2RDXA

Crystal structure of mandelate racemase/muconate lactonizing enzyme from roseovarius nubinhibens ism
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
369
structure length
369
Chain Sequence
SLRITRIRLYKTDLPYVDGSYGWGAGNAITVARASVVVIDTDAGLQGCGEFTPCGENYMIAHSEGVDAFARLAAPQLLGQDPRQVARMERLMDHLVQGHGYAKAPFDAAFWDILGQATGQPVWMLLGGKLCDGAPMYRVAPQRSEAETRAELARHRAAGYRQFQIKVGADWQSDIDRIRACLPLLEPGEKAMADANQGWRVDNAIRLARATRDLDYILEQPCRSYEECQQVRRVADQPMKLDECVTGLHMAQRIVADRGAEICCLKISNLGGLSKARRTRDFLIDNRMPVVAEDSWGGEIASAAVAHFAASTPEEFLINSTDLMNYNTRSTGLGGPTVHQGRLYASDTPGLGVTPDFNSLGAPVADWAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mandelate racemase/muconate lactonizing enzyme from Roseovarius nubinhibens ISM.
rcsb
source organism Roseovarius nubinhibens
molecule tags Structural genomics, unknown function
molecule keywords Mandelate racemase/muconate lactonizing enzyme, putative
total genus 124
structure length 369
sequence length 369
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2rdxA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2rdxA01
2OZTA 3R10A 2HXTA 4IHCA 2XH7A 3IJIA 2QGYA 2HZGA 3KUMA 3B97A 3P0WA 4KPLA 3CB3A 1F9CA 1EBHA 4FP1A 1JDFA 3NFUA 4IL0A 3MZNA 1KD0A 3V4BA 3UJ2A 3IK4A 2CHRA 2RDXA 1ELSA 3MQTA 1R0MA 3R25A 2FYMA 4H1ZA 4YWSA 2OQYA 3RITA 4KEMA 3SN1A 1L8PA 1DTNA 3R0KA 3STPA 2PGWA 3VDGA 2PU0A 4GISA 1KCZA 1MDLA 5BOEA 3N6JA 2AKZA 1P43A 3R11A 3UCCA 4DYEA 3ZVHA 3TJ4A 3T8QA 3EKGA 5EU9A 4J3ZA 1EC7A 3NZGA 3R0UA 4K8GA 3NXLA 3S47A 4KWSA 6ENLA 3PWGA 1JPDX 4E6MA 3MKCA 4X2PA 5ENLA 1WUFA 3MWCA 2AL2B 3V5CA 3DFHA 3RRAA 2GDQA 4A6GA 3DG7A 3EEZA 1NELA 3FYYA 4ROPA 4KT2A 3GY1A 3OPSA 5IDZA 1TKKA 4K2SA 3UXLA 2P88A 2PMQA 2HNEA 4HCDA 4M0XA 1XS2A 5FJPA 7ENLA 3FJ4A 4JN7A 4DX3A 1XPYA 3U4FA 3TOYA 4GYPA 1OEPA 1KKRA 4FI4A 1TE6A 1TZZA 2OG9A 3ZLFA 2OZ3A 3OW1A 2PU1A 2GGHA 3DESA 4IT1A 1ECQA 2PCEA 2ZC8A 3QLDA 3RGTA 2PODA 3H8AA 1MUCA 3D46A 3DDMA 5FJUA 3UJRA 4ZCWA 2QVHA 3QPEA 3Q4DA 3VC6A 3P93A 2QJMA 3SJNA 5J04A 1SJBA 3N4FA 4GIRA 1R6WA 3SSZA 4Z1YA 2P0IA 4IL2A 3RO6A 3TWAA 2QJJA 3JW7A 3SQSA 2OZ8A 1E9IA 4Z17A 1PDZA 2PTXA 3JVAA 2MNRA 1YEYA 2XH0A 3RR1A 4MKSA 4JN8A 2XH2A 3H70A 2I5QA 4ENLA 3FV9A 2PPGA 4M6UA 4JHMA 4K1WA 3UJSA 2OO6A 3VC5A 3PK7A 4HCHA 2XH4A 3UXKA 2GGEA 3TQPA 4ZA0A 3CK5A 3UJFA 3TTEA 3ES8A 3T9PA 3PFRA 3I6TA 3MSYA 4A3RA 2OKTA 3GC2A 4J1OA 2PP0A 3ZVHB 1BQGA 4MGGA 4A35A 2GGGA 2PGEA 3VCCA 2QQ6A 3PWIA 2GSHA 3DGBA 2PTWA 3GD6A 2OPJA 3OZMA 4HPNA 2OX4A 3BSMA 1FHVA 3QN3A 2OLAA 2PA6A 3V5FA 1JPMA 2QDDA 1MNSA 3VA8A 4IZGA 3IJLA 4DN1A 3SBFA 2PP1A 1P48A 2OFJA 4GGHA 2XGZA 3HPFA 3FVDA 3OP2A 3BOXA 4HNCA 4DHGA 1SJDA 4EWJA 3DG6A 4GFIA 3CAWA 4HN8A 4IP4A 2AL2A 4H2HA 1SJCA 2PS2A 3K1GA 1W6TA 2XSXA 2OQHA 5BOFA 3VFCA 2P8BA 1EBGA 1PDYA 1JCTA 2MUCA 3DG3A 2PSNA 2QDEA 4G7FA 3TJIA 4E4UA 3FXGA 4H83A 3TWBA 3CXOA 3FCPA 2PTZA 1WUEA 3T6CA 4F4RA 2AL1A 4G8TA 1MDRA 3ZLGA 3I4KA 1EC8A 3IJQA 3THUA 4IP5A 3ZVIA 2P3ZA 4MMWA 2QJNA 4DWDA 3OZYA 3SN0A 3MY9A 3S5SA 3H12A 1FHUA 3CT2A 3JZUA 2FKPA 3DERA 3ES7A 3U9IA 4GMEA 1IYXA 3UCDA 3DIPA 4HCLA 3QKEA 4DXKA 3Q45A 3D47A 3DFYA 2GGIA 3QTPA 3ZLHA 4H19A 1EC9A 4E5TA 2O56A 3OTRA 4E4FA 3N4EA 2POZA 3UGVA 2HXUA 2DW7A 3TCSA 1SJAA 3TW9A 2GL5A 4E8GA 3H7VA 2PP3A 2NQLA 5FJOA 3N6HA 4GYPC 3BJSA 3GO2A 1BKHA 3UJEA 2DW6A 4HNLA 4HYRA 1ONEA 3ENLA 3MUCA 1NU5A 3I6EA 2AKMA 5FJTA 1KKOA 4GGBA 3V3WA 1MRAA 2OVLA 3VCNA 3P3BA 1RVKA 3DEQA 2ONEA 3R1ZA 2ZADA 3CYJA 3SN4A 3RCYA 5FJRA 3T4WA 2P8CA 2PTYA 2GGJA 3NO1A
chains in the Genus database with same CATH superfamily
1KLZA 1XDLA 2JKPA 3MI3A 1S2AA 3EWBX 4GABA 2J7DA 4GWEA 3P0WA 2YYUA 1LL4A 4M19A 1Q4NX 1B2YA 2YYTA 1EJTC 3ZT7A 3H2FA 1KW1A 4NJKA 4O12A 2CWXA 1VJZA 4H6EA 1LPFA 1SB3B 4B4HA 3E9AA 1BZLA 4G6CA 1GESA 4JQ9A 1FKWA 3ITLA 2GJNA 3GFZA 3F4WA 1XIBA 2OQYA 5EB8A 3SN1A 1RH9A 3STPA 1SW0A 3VMNA 3VDGA 4M52A 2V63A 2C8NA 5CZSA 5LIKX 3T44A 3D3AA 2V8ZA 4DZ5A 2X99A 1P43A 1ZNNA 4S3BA 3NJ3A 1ZJHA 4OTKA 2WZMA 2YCLB 1CIUA 1GTEA 1R2TA 2DUXA 1TPB1 1PYMA 4NI3A 1ITCA 1XD0A 3QC3A 2YSWA 5HDRA 3GVGA 1UHVA 1CYGA 6ENLA 4G9PA 4UQDA 4D9PA 2X1UA 4LF2A 3G18A 1HT6A 3WJWA 4AD1A 4JKLA 2PLMA 3MWCA 4PTVA 1X96A 3B40A 2A7NA 2HE5A 1JCNA 1GRTA 1XV8A 2GWNA 3O15A 1XW8A 4TVUA 2PRLA 3C86A 2J7CA 2VWSA 1VBJA 3CC1A 1NDZA 4REQA 3ARYA 1UKPA 3UPMA 4CQAA 3R5EA 5F2MA 4MDOA 1R9ZA 3VD9A 1FWGC 7ENLA 3JU2A 3LEPA 4UCGA 4HNOA 3QHNA 2XZ9A 1YXDA 1XINA 1FWJC 2YCIX 2XIIA 3MA8A 4FI4A 4J40A 3S6DA 2VZUA 3P60A 4AD3A 1NOUA 2OZ3A 5K4ZA 1FH9A 2D20A 3NNTA 2EG8A 4UFHA 2FH6A 5LXXA 2H6RA 3VYLA 3DK8A 2CFYA 1EEXA 4O1FA 2GJXB 1EUNA 5CPNA 1TMHA 1JPKA 4J35A 3CUGA 4HOXA 5DX7A 3TN3A 2QJMA 2D0FA 1F6KA 3L5AA 3VE9A 2UY2A 3KL0A 2WP5A 2QCDB 1YYAA 3WQ6A 2ZXBA 4Z17A 1ITXA 3VE7A 1PO9A 2DZUA 4XZNX 1TTQA 1CWYA 4C1NA 3MO4A 1M7JA 4PR4A 4WKFA 4R27A 2NXIA 4WGXA 1PAMA 4Y9MA 2FTWA 5D38A 4M7TA 3WD3A 1YMYA 5EKYA 4OIFA 4Q8UA 3WH9A 2FVLA 3ITCA 4LAMA 1FECA 2X30A 1RAKA 1HKKA 2Y8KA 3GFXA 5AHIA 9RUBA 1HKWA 1TPH1 2G3IA 3GG0A 3G1HA 3C8FA 1VRXA 3GC4A 2PDLA 3G77A 5C70A 4D8ZA 3GKFA 1PIFA 3OG2A 3NVZB 4RK8A 1FDZA 4LCSA 4DELA 4PULA 3ITTA 3CL7A 2PLKA 1B0IA 4IGMA 1EP1A 5AHLA 2PGEA 2EQDA 1FWNA 4MJZA 1OG0A 1WO2A 3CZJA 