3ZVHB

Methylaspartate ammonia lyase from clostridium tetanomorphum mutant q73a
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
415
structure length
414
Chain Sequence
b'MKIVDVLCTPGLTGFYFDDQRAIKKGAGHDGFTYTGSTVTEGFTQVRQKGESISVLLVLEDGQVAHGDCAAVAYSGAGGRDPLFLAKDFIPVIEKEIAPKLIGREITNFKPMAEEFDKMTVNGNRLHTAIRYGITQAILDAVAKTRKVTMAEVIRDEYNPGAEINAVPVFAQSGDDRYDNVDKMIIKEADVLPHALINNVEEKLGLKGEKLLEYVKWLRDRIIKLRVREDYAPIFHIDVYGTIGAAFDVDIKAMADYIQTLAEAAKPFHLRIEGPMDVEDRQKQMEAMRDLRAELDGRGVDAELVADEWCNTVEDVKFFTDNKAGHMVQIKTPDLGGVNNIADAIMYCKANGMGAYCGGTNETNRSAEVTTNIGMACGARQVLAKPGMGVDEGMMIVKNEMNRVLALVGRRKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLASPARTATE AMMONIA-LYASE
publication title Engineering Methylaspartate Ammonia Lyase for the Asymmetric Synthesis of Unnatural Amino Acids.
pubmed doi rcsb
source organism Clostridium tetanomorphum
molecule tags Lyase
total genus 162
structure length 414
sequence length 415
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
B PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3zvhB02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3zvhB01
3TJ4A 4KPLA 4IL0A 4HYRA 3B97A 3R11A 4IL2A 1XPYA 2GDQA 2FKPA 3QLDA 1OEPA 2QJJA 3Q4DA 4IHCA 4GISA 2ONEA 3MWCA 3THUA 2XGZA 3H7VA 1MNSA 3DIPA 3ES8A 2XH4A 3VDGA 1PDZA 1JPDX 3HPFA 1TE6A 4MKSA 4DXKA 3P93A 3UXLA 2QQ6A 1L8PA 4HCDA 3ZLHA 3UJEA 3QN3A 2PTXA 3GY1A 3K1GA 3SJNA 2POZA 2QVHA 1JPMA 3BOXA 1NELA 2QDEA 7ENLA 3ZLFA 3TCSA 1E9IA 1JCTA 1EC9A 5BOFA 3MKCA 1SJBA 3KUMA 3FV9A 4JN7A 3DESA 4GYPC 1SJAA 2NQLA 1JDFA 1MUCA 3IJLA 3ZVHB 4ZA0A 2OQYA 1ONEA 2OLAA 3RGTA 2RDXA 2QGYA 3P0WA 2OFJA 3N6HA 1PDYA 3D46A 3PK7A 4K2SA 3GD6A 3TQPA 3DGBA 2PTZA 3RO6A 3ENLA 5FJRA 3CYJA 3DDMA 3RITA 2MNRA 3OTRA 3SBFA 3GC2A 3TJIA 2ZADA 3PFRA 4H1ZA 5FJPA 3DG3A 5EU9A 3UJ2A 4DX3A 2PA6A 4A3RA 2AL2A 3MQTA 4J3ZA 4DWDA 3UJSA 2AL1A 5FJUA 4GIRA 3N6JA 4E4UA 2OKTA 3R25A 2GGIA 1P48A 1KKOA 4MGGA 3VC6A 4IP5A 1KCZA 3MSYA 3N4FA 3IK4A 4GFIA 2GGEA 3S5SA 1MDRA 3DFYA 3CXOA 2PU0A 2OVLA 3EKGA 4H19A 1WUEA 4ZCWA 1FHUA 2PMQA 4JN8A 2P0IA 3T4WA 2XSXA 4HCLA 2PGEA 1SJDA 3IJQA 2HXTA 3DEQA 4E5TA 4FP1A 4ROPA 4IZGA 5J04A 3NFUA 4F4RA 3CK5A 2GGGA 3RCYA 3BJSA 3OP2A 3R10A 2QJMA 3U9IA 2DW7A 3FYYA 2DW6A 3FXGA 4K8GA 3MY9A 3UGVA 4KWSA 1F9CA 3FVDA 2AKMA 4GMEA 1KKRA 3ES7A 3TWAA 1SJCA 4GGHA 3JVAA 2PU1A 3R1ZA 1MDLA 2P3ZA 3VA8A 4A35A 3QKEA 2OX4A 5FJTA 3H70A 2OQHA 4H2HA 3D47A 3V5CA 3FJ4A 3EEZA 3CB3A 4KEMA 1EBGA 1BKHA 5FJOA 2XH7A 2I5QA 3SN1A 2MUCA 1TKKA 4DHGA 3I4KA 2OZ3A 3TTEA 1DTNA 1XS2A 4K1WA 2PP0A 3H12A 3BSMA 3DERA 3TOYA 4HCHA 1BQGA 3STPA 4DYEA 2PP3A 1MRAA 4FI4A 3UCCA 3CAWA 2P8CA 5IDZA 1WUFA 2PPGA 4Z1YA 4M6UA 2AKZA 2OZ8A 3SSZA 2QJNA 4Z17A 3R0UA 3PWGA 4H83A 3OZYA 3UXKA 1ELSA 3OPSA 1EC8A 2PP1A 3TWBA 2GGJA 2GL5A 2PCEA 4MMWA 2PGWA 1KD0A 1W6TA 3GO2A 4IT1A 3NO1A 3DG7A 3V4BA 3N4EA 4G7FA 5ENLA 3JW7A 3VCNA 2QDDA 1IYXA 2GSHA 3V3WA 3ZLGA 3NZGA 4JHMA 2HNEA 2P88A 3SQSA 2OO6A 2FYMA 3DFHA 3JZUA 1TZZA 3S47A 3T6CA 3H8AA 2XH2A 3UCDA 2HXUA 3OW1A 3U4FA 1NU5A 2PODA 3NXLA 4DN1A 2OZTA 4E8GA 3UJRA 5BOEA 1ECQA 4HPNA 3FCPA 2HZGA 3QTPA 2PTWA 3ZVHA 2OG9A 4IP4A 4EWJA 3V5FA 4HN8A 2XH0A 4X2PA 3MUCA 6ENLA 3Q45A 4HNCA 2CHRA 3DG6A 3MZNA 4J1OA 3R0KA 3UJFA 2PSNA 3VFCA 4GYPA 1RVKA 3T9PA 2O56A 4YWSA 3RR1A 3RRAA 4M0XA 3SN4A 3ZVIA 3P3BA 1R0MA 3VC5A 4ENLA 3VCCA 3IJIA 3PWIA 2P8BA 3T8QA 2AL2B 4E6MA 1EC7A 3OZMA 3QPEA 4E4FA 4G8TA 3I6TA 3TW9A 1FHVA 2ZC8A 4A6GA 1EBHA 1R6WA 2PTYA 3SN0A 3CT2A 4GGBA 4HNLA 1P43A 2PS2A 2OPJA 4KT2A 1YEYA 2GGHA 3I6EA
chains in the Genus database with same CATH superfamily
5LNWA 1TWWA 3Q94A 1KBIA 3KOZA 3P74A 5EY5A 4H7VA 1P6BA 1JCLA 4C6QA 2QJJA 4R88A 3MMWA 2PBGA 3CQJA 1XFBA 4YVVA 5EMYA 2CLPA 5A8OA 1XIIA 2DZAA 4J2MA 3S83A 3VNDA 4Y96A 2ZRWA 2PTXA 4LY8A 2EG7A 3W1PA 4LVDA 3GY1A 2C15A 2QUVA 1TYTA 4TIMA 2X8GA 3UG8A 3MO7A 4N4PA 3T0BA 1FP9A 1HKJA 1GXFA 5CGQA 2YVFA 3A4XA 3OBKA 2XN1A 5AHNA 2DGAA 4AIOA 3R07C 2F9RA 3DESA 3WUFA 2VR2A 1SZGA 2CXEA 1YPFA 1Q1WA 1A5BA 2QJGA 2DH3A 1UWTA 4HA3A 4PB3A 4MZ1A 3DYPA 4B4HA 2IMRA 2EF9A 2D3NA 4AZIA 2Z1KA 1OG6A 4Z08A 1W1VA 3O0KA 4H41A 3UR8A 4EIVA 1VIWA 3SBFA 1XSIA 1GK8A 1F6PA 4DX3A 3K1DA 4ZB0A 2PUZA 5HMSA 3TZFA 4FIQA 2ZUWA 3A7AA 4WUIA 1NDYA 1TQXA 3MSDA 5LGXA 3WFLA 1IXPA 1UC4A 2DUAA 4JAWA 3A21A 1OIMA 4O1CA 2XM2A 3B0UX 2I5GA 4YTUA 1K7XA 1H5VA 4Q7NA 5HR6A 5BMWA 5HANA 4BURA 4LS1A 1KXVA 2QKFA 1U1UA 1CGTA 5C7HA 1BF6A 2EPOA 5HNTA 2CZDA 3ARYA 4LVGA 3OZOA 5CZKA 2RUSA 3BDKA 1KGWA 2OVLA 3EKGA 4UTTA 3SAZA 4F0KA 1C9WA 3RU6A 1WUEA 1VRDA 1THFD 6TIMA 3CHEA 1W9XA 4H4VA 2Y88A 1E0VA 1PKMA 1P6WA 4AUBA 1XICA 3KBNA 3JS3A 4JEJA 5KMYA 2VDHA 4PCSA 2PDGA 3LSCA 1FFVC 4LV9A 3LQGA 4LJ3A 3RO8A 3SRFA 4BWLC 3SY8A 5E70A 1K02A 4E4PA 4GI6A 4B2DD 2NV2A 3RPDA 3LB0A 2V6AA 1Q66A 1VENA 4HMEA 3WLTA 1E4LA 4K8GA 1SO6A 1K4GA 2VDIA 3DYOA 4ASTA 4FNQA 4CD6A 1E6RA 3MZ2A 3V75A 4X3ZA 4RK8A 3NUKA 4C6IA 5D2XA 4RW5A 1AW2A 3NXFA 2YR1A 3QM3A 3SGUA 1C8QA 2GOKA 6TAAA 1Q6RA 4S3EA 1S1RA 1GYLA 4RE4A 2FJKA 4HA1A 2BMBA 5IBXC 1Q5MA 2VVNA 1WPCA 1ZP3A 3M41A 2FVKA 4WKHA 2GSJA 1AZ1A 3QMSA 1UMYA 2G95A 3CZ8A 2E6DA 1NF7A 1E71M 3LENA 3G3DA 4DM1A 1XS2A 1RBLA 1K8XA 3LEPA 2CZ5A 