3D9XA

Structure of the head of the bartonella adhesin bada
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
114
structure length
114
Chain Sequence
b'GGWNLTVNNDNNTVVSSGGALDLSSGSKNLKIVKDGKKNNVTFDVARDLTLKSIKLDGVTLNETGLFIANGPQITASGINAGSQKITGVAEGTDANDAVNFGQLKKIETEVKEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adhesin A
molecule tags Cell adhesion
source organism Bartonella henselae
publication title Structure of the head of the Bartonella adhesin BadA
pubmed doi rcsb
total genus 13
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05662 YadA_stalk Coiled stalk of trimeric autotransporter adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.490 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3d9xA01
3.30.390.90 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3d9xA02
3D9XA 1S7MA
chains in the Genus database with same CATH superfamily
1VQ4Z 3TTEA 5FJUA 3S2DI 3MKCA 1YUAA 1F8WA 1EC7A 2AAQA 3AM9A 2TPRA 3L5OA 3DK8A 5IP9I 3VMIA 1RVKA 1ZMCA 4A3RA 1NPXA 1TFIA 2GDQA 3CXBA 3N6HA 4E31A 3N6JA 5FS9A 2WPEA 2X8GA 2X99A 3MONA 5JCKA 4K1WA 1BKHA 4E4FA 2E5AA 3P5JB 1RO4A 4NBCA 3B97A 3DESA 5JRBA 1JJ2Z 1ECQA 2LFUA 1X2HA 1YJ91 2V8KA 3U9IA 4DX3A 3NDJA 4LA1A 5JCMA 3D6WA 1OJTA 3DFHA 3DIPA 3SQPA 1ZH1A 3S1MI 3CMAZ 3J80b 3EAOA 4A35A 2PTXA 2NPXA 1FDOA 1H2IA 3NFZA 3I4MI 1Q861 1JJ2Y 4HGYA 3H7VA 1YJWZ 3QPEA 1ONEA 4A3FI 1NHQA 1PDYA 1EC9A 3CD61 4ROPA 3NXLA 2OFJA 4E2WA 4E33A 2QGYA 2XH2A 1Z03A 3ZVHB 1LVLA 2F5ZA 1ZB9A 1TWGI 1TZZA 1X2GA 3IC9A 4GR1A 4H4VA 3RGTA 4E2YA 1VQ51 1Z02A 3V5CA 1S7MA 3HRDC 2NVTI 3RNMA 3PK7A 4HN8A 1Q862 2C3CA 3CCR1 3K1GA 4DWDA 2QKDA 1VQN1 3JW7A 1TWAI 4DNAA 4E5TA 2P8CA 3O0HA 3S14I 3IX0A 3PWIA 4FX9A 2OTJZ 1SFOI 4GGBA 1YUKA 4NEVA 3JAMf 4E32A 1R6WA 3CCUZ 5J04A 2JIRA 3LUSA 3IFUA 4RVGA 1JROA 3Q87A 1Q7Y2 1NJI2 3IJQA 4K7ZA 3T4NB 4EQRA 3R10A 1TYTA 2RHBA 2DE5A 5A2Qb 3SR6B 1AOGA 3AMZA 4BBRI 1TWHI 3GRTA 4RS4A 1BZLA 1M901 2AKMA 1N61C 2DW7A 2OO6A 4IP5A 2V3VA 2EQ9A 3CCVZ 3KLJA 4H4UA 5C3EI 3EUB3 1MDLA 2O4HA 2RT9A 3D2LA 3DGHA 2PK7A 1YJN1 1YHQ1 2JMOA 4S1TA 2PPGA 4DXKA 4EQWA 4DHGA 2HF1A 3HOUI 1STZA 1FFVC 1WZNA 2P0IA 3II4A 3HOZI 3CCLZ 3QN3A 1XDIA 3EF6A 3I07A 1RO0A 3VCNA 4M0XA 2E9HA 3FVDA 3GRSA 4RVFA 3CC4Z 2H85A 3CD6Z 2AL2A 3GTPI 1ZDLA 1NP6A 1SJBA 1YI2Z 3VMHA 2PA6A 2W54A 5KVIA 1VQK1 3UJEA 1K9M1 2ZC8A 3KUMA 3MY9A 3H3VJ 1KCZA 1EC8A 1L8PA 2HQMA 2HZGA 1YIJ1 3CC71 1JOAA 4DN1A 2DE6A 2HU9A 3DG7A 3FXGA 1DL6A 1X0TA 2QAEA 1KN0A 1YJ9Z 2R92I 2JIOA 3GCFA 3FQMA 2E3TA 2PCEA 3BSMA 3CK5A 3I6EA 1M6IA 2YAUA 3THUA 2F4MA 3VCCA 2VPZA 3IJIA 3VDGA 1SB3B 2JNYA 4EWCA 1VQP1 3ESWA 4NBHA 2LEXA 3HOVI 1XHCA 3RCYA 3TQPA 4H4ZA 2BC1A 2WOIA 2GRTA 3A7RA 3V3WA 1SJCA 3CCJ1 2PU0A 4BY7I 2OQYA 1DXLA 2HXTA 1FHUA 2P28A 2XSXA 3DEQA 4H4YA 1M1K2 2QJNA 3CCEZ 1QXFA 2V45A 2VPWA 4RV9A 2CFYA 3GD3A 4GYPC 3ZLFA 2V6OA 2PTYA 5GRTA 2OKTA 3ETRB 3TOYA 1Y8CA 3GD4A 1WUEA 3ENLA 4H4QA 3RZDI 2V8IA 1Q7Y1 4NBFA 3SBFA 4HNLA 2NVYI 2YVJA 2M48A 3CMEZ 1M1K1 4H4WA 5ENLA 5FS6A 2EQ8A 3SJNA 4MD7A 2OLAA 4IL2A 3R25A 3UGVA 3QKEA 1YEYA 3CC21 2P8BA 3CCL1 2R9ZA 3TJIA 1P43A 1RQFA 1V97A 2PGWA 4AYBA 4TNUA 1YIT1 4RVHA 2E2HI 3TWAA 3R0KA 1K731 1NUIA 3H8AA 4JDRA 1JWHC 4A3MI 1Q821 2PMQA 2WPCA 4EMJA 4GGHA 4HPNA 3SSZA 2YQUA 1KD11 1ZB8A 1YJW1 2WP5A 3BG0B 3S1QI 1JEHA 4Z17A 3A7AA 1FECA 1VQO1 2PTZA 3S1NI 4NBAA 3RZOI 1ZK7A 3OW2Y 2OOYB 3DERA 1WCMI 4E4UA 5D1OA 2MUCA 3VC5A 4Y52I 3IR7A 2YVGA 1V59A 2J3NA 1ML8A 3FJ4A 3JAMb 2GR3A 2K3RA 3BG1B 2PS2A 3FYYA 3CT2A 4JN8A 6ENLA 2WOVA 1RLYA 2QDEA 2GU2A 4KPLA 3DGBA 3SN0A 2OTLZ 1GSNA 2ZADA 3A7UA 3DG6A 2XH7A 3S5SA 2IV2X 3CCJZ 4NFRA 3U50C 2ONEA 3D47A 4IT1A 4ENLA 1TKKA 4A3II 5A2Qf 1S721 1EBHA 1FEAA 