1XHCA

Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779-001
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
351
structure length
346
Chain Sequence
SKVVIVGNGPGGFELAKQLSQTYEVTVIDKEPVPYYSKPMLSHYIAGFIPRNRLFPYSLDWYRKRGIEIRLAEEAKLIDRGRKVVITEKGEVPYDTLVLATGARAREPQIKGKEYLLTLRTIFDADRIKESIENSGEAIIIGGGFIGLELAGNLAEAGYHVKLIHRGAMFLGLDEELSNMIKDMLEETGVKFFLNSELLEANEEGVLTNSGFIEGKVKICAIGIVPNVDLARRSGIHTGRGILIDDNFRTSAKDVYAIGDCAEYSGIIAGTAKAAMEQARVLADILKGEPRRYNFKFRSTVFKFGKLQIAIIGNTKGEGKWIEDNTKVFYIGAVVFNDIRKATKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NADH oxidase /nitrite reductase from Pyrococcus furiosus Pfu-1140779-001
rcsb
source organism Pyrococcus furiosus
molecule tags Oxidoreductase
molecule keywords NADH oxidase /nitrite reductase
total genus 105
structure length 346
sequence length 351
ec nomenclature
pdb deposition date 2004-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1xhcA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xhcA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xhcA02
4O5UA 2C3DA 3AEAA 4X9NA 4DSGA 3WE0A 4YKGA 4CRTA 2XYOA 2C73A 1LTXR 5JCIA 4H4TA 4H4YA 1FCDA 2RGOA 2YG6A 2YR6A 3B6DA 1JOAA 1YKJA 3LZXA 2BCPA 2A89A 4X9MA 4CCRA 4GUVA 2V3BA 3COXA 3UKKA 4Z25A 2BS4A 4Z44A 1E6EA 3F8RA 5KVHA 1GXFA 4K2XA 4BK2A 4U8IA 1MXTA 1ELIA 3VR9A 1GPEA 4U8NA 3CGEA 3K7QX 3CIRA 2TPRA 2FJBA 2V61A 3G5SA 1F3PA 1Q9IA 1F8SA 2GR2A 1H7WA 5U63A 4BJYA 2E5VA 2Z5XA 3AE6A 3AD8B 2OA1A 1DJNA 2FJEA 2X3NA 3IHGA 3AE3A 2YAUA 1BGJA 1GNDA 1L9EA 3ATQA 3NKSA 4OPLA 4TM3A 3SM8A 2OLNA 3ITJA 4U8PA 4I58A 2YWLA 2ACZA 3K7MX 1E1NA 4A6NB 1NHSA 1YY5A 1E1LA 1YQ3A 1PBDA 2BK5A 1GT8A 3NYEA 4OPUA 4AOXA 5KOXA 1JRZA 3P4RA 3GMCA 4JY3A 4EQXA 1H86A 2YG7A 2YLXA 3LZWA 4Y4LA 4CBQA 4Z2TA 5ER0A 2WESA 3ICSA 4U2LA 1GOSA 1NEKA 2JB1A 1H82A 3KLJA 3EF6A 3DJDA 4CY8A 2X8GA 3GRTA 4IVOB 4AT2A 4YSHA 1JEHA 2XFUA 4OPTA 2YG4A 4U8JA 3FBSA 1FEAA 2WOIA 3DGZA 2I0ZA 3C96A 2X8CA 4K22A 3NK1X 3ICTA 1NENA 2PYXA 3O0HA 1CC6A 3ALMA 3V76A 2CDUA 2YG3A 2WOWA 3RHAA 1LJ1A 4JNQA 4K7ZA 4NEVA 3NN6X 2GR0A 2VVLA 4H2QA 4K5RA 4D03A 1PHHA 3LOVA 1GRBA 3SGLA 4H4ZA 4JNAA 5FS7A 2CVJA 4YTNA 3FIMB 4K5SA 1TYPA 3BNUA 1D4EA 1OJDA 2JBVA 2GMHA 2Q0KA 3CNDA 1DNCA 2WPCA 1IUUA 4J36A 3DMEA 2WBAA 1GALA 3CNPA 2C70A 3NN0X 4YT0A 1KNPA 3KKJA 4CY6A 1S3EA 1ZDLA 3UTHA 2WDVA 1B4VA 2YQUA 4N9XA 2XVHA 2RGHA 5LV9A 4H4RA 2WP9A 3QFAA 1NHRA 1O5WA 2BA9A 5FS9A 2IVEA 1ZY8A 2H88A 1UKVG 2IVDA 1D7LA 1F6MA 3DK8A 1IUSA 1DOEA 4U8OA 2XFPA 2VVMA 3FG2P 3M13A 4OVIA 1E1MA 2GR1A 4JQ9A 3M12A 1BWCA 2C72A 4ADWA 2X50A 1PJ6A 1NG4A 4FDCB 5GSNA 1BGNA 3CN8A 4PABA 4OCGA 4EIPA 3CNSA 2GR3A 1TDOA 4A99A 2EQ9A 4EQSA 2YLZA 5TR3A 2WHDA 3BHFA 1HYUA 5HY5A 2GAHB 3GD3A 2UZZA 3UOXA 2AR8A 1Y56A 1ONFA 3SQPA 4ZCDA 2WPFA 1N4WA 1GETA 3P4PA 2ZZCA 3P4SA 1GRAA 1NAAA 4WCTA 2GQWA 4RSLA 1REOA 2APGA 2GB0A 1Q1WA 3UTFA 4B63A 1NHQA 4BK3A 1TDEA 3AEDA 3NHOX 4AT0A 5FS8A 4J56A 4DNAA 2JB3A 4U8KA 5BULA 1ZOYA 2BYBA 4REKA 5EBKA 2X99A 3AE7A 3CNTA 1GESA 3G5RA 3VRBA 3E1TA 1DODA 1NDAA 3L8KA 1H81A 1TDFA 1X31B 1NPXA 2RGJA 3C4AA 4E0VA 3GWDA 3CGDA 2TMDA 2XLPA 4UP3A 2XVEA 3S61A 1KFYA 4U2SA 2E4GA 4H4VA 4CNKA 2OLOA 2WEUA 3DJEA 3ALJA 3NRNA 4J34A 4Z2RA 4EMWA 2A87A 5J60A 4KPRA 1IUTA 3GMBA 2XCGA 1EBDA 1S2QA 2FBWA 4WX1A 2XFNA 5L46A 1RSGA 4J57A 1D7YA 4GDPA 3CPIG 3CPJG 3GYIA 2Y6RA 3NT6A 2R0GA 5KWFA 1JNZA 2XVFA 1CJ4A 3D8XA 2WDRA 2BABA 1IJHA 3B3RA 3CTYA 4C5OA 4H4XA 2XVIA 4YXDA 5GRTA 4H7UA 1IUVA 5C3JA 1GERA 4EM3A 2B9WA 3M0OA 3AE5A 1FOHA 1YQ4A 1NG3A 1CHUA 2Q7VA 5KRQA 3NGCX 2AAQA 4H4QA 1E1KA 2VOUA 2V60A 5KXJA 3PS9A 4YSZA 2A8XA 1DOBA 3VR8A 1ZX9A 1Q1RA 2ZZ0A 1S2YA 2C65A 3OZ2A 1PBEA 4J31A 5HHFA 3JSKA 1PBFA 3NG7X 3GD4A 3IHMA 2AQJA 3PVCA 4JN9A 3UKHA 1JU2A 1KNRA 2Q0LA 4BV6A 4DGKA 5JCNA 1KF6A 4GRTA 4UDPA 3KPFA 1S3BA 2WDQA 1BF3A 5CQFA 4Y4NA 4H2NA 2WETA 3QFBA 3AEEA 1GRFA 4DSHA 3AECA 4EQWA 3IWAA 3AE8A 4A79A 2WU5A 2XVJA 3GRSA 1DXLA 1AOGA 1N4UA 1EL9A 4RG4A 1EL8A 4UDRA 5EB5A 2V6OA 4YSXA 4A6NA 3IF9A 3QSEA 3AEBA 1BZLA 3AYIA 4C77A 5KOWA 2YR4A 5M0ZA 3EANA 4LA1A 2NVKX 3AE2A 1P2EA 4C3YA 4YWOA 3KU9A 1EL5A 2GQFA 4UDQA 4CNJA 2HQMA 1LV0A 3DGHA 3BHKA 1VG9A 1CBOA 3RP8A 5EOWA 1RYIA 2JKCA 2OALA 4IA5A 4EMJA 4NZHA 4Z26A 3AWIA 1VG0A 4B69A 1GREA 3UKPA 1F8WA 4APNA 3ICRA 4U8LA 4OPGA 3BNMA 3PO7A 4Z2UA 2BACA 2R4JA 2R4EA 2R0PA 3AYJA 4EQRA 3P4QA 3NH3X 4H2PA 1GTEA 1JNRA 3IC9A 2H89A 1ZK7A 5C2TA 1ZMDA 1XANA 2BC1A 2YVGA 4HB9A 2CFYA 2YLWA 1N1PA 4YTMA 5J7XA 4TLZA 3UKQA 1CL0A 3UOZA 5CKUA 3V3NA 2Q6UA 1K0IA 1MOKA 1K4QA 2F5ZA 4ICYA 4JY2A 5BUKA 4NEWA 1M6IA 2X8HA 1SEZA 2R46A 2C64A 2WU2A 3GDPA 4LU6A 2WOVA 5FS6A 4HA6A 4BURA 3AYLA 2B76A 3LB8A 2GF3A 2YLRA 3UP5A 3UTGA 1GSNA 2ZBWA 1XDIA 1ZKQA 4BK1A 5DBJA 5HXIA 3H8IA 3P9UA 3FPZA 1PJ7A 2GRTA 1JRXA 2EQ8A 2B7RA 1XHCA 2EQ6A 1GRGA 3NLCA 3AXBA 2ARDA 1V59A 1E7PA 2BS3A 4Z43A 4C74A 1Y56B 3HZLA 3SFDA 1EL7A 1MO9A 2CULA 1RP0A 2C75A 4I59A 1O94A 2VRLA 5JCKA 1BKWA 4B64A 1LVLA 4Y4MA 4GR1A 4A9WA 2XLSA 4NTDA 3I3LA 3URHA 2C66A 3UOYA 5KVIA 4AP3A 1FECA 3NTAA 2BC0A 3DK9A 3ISHA 2JK6A 1E39A 4BJZA 1QO8A 2VRMA 2WP6A 3ZYXA 1CC2A 2V3AA 2R45A 3UKFA 2GVCA 1W4XA 2GEWA 3ABVA 3R9UA 3NYFA 1PBBA 2BXRA 3GSIA 1L9CA 3ALLA 2VZ2A 5IQ4A 4XWRA 3NYCA 1QJDA 3ADAB 4TM4A 4GDEA 4ZCCA 1O95A 4H50A 4B66A 1GEUA 1D4CA 2GMJA 1OJCA 1QLBA 4LIIA 4GCMA 3Q6JA 3EPTA 1LQTA 3KVEA 3QSSA 3RP7A 1IUXA 3RNMA 2DKHA 3I6DA 2Y6QA 2YG5A 1ZOVA 1TDNA 3CPHG 3F8DA 1YQZA 5HYMA 3G5QA 4XXGA 3EAOA 4USQA 4A7AA 1DOCA 1FL2A 1K0LA 2QA2A 3UKAA 1CJCA 1PXBA 3FMWA 3RP6A 3UP4A 4NTCA 3C4NA 4CCQA 2XLTA 1VRQB 4USRA 2YM2A 2QA1A 2YLSA 2WS3A 4D04A 2ZZBA 3V3OA 1VDCA 1OJAA 3QVRA 1TRBA 2C76A 3REDA 3DJJA 4H2RA 4J33A 3BI2A 4NTEA 3GWFA 2XFQA 4OPIA 1CJ2A 1OJTA 2Z5YA 3LADA 3AE4A 4O5QA 3H4KA 3UTEA 3II4A 4U2TA 4H4SA 2B7SA 2XLUA 4OPDA 4X4JA 5BRTA 2YVFA 1CJ3A 1KSSA 2FJDA 1GRTA 1GV4A 2J3NA 2NPXA 4U8MA 2R9ZA 1KSUA 4H4WA 1LPFA 2O9ZA 1B37A 3AB1A 4TM1A 1K0JA 4K8DA 3QSMA 3K30A 3H8LA 1D5TA 1F8RA 3UKLA 5IQ1A 1KDGA 2BCGG 3NTDA 1FEBA 1PDHA 1XPQA 2VQ7A 3CGCA 2IIDA 1GRHA 4FX9A 5JCMA 3QVPA 2C3CA 3VRAA 2QAEA 5JCLA 3AD7B 3BI4A 1PS9A 4B1BA 1Y0PA 3KD9A 4IA6A 2R0CA 3UCLA 5EB4A 3ZDNA 2EQ7A 1PXCA 2VQBA 3GDNA 1OJ9A 4YSYA 2DKIA 4JDRA 3VQRA 3T37A 1L9DA 1PXAA 4J2WA 2GH5A 3DJGX 3CNJA 3NK2X 2XFOA 2RABA 1JRYA 3AEGA 3D1CA 1NHPA 2B9YA 3K7TA 3LJPA 3BI5A 4B67A 3DA1A 1ZMCA 2BXSA 1TYTA 1H84A 1DJQA 1M64A 4FK1C 4XWZA 5U1OA 2JB2A 3ATRA 3AE1A 3AE9A 4GF7A 3F8PA 4YKFA 4IVMB 3NK0X 2W0HA 1H7XA 2E1MA 5U25A 1PBCA 3CGBA 3AEFA 2FJAA 1IUWA 2WPEA 2JAEA 2C7GA 1TDKA 4C3XA 2WP5A 3LXDA 4H4UA 1L0VA 4RG3A 5IPYA 2YVJA 5BVAA 4Z24A 1CF3A 1B8SA 3QJ4A 1H83A 4M52A 3NIXA 1PN0A 2QCUA 3NNEA 4TM0A 4P9SA 1P2HA 5M10A 2C67A 1LQUA 2V5ZA 4TLXA 2PHHA 3OC4A 1ZP0A 2GAGB 3KA7A 5FMHA 1D4DA 2XLRA 2WQYA 4B68A 2BK3A 2XDOA 2BK4A 4EIQA 2VVLG 1N4VA 1PJ5A 4B65A 2OAMA 4FK1A 4EMIA 4IV9A 4OPCA 3SFEA 1H6VA 3VRDB 4PAAA 1CC4A 4AP1A 1GTHA 1B5QA 3Q9TA 3S5WA 4YTPA 3L1RA 3AD9B 2B9XA 4KX6A 3P1WA 3UOVA 1COYA 4MJWA 2YM1A 4EM4A 2BS2A 3DH9A 3DK4A 1Z6LA 4A5LA 3GYJA 4A65A 2YLTA 2YR5A 4ZN0A 4ECHA 4AOSA 1VQWA 2GV8A 4H4PA
