2RDXA

Crystal structure of mandelate racemase/muconate lactonizing enzyme from roseovarius nubinhibens ism
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
369
structure length
369
Chain Sequence
SLRITRIRLYKTDLPYVDGSYGWGAGNAITVARASVVVIDTDAGLQGCGEFTPCGENYMIAHSEGVDAFARLAAPQLLGQDPRQVARMERLMDHLVQGHGYAKAPFDAAFWDILGQATGQPVWMLLGGKLCDGAPMYRVAPQRSEAETRAELARHRAAGYRQFQIKVGADWQSDIDRIRACLPLLEPGEKAMADANQGWRVDNAIRLARATRDLDYILEQPCRSYEECQQVRRVADQPMKLDECVTGLHMAQRIVADRGAEICCLKISNLGGLSKARRTRDFLIDNRMPVVAEDSWGGEIASAAVAHFAASTPEEFLINSTDLMNYNTRSTGLGGPTVHQGRLYASDTPGLGVTPDFNSLGAPVADWAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Mandelate racemase/muconate lactonizing enzyme, putative
publication title Crystal structure of mandelate racemase/muconate lactonizing enzyme from Roseovarius nubinhibens ISM.
rcsb
source organism Roseovarius nubinhibens
total genus 124
structure length 369
sequence length 369
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2rdxA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2rdxA01
3IJLA 7ENLA 3V4BA 3N4FA 2P88A 1BKHA 4GIRA 3I4KA 3MSYA 1P48A 1JCTA 3TTEA 3SQSA 1WUFA 2P8BA 3DFYA 3FJ4A 3D46A 1MDLA 3MQTA 3GD6A 3CK5A 4Z1YA 1MNSA 1BQGA 2O56A 3ES7A 4KT2A 3SN1A 3MY9A 3DG3A 3B97A 3CT2A 3QKEA 4JN7A 2I5QA 3U9IA 5J04A 3H70A 1YEYA 4GMEA 4FP1A 1SJCA 3I6EA 2QJJA 3H7VA 3DESA 3JVAA 4HPNA 1R6WA 3QTPA 2GDQA 3PK7A 1EBGA 4DXKA 3FVDA 4IL0A 3H12A 2PMQA 2PCEA 3FCPA 5BOEA 4GYPA 1EC9A 4E5TA 1OEPA 3VDGA 1NU5A 2PP0A 2HNEA 4ZA0A 1EC7A 5FJTA 1MUCA 3ES8A 3UJFA 4E4UA 3RR1A 1ECQA 2ONEA 4DX3A 2CHRA 1EBHA 2PTZA 3UXKA 3H8AA 2OVLA 2P8CA 1TKKA 3V5CA 3Q4DA 3R1ZA 4GFIA 3IJIA 2MUCA 2XH4A 2OO6A 3N4EA 4MMWA 2PU1A 1MDRA 3R0UA 4IL2A 1KD0A 3NZGA 3QPEA 4M6UA 3S47A 2PS2A 3K1GA 3VCNA 3ZLGA 2AL1A 3ZLHA 1TZZA 2XGZA 1L8PA 3SN0A 3OZYA 2POZA 3THUA 2DW7A 2PSNA 3UXLA 4HNCA 3P93A 5FJPA 1EC8A 2QDEA 1FHVA 3EEZA 4ROPA 4J1OA 2ZC8A 1RVKA 4GYPC 2QVHA 4HNLA 3U4FA 4J3ZA 3MKCA 3BSMA 3OPSA 3TQPA 3VCCA 4DHGA 3MUCA 3ZVIA 1DTNA 1FHUA 2OZ3A 2QJNA 3QN3A 2OQYA 3OZMA 4GGHA 3P0WA 3T8QA 3TOYA 4IP5A 1SJBA 3UJEA 3T6CA 3CB3A 1IYXA 5EU9A 1PDYA 2PP3A 3TWBA 2PA6A 4FI4A 2OZTA 1ELSA 3OP2A 3NFUA 3RRAA 3R0KA 2AKMA 4G8TA 3HPFA 4K1WA 3R11A 4HCHA 3PWIA 4H19A 1W6TA 3DG7A 1E9IA 3FV9A 2QDDA 4H2HA 4A3RA 3UJSA 2HXTA 3SSZA 3GC2A 4KWSA 4A35A 1PDZA 2OZ8A 3RO6A 4MGGA 1P43A 5FJRA 4HYRA 5ENLA 2GGHA 2FYMA 4A6GA 1NELA 3ZLFA 4DYEA 3TWAA 2OG9A 2OQHA 6ENLA 4HCDA 2AKZA 3V5FA 2XH2A 2RDXA 1TE6A 2OPJA 3KUMA 4H83A 3ZVHB 3MWCA 3PWGA 4E6MA 3EKGA 3DDMA 2PTYA 3FYYA 1JDFA 3DEQA 4GISA 3SN4A 4X2PA 2XSXA 3ZVHA 2DW6A 2PGWA 4E8GA 4G7FA 4E4FA 4ZCWA 3TJIA 1F9CA 2P0IA 3DG6A 3SBFA 3VA8A 2PPGA 3TJ4A 3ENLA 4IP4A 4F4RA 3CAWA 3GY1A 4K8GA 3OW1A 3UJRA 3DFHA 2GGEA 2NQLA 3JW7A 4Z17A 3VFCA 2P3ZA 3UCCA 5IDZA 2GL5A 5FJUA 4JN8A 2PODA 4M0XA 4H1ZA 3IK4A 3UGVA 3R25A 4HCLA 3FXGA 1MRAA 4ENLA 4GGBA 1ONEA 3T4WA 1SJDA 4DWDA 2MNRA 3V3WA 3RCYA 3STPA 2PGEA 1KKRA 3IJQA 4KPLA 4IT1A 4JHMA 3CXOA 2PP1A 3N6HA 4IZGA 4IHCA 3BOXA 1XS2A 3D47A 2XH0A 2OLAA 4DN1A 4KEMA 1JPDX 3MZNA 2QQ6A 3N6JA 3VC5A 3RITA 1KCZA 3QLDA 1R0MA 4HN8A 3NXLA 3CYJA 1SJAA 3PFRA 2OFJA 4EWJA 2QGYA 2GGIA 2PU0A 3T9PA 2XH7A 5FJOA 3P3BA 3VC6A 2PTWA 2OX4A 3Q45A 1WUEA 4K2SA 2HXUA 2AL2B 2FKPA 2ZADA 1JPMA 5BOFA 2PTXA 2GSHA 2QJMA 3S5SA 2AL2A 3TW9A 3UJ2A 3NO1A 2OKTA 4YWSA 3OTRA 3RGTA 3DGBA 3I6TA 3GO2A 3R10A 3UCDA 3SJNA 1KKOA 2GGJA 3DERA 4MKSA 2HZGA 3TCSA 3JZUA 1XPYA 3BJSA 3DIPA 2GGGA
chains in the Genus database with same CATH superfamily
5TNVA 3H24A 1OZMA 4JPGA 3WD2A 4DEFA 5I78A 3WJZA 3NNTA 3E0IA 3L4TA 2A21A 4MDPA 1XCXA 1DNCA 3VOHA 4GIAA 2Q8LA 1W3TA 2AQWA 1TMHA 1KGUA 2QUNA 1DOSA 2VURA 2VWSA 3SECA 1UZ1A 3WEOA 2QAPA 3RJXA 3N29A 3FNDA 3ISIX 3AHYA 2I57A 2V5KA 3KVJA 2WOQA 3NA8A 4BQ2A 1DQUA 2D23A 5DY3A 3TC6A 3THDA 3LM3A 1TJPA 4US6A 3OBAA 1Z6KA 2ZE0A 1GYMA 3TMQA 3EWWA 5JH2A 1HKMA 2HSAA 1YEYA 2Q01A 4GR1A 4HSOA 3M47A 3CUFA 7ODCA 3I7QA 3H2FA 1EJWC 3DESA 4RKAA 1QU4A 3SY8A 1O60A 4PBGA 3OEXA 1U1JA 3GIPA 2PMQA 4A8RA 4S3JA 3BQ6A 3W24A 3STFA 2PF0A 3WO8A 4GKLA 2WCAA 1MXSA 5D2VA 5A8NA 1SMDA 3S1VA 1M53A 2OELA 2WBAA 5F4SA 2XWEA 5T91A 3PJTA 1SZFA 3C8FA 1ECQA 4O0KA 3URAA 3U5UA 1G4SA 1E0XA 3B03A 2RABA 2VFGA 3HGJA 2PTZA 4YHEA 3EOUA 1PEZA 5C9WA 1VBUA 2ZZ2A 2BHUA 3QHOA 1DHKA 3HG3A 2OYKA 4EMJA 3UT0A 3DC8A 1B0IA 2DH3A 2ZXBA 4KEZA 1I75A 2O9OA 2JE8A 2W66A 1V02A 2XHYA 3G0XA 4K3ZA 4LVGA 3MDWA 5I02A 1SW7A 1PCWA 1ZBKA 2C16A 5LIWX 1QNSA 3WK0A 3C86A 4C6FA 3UXLA 2CPUA 3EX1A 3VMNA 4RPPA 2EHHA 2DGAA 4GHRA 3EEZA 4AD4A 4CNTA 3KFTA 4FLOA 2V38A 3LBOA 3IACA 1QK2A 1BWLA 1F6YA 3RM8A 3HG4A 4BA0A 4JX6A 1NFGA 3EPMA 4IPNB 4UQDA 2BVYA 3MHFA 4GE8A 2PBGA 4TVWA 3QJAA 3HG2A 4DHGA 4HHPA 1V0KA 2P0OA 1UR3M 1DTNA 1DPMA 1KXVA 3W7MA 1DJZA 1XHGA 3HGOA 1ITUA 1M6JA 4QGCA 4YYCA 1XBVA 1PZ1A 2NVCA 3S2LA 1WO2A 4DPPA 4G7EA 4EQSA 2L5HA 8RUCA 3GHRA 3LPOA 3HM7A 4JKLA 4DUVA 3WG6A 3KTSA 3A9BA 2ACRA 4J40A 1OZQA 2W63A 1EFZA 3QYQA 2Z25A 4NXSA 3NQBA 1OIFA 1RHCA 2FHFA 4JNYA 1MXGA 1ISVA 2AAAA 3H54A 2H8XA 4K1WA 1VEOA 1MEWA 1OABA 3QV7A 5BXPA 1V8EA 4C1KA 5KEZA 2A7NA 3CPRA 4IX0A 2GR3A 3R4IA 4X9SA 4PYSA 3BANA 4RUBA 3RFAA 2BVDA 3G8EA 3UJSA 