1BQGA 1R0MA 1KD12 5EBKA 1TYPA 2FKPA 4EMWA 4M52A 3ZVIA 3R0UA 4X2PA 5FLXb 4F4RA 3OPSA 3RR1A 3QFBA 1RNIA 3HOXI 2OG9A 1KQSY 4NBDA 4KEMA 5T67A 3Q45A 2JK6A 3UJRA 3T8QA 1X3ZA 4IHCA 3JVAA 2W3RA 3S15I 1K8A1 3FQQA 4Y7NI 2QLVB 1D7YA 4HNCA 5TR3A 3RO6A 2DE7A 1FDIA 3CCV1 3NH5A 2KPIA 2W3SA 2DW6A 1TE6A 2JA5I 1F3PA 4H4XA 4TVWA 3CQZI 1DNCA 2O56A 3MWCA 3S17I 3SN1A 2PGEA 1VQZA 4EMIA 2OVLA 3CPWZ 4EWJA 1GEUA 2E7ZA 5FS7A 3HOYI 3SN4A 2F4OA 2ZAEB 1GRHA 5T6BA 2EQ7A 4MKSA 3MZLB 2PODA 2GTIA 3CGEA 4HCDA 1WUFA 2EGTA 2QVHA 3CCU1 1Z01A 2BC0A 1GRAA 2WB1A 4DK1A 3MQTA 3NFUA 4E2ZA 2OOXB 3NVZB 1I50I 3CAWA 4HCLA 5FLXf 2E2II 1VQ81 2PP0A 3JZUA 1VQKZ 4J3ZA 2RDXA 3MZNA 1GRTA 5T64A 2JA8I 1VQL1 2GR1A 1GXFA 1WIIA 3CC41 1N8R1 3GTKI 3OP2A 4IZGA 2LIYA 2QA41 3NZGA 3DGZA 1VQ41 5FLMI 1GREA 1YITZ 1VDVA 5FJOA 4NBBA 1JCTA 3BOXA 1KQSZ 3DH9A 2AKZA 1FHVA 3GD6A 3S47A 1P9NA 3GTQI 2AKLA 4TVYA 1I6HI 2PP3A 4EM4A 2WPFA 2RBLA 1K83I 2WBAA 1VQOZ 3S16I 2GQWA 3UJ2A 4ADWA 1QVFZ 3QTPA 3DG3A 3G71Z 3OW2Z 3MUCA 4H2HA 1NDAA 1USPB 4HH4A 4XX2A 5LL6f 3NH4A 2P3YA 4H50A 4JN7A 3CCE1 1QVGZ 4E2XA 1K4QA 4YWSA 3UXKA 3F3FC 2W0HA 3MZKB 2WP6A 5D1OB 3J7A4 2A8XA 1VQ91 5C4XI 1NHPA 2IZ4A 3AN1A 2OPJA 5BOEA 1Y1WI 3RITA 3G711 3NRZB 4H4RA 2M6NA 4A3KI 3SQSA 3MSYA 3ES8A 2E2JI 2PSNA 2NVQI 3CYJA 2QRCB 3GKQA 3GTMS 3TJ4A 3NO1A 2JIPA 1LQLA 5KVHA 2JUBA 4G7FA 2JR6A 2Y0SA 3S1RI 1KC82 1Y1VI 3GY1A 5JCNA 2ZZ0A 3P93A 2JIMA 2X8CA 3DDMA 3N4EA 3QFAA 2BJOA 3STPA 1T3QC 2JA6I 1YQZA 1EBDA 1ZMDA 1VQLZ 1WW9A 5U25A 2NVKX 3CGDA 3M4OI 2P3ZA 2QDDA 3EERA 1KC81 1NU5A 3M3YI 3J80f 2OZ8A 1XANA 2PTWA 5D1PA 3CMA1 1GRGA 2KI7B 3K7AI 4H4TA 4A3EI 3Q4DA 4BURA 3TE5B 1KKOA 2OZKA 3EKGA 2MNRA 1Q812 2YU9I 4EQXA 4MH4A 2GGEA 2W04A 2AYDA 5FJPA 5EU9A 1W2BZ 2QEX1 4JHMA 3CC7Z 1YIJZ 1VQM1 3ZLGA 3PO3S 3LXDA 3CPWY 4BV6A 4GMEA 3CXCZ 3NVVB 4J56A 3PWGA 5AN9F 4MONA 1JPDX 4CL1A 4DGLA 2K5RA 1ONFA 1ZX9A 3OC4A 2V8JA 4J57A 4JQ9A 3CGCA 1VQ9Z 2CDUA 3J81f 5BOFA 1GRBA 4ZOHB 4IP4A 5G5GB 1WYGA 7ENLA 5IDZA 1EBGA 2CHRA 3CCRZ 4ZA0A 3NVWB 3OW1A 3TWBA 1ZKQA 4KWSA 3G4SZ 3CCM1 2VF1A 2NVXI 1NHSA 1NHRA 1I3QI 4DQYB 3HPFA 2JS4A 2PU1A 1Q811 2C3DA 3CCQZ 1Q1RA 3FV9A 2G2KA 2AL2B 3IF8A 4E30A 1N5XA 3B9JB 5JCLA 3I4KA 5U1OA 1LPFA 2QJJA 4QTTA 1VQ71 5FMHA 4BBSI 4H19A 2I3CA 2HNEA 4KT2A 3QLDA 3GTLI 1N8R2 1SIWA 3NH8A 2FYMA 3T9PA 1ELSA 1FO4A 2NQLA 3NS1B 1N63C 2IZ3A 2GGGA 3R07C 2R6MA 3DK4A 4J1OA 3RRAA 5IT9b 1MO9A 1QVFY 3I4NI 1RM6B 1N60C 3I551 3CGBA 4NOZA 4FP1A 4NBEA 1IYXA 2RABA 2X8HA 3CC2Z 3TCSA 4GIRA 3VA8A 3CXOA 4G8TA 1TWCI 2OTJ1 4EM3A 3OZYA 3D9XA 1S72Z 2PMZA 4A3JI 3PO3I 4A3GI 4MD9A 4RVDA 1K8A2 4MGGA 2POZA 5FJTA 1KRLA 3I561 3Q6JA 4FDCB 1FIQB 1OEPA 3NVYB 3PO2I 4GISA 1F9CA 1JPMA 2NAPA 1N5WC 4K8DA 4YWOA 4K8GA 1Q1WA 2QQ6A 2GSHA 3UJFA 4DYEA 1W6TA 4LIIA 4X6AI 3DK9A 3VTNA 4H83A 1PFTA 3GTMI 3IJLA 3I6TA 5FJRA 3VMGA 3P0WA 4MXUA 1R9TI 4GFIA 3GTOI 4E6MA 2O53A 1VQ8Z 3H70A 3GTGI 1H6VA 1XPYA 2V3BA 5CM2M 1Q16A 3CCMZ 1VQPZ 2GGIA 4GYPA 2GTHA 3V5FA 4GRTA 4KPRA 2XH4A 1MOKA 4HCHA 1MNSA 3QWUA 1QVGY 4K2SA 2Q4ZA 3LB8A 3ZLHA 1KD0A 2V3AA 1VLAA 2R7ZI 1VQ7Z 3DJJA 1NELA 2QR1B 3NDIA 3LADA 1N2FA 2HXUA 2QEXZ 1AA6A 2W03A 1FEBA 1FFUC 2BCPA 2VUMI 3FG2P 3URHA 3EEDA 3P3BA 3H0GI 3UXLA 1SJDA 4A3DI 1MDRA 3GO2A 3VFCA 2I5QA 5G5HB 3I55Z 3TW9A 3KIFA 5C4JI 1Q822 1QYPA 5IP7I 1GV4A 2GGHA 2GH5A 2OZTA 2OZ3A 2XH0A 3HW2A 4MMWA 2PP1A 1XS2A 4NEWA 3G4S1 5FS8A 4NH1C 2GGJA 1VQ61 3L8KA 5C44I 3CXCY 3VC6A 1YI21 3J81b 1NJI1 4HYRA 4ZCWA 3D46A 2GL5A 3BJSA 3UJSA 3R1ZA 4QTUA 3I56Z 2YVFA 2GR2A 3CCQ1 2QJMA 4EQSA 4NB9A 1L1OC 3GTJI 1KKRA 4A3CI 4E8GA 2VUGA 2OX4A 3T6CA 3FKII 2OTL1 2OQHA 3UCDA 1JRPA 1WJ2A 3ES7A 2XGZA 4A6GA 5JCIA 3HOWI 1M902 1VQ5Z 3H4KA 3FCPA 2AL1A 1YHQZ 2WOWA 