1XHCA

Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779-001
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
351
structure length
346
Chain Sequence
SKVVIVGNGPGGFELAKQLSQTYEVTVIDKEPVPYYSKPMLSHYIAGFIPRNRLFPYSLDWYRKRGIEIRLAEEAKLIDRGRKVVITEKGEVPYDTLVLATGARAREPQIKGKEYLLTLRTIFDADRIKESIENSGEAIIIGGGFIGLELAGNLAEAGYHVKLIHRGAMFLGLDEELSNMIKDMLEETGVKFFLNSELLEANEEGVLTNSGFIEGKVKICAIGIVPNVDLARRSGIHTGRGILIDDNFRTSAKDVYAIGDCAEYSGIIAGTAKAAMEQARVLADILKGEPRRYNFKFRSTVFKFGKLQIAIIGNTKGEGKWIEDNTKVFYIGAVVFNDIRKATKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH oxidase /nitrite reductase
publication title NADH oxidase /nitrite reductase from Pyrococcus furiosus Pfu-1140779-001
rcsb
source organism Pyrococcus furiosus
total genus 105
structure length 346
sequence length 351
ec nomenclature
pdb deposition date 2004-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1xhcA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xhcA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xhcA02
3ALLA 4HB9A 3ATQA 3H8LA 4RSLA 1GNDA 1VRQB 3LOVA 4EM4A 3NTDA 2C72A 1OJAA 2Q6UA 3AEFA 3ADAB 5FS9A 1TDEA 2QAEA 5CKUA 3DGZA 1DNCA 1H7WA 1DJQA 1EBDA 3WE0A 4H4RA 2VOUA 4TM0A 3AE1A 4H4XA 2XLSA 1TRBA 4YSZA 1GESA 2YR5A 5KRQA 3ITJA 3JSKA 2R46A 5EOWA 1GALA 1ZMDA 3AB1A 4APNA 1QO8A 3BI5A 4H2PA 4J34A 4OPTA 4TLZA 2BS3A 1QLBA 4U8LA 1EL5A 2C65A 4H4WA 2BCPA 3LADA 2OLNA 1NHQA 1BKWA 1PBDA 2C3DA 3DK4A 2CDUA 2FJAA 1IJHA 3GD3A 2BK3A 5DBJA 2WOIA 2XFNA 1E39A 4Z24A 1PHHA 3EPTA 2A8XA 2Y6QA 4JY2A 4I59A 3UTEA 5JCKA 2TPRA 3L8KA 3KD9A 4ZCCA 4ICYA 4YT0A 2XFUA 1Y56A 1K0JA 2B76A 4EQRA 2WDQA 4ADWA 1LJ1A 4O5UA 3C4AA 1BGJA 2GRTA 1CF3A 3ABVA 2RABA 5LV9A 5JCLA 4TM3A 3UOVA 5L46A 1XDIA 2XLPA 3REDA 1E1MA 3SGLA 5J7XA 1GRFA 3QFBA 3O0HA 3LZXA 1O5WA 2WESA 4NTEA 4YTNA 1OJ9A 1JRZA 1VG9A 2BABA 2H88A 2PHHA 3AD7B 4U8JA 3UOXA 2GEWA 4DSGA 2YG4A 3UKLA 4C3YA 4U2LA 2I0ZA 2OA1A 2YLZA 3PS9A 4CNKA 1JEHA 4LU6A 1D4DA 2ZZBA 1O94A 3AE7A 2RGJA 2XVJA 4A99A 4H4PA 1N4VA 3KA7A 2YVJA 1L9DA 3F8DA 4IA6A 1IUXA 3NHOX 2C67A 3ZDNA 1H83A 4FX9A 2WEUA 2B9YA 4M52A 2YG7A 1CJ3A 2ARDA 1CC6A 2WP6A 1B37A 4DSHA 1N4WA 2VVLG 4U2SA 1KNRA 3GDPA 3FIMB 2E4GA 3KVEA 1GRAA 3UTHA 4NTDA 4H4QA 1CBOA 2QA1A 4IA5A 4U2TA 1ZOVA 2WP9A 3BNMA 4RG3A 4YTPA 1GPEA 4Z2RA 2X8GA 1IUSA 3EANA 1L9CA 1VQWA 4YKFA 3IC9A 5M0ZA 4BV6A 3V76A 2QA2A 1H84A 4UDPA 2WPFA 4NEWA 3ATRA 2C7GA 3C4NA 1DJNA 3RP6A 4OPIA 2HQMA 2AR8A 3QSSA 1XPQA 4X9NA 4E0VA 1ZOYA 3AD9B 2V5ZA 5M10A 2W0HA 3GD4A 3AE5A 5BVAA 1KSUA 1PDHA 5BRTA 3BI2A 1LQUA 3VRBA 1FEAA 4Z26A 3DJEA 3AD8B 1F3PA 5U1OA 2WDRA 3AEEA 4K5SA 4CNJA 5IQ4A 1GRHA 2EQ7A 4AP1A 4JN9A 2TMDA 2GV8A 3UKQA 1DXLA 2PYXA 1F8SA 4USRA 3S5WA 1GOSA 1S2QA 3QVPA 1OJTA 3B6DA 3SFEA 3NN6X 1CJCA 2ZBWA 3I6DA 4IVOB 3ICSA 4BJZA 3F8PA 1P2EA 4B68A 1E6EA 4YTMA 4U8IA 4MJWA 3QSEA 2BXRA 1B5QA 3NK1X 1PBCA 3QVRA 3AE2A 4PABA 5KVHA 2FJEA 3P9UA 4B66A 5TR3A 1H86A 4KPRA 2R0PA 3UOZA 3NN0X 4EMJA 1MO9A 1CC4A 1NDAA 2XLUA 3CNTA 4C77A 4GDEA 3L1RA 2E1MA 2GMHA 3IHMA 4FK1A 2YR6A 1GT8A 3UKKA 3H4KA 3AE4A 4K5RA 1GERA 2GMJA 1PS9A 3AEAA 1DOBA 5KOWA 2ZZCA 3GRTA 5ER0A 3M0OA 2JK6A 3NGCX 3NLCA 4OCGA 3UOYA 4YSHA 3AYJA 2JKCA 3NIXA 1PXAA 3BI4A 3ALJA 4H2RA 4DGKA 1ZKQA 1PXBA 3CNSA 4CY8A 1VDCA 4K7ZA 5FS8A 2YLRA 3HZLA 5HHFA 2X8CA 2FBWA 1BZLA 2YVGA 1FL2A 3NRNA 3NYCA 4JY3A 4PAAA 4A5LA 3GWFA 1GRTA 4IVMB 4BJYA 2IIDA 4B67A 2YLTA 4AT2A 3VQRA 4YWOA 3S61A 4XXGA 3DH9A 1QJDA 4U8NA 4A6NB 4CRTA 3UTGA 3ICTA 2WPEA 1N1PA 2JB3A 3VRAA 2XFPA 4GR1A 4H4TA 1ZMCA 5EB4A 4A65A 3FBSA 1GTEA 2BC1A 1KFYA 3F8RA 3RP8A 3D1CA 2GQFA 2GH5A 1E1NA 4GUVA 4CBQA 2Z5XA 3T37A 1Z6LA 2RGHA 2C75A 4YKGA 2BCGG 1K0LA 1NAAA 3SM8A 4D04A 3P4RA 3BHKA 4EMIA 3NYEA 1GRGA 4B69A 2C70A 1CC2A 2VVMA 5HY5A 3QSMA 3NKSA 5CQFA 4H2NA 1TYPA 3GWDA 3DA1A 2WDVA 2BK5A 5KVIA 4OPGA 4OPDA 4OVIA 1K4QA 3UKHA 3IWAA 4XWRA 5GRTA 1B4VA 2A87A 1H6VA 4AOSA 3P4SA 4H4VA 4DNAA 1ELIA 1YQ3A 1GSNA 2XVHA 3K7TA 3RHAA 3RP7A 3R9UA 1NHSA 2B9WA 2GAGB 2WU5A 5C3JA 3AECA 2J3NA 4BK3A 2WQYA 1L0VA 4B64A 3G5RA 4Z25A 2EQ8A 1COYA 4LA1A 3AEBA 5FMHA 3AYIA 3NYFA 4J33A 4TLXA 4J31A 1LVLA 1GV4A 1BGNA 1E1LA 3Q6JA 4OPLA 4LIIA 4NEVA 1NENA 3CTYA 4JDRA 4U8PA 4Y4NA 2VQ7A 4H4SA 3AE6A 4NTCA 1GXFA 2IVEA 3ZYXA 3G5SA 4Z44A 2JB1A 3IF9A 3LB8A 3GMCA 4J56A 5FS6A 1LV0A 1NG3A 2R4JA 3AWIA 1LQTA 4D03A 2YM1A 1F8WA 4U8MA 3UKFA 4Z43A 3M13A 2ACZA 3UP5A 2IVDA 1NHRA 3GYIA 3P1WA 2RGOA 2V60A 2WHDA 1ZDLA 4H50A 4H7UA 4A7AA 2QCUA 2BS4A 1REOA 4Y4MA 1MXTA 1TDOA 2BXSA 1GRBA 1IUTA 3ICRA 1Q9IA 1VG0A 1YQZA 3PVCA 1JNZA 1HYUA 4GCMA 2CVJA 1NPXA 3C96A 4AOXA 5HYMA 3CPJG 3NK2X 1KDGA 2JBVA 2GAHB 2GR3A 2GB0A 1CJ2A 3AEGA 3LXDA 4Z2TA 1JRXA 4C5OA 2UZZA 1D4EA 2WPCA 2V6OA 2XFQA 3M12A 3B3RA 2O9ZA 3SFDA 2GR2A 1JNRA 2V3AA 2Z5YA 4XWZA 3GMBA 3KLJA 1ZP0A 3CPHG 1D7YA 4UDQA 2VZ2A 4EQXA 1PJ5A 2YG5A 4A9WA 3K7QX 5KOXA 5KWFA 1KNPA 3EF6A 1PN0A 3UTFA 2BACA 3AE8A 2XLRA 4KX6A 3II4A 1IUVA 2YR4A 1S3BA 4J57A 2XVEA 3KPFA 1GREA 2B7SA 2BYBA 4TM1A 3VR9A 1CL0A 4GDPA 4WCTA 3KU9A 4A79A 3E1TA 1F6MA 1SEZA 1UKVG 2YLSA 5KXJA 1M6IA 3OZ2A 2B9XA 4BK1A 1GTHA 3FMWA 1RSGA 4RG4A 1RP0A 3COXA 4B1BA 2XCGA 4ZCDA 2YAUA 2C66A 5FS7A 2Y6RA 1FEBA 3K7MX 3GYJA 3NNEA 2H89A 4YSYA 5BUKA 2CULA 1PBEA 5EB5A 1H7XA 5J60A 1AOGA 3URHA 3GSIA 2F5ZA 5JCIA 4ECHA 3UKAA 2GVCA 3NTAA 2GR1A 4EMWA 1S3EA 2YM2A 3QFAA 2DKIA 2NPXA 3AYLA 3P4PA 4JNQA 4YXDA 4O5QA 1FOHA 2OALA 5GSNA 4H4ZA 2XVIA 2WETA 4BK2A 1E1KA 1PJ7A 4UP3A 4NZHA 3CN8A 2OAMA 4JQ9A 1Q1WA 4WX1A 1TDNA 3ALMA 1LPFA 2YLWA 4Y4LA 1S2YA 2WOVA 2YLXA 5BULA 2R45A 1YQ4A 2GF3A 2VRMA 3DGHA 4IV9A 1E7PA 2R0CA 2BC0A 2X3NA 2BS2A 4FK1C 4K8DA 4J36A 2AAQA 2X8HA 3UP4A 1NHPA 1EL7A 1F8RA 2GR0A 1BWCA 1MOKA 1D7LA 1NG4A 2E5VA 2Q0KA 2WOWA 2WU2A 1EL8A 3QJ4A 4OPUA 4FDCB 3CNPA 5JCNA 2XYOA 1XANA 1NEKA 1EL9A 1OJDA 3DK8A 5HXIA 1PBBA 4C3XA 1DOCA 2XLTA 1CJ4A 4REKA 4ZN0A 4I58A 1ZK7A 3VR8A 4U8OA 2R0GA 3G5QA 4J2WA 1H82A 4CCQA 1ZY8A 3CNDA 4CCRA 1FECA 3V3OA 1GEUA 4H4UA 1GETA 5C2TA 4U8KA 4Z2UA 2C76A 1D5TA 3KKJA 3CPIG 2YG3A 4B65A 3GDNA 4EIPA 2A89A 1CHUA 1YY5A 3NK0X 2VQBA 2JB2A 1L9EA 3P4QA 1V59A 5IQ1A 3BHFA 3DMEA 2VVLA 1TYTA 2WBAA 4BURA 3DK9A 3H8IA 4GF7A 3K30A 3DJDA 4OPCA 1O95A 3CGBA 2C73A 3FPZA 3AEDA 4GRTA 2R4EA 2YWLA 4CY6A 2YQUA 5EBKA 3LZWA 2EQ9A 1ZX9A 2APGA 3IHGA 1D4CA 1B8SA 2B7RA 3AE9A 3OC4A 4JNAA 3DJGX 3GRSA 2Q7VA 3EAOA 3CNJA 4A6NA 1K0IA 4USQA 3VRDB 2CFYA 4EM3A 2Q0LA 3V3NA 1YKJA 1DODA 4X4JA 1JRYA 1DOEA 2XFOA 1XHCA 4YSXA 3D8XA 1Y0PA 2YVFA 1BF3A 2JAEA 3UCLA 4EQSA 2OLOA 3BNUA 2ZZ0A 1IUUA 3PO7A 2C3CA 2BA9A 1JU2A 5IPYA 4AT0A 1M64A 4X9MA 2VRLA 2XVFA 1H81A 4H4YA 1Q1RA 2FJBA 4H2QA 1LTXR 1PJ6A 3NT6A 3Q9TA 2V61A 1Y56B 4K2XA 1TDFA 2X50A 3CIRA 3UKPA 1P2HA 2WP5A 4C74A 3NG7X 2FJDA 4P9SA 3CGDA 1N4UA 2X99A 2AQJA 2WS3A 1PBFA 2XDOA 2V3BA 1ONFA 2YG6A 5U63A 4EIQA 1W4XA 4EQWA 4AP3A 1FCDA 2BK4A 5JCMA 4N9XA 3DJJA 3AXBA 3ISHA 3FG2P 2DKHA 2C64A 1IUWA 1KF6A 3RNMA 3LJPA 2GQWA 1JOAA 1KSSA 4UDRA 1TDKA 3NH3X 2EQ6A 2R9ZA 1PXCA 3I3LA 3CGCA 1OJCA 4TM4A 3SQPA 1X31B 4B63A 1RYIA 2NVKX 4HA6A 3AE3A 3CGEA 4K22A 5U25A