chains in the Genus database with same CATH superfamily
4CRTA 2YR6A 1YKJA 2BCPA 1PDZA 3COXA 4Z25A 3FYYA 2OX4A 3K7QX 2V61A 3G5SA 1F3PA 1H7WA 3T0KA 2E5VA 2OA1A 3AE3A 1BGJA 1GNDA 4OPLA 2HNEA 4U8PA 3UGVA 3A7UA 2YWLA 4HCLA 1E1NA 1NHSA 1YQ3A 2BK5A 1JRZA 3GMCA 2YG7A 2YLXA 4Z2TA 3LZWA 4Y4LA 3P93A 2WESA 1GOSA 3FXGA 4CY8A 4DN1A 2PSNA 3UJFA 3TJ4A 3SBFA 3SZFA 2X8CA 3RGTA 4Z1YA 3ALMA 4M6UA 2CDUA 4IHCA 4J1OA 3BOXA 1GRBA 3SGLA 3AN1A 5FS7A 4YTNA 2JBVA 3CNDA 2WPCA 4J36A 3DMEA 3TWAA 3S47A 1ZDLA 2WDVA 1EC8A 2XVHA 2RGHA 2WP9A 4GYPA 2BA9A 2GL5A 1ZY8A 2H88A 3DK8A 1DOEA 4U8OA 2XFPA 3TW9A 2GR1A 4MGGA 5G5HB 2OFJA 3CN8A 1TDOA 3IK4A 4A99A 1WYGA 1Y56A 1N4WA 2W54A 1NAAA 2GB0A 3NHOX 4AT0A 5FS8A 2JB3A 2ZADA 4DHGA 2BYBA 4E8GA 1VQZA 5FJPA 3I6TA 3P3BA 1ELSA 3V4BA 3R10A 1DODA 2RGJA 4K2SA 1ZXIC 3GWDA 1EBHA 4F4RA 4H4VA 4G74A 1EBDA 2FBWA 4HNCA 4GDPA 2Y6RA 2R0GA 1CJ4A 2WDRA 2BABA 1IJHA 1N5XA 4YXDA 1MDRA 3I6EA 1GERA 1N63C 1FOHA 1NG3A 1CHUA 3A7RA 3NGCX 5KMQA 3VR8A 2QDDA 1ZX9A 4J31A 1EC7A 1FIQB 3GD4A 3IHMA 4II2A 3FVDA 3H8AA 4UDPA 1FFVC 4H2NA 3QFBA 4DSHA 4GIRA 1N4UA 1EL9A 3IJQA 4UDRA 3VCCA 4ENLA 2YR4A 4LA1A 3AE2A 1P2EA 4C3YA 4CNJA 1LV0A 3CB3A 5EOWA 3RP8A 3V3WA 2OPJA 1VG0A 3HYWA 4Z2UA 4KEMA 2BACA 3P4QA 3NH3X 4GYPC 2ZC8A 3U9IA 5J7XA 3R25A 3UOZA 2E5AA 3FJ4A 1MOKA 1M6IA 3GDPA 3TQPA 1VDVA 3UTGA 4BK1A 1ONEA 3FPZA 1PJ7A 1JRXA 2B7RA 2OLAA 3NLCA 1EL7A 2CULA 1O94A 2VRLA 5JCKA 4B64A 4ROPA 3DFHA 4A9WA 2XLSA 5KVIA 3ZYXA 3GSIA 3NYCA 4ZCCA 1OJCA 1SJCA 1BQGA 3RNMA 1ZOVA 1TDNA 1YQZA 5HYMA 4XXGA 4USQA 4A7AA 4H83A 1PXBA 3UP4A 3ENLA 4USRA 2YM2A 4D04A 3K1GA 1OJAA 4E5TA 2C76A 3OPSA 4NTEA 3GWFA 4ZOHB 3AE4A 4H4SA 1GV4A 2NPXA 4H4WA 2O9ZA 3AB1A 4K8DA 3QSMA 1D5TA 3UKLA 1KDGA 3NTDA 2IIDA 1GRHA 2C3CA 2QAEA 3BI4A 4B1BA 5EB4A 1T3QC 3GDNA 3T9PA 2HXTA 2DKIA 1KD0A 4H2HA 3DJGX 3AMZA 2AL2A 2RDXA 4GAPA 1ZMCA 1TYTA 4FK1C 4XWZA 2CHRA 1JRPA 3ZLGA 3ATRA 1JROA 2WP5A 3UCCA 5IPYA 5BVAA 3QJ4A 3NIXA 2PP1A 4NNJA 2QCUA 4TM0A 1ECQA 2POZA 5FMHA 1R0MA 3SYIA 2BK3A 2XDOA 1N4VA 3NRZB 2OAMA 3S5WA 3Q9TA 4YTPA 5BOEA 3P1WA 1X2GA 3CAWA 2BS2A 3GYJA 4IP4A 2YLTA 4AOSA 3N4FA 4O5UA 3WE0A 5BOFA 2XYOA 2RGOA 1FCDA 3B6DA 1JOAA 3LZXA 4CCRA 3STPA 4GMEA 3CK5A 1GXFA 3R11A 3DG3A 4U8IA 1MXTA 3VR9A 3CIRA 1KN0A 1Q9IA 1F8SA 4BJYA 4DWDA 2Z5XA 1WUFA 1DJNA 2FJEA 3ATQA 1L9EA 4I58A 3IJIA 1YY5A 4AOXA 1PBDA 3UCDA 3ICSA 2JB1A 5EU9A 3CT2A 2XH7A 2XFUA 2YG4A 1FEAA 3C96A 3DGZA 4K22A 3V76A 1NENA 2PYXA 3NFUA 1CC6A 2OQYA 4K7ZA 1JCTA 5J04A 3T14A 1PHHA 3LOVA 4H4ZA 1TYPA 2MUCA 1DNCA 2C70A 3NN0X 1S3EA 4H4RA 3QFAA 2DW6A 1O5WA 3NO1A 1F9CA 1IUSA 4G8TA 4OVIA 3T6CA 1BWCA 2C72A 4ADWA 2X50A 1PJ6A 1NG4A 4FDCB 4PABA 2GR3A 3L5OA 4EQSA 3BHFA 1HYUA 5HY5A 1SJBA 3GD3A 2UZZA 2AR8A 4G9KA 4ZCDA 1GETA 2ZZCA 3JZUA 3P4SA 1GRAA 2P0IA 4RSLA 2QGYA 2APGA 1Q1WA 4B63A 4J56A 4DNAA 2QJJA 3AE7A 1GESA 1EBGA 1TDFA 3CGDA 3HYXA 4UP3A 4DYEA 4HCHA 2E4GA 2WEUA 3ALJA 4J34A 5J60A 2A87A 4KPRA 1IUTA 1S2QA 3UJ2A 5L46A 4IT1A 3DDMA 3CPIG 3CPJG 3GYIA 3SXIA 5KWFA 2XVFA 2I5QA 3B3RA 4H4XA 1S7MA 1P43A 2W3RA 1IUVA 4EM3A 3M0OA 3MY9A 5KRQA 2Q7VA 2PODA 4H4QA 2VOUA 3BSMA 4IZGA 5KXJA 3PS9A 2A8XA 3QPEA 2ZZ0A 5HHFA 3OZ2A 3FV9A 2OKTA 4JN9A 1JU2A 2Q0LA 4BV6A 1P48A 4DGKA 1KF6A 4IL2A 2OO6A 3KPFA 2WETA 3MKCA 1GRFA 3RITA 3TJIA 4RG4A 5EB5A 3IF9A 1BZLA 3AYIA 5M0ZA 1E9IA 4GGBA 4UDQA 3KU9A 1EL5A 3ZLFA 1VG9A 1CBOA 3EEZA 4HCDA 3H70A 4NZHA 2XGZA 3AWIA 4B69A 1GREA 3UKPA 1EC9A 1F8WA 3ICRA 5FJUA 3CXBA 3NVVB 2R0PA 4TVYA 1OEPA 2W3SA 2FYMA 2YVGA 2BC1A 2YLWA 1CL0A 2AL1A 3HW2A 3SN4A 3JVAA 4ICYA 1K4QA 1SEZA 2WU2A 2PTWA 5FS6A 4LU6A 4HPNA 3R1ZA 4Z17A 2GF3A 2YLRA 3UP5A 5DBJA 1SB3B 3P9UA 3Q45A 1SJAA 2PTYA 2ARDA 2BS3A 4Z43A 3P0WA 4C74A 3UXLA 3NXLA 4I59A 3KPKA 1BKWA 4FI4A 3URHA 3UOYA 1E39A 2O56A 2WP6A 1CC2A 3H12A 2GEWA 3NVZB 1L9CA 3ALLA 5IQ4A 4XWRA 4H1ZA 2QVHA 4B66A 1GEUA 1QLBA 1LQTA 1PDYA 2OZ8A 3I6DA 1N60C 4DXKA 3D47A 4MMWA 1K0LA 1CJCA 2P3ZA 4NTCA 4CCQA 3OW1A 3SR6B 3SQSA 2ZZBA 1VDCA 3QVRA 3NVWB 1TRBA 4J33A 3BI2A 2XFQA 1CJ2A 2Z5YA 3II4A 4OPDA 5BRTA 2YVFA 2QJNA 3VCNA 4U8MA 4E6MA 5ENLA 1KSUA 4X2PA 4TM1A 3TCSA 2HZGA 4II3A 1NU5A 3CGCA 3VRAA 4FX9A 5JCMA 1PS9A 2C4CA 1Y0PA 3RRAA 1PXCA 2VQBA 1OJ9A 4FP1A 4JDRA 2QJMA 3T37A 1PXAA 1IYXA 4TVWA 4GISA 2XFOA 1JRYA 3T8QA 3LJPA 3BI5A 1H84A 1DJQA 5U1OA 2JB2A 3F8PA 4YKFA 3NK0X 5U25A 3CGBA 2C7GA 4C3XA 2YVJA 3NNEA 4P9SA 1P2HA 2C67A 3V5CA 4TLXA 4DX3A 4G7FA 3OC4A 1ZP0A 3KA7A 2XLRA 4B65A 3T2ZA 4FK1A 4EMIA 4IV9A 4OPCA 1H6VA 2P88A 4KWSA 4AP1A 1R6WA 1GTHA 3GD6A 1B5QA 4JHMA 2B9XA 1COYA 2YM1A 3DH9A 3JW7A 4A65A 4ZN0A 1TE6A 4YTMA 3PVCA 4H4PA 2C3DA 3AEAA 4X9NA 4DSGA 4YKGA 4ZA0A 5JCIA 3DG7A 3UJEA 4M0XA 3SN0A 2V3BA 1BKHA 3UKKA 3QN3A 4K2XA 4BK2A 2FKPA 1ELIA 2TPRA 3CYJA 1X2HA 3EUB3 2FJBA 2GR2A 5U63A 1MDLA 3AE6A 3AD8B 3VFCA 2X3NA 3IHGA 3ETRB 4TM3A 3NZGA 3SM8A 3DGBA 3K7MX 4A6NB 1E1LA 3NYEA 4OPUA 3TOYA 4JY3A 4CBQA 5ER0A 4U2LA 3DEQA 1JDFA 2X8GA 3GRTA 4IVOB 4YSHA 3VDGA 3O0HA 3ES7A 3RHAA 1LJ1A 3NN6X 4HYRA 1MRAA 4D03A 1N61C 1FO4A 4JNAA 2CVJA 3FIMB 1IUUA 2WBAA 1GALA 3CNPA 4YT0A 3SJNA 1B4VA 2YQUA 5LV9A 1NHRA 2OZTA 5FS9A 3MUCA 2IVDA 1D7LA 1F6MA 2GDQA 3FG2P 3PK7A 4JQ9A 3M12A 3SY4A 5GSNA 2GGIA 1BGNA 3B9JB 2EQ9A 2YLZA 2WHDA 1ONFA 4NWZA 4A6GA 2WPFA 3UJSA 1REOA 1NHQA 3AEDA 3PFRA 4U8KA 4J3ZA 2PPGA 1ZOYA 4REKA 3QTPA 1WUEA 2GSHA 3AM9A 1X31B 1NPXA 2P8BA 3C4AA 4E0VA 3T2YA 3S61A 4U2SA 3SSZA 4EMWA 4A3RA 2XFNA 1FHVA 4ZCWA 5FJOA 3V5FA 3CTYA 4C5OA 3SN1A 4H7UA 5C3JA 3AE5A 2AAQA 1E1KA 1Q1RA 5KMSA 1PBEA 1FFUC 1PBFA 2AKMA 3UKHA 5JCNA 4GRTA 1N62C 2AL2B 2WDQA 1BF3A 5CQFA 4Y4NA 3SZWA 3AEEA 4E4FA 3IWAA 4EQWA 3AE8A 4A79A 2WU5A 1DXLA 3TWBA 5KNLA 2V6OA 3QSEA 5KOWA 4YWOA 2GQFA 5KMRA 1RYIA 2JKCA 4EMJA 4Z26A 4APNA 4U8LA 1DTNA 4OPGA 3BNMA 5JRBA 3DERA 3OZYA 3OZMA 3IC9A 5C2TA 1ZMDA 2CFYA 2PP0A 5CKUA 3V3NA 2Q6UA 2XH2A 1K0IA 4NEWA 2R46A 2C64A 2WOVA 4BURA 3AYLA 2B76A 3DFYA 1XDIA 1ZKQA 3ZVHB 3FCPA 4K1WA 2GRTA 2EQ8A 1XHCA 2EQ6A 3AXBA 1Y56B 3HZLA 2PCEA 2C75A 3RO6A 2C66A 3NTAA 3DK9A 3ISHA 4BJZA 2VRMA 3NVYB 2R45A 2XH4A 1W4XA 3ABVA 3NYFA 1PBBA 2BXRA 3ADAB 4H50A 1D4CA 4LIIA 3RP7A 2DKHA 2YG5A 3SX6A 1JPMA 1L8PA 1W6TA 3EAOA 3UKAA 2PS2A 3FMWA 2AKZA 2XLTA 1VRQB 3ZLHA 3TTEA 2QA1A 2WS3A 3MZNA 3R07C 3A7AA 3T31A 3REDA 4H2RA 2PGEA 1OJTA 3LADA 4O5QA 4U2TA 1KSSA 2FJDA 4A35A 2R9ZA 3GYXA 1LPFA 3QLDA 3U4FA 1K0JA 2GGJA 2BCGG 1FEBA 1PDHA 2VQ7A 3QVPA 3AD7B 2NQLA 3KD9A 2R0CA 4G6HA 3ZDNA 2EQ7A 3QKEA 2PTZA 2GH5A 3CNJA 3NK2X 3D1CA 3DESA 3K7TA 1XPYA 3AE1A 4GF7A 2OQHA 4IVMB 2HXUA 2E1MA 1PBCA 2FJAA 1IUWA 2WPEA 1TDKA 4H4UA 1L0VA 3KUMA 4Z24A 1STZA 1CF3A 3T2KA 