3R07C

Structural analysis of an archaeal lipoylation system. a bi-partite lipoate protein ligase and its e2 lipoyl domain from thermoplasma acidophilum
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
88
Chain Sequence
MHMMYSKNWKAKKGLIRVTLDLDGNRIKDIHISGDFFMFPEDSINRLEDMLRGSSIEKINDIIRDFYNQGVITPGVEPEDFIQALRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Lipoate-protein ligase A subunit 1
publication title Structural analysis of an archaeal lipoylation system. A bi-partite lipoate protein ligase and its E2 lipoyl domain from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum dsm 1728
total genus 21
structure length 88
sequence length 88
ec nomenclature ec 6.3.1.20: Lipoate--protein ligase.
pdb deposition date 2011-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 3r07C00
1WYGA 3NVWB 1FO4A 1FFUC 3NVZB 5G5GB 1N61C 1VQZA 4TVYA 3AMZA 3SR6B 1V97A 1JROA 1X2HA 3AN1A 3A7UA 1N5WC 3HRDC 3AM9A 1ZXIC 3NRZB 1T3QC 2W55A 4ZOHB 3EUB3 2W3RA 3A7RA 3R07C 2E5AA 1N5XA 1X2GA 1VDVA 3NS1B 3NVYB 2E3TA 3NVVB 2W54A 3B9JB 3ETRB 5G5HB 2W3SA 1FIQB 1N60C 1FFVC 4TVWA 3A7AA 1N62C 1N63C 1SB3B 1RM6B 1JRPA
chains in the Genus database with same CATH superfamily
4X2PA 2QVHA 2QDDA 3NXLA 3THUA 1MRAA 3DK8A 2PP1A 3RCYA 4GYPC 3I6EA 1PDZA 1WUFA 5GRTA 1MDRA 4IT1A 5FJUA 4EMJA 2W3RA 3Q6JA 1GERA 5JCKA 4DXKA 2X8HA 1EBDA 3EANA 2QJMA 1SJBA 4APNA 5KVIA 3EAOA 3L5OA 3UJEA 2GR2A 2GQWA 4A3RA 3IJQA 4YWSA 4J1OA 1IYXA 3URHA 1KCZA 3NVWB 3MSYA 2BCPA 2PMQA 2C3DA 1GRBA 1SJCA 3TTEA 3CYJA 3STPA 1ONEA 3N4FA 3UJ2A 1TE6A 1JEHA 1EC7A 4ZA0A 3TWBA 2GL5A 2OG9A 2FKPA 2PGEA 2PA6A 1GSNA 3RR1A 1BZLA 3A7AA 3RRAA 4M52A 1GETA 1WYGA 3DGHA 3S5SA 4A6GA 3P0WA 1R6WA 5FS7A 2PP0A 1XDIA 1EBHA 2R9ZA 1Q1WA 4ZCWA 3T6CA 2ZZ0A 1NHPA 3TCSA 2GRTA 2PS2A 3Q4DA 3D47A 3CB3A 1F9CA 2CHRA 3L8KA 3RO6A 4DWDA 5JCLA 2QGYA 3CXBA 4E4FA 4GIRA 2PP3A 2WP6A 2OPJA 2HXUA 4H4TA 2HXTA 2WOIA 3H7VA 4YWOA 4GR1A 4H4YA 3SR6B 2A8XA 2P8BA 3S47A 3QTPA 3KLJA 2GDQA 1TKKA 3NO1A 1ELSA 3HW2A 2OZ8A 1F8WA 2EQ9A 2P8CA 3OTRA 5ENLA 2E5AA 1N5XA 2XSXA 2GGGA 3DDMA 2J3NA 4GGBA 3D9XA 3V5CA 3PWIA 3PWGA 2NVKX 2GGHA 2PCEA 1JRPA 3PG6A 4F4RA 3TOYA 