3ZVHB

Methylaspartate ammonia lyase from clostridium tetanomorphum mutant q73a
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
415
structure length
414
Chain Sequence
MKIVDVLCTPGLTGFYFDDQRAIKKGAGHDGFTYTGSTVTEGFTQVRQKGESISVLLVLEDGQVAHGDCAAVAYSGAGGRDPLFLAKDFIPVIEKEIAPKLIGREITNFKPMAEEFDKMTVNGNRLHTAIRYGITQAILDAVAKTRKVTMAEVIRDEYNPGAEINAVPVFAQSGDDRYDNVDKMIIKEADVLPHALINNVEEKLGLKGEKLLEYVKWLRDRIIKLRVREDYAPIFHIDVYGTIGAAFDVDIKAMADYIQTLAEAAKPFHLRIEGPMDVEDRQKQMEAMRDLRAELDGRGVDAELVADEWCNTVEDVKFFTDNKAGHMVQIKTPDLGGVNNIADAIMYCKANGMGAYCGGTNETNRSAEVTTNIGMACGARQVLAKPGMGVDEGMMIVKNEMNRVLALVGRRKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords METHYLASPARTATE AMMONIA-LYASE
publication title Engineering Methylaspartate Ammonia Lyase for the Asymmetric Synthesis of Unnatural Amino Acids.
pubmed doi rcsb
source organism Clostridium tetanomorphum
total genus 162
structure length 414
sequence length 415
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
B PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3zvhB02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3zvhB01
2PU0A 2XH7A 3IK4A 2QJJA 5FJUA 1TKKA 2AKMA 4H1ZA 3DG6A 3OTRA 3UJSA 4ENLA 3QN3A 2ONEA 4HCHA 4DN1A 4DXKA 1P43A 3JW7A 3ZLFA 1EBGA 4M0XA 1OEPA 5ENLA 3MQTA 3CK5A 4A3RA 3DG7A 4IHCA 2OZ8A 3NO1A 2PGWA 4HCDA 2PP3A 2PGEA 3TCSA 3N6HA 2QVHA 3NFUA 4A35A 3VCNA 1MRAA 1PDZA 4HN8A 1XPYA 3QTPA 3RO6A 1XS2A 4J1OA 4IL0A 4ZA0A 2OFJA 3FYYA 2QGYA 3DESA 5FJPA 4HYRA 3PWIA 3FVDA 3D46A 3CAWA 5EU9A 3TOYA 3H7VA 3OPSA 2PS2A 3RR1A 3OZYA 3ZVHA 1PDYA 3DFHA 3MY9A 2XH4A 4F4RA 2NQLA 2PP1A 2HZGA 3TWBA 2GDQA 2PTXA 3UJRA 4IL2A 2GGJA 3THUA 3S47A 1WUFA 1EBHA 4DWDA 1WUEA 3OW1A 1SJCA 1P48A 2I5QA 3ES8A 2PODA 2OKTA 3VC5A 1NU5A 4DX3A 3MUCA 2DW6A 3OZMA 3RGTA 2GGGA 4G7FA 3MSYA 3FJ4A 4JN7A 3D47A 5BOEA 3QKEA 2ZC8A 2RDXA 3UGVA 4MGGA 3IJQA 4HPNA 2OZ3A 4KT2A 4Z17A 3P93A 2PSNA 2O56A 4GMEA 3K1GA 3ES7A 3IJIA 3U4FA 1MNSA 3DIPA 4HNCA 3BJSA 3NXLA 3TWAA 3TTEA 2OX4A 3V3WA 3SQSA 3TJIA 4GIRA 3SN0A 1ECQA 4IZGA 3UJFA 3QPEA 3MWCA 3JVAA 3ZLHA 1JDFA 3T8QA 2PA6A 1ONEA 1FHUA 3QLDA 4ROPA 3FXGA 2QDEA 3HPFA 4M6UA 5FJTA 4FI4A 2PMQA 3SSZA 1W6TA 2XSXA 2POZA 3V4BA 3R0KA 2OPJA 3DEQA 3N4EA 2P8CA 3Q45A 1JCTA 3ZVHB 2OO6A 3STPA 4ZCWA 1R0MA 5J04A 4HCLA 3UXKA 4KPLA 2OQYA 4GYPA 3SBFA 3T4WA 3T9PA 3SN1A 3VDGA 2GL5A 5FJOA 3U9IA 3UCCA 2P8BA 3R0UA 3DGBA 4K8GA 4E6MA 3P3BA 4GYPC 3CT2A 2OQHA 3H70A 3UCDA 4E8GA 1R6WA 3DG3A 2AL2A 1JPDX 2GSHA 4A6GA 4JN8A 2OLAA 1BKHA 4H83A 3P0WA 4K2SA 3VCCA 3H8AA 3R1ZA 2GGHA 1FHVA 3I6EA 3VA8A 1MDRA 1MUCA 2GGEA 3FV9A 3V5FA 1MDLA 3I6TA 2QJNA 3T6CA 2HXTA 3TW9A 1SJBA 2OVLA 3CYJA 4FP1A 2AL1A 2FYMA 4GFIA 3TQPA 3N4FA 3S5SA 3NZGA 6ENLA 3MZNA 4E4UA 3GD6A 3PWGA 1IYXA 2PTZA 3DFYA 4DYEA 2P88A 3DDMA 4GGHA 1L8PA 4HNLA 4X2PA 3ENLA 5IDZA 4J3ZA 2MNRA 1JPMA 3JZUA 3CB3A 3EKGA 3V5CA 4Z1YA 4IP4A 3EEZA 1E9IA 4YWSA 1KKOA 3Q4DA 3SN4A 2CHRA 1BQGA 2QDDA 5BOFA 3PFRA 2PP0A 2XGZA 1NELA 3UJ2A 2QJMA 3UXLA 2ZADA 3CXOA 1DTNA 2DW7A 4MMWA 4GGBA 2FKPA 2OZTA 1YEYA 3PK7A 3OP2A 1EC8A 1EC7A 3ZLGA 2P3ZA 2PU1A 5FJRA 1KD0A 3FCPA 2HXUA 2AL2B 3H12A 2PCEA 4K1WA 3UJEA 3TJ4A 2PTYA 3RCYA 3I4KA 2XH2A 3GO2A 4E5TA 3DERA 3BOXA 3N6JA 2HNEA 1EC9A 2OG9A 3KUMA 3RRAA 3GY1A 2PPGA 3RITA 4DHGA 3VC6A 7ENLA 4EWJA 1SJAA 3ZVIA 2MUCA 1ELSA 2QQ6A 3IJLA 1F9CA 3R10A 4GISA 2AKZA 1RVKA 4E4FA 2P0IA 3B97A 4H19A 4G8TA 3GC2A 1KCZA 1TZZA 2PTWA 1SJDA 2GGIA 3BSMA 3MKCA 1TE6A 3R25A 4KWSA 4MKSA 2XH0A 4KEMA 3SJNA 1KKRA 4IP5A 4IT1A 4JHMA 3VFCA 4H2HA 3R11A
chains in the Genus database with same CATH superfamily
1MI3A 3L8KA 2EJ1A 2NQ9A 3M6YA 2J9XA 1HNYA 4LXFA 1VH7A 3MMTA 4J3VA 1OHLA 4GKTA 2NQZA 1O66A 3MCNA 3L2IA 3GIQA 4UTLA 4KCUA 4E4PA 1TRDA 1AZ1A 3JZEA 2G3NA 4OBRA 3LU2A 3N17A 4CCCA 5HJXA 3UWEA 6A3HA 2G50A 3JRKA 1V0NA 1DWFM 4WIWA 2PGEA 1W2PA 1VIWA 4MZ8A 4OQVA 5CPLA 4B92A 4LW7A 1YDYA 2WOIA 2ZUMA 2YDSA 1KC7A 3AXKA 4I5XA 4H4RA 1DE6A 2OYLA 2HWGA 1IT7A 1BF2A 3EOEA 2VXNA 1V93A 1AOGA 3PF3A 2DP3A 4FNPA 4AZCA 1QAPA 2PS2A 4RUBA 3TN6A 1GUVA 4BCEA 1TPDA 3IK2A 4OZOA 1KGWA 1X38A 1SGJA 3FY1A 4D6FA 4JIPA 3CV1A 4NEVA 3FJNA 3DK4A 2DIJA 1EBHA 2X0SA 4EM3A 4Q8VA 1EL3A 1SJCA 1I1XA 3ZT5A 2F2HA 3VKKA 1DJXA 3VU2A 1RJRA 1E1CA 4MWAD 1BTCA 4I6KA 1OYCA 3DFPA 1DQXA 1POKA 1Z89A 3FEQA 3SCUA 1BWKA 1UR9A 2D2JA 4WY0B 1EPVA 4D1JA 1QW7A 4FNUA 2Y8UA 3WQCA 2POTA 4N0RA 3PAJA 1S7MA 3QV9A 4HZ6A 1HO1A 4JTCA 1A5OC 2E5AA 1OBAA 3VGDA 2PSNA 4PMUA 3SECA 1A4MA 1GT8A 2Y8VA 4ZE4A 4RDVA 3V18A 4DJEA 3VZZA 1PTDA 4CCZA 4DI8A 1IXQA 1FCQA 2XPKA 1LOLA 4Q8TA 3W75A 4Y9PA 3CGEA 2JGQA 5M2FX 8CGTA 1F3TA 2HPIA 3SQSA 5IRPA 1B3OA 3UJFA 1H60A 2JF6A 4RCXA 3BW3A 1RJPA 4RE2A 2PA6A 5CXPA 1AA1B 3S2JA 4JYDA 5KSWA 4B5UA 4L1XA 3G1VA 2B31A 1B4KA 2ACQA 2VDIA 3RCMA 4M6UA 5AC8A 2PWEA 2W0UA 2PWDA 3DYPA 3D0CA 3KHDA 3M9YA 1OC5A 1XX1A 2INFA 2WWDA 5G2HA 3WL0A 2OO6A 1VEPA 2H9AB 3DFNA 4DRSA 1GG0A 3TIMA 3VNLA 1TV2A 4UTKA 2WBKA 3EPNA 5EKYA 4IFOA 2NVDA 3HURA 2NQJA 1W0MA 3T44A 1BSIA 3WD0A 3NSMA 3LRLA 3UW6A 3TW6A 4A8NA 2NW0A 3PPGA 5AHLA 2G96A 4PEKA 4BF5A 2EQ7A 4AY7A 5GNXA 4B5SA 4B9ZA 3H7RA 1UC4A 1FWRA 3GNRA 3HGOA 1E6QM 3BLFA 1EB3A 1JGMA 3VDHA 4NZFA 3PFMA 2PDMA 3POHA 