3R07C

Structural analysis of an archaeal lipoylation system. a bi-partite lipoate protein ligase and its e2 lipoyl domain from thermoplasma acidophilum
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
88
Chain Sequence
b'MHMMYSKNWKAKKGLIRVTLDLDGNRIKDIHISGDFFMFPEDSINRLEDMLRGSSIEKINDIIRDFYNQGVITPGVEPEDFIQALRVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoate-protein ligase A subunit 1
publication title Structural analysis of an archaeal lipoylation system. A bi-partite lipoate protein ligase and its E2 lipoyl domain from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum dsm 1728
molecule tags Transferase
total genus 21
structure length 88
sequence length 88
ec nomenclature ec 6.3.1.20: Lipoate--protein ligase.
pdb deposition date 2011-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 3r07C00
1N5WC 1N60C 1SB3B 5G5HB 3NS1B 3A7AA 1FO4A 1N5XA 1X2GA 2W54A 3ETRB 3NRZB 1JROA 3R07C 2W3RA 3A7RA 2W3SA 1VDVA 1N62C 1X2HA 2W55A 1N61C 1WYGA 4TVYA 1VQZA 3HRDC 1JRPA 3AM9A 2E3TA 4TVWA 1T3QC 2E5AA 1N63C 1RM6B 1V97A 3NVVB 3B9JB 1ZXIC 3AMZA 3AN1A 3EUB3 3NVYB 1FFVC 1FIQB 1FFUC 3NVWB 5G5GB 3NVZB 3A7UA 3SR6B 4ZOHB
chains in the Genus database with same CATH superfamily
1SJAA 1FEBA 3EF6A 2PGWA 2PTZA 1K4QA 1JEHA 4EM4A 3NRZB 3A7RA 1L8PA 2GGGA 3L5OA 3MWCA 3QPEA 3VCCA 3UJFA 3DG6A 3JZUA 2PA6A 1TZZA 2TPRA 3UJSA 3CGDA 2PMQA 1GESA 1NHSA 4H4YA 5JCKA 3SJNA 3SSZA 4GRTA 2ONEA 3I6EA 6ENLA 4G7FA 2HNEA 4IT1A 1X2GA 3VC6A 2PP0A 5BOFA 2FKPA 3KLJA 4ADWA 2PU1A 1XS2A 2PTWA 2GR2A 3SN4A 3DGHA 2YVJA 4A6GA 4X2PA 4H4SA 1V97A 3ZVIA 4JHMA 2ZADA 2OZ8A 3JW7A 3D47A 3GC2A 2GR1A 1BQGA 1ZY8A 5G5HB 1N60C 3PFRA 5ENLA 1FO4A 2V3AA 4FI4A 3H4KA 3V5FA 2X50A 3VA8A 3U9IA 2XSXA 2HZGA 1T3QC 2HXUA 3GRSA 4KPRA 2EQ8A 3FJ4A 2W0HA 5U1OA 1JPMA 1FIQB 3NVZB 3PWIA 2OG9A 3II4A 1H2IA 2X8HA 3NXLA 4GGBA 3UXKA 2XH4A 1S7MA 1SB3B 2AKMA 4EMIA 1ELSA 2AL1A 2P3ZA 3Q45A 1YQZA 5TR3A 2W54A 3TW9A 4NEVA 2OFJA 1JCTA 1WUFA 2FYMA 2WBAA 1R0MA 2NVKX 2C3CA 2P0IA 5JRBA 2HQMA 3TWAA 3K1GA 3SQSA 3EEZA 2POZA 3MZNA 2ZZBA 3RO6A 3AN1A 2BCPA 3NVYB 1FFUC 2EQ6A 2QGYA 3DGBA 3RGTA 3JVAA 5FS7A 5BOEA 1EBDA 1NDAA 5FJOA 2F5ZA 