1XHCA

Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779-001
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
351
structure length
346
Chain Sequence
SKVVIVGNGPGGFELAKQLSQTYEVTVIDKEPVPYYSKPMLSHYIAGFIPRNRLFPYSLDWYRKRGIEIRLAEEAKLIDRGRKVVITEKGEVPYDTLVLATGARAREPQIKGKEYLLTLRTIFDADRIKESIENSGEAIIIGGGFIGLELAGNLAEAGYHVKLIHRGAMFLGLDEELSNMIKDMLEETGVKFFLNSELLEANEEGVLTNSGFIEGKVKICAIGIVPNVDLARRSGIHTGRGILIDDNFRTSAKDVYAIGDCAEYSGIIAGTAKAAMEQARVLADILKGEPRRYNFKFRSTVFKFGKLQIAIIGNTKGEGKWIEDNTKVFYIGAVVFNDIRKATKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NADH oxidase /nitrite reductase from Pyrococcus furiosus Pfu-1140779-001
rcsb
source organism Pyrococcus furiosus
molecule tags Oxidoreductase
molecule keywords NADH oxidase /nitrite reductase
total genus 105
structure length 346
sequence length 351
ec nomenclature
pdb deposition date 2004-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1xhcA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xhcA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xhcA02
2Z5YA 1BZLA 4K2XA 4EMJA 4ZCDA 4A6NA 3KU9A 3VRBA 3L8KA 3NRNA 1L0VA 2GR2A 3GMBA 1OJAA 1REOA 1VG9A 2JAEA 3V3OA 2X50A 1S3EA 4CY8A 3T37A 5KOXA 1F3PA 2WEUA 1K0JA 4IVOB 1D5TA 3EF6A 1NHQA 1HYUA 4FDCB 1RP0A 2BK5A 5BRTA 2JKCA 2OLOA 1E7PA 3II4A 4PAAA 3REDA 4YKGA 2EQ6A 4EQXA 1JNRA 2QA1A 1JEHA 2VVLG 2YR4A 1TDKA 3CNDA 2WDQA 3F8DA 1Q9IA 2GQWA 2YLTA 3AEEA 2R0CA 1F8WA 4LU6A 4D03A 3AE2A 1H7WA 3UTFA 2PYXA 1D4EA 3DH9A 1UKVG 4U2TA 4H4PA 2BS4A 4NTCA 1K0IA 3QSMA 4Z44A 3DA1A 3VR8A 1ZKQA 4H4XA 3K7TA 1D4DA 3NLCA 2Q0LA 4XXGA 3VRAA 1KF6A 2UZZA 2CDUA 1ONFA 1CC2A 2YLSA 4A65A 1E1MA 4TM3A 1H86A 3NKSA 3NGCX 4J34A 4ADWA 3QSEA 3BNUA 1XANA 2AR8A 3AE3A 4H50A 2YG6A 4AP3A 4X9NA 1PJ5A 1IUVA 3UCLA 3CGEA 2V5ZA 1EL9A 1H84A 1BWCA 4GR1A 1LQUA 4UDQA 5CQFA 1K0LA 4H4UA 2GV8A 3EPTA 4K8DA 4J2WA 2A87A 3ZYXA 1GT8A 1LPFA 2BK3A 1KNPA 3NNEA 3ALLA 3COXA 2DKIA 4AP1A 2WU2A 5CKUA 2WP6A 5JCMA 3GD3A 1EL7A 2V3AA 4NZHA 5KVHA 4N9XA 1BKWA 1E1NA 2Z5XA 4GDPA 1NG4A 4K7ZA 1F6MA 5FMHA 2XVHA 3DJGX 3CNPA 4A5LA 3UP4A 1OJDA 1NAAA 4U8KA 4DNAA 3G5SA 3ZDNA 1H7XA 3K7QX 1B37A 1TDFA 4OPGA 1PDHA 2WBAA 1S2QA 2GMJA 1CJ2A 2R46A 2R4EA 4USRA 3S5WA 3G5QA 4AOSA 3AE9A 3AE4A 4U8LA 3B3RA 2GR1A 2E5VA 5IQ1A 4KPRA 3NK2X 2VRMA 2C66A 3QVPA 2BABA 1GPEA 2YG5A 1N4UA 3M12A 2WDVA 3I6DA 5BULA 4C77A 4B67A 3D1CA 2BXSA 1GOSA 1PBEA 2YAUA 3EAOA 1S3BA 2GF3A 4YXDA 2C70A 3P4RA 3UKHA 1QO8A 2QCUA 3V76A 2WETA 2EQ9A 5BVAA 3CN8A 3GRSA 1TDEA 4CNKA 2B76A 4DGKA 1CC6A 1NEKA 2YM1A 3GSIA 4Y4NA 3SFEA 4EMIA 4DSHA 4ICYA 3GWFA 3ATRA 1DOCA 3UOZA 4YT0A 3ADAB 3GWDA 1ZP0A 1PXBA 4BK2A 2RGJA 3FIMB 3P9UA 3ICSA 3H4KA 3D8XA 3UKPA 3NTDA 3C96A 2BC1A 5EB5A 2C73A 2ZBWA 5FS6A 3UKLA 4IV9A 2GEWA 4UP3A 1FL2A 4U8MA 2PHHA 1OJ9A 4H7UA 3UOXA 1NG3A 2GR0A 3RP8A 4B64A 4EM4A 3LADA 1GRBA 4YSHA 4TM4A 1AOGA 4YSXA 2XFNA 3RHAA 3P4SA 2WHDA 4GF7A 4A7AA 3FPZA 2A8XA 1N1PA 4Z26A 3SQPA 4BK3A 1ZMCA 4U8NA 1V59A 1PBBA 4TLXA 1PXAA 5GRTA 3PO7A 1QLBA 1Y0PA 4DSGA 4H4VA 4JDRA 2ZZ0A 4Z2UA 4BJZA 1BGJA 1IUUA 1P2EA 5L46A 3ALJA 3AE6A 3RP7A 5JCIA 3KKJA 1PJ6A 3OC4A 1KNRA 1KSSA 1CJ4A 1KDGA 1MXTA 4K22A 4O5UA 1RYIA 2B9XA 5DBJA 2OALA 1TYTA 2NPXA 2R0GA 3HZLA 2IIDA 3M0OA 3NYFA 3AEAA 4UDPA 2VVMA 1GRGA 2XYOA 1CHUA 1JRZA 3GRTA 3AE7A 4AOXA 2XDOA 2J3NA 3UOVA 1PBDA 3CIRA 3NN0X 1CF3A 3I3LA 3QVRA 1H82A 1O94A 3AB1A 3AXBA 1CJ3A 1GRFA 1BF3A 2R9ZA 1H83A 4YKFA 5HXIA 3GDPA 1JOAA 1E39A 1YQ4A 4U8IA 3KLJA 2E4GA 1TDOA 1CL0A 2Q6UA 3IHGA 1MO9A 2BS2A 4X4JA 2OLNA 4RG3A 4EQSA 4JY2A 2YR6A 2IVEA 2QAEA 5HYMA 5BUKA 2IVDA 4O5QA 3BHKA 4Z43A 4Z24A 4H4WA 2A89A 3FMWA 4BV6A 4X9MA 4C3YA 3NHOX 1JNZA 3CNTA 4GRTA 5EB4A 4EIPA 3IF9A 3IHMA 4KX6A 5IQ4A 3BNMA 3BI2A 5EOWA 1K4QA 2YG3A 3CPHG 4GCMA 5HY5A 3IC9A 1NPXA 4TM0A 2Y6QA 1IUWA 2GAGB 1DNCA 3C4NA 2V61A 1FOHA 2B9YA 4JN9A 3ICRA 3FBSA 2X8HA 1DJNA 3DGZA 2GQFA 3ICTA 2YVJA 2RGHA 4YWOA 2YG4A 3UKFA 4B63A 2WPCA 2WQYA 3AYIA 4JNQA 4EQRA 4LA1A 1LTXR 3DMEA 3O0HA 2C64A 3K30A 3B6DA 5U25A 4H2RA 1NENA 1D7YA 5M10A 1YQZA 3LXDA 1FECA 3EANA 3LZWA 4UDRA 3QFBA 4J57A 5M0ZA 2XLSA 3P1WA 4H2PA 3R9UA 2CVJA 3NT6A 1P2HA 4NEWA 4TM1A 3UTGA 1B8SA 4OCGA 2ZZBA 1JRYA 2YR5A 3ITJA 3CGBA 3VR9A 3F8RA 1F8SA 2WU5A 4D04A 3PS9A 1IJHA 2VZ2A 3ATQA 1PBFA 4JNAA 3V3NA 1Q1RA 2AQJA 1GRHA 3DK9A 1XDIA 1GTHA 2BA9A 2BS3A 3LB8A 3AE8A 3AWIA 1ZMDA 2TPRA 3L1RA 4Y4MA 4IA6A 1LQTA 1OJCA 2C76A 2GB0A 2V60A 4WCTA 1RSGA 2YVFA 2FBWA 2X3NA 1H6VA 3GYIA 4A99A 4GUVA 3CGCA 4EM3A 2XLTA 3OZ2A 1IUXA 4ECHA 2C75A 2WOWA 3PVCA 5GSNA 1GV4A 3UTHA 2YWLA 1COYA 1DOBA 2H88A 4RG4A 1YKJA 4PABA 4H4ZA 4HB9A 1FCDA 3GYJA 1GSNA 2XLPA 2WESA 2YLZA 5J60A 2XCGA 1E1LA 3UP5A 3CGDA 4Z25A 3AEGA 4U2LA 1TRBA 1GALA 4AT0A 4J33A 3Q6JA 3UOYA 2XFOA 1DODA 4LIIA 1TDNA 2WPEA 4JQ9A 1VQWA 3KVEA 2QA2A 4TLZA 4BJYA 2E1MA 4B66A 3GDNA 3UKQA 2OA1A 1GXFA 3AD7B 5ER0A 1Y56A 1PBCA 1CC4A 1PN0A 4XWRA 1PHHA 4C3XA 3P4PA 3NYCA 5J7XA 2XLRA 4YTPA 4FX9A 2R4JA 2FJBA 1LVLA 4CY6A 1GRTA 1L9CA 4I58A 4EIQA 4CBQA 2B7RA 2XVEA 2Y6RA 4USQA 2O9ZA 2GRTA 1PJ7A 1QJDA 2BYBA 4XWZA 4A9WA 2F5ZA 1ZOYA 3SFDA 1YQ3A 4BURA 4OVIA 1GEUA 3DJEA 2B9WA 1LV0A 4ZCCA 1YY5A 3AEBA 1GNDA 2JBVA 4K5RA 4B68A 5FS8A 5U1OA 2R0PA 4WX1A 2Q7VA 3URHA 3JSKA 2X8GA 3H8LA 4H2NA 5FS7A 3CPJG 5KVIA 4J31A 1DXLA 2VRLA 1OJTA 2C67A 2XVFA 2XFPA 3CNSA 2VOUA 3LZXA 4OPUA 2GVCA 2X99A 1B4VA 5KXJA 2OAMA 3F8PA 1H81A 5C3JA 1ZOVA 3AYLA 3KD9A 2BK4A 2XVJA 1VRQB 3VQRA 3VRDB 3UTEA 3AD9B 1IUSA 2X8CA 2B7SA 3RP6A 2YLWA 1KSUA 1SEZA 4OPTA 2YVGA 3DGHA 4U8OA 4NTEA 2VQ7A 1GREA 2WPFA 2C3CA 3NH3X 3KPFA 4YSYA 1M6IA 4U2SA 2CFYA 3DJJA 3DK4A 1D7LA 1KFYA 4CCQA 3LJPA 2GMHA 2YM2A 2XVIA 1CBOA 2JK6A 4U8JA 4IVMB 4P9SA 4J56A 2JB3A 1GETA 2RABA 1XPQA 2EQ7A 2YG7A 3BI4A 3NIXA 5IPYA 4RSLA 5KOWA 4M52A 4ZN0A 1Q1WA 3CTYA 1W4XA 1ZY8A 1NDAA 3P4QA 1S2YA 2V3BA 2AAQA 2GR3A 3QFAA 3AEDA 3E1TA 1ZK7A 3QJ4A 1ELIA 4CCRA 3DK8A 5JCLA 2FJDA 1EBDA 2R45A 1O95A 1E6EA 2JB2A 4NTDA 2BXRA 1VG0A 4K5SA 5EBKA 2BCPA 2EQ8A 2BCGG 4CRTA 4Z2RA 5TR3A 4A6NB 2CULA 1LJ1A 4U8PA 4GDEA 1GTEA 1IUTA 1D4CA 4H4YA 5JCKA 2C72A 4HA6A 1DOEA 1NHPA 2V6OA 1TYPA 1N4WA 2VQBA 3QSSA 4J36A 4OPIA 1VDCA 3GMCA 3NG7X 5LV9A 3K7MX 3LOVA 3NK1X 4B69A 1ZX9A 2WOIA 2XFUA 1GERA 1ZDLA 1JU2A 2YQUA 2W0HA 1X31B 4BK1A 4E0VA 1JRXA 3BHFA 3IWAA 4OPDA 3KA7A 1DJQA 5FS9A 2YLRA 3H8IA 1F8RA 2ZZCA 3AYJA 2XLUA 4B1BA 1CJCA 2RGOA 2C7GA 4FK1A 3NYEA 3AE5A 1NHRA 1FEBA 4YTNA 4MJWA 2BC0A 4CNJA 2BACA 2APGA 1MOKA 3CNJA 4AT2A 3AD8B 4OPLA 3SGLA 3M13A 3G5RA 4YTMA 2NVKX 1PS9A 2ACZA 1B5QA 2FJEA 3NN6X 4EMWA 4H4SA 1GRAA 1Y56B 2H89A 3C4AA 1NHSA 1XHCA 3SM8A 1O5WA 2XFQA 2JB1A 4NEVA 4H4TA 4B65A 3CPIG 2FJAA 3BI5A 2WP9A 2I0ZA 2YLXA 2DKHA 4YSZA 1L9DA 2VVLA 3ALMA 3S61A 4APNA 2GAHB 2C3DA 3WE0A 4H4QA 5JCNA 3AEFA 3GD4A 4JY3A 3UKAA 3AECA 4OPCA 3Q9TA 3DJDA 1PXCA 1FEAA 2HQMA 2WDRA 2Q0KA 5KWFA 2WOVA 1EL5A 2WP5A 1EL8A 3AE1A 5HHFA 5U63A 4Y4LA 3FG2P 3NK0X 1E1KA 2TMDA 2ARDA 4A79A 4H2QA 3NTAA 1M64A 5C2TA 2GH5A 1N4VA 4IA5A 5KRQA 1BGNA 2WS3A 1Z6LA 3UKKA 4FK1C 4EQWA 4REKA 4I59A 4C74A 1L9EA 3RNMA 2C65A 1GESA 4C5OA 3ABVA 4H4RA 4Z2TA 3ISHA
