1XHCA

Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779-001
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
351
structure length
346
Chain Sequence
SKVVIVGNGPGGFELAKQLSQTYEVTVIDKEPVPYYSKPMLSHYIAGFIPRNRLFPYSLDWYRKRGIEIRLAEEAKLIDRGRKVVITEKGEVPYDTLVLATGARAREPQIKGKEYLLTLRTIFDADRIKESIENSGEAIIIGGGFIGLELAGNLAEAGYHVKLIHRGAMFLGLDEELSNMIKDMLEETGVKFFLNSELLEANEEGVLTNSGFIEGKVKICAIGIVPNVDLARRSGIHTGRGILIDDNFRTSAKDVYAIGDCAEYSGIIAGTAKAAMEQARVLADILKGEPRRYNFKFRSTVFKFGKLQIAIIGNTKGEGKWIEDNTKVFYIGAVVFNDIRKATKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH oxidase /nitrite reductase
publication title NADH oxidase /nitrite reductase from Pyrococcus furiosus Pfu-1140779-001
rcsb
source organism Pyrococcus furiosus
molecule tags Oxidoreductase
total genus 105
structure length 346
sequence length 351
ec nomenclature
pdb deposition date 2004-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1xhcA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xhcA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xhcA02
2E5VA 1ZMDA 3DGHA 1GXFA 4C5OA 1K0LA 2GF3A 3AE6A 1CC2A 3GYIA 4ZCDA 2GQFA 4U8IA 1GPEA 1E1NA 4JDRA 4Z44A 3VR9A 5IPYA 1CC6A 2ZZCA 3AEAA 1PHHA 3EPTA 1CF3A 4NTCA 4A99A 3KA7A 2C3DA 4BK1A 4AT0A 5CKUA 3KVEA 3V3NA 4UDPA 4Y4LA 2VZ2A 4EMIA 4TM4A 1LVLA 3K7QX 3AYJA 1K4QA 1KNRA 1QJDA 3G5SA 4IVOB 1OJTA 2XFNA 4TM1A 4YSYA 2BK5A 2B9YA 4H4XA 4EQSA 4U8JA 2WHDA 3SFEA 5HY5A 4B68A 4A65A 2C72A 2EQ8A 1JOAA 1MOKA 3FG2P 1FL2A 4ZN0A 4JY2A 3SFDA 4CY8A 5EBKA 1KDGA 3V3OA 2YR5A 2C75A 1LV0A 2GVCA 3AE7A 1FEBA 4TM0A 4CCRA 1DOCA 4U8OA 3GYJA 5KVHA 3LXDA 1MO9A 2XLRA 2YG3A 4Z26A 1ZMCA 3K7TA 3NK2X 1DNCA 1GREA 3GRTA 3LADA 3Q6JA 2BYBA 2E1MA 3QJ4A 1TDEA 1N4VA 4YTPA 2FBWA 2YLSA 4GRTA 1E1MA 4M52A 2Y6RA 3BNUA 2JAEA 1TDNA 3AECA 1GRBA 1AOGA 1H81A 4JNQA 1PN0A 2YM2A 4ICYA 1JRZA 1PJ6A 1HYUA 2A8XA 1Y56B 3ICRA 2BA9A 1PXAA 5TR3A 3R9UA 1F8RA 1S2QA 4ECHA 1Y0PA 3GMCA 2DKIA 3OC4A 1M64A 1VDCA 3DA1A 4Z2RA 2X99A 3DJEA 1S3BA 3AB1A 4GF7A 4CCQA 4EIQA 2AAQA 1GEUA 3K30A 3ALLA 1V59A 1RYIA 3ICTA 3DH9A 2JBVA 2Q0LA 2R4JA 1NHPA 1GTHA 4GDEA 4H4YA 3NIXA 1YKJA 3QVPA 1EL9A 1ZKQA 3M12A 2VQBA 1CC4A 3ATRA 3CIRA 4C3XA 2YLRA 3L1RA 4AP3A 1F8WA 3F8DA 1FCDA 2H88A 1VQWA 3ALJA 4B1BA 4EM4A 1GSNA 3CNTA 3CPIG 4OPDA 5GSNA 3D1CA 1YY5A 2X8HA 4A79A 2YR4A 3IF9A 2JB1A 1XPQA 4OPLA 4OPIA 1N4WA 2XVHA 1E1LA 2WBAA 2C76A 1B8SA 1TDKA 5JCMA 2WDVA 1YQ4A 3LB8A 3KLJA 5FMHA 3BHKA 2RGHA 2PHHA 1OJCA 3CNPA 3NK0X 4H4RA 2WQYA 4REKA 4DGKA 4BK2A 1GRAA 3ZYXA 1B5QA 2WESA 1ZX9A 1TYTA 3NYCA 1S2YA 3RP7A 2XVIA 2CULA 4H4WA 3VR8A 3AEFA 4H2QA 4GUVA 1PXCA 4OCGA 4GCMA 1DJQA 5DBJA 4B65A 3UTEA 1GTEA 2WPCA 3GMBA 3AD7B 3PVCA 4EMWA 1EL5A 1FOHA 4H2NA 1RP0A 4RG4A 2YLTA 4XWZA 3WE0A 4A6NB 3FIMB 3NT6A 2Q7VA 2WEUA 4GR1A 2BS2A 4YKFA 2R46A 3LZXA 4DSHA 4EQRA 2R0GA 2GAGB 2WOVA 3QSMA 4B66A 1BF3A 2RABA 5KOWA 2E4GA 1CJ3A 2YVFA 5M10A 2AR8A 4ZCCA 2VVMA 4PABA 1L0VA 4X4JA 5JCNA 3M0OA 2YG6A 4Z24A 2XFOA 4YWOA 1KSUA 2BXSA 2XFQA 3S5WA 4B67A 1BWCA 3AXBA 3KKJA 1TDOA 5U1OA 3CGDA 2FJDA 2C3CA 4USQA 2IVDA 2NPXA 1PBBA 1D7LA 2RGOA 3AE8A 1Z6LA 1JRXA 1OJDA 1E1KA 2OA1A 4IA5A 1PXBA 4U2LA 2RGJA 3H4KA 2WP6A 2GH5A 3UKAA 1EL8A 3BI4A 4DNAA 4H4QA 3SGLA 3UP5A 3SQPA 2XDOA 2APGA 2BCGG 2XFUA 3KPFA 2W0HA 3DK8A 2FJAA 3AE2A 1GRGA 4AT2A 2YG7A 1YQ3A 5KWFA 1H83A 3F8RA 4UDRA 4LU6A 3IHMA 2BABA 4IA6A 3NKSA 2WP5A 4O5UA 1GNDA 4Z25A 3C4NA 1GOSA 3AD9B 2DKHA 3FMWA 1P2EA 4K2XA 2GMHA 2GEWA 2VVLG 3NGCX 3D8XA 3VQRA 3NN6X 1H86A 2PYXA 1K0JA 4JQ9A 1OJ9A 1K0IA 1REOA 4A5LA 1PDHA 1LPFA 4GDPA 4J36A 2NVKX 3AE3A 3H8IA 1B4VA 3LOVA 2XVEA 1F3PA 2BC1A 1PBFA 2BXRA 3UOYA 3RP6A 3JSKA 4C77A 2YVJA 2R4EA 5C2TA 5M0ZA 3M13A 2FJBA 4X9NA 3NK1X 4YSZA 1PJ5A 3NRNA 3UTHA 1O5WA 4O5QA 1GERA 3K7MX 2X8CA 1CJ4A 3E1TA 3NLCA 4EM3A 2OAMA 4U2TA 4K5RA 1NEKA 2YM1A 1H7XA 1E7PA 1L9EA 4U2SA 3EANA 2V6OA 2XLPA 3PS9A 3GRSA 3AEDA 3DJJA 4TLXA 2IVEA 1LJ1A 4U8PA 1CBOA 1L9DA 1ZP0A 4NTDA 2BS4A 3VRBA 4H4TA 2JKCA 4H2PA 4EQWA 3UTFA 4J34A 3AEGA 3B6DA 2B7SA 4OPGA 2WU5A 5C3JA 4FK1A 3RP8A 2C70A 5KOXA 2B7RA 2XLSA 4BJZA 2BC0A 2AQJA 3UKQA 4K8DA 1Q1WA 5FS7A 1ZOVA 1KNPA 2O9ZA 3DMEA 2C67A 3FPZA 4TM3A 1LQUA 1KSSA 3CGCA 3S61A 4YKGA 3P4RA 3LZWA 4U8KA 1LQTA 3UKHA 2GRTA 1F8SA 1MXTA 2CVJA 1ZOYA 4J33A 5U63A 2F5ZA 1QO8A 3GDPA 4HA6A 4EMJA 2V3BA 1IUSA 4XXGA 3BI5A 2J3NA 1N1PA 3AD8B 3AE1A 3UOXA 3Q9TA 2GMJA 3KU9A 2Z5XA 5HXIA 2WU2A 1BKWA 3GD4A 5BULA 4J57A 3ADAB 1BZLA 3RHAA 1JEHA 3G5QA 1H82A 1NG4A 2YWLA 2GR0A 1OJAA 1F6MA 3ISHA 3CGEA 1IUVA 2VQ7A 4JY3A 1GESA 2V61A 2YR6A 3CPHG 4LIIA 2QA1A 1ELIA 1NHRA 1Q1RA 4HB9A 4Y4MA 4YTMA 4J56A 2JK6A 1B37A 2WETA 3DJGX 1VRQB 2XVFA 2GB0A 1DOEA 3ICSA 4C3YA 2XLTA 4KPRA 1XANA 4EQXA 3AEEA 4LA1A 1Q9IA 1GRFA 2XFPA 4J2WA 4USRA 4UDQA 3UKFA 1FEAA 2A87A 5EOWA 1XHCA 2BACA 2WS3A 2GR2A 3CNJA 5LV9A 1ZDLA 2ZBWA 1PBDA 5GRTA 3SM8A 2I0ZA 2YLXA 2GR1A 2R9ZA 2BCPA 2C65A 2VOUA 3DJDA 4OVIA 4D03A 4EIPA 4H4VA 1O94A 3ZDNA 4H7UA 4OPCA 3VRDB 2JB3A 1P2HA 1EL7A 1DOBA 4XWRA 4J31A 3PO7A 4NTEA 1KF6A 2X8GA 2IIDA 1RSGA 4YXDA 5J7XA 1DXLA 3G5RA 4N9XA 5KRQA 3C4AA 1L9CA 2XLUA 3C96A 2R0CA 5ER0A 3P4SA 4B63A 4Z2TA 2UZZA 4BK3A 3FBSA 2EQ6A 2ACZA 2Q6UA 3BI2A 1E6EA 2EQ7A 1D4DA 3P4QA 2WP9A 1TDFA 4C74A 2WPEA 3NNEA 3DGZA 3IWAA 3DK9A 3T37A 2YQUA 2QAEA 1YQZA 4H4ZA 5U25A 2YLZA 4UP3A 5KXJA 3DK4A 4RG3A 1NPXA 4CRTA 3RNMA 1GV4A 4FK1C 2BK3A 1NG3A 2YLWA 3CNDA 2QCUA 4CNJA 4CNKA 5HYMA 4NEVA 4FX9A 2YAUA 1NAAA 3B3RA 3H8LA 5IQ4A 3UTGA 1CJCA 1NHQA 1D4EA 1Y56A 3ALMA 4K22A 3UKLA 3LJPA 4U8NA 3REDA 2WPFA 4A7AA 3BHFA 3F8PA 1GALA 1FECA 1H6VA 1CHUA 1SEZA 1X31B 4I58A 2YG5A 4Z43A 3AE4A 1JNZA 5JCKA 2X50A 1JRYA 3HZLA 3I6DA 1GETA 2XYOA 1KFYA 4Y4NA 4FDCB 4APNA 3UOZA 5BUKA 2JB2A 1H84A 4K5SA 1IUUA 2GR3A 4NEWA 2B76A 4PAAA 4BJYA 3CTYA 2OLNA 1IUWA 1VG0A 1QLBA 2ZZ0A 1D7YA 2C64A 2OLOA 3COXA 3P1WA 1IUXA 1GT8A 3VRAA 2VRLA 4CBQA 4CY6A 3II4A 3UP4A 3UKPA 1CL0A 4ADWA 3P9UA 2X3NA 1GRTA 3EAOA 3ATQA 4YSXA 1BGNA 3CGBA 3NTAA 4H4SA 1IJHA 2Y6QA 2TMDA 2XCGA 2GAHB 3UOVA 4DSGA 1PS9A 2B9WA 1UKVG 3AE9A 1DJNA 3O0HA 1JNRA 3AYIA 1N4UA 3I3LA 1NHSA 1JU2A 3EF6A 4H50A 2TPRA 2ARDA 2GQWA 4K7ZA 2V5ZA 3NYEA 2R0PA 3NYFA 5EB4A 2GV8A 3NN0X 3NTDA 4BURA 3QFAA 5EB5A 2C7GA 2OALA 2C73A 4JNAA 4AP1A 2H89A 2R45A 2WDRA 3IHGA 4U8LA 3QFBA 3URHA 3GSIA 3GD3A 3NHOX 1XDIA 4AOSA 3ABVA 1W4XA 5IQ1A 2V3AA 2WOIA 2BS3A 4U8MA 4X9MA 1CJ2A 1O95A 4JN9A 2B9XA 5CQFA 3QVRA 3GWFA 3OZ2A 4A6NA 5J60A 3AE5A 3CNSA 3KD9A 5JCIA 2YG4A 4OPTA 1NDAA 4WX1A 5KVIA 1LTXR 4P9SA 4RSLA 2CDUA 3CPJG 4H4UA 4WCTA 3L8KA 2Q0KA 1GRHA 3GWDA 1COYA 3AYLA 4KX6A 4B64A 1D5TA 1S3EA 3QSSA 4YTNA 3NH3X 4IV9A 3ITJA 2A89A 4TLZA 1NENA 5FS8A 4YSHA 4H2RA 1ONFA 2VVLA 4E0VA 5BRTA 4Z2UA 5JCLA 2CFYA 5FS6A 1PBCA 2EQ9A 4A9WA 2VRMA 4NZHA 4MJWA 1ZK7A 5L46A 1PJ7A 4BV6A 3IC9A 3NG7X 1TRBA 2XVJA 2V60A 5HHFA 2WOWA 2WDQA 3V76A 4YT0A 2Z5YA 5FS9A 1VG9A 1M6IA 3CN8A 4AOXA 1ZY8A 3UKKA 3QSEA 2ZZBA 4B69A 1IUTA 2FJEA 1PBEA 3UCLA 4D04A 2HQMA 4IVMB 1D4CA 1H7WA 2C66A 4I59A 4OPUA 1EBDA 3BNMA 1E39A 4H4PA 3AWIA 1DODA 3AEBA 2BK4A 2QA2A 2YVGA 3P4PA 3GDNA 1BGJA 5BVAA 1TYPA