3OZMA 5G5GB 3DFHA 1M6IA 4GISA 3TJ4A 3P3BA 3MQTA 3GD6A 4KT2A 4J57A 4J56A 4E5TA 5IDZA 2OO6A 4IHCA 3BOXA 5EBKA 3FG2P 2XH4A 1DXLA 1Q1RA 3B9JB 3DG7A 3ETRB 4H4QA 3DJGX 5G5HB 4GGHA 4H2HA 5FJOA 4JN7A 4DHGA 4HCDA 1XPYA 2QQ6A 3VFCA 3H70A 4H1ZA 5FS6A 2YVJA 5FS8A 3CT2A 1F3PA 1FFUC 1N61C 2JK6A 3DK4A 1ZX9A 2OVLA 3T4WA 4EQRA 3OP2A 3R0KA 5EU9A 1JPDX 3CAWA 4JHMA 1ONFA 1BWCA 2P3ZA 3EUB3 4LA1A 1E9IA 2XH0A 2FYMA 3CK5A 1GRGA 2O56A 2X8GA 2AKZA 2WPEA 4HYRA 2NQLA 2AAQA 2PSNA 2X50A 4KEMA 2AL2A 4DNAA 3DG3A 3HPFA 4FI4A 2V3BA 4JQ9A 3VC6A 2EQ8A 4NEVA 3MWCA 4KPRA 1R0MA 1SJDA 2OX4A 4DN1A 3AM9A 1DTNA 4HPNA 4ZOHB 4EMWA 4HCLA 3FJ4A 2PODA 3SQSA 2ZC8A 2WP5A 3SSZA 4IL2A 2OFJA 3H8AA 3RGTA 1N63C 4EMIA 4Z17A 4K7ZA 5TR3A 3T8QA 3BSMA 3VDGA 2PGWA 3FYYA 4IP5A 1VQZA 4M6UA 3DFYA 3VCCA 1JROA 4IP4A 2GR1A 4JDRA 1ZY8A 4HN8A 2QJJA 3DGZA 3UJSA 1WUEA 1ECQA 2GGIA 2PPGA 4FDCB 3A7RA 3UGVA 4J3ZA 1P43A 1ZMDA 4BV6A 1MUCA 4IZGA 2PTYA 3D46A 1NHSA 1XS2A 2WOVA 1GREA 4A35A 3EF6A 1KD0A 4EQWA 4TVYA 2TPRA 3I6TA 1V97A 3OZYA 2RDXA 3GC2A 2PTZA 1PDYA 3CGEA 2YAUA 3N6JA 1GEUA 4H4SA 3IC9A 3KUMA 3QPEA 1JCTA 1NPXA 1YEYA 2DW7A 2GSHA 1STZA 3CXOA 3NS1B 2W54A 3UCCA 3MZNA 3JW7A 3ZLHA 2GGEA 2AL2B 4G8TA 5JRBA 3K1GA 2NPXA 3ZLFA 2MNRA 3DGBA 3Q45A 2EQ6A 1BKHA 2OQHA 1NDAA 2XGZA 1GRAA 3LADA 1AOGA 1KKRA 3GRSA 3GRTA 2YVGA 4K8GA 3MUCA 3OC4A 5JCIA 3NRZB 5KVHA 4JN8A 2V6OA 3OW1A 4ENLA 3GD4A 4H4RA 1VDVA 3N4EA 3NVYB 1JPMA 3ZVHA 1FIQB 1L8PA 3LXDA 3EEZA 3V5FA 2W0HA 1NHQA 3SN1A 1N62C 3DERA 3SBFA 3TWAA 3II4A 4EQXA 1XHCA 4H4ZA 3UJRA 1D7YA 3TW9A 2P0IA 1FEBA 5JCMA 3CGCA 4LIIA 7ENLA 1OEPA 1GRTA 1YQZA 3HRDC 3TJIA 3QN3A 3QKEA 3H12A 3FCPA 2X8CA 3U9IA 1GRHA 4E4UA 2X99A 2MUCA 2HNEA 3NVVB 1X2GA 2PTWA 2E3TA 3H4KA 3N6HA 3R0UA 3OPSA 3SN4A 3ENLA 2POZA 3QFBA 3O0HA 1XANA 3IJLA 2C3CA 3IJIA 1RVKA 4HNLA 2AKMA 3DH9A 1NHRA 1BQGA 1N5WC 3R10A 4K2SA 1EBGA 1OJTA 2EQ7A 3FV9A 2I5QA 3JVAA 1ZDLA 4H19A 1ZK7A 2W3SA 1EC8A 4H50A 4Z1YA 1MO9A 2QJNA 3T9PA 4DYEA 3I4KA 3QFAA 3VCNA 3B97A 4E6MA 2YVFA 1MOKA 2V3AA 3R11A 3JZUA 1W6TA 6ENLA 3AMZA 4HCHA 3DK9A 3ES7A 4MKSA 3QLDA 2CFYA 3MKCA 2QAEA 4H4UA 4K8DA 1P48A 5ER0A 2WPCA 4ROPA 5J04A 1GV4A 2BC1A 3NFUA 5BOEA 3ZVHB 5JCNA 