chains in the Genus database with same CATH superfamily
3ALLA 2OQYA 3H8LA 2GGGA 1JDFA 3HYWA 5FS9A 3FV9A 3DGZA 3WE0A 2VOUA 1EC7A 4H4XA 2XLSA 3ETRB 3UJFA 5EOWA 3JZUA 3UXKA 1QO8A 3BI5A 2BS3A 1EL5A 1SJCA 2P0IA 1BKWA 2PODA 3ZLHA 4DWDA 1EC9A 2CDUA 3I6EA 5DBJA 2XFNA 1E39A 2A8XA 2Y6QA 5JCKA 3L8KA 3KD9A 1K0JA 1LJ1A 1KN0A 3ABVA 2RABA 1N5XA 1XDIA 5J7XA 3O0HA 2WESA 3H8AA 1JRZA 2H88A 4U8JA 2PHHA 3UOXA 1N60C 2XSXA 2PPGA 4C3YA 2OA1A 3V3WA 4LU6A 4E6MA 2AL2B 3DERA 4G7FA 4MGGA 3F8DA 4IA6A 1CJ3A 2OFJA 1B37A 3R07C 2VVLG 4U2SA 1KNRA 2PTXA 3FIMB 2E4GA 2OZ8A 4NTDA 1CBOA 4HCLA 4U2TA 3MWCA 2X8GA 1VQWA 1H2IA 5M0ZA 4J3ZA 3DFHA 4BV6A 1H84A 3RP6A 1DJNA 4OPIA 2OVLA 3GD4A 3AE5A 3FJ4A 3NVVB 4Z26A 3OPSA 3SSZA 1GRHA 3THUA 2GV8A 3UKQA 2PYXA 1GOSA 3NN6X 1CJCA 2ZBWA 2CHRA 1P2EA 4B68A 2FYMA 4IT1A 4B66A 4GGBA 2QDDA 3SN1A 4GGHA 3IHMA 2GMHA 4FK1A 3UKKA 2GMJA 3AEAA 1DOBA 4IP4A 3GRTA 5ER0A 3M0OA 3TW9A 4YSHA 3P3BA 3BI4A 1JPMA 1PXBA 3Q4DA 4CY8A 4K7ZA 5HHFA 2X8CA 3NRNA 5FJTA 4IVMB 2IIDA 2YLTA 4YWOA 4XXGA 1QJDA 4U8NA 3T4WA 3NVYB 1ECQA 3VRAA 1DTNA 4GR1A 5EB4A 3F8RA 3D1CA 2GQFA 1E1NA 2Z5XA 3QTPA 1K0LA 3SM8A 2BRYA 3BHKA 3NYEA 3GO2A 3QSMA 2BK5A 3JVAA 4OPGA 3UKHA 4H4VA 4DNAA 4GMEA 1YQ3A 1NHSA 2GAGB 2WU5A 5C3JA 2J3NA 1L0VA 3R11A 3G5RA 3AEBA 4OPLA 5FJUA 3QN3A 4Z44A 3K1GA 2JB1A 4J56A 1NG3A 1LQTA 2YM1A 3BOXA 2ACZA 2RGOA 2DW6A 3BSMA 2RDXA 1GRBA 3ICRA 3PVCA 3C96A 2P8BA 3UCDA 4A3RA 1KDGA 2GB0A 1CJ2A 4Z2TA 4GYPA 2XFQA 4UDQA 3K7QX 5KWFA 1KNPA 3EF6A 2YR4A 3KUMA 4J57A 2XVEA 3KPFA 4GDPA 4WCTA 4JHMA 4A79A 3E1TA 1F6MA 1ELSA 1M6IA 3OZ2A 2B9XA 1GTHA 3FMWA 3H7VA 4B1BA 2YAUA 4YSYA 3K7MX 3GYJA 1AOGA 3URHA 2QJNA 5JCIA 1NU5A 3NTAA 2PGWA 4O5QA 1PJ7A 4UP3A 3D46A 2XH0A 2OAMA 4JQ9A 2PTYA 4ZOHB 2OQHA 2YLWA 3T2YA 3NZGA 2WOVA 2R45A 4IV9A 1E7PA 2X3NA 3RR1A 1STZA 2BS2A 3VDGA 2AAQA 2HXUA 2GGHA 4HN8A 1N5WC 1EL7A 3K7TA 1D7LA 2Q0KA 1NG4A 1N63C 4GAVA 1NEKA 1EL9A 4C3XA 1TE6A 1S7MA 4U8OA 3G5QA 1PDYA 1H82A 1ZY8A 4CCQA 4CCRA 1GEUA 4H4UA 1GETA 4Z2UA 2YG3A 5BOFA 3NK0X 2JB2A 1V59A 3BHFA 4TVYA 4GF7A 1O95A 3FPZA 3AEDA 4GRTA 1PDZA 3NVWB 2EQ9A 3UXLA 3EAOA 2PP3A 4A6NA 1K0IA 4EM3A 1DODA 1XHCA 3D8XA 2YVFA 1BF3A 2PGEA 2C3CA 3DGBA 2NQLA 5FJOA 4X9MA 2XVFA 4H4YA 1LTXR 1PJ6A 3NT6A 1Y56B 3IJQA 3CIRA 3UKPA 1P43A 4P9SA 2WS3A 2XH2A 4B67A 2XDOA 3PG6A 5U63A 4EQWA 4H83A 1KF6A 3RNMA 3LJPA 3FYYA 1JRPA 1KSSA 1TDKA 4HCDA 3I3LA 3SQPA 1X31B 3N4EA 3AE3A 1GNDA 3NTDA 3IJIA 2W55A 2QAEA 5CKUA 3ENLA 3QPEA 2QGYA 2YR5A 1XPYA 5KRQA 2R46A 1GALA 1ZMDA 4J34A 3NXLA 3VC5A 2C65A 4H4WA 2BCPA 2OLNA 1NHQA 2C3DA 1MDRA 1P48A 2WOIA 2PMQA 4Z24A 1PHHA 2TPRA 3RITA 4ICYA 2FKPA 1JCTA 4EQRA 2WDQA 4KEMA 4G74A 1BGJA 5JCLA 3UOVA 2XLPA 3REDA 1GRFA 2MUCA 3LZXA 3UJ2A 4NTEA 1N62C 1VG9A 3SZ0A 3UKLA 4U2LA 2ZC8A 2O56A 2YLZA 4K1WA 1O94A 4A99A 4H4PA 4JN7A 3KA7A 2YVJA 1TZZA 3ZDNA 1H83A 3T0KA 4HCHA 4A6GA 2ARDA 4DSHA 3GDPA 3KVEA 1GRAA 2QVHA 4IL0A 1ZOVA 2WP9A 4Z2RA 3EANA 1L9CA 3IC9A 3V76A 3STPA 2WPFA 3ATRA 3C4NA 4TVWA 4X9NA 4E0VA 3AD9B 3VC6A 4FI4A 5M10A 2W0HA 3I4KA 3EKGA 4H19A 1F3PA 2WDRA 5IQ4A 3QLDA 3R25A 1DXLA 2HNEA 4USRA 4ZCWA 3QVPA 4IVOB 5FJPA 4E8GA 4PABA 1H86A 1NDAA 2XLUA 3CNTA 3SX6A 4K5RA 3CK5A 1X2GA 2PTZA 3NLCA 4OCGA 3UOYA 1PXAA 3ALJA 4H2RA 5FS8A 2YLRA 3NYCA 1BZLA 2YVGA 1FL2A 1OEPA 1SJAA 3GWFA 4Z1YA 3CYJA 3S61A 3DH9A 3UTGA 3ICTA 1N1PA 2JB3A 4M0XA 4H4TA 3B9JB 3FBSA 1GTEA 2BC1A 1KFYA 3RP8A 3T37A 2GGJA 4EMIA 2XH7A 2VVMA 1TYPA 2OZTA 3DA1A 1H6VA 1ELIA 3RHAA 2XVHA 3JW7A 3RP7A 2GGEA 2WQYA 2EQ8A 4LA1A 1VQZA 3MSYA 1NENA 3H12A 3CTYA 2VQ7A 4DN1A 4NTCA 2IVEA 3NO1A 3IF9A 3LB8A 1LV0A 2OX4A 2PA6A 4Z43A 3M13A 3UCCA 1ZDLA 4DHGA 2BS4A 1TDOA 2BXSA 1Q9IA 1V97A 4GCMA 1FFUC 3CPJG 3TQPA 1ONEA 2JBVA 1JROA 4FP1A 3LXDA 3VCCA 1JRXA 1SJBA 1D4EA 2WPCA 3B3RA 2HZGA 1JNRA 2V3AA 3HW2A 2Z5YA 3TWBA 2PTWA 3GMBA 3CPHG 1D7YA 4EQXA 2YG5A 2BACA 3AE8A 3II4A 1CL0A 3V5FA 5KXJA 4BK1A 1WUFA 3EEZA 1RP0A 3BJSA 3T31A 1FEBA 5BUKA 3NNEA 2H89A 1PBEA 2F5ZA 1S3EA 2YM2A 2DKIA 2NPXA 3AYLA 4YXDA 4H1ZA 3S47A 2WETA 1E1KA 2P8CA 3AMZA 4NZHA 3CN8A 3ES8A 4IP5A 5KMQA 1Q1WA 1ZXIC 3NFUA 4YWSA 2XGZA 3ALMA 1LPFA 4Y4LA 1S2YA 5BULA 1YQ4A 2GF3A 2R0CA 4FK1C 2GR0A 4FDCB 3CNPA 5JCNA 1OJDA 3DK8A 1PBBA 1DOCA 4REKA 1ZK7A 2R0GA 4J2WA 5C2TA 3VA8A 1D5TA 3KKJA 3H70A 2A89A 3D47A 2VQBA 3P4QA 3HRDC 5IQ1A 3GYXA 2WBAA 3H8IA 3DK9A 3K30A 3DJDA 4E4UA 2R4EA 1FIQB 1ZX9A 2APGA 1D4CA 2PCEA 4USQA 3V3NA 1DOEA 2XFOA 3PFRA 4YSXA 2ZZ0A 3TWAA 3SN0A 2BA9A 5IPYA 1R6WA 1Q1RA 1KKRA 2X50A 3ZLFA 4C74A 3RRAA 5IDZA 2FJDA 3CGDA 2X99A 4EIQA 4E4FA 1ONFA 2BK4A 3AXBA 2C64A 1IUWA 1JOAA 1PXCA 3DG6A 4B63A 3D9XA 2BRAA 2AKZA 3ATQA 1VRQB 3LOVA 4EM4A 3AEFA 4K8GA 3ADAB 3S5SA 1DJQA 1EBDA 4H4RA 3AE1A 4YSZA 3ITJA 2OG9A 3JSKA 2C4CA 4H2PA 2QJJA 4OPTA 4TLZA 1QLBA 4U8LA 3DIPA 3LADA 3DK4A 2FJAA 3GD3A 3PWGA 3UJRA 2BK3A 4KPLA 4JY2A 4I59A 3UTEA 4ZCCA 4YT0A 2XFUA 1Y56A 4ADWA 3NRZB 3C4AA 5L46A 1E1MA 3QFBA 2AL1A 1O5WA 4ENLA 4Z17A 2BABA 5KNLA 2GEWA 3U4FA 2YG4A 1W6TA 2POZA 2I0ZA 2W3SA 3PS9A 4CNKA 1JEHA 2ZZBA 4G6GA 2XVJA 2OZ3A 1IUXA 3NHOX 2GGIA 4FX9A 3HYVA 2WEUA 2B9YA 4M52A 2YG7A 1CC6A 2WP6A 3RCYA 4H4QA 2QA1A 4IA5A 3T8QA 4YTPA 4ROPA 2PS2A 4E5TA 2QA2A 4DYEA 4NEWA 2C7GA 2AR8A 1XPQA 1ZOYA 2V5ZA 1PDHA 3BI2A 3DJEA 3AD8B 3AEEA 4CNJA 4AP1A 3AM9A 3N4FA 2TMDA 4GFIA 1F8SA 3SFEA 3CAWA 3ICSA 4BJZA 1KD0A 3L5OA 4YTMA 4U8IA 4MJWA 3QSEA 3NK1X 1PBCA 3QVRA 3AE2A 5KVHA 2FJEA 3P9UA 2XH4A 2R0PA 3UOZA 1MO9A 2QDEA 1CC4A 2E1MA 1GT8A 1GERA 5KOWA 2JK6A 2JKCA 3P0WA 4DGKA 1VDCA 2E3TA 3UJSA 4HYRA 4A6NB 4CRTA 4F4RA 2ZADA 2XFPA 1ZMCA 4A65A 2GH5A 4CBQA 3T2ZA 1Z6LA 3ZVHA 4YKGA 5KMPA 3OZYA 2BCGG 2C70A 3FVDA 5HY5A 3NKSA 5CQFA 6ENLA 4OPDA 4OVIA 2DW7A 5KVIA 1K4QA 4XWRA 5GRTA 1B4VA 2A87A 3P4SA 1GSNA 3SXIA 4BK3A 4Z25A 3AYIA 1COYA 2OPJA 4J33A 4J31A 1LVLA 1GV4A 4NEVA 1T3QC 4U8PA 4H4SA 3AE6A 1GXFA 3ZYXA 3OTRA 3GC2A 5FS6A 1BKHA 3FCPA 4D03A 4U8MA 3PK7A 5J04A 3GYIA 1F9CA 3P1WA 2WHDA 4A35A 4A7AA 3SR6B 1REOA 1MXTA 1IUTA 1JNZA 1HYUA 4AOXA 5HYMA 1BQGA 3NK2X 3MY9A 4II3A 1FO4A 3AEGA 3M12A 2V6OA 2O9ZA 1SB3B 1IYXA 3R0KA 4A9WA 5ENLA 2AL2A 3UTFA 2XLRA 4KX6A 1IUVA 1GREA 2BYBA 4TM1A 2W3RA 1FFVC 2PU1A 3PWIA 1SEZA 1UKVG 3HYXA 2XCGA 3VFCA 5EB5A 1H7XA 3GSIA 3A7UA 2GVCA 4DXKA 4EMWA 3QFAA 3R1ZA 3P4PA 4JNQA 4H4ZA 1RM6B 4WX1A 2OLAA 3CXBA 5BOEA 2YLXA 4HPNA 3T2KA 3UJEA 4J36A 3UP4A 1F8RA 3UP5A 1BWCA 2E5VA 1EL8A 4OPUA 3I6TA 2XLTA 4ZN0A 3VR8A 2AKMA 3CNDA 1FECA 5FJRA 3GDNA 1YY5A 4OPCA 3P93A 3DESA 2YWLA 4CY6A 2YQUA 5EBKA 3LZWA 7ENLA 3IHGA 2PP0A 1B8SA 2B7RA 3OC4A 4JNAA 2W54A 3GRSA 3SQSA 2Q7VA 3VRDB 2CFYA 2Q0LA 4X4JA 1JRYA 5EU9A 4G6HA 1Y0PA 2JAEA 3UCLA 2OLOA 