chains in the Genus database with same CATH superfamily
3DGHA 1GXFA 1FIQB 4C5OA 3GYIA 3A7UA 1E1NA 1CC6A 5CKUA 3RRAA 3UXLA 4NNJA 4Y4LA 3QTPA 4E4FA 1K4QA 1KNRA 3AYJA 4YSYA 2XFNA 5HY5A 4JN7A 4A65A 2EQ8A 4JY2A 3SFDA 1T3QC 5EBKA 1KDGA 3V3OA 2GVCA 1LV0A 2E3TA 4TM0A 2ZC8A 4HYRA 1DOCA 5KVHA 3LXDA 1MO9A 2YG3A 3Q6JA 3LADA 4YTPA 4GRTA 1EC8A 4II3A 2W55A 2Y6RA 2OO6A 2JAEA 3AECA 1AOGA 3S47A 1PN0A 1JRZA 1HYUA 2BA9A 4ECHA 3GMCA 1JCTA 4GF7A 4CCQA 3QLDA 3ALLA 3QN3A 2Q0LA 2VQBA 1CC4A 3CIRA 2PGWA 3L1RA 1FCDA 3PG6A 1GSNA 2QDDA 3D1CA 2X8HA 4A79A 5ENLA 1N4WA 2XVHA 3KLJA 3BHKA 1OJCA 3CNPA 3ZYXA 2WESA 1ZX9A 1TYTA 3VR8A 4GUVA 1PXCA 3DFHA 4GGBA 1DJQA 1W6TA 2P0IA 1VQZA 4H2HA 4EQRA 2R0GA 4X2PA 2GAGB 1P43A 1TZZA 2YVFA 5FJPA 5M10A 2VVMA 1FHVA 2QJMA 3UJRA 4PABA 4Z24A 4IHCA 4YWOA 1KSUA 1BWCA 3B97A 3AXBA 5U1OA 1PBBA 2AL1A 1EC9A 1E1KA 1PXBA 2WP6A 3VCNA 2PTZA 3UKAA 2BCGG 3DK8A 3U9IA 1H2IA 2ONEA 2PTYA 3NVZB 1YQ3A 1H83A 4UDRA 4LU6A 2HXTA 2O56A 2WP5A 4Z25A 1R6WA 3VC6A 2DKHA 2GMHA 2VVLG 1SB3B 1H86A 3NN6X 2PYXA 2POZA 1K0IA 1PDHA 4J36A 4IL2A 3M13A 3TQPA 4YSZA 3NRNA 4O5QA 3SZCA 4EM3A 2P3ZA 3UJFA 1H7XA 2XLPA 4GMEA 4DWDA 2GSHA 4ZCWA 1LJ1A 1CBOA 2GGEA 1L9DA 1ZP0A 3VRBA 4H4TA 4J34A 3JVAA 3AEGA 2WU5A 3RP8A 5KOXA 3UJEA 2BC0A 1Q1WA 3Q45A 4TM3A 3CGCA 3MSYA 3P4RA 3LZWA 3P3BA 1MXTA 2OZ8A 3D46A 2CVJA 2F5ZA 4HA6A 4DXKA 1FO4A 3Q9TA 5JRBA 4IP4A 4J57A 1BZLA 2YWLA 3CXOA 1OJAA 3CGEA 1GESA 2V61A 1ZXIC 4G73A 3D47A 3ZLFA 1DOEA 4C3YA 4MGGA 2XLTA 1XANA 2W3RA 4J2WA 1XHCA 2WS3A 2GR2A 4DYEA 2C65A 4EIPA 3HYVA 1P2HA 4NTEA 3HW2A 2XLUA 4NWZA 1SJAA 2ACZA 2Q6UA 3K1GA 1E6EA 3T8QA 3DEQA 4H4ZA 4HPNA 3NZGA 4RG3A 4FK1C 3JZUA 3CNDA 3DIPA 5HYMA 4NEVA 3ALMA 4U8NA 3UCDA 3H70A 3UGVA 3ZVIA 3P0WA 3I6DA 4FDCB 2B76A 3DDMA 4EWJA 4GYPC 3COXA 1R0MA 2ZZ0A 3P1WA 1D7YA 1IUXA 4CBQA 3UP4A 3EAOA 3ATQA 3OTRA 2PP3A 2Y6QA 2TMDA 2GAHB 4DSGA 1PS9A 2B9WA 3AE9A 4M6UA 3AYIA 1N4UA 3H8AA 3EF6A 1KKRA 2TPRA 2V5ZA 2GQWA 4K7ZA 3R0UA 2R0PA 3NVYB 2GV8A 5EB5A 2C73A 4DN1A 3GSIA 3GD3A 3ABVA 3CT2A 3IJIA 1O95A 5CQFA 3AE5A 3Q4DA 2OQYA 3L8KA 1COYA 1P48A 1S3EA 3ITJA 4H2RA 5BRTA 2OG9A 5JCLA 2P8BA 4NZHA 4IP5A 1ZK7A 4BV6A 5HHFA 4YT0A 3SQSA 2V60A 3MZNA 3D9XA 1VG9A 3CN8A 3NVWB 4B69A 4I59A 3R25A 1E39A 2XH2A 2BK4A 2QA2A 4H83A 1BGJA 2E5VA 1WUFA 2GF3A 3AE6A 5IPYA 1GPEA 4JDRA 1JPDX 3AEAA 4NTCA 3CB3A 2C3DA 4BK1A 3KVEA 3V3NA 1V97A 2VZ2A 1LVLA 2DW6A 3K7QX 1QJDA 1ECQA 2B9YA 2QGYA 3SFEA 4E4UA 4B68A 4GGHA 2C72A 3SN0A 4II2A 3AE7A 4U8OA 4Z26A 3NK2X 3QJ4A 3ZVHA 1TDEA 2FBWA 3R11A 3SYIA 3SR6B 1DTNA 1BKHA 1H81A 4JNQA 3UJ2A 3T2YA 3HRDC 2XH4A 1S2QA 1Y0PA 2PA6A 3OC4A 1M64A 1VDCA 3AB1A 1RYIA 2R4JA 1NHPA 1YKJA 3M12A 2OX4A 4C3XA 3ES8A 4AP3A 1KN0A 2H88A 3ALJA 4B1BA 3CNTA 4OPDA 2YR4A 1E1LA 1B8SA 4K2SA 1TDKA 3V3WA 5FMHA 2QJJA 2RGHA 2PHHA 3NK0X 5BOFA 1GRAA 1S2YA 2XVIA 4GCMA 4B65A 3VA8A 2YLTA 2WEUA 2BS2A 2R46A 3LZXA 3FVDA 2FYMA 3OW1A 1BF3A 3SJNA 1N5WC 2RABA 1MRAA 2AR8A 4ZCCA 5JCNA 3M0OA 3AM9A 1D7LA 2RGOA 1Z6LA 1JRXA 4IA5A 2RGJA 3H4KA 3SN1A 1EL8A 4DNAA 4H4QA 2XDOA 3DFYA 1N62C 4AT2A 3GC2A 5KWFA 2BABA 1PDZA 3NKSA 4O5UA 1P2EA 2GEWA 3MUCA 4JQ9A 1OJ9A 4A5LA 4GDPA 1LPFA 4K8GA 2NVKX 4KPLA 1B4VA 2BC1A 2R4EA 2FJBA 3ZVHB 1PJ5A 1MNSA 1NEKA 2YM1A 1L9EA 1PDYA 3DJJA 4TLXA 2W3SA 3L5OA 2IVEA 3ENLA 4HCHA 4H2PA 4EQWA 4OPGA 1KCZA 2B7RA 2XLSA 4BJZA 2AQJA 1ZOVA 4K8DA 5FS7A 3CYJA 3UCCA 3SXIA 2C67A 4YKGA 1LQUA 4U8KA 4ZOHB 3UKHA 2GRTA 1MDLA 4J33A 1QO8A 4HNLA 2V3BA 4EMJA 2J3NA 3UOXA 3AE1A 3FCPA 2Z5XA 5HXIA 1KKOA 3S5SA 3ADAB 3G5QA 1NG4A 3IJLA 1F6MA 3T2KA 3ISHA 3FJ4A 4JY3A 4IT1A 3CPHG 4HB9A 4YTMA 1NHRA 1ELIA 3BSMA 4J56A 1B37A 3DJGX 3CXBA 2XVFA 1TE6A 4ZA0A 1N60C 4G7FA 4LA1A 3H12A 4USRA 4UDQA 2A87A 3R0KA 2PU1A 1ZDLA 2ZBWA 3SM8A 2I0ZA 2YLXA 2VOUA 3DJDA 4OVIA 4D03A 3AMZA 1O94A 3ZDNA 4OPCA 3VRDB 4XWRA 4J31A 4J3ZA 1KF6A 2X8GA 2IIDA 1RSGA 5J7XA 1DXLA 3DERA 3C96A 5ER0A 3P4SA 2OKTA 2UZZA 4BK3A 3BI2A 1D4DA 1TDFA 4C74A 1EBHA 3IWAA 2YQUA 2QAEA 3SZWA 1JDFA 5KXJA 1NPXA 4CRTA 3RITA 3RNMA 4KT2A 1NG3A 2QCUA 4CNJA 4A35A 1NAAA 1CJCA 1NHQA 1D4EA 3UKLA 2WPFA 3VC5A 4A7AA 3BHFA 1EBGA 4MKSA 1EC7A 3MY9A 1H6VA 1SEZA 1X31B 4I58A 3RGTA 5JCKA 4NEWA 4PAAA 4A6GA 1QLBA 3RCYA 3UKPA 3P9UA 4A3RA 4YSXA 1IYXA 4H4SA 1IJHA 1DJNA 3O0HA 2HNEA 2XSXA 3I3LA 1NHSA 4FP1A 2ARDA 3T4WA 3NYEA 2I5QA 3NYFA 5EB4A 3NTDA 4JNAA 2H89A 3SX6A 3NHOX 1XDIA 4AOSA 1W4XA 5IQ1A 2V3AA 2BS3A 4U8MA 4X9MA 3QVRA 3GWFA 2AKZA 3CNSA 4OPTA 1NDAA 2CDUA 3CPJG 4H4UA 3GWDA 4B64A 4IV9A 2A89A 4TLZA 5FS8A 4H19A 3TW9A 4DX3A 5FS6A 2EQ9A 2QVHA 2P88A 5L46A 1PJ7A 3NG7X 2XVJA 4AOXA 1ZY8A 1IUTA 2FJEA 3UCLA 4D04A 2HQMA 3DGBA 5FJTA 1H7WA 3FXGA 1DODA 3AEBA 3SY4A 3MKCA 3I6EA 3GDNA 3U4FA 1ZMDA 1K0LA 4MMWA 4ZCDA 2GQFA 2ZZCA 3EPTA 1CF3A 5KMSA 2PMQA 4UDPA 1NELA 4IVOB 4TM1A 4H4XA 4EQSA 4U8JA 3BOXA 3HPFA 1MOKA 4ZN0A 1FEBA 1ZMCA 2E1MA 2YLSA 1E1MA 3BNUA 1TDNA 3N4FA 3SBFA 1GRBA 2FKPA 3TJIA 2YM2A 1PJ6A 3ICRA 1PXAA 5TR3A 3SN4A 2C4CA 2DKIA 3DA1A 2X99A 1S3BA 4Z17A 3K30A 1V59A 2GGJA 4GDEA 4H4YA 3NIXA 3QVPA 1EL9A 5FJUA 2YLRA 1VQWA 4EM4A 3P93A 1YY5A 3A7AA 3IF9A 2JB1A 1XPQA 4OPIA 2C76A 5JCMA 2OLAA 4Z1YA 2WDVA 3LB8A 6ENLA 2GL5A 4H4RA 2WQYA 2OZ3A 4REKA 3NYCA 3RP7A 1STZA 2CHRA 2CULA 4H4WA 4H2QA 2E5AA 4OCGA 2BRYA 3V4BA 3TWBA 2WPCA 3B9JB 3PVCA 1FOHA 4XWZA 3WE0A 1RP0A 3FIMB 3NT6A 3BJSA 4GR1A 4E6MA 1X2HA 4YKFA 4DSHA 3QSMA 4B66A 1SJBA 2E4GA 1CJ3A 3T31A 3CAWA 1FHUA 4X4JA 2YG6A 3N6HA 2XFOA 2BXSA 2XFQA 4B67A 2PTWA 3KKJA 1TDOA 2FJDA 3T0KA 1ONEA 4HCDA 3AE8A 3VDGA 2GH5A 3BI4A 3SQPA 2APGA 2W0HA 2FJAA 2YG7A 3EEZA 3F8RA 4IA6A 3ZLHA 3N6JA 1GNDA 3C4NA 1GOSA 1NU5A 3FMWA 4K2XA 4G9KA 3D8XA 1JPMA 3AE3A 2OVLA 3H8IA 3LOVA 2XVEA 1F3PA 1PBFA 2BXRA 3UOYA 5FJRA 4ENLA 2YVJA 5M0ZA 3NFUA 3NK1X 3MQTA 1O5WA 1GERA 3RR1A 1CJ4A 3E1TA 2OAMA 4U2TA 2QDEA 5IDZA 4U8PA 1XS2A 3UTFA 3PWGA 2B7SA 4IL0A 5C3JA 4FK1A 3UKQA 1L8PA 2O9ZA 2AKMA 3EUB3 4TM4A 4HNCA 1KNPA 3FPZA 2HZGA 1LQTA 4GFIA 1ZOYA 4XXGA 1YEYA 3KU9A 2WU2A 1H82A 2GR0A 3GO2A 2YR6A 4E5TA 2QA1A 2GB0A 4KPRA 4EQXA 1JROA 3AEEA 3PFRA 1GRFA 2XFPA 3UKFA 2HXUA 5EOWA 5LV9A 5GRTA 2GR1A 1N63C 4H4VA 4H7UA 5J04A 1EL7A 4YXDA 4N9XA 3C4AA 2R0CA 3JW7A 4B63A 4Z2TA 3FBSA 2EQ6A 3FYYA 2EQ7A 2OPJA 2WPEA 3NNEA 3NO1A 3DK9A 5U25A 4UP3A 2ZADA 3ES7A 5KNLA 1GV4A 2OQHA 2BK3A 2YLWA 3DG6A 4FX9A 5IQ4A 3UTGA 1Y56A 4E8GA 3OP2A 3R10A 3LJPA 3REDA 3VFCA 1FECA 1RM6B 1XPYA 4Z43A 1JNZA 1JRYA 4Y4NA 2JB2A 1H84A 4K5SA 1IUUA 3HYXA 4BJYA 3CTYA 2OLNA 1IUWA 1VG0A 3VRAA 2C64A 2OLOA 1GT8A 2VRLA 3II4A 1BGNA 5KMPA 2NQLA 3NTAA 1JRPA 3UOVA 1UKVG 3T9PA 1JU2A 5G5GB 3OPSA 3DG3A 3KUMA 3NN0X 1MDRA 2C7GA 3SSZA 