3R07C

Structural analysis of an archaeal lipoylation system. a bi-partite lipoate protein ligase and its e2 lipoyl domain from thermoplasma acidophilum
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
88
Chain Sequence
MHMMYSKNWKAKKGLIRVTLDLDGNRIKDIHISGDFFMFPEDSINRLEDMLRGSSIEKINDIIRDFYNQGVITPGVEPEDFIQALRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of an archaeal lipoylation system. A bi-partite lipoate protein ligase and its E2 lipoyl domain from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum dsm 1728
molecule tags Transferase
molecule keywords Lipoate-protein ligase A subunit 1
total genus 21
structure length 88
sequence length 88
ec nomenclature ec 6.3.1.20: Lipoate--protein ligase.
pdb deposition date 2011-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 3r07C00
2E5AA 1V97A 2W55A 3B9JB 1FFVC 3NVVB 1N62C 1N61C 3NVYB 1N60C 1JROA 3A7RA 1T3QC 2W54A 3AM9A 3EUB3 3NRZB 3R07C 2E3TA 1FO4A 5G5HB 4TVYA 1JRPA 3HRDC 1VDVA 1N5WC 3A7AA 5G5GB 4ZOHB 1RM6B 3NS1B 1X2HA 2W3SA 1N63C 2W3RA 1N5XA 1FIQB 1FFUC 3A7UA 4TVWA 3SR6B 1VQZA 1ZXIC 1WYGA 3NVZB 3ETRB 1SB3B 3NVWB 3AN1A 1X2GA 3AMZA
chains in the Genus database with same CATH superfamily
3UJSA 1MRAA 2EQ9A 2QDDA 4KPLA 1ONEA 2QJNA 3GRTA 3I6EA 3MY9A 4K2SA 3CYJA 3MSYA 4H4QA 2GGJA 3ZLHA 4JN8A 4NEWA 5FS7A 2WOVA 1L8PA 5FJPA 4DNAA 1ZY8A 2W3SA 3R25A 4GYPC 1GV4A 2PS2A 1GERA 2PTZA 1ZXIC 2DW7A 1SB3B 3SSZA 3H4KA 4GIRA 4J3ZA 3TJIA 1JDFA 4LIIA 1YQZA 4HNCA 2PGWA 1ELSA 4ENLA 4ADWA 4X2PA 2BC1A 3OC4A 3SN0A 4H4SA 3VDGA 4J57A 2TPRA 3A7AA 1RM6B 4DXKA 1DXLA 3OTRA 5TR3A 2ZZ0A 3UJEA 2C3CA 3UXKA 2ZC8A 3Q6JA 4K1WA 3OZMA 4M6UA 2BC0A 3IK4A 4JN7A 1Q1RA 2EQ6A 2YVFA 3VC5A 3KLJA 3ZLGA 3DGBA 3H8AA 1M6IA 2XSXA 2W54A 3R11A 1ZDLA 4HCDA 3RGTA 3U4FA 2QDEA 3QLDA 1F3PA 4YWOA 4IL0A 4ROPA 2POZA 2C3DA 3NS1B 1GRBA 3JZUA 4FX9A 1FIQB 3A7UA 2PP3A 2PA6A 3S47A 3DEQA 1ZK7A 1GREA 1EC7A 1STZA 4ZCWA 1JPMA 5FS8A 3SJNA 3ETRB 2YQUA 4G8TA 3NXLA 1LVLA 3V4BA 4APNA 1P43A 1E9IA 3R10A 3B9JB 1FFVC 1MNSA 1PDZA 2X50A 1EC8A 1GEUA 2GR1A 2XGZA 3QFBA 4HCHA 4GFIA 3H7VA 3VC6A 4HN8A 3DESA 3TW9A 3I4KA 2X99A 3O0HA 1D7YA 3CGEA 3FYYA 3S5SA 