1W32A 1V3MA 3ZSTA 1XYFA 3LXAA 1WDSA 3W1QA 5K4ZA 2X1TA 1R38A 3PTDA 6CGTA 3BTNA 1EDTA 4NYUA 3EOLA 1F61A 4Z1YA 4X0VA 4O4VA 1TQJA 3R8RA 2YOCA 3OG2A 4DPPA 1PHWA 1HZYA 4FDCB 1FHDA 3IPWA 4MAZA 4BKNA 2VC5A 4MVAA 1US0A 2WCAA 1MW0A 2PWEA 3L8KA 2DUXA 3UXKA 3LHUA 2VURA 3ZYZA 1XI3A 3KZPA 1D7YA 3EDJA 3V7PA 4C6OA 1NTHA 1HFBA 3GU1A 4H6QA 2NX9A 2VENA 1Q7ZA 2YCLB 4ATLA 4YYCA 1KM1A 3WQ4A 4WOQA 3N6QA 2GVLA 1XCWA 3VKJA 1V6UA 3ONBA 1O12A 1LUCB 3O0FA 1E6ZA 3AAMA 4HK7A 5BXPA 1M68A 1XDLA 4PB4A 4D8LA 1IYXA 3KBVA 5FF3A 3ZLGA 1XLKA 3NZGA 3AS0A 1FIQB 1W2VA 4MB1A 4BS0A 2R1NA 2FYMA 1QNQA 1WDDA 3OU8A 1VLWA 4IMGA 1HGYA 1PX8A 3TA6A 1MW3A 1FWSA 3TTQA 2HISA 3ARXA 5D8ZA 2XN0A 4XG1A 4FIRA 5A2CA 5A6SA 2NVKX 2CBJA 3WMLA 5KETA 3U4FA 4YCPA 2DT0A 5FEPA 3VNMA 4FO4A 1M5WA 2GDUA 5HK4A 2VD8A 4QEHA 2AQVA 1BXBA 1XYZA 2G4FA 4IQLA 2F2HA 1G01A 4HBKA 3EEGA 4CNUA 1QO5A 4ZE5A 1L6FA 2E3TA 5CLTA 2JALA 4UFIA 1O94A 2NLIA 5C6MA 1CWYA 1VCVA 3JRKA 4LIIA 2V5CA 4YWSA 5DXYA 2VP8A 2QJIA 3KCOA 3HTWA 1E5NA 3ORWA 3L2IA 4W84A 3TYBA 1FXPA 4DB7A 1MOKA 1ZCCA 1Z7AA 1H1NA 3FEMA 4JTDA 4PMNA 4YTTA 1NY1A 3G22A 3SGZA 3PPGA 4UR9A 4GJJA 4FLRA 4FB7A 2PWUA 2V5KA 1UR0A 4GGBA 4PTNA 3IJDA 4GPNA 2VQTA 1TTIA 3UXAA 3HU7A 3WYZA 1ALDA 4WGHA 1Q6CA 2INFA 3UY8A 2G50A 4DYKA 3VI2A 3RUBL 3WLKX 3UWQA 1LWJA 2VC7A 3Q4DA 3O15A 4IHCA 1RR2A 4AF0A 5F2IA 4GISA 3FYPA 3AXKA 1GESA 2XVPA 3C8NA 5A6LA 1NFBA 3E0LA 1EUAA 1U1JA 3AO0A 3BOFA 4XBSA 4AIEA 3M0HA 1W5NA 3BJFA 7ODCA 5AVNA 3ZLHA 3WLQA 1PB0A 1VR6A 3HN3A 2ZRVA 4V2XA 2Z1VA 4CVWA 3DHUA 4NJKA 3VFLA 3SY1A 2RDUA 1H2IA 1CB7B 3BOXA 3W1RA 3T78A 3AN1A 4P61A 5HAOA 1E9IA 4E8DA 4K1GA 2DSVA 2WP6A 5BOFA 1FOBA 2AAQA 4JQAA 4OE7A 5HMFA 1GOIA 4XAGA 1JZ5A 5AHIA 1ISWA 4FNRA 1TPB1 5DCEA 4RNJA 4LNCA 5CSYA 7REQB 1T8XA 1GQLA 2QGYA 3P0WA 3PG9A 1OGSA 1LRTA 2CLEA 4H6EA 2BY0A 4M56A 3P6LA 5I3IA 4K6AA 1S5VA 1S39A 1V7YA 3BE7A 3IIOA 3UWYA 1OC7A 3WK2A 1O1HA 4JYFA 1KFEA 2CPUA 4Q8NA 1ONFA 1L6SA 2VRQA 3MKVA 4DPQA 1PKLA 1GQNA 4EM3A 3UJSA 2WOVA 2B0MA 2I7GA 1ZAJA 3WF1A 3UNDA 2Q8LA 2VYOA 4KWOA 1FXQA 4C1NB 4QLKA 2VOTA 3BLEA 3R43A 1NP0A 5XINA 2ICSA 5BW6A 3ARQA 5HJYA 2FGBA 2VOMA 2X2YA 3W0KA 4IMAA 4B5NA 4QG6A 3V1PA 3SCOA 4Q6XA 4N9BA 1OT2A 4PUMA 1CX9A 4KWWA 4MUPA 4A8NA 4HPXA 2HS8A 9XIAA 3ARZA 3CL8A 5HNUA 2D0FA 2WMKA 4ZQRA 1Z69A 1YXYA 5E6YA 1MQPA 4EAYA 1GNXA 5A6BD 1YNYA 1YXDA 3AZTA 3PUGA 2VKZG 1GOKA 4B5TA 3L9CA 1P5BA 1XC6A 2PGEA 5CKSA 4AWEA 3G1HA 1E3XA 2YFOA 1J2WA 4GZEA 3EX6A 2NVCA 2GGGA 3VPLA 5HATA 3BJSA 3P81A 2EJAA 4LW7A 1A0CA 5A2AA 3DFOA 3QW3A 4J7RA 1IWPA 2DW7A 3QQ0A 3FA4A 5H8PA 3RM8A 3AYTA 1XR2A 2Y7FA 3BOLA 1XINA 2IKGA 3N73A 4J3UA 2OGJA 2HPIA 3EOOA 4NYYA 4UZUA 2PURA 3OBEA 4S3DA 4ZOEA 2TODA 4CU8A 3CZLA 3GHRA 3GSMA 1Z3NA 4UUIA 1RALA 1BHGA 1K9FA 4JTLA 4UFLA 1EX5A 2OQHA 3M16A 1PX3A 2ZUMA 3FJ4A 1JDEA 2DUZA 3BZGA 3GIYA 3AMCA 4KEMA 2VUYA 1VD6A 3G1XA 1KQYA 5DN1A 3F5LA 1F76A 2J7EA 3IGSA 1JYVA 1PUDA 3I4KA 5LXEA 4EF9A 2FMOA 4KFNA 1H6VA 4NP7A 1RY8A 3PPCA 2WCSA 4H9UA 3GXIA 1X2HA 3KS6A 2VM8A 3S0CA 1BXNA 4XIMA 4ICMA 2E5AA 3P5YA 3FX4A 1GZJA 4OBTA 5KSWA 1VFLA 3K4WA 4GZJA 3V0TA 4ZB2A 4KEUA 3I7QA 2FDMA 4W86A 4RPQA 4NRRA 3IGHX 1EYWA 3SSZA 4M1RA 3T55A 5DFAA 3T42A 2WK2A 2GJPA 3KXQA 1WBHA 4RUBA 5ABEA 3TAOA 1T0OA 4O1DA 1VJZA 4XVEA 2VD9A 3E0FA 1OFRA 3SCUA 3ZM8A 4DXVA 2ISSA 4Q4QA 4X9SA 1CLKA 4YYFA 4AD5A 2PGWA 2BCPA 4PB5A 4AD1A 1TSIA 1S2WA 4QG8A 1KN0A 3HFYA 4GY7A 2FMNA 4PR4A 1FWRA 1EP3A 4IJRA 5C55A 1FCBA 2O55A 1NDVA 4DJFC 1TTPA 2Y70A 2X50A 4DXXA 3ZFHA 3IIPA 4O1BA 5IDIA 1STZA 1K6WA 4DJED 1VHNA 5I3DA 2GYIA 4ZQNA 3EOSA 3TQ0A 4NZFA 2HZGA 3T2QA 4PBFA 4WQ6A 3T0AA 4CQ8A 5C9UA 2OG9A 3E9AA 2IQDA 3Q45A 2YBUA 4MB4A 2VO5A 3C3NA 5LYRA 1XBXA 4WK9A 2PFHA 3IVTA 1RVKA 4P8UA 5CPNA 4JNMA 3LZ5A 1B3VA 5GPRA 3CPUA 5CZJA 4QNWA 3HIJA 5DMNA 1GW9A 3L7RA 1SPQA 1HT6A 2DV0A 3D0CA 1UCWA 2WM0A 2D0HA 4PN2A 3R89A 1CNVA 4AFYA 3F2DA 1RQBA 3MS8A 2C14A 4S3GA 4KIEA 2VMFA 4AY8A 3NPWA 3CC1A 1DIDA 2H9AA 3PB2A 1K9DA 3VVGA 3VX1A 2H6RA 1VS1A 4A6GA 3V18A 1HP4A 4LU0A 3SRHA 2PDQA 3W7JA 2TMDA 3LHZA 3CT2A 5MHBA 3DKLA 4MKNA 2VFGA 4BF7A 2CWXA 4NZJA 3SECA 3NSNA 5AKQA 3WFAA 5FA5A 1XCXA 1SO3A 3TOPA 1E1CA 1DE5A 5BWAA 1IQ8A 1OCNA 1OYBA 4QLJA 3B3DA 3CMGA 3I10A 5G5IA 2JFEX 3QLLA 3KL5A 4LCRA 1KC7A 4XAYA 4LUJA 1RQHA 4IG2A 5TQLA 3P0XA 4RE3A 5BU9A 4M82A 3KZSA 3VUSA 2E9LA 4JKLA 4WSHA 1W1B1 2XGZA 1J01A 3FHQA 2XM1A 4FR6A 5KZDA 4PMQA 1HN1A 2J7HA 1CT5A 2V67A 3MC5A 1IZKA 1W31A 3EOUA 4W4QA 1EJSC 3P7YA 1QJWA 5AYYA 4XK2A 3DC8A 1QRQA 4K7VA 4PTDA 4GUGA 5DT7A 1XYBA 2XIOA 5ABFB 2WVVA 1SB3B 3TQKA 2UY5A 4L7ZA 4QDPA 4RNHA 7ENLA 4JIPA 1JCTA 4LC8A 1EYEA 3WELA 1EOMA 5K9XA 1W3HA 1FWBC 1OYAA 4W7WA 5SWUA 2R82A 2X1IA 1GRTA 1O6IA 1DTUA 4U10A 2WKLA 4H4IA 4NZ5A 3W22A 2V81A 1GREA 2JKAA 1E43A 3QPZA 4IOTA 2V5LA 3AMGA 1DBTA 4GINA 2ZVIA 1W54A 2BBFA 3DFTA 4R33A 3GD6A 1XW8A 3M0XA 4LCQA 5CLWA 3AQUA 2QIIA 2DP3A 5DMMA 4BF5A 1JR1A 1ZBVA 1KLZA 1QMLA 4YXGA 4ICNA 1QPQA 3W3OA 1R46A 5IFPA 4U28A 4GYJA 2ZZ3A 4LAKA 3HV8A 4J3ZA 1X7FA 4ZMGA 5AB3A 5T8GA 1N61C 2Y5JA 4S3JA 1FWNA 5BRQA 5FJUA 1K4HA 3UP8A 1UJQA 1XXXA 2F5ZA 2WNNA 5FJIA 5FS6A 3AMZA 5IHRA 4MSSA 2NV1A 2PDCA 4UFMA 3MP3A 3U2EA 1Y5XA 2E3ZA 4KPRA 2ZQ0A 5CPLA 3RCNA 2Z2UA 