1GYLA 2DZUA 4REQB 2DU2A 1P43A 3N14A 1H1ZA 5L9FA 3L5MA 1X96A 2XINA 3OLIA 4OV9A 3CHVA 1UIOA 2EKCA 5LYRA 1U33A 1V0NA 4HCDA 4H4VA 1F3PA 1GVIA 3LI1A 1P0KA 3U2ZA 4NI3A 4Z0SA 2D0HA 3PWGA 4LUSA 3TAOA 4WDUA 4D1JA 3BG5A 3G6LA 3QR0A 2J24A 2VYOA 4LEFA 2XSXA 2HEJA 4E8GA 3WLOA 1CGWA 1E72M 2DH2A 5CSUA 2C7FA 3LBCA 2V0TA 3M5YA 1D8WA 3G1RA 4UR7A 4RZ6A 2AQVA 3CAWA 3IPWA 3KRSA 3GDTA 3MMUA 2ZXQA 4D2JA 2XVNA 2RHGA 3DFHA 1LM1A 3EKZA 2NW0A 5U1OA 4YWIA 1GRTA 5I3JA 3QMSA 3Q37A 2PODA 2J8FA 1M03A 3I3EA 1O94A 2E1DA 4AX7A 4KH2A 4V27A 2BLEA 2DUZA 4BR1A 4RNIA 3WUGA 2ZCGA 3V1HA 4TVYA 1XLDA 3MO7A 4QRNA 4GBUA 3PBUA 2EG6A 2ISFA 4JCLA 2MNRA 1B2YA 3BARA 5CBBA 1S5TA 4ZO7A 3TTYA 1TA3A 5K9CA 3A9IA 1B9ZA 2HBXA 4LJ3A 3W53A 4EXBA 3NPXA 4DAFA 2IPJA 4IT1A 3MBDA 4QXIA 3KLKA 3M4HA 4KW2A 1HVQA 4G5DA 1KQYA 1E1CA 1MEHA 5GNYA 2OLAA 1KGWA 3A3WA 4IGSA 4LYRA 3ANVA 3CV6A 2QCEA 3QLDA 2WBKA 2CFFA 1C8QA 4NX0A 4O0ZA 5FF2A 2ZZ6A 4JTKA 3GU9A 1SJAA 3UNDA 3FG2P 3W0KA 2WM0A 2YCKX 4IFKB 2A85A 4CU6A 1CNVA 1J2WA 2G4JA 4K2SA 3FN9A 4H50A 2FKPA 2WKGA 3LHVA 3WEMA 5BOFA 3NQAA 3DFPA 5D2WA 2JKEA 2DEPA 4H7VA 1HJXA 3L23A 3BAKA 1FFUC 3RGTA 3WQVA 2X0HA 3D0CA 4UTHA 3TCSA 4DYKA 5C70A 3ABRA 3BJSA 3LQLA 1CGYA 3C0LA 2FFCA 2ZZ4A 3ORWA 5LA0A 1TRIA 2P88A 2QIWA 4GIRA 2ASHA 1H11A 1C90A 2DV0A 3P82A 3GTFA 1EJRC 1FXPA 1UWAA 1TPB1 5F2LA 4K8DA 3GYEA 5D2XA 4O8AA 4DB7A 4NAEA 1JCTA 1ZBWA 1TYTA 4RK8A 5TAOA 7TIMA 3S5NA 3HG5A 1WCGA 3B3DA 3W73A 3NVWB 1NEYA 4YTUA 4ZR8A 3T55A 5CC3A 4TXEA 3GFXA 4KCVA 3VDCA 4NU7A 2J9XA 1YIXA 3RIKA 3S2MA 4IX2A 3AS1A 4MPKA 2VZSA 3O0FA 3T0BA 2YA2A 1J9YA 1UKPA 3AMGA 5HNTA 1S2UA 3CL6A 1W37A 2CLPA 3ZXWA 3GR4A 3K30A 4O1DA 1XBXA 1XRTA 1EBGA 4GNVA 4XISA 1XDLA 3LPFA 1K4QA 1GG1A 4FHAA 3UA4A 1W54A 2PP0A 1TPUA 4O11A 1R30A 3SURA 2GRTA 5M03A 3TXZA 5GNXA 4GI6A 1E4NA 4WD0A 5CQ1A 3CBWA 2WNWA 3CHCA 2ZZ3A 1RP8A 4ORMA 1J18A 1T40A 1JCNA 3UD6A 3WD0A 1NFPA 2FPTA 1H7OA 3V5CA 2EQDA 3T08A 1GRFA 2VEGA 3R89A 4GBDA 7TAAA 2PB1A 4O8RA 5T8GA 4MMWA 7XIMA 3ZSSA 5J8LA 2CZEA 3ANYA 2HE5A 4J3XA 2A4AA 4PTXA 3G1AA 4UWMA 4W93A 3AZTA 2XGZA 3VDAA 3TEVA 3DJJA 3WJXA 2DY3A 2JGQA 5HMEA 3SW6A 1HP5A 3AOFA 1T96A 1HZYA 1P1XA 2F8QA 3BCFA 5D04C 4JIEA 2DZXA 1GEUA 1YADA 4GYPC 1XD0A 1MEIA 4PUNA 1GT8A 2DQXA 1V5XA 3O7UA 3UZZA 1FIQB 2UV8G 5A8GA 3T40A 4AXKA 2B81A 3FIGA 2JK2A 4Q22A 3WDPP 2VD9A 3MTWA 3MUIA 4EPBC 4GC3A 2OMAA 1KM2A 5DCDA 1KM1A 5DX7A 1ISZA 7REQB 2NWSA 4IF2A 4LUIA 2XSBA 1FRBA 1ZLPA 3NUKA 1HG3A 3IIPA 1JVNA 3T8QA 2D1ZA 3WF1A 2C3ZA 1Q85A 2ZA2A 4ZB2A 1FFQA 3DXIA 4UTTC 4PCNA 1OB0A 4FALA 1YPXA 2BWGA 3UZJA 2ZC1A 9RUBA 3LXAA 4GABA 2DT1A 1ELSA 4NZ3A 3ARWA 1UD4A 3FS2A 4JQ3A 4EQWA 2BOGX 2OCZA 3APYA 1W1PA 5H8PA 4AG0A 2INEA 1KWKA 2YFNA 4I6VA 1BVNP 2WWCA 2YVGA 5BXRA 4JDBA 4YMZA 3U57A 3GSMA 3W2LA 2QCCA 2A3LA 4EAYA 3E0FA 1XLBA 1W1YA 4NYYA 4PBFA 1YNQA 5FS8A 1WE5A 2AGTA 3H2OA 4W8BA 3NM1A 4A3QA 5GRTA 4YCPA 1L6GA 4IWWA 1FFVC 1TG7A 4V28A 3S1WA 2QEZA 3VOIA 3ZVHB 3VKBA 4DBWA 4CQDA 3B0YA 4YS1A 2D2JA 2HRWA 1QHZA 3H6OA 3WBXA 1CIUA 3TX9A 3VA8A 2Y70A 4IGHA 4QSFA 1V6UA 1TSIA 2V2HA 2XWDA 1FDJA 1REQA 1SPQA 3ABOA 3B0UX 4MY8A 4C6MA 1N8WA 3PPGA 1GW1A 2CESA 3RPDA 3CQJA 1GOWA 4HPGA 1Y65A 3LPPA 3QBUA 3EOEA 1TTJA 1CDGA 3U7VA 5HMDA 2DUAA 4M0XA 4BF5A 4E3VA 1JD9A 1W8SA 3FXYA 3IK4A 2B7OA 3BAXA 4WKHA 1Z7AA 5H2ZA 1LL4A 3QMRA 4UMCA 2QMKA 4FO4A 3AC0A 2SFPA 2RDUA 3GAYA 4AEFA 2EEXA 4BEQA 6REQA 3PFMA 2JK6A 2NQ5A 3WNKA 1LWHA 5G5IA 2WQPA 3WLKX 1CTNA 4DI8A 5A6AA 8CGTA 1EL3A 3KWSA 4ZSTA 4P8WA 1W3KA 2F84A 2VX4A 3A5VA 4P5UA 1D8CA 2OWCA 5CSYA 4PMNA 5TF0A 5CGMA 1O12A 2VHLA 3GVRA 3MZNA 2QQ6A 1ONFA 3VC5A 1UR1A 1WDPA 3GDBA 2Q02A 4TX6A 3QKZA 2G3IA 1XQKA 1IZCA 4AZ5A 1ADSA 3M0XA 5EFFA 5GQBA 4ZGYA 1GQKA 4AUBA 1M65A 4CLMA 3T9PA 1OFOA 5HXMA 1E4IA 5C7HA 1UKSA 1VCGA 3Q45A 1ZBVA 3HV9A 3G77A 1K4HA 5EYWA 4B15A 5CG7A 4UFJA 3T78A 6XIMA 3BCDA 3G0SA 3W1PA 4ZXLA 3V18A 2GSHA 1UQYA 1GKPA 4I5XA 2TRSA 1CZ1A 4J3UA 2IS7A 3R10A 3UCDA 3V0SA 3INPA 5DT7A 3NQEA 2TPRA 3E49A 3OYXA 4D6EA 2CERA 1AJ2A 4NSBA 1A4MA 3HPZA 4EE9A 3IJLA 2YJQA 1ZJAA 3M5VA 3EWCA 2IMRA 1MW2A 4R53A 3B8VA 1Q6EA 4XKYB 1TVPA 4QE4A 5I03A 1V3KA 2C1GA 5MF5A 1A5NC 4AMCA 1RPKA 4CNNA 1K9DA 1KXTA 3WQFA 2ZRVA 2Z28A 3W2KA 1KM5A 3XINA 2H3DA 4XAFA 3G22A 4ZZ9A 3HB9A 1ICPA 2YL6A 2Z1BA 1XPGA 5D2TA 3FAXA 1CB2A 3A7RA 2QJHA 3QZAA 5LIUX 4PA8A 2P10A 3IJ8A 3N04A 1BYBA 4DBUA 4JTQA 3W1XA 1ESWA 2Y7DA 3AO0A 1U5HA 4GMEA 2BHYA 3I6EA 3H7VA 3UCQA 2V2DA 1DL3A 1BGGA 2GDVA 1VFTA 3NDZA 1B3YA 1AW2A 3S2CA 1EC9A 3IVUA 3WQOA 3DK8A 4MJZA 2V81A 1OEPA 1V59A 2QCMA 2RGLA 5XIMA 5CAHA 4PEEA 1AQHA 4ZA0A 3CPGA 1VFSA 5KMYA 5BZAA 4QFUA 2VX7A 3BW3A 2NQHA 3USBA 2I16A 2QCDA 5F2MA 2J4GA 1ME9A 3B8DA 3BZGA 1TELA 3NQ8A 2V6OA 2ZICA 4S3CA 2BY1A 3IJIA 3BSGA 4HYWA 1JAKA 4AWSA 1R86A 3VIPA 2OO6A 3W3OA 4GVHA 3WMCA 1S7MA 4Q8PA 1JUEA 4EXAA 3TVAA 3QGVA 4FNQA 3TSDA 3DH9A 3CGEA 4JQ1A 2VOTA 3HGSA 1US2A 2DSUA 1PX8A 3E2RA 3G6MA 5U7SA 6A3HA 3FEMA 1TPFA 3ARXA 4ZO9A 2QDEA 4AZGA 3CNYA 2J79A 3BW2A 3T8LA 3M6YA 4KMQA 1UH2A 2WOWA 1L0PA 2OXNA 1AZ1A 4O1AA 4FK9A 4KESA 4YU1A 4HMCA 4X60A 1W5OA 2VFHA 3WNOA 3GUGA 4D1IA 4UOZA 4LGXA 3WH8A 3WF2A 4M80A 1FHLA 3DHPA 5CPQA 3KVKA 4C7DA 1BEUA 4PB5A 3B4YA 4GQQA 