3ZLGA 2OKTA 1H81A 2FJBA 3Q9TA 2V61A 1P2HA 3T6CA 3NG7X 1N4UA 2YG6A 2V3BA 3NVZB 4AP3A 1TKKA 3DJJA 3ISHA 2DKHA 2EQ6A 1RVKA 3CGCA 4NNJA 3VCNA 4HA6A 3CGEA 4K22A 5U25A 1EC8A 4MMWA 4HB9A 4RSLA 1FHUA 3GD6A 2C72A 1OJAA 2Q6UA 3A7RA 1TDEA 1NELA 1DNCA 1H7WA 4TM0A 1TRBA 1GESA 4H2HA 5JRBA 3RGTA 3AB1A 4APNA 3DG7A 3SBFA 3OZMA 1PBDA 4EWJA 4IL2A 3SYIA 3EUB3 3DDMA 1IJHA 1EBHA 3EPTA 2B76A 1SJDA 4O5UA 3SZCA 2GRTA 1CF3A 5LV9A 4TM3A 2P3ZA 3SGLA 3CMMA 4YTNA 1OJ9A 5G5GB 2E5AA 3AD7B 4DSGA 3RO6A 1WYGA 1D4DA 3AE7A 2RGJA 1L8PA 3TTEA 1N4VA 3Q45A 1L9DA 4G73A 2C67A 1KCZA 4NWZA 1N4WA 3UTHA 3FXGA 4RG3A 3BNMA 1GPEA 3IK4A 1IUSA 4YKFA 2GL5A 4UDPA 1MDLA 3OP2A 2HQMA 2PP1A 3QSSA 5BVAA 1KSUA 5BRTA 2MNRA 3NS1B 1LQUA 3VRBA 1FEAA 5U1OA 4K5SA 2EQ7A 4MKSA 4JN9A 3TCSA 3S5WA 1S2QA 1OJTA 3B6DA 4J1OA 3I6DA 3F8PA 1E6EA 3V4BA 2BXRA 1B5QA 3CT2A 5TR3A 4KPRA 4G8TA 3NN0X 4EMJA 3T9PA 4C77A 4GDEA 3L1RA 4X2PA 2YR6A 3H4KA 3AE4A 4G9KA 1PS9A 4II2A 2ZZCA 3HPFA 3IJLA 3NGCX 1YEYA 3AYJA 3NIXA 4GYPC 3TJ4A 1FHVA 3R0UA 1ZKQA 2HXTA 3CNSA 3UGVA 3HZLA 4PAAA 2FBWA 4HNLA 4A5LA 4JY3A 1GRTA 4BJYA 4AT2A 3VQRA 1MNSA 2WPEA 3SZWA 3KPKA 3N6HA 4GUVA 2RGHA 2C75A 2PU0A 1NAAA 3GY1A 4D04A 3P4RA 4IZGA 1GRGA 4B69A 1CC2A 1MRAA 4H2NA 3MZNA 3GWDA 2WDVA 1X2HA 1KKOA 4IHCA 3DG3A 3IWAA 3DEQA 4AOSA 4M6UA 2B9WA 3AECA 4B64A 5FMHA 3NYFA 4TLXA 1BGNA 1E1LA 3Q6JA 4HNCA 4LIIA 4JDRA 4Y4NA 3CB3A 2OO6A 4GAPA 3G5SA 3GMCA 4KWSA 2R4JA 3AWIA 1F8WA 3UKFA 2IVDA 2GDQA 1NHRA 3QKEA 2V60A 4H50A 4H7UA 2QCUA 1VDVA 4Y4MA 3ZVIA 3MUCA 1VG0A 1YQZA 4GIRA 1MUCA 4JN8A 2CVJA 1NPXA 2GAHB 2GR3A 3MQTA 5KMSA 4C5OA 2UZZA 3SFDA 2GR2A 4XWZA 3KLJA 1ZP0A 4KT2A 2VZ2A 1PJ5A 5KOXA 1PN0A 1S3BA 2P88A 2B7SA 3VR9A 4GISA 3KU9A 2YLSA 1RSGA 4RG4A 3COXA 1XS2A 4ZCDA 2C66A 5FS7A 2Y6RA 3MKCA 2CULA 5J60A 4ECHA 3UKAA 2GR1A 1FOHA 2OALA 5GSNA 2XVIA 4BK2A 3T14A 2ONEA 1TDNA 3CXOA 3DFYA 2VRMA 3DGHA 2BC0A 3A7AA 4K8DA 2I5QA 2X8HA 1NHPA 3SN4A 3V5CA 1MOKA 3QJ4A 2WOWA 2WU2A 3SZFA 1N61C 2XYOA 1XANA 5HXIA 4DX3A 1EBGA 1CJ4A 4I58A 4ZA0A 2QJMA 3V3OA 4U8KA 2C76A 3N6JA 3CPIG 4B65A 4EIPA 1CHUA 3B97A 3AN1A 1L9EA 3DMEA 1WUEA 2VVLA 1TYTA 4BURA 3CGBA 2C73A 3U9IA 3AE9A 3DJGX 3TJIA 3CNJA 1YKJA 3SJNA 2GSHA 2QQ6A 4EQSA 3BNUA 1IUUA 3PO7A 1JU2A 4AT0A 2PSNA 5G5HB 1M64A 2VRLA 4K2SA 1E9IA 5KMRA 4H2QA 3TOYA 4K2XA 1TDFA 2WP5A 3SY4A 3R9UA 2AQJA 1PBFA 3ES7A 1R0MA 1W4XA 3ZVHB 1FCDA 5JCMA 4N9XA 3R10A 3FG2P 2GQWA 4UDRA 3NH3X 2R9ZA 1OJCA 1JPDX 4TM4A 1RYIA 2NVKX 3OW1A
chains in the Genus database with same CATH topology
3ALLA 4HB9A 3ATQA 3H8LA 4RSLA 1GNDA 1VRQB 3LOVA 4EM4A 3HYWA 3NTDA 2C72A 1OJAA 2Q6UA 3AEFA 3ADAB 5FS9A 1TDEA 2QAEA 5CKUA 3DGZA 1DNCA 1H7WA 1DJQA 1EBDA 3WE0A 4H4RA 2VOUA 4TM0A 3AE1A 4H4XA 2XLSA 1TRBA 4YSZA 1GESA 2YR5A 5KRQA 3ITJA 5JRBA 3JSKA 2R46A 5EOWA 1GALA 1ZMDA 2C4CA 3AB1A 4APNA 1QO8A 3BI5A 4H2PA 4EIQA 4J34A 4OPTA 4TLZA 2BS3A 1QLBA 4U8LA 1EL5A 2C65A 4H4WA 2BCPA 3LADA 2OLNA 1NHQA 1BKWA 1PBDA 2C3DA 3DK4A 3SYIA 2CDUA 2FJAA 1IJHA 3GD3A 2BK3A 5DBJA 2WOIA 2XFNA 1E39A 4Z24A 1PHHA 3EPTA 2A8XA 2Y6QA 4JY2A 4I59A 3UTEA 5JCKA 2TPRA 3L8KA 3KD9A 4ZCCA 4ICYA 4YT0A 2XFUA 1Y56A 1K0JA 2B76A 4EQRA 2WDQA 4G74A 4ADWA 1LJ1A 4O5UA 3C4AA 1BGJA 1KN0A 2GRTA 1CF3A 3SZCA 3ABVA 2RABA 5LV9A 5JCLA 4TM3A 3UOVA 5L46A 1XDIA 2XLPA 3REDA 1E1MA 3SGLA 5J7XA 1GRFA 3QFBA 3O0HA 3CMMA 1O5WA 2WESA 3LZXA 4NTEA 4YTNA 1OJ9A 1JRZA 1VG9A 2BABA 2H88A 2PHHA 3AD7B 4U8JA 3UOXA 5KNLA 2GEWA 4DSGA 3SZ0A 2YG4A 3UKLA 4C3YA 4U2LA 2I0ZA 2OA1A 2YLZA 3PS9A 4CNKA 1JEHA 4LU6A 1D4DA 2ZZBA 1O94A 3AE7A 2RGJA 4G6GA 2XVJA 4A99A 4H4PA 1N4VA 3KA7A 2YVJA 1L9DA 3F8DA 4G73A 4IA6A 1IUXA 3NHOX 2C67A 3ZDNA 1H83A 3HYVA 4FX9A 3T0KA 2WEUA 2B9YA 4M52A 2YG7A 1CJ3A 2ARDA 1CC6A 2WP6A 1B37A 4DSHA 4NWZA 1N4WA 2VVLG 4U2SA 1KNRA 3GDPA 3FIMB 2E4GA 3KVEA 1GRAA 3UTHA 4NTDA 4H4QA 1CBOA 2QA1A 4IA5A 4U2TA 1ZOVA 2WP9A 3BNMA 4RG3A 4YTPA 1GPEA 4Z2RA 2X8GA 1IUSA 3EANA 1L9CA 1VQWA 1H2IA 4YKFA 3IC9A 5M0ZA 4BV6A 3V76A 2QA2A 1H84A 4UDPA 2WPFA 4NEWA 3ATRA 2C7GA 3C4NA 1DJNA 3RP6A 4OPIA 2HQMA 2AR8A 3QSSA 1XPQA 4X9NA 4E0VA 1ZOYA 3AD9B 2V5ZA 5M10A 2W0HA 3GD4A 3AE5A 5BVAA 1KSUA 1PDHA 5BRTA 3BI2A 1LQUA 3VRBA 1FEAA 4Z26A 3DJEA 3AD8B 1F3PA 5U1OA 2WDRA 3AEEA 4K5SA 4CNJA 5IQ4A 1GRHA 2EQ7A 4AP1A 4JN9A 2TMDA 2GV8A 3UKQA 1DXLA 2PYXA 1F8SA 4USRA 3S5WA 1GOSA 1S2QA 3QVPA 1OJTA 3B6DA 3SFEA 3NN6X 1CJCA 2ZBWA 3I6DA 4IVOB 3ICSA 4BJZA 3F8PA 1P2EA 4B68A 3L5OA 1E6EA 4YTMA 4U8IA 4MJWA 3QSEA 2BXRA 1B5QA 3NK1X 1PBCA 3QVRA 3AE2A 4PABA 5KVHA 2FJEA 3P9UA 4B66A 5TR3A 1H86A 4KPRA 2R0PA 3UOZA 3NN0X 4EMJA 1MO9A 1CC4A 1NDAA 2XLUA 3CNTA 3SX6A 4GDEA 3L1RA 4C77A 2E1MA 2GMHA 3IHMA 4FK1A 2YR6A 1GT8A 3UKKA 3H4KA 3AE4A 4K5RA 1GERA 2GMJA 4G9KA 1PS9A 3AEAA 1DOBA 4II2A 2ZZCA 3GRTA 5ER0A 5KOWA 3M0OA 2JK6A 3NGCX 3NLCA 4OCGA 3UOYA 4YSHA 3AYJA 2JKCA 3NIXA 1PXAA 3BI4A 3ALJA 4H2RA 4DGKA 1ZKQA 1PXBA 3CNSA 4CY8A 1VDCA 4K7ZA 5FS8A 2YLRA 3HZLA 5HHFA 2X8CA 2FBWA 1BZLA 2YVGA 1FL2A 3NRNA 3NYCA 4JY3A 4PAAA 4A5LA 3GWFA 1GRTA 4IVMB 4BJYA 2IIDA 4B67A 2YLTA 4AT2A 3VQRA 4YWOA 3S61A 4XXGA 3DH9A 1QJDA 4U8NA 4A6NB 4CRTA 3UTGA 3ICTA 2WPEA 1N1PA 2JB3A 3SZWA 3VRAA 2XFPA 4GR1A 4H4TA 1ZMCA 5EB4A 3KPKA 4A65A 3FBSA 1GTEA 2BC1A 1KFYA 3F8RA 3RP8A 3D1CA 2GQFA 2GH5A 1E1NA 4GUVA 4CBQA 2Z5XA 3T2ZA 3T37A 2BRAA 1Z6LA 2RGHA 2C75A 4YKGA 5KMPA 2BCGG 1K0LA 1NAAA 2BRYA 3SM8A 3P4RA 3BHKA 4EMIA 3NYEA 4D04A 1GRGA 4B69A 2C70A 1CC2A 2VVMA 5HY5A 3QSMA 3NKSA 5CQFA 4H2NA 1TYPA 3GWDA 3DA1A 2WDVA 2BK5A 5KVIA 4OPGA 4OPDA 4OVIA 1K4QA 3UKHA 3IWAA 4XWRA 5GRTA 1B4VA 2A87A 1H6VA 4AOSA 3P4SA 4H4VA 4DNAA 1ELIA 1YQ3A 1GSNA 2XVHA 3K7TA 3RHAA 3RP7A 3R9UA 1NHSA 2B9WA 2GAGB 2WU5A 3SXIA 5C3JA 3AECA 2J3NA 4BK3A 2WQYA 1L0VA 4B64A 3G5RA 4Z25A 2EQ8A 1COYA 4LA1A 3AEBA 5FMHA 3AYIA 3NYFA 4J33A 4TLXA 4J31A 1LVLA 1GV4A 1BGNA 1E1LA 3Q6JA 4OPLA 4LIIA 4NEVA 1NENA 3CTYA 4JDRA 4U8PA 4Y4NA 2VQ7A 4H4SA 3AE6A 4NTCA 1GXFA 2IVEA 3ZYXA 4GAPA 3G5SA 4Z44A 2JB1A 3IF9A 3LB8A 3GMCA 4J56A 5FS6A 1LV0A 1NG3A 2R4JA 3AWIA 1LQTA 4D03A 2YM1A 1F8WA 4U8MA 3UKFA 4Z43A 3M13A 2ACZA 3UP5A 2IVDA 1NHRA 3GYIA 3P1WA 2RGOA 2V60A 2WHDA 1ZDLA 4H50A 4H7UA 4A7AA 2QCUA 2BS4A 1REOA 4Y4MA 1MXTA 1TDOA 2BXSA 1GRBA 1IUTA 3ICRA 1Q9IA 1VG0A 1YQZA 3PVCA 1JNZA 1HYUA 4GCMA 2CVJA 1NPXA 3C96A 4AOXA 5HYMA 3CPJG 3NK2X 1KDGA 2JBVA 2GAHB 2GR3A 4II3A 2GB0A 1CJ2A 5KMSA 3AEGA 3LXDA 4Z2TA 1JRXA 4C5OA 2UZZA 1D4EA 2WPCA 2V6OA 2XFQA 3M12A 3B3RA 2O9ZA 3SFDA 2GR2A 1JNRA 2V3AA 2Z5YA 4XWZA 3GMBA 3KLJA 1ZP0A 3CPHG 1D7YA 4UDQA 2VZ2A 4EQXA 1PJ5A 2YG5A 4A9WA 3K7QX 5KOXA 5KWFA 1KNPA 3EF6A 1PN0A 3UTFA 2BACA 3AE8A 2XLRA 4KX6A 3II4A 1IUVA 2YR4A 1S3BA 4J57A 2XVEA 3KPFA 1GREA 2B7SA 2BYBA 4TM1A 3VR9A 1CL0A 4GDPA 4WCTA 3KU9A 4A79A 3E1TA 1F6MA 1SEZA 1UKVG 2YLSA 3HYXA 5KXJA 1M6IA 3OZ2A 2B9XA 4BK1A 1GTHA 3FMWA 1RSGA 4RG4A 1RP0A 3T31A 3COXA 4B1BA 2XCGA 4ZCDA 2YAUA 2C66A 