1XHCA

Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779-001
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
351
structure length
346
Chain Sequence
b'SKVVIVGNGPGGFELAKQLSQTYEVTVIDKEPVPYYSKPMLSHYIAGFIPRNRLFPYSLDWYRKRGIEIRLAEEAKLIDRGRKVVITEKGEVPYDTLVLATGARAREPQIKGKEYLLTLRTIFDADRIKESIENSGEAIIIGGGFIGLELAGNLAEAGYHVKLIHRGAMFLGLDEELSNMIKDMLEETGVKFFLNSELLEANEEGVLTNSGFIEGKVKICAIGIVPNVDLARRSGIHTGRGILIDDNFRTSAKDVYAIGDCAEYSGIIAGTAKAAMEQARVLADILKGEPRRYNFKFRSTVFKFGKLQIAIIGNTKGEGKWIEDNTKVFYIGAVVFNDIRKATKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH oxidase /nitrite reductase
publication title NADH oxidase /nitrite reductase from Pyrococcus furiosus Pfu-1140779-001
rcsb
source organism Pyrococcus furiosus
molecule tags Oxidoreductase
total genus 105
structure length 346
sequence length 351
ec nomenclature
pdb deposition date 2004-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1xhcA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xhcA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xhcA02
4K8DA 2BYBA 1K4QA 1E39A 1JRXA 4RG4A 4B66A 1PBDA 5KVHA 4NTDA 2VRLA 4J2WA 1DODA 3VRBA 4JY3A 4B69A 1VRQB 3UKKA 4FDCB 1E1NA 1MO9A 3FIMB 3CTYA 4OCGA 4ZCCA 3ATQA 4K5SA 3AEAA 1GXFA 4A65A 3AE7A 3F8RA 2GQWA 3GWDA 2IIDA 5IQ1A 1EL7A 3AWIA 4TLXA 3UKLA 1KNRA 1N4VA 2PHHA 1VQWA 4WCTA 2YR4A 4CCRA 1IUXA 1K0JA 1PBBA 2XVEA 3DJGX 2BABA 3QFAA 2V60A 3ALLA 1PJ6A 3M12A 3B3RA 4FK1C 3BI5A 4C3YA 4EM4A 1Q1RA 4EQWA 1JRYA 4BJZA 1H7WA 3LJPA 4A99A 1COYA 1Y0PA 1YKJA 4A79A 1H86A 2WBAA 3H8LA 4JNAA 1ZOVA 3QFBA 1B4VA 4KX6A 4EQSA 3BHFA 4H4YA 2BC1A 4EQRA 1ZOYA 2RGJA 3BNUA 3L1RA 3NH3X 2WPCA 2F5ZA 3AD9B 1F8WA 1S3EA 1HYUA 2FJEA 2Y6RA 3P1WA 4H2NA 1D4DA 4GUVA 4K2XA 3CN8A 4YSYA 3NLCA 2YM2A 2EQ7A 2FJBA 1TDEA 2FJAA 1PN0A 3FMWA 2H89A 3CPJG 4A9WA 3ICSA 4O5QA 1D5TA 1D4EA 2OLOA 2XLTA 2WOVA 1GSNA 2JAEA 2XFOA 4TM0A 2AQJA 2GRTA 2E5VA 2WDQA 1UKVG 1L9CA 2B7SA 2V3BA 4I58A 2VQ7A 2ARDA 1CJCA 2VRMA 3RP8A 3S61A 2BA9A 3UTGA 4ECHA 1JU2A 2YG3A 4IVOB 1JOAA 4MJWA 3DGZA 2B9YA 5C3JA 2EQ6A 3UP5A 1EBDA 4BK3A 4U8IA 2CULA 3GD3A 1RP0A 2GAGB 1K0IA 3NIXA 3NYEA 1N4WA 1GTHA 2CVJA 3ICTA 3I3LA 4EMJA 2IVEA 2BK4A 4U2TA 4WX1A 1QO8A 5EB5A 4AP3A 3EPTA 3D8XA 3K7TA 5BRTA 2AR8A 3H8IA 4UP3A 4Z2UA 3EANA 1GV4A 2YQUA 4ZCDA 3P4QA 2R0CA 5DBJA 1GRBA 2GF3A 3AYLA 1VG0A 1KNPA 5CKUA 2C7GA 3RP7A 4FX9A 2WP5A 2GH5A 2OA1A 2YG5A 1DOBA 3UCLA 1ZDLA 1YQZA 4YXDA 2VOUA 2DKHA 3KKJA 2H88A 1OJTA 4OPCA 1LJ1A 4ZN0A 2BS3A 3ALMA 3DJDA 2XLPA 4BV6A 4BK2A 2TPRA 3GSIA 2XLRA 4CCQA 1Q9IA 1PBFA 3Q6JA 1Y56B 5KOWA 1AOGA 3ALJA 2XFNA 4NTCA 4C77A 3CNJA 4H7UA 2YAUA 3KU9A 1ZMCA 2V61A 1NAAA 2BK3A 2RGOA 3KVEA 2XFUA 1O5WA 5C2TA 1PJ5A 5U25A 2Q6UA 1BZLA 1OJDA 4U2LA 5FMHA 2X50A 3M0OA 4A7AA 3UKPA 4AOXA 4ADWA 2B9WA 1NHRA 2Q0LA 3IWAA 1E7PA 2FJDA 4B67A 3NRNA 3AD8B 3KD9A 4B68A 3NYCA 3LZWA 3QSMA 2XVJA 3VRAA 2OLNA 2WU2A 3BNMA 1GRAA 1NEKA 3KA7A 4GDPA 3UKFA 1FEBA 3NHOX 1ZMDA 1XDIA 1BGNA 4CY8A 3VR8A 1ZP0A 3SM8A 1ELIA 4UDPA 4PAAA 1B8SA 2GR3A 3LADA 3FBSA 5CQFA 4B1BA 1NHPA 2EQ8A 3AE8A 4GF7A 5BULA 1PXAA 4NZHA 4YTPA 1GEUA 4OPDA 1CC4A 3CNSA 2JB2A 4RG3A 4C5OA 2NPXA 1GOSA 4K22A 1V59A 4H4TA 3P4RA 1PHHA 1KFYA 2YG4A 3AE5A 5M0ZA 3AYJA 1Y56A 2YWLA 3K7MX 1GALA 2JBVA 5HXIA 4UDRA 2C66A 3QSSA 3IC9A 3I6DA 1ZX9A 3NT6A 3NNEA 2BACA 1O94A 3F8PA 1KF6A 2JB1A 2GAHB 1ZKQA 5KOXA 1KSSA 3RHAA 3K7QX 3DA1A 4H2PA 2WP6A 2QAEA 2ZZ0A 2R9ZA 3DGHA 3GD4A 4AP1A 5HY5A 4D04A 2XLUA 4JQ9A 4EMWA 1E6EA 4GR1A 4JDRA 5FS6A 5BUKA 4LU6A 4Y4MA 3SQPA 3S5WA 2W0HA 1CC6A 2Z5YA 2YLZA 1B37A 1Q1WA 2YG7A 1PS9A 4APNA 4XXGA 1D7LA 1F3PA 3AE2A 3PS9A 4H4QA 1FL2A 4H4WA 3CPHG 3BI4A 2YR5A 3AEFA 3AD7B 3L8KA 2QCUA 4J34A 4C74A 4Z2TA 4J36A 3GRTA 1X31B 3PVCA 1NHQA 2APGA 1FCDA 2GV8A 4NEWA 2VVMA 1GREA 3CNPA 2VZ2A 2Z5XA 1TYTA 1CJ4A 3II4A 2BS2A 4USRA 5KVIA 3DMEA 1NPXA 3UTHA 1EL8A 4Z2RA 3AE1A 2YM1A 4EQXA 1QJDA 2YG6A 2WEUA 4IA5A 2X99A 1TDFA 4X9NA 4NTEA 4M52A 4CNKA 1NENA 1IUVA 3ZDNA 4B64A 1S2YA 3SGLA 2B7RA 1PJ7A 2VVLG 3CGDA 2WS3A 2XDOA 3WE0A 1LQUA 1ONFA 2E1MA 2B76A 5EBKA 4GCMA 1CHUA 3AEDA 2XYOA 3V3OA 4H4PA 3AEGA 5KRQA 5HYMA 2I0ZA 3NGCX 4A6NB 3GRSA 1MOKA 1H84A 4OPUA 3CIRA 4H4XA 4YKGA 5IPYA 3DK8A 2VVLA 1OJ9A 2XVFA 3AB1A 2UZZA 3IHMA 1YY5A 2WHDA 4GDEA 3R9UA 3GYIA 2J3NA 4RSLA 5JCMA 4PABA 5FS7A 4AOSA 3Q9TA 3UOZA 1PBCA 4E0VA 2WP9A 2C3DA 5U63A 3IHGA 4JN9A 1JRZA 1O95A 2YR6A 4CY6A 4EM3A 4U8OA 1NG3A 4U8NA 4Y4NA 4LA1A 1XPQA 1DJQA 2XCGA 3FG2P 4LIIA 1GTEA 5FS8A 3AECA 3NK2X 4IV9A 4B65A 2GQFA 1GT8A 3AE6A 2ZBWA 4D03A 3G5QA 3ITJA 2GVCA 1OJCA 1GRHA 2DKIA 2Q0KA 5J60A 4CRTA 1H6VA 3B6DA 2X8HA 2CFYA 4REKA 3T37A 2X8CA 4X9MA 2WOWA 2C65A 2QA1A 1TRBA 1E1MA 4J31A 4UDQA 2BCGG 3PO7A 2C73A 4U8MA 2WETA 1PXBA 2XFQA 3AXBA 3QJ4A 2C70A 3VRDB 1EL9A 1VG9A 2GMJA 4A6NA 3LOVA 3GWFA 1N4UA 4YTNA 1NDAA 1CL0A 4H4SA 3P4SA 1Z6LA 4IA6A 4USQA 3GMBA 4H4UA 3V76A 2IVDA 2WOIA 2V5ZA 4AT0A 5KWFA 3ZYXA 2XFPA 1ZY8A 1NG4A 1BWCA 2C67A 3COXA 2YLXA 2OALA 2BS4A 2R0PA 2X3NA 2WDVA 2BXRA 3FPZA 2YVJA 1IUWA 2JKCA 4YKFA 3DJJA 3LXDA 4Z44A 1TYPA 1W4XA 1RSGA 1H83A 4N9XA 4DSHA 4H4ZA 3NKSA 1L9EA 2FBWA 1CBOA 2O9ZA 4I59A 1XANA 5EB4A 3BI2A 3URHA 3E1TA 4YSZA 1FOHA 2Y6QA 4OPTA 5FS9A 2C64A 2R45A 2RGHA 2WPFA 2XVHA 3AEBA 2R0GA 1GRGA 2NVKX 3NK0X 4BK1A 3DH9A 4CNJA 4YT0A 3CNTA 3EAOA 3F8DA 3UOYA 3NK1X 4OPGA 1DOEA 2JK6A 4H2RA 3DK9A 3D1CA 3SFDA 3QSEA 1BGJA 4DSGA 4JNQA 1GRFA 1GERA 1LTXR 5BVAA 4EMIA 3C4AA 4BJYA 4H50A 2B9XA 2WQYA 1DNCA 2XVIA 3ISHA 4XWZA 4A5LA 4BURA 1GETA 4TLZA 1H7XA 1XHCA 1E1KA 3QVRA 2RABA 3UKHA 2GMHA 1TDKA 2AAQA 1FECA 4U8LA 4Y4LA 1H82A 2GR1A 5TR3A 1K0LA 1SEZA 2C72A 2WESA 3CNDA 3NTAA 3SFEA 3CGEA 3DJEA 1P2HA 2QA2A 2BXSA 2WU5A 3HZLA 3NN0X 5LV9A 2GEWA 3LZXA 2BC0A 1IUSA 1M6IA 4X4JA 3H4KA 4HB9A 3CGCA 4K7ZA 1CF3A 3KLJA 3ICRA 5J7XA 2X8GA 2A89A 4XWRA 3DK4A 1RYIA 3REDA 4B63A 4EIQA 3C4NA 1PXCA 3UOVA 1IUUA 4HA6A 2GR2A 3IF9A 3QVPA 4AT2A 2WPEA 3RNMA 4YSXA 1GPEA 3NN6X 2YVGA 1JNRA 2ACZA 5HHFA 1PDHA 4TM3A 5KXJA 3VR9A 3UP4A 3LB8A 2V6OA 2YVFA 1REOA 2GB0A 2V3AA 2R4JA 3GMCA 3NG7X 1DXLA 1JNZA 2R4EA 4EIPA 1LPFA 1N1PA 4OVIA 1BKWA 1S2QA 1M64A 1TDOA 1YQ3A 4U8KA 4JY2A 1LQTA 3P4PA 2PYXA 2A87A 3AE9A 5GRTA 3AE3A 4J56A 4NEVA 3GYJA 4C3XA 1ZK7A 4O5UA 4OPLA 4KPRA 3P9UA 2A8XA 2XLSA 5JCKA 1KDGA 1F8SA 2YLTA 4P9SA 3UKAA 4K5RA 1CC2A 1VDCA 5EOWA 4DNAA 5GSNA 2C76A 5M10A 1GNDA 1JEHA 3O0HA 3JSKA 3VQRA 2C3CA 1CJ2A 2VQBA 1F6MA 3BHKA 4Z26A 2JB3A 4YSHA 1QLBA 1H81A 1F8RA 3EF6A 3GDPA 2BK5A 2CDUA 2E4GA 2R46A 3AE4A 1PBEA 2TMDA 1LVLA 1NHSA 4H2QA 3UKQA 1LV0A 3C96A 3G5RA 3V3NA 4Z43A 1DOCA 5JCIA 3RP6A 4YTMA 5JCNA 2EQ9A 1MXTA 4H4VA 5L46A 2ZZCA 3AYIA 3G5SA 3OC4A 4Z24A 4IVMB 3ATRA 2HQMA 3CGBA 5JCLA 1D4CA 5U1OA 1S3BA 2YLSA 1GRTA 4ICYA 2OAMA 1IUTA 4Z25A 1B5QA 2ZZBA 4TM1A 2BCPA 2YLRA 3KPFA 1L0VA 1L9DA 1DJNA 1EL5A 3AEEA 3NYFA 1E1LA 1KSUA 1OJAA 4OPIA 3NTDA 2Q7VA 4H4RA 4J33A 2YLWA 1GESA 3UTEA 3ADAB 4J57A 3ABVA 4GRTA 1CJ3A 1TDNA 3UOXA 4FK1A 3UTFA 3GDNA 4DGKA 1YQ4A 1P2EA 1D7YA 2GR0A 2C75A 3CPIG 4TM4A 1IJHA 4U8PA 1BF3A 4U8JA 2WDRA 3M13A 4U2SA 3OZ2A 1FEAA 5IQ4A 3K30A 4CBQA 4YWOA 5ER0A
