3D9XA

Structure of the head of the bartonella adhesin bada
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
114
structure length
114
Chain Sequence
GGWNLTVNNDNNTVVSSGGALDLSSGSKNLKIVKDGKKNNVTFDVARDLTLKSIKLDGVTLNETGLFIANGPQITASGINAGSQKITGVAEGTDANDAVNFGQLKKIETEVKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adhesin A
publication title Structure of the head of the Bartonella adhesin BadA
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Cell adhesion
total genus 13
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05662 YadA_stalk Coiled stalk of trimeric autotransporter adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.490 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3d9xA01
3.30.390.90 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3d9xA02
1S7MA 3D9XA
chains in the Genus database with same CATH superfamily
3DH9A 3IJIA 1KC81 1XHCA 3NVVB 1Q1RA 1VQM1 2IZ3A 3CC21 2OTJZ 3G6E1 3NRZB 3KIHA 3CC7Z 2EGTA 1YI2Z 3OPSA 2V6OA 1FFUC 1X0TA 3GTMI 3FYYA 4NBEA 3EUB3 2OG9A 1TWGI 3PWGA 1RO2A 4J3ZA 4J57A 4NEVA 2IV2X 2JA7I 2VUMI 3TQPA 1VQ81 2K5RA 3CCJ1 3LB8A 3IC9A 1USPB 2I3CA 3CME1 3CGCA 2WBAA 5JCKA 3CCVZ 3KLJA 1R0MA 2HXUA 2OLAA 1DTNA 1F9CA 4MONA 3T9PA 3I4NI 4Y52I 3NVYB 1NUIA 2P28A 1KCZA 2M48A 2E9HA 3CCMZ 3G4S1 1SJBA 3PG6A 4X6AI 2QDDA 4KPRA 2ZADA 4JN8A 1VQ7Z 3ESWA 1QVGZ 2HZGA 2OZTA 3U9IA 3UJRA 4HH4A 2OVLA 3FXGA 2DE5A 3P5JB 1NHRA 1ZK7A 2EQ9A 3AMZA 3I6TA 2WP6A 2GTIA 1GRTA 1YHQ1 1PDYA 2GDQA 2J3NA 3Q6JA 3UJ2A 3S14I 1NELA 3NZGA 3MZKB 4ENLA 3CCLZ 4IL2A 1WJ2A 1ZB9A 4NBFA 1ZY8A 1FFVC 4BY7I 3GO2A 4A3CI 1M901 1R6WA 3K1GA 3D46A 2RIQA 1QXFA 2OTLZ 4GYPA 3TWAA 4EQSA 3UJFA 4HGYA 1N60C 2GGJA 2X99A 2QRCB 1RVKA 4HCHA 2GL5A 1OJTA 3FVDA 4BXXI 3F3FC 1YIT1 3CD6Z 4H4TA 4NBCA 2PM9A 1JJ2Y 1N61C 2KPIA 2P88A 5C4JI 2ZC8A 3VC5A 4DXKA 5CM2M 3DK4A 2VPYA 1X2HA 1TWFI 2X8CA 1YQZA 4JN7A 1AA6A 3DG6A 4H4WA 1DNCA 3NDJA 2QREB 4MD7A 2R92I 3GTMS 1KKRA 3NXLA 2PA6A 5U1OA 4RS4A 3CCR1 5ENLA 3EERA 3QLDA 2WB1A 3CK5A 2P3ZA 1FDIA 5FS9A 3OW2Z 4ROPA 2OZ3A 3SR6B 3CC2Z 3EAOA 1WIIA 3G6EZ 4NB8A 1GXFA 3GD4A 3F3PC 3VFCA 5IDZA 1L1OC 2VPXA 3J81b 2E3TA 4H83A 4KWSA 3N6JA 3SSZA 1ZMCA 3Q87A 2NVXI 3GTPI 5FJOA 4E5TA 3O0HA 4NBDA 3PO3I 1DXLA 4MH4A 3AM9A 2O53A 4NH1C 1RQFA 3CCJZ 2KI7B 1K8A2 2E2HI 2OKTA 3NDIA 1ONFA 4GMEA 3S15I 2P3YA 3RRAA 4BV6A 1BKHA 4M52A 1Q862 3MSYA 3DEQA 1N2FA 3MONA 2NAPA 1YUAA 1ECQA 1PDZA 4Z17A 1Y1VI 2F4OA 3CCE1 2W0HA 1SJAA 1STZA 3QPEA 4H2HA 2V3BA 4QTUA 4E33A 1RM6B 3CXBA 3G4SZ 4EQRA 5A2Qb 2XH7A 4Z1YA 5FJPA 3CAWA 1KQSZ 2BC1A 3S2DI 2R93I 2AYDA 5U25A 2ZZCA 3THUA 2WOWA 2B63I 1GRFA 1K4QA 2OFJA 2OQYA 2AAQA 1Q7Y2 1QVFY 2W04A 1MNSA 3D2LA 5AN9F 2OZ8A 3A7UA 3DFYA 1MDLA 3TTEA 3J81f 3H0GI 1YHQZ 1VQL1 1IYXA 4Y7NI 4H4ZA 2QEX1 1R9TI 5IT9b 1N62C 1TWHI 2MUCA 2TPRA 2RABA 3GD6A 2VPZA 2JA6I 3OP2A 1Q7Y1 1F3PA 1FHVA 4H1ZA 3DGHA 2E7ZA 1TZZA 5FS8A 4YWSA 4J1OA 2WAQA 2PTYA 3FQMA 4DGLA 3VCCA 1VQ9Z 1W2BZ 1YJW1 3GD3A 1TYPA 3A7RA 2IZ4A 3B9JB 4DWDA 2V45A 3D6WA 1Y1WI 2PMQA 3VB9A 3R0KA 3NH4A 3S1MI 3MY9A 3HOXI 4NBHA 5G5HB 5EBKA 4H4XA 4A3KI 2W3SA 3S17I 2C3DA 2LIYA 1NJI1 4K1WA 2QRDB 2QAEA 3S16I 5A2Qf 2RT9A 3OZMA 3FCPA 2Q51A 3FV9A 4MD9A 1YIJ1 3PO3S 3DGBA 3R11A 4LA1A 2PODA 3DDMA 4HNLA 4HYRA 1LQLA 3EEDA 1FIQB 1KD0A 1JPDX 1MUCA 1LVLA 2EQ8A 3MZLB 4MD8A 1K9M2 1Y1VS 2JNYA 2QR1B 3GC2A 2V3VA 4E8GA 5IT9f 3EANA 2E2II 5D1OA 2JIQA 3HOUI 1YEYA 3DK8A 1Z03A 1WYGA 1GSNA 2XSXA 1GERA 3LADA 3FKII 3S1NI 1W6TA 1S721 4BY1I 3P3BA 5KVHA 4J56A 3CT2A 3V5FA 1VQNZ 2QVHA 2JA8I 4EMWA 1NP6A 1RO4A 5BOEA 4A3II 1GREA 3HOZI 2JIRA 3ZLHA 2QQ6A 3RZDI 4DX3A 4A3FI 3VCNA 1PFTA 3HRDC 3HOYI 5D1OB 5FJUA 4X2PA 3NH5A 1I3QI 2QDEA 3RITA 