2RDXA

Crystal structure of mandelate racemase/muconate lactonizing enzyme from roseovarius nubinhibens ism
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
369
structure length
369
Chain Sequence
b'SLRITRIRLYKTDLPYVDGSYGWGAGNAITVARASVVVIDTDAGLQGCGEFTPCGENYMIAHSEGVDAFARLAAPQLLGQDPRQVARMERLMDHLVQGHGYAKAPFDAAFWDILGQATGQPVWMLLGGKLCDGAPMYRVAPQRSEAETRAELARHRAAGYRQFQIKVGADWQSDIDRIRACLPLLEPGEKAMADANQGWRVDNAIRLARATRDLDYILEQPCRSYEECQQVRRVADQPMKLDECVTGLHMAQRIVADRGAEICCLKISNLGGLSKARRTRDFLIDNRMPVVAEDSWGGEIASAAVAHFAASTPEEFLINSTDLMNYNTRSTGLGGPTVHQGRLYASDTPGLGVTPDFNSLGAPVADWAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme, putative
publication title Crystal structure of mandelate racemase/muconate lactonizing enzyme from Roseovarius nubinhibens ISM.
rcsb
source organism Roseovarius nubinhibens
molecule tags Structural genomics, unknown function
total genus 124
structure length 369
sequence length 369
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2rdxA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2rdxA01
3RO6A 3PWIA 2RDXA 4E4FA 4KWSA 2PU1A 3R0KA 2QJNA 4FP1A 1P43A 2PODA 2XH7A 2OO6A 1EBGA 1MNSA 4K1WA 4K2SA 2HXTA 3H8AA 4M0XA 3TJ4A 2OFJA 2HZGA 4MMWA 3ES7A 3VC6A 2GGIA 4GFIA 3GY1A 3JVAA 4IL2A 1SJAA 1DTNA 3CK5A 4GYPA 4DN1A 4H2HA 3DIPA 5FJOA 3H70A 2O56A 2XSXA 3T4WA 3ZVIA 2ONEA 3JZUA 2GGGA 1KKOA 1MDLA 1EC8A 3DG6A 4IP4A 4F4RA 3OZYA 3EEZA 3FCPA 4E5TA 3SN1A 1TKKA 4HCDA 3V3WA 4ZCWA 5IDZA 5J04A 2AKMA 4GGBA 3TJIA 4Z17A 3NO1A 4IL0A 4E6MA 1RVKA 1ECQA 3S5SA 3TCSA 3R0UA 3TWBA 3DESA 3DGBA 2OVLA 3P3BA 3IK4A 3R25A 3MUCA 3BJSA 3T8QA 3THUA 3CYJA 1JPDX 4IHCA 3MY9A 1MRAA 3U4FA 2NQLA 1XS2A 1OEPA 3UCCA 3SN4A 4DX3A 3JW7A 3VDGA 5FJTA 3V4BA 4GMEA 2AL2B 3PK7A 1KKRA 5BOEA 2PSNA 3MZNA 3N6JA 3I4KA 2OKTA 2PGWA 3OP2A 2P88A 1R6WA 2XGZA 2GSHA 2HXUA 3H7VA 4A6GA 2MNRA 3FXGA 2DW7A 4G7FA 2PA6A 4K8GA 1W6TA 4MGGA 4DWDA 2PP1A 1SJCA 3UXKA 2P8BA 3VA8A 3CXOA 1ELSA 2OLAA 2FKPA 1R0MA 5FJRA 3DG3A 3R1ZA 4DXKA 5FJUA 3OW1A 1JDFA 3ZLFA 3CAWA 3TQPA 4J3ZA 4HCLA 1P48A 2OX4A 3OPSA 3VFCA 2XH4A 3UCDA 2PTYA 2PP0A 4H19A 4H83A 3B97A 3KUMA 1KCZA 4JHMA 3H12A 2AL1A 3OZMA 4GGHA 1BQGA 1PDYA 4KEMA 3RR1A 5BOFA 1WUFA 4GYPC 1L8PA 3IJLA 3SQSA 2XH2A 2FYMA 2MUCA 3GC2A 4ZA0A 2GDQA 2OPJA 3SSZA 3STPA 3UJRA 3QLDA 1EBHA 4HNCA 4HNLA 2OQHA 4H1ZA 3FV9A 1F9CA 4A3RA 3Q45A 3UJSA 1EC9A 1MDRA 2DW6A 1TZZA 4JN7A 4G8TA 3UGVA 3RRAA 2GGJA 3MSYA 3CT2A 4IT1A 2PS2A 4YWSA 1EC7A 2PTWA 3SBFA 4E4UA 2ZADA 3N6HA 4MKSA 2QDEA 2QDDA 3N4FA 2OZ3A 2I5QA 3BSMA 3D47A 4X2PA 4Z1YA 3TW9A 3VCCA 3P0WA 4EWJA 3CB3A 4GISA 3T6CA 4GIRA 3FVDA 2GGHA 2OG9A 2P3ZA 2QJJA 3ENLA 3V5FA 2PP3A 3ZVHA 1SJDA 3FJ4A 1KD0A 2POZA 1ONEA 3UXLA 4J1OA 1XPYA 3MWCA 4HYRA 3N4EA 3IJIA 2HNEA 3K1GA 2OZTA 3DERA 3FYYA 2OQYA 3DDMA 3P93A 3MQTA 3DFYA 3RCYA 4A35A 4HCHA 3IJQA 2PPGA 2OZ8A 3QPEA 3TTEA 3R10A 1SJBA 3VC5A 3QKEA 3V5CA 4DHGA 2QGYA 2P0IA 4KPLA 3TWAA 4FI4A 1IYXA 3GD6A 1BKHA 3S47A 3UJFA 3MKCA 4KT2A 2ZC8A 3Q4DA 1FHVA 4HPNA 1E9IA 2QVHA 5ENLA 3BOXA 3VCNA 5FJPA 2AKZA 1WUEA 2PCEA 3I6EA 3HPFA 1PDZA 2PMQA 6ENLA 2QJMA 3ZLHA 4E8GA 1MUCA 2PTXA 4IP5A 1NELA 2PGEA 3NZGA 4JN8A 3PWGA 4HN8A 2P8CA 3GO2A 3RGTA 2GL5A 2PU0A 1JPMA 3DG7A 3QTPA 3NFUA 1FHUA 4ROPA 3U9IA 3DFHA 4ENLA 2AL2A 3UJEA 4DYEA 3R11A 3T9PA 2CHRA 3NXLA 4M6UA 2GGEA 1YEYA 5EU9A 3TOYA 3I6TA 3ES8A 3D46A 3RITA 3SJNA 7ENLA 3DEQA 1JCTA 1NU5A 3SN0A 4IZGA 3UJ2A 3PFRA 1TE6A 3EKGA 3ZLGA 3QN3A 2PTZA 3OTRA 2XH0A 2QQ6A 3ZVHB
chains in the Genus database with same CATH superfamily
1X6UA 4KERA 4JYDA 4LNYA 4XISA 1EDGA 2BASA 2PDPA 2WPEA 1MEWA 1RPXA 1UD4A 4Y7EA 2HQMA 2EF9A 3U2OA 3KE0A 2VZSA 4HGXA 3GY1A 4HZ6A 3BLLA 1CECA 3TAOA 4N6FA 4EIVA 1OX4A 1EOKA 4LUSA 1FBAA 1BVWA 3KFTA 1KV5A 5GJNA 1RM6B 4W84A 2ONEA 2EG8A 1FWJC 5I3DA 4J3SA 2GGGA 3Q2DA 1SW0A 4H6KA 1L6FA 1W5PA 5E0FA 2GJPA 1UKOA 4NF7A 3S5ZA 1AODA 6TIMA 3RO8A 1I8JA 3BMWA 2FDSA 4LTSA 1I1WA 3GZAA 3NO1A 1EXPA 3AHTA 1S3TC 2BVWA 4WD0A 3BL3A 3M41A 3S6DA 4GUFA 3WBXA 3GU1A 1B0IA 5GVJA 3MY9A 3U4FA 3WJZA 1QHZA 2QMKA 2QXWA 3UCCA 4CN1A 4IX0A 3A5VA 2Q02A 4QM1A 3WELA 3NL2A 5I06A 6A3HA 1H50A 1VP5A 3JUGA 4DBWA 2VX4A 5DANA 1E0XA 4IQDA 2G3JA 4GUGA 4Q4MA 2QJGA 5C9XA 1A5SA 4CQ8A 3VPLA 3ZJ7A 4IMGA 4PCTA 1KM4A 3GX9A 2ZDRA 4AZCA 3H2EA 3I4KA 3FNDA 3VZYA 1MXGA 1AJ2A 4HK5A 4O1CA 4AXNA 2YQUA 3PZVA 2JF6A 4MG4A 4Q8UA 3T44A 2JEQA 1J96A 2GJXA 4QNEA 4QEEA 2VX7A 1OD0A 1XGEA 2ATSA 4V2XA 4FLRA 5BU6A 3FA5A 1Y5VA 1UD2A 2WWCA 2X7VA 3CXOA 4C7FA 2IKGA 2W6RA 4D8AA 3GXMA 3LCLA 3LBCA 1JYNA 1TQXA 2QF8A 3IGXA 3LPOA 4CD6A 5ECUA 1XLLA 4FO4A 1RD5A 2VUNA 5JH1A 1T3QC 1CGTA 1CEOA 4LUJA 5K9CA 4LT9A 5CH9A 2VMFA 4G7EB 2W3SA 3KXQA 5EYWA 3DGZA 1YPFA 3WL0A 1M03A 1R3SA 4IJRA 2YBVA 3AMDA 4LV9A 4XD6A 1WDSA 1OT2A 2ZE0A 4FX6M 1XRTA 2FYMA 5T9CE 2YA1A 1MXSA 1VFHA 4XKYA 1POJA 2HVNA 3QFWA 2EAWA 3AHZA 1PAMA 5D32A 3FYOA 3W22A 4C7GA 3A12A 1PTGA 3O0HA 1W3KA 5LGXA 3M0YA 2YYUA 4I3GA 1WB0A 1AH0A 1PKYA 4ZXLA 4XUYA 5FCZA 1JXJA 2Y62A 5D9OA 3CUZA 1SFLA 2EQDA 2NWRA 4QG6A 3O1NA 4R9XA 4C6BA 3TKFA 4NHVA 4MHBA 3SCPA 1XH1A 5A6TC 3UETA 1OYCA 2Z1WA 1SZFA 4CKQA 2W91A 2HQAA 1E4NA 1D3GA 4NZ4A 4Q8OA 2VC9A 4S2CA 4JTCA 1FCVA 5DMNA 