3EEZA 1GRFA 3DFYA 3GD4A 3HPFA 4E4FA 1FEAA 2PTWA 3CAWA 1BZLA 2AL2B 3N4EA 3DK4A 4GGBA 2PGEA 1JROA 4H50A 3EF6A 4H4PA 1OEPA 3QTPA 3U9IA 5G5HB 4TVYA 1VDVA 2HXTA 2GL5A 3PK7A 3H12A 3RNMA 2MNRA 1N63C 1RVKA 2NQLA 3GD6A 3I6TA 3SQPA 5ER0A 1JOAA 3TWBA 1SJAA 3ZVIA 1SJCA 2ZZCA 1P48A 3K1GA 4J1OA 4EQRA 2W55A 2WP5A 4HNLA 3GRSA 5U25A 4BV6A 2GGGA 3FV9A 3Q45A 4NEVA 1XDIA 2WOWA 5FMHA 3JVAA 4E5TA 4LA1A 1H2IA 2XH0A 1ZKQA 2YVGA 3HRDC 3ENLA 1KKRA 2AL2A 1NHPA 1R6WA 3P0WA 3MQTA 4IT1A 1ZMCA 2BCPA 1JEHA 2CHRA 2OQHA 4E6MA 2GR3A 2P8CA 1N5XA 2WPFA 3L8KA 1K4QA 2MUCA 1V59A 3ZVHA 2ONEA 1DTNA 3DERA 5KVHA 2OKTA 4MMWA 3UGVA 3NVWB 4JHMA 1XPYA 1GSNA 1V97A 2E5AA 4DYEA 3V5FA 2FKPA 2X8CA 3SBFA 4JQ9A 5FS9A 5JCLA 4EWJA 3FVDA 1BWCA 3BJSA 3UJRA 1BKHA 2HZGA 3FCPA 3LXDA 3QN3A 3DJGX 2OO6A 5FS6A 3HW2A 3DK9A 5G5GB 5J04A 2WPCA 3ES7A 3MWCA 1SJBA 3DGHA 4A6GA 3SR6B 4M0XA 3RR1A 3IJLA 1GESA 4Z1YA 1FECA 3BOXA 2DW6A 4H4XA 4H83A 1GRTA 3RO6A 3FJ4A 1DNCA 3NO1A 1XS2A 2CDUA 4HYRA 1GXFA 4H1ZA 1FHVA 2HNEA 4GRTA 3NRZB 2YAUA 4IHCA 5FJTA 4H4YA 1ZX9A 4ZA0A 3QPEA 3DG3A 3CK5A 2HQMA 4IP4A 4K7ZA 5JCNA 5JCKA 1WYGA 4JDRA 2OPJA 1OJTA 4Z17A 1ECQA 4EMJA 3N4FA 3EKGA 3IJIA 3TOYA 3CGCA 2OZ8A 1GRHA 3DGZA 1F9CA 3CGBA 2GQWA 3TWAA 2P88A 1KN0A 3EAOA 1AOGA 1JPDX 3PFRA 4FDCB 4K8DA 3CT2A 4KWSA 3D47A 3TCSA 3OP2A 3EANA 2RDXA 5JCIA 2WBAA 4H4TA 3N6HA 1N62C 2OLAA 4IZGA 5GRTA 2QQ6A 3PG6A 1NPXA 1EC9A 2QJJA 4HPNA 2F5ZA 1XANA 3RCYA 3CGDA 2GR0A 2PMQA 3RITA 1KD0A 3OPSA 4A3RA 2RABA 2WOIA 3GC2A 4FP1A 2V3BA 6ENLA 3L5OA 2GGEA 4H2HA 3D46A 1FHUA 2QJMA 3TJ4A 4H4VA 2PODA 3VA8A 3PWGA 4GYPA 3VCCA 5KVIA 1MOKA 4F4RA 3QKEA 1NHSA 3FXGA 1YEYA 1NHQA 1FO4A 4J56A 1TE6A 2EQ8A 1N5WC 1PDYA 1MDRA 2J3NA 3NZGA 2W3RA 1IYXA 1ZMDA 2GR2A 3JW7A 2I5QA 1GRAA 2O56A 2V3AA 4KEMA 3ZLFA 2PSNA 4K8GA 1NHRA 4HCLA 2OFJA 3LB8A 4KT2A 4EM3A 1NDAA 1EBGA 2PPGA 3Q4DA 2AAQA 2ZZBA 3MKCA 2NVKX 1N61C 3T8QA 3DH9A 4GR1A 5JRBA 3ZVHB 5IDZA 2W0HA 1TKKA 1KCZA 3T9PA 2HXUA 3SQSA 4E8GA 1ONFA 3B97A 2QAEA 2GGHA 2PTXA 1W6TA 3H70A 1NELA 1MDLA 2NPXA 3VCNA 1R0MA 5ENLA 3V3WA 3MZNA 3CB3A 4EQXA 3DK8A 1TZZA 1XHCA 1VQZA 3UJ2A 1MUCA 2FYMA 2PCEA 3DG6A 5BOFA 2A8XA 2EQ7A 3OZYA 3NVYB 4BURA 3A7RA 2WP6A 