3D9XA

Structure of the head of the bartonella adhesin bada
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
114
structure length
114
Chain Sequence
GGWNLTVNNDNNTVVSSGGALDLSSGSKNLKIVKDGKKNNVTFDVARDLTLKSIKLDGVTLNETGLFIANGPQITASGINAGSQKITGVAEGTDANDAVNFGQLKKIETEVKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Adhesin A
publication title Structure of the head of the Bartonella adhesin BadA
pubmed doi rcsb
source organism Bartonella henselae
total genus 13
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05662 YadA_stalk Coiled stalk of trimeric autotransporter adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.490 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3d9xA01
3.30.390.90 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3d9xA02
3D9XA 1S7MA
chains in the Genus database with same CATH superfamily
1R9TI 2GGJA 2OVLA 2PCEA 1F9CA 2DE6A 3VCNA 1GRHA 3CMAZ 3GTJI 3DJGX 5FLXb 1K83I 1W2BY 2GSHA 1N2FA 4IL0A 1EBDA 1ZMDA 2EGTA 3T9PA 3ZLFA 4E6MA 3JAMf 3N4EA 3OP2A 2HZGA 3TQPA 4TVWA 4A93I 3L5OA 1RM6B 3RZDI 3GTPI 2NVXI 3CC2Z 4EQSA 4MD9A 3U50C 1YJ9Z 2PPGA 3FVDA 4ZA0A 3Q45A 3HOVI 2E7ZA 1EC8A 1R0MA 3B9JB 3FYYA 3H8AA 3QFAA 4M0XA 3T4WA 5JCMA 2QEXZ 1SJDA 4IL2A 1I6HI 1JROA 4E2WA 2E2HI 1FDIA 1Q821 3J7A4 1Q7Y1 1VQM1 3DK8A 3ZVHB 2GRTA 3UXKA 3RITA 1DTNA 3G6E1 3J80f 1XPYA 2HQMA 1YJN1 1NP6A 3LADA 1N60C 4H4PA 5FS8A 1WUFA 4NFRA 2RBLA 1GRBA 3SBFA 3CCMZ 5JRBA 3OPSA 2FKPA 2W03A 3U4FA 1S7MA 2EQ6A 1ZMCA 1SJAA 3URHA 3ESWA 2XGZA 3GY1A 3S5SA 1MDRA 1TFIA 2V3VA 2OZTA 3QPEA 2JIQA 5ER0A 4Z17A 2VPXA 3OTRA 4A3RA 4E2ZA 3DEQA 3IF8A 1QYPA 2LIYA 4RVFA 5FJPA 2PODA 1QVGZ 2QRDB 3CQZI 3NH8A 1AA6A 3OW2Y 2I5QA 4NBHA 4AYBA 2QR1B 1Q861 1FHVA 2GR1A 3DESA 3DK9A 3CPWY 2OTL1 3EKGA 3IK4A 4J1OA 3NDJA 4HGYA 3ZLGA 2OFJA 1JEHA 1FECA 1JPDX 3AN1A 2PU0A 4EWJA 1YJNZ 1NHQA 2XH2A 3PWGA 3R0UA 2GR0A 3SSZA 1W6TA 4JN7A 2QRCB 4A3GI 3VMIA 1KKOA 2R92I 2NVTI 3T4NB 1SFOI 2OTJZ 3H4KA 1SIWA 2WOWA 1EC9A 3Q4DA 5G5GB 1WIIA 4A6GA 1VQO1 2RDXA 2PTXA 3V5FA 1XS2A 3QFBA 1NPXA 3I4NI 1RO0A 2CHRA 3T6CA 5JCIA 3P3BA 1L1OC 2E5AA 2HU9A 4NH1C 2OLAA 4G8TA 3TW9A 1X0TA 2JIOA 2OTLZ 3EEZA 4K8DA 2QLVB 3MZLB 3HRDC 2YADA 4NBGA 5T67A 1W2BZ 3ES8A 3I561 1P48A 1JRPA 3HOUI 2POZA 1MOKA 4NB8A 3R0KA 4K1WA 2PM9A 2OOYB 3UJEA 3CB3A 3VMGA 4BBSI 2NPXA 3JZUA 3SQPA 4EQXA 1Q1WA 4GIRA 4DYEA 2XH4A 3CGCA 3VDGA 3TJIA 4KWSA 2QA4Z 2W3RA 2OZKA 2QVHA 5IT9b 2PMQA 3CCVZ 2WOVA 3HOZI 1VQOZ 4M52A 3ZLHA 2CFYA 3L8KA 2E2II 4DXKA 4H4TA 2OOXB 3IJIA 1N8R1 5FJRA 3SQSA 3ES7A 1WZNA 3FXGA 1NHRA 3UCCA 3MKCA 3CT2A 3D6WA 5FS6A 4JN8A 5AN9F 5J04A 3J81f 2R93I 4J56A 2VUMI 3UJRA 2GH5A 3DIPA 3VB9A 3TDHB 2GR3A 3S17I 3NS1B 3FKII 2GGHA 3DERA 2C3CA 3GD3A 3DG7A 1KC81 2GU2A 2QQ6A 3OZMA 3VMHA 1PFTA 2VPYA 3NVWB 1RQFA 3CC41 1VQKZ 2V8JA 3VA8A 4HH4A 5FS7A 4ENLA 3U9IA 1S721 1N5XA 3RZOI 4H4WA 3DGZA 5G5HB 4A3JI 4MH4A 3EF6A 5IDZA 3H3VJ 1VQ5Z 3CK5A 5C4XI 3CMA1 2QJMA 4M6UA 3D9XA 3LB8A 1ZX9A 3RGTA 3HOYI 4Y52I 4H4XA 1XHCA 4LIIA 3OW2Z 2RPRA 1DL6A 1ZB8A 1LVLA 2HNEA 1K731 2WPFA 3P5JB 3K1GA 1VQ4Z 1ZDLA 5A2Qb 3CPWZ 2PP0A 3KLJA 5FMHA 1Z02A 3B97A 4HN8A 3CD6Z 2DW6A 3S16I 1TYTA 3BG0B 4X2PA 4LA1A 3F3PC 2RT9A 3CC21 1N62C 2QJNA 1YJ91 2W55A 1NELA 3CME1 2NQLA 3JVAA 5CM2M 1ZB9A 4F4RA 2PP3A 2GGIA 4J57A 1XDIA 5U1OA 1RLYA 2MNRA 1BWCA 4A3MI 3TCSA 1S72Z 3S1MI 4A3CI 4EM3A 1KQSZ 1Y8CA 1Q822 4FX9A 3CXBA 1Q7Y2 4ROPA 4IP5A 1GXFA 2BC0A 2FYMA 3IC9A 1SJCA 1FFVC 4H83A 2YAUA 2ZZBA 2F5ZA 4BV6A 2HXTA 3AM9A 1EBGA 1GRTA 4GISA 4H50A 4BURA 5C44I 3CCM1 3CCE1 1YI2Z 2NVYI 5EU9A 1X3WA 3TWAA 3I4KA 7ENLA 3RRAA 3S2DI 3CMEZ 3QLDA 1RO4A 5BOEA 4H19A 1JCTA 1ELSA 1LPFA 4MKSA 1M1K1 1V59A 3M3YI 1YJWZ 2RABA 