3G1SA 3FW6A 3DC8A 4G9PA 4JEQA 3WLQA 4H4UA 1WXYA 3KOWA 2OO0A 1KWGA 2Q3RA 2Z26A 2GWGA 4C6JA 3OLDA 2YPIA 3AS1A 3ZVHA 3LI0A 2TPSA 4WR3A 2YW3A 4IIDA 1TX0A 4JTEA 1YBQA 5LYRA 1EWDA 4UTHA 4OQVA 5LIKX 5I3KA 4RX0A 4HZ8A 4K6AA 3CUHA 2J78A 4D72A 2BHYA 3KCOA 4PSPA 2YCEA 1EJRC 2O7SA 3W7NA 2C3DA 1EGVA 1QCWA 1TPFA 3EKZA 4J3VA 3PULA 1CXKA 1P1MA 3GTIA 1TR9A 3L7RA 4O10A 2O9TA 3O2LA 2ZZ2A 1L2QA 1GOOA 4N9DA 1JAKA 2XVGA 1XCXA 1DQWA 1JGMA 4QS5A 3L23A 1H60A 2VFHA 2NV1A 3H4XA 4ZL1A 2Z1SA 3W6YA 2VYOA 3F4DA 2PMQA 2IMRA 3RG6A 3LGGA 3VNIA 1AQMA 3VDBA 4JFVA 1KGUA 3AAMA 8RUCA 1E3XA 4RE0A 1Y5XA 2WKJA 4TUFA 3VYLA 1D3CA 1E6SM 3W28A 2JKPA 2WJFA 3M5VA 3MO4A 2G3MA 3W7LA 3C0LA 1FHUA 3S2NA 3K2GA 1XYLA 2BVYA 4ATLA 2E1WA 1GREA 3AXIA 1UROA 1SYTA 1UJQA 5E5CA 5BROA 1AW5A 4GHRA 4HYWA 1FWAC 4IQEA 1W5NA 1XLJA 1KR1A 3KP1A 3W88A 4H4SA 1G5AA 5I24A 1A3WA 5LIYX 4O1BA 3QBUA 7ENLA 4RNFA 4GRSA 1PWLA 3FS2A 5HQLA 3I7SA 2Y88A 4W86A 4YNGA 4QBXA 4QR6A 2GUYA 2JALA 2OODA 4O50A 5U25A 3CASA 4JYFA 2P0OA 3ELFA 1OG6A 3LQLA 3LBMA 1GJPA 2B7NA 3PWIA 3PUDA 5AYBA 3VIGA 2VD8A 1JAEA 4WGXA 4PRTA 1TPC1 2OO6A 1MNSA 1MSSA 3QFBA 1QI3A 2VX5A 1T41A 1K03A 1JF5A 4JTIA 4C6LA 2C6QA 2G96A 4IQLA 5DY2A 2ISDA 3EKLA 3TFXA 4APNA 3UZ5A 5L6UA 4GJJA 2YB4A 1ME8A 4GACA 3WBAA 1LQ2A 2YBTA 1CLXA 1PIIA 4PUKA 3HFTA 4IM4A 1UH2A 3G1FA 1E1CA 3TQ0A 4B4FA 4CVWA 1TKKA 4NJIA 2OB3A 3ABSA 1X7IA 3LHYA 2P53A 4FXSA 1UKSA 4UNKA 3QPYA 4C1KA 2VX6A 1J6OA 4E3TA 3GH5A 1E15A 3A4XA 3H6OA 1DXFA 1KN0A 3DESA 4J3XA 2E9LA 4V27A 5LIUX 3ZR6A 2JIWA 3MTWA 1VC4A 5AYIA 1ONFA 5C7VA 2YW4A 3GR4A 3H55A 4U5KA 1R3WA 2D2GA 3USBA 3R07C 4R85A 4NG3A 1EQPA 1IZJA 2RUSA 1VB9A 4WDXA 3KWSA 3VDGA 2ZA3A 1XWYA 3W2NA 2F38A 1TJRA 8CGTA 3T05A 3CT7A 3QMTA 4M8UA 4AF0B 2VR2A 3L68A 2WOVA 3T0DA 2ABAA 1EBDA 2PGWA 4JZ5A 2ISSA 1KBJA 1IEVA 3KOYA 1JDCA 5JCKA 4A6GA 5CC5A 4H6QA 1SO5A 1M7OA 3KLLA 4DJFC 2HV5A 1A80A 3HM7A 4FZIA 3VKKA 2DEPA 4PC8A 3BCJA 1HL8A 3QRHA 1FQ0A 1GVEA 4DWDA 3DFOA 2ANUA 1TPDA 3SR7A 4EAYA 4ADUA 5FJRA 4XAZA 3NQAA 1RA5A 3CO4A 3B8TA 4NL1A 3EDFA 4ICCX 3S9YA 1CGVA 3VFCA 1WCGA 4PMUA 4W88A 4XIAA 3BSGA 4UFKA 1TX2A 5DMYA 1FWBC 1SZGA 3G1RA 1V0NA 3NPUA 3D3FA 3E49A 4PL2A 1GJUA 3T40A 5FJJA 1X6LA 1KGWA 3SQSA 1TFVA 2CLMA 3WDJA 4RE4A 3W74A 4H7CA 2IQDA 1E51A 2PLMA 1V7YA 3CQIA 3LMYA 1UASA 1ZBKA 4AAJA 5TQLA 1MUWA 4PYSA 2PZ0A 1REQB 4PULA 2GVGA 3QEZA 4E2OA 1NF7A 4FX8A 3G77A 1XYCA 3TVAA 4ZB5A 3LS9A 4M1RA 3B0UX 2XINA 2XVKA 3WDQA 1J0KA 5AOUA 1KO0A 2ZX7A 4XTDA 5FF7A 1PVNA 4MB3A 4ES4A 3PNUA 5AHMA 2WNZA 2V5KA 3W82A 3HGRA 3SJ3A 2WVVB 4ECLA 1BGGA 1T40A 4B92A 1V6YA 1R9YA 1RA0A 2YA0A 1M6JA 4AMCA 2WJZA 2J74A 3K8KA 5AYXA 4N4QA 1TJ1A 5CZJA 3GYEA 1QJWA 1L6WA 1YMYA 3V5FA 2XFWA 3RPMA 4CD7A 5C7HA 2R1KA 4J1OA 2YDQA 4LA1A 3FA4A 3MVIA 1MZRA 4LYRA 2GVEA 4GI8A 1M01A 2YCJA 3RCYA 2BOFX 1PYFA 1RQBA 1R3YA 1PX4A 1E40A 1LOLA 3DH7A 3PTKA 2ZX9A 1GVFA 1WKEA 3KHDA 4JQ1A 2GSEA 3V5CA 4ALDA 1H63A 4QQ3A 2ZTKA 2CW6A 3EEGA 1A0DA 3C6CA 3WF0A 1BKHA 3NL6A 4NJHA 4TVCA 3O8AA 1SSDA 1E55A 2VENA 1E9ZB 4LGXA 4DAFA 5A8QA 2GRTA 2ZX8A 4YTUA 3G3DA 3G8EA 4F0SA 1R7AA 1VJIA 3EWWA 3MMDA 3N18A 3DECA 4DJFD 1C8XA 2OT0A 1H62A 1GVRA 3PZUA 2ODOA 3RM4A 3UNTA 2WNWA 3GO2A 4JQAA 2PCQA 3EPNA 1W9DM 2VFEA 1BRLA 1EP2A 1ZSXA 4J3WA 4JICA 1DWIM 3G18A 2WV8A 1VPXA 4HMDA 3FGCB 1OFQA 3D9XA 3VKJA 4GVIA 3PVFA 5H91A 1N8IA 1C91A 2FJUB 1KM6A 1LZOA 5LKYA 3TYZA 3Q58A 1HVXA 4PCPA 1GVSA 1PCKA 5HWMA 4GJIA 3RITA 5DCBA 3UCQA 4NVTA 1XSJA 3GU2A 4RR4A 5F2MA 4DZIA 1LROA 2OKOA 1NDZA 2E9BA 3F2DA 2DY3A 1B9BA 3CV7A 2JGQA 3WNNA 1VFTA 5EMYA 4Y90A 5M5DA 1FUYA 2ABBA 2WJDA 4H7ZA 4TIMA 1P7TB 1PSCA 1RR2A 4MWAB 2RDXA 2PU1A 3COTA 1R3RA 3UZZA 3L0GA 5D2TA 4S3AA 2BV9A 4M80A 2GFTA 4LH8A 1QNPA 1Q6CA 3KVKA 4ZO7A 4GZEA 1PV8A 4AYSA 2G37A 4QTGA 4E8CA 5E0KA 1RLDA 3PUEA 3POCA 2W4XA 3FHQA 3VX1A 3BJTA 3HURA 3OU8A 3NO5A 3NVTA 4TMBA 3WLPA 4NYUA 3MP3A 1CW2A 3QFEA 2JF7A 5LA0A 1Q7QA 3CGCA 3F4CA 3TSDA 1SUXA 5FKYA 1AD1A 1M41A 4B5NA 5JRBA 5G2IA 3CMGA 4BFAA 4IXHA 2Z29A 1Q6QA 5HJLA 2J13A 5KZMA 3S5SA 2PAJA 1G7UA 4HNVA 3EXRA 3IVUA 2OVLA 3P3BA 4QS6A 1P1XA 4GI9A 4F66A 1UD6A 2F5ZA 3MUIA 4IHCA 3CXBA 3W70A 3QM3A 2Z2AA 4HYVA 3V7PA 4PUWA 1OEPA 1VCFA 2Z2UA 1B54A 3EX6A 2AQVA 3IIOA 4WVXA 2QPUA 3MU7A 4CEUC 1ZAIA 3RYSA 1JFXA 4FS9A 2ICSA 4BI6A 3RU8X 1SO4A 3SQPA 1FWDC 1VRXA 3EAUA 2Z28A 1VFFA 3BXWA 3GLCA 1N61C 3SCRA 3GNNA 4R7OA 1AL8A 4ZTYA 3DKLA 4IIEA 1XIMA 3RJXA 3BV7A 4JIHA 1RVGA 4CQDA 1KXTA 1NJJA 1KFKA 3WMCA 1KXVA 8XIMA 4LVGA 3O06A 5CG7A 4GH3A 3L8KA 3ITOA 4OUIA 2E09A 1YNYA 3U7BA 1E5NA 3BZJA 4MSSA 1BGAA 1XYMA 1EA9C 4DXKA 4K7VA 4U31A 4DPQA 1A3XA 3O05A 3AIUA 4DO5A 1J2BA 3C2EA 2D69A 1A5BA 1Z3NA 4DLFA 1TTQA 3WLMA 1TIMA 2WAGA 2OYMA 2I16A 1AOGA 3M43A 1FDZA 1TZ9A 2X2GA 4KEUA 3ABXA 1ICSA 2GQ8A 5I7GA 3RMEA 4JHMA 3LGDA 4M19A 5CPOA 3VTRA 5BOFA 2ZYFA 2V3BA 1WUFA 3WLNA 4BKNA 3W2LA 1AJ0A 3MWAA 2FZDA 1RY0A 5A2BA 4Y9PA 4CGTA 2E4TA 2WMIB 1H49A 5FSEC 4H1ZA 4YVXA 2B81A 1F9CA 4UR9A 4JKKA 1UPPA 1OYBA 2YXOA 3ARXA 1FWEC 4P8XA 1V0MA 4U10A 3VVGA 1FRBA 3URQA 3W23A 1IT0A 1XDMA 2ZADA 3GNPA 2WZEA 2I9UA 1NOFA 1JR1A 4EQWA 1VJZA 4NZ1A 4ORIA 4EMWA 5BWAA 1LM1A 2DH2A 1VBJA 5HNRA 3TQVA 3L2MA 1MQPA 1EPXA 3NQEA 3UZXA 1CYGA 1GOXA 1XLDA 3NTYA 3WF3A 2VGFA 4ASTA 1LUCB 9XIMA 3QY7A 4AY7A 2JE8A 4LWWA 1NY1A 2PP3A 1ITXA 3R58A 4QG8A 5K4ZA 1KM2A 1SJDA 2TMDA 3TAKA 1ONEA 3F4VA 4AC1X 1XDJA 1UKPA 2NX1A 5J8LA 4UTKA 4Z1DA 3UA3A 3CJPA 3KOZA 2PPGA 4IWWA 4JYEA 5G2WA 1IF2A 5AC8A 5J5DA 4WCJA 5DXYA 3GXFA 3W75A 1MQQA 1P0KA 1XIFA 1JZ3A 3N2OA 2H6RA 1XINA 4GO9A 4D6IA 3UJFA 2XJ7A 4JTSA 4UMBA 3AC0A 4HIBA 5EMJA 1GRAA 3BICA 5C2XA 1E9IA 4WLCA 4GZJA 3WZ0E 2RABA 3CC1A 5E6ZA 2UY5A 4RK8A 2AKZA 3PB0A 3HPFA 3JU2A 3WQGA 3CZJA 4BWLC 1JDEA 4L9YA 3GTXA 1TMLA 4I5XA 1VFSA 2W61A 2E3ZA 2PDMA 1FOBA 1XC6A 5CJNA 2W27A 1Q6OA 4AHPA 1CPUA 2C79A 1EOMA 1FDYA 2W62A 4FHAA 1RJPA 4WJXA 2GL5A 2FLIA 2EQ6A 4LY4A 4R5EA 3W6MA 1RQEA 1DWAM 4DIAA 1NM9A 1FFQA 1KM1A 4J9JA 1UG6A 4MUPA 4RXGA 5CPMA 4WXYA 2J7DA 5IHRA 1PKNA 4L9ZA 1W9UA 2DSZA 3ITXA 4IIBA 3W37A 3VFLA 4M6UA 4ZGYA 1UYQA 2HS6A 3WNLA 4N7QA 1GTHA 3VKAA 3G24A 3QQWA 3BTNA 2YR1A 4AIUA 3PBMA 3BLPX 1V5XA 4DZAA 3RIKA 4DJEA 2E1DA 1CDGA 3D46A 3IARA 1P5BA 2Z25A 2VQUA 4GI6A 4PN2A 3C4UA 3UXAA 4D1IA 3CB8A 3HOJA 5G5HB 2A3CA 4AYGA 4PA8A 3NURA 1ISVA 1LCOA 2QV5A 2OX1A 4Q7BA 3CUIA 4I9TA 2XIMA 3DXIA 3OGVA 3AJXA 1AA1B 5BRBA 4NNBA 2QLYA 2E7FA 4PMRA 3EA3A 3OYXA 2PODA 3ANVA 3QV9A 1JZ8A 3WH6A 4TVDA 4L4OA 3CQJA 4M0XA 3TJ4A 4W7UA 3ATYA 3ZWSA 2WQDA 3HZ3A 2E5CA 3L4ZA 4BZYA 1IGWA 3H2OA 4GFIA 2WPCA 4NZ3A 3JVAA 2TPRA 3CGDA 2XZ9A 4Q32A 3KS6A 4M6QA 3L2LA 3ECQA 4V33A 3H70A 2O56A 1T99A 3T4WA 3FX4A 1MRQA 3N9KA 3JZUA 4Q4OA 3ZSTA 1XLHA 2VEIA 3W71A 4HOXA 4F9JA 5LA1A 1PHQA 3VNLA 4E5TA 1GNXA 1LRQA 3VE9A 2OR2A 1X1OA 3GFZA 3NRZB 5I77A 1DYSA 5FJIA 1GGOA 1GERA 1V3KA 4GUHA 1O6IA 1UMLA 3R0UA 1MQRA 4RLIA 1GZGA 1VLIA 3R25A 2WHJA 2C15A 4WEVX 3UVIA 3CUXA 2DT2A 2GVJA 4DWSC 3B9JB 1OF6A 4OU1A 3JS3A 4QAIA 4Z2GA 4JHZA 4WF7A 1FHDA 1WZMA 1UMYA 4U33A 1DXEA 4I90A 4I6VA 5CEWA 3QLLA 5MKGB 3LY0A 1ALDA 1A4LA 2I1OA 1HJWA 3Q67A 1ECEA 3A4JA 4UOJA 4TX8A 1JDAA 3AXKA 3MW7A 3BW2A 3DI0A 5GPRA 6REQB 2DGAA 2QCDB 1I1XA 1FFRA 5HUPA 4PUUA 1VPYA 1Q6RA 5C70A 3VNKA 1BPLB 1TPWA 3WJXA 4CCZA 2DW7A 1TJPA 5CLTA 4G7FA 5AHLA 5D9PA 1ISWA 4K3ZA 2CZEA 1GHSA 3GDTA 4ORMA 4J4KA 4EF8A 1XIBA 3VCRA 1DPMA 5A8GA 4BK9A 5G4WA 1E56A 4US6A 4YVVA 1LL4A 2ZXQA 3CAWA 3M64A 1SPQA 2F8QA 4PTNA 2ZICA 4GG9A 1JDDA 5M1TA 2C1GA 2RJHA 3PG9A 2PTYA 3EWCA 4GQRA 3AIVA 1U83A 4CNNA 1F3TA 1TJ2A 3GAYA 3ZO9A 4GGHA 1C7SA 2VFFA 3KL3A 3NGJA 1AJZA 3GHUA 3PS7A 2PWFA 3EXTA 2EPKX 4DO7A 5A3HA 2WZTA 3EDKA 2DZSA 3KS5A 4K38A 4ZMGA 1YTKA 5BZAA 5IBXC 4Z1AA 4GNJA 4HNLA 2XM2A 1J12A 3UF9A 2OQHA 1QBAA 2GQ9A 2ZUMA 4HHMA 3TXVA 2VZOA 2YBUA 3PJXA 3UA4A 1TZZA 3RRAA 3ERPA 4AWSA 1H41A 4O54A 4KEZA 4HMNA 1FWIC 3CYVA 1YXCA 1XF0A 4HMEA 3W07A 5L9FA 4GUJA 3EDDA 2GH5A 1F6KA 3LM7A 2WCAA 3SB0A 4JDYA 4L6HA 1Q6FA 2VC5A 3S9IA 4PEEA 1FFVC 1XHCA 4LS2A 4Z0JA 1S5MA 3D47A 1GOKA 3HMJG 3U57A 3VKBA 1SB3B 2GPTA 4BF7A 1YRRA 4O18A 1FVPA 4EWJA 4IG2A 1QUMA 4KH2A 5CSRA 3C5QA 2BGQA 5KVIA 4OOUA 4LAMA 3H23A 1ZKQA 3SEPA 5JMUA 2QJHA 2BXYA 2BHUA 1K4GA 3FJ4A 3HA1A 2R24A 2E68A 1W8GA 4GOAA 2POZA 3VGDA 3QH2A 4AH7A 4GYJA 3S4TA 4AD4A 1TZ7A 1JROA 4IICA 3TYBA 3ONCA 3CV1A 3IJQA 2VUYA 3WIJA 1RBLA 4DWSD 2FDMA 4JBRA 4P5UA 3GVRA 4O19A 4B2DD 3DAQA 4OTKA 5HUOA 3QKEA 4QE5A 3CWOX 3PJWA 2WKLA 4GVHA 4FNQA 3OVPA 3WK2A 1SZNA 2NLIA 4CNSA 3S47A 2AQWA 2W67A 2P50A 3E0FA 3WDHA 2XN0A 4HPGA 4JTLA 1UC4A 3CMFA 4EAMA 3KDOA 2DVTA 3CMJA 3A4AA 3WNPA 2R1NA 3M7SA 2ZUWA 4MFEA 4EXAA 2DZXA 3B8UA 1H7OA 1TA3B 1ZAJA 4RZ6A 4FLQA 3CLWA 5FS9A 4YHGA 1KTNA 4Z2IA 4LUYA 3GW3A 4JN8A 1XLBA 2FHFA 1GPWA 4HU0A 1UD8A 3RGTA 4NZFA 4F0LA 3MJYA 3THQA 2QMJA 1JCMP 3PWAA 1GQLA 4NXKA 3XINA 3WD0A 1TRIA 3FDGA 3CM4A 3EGJA 4ROPA 2F2KA 4B3LA 3P80A 4S3GA 5TNVA 3UJEA 1AQ0A 1UC5A 3HG5A 3N6QA 4HN4A 3LB0A 1YE4A 4M82A 4A3HA 4PMJA 3VMNA 3WLHA 2NVAA 3CV2A 3VU2A 5I09A 3T0TA 2QYGA 4O15A 2WLYA 5JUVA 3R2GA 3HJEA 3WFLA 3T4CA 1K3UA 3MDUA 3LCFA 1FDJA 4UFHA 5FS6A 2J75A 4TU1A 1HJQA 4FR1A 2GOUA 4R53A 2BSLA 3SRFA 5G1TA 1OGGA 4DUVA 2WSQA 5I03A 3PHAA 3NVWB 3LTSA 4V1YA 5G4EA 3QMSA 3E5BA 3EB4A 1EX5A 4C7DA 2PRMA 4IIHA 2XHYA 3K8MA 2J8FA 1OFOA 2Z6JA 4E4FA 3DUGA 3H21A 3R0KA 4AC7C 1R3VA 2OSXA 1AW2A 5F2LA 1DIDA 2YAUA 4W7VA 2PLJA 4G7EA 4O8RA 4J5NA 4LUTB 4Y6GA 1NP0A 3CGTA 3W1QA 4N2YA 2CCRA 4NY2A 3TC3A 4DN1A 1X2GA 4UTTC 3GXPA 3BARA 3LV6A 4YTTA 4D8ZA 7ODCA 1EJSC 2E77A 4O4WA 1NDVA 4Y9OA 4KGLA 5AYYA 3E2SA 4AD3A 3DG6A 3QR0A 1Q63A 5FI8A 2J9XA 4J3TA 4AX6A 3QR1A 4GVFA 3B8WA 3FJLA 1FA2A 3QQ1A 5KZEA 2WKGA 1E0VA 5IXEA 3LGEA 1W8SA 1NWTA 2R1PA 1WXJA 3RCMA 1GOQA 3BJSA 1MW1A 3NSMA 1UZ4A 1GJWA 3R8GA 5PTDA 3PJTA 5DELA 4C1LA 1O5KA 2QCFA 1DOSA 1QHPA 3ZYZA 4HNTA 2XM1A 1S1PA 4KMQA 4R7WA 1THFD 1GOIA 3EWUA 3LV5A 1D2KA 1L6SA 4YJ5A 5BXRA 2WO5A 4ZQMA 1H7RA 3PZ9A 2VEGA 4FR6A 3TTYA 1R7OA 3INPA 3LB8A 1LG2A 4JXCA 2VELA 1UP2A 3NVYB 4EX4A 3LXCA 3CBWA 4GD0A 1W6TA 5B80A 5REQB 4KWUA 1BYCA 4S38A 3A47A 2PC4A 2GR0A 4IMFA 2D2OA 4JIEA 3BH4A 4MNMA 3EPOA 1OCQA 4UB9A 4GRTA 3MVTA 3M07A 1Y7VA 3R0DA 3W85A 4O0QA 1ISXA 1DVJA 2H3BA 4FA3A 1R2TA 5JCLA 3NNTA 4WSHA 3DFQA 4M81A 4S3CA 3TP4A 3UFYA 2W79A 1ODUA 4TVUA 3LZ3A 5KZ6A 3S1WA 2PWDA 3BCFA 3RR1A 4CQBA 4D6JA 1L8PA 1QK2A 2YXGA 4DVOA 5C2CA 1FH9A 2IPFA 4P7RA 3W3OA 4DZHA 1LTDA 3STPA 4I7VA 3UJRA 