3D9XA

Structure of the head of the bartonella adhesin bada
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
114
structure length
114
Chain Sequence
GGWNLTVNNDNNTVVSSGGALDLSSGSKNLKIVKDGKKNNVTFDVARDLTLKSIKLDGVTLNETGLFIANGPQITASGINAGSQKITGVAEGTDANDAVNFGQLKKIETEVKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the head of the Bartonella adhesin BadA
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Cell adhesion
molecule keywords Adhesin A
total genus 13
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05662 YadA_stalk Coiled stalk of trimeric autotransporter adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.490 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3d9xA01
3.30.390.90 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3d9xA02
3D9XA 1S7MA
chains in the Genus database with same CATH superfamily
2AL2B 3JZUA 2JIOA 1YI21 1GRGA 5ENLA 1GETA 4GGHA 4IP5A 4DNAA 5JCNA 1YIT1 4NBGA 2GR1A 2LFUA 3D6WA 4LIIA 3RZDI 1F9CA 3RGTA 3GD6A 1ONFA 1SB3B 1WZNA 1ECQA 1RM6B 3CC71 1P48A 4A93I 2HXUA 4A3EI 1YHQ1 3CC41 4GISA 5FS7A 1YJW1 2GL5A 5FLXb 3U4FA 1KKOA 3KUMA 3TWAA 1TYTA 1SJAA 4NBFA 1FEBA 4A3JI 1K731 2F5ZA 1ZH1A 2AAQA 4ZOHB 3NH5A 3I4MI 1MO9A 4NB9A 2NVKX 3FJ4A 4RVFA 1EC7A 3DDMA 3GTJI 3PO3S 2EGTA 4E32A 1H2IA 4J56A 2PP1A 1FFVC 1NPXA 2PS2A 4NFRA 4MRIA 1TE6A 4GFIA 1VLAA 1WYGA 1DXLA 1JJ2Z 3EANA 4E2WA 2VPXA 2OQYA 2M48A 3TJIA 2ZZBA 3O0HA 3DK4A 3TCSA 2GR2A 4DQYB 4HH4A 4X6AI 2O4HA 3DERA 2M6NA 2OTJ1 3SBFA 3U50C 2OG9A 4H4PA 2OKTA 4Y52I 3SQSA 1VQK1 3GTQI 4A3LI 3DG3A 3FCPA 3Q4DA 1VQMZ 2P8BA 3LADA 4NBDA 3SN1A 1K83I 4HGZA 1EC9A 1JDFA 4ENLA 1KKRA 1YEYA 2OO6A 3UXKA 5GRTA 4E33A 2YU9I 2PMQA 4H4UA 1NHPA 1EBHA 2BJOA 5JRBA 2Q4ZA 2B63I 1VQZA 2HXTA 2ONEA 3FXGA 1YJ91 2ZZCA 2QDEA 2WBAA 1L1OC 1S72Z 3HOZI 3DK8A 5IT9b 1XHCA 3THUA 1DTNA 5ER0A 3RNMA 4K1WA 2ZZ0A 4NB8A 5C4XI 4BV6A 3OC4A 2HF1A 2GTIA 2WB1A 