2RDXA

Crystal structure of mandelate racemase/muconate lactonizing enzyme from roseovarius nubinhibens ism
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
369
structure length
369
Chain Sequence
SLRITRIRLYKTDLPYVDGSYGWGAGNAITVARASVVVIDTDAGLQGCGEFTPCGENYMIAHSEGVDAFARLAAPQLLGQDPRQVARMERLMDHLVQGHGYAKAPFDAAFWDILGQATGQPVWMLLGGKLCDGAPMYRVAPQRSEAETRAELARHRAAGYRQFQIKVGADWQSDIDRIRACLPLLEPGEKAMADANQGWRVDNAIRLARATRDLDYILEQPCRSYEECQQVRRVADQPMKLDECVTGLHMAQRIVADRGAEICCLKISNLGGLSKARRTRDFLIDNRMPVVAEDSWGGEIASAAVAHFAASTPEEFLINSTDLMNYNTRSTGLGGPTVHQGRLYASDTPGLGVTPDFNSLGAPVADWAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mandelate racemase/muconate lactonizing enzyme from Roseovarius nubinhibens ISM.
rcsb
source organism Roseovarius nubinhibens
molecule tags Structural genomics, unknown function
molecule keywords Mandelate racemase/muconate lactonizing enzyme, putative
total genus 124
structure length 369
sequence length 369
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2rdxA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2rdxA01
2QQ6A 3RO6A 4EWJA 4IL2A 4HCLA 3ZLHA 3GY1A 1KCZA 3CB3A 4MGGA 2XSXA 4ENLA 4GGBA 2XH0A 3DEQA 1NU5A 2GGHA 5FJOA 3CAWA 3VC5A 3DG3A 7ENLA 1SJDA 3IJIA 2QGYA 4DYEA 3UCDA 3QLDA 3V4BA 1TZZA 4DWDA 3CK5A 3H12A 3THUA 4HCDA 5FJUA 2OLAA 2PS2A 2QDEA 2OX4A 3VCCA 2HXUA 1MDRA 2PPGA 4ZA0A 3K1GA 3DFHA 2GGGA 2I5QA 3OZYA 4KEMA 1JPDX 3S47A 3TOYA 4GYPC 3SN0A 3KUMA 4X2PA 1JDFA 2AL2A 2HXTA 3DIPA 4H19A 3B97A 3QTPA 3UJFA 3EEZA 1EC7A 3SJNA 4E4FA 1SJBA 1R0MA 1BKHA 3D46A 2HZGA 4IL0A 1F9CA 2RDXA 3TCSA 3VFCA 3ZVHB 2PODA 3OTRA 3BJSA 4IT1A 2PTXA 1BQGA 1JCTA 1L8PA 3FV9A 4G8TA 3PWGA 3T4WA 4GYPA 1TKKA 4Z1YA 2XH2A 2AKZA 3TWBA 4E4UA 3DERA 1EC8A 3V5CA 5FJTA 4A3RA 3T9PA 3UXKA 3OZMA 5J04A 2GDQA 5BOFA 2ZADA 1TE6A 2P88A 4E8GA 2PGEA 2OPJA 2QVHA 2PP0A 3TQPA 4KT2A 3V5FA 2PGWA 2OZ3A 3DFYA 3IJLA 1NELA 5EU9A 4IZGA 2GSHA 5IDZA 3CYJA 4GMEA 1PDYA 2P8CA 3GO2A 1R6WA 3T8QA 1E9IA 3FJ4A 3N4FA 4KPLA 2PTZA 3JVAA 4M6UA 3UJSA 3EKGA 3QN3A 4FI4A 4YWSA 2HNEA 3R0UA 4DHGA 1KKRA 2OQYA 1FHUA 4IHCA 3TJ4A 3R11A 4JN7A 3U9IA 4IP4A 2OZ8A 3TTEA 4K8GA 3V3WA 3R0KA 2QJNA 2ONEA 1EBHA 2PMQA 3QKEA 1JPMA 3PWIA 2OO6A 3MY9A 4A35A 1MDLA 4FP1A 2OFJA 3H7VA 1XS2A 1KKOA 3NZGA 3ZLFA 2QJMA 3R1ZA 4ROPA 3VCNA 1WUEA 3R25A 3STPA 4DXKA 1IYXA 3RRAA 4J3ZA 1RVKA 1P43A 2PA6A 3SSZA 3DESA 3RGTA 2NQLA 3MZNA 2MUCA 3NFUA 3SN4A 3RCYA 3VA8A 1DTNA 4JHMA 1EBGA 3S5SA 3UGVA 2AL2B 2XH4A 1FHVA 2FKPA 2PTYA 3N4EA 1MUCA 4K2SA 2PTWA 1SJAA 3ES7A 3PFRA 2DW7A 2DW6A 4JN8A 3P0WA 3DG6A 3T6CA 3TWAA 3GD6A 3BSMA 3MWCA 1EC9A 4H1ZA 3MSYA 3UCCA 4HNCA 2FYMA 2O56A 2QDDA 3NXLA 3P93A 3ZVHA 3SQSA 3VDGA 2POZA 5FJRA 3GC2A 3N6JA 2P0IA 1OEPA 3OPSA 3UXLA 2CHRA 4A6GA 1ECQA 3IK4A 3DDMA 4HYRA 3Q45A 3H70A 3Q4DA 3QPEA 3FXGA 3P3BA 3ZVIA 3I6TA 3JZUA 2OQHA 1P48A 4KWSA 3MQTA 3SBFA 1W6TA 1ELSA 2ZC8A 3H8AA 2P8BA 2XGZA 3OW1A 2AL1A 2MNRA 2GGIA 4J1OA 2QJJA 2PU0A 1XPYA 1YEYA 3UJRA 4HN8A 3HPFA 4DX3A 4H83A 1MRAA 5BOEA 6ENLA 3ENLA 2OZTA 4IP5A 3CXOA 3IJQA 4H2HA 3CT2A 2PU1A 4M0XA 4Z17A 1SJCA 3RR1A 4E6MA 4GISA 4GGHA 2GGEA 4K1WA 1PDZA 3SN1A 5ENLA 3U4FA 2OG9A 2GL5A 1MNSA 2P3ZA 1ONEA 4GFIA 3TW9A 4HNLA 4MMWA 3MKCA 3FVDA 5FJPA 4MKSA 3UJEA 3RITA 3ES8A 3JW7A 4E5TA 3UJ2A 2PCEA 4F4RA 3PK7A 4ZCWA 3MUCA 3TJIA 3DGBA 2OVLA 3FYYA 2PP3A 3R10A 4GIRA 2GGJA 3OP2A 4G7FA 3NO1A 3I4KA 3D47A 4HCHA 3DG7A 3ZLGA 3VC6A 2OKTA 4DN1A 1KD0A 3N6HA 2XH7A 3BOXA 4HPNA 3FCPA 3I6EA 2PP1A 1WUFA 2PSNA 2AKMA
chains in the Genus database with same CATH superfamily
1I6NA 3DYPA 1QI5A 3OYXA 4ADUA 5CEWA 1ZBWA 3NQFA 4GKLA 1GOMA 2DH2A 2VGBA 1T8XA 4JTIA 2XH0A 5CCZA 1EX1A 5M3WA 4S3BA 1I2OA 1OJXA 5CZJA 4PMOA 3WH8A 2VQTA 5JH1A 4JZ5A 1ISZA 4G6CA 5KETA 3TP4A 2QGYA 4WDWA 3TONA 1W9PA 1TJ0A 4H7ZA 1P6CA 3W7PA 4H4QA 1UKOA 4LALA 2AAQA 1YQ2A 3GHTA 3NRZB 3S8HA 2NQ9A 3U57A 5FF4A 2JQXA 4V2XA 2ZX6A 5HPOA 2FZMA 5A6TC 5DCBA 3USZA 4QE5A 4RZ4A 1JOAA 4QQUA 1C91A 1GOWA 1DJQA 1DXIA 5TAOA 4PH6A 3LYEA 3N9KA 5G1YA 3B06A 4KEMA 2RFGA 3THQA 5JCNA 5A6MA 1TFVA 2Z1VA 3WEMA 1JDFA 3AZSA 3N9SA 1D9EA 1W5OA 1O7AA 4O10A 2HSAA 2DIEA 2WC3A 1BRLB 3CASA 1ISVA 2J24A 4EM4A 5TD4A 5LA2A 2YYTA 2HZGA 1UC4A 5LGXA 3MP4A 4XKYB 2EEXA 2DT1A 1K7EA 2VZUA 1FWRA 2G5WA 2JEQA 1R3YA 3SIZA 3FJNA 1RBAA 2Y85A 2OT0A 1KM6A 1L8PA 5EBKA 3FFSA 1WV2A 2E1WA 1Y7VA 3LK6A 4GYPA 4LWWA 2CLOA 3OHIA 2DSWA 1H7RA 2A0NA 1X6UA 3KVLA 1JZ3A 1JQXA 1XYMA 5I3JA 1ZKQA 4J28A 1R7OA 2WAGA 1V3LA 5FIPA 7TAAA 1JAKA 2QCDA 3KS6A 4Q8MA 5FJTA 1LLZA 3MBDA 5M2FX 1TTJA 4UXDA 4IPLA 4J9JA 4XZHA 1E4IA 2J9XA 1B4EA 4D6IA 3QV6A 1ZAJA 2ISFA 4AHQA 2PLKA 5E5CA 1LJYA 1UMYA 2WKGA 4M6QA 3WH5A 3FHAA 5CPQA 4R27A 1XIDA 1Y5VA 2VWTA 3MP3A 4IZGA 4R9XA 5IDZA 4FAMA 3OIHA 5T8GA 3WH7A 1N55A 1PDYA 3NQCA 3RM9A 3WQ6A 4C7GA 3N2BA 3L2LA 1QK2A 3GR8A 1B2YA 3TTYA 1F8MA 1P6WA 2PTZA 4DBWA 2GVGA 3NM3A 4W9TA 2VFDA 1XIIA 1K9EA 4NILA 5TNVA 1VD6A 2H90A 2PC8A 1A5UA 1KKRA 4YJ5A 4QAWA 3TH6A 3G77A 3B9NA 4X0NA 4KCTA 4YWIA 3WLOA 1E56A 3GLCA 1NTHA 3WLQA 1XG3A 1KM3A 2Z28A 4W5UA 3HA1A 1ZMCA 4K3ZA 4F66A 2R9RA 1EGZA 2DZSA 3NQDA 2OU4A 3FAXA 3AXHA 1V3MA 1VR6A 1AMKA 5FMHA 3ITCA 1NDYA 1BD0A 1HKWA 4LAZA 4K7ZA 