2Z6IA 3J7HA 4JTJA 1L2QA 1ADSA 2W3ZA 4JN8A 1KB3A 4FZIA 3VOGA 2RJHA 3ZOAA 1QI3A 2R6OA 5H91A 2EKCA 3SW6A 1QFEA 1AK5A 2HXTA 3DEQA 2EQ7A 3W7QA 2AGTA 5DANA 3H4XA 2Z6JA 3VIOA 2X2GA 4NEWA 5EBAA 3EWYA 1JQVA 4P7RA 3TQVA 3BQ6A 3WLNA 1V79A 6XIAA 1VPXA 1YKWA 4CNSA 2OOGA 2VZOA 4GZIA 4XWUA 3FDGA 1KFLA 2XWDA 3ATYA 3FVDA 2AKMA 2C6QA 4UNIA 3WQCA 1K6AA 2C0AA 2FHBA 3LV6A 1YTEA 3H2CA 3DC0A 1KRCC 5CAKA 4GGHA 4BY3A 1UR1A 3BLPX 1YMYA 4XZWA 2W54A 4CD7A 4D1IA 1OWQA 2OX4A 3LCFA 4DNAA 2OXNA 3EDFA 3U4AA 3PBMA 5K9DA 4DLFA 4GH1A 3VIGA 3IANA 4JR5A 3U5UA 4YS1A 3A47A 1GOMA 3U0HA 1T3QC 3UESA 3IJ6A 1FA2A 1LZOA 1UWSA 3BO9A 1P0EA 3QGAC 2BASA 5J5RA 1KFWA 4E2BA 4J57A 4O16A 4W5ZA 1W9BM 2PLCA 4UNLA 1UOKA 4FLOA 4HHPA 4Z2JA 3IGXA 2D2HA 1VC4A 3LB8A 4TTUA 3O8AA 4QISA 4HT3A 3BL3A 3W24A 5FEXA 5CPMA 1QW9A 5CC7A 3LY0A 2V5JA 3HM7A 4B91A 5M2FX 1TX2A 4MF4A 1RCQA 4N2YA 5FIPA 1B4EA 1OX6A 1FWDC 1JCXA 3AXHA 4PMUA 3FGCB 5LIKX 1U5VA 5JCKA 2XFFA 1XIGA 3N04A 4OZOA 2O7QA 1YLVA 3BUVA 1T7LA 3DGRA 5CPTA 1REQA 3RU8X 1RXOB 5FS9A 4FAMA 1KD0A 1N55A 2Q8ZA 3A22A 1S2TA 4GVFA 3T8LA 1JZ2A 1PZ2A 3PBVA 3N4EA 1G7UA 2ZVRA 2X99A 1WAWA 2ZRUA 4XUGA 3K46A 5GNZA 3W85A 2B4GA 2WM1A 4H9ZA 2OO6A 5DMYA 1GVSA 1DP0A 3W1LA 4H4QA 2V3GA 3JZUA 3ZT5A 5LHFA 3WNKA 1QNSA 2W5FA 5CJ5A 2XH2A 4UTLA 4EMJA 5M5DA 3S5OA 1IV8A 1J5SA 2ZUUA 5E09A 3PAOA 4O4WA 2CLHA 3E0WA 1AJZA 2Q8XA 4PULA 3SRKA 2NZLA 2QUUA 2CERA 3HGJA 4DWSD 3CO4A 3C2VA 1GJWA 1UIOA 4MJ2A 3FG2P 4EQRA 1DJNA 2HSAA 1EOKA 3R0KA 4DLMA 3P5ZA 3B8SA 3TCEA 2GR0A 3LHVA 4B9YA 1J0KA 2R94A 2R1LA 3TMLA 1WOBA 3P3BA 3GIPA 3L21A 3OVQA 3DBPA 2PDHA 1T40A 1QBBA 4N0RA 2J66A 4DM2A 8RUCA 4AY7A 2YAUA 4F9JA 4I9JA 3UETA 3ELFA 3B0YA 1LBLA 1QU4A 3WG6A 3WD3A 2BV9A 4UMAA 5JIPA 3NA8A 1EBHA 1PTDA 5F7UA 2RH9A 4NVTA 1YDVA 1VB9A 3ARPA 5U4NA 4POCA 2E6FA 1ZLPA 1Q45A 1VGAA 4X9YA 4C6EA 5H8MA 1LLOA 3AYSA 4AEEA 3URNA 3N13A 4NZ3A 3O06A 4O1EA 3H7VA 3VM7A 3FSUA 3FW6A 3G1SA 1GWJA 4LRTA 1FKXA 1TYGA 1BFNA 4IISA 4JTFA 3F03K 3GB6A 4HCDA 3NWRA 1SW7A 3M44A 3CUGA 4UQAA 3ID7A 4LANA 3V0SA 2R14A 3K1GA 3ANVA 4G2DA 1UOZA 3U6WA 4GE8A 1E51A 3UWZA 2V0TA 4CNOA 2HROA 1XC4A 4V15A 2XG9A 2X16A 4EPDC 1YX1A 2ISWA 3RNMA 2Y5EA 3AXIA 1VEOA 4IJBA 3O7UA 1RP9A 3O6CA 1SQ7A 1VP5A 3W83A 3MANA 1PAMA 3H2AA 3PUEA 3KUMA 1GKPA 3RXZA 1PO9A 1GQJA 2PAJA 3G0UA 5D2YA 5ER0A 2VDGA 3VNIA 3BMVA 1Q2RA 1VBRA 3KRUA 3GXFA 4O28A 4X61A 1HKWA 3TN5A 3F2BA 3GM8A 2V5BA 5D02A 3WQWA 3L5AA 1GKRA 2CLKA 4ZOBA 1NIUA 3LQLA 3CBWA 4L5ZA 1Q65A 1FWIC 1XGZA 2CYGA 3WD0A 3WFZA 5L6UA 3LX9A 3WQEA 3ABXA 1S3TC 3LN3A 3QOMA 3BCDA 4LPCA 2J6VA 3GE7A 5AYBA 4I90A 3NYDA 1HJVA 4D2JA 2XHYA 3FKKA 2JIEA 4GIRA 1A5SA 3QBUA 4UZSA 3FS2A 4LSBA 2YXGA 3DXIA 1XHGA 3SCNA 4JDBA 2GGIA 4E38A 2DDXA 5I09A 1QPNA 1XUZA 1CZ1A 3WQ5A 3DUGA 3LYEA 4E2OA 2WZTA 4QE1A 3UWUA 5D32A 1X97A 1JG9A 4FXFA 2D3LA 2YZRA 4O57A 3C0JA 4JN6A 3UYIA 1QNOA 1BWLA 2YVGA 2CITA 3IVUA 4KQNA 3OB8A 4H4SA 1JXKA 3ZJ7A 1LF1A 1OBAA 3U3HA 3M64A 3NPUA 4IX2A 1EEPA 1Y5WA 2Y0FA 1R2TA 1A53A 4JKMA 2QAPA 4DUVA 2PLKA 3H7RA 1KCKA 4HHHA 1MXDA 3LHYA 5FKYA 3B9OA 4GC4A 3CAKA 3U9IA 3VINA 1QPRA 4AD3A 4ZO8A 5C54A 5BYWA 1KV8A 5FF4A 2FZNA 4UR7A 5C9ZA 1SMDA 5I2UA 5KEZA 4ICCX 4HZMA 1V6VA 4Q8UA 5E9AA 2X1SA 1F4AA 3JVAA 4Z1DA 4U33A 1D3GA 3VA8A 4MWAA 3GRTA 1BYDA 1YTDA 3L23A 7REQA 4AZCB 1NOWA 1OK4A 1WZMA 3L4TA 1KM5A 1E4IA 2BOEX 3QW4B 2A7PA 4EWND 4BI5A 3YPIA 3V16A 1KNWA 1EGMA 3HG4A 2CLIA 5A8QA 1XQLA 4KCWA 1ODZA 4JTUA 5I03A 2BLEA 1N8FA 4W5UA 2XH7A 3THAA 3W00A 3GFYA 2MUCA 1WQ5A 1IZCA 2FLIA 1BVNP 1Q1RA 4KS0A 1KTNA 5D9NA 2WSYA 1FECA 2VGFA 4UOQA 3COTA 4XZNX 3KBWA 1UBPC 2NQ9A 1Q4WA 5A6JA 4HCHA 2WOIA 6PTDA 1OY0A 2QAFA 1ZBWA 4XZHA 1TIMA 3HG2A 3MSRA 3AHVA 3W7OA 3CPGA 4DZ5A 3NDOA 1WUFA 2NUXA 4NJGA 1AJ0A 3WKZA 2UZ9A 3BAKA 7A3HA 3ZWSA 1RH9A 5AC6A 2G3IA 5DLCA 4H83A 4JDYA 3N9SA 2OCZA 1XYLA 2VEMA 4CQCA 3IAQA 3EWDA 4H9TA 1TA3B 3V35A 2BWGA 2WSKA 4XBJA 3TYDA 2JEPA 3SM0A 2W0HA 4A8IA 3DFPA 1PCWA 4WCJA 4A3UA 3VIHA 3PBYA 2HTMA 3U7BA 1VCGA 3W25A 1J79A 5LNSA 4EPEC 1T99A 4HJFA 1U22A 4GQRA 2GSHA 3NM3A 4PUDA 1EWDA 3UYCA 4CCEA 1C9DA 4OUEA 4L4MA 2HQMA 1TB3A 4Y8EA 1D7FA 1MI3A 1NAL1 2HXUA 1T6MA 1S3HA 3EAUA 4R53A 1XLJA 1VDVA 5D2TA 5FF0A 5EBKA 5BOEA 3ZVHA 1R3RA 3BJTA 5BRBA 1EJVC 2HJPA 4V28A 3RJXA 3VGBA 4NXSA 2V5DA 4KFOA 1SR9A 5D09A 3UG5A 1P0NA 3C56A 1YBQA 4DJEC 5AC7A 4CCCA 3EANA 3W7DA 3AHXA 3CNYA 4AEOA 3G0XA 4KGJA 2BGQA 2GQ9A 3QV9A 3PZIA 2BC1A 1VHCA 1M1BA 2UV8G 5PTDA 3S6TA 1KRAC 4GY1A 3AZSA 3T8QA 4E6MA 4ZVJA 1HL2A 3VNLA 5BNKA 2HVNA 3QYSA 3WNOA 4Y9OA 2QCCA 4BZYA 2C3CA 3BZJA 3G2GA 5GRTA 3ZT6A 1YHTA 3T81A 5JCNA 3UPWA 2QCFA 4O14A 3T0CA 3MW7A 3G77A 4ADTA 5ECVA 2FB3A 2V3BA 2Z1SA 1ZZMA 4K68A 4TV6A 4KT2A 4DO6A 1YEYA 3I6EA 2OB3A 4TV5A 3WCZA 4HB7A 2GQ3A 1OEPA 2WWDA 3R12A 5D9PA 3SQMA 1O5KA 2XN2A 1I1WA 4LAUA 1RCXB 1RK5A 4JZ5A 1BF2A 4KERA 3TN6A 1JDAA 4M81A 1E70M 2O9PA 4C6NA 4PTMA 4H4UA 2VX5A 3CO8A 5FF7A 2FVLA 4BR1A 3QR3A 5HINA 3LRKA 3GDBA 1L8PA 3LCXA 1GVOA 2XZ9A 4GVGA 1UYQA 3UWWA 1CXIA 4XKMA 5I23A 4AB4A 2WO5A 1NDWA 2J13A 3BXWA 3TU9A 4MWAE 3VAVA 2RKXA 3AUOA 1B31A 4OIFA 1A3HA 1E0TA 4RDWA 4MYAA 4QR6A 2Z2BA 2X1UA 3E0IA 4GXWA 3U48A 1GVYA 4DF1A 2VZTA 3CH0A 4R9OA 3MB9A 2YVJA 3WQFA 1ZJHA 