3R07C

Structural analysis of an archaeal lipoylation system. a bi-partite lipoate protein ligase and its e2 lipoyl domain from thermoplasma acidophilum
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
88
Chain Sequence
MHMMYSKNWKAKKGLIRVTLDLDGNRIKDIHISGDFFMFPEDSINRLEDMLRGSSIEKINDIIRDFYNQGVITPGVEPEDFIQALRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoate-protein ligase A subunit 1
publication title Structural analysis of an archaeal lipoylation system. A bi-partite lipoate protein ligase and its E2 lipoyl domain from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum dsm 1728
molecule tags Transferase
total genus 21
structure length 88
sequence length 88
ec nomenclature ec 6.3.1.20: Lipoate--protein ligase.
pdb deposition date 2011-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 3r07C00
5G5HB 1N62C 3NRZB 3AMZA 1FFVC 2E3TA 1SB3B 1FFUC 1JROA 3AM9A 3AN1A 5G5GB 1N5XA 1N61C 1RM6B 1X2HA 3NVYB 3NVVB 1T3QC 3A7UA 1FO4A 3A7RA 1JRPA 3ETRB 3SR6B 4TVWA 3A7AA 4ZOHB 1V97A 2W54A 3EUB3 3HRDC 2W55A 1VQZA 3NS1B 2W3SA 1FIQB 2E5AA 4TVYA 1X2GA 3B9JB 3R07C 1ZXIC 1WYGA 1N63C 1N5WC 1N60C 2W3RA 1VDVA 3NVZB 3NVWB
chains in the Genus database with same CATH superfamily
2EQ9A 4HNLA 2PTYA 5ER0A 1N62C 3PWIA 3MZNA 4DXKA 2OG9A 2XH0A 1FFVC 2O56A 3IJLA 2PGEA 3IJIA 2GGHA 2RABA 3SN0A 3DGZA 1GRFA 4IL0A 3FCPA 2GRTA 3URHA 2PTZA 4M6UA 3UGVA 3PWGA 3MKCA 2AAQA 2QDEA 3GD6A 2QGYA 3DG7A 2YVGA 2ZC8A 3R0UA 2PMQA 6ENLA 4GRTA 1N63C 1IYXA 1N60C 4GMEA 3JZUA 4K8DA 4ADWA 1F8WA 2OQYA 4FI4A 1ZKQA 2DW7A 4Z1YA 3IC9A 3N4FA 3I6EA 4K8GA 1SJCA 3V4BA 4E8GA 2QAEA 2X8CA 2JK6A 2PS2A 2P3ZA 3ETRB 2GGIA 3KUMA 3DDMA 2P8CA 1KKOA 1P48A 2P0IA 2V6OA 2FKPA 4J1OA 4K2SA 1R0MA 3H4KA 4ENLA 5FMHA 1FIQB 2E5AA 5EU9A 3CGEA 1JDFA 2C3CA 3P3BA 4JHMA 2OX4A 3VCCA 1M6IA 5JCIA 3OW1A 3T4WA 2GR2A 4GGBA 2R9ZA 2QJNA 1NELA 2DW6A 3EKGA 4GR1A 3L5OA 1H6VA 1FEAA 1TYPA 3I4KA 1DNCA 1JPDX 3DK8A 4IP5A 3A7AA 3JVAA 4JQ9A 3STPA 5KVIA 4LA1A 2W55A 2OKTA 3GRTA 3RO6A 1GRHA 3RITA 3DIPA 3B9JB 2OQHA 1ONEA 4H4QA 4HCHA 4ROPA 1XDIA 3N6JA 1EC7A 3Q45A 4IT1A 5U1OA 1MOKA 2XSXA 4BURA 1YEYA 2FYMA 3CGBA 3II4A 4H4TA 1R6WA 4HNCA 