3STPA 5JCIA 4D71A 1JZ2A 4LUYA 2WQDA 3ORWA 2CW6A 2VRKA 1LP6A 1XYFA 2REQA 1XLAA 4UTFA 1GVOA 3BWWA 3RGTA 3MZNA 5AY7A 3KVJA 3VUPA 3GH7A 3IRDA 1NARA 4KS0A 2DZPA 2BG5A 4UFIA 5C9WA 4HHMA 3SEPA 5FS6A 1TPWA 5EMLA 4ZVJA 3HF3A 2X1UA 1MUCA 1KCKA 1BRLA 2WNNA 3LRLA 2W27A 4XZWA 1CYGA 1RJQA 3RYSA 3UG3A 4JTCA 1DQWA 1ISWA 2EGZA 1DIKA 1J4EA 1LLWA 1AW1A 4MY1A 3B8DA 1FUYA 2NQHA 2MANA 2O56A 1EJSC 2E1DA 3E0VA 4PRRA 3G3DA 5FESA 3AXMA 2IXVA 2FJKA 1RA5A 3TUUA 2B7PA 1BGAA 1YDNA 3IK4A 2GPTA 1J01A 3Q45A 4CNPA 3TSMA 2FH8A 4NASA 4X22A 3V5OA 2OGYA 4Y9AA 1UKSA 1VJIA 2J13A 3MQTA 1EPVA 4I5UA 3BL3A 4UFJA 1L2UA 2XGZA 3OW1A 4WR3A 3FJLA 1W31A 2V8ZA 1FWFC 2W3SA 1LT7A 3E5BA 4YVXA 3GBDA 3PG9A 4HN8A 4KFOA 2OX1A 4NXKA 5CSYA 1ZMDA 3WBWA 5EFDA 4D6CA 4ZXLA 5G5GB 2J66A 1GETA 4XV0A 4MUZA 3RM8A 4RDVA 3O1NA 1LTDA 2PDLA 3MO7A 1WDDA 2QJIA 3LGGA 4HT3A 2YL9A 1E0VA 2INZA 1UB3A 1HJXA 4GACA 1PKYA 1R38A 1OQFA 3GNXA 2UY5A 4PL1A 3IWPA 3CM4A 2J79A 4FF5A 3EANA 3NVZB 5C71A 3AQUA 4H6QA 1ONEA 3UR7A 3TW9A 5DY3A 4Z1DA 2C79A 3C2EA 1H61A 3ZR6A 4HMCA 4LC8A 2HVOA 3RAOA 4L6DA 1H11A 4QDPA 3UJEA 1Q2RA 4JKKA 4TX9A 3PPCA 1BZLA 1OG0A 3AAMA 5JBEA 3I7RA 4OTKA 3BW3A 2UY3A 1Q8JA 1V4YA 4XD4A 1C9DA 2O9TA 3EXTA 1BLIA 3L67A 4CUCA 1TPB1 1UH2A 1Z6KA 1F3EA 1T96A 1HJWA 1U22A 3FA5A 5CBBA 4HCHA 5A8MA 2PD9A 1N62C 2OKTA 4Z2IA 4HA3A 3PG6A 4UOZA 1SO5A 5JVLA 3W7LA 4FLRA 3AROA 4NF7A 1BG9A 4C1LA 2VR2A 3GHUA 5HPCA 5EMYA 4LVBA 3M47A 1H1NA 3QQ0A 3WD0A 4EWJA 3NL6A 3VDCA 2O9PA 4UNLA 2XSXA 1KRBC 4MJMA 4U5KA 4Y9MA 1TVPA 1O66A 5D03A 3M0JA 1F2JA 1KRAC 1VFUA 1NU5A 1NVMA 4Y90A 1HIZA 1OD0A 1PZ1A 4LF1A 1I60A 4AC7C 1GW1A 3VMPA 2R82A 4ICCX 1S38A 4OU1A 1EO5A 5AOUA 4H3DA 4MG4A 2QDEA 1ZAIA 1BTMA 2CZDA 5GQBA 4J3WA 5LNSA 1A5KC 4W7UA 3GUWA 1JPIA 4L1GA 1A0CA 4IIEA 4QIUA 3GVQA 4MNJA 1UKPA 3H26A 3QYSA 5BU6A 3ARUA 5E1QA 2XTKA 1MEIA 1I1WA 1JZ5A 2EG7A 4XAFA 1WXJA 1T0OA 1JPDX 3BDKA 3SN0A 4RNJA 1R47A 3UBPC 3GRIA 4IPNB 2HXTA 1GW9A 1V8EA 6REQB 3V18A 3PTMA 4DF2A 5FSDC 4M24A 4QGCA 1NDAA 3BG9A 4F48A 4F40A 2FPYA 4WUIA 4C6EA 3BUVA 2YZRA 2DSUA 2VUYA 1RY8A 1TQJA 1K9FA 5IRPA 4NRRA 5ABTA 2DUXA 2WYSA 1MW3A 4PEKA 1AH3A 1OT2A 3S2MA 3OTRA 4JKMA 3UWYA 3C2YA 5D2YA 3GD3A 3MJYA 1BWKA 3SCOA 3I3EA 2WNQA 3W25A 1STZA 2X09A 3T4WA 3FAWA 5FD0A 2JBMA 5IHRA 1G4SA 3G8RA 4EACA 3EX3A 1WDQA 1KWKA 4H6RA 3SCPA 1SMDA 4JFVA 2QULA 2VC6A 1EFZA 1KBIA 1O60A 4JFTA 1OSEA 4YTUA 5DO8A 3F4VA 1FCUA 1L9WA 3T9PA 4EK7A 1X7IA 1EX5A 3SGUA 3PPFA 3WEOA 1XP3A 1OADA 2WVSA 3PZGA 1FP8A 2VFHA 2NX9A 2P1FA 4RLIA 5I6SA 2G97A 3K8MA 2GFTA 2NXHA 4JIEA 1ZJIA 2XN2A 3AMGA 1DJYA 2FPTA 3CWOX 4E2DA 2WOWA 1XC6A 3S83A 3RLGA 4O8AA 3MSGA 3LXDA 1M65A 5BXSA 5I23A 1VEPA 1OGGA 3AHZA 5FEXA 4C91A 3REQB 1V6VA 3RU8X 3SR7A 2PDKA 1LG1A 4J3SA 3WO8A 3LCGA 4L6OA 1CI1A 5JBFA 2VOMA 4NEVA 5DCDA 3BLOA 4EQSA 2KAUC 1XGZA 1T6MA 2OQYA 3WQGA 4QS5A 1TMQA 1V0LA 4FXFA 1ISXA 2XVGA 3BQ5A 4WF7A 3R43A 3V3WA 1JPMA 1BXBA 3LV6A 2E3TA 4JQ3A 4NRSA 1FWCC 3BLDA 2GDUA 2XN0A 3IV3A 1XBXA 5I24A 1SFSA 4W89A 5CSRA 5CSSA 2HK0A 4GKTA 2PGRA 4J3ZA 3NUKA 3AIEA 3NURA 1RHCA 4GG9A 5D30A 3SQMA 1AOGA 3RCYA 1Y5WA 1DWIM 3PVFA 3AIUA 1H1YA 3ANYA 2J7GA 3I10A 1PYFA 4MLJA 3FA3A 3WQDA 3W3OA 3L0GA 1MXDA 2FVLA 3EOUA 3GC4A 4LVAA 4YN5A 3HRDC 3RLHA 5AC6A 3UWZA 4Y9NA 4HU3A 3N4EA 3ZYZA 1TTIA 5A8NA 3NS1B 1XIBA 4Y2WA 2BVDA 1D8WA 5TR3A 3D3FA 5K9XA 4H9ZA 1S2UA 5HULA 3QQWA 3GDLA 1M03A 4H50A 3UZYA 3MA8A 3BSHA 4GH1A 1SZNA 3H2EA 4UWMA 1KXTA 5ECVA 2GR2A 3OBEA 1PV8A 4PMJA 2NXGA 3IACA 4MWAD 5D04C 3WJZA 3HZ3A 4GY0A 4TU1A 4XUGA 1QWKA 3WQEA 2ZRXA 2QUTA 3P67A 1WZLA 3E3HA 3H70A 3QPEA 3VGBA 1P0EA 3I6TA 2OQHA 1GJWA 2GDVA 4KW2A 4B3ZA 3W07A 1HVXA 4EANA 3E74A 1Z42A 2W91A 5HNNA 3LTPA 3IAQA 2PDXA 3CHVA 1YEYA 4MB5A 1I9CB 4OBSA 4U28A 3RPMA 1UZ4A 4AQLA 3EOEA 2YFOA 1TV3A 1Q4WA 2R1PA 1O1HA 1B9BA 4G5DA 3OOQA 3WELA 3W75A 1P7TA 4V28A 4IJBA 3H2OA 5AN7A 2CLMA 3AZTA 2OYMA 3O6AA 3VGEA 1TPUA 4H7VA 4HK7A 4MOZA 4UQEA 3T81A 1SJCA 3RR1A 2QIWA 3ISIX 1OFRA 2CYGA 1DL3A 3JZEA 3BZJA 3VU2A 1F76A 4FOJA 5G1TA 4BQ2A 5BZAA 4DNAA 3K4DA 4IMGA 2G0WA 1WO2A 4WQ6A 3VNYA 3RITA 1NOWA 1N5WC 3AS3A 5BMXA 5LXXA 1Z41A 1RJPA 3VILA 2NLIA 2X1RA 4UZSA 3C4UA 3FYYA 1XISA 1ONWA 4ORIA 2V63A 1QI3A 1HFBA 4ZB5A 3TTOA 2WZTA 1G4TA 2WSYA 2Y7DA 4HPNA 2PP1A 3AXXA 5F2GA 1X2GA 2PSNA 1EWEA 4M52A 4IIFA 3ARYA 1ZP3A 2B7QA 3CB3A 1H63A 1XF0A 2YOCA 3CHDA 1KTNA 4S3EA 2Z6JA 4QTGA 2Z00A 2XVKA 2PI6A 3A47A 4O0KA 1XD0A 2JIWA 3CAWA 2YCLA 2W3ZA 2WC4A 1TUFA 2H6RA 3QSTA 4JPGA 3CQJA 1A47A 3PUOA 4H04A 3CK5A 2Z1BA 1C8YA 2BBFA 1WZAA 1V6WA 1NIUA 1ME7A 1KW1A 3QV8A 4NZ1A 5CZKA 1CLVA 4PUKA 2QMKA 3L21A 4NT0A 3PZOA 3T44A 1U5JA 3T7VA 3E49A 1GQLA 4IXHA 4CU7A 3I4EA 2XFRA 3VM5A 2PWVA 3WLTA 1DIEA 3ALFA 3M6DA 3WJXA 2VZVA 3NVWB 1Z32X 1SZEA 3QR3A 3M0HA 3C8NA 4HK6A 2GR0A 3U5UA 3W1QA 4EMWA 2W9MA 4UTWA 4GCAA 2CBUA 1R30A 4HNNA 4TVYA 1SSDA 5C55A 3KOXA 4O28A 1W3IA 4O11A 1GG1A 5GVJA 5HJYA 1JZ6A 1BKHA 1Q6QA 3KLLA 4L9ZA 3RLVA 3EWUA 4M8UA 5D37A 1A3XA 1UC5A 2XG9A 2PDHA 9XIMA 4PB4A 1KO0A 1CXHA 1J0ZA 4W84A 4IGHA 3WUFA 3QKZA 4GD0A 4LS0A 3UZJA 1FFVC 4I7VA 3WMCA 4M56A 3WX7A 4G8TA 1A53A 1FXPA 1Z3NA 3A3HA 4L4LA 3PBMA 3FGCB 3LXBA 1I2NA 3F7JA 4AZHA 1PX4A 4WDTA 2Q01A 3F5KA 2ZBTA 3FSUA 