2PTXA 2GGJA 1GXFA 3R07C 1MDLA 2GH5A 4KPLA 3SJNA 1H6VA 3PK7A 3RITA 4KWSA 4EWJA 3R1ZA 1GESA 1LVLA 4HNCA 5FJRA 3UJFA 5FJTA 3R25A 1FO4A 2RABA 3IK4A 2P88A 3DJJA 3DG6A 4GYPA 5FMHA 2WOWA 5U25A 3A7UA 1JDFA 1TYTA 4NEWA 1NU5A 3U4FA 3ES8A 4MMWA 4GFIA 3ZLGA 1H2IA 1GRFA 3V3WA 4K1WA 2BC0A 4H4PA 3SQPA 1FHVA 4DX3A 2DW6A 3BJSA 3DESA 3TQPA 4GRTA 4H4XA 1KKOA 2PU1A 4GMEA 1NELA 2F5ZA 5U1OA 1ZMCA 1TZZA 1SB3B 2ZZBA 1RM6B 2GR0A 4FX9A 3ZVIA 1S7MA 4BURA 4M0XA 2ONEA 1X2HA 3AN1A 1ZKQA 1LPFA 2GR3A 3V4BA 4G7FA 4EM4A 1JOAA 1ZXIC 1KN0A 2YQUA 2OLAA 2WBAA 2W55A 3GD3A 3CGBA 2PU0A 3DEQA 4EQSA 2OZ3A 1FECA 3MY9A 4EM3A 1TYPA 2XH2A 1DNCA 1FEAA 3GO2A 4H4WA 3UXLA 2AL1A 2QDEA 2HZGA 3GY1A 1FHUA 4MGGA 3SN0A 3NVZB 3UXKA 3FXGA 1V59A 2HQMA 5FS9A 5FJPA 4FP1A 3CGDA 3FVDA 5BOFA 3DIPA 1EC9A 4IL0A 1T3QC 2ZZCA 2CDUA 4H4VA 1MNSA 3UCDA 3EKGA 3RNMA 2WPFA 2XH7A 2ZADA 3NZGA 4E8GA 3LB8A 3VA8A 1N60C 2OKTA 2OQYA 4ADWA 1FFVC 2OZTA 3PFRA 4TVWA 1K4QA 1SJAA 3VC5A 4H83A 3P93A
chains in the Genus database with same CATH topology
1WYGA 3NVWB 1FO4A 1FFUC 3NVZB 5G5GB 1N61C 1VQZA 4TVYA 3AMZA 3SR6B 1V97A 1JROA 1X2HA 3AN1A 3A7UA 1N5WC 3HRDC 3AM9A 1ZXIC 3NRZB 1T3QC 2W55A 4ZOHB 3EUB3 2W3RA 3A7RA 3R07C 2E5AA 1N5XA 1X2GA 1VDVA 3NS1B 3NVYB 2E3TA 3NVVB 2W54A 3B9JB 3ETRB 5G5HB 2W3SA 1FIQB 1N60C 1FFVC 4TVWA 3A7AA 1N62C 1N63C 1SB3B 1RM6B 1JRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYG A;  3NVW B;  1FO4 A;  1FFU C;  3NVZ B;  5G5G B;  1N61 C;  1VQZ A;  4TVY A;  3AMZ A;  3SR6 B;  1V97 A;  1JRO A;  1X2H A;  3AN1 A;  3A7U A;  1N5W C;  3HRD C;  3AM9 A;  1ZXI C;  3NRZ B;  1T3Q C;  2W55 A;  4ZOH B;  3EUB 3;  2W3R A;  3A7R A;  3R07 C;  2E5A A;  1N5X A;  1X2G A;  1VDV A;  3NS1 B;  3NVY B;  2E3T A;  3NVV B;  2W54 A;  3B9J B;  3ETR B;  5G5H B;  2W3S A;  1FIQ B;  1N60 C;  1FFV C;  4TVW A;  3A7A A;  1N62 C;  1N63 C;  1SB3 B;  1RM6 B;  1JRP A; 
#chains in the Genus database with same CATH topology