3NDIA 1Q862 1K4QA 3JW7A 4FI4A 4A6GA 1R0MA 4BBRI 2BCPA 2IV2X 3IX0A 5JCMA 4HNCA 4E6MA 3D2LA 1VDVA 2JIQA 1VQ41 3I55Z 1NJI2 4Z1YA 4DK1A 1FEAA 3MONA 2JNYA 4BBSI 1N8R1 5KVHA 1VQO1 2WP5A 1GERA 3R1ZA 2DE6A 1WJ2A 3OZMA 4K8DA 5U25A 1E9IA 3CC21 4MH4A 3H4KA 4JDRA 1AOGA 4E4UA 2PP3A 3D47A 1Q16A 2JA5I 5CM2M 3R07C 1I50I 3H3VJ 2PTXA 5T67A 1RO2A 4J3ZA 2EQ6A 3TE5B 4A3FI 1NHRA 2P8CA 3LB8A 2E2HI 4GMEA 5FS6A 1KD0A 2P3ZA 3V4BA 4HN8A 3AM9A 3IC9A 1K8A1 4NOZA 3NVWB 3CGDA 1T3QC 2PTZA 4MD8A 4J57A 3ZVIA 3VDGA 4G7FA 2QLVB 4YWSA 1W2BY 4K8GA 2WPCA 2EQ9A 2V3VA 1S7MA 1YI2Z 3GTMI 2QJNA 4GRTA 3S15I 4NEVA 4IL0A 3QKEA 3CCVZ 3FVDA 1QVGY 3NVZB 5FLXf 1MRAA 3I56Z 1YUAA 4TNUA 4HYRA 3MY9A 1I6HI 3BG1B 1VQ61 4DGLA 3II4A 2V3AA 4H4YA 2VUGA 3H12A 5U1OA 4EQSA 2W54A 2CFYA 1MDRA 4MKSA 2OPJA 1W2BZ 2C3CA 2WPEA 3EF6A 2GR0A 1N5WC 3T4NB 3P5JB 3I551 3CD61 2QVHA 2ZC8A 1P43A 3GRSA 1VQ51 4BY1I 5EBKA 1X2GA 2QRDB 1GESA 2E2JI 2QREB 3CK5A 1L8PA 2OOYB 2V6OA 1I3QI 3VMHA 2W0HA 3I6TA 4QTUA 3TDHB 1YITZ 1VQ91 2OTL1 4GIRA 3JAMb 4A3GI 4H50A 3RO6A 3I561 3STPA 1ML8A 3DJJA 3NVYB 2V3BA 3ZLFA 1BWCA 3Q6JA 1JJ2Y 4RS4A 3UJEA 1GRBA 3DFYA 3KLJA 2PODA 3PFRA 4A3RA 1M1K2 1JEHA 4NBBA 2OVLA 4GYPC 5JCIA 2GGJA 2HQMA 2PA6A 3T9PA 2K5RA 3VA8A 2O53A 1EC8A 4EWJA 1N8R2 4M0XA 3TW9A 1N61C 2PMZA 3GTGI 1EBGA 1VQ81 2X99A 1FO4A 2YVJA 3SJNA 3DH9A 4ADWA 1TWGI 2JS4A 3L5OA 4X2PA 3CC7Z 5JCLA 3SN4A 1ZB8A 3VMGA 2DW7A 3VC5A 2LEXA 4MD9A 3GKQA 3HOYI 2RHBA 2GGGA 5D1OA 3GTKI 3BOXA 1KCZA 1NU5A 3DK9A 2BC1A 3MZKB 4HPNA 1V59A 5G5HB 1VQ4Z 3RITA 3CD6Z 4FP1A 3URHA 2R93I 2QDDA 1PDZA 1FDIA 2JA6I 2HU9A 2PGWA 4M52A 3NO1A 4EMJA 2KPIA 1JROA 5FLMI 1WCMI 1PDYA 2QAEA 4HGYA 3J81b 1KC81 3HOVI 3UJRA 5G5GB 5IP7I 3S1MI 1F3PA 3G711 3J80b 4EQWA 1TWHI 2NVYI 1MOKA 2CHRA 3CCQ1 1K9M1 3B9JB 3VFCA 3S47A 4NBAA 4KT2A 2NPXA 4E2XA 2EQ8A 3LXDA 3IK4A 1Q1WA 1Q811 4H4ZA 3V3WA 1YJWZ 3CXOA 2GGHA 2R9ZA 1VQPZ 3EEDA 2E2II 2WOWA 1Y1VI 3U9IA 