4IIDA 4QSFA 2NQHA 3F2BA 3NQFA 1X2HA 3BURA 3RLUA 3AHVA 3B8DA 5DELA 1VQZA 3QVQA 4PH6A 3L4WA 4UZSA 4C65A 4DYJA 3WNNA 3I6TA 2PGRA 3LRKA 1S2UA 4KIRA 4ADWA 4L56A 5KZEA 3VKDA 4LV9A 2RJHA 3NQ6A 4CU6A 1PZ1A 3DUGA 2D2GA 1GTHA 3PTDA 3WDPP 3U7BA 2HTMA 3IJDA 4UFKA 1W1A1 1FWCC 3IRSA 3DU0A 1SSDA 5A8MA 3K30A 2PLMA 3NNTA 5FF4A 2ZUWA 3S2NA 5H8UA 3IIPA 3V5CA 4A05A 1R30A 4UOQA 2VGGA 3I10A 3TSDA 1IIHA 5F4SA 3GDLA 4UTIA 3NJ3A 3RRXA 1X2GA 1UCWA 2CXEA 2CWNA 4RXGA 4XTDA 1EYEA 2TODA 1UP3A 2YX0A 4O0QA 2V2DA 3F4VA 3PULA 3MP5A 1NFBA 4LBUA 2A21A 1JZ3A 3B8UA 5T91A 3GW3A 1XYCA 1R87A 3PK7A 3B4UA 4A22A 1PZ2A 2FZBA 1EC7A 4R53A 3HQOA 2PE4A 3S9ZA 4ZOAA 1QNVA 2PWGA 1GEQA 2PCEA 4YHGA 1RCQA 4CCEA 3TJ4A 5AYYA 4ZQMA 3BAJA 2O4MA 3P62A 2IMRA 3W7GA 1Y5WA 4JTIA 3W71A 4AIUA 4KRUA 1VBHA 4C6OA 3I4KA 5AB3A 1GONA 4CD8A 4XK2A 1MEHA 4PBFA 2Z6JA 2BXVA 3TN3A 1MXGA 2FB3A 1SFLA 3OQ8A 3UWYA 4UTMA 3RRAA 3GY1A 3DFOA 2PPGA 1SJAA 4H9TA 5FS8A 4QS6A 3LHWA 5XIMA 4O1AA 4LV4A 1F3XA 3IJLA 3MZ2A 4CGTA 2DZTA 4HMNA 5GQBA 2VZTA 1HN1A 4PUDA 1O94A 3W7IA 1R2RA 1A80A 2V68A 2Q8LA 3BQ5A 5A8PA 3L0KA 1ZJHA 5AC5A 4LUJA 3GS6A 1XIFA 1R9ZA 3M6DA 4JTDA 2WC4A 2VEKA 3KE0A 3VK5A 1GTEA 1GRTA 2ASHA 4UBPC 1UWAA 3SJNA 1WXZA 2PUZA 4AFYA 2QUNA 4N9EA 1VZWA 4AZ5A 3M0HA 5CAHA 3P82A 2Y7GA 3MV11 4H50A 5D8WA 2IS7A 1KRCC 1FWDC 1PE1A 5CH9A 4YL2A 3KRBA 2QKFA 3UJSA 4BS0A 1VJZA 9RUBA 3APYA 2PRMA 3VKCA 1E4LA 3TZFA 1G94A 1XLAA 1XCFA 1WKYA 1TTQA 3W82A 1CXKA 2BVYA 1ONXA 3LSCA 4L4PA 3STCA 3UXIA 2WJZA 5F4XA 3RU6A 1X1ZA 3IIXA 3W88A 2ESCA 5KINA 2V67A 4K36A 3S8HA 4HU4A 1U5VA 4IIGA 3FAXA 4IL0A 4ZA0A 1H7PA 1JGIA 1TJ1A 2FDMA 2XM2A 2BTMA 2YIHA 2R1PA 2J7GA 3H7UA 1HZYA 1AVAA 1YADA 1TSIA 3WH6A 5JCMA 1VCGA 3L5MA 3APTA 1DQUA 2QUVA 1XI3A 2QEZA 2QPXA 2ZZ5A 5G4EA 2ZZ0A 1CX9A 2W4XA 1SO5A 3GBEA 4QQUA 4XWUA 1OADA 3FN9A 3EB3A 3TH6A 3EDDA 2VCAA 3G1FA 4G7EA 4J2PA 1EOKA 5T26A 4I7VA 3VCRA 4ATWA 2W3SA 3W6MA 2X0YA 6REQB 2V6AA 3C56A 1BXCA 2PODA 1JJKA 5BMWA 3QHNA 4RKAA 2CHOA 5HMEA 4E2VA 1J0KA 1KM6A 2FFIA 3FJ4A 3D47A 3I3BA 3W73A 3EWZA 3NQMA 3QKEA 2BX7A 9XIAA 4GQBA 4MY1A 2D0FA 1KBIA 4A3YA 2W63A 4HU0A 2HBVA 4Y9OA 3EOOA 1JI2A 3I68A 1W54A 1FWFC 3T42A 1FECA 3WL1A 4E3VA 4JZ5A 3G8RA 3OC4A 2WKGA 4ICNA 4H6RA 4ZOHB 1OX6A 3OJGA 2A5HA 1ZNNA 1ZB5A 1TPC1 3A5VA 3POCA 1P1MA 4NF7A 4C1NB 2CLMA 3GYCA 2Z7GA 4A3QA 1K9TA 3N04A 1CB2A 4R7JA 3N2XA 4KWUA 1UKQA 2LLEA 3B8VA 1WYGA 5TBOA 1ZAHA 4XZ9A 3BK0A 2VJXA 3HPFA 1F3EA 3W85A 5FJTA 3ISIX 3RYSA 3C52A 2C1GA 3OBKA 1AMYA 4EPKA 3R0KA 2EAWA 2UY3A 4PYSA 2OT1A 3BUVA 3W9ZA 2BZNA 4C6IA 4WJXA 1FCUA 1WDWA 1RY0A 3GHRA 3UNTA 1BHGA 3AJXA 5HR7A 4F9JA 2VCBA 2GQWA 1XSKA 4PCFA 4UIOA 3W7EA 4FS9A 1GNXA 2BHZA 4K68A 5C9XA 3AIVA 3DENA 4GXMA 3R0UA 5C7VA 1SQ7A 1ZBWA 3KOXA 2CU0A 1GPWA 2C18A 4AG0A 1W2VA 3B8TA 3RF9A 1LZOA 4EPBC 2FHFA 5IFTA 1WOBA 4UMAA 3NQ7A 3KBSA 5MKGA 2AL2A 1FQ0A 5HQEA 3MDWA 4S3FA 1XC6A 2NUYA 2GSHA 3PBMA 2NV9A 4WLCA 3P80A 1VKFA 3UA3A 3UR8A 4GVHA 1UR2A 1ZSXA 1C7TA 3EAUA 5AHIA 3MBFA 3CQ0A 3NM3A 4C6CA 3S5NA 4ML4A 5K4ZA 1ZAIA 1EDQA 3VMOA 2Z1SA 1XPGA 3QTGA 2FVMA 2HXTA 2CYGA 2ZVRA 3UWQA 2GOKA 2ACRA 4L64A 2A8XA 2J9YA 3BAYA 5DEZA 3H22A 2Y7EA 4GCAA 3ONCA 4IFKA 2X8GA 2Y70A 4B3ZA 2XVLA 3TAKA 4BQ2A 3KX6A 2JGYA 3GU9A 3MUIA 5F1VA 3GH7A 2JK2A 3NQDA 1EX5A 4JGDA 3CGCA 3C0JA 3EX4A 3PSWA 1TQJA 1UKOA 4E2BA 5BROA 1JPMA 3K8MA 5CPQA 2E67A 4IQJA 3CIWA 3NSXA 4JS3A 1PS9A 1UH2A 1BQGA 4GUGA 4GQGA 1YW1A 1MVYA 2F61A 5A2AA 3CWNA 1ZP4A 5CPSA 1TVLA 2ABBA 1GVOA 3ARWA 4DQWA 3DBNA 1OGGA 2JALA 3STEA 1NWUA 3B8WA 2ZX8A 3UG3A 1SFJA 5IBXA 2QV4A 4IX0A 3W2LA 4ML9A 3W4RA 4FOUA 3S1WA 3T07A 7REQB 3KBWA 2DT1A 3P6LA 2PGFA 3R94A 2XVPA 3VGBA 1CGVA 4EP8C 3VKAA 1IE7C 2QXWA 1FRBA 3W70A 5HANA 1WKEA 1FH7A 4FXJA 2WBGA 5CLWA 2DSUA 5CZ0A 4BF7A 2X7VA 1XL9A 3KBJA 1Z7AA 3QZ6A 4AC1X 3ALFA 3QH2A 1N60C 2YA0A 2XM1A 2D23A 1GOKA 4DAFA 2PDQA 4NJIA 1PX4A 1VYRA 3EEGA 1T3QC 3O06A 1B3YA 2VTFA 1Z69A 3WELA 3OG3A 3S83A 3MVIA 3ZT6A 4GZ7A 3UYIA 1UR0A 4GISA 2FZNA 3L0NA 4QG8A 2V3FA 3NO3A 3WJYA 1OFAA 4G5DA 1P1XA 4IJCA 3NYZA 4G8TA 3LMYA 2WVUA 2VUNA 2E4TA 2Y4SA 3ABOA 1Z32X 1XLEA 4DJFC 3NVVB 4JPGA 1XM3A 3R25A 3B0UX 1EJTC 3B9DA 1HO4A 4B5WA 1WA3A 4AWTA 4UTTC 2GVLA 1GRFA 4GH1A 3Q67A 2NLYA 5EL1A 1P7TA 5A6JA 1KWGA 2R8WA 3IK4A 3KCOA 3IPWA 3C4UA 2VFGA 1ZZMA 3QYQA 3T0TA 2FH8A 3KRUA 4QLKA 2J77A 4PE8A 2CDUA 3Q94A 2GJNA 4EF9A 2J25A 1GVYA 3TMQA 1UR3M 1AH0A 1ADSA 1W9PA 2FGZA 4DLFA 4IPIA 4FPSA 1FEBA 3WX7A 3WN6A 4Q4QA 5DXYA 3WJXA 1K7XA 3REQB 2JIEA 4QNEA 1YIXA 4QEHA 4C1KA 1GQIA 3DK9A 1UASA 3LERA 4AZCB 1NAL1 1PVNA 5ABGA 2XIIA 4S39A 2WZTA 3HG3A 3FYYA 1T8QA 4NRRA 5EA9A 1A5UA 2I9UA 3INPA 2J24A 2XFYA 3KOWA 3OA3A 2W55A 3SGUA 3FVDA 4E8CA 4TO8A 3KL3A 3T78A 1AMKA 3CH0A 2E5DA 1OX5A 2FGLA 3LI1A 3GR7A 3LLFA 4X9SA 1N8IA 1CECA 3KXQA 3NOEA 3TYAA 3NRZB 2XH4A 5C8BB 2CFYA 1R46A 2C6QA 4OECA 4MFEA 3GDKA 4UQDA 1GVSA 3MA8A 2C15A 5G5IA 1JAKA 1BXBA 3CMJA 3PBVA 5CPMA 5E0FA 3N3TA 1F6KA 1UD3A 1L6YA 1R3WA 3ITVA 4C6BA 4JY8A 2DIKA 2PDJA 2H3BA 2EBNA 1PYFA 1S2TA 3IVUA 4GWEA 3NA8A 4NJGA 4G7FA 3I7QA 3KBVA 5I6SA 4FIRA 2ZUNA 1M6IA 2P53A 3KOYA 3UGVA 4HPXA 3T2PA 5E0KA 4AYGA 2X8CA 2CBUA 4MFDA 4LEFA 3DHUA 3NEHA 4MKNA 4PRWA 4NXSA 2VWSA 1VBUA 3W7KA 