2OYLA 1RY0A 4TOQA 4O16A 2QHAA 4LANA 5DY3A 1EDQA 3V5FA 2QCLA 3IJLA 3SQLA 3S1WA 2Y7DA 3BCFA 2VD8A 4FNPA 1B3VA 5GJPA 3LCWA 1ISVA 3GH7A 2CXEA 4PUEA 4XZHA 3BK0A 3B8DA 2VX4A 4HN8A 1LLOA 1QATA 4S23A 1NWSA 1BSIA 4W88A 3BJTA 2R6OA 1KLYA 1F8WA 2CBJA 3N3TA 3WNMA 1AFSA 1BVNP 2WKJA 1Q7MA 3W87A 4HVXA 2ISFA 3CXBA 3MMTA 1O94A 3QMSA 5REQA 3GVWA 4KRUA 2FPVA 2QIIA 1XYZA 3CGTA 4N0RA 2IPFA 2ZRUA 3HZ3A 1K9TA 1H11A 2V5CA 1DJGA 3MMUA 4DNAA 2PDHA 3BLFA 3M0LA 3W7OA 4ICNA 3W1TA 3SIZA 2B7PA 4TMBA 4DXVA 4JTLA 4CCDA 2XVGA 4JTJA 1GRBA 3K2GA 4NYYA 4QG8A 3BARA 1QU4A 3N2OA 1QHPA 3JRKA 4C60A 4PMNA 5CG7A 3EKZA 4J2MA 1CW2A 1E70M 3U2ZA 5LNRA 3QGVA 2NV2A 4OBRA 3CT2A 3TYCA 2C3CA 2DIEA 1H7OA 2L5HA 3D9XA 1NVMA 4DYJA 2XGBA 4QSFA 3M07A 2XFFA 3QFWA 3ZLHA 5FF2A 1QOQA 2GQAA 3K4DA 4I5RA 3WDIA 3CTLA 4ZQOA 3QSTA 2C1GA 4WCJA 3NZRA 5FS6A 1K7EA 1B30A 2WSPA 3T2OA 1E1CA 2FZ9A 1UZ1A 1XBXA 2JFEX 1VFMA 4IMGA 2H90A 4GBUA 3LN3A 2A7PA 6PTDA 3HV8A 4H7ZA 1G4TA 4PL1A 5E0CA 3CV2A 4Q8QA 3DN5A 2NVCA 3IPWA 4D6DA 1C7TA 3VKDA 4C1LA 4A29A 2NQJA 1TG7A 4BY3A 1QHOA 4RW3A 4C6QA 4C1KA 1LZOA 5H2ZA 3NOYA 1BWVA 2CLMA 1MO9A 3BGGA 2E6DA 1FA2A 4IMAA 2AKMA 1U22A 1WDDA 3A22A 4QP0A 1HIZA 1QW8A 1YDYA 2X7VA 3W28A 1C8QA 1DORA 1STZA 2TSYA 4APNA 3ZQ9A 2VDHA 4XZ9A 3R8HA 2CLFA 2ZZ2A 4KFOA 1E0XA 1J5SA 1L8NA 2VUNA 2Z6IA 4NZ5A 3WH5A 3EDJA 3OVQA 4GQQA 4MB1A 2BLEA 5AC7A 4I9AA 3VOFA 3KUMA 4K38A 2QPXA 2CIPA 1CXIA 4M80A 3UPBA 3LQLA 5BU9A 1ISYA 4XZMX 4MWAA 3V0SA 1AOGA 5C2XA 2XVKA 3K46A 3AMDA 1S1RA 2NVKX 3EAUA 4ERGA 1BEUA 1WXYA 3RITA 1PYFA 4M3PA 4LY4A 5D33A 4NEVA 4CD8A 3W22A 5CGTA 3VKBA 1V4YA 3MMWA 2XINA 3MVTA 4C5YA 4R53A 1XYAA 2WOQA 5D05A 4JDYA 3GQYA 1AA1B 3HG3A 3EWZA 3H4WA 1P1XA 4C5ZA 4RV3A 5H6HA 4TVCA 2J7BA 3WSUA 4FA3A 1F05A 2O92A 2W6RA 4FLQA 1ZP3A 2J24A 3BLPX 3CLWA 4AZCB 5GPRA 1ISXA 2VFDA 2XTKA 4HN4A 1CLKA 3KHDA 4GVHA 1BXNA 5XIAA 1MQRA 3G0UA 4TXEA 3HQPA 4ZOAA 4ACYA 5JXQA 5CPSA 4EF9A 4JL2A 4U5KA 4R34A 3IVUA 3WQWA 5ECUA 2QYGA 2V5DA 4V1YA 5HWNA 4KT2A 3HFTA 1FWHC 1KFLA 5LNUA 4AWTA 3JS3A 4GI9A 4JR5A 5A5WA 3NQCA 4C6KA 2A0NA 2YVFA 2ZZCA 4UTKA 1PCWA 3DC8A 3EBVA 2OEMA 3P6LA 2EG7A 1R5YA 1YDOA 4FK9A 3B06A 2VR2A 1TE6A 1TZZA 2VD9A 2A6LA 2J13A 4NZ1A 3LZ5A 4ZXOA 4MB4A 3NURA 4QEHA 1J6PA 3ECQA 4ZZ9A 3SECA 3VI2A 4MLJA 4ZO9A 1MUCA 4FXSA 2XPKA 2QPUA 5IBXC 1KCKA 1OCQA 3LM3A 3UJRA 3RYSA 2PEVA 4QCFA 3L8KA 3A47A 3KLKA 2B0MA 3KM8A 1NHSA 2ICSA 4M51A 3P93A 4G7EB 4AZ7A 1TSIA 1UD6A 1J0IA 5J04A 1NPXA 4JCLA 3ANVA 4AZGA 2GQ8A 3B0XA 2ZZ7A 1KM3A 1I2NA 4AFYA 3GVQA 2EPOA 1QNVA 5K2ZA 5FF3A 1Q6LA 1XC6A 2ZZ3A 4J4KA 2QAPA 2VQUA 3R8RA 3A23A 2V68A 4UUIA 4AWUA 2G5WA 4EAMA 3WF1A 1W9DM 1AVAA 2QCEA 4P7NA 1WZKA 2PBOA 5REQB 2QJGA 3QHOA 4D2JA 3S2LA 5JMUA 4QX4A 3W2JA 5DY2A 3UJSA 5CJNA 1J11A 4HPJA 3CUJA 2ZRVA 2Z6JA 1NOFA 4ZA0A 4GUJA 3UWUA 1DL3A 2MANA 3I7QA 3TTEA 3BH4A 2C19A 3QY7A 4CCCA 2WOVA 4AHPA 4H4IA 1HJVA 3GXIA 4RPQA 2J8TA 3MSYA 3AZTA 4EPBC 3EA3A 2FZBA 3FEMA 1A0DA 3G3MA 1RR2A 4L4MA 4PSPA 3CIVA 1TPC1 4PMZA 3VK5A 3UNDA 3PWIA 3ARUA 1UMLA 3DC0A 2E4TA 2GH5A 1JI2A 3BO9A 1VCFA 5C71A 8CGTA 4XK2A 4P2VA 4E2VA 2XJ7A 2DSKA 3FSTA 2F7FA 1I8JA 3UWYA 4ZGYA 3CZLA 5HMEA 3M5YA 5I0DA 1AH4A 4X3ZA 1KM1A 1ZALA 5DO8A 1A53A 1OK4A 3WQPA 3UGRA 1HJSA 5EMMA 4PRWA 3VNJA 1L6SA 3C56A 3K1GA 2XSXA 3VX0A 1W5NA 1OG6A 3CL6A 2HPMA 1M6IA 2CCRA 1PV8A 4JIQA 3TFCA 2IPWA 3WDRA 1REQA 2J77A 2WMHA 5J5RA 1LT7A 1EGZA 4CCZA 1QFEA 2ZDSA 4WVXA 3RU8X 3WBWA 5K3VA 3AHZA 2ATMA 2H9AA 1PPIA 2G4FA 4IIHA 2QV4A 1O1HA 4N9DA 3A4JA 1YPFA 3I4KA 1VDVA 2YBTA 1EWDA 1I1WA 4HKPA 4NRRA 5KSWA 4MMWA 1GK8A 1DWJM 1IV8A 3K5XA 3CEPA 2HBXA 1UOZA 4CN4A 2YLLA 4DZIA 1UWAA 3OA5A 3S42A 3JZUA 4ROQA 2RGMA 4I5XA 2IKIA 3HIJA 1GEHA 4GI4A 1GRGA 4J27A 4C7GA 3PAJA 5M03A 3CH9A 5DT5A 1CGYA 5CZKA 3WELA 4HD5A 4Z2GA 1ODUA 4KRTA 1KFKA 2D0GA 3E12A 1ZDLA 1UH2A 1RA0A 2CYGA 3LGEA 3NSMA 1H49A 5I78A 1LUCA 3BJSA 3M0XA 4XSLA 1FTXA 2Z28A 2DW6A 1GETA 1J79A 1N5WC 1G4EA 2GSJA 3NQBA 3FDGA 3HPAA 3UY7A 3WQFA 4H4SA 1NU5A 1VR6A 4Q6XA 2FVMA 3P82A 3ZIZA 8XIMA 2CZVA 1S3TC 3ONBA 5HJYA 1GRHA 3HFYA 1Q6CA 3QYSA 3WG6A 4AVNA 3EANA 2PC8A 2ZDRA 2J8GA 2BVYA 2OZTA 4W87A 1SMAA 4WUIA 5HINA 1A5CA 4DQWA 2QS8A 2GVJA 5AZ0A 2WNZA 4L9XA 1F73A 3LQGA 1US2A 4NL1A 4F0RA 4BI6A 4WXZA 3V4BA 1NSJA 1EOMA 1V6YA 2CHRA 2HVMA 2RDXA 3ALFA 4UOQA 2F61A 3BXWA 5KZEA 1CLXA 1H1YA 1B54A 3W7KA 3I6RA 1VFOA 3BPWA 1CLVA 3H4GA 5D2XA 1IXPA 1ZJAA 2W92A 2QEZA 4CGTA 3QH2A 2AMGA 1JDAA 2AKZA 5BROA 1HUVA 4CNPA 1ZK7A 1TPFA 4QAIA 1L2QA 1OADA 4C6BA 4K8GA 3TQKA 1V3JA 1D9EA 1OCJA 4JYEA 2A2IA 1OGBA 4WF7A 3QV7A 4H41A 5DXXA 4WJXA 1UPMB 3V5CA 3DFHA 4WOZA 7TAAA 1W3NA 1LRNA 1B4EA 3SRHA 3LYEA 2Z29A 3T8LA 1XF0A 5E6YA 1DIOA 3W53A 3LPFA 1KFEA 3VDAA 4FX7A 5A6LA 3BG3A 3PZMA 1QW9A 3U0HA 1R46A 3KCOA 4GBDA 3W37A 2YFNA 4LB4A 2E6FA 2HNEA 1XS2A 4OGZA 2A3CA 5B7ZA 2DVXA 2ZUWA 4KGLA 2VQTA 1XH2A 3HPZA 4OFCA 3B9DA 3QGAC 2HMCA 1P4CA 1LROA 3W7RA 3PN8A 3GHRA 2RJGA 2LLEA 2JF7A 3GNPA 1UD5A 5HWJA 3KBVA 3O7UA 2F6KA 2EKCA 5CPOA 1ZAJA 2GK1B 5AFDA 1B9BA 1XG3A 3B0YA 3D46A 3WD0A 3ARSA 4ZCWA 1QI5A 1CZ1A 1HW6A 4JIEA 2WQDA 2JALA 3G6MA 1BYDA 1YADA 2Z1SA 4MY8A 2PWUA 5BXRA 2SFPA 2WZIA 4M6QA 3BSGA 2ACSA 1P0DA 2ISWA 2W5FA 3R0DA 3DFNA 2ZYFA 