2AL2A 2XSXA 1KD12 3MZNA 3CCLZ 3I4KA 2AL1A 4H4XA 3RR1A 4E2YA 1RNIA 3QPEA 3AMZA 4KPLA 2RABA 4IL2A 2OZKA 4E2ZA 2OQHA 3R0KA 2QRCB 3GC2A 4H83A 1X3WA 2X8CA 1SFOI 1R6WA 3J7A4 1QVFY 3J80f 2YVGA 1MDLA 3DG7A 4EQXA 3F3PC 1NP6A 4QTTA 1LPFA 1SJBA 3CC4Z 1VQKZ 2QA4Z 1PFTA 2POZA 1VQP1 2E5AA 4AYBA 2RDXA 2OTJZ 1SJDA 3FQQA 3KIHA 1BQGA 2TPRA 5FJPA 3IF8A 1VQ9Z 1Y8CA 4NH1C 5A2Qb 2OTLZ 2WOIA 3JAMf 3M3YI 1ZDLA 3D46A 3AN1A 5FJUA 3CXBA 1JCTA 3FV9A 3MSYA 4LA1A 1V97A 3RRAA 4RVGA 4YWOA 4H4SA 3SSZA 2P88A 3TJ4A 3CCEZ 4EM3A 1KQSZ 2GGEA 3UJFA 3DJGX 2GTHA 2RIQA 5T64A 3S1RI 4A3CI 3Q45A 4E4FA 1N62C 2OOXB 2R6MA 3HW2A 3CXCY 3QLDA 3GTLI 3T6CA 4E5TA 3S16I 3CMEZ 3DGHA 4MGGA 5EU9A 1Z03A 1R9TI 1N63C 2VPYA 1DL6A 1ZX9A 4KPRA 3CC2Z 4NBHA 5FS8A 2QKDA 2PP0A 3I07A 4APNA 1NHQA 2AKZA 4HCHA 1K9M2 3HKZA 2V8JA 1SIWA 3SQPA 3TTEA 1F8WA 4IZGA 4HCDA 4H4RA 4K2SA 5BOFA 2J6AA 2NVQI 1ELSA 2QJJA 3T4WA 2F4MA 3CMA1 5FS9A 5FJOA 3MUCA 1N60C 2P0IA 5TR3A 2PM9A 1WUEA 5C4JI 3G6EZ 2GGIA 2MNRA 3H70A 4H1ZA 5FJRA 1RLYA 1VQM1 3PK7A 1FIQB 1N5XA 3NS1B 4DN1A 2GR3A 4RVHA 5A2Qf 2JA8I 3DIPA 3G71Z 3ZLHA 1USPA 1WUFA 3N4FA 4E31A 3OW2Z 3M4OI 3CYJA 1GRAA 2W55A 3BJSA 3TWBA 1K732 3F3FC 3RZOI 5FMHA 4E8GA 2JIRA 4RV9A 1NELA 1Z01A 2GDQA 1Q821 4IP4A 3CCUZ 3EERA 1VQL1 2MUCA 3CGBA 1ZMDA 2OZ3A 1GRFA 3G4SZ 1USPB 3IR7A 2R92I 3GTPI 4Y7NI 2OX4A 3HPFA 4XX2A 4JN7A 3HOWI 3ETRB 2XH7A 3S14I 1MUCA 3CCS1 1YQZA 3EAOA 1BKHA 4IT1A 4KEMA 4GGBA 2NAPA 2OZ8A 2AYDA 4DHGA 3R25A 2ZADA 4EWCA 1VQ7Z 3GTOI 1NDAA 4H4WA 1SJCA 3NXLA 3LUSA 1D7YA 3FYYA 4GYPA 4EMIA 2HNEA 2VF1A 3DGBA 2W03A 1M6IA 1JOAA 1H6VA 5LL6f 2O56A 5KVIA 3PWGA 4DX3A 2WAQA 1GREA 2VPZA 3PO3I 1ZXIC 2QEXZ 3ESWA 1DNCA 4S1TA 2C3DA 1N2FA 3CCSZ 4DYEA 1QVFZ 2PU0A 3MZLB 3S1QI 1XDIA 3N4EA 3CAWA 2JA7I 3S5SA 3CCJZ 1XS2A 2A8XA 3UJ2A 2JUBA 4EMWA 2OLAA 1QYPA 3H7VA 4A3MI 4HNLA 1LQLA 2DE5A 5C44I 1VQ5Z 1VQN1 3CT2A 3OPSA 4JHMA 2QJMA 1TFIA 3ZLGA 5BOEA 2XH0A 