3PG6A 3T6CA 3FG2P 4H4QA 1WUEA 2ZZ0A 3CT2A 4EQWA 1ONEA 4HPNA 3I6TA 2E3TA 4KWSA 3OPSA 4JDRA 1NHQA 1GRGA 1JPDX 1KCZA 3H7VA 4HNLA 2AL2A 4KPLA 3B9JB 3DGZA 3AMZA 2OQHA 4YWSA 4J56A 3SBFA 3H12A 4ENLA 2NPXA 1KKRA 1TYPA 1XHCA 4BV6A 4H4ZA 4EMJA 2QJMA 3A7AA 4IZGA 2OLAA 3IJIA 4GFIA 1KKOA 3P93A 1TE6A 5JCMA 2CHRA 3CAWA 4HCHA 4E4UA 3DG7A 1WYGA 4H4WA 3SN1A 3SQPA 1OEPA 4J1OA 3ZVHB 1MUCA 4J57A 3FCPA 4TVWA 4GYPA 3EANA 1OJTA 3VCNA 3R0UA 3O0HA 3Q6JA 3NVWB 1FHUA 3DJJA 1MDRA 4HN8A 4M6UA 4ZCWA 2EQ7A 3T8QA 3VDGA 1V59A 3A7UA 2X8CA 3RCYA 2RABA 1P48A 3QLDA 2MUCA 3OW1A 2XH7A 2V3BA 5U25A 1EC8A 3TQPA 1ZMDA 4IP5A 3TJIA 2GSHA 4DYEA 1MRAA 1VDVA 2W55A 1Q1RA 4A3RA 1EBGA 5EBKA 2GGHA 2YVFA 1NHRA 2PU0A 1H6VA 5KVIA 4DNAA 2J3NA 4H2HA 4K7ZA 3FVDA 2JK6A 2PP3A 4FDCB 4DN1A 3TJ4A 4EQXA 1W6TA 2WPEA 1GETA 1XPYA 2WPCA 1GERA 2X8GA 3TCSA 1ZX9A 2QJNA 5FS6A 4EM3A 3V4BA 1MOKA 3P0WA 2CFYA 3KUMA 3ZLFA 4K8DA 3UXLA 4EWJA 5JCNA 3GO2A 1BWCA 5IDZA 1PDYA 3ZLGA 3DFYA 3R11A 4KT2A 2HXTA 1NPXA 2ZC8A 1N63C 1F8WA 2PP1A 3TWBA 3UJRA 5G5GB 1YEYA 1RVKA 2EQ9A 2V6OA 4E4FA 1EC9A 2BC0A 3GD6A 3QFBA 1MO9A 4FX9A 4H4PA 4HNCA 4HCDA 3N6HA 3UJ2A 1F9CA 3QTPA 3CGCA 3GD3A 3R07C 3R25A 4IL0A 4K8GA 3EAOA 2XH0A 2DW6A 3P3BA 5FS8A 3FXGA 1ECQA 1VQZA 1GREA 3HRDC 3NO1A 4EQSA 2QVHA 2I5QA 4H4XA 4YWOA 3SN0A 1RM6B 3N4EA 2BC1A 3U4FA 3URHA 4NEWA 4IL2A 2QDEA 3B97A 3CB3A 3STPA 2P8BA 5GRTA 5ER0A 1SJDA 1N5WC 3LADA 3V3WA 1Q1WA 2OPJA 1N5XA 3IJQA 3CGEA 4ZA0A 1SJCA 3ETRB 3GRTA 3TTEA 3OC4A 3GY1A 4J3ZA 2PSNA 3S47A 1IYXA 1TYTA 5FJPA 4TVYA 1XDIA 2C3DA 2GR0A 2YQUA 1JOAA 4MGGA 1DXLA 1GRHA 1KN0A 2QQ6A 2XH2A 3EUB3 1R6WA 3IJLA 4G8TA 3VC5A 2DW7A 2AKZA 4H19A 2PCEA 2X99A 4EQRA 2P8CA 4M0XA 3EKGA 4FP1A 3TOYA 2PTXA 2GL5A 1AOGA 3IC9A 3DK8A 1X2HA 2NQLA 3CXBA 4IP4A 2GH5A 5EU9A 4DXKA 5J04A 2P88A 1MDLA 2AL2B 3UCCA 2WPFA 3AM9A 4K1WA 2GGJA 1XANA 3DDMA 1GRAA 4HYRA 2WOIA 4GYPC 3NVVB 4DHGA 1BZLA 5FJRA 3OTRA 4MKSA 4KEMA 1FFVC 1DTNA 3THUA 3RR1A 1ZDLA 3DIPA 2PGEA 3NS1B 1GRBA 3RRAA 3OZYA 2QJJA 2WOVA 3CK5A 1GV4A 1N62C 1N61C 2GRTA 2O56A 1STZA 3R0KA 3MY9A 2QDDA 2WP6A 3FV9A 4E5TA 2E5AA 1TKKA 1LPFA 1PDZA 3NZGA 3R1ZA 3MKCA 3BJSA 3CYJA 4GGHA 2GDQA 1NU5A 3T4WA 3CXOA 1KD0A 