chains in the Genus database with same CATH superfamily
3EUB3 1PBDA 5KVHA 4FDCB 3R10A 1MO9A 3FIMB 4OCGA 4ZCCA 3UCDA 4DYEA 2GQWA 3GWDA 3UKLA 2PHHA 1IUXA 4K1WA 4FK1C 4C3YA 2C4CA 1WUFA 4A79A 3H8LA 4JNAA 4KX6A 3SX6A 2OZ3A 3BHFA 4H4YA 2RGJA 3BNUA 3AD9B 3P1WA 4YSYA 4GUVA 3CN8A 2FJBA 2DW6A 2GL5A 2OLOA 3S5SA 1GSNA 2GSHA 1KKOA 2E5VA 2WDQA 4I58A 1FFUC 1CJCA 3UJEA 4IVOB 4MJWA 3ZLHA 5C3JA 2OX4A 1EBDA 4U8IA 2CULA 4K8GA 1RP0A 3NIXA 3NYEA 3PWIA 3ICTA 3N4EA 4EMJA 4GAVA 4UP3A 3EANA 2YQUA 4ZCDA 2R0CA 3NZGA 2GF3A 3AYLA 3RP7A 1KNPA 3UCLA 1ZDLA 3HRDC 3AMZA 1EC8A 3R1ZA 2XLPA 1MUCA 4HCHA 2XLRA 4CCQA 1PBFA 1Y56B 5KOWA 5KMQA 3FXGA 4H7UA 1NAAA 2BK3A 2RGOA 3KVEA 1O5WA 5C2TA 4A7AA 3UKPA 4ADWA 2B9WA 1NHRA 3IWAA 2GDQA 4J1OA 3H70A 3QSMA 3BOXA 3NHOX 1XDIA 4CY8A 3JZUA 4UDPA 4PAAA 3R0UA 3NO1A 3FBSA 5CQFA 4B1BA 1NHPA 2ZADA 1PXAA 3NVZB 1BQGA 2YG4A 3AE5A 5M0ZA 1PDYA 4TVYA 3QN3A 3IC9A 3NT6A 2BACA 1KF6A 2JB1A 4JHMA 3T6CA 5KOXA 1KSSA 3DGHA 4M6UA 1E6EA 1JDFA 5BUKA 5FJRA 3S5WA 2W0HA 3ZLFA 1B37A 3V3WA 4APNA 4XXGA 2HXUA 3CPHG 1X2GA 4GIRA 4J34A 3TW9A 1X31B 3A7UA 2APGA 1GREA 1NPXA 3PG6A 1EL8A 2YM1A 4EQXA 1TE6A 2YG6A 4IA5A 2X99A 3UJSA 2PGWA 4NTEA 4M52A 2OQHA 2OZ8A 4GGHA 1P48A 3SGLA 1PJ7A 3CGDA 4GFIA 3WE0A 1LQUA 2B76A 4GCMA 3ETRB 3VCCA 5KRQA 3D46A 4A6NB 3CIRA 3CAWA 2W54A 1KN0A 5FS7A 1TZZA 3PFRA 4GAPA 2WP9A 4DN1A 3IHGA 1T3QC 3GYXA 1JRZA 2YR6A 4U8OA 2XH7A 4Y4NA 3UJRA 1FHVA 1GT8A 3AE6A 2ZBWA 3H7VA 3TWAA 2GVCA 1MNSA 2Q0KA 4CRTA 1H6VA 2CFYA 4X9MA 2QA1A 1E1MA 3VC6A 2BCGG 2C73A 1VG9A 1NDAA 4USQA 3GMBA 2IVDA 5KWFA 1NG4A 3ZVIA 3COXA 2YLXA 2OALA 3KPKA 2YVJA 1IUWA 3T2YA 1RSGA 1H83A 4DSHA 4H4ZA 1MRAA 2FBWA 5EB4A 3BI2A 2QJNA 4GMEA 4OPTA 5FS9A 3AEBA 2PODA 2R0GA 3NK0X 4BK1A 2FYMA 4DHGA 4H2RA 1JRPA 2HXTA 1GERA 5BVAA 4EMIA 4BJYA 2GGGA 4XWZA 1E1KA 3QVRA 3QPEA 3UKHA 1TDKA 2AAQA 3OW1A 1H82A 2GR1A 1K0LA 2GEWA 1M6IA 4HB9A 4K7ZA 5J7XA 4XWRA 2A89A 3DK4A 1RYIA 4EIQA 5J04A 3C4NA 3UOVA 4HA6A 4AT2A 3IF9A 4YSXA 3VR9A 3T8QA 3LB8A 2R4JA 1DXLA 2XSXA 1YQ3A 4JY2A 2A87A 3AE9A 2AL2B 4O5UA 4P9SA 3UKAA 4K5RA 1VDCA 5EOWA 5GSNA 2C76A 4HN8A 3VQRA 2VQBA 4Z26A 2JB3A 3RR1A 3EF6A 1PBEA 2TMDA 1LVLA 1LV0A 4YTMA 2EQ9A 1MXTA 4MMWA 3NXLA 5BOEA 5L46A 5FJUA 4IVMB 3U9IA 4J33A 5U1OA 4Z25A 1FO4A 3TJ4A 2FKPA 4TM1A 5EU9A 3B97A 1KSUA 3CYJA 3NTDA 3ADAB 3ABVA 3UOXA 4E8GA 4ZOHB 3GDNA 4DGKA 1P2EA 2GR0A 2OO6A 4TM4A 4U8PA 4CBQA 4K8DA 1JRXA 4K5SA 4A65A 4Z1YA 3F8RA 2IIDA 4DXKA 2XVEA 3JW7A 2V60A 3VC5A 3BI5A 4EM4A 1Q1RA 3HYWA 6ENLA 1JRYA 1H7WA 3LJPA 2OQYA 1COYA 1YKJA 1N62C 1ZOVA 3CXOA 3L1RA 2F5ZA 1S3EA 4H2NA 3STPA 3FMWA 1PN0A 3SZ0A 4A6GA 3ICSA 1D5TA 2XLTA 2WOVA 1JPMA 2AQJA 2MNRA 2B7SA 2QQ6A 4KWSA 3RP8A 3UTGA 4ECHA 1FHUA 3SY4A 4GGBA 2OG9A 3GD3A 2GAGB 2CVJA 2OPJA 4U2TA 3RCYA 3NVVB 4Z2UA 1DTNA 3P4QA 2OA1A 2YG5A 2VOUA 3KKJA 2H88A 1OJTA 1LJ1A 1X2HA 3DJDA 3GY1A 1FFVC 3DFYA 4HNLA 4DWDA 4C77A 3CNJA 2PS2A 3KU9A 1ZMCA 2XFUA 2Q6UA 1OJDA 4U2LA 2X50A 4ENLA 4II3A 3GO2A 4E6MA 2FJDA 4B67A 1TKKA 3NYCA 3SZCA 2OLNA 1NEKA 3UKFA 1L8PA 3SM8A 1ELIA 1NELA 4GISA 4ROPA 3CNSA 2MUCA 2PPGA 4RG3A 4K22A 3P4RA 1PHHA 3AYJA 1Y56A 3K7MX 4UDRA 3QSSA 1VDVA 3N6HA 3I6DA 3NNEA 2GAHB 3DA1A 3CXBA 2PU1A 2QAEA 2R9ZA 3GD4A 4AP1A 5FJOA 5HY5A 2XLUA 5FS6A 4Y4MA 2OLAA 2YLZA 2PP3A 2PU0A 3MKCA 1PS9A 3PS9A 4H4WA 4IZGA 3AEFA 3L8KA 4Z2TA 4J36A 2P8BA 3FV9A 2XH2A 1CJ4A 2XH4A 3DMEA 3UTHA 4GYPA 2PTXA 1RVKA 3U4FA 1NENA 2VVLG 2XDOA 4EWJA 1KCZA 1CHUA 3CK5A 4H4PA 5G5GB 3AEGA 5HYMA 2PP0A 2I0ZA 3NGCX 1H84A 5IPYA 3SXIA 4GDEA 3GYIA 2J3NA 4RSLA 5JCMA 4PABA 4E0VA 3FYYA 5U63A 3BJSA 4JN9A 1O95A 4CY6A 4U8NA 3L5OA 4LA1A 2XCGA 1GTEA 1EC7A 4B65A 3GC2A 3G5QA 1OJCA 1BKHA 1GRHA 5J60A 2WETA 3AXBA 2XFQA 3QJ4A 4E4UA 4A6NA 3GWFA 1N4UA 4YTNA 1CL0A 3ZVHB 1STZA 4A3RA 3V76A 4AT0A 3ZYXA 2XFPA 1ZY8A 1BWCA 4JN7A 2BS4A 2X3NA 2BXRA 1TYPA 1W4XA 4N9XA 3NKSA 1L9EA 1CBOA 4I59A 3URHA 1FOHA 3I6EA 2Y6QA 3MQTA 2RGHA 3UJFA 2XVHA 1P43A 4YT0A 3UOYA 4G7FA 3D1CA 3SN0A 3DG6A 4JNQA 5KMSA 3V4BA 2WQYA 1DNCA 2XVIA 4A5LA 3MSYA 4FI4A 4BURA 4TLZA 2AKZA 4G9KA 1XHCA 2RABA 1XS2A 4HNCA 1FECA 1WUEA 2WESA 1P2HA 3ES7A 4NWZA 1JROA 4X4JA 3H4KA 3H12A 3KLJA 2X8GA 4FP1A 3RNMA 3I4KA 3NN6X 1JNRA 3HW2A 2XH0A 2ACZA 2V6OA 2YVFA 3NG7X 2R4EA 4EIPA 4U8KA 1TDOA 1LQTA 4NEVA 4C3XA 4OPLA 2A8XA 2P3ZA 1N60C 3SQSA 4ZA0A 3N4FA 3HYVA 1GNDA 3T31A 1F6MA 4YSHA 3A7RA 1F8RA 3GDPA 3SZFA 2BK5A 2CDUA 3AE4A 1NHSA 3G5RA 3V3NA 1DOCA 5JCIA 5FJTA 3AYIA 1N61C 3OC4A 4G74A 2HQMA 1S3BA 2OAMA 2QJMA 3KPFA 1L9DA 3NYFA 3FJ4A 3A7AA 3UTEA 1GESA 1CJ3A 1TDNA 2AL2A 3EKGA 4U2SA 2RDXA 2OVLA 4YWOA 5ER0A 1K4QA 4NTDA 4F4RA 2VRLA 1DODA 4J2WA 4JY3A 3UXLA 1VRQB 3UKKA 1E1NA 2E3TA 3CTYA 3ATQA 3AEAA 4IL2A 4DX3A 1R6WA 3AWIA 4E5TA 1KNRA 1N4VA 4CCRA 4WCTA 2YR4A 2PTYA 3DJGX 2BABA 3QFAA 3ALLA 3M12A 3RITA 4BJZA 1OEPA 1H86A 2WBAA 1B4VA 4EQSA 4EQRA 1ZOYA 2WPCA 1F8WA 3H8AA 1D4DA 3NLCA 2PA6A 2YM2A 4IL0A 1V97A 4KPLA 2FJAA 3TCSA 3CPJG 4O5QA 1D4EA 2QGYA 2GRTA 1L9CA 3P0WA 3BSMA 2VQ7A 2VRMA 3S61A 2BA9A 1JU2A 2YG3A 2P88A 1VQZA 2B9YA 1H2IA 4BK3A 3PK7A 2W55A 3TTEA 2IVEA 2BK4A 1QO8A 5EB5A 3EPTA 3D8XA 2AR8A 7ENLA 2NQLA 2QJJA 5CKUA 2C7GA 2WP5A 3NS1B 1DOBA 5ENLA 2DW7A 2BS3A 3TWBA 3ALMA 4BK2A 3GSIA 4KEMA 1AOGA 2YAUA 3OP2A 4K2SA 5U25A 3S47A 3IJQA 3M0OA 4AOXA 2Q0LA 1MDLA 1E7PA 2AL1A 3NRNA 3AD8B 3UCCA 3T9PA 3R07C 3VRAA 3BNMA 3VA8A 4GDPA 1FEBA 1ZMDA 1BGNA 1B8SA 3LADA 3AE8A 3SYIA 1JPDX 4YTPA 4OPDA 1CC4A 1N5WC 4C5OA 2NPXA 4H4TA 1KFYA 3NVYB 1GALA 2C66A 1ZX9A 1O94A 2BRYA 3MWCA 2HNEA 3MY9A 4JDRA 4HYRA 1CC6A 2OFJA 1Q1WA 3EEZA 1D7LA 3D9XA 4HPNA 3AE2A 3AD7B 2QCUA 4C74A 4IP5A 3GRTA 2GV8A 1FCDA 4NEWA 5G5HB 3CNPA 3QKEA 2Z5XA 1TYTA 4USRA 2BS2A 5KVIA 4Z2RA 3IK4A 2WEUA 4G8TA 3SN1A 4CNKA 4A35A 2W3RA 3ZDNA 2B7RA 1ONFA 2OZTA 5EBKA 3V3OA 3R0KA 1SB3B 3NVWB 3GRSA 4OPUA 4IP4A 3DK8A 3IHMA 3R9UA 1YY5A 2WHDA 4GYPC 4AOSA 3Q9TA 3UOZA 1PBCA 2C3DA 1SJAA 4EM3A 1XPQA 5FS8A 3NK2X 2GQFA 3TOYA 4D03A 2DKIA 5BOFA 3IJLA 2WOWA 1TRBA 4J31A 2ONEA 3D47A 1PXBA 3VRDB 2C70A 2GMJA 3JVAA 3LOVA 5IDZA 4H4SA 3P4SA 4IA6A 4YWSA 3AM9A 1PDZA 3IJIA 2WOIA 3UJ2A 3V5FA 2C67A 2WDVA 4Z44A 3FPZA 5FJPA 3DJJA 3LXDA 1XANA 4MKSA 3E1TA 4YSZA 2C64A 2NVKX 3CNTA 1R0MA 3EAOA 3F8DA 3ZLGA 3SFDA 3QSEA 4DSGA 1GRFA 1LTXR 3T2KA 4H50A 2BRAA 3ISHA 3MUCA 1GETA 3ZVHA 2GMHA 1S7MA 1ELSA 3UXKA 3SFEA 3NTAA 2BXSA 2WU5A 5LV9A 2BC0A 3T4WA 3CGCA 3ICRA 2QVHA 4B63A 1IUUA 2GR2A 4H19A 5KMPA 1GPEA 5HHFA 5KXJA 3UP4A 2GB0A 3GMCA 2OKTA 3T2ZA 4OVIA 5GRTA 4IT1A 5JCKA 1KDGA 1F8SA 2YLTA 4NNJA 1ECQA 1CC2A 4DNAA 3TQPA 3DESA 2PP1A 3UGVA 2C3CA 1CJ2A 1QLBA 1H81A 5JCNA 4H4VA 2ZZCA 3G5SA 4Z24A 