4IL2A 3WLKX 1N63C 3DFPA 1ICPA 1OFBA 3NVVB 4PUDA 1PDZA 2IXVA 3CO8A 2YVGA 3S6OA 3UZXA 1EHNA 1N82A 1AQFA 5CC3A 3W1XA 3RR1A 4B2DD 4LV4A 4LC8A 2Z1VA 3GXNA 3L2MA 4Q4QA 4ENLA 4CU6A 4IIEA 1G4SA 4RDYA 4TU1A 5IHSA 3D0CA 1PIGA 2POTA 3GHUA 3PK7A 2PDWA 2XH4A 1ADOA 2ALDA 4DVOA 3FEQA 5DLCA 5D04C 4HK5A 3SCPA 2Y4SA 2IKHA 3WQVA 3NPWA 2W54A 1TV7A 3CGBA 1DTUA 3C2VA 1OFQA 3K8LA 5EBUA 4WKAA 4O17A 1G1YA 3W1NA 1Z32X 3B8UA 3BSMA 1V0MA 3RLHA 4ADWA 2QDGA 4GPNA 1MNSA 3VIHA 1JRBA 4YVVA 3BOLA 2R9RA 3HPXA 4UXDA 3W73A 4M1RA 4FNQA 2ZRYA 3OP2A 3NGJA 4FAMA 4GQ0A 1QNOA 4EWJA 1M68A 3VZYA 3BE7A 2VGIA 4FB7A 1IR2A 5GRTA 1O95A 3LHWA 1QAPA 1E6SM 4UMCA 4AEOA 3WF2A 2MUCA 1UR9A 2O7QA 3PTDA 4D1IA 3GKAA 1J8VA 4FO4A 2XVLA 1XICA 2QDEA 3KVMA 5CPMA 2DFAA 4GI6A 4PE8A 1Q5MA 2XIJA 4Q8VA 1EO7A 3QZ6A 2WC7A 4XKMA 3NWRA 4MWAD 4NXKA 3NG3A 2Z2BA 5CSYA 2HQMA 3M43A 1T40A 3WMSA 4NT0A 3KRUA 3WZ0E 1J2BA 4XVDA 1FO4A 4OE7A 4O28A 4H6QA 1GHRA 3SN0A 3NVYB 1SFTA 3NM3A 1YKWA 3VZZA 3H12A 3U2EA 3CJPA 4O1AA 4U10A 4GI8A 3UT0A 2FKPA 3MZ2A 5JBFA 3VIJA 2WZHA 2TPSA 1JZ8A 2WV8A 3D47A 4GVIA 3SZ8A 2D3LA 2VDIA 5I2UA 5CSUA 4H19A 1EC9A 1FCQA 2P5NA 4K3ZA 3W7DA 4E4FA 4X63A 3N17A 5I3IA 1FWAC 5CC6A 1JYVA 3EF6A 2BBFA 3SGGA 1PIIA 1AODA 1Z41A 1UUQA 3WCZA 4D6EA 3NGFA 3N6HA 4KESA 1XDIA 5JBDA 3BLDA 4C65A 4Y7EA 1R9XA 2XIBA 4ZXLA 3KOXA 3GW0A 2X09A 3H2CA 3TROA 3U5UA 2Y8UA 1K7XA 3T1GA 1BVWA 5CCZA 3REQA 4US6A 4RW5A 1GVEA 2CESA 1LL7A 4HNTA 3LPGA 3SAZA 1BTMA 3HQOA 5A8MA 8TIMA 1XL9A 3DEQA 3EXTA 3R1ZA 4US5A 3NO3A 4ASTA 4ZB2A 4U31A 4PTWA 2W79A 1LBFA 2GGJA 1J0ZA 1VS1A 1NTHA 4MADA 1YDNA 2DIKA 2XVPA 3IC9A 3KRSA 5IDIA 3M0ZA 2I7GA 3CB3A 1F9CA 3ABZA 3M44A 2A8XA 4IG2B 4HMEA 4NZJA 3NQ8A 3P5YA 3UXAA 5MKGA 1MEHA 2BXZA 3U2CA 3CM4A 1TR9A 1VEMA 2PGRA 2PLCA 2NQ5A 1UC4A 1SM9A 4CEUC 4NJIA 2VRQA 1SZGA 5E9XA 3R0KA 3W7PA 3FW6A 3K8MA 5E5CA 1AMKA 3RK8A 1MNZA 5FJIA 3O16A 1Z89A 2YCJA 5BCAA 3CHEA 3EB2A 2OSYA 1DQXA 2BS9A 1MEWA 4MPKA 4ZENA 2V3AA 3PZGA 4AZBA 4W8LA 2WPGA 3HTWA 4L4PA 2D24A 3PZIA 2PWVA 1Q8JA 3ZYZA 3UR2A 4GC4A 3VCRA 1TIWA 1QO2A 4AD4A 4LFYA 3S1UA 1E5JA 1VQTA 1A0CA 1DKWA 1SR9A 5E0KA 3OLDA 3E6EA 3WD4A 3OJGA 3EWWA 1W8GA 2ALRA 1FRBA 5F2LA 2OLSA 1B3YA 2DSWA 1TUXA 4ML4A 1XR2A 4N4QA 2OODA 4LV9A 1ICQA 3A4WA 2BGSA 4XQ6A 4S3AA 4CQCA 3TA6A 3BANA 3OG3A 1POKA 4PL2A 1ME8A 4MKNA 4PB3A 1POJA 2V2HA 5EPDA 1RUSA 3AMZA 3R7MA 1HP5A 1Q6DA 1ZBCA 5AYXA 5HULA 1AW5A 4V28A 4J3SA 1ZGDA 3W7EA 4ZL1A 4GY0A 4ZOEA 3FNDA 4BS0A 1ZCCA 3D5HA 3P84A 1PTAA 4YTRA 3GC5A 3QPZA 2VELA 3LHUA 3EA2A 5FSEC 1XI3A 5GJMA 3SIMA 4NAEA 3IAPA 4EXBA 4HNNA 2H9AB 4OOZA 4B5UA 2VENA 1NP0A 2DPEA 4L5ZA 3WK3A 1DNCA 2HBVA 3IUHA 4GFSA 3AXKA 1CXEA 1E9IA 1Q1RA 4B90A 2Q09A 1OGSA 2ZZ6A 5CLWA 3JUGA 2J62A 4FSAA 3A4AA 1J01A 3KEHA 1W1A1 1DXFA 4AISA 3UNTA 4KGJA 5HUPA 4QQUA 2O9RA 1YE4A 1JGIA 1HVXA 1E4MM 1EPVA 2FDSA 4ZVJA 5LHFA 4ECLA 4IJCA 1V6UA 5EBAA 4B5XA 3W26A 1YPXA 2QF7A 4ZMGA 1XKYA 2VR4A 7TIMA 3TV8A 3IGSA 1EJ7L 2WMIB 1G9HA 3ES8A 5LNVA 9XIMA 4KCVA 5CEWA 3TR2A 5FCZA 2OELA 5HNNA 1VHNA 4Q4RA 2CKRA 4DJEA 1K77A 3EWYA 3W86A 3S83A 5DEZA 4X2RA 1LCOA 3VNMA 3QN3A 2WNQA 2WNNA 2AQVA 1ONFA 1WDQA 1EH9A 1D8CA 4F2BA 2W0UA 3W4RA 2R94A 1FY6A 4FDCB 4EACA 5C5YA 1K02A 1MUMA 1UWQA 3WUBA 2PDUA 4DJEC 4HA3A 4QR6A 5KZ6A 3STGA 2HPIA 4IP4A 1ZXIC 4EOUA 1EOKA 1DIKA 1S1PA 3NQAA 3B4UA 1VYPX 1P0NA 1OY0A 1LRTA 2WVUA 2INEA 4PMDA 1US0A 7CGTA 3RMEA 4E4PA 2OZ0A 5DN1A 1UPPA 5D9MA 5FF7A 4KEUA 4L7ZA 4PMYA 3HQNA 1QNSA 1AL7A 3IANA 4JTEA 4WHBA 4EQRA 1OFDA 3RM8A 2E8ZA 3E74A 2G96A 5TNVA 4P8WA 3APTA 1ZCOA 1SGJA 2X8RA 4G1NA 2CERA 4O18A 1KM5A 3DJGX 2ZUVA 2AQOA 3KZSA 4M29A 4LT9A 4LUIA 1V93A 3W24A 5A95A 3I3BA 2OT0A 2W66A 4B3ZA 4EQXA 4UMBA 1JCXA 2EG6A 2YBUA 3W23A 2WQPA 2DT0A 3DERA 4GMEA 4L1XA 1SFSA 2ZUMA 3TIMA 5EMYA 3LRLA 4J56A 2ZE0A 3NSNA 2Q6ZA 3WQ4A 2GGIA 4LJ3A 5CG0A 4ZR8A 1FUYA 4QROA 4R9XA 2V2DA 1F3XA 4YMZA 1XPGA 1KQZA 1UD2A 1W1ZA 5T9BG 1OX4B 1DJQA 3TW9A 3C0JA 3LXCA 5I00A 2WBGA 4JTAA 3WLOA 3WF4A 6A3HA 5MKGB 1M7XA 1N7KA 2HROA 4JPGA 4S3CA 3UJEA 1TQXA 1W1B1 3RCMA 3IJ6A 3EOSA 3MUCA 1GKRA 1UR2A 1GOWA 4YTQA 2OJPA 1R30A 4W7VA 4A8IA 2WVSA 1UIOA 1N55A 4WJEA 4B5WA 4NZ3A 1XLGA 1N61C 4A8LA 4TTUA 3QFBA 4LRTA 2OCZA 1YW1A 1IZKA 1J9YA 3W7JA 1XD1A 4GIEA 4M8UA 1JZ5A 3AU6A 3L4UA 1GVSA 3PZUA 4WOQA 4UQAA 4RXGA 2XH7A 2FGLA 3KBMA 4LAZA 1SFLA 1KA9F 4YHGA 2FHCA 2VURA 3RNMA 1U1JA 1B9ZA 4DJFA 1W3IA 2XUCA 4IFOA 4CQ9A 4GC3A 2DH2A 1TA3B 4IFRA 4TVDA 3UJ2A 1V6XA 2BODX 4AH7A 3LI1A 3UETA 2FYMA 4LU0A 1K9EA 1L6WA 3DGZA 4FLRA 3VOGA 4ZOCA 1D3HA 5D8ZA 3T7VA 2V81A 3W7GA 1ZP4A 2YDQA 1OQFA 5I3DA 4MSSA 1HO4A 4DYEA 1X7FA 4LCQA 3K1DA 2JGYA 1ME7A 3FAXA 1IIGA 4C6IA 4AEFA 4F2TA 4AB4A 2BXYA 3FA4A 3ME3A 1QI3A 3URAA 3H7UA 4JX6A 3U7VA 1WUFA 3TTQA 2VZSA 4HTYA 2VUYA 3EZ4A 4GYFA 2AL2B 3UA3A 3DZ1A 3NOEA 3FOKA 4A6GA 4MWAB 1V02E 4IQDA 1WDRA 1WA3A 3HJZA 4WSKA 3GSMA 1XGDA 3LG3A 2PDJA 3CAVA 3II1A 2ZFAA 2GJLA 3OPSA 4RZ6A 2WSQA 4NNAA 3UXIA 1GGOA 5FS9A 3E0IA 1LBLA 2P88A 1RV8A 4MNJA 4KCUA 5CGQA 5JCKA 3MUY1 2VVNA 4JIPA 3VIFA 4UTLA 2D3NA 3NQEA 3N11A 3U4FA 4LVFA 1KGWA 1GT8A 2FJUB 3TXZA 4XIAA 3CHFA 3CYVA 1PHWA 1XM3A 3IJ8A 3RNDA 4G56A 3T08A 3ZJ6A 5DBTA 5G5HB 5D32A 3OW1A 4ALDA 2ZZ5A 2Q3OA 1KCXA 