1EEPA 1MW1A 3UPMA 3NUKA 3B9NA 4OHQA 4B5TA 5AYZA 2A2IA 4P8XA 5DRIA 3CV1A 3B03A 3VKCA 4HA1A 5JUVA 5AC4A 4HHPA 3LLXA 2YDAA 1RPKA 5TD4A 1GG0A 1H61A 2YVGA 2R91A 3UGRA 4W9TA 3H4XA 3LPPA 2VZUA 3GUGA 3WFZA 1WUEA 1K70A 2D2HA 5IFPA 2DFAA 3JS3A 1HP4A 2VO5A 5DX7A 3PHAA 2VTFA 3PB0A 4Q8MA 3RJXA 4AHPA 1X6UA 1ADDA 1XQLA 4UTKA 2EQ8A 3H2MA 5FL1A 2CBJA 3C0LA 1UG6A 2OT0A 3W2LA 2G4FA 4B91A 1MQRA 4JAWA 1QK2A 3UWYA 1LZOA 1J11A 1TB3A 1EDGA 3NURA 4QBXA 2YJQA 1ZMDA 1PWMA 2DUZA 3WL0A 3THAA 2C6QA 3EX3A 3HGSA 1H0GA 4H2CA 3W1RA 3MDWA 1LORA 1GOQA 1VDVA 2WVUA 3WQ5A 1EXPA 4AXNA 4TO8A 4HTYA 4AZIA 3FOKA 1TQJA 1ML1A 4X63A 3AXMA 5FS7A 1O12A 3M0JA 2XH7A 1DJNA 1WXJA 3POHA 4FLOA 2R1KA 2HCVA 3ISIX 5DFAA 4G5DA 1F4HA 5AZ0A 1WXZA 3ATZA 5LA1A 3HFTA 2W3ZA 3W7LA 4HMDA 1PBGA 3WQGA 1SFTA 3MJMA 3TMQA 3RUBL 4ATDA 3FHAA 1T8XA 1KCKA 5U1OA 1WDWA 1O1ZA 4XX6A 5JQ9A 5BOFA 5LNUA 3QOKA 1PZ3A 3AZSA 1V6UA 4I7UA 4TMBA 2VOTA 3OW1A 5D9MA 5TQLA 1DXLA 3CZLA 3TYCA 2CNCA 1Q7MA 1LOQA 2F2HA 1IWPA 4I7WA 5H8UA 4F3HA 2ZUWA 1V59A 3HG3A 2Z1SA 1DJYA 4HNUA 1YBQA 3GFZA 3CM4A 1DWFM 3KWSA 3W2JA 2H3BA 2QZRA 2XZ9A 1LDCA 5M5DA 4EQWA 5FEZA 4LBSA 3I6EA 4AC1X 3UA3A 3RX2A 1CXFA 4GX9A 1EDTA 1JRPA 3MUXA 1ICQA 3LTSA 3PUOA 1EPVA 1C7TA 5HJYA 1VIWA 2EKGA 4DJFA 3QMRA 1RQEA 1KC7A 4D8AA 4B5NA 2H8XA 3KWXA 4J3SA 4HPNA 3T4CA 4EAMA 1IIGA 1UIOA 3T42A 1E43A 2VQUA 3RFAA 1M53A 3OYZA 3I4EA 5EMMA 3C56A 1W3HA 2P76A 2C18A 3EMZA 1J96A 4JIRA 1JJKA 2OZTA 2UY3A 2CLMA 5D8WA 5DLCA 3W73A 5AC5A 3SUVA 1XDMA 2WJEA 3LPGA 1IIHA 4TQTA 1D7KA 1PZ0A 1YNQA 3WUFA 3EOSA 1IEVA 2BXVA 3G1AA 1ZCCA 3ES8A 3RITA 5HOSA 5CZKA 3P60A 2W63A 3VOJA 4H6EA 4HVXA 2A6LA 3EMCA 3S46A 4C1NB 1DJXA 2QCFA 1KXQA 3TNOA 1R3TA 4X3ZA 5DEZA 3LRKA 1SUXA 2CEQA 4GYPA 3UA4A 4KKXA 1PTAA 2NX9A 2BXZA 2GR0A 1GYNA 2WVVB 1H2JA 3W70A 3KCJA 3ZLHA 1P5BA 4ZGYA 4N6EA 2E28A 3TYEA 3PK7A 1AD4A 1BVWA 1CYGA 1Y8BA 5DN1A 2PD5A 1PYFA 3GY1A 4ZQCA 1GRBA 1I1XA 2FHCA 4XQ6A 3STCA 5IBXA 4Q8NA 1UKOA 4KGJA 2PZ0A 4K7YA 3OO2A 3N4FA 2GVEA 4Y6GA 1W8GA 1DEDA 4BFAA 5CBJA 4QJ3B 2OVLA 1E9LA 2QMKA 3IV3A 2FKPA 1PHWA 3W37A 2J7FA 4BI7A 4S3DA 1KM2A 1OK4A 3QQ1A 4J2MA 2JGQA 3RX3A 3I7SA 3CJPA 1OC7A 3PBWA 2Z24A 4PBFA 5LYRA 3B3DA 3L4WA 5AYXA 3QN3A 4LAMA 1EO7A 3CAQA 3VNDA 2EPKX 1FRBA 4HP5A 1XIDA 3CS2A 2PFHA 3NQDA 1IGSA 2PDYA 1R3VA 6XIMA 1IHIA 3SJNA 2PWUA 2XVNA 2ALRA 3RK8A 2Z26A 1FXQA 2W9MA 5C8BB 3G1HA 2WSKA 1CGWA 4H4TA 2FDMA 3EKLA 1OF8A 3OVPA 4R85A 1DE6A 5HDRA 1EC8A 4GX8A 1WBHA 3TYZA 3W86A 4RPPA 4ASTA 1GJPA 2YSWA 3MDUA 1BYCA 2XIJA 4W85A 1YNYA 4HIBA 3TTSA 1ZJAA 1V6VA 1M01A 3VOGA 3FK4A 5FJUA 1ZGDA 3GNOA 2J9XA 1F8WA 4C90A 1H63A 3H70A 1UKQA 4C6IA 1EDQA 2G50A 2PDUA 5I3HA 3FA4A 2NWSA 3BARA 4IL2A 5T26A 2VFHA 1H50A 3L23A 1KCZA 2JBMA 1TPB1 3ARTA 4B92A 3AMDA 4MWAC 3QPYA 2FB3A 4O4WA 1UQYA 3HGJA 4IQEA 3F5LA 2HDJA 1KLYA 5DF0A 2IKIA 3A4JA 2V67A 4YWOA 2JIEA 2GOKA 2BHUA 3QSTA 2E3TA 2KAUC 2BS9A 1AW5A 3WNOA 1FCVA 4H9XA 1CGXA 4B5WA 3HV9A 2YXGA 3TQPA 2OZ8A 3EKZA 3BICA 5CC6A 1SM9A 1FCUA 4F0SA 3WFAA 3VUSA 5ABFB 4JIEA 4D6IA 4Z1AA 5IXEA 4IGNA 4M0XA 5DBUA 3VKAA 2EPHA 4DELA 1W9VA 3EZ4A 2P0IA 3FHQA 1S39A 1WKEA 5LA0A 3SN1A 3ZO9A 1MOKA 3K4AA 2BDQA 3OQ8A 1XYCA 4QGCA 2X1UA 4J4KA 1AQHA 3QYQA 2FMOA 4YHGA 1PS9A 1H1NA 3KP0A 3LCXA 1QK0A 1OM0A 1R85A 1ZPTA 4RV3A 1PX4A 4UZSA 3M7SA 4KRUA 1TE6A 2UZ9A 4C6PA 6ALDA 4DWSC 4HNOA 1ONXA 3NGJA 2OQLA 4AXKA 2NVKX 3KLKA 5AC8A 3I6TA 4LY8A 6XIAA 3QFWA 1EYEA 3QY8A 4WUIA 1HTIA 4WSHA 2CFFA 1F7BA 1EYWA 1QPKA 3A24A 1XS2A 2WZMA 5A8OA 2WWCA 3O6DA 5D33A 4DM1A 4CGTA 2WV8A 3EWZA 2G3JA 4S1FA 3WH9A 2XTKA 3L2IA 1S2VA 5M17A 1X6LA 4A05A 4PUNA 3MV01 4QE4A 3CLMA 2ISFA 3E74A 4YPJA 2OG9A 1IT7A 3F4WA 4FB7A 2QJJA 1OFRA 2QLYA 1I45A 3WKZA 3W2MA 4KF1A 1IGWA 3MY9A 4CU7A 1IEQA 4QNEA 4MKVA 4M24A 2CW6A 2XDFA 1X39A 3M0VA 3S1GA 4CNPA 1AH3A 2GGJA 5G5GB 2CPUA 1XIMA 4EMJA 1I6NA 4JCMA 3WNPA 3RLHA 2VCAA 1YX1A 2ZQ0A 2INEA 3MO7A 1TVNA 1WDSA 3E02A 3FKKA 4NZ1A 3CHDA 3OTRA 1TPWA 4PCPA 4W5ZA 3E0FA 3UP8A 4S3AA 3AXIA 3PPCA 3LXAA 3CHVA 1OIFA 4UOZA 3EOEA 1KM1A 4UMBA 4UFIA 4ECLA 4HSOA 2KZHA 1ZZMA 1DWGM 2FLIA 1PDZA 2OZ0A 1GJUA 1P1XA 3RM4A 3OGVA 1VIZA 3O16A 2MUCA 4O52A 2DGAA 3GFYA 