1XHCA

Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779-001
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
351
structure length
346
Chain Sequence
SKVVIVGNGPGGFELAKQLSQTYEVTVIDKEPVPYYSKPMLSHYIAGFIPRNRLFPYSLDWYRKRGIEIRLAEEAKLIDRGRKVVITEKGEVPYDTLVLATGARAREPQIKGKEYLLTLRTIFDADRIKESIENSGEAIIIGGGFIGLELAGNLAEAGYHVKLIHRGAMFLGLDEELSNMIKDMLEETGVKFFLNSELLEANEEGVLTNSGFIEGKVKICAIGIVPNVDLARRSGIHTGRGILIDDNFRTSAKDVYAIGDCAEYSGIIAGTAKAAMEQARVLADILKGEPRRYNFKFRSTVFKFGKLQIAIIGNTKGEGKWIEDNTKVFYIGAVVFNDIRKATKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH oxidase /nitrite reductase
publication title NADH oxidase /nitrite reductase from Pyrococcus furiosus Pfu-1140779-001
rcsb
source organism Pyrococcus furiosus
molecule tags Oxidoreductase
total genus 105
structure length 346
sequence length 351
ec nomenclature
pdb deposition date 2004-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1xhcA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xhcA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1xhcA02
1B37A 2YR4A 1CC2A 4EQXA 2XYOA 5C3JA 4CCRA 2GR1A 1H7XA 2ARDA 5J60A 1GNDA 2FJEA 5FS8A 3AE6A 3SM8A 2O9ZA 4J33A 1E1KA 2OLNA 3AEAA 1KDGA 3RP7A 3K30A 1H86A 3LB8A 2OA1A 2C3DA 1VRQB 2A89A 4BK3A 2XLPA 3CPJG 2WDQA 4USQA 3UKKA 2YAUA 1MOKA 3VR9A 1PBDA 2B76A 2JBVA 1N4WA 1PBFA 4H4ZA 4LU6A 1Z6LA 2R4JA 1KSUA 3UKPA 2QA1A 1KSSA 3CNPA 3P4QA 4PAAA 2VRMA 1KF6A 4M52A 2BS2A 4AP1A 4YSYA 1DOCA 3K7QX 1CJ2A 4EQRA 2WPFA 3IWAA 2GEWA 3GWFA 2VVLA 4REKA 2WPEA 2YVGA 3CPIG 1FEBA 4ZCDA 4RG3A 4H4YA 4CNKA 3GDPA 2YM2A 4H4PA 1LTXR 2B9WA 4H4WA 2APGA 4C3YA 1DNCA 3CGEA 4H4VA 2DKIA 3AXBA 2YLSA 2YG3A 3AEGA 4NTDA 1ZOVA 4Z25A 2BK3A 2WU5A 1NAAA 2C7GA 1GETA 3NGCX 1MXTA 1BGNA 4KX6A 1Y0PA 1L9EA 3UKHA 1GRTA 1JOAA 2Y6QA 4RG4A 2C70A 2VZ2A 3QVRA 4AOXA 3P1WA 3AEFA 4KPRA 3PVCA 4XXGA 4A6NA 3NN6X 4AT2A 3NKSA 1ZOYA 2Q0LA 1FECA 3H8IA 1XHCA 1IUSA 4IA5A 5M0ZA 4NEWA 1FEAA 1E1LA 2YG4A 1ZMCA 4NTEA 2E1MA 3L8KA 5GRTA 2E4GA 1L9CA 1PBCA 4H2RA 1O94A 3QJ4A 4RSLA 2C72A 4B63A 1S2QA 4UP3A 3ICRA 3NH3X 4H2NA 2YR5A 2Z5YA 3GYIA 3NHOX 3ALJA 4Z2RA 2YWLA 3QFAA 4A79A 1VG9A 4EMJA 3CNSA 4A7AA 2BK5A 4YXDA 1NHSA 1D7YA 4H2QA 3VQRA 1GV4A 4IV9A 3UTHA 1D4DA 2GR0A 1EL5A 1BKWA 3RNMA 1K0LA 2BK4A 4U8IA 4HB9A 1GALA 4P9SA 2B9YA 1CF3A 4CNJA 3IF9A 4I59A 2BA9A 2C64A 4BJZA 1HYUA 4UDPA 3GRTA 2XVHA 2FJBA 4GRTA 2Q7VA 2YLTA 3CNJA 3LZWA 4H4XA 3P4SA 1H7WA 1F6MA 4J36A 1GERA 1CL0A 3URHA 3SFEA 3SFDA 2W0HA 4J31A 1GEUA 4OPCA 2Q0KA 3LJPA 2JB3A 3UKLA 1BGJA 3DJEA 4B65A 2XVEA 3AEEA 5L46A 2RABA 3QSMA 2XVFA 4HA6A 4D04A 4AT0A 5KWFA 2YQUA 1REOA 3CNDA 2ZZ0A 4BV6A 2XVJA 5FS9A 2XFQA 2YLWA 4CRTA 1NG4A 3QVPA 3UP5A 1XANA 2JAEA 2OLOA 1MO9A 4DNAA 3AWIA 4H2PA 4Z24A 4CBQA 2DKHA 2VVLG 4EMWA 3EPTA 1TYTA 3GD4A 2C67A 2X8GA 4FDCB 1UKVG 5EOWA 2WP9A 2WQYA 2EQ9A 1YKJA 2XLTA 1CJ3A 3JSKA 4UDQA 4YKFA 1IUTA 2WDVA 4Y4LA 1CC6A 1DJNA 4A5LA 2X99A 1GESA 1DODA 2XLSA 2VRLA 4I58A 3CPHG 2V3AA 2WP5A 5KXJA 1ZX9A 1XDIA 4MJWA 3PO7A 3AYLA 3C4NA 4X9NA 1E6EA 1Q1RA 1VG0A 3VRDB 5HHFA 3AECA 1S2YA 2AR8A 2GVCA 1ZKQA 4YT0A 4EQSA 2XVIA 4J2WA 5BVAA 2WOIA 4TM3A 2YG7A 4OPIA 4WCTA 2YM1A 1JRXA 3I3LA 2XFUA 2YLXA 1LQTA 2RGOA 1OJ9A 4C3XA 3CGDA 5HY5A 3VRAA 4DSGA 2GMHA 2YLRA 1E1MA 3P4PA 4J57A 1EL8A 2VQBA 2Y6RA 4NEVA 1TDFA 2YVJA 1COYA 2C66A 5JCLA 3AYIA 4BK2A 5KOWA 3DGZA 3ALLA 3FIMB 1EL7A 1PHHA 5M10A 3NG7X 3E1TA 1ONFA 3NK2X 2TPRA 4BURA 1NG3A 3UKQA 3V3NA 4UDRA 4ZN0A 4H4SA 4X4JA 2XDOA 3AE4A 3DJGX 4AP3A 1AOGA 2IIDA 1GRBA 1LVLA 1O95A 1PXCA 5J7XA 3REDA 4U2LA 1VDCA 1NPXA 3BNMA 3C96A 4C74A 3HZLA 2V3BA 4JY3A 2F5ZA 1EBDA 4H4RA 3Q9TA 1RYIA 4O5UA 2GQWA 2FJAA 2GB0A 3FG2P 1PS9A 1D4EA 1PBBA 3ALMA 2ZBWA 1TDNA 1GREA 1PXAA 3GYJA 5CKUA 3UKFA 5JCMA 2I0ZA 5JCKA 3UOZA 4U8OA 3AYJA 4B68A 2GR3A 4BK1A 2V61A 3NTDA 2B7RA 3ISHA 3IC9A 2C75A 1GRAA 1B5QA 2V5ZA 4BJYA 1Q1WA 3CGBA 3H4KA 3NIXA 4APNA 5GSNA 5U63A 2QA2A 3LADA 4B69A 1IUVA 1NHRA 1IUXA 1OJDA 1L9DA 1ELIA 4FX9A 3NYFA 4H7UA 2FJDA 1VQWA 4Z43A 1K0JA 1JNRA 3GWDA 4OCGA 1P2HA 1CHUA 4XWZA 3G5RA 2FBWA 3OZ2A 2V60A 1GXFA 1YQ3A 2YG6A 2YG5A 2YLZA 4PABA 3AD9B 3ADAB 3RP6A 4E0VA 1H6VA 3I6DA 5FMHA 1OJTA 2GRTA 1RP0A 1M64A 2WDRA 3AE3A 3S5WA 2GAGB 1OJCA 3RHAA 4B66A 2BCGG 1GRFA 1GTHA 5HYMA 3NYCA 3AE1A 1PN0A 3NNEA 3UOYA 3QSEA 1Y56B 1L0VA 3S61A 1B8SA 2XLRA 1H84A 3AE9A 5C2TA 4GF7A 4C77A 5LV9A 3K7TA 3CNTA 4A6NB 4Z2TA 1IUUA 1JRZA 5IQ4A 2XFOA 2R0CA 2A8XA 3BNUA 4YTPA 3DA1A 4FK1C 2EQ7A 3T37A 2BCPA 3NYEA 4A65A 4GR1A 1OJAA 2WPCA 2J3NA 2BXSA 2XFNA 2R46A 3ABVA 3BI5A 4TM4A 5U25A 1PJ7A 3LXDA 1EL9A 1Q9IA 3LZXA 3AD8B 1LJ1A 4CY6A 2BYBA 1DJQA 2WEUA 1ZMDA 3L1RA 2NVKX 4NTCA 4YTMA 4OVIA 2VQ7A 3OC4A 1GRHA 3SGLA 5KRQA 2ACZA 3NK1X 4D03A 4CCQA 1CC4A 3EAOA 3CGCA 3NN0X 2BC0A 2CFYA 2NPXA 3D1CA 4YSXA 3FBSA 3KKJA 3GDNA 2QCUA 4U8PA 3AE5A 2PYXA 1F8WA 1D5TA 4YKGA 1GOSA 1LV0A 3BHKA 2C65A 3ITJA 4Y4NA 2WETA 1H83A 3M13A 4K7ZA 4H4UA 3F8DA 4EIPA 1ZY8A 4U8KA 3KA7A 2GMJA 3B3RA 3P4RA 3EANA 5FS7A 2WESA 4USRA 3R9UA 1XPQA 2R45A 3DMEA 2WHDA 4LA1A 4JNAA 5EB5A 4U8NA 3EF6A 2BS3A 3F8RA 1N4UA 1LPFA 3H8LA 1PBEA 4OPDA 3QFBA 4U2TA 2WOVA 2VOUA 3Q6JA 4NZHA 4A99A 2ZZCA 2WP6A 2B7SA 1GRGA 2OALA 3UTEA 5JCIA 1CJCA 1JU2A 1PDHA 1KFYA 4JY2A 4ICYA 3ICSA 3DJDA 4WX1A 3FMWA 3II4A 2WS3A 1F3PA 2IVEA 1H82A 1BZLA 1CBOA 4OPUA 1K4QA 2V6OA 5EBKA 4U8JA 3VR8A 2GF3A 3BI2A 1JNZA 2C3CA 3GMBA 1GSNA 5KVHA 4U8LA 1TDOA 3UOXA 4U2SA 2BS4A 2X8CA 4TM1A 1JRYA 2X3NA 4AOSA 3FPZA 1KNPA 3M12A 3QSSA 4GDEA 4EMIA 3DJJA 4H4TA 2BXRA 5BRTA 1YQZA 3SQPA 2WBAA 3BI4A 2GR2A 3WE0A 3CIRA 2PHHA 3G5QA 2R0GA 4ADWA 4JNQA 1QJDA 1QLBA 3PS9A 1NHQA 4YTNA 4Z2UA 4U8MA 3IHGA 4GUVA 5EB4A 5BUKA 3UCLA 2JK6A 4JQ9A 3AE8A 3NRNA 4J34A 1YY5A 4TLXA 4ECHA 3NK0X 4JDRA 1IUWA 3KD9A 2H89A 3BHFA 3DK4A 1PJ5A 2OAMA 2H88A 3KVEA 5BULA 1GT8A 3O0HA 1Y56A 3P9UA 4X9MA 3KU9A 4N9XA 3AD7B 5ER0A 4K5RA 2VVMA 1N1PA 4A9WA 3NTAA 1ZDLA 1DXLA 5U1OA 1D4CA 3AEDA 2GQFA 2HQMA 5HXIA 3NT6A 3UKAA 5JCNA 1SEZA 4DSHA 1GPEA 3ICTA 3AB1A 4Z26A 1PXBA 2ZZBA 2JKCA 3C4AA 3K7MX 2XLUA 2AQJA 5KOXA 1E39A 2GAHB 3COXA 2Q6UA 4GCMA 1ZP0A 1TDEA 1RSGA 3KPFA 3ZDNA 5TR3A 3F8PA 2WOWA 4EM3A 1KNRA 2R0PA 3AEBA 2X8HA 4JN9A 4TLZA 1TYPA 4EIQA 1X31B 4OPTA 1TRBA 3AE2A 1NHPA 4XWRA 1BWCA 2GH5A 2TMDA 3GRSA 4YSZA 4YWOA 1B4VA 4LIIA 5DBJA 1K0IA 3UOVA 4H4QA 2BACA 3ZYXA 3NLCA 3ATQA 3DGHA 1S3BA 5FS6A 1QO8A 2BABA 1LQUA 4K2XA 3V76A 1DOBA 2RGJA 3KLJA 1E1NA 1FCDA 4EM4A 2B9XA 3UTFA 4B1BA 4O5QA 3DK8A 3ATRA 1BF3A 2C76A 2IVDA 1CJ4A 1M6IA 1DOEA 3B6DA 3G5SA 5CQFA 4DGKA 2WU2A 3AE7A 3LOVA 4GDPA 1FOHA 2CULA 1V59A 3DK9A 2AAQA 1N4VA 4TM0A 3D8XA 3GD3A 1ZK7A 4Z44A 1NENA 1O5WA 3M0OA 1IJHA 2E5VA 4IA6A 2EQ8A 2YVFA 4Y4MA 1S3EA 1D7LA 2JB1A 4FK1A 2JB2A 4IVOB 4K5SA 4C5OA 2GV8A 2XFPA 3UTGA 4J56A 1GTEA 1TDKA 2C73A 2R4EA 2UZZA 4IVMB 3V3OA 2YR6A 3VRBA 3IHMA 2CDUA 3GSIA 2Z5XA 4K22A 3CN8A 3GMCA 5IPYA 2XCGA 1NDAA 2RGHA 1H81A 1P2EA 1F8RA 5IQ1A 4CY8A 2CVJA 3CTYA 4YSHA 1PJ6A 2QAEA 4H50A 4OPLA 3DH9A 4EQWA 4K8DA 3UP4A 2X50A 2EQ6A 1E7PA 5KVIA 1NEKA 2R9ZA 1F8SA 3RP8A 1FL2A 2BC1A 4B67A 1W4XA 1YQ4A 4OPGA 4B64A 1JEHA 4ZCCA 2A87A