4A3QA 1LVLA 5J04A 1JR1A 3TW7A 4D8AA 3QOKA 4H9VA 2Y5JA 3N2OA 4UMAA 2VWSA 4QX4A 4Z08A 3V5FA 4GVGA 2YYUA 4PBFA 3KM8A 2OZ3A 3CWHA 2FZBA 4JCLA 4O4VA 1Q6LA 4HVXA 5CC7A 1E0UA 4H4XA 1FWNA 1TPEA 2DZWA 5C7HA 1Q7MA 2L5HA 1DVJA 1Z8AA 2JKEA 2EG8A 1JRCA 4MIMA 3ABOA 4QSFA 1H0IA 1TV5A 1XL9A 2OELA 1M7PA 3P84A 2WO5A 2WOQA 2JIEA 1M5WA 4GNKB 3DUGA 1JCYA 2FB2A 4IHCA 2E25A 4R34A 4RPPA 4EAMA 1SVDA 2PDCA 4QITA 5ABHA 3WBEA 1XC4A 1QU4A 2OLHA 3PZTA 7REQB 3LPGA 4OJYA 1H7OA 2W79A 3QV9A 3BURA 2EO7A 3G6MA 3QVQA 4MWAB 2PDWA 4O0QA 3RRAA 2NQJA 1R85A 2Z26A 1WBHA 2FHBA 1E0XA 2WPEA 1GQKA 1OT1A 2Y63A 3NFUA 3TEVA 1GOKA 5LA0A 1J8VA 1EBGA 1SB3B 3S1WA 5CPLA 2LLEA 1QFEA 1TPDA 4FIQA 4MLRA 2ZZ1A 3L7RA 2ZE0A 4ZEPA 1BQCA 3CMFA 4O19A 2J27A 3MANA 3SCSA 1XIJA 1E0WA 4E4PA 4HB7A 4XBSA 4US6A 3G1RA 1HP4A 1XSIA 1KFLA 4AZGA 3NQ7A 3BSMA 3MWCA 1EC9A 1FCBA 4P2VA 3HPZA 3MSYA 4MTVA 2R91A 5I7GA 2QCEA 3WLLA 3E0LA 3GNRA 4AF0A 4E3VA 4HSHA 4LV9A 5CGTA 2YDQA 1XDJA 1IXOA 3WQ8A 4LUSB 1TTQA 4HYRA 4CCZA 3STGA 2YCKX 3V16A 1SR9A 4FXRA 4F0LA 3MUXA 1EHAA 4IQJA 5HUOA 4JXCA 3A4AA 1JL8A 4J1OA 3E96A 4NKCA 3GU2A 5CLTA 5F1UA 3P5YA 1NSJA 3IIPA 4B2DD 3DFSA 3HPFA 3U5YA 1HO1A 3WD2A 5D32A 4PTNA 1ZLPA 1QI0A 5A2BA 4LAMA 1EIBA 2DVUA 4UNKA 3NO3A 2JF7A 2WSQA 3H4XA 4FIRA 3SUTA 2BGQA 4XO6A 4OFCA 3CT2A 3TOPA 4UBPC 3VOIA 2X7WA 4JIRA 2Z29A 3A7UA 1RK6A 4GGHA 3WKZA 5D9NA 3TW6A 4E2OA 2DZUA 2BASA 4N9DA 4UTLA 4AIBA 4CEXC 3C3UA 1ONRA 1E9LA 4EOUA 1X1OA 4GFIA 3BG3A 3TYAA 2Q6ZA 3DHDA 2FZNA 2XIBA 4B9YA 2GQWA 3ES8A 1HVQA 1LBLA 1AVAA 3WNLA 4GOAA 4HHHA 1DHPA 3UVAA 1OD8A 1TIMA 2EPHA 1ITXA 4C1KA 5EBUA 7REQA 3OLGA 2NVCA 3LLFA 3MUZ1 4G7FA 1L0PA 5AECA 3TNOA 3S6TA 4B4FA 2WJEA 3UERA 1JF5A 4HGXA 2WCAA 2A3CA 1XPGA 3HU7A 1CXKA 3GD4A 4B2DA 2AGKA 2GVEA 3MTWA 1PXGA 2Z1XA 1K4QA 3LB8A 5KSWA 3OQ8A 1W1TA 3G6LA 1S2WA 3IARA 3CV7A 2RUSA 2BS9A 3EWZA 3DG3A 1IXQA 1GV4A 2Z27A 4O52A 3TJXA 2C16A 1VJZA 2HNHA 4C65A 3TXZA 4TQTA 1N82A 1J0YA 1QPNA 1SZGA 4Q8TA 1LOLA 1GVIA 1OK4A 4XAZA 3PZIA 4YXGA 1D7FA 4QHRA 1GT8A 2Y89A 1YKWA 3TFXA 4P7LA 3AWNA 3LPOA 2HISA 4IMCA 4QEHA 4ZQRA 3LB0A 1WAWA 4P8VA 4KPRA 1RP8A 4I3GA 3OZYA 1WDRA 1N2VA 5C6MA 4HZ8A 1DOSA 2C13A 3V0TA 3B0UX 3NA8A 3NQGA 2FVMA 5A6JA 2A7NA 4HNTA 2VR5A 3KOWA 4RZ6A 4IWWA 4ZMGA 3B97A 3G2GA 3LNPA 1Q7ZA 2VEPA 2YXXA 4LBRA 1MZHA 4FEZA 2JGQA 1DQXA 2A8XA 3KBVA 4POCA 3V7PA 4RK8A 1L2QA 1UWUA 4KF1A 3CAKA 2ANUA 3CZJA 3DGZA 1CX9A 3W81A 1D2KA 2A85A 3BJSA 3L9CA 4EXAA 5LNWA 3TAOA 4C6QA 1JNDA 3TZNA 5MKGA 5EKYA 2V5BA 2G96A 4LRTA 4J57A 1DJXA 5F4WA 3G1YA 2BVTA 1E5NA 1QBAA 4DQWA 1TA3A 2F2KA 1WZKA 5FSEC 3W1AA 3F2BA 5KTLA 4GVHA 2GR3A 3THCA 5DT5A 3UR8A 2CHNA 1ZL1A 2YAUA 4KIEA 1GSNA 1A80A 3GYCA 3LCHA 2CLEA 3GNPA 3M46A 5DN1A 3PS7A 3DFYA 5EBAA 4RX0A 1FH8A 1ML1A 3SURA 2XIMA 3SCRA 3KBNA 5FF2A 4URIA 1QDSA 2GSHA 1GYLA 4KEUA 2E5BA 4ADWA 1ZK7A 3T2QA 1GXFA 3CO8A 1E70M 3ANUA 1YTEA 1Z44A 4O8RA 3FW6A 4EWND 4YWSA 3KOYA 1U1UA 3D9XA 4W4QA 3R0UA 3D0CA 1JZ8A 4MDPA 3IC9A 4QR6A 2NSOA 4JTLA 1DWHM 3M16A 5CBJA 4GI9A 4NG3A 1XS2A 1NEYA 2R1NA 1CXLA 3T4CA 2WP5A 5FOOA 2OODA 4LB4A 4GR1A 4MDOA 3ITYA 3SSZA 3DESA 2O4QA 3PZ9A 1NF7A 1DP0A 4GNVA 5FF0A 2FZ8A 2XIJA 4BZYA 4MFEA 2C6QA 1UP0A 4JHMA 4MADA 2DV0A 4KH2A 1X97A 2ZZBA 4WGXA 2WOVA 1IEXA 1R2RA 2YKKA 2X1IA 5T91A 1H60A 1IIHA 5CPNA 2FKPA 1EO7A 3C2VA 4K2SA 4S3FA 3PF3A 1FOBA 4NZCA 3ZIZA 1JXKA 4AAJA 1VEOA 3W2UA 4JN8A 3W2JA 3UZXA 3L4WA 1W0MA 2D2JA 2EAWA 3VD5A 4WOZA 4K6AA 5TQLA 4M19A 5HANA 3LZ5A 3DJGX 1AQFA 3NAVA 3P93A 4GRSA 2I14A 2O92A 4ZO6A 4WY0A 4QXIA 2E09A 4E2BA 1CNVA 1OEPA 3W01A 3RO8A 3ECQA 4GUHA 3QR0A 1H0GA 1M7XA 3AU6A 4R53A 3LPPA 4W93A 2GUUA 4DAFA 4H8UA 5I0DA 1OFOA 1W54A 3VZXA 3Q94A 1A3HA 4OWGA 2GGIA 2YW4A 4BFAA 4F9JA 1VBGA 2OLSA 3O6YX 2D0GA 2CLLA 4DF0A 3AMDA 1VYRA 3H6OA 1J5SA 2J78A 2WMIA 3BV4A 1EGMA 5CSUA 3R4IA 1UHVA 4HQVA 1E71M 2XVPA 4PCPA 2ZYFA 2BHYA 4WXZA 1PEZA 3P81A 3IJQA 3OG2A 1UZDA 1FH7A 4IXXA 4QE1A 4LYQA 1LBFA 1GQNA 3AZRA 1OX4A 3SIMA 1YTDA 3I68A 3TE9A 3K46A 4W7WA 3DK8A 3LHUA 4YNGA 3MJMA 1V6UA 1CGXA 1W1IE 4BR1A 2JKPA 4JTRA 2IPWA 4UTTA 3QGKC 2AQWA 3ZJ8A 4Q8QA 4BURA 4MKSA 4DJDD 2GOUA 3WH6A 5I06A 3M0KA 3SR6B 4JX4A 3HQ1A 1HKJA 1OCBA 1M53A 4ZCWA 1YBQA 4B5NA 4XZLX 2QMJA 3HG2A 1PTDA 1HJVA 4DZHA 4NEWA 7PTDA 3CQIA 1QNVA 1J93A 1ZJBA 3N9RA 2WJDA 4GQRA 5HATA 3IUDA 2IQDA 4DUWA 5CJMA 3I6EA 5D8ZA 2X30A 2V5DA 1LRTA 1DJZA 2OO0A 1XXXA 3ARTA 1SFJA 4HCLA 2WBGA 3ATYA 2X8HA 4BF9A 2YPIA 4GGBA 3MB9A 4MJ2A 2NVKX 4LW7A 4NX0A 4ZGYA 1F8IA 3W2MA 4ICMA 1KQYA 2FFCA 1V0MA 1KFCA 3TDFA 1CGUA 5FAGA 3QBUA 2WHKA 1QPRA 3SB0A 1EP1A 1S2TA 1UD6A 4C6IA 4NZ3A 3G22A 2E28A 3L8KA 4MNKA 3R8GA 3WLRA 2F6XA 5HK4A 3MI3A 5C7VA 3KWXA 4J4KA 3VD9A 4TO8A 3HV9A 3M0ZA 3DCPA 3OZPA 4FR6A 3TYCA 3LGDA 3NVTA 3LXCA 3F2DA 3HJZA 4TUFA 3NL2A 5IDIA 1ALDA 3A64A 1LROA 4A2RA 1QNQA 3DIPA 3RRXA 3GWQA 3FSTA 1C3FA 4DO4A 4S3AA 4AX7A 1EEPA 1UOZA 1CLKA 4OV4A 5A6KA 3T0DA 1VKFA 1LWIA 2GUYA 2VEIA 1V6YA 2YGYA 1UR3M 3B8IA 3ONBA 4EE9A 1ITCA 1CGWA 2QNEA 2HVMA 3UR2A 2DZAA 1DHKA 3NG3A 5C5YA 1Q5MA 4IMAA 3A7RA 3WDQA 4LCQA 3VABA 2DEPA 3SSJA 5A5WA 4DWSB 2DSZA 3HGJA 1P0KA 2V82A 4ZOHB 1P1MA 4XZNX 1J6OA 3W74A 1PX8A 1XLLA 4DBUA 3PZVA 3S42A 1VHCA 3MU7A 1XLBA 2QT3A 2FGZA 