1WO2A 2YR1A 1UKSA 3TJXA 1GESA 4LWWA 4A4AA 5CAKA 2C71A 3I3EA 4N4QA 4LCSA 1JQVA 3RMJA 3XIMA 1K6WA 2HTMA 4LJ3A 4NF7A 3EANA 1PL9A 3TW7A 5IRPA 1TE1A 2DT2A 1UZHA 1SU5A 4YL2A 1JUBA 3WL1A 3CPGA 1KD0A 3W01A 1N8FA 4LYKA 5D9OA 2G37A 3UETA 3CZJA 4DB7A 2C91A 2X40A 4MDOA 4O1AA 1GETA 5AYYA 2QULA 4AZHA 3CNYA 3BANA 5A8NA 1TJPA 5LKYA 2Y62A 4MZ8A 1QU4A 4U5KA 2G3IA 3UWZA 4I5XA 4K8EA 2WP5A 4ZOEA 2Q01A 4PUDA 2VCCA 3GD6A 4IZGA 4O1CA 3R12A 1VP5A 3OA3A 3U5UA 2B7PA 3IIPA 3NJ3A 1CW2A 3TIMA 4HA4A 4GGBA 4GJJA 2C16A 4Q7BA 2D0HA 3LA4A 2BY3A 2GUBA 1ONEA 1S5TA 2PLCA 3ITXA 1P1MA 2ZTKA 1VQTA 1ME8A 1XLIA 4J56A 2PLMA 2YCLB 3AS3A 3IJ6A 4JIQA 3HJZA 2W4XA 4J57A 2NX1A 4JTJA 3OZPA 1BWLA 4PBGA 4XUGA 2WHMA 4TVYA 3C0JA 3NVVB 5DMLA 4ACZB 5HA7A 4GXWA 4RE2A 1BG4A 1TYGA 4MHBA 3WD4A 2WAGA 5RUBA 1T0OA 1L6FA 2ZDSA 4M80A 3SGGA 3O9NA 2VR5A 3VD5A 3OOQA 3QPEA 3HN3A 3RF9A 3VZXA 3LTYA 2ZADA 1CGYA 4TTGA 3GIPA 4Z2HA 2B7QA 2F2KA 1YXDA 4CD8A 3DDMA 4F79A 5G5IA 3QW4B 3BLLA 5FS6A 4DXKA 5FAJA 3VD4A 5I3KA 3RNMA 1H51A 1C3FA 4N9DA 1X7FA 1TSIA 2E09A 4FS9A 4DAFA 2FDSA 1RCQA 4EWND 3SBFA 3ABOA 3K8LA 1V3HA 3HTWA 1DTNA 1K4GA 3GX9A 4C65A 4WEVX 3BH4A 2DJLA 3PZOA 4XSMA 4DBEA 4MUZA 3AC0A 3OHMB 3D5HA 1TPUA 1TPH1 5TBOA 4FF7A 2A7NA 1QO5A 2PWGA 3C61A 4NT0A 3GBDA 1J0JA 1XXXA 4JTLA 3SQPA 4PUMA 5HXMA 4RL3A 5ER0A 2WJFA 4IJRA 1KW1A 1HZYA 4NX5A 2Q8XA 5CPLA 4YYFA 3UF9A 4JTAA 4OBSA 4E4PA 2DZXA 3P82A 5LIUX 2HXTA 4PMYA 1EZWA 2WLZA 4MAZA 3CUZA 3T0BA 3CIVA 2BB0A 4JD4A 3ICJA 3GS6A 3W9ZA 2J9ZA 4H9YA 1N2VA 3SRKA 2VXNA 3F4VA 4NYUA 2Z6IA 4DNMA 3W1PA 3CMFA 1YTKA 3DGHA 2ZWYA 3W3OA 1IXOA 2V3EA 1HKMA 3CAKA 3S42A 4HYWA 1XYFA 2XIQA 1OX4B 2PMQA 2B4GA 1HKWA 1M7JA 4NNAA 2VGGA 1ZXIC 2G41A 3DFOA 5IHSA 1UZDA 1M6JA 1ZHAA 3VYLA 4FXFA 2HVMA 4P7NA 3IC9A 1CLXA 2Z1BA 3MJYA 4V27A 3FNDA 3MUIA 3G1DA 2VZTA 3U3HA 3L0NA 3IK2A 4V1XA 4DZHA 2PP1A 3R8GA 3UWQA 2J6XA 4ZA0A 2FIQA 5CCZA 1EA9C 1XUUA 2E9MA 3URQA 4H7CA 2TAAA 4NZJA 4YS1A 4H4QA 2IW0A 1VRXA 4N9EA 2ZZ4A 1SW7A 3VD7A 3CXBA 2D22A 1YPFA 4A35A 4M56A 3BMVA 1ZJBA 1P0EA 3R79A 4H19A 4NZ3A 1QHOA 1MDRA 3IVSA 4DJED 3GRTA 3RPTA 4Q7NA 3AXHA 4XIAA 3U8GA 3VU2A 3TR9A 1H09A 3W29A 4WY0F 1O66A 1PO9A 4O17A 2CLHA 4J3TA 4HHLA 5FF0A 3AHYA 5BCAA 2C0AA 4EK7A 1D8CA 2JEPA 4GRTA 3CASA 1B31A 3MYOA 3NO1A 2F6XA 4W7VA 3BW3A 2Q6ZA 1WP6A 3ZJ7A 2EPMX 5J5DA 1JI1A 3VI2A 7REQA 3PUDA 1JXJA 1MWOA 1UA7A 4QE1A 1F3TA 1UWAA 3QV9A 4GXMA 2GDQA 1VJZA 5BYWA 5TF0A 4MYXA 1NWRA 5HPOA 3Q94A 1X98A 2ZFAA 2BC1A 3BAYA 2ZBTA 4GZEA 4LALA 4HA3A 1G7UA 5KZEA 2NXIA 1VJIA 5H1WA 1JZ4A 3USBA 3GTIA 4S3BA 1VFTA 1JD9A 2AQVA 3CV7A 3UW6A 5DY3A 5FESA 1A0EA 1PXGA 1I8JA 4ERIA 3RIKA 3M1ZA 1OCJA 3N18A 1E5JA 3DHFA 3T0AA 3RM9A 2Y8UA 2O9TA 2CC0A 5LNWA 4ZCWA 1H7RA 3M46A 3VIFA 4S2CA 3LX9A 4PRRA 3TLQA 3W1MA 3FXGA 3NVYB 3BXWA 1U83A 5CSSA 5EMLA 2ZA3A 2XISA 4AD0A 3PTKA 4LU0A 3NDOA 4F2UA 3USZA 2JKEA 1UWSA 2NQ5A 3AYTA 4DUWA 1JAKA 1W5NA 1NIUA 3SO7A 3M6YA 3EXRA 2QDHA 2OSXA 1NU5A 4NXSA 1B3ZA 4RR4A 2V63A 3RPMA 3BJFA 3AMLA 1GKQA 4IMDA 1SSDA 3LY0A 4JICA 4GR1A 4R9XA 1QRQA 1UD5A 1WCGA 3K13A 2VEIA 1FEBA 1JEZA 1NFGA 2PRHA 1ZQ5A 4XISA 4FX6M 5AOUA 2YZRA 1F5ZA 4DI9A 3LPFA 3V1HA 1HW6A 3NNTA 3TW9A 6TAAA 2OO0A 4BQ2A 3PBVA 2A6NA 4GWEA 3CHCA 5M2FX 2NXHA 3BDKA 2PLKA 3IUDA 4K39A 5F7UA 3L7RA 2ZCGA 4XWUA 3UQNA 2V9DA 1G69A 4ES4A 1RALA 2BG5A 1TRIA 4J27A 2WXDM 4G1KA 3CH0A 5CPMA 4H1ZA 2J8TA 4ICNA 3DUGA 1M9HA 2NW0A 1UD4A 3MCNA 3IIOA 1W1VA 1NF7A 1TMHA 3K5XA 1KBBA 1EFZA 3LLDA 4US5D 3O07A 4MDPA 2ZZ3A 4D1IA 4K36A 1DVJA 1OCQA 3C6CA 3R2GA 4O54A 4AY1A 4JX6A 1YKWA 3RCNA 3W7MA 2YL8A 2J4GA 3IUIA 3N9SA 1D2KA 2NLYA 2VVNA 2RABA 4HU0A 1A53A 3TC6A 2X7WA 1PTGA 2HRWA 1S2UA 1M7XA 4FLQA 4K7ZA 4PUKA 3QTPA 1T3QC 2XN2A 4JIPA 5E9XA 1RVGA 1SO3A 4FIRA 4CQAA 4ZXLA 1ZJHA 3GNPA 1XD1A 4PE8A 2CLIA 1WDDA 1E1FA 3PAJA 4ORIA 4GXPA 1BGGA 1EC7A 4HK7A 3GWQA 4GISA 3T7VA 1IXNA 2QIIA 1RXOB 1XLJA 1ZJIA 2B7NA 4GK8A 3QGAC 4IMEA 1H2IA 3VIKA 2CZEA 2BCPA 3MUAA 5F1UA 1YDYA 2FTWA 4ZQNA 1BWVA 5GNXA 3VZYA 4AHOA 1JEHA 3OHIA 4LUSB 1XP3A 2P88A 2NSOA 4JFTA 4GA8A 3RO6A 1ZTVA 1ITQA 3FJ4A 2P8CA 3DFNA 3MC5A 2QCCA 1EHNA 4M19A 2UBPC 4H7ZA 4IIFA 4TVUA 5HQEA 2QDDA 1O60A 