3DJGX 4ZA0A 3GD4A 3CYJA 3VC6A 3ZVHA 3DEQA 2PA6A 1EBGA 4HN8A 4EQRA 3MY9A 3FYYA 3TOYA 1MDLA 2P88A 4MKSA 3OZMA 5U25A 4MMWA 3GD3A 1TKKA 4IZGA 2PU0A 2WP5A 2PCEA 3FXGA 3Q6JA 3R1ZA 2EQ8A 2NVKX 4GFIA 4H4WA 2X8HA 4GIRA 3GY1A 3CB3A 2RDXA 1KN0A 1BKHA 3TTEA 3EUB3 5JCNA 3V5FA 1VQZA 2YAUA 2GH5A 3TCSA 3UCCA 2OFJA 2OO6A 2QJJA 2W3RA 1MRAA 3L8KA 4H4PA 2WPEA 3LB8A 5J04A 2BC0A 2QVHA 3UJSA 1YQZA 2E3TA 2HXTA 2OZ3A 4E5TA 3VFCA 1XANA 1D7YA 5FS6A 2ZADA 3LADA 2BC1A 4IHCA 4GYPA 2GSHA 1JPMA 4M0XA 2MNRA 1GRBA 1ZK7A 3SJNA 3HRDC 1GEUA 1GSNA 3IJQA 1WUFA 1NPXA 3RNMA 3UJRA 3R07C 1F3PA 3PFRA 4H83A 2F5ZA 4A35A 1N5WC 4X2PA 3DK4A 3MSYA 3NVWB 1WUEA 2EQ6A 4IL2A 2PSNA 3LXDA 3QFBA 3NRZB 4HPNA 3UCDA 2CHRA 3NZGA 4K1WA 3I6TA 1FFUC 1K4QA 2CFYA 3MQTA 4BV6A 5FJOA 3A7UA 4GYPC 3VCNA 4DN1A 3PG6A 4EM4A 1MNSA 4FDCB 2W54A 2PODA 3TWAA 5GRTA 4IP4A 3ZVIA 2XH7A 1NHQA 5FS8A 4JDRA 3P93A 3RR1A 3FG2P 3OPSA 4EQXA 2I5QA 1NHRA 4DYEA 2GGGA 1ZX9A 3FV9A 2PGWA 3AN1A 3CXOA 3DH9A 3K1GA 3T8QA 1MUCA 2ZZ0A 3A7RA 1LPFA 2AKZA 3CGDA 3NFUA 3V3WA 4NEWA 1L8PA 3H8AA 4G7FA 3TW9A 2W3SA 4H4RA 5JRBA 3FVDA 1Q1WA 4HCLA 1S7MA 4M52A 3UJFA 4DHGA 4E4FA 3NO1A 1WYGA 2PP3A 2BCPA 3FJ4A 3OP2A 1GRAA 1SJDA 3NVZB 3ZLFA 4GISA 1TZZA 3RGTA 5JCMA 2X8GA 3EAOA 5JCLA 3EEZA 3Q4DA 1ONFA 3GC2A 1OJTA 2ZZBA 1RM6B 3CAWA 1GRGA 1P43A 1BZLA 1JEHA 2WOIA 3DGBA 1SJBA 4H4SA 4KEMA 4E6MA 1KKRA 3QTPA 2EQ7A 2HNEA 3NS1B 3PK7A 1STZA 1GXFA 3HW2A 3VDGA 1ZMDA 2XH4A 4HCDA 5FJTA 3TJIA 2WP6A 1VDVA 3SQPA 3TWBA 4DWDA 1BWCA 4H19A 1ECQA 3N6HA 2OVLA 2P8BA 3U9IA 3RRAA 1JROA 3DGHA 1FHVA 2WPCA 3NVYB 4A3RA 3QLDA 1XS2A 2YQUA 2GR1A 3ZLHA 4EMJA 3SQSA 1JRPA 4EQSA 3MUCA 2A8XA 2XGZA 1ELSA 1GETA 2GL5A 1W6TA 2W0HA 2PP1A 3DG3A 2GR0A 1XPYA 4GGHA 3THUA 1ZXIC 3ES8A 4YWSA 4J57A 3EF6A 4H4YA 4EM3A 2AL2B 5ENLA 3DERA 3S5SA 4FP1A 2MUCA 2NQLA 3AM9A 3ZLGA 2WBAA 1BQGA 1DTNA 1GREA 1N61C 1N5XA 1F9CA 1T3QC 3DG6A 4DNAA 2X50A 3R11A 3SR6B 1GRTA 5FJRA 3SSZA 1NHPA 2WPFA 2HZGA 3BJSA 2OZTA 2YVFA 3U4FA 4KT2A 1NDAA 3N4EA 3TQPA 4ZCWA 3H7VA 1EC8A 3B97A 4H4XA 4Z17A 2AKMA 3AMZA 4J56A 3DJJA 7ENLA 3OTRA 3T9PA 4H1ZA 1H2IA 3UJEA 1ZY8A 3GO2A 1DXLA 3HPFA 1FEBA 4TVWA 4ZOHB 4JN7A 1V97A 1NU5A 3UJ2A 4LIIA 2WOWA 