2VHLA 3W82A 2ACRA 1FHLA 2PWDA 3VTRA 2J7HA 3ZT5A 3NOEA 3M0VA 5LIUX 1KFBA 2ZADA 4DELA 5D38A 1SPQA 2GWNA 4I8YA 3WIJA 2NV9A 1T7LA 4AZIA 1S5WA 3R2GA 3O07A 5CC3A 1CGTA 1LOSA 5I79A 5EFFA 1UD8A 3IJLA 4F3HA 3VO0A 1K03A 1EZ2A 3CHEA 1OB0A 4UFKA 3HGSA 4Q8WA 3WENA 4K8EA 1FP9A 3LX9A 4XWUA 3XIMA 4EXQA 3A23A 5D2TA 3UNTA 4Q4QA 3PM6A 1E9IA 3E12A 3WDPP 3E0IA 4UMCA 2PWGA 2ZUVA 1G67A 4EPEC 2ZUNA 2J62A 3H7UA 3OODA 1PPIA 1BXCA 1DE5A 2OB3A 1TWSA 4MWAA 4PMNA 4R85A 1Q1RA 3N18A 2J7DA 1A5NC 5J5DA 3GAKA 1UH4A 3AYVA 4NXSA 3CV2A 2DORA 4QNEA 1DV7A 1TR1A 2FMNA 1A3WA 1B3XA 1E6RA 2A3EA 5C9ZA 3M0IA 2ZUUA 5K9DA 4YS1A 2G4FA 2OFJA 2B7NA 3H7VA 2R1KA 3QY6A 4OKDA 3A22A 4ROPA 1OJTA 3W7JA 2DY3A 3GM8A 3TROA 4PUMA 2G8ZA 3UWUA 5JXQA 2XM1A 4QSHA 4PRTA 1WKFA 4PL2A 4QFUA 1OX5A 3W83A 1EDTA 1WAUA 3KZPA 5AZ0A 4IPPA 4XAPA 3W27A 4I7UA 1ZBVA 4HMDA 5TBOA 2REQB 3WLKX 3HQNA 4JDYA 3ONCA 3ANVA 1HTIA 5HMFA 4IG2A 3ARRA 3P0WA 4QP0A 4AZ7A 3DG6A 1QT1A 3Q67A 1UQZA 3VAVA 2F5ZA 2ALDA 3BLKA 1FCVA 1VPYA 4RCXA 4BK9A 1M9HA 1R3VA 3BLLA 2H3DA 3NGFA 2POZA 5EY5A 3UG5A 4JOMA 1DXLA 1QR7A 4A6GA 1D7YA 4H6EA 2PWHA 3MUY1 5K4ZA 4KEZA 3RX2A 3P3BA 1EH9A 1W56A 1G6CA 4LXFA 4EAYA 3WCZA 4UCGA 2WSRA 1ITQA 2FH6A 3H8AA 1LL4A 4XB3A 3SZ8A 3CZKA 1EWDA 5HR6A 4IGSA 4CU8A 1XPYA 4DUXA 1ZY9A 4C6NA 1PVNA 5B80A 4LGXA 1XW8A 2YBUA 3OC4A 1R46A 3PB2A 1OYCA 2Y8UA 3WD1A 1LORA 1QAPA 3TYUA 1YPIA 2Z1KA 3MS8A 3C52A 2E77A 3T42A 1S3TC 1TPH1 4KCUA 5G2HA 4HHPA 4UB9A 3ZR5A 5DXYA 3DECA 3HGRA 1ZCOA 3INPA 1AZ1A 2VXNA 2HMCA 5H8UA 5LHEA 2ZDSA 2BZNA 2VOTA 1J12A 2Y7EA 2GRTA 3B0YA 2NT1A 4ZTYA 2P3ZA 4L64A 3QHOA 2G3IA 3QFWA 4JYFA 1TPFA 2PTDA 3TN3A 3ITTA 2E9BA 1C8VA 3EF6A 1XLGA 5F4SA 2P53A 5E9AA 4H9UA 4PTVA 3W0KA 3OYZA 3AS0A 2YB1A 5GRTA 3K5XA 5AHNA 3BPWA 3W38A 1XD1A 1FH9A 1VJSA 1QOXA 1TVNA 5J5RA 1JF6A 4JBRA 4K38A 2YCEA 4Y96A 3WMSA 1LQ2A 5DMNA 2IKIA 4DYJA 1PIFA 4PR4A 2Y1HA 2CLFA 3IGHX 1R5YA 3LHTA 4UFHA 2A5HA 1XYZA 3THDA 1XQKA 1NWSA 3NDYA 1WUFA 8A3HA 1EDGA 2GVLA 1H41A 4NI3A 4Y7EA 2QZRA 3BE7A 1MQQA 2NZLA 2NUXA 3GFXA 4DJFA 2ON3A 4S2BA 2ZX5A 3GXTA 3LSBA 4XG1A 1JYWA 4KWOA 4GUGA 5DMLA 1AW5A 3TNBA 3ZMRA 4A29A 3O9NA 2WQPA 1M1BA 3KRBA 4CQCA 2DZTA 3VI2A 3BCFA 1UWRA 1ZB5A 1LPFA 3RPTA 3B40A 1AFSA 1W5MA 2VUNA 1BXNA 4NYUA 3IJ7A 1HKMA 4PTXA 2RJGA 2PS2A 4RPQA 1TG7A 1Q6DA 4B3KA 2FTPA 2VT0A 1BGGA 2EQDA 5FEWA 5EMUA 2D2GA 3DJJA 4P5UA 4RDYA 4PUJA 3SCTA 1R3WA 3VCRA 3WNMA 3IV8A 1V93A 4LYPA 2WHJA 2Y62A 4W86A 1QUMA 4RNFA 2VX5A 4B15A 3TMLA 5BMWA 4YCPA 4JL1A 2PBOA 5FF3A 3BCDA 2AL2A 1IE7C 2GQ8A 2WOIA 1ODUA 1UOKA 2XINA 2W5FA 2CLKA 1IEVA 2VC9A 2VX6A 5MKGB 1DORA 1IWBA 4HA0A 3BVJA 2X8GA 4WOQA 4DZIA 1OZQA 2WSPA 4NJIA 3LERA 3SCNA 1HP5A 4IL0A 4LS2A 4RV3A 3E2QA 4IISA 3A9BA 2RABA 3E9AA 3PJWA 1U30A 2QJHA 2D73A 4FK9A 4FPSA 5HMSA 4AZ6A 4US5A 2H8ZA 4MKVA 3UY7A 5C0QA 3KDNA 1XDIA 4TX6A 1PE1A 5CZSA 1YXCA 2WP6A 3S9YA 3SY8A 2WKLA 4Z1YA 4DPPA 3UPMA 2CEQA 2QPUA 3M7SA 5CZ0A 4YHEA 3PANA 4HYWA 2YZ5A 3B8VA 3UXDA 3G5EA 4CQ9A 1YDVA 3NVDA 1AODA 1XHGA 3UXKA 3ARQA 1Z7AA 1KC7A 1MI3A 2OJPA 4WZHA 4DF1A 1XQLA 1NWTA 3ID7A 1RM6B 2QJGA 5B7ZA 4LFYA 2XJ7A 3OLEA 3VM7A 1XCWA 1UZHA 2A6LA 2ZQ0A 3CPRA 3B0XA 5E0FA 1GVEA 4BHYA 3IJDA 3MI2A 4IGNA 4PC8A 4LF2A 2V9DA 4QJ4B 4ZODA 4CD7A 3AS2A 3VNIA 4Q8OA 3I7SA 2FFIA 4P7QA 1J0IA 2NWSA 2PLMA 1RLCL 1IF2A 4JTSA 1XFBA 1RK5A 2ZC1A 2EJ1A 2GJPA 3UJSA 4XBKA 4KCVA 4D6GA 3MMWA 1J5TA 4ATDA 3EB2A 3KVKA 3BZGA 5E0KA 3ITLA 2OZ8A 1XJBA 2V2HA 3DYMA 2Y7GA 4US5D 5CXPA 3REQA 1XLDA 2BX7A 4LYKA 4UCFA 3WQCA 2RH9A 3NL3A 2W62A 4GXWA 3IRSA 3R89A 4JTQA 3K8LA 3VE9A 2DPEA 1GRHA 5CH9A 5IFPA 2QJMA 1LUCA 4NQ1A 2TRSA 1NOFA 4XZBA 1EPXA 3CPUA 1IYXA 4CNNA 1JDCA 1UD5A 5C2CA 1QW9A 3WJWA 1UROA 3WBXA 1TRIA 4AYSA 4WD0A 3O7UA 3WD3A 3O06A 1R9XA 1XSKA 1LOQA 4GXMA 2C15A 1DTNA 1ZNNA 3WD4A 2FTYA 3QW3A 2PDIA 5CAKA 2FDMA 2PDPA 4P61A 5A95A 2QHAA 1GGOA 4XTIA 2NLYA 2V2DA 1DWGM 1MUWA 5AC8A 4JEJA 1Q2SA 3GG8A 2W0HA 1BHGA 1CIUA 2E6DA 4OUEA 4MAVA 1EUNA 5BYWA 3EKLA 3EA2A 1YADA 2EJAA 3D5HA 4B3LA 3E2VA 2QXWA 4H00A 4EP8C 1T40A 4QM1A 1KLYA 3S2LA 4N9BA 1M04A 3EXRA 4MKNA 2GK1B 4C60A 4U31A 3RUBL 4FO4A 3AS1A 4WY0F 3D6NA 4PBEA 3VNZA 3U3HA 1WXYA 3MDWA 3BMXA 3O63A 3WG6A 1I8JA 1FKWA 2MNRA 3QPZA 4LBUA 2ODOA 1O4UA 3NL5A 2TYSA 4O1AA 4PB3A 1ZX9A 9RUBA 3CEUA 2XGIA 1I45A 2VVSA 3UWQA 3F2CA 3CJPA 1SO3A 3ABQA 1J79A 1MRAA 2WZHA 5AKQA 4AY1A 4JYEA 4DJED 1EJTC 3G1AA 3NYZA 4GCXA 1MW1A 2VURA 2WLZA 5IBXC 4DUOA 1EL3A 1CBGA 3WY1A 4N9CA 1ZHAA 3N17A 9CGTA 4AEEA 3QY7A 4Y8EA 5IFTA 1TCDA 3CUIA 3BMVA 2PCQA 3SAZA 3AYTA 3WMLA 1KWGA 3B9OA 4IIHA 3PJTA 1AD1A 2ZE3A 2QCDB 4HU0A 4RW5A 3GZ3A 1N8IA 2XDFA 5HMDA 2DSKA 4H2CA 1Z89A 1W1A1 3W1PA 3DH7A 4Q6JA 2PZ0A 4H01A 3ZWSA 1G4PA 3NZQA 4MUPA 1G4EA 3MUCA 1X98A 1ZP4A 4LY8A 1TSIA 4GI6A 4I5XA 1JXJA 3WJSA 3ZLGA 2OWCA 2W61A 2EPOA 4ZQCA 3PTQA 1UWAA 1F6PA 2QAPA 4AU0A 3UPBA 3Q6JA 2TPSA 3SW6A 3TC7A 4IMFA 4KIRA 3PNUA 1NDWA 3CXBA 1H2IA 3PFMA 4GYFA 1B3YA 2YDRA 1JPHA 1XIEA 3BGAA 3IGUA 4XAYA 1ZDLA 2G50A 1S1PA 4MY9A 3CGCA 3T05A 3BAXA 1EB3A 2P10A 2JEPA 4DYEA 2ZKMX 4H4YA 1GONA 2J8TA 1ICPA 3H12A 2OT1A 2OLAA 1XLJA 3WF3A 5AFDA 4DUVA 3IIVA 3PBVA 3RU6A 4C5ZA 3KRUA 3TC3A 4LCRA 1K9TA 2I5QA 5D9PA 1K8ZA 2G41A 1H1ZA 2H9AB 5LKYA 