1Q6EA 4HQVA 1TPVA 1RSCA 1N5WC 1V3MA 3TE9A 3E3HA 3WBAA 3NURA 3UR2A 4CEXC 1OD0A 4O28A 4W88A 3L0GA 3LHZA 5EMYA 1N7KA 4M52A 5A6AA 3PB0A 2QCNA 3F5JA 5EMKA 4FZIA 4E2DA 3CPRA 4G56A 3WF3A 3W81A 1IXOA 4JIEA 1LWIA 1JPIA 4HMCA 4H4XA 3H6OA 1HP4A 1QXLA 2YZ5A 5EY5A 5KZ6A 1JR1A 4Y96A 3WLQA 1VLIA 3VX0A 4NILA 3EWYA 1A5CA 2CZ5A 3GVVA 4FLQA 4MKVA 3ZSSA 1I2NA 1DIEA 3BO9A 5J04A 3WQWA 3NQCA 4C7GA 2EQDA 4EF8A 5CC3A 3EMZA 3PZTA 4M5PA 1ODUA 2YXOA 3N9SA 3T4WA 2WO5A 4DO7A 4LY4A 1QTWA 1V79A 3VDGA 2GOUA 3V36A 1N63C 4N42A 1A3XA 2WPFA 2DSZA 4AD2A 3CUFA 1HVQA 1MUMA 8XIMA 4P7LA 2Z1WA 1W9VA 1RA5A 4OUEA 1GHSA 1XBVA 1NDAA 2VI0A 3W3OA 1JPDX 4UNIA 1PWMA 4M51A 4IUGA 3GTXA 5CQ1A 4HA0A 5CZKA 2C1IA 5C9WA 4LS0A 3SUSA 1K8CA 3EDFA 5TD4A 1FHVA 4ATDA 3QSRA 5HJYA 5FS7A 3LGDA 2ZA1A 4H6EA 1RBAA 2G3MA 5B7ZA 3CYJA 1NHRA 3TQ0A 2Q71A 4NL1A 1HKMA 1JXKA 3WEMA 5HMSA 5I06A 2V3EA 3B3DA 2PDFA 1UWRA 2VX7A 4LFYA 1M7OA 3VIPA 1C8YA 4C90A 4J3TA 4IGNA 4S3EA 1K4HA 4J56A 4GGHA 2PC8A 1JZ2A 1XUZA 2CLLA 4LCRA 2GUUA 2AQVA 3WLIA 4U3AA 1POJA 5CPTA 2YYUA 5FS9A 1W1ZA 1QOXA 2XDFA 5JH2A 3T81A 4F0SA 1M3UA 4CNTA 5BOFA 3PFRA 3A9BA 1DJNA 1U30A 4ADSA 1D3GA 1TV4A 1V4YA 4PTVA 1Z9AA 3FG2P 3UXLA 3PN8A 4JTKA 1BD0A 7PTDA 4H9UA 2C19A 3N2TA 2WNNA 2FFCA 3WF1A 5BU9A 2WSQA 3VNJA 2QAPA 4ZB0A 3A7RA 1LT8A 5B80A 3GFXA 5U25A 1VIZA 3N34A 4AHOA 3S2CA 3WQ4A 3H53A 1XLLA 3TNOA 2PU1A 2TAAA 1KD0A 3FCPA 1EO7A 1A0CA 3CTLA 3T0BA 1QI5A 3PG9A 3GB6A 3ITOA 3VGFA 3OVRA 5JBDA 4KEZA 1OZQA 4P7RA 3OO2A 4AB4A 1B5TA 2MANA 4PN2A 2VD8A 2HJPA 2X1TA 3OYXA 1VC4A 1VD6A 3PZVA 2JKPA 2E9LA 4J28A 3NVWB 4GIEA 2E09A 2YPIA 3D3AA 1EHNA 2FHBA 7ENLA 4EWJA 1KTBA 1UJPA 3VD5A 1WCGA 3BICA 1W3NA 1QPNA 2Z25A 4K7ZA 1W5NA 3M64A 3TC6A 3PP7A 1RVKA 2ISSA 4BFAA 3B97A 1VB9A 3ZR6A 5ABHA 1TZZA 1QK2A 2DJLA 3L65A 1WPCA 1UROA 4Y8EA 1TV7A 4LAZA 5G5HB 5A6BA 1JIBA 1ME9A 3PBGA 2C71A 5G1MA 1R9YA 4IMGA 4ONVA 1S2WA 1NOFA 5KETA 1MZRA 1AUSL 2HMCA 4LC6A 4N4PA 1C29A 2XH7A 3A3HA 5D2VA 4R88A 3O0KA 4FXFA 4UTUA 2DV0A 1YDOA 5AHNA 4MAVA 1NP0A 2V63A 4WQ6A 2OB3A 1HW6A 3OBEA 4C1LA 1B1YA 4S23A 3GZ3A 5DT7A 2XYLA 5HBFA 1L6GA 2AAAA 1KLZA 3T2QA 1O5XA 2GVYA 4AD5A 4M6PA 2NV1A 4JCMA 1J6PA 1F8MA 4HOWA 5JRBA 1H5YA 3HTWA 1G1YA 1ZLPA 4LS1A 4KERA 3NO5A 3DYMA 3UZYA 2ISDA 1XS2A 3A9IA 3RO6A 2NVAA 2YJQA 1H7RA 3DESA 1EXPA 5FEZA 4B3KA 2EG6A 2X1UA 3AM9A 3PWIA 4U5KA 3BCDA 2J75A 2HVNA 3WLSA 2AAMA 5AKQA 3HRDC 3W84A 1PDYA 1H6VA 3GTFA 2NQLA 2WC3A 3N29A 4N2YA 2HZGA 3TWBA 4ZVJA 1WO2A 1MO9A 1PTGA 1GVEA 2DZVA 4R9OA 2JE8A 4Q4KA 3MSGA 1GYLA 1GKPA 2ZE0A 2BMBA 4HK6A 3CGDA 3PZMA 3QFEA 4K8HA 4XAFA 1S2AA 3WF4A 4C6JA 1ZMDA 1JZ4A 1OCNA 1PHWA 4XD4A 3T0AA 3QQ1A 2FGBA 3QGAC 5AHMA 3RGTA 3WQ5A 1XD0A 4MOZA 3RDKA 1QNRA 2GUYA 3NDOA 1F5ZA 3VGEA 1IEQA 5J8LA 3GZAA 1XBXA 4RNHA 1CXLA 2ZC8A 4O1DA 3MP3A 1Q13A 4IMDA 2PBGA 4L9YA 4KMQA 5A2BA 2C8NA 2YDAA 4EANA 2IKGA 2VRQA 5BCAA 2Z1XA 4H2CA 1O5KA 2BY0A 1JFXA 1VFMA 4GMEA 3IJIA 1UWIA 1V0LA 5HK4A 1LLOA 1ZALA 4H04A 1Q7MA 8XIAA 3VOCA 3LRMA 3TJLA 3GXPA 3EPMA 1V7YA 1KQZA 2XFWA 4FDCB 1EDGA 2WSRA 4XIAA 4LX4A 1DIDA 3JVAA 3T8QA 3V1PA 3NAVA 4XAPA 3KOFA 2PDLA 4EMWA 1VS1A 5BRBA 3W22A 3F7JA 2QLYA 3FXGA 2XZ7A 3LM3A 4V1XA 1GCYA 1GVQA 2CWXA 1T8XA 4MNJA 3UG8A 2Y24A 5D4YA 2BS9A 1OYAA 3C2RA 3PVFA 4H8NA 3ZVHB 5D2TA 1FWBC 2J6XA 3U2ZA 4R9XA 2OELA 3WH9A 1V6TA 2D1ZA 1K8YA 3NL6A 3UXKA 4KEUA 3M0ZA 3NQEA 2QMKA 5I07A 3Q6JA 3TVAA 5DFAA 1MSSA 3B06A 2CFFA 4F2TA 2NLIA 3TC7A 1RLCL 2YW3A 1H4PA 4NX5A 3G6LA 3W1XA 4UOJA 1YNYA 3GHUA 1F3WA 4E6MA 4Z0SA 2DQXA 3AROA 1IGWA 1DE5A 4JQ3A 2QCEA 2JKAA 3EX2A 1XG3A 2ZE3A 3AS1A 3D9XA 1KM2A 3FVMA 1HKJA 3S0CA 2V2HA 2WZHA 3KBNA 3GC4A 2PDGA 3OA5A 4LQ1A 3VE9A 3TYUA 3W2KA 4ES4A 3ICJA 4WUIA 2QW5A 3UR7A 4K2SA 2VHLA 4PA8A 3OG2A 3TU9A 2ZOXA 3W07A 2PDIA 1ADDA 1G4PA 1FDJA 2PURA 3KZSA 1LL7A 1RQBA 4K8EA 1KM0A 1V3IA 1Z41A 3ZJ7A 2ZUVA 4H01A 3V7PA 3N4FA 3LBMA 4M7TA 5BXSA 4UUIA 4ZL1A 5I3JA 3WLTA 3B9AA 4UOZA 1U1UA 3DGRA 2O7SA 1GSNA 3NEVA 2BVWA 4K39A 7A3HA 4Q8OA 4ZEPA 4AY8A 1D7FA 1SW0A 3KBMA 2CHRA 3P84A 4W89A 2WWCA 1SZFA 1OK4A 2NUXA 3CO4A 3WLHA 2FVLA 4JIQA 4P8XA 3W6YA 1XYMA 2NPXA 4HMEA 1WDPA 4Y90A 2AMXA 3NVDA 2B7OA 3NPVA 3D3FA 1KRBC 4XAYA 1X7IA 4J3SA 2ZDRA 1WDQA 3N11A 5IM51 4AISA 1PXGA 3GW0A 4U2YA 4W8AA 1I9CB 5F4WA 3EXTA 3HB9A 1AH3A 3UG4A 3ARSA 3S1VA 2GQAA 3O7UA 1TJ2A 3FDKA 3S1UA 2Y6ZA 3GRTA 5L9FA 4O10A 4W7VA 4JL2A 3UYCA 1ONFA 4D6EA 4GUFA 3WDRA 3RCYA 3B9OA 1LQAA 4XB3A 2YFOA 1LRNA 3MS8A 2W92A 3EX6A 1PYMA 2J66A 4MUPA 3BAIA 3PTKA 4C91A 1D8WA 3R2GA 1MQRA 4DZIA 1UQZA 4H6QA 3P8JA 2WVVB 4ZMGA 5I3GA 2Y88A 1IT8A 5AYXA 1JZ7A 3ZVIA 3BDKA 2QQ6A 3HG4A 4GRSA 4DJFA 3GDRA 2HROA 3BAWA 5D02A 2QS8A 4LAUA 4UTTA 1U83A 2XJ7A 3G18A 4O13A 1A49A 5EMJA 3WQFA 4DO5A 1SU5A 1UOZA 2PDBA 3N3MA 2BP1A 1CEOA 3CUZA 4PFMA 4DNHA 1RD6A 1JRBA 3DFTA 1WAUA 3VZXA 1PIGA 2F8QA 4WX2A 1H0IA 3T55A 3GRIA 1A5AA 2Y89A 3IACA 4Y6GA 1QJWA 4M81A 2HISA 1AH4A 2OZ0A 3FGCB 2PWHA 3CUHA 1P43A 2BC0A 1H2JA 4Z0JA 2DGAA 1W9XA 4LCSA 2TRSA 3MI2A 5HQMA 3W1QA 3MQTA 4DF1A 4O18A 4N6FA 5G2IA 1JROA 2OZ8A 2AQOA 1RPKA 1SVDA 4C6MA 2BXZA 1M01A 2NXGA 2IPGA 1BYAA 2Y62A 3MI6A 2QVHA 1TVNA 3ZZ1A 3TR9A 1J12A 1XBYA 4BI7A 1X1NA 3RK8A 2YW4A 1EA9C 1DJGA 2OFJA 4YS1A 4JHOA 1LL4A 