3ZVHB 2P28A 1YJNZ 5JCKA 3IFUA 2YQUA 3I4NI 3PG6A 3MWCA 3QFBA 3CGCA 3HOXI 2I3CA 2PSNA 2DE7A 1GXFA 2JMOA 4FX9A 3SN0A 1WW9A 3DESA 1M901 1NJI1 1QXFA 4NBEA 1Q7Y1 3BG0B 1TWAI 1M1K1 3CCJ1 3VMIA 2HZGA 4EQRA 3N6JA 3CCR1 3S2DI 1JRPA 3OW1A 2GH5A 1GEUA 3ES8A 1GRHA 3MQTA 4A35A 3R11A 1RO4A 3GD4A 2W04A 3IJIA 3NZGA 3DFHA 2V8KA 2PPGA 4KWSA 3CCM1 4Z17A 2F4OA 3NFUA 3HRDC 5IDZA 1NUIA 3MKCA 5D1OB 4H19A 4GR1A 4ZCWA 3S2HI 4CL1A 1KC82 3G6E1 1GV4A 3PO2I 2FYMA 3CGEA 1X0TA 1YIJ1 2WOVA 1LVLA 2E3TA 4IHCA 3RCYA 2E7ZA 1Y1WI 4DXKA 4E30A 3CXCZ 2FKPA 3N6HA 3FKII 3DEQA 3OTRA 3ES7A 4J1OA 4DWDA 1YJN1 3OZYA 2JK6A 1KQSY 1RQFA 1Q861 3GRTA 3NDJA 1Q812 5IT9f 3CCL1 2R7ZI 2W3RA 2AKLA 1TWCI 2Q51A 1FECA 2X8HA 2RPRA 2JIPA 1JWHC 3FQMA 2OZTA 4ROPA 3UCCA 3CCU1 2V45A 5D1PA 1ZK7A 3CME1 1TKKA 3GD3A 4F4RA 3NH8A 2YVFA 5IP9I 1AA6A 4EM4A 2DW6A 1ONEA 4NBCA 3GTMS 3R0UA 3CCRZ 1STZA 2I5QA 1K8A2 2IZ4A 1MNSA 2WP6A 4G8TA 3VB9A 2RBLA 3B97A 2BC0A 3QFAA 1KRLA 4H4TA 2VPWA 4ZA0A 4MXUA 3A7AA 3OW2Y 1S721 2W3SA 3SR6B 3S17I 3K1GA 2V8IA 3UJSA 4A3DI 2CDUA 3HOUI 4A3BI 3I6EA 5FJTA 2KI7B 1XANA 2QR1B 2G2KA 3TQPA 1GSNA 1ZMCA 3EKGA 3JVAA 1X2HA 3FG2P 4A3KI 1P9NA 2LIYA 1Q7Y2 1QF8A 2VUMI 1W6TA 2QGYA 1YHQZ 2PTYA 3UXLA 3CPWZ 4NEWA 1TZZA 3UCDA 3P3BA 2QA41 4BURA 3VC6A 2YAUA 2PTWA 5AN9F 3R10A 3CQZI 1GRTA 3NVVB 3CPWY 1EBDA 4H4VA 1Y1VS 2GSHA 4MONA 1VQ71 1X3ZA 1IYXA 3ENLA 3P93A 3K7AI 2NVTI 1RVKA 3TOYA 1ZY8A 1KD11 3A7RA 2H85A 3CCV1 3S1NI 3VCNA 1Q1RA 2P3YA 1VQLZ 1FFUC 2OFJA 4TVYA 1ZKQA 2X50A 3V5CA 1TYPA 1Q822 6ENLA 3DGZA 3ZVHA 2XH2A 3L8KA 2WPFA 1VQ8Z 4H4QA 1XPYA 1Z02A 3NRZB 1OEPA 2AKMA 3VCCA 2EQ7A 2PU1A 2RT9A 2QQ6A 4FDCB 1KN0A 2GU2A 3OP2A 3P0WA 3T8QA 1NHSA 3UGVA 1WIIA 3CCE1 1M902 3CCMZ 2NVXI 3QTPA 4M6UA 5J04A 2GRTA 5T6BA 1FHUA 2NQLA 1TWFI 3BSMA 2J3NA 3QWUA 1JPMA 1YIJZ 3Q87A 3KIFA 4RVDA 1JPDX 3V5FA 3H0GI 4BY7I 3G4S1 5C3EI 2X8GA 2K3RA 3VTNA 4A3II 1OJTA 2PCEA 1BZLA 4K7ZA 1VQOZ 1VQNZ 