chains in the Genus database with same CATH superfamily
4EMJA 4ZCDA 3VRBA 1L0VA 1OJAA 1FHVA 2JAEA 5JRBA 3PWIA 2PTZA 1K0JA 3MSYA 5BRTA 3VCNA 4FI4A 2XGZA 1WUFA 3AE2A 1H7WA 2PYXA 1D4EA 4H19A 3MWCA 2GGHA 2PMQA 1JCTA 3DA1A 1KF6A 2CDUA 4J3ZA 3NGCX 3QSEA 3NZGA 2YG6A 2OLAA 1PJ5A 1IUVA 1R0MA 4UDQA 3ZYXA 2QDEA 3T2YA 2QJMA 3COXA 5CKUA 2GGJA 2WP6A 5JCMA 3NVZB 4N9XA 1BKWA 4GDPA 3UP4A 4MGGA 3ZDNA 1H7XA 1B37A 1TDFA 2XSXA 3TTEA 3AE9A 3V4BA 4U8LA 2VRMA 3CYJA 2C66A 5KMSA 1GPEA 1S3BA 4YXDA 3MZNA 2EQ9A 3CN8A 3GRSA 1TDEA 4CNKA 4DGKA 4DSHA 4JN7A 2AL2B 4BK2A 2W54A 3FIMB 1TZZA 3D8XA 3NTDA 4GYPA 3UKLA 2C73A 1FL2A 3RO6A 2OZ8A 3V5CA 2PHHA 3RHAA 4GF7A 3UJ2A 4Z26A 4BK3A 1ZMCA 3OTRA 4TLXA 5GRTA 3PO7A 4DSGA 1BGJA 1P2EA 3KKJA 1PJ6A 4HYRA 2OZ3A 3OC4A 1KNRA 1KSSA 1KDGA 1MXTA 4IHCA 4DN1A 2B9XA 5DBJA 2NPXA 1N63C 1VDVA 4UDPA 2XYOA 3AM9A 2PP0A 2AKZA 3NN0X 3T4WA 1CJ3A 3SZCA 3H7VA 4YKFA 1E39A 4U8IA 2BS2A 2OLNA 3H8AA 2YR6A 2IVEA 5HYMA 4E5TA 1N62C 4H4WA 3FMWA 3P93A 4BV6A 4X9MA 5EB4A 5IQ4A 3BNMA 3DERA 2V61A 2B9YA 1VQZA 3ICRA 4K2SA 1DJNA 4YWOA 2YG4A 4B63A 2WPCA 4EQRA 4LA1A 3IJLA 4KT2A 1D7YA 3LXDA 3HW2A 1FECA 3N4EA 3EANA 3LZWA 5M0ZA 4H2PA 3T31A 3NT6A 3R25A 4E4FA 4OCGA 3VR9A 1PDZA 3F8RA 1FFUC 1ELSA 1GRHA 3HPFA 3L1RA 4IA6A 1LQTA 1W6TA 3JZUA 2P88A 2V60A 4WCTA 2X3NA 3KUMA 3JW7A 2XLTA 1T3QC 3UTHA 2MUCA 2H88A 1FCDA 1E1LA 3DDMA 3CGDA 1ONEA 3AEGA 4U2LA 1GALA 4LIIA 1TDNA 4JQ9A 2GGIA 3FCPA 3FJ4A 4BJYA 2E1MA 4B66A 2OA1A 1PHHA 2PTYA 2ZC8A 3A7UA 4FX9A 5BOFA 1GRTA 1L9CA 2B7RA 2Y6RA 2PP3A 2O9ZA 2GRTA 1PJ7A 3DG6A 3AEBA 3HRDC 4E6MA 1H2IA 4YWSA 5KVIA 4J31A 1N5WC 2OZTA 2QJJA 1IYXA 3BOXA 2C67A 2XVFA 2VOUA 3NVVB 1B4VA 2OAMA 1ZOVA 3AD9B 3TJIA 1SEZA 3PG6A 1FHUA 2C3CA 2WPFA 4H2HA 1M6IA 2CFYA 3VFCA 1X2GA 2QJNA 3CXOA 4U8JA 1ZXIC 1XPQA 2EQ7A 3CMMA 1XS2A 5KOWA 1FFVC 4ZN0A 1E9IA 1ZY8A 4GFIA 3U4FA 3SN4A 3E1TA 5JCLA 2FJDA 1EBDA 3PWGA 2BXRA 2EQ8A 4A6NB 3SJNA 2CULA 3P0WA 4H4YA 3MY9A 3EKGA 4HCLA 5JCKA 4J36A 2VQBA 3NRZB 5LV9A 3GMCA 4HCDA 3LOVA 3SZWA 2PODA 3FVDA 4FP1A 2W0HA 4TVYA 3BHFA 2ZZCA 3AYJA 2RGOA 1KD0A 3AE5A 4MJWA 3GO2A 4KPLA 3AD8B 3SGLA 3NVWB 3D47A 1PS9A 1Y56B 4H4SA 1EC8A 4DHGA 2FJAA 3BI5A 2VVLA 3S61A 3WE0A 3AEFA 4MMWA 1FEAA 4MKSA 2P3ZA 5KWFA 3T9PA 3FG2P 2TMDA 1BGNA 2WS3A 1Z6LA 4FK1C 2MNRA 2HZGA 4HCHA 3I6EA 2Z5YA 4A6NA 3L8KA 1VG9A 3FYYA 4CY8A 5KOXA 2WEUA 1NHQA 2E3TA 1SB3B 1E7PA 3REDA 2PPGA 4EQXA 1JEHA 1Q9IA 4GISA 3AEEA 3CB3A 4LU6A 6ENLA 2BS4A 3NFUA 4H4XA 3K7TA 1JRPA 2Q0LA 4XXGA 3VRAA 3N6HA 1ONFA 3NKSA 3UXLA 4ADWA 2AR8A 4Z17A 3UCLA 3TOYA 3T2ZA 4GR1A 1K0LA 3EPTA 4K8DA 3SY4A 4ENLA 2BK3A 3ALLA 2DKIA 4NZHA 3I6TA 1E1NA 2PTXA 2Z5XA 4K7ZA 3CAWA 4A5LA 4U8KA 3G5SA 4OPGA 3S5WA 1CJ2A 3G5QA 4AOSA 3AE4A 3D46A 3RRAA 2YG5A 3I6DA 1PBEA 5EU9A 2GF3A 3UXKA 2C70A 3HYWA 3V76A 4Y4NA 4EWJA 4ICYA 3GWFA 3ATRA 3UOZA 3GWDA 3RR1A 1ZP0A 3D9XA 3C96A 2ZBWA 5FS6A 4IV9A 3BSMA 4U8MA 3JVAA 1OJ9A 3GYXA 4GAPA 2PGEA 4DX3A 2RDXA 3RP8A 4B64A 4EM4A 1EBHA 3LADA 4TM4A 1AOGA 4YSXA 4A7AA 4GGBA 1EBGA 4A6GA 3SQPA 4JDRA 2ZZ0A 5L46A 3AE6A 4O5UA 1CJ4A 3VC6A 2OALA 1TYTA 3NYFA 3AEAA 1GRGA 3TWAA 3GRTA 4GYPC 3AE7A 3UOVA 2J3NA 3HYXA 4G6HA 3S47A 4NNJA 1CF3A 3QVRA 1H82A 1BF3A 5HXIA 1JOAA 2E4GA 4X4JA 2PCEA 5BUKA 2A89A 1SJAA 4C3YA 1JNZA 3CNTA 3BI2A 2Y6QA 1IUWA 3C4NA 1FOHA 2X8HA 2CHRA 2OFJA 2GQFA 2YVJA 2RGHA 3UKFA 2WQYA 3AYIA 4X2PA 4JNQA 1LTXR 3O0HA 3T6CA 3VDGA 3BJSA 3I4KA 1NENA 5M10A 4H83A 3FV9A 3ENLA 1YQZA 3R10A 1FO4A 2XLSA 3CT2A 4TM1A 1JRYA 2WU5A 4D04A 3PS9A 4M6UA 4JNAA 3ATQA 3R11A 1PBFA 1Q1RA 3DK9A 2I5QA 1XDIA 2BS3A 3AWIA 1ZMDA 2TPRA 2GB0A 1RSGA 4A99A 3CGCA 4EM3A 2WOWA 2OG9A 5GSNA 2YWLA 1COYA 1DOBA 1YKJA 4H4ZA 3CK5A 5FJUA 2XCGA 5J60A 1KN0A 3SXIA 3PFRA 2WPEA 3NS1B 4G9KA 2QA2A 4TLZA 3GDNA 2PSNA 3UKQA 3AD7B 1PBCA 2OO6A 3V3WA 3RCYA 3GD6A 3P4PA 2XLRA 2R4JA 2QQ6A 2BRAA 4EIQA 4CBQA 3UJEA 1JPDX 4J1OA 1ECQA 3T0KA 1KCZA 3DJEA 2JBVA 3H8LA 3OW1A 5FS7A 3CPJG 1DXLA 2BRYA 2VRLA 3NXLA 1MDLA 4E8GA 4IL0A 1KKRA 5FJTA 4OPUA 2GVCA 5KXJA 2QGYA 1H81A 4ZA0A 1TKKA 3KD9A 2PP1A 3KPKA 2BK4A 1VRQB 3VRDB 1IUSA 3RP6A 2YLWA 4A35A 3S5SA 4U8OA 1GREA 3NH3X 3DK4A 1D7LA 3LJPA 2AL2A 1CBOA 4Z1YA 3NIXA 4DXKA 4RSLA 3A7RA 4F4RA 2AAQA 2C4CA 4HNCA 2JB2A 4NTDA 1BQGA 4K5SA 3UCDA 4CRTA 2BCPA 2OPJA 4HA6A 1DOEA 3QSSA 5BOEA 1ZX9A 3IK4A 2WOIA 2XFUA 3MQTA 1ZDLA 1X31B 4E0VA 1JRXA 3IWAA 4OPDA 5IDZA 2C7GA 3NYEA 4CNJA 2BACA 2APGA 1MOKA 4AT2A 2FJEA 2ACZA 1B5QA 1GRAA 1XHCA 3RGTA 2XFQA 1PDYA 3UJRA 2I0ZA 2DKHA 2QVHA 4APNA 3THUA 2C3DA 5JCNA 3UKAA 2NQLA 4HN8A 4ROPA 3AECA 3STPA 3DJDA 1EL5A 2WP5A 1EL8A 3AE1A 2GDQA 1E1KA 4A79A 4H2QA 1M64A 5C2TA 2GH5A 3GY1A 3UKKA 4I59A 3UCCA 4C5OA 4H4RA 3DEQA 1BZLA 4K2XA 3NRNA 3GMBA 1REOA 3V3OA 3T37A 4IVOB 1D5TA 2BK5A 1HYUA 2OLOA 3II4A 2EQ6A 2GGGA 1JNRA 2QA1A 2VVLG 1TDKA 3CNDA 2GQWA 2YLTA 2R0CA 3UTFA 3DH9A 4H4PA 4IP4A 3SYIA 1K0IA 4Z44A 5G5GB 3NLCA 2UZZA 2YLSA 4A65A 4TM3A 3B9JB 3TQPA 1H84A 3R0UA 4JN8A 2A87A 1KNPA 3QN3A 2WU2A 2V3AA 1EL7A 5KVHA 4HPNA 2XVHA 3DJGX 2FKPA 1NAAA 4DNAA 1PDHA 2WBAA 2R4EA 1NELA 2GR1A 5IQ1A 4KPRA 4K8GA 2BABA 1N4UA 2WDVA 4C77A 4B67A 2BXSA 1GOSA 3EAOA 3P4RA 1QO8A 2QCUA 3PK7A 5BVAA 2B76A 1CC6A 1NEKA 2YM1A 1DOCA 4YT0A 2XH7A 3N6JA 4DWDA 1N61C 2RGJA 3UKPA 1TE6A 4H7UA 3UOXA 3VA8A 1RM6B 2W55A 3FPZA 2A8XA 3ZVHA 3SR6B 1QLBA 4H4VA 4Z2UA 4BJZA 1IUUA 3ALJA 3DGBA 2HXTA 4YKGA 1RYIA 2XH0A 3HZLA 2IIDA 5FJOA 1JRZA 4AOXA 1PBDA 2PGWA 3AXBA 4G73A 4IL2A 7ENLA 1YQ4A 3KLJA 3Q4DA 1CL0A 2Q6UA 4JY2A 2QAEA 3T2KA 2IVDA 3BHKA 4GRTA 4EIPA 3IF9A 3IHMA 5KMRA 5EOWA 1K4QA 3ES7A 4GCMA 3IC9A 1NPXA 4TM0A 2GAGB 3GC2A 4JN9A 3FBSA 3CXBA 3ICTA 5G5HB 3ZVIA 4KWSA 3B6DA 4H2RA 4G8TA 2ONEA 4H1ZA 1L8PA 3OP2A 4A3RA 4UDRA 4J57A 3P1WA 3R9UA 2CVJA 1P2HA 4NEWA 3DG3A 1IJHA 2VZ2A 3V3NA 2AQJA 3SN1A 2BA9A 3LB8A 1SJCA 1OJCA 3DFYA 1MRAA 2YVFA 2FBWA 4GUVA 3OZ2A 1IUXA 5KNLA 1V97A 1F9CA 4HB9A 1GSNA 4JHMA 3ZLFA 4AT0A 3Q6JA 1DODA 1VQWA 1Y56A 2OVLA 1CC4A 4XWRA 4C3XA 4YTPA 2FJBA 4CY6A 4I58A 2XVEA 4USQA 1JPMA 1QJDA 2F5ZA 3SBFA 3SFDA 1YQ3A 4HNLA 2B9WA 1LV0A 1YY5A 4B68A 5FS8A 5U1OA 2R0PA 3URHA 3JSKA 2X8GA 4KEMA 1XPYA 3R07C 2HXUA 1OJTA 2PA6A 2XFPA 3CNSA 3LZXA 2X99A 5C3JA 3IJIA 2XVJA 3VQRA 3UTEA 1MNSA 4OPTA 3DGHA 4NTEA 2VQ7A 4YSYA 3R0KA 3KPFA 4U2SA 3DJJA 2XVIA 2JK6A 4IVMB 4J56A 2JB3A 2RABA 2P8CA 4IT1A 2AKMA 3H70A 5IPYA 1S7MA 5FJPA 1Q1WA 3SX6A 3SZ0A 5ENLA 1W4XA 3P4QA 2V3BA 2GR3A 3QFAA 3TCSA 3QJ4A 4CCRA 1ZK7A 1ELIA 2R45A 3ETRB 3QLDA 1N5XA 1VG0A 5EBKA 3T14A 1MUCA 3QTPA 1LJ1A 1FIQB 1GTEA 1IUTA 1D4CA 2C72A 1TYPA 2O56A 3K7MX 3NK1X 2P8BA 1JU2A 2YQUA 3ZLGA 1DJQA 5FS9A 4GAVA 1F8RA 4B1BA 4K1WA 