2XH2A 2J3NA 2ONEA 2PTXA 1X2GA 4EWJA 3TJ4A 1XHCA 2HXUA 3CGCA 4H4VA 4A6GA 3OZYA 5G5HB 2GDQA 1FECA 4G8TA 3D46A 3H70A 2HQMA 4KWSA 2GQWA 2PU1A 3UXLA 3NVVB 1PDZA 4J3ZA 4JN8A 4EQWA 1FO4A 2GR3A 1E9IA 1JCTA 3GRSA 1EC9A 4H50A 1SJAA 2POZA 4H4UA 3BSMA 1MDRA 2QDDA 1JOAA 1NHSA 3CT2A 5BOEA 5IDZA 5FJUA 2ZZCA 3OC4A 3UXKA 2PTWA 3VC5A 1GV4A 3P0WA 1Q1RA 3RCYA 4KPRA 4EMWA 3QKEA 3SN1A 3S47A 3DFYA 5G5GB 1EBHA 1ZDLA 2GGJA 3R10A 2X99A 4KPLA 1ZMCA 3IK4A 1RVKA 4NEVA 4H4ZA 3SN4A 3R25A 3CK5A 4K7ZA 1TE6A 2OPJA 1MO9A 2TPRA 3ENLA 4YWOA 5KVHA 1GERA 5BOFA 3BOXA 3D47A 1LVLA 5FS9A 1AOGA 3QN3A 4E4UA 1KCZA 3ZVHB 3DK9A 1EBDA 1X2HA 2AL1A 3H12A 3SBFA 3V5CA 3CXBA 1KD0A 1TYTA 3QFAA 1OEPA 5EBKA 5FJPA 3O0HA 4TVYA 5JCKA 3JW7A 2V3AA 3R0KA 4HYRA 1FHUA 4MGGA 2YVJA 3EANA 4EMIA 3KLJA 1SB3B 3DFHA 2QQ6A 3NXLA 1V59A 4FX9A 2OLAA 2CDUA 2AL2A 1GESA 3ES7A 3D9XA 3VA8A 5TR3A 4DX3A 2NPXA 2V3BA 5FS7A 2GGEA 3MWCA 2PP0A 2C3DA 1PDYA 4F4RA 2WOVA 4H2HA 2PPGA 4APNA 3DESA 3QPEA 2QJMA 2OZ8A 3T6CA
chains in the Genus database with same CATH topology
5G5HB 1N62C 3NRZB 3AMZA 1FFVC 2E3TA 1SB3B 1FFUC 1JROA 3AM9A 3AN1A 5G5GB 1N5XA 1N61C 1RM6B 1X2HA 3NVYB 3NVVB 1T3QC 3A7UA 1FO4A 3A7RA 1JRPA 3ETRB 3SR6B 4TVWA 3A7AA 4ZOHB 1V97A 2W54A 3EUB3 3HRDC 2W55A 1VQZA 3NS1B 2W3SA 1FIQB 2E5AA 4TVYA 1X2GA 3B9JB 3R07C 1ZXIC 1WYGA 1N63C 1N5WC 1N60C 2W3RA 1VDVA 3NVZB 3NVWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G5H B;  1N62 C;  3NRZ B;  3AMZ A;  1FFV C;  2E3T A;  1SB3 B;  1FFU C;  1JRO A;  3AM9 A;  3AN1 A;  5G5G B;  1N5X A;  1N61 C;  1RM6 B;  1X2H A;  3NVY B;  3NVV B;  1T3Q C;  3A7U A;  1FO4 A;  3A7R A;  1JRP A;  3ETR B;  3SR6 B;  4TVW A;  3A7A A;  4ZOH B;  1V97 A;  2W54 A;  3EUB 3;  3HRD C;  2W55 A;  1VQZ A;  3NS1 B;  2W3S A;  1FIQ B;  2E5A A;  4TVY A;  1X2G A;  3B9J B;  3R07 C;  1ZXI C;  1WYG A;  1N63 C;  1N5W C;  1N60 C;  2W3R A;  1VDV A;  3NVZ B;  3NVW B; 
#chains in the Genus database with same CATH topology