1MUCA 3QSRA 1K7FA 5CBIA 1R2SA 1AA1B 1S2VA 2DVXA 1TFVA 2WJFA 4FX6M 1N5XA 4GC3A 2DSUA 4WJXA 4ZR8A 1LQ2A 1WNOA 3ALFA 2CLOA 1ZMDA 1BRLB 2V2CA 4DY1A 4TU1A 2JF7A 3ABOA 1C90A 3GRSA 3BMXA 3L0GA 1UASA 4CN1A 1JZ7A 2NSOA 4EQSA 4ORMA 3VD3A 4FF5A 4IQEA 1RZMA 3KHDA 4GVHA 4C91A 3C4UA 4ZOCA 3QGKC 3A4WA 4AEFA 3MCMA 1J6OA 3S2CA 1G1YA 1H0IA 4QJ3B 4W7VA 3WNPA 3B40A 1S7MA 4ACZB 4HTBA 2DZXA 3LCGA 4QNEA 2PDIA 3IARA 2QCDA 3NQ6A 1A3WA 2FZ9A 2PLJA 3WD4A 2ACUA 3HQNA 5CZSA 3G5EA 1CW2A 4MNKA 3VX0A 4F0MA 2F8QA 3CL7A 3WLJA 3P60A 3N9KA 4UBPC 2W9MA 1LROA 2DEPA 1K70A 2EG8A 4US6A 4O0KA 2P50A 1XG4A 3N14A 4Q32A 3OP2A 2YQUA 3GUGA 4XB3A 1XLMA 3W70A 3FHAA 4HGXA 1B3ZA 3HPSA 1O95A 3UZYA 4UCFA 4W85A 3W2UA 1TE1A 5DY3A 1LQ0A 3VZZA 1GONA 5M03A 1MW1A 3KVLA 2D23A 1EPXA 3PSVA 2GWGA 2O7SA 1O7AA 1JD7A 3WF2A 3A13A 2I56A 2O4QA 5RUBA 3MUXA 1PIIA 1YTKA 2BNJA 3PJXA 5HDRA 4C6MA 1VYPX 2W61A 4M80A 1I2NA 1K8YA 1YNPA 2GVJA 2FIQA 1JDDA 1OCJA 4W8BA 4JOMA 3H4GA 1NH6A 4M6QA 2IPJA 1V0MA 3PTMA 3S42A 1JZ4A 3I7SA 4OHQA 2BHYA 3RF9A 1E6QM 4PTWA 3WLIA 4XSLA 2NXGA 3LPOA 1Q13A 1F3XA 1BQGA 4B9ZA 3OVPA 3N25A 2PE4A 1KM2A 1TJRA 4I6VA 1I2RA 2PPGA 3E3HA 4OECA 2E1DA 3GG0A 3VGGA 3MMUA 1V77A 3TJXA 2WPGA 1IGSA 4XISA 2XZ7A 2G3FA 2HE5A 4LB3A 4ZQPA 1XSKA 1ITXA 1ELSA 1YPIA 2FH6A 3OPSA 2VZVA 4UFHA 4FNUA 5CC5A 5FEZA 2O0TA 3KVJA 2BS9A 2H8ZA 4CNTA 1EJWC 3DENA 4LAMA 2PCEA 2PC8A 3HGOA 4L4OA 4C90A 3SZ8A 1W6TA 2PDXA 4HJWA 5K9CA 3W9ZA 3NJ3A 2FFIA 3PBWA 2VGBA 4X22A 1KM6A 1UR4A 1NOFA 4KEZA 2YB4A 2C8NA 1E0XA 4EANA 2WHMA 3IJ8A 4FNSA 3CGBA 3VABA 2GPTA 1ZJIA 1SZNA 5A3HA 1BEUA 3GIQA 4O0ZA 4IFKB 2YL8A 3B04A 3NQBA 3WIJA 1EL3A 4KIRA 1S46A 4XQ6A 3VKBA 2Y7GA 3G6LA 3H4WA 3B0XA 1DXFA 2RGMA 2V6OA 4KETA 4FLQA 3NL2A 4IUOA 5FL1A 4IFRA 3B9AA 4Q8MA 1IR1A 3AJ7A 1TJ2A 1VJIA 2X30A 2VRKA 2OODA 4ZL1A 1FP8A 4JX5A 5D2VA 3N12A 1W8GA 1S2AA 3VOHA 5AYZA 4Y9AA 3NO5A 4RL3A 1HKMA 2AAAA 2WBKA 1RJQA 5H2ZA 4MZYA 4QDWA 1U1HA 2WKJA 3GG7A 2Q02A 4PH6A 2I5IA 4PMXA 2VVSA 5C9XA 1GCYA 4JTSA 4DWSC 2ALDA 2W3SA 1PSCA 3ITLA 1EC7A 1GJPA 1GPFA 1Z48A 2Z1XA 1DE6A 1DHKA 2A5HA 4D72A 3MJYA 3IAPA 3KOWA 3PTKA 1J2BA 3EWUA 1SMAA 1TPFA 4HNLA 1G7VA 4WGXA 2OZ0A 3STGA 1EDGA 1L6YA 5FESA 2UBPC 4Y6GA 3MMDA 2FPVA 2WZEA 1Q63A 4IM4A 1UD5A 2VX6A 2EPLX 1EA9C 1QT1A 5LIWX 1FEBA 2X09A 2ZZ6A 4MKVA 3W53A 2D24A 1KFJA 3POHA 4ML9A 1UKSA 4ZTXA 3H2NA 2HEJA 3MJMA 4M24A 1TWDA 1DV7A 3KTSA 1GOOA 1EIBA 1DXIA 4M7TA 4FHAA 3NQ7A 3NEHA 2G5WA 4J27A 5AHEA 2Q3RA 5HPOA 3UVAA 4AYGA 5FSDC 2WNWA 2F38A 2NX3A 4ERAA 2J25A 4JIIX 5EFFA 2XU2A 1JPMA 2A3BA 2J4GA 1PZ1A 1V5XA 2YW3A 3EA1A 1C8XA 3SRDA 3E96A 1WYIA 1OJTA 1X96A 3CIVA 5G1MA 4YHGA 4K36A 4EACA 1UKQA 3DZ1A 1DJHA 2JGQA 4GUJA 9RUBA 1I9CB 1C93A 3M1ZA 1UR8A 3JZEA 3B06A 5IXEA 4UTIA 2OLAA 4EKJA 4N6FA 1P6CA 2DSWA 4HNUA 2DZUA 4OOUA 3OODA 4I3GA 4AHPA 4YWIA 2PTZA 3ABSA 3RO6A 3LTPA 1GW1A 3W1XA 2WPFA 3OTRA 2W62A 1JRPA 1M9HA 3QOKA 4A3YA 2GJLA 2GVYA 2PA6A 5FJJA 4YHEA 4A3RA 3ITOA 4M5PA 4S3AA 1JQXA 4AHQA 1LWIA 3A24A 3HQOA 3QMRA 5EPDA 2B7QA 5AC8A 2V82A 1GOWA 2P53A 3CGDA 2EAWA 3DHFA 3AM9A 4FPSA 3WJXA 3IRSA 3WF0A 3K2GA 1GORA 3IJ9A 1O66A 2IW0A 1UPMB 3MSYA 1U83A 2DQWA 4C60A 1K4QA 4NZ4A 4AX7A 2WMIA 4DBSA 3WLPA 2ZA1A 3VNKA 2ZRYA 1R3WA 3ETRB 4JIEA 3APYA 3WQOA 4TX6A 1Q8JA 1C3FA 4GUIA 1HGWA 1V03A 1V93A 4K7YA 4Q4PA 2A79A 4AF0B 2E25A 2XSXA 3RLVA 2V3FA 1D8CA 1KW1A 3N2CA 4FP1A 4ROPA 1E6NA 3NFUA 4UQ9A 1DIKA 3INPA 3WF4A 4H9YA 3AC0A 3BG5A 2E6AA 3S3GA 1WP6A 5E0CA 2YYTA 1AMYA 3E5PA 1QW8A 2G3JA 4EP8C 2PBOA 4ATDA 4O15A 3GHTA 4CLMA 1G4PA 4I8YA 1KKRA 2ACSA 3AS1A 2E77A 4DRSA 1PYFA 1D7KA 2WOQA 4G5DA 4MB5A 1DJWA 2ZICA 1I2OA 3ME3A 2VFDA 3BMWA 4Z2GA 3WUBA 5JH1A 3POCA 4EVZA 4PRRA 1JJKA 2WZHA 1XDIA 1W3NA 4UTKA 2WHLA 4GCAA 3VNZA 3FEQA 1WBJA 3SIZA 4H7CA 4HMNA 4I9TA 4JX6A 3GXNA 2AMGA 2ZZ2A 1PXGA 3RILA 2OYMA 4RCXA 2BVWA 1BKHA 1HJQA 5HULA 3AFBA 3N3TA 4IWWA 2C79A 3G1FA 2FTYA 3DJGX 2BXYA 3RN6A 1TVPA 1XSJA 3LK6A 4H4WA 4OU1A 3WBWA 5J5DA 5GNYA 3ZIZA 2PD9A 2ZE3A 3XINA 3XIMA 2E1WA 4NIRA 3UPBA 5KINA 3CAQA 1K9TA 4GOAA 3EUB3 4UFKA 8TIMA 3HGSA 1XP3A 4KMQA 4Q7IA 3O1NA 2YZ5A 1PWMA 4UTTC 4W89A 1NWTA 3QZ6A 4JNZA 2J7DA 4S2CA 2HDJA 2ZZ5A 3N2MA 3ABQA 5EKYA 4AWUA 1X98A 3SUWA 3K8KA 2QF7A 4GNVA 1TO3A 4JCLA 2PP1A 1E6XM 2TYSA 3WDQA 4HNNA 3R94A 3S8HA 4OQVA 1GOXA 4NUWA 3W7PA 4DI8A 4L6OA 3LGEA 3VDCA 2X0HA 3W37A 1DQWA 3S9ZA 3MUZ1 3KLLA 1Q7MA 1BGAA 5ENLA 2DZBA 3KWSA 3SQLA 4TO8A 4PL2A 3WO8A 1M65A 2YCJA 3N18A 1ZY8A 2DJLA 4K38A 2IXUA 4S23A 1ONWA 3CEPA 4PE8A 3WQVA 4IPJA 4ALDA 4Y9MA 3VGDA 1XYMA 2VX4A 3AYRA 1V6YA 3T2PA 1HL8A 1TR1A 3L0NA 4NU7A 2CZVA 5IOBA 3LZ3A 1HW6A 2OEJA 4CNNA 4HK6A 5BCAA 5IHSA 4G1KA 4GA8A 1LPFA 1VFOA 4RZBA 4WKFA 3W02A 4QJ1A 3T7VA 4QS6A 3V1HA 2E4TA 3WL1A 1NDAA 2EQ6A 1ZU8A 5XIMA 2OWCA 4O1FA 3CMJA 2GK1B 4F2TA 7CGTA 2X0YA 2V68A 2QAEA 1OVDA 2I57A 4D6CA 1VF8A 1WE5A 4CGTA 3I6TA 4FX9A 3K30A 3DGHA 3IV8A 4TX8A 1OD8A 4D6IA 2FGZA 1AW1A 4TMBA 2C3DA 5AYIA 2BDQA 4AH7A 3USBA 4JTEA 1DL3A 4UTJA 2YLAA 3I68A 1JL8A 3RHGA 2E09A 2TAAA 4MPQA 1SO4A 1FDZA 4LFYA 3TXVA 2YA1A 4FF7A 3AOFA 1ME7A 2YBVA 2PI6A 1MNSA 1QNRA 3ES8A 4O1AA 2BFGA 3O16A 1OC6A 2V3EA 4JQ2A 3NQCA 2GVEA 1XRFA 2KX9A 1Z44A 1W5PA 4DXKA 3P93A 3UXLA 4Q33A 2WNZA 5M1TA 