4W4QA 1FHUA 2E1WA 3H55A 2ISDA 3E38A 1VENA 1RBLA 2VR2A 4GGHA 4LAKA 2C6QA 4EANA 2CBVA 1GVQA 3RHGA 3MANA 1IEVA 1VF8A 2DT2A 3E0VA 2W79A 3CPUA 1PKNA 4RW5A 5EKYA 1MO9A 5F2GA 3CZGA 1D9EA 2Y2WA 2X8GA 3A21A 1WP6A 1EWEA 4D6FA 2OZTA 4S1FA 3L4YA 4H6QA 1V79A 3C4UA 3B8SA 2OLSA 2PLKA 3LLDA 1VEPA 2WZHA 4HNNA 1OT2A 1K02A 8A3HA 2Z4GA 1PSCA 1OM0A 3AS0A 1KNWA 4MLJA 2ZX9A 2PLJA 2INFA 4AD2A 4DY1A 3ZMRA 3GC4A 2GFTA 3NQMA 1YTDA 1XW8A 4BWLA 3EWYA 1HFBA 1I2RA 1C92A 4Z2HA 1XINA 3BLIA 1L6YA 1HN1A 2W27A 2AKZA 2QNEA 4ZTXA 4YPJA 4PUJA 1HJQA 1J0IA 2B4GA 1XIBA 4C6LA 1MYRA 2XSAA 1PTGA 4LBSA 1KGXA 2V82A 4OWGA 4AZIA 4BURA 3TJIA 1TJ0A 3LCXA 1DXLA 4I5RA 4DO4A 5LSMA 3BSHA 6TAAA 3TZNA 3F4CA 2ABBA 3QY8A 5HDRA 3REQA 3PG6A 1F07A 2E3ZA 3WFLA 3W71A 2Z1KA 3AN1A 5A6JA 4LVBA 2Y4SA 1W56A 1AJ0A 4E38A 4XWUA 3PTQA 2FPYA 2V2CA 1U2YA 1ADDA 5C6MA 4LU0A 3B8IA 2WAGA 3P8IA 1H1NA 2H9AB 2F5ZA 3N9RA 4C5YA 3NOYA 3WQWA 2ZVIA 3CQHA 4ZXOA 4DNHA 3RCYA 1S1RA 1DJGA 4QG6A 1G0CA 3MUXA 4JD4A 4YTQA 1PE1A 1QOXA 3W7OA 1G94A 4K39A 2VRQA 1JAEA 1GCYA 4D6JA 3UG5A 3RM4A 4U5IA 3I7RA 4L7ZA 4CQAA 3TW6A 1XLAA 4HP5A 1QPOA 1B3OA 3GK0A 4N02A 1K9FA 3VGFA 4FDCB 3R0DA 3WIJA 3OBEA 4GUFA 1Q7QA 2QGYA 2GGIA 3AYSA 2NV1A 2E6AA 2CIPA 2VJXA 2XFRA 5BMWA 4B90A 1L6SA 4ATLA 4XK2A 4XV0A 2AL2B 2IW0A 1LT8A 3PBVA 4WUIA 2V68A 4FNUA 4NJKA 3KAOA 3ARRA 1V6VA 1W9VA 2EJAA 1TCMA 1FCVA 5BYWA 1EOKA 3SJNA 4CEXC 1Q6FA 2HZGA 4MKSA 1VFLA 3FHQA 5IHSA 4NJJA 3HJEA 3WX7A 1V6YA 4I8DA 5CH9A 3P60A 4YXGA 3O6AA 1F05A 4RNFA 5FEXA 3GXPA 3UPWA 1J0HA 1NQKA 1UJPA 1NY1A 4M1RA 2YPIA 2XZ7A 2QMJA 1V3JA 4JTHA 4B5VA 1YHTA 3CM4A 2V3FA 3BG9A 2POTA 4S3EA 4NY2A 5HOSA 2BSLA 1FEBA 4WDWA 1S1PA 4ERAA 4TV5A 1FX6A 3SN1A 1HXJA 3GR7A 3PPCA 4OU1A 3IUHA 3L4ZA 4ZEPA 3WDJA 1OBAA 1KV5A 2YB1A 4H8NA 2BVWA 4UBPC 4BY3A 2NLIA 3AQUA 3QTPA 4WK9A 2X99A 1J6OA 4M56A 3FCPA 5BOEA 5FL1A 1BHGA 2YFOA 4UNIA 2V5CA 1XANA 5AHNA 3W86A 3I3BA 3GH4A 4KWWA 4O57A 4ZMGA 3VKAA 2TSYA 2YZRA 3SCTA 1AOGA 1WKFA 4NIRA 1TWSA 2C18A 2ONEA 4RDZA 2WMKA 3CL8A 1Z89A 3OZOA 4MJ2A 3W7GA 3EAOA 3UYIA 3UXKA 1STZA 1Z9AA 4LUJA 1AA1B 3CJPA 4GCAA 2CDUA 1P7TB 2HDJA 3ONCA 3AWOA 1QNRA 4GI8A 5D30A 1TVLA 2VCAA 1YDNA 3IRSA 5C9UA 4J2MA 2PE4A 3B0XA 2F38A 1GJWA 3EANA 3WJYA 1MDRA 3PZQA 1VRDA 3TE9A 4P8XA 4LPCA 1SFJA 1JRCA 3E5PA 4IIDA 3TN4A 4BV6A 1GGOA 1RV8A 3EA3A 1QNPA 3G1SA 3M0HA 3OZYA 4RE3A 4AISA 1OYBA 1EA9C 3R13A 4EIVA 1MOKA 3P93A 1GHRA 1EHAA 1LWJA 3W7HA 3K46A 1EC8A 4GQBA 2X2YA 1TRDA 4DJDC 3NEHA 4FLQA 4Z1AA 3M5XA 4M6QA 5DBTA 1VPQA 4A21A 3UQNA 3CQIA 3EX2A 4PUDA 1LUCB 4A22A 4OZOA 5G4EA 1M7OA 1RD5A 4Q8MA 4RV3A 1O5RA 1XIEA 1Y8BA 3IUIA 4BI6A 1KFBA 2GQ9A 2J6VA 3WBYA 4N4PA 4O28A 4WR3A 1F7BA 1H7XA 4ZTYA 2OOGA 1RD6A 1T8QA 2VC7A 3T2PA 4GYJA 1XDMA 1MW1A 2JF6A 1LQ0A 1GERA 2OJPA 4QDWA 2E25A 4UTJA 2YCLB 3R6IA 3W7QA 5EU9A 4ZQOA 4AD0A 4AY7A 2ZRYA 4JIRA 8XIMA 4LXFA 3G0UA 2Y1HA 4UOJA 2J78A 4XIAA 1E40A 3DK9A 1XIIA 3I68A 3M64A 3ZJ8A 1ODZA 3VNZA 4DJFD 4IIEA 4PGLA 2D3NA 3GNXA 3MKVA 5A6SA 2Y5SA 2I7GA 1OY0A 2QCLA 1FECA 3PANA 1M1BA 4AVNA 3BICA 4EQRA 4AHPA 2QDDA 3R12A 5LGZA 5K2ZA 3EWBX 2HXTA 3KM8A 3L2LA 4EQXA 1I6NA 1B4EA 4LOCA 3FY1A 2J9YA 3IJ6A 3UXAA 1CPUA 5EPDA 4F0RA 1GZGA 4N9CA 5CLWA 3PVFA 3TWAA 3PC0A 3A4JA 3GS6A 2WPBA 4NASA 4D6DA 2OPJA 1UR0A 1NQ6A 3EKGA 1JYXA 4AWTA 1TWZA 1D2KA 4GKTA 4U5KA 2NXHA 1B4KA 2C1IA 2PGWA 1XDIA 3N34A 3UWEA 4Q8VA 2GK1B 3PBMA 3L7RA 4IISA 1QHOA 1OSEA 3VX1A 1F76A 2PPGA 3OZPA 5G2HA 1YNYA 2WW5A 3M6DA 2G37A 2J74A 3DCPA 4ZQCA 3VPLA 4YYFA 2G3NA 4H4YA 1XH1A 2UY3A 3AMDA 1GG0A 4QIUA 4B5NA 3IGHX 1BG9A 2A3EA 4H1ZA 2VO5A 2R1LA 3M44A 4TR9A 1XSJA 3UGVA 4LB4A 3GXTA 4J57A 3WFAA 1U83A 1ONEA 1XC4A 3D3AA 1R5YA 2D22A 1XFCA 3NVDA 1JD7A 4HKPA 4Z42C 3K1DA 3F5LA 4F0MA 1DIDA 5A1AA 2ZWYA 2PGEA 4JTAA 1TIWA 2BFGA 1I8JA 3TAKA 3O2LA 3NTYA 4DELA 2VCBA 4EF8A 1DEDA 1S5VA 1H2IA 3RNDA 4QROA 1DWHM 4RZ4A 2XGBA 5IM51 1JZ6A 1UUMA 2VNCA 3SY5A 3DC0A 2J9ZA 4GH1A 2OFJA 2BMBA 3H2CA 3W7EA 1BWVA 5CSRA 1ZZMA 3VNYA 4D8LA 4FF5A 1V77A 5EB8A 4WY0B 3TC3A 4GXPA 3QEZA 5AYZA 2YIHA 2YXOA 2TPSA 1WQ5A 4LAMA 3PTKA 1C29A 2OKTA 2WKJA 4XZIA 2E5DA 3I6TA 2ZXAA 3TMLA 1WAWA 3OVPA 3KBVA 1KBLA 1OGSA 3AWNA 3CUIA 1M3UA 5KZDA 1RLCL 2DT3A 2GPTA 1GKRA 2PDHA 1K8XA 3IIVA 3SCQA 3OQ8A 3AMLA 5D38A 3U48A 1G4TA 1UKQA 5A8MA 3OO2A 4CQCA 5HNUA 4GQ0A 3W29A 2PFHA 2Y8KA 5CC7A 3NVZB 3B8WA 5JBFA 1S3HA 3FJ4A 1OF6A 4JN6A 4W89A 2WVSA 2DVUA 3PJXA 3SFKA 4PRRA 1ZP3A 1FWWA 3ZZ1A 4KRUA 1F8IA 4KT2A 2Z0IA 1Y5WA 1GOXA 1EZWA 4AY1A 1YRRA 2J7EA 3L0NA 5F7UA 2HQMA 1CXLA 3BE7A 2J75A 3UESA 3SM0A 2NWRA 2PDUA 2OGYA 2J7CA 3HBLA 1P5BA 4HPHA 4QJ5B 4YNGA 3L5LA 3M9YA 1OINA 4PTMA 5CXPA 1F3EA 2GDQA 3PK7A 3JR2A 1ZALA 2YB4A 1JF6A 2WCSA 5EBUA 1OX5A 1W5NA 4JNMA 2REQB 1FH7A 4R7JA 3K4DA 2BP1A 1WZMA 2BS9A 4MNMA 4IQJA 4O4VA 3M0IA 4W88A 4LA1A 5LIKX 2NQZA 1ZY9A 3ARPA 4GO9A 2WB5A 5DO8A 2XGIA 3WUEA 2NUWA 2X41A 4XQ6A 3ITVA 3L67A 1UKTA 3RLGA 1FO4A 3OG2A 4UMAA 3VIHA 4CCDA 3AIUA 3U2OA 1KW1A 4IQEA 3AJXA 2EPOA 1CGUA 3N4EA 2PU1A 1D7KA 3R0UA 5EGRA 4W7UA 3K1GA 3KDOA 1OD0A 5FAJA 3MMTA 4AIBA 2BODX 4PE8A 1XYLA 2DW7A 4ACYA 3CIXA 1LPFA 5K7JA 4MZ1A 1KBBA 4MB5A 4DVOA 3M0VA 4JNZA 1QXLA 1DJWA 4H4WA 1AMYA 3NCOA 1SMAA 3C56A 4ROPA 2VUYA 