 4X2P A;  2QVH A;  2QDD A;  3NXL A;  3THU A;  1MRA A;  3DK8 A;  2PP1 A;  3RCY A;  4GYP C;  3I6E A;  1PDZ A;  1WUF A;  5GRT A;  1MDR A;  4IT1 A;  5FJU A;  4EMJ A;  2W3R A;  3Q6J A;  1GER A;  5JCK A;  4DXK A;  2X8H A;  1EBD A;  3EAN A;  2QJM A;  1SJB A;  4APN A;  5KVI A;  3EAO A;  3L5O A;  3UJE A;  2GR2 A;  2GQW A;  4A3R A;  3IJQ A;  4YWS A;  4J1O A;  1IYX A;  3URH A;  1KCZ A;  3NVW B;  3MSY A;  2BCP A;  2PMQ A;  2C3D A;  1GRB A;  1SJC A;  3TTE A;  3CYJ A;  3STP A;  1ONE A;  3N4F A;  3UJ2 A;  1TE6 A;  1JEH A;  1EC7 A;  4ZA0 A;  3TWB A;  2GL5 A;  2OG9 A;  2FKP A;  2PGE A;  2PA6 A;  1GSN A;  3RR1 A;  1BZL A;  3A7A A;  3RRA A;  4M52 A;  1GET A;  1WYG A;  3DGH A;  3S5S A;  4A6G A;  3P0W A;  1R6W A;  5FS7 A;  2PP0 A;  1XDI A;  1EBH A;  2R9Z A;  1Q1W A;  4ZCW A;  3T6C A;  2ZZ0 A;  1NHP A;  3TCS A;  2GRT A;  2PS2 A;  3Q4D A;  3D47 A;  3CB3 A;  1F9C A;  2CHR A;  3L8K A;  3RO6 A;  4DWD A;  5JCL A;  2QGY A;  3CXB A;  4E4F A;  4GIR A;  2PP3 A;  2WP6 A;  2OPJ A;  2HXU A;  4H4T A;  2HXT A;  2WOI A;  3H7V A;  4YWO A;  4GR1 A;  4H4Y A;  3SR6 B;  2A8X A;  2P8B A;  3S47 A;  3QTP A;  3KLJ A;  2GDQ A;  1TKK A;  3NO1 A;  1ELS A;  3HW2 A;  2OZ8 A;  1F8W A;  2EQ9 A;  2P8C A;  3OTR A;  5ENL A;  2E5A A;  1N5X A;  2XSX A;  2GGG A;  3DDM A;  2J3N A;  4GGB A;  3D9X A;  3V5C A;  3PWI A;  3PWG A;  2NVK X;  2GGH A;  2PCE A;  1JRP A;  3PG6 A;  4F4R A;  3TOY A;  3OZM A;  5G5G B;  3DFH A;  1M6I A;  4GIS A;  3TJ4 A;  3P3B A;  3MQT A;  3GD6 A;  4KT2 A;  4J57 A;  4J56 A;  4E5T A;  5IDZ A;  2OO6 A;  4IHC A;  3BOX A;  5EBK A;  3FG2 P;  2XH4 A;  1DXL A;  1Q1R A;  3B9J B;  3DG7 A;  3ETR B;  4H4Q A;  3DJG X;  5G5H B;  4GGH A;  4H2H A;  5FJO A;  4JN7 A;  4DHG A;  4HCD A;  1XPY A;  2QQ6 A;  3VFC A;  3H70 A;  4H1Z A;  5FS6 A;  2YVJ A;  5FS8 A;  3CT2 A;  1F3P A;  1FFU C;  1N61 C;  2JK6 A;  3DK4 A;  1ZX9 A;  2OVL A;  3T4W A;  4EQR A;  3OP2 A;  3R0K A;  5EU9 A;  1JPD X;  3CAW A;  4JHM A;  1ONF A;  1BWC A;  2P3Z A;  3EUB 3;  4LA1 A;  1E9I A;  2XH0 A;  2FYM A;  3CK5 A;  1GRG A;  2O56 A;  2X8G A;  2AKZ A;  2WPE A;  4HYR A;  2NQL A;  2AAQ A;  2PSN A;  2X50 A;  4KEM A;  2AL2 A;  4DNA A;  3DG3 A;  3HPF A;  4FI4 A;  2V3B A;  4JQ9 A;  3VC6 A;  2EQ8 A;  4NEV A;  3MWC A;  4KPR A;  1R0M A;  1SJD A;  2OX4 A;  4DN1 A;  3AM9 A;  1DTN A;  4HPN A;  4ZOH B;  4EMW A;  4HCL A;  3FJ4 A;  2POD A;  3SQS