 2EQ9 A;  4HNL A;  2PTY A;  5ER0 A;  1N62 C;  3PWI A;  3MZN A;  4DXK A;  2OG9 A;  2XH0 A;  1FFV C;  2O56 A;  3IJL A;  2PGE A;  3IJI A;  2GGH A;  2RAB A;  3SN0 A;  3DGZ A;  1GRF A;  4IL0 A;  3FCP A;  2GRT A;  3URH A;  2PTZ A;  4M6U A;  3UGV A;  3PWG A;  3MKC A;  2AAQ A;  2QDE A;  3GD6 A;  2QGY A;  3DG7 A;  2YVG A;  2ZC8 A;  3R0U A;  2PMQ A;  6ENL A;  4GRT A;  1N63 C;  1IYX A;  1N60 C;  4GME A;  3JZU A;  4K8D A;  4ADW A;  1F8W A;  2OQY A;  4FI4 A;  1ZKQ A;  2DW7 A;  4Z1Y A;  3IC9 A;  3N4F A;  3I6E A;  4K8G A;  1SJC A;  3V4B A;  4E8G A;  2QAE A;  2X8C A;  2JK6 A;  2PS2 A;  2P3Z A;  3ETR B;  2GGI A;  3KUM A;  3DDM A;  2P8C A;  1KKO A;  1P48 A;  2P0I A;  2V6O A;  2FKP A;  4J1O A;  4K2S A;  1R0M A;  3H4K A;  4ENL A;  5FMH A;  1FIQ B;  2E5A A;  5EU9 A;  3CGE A;  1JDF A;  2C3C A;  3P3B A;  4JHM A;  2OX4 A;  3VCC A;  1M6I A;  5JCI A;  3OW1 A;  3T4W A;  2GR2 A;  4GGB A;  2R9Z A;  2QJN A;  1NEL A;  2DW6 A;  3EKG A;  4GR1 A;  3L5O A;  1H6V A;  1FEA A;  1TYP A;  3I4K A;  1DNC A;  1JPD X;  3DK8 A;  4IP5 A;  3A7A A;  3JVA A;  4JQ9 A;  3STP A;  5KVI A;  4LA1 A;  2W55 A;  2OKT A;  3GRT A;  3RO6 A;  1GRH A;  3RIT A;  3DIP A;  3B9J B;  2OQH A;  1ONE A;  4H4Q A;  4HCH A;  4ROP A;  1XDI A;  3N6J A;  1EC7 A;  3Q45 A;  4IT1 A;  5U1O A;  1MOK A;  2XSX A;  4BUR A;  1YEY A;  2FYM A;  3CGB A;  3II4 A;  4H4T A;  1R6W A;  4HNC A;  3DJG X;  4ZA0 A;  3GD4 A;  3CYJ A;  3VC6 A;  3ZVH A;  3DEQ A;  2PA6 A;  1EBG A;  4HN8 A;  4EQR A;  3MY9 A;  3FYY A;  3TOY A;  1MDL A;  2P88 A;  4MKS A;  3OZM A;  5U25 A;  4MMW A;  3GD3 A;  1TKK A;  4IZG A;  2PU0 A;  2WP5 A;  2PCE A;  3FXG A;  3Q6J A;  3R1Z A;  2EQ8 A;  2NVK X;  4GFI A;  4H4W A;  2X8H A;  4GIR A;  3GY1 A;  3CB3 A;  2RDX A;  1KN0 A;  1BKH A;  3TTE A;  3EUB 3;  5JCN A;  3V5F A;  1VQZ A;  2YAU A;  2GH5 A;  3TCS A;  3UCC A;  2OFJ A;  2OO6 A;  2QJJ A;  2W3R A;  1MRA A;  3L8K A;  4H4P A;  2WPE A;  3LB8 A;  5J04 A;  2BC0 A;  2QVH A;  3UJS A;  1YQZ A;  2E3T A;  2HXT A;  2OZ3 A;  4E5T A;  3VFC A;  1XAN A;  1D7Y A;  5FS6 A;  2ZAD A;  3LAD A;  2BC1 A;  4IHC A;  4GYP A;  2GSH A;  1JPM A;  4M0X A;  2MNR A;  1GRB A;  1ZK7 A;  3SJN A;  3HRD C;  1GEU A;  1GSN A;  3IJQ A;  1WUF A;  1NPX A;  3RNM A;  3UJR A;  3R07 C;  1F3P A;  3PFR A;  4H83 A;  2F5Z A;  4A35 A;  1N5W C;  4X2P A;  3DK4 A;  3MSY A;  3NVW B;  1WUE A;  2EQ6 A;  4IL2 A;  