3M5XA 4UR9A 4PMVA 4U3AA 4PMNA 4HPJA 1O95A 3ZS4A 2V69A 1KKRA 3VD9A 1EF3A 3GZAA 4MWAE 1HL9A 3WSUA 4IPJA 2NV1A 1VFUA 4CD7A 1EKOA 4JNYA 1VGAA 1Q6RA 3H2FA 1YW1A 3AIEA 4UUIA 5C2XA 4NZFA 4BZYA 4QQ3A 4JDBA 3G24A 3MA8A 2VEPA 1VLIA 1KV5A 1YXYA 3VMOA 1OFPA 1KCLA 1V3KA 3S2CA 3JVAA 3KW3A 3RMEA 1DWAM 3IVTA 3TCSA 2HWGA 3AQUA 3BCDA 2NUYA 2F7FA 3E0WA 1FWRA 3T9PA 4N0RA 4PMQA 2X42A 2OOGA 1K77A 1F6YA 4GMEA 1A3XA 1Y7VA 4URIA 4N2YA 3ONCA 1Q1WA 1NWTA 4XD5A 4F4RA 1AZ1A 4FOUA 5JH1A 2GGEA 1WDQA 1MNSA 2XHYA 2QUNA 1JVNA 1G67A 4JQ1A 3QSRA 1WZMA 4DJFC 3AYSA 3VK5A 4P8VA 4GG9A 1ME7A 4V15A 2WJDA 1A5MC 5B7ZA 4ORMA 2D23A 3S1WA 4IMCA 4UMCA 4H41A 1LG2A 3TLLA 3UJRA 5A8PA 5I3FA 3PNUA 2OKOA 2VEKA 3ZZ1A 4ADSA 4K8DA 1RP9A 4WIWA 2HBVA 1SJCA 1XLMA 4M29A 1GQIA 2PP0A 3S6DA 4LUTB 3SCSA 1XDIA 2J66A 3NYDA 3VNMA 3ZMRA 5JBFA 3U2CA 2R1LA 3PWIA 1ADOA 1BRLA 4AYSA 1STZA 5HWNA 1U33A 4U10A 1ZDLA 1RLDA 2H3DA 4S39A 1UC5A 1JGMA 1KM3A 3G8EA 2VMFA 3B8TA 1NF0A 3DC8A 3WDQA 3R6IA 4EF9A 3U57A 4Z2GA 2PF0A 5EL1A 1OYCA 3EOUA 7TIMA 3TDFA 3UCDA 2P3ZA 4GYPC 4IQLA 2HJPA 4JQ4A 1Q6GA 5AN7A 1DIKA 4L6DA 4ZE4A 1GQNA 2WPEA 1W6TA 3COTA 3PJUA 4A8RA 3MSRA 4YHEA 3CTTA 3MBDA 4GYJA 3WLOA 3WF4A 5C6MA 1UUOA 5IBXC 4IM4A 2J8FA 4DWDA 2DSZA 3BW2A 4ZTYA 4QFUA 4YMZA 1RQHA 4Q4RA 3QFBA 1BEUA 1JNEA 4DI8A 4K8HA 4FX8A 1SFSA 5CPTA 3S0CA 1GVIA 1G5AA 1XW8A 1AJ0A 2YA0A 4PUEA 3AUOA 3T40A 1AFSA 2ZTJA 2PF8A 4NY2A 2E5DA 3VM5A 1EIBA 4DO7A 2WSYA 3U7BA 1W2PA 1KRAC 3OYXA 2D3NA 4W88A 2GUUA 1DWIM 3GR4A 3PJXA 3U9IA 3LHUA 1J2BA 1F3XA 2JALA 2FZMA 3EDDA 3A3XA 2YDRA 4DO6A 4JYEA 3VIIA 1B54A 3PM6A 2V6OA 4QP0A 2OWCA 3T2QA 4I9AA 3U48A 5JU6A 1A5CA 4ZB0A 4MB3A 5I77A 1JL8A 3N19B 1E15A 4JL2A 4MVAA 3CHFA 3H24A 1OT1A 5D30A 4JQAA 1DIOA 5HAOA 2IS7A 5CZTA 1FH9A 3NPXA 4CNUA 2XWDA 1V4YA 2VEGA 4M6QA 3KRBA 3EWXA 2VC6A 5EBUA 3V35A 5HUOA 4F2BA 1Q85A 3A21A 4B5SA 4E0CA 2ZC8A 4HNVA 4KWVA 3ANVA 3ENLA 1KRMA 1TFVA 3UZJA 3QYSA 1CB7B 1ISZA 1ZENA 2PRLA 7XIMA 4O1DA 2MANA 5C70A 4MNKA 1VFLA 2PDPA 4CD4A 1XYZA 3R4IA 1BVNP 1JDAA 2OYMA 1K8XA 2WNZA 5JCKA 3S5YA 1P0KA 2RUSA 5JMUA 4XBSA 2Y85A 2QCGA 3SCVA 3WUEA 3ZWTA 1VHCA 3T44A 3AHZA 1L2QA 5K2ZA 1K7FA 1UR4A 4WVXA 5CGMA 3UXIA 3A5FA 4XD4A 3I3DA 3CHEA 3W82A 4PMXA 3RCYA 2WQPA 2GVGA 3O8AA 1FCQA 4J2PA 3G18A 4OIFA 1U5VA 4TX8A 4MADA 2YPIA 4LEQA 2VJXA 4JIHA 2QMJA 1FWWA 5PTDA 1TV8A 4LSBA 1SFLA 1W9UA 5F2IA 1HJXA 2XUCA 4FALA 6REQA 3EOLA 5LHEA 3WLPA 4TOQA 1Q7ZA 4B5XA 1TR9A 3IWPA 1HVXA 5I3GA 1JYNA 3WLIA 1VCFA 3DHDA 3GQYA 1EC9A 4GUIA 3TSDA 4ZODA 1S2AA 2OPJA 1OK6A 4EANA 5CBIA 3WDRA 2CLOA 5FL0A 3PZMA 1IR1A 1RUSA 3AISA 3RLVA 2J24A 3ARZA 3CGTA 3EF6A 1O7AA 3P80A 2IPWA 2XM2A 2YQUA 4L4LA 3KLLA 3GXTA 1P6WA 2PC4A 3CMJA 3VNIA 2YKKA 4JHOA 4LF1A 3PZVA 4E8CA 1E6QM 1Q6FA 3B9OA 4FR6A 3L8KA 3P8IA 3U5YA 4A3QA 4X61A 3WQWA 1XPGA 4JTGA 4FXJA 1IXQA 3SZ8A 1EJVC 3CBWA 1J9YA 1YDOA 3KBSA 4HPHA 4YYCA 3TN4A 3DESA 1XDJA 3VILA 1RVKA 3EGJA 1V08A 1X96A 2EF9A 3WF3A 3QV7A 1H11A 3LSBA 3SIZA 1JPIA 4AZ7A 2X16A 3VDGA 1LOSA 1Z32X 1WUFA 1GORA 3E2QA 3P67A 4AG0A 1X7IA 4QCFA 4Y9PA 2FGBA 3A7AA 2Z1XA 4O57A 2ZRUA 1YDVA 3EUB3 3GAYA 2VZOA 5HWMA 2QCEA 1A0DA 3H4WA 1FP9A 3W22A 4GH1A 1CZ1A 3IIVA 4H6KA 3EA1A 4XKMA 2CU0A 4PL2A 3EWBX 1TA3A 3VCRA 3ZT5A 4G2DA 4ADTA 3Q2DA 1RK5A 4BF9A 3GO2A 3FVMA 1SJDA 4YTRA 1I0BA 2EQ9A 3N9KA 1V6WA 3FX4A 3ZJ6A 1H7WA 2ZX9A 4UIOA 2E8ZA 1JDCA 1S2WA 1R47A 1RLCL 1KBKA 4EXAA 1R2SA 2DT1A 3EX1A 2NZLA 2GOUA 1WXYA 3W0KA 2QKFA 3AM9A 1P4CA 1JCTA 1X97A 3W26A 3LEPA 1IE7C 4LF2A 4NEWA 1MZRA 2J9YA 1H5YA 4H4XA 4JQ3A 2XSXA 1W3IA 3RR4A 1TPVA 4MKNA 4G8TA 1W9XA 4Y8EA 2I5QA 1W1TA 4RW3A 2OT1A 4AEEA 4WKFA 4MPKA 4WX2A 1Q6DA 2EPLX 3O0FA 5U4NA 3LM3A 3DAQA 1V7AA 1UHVA 5KMYA 1Q1RA 5FJTA 4UNKA 3CWNA 2E6FA 4UTJA 1N5WC 1D9EA 2DDXA 1SSGA 1Z41A 1BXBA 2DVTA 4RXFA 5LZLA 2X99A 1WZLA 4H4RA 3GKAA 1VPQA 4IP4A 3LBCA 4H8HA 1R7OA 1K9TA 3G1SA 4X0NA 4Y9NA 3R0DA 2GPTA 4R34A 3M9YA 3WF2A 1C8VA 5D38A 9XIAA 6PTDA 1TKKA 3Q6JA 5A6JA 5C9UA 2BOFX 4A8NA 1MFUA 3TAOA 3QR3A 3TYDA 4RDVA 3RNDA 1KNWA 2POZA 4D72A 3WMCA 2YW3A 1S46A 1A5KC 1BYAA 4PB3A 3EMQA 2GGIA 4WDWA 2ZZBA 4F0LA 3CZGA 4DIAA 3EAOA 1W3TA 1KFJA 4DJDA 3ZR4A 1S38A 2QV5A 3U2OA 