3LD5A 3LS9A 4OT7A 3THCA 3EPOA 1N5XA 3BW4A 1LTDA 1WZLA 3RILA 3GVGA 2EG8A 1FH8A 1SW3A 3VNKA 4KKXA 4IGMA 2VDGA 4URIA 2A6LA 3SUTA 3LLDA 2OEKA 2P1FA 4NYUA 1TTPA 4W85A 3NM1A 2OMAA 1XHCA 1VFFA 3GHSA 3NQVA 4H8VA 3TN4A 3LGGA 4F0RA 2A0NA 1YXYA 1Q2RA 4Q8WA 3THUA 2YLAA 4GI6A 4CD4A 2OOFA 1EA0A 4Q4MA 3EWUA 5D37A 1P48A 1XLMA 2VOTA 3CYVA 3ES8A 5LIWX 3OGVA 4PC8A 4Z2LA 3VC5A 3LV6A 3OLGA 4Q8UA 4DB7A 1RA0A 4AMCA 2P76A 3GVQA 4I8YA 4LWWA 4LEQA 4AWSA 3MSYA 2XVNA 5I02A 2G4JA 4L6OA 4OUIA 1QW9A 1TFVA 3DI0A 1UOKA 2H8ZA 4JTQA 3NL2A 1RY8A 5A95A 2PEVA 3H4WA 4HPNA 2H90A 4O1EA 3BLLA 2KX9A 4XZBA 4N9CA 3LHYA 2QMJA 1E5NA 4DO4A 3DIPA 3E5PA 3M0XA 3EOSA 2WW5A 4EAMA 3HG2A 3NXLA 4MLJA 4GJJA 2WMGA 1OCJA 1HJXA 4IMFA 5GNZA 3CAKA 3CZJA 3IUHA 3ZJKA 4EACA 3TLQA 1XKJA 3MYOA 3U8GA 1ONEA 1VRDA 1XIGA 1R3RA 4HB7A 1Q6QA 4TVYA 2FZ9A 3KTXA 2A2IA 2WPEA 4ROPA 2GLKA 4F2UA 1B4EA 4NI3A 2FPTA 2P8CA 5LIXX 3KOZA 4INFA 4ERIA 4PBEA 4LS2A 2OSXA 4YNGA 3GC5A 2J7BA 2PF0A 3L4YA 3UZWA 1N2VA 3E2VA 1H7XA 5JU6A 2Q6ZA 3EWCA 4GHRA 3EX3A 1GOMA 4OV4A 3UCCA 1KFLA 3U57A 1NIUA 3CHFA 1U22A 3AI0A 3T1GA 3PZIA 4J3UA 3VOFA 1WDDA 4UFMA 3BG9A 1VLWA 2C0AA 4E8GA 6ALDA 3F5LA 4X0VA 3DG3A 3RLGA 3DKJA 1EJ7L 1SSGA 4AVOA 4EXQA 1CLXA 2QT3A 1UHVA 3H2FA 1GREA 4JQ9A 1Q4NX 4B2DA 4JN8A 1P0KA 1E55A 1GQJA 4PB3A 3VCCA 1XR2A 2GGHA 3K5XA 1ZPTA 1FCVA 3B0PA 1MDRA 3EB2A 3HPZA 4Y8FA 3SCTA 2FYMA 1Q6DA 3QFWA 4TVUA 5I3FA 1ZX9A 1KXTA 3RUBL 1ML1A 3M0VA 4D71A 2PC4A 4TU1A 3VIOA 2CLHA 1Q3NA 3NZGA 1QW8A 2PDWA 3MZNA 4PTNA 4C6EA 1XIEA 3C0QA 2HE8A 1UZDA 2QF8A 1P0NA 5DMYA 3CLMA 5CC7A 1L8PA 3NUKA 5CSYA 1FP9A 3IV3A 2VM8A 4BQ4A 1G0CA 4J3ZA 3URAA 1Q6CA 2PDYA 1GJPA 3AMZA 4L1GA 3Q4DA 3C2VA 1T7LA 3SN4A 1XFCA 3V1HA 5IHSA 2VC6A 3YPIA 1H2IA 4B15A 2ZC1A 4D9PA 5AECA 3SCQA 2VT0A 1QHZA 3H2MA 2QJMA 3LUTA 4O17A 3HU7A 1J01A 3TEVA 5I00A 1OF6A 1A5NC 4N4QA 3Q65A 1EKOA 2X41A 4F8XA 4D72A 4MNLA 2E28A 4LF1A 4GO8A 4CUCA 1XSJA 1EQPA 1UUMA 2BVTA 5BRPA 1TX2A 2WSPA 4JFUA 3TR2A 3CGTA 2XFFA 4QG6A 1GOWA 4HPGA 1M53A 4I8DA 2Y8KA 3U48A 2WPCA 4HYVA 1ZK7A 1GOXA 1CTNA 3S6OA 2OEJA 3ZSTA 5LA1A 2OG9A 3KUMA 1FWWA 3LPPA 3RITA 3LXCA 2O9OA 3N2BA 2ZKMX 1V59A 3B8IA 3O9NA 1V02A 1WZAA 4K8DA 1I8JA 2YLLA 3ANVA 4LALA 3RMEA 5D09A 5DRIA 4WGXA 3TYCA 2PDNA 4Z2GA 2YAUA 2E9BA 3S6DA 3O63A 1K3UA 2I14A 3W1AA 2EO7A 2F7FA 4M3PA 3Q58A 1J5SA 4NAEB 3U2OA 5A6BD 1Q6LA 5GRTA 4Q3MA 3VNYA 1B54A 2Z1KA 5JBEA 1K02A 3WY1A 1WNOA 3C2YA 4O53A 3IUDA 5HPCA 4LUSB 4JXCA 1BTMA 2EPNA 3E5BA 4GNKB 1NFGA 1BYDA 2VZSA 3N9RA 1KKRA 3LV5A 1FWIC 3GBDA 1IXPA 3GG8A 4WY0A 3ARPA 3GDTA 3WH7A 4C6LA 2GUBA 2O9PA 1ONRA 1CGWA 3STFA 2EPLX 3EWBX 4LIIA 2ZA2A 2ONEA 3M07A 2RDUA 4H4UA 1IZCA 4KW2A 4FMVA 2DSKA 3ZLFA 2Y5EA 1VYPX 2BBFA 4LAKA 1J2WA 1YNQA 4CN4A 1GZGA 1MEIA 4HVXA 3DG7A 3Q37A 3R13A 3PJWA 4W5ZA 2AAQA 1XRSA 1WBHA 2Y7DA 3S3GA 4WZHA 1T96A 4E8DA 1NOWA 4OFCA 1EDTA 1S3TC 3TLLA 1C3FA 2ZYFA 3TZNA 1GG1A 4IICA 4J1OA 1V6UA 1QMLA 2VVNA 1CGTA 3BGGA 2V5JA 2YXGA 3TQVA 3OLDA 2G3FA 4QAWA 3LADA 1PCWA 2KZHA 5E9XA 4MPKA 2VNCA 4O1BA 4BI5A 3AWNA 5FSDC 1KBLA 4HA1A 2H9AA 2WPGA 3GG0A 1W8SA 4PCTA 5GJNA 3OGRA 4AEEA 1MQQA 4GO9A 1VJSA 1UMYA 1WUEA 4LUTB 4KH2A 4XBKA 5BW6A 3A21A 3RM9A 3GG1A 4QROA 1T41A 4JIRA 1J96A 1LWHA 4ZTXA 5LNVA 4BQ5A 5I23A 2QUMA 1KFWA 5U7SA 3KFTA 1CPUA 1ZCOA 3WO8A 3TNBA 1UZ4A 2W61A 1B3XA 1YMYA 4FX6M 1FWAC 3M5YA 4TVCA 4Q4RA 2YFNA 1W1B1 1OYBA 3WDQA 4L1WA 1F76A 4PMJA 1XLKA 1J4EA 3WLMA 1ZDLA 1PZ0A 2PI6A 3WQPA 1K1DA 1MW1A 4M80A 4YVPA 2V38A 3ITGA 1DOSA 1FDZA 2PD5A 1NQ6A 4D6HA 2OX4A 4JN6A 1M68A 3AMCA 4UFJA 2BOGX 3EYPA 1IEIA 4P2VA 3S9IA 2GR1A 1GERA 1BPLB 3VMPA 3RN6A 1W9DM 4GYKA 3RHGA 5A8GA 3O07A 5D2XA 4AY1A 4I5RA 3U3HA 3MKKA 2XGIA 1TIWA 3DOPA 2FTWA 2V3DA 3VPLA 1AD4A 1GXFA 4H4WA 1JCTA 3NQ2A 3SUVA 3QSTA 1QBBA 1W3HA 5D32A 3M0IA 7XIMA 4ZCWA 2W67A 2OODA 1R7OA 3W83A 3DC0A 2WV8A 4EPDC 4L4OA 2O4QA 3SN1A 4PCPA 1XIBA 1O1HA 4LC8A 2R6OA 5FF7A 1DWIM 2P8BA 2FIQA 4TMCA 4XV0A 1M6JA 3E49A 3V5OA 3ANUA 2Z2BA 4GYPC 1JDCA 2BOFX 4LU0A 3OVPA 2Z6IA 3S42A 3ABSA 1EIXA 4ROQA 3ARQA 3SCOA 5I0DA 5I77A 4NZCA 3W7QA 4EE9A 5HMFA 3NGFA 1JRCA 4MB4A 1BVNP 3GWQA 2TMDA 2V2CA 4IIHA 1HXJA 3IJ6A 4PUKA 2FTPA 2YYTA 5TF0A 3W1MA 4Z1CA 1L9WA 1DORA 2DUZA 5C9RA 1AJZA 3E12A 3T7VA 4IUOA 2EPHA 2J4GA 4H4ZA 3ARZA 1SYTA 4L4MA 2BSLA 4WJ8A 3SO7A 4HHLA 4DY1A 2VR4A 4AXNA 3IGSA 1DXEA 3CM4A 3VE7A 3VAVA 4C6DA 3H55A 3S5SA 3AALA 4MWAC 3CJPA 4NAFB 3PWGA 2IUZA 4L6HA 3DI1A 5CZSA 4DYEA 4BURA 3ELFA 1W3JA 2BY3A 1FWJC 4X2PA 4LJ3A 4DM2A 2DY3A 3PM6A 1KFBA 1UR8A 4UMCA 1PKYA 2DZPA 1V6WA 5HAOA 1WOAA 4DBSA 4CD6A 3LXBA 4DPPA 1LQ2A 4NJKA 1Q7ZA 5JVLA 2QDDA 1B9BA 3I7SA 3DHDA 3N4AA 2GH5A 4NRSA 3WK2A 5IFPA 2ZQ0A 3IVSA 1QO5A 4N02A 1B3VA 1JULA 3DHPA 1BF6A 5K7JA 3UQNA 1R86A 2BNJA 2CBIA 5FL1A 4JFSA 1LOQA 3OGSA 3R4IA 2E7FA 4MPQA 2IQDA 3MCMA 1RQEA 2ZZBA 3B0YA 4TV5A 2E68A 4B5XA 3W38A 3NDYA 3HFYA 3VI2A 3W2MA 4GZJA 3WEZA 1K03A 1F8WA 5D9NA 3W2JA 1VAHA 3QQ0A 4B5TA 2QCLA 4DM1A 4NNAA 1D8CA 2Z1BA 3I6RA 4W8LA 1VFHA 1P5BA 3NPUA 3SRFA 1XC4A 4R3UA 3AICA 1X6LA 1JDEA 4QLJA 1E4IA 4NX0A 5DBTA 1O4UA 4QDWA 3R10A 4NYYA 3TYBA 1HX0A 2W79A 2QAEA 4L9ZA 3WJSA 1N82A 4C5ZA 2WMJA 3B0XA 1XLJA 2PDUA 1UD6A 3M44A 1HG3A 6REQA 4RR4A 1EO5A 4GFSA 