3N4AA 4ZFMA 4D1JA 3UG3A 1QOQA 2J6XA 3QR3A 5LSMA 4YYCA 3U0HA 2WBAA 1MVYA 2GGJA 3GVGA 1C7TA 3PG6A 4Z1CA 1OVDA 4E4UA 1H4PA 3UPWA 1BKSA 4KRZA 1CLKA 1M65A 1W31A 1MWOA 3IS4A 4DI8A 1IXOA 2FHCA 3NJ3A 2QCNA 3S42A 1S5TA 2YZRA 1DQXA 3VIIA 3GIQA 3ZQ9A 1TV3A 4HP5A 3CH9A 4K8HA 3LHWA 3ISIX 2J79A 4QNWA 1KFBA 3AIBA 5BNKA 1IQ8A 1WX0A 2WP5A 4WUIA 4LYQA 3SO7A 2BZNA 1GHRA 1H5VA 4HSOA 1K8CA 4TO8A 2VR5A 3G0UA 4M56A 4MF4A 3PUOA 4IGNA 3B4UA 4GX9A 4QEHA 3TU9A 7XIMA 3PR2A 4BEQA 2DUAA 3M44A 3UXLA 5K4XA 4HYRA 1C8VA 3CS2A 4KS0A 4QCEA 4QLLA 1FWNA 3O6CA 2PEVA 5CGQA 1Q8AA 1UR8A 2EJAA 1E0WA 2NLYA 5CC6A 1XLIA 2J7HA 2VC6A 1PJ9A 2J7CA 1AQHA 4EK7A 4JCMA 4X9SA 2QIWA 1XRFA 1HJXA 3ATZA 4JTRA 4F0RA 1B30A 1W32A 4C6NA 4TX9A 1WPCA 3PPCA 1E72M 2D0GA 2PD9A 3VM7A 3DFSA 3EYPA 1XH0A 1CGWA 5DF0A 5K3VA 1K7EA 3SQMA 1OSEA 4IUOA 1I2OA 3ZT5A 3LCGA 3GAKA 3WEMA 1JEHA 3EBVA 3UBPC 2Y5JA 3A22A 2NXIA 4JQ9A 2X7WA 2EKCA 5CGTA 4LF2A 4F79A 1RQHA 3C8FA 1XI3A 3I6EA 3I4EA 4BEUA 3SCSA 4LX4A 3TUUA 2X30A 3HF3A 5I3FA 1F74A 3GVWA 3K4DA 3RX3A 3KRSA 3L4VA 1HN1A 2WMKA 4LAZA 2PE4A 2RAGA 1O66A 4IFRA 3TLQA 2ZZ5A 1YHTA 2P10A 1YIXA 2YVFA 1V51A 1ZP4A 3T08A 4UTFA 1Q2RA 3E2RA 1K9DA 1B3YA 1JUEA 1KTCA 3BLOA 1ZB5A 3G1YA 3NPVA 3MHGA 4AF0A 1FIQB 4KPRA 1PZ3A 2Z6IA 1XIHA 4Z2HA 1EH9A 1V6XA 3GC5A 3BW4A 3QHNA 2IW0A 3LRLA 2X50A 4HA0A 2FZMA 5E09A 5EFDA 3NAVA 4JTDA 3E9AA 4GKLA 5T26A 3IGHX 4CQAA 3B0YA 2DQWA 4ZE5A 3FEMA 1OT1A 1DXIA 3UR7A 3UY7A 3LCIA 3SCVA 5AC4A 3MI2A 2XTKA 4AVNA 3M0MA 2XIOA 1EEXA 1W1A1 3MKKA 1OCBA 3M5YA 1J0JA 1G9HA 1CGUA 3CEUA 4HK7A 4JL2A 3WH5A 1D8WA 4AEOA 2ZUSA 3RO6A 4HNUA 1NWUA 4PRWA 2YKKA 2YX0A 1R8LA 1ZLPA 1PWMA 4J27A 1P0DA 1GETA 1VR6A 1YXDA 1XM3A 1OCNA 4GXMA 1XKJA 2OFJA 4H50A 1RCQA 1LOQA 1RAKA 4GIYA 3WJSA 3ES7A 4PUEA 2GGIA 4Q4SA 1SJAA 3QJAA 1I2QA 2V0TA 1OJTA 4L4LA 3W0KA 2YLAA 3C56A 4L61A 1T0OA 1UJPA 3DCPA 1C3FA 4L64A 4GX8A 2QCLA 1REQA 1BWVA 3LYEA 1TPVA 4DQWA 3L65A 3R43A 1Q3NA 4OE7A 3W4RA 3VOCA 2FB3A 2DUXA 4ZCWA 4PMXA 3NWRA 3W7RA 2C7FA 1RVKA 4MNKA 3L0NA 1MFVA 4WQ6A 1ZY9A 4WJ8A 4I5RA 4Y8FA 2NVKX 2ZVRA 1GKQA 4XD4A 2WVVA 5M03A 2A85A 2BXZA 2C71A 3GFYA 1KNWA 5AC7A 2R1MA 2NQLA 1L6GA 1XS2A 4QP0A 4ZB0A 1J0ZA 3W73A 3F4NA 2A21A 1XYAA 1FHLA 1R86A 5TAOA 1TTJA 2J7BA 4F2BA 2X16A 1M9HA 2Z7KA 1WBHA 4LRTA 3MC5A 1JFHA 1TV8A 1QI4A 2WWDA 4UTUA 1I2PA 4LVAA 1WA3A 2W5FA 3BLFA 1EWEA 4TMCA 3VD3A 4UMCA 3GG8A 5K9DA 3VOIA 4LEFA 1JUBA 4UIOA 3LA4A 4MLJA 3SFWA 1N5XA 1UWTA 4JIRA 3IJ6A 3TYAA 3GG7A 1JXKA 4C60A 1HO4A 1Q6LA 1LT8A 4C6FA 5EMMA 5BOOA 2PP1A 3HQOA 2PDIA 3RUBL 3WYZA 3WUFA 2POTA 4JNYA 4NKCA 1HL9A 5LNRA 2CZVA 4Y9AA 3DG3A 3R1ZA 3NOYA 4RDVA 3PC0A 2O7QA 1FWRA 1HVQA 2B7OA 4L65A 4P7LA 2PWUA 3DU0A 2H8XA 3W7JA 3TQPA 2ZUTA 3TN3A 4L56A 1FEBA 5C0QA 3S1GA 4XZIA 2E9MA 1UIPA 2PDQA 2CXEA 2WNQA 4WDTA 2GZXA 2V2DA 1H09A 3CHCA 3WQPA 4GY1A 5FF3A 4GPNA 3N25A 2C16A 1HF6A 1AUSL 1FCUA 4KEMA 1BYDA 3W6LA 1GWJA 3GR7A 4U2ZA 5G4HC 4H9MA 1PIGA 3THCA 4DF2A 2ZX5A 3V16A 3EWXA 2VGGA 2V69A 2OPJA 4MB5A 4HNCA 2INZA 4LOCA 4HSNA 2CKSA 4W5UA 2H9AB 4NZ5A 3HU7A 3TR9A 1YLVA 5DY3A 5GNYA 4CN4A 2VFGA 4IMCA 4DXVA 3FGCA 4R34A 1R38A 3SDOA 4ONVA 4DJDA 4IT1A 5FOOA 4Q3MA 5CZ0A 4DO6A 1J0IA 3SBFA 3BSHA 1XBZA 1PTAA 2WSKA 5E9XA 3PZNA 1UD3A 1ZBVA 1EEPA 2QZRA 1WV2A 1GSNA 3QYQA 3S9ZA 3L5AA 4TVWA 4RKAA 3ZR4A 3RLHA 4S3KA 2I5QA 3N2TA 2C1IA 1JQVA 4AWEA 3EDJA 3NM3A 1R87A 1O1ZA 2BDQA 1KGXA 3C86A 4O1DA 3N17A 1AZ2A 4XG1A 4XK2A 4KIEA 1A5CA 3L5OA 1JPHA 1KQZA 2FPTA 1O5XA 4P8VA 3N29A 2XVNA 2V63A 1P7TA 2OEJA 4UQDA 4R7JA 2EPMX 4MWAA 1NWRA 5HMFA 1IXNA 1TSIA 4YLWA 1XPYA 4Q4PA 3SW6A 5D2WA 2FTYA 1D8CA 3TYEA 2BY0A 4A35A 1HL2A 4LNCA 4MYXA 2NUWA 2FVLA 4FXJA 3KX6A 1E71M 1SJBA 4NUWA 1ZPTA 1P6CA 2FH8A 4R9OA 5CG0A 1FY6A 1TREA 3HN3A 3E0VA 3K4WA 3FVMA 1F07A 1V7AA 1X38A 2E5BA 3AYRA 3GD6A 4IIFA 2C3ZA 4FLSA 2VEMA 4I8YA 5EMLA 3RFAA 4FOUA 1GOWA 2ALDA 2OLHA 1A53A 1SR9A 1KM3A 4OT7A 4MZ1A 3NVZB 4DY1A 2PCEA 2VKZG 3I6RA 2CEQA 2WOQA 1YW1A 1CCWB 3EMQA 3LPGA 3IPWA 2BHZA 1TTPA 1JI1A 3PBGA 1H7WA 2XGBA 3UVAA 4RZBA 4WGHA 2PTDA 4OGZA 3CZ8A 2VOTA 4IQJA 5KVHA 2EQ7A 4MFDA 4F0KA 1XD0A 4JHOA 3NFUA 3QGVA 3B9AA 4ERGA 2Y2WA 1XHGA 4H41A 1N62C 4N9BA 2OYKA 1EYWA 2GR1A 1VQZA 3OZOA 4IFOA 4JNZA 1XUZA 1GEHA 2V81A 1J2WA 1HT6A 4NEVA 3T81A 3FKKA 3PN8A 3PF3A 1GQIA 3GHSA 1A5AA 1OFAA 2ZZBA 4MNLA 5CAKA 1QO5A 2E6AA 4OV4A 3ITGA 3HMCA 4ACZB 2B4GA 3MYPA 4LAKA 5GJMA 1OD8A 4ZXOA 1H3GA 1XFBA 2V5LA 3CQHA 1JYWA 3C2FA 2NUYA 7REQB 4OJYA 3LLXA 3LENA 2D0FA 1VZWA 3OTRA 2XH0A 1NHQA 1TG7A 3U2ZA 3ICJA 4FP1A 4YTQA 3RK8A 3HGOA 1G67A 3AXHA 2YXXA 3SRDA 1C90A 5A8OA 1NVMA 4PMZA 3MMWA 3G6MA 4PBEA 2FH6A 3CIWA 4UTLA 4ZO8A 3U5YA 4I7UA 1F8IA 1TV4A 3H22A 1PYMA 5FACA 1H0IA 3O16A 3SY8A 2J3NA 1RCXB 1Z42A 5JBFA 2G8ZA 3MV11 3RNDA 4FOKA 1EHNA 3NVVB 3FOKA 2DSWA 2WMIA 1MDLA 1NPXA 3T7VA 2A3HA 4ZVJA 4AZ7A 2AAQA 3FCPA 3W1RA 3W00A 3UZJA 3KBSA 3RLGA 4UQ9A 3OLIA 2A1YA 1N7KA 3CPUA 5XIAA 1ZU8A 1A5KC 2HJPA 3DYOA 3QW4B 4P61A 2RFGA 5GRTA 3AALA 1JOAA 2WZMA 2ZQ0A 3IAQA 1WYGA 1U5VA 3KCLA 5AVNA 3W7PA 4GR1A 1FWGC 1XSIA 3O0FA 1L2UA 1UWAA 3I7RA 1BWCA 2ZWZA 2QGHA 2REQA 4QJ5B 1Z7AA 5FEXA 1CB2A 3ARSA 3H2NA 1Z6KA 5JBEA 1NFPA 3B06A 4DAIA 1MW3A 2G97A 1LVLA 3AHVA 4Q8NA 1UBSA 