2W3SA 1CJCA 4II3A 3N4FA 1NHRA 4YTNA 3MKCA 3NO1A 3M13A 5KMPA 3B97A 3NN6X 2H89A 3C4AA 3SM8A 1O5WA 2JB1A 4NEVA 4B65A 3CPIG 1L9DA 3ALMA 2GAHB 3VCCA 4H4QA 4GIRA 1PXCA 2WDRA 2Q0KA 2WOVA 5HHFA 5U63A 3NK0X 3H12A 3NTAA 1N4VA 1YEYA 3OZYA 4EQWA 4C74A 4NWZA 3RNMA 2C65A 1GESA 3K1GA 4Z2TA 3ISHA 3KU9A 2GR2A 2X50A 2OX4A 2AL1A 3V5FA 1S3EA 1F3PA 3EF6A 4FDCB 1RP0A 2JKCA 4PAAA 2YR4A 3F8DA 3GYIA 4K5RA 2WDQA 1F8WA 4D03A 3TWBA 1UKVG 4U2TA 4NTCA 2QDDA 3QSMA 3VR8A 1ZKQA 1D4DA 2GGEA 3ES8A 1CC2A 3AMZA 2POZA 1E1MA 3HYVA 4GGHA 1H86A 4J34A 3BNUA 1XANA 2PS2A 3AE3A 4H50A 4AP3A 1WYGA 4X9NA 3CGEA 2V5ZA 1EL9A 1LQUA 1BWCA 5CQFA 4H4UA 2GV8A 4J2WA 1GT8A 3QKEA 1LPFA 4IZGA 3NNEA 4AP1A 2GSHA 3GD3A 3DG7A 4ZCWA 3VC5A 3IJQA 1NG4A 1F6MA 5FMHA 3CNPA 1OJDA 2DW6A 3K7QX 3QPEA 2GMJA 4USRA 1S2QA 2R46A 2W3RA 3B3RA 2E5VA 3NK2X 3QVPA 3M12A 2HNEA 3OZMA 5BULA 3D1CA 1NU5A 2YAUA 4GMEA 3UKHA 2XH4A 2WETA 3GSIA 1N60C 4EMIA 3SFEA 3U9IA 3ADAB 1PXBA 3P9UA 2OKTA 3ICSA 3H4KA 2BC1A 1KKOA 5EB5A 2GEWA 4UP3A 5J04A 1NG3A 2GR0A 1GRBA 4YSHA 3L5OA 2XFNA 3P4SA 2WHDA 1N1PA 4U8NA 1V59A 1PBBA 3OPSA 1PXAA 1Y0PA 5FJRA 3RP7A 5JCIA 1JROA 4K22A 2R0GA 3M0OA 2VVMA 3T8QA 1CHUA 3FXGA 2XDOA 4ZOHB 3CIRA 4G6GA 3EEZA 4IP5A 3I3LA 1EC7A 1O94A 3AB1A 1GRFA 1H83A 2R9ZA 2PU1A 3GDPA 1SJBA 1TDOA 3IHGA 1MO9A 4RG3A 4EQSA 3DIPA 4O5QA 4Z43A 4Z24A 5HY5A 3NHOX 4KX6A 2YG3A 3CPHG 1DNCA 3ZLHA 3DGZA 3UJFA 3TJ4A 3DMEA 2C64A 3K30A 5U25A 2P0IA 4E4UA 4II2A 3QFBA 3P3BA 3UTGA 1JDFA 1B8SA 2ZZBA 2YR5A 3ITJA 3CGBA 1F8SA 1EC9A 3AN1A 1GTHA 3AE8A 4Y4MA 3A7AA 3EUB3 2C76A 1H6VA 4ECHA 2C75A 3PVCA 1GV4A 3TW9A 4RG4A 4PABA 3SZFA 3GYJA 2XLPA 2WESA 2YLZA 3UP5A 4Z25A 1P43A 1TRBA 4J33A 3UOYA 2XFOA 1OEPA 3KVEA 3NVYB 1SJDA 2FYMA 1GXFA 3R1ZA 5ER0A 1PN0A 3Q45A 3NYCA 5J7XA 1LVLA 1P48A 2BYBA 4XWZA 4A9WA 1ZOYA 4BURA 2E5AA 4OVIA 1GEUA 2OQHA 4ZCCA 1GNDA 4WX1A 2Q7VA 1MDRA 4H2NA 1STZA 2DW7A 5KMQA 2ZADA 1WUEA 2OQYA 3F8PA 3AYLA 2X8CA 2B7SA 1KSUA 2YVGA 3DESA 2PTWA 1KFYA 4CCQA 2GMHA 2YM2A 4P9SA 1GETA 3SSZA 2YG7A 3BI4A 4M52A 2PU0A 1X2HA 3CTYA 1NDAA 1S2YA 3AEDA 3DK8A 1O95A 3MUCA 1E6EA 4Z2RA 2BCGG 5TR3A 4M0XA 4U8PA 4GDEA 4DYEA 1R6WA 4G7FA 4OPIA 1NHPA 2V6OA 1N4WA 1VDCA 4TVWA 3NG7X 4B69A 1GERA 4BK1A 1DTNA 3KA7A 2YLRA 3H8IA 2XLUA 3UGVA 4FK1A 1FEBA 2BC0A 3RITA 3CNJA 4OPLA 1BKHA 3G5RA 4YTMA 2NVKX 4EMWA 1NHSA 1RVKA 4H4TA 4G74A 3SQSA 2WP9A 3DFHA 2YLXA 4YSZA 3GD4A 4JY3A 4OPCA 3Q9TA 3SN0A 2HQMA 4Y4LA 2ARDA 5KRQA 4IA5A 2XH2A 4REKA 1L9EA 3UJSA 2GL5A 3ABVA 3ZVHB
chains in the Genus database with same CATH topology
2Z5YA 1BZLA 4K2XA 4EMJA 4ZCDA 4A6NA 3KU9A 3VRBA 3L8KA 3NRNA 1L0VA 2GR2A 3GMBA 1OJAA 1REOA 1VG9A 2JAEA 3V3OA 5JRBA 2X50A 1S3EA 4CY8A 3T37A 5KOXA 1F3PA 2WEUA 1K0JA 4IVOB 1D5TA 3EF6A 1NHQA 1HYUA 4FDCB 1RP0A 2BK5A 5BRTA 2JKCA 2OLOA 1E7PA 3II4A 4PAAA 3REDA 4YKGA 2EQ6A 4EQXA 1JNRA 2QA1A 1JEHA 2VVLG 2YR4A 1TDKA 3CNDA 2WDQA 3F8DA 1Q9IA 2GQWA 2YLTA 3AEEA 2R0CA 1F8WA 4LU6A 4D03A 3AE2A 1H7WA 3UTFA 2PYXA 1D4EA 3DH9A 1UKVG 4U2TA 4H4PA 2BS4A 4NTCA 3SYIA 1K0IA 3QSMA 4Z44A 3DA1A 3VR8A 1ZKQA 4H4XA 3K7TA 1D4DA 3NLCA 2Q0LA 4XXGA 3VRAA 1KF6A 2UZZA 2CDUA 1ONFA 1CC2A 2YLSA 4A65A 1E1MA 3HYVA 4TM3A 1H86A 3NKSA 3NGCX 4J34A 4ADWA 3QSEA 3BNUA 1XANA 2AR8A 3AE3A 4H50A 2YG6A 4AP3A 4X9NA 1PJ5A 1IUVA 3UCLA 3CGEA 2V5ZA 1EL9A 1H84A 1BWCA 4GR1A 1LQUA 4UDQA 5CQFA 3T2ZA 1K0LA 4H4UA 2GV8A 3EPTA 4K8DA 4J2WA 2A87A 3SY4A 3ZYXA 3T2YA 1GT8A 1LPFA 2BK3A 1KNPA 3NNEA 3ALLA 3COXA 2DKIA 4AP1A 2WU2A 5CKUA 2WP6A 5JCMA 2V3AA 3GD3A 1EL7A 4NZHA 5KVHA 4N9XA 1BKWA 1E1NA 2Z5XA 4GDPA 1NG4A 4K7ZA 1F6MA 5FMHA 2XVHA 3DJGX 3CNPA 4A5LA 3UP4A 1OJDA 1NAAA 4U8KA 4DNAA 3G5SA 3ZDNA 1H7XA 3K7QX 1B37A 1TDFA 4OPGA 1PDHA 2WBAA 1S2QA 2GMJA 1CJ2A 2R46A 2R4EA 4USRA 3S5WA 3G5QA 4AOSA 3AE9A 3AE4A 4U8LA 3B3RA 2GR1A 2E5VA 5IQ1A 4KPRA 3NK2X 2VRMA 2C66A 3QVPA 2BABA 1GPEA 2YG5A 1N4UA 3M12A 2WDVA 5KMSA 3I6DA 5BULA 4C77A 4B67A 3D1CA 2BXSA 1GOSA 1PBEA 2YAUA 3EAOA 1S3BA 2GF3A 4YXDA 2C70A 3HYWA 3P4RA 3UKHA 1QO8A 2QCUA 3V76A 2WETA 2EQ9A 5BVAA 3CN8A 3GRSA 1TDEA 4CNKA 2B76A 4DGKA 1CC6A 1NEKA 2YM1A 3GSIA 4Y4NA 3SFEA 4EMIA 4DSHA 4ICYA 3GWFA 3ATRA 1DOCA 3UOZA 4YT0A 3ADAB 3GWDA 1ZP0A 1PXBA 4BK2A 2RGJA 3FIMB 3P9UA 3ICSA 3H4KA 3D8XA 3UKPA 3D9XA 3NTDA 3C96A 2BC1A 5EB5A 2C73A 2ZBWA 5FS6A 3UKLA 4IV9A 2GEWA 4UP3A 1FL2A 4U8MA 2PHHA 1OJ9A 3GYXA 4GAPA 4H7UA 3UOXA 1NG3A 2GR0A 3RP8A 4B64A 4EM4A 3LADA 1GRBA 4YSHA 4TM4A 3L5OA 1AOGA 4YSXA 2XFNA 3RHAA 3P4SA 2WHDA 4GF7A 4A7AA 3FPZA 2A8XA 1N1PA 4Z26A 3SQPA 4BK3A 1ZMCA 4U8NA 1V59A 1PBBA 4TLXA 1PXAA 5GRTA 3PO7A 1QLBA 1Y0PA 4DSGA 4H4VA 4JDRA 2ZZ0A 4Z2UA 4BJZA 1BGJA 1IUUA 1P2EA 5L46A 3ALJA 3AE6A 3RP7A 5JCIA 3KKJA 1PJ6A 3OC4A 1KNRA 1KSSA 1CJ4A 1KDGA 1MXTA 4K22A 4O5UA 1RYIA 2B9XA 5DBJA 2OALA 1TYTA 2NPXA 2R0GA 3HZLA 2IIDA 3M0OA 3NYFA 3AEAA 4UDPA 2VVMA 1GRGA 2XYOA 1CHUA 1JRZA 3GRTA 3AE7A 4AOXA 2XDOA 2J3NA 3UOVA 3HYXA 4G6HA 1PBDA 3CIRA 4G6GA 4NNJA 3NN0X 1CF3A 3I3LA 3QVRA 1H82A 1O94A 3AB1A 3AXBA 1CJ3A 3SZCA 1GRFA 1BF3A 2R9ZA 1H83A 4G73A 4YKFA 3GDPA 1JOAA 1E39A 5HXIA 1YQ4A 4U8IA 3KLJA 2E4GA 1TDOA 1CL0A 2Q6UA 3IHGA 1MO9A 2BS2A 4X4JA 2OLNA 4RG3A 4EQSA 4JY2A 2YR6A 2IVEA 2QAEA 3T2KA 5BUKA 2IVDA 5HYMA 4O5QA 3BHKA 4Z43A 4Z24A 4H4WA 2A89A 3FMWA 4BV6A 4X9MA 4C3YA 3NHOX 1JNZA 3CNTA 4GRTA 5EB4A 4EIPA 3IF9A 3IHMA 4KX6A 5IQ4A 3BNMA 3BI2A 5KMRA 5EOWA 1K4QA 2YG3A 3CPHG 4GCMA 5HY5A 3IC9A 1NPXA 4TM0A 2Y6QA 1IUWA 2GAGB 1DNCA 3C4NA 2V61A 1FOHA 2B9YA 4JN9A 3ICRA 3FBSA 2X8HA 1DJNA 3DGZA 2GQFA 3ICTA 2YVJA 2RGHA 4YWOA 2YG4A 3UKFA 4B63A 2WPCA 2WQYA 3AYIA 4JNQA 4EQRA 4LA1A 1LTXR 3DMEA 3O0HA 2C64A 3K30A 3B6DA 5U25A 4H2RA 1NENA 1D7YA 5M10A 1YQZA 3LXDA 1FECA 4II2A 3EANA 3LZWA 4UDRA 3QFBA 4J57A 5M0ZA 2XLSA 3P1WA 4H2PA 3T31A 3R9UA 2CVJA 3NT6A 1P2HA 4NEWA 4TM1A 3UTGA 1B8SA 4OCGA 2ZZBA 1JRYA 2YR5A 3ITJA 3CGBA 3VR9A 3F8RA 1F8SA 2WU5A 4D04A 3PS9A 1IJHA 2VZ2A 3ATQA 1PBFA 4JNAA 3V3NA 1Q1RA 2AQJA 1GRHA 3DK9A 1XDIA 1GTHA 2BA9A 2BS3A 3LB8A 3AE8A 3AWIA 1ZMDA 2TPRA 3L1RA 4Y4MA 4IA6A 1LQTA 1OJCA 2C76A 2GB0A 2V60A 4WCTA 1RSGA 2YVFA 2FBWA 2X3NA 1H6VA 3GYIA 4A99A 4GUVA 3CGCA 4EM3A 2XLTA 3OZ2A 1IUXA 4ECHA 2C75A 2WOWA 3PVCA 5KNLA 5GSNA 1GV4A 3UTHA 2YWLA 1COYA 1DOBA 2H88A 4RG4A 1YKJA 4PABA 4H4ZA 3SZFA 4HB9A 1FCDA 3GYJA 1GSNA 2XLPA 2WESA 2YLZA 5J60A 2XCGA 1E1LA 1KN0A 3UP5A 3CGDA 4Z25A 3AEGA 4U2LA 1TRBA 3SXIA 1GALA 4AT0A 4J33A 3Q6JA 3UOYA 2XFOA 1DODA 4LIIA 1TDNA 2WPEA 4JQ9A 1VQWA 3KVEA 4G9KA 2QA2A 4TLZA 4BJYA 2E1MA 4B66A 3GDNA 3UKQA 2OA1A 1GXFA 3AD7B 5ER0A 1Y56A 1PBCA 1CC4A 1PN0A 4XWRA 1PHHA 4C3XA 3P4PA 3NYCA 5J7XA 2XLRA 4YTPA 4FX9A 2R4JA 2FJBA 1LVLA 4CY6A 1GRTA 1L9CA 4I58A 2BRAA 4EIQA 4CBQA 2B7RA 2XVEA 2Y6RA 4USQA 2O9ZA 2GRTA 1PJ7A 1QJDA 2BYBA 3T0KA 4XWZA 4A9WA 2F5ZA 1ZOYA 3SFDA 1YQ3A 4BURA 4OVIA 1GEUA 3DJEA 2B9WA 1LV0A 4ZCCA 1YY5A 3AEBA 1GNDA 2JBVA 4K5RA 4B68A 5FS8A 