3D9XA

Structure of the head of the bartonella adhesin bada
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
114
structure length
114
Chain Sequence
GGWNLTVNNDNNTVVSSGGALDLSSGSKNLKIVKDGKKNNVTFDVARDLTLKSIKLDGVTLNETGLFIANGPQITASGINAGSQKITGVAEGTDANDAVNFGQLKKIETEVKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adhesin A
publication title Structure of the head of the Bartonella adhesin BadA
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Cell adhesion
total genus 13
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05662 YadA_stalk Coiled stalk of trimeric autotransporter adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.490 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3d9xA01
3.30.390.90 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3d9xA02
3D9XA 1S7MA
chains in the Genus database with same CATH superfamily
3EKGA 4HNLA 2V45A 3VTNA 1YJNZ 3NRZB 3EAOA 1KD11 2LEXA 3IJIA 2NVXI 3CXCY 2DW7A 3Q6JA 3RNMA 3N6JA 4J57A 1K83I 1GRAA 1VQ71 2P3YA 5J04A 1I3QI 4KT2A 3QWUA 3P0WA 3DDMA 4ENLA 3BSMA 2OTJ1 2PS2A 3GTOI 2OO6A 3CXOA 3GY1A 1NHPA 2DW6A 3DESA 1VQNZ 1NHRA 3TQPA 2AAQA 5FS8A 2OTLZ 2V3VA 3G711 1WUFA 3N6HA 3HOWI 2A8XA 2CHRA 1P48A 4DGLA 7ENLA 1NU5A 1GRFA 1H2IA 5IP9I 4MD8A 1JEHA 2OQYA 2POZA 5FS6A 1Z02A 4Z1YA 1YJW1 4GGHA 4DN1A 3TJIA 1SFOI 2FKPA 2QREB 3D47A 1L1OC 3CK5A 4DNAA 3FVDA 1EBDA 2W0HA 4MD9A 1TYPA 2P3ZA 5JCMA 5C4JI 3I6EA 3DGZA 1VQ6Z 3IJLA 3LXDA 4E8GA 1TYTA 1VQO1 1MRAA 4NOZA 1TWCI 2R7ZI 1BZLA 1W2BY 3CCJ1 1DL6A 3EF6A 1EC7A 3CPWZ 2GGIA 1RNIA 3RITA 1YQZA 3CCRZ 1VQLZ 1NDAA 2FYMA 1M6IA 1USPA 2YU9I 2JMOA 2O53A 2BCPA 3SSZA 3HOZI 4H2HA 3CCS1 1XANA 2IZ3A 2WP6A 3VMGA 2GGGA 3NDJA 2HXTA 3HOUI 2P28A 1F3PA 2ZADA 2W04A 3PG6A 2R6MA 1JPMA 2V3BA 2ZZ0A 5FS7A 1VQMZ 2LIYA 3R07C 3NFUA 4K1WA 3GTGI 1YIJ1 4GYPC 1NJI2 3TOYA 4DHGA 2JR6A 3THUA 1Z01A 3GTPI 1USPB 1JJ2Z 2AL1A 2OX4A 4EWJA 4E33A 3N4FA 1GXFA 3KLJA 2V6OA 5A2Qb 2OLAA 1GREA 1XS2A 3CC7Z 1EBGA 1YEYA 3S17I 1I6HI 3DJGX 3EEDA 4FP1A 4MGGA 4ZA0A 3P5JB 4BBSI 2PU0A 1Q821 3FG2P 4G7FA 3DEQA 3TDHB 3GD4A 2JNYA 2E2JI 1XHCA 1FEAA 1TFIA 5IT9f 2QQ6A 3OW1A 1ZK7A 4H4VA 3IFUA 3LADA 5U1OA 1K9M1 1VDVA 3DG7A 1Q812 3CCQZ 3MZLB 1YITZ 1V59A 2WPCA 1Q16A 2IZ4A 3M3YI 3O0HA 2XGZA 3JAMf 4MRIA 1KKOA 1JROA 3R25A 5IDZA 1TWFI 2R92I 3MUCA 1N8R1 2VUMI 2QRDB 4QTTA 1VQPZ 3GO2A 3Q45A 5JCNA 2WB1A 2OZ3A 4MONA 1JCTA 2JIRA 1WJ2A 1VQK1 3CPWY 5D1OB 1NHQA 1YHQZ 1FEBA 3EUB3 4IT1A 3A7UA 4A3JI 3DIPA 4KPLA 2NAPA 4TVWA 1RM6B 1S72Z 3S2HI 1Q7Y1 2GTIA 1VQ5Z 4FI4A 2OOYB 1N62C 3OPSA 1YJN1 3RGTA 1XPYA 5T64A 4MXUA 3ZVIA 2PPGA 2VPZA 3H3VJ 1KC81 2PMQA 3L5OA 4AYBA 1RO4A 2GQWA 2NPXA 3CXBA 3CCEZ 1STZA 4GYPA 1JJ2Y 1VQ8Z 3VA8A 3ZVHA 1Q1WA 4EQXA 2MUCA 1RQFA 2ZAEB 4RVFA 2YVFA 1R0MA 2HU9A 1L8PA 3UJ2A 2E9HA 1VQN1 5T6BA 1SJAA 3I56Z 2GRTA 2GSHA 2OTL1 4YWOA 3H0GI 4BY1I 1M1K1 2PP0A 3OC4A 4HPNA 1ZMDA 3UJRA 1M901 1X3ZA 4QTUA 1TE6A 1WYGA 4HCLA 4TVYA 3ZVHB 3CB3A 2WPFA 1WZNA 4A3LI 1SIWA 1YUKA 3GCFA 2GR0A 4HCDA 4JHMA 3ZLGA 3LB8A 4H4XA 3K7AI 1F8WA 2C3CA 3U9IA 1QYPA 2QDDA 3AMZA 4HGYA 3OP2A 1N61C 4EMIA 3UJFA 4H4SA 4E32A 1VQ61 5EBKA 3NVVB 3L8KA 2I5QA 3HOYI 2M48A 1VQ9Z 4E5TA 2X8CA 4A3RA 2YAUA 2P88A 3CCR1 3RZOI 1FFVC 1GETA 1WUEA 4Y7NI 3GTLI 1H6VA 4NEWA 4ZCWA 4NBDA 2O4HA 1GV4A 1PDZA 3T6CA 2K5RA 3NH8A 4E2YA 3HOXI 2V8IA 1VQM1 3GTJI 2EQ9A 1K732 2QRCB 2H85A 1SJDA 2HQMA 1NPXA 3CC41 2ZZBA 4MD7A 2RABA 2WPEA 3S2DI 5FLXf 3V5CA 2W54A 3R0UA 2GDQA 2EQ8A 3MSYA 2AKZA 3J80f 2EQ7A 2B63I 1Q1RA 2X50A 3ZLHA 4NBHA 1Y1WI 1BKHA 3SR6B 2E2HI 4EWCA 2GGJA 3OZYA 3J81f 1ML8A 1FIQB 4H4ZA 4EMJA 1ZH1A 3AN1A 4H4PA 4IP5A 1SB3B 1ZX9A 4TNUA 5U25A 2XSXA 1FFUC 3FYYA 3S14I 1YI2Z 4A3FI 1GRTA 