3R07C

Structural analysis of an archaeal lipoylation system. a bi-partite lipoate protein ligase and its e2 lipoyl domain from thermoplasma acidophilum
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
88
Chain Sequence
MHMMYSKNWKAKKGLIRVTLDLDGNRIKDIHISGDFFMFPEDSINRLEDMLRGSSIEKINDIIRDFYNQGVITPGVEPEDFIQALRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of an archaeal lipoylation system. A bi-partite lipoate protein ligase and its E2 lipoyl domain from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum dsm 1728
molecule tags Transferase
molecule keywords Lipoate-protein ligase A subunit 1
total genus 21
structure length 88
sequence length 88
ec nomenclature ec 6.3.1.20: Lipoate--protein ligase.
pdb deposition date 2011-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 3r07C00
1FFVC 3NVWB 1FO4A 2E5AA 1JRPA 1V97A 3A7UA 5G5HB 1N60C 2E3TA 3NRZB 2W3RA 4TVWA 1VDVA 2W3SA 1N5XA 1SB3B 1N63C 1FFUC 3B9JB 3NVYB 1N5WC 1JROA 2W55A 3HRDC 4TVYA 3SR6B 3AMZA 3R07C 3AN1A 1T3QC 3EUB3 3NS1B 3NVZB 3ETRB 1N62C 3AM9A 3A7AA 1N61C 1FIQB 4ZOHB 1WYGA 1X2HA 1ZXIC 3A7RA 3NVVB 2W54A 5G5GB 1X2GA 1VQZA 1RM6B
chains in the Genus database with same CATH superfamily
2HZGA 3ZVHA 3CYJA 3N6HA 2CDUA 2E3TA 3QKEA 3OZMA 4TVWA 1EC8A 1N5XA 1V59A 5J04A 2PP0A 3NVYB 1TYPA 5JCMA 5FJOA 3CXBA 3SQPA 3GO2A 4IHCA 3CGBA 3DIPA 1Q1RA 4JN7A 2GGJA 4BURA 1L8PA 3STPA 4ZA0A 1PDYA 3NZGA 3QFBA 3OPSA 3R10A 3ENLA 3R25A 1D7YA 2PU1A 1ZKQA 3Q4DA 1MDLA 2P0IA 3IC9A 3N4EA 4J1OA 3RR1A 3TCSA 4H4PA 4E4UA 2AL2B 2C3CA 2PTWA 1BQGA 2PMQA 3UXLA 4EM3A 3AMZA 3IJLA 4H4RA 3JZUA 3UGVA 5FJUA 2GR0A 4Z1YA 2ZZ0A 2C3DA 2XGZA 4EQSA 1P43A 1NDAA 3OP2A 3VC6A 3DGBA 2X8HA 2YVGA 1ZMDA 1E9IA 2EQ9A 2YQUA 3MZNA 4K8DA 2WOVA 1N60C 2OO6A 4FI4A 2GDQA 3MQTA 4BV6A 3B9JB 4MMWA 5FS7A 2YAUA 3JW7A 1R6WA 3L5OA 3MSYA 3FJ4A 2DW6A 2GH5A 2P3ZA 1GRAA 3QPEA 2OZ8A 2QJJA 5FMHA 1JPMA 2AAQA 2DW7A 3TJ4A 4J3ZA 4YWSA 2GRTA 2QJNA 2OLAA 1X2GA 1MUCA 2PS2A 3N4FA 4H50A 1YEYA 2OKTA 3OC4A 1DTNA 1V97A 3T6CA 3A7UA 3H4KA 4EMIA 3U9IA 3PK7A 2ZZCA 2HXTA 3MKCA 1MNSA 1TZZA 4H4TA 2F5ZA 1NHPA 1IYXA 3RCYA 2PCEA 2JK6A 3GC2A 4HCDA 3AM9A 1MDRA 2XH7A 