2WWDA 2NUYA 4M6PA 1V79A 1KM0A 3PBWA 4GY7A 1VF8A 3AJXA 1CECA 4J3VA 1IEQA 3AMKA 1BF2A 1NH6A 2IPJA 3QTPA 4DJEA 2WVTA 3QGAC 5M5DA 4HZ7A 4WEVX 2DDXA 4ZOBA 5GJPA 4M81A 4A2SA 4AUBA 4U3CA 5A94A 1JCNA 1AH0A 2E5DA 5GNYA 2A79A 4BJHA 3GAYA 4IFOA 3C8FA 4K7YA 1DWFM 2Q8XA 5C70A 4WKFA 2HBXA 3W00A 1UCWA 3S46A 2WMGA 2VO5A 2KZHA 2ACUA 1TMLA 1G9HA 1G01A 1ZRQA 1W5QA 3EKZA 3WFAA 4E4UA 3W85A 3EWWA 5JCMA 3P14A 3QF0A 2ZUMA 2AMXA 3RLUA 5DMYA 2FMOA 4YHGA 3CAVA 2VCBA 2YSWA 4W85A 5LXEA 3RFAA 5DANA 3W29A 1W5PA 2QVHA 2UV8G 3TQPA 1UQYA 3FGCA 4XZ9A 3ETRB 3WNPA 1TIWA 1F73A 4UTHA 3O8AA 3NQMA 1R2TA 4GVFA 5I77A 3IJ8A 2I16A 1BAGA 4GXPA 3UP8A 1RD5A 2HVNA 4AW7A 1IR2A 1L6SA 1NM9A 5CG0A 1C90A 1EBDA 5DY2A 1DWJM 3G0UA 1R6WA 3T8QA 2NW0A 3SY1A 3N19B 3N4FA 4D6DA 3EA3A 4LTSA 2VFFA 4FXSA 1CXFA 3QJAA 4AZCB 2HNEA 3VDAA 5DEZA 3EDFA 1NHRA 2UBPC 2R1MA 3R8HA 2OYKA 3U9IA 1R3RA 4H9MA 8XIAA 3BAJA 2XPKA 3MVTA 1JAEA 4MWAC 2ZRVA 3W7GA 4C6DA 3FKKA 1LQAA 1C29A 1DE6A 1KFKA 3OGVA 2BXZA 4IX2A 3L5OA 4AHOA 5D2VA 1QI4A 2V6AA 3KCJA 2FHFA 3SN4A 5H8MA 3S5SA 4UTKA 4WJXA 1W8GA 1QHZA 1V7AA 2H9AA 5AYZA 1W32A 1KGXA 3B05A 4AMCA 1BSLA 3N2MA 1A5MC 5A2AA 3RNMA 2R8WA 2XH4A 1EJWC 1FHVA 3QZEA 4DWSD 1PHQA 3WLMA 1L6GA 3E5PA 2BTMA 4H8VA 5L6UA 4DXXA 1K4HA 4GJJA 4AIOA 4QJ5B 2NVDA 5CGQA 1AQMA 4DZ5A 3RILA 3APTA 4H1ZA 2WJFA 3WUEA 6TAAA 3PP7A 2UY2A 1PTGA 1GVQA 5AZ1A 1R2SA 4OOUA 3FA4A 4DJDA 3GC2A 3N6JA 4AD2A 4KWUA 1Y5XA 1AW2A 5AVNA 5I3FA 3LDVA 4IOTA 3IK2A 1JRPA 3PN8A 3CO4A 1C93A 3FVMA 2W6RA 2V3FA 4NAEA 1O1ZA 2WWCA 2YB4A 3H21A 1RVGA 1UWIA 3ZSTA 1AMYA 3JZUA 3NO5A 3MHGA 4W5ZA 1QPKA 3BOLA 3OLDA 2QJJA 4JD4A 4C1NA 3S3GA 3G1VA 4QROA 1M3UA 4HHLA 1HL2A 4TXEA 1QI2A 3G1FA 1NAL1 3QMTA 4QCFA 2I1OA 1U1JA 4AWTA 2NT0A 4PODA 2BDQA 4ZENA 1OFPA 1FECA 3B4UA 6XIMA 1QVBA 2XHYA 2G3JA 4B91A 3APYA 3WLJA 1Y0EA 5FS8A 1QXLA 1N60C 4S3CA 4C6MA 5LIKX 2XIQA 1VPQA 3CH0A 3VD4A 5G2WA 3J7HA 3F4CA 1LRNA 1VBUA 1N5XA 3THAA 3O3RA 5FL1A 1R87A 2BWGA 4I9MA 1C8XA 3AMCA 2Z7GA 1H7NA 4HSNA 3TV8A 4CCEA 1T5AA 2J9YA 3TSDA 3OVPA 1KXQA 2ZCGA 3ZJ7A 3TYZA 3PK7A 5DBTA 4AY7A 4W7VA 2X1SA 1FDZA 3HN3A 4H7CA 3W84A 4D1IA 2EF9A 2V6OA 1RXOB 1M7JA 3GXIA 4R7JA 3DG7A 5F2IA 1KNWA 5TIMA 3VC6A 1POJA 4TIMA 4KFPA 3N6HA 3M4HA 2ZZCA 3VOJA 4CQBA 3CGBA 5K3VA 3K2GA 4NJJA 2E40A 4N02A 2C19A 2ASHA 4Z2LA 4HMEA 3DGHA 1VIWA 1ISYA 2INFA 4JHZA 3CUGA 3LLXA 1ME9A 2ZUWA 1UZ1A 1A0DA 1Q85A 4M82A 3U8GA 1TYGA 3DEQA 3UYCA 4NZ5A 1GCYA 3KRSA 4AVNA 1OYAA 4L6HA 1MWOA 2R94A 3JRKA 3QC3A 3LCFA 1W3TA 2Y2WA 3FJ6A 3PJXA 1US3A 5E09A 1V59A 4BV6A 3IJIA 3Q2DA 1EJVC 3EX2A 4KBXA 1PZ3A 1KN0A 2D24A 4TX8A 1M6JA 3WDHA 5FJUA 1CW2A 4IFRA 2CERA 5C9RA 4A8LA 1QRQA 4AZ5A 4H4RA 1CEOA 3S6DA 3DN5A 3CYVA 2Y70A 5E70A 3DFHA 3GKFA 4B5TA 3N1AA 1J2WA 4NAEB 3SGZA 1WB0A 4EQWA 1UUMA 4UTJA 1NHPA 4GINA 1S3HA 3L5MA 1AQHA 3A3XA 2ISVA 1IXNA 2FTWA 4H19A 3URNA 3KTSA 3A4WA 3GYEA 1ONFA 1IV8A 3WQVA 3GTIA 3GSMA 4H4UA 2Z2UA 1ZU8A 3GVGA 3AHVA 2HK1A 3KCOA 4GHRA 4O50A 2OR2A 1Z48A 4EXBA 2VMFA 2PDQA 3OHMB 3CLWA 8CGTA 2WPGA 1B5TA 1UPPA 3M64A 4FLOA 5LGZA 4AD1A 4PTWA 3ZM8A 5CC5A 4OQVA 1GHRA 4NNBA 3TKFA 4XSLA 3LG3A 1GJPA 1PYMA 2VI0A 4ACYA 2P0OA 5RUBA 4IQEA 4Q4RA 2CNCA 4RNHA 1BFNA 4JDRA 4K8DA 1POKA 4NL1A 3DKJA 1C9WA 1W8SA 1E6QM 4GIYA 5HAOA 3SUVA 3FDKA 4QLKA 1W17A 5BOFA 2PDYA 2PDMA 4RKAA 5AHMA 4BWLC 2OPJA 4ERAA 1SO6A 4O1BA 1KXHA 1TA3B 5XIAA 3LBMA 2CXEA 4CEUC 1R3SA 1I75A 4R7OA 3LPFA 4UZUA 1EEXA 2DQXA 3O6DA 4WRHA 5EU9A 3MVIA 2VR4A 3CYJA 3P6LA 1ZBCA 1GRGA 1B1YA 3FJ4A 1SR0A 3RX4A 1NDZA 4Z2HA 2QVNA 3NNTA 2ZDRA 3EPOA 2QUMA 3NSNA 1LUCB 3V1PA 3EB3A 2DQWA 2WW5A 1FHUA 3R11A 4EPKA 1QASA 3L2MA 4UIOA 4R3UA 5AYIA 4DBEA 3TJLA 1R86A 5GNXA 3U6WA 1LL6A 1OY0A 2QCGA 2Z7KA 1XH2A 3ZR4A 1BF6A 2H8XA 3M0XA 1HX0A 3M41A 4JY8A 4PSPA 4NJKA 3K4WA 4A3YA 3KZSA 2J8GA 3WLHA 3N2XA 4RV8A 1WDSA 4B5WA 1K70A 1NOUA 4YVPA 1RALA 3L4UA 2OQLA 4LEFA 4F2TA 2IUZA 3WBAA 4FX8A 1VCVA 3EX1A 4RDZA 4XZMX 1FA2A 3VKCA 2WANA 5XINA 4ZB2A 4LYRA 1FXQA 2YCLB 4PA8A 5LNUA 1OFBA 3NM1A 3OGRA 3MYOA 1OX6A 3NQ6A 3VKDA 1UUOA 3MPGA 1SJAA 4I5RA 3N73A 4GQBA 2VZOA 4XD6A 1E3ZA 1YPFA 2J77A 4D1JA 2GK1A 4PBGA 5KMYA 1BKSA 4MYAA 2Z1SA 1GORA 3P7YA 3UCCA 1YXDA 4Q3MA 4R7WA 3OGSA 3PUDA 1M01A 1UASA 5EMJA 2VM8A 3EBVA 3VK5A 3AIQA 3OA3A 2QW5A 3VDGA 2CLIA 4JFUA 1J0HA 1K4GA 3L5LA 4ZQMA 2WPCA 1KBKA 3AHYA 3DDMA 4NNAA 1TYTA 4GC3A 3P61A 4UOQA 4X63A 4KKXA 3SBFA 3W70A 3N6QA 2J8FA 2AAMA 1F07A 1UIOA 2VDHA 7TIMA 3IGXA 4WY0B 4ZSUA 4GRTA 4PFMA 3P74A 2C1HA 1XLEA 1S2CA 1R9ZA 1EA0A 2GQ9A 3LN3A 3LM3A 1MQPA 1UR2A 3V0UA 4V1XA 3WL1A 1XRVA 2GOKA 4JTKA 3EOSA 4MJ4A 4BI7A 3BCJA 4FDCB 1ZZMA 3HG4A 4DZAA 3H55A 3E02A 1LG2A 1RR2A 2CBVA 3BW2A 3G0SA 3URAA 3WF4A 3DFPA 3LEPA 1LYXA 1B3WA 1UPMB 3W6YA 1GK8A 3NOYA 4OBTA 3CHFA 4J2PA 1OCQA 1J9YA 4HNOA 3K8KA 1IWAA 3QC0A 3LCIA 1SSGA 4HNLA 1W1B1 4IIBA 1V0KA 1S5TA 2OEJA 2VP8A 4DNMA 1FFRA 1TRDA 1GVRA 2YFNA 3N14A 4LBSA 4EPBC 2VL4A 2V3DA 4AG0A 7ODCA 3L4XA 3TJIA 3R10A 1VQZA 4DM1A 1XV8A 2QR6A 4O54A 4P7OA 1LWHA 2AOSA 4MB3A 3NO1A 3I4KA 2ZUTA 4APNA 7XIMA 3GQYA 3HM7A 1JCMP 1GPFA 2GJNA 4E8DA 3FYPA 4UFMA 3R58A 4GH3A 3GY1A 1YX1A 5HUPA 4ENLA 3PY2A 3ALGA 3VXGA 1CWYA 3HQOA 4H8NA 3GBEA 3E2SA 4JEQA 5ABGA 5FJOA 3TU9A 1WYIA 