3PWIA 2OZ3A 2OQYA 1TYPA 4DN1A 1GRGA 4M52A 3DG7A 3R0KA 1S7MA 4ZOHB 4EMWA 5EBKA 3UCDA 4TVWA 4DHGA 3D9XA 1TYTA 1F8WA 3DIPA 1EBDA 4EQWA 3THUA 2XH7A 3UXLA 2PU0A 3R0UA 3URHA 3NVVB 2XH4A 2WPEA 1JCTA 3FG2P 3AM9A 2OG9A 2P3ZA 1LPFA 1KKOA 2PTYA 3CXOA 1JRPA 3P93A 3GY1A 1NU5A 4IL2A 3OW1A 4DX3A 2AKMA 3UJFA 3TQPA 4A35A 3T4WA 4EMIA 5FJRA 1FFUC 4IP5A 3UCCA 1WUEA 2X8HA 2GRTA 3DJJA 3SN4A 3II4A 3NVZB 5BOEA 2PP0A 3IC9A 3DFHA 3KUMA 1GETA 3T6CA 2PP1A 3GD3A 1N60C 4H4UA 2CFYA 2ZADA 3IJQA 3R07C 4H19A 1MO9A 2R9ZA 2QVHA 5U1OA 2V6OA 4EQSA 2PU1A 2QGYA 1H6VA 5EU9A 2OZTA 4GMEA 2AKZA 2JK6A 3STPA 4KPRA 3DDMA 3V5CA 5FJOA 1SJDA 4H4RA 1X2GA 3AMZA 4DWDA 4FI4A 4H4WA 1T3QC 3MUCA 4E4UA 3N6JA 2GSHA 2X8GA 3QFAA 3EUB3 7ENLA 2OX4A 2E3TA 3VFCA 3NFUA 2P8BA 3TTEA 4GISA 3BSMA 3CXBA 3ES8A 1FEBA 4GGHA 3GO2A 4MKSA 4EM4A 5JCMA 1WUFA 2AL1A 3P3BA 1X2HA 3R1ZA 5FJUA 3LADA 2P0IA 3RRAA 4G7FA 3SN1A 2YVJA 2OVLA 1EBHA 2XH2A 4MGGA 1Q1WA 2GH5A 2GGIA 4YWSA 3AN1A 2GDQA 4H4ZA 1BQGA
chains in the Genus database with same CATH topology
2E5AA 1V97A 2W55A 3B9JB 1FFVC 3NVVB 1N62C 1N61C 3NVYB 1N60C 1JROA 3A7RA 1T3QC 2W54A 3AM9A 3EUB3 3NRZB 3R07C 2E3TA 1FO4A 5G5HB 4TVYA 1JRPA 3HRDC 1VDVA 1N5WC 3A7AA 5G5GB 4ZOHB 1RM6B 3NS1B 1X2HA 2W3SA 1N63C 2W3RA 1N5XA 1FIQB 1FFUC 3A7UA 4TVWA 3SR6B 1VQZA 1ZXIC 1WYGA 3NVZB 3ETRB 1SB3B 3NVWB 3AN1A 1X2GA 3AMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5A A;  1V97 A;  2W55 A;  3B9J B;  1FFV C;  3NVV B;  1N62 C;  1N61 C;  3NVY B;  1N60 C;  1JRO A;  3A7R A;  1T3Q C;  2W54 A;  3AM9 A;  3EUB 3;  3NRZ B;  3R07 C;  2E3T A;  1FO4 A;  5G5H B;  4TVY A;  1JRP A;  3HRD C;  1VDV A;  1N5W C;  3A7A A;  5G5G B;  4ZOH B;  1RM6 B;  3NS1 B;  1X2H A;  2W3S A;  1N63 C;  2W3R A;  1N5X A;  1FIQ B;  1FFU C;  3A7U A;  4TVW A;  3SR6 B;  1VQZ A;  1ZXI C;  1WYG A;  3NVZ B;  3ETR B;  1SB3 B;  3NVW B;  3AN1 A;  1X2G A;  3AMZ A; 
#chains in the Genus database with same CATH topology