2E9HA 2PGEA 1FHVA 1YUKA 4HCLA 3IJLA 2PK7A 4MMWA 3QN3A 2XGZA 4JN8A 3IJQA 2Y0SA 3CCQZ 2YADA 2XH4A 3GY1A 4TVWA 2JIMA 2QEX1 7ENLA 1YJ9Z 2JR6A 3CB3A 2IZ3A 3EEZA 1QVGZ 1ZB9A 3EUB3 1RO0A 1VQ6Z 3NFZA 3NH4A 1FDOA 3D9XA 3H8AA 3GCFA 4BXXI 3J81f 4JQ9A 4MD7A 3CMAZ 2GQWA 3DG6A 3GO2A 2ZAEB 3PWIA 3A7UA 4H2HA
chains in the Genus database with same CATH topology
1YI21 1GRGA 1GETA 4DNAA 5JCNA 1YIT1 4NBGA 2GR1A 2LFUA 3D6WA 4LIIA 3RZDI 1ONFA 3CC71 5FS7A 4A93I 4A3EI 1YHQ1 3CC41 1YJW1 5FLXb 1TYTA 4NBFA 1FEBA 4A3JI 1K731 2F5ZA 1ZH1A 2AAQA 3NH5A 3I4MI 1MO9A 4NB9A 2NVKX 4RVFA 4J56A 3GTJI 3PO3S 2EGTA 4E32A 1H2IA 1NPXA 4NFRA 4MRIA 1VLAA 1DXLA 1JJ2Z 3EANA 4E2WA 2M48A 2ZZBA 3O0HA 3DK4A 2GR2A 4DQYB 4HH4A 4X6AI 2O4HA 2M6NA 2OTJ1 3U50C 4H4PA 4Y52I 1VQK1 3GTQI 4A3LI 1VQMZ 3LADA 4NBDA 1K83I 4HGZA 5GRTA 4E33A 2YU9I 4H4UA 1NHPA 2BJOA 5JRBA 2Q4ZA 2B63I 1YJ91 2ZZCA 2WBAA 1L1OC 1S72Z 3HOZI 3DK8A 5IT9b 1XHCA 5ER0A 3RNMA 2ZZ0A 4NB8A 5C4XI 4BV6A 3OC4A 2HF1A 2GTIA 2WB1A 3NDIA 1Q862 1K4QA 2BCPA 4BBRI 3IX0A 5JCMA 1VQ41 3I55Z 1NJI2 4DK1A 1FEAA 3MONA 2JNYA 4BBSI 1N8R1 5KVHA 1VQO1 2WP5A 1GERA 2DE6A 4K8DA 5U25A 3CC21 4MH4A 3H4KA 4JDRA 1AOGA 2JA5I 5CM2M 1I50I 3H3VJ 5T67A 1RO2A 2EQ6A 3TE5B 4A3FI 1NHRA 3LB8A 2E2HI 5FS6A 3IC9A 1K8A1 4NOZA 3CGDA 4MD8A 4J57A 2QLVB 1W2BY 2WPCA 2EQ9A 1YI2Z 1S7MA 3GTMI 4GRTA 3S15I 4NEVA 3CCVZ 1QVGY 5FLXf 3I56Z 1YUAA 4TNUA 1I6HI 3BG1B 1VQ61 4DGLA 3II4A 2V3AA 4H4YA 2VUGA 5U1OA 4EQSA 2CFYA 1W2BZ 2C3CA 2WPEA 3EF6A 2GR0A 3T4NB 3P5JB 3I551 3CD61 3GRSA 1VQ51 4BY1I 5EBKA 2QRDB 1GESA 2E2JI 2QREB 2OOYB 2V6OA 1I3QI 3VMHA 2W0HA 4QTUA 3TDHB 1YITZ 1VQ91 2OTL1 4H50A 3JAMb 4A3GI 3I561 1ML8A 3DJJA 2V3BA 1BWCA 3Q6JA 1JJ2Y 4RS4A 1GRBA 3KLJA 1M1K2 1JEHA 4NBBA 5JCIA 2HQMA 2K5RA 2O53A 1N8R2 2X99A 2PMZA 3GTGI 1VQ81 2YVJA 3DH9A 4ADWA 1TWGI 2JS4A 3L5OA 3CC7Z 5JCLA 1ZB8A 3VMGA 4MD9A 3GKQA 3HOYI 2RHBA 5D1OA 3GTKI 3DK9A 2BC1A 3MZKB 