5FS7A 2Y6RA 1FEBA 3K7MX 3GYJA 3NNEA 2H89A 4YSYA 5BUKA 2CULA 1PBEA 5EB5A 1H7XA 5J60A 1AOGA 3URHA 3GSIA 2F5ZA 5JCIA 4ECHA 3UKAA 2GVCA 3NTAA 2GR1A 4EMWA 1S3EA 2YM2A 3QFAA 2DKIA 2NPXA 3AYLA 3P4PA 4JNQA 4YXDA 4O5QA 1FOHA 2OALA 5GSNA 4H4ZA 2XVIA 2WETA 4BK2A 1E1KA 1PJ7A 4UP3A 4NZHA 3CN8A 2OAMA 3T14A 4JQ9A 5KMQA 1Q1WA 4WX1A 1TDNA 3ALMA 1LPFA 2YLWA 3T2YA 4Y4LA 1S2YA 2WOVA 2YLXA 5BULA 2R45A 1YQ4A 2GF3A 2VRMA 3DGHA 4IV9A 1E7PA 3T2KA 2R0CA 2BC0A 2X3NA 2BS2A 4FK1C 4K8DA 4J36A 2AAQA 2X8HA 3UP4A 1NHPA 1EL7A 1F8RA 2GR0A 1BWCA 1MOKA 1D7LA 1NG4A 2E5VA 2Q0KA 2WOWA 2WU2A 1EL8A 3QJ4A 4GAVA 4OPUA 3SZFA 4FDCB 3CNPA 5JCNA 2XYOA 1XANA 1NEKA 1EL9A 1OJDA 3DK8A 5HXIA 1PBBA 4C3XA 1DOCA 2XLTA 1S7MA 1CJ4A 4REKA 4ZN0A 4I58A 1ZK7A 3VR8A 4U8OA 2R0GA 3G5QA 4J2WA 1H82A 4CCQA 1ZY8A 3CNDA 4CCRA 1FECA 3V3OA 1GEUA 4H4UA 1GETA 5C2TA 4U8KA 4Z2UA 2C76A 1D5TA 3KKJA 3CPIG 2YG3A 4B65A 3GDNA 4EIPA 2A89A 1CHUA 1YY5A 3NK0X 2VQBA 2JB2A 1L9EA 3P4QA 1V59A 5IQ1A 3BHFA 3DMEA 2VVLA 3GYXA 1TYTA 2WBAA 4BURA 3DK9A 3H8IA 4GF7A 3K30A 3DJDA 4OPCA 1O95A 3CGBA 2C73A 3FPZA 3AEDA 4GRTA 2R4EA 2YWLA 4CY6A 2YQUA 5EBKA 3LZWA 2EQ9A 1ZX9A 2APGA 3IHGA 1D4CA 1B8SA 2B7RA 3AE9A 3OC4A 4JNAA 3DJGX 3GRSA 2Q7VA 3EAOA 3CNJA 4A6NA 1K0IA 4USQA 3VRDB 2CFYA 4EM3A 2Q0LA 3V3NA 1YKJA 1DODA 4X4JA 1JRYA 1DOEA 4G6HA 2XFOA 1XHCA 4YSXA 3D8XA 1Y0PA 2YVFA 1BF3A 2JAEA 3UCLA 4EQSA 2OLOA 3BNUA 2ZZ0A 1IUUA 3PO7A 2C3CA 2BA9A 1JU2A 5IPYA 4AT0A 1M64A 4X9MA 2VRLA 2XVFA 1H81A 4H4YA 1Q1RA 2FJBA 5KMRA 4H2QA 1LTXR 1PJ6A 3NT6A 3Q9TA 2V61A 1Y56B 4K2XA 1TDFA 2X50A 3CIRA 3UKPA 1P2HA 2WP5A 4C74A 3NG7X 3SY4A 2FJDA 4P9SA 3CGDA 1N4UA 2X99A 2AQJA 2WS3A 1PBFA 3PG6A 2V3BA 1ONFA 2XDOA 2YG6A 5U63A 1W4XA 4EQWA 4AP3A 1FCDA 2BK4A 5JCMA 4N9XA 3DJJA 3AXBA 3ISHA 3FG2P 2DKHA 2C64A 1IUWA 1KF6A 3RNMA 3LJPA 2GQWA 1JOAA 1KSSA 4UDRA 1TDKA 3NH3X 2EQ6A 2R9ZA 1PXCA 3I3LA 3CGCA 1OJCA 4TM4A 4NNJA 3SQPA 1X31B 4B63A 3D9XA 1RYIA 2NVKX 4HA6A 3AE3A 3CGEA 4K22A 5U25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ALL A;  4HB9 A;  3ATQ A;  3H8L A;  4RSL A;  1GND A;  1VRQ B;  3LOV A;  4EM4 A;  3NTD A;  2C72 A;  1OJA A;  2Q6U A;  3AEF A;  3ADA B;  5FS9 A;  1TDE A;  2QAE A;  5CKU A;  3DGZ A;  1DNC A;  1H7W A;  1DJQ A;  1EBD A;  3WE0 A;  4H4R A;  2VOU A;  4TM0 A;  3AE1 A;  4H4X A;  2XLS A;  1TRB A;  4YSZ A;  1GES A;  2YR5 A;  5KRQ A;  3ITJ A;  3JSK A;  2R46 A;  5EOW A;  1GAL A;  1ZMD A;  3AB1 A;  4APN A;  1QO8 A;  3BI5 A;  4H2P A;  4J34 A;  4OPT A;  4TLZ A;  2BS3 A;  1QLB A;  4U8L A;  1EL5 A;  2C65 A;  4H4W A;  2BCP A;  3LAD A;  2OLN A;  1NHQ A;  1BKW A;  1PBD A;  2C3D A;  3DK4 A;  2CDU A;  2FJA A;  1IJH A;  3GD3 A;  2BK3 A;  5DBJ A;  2WOI A;  2XFN A;  1E39 A;  4Z24 A;  1PHH A;  3EPT A;  2A8X A;  2Y6Q A;  4JY2 A;  4I59 A;  3UTE A;  5JCK A;  2TPR A;  3L8K A;  3KD9 A;  4ZCC A;  4ICY A;  4YT0 A;  2XFU A;  1Y56 A;  1K0J A;  2B76 A;  4EQR A;  2WDQ A;  4ADW A;  1LJ1 A;  4O5U A;  3C4A A;  1BGJ A;  2GRT A;  1CF3 A;  3ABV A;  2RAB A;  5LV9 A;  5JCL A;  4TM3 A;  3UOV A;  5L46 A;  1XDI A;  2XLP A;  3RED A;  1E1M A;  3SGL A;  5J7X A;  1GRF A;  3QFB A;  3O0H A;  3LZX A;  1O5W A;  2WES A;  4NTE A;  4YTN A;  1OJ9 A;  1JRZ A;  1VG9 A;  2BAB A;  2H88 A;  2PHH A;  3AD7 B;  4U8J A;  3UOX A;  2GEW A;  4DSG A;  2YG4 A;  3UKL A;  4C3Y A;  4U2L A;  2I0Z A;  2OA1 A;  2YLZ A;  3PS9 A;  4CNK A;  1JEH A;  4LU6 A;  1D4D A;  2ZZB A;  1O94 A;  3AE7 A;  2RGJ A;  2XVJ A;  4A99 A;  4H4P A;  1N4V A;  3KA7 A;  2YVJ A;  1L9D A;  3F8D A;  4IA6 A;  1IUX A;  3NHO X;  2C67 A;  3ZDN A;  1H83 A;  4FX9 A;  2WEU A;  2B9Y A;  4M52 A;  2YG7 A;  1CJ3 A;  2ARD A;  1CC6 A;  2WP6 A;  1B37 A;  4DSH A;  1N4W A;  2VVL G;  4U2S A;  1KNR A;  3GDP A;  3FIM B;  2E4G A;  3KVE A;  1GRA A;  3UTH A;  4NTD A;  4H4Q A;  1CBO A;  2QA1 A;  4IA5 A;  4U2T A;  1ZOV A;  2WP9 A;  3BNM A;  4RG3 A;  4YTP A;  1GPE A;  4Z2R A;  2X8G A;  1IUS A;  3EAN A;  1L9C A;  1VQW A;  4YKF A;  3IC9 A;  5M0Z A;  4BV6 A;  3V76 A;  2QA2 A;  1H84 A;  4UDP A;  2WPF A;  4NEW A;  3ATR A;  2C7G A;  3C4N A;  1DJN A;  3RP6 A;  4OPI A;  2HQM A;  2AR8 A;  3QSS A;  1XPQ A;  4X9N A;  4E0V A;  1ZOY A;  3AD9 B;  2V5Z A;  5M10 A;  2W0H A;  3GD4 A;  3AE5 A;  5BVA A;  1KSU A;  1PDH A;  5BRT A;  3BI2 A;  1LQU A;  3VRB A;  1FEA A;  4Z26 A;  3DJE A;  3AD8 B;  1F3P A;  5U1O A;  2WDR A;  3AEE A;  4K5S A;  4CNJ A;  5IQ4 A;  1GRH A;  2EQ7 A;  4AP1 A;  4JN9 A;  2TMD A;  2GV8 A;  3UKQ A;  1DXL A;  2PYX A;  1F8S A;  4USR A;  3S5W A;  1GOS A;  1S2Q A;  3QVP A;  1OJT A;  3B6D A;  3SFE A;  3NN6 X;  1CJC A;  2ZBW A;  3I6D A;  4IVO B;  3ICS A;  4BJZ A;  3F8P A;  1P2E A;  4B68 A;  1E6E A;  4YTM A;  4U8I A;  4MJW A;  3QSE A;  2BXR A;  1B5Q A;  3NK1 X;  1PBC A;  3QVR A;  3AE2 A;  4PAB A;  5KVH A;  2FJE A;  3P9U A;  4B66 A;  5TR3 A;  1H86 A;  4KPR A;  2R0P A;  3UOZ A;  3NN0 X;  4EMJ A;  1MO9 A;  1CC4 A;  1NDA A;  2XLU A;  3CNT A;  4C77 A;  4GDE A;  3L1R A;  2E1M A;  2GMH A;  3IHM A;  4FK1 A;  2YR6 A;  1GT8 A;  3UKK A;  3H4K A;  3AE4 A;  4K5R A;  1GER A;  2GMJ A;  1PS9 A;  3AEA A;  1DOB A;  5KOW A;  2ZZC A;  3GRT A;  5ER0 A;  3M0O A;  2JK6 A;  3NGC X;  3NLC A;  4OCG A;  3UOY A;  4YSH A;  3AYJ A;  2JKC A;  3NIX A;  1PXA A;  3BI4 A;  3ALJ A;  4H2R A;  4DGK A;  1ZKQ A;  1PXB A;  3CNS A;  4CY8 A;  1VDC A;  4K7Z A;  5FS8 A;  2YLR A;  3HZL A;  5HHF A;  2X8C A;  2FBW A;  1BZL A;  2YVG A;  1FL2 A;  3NRN A;  3NYC A;  4JY3 A;  4PAA A;  4A5L A;  3GWF A;  1GRT A;  4IVM B;  4BJY A;  2IID A;  4B67 A;  2YLT A;  4AT2 A;  3VQR A;  4YWO A;  3S61 A;  4XXG A;  3DH9 A;  1QJD A;  4U8N A;  4A6N B;  4CRT A;  3UTG A;  3ICT A;  2WPE A;  1N1P A;  2JB3 A;  3VRA A;  2XFP A;  4GR1 A;  4H4T A;  1ZMC A;  5EB4 A;  4A65 A;  3FBS A;  1GTE A;  2BC1 A;  1KFY A;  3F8R A;  3RP8 A;  3D1C A;  2GQF A;  2GH5 A;  1E1N A;  4GUV A;  4CBQ A;  2Z5X A;  3T37 A;  1Z6L A;  2RGH A;  2C75 A;  4YKG A;  2BCG G;  1K0L A;  1NAA A;  3SM8 A;  4D04 A;  3P4R A;  3BHK A;  4EMI A;  3NYE A;  1GRG A;  4B69 A;  2C70 A;  1CC2 A;  2VVM A;  5HY5 A;  3QSM A;  3NKS A;  5CQF A;  4H2N A;  1TYP A;  3GWD A;  3DA1 A;  2WDV A;  2BK5 A;  5KVI A;  4OPG A;  4OPD A;  4OVI A;  1K4Q A;  3UKH A;  3IWA A;  4XWR A;  5GRT A;  1B4V A;  2A87 A;  1H6V A;  4AOS A;  3P4S A;  4H4V A;  4DNA A;  1ELI A;  1YQ3 A;  1GSN A;  2XVH A;  3K7T A;  3RHA A;  3RP7 A;  3R9U A;  1NHS A;  2B9W A;  2GAG B;  2WU5 A;  5C3J A;  3AEC A;  2J3N A;  4BK3 A;  2WQY A;  1L0V A;  4B64 A;  3G5R A;  4Z25 A;  2EQ8 A;  1COY A;  4LA1 A;  3AEB A;  5FMH A;  3AYI A;  3NYF A;  4J33 A;  4TLX A;  4J31 A;  1LVL A;  1GV4 A;  1BGN A;  1E1L A;  3Q6J A;  4OPL A;  4LII A;  4NEV A;  1NEN A;  3CTY A;  4JDR A;  4U8P A;  4Y4N A;  2VQ7 A;  4H4S A;  3AE6 A;  4NTC A;  1GXF A;  2IVE A;  3ZYX A;  3G5S A;  