 3UJS A;  1MRA A;  2EQ9 A;  2QDD A;  4KPL A;  1ONE A;  2QJN A;  3GRT A;  3I6E A;  3MY9 A;  4K2S A;  3CYJ A;  3MSY A;  4H4Q A;  2GGJ A;  3ZLH A;  4JN8 A;  4NEW A;  5FS7 A;  2WOV A;  1L8P A;  5FJP A;  4DNA A;  1ZY8 A;  2W3S A;  3R25 A;  4GYP C;  1GV4 A;  2PS2 A;  1GER A;  2PTZ A;  1ZXI C;  2DW7 A;  1SB3 B;  3SSZ A;  3H4K A;  4GIR A;  4J3Z A;  3TJI A;  1JDF A;  4LII A;  1YQZ A;  4HNC A;  2PGW A;  1ELS A;  4ENL A;  4ADW A;  4X2P A;  2BC1 A;  3OC4 A;  3SN0 A;  4H4S A;  3VDG A;  4J57 A;  2TPR A;  3A7A A;  1RM6 B;  4DXK A;  1DXL A;  3OTR A;  5TR3 A;  2ZZ0 A;  3UJE A;  2C3C A;  3UXK A;  2ZC8 A;  3Q6J A;  4K1W A;  3OZM A;  4M6U A;  2BC0 A;  3IK4 A;  4JN7 A;  1Q1R A;  2EQ6 A;  2YVF A;  3VC5 A;  3KLJ A;  3ZLG A;  3DGB A;  3H8A A;  1M6I A;  2XSX A;  2W54 A;  3R11 A;  1ZDL A;  4HCD A;  3RGT A;  3U4F A;  2QDE A;  3QLD A;  1F3P A;  4YWO A;  4IL0 A;  4ROP A;  2POZ A;  2C3D A;  3NS1 B;  1GRB A;  3JZU A;  4FX9 A;  1FIQ B;  3A7U A;  2PP3 A;  2PA6 A;  3S47 A;  3DEQ A;  1ZK7 A;  1GRE A;  1EC7 A;  1STZ A;  4ZCW A;  1JPM A;  5FS8 A;  3SJN A;  3ETR B;  2YQU A;  4G8T A;  3NXL A;  1LVL A;  3V4B A;  4APN A;  1P43 A;  1E9I A;  3R10 A;  3B9J B;  1FFV C;  1MNS A;  1PDZ A;  2X50 A;  1EC8 A;  1GEU A;  2GR1 A;  2XGZ A;  3QFB A;  4HCH A;  4GFI A;  3H7V A;  3VC6 A;  4HN8 A;  3DES A;  3TW9 A;  3I4K A;  2X99 A;  3O0H A;  1D7Y A;  3CGE A;  3FYY A;  3S5S A;  3EEZ A;  1GRF A;  3DFY A;  3GD4 A;  3HPF A;  4E4F A;  1FEA A;  2PTW A;  3CAW A;  1BZL A;  2AL2 B;  3N4E A;  3DK4 A;  4GGB A;  2PGE A;  1JRO A;  4H50 A;  3EF6 A;  4H4P A;  1OEP A;  3QTP A;  3U9I A;  5G5H B;  4TVY A;  1VDV A;  2HXT A;  2GL5 A;  3PK7 A;  3H12 A;  3RNM A;  2MNR A;  1N63 C;  1RVK A;  2NQL A;  3GD6 A;  3I6T A;  3SQP A;  5ER0 A;  1JOA A;  3TWB A;  1SJA A;  3ZVI A;  1SJC A;  2ZZC A;  1P48 A;  3K1G A;  4J1O A;  4EQR A;  2W55 A;  2WP5 A;  4HNL A;  3GRS A;  5U25 A;  4BV6 A;  2GGG A;  3FV9 A;  3Q45 A;  4NEV A;  1XDI A;  2WOW A;  5FMH A;  3JVA A;  4E5T A;  4LA1 A;  1H2I A;  2XH0 A;  1ZKQ A;  2YVG A;  3HRD C;  3ENL A;  1KKR A;  2AL2 A;  1NHP A;  1R6W A;  3P0W A;  3MQT A;  4IT1 A;  1ZMC A;  2BCP A;  1JEH A;  2CHR A;  2OQH A;  4E6M A;  2GR3 A;  2P8C A;  1N5X A;  2WPF A;  3L8K A;  1K4Q A;  2MUC A;  1V59 A;  3ZVH A;  2ONE A;  1DTN A;  3DER A;  5KVH A;  2OKT A;  4MMW A;  3UGV A;  3NVW B;  4JHM A;  1XPY A;  1GSN A;  1V97 