5U1OA 2R0PA 4WX1A 2Q7VA 3URHA 3JSKA 2X8GA 1H2IA 3H8LA 4H2NA 5FS7A 3CPJG 5KMQA 5KVIA 4J31A 1DXLA 2BRYA 2VRLA 1OJTA 2C67A 2XVFA 2XFPA 3CNSA 2VOUA 3LZXA 4OPUA 2GVCA 2X99A 1B4VA 5KXJA 2OAMA 3F8PA 1H81A 5C3JA 1ZOVA 3AYLA 3KD9A 3KPKA 2BK4A 2XVJA 1VRQB 3VQRA 3VRDB 3UTEA 3AD9B 1IUSA 2X8CA 2B7SA 3RP6A 2YLWA 1KSUA 1SEZA 4OPTA 2YVGA 3DGHA 4U8OA 4NTEA 2VQ7A 1GREA 3PG6A 2WPFA 2C3CA 3NH3X 3KPFA 4YSYA 1M6IA 4U2SA 2CFYA 3DJJA 3DK4A 1D7LA 1KFYA 4CCQA 3LJPA 2GMHA 2YM2A 2XVIA 1CBOA 2JK6A 4U8JA 4IVMB 4P9SA 4J56A 2JB3A 1GETA 2RABA 1XPQA 2EQ7A 2YG7A 3BI4A 3CMMA 3NIXA 5IPYA 4RSLA 5KOWA 4M52A 4ZN0A 1S7MA 1Q1WA 3SX6A 3CTYA 1W4XA 3SZ0A 1ZY8A 1NDAA 3P4QA 1S2YA 2V3BA 2AAQA 2GR3A 3QFAA 2C4CA 3AEDA 3E1TA 1ZK7A 3QJ4A 1ELIA 4CCRA 3DK8A 5JCLA 2FJDA 1EBDA 2R45A 1O95A 1E6EA 2JB2A 4NTDA 2BXRA 1VG0A 4K5SA 5EBKA 3T14A 2BCPA 2EQ8A 2BCGG 4CRTA 4Z2RA 5TR3A 4A6NB 2CULA 1LJ1A 4U8PA 4GDEA 1GTEA 1IUTA 1D4CA 4H4YA 5JCKA 2C72A 4HA6A 1DOEA 1NHPA 2V6OA 1TYPA 1N4WA 2VQBA 3QSSA 4J36A 4OPIA 1VDCA 3GMCA 3NG7X 5LV9A 3K7MX 3LOVA 3NK1X 3SZWA 1ZX9A 4B69A 2WOIA 2XFUA 1GERA 1ZDLA 1JU2A 2YQUA 2W0HA 1X31B 4BK1A 4E0VA 1JRXA 3BHFA 3IWAA 4OPDA 3KA7A 1DJQA 5FS9A 2YLRA 3H8IA 1F8RA 4GAVA 2ZZCA 3AYJA 2XLUA 4B1BA 1CJCA 2RGOA 4II3A 2C7GA 4FK1A 3NYEA 3AE5A 1NHRA 1FEBA 4YTNA 4MJWA 2BC0A 4CNJA 2BACA 2APGA 1MOKA 3CNJA 4AT2A 3AD8B 4OPLA 3SGLA 3M13A 3G5RA 5KMPA 4YTMA 2NVKX 1PS9A 2ACZA 1B5QA 2FJEA 3NN6X 4EMWA 4H4SA 1GRAA 1Y56B 2H89A 3C4AA 1NHSA 1XHCA 3SM8A 1O5WA 2XFQA 2JB1A 4NEVA 4H4TA 4B65A 3CPIG 2FJAA 3BI5A 4G74A 2WP9A 2I0ZA 2YLXA 2DKHA 4YSZA 1L9DA 2VVLA 3ALMA 3S61A 4APNA 2GAHB 2C3DA 3WE0A 4H4QA 5JCNA 3AEFA 3GD4A 4JY3A 3UKAA 3AECA 4OPCA 3Q9TA 3DJDA 1PXCA 1FEAA 2HQMA 2WDRA 2Q0KA 5KWFA 2WOVA 1EL5A 2WP5A 1EL8A 3AE1A 5HHFA 5U63A 4Y4LA 3FG2P 3NK0X 1E1KA 2TMDA 2ARDA 4A79A 4H2QA 3NTAA 1M64A 5C2TA 2GH5A 1N4VA 4IA5A 5KRQA 1BGNA 2WS3A 1Z6LA 3UKKA 4FK1C 4EQWA 4REKA 4I59A 4C74A 1L9EA 4NWZA 3RNMA 2C65A 1GESA 4C5OA 3ABVA 4H4RA 4Z2TA 3ISHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5Y A;  1BZL A;  4K2X A;  4EMJ A;  4ZCD A;  4A6N A;  3KU9 A;  3VRB A;  3L8K A;  3NRN A;  1L0V A;  2GR2 A;  3GMB A;  1OJA A;  1REO A;  1VG9 A;  2JAE A;  3V3O A;  2X50 A;  1S3E A;  4CY8 A;  3T37 A;  5KOX A;  1F3P A;  2WEU A;  1K0J A;  4IVO B;  1D5T A;  3EF6 A;  1NHQ A;  1HYU A;  4FDC B;  1RP0 A;  2BK5 A;  5BRT A;  2JKC A;  2OLO A;  1E7P A;  3II4 A;  4PAA A;  3RED A;  4YKG A;  2EQ6 A;  4EQX A;  1JNR A;  2QA1 A;  1JEH A;  2VVL G;  2YR4 A;  1TDK A;  3CND A;  2WDQ A;  3F8D A;  1Q9I A;  2GQW A;  2YLT A;  3AEE A;  2R0C A;  1F8W A;  4LU6 A;  4D03 A;  3AE2 A;  1H7W A;  3UTF A;  2PYX A;  1D4E A;  3DH9 A;  1UKV G;  4U2T A;  4H4P A;  2BS4 A;  4NTC A;  1K0I A;  3QSM A;  4Z44 A;  3DA1 A;  3VR8 A;  1ZKQ A;  4H4X A;  3K7T A;  1D4D A;  3NLC A;  2Q0L A;  4XXG A;  3VRA A;  1KF6 A;  2UZZ A;  2CDU A;  1ONF A;  1CC2 A;  2YLS A;  4A65 A;  1E1M A;  4TM3 A;  1H86 A;  3NKS A;  3NGC X;  4J34 A;  4ADW A;  3QSE A;  3BNU A;  1XAN A;  2AR8 A;  3AE3 A;  4H50 A;  2YG6 A;  4AP3 A;  4X9N A;  1PJ5 A;  1IUV A;  3UCL A;  3CGE A;  2V5Z A;  1EL9 A;  1H84 A;  1BWC A;  4GR1 A;  1LQU A;  4UDQ A;  5CQF A;  1K0L A;  4H4U A;  2GV8 A;  3EPT A;  4K8D A;  4J2W A;  2A87 A;  3ZYX A;  1GT8 A;  1LPF A;  2BK3 A;  1KNP A;  3NNE A;  3ALL A;  3COX A;  2DKI A;  4AP1 A;  2WU2 A;  5CKU A;  2WP6 A;  5JCM A;  3GD3 A;  1EL7 A;  2V3A A;  4NZH A;  5KVH A;  4N9X A;  1BKW A;  1E1N A;  2Z5X A;  4GDP A;  1NG4 A;  4K7Z A;  1F6M A;  5FMH A;  2XVH A;  3DJG X;  3CNP A;  4A5L A;  3UP4 A;  1OJD A;  1NAA A;  4U8K A;  4DNA A;  3G5S A;  3ZDN A;  1H7X A;  3K7Q X;  1B37 A;  1TDF A;  4OPG A;  1PDH A;  2WBA A;  1S2Q A;  2GMJ A;  1CJ2 A;  2R46 A;  2R4E A;  4USR A;  3S5W A;  3G5Q A;  4AOS A;  3AE9 A;  3AE4 A;  4U8L A;  3B3R A;  2GR1 A;  2E5V A;  5IQ1 A;  4KPR A;  3NK2 X;  2VRM A;  2C66 A;  3QVP A;  2BAB A;  1GPE A;  2YG5 A;  1N4U A;  3M12 A;  2WDV A;  3I6D A;  5BUL A;  4C77 A;  4B67 A;  3D1C A;  2BXS A;  1GOS A;  1PBE A;  2YAU A;  3EAO A;  1S3B A;  2GF3 A;  4YXD A;  2C70 A;  3P4R A;  3UKH A;  1QO8 A;  2QCU A;  3V76 A;  2WET A;  2EQ9 A;  5BVA A;  3CN8 A;  3GRS A;  1TDE A;  4CNK A;  2B76 A;  4DGK A;  1CC6 A;  1NEK A;  2YM1 A;  3GSI A;  4Y4N A;  3SFE A;  4EMI A;  4DSH A;  4ICY A;  3GWF A;  3ATR A;  1DOC A;  3UOZ A;  4YT0 A;  3ADA B;  3GWD A;  1ZP0 A;  1PXB A;  4BK2 A;  2RGJ A;  3FIM B;  3P9U A;  3ICS A;  3H4K A;  3D8X A;  3UKP A;  3NTD A;  3C96 A;  2BC1 A;  5EB5 A;  2C73 A;  2ZBW A;  5FS6 A;  3UKL A;  4IV9 A;  2GEW A;  4UP3 A;  1FL2 A;  4U8M A;  2PHH A;  1OJ9 A;  4H7U A;  3UOX A;  1NG3 A;  2GR0 A;  3RP8 A;  4B64 A;  4EM4 A;  3LAD A;  1GRB A;  4YSH A;  4TM4 A;  1AOG A;  4YSX A;  2XFN A;  3RHA A;  3P4S A;  2WHD A;  4GF7 A;  4A7A A;  3FPZ A;  2A8X A;  1N1P A;  4Z26 A;  3SQP A;  4BK3 A;  1ZMC A;  4U8N A;  1V59 A;  1PBB A;  4TLX A;  1PXA A;  5GRT A;  3PO7 A;  1QLB A;  1Y0P A;  4DSG A;  4H4V A;  4JDR A;  2ZZ0 A;  4Z2U A;  4BJZ A;  1BGJ A;  1IUU A;  1P2E A;  5L46 A;  3ALJ A;  3AE6 A;  3RP7 A;  5JCI A;  3KKJ A;  1PJ6 A;  3OC4 A;  1KNR A;  1KSS A;  1CJ4 A;  1KDG A;  1MXT A;  4K22 A;  4O5U A;  1RYI A;  2B9X A;  5DBJ A;  2OAL A;  1TYT A;  2NPX A;  2R0G A;  3HZL A;  2IID A;  3M0O A;  3NYF A;  3AEA A;  4UDP A;  2VVM A;  1GRG A;  2XYO A;  1CHU A;  1JRZ A;  3GRT A;  3AE7 A;  4AOX A;  2XDO A;  2J3N A;  3UOV A;  1PBD A;  3CIR A;  3NN0 X;  1CF3 A;  3I3L A;  3QVR A;  1H82 A;  1O94 A;  3AB1 A;  3AXB A;  1CJ3 A;  1GRF A;  1BF3 A;  2R9Z A;  1H83 A;  4YKF A;  5HXI A;  3GDP A;  1JOA A;  1E39 A;  1YQ4 A;  4U8I A;  3KLJ A;  2E4G A;  1TDO A;  1CL0 A;  2Q6U A;  3IHG A;  1MO9 A;  2BS2 A;  4X4J A;  2OLN A;  4RG3 A;  4EQS A;  4JY2 A;  2YR6 A;  2IVE A;  2QAE A;  5HYM A;  5BUK A;  2IVD A;  4O5Q A;  3BHK A;  4Z43 A;  4Z24 A;  4H4W A;  2A89 A;  3FMW A;  4BV6 A;  4X9M A;  4C3Y A;  3NHO X;  1JNZ A;  3CNT A;  4GRT A;  5EB4 A;  4EIP A;  3IF9 A;  3IHM A;  4KX6 A;  5IQ4 A;  3BNM A;  3BI2 A;  5EOW A;  1K4Q A;  2YG3 A;  3CPH G;  4GCM A;  5HY5 A;  3IC9 A;  1NPX A;  4TM0 A;  2Y6Q A;  1IUW A;  2GAG B;  1DNC A;  3C4N A;  2V61 A;  1FOH A;  2B9Y A;  4JN9 A;  3ICR A;  3FBS A;  2X8H A;  1DJN A;  3DGZ A;  2GQF A;  3ICT A;  2YVJ A;  2RGH A;  4YWO A;  2YG4 A;  3UKF A;  4B63 A;  2WPC A;  2WQY A;  3AYI A;  4JNQ A;  4EQR A;  4LA1 A;  1LTX R;  3DME A;  3O0H A;  2C64 A;  3K30 A;  3B6D A;  5U25 A;  4H2R A;  1NEN A;  1D7Y A;  5M10 A;  1YQZ A;  3LXD A;  1FEC A;  3EAN A;  3LZW A;  4UDR A;  3QFB A;  4J57 A;  5M0Z A;  2XLS A;  3P1W A;  4H2P A;  3R9U A;  2CVJ A;  3NT6 A;  1P2H A;  4NEW A;  4TM1 A;  3UTG A;  1B8S A;  4OCG A;  2ZZB A;  1JRY A;  2YR5 A;  3ITJ A;  3CGB A;  3VR9 A;  3F8R A;  1F8S A;  2WU5 A;  4D04 A;  3PS9 A;  1IJH A;  2VZ2 A;  3ATQ A;  1PBF A;  4JNA