3BJSA 3NZGA 4GFIA 3SN0A 2QLVB 2X8HA 2JA7I 2X8GA 3GC2A 2QEXZ 1ZXIC 3QFAA 2JIOA 3CCQ1 1YIT1 1FO4A 3CCMZ 3DK8A 5ER0A 2VPYA 2AYDA 4DXKA 3DH9A 2GH5A 3II4A 3NVWB 1KQSY 2BC0A 5G5HB 3CC21 3TCSA 4NBBA 3VMHA 4DQYB 1MDRA 4E4FA 1VQ4Z 3IC9A 5KVIA 2OFJA 3GKQA 3CQZI 1YJ91 2CFYA 5FJPA 1QVGZ 5FJUA 1LPFA 4E4UA 3HPFA 1YHQ1 2E5AA 5C3EI 2ONEA 3CCVZ 4JQ9A 5GRTA 3V4BA 2QAEA 2MNRA 3CT2A 4DYEA 3Q4DA 4EQRA 3EANA 1S721 3JZUA 2RHBA 3NH4A 1VQ51 2ZZCA 3SBFA 3SN4A 1VQ7Z 3S1RI 3AM9A 1I50I 1SJBA 3S47A 3QTPA 4H83A 1JPDX 4E2ZA 3T8QA 5FLMI 2GGEA 3ENLA 2GTHA 3IK4A 2KI7B 2RPRA 1FDIA 2QGYA 4EM3A 5C4XI 5FS9A 1GRGA 2Q4ZA 2PTYA 3CCE1 1ZY8A 4MH4A 1K8A1 1VQ81 2JUBA 2HZGA 2QVHA 5AN9F 1JRPA 2PTZA 2AKLA 1Q862 3GTKI 3IR7A 4E31A 2YQUA 3CCLZ 2WOIA 3GRSA 3NO1A 3QPEA 2RBLA 3CGBA 4BURA 4GIRA 5D1OA 1GEUA 1KN0A 4J56A 3TTEA 4MKSA 3SQPA 6ENLA 1T3QC 2PMZA 3I561 3PWGA 4NBFA 4H4YA 4EQSA 3SN1A 3CMEZ 4NBCA 3CD6Z 2OPJA 3DG6A 3UJEA 2AL2B 3D6WA 2KPIA 3CAWA 3D2LA 1JOAA 3P93A 3D9XA 4NEVA 1EC9A 3B97A 4LA1A 4HNCA 3J80b 2JIPA 4EM4A 2PM9A 4GR1A 4K8DA 4A35A 4JDRA 2GR3A 2DE6A 2QR1B 4K2SA 2F5ZA 3TW9A 4A3II 3DG3A 1QF8A 4LIIA 3EEZA 4H4QA 1GSNA 4E2XA 1EC8A 5FJTA 3VMIA 4M0XA 4HH4A 1VQ91 5LL6f 2PODA 3NFZA 4E2WA 2P8BA 4M52A 1DXLA 2GL5A 3HW2A 1Q822 1QVGY 3VDGA 3IJQA 3F3FC 3A7RA 2AKMA 3DGHA 4H19A 3SJNA 2R93I 2YVJA 4RVHA 3S5SA 3I55Z 3PO2I 3JW7A 1NP6A 3QLDA 4ZOHB 3SQSA 4ADWA 3M4OI 2W55A 4IL0A 1VLAA 1MOKA 2TPRA 2PCEA 3V3WA 1FHVA 3U4FA 3B9JB 4MMWA 1X0TA 4A3BI 3ETRB 4NBGA 2W3SA 1KKRA 3TWBA 2GGHA 3KIHA 3H70A 4K7ZA 4M6UA 1KD0A 1N8R2 2G2KA 3NVYB 4A3GI 2WAQA 1QVFZ 4NBEA 2XH0A 3R11A 4E6MA 2F4MA 3G6EZ 1TWAI 3CCUZ 3DFYA 3VCCA 2PA6A 1AOGA 1ZDLA 1GRHA 3VFCA 1F9CA 1KQSZ 4EQWA 3UXKA 5C44I 5JCKA 1FDOA 2P8CA 4H50A 2NVYI 1NELA 3G4SZ 4XX2A 1NHSA 2C3DA 1X3WA 1ZMCA 2YADA 1TWHI 1OJTA 4KPRA 3CMAZ 5IT9b 4RS4A 1D7YA 1TKKA 3BOXA 2QA4Z 3S16I 2QEX1 4X6AI 3MWCA 3U50C 1KC82 1ZB9A 1VQL1 1ELSA 1LVLA 1Z03A 3CCM1 3I6TA 2NQLA 2PTXA 3NDIA 3UCCA 3JAMb 3FXGA 3P3BA 2PSNA 5FJOA 3RRAA 1ZKQA 2J3NA 3DK4A 2NVQI 3V5FA 2OKTA 1VQ41 3S1MI 1MO9A 2OZTA 3PWIA 3R1ZA 2PU1A 5A2Qf 4H1ZA 2WP5A 3DERA 2EGTA 1M1K2 3JVAA 4GISA 1RO0A 4NB8A 3CCV1 1PFTA 4NBAA 3J7A4 3F3PC 1M902 1BWCA 3FQMA 2Q51A 1K4QA 1WW9A 1AA6A 3GD3A 3UJSA 3VCNA 4BY7I 4K8GA 3UXLA 4KEMA 3CC71 2K3RA 5IP7I 1TZZA 4IL2A 4IZGA 3ES7A 3S1QI 4RVGA 2W3RA 2YVGA 2QJNA 4JN8A 3T9PA 3T4NB 3S1NI 3GTMI 4YWSA 2OVLA 2HNEA 1ECQA 1MUCA 2LFUA 2PP1A 3OZMA 4H4TA 5EU9A 3VB9A 1KD12 3PO3I 3RCYA 1NJI1 2RDXA 2OOXB 4BBRI 3MONA 1QVFY 3CCL1 1RVKA 2OZKA 3FCPA 4G8TA 3DFHA 3FQQA 3LUSA 1BQGA 1XDIA 1IYXA 2PGEA 4IP4A 4RV9A 4EMWA 4F4RA 2EQ6A 1N5XA 3CME1 4IHCA 3CD61 4A3CI 2X99A 3HRDC 3QKEA 1VQP1 4FX9A 3VC5A 3H7VA 4A6GA 1FHUA 3DK9A 2M6NA 3HOVI 2PTWA 1Y1VS 2VPWA 4NFRA 1WCMI 5JCLA 4GGBA 2PP3A 1Q861 1OEPA 3HKZA 4H4UA 1P43A 1KRLA 1Q811 1RLYA 2E2II 2E3TA 2OG9A 3KIFA 2QDEA 5BOEA 3GTQI 4DX3A 3ESWA 3R0KA 2I3CA 2OTJZ 1GRBA 1R9TI 2O56A 3MQTA 3UGVA 3OTRA 2F4OA 5KVHA 2VPXA 4RVDA 3URHA 3FV9A 3RZDI 3I4MI 2HF1A 2E7ZA 1NUIA 2DE5A 2AL2A 2CDUA 1KCZA 2DE7A 3STPA 4DWDA 3I551 3G71Z 5FJRA 3GTMS 2P0IA 3CC4Z 1QXFA 3MZKB 1TWGI 5FMHA 3H12A 3VC6A 2RT9A 4NH1C 1E9IA 4HCHA 3TE5B 4NB9A 3OW2Z 3PO3S 3MKCA 2WOWA 1ONEA 4A3EI 1YJWZ 3A7AA 3NH5A 1ONFA 3MZNA 5TR3A 3I4NI 3IF8A 2NVTI 1EBHA 2VUGA 1X2HA 5FLXb 2R9ZA 2JS4A 2XH4A 4Z17A 1X2GA 3QN3A 3BG1B 3G6E1 3CCU1 1VQOZ 4Y52I 3MY9A 3NS1B 3Q87A 3J81b 3D46A 1N63C 3CCJZ 3RR1A 3ES8A 4GRTA 3FJ4A 1Y8CA 2OZ8A 4H4WA 3G4S1 3ZLFA 3I07A 2IV2X 3QFBA 3CMA1 5G5GB 3TJ4A 2PGWA 4KWSA 4APNA 3CCSZ 1GERA 5JRBA 1YUAA 2V8JA 5ENLA 2W03A 5T67A 4CL1A 2Y0SA 2QA41 3CC2Z 1DTNA 2QJMA 2WOVA 2JA5I 3CGDA 3RO6A 4A3DI 4J1OA 4S1TA 2J6AA 3CXCZ 1K8A2 1YIJZ 2XH7A 1K9M2 