2OALA 1BQGA 3IHGA 4U8LA 2AL2A 1CJ2A 4JN9A 3GD6A 5EU9A 2B9XA 4A6NA 3OZ2A 5J60A 3KD9A 5JCIA 2YG4A 4WX1A 5KVIA 1LTXR 4RSLA 2Q0KA 4KX6A 1GRHA 3AYLA 3TTEA 3QSSA 3NRZB 3AN1A 4YSHA 1ONFA 2VVLA 4TVYA 4J1OA 1TRBA 2WOWA 2WDQA 2Z5YA 5FS9A 3UKKA 3QSEA 4GAPA 4OPUA 3T6CA 1EBDA 3BNMA 4K1WA 4H4PA 1SJCA 3P4PA 1TYPA 5FJOA 2PS2A 1CC2A 3I4KA 4U8IA 4Z44A 3VR9A 1PHHA 4A99A 3KA7A 3A7RA 3RO6A 4AT0A 3KPKA 2RDXA 2XH7A 3HYWA 4EMIA 1FFVC 3G5SA 1OJTA 2BK5A 2WHDA 2XH0A 3OZMA 1N5XA 2MNRA 3FG2P 1JOAA 1FL2A 3N4EA 4CY8A 3FV9A 2YR5A 2C75A 4CCRA 3NS1B 1WYGA 3GYJA 2XLRA 1FFUC 3K7TA 1DNCA 1GREA 3GRTA 2BYBA 1TKKA 1N4VA 4M52A 1SJDA 3NXLA 4ICYA 5KMQA 2A8XA 1Y56B 1KD0A 3R9UA 1F8RA 3DESA 2PU0A 3TWAA 4Z2RA 3DJEA 4EIQA 2AAQA 1GEUA 3V5FA 3ICTA 3DH9A 2JBVA 1GTHA 3ETRB 1ZKQA 3I6TA 3ATRA 1F8WA 3F8DA 3VCCA 2GGHA 5G5HB 3CPIG 5GSNA 2MUCA 4OPLA 2WBAA 2XGZA 3PWIA 1YQ4A 1RVKA 1F9CA 4GIRA 4DGKA 4BK2A 1B5QA 4G6GA 3AEFA 3TJ4A 5DBJA 3UTEA 1GTEA 2AL2B 3AD7B 3GMBA 4H2NA 4EMWA 1EL5A 4RG4A 3CK5A 4A6NB 4H1ZA 2Q7VA 3IK4A 3STPA 2WOVA 5KOWA 4DHGA 4TVWA 1E9IA 1L0VA 1ELSA 3S5WA 4YWSA 3CGDA 2C3CA 4USQA 2IVDA 2NPXA 1OJDA 2OA1A 4U2LA 3MWCA 3TOYA 3SGLA 3UP5A 3KPFA 3TCSA 2XFUA 3AE2A 1GRGA 3ZLGA 4G6HA 3IHMA 3IJQA 3R1ZA 3AD9B 3NGCX 3VQRA 1K0JA 1REOA 3RP6A 3JSKA 3OZYA 4C77A 5C2TA 1X2GA 2PP0A 4X9NA 2PGEA 3UTHA 3K7MX 2X8CA 3NLCA 2QQ6A 4K5RA 1E7PA 4U2SA 2PCEA 3EANA 2V6OA 3PS9A 3GRSA 3AEDA 4JN8A 3DG7A 4IZGA 4NTDA 2BS4A 3EKGA 2JKCA 3B6DA 3T2ZA 2C70A 3DMEA 3S61A 1KSSA 5BOEA 4F4RA 2DW7A 1F8SA 5U63A 3GDPA 3SZ0A 1IUSA 4ROPA 3BI5A 1N1PA 2OFJA 3AD8B 2GMJA 1BKWA 3GD4A 5BULA 3RHAA 1JEHA 2PP1A 4FI4A 1IUVA 2VQ7A 4LIIA 4Y4MA 1Q1RA 3CMMA 3GY1A 2JK6A 2WETA 1VRQB 3ICSA 1Q9IA 1FEAA 2BACA 3CNJA 1PBDA 2R9ZA 2BCPA 2JB3A 1DOBA 3PO7A 3V5CA 2OZTA 3G5RA 5KRQA 1L9CA 1OEPA 3R07C 1WUEA 4JHMA 2P8CA 2W54A 4KWSA 3P4QA 2WP9A 3DGZA 3QKEA 2PTXA 3T37A 3UXKA 1YQZA 4G74A 2YLZA 3DK4A 4CNKA 2YAUA 3H8LA 3B3RA 7ENLA 2PODA 4K22A 3F8PA 1GALA 4KEMA 2BRAA 1CHUA 4GAVA 2YG5A 3AE4A 2X50A 3HZLA 1GETA 3PK7A 3THUA 1KFYA 2XYOA 4APNA 3UOZA 5BUKA 4HN8A 2GR3A 2PSNA 1MUCA 4CY6A 2GGGA 4HCLA 1CL0A 4ADWA 2X3NA 1GRTA 3CGBA 2XCGA 4G8TA 1JNRA 3UJSA 3GYXA 4H50A 3SZFA 2PPGA 4M0XA 4BURA 3QFAA 4AP1A 2R45A 2WDRA 3QFBA 3URHA 4GYPA 2WOIA 2GGIA 3H7VA 4GISA 4P9SA 3QPEA 4WCTA 1D5TA 4YTNA 3NH3X 1NENA 5KMRA 4E0VA 4Z2UA 2CFYA 3T14A 1PBCA 1VDVA 4A9WA 2VRMA 4MJWA 3IC9A 3V76A 1M6IA 2GDQA 2ZZBA 2QJNA 1PBEA 4IVMB 1S7MA 1D4CA 2C66A 3AWIA 1N61C 2YVGA 3NVVB 5BVAA
chains in the Genus database with same CATH topology
2E5VA 1ZMDA 3DGHA 1GXFA 4C5OA 1K0LA 2GF3A 3AE6A 1CC2A 3GYIA 4ZCDA 2GQFA 4U8IA 1GPEA 1E1NA 4JDRA 4Z44A 3VR9A 5IPYA 1CC6A 2ZZCA 3AEAA 1PHHA 3EPTA 1CF3A 4NTCA 4A99A 3KA7A 2C3DA 4BK1A 4AT0A 5CKUA 3KPKA 3KVEA 3V3NA 5KMSA 3HYWA 4UDPA 4NNJA 4Y4LA 2VZ2A 4EMIA 4TM4A 1LVLA 3K7QX 3AYJA 1K4QA 1KNRA 1QJDA 3G5SA 4IVOB 1OJTA 2XFNA 4TM1A 4YSYA 2BK5A 2B9YA 4H4XA 4EQSA 4U8JA 2WHDA 3SFEA 5HY5A 4B68A 4A65A 2C72A 2EQ8A 1JOAA 1MOKA 3FG2P 1FL2A 4ZN0A 4JY2A 3SFDA 4II2A 4CY8A 5EBKA 1KDGA 3V3OA 2YR5A 2C75A 1LV0A 2GVCA 3AE7A 1FEBA 4TM0A 4CCRA 1DOCA 4U8OA 3GYJA 5KVHA 3LXDA 1MO9A 2XLRA 2YG3A 4Z26A 1ZMCA 3K7TA 3NK2X 1DNCA 1GREA 3GRTA 3LADA 3Q6JA 2BYBA 2E1MA 3QJ4A 1TDEA 1N4VA 4YTPA 2FBWA 2YLSA 4GRTA 4II3A 1E1MA 4M52A 2Y6RA 3BNUA 3SYIA 2JAEA 1TDNA 3AECA 1GRBA 1AOGA 1H81A 4JNQA 1PN0A 2YM2A 4ICYA 1JRZA 1PJ6A 5KMQA 3T2YA 1HYUA 2A8XA 1Y56B 3ICRA 2BA9A 1PXAA 5TR3A 3R9UA 1F8RA 1S2QA 4ECHA 2C4CA 1Y0PA 3GMCA 2DKIA 3OC4A 1M64A 1VDCA 3DA1A 4Z2RA 2X99A 3DJEA 1S3BA 3AB1A 4GF7A 4CCQA 4EIQA 2AAQA 1GEUA 3K30A 3ALLA 1V59A 1RYIA 3ICTA 3DH9A 2JBVA 2Q0LA 2R4JA 1NHPA 1GTHA 4GDEA 4H4YA 3NIXA 1YKJA 3QVPA 1EL9A 1ZKQA 3M12A 2VQBA 1CC4A 3ATRA 3CIRA 4C3XA 2YLRA 3L1RA 4AP3A 1F8WA 3F8DA 1FCDA 1KN0A 2H88A 1VQWA 3ALJA 4B1BA 4EM4A 3PG6A 1GSNA 3CNTA 3CPIG 4OPDA 5GSNA 3D1CA 1YY5A 2X8HA 4A79A 2YR4A 3IF9A 2JB1A 1XPQA 4OPLA 4OPIA 1N4WA 2XVHA 1E1LA 2WBAA 2C76A 1B8SA 1TDKA 5JCMA 2WDVA 1YQ4A 3LB8A 3KLJA 5FMHA 3BHKA 2RGHA 2PHHA 1OJCA 3CNPA 3NK0X 4H4RA 2WQYA 4REKA 4DGKA 4BK2A 1GRAA 3ZYXA 1B5QA 2WESA 1ZX9A 1TYTA 3NYCA 1S2YA 3RP7A 2XVIA 2CULA 4H4WA 4G6GA 3VR8A 3AEFA 4H2QA 4GUVA 1PXCA 4OCGA 4GCMA 1DJQA 2BRYA 5DBJA 4B65A 3UTEA 1GTEA 2WPCA 3GMBA 3AD7B 3PVCA 4EMWA 1EL5A 1FOHA 4H2NA 1RP0A 4RG4A 2YLTA 4XWZA 3WE0A 4A6NB 3FIMB 3NT6A 2Q7VA 2WEUA 4GR1A 2BS2A 4YKFA 2R46A 3LZXA 4DSHA 4EQRA 2R0GA 2GAGB 2WOVA 3QSMA 4B66A 1BF3A 2RABA 5KOWA 2E4GA 1CJ3A 2YVFA 3T31A 5M10A 2AR8A 4ZCCA 2VVMA 4PABA 1L0VA 4X4JA 5JCNA 3M0OA 2YG6A 4Z24A 2XFOA 4YWOA 1KSUA 2BXSA 2XFQA 3S5WA 4B67A 1BWCA 3AXBA 3KKJA 1TDOA 5U1OA 3CGDA 2FJDA 2C3CA 4USQA 2IVDA 3T0KA 2NPXA 1PBBA 1D7LA 2RGOA 3AE8A 1Z6LA 1JRXA 1OJDA 1E1KA 2OA1A 4IA5A 1PXBA 4U2LA 2RGJA 3H4KA 2WP6A 2GH5A 3UKAA 1EL8A 3BI4A 4DNAA 4H4QA 3SGLA 3UP5A 3SQPA 2XDOA 2APGA 2BCGG 2XFUA 3KPFA 2W0HA 3DK8A 2FJAA 3AE2A 1GRGA 4AT2A 2YG7A 1H2IA 4G6HA 1YQ3A 5KWFA 1H83A 3F8RA 4UDRA 4LU6A 3SXIA 3IHMA 2BABA 4IA6A 3NKSA 2WP5A 4O5UA 1GNDA 4Z25A 3C4NA 1GOSA 3AD9B 2DKHA 3FMWA 1P2EA 4K2XA 4G9KA 2GMHA 2GEWA 2VVLG 3NGCX 3D8XA 3VQRA 3NN6X 1H86A 2PYXA 1K0JA 4JQ9A 1OJ9A 1K0IA 1REOA 4A5LA 1PDHA 1LPFA 4GDPA 4J36A 2NVKX 3AE3A 3H8IA 1B4VA 3LOVA 2XVEA 1F3PA 2BC1A 1PBFA 2BXRA 3UOYA 3RP6A 3JSKA 4C77A 2YVJA 2R4EA 5C2TA 5M0ZA 3M13A 2FJBA 4X9NA 3NK1X 4YSZA 1PJ5A 3NRNA 3UTHA 1O5WA 4O5QA 3SZCA 1GERA 3K7MX 2X8CA 1CJ4A 3E1TA 3NLCA 4EM3A 2OAMA 4U2TA 4K5RA 1NEKA 2YM1A 1H7XA 1E7PA 1L9EA 4U2SA 3EANA 2V6OA 2XLPA 3PS9A 3GRSA 3AEDA 3DJJA 4TLXA 2IVEA 3L5OA 1LJ1A 4U8PA 1CBOA 1L9DA 1ZP0A 4NTDA 2BS4A 3VRBA 4H4TA 2JKCA 4H2PA 4EQWA 3UTFA 4J34A 3AEGA 3B6DA 2B7SA 4OPGA 2WU5A 3T2ZA 5C3JA 4FK1A 3RP8A 2C70A 5KOXA 2B7RA 2XLSA 4BJZA 2BC0A 2AQJA 3UKQA 4K8DA 1Q1WA 5FS7A 1ZOVA 1KNPA 2O9ZA 3DMEA 2C67A 3FPZA 4TM3A 1LQUA 1KSSA 3CGCA 3S61A 4YKGA 3P4RA 3LZWA 4U8KA 1LQTA 3UKHA 2GRTA 1F8SA 1MXTA 2CVJA 1ZOYA 4J33A 5U63A 2F5ZA 1QO8A 3GDPA 4HA6A 3SZ0A 2V3BA 4EMJA 1IUSA 4XXGA 3BI5A 2J3NA 1N1PA 3AD8B 3AE1A 3UOXA 3Q9TA 2GMJA 3KU9A 2Z5XA 5HXIA 5JRBA 2WU2A 1BKWA 3GD4A 5BULA 4J57A 3ADAB 1BZLA 3RHAA 1JEHA 3G5QA 1H82A 1NG4A 2YWLA 2GR0A 1OJAA 1F6MA 3T2KA 3ISHA 3CGEA 1IUVA 2VQ7A 4JY3A 1GESA 2V61A 2YR6A 3CPHG 4LIIA 2QA1A 1ELIA 1NHRA 1Q1RA 3CMMA 4HB9A 4Y4MA 4YTMA 4J56A 4G73A 2JK6A 1B37A 2WETA 3DJGX 1VRQB 2XVFA 2GB0A 1DOEA 3ICSA 4C3YA 2XLTA 4KPRA 1XANA 4EQXA 3AEEA 4LA1A 1Q9IA 1GRFA 2XFPA 4J2WA 4USRA 4UDQA 3UKFA 1FEAA 2A87A 5EOWA 1XHCA 2BACA 2WS3A 2GR2A 3CNJA 5LV9A 1ZDLA 2ZBWA 1PBDA 5GRTA 3SM8A 2I0ZA 2YLXA 2GR1A 2R9ZA 2BCPA 2C65A 2VOUA 3DJDA 4OVIA 4D03A 4EIPA 3HYVA 4H4VA 1O94A 3ZDNA 4H7UA 4OPCA 3VRDB 2JB3A 1P2HA 1EL7A 1DOBA 4XWRA 4J31A 3PO7A 4NTEA 1KF6A 2X8GA 2IIDA 1RSGA 4YXDA 5J7XA 1DXLA 3G5RA 4N9XA 5KRQA 3C4AA 1L9CA 2XLUA 3C96A 4NWZA 2R0CA 5ER0A 3P4SA 4B63A 4Z2TA 2UZZA 4BK3A 3FBSA 2EQ6A 2ACZA 2Q6UA 3BI2A 