2ZZBA 1ZXIC 2QA4Z 2GR0A 3T4WA 1TWFI 1USPA 2YADA 1MUCA 4IL0A 3EEZA 2B63I 3KIHA 1GETA 2PM9A 3IK4A 1QF8A 1ZY8A 2ZZCA 1E9IA 3G6E1 1VQMZ 4A3BI 4MRIA 4A93I 4A3LI 3EANA 5IT9f 2JIQA 3PG6A 4BXXI 2EQ6A 4NB8A 1BWCA 2X50A 3OZMA 3F3PC 1X3WA 3S2HI 4M6UA 1GRFA 1P48A 2J6AA 4FI4A 3H12A 2W55A 4H4SA 1N62C 3R11A 2Q51A 1GERA 3N4FA 1SJAA 3HKZA 3CCSZ 3G6EZ 1K9M2 2QRDB 3CME1 4MD8A 4NBGA 1GESA 1DTNA 2R93I 3CB3A 3V4BA 3DJGX 2VPYA 2WAQA 3ZVHA 4BY1I 4HGZA 1JDFA 4H4PA 1W2BY 1K732 2JA7I 3U4FA 2RPRA 3OTRA 1VQNZ 4H1ZA 3GC2A 1RO2A 1Y1VS 3CCS1 2P88A 3DFYA 3PFRA 2VPXA 1MRAA 5ER0A 3UCCA 4Z1YA 1YJNZ 3VB9A 1VQ6Z 2RIQA 4APNA 2QREB 3TDHB 1PDZA
chains in the Genus database with same CATH topology
1VQ4Z 3S2DI 1YUAA 1F8WA 2AAQA 3L5OA 2TPRA 3DK8A 5IP9I 3VMIA 1ZMCA 1NPXA 1TFIA 5FS9A 4E31A 2WPEA 2X8GA 2X99A 3MONA 5JCKA 3P5JB 1RO4A 4NBCA 5JRBA 1JJ2Z 2LFUA 1YJ91 2V8KA 3NDJA 4LA1A 5JCMA 3D6WA 1OJTA 3SQPA 1ZH1A 3S1MI 3CMAZ 3J80b 3EAOA 2NPXA 1H2IA 3NFZA 3I4MI 1Q861 1JJ2Y 4HGYA 1YJWZ 4A3FI 1NHQA 3CD61 4E2WA 4E33A 1Z03A 1LVLA 2F5ZA 1ZB9A 1TWGI 3IC9A 4GR1A 4H4VA 4E2YA 1VQ51 1Z02A 1S7MA 2NVTI 3RNMA 1Q862 2C3CA 3CCR1 2QKDA 1VQN1 1TWAI 4DNAA 3O0HA 3S14I 3IX0A 4FX9A 2OTJZ 1SFOI 1YUKA 4NEVA 3JAMf 4E32A 3CCUZ 3LUSA 3IFUA 4RVGA 3Q87A 1Q7Y2 1NJI2 4EQRA 4K7ZA 3T4NB 1TYTA 2RHBA 2DE5A 5A2Qb 1AOGA 4BBRI 1TWHI 3GRTA 4RS4A 1BZLA 1M901 2EQ9A 3CCVZ 3KLJA 4H4UA 5C3EI 2O4HA 2RT9A 3DGHA 2PK7A 1YJN1 1YHQ1 2JMOA 4S1TA 4EQWA 2HF1A 3HOUI 3II4A 3HOZI 3CCLZ 1XDIA 3EF6A 3I07A 1RO0A 2E9HA 3GRSA 4RVFA 3CC4Z 2H85A 3CD6Z 3GTPI 1ZDLA 1NP6A 1YI2Z 3VMHA 5KVIA 1VQK1 1K9M1 3H3VJ 2HQMA 1YIJ1 3CC71 1JOAA 2DE6A 2HU9A 1DL6A 1X0TA 2QAEA 1KN0A 1YJ9Z 2R92I 3GCFA 3FQMA 1M6IA 2YAUA 2F4MA 2JNYA 4EWCA 1VQP1 3ESWA 4NBHA 3HOVI 1XHCA 4H4ZA 2BC1A 2WOIA 2GRTA 3CCJ1 4BY7I 1DXLA 2P28A 4H4YA 1M1K2 3CCEZ 4RV9A 2CFYA 3GD3A 2V6OA 5GRTA 3GD4A 4H4QA 3RZDI 2V8IA 1Q7Y1 4NBFA 2NVYI 2YVJA 2M48A 3CMEZ 1M1K1 4H4WA 5FS6A 2EQ8A 4MD7A 3CC21 3CCL1 2R9ZA 1RQFA 4AYBA 4TNUA 1YIT1 4RVHA 2E2HI 4JDRA 1K731 1NUIA 1JWHC 4A3MI 1Q821 2WPCA 4EMJA 2YQUA 1KD11 1ZB8A 1YJW1 2WP5A 3BG0B 3S1QI 1JEHA 1FECA 1VQO1 3S1NI 4NBAA 3RZOI 1ZK7A 3OW2Y 2OOYB 1WCMI 5D1OA 4Y52I 2YVGA 1V59A 2J3NA 1ML8A 3JAMb 2GR3A 2K3RA 3BG1B 2WOVA 1RLYA 2GU2A 2OTLZ 1GSNA 3CCJZ 4NFRA 3U50C 4A3II 5A2Qf 1S721 1FEAA 1KD12 5EBKA 1TYPA 4EMWA 4M52A 5FLXb 3QFBA 1RNIA 3HOXI 1KQSY 4NBDA 5T67A 2JK6A 1X3ZA 3S15I 1K8A1 3FQQA 4Y7NI 2QLVB 1D7YA 5TR3A 2DE7A 3CCV1 3NH5A 2KPIA 2JA5I 1F3PA 4H4XA 3CQZI 1DNCA 3S17I 4EMIA 3CPWZ 1GEUA 5FS7A 3HOYI 2F4OA 2ZAEB 1GRHA 5T6BA 2EQ7A 3MZLB 2GTIA 3CGEA 2EGTA 3CCU1 1Z01A 2BC0A 1GRAA 2WB1A 4DK1A 4E2ZA 2OOXB 1I50I 5FLXf 2E2II 1VQ81 1VQKZ 1GRTA 5T64A 2JA8I 1VQL1 2GR1A 1GXFA 1WIIA 3CC41 1N8R1 3GTKI 2LIYA 2QA41 3DGZA 1VQ41 5FLMI 1GREA 1YITZ 4NBBA 3DH9A 1KQSZ 1P9NA 3GTQI 2AKLA 1I6HI 4EM4A 2WPFA 2RBLA 1K83I 2WBAA 1VQOZ 3S16I 2GQWA 4ADWA 1QVFZ 3G71Z 3OW2Z 1NDAA 1USPB 4HH4A 4XX2A 5LL6f 3NH4A 2P3YA 4H50A 3CCE1 1QVGZ 4E2XA 1K4QA 3F3FC 2W0HA 3MZKB 2WP6A 5D1OB 3J7A4 2A8XA 1VQ91 5C4XI 1NHPA 2IZ4A 1Y1WI 3G711 4H4RA 2M6NA 4A3KI 2E2JI 2NVQI 2QRCB 3GKQA 3GTMS 5KVHA 1LQLA 2JUBA 2JR6A 2Y0SA 3S1RI 1KC82 1Y1VI 5JCNA 2ZZ0A 2X8CA 3QFAA 2BJOA 2JA6I 1YQZA 1EBDA 1ZMDA 1VQLZ 1WW9A 5U25A 2NVKX 3CGDA 3M4OI 3EERA 1KC81 3M3YI 3J80f 1XANA 5D1PA 3CMA1 1GRGA 2KI7B 3K7AI 4H4TA 4A3EI 4BURA 3TE5B 2OZKA 1Q812 2YU9I 4EQXA 4MH4A 2W04A 1W2BZ 2QEX1 3CC7Z 1YIJZ 1VQM1 3PO3S 3LXDA 3CPWY 4BV6A 3CXCZ 4J56A 5AN9F 4MONA 1ONFA 4CL1A 4DGLA 2K5RA 1ZX9A 3OC4A 4J57A 2V8JA 4JQ9A 3CGCA 1VQ9Z 2CDUA 3J81f 1GRBA 3CCRZ 1ZKQA 3G4SZ 3CCM1 2VF1A 2NVXI 1NHSA 1NHRA 1I3QI 4DQYB 2JS4A 1Q811 2C3DA 3CCQZ 1Q1RA 2G2KA 3IF8A 4E30A 5JCLA 5U1OA 