1YJ9Z 4E30A 2NVKX 1N5WC 3GRTA 4HYRA 4J3ZA 4BXXI 4A3KI 2JIMA 2ZC8A 3TWAA 4H4RA 2HXUA 1MNSA 2GR1A 1SJCA 4ROPA 1S7MA 4JN7A 4BV6A 2V8KA 4DK1A 2RIQA 3FKII 2OQHA 1RO2A 3GD6A 4GMEA 1LQLA 1VQZA 2V3AA 1JDFA 1R6WA 1N60C 1V97A 3CYJA 5CM2M 1DNCA 5BOFA 3UCDA 4HN8A 3IX0A 4HGZA 1MDLA 3OW2Y 5JCIA 2GR2A 2BC1A 3DJJA 1Q7Y2 3NVZB 1ZB8A 3BG0B 1YI21 2XH2A 1N2FA 4A93I 1K731 2JIQA 2JK6A 3CGEA 1WIIA 3PK7A 4X2PA 3I4KA 1W6TA 3H4KA 3KUMA 5D1PA 3DGBA 3R10A 1W2BZ 1PDYA 2QJJA 3T4WA 1VQKZ 1Y1VI 2VF1A 1JWHC 4A3MI 3H8AA 3EERA 2BJOA 2PK7A 3PFRA 3S15I 2QKDA 3NXLA 2JA8I 1GESA 1P9NA 2JA6I 1FECA 2WBAA 3CGCA 3K1GA 2GU2A 3N4EA 4FDCB
chains in the Genus database with same CATH topology
3VTNA 1YJNZ 1KD11 2NVXI 3CXCY 3Q6JA 3RNMA 4J57A 1K83I 1GRAA 1VQ71 2P3YA 1I3QI 3QWUA 2OTJ1 3GTOI 1NHPA 1VQNZ 1NHRA 2AAQA 5FS8A 2OTLZ 3G711 3HOWI 2A8XA 4DGLA 1GRFA 1H2IA 5IP9I 4MD8A 1JEHA 5FS6A 1Z02A 1YJW1 1SFOI 2QREB 1L1OC 4DNAA 1EBDA 2W0HA 4MD9A 1TYPA 5JCMA 5C4JI 3LXDA 3DGZA 1VQ6Z 1TYTA 1VQO1 4NOZA 1TWCI 2R7ZI 1BZLA 1W2BY 3CCJ1 1DL6A 3EF6A 3CPWZ 1RNIA 1YQZA 3CCRZ 1VQLZ 1NDAA 1M6IA 1USPA 2YU9I 2JMOA 2O53A 2BCPA 3HOZI 3CCS1 1XANA 2IZ3A 2WP6A 3VMGA 3NDJA 3PG6A 3HOUI 2P28A 1F3PA 2W04A 2R6MA 2V3BA 2ZZ0A 5FS7A 1VQMZ 2LIYA 3GTGI 1YIJ1 1NJI2 2JR6A 1Z01A 3GTPI 1USPB 1JJ2Z 4E33A 1GXFA 3KLJA 2V6OA 5A2Qb 1GREA 3CC7Z 3DJGX 3S17I 1I6HI 3EEDA 3P5JB 4BBSI 1Q821 3FG2P 3TDHB 3GD4A 2JNYA 2E2JI 1XHCA 1FEAA 1TFIA 5IT9f 4H4VA 5U1OA 1ZK7A 3IFUA 3LADA 1K9M1 1Q812 3CCQZ 3MZLB 1YITZ 1V59A 2WPCA 2IZ4A 3M3YI 3O0HA 3JAMf 4MRIA 1TWFI 2R92I 1N8R1 2VUMI 2QRDB 4QTTA 1VQPZ 5JCNA 2WB1A 4MONA 1VQK1 3CPWY 5D1OB 1NHQA 1YHQZ 1FEBA 4A3JI 1S72Z 3S2HI 1Q7Y1 2GTIA 1VQ5Z 2OOYB 1YJN1 5T64A 4MXUA 3H3VJ 1KC81 3L5OA 4AYBA 1RO4A 2GQWA 2NPXA 3CCEZ 1JJ2Y 1VQ8Z 1Q1WA 4EQXA 1RQFA 2ZAEB 4RVFA 2YVFA 2HU9A 2E9HA 1VQN1 5T6BA 3I56Z 2GRTA 2OTL1 4YWOA 3H0GI 4BY1I 1M1K1 3OC4A 1ZMDA 1M901 1X3ZA 4QTUA 2WPFA 4A3LI 1YUKA 3GCFA 2GR0A 3LB8A 4H4XA 3K7AI 1F8WA 2C3CA 1QYPA 4HGYA 4EMIA 4H4SA 4E32A 1VQ61 5EBKA 3L8KA 3HOYI 2M48A 1VQ9Z 2X8CA 2YAUA 3CCR1 3RZOI 1GETA 4NEWA 4Y7NI 3GTLI 1H6VA 4NBDA 2O4HA 1GV4A 2K5RA 3NH8A 4E2YA 3HOXI 2V8IA 1VQM1 3GTJI 2EQ9A 1K732 2QRCB 2H85A 2HQMA 1NPXA 3CC41 2ZZBA 4MD7A 2RABA 2WPEA 3S2DI 5FLXf 2EQ8A 3J80f 2EQ7A 2B63I 1Q1RA 2X50A 4NBHA 1Y1WI 2E2HI 4EWCA 3J81f 1ML8A 4H4ZA 4EMJA 1ZH1A 4H4PA 1ZX9A 5U25A 4TNUA 3S14I 1YI2Z 4A3FI 1GRTA 2QLVB 2X8HA 2JA7I 2X8GA 2QEXZ 3QFAA 3CCQ1 1YIT1 3CCMZ 3DK8A 5ER0A 3DH9A 2GH5A 3II4A 1KQSY 2BC0A 3CC21 4NBBA 4DQYB 3VMHA 1VQ4Z 3IC9A 5KVIA 3GKQA 3CQZI 1YJ91 2CFYA 1QVGZ 1LPFA 1YHQ1 5C3EI 3CCVZ 4JQ9A 5GRTA 2QAEA 4EQRA 3EANA 1S721 2RHBA 3NH4A 1VQ51 2ZZCA 1VQ7Z 3S1RI 1I50I 4E2ZA 5FLMI 2GTHA 4EM3A 2KI7B 2RPRA 5C4XI 5FS9A 1GRGA 2Q4ZA 3CCE1 1ZY8A 4MH4A 1K8A1 1VQ81 2JUBA 3EAOA 2YQUA 5AN9F 2AKLA 1Q862 3GTKI 3GRSA 4E31A 3CCLZ 2WOIA 2RBLA 3CGBA 4BURA 5D1OA 1GEUA 1KN0A 4J56A 3SQPA 4H4YA 2PMZA 3I561 4NBFA 4EQSA 3CMEZ 4NBCA 3CD6Z 3D6WA 2KPIA 1JOAA 3D9XA 4NEVA 4LA1A 3J80b 4EM4A 2PM9A 4GR1A 4K8DA 4JDRA 2GR3A 2DE6A 2QR1B 2F5ZA 4A3II 1QF8A 4LIIA 4H4QA 1GSNA 4E2XA 3VMIA 4HH4A 1VQ91 5LL6f 3NFZA 4E2WA 4M52A 1DXLA 1Q822 1QVGY 3F3FC 3DGHA 2R93I 2YVJA 4RVHA 3I55Z 3PO2I 1NP6A 4ADWA 3M4OI 1VLAA 1MOKA 2TPRA 1X0TA 4A3BI 4NBGA 3KIHA 4K7ZA 1N8R2 2G2KA 4A3GI 2WAQA 1QVFZ 4NBEA 2F4MA 1TWAI 3G6EZ 3CCUZ 1AOGA 1ZDLA 1GRHA 4EQWA 1KQSZ 5JCKA 5C44I 4H50A 2NVYI 3G4SZ 4XX2A 1NHSA 2C3DA 1X3WA 1ZMCA 2YADA 1TWHI 1OJTA 4KPRA 3CMAZ 5IT9b 4RS4A 1D7YA 2QA4Z 3S16I 2QEX1 4X6AI 3U50C 1KC82 1ZB9A 1VQL1 1LVLA 1Z03A 3CCM1 3NDIA 3JAMb 1ZKQA 2J3NA 3DK4A 2NVQI 1VQ41 3S1MI 1MO9A 5A2Qf 2WP5A 2EGTA 1M1K2 1RO0A 4NB8A 3CCV1 1PFTA 4NBAA 3J7A4 3F3PC 1M902 