3LXDA 2YVGA 1GEUA 1EC7A 2W3SA 1ZK7A 2GR3A 3DJGX 3OP2A 3D9XA 1E9IA 1ZKQA 3ZLHA 4F4RA 3DESA 2A8XA 3HPFA 3DH9A 1FHVA 2YAUA 2PODA 2GGIA 1ZMCA 3QKEA 1DNCA 3PK7A 4JN7A 5FMHA 4H1ZA 3OZMA 4APNA 2OZTA 2OQYA 1NHPA 4ROPA 3ENLA 5JCLA 1SJBA 4Z1YA 1FEAA 3L8KA 4A35A 1GRFA 4DX3A 1LVLA 3DERA 3H70A 3D46A 4H4VA 5FS9A 3DK9A 4K2SA 4JN8A 1GXFA 2GQWA 4GISA 4H83A 2GGEA 4LA1A 3RITA 4IHCA 4DWDA 2OO6A 3ES8A 4H50A 2RDXA 3I4KA 3T9PA 5JCIA 1BKHA 4LIIA 3DG3A 1F3PA 3FYYA 4E6MA 3DEQA 3Q4DA 4JQ9A 1NELA 4ZOHB 2PS2A 4MMWA 4H4RA 1D7YA 2OZ3A 1JROA 5FJUA 2WP5A 3UCDA 2QAEA 2XGZA 4EMWA 3N6JA 1GRTA 1ONFA 2R9ZA 3N4FA 3PWGA 1MNSA 5FJTA 3S5SA 3UGVA 3V5CA 1GSNA 4Z17A 2OVLA 4H4TA 1P43A 3HW2A 4GMEA 4BURA 2PTYA 3RNMA 3UJEA 3QFAA 2WOWA 3DK4A 3LB8A 1JDFA 3SR6B 4GIRA 4H4UA 5KVHA 3BOXA 3CGBA 4E8GA 1FECA 3NFUA 2W3RA 3QN3A 3IK4A 3ZVHA 3DFHA 3ES7A 3R10A 4HCLA 3GD4A 1M6IA 1JRPA 1EBHA 7ENLA 3H8AA 4M52A 2MNRA 3VFCA 1ZXIC 2ZZCA 2OX4A 3MSYA 2CDUA 3BSMA 4GR1A 2AAQA 2OKTA 2PPGA 3MQTA 3MUCA
chains in the Genus database with same CATH topology
1N5WC 1N60C 1SB3B 5G5HB 3NS1B 3A7AA 1FO4A 1N5XA 1X2GA 2W54A 3ETRB 3NRZB 1JROA 3R07C 2W3RA 3A7RA 2W3SA 1VDVA 1N62C 1X2HA 2W55A 1N61C 1WYGA 4TVYA 1VQZA 3HRDC 1JRPA 3AM9A 2E3TA 4TVWA 1T3QC 2E5AA 1N63C 1RM6B 1V97A 3NVVB 3B9JB 1ZXIC 3AMZA 3AN1A 3EUB3 3NVYB 1FFVC 1FIQB 1FFUC 3NVWB 5G5GB 3NVZB 3A7UA 3SR6B 4ZOHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5W C;  1N60 C;  1SB3 B;  5G5H B;  3NS1 B;  3A7A A;  1FO4 A;  1N5X A;  1X2G A;  2W54 A;  3ETR B;  3NRZ B;  1JRO A;  3R07 C;  2W3R A;  3A7R A;  2W3S A;  1VDV A;  1N62 C;  1X2H A;  2W55 A;  1N61 C;  1WYG A;  4TVY A;  1VQZ A;  3HRD C;  1JRP A;  3AM9 A;  2E3T A;  4TVW A;  1T3Q C;  2E5A A;  1N63 C;  1RM6 B;  1V97 A;  3NVV B;  3B9J B;  1ZXI C;  3AMZ A;  3AN1 A;  3EUB 3;  3NVY B;  1FFV C;  1FIQ B;  1FFU C;  3NVW B;  5G5G B;  3NVZ B;  3A7U A;  3SR6 B;  4ZOH B; 
#chains in the Genus database with same CATH topology