4Z44 A;  2JB1 A;  3IF9 A;  3LB8 A;  3GMC A;  4J56 A;  5FS6 A;  1LV0 A;  1NG3 A;  2R4J A;  3AWI A;  1LQT A;  4D03 A;  2YM1 A;  1F8W A;  4U8M A;  3UKF A;  4Z43 A;  3M13 A;  2ACZ A;  3UP5 A;  2IVD A;  1NHR A;  3GYI A;  3P1W A;  2RGO A;  2V60 A;  2WHD A;  1ZDL A;  4H50 A;  4H7U A;  4A7A A;  2QCU A;  2BS4 A;  1REO A;  4Y4M A;  1MXT A;  1TDO A;  2BXS A;  1GRB A;  1IUT A;  3ICR A;  1Q9I A;  1VG0 A;  1YQZ A;  3PVC A;  1JNZ A;  1HYU A;  4GCM A;  2CVJ A;  1NPX A;  3C96 A;  4AOX A;  5HYM A;  3CPJ G;  3NK2 X;  1KDG A;  2JBV A;  2GAH B;  2GR3 A;  2GB0 A;  1CJ2 A;  3AEG A;  3LXD A;  4Z2T A;  1JRX A;  4C5O A;  2UZZ A;  1D4E A;  2WPC A;  2V6O A;  2XFQ A;  3M12 A;  3B3R A;  2O9Z A;  3SFD A;  2GR2 A;  1JNR A;  2V3A A;  2Z5Y A;  4XWZ A;  3GMB A;  3KLJ A;  1ZP0 A;  3CPH G;  1D7Y A;  4UDQ A;  2VZ2 A;  4EQX A;  1PJ5 A;  2YG5 A;  4A9W A;  3K7Q X;  5KOX A;  5KWF A;  1KNP A;  3EF6 A;  1PN0 A;  3UTF A;  2BAC A;  3AE8 A;  2XLR A;  4KX6 A;  3II4 A;  1IUV A;  2YR4 A;  1S3B A;  4J57 A;  2XVE A;  3KPF A;  1GRE A;  2B7S A;  2BYB A;  4TM1 A;  3VR9 A;  1CL0 A;  4GDP A;  4WCT A;  3KU9 A;  4A79 A;  3E1T A;  1F6M A;  1SEZ A;  1UKV G;  2YLS A;  5KXJ A;  1M6I A;  3OZ2 A;  2B9X A;  4BK1 A;  1GTH A;  3FMW A;  1RSG A;  4RG4 A;  1RP0 A;  3COX A;  4B1B A;  2XCG A;  4ZCD A;  2YAU A;  2C66 A;  5FS7 A;  2Y6R A;  1FEB A;  3K7M X;  3GYJ A;  3NNE A;  2H89 A;  4YSY A;  5BUK A;  2CUL A;  1PBE A;  5EB5 A;  1H7X A;  5J60 A;  1AOG A;  3URH A;  3GSI A;  2F5Z A;  5JCI A;  4ECH A;  3UKA A;  2GVC A;  3NTA A;  2GR1 A;  4EMW A;  1S3E A;  2YM2 A;  3QFA A;  2DKI A;  2NPX A;  3AYL A;  3P4P A;  4JNQ A;  4YXD A;  4O5Q A;  1FOH A;  2OAL A;  5GSN A;  4H4Z A;  2XVI A;  2WET A;  4BK2 A;  1E1K A;  1PJ7 A;  4UP3 A;  4NZH A;  3CN8 A;  2OAM A;  4JQ9 A;  1Q1W A;  4WX1 A;  1TDN A;  3ALM A;  1LPF A;  2YLW A;  4Y4L A;  1S2Y A;  2WOV A;  2YLX A;  5BUL A;  2R45 A;  1YQ4 A;  2GF3 A;  2VRM A;  3DGH A;  4IV9 A;  1E7P A;  2R0C A;  2BC0 A;  2X3N A;  2BS2 A;  4FK1 C;  4K8D A;  4J36 A;  2AAQ A;  2X8H A;  3UP4 A;  1NHP A;  1EL7 A;  1F8R A;  2GR0 A;  1BWC A;  1MOK A;  1D7L A;  1NG4 A;  2E5V A;  2Q0K A;  2WOW A;  2WU2 A;  1EL8 A;  3QJ4 A;  4OPU A;  4FDC B;  3CNP A;  5JCN A;  2XYO A;  1XAN A;  1NEK A;  1EL9 A;  1OJD A;  3DK8 A;  5HXI A;  1PBB A;  4C3X A;  1DOC A;  2XLT A;  1CJ4 A;  4REK A;  4ZN0 A;  4I58 A;  1ZK7 A;  3VR8 A;  4U8O A;  2R0G A;  3G5Q A;  4J2W A;  1H82 A;  4CCQ A;  1ZY8 A;  3CND A;  4CCR A;  1FEC A;  3V3O A;  1GEU A;  4H4U A;  1GET A;  5C2T A;  4U8K A;  4Z2U A;  2C76 A;  1D5T A;  3KKJ A;  3CPI G;  2YG3 A;  4B65 A;  3GDN A;  4EIP A;  2A89 A;  1CHU A;  1YY5 A;  3NK0 X;  2VQB A;  2JB2 A;  1L9E A;  3P4Q A;  1V59 A;  5IQ1 A;  3BHF A;  3DME A;  2VVL A;  1TYT A;  2WBA A;  4BUR A;  3DK9 A;  3H8I A;  4GF7 A;  3K30 A;  3DJD A;  4OPC A;  1O95 A;  3CGB A;  2C73 A;  3FPZ A;  3AED A;  4GRT A;  2R4E A;  2YWL A;  4CY6 A;  2YQU A;  5EBK A;  3LZW A;  2EQ9 A;  1ZX9 A;  2APG A;  3IHG A;  1D4C A;  1B8S A;  2B7R A;  3AE9 A;  3OC4 A;  4JNA A;  3DJG X;  3GRS A;  2Q7V A;  3EAO A;  3CNJ A;  4A6N A;  1K0I A;  4USQ A;  3VRD B;  2CFY A;  4EM3 A;  2Q0L A;  3V3N A;  1YKJ A;  1DOD A;  4X4J A;  1JRY A;  1DOE A;  2XFO A;  1XHC A;  4YSX A;  3D8X A;  1Y0P A;  2YVF A;  1BF3 A;  2JAE A;  3UCL A;  4EQS A;  2OLO A;  3BNU A;  2ZZ0 A;  1IUU A;  3PO7 A;  2C3C A;  2BA9 A;  1JU2 A;  5IPY A;  4AT0 A;  1M64 A;  4X9M A;  2VRL A;  2XVF A;  1H81 A;  4H4Y A;  1Q1R A;  2FJB A;  4H2Q A;  1LTX R;  1PJ6 A;  3NT6 A;  3Q9T A;  2V61 A;  1Y56 B;  4K2X A;  1TDF A;  2X50 A;  3CIR A;  3UKP A;  1P2H A;  2WP5 A;  4C74 A;  3NG7 X;  2FJD A;  4P9S A;  3CGD A;  1N4U A;  2X99 A;  2AQJ A;  2WS3 A;  1PBF A;  2XDO A;  2V3B A;  1ONF A;  2YG6 A;  5U63 A;  4EIQ A;  1W4X A;  4EQW A;  4AP3 A;  1FCD A;  2BK4 A;  5JCM A;  4N9X A;  3DJJ A;  3AXB A;  3ISH A;  3FG2 P;  2DKH A;  2C64 A;  1IUW A;  1KF6 A;  3RNM A;  3LJP A;  2GQW A;  1JOA A;  1KSS A;  4UDR A;  1TDK A;  3NH3 X;  2EQ6 A;  2R9Z A;  1PXC A;  3I3L A;  3CGC A;  1OJC A;  4TM4 A;  3SQP A;  1X31 B;  4B63 A;  1RYI A;  2NVK X;  4HA6 A;  3AE3 A;  3CGE A;  4K22 A;  5U25 A; 
#chains in the Genus database with same CATH topology
 3ALL A;  2OQY A;  3H8L A;  2GGG A;  1JDF A;  3HYW A;  5FS9 A;  3FV9 A;  3DGZ A;  3WE0 A;  2VOU A;  1EC7 A;  4H4X A;  2XLS A;  3ETR B;  3UJF A;  5EOW A;  3JZU A;  3UXK A;  1QO8 A;  3BI5 A;  2BS3 A;  1EL5 A;  1SJC A;  2P0I A;  1BKW A;  2POD A;  3ZLH A;  4DWD A;  1EC9 A;  2CDU A;  3I6E A;  5DBJ A;  2XFN A;  1E39 A;  2A8X A;  2Y6Q A;  5JCK A;  3L8K A;  3KD9 A;  1K0J A;  1LJ1 A;  1KN0 A;  3ABV A;  2RAB A;  1N5X A;  1XDI A;  5J7X A;  3O0H A;  2WES A;  3H8A A;  1JRZ A;  2H88 A;  4U8J A;  2PHH A;  3UOX A;  1N60 C;  2XSX A;  2PPG A;  4C3Y A;  2OA1 A;  3V3W A;  4LU6 A;  4E6M A;  2AL2 B;  3DER A;  4G7F A;  4MGG A;  3F8D A;  4IA6 A;  1CJ3 A;  2OFJ A;  1B37 A;  3R07 C;  2VVL G;  4U2S A;  1KNR A;  2PTX A;  3FIM B;  2E4G A;  2OZ8 A;  4NTD A;  1CBO A;  4HCL A;  4U2T A;  3MWC A;  2X8G A;  1VQW A;  1H2I A;  5M0Z A;  4J3Z A;  3DFH A;  4BV6 A;  1H84 A;  3RP6 A;  1DJN A;  4OPI A;  2OVL A;  3GD4 A;  3AE5 A;  3FJ4 A;  3NVV B;  4Z26 A;  3OPS A;  3SSZ A;  1GRH A;  3THU A;  2GV8 A;  3UKQ A;  2PYX A;  1GOS A;  3NN6 X;  1CJC A;  2ZBW A;  2CHR A;  1P2E A;  4B68 A;  2FYM A;  4IT1 A;  4B66 A;  4GGB A;  2QDD A;  3SN1 A;  4GGH A;  3IHM A;  2GMH A;  4FK1 A;  3UKK A;  2GMJ A;  3AEA A;  1DOB A;  4IP4 A;  3GRT A;  5ER0 A;  3M0O A;  3TW9 A;  4YSH A;  3P3B A;  3BI4 A;  1JPM A;  1PXB A;  3Q4D A;  4CY8 A;  4K7Z A;  5HHF A;  2X8C A;  3NRN A;  5FJT A;  4IVM B;  2IID A;  2YLT A;  4YWO A;  4XXG A;  1QJD A;  4U8N A;  3T4W A;  3NVY B;  1ECQ A;  3VRA A;  1DTN A;  4GR1 A;  5EB4 A;  3F8R A;  3D1C A;  2GQF A;  1E1N A;  2Z5X A;  3QTP A;  1K0L A;  3SM8 A;  2BRY A;  3BHK A;  3NYE A;  3GO2 A;  3QSM A;  2BK5 A;  3JVA A;  4OPG A;  3UKH A;  4H4V A;  4DNA A;  4GME A;  1YQ3 A;  1NHS A;  2GAG B;  2WU5 A;  5C3J A;  2J3N A;  1L0V A;  3R11 A;  3G5R A;  3AEB A;  4OPL A;  5FJU A;  3QN3 A;  4Z44 A;  3K1G A;  2JB1 A;  4J56 A;  1NG3 A;  1LQT A;  2YM1 A;  3BOX A;  2ACZ A;  2RGO A;  2DW6 A;  3BSM A;  2RDX A;  1GRB A;  3ICR A;  3PVC A;  3C96 A;  2P8B A;  3UCD A;  4A3R A;  1KDG A;  2GB0 A;  1CJ2 A;  4Z2T A;  4GYP A;  2XFQ A;  4UDQ A;  3K7Q X;  5KWF A;  1KNP A;  3EF6 A;  2YR4 A;  3KUM A;  4J57 A;  2XVE A;  3KPF A;  4GDP A;  4WCT A;  4JHM A;  4A79 A;  3E1T A;  1F6M A;  1ELS A;  1M6I A;  3OZ2 A;  2B9X A;  1GTH A;  3FMW A;  3H7V A;  4B1B A;  2YAU A;  4YSY A;  3K7M X;  3GYJ A;  1AOG A;  3URH A;  2QJN A;  5JCI A;  1NU5 A;  3NTA A;  2PGW A;  4O5Q A;  1PJ7 A;  4UP3 A;  3D46 A;  2XH0 A;  2OAM A;  4JQ9 A;  2PTY A;  4ZOH B;  2OQH A;  2YLW A;  3T2Y A;  3NZG A;  2WOV A;  