1LPFA 4QTTA 1VQ71 5FMHA 4BBSI 2I3CA 3GTLI 1N8R2 3NH8A 2IZ3A 2R6MA 3DK4A 5IT9b 1MO9A 1QVFY 3I4NI 4KPRA 3CGBA 3I551 4NOZA 4NBEA 2X8HA 2RABA 3CC2Z 1TWCI 2OTJ1 4EM3A 1S72Z 3D9XA 2PMZA 4A3JI 3PO3I 4A3GI 4MD9A 4RVDA 1K8A2 1KRLA 3I561 3Q6JA 4FDCB 3PO2I 4K8DA 4YWOA 1Q1WA 4LIIA 4X6AI 3DK9A 3VTNA 1PFTA 3GTMI 3VMGA 4MXUA 1R9TI 3GTOI 2O53A 1VQ8Z 3GTGI 1H6VA 2V3BA 5CM2M 1VQPZ 3CCMZ 2GTHA 4GRTA 1MOKA 3QWUA 1QVGY 2Q4ZA 3LB8A 2V3AA 1VLAA 2R7ZI 1VQ7Z 3DJJA 2QR1B 3NDIA 3LADA 1N2FA 2QEXZ 1FEBA 2W03A 2BCPA 3URHA 2VUMI 3FG2P 3EEDA 3H0GI 4A3DI 3I55Z 3KIFA 5C4JI 1Q822 1QYPA 5IP7I 1GV4A 2GH5A 4NEWA 3G4S1 5FS8A 4NH1C 1VQ61 3L8KA 5C44I 3CXCY 1YI21 3J81b 1NJI1 4QTUA 3I56Z 2YVFA 2GR2A 3CCQ1 4EQSA 4NB9A 1L1OC 3GTJI 4A3CI 2VUGA 3FKII 2OTL1 5JCIA 3HOWI 1M902 1VQ5Z 3H4KA 1YHQZ 2WOWA 2ZZBA 2QA4Z 2GR0A 1TWFI 1USPA 2YADA 2B63I 3KIHA 1GETA 2PM9A 1QF8A 1ZY8A 2ZZCA 3G6E1 1VQMZ 4A3BI 4MRIA 4A93I 4A3LI 3EANA 5IT9f 3PG6A 4BXXI 2EQ6A 4NB8A 1BWCA 2X50A 3F3PC 1X3WA 3S2HI 1GRFA 2J6AA 4H4SA 2Q51A 1GERA 3HKZA 3CCSZ 3G6EZ 1K9M2 2QRDB 3CME1 4MD8A 4NBGA 1GESA 2R93I 3DJGX 2WAQA 4BY1I 4HGZA 4H4PA 1W2BY 1K732 2JA7I 2RPRA 1VQNZ 1RO2A 1Y1VS 3CCS1 5ER0A 1YJNZ 3VB9A 1VQ6Z 2RIQA 4APNA 2QREB 3TDHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9X A;  1S7M A; 
#chains in the Genus database with same CATH topology
 1VQ4 Z;  3TTE A;  5FJU A;  3S2D I;  3MKC A;  1YUA A;  1F8W A;  1EC7 A;  2AAQ A;  3AM9 A;  2TPR A;  3L5O A;  3DK8 A;  5IP9 I;  3VMI A;  1RVK A;  1ZMC A;  4A3R A;  1NPX A;  1TFI A;  2GDQ A;  3CXB A;  3N6H A;  4E31 A;  3N6J A;  5FS9 A;  2WPE A;  2X8G A;  2X99 A;  3MON A;  5JCK A;  4K1W A;  1BKH A;  4E4F A;  2E5A A;  3P5J B;  1RO4 A;  4NBC A;  3B97 A;  3DES A;  5JRB A;  1JJ2 Z;  1ECQ A;  2LFU A;  1X2H A;  1YJ9 1;  2V8K A;  3U9I A;  4DX3 A;  3NDJ A;  4LA1 A;  5JCM A;  3D6W A;  1OJT A;  3DFH A;  3DIP A;  3SQP A;  1ZH1 A;  3S1M I;  3CMA Z;  3J80 b;  3EAO A;  4A35 A;  2PTX A;  2NPX A;  1FDO A;  1H2I A;  3NFZ A;  3I4M I;  1Q86 1;  1JJ2 Y;  4HGY A;  3H7V A;  1YJW Z;  3QPE A;  1ONE A;  4A3F I;  1NHQ A;  1PDY A;  1EC9 A;  3CD6 1;  4ROP A;  3NXL A;  2OFJ A;  4E2W A;  4E33 A;  2QGY A;  2XH2 A;  1Z03 A;  3ZVH B;  1LVL A;  2F5Z A;  1ZB9 A;  1TWG I;  1TZZ A;  1X2G A;  3IC9 A;  4GR1 A;  4H4V A;  3RGT A;  4E2Y A;  1VQ5 1;  1Z02 A;  3V5C A;  1S7M A;  3HRD C;  2NVT I;  3RNM A;  3PK7 A;  4HN8 A;  1Q86 2;  2C3C A;  3CCR 1;  3K1G A;  4DWD A;  2QKD A;  1VQN 1;  3JW7 A;  1TWA I;  4DNA A;  4E5T A;  2P8C A;  3O0H A;  3S14 I;  3IX0 A;  3PWI A;  4FX9 A;  2OTJ Z;  1SFO I;  4GGB A;  1YUK A;  4NEV A;  3JAM f;  4E32 A;  1R6W A;  3CCU Z;  5J04 A;  2JIR A;  3LUS A;  3IFU A;  4RVG A;  1JRO A;  3Q87 A;  1Q7Y 2;  1NJI 2;  3IJQ A;  4K7Z A;  3T4N B;  4EQR A;  3R10 A;  1TYT A;  2RHB A;  2DE5 A;  5A2Q b;  3SR6 B;  1AOG A;  3AMZ A;  4BBR I;  1TWH I;  3GRT A;  4RS4 A;  1BZL A;  1M90 1;  2AKM A;  1N61 C;  2DW7 A;  2OO6 A;  4IP5 A;  2V3V A;  2EQ9 A;  3CCV Z;  3KLJ A;  4H4U A;  5C3E I;  3EUB 3;  1MDL A;  2O4H A;  2RT9 A;  3D2L A;  3DGH A;  2PK7 A;  1YJN 1;  1YHQ 1;  2JMO A;  4S1T A;  2PPG A;  4DXK A;  4EQW A;  4DHG A;  2HF1 A;  3HOU I;  1STZ A;  1FFV C;  1WZN A;  2P0I A;  3II4 A;  3HOZ I;  3CCL Z;  3QN3 A;  1XDI A;  3EF6 A;  3I07 A;  1RO0 A;  3VCN A;  4M0X A;  2E9H A;  3FVD A;  3GRS A;  4RVF A;  3CC4 Z;  2H85 A;  3CD6 Z;  2AL2 A;  3GTP I;  1ZDL A;  1NP6 A;  1SJB A;  1YI2 Z;  3VMH A;  2PA6 A;  2W54 A;  5KVI A;  1VQK 1;  3UJE A;  1K9M 1;  2ZC8 A;  3KUM A;  3MY9 A;  3H3V J;  1KCZ A;  1EC8 A;  1L8P A;  2HQM A;  2HZG A;  1YIJ 1;  3CC7 1;  1JOA A;  4DN1 A;  2DE6 A;  2HU9 A;  3DG7 A;  3FXG A;  1DL6 A;  1X0T A;  2QAE