chains in the Genus database with same CATH superfamily
1N60C 1ELSA 1KDGA 3LB8A 4BK3A 4USQA 3ENLA 3DERA 1PBFA 3NZGA 1Z6LA 3CNPA 4ZOHB 1KF6A 4AP1A 4EQRA 3GWFA 2WPEA 4ZCDA 4H4YA 4H4PA 4H4WA 4C3YA 3CGEA 3AXBA 2BK3A 2QJNA 2C7GA 1L9EA 1JOAA 3FCPA 3QVRA 4NNJA 4K8GA 3R11A 4AT2A 4IZGA 1ZMCA 4NTEA 2E1MA 5GRTA 2E4GA 3QJ4A 4RSLA 1JPDX 4UP3A 3ICRA 2XSXA 3GYIA 3QFAA 1VG9A 4EMJA 2BK5A 3A7UA 4HB9A 1GALA 1CF3A 4CNJA 4I59A 3AN1A 3PG6A 3DEQA 4GRTA 2YLTA 3T4WA 2PU0A 4OPCA 2W3RA 3DJEA 2XVEA 2RABA 3QSMA 2XVFA 3CK5A 3MKCA 1FO4A 2YLWA 1NG4A 3AWIA 4H2PA 4Z24A 3V5CA 2PGEA 2BRAA 3VA8A 3H7VA 1IUTA 4Y4LA 1CC6A 2NQLA 2WP5A 1ZX9A 4MJWA 1E6EA 1VG0A 1S2YA 4EQSA 4WCTA 4DHGA 3I3LA 2XFUA 1LQTA 4II2A 5HY5A 1E1MA 3P4PA 2VQBA 1TDFA 3FIMB 3CAWA 5M10A 2QDEA 3NK2X 1ONFA 1ECQA 1NG3A 4UDRA 4ZN0A 4AP3A 2IIDA 5G5HB 2PP0A 1O95A 3FV9A 1N62C 2F5ZA 2GQWA 3P93A 3FG2P 1D4EA 4K1WA 3KUMA 1TDNA 3T0KA 1WYGA 4II3A 2GR3A 3ISHA 3IC9A 1GRAA 2V5ZA 3S5SA 1Q1WA 3CGBA 2QA2A 1S7MA 1VDVA 1IUXA 1JRPA 4HCHA 2OG9A 1VQWA 1JNRA 3Q45A 3RCYA 1P2HA 1CHUA 4XWZA 3G5RA 3OZ2A 1VQZA 2YG6A 3RP6A 3P3BA 1OJTA 2HXTA 3RHAA 1GTHA 2BRYA 1L0VA 3CXBA 3IJLA 3S61A 3AE9A 1BQGA 2QQ6A 1FHVA 4Z2TA 1WUEA 3BJSA 2XFOA 3BNUA 3NYEA 3DIPA 3OTRA 1OJAA 4TM4A 3BI5A 2R46A 3ABVA 5U25A 3LXDA 3UCDA 1FHUA 2P8BA 4KT2A 1Q9IA 3LZXA 3AD8B 1ZMDA 2PPGA 2FKPA 2HNEA 3EAOA 2AL2B 2NPXA 3SR6B 2PYXA 1H83A 3F8DA 5KNLA 3KA7A 2GMJA 1STZA 3B3RA 4USRA 1XPQA 3F8RA 3UJEA 4U2TA 2WOVA 4NZHA 4A99A 2ZZCA 3DG7A 2B7SA 1GRGA 5BOEA 3B9JB 1JU2A 4JY2A 4ICYA 4WX1A 3T14A 2IVEA 1H82A 4MGGA 4U8JA 3BI2A 4KEMA 3QPEA 4TM1A 1KNPA 3STPA 1N5WC 2BXRA 3BI4A 2GR2A 4HCDA 4JNQA 4DWDA 1FIQB 1NHQA 4YTNA 5EB4A 3UCLA 3MWCA 3NRNA 3NK0X 4JDRA 4G6GA 1IUWA 3R10A 3KD9A 3BHFA 4TVYA 2H88A 4X9MA 3T31A 4K5RA 2VVMA 3OW1A 2GQFA 3UKAA 3ICTA 1PXBA 2JKCA 5KOXA 2GAHB 2GGHA 2Q6UA 3KPFA 3TW9A 3AMZA 1TRBA 3AE2A 3R0KA 4YSZA 4GAPA 5DBJA 7ENLA 2BACA 3ATQA 3MUCA 3L5OA 1E1NA 4JN8A 4DX3A 3DK8A 1BF3A 3SJNA 4DGKA 2WU2A 3AE7A 4IA6A 4Y4MA 2JB2A 4IVOB 5KMQA 4KPLA 2GV8A 2PODA 2XFPA 2YR6A 3VRBA 3GSIA 2OO6A 4JN7A 1W6TA 2RDXA 2QAEA 4EQWA 4K8DA 3UJSA 2W3SA 1NEKA 3RP8A 4B67A 3SN0A 4B64A 3KPKA 1B37A 3I6TA 2XYOA 5J60A 1R0MA 1GNDA 2FJEA 2GL5A 2O9ZA 1E1KA 3AEAA 3RP7A 2O56A 1VRQB 2MNRA 1ZXIC 3VR9A 1MOKA 2B76A 2PCEA 1KSUA 3UKPA 4K2SA 1KSSA 4ROPA 4M52A 4REKA 3CPIG 3NRZB 2YM2A 1SJCA 3N4FA 2PMQA 4H4VA 3NS1B 1ZOVA 4Z25A 2WU5A 3H12A 1MXTA 1BGNA 4KX6A 3UKHA 4RG4A 2VZ2A 1MDLA 3P1WA 4KPRA 3RO6A 4A6NA 3T2ZA 1ZOYA 2Q0LA 3H8IA 4IA5A 4NEWA 2YG4A 3SY4A 1S2QA 2XH4A 3UJRA 2YWLA 1XPYA 4MMWA 4YXDA 3VQRA 1BKWA 1K0LA 2BK4A 2B9YA 2BA9A 3R07C 1HYUA 4UDPA 1JDFA 3CNJA 4H4XA 3P4SA 1TKKA 2PA6A 2GDQA 4GMEA 1CL0A 3CB3A 2W0HA 4J31A 1SJAA 1GEUA 2JB3A 4G74A 3AEEA 2I5QA 4HA6A 4AT0A 2YQUA 2ZZ0A 4CRTA 3UP5A 4IP4A 1XANA 2JAEA 3UCCA 4DNAA 4EMWA 3EPTA 3ZVHB 1TYTA 2WQYA 2C4CA 4A5LA 2XLSA 2VRLA 4I58A 3CPHG 1JPMA 4X9NA 3R1ZA 5HHFA 2AR8A 2GVCA 4YT0A 4J2WA 2WOIA 4OPIA 3CYJA 1JRXA 2YLXA 3HRDC 4C3XA 3VRAA 4DSGA 2YLRA 4BK2A 5JCLA 3AYIA 5KOWA 3PK7A 1EL7A 3P0WA 4BURA 4H4SA 1GRBA 5KMSA 1NPXA 4C74A 3HZLA 4JY3A 1EBDA 3Q9TA 4O5UA 2GB0A 1PBBA 3DG6A 3GYJA 4ZA0A 3UKFA 3UOZA 2PTZA 4BK1A 3NTDA 2B7RA 4A6GA 4BJYA 3H4KA 5GSNA 5U63A 3LADA 1OJDA 1ELIA 4H7UA 1MNSA 4Z43A 3OZYA 1YQ3A 2YG5A 3ADAB 1H6VA 3I6DA 5FMHA 2GRTA 3AE3A 3S5WA 1M64A 1KN0A 3GO2A 3AE1A 3UOYA 3QSEA 3SX6A 3D46A 1B8SA 2XLRA 1H84A 3ETRB 5C2TA 1SJDA 3H70A 3K7TA 3CNTA 3SZFA 4E8GA 1IUUA 1JRZA 3ZLHA 2R0CA 2A8XA 3ZVHA 4YTPA 3DA1A 3HYWA 2EQ7A 4GR1A 2MUCA 2XFNA 1NU5A 3OP2A 1T3QC 4YTMA 3NXLA 4OVIA 2GGEA 2VQ7A 3VC5A 3N6JA 2ACZA 3CGCA 3FBSA 3GDNA 2QCUA 4U8PA 3AE5A 2GSHA 1D5TA 1LV0A 3ITJA 2C65A 1EBGA 3M13A 1H2IA 3P4RA 4GGHA 3EANA 5FS7A 2WHDA 4LA1A 5EB5A 4HYRA 1LPFA 4OPDA 2VOUA 3Q6JA 2WP6A 2OALA 1KFYA 3ICSA 3OPSA 3UXKA 1BZLA 4OPUA 2V6OA 3VR8A 5KVHA 1KKOA 1TDOA 4U2SA 2BS4A 3R25A 1JRYA 3U4FA 4A3RA 3QSSA 4GDEA 4EMIA 5BRTA 2WBAA 3TOYA 1QLBA 5BUKA 4Z2UA 4J34A 4ECHA 3BOXA 3OZMA 5BULA 1BKHA 3KU9A 4HPNA 4TVWA 1ZDLA 5HXIA 2HQMA 3NT6A 4M0XA 2PTWA 3Q4DA 3N4EA 2AQJA 3VDGA 3T9PA 3COXA 2OQYA 1RSGA 3ZDNA 1XS2A 4EIQA 4EM3A 1KNRA 1TYPA 2GH5A 2TMDA 3GRSA 4YWOA 1B4VA 3UOVA 1S3BA 5FS6A 1DOBA 1RVKA 1RM6B 2B9XA 4GAVA 4B1BA 4O5QA 3ATRA 2C76A 3B6DA 1M6IA 2CULA 1N4VA 3GD3A 3UGVA 4Z44A 3FJ4A 1NENA 1IJHA 2EQ8A 2YVFA 4FK1A 3UTGA 4J56A 2C73A 4IVMB 2UZZA 2PU1A 5IPYA 3CN8A 2XCGA 4G9KA 1P2EA 1F8RA 2CVJA 3CTYA 3NO1A 4YSHA 4H50A 4OPLA 2QVHA 3MZNA 1F8SA 2ZC8A 1W4XA 2PSNA 3UJFA 1JEHA 4H19A 1IYXA 4ZCCA 2YR4A 1CC2A 4EQXA 5C3JA 4CCRA 2GR1A 1H7XA 2ARDA 4NWZA 5FS8A 4H83A 1H86A 2A89A 2XLPA 3CPJG 6ENLA 2WDQA 3QLDA 3QN3A 1PBDA 1N4WA 4H4ZA 4LU6A 1PDZA 2R4JA 1ONEA 3P4QA 3VFCA 2VRMA 4KWSA 1CJ2A 2WPFA 3HYXA 3IWAA 2VVLA 1PDYA 4CNKA 1FEBA 4RG3A 3GDPA 3RRAA 2B9WA 2APGA 1DNCA 2E5AA 3IJQA 2DKIA 2YLSA 4NTDA 3HYVA 1NAAA 1GETA 3NGCX 1GRTA 3A7AA 2Y6QA 2C70A 3AEFA 3NN6X 1XHCA 1IUSA 3H8AA 1FEAA 1E1LA 1L9CA 1PBCA 2QGYA 1O94A 2C72A 3NH3X 4H2NA 2YR5A 3NHOX 4H1ZA 1D7YA 1SB3B 3DGBA 4FP1A 3VCNA 3UTHA 1EL5A 3RNMA 4U8IA 3GYXA 1EC7A 4P9SA 2AL2A 3MSYA 1DTNA 2XVHA 2FJBA 2Q7VA 3LZWA 2OPJA 4J36A 3TWAA 3SFEA 2Q0KA 3LJPA 4FI4A 3UKLA 1BGJA 2W54A 5KWFA 3MY9A 3NVVB 2AKMA 2XFQA 3JZUA 3QVPA 4CBQA 2DKHA 2FYMA 3FVDA 1UKVG 2XLTA 4UDQA 2OZTA 1EC8A 2WDVA 1GESA 1DODA 1MUCA 5KXJA 3PO7A 3AYLA 4HCLA 3AECA 5BVAA 2QDDA 2YG7A 4GIRA 2OZ8A 2RGOA 1OJ9A 1YEYA 2Y6RA 3BSMA 4NEVA 3DGZA 3ALLA 2PS2A 1PHHA 3NG7X 3V3NA 4X4JA 5J7XA 1PXCA 3REDA 4U2LA 4H4RA 1RYIA 2QJMA 1N61C 2FJAA 1PS9A 4DN1A 1PXAA 3V5FA 5CKUA 4U8OA 3AYJA 2C75A 5FJRA 1TE6A 3NIXA 2OLAA 4B69A 3VC6A 3TTEA 3SXIA 1K0JA 3TQPA 4OCGA 3EEZA 4PABA 1F9CA 3AD9B 4E0VA 1RP0A 2WDRA 2BCGG 4JHMA 1GRFA 4GFIA 5HYMA 2GGIA 1PN0A 1Y56B 2OVLA 3S47A 3AM9A 4GF7A 3SBFA 3RR1A 4YWSA 3T37A 2POZA 2BCPA 4A65A 2WPCA 2J3NA 2BXSA 1PJ7A 4ZCWA 5KMPA 2ZADA 1EL9A 3SYIA 1LJ1A 4CY6A 2PTXA 4Z1YA 3L1RA 4NTCA 1GRHA 4D03A 1N63C 3T8QA 5BOFA 2CFYA 1SJBA 3D1CA 3KKJA 3DFYA 4F4RA 1GOSA 2WETA 3PWIA 5J04A 3SSZA 2WESA 3R9UA 2R45A 4JNAA 1N4UA 3H8LA 1PBEA 3N6HA 3QFBA 3SZ0A 3UTEA 5JCIA 1CJCA 1PDHA 3D47A 1OEPA 3DJDA 3FMWA 1F3PA 1CBOA 1JROA 1K4QA 1X2HA 2P3ZA 3ES8A 3GMBA 4U8LA 4E6MA 2OQHA 3UOXA 2X8CA 2X3NA 3FPZA 3T6CA 4EWJA 3M12A 3CT2A 3DJJA 4H4TA 1YQZA 3WE0A 2P8CA 3I4KA 4A35A 2PHHA 3ZVIA 3G5QA 4ADWA 1QJDA 4U8MA 2JK6A 3AE8A 1YY5A 5FJOA 3EUB3 5JRBA 1PJ5A 2OKTA 1Y56A 3IJIA 5ER0A 3THUA 1N1PA 3NTAA 4GYPC 1EC9A 5U1OA 1DXLA 3DESA 3ZLFA 5JCNA 3AB1A 2ZZBA 3C4AA 3K7MX 2XLUA 2E3TA 4M6UA 3F8PA 4IP5A 2R0PA 4JN9A 1X31B 4XWRA 1NHPA 3JVAA 1BWCA 4GGBA 5FJUA 3T2YA 4H4QA 3ZYXA 1QO8A 2BABA 