5FJTA 1LQUA 2GAGB 1D4DA 4B68A 4MKSA 1FHUA 2BK4A 1PJ5A 3CMMA 2E3TA 3VRDB 3SFEA 3AD9B 4KX6A 1TKKA 3D46A 1Z6LA 4A5LA 4IP5A 4ECHA 1VQWA 2GV8A 2C73A 1LTXR 4H4TA 4H4YA 2YG6A 2A89A 4X9MA 1NELA 4GUVA 2BS4A 4Z44A 1E6EA 3F8RA 5KVHA 3RR1A 1GPEA 4U8NA 3CGEA 3THUA 2OZ3A 3VA8A 2PTXA 2YAUA 3NKSA 2OLNA 3ITJA 3BJSA 2ACZA 5KOXA 1GT8A 3P4RA 4EQXA 1H86A 1NEKA 1H82A 3KLJA 3EF6A 3DJDA 4AT2A 2MNRA 1JEHA 4OPTA 4U8JA 3B97A 3FBSA 2WOIA 2I0ZA 3NK1X 3ICTA 2PGWA 2YG3A 2WOWA 4JNQA 4NEVA 5FJRA 2GR0A 2VVLA 4H2QA 4K5RA 3DIPA 4K5SA 3BNUA 1D4EA 1OJDA 2Q0KA 2GMHA 1KNPA 3KKJA 4CY6A 3UTHA 4N9XA 4G6GA 2IVEA 1UKVG 4GFIA 2VVMA 3EKGA 3M13A 1E1MA 3MWCA 4E4UA 3R0UA 4OCGA 4EIPA 3CNSA 3MQTA 2OG9A 3N4EA 5TR3A 2GAHB 2P8CA 3UOXA 2BRAA 1H2IA 3SQPA 3P4PA 3RCYA 4WCTA 2GQWA 3UTFA 4BK3A 1TDEA 5BULA 5EBKA 2PP3A 2X99A 3CNTA 3G5RA 3VRBA 3E1TA 1NDAA 3L8KA 1H81A 3PWIA 4GAVA 2TMDA 2XLPA 2XVEA 1KFYA 4CNKA 2XSXA 2OLOA 7ENLA 1XS2A 3DJEA 3NRNA 4Z2RA 3GMBA 2XCGA 4WX1A 1RSGA 4J57A 1D7YA 3NT6A 1JNZA 3D8XA 2ONEA 2XVIA 5GRTA 2B9WA 1MNSA 4HNLA 1YQ4A 3SZCA 2V60A 4YSZA 1DOBA 2C65A 3GO2A 1S2YA 3JSKA 3NG7X 1RM6B 2AQJA 3VC5A 1KNRA 4JN7A 4HN8A 3T4WA 1S3BA 2GGEA 2PU1A 3OP2A 3AECA 2XVJA 3GRSA 1AOGA 4JN8A 3HPFA 1EL8A 5KMPA 4YSXA 4A6NA 3AEBA 2XH0A 4C77A 3EANA 2NVKX 2HQMA 3DGHA 3UXKA 3BHKA 3NS1B 2OALA 4IA5A 3CXOA 4K8GA 3PO7A 2R4JA 2R4EA 3AYJA 4EQRA 4H2PA 1GTEA 1JNRA 2H89A 4KPLA 1ZK7A 1TZZA 4HB9A 1XANA 1N1PA 4TLZA 3UKQA 4JY2A 2F5ZA 1N5WC 5BUKA 2X8HA 3I4KA 4HA6A 3LB8A 1GSNA 4IL0A 2ZBWA 5HXIA 3H8IA 3Q4DA 3ZVIA 2W55A 3VC6A 1GRGA 1YEYA 1V59A 1E7PA 3N6HA 1KCZA 3SFDA 3S5SA 1MO9A 1RP0A 3UJRA 1LVLA 4Y4MA 4GR1A 4EWJA 4NTDA 3I3LA 4AP3A 1FECA 2BC0A 2JK6A 1QO8A 1KKRA 3R0KA 2V3AA 3UKFA 2GVCA 3R9UA 2VZ2A 3D9XA 1QJDA 4TM4A 4GDEA 1O95A 3MSYA 3PG6A 2GMJA 2QDEA 4GCMA 3Q6JA 3EPTA 3KVEA 3QSSA 1IUXA 2Y6QA 1RVKA 3HRDC 3CPHG 3F8DA 3G5QA 1DOCA 1FL2A 2QA2A 2QQ6A 3RP6A 3C4NA 2YLSA 3OTRA 1KKOA 3V3OA 2PMQA 2PA6A 2PU0A 3DJJA 1V97A 4OPIA 3GY1A 2OVLA 3H4KA 3UTEA 2DW7A 2B7SA 2XLUA 4X4JA 1CJ3A 1GRTA 2J3NA 1B37A 3H7VA 3K30A 5IDZA 3H8LA 1F8RA 5IQ1A 3N6JA 3IJLA 1XPQA 5JCLA 2BRYA 4GGHA 1JPDX 4IA6A 3UCLA 4YSYA 3VQRA 3HYVA 1L9DA 4J2WA 3GC2A 1SJDA 2RABA 3AEGA 1NHPA 2B9YA 4B67A 3DA1A 3ZVHA 2BXSA 4H19A 1M64A 3ES8A 3AE9A 2W0HA 1H7XA 3AEFA 2GGHA 2JAEA 3LXDA 4RG3A 6ENLA 1B8SA 1H83A 4M52A 1PN0A 5M10A 4YWSA 3SZ0A 2V5ZA 2PHHA 2WQYA 4KT2A 4EIQA 2VVLG 3DG6A 4PAAA 1CC4A 3L1RA 2GGGA 3UOVA 4MJWA 1MUCA 4EM4A 3DK4A 5G5GB 2YR5A 3PWGA 4G73A
chains in the Genus database with same CATH topology
4O5UA 2C3DA 3AEAA 4X9NA 4DSGA 3WE0A 4YKGA 4CRTA 2XYOA 2C73A 1LTXR 5JCIA 4H4TA 4H4YA 1FCDA 2RGOA 2YG6A 2YR6A 3B6DA 1JOAA 1YKJA 3LZXA 2BCPA 2A89A 4X9MA 4CCRA 4GUVA 2V3BA 3COXA 3UKKA 4Z25A 2BS4A 4Z44A 1E6EA 3F8RA 5KVHA 1GXFA 4K2XA 4BK2A 4U8IA 1MXTA 1ELIA 3VR9A 1GPEA 4U8NA 3CGEA 3K7QX 3CIRA 2TPRA 2FJBA 1KN0A 2V61A 1F3PA 3G5SA 1Q9IA 1F8SA 2GR2A 1H7WA 5U63A 4BJYA 3T0KA 2E5VA 2Z5XA 3AE6A 3AD8B 2OA1A 1DJNA 2FJEA 2X3NA 3IHGA 3AE3A 2YAUA 1BGJA 1GNDA 1L9EA 3ATQA 3NKSA 4OPLA 4TM3A 3SM8A 2OLNA 3ITJA 4U8PA 4I58A 2YWLA 2ACZA 3K7MX 1E1NA 4A6NB 1NHSA 1YY5A 1E1LA 1YQ3A 1PBDA 2BK5A 1GT8A 3NYEA 4OPUA 4AOXA 5KOXA 1JRZA 3P4RA 3GMCA 4JY3A 4EQXA 1H86A 2YG7A 2YLXA 3LZWA 4Y4LA 4CBQA 4Z2TA 5ER0A 2WESA 3ICSA 4U2LA 1GOSA 1NEKA 2JB1A 1H82A 3KLJA 3EF6A 3DJDA 4CY8A 2X8GA 3GRTA 4IVOB 4AT2A 4YSHA 1JEHA 2XFUA 4OPTA 2YG4A 4U8JA 3FBSA 1FEAA 2WOIA 3DGZA 2I0ZA 3C96A 2X8CA 4K22A 3NK1X 3ICTA 1NENA 2PYXA 3O0HA 1CC6A 3ALMA 3V76A 2CDUA 2YG3A 2WOWA 3RHAA 1LJ1A 4JNQA 4K7ZA 4NEVA 3NN6X 2GR0A 2VVLA 4H2QA 4K5RA 4D03A 3T14A 1PHHA 3LOVA 1GRBA 3SGLA 4H4ZA 4JNAA 5FS7A 2CVJA 4YTNA 3FIMB 4K5SA 1TYPA 3BNUA 1D4EA 1OJDA 2JBVA 2GMHA 2Q0KA 3CNDA 1DNCA 2WPCA 1IUUA 4J36A 3DMEA 2WBAA 1GALA 3CNPA 2C70A 3NN0X 4YT0A 1KNPA 3KKJA 4CY6A 1S3EA 1ZDLA 3UTHA 2WDVA 1B4VA 2YQUA 4N9XA 2XVHA 2RGHA 5LV9A 4G6GA 4H4RA 2WP9A 3QFAA 1NHRA 1O5WA 2BA9A 5FS9A 2IVEA 1ZY8A 2H88A 1UKVG 2IVDA 1D7LA 1F6MA 3DK8A 1IUSA 1DOEA 4U8OA 2XFPA 2VVMA 3FG2P 3M13A 4OVIA 1E1MA 2GR1A 4JQ9A 3M12A 1BWCA 2C72A 3SY4A 4ADWA 2X50A 1PJ6A 1NG4A 4FDCB 5GSNA 1BGNA 3CN8A 4PABA 4OCGA 4EIPA 3CNSA 2GR3A 1TDOA 4A99A 3L5OA 2EQ9A 4EQSA 2YLZA 5TR3A 2WHDA 3BHFA 1HYUA 5HY5A 2GAHB 3GD3A 2UZZA 3UOXA 2AR8A 2BRAA 1Y56A 1ONFA 1H2IA 3SQPA 4NWZA 4G9KA 4ZCDA 2WPFA 1N4WA 1GETA 3P4PA 2ZZCA 3P4SA 1GRAA 1NAAA 4WCTA 2GQWA 4RSLA 1REOA 2APGA 2GB0A 1Q1WA 3UTFA 4B63A 1NHQA 4BK3A 1TDEA 3AEDA 3NHOX 4AT0A 5FS8A 4J56A 4DNAA 2JB3A 4U8KA 5BULA 1ZOYA 2BYBA 4REKA 5EBKA 2X99A 3AE7A 3CNTA 1GESA 3G5RA 3VRBA 3E1TA 1DODA 1NDAA 3L8KA 1H81A 1TDFA 1X31B 1NPXA 2RGJA 3C4AA 4E0VA 3GWDA 4GAVA 3CGDA 2TMDA 2XLPA 3HYXA 4UP3A 3T2YA 2XVEA 3S61A 1KFYA 4U2SA 2E4GA 4H4VA 4CNKA 2OLOA 2WEUA 3DJEA 4G74A 3ALJA 3NRNA 4J34A 4Z2RA 4EMWA 2A87A 5J60A 4KPRA 1IUTA 3GMBA 2XCGA 1EBDA 1S2QA 2FBWA 4WX1A 2XFNA 5L46A 1RSGA 4J57A 1D7YA 4GDPA 3CPIG 3CPJG 3GYIA 2Y6RA 3NT6A 3SXIA 2R0GA 5KWFA 1JNZA 2XVFA 1CJ4A 3D8XA 2WDRA 2BABA 1IJHA 3B3RA 3CTYA 4C5OA 4H4XA 2XVIA 1S7MA 4YXDA 5GRTA 4H7UA 1IUVA 5C3JA 1GERA 4EM3A 2B9WA 3M0OA 3AE5A 1FOHA 1YQ4A 1NG3A 1CHUA 2Q7VA 3SZCA 3NGCX 5KRQA 2AAQA 4H4QA 1E1KA 2VOUA 2V60A 5KMQA 3PS9A 4YSZA 2A8XA 1DOBA 3VR8A 5KXJA 1ZX9A 1Q1RA 2ZZ0A 1S2YA 2C65A 3OZ2A 1PBEA 4J31A 5HHFA 5KMSA 3JSKA 1PBFA 3NG7X 3GD4A 3IHMA 4II2A 2AQJA 3PVCA 4JN9A 3UKHA 1JU2A 1KNRA 2Q0LA 4BV6A 4DGKA 5JCNA 1KF6A 4GRTA 4UDPA 3KPFA 1S3BA 2WDQA 1BF3A 5CQFA 4Y4NA 4H2NA 2WETA 3SZWA 3QFBA 3AEEA 1GRFA 4DSHA 3AECA 4EQWA 3IWAA 3AE8A 4A79A 2WU5A 2XVJA 3GRSA 1DXLA 1AOGA 1N4UA 1EL9A 4RG4A 1EL8A 4UDRA 5KNLA 5KMPA 5EB5A 2V6OA 4YSXA 4A6NA 3IF9A 3QSEA 3AEBA 1BZLA 3AYIA 4C77A 5KOWA 2YR4A 5M0ZA 3EANA 4LA1A 2NVKX 3AE2A 1P2EA 4C3YA 4YWOA 3KU9A 1EL5A 2GQFA 4UDQA 4CNJA 2HQMA 1LV0A 3DGHA 5KMRA 3BHKA 1VG9A 1CBOA 3RP8A 5EOWA 1RYIA 2JKCA 2OALA 4IA5A 4EMJA 4NZHA 4Z26A 3AWIA 1VG0A 4B69A 1GREA 3UKPA 1F8WA 4APNA 3ICRA 4U8LA 4OPGA 3BNMA 3PO7A 5JRBA 3HYWA 4Z2UA 2BACA 2R4JA 2R4EA 2R0PA 3AYJA 4EQRA 3P4QA 3NH3X 4H2PA 1GTEA 1JNRA 3IC9A 2H89A 1ZK7A 5C2TA 1ZMDA 1XANA 2BC1A 2YVGA 4HB9A 2CFYA 2YLWA 1N1PA 4YTMA 5J7XA 4TLZA 3UKQA 1CL0A 3UOZA 5CKUA 3V3NA 2Q6UA 1K0IA 1MOKA 1K4QA 2F5ZA 4ICYA 4JY2A 5BUKA 4NEWA 1M6IA 2X8HA 1SEZA 2R46A 2C64A 2WU2A 3GDPA 4LU6A 2WOVA 5FS6A 4HA6A 4BURA 3AYLA 2B76A 3LB8A 2GF3A 2YLRA 3UP5A 3UTGA 1GSNA 2ZBWA 1XDIA 1ZKQA 4BK1A 5DBJA 5HXIA 3H8IA 3P9UA 3FPZA 1PJ7A 2GRTA 1JRXA 2EQ8A 2B7RA 1XHCA 2EQ6A 1GRGA 3NLCA 3AXBA 2ARDA 1V59A 1E7PA 2BS3A 4Z43A 4C74A 1Y56B 3HZLA 3SFDA 1EL7A 1MO9A 2CULA 1RP0A 2C75A 4I59A 1O94A 2VRLA 5JCKA 1BKWA 3KPKA 4B64A 1LVLA 4Y4MA 4GR1A 4A9WA 2XLSA 4NTDA 3I3LA 3URHA 2C66A 3UOYA 5KVIA 4AP3A 1FECA 3NTAA 2BC0A 3DK9A 3ISHA 2JK6A 1E39A 4BJZA 1QO8A 2VRMA 2WP6A 3ZYXA 1CC2A 2V3AA 2R45A 3UKFA 2GVCA 1W4XA 2GEWA 3ABVA 3R9UA 3NYFA 1PBBA 2BXRA 3GSIA 1L9CA 3ALLA 