4DJDC 5ABTA 3VX1A 3W7RA 3K1DA 3TA9A 4Y9AA 3GU2A 2GGIA 3TOPA 1F4HA 4R27A 3L4VA 4GBDA 1Q4WA 1B3ZA 4XZNX 3G1HA 3UD6A 4H7VA 4JTSA 4CNSA 4DZ5A 3SY8A 6CGTA 2QHAA 3B9NA 5IHRA 1S1PA 4LAOA 4AIEA 1VGAA 6TAAA 3E2RA 1YKWA 4RZBA 4GI4A 4HIBA 2OWWA 1FH9A 4DXKA 4FLOA 1WE5A 2OO0A 1RPXA 1EBGA 4M0XA 6XIAA 1LL6A 1V3HA 4LRTA 3BVJA 4C1NA 3NO1A 3F4CA 2VEGA 3ZR4A 3HG5A 2AOSA 2PP3A 2VOMA 2ZTKA 1JCLA 3SIZA 1MRAA 4XZWA 3BV7A 4XZLX 2YL9A 1CGXA 1XLHA 3QTPA 1NH6A 3WBEA 3VYLA 4IH3A 4WGHA 1UKPA 4FA3A 4UC5A 4JAWA 2WP5A 2VO5A 3BGJA 1LCOA 4NT0A 4V1YA 4EQRA 2CHNA 1UA7A 3BJFA 2INZA 1Y8BA 4YWOA 3BMXA 3QY6A 1BG9A 4MJ2A 2EJAA 4ZBCA 1JUKA 4ZXLA 2ZRZA 4GH3A 2OTDA 3USBA 4S3CA 2C3CA 3CU2A 3OW1A 5I79A 3WQ6A 1XGDA 1W5MA 2I5QA 4CNPA 3E38A 1YLVA 4HTBA 2FZDA 5AYBA 1FX6A 3ITXA 4GXPA 2GGGA 1FFRA 1TV5A 1TV3A 3H21A 2V3AA 2E9MA 5JUVA 2PLKA 2VC5A 4XAZA 5KVHA 1TPWA 1GQNA 4PR4A 3FA4A 2PDKA 3UNDA 2EKGA 2HCVA 5EMUA 2WXDM 3QR1A 1QPRA 4YTSA 4HK7A 4LVAA 4AEOA 4R7WA 2VZVA 4CQDA 3LY0A 3VIJA 4TIMA 4JTEA 4LB4A 4KF1A 1C91A 4TUFA 2DSWA 5CZJA 3U4AA 3V3WA 1E3XA 5JBFA 4L61A 2WJDA 4IZGA 3H2EA 3U2EA 1OB0A 4DXXA 1KR0A 3ZLHA 3HW2A 5HXMA 1L6FA 2XN1A 3QYSA 4U3CA 1QT1A 3FYOA 4R5EA 1ALDA 4PMYA 3AHYA 1CBGA 1FHUA 3RMJA 1B2YA 4IWWA 4GQRA 1ZP3A 3NPXA 1OFEA 3SR7A 1W6TA 4KIEA 3V4BA 4QE1A 3ECQA 3ERPA 4PUEA 1LQ0A 1QPOA 4BZYA 2VGFA 4ALDA 3E0IA 1RUSA 1OF8A 1NWSA 1CLKA 4CCDA 1SZEA 3B9JB 2QV5A 1JNDA 1NPXA 3N13A 1T6MA 2VGBA 4DZHA 4Z2IA 1KM1A 3DGBA 2AGKA 1MEWA 1TJRA 4LVDA 3A22A 4IQEA 2WOQA 4D8ZA 1E4NA 2ISVA 4B2DD 3ITYA 4N9BA 3HF3A 1BG4A 3FX4A 1W91A 3G1RA 4QGCA 1E5JA 5TNVA 7REQA 1UMLA 2VWTA 3R07C 4A6GA 5DXXA 4YJ5A 3K4WA 5TAOA 1F3PA 1W17A 4GBUA 2UZ9A 1H62A 1U1HA 3CEPA 3G0SA 4UWMA 2QYGA 4UQCA 4YMZA 1DHKA 2HK0A 4H4VA 4CQAA 4OBTA 2VFIA 4R7OA 4LB3A 3K2GA 3FV9A 4HU3A 2DVUA 1SJBA 3G2GA 5HNTA 2PDCA 3R8RA 3A47A 2XHYA 1EXBA 2Q02A 4DBEA 3P74A 1XRFA 5CPOA 1E6NA 1IYXA 3WUFA 3UGRA 1F6YA 1JYVA 4QP0A 2W91A 3GM8A 1UBPC 4O11A 2J7EA 4A8IA 4HNLA 4WK9A 2OJPA 2O9RA 1OT1A 3AXMA 5DF0A 1EQCA 1FXQA 2WVTA 5IOBA 4JYEA 3D6NA 4NASA 2E6AA 1FHLA 1GYMA 3HQ1A 3M0KA 1KV5A 1AODA 4H4IA 2NT1A 3WMBA 3SFWA 3EA1A 2QCDB 4C7FA 3LB0A 3V0TA 3AIUA 1ISZA 3GD4A 2P10A 4DWSB 3FDGA 4EXAA 3BPWA 2A85A 2HVMA 3FHAA 4PB5A 3LCWA 3TDFA 4Q6JA 1Q66A 4OU1A 3URHA 1XRTA 1PIFA 4RW5A 1N61C 1YBQA 4YCOA 2HS8A 3AYRA 3REQA 3H4XA 5FSEC 4PMOA 2Y7FA 3GG7A 3SUWA 1E4MM 3AUJA 3BJTA 3O8AA 3AN1A 2ZICA 4YYFA 1S3HA 2Z2UA 2ZBTA 5KTLA 4Q8NA 3ZR5A 1EBDA 2J7DA 3EAOA 1UD5A 5F2MA 4JTAA 3DERA 1JF6A 3AXHA 2PWVA 3QV6A 1PO9A 4LRSA 1E6ZA 3TKFA 4LCQA 1S5TA 3R43A 5KMYA 1QO2A 1BRLB 3WENA 5CGQA 1JDAA 2ADAA 2VFFA 3U0HA 2MUCA 4XD5A 3BLEA 1IR2A 1TTJA 3TROA 4QE5A 3VZYA 4FNRA 4J3XA 3W76A 4NZJA 4REQA 2GVEA 3BMWA 5F2GA 2V8ZA 4H9XA 1NDYA 2PTWA 3MCOA 1YQ2A 1QHOA 3ARUA 2QZRA 3QFBA 3EXSA 5REQB 3WLRA 4PMVA 1RM6B 1PIIA 2EEXA 4WCJA 2PU0A 1KM5A 3QPZA 1MW0A 2D22A 3NSNA 2AKMA 3H26A 1E0TA 1OGBA 2I5IA 4CQ9A 1DV7A 3SR6B 1XYZA 4WF7A 3M16A 3WF2A 4OJYA 4EMIA 2DT3A 1MYRA 3JW7A 3AWOA 2FQIA 1OFDA 3MHGA 4N9DA 1HP5A 1H1NA 1AL8A 2YVJA 1MMFA 2WMIB 5LYRA 1LLZA 1JAEA 3QGKC 1E56A 1LBFA 3RM8A 1A0EA 4CU7A 2DIEA 1ZJIA 1DXLA 1J2BA 4HN8A 3DJJA 3CL7A 2R9ZA 4Z1DA 4NNBA 3EZ4A 3TXZA 1CCWB 3UPWA 1NDWA 1O6IA 3RLHA 5AC4A 1ISXA 2FMNA 2E40A 4HSNA 4HTYA 1XUUA 1A53A 1I4NA 2GWNA 1IWPA 1WDSA 2XGBA 4Z08A 4QXIA 1VENA 2DPEA 2QVNA 4WKHA 1RLDA 3PUOA 1Z48A 4HHPA 2GR2A 4PL1A 3BL3A 4JX6A 2GGJA 1EFZA 4I9TA 3DGZA 1HVXA 3CHEA 3W53A 3CUXA 3LQLA 3S1GA 4MG4A 3WQEA 4GC3A 4ZB5A 4XZHA 3SQMA 1WP6A 3FK4A 4AC7C 1C92A 2OKTA 5C71A 2PWFA 4DO6A 1V6YA 3ABRA 3NVYB 3B4YA 2R14A 1IEWA 2YBUA 1OFOA 3SGGA 2H6RA 1VEMA 2XSBA 3SURA 3BG3A 2PCQA 3W27A 5K3VA 4OBSA 3WYZA 2NSOA 2RDXA 3IJQA 5HQLA 3BAKA 3TW7A 3ORWA 4PSRA 3HGSA 2ALDA 4CD5A 4KT2A 4MJ4A 1G01A 5TR3A 2H3DA 4TVWA 4AH7A 1HJUA 1MXSA 3BOLA 1XIMA 1P0BA 3U4FA 1AZ2A 1WDRA 1FVPA 3BJSA 2VC9A 3TWAA 3A3XA 2IKHA 1LPFA 1YNPA 1M65A 2G37A 3N18A 2FPYA 4DYKA 1HIZA 4CN6A 3THQA 3GXFA 4UFIA 1M7PA 1H1YA 1X8FA 4J57A 1OFRA 4UQEA 1F74A 3DBPA 3WKZA 2UY5A 4CLMA 4ZENA 3TA6A 2CETA 3F2DA 3NZRA 2P5NA 5PTDA 3WK3A 2VZUA 1ICQA 2VFHA 3IANA 4JKMA 4KCWA 3M1ZA 2D20A 2YB4A 1QU4A 5CSRA 2ZXAA 1NF7A 2CZEA 3A64A 3QEZA 1JRPA 3NWRA 4O1FA 3OHIA 1TWSA 3O3RA 4GYPA 1JUEA 4LVBA 3ZQ9A 3OIXA 4F0LA 1R3SA 2GL5A 3QJAA 3W7OA 2PZNA 3T4CA 1XLDA 4FX8A 4NJHA 2E3ZA 1KB3A 2GQ9A 4Q4PA 4PSPA 1W8GA 3BH4A 1LORA 3H54A 1TMQA 4HZMA 1TUXA 3F4DA 2YL5A 3TTQA 5KITA 1UWUA 3GR4A 2FZ8A 1IIGA 1P6CA 2PD9A 2YXXA 1UQYA 2CW6A 5DQPA 3KRSA 1WZKA 1G5AA 1BXNA 5AYZA 3IARA 1E9ZB 4S3BA 2WMHA 2GK1B 4Q8PA 5D03A 2R1MA 4MWAA 2BG5A 4FK9A 4LNYA 5HOSA 2QJNA 5A6SA 2V69A 3ARTA 2QCHA 4ZSTA 1K6AA 2XWDA 3SFKA 4QS5A 1TPUA 1U1JA 3PBWA 4XKYB 3O1NA 1VFLA 2R94A 3CASA 2ZWZA 2IPWA 2E5BA 4RJEA 3AS3A 1VYSX 1KNWA 2V5LA 2YBVA 4AHPA 4NP7A 3U5UA 4C7DA 1O5QA 4E0CA 3GX9A 3EF6A 2DZWA 3WNMA 3II4A 2HRWA 2IXVA 4IP4A 2DH3A 1KKOA 1TQXA 4GY1A 1PL9A 4ERGA 1E0WA 3PANA 3MV01 1AQ0A 4J2MA 2J9ZA 5M17A 2O55A 1OJTA 2F6XA 2A7PA 1EH9A 4BWLC 2BVDA 2E6YA 4H8HA 1UKSA 1SZRA 1DTNA 5EBKA 1FWNA 1E71M 1J0YA 5JMUA 3AZRA 1M1BA 2CESA 3F1QA 3RO8A 4Q22A 5A6LA 2ZIDA 1EC8A 1VBGA 1XIIA 2VRJA 3G0UA 4X9YA 2ZDSA 4LUIA 4MDOA 1R3YA 3UXDA 3GVRA 1V6XA 2YVGA 