A;  2E5A A;  4DYE A;  3V5F A;  2FKP A;  2X8C A;  3SBF A;  4JQ9 A;  5FS9 A;  5JCL A;  4EWJ A;  3FVD A;  1BWC A;  3BJS A;  3UJR A;  1BKH A;  2HZG A;  3FCP A;  3LXD A;  3QN3 A;  3DJG X;  2OO6 A;  5FS6 A;  3HW2 A;  3DK9 A;  5G5G B;  5J04 A;  2WPC A;  3ES7 A;  3MWC A;  1SJB A;  3DGH A;  4A6G A;  3SR6 B;  4M0X A;  3RR1 A;  3IJL A;  1GES A;  4Z1Y A;  1FEC A;  3BOX A;  2DW6 A;  4H4X A;  4H83 A;  1GRT A;  3RO6 A;  3FJ4 A;  1DNC A;  3NO1 A;  1XS2 A;  2CDU A;  4HYR A;  1GXF A;  4H1Z A;  1FHV A;  2HNE A;  4GRT A;  3NRZ B;  2YAU A;  4IHC A;  5FJT A;  4H4Y A;  1ZX9 A;  4ZA0 A;  3QPE A;  3DG3 A;  3CK5 A;  2HQM A;  4IP4 A;  4K7Z A;  5JCN A;  5JCK A;  1WYG A;  4JDR A;  2OPJ A;  1OJT A;  4Z17 A;  1ECQ A;  4EMJ A;  3N4F A;  3EKG A;  3IJI A;  3TOY A;  3CGC A;  2OZ8 A;  1GRH A;  3DGZ A;  1F9C A;  3CGB A;  2GQW A;  3TWA A;  2P88 A;  1KN0 A;  3EAO A;  1AOG A;  1JPD X;  3PFR A;  4FDC B;  4K8D A;  3CT2 A;  4KWS A;  3D47 A;  3TCS A;  3OP2 A;  3EAN A;  2RDX A;  5JCI A;  2WBA A;  4H4T A;  3N6H A;  1N62 C;  2OLA A;  4IZG A;  5GRT A;  2QQ6 A;  3PG6 A;  1NPX A;  1EC9 A;  2QJJ A;  4HPN A;  2F5Z A;  1XAN A;  3RCY A;  3CGD A;  2GR0 A;  2PMQ A;  3RIT A;  1KD0 A;  3OPS A;  4A3R A;  2RAB A;  2WOI A;  3GC2 A;  4FP1 A;  2V3B A;  6ENL A;  3L5O A;  2GGE A;  4H2H A;  3D46 A;  1FHU A;  2QJM A;  3TJ4 A;  4H4V A;  2POD A;  3VA8 A;  3PWG A;  4GYP A;  3VCC A;  5KVI A;  1MOK A;  4F4R A;  3QKE A;  1NHS A;  3FXG A;  1YEY A;  1NHQ A;  1FO4 A;  4J56 A;  1TE6 A;  2EQ8 A;  1N5W C;  1PDY A;  1MDR A;  2J3N A;  3NZG A;  2W3R A;  1IYX A;  1ZMD A;  2GR2 A;  3JW7 A;  2I5Q A;  1GRA A;  2O56 A;  2V3A A;  4KEM A;  3ZLF A;  2PSN A;  4K8G A;  1NHR A;  4HCL A;  2OFJ A;  3LB8 A;  4KT2 A;  4EM3 A;  1NDA A;  1EBG A;  2PPG A;  3Q4D A;  2AAQ A;  2ZZB A;  3MKC A;  2NVK X;  1N61 C;  3T8Q A;  3DH9 A;  4GR1 A;  5JRB A;  3ZVH B;  5IDZ A;  2W0H A;  1TKK A;  1KCZ A;  3T9P A;  2HXU A;  3SQS A;  4E8G A;  1ONF A;  3B97 A;  2QAE A;  2GGH A;  2PTX A;  1W6T A;  3H70 A;  1NEL A;  1MDL A;  2NPX A;  3VCN A;  1R0M A;  5ENL A;  3V3W A;  3MZN A;  3CB3 A;  4EQX A;  3DK8 A;  1TZZ A;  1XHC A;  1VQZ A;  3UJ2 A;  1MUC