5JCLA 1D4CA 2YLSA 2ZZBA 2BCPA 2YLRA 3FCPA 1L0VA 4H83A 1E1LA 2Q7VA 3SR6B 2YLWA 4FK1A 3UTFA 1IJHA 4U8JA 2WDRA 3OZ2A 1FEAA 3K30A 2BYBA 1EBHA 1E39A 4RG4A 4B66A 3VRBA 3DEQA 4B69A 1GXFA 3AE7A 5IQ1A 1EL7A 4G6HA 4TLXA 1VQWA 1KD0A 1K0JA 1PBBA 1PJ6A 3B3RA 4EQWA 4A99A 1Y0PA 3QFBA 2BC1A 3NH3X 1HYUA 2FJEA 2Y6RA 4K2XA 2GGEA 2EQ7A 1TDEA 1KKRA 2H89A 2P8CA 3DG3A 4A9WA 4JN8A 2PGEA 2JAEA 2XFOA 4TM0A 1UKVG 2V3BA 2ARDA 3P3BA 3KUMA 1JOAA 3DGZA 2EQ6A 3UP5A 3DERA 3HPFA 3RGTA 1K0IA 1N4WA 1GTHA 3I3LA 4AP3A 4WX1A 3K7TA 5BRTA 3H8IA 1GV4A 3DFHA 1GRBA 5DBJA 3DIPA 1VG0A 4FX9A 2GH5A 1YQZA 4YXDA 1EBGA 2DKHA 4OPCA 2P0IA 2W3SA 4ZN0A 5KNLA 4BV6A 2TPRA 3VDGA 1Q9IA 3Q6JA 2QDEA 3ALJA 3B9JB 2XFNA 4NTCA 2V61A 3RO6A 2PCEA 3NRZB 1PJ5A 3SJNA 1YEYA 1BZLA 5FMHA 3OPSA 3KD9A 4B68A 3LZWA 1E9IA 2XVJA 2WU2A 1GRAA 4J3ZA 3KA7A 1SJBA 1ZP0A 3VR8A 2GR3A 2EQ8A 4GF7A 3SN4A 5BULA 4NZHA 4H1ZA 1GEUA 3HYXA 2JB2A 1GOSA 1V59A 4II2A 2YWLA 2JBVA 5HXIA 3CMMA 3F8PA 1ZKQA 2CHRA 3RHAA 3K7QX 4H2PA 1WYGA 3SBFA 3DDMA 2WP6A 2ZZ0A 4G6GA 4D04A 4JQ9A 4EMWA 4GR1A 3V5CA 4LU6A 3SQPA 2Z5YA 2YG7A 3OZYA 1F3PA 3SZWA 3CB3A 4H4QA 1FL2A 3BI4A 2YR5A 3PVCA 1NHQA 2VVMA 2VZ2A 3GD6A 4IHCA 3II4A 1W6TA 3AE1A 4E4FA 1QJDA 1TDFA 1SJCA 2XGZA 3DGBA 4X9NA 2I5QA 3R11A 1IUVA 4B64A 1S2YA 2WS3A 4TVWA 3Q45A 2E1MA 3AEDA 2XYOA 1MOKA 4H4XA 4G73A 4HCDA 4YKGA 2VVLA 1OJ9A 2XVFA 3AB1A 2UZZA 3ES8A 3RRAA 2PTZA 4KT2A 3AN1A 5JRBA 2PMQA 1NG3A 1DJQA 3AECA 3FG2P 4LIIA 4IV9A 1N5XA 3ITJA 4M0XA 3B6DA 2X8HA 4REKA 3T37A 2X8CA 3K1GA 2C65A 2E5AA 4UDQA 3PO7A 4U8MA 1EL9A 3CT2A 3N6JA 1Z6LA 1JCTA 4H4UA 4H2HA 2V5ZA 3R25A 4Z17A 2R0PA 4YKFA 2JKCA 3QTPA 2GGHA 2O9ZA 2O56A 1NU5A 2R45A 2WPFA 1GRGA 3DH9A 4CNJA 2HZGA 2ZC8A 3VFCA 3NK1X 4OPGA 1DOEA 2JK6A 3DK9A 1BGJA 3DG7A 4ZCWA 3C4AA 2B9XA 1IYXA 1H7XA 4X2PA 4U8LA 4Y4LA 5TR3A 1SEZA 2C72A 3CNDA 1N63C 3CGEA 3DJEA 2QA2A 3HZLA 3NN0X 3LZXA 3OTRA 1XPYA 1IUSA 3P93A 3OZMA 1CF3A 2POZA 3REDA 1MDRA 1PXCA 3QVPA 2WPEA 3I6TA 1SJDA 2YVGA 1FIQB 2GGIA 1PDHA 4TM3A 3PWGA 2V3AA 1REOA 1JNZA 1LPFA 1N1PA 1BKWA 1S2QA 1M64A 3P4PA 2PYXA 3AE3A 4J56A 3GYJA 3TJIA 1ZK7A 3ENLA 4KPRA 3P9UA 2XLSA 3SSZA 3NFUA 1ZXIC 2AKMA 5M10A 1JEHA 3O0HA 4HCLA 3JSKA 3BHKA 3Q4DA 3QLDA 2E4GA 2R46A 4H2QA 3FVDA 3UKQA 3C96A 4Z43A 3RP6A 1F9CA 4MGGA 3ATRA 3CGBA 4ICYA 2GGJA 1GRTA 2PSNA 1IUTA 3MZNA 1B5QA 3T0KA 1DJNA 1EL5A 3AEEA 4OPIA 1OJAA 4H4RA 2QDDA 3T14A 3THUA 2PTWA 1EC9A 4J57A 4GRTA 5KMRA 1YQ4A 1D7YA 2C75A 3VCNA 3CPIG 1BF3A 3M13A 5IQ4A 1ONEA 1RM6B
chains in the Genus database with same CATH topology
4K8DA 2BYBA 1K4QA 1E39A 1JRXA 4RG4A 4B66A 1PBDA 5KVHA 4NTDA 2VRLA 4J2WA 1DODA 3VRBA 4JY3A 4B69A 1VRQB 3UKKA 4FDCB 1E1NA 1MO9A 3FIMB 3CTYA 4OCGA 4ZCCA 3ATQA 4K5SA 3AEAA 1GXFA 4A65A 3AE7A 3F8RA 2GQWA 3GWDA 2IIDA 5IQ1A 1EL7A 3AWIA 4G6HA 4TLXA 1KNRA 1N4VA 3UKLA 2PHHA 1VQWA 4WCTA 2YR4A 4CCRA 1IUXA 1K0JA 1PBBA 2XVEA 3DJGX 2BABA 3QFAA 2V60A 3ALLA 1PJ6A 3M12A 3B3RA 4FK1C 3BI5A 4C3YA 4EM4A 1Q1RA 3HYWA 4EQWA 1JRYA 2C4CA 4BJZA 1H7WA 3LJPA 4A99A 1COYA 1Y0PA 1YKJA 4A79A 1H86A 2WBAA 3H8LA 4JNAA 1ZOVA 3QFBA 1B4VA 4KX6A 3SX6A 4EQSA 3BHFA 4H4YA 2BC1A 4EQRA 1ZOYA 2RGJA 3BNUA 3L1RA 3NH3X 2WPCA 2F5ZA 3AD9B 1F8WA 1S3EA 1HYUA 2FJEA 2Y6RA 3P1WA 4H2NA 1D4DA 4GUVA 4K2XA 3CN8A 4YSYA 3NLCA 2YM2A 2EQ7A 2FJBA 1TDEA 2FJAA 1PN0A 3FMWA 2H89A 3CPJG 3SZ0A 4A9WA 3ICSA 4O5QA 1D5TA 1D4EA 2OLOA 2XLTA 2WOVA 1GSNA 2JAEA 2XFOA 4TM0A 2AQJA 2GRTA 2E5VA 2WDQA 1UKVG 1L9CA 2V3BA 2B7SA 4I58A 2VQ7A 2ARDA 1CJCA 2VRMA 3RP8A 3S61A 2BA9A 3UTGA 4ECHA 1JU2A 2YG3A 4IVOB 1JOAA 3SY4A 4MJWA 3DGZA 2B9YA 5C3JA 2EQ6A 1H2IA 3UP5A 1EBDA 4BK3A 4U8IA 2CULA 3GD3A 1RP0A 2GAGB 1K0IA 3NIXA 3NYEA 1N4WA 1GTHA 2CVJA 3ICTA 3I3LA 4EMJA 2IVEA 2BK4A 4U2TA 4WX1A 1QO8A 5EB5A 4AP3A 3EPTA 3D8XA 3K7TA 5BRTA 2AR8A 3H8IA 4GAVA 4UP3A 4Z2UA 3EANA 1GV4A 2YQUA 4ZCDA 3P4QA 2R0CA 5DBJA 1GRBA 2GF3A 3AYLA 1VG0A 1KNPA 5CKUA 2C7GA 3RP7A 4FX9A 2WP5A 2GH5A 2OA1A 2YG5A 1DOBA 3UCLA 1ZDLA 1YQZA 4YXDA 2VOUA 2DKHA 3KKJA 2H88A 1OJTA 4OPCA 1LJ1A 4ZN0A 2BS3A 3ALMA 3DJDA 2XLPA 4BV6A 5KNLA 4BK2A 2TPRA 3GSIA 2XLRA 4CCQA 1Q9IA 1PBFA 3Q6JA 1Y56B 5KOWA 1AOGA 3ALJA 2XFNA 4NTCA 5KMQA 4C77A 3CNJA 4H7UA 2YAUA 3KU9A 1ZMCA 2V61A 1NAAA 2BK3A 2RGOA 3KVEA 2XFUA 1O5WA 5C2TA 1PJ5A 5U25A 2Q6UA 1BZLA 1OJDA 4U2LA 5FMHA 2X50A 3M0OA 4A7AA 3UKPA 4AOXA 4ADWA 4II3A 2B9WA 1NHRA 2Q0LA 3IWAA 1E7PA 2FJDA 4B67A 3NRNA 3AD8B 3KD9A 4B68A 3NYCA 3LZWA 3SZCA 3QSMA 2XVJA 3VRAA 2OLNA 2WU2A 3BNMA 1GRAA 1NEKA 3KA7A 4GDPA 3UKFA 1FEBA 3NHOX 1ZMDA 1XDIA 1BGNA 4CY8A 3VR8A 1ZP0A 3SM8A 1ELIA 4UDPA 4PAAA 1B8SA 2GR3A 3LADA 3FBSA 5CQFA 4B1BA 1NHPA 2EQ8A 3AE8A 4GF7A 3SYIA 5BULA 1PXAA 4NZHA 4YTPA 1GEUA 4OPDA 1CC4A 3CNSA 2JB2A 3HYXA 4RG3A 4C5OA 2NPXA 1GOSA 4K22A 1V59A 4H4TA 3P4RA 1PHHA 1KFYA 2YG4A 3AE5A 5M0ZA 3AYJA 1Y56A 4II2A 2YWLA 3K7MX 1GALA 2JBVA 5HXIA 4UDRA 2C66A 3QSSA 3IC9A 3I6DA 1ZX9A 3NT6A 3NNEA 2BACA 1O94A 3CMMA 1KF6A 3F8PA 2JB1A 2GAHB 1ZKQA 5KOXA 1KSSA 3RHAA 3K7QX 3DA1A 4H2PA 2WP6A 2QAEA 2ZZ0A 2R9ZA 2BRYA 3DGHA 4G6GA 3GD4A 4AP1A 5HY5A 4D04A 2XLUA 4JQ9A 4EMWA 1E6EA 4GR1A 4JDRA 5FS6A 5BUKA 4LU6A 4Y4MA 3SQPA 3S5WA 2W0HA 1CC6A 2Z5YA 2YLZA 1B37A 1Q1WA 2YG7A 1PS9A 4APNA 4XXGA 1D7LA 1F3PA 3D9XA 3AE2A 3SZWA 3PS9A 4H4QA 1FL2A 4H4WA 3CPHG 3BI4A 2YR5A 3AEFA 3AD7B 3L8KA 2QCUA 4J34A 4C74A 4Z2TA 4J36A 3GRTA 1X31B 3PVCA 1NHQA 2APGA 1FCDA 2GV8A 4NEWA 2VVMA 1GREA 3CNPA 2VZ2A 2Z5XA 1TYTA 1CJ4A 3II4A 2BS2A 4USRA 5KVIA 3DMEA 1NPXA 3UTHA 3PG6A 1EL8A 4Z2RA 3AE1A 2YM1A 4EQXA 1QJDA 2YG6A 2WEUA 4IA5A 2X99A 1TDFA 4X9NA 4NTEA 4M52A 4CNKA 1NENA 1IUVA 3ZDNA 4B64A 1S2YA 3SGLA 2B7RA 1PJ7A 2VVLG 3CGDA 2WS3A 2XDOA 3WE0A 1LQUA 1ONFA 2E1MA 2B76A 5EBKA 4GCMA 1CHUA 3AEDA 2XYOA 3V3OA 4H4PA 3AEGA 5KRQA 5HYMA 2I0ZA 3NGCX 4A6NB 3GRSA 1MOKA 1H84A 4OPUA 3CIRA 4H4XA 4G73A 4YKGA 5IPYA 3DK8A 3SXIA 2VVLA 1OJ9A 2XVFA 3AB1A 2UZZA 3IHMA 1YY5A 2WHDA 4GDEA 3R9UA 3GYIA 1KN0A 2J3NA 4RSLA 5JCMA 4PABA 5FS7A 4AOSA 3Q9TA 4GAPA 3UOZA 1PBCA 4E0VA 2WP9A 2C3DA 5U63A 3IHGA 3GYXA 4JN9A 1JRZA 1O95A 2YR6A 5JRBA 4EM3A 4U8OA 1NG3A 3L5OA 4U8NA 4LA1A 1XPQA 4Y4NA 1DJQA 2XCGA 3FG2P 4LIIA 1GTEA 5FS8A 3AECA 3NK2X 4IV9A 4B65A 2GQFA 1GT8A 3AE6A 2ZBWA 4D03A 3G5QA 3ITJA 2GVCA 1OJCA 1GRHA 2DKIA 2Q0KA 5J60A 4CRTA 1H6VA 3B6DA 2X8HA 2CFYA 4REKA 3T37A 2X8CA 4X9MA 2WOWA 2C65A 2QA1A 1TRBA 1E1MA 4J31A 4UDQA 2BCGG 3PO7A 2C73A 4U8MA 2WETA 1PXBA 2XFQA 3AXBA 3QJ4A 2C70A 3VRDB 1EL9A 1VG9A 2GMJA 4A6NA 3LOVA 3GWFA 1N4UA 4YTNA 1NDAA 1CL0A 4H4SA 3P4SA 1Z6LA 4IA6A 4USQA 3GMBA 4H4UA 3V76A 2IVDA 2WOIA 2V5ZA 4AT0A 5KWFA 3ZYXA 2XFPA 1ZY8A 1NG4A 1BWCA 2C67A 3COXA 2YLXA 2OALA 3KPKA 2BS4A 2R0PA 2X3NA 2WDVA 2BXRA 3FPZA 2YVJA 1IUWA 2JKCA 4YKFA 3DJJA 3LXDA 4Z44A 1TYPA 3T2YA 4CY6A 1W4XA 1RSGA 1H83A 4N9XA 4DSHA 4H4ZA 3NKSA 1L9EA 2FBWA 1CBOA 2O9ZA 4I59A 1XANA 5EB4A 3BI2A 3URHA 3E1TA 4YSZA 1FOHA 2Y6QA 4OPTA 