3BG1B 3R0UA 2HNEA 3CPWZ 3LXDA 4TVYA 1GRHA 3HKZA 3STPA 2VUGA 3CCU1 3CQZI 2R6MA 1DL6A 3ZLGA 2QA4Z 1VQLZ 3T6CA 2QEXZ 5FLMI 1WCMI 1SB3B 4H4PA 3NFZA 4FDCB 4BBRI 3JVAA 1VQ41 2HU9A 1EC8A 4E2ZA 1ZMDA 4BBSI 2FKPA 3I6EA 4K7ZA 3NFUA 1NHQA 3H4KA 1YJWZ 4EM3A 1ZXIC 1FEBA 2YAUA 2YADA 1VDVA 4H4RA 2DE7A 1Q822 1JOAA 4ZA0A 3DJJA 3BG0B 1SFOI 2W55A 3CCQ1 2JR6A 1EC9A 3UJSA 2QGYA 2JMOA 2XH0A 2V8KA 3FG2P 1VQK1 3RZOI 1M1K2 1WUEA 2HXTA 3ES7A 3ES8A 4GRTA 3CCS1 2GGGA 1YIJZ 1Q1WA 2GTHA 2GR1A 3GY1A 1JEHA 3UJEA 3ZVHA 1VQP1 3CXCZ 1FHUA 1V59A 3H3VJ 4E31A 2OOYB 3V4BA 4ADWA 4E30A 3Q45A 2VPWA 4DNAA 2M6NA 2PP0A 3IR7A 2PK7A 4A3LI 5LL6f 2QJMA 4GFIA 4HGZA 1VQMZ 1NHSA 4A3GI 5FLXb 1WW9A 4MXUA 4H4QA 2WOIA 3VC6A 2OO6A 2G2KA 3QWUA 3MZNA 1LPFA 2PGEA 4H4YA 3I4MI 3EEZA 1S72Z 3H12A 4JQ9A 3QFAA 4LIIA 2H85A 3T4NB 2OX4A 2PTZA 2JS4A 3NVWB 3ZVHB 1VQ8Z 1ZB8A 2PS2A 4IL0A 3VMIA 3CMEZ 1YJN1 1EBDA 3OW2Y 3DG3A 1NHPA 2K3RA 4A6GA 3SN4A 1VQ51 3DJGX 3TE5B 2YU9I 2OOXB 1K8A1 3S47A 4A3EI 3L5OA 2WPEA 1Q861 3A7AA 1ZH1A 4E4UA 1JPMA 2X8HA 3URHA 3L8KA 4IHCA 1N5XA 4A3DI 1JRPA 4NOZA 3CCUZ 1ONEA 4NBGA 4NBAA 1MRAA 1FDOA 3ENLA 4GYPC 2OTJ1 4EWJA 1RO0A 1EBHA 3CMA1 4FI4A 4RVHA 2GSHA 1X3ZA 5FLXf 2NVQI 4KEMA 3RR1A 3JW7A 1RNIA 4RVFA 2NVTI 3CXOA 3RO6A 1KD12 4HNCA 4BURA 1JCTA 2GR0A 4HCDA 4GGHA 4M0XA 2PSNA 3CC41 1XDIA 4DQYB 1KQSY 3OTRA 3PWIA 3ZLFA 4NB9A 1BZLA 3CYJA 5FS6A 1BQGA 3MWCA 4EQXA 3CCQZ 1KN0A 1YITZ 3I551 4E2YA 4GR1A 5G5GB 1GEUA 4IP4A 1VQKZ 3S5SA 2NVYI 2OQHA 4H19A 1GRGA 3R07C 1VQO1 3HOWI 1GRAA 3DESA 3TJ4A 4APNA 5JRBA 3N4EA 4DN1A 2BC0A 3RGTA 1ML8A 3ETRB 3UCDA 3GRTA 1H2IA 2JIPA 1VQZA 3B97A 3MQTA 3CCRZ 2NVKX 3GRSA 3S1QI 2O4HA 4HCLA 4M6UA 1W2BY 1FECA 5JCMA 4K8DA 1N8R2 1YJ91 1JWHC 4FP1A 3G711 4KPLA 2XH2A 4DYEA 4A35A 2X50A 3U4FA 3MKCA 4NBBA 2PU0A 4JHMA 4HN8A 3NVZB 2R7ZI 1N8R1 4GIRA 3N6HA 3R10A 1TE6A 1H6VA 1P9NA 3EKGA 3CGDA 3H7VA 5FJTA 2PMZA 3CD61 1JDFA 1YJNZ 2NPXA 1K9M1 1GRBA 4FX9A 1NDAA 1M6IA 4QTTA 1Q812 1OEPA 1X3WA 5T6BA 4IT1A 3VMHA 1L8PA 1VQ5Z 3HPFA 3I561 1KC82 2CHRA 3DG7A 3NS1B 4MMWA 3CCEZ 1RLYA 1FEAA 1XANA 1I50I 2DE6A 2GU2A 3NO1A 3TOYA 3V5CA 4E2WA 2GR2A 4HPNA 3TJIA 2AL1A 3SN1A 2RPRA 1YUKA 2P8BA 3M4OI 1KKOA 4H4UA 3IK4A 4DK1A 2PCEA 2PU1A 3DGZA 1BWCA 1X2GA 5J04A 3CMAZ 2DW6A 3BOXA 4JDRA 5FJRA 3R1ZA 1Q16A 5EU9A 1NPXA 3BSMA 2GGEA 3VA8A 5IP7I 4A3BI 2JK6A 3MUCA 3RNMA 3R25A 4DHGA 4RV9A 3PO2I 3GTOI 2ZZBA 4E6MA 2J6AA 2AKMA 2JUBA 2V3AA 2WP5A 3CC4Z 2PPGA 5BOFA 4G7FA 3CGBA 2V8IA 3JAMb 3GTJI 3DFHA 3EF6A 2V8JA 1SJCA 1T3QC 2POZA 4AYBA 3CB3A 3I55Z 3T4WA 3CPWY 5JCLA 2CDUA 4A3JI 4TVWA 3UGVA 5JCNA 2E5AA 1QVGY 4EWCA 2PP3A 4EM4A 3JZUA 4GGBA 1N5WC 2MNRA 1VQOZ 3GKQA 1GESA 3VDGA 5FMHA 2GQWA 1EC7A 5IP9I 3HW2A 2PGWA 4RVDA 4H4VA 2P0IA 3QTPA 4NEWA 2I5QA 4YWOA 1Q821 1M902 4CL1A 3IJQA 2O56A 3PK7A 4H4SA 5JCIA 1JJ2Z 3SN0A 1S7MA 2Y0SA 3D9XA 5T67A 3ZVIA 1YJ9Z 1TWAI 3IFUA 1SIWA 3G71Z 1M1K1 3TW9A 2C3CA 3VTNA 3M3YI 1Y8CA 2W03A 1Z02A 2ZAEB 3GCFA 4A3RA 3QN3A 1Z01A 1QYPA 2P8CA 3QKEA 6ENLA 3DERA 2GR3A 3IX0A 1VQ91 1MO9A 2AL2A 3P93A 4GISA 7ENLA 3JAMf 1P48A 4S1TA 3CXCY 3FQQA 5TR3A 1MDRA 4MKSA 4TNUA 2XGZA 3SQSA 3I56Z 1KRLA 2GRTA 2HQMA 2BCPA 5FS7A 4RVGA 1XPYA 4H50A 5T64A 2QJNA 2AKLA 3SBFA 2ZZ0A 1NU5A 3UXLA 3I4KA 1VQ61 2WPCA 5GRTA 3GTGI 3IJLA 3J80b 1ZKQA 3J7A4 3AN1A 1ZX9A 2AL2B 1TKKA 2NQLA 3H8AA 5C4XI 2RDXA 3CGEA 2LFUA 3QFBA 1K83I 4E2XA 2JA5I 3PFRA 4ZOHB 1ELSA 2EQ6A 1YI21 3CC71 2YVJA 3KIFA 1EBGA 1GV4A 1MOKA 2PP1A 5KVIA 1VQ4Z 1WUFA 3D47A 2DW7A 1JROA 1AOGA 1V97A 2F5ZA 2WOVA 3GTQI 3RCYA 4EQWA 2F4MA 2A8XA 1VQN1 4IZGA 3OZYA 1QVFZ 5C44I 1WZNA 4E4FA 3OC4A 3H70A 1N63C 3CCV1 2Q4ZA 3HOVI 2GGIA 4F4RA 4EMJA 1F8WA 4IP5A 4A93I 1KD11 5ER0A 2LEXA 3IF8A 1ZDLA 