1V59A 1VQ4Z 3URHA 3CD6Z 2R93I 2JA6I 2HU9A 4M52A 4EMJA 2KPIA 5FLMI 1WCMI 2QAEA 4HGYA 3J81b 1KC81 3HOVI 5IP7I 3S1MI 1F3PA 3G711 3J80b 4EQWA 1TWHI 2NVYI 1MOKA 3CCQ1 1K9M1 4NBAA 2NPXA 4E2XA 2EQ8A 3LXDA 1Q1WA 1Q811 4H4ZA 1YJWZ 2R9ZA 1VQPZ 3EEDA 2E2II 2WOWA 1Y1VI 1KD12 4H4XA 3CCLZ 4E2YA 1RNIA 2RABA 2OZKA 4E2ZA 2QRCB 1X3WA 2X8CA 1SFOI 3J7A4 1QVFY 3J80f 2YVGA 4EQXA 3F3PC 1NP6A 4QTTA 1LPFA 3CC4Z 1VQKZ 2QA4Z 1PFTA 1VQP1 4AYBA 2OTJZ 3FQQA 3KIHA 2TPRA 3IF8A 1VQ9Z 2OTLZ 4NH1C 5A2Qb 2WOIA 3JAMf 3M3YI 1ZDLA 4LA1A 4RVGA 4YWOA 4H4SA 3CCEZ 4EM3A 1KQSZ 3DJGX 2GTHA 2RIQA 5T64A 3S1RI 4A3CI 2OOXB 2R6MA 3CXCY 3GTLI 3S16I 3CMEZ 3DGHA 1Z03A 1R9TI 1DL6A 1ZX9A 4KPRA 3CC2Z 4NBHA 5FS8A 2QKDA 3I07A 4APNA 1NHQA 1K9M2 3HKZA 2V8JA 3SQPA 1F8WA 4H4RA 2J6AA 2NVQI 2F4MA 3CMA1 5FS9A 5TR3A 2PM9A 5C4JI 3G6EZ 1RLYA 1VQM1 2GR3A 4RVHA 5A2Qf 2JA8I 3G71Z 1USPA 4E31A 3OW2Z 3M4OI 1GRAA 1K732 3F3FC 3RZOI 5FMHA 4RV9A 1Z01A 1Q821 3CCUZ 3EERA 1VQL1 3CGBA 1ZMDA 1GRFA 3G4SZ 1USPB 2R92I 3GTPI 4Y7NI 4XX2A 3HOWI 3S14I 3EAOA 3CCS1 1YQZA 4H4WA 4EWCA 1VQ7Z 3GTOI 1NDAA 3LUSA 1D7YA 4EMIA 2VF1A 2W03A 1M6IA 1JOAA 1H6VA 5LL6f 5KVIA 2WAQA 1GREA 3PO3I 2QEXZ 3ESWA 1DNCA 4S1TA 2C3DA 1N2FA 3CCSZ 1QVFZ 3MZLB 3S1QI 1XDIA 2JA7I 3CCJZ 2A8XA 2JUBA 4EMWA 1QYPA 4A3MI 1LQLA 2DE5A 5C44I 1VQ5Z 1VQN1 1TFIA 2P28A 1YJNZ 5JCKA 3IFUA 2YQUA 3I4NI 3PG6A 3QFBA 3CGCA 3HOXI 2I3CA 2DE7A 1GXFA 2JMOA 4FX9A 1WW9A 1M901 1NJI1 4NBEA 1Q7Y1 3BG0B 1TWAI 1M1K1 3CCJ1 3VMIA 4EQRA 3CCR1 3S2DI 2GH5A 1GEUA 1GRHA 1RO4A 3GD4A 2W04A 2V8KA 3CCM1 2F4OA 1NUIA 5D1OB 4GR1A 3S2HI 4CL1A 1KC82 3G6E1 1GV4A 3PO2I 3CGEA 1X0TA 1YIJ1 2WOVA 1LVLA 1Y1WI 4E30A 3CXCZ 3FKII 1YJN1 2JK6A 1KQSY 1RQFA 1Q861 3GRTA 3NDJA 1Q812 5IT9f 3CCL1 2R7ZI 2AKLA 1TWCI 2Q51A 1FECA 2X8HA 2RPRA 1JWHC 3FQMA 3CCU1 5D1PA 1ZK7A 3CME1 3GD3A 3NH8A 2YVFA 5IP9I 4EM4A 4NBCA 3GTMS 3CCRZ 1K8A2 2IZ4A 2WP6A 3VB9A 2RBLA 3QFAA 2BC0A 4H4TA 1KRLA 