1YEYA 3KIHA 3NH5A 4NB9A 3CCS1 2WPCA 3OC4A 4HNCA 2HXUA 1Q862 1RVKA 4GR1A 3EUB3 4H4SA 2JS4A 2X8GA 3SR6B 3CC71 3OW1A 5EBKA 2GTIA 3BSMA 2LEXA 1RO2A 3S1NI 4EM4A 2F4OA 3UJSA 4RVGA 1SJBA 1JJ2Z 4A3DI 4DQYB 2IZ4A 3RCYA 4BY7I 4H4RA 4X6AI 2M48A 3Q87A 3CCEZ 2EQ7A 1P43A 2PTYA 2OTJ1 3N6JA 2R9ZA 2PGEA 2X8HA 4YWOA 5BOFA 1V97A 1MO9A 1H2IA 1IYXA 2PTWA 4IT1A 4BXXI 2JNYA 4BBRI 3PO2I 3BOXA 4MD7A 5FLXf 2AAQA 3DFYA 3H12A 4TVYA 2PGWA 3NRZB 1FDOA 1ML8A 2J3NA 4DNAA 3EANA 4EWCA 3CCSZ 2V3AA 3S15I 4HGZA 3GTKI 3V5CA 1KD11 3FJ4A 3SN1A 3RO6A 5FLMI 3G4SZ 2J6AA 4MXUA 3CC7Z 4A3EI 2GDQA 1N5WC 3R10A 2P88A 2OQHA 3HPFA 4GGHA 4H4YA 1KN0A 2YVFA 3CXCY 1L8PA 3FCPA 1TWHI 1VLAA 2BC1A 2QA41 1I3QI 1VQZA 3CCUZ 4RVDA 2NVKX 3KUMA 3CCV1 1I50I 4RS4A 1YIJ1 1QF8A 4E31A 1USPA 2GGGA 4MONA 1Z01A 1N8R2 2PP1A 1STZA 2P8CA 1FFUC 3UJFA 1FEAA 3G71Z 2V8IA 4XX2A 2AL1A 3HOXI 2ONEA 2QDDA 1VQ8Z 1X3ZA 4DK1A 3CCRZ 1KC82 2W54A 3I6EA 1VQK1 2DE5A 3DGBA 4E2XA 4DGLA 2TPRA 3H7VA 4GFIA 3GTOI 3CXOA 4IZGA 1VDVA 2VPWA 3NVVB 1VQ51 3I4MI 2ZC8A 3TJ4A 2A8XA 1GEUA 2O4HA 3D47A 1YIJZ 1OJTA 1R6WA 2W3SA 1M6IA 5U25A 2JUBA 2X99A 1JPMA 4GGBA 4A3KI 1GRGA 3TE5B 3QN3A 5JCNA 4DWDA 1ZXIC 1VQ41 1X2GA 2QAEA 1YUAA 3MY9A 1YHQZ 3GTLI 3NFZA 1K732 1KCZA 1EBHA 3GCFA 1BKHA 1F8WA 3CD61 3UCDA 4BY1I 4H4QA 5LL6f 1BQGA 3A7UA 1ECQA 1N61C 3BJSA 2GGEA 4NBAA 1YITZ 1Z03A 1VQ6Z 3MWCA 3MSYA 2E9HA 3I55Z 1BZLA 3PO3I 3DJJA 3FG2P 3UXLA 1H6VA 1KD0A 1ZK7A 2YVJA 2ZZ0A 3NVZB 3ZVIA 1OEPA 2DW7A 1PDZA 3R1ZA 2OX4A 4ZOHB 3VC6A 4EQWA 4S1TA 4MGGA 5FS9A 2RHBA 2B63I 4HCDA 3VFCA 2JA7I 3QWUA 1NJI1 1VQL1 2KPIA 3A7RA 3R11A 1KRLA 4E32A 2V6OA 3RNMA 4GRTA 3N6HA 4E4UA 3Q6JA 1F3PA 1P9NA 3JAMb 3GD6A 1YI21 3QTPA 1VQPZ 5FJUA 5TR3A 4H1ZA 2IZ3A 3THUA 4K7ZA 1JOAA 3KIFA 3PO3S 3CCQ1 4K8GA 3I6TA 1Y1VI 1TZZA 1QVGY 1KKRA 3UGVA 3NDIA 1GETA 1GV4A 4A35A 1YJW1 3EEDA 1M1K2 1VQ7Z 3MUCA 2WPEA 3NVYB 3NXLA 2AKMA 3GTMI 1ONFA 3DG3A 1ZY8A 1MNSA 1AOGA 1FIQB 3GO2A 3MZNA 6ENLA 1JWHC 3FQMA 2BJOA 1TYPA 2R6MA 2AYDA 2JA5I 1VQLZ 1VQ9Z 4FP1A 5D1PA 3IJQA 2RIQA 3J80b 1USPB 2C3DA 2I3CA 1Y1VS 3CGEA 1M901 2GL5A 3PG6A 3FV9A 3DFHA 4HPNA 2M6NA 3CCQZ 3F3FC 2WAQA 4NEVA 2AKZA 3GTMS 1NU5A 2CDUA 1FEBA 3S47A 3II4A 4H4UA 2Q51A 2ZADA 4NOZA 2Q4ZA 4RV9A 1TWFI 1NHPA 4KT2A 2VPZA 2W04A 2PK7A 3BG1B 3TTEA 5A2Qf 2O56A 2P8BA 2YQUA 3G4S1 2PTZA 3R07C 1KD12 3CAWA 1WYGA 1PDYA 2OQYA 2WP6A 4TNUA 4E33A 1Q811 1K9M1 1D7YA 1K8A1 2P3ZA 3MQTA 4KPLA 4E8GA 4FI4A 2XH7A 1MDLA 5GRTA 3MZKB 4EQRA 5KVHA 2JIPA 2W0HA 2ZZCA 2V3BA 3VTNA 4FDCB 3EAOA 3IX0A 3CCU1 4MMWA 3V4BA 1GRFA 1LQLA 4HCLA 3GKQA 4IP4A 5FJTA 2DE7A 3FQQA 3VCCA 3GRSA 1MUCA 3CGBA 4Z1YA 1QVFY 4NBFA 2EQ9A 2PMZA 1FHUA 3JW7A 3CCJ1 2BCPA 3O0HA 2QREB 2V8KA 4JQ9A 4KPRA 3G711 3NO1A 4GYPC 3IFUA 1DXLA 4RVHA 3T8QA 1VQ81 4HNLA 2X50A 1TWCI 3CCR1 3RR1A 1YQZA 5IP7I 3OZYA 2P0IA 4ZCWA 3S2HI 1SB3B 4DN1A 4EMIA 2EQ8A 3V3WA 3D2LA 1WW9A 3GRTA 3S14I 2P28A 3NFUA 3HKZA 1TWAI 1WJ2A 1VQMZ 1X2HA 3N4FA 4JDRA 3TOYA 4YWSA 3IR7A 3K7AI 3CCJZ 2OKTA 2WB1A 1GRAA 4NBEA 4K2SA 5IP9I 1YHQ1 3G6EZ 3CGDA 1FO4A 3A7AA 2XH0A 3NH4A 4KEMA 5FJOA 5C3EI 3J81b 2WOIA 3STPA 4ADWA 1N63C 1XANA 2R7ZI 2GR2A 3AMZA 3PK7A 4H2HA 3SJNA 5D1OB 3M4OI 1DNCA 3VC5A 2JIMA 2JK6A 3ETRB 3PFRA 1YIT1 2V45A 1VQ61 2QGYA 1KQSY 4NBBA 2OPJA 3PWIA 2YVGA 3R25A 2JR6A 1GSNA 3I551 4E2YA 1GESA 2JIRA 4A3II 2ZAEB 1GREA 4MD8A 2AL2B 4A3LI 3S1QI 5ENLA 4DX3A 5JCKA 3NZGA 1TWGI 4E30A 4E4FA 2G2KA 3SN0A 2PSNA 1YUKA 2QJJA 4E5TA 5T6BA 1ONEA 1NUIA 1E9IA 4A3FI 3GTQI 1NJI2 3GTGI 2AKLA 4Y7NI 2OO6A 2JMOA 1EC7A 2HF1A 2KI7B 4HCHA 4IHCA 1VQP1 3TWBA 2QDEA 4NEWA 1WUEA 3IJLA 3ZVHA 1T3QC 5JCLA 2IV2X 2WP5A 5KVIA 4EMWA 4A3BI 4HYRA 1GERA 4CL1A 1VQ71 2E2JI 1VQN1 2NVQI 3LUSA 2GQWA 2PA6A 3HW2A 