4HZ8A 2IXUA 4C6DA 2W62A 3GIQA 1KBLA 3P8JA 2PU0A 3UR7A 1TVPA 2Y4SA 4GQRA 3M5ZA 4NNBA 5A6BD 2QAEA 1RY8A 1T8QA 2D3LA 1VQZA 3R94A 1QOXA 3N2MA 3REQB 3UNDA 2PTDA 2BMBA 5JIPA 4IIDA 2RH9A 1NY1A 3U0HA 2Y7GA 2CZFA 4Q22A 5C9RA 4PEEA 2Z0IA 3NAVA 4U28A 1X1ZA 5CGTA 3GD4A 2YDQA 3ZM8A 3VNZA 1ISVA 1CI1A 4JBRA 3BG5A 3C5QA 3OEXA 1D7YA 1KM5A 1DXIA 3UD6A 3CL6A 2GFTA 2J27A 1FVPA 4LNCA 2BNJA 3OVRA 4IXHA 5GJPA 4AD1A 3EDKA 5FJOA 3AMKA 4HT3A 5T9BG 2PCQA 4QE5A 2WZTA 1U2YA 5DELA 4B4HA 5EYWA 5KVIA 3TJLA 3TN6A 3MW7A 3I7RA 5E1QA 3HU7A 1R2TA 8CGTA 1KO0A 2OEJA 5HJLA 1ZRQA 3S3GA 1QO2A 3UU0A 4Q33A 3EA3A 1FH8A 3W7QA 1XBZA 3WNLA 4J28A 3H4KA 3D46A 2DPEA 4H00A 4RV8A 1Q65A 2RDTA 1EWDA 1NAL1 3B05A 3ETRB 4A8IA 1REQB 3WENA 4TTUA 4UFKA 3W76A 4QTGA 5H8PA 3Q4DA 1F73A 3GXDA 1JRCA 4C7FA 1XLDA 1XYMA 1LBMA 3PPGA 3VNYA 2PTWA 1H3GA 3B97A 4C6NA 1BWKA 2AL2A 2VWTA 4CNSA 1ISWA 2C1GA 4AFYA 4PEKA 3JR2A 1HL8A 1Y5XA 2Z1KA 4AEOA 2V3GA 2V2CA 1VENA 3DU0A 4K3ZA 2PTYA 3E0VA 3R0KA 1F8MA 2V30A 2GJXA 3CIXA 3N04A 5CGQA 4LUTA 1OX6A 2ZWZA 3BGGA 4W4QA 1K4QA 3FEQA 2WQDA 2ZIDA 3KE0A 1DWJM 1UP3A 4H04A 1KFEA 3MVTA 4IX2A 1ADSA 4EQRA 4JFUA 3OC4A 1JRBA 4QHRA 1XLFA 3T4WA 2WOWA 1CCWB 5KVHA 1KXHA 1GYLA 3THCA 1KV8A 1I0DA 2E68A 1LL4A 3HIJA 4E38A 1EOMA 2X7VA 4DO4A 1VB9A 1YXCA 4AD3A 1FWIC 4Q4OA 3RRXA 3S9IA 3WLLA 1KBJA 4DF1A 3SB0A 3TXZA 4XAPA 3AHVA 4Z1BA 4IIHA 1PZ1A 5BWAA 4MNMA 4NKCA 4E5TA 2WBGA 2GQ8A 4LBUA 1V8EA 3DBNA 5FAGA 2V5CA 4BEQA 2CIPA 2V5JA 2J7GA 3GDLA 4X60A 3G0UA 4UTHA 4AIUA 1CWYA 4O0KA 5MKGB 2EPOA 3DKJA 3SCTA 4YIWA 4H4PA 1B4EA 4LCQA 1EJXC 4INFA 2X8CA 4W7WA 1DQWA 3CGDA 2YFNA 4A3RA 3WBWA 2YA1A 2Y6ZA 3QFEA 4V2XA 4AVFA 3H12A 3UY7A 1YLVA 3LN3A 4FLSA 2PGWA 4ZVJA 1JDFA 1OFOA 1NHPA 3KTCA 1RZMA 1XIHA 2QJIA 3WJYA 1TJ2A 3SN4A 3NL5A 2WMFA 2O9OA 1DHKA 1PPIA 1JFHA 4JYDA 5FF7A 3BAIA 2FB2A 4OBRA 1UUQA 3UR8A 1UASA 4S3FA 5FA5A 1M04A 3WDJA 3DIPA 1Q7QA 1MW0A 3LQLA 4UMAA 1JZ6A 1W9DM 1Z89A 4GI8A 3L5OA 5HMFA 3QOMA 3VA8A 3MP4A 2IKJA 1LQ2A 3AIRA 3VDBA 4OBTA 4Y2WA 1HJSA 1K9DA 4IWWA 5HNTA 3LCLA 5AB3A 2VFGA 3B0YA 4LUJA 4PMDA 1LM1A 2HS6A 4AZCA 1VRDA 5CLTA 2HROA 2XFWA 1K8CA 1O5KA 3VFCA 3W7RA 3VDHA 1QXLA 3A12A 1Q6LA 3GTHA 1TZ9A 4K37A 1PTDA 1E6RA 3G6LA 3G1YA 3N11A 4GKLA 5C0QA 1GGOA 4GY1A 4ZOCA 5I02A 1JPKA 4S3KA 4FAMA 1QPNA 3IJ7A 2F8QA 1JF5A 2WM0A 5KEZA 3W2NA 3LD5A 3V0SA 1IZCA 4GGHA 1WDRA 5JRBA 1XL9A 2R1MA 4M1RA 3H2EA 1SFJA 3GHTA 1IT8A 2WWDA 1R7AA 1LQ0A 4O1BA 1OHLA 4KFOA 3RILA 1DJHA 5C2CA 1S5MA 1L6SA 2J7BA 3FFSA 1GVSA 5IDZA 1OF6A 2ZX7A 3ARRA 4GFSA 2XIIA 1BKHA 3RAOA 1AW2A 4UQEA 3CYVA 3UYIA 5M03A 2O9PA 1OWQA 4WK9A 3LMZA 2O9RA 3NS1B 3EWWA 3NA8A 2A8XA 1QI5A 3IARA 3WNNA 1S5NA 2ZDRA 1QNSA 3GLCA 1CECA 3LADA 1NHQA 3DFQA 4E3VA 4H9MA 2G5WA 5D2WA 3T0CA 4FO4A 2X0HA 4B9ZA 4ENLA 3HPAA 1PEZA 2YB1A 2VUYA 2CZDA 4ADUA 4RNHA 2ATSA 1MO9A 1O4UA 3ABRA 3QPZA 3MU7A 2CKRA 1E5NA 1KB3A 3A7UA 4I3GA 2BP1A 2J47A 4WY0A 3NZGA 1GTEA 3BSHA 3WQVA 3BL3A 5H2ZA 1WOBA 1N8IA 3H55A 4FR1A 3IRSA 3EXTA 3MKKA 4BS0A 1R38A 5BOOA 1EBGA 4HNNA 4F0MA 3KL5A 3AIWA 3IANA 4J7RA 3EDJA 4LT9A 2Y5SA 1O5QA 1FDYA 1E72M 1I4NA 3M0XA 3WELA 3UXKA 1ZL1A 4H3DA 1E70M 4TX9A 4RZ6A 4UQ9A 1SVDA 2PDCA 3ZQ9A 4ERAA 3ZJ8A 4J3ZA 2QS8A 3SCWA 4LVAA 1UUMA 3H7VA 2QJGA 3TNBA 5DMYA 1BSIA 3KBNA 3TMLA 2QNEA 1AQ0A 3M4HA 4AY7A 5LGXA 1XX1A 2YLAA 1QVBA 1BWCA 1BKSA 4Q4QA 2CZ5A 1Z42A 4L1XA 1UPPA 3EYPA 1SPQA 3R1ZA 3FEMA 2GQAA 1ITUA 4EKJA 4GPNA 3R07C 1W17A 4MB5A 2ZE0A 8XIAA 1XLAA 4HB7A 1I2PA 4UTTC 3NXFA 1LYXA 1Q63A 2ZRVA 1OIMA 1J0HA 1TTJA 5GNYA 3RM8A 5H6HA 4YWIA 3WMBA 2Y88A 1DPMA 1XGEA 4DJFD 1ZAJA 3SRHA 2BVDA 2NVAA 2PTXA 2VYOA 3LMYA 2P3EA 1XJBA 1E6XM 4B90A 2AAAA 3VMNA 1QPOA 1NDYA 3SECA 4H6QA 2RJGA 4GIRA 4GIAA 4J3VA 2PDLA 4FK9A 2POTA 1EPXA 3TYUA 2WNNA 1ZB5A 3H2OA 1VHNA 3KVMA 4M6UA 2WMGA 2EO7A 5FSDC 2XJ7A 3E6EA 3N4AA 2V68A 5EU9A 3DXIA 1JR1A 1PIIA 4QIUA 5D09A 4MFDA 2PPGA 1H1YA 3LHYA 2ZUUA 3EB3A 2PODA 1T96A 1B4KA 2HISA 3W7NA 4BKNA 4C6CA 5FJJA 3WEZA 2P0OA 1V0KA 3LTPA 1TUXA 3SRDA 2WC3A 3QVQA 1P7TA 5BMXA 1HP5A 1OZMA 3TN5A 2W92A 4Y9OA 2OQYA 3M0LA 4C7GA 4L80A 1XM3A 3HRDC 2WCGA 4S23A 3REQA 1TRDA 1FWAC 4M6VA 5ECUA 2Y2WA 1KTCA 1QPQA 1BF2A 