1E6EA 2EQ7A 1D4DA 3P4QA 2WP9A 1TDFA 4C74A 2WPEA 3NNEA 3DGZA 3IWAA 3DK9A 3T37A 2YQUA 2QAEA 1YQZA 4H4ZA 5U25A 4G74A 2YLZA 3SZWA 4UP3A 5KXJA 3DK4A 4RG3A 1NPXA 4CRTA 3RNMA 5KNLA 1GV4A 4FK1C 2BK3A 1NG3A 2YLWA 3CNDA 2QCUA 4CNJA 4CNKA 5HYMA 4NEVA 4FX9A 2YAUA 1NAAA 3B3RA 3H8LA 5IQ4A 3UTGA 1CJCA 1NHQA 1D4EA 1Y56A 3ALMA 4K22A 3UKLA 3LJPA 4U8NA 3REDA 2WPFA 4A7AA 3BHFA 3F8PA 1GALA 1FECA 2BRAA 1H6VA 1CHUA 1SEZA 4GAVA 1X31B 4I58A 2YG5A 4Z43A 3AE4A 1JNZA 5JCKA 2X50A 1JRYA 3HZLA 3I6DA 1GETA 2XYOA 1KFYA 4Y4NA 4FDCB 4APNA 3UOZA 5BUKA 2JB2A 1H84A 4K5SA 1IUUA 2GR3A 4NEWA 2B76A 4PAAA 3HYXA 4BJYA 3CTYA 2OLNA 1IUWA 1VG0A 1QLBA 2ZZ0A 1D7YA 2C64A 2OLOA 3COXA 3P1WA 1IUXA 1GT8A 3VRAA 2VRLA 4CBQA 4CY6A 3II4A 3UP4A 3UKPA 1CL0A 4ADWA 3P9UA 2X3NA 1GRTA 3EAOA 3ATQA 4YSXA 1BGNA 5KMPA 3CGBA 3NTAA 4H4SA 1IJHA 2Y6QA 2TMDA 2XCGA 2GAHB 3UOVA 4DSGA 1PS9A 2B9WA 1UKVG 3AE9A 1DJNA 3O0HA 1JNRA 3AYIA 1N4UA 3I3LA 1NHSA 1JU2A 3EF6A 4H50A 3GYXA 2TPRA 2ARDA 2GQWA 4K7ZA 2V5ZA 3NYEA 3SZFA 2R0PA 3NYFA 5EB4A 2GV8A 3NN0X 3NTDA 4BURA 3QFAA 5EB5A 2C7GA 2OALA 2C73A 4JNAA 4AP1A 2H89A 2R45A 2WDRA 3IHGA 4U8LA 3QFBA 3URHA 3GSIA 3GD3A 3SX6A 3NHOX 1XDIA 4AOSA 3ABVA 1W4XA 5IQ1A 2V3AA 2WOIA 2BS3A 4U8MA 4X9MA 1CJ2A 1O95A 4JN9A 2B9XA 5CQFA 3QVRA 3GWFA 3OZ2A 4A6NA 5J60A 3AE5A 3CNSA 3KD9A 5JCIA 2YG4A 4OPTA 1NDAA 4WX1A 5KVIA 1LTXR 4P9SA 4RSLA 2CDUA 3CPJG 4H4UA 4WCTA 3L8KA 2Q0KA 1GRHA 3GWDA 1COYA 3AYLA 4KX6A 4B64A 1D5TA 1S3EA 3QSSA 4YTNA 3NH3X 4IV9A 3ITJA 2A89A 4TLZA 1NENA 5KMRA 5FS8A 4YSHA 4H2RA 1ONFA 2VVLA 4E0VA 5BRTA 4Z2UA 5JCLA 2CFYA 3T14A 5FS6A 1PBCA 2EQ9A 4A9WA 2VRMA 4NZHA 4MJWA 1ZK7A 5L46A 1PJ7A 4BV6A 3IC9A 3NG7X 1TRBA 2XVJA 2V60A 5HHFA 2WOWA 2WDQA 3V76A 4YT0A 3D9XA 2Z5YA 5FS9A 1VG9A 1M6IA 3CN8A 4AOXA 1ZY8A 3UKKA 3QSEA 2ZZBA 4B69A 1IUTA 2FJEA 1PBEA 3UCLA 4D04A 4GAPA 2HQMA 1S7MA 1D4CA 1H7WA 2C66A 4I59A 4IVMB 4OPUA 1EBDA 3BNMA 1E39A 4H4PA 3AWIA 1DODA 3AEBA 3SY4A 2BK4A 2QA2A 2YVGA 3P4PA 3GDNA 1BGJA 5BVAA 1TYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5V A;  1ZMD A;  3DGH A;  1GXF A;  4C5O A;  1K0L A;  2GF3 A;  3AE6 A;  1CC2 A;  3GYI A;  4ZCD A;  2GQF A;  4U8I A;  1GPE A;  1E1N A;  4JDR A;  4Z44 A;  3VR9 A;  5IPY A;  1CC6 A;  2ZZC A;  3AEA A;  1PHH A;  3EPT A;  1CF3 A;  4NTC A;  4A99 A;  3KA7 A;  2C3D A;  4BK1 A;  4AT0 A;  5CKU A;  3KVE A;  3V3N A;  4UDP A;  4Y4L A;  2VZ2 A;  4EMI A;  4TM4 A;  1LVL A;  3K7Q X;  3AYJ A;  1K4Q A;  1KNR A;  1QJD A;  3G5S A;  4IVO B;  1OJT A;  2XFN A;  4TM1 A;  4YSY A;  2BK5 A;  2B9Y A;  4H4X A;  4EQS A;  4U8J A;  2WHD A;  3SFE A;  5HY5 A;  4B68 A;  4A65 A;  2C72 A;  2EQ8 A;  1JOA A;  1MOK A;  3FG2 P;  1FL2 A;  4ZN0 A;  4JY2 A;  3SFD A;  4CY8 A;  5EBK A;  1KDG A;  3V3O A;  2YR5 A;  2C75 A;  1LV0 A;  2GVC A;  3AE7 A;  1FEB A;  4TM0 A;  4CCR A;  1DOC A;  4U8O A;  3GYJ A;  5KVH A;  3LXD A;  1MO9 A;  2XLR A;  2YG3 A;  4Z26 A;  1ZMC A;  3K7T A;  3NK2 X;  1DNC A;  1GRE A;  3GRT A;  3LAD A;  3Q6J A;  2BYB A;  2E1M A;  3QJ4 A;  1TDE A;  1N4V A;  4YTP A;  2FBW A;  2YLS A;  4GRT A;  1E1M A;  4M52 A;  2Y6R A;  3BNU A;  2JAE A;  1TDN A;  3AEC A;  1GRB A;  1AOG A;  1H81 A;  4JNQ A;  1PN0 A;  2YM2 A;  4ICY A;  1JRZ A;  1PJ6 A;  1HYU A;  2A8X A;  1Y56 B;  3ICR A;  2BA9 A;  1PXA A;  5TR3 A;  3R9U A;  1F8R A;  1S2Q A;  4ECH A;  1Y0P A;  3GMC A;  2DKI A;  3OC4 A;  1M64 A;  1VDC A;  3DA1 A;  4Z2R A;  2X99 A;  3DJE A;  1S3B A;  3AB1 A;  4GF7 A;  4CCQ A;  4EIQ A;  2AAQ A;  1GEU A;  3K30 A;  3ALL A;  1V59 A;  1RYI A;  3ICT A;  3DH9 A;  2JBV A;  2Q0L A;  2R4J A;  1NHP A;  1GTH A;  4GDE A;  4H4Y A;  3NIX A;  1YKJ A;  3QVP A;  1EL9 A;  1ZKQ A;  3M12 A;  2VQB A;  1CC4 A;  3ATR A;  3CIR A;  4C3X A;  2YLR A;  3L1R A;  4AP3 A;  1F8W A;  3F8D A;  1FCD A;  2H88 A;  1VQW A;  3ALJ A;  4B1B A;  4EM4 A;  1GSN A;  3CNT A;  3CPI G;  4OPD A;  5GSN A;  3D1C A;  1YY5 A;  2X8H A;  4A79 A;  2YR4 A;  3IF9 A;  2JB1 A;  1XPQ A;  4OPL A;  4OPI A;  1N4W A;  2XVH A;  1E1L A;  2WBA A;  2C76 A;  1B8S A;  1TDK A;  5JCM A;  2WDV A;  1YQ4 A;  3LB8 A;  3KLJ A;  5FMH A;  3BHK A;  2RGH A;  2PHH A;  1OJC A;  3CNP A;  3NK0 X;  4H4R A;  2WQY A;  4REK A;  4DGK A;  4BK2 A;  1GRA A;  3ZYX A;  1B5Q A;  2WES A;  1ZX9 A;  1TYT A;  3NYC A;  1S2Y A;  3RP7 A;  2XVI A;  2CUL A;  4H4W A;  3VR8 A;  3AEF A;  4H2Q A;  4GUV A;  1PXC A;  4OCG A;  4GCM A;  1DJQ A;  5DBJ A;  4B65 A;  3UTE A;  1GTE A;  2WPC A;  3GMB A;  3AD7 B;  3PVC A;  4EMW A;  1EL5 A;  1FOH A;  4H2N A;  1RP0 A;  4RG4 A;  2YLT A;  4XWZ A;  3WE0 A;  4A6N B;  3FIM B;  3NT6 A;  2Q7V A;  2WEU A;  4GR1 A;  2BS2 A;  4YKF A;  2R46 A;  3LZX A;  4DSH A;  4EQR A;  2R0G A;  2GAG B;  2WOV A;  3QSM A;  4B66 A;  1BF3 A;  2RAB A;  5KOW A;  2E4G A;  1CJ3 A;  2YVF A;  5M10 A;  2AR8 A;  4ZCC A;  2VVM A;  4PAB A;  1L0V A;  4X4J A;  5JCN A;  3M0O A;  2YG6 A;  4Z24 A;  2XFO A;  4YWO A;  1KSU A;  2BXS A;  2XFQ A;  3S5W A;  4B67 A;  1BWC A;  3AXB A;  3KKJ A;  1TDO A;  5U1O A;  3CGD A;  2FJD A;  2C3C A;  4USQ A;  2IVD A;  2NPX A;  1PBB A;  1D7L A;  2RGO A;  3AE8 A;  1Z6L A;  1JRX A;  1OJD A;  1E1K A;  2OA1 A;  4IA5 A;  1PXB A;  4U2L A;  2RGJ A;  3H4K A;  2WP6 A;  2GH5 A;  3UKA A;  1EL8 A;  3BI4 A;  4DNA A;  4H4Q A;  3SGL A;  3UP5 A;  3SQP A;  2XDO A;  2APG A;  2BCG G;  2XFU A;  3KPF A;  2W0H A;  3DK8 A;  2FJA A;  3AE2 A;  1GRG A;  4AT2 A;  2YG7 A;  1YQ3 A;  5KWF A;  1H83 A;  3F8R A;  4UDR A;  4LU6 A;  3IHM A;  2BAB A;  4IA6 A;  3NKS A;  2WP5 A;  4O5U A;  1GND A;  4Z25 A;  3C4N A;  1GOS A;  3AD9 B;  2DKH A;  3FMW A;  1P2E A;  4K2X A;  2GMH A;  2GEW A;  2VVL G;  3NGC X;  3D8X A;  3VQR A;  3NN6 X;  1H86 A;  2PYX A;  1K0J A;  4JQ9 A;  1OJ9 A;  1K0I A;  1REO A;  4A5L A;  1PDH A;  1LPF A;  4GDP A;  4J36 A;  2NVK X;  3AE3 A;  3H8I A;  1B4V A;  3LOV A;  2XVE A;  1F3P A;  2BC1 A;  1PBF A;  2BXR A;  3UOY A;  3RP6 A;  3JSK A;  4C77 A;  2YVJ A;  2R4E A;  5C2T A;  5M0Z A;  3M13 A;  2FJB A;  4X9N A;  3NK1 X;  4YSZ A;  1PJ5 A;  3NRN A;  3UTH A;  1O5W A;  4O5Q A;  1GER A;  3K7M X;  2X8C A;  1CJ4 A;  3E1T A;  3NLC A;  4EM3 A;  2OAM A;  4U2T A;  4K5R A;  1NEK A;  2YM1 A;  1H7X A;  1E7P A;  1L9E A;  4U2S A;  3EAN A;  2V6O A;  2XLP A;  3PS9 A;  3GRS A;  3AED A;  3DJJ A;  4TLX A;  2IVE A;  1LJ1 A;  4U8P A;  1CBO A;  1L9D A;  1ZP0 A;  4NTD A;  2BS4 A;  3VRB A;  4H4T A;  2JKC A;  4H2P A;  4EQW A;  3UTF A;  4J34 A;  3AEG A;  3B6D A;  2B7S A;  4OPG A;  2WU5 A;  5C3J A;  4FK1 A;  3RP8 A;  2C70 A;  5KOX A;  2B7R A;  2XLS A;  4BJZ A;  2BC0 A;  2AQJ A;  3UKQ A;  4K8D A;  1Q1W A;  5FS7 A;  1ZOV A;  1KNP A;  2O9Z A;  3DME A;  2C67 A;  3FPZ A;  4TM3 A;  1LQU A;  1KSS A;  3CGC A;  3S61 A;  4YKG A;  3P4R A;  3LZW A;  4U8K A;  1LQT A;  3UKH A;  2GRT A;  1F8S A;  1MXT A;  2CVJ A;  1ZOY A;  4J33 