2VZ2A 5IQ4A 4XWRA 3D9XA 3NYCA 1QJDA 3ADAB 4TM4A 4GDEA 4ZCCA 1O95A 4H50A 3PG6A 4B66A 1GEUA 1D4CA 2GMJA 1OJCA 1QLBA 4LIIA 4GCMA 3Q6JA 3EPTA 1LQTA 3KVEA 3QSSA 3RP7A 1IUXA 3RNMA 2DKHA 3I6DA 2Y6QA 2YG5A 3SX6A 1ZOVA 1TDNA 3CPHG 3F8DA 1YQZA 5HYMA 3G5QA 4XXGA 3EAOA 4USQA 4A7AA 1DOCA 1FL2A 1K0LA 2QA2A 3UKAA 1CJCA 1PXBA 3FMWA 3RP6A 3UP4A 4NTCA 3C4NA 4CCQA 2XLTA 1VRQB 4USRA 2YM2A 2QA1A 2YLSA 2WS3A 4D04A 2ZZBA 3V3OA 1VDCA 1OJAA 3T31A 3QVRA 1TRBA 2C76A 3REDA 3DJJA 4H2RA 4J33A 3BI2A 4NTEA 3GWFA 2XFQA 4OPIA 1CJ2A 1OJTA 2Z5YA 3LADA 3AE4A 4O5QA 3H4KA 3UTEA 3II4A 4U2TA 4H4SA 2B7SA 2XLUA 4OPDA 4X4JA 5BRTA 2YVFA 1CJ3A 1KSSA 2FJDA 1GRTA 1GV4A 2J3NA 2NPXA 4U8MA 2R9ZA 1KSUA 4H4WA 1LPFA 2O9ZA 1B37A 3AB1A 3GYXA 4TM1A 1K0JA 4K8DA 3QSMA 3K30A 3H8LA 1D5TA 1F8RA 3UKLA 5IQ1A 1KDGA 2BCGG 4II3A 3NTDA 1FEBA 1PDHA 1XPQA 2VQ7A 3CGCA 2IIDA 1GRHA 4FX9A 5JCMA 3QVPA 2C3CA 3VRAA 2QAEA 5JCLA 3AD7B 3BI4A 2BRYA 1PS9A 4B1BA 2C4CA 1Y0PA 3KD9A 4IA6A 2R0CA 3UCLA 4G6HA 5EB4A 3ZDNA 2EQ7A 1PXCA 2VQBA 3GDNA 1OJ9A 4YSYA 2DKIA 4JDRA 3VQRA 3HYVA 3T37A 1L9DA 1PXAA 4J2WA 2GH5A 3DJGX 3CNJA 3NK2X 2XFOA 2RABA 1JRYA 3AEGA 3D1CA 1NHPA 2B9YA 3K7TA 3LJPA 3BI5A 4G73A 4GAPA 4B67A 3DA1A 1ZMCA 2BXSA 1TYTA 1H84A 1DJQA 1M64A 4FK1C 4XWZA 5U1OA 2JB2A 3ATRA 3AE1A 3AE9A 4GF7A 3F8PA 4YKFA 4IVMB 3NK0X 2W0HA 1H7XA 2E1MA 5U25A 1PBCA 3CGBA 3AEFA 2FJAA 1IUWA 2WPEA 2JAEA 2C7GA 1TDKA 4C3XA 2WP5A 3LXDA 4H4UA 1L0VA 4RG3A 5IPYA 2YVJA 5BVAA 4Z24A 1CF3A 3T2KA 1B8SA 3QJ4A 1H83A 4M52A 3NIXA 4NNJA 1PN0A 2QCUA 3NNEA 4TM0A 4P9SA 1P2HA 5M10A 2C67A 3SZ0A 1LQUA 2V5ZA 4TLXA 2PHHA 3OC4A 1ZP0A 2GAGB 3KA7A 5FMHA 1D4DA 2XLRA 2WQYA 3SYIA 4B68A 2BK3A 2XDOA 2BK4A 4EIQA 2VVLG 1N4VA 1PJ5A 4B65A 3T2ZA 3CMMA 2OAMA 4FK1A 4EMIA 3SZFA 4IV9A 4OPCA 3SFEA 1H6VA 3VRDB 4PAAA 1CC4A 4AP1A 1GTHA 1B5QA 3Q9TA 3S5WA 4YTPA 3L1RA 3AD9B 2B9XA 4KX6A 3P1WA 3UOVA 1COYA 4MJWA 2YM1A 4EM4A 2BS2A 3DH9A 3DK4A 1Z6LA 4A5LA 3GYJA 4A65A 2YLTA 2YR5A 4ZN0A 4ECHA 4AOSA 1VQWA 2GV8A 4H4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O5U A;  2C3D A;  3AEA A;  4X9N A;  4DSG A;  3WE0 A;  4YKG A;  4CRT A;  2XYO A;  2C73 A;  1LTX R;  5JCI A;  4H4T A;  4H4Y A;  1FCD A;  2RGO A;  2YG6 A;  2YR6 A;  3B6D A;  1JOA A;  1YKJ A;  3LZX A;  2BCP A;  2A89 A;  4X9M A;  4CCR A;  4GUV A;  2V3B A;  3COX A;  3UKK A;  4Z25 A;  2BS4 A;  4Z44 A;  1E6E A;  3F8R A;  5KVH A;  1GXF A;  4K2X A;  4BK2 A;  4U8I A;  1MXT A;  1ELI A;  3VR9 A;  1GPE A;  4U8N A;  3CGE A;  3K7Q X;  3CIR A;  2TPR A;  2FJB A;  2V61 A;  3G5S A;  1F3P A;  1Q9I A;  1F8S A;  2GR2 A;  1H7W A;  5U63 A;  4BJY A;  2E5V A;  2Z5X A;  3AE6 A;  3AD8 B;  2OA1 A;  1DJN A;  2FJE A;  2X3N A;  3IHG A;  3AE3 A;  2YAU A;  1BGJ A;  1GND A;  1L9E A;  3ATQ A;  3NKS A;  4OPL A;  4TM3 A;  3SM8 A;  2OLN A;  3ITJ A;  4U8P A;  4I58 A;  2YWL A;  2ACZ A;  3K7M X;  1E1N A;  4A6N B;  1NHS A;  1YY5 A;  1E1L A;  1YQ3 A;  1PBD A;  2BK5 A;  1GT8 A;  3NYE A;  4OPU A;  4AOX A;  5KOX A;  1JRZ A;  3P4R A;  3GMC A;  4JY3 A;  4EQX A;  1H86 A;  2YG7 A;  2YLX A;  3LZW A;  4Y4L A;  4CBQ A;  4Z2T A;  5ER0 A;  2WES A;  3ICS A;  4U2L A;  1GOS A;  1NEK A;  2JB1 A;  1H82 A;  3KLJ A;  3EF6 A;  3DJD A;  4CY8 A;  2X8G A;  3GRT A;  4IVO B;  4AT2 A;  4YSH A;  1JEH A;  2XFU A;  4OPT A;  2YG4 A;  4U8J A;  3FBS A;  1FEA A;  2WOI A;  3DGZ A;  2I0Z A;  3C96 A;  2X8C A;  4K22 A;  3NK1 X;  3ICT A;  1NEN A;  2PYX A;  3O0H A;  1CC6 A;  3ALM A;  3V76 A;  2CDU A;  2YG3 A;  2WOW A;  3RHA A;  1LJ1 A;  4JNQ A;  4K7Z A;  4NEV A;  3NN6 X;  2GR0 A;  2VVL A;  4H2Q A;  4K5R A;  4D03 A;  1PHH A;  3LOV A;  1GRB A;  3SGL A;  4H4Z A;  4JNA A;  5FS7 A;  2CVJ A;  4YTN A;  3FIM B;  4K5S A;  1TYP A;  3BNU A;  1D4E A;  1OJD A;  2JBV A;  2GMH A;  2Q0K A;  3CND A;  1DNC A;  2WPC A;  1IUU A;  4J36 A;  3DME A;  2WBA A;  1GAL A;  3CNP A;  2C70 A;  3NN0 X;  4YT0 A;  1KNP A;  3KKJ A;  4CY6 A;  1S3E A;  1ZDL A;  3UTH A;  2WDV A;  1B4V A;  2YQU A;  4N9X A;  2XVH A;  2RGH A;  5LV9 A;  4H4R A;  2WP9 A;  3QFA A;  1NHR A;  1O5W A;  2BA9 A;  5FS9 A;  2IVE A;  1ZY8 A;  2H88 A;  1UKV G;  2IVD A;  1D7L A;  1F6M A;  3DK8 A;  1IUS A;  1DOE A;  4U8O A;  2XFP A;  2VVM A;  3FG2 P;  3M13 A;  4OVI A;  1E1M A;  2GR1 A;  4JQ9 A;  3M12 A;  1BWC A;  2C72 A;  4ADW A;  2X50 A;  1PJ6 A;  1NG4 A;  4FDC B;  5GSN A;  1BGN A;  3CN8 A;  4PAB A;  4OCG A;  4EIP A;  3CNS A;  2GR3 A;  1TDO A;  4A99 A;  2EQ9 A;  4EQS A;  2YLZ A;  5TR3 A;  2WHD A;  3BHF A;  1HYU A;  5HY5 A;  2GAH B;  3GD3 A;  2UZZ A;  3UOX A;  2AR8 A;  1Y56 A;  1ONF A;  3SQP A;  4ZCD A;  2WPF A;  1N4W A;  1GET A;  3P4P A;  2ZZC A;  3P4S A;  1GRA A;  1NAA A;  4WCT A;  2GQW A;  4RSL A;  1REO A;  2APG A;  2GB0 A;  1Q1W A;  3UTF A;  4B63 A;  1NHQ A;  4BK3 A;  1TDE A;  3AED A;  3NHO X;  4AT0 A;  5FS8 A;  4J56 A;  4DNA A;  2JB3 A;  4U8K A;  5BUL A;  1ZOY A;  2BYB A;  4REK A;  5EBK A;  2X99 A;  3AE7 A;  3CNT A;  1GES A;  3G5R A;  3VRB A;  3E1T A;  1DOD A;  1NDA A;  3L8K A;  1H81 A;  1TDF A;  1X31 B;  1NPX A;  2RGJ A;  3C4A A;  4E0V A;  3GWD A;  3CGD A;  2TMD A;  2XLP A;  4UP3 A;  2XVE A;  3S61 A;  1KFY A;  4U2S A;  2E4G A;  4H4V A;  4CNK A;  2OLO A;  2WEU A;  3DJE A;  3ALJ A;  3NRN A;  4J34 A;  4Z2R A;  4EMW A;  2A87 A;  5J60 A;  4KPR A;  1IUT A;  3GMB A;  2XCG A;  1EBD A;  1S2Q A;  2FBW A;  4WX1 A;  2XFN A;  5L46 A;  1RSG A;  4J57 A;  1D7Y A;  4GDP A;  3CPI G;  3CPJ G;  3GYI A;  2Y6R A;  3NT6 A;  2R0G A;  5KWF A;  1JNZ A;  2XVF A;  1CJ4 A;  3D8X A;  2WDR A;  2BAB A;  1IJH A;  3B3R A;  3CTY A;  4C5O A;  4H4X A;  2XVI A;  4YXD A;  5GRT A;  4H7U A;  1IUV A;  5C3J A;  1GER A;  4EM3 A;  2B9W A;  3M0O A;  3AE5 A;  1FOH A;  1YQ4 A;  1NG3 A;  1CHU A;  2Q7V A;  5KRQ A;  3NGC X;  2AAQ A;  4H4Q A;  1E1K A;  2VOU A;  2V60 A;  5KXJ A;  3PS9 A;  4YSZ A;  2A8X A;  1DOB A;  3VR8 A;  1ZX9 A;  1Q1R A;  2ZZ0 A;  1S2Y A;  2C65 A;  3OZ2 A;  1PBE A;  4J31 A;  5HHF A;  3JSK A;  1PBF A;  3NG7 X;  3GD4 A;  3IHM A;  2AQJ A;  3PVC A;  4JN9 A;  3UKH A;  1JU2 A;  1KNR A;  2Q0L A;  4BV6 A;  4DGK A;  5JCN A;  1KF6 A;  4GRT A;  4UDP A;  3KPF A;  1S3B A;  2WDQ A;  1BF3 A;  5CQF A;  4Y4N A;  4H2N A;  2WET A;  3QFB A;  3AEE A;  1GRF A;  4DSH A;  3AEC A;  4EQW A;  3IWA A;  3AE8 A;  4A79 A;  2WU5 A;  2XVJ A;  3GRS A;  1DXL A;  1AOG A;  1N4U A;  1EL9 A;  4RG4 A;  1EL8 A;  4UDR A;  5EB5 A;  2V6O A;  4YSX A;  4A6N A;  3IF9 A;  3QSE A;  3AEB A;  1BZL A;  3AYI A;  4C77 A;  5KOW A;  2YR4 A;  5M0Z A;  3EAN A;  4LA1 A;  2NVK X;  3AE2 A;  1P2E A;  4C3Y A;  4YWO A;  3KU9 A;  1EL5 A;  2GQF A;  4UDQ A;  4CNJ A;  2HQM A;  1LV0 A;  3DGH A;  3BHK A;  1VG9 A;  1CBO A;  3RP8 A;  5EOW A;  1RYI A;  2JKC A;  2OAL A;  4IA5 A;  4EMJ A;  4NZH A;  4Z26 A;  3AWI A;  1VG0 A;  4B69 A;  1GRE A;  3UKP A;  1F8W A;  4APN