4J1OA 2VL4A 1NOUA 2EQ7A 5JBEA 2D69A 4ICCX 4TVDA 2AMXA 3IJDA 3LN3A 3O1NA 2V3BA 3GDRA 3COTA 2QAEA 2WMHA 2FH8A 1TE1A 3NDOA 4PCTA 3GKFA 3SQLA 3HW2A 1JDEA 3UR8A 5HR6A 5FS6A 3W1UA 1KM4A 3DOPA 4G2DA 4IMFA 3EPOA 3E2VA 4GZ7A 3OOQA 1U1HA 5BCAA 5IHRA 4NRRA 3TYCA 3M16A 3KWXA 3TOYA 2X40A 3V5OA 4JKKA 1AMKA 2YBUA 5BXSA 3F2BA 4KIRA 2BASA 2IPWA 5D03A 3PJUA 4IQLA 3LM7A 5FF3A 3WBEA 1EUAA 4H9TA 4X9YA 3SI9A 1HKIA 5AC7A 2OWWA 1UQZA 1UYQA 1JDCA 4QBXA 3W25A 4AEEA 4ZOCA 1Q7ZA 1ZQ5A 2PC4A 5DQPA 3UR7A 1JULA 3WCZA 3W76A 5CC5A 1E0WA 3ATYA 5G1MA 1PXGA 3BVJA 4H4SA 4X61A 3NURA 4Y9AA 5F1UA 3T0DA 1N61C 4EK7A 4XKMA 1E6QM 3W27A 2ZDSA 4RDVA 5E5CA 4J4KA 3FLUA 4XAZA 2PRMA 4U3CA 5HMSA 4Q4MA 3W1MA 3GNRA 4TMBA 4FLRA 4ML4A 3PULA 1V3HA 1RQBA 3MJYA 1QJWA 1RA5A 4REQA 1THFD 4PMOA 1PZ3A 3ECQA 2XIBA 3V5FA 3DGZA 4FOJA 1NDYA 1JG9A 3T0AA 3U7BA 4QCFA 1N5WC 3MWCA 2HISA 2X42A 3QPZA 1FWTA 2RDWA 4ZCWA 1GORA 2HBVA 1TJRA 2QPSA 2V67A 3RMJA 4N9EA 3TJ4A 3E02A 3KBNA 2DP3A 4DUOA 4NI8A 1I2OA 2HNHA 3RDKA 3ZQ9A 3NL6A 3VINA 1KC7A 3ICJA 3CAVA 3JS3A 3VFCA 2P3ZA 2WZIA 2G5WA 3QMTA 4QLKA 4PH6A 3OYZA 3GD3A 3KP0A 3VILA 3KHDA 3TK7A 1TJ2A 1QO2A 2OODA 3VMPA 1O4UA 3TROA 2BY2A 1XRFA 3KCJA 1ZHAA 5FSDC 3S1XA 2YL9A 3F03K 4TIMA 3CLWA 1E5NA 1EEXA 3DH7A 3ARZA 3MI3A 1DORA 1W5QA 4QCEA 5LNUA 5EMJA 4H9XA 5H8UA 1UWRA 1AH3A 3NO3A 1P6WA 2GJXB 4GXMA 1C8XA 4WOZA 2CLHA 1PYFA 3CXOA 5HWNA 3UVIA 3OIXA 1TTPA 4KWUA 3SEPA 4JFSA 3RU6A 1OX4B 5DFAA 3SZ8A 1G01A 3AXMA 3S5OA 4DUWA 1GV4A 3SR6B 1Z42A 1VQZA 4WSJA 1CXFA 5A8PA 4M3PA 1GESA 1X1ZA 5JUVA 1CLVA 1VJSA 3EB4A 3B0PA 2YQUA 3ZJ6A 4PMJA 2NT1A 4EWJA 1S3TC 3VUPA 1GVFA 2BY3A 4GY0A 2CC0A 1KRAC 5DCBA 4CNOA 1GQJA 4B5TA 5A2AA 4IFKA 1FWJC 3FEQA 3L21A 4AZ6A 3CU2A 4C91A 3UU0A 4CCCA 4B5WA 3NRZB 3CWOX 4J35A 2CWNA 5U4NA 4HK7A 4AD5A 2O7QA 3PY2A 1AJZA 3KOYA 4NRSA 5D8ZA 3U0HA 3W37A 5G5GB 4YTRA 1JF5A 4EVZA 1F4AA 2X2GA 3L5OA 3KOZA 1E6RA 3DFTA 1FUYA 4TU1A 2ODOA 5LZLA 3VO0A 2EPMX 3WLNA 3M0ZA 1EPVA 4CD8A 2BOFX 2J7HA 1V03A 2HK1A 4FAMA 3O6YX 1TMLA 8TIMA 1RJQA 1YE4A 4G6CA 1P48A 2PDKA 1WPCA 5A8QA 3CQ0A 3URBA 3T0TA 1A47A 1PB0A 1GVSA 2ZA3A 3PUEA 3GD6A 2ZOXA 2WOIA 5F4XA 1BQGA 2VEIA 1H3GA 1XIFA 3CTTA 3DK4A 3H4XA 1S2CA 4LIIA 2W67A 1KQZA 4LC6A 4C60A 3VM7A 2FTPA 4R7WA 3BLPX 1XFBA 1ZU8A 1AQ0A 1SJCA 2VQUA 2E5BA 1ZB5A 4KBXA 4YCOA 4XTIA 2FVKA 3LCHA 2C8NA 4A4AA 3LA4A 4QJ1A 4QJ3B 1TWIA 3WEZA 1TR9A 3VGEA 2DVXA 3RM9A 1JDDA 2R1NA 2A3CA 3CO4A 2GSJA 2Z2AA 3KTCA 4HJFA 5AC8A 1IIGA 1GPWA 3GB6A 2QPUA 2AQOA 2I5IA 4AIEA 3VABA 1XC6A 1SVDA 3ARYA 3UG3A 3O3RA 3DJGX 3DHUA 1IR1A 5BWFA 4F0SA 1HX0A 1LOSA 3NR0A 2JKPA 4XUGA 3E0WA 4Y96A 2R1KA 4Z0JA 3XISA 2G97A 4FS9A 3R1ZA 3ELFA 2J47A 4GJIA 1WBJA 3WQDA 1XJBA 4Q4KA 4DWSB 2QYGA 4IJCA 1OG6A 1W9BM 5JIPA 4LH8A 1B9BA 3AHXA 3OODA 1XLJA 1Q6QA 1Q6GA 1PAMA 2XN0A 3K8LA 3CGDA 3WK2A 3ARSA 5BXTA 4PSRA 3STGA 1WXYA 2DSVA 1XG4A 4W9TA 1BWKA 1GQIA 3KLJA 3TNBA 2O0TA 4LRSA 4Q4PA 4LUTB 2Z24A 2FHCA 4ZO8A 1TJ1A 1OCNA 1OCBA 1UUQA 1TIMA 3HU7A 4I90A 1P1MA 2YXXA 2G8ZA 2DPEA 1VFMA 1QI4A 2BB0A 1GUVA 2X05A 3HZ3A 3MSGA 4G56A 3S5YA 3WLTA 3CGTA 4G9PA 3RX4A 3ABZA 1NDZA 2GUBA 3GTNA 2DZVA 1QW8A 3RXZA 1K4GA 1RALA 3B05A 3QN3A 3KTXA 4MSSA 1Q8AA 1FWNA 1C7TA 5CC6A 2CHOA 4ZE5A 3Q65A 7REQA 4C6PA 3LUTA 3UJEA 3NO5A 4NJGA 1UBPC 4EXQA 4R7OA 3ZS4A 4S38A 3OA3A 1W1IE 2PUZA 1FH9A 1LJYA 4BQ3A 3DECA 4NL1A 4NNAA 5TD4A 2PWFA 3NFUA 3IC9A 5I23A 1SGJA 4K7VA 1KFKA 1ZAJA 4UIOA 4LVDA 1GRGA 3PWIA 4C6DA 4TQTA 1X1NA 2CLFA 3KBWA 4KQNA 1OT1A 3T81A 3UYCA 4MZYA 2NPXA 1ZL1A 2Y8VA 4H2HA 4HYVA 2WP5A 2I14A 3SSZA 3G1HA 3KP1A 3W2NA 1KFCA 1PKMA 1QK0A 4PB3A 1UWTA 1JQXA 3RLVA 3W7PA 5FJRA 4AB4A 4AIOA 3RMEA 1UR4A 2VXNA 1UP3A 2WJDA 4C6QA 5LHFA 3TH6A 2Y5EA 2H3BA 2XU2A 1XYBA 3F5JA 3QC0A 1X1OA 5ABTA 1TE6A 3E0LA 3G8RA 3RLHA 4HNUA 2EF9A 3A3XA 4EP8C 4HU3A 1WX0A 2ZRZA 3EWDA 2V5LA 3KZPA 3ZVHA 3GVVA 3L4WA 4G7FA 4J3VA 3VVGA 3LGDA 5DMLA 4Q3MA 2C3CA 3KXQA 1LG1A 1IIHA 2R24A 1C8YA 3AFBA 3KCOA 1RXOB 2FMNA 4IMDA 1A5BA 3GU1A 4JICA 2AMGA 1VEMA 2GOKA 3AIVA 4O12A 1NDWA 3PSVA 3GW0A 5HNRA 4JTCA 4NEVA 2CNCA 4JN8A 5FACA 4TV6A 3R8RA 5HJXA 5DRCA 5AB3A 3U4AA 1E0VA 4MY9A 1QWKA 4ZQRA 1EQCA 3ITGA 3AXXA 4QQUA 1FKXA 1JQVA 3GRSA 1KR1A 3PZ9A 3WLHA 1Q6DA 3CYVA 5CZJA 3T4WA 3FDGA 4FX7A 1TYGA 2OSXA 2VZOA 3HQ1A 3M0JA 4CVWA 5EMMA 3A47A 2OQLA 2YBVA 1PHQA 1H41A 1ZJHA 2GQAA 5G2WA 2ZBTA 3LCFA 3VCRA 5LA2A 3H22A 1EJ7L 2Y63A 1S5NA 5DLCA 3FSUA 4GUJA 4XTDA 1GTHA 3UXDA 3TSBA 2VGFA 5ABEA 1UKOA 3BOXA 1XS2A 3WQEA 4IPJA 4MVAA 2WLYA 1OD8A 5JCKA 3CLMA 1IT7A 1OC7A 2WPEA 1B3ZA 3TJXA 2FZ9A 4H9VA 4HN8A 2X8HA 4S3DA 3QSTA 4DJFA 3ABSA 1X8CA 3VNMA 2QV5A 2HPMA 5JCLA 1EYWA 2QF8A 2QXWA 1XF0A 1YKWA 4M24A 1F3WA 1W5MA 2C71A 1NM9A 3DI1A 2FTWA 2OEJA 3GWQA 2HXUA 2XPKA 4GIEA 3PZIA 1FY6A 3AS2A 2GOUA 4WX2A 4HA0A 4XD5A 1UH3A 1MW3A 4Q32A 5E93A 2BXZA 1VYRA 3TW9A 3UJ2A 4ZOEA 5E09A 4W5ZA 3A12A 5HMFA 2EBNA 3DGBA 4L61A 3SCVA 2W9MA 4HJWA 1CXHA 2E77A 2O7SA 5AC4A 1YYAA 1HUVA 3JU2A 5HQLA 1C9WA 3AHVA 4CGTA 1SW3A 3POCA 4GRTA 3O05A 4PFMA 4GWEA 2WSYA 3SB0A 3H7RA 1BKHA 3W7CA 7A3HA 1V6WA 1ZMDA 2VENA 1V93A 3W4RA 1Q4WA 2DFAA 1IWBA 4UNKA 3LXCA 4C90A 7PTDA 3OB8A 4XKYA 1TZ9A 1WUFA 3B4UA 2GJLA 3TP4A 1OF8A 2P76A 3U8GA 4IPPA 4JTLA 