A;  5U63 A;  2F5Z A;  1QO8 A;  3GDP A;  4HA6 A;  4EMJ A;  2V3B A;  1IUS A;  4XXG A;  3BI5 A;  2J3N A;  1N1P A;  3AD8 B;  3AE1 A;  3UOX A;  3Q9T A;  2GMJ A;  3KU9 A;  2Z5X A;  5HXI A;  2WU2 A;  1BKW A;  3GD4 A;  5BUL A;  4J57 A;  3ADA B;  1BZL A;  3RHA A;  1JEH A;  3G5Q A;  1H82 A;  1NG4 A;  2YWL A;  2GR0 A;  1OJA A;  1F6M A;  3ISH A;  3CGE A;  1IUV A;  2VQ7 A;  4JY3 A;  1GES A;  2V61 A;  2YR6 A;  3CPH G;  4LII A;  2QA1 A;  1ELI A;  1NHR A;  1Q1R A;  4HB9 A;  4Y4M A;  4YTM A;  4J56 A;  2JK6 A;  1B37 A;  2WET A;  3DJG X;  1VRQ B;  2XVF A;  2GB0 A;  1DOE A;  3ICS A;  4C3Y A;  2XLT A;  4KPR A;  1XAN A;  4EQX A;  3AEE A;  4LA1 A;  1Q9I A;  1GRF A;  2XFP A;  4J2W A;  4USR A;  4UDQ A;  3UKF A;  1FEA A;  2A87 A;  5EOW A;  1XHC A;  2BAC A;  2WS3 A;  2GR2 A;  3CNJ A;  5LV9 A;  1ZDL A;  2ZBW A;  1PBD A;  5GRT A;  3SM8 A;  2I0Z A;  2YLX A;  2GR1 A;  2R9Z A;  2BCP A;  2C65 A;  2VOU A;  3DJD A;  4OVI A;  4D03 A;  4EIP A;  4H4V A;  1O94 A;  3ZDN A;  4H7U A;  4OPC A;  3VRD B;  2JB3 A;  1P2H A;  1EL7 A;  1DOB A;  4XWR A;  4J31 A;  3PO7 A;  4NTE A;  1KF6 A;  2X8G A;  2IID A;  1RSG A;  4YXD A;  5J7X A;  1DXL A;  3G5R A;  4N9X A;  5KRQ A;  3C4A A;  1L9C A;  2XLU A;  3C96 A;  2R0C A;  5ER0 A;  3P4S A;  4B63 A;  4Z2T A;  2UZZ A;  4BK3 A;  3FBS A;  2EQ6 A;  2ACZ A;  2Q6U A;  3BI2 A;  1E6E A;  2EQ7 A;  1D4D A;  3P4Q A;  2WP9 A;  1TDF A;  4C74 A;  2WPE A;  3NNE A;  3DGZ A;  3IWA A;  3DK9 A;  3T37 A;  2YQU A;  2QAE A;  1YQZ A;  4H4Z A;  5U25 A;  2YLZ A;  4UP3 A;  5KXJ A;  3DK4 A;  4RG3 A;  1NPX A;  4CRT A;  3RNM A;  1GV4 A;  4FK1 C;  2BK3 A;  1NG3 A;  2YLW A;  3CND A;  2QCU A;  4CNJ A;  4CNK A;  5HYM A;  4NEV A;  4FX9 A;  2YAU A;  1NAA A;  3B3R A;  3H8L A;  5IQ4 A;  3UTG A;  1CJC A;  1NHQ A;  1D4E A;  1Y56 A;  3ALM A;  4K22 A;  3UKL A;  3LJP A;  4U8N A;  3RED A;  2WPF A;  4A7A A;  3BHF A;  3F8P A;  1GAL A;  1FEC A;  1H6V A;  1CHU A;  1SEZ A;  1X31 B;  4I58 A;  2YG5 A;  4Z43 A;  3AE4 A;  1JNZ A;  5JCK A;  2X50 A;  1JRY A;  3HZL A;  3I6D A;  1GET A;  2XYO A;  1KFY A;  4Y4N A;  4FDC B;  4APN A;  3UOZ A;  5BUK A;  2JB2 A;  1H84 A;  4K5S A;  1IUU A;  2GR3 A;  4NEW A;  2B76 A;  4PAA A;  4BJY A;  3CTY A;  2OLN A;  1IUW A;  1VG0 A;  1QLB A;  2ZZ0 A;  1D7Y A;  2C64 A;  2OLO A;  3COX A;  3P1W A;  1IUX A;  1GT8 A;  3VRA A;  2VRL A;  4CBQ A;  4CY6 A;  3II4 A;  3UP4 A;  3UKP A;  1CL0 A;  4ADW A;  3P9U A;  2X3N A;  1GRT A;  3EAO A;  3ATQ A;  4YSX A;  1BGN A;  3CGB A;  3NTA A;  4H4S A;  1IJH A;  2Y6Q A;  2TMD A;  2XCG A;  2GAH B;  3UOV A;  4DSG A;  1PS9 A;  2B9W A;  1UKV G;  3AE9 A;  1DJN A;  3O0H A;  1JNR A;  3AYI A;  1N4U A;  3I3L A;  1NHS A;  1JU2 A;  3EF6 A;  4H50 A;  2TPR A;  2ARD A;  2GQW A;  4K7Z A;  2V5Z A;  3NYE A;  2R0P A;  3NYF A;  5EB4 A;  2GV8 A;  3NN0 X;  3NTD A;  4BUR A;  3QFA A;  5EB5 A;  2C7G A;  2OAL A;  2C73 A;  4JNA A;  4AP1 A;  2H89 A;  2R45 A;  2WDR A;  3IHG A;  4U8L A;  3QFB A;  3URH A;  3GSI A;  3GD3 A;  3NHO X;  1XDI A;  4AOS A;  3ABV A;  1W4X A;  5IQ1 A;  2V3A A;  2WOI A;  2BS3 A;  4U8M A;  4X9M A;  1CJ2 A;  1O95 A;  4JN9 A;  2B9X A;  5CQF A;  3QVR A;  3GWF A;  3OZ2 A;  4A6N A;  5J60 A;  3AE5 A;  3CNS A;  3KD9 A;  5JCI A;  2YG4 A;  4OPT A;  1NDA A;  4WX1 A;  5KVI A;  1LTX R;  4P9S A;  4RSL A;  2CDU A;  3CPJ G;  4H4U A;  4WCT A;  3L8K A;  2Q0K A;  1GRH A;  3GWD A;  1COY A;  3AYL A;  4KX6 A;  4B64 A;  1D5T A;  1S3E A;  3QSS A;  4YTN A;  3NH3 X;  4IV9 A;  3ITJ A;  2A89 A;  4TLZ A;  1NEN A;  5FS8 A;  4YSH A;  4H2R A;  1ONF A;  2VVL A;  4E0V A;  5BRT A;  4Z2U A;  5JCL A;  2CFY A;  5FS6 A;  1PBC A;  2EQ9 A;  4A9W A;  2VRM A;  4NZH A;  4MJW A;  1ZK7 A;  5L46 A;  1PJ7 A;  4BV6 A;  3IC9 A;  3NG7 X;  1TRB A;  2XVJ A;  2V60 A;  5HHF A;  2WOW A;  2WDQ A;  3V76 A;  4YT0 A;  2Z5Y A;  5FS9 A;  1VG9 A;  1M6I A;  3CN8 A;  4AOX A;  1ZY8 A;  3UKK A;  3QSE A;  2ZZB A;  4B69 A;  1IUT A;  2FJE A;  1PBE A;  3UCL A;  4D04 A;  2HQM A;  4IVM B;  1D4C A;  1H7W A;  2C66 A;  4I59 A;  4OPU A;  1EBD A;  3BNM A;  1E39 A;  4H4P A;  3AWI A;  1DOD A;  3AEB A;  2BK4 A;  2QA2 A;  2YVG A;  3P4P A;  3GDN A;  1BGJ A;  5BVA A;  1TYP A; 
#chains in the Genus database with same CATH topology
 3DGH A;  1GXF A;  1FIQ B;  4C5O A;  3GYI A;  3A7U A;  1E1N A;  1CC6 A;  5CKU A;  3RRA A;  3UXL A;  4NNJ A;  4Y4L A;  3QTP A;  4E4F A;  1K4Q A;  1KNR A;  3AYJ A;  4YSY A;  2XFN A;  5HY5 A;  4JN7 A;  4A65 A;  2EQ8 A;  4JY2 A;  3SFD A;  1T3Q C;  5EBK A;  1KDG A;  3V3O A;  2GVC A;  1LV0 A;  2E3T A;  4TM0 A;  2ZC8 A;  4HYR A;  1DOC A;  5KVH A;  3LXD A;  1MO9 A;  2YG3 A;  3Q6J A;  3LAD A;  4YTP A;  4GRT A;  1EC8 A;  4II3 A;  2W55 A;  2Y6R A;  2OO6 A;  2JAE A;  3AEC A;  1AOG A;  3S47 A;  1PN0 A;  1JRZ A;  1HYU A;  2BA9 A;  4ECH A;  3GMC A;  1JCT A;  4GF7 A;  4CCQ A;  3QLD A;  3ALL A;  3QN3 A;  2Q0L A;  2VQB A;  1CC4 A;  3CIR A;  2PGW A;  3L1R A;  1FCD A;  3PG6 A;  1GSN A;  2QDD A;  3D1C A;  2X8H A;  4A79 A;  5ENL A;  1N4W A;  2XVH A;  3KLJ A;  3BHK A;  1OJC A;  3CNP A;  3ZYX A;  2WES A;  1ZX9 A;  1TYT A;  3VR8 A;  4GUV A;  1PXC A;  3DFH A;  4GGB A;  1DJQ A;  1W6T A;  2P0I A;  1VQZ A;  4H2H A;  4EQR A;  2R0G A;  4X2P A;  2GAG B;  1P43 A;  1TZZ A;  2YVF A;  5FJP A;  5M10 A;  2VVM A;  1FHV A;  2QJM A;  3UJR A;  4PAB A;  4Z24 A;  4IHC A;  4YWO A;  1KSU A;  1BWC A;  3B97 A;  3AXB A;  5U1O A;  1PBB A;  2AL1 A;  1EC9 A;  1E1K A;  1PXB A;  2WP6 A;  3VCN A;  2PTZ A;  3UKA A;  2BCG G;  3DK8 A;  3U9I A;  1H2I A;  2ONE A;  2PTY A;  3NVZ B;  1YQ3 A;  1H83 A;  4UDR A;  4LU6 A;  2HXT A;  2O56 A;  2WP5 A;  4Z25 A;  1R6W A;  3VC6 A;  2DKH A;  2GMH A;  2VVL G;  1SB3 B;  1H86 A;  3NN6 X;  2PYX A;  2POZ A;  1K0I A;  1PDH A;  4J36 A;  4IL2 A;  3M13 A;  3TQP A;  4YSZ A;  3NRN A;  4O5Q A;  3SZC A;  4EM3 A;  2P3Z A;  3UJF A;  1H7X A;  2XLP A;  4GME A;  4DWD A;  2GSH A;  4ZCW A;  1LJ1 A;  1CBO A;  2GGE A;  1L9D A;  1ZP0 A;  3VRB A;  4H4T A;  4J34 A;  3JVA A;  3AEG A;  2WU5 A;  3RP8 A;  5KOX A;  3UJE A;  2BC0 A;  1Q1W A;  3Q45 A;  4TM3 A;  3CGC A;  3MSY A;  3P4R A;  3LZW A;  3P3B A;  1MXT A;  2OZ8 A;  3D46 A;  2CVJ A;  2F5Z A;  4HA6 A;  4DXK A;  1FO4 A;  3Q9T A;  5JRB A;  4IP4 A;  4J57 A;  1BZL A;  2YWL A;  3CXO A;  1OJA A;  3CGE A;  1GES A;  2V61 A;  1ZXI C;  4G73 A;  3D47 A;  3ZLF A;  1DOE A;  4C3Y A;  4MGG A;  2XLT A;  1XAN A;  2W3R A;  4J2W A;  1XHC A;  2WS3 A;  2GR2 A;  4DYE A;  2C65 A;  4EIP A;  3HYV A;  1P2H A;  4NTE A;  3HW2 A;  2XLU A;  4NWZ A;  1SJA A;  2ACZ A;  2Q6U A;  3K1G A;  1E6E A;  3T8Q A;  3DEQ A;  4H4Z A;  4HPN A;  3NZG A;  4RG3 A;  4FK1 C;  3JZU A;  3CND A;  3DIP A;  5HYM A;  4NEV A;  3ALM A;  4U8N A;  3UCD A;  3H70 A;  3UGV A;  3ZVI A;  3P0W A;  3I6D A;  4FDC B;  2B76 A;  3DDM A;  4EWJ A;  4GYP C;  3COX A;  1R0M A;  2ZZ0 A;  3P1W A;  1D7Y A;  1IUX A;  4CBQ A;  3UP4 A;  3EAO A;  3ATQ A;  3OTR A;  2PP3 A;  2Y6Q A;  2TMD A;  2GAH B;  4DSG A;  1PS9 A;  2B9W A;  3AE9 A;  4M6U A;  3AYI A;  1N4U A;  3H8A A;  3EF6 A;  1KKR A;  2TPR A;  2V5Z A;  2GQW A;  4K7Z A;  3R0U A;  2R0P A;  3NVY B;  2GV8 A;  5EB5 A;  2C73 A;  4DN1 A;  3GSI A;  3GD3 A;  3ABV A;  3CT2 A;  3IJI A;  1O95 A;  5CQF A;  3AE5 A;  3Q4D A;  2OQY A;  3L8K A;  1COY A;  1P48 A;  1S3E A;  3ITJ A;  4H2R A;  5BRT A;  2OG9 A;  5JCL A;  2P8B A;  4NZH A;  4IP5 A;  1ZK7 A;  4BV6 A;  5HHF A;  4YT0 A;  3SQS A;  2V60 A;  3MZN A;  3D9X A;  1VG9 A;  3CN8 A;  3NVW B;  4B69 A;  4I59 A;  3R25 A;  1E39 A;  2XH2 A;  2BK4 A;  2QA2 A;  4H83 A;  1BGJ A;  2E5V A;  1WUF A;  2GF3 A;  3AE6 A;  5IPY A;  1GPE A;  4JDR A;  1JPD X;  3AEA A;  4NTC A;  3CB3 A;  2C3D A;  4BK1 A;  3KVE A;  3V3N A;  1V97 A;  2VZ2 A;  1LVL A;  2DW6 A;  3K7Q X;  1QJD A;  1ECQ A;  2B9Y A;  2QGY A;  3SFE A;  4E4U A;  4B68 A;  4GGH A;  2C72 A;  3SN0 A;  4II2 A;  3AE7 A;  4U8O A;  4Z26 A;  3NK2 X;  3QJ4 A;  3ZVH A;  1TDE A;  2FBW A;  3R11 A;  3SYI A;  3SR6 B;  1DTN A;  1BKH A;  1H81 A;  4JNQ A;  3UJ2 A;  3T2Y A;  3HRD C;  2XH4 A;  1S2Q A;  1Y0P A;  2PA6 A;  3OC4 A;  1M64 A;  1VDC A;  3AB1 A;  1RYI A;  2R4J A;  1NHP A;  1YKJ A;  3M12 A;  2OX4 A;  4C3X A;  3ES8 A;  4AP3 A;  1KN0 A;  2H88 A;  3ALJ A;  4B1B A;  3CNT A;  4OPD A;  2YR4 A;  1E1L A;  1B8S A;  4K2S A;  1TDK A;  3V3W A;  5FMH A;  2QJJ A;  2RGH A;  2PHH A;  3NK0 X;  5BOF A;  1GRA A;  1S2Y A;  2XVI A;  4GCM A;  4B65 A;  3VA8 A;  2YLT A;  2WEU A;  2BS2 A;  2R46 A;  3LZX A;  3FVD A;  2FYM A;  3OW1 A;  1BF3 A;  3SJN A;  1N5W C;  2RAB A;  1MRA A;  2AR8 A;  4ZCC A;  5JCN A;  3M0O A;  3AM9 A;  1D7L A;  2RGO A;  1Z6L A;  1JRX A;  4IA5 A;  2RGJ A;  3H4K A;  3SN1 A;  1EL8 A;  4DNA A;  4H4Q A;  2XDO A;  3DFY A;  1N62 C;  4AT2 A;  3GC2 A;  5KWF A;  2BAB A;  1PDZ A;  3NKS A;  4O5U A;  1P2E A;  2GEW A;  3MUC A;  4JQ9 A;  1OJ9 A;  4A5L A;  4GDP A;  1LPF A;  4K8G A;  2NVK X;  4KPL A;  1B4V A;  2BC1 A;  2R4E A;  2FJB A;  3ZVH B;  1PJ5 A;  1MNS A;  1NEK A;  2YM1 A;  1L9E A;  1PDY A;  3DJJ A;  4TLX A;  2W3S A;  3L5O A;  2IVE A;  3ENL A;  4HCH A;  4H2P A;  4EQW A;  4OPG A;  1KCZ A;  2B7R A;  2XLS A;  4BJZ A;  2AQJ A;  1ZOV A;  4K8D A;  5FS7 A;  3CYJ A;  3UCC A;  3SXI A;  2C67 A;  4YKG A;  1LQU A;  4U8K A;  4ZOH B;  3UKH A;  2GRT A;  1MDL A;  4J33 A;  1QO8 A;  4HNL A;  2V3B A;  4EMJ A;  2J3N A;  3UOX A;  3AE1 A;  3FCP A;  2Z5X A;  5HXI A;  1KKO A;  3S5S A;  3ADA B;  3G5Q A;  1NG4 A;  3IJL A;  1F6M A;  3T2K A;  3ISH A;  3FJ4 A;  4JY3 A;  4IT1 A;  3CPH G;  4HB9 A;  4YTM A;  1NHR A;  1ELI A;  3BSM A;  4J56 A;  1B37 A;  3DJG X;  3CXB A;  2XVF A;  1TE6 A;  4ZA0 A;  1N60 C;  4G7F A;  4LA1 A;  3H12 A;  4USR A;  4UDQ A;  2A87 A;  3R0K A;  2PU1 A;  1ZDL A;  2ZBW A;  3SM8 A;  2I0Z A;  2YLX A;  2VOU A;  3DJD A;  4OVI A;  4D03 A;  3AMZ A;  1O94 A;  3ZDN A;  4OPC A;  3VRD B;  4XWR A;  4J31 A;  4J3Z A;  1KF6 A;  2X8G A;  2IID A;  1RSG A;  5J7X A;  1DXL A;  3DER A;  3C96 A;  5ER0 A;  3P4S A;  2OKT A;  2UZZ A;  4BK3 A;  3BI2 A;  1D4D A;  1TDF A;  4C74 A;  1EBH A;  3IWA A;  2YQU A;  2QAE A;  3SZW A;  1JDF A;  5KXJ A;  1NPX A;  4CRT A;  3RIT A;  3RNM A;  4KT2 A;  1NG3 A;  2QCU A;  4CNJ A;  4A35 A;  1NAA A;  1CJC A;  1NHQ A;  1D4E A;  3UKL A;  2WPF A;  3VC5 A;  4A7A A;  3BHF A;  1EBG A;  4MKS A;  1EC7 A;  3MY9 A;  1H6V A;  1SEZ A;  1X31 B;  4I58 A;  3RGT A;  5JCK A;  4NEW A;  4PAA A;  4A6G A;  1QLB A;  3RCY A;  3UKP A;  3P9U A;  4A3R A;  4YSX A;  1IYX A;  4H4S A;  1IJH A;  1DJN A;  3O0H A;  2HNE A;  2XSX A;  3I3L A;  1NHS A;  4FP1 A;  2ARD A;  3T4W A;  3NYE A;  2I5Q A;  3NYF A;  5EB4 A;  3NTD A;  4JNA A;  2H89 A;  3SX6 A;  3NHO X;  1XDI A;  4AOS A;  1W4X A;  5IQ1 A;  2V3A A;  2BS3 A;  4U8M A;  4X9M A;  3QVR A;  3GWF A;  2AKZ A;  3CNS A;  4OPT A;  1NDA A;  2CDU A;  3CPJ G;  4H4U A;  3GWD A;  4B64 A;  4IV9 A;  2A89 A;  4TLZ A;  5FS8 A;  4H19 A;  3TW9 A;  4DX3 A;  5FS6 A;  2EQ9 A;  2QVH A;  2P88 A;  5L46 A;  1PJ7 A;  3NG7 X;  2XVJ A;  4AOX A;  1ZY8 A;  1IUT A;  2FJE A;  3UCL A;  4D04 A;  2HQM A;  3DGB A;  5FJT A;  1H7W A;  3FXG A;  1DOD A;  3AEB A;  3SY4 A;  3MKC A;  3I6E A;  3GDN A;  3U4F A;  1ZMD A;  1K0L A;  4MMW A;  4ZCD A;  2GQF A;  2ZZC A;  3EPT A;  1CF3 A;  5KMS A;  2PMQ A;  4UDP A;  1NEL A;  4IVO B;  4TM1 A;  4H4X A;  4EQS A;  4U8J A;  3BOX A;  3HPF A;  1MOK A;  4ZN0 A;  1FEB A;  1ZMC A;  2E1M A;  2YLS A;  1E1M A;  3BNU A;  1TDN A;  3N4F A;  3SBF A;  1GRB A;  2FKP A;  3TJI A;  2YM2 A;  1PJ6 A;  3ICR A;  1PXA A;  5TR3 A;  3SN4 A;  2C4C A;  2DKI A;  3DA1 A;  2X99 A;  1S3B A;  4Z17 A;  3K30 A;  1V59 A;  2GGJ A;  4GDE A;  4H4Y A;  3NIX A;  3QVP A;  1EL9 A;  5FJU A;  2YLR A;  1VQW A;  4EM4 A;  3P93 A;  1YY5 A;  3A7A A;  3IF9 A;  2JB1 A;  1XPQ A;  4OPI A;  2C76 A;  5JCM A;  2OLA A;  4Z1Y A;  2WDV A;  3LB8 A;  6ENL A;  2GL5 A;  4H4R A;  2WQY A;  2OZ3 A;  4REK A;  3NYC A;  3RP7 A;  1STZ A;  2CHR A;  2CUL A;  4H4W A;  4H2Q A;  2E5A A;  4OCG A;  2BRY A;  3V4B A;  3TWB A;  2WPC A;  3B9J B;  3PVC A;  1FOH A;  4XWZ A;  3WE0 A;  1RP0 A;  3FIM B;  3NT6 A;  3BJS A;  4GR1 A;  4E6M A;  1X2H A;  4YKF A;  4DSH A;  3QSM A;  4B66 A;  1SJB A;  2E4G A;  1CJ3 A;  3T31 A;  3CAW A;  1FHU A;  4X4J A;  2YG6 A;  3N6H A;  2XFO A;  2BXS A;  2XFQ A;  4B67 A;  2PTW A;  3KKJ A;  1TDO A;  2FJD A;  3T0K A;  1ONE A;  4HCD A;  3AE8 A;  3VDG A;  2GH5 A;  3BI4 A;  3SQP A;  2APG A;  2W0H A;  2FJA A;  2YG7 A;  3EEZ A;  3F8R A;  4IA6 A;  3ZLH A;  3N6J A;  1GND A;  3C4N A;  1GOS A;  1NU5 A;  3FMW A;  4K2X A;  4G9K A;  3D8X A;  1JPM A;  3AE3 A;  2OVL A;  3H8I A;  3LOV A;  2XVE A;  1F3P A;  1PBF A;  2BXR A;  3UOY A;  5FJR A;  4ENL A;  2YVJ A;  5M0Z A;  3NFU A;  3NK1 X;  3MQT A;  1O5W A;  1GER A;  3RR1 A;  1CJ4 A;  3E1T A;  2OAM A;  4U2T A;  2QDE A;  5IDZ A;  4U8P A;  1XS2 A;  3UTF A;  3PWG A;  2B7S A;  4IL0 A;  5C3J A;  4FK1 A;  3UKQ A;  1L8P A;  2O9Z A;  2AKM A;  3EUB 3;  4TM4 A;  4HNC A;  1KNP A;  3FPZ A;  2HZG A;  1LQT A;  4GFI A;  1ZOY A;  4XXG A;  1YEY A;  3KU9 A;  2WU2 A;  1H82 A;  2GR0 A;  3GO2 A;  2YR6 A;  4E5T A;  2QA1 A;  2GB0 A;  4KPR A;  4EQX A;  1JRO A;  3AEE A;  3PFR A;  1GRF A;  2XFP A;  3UKF A;  2HXU A;  5EOW A;  5LV9 A;  5GRT A;  2GR1 A;  1N63 C;  4H4V A;  4H7U A;  5J04 A;  1EL7 A;  4YXD A;  4N9X A;  3C4A A;  2R0C A;  3JW7 A;  4B63 A;  4Z2T A;  3FBS A;  2EQ6 A;  3FYY A;  2EQ7 A;  2OPJ A;  2WPE A;  3NNE A;  3NO1 A;  3DK9 A;  5U25 A;  4UP3 A;  2ZAD A;  3ES7 A;  5KNL A;  1GV4 A;  2OQH A;  2BK3 A;  2YLW A;  3DG6 A;  4FX9 A;  5IQ4 A;  3UTG A;  1Y56 A;  4E8G A;  3OP2 A;  3R10 A;  3LJP A;  3RED A;  3VFC