4GGBA 3A7AA 2WOIA 2XH4A 3FG2P 2NQLA 4NEWA 1GETA 1GESA 1JPDX 3P0WA 3D47A 1OJTA 3R0KA 1FEBA 1DNCA 3CAWA 3DK4A 1TKKA 2QAEA 4GIRA 3VA8A 3EEZA 3JVAA 3S5SA 3IJQA 3ZLFA 4DX3A 2X8GA 2QJMA 1NU5A 3ES7A 3PFRA 2HQMA 4A3RA 3DK8A 4DWDA 1FFVC 5FJPA 3HPFA 2WBAA 2QDDA 1F9CA 1NHSA 4M52A 3B97A 1VDVA 1ONFA 4HN8A 2MUCA 2PTXA 2WP6A 3DG6A 4LA1A 3HRDC 1GRBA 3DH9A 2NPXA 4GR1A 3QFAA 3ETRB 5BOEA 3OZYA 4K8GA 3TQPA 3CK5A 3A7RA 2V6OA 2EQ7A 3H70A 4ZCWA 2OFJA 2P8BA 4IZGA 1LVLA 5FS8A 3SJNA 2ZC8A 4JHMA 2PSNA 4HPNA 3UJ2A 4IL2A 2W3SA 1SB3B 2OZTA 1SJDA 4DHGA 3PWGA 4TVYA 3P93A 1GXFA 1OEPA 3GRSA 3TWAA 3UJRA 3CB3A 3NVZB 2RABA 1W6TA 3QN3A 4IT1A 3DESA 4MGGA 3NFUA 4H4QA 4GISA 1N61C 4ZOHB 4K2SA 1F3PA 4HCLA 5G5GB 2HNEA 2X8CA 4ROPA 1SJBA 4FP1A 4DXKA 4MKSA 5EBKA 2QDEA 1GEUA 3SSZA 4Z17A 2EQ8A 3DG3A 3EANA 3UJEA 2GR3A 4H4WA 3I4KA 3T8QA 4EMJA 2GL5A 2OVLA 3R07C 3MWCA 3S47A 4GMEA 3FVDA 1ZMCA 3MY9A 3RNMA 1SJAA 3SBFA 3KLJA 1ZXIC 2YVFA 4IP5A 1NHRA 4F4RA 2ONEA 4G7FA 3SN4A 3KUMA 1RM6B 3FYYA 4E8GA 1R0MA 3CXOA 3TWBA 1F8WA 1M6IA 2AL1A 4G8TA 1ELSA 1PDZA 2PP1A 3NRZB 3OTRA 3PG6A 4FDCB 1GERA 2PA6A 4KPRA 3GY1A 1N5WC 4KT2A 3DGZA 4JQ9A 1H6VA 1XPYA 1JCTA 1T3QC 2QQ6A 3GD4A 4IP4A 1EC9A 2OZ3A 4M0XA 2ZADA 4X2PA 3L8KA 3RITA 1KN0A 1GSNA 1XANA 4K7ZA 3NVWB 3I6EA 4KWSA 5FJTA 1FO4A 3DGHA 4HCHA 3ES8A 2QVHA 3VFCA 3BOXA 2CFYA 2XH0A 1BKHA 3H8AA 1FEAA 2A8XA 4GYPA 2BC1A 1STZA 5KVIA 1SJCA 2XH2A 3Q45A 4E4FA 1KKRA 3UCDA 2OPJA 2QGYA 1MOKA 2GSHA 5GRTA 3CGDA 4EQXA 1ZDLA 4GYPC 4EQWA 7ENLA 3DFYA 2GR1A 3V5FA 3SN1A 3D46A 3BSMA 2POZA 3DFHA 2XSXA 2CHRA 1FHUA 2OQYA 1KD0A 3HW2A 2OQHA 2GGEA 1RVKA 3UCCA 1N63C 2V3AA 2W55A 3IK4A 1AOGA 1EBDA 1TE6A 3EF6A 3GD6A 3H12A 1GRFA 3TOYA 4DNAA 3TJIA 4H4SA 4H4UA 1WYGA 3FV9A 3VC5A 3LADA 1BZLA 3ZLHA 3DJGX 3EAOA 4DYEA 3SN0A 1FECA 3CGEA 3QTPA 2NVKX 3CT2A 4E5TA 1GV4A 4GRTA 1WUFA 2GR2A 4H4ZA 1FFUC 3EKGA 5JCNA 3RRAA 2RDXA 3AN1A 3EUB3 1N62C 2WOWA 1XHCA 4J56A 1S7MA 3T9PA 4HNCA 4HYRA 3DJJA 3QLDA 4EMWA 2P8CA 2PTYA 4E6MA 2W54A 4KEMA 3P3BA 3N6JA 1GREA 4YWOA 5JCLA 2R9ZA 2ZZBA 2PGEA 5U25A 4HNLA 2X99A 2TPRA 1JRPA 1DXLA 2GGIA 1Q1WA 2YVJA 5G5HB 2WP5A 4ADWA 3BJSA 4GGHA 3MUCA 2PU0A 5JCKA 5EU9A 6ENLA 3TTEA 2J3NA 