2TYSA 3AIEA 2OT1A 1ALDA 1JF6A 4WD0A 4DM1A 1L6YA 2Y70A 2QVHA 3AXXA 4DJFC 4I9JA 2PZ0A 2Y89A 1C9WA 2OWCA 2R1MA 3W71A 1HP4A 1OX6A 4AC1X 4GA8A 1MW0A 4ILSA 1MEIA 4Z0JA 4PEKA 1FEAA 1Z42A 4DUOA 3TWAA 4ZQMA 2QMJA 2QCGA 4AD5A 3IUDA 3JW7A 3SQSA 5BWAA 4QG6A 2C0AA 4I8DA 5D09A 5CC5A 3LHTA 4F79A 2WWDA 2HCVA 2XH0A 4H4XA 1YQZA 4TX9A 4LIIA 4U2ZA 4GCAA 3UA4A 1M53A 2XHYA 1EXBA 3TAKA 4NY2A 4DF1A 2PPGA 2WMGA 3IJ7A 1A3XA 3R94A 3ABOA 3U6WA 3PBUA 3ETRB 3DGHA 3P5ZA 4O19A 3L65A 1TV3A 3CK5A 4Y2WA 3UR7A 1DJHA 2DT1A 4H6RA 4P8XA 1LORA 1TO3A 1TRDA 1UBPC 1UMYA 1JUEA 3FK4A 1FWCC 4H8HA 3QSRA 1PX4A 1R7OA 1A0EA 3W1AA 3P8IA 3LRMA 1EJVC 2HEJA 1U5VA 4B16A 3GC2A 2PP0A 2E8YA 3DHUA 2ACRA 4Q32A 1B3ZA 2QQ6A 4PUUA 4HU4A 5CXPA 4JX4A 4N02A 5G2IA 3L5LA 1MXSA 3CEUA 2Z0IA 2ODOA 3MW7A 4UFLA 3CZGA 1CNVA 4IZGA 1AD1A 3PS7A 1I1XA 4HOWA 3DHPA 1XC4A 1P48A 1RCQA 5D8WA 5U1OA 2OFJA 3PNUA 4PMJA 4GGHA 4YWIA 4E2OA 1S7MA 1T6MA 1WYIA 4HP5A 2YVJA 3QXBA 2ZX5A 4J5NA 2FZMA 2BASA 4Y9OA 3SCRA 1SO3A 2BNJA 5AYZA 1SJCA 3GG8A 5H8PA 3AYSA 3PZQA 4BQ2A 2PUZA 3BURA 1NP2A 2GZXA 3W07A 2FIQA 4MNLA 1DJNA 4LNCA 4A4AA 1JG9A 2PCQA 2WMJA 2VZOA 4MJMA 2QPSA 3TMLA 3VO0A 4GNKB 5BNKA 2UY5A 5L6UA 2IQTA 3V36A 3G1DA 3ARQA 4PZVA 5H91A 1WBHA 4E4UA 3WYZA 5F4WA 4EK7A 1QJWA 1WZAA 3OBAA 2OMAA 4ZOHB 3QHMA 3WK0A 1WUEA 3N2CA 4OU1A 3SGZA 3IIXA 3MS8A 1BXCA 4LS2A 2DEPA 3KHJA 5TAOA 2NQZA 2WO5A 3EX2A 3S9IA 4OKDA 2CLHA 1R7AA 2ON3A 3WH6A 2X7WA 4KETA 5AHMA 3WQCA 3GTIA 1E55A 4FLOA 4WKHA 6CGTA 5U7SA 2NLIA 3AMKA 3UERA 1EYWA 4N6FA 1CGXA 1BQCA 3AIUA 1TMQA 5DMMA 4CN6A 4A8NA 1EX1A 2ACQA 2YR1A 2JEQA 3S1GA 1CCWB 3STEA 4H4QA 2IKJA 5LIWX 1BWCA 2VCBA 3G8RA 1R3TA 3NQ2A 3KL3A 5A94A 2CITA 3E02A 1JRCA 4TIMA 3IGXA 4IXHA 1BKHA 3WLIA 2PDBA 1UKQA 4EANA 3SM0A 3N6QA 4CD5A 4ZE4A 1V6WA 3T78A 4HBKA 3WJYA 1OT1A 4ZQRA 3I6EA 2OU4A 3E2VA 3VMOA 1SR0A 4Q4KA 4PBGA 2BV9A 2PAJA 5C7VA 3VNZA 3Q2DA 1OF6A 5IHRA 1IXNA 2PI6A 4W8BA 3RU6A 1X39A 3LD5A 3BWWA 4GO8A 2RABA 3GLCA 1NF0A 1CXHA 1LJYA 4TV6A 4IHCA 3O0KA 3C61A 4QCEA 2C7FA 3GTHA 3WFAA 1KQYA 1FDYA 2VFHA 1Z8AA 1U5JA 2CKSA 3D6NA 3SY1A 5CAKA 5A6JA 2W4XA 2C16A 5JBEA 3SRFA 3L7RA 4LPCA 3MCNA 2FFIA 3DKJA 1HTIA 3GXMA 1T8QA 1QNPA 3LDVA 5EMJA 3BAKA 2CFFA 1BF2A 1WDWA 2QV5A 1XQKA 5G5IA 2WLYA 1XX1A 2RDWA 4IPPA 3BOFA 3CWHA 1W9BM 1W32A 1UR8A 1QXLA 1YDVA 1XGZA 3F4DA 1QWGA 5BU6A 3LCGA 1A3WA 3TFXA 2WZTA 4AZHA 1S3HA 4B15A 1QVBA 3NZGA 4TO8A 5BOOA 3LB8A 1ZMCA 2DZTA 3ABRA 2DUZA 4WDTA 2DVUA 4DUXA 2PRMA 4MKVA 3H54A 3C2YA 1ONXA 2I14A 4RX0A 3THCA 4S2CA 3W1RA 3VABA 1EZ2A 1AW1A 4PN2A 3FJ6A 2QNEA 2E1DA 1GTHA 1Q6GA 4IPNB 5CSSA 4D6IA 2NLYA 5HBFA 4G7EA 1W5OA 4LAUA 1FWWA 1TTIA 4JTSA 3GDTA 1R3RA 2J78A 3P74A 5BXTA 2DQXA 3IIZA 3L4TA 3UVIA 3VNYA 4UOJA 3KL5A 3QM3A 3N14A 4HJWA 3FY1A 5JH1A 3A9BA 5FJPA 1NJJA 3W27A 1QTWA 1TJPA 4QLJA 3LXDA 2ZX7A 1GOXA 1MW2A 3NQ7A 3MBFA 1VPXA 2VKZG 1UA7A 1H7XA 2VT0A 4XUYA 1MXGA 5JIPA 4GHRA 3ITYA 2E9BA 1WAWA 3F7JA 1GOKA 1UP0A 1A49A 1VC4A 1GZ1A 1V77A 5FOOA 2P76A 1QHZA 2BB0A 4XZBA 3BGJA 4PA8A 3LSBA 1TPVA 1DWAM 3CNYA 2Q8LA 3CL8A 4A2SA 1K9DA 4C6MA 3CLMA 4UTJA 3LHVA 4LBSA 4TR9A 4HQVA 2WHMA 1TE1A 2F84A 3PM6A 1E4NA 5EY5A 5G4HC 2F6UA 4NAFA 1A5OC 4C7DA 2XG9A 1WCGA 5AHFA 5ABFA 1ZAIA 4GVGA 3UD6A 3THQA 3L66A 3BLOA 4PUWA 3FV9A 2G3JA 4O4WA 3QLLA 3R58A 4DO7A 4HSNA 4IP7A 3BGAA 3THAA 3S5NA 4ZQNA 4XTDA 4DXXA 1A47A 3U3HA 2R91A 1IEXA 4DAIA 3MYOA 2WBAA 2J3NA 3FFSA 4YVPA 3BLIA 3EDFA 1UA3A 4ZODA 2E40A 5A6BD 2DQWA 2WPBA 1S5VA 1JZ2A 3K4AA 4A35A 1H41A 1KR1A 3CZEA 1E5NA 4OBTA 1WXJA 1QR7A 1BRLA 3RLGA 3VD4A 4BF7A 3NEHA 3DGBA 3LV6A 1GHSA 4Z2JA 5KTLA 3MWAA 3RRXA 1K8XA 4FIQA 1GG1A 4R7OA 3STFA 3PBMA 4H9VA 3TN4A 1IZCA 2E28A 5BXSA 4FNSA 1F3EA 3T81A 3CIXA 4LTSA 1V6VA 1I2PA 1LF1A 3FVDA 1S2VA 4JD4A 3DU0A 2NX1A 3GUWA 1VJIA 3DG6A 1JNDA 3CAWA 3N4AA 2XSAA 3NUKA 3FGCA 3NRZB 1E0UA 2GVLA 3TYZA 2E9LA 5C9XA 3BICA 3WQOA 3C0QA 1N2VA 3WO8A 3H55A 3G0XA 2HV5A 5E6ZA 3W7NA 4LA1A 4PCSA 1V97A 1JQVA 4W7UA 1GQKA 3H2EA 3CXOA 3VDBA 1BG9A 5CC7A 4LUTA 3MKVA 1UR0A 1HXJA 2A3AA 2J6XA 5KETA 2GSEA 2AL1A 1I4NA 3VGDA 4J3UA 3TC7A 4FX8A 4NAFB 3WQ5A 2P3ZA 1SYTA 3OZYA 3UW6A 1EDGA 2D1ZA 3AWOA 3EWUA 2XIMA 1CGUA 3D3FA 1RK6A 4DPPA 1XSIA 3NVTA 2E5BA 3V5OA 4OECA 3DIPA 1R3WA 3TYBA 5EMKA 4S1FA 2CDUA 3QTPA 3KVLA 3NA8A 3PPHA 3V7PA 4FF7A 1X38A 2B7QA 1K7FA 2IMRA 4AEEA 1SW7A 5AHNA 4KW2A 3TA9A 2TRSA 4CU7A 1UASA 4RV8A 2WMIA 4IJRA 1HL9A 2NV1A 3TNOA 1RD5A 5DMYA 5D9PA 4K7ZA 4GYPC 1H0IA 4ERIA 5ABFB 1PXGA 1VFSA 3STCA 3XISA 2OR2A 5KZDA 2XN0A 5JU6A 3M0IA 4FOJA 4NASA 1TELA 3NQDA 4TQTA 1P1MA 2BFGA 2BOEX 2ATSA 1GPWA 1E40A 4LCRA 4UFKA 4GZIA 3OIHA 3VIKA 2I1OA 3CQKA 2HK1A 3WJSA 5LSMA 2ISVA 4C91A 2R1NA 3VZXA 4F48A 1OD8A 1AH0A 1HL2A 1XFCA 3PZVA 1JJKA 3CMGA 2ISDA 3AM9A 2HXTA 3VIPA 1GVIA 3GFYA 1BSLA 4XAYA 3DFQA 2DT2A 5LHEA 3EGJA 3HGJA 3FA3A 1X8CA 1EBHA 4IGSA 3UZ5A 1IEWA 1GOIA 2GR0A 3DI0A 1KD0A 1RJQA 3S8HA 1MWOA 3AI0A 1Q6RA 1LQ0A 4INFA 4RNFA 4KEZA 2DP3A 5D03A 3N2XA 8RUCA 3ELFA 3GXFA 4YYCA 1NWTA 5A6MA 5HMSA 1PZ3A 3CV1A 3OYZA 3KBNA 2QF8A 1KTNA 2GOKA 3E1F1 3W74A 3UY8A 3KLLA 1B1YA 3HG2A 2D2OA 3TEVA 4J3ZA 1BRLB 4JTRA 3WJZA 2E3ZA 2RKXA 3TQVA 1KV8A 5I02A 4DWSA 4F0LA 5AN7A 1H3GA 3WQEA 1VAHA 4X2PA 4BI7A 4ADSA 