A;  3ICR A;  4U8L A;  4OPG A;  3BNM A;  3PO7 A;  4Z2U A;  2BAC A;  2R4J A;  2R4E A;  2R0P A;  3AYJ A;  4EQR A;  3P4Q A;  3NH3 X;  4H2P A;  1GTE A;  1JNR A;  3IC9 A;  2H89 A;  1ZK7 A;  5C2T A;  1ZMD A;  1XAN A;  2BC1 A;  2YVG A;  4HB9 A;  2CFY A;  2YLW A;  1N1P A;  4YTM A;  5J7X A;  4TLZ A;  3UKQ A;  1CL0 A;  3UOZ A;  5CKU A;  3V3N A;  2Q6U A;  1K0I A;  1MOK A;  1K4Q A;  2F5Z A;  4ICY A;  4JY2 A;  5BUK A;  4NEW A;  1M6I A;  2X8H A;  1SEZ A;  2R46 A;  2C64 A;  2WU2 A;  3GDP A;  4LU6 A;  2WOV A;  5FS6 A;  4HA6 A;  4BUR A;  3AYL A;  2B76 A;  3LB8 A;  2GF3 A;  2YLR A;  3UP5 A;  3UTG A;  1GSN A;  2ZBW A;  1XDI A;  1ZKQ A;  4BK1 A;  5DBJ A;  5HXI A;  3H8I A;  3P9U A;  3FPZ A;  1PJ7 A;  2GRT A;  1JRX A;  2EQ8 A;  2B7R A;  1XHC A;  2EQ6 A;  1GRG A;  3NLC A;  3AXB A;  2ARD A;  1V59 A;  1E7P A;  2BS3 A;  4Z43 A;  4C74 A;  1Y56 B;  3HZL A;  3SFD A;  1EL7 A;  1MO9 A;  2CUL A;  1RP0 A;  2C75 A;  4I59 A;  1O94 A;  2VRL A;  5JCK A;  1BKW A;  4B64 A;  1LVL A;  4Y4M A;  4GR1 A;  4A9W A;  2XLS A;  4NTD A;  3I3L A;  3URH A;  2C66 A;  3UOY A;  5KVI A;  4AP3 A;  1FEC A;  3NTA A;  2BC0 A;  3DK9 A;  3ISH A;  2JK6 A;  1E39 A;  4BJZ A;  1QO8 A;  2VRM A;  2WP6 A;  3ZYX A;  1CC2 A;  2V3A A;  2R45 A;  3UKF A;  2GVC A;  1W4X A;  2GEW A;  3ABV A;  3R9U A;  3NYF A;  1PBB A;  2BXR A;  3GSI A;  1L9C A;  3ALL A;  2VZ2 A;  5IQ4 A;  4XWR A;  3NYC A;  1QJD A;  3ADA B;  4TM4 A;  4GDE A;  4ZCC A;  1O95 A;  4H50 A;  4B66 A;  1GEU A;  1D4C A;  2GMJ A;  1OJC A;  1QLB A;  4LII A;  4GCM A;  3Q6J A;  3EPT A;  1LQT A;  3KVE A;  3QSS A;  3RP7 A;  1IUX A;  3RNM A;  2DKH A;  3I6D A;  2Y6Q A;  2YG5 A;  1ZOV A;  1TDN A;  3CPH G;  3F8D A;  1YQZ A;  5HYM A;  3G5Q A;  4XXG A;  3EAO A;  4USQ A;  4A7A A;  1DOC A;  1FL2 A;  1K0L A;  2QA2 A;  3UKA A;  1CJC A;  1PXB A;  3FMW A;  3RP6 A;  3UP4 A;  4NTC A;  3C4N A;  4CCQ A;  2XLT A;  1VRQ B;  4USR A;  2YM2 A;  2QA1 A;  2YLS A;  2WS3 A;  4D04 A;  2ZZB A;  3V3O A;  1VDC A;  1OJA A;  3QVR A;  1TRB A;  2C76 A;  3RED A;  3DJJ A;  4H2R A;  4J33 A;  3BI2 A;  4NTE A;  3GWF A;  2XFQ A;  4OPI A;  1CJ2 A;  1OJT A;  2Z5Y A;  3LAD A;  3AE4 A;  4O5Q A;  3H4K A;  3UTE A;  3II4 A;  4U2T A;  4H4S A;  2B7S A;  2XLU A;  4OPD A;  4X4J A;  5BRT A;  2YVF A;  1CJ3 A;  1KSS A;  2FJD A;  1GRT A;  1GV4 A;  2J3N A;  2NPX A;  4U8M A;  2R9Z A;  1KSU A;  4H4W A;  1LPF A;  2O9Z A;  1B37 A;  3AB1 A;  4TM1 A;  1K0J A;  4K8D A;  3QSM A;  3K30 A;  3H8L A;  1D5T A;  1F8R A;  3UKL A;  5IQ1 A;  1KDG A;  2BCG G;  3NTD A;  1FEB A;  1PDH A;  1XPQ A;  2VQ7 A;  3CGC A;  2IID A;  1GRH A;  4FX9 A;  5JCM A;  3QVP A;  2C3C A;  3VRA A;  2QAE A;  5JCL A;  3AD7 B;  3BI4 A;  1PS9 A;  4B1B A;  1Y0P A;  3KD9 A;  4IA6 A;  2R0C A;  3UCL A;  5EB4 A;  3ZDN A;  2EQ7 A;  1PXC A;  2VQB A;  3GDN A;  1OJ9 A;  4YSY A;  2DKI A;  4JDR A;  3VQR A;  3T37 A;  1L9D A;  1PXA A;  4J2W A;  2GH5 A;  3DJG X;  3CNJ A;  3NK2 X;  2XFO A;  2RAB A;  1JRY A;  3AEG A;  3D1C A;  1NHP A;  2B9Y A;  3K7T A;  3LJP A;  3BI5 A;  4B67 A;  3DA1 A;  1ZMC A;  2BXS A;  1TYT A;  1H84 A;  1DJQ A;  1M64 A;  4FK1 C;  4XWZ A;  5U1O A;  2JB2 A;  3ATR A;  3AE1 A;  3AE9 A;  4GF7 A;  3F8P A;  4YKF A;  4IVM B;  3NK0 X;  2W0H A;  1H7X A;  2E1M A;  5U25 A;  1PBC A;  3CGB A;  3AEF A;  2FJA A;  1IUW A;  2WPE A;  2JAE A;  2C7G A;  1TDK A;  4C3X A;  2WP5 A;  3LXD A;  4H4U A;  1L0V A;  4RG3 A;  5IPY A;  2YVJ A;  5BVA A;  4Z24 A;  1CF3 A;  1B8S A;  3QJ4 A;  1H83 A;  4M52 A;  3NIX A;  1PN0 A;  2QCU A;  3NNE A;  4TM0 A;  4P9S A;  1P2H A;  5M10 A;  2C67 A;  1LQU A;  2V5Z A;  4TLX A;  2PHH A;  3OC4 A;  1ZP0 A;  2GAG B;  3KA7 A;  5FMH A;  1D4D A;  2XLR A;  2WQY A;  4B68 A;  2BK3 A;  2XDO A;  2BK4 A;  4EIQ A;  2VVL G;  1N4V A;  1PJ5 A;  4B65 A;  2OAM A;  4FK1 A;  4EMI A;  4IV9 A;  4OPC A;  3SFE A;  1H6V A;  3VRD B;  4PAA A;  1CC4 A;  4AP1 A;  1GTH A;  1B5Q A;  3Q9T A;  3S5W A;  4YTP A;  3L1R A;  3AD9 B;  2B9X A;  4KX6 A;  3P1W A;  3UOV A;  1COY A;  4MJW A;  2YM1 A;  4EM4 A;  2BS2 A;  3DH9 A;  3DK4 A;  1Z6L A;  4A5L A;  3GYJ A;  4A65 A;  2YLT A;  2YR5 A;  4ZN0 A;  4ECH A;  4AOS A;  1VQW A;  2GV8 A;  4H4P A; 
#chains in the Genus database with same CATH topology
 4CRT A;  2YR6 A;  1YKJ A;  2BCP A;  1PDZ A;  3COX A;  4Z25 A;  3FYY A;  2OX4 A;  3K7Q X;  2V61 A;  3G5S A;  1F3P A;  1H7W A;  3T0K A;  2E5V A;  2OA1 A;  3AE3 A;  1BGJ A;  1GND A;  4OPL A;  2HNE A;  4U8P A;  3UGV A;  3A7U A;  2YWL A;  4HCL A;  1E1N A;  1NHS A;  1YQ3 A;  2BK5 A;  1JRZ A;  3GMC A;  2YG7 A;  2YLX A;  4Z2T A;  3LZW A;  4Y4L A;  3P93 A;  2WES A;  1GOS A;  3FXG A;  4CY8 A;  4DN1 A;  2PSN A;  3UJF A;  3TJ4 A;  3SBF A;  3SZF A;  2X8C A;  3RGT A;  4Z1Y A;  3ALM A;  4M6U A;  2CDU A;  4IHC A;  4J1O A;  3BOX A;  1GRB A;  3SGL A;  3AN1 A;  5FS7 A;  4YTN A;  2JBV A;  3CND A;  2WPC A;  4J36 A;  3DME A;  3TWA A;  3S47 A;  1ZDL A;  2WDV A;  1EC8 A;  2XVH A;  2RGH A;  2WP9 A;  4GYP A;  2BA9 A;  2GL5 A;  1ZY8 A;  2H88 A;  3DK8 A;  1DOE A;  4U8O A;  2XFP A;  3TW9 A;  2GR1 A;  4MGG A;  5G5H B;  2OFJ A;  3CN8 A;  1TDO A;  3IK4 A;  4A99 A;  1WYG A;  1Y56 A;  1N4W A;  2W54 A;  1NAA A;  2GB0 A;  3NHO X;  4AT0 A;  5FS8 A;  2JB3 A;  2ZAD A;  4DHG A;  2BYB A;  4E8G A;  1VQZ A;  5FJP A;  3I6T A;  3P3B A;  1ELS A;  3V4B A;  3R10 A;  1DOD A;  2RGJ A;  4K2S A;  1ZXI C;  3GWD A;  1EBH A;  4F4R A;  4H4V A;  4G74 A;  1EBD A;  2FBW A;  4HNC A;  4GDP A;  2Y6R A;  2R0G A;  1CJ4 A;  2WDR A;  2BAB A;  1IJH A;  1N5X A;  4YXD A;  1MDR A;  3I6E A;  1GER A;  1N63 C;  1FOH A;  1NG3 A;  1CHU A;  3A7R A;  3NGC X;  5KMQ A;  3VR8 A;  2QDD A;  1ZX9 A;  4J31 A;  1EC7 A;  1FIQ B;  3GD4 A;  3IHM A;  4II2 A;  3FVD A;  3H8A A;  4UDP A;  1FFV C;  4H2N A;  3QFB A;  4DSH A;  4GIR A;  1N4U A;  1EL9 A;  3IJQ A;  4UDR A;  3VCC A;  4ENL A;  2YR4 A;  4LA1 A;  3AE2 A;  1P2E A;  4C3Y A;  4CNJ A;  1LV0 A;  3CB3 A;  5EOW A;  3RP8 A;  3V3W A;  2OPJ A;  1VG0 A;  3HYW A;  4Z2U A;  4KEM A;  2BAC A;  3P4Q A;  3NH3 X;  4GYP C;  2ZC8 A;  3U9I A;  5J7X A;  3R25 A;  3UOZ A;  2E5A A;  3FJ4 A;  1MOK A;  1M6I A;  3GDP A;  3TQP A;  1VDV A;  3UTG A;  4BK1 A;  1ONE A;  3FPZ A;  1PJ7 A;  1JRX A;  2B7R A;  2OLA A;  3NLC A;  1EL7 A;  2CUL A;  1O94 A;  2VRL A;  5JCK A;  4B64 A;  4ROP A;  3DFH A;  4A9W A;  2XLS A;  5KVI A;  3ZYX A;  3GSI A;  3NYC A;  4ZCC A;  1OJC A;  1SJC A;  1BQG A;  3RNM A;  1ZOV A;  1TDN A;  1YQZ A;  5HYM A;  4XXG A;  4USQ A;  4A7A A;  4H83 A;  1PXB A;  3UP4 A;  3ENL A;  4USR A;  2YM2 A;  4D04 A;  3K1G A;  1OJA A;  4E5T A;  2C76 A;  3OPS A;  4NTE A;  3GWF A;  4ZOH B;  3AE4 A;  4H4S A;  1GV4 A;  2NPX A;  4H4W A;  2O9Z A;  3AB1 A;  4K8D A;  3QSM A;  1D5T A;  3UKL A;  1KDG A;  3NTD A;  2IID A;  1GRH A;  2C3C A;  2QAE A;  3BI4 