5FS9A 2C64A 2R45A 2RGHA 2WPFA 2XVHA 3AEBA 2R0GA 1GRGA 2NVKX 3NK0X 4BK1A 3DH9A 4CNJA 4YT0A 3CNTA 3EAOA 3F8DA 3UOYA 3NK1X 4OPGA 1DOEA 2JK6A 4H2RA 3DK9A 3D1CA 3SFDA 3QSEA 1BGJA 4DSGA 4JNQA 5KMSA 1GRFA 1GERA 1LTXR 3T2KA 5BVAA 4EMIA 3C4AA 4BJYA 4H50A 2B9XA 2WQYA 1DNCA 2BRAA 2XVIA 3ISHA 4XWZA 4A5LA 4BURA 1GETA 4TLZA 1H7XA 4G9KA 1XHCA 1E1KA 3QVRA 2RABA 3UKHA 2GMHA 1TDKA 2AAQA 1FECA 1S7MA 4U8LA 4Y4LA 1H82A 2GR1A 5TR3A 1K0LA 1SEZA 2C72A 2WESA 3CNDA 3NTAA 3SFEA 3CGEA 3DJEA 1P2HA 2QA2A 2BXSA 2WU5A 3HZLA 3NN0X 4NWZA 5LV9A 2GEWA 3LZXA 2BC0A 1IUSA 1M6IA 4X4JA 3H4KA 4HB9A 3CGCA 4K7ZA 1CF3A 3KLJA 3ICRA 5J7XA 2X8GA 2A89A 4XWRA 3DK4A 1RYIA 3REDA 4B63A 4EIQA 3C4NA 1PXCA 3UOVA 1IUUA 4HA6A 2GR2A 3IF9A 3QVPA 4AT2A 2WPEA 3RNMA 4YSXA 5KMPA 1GPEA 3NN6X 2YVGA 1JNRA 2ACZA 5HHFA 1PDHA 4TM3A 5KXJA 3VR9A 3UP4A 3LB8A 2V6OA 2V3AA 2YVFA 1REOA 2GB0A 2R4JA 3GMCA 3NG7X 1DXLA 1JNZA 2R4EA 4EIPA 1LPFA 3T2ZA 1N1PA 4OVIA 1BKWA 1S2QA 1M64A 1TDOA 1YQ3A 4U8KA 4JY2A 1LQTA 3P4PA 2PYXA 2A87A 3AE9A 5GRTA 3AE3A 4J56A 4NEVA 3GYJA 4C3XA 1ZK7A 4O5UA 4OPLA 4KPRA 3P9UA 2A8XA 2XLSA 5JCKA 1KDGA 1F8SA 2YLTA 4P9SA 3UKAA 4NNJA 4K5RA 1CC2A 1VDCA 5EOWA 4DNAA 5GSNA 2C76A 5M10A 3HYVA 1GNDA 1JEHA 3O0HA 3JSKA 3T31A 2C3CA 1CJ2A 2VQBA 3VQRA 1F6MA 3BHKA 4Z26A 2JB3A 4YSHA 1QLBA 1H81A 1F8RA 3EF6A 3GDPA 3SZFA 2BK5A 2CDUA 2E4GA 2R46A 3AE4A 1PBEA 2TMDA 1LVLA 1NHSA 4H2QA 3UKQA 1LV0A 3C96A 3G5RA 3V3NA 4Z43A 1DOCA 5JCIA 3RP6A 4YTMA 5JCNA 2EQ9A 1MXTA 4H4VA 5L46A 2ZZCA 3AYIA 3G5SA 3OC4A 4Z24A 4G74A 4IVMB 3ATRA 2HQMA 3CGBA 5JCLA 1D4CA 5U1OA 1S3BA 2YLSA 1GRTA 4ICYA 2OAMA 1IUTA 4Z25A 1B5QA 2ZZBA 4TM1A 2BCPA 2YLRA 3KPFA 1L0VA 1L9DA 3T0KA 1DJNA 1EL5A 3AEEA 3NYFA 1E1LA 1KSUA 1OJAA 4OPIA 3NTDA 2Q7VA 4H4RA 4J33A 3T14A 2YLWA 1GESA 3UTEA 3ADAB 4J57A 3ABVA 4GRTA 1CJ3A 1TDNA 3UOXA 4FK1A 5KMRA 3UTFA 3GDNA 4DGKA 1YQ4A 1P2EA 1D7YA 2GR0A 2C75A 3CPIG 4TM4A 1IJHA 4U8PA 1BF3A 4U8JA 2WDRA 3M13A 4U2SA 3OZ2A 1FEAA 5IQ4A 3K30A 4CBQA 4YWOA 5ER0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K8D A;  2BYB A;  1K4Q A;  1E39 A;  1JRX A;  4RG4 A;  4B66 A;  1PBD A;  5KVH A;  4NTD A;  2VRL A;  4J2W A;  1DOD A;  3VRB A;  4JY3 A;  4B69 A;  1VRQ B;  3UKK A;  4FDC B;  1E1N A;  1MO9 A;  3FIM B;  3CTY A;  4OCG A;  4ZCC A;  3ATQ A;  4K5S A;  3AEA A;  1GXF A;  4A65 A;  3AE7 A;  3F8R A;  2GQW A;  3GWD A;  2IID A;  5IQ1 A;  1EL7 A;  3AWI A;  4TLX A;  3UKL A;  1KNR A;  1N4V A;  2PHH A;  1VQW A;  4WCT A;  2YR4 A;  4CCR A;  1IUX A;  1K0J A;  1PBB A;  2XVE A;  3DJG X;  2BAB A;  3QFA A;  2V60 A;  3ALL A;  1PJ6 A;  3M12 A;  3B3R A;  4FK1 C;  3BI5 A;  4C3Y A;  4EM4 A;  1Q1R A;  4EQW A;  1JRY A;  4BJZ A;  1H7W A;  3LJP A;  4A99 A;  1COY A;  1Y0P A;  1YKJ A;  4A79 A;  1H86 A;  2WBA A;  3H8L A;  4JNA A;  1ZOV A;  3QFB A;  1B4V A;  4KX6 A;  4EQS A;  3BHF A;  4H4Y A;  2BC1 A;  4EQR A;  1ZOY A;  2RGJ A;  3BNU A;  3L1R A;  3NH3 X;  2WPC A;  2F5Z A;  3AD9 B;  1F8W A;  1S3E A;  1HYU A;  2FJE A;  2Y6R A;  3P1W A;  4H2N A;  1D4D A;  4GUV A;  4K2X A;  3CN8 A;  4YSY A;  3NLC A;  2YM2 A;  2EQ7 A;  2FJB A;  1TDE A;  2FJA A;  1PN0 A;  3FMW A;  2H89 A;  3CPJ G;  4A9W A;  3ICS A;  4O5Q A;  1D5T A;  1D4E A;  2OLO A;  2XLT A;  2WOV A;  1GSN A;  2JAE A;  2XFO A;  4TM0 A;  2AQJ A;  2GRT A;  2E5V A;  2WDQ A;  1UKV G;  1L9C A;  2B7S A;  2V3B A;  4I58 A;  2VQ7 A;  2ARD A;  1CJC A;  2VRM A;  3RP8 A;  3S61 A;  2BA9 A;  3UTG A;  4ECH A;  1JU2 A;  2YG3 A;  4IVO B;  1JOA A;  4MJW A;  3DGZ A;  2B9Y A;  5C3J A;  2EQ6 A;  3UP5 A;  1EBD A;  4BK3 A;  4U8I A;  2CUL A;  3GD3 A;  1RP0 A;  2GAG B;  1K0I A;  3NIX A;  3NYE A;  1N4W A;  1GTH A;  2CVJ A;  3ICT A;  3I3L A;  4EMJ A;  2IVE A;  2BK4 A;  4U2T A;  4WX1 A;  1QO8 A;  5EB5 A;  4AP3 A;  3EPT A;  3D8X A;  3K7T A;  5BRT A;  2AR8 A;  3H8I A;  4UP3 A;  4Z2U A;  3EAN A;  1GV4 A;  2YQU A;  4ZCD A;  3P4Q A;  2R0C A;  5DBJ A;  1GRB A;  2GF3 A;  3AYL A;  1VG0 A;  1KNP A;  5CKU A;  2C7G A;  3RP7 A;  4FX9 A;  2WP5 A;  2GH5 A;  2OA1 A;  2YG5 A;  1DOB A;  3UCL A;  1ZDL A;  1YQZ A;  4YXD A;  2VOU A;  2DKH A;  3KKJ A;  2H88 A;  1OJT A;  4OPC A;  1LJ1 A;  4ZN0 A;  2BS3 A;  3ALM A;  3DJD A;  2XLP A;  4BV6 A;  4BK2 A;  2TPR A;  3GSI A;  2XLR A;  4CCQ A;  1Q9I A;  1PBF A;  3Q6J A;  1Y56 B;  5KOW A;  1AOG A;  3ALJ A;  2XFN A;  4NTC A;  4C77 A;  3CNJ A;  4H7U A;  2YAU A;  3KU9 A;  1ZMC A;  2V61 A;  1NAA A;  2BK3 A;  2RGO A;  3KVE A;  2XFU A;  1O5W A;  5C2T A;  1PJ5 A;  5U25 A;  2Q6U A;  1BZL A;  1OJD A;  4U2L A;  5FMH A;  2X50 A;  3M0O A;  4A7A A;  3UKP A;  4AOX A;  4ADW A;  2B9W A;  1NHR A;  2Q0L A;  3IWA A;  1E7P A;  2FJD A;  4B67 A;  3NRN A;  3AD8 B;  3KD9 A;  4B68 A;  3NYC A;  3LZW A;  3QSM A;  2XVJ A;  3VRA A;  2OLN A;  2WU2 A;  3BNM A;  1GRA A;  1NEK A;  3KA7 A;  4GDP A;  3UKF A;  1FEB A;  3NHO X;  1ZMD A;  1XDI A;  1BGN A;  4CY8 A;  3VR8 A;  1ZP0 A;  3SM8 A;  1ELI A;  4UDP A;  4PAA A;  1B8S A;  2GR3 A;  3LAD A;  3FBS A;  5CQF A;  4B1B A;  1NHP A;  2EQ8 A;  3AE8 A;  4GF7 A;  5BUL A;  1PXA A;  4NZH A;  4YTP A;  1GEU A;  4OPD A;  1CC4 A;  3CNS A;  2JB2 A;  4RG3 A;  4C5O A;  2NPX A;  1GOS A;  4K22 A;  1V59 A;  4H4T A;  3P4R A;  1PHH A;  1KFY A;  2YG4 A;  3AE5 A;  5M0Z A;  3AYJ A;  1Y56 A;  2YWL A;  3K7M X;  1GAL A;  2JBV A;  5HXI A;  4UDR A;  2C66 A;  3QSS A;  3IC9 A;  3I6D A;  1ZX9 A;  3NT6 A;  3NNE A;  2BAC A;  1O94 A;  3F8P A;  1KF6 A;  2JB1 A;  2GAH B;  1ZKQ A;  5KOX A;  1KSS A;  3RHA A;  3K7Q X;  3DA1 A;  4H2P A;  2WP6 A;  2QAE A;  2ZZ0 A;  2R9Z A;  3DGH A;  3GD4 A;  4AP1 A;  5HY5 A;  4D04 A;  2XLU A;  4JQ9 A;  4EMW A;  1E6E A;  4GR1 A;  4JDR A;  5FS6 A;  5BUK A;  4LU6 A;  4Y4M A;  3SQP A;  3S5W A;  2W0H A;  1CC6 A;  2Z5Y A;  2YLZ A;  1B37 A;  1Q1W A;  2YG7 A;  1PS9 A;  4APN A;  4XXG A;  1D7L A;  1F3P A;  3AE2 A;  3PS9 A;  4H4Q A;  1FL2 A;  4H4W A;  3CPH G;  3BI4 A;  2YR5 A;  3AEF A;  3AD7 B;  3L8K A;  2QCU A;  4J34 A;  4C74 A;  4Z2T A;  4J36 A;  3GRT A;  1X31 B;  3PVC A;  1NHQ A;  2APG A;  1FCD A;  2GV8 A;  4NEW A;  2VVM A;  1GRE A;  3CNP A;  2VZ2 A;  2Z5X A;  1TYT A;  1CJ4 A;  3II4 A;  2BS2 A;  4USR A;  5KVI A;  3DME A;  1NPX A;  3UTH A;  1EL8 A;  4Z2R A;  3AE1 A;  2YM1 A;  4EQX A;  1QJD A;  2YG6 A;  2WEU A;  4IA5 A;  2X99 A;  1TDF A;  4X9N A;  4NTE A;  4M52 A;  4CNK A;  1NEN A;  1IUV A;  3ZDN A;  4B64 A;  1S2Y A;  3SGL A;  2B7R A;  1PJ7 A;  2VVL G;  3CGD A;  2WS3 A;  2XDO A;  3WE0 A;  1LQU A;  1ONF A;  2E1M A;  2B76 A;  5EBK A;  4GCM A;  1CHU A;  3AED A;  2XYO A;  3V3O A;  4H4P A;  3AEG A;  5KRQ A;  5HYM A;  2I0Z A;  3NGC X;  4A6N B;  3GRS A;  1MOK A;  1H84 A;  4OPU A;  3CIR A;  4H4X A;  4YKG A;  5IPY A;  3DK8 A;  2VVL A;  1OJ9 A;  2XVF A;  3AB1 A;  2UZZ A;  3IHM A;  1YY5 A;  2WHD A;  4GDE A;  3R9U A;  3GYI A;  2J3N