A;  3V3N A;  1Q1R A;  2AQJ A;  1GRH A;  3DK9 A;  1XDI A;  1GTH A;  2BA9 A;  2BS3 A;  3LB8 A;  3AE8 A;  3AWI A;  1ZMD A;  2TPR A;  3L1R A;  4Y4M A;  4IA6 A;  1LQT A;  1OJC A;  2C76 A;  2GB0 A;  2V60 A;  4WCT A;  1RSG A;  2YVF A;  2FBW A;  2X3N A;  1H6V A;  3GYI A;  4A99 A;  4GUV A;  3CGC A;  4EM3 A;  2XLT A;  3OZ2 A;  1IUX A;  4ECH A;  2C75 A;  2WOW A;  3PVC A;  5GSN A;  1GV4 A;  3UTH A;  2YWL A;  1COY A;  1DOB A;  2H88 A;  4RG4 A;  1YKJ A;  4PAB A;  4H4Z A;  4HB9 A;  1FCD A;  3GYJ A;  1GSN A;  2XLP A;  2WES A;  2YLZ A;  5J60 A;  2XCG A;  1E1L A;  3UP5 A;  3CGD A;  4Z25 A;  3AEG A;  4U2L A;  1TRB A;  1GAL A;  4AT0 A;  4J33 A;  3Q6J A;  3UOY A;  2XFO A;  1DOD A;  4LII A;  1TDN A;  2WPE A;  4JQ9 A;  1VQW A;  3KVE A;  2QA2 A;  4TLZ A;  4BJY A;  2E1M A;  4B66 A;  3GDN A;  3UKQ A;  2OA1 A;  1GXF A;  3AD7 B;  5ER0 A;  1Y56 A;  1PBC A;  1CC4 A;  1PN0 A;  4XWR A;  1PHH A;  4C3X A;  3P4P A;  3NYC A;  5J7X A;  2XLR A;  4YTP A;  4FX9 A;  2R4J A;  2FJB A;  1LVL A;  4CY6 A;  1GRT A;  1L9C A;  4I58 A;  4EIQ A;  4CBQ A;  2B7R A;  2XVE A;  2Y6R A;  4USQ A;  2O9Z A;  2GRT A;  1PJ7 A;  1QJD A;  2BYB A;  4XWZ A;  4A9W A;  2F5Z A;  1ZOY A;  3SFD A;  1YQ3 A;  4BUR A;  4OVI A;  1GEU A;  3DJE A;  2B9W A;  1LV0 A;  4ZCC A;  1YY5 A;  3AEB A;  1GND A;  2JBV A;  4K5R A;  4B68 A;  5FS8 A;  5U1O A;  2R0P A;  4WX1 A;  2Q7V A;  3URH A;  3JSK A;  2X8G A;  3H8L A;  4H2N A;  5FS7 A;  3CPJ G;  5KVI A;  4J31 A;  1DXL A;  2VRL A;  1OJT A;  2C67 A;  2XVF A;  2XFP A;  3CNS A;  2VOU A;  3LZX A;  4OPU A;  2GVC A;  2X99 A;  1B4V A;  5KXJ A;  2OAM A;  3F8P A;  1H81 A;  5C3J A;  1ZOV A;  3AYL A;  3KD9 A;  2BK4 A;  2XVJ A;  1VRQ B;  3VQR A;  3VRD B;  3UTE A;  3AD9 B;  1IUS A;  2X8C A;  2B7S A;  3RP6 A;  2YLW A;  1KSU A;  1SEZ A;  4OPT A;  2YVG A;  3DGH A;  4U8O A;  4NTE A;  2VQ7 A;  1GRE A;  2WPF A;  2C3C A;  3NH3 X;  3KPF A;  4YSY A;  1M6I A;  4U2S A;  2CFY A;  3DJJ A;  3DK4 A;  1D7L A;  1KFY A;  4CCQ A;  3LJP A;  2GMH A;  2YM2 A;  2XVI A;  1CBO A;  2JK6 A;  4U8J A;  4IVM B;  4P9S A;  4J56 A;  2JB3 A;  1GET A;  2RAB A;  1XPQ A;  2EQ7 A;  2YG7 A;  3BI4 A;  3NIX A;  5IPY A;  4RSL A;  5KOW A;  4M52 A;  4ZN0 A;  1Q1W A;  3CTY A;  1W4X A;  1ZY8 A;  1NDA A;  3P4Q A;  1S2Y A;  2V3B A;  2AAQ A;  2GR3 A;  3QFA A;  3AED A;  3E1T A;  1ZK7 A;  3QJ4 A;  1ELI A;  4CCR A;  3DK8 A;  5JCL A;  2FJD A;  1EBD A;  2R45 A;  1O95 A;  1E6E A;  2JB2 A;  4NTD A;  2BXR A;  1VG0 A;  4K5S A;  5EBK A;  2BCP A;  2EQ8 A;  2BCG G;  4CRT A;  4Z2R A;  5TR3 A;  4A6N B;  2CUL A;  1LJ1 A;  4U8P A;  4GDE A;  1GTE A;  1IUT A;  1D4C A;  4H4Y A;  5JCK A;  2C72 A;  4HA6 A;  1DOE A;  1NHP A;  2V6O A;  1TYP A;  1N4W A;  2VQB A;  3QSS A;  4J36 A;  4OPI A;  1VDC A;  3GMC A;  3NG7 X;  5LV9 A;  3K7M X;  3LOV A;  3NK1 X;  4B69 A;  1ZX9 A;  2WOI A;  2XFU A;  1GER A;  1ZDL A;  1JU2 A;  2YQU A;  2W0H A;  1X31 B;  4BK1 A;  4E0V A;  1JRX A;  3BHF A;  3IWA A;  4OPD A;  3KA7 A;  1DJQ A;  5FS9 A;  2YLR A;  3H8I A;  1F8R A;  2ZZC A;  3AYJ A;  2XLU A;  4B1B A;  1CJC A;  2RGO A;  2C7G A;  4FK1 A;  3NYE A;  3AE5 A;  1NHR A;  1FEB A;  4YTN A;  4MJW A;  2BC0 A;  4CNJ A;  2BAC A;  2APG A;  1MOK A;  3CNJ A;  4AT2 A;  3AD8 B;  4OPL A;  3SGL A;  3M13 A;  3G5R A;  4YTM A;  2NVK X;  1PS9 A;  2ACZ A;  1B5Q A;  2FJE A;  3NN6 X;  4EMW A;  4H4S A;  1GRA A;  1Y56 B;  2H89 A;  3C4A A;  1NHS A;  1XHC A;  3SM8 A;  1O5W A;  2XFQ A;  2JB1 A;  4NEV A;  4H4T A;  4B65 A;  3CPI G;  2FJA A;  3BI5 A;  2WP9 A;  2I0Z A;  2YLX A;  2DKH A;  4YSZ A;  1L9D A;  2VVL A;  3ALM A;  3S61 A;  4APN A;  2GAH B;  2C3D A;  3WE0 A;  4H4Q A;  5JCN A;  3AEF A;  3GD4 A;  4JY3 A;  3UKA A;  3AEC A;  4OPC A;  3Q9T A;  3DJD A;  1PXC A;  1FEA A;  2HQM A;  2WDR A;  2Q0K A;  5KWF A;  2WOV A;  1EL5 A;  2WP5 A;  1EL8 A;  3AE1 A;  5HHF A;  5U63 A;  4Y4L A;  3FG2 P;  3NK0 X;  1E1K A;  2TMD A;  2ARD A;  4A79 A;  4H2Q A;  3NTA A;  1M64 A;  5C2T A;  2GH5 A;  1N4V A;  4IA5 A;  5KRQ A;  1BGN A;  2WS3 A;  1Z6L A;  3UKK A;  4FK1 C;  4EQW A;  4REK A;  4I59 A;  4C74 A;  1L9E A;  3RNM A;  2C65 A;  1GES A;  4C5O A;  3ABV A;  4H4R A;  4Z2T A;  3ISH A; 
#chains in the Genus database with same CATH topology
 4EMJ A;  4ZCD A;  3VRB A;  1L0V A;  1OJA A;  1FHV A;  2JAE A;  5JRB A;  3PWI A;  2PTZ A;  1K0J A;  3MSY A;  5BRT A;  3VCN A;  4FI4 A;  2XGZ A;  1WUF A;  3AE2 A;  1H7W A;  2PYX A;  1D4E A;  4H19 A;  3MWC A;  2GGH A;  2PMQ A;  1JCT A;  3DA1 A;  1KF6 A;  2CDU A;  4J3Z A;  3NGC X;  3QSE A;  3NZG A;  2YG6 A;  2OLA A;  1PJ5 A;  1IUV A;  1R0M A;  4UDQ A;  3ZYX A;  2QDE A;  3T2Y A;  2QJM A;  3COX A;  5CKU A;  2GGJ A;  2WP6 A;  5JCM A;  3NVZ B;  4N9X A;  1BKW A;  4GDP A;  3UP4 A;  4MGG A;  3ZDN A;  1H7X A;  1B37 A;  1TDF A;  2XSX A;  3TTE A;  3AE9 A;  3V4B A;  4U8L A;  2VRM A;  3CYJ A;  2C66 A;  5KMS A;  1GPE A;  1S3B A;  4YXD A;  3MZN A;  2EQ9 A;  3CN8 A;  3GRS A;  1TDE A;  4CNK A;  4DGK A;  4DSH A;  4JN7 A;  2AL2 B;  4BK2 A;  2W54 A;  3FIM B;  1TZZ A;  3D8X A;  3NTD A;  4GYP A;  3UKL A;  2C73 A;  1FL2 A;  3RO6 A;  2OZ8 A;  3V5C A;  2PHH A;  3RHA A;  4GF7 A;  3UJ2 A;  4Z26 A;  4BK3 A;  1ZMC A;  3OTR A;  4TLX A;  5GRT A;  3PO7 A;  4DSG A;  1BGJ A;  1P2E A;  3KKJ A;  1PJ6 A;  4HYR A;  2OZ3 A;  3OC4 A;  1KNR A;  1KSS A;  1KDG A;  1MXT A;  4IHC A;  4DN1 A;  2B9X A;  5DBJ A;  2NPX A;  1N63 C;  1VDV A;  4UDP A;  2XYO A;  3AM9 A;  2PP0 A;  2AKZ A;  3NN0 X;  3T4W A;  1CJ3 A;  3SZC A;  3H7V A;  4YKF A;  1E39 A;  4U8I A;  2BS2 A;  2OLN A;  3H8A A;  2YR6 A;  2IVE A;  5HYM A;  4E5T A;  1N62 C;  4H4W A;  3FMW A;  3P93 A;  4BV6 A;  4X9M A;  5EB4 A;  5IQ4 A;  3BNM A;  3DER A;  2V61 A;  2B9Y A;  1VQZ A;  3ICR A;  4K2S A;  1DJN A;  4YWO A;  2YG4 A;  4B63 A;  2WPC A;  4EQR A;  4LA1 A;  3IJL A;  4KT2 A;  1D7Y A;  3LXD A;  3HW2 A;  1FEC A;  3N4E A;  3EAN A;  3LZW A;  5M0Z A;  4H2P A;  3T31 A;  3NT6 A;  3R25 A;  4E4F A;  4OCG A;  3VR9 A;  1PDZ A;  3F8R A;  1FFU C;  1ELS A;  1GRH A;  3HPF A;  3L1R A;  4IA6 A;  1LQT A;  1W6T A;  3JZU A;  2P88 A;  2V60 A;  4WCT A;  2X3N A;  3KUM A;  3JW7 A;  2XLT A;  1T3Q C;  3UTH A;  2MUC A;  2H88 A;  1FCD A;  1E1L A;  3DDM A;  3CGD A;  1ONE A;  3AEG A;  4U2L A;  1GAL A;  4LII A;  1TDN A;  4JQ9 A;  2GGI A;  3FCP A;  3FJ4 A;  4BJY A;  2E1M A;  4B66 A;  2OA1 A;  1PHH A;  2PTY A;  2ZC8 A;  3A7U A;  4FX9 A;  5BOF A;  1GRT A;  1L9C A;  2B7R A;  2Y6R A;  2PP3 A;  2O9Z A;  2GRT A;  1PJ7 A;  3DG6 A;  3AEB A;  3HRD C;  4E6M A;  1H2I A;  4YWS A;  5KVI A;  4J31 A;  1N5W C;  2OZT A;  2QJJ A;  1IYX A;  3BOX A;  2C67 A;  2XVF A;  2VOU A;  3NVV B;  1B4V A;  2OAM A;  1ZOV A;  3AD9 B;  3TJI A;  1SEZ A;  3PG6 A;  1FHU A;  2C3C A;  2WPF A;  4H2H A;  1M6I A;  2CFY A;  3VFC A;  1X2G A;  2QJN