5DF0A 1MDLA 1YQ2A 5K9DA 2NUYA 3WMBA 1UW9A 4PUMA 3O0HA 1MNSA 4Y9PA 3ES7A 2UY5A 1JEZA 3FJ6A 5JBDA 4JN7A 5I09A 3LX9A 4GJ1A 2VVNA 1LQ2A 3WELA 4S3FA 4IUGA 2GZXA 3DHFA 4WHBA 3HFTA 5FI8A 1YXYA 3DYMA 2HVMA 1QDSA 4W84A 3OGVA 4DXKA 5DXXA 3WN6A 1IT0A 5TR3A 4AYSA 1DWJM 2WSKA 1E4LA 2VDIA 1MUCA 1RVGA 2CLKA 2QLYA 1IXOA 3NQDA 4O1CA 1MZHA 3AHTA 3LHYA 1XSIA 4BJHA 1N55A 3H53A 3SADA 3FYPA 1GHSA 1RR2A 1SO5A 4F2BA 1OHLA 3CV2A 4GFIA 1EB3A 4YVVA 4HD5A 4WXYA 4MJMA 1UOZA 2ESCA 4Y8EA 2PZNA 1KD0A 3G1VA 4S3KA 3DUGA 3L4UA 2EO7A 4H7ZA 1VLWA 1EH9A 1E6XM 3THUA 4U33A 1HL9A 1SO6A 1H49A 3MPGA 1C93A 2WWDA 1XIMA 1L2UA 4HNCA 3BLFA 2ATMA 2Y62A 5DXYA 4IP7A 1J11A 3T44A 5BMXA 4Q6JA 2BOEX 2ZTJA 4UMBA 4Z2IA 1BKSA 1YTEA 4RE2A 1K6AA 1SQ7A 5ABGA 2XIOA 1FCUA 4PMXA 2RKXA 2PEVA 4ZB5A 4AWUA 1SYTA 2OTDA 3KBJA 4Y7EA 4RCXA 3CZLA 1JZ3A 2PF8A 5AYBA 3CZ8A 2UY2A 3MUCA 4U2ZA 3GZ3A 3S9YA 3VKJA 3L8KA 4UQAA 4IIGA 2G3MA 3MHGA 1JJKA 3IGUA 4TTGA 1Q65A 3HMJG 3DFNA 2ON3A 4Q33A 2WVTA 5D05A 2DSWA 1KWGA 4O10A 3NVVB 2GQ3A 4B4HA 1CENA 3RJYA 3IJ7A 3TQ0A 5I5RA 1V3LA 5JH1A 1B31A 4NYUA 4UQEA 4LEQA 2XFWA 2G0WA 4HA1A 2PWVA 4MB3A 4D8AA 1A5CA 3PZTA 3BH4A 4HVXA 1DQWA 3ARVA 2VEMA 4B4FA 3N2CA 1W9XA 1FHDA 3CHDA 3BCJA 1MUWA 1IEWA 4AF0B 3VD5A 4DAIA 5AHEA 4H4XA 3KHJA 4HNTA 1IT8A 4I3GA 2FVLA 3BV7A 3R79A 3TTOA 4A3RA 4JCMA 1JR1A 1PX4A 3WH9A 3K2GA 3RO6A 2HS6A 2R14A 4E8CA 4GO8A 1UHVA 5D9MA 5I79A 2HROA 2OG9A 2XH2A 4DZHA 2G95A 3S0CA 4GINA 4JIPA 3G3MA 3EDDA 1UMYA 2JKAA 3RILA 3BMWA 3LS9A 3W1NA 2WSQA 3N3MA 2VR4A 1J4EA 1E0TA 3LMZA 4S2CA 3TQKA 6TIMA 1VPXA 2R9RA 1R2TA 1VFHA 1IR2A 1MRQA 1KRMA 1CXIA 4GNJA 3S1GA 3C0JA 3GH5A 1Z3NA 4BS0A 3M0YA 1A0EA 3P5ZA 4UC5A 2W92A 4QX4A 2E09A 2O4QA 3LXDA 4E2DA 1E70M 1FWRA 2BX7A 3WDRA 1Q66A 4OV4A 4JTDA 5C2XA 1Z8AA 3C0SA 1TWDA 5HPOA 2O4MA 3GC5A 2W91A 2GYIA 1M01A 2AAMA 2VC6A 3A24A 3HPAA 4GGBA 2YDAA 2PDMA 2XVGA 3WJSA 4WJXA 3MU7A 4JYDA 3M5ZA 4J27A 3UGRA 4P8UA 1X97A 4YVXA 3QOKA 3UBPC 2H9AA 4JTSA 2XN1A 3WF0A 1PJ9A 2D0FA 3MKKA 1A3HA 4M6VA 1GRHA 5KITA 4IZGA 3C2OA 3QH2A 1V0LA 1WDWA 4BHYA 4PUEA 2HWGA 1GRAA 2NQ9A 1XM3A 3WLJA 2PDLA 1NF7A 4AVFA 4Y6GA 3BV4A 5C5YA 3MMWA 3VYLA 3UPMA 2GJPA 2ZUTA 3GXFA 2W3ZA 2NLYA 1NSJA 2IQTA 2PTWA 2OX4A 1UA7A 1ZP4A 1IGWA 3NSNA 1JZ4A 4DWSD 3U6WA 2AL2A 2FZBA 2PRHA 1WDRA 3OTRA 1BXBA 2OOFA 4O16A 2P1FA 3NAVA 3MCMA 3PB2A 1VRXA 5AHMA 1B3VA 1ICQA 1T0OA 4H04A 1JI2A 1A5LC 4O19A 1LT7A 4R33A 1KCKA 1ZDLA 2ZZBA 1EF2A 3MI6A 4JFVA 2CITA 4JQ9A 4RR4A 4P7LA 3G1XA 2E5CA 2VEFA 4MB4A 1MQQA 2DZBA 2BGQA 3L12A 3UWVA 3ALFA 1DIEA 2W3SA 4KCUA 4NVTA 3ITLA 1XXXA 4EM4A 1KB3A 3TNOA 3RG6A 1DTUA 3SIZA 3LHUA 4PCPA 1UD8A 2OEMA 1XQLA 4YL2A 3ONBA 2FZ8A 4BEUA 4LYKA 2H6RA 3AZSA 3G1YA 1VCFA 1KV8A 1DVJA 3W81A 3VKDA 2OSYA 1KFLA 1EOMA 1JCLA 1MW0A 2PDFA 4NNBA 3GVWA 1TFVA 3C3UA 3EXTA 4EWND 4WY0F 4IJBA 3TFCA 3FX4A 3P2VA 4HBKA 4UB9A 1CWYA 4QJ4B 2HVNA 4IL0A 4V1YA 4Y9MA 1PPIA 5AFDA 4DZ5A 4E5TA 2FGZA 2CXEA 3LADA 3VDGA 3CL7A 1WXZA 1SFTA 2PDNA 3SRKA 2GR1A 2ZA1A 4O13A 3Q2DA 1AQMA 3Q94A 2X8RA 1N8IA 3V7PA 2WMGA 1NTHA 1Z32X 4DM2A 4XBSA 4DX3A 4MWAE 5BOOA 2EPKX 1M6IA 1A50A 5PTDA 5KVIA 4A3HA 2PI6A 4GI4A 3CQKA 1VJZA 1JXJA 2Z6JA 1LP6A 1BTCA 2P8CA 4XBKA 1DE5A 5FS9A 3URHA 5HINA 3P7YA 4H3DA 4ICNA 4K8EA 4ZL1A 4L5ZA 1RCXB 2B7NA 1IHIA 2VCCA 1P7TA 5RUBA 3NQCA 1K7EA 3MA8A 3VIGA 5HJLA 3WLIA 2WLZA 3A6OA 3JZEA 1EDQA 4XVDA 2POZA 3MCNA 3AXKA 3WK3A 1W8GA 1H63A 4UFMA 4DBEA 1LRTA 3VNKA 5BU6A 5H8MA 3GFYA 3PHAA 2RJGA 4HNLA 1GQLA 3PNZA 5CGTA 1OFDA 2DORA 3KLLA 1OWQA 2QS8A 2HMCA 3IIXA 3AU2A 1OGGA 2WO5A 3SCOA 3P5YA 1ISXA 4GRSA 4IH3A 3BUVA 1OADA 1F2JA 3WQGA 3ZVIA 1S46A 1LUCA 3CUZA 3BC9A 2DVTA 2OZ3A 4GOAA 4O14A 2Z2BA 3TTSA 1QCWA 3QFEA 2XG9A 3WQ5A 4C6NA 1Y5XA 1BYDA 3RRXA 5I06A 3P0WA 5AN7A 1VFUA 2A7RA 1B3XA 3T7VA 3LCLA 2FJUB 2FHBA 3LRMA 2Y7EA 4L4PA 1SB3B 4RNHA 3SRHA 3CGBA 1AW1A 2IPFA 1DBTA 4X63A 5M2FX 4PTWA 2PP3A 4H01A 1G9HA 1DIKA 3W00A 2YCLA 2V3GA 1K7FA 1WB0A 4B3ZA 1F4HA 1TV3A 3MS8A 1QPQA 4TOQA 1PWLA 4L6OA 3SRFA 3RRAA 1A0DA 4JTIA 1I0BA 1EBDA 2WMIB 3ITYA 4OKDA 3KS6A 2WNQA 1E6NA 1EF3A 1E3ZA 2G3FA 5A3HA 1AUSL 4F48A 4GUHA 1A3WA 4EMIA 4S3GA 2INZA 4JTUA 1VFFA 4RJEA 1JCYA 4GK8A 3AUOA 1POJA 1W91A 3WLSA 3E74A 1TQJA 3GHSA 3NZRA 2HV5A 4ATDA 4RLIA 1US0A 1HKJA 4MIMA 3C0QA 4H83A 3NQ2A 2G4FA 3CEPA 3CS2A 4E6MA 3OLGA 4OTKA 1NWRA 4NZFA 1H4PA 3S46A 4PTNA 4Q4QA 3E96A 2F7FA 4ZQNA 4C6IA 3S6OA 4X2PA 1PIFA 1OX6A 1DJHA 2C19A 4LBUA 3DG6A 1XV8A 5BW6A 1N8FA 4DLFA 4GG9A 1LL6A 2D20A 5M1TA 3S6DA 2GK1A 3LLFA 1NHPA 5LIXX 4JX4A 3LXBA 4GY1A 4ZBCA 2YVJA 2GL5A 3TXVA 3SQPA 3FW6A 5CCZA 2P53A 3RUBL 1FWCC 1QOQA 3NZPA 3GAKA 2WC4A 3CO8A 3AIRA 5KETA 4LAUA 2YDRA 1IZKA 1MRAA 4B2DD 3UZXA 1HJSA 1KBKA 2VFDA 4RW3A 2QGHA 4DWDA 5F1VA 4BWLC 4JTEA 4QAWA 2PLCA 3O6CA 1ZUAX 3TW7A 4YTSA 1R3SA 3LD5A 5CZKA 2DJLA 3TYDA 3W2MA 9CGTA 3SAZA 4H7CA 1OC6A 4EPEC 2QUVA 4ZVJA 2PCQA 3GNNA 1VBJA 4Z1CA 2YL8A 1GREA 1RK5A 3N6HA 4MFDA 3C8NA 1EGVA 3DYOA 3H7UA 1JGIA 4UTUA 4KEMA 1K8YA 3JRKA 3BLLA 1X7IA 2G96A 2VRJA 3LCWA 1OG0A 3PSWA 2Y7FA 3VU2A 4R88A 1SO4A 3O07A 2A0NA 4H6RA 3S2NA 4TMCA 2A3BA 1LBLA 2J8GA 5C9RA 3WQCA 3P3BA 3FGCB 4PMYA 4AZHA 2PDPA 5CSSA 4UFIA 1XCWA 5D02A 4GH3A 4H6EA 4WGXA 3O8AA 1NVMA 