A;  4RSL A;  5JCM A;  4PAB A;  5FS7 A;  4AOS A;  3Q9T A;  3UOZ A;  1PBC A;  4E0V A;  2WP9 A;  2C3D A;  5U63 A;  3IHG A;  4JN9 A;  1JRZ A;  1O95 A;  2YR6 A;  4CY6 A;  4EM3 A;  4U8O A;  1NG3 A;  4U8N A;  4Y4N A;  4LA1 A;  1XPQ A;  1DJQ A;  2XCG A;  3FG2 P;  4LII A;  1GTE A;  5FS8 A;  3AEC A;  3NK2 X;  4IV9 A;  4B65 A;  2GQF A;  1GT8 A;  3AE6 A;  2ZBW A;  4D03 A;  3G5Q A;  3ITJ A;  2GVC A;  1OJC A;  1GRH A;  2DKI A;  2Q0K A;  5J60 A;  4CRT A;  1H6V A;  3B6D A;  2X8H A;  2CFY A;  4REK A;  3T37 A;  2X8C A;  4X9M A;  2WOW A;  2C65 A;  2QA1 A;  1TRB A;  1E1M A;  4J31 A;  4UDQ A;  2BCG G;  3PO7 A;  2C73 A;  4U8M A;  2WET A;  1PXB A;  2XFQ A;  3AXB A;  3QJ4 A;  2C70 A;  3VRD B;  1EL9 A;  1VG9 A;  2GMJ A;  4A6N A;  3LOV A;  3GWF A;  1N4U A;  4YTN A;  1NDA A;  1CL0 A;  4H4S A;  3P4S A;  1Z6L A;  4IA6 A;  4USQ A;  3GMB A;  4H4U A;  3V76 A;  2IVD A;  2WOI A;  2V5Z A;  4AT0 A;  5KWF A;  3ZYX A;  2XFP A;  1ZY8 A;  1NG4 A;  1BWC A;  2C67 A;  3COX A;  2YLX A;  2OAL A;  2BS4 A;  2R0P A;  2X3N A;  2WDV A;  2BXR A;  3FPZ A;  2YVJ A;  1IUW A;  2JKC A;  4YKF A;  3DJJ A;  3LXD A;  4Z44 A;  1TYP A;  1W4X A;  1RSG A;  1H83 A;  4N9X A;  4DSH A;  4H4Z A;  3NKS A;  1L9E A;  2FBW A;  1CBO A;  2O9Z A;  4I59 A;  1XAN A;  5EB4 A;  3BI2 A;  3URH A;  3E1T A;  4YSZ A;  1FOH A;  2Y6Q A;  4OPT A;  5FS9 A;  2C64 A;  2R45 A;  2RGH A;  2WPF A;  2XVH A;  3AEB A;  2R0G A;  1GRG A;  2NVK X;  3NK0 X;  4BK1 A;  3DH9 A;  4CNJ A;  4YT0 A;  3CNT A;  3EAO A;  3F8D A;  3UOY A;  3NK1 X;  4OPG A;  1DOE A;  2JK6 A;  4H2R A;  3DK9 A;  3D1C A;  3SFD A;  3QSE A;  1BGJ A;  4DSG A;  4JNQ A;  1GRF A;  1GER A;  1LTX R;  5BVA A;  4EMI A;  3C4A A;  4BJY A;  4H50 A;  2B9X A;  2WQY A;  1DNC A;  2XVI A;  3ISH A;  4XWZ A;  4A5L A;  4BUR A;  1GET A;  4TLZ A;  1H7X A;  1XHC A;  1E1K A;  3QVR A;  2RAB A;  3UKH A;  2GMH A;  1TDK A;  2AAQ A;  1FEC A;  4U8L A;  4Y4L A;  1H82 A;  2GR1 A;  5TR3 A;  1K0L A;  1SEZ A;  2C72 A;  2WES A;  3CND A;  3NTA A;  3SFE A;  3CGE A;  3DJE A;  1P2H A;  2QA2 A;  2BXS A;  2WU5 A;  3HZL A;  3NN0 X;  5LV9 A;  2GEW A;  3LZX A;  2BC0 A;  1IUS A;  1M6I A;  4X4J A;  3H4K A;  4HB9 A;  3CGC A;  4K7Z A;  1CF3 A;  3KLJ A;  3ICR A;  5J7X A;  2X8G A;  2A89 A;  4XWR A;  3DK4 A;  1RYI A;  3RED A;  4B63 A;  4EIQ A;  3C4N A;  1PXC A;  3UOV A;  1IUU A;  4HA6 A;  2GR2 A;  3IF9 A;  3QVP A;  4AT2 A;  2WPE A;  3RNM A;  4YSX A;  1GPE A;  3NN6 X;  2YVG A;  1JNR A;  2ACZ A;  5HHF A;  1PDH A;  4TM3 A;  5KXJ A;  3VR9 A;  3UP4 A;  3LB8 A;  2V6O A;  2YVF A;  1REO A;  2GB0 A;  2V3A A;  2R4J A;  3GMC A;  3NG7 X;  1DXL A;  1JNZ A;  2R4E A;  4EIP A;  1LPF A;  1N1P A;  4OVI A;  1BKW A;  1S2Q A;  1M64 A;  1TDO A;  1YQ3 A;  4U8K A;  4JY2 A;  1LQT A;  3P4P A;  2PYX A;  2A87 A;  3AE9 A;  5GRT A;  3AE3 A;  4J56 A;  4NEV A;  3GYJ A;  4C3X A;  1ZK7 A;  4O5U A;  4OPL A;  4KPR A;  3P9U A;  2A8X A;  2XLS A;  5JCK A;  1KDG A;  1F8S A;  2YLT A;  4P9S A;  3UKA A;  4K5R A;  1CC2 A;  1VDC A;  5EOW A;  4DNA A;  5GSN A;  2C76 A;  5M10 A;  1GND A;  1JEH A;  3O0H A;  3JSK A;  3VQR A;  2C3C A;  1CJ2 A;  2VQB A;  1F6M A;  3BHK A;  4Z26 A;  2JB3 A;  4YSH A;  1QLB A;  1H81 A;  1F8R A;  3EF6 A;  3GDP A;  2BK5 A;  2CDU A;  2E4G A;  2R46 A;  3AE4 A;  1PBE A;  2TMD A;  1LVL A;  1NHS A;  4H2Q A;  3UKQ A;  1LV0 A;  3C96 A;  3G5R A;  3V3N A;  4Z43 A;  1DOC A;  5JCI A;  3RP6 A;  4YTM A;  5JCN A;  2EQ9 A;  1MXT A;  4H4V A;  5L46 A;  2ZZC A;  3AYI A;  3G5S A;  3OC4 A;  4Z24 A;  4IVM B;  3ATR A;  2HQM A;  3CGB A;  5JCL A;  1D4C A;  5U1O A;  1S3B A;  2YLS A;  1GRT A;  4ICY A;  2OAM A;  1IUT A;  4Z25 A;  1B5Q A;  2ZZB A;  4TM1 A;  2BCP A;  2YLR A;  3KPF A;  1L0V A;  1L9D A;  1DJN A;  1EL5 A;  3AEE A;  3NYF A;  1E1L A;  1KSU A;  1OJA A;  4OPI A;  3NTD A;  2Q7V A;  4H4R A;  4J33 A;  2YLW A;  1GES A;  3UTE A;  3ADA B;  4J57 A;  3ABV A;  4GRT A;  1CJ3 A;  1TDN A;  3UOX A;  4FK1 A;  3UTF A;  3GDN A;  4DGK A;  1YQ4 A;  1P2E A;  1D7Y A;  2GR0 A;  2C75 A;  3CPI G;  4TM4 A;  1IJH A;  4U8P A;  1BF3 A;  4U8J A;  2WDR A;  3M13 A;  4U2S A;  3OZ2 A;  1FEA A;  5IQ4 A;  3K30 A;  4CBQ A;  4YWO A;  5ER0 A; 
#chains in the Genus database with same CATH topology
 3EUB 3;  1PBD A;  5KVH A;  4FDC B;  3R10 A;  1MO9 A;  3FIM B;  4OCG A;  4ZCC A;  3UCD A;  4DYE A;  2GQW A;  3GWD A;  3UKL A;  2PHH A;  1IUX A;  4K1W A;  4FK1 C;  4C3Y A;  2C4C A;  1WUF A;  4A79 A;  3H8L A;  4JNA A;  4KX6 A;  3SX6 A;  2OZ3 A;  3BHF A;  4H4Y A;  2RGJ A;  3BNU A;  3AD9 B;  3P1W A;  4YSY A;  4GUV A;  3CN8 A;  2FJB A;  2DW6 A;  2GL5 A;  2OLO A;  3S5S A;  1GSN A;  2GSH A;  1KKO A;  2E5V A;  2WDQ A;  4I58 A;  1FFU C;  1CJC A;  3UJE A;  4IVO B;  4MJW A;  3ZLH A;  5C3J A;  2OX4 A;  1EBD A;  4U8I A;  2CUL A;  4K8G A;  1RP0 A;  3NIX A;  3NYE A;  3PWI A;  3ICT A;  3N4E A;  4EMJ A;  4GAV A;  4UP3 A;  3EAN A;  2YQU A;  4ZCD A;  2R0C A;  3NZG A;  2GF3 A;  3AYL A;  3RP7 A;  1KNP A;  3UCL A;  1ZDL A;  3HRD C;  3AMZ A;  1EC8 A;  3R1Z A;  2XLP A;  1MUC A;  4HCH A;  2XLR A;  4CCQ A;  1PBF A;  1Y56 B;  5KOW A;  5KMQ A;  3FXG A;  4H7U A;  1NAA A;  2BK3 A;  2RGO A;  3KVE A;  1O5W A;  5C2T A;  4A7A A;  3UKP A;  4ADW A;  2B9W A;  1NHR A;  3IWA A;  2GDQ A;  4J1O A;  3H70 A;  3QSM A;  3BOX A;  3NHO X;  1XDI A;  4CY8 A;  3JZU A;  4UDP A;  4PAA A;  3R0U A;  3NO1 A;  3FBS A;  5CQF A;  4B1B A;  1NHP A;  2ZAD A;  1PXA A;  3NVZ B;  1BQG A;  2YG4 A;  3AE5 A;  5M0Z A;  1PDY A;  4TVY A;  3QN3 A;  3IC9 A;  3NT6 A;  2BAC A;  1KF6 A;  2JB1 A;  4JHM A;  3T6C A;  5KOX A;  1KSS A;  3DGH A;  4M6U A;  1E6E A;  1JDF A;  5BUK A;  5FJR A;  3S5W A;  2W0H A;  3ZLF A;  1B37 A;  3V3W A;  4APN A;  4XXG A;  2HXU A;  3CPH G;  1X2G A;  4GIR A;  4J34 A;  3TW9 A;  1X31 B;  3A7U A;  2APG A;  1GRE A;  1NPX A;  3PG6 A;  1EL8 A;  2YM1 A;  4EQX A;  1TE6 A;  2YG6 A;  4IA5 A;  2X99 A;  3UJS A;  2PGW A;  4NTE A;  4M52 A;  2OQH A;  2OZ8 A;  4GGH A;  1P48 A;  3SGL A;  1PJ7 A;  3CGD A;  4GFI A;  3WE0 A;  1LQU A;  2B76 A;  4GCM A;  3ETR B;  3VCC A;  5KRQ A;  3D46 A;  4A6N B;  3CIR A;  3CAW A;  2W54 A;  1KN0 A;  5FS7 A;  1TZZ A;  3PFR A;  4GAP A;  2WP9 A;  4DN1 A;  3IHG A;  1T3Q C;  3GYX A;  1JRZ A;  2YR6 A;  4U8O A;  2XH7 A;  4Y4N A;  3UJR A;  1FHV A;  1GT8 A;  3AE6 A;  2ZBW A;  3H7V A;  3TWA A;  2GVC A;  1MNS A;  2Q0K A;  4CRT A;  1H6V A;  2CFY A;  4X9M A;  2QA1 A;  1E1M A;  3VC6 A;  2BCG G;  2C73 A;  1VG9 A;  1NDA A;  4USQ A;  3GMB A;  2IVD A;  5KWF A;  1NG4 A;  3ZVI A;  3COX A;  2YLX A;  2OAL A;  3KPK A;  2YVJ A;  1IUW A;  3T2Y A;  1RSG A;  1H83 A;  4DSH A;  4H4Z A;  1MRA A;  2FBW A;  5EB4 A;  3BI2 A;  2QJN A;  4GME A;  4OPT A;  5FS9 A;  3AEB A;  2POD A;  2R0G A;  3NK0 X;  4BK1 A;  2FYM A;  4DHG A;  4H2R A;  1JRP A;  2HXT