3RITA 3V76A 2RGJA 3KLJA 3FXGA 1X2GA 1KD0A 3ES7A 5CQFA 4GDPA 3LOVA 1FOHA 2AAQA 3M0OA 2E5VA 1S3EA 3CXOA 1D7LA 2JB1A 4C5OA 1GTEA 1TDKA 2R4EA 1MRAA 1H81A 5IQ1A 4CY8A 2XH0A 1PJ6A 3GD6A 3DH9A 2X50A 4G73A 2R9ZA 2A87A 3NVYB 3AE6A 3B97A 4J1OA 3SM8A 4J33A 2OLNA 3K30A 2OA1A 2C3DA 4IHCA 3UKKA 2YAUA 1MDRA 2JBVA 2QA1A 5IDZA 3PWGA 4PAAA 2BS2A 3QTPA 1DOCA 3K7QX 4YSYA 2GEWA 2YVGA 1FFVC 1LTXR 2YG3A 3AEGA 2P0IA 3SZWA 2OFJA 1Y0PA 4AOXA 3PVCA 4XXGA 2GGGA 3NKSA 1FECA 5M0ZA 3L8KA 4H2RA 4B63A 1P48A 1N5XA 2Z5YA 4Z2RA 3ALJA 4A79A 3CNSA 4A7AA 1NHSA 3D9XA 4H2QA 1GV4A 4IV9A 1D4DA 2GR0A 2CHRA 3IF9A 2HZGA 2C64A 4BJZA 3GRTA 4X2PA 3I6EA 4E4FA 3V4BA 1H7WA 1F6MA 1GERA 3URHA 3SFDA 4B65A 5L46A 4D04A 3CNDA 1REOA 4BV6A 2XVJA 5FS9A 1KCZA 1L8PA 4E4UA 2OLOA 1MO9A 2VVLG 2C67A 3GD4A 2X8GA 1EBHA 4FDCB 5EOWA 2WP9A 4G7FA 2EQ9A 1YKJA 1CJ3A 3JSKA 4YKFA 4IL2A 1DJNA 2X99A 2V3AA 3EKGA 1XDIA 3C4NA 1Q1RA 3VRDB 1ZKQA 2XVIA 4TM3A 2OX4A 2YM1A 3CGDA 3HPFA 2GMHA 4HNLA 4J57A 1EL8A 2YVJA 1COYA 2C66A 3SN4A 4ENLA 3E1TA 4J3ZA 2TPRA 3UKQA 2XDOA 2XH2A 3AE4A 3DJGX 3TWBA 1AOGA 3V3WA 1LVLA 1VDCA 3BNMA 3C96A 2V3BA 3SZCA 1JCTA 4MKSA 2AL1A 3ALMA 1WUFA 2ZBWA 1GREA 3TJIA 5JCMA 3K1GA 5JCKA 2I0ZA 4IL0A 4B68A 2V61A 1FFUC 1B5QA 4APNA 4HNCA 1IUVA 1NHRA 4Z17A 2XGZA 4IT1A 1L9DA 4FX9A 3NYFA 2FJDA 5ENLA 1P43A 5FJPA 3GWDA 2PP3A 2DW7A 2FBWA 2V60A 1GXFA 2YLZA 2GAGB 1OJCA 4B66A 2PTYA 3NYCA 3NNEA 2XH7A 5FJTA 3ZLGA 5LV9A 4E5TA 4A6NB 5IQ4A 3SQSA 4FK1C 3JW7A 4H2HA 4C77A 1E9IA 4G8TA 3DDMA 2PGWA 2P88A 2BYBA 1DJQA 2WEUA 2NVKX 3UXLA 1R6WA 3OC4A 3SGLA 5KRQA 3NK1X 3GY1A 4CCQA 1CC4A 4DYEA 3NN0X 2BC0A 4YSXA 1V97A 3NVWB 4YKGA 1F8WA 2ONEA 3BHKA 4Y4NA 4K7ZA 4H4UA 3CMMA 4EIPA 1ZY8A 4U8KA 2HXUA 3A7RA 3DMEA 4U8NA 3EF6A 3RGTA 2BS3A 5EU9A 3VCCA 3GC2A 3II4A 2WS3A 5EBKA 2GF3A 1JNZA 2C3CA 1GSNA 3SN1A 2AKZA 3U9IA 4AOSA 3UJ2A 3SQPA 3IK4A 3CIRA 2QJJA 2R0GA 3MQTA 3PS9A 3NVZB 3IHGA 4GUVA 2W55A 2GGJA 4JQ9A 4TLXA 2H89A 3DK4A 4HN8A 2OAMA 3KVEA 1GT8A 3O0HA 3P9UA 4N9XA 3AD7B 4A9WA 1D4CA 3AEDA 1SEZA 4DSHA 1GPEA 4Z26A 2PP1A 1E39A 4GCMA 1ZP0A 1TDEA 5TR3A 1NELA 1KKRA 4TLZA 2WOWA 5G5GB 3AEBA 2X8HA 3HW2A 4OPTA 3PFRA 4GYPA 4LIIA 1K0IA 3TCSA 3NLCA 3DGHA 1LQUA 4K2XA 1FCDA 4EM4A 3UTFA 5KMRA 3DFHA 2IVDA 1CJ4A 3G5SA 1DOEA 3DG3A 1V59A 3DK9A 4TM0A 3D8XA 1ZK7A 1O5WA 3FYYA 3NFUA 4K5SA 3R0UA 3V3OA 3IHMA 2CDUA 2Z5XA 4K22A 3GMCA 2DW6A 1NDAA 4DXKA 2RGHA 4G6HA 3QKEA 3UP4A 2EQ6A 1E7PA 5KVIA 2OZ3A 1FL2A 2BC1A 3T2KA 1YQ4A 4OPGA 4GISA 3TJ4A 1TZZA
chains in the Genus database with same CATH topology
1B37A 2YR4A 1CC2A 4EQXA 2XYOA 5C3JA 4CCRA 2GR1A 1H7XA 2ARDA 4NWZA 5J60A 1GNDA 2FJEA 5FS8A 3AE6A 3SM8A 2O9ZA 4J33A 1E1KA 2OLNA 3AEAA 1KDGA 3RP7A 3K30A 1H86A 3LB8A 2OA1A 2C3DA 1VRQB 2A89A 4BK3A 2XLPA 3CPJG 2WDQA 4USQA 3UKKA 2YAUA 1MOKA 3VR9A 1PBDA 2B76A 2JBVA 1N4WA 1PBFA 4H4ZA 4LU6A 1Z6LA 2R4JA 1KSUA 3UKPA 2QA1A 1KSSA 3CNPA 3P4QA 4PAAA 2VRMA 1KF6A 4M52A 2BS2A 4AP1A 4YSYA 1DOCA 3K7QX 1CJ2A 4EQRA 2WPFA 3HYXA 3IWAA 2GEWA 3GWFA 2VVLA 4REKA 2WPEA 2YVGA 3CPIG 1FEBA 4ZCDA 4RG3A 4H4YA 4CNKA 3GDPA 2YM2A 4H4PA 1LTXR 2B9WA 4H4WA 2APGA 4C3YA 1DNCA 3CGEA 4H4VA 2DKIA 3AXBA 2YLSA 2YG3A 3AEGA 4NTDA 1ZOVA 4Z25A 2BK3A 2WU5A 3HYVA 1NAAA 2C7GA 1GETA 3NGCX 1MXTA 1BGNA 3SZWA 4KX6A 1Y0PA 1L9EA 3UKHA 1GRTA 1JOAA 2Y6QA 4RG4A 2C70A 2VZ2A 3QVRA 4NNJA 3P1WA 4AOXA 3AEFA 4KPRA 3PVCA 4XXGA 4A6NA 3T2ZA 3NN6X 4AT2A 3NKSA 1ZOYA 2Q0LA 1FECA 3H8IA 1XHCA 1IUSA 4IA5A 5M0ZA 4NEWA 1FEAA 1E1LA 2YG4A 1ZMCA 4NTEA 2E1MA 3L8KA 5GRTA 2E4GA 1L9CA 1PBCA 4H2RA 1O94A 3QJ4A 4RSLA 2C72A 4B63A 3SY4A 1S2QA 4UP3A 3ICRA 3NH3X 4H2NA 2YR5A 2Z5YA 3GYIA 3NHOX 3ALJA 4Z2RA 2YWLA 3QFAA 4A79A 1VG9A 4EMJA 3CNSA 4A7AA 2BK5A 4YXDA 1NHSA 1D7YA 3D9XA 4H2QA 3VQRA 1GV4A 4IV9A 3UTHA 1D4DA 2GR0A 1EL5A 1BKWA 3RNMA 1K0LA 2BK4A 4U8IA 4HB9A 1GALA 3GYXA 4P9SA 2B9YA 1CF3A 4CNJA 3IF9A 4I59A 2BA9A 2C64A 4BJZA 1HYUA 4UDPA 3GRTA 3PG6A 2XVHA 2FJBA 4GRTA 2Q7VA 2YLTA 3CNJA 3LZWA 4H4XA 3P4SA 1H7WA 1F6MA 4J36A 1GERA 1CL0A 3URHA 3SFEA 3SFDA 2W0HA 4J31A 1GEUA 4OPCA 2Q0KA 3LJPA 2JB3A 3UKLA 1BGJA 3DJEA 4G74A 4B65A 2XVEA 3AEEA 5L46A 2RABA 3QSMA 2XVFA 4HA6A 4D04A 4AT0A 5KWFA 2YQUA 1REOA 3CNDA 2ZZ0A 4BV6A 2XVJA 5FS9A 2XFQA 2YLWA 4CRTA 1NG4A 3QVPA 3UP5A 1XANA 2JAEA 2OLOA 1MO9A 4DNAA 3AWIA 4H2PA 4Z24A 4CBQA 2DKHA 2VVLG 4EMWA 3EPTA 1TYTA 3GD4A 2C67A 2X8GA 4FDCB 1UKVG 5EOWA 2WP9A 2BRAA 2WQYA 2EQ9A 1YKJA 2XLTA 1CJ3A 3JSKA 2C4CA 4UDQA 4YKFA 1IUTA 2WDVA 4Y4LA 1CC6A 1DJNA 4A5LA 2X99A 1GESA 1DODA 2XLSA 2VRLA 4I58A 3CPHG 2V3AA 2WP5A 5KXJA 1ZX9A 1XDIA 4MJWA 3PO7A 3AYLA 3C4NA 4X9NA 1E6EA 1Q1RA 1VG0A 3VRDB 5HHFA 3AECA 1S2YA 2AR8A 2GVCA 1ZKQA 4YT0A 4EQSA 2XVIA 4J2WA 5BVAA 2WOIA 4TM3A 2YG7A 4OPIA 4WCTA 2YM1A 1JRXA 3I3LA 2XFUA 2YLXA 1LQTA 2RGOA 1OJ9A 4C3XA 3CGDA 4II2A 5HY5A 3VRAA 4DSGA 2GMHA 2YLRA 1E1MA 3P4PA 4J57A 1EL8A 2VQBA 2Y6RA 4NEVA 1TDFA 2YVJA 1COYA 2C66A 5JCLA 3AYIA 4BK2A 5KOWA 3DGZA 3ALLA 3FIMB 1EL7A 1PHHA 5M10A 3NG7X 3E1TA 1ONFA 3NK2X 2TPRA 4BURA 1NG3A 3UKQA 3V3NA 4UDRA 4ZN0A 4H4SA 4X4JA 2XDOA 3AE4A 3DJGX 4AP3A 1AOGA 2IIDA 1GRBA 5KMSA 1LVLA 1O95A 1PXCA 5J7XA 3REDA 4U2LA 1VDCA 1NPXA 3BNMA 3C96A 4C74A 3HZLA 2V3BA 4JY3A 2F5ZA 1EBDA 4H4RA 3Q9TA 1RYIA 4O5UA 2GQWA 3SZCA 2FJAA 2GB0A 3FG2P 1PS9A 1D4EA 1PBBA 3ALMA 2ZBWA 1TDNA 1GREA 1PXAA 3GYJA 5CKUA 3UKFA 5JCMA 2I0ZA 5JCKA 3T0KA 4U8OA 3UOZA 3AYJA 4II3A 4B68A 2GR3A 4BK1A 2V61A 3NTDA 2B7RA 3ISHA 3IC9A 2C75A 1GRAA 1B5QA 2V5ZA 4BJYA 1Q1WA 3CGBA 3H4KA 3NIXA 4APNA 5GSNA 5U63A 2QA2A 3LADA 1S7MA 4B69A 1IUVA 1NHRA 1IUXA 1OJDA 1L9DA 1ELIA 4FX9A 3NYFA 4H7UA 2FJDA 3SXIA 1VQWA 4Z43A 1K0JA 1JNRA 3GWDA 4OCGA 1P2HA 1CHUA 4XWZA 3G5RA 2FBWA 3OZ2A 2V60A 1GXFA 1YQ3A 2YG6A 2YG5A 2YLZA 4PABA 3AD9B 3ADAB 3RP6A 4E0VA 1H6VA 3I6DA 5FMHA 1OJTA 2GRTA 1RP0A 1M64A 2WDRA 3AE3A 3S5WA 2GAGB 1OJCA 3RHAA 4B66A 1KN0A 2BCGG 1GRFA 1GTHA 5HYMA 3NYCA 2BRYA 3AE1A 1PN0A 3NNEA 3UOYA 3QSEA 3SX6A 1Y56B 1L0VA 3S61A 1B8SA 2XLRA 1H84A 3AE9A 5C2TA 4GF7A 4C77A 5LV9A 3K7TA 3CNTA 3SZFA 4A6NB 4Z2TA 1IUUA 1JRZA 5IQ4A 2XFOA 2R0CA 2A8XA 3BNUA 4YTPA 3DA1A 3HYWA 2EQ7A 4FK1C 3T37A 2BCPA 3NYEA 4A65A 4GR1A 1OJAA 2WPCA 2J3NA 2BXSA 2XFNA 2R46A 3ABVA 3BI5A 4TM4A 5U25A 1PJ7A 3LXDA 5KMPA 1EL9A 1Q9IA 3LZXA 3SYIA 3AD8B 1LJ1A 4CY6A 2BYBA 1DJQA 2WEUA 1ZMDA 3L1RA 2NVKX 4NTCA 4YTMA 4OVIA 2VQ7A 3OC4A 1GRHA 3SGLA 5KRQA 2ACZA 3NK1X 4D03A 4CCQA 1CC4A 3EAOA 3CGCA 3NN0X 2BC0A 2CFYA 2NPXA 3D1CA 4YSXA 3FBSA 3KKJA 3GDNA 2QCUA 4U8PA 3AE5A 2PYXA 1F8WA 1D5TA 4YKGA 1GOSA 1LV0A 3BHKA 2C65A 3ITJA 4Y4NA 2WETA 1H83A 3M13A 4K7ZA 4H4UA 3CMMA 3F8DA 1H2IA 4EIPA 1ZY8A 4U8KA 5KNLA 3KA7A 2GMJA 3B3RA 3P4RA 3EANA 5FS7A 2WESA 4USRA 3R9UA 1XPQA 2R45A 3DMEA 2WHDA 4LA1A 4JNAA 5EB5A 4U8NA 3EF6A 2BS3A 3F8RA 1N4UA 1LPFA 3H8LA 1PBEA 4OPDA 3QFBA 4U2TA 2WOVA 2VOUA 3Q6JA 3SZ0A 4NZHA 4A99A 2ZZCA 2WP6A 2B7SA 1GRGA 2OALA 3UTEA 