A;  2FYM A;  2PCE A;  3DG6 A;  5BOF A;  2A8X A;  2EQ7 A;  3OZY A;  3NVY B;  4BUR A;  3A7R A;  2WP6 A;  3PWI A;  2OZ3 A;  2OQY A;  1TYP A;  4DN1 A;  1GRG A;  4M52 A;  3DG7 A;  3R0K A;  1S7M A;  4ZOH B;  4EMW A;  5EBK A;  3UCD A;  4TVW A;  4DHG A;  3D9X A;  1TYT A;  1F8W A;  3DIP A;  1EBD A;  4EQW A;  3THU A;  2XH7 A;  3UXL A;  2PU0 A;  3R0U A;  3URH A;  3NVV B;  2XH4 A;  2WPE A;  1JCT A;  3FG2 P;  3AM9 A;  2OG9 A;  2P3Z A;  1LPF A;  1KKO A;  2PTY A;  3CXO A;  1JRP A;  3P93 A;  3GY1 A;  1NU5 A;  4IL2 A;  3OW1 A;  4DX3 A;  2AKM A;  3UJF A;  3TQP A;  4A35 A;  3T4W A;  4EMI A;  5FJR A;  1FFU C;  4IP5 A;  3UCC A;  1WUE A;  2X8H A;  2GRT A;  3DJJ A;  3SN4 A;  3II4 A;  3NVZ B;  5BOE A;  2PP0 A;  3IC9 A;  3DFH A;  3KUM A;  1GET A;  3T6C A;  2PP1 A;  3GD3 A;  1N60 C;  4H4U A;  2CFY A;  2ZAD A;  3IJQ A;  3R07 C;  4H19 A;  1MO9 A;  2R9Z A;  2QVH A;  5U1O A;  2V6O A;  4EQS A;  2PU1 A;  2QGY A;  1H6V A;  5EU9 A;  2OZT A;  4GME A;  2AKZ A;  2JK6 A;  3STP A;  4KPR A;  3DDM A;  3V5C A;  5FJO A;  1SJD A;  4H4R A;  1X2G A;  3AMZ A;  4DWD A;  4FI4 A;  4H4W A;  1T3Q C;  3MUC A;  4E4U A;  3N6J A;  2GSH A;  2X8G A;  3QFA A;  3EUB 3;  7ENL A;  2OX4 A;  2E3T A;  3VFC A;  3NFU A;  2P8B A;  3TTE A;  4GIS A;  3BSM A;  3CXB A;  3ES8 A;  1FEB A;  4GGH A;  3GO2 A;  4MKS A;  4EM4 A;  5JCM A;  1WUF A;  2AL1 A;  3P3B A;  1X2H A;  3R1Z A;  5FJU A;  3LAD A;  2P0I A;  3RRA A;  4G7F A;  3SN1 A;  2YVJ A;  2OVL A;  1EBH A;  2XH2 A;  4MGG A;  1Q1W A;  2GH5 A;  2GGI A;  4YWS A;  3AN1 A;  2GDQ A;  4H4Z A;  1BQG A; 
#chains in the Genus database with same CATH homology
 2E5A A;  1V97 A;  2W55 A;  3B9J B;  1FFV C;  3NVV B;  1N62 C;  1N61 C;  3NVY B;  1N60 C;  1JRO A;  3A7R A;  1T3Q C;  2W54 A;  3AM9 A;  3EUB 3;  3NRZ B;  3R07 C;  2E3T A;  1FO4 A;  5G5H B;  4TVY A;  1JRP A;  3HRD C;  1VDV A;  1N5W C;  3A7A A;  5G5G B;  4ZOH B;  1RM6 B;  3NS1 B;  1X2H A;  2W3S A;  1N63 C;  2W3R A;  1N5X A;  1FIQ B;  1FFU C;  3A7U A;  4TVW A;  3SR6 B;  1VQZ A;  1ZXI C;  1WYG A;  3NVZ B;  3ETR B;  1SB3 B;  3NVW B;  3AN1 A;  1X2G A;  3AMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...