3EA1A 4PH6A 2YA0A 1D3GA 3LCFA 4A3UA 4GX9A 4JYFA 3UF9A 1DXEA 2DY3A 4AVOA 4PTNA 1YTDA 1GVFA 3B9OA 3ZR5A 3KZPA 4U3CA 3GU1A 1OINA 4EAYA 3KOYA 1R3QA 3EOUA 1X97A 4UOZA 2QKFA 1DJWA 3LGDA 1K4GA 1LVLA 3IS4A 3NZ1A 3GWQA 1VFLA 2YW3A 5A2CA 1U83A 4K7VA 3R12A 3RHGA 3CGDA 1S2WA 1RK5A 1PKLA 1JDEA 3RXZA 3C8NA 2BVTA 1FQ0A 2H3DA 4F3HA 4S3KA 3SCOA 3VTRA 4YTTA 4HA0A 1PWLA 3GU9A 3REQB 1HKMA 1PEZA 3L4WA 3SUVA 3B3DA 3PWAA 1FHDA 1BWLA 3DXIA 2NUYA 3RGTA 1XIIA 1YNQA 5D02A 4I7VA 3UR8A 3KP1A 4AHQA 4DBEA 3AQUA 4XV0A 4LXFA 3LCXA 4LH8A 4N7QA 1NWUA 4NQ1A 2JKAA 3E2QA 3DK4A 3FYPA 1IXQA 1XIHA 3LY0A 4XD6A 2P50A 1R8LA 1HF6A 1V03A 1KRCC 4C6LA 1XP3A 4H6KA 2WLZA 3OGSA 1Z7AA 3ITVA 1VBHA 3EXSA 4UTTA 4QISA 1KM4A 1LQAA 1DHPA 3H2AA 3CS2A 2YXXA 2PDGA 3LGGA 4O14A 4QSHA 3QTGA 4B3KA 3NQGA 3TVAA 4BFAA 3NSXA 1JOAA 1WAUA 4A2RA 3AHXA 4JNMA 3UG5A 5B80A 1B3WA 3LB0A 1GUVA 1E6ZA 1VFHA 3BLLA 3K30A 4LRSA 4UNIA 4A3QA 1A5UA 4PMXA 3QV6A 5AVNA 4KH2A 1UUMA 1JGMA 1NH6A 1J0HA 4QIUA 3PPFA 3BTNA 5AC8A 4KF1A 4MGGA 4RUBA 1MXDA 1NDYA 1EKOA 5HXMA 2EKGA 2GJRA 1UKSA 2GQ9A 3AMGA 4JS3A 3LXBA 3N1AA 4C6CA 4XO7A 4DBUA 1IE7C 1D8WA 4QAWA 4YVXA 3NYDA 2XU2A 2WOWA 4HHMA 2CZFA 1O5RA 1X1NA 2YDRA 1ZMDA 1J5TA 4EPKA 2VHLA 4US5D 1O7AA 4Z08A 3ZJ8A 4D8AA 1W1IE 3KWXA 5RUBA 1U2YA 4TTGA 3FVMA 3NTYA 3CPGA 1UD8A 2Z2UA 1XBZA 3S9ZA 4W93A 3I68A 2XFWA 3PG9A 1JPHA 2OOGA 3HMCA 4H9TA 5KINA 1OBAA 1EQPA 2EJ1A 2DH3A 1JZ4A 3HRDC 1H7NA 1JCTA 1F74A 1TVLA 4Z1DA 2QUMA 3GG7A 4JKMA 4RPPA 1ZS2A 4OQVA 1BXBA 4AX7A 1IWAA 3NL6A 4E3VA 5JH2A 3AYTA 4H83A 2YXOA 1LOQA 2A3HA 3NDYA 4S3EA 3CH0A 4WRHA 3VD3A 3KBWA 1YLVA 2Y7EA 2NW0A 4IM4A 4G8TA 1D7FA 4A21A 4L6HA 3TDFA 3EEGA 3ARTA 4UTMA 4PTXA 4HMNA 1K70A 2E09A 2QJNA 4DWDA 3W7CA 1CGWA 4B2DA 3WDJA 2GVYA 1K8CA 3O63A 1R38A 3SURA 3NDZA 4JFVA 3FSUA 1DVJA 3LLDA 3WENA 1EL3A 2FPYA 3ZXWA 1MOKA 2ABAA 1XLEA 3MVIA 1PSCA 3T07A 4ZE5A 4FIRA 3IIVA 4IMFA 4QS6A 4JYDA 2YZRA 2QCHA 1SZNA 2PDQA 2O56A 4S38A 3N4EA 2POZA 5EBKA 4P7OA 4F40A 5JCNA 3HG4A 1HFBA 3S5OA 4HZMA 4O54A 4V2XA 3RIKA 3H23A 4AY1A 4MY1A 4H4PA 2JIWA 4YPJA 1DJYA 2YPIA 2QCNA 5FJOA 2G4JA 3FIGA 4O1EA 8XIAA 3PG6A 1KM0A 3WNLA 3KFTA 4L64A 3F4CA 1EUAA 1XSJA 4NRSA 2O9OA 1L9WA 1TWWA 2RDUA 3QR3A 4D8LA 4FPSA 2Y8VA 1VRDA 3PBYA 2BC0A 2H8XA 1Q3NA 4Q8TA 1J10A 1VYRA 3GS6A 2WHLA 4JFWA 2RH9A 1HKIA 2QVNA 4WR3A 1CGVA 2A79A 2WPCA 1MRAA 3TKFA 4AU0A 3GW3A 3G1FA 1P0BA 1RBOB 4KIRA 3S2JA 3QV8A 2AAMA 3UU0A 2A7RA 3RCYA 3ZWTA 1DQUA 5DRCA 3SR6B 3TH6A 2BVWA 3LRKA 3FJLA 3LHZA 3IJIA 3TZFA 3BCDA 4C6FA 3LV5A 3T0TA 5FA5A 2FB2A 5C2CA 3BVJA 3JZEA 2EF9A 3SCWA 4IPJA 4H4YA 4ZO6A 1OFRA 1SMDA 4O1BA 1KFCA 3WJXA 4O10A 4E2DA 5C55A 3TC3A 3W1PA 2Z24A 5TQLA 2PU0A 3OBKA 2D2JA 4EIVA 1LT8A 3IV3A 2VRJA 4OVXA 4G2DA 3OA3A 3CGEA 1GRFA 1AW2A 4XSMA 3WQDA 2RHGA 4HB7A 4WZHA 5B7YA 1E0TA 4M82A 3AS0A 1WKEA 3IIOA 1OF8A 3MKKA 4KWSA 1CX9A 3QBUA 1US3A 1H60A 1S46A 3TNBA 4E6MA 2Z25A 4PC8A 4CQ8A 1ZZMA 3APGA 1X2GA 4D6HA 1YNPA 2BWGA 1LBMA 5HNTA 2YCEA 1DEDA 1M3UA 1Y5XA 4W5UA 3FXYA 3EMCA 1NELA 1XWYA 4BCEA 1EGMA 1O66A 4WLCA 1W8SA 3A4XA 3RM9A 3EWCA 1TX2A 1KM2A 4J3TA 3KVJA 5F4SA 3GUGA 1AL8A 2W3SA 1C90A 1P7TB 5I3FA 3MSGA 2XVNA 2HDJA 1R2SA 2QXWA 4JHOA 3W75A 4BQ4A 1Q1WA 3GD4A 5DFAA 4R7WA 1MW3A 3MHFA 1XRTA 4Q4PA 3ZFHA 2VC5A 4GUHA 1Z48A 2WC4A 1CXKA 3T2QA 1MRQA 4W7WA 4RNJA 4YTUA 3GRSA 2GGHA 3QMRA 2ZZ0A 3DESA 4I7UA 2D23A 1SPQA 3G1AA 4RZBA 2VWTA 1EJSC 1FWIC 3BV4A 2YL8A 1G4PA 1A5MC 1JYNA 4B5SA 1REQB 4UWMA 4OT7A 3MMDA 2YKKA 4IIDA 4GUIA 2DUAA 3GNRA 1ECEA 5DXYA 1XH1A 3N29A 4PMOA 1H2IA 4JTDA 3SSZA 3RJYA 1NFPA 4URIA 3BZGA 4NZFA 3NEVA 3PJUA 3TONA 4IGHA 3ZM8A 3AHTA 1MQPA 2XISA 4AIBA 1D2KA 1DHKA 5I3KA 3BLKA 3OYXA 4OUEA 4IIGA 3CQHA 7REQA 2AGKA 3VMPA 3H53A 1AJ0A 1H1ZA 4K1WA 2XN2A 2BY0A 1XIEA 1V8EA 2BZNA 2UY4A 2GGEA 3GH5A 2X2YA 2FH8A 2GVEA 5DCEA 2Y0FA 3UJFA 2VC6A 4BI5A 4N9EA 4X0NA 2B4GA 1FCUA 1XYLA 4PGLA 3SJ3A 4AF0B 4JTCA 1J12A 3K8KA 1T99A 1I2OA 2XDFA 3L0KA 2W61A 3EMQA 3W88A 4PCNA 2NT1A 5A8OA 1V6TA 2IPJA 6TIMA 1NDVA 1SZRA 4A05A 1R3VA 2Y1HA 2A3BA 1Y7VA 3SCVA 5TBOA 3SY5A 2AOSA 2KZHA 4NUWA 4J3WA 4ML9A 4LB3A 1AZ2A 1BWKA 2PA6A 2RDTA 4GIAA 2DT3A 4UQCA 1XLCA 4DJED 1OC7A 2XFYA 1IHIA 4EM4A 1M7PA 1V3KA 4HHPA 1KV5A 1FDJA 1QO5A 3SDOA 4HNCA 4BHYA 3ANYA 4O0QA 5AY7A 4ZSUA 3BW4A 1O1ZA 4GZEA 2G0WA 1JULA 1ZB5A 3N73A 2E68A 1X6NA 1QBBA 1RZMA 2JBMA 4B5NA 2VMFA 1H4PA 5FL1A 3NQMA 2UY3A 4WK9A 1NAL1 4Y9PA 1LP6A 1UP3A 1DWGM 2IUZA 1IT0A 3BQ5A 1TZ9A 4G7FA 1K6WA 5CZ0A 3CV6A 3UYCA 3AC0A 2X42A 3U8GA 2NWSA 4WJ8A 2R8WA 1I60A 1ZAHA 4CQBA 4H4RA 1SUXA 5ER0A 4F4RA 3C0LA 3DYPA 3ZLGA 1EC8A 1M03A 1QK2A 3ZVIA 3PVFA 1P6BA 2X41A 3U57A 2ZUUA 3B8VA 1N8FA 4ICCX 4RZ5A 4MG4A 3W1LA 5JCLA 1GONA 5FKYA 5LIUX 4A3YA 1UZ4A 3BL3A 4DJDD 3L4ZA 3GTXA 3ES7A 1Z6KA 1JEHA 4U5IA 3LLXA 3GYCA 1K03A 1UWIA 4UR8A 1D7YA 1HO1A 3CBWA 1OYCA 4GZJA 2E3TA 2QZRA 2C0HA 3COTA 3USZA 4NZCA 4FOKA 2DW7A 2CU0A 3TTYA 4AZCA 1WDPA 1ZY9A 1E51A 2X1SA 3G24A 3NR0A 1W9VA 1PTDA 1CTNA 3PFMA 5FEXA 4I6VA 3O6DA 1XKJA 4GX8A 5FD0A 3NS1B 1E6PA 1XIFA 2ZE3A 5HANA 5G1YA 2CEQA 4HMDA 1JVNA 1EWEA 3MHUA 1FWFC 2EQ7A 3NQFA 2HK0A 3QYQA 5FMHA 4HU8A 3N34A 1E0VA 5C54A 1WNOA 3ZJ7A 3HGOA 3HMJG 3LU2A 4JQ2A 3QR1A 3PP7A 4GE8A 3UG4A 3B9JB 