5JCIA 1CJCA 1JU2A 1PDHA 1KFYA 4JY2A 4ICYA 3ICSA 3DJDA 4WX1A 3FMWA 3T14A 3II4A 2WS3A 1F3PA 2IVEA 1H82A 1CBOA 1BZLA 4OPUA 1K4QA 2V6OA 5EBKA 4U8JA 3VR8A 2GF3A 3BI2A 1JNZA 2C3CA 3GMBA 1GSNA 5KVHA 4U8LA 1TDOA 3UOXA 4U2SA 2BS4A 2X8CA 4TM1A 1JRYA 2X3NA 4AOSA 3FPZA 1KNPA 3M12A 3QSSA 4GDEA 4EMIA 3DJJA 4H4TA 2BXRA 5BRTA 1YQZA 3SQPA 2WBAA 3BI4A 2GR2A 3WE0A 3CIRA 2PHHA 3G5QA 2R0GA 4ADWA 4JNQA 1QJDA 1QLBA 3PS9A 1NHQA 4YTNA 4Z2UA 4U8MA 3IHGA 4GUVA 5EB4A 5BUKA 3UCLA 2JK6A 4JQ9A 3AE8A 3NRNA 4J34A 1YY5A 4TLXA 4ECHA 3NK0X 4JDRA 4G6GA 1IUWA 5JRBA 3KD9A 2H89A 3BHFA 3DK4A 1PJ5A 2OAMA 2H88A 3KVEA 5BULA 1GT8A 3O0HA 1Y56A 3P9UA 4X9MA 3KU9A 4N9XA 3AD7B 3T31A 5ER0A 4K5RA 2VVMA 1N1PA 4A9WA 3NTAA 1ZDLA 1DXLA 5U1OA 1D4CA 3AEDA 2GQFA 2HQMA 5HXIA 3NT6A 3UKAA 5JCNA 1SEZA 4DSHA 1GPEA 3ICTA 3AB1A 4Z26A 1PXBA 2ZZBA 2JKCA 3C4AA 3K7MX 2XLUA 2AQJA 5KOXA 1E39A 2GAHB 3COXA 2Q6UA 4GCMA 1ZP0A 1TDEA 1RSGA 3KPFA 3ZDNA 5TR3A 3F8PA 2WOWA 4EM3A 1KNRA 2R0PA 3AEBA 2X8HA 4JN9A 4TLZA 1TYPA 4EIQA 1X31B 4OPTA 1TRBA 3AE2A 1NHPA 4XWRA 1BWCA 2GH5A 2TMDA 3GRSA 4YSZA 4GAPA 4YWOA 1B4VA 4LIIA 5DBJA 1K0IA 3T2YA 3UOVA 4H4QA 2BACA 3ZYXA 3NLCA 3ATQA 3DGHA 1S3BA 5FS6A 1QO8A 2BABA 1LQUA 4K2XA 3V76A 1DOBA 3L5OA 3KLJA 1E1NA 1FCDA 4EM4A 2RGJA 2B9XA 4GAVA 3UTFA 5KMRA 4B1BA 4O5QA 3DK8A 3ATRA 1BF3A 2C76A 2IVDA 1CJ4A 1M6IA 1DOEA 3B6DA 3G5SA 5CQFA 4DGKA 2WU2A 3AE7A 3LOVA 4GDPA 1FOHA 2CULA 1V59A 3DK9A 2AAQA 1N4VA 4TM0A 3D8XA 3GD3A 1ZK7A 4Z44A 1NENA 1O5WA 3M0OA 1IJHA 2E5VA 4IA6A 2EQ8A 2YVFA 4Y4MA 1S3EA 1D7LA 2JB1A 4FK1A 2JB2A 4IVOB 4K5SA 5KMQA 4C5OA 2GV8A 2XFPA 3UTGA 4J56A 1GTEA 1TDKA 2C73A 2R4EA 2UZZA 4IVMB 3V3OA 2YR6A 3VRBA 3IHMA 2CDUA 3GSIA 2Z5XA 4K22A 3CN8A 3GMCA 5IPYA 2XCGA 1NDAA 2RGHA 1H81A 4G9KA 1P2EA 1F8RA 5IQ1A 4CY8A 2CVJA 3CTYA 4G6HA 4YSHA 1PJ6A 2QAEA 4H50A 4OPLA 3DH9A 4EQWA 4K8DA 3UP4A 2X50A 2EQ6A 1E7PA 5KVIA 4G73A 1NEKA 2R9ZA 1F8SA 3RP8A 1FL2A 2BC1A 4B67A 3T2KA 1W4XA 1YQ4A 4OPGA 4B64A 1JEHA 3KPKA 4ZCCA 2A87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B37 A;  2YR4 A;  1CC2 A;  4EQX A;  2XYO A;  5C3J A;  4CCR A;  2GR1 A;  1H7X A;  2ARD A;  5J60 A;  1GND A;  2FJE A;  5FS8 A;  3AE6 A;  3SM8 A;  2O9Z A;  4J33 A;  1E1K A;  2OLN A;  3AEA A;  1KDG A;  3RP7 A;  3K30 A;  1H86 A;  3LB8 A;  2OA1 A;  2C3D A;  1VRQ B;  2A89 A;  4BK3 A;  2XLP A;  3CPJ G;  2WDQ A;  4USQ A;  3UKK A;  2YAU A;  1MOK A;  3VR9 A;  1PBD A;  2B76 A;  2JBV A;  1N4W A;  1PBF A;  4H4Z A;  4LU6 A;  1Z6L A;  2R4J A;  1KSU A;  3UKP A;  2QA1 A;  1KSS A;  3CNP A;  3P4Q A;  4PAA A;  2VRM A;  1KF6 A;  4M52 A;  2BS2 A;  4AP1 A;  4YSY A;  1DOC A;  3K7Q X;  1CJ2 A;  4EQR A;  2WPF A;  3IWA A;  2GEW A;  3GWF A;  2VVL A;  4REK A;  2WPE A;  2YVG A;  3CPI G;  1FEB A;  4ZCD A;  4RG3 A;  4H4Y A;  4CNK A;  3GDP A;  2YM2 A;  4H4P A;  1LTX R;  2B9W A;  4H4W A;  2APG A;  4C3Y A;  1DNC A;  3CGE A;  4H4V A;  2DKI A;  3AXB A;  2YLS A;  2YG3 A;  3AEG A;  4NTD A;  1ZOV A;  4Z25 A;  2BK3 A;  2WU5 A;  1NAA A;  2C7G A;  1GET A;  3NGC X;  1MXT A;  1BGN A;  4KX6 A;  1Y0P A;  1L9E A;  3UKH A;  1GRT A;  1JOA A;  2Y6Q A;  4RG4 A;  2C70 A;  2VZ2 A;  3QVR A;  4AOX A;  3P1W A;  3AEF A;  4KPR A;  3PVC A;  4XXG A;  4A6N A;  3NN6 X;  4AT2 A;  3NKS A;  1ZOY A;  2Q0L A;  1FEC A;  3H8I A;  1XHC A;  1IUS A;  4IA5 A;  5M0Z A;  4NEW A;  1FEA A;  1E1L A;  2YG4 A;  1ZMC A;  4NTE A;  2E1M A;  3L8K A;  5GRT A;  2E4G A;  1L9C A;  1PBC A;  4H2R A;  1O94 A;  3QJ4 A;  4RSL A;  2C72 A;  4B63 A;  1S2Q A;  4UP3 A;  3ICR A;  3NH3 X;  4H2N A;  2YR5 A;  2Z5Y A;  3GYI A;  3NHO X;  3ALJ A;  4Z2R A;  2YWL A;  3QFA A;  4A79 A;  1VG9 A;  4EMJ A;  3CNS A;  4A7A A;  2BK5 A;  4YXD A;  1NHS A;  1D7Y A;  4H2Q A;  3VQR A;  1GV4 A;  4IV9 A;  3UTH A;  1D4D A;  2GR0 A;  1EL5 A;  1BKW A;  3RNM A;  1K0L A;  2BK4 A;  4U8I A;  4HB9 A;  1GAL A;  4P9S A;  2B9Y A;  1CF3 A;  4CNJ A;  3IF9 A;  4I59 A;  2BA9 A;  2C64 A;  4BJZ A;  1HYU A;  4UDP A;  3GRT A;  2XVH A;  2FJB A;  4GRT A;  2Q7V A;  2YLT A;  3CNJ A;  3LZW A;  4H4X A;  3P4S A;  1H7W A;  1F6M A;  4J36 A;  1GER A;  1CL0 A;  3URH A;  3SFE A;  3SFD A;  2W0H A;  4J31 A;  1GEU A;  4OPC A;  2Q0K A;  3LJP A;  2JB3 A;  3UKL A;  1BGJ A;  3DJE A;  4B65 A;  2XVE A;  3AEE A;  5L46 A;  2RAB A;  3QSM A;  2XVF A;  4HA6 A;  4D04 A;  4AT0 A;  5KWF A;  2YQU A;  1REO A;  3CND A;  2ZZ0 A;  4BV6 A;  2XVJ A;  5FS9 A;  2XFQ A;  2YLW A;  4CRT A;  1NG4 A;  3QVP A;  3UP5 A;  1XAN A;  2JAE A;  2OLO A;  1MO9 A;  4DNA A;  3AWI A;  4H2P A;  4Z24 A;  4CBQ A;  2DKH A;  2VVL G;  4EMW A;  3EPT A;  1TYT A;  3GD4 A;  2C67 A;  2X8G A;  4FDC B;  1UKV G;  5EOW A;  2WP9 A;  2WQY A;  2EQ9 A;  1YKJ A;  2XLT A;  1CJ3 A;  3JSK A;  4UDQ A;  4YKF A;  1IUT A;  2WDV A;  4Y4L A;  1CC6 A;  1DJN A;  4A5L A;  2X99 A;  1GES A;  1DOD A;  2XLS A;  2VRL A;  4I58 A;  3CPH G;  2V3A A;  2WP5 A;  5KXJ A;  1ZX9 A;  1XDI A;  4MJW A;  3PO7 A;  3AYL A;  3C4N A;  4X9N A;  1E6E A;  1Q1R A;  1VG0 A;  3VRD B;  5HHF A;  3AEC A;  1S2Y A;  2AR8 A;  2GVC A;  1ZKQ A;  4YT0 A;  4EQS A;  2XVI A;  4J2W A;  5BVA A;  2WOI A;  4TM3 A;  2YG7 A;  4OPI A;  4WCT A;  2YM1 A;  1JRX A;  3I3L A;  2XFU A;  2YLX A;  1LQT A;  2RGO A;  1OJ9 A;  4C3X A;  3CGD A;  5HY5 A;  3VRA A;  4DSG A;  2GMH A;  2YLR A;  1E1M A;  3P4P A;  4J57 A;  1EL8 A;  2VQB A;  2Y6R A;  4NEV A;  1TDF A;  2YVJ A;  1COY A;  2C66 A;  5JCL A;  3AYI A;  4BK2 A;  5KOW A;  3DGZ A;  3ALL A;  3FIM B;  1EL7 A;  1PHH A;  5M10 A;  3NG7 X;  3E1T A;  1ONF A;  3NK2 X;  2TPR A;  4BUR A;  1NG3 A;  3UKQ A;  3V3N A;  4UDR A;  4ZN0 A;  4H4S A;  4X4J A;  2XDO A;  3AE4 A;  3DJG X;  4AP3 A;  1AOG A;  2IID A;  1GRB A;  1LVL A;  1O95 A;  1PXC A;  5J7X A;  3RED A;  4U2L A;  1VDC A;  1NPX A;  3BNM A;  3C96 A;  4C74 A;  3HZL A;  2V3B A;  4JY3 A;  2F5Z A;  1EBD A;  4H4R A;  3Q9T A;  1RYI A;  4O5U A;  2GQW A;  2FJA A;  2GB0 A;  3FG2 P;  1PS9 A;  1D4E A;  1PBB A;  3ALM A;  2ZBW A;  1TDN A;  1GRE A;  1PXA A;  3GYJ A;  5CKU A;  3UKF A;  5JCM A;  2I0Z A;  5JCK A;  3UOZ A;  4U8O A;  3AYJ A;  4B68 A;  2GR3 A;  4BK1 A;  2V61 A;  3NTD A;  2B7R A;  3ISH A;  3IC9 A;  2C75 A;  1GRA A;  1B5Q A;  2V5Z A;  4BJY A;  1Q1W A;  3CGB A;  3H4K A;  3NIX A;  4APN A;  5GSN A;  5U63 A;  2QA2 A;  3LAD A;  4B69 A;  1IUV A;  1NHR A;  1IUX A;  1OJD A;  1L9D A;  1ELI A;  4FX9 A;  3NYF A;  4H7U A;  2FJD A;  1VQW A;  4Z43 A;  1K0J A;  1JNR A;  3GWD A;  4OCG A;  1P2H A;  1CHU A;  4XWZ A;  3G5R A;  2FBW A;  3OZ2 A;  2V60 A;  1GXF A;  1YQ3 A;  2YG6 A;  2YG5 A;  2YLZ A;  4PAB A;  3AD9 B;  3ADA B;  3RP6 A;  4E0V A;  1H6V A;  3I6D A;  5FMH A;  1OJT A;  2GRT A;  1RP0 A;  1M64 A;  2WDR A;  3AE3 A;  3S5W A;  2GAG B;  1OJC A;  3RHA A;  4B66 A;  2BCG G;  1GRF A;  1GTH A;  5HYM A;  3NYC A;  3AE1 A;  1PN0 A;  3NNE