 1SJA A;  1FEB A;  3EF6 A;  2PGW A;  2PTZ A;  1K4Q A;  1JEH A;  4EM4 A;  3NRZ B;  3A7R A;  1L8P A;  2GGG A;  3L5O A;  3MWC A;  3QPE A;  3VCC A;  3UJF A;  3DG6 A;  3JZU A;  2PA6 A;  1TZZ A;  2TPR A;  3UJS A;  3CGD A;  2PMQ A;  1GES A;  1NHS A;  4H4Y A;  5JCK A;  3SJN A;  3SSZ A;  4GRT A;  2ONE A;  3I6E A;  6ENL A;  4G7F A;  2HNE A;  4IT1 A;  1X2G A;  3VC6 A;  2PP0 A;  5BOF A;  2FKP A;  3KLJ A;  4ADW A;  2PU1 A;  1XS2 A;  2PTW A;  2GR2 A;  3SN4 A;  3DGH A;  2YVJ A;  4A6G A;  4X2P A;  4H4S A;  1V97 A;  3ZVI A;  4JHM A;  2ZAD A;  2OZ8 A;  3JW7 A;  3D47 A;  3GC2 A;  2GR1 A;  1BQG A;  1ZY8 A;  5G5H B;  1N60 C;  3PFR A;  5ENL A;  1FO4 A;  2V3A A;  4FI4 A;  3H4K A;  3V5F A;  2X50 A;  3VA8 A;  3U9I A;  2XSX A;  2HZG A;  1T3Q C;  2HXU A;  3GRS A;  4KPR A;  2EQ8 A;  3FJ4 A;  2W0H A;  5U1O A;  1JPM A;  1FIQ B;  3NVZ B;  3PWI A;  2OG9 A;  3II4 A;  1H2I A;  2X8H A;  3NXL A;  4GGB A;  3UXK A;  2XH4 A;  1S7M A;  1SB3 B;  2AKM A;  4EMI A;  1ELS A;  2AL1 A;  2P3Z A;  3Q45 A;  1YQZ A;  5TR3 A;  2W54 A;  3TW9 A;  4NEV A;  2OFJ A;  1JCT A;  1WUF A;  2FYM A;  2WBA A;  1R0M A;  2NVK X;  2C3C A;  2P0I A;  5JRB A;  2HQM A;  3TWA A;  3K1G A;  3SQS A;  3EEZ A;  2POZ A;  3MZN A;  2ZZB A;  3RO6 A;  3AN1 A;  2BCP A;  3NVY B;  1FFU C;  2EQ6 A;  2QGY A;  3DGB A;  3RGT A;  3JVA A;  5FS7 A;  5BOE A;  1EBD A;  1NDA A;  5FJO A;  2F5Z A;  3PG6 A;  3T6C A;  3FG2 P;  4H4Q A;  1WUE A;  2ZZ0 A;  3CT2 A;  4EQW A;  1ONE A;  4HPN A;  3I6T A;  2E3T A;  4KWS A;  3OPS A;  4JDR A;  1NHQ A;  1GRG A;  1JPD X;  1KCZ A;  3H7V A;  4HNL A;  2AL2 A;  4KPL A;  3B9J B;  3DGZ A;  3AMZ A;  2OQH A;  4YWS A;  4J56 A;  3SBF A;  3H12 A;  4ENL A;  2NPX A;  1KKR A;  1TYP A;  1XHC A;  4BV6 A;  4H4Z A;  4EMJ A;  2QJM A;  3A7A A;  4IZG A;  2OLA A;  3IJI A;  4GFI A;  1KKO A;  3P93 A;  1TE6 A;  5JCM A;  2CHR A;  3CAW A;  4HCH A;  4E4U A;  3DG7 A;  1WYG A;  4H4W A;  3SN1 A;  3SQP A;  1OEP A;  4J1O A;  3ZVH B;  1MUC A;  4J57 A;  3FCP A;  4TVW A;  4GYP A;  3EAN A;  1OJT A;  3VCN A;  3R0U A;  3O0H A;  3Q6J A;  3NVW B;  1FHU A;  3DJJ A;  1MDR A;  4HN8 A;  4M6U A;  4ZCW A;  2EQ7 A;  3T8Q A;  3VDG A;  1V59 A;  3A7U A;  2X8C A;  3RCY A;  2RAB A;  1P48 A;  3QLD A;  2MUC A;  3OW1 A;  2XH7 A;  2V3B A;  5U25 A;  1EC8 A;  3TQP A;  1ZMD A;  4IP5 A;  3TJI A;  2GSH A;  4DYE A;  1MRA A;  1VDV A;  2W55 A;  1Q1R A;  4A3R A;  1EBG A;  5EBK A;  2GGH A;  2YVF A;  1NHR A;  2PU0 A;  1H6V A;  5KVI A;  4DNA A;  2J3N A;  4H2H A;  4K7Z A;  3FVD A;  2JK6 A;  2PP3 A;  4FDC B;  4DN1 A;  3TJ4 A;  4EQX A;  1W6T A;  2WPE A;  1GET A;  1XPY A;  2WPC A;  1GER A;  2X8G A;  3TCS A;  1ZX9 A;  2QJN A;  5FS6 A;  4EM3 A;  3V4B A;  1MOK A;  3P0W A;  2CFY A;  3KUM A;  3ZLF A;  4K8D A;  3UXL A;  4EWJ A;  5JCN A;  3GO2 A;  1BWC A;  5IDZ A;  1PDY A;  3ZLG A;  3DFY A;  3R11 A;  4KT2 A;  2HXT A;  1NPX A;  2ZC8 A;  1N63 C;  1F8W A;  2PP1 A;  3TWB A;  3UJR A;  5G5G B;  1YEY A;  1RVK A;  2EQ9 A;  2V6O A;  4E4F A;  1EC9 A;  2BC0 A;  3GD6 A;  3QFB A;  1MO9 A;  4FX9 A;  4H4P A;  4HNC A;  4HCD A;  3N6H A;  3UJ2 A;  1F9C A;  3QTP A;  3CGC A;  3GD3 A;  3R07 C;  3R25 A;  4IL0 A;  4K8G A;  3EAO A;  2XH0 A;  2DW6 A;  3P3B A;  5FS8 A;  3FXG A;  1ECQ A;  1VQZ A;  1GRE A;  3HRD C;  3NO1 A;  4EQS A;  2QVH A;  2I5Q A;  4H4X A;  4YWO A;  3SN0 A;  1RM6 B;  3N4E A;  2BC1 A;  3U4F A;  3URH A;  4NEW A;  4IL2 A;  2QDE A;  3B97 A;  3CB3 A;  3STP A;  2P8B A;  5GRT A;  5ER0 A;  1SJD A;  1N5W C;  3LAD A;  3V3W A;  1Q1W A;  2OPJ A;  1N5X A;  3IJQ A;  3CGE A;  4ZA0 A;  1SJC A;  3ETR B;  3GRT A;  3TTE A;  3OC4 A;  3GY1 A;  4J3Z A;  2PSN A;  3S47 A;  1IYX A;  1TYT A;  5FJP A;  4TVY A;  1XDI A;  2C3D A;  2GR0 A;  2YQU A;  1JOA A;  4MGG A;  1DXL A;  1GRH A;  1KN0 A;  2QQ6 A;  2XH2 A;  3EUB 3;  1R6W A;  3IJL A;  4G8T A;  3VC5 A;  2DW7 A;  2AKZ A;  4H19 A;  2PCE A;  2X99 A;  4EQR A;  2P8C A;  4M0X A;  3EKG A;  4FP1 A;  3TOY A;  2PTX A;  2GL5 A;  1AOG A;  3IC9 A;  3DK8 A;  1X2H A;  2NQL A;  3CXB A;  4IP4 A;  2GH5 A;  5EU9 A;  4DXK A;  5J04 A;  2P88 A;  1MDL A;  2AL2 B;  3UCC A;  2WPF A;  3AM9 A;  4K1W A;  2GGJ A;  1XAN A;  3DDM A;  1GRA A;  4HYR A;  2WOI A;  4GYP C;  3NVV B;  4DHG A;  1BZL A;  5FJR A;  3OTR A;  4MKS A;  4KEM A;  1FFV C;  1DTN A;  3THU A;  3RR1 A;  1ZDL A;  3DIP A;  2PGE A;  3NS1 B;  1GRB A;  3RRA A;  3OZY A;  2QJJ A;  2WOV A;  3CK5 A;  1GV4 A;  1N62 C;  1N61 C;  2GRT A;  2O56 A;  1STZ A;  3R0K A;  3MY9 A;  2QDD A;  2WP6 A;  3FV9 A;  4E5T A;  2E5A A;  1TKK A;  1LPF A;  1PDZ A;  3NZG A;  3R1Z