3TDHB 3S1RI 1FO4A 3GTLI 3UCCA 3UXKA 3CCSZ 2WPFA 3CCM1 3J80f 2JIOA 3T8QA 2OZKA 1VQPZ 3S2HI 2EQ7A 3LUSA 1VQ71 3BJSA 4ZCWA 3SJNA 1I6HI 2QA41 4XX2A 2GGHA 4G8TA 3V3WA 2VF1A 1D7YA 3II4A 4K2SA 3VMGA 2GH5A 2RHBA 4EMIA 2W3RA 2BJOA 2E2JI 2OPJA 1TFIA 1XS2A 3P0WA 3CCL1 1K732 1GETA 3K7AI 3Q4DA 1NJI2 2AKZA 4NFRA 2W54A 2OTL1 4K8GA 2HF1A 2JIMA 2ONEA 2R9ZA 5C3EI 3NH8A 3TWBA 4MGGA 2YVGA 3OW1A 1SJDA 3SQPA 1QF8A 2QKDA 1P43A 1K731 4E32A 3U50C 2PTXA 2YQUA 3KUMA 1E9IA 2QLVB 2QJJA 3GTKI 3I07A 4A3MI 1VQ6Z 1VLAA 2RBLA 4KT2A 2PTWA 2X8GA 3N4FA 1USPA 1TWCI 2CFYA 3DIPA 3DK9A 3FJ4A 5D1PA 1TYTA 1Q811 2XH4A 3TCSA 2YVFA 4MRIA 2FYMA
chains in the Genus database with same CATH topology
3DH9A 1KC81 1XHCA 1Q1RA 1VQM1 2IZ3A 3CC21 2OTJZ 3G6E1 3KIHA 3CC7Z 2EGTA 1YI2Z 2V6OA 1X0TA 3GTMI 4NBEA 4J57A 1TWGI 1RO2A 4NEVA 2JA7I 2VUMI 1VQ81 2K5RA 3CCJ1 3LB8A 3IC9A 1USPB 2I3CA 3CME1 3CGCA 2WBAA 5JCKA 3CCVZ 3KLJA 4MONA 3I4NI 4Y52I 1NUIA 2P28A 2M48A 2E9HA 3CCMZ 3G4S1 3PG6A 4X6AI 4KPRA 1VQ7Z 3ESWA 1QVGZ 4HH4A 2DE5A 3P5JB 1NHRA 1ZK7A 2EQ9A 2WP6A 2GTIA 1GRTA 1YHQ1 3Q6JA 2J3NA 3S14I 3MZKB 3CCLZ 1ZB9A 4NBFA 1ZY8A 4BY7I 4A3CI 1M901 2RIQA 2OTLZ 4EQSA 4HGYA 2X99A 2QRCB 1OJTA 4BXXI 3F3FC 1YIT1 3CD6Z 4H4TA 4NBCA 2PM9A 1JJ2Y 2KPIA 5C4JI 5CM2M 3DK4A 2X8CA 1TWFI 1YQZA 4H4WA 1DNCA 3NDJA 2QREB 4MD7A 2R92I 3GTMS 5U1OA 4RS4A 3CCR1 3EERA 2WB1A 5FS9A 3OW2Z 3CC2Z 3EAOA 1WIIA 3G6EZ 4NB8A 1GXFA 3GD4A 3F3PC 1L1OC 3J81b 1ZMCA 3Q87A 2NVXI 3GTPI 3O0HA 4NBDA 3PO3I 1DXLA 4MH4A 2O53A 4NH1C 1RQFA 3CCJZ 2KI7B 1K8A2 2E2HI 3NDIA 1ONFA 3S15I 2P3YA 4BV6A 4M52A 1Q862 1N2FA 3MONA 1YUAA 1Y1VI 2F4OA 3CCE1 2W0HA 2V3BA 4QTUA 4E33A 4EQRA 3G4SZ 5A2Qb 1KQSZ 2BC1A 3S2DI 2R93I 5U25A 2ZZCA 2WOWA 2B63I 1GRFA 1K4QA 2AAQA 1Q7Y2 1QVFY 2W04A 5AN9F 3J81f 3H0GI 1YHQZ 1VQL1 4H4ZA 4Y7NI 2QEX1 1R9TI 5IT9b 1TWHI 2TPRA 2RABA 2JA6I 1Q7Y1 1F3PA 5FS8A 3DGHA 2WAQA 3FQMA 4DGLA 1VQ9Z 1W2BZ 1YJW1 3GD3A 1TYPA 2IZ4A 1Y1WI 3D6WA 3VB9A 3NH4A 3S1MI 3HOXI 4NBHA 5EBKA 4H4XA 4A3KI 3S17I 2C3DA 2LIYA 1NJI1 2QRDB 2QAEA 3S16I 5A2Qf 2RT9A 2Q51A 4MD9A 1YIJ1 3PO3S 4LA1A 1LQLA 3EEDA 1LVLA 2EQ8A 3MZLB 4MD8A 1K9M2 1Y1VS 2JNYA 2QR1B 5IT9f 3EANA 2E2II 5D1OA 3HOUI 3DK8A 1Z03A 1GSNA 1GERA 3LADA 3FKII 3S1NI 1S721 4BY1I 5KVHA 4J56A 1VQNZ 2JA8I 4EMWA 1NP6A 1RO4A 4A3II 1GREA 3HOZI 3RZDI 4A3FI 1PFTA 3HOYI 5D1OB 3NH5A 1I3QI 3BG1B 3CPWZ 3LXDA 1GRHA 3HKZA 2VUGA 3CCU1 3CQZI 2R6MA 1DL6A 2QA4Z 1VQLZ 2QEXZ 5FLMI 1WCMI 4H4PA 3NFZA 4FDCB 4BBRI 1VQ41 2HU9A 1ZMDA 4E2ZA 4BBSI 4K7ZA 1NHQA 3H4KA 1YJWZ 4EM3A 1FEBA 2YAUA 2YADA 4H4RA 2DE7A 1Q822 1JOAA 3DJJA 3BG0B 1SFOI 3CCQ1 2JR6A 2JMOA 2V8KA 3FG2P 1VQK1 3RZOI 1M1K2 4GRTA 3CCS1 1YIJZ 1Q1WA 2GTHA 2GR1A 1JEHA 1VQP1 3CXCZ 1V59A 4ADWA 3H3VJ 4E31A 2OOYB 4E30A 4DNAA 2M6NA 2PK7A 4A3LI 5LL6f 4HGZA 1VQMZ 1NHSA 4A3GI 5FLXb 1WW9A 4MXUA 4H4QA 2WOIA 2G2KA 3QWUA 1LPFA 4H4YA 3I4MI 4JQ9A 1S72Z 3QFAA 4LIIA 2H85A 3T4NB 2JS4A 1VQ8Z 1ZB8A 3VMIA 3CMEZ 1YJN1 1EBDA 3OW2Y 1NHPA 2K3RA 1VQ51 3DJGX 3TE5B 2YU9I 2OOXB 1K8A1 4A3EI 3L5OA 2WPEA 1Q861 1ZH1A 2X8HA 3URHA 3L8KA 4A3DI 4NOZA 3CCUZ 4NBGA 4NBAA 2OTJ1 1RO0A 3CMA1 4RVHA 1X3ZA 5FLXf 2NVQI 1RNIA 4RVFA 2NVTI 1KD12 4BURA 2GR0A 3CC41 1XDIA 4DQYB 1KQSY 4NB9A 1BZLA 4EQXA 5FS6A 3CCQZ 1KN0A 1YITZ 3I551 4E2YA 4GR1A 1GEUA 1VQKZ 2NVYI 1GRGA 1VQO1 3HOWI 1GRAA 4APNA 5JRBA 2BC0A 1ML8A 3GRTA 1H2IA 3CCRZ 2NVKX 3GRSA 3S1QI 2O4HA 1W2BY 1FECA 5JCMA 4K8DA 1N8R2 1YJ91 1JWHC 3G711 2X50A 4NBBA 2R7ZI 1N8R1 1H6VA 1P9NA 3CGDA 2PMZA 3CD61 2NPXA 1YJNZ 4FX9A 1K9M1 1GRBA 1NDAA 1M6IA 4QTTA 1Q812 1X3WA 5T6BA 3VMHA 1VQ5Z 3I561 1KC82 3CCEZ 1RLYA 1FEAA 1XANA 1I50I 2DE6A 2GU2A 4E2WA 2GR2A 2RPRA 1YUKA 3M4OI 4H4UA 4DK1A 3DGZA 1BWCA 3CMAZ 4JDRA 