A;  3CXO A;  4U8J A;  1ZXI C;  1XPQ A;  2EQ7 A;  3CMM A;  1XS2 A;  5KOW A;  1FFV C;  4ZN0 A;  1E9I A;  1ZY8 A;  4GFI A;  3U4F A;  3SN4 A;  3E1T A;  5JCL A;  2FJD A;  1EBD A;  3PWG A;  2BXR A;  2EQ8 A;  4A6N B;  3SJN A;  2CUL A;  3P0W A;  4H4Y A;  3MY9 A;  3EKG A;  4HCL A;  5JCK A;  4J36 A;  2VQB A;  3NRZ B;  5LV9 A;  3GMC A;  4HCD A;  3LOV A;  3SZW A;  2POD A;  3FVD A;  4FP1 A;  2W0H A;  4TVY A;  3BHF A;  2ZZC A;  3AYJ A;  2RGO A;  1KD0 A;  3AE5 A;  4MJW A;  3GO2 A;  4KPL A;  3AD8 B;  3SGL A;  3NVW B;  3D47 A;  1PS9 A;  1Y56 B;  4H4S A;  1EC8 A;  4DHG A;  2FJA A;  3BI5 A;  2VVL A;  3S61 A;  3WE0 A;  3AEF A;  4MMW A;  1FEA A;  4MKS A;  2P3Z A;  5KWF A;  3T9P A;  3FG2 P;  2TMD A;  1BGN A;  2WS3 A;  1Z6L A;  4FK1 C;  2MNR A;  2HZG A;  4HCH A;  3I6E A;  2Z5Y A;  4A6N A;  3L8K A;  1VG9 A;  3FYY A;  4CY8 A;  5KOX A;  2WEU A;  1NHQ A;  2E3T A;  1SB3 B;  1E7P A;  3RED A;  2PPG A;  4EQX A;  1JEH A;  1Q9I A;  4GIS A;  3AEE A;  3CB3 A;  4LU6 A;  6ENL A;  2BS4 A;  3NFU A;  4H4X A;  3K7T A;  1JRP A;  2Q0L A;  4XXG A;  3VRA A;  3N6H A;  1ONF A;  3NKS A;  3UXL A;  4ADW A;  2AR8 A;  4Z17 A;  3UCL A;  3TOY A;  3T2Z A;  4GR1 A;  1K0L A;  3EPT A;  4K8D A;  3SY4 A;  4ENL A;  2BK3 A;  3ALL A;  2DKI A;  4NZH A;  3I6T A;  1E1N A;  2PTX A;  2Z5X A;  4K7Z A;  3CAW A;  4A5L A;  4U8K A;  3G5S A;  4OPG A;  3S5W A;  1CJ2 A;  3G5Q A;  4AOS A;  3AE4 A;  3D46 A;  3RRA A;  2YG5 A;  3I6D A;  1PBE A;  5EU9 A;  2GF3 A;  3UXK A;  2C70 A;  3HYW A;  3V76 A;  4Y4N A;  4EWJ A;  4ICY A;  3GWF A;  3ATR A;  3UOZ A;  3GWD A;  3RR1 A;  1ZP0 A;  3D9X A;  3C96 A;  2ZBW A;  5FS6 A;  4IV9 A;  3BSM A;  4U8M A;  3JVA A;  1OJ9 A;  3GYX A;  4GAP A;  2PGE A;  4DX3 A;  2RDX A;  3RP8 A;  4B64 A;  4EM4 A;  1EBH A;  3LAD A;  4TM4 A;  1AOG A;  4YSX A;  4A7A A;  4GGB A;  1EBG A;  4A6G A;  3SQP A;  4JDR A;  2ZZ0 A;  5L46 A;  3AE6 A;  4O5U A;  1CJ4 A;  3VC6 A;  2OAL A;  1TYT A;  3NYF A;  3AEA A;  1GRG A;  3TWA A;  3GRT A;  4GYP C;  3AE7 A;  3UOV A;  2J3N A;  3HYX A;  4G6H A;  3S47 A;  4NNJ A;  1CF3 A;  3QVR A;  1H82 A;  1BF3 A;  5HXI A;  1JOA A;  2E4G A;  4X4J A;  2PCE A;  5BUK A;  2A89 A;  1SJA A;  4C3Y A;  1JNZ A;  3CNT A;  3BI2 A;  2Y6Q A;  1IUW A;  3C4N A;  1FOH A;  2X8H A;  2CHR A;  2OFJ A;  2GQF A;  2YVJ A;  2RGH A;  3UKF A;  2WQY A;  3AYI A;  4X2P A;  4JNQ A;  1LTX R;  3O0H A;  3T6C A;  3VDG A;  3BJS A;  3I4K A;  1NEN A;  5M10 A;  4H83 A;  3FV9 A;  3ENL A;  1YQZ A;  3R10 A;  1FO4 A;  2XLS A;  3CT2 A;  4TM1 A;  1JRY A;  2WU5 A;  4D04 A;  3PS9 A;  4M6U A;  4JNA A;  3ATQ A;  3R11 A;  1PBF A;  1Q1R A;  3DK9 A;  2I5Q A;  1XDI A;  2BS3 A;  3AWI A;  1ZMD A;  2TPR A;  2GB0 A;  1RSG A;  4A99 A;  3CGC A;  4EM3 A;  2WOW A;  2OG9 A;  5GSN A;  2YWL A;  1COY A;  1DOB A;  1YKJ A;  4H4Z A;  3CK5 A;  5FJU A;  2XCG A;  5J60 A;  1KN0 A;  3SXI A;  3PFR A;  2WPE A;  3NS1 B;  4G9K A;  2QA2 A;  4TLZ A;  3GDN A;  2PSN A;  3UKQ A;  3AD7 B;  1PBC A;  2OO6 A;  3V3W A;  3RCY A;  3GD6 A;  3P4P A;  2XLR A;  2R4J A;  2QQ6 A;  2BRA A;  4EIQ A;  4CBQ A;  3UJE A;  1JPD X;  4J1O A;  1ECQ A;  3T0K A;  1KCZ A;  3DJE A;  2JBV A;  3H8L A;  3OW1 A;  5FS7 A;  3CPJ G;  1DXL A;  2BRY A;  2VRL A;  3NXL A;  1MDL A;  4E8G A;  4IL0 A;  1KKR A;  5FJT A;  4OPU A;  2GVC A;  5KXJ A;  2QGY A;  1H81 A;  4ZA0 A;  1TKK A;  3KD9 A;  2PP1 A;  3KPK A;  2BK4 A;  1VRQ B;  3VRD B;  1IUS A;  3RP6 A;  2YLW A;  4A35 A;  3S5S A;  4U8O A;  1GRE A;  3NH3 X;  3DK4 A;  1D7L A;  3LJP A;  2AL2 A;  1CBO A;  4Z1Y A;  3NIX A;  4DXK A;  4RSL A;  3A7R A;  4F4R A;  2AAQ A;  2C4C A;  4HNC A;  2JB2 A;  4NTD A;  1BQG A;  4K5S A;  3UCD A;  4CRT A;  2BCP A;  2OPJ A;  4HA6 A;  1DOE A;  3QSS A;  5BOE A;  1ZX9 A;  3IK4 A;  2WOI A;  2XFU A;  3MQT A;  1ZDL A;  1X31 B;  4E0V A;  1JRX A;  3IWA A;  4OPD A;  5IDZ A;  2C7G A;  3NYE A;  4CNJ A;  2BAC A;  2APG A;  1MOK A;  4AT2 A;  2FJE A;  2ACZ A;  1B5Q A;  1GRA A;  1XHC A;  3RGT A;  2XFQ A;  1PDY A;  3UJR A;  2I0Z A;  2DKH A;  2QVH A;  4APN A;  3THU A;  2C3D A;  5JCN A;  3UKA A;  2NQL A;  4HN8 A;  4ROP A;  3AEC A;  3STP A;  3DJD A;  1EL5 A;  2WP5 A;  1EL8 A;  3AE1 A;  2GDQ A;  1E1K A;  4A79 A;  4H2Q A;  1M64 A;  5C2T A;  2GH5 A;  3GY1 A;  3UKK A;  4I59 A;  3UCC A;  4C5O A;  4H4R A;  3DEQ A;  1BZL A;  4K2X A;  3NRN A;  3GMB A;  1REO A;  3V3O A;  3T37 A;  4IVO B;  1D5T A;  2BK5 A;  1HYU A;  2OLO A;  3II4 A;  2EQ6 A;  2GGG A;  1JNR A;  2QA1 A;  2VVL G;  1TDK A;  3CND A;  2GQW A;  2YLT A;  2R0C A;  3UTF A;  3DH9 A;  4H4P A;  4IP4 A;  3SYI A;  1K0I A;  4Z44 A;  5G5G B;  3NLC A;  2UZZ A;  2YLS A;  4A65 A;  4TM3 A;  3B9J B;  3TQP A;  1H84 A;  3R0U A;  4JN8 A;  2A87 A;  1KNP A;  3QN3 A;  2WU2 A;  2V3A A;  1EL7 A;  5KVH A;  4HPN A;  2XVH A;  3DJG X;  2FKP A;  1NAA A;  4DNA A;  1PDH A;  2WBA A;  2R4E A;  1NEL A;  2GR1 A;  5IQ1 A;  4KPR A;  4K8G A;  2BAB A;  1N4U A;  2WDV A;  4C77 A;  4B67 A;  2BXS A;  1GOS A;  3EAO A;  3P4R A;  1QO8 A;  2QCU A;  3PK7 A;  5BVA A;  2B76 A;  1CC6 A;  1NEK A;  2YM1 A;  1DOC A;  4YT0 A;  2XH7 A;  3N6J A;  4DWD A;  1N61 C;  2RGJ A;  3UKP A;  1TE6 A;  4H7U A;  3UOX A;  3VA8 A;  1RM6 B;  2W55 A;  3FPZ A;  2A8X A;  3ZVH A;  3SR6 B;  1QLB A;  4H4V A;  4Z2U A;  4BJZ A;  1IUU A;  3ALJ A;  3DGB A;  2HXT A;  4YKG A;  1RYI A;  2XH0 A;  3HZL A;  2IID A;  5FJO A;  1JRZ A;  4AOX A;  1PBD A;  2PGW A;  3AXB A;  4G73 A;  4IL2 A;  7ENL A;  1YQ4 A;  3KLJ A;  3Q4D A;  1CL0 A;  2Q6U A;  4JY2 A;  2QAE A;  3T2K A;  2IVD A;  3BHK A;  4GRT A;  4EIP A;  3IF9 A;  3IHM A;  5KMR A;  5EOW A;  1K4Q A;  3ES7 A;  4GCM A;  3IC9 A;  1NPX A;  4TM0 A;  2GAG B;  3GC2 A;  4JN9 A;  3FBS A;  3CXB A;  3ICT A;  5G5H B;  3ZVI A;  4KWS A;  3B6D A;  4H2R A;  4G8T A;  2ONE A;  4H1Z A;  1L8P A;  3OP2 A;  4A3R A;  4UDR A;  4J57 A;  3P1W A;  3R9U A;  2CVJ A;  1P2H A;  4NEW A;  3DG3 A;  1IJH A;  2VZ2 A;  3V3N A;  2AQJ A;  3SN1 A;  2BA9 A;  3LB8 A;  1SJC A;  1OJC A;  3DFY A;  1MRA A;  2YVF A;  2FBW A;  4GUV A;  3OZ2 A;  1IUX A;  5KNL A;  1V97 A;  1F9C A;  4HB9 A;  1GSN A;  4JHM A;  3ZLF A;  4AT0 A;  3Q6J A;  1DOD A;  1VQW A;  1Y56 A;  2OVL A;  1CC4 A;  4XWR A;  4C3X A;  4YTP A;  2FJB A;  4CY6 A;  4I58 A;  2XVE A;  4USQ A;  1JPM A;  1QJD A;  2F5Z A;  3SBF A;  3SFD A;  1YQ3 A;  4HNL A;  2B9W A;  1LV0 A;  1YY5 A;  4B68 A;  5FS8 A;  5U1O A;  2R0P A;  3URH A;  3JSK A;  2X8G A;  4KEM A;  1XPY A;  3R07 C;  2HXU A;  1OJT A;  2PA6 A;  2XFP A;  3CNS A;  3LZX A;  2X99 A;  5C3J A;  3IJI A;  2XVJ A;  3VQR A;  3UTE A;  1MNS A;  4OPT A;  3DGH A;  4NTE A;  2VQ7 A;  4YSY A;  3R0K A;  3KPF A;  4U2S A;  3DJJ A;  2XVI A;  2JK6 A;  4IVM B;  4J56 A;  2JB3 A;  2RAB A;  2P8C A;  4IT1 A;  2AKM A;  3H70 A;  5IPY A;  1S7M A;  5FJP A;  1Q1W A;  3SX6 A;  3SZ0 