A;  2ZC8 A;  2WP5 A;  3SSZ A;  4IL2 A;  2OFJ A;  3H8A A;  3RGT A;  1N63 C;  4EMI A;  4Z17 A;  4K7Z A;  5TR3 A;  3T8Q A;  3BSM A;  3VDG A;  2PGW A;  3FYY A;  4IP5 A;  1VQZ A;  4M6U A;  3DFY A;  3VCC A;  1JRO A;  4IP4 A;  2GR1 A;  4JDR A;  1ZY8 A;  4HN8 A;  2QJJ A;  3DGZ A;  3UJS A;  1WUE A;  1ECQ A;  2GGI A;  2PPG A;  4FDC B;  3A7R A;  3UGV A;  4J3Z A;  1P43 A;  1ZMD A;  4BV6 A;  1MUC A;  4IZG A;  2PTY A;  3D46 A;  1NHS A;  1XS2 A;  2WOV A;  1GRE A;  4A35 A;  3EF6 A;  1KD0 A;  4EQW A;  4TVY A;  2TPR A;  3I6T A;  1V97 A;  3OZY A;  2RDX A;  3GC2 A;  2PTZ A;  1PDY A;  3CGE A;  2YAU A;  3N6J A;  1GEU A;  4H4S A;  3IC9 A;  3KUM A;  3QPE A;  1JCT A;  1NPX A;  1YEY A;  2DW7 A;  2GSH A;  1STZ A;  3CXO A;  3NS1 B;  2W54 A;  3UCC A;  3MZN A;  3JW7 A;  3ZLH A;  2GGE A;  2AL2 B;  4G8T A;  5JRB A;  3K1G A;  2NPX A;  3ZLF A;  2MNR A;  3DGB A;  3Q45 A;  2EQ6 A;  1BKH A;  2OQH A;  1NDA A;  2XGZ A;  1GRA A;  3LAD A;  1AOG A;  1KKR A;  3GRS A;  3GRT A;  2YVG A;  4K8G A;  3MUC A;  3OC4 A;  5JCI A;  3NRZ B;  5KVH A;  4JN8 A;  2V6O A;  3OW1 A;  4ENL A;  3GD4 A;  4H4R A;  1VDV A;  3N4E A;  3NVY B;  1JPM A;  3ZVH A;  1FIQ B;  1L8P A;  3LXD A;  3EEZ A;  3V5F A;  2W0H A;  1NHQ A;  3SN1 A;  1N62 C;  3DER A;  3SBF A;  3TWA A;  3II4 A;  4EQX A;  1XHC A;  4H4Z A;  3UJR A;  1D7Y A;  3TW9 A;  2P0I A;  1FEB A;  5JCM A;  3CGC A;  4LII A;  7ENL A;  1OEP A;  1GRT A;  1YQZ A;  3HRD C;  3TJI A;  3QN3 A;  3QKE A;  3H12 A;  3FCP A;  2X8C A;  3U9I A;  1GRH A;  4E4U A;  2X99 A;  2MUC A;  2HNE A;  3NVV B;  1X2G A;  2PTW A;  2E3T A;  3H4K A;  3N6H A;  3R0U A;  3OPS A;  3SN4 A;  3ENL A;  2POZ A;  3QFB A;  3O0H A;  1XAN A;  3IJL A;  2C3C A;  3IJI A;  1RVK A;  4HNL A;  2AKM A;  3DH9 A;  1NHR A;  1BQG A;  1N5W C;  3R10 A;  4K2S A;  1EBG A;  1OJT A;  2EQ7 A;  3FV9 A;  2I5Q A;  3JVA A;  1ZDL A;  4H19 A;  1ZK7 A;  2W3S A;  1EC8 A;  4H50 A;  4Z1Y A;  1MO9 A;  2QJN A;  3T9P A;  4DYE A;  3I4K A;  3QFA A;  3VCN A;  3B97 A;  4E6M A;  2YVF A;  1MOK A;  2V3A A;  3R11 A;  3JZU A;  1W6T A;  6ENL A;  3AMZ A;  4HCH A;  3DK9 A;  3ES7 A;  4MKS A;  3QLD A;  2CFY A;  3MKC A;  2QAE A;  4H4U