4NBCA 4GMEA 4QTUA 3P0WA 1JDFA 2VF1A 4APNA 3CCL1 2OZ8A 2K5RA 3DDMA 5C4JI 1QVFZ 1VQ91 1JJ2Y 2PU1A 1NHSA 2YU9I 3D46A 2XSXA 2P3YA 3QKEA 2PS2A 3H70A 3I56Z 3H0GI 4QTTA 1WCMI 2WBAA 3LXDA 4GYPA 1M902 4H4ZA 3EERA 4DHGA 5T64A 2JA6I 5IT9f 3I07A 3CXCZ 1K4QA 3UJ2A 1Q1RA 2F4MA 3DGHA 1ZKQA 2LFUA 2JA8I 1VQNZ 1QXFA 1MRAA 3DH9A 1ZH1A 4G7FA 2Y0SA 2OZ3A 3DG6A 1TE6A 5D1OA 3CCLZ 4MRIA 3S1RI 2GTHA 4J3ZA 2K3RA 2QKDA 3DK4A 2VUGA 2NAPA 3P93A 4H4VA 1RNIA 1NDAA 3CYJA 3HOWI 2AL2A 2O53A 4JHMA 1Y1WI 1TKKA 3ENLA 4NBDA 1Q812 1K9M2 2E3TA 2X8CA 3MONA 1K8A2 3GC2A 4EMJA 3SN4A 1Q16A 2MUCA 3CC4Z 2OG9A 2H85A 3GD4A 2QEX1
chains in the Genus database with same CATH topology
1R9TI 2DE6A 1GRHA 3CMAZ 3GTJI 3DJGX 5FLXb 1K83I 1W2BY 1N2FA 1EBDA 1ZMDA 2EGTA 3JAMf 4A93I 3L5OA 3RZDI 3GTPI 2NVXI 3CC2Z 4EQSA 4MD9A 3U50C 1YJ9Z 3HOVI 5JCMA 3QFAA 2QEXZ 1I6HI 4E2WA 2E2HI 1Q821 3J7A4 1Q7Y1 1VQM1 3DK8A 2GRTA 3G6E1 3J80f 2HQMA 1YJN1 1NP6A 3LADA 4H4PA 5FS8A 5JRBA 4NFRA 2RBLA 1GRBA 3CCMZ 2W03A 1S7MA 2EQ6A 1ZMCA 3URHA 3ESWA 1TFIA 5ER0A 4E2ZA 3IF8A 1QYPA 2LIYA 4RVFA 1QVGZ 2QRDB 3CQZI 3NH8A 3OW2Y 4NBHA 4AYBA 2QR1B 1Q861 3DK9A 2GR1A 3CPWY 2OTL1 3NDJA 4HGYA 1JEHA 1FECA 1YJNZ 1NHQA 2GR0A 2QRCB 4A3GI 3VMIA 2R92I 2NVTI 3T4NB 1SFOI 2OTJZ 3H4KA 2WOWA 1WIIA 1VQO1 3QFBA 1NPXA 3I4NI 1RO0A 5JCIA 1L1OC 2HU9A 4NH1C 1X0TA 2OTLZ 4K8DA 2QLVB 3MZLB 2YADA 4NBGA 5T67A 1W2BZ 3I561 3HOUI 1MOKA 4NB8A 2PM9A 2OOYB 3VMGA 4BBSI 2NPXA 3SQPA 4EQXA 1Q1WA 3CGCA 2QA4Z 2OZKA 5IT9b 3CCVZ 2WOVA 3HOZI 1VQOZ 4M52A 2CFYA 3L8KA 2E2II 4H4TA 2OOXB 1N8R1 1NHRA 5FS6A 3D6WA 5AN9F 3J81f 2R93I 4J56A 2VUMI 2GH5A 3VB9A 3TDHB 2GR3A 3S17I 3FKII 2C3CA 3GD3A 1KC81 2GU2A 3VMHA 1PFTA 1RQFA 3CC41 1VQKZ 2V8JA 4HH4A 5FS7A 1S721 3RZOI 4H4WA 3DGZA 4A3JI 4MH4A 3EF6A 3H3VJ 1VQ5Z 5C4XI 3CMA1 3D9XA 3LB8A 1ZX9A 3HOYI 4Y52I 4H4XA 1XHCA 4LIIA 3OW2Z 2RPRA 1DL6A 1ZB8A 1LVLA 1K731 2WPFA 3P5JB 3KLJA 1VQ4Z 1ZDLA 5A2Qb 3CPWZ 5FMHA 1Z02A 3CD6Z 3S16I 1TYTA 3BG0B 4LA1A 3F3PC 2RT9A 3CC21 1YJ91 3CME1 5CM2M 1ZB9A 4J57A 1XDIA 5U1OA 1RLYA 1BWCA 4A3MI 1S72Z 3S1MI 4A3CI 4EM3A 1KQSZ 1Q822 4FX9A 1Q7Y2 1GXFA 2BC0A 3IC9A 2YAUA 2ZZBA 2F5ZA 4BV6A 1GRTA 4H50A 4BURA 5C44I 3CCM1 3CCE1 1YI2Z 2NVYI 1X3WA 3S2DI 3CMEZ 1RO4A 1LPFA 1M1K1 1V59A 3M3YI 1YJWZ 2RABA 3KIHA 3NH5A 4NB9A 3CCS1 2WPCA 3OC4A 1Q862 4GR1A 4H4SA 2JS4A 2X8GA 3CC71 5EBKA 2GTIA 1RO2A 3S1NI 4EM4A 2F4OA 4RVGA 1JJ2Z 4A3DI 4DQYB 2IZ4A 4BY7I 4H4RA 4X6AI 2M48A 3Q87A 3CCEZ 2EQ7A 2OTJ1 2R9ZA 2X8HA 4YWOA 1MO9A 1H2IA 4BXXI 2JNYA 4BBRI 3PO2I 4MD7A 5FLXf 2AAQA 1ML8A 2J3NA 4DNAA 3EANA 4EWCA 3CCSZ 2V3AA 3S15I 4HGZA 3GTKI 1KD11 5FLMI 3G4SZ 2J6AA 4MXUA 3CC7Z 4A3EI 4H4YA 1KN0A 2YVFA 3CXCY 1TWHI 1VLAA 2BC1A 2QA41 1I3QI 3CCUZ 4RVDA 2NVKX 3CCV1 1I50I 4RS4A 1YIJ1 1QF8A 4E31A 1USPA 4MONA 1Z01A 1N8R2 1FEAA 3G71Z 2V8IA 4XX2A 3HOXI 1VQ8Z 1X3ZA 4DK1A 3CCRZ 1KC82 1VQK1 2DE5A 4E2XA 4DGLA 2TPRA 3GTOI 1VQ51 3I4MI 2A8XA 1GEUA 2O4HA 1YIJZ 1OJTA 1M6IA 5U25A 2JUBA 2X99A 4A3KI 1GRGA 3TE5B 5JCNA 1VQ41 2QAEA 1YUAA 1YHQZ 3GTLI 3NFZA 1K732 3GCFA 1F8WA 3CD61 4BY1I 4H4QA 5LL6f 4NBAA 1YITZ 1Z03A 1VQ6Z 2E9HA 3I55Z 1BZLA 3PO3I 3DJJA 3FG2P 1H6VA 1ZK7A 2YVJA 2ZZ0A 4EQWA 4S1TA 5FS9A 2RHBA 2B63I 2JA7I 3QWUA 1NJI1 1VQL1 2KPIA 3RNMA 1KRLA 4E32A 2V6OA 4GRTA 3Q6JA 1F3PA 1P9NA 3JAMb 1YI21 1VQPZ 5TR3A 2IZ3A 4K7ZA 1JOAA 3KIFA 3PO3S 3CCQ1 1Y1VI 1QVGY 3NDIA 1GETA 1GV4A 1YJW1 3EEDA 1M1K2 1VQ7Z 2WPEA 3GTMI 1ONFA 1ZY8A 1AOGA 1JWHC 3FQMA 2BJOA 1TYPA 2R6MA 2JA5I 1VQLZ 1VQ9Z 5D1PA 2RIQA 3J80b 1USPB 2C3DA 2I3CA 1Y1VS 3CGEA 1M901 3PG6A 2M6NA 3CCQZ 3F3FC 2WAQA 4NEVA 2CDUA 3GTMS 1FEBA 3II4A 4H4UA 2Q51A 4NOZA 2Q4ZA 4RV9A 1TWFI 1NHPA 2W04A 2PK7A 3BG1B 5A2Qf 2YQUA 3G4S1 1KD12 