2E5CA 7PTDA 5TR3A 4R88A 2ZADA 2WHKA 4ZO7A 3C2OA 3AO0A 5I23A 2OWXA 4JBRA 4FR6A 4BQ5A 1M65A 1UJQA 3GX9A 1LOLA 5I79A 3ZMRA 4UR7A 3DBPA 1OB0A 4QDPA 3OLIA 5T8GA 1CGTA 4MDPA 1Q2RA 2YJQA 4GY1A 1QPQA 3MO7A 2NQ9A 3MQTA 3G1YA 4DBSA 3TK7A 1FWDC 1O60A 3R25A 1KXTA 4ADTA 3NZQA 1J2WA 4KEMA 1QT1A 1TZ7A 1ZRQA 2CC0A 5A6BA 2PGWA 3SQPA 5AC6A 4G1KA 4BJHA 4H3DA 4C6DA 3W72A 2QUUA 5IBXA 2WW5A 4L4OA 4S2BA 4Z42C 1JFXA 4OWGA 3L5OA 4WDUA 1XIDA 3V18A 4AY7A 3IAQA 4ATWA 1HJXA 4CNSA 4AXKA 4FR1A 4I9TA 5FJJA 1E9ZB 1UUOA 3QQWA 1VGAA 1PE1A 2GR3A 1TVPA 4X61A 4GNJA 1WV2A 4AF0A 4N42A 1H63A 3AROA 1TWIA 3GG1A 5A8QA 2V67A 3PNZA 1E3XA 1UR1A 1ENUA 4NJHA 1O4UA 2WOIA 2PZNA 3C3UA 3C5QA 3HB9A 3SCTA 3L68A 5GNZA 3T0DA 3PC0A 3DJJA 1Q6OA 1Y0EA 3KLJA 3GY1A 2E77A 1GZGA 1EP2A 2B7NA 4K2SA 5A6AA 4FX6M 3GDLA 3CWNA 4JTUA 4CN1A 4DX3A 4O0ZA 2OYMA 3RDKA 2OSWA 3KVKA 3M0KA 1K4QA 1DXLA 4GYPA 3AU2A 1GW1A 2FVKA 4PUKA 3DX5A 3QV9A 4DF2A 3JR2A 3F4NA 4GQRA 1I45A 1LG2A 3UBPC 1ECQA 4ZBCA 2QUNA 1ZUAX 1VF8A 4AD2A 4WY0A 3S1VA 4DI8A 4AMCA 1TJ1A 3HF3A 3A64A 4S3GA 4NVTA 1J96A 1DOSA 4ZQCA 1JROA 3S46A 1OVDA 2EPMX 2BY2A 2CLOA 2GLKA 1M04A 5HMDA 1UOKA 4GIRA 3IIPA 2F2HA 5JRBA 1R6WA 3MBDA 4ZQPA 1UQYA 4Z1YA 3VIIA 1GG0A 3W70A 3RO6A 4NEWA 4K1GA 2A6NA 2QJJA 1GORA 2VGGA 3SCQA 2PTXA 1VPYA 2W67A 4DZAA 3KXQA 1U1UA 1XRFA 3WIJA 1YEYA 1W3JA 3AFBA 4JQAA 2XH2A 2WKLA 5BW6A 1IT8A 1DV7A 1TTPA 1EF2A 4YTSA 1Z3NA 4JFSA 1VENA 3CTTA 3L21A 2BHUA 4L4LA 2Y24A 5BXPA 1V3IA 5HATA 1I2QA 3CPRA 3DYOA 4A3RA 2QR6A 3GAKA 2GOUA 4L9YA 2NX3A 1JCMP 4MJ4A 1KC7A 4ATLA 2GGGA 1EB3A 3G2GA 3VCCA 1XDMA 3GNXA 3VNIA 1V51A 2GDVA 3TJLA 2PTWA 3ATYA 1CB7B 3BAYA 2KAUC 4H8VA 3M46A 3OODA 3N9KA 1H5VA 1JF5A 3LMYA 4YIWA 2A85A 3O8AA 3VILA 3GDMA 3MJMA 4E2BA 3DCPA 3TMQA 3RILA 2HS6A 3OHMB 3DKLA 1E6XM 5C0QA 1OX4A 2YB1A 3ITXA 1TCDA 4LBRA 1O12A 3UZJA 3E2SA 2WXDM 3DBNA 4DNHA 2ISSA 3B9EA 1G5AA 2A1YA 3OU8A 2O0TA 2CBVA 2BX7A 1UD4A 2E5AA 2OQHA 1JDCA 4JDBA 1W17A 1A3HA 5HNUA 2YIHA 1PUDA 5A6KA 1EGVA 4QDMA 1EBGA 5G1MA 5LYRA 4TVYA 3PTMA 4DUWA 3URBA 2J7HA 4I5UA 3LPOA 5AC5A 3NZPA 4JL1A 1HQTA 2D22A 1XISA 4RDWA 3TW6A 4QJ4B 3R89A 1E3ZA 2XSBA 3L2LA 4NU7A 3A5VA 3WQ8A 3GRIA 5G4WA 1MZHA 4XD5A 1TJ2A 3UYIA 1CT5A 3OZPA 4GXPA 2OGYA 2NT0A 2PWFA 3AIRA 3UCQA 4HIBA 1OSEA 3R6IA 2G97A 2X0SA 3VGFA 2CHNA 4FALA 3IJQA 3ARVA 4WSHA 2OOFA 1W91A 1FHUA 4WIWA 1CBGA 4UTHA 3CUZA 1QPNA 3R2GA 1GVRA 3UCDA 3OGVA 3T05A 4KQNA 1WZLA 4O0KA 4FXJA 1AMYA 2REQA 1V3HA 7REQB 1OFEA 3W7HA 4OBSA 3OLEA 3S5YA 3VXGA 2J9YA 4EM3A 2BHYA 2EO7A 2YW4A 4R33A 1MZRA 3PHAA 1VP5A 4W9TA 1JYXA 2WCAA 2Z1KA 4JN6A 4CVUA 2NQLA 4JFTA 3WUFA 2X2GA 1JR1A 1B90A 1K6AA 2YA2A 3L4VA 3I3EA 4JTHA 1V3MA 4HYRA 3ENLA 4QE4A 1MI3A 3NL5A 4PTDA 4BK9A 2V3BA 3KS6A 1JYWA 3OBEA 2WM0A 1TJ0A 2J8FA 1K1DA 2VEGA 3NPVA 2GQ3A 1KKOA 2CZDA 5CBJA 4AX6A 3WUGA 3EOOA 3QOKA 4XAZA 4MAVA 1W3KA 4IPIA 3G1RA 3MU7A 4PCTA 3CO4A 3DUGA 2BOFX 3EDKA 2WKGA 2PDCA 1GKPA 1E4LA 1L6GA 2A21A 1W3LA 4FP1A 1MVYA 1GQJA 4EE9A 4EQWA 2GJXA 1ELSA 1G7VA 3AHVA 3EKLA 1R0MA 4UZUA 3N2TA 2F38A 4EP8C 4LBUA 1SO6A 1L8PA 5CZTA 5KMYA 4X9SA 4F2UA 5HQLA 2NUWA 3GTFA 3LSCA 5BRBA 1QW7A 1PVNA 3FA5A 4UTIA 1MDLA 2YDSA 1XBYA 3GIPA 2TODA 4L1WA 3KTSA 1VZWA 3MV11 2KX9A 5SWUA 4AY8A 5C9RA 5K7JA 3T8QA 2YOCA 4NNCA 1FWEC 1OT2A 1X2HA 2VEFA 1EC7A 4HPHA 4BQ3A 4WY0F 4MZYA 2VX5A 5FAGA 2OKOA 2E67A 4BV6A 3GR7A 4C6EA 4FNUA 3M1ZA 5HJXA 4AAJA 2NVDA 1X8FA 1JAKA 3CIWA 2YLAA 5MHBA 1VHCA 3RRAA 1W2PA 1C9DA 5G4EA 4JQ4A 3SFKA 1SW3A 1RPKA 1TVNA 5CQ1A 3FLUA 3MDUA 4QDWA 1OYBA 2ZRXA 2PC4A 1XGEA 3EWXA 4NHVA 1WKDA 4PODA 1G01A 1BFNA 1NHPA 4DBDA 1ISWA 2ZOXA 4F9DA 2YCLA 5IFPA 1XQLA 2JKEA 3Q94A 5F4XA 2JF6A 2Y5JA 1F4HA 3L0NA 2OSXA 2ZUSA 3SEPA 1YTEA 3ZT6A 4I90A 2Y5EA 4DWSC 3PTQA 2X0HA 4DPQA 2DV0A 3U48A 2J27A 3C2EA 2PTDA 2ZBTA 1NIUA 2PCEA 3Q67A 3DFSA 4Y90A 3S1XA 2GR2A 1E1CB 2FB3A 4MZ8A 4NG3A 5D2TA 2BY1A 2C1HA 1I75A 4QLLA 3Q4DA 1XANA 3VC6A 1VBUA 3O6CA 1UZDA 2PB1A 4LWWA 4GY7A 1RP9A 2DDXA 4ICMA 1OIFA 3SJNA 5KZMA 2DZBA 5CH9A 2VYOA 4YHEA 1TRIA 5ABTA 2WCSA 2FHFA 1M01A 1IEQA 2OZ8A 4UFMA 5T26A 3M9YA 4JKKA 2WYSA 1AJZA 4N4PA 2V2CA 3KDOA 1XCXA 1B4KA 4HSHA 1NHQA 1KM6A 2UBPC 4CD7A 1Q7ZA 4H00A 4YCOA 1EDTA 4JICA 2EHHA 2OO6A 4PUNA 4LEFA 4Y6GA 3TQPA 1UB3A 4AVFA 3I7RA 2E6AA 4F8XA 1NFBA 1RM6B 2JK2A 5CJMA 1EX5A 1B3XA 4AZ6A 4J1OA 4UTFA 3SGUA 5C9WA 3BAIA 1KBJA 3MHGA 3PJXA 4XTIA 1W5QA 1C8YA 4QE1A 3NIYA 4UR9A 4OHQA 4AW7A 4PMUA 4N9BA 1RLDA 1W9UA 4HSOA 2C79A 3T42A 1A80A 4W84A 1M5WA 4IGNA 2I17A 2C18A 4QHRA 2W27A 4L6DA 3PZ9A 4ACZA 4YCPA 1IXOA 4PCFA 3OHIA 1EO5A 2YL9A 4X0VA 1JRPA 4MYXA 5DQPA 3VUSA 3S9YA 2WMFA 2EGZA 2CHOA 1ONWA 1RQHA 1I2RA 1KRBC 4MB3A 4DLFA 3R43A 4GH3A 2XFRA 2WAGA 4PTMA 5K9CA 1CB2A 5FACA 4L61A 1T0OA 4UZSA 3XINA 3GDKA 1LWIA 5FS7A 1X1OA 3W38A 3AIBA 1E15A 2J25A 5HUOA 1R3SA 3TJIA 3E38A 4WXYA 1IEVA 1P6WA 2X50A 5E1QA 3FCPA 3HGSA 4NILA 2DSVA 1Q45A 3LXAA 5CLTA 1RP8A 3IVSA 1MDRA 3TTSA 3W1QA 3OIXA 3UP8A 4GXMA 4B3LA 3II4A 2DSUA 3C2RA 3SUWA 1CDGA 3NVWB 3SRDA 1RCXB 7ODCA 1VFUA 2PDNA 2IQDA 3GZ3A 1Y5WA 3KBJA 1LYXA 1TREA 4CNTA 4MNKA 1OZMA 4OZOA 1TTJA 4HCLA 1QRQA 1B31A 3LOTA 2J4GA 2YA1A 3DAQA 2E9MA 3KP0A 2INFA 2OLHA 3CZ8A 1X6UA 3QGKC 1UZHA 2V38A 4DWSD 4O57A 