A;  4B1B A;  5EB4 A;  1T3Q C;  3GDN A;  3T9P A;  2HXT A;  2DKI A;  1KD0 A;  4H2H A;  3DJG X;  3AMZ A;  2AL2 A;  2RDX A;  4GAP A;  1ZMC A;  1TYT A;  4FK1 C;  4XWZ A;  2CHR A;  1JRP A;  3ZLG A;  3ATR A;  1JRO A;  2WP5 A;  3UCC A;  5IPY A;  5BVA A;  3QJ4 A;  3NIX A;  2PP1 A;  4NNJ A;  2QCU A;  4TM0 A;  1ECQ A;  2POZ A;  5FMH A;  1R0M A;  3SYI A;  2BK3 A;  2XDO A;  1N4V A;  3NRZ B;  2OAM A;  3S5W A;  3Q9T A;  4YTP A;  5BOE A;  3P1W A;  1X2G A;  3CAW A;  2BS2 A;  3GYJ A;  4IP4 A;  2YLT A;  4AOS A;  3N4F A;  4O5U A;  3WE0 A;  5BOF A;  2XYO A;  2RGO A;  1FCD A;  3B6D A;  1JOA A;  3LZX A;  4CCR A;  3STP A;  4GME A;  3CK5 A;  1GXF A;  3R11 A;  3DG3 A;  4U8I A;  1MXT A;  3VR9 A;  3CIR A;  1KN0 A;  1Q9I A;  1F8S A;  4BJY A;  4DWD A;  2Z5X A;  1WUF A;  1DJN A;  2FJE A;  3ATQ A;  1L9E A;  4I58 A;  3IJI A;  1YY5 A;  4AOX A;  1PBD A;  3UCD A;  3ICS A;  2JB1 A;  5EU9 A;  3CT2 A;  2XH7 A;  2XFU A;  2YG4 A;  1FEA A;  3C96 A;  3DGZ A;  4K22 A;  3V76 A;  1NEN A;  2PYX A;  3NFU A;  1CC6 A;  2OQY A;  4K7Z A;  1JCT A;  5J04 A;  3T14 A;  1PHH A;  3LOV A;  4H4Z A;  1TYP A;  2MUC A;  1DNC A;  2C70 A;  3NN0 X;  1S3E A;  4H4R A;  3QFA A;  2DW6 A;  1O5W A;  3NO1 A;  1F9C A;  1IUS A;  4G8T A;  4OVI A;  3T6C A;  1BWC A;  2C72 A;  4ADW A;  2X50 A;  1PJ6 A;  1NG4 A;  4FDC B;  4PAB A;  2GR3 A;  3L5O A;  4EQS A;  3BHF A;  1HYU A;  5HY5 A;  1SJB A;  3GD3 A;  2UZZ A;  2AR8 A;  4G9K A;  4ZCD A;  1GET A;  2ZZC A;  3JZU A;  3P4S A;  1GRA A;  2P0I A;  4RSL A;  2QGY A;  2APG A;  1Q1W A;  4B63 A;  4J56 A;  4DNA A;  2QJJ A;  3AE7 A;  1GES A;  1EBG A;  1TDF A;  3CGD A;  3HYX A;  4UP3 A;  4DYE A;  4HCH A;  2E4G A;  2WEU A;  3ALJ A;  4J34 A;  5J60 A;  2A87 A;  4KPR A;  1IUT A;  1S2Q A;  3UJ2 A;  5L46 A;  4IT1 A;  3DDM A;  3CPI G;  3CPJ G;  3GYI A;  3SXI A;  5KWF A;  2XVF A;  2I5Q A;  3B3R A;  4H4X A;  1S7M A;  1P43 A;  2W3R A;  1IUV A;  4EM3 A;  3M0O A;  3MY9 A;  5KRQ A;  2Q7V A;  2POD A;  4H4Q A;  2VOU A;  3BSM A;  4IZG A;  5KXJ A;  3PS9 A;  2A8X A;  3QPE A;  2ZZ0 A;  5HHF A;  3OZ2 A;  3FV9 A;  2OKT A;  4JN9 A;  1JU2 A;  2Q0L A;  4BV6 A;  1P48 A;  4DGK A;  1KF6 A;  4IL2 A;  2OO6 A;  3KPF A;  2WET A;  3MKC A;  1GRF A;  3RIT A;  3TJI A;  4RG4 A;  5EB5 A;  3IF9 A;  1BZL A;  3AYI A;  5M0Z A;  1E9I A;  4GGB A;  4UDQ A;  3KU9 A;  1EL5 A;  3ZLF A;  1VG9 A;  1CBO A;  3EEZ A;  4HCD A;  3H70 A;  4NZH A;  2XGZ A;  3AWI A;  4B69 A;  1GRE A;  3UKP A;  1EC9 A;  1F8W A;  3ICR A;  5FJU A;  3CXB A;  3NVV B;  2R0P A;  4TVY A;  1OEP A;  2W3S A;  2FYM A;  2YVG A;  2BC1 A;  2YLW A;  1CL0 A;  2AL1 A;  3HW2 A;  3SN4 A;  3JVA A;  4ICY A;  1K4Q A;  1SEZ A;  2WU2 A;  2PTW A;  5FS6 A;  4LU6 A;  4HPN A;  3R1Z A;  4Z17 A;  2GF3 A;  2YLR A;  3UP5 A;  5DBJ A;  1SB3 B;  3P9U A;  3Q45 A;  1SJA A;  2PTY A;  2ARD A;  2BS3 A;  4Z43 A;  3P0W A;  4C74 A;  3UXL A;  3NXL A;  4I59 A;  3KPK A;  1BKW A;  4FI4 A;  3URH A;  3UOY A;  1E39 A;  2O56 A;  2WP6 A;  1CC2 A;  3H12 A;  2GEW A;  3NVZ B;  1L9C A;  3ALL A;  5IQ4 A;  4XWR A;  4H1Z A;  2QVH A;  4B66 A;  1GEU A;  1QLB A;  1LQT A;  1PDY A;  2OZ8 A;  3I6D A;  1N60 C;  4DXK A;  3D47 A;  4MMW A;  1K0L A;  1CJC A;  2P3Z A;  4NTC A;  4CCQ A;  3OW1 A;  3SR6 B;  3SQS A;  2ZZB A;  1VDC A;  3QVR A;  3NVW B;  1TRB A;  4J33 A;  3BI2 A;  2XFQ A;  1CJ2 A;  2Z5Y A;  3II4 A;  4OPD A;  5BRT A;  2YVF A;  2QJN A;  3VCN A;  4U8M A;  4E6M A;  5ENL A;  1KSU A;  4X2P A;  4TM1 A;  3TCS A;  2HZG A;  4II3 A;  1NU5 A;  3CGC A;  3VRA A;  4FX9 A;  5JCM A;  1PS9 A;  2C4C A;  1Y0P A;  3RRA A;  1PXC A;  2VQB A;  1OJ9 A;  4FP1 A;  4JDR A;  2QJM A;  3T37 A;  1PXA A;  1IYX A;  4TVW A;  4GIS A;  2XFO A;  1JRY A;  3T8Q A;  3LJP A;  3BI5 A;  1H84 A;  1DJQ A;  5U1O A;  2JB2 A;  3F8P A;  4YKF A;  3NK0 X;  5U25 A;  3CGB A;  2C7G A;  4C3X A;  2YVJ A;  3NNE A;  4P9S A;  1P2H A;  2C67 A;  3V5C A;  4TLX A;  4DX3 A;  4G7F A;  3OC4 A;  1ZP0 A;  3KA7 A;  2XLR A;  4B65 A;  3T2Z A;  4FK1 A;  4EMI A;  4IV9 A;  4OPC A;  1H6V A;  2P88 A;  4KWS A;  4AP1 A;  1R6W A;  1GTH A;  3GD6 A;  1B5Q A;  4JHM A;  2B9X A;  1COY A;  2YM1 A;  3DH9 A;  3JW7 A;  4A65 A;  4ZN0 A;  1TE6 A;  4YTM A;  3PVC A;  4H4P A;  2C3D A;  3AEA A;  4X9N A;  4DSG A;  4YKG A;  4ZA0 A;  5JCI A;  3DG7 A;  3UJE A;  4M0X A;  3SN0 A;  2V3B A;  1BKH A;  3UKK A;  3QN3 A;  4K2X A;  4BK2 A;  2FKP A;  1ELI A;  2TPR A;  3CYJ A;  1X2H A;  3EUB 3;  2FJB A;  2GR2 A;  5U63 A;  1MDL A;  3AE6 A;  3AD8 B;  3VFC A;  2X3N A;  3IHG A;  3ETR B;  4TM3 A;  3NZG A;  3SM8 A;  3DGB A;  3K7M X;  4A6N B;  1E1L A;  3NYE A;  4OPU A;  3TOY A;  4JY3 A;  4CBQ A;  5ER0 A;  4U2L A;  3DEQ A;  1JDF A;  2X8G A;  3GRT A;  4IVO B;  4YSH A;  3VDG A;  3O0H A;  3ES7 A;  3RHA A;  1LJ1 A;  3NN6 X;  4HYR A;  1MRA A;  4D03 A;  1N61 C;  1FO4 A;  4JNA A;  2CVJ A;  3FIM B;  1IUU A;  2WBA A;  1GAL A;  3CNP A;  4YT0 A;  3SJN A;  1B4V A;  2YQU A;  5LV9 A;  1NHR A;  2OZT A;  5FS9 A;  3MUC A;  2IVD A;  1D7L A;  1F6M A;  2GDQ A;  3FG2 P;  3PK7 A;  4JQ9 A;  3M12 A;  3SY4 A;  5GSN A;  2GGI A;  1BGN A;  3B9J B;  2EQ9 A;  2YLZ A;  2WHD A;  1ONF A;  4NWZ A;  4A6G A;  2WPF A;  3UJS A;  1REO A;  1NHQ A;  3AED A;  3PFR A;  4U8K A;  4J3Z A;  2PPG A;  1ZOY A;  4REK A;  3QTP A;  1WUE A;  2GSH A;  3AM9 A;  1X31 B;  1NPX A;  2P8B A;  3C4A A;  4E0V A;  3T2Y A;  3S61 A;  4U2S A;  3SSZ A;  4EMW A;  4A3R A;  2XFN A;  1FHV A;  4ZCW A;  5FJO A;  3V5F A;  3CTY A;  4C5O A;  3SN1 A;  4H7U A;  5C3J A;  3AE5 A;  2AAQ A;  1E1K A;  1Q1R A;  5KMS A;  1PBE A;  1FFU C;  1PBF A;  2AKM A;  3UKH A;  5JCN A;  4GRT A;  1N62 C;  2AL2 B;  2WDQ A;  1BF3 A;  5CQF A;  4Y4N A;  3SZW A;  3AEE A;  4E4F A;  3IWA A;  4EQW A;  3AE8 A;  4A79 A;  2WU5 A;  1DXL A;  3TWB A;  5KNL A;  2V6O A;  3QSE A;  5KOW A;  4YWO A;  2GQF A;  5KMR A;  1RYI A;  2JKC A;  4EMJ A;  4Z26 A;  4APN A;  4U8L A;  1DTN A;  4OPG A;  3BNM A;  5JRB A;  3DER A;  3OZY A;  3OZM A;  3IC9 A;  5C2T A;  1ZMD A;  2CFY A;  2PP0 A;  5CKU A;  3V3N A;  2Q6U A;  2XH2 A;  1K0I A;  4NEW A;  2R46 A;  2C64 A;  2WOV A;  4BUR A;  3AYL A;  2B76 A;  3DFY A;  1XDI A;  1ZKQ A;  3ZVH B;  3FCP A;  4K1W A;  2GRT A;  2EQ8 A;  1XHC A;  2EQ6 A;  3AXB A;  1Y56 B;  3HZL A;  2PCE A;  2C75 A;  3RO6 A;  2C66 A;  3NTA A;  3DK9 A;  3ISH A;  4BJZ A;  2VRM A;  3NVY B;  2R45 A;  2XH4 A;  1W4X A;  3ABV A;  3NYF A;  1PBB A;  2BXR A;  3ADA B;  4H50 A;  1D4C A;  4LII A;  3RP7 A;  2DKH A;  2YG5 A;  3SX6 A;  1JPM A;  1L8P A;  1W6T A;  3EAO A;  3UKA A;  2PS2 A;  3FMW A;  2AKZ A;  2XLT A;  1VRQ B;  3ZLH A;  3TTE A;  2QA1 A;  2WS3 A;  3MZN A;  3R07 C;  3A7A A;  3T31 A;  3RED A;  4H2R A;  2PGE A;  1OJT A;  3LAD A;  4O5Q A;  4U2T A;  1KSS A;  2FJD A;  4A35 A;  2R9Z A;  3GYX A;  1LPF A;  3QLD A;  3U4F A;  1K0J