2WP6A 4TNUA 4E33A 1Q811 1K9M1 1D7YA 1K8A1 5KVHA 5GRTA 3MZKB 4EQRA 2W0HA 2ZZCA 2V3BA 3VTNA 4FDCB 3EAOA 3IX0A 3CCU1 1GRFA 1LQLA 3GKQA 2DE7A 3FQQA 3GRSA 3CGBA 1QVFY 4NBFA 2EQ9A 2PMZA 3CCJ1 2BCPA 3O0HA 2QREB 2V8KA 4JQ9A 4KPRA 3G711 3IFUA 1DXLA 4RVHA 1VQ81 2X50A 1TWCI 3CCR1 1YQZA 5IP7I 3S2HI 4EMIA 2EQ8A 1WW9A 3GRTA 3S14I 2P28A 3HKZA 1TWAI 1VQMZ 4JDRA 3K7AI 3CCJZ 2WB1A 1GRAA 4NBEA 5IP9I 1YHQ1 3G6EZ 3CGDA 3NH4A 4ADWA 5C3EI 3J81b 2WOIA 1XANA 2R7ZI 2GR2A 5D1OB 3M4OI 1DNCA 2JK6A 1YIT1 1VQ61 1KQSY 4NBBA 2YVGA 2JR6A 1GSNA 3I551 4E2YA 1GESA 1GREA 4A3II 2ZAEB 4MD8A 4A3LI 3S1QI 5JCKA 1TWGI 4E30A 2G2KA 1YUKA 5T6BA 1NUIA 4A3FI 3GTQI 1NJI2 3GTGI 2AKLA 4Y7NI 2JMOA 2HF1A 2KI7B 1VQP1 4NEWA 5JCLA 2WP5A 5KVIA 4EMWA 4A3BI 1GERA 4CL1A 1VQ71 2E2JI 1VQN1 2NVQI 3LUSA 2GQWA 4NBCA 4QTUA 2VF1A 4APNA 3CCL1 2K5RA 5C4JI 1QVFZ 1VQ91 1JJ2Y 1NHSA 2YU9I 2P3YA 3I56Z 3H0GI 4QTTA 1WCMI 2WBAA 3LXDA 1M902 4H4ZA 3EERA 5T64A 2JA6I 5IT9f 3I07A 3CXCZ 1K4QA 1Q1RA 2F4MA 3DGHA 1ZKQA 2LFUA 2JA8I 1VQNZ 3DH9A 1ZH1A 2Y0SA 5D1OA 3CCLZ 4MRIA 3S1RI 2GTHA 2K3RA 2QKDA 3DK4A 2VUGA 4H4VA 1RNIA 1NDAA 3HOWI 2O53A 1Y1WI 4NBDA 1Q812 1K9M2 2X8CA 3MONA 1K8A2 4EMJA 3CC4Z 2H85A 3GD4A 2QEX1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9X A;  1S7M A; 
#chains in the Genus database with same CATH topology
 1R9T I;  2GGJ A;  2OVL A;  2PCE A;  1F9C A;  2DE6 A;  3VCN A;  1GRH A;  3CMA Z;  3GTJ I;  3DJG X;  5FLX b;  1K83 I;  1W2B Y;  2GSH A;  1N2F A;  4IL0 A;  1EBD A;  1ZMD A;  2EGT A;  3T9P A;  3ZLF A;  4E6M A;  3JAM f;  3N4E A;  3OP2 A;  2HZG A;  3TQP A;  4TVW A;  4A93 I;  3L5O A;  1RM6 B;  3RZD I;  3GTP I;  2NVX I;  3CC2 Z;  4EQS A;  4MD9 A;  3U50 C;  1YJ9 Z;  2PPG A;  3FVD A;  4ZA0 A;  3Q45 A;  3HOV I;  2E7Z A;  1EC8 A;  1R0M A;  3B9J B;  3FYY A;  3H8A A;  3QFA A;  4M0X A;  3T4W A;  5JCM A;  2QEX Z;  1SJD A;  4IL2 A;  1I6H I;  1JRO A;  4E2W A;  2E2H I;  1FDI A;  1Q82 1;  3J7A 4;  1Q7Y 1;  1VQM 1;  3DK8 A;  3ZVH B;  2GRT A;  3UXK A;  3RIT A;  1DTN A;  3G6E 1;  3J80 f;  1XPY A;  2HQM A;  1YJN 1;  1NP6 A;  3LAD A;  1N60 C;  4H4P A;  5FS8 A;  1WUF A;  4NFR A;  2RBL A;  1GRB A;  3SBF A;  3CCM Z;  5JRB A;  3OPS A;  2FKP A;  2W03 A;  3U4F A;  1S7M A;  2EQ6 A;  1ZMC A;  1SJA A;  3URH A;  3ESW A;  2XGZ A;  3GY1 A;  3S5S A;  1MDR A;  1TFI A;  2V3V A;  2OZT A;  3QPE A;  2JIQ A;  5ER0 A;  4Z17 A;  2VPX A;  3OTR A;  4A3R A;  4E2Z A;  3DEQ A;  3IF8 A;  1QYP A;  2LIY A;  4RVF A;  5FJP A;  2POD A;  1QVG Z;  2QRD B;  3CQZ I;  3NH8 A;  1AA6 A;  3OW2 Y;  2I5Q A;  4NBH A;  4AYB A;  2QR1 B;  1Q86 1;  1FHV A;  2GR1 A;  3DES A;  3DK9 A;  3CPW Y;  2OTL 1;  3EKG A;  3IK4 A;  4J1O A;  3NDJ A;  4HGY A;  3ZLG A;  2OFJ A;  1JEH A;  1FEC A;  1JPD X;  3AN1 A;  2PU0 A;  4EWJ A;  1YJN Z;  1NHQ A;  2XH2 A;  3PWG A;  3R0U A;  2GR0 A;  3SSZ A;  1W6T A;  4JN7 A;  2QRC B;  4A3G I;  3VMI A;  1KKO A;  2R92 I;  2NVT I;  3T4N B;  1SFO I;  2OTJ Z;  3H4K A;  1SIW A;  2WOW A;  1EC9 A;  3Q4D A;  5G5G B;  1WII A;  4A6G A;  1VQO 1;  2RDX A;  2PTX A;  3V5F A;  1XS2 A;  3QFB A;  1NPX A;  3I4N I;  1RO0 A;  2CHR A;  3T6C A;  5JCI A;  3P3B A;  1L1O C;  2E5A A;  2HU9 A;  4NH1 C;  2OLA A;  4G8T A;  3TW9 A;  1X0T A;  2JIO A;  2OTL Z;  3EEZ A;  4K8D A;  2QLV B;  3MZL B;  3HRD C;  2YAD A;  4NBG A;  5T67 A;  1W2B Z;  3ES8 A;  3I56 1;  1P48 A;  1JRP A;  3HOU I;  2POZ A;  1MOK A;  4NB8 A;  3R0K A;  4K1W A;  2PM9 A;  2OOY B;  3UJE A;  3CB3 A;  3VMG A;  4BBS I;  2NPX A;  3JZU A;  3SQP A;  4EQX A;  1Q1W A;  4GIR A;  4DYE A;  2XH4 A;  3CGC A;  3VDG A;  3TJI A;  4KWS A;  2QA4 Z;  2W3R A;  2OZK A;  2QVH A;  5IT9 b;  2PMQ A;  3CCV Z;  2WOV A;  3HOZ I;  1VQO Z;  4M52 A;  3ZLH A;  2CFY A;  3L8K A;  2E2I I;  4DXK A;  4H4T A;  2OOX B;  3IJI A;  1N8R 1;  5FJR A;  3SQS A;  3ES7 A;  1WZN A;  3FXG A;  1NHR A;  3UCC A;  3MKC A;  3CT2 A;  3D6W A;  5FS6 A;  4JN8 A;  5AN9 F;  5J04 A;  3J81 f;  2R93 I;  4J56 A;  2VUM I;  3UJR A;  2GH5 A;  3DIP A;  3VB9 A;  3TDH B;  2GR3 A;  3S17 I;  3NS1 B;  3FKI I;  2GGH A;  3DER A;  2C3C A;  3GD3 A;  3DG7 A;  1KC8 1;  2GU2 A;  2QQ6 A;  3OZM A;  3VMH A;  1PFT A;  2VPY A;  3NVW B;  1RQF A;  3CC4 1;  1VQK Z;  2V8J A;  3VA8 A;  4HH4 A;  5FS7 A;  4ENL A;  3U9I A;  1S72 1;  1N5X A;  3RZO I;  4H4W A;  3DGZ A;  5G5H B;  4A3J I;  4MH4 A;  3EF6 A;  5IDZ A;  3H3V J;  1VQ5 Z;  3CK5 A;  5C4X I;  3CMA 1;  2QJM A;  4M6U A;  3D9X A;  3LB8 A;  1ZX9 A;  3RGT A;  3HOY I;  4Y52 I;  4H4X A;  1XHC A;  4LII A;  3OW2 Z;  2RPR A;  1DL6 A;  1ZB8 A;  1LVL A;  2HNE A;  1K73 1;  2WPF A;  3P5J B;  3K1G A;  1VQ4 Z;  1ZDL A;  5A2Q b;  3CPW Z;  2PP0 A;  3KLJ A;  5FMH A;  1Z02 A;  3B97 A;  4HN8 A;  3CD6 Z;  2DW6 A;  3S16 I;  1TYT A;  3BG0 B;  4X2P A;  4LA1 A;  3F3P C;  2RT9 A;  3CC2 1;  1N62 C;  2QJN A;  1YJ9 1;  2W55 A;  1NEL A;  3CME 1;  2NQL A;  3JVA A;  5CM2 M;  1ZB9 A;  4F4R A;  2PP3 A;  2GGI A;  4J57 A;  1XDI A;  5U1O A;  1RLY A;  2MNR A;  1BWC A;  4A3M I;  3TCS A;  1S72 Z;  3S1M I;  4A3C I;  4EM3 A;  1KQS Z;  1Y8C A;  1Q82 2;  4FX9 A;  3CXB A;  1Q7Y 2;  4ROP A;  4IP5 A;  1GXF A;  2BC0 A;  2FYM A;  3IC9 A;  1SJC A;  1FFV C;  4H83 A;  2YAU A;  2ZZB A;  2F5Z A;  4BV6 A;  2HXT A;  3AM9 A;  1EBG A;  1GRT A;  4GIS A;  4H50 A;  4BUR A;  5C44 I;  3CCM 1;  3CCE 1;  1YI2 Z;  2NVY I;  5EU9 A;  1X3W A;  3TWA A;  3I4K A;  7ENL A;  3RRA A;  3S2D I;  3CME Z;  3QLD A;  1RO4 A;  5BOE A;  4H19 A;  1JCT A;  1ELS A;  1LPF A;  4MKS A;  1M1K 1;  1V59 A;  3M3Y I;  1YJW Z;  2RAB A;  1YEY A;  3KIH A;  3NH5 A;  4NB9 A;  3CCS 1;  2WPC A;  3OC4 A;  4HNC A;  2HXU A;  1Q86 2;  1RVK A;  4GR1 A;  3EUB 3;  4H4S A;  2JS4 A;  2X8G A;  3SR6 B;  3CC7 1;  3OW1 A;  5EBK A;  2GTI A;  3BSM A;  2LEX A;  1RO2 A;  3S1N I;  4EM4 A;  2F4O A;  3UJS A;  4RVG A;  1SJB A;  1JJ2 Z;  4A3D I;  4DQY B;  2IZ4 A;  3RCY A;  4BY7 I;  4H4R A;  4X6A I;  2M48 A;  3Q87 A;  3CCE Z;  2EQ7 A;  1P43 A;  2PTY A;  2OTJ 1;  3N6J A;  2R9Z A;  2PGE A;  2X8H A;  4YWO A;  5BOF A;  1V97 A;  1MO9 A;  1H2I A;  1IYX A;  2PTW A;  4IT1 A;  4BXX I;  2JNY A;  4BBR I;  3PO2 I;  3BOX A;  4MD7 A;  5FLX f;  2AAQ A;  3DFY A;  3H12 A;  4TVY A;  2PGW A;  3NRZ B;  1FDO A;  1ML8 A;  2J3N A;  4DNA A;  3EAN A;  4EWC A;  3CCS Z;  2V3A A;  3S15 I;  4HGZ A;  3GTK I;  3V5C A;  1KD1 1;  3FJ4 A;  3SN1 A;  3RO6 A;  5FLM I;  3G4S Z;  2J6A A;  4MXU A;  3CC7 Z;  4A3E I;  2GDQ A;  1N5W C;  3R10 A;  2P88 A;  2OQH A;  3HPF A;  4GGH A;  4H4Y A;  1KN0 A;  2YVF A;  3CXC Y;  1L8P A;  3FCP A;  1TWH I;  1VLA A;  2BC1 A;  2QA4 1;  1I3Q I;  1VQZ A;  3CCU Z;  4RVD A;  2NVK X;  3KUM A;  3CCV 1;  1I50 I;  4RS4 A;  1YIJ 1;  1QF8 A;  4E31 A;  1USP A;  2GGG A;  4MON A;  1Z01 A;  1N8R 2;  2PP1 A;  1STZ A;  2P8C A;  1FFU C;  3UJF A;  1FEA A;  3G71 Z;  2V8I A;  4XX2 A;  2AL1 A;  3HOX I;  2ONE A;  2QDD A;  1VQ8 Z;  1X3Z A;  4DK1 A;  3CCR Z;  1KC8 2;  2W54 A;  3I6E A;  1VQK 1;  2DE5 A;  3DGB A;  4E2X A;  4DGL A;  2TPR A;  3H7V A;  4GFI A;  3GTO I;  3CXO A;  4IZG A;  1VDV A;  2VPW A;  3NVV B;  1VQ5 1;  3I4M I;  2ZC8 A;  3TJ4 A;  2A8X A;  1GEU A;  2O4H A;  3D47 A;  1YIJ Z;  1OJT A;  1R6W A;  2W3S A;  1M6I A;  5U25 A;  2JUB A;  2X99 A;  1JPM A;  4GGB A;  4A3K I;  1GRG A;  3TE5 B;  3QN3 A;  5JCN A;  4DWD A;  1ZXI C;  1VQ4 1;  1X2G A;  2QAE A;  1YUA A;  3MY9 A;  1YHQ Z;  3GTL I;  3NFZ A;  1K73 