A;  3UOY A;  3QSE A;  1Y56 B;  1L0V A;  3S61 A;  1B8S A;  2XLR A;  1H84 A;  3AE9 A;  5C2T A;  4GF7 A;  4C77 A;  5LV9 A;  3K7T A;  3CNT A;  4A6N B;  4Z2T A;  1IUU A;  1JRZ A;  5IQ4 A;  2XFO A;  2R0C A;  2A8X A;  3BNU A;  4YTP A;  3DA1 A;  4FK1 C;  2EQ7 A;  3T37 A;  2BCP A;  3NYE A;  4A65 A;  4GR1 A;  1OJA A;  2WPC A;  2J3N A;  2BXS A;  2XFN A;  2R46 A;  3ABV A;  3BI5 A;  4TM4 A;  5U25 A;  1PJ7 A;  3LXD A;  1EL9 A;  1Q9I A;  3LZX A;  3AD8 B;  1LJ1 A;  4CY6 A;  2BYB A;  1DJQ A;  2WEU A;  1ZMD A;  3L1R A;  2NVK X;  4NTC A;  4YTM A;  4OVI A;  2VQ7 A;  3OC4 A;  1GRH A;  3SGL A;  5KRQ A;  2ACZ A;  3NK1 X;  4D03 A;  4CCQ A;  1CC4 A;  3EAO A;  3CGC A;  3NN0 X;  2BC0 A;  2CFY A;  2NPX A;  3D1C A;  4YSX A;  3FBS A;  3KKJ A;  3GDN A;  2QCU A;  4U8P A;  3AE5 A;  2PYX A;  1F8W A;  1D5T A;  4YKG A;  1GOS A;  1LV0 A;  3BHK A;  2C65 A;  3ITJ A;  4Y4N A;  2WET A;  1H83 A;  3M13 A;  4K7Z A;  4H4U A;  3F8D A;  4EIP A;  1ZY8 A;  4U8K A;  3KA7 A;  2GMJ A;  3B3R A;  3P4R A;  3EAN A;  5FS7 A;  2WES A;  4USR A;  3R9U A;  1XPQ A;  2R45 A;  3DME A;  2WHD A;  4LA1 A;  4JNA A;  5EB5 A;  4U8N A;  3EF6 A;  2BS3 A;  3F8R A;  1N4U A;  1LPF A;  3H8L A;  1PBE A;  4OPD A;  3QFB A;  4U2T A;  2WOV A;  2VOU A;  3Q6J A;  4NZH A;  4A99 A;  2ZZC A;  2WP6 A;  2B7S A;  1GRG A;  2OAL A;  3UTE A;  5JCI A;  1CJC A;  1JU2 A;  1PDH A;  1KFY A;  4JY2 A;  4ICY A;  3ICS A;  3DJD A;  4WX1 A;  3FMW A;  3II4 A;  2WS3 A;  1F3P A;  2IVE A;  1H82 A;  1BZL A;  1CBO A;  4OPU A;  1K4Q A;  2V6O A;  5EBK A;  4U8J A;  3VR8 A;  2GF3 A;  3BI2 A;  1JNZ A;  2C3C A;  3GMB A;  1GSN A;  5KVH A;  4U8L A;  1TDO A;  3UOX A;  4U2S A;  2BS4 A;  2X8C A;  4TM1 A;  1JRY A;  2X3N A;  4AOS A;  3FPZ A;  1KNP A;  3M12 A;  3QSS A;  4GDE A;  4EMI A;  3DJJ A;  4H4T A;  2BXR A;  5BRT A;  1YQZ A;  3SQP A;  2WBA A;  3BI4 A;  2GR2 A;  3WE0 A;  3CIR A;  2PHH A;  3G5Q A;  2R0G A;  4ADW A;  4JNQ A;  1QJD A;  1QLB A;  3PS9 A;  1NHQ A;  4YTN A;  4Z2U A;  4U8M A;  3IHG A;  4GUV A;  5EB4 A;  5BUK A;  3UCL A;  2JK6 A;  4JQ9 A;  3AE8 A;  3NRN A;  4J34 A;  1YY5 A;  4TLX A;  4ECH A;  3NK0 X;  4JDR A;  1IUW A;  3KD9 A;  2H89 A;  3BHF A;  3DK4 A;  1PJ5 A;  2OAM A;  2H88 A;  3KVE A;  5BUL A;  1GT8 A;  3O0H A;  1Y56 A;  3P9U A;  4X9M A;  3KU9 A;  4N9X A;  3AD7 B;  5ER0 A;  4K5R A;  2VVM A;  1N1P A;  4A9W A;  3NTA A;  1ZDL A;  1DXL A;  5U1O A;  1D4C A;  3AED A;  2GQF A;  2HQM A;  5HXI A;  3NT6 A;  3UKA A;  5JCN A;  1SEZ A;  4DSH A;  1GPE A;  3ICT A;  3AB1 A;  4Z26 A;  1PXB A;  2ZZB A;  2JKC A;  3C4A A;  3K7M X;  2XLU A;  2AQJ A;  5KOX A;  1E39 A;  2GAH B;  3COX A;  2Q6U A;  4GCM A;  1ZP0 A;  1TDE A;  1RSG A;  3KPF A;  3ZDN A;  5TR3 A;  3F8P A;  2WOW A;  4EM3 A;  1KNR A;  2R0P A;  3AEB A;  2X8H A;  4JN9 A;  4TLZ A;  1TYP A;  4EIQ A;  1X31 B;  4OPT A;  1TRB A;  3AE2 A;  1NHP A;  4XWR A;  1BWC A;  2GH5 A;  2TMD A;  3GRS A;  4YSZ A;  4YWO A;  1B4V A;  4LII A;  5DBJ A;  1K0I A;  3UOV A;  4H4Q A;  2BAC A;  3ZYX A;  3NLC A;  3ATQ A;  3DGH A;  1S3B A;  5FS6 A;  1QO8 A;  2BAB A;  1LQU A;  4K2X A;  3V76 A;  1DOB A;  2RGJ A;  3KLJ A;  1E1N A;  1FCD A;  4EM4 A;  2B9X A;  3UTF A;  4B1B A;  4O5Q A;  3DK8 A;  3ATR A;  1BF3 A;  2C76 A;  2IVD A;  1CJ4 A;  1M6I A;  1DOE A;  3B6D A;  3G5S A;  5CQF A;  4DGK A;  2WU2 A;  3AE7 A;  3LOV A;  4GDP A;  1FOH A;  2CUL A;  1V59 A;  3DK9 A;  2AAQ A;  1N4V A;  4TM0 A;  3D8X A;  3GD3 A;  1ZK7 A;  4Z44 A;  1NEN A;  1O5W A;  3M0O A;  1IJH A;  2E5V A;  4IA6 A;  2EQ8 A;  2YVF A;  4Y4M A;  1S3E A;  1D7L A;  2JB1 A;  4FK1 A;  2JB2 A;  4IVO B;  4K5S A;  4C5O A;  2GV8 A;  2XFP A;  3UTG A;  4J56 A;  1GTE A;  1TDK A;  2C73 A;  2R4E A;  2UZZ A;  4IVM B;  3V3O A;  2YR6 A;  3VRB A;  3IHM A;  2CDU A;  3GSI A;  2Z5X A;  4K22 A;  3CN8 A;  3GMC A;  5IPY A;  2XCG A;  1NDA A;  2RGH A;  1H81 A;  1P2E A;  1F8R A;  5IQ1 A;  4CY8 A;  2CVJ A;  3CTY A;  4YSH A;  1PJ6 A;  2QAE A;  4H50 A;  4OPL A;  3DH9 A;  4EQW A;  4K8D A;  3UP4 A;  2X50 A;  2EQ6 A;  1E7P A;  5KVI A;  1NEK A;  2R9Z A;  1F8S A;  3RP8 A;  1FL2 A;  2BC1 A;  4B67 A;  1W4X A;  1YQ4 A;  4OPG A;  4B64 A;  1JEH A;  4ZCC A;  2A87 A; 
#chains in the Genus database with same CATH topology
 1N60 C;  1ELS A;  1KDG A;  3LB8 A;  4BK3 A;  4USQ A;  3ENL A;  3DER A;  1PBF A;  3NZG A;  1Z6L A;  3CNP A;  4ZOH B;  1KF6 A;  4AP1 A;  4EQR A;  3GWF A;  2WPE A;  4ZCD A;  4H4Y A;  4H4P A;  4H4W A;  4C3Y A;  3CGE A;  3AXB A;  2BK3 A;  2QJN A;  2C7G A;  1L9E A;  1JOA A;  3FCP A;  3QVR A;  4NNJ A;  4K8G A;  3R11 A;  4AT2 A;  4IZG A;  1ZMC A;  4NTE A;  2E1M A;  5GRT A;  2E4G A;  3QJ4 A;  4RSL A;  1JPD X;  4UP3 A;  3ICR A;  2XSX A;  3GYI A;  3QFA A;  1VG9 A;  4EMJ A;  2BK5 A;  3A7U A;  4HB9 A;  1GAL A;  1CF3 A;  4CNJ A;  4I59 A;  3AN1 A;  3PG6 A;  3DEQ A;  4GRT A;  2YLT A;  3T4W A;  2PU0 A;  4OPC A;  2W3R A;  3DJE A;  2XVE A;  2RAB A;  3QSM A;  2XVF A;  3CK5 A;  3MKC A;  1FO4 A;  2YLW A;  1NG4 A;  3AWI A;  4H2P A;  4Z24 A;  3V5C A;  2PGE A;  2BRA A;  3VA8 A;  3H7V A;  1IUT A;  4Y4L A;  1CC6 A;  2NQL A;  2WP5 A;  1ZX9 A;  4MJW A;  1E6E A;  1VG0 A;  1S2Y A;  4EQS A;  4WCT A;  4DHG A;  3I3L A;  2XFU A;  1LQT A;  4II2 A;  5HY5 A;  1E1M A;  3P4P A;  2VQB A;  1TDF A;  3FIM B;  3CAW A;  5M10 A;  2QDE A;  3NK2 X;  1ONF A;  1ECQ A;  1NG3 A;  4UDR A;  4ZN0 A;  4AP3 A;  2IID A;  5G5H B;  2PP0 A;  1O95 A;  3FV9 A;  1N62 C;  2F5Z A;  2GQW A;  3P93 A;  3FG2 P;  1D4E A;  4K1W A;  3KUM A;  1TDN A;  3T0K A;  1WYG A;  4II3 A;  2GR3 A;  3ISH A;  3IC9 A;  1GRA A;  2V5Z A;  3S5S A;  1Q1W A;  3CGB A;  2QA2 A;  1S7M A;  1VDV A;  1IUX A;  1JRP A;  4HCH A;  2OG9 A;  1VQW A;  1JNR A;  3Q45 A;  3RCY A;  1P2H A;  1CHU A;  4XWZ A;  3G5R A;  3OZ2 A;  1VQZ A;  2YG6 A;  3RP6 A;  3P3B A;  1OJT A;  2HXT A;  3RHA A;  1GTH A;  2BRY A;  1L0V A;  3CXB A;  3IJL A;  3S61 A;  3AE9 A;  1BQG A;  2QQ6 A;  1FHV A;  4Z2T A;  1WUE A;  3BJS A;  2XFO A;  3BNU A;  3NYE A;  3DIP A;  3OTR A;  1OJA A;  4TM4 A;  3BI5 A;  2R46 A;  3ABV A;  5U25 A;  3LXD A;  3UCD A;  1FHU A;  2P8B A;  4KT2 A;  1Q9I A;  3LZX A;  3AD8 B;  1ZMD A;  2PPG A;  2FKP A;  2HNE A;  3EAO A;  2AL2 B;  2NPX A;  3SR6 B;  2PYX A;  1H83 A;  3F8D A;  5KNL A;  3KA7 A;  2GMJ A;  1STZ A;  3B3R A;  4USR A;  1XPQ A;  3F8R A;  3UJE A;  4U2T A;  2WOV A;  4NZH A;  4A99 A;  2ZZC A;  3DG7 A;  2B7S A;  1GRG A;  5BOE A;  3B9J B;  1JU2 A;  4JY2 A;  4ICY A;  4WX1 A;  3T14 A;  2IVE A;  1H82 A;  4MGG A;  4U8J A;  3BI2 A;  4KEM A;  3QPE A;  4TM1 A;  1KNP A;  3STP A;  1N5W C;  2BXR A;  3BI4 A;  2GR2 A;  4HCD A;  4JNQ A;  4DWD A;  1FIQ B;  1NHQ A;  4YTN A;  5EB4 A;  3UCL A;  3MWC A;  3NRN A;  3NK0 X;  4JDR A;  4G6G A;  1IUW A;  3R10 A;  3KD9 A;  3BHF A;  4TVY A;  2H88 A;  4X9M A;  3T31 A;  4K5R A;  2VVM A;  3OW1 A;  2GQF A;  3UKA A;  3ICT A;  1PXB A;  2JKC A;  5KOX A;  2GAH B;  2GGH A;  2Q6U A;  3KPF A;  3TW9 A;  3AMZ A;  1TRB A;  3AE2 A;  3R0K A;  4YSZ A;  4GAP A;  5DBJ A;  7ENL A;  2BAC A;  3ATQ A;  3MUC A;  3L5O A;  1E1N A;  4JN8 A;  4DX3 A;  3DK8 A;  1BF3 A;  3SJN A;  4DGK A;  2WU2 A;  3AE7 A;  4IA6 A;  4Y4M A;  2JB2 A;  4IVO B;  5KMQ A;  4KPL A;  2GV8 A;  2POD A;  2XFP A;  2YR6 A;  3VRB A;  3GSI A;  2OO6 A;  4JN7 A;  1W6T A;  2RDX A;  2QAE A;  4EQW A;  4K8D A;  3UJS A;  2W3S A;  1NEK A;  3RP8 A;  4B67 A;  3SN0 A;  4B64 A;  3KPK A;  1B37 A;  3I6T A;  2XYO A;  5J60 A;  1R0M A;  1GND A;  2FJE A;  2GL5 A;  2O9Z A;  1E1K A;  3AEA A;  3RP7 A;  2O56 A;  1VRQ B;  2MNR A;  1ZXI C;  3VR9 A;  1MOK A;  2B76 A;  2PCE A;  1KSU A;  3UKP A;  4K2S A;  1KSS A;  4ROP A;  4M52 A;  4REK A;  3CPI G;  3NRZ B;  2YM2 A;  1SJC A;  3N4F A;  2PMQ A;  4H4V A;  3NS1 B;  1ZOV A;  4Z25 A;  2WU5 A;  3H12 A;  1MXT A;  1BGN A;  4KX6 A;  3UKH A;  4RG4 A;  2VZ2 A;  1MDL A;  3P1W A;  4KPR A;  3RO6 A;  4A6N A;  3T2Z A;  1ZOY A;  2Q0L A;  3H8I A;  4IA5 A;  4NEW A;  2YG4 A;  3SY4 A;  1S2Q A;  2XH4 A;  3UJR A;  2YWL A;  1XPY A;  4MMW A;  4YXD A;  3VQR A;  1BKW A;  1K0L A;  2BK4 A;  2B9Y A;  2BA9 A;  3R07 C;  1HYU A;  4UDP A;  1JDF A;  3CNJ A;  4H4X A;  3P4S A;  1TKK A;  2PA6 A;  2GDQ A;  4GME A;  1CL0 A;  3CB3 A;  2W0H A;  4J31 A;  1SJA A;  1GEU A;  2JB3 A;  4G74 A;  3AEE A;  2I5Q A;  4HA6 A;  4AT0 A;  2YQU A;  2ZZ0 A;  4CRT A;  3UP5 A;  4IP4 A;  1XAN A;  2JAE A;  3UCC A;  4DNA A;  4EMW A;  3EPT A;  3ZVH B;  1TYT A;  2WQY A;  2C4C A;  4A5L A;  2XLS A;  2VRL A;  4I58 A;  3CPH G;  1JPM A;  4X9N A;  3R1Z A;  5HHF A;  2AR8 A;  2GVC A;  4YT0 A;  4J2W A;  2WOI A;  4OPI A;  3CYJ A;  1JRX A;  2YLX A;  3HRD C;  4C3X A;  3VRA A;  4DSG A;  2YLR A;  4BK2 A;  5JCL A;  3AYI A;  5KOW A;  3PK7 A;  1EL7 A;  3P0W A;  4BUR A;  4H4S A;  1GRB A;  5KMS A;  1NPX A;  4C74 A;  3HZL A;  4JY3 A;  1EBD A;  3Q9T A;  4O5U A;  2GB0 A;  1PBB A;  3DG6 A;  3GYJ A;  4ZA0 A;  3UKF A;  3UOZ A;  2PTZ A;  4BK1 A;  3NTD A;  2B7R A;  4A6G A;  4BJY A;  3H4K A;  5GSN A;  5U63 A;  3LAD A;  1OJD A;  1ELI A;  4H7U A;  1MNS A;  4Z43 A;  3OZY A;  1YQ3 A;  2YG5 A;  3ADA B;  1H6V A;  3I6D A;  5FMH A;  2GRT A;  3AE3 A;  3S5W A;  1M64 A;  1KN0 A;  3GO2 A;  3AE1 A;  3UOY A;  3QSE A;  3SX6 A;  3D46 A;  1B8S A;  2XLR A;  1H84 A;  3ETR B;  5C2T A;  1SJD A;  3H70 A;  3K7T A;  3CNT A;  3SZF A;  4E8G A;  1IUU A;  1JRZ A;  3ZLH A;  2R0C A;  2A8X A;  3ZVH A;  4YTP A;  3DA1 A;  3HYW A;  2EQ7 A;  4GR1 A;  2MUC A;  2XFN A;  1NU5 A;  3OP2 A;  1T3Q C;  4YTM A;  3NXL A;  4OVI A;  2GGE A;  2VQ7 A;  3VC5 A;  3N6J A;  2ACZ A;  3CGC A;  3FBS A;  3GDN A;  2QCU A;  4U8P A;  3AE5 A;  2GSH A;  1D5T A;  1LV0 A;  3ITJ A;  2C65 A;  1EBG A;  3M13 A;  1H2I A;  3P4R A;  4GGH A;  3EAN A;  5FS7 A;  2WHD A;  4LA1 A;  5EB5 A;  4HYR A;  1LPF A;  4OPD A;  2VOU A;  3Q6J A;  2WP6 A;  2OAL A;  1KFY A;  3ICS A;  3OPS A;  3UXK A;  1BZL A;  4OPU A;  2V6O A;  3VR8 A;  5KVH A;  1KKO A;  1TDO A;  4U2S A;  2BS4 A;  3R25 A;  1JRY A;  3U4F A;  4A3R A;  3QSS A;  4GDE A;  4EMI A;  5BRT A;  2WBA A;  3TOY A;  1QLB A;  5BUK A;  4Z2U A;  4J34 A;  4ECH A;  3BOX A;  3OZM A;  5BUL A;  1BKH A;  3KU9 A;  4HPN A;  4TVW A;  1ZDL A;  5HXI A;  2HQM A;  3NT6 A;  4M0X A;  2PTW A;  3Q4D A;  3N4E A;  2AQJ A;  3VDG A;  3T9P A;  3COX A;  2OQY A;  1RSG A;  3ZDN A;  1XS2 A;  4EIQ A;  4EM3 A;  1KNR A;  1TYP A;  2GH5 A;  2TMD A;  3GRS A;  4YWO A;  1B4V A;  3UOV A;  1S3B A;  5FS6 A;  1DOB A;  1RVK A;  1RM6 B;  2B9X A;  4GAV A;  4B1B A;  4O5Q A;  3ATR A;  2C76 A;  3B6D A;  1M6I A;  2CUL A;  1N4V A;  3GD3 A;  3UGV A;  4Z44 A;  3FJ4 A;  1NEN A;  1IJH A;  2EQ8 A;  2YVF A;  4FK1 A;  3UTG A;  4J56 A;  2C73 A;  4IVM B;  2UZZ A;  2PU1 A;  5IPY A;  3CN8 A;  2XCG A;  4G9K A;  1P2E A;  1F8R A;  2CVJ A;  3CTY A;  3NO1 A;  4YSH A;  4H50 A;  4OPL A;  2QVH A;  3MZN A;  1F8S A;  2ZC8 A;  1W4X A;  2PSN A;  3UJF A;  1JEH A;  4H19 A;  1IYX A;  4ZCC A;  2YR4 A;  1CC2 A;  4EQX A;  5C3J A;  4CCR A;  2GR1 A;  1H7X A;  2ARD A;  4NWZ A;  5FS8 A;  4H83 A;  1H86 A;  2A89 A;  2XLP A;  3CPJ G;  6ENL A;  2WDQ A;  3QLD A;  3QN3 A;  1PBD A;  1N4W A;  4H4Z A;  4LU6 A;  1PDZ A;  2R4J A;  1ONE A;  3P4Q A;  3VFC A;  2VRM A;  4KWS A;  1CJ2 A;  2WPF A;  3HYX A;  3IWA A;  2VVL A;  1PDY A;  4CNK A;  1FEB A;  4RG3 A;  3GDP A;  3RRA A;  2B9W A;  2APG A;  1DNC A;  2E5A A;  3IJQ A;  2DKI A;  2YLS A;  4NTD A;  3HYV A;  1NAA A;  1GET A;  3NGC X;  1GRT A;  3A7A A;  2Y6Q A;  2C70 A;  3AEF A;  3NN6 X;  1XHC A;  1IUS A;  3H8A A;  1FEA A;  1E1L A;  1L9C A;  1PBC A;  2QGY A;  1O94 A;  2C72 A;  3NH3 X;  4H2N A;  2YR5 A;  3NHO X;  4H1Z A;  1D7Y A;  1SB3 B;  3DGB A;  4FP1 A;  3VCN A;  3UTH A;  1EL5 A;  3RNM A;  4U8I A;  3GYX A;  1EC7 A;  4P9S A;  2AL2 A;  3MSY A;  1DTN A;  2XVH A;  2FJB A;  2Q7V A;  3LZW A;  2OPJ A;  4J36 A;  3TWA A;  3SFE A;  2Q0K A;  3LJP A;  4FI4 A;  3UKL A;  1BGJ A;  2W54 A;  5KWF A;  3MY9 A;  3NVV B;  2AKM A;  2XFQ A;  3JZU A;  3QVP A;  4CBQ A;  2DKH A;  2FYM A;  3FVD A;  1UKV G;  2XLT A;  4UDQ A;  2OZT A;  1EC8 A;  2WDV A;  1GES A;  1DOD A;  1MUC A;  5KXJ A;  3PO7 A;  3AYL A;  4HCL A;  3AEC A;  5BVA A;  2QDD A;  2YG7 A;  4GIR A;  2OZ8 A;  2RGO A;  1OJ9 A;  1YEY A;  2Y6R A;  3BSM A;  4NEV A;  3DGZ A;  3ALL A;  2PS2 A;  1PHH A;  3NG7 X;  3V3N A;  4X4J A;  5J7X A;  1PXC A;  3RED A;  4U2L A;  4H4R A;  1RYI A;  2QJM A;  1N61 C;  2FJA A;  1PS9 A;  4DN1 A;  1PXA A;  3V5F A;  5CKU A;  4U8O A;  3AYJ A;  2C75 A;  5FJR A;  1TE6 A;  3NIX A;  2OLA A;  4B69 A;  3VC6 A;  3TTE A;  3SXI A;  1K0J A;  3TQP A;  4OCG A;  3EEZ A;  4PAB A;  1F9C A;  3AD9 B;  4E0V A;  1RP0 A;  2WDR A;  2BCG G;  4JHM A;  1GRF A;  4GFI A;  5HYM A;  2GGI A;  1PN0 A;  1Y56 B;  2OVL A;  3S47 A;  3AM9 A;  4GF7 A;  3SBF A;  3RR1 A;  4YWS A;  3T37 A;  2POZ A;  2BCP A;  4A65 A;  2WPC A;  2J3N A;  2BXS A;  1PJ7 A;  4ZCW A;  5KMP A;  2ZAD A;  1EL9 A;  3SYI A;  1LJ1 A;  4CY6 A;  2PTX A;  4Z1Y A;  3L1R A;  4NTC A;  1GRH A;  4D03 A;  1N63 C;  3T8Q A;  5BOF A;  2CFY A;  1SJB A;  3D1C A;  3KKJ A;  3DFY A;  4F4R A;  1GOS A;  2WET A;  3PWI A;  5J04 A;  3SSZ A;  2WES A;  3R9U A;  2R45 A;  4JNA A;  1N4U A;  3H8L A;  1PBE A;  3N6H A;  3QFB A;  3SZ0 A;  3UTE A;  5JCI A;  1CJC A;  1PDH A;  3D47 A;  1OEP A;  3DJD A;  3FMW A;  1F3P A;  1CBO A;  1JRO A;  1K4Q A;  1X2H A;  2P3Z A;  3ES8 A;  3GMB A;  4U8L A;  4E6M A;  2OQH A;  3UOX A;  2X8C A;  2X3N A;  3FPZ A;  3T6C A;  4EWJ A;  3M12 A;  3CT2 A;  3DJJ A;  4H4T A;  1YQZ A;  3WE0 A;  2P8C A;  3I4K A;  4A35 A;  2PHH A;  3ZVI A;  3G5Q A;  4ADW A;  1QJD A;  4U8M A;  2JK6 A;  3AE8 A;  1YY5 A;  5FJO