2R45 A;  4IV9 A;  1E7P A;  2X3N A;  3RR1 A;  1STZ A;  2BS2 A;  3VDG A;  2AAQ A;  2HXU A;  2GGH A;  4HN8 A;  1N5W C;  1EL7 A;  3K7T A;  1D7L A;  2Q0K A;  1NG4 A;  1N63 C;  4GAV A;  1NEK A;  1EL9 A;  4C3X A;  1TE6 A;  1S7M A;  4U8O A;  3G5Q A;  1PDY A;  1H82 A;  1ZY8 A;  4CCQ A;  4CCR A;  1GEU A;  4H4U A;  1GET A;  4Z2U A;  2YG3 A;  5BOF A;  3NK0 X;  2JB2 A;  1V59 A;  3BHF A;  4TVY A;  4GF7 A;  1O95 A;  3FPZ A;  3AED A;  4GRT A;  1PDZ A;  3NVW B;  2EQ9 A;  3UXL A;  3EAO A;  2PP3 A;  4A6N A;  1K0I A;  4EM3 A;  1DOD A;  1XHC A;  3D8X A;  2YVF A;  1BF3 A;  2PGE A;  2C3C A;  3DGB A;  2NQL A;  5FJO A;  4X9M A;  2XVF A;  4H4Y A;  1LTX R;  1PJ6 A;  3NT6 A;  1Y56 B;  3IJQ A;  3CIR A;  3UKP A;  1P43 A;  4P9S A;  2WS3 A;  2XH2 A;  4B67 A;  2XDO A;  3PG6 A;  5U63 A;  4EQW A;  4H83 A;  1KF6 A;  3RNM A;  3LJP A;  3FYY A;  1JRP A;  1KSS A;  1TDK A;  4HCD A;  3I3L A;  3SQP A;  1X31 B;  3N4E A;  3AE3 A;  1GND A;  3NTD A;  3IJI A;  2W55 A;  2QAE A;  5CKU A;  3ENL A;  3QPE A;  2QGY A;  2YR5 A;  1XPY A;  5KRQ A;  2R46 A;  1GAL A;  1ZMD A;  4J34 A;  3NXL A;  3VC5 A;  2C65 A;  4H4W A;  2BCP A;  2OLN A;  1NHQ A;  2C3D A;  1MDR A;  1P48 A;  2WOI A;  2PMQ A;  4Z24 A;  1PHH A;  2TPR A;  3RIT A;  4ICY A;  2FKP A;  1JCT A;  4EQR A;  2WDQ A;  4KEM A;  4G74 A;  1BGJ A;  5JCL A;  3UOV A;  2XLP A;  3RED A;  1GRF A;  2MUC A;  3LZX A;  3UJ2 A;  4NTE A;  1N62 C;  1VG9 A;  3SZ0 A;  3UKL A;  4U2L A;  2ZC8 A;  2O56 A;  2YLZ A;  4K1W A;  1O94 A;  4A99 A;  4H4P A;  4JN7 A;  3KA7 A;  2YVJ A;  1TZZ A;  3ZDN A;  1H83 A;  3T0K A;  4HCH A;  4A6G A;  2ARD A;  4DSH A;  3GDP A;  3KVE A;  1GRA A;  2QVH A;  4IL0 A;  1ZOV A;  2WP9 A;  4Z2R A;  3EAN A;  1L9C A;  3IC9 A;  3V76 A;  3STP A;  2WPF A;  3ATR A;  3C4N A;  4TVW A;  4X9N A;  4E0V A;  3AD9 B;  3VC6 A;  4FI4 A;  5M10 A;  2W0H A;  3I4K A;  3EKG A;  4H19 A;  1F3P A;  2WDR A;  5IQ4 A;  3QLD A;  3R25 A;  1DXL A;  2HNE A;  4USR A;  4ZCW A;  3QVP A;  4IVO B;  5FJP A;  4E8G A;  4PAB A;  1H86 A;  1NDA A;  2XLU A;  3CNT A;  3SX6 A;  4K5R A;  3CK5 A;  1X2G A;  2PTZ A;  3NLC A;  4OCG A;  3UOY A;  1PXA A;  3ALJ A;  4H2R A;  5FS8 A;  2YLR A;  3NYC A;  1BZL A;  2YVG A;  1FL2 A;  1OEP A;  1SJA A;  3GWF A;  4Z1Y A;  3CYJ A;  3S61 A;  3DH9 A;  3UTG A;  3ICT A;  1N1P A;  2JB3 A;  4M0X A;  4H4T A;  3B9J B;  3FBS A;  1GTE A;  2BC1 A;  1KFY A;  3RP8 A;  3T37 A;  2GGJ A;  4EMI A;  2XH7 A;  2VVM A;  1TYP A;  2OZT A;  3DA1 A;  1H6V A;  1ELI A;  3RHA A;  2XVH A;  3JW7 A;  3RP7 A;  2GGE A;  2WQY A;  2EQ8 A;  4LA1 A;  1VQZ A;  3MSY A;  1NEN A;  3H12 A;  3CTY A;  2VQ7 A;  4DN1 A;  4NTC A;  2IVE A;  3NO1 A;  3IF9 A;  3LB8 A;  1LV0 A;  2OX4 A;  2PA6 A;  4Z43 A;  3M13 A;  3UCC A;  1ZDL A;  4DHG A;  2BS4 A;  1TDO A;  2BXS A;  1Q9I A;  1V97 A;  4GCM A;  1FFU C;  3CPJ G;  3TQP A;  1ONE A;  2JBV A;  1JRO A;  4FP1 A;  3LXD A;  3VCC A;  1JRX A;  1SJB A;  1D4E A;  2WPC A;  3B3R A;  2HZG A;  1JNR A;  2V3A A;  3HW2 A;  2Z5Y A;  3TWB A;  2PTW A;  3GMB A;  3CPH G;  1D7Y A;  4EQX A;  2YG5 A;  2BAC A;  3AE8 A;  3II4 A;  1CL0 A;  3V5F A;  5KXJ A;  4BK1 A;  1WUF A;  3EEZ A;  1RP0 A;  3BJS A;  3T31 A;  1FEB A;  5BUK A;  3NNE A;  2H89 A;  1PBE A;  2F5Z A;  1S3E A;  2YM2 A;  2DKI A;  2NPX A;  3AYL A;  4YXD A;  4H1Z A;  3S47 A;  2WET A;  1E1K A;  2P8C A;  3AMZ A;  4NZH A;  3CN8 A;  3ES8 A;  4IP5 A;  5KMQ A;  1Q1W A;  1ZXI C;  3NFU A;  4YWS A;  2XGZ A;  3ALM A;  1LPF A;  4Y4L A;  1S2Y A;  5BUL A;  1YQ4 A;  2GF3 A;  2R0C A;  4FK1 C;  2GR0 A;  4FDC B;  3CNP A;  5JCN A;  1OJD A;  3DK8 A;  1PBB A;  1DOC A;  4REK A;  1ZK7 A;  2R0G A;  4J2W A;  5C2T A;  3VA8 A;  1D5T A;  3KKJ A;  3H70 A;  2A89 A;  3D47 A;  2VQB A;  3P4Q A;  3HRD C;  5IQ1 A;  3GYX A;  2WBA A;  3H8I A;  3DK9 A;  3K30 A;  3DJD A;  4E4U A;  2R4E A;  1FIQ B;  1ZX9 A;  2APG A;  1D4C A;  2PCE A;  4USQ A;  3V3N A;  1DOE A;  2XFO A;  3PFR A;  4YSX A;  2ZZ0 A;  3TWA A;  3SN0 A;  2BA9 A;  5IPY A;  1R6W A;  1Q1R A;  1KKR A;  2X50 A;  3ZLF A;  4C74 A;  3RRA A;  5IDZ A;  2FJD A;  3CGD A;  2X99 A;  4EIQ A;  4E4F A;  1ONF A;  2BK4 A;  3AXB A;  2C64 A;  1IUW A;  1JOA A;  1PXC A;  3DG6 A;  4B63 A;  3D9X A;  2BRA A;  2AKZ A;  3ATQ A;  1VRQ B;  3LOV A;  4EM4 A;  3AEF A;  4K8G A;  3ADA B;  3S5S A;  1DJQ A;  1EBD A;  4H4R A;  3AE1 A;  4YSZ A;  3ITJ A;  2OG9 A;  3JSK A;  2C4C A;  4H2P A;  2QJJ A;  4OPT A;  4TLZ A;  1QLB A;  4U8L A;  3DIP A;  3LAD A;  3DK4 A;  2FJA A;  3GD3 A;  3PWG A;  3UJR A;  2BK3 A;  4KPL A;  4JY2 A;  4I59 A;  3UTE A;  4ZCC A;  4YT0 A;  2XFU A;  1Y56 A;  4ADW A;  3NRZ B;  3C4A A;  5L46 A;  1E1M A;  3QFB A;  2AL1 A;  1O5W A;  4ENL A;  4Z17 A;  2BAB A;  5KNL A;  2GEW A;  3U4F A;  2YG4 A;  1W6T A;  2POZ A;  2I0Z A;  2W3S A;  3PS9 A;  4CNK A;  1JEH A;  2ZZB A;  4G6G A;  2XVJ A;  2OZ3 A;  1IUX A;  3NHO X;  2GGI A;  4FX9 A;  3HYV A;  2WEU A;  2B9Y A;  4M52 A;  2YG7 A;  1CC6 A;  2WP6 A;  3RCY A;  4H4Q A;  2QA1 A;  4IA5 A;  3T8Q A;  4YTP A;  4ROP A;  2PS2 A;  4E5T A;  2QA2 A;  4DYE A;  4NEW A;  2C7G A;  2AR8 A;  1XPQ A;  1ZOY A;  2V5Z A;  1PDH A;  3BI2 A;  3DJE A;  3AD8 B;  3AEE A;  4CNJ A;  4AP1 A;  3AM9 A;  3N4F A;  2TMD A;  4GFI A;  1F8S A;  3SFE A;  3CAW A;  3ICS A;  4BJZ A;  1KD0 A;  3L5O A;  4YTM A;  4U8I A;  4MJW A;  3QSE A;  3NK1 X;  1PBC A;  3QVR A;  3AE2 A;  5KVH A;  2FJE A;  3P9U A;  2XH4 A;  2R0P A;  3UOZ A;  1MO9 A;  2QDE A;  1CC4 A;  2E1M A;  1GT8 A;  1GER A;  5KOW A;  2JK6 A;  2JKC A;  3P0W A;  4DGK A;  1VDC A;  2E3T A;  3UJS A;  4HYR A;  4A6N B;  4CRT A;  4F4R A;  2ZAD A;  2XFP A;  1ZMC A;  4A65 A;  2GH5 A;  4CBQ A;  3T2Z A;  1Z6L A;  3ZVH A;  4YKG A;  5KMP A;  3OZY A;  2BCG G;  2C70 A;  3FVD A;  5HY5 A;  3NKS A;  5CQF A;  6ENL A;  4OPD A;  4OVI A;  2DW7 A;  5KVI A;  1K4Q A;  4XWR A;  5GRT A;  1B4V A;  2A87 A;  3P4S A;  1GSN A;  3SXI A;  4BK3 A;  4Z25 A;  3AYI A;  1COY A;  2OPJ A;  4J33 A;  4J31 A;  1LVL A;  1GV4 A;  4NEV A;  1T3Q C;  4U8P A;  4H4S A;  3AE6 A;  1GXF A;  3ZYX A;  3OTR A;  3GC2 A;  5FS6 A;  1BKH A;  3FCP A;  4D03 A;  4U8M A;  3PK7 A;  5J04 A;  3GYI A;  1F9C A;  3P1W A;  2WHD A;  4A35 A;  4A7A A;  3SR6 B;  1REO A;  1MXT A;  1IUT A;  1JNZ A;  1HYU A;  4AOX A;  5HYM A;  1BQG A;  3NK2 X;  3MY9 A;  4II3 A;  1FO4 A;  3AEG A;  3M12 A;  2V6O A;  2O9Z A;  1SB3 B;  1IYX A;  3R0K A;  4A9W A;  5ENL A;  2AL2 A;  3UTF A;  2XLR A;  4KX6 A;  1IUV A;  1GRE A;  2BYB A;  4TM1 A;  2W3R A;  1FFV C;  2PU1 A;  3PWI A;  1SEZ A;  1UKV G;  3HYX A;  2XCG A;  3VFC A;  5EB5 A;  1H7X A;  3GSI A;  3A7U A;  2GVC A;  4DXK A;  4EMW A;  3QFA A;  3R1Z A;  3P4P A;  4JNQ A;  4H4Z A;  1RM6 B;  4WX1 A;  2OLA A;  3CXB A;  5BOE A;  2YLX A;  4HPN A;  3T2K A;  3UJE A;  4J36 A;  3UP4 A;  1F8R A;  3UP5 A;  1BWC