2;  1KCZ A;  1EBH A;  3GCF A;  1BKH A;  1F8W A;  3CD6 1;  3UCD A;  4BY1 I;  4H4Q A;  5LL6 f;  1BQG A;  3A7U A;  1ECQ A;  1N61 C;  3BJS A;  2GGE A;  4NBA A;  1YIT Z;  1Z03 A;  1VQ6 Z;  3MWC A;  3MSY A;  2E9H A;  3I55 Z;  1BZL A;  3PO3 I;  3DJJ A;  3FG2 P;  3UXL A;  1H6V A;  1KD0 A;  1ZK7 A;  2YVJ A;  2ZZ0 A;  3NVZ B;  3ZVI A;  1OEP A;  2DW7 A;  1PDZ A;  3R1Z A;  2OX4 A;  4ZOH B;  3VC6 A;  4EQW A;  4S1T A;  4MGG A;  5FS9 A;  2RHB A;  2B63 I;  4HCD A;  3VFC A;  2JA7 I;  3QWU A;  1NJI 1;  1VQL 1;  2KPI A;  3A7R A;  3R11 A;  1KRL A;  4E32 A;  2V6O A;  3RNM A;  4GRT A;  3N6H A;  4E4U A;  3Q6J A;  1F3P A;  1P9N A;  3JAM b;  3GD6 A;  1YI2 1;  3QTP A;  1VQP Z;  5FJU A;  5TR3 A;  4H1Z A;  2IZ3 A;  3THU A;  4K7Z A;  1JOA A;  3KIF A;  3PO3 S;  3CCQ 1;  4K8G A;  3I6T A;  1Y1V I;  1TZZ A;  1QVG Y;  1KKR A;  3UGV A;  3NDI A;  1GET A;  1GV4 A;  4A35 A;  1YJW 1;  3EED A;  1M1K 2;  1VQ7 Z;  3MUC A;  2WPE A;  3NVY B;  3NXL A;  2AKM A;  3GTM I;  1ONF A;  3DG3 A;  1ZY8 A;  1MNS A;  1AOG A;  1FIQ B;  3GO2 A;  3MZN A;  6ENL A;  1JWH C;  3FQM A;  2BJO A;  1TYP A;  2R6M A;  2AYD A;  2JA5 I;  1VQL Z;  1VQ9 Z;  4FP1 A;  5D1P A;  3IJQ A;  2RIQ A;  3J80 b;  1USP B;  2C3D A;  2I3C A;  1Y1V S;  3CGE A;  1M90 1;  2GL5 A;  3PG6 A;  3FV9 A;  3DFH A;  4HPN A;  2M6N A;  3CCQ Z;  3F3F C;  2WAQ A;  4NEV A;  2AKZ A;  3GTM S;  1NU5 A;  2CDU A;  1FEB A;  3S47 A;  3II4 A;  4H4U A;  2Q51 A;  2ZAD A;  4NOZ A;  2Q4Z A;  4RV9 A;  1TWF I;  1NHP A;  4KT2 A;  2VPZ A;  2W04 A;  2PK7 A;  3BG1 B;  3TTE A;  5A2Q f;  2O56 A;  2P8B A;  2YQU A;  3G4S 1;  2PTZ A;  3R07 C;  1KD1 2;  3CAW A;  1WYG A;  1PDY A;  2OQY A;  2WP6 A;  4TNU A;  4E33 A;  1Q81 1;  1K9M 1;  1D7Y A;  1K8A 1;  2P3Z A;  3MQT A;  4KPL A;  4E8G A;  4FI4 A;  2XH7 A;  1MDL A;  5GRT A;  3MZK B;  4EQR A;  5KVH A;  2JIP A;  2W0H A;  2ZZC A;  2V3B A;  3VTN A;  4FDC B;  3EAO A;  3IX0 A;  3CCU 1;  4MMW A;  3V4B A;  1GRF A;  1LQL A;  4HCL A;  3GKQ A;  4IP4 A;  5FJT A;  2DE7 A;  3FQQ A;  3VCC A;  3GRS A;  1MUC A;  3CGB A;  4Z1Y A;  1QVF Y;  4NBF A;  2EQ9 A;  2PMZ A;  1FHU A;  3JW7 A;  3CCJ 1;  2BCP A;  3O0H A;  2QRE B;  2V8K A;  4JQ9 A;  4KPR A;  3G71 1;  3NO1 A;  4GYP C;  3IFU A;  1DXL A;  4RVH A;  3T8Q A;  1VQ8 1;  4HNL A;  2X50 A;  1TWC I;  3CCR 1;  3RR1 A;  1YQZ A;  5IP7 I;  3OZY A;  2P0I A;  4ZCW A;  3S2H I;  1SB3 B;  4DN1 A;  4EMI A;  2EQ8 A;  3V3W A;  3D2L A;  1WW9 A;  3GRT A;  3S14 I;  2P28 A;  3NFU A;  3HKZ A;  1TWA I;  1WJ2 A;  1VQM Z;  1X2H A;  3N4F A;  4JDR A;  3TOY A;  4YWS A;  3IR7 A;  3K7A I;  3CCJ Z;  2OKT A;  2WB1 A;  1GRA A;  4NBE A;  4K2S A;  5IP9 I;  1YHQ 1;  3G6E Z;  3CGD A;  1FO4 A;  3A7A A;  2XH0 A;  3NH4 A;  4KEM A;  5FJO A;  5C3E I;  3J81 b;  2WOI A;  3STP A;  4ADW A;  1N63 C;  1XAN A;  2R7Z I;  2GR2 A;  3AMZ A;  3PK7 A;  4H2H A;  3SJN A;  5D1O B;  3M4O I;  1DNC A;  3VC5 A;  2JIM A;  2JK6 A;  3ETR B;  3PFR A;  1YIT 1;  2V45 A;  1VQ6 1;  2QGY A;  1KQS Y;  4NBB A;  2OPJ A;  3PWI A;  2YVG A;  3R25 A;  2JR6 A;  1GSN A;  3I55 1;  4E2Y A;  1GES A;  2JIR A;  4A3I I;  2ZAE B;  1GRE A;  4MD8 A;  2AL2 B;  4A3L I;  3S1Q I;  5ENL A;  4DX3 A;  5JCK A;  3NZG A;  1TWG I;  4E30 A;  4E4F A;  2G2K A;  3SN0 A;  2PSN A;  1YUK A;  2QJJ A;  4E5T A;  5T6B A;  1ONE A;  1NUI A;  1E9I A;  4A3F I;  3GTQ I;  1NJI 2;  3GTG I;  2AKL A;  4Y7N I;  2OO6 A;  2JMO A;  1EC7 A;  2HF1 A;  2KI7 B;  4HCH A;  4IHC A;  1VQP 1;  3TWB A;  2QDE A;  4NEW A;  1WUE A;  3IJL A;  3ZVH A;  1T3Q C;  5JCL A;  2IV2 X;  2WP5 A;  5KVI A;  4EMW A;  4A3B I;  4HYR A;  1GER A;  4CL1 A;  1VQ7 1;  2E2J I;  1VQN 1;  2NVQ I;  3LUS A;  2GQW A;  2PA6 A;  