1EP1A 2EPHA 2WXDM 3K8MA 2QJMA 1BD0A 1DV7A 4GI9A 2PDJA 2BC0A 2EQ9A 3BJTA 3QTGA 4WY0A 2ZX5A 2OR2A 2PGFA 1DWIM 1SSDA 3WYZA 1RJRA 4PRWA 4LC8A 3NSXA 4LS2A 2OX1A 2X1SA 3RYSA 2V3AA 3AIBA 2NUXA 5FSEC 4W8AA 3W07A 4ADWA 3N4FA 5FCZA 3S9IA 3SGZA 3V36A 1QHPA 5TBOA 3B8UA 3MSYA 4U3AA 2NXIA 2J7FA 1UR9A 3NL3A 4HHLA 1C3FA 1D3HA 2P8BA 1EO7A 1AD4A 2I56A 4IPLA 1TWWA 3O06A 1PZ0A 2ACQA 3WQ8A 1A80A 4H4UA 2O56A 3N19B 2E5AA 4K6AA 3UP8A 4WLCA 2ZKMX 3VAVA 3E2QA 3CT2A 3O63A 2ICSA 3IUDA 2I5QA 1I60A 2WNNA 4MKNA 1J10A 4XB3A 2W54A 3AXHA 4DBSA 3CH9A 2BNJA 1EJXC 4UZUA 1J96A 1QUMA 4ERIA 3C2YA 5REQB 3QR3A 2PWDA 1G69A 4ZQMA 2Z1VA 2FZNA 1FCBA 4BF9A 1GTEA 1V97A 3VOJA 1RM6B 3TR9A 3TLLA 5FJTA 5CZ0A 1KLYA 5LIYX 5HANA 1FKWA 2R82A 1MXDA 3L4VA 2V5BA 1I2QA 1GVYA 4HMEA 2REQA 2NV9A 3OLEA 2J7GA 5CBIA 2X50A 1BSIA 4IMAA 5HULA 2D73A 1XLLA 1LLOA 4N7QA 1Q6LA 3N15A 3ZT5A 4DJED 3Q4DA 5T26A 1TPDA 2VD8A 1QVBA 3EOSA 4IMGA 4XD6A 4IOTA 3MYOA 2KAUC 4NT0A 3KOWA 2P3EA 5AY7A 1FA2A 4JKMA 2PS2A 1WZKA 5CEWA 1J5SA 1WDDA 3PZNA 3WNNA 4K1GA 4FB7A 3OIHA 1IXQA 4NP7A 4UFKA 1MVYA 4MYXA 1RJPA 3OQEA 1E9LA 3P80A 3T1GA 3G1FA 1B1YA 1JNDA 3LNMA 2ISWA 1UIPA 4FNRA 1G6CA 4C6EA 2CKSA 1RVKA 3NQ7A 1BGAA 1N2VA 1XD1A 2V30A 2W4XA 5DMMA 1WKEA 3CUXA 3VFLA 1HL8A 3AJ7A 1W3JA 2JALA 3DKLA 3VIOA 6ALDA 3UEQA 3N4AA 1W1VA 1R87A 1XIGA 4LANA 3LB8A 1ADOA 3DHDA 4L9XA 3VD9A 2QZRA 4IFOA 2QIIA 2OQYA 1YDVA 5HNNA 5C7VA 1GVRA 3BK0A 1AFSA 4Q6XA 2B7QA 1SJBA 3KDNA 2DT0A 4OECA 3T6CA 1XUZA 2XTKA 4US5D 3FDKA 1GVEA 1W9UA 5E0FA 5C71A 2X1RA 4ZOAA 4PMDA 3W85A 1SFSA 4EOUA 4FMVA 3ZJ7A 5GJPA 3ID7A 1R3QA 4WCJA 3H2AA 1YDOA 3NM3A 2LLEA 2ADAA 4OT7A 1ZKQA 2ZYFA 1JRPA 2VGBA 1CECA 2WQDA 3CZEA 1QRQA 2QVNA 3LV6A 5JQ9A 2E6FA 4HT3A 1W1TA 3P81A 1E9IA 3D9XA 1E55A 1R3TA 3WDIA 4QNWA 1E15A 4L1WA 4R9XA 4H00A 1LRNA 3F4DA 3QXBA 1CW2A 3E6EA 3MHUA 4MGGA 4IMEA 3PZMA 3VD4A 3DU0A 3SRDA 4XO7A 4C6JA 3CC1A 3C52A 1MFVA 4DYJA 3TU9A 4MNLA 1FWDC 3I7SA 2VR5A 2RDXA 4O54A 5HATA 2WZTA 2DZSA 1XBYA 2NXGA 4XZHA 1UBSA 2VP8A 3KUMA 1OJXA 1UASA 1RPXA 3KL5A 3QQWA 2WVVB 3CMJA 1JDFA 3DEQA 4INFA 1PIIA 1B54A 1ZNNA 4S3AA 1OFBA 3Q58A 1BF2A 3PUGA 1S39A 1G5AA 5IRPA 1SSGA 1BYAA 1CX9A 3PUDA 3ZOAA 4B91A 1HGWA 3OW1A 3UJRA 4DNMA 4H9YA 2GGEA 2NQLA 4Z17A 1WKYA 1X7FA 2BC1A 1VCVA 3KZSA 3LY0A 3NSMA 1UUOA 4MAZA 1LDCA 3IEBA 1T3QC 4I7WA 4EPKA 3DGHA 4N2YA 1P4CA 4MNKA 2WJZA 3TLQA 1XLGA 1IXNA 1BSLA 1KCXA 3H21A 5EMUA 1LYXA 4PMUA 1E73M 4MNJA 3L5AA 4NHVA 1RUSA 5ER0A 3V3WA 2ZQ0A 3RAOA 4RE4A 4FEZA 4C1NB 4ADSA 3HA1A 3FJLA 5I3GA 3IGXA 1FDZA 2ALRA 1VAHA 1EO5A 5T9BG 3F4VA 3SO7A 4WSHA 2XDFA 2GJXA 3BG3A 2ZUVA 2HE8A 2NQJA 4Y90A 3AHZA 1DXEA 1ITQA 2FJKA 1LQAA 1KCZA 1R0MA 3IV3A 5I2UA 1OX4A 3EB3A 3BURA 2E9MA 1ONWA 1LRQA 3LTPA 1H2JA 4UFLA 4LUYA 4ACZB 3CTLA 2CU0A 4OOZA 4OIFA 2YKKA 4QEHA 3UWUA 1A5OC 3NYDA 2ZZ7A 4RZBA 1WUEA 2CYGA 1BWCA 4PR4A 3W6MA 1G4EA 1NWUA 5HK4A 2C79A 3DBNA 1PTDA 2WHLA 2I9EA 1KCLA 1NWSA 3P0XA 4NILA 4IM4A 4W5UA 3KVMA 4ZENA 4PMZA 1T41A 5D2YA 4FF7A 4Y2WA 5D09A 3W2JA 3UWZA 1VP5A 5FOOA 2JFEX 4RX0A 1CI1A 4KFOA 4DF2A 3PR2A 2QF7A 1NP2A 1R7OA 4J3TA 2WP6A 4W8LA 3GXIA 3PZGA 2YZ5A 3SQSA 1RAKA 3SR7A 2JEQA 4L9YA 1ICSA 3OJGA 1W1B1 3ZR5A 1YXDA 5EMLA 4TVUA 2DUXA 2ZXDA 3EWUA 1VBRA 2GWGA 4XUYA 2VZTA 3T2OA 2IKHA 4M82A 1B30A 4BCEA 4W7WA 2C3DA 3AZRA 1Q5MA 4DQWA 1CLKA 2XZ9A 2Y85A 1W1ZA 3SCNA 2GDUA 3MMDA 2PDBA 1TTIA 1ZS2A 4YN5A 5AYYA 1UR8A 4K37A 4BK9A 3MB9A 1RZMA 3RNMA 2EGZA 2A3AA 3WJWA 3A7UA 2PLMA 2ZVRA 1V6TA 3T0CA 4CD7A 1R2RA 3AISA 4V15A 1V02E 1PTAA 3U2EA 5MKGB 3TOPA 2IKIA 3LSCA 3AYVA 2YCEA 1O1ZA 1RP9A 3C6CA 1K9TA 1SM9A 3DENA 5ABFB 2PDGA 1EPXA 4M8UA 2ZIDA 2JIWA 1M9HA 5CJNA 5G4WA 2ZZ1A 2WJFA 1XH0A 2YYTA 1U22A 1UJQA 4U2YA 1JDAA 2WK2A 4P61A 1XDJA 4YTTA 2MUCA 3GVQA 3VIMA 2TODA 3OVGA 3LBMA 3P84A 4Z2LA 4EMWA 2F6XA 3MCOA 3VCNA 4DWSA 4XAGA 3ZLGA 2AL1A 4ECLA 4QHRA 3SN0A 4HK6A 2DSKA 4PL2A 2VZVA 2BZNA 2F9RA 1BRLB 4HOZA 5DBUA 2ZX8A 4LF1A 4HHHA 4B5UA 5HA7A 5FJPA 1FHVA 4AU0A 1TPC1 5CPMA 3LHZA 2W55A 1QBAA 2V63A 3WD4A 4AC1X 4GQGA 4LUTA 3HURA 2ZC8A 1R3YA 4N6EA 2BXVA 4HU4A 1CXEA 3OGSA 3BSMA 4UTKA 3G18A 1FWHC 1JOAA 1PZ2A 1FBAA 4L4OA 1KA9F 2EJ1A 3BOFA 1NHRA 4APNA 1T5AA 2J88A 2QJNA 2A6LA 3OZMA 2PWHA 1JRBA 4N4QA 3EWZA 2QUTA 2Z27A 1VFOA 3TJLA 4DLMA 1NIUA 3SCUA 2G3JA 3CHFA 1NOWA 3U3HA 1BZLA 4Z2JA 1DHPA 1ONXA 4IXHA 4IMCA 2O55A 1LOLA 1HL2A 4P7RA 1CLXA 1GJPA 2WVUA 1XBZA 5CLTA 1O6IA 3H2MA 3QSRA 1DWGM 1ZENA 4F0LA 3K13A 4JXCA 2PDCA 4D6CA 3M7SA 1UMLA 5K4XA 3ZT7A 1QNVA 5EMYA 3WLLA 2ALDA 1PIGA 1SZNA 3EX6A 1PWMA 2GUUA 3VE9A 1H7NA 1DXFA 3ZT6A 2FZMA 1JXKA 2X8CA 3GTIA 3UY8A 4DYEA 1Z69A 3EXRA 1V7AA 4OJYA 2I5GA 1QPNA 1QO5A 3GRTA 4C6CA 1FH8A 5CJMA 1SR9A 4BZYA 4ZOHB 4R27A 2RFGA 1UA3A 1GQNA 1ITCA 1EEPA 1NJJA 4JTGA 3V35A 3F4WA 2XIQA 3VKCA 1Y7VA 5BU9A 3LENA 4GZIA 4Q7NA 1JCXA 3M0KA 2Y6ZA 3URQA 4NX5A 3EDFA 4P7QA 2E68A 3HRDC 5U25A 4F4RA 1Q8JA 2E4TA 3W84A 2QPXA 1Y0EA 3CEUA 3CZJA 1R9ZA 2ATSA 3UCCA 3GBDA 3F2DA 1NDVA 3VD7A 4AEOA 4C7GA 1TCDA 4TTUA 5CG0A 3OLDA 3GKAA 4RPQA 2Z00A 1VC4A 4GYFA 3DYPA 4E2VA 3ZR4A 4MDOA 3W88A 3H26A 3QC3A 1OFQA 2Y5JA 4AHQA 2IQ0A 1OQFA 3R5EA 1K3UA 1KTBA 2FIQA 3UG8A 3SQMA 5FF0A 2NSOA 4R3UA 5LKYA 3WH5A 3H4KA 3MV01 3E9AA 