A;  1FEC A;  1RM6 B;  1XPY A;  4Z43 A;  1JNZ A;  1JRY A;  4Y4N A;  2JB2 A;  1H84 A;  4K5S A;  1IUU A;  3HYX A;  4BJY A;  3CTY A;  2OLN A;  1IUW A;  1VG0 A;  3VRA A;  2C64 A;  2OLO A;  1GT8 A;  2VRL A;  3II4 A;  1BGN A;  5KMP A;  2NQL A;  3NTA A;  1JRP A;  3UOV A;  1UKV G;  3T9P A;  1JU2 A;  5G5G B;  3OPS A;  3DG3 A;  3KUM A;  3NN0 X;  1MDR A;  2C7G A;  3SSZ A;  2OAL A;  1BQG A;  3IHG A;  4U8L A;  2AL2 A;  1CJ2 A;  4JN9 A;  3GD6 A;  5EU9 A;  2B9X A;  4A6N A;  3OZ2 A;  5J60 A;  3KD9 A;  5JCI A;  2YG4 A;  4WX1 A;  5KVI A;  1LTX R;  4RSL A;  2Q0K A;  4KX6 A;  1GRH A;  3AYL A;  3TTE A;  3QSS A;  3NRZ B;  3AN1 A;  4YSH A;  1ONF A;  2VVL A;  4TVY A;  4J1O A;  1TRB A;  2WOW A;  2WDQ A;  2Z5Y A;  5FS9 A;  3UKK A;  3QSE A;  4GAP A;  4OPU A;  3T6C A;  1EBD A;  3BNM A;  4K1W A;  4H4P A;  1SJC A;  3P4P A;  1TYP A;  5FJO A;  2PS2 A;  1CC2 A;  3I4K A;  4U8I A;  4Z44 A;  3VR9 A;  1PHH A;  4A99 A;  3KA7 A;  3A7R A;  3RO6 A;  4AT0 A;  3KPK A;  2RDX A;  2XH7 A;  3HYW A;  4EMI A;  1FFV C;  3G5S A;  1OJT A;  2BK5 A;  2WHD A;  2XH0 A;  3OZM A;  1N5X A;  2MNR A;  3FG2 P;  1JOA A;  1FL2 A;  3N4E A;  4CY8 A;  3FV9 A;  2YR5 A;  2C75 A;  4CCR A;  3NS1 B;  1WYG A;  3GYJ A;  2XLR A;  1FFU C;  3K7T A;  1DNC A;  1GRE A;  3GRT A;  2BYB A;  1TKK A;  1N4V A;  4M52 A;  1SJD A;  3NXL A;  4ICY A;  5KMQ A;  2A8X A;  1Y56 B;  1KD0 A;  3R9U A;  1F8R A;  3DES A;  2PU0 A;  3TWA A;  4Z2R A;  3DJE A;  4EIQ A;  2AAQ A;  1GEU A;  3V5F A;  3ICT A;  3DH9 A;  2JBV A;  1GTH A;  3ETR B;  1ZKQ A;  3I6T A;  3ATR A;  1F8W A;  3F8D A;  3VCC A;  2GGH A;  5G5H B;  3CPI G;  5GSN A;  2MUC A;  4OPL A;  2WBA A;  2XGZ A;  3PWI A;  1YQ4 A;  1RVK A;  1F9C A;  4GIR A;  4DGK A;  4BK2 A;  1B5Q A;  4G6G A;  3AEF A;  3TJ4 A;  5DBJ A;  3UTE A;  1GTE A;  2AL2 B;  3AD7 B;  3GMB A;  4H2N A;  4EMW A;  1EL5 A;  4RG4 A;  3CK5 A;  4A6N B;  4H1Z A;  2Q7V A;  3IK4 A;  3STP A;  2WOV A;  5KOW A;  4DHG A;  4TVW A;  1E9I A;  1L0V A;  1ELS A;  3S5W A;  4YWS A;  3CGD A;  2C3C A;  4USQ A;  2IVD A;  2NPX A;  1OJD A;  2OA1 A;  4U2L A;  3MWC A;  3TOY A;  3SGL A;  3UP5 A;  3KPF A;  3TCS A;  2XFU A;  3AE2 A;  1GRG A;  3ZLG A;  4G6H A;  3IHM A;  3IJQ A;  3R1Z A;  3AD9 B;  3NGC X;  3VQR A;  1K0J A;  1REO A;  3RP6 A;  3JSK A;  3OZY A;  4C77 A;  5C2T A;  1X2G A;  2PP0 A;  4X9N A;  2PGE A;  3UTH A;  3K7M X;  2X8C A;  3NLC A;  2QQ6 A;  4K5R A;  1E7P A;  4U2S A;  2PCE A;  3EAN A;  2V6O A;  3PS9 A;  3GRS A;  3AED A;  4JN8 A;  3DG7 A;  4IZG A;  4NTD A;  2BS4 A;  3EKG A;  2JKC A;  3B6D A;  3T2Z A;  2C70 A;  3DME A;  3S61 A;  1KSS A;  5BOE A;  4F4R A;  2DW7 A;  1F8S A;  5U63 A;  3GDP A;  3SZ0 A;  1IUS A;  4ROP A;  3BI5 A;  1N1P A;  2OFJ A;  3AD8 B;  2GMJ A;  1BKW A;  3GD4 A;  5BUL A;  3RHA A;  1JEH A;  2PP1 A;  4FI4 A;  1IUV A;  2VQ7 A;  4LII A;  4Y4M A;  1Q1R A;  3CMM A;  3GY1 A;  2JK6 A;  2WET A;  1VRQ B;  3ICS A;  1Q9I A;  1FEA A;  2BAC A;  3CNJ A;  1PBD A;  2R9Z A;  2BCP A;  2JB3 A;  1DOB A;  3PO7 A;  3V5C A;  2OZT A;  3G5R A;  5KRQ A;  1L9C A;  1OEP A;  3R07 C;  1WUE A;  4JHM A;  2P8C A;  2W54 A;  4KWS A;  3P4Q A;  2WP9 A;  3DGZ A;  3QKE A;  2PTX A;  3T37 A;  3UXK A;  1YQZ A;  4G74 A;  2YLZ A;  3DK4 A;  4CNK A;  2YAU A;  3H8L A;  3B3R A;  7ENL A;  2POD A;  4K22 A;  3F8P A;  1GAL A;  4KEM A;  2BRA A;  1CHU A;  4GAV A;  2YG5 A;  3AE4 A;  2X50 A;  3HZL A;  1GET A;  3PK7 A;  3THU A;  1KFY A;  2XYO A;  4APN A;  3UOZ A;  5BUK A;  4HN8 A;  2GR3 A;  2PSN A;  1MUC A;  4CY6 A;  2GGG A;  4HCL A;  1CL0 A;  4ADW A;  2X3N A;  1GRT A;  3CGB A;  2XCG A;  4G8T A;  1JNR A;  3UJS A;  3GYX A;  4H50 A;  3SZF A;  2PPG A;  4M0X A;  4BUR A;  3QFA A;  4AP1 A;  2R45 A;  2WDR A;  3QFB A;  3URH A;  4GYP A;  2WOI A;  2GGI A;  3H7V A;  4GIS A;  4P9S A;  3QPE A;  4WCT A;  1D5T A;  4YTN A;  3NH3 X;  1NEN A;  5KMR A;  4E0V A;  4Z2U A;  2CFY A;  3T14 A;  1PBC A;  1VDV A;  4A9W A;  2VRM A;  4MJW A;  3IC9 A;  3V76 A;  1M6I A;  2GDQ A;  2ZZB A;  2QJN A;  1PBE A;  4IVM B;  1S7M A;  1D4C A;  2C66 A;  3AWI A;  1N61 C;  2YVG A;  3NVV B;  5BVA A; 
#chains in the Genus database with same CATH homology
 2E5V A;  1ZMD A;  3DGH A;  1GXF A;  4C5O A;  1K0L A;  2GF3 A;  3AE6 A;  1CC2 A;  3GYI A;  4ZCD A;  2GQF A;  4U8I A;  1GPE A;  1E1N A;  4JDR A;  4Z44 A;  3VR9 A;  5IPY A;  1CC6 A;  2ZZC A;  3AEA A;  1PHH A;  3EPT A;  1CF3 A;  4NTC A;  4A99 A;  3KA7 A;  2C3D A;  4BK1 A;  4AT0 A;  5CKU A;  3KPK A;  3KVE A;  3V3N A;  5KMS A;  3HYW A;  4UDP A;  4NNJ A;  4Y4L A;  2VZ2 A;  4EMI A;  4TM4 A;  1LVL A;  3K7Q X;  3AYJ A;  1K4Q A;  1KNR A;  1QJD A;  3G5S A;  4IVO B;  1OJT A;  2XFN A;  4TM1 A;  4YSY A;  2BK5 A;  2B9Y A;  4H4X A;  4EQS A;  4U8J A;  2WHD A;  3SFE A;  5HY5 A;  4B68 A;  4A65 A;  2C72 A;  2EQ8 A;  1JOA A;  1MOK A;  3FG2 P;  1FL2 A;  4ZN0 A;  4JY2 A;  3SFD A;  4II2 A;  4CY8 A;  5EBK A;  1KDG A;  3V3O A;  2YR5 A;  2C75 A;  1LV0 A;  2GVC A;  3AE7 A;  1FEB A;  4TM0 A;  4CCR A;  1DOC A;  4U8O A;  3GYJ A;  5KVH A;  3LXD A;  1MO9 A;  2XLR A;  2YG3 A;  4Z26 A;  1ZMC A;  3K7T A;  3NK2 X;  1DNC A;  1GRE A;  3GRT A;  3LAD A;  3Q6J A;  2BYB A;  2E1M A;  3QJ4 A;  1TDE A;  1N4V A;  4YTP A;  2FBW A;  2YLS A;  4GRT A;  4II3 A;  1E1M A;  4M52 A;  2Y6R A;  3BNU A;  3SYI A;  2JAE A;  1TDN A;  3AEC A;  1GRB A;  1AOG A;  1H81 A;  4JNQ A;  1PN0 A;  2YM2 A;  4ICY A;  1JRZ A;  1PJ6 A;  5KMQ A;  3T2Y A;  1HYU A;  2A8X A;  1Y56 B;  3ICR A;  2BA9 A;  1PXA A;  5TR3 A;  3R9U A;  1F8R A;  1S2Q A;  4ECH A;  2C4C A;  1Y0P A;  3GMC A;  2DKI A;  3OC4 A;  1M64 A;  1VDC A;  3DA1 A;  4Z2R A;  2X99 A;  3DJE A;  1S3B A;  3AB1 A;  4GF7 A;  4CCQ A;  4EIQ A;  2AAQ A;  1GEU A;  3K30 A;  3ALL A;  1V59 A;  1RYI A;  3ICT A;  3DH9 A;  2JBV A;  2Q0L A;  2R4J A;  1NHP A;  1GTH A;  4GDE A;  4H4Y A;  3NIX A;  1YKJ A;  3QVP A;  1EL9 A;  1ZKQ A;  3M12 A;  2VQB A;  1CC4 A;  3ATR A;  3CIR A;  4C3X A;  2YLR A;  3L1R A;  4AP3 A;  1F8W A;  3F8D A;  1FCD A;  1KN0 A;  2H88 A;  1VQW A;  3ALJ A;  4B1B A;  4EM4 A;  3PG6 A;  1GSN A;  3CNT A;  3CPI G;  4OPD A;  5GSN A;  3D1C A;  1YY5 A;  2X8H A;  4A79 A;  2YR4 A;  3IF9 A;  2JB1 A;  1XPQ A;  4OPL A;  4OPI A;  1N4W A;  2XVH A;  1E1L A;  2WBA A;  2C76 A;  1B8S A;  1TDK A;  5JCM A;  2WDV A;  1YQ4 A;  3LB8 A;  3KLJ A;  5FMH A;  3BHK A;  2RGH A;  2PHH A;  1OJC A;  3CNP A;  3NK0 X;  4H4R A;  2WQY A;  4REK A;  4DGK A;  4BK2 A;  1GRA A;  3ZYX A;  1B5Q A;  2WES A;  1ZX9 A;  1TYT A;  3NYC A;  1S2Y A;  3RP7 A;  2XVI A;  2CUL A;  4H4W A;  4G6G A;  3VR8 A;  3AEF A;  4H2Q A;  4GUV A;  1PXC A;  4OCG A;  4GCM A;  1DJQ A;  2BRY A;  5DBJ A;  4B65 A;  3UTE A;  1GTE A;  2WPC A;  3GMB A;  3AD7 B;  3PVC A;  4EMW A;  1EL5 A;  1FOH A;  4H2N A;  1RP0 A;  4RG4 A;  2YLT A;  4XWZ A;  3WE0 