3HW2 A;  4NBC A;  4GME A;  4QTU A;  3P0W A;  1JDF A;  2VF1 A;  4APN A;  3CCL 1;  2OZ8 A;  2K5R A;  3DDM A;  5C4J I;  1QVF Z;  1VQ9 1;  1JJ2 Y;  2PU1 A;  1NHS A;  2YU9 I;  3D46 A;  2XSX A;  2P3Y A;  3QKE A;  2PS2 A;  3H70 A;  3I56 Z;  3H0G I;  4QTT A;  1WCM I;  2WBA A;  3LXD A;  4GYP A;  1M90 2;  4H4Z A;  3EER A;  4DHG A;  5T64 A;  2JA6 I;  5IT9 f;  3I07 A;  3CXC Z;  1K4Q A;  3UJ2 A;  1Q1R A;  2F4M A;  3DGH A;  1ZKQ A;  2LFU A;  2JA8 I;  1VQN Z;  1QXF A;  1MRA A;  3DH9 A;  1ZH1 A;  4G7F A;  2Y0S A;  2OZ3 A;  3DG6 A;  1TE6 A;  5D1O A;  3CCL Z;  4MRI A;  3S1R I;  2GTH A;  4J3Z A;  2K3R A;  2QKD A;  3DK4 A;  2VUG A;  2NAP A;  3P93 A;  4H4V A;  1RNI A;  1NDA A;  3CYJ A;  3HOW I;  2AL2 A;  2O53 A;  4JHM A;  1Y1W I;  1TKK A;  3ENL A;  4NBD A;  1Q81 2;  1K9M 2;  2E3T A;  2X8C A;  3MON A;  1K8A 2;  3GC2 A;  4EMJ A;  3SN4 A;  1Q16 A;  2MUC A;  3CC4 Z;  2OG9 A;  2H85 A;  3GD4 A;  2QEX 1; 
#chains in the Genus database with same CATH homology
 1R9T I;  2DE6 A;  1GRH A;  3CMA Z;  3GTJ I;  3DJG X;  5FLX b;  1K83 I;  1W2B Y;  1N2F A;  1EBD A;  1ZMD A;  2EGT A;  3JAM f;  4A93 I;  3L5O A;  3RZD I;  3GTP I;  2NVX I;  3CC2 Z;  4EQS A;  4MD9 A;  3U50 C;  1YJ9 Z;  3HOV I;  5JCM A;  3QFA A;  2QEX Z;  1I6H I;  4E2W A;  2E2H I;  1Q82 1;  3J7A 4;  1Q7Y 1;  1VQM 1;  3DK8 A;  2GRT A;  3G6E 1;  3J80 f;  2HQM A;  1YJN 1;  1NP6 A;  3LAD A;  4H4P A;  5FS8 A;  5JRB A;  4NFR A;  2RBL A;  1GRB A;  3CCM Z;  2W03 A;  1S7M A;  2EQ6 A;  1ZMC A;  3URH A;  3ESW A;  1TFI A;  5ER0 A;  4E2Z A;  3IF8 A;  1QYP A;  2LIY A;  4RVF A;  1QVG Z;  2QRD B;  3CQZ I;  3NH8 A;  3OW2 Y;  4NBH A;  4AYB A;  2QR1 B;  1Q86 1;  3DK9 A;  2GR1 A;  3CPW Y;  2OTL 1;  3NDJ A;  4HGY A;  1JEH A;  1FEC A;  1YJN Z;  1NHQ A;  2GR0 A;  2QRC B;  4A3G I;  3VMI A;  2R92 I;  2NVT I;  3T4N B;  1SFO I;  2OTJ Z;  3H4K A;  2WOW A;  1WII A;  1VQO 1;  3QFB A;  1NPX A;  3I4N I;  1RO0 A;  5JCI A;  1L1O C;  2HU9 A;  4NH1 C;  1X0T A;  2OTL Z;  4K8D A;  2QLV B;  3MZL B;  2YAD A;  4NBG A;  5T67 A;  1W2B Z;  3I56 1;  3HOU I;  1MOK A;  4NB8 A;  2PM9 A;  2OOY B;  3VMG A;  4BBS I;  2NPX A;  3SQP A;  4EQX A;  1Q1W A;  3CGC A;  2QA4 Z;  2OZK A;  5IT9 b;  3CCV Z;  2WOV A;  3HOZ I;  1VQO Z;  4M52 A;  2CFY A;  3L8K A;  2E2I I;  4H4T A;  2OOX B;  1N8R 1;  1NHR A;  5FS6 A;  3D6W A;  5AN9 F;  3J81 f;  2R93 I;  4J56 A;  2VUM I;  2GH5 A;  3VB9 A;  3TDH B;  2GR3 A;  3S17 I;  3FKI I;  2C3C A;  3GD3 A;  1KC8 1;  2GU2 A;  3VMH A;  1PFT A;  1RQF A;  3CC4 1;  1VQK Z;  2V8J A;  4HH4 A;  5FS7 A;  1S72 1;  3RZO I;  4H4W A;  3DGZ A;  4A3J I;  4MH4 A;  3EF6 A;  3H3V J;  1VQ5 Z;  5C4X I;  3CMA 1;  3D9X A;  3LB8 A;  1ZX9 A;  3HOY I;  4Y52 I;  4H4X A;  1XHC A;  4LII A;  3OW2 Z;  2RPR A;  1DL6 A;  1ZB8 A;  1LVL A;  1K73 1;  2WPF A;  3P5J B;  3KLJ A;  1VQ4 Z;  1ZDL A;  5A2Q b;  3CPW Z;  5FMH A;  1Z02 A;  3CD6 Z;  3S16 I;  1TYT A;  3BG0 B;  4LA1 A;  3F3P C;  2RT9 A;  3CC2 1;  1YJ9 1;  3CME 1;  5CM2 M;  1ZB9 A;  4J57 A;  1XDI A;  5U1O A;  1RLY A;  1BWC A;  4A3M I;  1S72 Z;  3S1M I;  4A3C I;  4EM3 A;  1KQS Z;  1Q82 2;  4FX9 A;  1Q7Y 2;  1GXF A;  2BC0 A;  3IC9 A;  2YAU A;  2ZZB A;  2F5Z A;  4BV6 A;  1GRT A;  4H50 A;  4BUR A;  5C44 I;  3CCM 1;  3CCE 1;  1YI2 Z;  2NVY I;  1X3W A;  3S2D I;  3CME Z;  1RO4 A;  1LPF A;  1M1K 1;  1V59 A;  3M3Y I;  1YJW Z;  2RAB A;  3KIH A;  3NH5 A;  4NB9 A;  3CCS 1;  2WPC A;  3OC4 A;  1Q86 2;  4GR1 A;  4H4S A;  2JS4 A;  2X8G A;  3CC7 1;  5EBK A;  2GTI A;  1RO2 A;  3S1N I;  4EM4 A;  2F4O A;  4RVG A;  1JJ2 Z;  4A3D I;  4DQY B;  2IZ4 A;  4BY7 I;  4H4R A;  4X6A I;  2M48 A;  3Q87 A;  3CCE Z;  2EQ7 A;  2OTJ 1;  2R9Z A;  