1BWCA 3FQMA 2Q51A 1K4QA 1WW9A 3GD3A 4BY7I 3CC71 2K3RA 5IP7I 3S1QI 4RVGA 2YVGA 3T4NB 3S1NI 3GTMI 2LFUA 4H4TA 3VB9A 1KD12 3PO3I 1NJI1 2OOXB 4BBRI 3MONA 1QVFY 3CCL1 2OZKA 3FQQA 3LUSA 1XDIA 4RV9A 4EMWA 2EQ6A 3CME1 3CD61 4A3CI 2X99A 4FX9A 1VQP1 3DK9A 2M6NA 3HOVI 1Y1VS 4NFRA 1WCMI 5JCLA 4H4UA 1Q861 3HKZA 1KRLA 1Q811 1RLYA 2E2II 3KIFA 3GTQI 3ESWA 2I3CA 2OTJZ 1GRBA 1R9TI 2F4OA 5KVHA 4RVDA 3URHA 3RZDI 3I4MI 2HF1A 1NUIA 2DE5A 2CDUA 2DE7A 3I551 3G71Z 3GTMS 3CC4Z 3MZKB 1TWGI 5FMHA 2RT9A 4NH1C 3TE5B 4NB9A 3OW2Z 3PO3S 2WOWA 4A3EI 1YJWZ 3NH5A 1ONFA 5TR3A 3I4NI 3IF8A 2NVTI 2R9ZA 2VUGA 5FLXb 2JS4A 3BG1B 3G6E1 3CCU1 1VQOZ 4Y52I 3Q87A 3J81b 3CCJZ 4GRTA 4H4WA 3G4S1 3I07A 3QFBA 3CMA1 4APNA 3CCSZ 1GERA 5JRBA 1YUAA 2V8JA 2W03A 5T67A 4CL1A 2Y0SA 2QA41 3CC2Z 2WOVA 2JA5I 3CGDA 4A3DI 4S1TA 2J6AA 3CXCZ 1K8A2 1YIJZ 1K9M2 1YJ9Z 4E30A 2NVKX 3GRTA 4BXXI 4A3KI 4H4RA 2GR1A 1S7MA 4BV6A 2V8KA 4DK1A 2RIQA 3FKII 1RO2A 1LQLA 2V3AA 5CM2M 1DNCA 3IX0A 4HGZA 3OW2Y 5JCIA 2GR2A 2BC1A 3DJJA 1Q7Y2 1ZB8A 3BG0B 1YI21 1N2FA 4A93I 1K731 2JK6A 3CGEA 1WIIA 3H4KA 5D1PA 1W2BZ 1VQKZ 1Y1VI 2VF1A 1JWHC 4A3MI 3EERA 2BJOA 2PK7A 3S15I 2QKDA 2JA8I 1GESA 1P9NA 2JA6I 1FECA 2WBAA 3CGCA 2GU2A 4FDCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9X A;  1S7M A; 
#chains in the Genus database with same CATH topology
 3EKG A;  4HNL A;  2V45 A;  3VTN A;  1YJN Z;  3NRZ B;  3EAO A;  1KD1 1;  2LEX A;  3IJI A;  2NVX I;  3CXC Y;  2DW7 A;  3Q6J A;  3RNM A;  3N6J A;  4J57 A;  1K83 I;  1GRA A;  1VQ7 1;  2P3Y A;  5J04 A;  1I3Q I;  4KT2 A;  3QWU A;  3P0W A;  3DDM A;  4ENL A;  3BSM A;  2OTJ 1;  2PS2 A;  3GTO I;  2OO6 A;  3CXO A;  3GY1 A;  1NHP A;  2DW6 A;  3DES A;  1VQN Z;  1NHR A;  3TQP A;  2AAQ A;  5FS8 A;  2OTL Z;  2V3V A;  3G71 1;  1WUF A;  3N6H A;  3HOW I;  2A8X A;  2CHR A;  1P48 A;  4DGL A;  7ENL A;  1NU5 A;  1GRF A;  1H2I A;  5IP9 I;  4MD8 A;  1JEH A;  2OQY A;  2POZ A;  5FS6 A;  1Z02 A;  4Z1Y A;  1YJW 1;  4GGH A;  4DN1 A;  3TJI A;  1SFO I;  2FKP A;  2QRE B;  3D47 A;  1L1O C;  3CK5 A;  4DNA A;  3FVD A;  1EBD A;  2W0H A;  4MD9 A;  1TYP A;  2P3Z A;  5JCM A;  5C4J I;  3I6E A;  3DGZ A;  1VQ6 Z;  3IJL A;  3LXD A;  4E8G A;  1TYT A;  1VQO 1;  1MRA A;  4NOZ A;  1TWC I;  2R7Z I;  1BZL A;  1W2B Y;  3CCJ 1;  1DL6 A;  3EF6 A;  1EC7 A;  3CPW Z;  2GGI A;  1RNI A;  3RIT A;  1YQZ A;  3CCR Z;  1VQL Z;  1NDA A;  2FYM A;  1M6I A;  1USP A;  2YU9 I;  2JMO A;  2O53 A;  2BCP A;  3SSZ A;  3HOZ I;  4H2H A;  3CCS 1;  1XAN A;  2IZ3 A;  2WP6 A;  3VMG A;  2GGG A;  3NDJ A;  2HXT A;  3HOU I;  2P28 A;  1F3P A;  2ZAD A;  2W04 A;  3PG6 A;  2R6M A;  1JPM A;  2V3B A;  2ZZ0 A;  5FS7 A;  1VQM Z;  2LIY A;  3R07 C;  3NFU A;  4K1W A;  3GTG I;  1YIJ 1;  4GYP C;  1NJI 2;  3TOY A;  4DHG A;  2JR6 A;  3THU A;  1Z01 A;  3GTP I;  1USP B;  1JJ2 Z;  2AL1 A;  2OX4 A;  4EWJ A;  4E33 A;  3N4F A;  1GXF A;  3KLJ A;  2V6O A;  5A2Q b;  2OLA A;  1GRE A;  1XS2 A;  3CC7 Z;  1EBG A;  1YEY A;  3S17 I;  1I6H I;  3DJG X;  3EED A;  4FP1 A;  4MGG A;  4ZA0 A;  3P5J B;  4BBS I;  2PU0 A;  1Q82 1;  3FG2 P;  4G7F A;  3DEQ A;  3TDH B;  3GD4 A;  2JNY A;  2E2J I;  1XHC A;  1FEA A;  1TFI A;  5IT9 f;  2QQ6 A;  3OW1 A;  1ZK7 A;  4H4V A;  3IFU A;  3LAD A;  5U1O A;  1K9M 1;  1VDV A;  3DG7 A;  1Q81 2;  3CCQ Z;  3MZL B;  1YIT Z;  1V59 A;  2WPC A;  1Q16 A;  2IZ4 A;  3M3Y I;  3O0H A;  2XGZ A;  3JAM f;  4MRI A;  1KKO A;  1JRO A;  3R25 A;  5IDZ A;  1TWF I;  2R92 I;  3MUC A;  1N8R 1;  2VUM I;  2QRD B;  4QTT A;  1VQP Z;  3GO2 A;  3Q45 A;  5JCN A;  2WB1 A;  2OZ3 A;  4MON A;  1JCT A;  2JIR A;  1WJ2 A;  1VQK 1;  3CPW Y;  5D1O B;  1NHQ A;  1YHQ Z;  1FEB A;  3EUB 3;  4IT1 A;  3A7U