3QKZA 3FYPA 4C6EA 1JZ2A 4Y2WA 1QNSA 2PDNA 5C2GA 5BOEA 3M4HA 3N6JA 3T0BA 3M46A 4ICMA 2ZC1A 1C92A 1X96A 3EOLA 3H7VA 3W1PA 2OELA 4FX9A 1U2YA 4ZSTA 5AFDA 2XFRA 2EBNA 3ZT7A 3T07A 1CGYA 3LD5A 5D38A 1UWUA 2HBVA 1SJCA 3UXKA 5EMKA 4XVEA 3S3GA 4JTUA 4XO7A 4HBKA 3LHVA 3IGUA 4S3JA 1LRNA 5D05A 1E0UA 2OTDA 1M53A 3VD9A 1UR3M 1QPQA 1IXPA 1POKA 3OPSA 3U8GA 1C8YA 1QHOA 4PFHA 4NRSA 4GO8A 1S46A 3QZAA 2VVSA 1F61A 5EY5A 3A3HA 1N2VA 3N34A 3BMXA 2F6XA 2DVUA 2MUCA 4PL1A 4UOQA 3BVJA 1M7PA 1A5MC 3OJGA 4L80A 1TV2A 3W25A 1EBHA 3DC0A 4WSKA 3U2EA 4QCFA 1TPH1 1XISA 4O28A 4RJEA 1G01A 3BURA 4YS1A 1IEIA 4JN7A 5A69A 2OJPA 2X8RA 3WQ4A 3AHYA 4CNUA 1GESA 2OQLA 4X0NA 5D37A 1Y65A 3QYSA 5A6AA 3W7EA 4HPJA 4XO6A 1AMYA 4PRRA 1WZKA 3BWWA 1JQXA 3W2MA 4AWTA 3TZNA 1KLYA 3ONBA 1I9CB 3P0WA 2ON3A 3S2MA 1B3WA 4PMDA 4NZCA 4ZE4A 3P0XA 3WBYA 1GEUA 2GK1B 2G41A 4EM4A 6ALDA 3EPMA 2BGNE 1DWGM 2BOEX 2J9ZA 1UD5A 3HV8A 1W2PA 3JZEA 3VMPA 2KAUC 3SCTA 3IJIA 2Y8UA 1WKFA 3DDMA 1YQZA 1V6WA 3AS3A 3WMBA 1GRTA 1VBHA 4NASA 2OZ8A 1CENA 3MO7A 1OGBA 4H4YA 4FPSA 2ISWA 3R10A 1AZ1A 3DN5A 1JCLA 1HKVA 5ABTA 3UG8A 2ZZCA 2P0IA 5CZKA 3TWAA 3F2CA 1GQNA 1NOUA 1PTDA 1WDWA 4YL2A 3T1GA 4IFKB 5CPNA 4WKFA 3N15A 3TROA 5C9ZA 5K7JA 4ZR8A 4JKLA 3W02A 1BEUA 4KT2A 4M1BA 2QUNA 3TYCA 1OWQA 3ARPA 4GXWA 4Q4KA 1C93A 2QV4A 3H2FA 4XSMA 3D0CA 3EAOA 1DJQA 1YX1A 1U1JA 4WX2A 3QOMA 4IP5A 3QHOA 2QIIA 2WPGA 3GH7A 4BF5A 3OBAA 1NFBA 1ZX9A 3MCOA 1KRBC 1NIUA 4O11A 3MV01 3I3BA 3UP8A 3EUB3 3AISA 2FZ8A 2DZVA 3OA5A 3OYZA 3KOFA 2CPUA 5MKGA 2DT1A 2YIHA 3AYVA 1F3PA 3BW3A 2P3EA 4A29A 2EO7A 3CGEA 1AFSA 5CXPA 3BG9A 5D9NA 1WBJA 3B40A 3RR4A 3C3UA 1BXCA 3N11A 6REQA 3QW3A 3GXIA 2QCDA 5DBTA 2QCGA 3T09A 3II4A 4V28A 2UY4A 3V0TA 3HG3A 4L9XA 1V02A 2JKEA 4JQ3A 1TYTA 3DEQA 1YDYA 2I56A 1H1ZA 4AISA 2GJNA 1JCTA 4H7VA 3CTTA 3SN0A 4JN6A 2DJXA 3C2VA 2YFNA 3S1VA 1F6YA 4FNRA 3QC3A 3YPIA 4K8DA 1RJRA 2PBGA 3WLOA 1K4QA 4JY9A 3NXFA 2A79A 1DE6A 5JU6A 1US3A 3FK4A 4XV0A 2CU0A 3O6AA 2CHOA 4LVBA 4E3VA 4UTJA 3QTGA 1OF8A 2DFAA 1XICA 4UWMA 1WDRA 3N2CA 3L5LA 3WLTA 1Q45A 2ZRZA 5C6MA 1VIWA 1PKMA 1HGWA 1VCGA 2XSAA 5LXXA 2YJQA 2W63A 4H2HA 1L9WA 1OC5A 3C8NA 4UCFA 1RUSA 1ZUAX 3STFA 3ZVIA 1IHIA 1PUDA 1FX6A 3K13A 1OCJA 1Q6GA 4NP7A 3HJZA 1PIFA 4Y96A 2QNEA 1LBFA 3UU0A 2EPOA 4O0KA 1TB3A 3DX5A 3E6EA 3FKRA 2C19A 4LC8A 3PPFA 3WD4A 4ZEPA 3F5LA 1UH3A 3G0XA 1OK6A 3NL5A 3AIRA 4BQ5A 3ARUA 1EB3A 1KBIA 5CJMA 5E0CA 4ZZ9A 4KCWA 1KFCA 5D4YA 1UR9A 3HO8A 4DBUA 4JIQA 2IKJA 2ZXDA 2Z4GA 3VOJA 4BQ3A 2VEPA 3NSNA 4AY8A 1GUVA 1OABA 3M7WA 4C6PA 5FMHA 3MUY1 2HISA 1FWFC 3L4XA 2D23A 1U5JA 2XGIA 3TTSA 2D3NA 2YB1A 1BVZA 1NF0A 4EPBC 4D9PA 3S83A 1BHGA 2Q3OA 3U5UA 1CT5A 1XX1A 3PBYA 3VUSA 2WM0A 5EMUA 4RDYA 3TEVA 1XQLA 5FESA 4GQGA 1Z41A 2E6YA 2QW5A 1XYFA 1IE7C 2XIIA 5LGZA 1CLVA 2E25A 4PUMA 3WO8A 1LL7A 2HXUA 2ZUNA 1QPRA 3UY8A 3DFNA 2XPKA 3EOSA 4CNTA 1TWDA 2Y63A 1ZHAA 4PTDA 3J7HA 4PE8A 3A7RA 5FEWA 3VXGA 4ZO9A 3CNYA 4YPJA 2R6OA 3WDIA 1EHAA 1VGAA 4JFUA 3KBWA 2IKIA 1JVNA 3G6LA 1XDLA 3OW1A 3IVTA 3W7CA 5RUBA 3C52A 2E28A 5CPSA 4HQVA 2XG9A 1TPUA 3NG3A 1UKQA 1DJXA 1YNQA 1XH2A 2IS7A 3DH9A 3W81A 4EQSA 3B97A 1Q7MA 3UR8A 3W1NA 2INEA 3LCHA 1EF2A 2A0NA 5IDIA 2WC3A 1TA3A 4OFCA 5AHEA 1HW6A 3T2PA 3GC4A 2HDJA 3C2YA 3ITYA 3B03A 1PX8A 2EGZA 2YVJA 4MPKA 1X7FA 4JD4A 5AC6A 2WW5A 4UZUA 1M1BA 3SSZA 1D3HA 4OV9A 2V8ZA 2HMCA 4H8HA 3NIYA 3H2CA 2G5WA 1RH9A 3GKFA 1XKYA 1K9EA 1K6WA 3DHUA 1W3TA 1LOSA 4B16A 1LL6A 3RDKA 1G69A 1HQTA 3PM6A 1CIUA 1EC7A 4IF2A 4UC5A 5AY7A 3A9IA 4LCRA 1W1IE 3LMZA 2WK2A 3IACA 3GDLA 5SWUA 3MUAA 3IK2A 5IFTA 3TN5A 2X41A 5TBOA 2ZX6A 5B7ZA 3AXXA 4XX6A 4X0VA 3S1UA 1N55A 1XQKA 4JAWA 3T6CA 4PCFA 3EX4A 4WOZA 2PZNA 4H00A 1SZRA 2ZUUA 6CGTA 4W7WA 2HCVA 3WK3A 4KIRA 3TZFA 3RF9A 3NPWA 3O9NA 2RJGA 3GG1A 1KD0A 4H4IA 4AB4A 2DSUA 2OQYA 1RP8A 5I3JA 1E6RA 4GCXA 4DBDA 2W9MA 1HNYA 4LUTA 3K1DA 1SQ7A 2NQHA 1VQTA 2HRWA 3UR5A 1XG4A 3GDRA 4AX7A 4LVDA 5C9WA 1WDQA 2AAAA 2D24A 2DPEA 1VEOA 2EG7A 3GTFA 2GUBA 3TIMA 1X39A 2FHBA 4O53A 1WO2A 3RJYA 4HU8A 5A5WA 1F5ZA 3FJ6A 4Q8VA 1IYXA 3R4IA 2WBGA 2A3BA 3DHDA 4K39A 3TN4A 5HBFA 3N3MA 1DE5A 2DIEA 3LM3A 4PB5A 1U22A 3WEOA 3AMKA 5ENLA 5BYWA 1QATA 4PMYA 3AZSA 3CL8A 3VCNA 3AMCA 1G94A 2O9RA 1O68A 1B3XA 5A6SA 3W7QA 2CERA 1PL9A 4K7YA 1E6PA 3UW6A 3A64A 5HMSA 4UCGA 4MDOA 2IPJA 1UA3A 2DV0A 2X99A 3TJXA 3E2VA 2OGYA 1O94A 4RE2A 1KFWA 3BAKA 1EUAA 2FTWA 4LXFA 2DORA 1HTIA 4PTWA 3DFHA 1GW9A 4TXEA 5C5YA 1RHCA 2XVPA 1UUOA 5JBDA 1TE1A 2CHRA 2YVGA 5I07A 1G6CA 2SFPA 1S39A 3SSJA 2R8WA 3NSXA 2YL9A 2VR4A 2CLHA 3GZ3A 3VGEA 1G7VA 3AZRA 3AYTA 1R3TA 5K9XA 3SJNA 3W2KA 1MOKA 2NVDA 1DL3A 3LADA 5REQA 2YCLB 2CHNA 1O7AA 3PFRA 4KFNA 4PMNA 1N5WC 3LCXA 3MPGA 5BU9A 4Q7NA 3MUZ1 3ITVA 2A8XA 3OG2A 1GYMA 1QR7A 4PH6A 3HGSA 2V6AA 3I65A 1GXFA 1RK5A 3CU2A 2O0TA 4O17A 3IIVA 4H8UA 4KCUA 1TYGA 4L1GA 3BLIA 2NQZA 5DMMA 6XIMA 7A3HA 1QDSA 2HXTA 3H8AA 1S2UA 4OECA 3LN3A 5MF5A 3STGA 3MMTA 2XIQA 1NDWA 4Q22A 3FDKA 3NL3A 4GQ0A 2E0PA 2WBKA 3MZ2A 4E4PA 3TNOA 1DTNA 1IGSA 3CK5A 4GYPA 3ALFA 4GC3A 4HPHA 3B9NA 1TCDA 1EZ2A 3MBFA 5DRCA 4L1WA 4OIFA 2IPWA 2D20A 1TUFA 1DNCA 3TDFA 5BRQA 2YDAA 5LZLA 4OBTA 1EO7A 1ZL1A 1EC8A 4IP4A 2BWGA 4MY1A 3KOXA 5A8MA 