2PSN A;  3LXD A;  3QFB A;  3NRZ B;  4HPN A;  3UCD A;  2CHR A;  3NZG A;  4K1W A;  3I6T A;  1FFU C;  1K4Q A;  2CFY A;  3MQT A;  4BV6 A;  5FJO A;  3A7U A;  4GYP C;  3VCN A;  4DN1 A;  3PG6 A;  4EM4 A;  1MNS A;  4FDC B;  2W54 A;  2POD A;  3TWA A;  5GRT A;  4IP4 A;  3ZVI A;  2XH7 A;  1NHQ A;  5FS8 A;  4JDR A;  3P93 A;  3RR1 A;  3FG2 P;  3OPS A;  4EQX A;  2I5Q A;  1NHR A;  4DYE A;  2GGG A;  1ZX9 A;  3FV9 A;  2PGW A;  3AN1 A;  3CXO A;  3DH9 A;  3K1G A;  3T8Q A;  1MUC A;  2ZZ0 A;  3A7R A;  1LPF A;  2AKZ A;  3CGD A;  3NFU A;  3V3W A;  4NEW A;  1L8P A;  3H8A A;  4G7F A;  3TW9 A;  2W3S A;  4H4R A;  5JRB A;  3FVD A;  1Q1W A;  4HCL A;  1S7M A;  4M52 A;  3UJF A;  4DHG A;  4E4F A;  3NO1 A;  1WYG A;  2PP3 A;  2BCP A;  3FJ4 A;  3OP2 A;  1GRA A;  1SJD A;  3NVZ B;  3ZLF A;  4GIS A;  1TZZ A;  3RGT A;  5JCM A;  2X8G A;  3EAO A;  5JCL A;  3EEZ A;  3Q4D A;  1ONF A;  3GC2 A;  1OJT A;  2ZZB A;  1RM6 B;  3CAW A;  1GRG A;  1P43 A;  1BZL A;  1JEH A;  2WOI A;  3DGB A;  1SJB A;  4H4S A;  4KEM A;  4E6M A;  1KKR A;  3QTP A;  2EQ7 A;  2HNE A;  3NS1 B;  3PK7 A;  1STZ A;  1GXF A;  3HW2 A;  3VDG A;  1ZMD A;  2XH4 A;  4HCD A;  5FJT A;  3TJI A;  2WP6 A;  1VDV A;  3SQP A;  3TWB A;  4DWD A;  1BWC A;  4H19 A;  1ECQ A;  3N6H A;  2OVL A;  2P8B A;  3U9I A;  3RRA A;  1JRO A;  3DGH A;  1FHV A;  2WPC A;  3NVY B;  4A3R A;  3QLD A;  1XS2 A;  2YQU A;  2GR1 A;  3ZLH A;  4EMJ A;  3SQS A;  1JRP A;  4EQS A;  3MUC A;  2A8X A;  2XGZ A;  1ELS A;  1GET A;  2GL5 A;  1W6T A;  2W0H A;  2PP1 A;  3DG3 A;  2GR0 A;  1XPY A;  4GGH A;  3THU A;  1ZXI C;  3ES8 A;  4YWS A;  4J57 A;  3EF6 A;  4H4Y A;  4EM3 A;  2AL2 B;  5ENL A;  3DER A;  3S5S A;  4FP1 A;  2MUC A;  2NQL A;  3AM9 A;  3ZLG A;  2WBA A;  1BQG A;  1DTN A;  1GRE A;  1N61 C;  1N5X A;  1F9C A;  1T3Q C;  3DG6 A;  4DNA A;  2X50 A;  3R11 A;  3SR6 B;  1GRT A;  5FJR A;  3SSZ A;  1NHP A;  2WPF A;  2HZG A;  3BJS A;  2OZT A;  2YVF A;  3U4F A;  4KT2 A;  1NDA A;  3N4E A;  3TQP A;  4ZCW A;  3H7V A;  1EC8 A;  3B97 A;  4H4X A;  4Z17 A;  2AKM A;  3AMZ A;  4J56 A;  3DJJ A;  7ENL A;  3OTR A;  3T9P A;  4H1Z A;  1H2I A;  3UJE A;  1ZY8 A;  3GO2 A;  1DXL A;  3HPF