A;  4A3J I;  3DIP A;  4KPL A;  2NAP A;  4TVW A;  1RM6 B;  1S72 Z;  3S2H I;  1Q7Y 1;  2GTI A;  1VQ5 Z;  4FI4 A;  2OOY B;  1N62 C;  3OPS A;  1YJN 1;  3RGT A;  1XPY A;  5T64 A;  4MXU A;  3ZVI A;  2PPG A;  2VPZ A;  3H3V J;  1KC8 1;  2PMQ A;  3L5O A;  4AYB A;  1RO4 A;  2GQW A;  2NPX A;  3CXB A;  3CCE Z;  1STZ A;  4GYP A;  1JJ2 Y;  1VQ8 Z;  3VA8 A;  3ZVH A;  1Q1W A;  4EQX A;  2MUC A;  1RQF A;  2ZAE B;  4RVF A;  2YVF A;  1R0M A;  2HU9 A;  1L8P A;  3UJ2 A;  2E9H A;  1VQN 1;  5T6B A;  1SJA A;  3I56 Z;  2GRT A;  2GSH A;  2OTL 1;  4YWO A;  3H0G I;  4BY1 I;  1M1K 1;  2PP0 A;  3OC4 A;  4HPN A;  1ZMD A;  3UJR A;  1M90 1;  1X3Z A;  4QTU A;  1TE6 A;  1WYG A;  4HCL A;  4TVY A;  3ZVH B;  3CB3 A;  2WPF A;  1WZN A;  4A3L I;  1SIW A;  1YUK A;  3GCF A;  2GR0 A;  4HCD A;  4JHM A;  3ZLG A;  3LB8 A;  4H4X A;  3K7A I;  1F8W A;  2C3C A;  3U9I A;  1QYP A;  2QDD A;  3AMZ A;  4HGY A;  3OP2 A;  1N61 C;  4EMI A;  3UJF A;  4H4S A;  4E32 A;  1VQ6 1;  5EBK A;  3NVV B;  3L8K A;  2I5Q A;  3HOY I;  2M48 A;  1VQ9 Z;  4E5T A;  2X8C A;  4A3R A;  2YAU A;  2P88 A;  3CCR 1;  3RZO I;  1FFV C;  1GET A;  1WUE A;  4Y7N I;  3GTL I;  1H6V A;  4NEW A;  4ZCW A;  4NBD A;  2O4H A;  1GV4 A;  1PDZ A;  3T6C A;  2K5R A;  3NH8 A;  4E2Y A;  3HOX I;  2V8I A;  1VQM 1;  3GTJ I;  2EQ9 A;  1K73 2;  2QRC B;  2H85 A;  1SJD A;  2HQM A;  1NPX A;  3CC4 1;  2ZZB A;  4MD7 A;  2RAB A;  2WPE A;  3S2D I;  5FLX f;  3V5C A;  2W54 A;  3R0U A;  2GDQ A;  2EQ8 A;  3MSY A;  2AKZ A;  3J80 f;  2EQ7 A;  2B63 I;  1Q1R A;  2X50 A;  3ZLH A;  4NBH A;  1Y1W I;  1BKH A;  3SR6 B;  2E2H I;  4EWC A;  2GGJ A;  3OZY A;  3J81 f;  1ML8 A;  1FIQ B;  4H4Z A;  4EMJ A;  1ZH1 A;  3AN1 A;  4H4P A;  4IP5 A;  1SB3 B;  1ZX9 A;  4TNU A;  5U25 A;  2XSX A;  1FFU C;  3FYY A;  3S14 I;  1YI2 Z;  4A3F I;  1GRT A;  3BJS A;  3NZG A;  4GFI A;  3SN0 A;  2QLV B;  2X8H A;  2JA7 I;  2X8G A;  3GC2 A;  2QEX Z;  1ZXI C;  3QFA A;  2JIO A;  3CCQ 1;  1YIT 1;  1FO4 A;  3CCM Z;  3DK8 A;  5ER0 A;  2VPY A;  2AYD A;  4DXK A;  3DH9 A;  2GH5 A;  3II4 A;  3NVW B;  1KQS Y;  2BC0 A;  5G5H B;  3CC2 1;  3TCS A;  4NBB A;  3VMH A;  4DQY B;  1MDR A;  4E4F A;  1VQ4 Z;  3IC9 A;  5KVI A;  2OFJ A;  3GKQ A;  3CQZ I;  1YJ9 1;  2CFY A;  5FJP A;  1QVG Z;  5FJU A;  1LPF A;  4E4U A;  3HPF A;  1YHQ 1;  2E5A A;  5C3E I;  2ONE A;  3CCV Z;  4JQ9 A;  5GRT A;  3V4B A;  2QAE A;  2MNR A;  3CT2 A;  4DYE A;  3Q4D A;  4EQR A;  3EAN A;  1S72 1;  3JZU A;  2RHB A;  3NH4 A;  1VQ5 1;  2ZZC A;  3SBF A;  3SN4 A;  1VQ7 Z;  3S1R I;  3AM9 A;  1I50 I;  1SJB A;  3S47 A;  3QTP A;  4H83 A;  1JPD X;  4E2Z A;  3T8Q A;  5FLM I;  2GGE A;  3ENL A;  2GTH A;  3IK4 A;  2KI7 B;  2RPR A;  1FDI A;  2QGY A;  4EM3 A;  5C4X I;  5FS9 A;  1GRG A;  2Q4Z A;  2PTY A;  3CCE 1;  1ZY8 A;  4MH4 A;  1K8A 1;  1VQ8 1;  2JUB A;  2HZG A;  2QVH A;  5AN9 F;  1JRP A;  2PTZ A;  2AKL A;  1Q86 2;  3GTK I;  3IR7 A;  4E31 A;  2YQU A;  3CCL Z;  2WOI A;  3GRS A;  3NO1 A;  3QPE A;  2RBL A;  3CGB A;  4BUR A;  4GIR A;  5D1O A;  1GEU A;  1KN0 A;  4J56 A;  3TTE A;  4MKS A;  3SQP A;  6ENL A;  1T3Q C;  2PMZ A;  3I56 1;  3PWG A;  4NBF A;  4H4Y A;  4EQS A;  3SN1 A;  3CME Z;  4NBC A;  3CD6 Z;  2OPJ A;  3DG6 A;  3UJE A;  2AL2 B;  3D6W A;  2KPI A;  3CAW A;  3D2L A;  1JOA A;  3P93 A;  3D9X A;  4NEV A;  1EC9 A;  3B97 A;  4LA1 A;  4HNC A;  3J80 b;  2JIP A;  4EM4 A;  2PM9 A;  4GR1 A;  4K8D A;  4A35 A;  4JDR A;  2GR3 A;  2DE6 A;  2QR1 B;  4K2S A;  2F5Z A;  3TW9 A;  4A3I I;  3DG3 A;  1QF8 A;  4LII A;  3EEZ A;  4H4Q A;  1GSN A;  4E2X A;  1EC8 A;  5FJT A;  3VMI A;  4M0X A;  4HH4 A;  1VQ9 1;  5LL6 f;  2POD A;  3NFZ A;  4E2W A;  2P8B A;  4M52 A;  1DXL