A;  1GER A;  5BVA A;  4EMI A;  4BJY A;  2GGG A;  4XWZ A;  1E1K A;  3QVR A;  3QPE A;  3UKH A;  1TDK A;  2AAQ A;  3OW1 A;  1H82 A;  2GR1 A;  1K0L A;  2GEW A;  1M6I A;  4HB9 A;  4K7Z A;  5J7X A;  4XWR A;  2A89 A;  3DK4 A;  1RYI A;  4EIQ A;  5J04 A;  3C4N A;  3UOV A;  4HA6 A;  4AT2 A;  3IF9 A;  4YSX A;  3VR9 A;  3T8Q A;  3LB8 A;  2R4J A;  1DXL A;  2XSX A;  1YQ3 A;  4JY2 A;  2A87 A;  3AE9 A;  2AL2 B;  4O5U A;  4P9S A;  3UKA A;  4K5R A;  1VDC A;  5EOW A;  5GSN A;  2C76 A;  4HN8 A;  3VQR A;  2VQB A;  4Z26 A;  2JB3 A;  3RR1 A;  3EF6 A;  1PBE A;  2TMD A;  1LVL A;  1LV0 A;  4YTM A;  2EQ9 A;  1MXT A;  4MMW A;  3NXL A;  5BOE A;  5L46 A;  5FJU A;  4IVM B;  3U9I A;  4J33 A;  5U1O A;  4Z25 A;  1FO4 A;  3TJ4 A;  2FKP A;  4TM1 A;  5EU9 A;  3B97 A;  1KSU A;  3CYJ A;  3NTD A;  3ADA B;  3ABV A;  3UOX A;  4E8G A;  4ZOH B;  3GDN A;  4DGK A;  1P2E A;  2GR0 A;  2OO6 A;  4TM4 A;  4U8P A;  4CBQ A;  4K8D A;  1JRX A;  4K5S A;  4A65 A;  4Z1Y A;  3F8R A;  2IID A;  4DXK A;  2XVE A;  3JW7 A;  2V60 A;  3VC5 A;  3BI5 A;  4EM4 A;  1Q1R A;  3HYW A;  6ENL A;  1JRY A;  1H7W A;  3LJP A;  2OQY A;  1COY A;  1YKJ A;  1N62 C;  1ZOV A;  3CXO A;  3L1R A;  2F5Z A;  1S3E A;  4H2N A;  3STP A;  3FMW A;  1PN0 A;  3SZ0 A;  4A6G A;  3ICS A;  1D5T A;  2XLT A;  2WOV A;  1JPM A;  2AQJ A;  2MNR A;  2B7S A;  2QQ6 A;  4KWS A;  3RP8 A;  3UTG A;  4ECH A;  1FHU A;  3SY4 A;  4GGB A;  2OG9 A;  3GD3 A;  2GAG B;  2CVJ A;  2OPJ A;  4U2T A;  3RCY A;  3NVV B;  4Z2U A;  1DTN A;  3P4Q A;  2OA1 A;  2YG5 A;  2VOU A;  3KKJ A;  2H88 A;  1OJT A;  1LJ1 A;  1X2H A;  3DJD A;  3GY1 A;  1FFV C;  3DFY A;  4HNL A;  4DWD A;  4C77 A;  3CNJ A;  2PS2 A;  3KU9 A;  1ZMC A;  2XFU A;  2Q6U A;  1OJD A;  4U2L A;  2X50 A;  4ENL A;  4II3 A;  3GO2 A;  4E6M A;  2FJD A;  4B67 A;  1TKK A;  3NYC A;  3SZC A;  2OLN A;  1NEK A;  3UKF A;  1L8P A;  3SM8 A;  1ELI A;  1NEL A;  4GIS A;  4ROP A;  3CNS A;  2MUC A;  2PPG A;  4RG3 A;  4K22 A;  3P4R A;  1PHH A;  3AYJ A;  1Y56 A;  3K7M X;  4UDR A;  3QSS A;  1VDV A;  3N6H A;  3I6D A;  3NNE A;  2GAH B;  3DA1 A;  3CXB A;  2PU1 A;  2QAE A;  2R9Z A;  3GD4 A;  4AP1 A;  5FJO A;  5HY5 A;  2XLU A;  5FS6 A;  4Y4M A;  2OLA A;  2YLZ A;  2PP3 A;  2PU0 A;  3MKC A;  1PS9 A;  3PS9 A;  4H4W A;  4IZG A;  3AEF A;  3L8K A;  4Z2T A;  4J36 A;  2P8B A;  3FV9 A;  2XH2 A;  1CJ4 A;  2XH4 A;  3DME A;  3UTH A;  4GYP A;  2PTX A;  1RVK A;  3U4F A;  1NEN A;  2VVL G;  2XDO A;  4EWJ A;  1KCZ A;  1CHU A;  3CK5 A;  4H4P A;  5G5G B;  3AEG A;  5HYM A;  2PP0 A;  2I0Z A;  3NGC X;  1H84 A;  5IPY A;  3SXI A;  4GDE A;  3GYI A;  2J3N A;  4RSL A;  5JCM A;  4PAB A;  4E0V A;  3FYY A;  5U63 A;  3BJS A;  4JN9 A;  1O95 A;  4CY6 A;  4U8N A;  3L5O A;  4LA1 A;  2XCG A;  1GTE A;  1EC7 A;  4B65 A;  3GC2 A;  3G5Q A;  1OJC A;  1BKH A;  1GRH A;  5J60 A;  2WET A;  3AXB A;  2XFQ A;  3QJ4 A;  4E4U A;  4A6N A;  3GWF A;  1N4U A;  4YTN A;  1CL0 A;  3ZVH B;  1STZ A;  4A3R A;  3V76 A;  4AT0 A;  3ZYX A;  2XFP A;  1ZY8 A;  1BWC A;  4JN7 A;  2BS4 A;  2X3N A;  2BXR A;  1TYP A;  1W4X A;  4N9X A;  3NKS A;  1L9E A;  1CBO A;  4I59 A;  3URH A;  1FOH A;  3I6E A;  2Y6Q A;  3MQT A;  2RGH A;  3UJF A;  2XVH A;  1P43 A;  4YT0 A;  3UOY A;  4G7F A;  3D1C A;  3SN0 A;  3DG6 A;  4JNQ A;  5KMS A;  3V4B A;  2WQY A;  1DNC A;  2XVI A;  4A5L A;  3MSY A;  4FI4 A;  4BUR A;  4TLZ A;  2AKZ A;  4G9K A;  1XHC A;  2RAB A;  1XS2 A;  4HNC A;  1FEC A;  1WUE A;  2WES A;  1P2H A;  3ES7 A;  4NWZ A;  1JRO A;  4X4J A;  3H4K A;  3H12 A;  3KLJ A;  2X8G A;  4FP1 A;  3RNM A;  3I4K A;  3NN6 X;  1JNR A;  3HW2 A;  2XH0 A;  2ACZ A;  2V6O A;  2YVF A;  3NG7 X;  2R4E A;  4EIP A;  4U8K A;  1TDO A;  1LQT A;  4NEV A;  4C3X A;  4OPL A;  2A8X A;  2P3Z A;  1N60 C;  3SQS A;  4ZA0 A;  3N4F A;  3HYV A;  1GND A;  3T31 A;  1F6M A;  4YSH A;  3A7R A;  1F8R A;  3GDP A;  3SZF A;  2BK5 A;  2CDU A;  3AE4 A;  1NHS A;  3G5R A;  3V3N A;  1DOC A;  5JCI A;  5FJT A;  3AYI A;  1N61 C;  3OC4 A;  4G74 A;  2HQM A;  1S3B A;  2OAM A;  2QJM A;  3KPF A;  1L9D A;  3NYF A;  3FJ4 A;  3A7A A;  3UTE A;  1GES A;  1CJ3 A;  1TDN A;  2AL2 A;  3EKG A;  4U2S A;  2RDX A;  2OVL A;  4YWO A;  5ER0 A;  1K4Q A;  4NTD A;  4F4R A;  2VRL A;  1DOD A;  4J2W A;  4JY3 A;  3UXL A;  1VRQ B;  3UKK A;  1E1N A;  2E3T A;  3CTY A;  3ATQ A;  3AEA A;  4IL2 A;  4DX3 A;  1R6W A;  3AWI A;  4E5T A;  1KNR A;  1N4V A;  4CCR A;  4WCT A;  2YR4 A;  2PTY A;  3DJG X;  2BAB A;  3QFA A;  3ALL A;  3M12 A;  3RIT A;  4BJZ A;  1OEP A;  1H86 A;  2WBA A;  1B4V A;  4EQS A;  4EQR A;  1ZOY A;  2WPC A;  1F8W A;  3H8A A;  1D4D A;  3NLC A;  2PA6 A;  2YM2 A;  4IL0 A;  1V97 A;  4KPL A;  2FJA A;  3TCS A;  3CPJ G;  4O5Q A;  1D4E A;  2QGY A;  2GRT A;  1L9C A;  3P0W A;  3BSM A;  2VQ7 A;  2VRM A;  3S61 A;  2BA9 A;  1JU2 A;  2YG3 A;  2P88 A;  1VQZ A;  2B9Y A;  1H2I A;  4BK3 A;  3PK7 A;  2W55 A;  3TTE A;  2IVE A;  2BK4 A;  1QO8 A;  5EB5 A;  3EPT A;  3D8X A;  2AR8 A;  7ENL A;  2NQL A;  2QJJ A;  5CKU A;  2C7G A;  2WP5 A;  3NS1 B;  1DOB A;  5ENL A;  2DW7 A;  2BS3 A;  3TWB A;  3ALM A;  4BK2 A;  3GSI A;  4KEM A;  1AOG A;  2YAU A;  3OP2 A;  4K2S A;  5U25 A;  3S47 A;  3IJQ A;  3M0O A;  4AOX A;  2Q0L A;  1MDL A;  1E7P A;  2AL1 A;  3NRN A;  3AD8 B;  3UCC A;  3T9P A;  3R07 C;  3VRA A;  3BNM A;  3VA8 A;  4GDP A;  1FEB A;  1ZMD A;  1BGN A;  1B8S A;  3LAD A;  3AE8 A;  3SYI A;  1JPD X;  4YTP A;  4OPD A;  1CC4 A;  1N5W C;  4C5O A;  2NPX A;  4H4T A;  1KFY A;  3NVY B;  1GAL A;  2C66 A;  1ZX9 A;  1O94 A;  2BRY A;  3MWC A;  2HNE A;  3MY9 A;  4JDR A;  4HYR A;  1CC6 A;  2OFJ A;  1Q1W A;  3EEZ A;  1D7L A;  3D9X A;  4HPN A;  3AE2 A;  3AD7 B;  2QCU A;  4C74 A;  4IP5 A;  3GRT A;  2GV8 A;  1FCD A;  4NEW A;  5G5H B;  3CNP A;  3QKE A;  2Z5X A;  1TYT A;  4USR A;  2BS2 A;  5KVI A;  4Z2R A;  3IK4 A;  2WEU A;  4G8T A;  3SN1 A;  4CNK A;  4A35 A;  2W3R A;  3ZDN A;  2B7R A;  1ONF A;  2OZT A;  5EBK A;  3V3O A;  3R0K A;  1SB3 B;  3NVW B;  3GRS A;  4OPU A;  4IP4 A;  3DK8 A;  3IHM A;  3R9U A;  1YY5 A;  2WHD A;  4GYP C;  4AOS A;  3Q9T A;  3UOZ A;  1PBC A;  2C3D A;  1SJA A;  4EM3 A;  1XPQ A;  5FS8 A;  3NK2 X;  2GQF A;  3TOY A;  4D03 A;  2DKI A;  5BOF A;  3IJL A;  2WOW A;  1TRB A;  4J31 A;  2ONE A;  3D47 A;  1PXB A;  3VRD B;  2C70 A;  2GMJ A;  3JVA A;  3LOV A;  5IDZ A;  4H4S A;  3P4S A;  4IA6 A;  4YWS A;  3AM9 A;  1PDZ A;  3IJI A;  2WOI A;  3UJ2 A;  3V5F A;  2C67 A;  2WDV A;  4Z44 A;  3FPZ A;  5FJP A;  3DJJ A;  3LXD A;  1XAN A;  4MKS A;  3E1T A;  4YSZ A;  2C64 A;  2NVK X;  3CNT A;  1R0M A;  3EAO A;  3F8D A;  3ZLG A;  3SFD A;  3QSE A;  4DSG A;  1GRF A;  1LTX R;  3T2K A;  4H50 A;  2BRA A;  3ISH A;  3MUC A;  1GET A;  3ZVH A;  2GMH A;  1S7M A;  1ELS A;  3UXK A;  3SFE A;  3NTA A;  2BXS A;  2WU5 A;  5LV9 A;  2BC0 A;  3T4W