4J57A 5TR3A 3SR6B 2X50A 3NS1B 4H4VA 3II4A 3R11A 4EM4A 3V5CA 4LIIA 1JDFA 1KCZA 3V3WA 1X2HA 2PODA 4H19A 1YQZA 4A6GA 2OX4A 1ZK7A 2PPGA 3DDMA 3T4WA 5BOFA 1K4QA 1VQZA 1GRHA 4H1ZA 4NEVA 4ENLA 3UJFA 3DERA 1BWCA 3DK9A 3Q6JA 2AKMA 3R0UA 1ONEA 3ZVIA 2AL2A 2P88A 4M6UA 3IJIA 3THUA 2WPFA 2GGGA 3FXGA 3VDGA 2HXUA 5IDZA 2FKPA 2FYMA 3CGCA 2PP3A 1ZX9A 4FX9A 2BC0A 1JEHA 1FIQB 1TYTA 1ECQA 3VCCA 3NXLA 3ZVHB 4H4XA 4DN1A 5JRBA 1EBGA 4JDRA 1NHQA 4H2HA 2E5AA 4EWJA 1P48A 2MNRA 2V3BA 4A35A 2AKZA 3UXKA 2GGHA 3V4BA 2WPCA 1H2IA 3GD3A 4KPLA 1FHVA 1JROA 2OG9A 2PGWA 5JCIA 5ENLA 3URHA 3D9XA 5U1OA 4APNA 1WUEA 3U4FA 3I6TA 2WPEA 3DEQA 1XS2A 3DG7A 3TW9A 3FCPA 3GRTA 3UJSA 1GRGA 3SQSA 1JOAA 3RO6A 5KVHA 3R1ZA 1MRAA 4IL0A 5FJRA 5ER0A 1XDIA 4H83A 3ZLGA 1GRTA 2W3RA 2O56A 3O0HA 2W0HA 3OW1A 1EC7A 1NPXA 3LXDA 2I5QA 3NO1A 2GQWA 1EBHA 1KKOA 1MO9A 3K1GA 4GFIA 5FS6A 3VCNA 2BCPA 2PTZA 4H4YA 4JN8A 1LPFA 2EQ6A 3NVVB 5FS9A 3RGTA 4EQRA 1ZY8A 3H7VA 4K1WA 3PWIA 3LB8A 1NELA
chains in the Genus database with same CATH topology
1FFVC 3NVWB 1FO4A 2E5AA 1JRPA 1V97A 3A7UA 5G5HB 1N60C 2E3TA 3NRZB 2W3RA 4TVWA 1VDVA 2W3SA 1N5XA 1SB3B 1N63C 1FFUC 3B9JB 3NVYB 1N5WC 1JROA 2W55A 3HRDC 4TVYA 3SR6B 3AMZA 3R07C 3AN1A 1T3QC 3EUB3 3NS1B 3NVZB 3ETRB 1N62C 3AM9A 3A7AA 1N61C 1FIQB 4ZOHB 1WYGA 1X2HA 1ZXIC 3A7RA 3NVVB 2W54A 5G5GB 1X2GA 1VQZA 1RM6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFV C;  3NVW B;  1FO4 A;  2E5A A;  1JRP A;  1V97 A;  3A7U A;  5G5H B;  1N60 C;  2E3T A;  3NRZ B;  2W3R A;  4TVW A;  1VDV A;  2W3S A;  1N5X A;  1SB3 B;  1N63 C;  1FFU C;  3B9J B;  3NVY B;  1N5W C;  1JRO A;  2W55 A;  3HRD C;  4TVY A;  3SR6 B;  3AMZ A;  3R07 C;  3AN1 A;  1T3Q C;  3EUB 3;  3NS1 B;  3NVZ B;  3ETR B;  1N62 C;  3AM9 A;  3A7A A;  1N61 C;  1FIQ B;  4ZOH B;  1WYG A;  1X2H A;  1ZXI C;  3A7R A;  3NVV B;  2W54 A;  5G5G B;  1X2G A;  1VQZ A;  1RM6 B; 
#chains in the Genus database with same CATH topology