A;  2GL5 A;  3HW2 A;  1Q82 2;  1QVG Y;  3VDG A;  3IJQ A;  3F3F C;  3A7R A;  2AKM A;  3DGH A;  4H19 A;  3SJN A;  2R93 I;  2YVJ A;  4RVH A;  3S5S A;  3I55 Z;  3PO2 I;  3JW7 A;  1NP6 A;  3QLD A;  4ZOH B;  3SQS A;  4ADW A;  3M4O I;  2W55 A;  4IL0 A;  1VLA A;  1MOK A;  2TPR A;  2PCE A;  3V3W A;  1FHV A;  3U4F A;  3B9J B;  4MMW A;  1X0T A;  4A3B I;  3ETR B;  4NBG A;  2W3S A;  1KKR A;  3TWB A;  2GGH A;  3KIH A;  3H70 A;  4K7Z A;  4M6U A;  1KD0 A;  1N8R 2;  2G2K A;  3NVY B;  4A3G I;  2WAQ A;  1QVF Z;  4NBE A;  2XH0 A;  3R11 A;  4E6M A;  2F4M A;  3G6E Z;  1TWA I;  3CCU Z;  3DFY A;  3VCC A;  2PA6 A;  1AOG A;  1ZDL A;  1GRH A;  3VFC A;  1F9C A;  1KQS Z;  4EQW A;  3UXK A;  5C44 I;  5JCK A;  1FDO A;  2P8C A;  4H50 A;  2NVY I;  1NEL A;  3G4S Z;  4XX2 A;  1NHS A;  2C3D A;  1X3W A;  1ZMC A;  2YAD A;  1TWH I;  1OJT A;  4KPR A;  3CMA Z;  5IT9 b;  4RS4 A;  1D7Y A;  1TKK A;  3BOX A;  2QA4 Z;  3S16 I;  2QEX 1;  4X6A I;  3MWC A;  3U50 C;  1KC8 2;  1ZB9 A;  1VQL 1;  1ELS A;  1LVL A;  1Z03 A;  3CCM 1;  3I6T A;  2NQL A;  2PTX A;  3NDI A;  3UCC A;  3JAM b;  3FXG A;  3P3B A;  2PSN A;  5FJO A;  3RRA A;  1ZKQ A;  2J3N A;  3DK4 A;  2NVQ I;  3V5F A;  2OKT A;  1VQ4 1;  3S1M I;  1MO9 A;  2OZT A;  3PWI A;  3R1Z A;  2PU1 A;  5A2Q f;  4H1Z A;  2WP5 A;  3DER A;  2EGT A;  1M1K 2;  3JVA A;  4GIS A;  1RO0 A;  4NB8 A;  3CCV 1;  1PFT A;  4NBA A;  3J7A 4;  3F3P C;  1M90 2;  1BWC A;  3FQM A;  2Q51 A;  1K4Q A;  1WW9 A;  1AA6 A;  3GD3 A;  3UJS A;  3VCN A;  4BY7 I;  4K8G A;  3UXL A;  4KEM A;  3CC7 1;  2K3R A;  5IP7 I;  1TZZ A;  4IL2 A;  4IZG A;  3ES7 A;  3S1Q I;  4RVG A;  2W3R A;  2YVG A;  2QJN A;  4JN8 A;  3T9P A;  3T4N B;  3S1N I;  3GTM I;  4YWS A;  2OVL A;  2HNE A;  1ECQ A;  1MUC A;  2LFU A;  2PP1 A;  3OZM A;  4H4T A;  5EU9 A;  3VB9 A;  1KD1 2;  3PO3 I;  3RCY A;  1NJI 1;  2RDX A;  2OOX B;  4BBR I;  3MON A;  1QVF Y;  3CCL 1;  1RVK A;  2OZK A;  3FCP A;  4G8T A;  3DFH A;  3FQQ A;  3LUS A;  1BQG A;  1XDI A;  1IYX A;  2PGE A;  4IP4 A;  4RV9 A;  4EMW A;  4F4R A;  2EQ6 A;  1N5X A;  3CME 1;  4IHC A;  3CD6 1;  4A3C I;  2X99 A;  3HRD C;  3QKE A;  1VQP 1;  4FX9 A;  3VC5 A;  3H7V A;  4A6G A;  1FHU A;  3DK9 A;  2M6N A;  3HOV I;  2PTW A;  1Y1V S;  2VPW A;  4NFR A;  1WCM I;  5JCL A;  4GGB A;  2PP3 A;  1Q86 1;  1OEP A;  3HKZ A;  4H4U A;  1P43 A;  1KRL A;  1Q81 1;  1RLY A;  2E2I I;  2E3T A;  2OG9 A;  3KIF A;  2QDE A;  5BOE A;  3GTQ I;  4DX3 A;  3ESW A;  3R0K A;  2I3C A;  2OTJ Z;  1GRB A;  1R9T I;  2O56 A;  3MQT A;  3UGV A;  3OTR A;  2F4O A;  5KVH A;  2VPX A;  4RVD A;  3URH A;  3FV9 A;  3RZD I;  3I4M I;  2HF1 A;  2E7Z A;  1NUI A;  2DE5 A;  2AL2 A;  2CDU A;  1KCZ A;  2DE7 A;  3STP A;  4DWD A;  3I55 1;  3G71 Z;  5FJR A;  3GTM S;  2P0I A;  3CC4 Z;  1QXF A;  3MZK B;  1TWG I;  5FMH A;  3H12 A;  3VC6 A;  2RT9 A;  4NH1 C;  1E9I A;  4HCH A;  3TE5 B;  4NB9 A;  3OW2 Z;  3PO3 S;  3MKC A;  2WOW A;  1ONE A;  4A3E I;  1YJW Z;  3A7A A;  3NH5 A;  1ONF A;  3MZN A;  5TR3 A;  3I4N I;  3IF8 A;  2NVT I;  1EBH A;  2VUG A;  1X2H A;  5FLX b;  2R9Z A;  2JS4 A;  2XH4 A;  4Z17 A;  1X2G A;  3QN3 A;  3BG1 B;  3G6E 1;  3CCU 1;  1VQO Z;  4Y52 I;  3MY9 A;  3NS1 B;  3Q87 A;  3J81 b;  3D46 A;  1N63 C;  3CCJ Z;  3RR1 A;  3ES8 A;  4GRT A;  3FJ4 A;  1Y8C A;  2OZ8 A;  4H4W A;  3G4S 1;  3ZLF A;  3I07 A;  2IV2 X;  3QFB A;  3CMA 1;  5G5G B;  3TJ4 A;  2PGW A;  4KWS A;  4APN A;  3CCS Z;  1GER A;  5JRB A;  1YUA A;  2V8J A;  5ENL A;  2W03 A;  5T67 A;  4CL1 A;  2Y0S A;  2QA4 1;  3CC2 Z;  1DTN A;  2QJM A;  2WOV A;  2JA5 I;  3CGD A;  3RO6 A;  4A3D I;  4J1O A;  4S1T A;  2J6A A;  3CXC Z;  1K8A 2;  1YIJ Z;  2XH7 A;  1K9M 2;  1YJ9 