A;  4K8D A;  1P48 A;  5ER0 A;  2WPC A;  4ROP A;  5J04 A;  1GV4 A;  2BC1 A;  3NFU A;  5BOE A;  3ZVH B;  5JCN A;  2PTX A;  2GGJ A;  1GXF A;  3R07 C;  1MDL A;  2GH5 A;  4KPL A;  3SJN A;  1H6V A;  3PK7 A;  3RIT A;  4KWS A;  4EWJ A;  3R1Z A;  1GES A;  1LVL A;  4HNC A;  5FJR A;  3UJF A;  5FJT A;  3R25 A;  1FO4 A;  2RAB A;  3IK4 A;  2P88 A;  3DJJ A;  3DG6 A;  4GYP A;  5FMH A;  2WOW A;  5U25 A;  3A7U A;  1JDF A;  1TYT A;  4NEW A;  1NU5 A;  3U4F A;  3ES8 A;  4MMW A;  4GFI A;  3ZLG A;  1H2I A;  1GRF A;  3V3W A;  4K1W A;  2BC0 A;  4H4P A;  3SQP A;  1FHV A;  4DX3 A;  2DW6 A;  3BJS A;  3DES A;  3TQP A;  4GRT A;  4H4X A;  1KKO A;  2PU1 A;  4GME A;  1NEL A;  2F5Z A;  5U1O A;  1ZMC A;  1TZZ A;  1SB3 B;  2ZZB A;  1RM6 B;  2GR0 A;  4FX9 A;  3ZVI A;  1S7M A;  4BUR A;  4M0X A;  2ONE A;  1X2H A;  3AN1 A;  1ZKQ A;  1LPF A;  2GR3 A;  3V4B A;  4G7F A;  4EM4 A;  1JOA A;  1ZXI C;  1KN0 A;  2YQU A;  2OLA A;  2WBA A;  2W55 A;  3GD3 A;  3CGB A;  2PU0 A;  3DEQ A;  4EQS A;  2OZ3 A;  1FEC A;  3MY9 A;  4EM3 A;  1TYP A;  2XH2 A;  1DNC A;  1FEA A;  3GO2 A;  4H4W A;  3UXL A;  2AL1 A;  2QDE A;  2HZG A;  3GY1 A;  1FHU A;  4MGG A;  3SN0 A;  3NVZ B;  3UXK A;  3FXG A;  1V59 A;  2HQM A;  5FS9 A;  5FJP A;  4FP1 A;  3CGD A;  3FVD A;  5BOF A;  3DIP A;  1EC9 A;  4IL0 A;  1T3Q C;  2ZZC A;  2CDU A;  4H4V A;  1MNS A;  3UCD A;  3EKG A;  3RNM A;  2WPF A;  2XH7 A;  2ZAD A;  3NZG A;  4E8G A;  3LB8 A;  3VA8 A;  1N60 C;  2OKT A;  2OQY A;  4ADW A;  1FFV C;  2OZT A;  3PFR A;  4TVW A;  1K4Q A;  1SJA A;  3VC5 A;  4H83 A;  3P93 A; 
#chains in the Genus database with same CATH homology
 1WYG A;  3NVW B;  1FO4 A;  1FFU C;  3NVZ B;  5G5G B;  1N61 C;  1VQZ A;  4TVY A;  3AMZ A;  3SR6 B;  1V97 A;  1JRO A;  1X2H A;  3AN1 A;  3A7U A;  1N5W C;  3HRD C;  3AM9 A;  1ZXI C;  3NRZ B;  1T3Q C;  2W55 A;  4ZOH B;  3EUB 3;  2W3R A;  3A7R A;  3R07 C;  2E5A A;  1N5X A;  1X2G A;  1VDV A;  3NS1 B;  3NVY B;  2E3T A;  3NVV B;  2W54 A;  3B9J B;  3ETR B;  5G5H B;  2W3S A;  1FIQ B;  1N60 C;  1FFV C;  4TVW A;  3A7A A;  1N62 C;  1N63 C;  1SB3 B;  1RM6 B;  1JRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...