2E5CA 2WCGA 1CPUA 4I7UA 3WEZA 3KS5A 1FVPA 4WY0A 5JCIA 1H2JA 4I9MA 1QTWA 4UB9A 3TDFA 2QVHA 2Z00A 3R0DA 4CD4A 4LAZA 5C2CA 3A7RA 3DFSA 4XAPA 4JY9A 3EDDA 3N29A 4H3DA 3AIRA 3LMZA 2J62A 4NAEA 1PHQA 4DEFA 1ENUA 3B9EA 2O92A 3PAJA 2RAGA 5E0KA 2NQLA 2WPCA 3CHCA 4QAWA 3KEHA 1JFHA 2RDTA 5DEZA 4IPIA 4N42A 4JFTA 3LHWA 2JF6A 1YE4A 3E5BA 5FCZA 1S5WA 3TQPA 4M1BA 1D3CA 4KKXA 5EMMA 5I79A 2Q3OA 3DX5A 2OX1A 2ABAA 2PRHA 5KITA 4LYRA 4XD3A 2BHUA 2XYLA 2YGYA 1ADOA 1BVZA 2Y63A 4H4YA 2CKSA 3E6EA 2VRJA 2WC4A 4QXIA 4L80A 4AZHA 3VIPA 1ONRA 5LIXX 2ZC1A 3GVWA 4MJZA 1P4CA 4IPLA 1R7OA 4AD2A 1HIZA 2NWSA 3O6AA 2H9AB 3AICA 1CECA 3GC5A 3DHDA 2XFYA 3WLHA 4JHZA 4EQWA 1R9XA 1N8WA 5JCLA 1A5KC 1E1CB 4F0RA 2QS8A 1EJ7L 4WKAA 2CKRA 5EMUA 3B8DA 4H19A 4D8ZA 1RAKA 2Q09A 3WD2A 1XBVA 2PMQA 4IG2B 1A4LA 2P0IA 1VBUA 3XISA 2NQHA 3P14A 5D9OA 4HCLA 1MNZA 3AMLA 4U4MA 5BXRA 2ANUA 3C2RA 3OOQA 4GABA 2WAGA 4ZTYA 4ILSA 3HA1A 2WLZA 5D05A 2QJMA 1O5QA 1Q6QA 3C3UA 4HIBA 3S2JA 4KCVA 1G67A 2F2KA 3P61A 3DFQA 3IIZA 3NVZB 4LX4A 4XZIA 3FXGA 3Q37A 1FX6A 4PYSA 3L5LA 3CUZA 2FZBA 3G24A 6A3HA 1F9CA 2W3RA 3CV6A 2HBVA 2WVVB 3P84A 2YPIA 4KH2A 5CSUA 1B90A 2RGLA 3CPRA 3VGEA 2A85A 4XD6A 3BC9A 3NL6A 2D22A 1X39A 3B8WA 5HWNA 4IQJA 1UH3A 2ZZCA 1XIDA 4I7VA 5FJTA 1A80A 4GQGA 4H6RA 1DWGM 1EO7A 4LEFA 1IR2A 3NSXA 4P8XA 3ARSA 3D47A 1ZFJA 1SM9A 1Y5VA 3AS3A 4AW7A 3M6YA 4NILA 5K4XA 1HJWA 3VKKA 4CKQA 1XX1A 4WXYA 2IKJA 3IIXA 5JCMA 3GZAA 5JQ9A 1TKKA 4FNPA 1EGZA 3BGAA 1AH4A 1JCMP 5T9BG 3TK7A 4U2ZA 4EMWA 3IACA 3W6YA 4UTWA 4IMEA 4FI4A 2P76A 3H2FA 1KBKA 3ZR6A 4IGNA 2X42A 3USZA 5EMJA 5CJMA 4F0SA 3N11A 4PUJA 1OFQA 4C5YA 2NXHA 4NY2A 4C6FA 1ZUAX 4H4ZA 5G1TA 3RX3A 1GRGA 1XG3A 5K2ZA 4IMCA 4ZOHB 1M41A 3NR0A 4C6KA 4IXHA 3FN9A 2Y1HA 3BV4A 1WDQA 4AZ7A 3AMDA 4JNYA 5E9XA 3ARVA 4GY0A 2WXDM 1VH7A 2J7CA 2ACQA 3QZAA 3TYEA 4IUGA 4RNFA 2PDWA 2EPHA 4CQ9A 4MWAD 4XAZA 4GIYA 3V4BA 2R1KA 1C7TA 3ARRA 4QSHA 2ASHA 2QDDA 4MYXA 1JROA 3AS2A 3CU2A 3NGJA 2VFHA 5A6AA 3TLQA 3C2YA 5C5YA 3RR4A 1LDCA 5HWMA 3NZPA 2F6XA 2P3EA 1IXOA 3PN8A 1DYSA 2ZZ4A 3TYAA 1WKYA 3NSMA 1NU5A 1BKSA 4TVYA 1ECQA 2PZ0A 3FCPA 3M0MA 3HBLA 3UVIA 1SFSA 2XH0A 2YCIX 3W2KA 3L65A 1FTXA 6ENLA 1VFTA 5XIAA 4WEVX 4DIAA 4O13A 3MP5A 4FMVA 3DH9A 3BANA 4AVFA 3CWHA 2OYLA 2WJEA 3Q2DA 3W72A 4NJHA 4R7WA 3PWAA 3M47A 1CGUA 2NT0A 3KL0A 3QKZA 3VC5A 1F6YA 1Q6FA 3MWAA 3C6CA 3TTOA 4NZCA 3TV8A 1VRXA 3H26A 5BZAA 3W71A 5D9MA 1UP3A 3CUJA 3LRLA 3QPEA 3W6LA 3PSWA 2CXGA 2GDVA 4M6VA 5AFDA 1ISVA 5FS8A 1DORA 3UG4A 1LOQA 1FCUA 4IMFA 1H63A 3AU6A 2IKHA 1EQCA 1DJZA 1EB3A 4R85A 2CC0A 3PUDA 1R7AA 2FKPA 3QLDA 4LUSA 5D8WA 3KW3A 4A22A 3P82A 1A5UA 1AODA 1WKDA 2X7VA 3S5NA 1XH0A 4W7UA 4LTSA 3SCVA 1C8VA 4KCTA 1GQIA 4GO8A 5C2XA 1REQB 3L4WA 5CZTA 1HTIA 3VIIA 1TG7A 2YIHA 3MV11 1KCXA 4MFEA 4O10A 2VCCA 5DMLA 1R86A 2IQTA 4G1NA 1LWHA 1L6GA 2QV5A 1RP8A 2QF8A 3URBA 4LUTA 4GBUA 1RJRA 3GLCA 1XIHA 2DH2A 5LNVA 4IFKA 3E49A 2QLYA 3F4DA 3BW3A 1C8YA 1NFPA 2QDEA 5GVJA 1F07A 3S46A 4EF8A 3TFCA 5B7YA 1QI5A 3ITXA 1DOSA 4GUHA 3ONCA 1SJBA 3FLUA 1UWAA 3UXIA 3VIFA 1OHLA 2QIWA 3CTTA 3WJZA 1JVNA 1QI0A 3B9NA 1YDYA 3M0VA 4GACA 3QF0A 1XLFA 4U31A 1CIUA 1ONEA 2RDXA 3WJWA 3L68A 1G5AA 4WLCA 3H7UA 4ZB5A 4DUOA 3DGBA 4HU8A 4WXZA 5LNRA 4CUCA 3NVTA 3CYVA 2OSWA 1AUSL 3L4ZA 4QJ5B 4TVWA 2DZVA 3M7SA 4O17A 2W27A 5I3FA 4DNMA 3RNDA 4K8EA 4ERIA 4IPPA 2WKGA 1PJ9A 2GSEA 2XFRA 3QGVA 1EF3A 3ITYA 4BEUA 2YCEA 1XH2A 4LGXA 1JAEA 1MEHA 3A3XA 3KL3A 1G4TA 4BHYA 2E6YA 5TBOA 5HQMA 2E68A 4J40A 4O53A 3U2OA 1HF6A 3O0HA 3QHOA 2X8HA 4UC5A 4BI6A 3C2FA 5DXXA 3SCWA 2PDFA 4Q4SA 4YLWA 1H4PA 3EAOA 4TX9A 3O63A 2EHHA 1N8IA 4J3WA 1EWEA 1JF5A 3R8HA 1J93A 1GV4A 1M6JA 4CU6A 3W29A 3PZVA 1I60A 3G1RA 3WMSA 1V4YA 2VGIA 4NSBA 3DCPA 1B5TA 4Y9NA 3BAXA 2BZNA 3FYOA 3WDIA 3SADA 1G4EA 3BAWA 4A4AA 4IP7A 3NQFA 1TWIA 2FZDA 1J6PA 4QITA 3VO0A 3OG3A 4H4PA 1KRMA 3KBSA 3KTXA 1DXEA 2OWWA 1FHLA 4A29A 3GU2A 3BCFA 3W81A 4ACYA 1SVDA 5A6BA 2WVTA 4P7LA 4RPPA 4L6DA 1K9EA 4Q4OA 3TVAA 1TCMA 2YDQA 2EJ1A 3R1ZA 2GR3A 3T2OA 1L9WA 4M52A 2NT1A 4R7OA 5AZ1A 4OFCA 5EFDA 4H50A 4PGLA 1ITCA 2W67A 4JPGA 3GNDA 1LBFA 3ZXWA 1V02A 3WZ0E 1E40A 5DX7A 2J8TA 5BRPA 2ZXQA 4PCFA 2CIPA 3K4AA 3EA3A 4NHVA 3P80A 1L2UA 1XPGA 3VKCA 1CLXA 2G8ZA 4UQEA 4YJ5A 1ZJBA 4MY9A 3D3FA 2DVUA 3F4VA 3DKJA 3KOXA 3W82A 4ZBCA 2WJDA 3Q67A 3O07A 1HO1A 3WENA 3RCMA 1XISA 1R3YA 2PDKA 4LRSA 4MNLA 3VU2A 2CBUA 1OFDA 5H1WA 2HCVA 1E9YB 4OKDA 3HB9A 3W26A 4I5UA 3U7VA 1OFBA 4QDMA 5F1UA 1B3XA 1W0MA 4AQLA 4H4TA 4J56A 1PCKA 1R3SA 1XIEA 2YBTA 5JBEA 2PF8A 2QUMA 1Q2SA 3FNDA 1AQFA 4C6CA 3UU0A 1RLCL 2WPBA 2XFWA 4IT1A 2HV5A 3NO1A 3CEUA 3S2MA 3WX7A 1P7TA 1F7BA 4DZIA 4IIGA 3GDRA 5FI8A 3O2LA 4IPNB 1KBLA 2C13A 1JF6A 1IT8A 2WVUA 2SFPA 2BG5A 4JEQA 2C91A 3R4IA 4L1GA 5BXTA 2WZMA 1BAGA 3NPVA 3SQPA 3NS1B 3A23A 3FFSA 1FFRA 2CDUA 4PUEA 4FALA 1FH8A 2XIQA 3GR7A 2VJXA 5DRIA 2J7FA 4PSPA 1XQKA 4MADA 2YL6A 5G4EA 1VJSA 4CD5A 1AZ2A 4LYPA 3SY5A 2IXVA 3UA3A 3OJGA 3NO3A 3OLGA 3AALA 1X6UA 4HMCA 4S3CA 5A8PA 4OUIA 1G94A 3MI3A 4RZ5A 4MWAB 2CHRA 1WX0A 1V59A 4J1OA 2ZUSA 1YNQA 4NAFB 4J3SA 3RX2A 2O56A 2A3LA 3DJJA 1UROA 1DPMA 5CQ1A 3MT1A 3WBYA 3OQEA 4QQ3A 3GDKA 3A12A 2WWCA 3W1TA 5A2BA 1JXJA 4AZ5A 3SCRA 4B4FA 