1NPXA 5IP7I 4A3BI 2JK6A 3RNMA 4RV9A 3PO2I 3GTOI 2ZZBA 2J6AA 2JUBA 2V3AA 2WP5A 3CC4Z 3CGBA 2V8IA 3JAMb 3GTJI 3EF6A 2V8JA 5JCLA 4AYBA 3I55Z 3CPWY 2CDUA 4A3JI 5JCNA 1QVGY 4EWCA 4EM4A 1VQOZ 3GKQA 1GESA 5FMHA 2GQWA 5IP9I 4RVDA 4H4VA 4NEWA 4YWOA 1Q821 1M902 4CL1A 4H4SA 5JCIA 1JJ2Z 1S7MA 2Y0SA 3D9XA 5T67A 1YJ9Z 1TWAI 3IFUA 1M1K1 3G71Z 2C3CA 3VTNA 3M3YI 2W03A 1Z02A 2ZAEB 3GCFA 1Z01A 1QYPA 2GR3A 3IX0A 1VQ91 1MO9A 3JAMf 4S1TA 3CXCY 3FQQA 5TR3A 4TNUA 3I56Z 1KRLA 2GRTA 2HQMA 2BCPA 5FS7A 4RVGA 4H50A 5T64A 2AKLA 2ZZ0A 1VQ61 2WPCA 5GRTA 3GTGI 3J80b 1ZKQA 3J7A4 1ZX9A 5C4XI 3CGEA 2LFUA 3QFBA 1K83I 4E2XA 2JA5I 2EQ6A 1YI21 3CC71 2YVJA 3KIFA 1MOKA 1GV4A 5KVIA 1VQ4Z 1AOGA 2WOVA 2F5ZA 4EQWA 3GTQI 2F4MA 2A8XA 1VQN1 1QVFZ 5C44I 3OC4A 3CCV1 2Q4ZA 3HOVI 4EMJA 1F8WA 4A93I 1KD11 5ER0A 3IF8A 1ZDLA 3TDHB 3S1RI 3GTLI 3CCSZ 2WPFA 3CCM1 3J80f 2OZKA 1VQPZ 3S2HI 2EQ7A 3LUSA 1VQ71 1I6HI 2QA41 4XX2A 2VF1A 1D7YA 3II4A 3VMGA 2GH5A 2RHBA 4EMIA 2BJOA 2E2JI 1TFIA 3CCL1 1K732 1GETA 3K7AI 1NJI2 4NFRA 2OTL1 2HF1A 2R9ZA 5C3EI 3NH8A 2YVGA 3SQPA 1QF8A 2QKDA 1K731 4E32A 3U50C 2YQUA 2QLVB 3GTKI 3I07A 4A3MI 1VQ6Z 1VLAA 2RBLA 2X8GA 1USPA 1TWCI 2CFYA 3DK9A 5D1PA 1TYTA 1Q811 2YVFA 4MRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7M A;  3D9X A; 
#chains in the Genus database with same CATH topology
 3DH9 A;  3IJI A;  1KC8 1;  1XHC A;  3NVV B;  1Q1R A;  1VQM 1;  2IZ3 A;  3CC2 1;  2OTJ Z;  3G6E 1;  3NRZ B;  3KIH A;  3CC7 Z;  2EGT A;  1YI2 Z;  3OPS A;  2V6O A;  1FFU C;  1X0T A;  3GTM I;  3FYY A;  4NBE A;  3EUB 3;  2OG9 A;  1TWG I;  3PWG A;  1RO2 A;  4J3Z A;  4J57 A;  4NEV A;  2IV2 X;  2JA7 I;  2VUM I;  3TQP A;  1VQ8 1;  2K5R A;  3CCJ 1;  3LB8 A;  3IC9 A;  1USP B;  2I3C A;  3CME 1;  3CGC A;  2WBA A;  5JCK A;  3CCV Z;  3KLJ A;  1R0M A;  2HXU A;  2OLA A;  1DTN A;  1F9C A;  4MON A;  3T9P A;  3I4N I;  4Y52 I;  3NVY B;  1NUI A;  2P28 A;  1KCZ A;  2M48 A;  2E9H A;  3CCM Z;  3G4S 1;  1SJB A;  3PG6 A;  4X6A I;  2QDD A;  4KPR A;  2ZAD A;  4JN8 A;  1VQ7 Z;  3ESW A;  1QVG Z;  2HZG A;  2OZT A;  3U9I A;  3UJR A;  4HH4 A;  2OVL A;  3FXG A;  2DE5 A;  3P5J B;  1NHR A;  1ZK7 A;  2EQ9 A;  3AMZ A;  3I6T A;  2WP6 A;  2GTI A;  1GRT A;  1YHQ 1;  1PDY A;  2GDQ A;  2J3N A;  3Q6J A;  3UJ2 A;  3S14 I;  1NEL A;  3NZG A;  3MZK B;  4ENL A;  3CCL Z;  4IL2 A;  1WJ2 A;  1ZB9 A;  4NBF A;  1ZY8 A;  1FFV C;  4BY7 I;  3GO2 A;  4A3C I;  1M90 1;  1R6W A;  3K1G A;  3D46 A;  2RIQ A;  1QXF A;  2OTL Z;  4GYP A;  3TWA A;  4EQS A;  3UJF A;  4HGY A;  1N60 C;  2GGJ A;  2X99 A;  2QRC B;  1RVK A;  4HCH A;  2GL5 A;  1OJT A;  3FVD A;  4BXX I;  3F3F C;  1YIT 1;  3CD6 Z;  4H4T A;  4NBC A;  2PM9 A;  1JJ2 Y;  1N61 C;  2KPI A;  2P88 A;  5C4J I;  2ZC8 A;  3VC5 A;  4DXK A;  5CM2 M;  3DK4 A;  2VPY A;  1X2H A;  1TWF I;  2X8C A;  1YQZ A;  4JN7 A;  1AA6 A;  3DG6 A;  4H4W A;  1DNC A;  3NDJ A;  2QRE B;  4MD7 A;  2R92 I;  3GTM S;  1KKR A;  3NXL A;  2PA6 A;  5U1O A;  4RS4 A;  3CCR 1;  5ENL A;  3EER A;  3QLD A;  2WB1 A;  3CK5 A;  2P3Z A;  1FDI A;  5FS9 A;  3OW2 Z;  4ROP A;  2OZ3 A;  3SR6 B;  3CC2 Z;  3EAO A;  1WII A;  3G6E Z;  4NB8 A;  1GXF A;  3GD4 A;  3F3P C;  3VFC A;  5IDZ A;  1L1O C;  2VPX A;  3J81 b;  2E3T A;  4H83 A;  4KWS A;  3N6J A;  3SSZ A;  1ZMC A;  3Q87 A;  2NVX I;  3GTP I;  5FJO A;  4E5T A;  3O0H A;  4NBD A;  3PO3 I;  1DXL A;  4MH4 A;  3AM9 A;  2O53 A;  4NH1 C;  1RQF A;  3CCJ Z;  2KI7 B;  1K8A 2;  2E2H I;  2OKT A;  3NDI A;  1ONF A;  4GME A;  3S15 I;  2P3Y A;  3RRA A;  4BV6 A;  1BKH A;  4M52 A;  1Q86 2;  3MSY A;  3DEQ A;  1N2F A;  3MON A;  2NAP A;  1YUA A;  1ECQ A;  1PDZ A;  4Z17 A;  1Y1V I;  2F4O A;  3CCE 1;  2W0H A;  1SJA