A;  3CGC A;  3ICR A;  2QVH A;  4B63 A;  1IUU A;  2GR2 A;  4H19 A;  5KMP A;  1GPE A;  5HHF A;  5KXJ A;  3UP4 A;  2GB0 A;  3GMC A;  2OKT A;  3T2Z A;  4OVI A;  5GRT A;  4IT1 A;  5JCK A;  1KDG A;  1F8S A;  2YLT A;  4NNJ A;  1ECQ A;  1CC2 A;  4DNA A;  3TQP A;  3DES A;  2PP1 A;  3UGV A;  2C3C A;  1CJ2 A;  1QLB A;  1H81 A;  5JCN A;  4H4V A;  2ZZC A;  3G5S A;  4Z24 A;  5JCL A;  1D4C A;  2YLS A;  2ZZB A;  2BCP A;  2YLR A;  3FCP A;  1L0V A;  4H83 A;  1E1L A;  2Q7V A;  3SR6 B;  2YLW A;  4FK1 A;  3UTF A;  1IJH A;  4U8J A;  2WDR A;  3OZ2 A;  1FEA A;  3K30 A;  2BYB A;  1EBH A;  1E39 A;  4RG4 A;  4B66 A;  3VRB A;  3DEQ A;  4B69 A;  1GXF A;  3AE7 A;  5IQ1 A;  1EL7 A;  4G6H A;  4TLX A;  1VQW A;  1KD0 A;  1K0J A;  1PBB A;  1PJ6 A;  3B3R A;  4EQW A;  4A99 A;  1Y0P A;  3QFB A;  2BC1 A;  3NH3 X;  1HYU A;  2FJE A;  2Y6R A;  4K2X A;  2GGE A;  2EQ7 A;  1TDE A;  1KKR A;  2H89 A;  2P8C A;  3DG3 A;  4A9W A;  4JN8 A;  2PGE A;  2JAE A;  2XFO A;  4TM0 A;  1UKV G;  2V3B A;  2ARD A;  3P3B A;  3KUM A;  1JOA A;  3DGZ A;  2EQ6 A;  3UP5 A;  3DER A;  3HPF A;  3RGT A;  1K0I A;  1N4W A;  1GTH A;  3I3L A;  4AP3 A;  4WX1 A;  3K7T A;  5BRT A;  3H8I A;  1GV4 A;  3DFH A;  1GRB A;  5DBJ A;  3DIP A;  1VG0 A;  4FX9 A;  2GH5 A;  1YQZ A;  4YXD A;  1EBG A;  2DKH A;  4OPC A;  2P0I A;  2W3S A;  4ZN0 A;  5KNL A;  4BV6 A;  2TPR A;  3VDG A;  1Q9I A;  3Q6J A;  2QDE A;  3ALJ A;  3B9J B;  2XFN A;  4NTC A;  2V61 A;  3RO6 A;  2PCE A;  3NRZ B;  1PJ5 A;  3SJN A;  1YEY A;  1BZL A;  5FMH A;  3OPS A;  3KD9 A;  4B68 A;  3LZW A;  1E9I A;  2XVJ A;  2WU2 A;  1GRA A;  4J3Z A;  3KA7 A;  1SJB A;  1ZP0 A;  3VR8 A;  2GR3 A;  2EQ8 A;  4GF7 A;  3SN4 A;  5BUL A;  4NZH A;  4H1Z A;  1GEU A;  3HYX A;  2JB2 A;  1GOS A;  1V59 A;  4II2 A;  2YWL A;  2JBV A;  5HXI A;  3CMM A;  3F8P A;  1ZKQ A;  2CHR A;  3RHA A;  3K7Q X;  4H2P A;  1WYG A;  3SBF A;  3DDM A;  2WP6 A;  2ZZ0 A;  4G6G A;  4D04 A;  4JQ9 A;  4EMW A;  4GR1 A;  3V5C A;  4LU6 A;  3SQP A;  2Z5Y A;  2YG7 A;  3OZY A;  1F3P A;  3SZW A;  3CB3 A;  4H4Q A;  1FL2 A;  3BI4 A;  2YR5 A;  3PVC A;  1NHQ A;  2VVM A;  2VZ2 A;  3GD6 A;  4IHC A;  3II4 A;  1W6T A;  3AE1 A;  4E4F A;  1QJD A;  1TDF A;  1SJC A;  2XGZ A;  3DGB A;  4X9N A;  2I5Q A;  3R11 A;  1IUV A;  4B64 A;  1S2Y A;  2WS3 A;  4TVW A;  3Q45 A;  2E1M A;  3AED A;  2XYO A;  1MOK A;  4H4X A;  4G73 A;  4HCD A;  4YKG A;  2VVL A;  1OJ9 A;  2XVF A;  3AB1 A;  2UZZ A;  3ES8 A;  3RRA A;  2PTZ A;  4KT2 A;  3AN1 A;  5JRB A;  2PMQ A;  1NG3 A;  1DJQ A;  3AEC A;  3FG2 P;  4LII A;  4IV9 A;  1N5X A;  3ITJ A;  4M0X A;  3B6D A;  2X8H A;  4REK A;  3T37 A;  2X8C A;  3K1G A;  2C65 A;  2E5A A;  4UDQ A;  3PO7 A;  4U8M A;  1EL9 A;  3CT2 A;  3N6J A;  1Z6L A;  1JCT A;  4H4U A;  4H2H A;  2V5Z A;  3R25 A;  4Z17 A;  2R0P A;  4YKF A;  2JKC A;  3QTP A;  2GGH A;  2O9Z A;  2O56 A;  1NU5 A;  2R45 A;  2WPF A;  1GRG A;  3DH9 A;  4CNJ A;  2HZG A;  2ZC8 A;  3VFC A;  3NK1 X;  4OPG A;  1DOE A;  2JK6 A;  3DK9 A;  1BGJ A;  3DG7 A;  4ZCW A;  3C4A A;  2B9X A;  1IYX A;  1H7X A;  4X2P A;  4U8L A;  4Y4L A;  5TR3 A;  1SEZ A;  2C72 A;  3CND A;  1N63 C;  3CGE A;  3DJE A;  2QA2 A;  3HZL A;  3NN0 X;  3LZX A;  3OTR A;  1XPY A;  1IUS A;  3P93 A;  3OZM A;  1CF3 A;  2POZ A;  3RED A;  1MDR A;  1PXC A;  3QVP A;  2WPE A;  3I6T A;  1SJD A;  2YVG A;  1FIQ B;  2GGI A;  1PDH A;  4TM3 A;  3PWG A;  2V3A A;  1REO A;  1JNZ A;  1LPF A;  1N1P A;  1BKW A;  1S2Q A;  1M64 A;  3P4P A;  2PYX A;  3AE3 A;  4J56 A;  3GYJ A;  3TJI A;  1ZK7 A;  3ENL A;  4KPR A;  3P9U A;  2XLS A;  3SSZ A;  3NFU A;  1ZXI C;  2AKM A;  5M10 A;  1JEH A;  3O0H A;  4HCL A;  3JSK A;  3BHK A;  3Q4D A;  3QLD A;  2E4G A;  2R46 A;  4H2Q A;  3FVD A;  3UKQ A;  3C96 A;  4Z43 A;  3RP6 A;  1F9C A;  4MGG A;  3ATR A;  3CGB A;  4ICY A;  2GGJ A;  1GRT A;  2PSN A;  1IUT A;  3MZN A;  1B5Q A;  3T0K A;  1DJN A;  1EL5 A;  3AEE A;  4OPI A;  1OJA A;  4H4R A;  2QDD A;  3T14 A;  3THU A;  2PTW A;  1EC9 A;  4J57 A;  4GRT A;  5KMR A;  1YQ4 A;  1D7Y A;  2C75 A;  3VCN A;  3CPI G;  1BF3 A;  3M13 A;  5IQ4 A;  1ONE A;  1RM6 B; 
#chains in the Genus database with same CATH homology
 4K8D A;  2BYB A;  1K4Q A;  1E39 A;  1JRX A;  4RG4 A;  4B66 A;  1PBD A;  5KVH A;  4NTD A;  2VRL A;  4J2W A;  1DOD A;  3VRB A;  4JY3 A;  4B69 A;  1VRQ B;  3UKK A;  4FDC B;  1E1N A;  1MO9 A;  3FIM B;  3CTY A;  4OCG A;  4ZCC A;  3ATQ A;  4K5S A;  3AEA A;  1GXF A;  4A65 A;  3AE7 A;  3F8R A;  2GQW A;  3GWD A;  2IID A;  5IQ1 A;  1EL7 A;  3AWI A;  4G6H A;  4TLX A;  1KNR A;  1N4V A;  3UKL A;  2PHH A;  1VQW A;  4WCT A;  2YR4 A;  4CCR A;  1IUX A;  1K0J A;  1PBB A;  2XVE A;  3DJG X;  2BAB A;  3QFA A;  2V60 A;  3ALL A;  1PJ6 A;  3M12 A;  3B3R A;  4FK1 C;  3BI5 A;  4C3Y A;  4EM4 A;  1Q1R A;  3HYW A;  4EQW A;  1JRY A;  2C4C A;  4BJZ A;  1H7W A;  3LJP A;  4A99 A;  1COY A;  1Y0P A;  1YKJ A;  4A79 A;  1H86 A;  2WBA A;  3H8L A;  4JNA A;  1ZOV A;  3QFB A;  1B4V A;  4KX6 A;  3SX6 A;  4EQS A;  3BHF A;  4H4Y A;  2BC1 A;  4EQR A;  1ZOY A;  2RGJ A;  3BNU A;  3L1R A;  3NH3 X;  2WPC A;  2F5Z A;  3AD9 B;  1F8W A;  1S3E A;  1HYU A;  2FJE A;  2Y6R A;  3P1W A;  4H2N A;  1D4D A;  4GUV A;  4K2X A;  3CN8 A;  4YSY A;  3NLC A;  2YM2 A;  2EQ7 A;  2FJB A;  1TDE A;  2FJA A;  1PN0 A;  3FMW A;  2H89 A;  3CPJ G;  3SZ0 A;  4A9W A;  3ICS A;  4O5Q A;  1D5T A;  1D4E A;  2OLO A;  2XLT A;  2WOV A;  1GSN A;  2JAE A;  2XFO A;  4TM0 A;  2AQJ A;  2GRT A;  2E5V A;  2WDQ A;  1UKV G;  1L9C A;  2V3B A;  2B7S A;  4I58 A;  2VQ7 A;  2ARD A;  1CJC A;  2VRM A;  3RP8 A;  3S61 A;  2BA9 A;  3UTG A;  4ECH A;  1JU2 A;  2YG3 A;  4IVO B;  1JOA A;  3SY4 A;  4MJW A;  3DGZ A;  2B9Y A;  5C3J A;  2EQ6 A;  1H2I A;  3UP5 A;  1EBD A;  4BK3 A;  4U8I A;  2CUL A;  3GD3 A;  1RP0 A;  2GAG B;  1K0I A;  3NIX A;  3NYE A;  1N4W A;  1GTH A;  2CVJ A;  3ICT A;  3I3L A;  4EMJ A;  2IVE A;  2BK4 A;  4U2T A;  4WX1 A;  1QO8 A;  5EB5 A;  4AP3 A;  3EPT A;  3D8X A;  3K7T A;  5BRT A;  2AR8 A;  3H8I A;  4GAV A;  4UP3 A;  4Z2U A;  3EAN A;  1GV4 A;  2YQU A;  4ZCD A;  3P4Q A;  2R0C A;  5DBJ A;  1GRB A;  2GF3 A;  3AYL A;  1VG0 A;  1KNP A;  5CKU A;  2C7G A;  3RP7 A;  4FX9 A;  2WP5 A;  2GH5 A;  2OA1 A;  2YG5 A;  1DOB A;  3UCL A;  1ZDL A;  1YQZ A;  4YXD A;  2VOU A;  2DKH A;  3KKJ A;  2H88 A;  1OJT A;  4OPC A;  1LJ1 A;  4ZN0 A;  2BS3 A;  3ALM A;  3DJD A;  2XLP A;  4BV6 A;  5KNL A;  4BK2 A;  2TPR A;  3GSI A;  2XLR A;  4CCQ A;  1Q9I A;  1PBF A;  3Q6J A;  1Y56 B;  5KOW A;  1AOG A;  3ALJ A;  2XFN A;  4NTC A;  5KMQ A;  4C77 A;  3CNJ A;  4H7U A;  2YAU A;  3KU9 A;  1ZMC A;  2V61 A;  1NAA A;  2BK3 A;  2RGO A;  3KVE A;  2XFU A;  1O5W A;  5C2T A;  1PJ5 A;  5U25 A;  2Q6U A;  1BZL A;  1OJD A;  4U2L A;  5FMH A;  2X50 A;  3M0O A;  4A7A A;  3UKP A;  4AOX A;  4ADW