1XKYA 5LIYX 4RZ5A 3CZGA 1S5WA 4HZ8A 3W7HA 7TIMA 1TJ0A 1WZMA 3KL5A 4E5TA 4GQ0A 1H49A 2BXYA 1U2YA 3NIYA 1Y0EA 5BMXA 3W7MA 3MW7A 4NZ5A 4EKJA 4YTUA 3CV7A 1K4GA 1E1EA 4BHYA 3RX4A 4DJDA 1US2A 4JICA 2QDGA 1JZ5A 5BOOA 2D0GA 2E6FA 1ME7A 1F8IA 4KESA 4LYPA 4PRRA 2BHYA 2ZZ4A 4JX4A 3IGXA 3K46A 5XIAA 4HOZA 1H61A 4H19A 2NX3A 3PS7A 2KAUC 4GACA 4AHQA 4QX4A 2PDPA 3O0HA 5HDRA 4K37A 3NCOA 1ZBKA 3WQOA 1TE6A 4WDUA 4MKSA 1W56A 2G0WA 3CQKA 2XH0A 3TP4A 4PEEA 2QR6A 4QE4A 1ME8A 3QMRA 1JEZA 5DX7A 3WLNA 1Z44A 4C5YA 4HNVA 5M5DA 1NEYA 1ISWA 1M04A 2DZUA 2YDQA 2F9RA 4IJRA 1MXDA 4DUXA 1FO4A 2WQDA 4HJWA 4LYRA 4FALA 3QN3A 5BWAA 4CNNA 2UV8G 1D2KA 3B8SA 4C6PA 3CMGA 2J8FA 2ACUA 3J7HA 3DFSA 3LPOA 5ENLA 3GNNA 3MHUA 1ODZA 2V9DA 4UQBA 4ORMA 1PKLA 3S5ZA 4LAMA 3P7YA 4NQ1A 2DQWA 1VCVA 2W9MA 1QI4A 3LCIA 1TA3B 3SZ8A 1ZAJA 1NY1A 1QR7A 1W37A 1LLWA 1A50A 4IPLA 1LUCB 1ECEA 2ZZCA 3VUSA 3P2VA 4ZQPA 1TG7A 3ZOAA 3BV4A 3EWWA 2CLKA 3DN5A 1J10A 4AWEA 4ZQRA 3ZVHA 1DJYA 3DFHA 2QNEA 1YDNA 2WAGA 1EEPA 2GDQA 4YTRA 3B03A 4W8BA 4CQBA 1GVIA 4HP5A 2D0HA 1Y65A 4LUYA 4WDWA 1BWCA 2D2HA 1J0IA 3OU8A 3OZMA 1R2TA 2HEJA 3PHAA 4PTWA 3EGJA 3RAOA 5K4XA 3HOJA 3UWWA 3WBXA 4FHAA 1HFBA 3RJXA 5CBJA 1BGAA 4XZIA 3ZWTA 1G4TA 2O56A 1FWEC 4H9YA 3WNOA 1TMLA 4KFPA 3RM4A 2R1LA 3WMCA 1ZBVA 3MT1A 3TTEA 2VZOA 4IFRA 1JF5A 3HGRA 3RPMA 4P7OA 2J13A 1GOIA 1XXXA 3BXWA 5I3HA 4GD0A 4DELA 1JQVA 1PWLA 1PSCA 1X39A 5A69A 4JL1A 3ZJ6A 1PKNA 1A5BA 4NUWA 5C55A 3WLKX 4ZFMA 3GXDA 5EBUA 2J47A 1S46A 3LSBA 4RV8A 1RK6A 2POZA 4Q7BA 1YTDA 4X61A 3BZGA 3KVMA 3N4EA 4TTUA 3BARA 4WSJA 5FL0A 1K8XA 3IV8A 1EJVC 3AC0A 4JHZA 1R0MA 2QUTA 1TV8A 1YPXA 4X0NA 1J18A 2R82A 1QWGA 4O12A 4P8VA 1VJIA 3QQWA 1QPQA 2JF7A 1E73M 3MU7A 3NGJA 3QOMA 4PTMA 2NVCA 1FXPA 1XWYA 3CEUA 4Q32A 5FS6A 5LIUX 3VILA 3L66A 3P14A 3V16A 3DH7A 3W7NA 2OSYA 2X0HA 1UWQA 2RJGA 3A4WA 3AU6A 4WSHA 3PNUA 2CZFA 4W9TA 5JH1A 3EDEA 4TVDA 2PLJA 3BZJA 1J8VA 1NDVA 5FEWA 1CGYA 3PPHA 1NARA 4GUIA 3SEPA 1LOSA 4F9DA 4QLLA 4OE7A 2ALRA 3H8AA 2BHUA 4MF4A 1LVLA 1EJWC 1MUCA 2GGEA 1DJWA 1MDLA 1NHPA 4FF7A 5CKSA 1I2RA 4AZBA 2WVVA 5CEWA 1GRBA 3WLJA 3EWXA 5E09A 4G9PA 7ODCA 1AK5A 3W72A 3QV7A 4AZ7A 3OZOA 1W3TA 2DZSA 1PJ9A 4PZVA 3V0SA 3CO8A 3TUUA 4F79A 3AS0A 3II1A 4EIVA 3CLWA 3BMVA 4Z2KA 2DT0A 1E51A 3R8HA 5CJNA 4IISA 4AZHA 4O14A 4RNJA 2PWUA 2XGZA 1PAMA 2TSYA 5AYIA 3UJ2A 2QPSA 3UETA 2ZADA 4TQTA 4C6QA 1YBQB 4OOUA 1O5RA 4QTGA 1YEYA 3PG8A 3CZEA 3FGCA 4F3HA 3W1TA 1UUOA 3ATYA 2WNWA 4QQ3A 3LGEA 1UBSA 1VPYA 5H91A 2ZX6A 3OOQA 3LCHA 3O0FA 4HNTA 1KM4A 1XFBA 3PUDA 2AQWA 3LTPA 3AO0A 5LNUA 4GIYA 2ATMA 4AU0A 3MBDA 3CAQA 3IAQA 4DAIA 3GIPA 4YXGA 4I9JA 3W1PA 3SCRA 1Q6FA 4I6VA 2VL4A 1JEHA 1ZRQA 2HNEA 5FF3A 1ICPA 1US0A 3AXXA 3IC9A 1EWDA 4RZ4A 3UZXA 3SW6A 3QLLA 4REQB 4JFVA 4O54A 2ZWYA 4WJEA 2VGIA 3P8IA 2F38A 1DTUA 3LN3A 3UPMA 4H8UA 5ABFB 1AW1A 2VVSA 3VXGA 4RE3A 4GR1A 4E4FA 3FFSA 4S3JA 3MANA 1I0BA 1XSIA 3GC2A 3QW3A 4FOJA 3OVGA 2CNCA 3CS2A 1KRMA 4DJED 2Q09A 4QDPA 2VELA 1PCKA 2QULA 5HWJA 8RUCA 2L5HA 3I65A 3KDNA 3FNDA 5DT5A 3HMJG 1GRGA 4JTGA 1L8NA 1A0DA 2HK1A 4ZO6A 3G77A 1AQHA 4IPPA 3VUPA 3B05A 3TYDA 1OJXA 4DUOA 1HTIA 1XLGA 3NQAA 4IM4A 3HPXA 3OTRA 2GFTA 3T09A 1UR4A 1SO6A 2WJFA 1BWVA 4IMAA 4ORIA 2CXGA 4G6CA 3L68A 4GY7A 4PRTA 1C8QA 3MPGA 4OV9A 2ON3A 1MWOA 4OKDA 2ZZ6A 5M3WA 4BK9A 1LT7A 1QVBA 4BY3A 3VIFA 3CXBA 1C8VA 2ZRVA 4WD0A 4BA0A 4B90A 3TTOA 1FFVC 3PZOA 4X63A 3WJZA 1E6XM 2VX6A 4AW7A 4QHRA 4A21A 2ZRYA 5LGZA 3MO4A 1RALA 1O95A 4MIMA 3UG5A 3LTYA 3PJUA 5DCDA 3CV6A 5LHEA 1HT6A 2V82A 1GOQA 1ISYA 1G4EA 3A13A 1S5NA 3F03K 5FOOA 2PLCA 2UY2A 5XINA 3KZPA 1LG1A 4NY2A 3P67A 1WUFA 1H11A 2WHJA 4Q8QA 3IWPA 2A7NA 2PRHA 3EKLA 2WP6A 7CGTA 3QFAA 1V6VA 4JTFA 4NI8A 5EMMA 3NQ8A 5I09A 4RV3A 2WCGA 5LIKX 5T8GA 2VEMA 3EUB3 4IPJA 1AW2A 1KW1A 3GLCA 4A3UA 2F84A 5FMHA 3EX1A 4LTSA 3NZ1A 3AQUA 5G4WA 4FX9A 2IKJA 4DI9A 2FVKA 2VEPA 4YWIA 3PTQA 1P6BA 3DECA 1R2SA 5AHFA 4DPQA 2I5GA 4K7VA 1KBJA 3LXAA 5CGMA 1UR1A 3N14A 1YTKA 1PTAA 3O6AA 2YA1A 4J35A 5GNYA 5DCBA 2IPFA 1GEUA 3QPEA 3IJ7A 3AIRA 3F2CA 2I57A 5FCZA 2NWSA 3QF0A 4M56A 1LG2A 3UWZA 3V0UA 1L6WA 3VINA 1JQXA 3QLDA 5JQ9A 4H7CA 4O50A 3S5YA 1OIMA 2OWXA 1RK5A 3EXRA 3FKRA 5CSUA 4Q6XA 4K38A 5U1OA 4B5VA 3CBWA 3UVAA 1G67A 1M03A 3WJWA 1JYXA 4RPQA 5FD0A 2YDRA 3VOIA 2DJXA 5E6ZA 2DVXA 1VFTA 3A3WA 4GY0A 3M47A 3WLLA 4XBJA 4HJFA 1FDYA 4TX8A 2WQPA 1SR9A 3NZQA 3G1DA 2BODX 1HQTA 3GE7A 3PZNA 2BY2A 1BWLA 3N25A 1NP2A 2WSYA 4UCGA 1FKWA 3CT2A 3RG6A 3BAXA 3GSMA 3H2AA 5A2CA 4DWSC 4MWAB 2W3ZA 4O0ZA 4ACZB 4FOKA 2DEPA 2YCKX 4GE8A 3UCQA 4WKFA 3URNA 1VR6A 1CWYA 1ZL1A 1P0EA 2R1NA 2PFHA 3C2EA 2JIWA 3CIXA 3TK7A 4JIHA 1R38A 5JCNA 1B0IA 3K4AA 4D2JA 1TIMA 4RPPA 2JFEX 2AMGA 4KS0A 1H0GA 1B31A 2ZVIA 1IWBA 3L4TA 4J9JA 3CHVA 2W3RA 4WXYA 1YPIA 1CI1A 1QWKA 4GJIA 1QOPA 2ZRWA 3TQPA 2QJIA 4H4TA 4DBDA 3QOKA 1RR2A 1KTCA 2TYSA 2VR5A 4X2RA 1ITQA 2OWCA 4E4UA 3GD6A 3IGUA 4GYFA 1XGEA 5HA7A 1FWTA 1QNQA 2OCZA 2YCEA 2PTZA 4NAEA 3M5VA 2P88A 4GVIA 1TWZA 3GNOA 2RGMA 2MNRA 3E74A 1CW2A 3JZUA 4BWLA 3EKGA 1TPB1 3EEZA 1MZHA 1EF2A 4JNZA 3NOYA 2XINA 3GIYA 1Q1WA 4PMXA 3M43A 4LUSA 4UB9A 3EOLA 3RJYA 4IJBA 5LHFA 1H7WA 2X8HA 1JVNA 3G6MA 1VFSA 4D6IA 3WUBA 2QCGA 3NS1B 