A;  1STZ A;  3QPE A;  4H2H A;  2V3B A;  4QTU A;  4E33 A;  1RM6 B;  3CXB A;  3G4S Z;  4EQR A;  5A2Q b;  2XH7 A;  4Z1Y A;  5FJP A;  3CAW A;  1KQS Z;  2BC1 A;  3S2D I;  2R93 I;  2AYD A;  5U25 A;  2ZZC A;  3THU A;  2WOW A;  2B63 I;  1GRF A;  1K4Q A;  2OFJ A;  2OQY A;  2AAQ A;  1Q7Y 2;  1QVF Y;  2W04 A;  1MNS A;  3D2L A;  5AN9 F;  2OZ8 A;  3A7U A;  3DFY A;  1MDL A;  3TTE A;  3J81 f;  3H0G I;  1YHQ Z;  1VQL 1;  1IYX A;  4Y7N I;  4H4Z A;  2QEX 1;  1R9T I;  5IT9 b;  1N62 C;  1TWH I;  2MUC A;  2TPR A;  2RAB A;  3GD6 A;  2VPZ A;  2JA6 I;  3OP2 A;  1Q7Y 1;  1F3P A;  1FHV A;  4H1Z A;  3DGH A;  2E7Z A;  1TZZ A;  5FS8 A;  4YWS A;  4J1O A;  2WAQ A;  2PTY A;  3FQM A;  4DGL A;  3VCC A;  1VQ9 Z;  1W2B Z;  1YJW 1;  3GD3 A;  1TYP A;  3A7R A;  2IZ4 A;  3B9J B;  4DWD A;  2V45 A;  3D6W A;  1Y1W I;  2PMQ A;  3VB9 A;  3R0K A;  3NH4 A;  3S1M I;  3MY9 A;  3HOX I;  4NBH A;  5G5H B;  5EBK A;  4H4X A;  4A3K I;  2W3S A;  3S17 I;  2C3D A;  2LIY A;  1NJI 1;  4K1W A;  2QRD B;  2QAE A;  3S16 I;  5A2Q f;  2RT9 A;  3OZM A;  3FCP A;  2Q51 A;  3FV9 A;  4MD9 A;  1YIJ 1;  3PO3 S;  3DGB A;  3R11 A;  4LA1 A;  2POD A;  3DDM A;  4HNL A;  4HYR A;  1LQL A;  3EED A;  1FIQ B;  1KD0 A;  1JPD X;  1MUC A;  1LVL A;  2EQ8 A;  3MZL B;  4MD8 A;  1K9M 2;  1Y1V S;  2JNY A;  2QR1 B;  3GC2 A;  2V3V A;  4E8G A;  5IT9 f;  3EAN A;  2E2I I;  5D1O A;  2JIQ A;  3HOU I;  1YEY A;  3DK8 A;  1Z03 A;  1WYG A;  1GSN A;  2XSX A;  1GER A;  3LAD A;  3FKI I;  3S1N I;  1W6T A;  1S72 1;  4BY1 I;  3P3B A;  5KVH A;  4J56 A;  3CT2 A;  3V5F A;  1VQN Z;  2QVH A;  2JA8 I;  4EMW A;  1NP6 A;  1RO4 A;  5BOE A;  4A3I I;  1GRE A;  3HOZ I;  2JIR A;  3ZLH A;  2QQ6 A;  3RZD I;  4DX3 A;  4A3F I;  3VCN A;  1PFT A;  3HRD C;  3HOY I;  5D1O B;  5FJU A;  4X2P A;  3NH5 A;  1I3Q I;  2QDE A;  3RIT A;  3BG1 B;  3R0U A;  2HNE A;  3CPW Z;  3LXD A;  4TVY A;  1GRH A;  3HKZ A;  3STP A;  2VUG A;  3CCU 1;  3CQZ I;  2R6M A;  1DL6 A;  3ZLG A;  2QA4 Z;  1VQL Z;  3T6C A;  2QEX Z;  5FLM I;  1WCM I;  1SB3 B;  4H4P A;  3NFZ A;  4FDC B;  4BBR I;  3JVA A;  1VQ4 1;  2HU9 A;  1EC8 A;  4E2Z A;  1ZMD A;  4BBS I;  2FKP A;  3I6E A;  4K7Z A;  3NFU A;  1NHQ A;  3H4K A;  1YJW Z;  4EM3 A;  1ZXI C;  1FEB A;  2YAU A;  2YAD A;  1VDV A;  4H4R A;  2DE7 A;  1Q82 2;  1JOA A;  4ZA0 A;  3DJJ A;  3BG0 B;  1SFO I;  2W55 A;  3CCQ 1;  2JR6 A;  1EC9 A;  3UJS A;  2QGY A;  2JMO A;  2XH0 A;  2V8K A;  3FG2 P;  1VQK 1;  3RZO I;  1M1K 2;  1WUE A;  2HXT A;  3ES7 A;  3ES8 A;  4GRT A;  3CCS 1;  2GGG A;  1YIJ Z;  1Q1W A;  2GTH A;  2GR1 A;  3GY1 A;  1JEH A;  3UJE A;  3ZVH A;  1VQP 1;  3CXC Z;  1FHU A;  1V59 A;  3H3V J;  4E31 A;  2OOY B;  3V4B A;  4ADW A;  4E30 A;  3Q45 A;  2VPW A;  4DNA A;  2M6N A;  2PP0 A;  3IR7 A;  2PK7 A;  4A3L I;  5LL6 f;  2QJM A;  4GFI A;  4HGZ A;  1VQM Z;  1NHS A;  4A3G I;  5FLX b;  1WW9 A;  4MXU A;  4H4Q A;  2WOI A;  3VC6 A;  2OO6 A;  2G2K A;  3QWU A;  3MZN A;  1LPF A;  2PGE A;  4H4Y A;  3I4M I;  3EEZ A;  1S72 Z;  3H12 A;  4JQ9 A;  3QFA A;  4LII A;  2H85 A;  3T4N B;  2OX4 A;  2PTZ A;  2JS4 A;  3NVW B;  3ZVH B;  1VQ8 Z;  1ZB8 A;  2PS2 A;  4IL0 A;  3VMI A;  3CME Z;  1YJN 1;  1EBD A;  3OW2 Y;  3DG3 A;  1NHP A;  2K3R A;  4A6G A;  3SN4 A;  1VQ5 1;  3DJG X;  3TE5 B;  2YU9 I;  2OOX B;  1K8A 1;  3S47 A;  4A3E I;  3L5O A;  2WPE A;  1Q86 1;  3A7A A;  1ZH1 A;  4E4U A;  1JPM A;  2X8H A;  3URH A;  3L8K A;  4IHC A;  1N5X A;  4A3D I;  1JRP A;  4NOZ A;  3CCU Z;  1ONE A;  4NBG A;  4NBA A;  1MRA A;  1FDO A;  3ENL A;  4GYP C;  2OTJ 1;  4EWJ A;  1RO0 A;  1EBH A;  3CMA 1;  4FI4 A;  4RVH A;  2GSH A;  1X3Z A;  5FLX f;  2NVQ I;  4KEM A;  3RR1 A;  3JW7 A;  1RNI A;  4RVF