3TA6A 3PUGA 4O14A 3LK6A 4RNJA 1RD5A 1TVLA 6TIMA 1A5SA 1E0TA 1WX0A 1P6CA 2WVSA 4B2DA 3OLIA 4ILSA 3B8VA 1WYGA 1V3IA 4GBDA 4KWWA 1EJRC 5EFFA 5REQA 1XKYA 1MZHA 4H4WA 1K03A 3FS2A 3KL3A 1OFDA 1GOKA 2HVNA 4ZB5A 3HW2A 2EXOA 3ARSA 3MTWA 1F4AA 1Q8AA 4PRWA 3CH9A 3AS2A 2BOEX 4Y9AA 1HO1A 3QZEA 1EGZA 5A8GA 4MGGA 3R8RA 5CG7A 5I79A 3SGUA 2EPNA 5LNVA 3VOHA 3VIMA 2F5ZA 4KETA 2JKPA 2NWRA 5A6SA 4EMWA 4GINA 2AMXA 3GVGA 1YTDA 4LVFA 3E12A 2BZNA 4IP5A 1GRTA 3TA9A 1OADA 3TSMA 4ML4A 3S5OA 3TKFA 4GI6A 5TR3A 2R82A 3R8HA 1LBLA 1XLCA 3HA1A 4GZJA 3PZNA 4D2JA 1J5SA 1HKIA 3W7EA 3SEPA 2HE5A 5G4EA 2J13A 3G6MA 1XBYA 4UFLA 2PU1A 1Q2SA 3T8LA 1DE5A 1WYIA 3Q67A 2NUWA 4EPEC 3Q37A 3SUSA 4DBDA 1UWIA 2Z29A 3WLHA 2J88A 3TN3A 3M0ZA 3BC9A 3WJZA 2VFEA 3CQJA 3KDNA 5BU9A 3TTOA 1EIXA 1A0CA 3UWUA 3IGUA 4S3CA 3OG3A 4Q32A 3M0HA 4RNFA 1S3TC 1E6NA 1SJAA 2C79A 2WLYA 4ZBCA 2DUXA 1V77A 3FGCA 1JCMP 3RYSA 2GJRA 3LZ3A 4LAKA 2J7HA 4FEZA 4NXKA 4MTVA 3DEQA 1GK8A 2VHLA 1JGIA 3O3RA 1S2TA 1V03A 4R27A 5K9XA 2GGHA 1QI3A 3WK3A 3PZGA 3XINA 3UR2A 1B3OA 2JIWA 4B5UA 1DORA 1KM6A 1J0IA 4XKYA 2RDXA 2WCSA 3H23A 4FNPA 4WRHA 5AHFA 2OSWA 3STFA 1Z9AA 5BZAA 4LC8A 2ZVRA 1AD1A 4AHQA 4AVOA 3AOFA 3RDKA 2WSRA 3S5NA 1YEYA 3G1XA 1K4HA 2CETA 5LSMA 3W2KA 3KBJA 3KP1A 1SR9A 3N13A 1RM6B 3ITTA 1IV8A 1E0UA 1BFNA 3LSCA 2WMKA 3I7QA 1GSNA 4APNA 1U5HA 2QVNA 5E93A 1KTNA 1XIBA 5GNZA 2Z1WA 8A3HA 3MPGA 2FVMA 1GCYA 3IPWA 1TPDA 3UNTA 1FHDA 3THDA 4G1NA 3QY6A 3OIHA 3SI9A 1W9PA 1H41A 1CXEA 5AKQA 3UWVA 4CVWA 2XN0A 4IIBA 1CPUA 4E4UA 1QR7A 1RP8A 4LCRA 3NVDA 3V7PA 4NJGA 1GZ1A 3VIHA 1W32A 5G4HC 2W54A 3W1LA 1QOQA 5HMDA 4BHYA 2VRJA 2GVJA 4LVGA 5DXXA 4UOQA 1UR3M 4L7ZA 2AGTA 3O2LA 1BD0A 1GUVA 5DCBA 2CERA 1GVFA 3P0WA 3AXXA 1GOOA 5GQBA 1KGUA 4NQ1A 3RO8A 1I2NA 4I8DA 4HPXA 1EO5A 3R89A 3O15A 1V6XA 4WD0A 2V5BA 2PDGA 3LGGA 5BW6A 5JCMA 3ELFA 3TR2A 4U3CA 3EEZA 1Y65A 2HS8A 1NM9A 4M6PA 3UESA 2G4JA 3GDMA 5DMMA 3VDCA 1XYAA 1UA3A 3U4AA 1XISA 4HOWA 1YPXA 3BLKA 1YIXA 3APYA 3QV6A 9RUBA 2RGLA 4TIMA 4FX9A 4I6KA 1J0KA 1JULA 5AC7A 1UMLA 3BG9A 2WVTA 1LL6A 3TQKA 3LPOA 4IHCA 4AZ6A 3H4GA 2QAPA 4MAVA 4C1KA 4RNIA 1JUEA 4XK2A 3AUJA 2YBUA 4JTEA 4J1OA 5E0CA 1MSSA 1XLBA 1ZBWA 5MF5A 1UR0A 2VURA 1CIUA 3ECQA 2PD9A 4XZIA 4FP1A 1GZGA 3WUBA 2YDSA 2TODA 4AB4A 3RR1A 5CPSA 1L0PA 1SZGA 1DYSA 2OMAA 1GEUA 4DBUA 3A9IA 4P7RA 4TVCA 3L4ZA 3SUTA 3LERA 4Q8UA 1TYTA 4EPKA 2DQWA 1LWHA 1MW2A 3V5FA 1W3KA 4RE3A 4HNCA 2DY3A 4JOMA 1XPYA 1NP2A 3C52A 2GSEA 4R3UA 3WZ0E 4UB9A 3T6CA 1TV4A 5A3HA 4J3XA 4DYEA 3PBYA 2RKXA 4BWLC 1VEOA 4AU0A 2E5CA 3OZYA 3POCA 4QNWA 1K9FA 1W8SA 1M5WA 1PIFA 3LOTA 1MMFA 5FS9A 4UNIA 4GYFA 2I56A 3QXBA 4Q4PA 2KX9A 2E9LA 4L4MA 4DXVA 4ICMA 4R53A 2OR2A 4IJBA 3W87A 3BQ6A 3F1QA 2GGGA 3UPBA 2BHYA 3FLUA 1SO4A 5CJ5A 3I68A 4MY9A 2BOGX 5AVHA 4BI6A 5JCNA 3OGRA 3GH7A 2OFJA 4N9CA 3C8NA 1E3XA 4JTCA 4HNTA 1LL7A 3MKVA 3WK2A 3DOPA 4XZLX 2WHJA 2Y8VA 2YZ5A 3KBWA 1SGJA 4YTSA 2G3MA 4BA0A 2PS2A 1C93A 3IJ8A 2QT3A 3WLSA 3IJDA 3HB9A 4UOJA 4XZNX 4ZSTA 3O63A 4DZ5A 2FZBA 5KINA 4HCDA 4DJDC 5JXQA 3NOYA 5CBBA 4XTDA 4QQUA 3VUPA 3ZT7A 1CXKA 5F1VA 2RJHA 3M6DA 1IQ8A 4M5PA 4AYGA 5BNKA 4Q6XA 3LV5A 1X2GA 4CNNA 4XG1A 3OZMA 3H54A 4EPBC 3MSYA 1PDYA 3Q65A 1P48A 1HVQA 1BGAA 3KDOA 3QEZA 1KWKA 2P53A 3AMZA 2YL5A 3SFWA 3K8MA 4IIEA 3O6CA 1LOLA 4QX4A 4WKHA 3S9ZA 3WH6A 1ISYA 1T99A 1A4LA 3TU9A 1J93A 1F74A 1IEWA 3GG1A 4XZMX 4UNLA 3Q45A 1QT1A 3ARQA 4XTIA 1AVAA 3LB0A 5D37A 2OB3A 2E5BA 3KZSA 3SCOA 3W1XA 4WXZA 2V82A 1NDZA 1L8NA 2WMHA 4MG4A 1DTUA 1D3GA 4H9UA 1GNXA 1RV8A 1EJUC 1M03A 3PY2A 3VKJA 1V5XA 3IGXA 2V2DA 4AUBA 1Z48A 2XFFA 1AK5A 1QWGA 4A29A 4O19A 4LS2A 2JE8A 3FJNA 2GJNA 2O56A 3N17A 2DU2A 5HQLA 1ZBVA 1FBAA 4ATLA 4AX7A 4NZ4A 3THUA 1Y0EA 4NX0A 3V75A 2ZUVA 1TTPA 1L6GA 4DNAA 3BSGA 3BSMA 1NEYA 4MWAA 2RAGA 4DVOA 1ENUA 3TH6A 2BVWA 4AWUA 3XISA 1UD2A 1OC6A 3MMDA 1EZ2A 4EXQA 1EQPA 2HEJA 3N9RA 4CNTA 5I6SA 3E2VA 5KSWA 3NOEA 3NQFA 1ZS2A 3MZ2A 3N3TA 3C3NA 1QWKA 4HN8A 2VDGA 3UERA 1PIGA 1MUMA 4ACYA 7REQB 3KOYA 1XRSA 1KFWA 4IGMA 2Q8LA 2PDMA 1AJ2A 3AMCA 4IIGA 4JGDA 4IPLA 2J6VA 2GR2A 1F6KA 1T5AA 4Z0SA 1XF0A 4JDYA 5FJRA 2HMCA 3UXLA 4Q4SA 2A1YA 4WGHA 2Y7DA 