A;  1KN0 A;  1YJ9 Z;  2R92 I;  2JIO A;  3GCF A;  3FQM A;  2E3T A;  2PCE A;  3BSM A;  3CK5 A;  3I6E A;  1M6I A;  2YAU A;  3THU A;  2F4M A;  3VCC A;  2VPZ A;  3IJI A;  3VDG A;  1SB3 B;  2JNY A;  4EWC A;  1VQP 1;  3ESW A;  4NBH A;  2LEX A;  3HOV I;  1XHC A;  3RCY A;  3TQP A;  4H4Z A;  2BC1 A;  2WOI A;  2GRT A;  3A7R A;  3V3W A;  1SJC A;  3CCJ 1;  2PU0 A;  4BY7 I;  2OQY A;  1DXL A;  2HXT A;  1FHU A;  2P28 A;  2XSX A;  3DEQ A;  4H4Y A;  1M1K 2;  2QJN A;  3CCE Z;  1QXF A;  2V45 A;  2VPW A;  4RV9 A;  2CFY A;  3GD3 A;  4GYP C;  3ZLF A;  2V6O A;  2PTY A;  5GRT A;  2OKT A;  3ETR B;  3TOY A;  1Y8C A;  3GD4 A;  1WUE A;  3ENL A;  4H4Q A;  3RZD I;  2V8I A;  1Q7Y 1;  4NBF A;  3SBF A;  4HNL A;  2NVY I;  2YVJ A;  2M48 A;  3CME Z;  1M1K 1;  4H4W A;  5ENL A;  5FS6 A;  2EQ8 A;  3SJN A;  4MD7 A;  2OLA A;  4IL2 A;  3R25 A;  3UGV A;  3QKE A;  1YEY A;  3CC2 1;  2P8B A;  3CCL 1;  2R9Z A;  3TJI A;  1P43 A;  1RQF A;  1V97 A;  2PGW A;  4AYB A;  4TNU A;  1YIT 1;  4RVH A;  2E2H I;  3TWA A;  3R0K A;  1K73 1;  1NUI A;  3H8A A;  4JDR A;  1JWH C;  4A3M I;  1Q82 1;  2PMQ A;  2WPC A;  4EMJ A;  4GGH A;  4HPN A;  3SSZ A;  2YQU A;  1KD1 1;  1ZB8 A;  1YJW 1;  2WP5 A;  3BG0 B;  3S1Q I;  1JEH A;  4Z17 A;  3A7A A;  1FEC A;  1VQO 1;  2PTZ A;  3S1N I;  4NBA A;  3RZO I;  1ZK7 A;  3OW2 Y;  2OOY B;  3DER A;  1WCM I;  4E4U A;  5D1O A;  2MUC A;  3VC5 A;  4Y52 I;  3IR7 A;  2YVG A;  1V59 A;  2J3N A;  1ML8 A;  3FJ4 A;  3JAM b;  2GR3 A;  2K3R A;  3BG1 B;  2PS2 A;  3FYY A;  3CT2 A;  4JN8 A;  6ENL A;  2WOV A;  1RLY A;  2QDE A;  2GU2 A;  4KPL A;  3DGB A;  3SN0 A;  2OTL Z;  1GSN A;  2ZAD A;  3A7U A;  3DG6 A;  2XH7 A;  3S5S A;  2IV2 X;  3CCJ Z;  4NFR A;  3U50 C;  2ONE A;  3D47 A;  4IT1 A;  4ENL A;  1TKK A;  4A3I I;  5A2Q f;  1S72 1;  1EBH A;  1FEA A;  1BQG A;  1R0M A;  1KD1 2;  5EBK A;  1TYP A;  2FKP A;  4EMW A;  4M52 A;  3ZVI A;  3R0U A;  4X2P A;  5FLX b;  4F4R A;  3OPS A;  3RR1 A;  3QFB A;  1RNI A;  3HOX I;  2OG9 A;  1KQS Y;  4NBD A;  4KEM A;  5T67 A;  3Q45 A;  2JK6 A;  3UJR A;  3T8Q A;  1X3Z A;  4IHC A;  3JVA A;  2W3R A;  3S15 I;  1K8A 1;  3FQQ A;  4Y7N I;  2QLV B;  1D7Y A;  4HNC A;  5TR3 A;  3RO6 A;  2DE7 A;  1FDI A;  3CCV 1;  3NH5 A;  2KPI A;  2W3S A;  2DW6 A;  1TE6 A;  2JA5 I;  1F3P A;  4H4X A;  4TVW A;  3CQZ I;  1DNC A;  2O56 A;  3MWC A;  3S17 I;  3SN1 A;  2PGE A;  1VQZ A;  4EMI A;  2OVL A;  3CPW Z;  4EWJ A;  1GEU A;  2E7Z A;  5FS7 A;  3HOY I;  3SN4 A;  2F4O A;  2ZAE B;  1GRH A;  5T6B A;  2EQ7 A;  4MKS A;  3MZL B;  2POD A;  2GTI A;  3CGE A;  4HCD A;  1WUF A;  2EGT A;  2QVH A;  3CCU 1;  1Z01 A;  2BC0 A;  1GRA A;  2WB1 A;  4DK1 A;  3MQT A;  3NFU A;  4E2Z A;  2OOX B;  3NVZ B;  1I50 I;  3CAW A;  4HCL A;  5FLX f;  2E2I I;  1VQ8 1;  2PP0 A;  3JZU A;  1VQK Z;  4J3Z A;  2RDX A;  3MZN A;  1GRT A;  5T64 A;  2JA8 I;  1VQL 1;  2GR1 A;  1GXF A;  1WII A;  3CC4 1;  1N8R 1;  3GTK I;  3OP2 A;  4IZG A;  2LIY A;  2QA4 1;  3NZG A;  3DGZ A;  1VQ4 1;  5FLM I;  1GRE A;  1YIT Z;  1VDV A;  5FJO A;  4NBB A;  1JCT A;  3BOX A;  1KQS Z;  3DH9 A;  2AKZ A;  1FHV A;  3GD6 A;  3S47 A;  1P9N A;  3GTQ I;  2AKL A;  4TVY A;  1I6H I;  2PP3 A;  4EM4 A;  2WPF A;  2RBL A;  1K83 I;  2WBA A;  1VQO Z;  3S16 I;  2GQW A;  3UJ2 A;  4ADW A;  1QVF Z;  3QTP A;  3DG3 A;  3G71 Z;  3OW2 Z;  3MUC A;  4H2H A;  1NDA A;  1USP B;  4HH4 A;  4XX2 A;  5LL6 f;  3NH4 A;  2P3Y A;  4H50 A;  4JN7 A;  3CCE 1;  1QVG Z;  4E2X A;  1K4Q A;  4YWS A;  3UXK A;  3F3F C;  2W0H A;  3MZK B;  2WP6 A;  5D1O B;  3J7A 4;  2A8X A;  1VQ9 1;  5C4X I;  1NHP A;  2IZ4 A;  3AN1 A;  2OPJ A;  5BOE A;  1Y1W I;  3RIT A;  3G71 1;  3NRZ B;  4H4R A;  2M6N A;  4A3K I;  