A;  2NVT I;  3CXO A;  3RO6 A;  1KD1 2;  4HNC A;  4BUR A;  1JCT A;  2GR0 A;  4HCD A;  4GGH A;  4M0X A;  2PSN A;  3CC4 1;  1XDI A;  4DQY B;  1KQS Y;  3OTR A;  3PWI A;  3ZLF A;  4NB9 A;  1BZL A;  3CYJ A;  5FS6 A;  1BQG A;  3MWC A;  4EQX A;  3CCQ Z;  1KN0 A;  1YIT Z;  3I55 1;  4E2Y A;  4GR1 A;  5G5G B;  1GEU A;  4IP4 A;  1VQK Z;  3S5S A;  2NVY I;  2OQH A;  4H19 A;  1GRG A;  3R07 C;  1VQO 1;  3HOW I;  1GRA A;  3DES A;  3TJ4 A;  4APN A;  5JRB A;  3N4E A;  4DN1 A;  2BC0 A;  3RGT A;  1ML8 A;  3ETR B;  3UCD A;  3GRT A;  1H2I A;  2JIP A;  1VQZ A;  3B97 A;  3MQT A;  3CCR Z;  2NVK X;  3GRS A;  3S1Q I;  2O4H A;  4HCL A;  4M6U A;  1W2B Y;  1FEC A;  5JCM A;  4K8D A;  1N8R 2;  1YJ9 1;  1JWH C;  4FP1 A;  3G71 1;  4KPL A;  2XH2 A;  4DYE A;  4A35 A;  2X50 A;  3U4F A;  3MKC A;  4NBB A;  2PU0 A;  4JHM A;  4HN8 A;  3NVZ B;  2R7Z I;  1N8R 1;  4GIR A;  3N6H A;  3R10 A;  1TE6 A;  1H6V A;  1P9N A;  3EKG A;  3CGD A;  3H7V A;  5FJT A;  2PMZ A;  3CD6 1;  1JDF A;  1YJN Z;  2NPX A;  1K9M 1;  1GRB A;  4FX9 A;  1NDA A;  1M6I A;  4QTT A;  1Q81 2;  1OEP A;  1X3W A;  5T6B A;  4IT1 A;  3VMH A;  1L8P A;  1VQ5 Z;  3HPF A;  3I56 1;  1KC8 2;  2CHR A;  3DG7 A;  3NS1 B;  4MMW A;  3CCE Z;  1RLY A;  1FEA A;  1XAN A;  1I50 I;  2DE6 A;  2GU2 A;  3NO1 A;  3TOY A;  3V5C A;  4E2W A;  2GR2 A;  4HPN A;  3TJI A;  2AL1 A;  3SN1 A;  2RPR A;  1YUK A;  2P8B A;  3M4O I;  1KKO A;  4H4U A;  3IK4 A;  4DK1 A;  2PCE A;  2PU1 A;  3DGZ A;  1BWC A;  1X2G A;  5J04 A;  3CMA Z;  2DW6 A;  3BOX A;  4JDR A;  5FJR A;  3R1Z A;  1Q16 A;  5EU9 A;  1NPX A;  3BSM A;  2GGE A;  3VA8 A;  5IP7 I;  4A3B I;  2JK6 A;  3MUC A;  3RNM A;  3R25 A;  4DHG A;  4RV9 A;  3PO2 I;  3GTO I;  2ZZB A;  4E6M A;  2J6A A;  2AKM A;  2JUB A;  2V3A A;  2WP5 A;  3CC4 Z;  2PPG A;  5BOF A;  4G7F A;  3CGB A;  2V8I A;  3JAM b;  3GTJ I;  3DFH A;  3EF6 A;  2V8J A;  1SJC A;  1T3Q C;  2POZ A;  4AYB A;  3CB3 A;  3I55 Z;  3T4W A;  3CPW Y;  5JCL A;  2CDU A;  4A3J I;  4TVW A;  3UGV A;  5JCN A;  2E5A A;  1QVG Y;  4EWC A;  2PP3 A;  4EM4 A;  3JZU A;  4GGB A;  1N5W C;  2MNR A;  1VQO Z;  3GKQ A;  1GES A;  3VDG A;  5FMH A;  2GQW A;  1EC7 A;  5IP9 I;  3HW2 A;  2PGW A;  4RVD A;  4H4V A;  2P0I A;  3QTP A;  4NEW A;  2I5Q A;  4YWO A;  1Q82 1;  1M90 2;  4CL1 A;  3IJQ A;  2O56 A;  3PK7 A;  4H4S A;  5JCI A;  1JJ2 Z;  3SN0 A;  1S7M A;  2Y0S A;  3D9X A;  5T67 A;  3ZVI A;  1YJ9 Z;  1TWA I;  3IFU A;  1SIW A;  3G71 Z;  1M1K 1;  3TW9 A;  2C3C A;  3VTN A;  3M3Y I;  1Y8C A;  2W03 A;  1Z02 A;  2ZAE B;  3GCF A;  4A3R A;  3QN3 A;  1Z01 A;  1QYP A;  2P8C A;  3QKE A;  6ENL A;  3DER A;  2GR3 A;  3IX0 A;  1VQ9 1;  1MO9 A;  2AL2 A;  3P93 A;  4GIS A;  7ENL A;  3JAM f;  1P48 A;  4S1T A;  3CXC Y;  3FQQ A;  5TR3 A;  1MDR A;  4MKS A;  4TNU A;  2XGZ A;  3SQS A;  3I56 Z;  1KRL A;  2GRT A;  2HQM A;  2BCP A;  5FS7 A;  4RVG A;  1XPY A;  4H50 A;  5T64 A;  2QJN A;  2AKL A;  3SBF A;  2ZZ0 A;  1NU5 A;  3UXL A;  3I4K A;  1VQ6 1;  2WPC A;  5GRT A;  3GTG I;  3IJL A;  3J80 b;  1ZKQ A;  3J7A 4;  3AN1 A;  1ZX9 A;  2AL2 B;  1TKK A;  2NQL A;  3H8A A;  5C4X I;  2RDX A;  3CGE A;  2LFU A;  3QFB A;  1K83 I;  4E2X A;  2JA5 I;  3PFR A;  4ZOH B;  1ELS A;  2EQ6 A;  1YI2 1;  3CC7 1;  2YVJ A;  3KIF A;  1EBG A;  1GV4 A;  1MOK A;  2PP1 A;  5KVI A;  1VQ4 Z;  1WUF A;  3D47 A;  2DW7 A;  1JRO A;  1AOG A;  1V97 A;  2F5Z A;  2WOV A;  3GTQ I;  3RCY A;  4EQW A;  2F4M A;  2A8X A;  1VQN 1;  4IZG A;  3OZY A;  1QVF Z;  5C44 I;  1WZN A;  4E4F A;  3OC4 A;  3H70 A;  1N63 C;  3CCV 1;  2Q4Z A;  3HOV I;  2GGI A;  4F4R A;  4EMJ A;  1F8W A;  4IP5 A;  4A93 I;  1KD1 1;  5ER0 A;  2LEX A;  3IF8 A;  1ZDL A;  3TDH B;  3S1R