4NJJA 4XD6A 3EAUA 3URNA 3PNZA 3KX6A 2VFFA 1F2JA 5M3WA 4X9SA 2OXNA 1XD0A 5C9ZA 4Y90A 1VBGA 4FI4A 2QR6A 4JN8A 1O1HA 1Z3NA 3VCNA 4H9VA 5KETA 2NQZA 4PUJA 3RRAA 5JCIA 2R24A 4S3GA 4JYFA 4N42A 3RLGA 1JCXA 4H9TA 3QY7A 4TXEA 4DWSA 1XYBA 2GR3A 3VFLA 1H4PA 4O13A 2AQOA 4P8UA 1UIPA 1RSCA 2FFIA 4IFRA 1OINA 1QTWA 4PCSA 4A21A 2WZHA 2EJ1A 3BOFA 4XB3A 1F05A 3UG8A 4NVTA 4IT1A 3NQBA 4JTRA 4JXCA 4R7JA 4W8BA 2NPXA 4GQ0A 4YVPA 3LM7A 3VE7A 3NQGA 1DIDA 3EPMA 4M82A 3ITLA 4MJ2A 3TE9A 2V5KA 4FF5A 2E3ZA 3GG7A 2FTPA 1KR0A 2QCMA 3HF3A 3QKZA 1CX9A 2A3BA 5JIWA 1J12A 4G9PA 1KM4A 3W24A 1TWDA 1FKWA 2FH6A 1OCBA 3RLUA 2PLJA 3P6LA 1JDDA 1DWHM 2RDWA 3GNXA 3MANA 3SY5A 2QHAA 1W91A 3DK4A 4JNZA 4DM2A 3VOIA 1NOUA 5C54A 2ZZ0A 3TK7A 4Q8VA 5DBTA 1XRTA 3AS1A 2O55A 4C60A 4I5RA 3HPFA 1GVRA 4EOUA 3B9EA 2WJZA 4DLMA 4LYQA 3KRZA 3W84A 3C0SA 1F3WA 3S1UA 1K6AA 1HJVA 3UGVA 5JVLA 5DQPA 3BCJA 3NL6A 2VCBA 4HMEA 2V3FA 3ZLFA 3O05A 1SW0A 3QR0A 1M41A 1EBHA 2PGEA 1HG3A 4RE0A 1HIZA 3T8QA 1FDZA 4JR5A 4RW5A 4H9ZA 1CB2A 2OEMA 2INZA 4QJ1A 4XBJA 4V33A 1WOAA 3NYZA 3UVAA 1AW1A 2BLEA 1YQ2A 4L61A 2OZ3A 1UWRA 2QXWA 1YHTA 1R2RA 2PB1A 3G5EA 3HPSA 3VD3A 2C15A 4OV4A 3VINA 3L5LA 4GIYA 5HR6A 4GCAA 1VS1A 3FG2P 2DZUA 1IWBA 1AH0A 2D0GA 1NHSA 3A9BA 1B1YA 7TAAA 1JROA 1YADA 1OG6A 1E6SM 2Z7GA 3BLOA 3DK8A 4NAEA 5XIAA 1UD6A 1NHRA 2W79A 3DG7A 4TR9A 5IHRA 4KEVA 1AJZA 1AG1O 1AODA 3H26A 1TMQA 4EXBA 1XG4A 1P0DA 1C92A 1CT5A 2ISSA 4F8XA 1Q3NA 1JPHA 1C8QA 1DOSA 2UY5A 2ZZCA 4PSPA 2VVSA 4IL0A 3GUWA 3GDBA 1S2CA 3S2LA 1JD7A 1VBJA 3L67A 4NYYA 3N15A 4B15A 1QNQA 4Q8PA 1P0BA 3CV2A 1N7KA 4XVEA 5D2TA 5EB8A 4QSFA 4MYAA 2A85A 3PWAA 2D1ZA 2CFYA 5IM51 4EVZA 5KITA 3DECA 1UPMB 2XFRA 4WQ6A 3B8SA 4JKLA 3CK5A 3NVTA 2G97A 2VD9A 3KHDA 2HV5A 2GJLA 2W3RA 1UROA 1BXCA 1J01A 3PSWA 1OVDA 2I5IA 4MJZA 1SR0A 2XVKA 2HBXA 4KMQA 4UZUA 1V93A 4LA1A 3W7IA 4HJWA 2FZ8A 4PL1A 5AHLA 3DFPA 1G0CA 4NIRA 2PDHA 3H2AA 1VCVA 3AWOA 2DZSA 4F40A 3NEHA 5L6UA 4D6CA 3MS8A 3ABSA 4QROA 3VKBA 1SB3B 1N63C 1D8WA 1GHSA 1ZNNA 4M7TA 4Q8WA 1B3WA 3NZRA 3EPOA 4LB4A 4Z17A 4KCWA 3VNLA 1H62A 3GU2A 1VJSA 2WOVA 4EP8C 1OEPA 4DYKA 5A6KA 1V3LA 2X05A 1EA0A 1DXEA 2AQWA 1FHUA 3BQ5A 3CQKA 1MXGA 1K1DA 1DJGA 2ZX6A 3HMJG 2RHGA 1XH2A 2ZZ1A 3PZQA 1PKMA 2E9BA 5E5CA 4LGXA 3FDKA 5A6TC 3SN0A 1ZKQA 2XVLA 3W7PA 4U5IA 8TIMA 2CLPA 4QG9A 1UJPA 1Q6QA 4JY8A 1RH9A 3W7OA 5LNRA 2VX6A 3IUHA 4WKAA 4S3EA 3TYBA 3AIBA 5IOBA 2ZXBA 3EA2A 3NO5A 2V8ZA 2WC7A 3BO9A 1JCYA 4WLCA 2P1FA 3OODA 3CPUA 4I9JA 2WMIB 5GRTA 1E0XA 1NJJA 3A7RA 1X2HA 5BRPA 3STPA 1HKKA 2J62A 1JYWA 1BRLB 2BGQA 1ZBKA 3GH5A 4HKPA 1TREA 5EY5A 5BXSA 2NVDA 1B2YA 3UWWA 5I7GA 1TX0A 3ABXA 2XSBA 2D2GA 1ISXA 2DUAA 2WSPA 3IIXA 2FHFA 4CU6A 3CC1A 3JZUA 3DK9A 3DGBA 1GEQA 3DG3A 3W53A 2XIMA 1H7PA 3RU8X 1US2A 1TPFA 4IFKA 4LQ1A 2PAJA 4LPCA 1FWNA 3EDFA 1W3JA 1I2RA 2WPGA 4ZO7A 3PR2A 3BK0A 3SW6A 1NH6A 1XICA 1PCWA 3GNRA 2ZICA 3RX4A 3SCNA 2G96A 4MNJA 4IG2A 2YGYA 4R9OA 3LQGA 3T2PA 1R3WA 2QJMA 3GB6A 3BW4A 4ZOBA 2W0HA 1B3XA 2V5DA 4PH6A 4JTFA 3GNNA 1B30A 3R25A 2XWEA 1A5BA 3LYEA 1PKNA 4POCA 1SZRA 5TAOA 4PTDA 3BAKA 2GZXA 4D71A 1E55A 2ZC1A 2GSJA 2OELA 1BTCA 4UR7A 3H6OA 3OG2A 4Z2JA 3MT1A 1XLEA 4WJ8A 1FWBC 3ZT6A 3SQSA 4L65A 4I8YA 2VM8A 2GRTA 3L4TA 3CTLA 2GQWA 3IJ9A 2E7FA 1HGYA 2ACQA 3B04A 3WQEA 5B80A 4GC3A 3AWNA 5T9CE 1JZ7A 3E49A 5DY2A 3FKRA 2X1SA 5CXPA 1GQLA 1V02A 3CL7A 2AMGA 3BLEA 2ZZ2A 4KBXA 1H60A 3W38A 4GZIA 4G7EA 5CSRA 4OE7A 1UP2A 2CHRA 4O0QA 4RZ5A 1JCLA 1XLGA 1TWSA 4FX7A 1VF8A 3GHUA 4I9TA 1GQKA 4XAYA 5GJNA 4Z2KA 3GVVA 1E9YB 2YVJA 4UFMA 1TPC1 5DCEA 1N5XA 1UD8A 1QNOA 3KTXA 1JPMA 5HJXA 4JEQA 4MF4A 5D2VA 3NQVA 1W3NA 1KBIA 3SCUA 3VIGA 2A21A 4MSSA 4E2OA 4P7LA 1DV7A 4AD5A 2BY1A 1B9BA 1A50A 2PDNA 3V4BA 3AAMA 1RPXA 2JF6A 1RD6A 3M47A 3I3BA 1KXTA 4D9PA 1US0A 3GU1A 3BAXA 2JK6A 5E6ZA 3UZZA 1UWQA 1EX5A 5BROA 3L4XA 2TPSA 3LZ5A 1XHGA 5LIKX 3ZVHA 4PSRA 2EEXA 1BZLA 1B3VA 1FQ0A 4XZBA 4YVXA 2HE8A 2NT0A 1DIEA 4AMAA 4O10A 3HO8A 2CDUA 1O94A 1JOAA 2FGLA 4OV9A 4Q8OA 3VIJA 2GVLA 2OYKA 3TOPA 2VUNA 1OYBA 4DPQA 1LPFA 3BE7A 1KFKA 4C6FA 2Y24A 5K7JA 4ICCX 1MQQA 1TX2A 4GLEA 3T08A 4ALDA 3E5BA 2YA2A 2BGSA 1W1B1 6REQB 3KUMA 