3NGJA 1GYNA 1EDTA 1HVXA 3APGA 3QQ1A 2A3HA 3BGJA 4FXRA 2J62A 1XYCA 3A64A 4CN4A 2I1OA 3GG1A 5K9XA 4DN1A 4AX6A 1J12A 4ALDA 3M1ZA 1X38A 3GHUA 3N73A 1A5UA 1UWQA 3P8JA 1NHQA 2QDHA 4CU7A 3S1UA 3P74A 4NXKA 3EGJA 3C2VA 1WDQA 3HJZA 1PKLA 1ME7A 5CPNA 4LCQA 2BHZA 1O7AA 3QF0A 1S38A 1O5KA 2OO0A 3TYBA 2Z26A 4CVUA 5HWMA 4HK5A 4F66A 1PS9A 3UWWA 5GPRA 1AVAA 4PTDA 3TCEA 1ZJBA 1YPIA 3AIQA 3GXDA 1VYSX 5AOUA 2V3EA 1NDAA 4J56A 1UC5A 1GZ1A 2J25A 1LVLA 4LAOA 3EDJA 2ZX6A 2WPCA 3DERA 1OK6A 4R85A 5AHFA 4AZCB 1KFWA 5A6LA 5DN1A 3AALA 4ZFMA 4DZAA 1TYPA 4WIWA 4O53A 1YBQB 2ISSA 5B7ZA 1TV7A 3NJ3A 3V4BA 4XIMA 1OFAA 2ACUA 2HS8A 1J93A 2O92A 3UXIA 3E1F1 2OSWA 1T8XA 1YMYA 1W31A 3HPXA 3PPFA 4RZ5A 1CCWB 1TO3A 5CPTA 3V16A 5EA9A 2OKOA 4HNVA 3RF9A 2Z7GA 2E40A 4LF2A 2WHJA 5I3DA 4CKQA 3MP3A 3VZYA 1EJVC 2FVMA 3L0KA 1ENUA 5AECA 4TO8A 2PRLA 2E67A 1RY0A 3R94A 1TQXA 3TYZA 5HPCA 2R6OA 2X30A 3LPGA 4HU0A 1UG6A 3O0KA 1VJIA 3NL5A 1AH4A 2NX3A 4HB7A 4NKCA 1EQPA 1AL7A 1M7XA 4J5NA 1DP0A 4M29A 2A5HA 1HO1A 3W1LA 1CB7B 4W85A 4L6DA 4B2DA 4XX6A 3BAIA 3TFXA 3H2NA 1R7AA 3BQ5A 4CCEA 2C0AA 3JVAA 3SIMA 4JEJA 1KLZA 4JIIX 4UZSA 3GDLA 3UR5A 1E9ZB 1LBMA 2PCEA 4G1KA 3W7IA 4KEUA 1KRCC 4BI5A 4QSHA 1NARA 4H41A 4LY8A 1ZCOA 1OK4A 3NDYA 1N63C 1XKYA 5GJMA 3G1DA 4QNEA 2H8ZA 1IEIA 1E6SM 2Y88A 1P6BA 2CHRA 1EBHA 3VOGA 1JPHA 4UUIA 2DIEA 1V51A 1BFNA 5I3KA 5D37A 2C1HA 1Q13A 3W1TA 1X6NA 4KGJA 3N2BA 3V1PA 2OZ0A 1AQFA 4AW7A 3MBFA 1NOFA 2X1UA 1CXKA 3W7NA 3RR4A 5I77A 4KCWA 4QS6A 4MWAB 4HGXA 1TPWA 1PL9A 4O18A 3RPTA 4QE5A 3E3HA 1TZZA 5C54A 5BRBA 2YW4A 3PWAA 3L4XA 3W26A 2PSNA 5LGXA 3FFSA 3NOEA 1VH7A 4MJ4A 3W82A 4BI7A 2PDWA 3G2GA 2V9DA 1X98A 4WZHA 3GG0A 3MUAA 4JDRA 4IIFA 2ZZ5A 3FK4A 1WZLA 3D6NA 2O9TA 3EUB3 5BRQA 2WPFA 3HMCA 1PYMA 2E9LA 3I65A 3W1AA 3PS7A 1GRBA 3FA4A 5FL0A 2Z29A 4QAIA 4OBSA 3WENA 4PSPA 1J0KA 2ISVA 3KBSA 1A4LA 3CMGA 3MDUA 1E51A 1Y5VA 3LHWA 5A2CA 1ZAIA 5AHLA 4WKAA 1PHWA 2GSEA 2O9RA 3STCA 4WDXA 1IYXA 1PDYA 1JNEA 3T42A 4QLLA 3WH7A 4AQLA 1UD5A 3CIWA 3N9KA 3ZO9A 1EIXA 2UZ9A 4F8XA 1Q6CA 3DZ1A 4Y9OA 5DT5A 3OHMB 4GX8A 4FIRA 3KE0A 3SUVA 1KBIA 3OP2A 1UC4A 4D72A 4DF0A 1DKWA 3WDHA 4G8TA 4IG2B 3SUUA 4U10A 2FDMA 1V0MA 3II1A 3R11A 3VXGA 3PG9A 4YLWA 3W22A 1JCJA 1QPKA 1W6TA 4QISA 3CWNA 4A05A 1XH2A 2EAWA 3I6RA 2ZFAA 5L6UA 4W87A 3W02A 5M3WA 4AF0A 3UF9A 2TYSA 4KWSA 4X0VA 3AM9A 3VX0A 4A35A 4CN1A 5M5DA 2VFEA 1V7YA 5J5RA 3UZ5A 3UETA 1HKVA 3CUHA 1LBFA 1ISYA 4DJEA 1J0JA 4EKJA 6ENLA 3VIIA 1XLFA 3KL0A 2V5DA 2W3RA 1E0UA 3PG8A 1FP9A 4ADUA 3CGCA 3WMLA 2J7BA 4GNKB 4MLRA 3QLLA 5E0KA 3QY6A 2QULA 1R47A 3FYOA 4CUCA 5JXQA 3FYYA 3NXFA 2PD5A 1A49A 4WXZA 1F3TA 4GXWA 1XICA 2Q3RA 2YVFA 3P14A 1F9CA 2P0IA 4O50A 4GUIA 4UTWC 4Q8NA 1RCQA 1EA0A 3B9AA 3GD4A 3NPWA 3BTNA 3ZWSA 1C8VA 3ABXA 3VM5A 1LWIA 3W6LA 1XLHA 5FJUA 5A94A 3VI2A 5LNSA 3CZKA 3O16A 4C6OA 2R91A 1XUUA 2WHMA 5FF7A 2PBOA 3BLEA 3WLMA 2YR1A 3WQPA 2ABAA 1E6PA 5I7GA 1UD2A 1ZX9A 4UR8A 4FZIA 3OG3A 2A2IA 4LVAA 4IGNA 4H4PA 4IIBA 3L2IA 1LROA 3NZ1A 3CT7A 5D33A 5KVHA 1V6XA 3EX4A 2E28A 4HZ7A 4C1LA 5FJJA 1KKRA 4XSMA 3MWAA 4JDYA 1DWAM 3GX9A 3W74A 3N17A 2E8YA 1JI1A 2HJPA 3STEA 4B92A 3URNA 1P0EA 3QV9A 2HQAA 4US5A 5IDIA 3NVYB 1ZRQA 1GZJA 2PWUA 4C65A 4Z1DA 2XH0A 4O1BA 1XGEA 4M1BA 4XVEA 2H90A 1HO4A 5D8WA 5DRIA 1BF6A 3L65A 4ZB0A 3KCLA 5KINA 2X1IA 3NXLA 4GPNA 4MYAA 1D7YA 3MW7A 1GOIA 3WSUA 1FOBA 2XH7A 2YCIX 1VD6A 3QY7A 3SCPA 1W1A1 1M04A 3N13A 3N9SA 4B5XA 1BQCA 1XLIA 1CBGA 1RQHA 1XGZA 1RBAA 1F6PA 3B9NA 1A53A 4AZ7A 1KXHA 3NO1A 5AZ0A 4ZODA 3ZJKA 1GPFA 3UA3A 2X7VA 1CGTA 1B90A 2ZTKA 2EQ8A 7CGTA 2NX1A 4M5PA 2QCNA 3W9ZA 4UTIA 3W1RA 2PDQA 3DAQA 4LALA 1US3A 4UFHA 4KFNA 1AK5A 7ENLA 4K36A 1PO9A 2XYLA 1Q6OA 1UH4A 1SO3A 1VZWA 5FEPA 3AICA 4UR9A 4EAMA 2VM8A 5H1WA 3I4KA 3CXBA 4DNAA 2V6AA 1XIJA 2XVPA 1KFJA 1GOQA 1EP2A 2OLHA 1S2AA 3CMFA 4OFCA 1QWGA 1VHNA 2PD9A 3MQTA 2YGYA 4ML9A 3VD3A 4DJFC 1JPIA 4MHBA 3LTSA 4Z1YA 5FS7A 3ZYZA 3MY9A 2J77A 3KRZA 3N1AA 1K8ZA 3U9IA 1S2TA 3BOLA 4DPQA 2GR0A 4MKVA 3N2XA 4AAJA 4RE0A 4M7SA 1QNOA 2FGLA 1V08A 3GE7A 3F5KA 3WL0A 2QAFA 5C55A 3OVQA 2A8XA 3V0UA 3PAOA 4MG4A 5LXEA 2BGNE 1TX0A 4NZ1A 1LOQA 4Q8TA 5CPSA 3W28A 4DI9A 1XGDA 4XAPA 5GVJA 1DJQA 3ES8A 3RR1A 6XIAA 1NH6A 1KM6A 1GWJA 5HQMA 2P5NA 3IRDA 1JZ5A 2YBTA 3QW3A 3BO9A 3CASA 5C2GA 3LGEA 3CUJA 3EEGA 3WMSA 2OVLA 2CHNA 3PZOA 3GR8A 4XO6A 3PNUA 3UR2A 1YNPA 4AZBA 3LTYA 1K77A 5JCNA 1EP3A 1ZFJA 5FJIA 1CYGA 4JX5A 3HV8A 3BL3A 3PTMA 3QPEA 3KW3A 3S47A 4L6HA 3S42A 2UBPC 2D2HA 4L80A 2Q09A 3PBWA 5C9ZA 4GZEA 3OVRA 2Z1XA 2OEKA 1CEOA 4CU8A 2Y7GA 3IVTA 3HO8A 1I1XA 1JUKA 4KWVA 5LA1A 5D9NA 4NZCA 3GH7A 3GYCA 4HMDA 3PUOA 3CV7A 4AWEA 4NAFB 1K8CA 3A4WA 4ORIA 2R1MA 1VB9A 1R8LA 4L56A 1VBHA 3CV1A 1BVWA 5IXEA 4PBEA 4S3BA 2Y0FA 5G5HB 3U4FA 1R46A 2IQDA 3W83A 1R85A 3MKCA 2WANA 1TV2A 5FF4A 1JZ8A 3OC4A 4PZVA 3LZ5A 4NF7A 3BLDA 4NZJA 3AMCA 3DGRA 4LFYA 1DJYA 4MF4A 4LAZA 4QITA 3XIMA 1ALDA 1OJTA 3VNJA 2XJ7A 5A95A 3SSJA 2A7PA 5D9OA 2W6RA 4B9YA 3HFYA 2B31A 3M7WA 4AFYA 4YWOA 2JGYA 1H7RA 3QGKC 4GA8A 2YDQA 1P6CA 1H5YA 4AMAA 3C61A 4JY9A 2PA6A 4A2RA 1FWGC 3BAJA 1OCJA 5FESA 5CGQA 3AMKA 3DX5A 4PRTA 4FNSA 1W3IA 1G1YA 4JZ5A 5K3VA 3TONA 6PTDA 2VZUA 3MUY1 3M46A 4QLJA 1JFHA 