A;  4II3 A;  2B9W A;  1NHR A;  2Q0L A;  3IWA A;  1E7P A;  2FJD A;  4B67 A;  3NRN A;  3AD8 B;  3KD9 A;  4B68 A;  3NYC A;  3LZW A;  3SZC A;  3QSM A;  2XVJ A;  3VRA A;  2OLN A;  2WU2 A;  3BNM A;  1GRA A;  1NEK A;  3KA7 A;  4GDP A;  3UKF A;  1FEB A;  3NHO X;  1ZMD A;  1XDI A;  1BGN A;  4CY8 A;  3VR8 A;  1ZP0 A;  3SM8 A;  1ELI A;  4UDP A;  4PAA A;  1B8S A;  2GR3 A;  3LAD A;  3FBS A;  5CQF A;  4B1B A;  1NHP A;  2EQ8 A;  3AE8 A;  4GF7 A;  3SYI A;  5BUL A;  1PXA A;  4NZH A;  4YTP A;  1GEU A;  4OPD A;  1CC4 A;  3CNS A;  2JB2 A;  3HYX A;  4RG3 A;  4C5O A;  2NPX A;  1GOS A;  4K22 A;  1V59 A;  4H4T A;  3P4R A;  1PHH A;  1KFY A;  2YG4 A;  3AE5 A;  5M0Z A;  3AYJ A;  1Y56 A;  4II2 A;  2YWL A;  3K7M X;  1GAL A;  2JBV A;  5HXI A;  4UDR A;  2C66 A;  3QSS A;  3IC9 A;  3I6D A;  1ZX9 A;  3NT6 A;  3NNE A;  2BAC A;  1O94 A;  3CMM A;  1KF6 A;  3F8P A;  2JB1 A;  2GAH B;  1ZKQ A;  5KOX A;  1KSS A;  3RHA A;  3K7Q X;  3DA1 A;  4H2P A;  2WP6 A;  2QAE A;  2ZZ0 A;  2R9Z A;  2BRY A;  3DGH A;  4G6G A;  3GD4 A;  4AP1 A;  5HY5 A;  4D04 A;  2XLU A;  4JQ9 A;  4EMW A;  1E6E A;  4GR1 A;  4JDR A;  5FS6 A;  5BUK A;  4LU6 A;  4Y4M A;  3SQP A;  3S5W A;  2W0H A;  1CC6 A;  2Z5Y A;  2YLZ A;  1B37 A;  1Q1W A;  2YG7 A;  1PS9 A;  4APN A;  4XXG A;  1D7L A;  1F3P A;  3D9X A;  3AE2 A;  3SZW A;  3PS9 A;  4H4Q A;  1FL2 A;  4H4W A;  3CPH G;  3BI4 A;  2YR5 A;  3AEF A;  3AD7 B;  3L8K A;  2QCU A;  4J34 A;  4C74 A;  4Z2T A;  4J36 A;  3GRT A;  1X31 B;  3PVC A;  1NHQ A;  2APG A;  1FCD A;  2GV8 A;  4NEW A;  2VVM A;  1GRE A;  3CNP A;  2VZ2 A;  2Z5X A;  1TYT A;  1CJ4 A;  3II4 A;  2BS2 A;  4USR A;  5KVI A;  3DME A;  1NPX A;  3UTH A;  3PG6 A;  1EL8 A;  4Z2R A;  3AE1 A;  2YM1 A;  4EQX A;  1QJD A;  2YG6 A;  2WEU A;  4IA5 A;  2X99 A;  1TDF A;  4X9N A;  4NTE A;  4M52 A;  4CNK A;  1NEN A;  1IUV A;  3ZDN A;  4B64 A;  1S2Y A;  3SGL A;  2B7R A;  1PJ7 A;  2VVL G;  3CGD A;  2WS3 A;  2XDO A;  3WE0 A;  1LQU A;  1ONF A;  2E1M A;  2B76 A;  5EBK A;  4GCM A;  1CHU A;  3AED A;  2XYO A;  3V3O A;  4H4P A;  3AEG A;  5KRQ A;  5HYM A;  2I0Z A;  3NGC X;  4A6N B;  3GRS A;  1MOK A;  1H84 A;  4OPU A;  3CIR A;  4H4X A;  4G73 A;  4YKG A;  5IPY A;  3DK8 A;  3SXI A;  2VVL A;  1OJ9 A;  2XVF A;  3AB1 A;  2UZZ A;  3IHM A;  1YY5 A;  2WHD A;  4GDE A;  3R9U A;  3GYI A;  1KN0 A;  2J3N A;  4RSL A;  5JCM A;  4PAB A;  5FS7 A;  4AOS A;  3Q9T A;  4GAP A;  3UOZ A;  1PBC A;  4E0V A;  2WP9 A;  2C3D A;  5U63 A;  3IHG A;  3GYX A;  4JN9 A;  1JRZ A;  1O95 A;  2YR6 A;  5JRB A;  4EM3 A;  4U8O A;  1NG3 A;  3L5O A;  4U8N A;  4LA1 A;  1XPQ A;  4Y4N A;  1DJQ A;  2XCG A;  3FG2 P;  4LII A;  1GTE A;  5FS8 A;  3AEC A;  3NK2 X;  4IV9 A;  4B65 A;  2GQF A;  1GT8 A;  3AE6 A;  2ZBW A;  4D03 A;  3G5Q A;  3ITJ A;  2GVC A;  1OJC A;  1GRH A;  2DKI A;  2Q0K A;  5J60 A;  4CRT A;  1H6V A;  3B6D A;  2X8H A;  2CFY A;  4REK A;  3T37 A;  2X8C A;  4X9M A;  2WOW A;  2C65 A;  2QA1 A;  1TRB A;  1E1M A;  4J31 A;  4UDQ A;  2BCG G;  3PO7 A;  2C73 A;  4U8M A;  2WET A;  1PXB A;  2XFQ A;  3AXB A;  3QJ4 A;  2C70 A;  3VRD B;  1EL9 A;  1VG9 A;  2GMJ A;  4A6N A;  3LOV A;  3GWF A;  1N4U A;  4YTN A;  1NDA A;  1CL0 A;  4H4S A;  3P4S A;  1Z6L A;  4IA6 A;  4USQ A;  3GMB A;  4H4U A;  3V76 A;  2IVD A;  2WOI A;  2V5Z A;  4AT0 A;  5KWF A;  3ZYX A;  2XFP A;  1ZY8 A;  1NG4 A;  1BWC A;  2C67 A;  3COX A;  2YLX A;  2OAL A;  3KPK A;  2BS4 A;  2R0P A;  2X3N A;  2WDV A;  2BXR A;  3FPZ A;  2YVJ A;  1IUW A;  2JKC A;  4YKF A;  3DJJ A;  3LXD A;  4Z44 A;  1TYP A;  3T2Y A;  4CY6 A;  1W4X A;  1RSG A;  1H83 A;  4N9X A;  4DSH A;  4H4Z A;  3NKS A;  1L9E A;  2FBW A;  1CBO A;  2O9Z A;  4I59 A;  1XAN A;  5EB4 A;  3BI2 A;  3URH A;  3E1T A;  4YSZ A;  1FOH A;  2Y6Q A;  4OPT A;  5FS9 A;  2C64 A;  2R45 A;  2RGH A;  2WPF A;  2XVH A;  3AEB A;  2R0G A;  1GRG A;  2NVK X;  3NK0 X;  4BK1 A;  3DH9 A;  4CNJ A;  4YT0 A;  3CNT A;  3EAO A;  3F8D A;  3UOY A;  3NK1 X;  4OPG A;  1DOE A;  2JK6 A;  4H2R A;  3DK9 A;  3D1C A;  3SFD A;  3QSE A;  1BGJ A;  4DSG A;  4JNQ A;  5KMS A;  1GRF A;  1GER A;  1LTX R;  3T2K A;  5BVA A;  4EMI A;  3C4A A;  4BJY A;  4H50 A;  2B9X A;  2WQY A;  1DNC A;  2BRA A;  2XVI A;  3ISH A;  4XWZ A;  4A5L A;  4BUR A;  1GET A;  4TLZ A;  1H7X A;  4G9K A;  1XHC A;  1E1K A;  3QVR A;  2RAB A;  3UKH A;  2GMH A;  1TDK A;  2AAQ A;  1FEC A;  1S7M A;  4U8L A;  4Y4L A;  1H82 A;  2GR1 A;  5TR3 A;  1K0L A;  1SEZ A;  2C72 A;  2WES A;  3CND A;  3NTA A;  3SFE A;  3CGE A;  3DJE A;  1P2H A;  2QA2 A;  2BXS A;  2WU5 A;  3HZL A;  3NN0 X;  4NWZ A;  5LV9 A;  2GEW A;  3LZX A;  2BC0 A;  1IUS A;  1M6I A;  4X4J A;  3H4K A;  4HB9 A;  3CGC A;  4K7Z A;  1CF3 A;  3KLJ A;  3ICR A;  5J7X A;  2X8G A;  2A89 A;  4XWR A;  3DK4 A;  1RYI A;  3RED A;  4B63 A;  4EIQ A;  3C4N A;  1PXC A;  3UOV A;  1IUU A;  4HA6 A;  2GR2 A;  3IF9 A;  3QVP A;  4AT2 A;  2WPE A;  3RNM A;  4YSX A;  5KMP A;  1GPE A;  3NN6 X;  2YVG A;  1JNR A;  2ACZ A;  5HHF A;  1PDH A;  4TM3 A;  5KXJ A;  3VR9 A;  3UP4 A;  3LB8 A;  2V6O A;  2V3A A;  2YVF A;  1REO A;  2GB0 A;  2R4J A;  3GMC A;  3NG7 X;  1DXL A;  1JNZ A;  2R4E A;  4EIP A;  1LPF A;  3T2Z A;  1N1P A;  4OVI A;  1BKW A;  1S2Q A;  1M64 A;  1TDO A;  1YQ3 A;  4U8K A;  4JY2 A;  1LQT A;  3P4P A;  2PYX A;  2A87 A;  3AE9 A;  5GRT A;  3AE3 A;  4J56 A;  4NEV A;  3GYJ A;  4C3X A;  1ZK7 A;  4O5U A;  4OPL A;  4KPR A;  3P9U A;  2A8X A;  2XLS A;  5JCK A;  1KDG A;  1F8S A;  2YLT A;  4P9S A;  3UKA A;  4NNJ A;  4K5R A;  1CC2 A;  1VDC A;  5EOW A;  4DNA A;  5GSN A;  2C76 A;  5M10 A;  3HYV A;  1GND A;  1JEH A;  3O0H A;  3JSK A;  3T31 A;  2C3C A;  1CJ2 A;  2VQB A;  3VQR A;  1F6M A;  3BHK A;  4Z26 A;  2JB3 A;  4YSH A;  1QLB A;  1H81 A;  1F8R A;  3EF6 A;  3GDP A;  3SZF A;  2BK5 A;  2CDU A;  2E4G A;  2R46 A;  3AE4 A;  1PBE A;  2TMD A;  1LVL A;  1NHS A;  4H2Q A;  3UKQ A;  1LV0 A;  3C96 A;  3G5R A;  3V3N A;  4Z43 A;  1DOC A;  5JCI A;  3RP6 A;  4YTM A;  5JCN A;  2EQ9 A;  1MXT A;  4H4V A;  5L46 A;  2ZZC A;  3AYI A;  3G5S A;  3OC4 A;  4Z24 A;  4G74 A;  4IVM B;  3ATR A;  2HQM A;  3CGB A;  5JCL A;  1D4C A;  5U1O A;  1S3B A;  2YLS A;  1GRT A;  4ICY A;  2OAM A;  1IUT A;  4Z25 A;  1B5Q A;  2ZZB A;  4TM1 A;  2BCP A;  2YLR A;  3KPF A;  1L0V A;  1L9D A;  3T0K A;  1DJN A;  1EL5 A;  3AEE A;  3NYF A;  1E1L A;  1KSU A;  1OJA A;  4OPI A;  3NTD A;  2Q7V A;  4H4R A;  4J33 A;  3T14 A;  2YLW A;  1GES A;  3UTE A;  3ADA B;  4J57 A;  3ABV A;  4GRT A;  1CJ3 A;  1TDN A;  3UOX A;  4FK1 A;  5KMR A;  3UTF A;  3GDN A;  4DGK A;  1YQ4 A;  1P2E A;  1D7Y A;  2GR0 A;  2C75 A;  3CPI G;  4TM4 A;  1IJH A;  4U8P A;  1BF3 A;  4U8J A;  2WDR A;  3M13 A;  4U2S A;  3OZ2 A;  1FEA A;  5IQ4 A;  3K30 A;  4CBQ A;  4YWO A;  5ER0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...