3NURA 1OT1A 4PUWA 3RPMA 3FKRA 3NVWB 1FDJA 3GU9A 2YYUA 3RIKA 3QY7A 1I45A 1OSEA 3N4AA 2C18A 2ODOA 2PEVA 3IC9A 3WLLA 3LLFA 1EF2A 3SN0A 4ATWA 3WEMA 1EPVA 1UP2A 4UIOA 1MEWA 3LM7A 1P43A 4IICA 2PS2A 1I4NA 1ZQ5A 3HW2A 4WD0A 3N19B 4A8RA 1RHCA 1A5OC 1XPYA 4HQVA 4J3XA 3A4JA 1CGXA 4R9XA 4M6PA 4GHRA 2CBVA 1LYXA 1TPDA 2ONEA 4PSRA 4EXBA 3THUA 3W2LA 4PFMA 3DIPA 4DJDA 3EB3A 3AI0A 4R27A 4B5SA 1LCOA 2ZE0A 3W7CA 1PDZA 5ABHA 1R9ZA 1TV7A 2FQIA 2QNEA 3WBAA 5KZMA 1AOGA 3TLLA 5GQBA 4D71A 3FSTA 3TN3A 4DBWA 5JH2A 2R24A 2D1ZA 3W84A 1R3VA 4XV0A 2POZA 2C0HA 4XO6A 3OVRA 3VMPA 4Z1AA 4KRUA 2V2HA 3MVIA 1JGIA 3C86A 1W1A1 3E0VA 3WEOA 4Z2IA 4QG9A 3MKCA 1UQZA 2Z2AA 4MB3A 1V02E 4PCNA 3B8IA 1WDRA 5K7JA 1BPLB 2Y61A 1OYCA 1T8QA 2WSQA 3SCPA 3ZVHB 1ZALA 5JBFA 2DFAA 4UCGA 3LRMA 1DJGA 5LZLA 2W0UA 3LTYA 1OQFA 3STFA 4JDRA 2AOSA 5ABTA 1N60C 5BOOA 3TYCA 4HA0A 1GRAA 2Y62A 1YBQB 4YIWA 3RITA 2ZTKA 3GS6A 3BLLA 1V6XA 1UZ4A 2PWGA 3M0JA 3GH7A 4DO5A 1BSIA 4HTYA 4GKTA 1D2KA 3CUFA 5AHFA 5FJPA 4DNHA 2OMAA 1B3WA 2GK1A 3B03A 3QSTA 3WLOA 3HQ1A 1XYCA 4YTRA 4GH3A 5GJNA 4E3TA 1KXTA 1X2GA 3A4AA 3NQVA 1X6LA 4FX7A 5HNNA 3GYCA 3U57A 3ISIX 2OGYA 4US5D 3PBGA 3LGGA 4URIA 5G4HC 1IEVA 1VBHA 2ZWZA 1P48A 4WHBA 2TPSA 4IF2A 1XWYA 4Y90A 5HMEA 4WSJA 4NNBA 3EWWA 4NF7A 4PTXA 2CBIA 2DZSA 2YA2A 4XKYA 1ME8A 3GX9A 1OIFA 2QT3A 3M0YA 4GUFA 1FBAA 3ZJ6A 3W01A 4CCDA 2YB1A 1IEQA 4FLSA 3WJSA 3CMFA 4M7SA 1T96A 4HNOA 3NRZB 2ZX5A 2QYGA 4ZCWA 1FHUA 5JXQA 2INZA 5T26A 1DQXA 1LLZA 2OKOA 3MDUA 5MKGA 4HNVA 4E5TA 3OGRA 3SFWA 3TEVA 4I8DA 5EGRA 1AQ0A 2J8FA 3RCYA 1M53A 3QPYA 2ZUTA 4IIFA 3ZQ9A 4FXJA 4H4RA 5TIMA 3UGVA 1W1IE 1CXEA 3N9RA 3N2BA 4QAIA 4IIEA 4A05A 3CH9A 5DCBA 3W7GA 1UKPA 3EOEA 3A9IA 1FUYA 3AU2A 1A5NC 3M0IA 1H11A 2LLEA 1X8CA 3AROA 1XH1A 3LUTA 2D73A 3VZYA 3ITVA 2B7OA 2P3ZA 3EX4A 2ZXBA 3L0KA 1QNVA 1E9ZB 3W88A 4LQ1A 3H70A 2HPMA 2R1PA 3HF3A 3E2RA 3DN5A 2GUBA 2YSWA 4MY1A 3UR7A 1M7PA 3B4UA 3CB3A 3KCJA 3PTQA 2DJXA 1E6PA 3ITCA 3CJPA 3UXDA 4LF1A 4JD4A 2I5QA 4Y7EA 1W9PA 1LL6A 5IM51 3C0LA 2TRSA 3M5ZA 3N1AA 3NQGA 2C19A 5LIUX 4EMIA 2QPXA 1PKYA 4JQ4A 1S5MA 1NWSA 3QYQA 4LF2A 3BK0A 3LV5A 5I3HA 3CV7A 4QM1A 4JKKA 3THCA 3TNBA 1KBJA 1AL8A 4ZFCA 1V3JA 4H8HA 1KQZA 2OQLA 4OBSA 1BYCA 3WMBA 1V0NA 3HPAA 1Z41A 1HJUA 2Y8UA 1XANA 2ZDRA 2G4JA 1PTGA 1KXHA 1S2UA 4GG9A 3G1AA 3MMTA 5HPCA 5CEWA 1ZX9A 2CLFA 2QJNA 1KGUA 3TSDA 4Z17A 4UTUA 2IQ0A 1FCVA 3ZJKA 3W1MA 3GDTA 2QCDB 3OA5A 5C0QA 1WAUA 3PPFA 3B0PA 3W74A 5JUVA 1WDWA 3K5XA 4AIBA 4GQBA 3G3MA 3NGFA 2OU4A 4MDOA 2VEPA 4TVCA 2HQAA 1IEIA 4IIBA 4G7FA 1GETA 3VKDA 1R5YA 4AVOA 4M3PA 1J0IA 2A3EA 4J35A 3EXSA 3KFTA 3SQSA 4FOJA 1PYMA 5AN7A 4W88A 1NF0A 3UW6A 3WH9A 3VIKA 3TKFA 3SDOA 3H8AA 3DH7A 3GFZA 5TNVA 3STCA 4MWAC 3OW1A 3GW3A 1DXLA 1CBGA 1Q6GA 2OZTA 3CZJA 4HPNA 2Y85A 1MWOA 5LA2A 1MFUA 1UC5A 3TYZA 9CGTA 4IGHA 1XLGA 3V5FA 2WZIA 1N63C 4F9DA 1J8VA 1FKWA 4MUZA 3RM4A 1I75A 5U1OA 1TELA 4WR3A 1JD9A 3L5MA 3T09A 3UJFA 4GYPA 4L6HA 2W66A 2DIJA 3KX6A 3VKAA 2BY1A 4GYKA 1B0IA 2ABBA 2GR2A 1JZ8A 1VLIA 3W1AA 1RSCA 4LOCA 1CXFA 1XGEA 3SUUA 1FWHC 2WYSA 5HJLA 2GQ8A 3CB8A 1SR0A 2QR6A 4BCEA 4C5ZA 5D04C 3DYMA 4DI9A 1W91A 2A6NA 3KVMA 2BOGX 2ZRXA 1CGWA 1YW1A 3R7MA 1MMFA 1OG0A 2H8XA 1SYTA 5A8GA 1I2PA 4FA3A 4JS3A 3TW7A 1UPPA 3KBJA 3W7NA 2PWFA 4N9CA 2A7NA 4GXPA 2EPNA 4Q8PA 4OOZA 5A5WA 1Q6OA 3ARWA 2FDSA 3S1UA 1GHSA 5CJNA 2W63A 5HA7A 5T91A 3G8RA 7XIMA 4IIHA 2E0PA 1EP1A 2O9TA 2OELA 5A69A 3HJZA 5DBUA 3N34A 3URHA 5DELA 4MJMA 1VAHA 1NFGA 3A7UA 4IMDA 2Z26A 3P62A 1VFFA 5FL0A 4DO4A 4FOUA 2QGHA 3KAOA 1W56A 1N82A 3QC0A 2RJGA 2X41A 1H7PA 1DWIM 3M4HA 1R47A 4DQWA 4P8VA 4HOZA 1AD1A 2QUNA 3QN3A 2A4AA 3A64A 2QZRA 1ECEA 2NVDA 5LNUA 2B31A 4IX0A 2QMJA 2X7WA 4C7FA 4AU0A 2WJZA 3W2NA 3G1YA 4H8UA 4JYDA 2ZDSA 2V63A 4MFDA 1SUXA 4C7GA 4H00A 4AWSA 4AIUA 4Z2KA 1RPKA 1OINA 1AQHA 2VHLA 1WB0A 4Q4RA 4ADWA 3AIBA 3DI1A 1B9BA 2WMGA 1JDFA 3S5ZA 1ZS2A 4J5NA 3IJLA 3SIMA 4ERGA 4ZA0A 1Y8BA 3GHUA 4S3BA 1V6TA 3R8GA 4TVDA 2OFJA 1K7EA 1TMQA 3D46A 3LMYA 4K2SA 3LCIA 1H60A 2NX1A 4K37A 1OC5A 2W92A 3FA5A 1XD0A 4B92A 3BW2A 4PCPA 1E1FA 4Q8OA 1EQPA 2J78A 3IIVA 3UJ2A 3AIWA 3GD4A 2PWVA 1ZDLA 2YDSA 4O18A 1RCOB 1OF6A 4I5RA 4JL2A 2PDLA 1GVRA 3BWWA 1WZAA 1QK2A 5CG0A 4IP5A 4LALA 2WBAA 3PG6A 2ISDA 1OGGA 1DJXA 1M03A 1HJXA 3SURA 1JI1A 2CHOA 2J6XA 4S1FA 1J0JA 3T1GA 1HX0A 3CAVA 5BROA 3HMCA 3E2VA 4FR1A 1JYWA 2XTKA 1Q8AA 2BTMA 3MPGA 1WZLA 4DYJA 5KVIA 2QXWA 5J04A 3KE0A 2ZIDA 3TW6A 4YCOA 3LBOA 1ZK7A 4B90A 2ZZ0A 4XVDA 3R10A 3PJTA 4JQ1A 1K8ZA 2Z1BA 3IV3A 3MDWA 4HP5A 3PANA 4NG3A 4CCZA 1GRBA 4L61A 3U5YA 5M17A 3LXDA 3WQDA 5G2HA 1TPWA 1WZKA 1EH9A 3VMOA 1TV2A 1F8WA 1V08A 1ZAIA 1BVWA 4LYKA 1MDLA 2GWNA 2NQZA 1YIXA 3QKEA 4TVUA 1KBBA 1CB2A 2VR4A 1E5JA 3UQNA 1LM1A 4S3FA 1WDPA 3GYEA 3BV7A 1HNYA 5I00A 3V5CA 2RFGA 4RV3A 3UZZA 1S2CA 4YU1A 4AG0A 5EMLA 2OLHA 2BXVA 3BLIA 1W3IA 2DT2A 4GO9A 2AQWA 4D9PA 1BZLA 1J0ZA 4XZBA 1UD3A 1WV2A 3OC4A 4MTVA 4MPKA 1W3TA 2DT3A 4CEUC 2DQXA 3HG5A 1KM0A 4YL2A 2GZXA 5A95A 3BSMA 3W2JA 3TOYA 3PG8A 2GQAA 1OX5A 4RXGA 4GI9A 5J8LA 1BYBA 4J3VA 1VEMA 1BTMA 3H4KA 5KVHA 3O3RA 4U5KA 2P8CA 3UPMA 1JNDA 1LT7A 2VUNA 1XRVA 8XIMA 3WDHA 5H8UA 3EZ4A 4EE9A 3EBVA 2POTA 4W93A 3WH5A 3SUVA 