3SQS A;  3MSY A;  3ES8 A;  2E2J I;  2PSN A;  2NVQ I;  3CYJ A;  2QRC B;  3GKQ A;  3GTM S;  3TJ4 A;  3NO1 A;  2JIP A;  1LQL A;  5KVH A;  2JUB A;  4G7F A;  2JR6 A;  2Y0S A;  3S1R I;  1KC8 2;  1Y1V I;  3GY1 A;  5JCN A;  2ZZ0 A;  3P93 A;  2JIM A;  2X8C A;  3DDM A;  3N4E A;  3QFA A;  2BJO A;  3STP A;  1T3Q C;  2JA6 I;  1YQZ A;  1EBD A;  1ZMD A;  1VQL Z;  1WW9 A;  5U25 A;  2NVK X;  3CGD A;  3M4O I;  2P3Z A;  2QDD A;  3EER A;  1KC8 1;  1NU5 A;  3M3Y I;  3J80 f;  2OZ8 A;  1XAN A;  2PTW A;  5D1P A;  3CMA 1;  1GRG A;  2KI7 B;  3K7A I;  4H4T A;  4A3E I;  3Q4D A;  4BUR A;  3TE5 B;  1KKO A;  2OZK A;  3EKG A;  2MNR A;  1Q81 2;  2YU9 I;  4EQX A;  4MH4 A;  2GGE A;  2W04 A;  2AYD A;  5FJP A;  5EU9 A;  1W2B Z;  2QEX 1;  4JHM A;  3CC7 Z;  1YIJ Z;  1VQM 1;  3ZLG A;  3PO3 S;  3LXD A;  3CPW Y;  4BV6 A;  4GME A;  3CXC Z;  3NVV B;  4J56 A;  3PWG A;  5AN9 F;  4MON A;  1JPD X;  4CL1 A;  4DGL A;  2K5R A;  1ONF A;  1ZX9 A;  3OC4 A;  2V8J A;  4J57 A;  4JQ9 A;  3CGC A;  1VQ9 Z;  2CDU A;  3J81 f;  5BOF A;  1GRB A;  4ZOH B;  4IP4 A;  5G5G B;  1WYG A;  7ENL A;  5IDZ A;  1EBG A;  2CHR A;  3CCR Z;  4ZA0 A;  3NVW B;  3OW1 A;  3TWB A;  1ZKQ A;  4KWS A;  3G4S Z;  3CCM 1;  2VF1 A;  2NVX I;  1NHS A;  1NHR A;  1I3Q I;  4DQY B;  3HPF A;  2JS4 A;  2PU1 A;  1Q81 1;  2C3D A;  3CCQ Z;  1Q1R A;  3FV9 A;  2G2K A;  2AL2 B;  3IF8 A;  4E30 A;  1N5X A;  3B9J B;  5JCL A;  3I4K A;  5U1O A;  1LPF A;  2QJJ A;  4QTT A;  1VQ7 1;  5FMH A;  4BBS I;  4H19 A;  2I3C A;  2HNE A;  4KT2 A;  3QLD A;  3GTL I;  1N8R 2;  1SIW A;  3NH8 A;  2FYM A;  3T9P A;  1ELS A;  1FO4 A;  2NQL A;  3NS1 B;  1N63 C;  2IZ3 A;  2GGG A;  3R07 C;  2R6M A;  3DK4 A;  4J1O A;  3RRA A;  5IT9 b;  1MO9 A;  1QVF Y;  3I4N I;  1RM6 B;  1N60 C;  3I55 1;  3CGB A;  4NOZ A;  4FP1 A;  4NBE A;  1IYX A;  2RAB A;  2X8H A;  3CC2 Z;  3TCS A;  4GIR A;  3VA8 A;  3CXO A;  4G8T A;  1TWC I;  2OTJ 1;  4EM3 A;  3OZY A;  3D9X A;  1S72 Z;  2PMZ A;  4A3J I;  3PO3 I;  4A3G I;  4MD9 A;  4RVD A;  1K8A 2;  4MGG A;  2POZ A;  5FJT A;  1KRL A;  3I56 1;  3Q6J A;  4FDC B;  1FIQ B;  1OEP A;  3NVY B;  3PO2 I;  4GIS A;  1F9C A;  1JPM A;  2NAP A;  1N5W C;  4K8D A;  4YWO A;  4K8G A;  1Q1W A;  2QQ6 A;  2GSH A;  3UJF A;  4DYE A;  1W6T A;  4LII A;  4X6A I;  3DK9 A;  3VTN A;  4H83 A;  1PFT A;  3GTM I;  3IJL A;  3I6T A;  5FJR A;  3VMG A;  3P0W A;  4MXU A;  1R9T I;  4GFI A;  3GTO I;  4E6M A;  2O53 A;  1VQ8 Z;  3H70 A;  3GTG I;  1H6V A;  1XPY A;  2V3B A;  5CM2 M;  1Q16 A;  3CCM Z;  1VQP Z;  2GGI A;  4GYP A;  2GTH A;  3V5F A;  4GRT A;  4KPR A;  2XH4 A;  1MOK A;  4HCH A;  1MNS A;  3QWU A;  1QVG Y;  4K2S A;  2Q4Z A;  3LB8 A;  3ZLH A;  1KD0 A;  2V3A A;  1VLA A;  2R7Z I;  1VQ7 Z;  3DJJ A;  1NEL A;  2QR1 B;  3NDI A;  3LAD A;  1N2F A;  2HXU A;  2QEX Z;  1AA6 A;  2W03 A;  1FEB A;  1FFU C;  2BCP A;  2VUM I;  3FG2 P;  3URH A;  3EED A;  3P3B A;  3H0G I;  3UXL A;  1SJD A;  4A3D I;  1MDR A;  3GO2 A;  3VFC A;  2I5Q A;  5G5H B;  3I55 Z;  3TW9 A;  3KIF A;  5C4J I;  1Q82 2;  1QYP A;  5IP7 I;  1GV4 A;  2GGH A;  2GH5 A;  2OZT A;  2OZ3 A;  2XH0 A;  3HW2 A;  4MMW A;  2PP1 A;  1XS2 A;  4NEW A;  3G4S 1;  5FS8 A;  4NH1 C;  2GGJ A;  1VQ6 1;  3L8K A;  5C44 I;  3CXC Y;  3VC6 A;  1YI2 1;  3J81 b;  1NJI 1;  4HYR A;  4ZCW A;  3D46 A;  2GL5 A;  3BJS A;  3UJS A;  3R1Z A;  4QTU A;  3I56 Z;  2YVF A;  2GR2 A;  3CCQ 1;  2QJM A;  4EQS A;  4NB9 A;  1L1O C;  3GTJ I;  1KKR A;  4A3C I;  4E8G A;  2VUG A;  2OX4 A;  3T6C A;  3FKI I;  2OTL 1;  2OQH A;  3UCD A;  1JRP A;  1WJ2 A;  3ES7 A;  2XGZ A;  4A6G A;  5JCI A;  3HOW I;  1M90 2;  1VQ5 Z;  3H4K A;  3FCP A;  2AL1 A;  1YHQ Z;  2WOW A;  2ZZB A;  1ZXI C;  