A;  2E5V A;  1EL8 A;  4OPU A;  3I6T A;  2XLT A;  4ZN0 A;  3VR8 A;  2AKM A;  3CND A;  1FEC A;  5FJR A;  3GDN A;  1YY5 A;  4OPC A;  3P93 A;  3DES A;  2YWL A;  4CY6 A;  2YQU A;  5EBK A;  3LZW A;  7ENL A;  3IHG A;  2PP0 A;  1B8S A;  2B7R A;  3OC4 A;  4JNA A;  2W54 A;  3GRS A;  3SQS A;  2Q7V A;  3VRD B;  2CFY A;  2Q0L A;  4X4J A;  1JRY A;  5EU9 A;  4G6H A;  1Y0P A;  2JAE A;  3UCL A;  2OLO A;  3ZLG A;  2OKT A;  1H81 A;  2FJB A;  3Q9T A;  2V61 A;  1P2H A;  3T6C A;  3NG7 X;  1N4U A;  2YG6 A;  2V3B A;  3NVZ B;  4AP3 A;  1TKK A;  3DJJ A;  3ISH A;  2DKH A;  2EQ6 A;  1RVK A;  3CGC A;  4NNJ A;  3VCN A;  4HA6 A;  3CGE A;  4K22 A;  5U25 A;  1EC8 A;  4MMW A;  4HB9 A;  4RSL A;  1FHU A;  3GD6 A;  2C72 A;  1OJA A;  2Q6U A;  3A7R A;  1TDE A;  1NEL A;  1DNC A;  1H7W A;  4TM0 A;  1TRB A;  1GES A;  4H2H A;  5JRB A;  3RGT A;  3AB1 A;  4APN A;  3DG7 A;  3SBF A;  3OZM A;  1PBD A;  4EWJ A;  4IL2 A;  3SYI A;  3EUB 3;  3DDM A;  1IJH A;  1EBH A;  3EPT A;  2B76 A;  1SJD A;  4O5U A;  3SZC A;  2GRT A;  1CF3 A;  5LV9 A;  4TM3 A;  2P3Z A;  3SGL A;  3CMM A;  4YTN A;  1OJ9 A;  5G5G B;  2E5A A;  3AD7 B;  4DSG A;  3RO6 A;  1WYG A;  1D4D A;  3AE7 A;  2RGJ A;  1L8P A;  3TTE A;  1N4V A;  3Q45 A;  1L9D A;  4G73 A;  2C67 A;  1KCZ A;  4NWZ A;  1N4W A;  3UTH A;  3FXG A;  4RG3 A;  3BNM A;  1GPE A;  3IK4 A;  1IUS A;  4YKF A;  2GL5 A;  4UDP A;  1MDL A;  3OP2 A;  2HQM A;  2PP1 A;  3QSS A;  5BVA A;  1KSU A;  5BRT A;  2MNR A;  3NS1 B;  1LQU A;  3VRB A;  1FEA A;  5U1O A;  4K5S A;  2EQ7 A;  4MKS A;  4JN9 A;  3TCS A;  3S5W A;  1S2Q A;  1OJT A;  3B6D A;  4J1O A;  3I6D A;  3F8P A;  1E6E A;  3V4B A;  2BXR A;  1B5Q A;  3CT2 A;  5TR3 A;  4KPR A;  4G8T A;  3NN0 X;  4EMJ A;  3T9P A;  4C77 A;  4GDE A;  3L1R A;  4X2P A;  2YR6 A;  3H4K A;  3AE4 A;  4G9K A;  1PS9 A;  4II2 A;  2ZZC A;  3HPF A;  3IJL A;  3NGC X;  1YEY A;  3AYJ A;  3NIX A;  4GYP C;  3TJ4 A;  1FHV A;  3R0U A;  1ZKQ A;  2HXT A;  3CNS A;  3UGV A;  3HZL A;  4PAA A;  2FBW A;  4HNL A;  4A5L A;  4JY3 A;  1GRT A;  4BJY A;  4AT2 A;  3VQR A;  1MNS A;  2WPE A;  3SZW A;  3KPK A;  3N6H A;  4GUV A;  2RGH A;  2C75 A;  2PU0 A;  1NAA A;  3GY1 A;  4D04 A;  3P4R A;  4IZG A;  1GRG A;  4B69 A;  1CC2 A;  1MRA A;  4H2N A;  3MZN A;  3GWD A;  2WDV A;  1X2H A;  1KKO A;  4IHC A;  3DG3 A;  3IWA A;  3DEQ A;  4AOS A;  4M6U A;  2B9W A;  3AEC A;  4B64 A;  5FMH A;  3NYF A;  4TLX A;  1BGN A;  1E1L A;  3Q6J A;  4HNC A;  4LII A;  4JDR A;  4Y4N A;  3CB3 A;  2OO6 A;  4GAP A;  3G5S A;  3GMC A;  4KWS A;  2R4J A;  3AWI A;  1F8W A;  3UKF A;  2IVD A;  2GDQ A;  1NHR A;  3QKE A;  2V60 A;  4H50 A;  4H7U A;  2QCU A;  1VDV A;  4Y4M A;  3ZVI A;  3MUC A;  1VG0 A;  1YQZ A;  4GIR A;  1MUC A;  4JN8 A;  2CVJ A;  1NPX A;  2GAH B;  2GR3 A;  3MQT A;  5KMS A;  4C5O A;  2UZZ A;  3SFD A;  2GR2 A;  4XWZ A;  3KLJ A;  1ZP0 A;  4KT2 A;  2VZ2 A;  1PJ5 A;  5KOX A;  1PN0 A;  1S3B A;  2P88 A;  2B7S A;  3VR9 A;  4GIS A;  3KU9 A;  2YLS A;  1RSG A;  4RG4 A;  3COX A;  1XS2 A;  4ZCD A;  2C66 A;  5FS7 A;  2Y6R A;  3MKC A;  2CUL A;  5J60 A;  4ECH A;  3UKA A;  2GR1 A;  1FOH A;  2OAL A;  5GSN A;  2XVI A;  4BK2 A;  3T14 A;  2ONE A;  1TDN A;  3CXO A;  3DFY A;  2VRM A;  3DGH A;  2BC0 A;  3A7A A;  4K8D A;  2I5Q A;  2X8H A;  1NHP A;  3SN4 A;  3V5C A;  1MOK A;  3QJ4 A;  2WOW A;  2WU2 A;  3SZF A;  1N61 C;  2XYO A;  1XAN A;  5HXI A;  4DX3 A;  1EBG A;  1CJ4 A;  4I58 A;  4ZA0 A;  2QJM A;  3V3O A;  4U8K A;  2C76 A;  3N6J A;  3CPI G;  4B65 A;  4EIP A;  1CHU A;  3B97 A;  3AN1 A;  1L9E A;  3DME A;  1WUE A;  2VVL A;  1TYT A;  4BUR A;  3CGB A;  2C73 A;  3U9I A;  3AE9 A;  3DJG X;  3TJI A;  3CNJ A;  1YKJ A;  3SJN A;  2GSH A;  2QQ6 A;  4EQS A;  3BNU A;  1IUU A;  3PO7 A;  1JU2 A;  4AT0 A;  2PSN A;  5G5H B;  1M64 A;  2VRL A;  4K2S A;  1E9I A;  5KMR A;  4H2Q A;  3TOY A;  4K2X A;  1TDF A;  2WP5 A;  3SY4 A;  3R9U A;  2AQJ A;  1PBF A;  3ES7 A;  1R0M A;  1W4X A;  3ZVH B;  1FCD A;  5JCM A;  4N9X A;  3R10 A;  3FG2 P;  2GQW A;  4UDR A;  3NH3 X;  2R9Z A;  1OJC A;  1JPD X;  4TM4 A;  1RYI A;  2NVK X;  3OW1 A; 
#chains in the Genus database with same CATH homology
 3ALL A;  4HB9 A;  3ATQ A;  3H8L A;  4RSL A;  1GND A;  1VRQ B;  3LOV A;  4EM4 A;  3HYW A;  3NTD A;  2C72 A;  1OJA A;  2Q6U A;  3AEF A;  3ADA B;  5FS9 A;  1TDE A;  2QAE A;  5CKU A;  3DGZ A;  1DNC A;  1H7W A;  1DJQ A;  1EBD A;  3WE0 A;  4H4R A;  2VOU A;  4TM0 A;  3AE1 A;  4H4X A;  2XLS A;  1TRB A;  4YSZ A;  1GES A;  2YR5 A;  5KRQ A;  3ITJ A;  5JRB A;  3JSK A;  2R46 A;  5EOW A;  1GAL A;  1ZMD A;  2C4C A;  3AB1 A;  4APN A;  1QO8 A;  3BI5 A;  4H2P A;  4EIQ A;  4J34 A;  4OPT A;  4TLZ A;  2BS3 A;  1QLB A;  4U8L A;  1EL5 A;  2C65 A;  4H4W A;  2BCP A;  3LAD A;  2OLN A;  1NHQ A;  1BKW A;  1PBD A;  2C3D A;  3DK4 A;  3SYI A;  2CDU A;  2FJA A;  1IJH A;  3GD3 A;  2BK3 A;  5DBJ A;  2WOI A;  2XFN A;  1E39 A;  4Z24 A;  1PHH A;  3EPT A;  2A8X A;  2Y6Q A;  4JY2 A;  4I59 A;  3UTE A;  5JCK A;  2TPR A;  3L8K A;  3KD9 A;  4ZCC A;  4ICY A;  4YT0 A;  2XFU A;  1Y56 A;  1K0J A;  2B76 A;  4EQR A;  2WDQ A;  4G74 A;  4ADW A;  1LJ1 A;  4O5U A;  3C4A A;  1BGJ A;  1KN0 A;  2GRT A;  1CF3 A;  3SZC A;  3ABV A;  2RAB A;  5LV9 A;  5JCL A;  4TM3 A;  3UOV A;  5L46 A;  1XDI A;  2XLP A;  3RED A;  1E1M A;  3SGL A;  5J7X A;  1GRF A;  3QFB A;  3O0H A;  3CMM A;  1O5W A;  2WES A;  3LZX A;  4NTE A;  4YTN A;  1OJ9 A;  1JRZ A;  1VG9 A;  2BAB A;  2H88 A;  2PHH A;  3AD7 B;  4U8J A;  3UOX A;  5KNL A;  2GEW A;  4DSG A;  3SZ0 A;  2YG4 A;  3UKL A;  4C3Y A;  4U2L A;  2I0Z A;  2OA1 A;  2YLZ A;  3PS9 A;  4CNK A;  1JEH A;  4LU6 A;  1D4D A;  2ZZB A;  1O94 A;  3AE7 A;  2RGJ A;  4G6G A;  2XVJ A;  4A99 A;  4H4P A;  1N4V A;  3KA7 A;  2YVJ A;  1L9D A;  3F8D A;  4G73 A;  4IA6 A;  1IUX A;  3NHO X;  2C67 A;  3ZDN A;  1H83 A;  3HYV A;  4FX9 A;  3T0K A;  2WEU A;  2B9Y A;  4M52 A;  2YG7 A;  1CJ3 A;  2ARD A;  1CC6 A;  2WP6 A;  1B37 A;  4DSH A;  4NWZ A;  1N4W A;  2VVL G;  4U2S A;  1KNR A;  3GDP A;  3FIM B;  2E4G A;  3KVE A;  1GRA A;  3UTH A;  4NTD A;  4H4Q A;  1CBO A;  2QA1 A;  4IA5 A;  4U2T A;  1ZOV A;  2WP9 A;  3BNM A;  4RG3 A;  4YTP A;  1GPE A;  4Z2R A;  2X8G A;  1IUS A;  3EAN A;  1L9C A;  1VQW A;  1H2I A;  4YKF A;  3IC9 A;  5M0Z A;  4BV6 A;  3V76 A;  2QA2 A;  1H84 A;  4UDP A;  2WPF A;  4NEW A;  3ATR A;  2C7G A;  3C4N A;  1DJN A;  3RP6 A;  4OPI A;  2HQM A;  2AR8 A;  3QSS A;  1XPQ A;  4X9N A;  4E0V A;  1ZOY A;  3AD9 B;  2V5Z A;  5M10 A;  2W0H A;  3GD4 A;  3AE5 A;  5BVA A;  1KSU A;  1PDH A;  5BRT A;  3BI2 A;  1LQU A;  3VRB A;  1FEA A;  4Z26 A;  3DJE A;  3AD8 B;  1F3P A;  5U1O A;  2WDR A;  3AEE A;  4K5S A;  4CNJ A;  5IQ4 A;  1GRH A;  2EQ7 A;  4AP1 A;  4JN9 A;  2TMD A;  2GV8 A;  3UKQ A;  1DXL A;  2PYX A;  1F8S A;  4USR A;  