2X8H A;  4YWO A;  1MO9 A;  1H2I A;  4BXX I;  2JNY A;  4BBR I;  3PO2 I;  4MD7 A;  5FLX f;  2AAQ A;  1ML8 A;  2J3N A;  4DNA A;  3EAN A;  4EWC A;  3CCS Z;  2V3A A;  3S15 I;  4HGZ A;  3GTK I;  1KD1 1;  5FLM I;  3G4S Z;  2J6A A;  4MXU A;  3CC7 Z;  4A3E I;  4H4Y A;  1KN0 A;  2YVF A;  3CXC Y;  1TWH I;  1VLA A;  2BC1 A;  2QA4 1;  1I3Q I;  3CCU Z;  4RVD A;  2NVK X;  3CCV 1;  1I50 I;  4RS4 A;  1YIJ 1;  1QF8 A;  4E31 A;  1USP A;  4MON A;  1Z01 A;  1N8R 2;  1FEA A;  3G71 Z;  2V8I A;  4XX2 A;  3HOX I;  1VQ8 Z;  1X3Z A;  4DK1 A;  3CCR Z;  1KC8 2;  1VQK 1;  2DE5 A;  4E2X A;  4DGL A;  2TPR A;  3GTO I;  1VQ5 1;  3I4M I;  2A8X A;  1GEU A;  2O4H A;  1YIJ Z;  1OJT A;  1M6I A;  5U25 A;  2JUB A;  2X99 A;  4A3K I;  1GRG A;  3TE5 B;  5JCN A;  1VQ4 1;  2QAE A;  1YUA A;  1YHQ Z;  3GTL I;  3NFZ A;  1K73 2;  3GCF A;  1F8W A;  3CD6 1;  4BY1 I;  4H4Q A;  5LL6 f;  4NBA A;  1YIT Z;  1Z03 A;  1VQ6 Z;  2E9H A;  3I55 Z;  1BZL A;  3PO3 I;  3DJJ A;  3FG2 P;  1H6V A;  1ZK7 A;  2YVJ A;  2ZZ0 A;  4EQW A;  4S1T A;  5FS9 A;  2RHB A;  2B63 I;  2JA7 I;  3QWU A;  1NJI 1;  1VQL 1;  2KPI A;  3RNM A;  1KRL A;  4E32 A;  2V6O A;  4GRT A;  3Q6J A;  1F3P A;  1P9N A;  3JAM b;  1YI2 1;  1VQP Z;  5TR3 A;  2IZ3 A;  4K7Z A;  1JOA A;  3KIF A;  3PO3 S;  3CCQ 1;  1Y1V I;  1QVG Y;  3NDI A;  1GET A;  1GV4 A;  1YJW 1;  3EED A;  1M1K 2;  1VQ7 Z;  2WPE A;  3GTM I;  1ONF A;  1ZY8 A;  1AOG A;  1JWH C;  3FQM A;  2BJO A;  1TYP A;  2R6M A;  2JA5 I;  1VQL Z;  1VQ9 Z;  5D1P A;  2RIQ A;  3J80 b;  1USP B;  2C3D A;  2I3C A;  1Y1V S;  3CGE A;  1M90 1;  3PG6 A;  2M6N A;  3CCQ Z;  3F3F C;  2WAQ A;  4NEV A;  2CDU A;  3GTM S;  1FEB A;  3II4 A;  4H4U A;  2Q51 A;  4NOZ A;  2Q4Z A;  4RV9 A;  1TWF I;  1NHP A;  2W04 A;  2PK7 A;  3BG1 B;  5A2Q f;  2YQU A;  3G4S 1;  1KD1 2;  2WP6 A;  4TNU A;  4E33 A;  1Q81 1;  1K9M 1;  1D7Y A;  1K8A 1;  5KVH A;  5GRT A;  3MZK B;  4EQR A;  2W0H A;  2ZZC A;  2V3B A;  3VTN A;  4FDC B;  3EAO A;  3IX0 A;  3CCU 1;  1GRF A;  1LQL A;  3GKQ A;  2DE7 A;  3FQQ A;  3GRS A;  3CGB A;  1QVF Y;  4NBF A;  2EQ9 A;  2PMZ A;  3CCJ 1;  2BCP A;  3O0H A;  2QRE B;  2V8K A;  4JQ9 A;  4KPR A;  3G71 1;  3IFU A;  1DXL A;  4RVH A;  1VQ8 1;  2X50 A;  1TWC I;  3CCR 1;  1YQZ A;  5IP7 I;  3S2H I;  4EMI A;  2EQ8 A;  1WW9 A;  3GRT A;  3S14 I;  2P28 A;  3HKZ A;  1TWA I;  1VQM Z;  4JDR A;  3K7A I;  3CCJ Z;  2WB1 A;  1GRA A;  4NBE A;  5IP9 I;  1YHQ 1;  3G6E Z;  3CGD A;  3NH4 A;  4ADW A;  5C3E I;  3J81 b;  2WOI A;  1XAN A;  2R7Z I;  2GR2 A;  5D1O B;  3M4O I;  1DNC A;  2JK6 A;  1YIT 1;  1VQ6 1;  1KQS Y;  4NBB A;  2YVG A;  2JR6 A;  1GSN A;  3I55 1;  4E2Y A;  1GES A;  1GRE A;  4A3I I;  2ZAE B;  4MD8 A;  4A3L I;  3S1Q I;  5JCK A;  1TWG I;  4E30 A;  2G2K A;  1YUK A;  5T6B A;  1NUI A;  4A3F I;  3GTQ I;  1NJI 2;  3GTG I;  2AKL A;  4Y7N I;  2JMO A;  2HF1 A;  2KI7 B;  1VQP 1;  4NEW A;  5JCL A;  2WP5 A;  5KVI A;  4EMW A;  4A3B I;  1GER A;  4CL1 A;  1VQ7 1;  2E2J I;  1VQN 1;  2NVQ I;  3LUS A;  2GQW A;  4NBC A;  4QTU A;  2VF1 A;  4APN A;  3CCL 1;  2K5R A;  5C4J I;  1QVF Z;  1VQ9 1;  1JJ2 Y;  1NHS A;  2YU9 I;  2P3Y A;  3I56 Z;  3H0G I;  4QTT A;  1WCM I;  2WBA A;  3LXD A;  1M90 2;  4H4Z A;  3EER A;  5T64 A;  2JA6 I;  5IT9 f;  3I07 A;  3CXC Z;  1K4Q A;  1Q1R A;  2F4M A;  3DGH A;  1ZKQ A;  2LFU A;  2JA8 I;  1VQN Z;  3DH9 A;  1ZH1 A;  2Y0S A;  5D1O A;  3CCL Z;  4MRI A;  3S1R I;  2GTH A;  2K3R A;  2QKD A;  3DK4 A;  2VUG A;  4H4V A;  1RNI A;  1NDA A;  3HOW I;  2O53 A;  1Y1W I;  4NBD A;  1Q81 2;  1K9M 2;  2X8C A;  3MON A;  1K8A 2;  4EMJ A;  3CC4 Z;  2H85 A;  3GD4 A;  2QEX 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...