2P0OA 1UWUA 2ZCGA 3R8GA 4TX6A 2VFEA 3RM4A 3VVGA 2QDHA 1H7PA 3AMCA 1ZLPA 2Y62A 4NI8A 1Q65A 1IF2A 2PFHA 1N8WA 5CZJA 3TN6A 3IWPA 4CNOA 4Z2IA 3LENA 2W63A 2V0TA 1GZJA 1RVKA 3DH9A 1MYRA 4DUVA 3CYJA 3SN4A 3V1HA 3S2MA 3UG3A 1BVZA 2Q71A 2Y7FA 3F5KA 2CLEA 4GD0A 1A5NC 3AUOA 4DO5A 5HMFA 1TPDA 3LERA 4AD0A 4ZTYA 4C90A 1S5MA 1HJQA 2EEXA 3QVQA 3VKJA 2Z2AA 4HTBA 4ZOBA 5GNYA 2BC1A 1ZY8A 4MB5A 4DF0A 2D2HA 3UWEA 1FXQA 4KFPA 3NVDA 1DTNA 4RDZA 1I0DA 1WXZA 3F1QA 4H9ZA 3QEZA 5AVHA 1F3TA 3IRDA 3I7SA 3AALA 4KEVA 4U4MA 2Z1XA 1DJZA 2HISA 2ZQ0A 4K37A 2FQIA 3QFEA 4B5VA 2ZRWA 3INPA 3EX3A 5CAHA 2EAWA 2O4QA 4X22A 5C2GA 4CEXC 4PB5A 3W02A 4LY8A 3MCOA 4KWVA 1IQ8A 4GXWA 4IMCA 4XBKA 4XKYB 4XO6A 2XWDA 3MDWA 1VBRA 4GACA 4J57A 2PGFA 3TYDA 1Y8BA 4DY1A 3MKCA 3G6LA 2GK1A 3M0YA 5C9ZA 5CJ5A 3VIGA 3VNDA 4EKJA 1H1NA 1UP2A 4JNZA 3L12A 3T09A 4JAWA 1XJBA 3AHYA 3T0BA 2J79A 1XIMA 1V3LA 1EIXA 3VOCA 1DPMA 1OK6A 3TTOA 4ZO8A 1M6JA 4QNWA 4S3FA 5HK4A 3B8TA 5IDZA 1TCMA 1TKKA 3PPGA 3UXLA 1PHQA 1JZ3A 1SO4A 1UIPA 1XYFA 4GLEA 3BQ6A 1WOAA 3H4XA 3LBOA 1PCKA 2ANUA 1XPYA 2ABBA 1OHLA 1H0GA 2ZA1A 2XM1A 5D2YA 9XIAA 1VQZA 4Q8PA 1KBLA 1W5PA 3MYPA 3CWOX 3BC9A 2OQLA 3M5VA 3U5YA 4P8UA 3N9RA 2DJXA 1GXFA 4K68A 5CPQA 3K4WA 2QULA 3GRTA 3A7RA 1JCJA 3PG8A 1B3OA 3EAOA 4RE4A 3PR2A 3W83A 2WVTA 4KMQA 4RE0A 5FIPA 3KOZA 3TOPA 4XAPA 3KTCA 5ECVA 3ZR4A 1VH7A 1J0YA 4IFKA 4M81A 1O5QA 1PKNA 1XLAA 3NO5A 2V3GA 1T5AA 3WLRA 3C3NA 4D1JA 1JD9A 4B9YA 3B4YA 3URQA 1X7IA 4R5EA 4BWLC 4XBJA 5GNXA 3GXDA 2JGQA 4Q7IA 5G2WA 5AECA 2J75A 4Q8NA 4XAGA 2BOGX 3ZS4A 4P7RA 3IACA 5DCBA 1R87A 1W1VA 2JK6A 4MKSA 5J5DA 3AYVA 4YXGA 4JN8A 1XYMA 5C9UA 2HRWA 4HNUA 2I9EA 2I5QA 1EXPA 1MFVA 1THFD 3C0SA 3QR0A 3PTKA 4ACZB 3A3XA 5DRIA 4Y96A 3VC5A 3ITOA 4H9UA 1G0CA 1IWPA 4OV4A 4CNUA 2P1FA 3BLEA 5F2IA 3CAKA 4TX8A 1C8XA 2WWCA 2I56A 1F3PA 1RCOB 2HQAA 1EYEA 1V0NA 5I24A 5D37A 1EQCA 1EA0A 1AQHA 1XFBA 5I3HA 3SRKA 3PSWA 5M5DA 3RX2A 4PMQA 2QCCA 4UBPC 1NDAA 3VGGA 3WMCA 4MPQA 2BSLA 1J93A 2GR1A 6XIMA 4TUFA 4H9YA 2OPJA 4V1XA 3W7MA 2W55A 2BVDA 2V3DA 2VOMA 4H01A 2OGJA 3UPWA 4GRTA 1PKMA 3HOJA 1E6QM 4ORIA 4DN1A 1PWMA 3M0MA 3SUUA 3VNLA 4H4UA 1W56A 3E0FA 2OO0A 4ADUA 1YBQB 3HPFA 1RSCA 4UIOA 3UWVA 4AQLA 1SJDA 4LYRA 4NJGA 5FS8A 1H5YA 1TPEA 5LIYX 5DELA 1VCVA 3A7AA 4QTGA 2G3MA 1W9PA 3VFCA 2FJKA 2V5JA 1Q4WA 3M5ZA 3IV8A 3N25A 1PDYA 1LLZA 3NM1A 1HJWA 1R9YA 4GH1A 3CUXA 4PUMA 4O1DA 2PWGA 1TB3A 4AYSA 3WK1A 2F8QA 4AXNA 1VIWA 3V35A 5ABEA 4DBWA 1P7TA 1PBGA 4LNYA 1A5AA 4HZ8A 4LOCA 4HHLA 3ABXA 3T6CA 1J0KA 3CQJA 3RUBL 3CV7A 1UC5A 2PD5A 4ZFCA 3IEBA 1RPXA 4RKAA 4UFIA 4QE5A 4GNVA 1C8VA 3TCEA 4FS9A 4QG9A 1UBSA 4I3GA 3IRSA 4EMIA 3E96A 3S5SA 2VI0A 2NV9A 4MJ2A 4QFUA 1RBAA 1RA5A 2HSAA 5HOSA 4HMCA 4GOAA 4BF9A 3M64A 4W86A 2EPNA 4NAEB 3Q45A 3H21A 1E43A 4ZTXA 3UFYA 1XLLA 3PB2A 3CMFA 1UH3A 3WDQA 5E0FA 3ZO9A 1GYNA 5LA0A 2ZVRA 5AYIA 4ATDA 1S5NA 3MUZ1 3LCIA 3RAOA 3WKZA 1ZFJA 1RLCL 2HE8A 2HJPA 4C6OA 3DGRA 4QJ5B 1NHRA 1N8IA 1O5KA 3I65A 2ZX6A 2UZ9A 2NSOA 4GKLA 3LNPA 3K13A 2VGBA 1RBLA 1GVOA 1ODZA 3EX4A 3BAXA 1QASA 3DHFA 3W76A 5EMLA 2GUYA 4H7VA 1DE6A 4QNEA 4EF8A 5AHEA 5TD4A 5CGMA 4QBXA 4Z2HA 3A12A 5LNWA 2OXNA 3A7UA 2GDUA 2BXVA 2F6XA 3RG6A 3CGCA 2PTYA 1UWTA 3OGRA 2Q02A 3VKAA 3PULA 2PDFA 2V3EA 5T9CE 1HX0A 1S5TA 3O1NA 3EPNA 1R85A 4M6PA 2HVOA 1SO5A 2DZWA 3NCOA 3HPSA 1QPRA 1GREA 3LI0A 1TV5A 3R4IA 3S0CA 3MZNA 1FFVC 1MW1A 2DJLA 1W54A 3KCJA 3IK4A 1BGGA 3FKRA 2FDMA 1WKFA 4O13A 1HKJA 1QOPA 4YWSA 1DXIA 4RCXA 3ZZ1A 3G0SA 2ZX9A 3SO7A 3VPLA 3NXFA 4GIYA 6TAAA 2IXUA 2BY3A 3CUIA 3M41A 4QXIA 3VINA 1D7KA 4NP7A 4IUGA 3N6JA 1K8YA 1DP0A 5LNSA 4H50A 2X8GA 3ZSSA 1T8XA 2GRTA 4I6KA 4MY9A 1TV8A 4Q8MA 2CWNA 4FXFA 5AOUA 4PYSA 1E56A 1RXOB 3V16A 4AWSA 1RALA 4RL3A 3POCA 1LTDA 1NQ6A 1FCVA 1FKXA 1YBQA 1P6CA 3ZT5A 5AYYA 2Z1WA 2FGBA 1UW9A 3WLHA 3KDNA 4BKNA 1XLHA 3KWSA 4Q8WA 3W01A 1F8IA 2AAQA 1FFRA 1H6VA 4I7WA 3UZYA 4LVDA 1E6RA 3GH4A 3BG5A 1Q63A 3DG7A 1P0EA 4MZ1A 3A3HA 3RPMA 1WZMA 2XIQA 4MTVA 2XM2A 2UWFA 1UKOA 1BYAA 4WEVX 2EQ6A 1K4HA 7XIMA 4BWLA 4E8DA 1T3QC 2Y61A 1IIHA 2J6VA 4JY8A 4IISA 4HCDA 3TX9A 3VNKA 3KBSA 5AYBA 1UR3M 3WL1A 1WPCA 4UQEA 4P5UA 4Z0SA 2A5HA 1AD4A 1F3WA 3B8SA 2PD9A 4W8AA 1OM0A 3EB3A 2OG9A 2VCCA 3HW2A 4Z2KA 5BRQA 1UCWA 3GK0A 3LCLA 3VM7A 1DIEA 1XLIA 3WEZA 4FZIA 4G5DA 3T4CA 2NXGA 3H8AA 3FYOA 4RE3A 1O5XA 2VR5A 1ZTVA 3ABQA 4I9MA 2PDIA 3N12A 3VKKA 2WJDA 3QPEA 3OC4A 5XIMA 5LA2A 1XRVA 3HU7A 1SVDA 2PDMA 1Q66A 3KRBA 2X16A 3TSDA 3NAVA 3N4FA 1EFZA 2OYKA 4XAFA 4FNTA 3C2FA 1EP3A 3W85A 4Q33A 2JEPA 5D9OA 3GE7A 3OQ8A 4YN5A 1A5KC 1GW9A 3KTXA 2J7EA 3I4EA 2PLJA 4QGCA 3MT1A 6ALDA 4IX2A 3GD3A 1J0JA 3ALGA 5HQMA 1PJ9A 3CMJA 3BAJA 1AZ1A 3WLNA 4WDXA 4JCMA 1TUFA 2X1IA 3EOEA 2BCPA 1NARA 5DANA 3WBEA 4MFDA 1VFFA 5E93A 5JCMA 4GG9A 4NF7A 3PUGA 4CLMA 2VXNA 2F5ZA 3FG2P 5CPTA 2YGYA 5I3JA 4HCHA 3TUUA 3UXKA 3ZOAA 1MFUA 2Y63A 3MTWA 1GOMA 2AMXA 1H61A 1ZJBA 9CGTA 4PB4A 5EFFA 4OUIA 5DMLA 3PFRA 3I6TA 1V79A 2VC7A 2ZA3A 1CPUA 4HYVA 1RQEA 4AZIA 1GJUA 1OCNA 3MUXA 3M6DA 5HQEA 6XIAA 1M1BA 4L1GA 1F6YA 1MQQA 3OZOA 3RMJA 5JVLA 3BW3A 3IJ9A 3MI2A 1HZYA 2VEKA 4HA4A 5D2VA 4L65A 3P80A 2YXGA 4FXRA 2V5BA 1IGWA 5K9XA 3SBFA 3PPCA 3UWZA 5KVIA 3I3DA 4EX4A 