 2HZG A;  3ZVH A;  3CYJ A;  3N6H A;  2CDU A;  2E3T A;  3QKE A;  3OZM A;  4TVW A;  1EC8 A;  1N5X A;  1V59 A;  5J04 A;  2PP0 A;  3NVY B;  1TYP A;  5JCM A;  5FJO A;  3CXB A;  3SQP A;  3GO2 A;  4IHC A;  3CGB A;  3DIP A;  1Q1R A;  4JN7 A;  2GGJ A;  4BUR A;  1L8P A;  3STP A;  4ZA0 A;  1PDY A;  3NZG A;  3QFB A;  3OPS A;  3R10 A;  3ENL A;  3R25 A;  1D7Y A;  2PU1 A;  1ZKQ A;  3Q4D A;  1MDL A;  2P0I A;  3IC9 A;  3N4E A;  4J1O A;  3RR1 A;  3TCS A;  4H4P A;  4E4U A;  2AL2 B;  2C3C A;  2PTW A;  1BQG A;  2PMQ A;  3UXL A;  4EM3 A;  3AMZ A;  3IJL A;  4H4R A;  3JZU A;  3UGV A;  5FJU A;  2GR0 A;  4Z1Y A;  2ZZ0 A;  2C3D A;  2XGZ A;  4EQS A;  1P43 A;  1NDA A;  3OP2 A;  3VC6 A;  3DGB A;  2X8H A;  2YVG A;  1ZMD A;  1E9I A;  2EQ9 A;  2YQU A;  3MZN A;  4K8D A;  2WOV A;  1N60 C;  2OO6 A;  4FI4 A;  2GDQ A;  3MQT A;  4BV6 A;  3B9J B;  4MMW A;  5FS7 A;  2YAU A;  3JW7 A;  1R6W A;  3L5O A;  3MSY A;  3FJ4 A;  2DW6 A;  2GH5 A;  2P3Z A;  1GRA A;  3QPE A;  2OZ8 A;  2QJJ A;  5FMH A;  1JPM A;  2AAQ A;  2DW7 A;  3TJ4 A;  4J3Z A;  4YWS A;  2GRT A;  2QJN A;  2OLA A;  1X2G A;  1MUC A;  2PS2 A;  3N4F A;  4H50 A;  1YEY A;  2OKT A;  3OC4 A;  1DTN A;  1V97 A;  3T6C A;  3A7U A;  3H4K A;  4EMI A;  3U9I A;  3PK7 A;  2ZZC A;  2HXT A;  3MKC A;  1MNS A;  1TZZ A;  4H4T A;  2F5Z A;  1NHP A;  1IYX A;  3RCY A;  2PCE A;  2JK6 A;  3GC2 A;  4HCD A;  3AM9 A;  1MDR A;  2XH7 A;  4GGB A;  3A7A A;  2WOI A;  2XH4 A;  3FG2 P;  2NQL A;  4NEW A;  1GET A;  1GES A;  1JPD X;  3P0W A;  3D47 A;  1OJT A;  3R0K A;  1FEB A;  1DNC A;  3CAW A;  3DK4 A;  1TKK A;  2QAE A;  4GIR A;  3VA8 A;  3EEZ A;  3JVA A;  3S5S A;  3IJQ A;  3ZLF A;  4DX3 A;  2X8G A;  2QJM A;  1NU5 A;  3ES7 A;  3PFR A;  2HQM A;  4A3R A;  3DK8 A;  4DWD A;  1FFV C;  5FJP A;  3HPF A;  2WBA A;  2QDD A;  1F9C A;  1NHS A;  4M52 A;  3B97 A;  1VDV A;  1ONF A;  4HN8 A;  2MUC A;  2PTX A;  2WP6 A;  3DG6 A;  4LA1 A;  3HRD C;  1GRB A;  3DH9 A;  2NPX A;  4GR1 A;  3QFA A;  3ETR B;  5BOE A;  3OZY A;  4K8G A;  3TQP A;  3CK5 A;  3A7R A;  2V6O A;  2EQ7 A;  3H70 A;  4ZCW A;  2OFJ A;  2P8B A;  4IZG A;  1LVL A;  5FS8 A;  3SJN A;  2ZC8 A;  4JHM A;  2PSN A;  4HPN A;  3UJ2 A;  4IL2 A;  2W3S A;  1SB3 B;  2OZT A;  1SJD A;  4DHG A;  3PWG A;  4TVY A;  3P93 A;  1GXF A;  1OEP A;  3GRS A;  3TWA A;  3UJR A;  3CB3 A;  3NVZ B;  2RAB A;  1W6T A;  3QN3 A;  4IT1 A;  3DES A;  4MGG