A;  2GGJ A;  2BCG G;  1FEB A;  1PDH A;  2VQ7 A;  3QVP A;  3AD7 B;  2NQL A;  3KD9 A;  2R0C A;  4G6H A;  3ZDN A;  2EQ7 A;  3QKE A;  2PTZ A;  2GH5 A;  3CNJ A;  3NK2 X;  3D1C A;  3DES A;  3K7T A;  1XPY A;  3AE1 A;  4GF7 A;  2OQH A;  4IVM B;  2HXU A;  2E1M A;  1PBC A;  2FJA A;  1IUW A;  2WPE A;  1TDK A;  4H4U A;  1L0V A;  3KUM A;  4Z24 A;  1STZ A;  1CF3 A;  3T2K A;  5FJT A;  1LQU A;  2GAG B;  1D4D A;  4B68 A;  4MKS A;  1FHU A;  2BK4 A;  1PJ5 A;  3CMM A;  2E3T A;  3VRD B;  3SFE A;  3AD9 B;  4KX6 A;  1TKK A;  3D46 A;  1Z6L A;  4A5L A;  4IP5 A;  4ECH A;  1VQW A;  2GV8 A;  2C73 A;  1LTX R;  4H4T A;  4H4Y A;  2YG6 A;  2A89 A;  4X9M A;  1NEL A;  4GUV A;  2BS4 A;  4Z44 A;  1E6E A;  3F8R A;  5KVH A;  3RR1 A;  1GPE A;  4U8N A;  3CGE A;  3THU A;  2OZ3 A;  3VA8 A;  2PTX A;  2YAU A;  3NKS A;  2OLN A;  3ITJ A;  3BJS A;  2ACZ A;  5KOX A;  1GT8 A;  3P4R A;  4EQX A;  1H86 A;  1NEK A;  1H82 A;  3KLJ A;  3EF6 A;  3DJD A;  4AT2 A;  2MNR A;  1JEH A;  4OPT A;  4U8J A;  3B97 A;  3FBS A;  2WOI A;  2I0Z A;  3NK1 X;  3ICT A;  2PGW A;  2YG3 A;  2WOW A;  4JNQ A;  4NEV A;  5FJR A;  2GR0 A;  2VVL A;  4H2Q A;  4K5R A;  3DIP A;  4K5S A;  3BNU A;  1D4E A;  1OJD A;  2Q0K A;  2GMH A;  1KNP A;  3KKJ A;  4CY6 A;  3UTH A;  4N9X A;  4G6G A;  2IVE A;  1UKV G;  4GFI A;  2VVM A;  3EKG A;  3M13 A;  1E1M A;  3MWC A;  4E4U A;  3R0U A;  4OCG A;  4EIP A;  3CNS A;  3MQT A;  2OG9 A;  3N4E A;  5TR3 A;  2GAH B;  2P8C A;  3UOX A;  2BRA A;  1H2I A;  3SQP A;  3P4P A;  3RCY A;  4WCT A;  2GQW A;  3UTF A;  4BK3 A;  1TDE A;  5BUL A;  5EBK A;  2PP3 A;  2X99 A;  3CNT A;  3G5R A;  3VRB A;  3E1T A;  1NDA A;  3L8K A;  1H81 A;  3PWI A;  4GAV A;  2TMD A;  2XLP A;  2XVE A;  1KFY A;  4CNK A;  2XSX A;  2OLO A;  7ENL A;  1XS2 A;  3DJE A;  3NRN A;  4Z2R A;  3GMB A;  2XCG A;  4WX1 A;  1RSG A;  4J57 A;  1D7Y A;  3NT6 A;  1JNZ A;  3D8X A;  2ONE A;  2XVI A;  5GRT A;  2B9W A;  1MNS A;  4HNL A;  1YQ4 A;  3SZC A;  2V60 A;  4YSZ A;  1DOB A;  2C65 A;  3GO2 A;  1S2Y A;  3JSK A;  3NG7 X;  1RM6 B;  2AQJ A;  3VC5 A;  1KNR A;  4JN7 A;  4HN8 A;  3T4W A;  1S3B A;  2GGE A;  2PU1 A;  3OP2 A;  3AEC A;  2XVJ A;  3GRS A;  1AOG A;  4JN8 A;  3HPF A;  1EL8 A;  5KMP A;  4YSX A;  4A6N A;  3AEB A;  2XH0 A;  4C77 A;  3EAN A;  2NVK X;  2HQM A;  3DGH A;  3UXK A;  3BHK A;  3NS1 B;  2OAL A;  4IA5 A;  3CXO A;  4K8G A;  3PO7 A;  2R4J A;  2R4E A;  3AYJ A;  4EQR A;  4H2P A;  1GTE A;  1JNR A;  2H89 A;  4KPL A;  1ZK7 A;  1TZZ A;  4HB9 A;  1XAN A;  1N1P A;  4TLZ A;  3UKQ A;  4JY2 A;  2F5Z A;  1N5W C;  5BUK A;  2X8H A;  3I4K A;  4HA6 A;  3LB8 A;  1GSN A;  4IL0 A;  2ZBW A;  5HXI A;  3H8I A;  3Q4D A;  3ZVI A;  2W55 A;  3VC6 A;  1GRG A;  1YEY A;  1V59 A;  1E7P A;  3N6H A;  1KCZ A;  3SFD A;  3S5S A;  1MO9 A;  1RP0 A;  3UJR A;  1LVL A;  4Y4M A;  4GR1 A;  4EWJ A;  4NTD A;  3I3L A;  4AP3 A;  1FEC A;  2BC0 A;  2JK6 A;  1QO8 A;  1KKR A;  3R0K A;  2V3A A;  3UKF A;  2GVC A;  3R9U A;  2VZ2 A;  3D9X A;  1QJD A;  4TM4 A;  4GDE A;  1O95 A;  3MSY A;  3PG6 A;  2GMJ A;  2QDE A;  4GCM A;  3Q6J A;  3EPT A;  3KVE A;  3QSS A;  1IUX A;  2Y6Q A;  1RVK A;  3HRD C;  3CPH G;  3F8D A;  3G5Q A;  1DOC A;  1FL2 A;  2QA2 A;  2QQ6 A;  3RP6 A;  3C4N A;  2YLS A;  3OTR A;  1KKO A;  3V3O A;  2PMQ A;  2PA6 A;  2PU0 A;  3DJJ A;  1V97 A;  4OPI A;  3GY1 A;  2OVL A;  3H4K A;  3UTE A;  2DW7 A;  2B7S A;  2XLU A;  4X4J A;  1CJ3 A;  1GRT A;  2J3N A;  1B37 A;  3H7V A;  3K30 A;  5IDZ A;  3H8L A;  1F8R A;  5IQ1 A;  3N6J A;  3IJL A;  1XPQ A;  5JCL A;  2BRY A;  4GGH A;  1JPD X;  4IA6 A;  3UCL A;  4YSY A;  3VQR A;  3HYV A;  1L9D A;  4J2W A;  3GC2 A;  1SJD A;  2RAB A;  3AEG A;  1NHP A;  2B9Y A;  4B67 A;  3DA1 A;  3ZVH A;  2BXS A;  4H19 A;  1M64 A;  3ES8 A;  3AE9 A;  2W0H A;  1H7X A;  3AEF A;  2GGH A;  2JAE A;  3LXD A;  4RG3 A;  6ENL A;  1B8S A;  1H83 A;  4M52 A;  1PN0 A;  5M10 A;  4YWS A;  3SZ0 A;  2V5Z A;  2PHH A;  2WQY A;  4KT2 A;  4EIQ A;  2VVL G;  3DG6 A;  4PAA A;  1CC4 A;  3L1R A;  2GGG A;  3UOV A;  4MJW A;  1MUC A;  4EM4 A;  3DK4 A;  5G5G B;  2YR5 A;  3PWG A;  4G73 A; 
#chains in the Genus database with same CATH homology
 4O5U A;  2C3D A;  3AEA A;  4X9N A;  4DSG A;  3WE0 A;  4YKG A;  4CRT A;  2XYO A;  2C73 A;  1LTX R;  5JCI A;  4H4T A;  4H4Y A;  1FCD A;  2RGO A;  2YG6 A;  2YR6 A;  3B6D A;  1JOA A;  1YKJ A;  3LZX A;  2BCP A;  2A89 A;  4X9M A;  4CCR A;  4GUV A;  2V3B A;  3COX A;  3UKK A;  4Z25 A;  2BS4 A;  4Z44 A;  1E6E A;  3F8R A;  5KVH A;  1GXF A;  4K2X A;  4BK2 A;  4U8I A;  1MXT A;  1ELI A;  3VR9 A;  1GPE A;  4U8N A;  3CGE A;  3K7Q X;  3CIR A;  2TPR A;  2FJB A;  1KN0 A;  2V61 A;  1F3P A;  3G5S A;  1Q9I A;  1F8S A;  2GR2 A;  1H7W A;  5U63 A;  4BJY A;  3T0K A;  2E5V A;  2Z5X A;  3AE6 A;  3AD8 B;  2OA1 A;  1DJN A;  2FJE A;  2X3N A;  3IHG A;  3AE3 A;  2YAU A;  1BGJ A;  1GND A;  1L9E A;  3ATQ A;  3NKS A;  4OPL A;  4TM3 A;  3SM8 A;  2OLN A;  3ITJ A;  4U8P A;  4I58 A;  2YWL A;  2ACZ A;  3K7M X;  1E1N A;  4A6N B;  1NHS A;  1YY5 A;  1E1L A;  1YQ3 A;  1PBD A;  2BK5 A;  1GT8 A;  3NYE A;  4OPU A;  4AOX A;  5KOX A;  1JRZ A;  3P4R A;  3GMC A;  4JY3 A;  4EQX A;  1H86 A;  2YG7 A;  2YLX A;  3LZW A;  4Y4L A;  4CBQ A;  4Z2T A;  5ER0 A;  2WES A;  3ICS A;  4U2L A;  1GOS A;  1NEK A;  2JB1 A;  1H82 A;  3KLJ A;  3EF6 A;  3DJD A;  4CY8 A;  2X8G A;  3GRT A;  4IVO B;  4AT2 A;  4YSH A;  1JEH A;  2XFU A;  4OPT A;  2YG4 A;  4U8J A;  3FBS A;  1FEA A;  2WOI A;  3DGZ A;  2I0Z A;  3C96 A;  2X8C A;  4K22 A;  3NK1 X;  3ICT A;  1NEN A;  2PYX A;  3O0H A;  1CC6 A;  3ALM A;  3V76 A;  2CDU A;  2YG3 A;  2WOW A;  3RHA A;  1LJ1 A;  4JNQ A;  4K7Z A;  4NEV A;  3NN6 X;  2GR0 A;  2VVL A;  4H2Q A;  4K5R A;  4D03 A;  3T14 A;  1PHH A;  3LOV A;  1GRB A;  3SGL A;  4H4Z A;  4JNA A;  5FS7 A;  2CVJ A;  4YTN A;  3FIM B;  4K5S A;  1TYP A;  3BNU A;  1D4E A;  1OJD A;  2JBV A;  2GMH A;  2Q0K A;  3CND A;  1DNC A;  2WPC A;  1IUU A;  4J36 A;  3DME A;  2WBA A;  1GAL A;  3CNP A;  2C70 A;  3NN0 X;  4YT0 A;  1KNP A;  3KKJ A;  4CY6 A;  1S3E A;  1ZDL A;  3UTH A;  2WDV A;  1B4V A;  2YQU A;  4N9X A;  2XVH A;  2RGH A;  5LV9 A;  4G6G A;  4H4R A;  2WP9 A;  3QFA A;  1NHR A;  1O5W A;  2BA9 A;  5FS9 A;  2IVE A;  1ZY8 A;  2H88 A;  1UKV G;  2IVD A;  1D7L A;  1F6M A;  3DK8 A;  1IUS A;  1DOE A;  4U8O A;  2XFP A;  2VVM A;  3FG2 P;  3M13 A;  4OVI A;  1E1M A;  2GR1 A;  4JQ9 A;  3M12 A;  1BWC A;  2C72 A;  3SY4 A;  4ADW A;  2X50 A;  1PJ6 A;  1NG4 A;  4FDC B;  5GSN A;  1BGN A;  3CN8 A;  4PAB A;  4OCG A;  4EIP A;  3CNS A;  2GR3 A;  1TDO A;  4A99 A;  3L5O A;  2EQ9 A;  4EQS A;  2YLZ A;  5TR3 A;  2WHD A;  3BHF A;  1HYU A;  5HY5 A;  2GAH B;  3GD3 A;  2UZZ A;  3UOX A;  2AR8 A;  2BRA A;  1Y56 A;  1ONF A;  1H2I A;  3SQP A;  4NWZ A;  4G9K A;  4ZCD A;  2WPF