1SUXA 1GJWA 4AF0B 3QRHA 1OG0A 4DUVA 1IGSA 4X22A 1BLIA 1OIFA 3C5QA 3N6QA 4Y2WA 4GGBA 4S3KA 3L9CA 4FNTA 2P3ZA 3WSUA 1TPEA 1NF0A 1THFD 4K1WA 3UJEA 4MZYA 3WNLA 3WQDA 4DZAA 5FKYA 4YLWA 1FA2A 1UA3A 3NVZB 1TTIA 4PMQA 4GCXA 4BEQA 2B7NA 3ITLA 5HUPA 5FAJA 4XVEA 2JQXA 4DVOA 4IG2B 2NT0A 1QUMA 2E8YA 4K6AA 3TC3A 3UVIA 4YTTA 2A7RA 4O8RA 2AGTA 4DJDD 3BOXA 3M0LA 2CLIA 2H8XA 4JEJA 2Z2AA 3ZM8A 1J6OA 5SWUA 5AHEA 1OG6A 4GOAA 2NX1A 2Y61A 3BCFA 1DWHM 3C8NA 4GYJA 1EGMA 1MOKA 3WMSA 1OFBA 2GR3A 2OKOA 4AZGA 3COTA 2A3AA 1ZGDA 3GDBA 1DHPA 4M1RA 2X7WA 1BVZA 4W86A 3VGHA 4BV6A 1JCXA 5L6UA 4APNA 4LUTA 3A4XA 5JIWA 3PR2A 2FB2A 1KO0A 4GVFA 3GH5A 3SCSA 1XW8A 3LPGA 2GWGA 3MKCA 4BEUA 3GXMA 4KWSA 2G95A 1WKFA 3G1XA 4OHQA 2YOCA 2CLOA 4DBWA 4JDRA 1W5QA 1V02E 1UD8A 2IQTA 3TFCA 1IT0A 5C6MA 2DSVA 1EGZA 1TKKA 5LNSA 1G69A 4QM1A 2J78A 3NQBA 4HCHA 2VFDA 5B7YA 1WV2A 5FF0A 4KCVA 1R47A 2HQMA 1VRXA 5D9OA 1S2VA 2X99A 3IVTA 4MY9A 3VIHA 2VQTA 5JCIA 1GW1A 2ZXQA 3FLUA 1GKRA 4O57A 3UP8A 3LHUA 3DFQA 4U31A 2OU4A 4A35A 3KHJA 3TONA 1XPYA 1NVMA 4J27A 1Q45A 4LY8A 5MHBA 5FJPA 2FZMA 4HSOA 4MB5A 2HS6A 2VP8A 5EGRA 3PJXA 4ZTYA 4F0KA 3BWWA 3D46A 1RQHA 4Y7EA 5C9ZA 1GZ1A 2BOEX 3CAWA 3O6CA 3TOYA 3OPSA 1DJIA 4XO6A 4ADUA 4W84A 4JTHA 1HUVA 2YGYA 3URQA 2GPTA 1OD8A 3UJRA 3E0WA 3RCNA 3AYSA 5CBIA 2FMOA 5HNRA 4GRTA 1QPKA 4M7SA 4J5NA 4V2XA 1H51A 3PNZA 2OT0A 1ONWA 1YQZA 3A12A 1PB0A 2XISA 3XISA 2A3CA 2WCAA 4NJJA 1SW7A 1W9BM 1KBBA 3BLIA 3A7UA 1C9DA 1YYAA 2XFRA 1OQFA 1UIPA 2REQB 4UNKA 1ZENA 4XX6A 1OCBA 1VCFA 4DX3A 2DW6A 1Q7QA 4ICMA 3FJ6A 1XGZA 3CPGA 4PUJA 4JN7A 2DT2A 3ZO9A 3VKJA 2GSJA 2DORA 4QJ3B 3OLEA 3A5FA 2BASA 2CBJA 2HDJA 3BW2A 7TAAA 2OZ3A 1SPQA 1HL8A 4IGHA 3RNMA 1H09A 3JUGA 3PBUA 3K1GA 4UCFA 1SB3B 5TQLA 3G1YA 4HNCA 5GJPA 4H4PA 4H3DA 1LJYA 2NX9A 2ISFA 3IGHX 1XDMA 4PFHA 3LOTA 3TJIA 3WD2A 4JOMA 4BF9A 1I6NA 1CXHA 5FF2A 2XVKA 3FSUA 2E0PA 2CLFA 1G7VA 2ZX9A 3CT7A 5G2WA 2PZ0A 4JEQA 3IJ9A 3UY7A 3W1RA 4KFNA 1OX4B 2X05A 2D2OA 4AD3A 4NAFA 2GJXB 3TTSA 1AD1A 1TREA 1RP9A 4LPCA 2NSXA 3C3NA 2QDEA 1V3KA 4K7YA 3GK0A 3SSZA 3BSGA 1GETA 4H9MA 5ECVA 4RDWA 1U5JA 1SMDA 2C3ZA 2X16A 1QHPA 2VURA 3R8GA 2WHLA 3AHTA 4UMBA 1S39A 4RX0A 1WB0A 5FJOA 4PMZA 4MNKA 3PTMA 4GQQA 3PZ9A 1XH2A 4C6FA 4K8GA 3GFYA 4IOTA 3B9EA 1JCJA 5K9XA 2V81A 3UCDA 3A24A 3BSHA 1OT2A 3VD7A 4O1CA 2EPKX 4N7QA 4CVUA 4S2CA 3MVTA 1KWKA 1WX0A 5KZDA 3E96A 4PMDA 3N2CA 4PGLA 1UKTA 4S2BA 3WLOA 3CQIA 3V5FA 5JCKA 1C90A 5HPOA 1HJVA 2DVTA 4B4HA 4X60A 3USZA 1PX8A 1G7UA 3BLDA 4F2BA 2WKLA 3NYDA 2VENA 1MO0A 6ENLA 1P6WA 3EKZA 2RFGA 1XIDA 2NXHA 3FIGA 4LNCA 3S2LA 1DIKA 4H6KA 1A3WA 3N1AA 3VMNA 5E5CA 4D6DA 2WZMA 1UH4A 3RNDA 2Z4GA 4IMEA 4YWSA 3EOUA 1DP0A 4FNQA 4HYWA 3HBLA 4EQSA 1U33A 4M29A 5F7UA 1FCBA 3UZZA 1XYFA 3EANA 2EHHA 1JOAA 2CITA 2QIWA 1NJJA 1N62C 3QGVA 1JG9A 3HPAA 3GHTA 3UF9A 2ATSA 2EG7A 2YQUA 5AZ0A 2OX1A 3CUJA 2ABAA 2YCIX 3CL8A 4CNOA 3QHOA 3RFAA 1W5PA 3HQNA 1HKVA 2G97A 2C16A 1BKSA 4O0KA 1R9XA 2QJHA 4JX5A 2G3IA 5LSMA 1KTNA 1W1PA 1MNZA 1YDVA 1TWIA 2OGJA 2Q3OA 2OQLA 3BOFA 2W0HA 2VX5A 1J9YA 1LM1A 5LA0A 1YXCA 3MDUA 4S38A 1SR0A 1LROA 1OC7A 1Q85A 1HJSA 3KLJA 1XCWA 3HJEA 2V5KA 4XSLA 3VNMA 4XBSA 3QMTA 2NWRA 4HNUA 1V03A 2GQ8A 4A8LA 5AN7A 3TFXA 4YYCA 2J8GA 3KP1A 4U4MA 2WM0A 2Z29A 4FXSA 4O19A 2HE5A 5JIPA 4XIMA 3RPTA 1NOUA 1SJDA 3BSMA 2PDHA 4O4WA 2RHGA 2YSWA 4AEFA 3CGBA 4PCSA 2QJGA 1S1RA 3WLPA 1G9HA 1QFEA 3ZWSA 5CJ5A 3OZPA 3L2LA 3VFCA 1OZMA 2Z0IA 1YE4A 2WOVA 5DN1A 2QJJA 4GZEA 1FFUC 3DG6A 3AFBA 4FX7A 3L21A 3W7PA 1T5AA 4MB1A 1NHSA 2QCMA 1O7AA 1D7KA 4LOCA 1GPFA 3GNPA 2B7QA 3CPUA 3BTNA 4AZ6A 3LBOA 5M03A 4RNFA 4WY0F 3ZJ8A 3N6HA 3TV8A 2V5CA 3NFUA 2CKSA 1TVPA 1STZA 5J5RA 2PRLA 3OHMB 1Z6KA 1LRTA 1BFNA 1WAWA 2CKRA 3VM7A 3IJ8A 1GZJA 4CNUA 4G1NA 4PCNA 4US5A 3CIVA 1QDSA 5EFDA 3LQGA 4AD4A 3RR1A 4BKNA 3C2FA 1RCOB 2Z24A 4PUUA 3IEBA 4EOUA 5F2IA 5EBAA 2DZBA 1R7AA 4MM1A 1DVJA 5A3HA 3D5HA 1V0KA 1J0HA 5ER0A 1V3LA 3WF0A 2A1YA 1EF3A 1XDJA 5C2GA 1V0MA 3HPSA 2NZLA 1FFQA 4UR9A 4GPNA 4JKLA 1TYTA 2P0OA 2W62A 1FKXA 2GJLA 1UZHA 4Z1AA 5BOEA 3T2OA 1ZTVA 3LZ3A 1CXEA 3N19B 4MGGA 4DNMA 4WDXA 1BQCA 3FSTA 2CZDA 2GSEA 3HA1A 4H9VA 3DXIA 3UPBA 3BQ6A 4AVFA 1UD4A 3RXZA 3MMDA 1GHRA 4BR1A 1MNSA 5CC5A 3F5KA 1J79A 4DLMA 3VNDA 1CB7B 1REQA 3GNDA 1XH0A 3VABA 3WNPA 1S5MA 2X1RA 3NQGA 4NIRA 2R91A 3QZAA 5I7GA 1EYWA 5HATA 1CYGA 4O52A 4F0HA 2OR2A 2ZX7A 2V6OA 1TUFA 1R5YA 3EDKA 5I2UA 3KWSA 4TTGA 3N15A 4EPEC 2I56A 2O7QA 1KXHA 2HNHA 2XSXA 1AL7A 1PHQA 2OPJA 3DEQA 3EMQA 1EZ2A 1ZFJA 2DUXA 3BCJA 3KDOA 1JPKA 1UWTA 3GXIA 4KPLA 1XLBA 4IX2A 3R6IA 2ZTJA 3ONBA 3S5OA 3WK1A 1EP1A 4O8AA 1TPFA 1W3LA 2QCDA 3URBA 3QZEA 3SJ3A 3AJ7A 1JCMP 4DWSA 3U5YA 1E1CB 2FH6A 3L5LA 5CG0A 3FHQA 2YKKA 2Y5SA 3VD3A 3W1NA 3LCLA 1MUWA 1RCXB 5H6HA 1H50A 3H70A 4FB7A 2V5BA 2R1KA 1IXNA 4GNJA 2CLPA 3U2CA 3QXBA 5A6TC 4A3HA 3FOKA 3ARYA 1R85A 2Y63A 1XICA 1BYBA 4JTJA 3JR2A 2PAJA 1RZMA 2DH2A 3CQHA 3O05A 4LVGA 2YR1A 3PZQA 4GINA 4NZ1A 3N73A 1M7XA 2ZZ7A 1TYPA 4GK8A 3OB8A 4MZ1A 2FJKA 3AIQA 3CNYA 4I9MA 4MYAA 1XH1A 2OVLA 3IIZA 4FP1A 3PJTA 1BRLA 4EMJA 4GFIA 3GAYA 3W23A 5C7HA 5LGXA 4UXDA 3AHXA 4V33A 4EM4A 1JFHA 1UZ1A 3SCVA 3VOJA 3CQJA 1TWWA 3E2SA 1P4CA 5HULA 3DFYA 2C91A 