A;  3EUB 3;  5JRB A;  1PJ5 A;  2OKT A;  1Y56 A;  3IJI A;  5ER0 A;  3THU A;  1N1P A;  3NTA A;  4GYP C;  1EC9 A;  5U1O A;  1DXL A;  3DES A;  3ZLF A;  5JCN A;  3AB1 A;  2ZZB A;  3C4A A;  3K7M X;  2XLU A;  2E3T A;  4M6U A;  3F8P A;  4IP5 A;  2R0P A;  4JN9 A;  1X31 B;  4XWR A;  1NHP A;  3JVA A;  1BWC A;  4GGB A;  5FJU A;  3T2Y A;  4H4Q A;  3ZYX A;  1QO8 A;  2BAB A;  3RIT A;  3V76 A;  2RGJ A;  3KLJ A;  3FXG A;  1X2G A;  1KD0 A;  3ES7 A;  5CQF A;  4GDP A;  3LOV A;  1FOH A;  2AAQ A;  3M0O A;  2E5V A;  1S3E A;  3CXO A;  1D7L A;  2JB1 A;  4C5O A;  1GTE A;  1TDK A;  2R4E A;  1MRA A;  1H81 A;  5IQ1 A;  4CY8 A;  2XH0 A;  1PJ6 A;  3GD6 A;  3DH9 A;  2X50 A;  4G73 A;  2R9Z A;  2A87 A;  3NVY B;  3AE6 A;  3B97 A;  4J1O A;  3SM8 A;  4J33 A;  2OLN A;  3K30 A;  2OA1 A;  2C3D A;  4IHC A;  3UKK A;  2YAU A;  1MDR A;  2JBV A;  2QA1 A;  5IDZ A;  3PWG A;  4PAA A;  2BS2 A;  3QTP A;  1DOC A;  3K7Q X;  4YSY A;  2GEW A;  2YVG A;  1FFV C;  1LTX R;  2YG3 A;  3AEG A;  2P0I A;  3SZW A;  2OFJ A;  1Y0P A;  4AOX A;  3PVC A;  4XXG A;  2GGG A;  3NKS A;  1FEC A;  5M0Z A;  3L8K A;  4H2R A;  4B63 A;  1P48 A;  1N5X A;  2Z5Y A;  4Z2R A;  3ALJ A;  4A79 A;  3CNS A;  4A7A A;  1NHS A;  3D9X A;  4H2Q A;  1GV4 A;  4IV9 A;  1D4D A;  2GR0 A;  2CHR A;  3IF9 A;  2HZG A;  2C64 A;  4BJZ A;  3GRT A;  4X2P A;  3I6E A;  4E4F A;  3V4B A;  1H7W A;  1F6M A;  1GER A;  3URH A;  3SFD A;  4B65 A;  5L46 A;  4D04 A;  3CND A;  1REO A;  4BV6 A;  2XVJ A;  5FS9 A;  1KCZ A;  1L8P A;  4E4U A;  2OLO A;  1MO9 A;  2VVL G;  2C67 A;  3GD4 A;  2X8G A;  1EBH A;  4FDC B;  5EOW A;  2WP9 A;  4G7F A;  2EQ9 A;  1YKJ A;  1CJ3 A;  3JSK A;  4YKF A;  4IL2 A;  1DJN A;  2X99 A;  2V3A A;  3EKG A;  1XDI A;  3C4N A;  1Q1R A;  3VRD B;  1ZKQ A;  2XVI A;  4TM3 A;  2OX4 A;  2YM1 A;  3CGD A;  3HPF A;  2GMH A;  4HNL A;  4J57 A;  1EL8 A;  2YVJ A;  1COY A;  2C66 A;  3SN4 A;  4ENL A;  3E1T A;  4J3Z A;  2TPR A;  3UKQ A;  2XDO A;  2XH2 A;  3AE4 A;  3DJG X;  3TWB A;  1AOG A;  3V3W A;  1LVL A;  1VDC A;  3BNM A;  3C96 A;  2V3B A;  3SZC A;  1JCT A;  4MKS A;  2AL1 A;  3ALM A;  1WUF A;  2ZBW A;  1GRE A;  3TJI A;  5JCM A;  3K1G A;  5JCK A;  2I0Z A;  4IL0 A;  4B68 A;  2V61 A;  1FFU C;  1B5Q A;  4APN A;  4HNC A;  1IUV A;  1NHR A;  4Z17 A;  2XGZ A;  4IT1 A;  1L9D A;  4FX9 A;  3NYF A;  2FJD A;  5ENL A;  1P43 A;  5FJP A;  3GWD A;  2PP3 A;  2DW7 A;  2FBW A;  2V60 A;  1GXF A;  2YLZ A;  2GAG B;  1OJC A;  4B66 A;  2PTY A;  3NYC A;  3NNE A;  2XH7 A;  5FJT A;  3ZLG A;  5LV9 A;  4E5T A;  4A6N B;  5IQ4 A;  3SQS A;  4FK1 C;  3JW7 A;  4H2H A;  4C77 A;  1E9I A;  4G8T A;  3DDM A;  2PGW A;  2P88 A;  2BYB A;  1DJQ A;  2WEU A;  2NVK X;  3UXL A;  1R6W A;  3OC4 A;  3SGL A;  5KRQ A;  3NK1 X;  3GY1 A;  4CCQ A;  1CC4 A;  4DYE A;  3NN0 X;  2BC0 A;  4YSX A;  1V97 A;  3NVW B;  4YKG A;  1F8W A;  2ONE A;  3BHK A;  4Y4N A;  4K7Z A;  4H4U A;  3CMM A;  4EIP A;  1ZY8 A;  4U8K A;  2HXU A;  3A7R A;  3DME A;  4U8N A;  3EF6 A;  3RGT A;  2BS3 A;  5EU9 A;  3VCC A;  3GC2 A;  3II4 A;  2WS3 A;  5EBK A;  2GF3 A;  1JNZ A;  2C3C A;  1GSN A;  3SN1 A;  2AKZ A;  3U9I A;  4AOS A;  3UJ2 A;  3SQP A;  3IK4 A;  3CIR A;  2QJJ A;  2R0G A;  3MQT A;  3PS9 A;  3NVZ B;  3IHG A;  4GUV A;  2W55 A;  2GGJ A;  4JQ9 A;  4TLX A;  2H89 A;  3DK4 A;  4HN8 A;  2OAM A;  3KVE A;  1GT8 A;  3O0H A;  3P9U A;  4N9X A;  3AD7 B;  4A9W A;  1D4C A;  3AED A;  1SEZ A;  4DSH A;  1GPE A;  4Z26 A;  2PP1 A;  1E39 A;  4GCM A;  1ZP0 A;  1TDE A;  5TR3 A;  1NEL A;  1KKR A;  4TLZ A;  2WOW A;  5G5G B;  3AEB A;  2X8H A;  3HW2 A;  4OPT A;  3PFR A;  4GYP A;  4LII A;  1K0I A;  3TCS A;  3NLC A;  3DGH A;  1LQU A;  4K2X A;  1FCD A;  4EM4 A;  3UTF A;  5KMR A;  3DFH A;  2IVD A;  1CJ4 A;  3G5S A;  1DOE A;  3DG3 A;  1V59 A;  3DK9 A;  4TM0 A;  3D8X A;  1ZK7 A;  1O5W A;  3FYY A;  3NFU A;  4K5S A;  3R0U A;  3V3O A;  3IHM A;  2CDU A;  2Z5X A;  4K22 A;  3GMC A;  2DW6 A;  1NDA A;  4DXK A;  2RGH A;  4G6H A;  3QKE A;  3UP4 A;  2EQ6 A;  1E7P A;  5KVI A;  2OZ3 A;  1FL2 A;  2BC1 A;  3T2K A;  1YQ4 A;  4OPG A;  4GIS A;  3TJ4 A;  1TZZ A; 
#chains in the Genus database with same CATH homology
 1B37 A;  2YR4 A;  1CC2 A;  4EQX A;  2XYO A;  5C3J A;  4CCR A;  2GR1 A;  1H7X A;  2ARD A;  4NWZ A;  5J60 A;  1GND A;  2FJE A;  5FS8 A;  3AE6 A;  3SM8 A;  2O9Z A;  4J33 A;  1E1K A;  2OLN A;  3AEA A;  1KDG A;  3RP7 A;  3K30 A;  1H86 A;  3LB8 A;  2OA1 A;  2C3D A;  1VRQ B;  2A89 A;  4BK3 A;  2XLP A;  3CPJ G;  2WDQ A;  4USQ A;  3UKK A;  2YAU A;  1MOK A;  3VR9 A;  1PBD A;  2B76 A;  2JBV A;  1N4W A;  1PBF A;  4H4Z A;  4LU6 A;  1Z6L A;  2R4J A;  1KSU A;  3UKP A;  2QA1 A;  1KSS A;  3CNP A;  3P4Q A;  4PAA A;  2VRM A;  1KF6 A;  4M52 A;  2BS2 A;  4AP1 A;  4YSY A;  1DOC A;  3K7Q X;  1CJ2 A;  4EQR A;  2WPF A;  3HYX A;  3IWA A;  2GEW A;  3GWF A;  2VVL A;  4REK A;  2WPE A;  2YVG A;  3CPI G;  1FEB A;  4ZCD A;  4RG3 A;  4H4Y A;  4CNK A;  3GDP A;  2YM2 A;  4H4P A;  1LTX R;  2B9W A;  4H4W A;  2APG A;  4C3Y A;  1DNC A;  3CGE A;  4H4V A;  2DKI A;  3AXB A;  2YLS A;  2YG3 A;  3AEG A;  4NTD A;  1ZOV A;  4Z25 A;  2BK3 A;  2WU5 A;  3HYV A;  1NAA A;  2C7G A;  1GET A;  3NGC X;  1MXT A;  1BGN A;  3SZW A;  4KX6 A;  1Y0P A;  1L9E A;  3UKH A;  1GRT A;  1JOA A;  2Y6Q A;  4RG4 A;  2C70 A;  2VZ2 A;  3QVR A;  4NNJ A;  3P1W A;  4AOX A;  3AEF A;  4KPR A;  3PVC A;  4XXG A;  4A6N A;  3T2Z A;  3NN6 X;  4AT2 A;  3NKS A;  1ZOY A;  2Q0L A;  1FEC A;  3H8I A;  1XHC A;  1IUS A;  4IA5 A;  5M0Z A;  4NEW A;  1FEA A;  1E1L A;  2YG4 A;  1ZMC A;  4NTE A;  2E1M A;  3L8K A;  5GRT A;  2E4G A;  1L9C A;  1PBC A;  4H2R A;  1O94 A;  3QJ4 A;  4RSL A;  2C72 A;  4B63 A;  3SY4 A;  1S2Q A;  4UP3 A;  3ICR A;  3NH3 X;  4H2N A;  2YR5 A;  2Z5Y A;  3GYI A;  3NHO X;  3ALJ A;  4Z2R A;  2YWL A;  3QFA A;  4A79 A;  1VG9 A;  4EMJ A;  3CNS A;  4A7A A;  2BK5 A;  4YXD A;  1NHS A;  1D7Y A;  3D9X A;  4H2Q A;  3VQR A;  1GV4 A;  4IV9 A;  3UTH A;  1D4D A;  2GR0 A;  1EL5 A;  1BKW A;  3RNM A;  1K0L A;  2BK4 A;  4U8I A;  4HB9 A;  1GAL A;  3GYX A;  4P9S A;  2B9Y A;  1CF3 A;  4CNJ A;  3IF9 A;  4I59 A;  2BA9 A;  2C64 A;  4BJZ A;  1HYU A;  4UDP A;  3GRT A;  3PG6 A;  2XVH A;  2FJB A;  4GRT A;  2Q7V A;  2YLT A;  3CNJ A;  3LZW A;  4H4X A;  3P4S A;  1H7W A;  1F6M A;  4J36 A;  1GER A;  1CL0 A;  3URH A;  3SFE A;  3SFD A;  2W0H A;  4J31 A;  1GEU A;  4OPC A;  2Q0K A;  3LJP A;  2JB3 A;  3UKL A;  1BGJ A;  3DJE A;  4G74 A;  4B65 A;  2XVE A;  3AEE A;  5L46 A;  2RAB A;  3QSM A;  2XVF A;  4HA6 A;  4D04 A;  4AT0 A;  5KWF A;  2YQU A;  1REO A;  3CND A;  2ZZ0 A;  4BV6 A;  2XVJ A;  5FS9 A;  2XFQ A;  2YLW A;  4CRT A;  1NG4 A;  3QVP A;  3UP5 A;  1XAN A;  2JAE A;  2OLO A;  1MO9 A;  4DNA A;  3AWI A;  4H2P A;  4Z24 A;  4CBQ A;  2DKH A;  2VVL G;  4EMW A;  3EPT