A;  1N4W A;  1GET A;  3P4P A;  2ZZC A;  3P4S A;  1GRA A;  1NAA A;  4WCT A;  2GQW A;  4RSL A;  1REO A;  2APG A;  2GB0 A;  1Q1W A;  3UTF A;  4B63 A;  1NHQ A;  4BK3 A;  1TDE A;  3AED A;  3NHO X;  4AT0 A;  5FS8 A;  4J56 A;  4DNA A;  2JB3 A;  4U8K A;  5BUL A;  1ZOY A;  2BYB A;  4REK A;  5EBK A;  2X99 A;  3AE7 A;  3CNT A;  1GES A;  3G5R A;  3VRB A;  3E1T A;  1DOD A;  1NDA A;  3L8K A;  1H81 A;  1TDF A;  1X31 B;  1NPX A;  2RGJ A;  3C4A A;  4E0V A;  3GWD A;  4GAV A;  3CGD A;  2TMD A;  2XLP A;  3HYX A;  4UP3 A;  3T2Y A;  2XVE A;  3S61 A;  1KFY A;  4U2S A;  2E4G A;  4H4V A;  4CNK A;  2OLO A;  2WEU A;  3DJE A;  4G74 A;  3ALJ A;  3NRN A;  4J34 A;  4Z2R A;  4EMW A;  2A87 A;  5J60 A;  4KPR A;  1IUT A;  3GMB A;  2XCG A;  1EBD A;  1S2Q A;  2FBW A;  4WX1 A;  2XFN A;  5L46 A;  1RSG A;  4J57 A;  1D7Y A;  4GDP A;  3CPI G;  3CPJ G;  3GYI A;  2Y6R A;  3NT6 A;  3SXI A;  2R0G A;  5KWF A;  1JNZ A;  2XVF A;  1CJ4 A;  3D8X A;  2WDR A;  2BAB A;  1IJH A;  3B3R A;  3CTY A;  4C5O A;  4H4X A;  2XVI A;  1S7M A;  4YXD A;  5GRT A;  4H7U A;  1IUV A;  5C3J A;  1GER A;  4EM3 A;  2B9W A;  3M0O A;  3AE5 A;  1FOH A;  1YQ4 A;  1NG3 A;  1CHU A;  2Q7V A;  3SZC A;  3NGC X;  5KRQ A;  2AAQ A;  4H4Q A;  1E1K A;  2VOU A;  2V60 A;  5KMQ A;  3PS9 A;  4YSZ A;  2A8X A;  1DOB A;  3VR8 A;  5KXJ A;  1ZX9 A;  1Q1R A;  2ZZ0 A;  1S2Y A;  2C65 A;  3OZ2 A;  1PBE A;  4J31 A;  5HHF A;  5KMS A;  3JSK A;  1PBF A;  3NG7 X;  3GD4 A;  3IHM A;  4II2 A;  2AQJ A;  3PVC A;  4JN9 A;  3UKH A;  1JU2 A;  1KNR A;  2Q0L A;  4BV6 A;  4DGK A;  5JCN A;  1KF6 A;  4GRT A;  4UDP A;  3KPF A;  1S3B A;  2WDQ A;  1BF3 A;  5CQF A;  4Y4N A;  4H2N A;  2WET A;  3SZW A;  3QFB A;  3AEE A;  1GRF A;  4DSH A;  3AEC A;  4EQW A;  3IWA A;  3AE8 A;  4A79 A;  2WU5 A;  2XVJ A;  3GRS A;  1DXL A;  1AOG A;  1N4U A;  1EL9 A;  4RG4 A;  1EL8 A;  4UDR A;  5KNL A;  5KMP A;  5EB5 A;  2V6O A;  4YSX A;  4A6N A;  3IF9 A;  3QSE A;  3AEB A;  1BZL A;  3AYI A;  4C77 A;  5KOW A;  2YR4 A;  5M0Z A;  3EAN A;  4LA1 A;  2NVK X;  3AE2 A;  1P2E A;  4C3Y A;  4YWO A;  3KU9 A;  1EL5 A;  2GQF A;  4UDQ A;  4CNJ A;  2HQM A;  1LV0 A;  3DGH A;  5KMR A;  3BHK A;  1VG9 A;  1CBO A;  3RP8 A;  5EOW A;  1RYI A;  2JKC A;  2OAL A;  4IA5 A;  4EMJ A;  4NZH A;  4Z26 A;  3AWI A;  1VG0 A;  4B69 A;  1GRE A;  3UKP A;  1F8W A;  4APN A;  3ICR A;  4U8L A;  4OPG A;  3BNM A;  3PO7 A;  5JRB A;  3HYW A;  4Z2U A;  2BAC A;  2R4J A;  2R4E A;  2R0P A;  3AYJ A;  4EQR A;  3P4Q A;  3NH3 X;  4H2P A;  1GTE A;  1JNR A;  3IC9 A;  2H89 A;  1ZK7 A;  5C2T A;  1ZMD A;  1XAN A;  2BC1 A;  2YVG A;  4HB9 A;  2CFY A;  2YLW A;  1N1P A;  4YTM A;  5J7X A;  4TLZ A;  3UKQ A;  1CL0 A;  3UOZ A;  5CKU A;  3V3N A;  2Q6U A;  1K0I A;  1MOK A;  1K4Q A;  2F5Z A;  4ICY A;  4JY2 A;  5BUK A;  4NEW A;  1M6I A;  2X8H A;  1SEZ A;  2R46 A;  2C64 A;  2WU2 A;  3GDP A;  4LU6 A;  2WOV A;  5FS6 A;  4HA6 A;  4BUR A;  3AYL A;  2B76 A;  3LB8 A;  2GF3 A;  2YLR A;  3UP5 A;  3UTG A;  1GSN A;  2ZBW A;  1XDI A;  1ZKQ A;  4BK1 A;  5DBJ A;  5HXI A;  3H8I A;  3P9U A;  3FPZ A;  1PJ7 A;  2GRT A;  1JRX A;  2EQ8 A;  2B7R A;  1XHC A;  2EQ6 A;  1GRG A;  3NLC A;  3AXB A;  2ARD A;  1V59 A;  1E7P A;  2BS3 A;  4Z43 A;  4C74 A;  1Y56 B;  3HZL A;  3SFD A;  1EL7 A;  1MO9 A;  2CUL A;  1RP0 A;  2C75 A;  4I59 A;  1O94 A;  2VRL A;  5JCK A;  1BKW A;  3KPK A;  4B64 A;  1LVL A;  4Y4M A;  4GR1 A;  4A9W A;  2XLS A;  4NTD A;  3I3L A;  3URH A;  2C66 A;  3UOY A;  5KVI A;  4AP3 A;  1FEC A;  3NTA A;  2BC0 A;  3DK9 A;  3ISH A;  2JK6 A;  1E39 A;  4BJZ A;  1QO8 A;  2VRM A;  2WP6 A;  3ZYX A;  1CC2 A;  2V3A A;  2R45 A;  3UKF A;  2GVC A;  1W4X A;  2GEW A;  3ABV A;  3R9U A;  3NYF A;  1PBB A;  2BXR A;  3GSI A;  1L9C A;  3ALL A;  2VZ2 A;  5IQ4 A;  4XWR A;  3D9X A;  3NYC A;  1QJD A;  3ADA B;  4TM4 A;  4GDE A;  4ZCC A;  1O95 A;  4H50 A;  3PG6 A;  4B66 A;  1GEU A;  1D4C A;  2GMJ A;  1OJC A;  1QLB A;  4LII A;  4GCM A;  3Q6J A;  3EPT A;  1LQT A;  3KVE A;  3QSS A;  3RP7 A;  1IUX A;  3RNM A;  2DKH A;  3I6D A;  2Y6Q A;  2YG5 A;  3SX6 A;  1ZOV A;  1TDN A;  3CPH G;  3F8D A;  1YQZ A;  5HYM A;  3G5Q A;  4XXG A;  3EAO A;  4USQ A;  4A7A A;  1DOC A;  1FL2 A;  1K0L A;  2QA2 A;  3UKA A;  1CJC A;  1PXB A;  3FMW A;  3RP6 A;  3UP4 A;  4NTC A;  3C4N A;  4CCQ A;  2XLT A;  1VRQ B;  4USR A;  2YM2 A;  2QA1 A;  2YLS A;  2WS3 A;  4D04 A;  2ZZB A;  3V3O A;  1VDC A;  1OJA A;  3T31 A;  3QVR A;  1TRB A;  2C76 A;  3RED A;  3DJJ A;  4H2R A;  4J33 A;  3BI2 A;  4NTE A;  3GWF A;  2XFQ A;  4OPI A;  1CJ2 A;  1OJT A;  2Z5Y A;  3LAD A;  3AE4 A;  4O5Q A;  3H4K A;  3UTE A;  3II4 A;  4U2T A;  4H4S A;  2B7S A;  2XLU A;  4OPD A;  4X4J A;  5BRT A;  2YVF A;  1CJ3 A;  1KSS A;  2FJD A;  1GRT A;  1GV4 A;  2J3N A;  2NPX A;  4U8M A;  2R9Z A;  1KSU A;  4H4W A;  1LPF A;  2O9Z A;  1B37 A;  3AB1 A;  3GYX A;  4TM1 A;  1K0J A;  4K8D A;  3QSM A;  3K30 A;  3H8L A;  1D5T A;  1F8R A;  3UKL A;  5IQ1 A;  1KDG A;  2BCG G;  4II3 A;  3NTD A;  1FEB A;  1PDH A;  1XPQ A;  2VQ7 A;  3CGC A;  2IID A;  1GRH A;  4FX9 A;  5JCM A;  3QVP A;  2C3C A;  3VRA A;  2QAE A;  5JCL A;  3AD7 B;  3BI4 A;  2BRY A;  1PS9 A;  4B1B A;  2C4C A;  1Y0P A;  3KD9 A;  4IA6 A;  2R0C A;  3UCL A;  4G6H A;  5EB4 A;  3ZDN A;  2EQ7 A;  1PXC A;  2VQB A;  3GDN A;  1OJ9 A;  4YSY A;  2DKI A;  4JDR A;  3VQR A;  3HYV A;  3T37 A;  1L9D A;  1PXA A;  4J2W A;  2GH5 A;  3DJG X;  3CNJ A;  3NK2 X;  2XFO A;  2RAB A;  1JRY A;  3AEG A;  3D1C A;  1NHP A;  2B9Y A;  3K7T A;  3LJP A;  3BI5 A;  4G73 A;  4GAP A;  4B67 A;  3DA1 A;  1ZMC A;  2BXS A;  1TYT A;  1H84 A;  1DJQ A;  1M64 A;  4FK1 C;  4XWZ A;  5U1O A;  2JB2 A;  3ATR A;  3AE1 A;  3AE9 A;  4GF7 A;  3F8P A;  4YKF A;  4IVM B;  3NK0 X;  2W0H A;  1H7X A;  2E1M A;  5U25 A;  1PBC A;  3CGB A;  3AEF A;  2FJA A;  1IUW A;  2WPE A;  2JAE A;  2C7G A;  1TDK A;  4C3X A;  2WP5 A;  3LXD A;  4H4U A;  1L0V A;  4RG3 A;  5IPY A;  2YVJ A;  5BVA A;  4Z24 A;  1CF3 A;  3T2K A;  1B8S A;  3QJ4 A;  1H83 A;  4M52 A;  3NIX A;  4NNJ A;  1PN0 A;  2QCU A;  3NNE A;  4TM0 A;  4P9S A;  1P2H A;  5M10 A;  2C67 A;  3SZ0 A;  1LQU A;  2V5Z A;  4TLX A;  2PHH A;  3OC4 A;  1ZP0 A;  2GAG B;  3KA7 A;  5FMH A;  1D4D A;  2XLR A;  2WQY A;  3SYI A;  4B68 A;  2BK3 A;  2XDO A;  2BK4 A;  4EIQ A;  2VVL G;  1N4V A;  1PJ5 A;  4B65 A;  3T2Z A;  3CMM A;  2OAM A;  4FK1 A;  4EMI A;  3SZF A;  4IV9 A;  4OPC A;  3SFE A;  1H6V A;  3VRD B;  4PAA A;  1CC4 A;  4AP1 A;  1GTH A;  1B5Q A;  3Q9T A;  3S5W A;  4YTP A;  3L1R A;  3AD9 B;  2B9X A;  4KX6 A;  3P1W A;  3UOV A;  1COY A;  4MJW A;  2YM1 A;  4EM4 A;  2BS2 A;  3DH9 A;  3DK4 A;  1Z6L A;  4A5L A;  3GYJ A;  4A65 A;  2YLT A;  2YR5 A;  4ZN0 A;  4ECH A;  4AOS A;  1VQW A;  2GV8 A;  4H4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...