3H2CA 2OWWA 7ENLA 1JROA 1MSSA 2WV8A 3PR2A 3IIXA 2BGNE 2IKGA 4MNLA 1G0CA 1FCQA 3B8SA 3MCNA 1TUXA 2QUUA 2WSKA 5BRPA 3VCCA 1EJUC 2YIHA 1L6WA 2OSYA 1TMHA 1DJGA 3XINA 4UQAA 2HXUA 4XD5A 3FDGA 1BG4A 4FNTA 4MHBA 2GQAA 1X2HA 2YBVA 1ZXIC 2YVJA 5EL1A 3L23A 2GGGA 1YW1A 4U33A 5AHLA 3UZWA 2V69A 2DVXA 3S47A 1O68A 2CXGA 4EQXA 3KUMA 1ZFJA 5A6AA 3OVQA 4C7FA 5A1AA 4GIAA 2QCLA 1B9ZA 4XX6A 1QATA 5JIWA 4M1RA 1IEIA 1E15A 2GJXB 3P0XA 4PZVA 1Q13A 2G95A 3RNDA 4DAIA 4YVVA 2ICSA 4N4QA 3WLSA 4ZBCA 4EMJA 3AO0A 1F9CA 3VIGA 3CUZA 1Q45A 4CN6A 4NJHA 2ZX9A 3LADA 4QCEA 3SFKA 2DUAA 1VDVA 1GVYA 1N8FA 1UIPA 2F9RA 4DJFC 2ZVRA 4TV6A 1BQGA 3ITXA 4ZZ9A 3VOCA 3TQVA 4TTGA 1OWQA 1LZOA 1TKKA 1AQ0A 1W3JA 4GYJA 2WCGA 5C9XA 3NCOA 4M1BA 2D3NA 1EC8A 3WK0A 1UYQA 3PZNA 3BMWA 1U5HA 4MYXA 4DXVA 2GR1A 3GXMA 2O7QA 4FX9A 2AQOA 4ZSTA 3GXFA 3MCOA 2WZIA 2E0PA 3B8WA 4S3KA 3B0VC 2W63A 4WSHA 4KT2A 3CGTA 3LTYA 4UQDA 2DJLA 1WYGA 1RV8A 2OKOA 1NELA 3SRKA 5F1VA 4IPJA 5A8QA 4AZCA 1UW9A 3DU0A 5HDRA 3RJXA 2RGMA 3VGDA 1JEHA 4B5SA 3RG6A 3C86A 3W6LA 1CXIA 2TMDA 4OUIA 3LD5A 2WVUA 3WK3A 2QF8A 1J18A 3B9EA 4TVWA 2Q3OA 3LENA 3URBA 1ZJAA 2VJXA 1W9VA 2BHUA 2ZA2A 3LCXA 1EA9C 4L65A 3I3DA 3QN3A 3A9IA 5LZLA 2VDIA 1BVNP 3BGJA 3H24A 5HNRA 3VD7A 4JIPA 1BVWA 4IP4A 4ACZA 4M5PA 1BYCA 2UY4A 3KFTA 3SQLA 1PIIA 3G24A 2XSBA 1G7VA 3R0KA 5HMEA 1EBHA 3URQA 3GXDA 4LOCA 3MY9A 3VZZA 1K6AA 5AHEA 4DLFA 3CHCA 3ZLFA 4WSJA 3C2RA 3CBWA 3QHNA 5E0CA 4GE8A 5A6SA 4FX7A 2PC4A 3ARZA 5MHBA 1XIGA 1CLXA 1DJIA 1KBBA 1P43A 3NDOA 2Y5EA 2GSJA 3G0XA 4IJRA 1U2YA 3BO9A 3VA8A 3G18A 4V15A 4WDUA 3WFZA 3KL5A 4ECLA 4RNIA 3R5EA 3W1TA 1EF3A 1PL9A 1OFAA 3LV5A 1V3JA 1AH4A 1DEDA 1JIBA 1AD4A 1K02A 2VD8A 1VIZA 3FKRA 1H50A 4LAUA 3JR2A 1W9UA 3L4TA 4Q8NA 4L4OA 1V03A 3NZ1A 1P1XA 5M1TA 1ADOA 2QDDA 1J96A 4JAWA 5FF7A 4AFYA 3TR9A 4IG2B 5JMUA 1FDYA 2CHRA 2IS7A 3IVUA 1XYCA 4Z2JA 2UZ9A 4JQ9A 3Q4DA 1GG0A 1CGVA 4IH3A 3ZVIA 4Z2KA 3LI1A 2O0TA 3VIIA 4UUIA 4F0RA 4MJZA 2JALA 4DEFA 2W66A 2AL1A 1N61C 2EBNA 3YPIA 3CL8A 3CZGA 4GBUA 4ZFMA 4O1CA 3WBYA 1IEWA 2HPIA 4ZE4A 1UD2A 3AIVA 4IQDA 4FX6M 4M80A 1MXGA 4NNCA 2PWEA 4PN2A 1E1FA 3VX0A 1O5XA 1E9ZB 3QH2A 1AUSL 4P7RA 3EMQA 3CMGA 4NYYA 4W88A 4JNZA 4UTMA 1S7MA 1F3XA 2DZBA 3VYLA 1GYNA 3FEMA 3HW2A 3G8EA 1WCGA 3WDRA 2GGEA 2BGSA 4JTUA 3KBJA 3W37A 5ABEA 3LY0A 1GQJA 4UNIA 4GA8A 4FOUA 1UBSA 3P80A 3MKCA 4HNUA 1HKIA 3LTSA 4H4SA 3CTLA 5ECUA 3QOMA 4JQ4A 3WNKA 2BY3A 3R94A 2QLYA 4TV5A 4LB3A 2GZXA 1LQ0A 2Z4GA 1M41A 1FWBC 1ZSXA 5REQA 3QPYA 5DLCA 3GW3A 3KOFA 3LNMA 1XICA 3NSXA 1FDJA 1E6XM 2EPNA 2Q71A 5U1OA 1SMAA 4DLMA 3L65A 3EAOA 3F4WA 4XBJA 1G94A 3DAQA 4GZJA 3GK0A 2AMGA 3GW0A 2XH7A 1EQCA 1A5OC 4CNTA 1JUKA 3H22A 3WL0A 2VCCA 4ORMA 4Q6XA 4M51A 1H6VA 1QK0A 1XYLA 4XIAA 4S1FA 4D6EA 1X1NA 2BY1A 2WPBA 4N0RA 2X2GA 3N13A 1KBLA 1IT7A 3KX6A 1WDWA 5BXTA 4E38A 1EXBA 2EPKX 1NP0A 1SU5A 2QIIA 3QW4B 3W87A 2WC7A 3E1F1 4B5VA 1JEZA 2HE8A 2CZ5A 1EDQA 2PF0A 2FZDA 5F4XA 2J6XA 1DJWA 2Q02A 4HBKA 4GC4A 5EB8A 4FLSA 1S46A 1ZAHA 1G7UA 2CU0A 1TZZA 3VMNA 3KE0A 2QPSA 2ZRWA 3BXWA 5AYBA 3GG0A 2DIJA 1OM0A 1NWUA 2QV5A 2VTFA 1YNPA 3UU0A 3KOZA 1US0A 3PAOA 2BC0A 3EB4A 2Z6IA 3ZXWA 2GJRA 2HS6A 4ZA0A 4M7SA 1E6ZA 1DTUA 3DOPA 1HL9A 5H2ZA 1XGEA 3EWCA 4JQAA 4KGLA 3QFAA 2WZMA 2R1LA 3F5LA 3VKKA 1UR1A 3GVVA 2BSLA 3UZZA 2Z2AA 3ITGA 1UA7A 4PUEA 2E7FA 1W1ZA 4AXNA 1NQ6A 3BC9A 4DJDC 4IQLA 4QBXA 3AXKA 4I9TA 2R14A 5I3HA 3VGFA 1KFJA 2OEKA 1XIHA 1K7FA 1C8QA 4Y6GA 4JFWA 3D46A 1T3QC 4HN4A 3W1XA 5CPMA 2V81A 2V67A 4U10A 4HTYA 4R5EA 2PODA 1ZPTA 4OIFA 2D2HA 2OWXA 4GUFA 4FMVA 4PCNA 4KWWA 4QG6A 2PDNA 3UWWA 4GI8A 2X16A 2B0MA 1PJ9A 1HN1A 3RMJA 1IHIA 2ZX7A 4W8BA 3O0KA 4F0KA 3CQKA 1NDVA 1TE1A 1TELA 4PCFA 1HUVA 1O95A 2ZA1A 4AD3A 2AKZA 5DQPA 2Z25A 3TWBA 2ZWYA 4HIBA 2C0HA 3SGGA 3W53A 4MM1A 3EWDA 4A3RA 4PMQA 3MV01 3HPSA 5I78A 2VELA 3EAUA 1PWLA 2WMIB 4RZBA 1MRQA 1MUMA 2TAAA 1VPXA 1MEHA 1F8WA 4AY8A 4LA1A 2VC7A 2YCJA 4LSBA 1OX4B 3KTCA 3C0QA 4EPDC 3GO2A 3UG8A 4QJ1A 3GH5A 3UR5A 2EQ9A 3AI0A 3MWAA 3PZQA 5G5IA 1TO3A 1GRAA 4J56A 3EKGA 1XH1A 4FI4A 2X42A 3TYBA 4DHGA 3AJ7A 3PPHA 4WIWA 4TVDA 2V5LA 3H2MA 4JL2A 1NJJA 4UQBA 4AD4A 3S0CA 1QOPA 4K8GA 4L9YA 3N3TA 4JY9A 5H6HA 3QKEA 2YL5A 5D2XA 4TR9A 3IUIA 4LV4A 1GWJA 3OA5A 3WEZA 1RBLA 2D0FA 2J75A 3EWYA 3O6CA 2X8RA 5LNVA 1E4LA 1GTEA 2CLPA 5F2LA 3HOJA 2VNCA 4NZ4A 3EEGA 3EYPA 3W7MA 5IOBA 2OXNA 4U2YA 1VBHA 1KRMA 2EQ7A 5M17A 2EKCA 2BFGA 1ODZA 3FK4A 4RXFA 4AC1X 1O12A 3QFBA 4MZ1A 1F74A 4WJEA 1PTAA 4JGDA 2PTYA 3GDTA 1VFHA 2B81A 2EPMX 3QEZA 3QHMA 3LOTA 4CD8A 2BB0A 1H2JA 1V97A 1VFLA 3MMTA 3TTSA 3CC1A 5FEPA 4JICA 2A4AA 3E0FA 4MZYA 3GR4A 3NPUA 5TF0A 5KVHA 2Y7FA 1A0EA 4H9XA 5ER0A 4D6HA 3G1XA 3R13A 2P0IA 5FCZA 1LDCA 2BLEA 1HJQA 2EKGA 3TFCA 3IS4A 3AWOA 4S39A 4Q4MA 3W2LA 3NPWA 4M29A 4MFDA 4O16A 4XVEA 5GNZA 2GSEA 1NWRA 1FQ0A 1ADDA 4X60A 2DSVA 4PMYA 3STFA 3OIXA 1E43A 3QZ6A 3NPVA 4NY2A 3IJ9A 4QAIA 1QW7A 3QQ1A 1F6KA 2OYLA 4WVXA 3MKVA 3N3MA 2PLJA 1QNSA 4AVFA 2D69A 2DJXA 2YL6A 4DX3A 1OGSA 1SUXA 2YDSA 2FDSA 4O1FA 6ENLA 2ZXDA 2QEZA 4OVXA 1VYSX 1EQPA 4WHBA 1OIFA 4L5ZA 4Y9OA 4Z17A 4LQ1A 3NEVA 4OZOA 1TQXA 3MT1A 1GKPA 5HQMA 4DWSA 3P8IA 2A3AA 2QUVA 2I5IA 1S2VA 1TJ1A 1YRRA 3OVRA 3BTNA 2AAAA 