A;  3NFU A;  4H4Q A;  4GIS A;  1N61 C;  4ZOH B;  4K2S A;  1F3P A;  4HCL A;  5G5G B;  2HNE A;  2X8C A;  4ROP A;  1SJB A;  4FP1 A;  4DXK A;  4MKS A;  5EBK A;  2QDE A;  1GEU A;  3SSZ A;  4Z17 A;  2EQ8 A;  3DG3 A;  3EAN A;  3UJE A;  2GR3 A;  4H4W A;  3I4K A;  3T8Q A;  4EMJ A;  2GL5 A;  2OVL A;  3R07 C;  3MWC A;  3S47 A;  4GME A;  3FVD A;  1ZMC A;  3MY9 A;  3RNM A;  1SJA A;  3SBF A;  3KLJ A;  1ZXI C;  2YVF A;  4IP5 A;  1NHR A;  4F4R A;  2ONE A;  4G7F A;  3SN4 A;  3KUM A;  1RM6 B;  3FYY A;  4E8G A;  1R0M A;  3CXO A;  3TWB A;  1F8W A;  1M6I A;  2AL1 A;  4G8T A;  1ELS A;  1PDZ A;  2PP1 A;  3NRZ B;  3OTR A;  3PG6 A;  4FDC B;  1GER A;  2PA6 A;  4KPR A;  3GY1 A;  1N5W C;  4KT2 A;  3DGZ A;  4JQ9 A;  1H6V A;  1XPY A;  1JCT A;  1T3Q C;  2QQ6 A;  3GD4 A;  4IP4 A;  1EC9 A;  2OZ3 A;  4M0X A;  2ZAD A;  4X2P A;  3L8K A;  3RIT A;  1KN0 A;  1GSN A;  1XAN A;  4K7Z A;  3NVW B;  3I6E A;  4KWS A;  5FJT A;  1FO4 A;  3DGH A;  4HCH A;  3ES8 A;  2QVH A;  3VFC A;  3BOX A;  2CFY A;  2XH0 A;  1BKH A;  3H8A A;  1FEA A;  2A8X A;  4GYP A;  2BC1 A;  1STZ A;  5KVI A;  1SJC A;  2XH2 A;  3Q45 A;  4E4F A;  1KKR A;  3UCD A;  2OPJ A;  2QGY A;  1MOK A;  2GSH A;  5GRT A;  3CGD A;  4EQX A;  1ZDL A;  4GYP C;  4EQW A;  7ENL A;  3DFY A;  2GR1 A;  3V5F A;  3SN1 A;  3D46 A;  3BSM A;  2POZ A;  3DFH A;  2XSX A;  2CHR A;  1FHU A;  2OQY A;  1KD0 A;  3HW2 A;  2OQH A;  2GGE A;  1RVK A;  3UCC A;  1N63 C;  2V3A A;  2W55 A;  3IK4 A;  1AOG A;  1EBD A;  1TE6 A;  3EF6 A;  3GD6 A;  3H12 A;  1GRF A;  3TOY A;  4DNA A;  3TJI A;  4H4S A;  4H4U A;  1WYG A;  3FV9 A;  3VC5 A;  3LAD A;  1BZL A;  3ZLH A;  3DJG X;  3EAO A;  4DYE A;  3SN0 A;  1FEC A;  3CGE A;  3QTP A;  2NVK X;  3CT2 A;  4E5T A;  1GV4 A;  4GRT A;  1WUF A;  2GR2 A;  4H4Z A;  1FFU C;  3EKG A;  5JCN A;  3RRA A;  2RDX A;  3AN1 A;  3EUB 3;  1N62 C;  2WOW A;  1XHC A;  4J56 A;  1S7M A;  3T9P A;  4HNC A;  4HYR A;  3DJJ A;  3QLD A;  4EMW A;  2P8C A;  2PTY A;  4E6M A;  2W54 A;  4KEM A;  3P3B A;  3N6J A;  1GRE A;  4YWO A;  5JCL A;  2R9Z A;  2ZZB A;  2PGE A;  5U25 A;  4HNL A;  2X99 A;  2TPR A;  1JRP A;  1DXL A;  2GGI A;  1Q1W A;  2YVJ A;  5G5H