A;  4A6N B;  3FIM B;  3NT6 A;  2Q7V A;  2WEU A;  4GR1 A;  2BS2 A;  4YKF A;  2R46 A;  3LZX A;  4DSH A;  4EQR A;  2R0G A;  2GAG B;  2WOV A;  3QSM A;  4B66 A;  1BF3 A;  2RAB A;  5KOW A;  2E4G A;  1CJ3 A;  2YVF A;  3T31 A;  5M10 A;  2AR8 A;  4ZCC A;  2VVM A;  4PAB A;  1L0V A;  4X4J A;  5JCN A;  3M0O A;  2YG6 A;  4Z24 A;  2XFO A;  4YWO A;  1KSU A;  2BXS A;  2XFQ A;  3S5W A;  4B67 A;  1BWC A;  3AXB A;  3KKJ A;  1TDO A;  5U1O A;  3CGD A;  2FJD A;  2C3C A;  4USQ A;  2IVD A;  3T0K A;  2NPX A;  1PBB A;  1D7L A;  2RGO A;  3AE8 A;  1Z6L A;  1JRX A;  1OJD A;  1E1K A;  2OA1 A;  4IA5 A;  1PXB A;  4U2L A;  2RGJ A;  3H4K A;  2WP6 A;  2GH5 A;  3UKA A;  1EL8 A;  3BI4 A;  4DNA A;  4H4Q A;  3SGL A;  3UP5 A;  3SQP A;  2XDO A;  2APG A;  2BCG G;  2XFU A;  3KPF A;  2W0H A;  3DK8 A;  2FJA A;  3AE2 A;  1GRG A;  4AT2 A;  2YG7 A;  1H2I A;  4G6H A;  1YQ3 A;  5KWF A;  1H83 A;  3F8R A;  4UDR A;  4LU6 A;  3SXI A;  3IHM A;  2BAB A;  4IA6 A;  3NKS A;  2WP5 A;  4O5U A;  1GND A;  4Z25 A;  3C4N A;  1GOS A;  3AD9 B;  2DKH A;  3FMW A;  1P2E A;  4K2X A;  4G9K A;  2GMH A;  2GEW A;  2VVL G;  3NGC X;  3D8X A;  3VQR A;  3NN6 X;  1H86 A;  2PYX A;  1K0J A;  4JQ9 A;  1OJ9 A;  1K0I A;  1REO A;  4A5L A;  1PDH A;  1LPF A;  4GDP A;  4J36 A;  2NVK X;  3AE3 A;  3H8I A;  1B4V A;  3LOV A;  2XVE A;  1F3P A;  2BC1 A;  1PBF A;  2BXR A;  3UOY A;  3RP6 A;  3JSK A;  4C77 A;  2YVJ A;  2R4E A;  5C2T A;  5M0Z A;  3M13 A;  2FJB A;  4X9N A;  3NK1 X;  4YSZ A;  1PJ5 A;  3NRN A;  3UTH A;  1O5W A;  4O5Q A;  3SZC A;  1GER A;  3K7M X;  2X8C A;  1CJ4 A;  3E1T A;  3NLC A;  4EM3 A;  2OAM A;  4U2T A;  4K5R A;  1NEK A;  2YM1 A;  1H7X A;  1E7P A;  1L9E A;  4U2S A;  3EAN A;  2V6O A;  2XLP A;  3PS9 A;  3GRS A;  3AED A;  3DJJ A;  4TLX A;  2IVE A;  3L5O A;  1LJ1 A;  4U8P A;  1CBO A;  1L9D A;  1ZP0 A;  4NTD A;  2BS4 A;  3VRB A;  4H4T A;  2JKC A;  4H2P A;  4EQW A;  3UTF A;  4J34 A;  3AEG A;  3B6D A;  2B7S A;  4OPG A;  2WU5 A;  3T2Z A;  5C3J A;  4FK1 A;  3RP8 A;  2C70 A;  5KOX A;  2B7R A;  2XLS A;  4BJZ A;  2BC0 A;  2AQJ A;  3UKQ A;  4K8D A;  1Q1W A;  5FS7 A;  1ZOV A;  1KNP A;  2O9Z A;  3DME A;  2C67 A;  3FPZ A;  4TM3 A;  1LQU A;  1KSS A;  3CGC A;  3S61 A;  4YKG A;  3P4R A;  3LZW A;  4U8K A;  1LQT A;  3UKH A;  2GRT A;  1F8S A;  1MXT A;  2CVJ A;  1ZOY A;  4J33 A;  5U63 A;  2F5Z A;  1QO8 A;  3GDP A;  4HA6 A;  3SZ0 A;  2V3B A;  4EMJ A;  1IUS A;  4XXG A;  3BI5 A;  2J3N A;  1N1P A;  3AD8 B;  3AE1 A;  3UOX A;  3Q9T A;  2GMJ A;  3KU9 A;  2Z5X A;  5HXI A;  5JRB A;  2WU2 A;  1BKW A;  3GD4 A;  5BUL A;  4J57 A;  3ADA B;  1BZL A;  3RHA A;  1JEH A;  3G5Q A;  1H82 A;  1NG4 A;  2YWL A;  2GR0 A;  1OJA A;  1F6M A;  3T2K A;  3ISH A;  3CGE A;  1IUV A;  2VQ7 A;  4JY3 A;  1GES A;  2V61 A;  2YR6 A;  3CPH G;  4LII A;  2QA1 A;  1ELI A;  1NHR A;  1Q1R A;  3CMM A;  4HB9 A;  4Y4M A;  4YTM A;  4J56 A;  4G73 A;  2JK6 A;  1B37 A;  2WET A;  3DJG X;  1VRQ B;  2XVF A;  2GB0 A;  1DOE A;  3ICS A;  4C3Y A;  2XLT A;  4KPR A;  1XAN A;  4EQX A;  3AEE A;  4LA1 A;  1Q9I A;  1GRF A;  2XFP A;  4J2W A;  4USR A;  4UDQ A;  3UKF A;  1FEA A;  2A87 A;  5EOW A;  1XHC A;  2BAC A;  2WS3 A;  2GR2 A;  3CNJ A;  5LV9 A;  1ZDL A;  2ZBW A;  1PBD A;  5GRT A;  3SM8 A;  2I0Z A;  2YLX A;  2GR1 A;  2R9Z A;  2BCP A;  2C65 A;  2VOU A;  3DJD A;  4OVI A;  4D03 A;  4EIP A;  3HYV A;  4H4V A;  1O94 A;  3ZDN A;  4H7U A;  4OPC A;  3VRD B;  2JB3 A;  1P2H A;  1EL7 A;  1DOB A;  4XWR A;  4J31 A;  3PO7 A;  4NTE A;  1KF6 A;  2X8G A;  2IID A;  1RSG A;  4YXD A;  5J7X A;  1DXL A;  3G5R A;  4N9X A;  5KRQ A;  3C4A A;  1L9C A;  2XLU A;  3C96 A;  4NWZ A;  2R0C A;  5ER0 A;  3P4S A;  4B63 A;  4Z2T A;  2UZZ A;  4BK3 A;  3FBS A;  2EQ6 A;  2ACZ A;  2Q6U A;  3BI2 A;  1E6E A;  2EQ7 A;  1D4D A;  3P4Q A;  2WP9 A;  1TDF A;  4C74 A;  2WPE A;  3NNE A;  3DGZ A;  3IWA A;  3DK9 A;  3T37 A;  2YQU A;  2QAE A;  1YQZ A;  4H4Z A;  5U25 A;  4G74 A;  2YLZ A;  3SZW A;  4UP3 A;  5KXJ A;  3DK4 A;  4RG3 A;  1NPX A;  4CRT A;  3RNM A;  5KNL A;  1GV4 A;  4FK1 C;  2BK3 A;  1NG3 A;  2YLW A;  3CND A;  2QCU A;  4CNJ A;  4CNK A;  5HYM A;  4NEV A;  4FX9 A;  2YAU A;  1NAA A;  3B3R A;  3H8L A;  5IQ4 A;  3UTG A;  1CJC A;  1NHQ A;  1D4E A;  1Y56 A;  3ALM A;  4K22 A;  3UKL A;  3LJP A;  4U8N A;  3RED A;  2WPF A;  4A7A A;  3BHF A;  3F8P A;  1GAL A;  1FEC A;  2BRA A;  1H6V A;  1CHU A;  1SEZ A;  4GAV A;  1X31 B;  4I58 A;  2YG5 A;  4Z43 A;  3AE4 A;  1JNZ A;  5JCK A;  2X50 A;  1JRY A;  3HZL A;  3I6D A;  1GET A;  2XYO A;  1KFY A;  4Y4N A;  4FDC B;  4APN A;  3UOZ A;  5BUK A;  2JB2 A;  1H84 A;  4K5S A;  1IUU A;  2GR3 A;  4NEW A;  2B76 A;  4PAA A;  3HYX A;  4BJY A;  3CTY A;  2OLN A;  1IUW A;  1VG0 A;  1QLB A;  2ZZ0 A;  1D7Y A;  2C64 A;  2OLO A;  3COX A;  3P1W A;  1IUX A;  1GT8 A;  3VRA A;  2VRL A;  4CBQ A;  4CY6 A;  3II4 A;  3UP4 A;  3UKP A;  1CL0 A;  4ADW A;  3P9U A;  2X3N A;  1GRT A;  3EAO A;  3ATQ A;  4YSX A;  1BGN A;  5KMP A;  3CGB A;  3NTA A;  4H4S A;  1IJH A;  2Y6Q A;  2TMD A;  2XCG A;  2GAH B;  3UOV A;  4DSG A;  1PS9 A;  2B9W A;  1UKV G;  3AE9 A;  1DJN A;  3O0H A;  1JNR A;  3AYI A;  1N4U A;  3I3L A;  1NHS A;  1JU2 A;  3EF6 A;  4H50 A;  3GYX A;  2TPR A;  2ARD A;  2GQW A;  4K7Z A;  2V5Z A;  3NYE A;  3SZF A;  2R0P A;  3NYF A;  5EB4 A;  2GV8 A;  3NN0 X;  3NTD A;  4BUR A;  3QFA A;  5EB5 A;  2C7G A;  2OAL A;  2C73 A;  4JNA A;  4AP1 A;  2H89 A;  2R45 A;  2WDR A;  3IHG A;  4U8L A;  3QFB A;  3URH A;  3GSI A;  3GD3 A;  3SX6 A;  3NHO X;  1XDI A;  4AOS A;  3ABV A;  1W4X A;  5IQ1 A;  2V3A A;  2WOI A;  2BS3 A;  4U8M A;  4X9M A;  1CJ2 A;  1O95 A;  4JN9 A;  2B9X A;  5CQF A;  3QVR A;  3GWF A;  3OZ2 A;  4A6N A;  5J60 A;  3AE5 A;  3CNS A;  3KD9 A;  5JCI A;  2YG4 A;  4OPT A;  1NDA A;  4WX1 A;  5KVI A;  1LTX R;  4P9S A;  4RSL A;  2CDU A;  3CPJ G;  4H4U A;  4WCT A;  3L8K A;  2Q0K A;  1GRH A;  3GWD A;  1COY A;  3AYL A;  4KX6 A;  4B64 A;  1D5T A;  1S3E A;  3QSS A;  4YTN A;  3NH3 X;  4IV9 A;  3ITJ A;  2A89 A;  4TLZ A;  1NEN A;  5KMR A;  5FS8 A;  4YSH A;  4H2R A;  1ONF A;  2VVL A;  4E0V A;  5BRT A;  4Z2U A;  5JCL A;  2CFY A;  3T14 A;  5FS6 A;  1PBC A;  2EQ9 A;  4A9W A;  2VRM A;  4NZH A;  4MJW A;  1ZK7 A;  5L46 A;  1PJ7 A;  4BV6 A;  3IC9 A;  3NG7 X;  1TRB A;  2XVJ A;  2V60 A;  5HHF A;  2WOW A;  2WDQ A;  3V76 A;  4YT0 A;  3D9X A;  2Z5Y A;  5FS9 A;  1VG9 A;  1M6I A;  3CN8 A;  4AOX A;  1ZY8 A;  3UKK A;  3QSE A;  2ZZB A;  4B69 A;  1IUT A;  2FJE A;  1PBE A;  3UCL A;  4D04 A;  4GAP A;  2HQM A;  1S7M A;  1D4C A;  1H7W A;  2C66 A;  4I59 A;  4IVM B;  4OPU A;  1EBD A;  3BNM A;  1E39 A;  4H4P A;  3AWI A;  1DOD A;  3AEB A;  3SY4 A;  2BK4 A;  2QA2 A;  2YVG A;  3P4P A;  3GDN A;  1BGJ A;  5BVA A;  1TYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...