2WNZA 3BQ6A 1RCOB 3TYEA 2VZSA 2E5AA 4WK9A 1BSIA 1L8NA 1V6TA 3FVDA 4KCWA 3EGJA 1H4PA 1FVPA 4FNQA 4J27A 5DFAA 2Y24A 4HOWA 5IBXA 4HK5A 4C6LA 4CNUA 3CZ8A 1TYPA 1K8YA 2ZXAA 3GDRA 3EUB3 5I3DA 2OVLA 3U0HA 3LGEA 3OP2A 5C2XA 5D02A 8RUCA 5BW6A 3DBNA 2ABAA 3HURA 4JNYA 1VAHA 3W7OA 3GE7A 4DM2A 4MNMA 1LWJA 1XRSA 4GQGA 3SM0A 4YYFA 1VC4A 2J88A 3C0JA 3PBGA 5GJNA 2J25A 2OTDA 3ZLHA 1KCZA 4V1YA 3PUGA 4INFA 4DYKA 3Q65A 3A13A 1XYAA 2R6OA 1X1ZA 1X38A 2XYLA 5A6BA 3UQNA 3ABXA 1LT8A 3UF9A 2GGHA 3VC5A 3TTQA 2ZRUA 1FWTA 1TV4A 1FTXA 3E6EA 1YPXA 3A4XA 1SYTA 1VQTA 4ZO9A 4HP5A 3ERPA 1YTKA 4DWSC 3LMZA 2YR1A 3UCDA 3QLDA 1H3GA 5DXXA 1I2RA 5JIPA 4ML9A 3OQEA 4DWDA 4HCDA 4O17A 1W1YA 4DIAA 2XWDA 1LL7A 2GVJA 1XLHA 3FOKA 4RXGA 1XBVA 1L6FA 3IIZA 3CQHA 4H4PA 4Z1CA 2PPGA 2QCCA 4UQCA 3P5ZA 3B03A 1VEMA 3HPXA 4LX4A 3KHDA 3LHZA 1JCJA 4D8LA 4XZIA 1HF6A 3PSWA 3WDIA 1HW6A 2WVVA 4LU0A 4DNHA 2WMHA 2ZZ0A 2VQUA 2YL8A 3M1ZA 1B90A 3UJFA 1BPLB 3TLQA 5AVHA 1R0MA 3Q58A 5A6LA 1NF0A 1JGIA 2A7RA 3VOFA 2AGTA 1WDPA 1RJRA 1RA0A 3RMEA 2V5KA 4DBSA 3OB8A 1LLOA 4OE7A 3TCSA 4JX6A 2VVNA 3GC5A 4A22A 4AEFA 3W7RA 1YHTA 4BI5A 2Q09A 4EVZA 2NQZA 2CPUA 5FS9A 1H7XA 2WBAA 2E8ZA 3S5OA 1X8CA 1IZKA 1TJRA 2NVAA 3FV9A 1HKKA 4G7EA 1EUAA 2XH2A 1C7SA 1FWJC 4G1NA 1FX6A 3KS5A 4IMEA 4NU7A 4J40A 4GO8A 1YIXA 1K6WA 5CGMA 3UNDA 3VMOA 4MPQA 4NZJA 1OINA 3QM3A 3GFYA 2D22A 3OZMA 4HZMA 1FO4A 4MB4A 1BWCA 1TE6A 2P88A 3EZ4A 3CUHA 4DBDA 2BV9A 2HE5A 3WUGA 3COTA 3S9ZA 2B31A 4F8XA 4LJ3A 1ICQA 4XUYA 3IAPA 2JGYA 5K4XA 3CGEA 2ZICA 2RDWA 1H62A 3O2LA 1QNRA 1T8QA 3UA4A 4GMEA 2E9LA 4HOZA 4E0CA 4X9SA 3C5QA 3PWAA 4KRZA 5A6BD 3VKBA 1GRBA 1UR9A 1XX1A 3ICJA 3IUHA 3JVAA 4KERA 3PG8A 5T9BG 4B5UA 2ZVIA 1TWWA 4F0MA 5H1WA 3MMUA 1MW0A 4DO6A 1UKQA 1VCGA 2IPFA 3DHUA 4F2BA 5T26A 5HA7A 4C6BA 1KM2A 1MW2A 2QAFA 4IX0A 3UWVA 3AU2A 3PZMA 1KV5A 1PKNA 2V5CA 5LIYX 4HTBA 4LH8A 5MF5A 1THFD 2CHOA 2WHLA 4I7WA 3SADA 2VEMA 3KLKA 3NZGA 3QTGA 3T08A 2XSAA 2GH5A 2ZXBA 4FNRA 1IXPA 3VCNA 3FXYA 4PMUA 1WUEA 3R12A 3R25A 1TV2A 1OC7A 3MW7A 1HO4A 3ZQ9A 3FLUA 3LCWA 1RVKA 4LVFA 3LQLA 1A5CA 1SW3A 2DZVA 2W67A 4JR5A 4B4HA 5JBDA 3GS6A 1HL8A 3R6IA 2Q8LA 4PTMA 3DENA 3AOFA 3N11A 1FKXA 4PULA 4F79A 6A3HA 1EF2A 4WX2A 1GUVA 2VYOA 5LA1A 4I6VA 1R8LA 5ABFA 3UD6A 1SM9A 4JS3A 5B7YA 1HGWA 2DW6A 3STEA 1JI1A 5AYYA 1H7PA 1SO4A 3MUAA 4LEQA 1MOKA 4WKAA 4D6JA 1W5NA 4GJ1A 2G37A 1CPUA 4XD3A 4UR8A 3R07C 1Q66A 3AIBA 1YNYA 3KXQA 4H9TA 1B4KA 2VZTA 1E1EA 3VOHA 4S3GA 2OCZA 3FXGA 1A5AA 2PUZA 3MCMA 5CAHA 4AXKA 3KBWA 1ADSA 1WBJA 2NX3A 2ZC8A 4JN6A 3GTXA 1UA3A 1OK6A 4OBRA 3C56A 3EOOA 3GTHA 2PU0A 5LSMA 3I6RA 2WPFA 3NR0A 1GOQA 3TN5A 1E55A 2C3CA 3WLIA 2YDAA 1AK5A 1ME8A 2J6VA 1JG9A 2O9RA 3ZWTA 5HINA 2BXVA 3UXAA 4LUIA 4N6EA 1HKVA 2J4GA 4IP5A 4BQ5A 3CXOA 4YL2A 3RJYA 2YXOA 4L4MA 1A5SA 2VEKA 4ERGA 9XIAA 1QCWA 3U48A 1XYBA 1R3TA 4C1NB 4LPCA 1IQ8A 4QNWA 2FJUB 3CQ0A 5KZEA 4DJEC 3MKKA 3VNMA 1DNCA 4HJFA 3USBA 2OG9A 3KWSA 3MSDA 1CZ1A 1O5QA 1X6LA 4GYKA 3E0WA 5AHIA 1UP2A 3H4KA 1JDAA 4D72A 2H3BA 2VKZG 3DC0A 1PBGA 4KESA 3O0FA 5A2CA 2OEMA 3AIWA 4HSOA 1D3CA 3W1LA 4F4RA 4A8NA 5AC4A 3OJGA 1W1VA 3SI9A 2JE8A 3WH9A 3LBOA 1FY6A 3IJ6A 2GGJA 1L6YA 1E3XA 4J2MA 4QE4A 1VFTA 4B5XA 4FNUA 1MZRA 3AXIA 4LVDA 3L66A 1YDOA 1Q3NA 5CQ1A 4FALA 2YX0A 3GH4A 8XIMA 1PO9A 1RZMA 3HFTA 2YA2A 2XGBA 4EF8A 1KTBA 4GX8A 1S39A 1JZ4A 4U4MA 4YU1A 1RH9A 4IMDA 4U3AA 3IPWA 2AKMA 4OV9A 2QQ6A 3RO6A 5G2IA 4G1KA 3AALA 1FWDC 1JVNA 3SUUA 1DXFA 4Z42C 3M0YA 3WK2A 2FPVA 4ZQPA 2DGAA 2B7OA 5AHFA 3TVAA 3HIJA 3LI0A 1PX3A 3S6OA 3DK4A 5I3GA 1V3IA 5CJ5A 1WQ5A 5H91A 3T1GA 5ABFB 1KB3A 2NX1A 4MY8A 3LM7A 4IIGA 3QR1A 3M5YA 1RSCA 4UQ9A 1H5VA 3EDKA 1FIQB 1GOOA 3DI1A 4H8HA 3SCUA 4Q4PA 3W4RA 3KLJA 4NUWA 5A8OA 4TMBA 2W0UA 4NX5A 1ZALA 5L9FA 3M43A 2O55A 4X61A 1Q6GA 2CC0A 1JI2A 4HMNA 3BICA 1U5VA 2VFGA 1WZMA 4JCMA 1QTWA 1F4AA 1Q6FA 3FS2A 1DYSA 2Y6ZA 3CIWA 3KCLA 1FWGC 4O14A 2XISA 4NAFB 1KM1A 2ZWZA 3RHGA 3LQGA 3LRMA 1B3OA 1X96A 4S3DA 2W3RA 3CEPA 3SY5A 3DKLA 3EX4A 2CKRA 2VEGA 5CKSA 1I4NA 2CIPA 2ZRYA 1X6NA 1WKYA 2HROA 3P8JA 1GZJA 2SFPA 1GOXA 1JZ7A 2V0TA 3K1DA 4IP7A 1B31A 1QPOA 3CUJA 4B16A 1LRQA 2CZVA 4K39A 3WYZA 3EWXA 1GRFA 1TJPA 4JTHA 6ALDA 3H2FA 4W87A 5FACA 4O0ZA 4O1EA 2JKAA 1JQVA 5D2WA 1UKTA 4C6PA 2BODX 1MQRA 3W2KA 1N8WA 1WX0A 2E6YA 4G56A 3UXIA 4A8IA 1R3QA 1XKJA 2GDQA 3PBYA 5C9UA 3T2OA 3A5FA 1QMLA 1FFUC 1UP3A 4E8GA 1VZWA 1Q8AA 1RUSA 1VS1A 2PGWA 2RDTA 3F5JA 1W2VA 5FEZA 2WBKA 4AVOA 3Q37A 5FS7A 1M6IA 3L0NA 3NQ2A 3WUBA 3BW4A 4ZFCA 1U33A 3GNOA 5D4YA 2W54A 2VDGA 3CT7A 5HBFA 2DT0A 2ALRA 5DF0A 1WNOA 1UR0A 2E6AA 1B3VA 4TVCA 1VRDA 1KGWA 3BK0A 1YLVA 2YCIX 5I3IA 4Z0JA 4X3ZA 3TQ0A 1PS9A 1IZJA 1TPVA 4QEEA 5G4HC 1RQEA 2QJNA 4KGJA 2ZFAA 1M7OA 4HA4A 1FEBA 1ECEA 3DFQA 3FYOA 4AIUA 4ICNA 1CENA 4RDWA 4Q32A 1RP9A 1E1CB 3BLPX 2E4TA 5C54A 5LIXX 3EDEA 1TZ9A 1KM5A 2QS8A 4RL3A 2CZEA 2O7SA 1JYXA 3NXFA 3P82A 4P8XA 4RW3A 2GQ3A 3QMSA 4OOZA 4UR9A 4F2UA 4JTFA 1PWMA 1XCXA 3ARXA 3PSVA 1EJRC 3UGVA 1KR0A 2PWUA 3RF9A 4GLEA 1UJPA 4DI9A 3A4JA 3G3MA 2EQ8A 5JCLA 2F7FA 5JCKA 1KFEA 1KBJA 4L7ZA 2Y4SA 3PFRA 1HNYA 4YCOA 6PTDA 4Z1BA 3RPDA 1V02E 2JFEX 3GXNA 2C18A 2XM2A 1RY0A 4GBDA 1JD7A 1RPKA 4ERIA 5J8LA 4PUNA 1GZGA 