B;  2WP5 A;  4ADW A;  3BJS A;  4GGH A;  3MUC A;  2PU0 A;  5JCK A;  5EU9 A;  6ENL A;  3TTE A;  2J3N A;  4J57 A;  5TR3 A;  3SR6 B;  2X50 A;  3NS1 B;  4H4V A;  3II4 A;  3R11 A;  4EM4 A;  3V5C A;  4LII A;  1JDF A;  1KCZ A;  3V3W A;  1X2H A;  2POD A;  4H19 A;  1YQZ A;  4A6G A;  2OX4 A;  1ZK7 A;  2PPG A;  3DDM A;  3T4W A;  5BOF A;  1K4Q A;  1VQZ A;  1GRH A;  4H1Z A;  4NEV A;  4ENL A;  3UJF A;  3DER A;  1BWC A;  3DK9 A;  3Q6J A;  2AKM A;  3R0U A;  1ONE A;  3ZVI A;  2AL2 A;  2P88 A;  4M6U A;  3IJI A;  3THU A;  2WPF A;  2GGG A;  3FXG A;  3VDG A;  2HXU A;  5IDZ A;  2FKP A;  2FYM A;  3CGC A;  2PP3 A;  1ZX9 A;  4FX9 A;  2BC0 A;  1JEH A;  1FIQ B;  1TYT A;  1ECQ A;  3VCC A;  3NXL A;  3ZVH B;  4H4X A;  4DN1 A;  5JRB A;  1EBG A;  4JDR A;  1NHQ A;  4H2H A;  2E5A A;  4EWJ A;  1P48 A;  2MNR A;  2V3B A;  4A35 A;  2AKZ A;  3UXK A;  2GGH A;  3V4B A;  2WPC A;  1H2I A;  3GD3 A;  4KPL A;  1FHV A;  1JRO A;  2OG9 A;  2PGW A;  5JCI A;  5ENL A;  3URH A;  3D9X A;  5U1O A;  4APN A;  1WUE A;  3U4F A;  3I6T A;  2WPE A;  3DEQ A;  1XS2 A;  3DG7 A;  3TW9 A;  3FCP A;  3GRT A;  3UJS A;  1GRG A;  3SQS A;  1JOA A;  3RO6 A;  5KVH A;  3R1Z A;  1MRA A;  4IL0 A;  5FJR A;  5ER0 A;  1XDI A;  4H83 A;  3ZLG A;  1GRT A;  2W3R A;  2O56 A;  3O0H A;  2W0H A;  3OW1 A;  1EC7 A;  1NPX A;  3LXD A;  2I5Q A;  3NO1 A;  2GQW A;  1EBH A;  1KKO A;  1MO9 A;  3K1G A;  4GFI A;  5FS6 A;  3VCN A;  2BCP A;  2PTZ A;  4H4Y A;  4JN8 A;  1LPF A;  2EQ6 A;  3NVV B;  5FS9 A;  3RGT A;  4EQR A;  1ZY8 A;  3H7V A;  4K1W A;  3PWI A;  3LB8 A;  1NEL A; 
#chains in the Genus database with same CATH homology
 1FFV C;  3NVW B;  1FO4 A;  2E5A A;  1JRP A;  1V97 A;  3A7U A;  5G5H B;  1N60 C;  2E3T A;  3NRZ B;  2W3R A;  4TVW A;  1VDV A;  2W3S A;  1N5X A;  1SB3 B;  1N63 C;  1FFU C;  3B9J B;  3NVY B;  1N5W C;  1JRO A;  2W55 A;  3HRD C;  4TVY A;  3SR6 B;  3AMZ A;  3R07 C;  3AN1 A;  1T3Q C;  3EUB 3;  3NS1 B;  3NVZ B;  3ETR B;  1N62 C;  3AM9 A;  3A7A A;  1N61 C;  1FIQ B;  4ZOH B;  1WYG A;  1X2H A;  1ZXI C;  3A7R A;  3NVV B;  2W54 A;  5G5G B;  1X2G A;  1VQZ A;  1RM6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...