3AZTA 1OFBA 4W84A 5SWUA 4KCVA 1SYTA 2F84A 3AS0A 2JKAA 1RJQA 4H83A 4G56A 3WQOA 5E09A 3EEGA 1PKLA 1SQ7A 3E9AA 3QZAA 4QM1A 4L9XA 3DGZA 5KZ6A 2CHOA 3NR0A 3GAKA 3LCHA 4JTUA 3WH5A 5A1AA 3WQDA 4K68A 3NFUA 2ZKMX 2FJKA 4UTUA 1PYMA 1TJ0A 2ATMA 5LIXX 5K4XA 4H50A 1R9XA 1LF1A 2E40A 4RZBA 2BGNE 1G94A 1NQKA 3LUTA 2V0TA 4PCFA 3HG5A 1A5UA 2OJPA 4S38A 2CZVA 1H49A 2R1NA 3BVJA 2BXYA 3TTQA 1EUAA 3UJ2A 1GREA 4HU4A 2ZA1A 5U25A 1TCMA 3W71A 3EWDA 3L65A 3DHPA 1KFCA 2Z2BA 3D3AA 2CBIA 2VR4A 3VABA 1MO0A 2V38A 3IJIA 3ZWSA 1MEIA 4AX6A 1TZZA 1V79A 4YN5A 4I9MA 1UC4A 2CWXA 1E6ZA 3N4EA 2C0HA 3FVDA 4D6GA 3KLJA 3QLDA 4V1YA 1G4TA 3T0DA 1DJZA 4RX0A 1FWJC 2GK1A 4JX5A 4IICA 2VC5A 1UMYA 4IPIA 3CT7A 4AW7A 3GZ3A 1RAKA 4WGXA 1RQBA 3UZ5A 1C91A 4AF0A 4H8VA 2YXOA 2CXEA 3OA5A 2WHLA 4LRSA 1XUZA 3F7JA 4DUXA 3F2CA 3JZEA 1TA3B 5KZMA 3B9AA 4HK5A 3CQ0A 3U2ZA 3EB4A 1WBJA 3EXSA 2R8WA 4Q8TA 4U2YA 3WQFA 4BQ3A 4FSAA 2DZPA 3M43A 3EDEA 1FUYA 3QQ0A 3MI6A 3IRDA 3NZPA 4DNHA 4PTXA 4UR8A 5HNNA 3H2CA 1UYQA 4LOCA 1ZSXA 2QDEA 3P2VA 3F4NA 4YTUA 5LA2A 1EUNA 4ZO9A 5CEWA 1UKTA 3W7CA 5CLWA 5ECVA 3SURA 4QLJA 2ASHA 1LQAA 2QQ6A 3FA5A 1V0LA 5XIMA 3CWOX 1BG9A 3ALFA 3L2MA 3APGA 4WSJA 3B06A 1POKA 3UPWA 4Q6JA 1Y5VA 3LGEA 4XD3A 3MUY1 2CESA 5A94A 2I17A 3TSBA 3VC5A 2WNQA 4BK9A 3MSDA 3AMGA 1CXIA 1FY6A 1H5VA 3ATYA 3V0UA 4GUFA 3BZJA 3LRMA 1XI3A 3UZXA 3BLDA 3O7UA 2GQ3A 5D04C 4P61A 3IS4A 5HR7A 1YE4A 3N12A 3PTQA 2HK0A 2VD8A 2YB4A 3A64A 5ABHA 4IOTA 2YCEA 5AECA 2IPJA 1UB3A 1XC6A 1WQ5A 4CCCA 3INPA 4KWUA 4LTSA 3OPSA 3WYZA 4RDWA 2OLHA 1DJIA 3NDYA 3E38A 2J8GA 3C2RA 2XVGA 3WBAA 4E8GA 4WCJA 3B8DA 3W72A 2R94A 3GDRA 3WBXA 4HZMA 2W55A 5G1TA 4NL1A 1BLIA 2GWNA 3B4UA 3N34A 3V0TA 4DBWA 1DJWA 3QFAA 1PHQA 2INFA 4BJHA 1QI2A 1LT7A 1YMYA 1GONA 5LNSA 1J8VA 5CZSA 2QUTA 2C3DA 2HK1A 1TUFA 1F9CA 4HCLA 1H7NA 3UEQA 2FPYA 2FVKA 2OQHA 2X50A 3W1UA 1LRNA 5HNRA 5G1YA 1X8CA 2X0SA 1TCDA 1FIQB 3KOXA 2ZX8A 3WQ6A 4PULA 5A2BA 5FI8A 3DJGX 2Q8ZA 4DJDD 3NVZB 3TXVA 3WNKA 4NZCA 1QATA 1RBAA 4AZBA 2WKJA 3ARPA 3DFYA 1QW8A 1TYPA 3SUWA 1QJWA 4ZO6A 3FJLA 5EBAA 2VRKA 4GRSA 4Q4KA 2R9ZA 3OVQA 3A47A 4PUWA 3SY8A 1GTHA 4NG3A 4JN7A 3P81A 3V18A 3ARUA 1X1NA 2IKGA 3T81A 5L9FA 4REQA 1JXKA 4LAUA 3P93A 4HYVA 5HUPA 4PTNA 4UTFA 5K9CA 1W5QA 3AN1A 1HN1A 1SMDA 2Z2AA 3VIPA 3R13A 4PCNA 2Q3OA 3BG3A 1XIJA 3ERPA 3PUEA 1B3YA 3P62A 4CCZA 1ZLPA 3HG4A 2A4AA 1L6WA 3F5JA 4GABA 1PE1A 2AKZA 1K7EA 2X1IA 1GXFA 3QZ6A 5D02A 1FO4A 2DW6A 3T09A 4HOZA 3GD3A 3LXDA 5K3VA 4FHAA 4D6JA 3TQVA 4X2RA 1M68A 3G8RA 5DO8A 3UG4A 3E3HA 1LJYA 1GRFA 3WMSA 2NQLA 1N61C 1HXJA 3URBA 4W89A 1K02A 5F4XA 4XSLA 3CO8A 2PTZA 4TUFA 1RR2A 2AL2B 2CKSA 2V2HA 1GRAA 5CQ1A 1MNZA 1XDLA 1LLZA 4L6OA 2WB5A 2JEQA 1ONFA 2Y63A 3LXBA 4NU7A 3V36A 4C6QA 2GJXB 3C2FA 5C55A 3E2RA 3NRZB 5AC6A 4MNLA 2OODA 2W91A 2QIWA 2WMIA 1FWGC 3PZIA 4OQVA 4B3LA 4K8GA 1ZUAX 4ZQOA 2D2JA 4AMCA 1FEAA 3UR5A 4WR3A 1LROA 5BU6A 4S3JA 3PJWA 3PBMA 2VRQA 1LUCA 1NELA 3DCPA 1NVMA 3WX7A 4ZMGA 4UQAA 3NQEA 1M7OA 1R87A 3L4YA 1R3QA 2PRMA 4K1WA 3L4UA 5EA9A 3SSZA 4FIQA 1JYXA 4Z1DA 3KRSA 3R43A 1W5PA 2FVLA 2VEFA 3CUGA 3OBKA 1WA3A 3EX6A 2XYLA 4NSBA 5DT7A 5ABEA 4O8AA 3SR7A 3UVIA 2VOMA 1EJWC 1NOFA 3B9DA 5CSYA 3AO0A 3AFBA 3QHNA 5I03A 4IUOA 1R46A 2TYSA 3TC3A 3NPVA 3S2MA 3LCIA 4LV4A 5B7YA 1Q45A 3AYVA 4LY4A 1XSKA 1QCWA 2QCNA 3H8AA 3W7DA 4GBUA 3YPIA 2YCJA 1I75A 2WHKA 3MYPA 1F3EA 2BBFA 1J0ZA 4CEXC 3H53A 4E8DA 2OWWA 4BURA 1HGWA 4CUCA 3BURA 2R14A 4DRSA 2E8YA 2Q02A 4QISA 4Z2IA 1NSJA 1LWJA 5D9PA 1GOMA 2QYGA 4JTHA 4MIMA 1EJTC 3EB2A 1GEHA 2YCKX 5FS8A 2W27A 3VX0A 1C8XA 4O12A 2YYTA 4O15A 4GKTA 4ZTXA 3W2UA 4DF0A 4JZ5A 3GXIA 3M0MA 2GH5A 1XGDA 3AJ7A 2TRSA 3WD3A 2CBUA 2TSYA 4FZIA 4N7QA 1XANA 3GTXA 3GYCA 3NSNA 4TVDA 4DUOA 4L56A 3PJTA 1QBAA 1SZEA 2Z7KA 1ZY9A 5A8QA 2WW5A 3GXPA 4D6EA 5AYIA 2ACSA 3L21A 4HPGA 3SADA 3QQWA 1OX5A 3TOYA 3UXAA 1QNPA 3L68A 3BLPX 4QLKA 4AZCB 1TWWA 1S7MA 2NSXA 3L4VA 4ZR8A 4YVVA 1MQPA 3BCFA 4W7UA 3T1GA 1VYRA 5JBEA 4IP7A 2E1DA 3LHVA 2VT0A 2Z00A 4PR4A 3AJXA 3LXCA 3H7UA 4Y9MA 1XKJA 3SRFA 2NUXA 3S6TA 3SUUA 2VDHA 3MSGA 3ITYA 1LWIA 5D9NA 3VE9A 1IYXA 2EAWA 4MUPA 4QLLA 4KWSA 3DFSA 3AHTA 4Q7IA 1HJWA 