5HQEA 1AL8A 3SQSA 4GABA 4X0VA 3LZ3A 3VDHA 3QGVA 4EKJA 1PUDA 4GY1A 1XLCA 3IVSA 2HEJA 1K7XA 3G1SA 3T0CA 4J35A 1OG6A 3SRHA 4CVWA 2F84A 1WKDA 4CNOA 3CUFA 3AIRA 1TWIA 1OCJA 2VGFA 2YLLA 1VLWA 2RDUA 2GVYA 4MZ8A 3DFOA 3UWEA 2XUCA 1ZY8A 4AH7A 1AG1O 4CD4A 3T0AA 3U2ZA 3DC8A 3UJRA 1XANA 1H09A 2GJLA 3VNJA 3V1HA 1UWSA 4WDXA 1XIFA 2D23A 3RDKA 1E5JA 1XLMA 2PRMA 2DIKA 4ZR8A 3QMRA 1PKLA 5BOEA 4QG8A 3S2JA 4HJWA 2VX7A 1GQIA 4H2HA 1XCFA 3L5AA 1OIMA 3VIFA 3CS2A 4WGHA 1EYEA 4MB1A 1X7FA 3VIOA 4EF9A 3HG5A 1OGBA 3GU9A 3NSMA 2GL5A 5BROA 1QPQA 1GJUA 2Q3RA 1XWYA 1DQUA 3AHTA 4S38A 4MMWA 3KDOA 4CD6A 1GNXA 2IQ0A 4XSMA 1JGMA 3UW6A 3V0SA 3P62A 1I1XA 3N34A 3BJTA 1X39A 6XIAA 1Q6EA 4ADSA 3TK7A 3ZFHA 3GHRA 3W23A 3IANA 3VIHA 1ZQ5A 2PBGA 3URHA 2HCVA 1EOKA 3W71A 2KX9A 4AISA 3CZLA 3KBMA 4LAKA 5DX7A 1QHOA 4DN1A 1X8FA 2OMAA 4Q8PA 1KTCA 3BV7A 2CESA 3BOXA 1XHCA 3R8RA 3W86A 3L12A 3RXZA 1VFOA 1CTNA 4PCSA 1AZ2A 2F61A 4ZOEA 2RJHA 1GVSA 5CZTA 1W91A 4MGGA 2QUNA 4MAZA 1ZBKA 1XDMA 4BCEA 1P6BA 1OFDA 2VRJA 3IIOA 1VCFA 1S5NA 2ZUSA 4OECA 4LIIA 1SJDA 1NY1A 2QF7A 2XFYA 2IW0A 3H54A 2X99A 1KRCC 1XIMA 2WM0A 3GDMA 1EGVA 2YA1A 3THUA 4LY4A 1JYVA 3MI6A 2TPRA 1V77A 2I5GA 1PZ2A 3NEHA 3DYOA 1IT0A 4XK2A 3S1VA 4CQ8A 2NWRA 2WVVB 2XVLA 3BGGA 2ACSA 3K1GA 4N4PA 3TQKA 2PDJA 3A21A 1KR1A 1Q6RA 5CC6A 1VFMA 3PC0A 1PHWA 3W7HA 2HBVA 1FWEC 3XISA 5EMMA 5AC5A 1Q4NX 4HD5A 1WKEA 1BYDA 4FXJA 4X2PA 3NQBA 3AFBA 1HT6A 3W9ZA 3U2EA 2XN1A 4S3JA 1DXEA 4Q33A 5KZDA 2UWFA 4PSRA 4CU6A 3EEZA 1IGSA 3L4ZA 5G4EA 1XLFA 4E4FA 3VIJA 4EQRA 2CETA 1CCWB 1RQBA 1MYRA 1JD9A 3BARA 3NQEA 2V38A 4G7EB 3CV1A 3M7WA 2PURA 1ZGDA 2V30A 2FVKA 3N15A 1XH0A 3ABZA 4DRSA 3G1HA 1KGUA 1IZCA 4N9EA 1F3WA 1V0NA 4HPHA 4IT1A 2BP1A 3SRDA 4OGZA 2IKJA 4Q7BA 1NFGA 3QXBA 1W3LA 3VINA 2QCHA 3NVVB 2Y8KA 3TIMA 3V36A 4WKHA 3CGDA 6CGTA 4HPGA 3O16A 2IPGA 3BG5A 4C7DA 5JUVA 3WJYA 1R9YA 3C61A 3I65A 1XSJA 2ZRZA 3CL6A 3LSCA 1SFTA 2ZTJA 1PIGA 1UWTA 3EX6A 2CFFA 1V08A 3W1NA 1W3NA 1IR1A 3WSUA 1YMYA 2PP0A 3H4WA 4WLCA 3QSRA 1J0KA 1JNEA 4PUDA 2DT2A 1TX2A 2C1GA 1QW8A 1XBYA 4MWAE 3C0LA 4FF7A 1VRXA 1TWZA 3WZ0E 4H4ZA 4UMBA 3C6CA 3HV8A 4DY1A 4PMVA 5E6ZA 4UTIA 3RK8A 1E6PA 3C2OA 3HG3A 1G69A 3ATZA 2ACQA 4A21A 4XQ6A 1OC6A 3WLNA 3BLEA 5A69A 2HPMA 2F8QA 4J5NA 1WOAA 2J7EA 4TVUA 4Z2GA 4GO9A 1RQHA 4Q4SA 3GRSA 1KLZA 2P5NA 2QDGA 4HPXA 3GHSA 1V02A 4GFSA 3TTEA 3WK1A 1ESWA 3AUOA 2ZZ2A 3ABSA 3WF1A 3SRFA 4JIHA 4U5IA 5HXMA 4ZE5A 2VD9A 4P8WA 2OO6A 2PDUA 5FJJA 4EX4A 4PE8A 1A50A 2WB5A 3R1ZA 1DKWA 1W3KA 5M03A 2CWXA 3ARVA 3GIPA 3BAIA 3D3AA 4RE2A 2INEA 3H23A 4UTUA 4Q4KA 4ACZB 1ONXA 1XFCA 4DVOA 4P8UA 2PA6A 3BH4A 4YIWA 3LLDA 2EQ6A 3KP0A 1GERA 5FAJA 2MUCA 3VGGA 3NZRA 2ZA3A 1GHSA 3DH9A 3MO4A 3A6OA 3EOLA 3DX5A 3HBLA 4G2DA 1OF6A 5U4NA 2A2IA 1BYAA 5K2ZA 2V2CA 1VBRA 5FL0A 4FA3A 3FEQA 1B3ZA 3U7VA 5H8PA 2BVWA 2PTWA 3MYPA 5LNRA 4GJIA 5FKYA 2VRQA 2IMRA 4AB4A 2G3FA 2CBJA 1GRTA 2WHMA 4DB7A 2HWGA 1DIDA 3BLFA 4XVDA 2A3LA 3W28A 4WSKA 2DH3A 3WNNA 1S5MA 5DELA 4GUJA 4B9ZA 3F03K 1K3UA 1REQA 3BAWA 4TTUA 3CL7A 1GYMA 2Y8VA 1JCXA 3NTYA 4BI6A 3ZOAA 2OSXA 4JHOA 1YE6A 4PGLA 4MSSA 2P8BA 3B8UA 4MVAA 4ROQA 1WA3A 4J3XA 1UJQA 3GR7A 3TAKA 2PF8A 1Q6OA 1T99A 4RR4A 5CJNA 2XFWA 1UR4A 4REQB 1IGWA 2HTMA 1ZTVA 2YLAA 3MV11 3RM4A 4O53A 4H83A 4IICA 3WF2A 1VFFA 1B0IA 2F2HA 2QGHA 4BY3A 2WMFA 3GU1A 2I17A 4GQ0A 1CXEA 1RBOB 2V3AA 2OZTA 1ENUA 2ZTKA 2YBTA 1UMLA 3GRTA 4GVIA 4XISA 2PU1A 1O5RA 5I5RA 2BCPA 3W22A 3VVGA 1BWLA 4E6MA 2NQ5A 2X1TA 4I9JA 2VX4A 3N12A 4GISA 3OG3A 1XKYA 4JYDA 5BRBA 1H49A 2ABBA 1XUZA 3GIYA 4H4VA 5JH2A 4PMDA 3HPAA 2V5JA 3LHWA 1ZCCA 3II4A 3LHVA 5FJPA 1CB2A 1H51A 3HGOA 3NPXA 1N7KA 4O18A 1OC5A 3EMCA 4E5TA 3FN9A 2PCEA 1DPMA 3L0KA 4AYGA 3CU2A 4H4TA 2ISSA 4IFKA 2C3DA 2C0AA 3DGBA 1I0BA 1HQTA 3AMZA 1KCLA 3HFYA 1A5BA 3H7RA 4AWEA 3QYQA 3GTFA 4YTRA 5G1MA 3ZSSA 4ZO8A 4L1XA 4FB7A 3DFNA 4V27A 1CB7B 3DGRA 1F05A 1NHSA 5REQB 3W7DA 5I02A 4IL2A 2YJQA 3I3BA 4NHVA 1QOQA 5SWUA 3FY1A 5C8BB 4GPNA 1FWSA 4QLLA 5D8WA 3TXVA 2VCAA 4R88A 4O57A 1MO9A 2X0HA 3AYSA 2WZEA 1EP2A 1JPKA 3VIPA 4JQ1A 2G3MA 2BOFX 3SFWA 2E8YA 5IM51 1W2PA 3R7MA 1KCXA 3CPGA 1LBMA 2X7VA 4CGTA 1GVFA 2OX4A 1F6YA 2ESCA 4KEVA 4YPJA 2Y5SA 1EIXA 3TSBA 4AF0B 4NI8A 4DPQA 1V5XA 1REQB 2RHGA 1S5VA 3UGRA 4RE3A 2X41A 3PUEA 4L80A 2E5CA 3NQAA 1JRBA 3TOYA 3N29A 1E0TA 1EP3A 1OZMA 4AHPA 3W73A 3O05A 4JIIX 2PDBA 4RJEA 2E9MA 1QHPA 5T9CE 1JCLA 1EC7A 3CIXA 4AZBA 4BQ3A 2ADAA 2PAJA 4HU8A 3VKJA 4F0HA 1HJUA 1P4CA 3VNLA 1BWVA 2ZZ6A 5E93A 2AQVA 4XAGA 3ZT6A 2D0HA 2XFFA 4IF2A 4GWEA 4O15A 4FS9A 3ZT7A 2HV5A 1NFPA 2PTXA 5BOOA 1SGJA 4ZXOA 4BQ4A 1V3KA 1ZUAX 5JU6A 1NHQA 2F6UA 3A3WA 2CCRA 1E51A 2ZIDA 4ZQOA 5F7UA 4YTQA 3EMZA 3HQPA 1MNZA 3P60A 1TPC1 4BF5A 4LNCA 1B54A 1HJSA 3PAJA 5GJMA 5KZ6A 4UC5A 4X9YA 2YVGA 2TODA 5BWAA 2NV2A 2ISDA 1UD3A 2F6KA 5I2UA 3VKAA 4QDMA 3S2CA 4Q4OA 1MMFA 4CCDA 4L1WA 1K8XA 4A4AA 5JRBA 3PBUA 2VGGA 1WPCA 3W2NA 1CT5A 3W26A 2OSWA 4GQQA 1WXZA 3PPGA 4YYCA 1GOIA 2GYIA 3H4GA 4CN4A 3S5NA 1Q63A 4MPKA 4D2JA 2I57A 1KM4A 1A4MA 1PKMA 3M6YA 2PLCA 3E2RA 2D20A 2YA0A 4CQDA 4Q7NA 2PEVA 3UESA 5KEZA 3TJ4A 1EOMA 3LBCA 1E1CA 2ATMA 1FHDA 3TCEA 5HWNA 1EJ7L 5U7SA 4P7NA 2NSXA 3NZPA 2FQIA 5K9CA 5LHFA 1RCQA