3S6OA 4PODA 5IDZA 3LTYA 2AKMA 4GGBA 4HT3A 4WXZA 5BXTA 4UTMA 3WL1A 4KQNA 2VI0A 4C5ZA 1BG4A 3GVVA 4A22A 2PLCA 1A5OC 1KWKA 3BANA 4UTWA 3L21A 1V0LA 4AG0A 1XANA 3KW3A 4YHEA 2GYIA 3WLRA 2Z7GA 3HBLA 1V8EA 4M6VA 2Z0IA 4JQ4A 3EA2A 1ZMDA 1PBGA 4UNIA 4NXSA 3SN4A 4EANA 5DQPA 1HGYA 5D8WA 4NJGA 2E3TA 1Q5MA 1K9TA 1ODZA 3P60A 3FFSA 2AL2B 4O13A 3V0SA 3LSBA 3SRKA 4HNOA 1M7JA 2WC7A 5EGRA 3UWQA 4DLMA 4EXQA 3CQ0A 4B9ZA 2PGFA 2AQOA 2XN1A 1H7PA 3ME3A 3H4WA 3OP2A 3ITLA 4P8UA 1OIMA 2ZRUA 4OUEA 1EQCA 3GNXA 2P76A 1TQJA 3GXTA 3GBEA 4B5SA 5G1YA 4DJEC 1TPEA 1XBYA 3EWDA 3XISA 2XWDA 2ZWYA 3ZSSA 4QSHA 2G50A 2ACUA 3LK6A 4DELA 1XLGA 1JG9A 2E5DA 1LF1A 4H6RA 4REQB 1ELSA 3NDYA 2A6LA 4JY8A 3KBVA 2YYTA 4HZMA 4JFTA 2I5GA 1QT1A 4F0HA 1TWZA 4NYYA 4H4WA 2V3EA 3VGFA 4J3ZA 1IT8A 1P48A 1IIHA 4N4PA 9CGTA 3M0LA 4H9ZA 3N13A 4Q8QA 2XH4A 2OEKA 5CCZA 1ADDA 4TOQA 2H3DA 2YL5A 4S23A 1WZAA 4ZQRA 1EUNA 4OKDA 3GW0A 4Q4RA 4MVAA 1CNVA 3EB3A 1Q66A 1BQGA 3IJDA 3NZPA 4QFUA 3RMJA 1BWKA 3TONA 1MUMA 1XIEA 3IJLA 4JDRA 2PRHA 4HSHA 3U4AA 4MY9A 4WK9A 2NQ5A 3SIMA 4K1GA 3NS1B 4LS0A 4NRRA 2B7QA 4RW5A 1RK6A 3MP4A 5D8ZA 3LXBA 3CL6A 1ONXA 2DDXA 3UEQA 5IM51 1VEMA 3II1A 3MP5A 4LFYA 3STEA 3TSMA 4JDBA 5F4XA 5HNUA 2HS8A 1DHPA 2VZTA 1UQYA 1J5TA 2HEJA 1QAPA 3VO0A 2QCMA 1W9XA 3ABZA 1XYBA 2PTWA 2XFYA 2HWGA 5EL1A 1RXOB 5C71A 3USZA 3BGJA 2V68A 2QDDA 3IWPA 3P82A 3DK8A 4OBRA 5TR3A 4Z1YA 2CBVA 4IOTA 3UG5A 4NZJA 4D6HA 1XR2A 1IWAA 3GD3A 1HJSA 4GIRA 2J77A 4RE3A 1V3MA 4IPPA 1AG1O 4MADA 2OXNA 3CEPA 5FL1A 7TAAA 2DSKA 3AS2A 1XLEA 1FCBA 1QO2A 4B3KA 4AY1A 3NQFA 1X8FA 1R85A 2QS8A 3THDA 2TYSA 5A2AA 3KHJA 2GLKA 4BA0A 1VFOA 3MWCA 4FF7A 4J56A 2HNEA 1XDIA 5T9BG 4JR5A 3DERA 3KBJA 3C0SA 5TF0A 1A3HA 1FWSA 3DFYA 4XZMX 2C8NA 1UUMA 2DZUA 3TW6A 4WSJA 4RV3A 4UZSA 3U2CA 3WG6A 3WKZA 4PUNA 1KBLA 3TV8A 4OBSA 1W9VA 2ATMA 4MNJA 4PB4A 4AUBA 4EP8C 4GQBA 3BQ6A 4PSRA 1E73M 3SCUA 1BQCA 3NQBA 3JRKA 4RNIA 2O9OA 4H8VA 3M0IA 2J24A 2WXDM 2DZTA 1ME9A 3SFKA 3M1ZA 1RBOB 1OX5A 2V5CA 3UYIA 1GYNA 1F05A 1XPGA 2J6VA 1UBPC 5XINA 3QV7A 1S3HA 2R82A 1NDYA 2VZVA 4M7SA 4MDPA 3ETRB 3PBWA 4DJED 4MTVA 4AIBA 1V3LA 3VD4A 3MSRA 2WHMA 4GABA 4NI3A 2PGEA 1XD1A 2UWFA 2H8ZA 5FIPA 3NQ7A 3OEXA 4J40A 3AU2A 1SU5A 2NX9A 2PU0A 1JYVA 1ZALA 1CWYA 1JPMA 1VH7A 2CKRA 3QTPA 2INFA 4H01A 3SQLA 1QWGA 2EKGA 1LPFA 5GQBA 1KV8A 1B1YA 3NXLA 3KRZA 1QW8A 1YPIA 3S2LA 3ITTA 1UWIA 4GZ7A 3LX9A 1UIOA 4B5TA 4OVXA 4Z2JA 1XC4A 3W26A 3OO2A 3TX9A 3AROA 2UY3A 2ZXAA 3D5HA 3VABA 3RHGA 2Q6ZA 5ABHA 4IMAA 3APGA 1J8VA 1PO9A 1EYEA 1NEYA 3P8JA 1NU5A 3QGKC 3G0SA 4M24A 2GUUA 3V1HA 5LXEA 2Y85A 3TA6A 1EGZA 2EXOA 2C18A 3V36A 1W54A 2A3LA 4KFOA 1DWFM 5D09A 5HQEA 2QVNA 3WFZA 4MM1A 5FS8A 3WQDA 4FALA 4FDCB 3R7MA 3M16A 1DORA 4P7QA 3LXDA 3H7RA 1IV8A 5D9MA 4DXXA 3EXSA 5GNXA 2VT0A 3IVSA 3GVQA 1YADA 4LAUA 4WZHA 4Q8TA 4MOZA 4DUXA 4H04A 4QE1A 4IGMA 3VC6A 3VD5A 4PCSA 4BHYA 1D9EA 3UYCA 2WM1A 4WY0B 1X6NA 2XWEA 1IWBA 4G56A 3WN6A 1I6NA 4QIUA 2QEZA 3W7MA 2XYLA 3OLEA 1E43A 3UPBA 4US5A 5A6BA 3NQCA 1OX6A 3O6DA 2H9AA 4AEFA 3VNZA 4RNHA 3FXYA 2WVTA 3ABOA 4D6FA 2C3CA 4W5ZA 1A5NC 1YQ2A 1JRCA 4E6MA 2PDYA 3M0KA 3UPMA 1KTBA 3ARZA 2Y7EA 4PB3A 3N2MA 4XQ6A 1KCXA 4H4RA 3VNJA 2BY2A 3A13A 3DGBA 4H8NA 3TR2A 2FFCA 3T8QA 1XGDA 2O4MA 1A4MA 3MKVA 2A7PA 1ONWA 3DI1A 1OZMA 1TO3A 3IIPA 3O3RA 4ML9A 3TLLA 2ISVA 4ZQOA 4NIRA 1Z8AA 2ACQA 2AMXA 4LW7A 1H0GA 2QUMA 2E40A 1ZFJA 2ZBTA 2CZFA 3HG2A 3QFAA 2A4AA 2HTMA 3PK7A 4HB7A 3RU6A 2V6OA 4PBFA 5A6LA 2FGBA 4QG9A 5FF2A 1ADOA 4LBSA 3WF1A 4QE4A 3ZT6A 3CIXA 3AUJA 3H54A 1UOKA 4FB7A 3GR8A 3N9RA 2CIPA 4QJ3B 2XSBA 4XBSA 4NI8A 1ZBWA 2FGZA 2CWNA 2DIKA 3FSTA 3ARWA 4RCXA 3AZTA 2WSYA 1UKTA 3SR6B 4U4MA 5I79A 4B5XA 8TIMA 4I6KA 1EJUC 4RDWA 1XIGA 1P0NA 4DYKA 1E4MM 2PP0A 1YYAA 4JX5A 2V2CA 1N60C 4BI5A 1KCZA 1ZBCA 4N6EA 1PZ2A 4D2JA 1QOXA 1PDYA 4LY8A 3C3NA 4MJ2A 2VWTA 3ALGA 4C6CA 5ABFB 3CZKA 2DT0A 4ZA0A 2A2IA 2GDQA 4X63A 3WNOA 3PTMA 3URNA 1XBXA 4H9UA 1YDVA 1VBUA 3PPGA 2DIJA 3TMQA 3QVQA 3AWOA 4EACA 2RGMA 4S3FA 4X60A 3H2MA 1IIGA 3Q45A 1MDRA 5HXMA 2FB2A 3H26A 3MSYA 3VNDA 8A3HA 1D7KA 1FP8A 4LUIA 1T6MA 4D6GA 5G5IA 4LJ3A 1W5QA 3OZPA 2PDUA 3FSUA 1WAWA 4Z2LA 2FIQA 5AYZA 2UBPC 4L1XA 2CLIA 1JZ5A 3TC6A 3G1HA 4CN6A 1K8XA 1B3VA 4ACZA 2IXUA 1PX3A 2VFDA 5F4SA 3BPWA 4LALA 2BVDA 2DH3A 1O5RA 2BLEA 5C54A 3OLGA 4OWGA 4PTXA 3A6OA 3SGZA 1V93A 7REQA 3ZJ8A 1W5OA 3OOQA 2PDCA 1IZCA 1BSIA 3CL7A 4OZOA 3T55A 1Q1WA 1J6PA 4IPIA 4A21A 4QJ4B 3OQEA 4ZB2A 4CUCA 2G95A 3TTQA 3MQTA 4HU4A 2GDUA 5HULA 1UUQA 1SW7A 4GA8A 1F73A 5JCIA 1VENA 4HTBA 4A3QA 3VOGA 1IXQA 4EPDC 5I3HA 2WNNA 3VINA 1S2WA 5F1VA 5LNUA 2VCBA 2J8TA 3R13A 1I2NA 4UUIA 4ADTA 3NCOA 5DT5A 3CZLA 4HPNA 3OVQA 4QQUA 3W2JA 3P62A 4KFPA 5FJPA 4XVDA 1ZQ5A 4ZQNA 1T8XA 3RLUA 3ZXWA 1PDZA 4QITA 1H61A 3PZIA 2NQ9A 3CO8A 3EANA 1AH4A 4E8GA 5C55A 1MUCA 3BAWA 1UR2A 3VAVA 3N1AA 3NDZA 1KFEA 3VDHA 4OOZA 3THAA 3UNDA 5HANA 4GINA 1NARA 3DGHA 5F2GA 4B15A 4B4HA 1STZA 5HAOA 3LRMA 2OT1A 1VFMA 3TCEA 2WMHA 4BS0A 5I3IA 3U9IA 3GIYA 3CZEA 1VF8A 1QPKA 2IXVA 3WBEA 1HZYA 3MBDA 3Q94A 4Q6XA 4XZNX 4K7ZA 4LS1A 3AU6A 3G5EA 2QCCA 4POCA 3D6NA 5EFFA 3CHDA 4HHLA 4K8EA 1O12A 2GGEA 4C5YA 1TJ0A 3G3MA 4XB3A 2Y24A 1UH4A 2HSAA 2X0SA 4QJ1A 