4F40A 3NZPA 2UY4A 1RXOB 1VBRA 1XISA 2Q01A 4LYQA 3ENLA 4OTKA 4XD3A 3WMLA 1A4LA 1A3HA 5A5WA 3CB3A 3MMUA 3ZT7A 1I2QA 2IQ0A 4MSSA 1XLIA 4PTXA 5GVJA 1NDZA 5REQA 5M1TA 2E77A 3VNZA 5LZLA 4ZQNA 5BXTA 3DHFA 3RLVA 1EJUC 3AS2A 1KGUA 3T0DA 2XN2A 3H4GA 4QCEA 1XINA 1X97A 1KM3A 4B16A 3APGA 4FIQA 5HWNA 2J6VA 3CXOA 3KLLA 4AZIA 2E1WA 3AXIA 3HO8A 2Z1VA 3ALGA 3MJMA 3AZTA 2WKJA 4V15A 3WD1A 3V75A 3WD3A 1EJXC 4W5UA 4FR6A 3TQKA 3MMWA 3M0MA 4UTHA 2I17A 1E3ZA 3IUIA 2WMIA 1XYLA 2YVFA 1LRQA 1JYNA 4UFHA 3EA3A 1GVFA 4UTFA 3ARVA 2OGYA 4XVDA 1M5WA 1RAKA 2W66A 4YU1A 4EK7A 4ERAA 5H1WA 3I3DA 1ZKQA 4JQ1A 4S1FA 4ZODA 3MC5A 3LNMA 5FIPA 2A6NA 4PUMA 3T05A 1SO3A 4AWUA 2Q8XA 1F9CA 1VQTA 3NVTA 1TO3A 2ZFAA 3A4AA 1E6SM 3CH9A 4KEVA 2AKZA 4FLSA 4P8WA 1SO4A 4FAMA 2D3NA 4JDYA 1XANA 4KQNA 2PTDA 2BC1A 4KPRA 1K4QA 3HFTA 5ECUA 4FEZA 1GGOA 1B3WA 1KXQA 4LT9A 4IP5A 3TYZA 3NTYA 1EGVA 3M0YA 4KRZA 1RVGA 1JNEA 4LYKA 1EPXA 5FESA 2QUUA 4XSMA 5FJUA 1KXVA 5J5DA 1DEDA 4G1KA 4ENLA 4Q4OA 1K77A 3SY1A 4H00A 4DN1A 4XISA 3CC1A 1C8XA 1GEHA 1GVRA 3ZXWA 3WFZA 1OEPA 4B5NA 4MVAA 1L6SA 3CK5A 1ZHAA 1NTHA 4IHCA 1CZ1A 4L80A 3TSMA 1KCKA 1A47A 1O12A 4H9ZA 2OLHA 3AMKA 2O0TA 3HJZA 1O1ZA 1JD7A 5E0CA 2OYMA 4ZR8A 3AIWA 1PDZA 2A3LA 3F4NA 4O16A 5C70A 1H1ZA 1XRVA 3W7LA 1LP6A 5CSSA 3MWAA 2CEQA 4HD5A 2WYSA 4HYRA 3W28A 2IPJA 1OFPA 3GDMA 1EP2A 1VPXA 3H7VA 2EQ9A 3AMLA 3VIKA 2GJPA 2BDQA 1V5XA 2R24A 3CMFA 2QPUA 2FDSA 4R85A 2OOGA 2PP1A 2J7CA 2CLEA 2PTXA 4ILSA 3L5OA 2GVGA 1NWRA 3SCWA 4IP7A 1CGUA 3S47A 2O92A 2J8TA 3GUGA 1BYCA 3HMCA 1BZLA 2F6UA 5DY3A 1Y7VA 1Q65A 3DYOA 5D04C 1OCQA 1X7FA 3U6WA 5I78A 1HL9A 1GESA 2BGQA 4J3WA 1WXYA 2RH9A 2C0HA 1XV8A 3NDZA 4J40A 3W1UA 1VPQA 3K13A 5AFDA 2YL8A 3BE7A 4Y9NA 3ABQA 2JKEA 2RDWA 5LNWA 1XLFA 4AXKA 1CXFA 1TWDA 3MHFA 3PPFA 2UBPC 1H63A 2VQUA 1PKMA 1XD1A 2GR0A 4WXZA 3P93A 4R34A 4QAIA 4NZ4A 4QRNA 1KFEA 2Q8ZA 4BI6A 2B4GA 2VR2A 2ZZ2A 3RPDA 1NWTA 4QJ5B 2GK1A 1NFPA 3L7RA 2HVOA 1VFUA 1PEZA 2X1SA 3LHVA 3G22A 1E9YB 3UBPC 3MWCA 3CTTA 2X8RA 1Q8JA 1XCXA 3GR8A 1GYNA 3WEOA 4XKYA 2VKZG 2NQ5A 4Q8MA 3BLPX 2IXUA 4IIFA 3TYEA 5A8QA 5D9PA 4M19A 2QF7A 6TIMA 1R3VA 1DKWA 3SB0A 3LMZA 3AIBA 3BG5A 3DKLA 4FI4A 5DRCA 3KS6A 1FEAA 1EX1A 1TRIA 3A7AA 3CB8A 5LXXA 3QR0A 1B57A 4HCLA 3PY2A 5AC6A 3TN5A 1PV8A 3AISA 4TV6A 3SBFA 4G7EB 4JDBA 3ZYZA 2GDVA 3T9PA 4NEWA 5EMLA 2VD9A 3QBUA 4QCFA 1RD5A 1A5SA 1PZ3A 1J93A 1OK6A 5C2XA 1K9DA 5BXPA 1L2UA 1JCNA 3QHMA 1R6WA 3UT0A 4R33A 1ZY9A 3K8KA 5FAGA 3ITCA 4CU8A 4DJFD 3LLXA 4NZ3A 4MLRA 4ZOBA 1M9HA 3RIKA 3CL6A 4H83A 4NVTA 1AG1O 5FEPA 1W1YA 2WLZA 4AUBA 3L23A 2ZRUA 1F7BA 5HINA 2WB5A 3THDA 3G24A 1E6PA 5I03A 3MUXA 2WC7A 3T6CA 3WUGA 3HGJA 1UJQA 3MUY1 4UTWC 3S6TA 1E0XA 1CIUA 1ISVA 3PZGA 2Z28A 4FNSA 4RK8A 2ZXDA 3BANA 1FWSA 4JTTA 3M5ZA 1UUQA 2C13A 1GOOA 4RDZA 5AOUA 1D3CA 1HKKA 2PDXA 2A3HA 4S3GA 1QATA 5BXRA 3CZLA 4GUJA 4XUYA 4H41A 3NG3A 2GZXA 3MUZ1 4A8RA 4D6GA 3P81A 1DYSA 4OGZA 2XIOA 1D7YA 2WOWA 1J0ZA 3C0LA 1ZCCA 4MWAE 3W74A 2RAGA 3S2MA 3MSRA 4C60A 2BFGA 4P8UA 3ZFHA 1ADOA 4ZQOA 1TZ9A 3CUIA 1DL3A 1EJSC 4LF2A 2D73A 3W2NA 1A5LC 2VEFA 3C61A 5JCLA 3DAQA 1ZBCA 2FKPA 3W7CA 2RUSA 3R79A 3P5YA 5FJRA 4HU8A 1G6CA 1XYAA 5MKGB 1MRQA 4LBSA 2AL2B 1XQLA 4HGXA 5K9CA 3MYPA 1DJZA 1JZ6A 2WMKA 3K8LA 4DF0A 3PAOA 1FTXA 3RX2A 2ZXBA 1GRHA 3GQYA 1TA3A 2I1OA 1K70A 3QR3A 2XH2A 1TZ7A 2B81A 2XSAA 3PUGA 4J7RA 4NKCA 1XF0A 3P0XA 1LUCA 4HHHA 1XDLA 4WRHA 1EC9A 2BLEA 4QSHA 1XYBA 3DCPA 4AX7A 1AW5A 3H2CA 4JYFA 3GRSA 2E25A 2G4FA 5AZ1A 3LM7A 4HHMA 3T0CA 5DO8A 2XWEA 4TX6A 5HR6A 3WH8A 3K4DA 1ZS2A 1H3GA 4XD6A 4IFKB 2QDHA 4GKLA 1DXIA 4I5UA 3R12A 3E1F1 4L7ZA 5DBUA 4QNWA 3PWAA 1KFJA 4LANA 4EWND 1JYWA 3I7RA 2ZUSA 1DWJM 3SCPA 3LENA 1E6RA 2HBXA 3M41A 1BVWA 1V7AA 2V3BA 1X98A 4KEMA 1DJHA 4AAJA 1SFTA 4BQ3A 4ADTA 4UR8A 1LBLA 4OOZA 1AJ0A 4H2HA 3C3UA 1HF6A 3M7WA 2YB1A 2XIBA 3JU2A 4RNIA 3M7SA 3LG3A 1Q8AA 8A3HA 3G1AA 1FWHC 2E1DA 2WNQA 3HM7A 3Q2DA 5C5YA 3GD3A 1TE1A 3W1LA 3VTRA 3W29A 3GUWA 4EXBA 2XN0A 4ATLA 3W25A 1I1WA 2E6DA 5A6KA 4B91A 4JQ4A 4ZXOA 3CZ8A 1ITCA 4AIBA 1X6UA 4LVFA 3W00A 3W0KA 1JZ8A 2EPMX 4P61A 4US5D 5I5RA 2WHMA 3GXTA 2JK6A 3G3DA 1F73A 3UERA 1Z3NA 5T9CE 4O4VA 3KTCA 1W31A 2YCLA 1RBLA 3SGZA 4LSBA 5D2YA 2BB0A 3AMDA 3FS2A 3HZ3A 4PUNA 1S5VA 4P7QA 1LF1A 3WDHA 5EU9A 3S4TA 1EEXA 1QK0A 1XDIA 3UFYA 3HV9A 1KGXA 4HSHA 2X2GA 8TIMA 4F4RA 4N6EA 4PL2A 1R3TA 2WZEA 1UP0A 3W6LA 3CV2A 4JFWA 2ZZ1A 1GW9A 3NL3A 2HQAA 3QW4B 3L4ZA 3QMSA 4CKQA 4DWDA 2EPOA 4EVZA 5I3DA 3OBAA 5FA5A 4Y9MA 2OXNA 1X8CA 4HN4A 1UC5A 1OWQA 3T8LA 4FXRA 3BLKA 4HNOA 2VRKA 1QNPA 4DIAA 2YBTA 3R7MA 3CAVA 1UD2A 4RE0A 5FJIA 2F6KA 1BSLA 1P7TB 1DPMA 5K9DA 4EQXA 4IXXA 1REQB 4UTJA 1T99A 3THAA 4WR3A 1SFSA 5DY2A 2D3LA 4QR6A 4I90A 4D1IA 1GWJA 3M0JA 1AQFA 3UZJA 2P3EA 3P5ZA 2ZZ3A 1YX1A 1H7OA 5CLTA 2J7HA 1OSEA 3GKAA 4Q4SA 1DIOA 3KEHA 4L9XA 3LEPA 4HNNA 2INEA 1F4AA 2PBOA 3PZUA 4W7UA 5A8NA 2Z00A 3N12A 1MW2A 1RJQA 3CWHA 3OIHA 2FTYA 4HOXA 1FBAA 3ZS4A 4Q33A 3AAMA 4I9AA 5GJMA 4NG3A 3RU8X 1EJRC 3AMGA 1CXIA 3M4HA 2VX4A 2PMQA 3E0FA 4WOQA 3GYEA 1TELA 3L5AA 1V08A 5HNNA 1C9WA 1US3A 5KVIA 3STPA 4G2DA 1PBGA 4TXEA 3S1XA 4DWSD 2WZIA 2X40A 2WJEA 3MB9A 4HT3A 4ZZ9A 1MFVA 1YRRA 1J11A 1GORA 2W27A 1DNCA 4RLIA