4MXUA 3OW2Y 1S721 3S17I 2V8IA 4A3DI 2CDUA 3HOUI 4A3BI 2KI7B 1XANA 2QR1B 2G2KA 1GSNA 1ZMCA 3FG2P 4A3KI 1P9NA 2LIYA 1Q7Y2 1QF8A 2VUMI 1YHQZ 4BURA 3CPWZ 4NEWA 2QA41 2YAUA 5AN9F 3CQZI 1GRTA 3CPWY 1EBDA 4H4VA 1Y1VS 4MONA 1VQ71 1X3ZA 3K7AI 2NVTI 1ZY8A 1KD11 2H85A 3CCV1 3S1NI 1Q1RA 2P3YA 1VQLZ 1ZKQA 2X50A 1TYPA 1Q822 3DGZA 3L8KA 2WPFA 1VQ8Z 4H4QA 1Z02A 2EQ7A 2RT9A 4FDCB 1KN0A 2GU2A 1NHSA 1WIIA 3CCE1 1M902 3CCMZ 2NVXI 2GRTA 5T6BA 1TWFI 2J3NA 3QWUA 1YIJZ 3Q87A 3KIFA 4RVDA 3H0GI 4BY7I 3G4S1 5C3EI 2X8GA 2K3RA 3VTNA 4A3II 1OJTA 1BZLA 4K7ZA 1VQOZ 1VQNZ 2E9HA 1YUKA 2PK7A 2Y0SA 3CCQZ 2YADA 2QEX1 1YJ9Z 2JR6A 2IZ3A 1QVGZ 1ZB9A 1RO0A 1VQ6Z 3NFZA 3NH4A 3D9XA 3GCFA 4BXXI 3J81f 4JQ9A 4MD7A 3CMAZ 2GQWA 2ZAEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9X A;  1S7M A; 
#chains in the Genus database with same CATH topology
 2AL2 B;  3JZU A;  2JIO A;  1YI2 1;  1GRG A;  5ENL A;  1GET A;  4GGH A;  4IP5 A;  4DNA A;  5JCN A;  1YIT 1;  4NBG A;  2GR1 A;  2LFU A;  3D6W A;  4LII A;  3RZD I;  1F9C A;  3RGT A;  3GD6 A;  1ONF A;  1SB3 B;  1WZN A;  1ECQ A;  1RM6 B;  3CC7 1;  1P48 A;  4A93 I;  2HXU A;  4A3E I;  1YHQ 1;  3CC4 1;  4GIS A;  5FS7 A;  1YJW 1;  2GL5 A;  5FLX b;  3U4F A;  1KKO A;  3KUM A;  3TWA A;  1TYT A;  1SJA A;  4NBF A;  1FEB A;  4A3J I;  1K73 1;  2F5Z A;  1ZH1 A;  2AAQ A;  4ZOH B;  3NH5 A;  3I4M I;  1MO9 A;  4NB9 A;  2NVK X;  3FJ4 A;  4RVF A;  1EC7 A;  3DDM A;  3GTJ I;  3PO3 S;  2EGT A;  4E32 A;  1H2I A;  4J56 A;  2PP1 A;  1FFV C;  1NPX A;  2PS2 A;  4NFR A;  4MRI A;  1TE6 A;  4GFI A;  1VLA A;  1WYG A;  1DXL A;  1JJ2 Z;  3EAN A;  4E2W A;  2VPX A;  2OQY A;  2M48 A;  3TJI A;  2ZZB A;  3O0H A;  3DK4 A;  3TCS A;  2GR2 A;  4DQY B;  4HH4 A;  4X6A I;  2O4H A;  3DER A;  2M6N A;  2OTJ 1;  3SBF A;  3U50 C;  2OG9 A;  4H4P A;  2OKT A;  4Y52 I;  3SQS A;  1VQK 1;  3GTQ I;  4A3L I;  3DG3 A;  3FCP A;  3Q4D A;  1VQM