1FWTA 4H6EA 3HW2A 3URHA 1H2JA 1ZAHA 3NM1A 3W53A 4HA1A 3AMLA 3DHFA 4TTGA 1JEZA 3RILA 2NWSA 1IEXA 3KBMA 2CLLA 2PTZA 1AVAA 1TIWA 3GE7A 4XZ9A 1FFUC 5BW6A 4H4QA 1WNOA 1KFJA 4W85A 3N9SA 2WC4A 3MI6A 1QRQA 4QX4A 5DEZA 2X8CA 5XIMA 2QAFA 2PI6A 4K1WA 1GVYA 4GY7A 1VPQA 4G5DA 4NSBA 5T91A 1AW1A 4FAMA 3G1AA 3QOKA 4CD4A 3S2JA 1J9YA 5KZDA 4Y9NA 4ACYA 3AOFA 4QLJA 3MB9A 3DIPA 5LIWX 1DJGA 3WH9A 3SAZA 3HV9A 4HK6A 1SVDA 3HFYA 4GCAA 3GM8A 4ZTXA 4Z08A 2I7GA 3VUPA 3QHMA 1OFEA 4LAOA 2NPXA 3UG4A 5HINA 3KTXA 4HCDA 3V3WA 3QY6A 5J04A 5AB3A 5FS7A 5AZ1A 1SO6A 5U7SA 1SZEA 2FQIA 3NQDA 1BAGA 3CV6A 1DXLA 5CC7A 3IK4A 1TMHA 4JTTA 3EWZA 2PB1A 2BG5A 4DWSB 3THUA 1HKMA 2VRJA 2VOMA 1JPDX 4M29A 2F6KA 1PE1A 3DFPA 4DI9A 1S7MA 3WJWA 3PBUA 3P81A 3DK4A 4GBUA 4I9JA 1GT8A 4I7WA 2PDJA 3EB2A 3GDBA 5FJTA 1SR0A 3FY1A 3B3DA 2Z1XA 3RX2A 2GK1A 1U33A 3UQNA 3S8HA 4R88A 2R9ZA 4MLRA 3GNOA 1M5WA 2VVNA 4NX0A 3NQVA 2PSNA 1TVLA 3P67A 3WQCA 1R9XA 5M2FX 2QUVA 3RN6A 1JCNA 2PDWA 4MJZA 4MKVA 2WCGA 1R6WA 4EF9A 5K2ZA 1BYAA 3UWYA 5DLCA 4AD1A 1S5WA 2Y7GA 3IJ9A 2ZA2A 2GVYA 4H3DA 1D7FA 3B04A 2QHAA 2PA6A 3AYSA 5FA5A 4LB4A 4K8GA 4GYFA 1NTHA 1XYZA 3R79A 1R46A 4D6EA 3BUVA 1KBKA 4Q33A 4C65A 1JRPA 4UR8A 3LG3A 4NNAA 1HO1A 1Q2SA 4WIWA 3R6IA 1C9WA 4AD2A 4IFKA 1JDFA 2ZKMX 4BURA 2Z1BA 4CCDA 3CGBA 3NEHA 1VRDA 3EZ4A 1OIFA 4GIAA 2VC7A 2YL6A 4R3UA 4J28A 2CLEA 4C1NB 4DF1A 3L4WA 3REQB 1LBLA 4F40A 3H12A 4PR4A 1Q1RA 2TAAA 1OFPA 3S0CA 1WXZA 3CZGA 1UP3A 3WUEA 2HVOA 5JXQA 5JCMA 3GC2A 1OQFA 2W0HA 1H7NA 4C90A 3FG2P 4G1KA 2BY3A 1ITQA 5I3GA 1NQ6A 2CDUA 4CEXC 3LLFA 4ATDA 3IJ7A 1BWLA 1LLZA 2YCKX 4YIWA 1WDPA 3E0LA 4FMVA 1V0KA 5D2XA 4FXFA 4G8TA 3CT2A 1PZ0A 5A6MA 2QUUA 3F2BA 3TFCA 5BXSA 2XDFA 3EOEA 1B2YA 5F7UA 4JGDA 4A3YA 3AS0A 4DBSA 2OWWA 4MKSA 1DV7A 1QPNA 3LXAA 4AVOA 4WHBA 2TSYA 1YTDA 5CZTA 1S2AA 5AHIA 4YMZA 3NOEA 1QVBA 1NFGA 1W9PA 4P7NA 3O6YX 4ZENA 4DUWA 5CQ1A 1DJNA 1K7FA 3IUDA 1HKKA 3FVDA 3NVDA 1RLCL 3WUBA 1QI5A 1R5YA 3VNYA 3H4GA 4XAPA 3WF4A 2OG9A 4Q8WA 1X8CA 2QPSA 4QGCA 2X2YA 3DK9A 1V6VA 4YU1A 5CSYA 3LDVA 4A4AA 2L5HA 2CXGA 4I9AA 3HIJA 6TAAA 1X2HA 4F9DA 1V3JA 1H1YA 3B0XA 4O1FA 3EX2A 1XJBA 3VIKA 2VCAA 4AXKA 1MNZA 1Z69A 1C8QA 3DKJA 4NT0A 2VP8A 3G22A 5AKQA 3AICA 3KL5A 3QZ6A 5I23A 1R2SA 3BO9A 2JKAA 2QGYA 3WD2A 3IV8A 3NGFA 4ZOEA 4QDWA 4M52A 4A05A 1W9BM 2QVHA 4AW7A 1YE6A 3WDPP 3A21A 3BOXA 5D03A 3W7OA 2CLKA 3QMRA 1WUEA 1XRSA 2KX9A 3IUHA 4ZO6A 4NAEB 1TV5A 2W54A 2GJLA 5FEPA 1ZJBA 2JBMA 3FJNA 5H8UA 2X1UA 3EWYA 5HQMA 1OY0A 3TA9A 5LNSA 5AVHA 1GRFA 4ZFCA 2TODA 4R27A 1BF2A 2VDIA 4KRUA 1CB7B 1V77A 2NW0A 4D71A 3S5OA 2C14A 3BMVA 4LEQA 2ZVIA 3ABRA 3AMZA 1DIEA 2WYSA 4IPLA 4IJBA 5M17A 2J7FA 4DJDC 5F2IA 1EXBA 1F4AA 2Z24A 4AEEA 5CAHA 3F7JA 1KLZA 5A8NA 1C9DA 2CC0A 3GKAA 3GS6A 4IGHA 2X05A 2PUZA 3L4TA 1J4EA 3CPRA 4UMAA 3VK5A 5H6HA 2PDHA 4EPKA 2YCIX 3ITCA 4PBGA 1G4PA 1W3NA 2PDBA 2VHLA 2ZA1A 1VHNA 5HJXA 1NAL1 1CBGA 5CBIA 3B4YA 2F61A 5FF0A 3RM9A 3UXIA 4FF5A 2OLSA 4V1XA 4QSFA 1V08A 4LPCA 4X2RA 1N8FA 1D7YA 2BB0A 4MWAC 2QJNA 2OYLA 2GSJA 1EBGA 3GD4A 1ZZMA 1YDOA 2QULA 3CHEA 4XTIA 2AGKA 3HPSA 1MI3A 1VD6A 2ZZ3A 1JCXA 2Y5SA 5BMXA 1L0PA 3A3WA 2GJRA 4LV4A 3VI2A 4MMWA 2VJXA 3F5JA 2NV9A 4KKXA 3ZJ6A 1DBTA 2ACRA 3VIFA 4MZYA 4KRTA 2BX7A 4JX4A 4X61A 1H51A 2V2HA 2QDHA 2ZZ6A 5EKYA 3NZ1A 3OHMB 1EZWA 3VILA 1JI2A 3HGJA 3L0KA 4UOZA 3LUTA 5KTLA 4YYFA 3SURA 1QI0A 2DQXA 2A7RA 1Z9AA 3EEZA 3IGSA 5DRIA 3OIHA 3IRDA 3M0JA 3KWXA 3LNPA 4IL0A 3MCMA 4LU0A 4LBUA 2GQ3A 2J7GA 4PMVA 4AD5A 2PRLA 3ABQA 4Y8EA 3TWBA 1J5SA 3VDAA 2WMFA 4P7OA 3W1UA 4YWIA 1ZCOA 4U5IA 5A94A 2Z27A 4LC6A 1V3HA 5HMEA 3GQYA 2ZZ4A 5JVLA 4GBDA 2Y70A 3WLSA 4DX3A 1TWSA 1OYAA 4L6OA 3ZWTA 1GRGA 2EQ9A 2J9YA 3HQPA 3N12A 4S3EA 1VDVA 1FXPA 4JX6A 1S2CA 2Y61A 4E2VA 1QWKA 4ADSA 4W89A 5HNTA 1DHKA 1LWIA 2XGZA 5JIWA 3EMCA 2GSHA 4UTIA 3LHTA 5AHNA 3KTSA 1HJVA 3FXGA 5T8GA 3SUTA 3NQGA 3NR0A 2OOGA 1E9YB 1O4UA 2H90A 1P0EA 1FH7A 2D1ZA 4S2BA 3FLUA 3OIXA 1PKLA 1GVIA 3W7DA 4QISA 2X09A 3DJGX 1ZJIA 2EEXA 2P8BA 3WQEA 5DN1A 3W1LA 2PWVA 5DO8A 2QCEA 3QV6A 4GNVA 4YCOA 1QASA 1TWWA 9RUBA 3URBA 1E9LA 3TTOA 5B7YA 3PSWA 1RY8A 1JZ7A 5DCEA 3W9ZA 1ZXIC 4Z1BA 4DJDD 1A49A 3PNZA 5CSUA 1Y0EA 4CNPA 2GQAA 5E1QA 1EO5A 1E6XM 3VOFA 1ZDLA 1RBAA 2AL1A 3OZMA 5BMWA 4FNSA 4QAWA 2EPNA 1ISZA 1R47A 5KEZA 3V5OA 2OSYA 2ESCA 2ZUVA 1F7BA 1K7XA 2D2JA 1GORA 8XIAA 4U3AA 1ONRA 5D33A 4CU6A 2FJKA 4AZBA 1W91A 3FV9A 3R89A 2DU2A 3WF2A 2IQTA 1J11A 1Q65A 1EC9A 1TELA 3GTNA 2BMBA 5A6KA 1A0EA 1EFZA 4B9YA 2DW6A 4MWAD 3UGVA 1PZ1A 3TYUA 3T0CA 3WD3A 1VHCA 1RP9A 1K9FA 4E2BA 4D6DA 3PTQA 3H7UA 1VFLA 2D3LA 5A6JA 4CU7A 4W93A 3N6HA 4H4XA 1NQKA 1UP0A 4KGJA 5I5RA 3BDKA 3A3XA 1W5MA 5M3WA 2WHKA 4DNHA 2C0HA 4L6DA 2HK0A 3GSMA 3VCCA 4M5PA 4CD8A 3TN6A 3SCNA 4ZOHB 2OEMA 3P6LA 2Y8KA 3CB3A 2YCLA 1JUKA 3FIGA 1JPKA 3LPPA 4EXBA 3W01A 2BBFA 2FPVA 3FN9A 5IFPA 1LQAA 2J4GA 2WOIA 2YSWA 1N63C 3LBOA 5DCDA 1F6PA 4KESA 3WDRA 4MJMA 1YDNA 3M0XA 2OSWA 5JH2A 1FTXA 3PAOA 3R12A 4KCTA 4UBPC 3F4WA 2BTMA 4MKNA 4S39A 2WJEA 4S1FA 2PF8A 1PB0A 3GXNA 1KR0A 1W56A 3TTEA 4JFSA 3U48A 1UHVA 2AOSA 9XIAA 5DMLA 4H9YA 2YL8A 2CLFA 2PBOA 2VGIA 3BAXA 3VMOA 5CKSA 3NEVA 3B8IA 3WSUA 1B5TA 4MAVA 3MKCA 1KA9F 3Q4DA 