2WB5A 2VWSA 3R0UA 4AXNA 3NNTA 3M5XA 3PWGA 2WMIB 4J9JA 5CGMA 1LQAA 3CV1A 1W9DM 3LCWA 3RDKA 2EPKX 4GD0A 3NQMA 2VEIA 5CSSA 1LL7A 3ATZA 3GAKA 2BXZA 5A94A 3DG7A 4XIAA 1GVIA 1XDMA 2PDPA 1ZBKA 1S38A 1CEOA 1V7AA 4NNCA 1KRBC 4PMRA 1TJ1A 3HO8A 2W55A 2HNEA 3KCLA 3AHTA 2ATSA 1EUNA 1NDZA 3P67A 3ARTA 3S47A 2O4MA 7PTDA 3M6DA 3UEQA 3GDMA 4F48A 2Y24A 4M19A 2QCEA 3OQ8A 2QDHA 4NT0A 4MNJA 4TXEA 4BK9A 3W2MA 4JQ3A 3UJRA 1R85A 2QCLA 4IP4A 3BAIA 3RJYA 2GH5A 2QCNA 2VEFA 1LOSA 1NOUA 1QXLA 2E40A 1KTCA 1H09A 5FD0A 1QHZA 1CCWB 3RPTA 4MDPA 2BVTA 1TJPA 4LUIA 1AH3A 3WQ8A 2OSYA 3QQWA 3W76A 1F3WA 4NL1A 3OLEA 3M46A 2C1IA 5B80A 1ME9A 1IIGA 2WQPA 4I5XA 2VX7A 4M29A 4P7OA 3B8TA 4XZMX 2PD5A 2HK1A 4L4LA 2XVLA 3IJIA 1POKA 2P8BA 1HG3A 2YXXA 4H8VA 1ZENA 4N9DA 3U8GA 4INFA 1WOAA 4JTTA 4NI8A 2PTYA 1QPKA 3BCJA 2VCAA 1I0BA 2V8ZA 4XTDA 3BICA 2WHKA 2KZHA 3WLRA 3H2EA 3G1DA 3TJ4A 4RR4A 4HYRA 1ITQA 4IL2A 1XKYA 4H9XA 3QR1A 3TSMA 4D6GA 1TV5A 2YXOA 2BHZA 3TFXA 3FIGA 4RJEA 4Q8VA 5EB8A 1P0KA 3L2MA 5AHMA 4K3ZA 3D6NA 1QNPA 1WKFA 3EYPA 2V3AA 1DEDA 2GRTA 3VDGA 4IQDA 1HVQA 1JPDX 3NG3A 4XX6A 3B8UA 4D8AA 4H04A 3CWOX 3E02A 4HN4A 3IJ7A 2E9MA 1E72M 2ZX9A 2CFFA 4PMJA 2B7PA 3R5EA 4LBUA 3F5KA 4QE5A 4F66A 3LBCA 4K8HA 2PDMA 4PODA 3QH2A 1NELA 5IFTA 4BA0A 3GFXA 1QR7A 5CPSA 2R9RA 3QV6A 4RDYA 1PBGA 1VCFA 2FVMA 3C2OA 3MP4A 3PC0A 2PDYA 3LBMA 1RUSA 4D6EA 1H1ZA 3OYZA 3A9BA 1FQ0A 5DT5A 1EIXA 3TONA 1XBYA 3GQYA 2A6LA 4L56A 4Z1CA 1M7XA 1EX1A 4NAFA 3N6HA 1F8IA 4JTRA 4ZFMA 1AVAA 1VYSX 1Z8AA 4NI3A 1DQUA 1V3LA 3CHDA 4O54A 3TR9A 1UMLA 1HKVA 4JTKA 1FWAC 4F2UA 5HOSA 1A5AA 1SGJA 3IUHA 4GBDA 1DWJM 3L4YA 3NQ8A 2VR5A 3APGA 2R9ZA 1QPOA 2Z7KA 1XL9A 1XLBA 4DWDA 3GXPA 2GR1A 3WD1A 1HO4A 4BV6A 3DU0A 2R1MA 3PNUA 2CEQA 1QBAA 4J4KA 1QHOA 3AMKA 4GIEA 3NZ1A 3LCHA 4KWVA 1OD0A 4MGGA 3MBDA 4DBDA 3LA4A 2GJXA 4G56A 4AXKA 3VM5A 3ZS4A 4E8CA 3W38A 1FWWA 2Z28A 3OHIA 4PMOA 3QC3A 3MO4A 1S1PA 4ADUA 3IK4A 1TYPA 4RE2A 1B54A 3O6DA 1XGDA 4GFIA 1BLIA 3B05A 3DFYA 5BXSA 3ZZ1A 1YE6A 1N62C 3TE9A 4F3HA 3FOKA 3TJLA 4G6CA 1TUFA 3QFEA 1YQZA 1ZY9A 3DECA 1TZ7A 3REQA 1VFMA 2QUTA 4FS9A 1K77A 3GG1A 4H9VA 3EWCA 2DIKA 3AJXA 1GEQA 4IZGA 2F7FA 3MA8A 4F4RA 1XIFA 5I06A 3GTFA 1KFCA 3N2TA 5EMKA 3GVGA 4HPJA 5AY7A 4L65A 1RBOB 1EJUC 2NVAA 3G18A 4MIMA 3EWZA 4JTHA 2V9DA 4WOZA 4PBGA 4BEQA 4WY0B 1J5TA 2O9RA 4OTKA 3UF9A 4Q3MA 4UR8A 3T07A 4YMZA 4ZQCA 3EF6A 2D20A 4N4QA 2PU1A 2FJUB 2Z29A 3DHPA 3OGSA 2HNHA 5F2LA 4B15A 4HYVA 4L1XA 4C6LA 4NAEB 3DGZA 1R3QA 1JUEA 2PDNA 1QOXA 5I07A 3N2XA 1TJ0A 1I6NA 1ZHAA 1ZXIC 1ISYA 1Q85A 1GG0A 1UKTA 2XIIA 3SFKA 3S2NA 3VUPA 1W1ZA 2HS6A 2P0OA 4B3ZA 2FTPA 3TTEA 3S1VA 2V38A 3TSBA 1B4KA 2ZFAA 1XLIA 1RD6A 3A5VA 1GYMA 3BPWA 2BODX 4A2SA 3WN6A 1Z9AA 1ONXA 4NQ1A 1VQZA 3STPA 3SJ3A 2DORA 3ECQA 1W1YA 2PP3A 4N02A 5I7GA 4FXSA 4ML4A 1W3KA 4BFAA 3PHAA 1MUMA 2AKZA 4REQA 3VD5A 4XZLX 2OZ8A 2WC7A 4GRTA 3F5JA 4H6KA 3QV8A 2Y8KA 4PZVA 1JULA 3GKFA 4JGDA 2JKEA 5G4WA 1U2YA 4ROQA 3SCSA 4L9XA 1UWQA 4ECLA 3W6MA 3SEPA 2CETA 1CXHA 2D2JA 3QMTA 1SZRA 1XLDA 3EX1A 4B3KA 2CNCA 1W9VA 4QSFA 4HZ6A 2Z1WA 5GNXA 1KFBA 3AHYA 4O11A 3V3WA 4GYFA 2Q71A 3LADA 3CIXA 4Q4KA 4M51A 3DFHA 4MLRA 3PZOA 1DJYA 3ABZA 2V69A 2ZX6A 1KXQA 3ITTA 3W28A 5I6SA 1O5RA 1WXYA 2F6KA 4V1XA 1ICPA 1XHCA 5C9WA 1PKNA 4E8GA 3S1GA 3WLMA 1PVNA 1X38A 2C1HA 1BYAA 4TOQA 1NM9A 4X2PA 1GVQA 3GZ3A 2XVKA 3BH4A 1XM3A 4RLIA 1QI4A 3QVQA 5EYWA 1H62A 4Q7BA 1SO5A 5HR7A 1DWFM 3H54A 3I3EA 5LA1A 3M0KA 3PZMA 3WNLA 1UJPA 1R0MA 4H01A 1XUUA 4ENLA 4H9MA 3MYPA 4A8LA 1ZPTA 3EX3A 3PWIA 1DJIA 2A2IA 2V3DA 1MZHA 3OZMA 5LA0A 2JBMA 1UG6A 3CZGA 1W2PA 2REQA 1X1ZA 2IUZA 1A5CA 2PB1A 1KA9F 1QCWA 4FNTA 2ZC8A 2Y5SA 1R6WA 3LS9A 2JK6A 3NL3A 3PM6A 3IWPA 1OJXA 1UD6A 1NHSA 4MM1A 5JVLA 5DQPA 4FXRA 2J75A 4OT7A 4ZO6A 2RHGA 5REQB 4WIWA 3GKAA 3IUDA 1B1YA 1NWUA 1LJYA 1UBSA 4UOJA 4AD4A 4O8RA 1V97A 1GSNA 3LXCA 3HOJA 2VL4A 1H1YA 4Q6JA 3BAJA 2J88A 4N6EA 2E7FA 4MKSA 3II4A 3LPFA 1UR3M 2IKIA 2IS7A 4KCUA 4GVIA 1Y7VA 1EJTC 1V0KA 4NXKA 3UZWA 2D69A 4BQ5A 1SW0A 2W91A 5L9FA 3TAKA 3L67A 4B16A 3H22A 5I77A 3S6OA 4ZQMA 1OFAA 2XPKA 4FOKA 5CPOA 4BWLA 4E2DA 3TROA 3RFAA 3KP0A 1H61A 4DBUA 4EXQA 2BY3A 2G37A 2XSBA 3S1XA 3FV9A 2QCGA 4S39A 1QO2A 1TR9A 2XGIA 4JBRA 2AQOA 2CZEA 1RV8A 3ZMRA 3GXDA 4RNIA 3WMCA 1KTBA 3H55A 4ZODA 1JNEA 3TNOA 1UIPA 3G0SA 4UQCA 1A4MA 3GTIA 4LC6A 4HD5A 4AY1A 4GLEA 1YPXA 1B30A 3FAWA 1M01A 1LP6A 3ENLA 1OX4A 2WV8A 5C2GA 3CYJA 3DDMA 1W37A 5TR3A 3GC2A 4GNJA 4C7DA 2QULA 5IBXA 5C8BB 3VDBA 1JIBA 4O8AA 1GEUA 4HZ8A 3DG3A 5EU9A 3UNTA 2IPWA 3LOTA 4JIRA 2D2OA 3MQTA 5TD4A 5C71A 2CHNA 4DJDD 2D0GA 1ODUA 3S4TA 4E4UA 3TA9A 3NVVB 3LDVA 3R58A 4DAFA 4C1LA 2Y8VA 1LLWA 5HBFA 1OK6A 3T40A 1TV4A 1J18A 3MHUA 2EQDA 3FDKA 2GJNA 3N4FA 3W75A 4F79A 2VFIA 4DUWA 3EGJA 1UWRA 4QCFA 3F2CA 2B7NA 1MDRA 4OV4A 2CCRA 3O9NA 4BQ2A 4C6PA 5FF2A 3H2OA 2DZTA 2NUYA 4AD0A 1US2A 1H7RA 4LUSB 4LBSA 1DIEA 2VC9A 3B8VA 1PIGA 3VMNA 4JX4A 2OO0A 2XUCA 1IT7A 1JCYA 3IS4A 4HU4A 2PRLA 3VNYA 4LVFA 3GXMA 4N9EA 2ZBTA 1XIBA 2EXOA 4KF1A 3MHFA 4RE0A 2JKPA 4S2BA 2VZSA 4C6JA 3L4VA 4LUTB 3L4UA 1IZJA 3CZEA 4UTHA 3CQKA 3GNOA 4CQDA 2EQ9A 3W7LA 3ES7A 1W9UA 1XD1A 1EGVA 4HU3A 1JCNA 3U2ZA 1BWCA 3AYVA 1L6WA 6REQA 3W87A 1P0BA 