A;  1FEB A;  4TVW A;  4ZOH B;  4JN7 A;  1V97 A;  1NU5 A;  3UJ2 A;  4LII A;  2WOW A;  2XH2 A;  2J3N A;  2ONE A;  2PTX A;  1X2G A;  4EWJ A;  3TJ4 A;  1XHC A;  2HXU A;  3CGC A;  4H4V A;  4A6G A;  3OZY A;  5G5H B;  2GDQ A;  1FEC A;  4G8T A;  3D46 A;  3H70 A;  2HQM A;  4KWS A;  2GQW A;  2PU1 A;  3UXL A;  3NVV B;  1PDZ A;  4J3Z A;  4JN8 A;  4EQW A;  1FO4 A;  2GR3 A;  1E9I A;  1JCT A;  3GRS A;  1EC9 A;  4H50 A;  1SJA A;  2POZ A;  4H4U A;  3BSM A;  1MDR A;  2QDD A;  1JOA A;  1NHS A;  3CT2 A;  5BOE A;  5IDZ A;  5FJU A;  2ZZC A;  3OC4 A;  3UXK A;  2PTW A;  3VC5 A;  1GV4 A;  3P0W A;  1Q1R A;  3RCY A;  4KPR A;  4EMW A;  3QKE A;  3SN1 A;  3S47 A;  3DFY A;  5G5G B;  1EBH A;  1ZDL A;  2GGJ A;  3R10 A;  2X99 A;  4KPL A;  1ZMC A;  3IK4 A;  1RVK A;  4NEV A;  4H4Z A;  3SN4 A;  3R25 A;  3CK5 A;  4K7Z A;  1TE6 A;  2OPJ A;  1MO9 A;  2TPR A;  3ENL A;  4YWO A;  5KVH A;  1GER A;  5BOF A;  3BOX A;  3D47 A;  1LVL A;  5FS9 A;  1AOG A;  3QN3 A;  4E4U A;  1KCZ A;  3ZVH B;  3DK9 A;  1EBD A;  1X2H A;  2AL1 A;  3H12 A;  3SBF A;  3V5C A;  3CXB A;  1KD0 A;  1TYT A;  3QFA A;  1OEP A;  5EBK A;  5FJP A;  3O0H A;  4TVY A;  5JCK A;  3JW7 A;  2V3A A;  3R0K A;  4HYR A;  1FHU A;  4MGG A;  2YVJ A;  3EAN A;  4EMI A;  3KLJ A;  1SB3 B;  3DFH A;  2QQ6 A;  3NXL A;  1V59 A;  4FX9 A;  2OLA A;  2CDU A;  2AL2 A;  1GES A;  3ES7 A;  3D9X A;  3VA8 A;  5TR3 A;  4DX3 A;  2NPX A;  2V3B A;  5FS7 A;  2GGE A;  3MWC A;  2PP0 A;  2C3D A;  1PDY A;  4F4R A;  2WOV A;  4H2H A;  2PPG A;  4APN A;  3DES A;  3QPE A;  2QJM A;  2OZ8 A;  3T6C A; 
#chains in the Genus database with same CATH homology
 5G5H B;  1N62 C;  3NRZ B;  3AMZ A;  1FFV C;  2E3T A;  1SB3 B;  1FFU C;  1JRO A;  3AM9 A;  3AN1 A;  5G5G B;  1N5X A;  1N61 C;  1RM6 B;  1X2H A;  3NVY B;  3NVV B;  1T3Q C;  3A7U A;  1FO4 A;  3A7R A;  1JRP A;  3ETR B;  3SR6 B;  4TVW A;  3A7A A;  4ZOH B;  1V97 A;  2W54 A;  3EUB 3;  3HRD C;  2W55 A;  1VQZ A;  3NS1 B;  2W3S A;  1FIQ B;  2E5A A;  4TVY A;  1X2G A;  3B9J B;  3R07 C;  1ZXI C;  1WYG A;  1N63 C;  1N5W C;  1N60 C;  2W3R A;  1VDV A;  3NVZ B;  3NVW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...