Z;  4E30 A;  2NVK X;  1N5W C;  3GRT A;  4HYR A;  4J3Z A;  4BXX I;  4A3K I;  2JIM A;  2ZC8 A;  3TWA A;  4H4R A;  2HXU A;  1MNS A;  2GR1 A;  1SJC A;  4ROP A;  1S7M A;  4JN7 A;  4BV6 A;  2V8K A;  4DK1 A;  2RIQ A;  3FKI I;  2OQH A;  1RO2 A;  3GD6 A;  4GME A;  1LQL A;  1VQZ A;  2V3A A;  1JDF A;  1R6W A;  1N60 C;  1V97 A;  3CYJ A;  5CM2 M;  1DNC A;  5BOF A;  3UCD A;  4HN8 A;  3IX0 A;  4HGZ A;  1MDL A;  3OW2 Y;  5JCI A;  2GR2 A;  2BC1 A;  3DJJ A;  1Q7Y 2;  3NVZ B;  1ZB8 A;  3BG0 B;  1YI2 1;  2XH2 A;  1N2F A;  4A93 I;  1K73 1;  2JIQ A;  2JK6 A;  3CGE A;  1WII A;  3PK7 A;  4X2P A;  3I4K A;  1W6T A;  3H4K A;  3KUM A;  5D1P A;  3DGB A;  3R10 A;  1W2B Z;  1PDY A;  2QJJ A;  3T4W A;  1VQK Z;  1Y1V I;  2VF1 A;  1JWH C;  4A3M I;  3H8A A;  3EER A;  2BJO A;  2PK7 A;  3PFR A;  3S15 I;  2QKD A;  3NXL A;  2JA8 I;  1GES A;  1P9N A;  2JA6 I;  1FEC A;  2WBA A;  3CGC A;  3K1G A;  2GU2 A;  3N4E A;  4FDC B; 
#chains in the Genus database with same CATH homology
 3VTN A;  1YJN Z;  1KD1 1;  2NVX I;  3CXC Y;  3Q6J A;  3RNM A;  4J57 A;  1K83 I;  1GRA A;  1VQ7 1;  2P3Y A;  1I3Q I;  3QWU A;  2OTJ 1;  3GTO I;  1NHP A;  1VQN Z;  1NHR A;  2AAQ A;  5FS8 A;  2OTL Z;  3G71 1;  3HOW I;  2A8X A;  4DGL A;  1GRF A;  1H2I A;  5IP9 I;  4MD8 A;  1JEH A;  5FS6 A;  1Z02 A;  1YJW 1;  1SFO I;  2QRE B;  1L1O C;  4DNA A;  1EBD A;  2W0H A;  4MD9 A;  1TYP A;  5JCM A;  5C4J I;  3LXD A;  3DGZ A;  1VQ6 Z;  1TYT A;  1VQO 1;  4NOZ A;  1TWC I;  2R7Z I;  1BZL A;  1W2B Y;  3CCJ 1;  1DL6 A;  3EF6 A;  3CPW Z;  1RNI A;  1YQZ A;  3CCR Z;  1VQL Z;  1NDA A;  1M6I A;  1USP A;  2YU9 I;  2JMO A;  2O53 A;  2BCP A;  3HOZ I;  3CCS 1;  1XAN A;  2IZ3 A;  2WP6 A;  3VMG A;  3NDJ A;  3PG6 A;  3HOU I;  2P28 A;  1F3P A;  2W04 A;  2R6M A;  2V3B A;  2ZZ0 A;  5FS7 A;  1VQM Z;  2LIY A;  3GTG I;  1YIJ 1;  1NJI 2;  2JR6 A;  1Z01 A;  3GTP I;  1USP B;  1JJ2 Z;  4E33 A;  1GXF A;  3KLJ A;  2V6O A;  5A2Q b;  1GRE A;  3CC7 Z;  3DJG X;  3S17 I;  1I6H I;  3EED A;  3P5J B;  4BBS I;  1Q82 1;  3FG2 P;  3TDH B;  3GD4 A;  2JNY A;  2E2J I;  1XHC A;  1FEA A;  1TFI A;  5IT9 f;  4H4V A;  5U1O A;  1ZK7 A;  3IFU A;  3LAD A;  1K9M 1;  1Q81 2;  3CCQ Z;  3MZL B;  1YIT Z;  1V59 A;  2WPC A;  2IZ4 A;  3M3Y I;  3O0H A;  3JAM f;  4MRI A;  1TWF I;  2R92 I;  1N8R 1;  2VUM I;  2QRD B;  4QTT A;  1VQP Z;  5JCN A;  2WB1 A;  4MON A;  1VQK 1;  3CPW Y;  5D1O B;  1NHQ A;  1YHQ Z;  1FEB A;  4A3J I;  1S72 Z;  3S2H I;  1Q7Y 1;  2GTI A;  1VQ5 Z;  2OOY B;  1YJN 1;  5T64 A;  4MXU A;  3H3V J;  1KC8 1;  3L5O A;  4AYB A;  1RO4 A;  2GQW A;  2NPX A;  3CCE Z;  1JJ2 Y;  1VQ8 Z;  1Q1W A;  4EQX A;  1RQF A;  2ZAE B;  4RVF A;  2YVF A;  2HU9 A;  2E9H A;  1VQN 1;  5T6B A;  3I56 Z;  2GRT A;  2OTL 1;  4YWO A;  3H0G I;  4BY1 I;  1M1K 1;  3OC4 A;  1ZMD A;  1M90 1;  1X3Z A;  4QTU A;  2WPF A;  4A3L I;  1YUK A;  3GCF A;  2GR0 A;  3LB8 A;  4H4X A;  3K7A I;  1F8W A;  2C3C A;  1QYP A;  4HGY A;  4EMI A;  4H4S A;  4E32 A;  1VQ6 1;  5EBK A;  3L8K A;  3HOY I;  2M48 A;  1VQ9 Z;  2X8C A;  2YAU A;  3CCR 1;  3RZO I;  1GET A;  4NEW A;  4Y7N I;  3GTL I;  1H6V A;  4NBD A;  2O4H A;  1GV4 A;  2K5R A;  3NH8 A;  4E2Y A;  3HOX I;  2V8I A;  1VQM 1;  3GTJ I;  2EQ9 A;  1K73 2;  2QRC B;  2H85 A;  2HQM A;  1NPX A;  3CC4 1;  2ZZB A;  4MD7 A;  2RAB A;  2WPE A;  3S2D I;  5FLX f;  2EQ8 A;  3J80 f;  2EQ7 A;  2B63 I;  1Q1R A;  2X50 A;  4NBH A;  1Y1W I;  2E2H I;  4EWC A;  3J81 f;  1ML8 A;  4H4Z A;  4EMJ A;  1ZH1 A;  4H4P A;  1ZX9 A;  5U25 A;  4TNU A;  3S14 I;  1YI2 Z;  4A3F I;  1GRT A;  2QLV B;  2X8H A;  2JA7 I;  2X8G A;  2QEX Z;  3QFA A;  3CCQ 1;  1YIT 1;  3CCM Z;  3DK8 A;  5ER0 A;  3DH9 A;  2GH5 