1E15A 4A35A 1EXPA 3KBMA 1F6KA 3TP4A 1B57A 3GDLA 4GKLA 2E9BA 1H3GA 3RAOA 3GTNA 2X8CA 3CQ0A 3OLIA 3M9YA 5F1VA 4WDUA 4MOZA 2J79A 3D3AA 3SR7A 3M07A 3EDEA 3ZJ8A 5FSEC 1BSLA 4NKCA 3R2GA 1M3UA 1X1NA 3VTRA 4ORIA 3GR8A 3SN1A 1IHIA 2ZX7A 1H50A 4LAOA 1BXCA 4QROA 3AIVA 4APNA 1YXCA 4JHOA 3H12A 3CM4A 5LKYA 2FFCA 2WW5A 4DF2A 1E6SM 1JYXA 4QX4A 4PRWA 4A2RA 1F74A 2G3MA 5LXXA 1LBMA 4CEXC 4JTIA 3KRSA 5K3VA 1IGWA 3CLWA 1MVYA 4QCEA 2H3BA 1PZ3A 3EWXA 1MUWA 2XIBA 2YL5A 1XF0A 1FWJC 4ZZ9A 3NEVA 2P1FA 2GGJA 2XINA 1FDYA 3F4WA 5ABGA 1F4HA 4P7QA 3H53A 5I02A 3BW4A 4L64A 1DVJA 1TPEA 3NDZA 2X0SA 4LNYA 5CPQA 3RMJA 3UCQA 1EFZA 5AECA 2JE8A 2OTDA 3W23A 3ZT7A 5TF0A 4PUKA 2UY4A 1RPXA 4GXMA 3VOJA 4GR1A 1D3HA 1RA5A 2WANA 2ZA2A 4ZENA 4BJHA 5LHEA 3PZQA 4HOWA 2FGLA 5HJXA 3TX9A 5CAHA 4HHLA 4WF7A 1UB3A 2WOWA 3LLDA 4WY0F 4HN8A 4PA8A 2VTFA 1IEWA 3MTWA 2DU2A 3AWOA 2XDFA 3WSUA 1R3TA 2YJQA 5D38A 3VD7A 2BGNE 3QHMA 1O5XA 1W1PA 1MQRA 3T05A 2WLYA 4Q4MA 4IXXA 1MO9A 2QCHA 1GG1A 3RRAA 1LVLA 3VD4A 3MI2A 1OFPA 1ZNNA 5A6TC 4NNAA 3AZRA 4RDZA 4UTWC 3TUUA 2ZUNA 1B9ZA 2AL2B 1MXGA 5DCDA 1VYRA 3I7RA 3B9JB 2Y4SA 1AH0A 4FK9A 3ZO9A 3DK4A 3QQ1A 3VDHA 2OR2A 1Z89A 2FZ8A 4QS5A 2E28A 3F7JA 2HVMA 1ITUA 3G6MA 4Z0SA 1Z6KA 2OEKA 3FAXA 2QPUA 1GEHA 3BGGA 1LG1A 4XD5A 2QPSA 3BLFA 1KGXA 1QAPA 5DF0A 4PBEA 5D2WA 4ES4A 2IPFA 3WDPP 3NQEA 3SSJA 3AIQA 4KRZA 3VD9A 2PDBA 4Q8QA 1IT0A 2NWRA 2PGFA 3WNNA 2BB0A 3OIHA 3HJEA 3LGDA 4IIDA 3QFWA 2XIMA 1P7TB 3CWNA 1NP2A 3WDJA 3EMQA 4YTSA 1EDQA 3KRBA 1A0DA 2C1GA 8A3HA 4PUNA 2C7FA 2YDRA 3EMCA 1K8CA 4FX8A 3WBEA 3ZLFA 4WSKA 1E4NA 4LVBA 1GYNA 5HNRA 4GK8A 1FY6A 1NJJA 5HMDA 1UP0A 1T41A 4XBKA 1VFHA 3GTXA 4LXFA 2DPEA 3NOEA 3C0QA 5LIYX 1NVMA 1K03A 2WP5A 4L9ZA 1SJAA 2JEQA 3THQA 4UOZA 5E5CA 4EX4A 1H51A 4ZGYA 1S5TA 5KZEA 1EBDA 2J9YA 3UERA 1XIMA 3KHJA 3RMEA 1R30A 2GVGA 1Q7QA 3VIJA 5FJRA 5CZ0A 1VZWA 1GT8A 1JPIA 1P1XA 4ZEPA 3TTSA 5BWFA 4H1ZA 3OZPA 2AMXA 4JCMA 3MBFA 1AW5A 2WBGA 2HVOA 4LA1A 2NW0A 2WHJA 3W73A 3LPPA 2J3NA 4P5UA 5BU6A 3C8FA 1OFEA 4XUYA 4AX6A 4E3VA 3PULA 1FH9A 2VFEA 1RJPA 4LWWA 2DSZA 2PDUA 5MF5A 4EPKA 3WUGA 3NM1A 1YDNA 4DELA 1BD0A 3E74A 3LPGA 3GWQA 3T0DA 1PL9A 3GAYA 3AUJA 3ERPA 3HZ3A 1Y65A 4G7EB 1ZP4A 1EZ2A 2YCLA 1F2JA 4CU7A 1YRRA 5M3WA 2X8RA 2Q01A 1LUCA 1E73M 4A3HA 4ZXLA 3QHNA 4BI7A 1N2VA 1U30A 3K8LA 3W7RA 2EQ8A 3GHSA 1JUKA 1NQKA 7TIMA 4JIQA 3D5HA 1O1ZA 3GTHA 2I14A 1DKWA 1HJSA 3UT0A 4TQTA 2Z27A 3I3DA 3MY9A 1FEAA 4KWSA 2JIWA 5A8NA 1KWKA 1SJCA 4DJFA 1LRNA 3W07A 1AG1O 3WJYA 1XLLA 1TPH1 3WLSA 3TIMA 3N2OA 5AC4A 3M7WA 2HBXA 2E8YA 2J7GA 5BMXA 2J7BA 2QW5A 1HP5A 5CBJA 5C9RA 1EA0A 4A3QA 4AC7C 4IFOA 4JFWA 4RXFA 3N15A 1EBGA 1UR9A 2XVGA 4BQ3A 1XDJA 3PUOA 2JGYA 1Q3NA 2C3ZA 3KDNA 1W8SA 3EA2A 3GVVA 3M0LA 2ALRA 3PF3A 1TPUA 3QR0A 1BWKA 3DERA 3F4CA 4D6JA 4PL1A 3EMZA 1I1XA 1ZTVA 4S3KA 5T9CE 2XGBA 2WPEA 3EPNA 5IDZA 4PTVA 3LSBA 2CFYA 4HZ7A 1QWGA 1W3LA 4P7NA 4CN6A 4XKYB 3OZYA 3K13A 1QW7A 4V27A 1B3YA 1SW3A 4MAVA 4QJ4B 2GL5A 2GQWA 1MRQA 2JK2A 1P0DA 2UY3A 5HXMA 3AHZA 5A6MA 4GQ0A 5F4XA 3GO2A 2OEMA 4UMCA 4ZO7A 1GERA 1XFCA 5E6ZA 1EJRC 4K7ZA 1EHAA 3JW7A 3NVYB 5MKGB 1RA0A 1KO0A 3GRIA 1I0DA 5E93A 3RX4A 3PPHA 3NQAA 3WQPA 2XISA 1CDGA 5U25A 1KM3A 2V2DA 4JTCA 1E0WA 2ON3A 1EO5A 1TZZA 4F40A 4PMDA 3CQIA 5CGTA 4W9TA 1W5QA 4PFHA 1HQTA 1VFSA 4CNPA 1RBAA 2V30A 1J0HA 3LI1A 2PODA 2GFTA 3BSGA 3WF3A 2Y89A 1TMLA 4PEEA 1C29A 2PC4A 3QY6A 1ZBCA 4B5VA 3M5YA 4AC1X 4EWJA 4NJIA 1GZ1A 3QTGA 2WC3A 3DFNA 3MUIA 1I2QA 1ZCOA 3MKKA 4CQBA 1EXBA 4JTQA 5D4YA 1EZWA 3BAYA 1ZKQA 1TRIA 3QJAA 3RR1A 3II1A 3CIWA 3B9DA 3DI0A 2INEA 3CQHA 4IJCA 3RLHA 2R91A 5CH9A 4LY4A 1UKOA 3VCCA 4KGLA 3PP7A 4F8XA 1DHPA 4QFUA 3WY1A 1W3JA 5GJPA 4CQAA 1O60A 4JYEA 3GBEA 3PZUA 4Y9PA 4C1NA 3HV9A 4HVXA 2E8ZA 3CGCA 4HMDA 1U5JA 2QDGA 2VC6A 2R8WA 3RLUA 3SO7A 4RX0A 3L5OA 3KP1A 1H49A 3VE9A 2NQ5A 1QVBA 3EPMA 2Z4GA 1EKOA 2OPJA 3CHVA 3C5QA 2FHFA 3HPXA 2UWFA 3P8JA 3B97A 3R11A 4WRHA 3H24A 2GDQA 1TV8A 3E12A 1A0EA 1CENA 2WSPA 4PMYA 1VBJA 3URAA 3F4NA 3IUIA 4KW2A 3ZR5A 3HG3A 4DBEA 5EBUA 2XH4A 3VOCA 3CGEA 2A1YA 3IGUA 2ZZ7A 4L9YA 3T0TA 2D2GA 3LXBA 1TE6A 4RKAA 1PX4A 1RK6A 1OFOA 4Z0JA 1XYAA 5H6HA 1CYGA 3OEXA 2AAMA 1MQQA 1XJBA 3N3MA 1FH7A 3QXBA 3SJNA 5G1YA 3BQ5A 1BG9A 1JCJA 3BLOA 3FK4A 3W7IA 1V3HA 2DY3A 1VPQA 1JRBA 3CT7A 4JIHA 4NJJA 3HRDC 3KDOA 4FEZA 2WNQA 3TC6A 1ICSA 1QI2A 2OWXA 2YFNA 3BGJA 1ZSXA 4U3AA 4B5XA 4M8UA 1L8NA 4OV9A 5EA9A 5B7ZA 4BF9A 2ZA3A 1N5WC 4Q22A 3I4EA 3A6OA 2L5HA 2OQYA 2GUYA 3V0UA 3SCQA 3RGTA 3C52A 1TTJA 4KFPA 2F6UA 4B2DA 3PK7A 4OVXA 3HQPA 3QFAA 2DZPA 1SFTA 3VDAA 5G5HB 2NSXA 4F0LA 3GH5A 3TJIA 3VK5A 2BOFX 3UZXA 1YYAA 4H8NA 2QMKA 3OLDA 2VT0A 4Z1BA 1SFLA 4Y8FA 1CXLA 1UZHA 5CCZA 3N6JA 4G9PA 3IEBA 3AIUA 4DWSB 3R25A 4GCXA 3R13A 3D9XA 2PWHA 3MHGA 1XLCA 1O4UA 3GNRA 3VC6A 2I17A 1KCZA 3QFBA 4EXAA 2GOUA 1BG4A 5HQEA 1KLYA 5A8MA 2I9UA 4WVXA 1JEHA 4TMCA 1JRCA 4DJDC 2UY2A 2OLSA 3E2SA 4QGCA 4F0HA 1D8WA 3Q6JA 5REQA 3LNPA 1UUOA 2EEXA 1QK0A 1FWFC 3DOPA 1FWEC 5E1QA 4TR9A 5E0FA 4HKPA 2ZOXA 1MEIA 3OYXA 5A6KA 5F2GA 3R79A 4CN4A 2W4XA 4GZ7A 3U2CA 1B2YA 4GX9A 1R8LA 1OCBA 2QHAA 1RLDA 1XIJA 4KBXA 1U5HA 3HFTA 4EOUA 5D03A 4R7JA 2ESCA 1ZRQA 1OCQA 1FRBA 3NQDA 3W7KA 4GMEA 1OF8A