A;  3MKC A;  3BJS A;  3CYJ A;  4GGH A;  2GDQ A;  1NU5 A;  3T4W A;  3CXO A;  1KD0 A;  3LXD A;  2YVG A;  1GEU A;  1EC7 A;  2W3S A;  1ZK7 A;  2GR3 A;  3DJG X;  3OP2 A;  3D9X A;  1E9I A;  1ZKQ A;  3ZLH A;  4F4R A;  3DES A;  2A8X A;  3HPF A;  3DH9 A;  1FHV A;  2YAU A;  2POD A;  2GGI A;  1ZMC A;  3QKE A;  1DNC A;  3PK7 A;  4JN7 A;  5FMH A;  4H1Z A;  3OZM A;  4APN A;  2OZT A;  2OQY A;  1NHP A;  4ROP A;  3ENL A;  5JCL A;  1SJB A;  4Z1Y A;  1FEA A;  3L8K A;  4A35 A;  1GRF A;  4DX3 A;  1LVL A;  3DER A;  3H70 A;  3D46 A;  4H4V A;  5FS9 A;  3DK9 A;  4K2S A;  4JN8 A;  1GXF A;  2GQW A;  4GIS A;  4H83 A;  2GGE A;  4LA1 A;  3RIT A;  4IHC A;  4DWD A;  2OO6 A;  3ES8 A;  4H50 A;  2RDX A;  3I4K A;  3T9P A;  5JCI A;  1BKH A;  4LII A;  3DG3 A;  1F3P A;  3FYY A;  4E6M A;  3DEQ A;  3Q4D A;  4JQ9 A;  1NEL A;  4ZOH B;  2PS2 A;  4MMW A;  4H4R A;  1D7Y A;  2OZ3 A;  1JRO A;  5FJU A;  2WP5 A;  3UCD A;  2QAE A;  2XGZ A;  4EMW A;  3N6J A;  1GRT A;  1ONF A;  2R9Z A;  3N4F A;  3PWG A;  1MNS A;  5FJT A;  3S5S A;  3UGV A;  3V5C A;  1GSN A;  4Z17 A;  2OVL A;  4H4T A;  1P43 A;  3HW2 A;  4GME A;  4BUR A;  2PTY A;  3RNM A;  3UJE A;  3QFA A;  2WOW A;  3DK4 A;  3LB8 A;  1JDF A;  3SR6 B;  4GIR A;  4H4U A;  5KVH A;  3BOX A;  3CGB A;  4E8G A;  1FEC A;  3NFU A;  2W3R A;  3QN3 A;  3IK4 A;  3ZVH A;  3DFH A;  3ES7 A;  3R10 A;  4HCL A;  3GD4 A;  1M6I A;  1JRP A;  1EBH A;  7ENL A;  3H8A A;  4M52 A;  2MNR A;  3VFC A;  1ZXI C;  2ZZC A;  2OX4 A;  3MSY A;  2CDU A;  3BSM A;  4GR1 A;  2AAQ A;  2OKT A;  2PPG A;  3MQT A;  3MUC A; 
#chains in the Genus database with same CATH homology
 1N5W C;  1N60 C;  1SB3 B;  5G5H B;  3NS1 B;  3A7A A;  1FO4 A;  1N5X A;  1X2G A;  2W54 A;  3ETR B;  3NRZ B;  1JRO A;  3R07 C;  2W3R A;  3A7R A;  2W3S A;  1VDV A;  1N62 C;  1X2H A;  2W55 A;  1N61 C;  1WYG A;  4TVY A;  1VQZ A;  3HRD C;  1JRP A;  3AM9 A;  2E3T A;  4TVW A;  1T3Q C;  2E5A A;  1N63 C;  1RM6 B;  1V97 A;  3NVV B;  3B9J B;  1ZXI C;  3AMZ A;  3AN1 A;  3EUB 3;  3NVY B;  1FFV C;  1FIQ B;  1FFU C;  3NVW B;  5G5G B;  3NVZ B;  3A7U A;  3SR6 B;  4ZOH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...