I;  1FO4 A;  3GTL I;  3UCC A;  3UXK A;  3CCS Z;  2WPF A;  3CCM 1;  3J80 f;  2JIO A;  3T8Q A;  2OZK A;  1VQP Z;  3S2H I;  2EQ7 A;  3LUS A;  1VQ7 1;  3BJS A;  4ZCW A;  3SJN A;  1I6H I;  2QA4 1;  4XX2 A;  2GGH A;  4G8T A;  3V3W A;  2VF1 A;  1D7Y A;  3II4 A;  4K2S A;  3VMG A;  2GH5 A;  2RHB A;  4EMI A;  2W3R A;  2BJO A;  2E2J I;  2OPJ A;  1TFI A;  1XS2 A;  3P0W A;  3CCL 1;  1K73 2;  1GET A;  3K7A I;  3Q4D A;  1NJI 2;  2AKZ A;  4NFR A;  2W54 A;  2OTL 1;  4K8G A;  2HF1 A;  2JIM A;  2ONE A;  2R9Z A;  5C3E I;  3NH8 A;  3TWB A;  4MGG A;  2YVG A;  3OW1 A;  1SJD A;  3SQP A;  1QF8 A;  2QKD A;  1P43 A;  1K73 1;  4E32 A;  3U50 C;  2PTX A;  2YQU A;  3KUM A;  1E9I A;  2QLV B;  2QJJ A;  3GTK I;  3I07 A;  4A3M I;  1VQ6 Z;  1VLA A;  2RBL A;  4KT2 A;  2PTW A;  2X8G A;  3N4F A;  1USP A;  1TWC I;  2CFY A;  3DIP A;  3DK9 A;  3FJ4 A;  5D1P A;  1TYT A;  1Q81 1;  2XH4 A;  3TCS A;  2YVF A;  4MRI A;  2FYM A; 
#chains in the Genus database with same CATH homology
 3DH9 A;  1KC8 1;  1XHC A;  1Q1R A;  1VQM 1;  2IZ3 A;  3CC2 1;  2OTJ Z;  3G6E 1;  3KIH A;  3CC7 Z;  2EGT A;  1YI2 Z;  2V6O A;  1X0T A;  3GTM I;  4NBE A;  4J57 A;  1TWG I;  1RO2 A;  4NEV A;  2JA7 I;  2VUM I;  1VQ8 1;  2K5R A;  3CCJ 1;  3LB8 A;  3IC9 A;  1USP B;  2I3C A;  3CME 1;  3CGC A;  2WBA A;  5JCK A;  3CCV Z;  3KLJ A;  4MON A;  3I4N I;  4Y52 I;  1NUI A;  2P28 A;  2M48 A;  2E9H A;  3CCM Z;  3G4S 1;  3PG6 A;  4X6A I;  4KPR A;  1VQ7 Z;  3ESW A;  1QVG Z;  4HH4 A;  2DE5 A;  3P5J B;  1NHR A;  1ZK7 A;  2EQ9 A;  2WP6 A;  2GTI A;  1GRT A;  1YHQ 1;  3Q6J A;  2J3N A;  3S14 I;  3MZK B;  3CCL Z;  1ZB9 A;  4NBF A;  1ZY8 A;  4BY7 I;  4A3C I;  1M90 1;  2RIQ A;  2OTL Z;  4EQS A;  4HGY A;  2X99 A;  2QRC B;  1OJT A;  4BXX I;  3F3F C;  1YIT 1;  3CD6 Z;  4H4T A;  4NBC A;  2PM9 A;  1JJ2 Y;  2KPI A;  5C4J I;  5CM2 M;  3DK4 A;  2X8C A;  1TWF I;  1YQZ A;  4H4W A;  1DNC A;  3NDJ A;  2QRE B;  4MD7 A;  2R92 I;  3GTM S;  5U1O A;  4RS4 A;  3CCR 1;  3EER A;  2WB1 A;  5FS9 A;  3OW2 Z;  3CC2 Z;  3EAO A;  1WII A;  3G6E Z;  4NB8 A;  1GXF A;  3GD4 A;  3F3P C;  1L1O C;  3J81 b;  1ZMC A;  3Q87 A;  2NVX I;  3GTP I;  3O0H A;  4NBD A;  3PO3 I;  1DXL A;  4MH4 A;  2O53 A;  4NH1 C;  1RQF A;  3CCJ Z;  2KI7 B;  1K8A 2;  2E2H I;  3NDI A;  1ONF A;  3S15 I;  2P3Y A;  4BV6 A;  4M52 A;  1Q86 2;  1N2F A;  3MON A;  1YUA A;  1Y1V I;  2F4O A;  3CCE 1;  2W0H A;  2V3B A;  4QTU A;  4E33 A;  4EQR A;  3G4S Z;  5A2Q b;  1KQS Z;  2BC1 A;  3S2D I;  2R93 I;  5U25 A;  2ZZC A;  2WOW A;  2B63 I;  1GRF A;  1K4Q A;  2AAQ A;  1Q7Y 2;  1QVF Y;  2W04 A;  5AN9 F;  3J81 f;  3H0G I;  1YHQ Z;  1VQL 1;  4H4Z A;  4Y7N I;  2QEX 1;  1R9T I;  5IT9 b;  1TWH I;  2TPR A;  2RAB A;  2JA6 I;  1Q7Y 1;  1F3P A;  5FS8 A;  3DGH A;  2WAQ A;  3FQM A;  4DGL A;  1VQ9 Z;  1W2B Z;  1YJW 1;  3GD3 A;  1TYP A;  2IZ4 A;  1Y1W I;  3D6W A;  3VB9 A;  3NH4 A;  3S1M I;  3HOX I;  4NBH A;  5EBK A;  4H4X A;  4A3K I;  3S17 I;  2C3D A;  2LIY A;  1NJI 1;  2QRD B;  2QAE A;  3S16 I;  5A2Q f;  2RT9 A;  2Q51 A;  4MD9 A;  1YIJ 1;  3PO3 S;  4LA1 A;  1LQL A;  3EED A;  1LVL A;  2EQ8 A;  3MZL B;  4MD8 A;  1K9M 2;  1Y1V S;  2JNY A;  2QR1 B;  5IT9 f;  3EAN A;  2E2I I;  5D1O A;  3HOU I;  3DK8 A;  1Z03 A;  1GSN A;  1GER A;  3LAD A;  3FKI I;  3S1N I;  1S72 1;  4BY1 I;  5KVH A;  4J56 A;  1VQN Z;  2JA8 I;  4EMW A;  1NP6 A;  1RO4 A;  4A3I I;  1GRE A;  3HOZ I;  3RZD I;  4A3F I;  1PFT A;  3HOY I;  5D1O B;  3NH5 A;  1I3Q I;  3BG1 B;  3CPW Z;  3LXD A;  1GRH A;  3HKZ A;  2VUG A;  3CCU 1;  3CQZ I;  2R6M A;  1DL6 A;  2QA4 Z;  1VQL Z;  2QEX Z;  5FLM I;  1WCM I;  4H4P A;  3NFZ A;  4FDC B;  4BBR I;  1VQ4 1;  2HU9 A;  1ZMD