3S5W A;  1GOS A;  1S2Q A;  3QVP A;  1OJT A;  3B6D A;  3SFE A;  3NN6 X;  1CJC A;  2ZBW A;  3I6D A;  4IVO B;  3ICS A;  4BJZ A;  3F8P A;  1P2E A;  4B68 A;  3L5O A;  1E6E A;  4YTM A;  4U8I A;  4MJW A;  3QSE A;  2BXR A;  1B5Q A;  3NK1 X;  1PBC A;  3QVR A;  3AE2 A;  4PAB A;  5KVH A;  2FJE A;  3P9U A;  4B66 A;  5TR3 A;  1H86 A;  4KPR A;  2R0P A;  3UOZ A;  3NN0 X;  4EMJ A;  1MO9 A;  1CC4 A;  1NDA A;  2XLU A;  3CNT A;  3SX6 A;  4GDE A;  3L1R A;  4C77 A;  2E1M A;  2GMH A;  3IHM A;  4FK1 A;  2YR6 A;  1GT8 A;  3UKK A;  3H4K A;  3AE4 A;  4K5R A;  1GER A;  2GMJ A;  4G9K A;  1PS9 A;  3AEA A;  1DOB A;  4II2 A;  2ZZC A;  3GRT A;  5ER0 A;  5KOW A;  3M0O A;  2JK6 A;  3NGC X;  3NLC A;  4OCG A;  3UOY A;  4YSH A;  3AYJ A;  2JKC A;  3NIX A;  1PXA A;  3BI4 A;  3ALJ A;  4H2R A;  4DGK A;  1ZKQ A;  1PXB A;  3CNS A;  4CY8 A;  1VDC A;  4K7Z A;  5FS8 A;  2YLR A;  3HZL A;  5HHF A;  2X8C A;  2FBW A;  1BZL A;  2YVG A;  1FL2 A;  3NRN A;  3NYC A;  4JY3 A;  4PAA A;  4A5L A;  3GWF A;  1GRT A;  4IVM B;  4BJY A;  2IID A;  4B67 A;  2YLT A;  4AT2 A;  3VQR A;  4YWO A;  3S61 A;  4XXG A;  3DH9 A;  1QJD A;  4U8N A;  4A6N B;  4CRT A;  3UTG A;  3ICT A;  2WPE A;  1N1P A;  2JB3 A;  3SZW A;  3VRA A;  2XFP A;  4GR1 A;  4H4T A;  1ZMC A;  5EB4 A;  3KPK A;  4A65 A;  3FBS A;  1GTE A;  2BC1 A;  1KFY A;  3F8R A;  3RP8 A;  3D1C A;  2GQF A;  2GH5 A;  1E1N A;  4GUV A;  4CBQ A;  2Z5X A;  3T2Z A;  3T37 A;  2BRA A;  1Z6L A;  2RGH A;  2C75 A;  4YKG A;  5KMP A;  2BCG G;  1K0L A;  1NAA A;  2BRY A;  3SM8 A;  3P4R A;  3BHK A;  4EMI A;  3NYE A;  4D04 A;  1GRG A;  4B69 A;  2C70 A;  1CC2 A;  2VVM A;  5HY5 A;  3QSM A;  3NKS A;  5CQF A;  4H2N A;  1TYP A;  3GWD A;  3DA1 A;  2WDV A;  2BK5 A;  5KVI A;  4OPG A;  4OPD A;  4OVI A;  1K4Q A;  3UKH A;  3IWA A;  4XWR A;  5GRT A;  1B4V A;  2A87 A;  1H6V A;  4AOS A;  3P4S A;  4H4V A;  4DNA A;  1ELI A;  1YQ3 A;  1GSN A;  2XVH A;  3K7T A;  3RHA A;  3RP7 A;  3R9U A;  1NHS A;  2B9W A;  2GAG B;  2WU5 A;  3SXI A;  5C3J A;  3AEC A;  2J3N A;  4BK3 A;  2WQY A;  1L0V A;  4B64 A;  3G5R A;  4Z25 A;  2EQ8 A;  1COY A;  4LA1 A;  3AEB A;  5FMH A;  3AYI A;  3NYF A;  4J33 A;  4TLX A;  4J31 A;  1LVL A;  1GV4 A;  1BGN A;  1E1L A;  3Q6J A;  4OPL A;  4LII A;  4NEV A;  1NEN A;  3CTY A;  4JDR A;  4U8P A;  4Y4N A;  2VQ7 A;  4H4S A;  3AE6 A;  4NTC A;  1GXF A;  2IVE A;  3ZYX A;  4GAP A;  3G5S A;  4Z44 A;  2JB1 A;  3IF9 A;  3LB8 A;  3GMC A;  4J56 A;  5FS6 A;  1LV0 A;  1NG3 A;  2R4J A;  3AWI A;  1LQT A;  4D03 A;  2YM1 A;  1F8W A;  4U8M A;  3UKF A;  4Z43 A;  3M13 A;  2ACZ A;  3UP5 A;  2IVD A;  1NHR A;  3GYI A;  3P1W A;  2RGO A;  2V60 A;  2WHD A;  1ZDL A;  4H50 A;  4H7U A;  4A7A A;  2QCU A;  2BS4 A;  1REO A;  4Y4M A;  1MXT A;  1TDO A;  2BXS A;  1GRB A;  1IUT A;  3ICR A;  1Q9I A;  1VG0 A;  1YQZ A;  3PVC A;  1JNZ A;  1HYU A;  4GCM A;  2CVJ A;  1NPX A;  3C96 A;  4AOX A;  5HYM A;  3CPJ G;  3NK2 X;  1KDG A;  2JBV A;  2GAH B;  2GR3 A;  4II3 A;  2GB0 A;  1CJ2 A;  5KMS A;  3AEG A;  3LXD A;  4Z2T A;  1JRX A;  4C5O A;  2UZZ A;  1D4E A;  2WPC A;  2V6O A;  2XFQ A;  3M12 A;  3B3R A;  2O9Z A;  3SFD A;  2GR2 A;  1JNR A;  2V3A A;  2Z5Y A;  4XWZ A;  3GMB A;  3KLJ A;  1ZP0 A;  3CPH G;  1D7Y A;  4UDQ A;  2VZ2 A;  4EQX A;  1PJ5 A;  2YG5 A;  4A9W A;  3K7Q X;  5KOX A;  5KWF A;  1KNP A;  3EF6 A;  1PN0 A;  3UTF A;  2BAC A;  3AE8 A;  2XLR A;  4KX6 A;  3II4 A;  1IUV A;  2YR4 A;  1S3B A;  4J57 A;  2XVE A;  3KPF A;  1GRE A;  2B7S A;  2BYB A;  4TM1 A;  3VR9 A;  1CL0 A;  4GDP A;  4WCT A;  3KU9 A;  4A79 A;  3E1T A;  1F6M A;  1SEZ A;  1UKV G;  2YLS A;  3HYX A;  5KXJ A;  1M6I A;  3OZ2 A;  2B9X A;  4BK1 A;  1GTH A;  3FMW A;  1RSG A;  4RG4 A;  1RP0 A;  3T31 A;  3COX A;  4B1B A;  2XCG A;  4ZCD A;  2YAU A;  2C66 A;  5FS7 A;  2Y6R A;  1FEB A;  3K7M X;  3GYJ A;  3NNE A;  2H89 A;  4YSY A;  5BUK A;  2CUL A;  1PBE A;  5EB5 A;  1H7X A;  5J60 A;  1AOG A;  3URH A;  3GSI A;  2F5Z A;  5JCI A;  4ECH A;  3UKA A;  2GVC A;  3NTA A;  2GR1 A;  4EMW A;  1S3E A;  2YM2 A;  3QFA A;  2DKI A;  2NPX A;  3AYL A;  3P4P A;  4JNQ A;  4YXD A;  4O5Q A;  1FOH A;  2OAL A;  5GSN A;  4H4Z A;  2XVI A;  2WET A;  4BK2 A;  1E1K A;  1PJ7 A;  4UP3 A;  4NZH A;  3CN8 A;  2OAM A;  3T14 A;  4JQ9 A;  5KMQ A;  1Q1W A;  4WX1 A;  1TDN A;  3ALM A;  1LPF A;  2YLW A;  3T2Y A;  4Y4L A;  1S2Y A;  2WOV A;  2YLX A;  5BUL A;  2R45 A;  1YQ4 A;  2GF3 A;  2VRM A;  3DGH A;  4IV9 A;  1E7P A;  3T2K A;  2R0C A;  2BC0 A;  2X3N A;  2BS2 A;  4FK1 C;  4K8D A;  4J36 A;  2AAQ A;  2X8H A;  3UP4 A;  1NHP A;  1EL7 A;  1F8R A;  2GR0 A;  1BWC A;  1MOK A;  1D7L A;  1NG4 A;  2E5V A;  2Q0K A;  2WOW A;  2WU2 A;  1EL8 A;  3QJ4 A;  4GAV A;  4OPU A;  3SZF A;  4FDC B;  3CNP A;  5JCN A;  2XYO A;  1XAN A;  1NEK A;  1EL9 A;  1OJD A;  3DK8 A;  5HXI A;  1PBB A;  4C3X A;  1DOC A;  2XLT A;  1S7M A;  1CJ4 A;  4REK A;  4ZN0 A;  4I58 A;  1ZK7 A;  3VR8 A;  4U8O A;  2R0G A;  3G5Q A;  4J2W A;  1H82 A;  4CCQ A;  1ZY8 A;  3CND A;  4CCR A;  1FEC A;  3V3O A;  1GEU A;  4H4U A;  1GET A;  5C2T A;  4U8K A;  4Z2U A;  2C76 A;  1D5T A;  3KKJ A;  3CPI G;  2YG3 A;  4B65 A;  3GDN A;  4EIP A;  2A89 A;  1CHU A;  1YY5 A;  3NK0 X;  2VQB A;  2JB2 A;  1L9E A;  3P4Q A;  1V59 A;  5IQ1 A;  3BHF A;  3DME A;  2VVL A;  3GYX A;  1TYT A;  2WBA A;  4BUR A;  3DK9 A;  3H8I A;  4GF7 A;  3K30 A;  3DJD A;  4OPC A;  1O95 A;  3CGB A;  2C73 A;  3FPZ A;  3AED A;  4GRT A;  2R4E A;  2YWL A;  4CY6 A;  2YQU A;  5EBK A;  3LZW A;  2EQ9 A;  1ZX9 A;  2APG A;  3IHG A;  1D4C A;  1B8S A;  2B7R A;  3AE9 A;  3OC4 A;  4JNA A;  3DJG X;  3GRS A;  2Q7V A;  3EAO A;  3CNJ A;  4A6N A;  1K0I A;  4USQ A;  3VRD B;  2CFY A;  4EM3 A;  2Q0L A;  3V3N A;  1YKJ A;  1DOD A;  4X4J A;  1JRY A;  1DOE A;  4G6H A;  2XFO A;  1XHC A;  4YSX A;  3D8X A;  1Y0P A;  2YVF A;  1BF3 A;  2JAE A;  3UCL A;  4EQS A;  2OLO A;  3BNU A;  2ZZ0 A;  1IUU A;  3PO7 A;  2C3C A;  2BA9 A;  1JU2 A;  5IPY A;  4AT0 A;  1M64 A;  4X9M A;  2VRL A;  2XVF A;  1H81 A;  4H4Y A;  1Q1R A;  2FJB A;  5KMR A;  4H2Q A;  1LTX R;  1PJ6 A;  3NT6 A;  3Q9T A;  2V61 A;  1Y56 B;  4K2X A;  1TDF A;  2X50 A;  3CIR A;  3UKP A;  1P2H A;  2WP5 A;  4C74 A;  3NG7 X;  3SY4 A;  2FJD A;  4P9S A;  3CGD A;  1N4U A;  2X99 A;  2AQJ A;  2WS3 A;  1PBF A;  3PG6 A;  2V3B A;  1ONF A;  2XDO A;  2YG6 A;  5U63 A;  1W4X A;  4EQW A;  4AP3 A;  1FCD A;  2BK4 A;  5JCM A;  4N9X A;  3DJJ A;  3AXB A;  3ISH A;  3FG2 P;  2DKH A;  2C64 A;  1IUW A;  1KF6 A;  3RNM A;  3LJP A;  2GQW A;  1JOA A;  1KSS A;  4UDR A;  1TDK A;  3NH3 X;  2EQ6 A;  2R9Z A;  1PXC A;  3I3L A;  3CGC A;  1OJC A;  4TM4 A;  4NNJ A;  3SQP A;  1X31 B;  4B63 A;  3D9X A;  1RYI A;  2NVK X;  4HA6 A;  3AE3 A;  3CGE A;  4K22 A;  5U25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...