A;  1TYT A;  3GD4 A;  2C67 A;  2X8G A;  4FDC B;  1UKV G;  5EOW A;  2WP9 A;  2BRA A;  2WQY A;  2EQ9 A;  1YKJ A;  2XLT A;  1CJ3 A;  3JSK A;  2C4C A;  4UDQ A;  4YKF A;  1IUT A;  2WDV A;  4Y4L A;  1CC6 A;  1DJN A;  4A5L A;  2X99 A;  1GES A;  1DOD A;  2XLS A;  2VRL A;  4I58 A;  3CPH G;  2V3A A;  2WP5 A;  5KXJ A;  1ZX9 A;  1XDI A;  4MJW A;  3PO7 A;  3AYL A;  3C4N A;  4X9N A;  1E6E A;  1Q1R A;  1VG0 A;  3VRD B;  5HHF A;  3AEC A;  1S2Y A;  2AR8 A;  2GVC A;  1ZKQ A;  4YT0 A;  4EQS A;  2XVI A;  4J2W A;  5BVA A;  2WOI A;  4TM3 A;  2YG7 A;  4OPI A;  4WCT A;  2YM1 A;  1JRX A;  3I3L A;  2XFU A;  2YLX A;  1LQT A;  2RGO A;  1OJ9 A;  4C3X A;  3CGD A;  4II2 A;  5HY5 A;  3VRA A;  4DSG A;  2GMH A;  2YLR A;  1E1M A;  3P4P A;  4J57 A;  1EL8 A;  2VQB A;  2Y6R A;  4NEV A;  1TDF A;  2YVJ A;  1COY A;  2C66 A;  5JCL A;  3AYI A;  4BK2 A;  5KOW A;  3DGZ A;  3ALL A;  3FIM B;  1EL7 A;  1PHH A;  5M10 A;  3NG7 X;  3E1T A;  1ONF A;  3NK2 X;  2TPR A;  4BUR A;  1NG3 A;  3UKQ A;  3V3N A;  4UDR A;  4ZN0 A;  4H4S A;  4X4J A;  2XDO A;  3AE4 A;  3DJG X;  4AP3 A;  1AOG A;  2IID A;  1GRB A;  5KMS A;  1LVL A;  1O95 A;  1PXC A;  5J7X A;  3RED A;  4U2L A;  1VDC A;  1NPX A;  3BNM A;  3C96 A;  4C74 A;  3HZL A;  2V3B A;  4JY3 A;  2F5Z A;  1EBD A;  4H4R A;  3Q9T A;  1RYI A;  4O5U A;  2GQW A;  3SZC A;  2FJA A;  2GB0 A;  3FG2 P;  1PS9 A;  1D4E A;  1PBB A;  3ALM A;  2ZBW A;  1TDN A;  1GRE A;  1PXA A;  3GYJ A;  5CKU A;  3UKF A;  5JCM A;  2I0Z A;  5JCK A;  3T0K A;  4U8O A;  3UOZ A;  3AYJ A;  4II3 A;  4B68 A;  2GR3 A;  4BK1 A;  2V61 A;  3NTD A;  2B7R A;  3ISH A;  3IC9 A;  2C75 A;  1GRA A;  1B5Q A;  2V5Z A;  4BJY A;  1Q1W A;  3CGB A;  3H4K A;  3NIX A;  4APN A;  5GSN A;  5U63 A;  2QA2 A;  3LAD A;  1S7M A;  4B69 A;  1IUV A;  1NHR A;  1IUX A;  1OJD A;  1L9D A;  1ELI A;  4FX9 A;  3NYF A;  4H7U A;  2FJD A;  3SXI A;  1VQW A;  4Z43 A;  1K0J A;  1JNR A;  3GWD A;  4OCG A;  1P2H A;  1CHU A;  4XWZ A;  3G5R A;  2FBW A;  3OZ2 A;  2V60 A;  1GXF A;  1YQ3 A;  2YG6 A;  2YG5 A;  2YLZ A;  4PAB A;  3AD9 B;  3ADA B;  3RP6 A;  4E0V A;  1H6V A;  3I6D A;  5FMH A;  1OJT A;  2GRT A;  1RP0 A;  1M64 A;  2WDR A;  3AE3 A;  3S5W A;  2GAG B;  1OJC A;  3RHA A;  4B66 A;  1KN0 A;  2BCG G;  1GRF A;  1GTH A;  5HYM A;  3NYC A;  2BRY A;  3AE1 A;  1PN0 A;  3NNE A;  3UOY A;  3QSE A;  3SX6 A;  1Y56 B;  1L0V A;  3S61 A;  1B8S A;  2XLR A;  1H84 A;  3AE9 A;  5C2T A;  4GF7 A;  4C77 A;  5LV9 A;  3K7T A;  3CNT A;  3SZF A;  4A6N B;  4Z2T A;  1IUU A;  1JRZ A;  5IQ4 A;  2XFO A;  2R0C A;  2A8X A;  3BNU A;  4YTP A;  3DA1 A;  3HYW A;  2EQ7 A;  4FK1 C;  3T37 A;  2BCP A;  3NYE A;  4A65 A;  4GR1 A;  1OJA A;  2WPC A;  2J3N A;  2BXS A;  2XFN A;  2R46 A;  3ABV A;  3BI5 A;  4TM4 A;  5U25 A;  1PJ7 A;  3LXD A;  5KMP A;  1EL9 A;  1Q9I A;  3LZX A;  3SYI A;  3AD8 B;  1LJ1 A;  4CY6 A;  2BYB A;  1DJQ A;  2WEU A;  1ZMD A;  3L1R A;  2NVK X;  4NTC A;  4YTM A;  4OVI A;  2VQ7 A;  3OC4 A;  1GRH A;  3SGL A;  5KRQ A;  2ACZ A;  3NK1 X;  4D03 A;  4CCQ A;  1CC4 A;  3EAO A;  3CGC A;  3NN0 X;  2BC0 A;  2CFY A;  2NPX A;  3D1C A;  4YSX A;  3FBS A;  3KKJ A;  3GDN A;  2QCU A;  4U8P A;  3AE5 A;  2PYX A;  1F8W A;  1D5T A;  4YKG A;  1GOS A;  1LV0 A;  3BHK A;  2C65 A;  3ITJ A;  4Y4N A;  2WET A;  1H83 A;  3M13 A;  4K7Z A;  4H4U A;  3CMM A;  3F8D A;  1H2I A;  4EIP A;  1ZY8 A;  4U8K A;  5KNL A;  3KA7 A;  2GMJ A;  3B3R A;  3P4R A;  3EAN A;  5FS7 A;  2WES A;  4USR A;  3R9U A;  1XPQ A;  2R45 A;  3DME A;  2WHD A;  4LA1 A;  4JNA A;  5EB5 A;  4U8N A;  3EF6 A;  2BS3 A;  3F8R A;  1N4U A;  1LPF A;  3H8L A;  1PBE A;  4OPD A;  3QFB A;  4U2T A;  2WOV A;  2VOU A;  3Q6J A;  3SZ0 A;  4NZH A;  4A99 A;  2ZZC A;  2WP6 A;  2B7S A;  1GRG A;  2OAL A;  3UTE A;  5JCI A;  1CJC A;  1JU2 A;  1PDH A;  1KFY A;  4JY2 A;  4ICY A;  3ICS A;  3DJD A;  4WX1 A;  3FMW A;  3T14 A;  3II4 A;  2WS3 A;  1F3P A;  2IVE A;  1H82 A;  1CBO A;  1BZL A;  4OPU A;  1K4Q A;  2V6O A;  5EBK A;  4U8J A;  3VR8 A;  2GF3 A;  3BI2 A;  1JNZ A;  2C3C A;  3GMB A;  1GSN A;  5KVH A;  4U8L A;  1TDO A;  3UOX A;  4U2S A;  2BS4 A;  2X8C A;  4TM1 A;  1JRY A;  2X3N A;  4AOS A;  3FPZ A;  1KNP A;  3M12 A;  3QSS A;  4GDE A;  4EMI A;  3DJJ A;  4H4T A;  2BXR A;  5BRT A;  1YQZ A;  3SQP A;  2WBA A;  3BI4 A;  2GR2 A;  3WE0 A;  3CIR A;  2PHH A;  3G5Q A;  2R0G A;  4ADW A;  4JNQ A;  1QJD A;  1QLB A;  3PS9 A;  1NHQ A;  4YTN A;  4Z2U A;  4U8M A;  3IHG A;  4GUV A;  5EB4 A;  5BUK A;  3UCL A;  2JK6 A;  4JQ9 A;  3AE8 A;  3NRN A;  4J34 A;  1YY5 A;  4TLX A;  4ECH A;  3NK0 X;  4JDR A;  4G6G A;  1IUW A;  5JRB A;  3KD9 A;  2H89 A;  3BHF A;  3DK4 A;  1PJ5 A;  2OAM A;  2H88 A;  3KVE A;  5BUL A;  1GT8 A;  3O0H A;  1Y56 A;  3P9U A;  4X9M A;  3KU9 A;  4N9X A;  3AD7 B;  3T31 A;  5ER0 A;  4K5R A;  2VVM A;  1N1P A;  4A9W A;  3NTA A;  1ZDL A;  1DXL A;  5U1O A;  1D4C A;  3AED A;  2GQF A;  2HQM A;  5HXI A;  3NT6 A;  3UKA A;  5JCN A;  1SEZ A;  4DSH A;  1GPE A;  3ICT A;  3AB1 A;  4Z26 A;  1PXB A;  2ZZB A;  2JKC A;  3C4A A;  3K7M X;  2XLU A;  2AQJ A;  5KOX A;  1E39 A;  2GAH B;  3COX A;  2Q6U A;  4GCM A;  1ZP0 A;  1TDE A;  1RSG A;  3KPF A;  3ZDN A;  5TR3 A;  3F8P A;  2WOW A;  4EM3 A;  1KNR A;  2R0P A;  3AEB A;  2X8H A;  4JN9 A;  4TLZ A;  1TYP A;  4EIQ A;  1X31 B;  4OPT A;  1TRB A;  3AE2 A;  1NHP A;  4XWR A;  1BWC A;  2GH5 A;  2TMD A;  3GRS A;  4YSZ A;  4GAP A;  4YWO A;  1B4V A;  4LII A;  5DBJ A;  1K0I A;  3T2Y A;  3UOV A;  4H4Q A;  2BAC A;  3ZYX A;  3NLC A;  3ATQ A;  3DGH A;  1S3B A;  5FS6 A;  1QO8 A;  2BAB A;  1LQU A;  4K2X A;  3V76 A;  1DOB A;  3L5O A;  3KLJ A;  1E1N A;  1FCD A;  4EM4 A;  2RGJ A;  2B9X A;  4GAV A;  3UTF A;  5KMR A;  4B1B A;  4O5Q A;  3DK8 A;  3ATR A;  1BF3 A;  2C76 A;  2IVD A;  1CJ4 A;  1M6I A;  1DOE A;  3B6D A;  3G5S A;  5CQF A;  4DGK A;  2WU2 A;  3AE7 A;  3LOV A;  4GDP A;  1FOH A;  2CUL A;  1V59 A;  3DK9 A;  2AAQ A;  1N4V A;  4TM0 A;  3D8X A;  3GD3 A;  1ZK7 A;  4Z44 A;  1NEN A;  1O5W A;  3M0O A;  1IJH A;  2E5V A;  4IA6 A;  2EQ8 A;  2YVF A;  4Y4M A;  1S3E A;  1D7L A;  2JB1 A;  4FK1 A;  2JB2 A;  4IVO B;  4K5S A;  5KMQ A;  4C5O A;  2GV8 A;  2XFP A;  3UTG A;  4J56 A;  1GTE A;  1TDK A;  2C73 A;  2R4E A;  2UZZ A;  4IVM B;  3V3O A;  2YR6 A;  3VRB A;  3IHM A;  2CDU A;  3GSI A;  2Z5X A;  4K22 A;  3CN8 A;  3GMC A;  5IPY A;  2XCG A;  1NDA A;  2RGH A;  1H81 A;  4G9K A;  1P2E A;  1F8R A;  5IQ1 A;  4CY8 A;  2CVJ A;  3CTY A;  4G6H A;  4YSH A;  1PJ6 A;  2QAE A;  4H50 A;  4OPL A;  3DH9 A;  4EQW A;  4K8D A;  3UP4 A;  2X50 A;  2EQ6 A;  1E7P A;  5KVI A;  4G73 A;  1NEK A;  2R9Z A;  1F8S A;  3RP8 A;  1FL2 A;  2BC1 A;  4B67 A;  3T2K A;  1W4X A;  1YQ4 A;  4OPG A;  4B64 A;  1JEH A;  3KPK A;  4ZCC A;  2A87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...