A;  5ENL A;  1W4X A;  3P4Q A;  2V3B A;  2GR3 A;  3QFA A;  3TCS A;  3QJ4 A;  4CCR A;  1ZK7 A;  1ELI A;  2R45 A;  3ETR B;  3QLD A;  1N5X A;  1VG0 A;  5EBK A;  3T14 A;  1MUC A;  3QTP A;  1LJ1 A;  1FIQ B;  1GTE A;  1IUT A;  1D4C A;  2C72 A;  1TYP A;  2O56 A;  3K7M X;  3NK1 X;  2P8B A;  1JU2 A;  2YQU A;  3ZLG A;  1DJQ A;  5FS9 A;  4GAV A;  1F8R A;  4B1B A;  4K1W A;  2W3S A;  1CJC A;  4II3 A;  3N4F A;  1NHR A;  4YTN A;  3MKC A;  3NO1 A;  3M13 A;  5KMP A;  3B97 A;  3NN6 X;  2H89 A;  3C4A A;  3SM8 A;  1O5W A;  2JB1 A;  4NEV A;  4B65 A;  3CPI G;  1L9D A;  3ALM A;  2GAH B;  3VCC A;  4H4Q A;  4GIR A;  1PXC A;  2WDR A;  2Q0K A;  2WOV A;  5HHF A;  5U63 A;  3NK0 X;  3H12 A;  3NTA A;  1N4V A;  1YEY A;  3OZY A;  4EQW A;  4C74 A;  4NWZ A;  3RNM A;  2C65 A;  1GES A;  3K1G A;  4Z2T A;  3ISH A;  3KU9 A;  2GR2 A;  2X50 A;  2OX4 A;  2AL1 A;  3V5F A;  1S3E A;  1F3P A;  3EF6 A;  4FDC B;  1RP0 A;  2JKC A;  4PAA A;  2YR4 A;  3F8D A;  3GYI A;  4K5R A;  2WDQ A;  1F8W A;  4D03 A;  3TWB A;  1UKV G;  4U2T A;  4NTC A;  2QDD A;  3QSM A;  3VR8 A;  1ZKQ A;  1D4D A;  2GGE A;  3ES8 A;  1CC2 A;  3AMZ A;  2POZ A;  1E1M A;  3HYV A;  4GGH A;  1H86 A;  4J34 A;  3BNU A;  1XAN A;  2PS2 A;  3AE3 A;  4H50 A;  4AP3 A;  1WYG A;  4X9N A;  3CGE A;  2V5Z A;  1EL9 A;  1LQU A;  1BWC A;  5CQF A;  4H4U A;  2GV8 A;  4J2W A;  1GT8 A;  3QKE A;  1LPF A;  4IZG A;  3NNE A;  4AP1 A;  2GSH A;  3GD3 A;  3DG7 A;  4ZCW A;  3VC5 A;  3IJQ A;  1NG4 A;  1F6M A;  5FMH A;  3CNP A;  1OJD A;  2DW6 A;  3K7Q X;  3QPE A;  2GMJ A;  4USR A;  1S2Q A;  2R46 A;  2W3R A;  3B3R A;  2E5V A;  3NK2 X;  3QVP A;  3M12 A;  2HNE A;  3OZM A;  5BUL A;  3D1C A;  1NU5 A;  2YAU A;  4GME A;  3UKH A;  2XH4 A;  2WET A;  3GSI A;  1N60 C;  4EMI A;  3SFE A;  3U9I A;  3ADA B;  1PXB A;  3P9U A;  2OKT A;  3ICS A;  3H4K A;  2BC1 A;  1KKO A;  5EB5 A;  2GEW A;  4UP3 A;  5J04 A;  1NG3 A;  2GR0 A;  1GRB A;  4YSH A;  3L5O A;  2XFN A;  3P4S A;  2WHD A;  1N1P A;  4U8N A;  1V59 A;  1PBB A;  3OPS A;  1PXA A;  1Y0P A;  5FJR A;  3RP7 A;  5JCI A;  1JRO A;  4K22 A;  2R0G A;  3M0O A;  2VVM A;  3T8Q A;  1CHU A;  3FXG A;  2XDO A;  4ZOH B;  3CIR A;  4G6G A;  3EEZ A;  4IP5 A;  3I3L A;  1EC7 A;  1O94 A;  3AB1 A;  1GRF A;  1H83 A;  2R9Z A;  2PU1 A;  3GDP A;  1SJB A;  1TDO A;  3IHG A;  1MO9 A;  4RG3 A;  4EQS A;  3DIP A;  4O5Q A;  4Z43 A;  4Z24 A;  5HY5 A;  3NHO X;  4KX6 A;  2YG3 A;  3CPH G;  1DNC A;  3ZLH A;  3DGZ A;  3UJF A;  3TJ4 A;  3DME A;  2C64 A;  3K30 A;  5U25 A;  2P0I A;  4E4U A;  4II2 A;  3QFB A;  3P3B A;  3UTG A;  1JDF A;  1B8S A;  2ZZB A;  2YR5 A;  3ITJ A;  3CGB A;  1F8S A;  1EC9 A;  3AN1 A;  1GTH A;  3AE8 A;  4Y4M A;  3A7A A;  3EUB 3;  2C76 A;  1H6V A;  4ECH A;  2C75 A;  3PVC A;  1GV4 A;  3TW9 A;  4RG4 A;  4PAB A;  3SZF A;  3GYJ A;  2XLP A;  2WES A;  2YLZ A;  3UP5 A;  4Z25 A;  1P43 A;  1TRB A;  4J33 A;  3UOY A;  2XFO A;  1OEP A;  3KVE A;  3NVY B;  1SJD A;  2FYM A;  1GXF A;  3R1Z A;  5ER0 A;  1PN0 A;  3Q45 A;  3NYC A;  5J7X A;  1LVL A;  1P48 A;  2BYB A;  4XWZ A;  4A9W A;  1ZOY A;  4BUR A;  2E5A A;  4OVI A;  1GEU A;  2OQH A;  4ZCC A;  1GND A;  4WX1 A;  2Q7V A;  1MDR A;  4H2N A;  1STZ A;  2DW7 A;  5KMQ A;  2ZAD A;  1WUE A;  2OQY A;  3F8P A;  3AYL A;  2X8C A;  2B7S A;  1KSU A;  2YVG A;  3DES A;  2PTW A;  1KFY A;  4CCQ A;  2GMH A;  2YM2 A;  4P9S A;  1GET A;  3SSZ A;  2YG7 A;  3BI4 A;  4M52 A;  2PU0 A;  1X2H A;  3CTY A;  1NDA A;  1S2Y A;  3AED A;  3DK8 A;  1O95 A;  3MUC A;  1E6E A;  4Z2R A;  2BCG G;  5TR3 A;  4M0X A;  4U8P A;  4GDE A;  4DYE A;  1R6W A;  4G7F A;  4OPI A;  1NHP A;  2V6O A;  1N4W A;  1VDC A;  4TVW A;  3NG7 X;  4B69 A;  1GER A;  4BK1 A;  1DTN A;  3KA7 A;  2YLR A;  3H8I A;  2XLU A;  3UGV A;  4FK1 A;  1FEB A;  2BC0 A;  3RIT A;  3CNJ A;  4OPL A;  1BKH A;  3G5R A;  4YTM A;  2NVK X;  4EMW A;  1NHS A;  1RVK A;  4H4T A;  4G74 A;  3SQS A;  2WP9 A;  3DFH A;  2YLX A;  4YSZ A;  3GD4 A;  4JY3 A;  4OPC A;  3Q9T A;  3SN0 A;  2HQM A;  4Y4L A;  2ARD A;  5KRQ A;  4IA5 A;  2XH2 A;  4REK A;  1L9E A;  3UJS A;  2GL5 A;  3ABV A;  3ZVH B; 
#chains in the Genus database with same CATH homology
 2Z5Y A;  1BZL A;  4K2X A;  4EMJ A;  4ZCD A;  4A6N A;  3KU9 A;  3VRB A;  3L8K A;  3NRN A;  1L0V A;  2GR2 A;  3GMB A;  1OJA A;  1REO A;  1VG9 A;  2JAE A;  3V3O A;  5JRB A;  2X50 A;  1S3E A;  4CY8 A;  3T37 A;  5KOX A;  1F3P A;  2WEU A;  1K0J A;  4IVO B;  1D5T A;  3EF6 A;  1NHQ A;  1HYU A;  4FDC B;  1RP0 A;  2BK5 A;  5BRT A;  2JKC A;  2OLO A;  1E7P A;  3II4 A;  4PAA A;  3RED A;  4YKG A;  2EQ6 A;  4EQX A;  1JNR A;  2QA1 A;  1JEH A;  2VVL G;  2YR4 A;  1TDK A;  3CND A;  2WDQ A;  3F8D A;  1Q9I A;  2GQW A;  2YLT A;  3AEE A;  2R0C A;  1F8W A;  4LU6 A;  4D03 A;  3AE2 A;  1H7W A;  3UTF A;  2PYX A;  1D4E A;  3DH9 A;  1UKV G;  4U2T A;  4H4P A;  2BS4 A;  4NTC A;  3SYI A;  1K0I A;  3QSM A;  4Z44 A;  3DA1 A;  3VR8 A;  1ZKQ A;  4H4X A;  3K7T A;  1D4D A;  3NLC A;  2Q0L A;  4XXG A;  3VRA A;  1KF6 A;  2UZZ A;  2CDU A;  1ONF A;  1CC2 A;  2YLS A;  4A65 A;  1E1M A;  3HYV A;  4TM3 A;  1H86 A;  3NKS A;  3NGC X;  4J34 A;  4ADW A;  3QSE A;  3BNU A;  1XAN A;  2AR8 A;  3AE3 A;  4H50 A;  2YG6 A;  4AP3 A;  4X9N A;  1PJ5 A;  1IUV A;  3UCL A;  3CGE A;  2V5Z A;  1EL9 A;  1H84 A;  1BWC A;  4GR1 A;  1LQU A;  4UDQ A;  5CQF A;  3T2Z A;  1K0L A;  4H4U A;  2GV8 A;  3EPT A;  4K8D A;  4J2W A;  2A87 A;  3SY4 A;  3ZYX A;  3T2Y A;  1GT8 A;  1LPF A;  2BK3 A;  1KNP A;  3NNE A;  3ALL A;  3COX A;  2DKI A;  4AP1 A;  2WU2 A;  5CKU A;  2WP6 A;  5JCM A;  2V3A A;  3GD3 A;  1EL7 A;  4NZH A;  5KVH A;  4N9X A;  1BKW A;  1E1N A;  2Z5X A;  4GDP A;  1NG4 A;  4K7Z A;  1F6M A;  5FMH A;  2XVH A;  3DJG X;  3CNP A;  4A5L A;  3UP4 A;  1OJD A;  1NAA A;  4U8K A;  4DNA A;  3G5S A;  3ZDN A;  1H7X A;  3K7Q X;  1B37 A;  1TDF A;  4OPG A;  1PDH A;  2WBA A;  1S2Q A;  2GMJ A;  1CJ2 A;  2R46 A;  2R4E A;  4USR A;  3S5W A;  3G5Q A;  4AOS A;  3AE9 A;  3AE4 A;  4U8L A;  3B3R A;  2GR1 A;  2E5V A;  5IQ1 A;  4KPR A;  3NK2 X;  2VRM A;  2C66 A;  3QVP A;  2BAB A;  1GPE A;  2YG5 A;  1N4U A;  3M12 A;  2WDV A;  5KMS A;  3I6D A;  5BUL A;  4C77 A;  4B67 A;  3D1C A;  2BXS A;  1GOS A;  1PBE A;  2YAU A;  3EAO A;  1S3B A;  2GF3 A;  4YXD A;  2C70 A;  3HYW A;  3P4R A;  3UKH A;  1QO8 A;  2QCU A;  3V76 A;  2WET A;  2EQ9 A;  5BVA A;  3CN8 A;  3GRS A;  1TDE A;  4CNK A;  2B76 A;  4DGK A;  1CC6 A;  1NEK A;  2YM1 A;  3GSI A;  4Y4N A;  3SFE A;  4EMI A;  4DSH A;  4ICY A;  3GWF A;  3ATR A;  1DOC A;  3UOZ A;  4YT0 A;  3ADA B;  3GWD A;  1ZP0 A;  1PXB A;  4BK2 A;  2RGJ A;  3FIM B;  3P9U A;  3ICS A;  3H4K A;  3D8X A;  3UKP A;  3D9X A;  3NTD A;  3C96 A;  2BC1 A;  5EB5 A;  2C73 A;  2ZBW A;  5FS6 A;  3UKL A;  4IV9 A;  2GEW A;  4UP3 A;  1FL2 A;  4U8M A;  2PHH