A;  4E2Z A;  4BBS I;  4K7Z A;  1NHQ A;  3H4K A;  1YJW Z;  4EM3 A;  1FEB A;  2YAU A;  2YAD A;  4H4R A;  2DE7 A;  1Q82 2;  1JOA A;  3DJJ A;  3BG0 B;  1SFO I;  3CCQ 1;  2JR6 A;  2JMO A;  2V8K A;  3FG2 P;  1VQK 1;  3RZO I;  1M1K 2;  4GRT A;  3CCS 1;  1YIJ Z;  1Q1W A;  2GTH A;  2GR1 A;  1JEH A;  1VQP 1;  3CXC Z;  1V59 A;  4ADW A;  3H3V J;  4E31 A;  2OOY B;  4E30 A;  4DNA A;  2M6N A;  2PK7 A;  4A3L I;  5LL6 f;  4HGZ A;  1VQM Z;  1NHS A;  4A3G I;  5FLX b;  1WW9 A;  4MXU A;  4H4Q A;  2WOI A;  2G2K A;  3QWU A;  1LPF A;  4H4Y A;  3I4M I;  4JQ9 A;  1S72 Z;  3QFA A;  4LII A;  2H85 A;  3T4N B;  2JS4 A;  1VQ8 Z;  1ZB8 A;  3VMI A;  3CME Z;  1YJN 1;  1EBD A;  3OW2 Y;  1NHP A;  2K3R A;  1VQ5 1;  3DJG X;  3TE5 B;  2YU9 I;  2OOX B;  1K8A 1;  4A3E I;  3L5O A;  2WPE A;  1Q86 1;  1ZH1 A;  2X8H A;  3URH A;  3L8K A;  4A3D I;  4NOZ A;  3CCU Z;  4NBG A;  4NBA A;  2OTJ 1;  1RO0 A;  3CMA 1;  4RVH A;  1X3Z A;  5FLX f;  2NVQ I;  1RNI A;  4RVF A;  2NVT I;  1KD1 2;  4BUR A;  2GR0 A;  3CC4 1;  1XDI A;  4DQY B;  1KQS Y;  4NB9 A;  1BZL A;  4EQX A;  5FS6 A;  3CCQ Z;  1KN0 A;  1YIT Z;  3I55 1;  4E2Y A;  4GR1 A;  1GEU A;  1VQK Z;  2NVY I;  1GRG A;  1VQO 1;  3HOW I;  1GRA A;  4APN A;  5JRB A;  2BC0 A;  1ML8 A;  3GRT A;  1H2I A;  3CCR Z;  2NVK X;  3GRS A;  3S1Q I;  2O4H A;  1W2B Y;  1FEC A;  5JCM A;  4K8D A;  1N8R 2;  1YJ9 1;  1JWH C;  3G71 1;  2X50 A;  4NBB A;  2R7Z I;  1N8R 1;  1H6V A;  1P9N A;  3CGD A;  2PMZ A;  3CD6 1;  2NPX A;  1YJN Z;  4FX9 A;  1K9M 1;  1GRB A;  1NDA A;  1M6I A;  4QTT A;  1Q81 2;  1X3W A;  5T6B A;  3VMH A;  1VQ5 Z;  3I56 1;  1KC8 2;  3CCE Z;  1RLY A;  1FEA A;  1XAN A;  1I50 I;  2DE6 A;  2GU2 A;  4E2W A;  2GR2 A;  2RPR A;  1YUK A;  3M4O I;  4H4U A;  4DK1 A;  3DGZ A;  1BWC A;  3CMA Z;  4JDR A;  1NPX A;  5IP7 I;  4A3B I;  2JK6 A;  3RNM A;  4RV9 A;  3PO2 I;  3GTO I;  2ZZB A;  2J6A A;  2JUB A;  2V3A A;  2WP5 A;  3CC4 Z;  3CGB A;  2V8I A;  3JAM b;  3GTJ I;  3EF6 A;  2V8J A;  5JCL A;  4AYB A;  3I55 Z;  3CPW Y;  2CDU A;  4A3J I;  5JCN A;  1QVG Y;  4EWC A;  4EM4 A;  1VQO Z;  3GKQ A;  1GES A;  5FMH A;  2GQW A;  5IP9 I;  4RVD A;  4H4V A;  4NEW A;  4YWO A;  1Q82 1;  1M90 2;  4CL1 A;  4H4S A;  5JCI A;  1JJ2 Z;  1S7M A;  2Y0S A;  3D9X A;  5T67 A;  1YJ9 Z;  1TWA I;  3IFU A;  1M1K 1;  3G71 Z;  2C3C A;  3VTN A;  3M3Y I;  2W03 A;  1Z02 A;  2ZAE B;  3GCF A;  1Z01 A;  1QYP A;  2GR3 A;  3IX0 A;  1VQ9 1;  1MO9 A;  3JAM f;  4S1T A;  3CXC Y;  3FQQ A;  5TR3 A;  4TNU A;  3I56 Z;  1KRL A;  2GRT A;  2HQM A;  2BCP A;  5FS7 A;  4RVG A;  4H50 A;  5T64 A;  2AKL A;  2ZZ0 A;  1VQ6 1;  2WPC A;  5GRT A;  3GTG I;  3J80 b;  1ZKQ A;  3J7A 4;  1ZX9 A;  5C4X I;  3CGE A;  2LFU A;  3QFB A;  1K83 I;  4E2X A;  2JA5 I;  2EQ6 A;  1YI2 1;  3CC7 1;  2YVJ A;  3KIF A;  1MOK A;  1GV4 A;  5KVI A;  1VQ4 Z;  1AOG A;  2WOV A;  2F5Z A;  4EQW A;  3GTQ I;  2F4M A;  2A8X A;  1VQN 1;  1QVF Z;  5C44 I;  3OC4 A;  3CCV 1;  2Q4Z A;  3HOV I;  4EMJ A;  1F8W A;  4A93 I;  1KD1 1;  5ER0 A;  3IF8 A;  1ZDL A;  3TDH B;  3S1R I;  3GTL I;  3CCS Z;  2WPF A;  3CCM 1;  3J80 f;  2OZK A;  1VQP Z;  3S2H I;  2EQ7 A;  3LUS A;  1VQ7 1;  1I6H I;  2QA4 1;  4XX2 A;  2VF1 A;  1D7Y A;  3II4 A;  3VMG A;  2GH5 A;  2RHB A;  4EMI A;  2BJO A;  2E2J I;  1TFI A;  3CCL 1;  1K73 2;  1GET A;  3K7A I;  1NJI 2;  4NFR A;  2OTL 1;  2HF1 A;  2R9Z A;  5C3E I;  3NH8 A;  2YVG A;  3SQP A;  1QF8 A;  2QKD A;  1K73 1;  4E32 A;  3U50 C;  2YQU A;  2QLV B;  3GTK I;  3I07 A;  4A3M I;  1VQ6 Z;  1VLA A;  2RBL A;  2X8G A;  1USP A;  1TWC I;  2CFY A;  3DK9 A;  5D1P A;  1TYT A;  1Q81 1;  2YVF A;  4MRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...