3WK1A 3MHFA 4C6IA 4W9TA 4DB7A 5E70A 3M6YA 5EA9A 3ZFHA 1S5VA 3HPAA 1BVNP 1HKJA 2NVCA 4TTUA 1JIBA 2WCSA 6ENLA 1IR1A 1R3QA 1XLAA 3A9BA 3LHUA 2I17A 4IJCA 3DBPA 3PZOA 4HHPA 4INFA 1NELA 3VGBA 1MO9A 4XWUA 2I14A 5GNZA 4WOQA 1K70A 4GJ1A 1ZJAA 4GH1A 1Q85A 3PY2A 2P8CA 1EP3A 4JTJA 2ZE3A 4ICNA 1FKWA 2FPYA 4CNOA 4FLOA 3A7UA 1OK4A 4ENLA 1CXFA 2AL2A 3B8SA 4E8DA 3OODA 1Q4WA 4TR9A 1IEQA 3XIMA 3VIJA 2REQB 1FWCC 2PWEA 3K8LA 3L9CA 1C29A 2DT3A 4GZIA 5F4WA 4DM1A 4AHOA 4DJFA 1GRBA 3DFTA 3BCDA 4LF1A 4HZ7A 3B9EA 1BF6A 3CAKA 3S5NA 2RGLA 3HB9A 3PPHA 1UCWA 4RW3A 2EHHA 1M68A 4UNLA 1AK5A 5HMDA 1WYIA 1T96A 4JCLA 4O57A 4REQA 3APTA 1OADA 2NT0A 1V6TA 1GZJA 1WDDA 3ARTA 1X1NA 3SUSA 4K36A 1VYSX 1OGSA 3QQ0A 4ZOCA 2LLEA 3SY5A 4Z0SA 4QROA 4L7ZA 4MAZA 4URIA 2YA2A 3G1XA 3VZXA 4FX7A 3BLKA 3MHUA 1GEQA 3DBNA 3VE7A 3NYDA 2IUZA 2XIJA 1GG0A 3UESA 3KP0A 4JIIX 5D2VA 3I68A 2F2HA 4ZBCA 1RSCA 1GKRA 5FJOA 1E70M 2WLZA 3AN1A 3RPDA 1K77A 2NQJA 1ZNNA 3BV4A 5FEZA 4XZHA 1MEIA 2ZCGA 3AI0A 3IAPA 3AIEA 3I7QA 1F2JA 2PDLA 3CUGA 5EPDA 4XD5A 3E12A 4FIQA 3EX3A 1TRDA 3SY1A 1QI2A 1ICQA 2FFIA 5EBKA 3MT1A 1TWIA 3WH7A 3A7AA 4JKMA 4HOZA 1XBVA 3MUCA 4NU7A 5KMYA 1A47A 4IISA 1CZ1A 2ASHA 1KM0A 1UZDA 2J66A 4ATWA 1SGJA 4O0ZA 1HKWA 4O1EA 4ZOAA 2DSVA 2HE8A 3V4BA 1UPMB 2FMOA 5I78A 1DWJM 1UWQA 4NAFB 4A2SA 6PTDA 2AGTA 1F4HA 1W0MA 3NQ8A 4MY8A 4UQEA 4UQCA 1QW7A 3KZPA 3W7KA 3WK0A 1QNQA 3LRKA 2GR3A 3BG3A 5H2ZA 1PEZA 3H2AA 3RPTA 1U30A 4ADWA 1GKPA 1E4LA 5KSWA 1MYRA 3RLVA 1ZGDA 3PSVA 1FWHC 3W7HA 4TVYA 4RZ5A 1LWJA 4N9CA 1BXBA 2QR6A 2ZOXA 2DJLA 3PG8A 3G1VA 5HATA 2FZNA 2ZXBA 1R0MA 4H9XA 4WDUA 3R94A 3H24A 4DNAA 4BR1A 5TIMA 2EPLX 3T2QA 2PWGA 5HR6A 4G6CA 1UWSA 3E5PA 4ZSUA 2OX4A 3LI1A 3EMZA 1V59A 4MYAA 3SZ8A 1P4CA 1NHRA 2V9DA 4KW2A 4BI7A 1JF6A 1CI1A 2CZDA 3CUFA 1SW3A 2CETA 3KBNA 3GH4A 3GU9A 2BOGX 3WQFA 1JULA 1EPVA 3G8RA 4PMOA 3WENA 1OX4B 3E96A 3NUKA 1E4IA 4LUSB 5CJ5A 4ZODA 3HPXA 3M0ZA 1YPXA 2OCZA 2GDVA 3FEQA 3TQKA 1KRAC 4AIOA 1OBAA 7CGTA 1S38A 4WKAA 4A3RA 1B9ZA 1S2TA 2A7NA 1B31A 1VAHA 4X9YA 2NSOA 1BTMA 2BNJA 2GQWA 2V82A 3AM9A 3VIOA 2W3ZA 1A5LC 2GVLA 1MFUA 2I57A 2A3EA 1K1DA 4PZVA 4F48A 2J47A 1B3ZA 1W1PA 2F84A 4LQ1A 3N04A 1RJQA 1WKDA 2BP1A 3CHFA 5I02A 3DOPA 2G3IA 5JIPA 1M3UA 4YN5A 1I4NA 4J35A 1BSLA 2CBJA 1E6NA 4CU8A 3L67A 1MMFA 4CVUA 4MWAE 3JR2A 1VLWA 3OGSA 2V5JA 4IXXA 3TH6A 3AIWA 1I0DA 5CSSA 3TSBA 2X1TA 2VNCA 1KBBA 1DEDA 1R2RA 3WLJA 1MZHA 1VFUA 1CXIA 2P3ZA 2MANA 2OOFA 2WB5A 2QJJA 4HKPA 2YDSA 4AZCB 3B9OA 1LLWA 4GUIA 4XBJA 2CLPA 4NQ1A 3K30A 4HVXA 3N2BA 1WZLA 3GRSA 1V97A 3QV8A 1KRMA 3CWNA 2GJXB 4JS3A 1EJWC 2Y6ZA 3GRTA 1R30A 5IHSA 4IUGA 3SCWA 4EMJA 4IMDA 4TX6A 2Y4SA 4UR7A 2GOKA 2Y5EA 4WY0A 5D04C 2W92A 1L6YA 1WQ5A 1EJXC 4I8DA 4K37A 3F03K 2ZIDA 1KB3A 5BRPA 2RHGA 1K02A 2CWXA 2WZIA 1P6BA 4FIRA 2ZC8A 1RV8A 4G1NA 1ZJHA 3UXDA 1N8WA 2P5NA 3W38A 1G4SA 4DF0A 2BFGA 3MSGA 1RD6A 2WSRA 3KTCA 3KVMA 3ANUA 1KRCC 5KETA 1JRBA 1JZ6A 5CZSA 2PTXA 5HK4A 2GWNA 1VKFA 2X8GA 2DP3A 3MANA 2V3GA 4HN8A 1OB0A 4XKYB 5G2HA 3A23A 3PANA 4GY0A 2VDHA 4XUGA 3KAOA 4WKHA 4W87A 3QZEA 2QJIA 4BQ4A 1BZLA 4A8LA 4J3UA 4LCQA 3LLDA 3BG5A 3B05A 4DYEA 4UFMA 4Q6JA 3BQ5A 2VRQA 3T9PA 4A8IA 3GFXA 2Y7DA 5HJYA 1CXEA 2QPXA 4RV8A 2WVSA 2NV2A 1P6WA 1TPB1 1DJZA 3CAQA 2WMGA 4LSBA 1YEYA 1GZ1A 2Q8XA 3NQ2A 3PB2A 1LUCA 1EX1A 3C61A 2Q8LA 1CXLA 2R1LA 5J5RA 2CFYA 3LCWA 2X1SA 1VYRA 4QLKA 4BV6A 4YCPA 3IUIA 4Z2KA 2V5BA 3S1XA 4UQBA 1B57A 1XV8A 1XCFA 1GYLA 1CX9A 1B3OA 5EBUA 4HHHA 4FNTA 3HRDC 5FD0A 4Q8PA 5ABGA 2R9RA 1CGXA 2HBXA 3WLKX 3ZVHB 3W24A 2PURA 5DBUA 1WOAA 1FEAA 4Q4QA 4P2VA 5CBJA 2IPGA 2XH7A 3UWEA 1J01A 1EL3A 2OMAA 3TK7A 3HQNA 1YBQB 4K2SA 3PZQA 1UB3A 1XLMA 3CPGA 4DNMA 5FAGA 2VFIA 3MYOA 1XG3A 4MZ8A 3KDNA 3EF6A 1KFLA 2WZHA 4B91A 1H5YA 4KWWA 2G3NA 4H9TA 4AHQA 3UWZA 1PPIA 2RDUA 1IT7A 3QGAC 3P74A 3ZR5A 3NQ6A 5ABFA 2YLLA 5CLWA 1TR1A 1SSGA 3QPZA 4KBXA 5LNVA 2CZ5A 4XAYA 2E8ZA 4L4PA 4HMCA 3W2UA 5CPLA 5HWJA 3VIHA 1KKOA 4M3PA 4QXIA 3ZS4A 2PLKA 2TRSA 4AFYA 1H6VA 1GK8A 4GE8A 5C8BB 3SCOA 4RUBA 2UV8G 3E0WA 2WPFA 1NOWA 3SN1A 1EP1A 3DYPA 3WQOA 3KVJA 3TJIA 1QFEA 1M7XA 2OU4A 3GUGA 4E0CA 1U1UA 1XFCA 4NX5A 4NILA 1ECQA 2PGRA 3LTPA 3P14A 4PUDA 2XUCA 5A1AA 2ZZ7A 3AWNA 4ZQCA 3VGGA 1EIXA 1TTIA 3V1PA 5E9AA 2C1HA 4LCSA 4RDZA 1BD0A 1MRAA 1XW8A 2NUXA 1HKIA 1W17A 3JW7A 2XFFA 3B8VA 3DZ1A 3VOHA 3PZMA 4DRSA 4U28A 3L2IA 1EJ7L 1U1HA 1GRHA 3M0HA 2WQPA 3BAYA 4GMEA 3WMSA 4GKTA 4KF1A 3HTWA 1IR2A 2V30A 3VIMA 1XL9A 4X3ZA 4AWUA 3F5KA 1EF3A 2Q71A 1FP9A 4JTAA 5CC3A 1DJHA 2PDKA 3N73A 3TYDA 3B0PA 2MNRA 4X22A 3PUGA 1JNEA 1G0CA 1V3IA 3UWVA 4QDMA 1SFJA 2YFOA 1YTEA 1DIKA 1ZK7A 4MGGA 5F1UA 2RDTA 1QPOA 3PZTA 3ZM8A 5HNNA 3MJMA 3WQ5A 1W1ZA 1EKOA 2BC0A 5FJUA 3RXZA 1J79A 3MA8A 3VKCA 2PF0A 2NZLA 4CLMA 5A2CA 1JYXA 3ZLFA 3B0VC 3Q37A 1Q8JA 1DP0A 5LIXX 3CWHA 3OHIA 2I9EA 3GB6A 1V03A 1X97A 3FAWA 1ML1A 1WAUA 4H83A 3KUMA 2B31A 3P5ZA 2V67A 4ZOBA 4BWLA 3NA8A 3UT0A 1Y5WA 4NEWA 3MMUA 2Y0FA 3W1XA 4JEJA 5CPQA 3QSRA 3P5YA 1OFRA 4GYPC 4WDWA 1XIDA 1KC7A 4J7RA 4AVFA 1J10A 1KXHA 4LVFA 2IQ0A 2QF7A 1DJIA 3RRXA 1E1CB 2ZDSA 5I2UA 5ECVA 4MIMA 2XISA 1HP4A 3UJSA 1J18A 4W8AA 1HIZA 3BGGA 4RZ4A 2R94A 3AO0A 1S1RA 1HJUA 2O9PA 4J2PA 1ITUA 4PGLA