2XGZA 1G67A 1TV4A 3EB4A 4XX6A 4O8RA 1SU5A 1LLWA 1P0KA 3BAWA 2Z26A 5JIWA 3M0HA 1WYGA 4PSRA 4CKQA 1W6TA 3U2OA 4BEQA 4BF5A 1U1HA 2Z4GA 3BSHA 3R13A 3TP4A 4QRNA 4MVAA 3WF3A 4X9YA 1BKSA 3PB0A 2DZXA 3F5JA 1OC6A 2QCFA 3AZSA 4YYFA 4XZLX 3WEMA 3M0VA 4CVWA 4LAOA 3VD5A 3G8EA 2IPGA 4W4QA 1IEIA 5A6TC 1XXXA 3M0JA 3GR4A 1JEZA 2QJHA 1Q6FA 3DYMA 4ZB0A 4O4VA 1E0WA 2VX6A 3THUA 2O9PA 1S2CA 1HKVA 1S38A 1FCBA 4B92A 5AB3A 3IGHX 2IKGA 1F5ZA 3LTYA 4TV5A 5E09A 1QDSA 1SQ7A 1FP8A 4MLRA 2WVVB 1Q7QA 3SCUA 3M7SA 3O6AA 4AHOA 2GUBA 3U9IA 1IYXA 4LUJA 5M3WA 3DFYA 2YFOA 5HPOA 1ZHAA 3E2RA 2A4AA 3E0VA 1F7BA 2RJHA 1WE5A 2YDAA 5GVJA 1NEYA 3TYUA 1XCWA 3WL0A 2Z27A 1LG1A 5JUVA 5LGZA 2VDGA 3A5FA 3LZ3A 4EWND 2QMKA 3MI6A 1V7AA 1GV4A 4Q7BA 4DB7A 2B81A 1L0PA 3DENA 3DFOA 1EF3A 2OEJA 1WKYA 1QI0A 1S2TA 3FX4A 2G8ZA 3AIWA 4CD4A 5PTDA 3TJXA 4AUBA 1BYBA 4RDVA 1LQ2A 3HM7A 5FJTA 4JOMA 4GGBA 3P14A 1LUCB 1EJUC 4IXXA 3WN6A 3IVTA 4UTWC 6REQA 3B8WA 4J3XA 1A5SA 1V0KA 1SZFA 3QW4B 3VU2A 2P10A 4Z1BA 2TAAA 3L0GA 3V0UA 3FGCB 4DWSB 2ZUTA 3PZTA 1LRQA 8A3HA 1V02A 1A50A 3PF3A 1EBDA 3GVVA 2HZGA 4AMAA 4N6EA 3CAQA 4KPLA 2WP6A 5EYWA 1MMFA 3WLLA 4D6GA 3AN1A 1JDFA 5H8MA 5FL0A 1GJPA 2BGQA 1L6FA 4C1NB 2ESCA 3CHDA 1HGWA 1XH0A 1HNYA 3E3HA 4LALA 4WGHA 2B7OA 1Q6EA 5D30A 3GNNA 3BG9A 2B31A 2V30A 3VOIA 4KBXA 4LYQA 4IWWA 1RHCA 4DM2A 4HU0A 1Q8AA 3EKGA 5EU9A 3OVGA 1F76A 4JTKA 3GHSA 4ZSTA 4IMDA 1V5XA 2C71A 4UNKA 3OVRA 3OVPA 3USBA 5HPCA 4GJIA 4GUGA 3H26A 4W89A 4NZ4A 1ME9A 3VD7A 2E7FA 2ZA2A 1JPDX 3WNPA 1M7OA 3F03K 2CLKA 5DT7A 5G5GB 2OB3A 3W9ZA 3AJ7A 4LGXA 1A5BA 2QCMA 4PMVA 1WDSA 5M2FX 3RX4A 1YE6A 4Z2LA 3EEZA 4IFKB 3VGBA 2J9XA 2Z7GA 1XSKA 2FTYA 3N13A 2C91A 3G5EA 3RLVA 5J8LA 3SR7A 3O06A 4CU8A 1VCGA 1PZ2A 3AS3A 3TSBA 4QM1A 1JUKA 5AZ1A 4K8HA 1PZ0A 4EPDC 3UVAA 5A2BA 3F2DA 1K8ZA 4JN7A 5HR7A 1YTKA 3MPGA 5JCIA 2CLIA 3RX3A 3TOYA 4Z1CA 3T2PA 1GQLA 5E9AA 2Z7KA 5HJLA 1SSGA 2JIEA 1KKRA 4U2YA 1C3FA 1FXPA 3IGUA 3P61A 2VX7A 2ASHA 3MP3A 2PU1A 1MUWA 3O05A 4IT1A 3C52A 4L56A 1RQBA 1X6LA 4DYKA 2W0HA 1W3HA 4JZ5A 3DDMA 4B9ZA 4NKCA 3LK6A 5E70A 3LADA 3NPUA 5I3GA 3O9NA 5I03A 2YCKX 1FOBA 4KERA 4GJ1A 3O6YX 4IX0A 3B04A 3S3GA 5CBIA 3LPPA 1SJBA 1TMLA 2ZICA 3P8JA 2WPEA 2W62A 1U30A 2Y5SA 2HTMA 3V0TA 2PDXA 2PDYA 1YX1A 1TWDA 1KRAC 2X40A 2BTMA 4F0KA 4LS1A 1T7LA 2Q01A 1QCWA 3MV01 1Q85A 1GEQA 1G7UA 2Y88A 2E0PA 4UTTC 1IWBA 3NL2A 4UQBA 2CPUA 3W29A 1TYPA 1NFGA 3H70A 4DO4A 2PWDA 3OLGA 3W2UA 3P2VA 2XYLA 1UQZA 2VO5A 1XLMA 3EPMA 1TIMA 3TZNA 4LUYA 2JE8A 2VVSA 4HT3A 2J9ZA 3F4VA 3LTSA 1VD6A 3KOFA 2W3ZA 5KVHA 3AYRA 1K3UA 3QPYA 1LL6A 1KCLA 5I07A 4MHBA 2OKTA 3NL3A 2O9TA 4LC6A 5C7HA 3MP4A 1QPOA 2VP8A 3FJNA 1DBTA 1W5MA 4AIOA 1XLDA 3VKCA 2BMBA 1BYCA 3SCNA 5KEZA 3VGEA 2QDDA 3YPIA 2REQB 3E49A 1FIQB 3LX9A 1LOSA 1YRRA 3RO8A 4CQDA 5L9FA 5A8PA 3AMLA 4JTIA 4K36A 3KE0A 3PUOA 1P5BA 4DHGA 2FPTA 2PBGA 3GTNA 2XZ7A 1ICSA 1I0BA 4RLIA 1HGYA 3B0UX 3ARXA 1OABA 3O2LA 4NYUA 2WCGA 3QQ1A 5I06A 2AL2A 2I16A 1A4MA 1LWJA 3Q65A 2PS2A 2X8CA 1I6NA 5BOFA 4C7FA 4HHHA 3GAYA 2V5LA 1XUZA 3L67A 4GYKA 3FHQA 1HL8A 1UWSA 3URNA 3DG3A 1GYMA 3DK9A 4KPRA 2QJIA 3RPDA 1JIBA 2R82A 1C93A 2D73A 2PDPA 3ZSTA 4FOUA 1GNXA 4XUGA 1UG6A 4EMWA 1BF6A 2P53A 2RAGA 2ZIDA 4XIMA 5EL1A 5U4NA 2Y7GA 1VJSA 4F9JA 4QLKA 4Q4OA 4RE2A 3MP5A 2DZAA 4V27A 3HN3A 3L4XA 3M5XA 1QOXA 1FHLA 2I57A 3HA1A 3WLMA 3MY9A 1VLWA 1KN0A 1Q6QA 3WMBA 4REQB 2I5IA 3O3RA 2WSKA 3GIYA 5BRPA 2WPFA 1KNWA 5D2WA 4TMCA 4DXKA 3QMTA 5FESA 4MWAE 4O15A 1E73M 3H22A 1E9LA 1E71M 3TYAA 3AIQA 1KBIA 4O8AA 2GFTA 4IH3A 3TCSA 3QZAA 2X0YA 2GL5A 1TPUA 4E8GA 1GERA 4PRRA 1TV2A 1YHTA 2DZVA 3O0FA 1GQNA 2VEMA 4BR1A 2E25A 4IOTA 1GOQA 2VNCA 3S4TA 4Q8OA 1WBJA 4H2CA 1MSSA 1ONEA 3UZZA 1ZJIA 3M4HA 2VGFA 4UC5A 4HK6A 5K4XA 1AG1O 4H4ZA 2IQ0A 4MFEA 3GDRA 3WBAA 1ADDA 1TYTA 1VYSX 5DCDA 4Q6JA 2W3RA 4HZ7A 4IIBA 1JL8A 4F0MA 4PMRA 2X1TA 1YXCA 3FDKA 3WBXA 2Y6ZA 1JXJA 3V3WA 3VCNA 3W2NA 3ORWA 3BCJA 4NX5A 4JTFA 4UCFA 4PFHA 3WLTA 4XD3A 5FJRA 1KXVA 2ACUA 4AIUA 4WX2A 2FZ8A 4JIRA 4YU1A 4FNRA 4KKXA 1NQKA 1BPLB 2Z00A 4JTQA 4UNLA 2PF8A 4XD4A 3WLJA 1F07A 3B97A 2PE4A 4E38A 5H1WA 4PFMA 4NJJA 1JPIA 3RCNA 2WK2A 1GYLA 4H1ZA 2YZ5A 4C6NA 5JQ9A 2AGTA 3QOMA 1V7YA 1AH3A 2BHZA 2R24A 4KS0A 5GJNA 1EJRC 1TFVA 1TWZA 4HA1A 2EPHA 3APYA 4GISA 2CXGA 4EQSA 3R11A 3WLSA 3TJ4A 1JUBA 2QAFA 4LYPA 1UJPA 3PUEA 1CENA 1QMLA 3EDEA 4X60A 3R0UA 4W85A 4HYWA 2NXHA 1W3TA 2C1IA 3GYEA 1SSDA 1J4EA 4O50A 2R1PA 3PWGA 2D0HA 3CB8A 3O0HA 2Q8ZA 2OX1A 3TR9A 4UTWA 3CPUA 4GZ7A 2UV8G 1FVPA 1E1FA 2GVGA 4EXQA 1RJRA 5IM51 5BYWA 2ZTJA 1FWTA 3AWNA 4ROPA 4RJEA 1H09A 1SFJA 4DRSA 5HNRA 3GDBA 2QCDA 1GEUA 2PMQA 5BMXA 4M0XA 3GM8A 1F6PA 4P7LA 4AYGA 2ADAA 4JTGA 4M1BA 2XGIA 2QIWA 1J6OA 3M6YA 2NPXA 2O55A 4R7JA 1DWIM 4QQ3A 5FEZA 2NWRA 1NDWA 3RN6A 3FAWA 1V08A 1KFBA 3S6TA 4GKTA 4IICA 1TJRA 3P62A 1TYGA 3WBYA 3AICA 5IXEA 5BMWA 2WANA 3QLDA 3PJTA 2PODA 2A3LA 4EMJA 4IJBA 4JEQA 2F2KA 3WFZA 4IMEA 4LVBA 4M24A 3Q37A 3WMLA 4E0CA 1RVGA 2ZTKA 4FLSA 2GQWA 2C15A 5FF0A 3N2BA 3G22A 4KCWA 2DORA 5K9DA 1BTCA 3PANA 4P8VA 1B5TA 4LX4A 3J7HA 3A6OA 3A9IA 1W1TA 3PBVA 4DO6A 1T41A 4FHAA 3JVAA 2WVVA 3W82A 3AZRA 2Z1BA 5HA7A 1GCYA 4BZYA 3TU9A 1S39A 1XBVA 1VB9A 3ZWSA 4XISA