2QA4 Z;  2GR0 A;  3T4W A;  1TWF I;  1USP A;  2YAD A;  1MUC A;  4IL0 A;  3EEZ A;  2B63 I;  3KIH A;  1GET A;  2PM9 A;  3IK4 A;  1QF8 A;  1ZY8 A;  2ZZC A;  1E9I A;  3G6E 1;  1VQM Z;  4A3B I;  4MRI A;  4A93 I;  4A3L I;  3EAN A;  5IT9 f;  2JIQ A;  3PG6 A;  4BXX I;  2EQ6 A;  4NB8 A;  1BWC A;  2X50 A;  3OZM A;  3F3P C;  1X3W A;  3S2H I;  4M6U A;  1GRF A;  1P48 A;  2J6A A;  4FI4 A;  3H12 A;  2W55 A;  4H4S A;  1N62 C;  3R11 A;  2Q51 A;  1GER A;  3N4F A;  1SJA A;  3HKZ A;  3CCS Z;  3G6E Z;  1K9M 2;  2QRD B;  3CME 1;  4MD8 A;  4NBG A;  1GES A;  1DTN A;  2R93 I;  3CB3 A;  3V4B A;  3DJG X;  2VPY A;  2WAQ A;  3ZVH A;  4BY1 I;  4HGZ A;  1JDF A;  4H4P A;  1W2B Y;  1K73 2;  2JA7 I;  3U4F A;  2RPR A;  3OTR A;  1VQN Z;  4H1Z A;  3GC2 A;  1RO2 A;  1Y1V S;  3CCS 1;  2P88 A;  3DFY A;  3PFR A;  2VPX A;  1MRA A;  5ER0 A;  3UCC A;  4Z1Y A;  1YJN Z;  3VB9 A;  1VQ6 Z;  2RIQ A;  4APN A;  2QRE B;  3TDH B;  1PDZ A; 
#chains in the Genus database with same CATH homology
 1VQ4 Z;  3S2D I;  1YUA A;  1F8W A;  2AAQ A;  3L5O A;  2TPR A;  3DK8 A;  5IP9 I;  3VMI A;  1ZMC A;  1NPX A;  1TFI A;  5FS9 A;  4E31 A;  2WPE A;  2X8G A;  2X99 A;  3MON A;  5JCK A;  3P5J B;  1RO4 A;  4NBC A;  5JRB A;  1JJ2 Z;  2LFU A;  1YJ9 1;  2V8K A;  3NDJ A;  4LA1 A;  5JCM A;  3D6W A;  1OJT A;  3SQP A;  1ZH1 A;  3S1M I;  3CMA Z;  3J80 b;  3EAO A;  2NPX A;  1H2I A;  3NFZ A;  3I4M I;  1Q86 1;  1JJ2 Y;  4HGY A;  1YJW Z;  4A3F I;  1NHQ A;  3CD6 1;  4E2W A;  4E33 A;  1Z03 A;  1LVL A;  2F5Z A;  1ZB9 A;  1TWG I;  3IC9 A;  4GR1 A;  4H4V A;  4E2Y A;  1VQ5 1;  1Z02 A;  1S7M A;  2NVT I;  3RNM A;  1Q86 2;  2C3C A;  3CCR 1;  2QKD A;  1VQN 1;  1TWA I;  4DNA A;  3O0H A;  3S14 I;  3IX0 A;  4FX9 A;  2OTJ Z;  1SFO I;  1YUK A;  4NEV A;  3JAM f;  4E32 A;  3CCU Z;  3LUS A;  3IFU A;  4RVG A;  3Q87 A;  1Q7Y 2;  1NJI 2;  4EQR A;  4K7Z A;  3T4N B;  1TYT A;  2RHB A;  2DE5 A;  5A2Q b;  1AOG A;  4BBR I;  1TWH I;  3GRT A;  4RS4 A;  1BZL A;  1M90 1;  2EQ9 A;  3CCV Z;  3KLJ A;  4H4U A;  5C3E I;  2O4H A;  2RT9 A;  3DGH A;  2PK7 A;  1YJN 1;  1YHQ 1;  2JMO A;  4S1T A;  4EQW A;  2HF1 A;  3HOU I;  3II4 A;  3HOZ I;  3CCL Z;  1XDI A;  3EF6 A;  3I07 A;  1RO0 A;  2E9H A;  3GRS A;  4RVF A;  3CC4 Z;  2H85 A;  3CD6 Z;  3GTP I;  1ZDL A;  1NP6 A;  1YI2 Z;  3VMH A;  5KVI A;  1VQK 1;  1K9M 1;  3H3V J;  2HQM A;  1YIJ 1;  3CC7 1;  1JOA A;  2DE6 A;  2HU9 A;  1DL6 A;  1X0T A;  2QAE A;  1KN0 A;  1YJ9 Z;  2R92 I;  3GCF A;  3FQM A;  1M6I A;  2YAU A;  2F4M A;  2JNY A;  4EWC A;  1VQP 1;  3ESW A;  4NBH A;  3HOV I;  1XHC A;  4H4Z A;  2BC1 A;  2WOI A;  2GRT A;  3CCJ 1;  4BY7 I;  1DXL A;  2P28 A;  4H4Y A;  1M1K 2;  3CCE Z;  4RV9 A;  2CFY A;  3GD3 A;  2V6O A;  5GRT A;  3GD4 A;  4H4Q A;  3RZD I;  2V8I A;  1Q7Y 1;  4NBF A;  2NVY I;  2YVJ A;  2M48 A;  3CME Z;  1M1K 1;  4H4W A;  5FS6 A;  2EQ8 A;  4MD7 A;  3CC2 1;  3CCL 1;  2R9Z A;  1RQF A;  4AYB A;  4TNU A;  1YIT 1;  4RVH A;  2E2H I;  4JDR A;  1K73 1;  1NUI A;  1JWH C;  4A3M I;  1Q82 1;  2WPC A;  4EMJ A;  2YQU A;  1KD1 1;  1ZB8 A;  1YJW 1;  2WP5 A;  3BG0 B;  3S1Q I;  1JEH A;  1FEC A;  1VQO 1;  3S1N I;  4NBA A;  3RZO I;  1ZK7 A;  3OW2 Y;  2OOY B;  1WCM I;  5D1O A;  4Y52 I;  2YVG A;  1V59 A;  2J3N A;  1ML8 A;  3JAM b;  2GR3 A;  2K3R A;  3BG1 B;  2WOV A;  1RLY A;  2GU2 A;  2OTL Z;  1GSN A;  3CCJ Z;  4NFR A;  3U50 C;  4A3I I;  5A2Q f;  1S72 1;  1FEA A;  1KD1 2;  5EBK A;  1TYP A;  4EMW A;  4M52 A;  5FLX b;  3QFB A;  1RNI A;  3HOX I;  1KQS Y;  4NBD A;  5T67 A;  2JK6 A;  1X3Z A;  3S15 I;  1K8A 1;  3FQQ A;  4Y7N I;  2QLV B;  1D7Y A;  5TR3 A;  2DE7 A;  3CCV 1;  3NH5 A;  2KPI A;  2JA5 I;  1F3P A;  4H4X A;  3CQZ I;  1DNC A;  3S17 I;  4EMI A;  3CPW Z;  1GEU A;  5FS7 A;  3HOY I;  2F4O A;  2ZAE B;  1GRH A;  5T6B A;  2EQ7 A;  3MZL B;  2GTI A;  3CGE A;  2EGT A;  3CCU 1;  1Z01 A;  2BC0 A;  1GRA A;  2WB1 A;  4DK1 A;  4E2Z A;  2OOX B;  1I50 I;  5FLX f;  2E2I I;  1VQ8 1;  1VQK Z;  1GRT A;  5T64 A;  2JA8 I;  1VQL 1;  2GR1 A;  1GXF A;  1WII A;  3CC4 1;  1N8R 1;  3GTK I;  2LIY A;  2QA4 1;  3DGZ A;  1VQ4 1;  5FLM I;  1GRE A;  1YIT Z;  4NBB A;  3DH9 A;  1KQS Z;  1P9N A;  3GTQ I;  2AKL A;  1I6H I;  4EM4 A;  2WPF A;  2RBL A;  1K83 I;  2WBA A;  1VQO Z;  3S16 I;  2GQW A;  4ADW A;  1QVF Z;  3G71 Z;  3OW2 Z;  1NDA A;  1USP B;  4HH4 A;  4XX2 A;  5LL6 f;  3NH4 A;  2P3Y A;  4H50 A;  3CCE 1;  1QVG Z;  4E2X A;  1K4Q A;  3F3F C;  2W0H A;  3MZK B;  2WP6 A;  5D1O B;  3J7A 4;  2A8X A;  1VQ9 1;  5C4X I;  1NHP A;  2IZ4 A;  1Y1W I;  3G71 1;  4H4R A;  2M6N A;  4A3K I;  2E2J I;  2NVQ I;  2QRC B;  3GKQ A;  3GTM S;  5KVH A;  1LQL A;  2JUB A;  2JR6 A;  2Y0S A;  3S1R I;  1KC8 2;  1Y1V I;  5JCN A;  2ZZ0 A;  2X8C A;  3QFA A;  2BJO A;  2JA6 I;  1YQZ A;  1EBD A;  1ZMD A;  1VQL Z;  1WW9 A;  5U25 A;  2NVK X;  3CGD A;  3M4O I;  3EER A;  1KC8 1;  3M3Y I;  3J80 f;  1XAN A;  5D1P A;  3CMA 1;  1GRG A;  2KI7 B;  3K7A I;  4H4T A;  4A3E I;  4BUR A;  3TE5 B;  2OZK A;  1Q81 2;  2YU9 I;  4EQX A;  4MH4 A;  2W04 A;  1W2B Z;  2QEX 1;  3CC7 Z;  1YIJ Z;  1VQM 1;  3PO3 S;  3LXD A;  3CPW Y;  4BV6 A;  3CXC Z;  4J56 A;  5AN9 F;  4MON A;  1ONF A;  4CL1 A;  4DGL A;  2K5R A;  1ZX9 A;  3OC4 A;  4J57 A;  2V8J A;  4JQ9 A;  3CGC A;  1VQ9 Z;  2CDU A;  3J81 f;  1GRB A;  3CCR Z;  1ZKQ A;  3G4S Z;  3CCM 1;  2VF1 A;  2NVX I;  1NHS A;  1NHR A;  1I3Q I;  4DQY B;  2JS4 A;  1Q81 1;  2C3D A;  3CCQ Z;  1Q1R A;  2G2K A;  3IF8 A;  4E30 A;  5JCL A;  5U1O A;  1LPF A;  4QTT A;  1VQ7 1;  5FMH A;  4BBS I;  2I3C A;  3GTL I;  1N8R 2;  3NH8 A;  2IZ3 A;  2R6M A;  3DK4 A;  5IT9 b;  1MO9 A;  1QVF Y;  3I4N I;  4KPR A;  3CGB A;  3I55 1;  4NOZ A;  4NBE A;  2X8H A;  2RAB A;  3CC2 Z;  1TWC I;  2OTJ 1;  4EM3 A;  1S72 Z;  3D9X A;  2PMZ A;  4A3J I;  3PO3 I;  4A3G I;  4MD9 A;  4RVD A;  1K8A 2;  1KRL A;  3I56 1;  3Q6J A;  4FDC B;  3PO2 I;  4K8D A;  4YWO A;  1Q1W A;  4LII A;  4X6A I;  3DK9 A;  3VTN A;  1PFT A;  3GTM I;  3VMG A;  4MXU A;  1R9T I;  3GTO I;  2O53 A;  1VQ8 Z;  3GTG I;  1H6V A;  2V3B A;  5CM2 M;  1VQP Z;  3CCM Z;  2GTH A;  4GRT A;  1MOK A;  3QWU A;  1QVG Y;  2Q4Z A;  3LB8 A;  2V3A A;  1VLA A;  2R7Z I;  1VQ7 Z;  3DJJ A;  2QR1 B;  3NDI A;  3LAD A;  1N2F A;  2QEX Z;  1FEB A;  2W03 A;  2BCP A;  3URH A;  2VUM I;  3FG2 P;  3EED A;  3H0G I;  4A3D I;  3I55 Z;  3KIF A;  5C4J I;  1Q82 2;  1QYP A;  5IP7 I;  1GV4 A;  2GH5 A;  4NEW A;  3G4S 1;  5FS8 A;  4NH1 C;  1VQ6 1;  3L8K A;  5C44 I;  3CXC Y;  1YI2 1;  3J81 b;  1NJI 1;  4QTU A;  3I56 Z;  2YVF A;  2GR2 A;  3CCQ 1;  4EQS A;  4NB9 A;  1L1O C;  3GTJ I;  4A3C I;  2VUG A;  3FKI I;  2OTL 1;  5JCI A;  3HOW I;  1M90 2;  1VQ5 Z;  3H4K A;  1YHQ Z;  2WOW A;  2ZZB A;  2QA4 Z;  2GR0 A;  1TWF I;  1USP A;  2YAD A;  2B63 I;  3KIH A;  1GET A;  2PM9 A;  1QF8 A;  1ZY8 A;  2ZZC A;  3G6E 1;  1VQM Z;  4A3B I;  4MRI A;  4A93 I;  4A3L I;  3EAN A;  5IT9 f;  3PG6 A;  4BXX I;  2EQ6 A;  4NB8 A;  1BWC A;  2X50 A;  3F3P C;  1X3W A;  3S2H I;  1GRF A;  2J6A A;  4H4S A;  2Q51 A;  1GER A;  3HKZ A;  3CCS Z;  3G6E Z;  1K9M 2;  2QRD B;  3CME 1;  4MD8 A;  4NBG A;  1GES A;  2R93 I;  3DJG X;  2WAQ A;  4BY1 I;  4HGZ A;  4H4P A;  1W2B Y;  1K73 2;  2JA7 I;  2RPR A;  1VQN Z;  1RO2 A;  1Y1V S;  3CCS 1;  5ER0 A;  1YJN Z;  3VB9 A;  1VQ6 Z;  2RIQ A;  4APN A;  2QRE B;  3TDH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...