4NAFA 2QPXA 2OCZA 1VAHA 1E1CB 1OABA 2A0NA 5C2GA 3II4A 3ONBA 1F07A 4KQNA 3UFYA 4H8UA 1SW3A 1K8ZA 3FW6A 4MKSA 1BPLB 2ZUSA 1OFAA 4WDUA 1C7SA 3QR1A 4NI3A 1AQMA 3VVGA 3SIMA 4Z0JA 1AQFA 2I7GA 3V16A 4QJ4B 1FOBA 4GYKA 1CNVA 4A8LA 5H8MA 4CVUA 3R7MA 4J35A 1WPCA 3WY1A 2VWSA 3RG6A 3WMLA 1JYVA 2E77A 3DYPA 3B0UX 4FPSA 1J6OA 1FXPA 3UJSA 1OJTA 1W1ZA 4IGHA 4LNYA 1Z8AA 3NM3A 3TUUA 3KL0A 1PAMA 5HATA 2XH2A 1ITCA 2YVFA 2HPIA 3SQLA 2X1TA 3AI0A 4FLRA 3GTNA 2REQA 1CGUA 3F4CA 2Y89A 1ZFJA 4EACA 3OP2A 5D03A 3S6OA 3M64A 1JZ8A 2NT1A 3H7RA 3FV9A 3W6YA 4WY0B 5C5YA 2I9EA 2V81A 2B0MA 4FDCB 4QAIA 1KM0A 4Q8QA 1UKPA 3CQIA 2YFOA 3DYOA 1UOZA 3NQAA 2PBOA 2HZGA 1VCGA 1JF6A 1IEXA 3WD0A 4FNRA 1OJXA 3PFRA 4NNCA 4NRSA 1TTIA 1HKVA 2Z2UA 4MY8A 5GVJA 3ARWA 2H9AA 2BVTA 3L9CA 4HD5A 3ARVA 5FEXA 4CCEA 1IZJA 4WOZA 1FFQA 4D8ZA 3CGEA 3AIQA 2QV4A 1AMYA 3HMCA 4YLWA 4ML9A 3RGTA 5J8LA 4PMZA 1XHCA 3K1GA 3S2NA 3LNMA 1QOPA 4LBRA 2G95A 2E0PA 4DXXA 2Y70A 1E1EA 1KRBC 4X0VA 1L9WA 4AQLA 3DKLA 1XYLA 8RUCA 3GU9A 3F2BA 1DJQA 4KCUA 4RDYA 3M0IA 4GZ7A 4IX0A 3NL3A 3A6OA 1EQCA 3PBUA 4LYRA 4CQ8A 2C14A 4IPNB 3TTEA 5DCDA 4MPQA 3FAXA 3SFKA 3G0XA 3GRIA 1MFVA 4QCEA 1AL7A 3OVGA 4HMNA 5LXXA 4IUGA 4PN2A 1UW9A 2H8ZA 3VIOA 3NQMA 4GO8A 1NFBA 3HJEA 2YBVA 2Q3RA 1V0MA 2QGHA 1XBXA 3WBYA 2PDQA 1HNYA 1OD8A 5HNUA 3W81A 3OZOA 3TZNA 3GXNA 4OOUA 2Z1VA 3VNJA 2PWHA 2ZRYA 2O7QA 1W56A 3WK0A 1NDAA 2HVOA 4HJFA 5AHEA 4H4SA 1J2WA 1EBDA 2J7EA 2OGYA 3VNKA 2A3HA 3G0SA 1KA9F 7PTDA 1FKXA 2DT3A 3LNPA 4UWMA 1Q13A 2YXXA 1RJPA 2Z6JA 3VC6A 4JCLA 1YDNA 4F0RA 1OFEA 5A6MA 3MMUA 2X8HA 4IF2A 1KXVA 2D24A 3N1AA 3WJWA 1AMKA 4AC7C 1Z7AA 4QEEA 1JCJA 3BLFA 4Q3MA 1ZK7A 2YL9A 4ZSUA 4OWGA 5FJPA 4NP7A 3BAJA 5AFDA 4DBSA 4ZOAA 4W8AA 3WG6A 3OGSA 5I0DA 5AY7A 1PJ9A 4DX3A 3G1VA 4OOZA 1VH7A 3CAVA 3DBPA 3G77A 4J3UA 3W88A 2OLAA 2B31A 1WDPA 1TR1A 1P7TB 4BR1A 1FX6A 3IV8A 5F2LA 4CQCA 3PG6A 4BY3A 1EOKA 2DEPA 2PDXA 3KBMA 4L64A 4IXXA 5CPNA 4KEUA 3GKFA 1D3CA 1GYMA 2A3LA 3GNDA 3PZUA 1R3YA 1UWUA 1XRVA 1A3HA 9XIMA 1BYBA 3A3WA 1E71M 2WKLA 2YLLA 1S5WA 1F3PA 1XQKA 1IEIA 2VELA 3DN5A 2DVUA 2OKTA 3LI1A 1B0IA 4GHRA 3G3MA 2UY2A 1CGVA 1LRTA 1GVOA 2DIJA 1EHAA 1X1OA 2CLEA 2ZRZA 1OQFA 3OBAA 1J0YA 1HFBA 1F6PA 1PSCA 1XH0A 4PC8A 5REQB 4WXYA 4I90A 4JNMA 3RXZA 5D32A 3PPHA 4A6GA 2X1RA 1F76A 2CLLA 3PZ9A 1MEWA 4CLMA 4PA8A 2WPFA 2NV2A 3KCOA 3EWYA 3GC4A 3MWAA 3DZ1A 1MUWA 3A4WA 2WOQA 5HANA 5CJMA 1OYAA 2VC9A 2EJAA 3CGBA 5A2CA 5LHFA 1P0NA 3F4DA 2PCEA 2OYLA 1YQZA 1LLWA 4XUYA 1CLKA 2NV9A 4BI5A 2GLKA 4DPPA 4B2DD 1V51A 3V1PA 1OGSA 3IK4A 1XINA 3GDTA 1J5TA 4FOKA 2FH8A 1MI3A 4C1NA 5E0FA 2Y5EA 4H6RA 2ESCA 2EBNA 2VENA 3PZTA 3WK1A 1G01A 2E6YA 4RK8A 4JTDA 5HQMA 3C0QA 4I7VA 2WVVA 4P8WA 1E4NA 4GVGA 3W7JA 4K38A 4XBKA 1KR1A 3LHZA 2NQJA 4KCTA 4YCPA 3VOCA 3WBEA 4W93A 4ZQRA 3QW3A 2WPBA 4ADWA 3BPWA 1G4SA 4EQSA 8XIMA 2SFPA 2EKCA 3D47A 3CUFA 3VKDA 1GZJA 1N62C 2EGZA 1R3RA 4DO5A 1WKFA 2D69A 3E96A 3LBMA 3BWWA 4K2SA 5AVNA 3HQNA 4RPQA 2X2GA 2WZIA 1WAWA 4JEJA 1OGBA 1YNPA 4ATWA 2ISDA 2O0TA 2W0UA 1GOIA 4GCXA 4OZOA 3TWBA 3WLJA 4QG6A 3N14A 3FGCB 3ZYZA 4AY8A 1NP0A 2PBGA 5LIYX 4C6KA 4E2VA 1W1YA 2PDWA 3DFTA 3ZXWA 1GW1A 1NFPA 2NLIA 5T8GA 4KH2A 3KVLA 1EX1A 2VFDA 4JS3A 5E9AA 3DX5A 5EMYA 1L2UA 4L9ZA 5EFDA 4K7VA 3K1DA 3WDIA 4JQ9A 4LC6A 4EX4A 1XLHA 4AVNA 3OBEA 2XVPA 5I78A 1FFUC 4JY9A 4OUIA 1JZ5A 5H91A 1DL3A 2ZZ7A 5D4YA 3B0VC 4LFYA 4XIMA 3OJGA 3BOXA 4XKYB 3TCEA 3GM8A 3WQ8A 1NPXA 1WAUA 1T41A 3ARYA 5TIMA 7ENLA 3MZNA 2HXUA 3GHSA 2JF7A 1RBLA 3IVUA 4TV6A 1Z69A 2EG7A 3I65A 4OGZA 1VFSA 3K4DA 1OGGA 3QKEA 4FXSA 4AD4A 1BSLA 5GJMA 3QC0A 4PFMA 4BF5A 3GRSA 3KHJA 3WUGA 1QPRA 5G1MA 1K3UA 3NQ8A 1Q4NX 1TQXA 3PANA 1RY0A 4IQJA 1ZY8A 3C2EA 3HQOA 4GJ1A 1U1JA 1VFOA 1FFRA 1Q4WA 4HBKA 4GACA 1TIWA 3S4TA 4P5UA 1U22A 1UH4A 5D8ZA 3P84A 4UFHA 3WO8A 4FA3A 1UJQA 2Q09A 2ZRXA 3HM7A 4QS6A 1UP0A 4AEFA 4HU8A 2DT0A 5EMUA 2RGMA 2YCIX 4UCFA 3LLFA 1FWDC 3ZSTA 4XVDA 3UYCA 1U1HA 2V6AA 1G1YA 1CENA 1T7LA 3N2XA 2CWNA 2IKHA 3GR7A 4GH3A 2CLFA 3NQCA 2Q71A 1H0IA 3PC0A 4NJHA 3M44A 2X30A 1BAGA 1PUDA 1EP2A 5ABFA 2NXGA 4ZZ9A 1ONWA 2V5LA 4HZ6A 4NUWA 4Z08A 1GVQA 1X8FA 4W8LA 1GT8A 3W25A 4JTQA 2I16