A;  3II4 A;  1KQS Y;  2BC0 A;  3CC2 1;  4NBB A;  4DQY B;  3VMH A;  1VQ4 Z;  3IC9 A;  5KVI A;  3GKQ A;  3CQZ I;  1YJ9 1;  2CFY A;  1QVG Z;  1LPF A;  1YHQ 1;  5C3E I;  3CCV Z;  4JQ9 A;  5GRT A;  2QAE A;  4EQR A;  3EAN A;  1S72 1;  2RHB A;  3NH4 A;  1VQ5 1;  2ZZC A;  1VQ7 Z;  3S1R I;  1I50 I;  4E2Z A;  5FLM I;  2GTH A;  4EM3 A;  2KI7 B;  2RPR A;  5C4X I;  5FS9 A;  1GRG A;  2Q4Z A;  3CCE 1;  1ZY8 A;  4MH4 A;  1K8A 1;  1VQ8 1;  2JUB A;  3EAO A;  2YQU A;  5AN9 F;  2AKL A;  1Q86 2;  3GTK I;  3GRS A;  4E31 A;  3CCL Z;  2WOI A;  2RBL A;  3CGB A;  4BUR A;  5D1O A;  1GEU A;  1KN0 A;  4J56 A;  3SQP A;  4H4Y A;  2PMZ A;  3I56 1;  4NBF A;  4EQS A;  3CME Z;  4NBC A;  3CD6 Z;  3D6W A;  2KPI A;  1JOA A;  3D9X A;  4NEV A;  4LA1 A;  3J80 b;  4EM4 A;  2PM9 A;  4GR1 A;  4K8D A;  4JDR A;  2GR3 A;  2DE6 A;  2QR1 B;  2F5Z A;  4A3I I;  1QF8 A;  4LII A;  4H4Q A;  1GSN A;  4E2X A;  3VMI A;  4HH4 A;  1VQ9 1;  5LL6 f;  3NFZ A;  4E2W A;  4M52 A;  1DXL A;  1Q82 2;  1QVG Y;  3F3F C;  3DGH A;  2R93 I;  2YVJ A;  4RVH A;  3I55 Z;  3PO2 I;  1NP6 A;  4ADW A;  3M4O I;  1VLA A;  1MOK A;  2TPR A;  1X0T A;  4A3B I;  4NBG A;  3KIH A;  4K7Z A;  1N8R 2;  2G2K A;  4A3G I;  2WAQ A;  1QVF Z;  4NBE A;  2F4M A;  1TWA I;  3G6E Z;  3CCU Z;  1AOG A;  1ZDL A;  1GRH A;  4EQW A;  1KQS Z;  5JCK A;  5C44 I;  4H50 A;  2NVY I;  3G4S Z;  4XX2 A;  1NHS A;  2C3D A;  1X3W A;  1ZMC A;  2YAD A;  1TWH I;  1OJT A;  4KPR A;  3CMA Z;  5IT9 b;  4RS4 A;  1D7Y A;  2QA4 Z;  3S16 I;  2QEX 1;  4X6A I;  3U50 C;  1KC8 2;  1ZB9 A;  1VQL 1;  1LVL A;  1Z03 A;  3CCM 1;  3NDI A;  3JAM b;  1ZKQ A;  2J3N A;  3DK4 A;  2NVQ I;  1VQ4 1;  3S1M I;  1MO9 A;  5A2Q f;  2WP5 A;  2EGT A;  1M1K 2;  1RO0 A;  4NB8 A;  3CCV 1;  1PFT A;  4NBA A;  3J7A 4;  3F3P C;  1M90 2;  1BWC A;  3FQM A;  2Q51 A;  1K4Q A;  1WW9 A;  3GD3 A;  4BY7 I;  3CC7 1;  2K3R A;  5IP7 I;  3S1Q I;  4RVG A;  2YVG A;  3T4N B;  3S1N I;  3GTM I;  2LFU A;  4H4T A;  3VB9 A;  1KD1 2;  3PO3 I;  1NJI 1;  2OOX B;  4BBR I;  3MON A;  1QVF Y;  3CCL 1;  2OZK A;  3FQQ A;  3LUS A;  1XDI A;  4RV9 A;  4EMW A;  2EQ6 A;  3CME 1;  3CD6 1;  4A3C I;  2X99 A;  4FX9 A;  1VQP 1;  3DK9 A;  2M6N A;  3HOV I;  1Y1V S;  4NFR A;  1WCM I;  5JCL A;  4H4U A;  1Q86 1;  3HKZ A;  1KRL A;  1Q81 1;  1RLY A;  2E2I I;  3KIF A;  3GTQ I;  3ESW A;  2I3C A;  2OTJ Z;  1GRB A;  1R9T I;  2F4O A;  5KVH A;  4RVD A;  3URH A;  3RZD I;  3I4M I;  2HF1 A;  1NUI A;  2DE5 A;  2CDU A;  2DE7 A;  3I55 1;  3G71 Z;  3GTM S;  3CC4 Z;  3MZK B;  1TWG I;  5FMH A;  2RT9 A;  4NH1 C;  3TE5 B;  4NB9 A;  3OW2 Z;  3PO3 S;  2WOW A;  4A3E I;  1YJW Z;  3NH5 A;  1ONF A;  5TR3 A;  3I4N I;  3IF8 A;  2NVT I;  2R9Z A;  2VUG A;  5FLX b;  2JS4 A;  3BG1 B;  3G6E 1;  3CCU 1;  1VQO Z;  4Y52 I;  3Q87 A;  3J81 b;  3CCJ Z;  4GRT A;  4H4W A;  3G4S 1;  3I07 A;  3QFB A;  3CMA 1;  4APN A;  3CCS Z;  1GER A;  5JRB A;  1YUA A;  2V8J A;  2W03 A;  5T67 A;  4CL1 A;  2Y0S A;  2QA4 1;  3CC2 Z;  2WOV A;  2JA5 I;  3CGD A;  4A3D I;  4S1T A;  2J6A A;  3CXC Z;  1K8A 2;  1YIJ Z;  1K9M 2;  1YJ9 Z;  4E30 A;  2NVK X;  3GRT A;  4BXX I;  4A3K I;  4H4R A;  2GR1 A;  1S7M A;  4BV6 A;  2V8K A;  4DK1 A;  2RIQ A;  3FKI I;  1RO2 A;  1LQL A;  2V3A A;  5CM2 M;  1DNC A;  3IX0 A;  4HGZ A;  3OW2 Y;  5JCI A;  2GR2 A;  2BC1 A;  3DJJ A;  1Q7Y 2;  1ZB8 A;  3BG0 B;  1YI2 1;  1N2F A;  4A93 I;  1K73 1;  2JK6 A;  3CGE A;  1WII A;  3H4K A;  5D1P A;  1W2B Z;  1VQK Z;  1Y1V I;  2VF1 A;  1JWH C;  4A3M I;  3EER A;  2BJO A;  2PK7 A;  3S15 I;  2QKD A;  2JA8 I;  1GES A;  1P9N A;  2JA6 I;  1FEC A;  2WBA A;  3CGC A;  2GU2 A;  4FDC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...