3IAQA 2GVEA 3MV11 1P0BA 2GJNA 1A5SA 4OUIA 1UPPA 4O4WA 4PB4A 3ITTA 3FV9A 2WMIA 1E4MM 3GQYA 4POCA 3IARA 2DQWA 4EACA 9XIMA 3F7JA 3I10A 3UW6A 1L8NA 5ECVA 1VIZA 2E6DA 4HYRA 4MOZA 3IJ9A 4A6GA 2X16A 3DKJA 5H6HA 1OCQA 1JZ2A 1PVNA 3EZ4A 1NPXA 2VUNA 3VNIA 2YDSA 4LBRA 1Q4NX 2FQIA 1F8WA 3EDKA 2YOCA 2NV2A 3NEVA 5EY5A 4J9JA 5DY2A 1FWBC 5I00A 4N42A 4E4FA 3S9ZA 2JF7A 2UY4A 4A3UA 1I45A 4Z2KA 1QR7A 1OFRA 5F2IA 6CGTA 1R38A 1S2VA 1H1YA 4XZMX 4K7YA 1IWAA 3IV8A 3IAPA 4AC7C 1EGMA 2IKGA 1DWFM 4TUFA 3S6TA 1ECEA 4PEKA 1M5WA 1QFEA 1Z44A 3KX6A 1A5AA 5CZTA 4NEWA 2GLKA 1WXJA 3DI0A 1JFXA 1PX3A 3K8KA 3TZFA 2CBIA 3RPMA 3VDHA 1KN0A 5A6MA 3PP7A 5ABHA 3RX2A 2EKGA 1XLKA 4E0CA 2PZ0A 4DJDD 3LI0A 1T7LA 4Q4OA 3NYZA 1E6ZA 2XM2A 4PODA 4V1XA 1FQ0A 4KPLA 5D9PA 1EYEA 3W7DA 2QW5A 1HQTA 4QTGA 1HKKA 3N25A 4IHCA 4DO7A 5DANA 4H4RA 3F1QA 2FTYA 3WUBA 1JPDX 4AD1A 1GKQA 3A3HA 1LLZA 1DJIA 5FEWA 1HT6A 4P7OA 3FSTA 3W7KA 4FX9A 1F3XA 1IE7C 3W70A 1AD1A 1HIZA 1I4NA 4JTJA 4CNPA 2BXYA 3SDOA 1GETA 5LHEA 1TV8A 3M0LA 4S23A 5E1QA 3B40A 1FWAC 2FZDA 4PC8A 1IF2A 4DXXA 1R2SA 3OU8A 3FGCA 3QPYA 4XG1A 1VLIA 4X3ZA 1I9CB 1J0ZA 4MWAD 3LHTA 2Q71A 4YWSA 3GG7A 2DZAA 4UCGA 1NP0A 4JTTA 3JZUA 4Q8OA 3EYPA 1A5MC 1XPYA 2D2OA 2F6KA 2A79A 2CEQA 5C0QA 1BAGA 3TV8A 4D6HA 3M43A 4F79A 1QTWA 2ZDRA 8XIAA 1HJUA 5JMUA 1EIBA 2J8TA 1UWUA 5A69A 4V2XA 1MI3A 2VRKA 3A22A 1KXQA 1HP4A 3GHTA 3KRBA 1ZSXA 4F9JA 4HPJA 3WLQA 1L2QA 1OC5A 3VGGA 3DFYA 4Z2GA 1IXPA 1QW7A 1TTQA 2RDTA 4PUUA 3D46A 3RN6A 1XIDA 4FSAA 4PCFA 3VDBA 4DM1A 4Z08A 2G50A 3QKEA 1D7FA 2VC9A 3NWRA 2W61A 1QMLA 2R8WA 1LTDA 4DBDA 4IIHA 4FP1A 3UZYA 3VK5A 3WLRA 4E2OA 5DMYA 1WYGA 4HPNA 1A0CA 1Q63A 2FH6A 4O17A 4NG3A 2WBGA 3S2JA 3MYPA 4UTWA 4GYPA 3IGSA 3C2EA 1Q6RA 1XKJA 1WOBA 5E70A 1CGVA 4ONVA 5REQA 3W75A 3UJFA 4F0KA 1AW5A 2VDGA 3GU2A 4N9DA 4ATWA 4XZBA 2KZHA 1WAUA 4LRTA 4HOXA 4XD3A 1Z48A 1JROA 4OQVA 2WMJA 3H8AA 1UD6A 4A8NA 3DFOA 3U2CA 3W7RA 4WF7A 5C8BB 4UTTA 4WSKA 3HTWA 3SGUA 1XHCA 1S5WA 2Y61A 3MI2A 4MUZA 2IUZA 1IEQA 1H0IA 2J7DA 4UTLA 4IL2A 1FWSA 1H0GA 2VEPA 1CGXA 3CH0A 3PF3A 3LZ3A 4F9DA 4ZSUA 3TN5A 3WNPA 3EB2A 3N18A 2W0HA 2ZRXA 1AODA 1XLMA 3GNOA 2ZWZA 4B16A 2V69A 5BNKA 3QQ0A 5AC6A 1W3NA 3NG3A 1W32A 3H4WA 4GFSA 2CZ5A 4OBRA 5A6TC 4WOQA 1HGYA 2B0MA 4TX8A 4KRZA 3PBGA 4JGDA 3Q6JA 3VCCA 1KRBC 3MO4A 4OVXA 4C6KA 4I6KA 2GH5A 4J3WA 4H4QA 1T6MA 1HJWA 3GZAA 1TR1A 4H4IA 2BBFA 1E3XA 3O6DA 3Q67A 4G7EB 4ERGA 4I8YA 3FKRA 3M41A 1O5QA 4YVPA 1WNOA 2PTDA 3CB8A 3CB3A 1TMQA 2VMFA 3EA1A 4DIAA 4UQ9A 1P0NA 2QR6A 3WLPA 3HQOA 4XAYA 2EG7A 1NWTA 4L64A 1CT5A 5A5WA 1QATA 5FMHA 4FI4A 2QDGA 1ZCCA 2ZUWA 1F8MA 2PC8A 1YXCA 3AIWA 4FOKA 1LLWA 1JL8A 3UVAA 3S83A 1N7KA 1XYZA 4H19A 4PTVA 2P50A 4XZWA 4O1FA 1VYPX 5G1YA 1YX1A 3LYEA 2J66A 4P8VA 2VVSA 3NVTA 2Z2UA 2BGSA 3LRLA 3GC2A 1K9EA 1YTKA 2WNZA 1PDZA 3N2TA 4M52A 3QHNA 5CPLA 2F2KA 2BVTA 1NELA 3ZLFA 4KIEA 3A13A 3EMZA 2VDHA 4CQBA 1J6PA 2OQHA 1KBJA 4LUSB 3TYAA 4MPQA 4J28A 2BG5A 1D3CA 4D8ZA 3FA3A 3N6QA 3I4EA 4H4TA 4FPSA 4N0RA 3TC7A 2NVAA 3DDMA 5DEZA 4AY8A 4GISA 3S4TA 3SJ3A 2VFFA 4MADA 4LWWA 2I9UA 2XIIA 3CAKA 1J0YA 2DW6A 2GJRA 1FWEC 4CD4A 1V4YA 3SBFA 1MUMA 2WVVA 2OGJA 3AIEA 3ENLA 1FP8A 3SFWA 3LEPA 1U1UA 3EMCA 1GSNA 1O95A 2X09A 2DDXA 3GY1A 1EXPA 4ASTA 3EPNA 3V0TA 4L4MA 3SY1A 5LNRA 3TR2A 3WZ0E 4W86A 1KO0A 5AZ1A 2W5FA 4FLSA 5HWJA 2JBMA 3M07A 3SGGA 3UY7A 3E2SA 3UPBA 4JFTA 1TA3B 1A5KC 2IKJA 1OVDA 3GLCA 1N60C 3BLOA 1FFRA 3W6YA 1J5TA 1SJDA 3N3TA 4KERA 4OUEA 2CFYA 2GR2A 3F4NA 3MVTA 3QYSA 3LU2A 5AYXA 3STPA 1ITXA 3ARQA 4DRSA 1E1CB 4FXJA 1W2PA 4C1NA 3LCGA 5CKSA 3WFZA 4MWAC 2RJHA 3GNPA 5B7YA 2DSZA 3S5ZA 1YE6A 3H4GA 1Q45A 1MQRA 1H6VA 2ZUUA 1FVPA 2E9BA 1VR6A 3CYJA 2GVYA 1R3VA 1H51A 1UZHA 2GQWA 5KTLA 4A8IA 3TN3A 5A8OA 1S5MA 1X39A 4ACZA 3FA5A 4Y9NA 1GONA 2ZADA 3DFQA 3VZXA 2GVLA 2PTXA 4XZNX 3VUSA 4BFAA 3ZWTA 5JVLA 3B9DA 1JGMA 3BMXA 4WEVX 3A5FA 1ZMCA 3KEHA 1QI3A 3GO2A 2CETA 4GVGA 3MP4A 1YQZA 4F40A 1KFEA 2CWXA 3TN6A 3AU6A 2GGGA 2CXGA 3RU8X 1WYIA 5HAOA 1DIOA 2D0GA 2XIMA 3G5EA 3NZQA 1R3RA 3AUJA 3L9CA 4H2CA 4NAEB 3TQVA 2ZE3A 3SUSA 4DO5A 4JQ4A 1BLIA 3GTXA 3IIOA 1POKA 2QCFA 2Z6IA 3QV6A 1GEQA 1F74A 4H6KA 3WF4A 3RK8A 3T05A 2C14A 1W2VA 1ZBCA 4KWOA 4H4ZA 2PDYA 2B7PA 3PPHA 1J01A 3H2EA 2CZVA 3N11A 3CK5A 2KX9A 3VGDA 1XL9A 4Q8QA 4EM3A 3B97A 2JQXA 3NIYA 4PFHA 5LNVA 2J27A 2CBJA 5EL1A 1U30A 2PWGA 4YIWA 2ZUMA 1RY8A 1SZEA 3ZSTA 2CKRA 1WOAA 4ZFCA 4F0HA 3B9OA 4CNUA 1XG3A 4QM1A 1I2PA 3KOFA 1MQPA 2CLMA 1VHCA 3MSRA 1H7WA 2XM1A 3PZUA 3I3DA 3AXIA 1IEXA 1NU5A 2WYSA 5K4ZA 4S39A 3T07A 1UD3A 2HNEA 3SCWA 1TPVA 2PWEA 3AMZA 2GUYA 4N9BA 3V75A 5HR7A 4LNYA 5MKGA 2PAJA 4S2BA 4IPIA 1VPYA 2OYMA 4QR6A 4Q7IA 2CZDA 4AHOA 1P0DA 1VBGA 4UCFA 5ABFA 3EOLA 1J79A 1JEHA 1GK8A 4JR5A 1OYAA 1XLEA 3NZGA 5IOBA 1UROA 3WQ6A 2HCVA 3HQNA 3T2QA 3AYRA 5FEZA 1ZY8A 3LNPA 2Y89A 3ALGA 3HGRA 4V33A 4E2BA 1ML1A 2VTFA 1LORA 2YXGA 4HMNA 1BRLA 3MVIA 4I7VA 1X2GA 3EKLA 5IBXC 5ECUA 4NJHA 3HIJA 2WM1A 3MC5A 4Z1BA 2YYUA 1VIWA 4O1EA 3CAQA 1Q2SA 4RXGA 4NZ4A 3TQPA 3A23A 3NQGA 3LRKA 2BY0A 3T09A 4Q8WA 4DUXA 4RL3A 4A8LA 1UCWA 4EF9A 4OHQA 4WRHA 2VGGA 2DJXA 2VOMA 5FIPA 3KL3A 4IP5A 5A6BD 5FA5A 4LQ1A 3PBYA 2W0UA 2EXOA 3GVGA 3PN8A 1K70A