A;  1OJ9 A;  3GYX A;  4GAP A;  4H7U A;  3UOX A;  1NG3 A;  2GR0 A;  3RP8 A;  4B64 A;  4EM4 A;  3LAD A;  1GRB A;  4YSH A;  4TM4 A;  3L5O A;  1AOG A;  4YSX A;  2XFN A;  3RHA A;  3P4S A;  2WHD A;  4GF7 A;  4A7A A;  3FPZ A;  2A8X A;  1N1P A;  4Z26 A;  3SQP A;  4BK3 A;  1ZMC A;  4U8N A;  1V59 A;  1PBB A;  4TLX A;  1PXA A;  5GRT A;  3PO7 A;  1QLB A;  1Y0P A;  4DSG A;  4H4V A;  4JDR A;  2ZZ0 A;  4Z2U A;  4BJZ A;  1BGJ A;  1IUU A;  1P2E A;  5L46 A;  3ALJ A;  3AE6 A;  3RP7 A;  5JCI A;  3KKJ A;  1PJ6 A;  3OC4 A;  1KNR A;  1KSS A;  1CJ4 A;  1KDG A;  1MXT A;  4K22 A;  4O5U A;  1RYI A;  2B9X A;  5DBJ A;  2OAL A;  1TYT A;  2NPX A;  2R0G A;  3HZL A;  2IID A;  3M0O A;  3NYF A;  3AEA A;  4UDP A;  2VVM A;  1GRG A;  2XYO A;  1CHU A;  1JRZ A;  3GRT A;  3AE7 A;  4AOX A;  2XDO A;  2J3N A;  3UOV A;  3HYX A;  4G6H A;  1PBD A;  3CIR A;  4G6G A;  4NNJ A;  3NN0 X;  1CF3 A;  3I3L A;  3QVR A;  1H82 A;  1O94 A;  3AB1 A;  3AXB A;  1CJ3 A;  3SZC A;  1GRF A;  1BF3 A;  2R9Z A;  1H83 A;  4G73 A;  4YKF A;  3GDP A;  1JOA A;  1E39 A;  5HXI A;  1YQ4 A;  4U8I A;  3KLJ A;  2E4G A;  1TDO A;  1CL0 A;  2Q6U A;  3IHG A;  1MO9 A;  2BS2 A;  4X4J A;  2OLN A;  4RG3 A;  4EQS A;  4JY2 A;  2YR6 A;  2IVE A;  2QAE A;  3T2K A;  5BUK A;  2IVD A;  5HYM A;  4O5Q A;  3BHK A;  4Z43 A;  4Z24 A;  4H4W A;  2A89 A;  3FMW A;  4BV6 A;  4X9M A;  4C3Y A;  3NHO X;  1JNZ A;  3CNT A;  4GRT A;  5EB4 A;  4EIP A;  3IF9 A;  3IHM A;  4KX6 A;  5IQ4 A;  3BNM A;  3BI2 A;  5KMR A;  5EOW A;  1K4Q A;  2YG3 A;  3CPH G;  4GCM A;  5HY5 A;  3IC9 A;  1NPX A;  4TM0 A;  2Y6Q A;  1IUW A;  2GAG B;  1DNC A;  3C4N A;  2V61 A;  1FOH A;  2B9Y A;  4JN9 A;  3ICR A;  3FBS A;  2X8H A;  1DJN A;  3DGZ A;  2GQF A;  3ICT A;  2YVJ A;  2RGH A;  4YWO A;  2YG4 A;  3UKF A;  4B63 A;  2WPC A;  2WQY A;  3AYI A;  4JNQ A;  4EQR A;  4LA1 A;  1LTX R;  3DME A;  3O0H A;  2C64 A;  3K30 A;  3B6D A;  5U25 A;  4H2R A;  1NEN A;  1D7Y A;  5M10 A;  1YQZ A;  3LXD A;  1FEC A;  4II2 A;  3EAN A;  3LZW A;  4UDR A;  3QFB A;  4J57 A;  5M0Z A;  2XLS A;  3P1W A;  4H2P A;  3T31 A;  3R9U A;  2CVJ A;  3NT6 A;  1P2H A;  4NEW A;  4TM1 A;  3UTG A;  1B8S A;  4OCG A;  2ZZB A;  1JRY A;  2YR5 A;  3ITJ A;  3CGB A;  3VR9 A;  3F8R A;  1F8S A;  2WU5 A;  4D04 A;  3PS9 A;  1IJH A;  2VZ2 A;  3ATQ A;  1PBF A;  4JNA A;  3V3N A;  1Q1R A;  2AQJ A;  1GRH A;  3DK9 A;  1XDI A;  1GTH A;  2BA9 A;  2BS3 A;  3LB8 A;  3AE8 A;  3AWI A;  1ZMD A;  2TPR A;  3L1R A;  4Y4M A;  4IA6 A;  1LQT A;  1OJC A;  2C76 A;  2GB0 A;  2V60 A;  4WCT A;  1RSG A;  2YVF A;  2FBW A;  2X3N A;  1H6V A;  3GYI A;  4A99 A;  4GUV A;  3CGC A;  4EM3 A;  2XLT A;  3OZ2 A;  1IUX A;  4ECH A;  2C75 A;  2WOW A;  3PVC A;  5KNL A;  5GSN A;  1GV4 A;  3UTH A;  2YWL A;  1COY A;  1DOB A;  2H88 A;  4RG4 A;  1YKJ A;  4PAB A;  4H4Z A;  3SZF A;  4HB9 A;  1FCD A;  3GYJ A;  1GSN A;  2XLP A;  2WES A;  2YLZ A;  5J60 A;  2XCG A;  1E1L A;  1KN0 A;  3UP5 A;  3CGD A;  4Z25 A;  3AEG A;  4U2L A;  1TRB A;  3SXI A;  1GAL A;  4AT0 A;  4J33 A;  3Q6J A;  3UOY A;  2XFO A;  1DOD A;  4LII A;  1TDN A;  2WPE A;  4JQ9 A;  1VQW A;  3KVE A;  4G9K A;  2QA2 A;  4TLZ A;  4BJY A;  2E1M A;  4B66 A;  3GDN A;  3UKQ A;  2OA1 A;  1GXF A;  3AD7 B;  5ER0 A;  1Y56 A;  1PBC A;  1CC4 A;  1PN0 A;  4XWR A;  1PHH A;  4C3X A;  3P4P A;  3NYC A;  5J7X A;  2XLR A;  4YTP A;  4FX9 A;  2R4J A;  2FJB A;  1LVL A;  4CY6 A;  1GRT A;  1L9C A;  4I58 A;  2BRA A;  4EIQ A;  4CBQ A;  2B7R A;  2XVE A;  2Y6R A;  4USQ A;  2O9Z A;  2GRT A;  1PJ7 A;  1QJD A;  2BYB A;  3T0K A;  4XWZ A;  4A9W A;  2F5Z A;  1ZOY A;  3SFD A;  1YQ3 A;  4BUR A;  4OVI A;  1GEU A;  3DJE A;  2B9W A;  1LV0 A;  4ZCC A;  1YY5 A;  3AEB A;  1GND A;  2JBV A;  4K5R A;  4B68 A;  5FS8 A;  5U1O A;  2R0P A;  4WX1 A;  2Q7V A;  3URH A;  3JSK A;  2X8G A;  1H2I A;  3H8L A;  4H2N A;  5FS7 A;  3CPJ G;  5KMQ A;  5KVI A;  4J31 A;  1DXL A;  2BRY A;  2VRL A;  1OJT A;  2C67 A;  2XVF A;  2XFP A;  3CNS A;  2VOU A;  3LZX A;  4OPU A;  2GVC A;  2X99 A;  1B4V A;  5KXJ A;  2OAM A;  3F8P A;  1H81 A;  5C3J A;  1ZOV A;  3AYL A;  3KD9 A;  3KPK A;  2BK4 A;  2XVJ A;  1VRQ B;  3VQR A;  3VRD B;  3UTE A;  3AD9 B;  1IUS A;  2X8C A;  2B7S A;  3RP6 A;  2YLW A;  1KSU A;  1SEZ A;  4OPT A;  2YVG A;  3DGH A;  4U8O A;  4NTE A;  2VQ7 A;  1GRE A;  3PG6 A;  2WPF A;  2C3C A;  3NH3 X;  3KPF A;  4YSY A;  1M6I A;  4U2S A;  2CFY A;  3DJJ A;  3DK4 A;  1D7L A;  1KFY A;  4CCQ A;  3LJP A;  2GMH A;  2YM2 A;  2XVI A;  1CBO A;  2JK6 A;  4U8J A;  4IVM B;  4P9S A;  4J56 A;  2JB3 A;  1GET A;  2RAB A;  1XPQ A;  2EQ7 A;  2YG7 A;  3BI4 A;  3CMM A;  3NIX A;  5IPY A;  4RSL A;  5KOW A;  4M52 A;  4ZN0 A;  1S7M A;  1Q1W A;  3SX6 A;  3CTY A;  1W4X A;  3SZ0 A;  1ZY8 A;  1NDA A;  3P4Q A;  1S2Y A;  2V3B A;  2AAQ A;  2GR3 A;  3QFA A;  2C4C A;  3AED A;  3E1T A;  1ZK7 A;  3QJ4 A;  1ELI A;  4CCR A;  3DK8 A;  5JCL A;  2FJD A;  1EBD A;  2R45 A;  1O95 A;  1E6E A;  2JB2 A;  4NTD A;  2BXR A;  1VG0 A;  4K5S A;  5EBK A;  3T14 A;  2BCP A;  2EQ8 A;  2BCG G;  4CRT A;  4Z2R A;  5TR3 A;  4A6N B;  2CUL A;  1LJ1 A;  4U8P A;  4GDE A;  1GTE A;  1IUT A;  1D4C A;  4H4Y A;  5JCK A;  2C72 A;  4HA6 A;  1DOE A;  1NHP A;  2V6O A;  1TYP A;  1N4W A;  2VQB A;  3QSS A;  4J36 A;  4OPI A;  1VDC A;  3GMC A;  3NG7 X;  5LV9 A;  3K7M X;  3LOV A;  3NK1 X;  3SZW A;  1ZX9 A;  4B69 A;  2WOI A;  2XFU A;  1GER A;  1ZDL A;  1JU2 A;  2YQU A;  2W0H A;  1X31 B;  4BK1 A;  4E0V A;  1JRX A;  3BHF A;  3IWA A;  4OPD A;  3KA7 A;  1DJQ A;  5FS9 A;  2YLR A;  3H8I A;  1F8R A;  4GAV A;  2ZZC A;  3AYJ A;  2XLU A;  4B1B A;  1CJC A;  2RGO A;  4II3 A;  2C7G A;  4FK1 A;  3NYE A;  3AE5 A;  1NHR A;  1FEB A;  4YTN A;  4MJW A;  2BC0 A;  4CNJ A;  2BAC A;  2APG A;  1MOK A;  3CNJ A;  4AT2 A;  3AD8 B;  4OPL A;  3SGL A;  3M13 A;  3G5R A;  5KMP A;  4YTM A;  2NVK X;  1PS9 A;  2ACZ A;  1B5Q A;  2FJE A;  3NN6 X;  4EMW A;  4H4S A;  1GRA A;  1Y56 B;  2H89 A;  3C4A A;  1NHS A;  1XHC A;  3SM8 A;  1O5W A;  2XFQ A;  2JB1 A;  4NEV A;  4H4T A;  4B65 A;  3CPI G;  2FJA A;  3BI5 A;  4G74 A;  2WP9 A;  2I0Z A;  2YLX A;  2DKH A;  4YSZ A;  1L9D A;  2VVL A;  3ALM A;  3S61 A;  4APN A;  2GAH B;  2C3D A;  3WE0 A;  4H4Q A;  5JCN A;  3AEF A;  3GD4 A;  4JY3 A;  3UKA A;  3AEC A;  4OPC A;  3Q9T A;  3DJD A;  1PXC A;  1FEA A;  2HQM A;  2WDR A;  2Q0K A;  5KWF A;  2WOV A;  1EL5 A;  2WP5 A;  1EL8 A;  3AE1 A;  5HHF A;  5U63 A;  4Y4L A;  3FG2 P;  3NK0 X;  1E1K A;  2TMD A;  2ARD A;  4A79 A;  4H2Q A;  3NTA A;  1M64 A;  5C2T A;  2GH5 A;  1N4V A;  4IA5 A;  5KRQ A;  1BGN A;  2WS3 A;  1Z6L A;  3UKK A;  4FK1 C;  4EQW A;  4REK A;  4I59 A;  4C74 A;  1L9E A;  4NWZ A;  3RNM A;  2C65 A;  1GES A;  4C5O A;  3ABV A;  4H4R A;  4Z2T A;  3ISH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...