Z;  2P8B A;  3LAD A;  4NBD A;  3SN1 A;  1K83 I;  4HGZ A;  1EC9 A;  1JDF A;  4ENL A;  1KKR A;  1YEY A;  2OO6 A;  3UXK A;  5GRT A;  4E33 A;  2YU9 I;  2PMQ A;  4H4U A;  1NHP A;  1EBH A;  2BJO A;  5JRB A;  2Q4Z A;  2B63 I;  1VQZ A;  2HXT A;  2ONE A;  3FXG A;  1YJ9 1;  2ZZC A;  2QDE A;  2WBA A;  1L1O C;  1S72 Z;  3HOZ I;  3DK8 A;  5IT9 b;  1XHC A;  3THU A;  1DTN A;  5ER0 A;  3RNM A;  4K1W A;  2ZZ0 A;  4NB8 A;  5C4X I;  4BV6 A;  3OC4 A;  2HF1 A;  2GTI A;  2WB1 A;  3NDI A;  1Q86 2;  1K4Q A;  3JW7 A;  4FI4 A;  4A6G A;  1R0M A;  4BBR I;  2BCP A;  2IV2 X;  3IX0 A;  5JCM A;  4HNC A;  4E6M A;  3D2L A;  1VDV A;  2JIQ A;  1VQ4 1;  3I55 Z;  1NJI 2;  4Z1Y A;  4DK1 A;  1FEA A;  3MON A;  2JNY A;  4BBS I;  1N8R 1;  5KVH A;  1VQO 1;  2WP5 A;  1GER A;  3R1Z A;  2DE6 A;  1WJ2 A;  3OZM A;  4K8D A;  5U25 A;  1E9I A;  3CC2 1;  4MH4 A;  3H4K A;  4JDR A;  1AOG A;  4E4U A;  2PP3 A;  3D47 A;  1Q16 A;  2JA5 I;  5CM2 M;  3R07 C;  1I50 I;  3H3V J;  2PTX A;  5T67 A;  1RO2 A;  4J3Z A;  2EQ6 A;  3TE5 B;  4A3F I;  1NHR A;  2P8C A;  3LB8 A;  2E2H I;  4GME A;  5FS6 A;  1KD0 A;  2P3Z A;  3V4B A;  4HN8 A;  3AM9 A;  3IC9 A;  1K8A 1;  4NOZ A;  3NVW B;  3CGD A;  1T3Q C;  2PTZ A;  4MD8 A;  4J57 A;  3ZVI A;  3VDG A;  4G7F A;  2QLV B;  4YWS A;  1W2B Y;  4K8G A;  2WPC A;  2EQ9 A;  2V3V A;  1S7M A;  1YI2 Z;  3GTM I;  2QJN A;  4GRT A;  3S15 I;  4NEV A;  4IL0 A;  3QKE A;  3CCV Z;  3FVD A;  1QVG Y;  3NVZ B;  5FLX f;  1MRA A;  3I56 Z;  1YUA A;  4TNU A;  4HYR A;  3MY9 A;  1I6H I;  3BG1 B;  1VQ6 1;  4DGL A;  3II4 A;  2V3A A;  4H4Y A;  2VUG A;  3H12 A;  5U1O A;  4EQS A;  2W54 A;  2CFY A;  1MDR A;  4MKS A;  2OPJ A;  1W2B Z;  2C3C A;  2WPE A;  3EF6 A;  2GR0 A;  1N5W C;  3T4N B;  3P5J B;  3I55 1;  3CD6 1;  2QVH A;  2ZC8 A;  1P43 A;  3GRS A;  1VQ5 1;  4BY1 I;  5EBK A;  1X2G A;  2QRD B;  1GES A;  2E2J I;  2QRE B;  3CK5 A;  1L8P A;  2OOY B;  2V6O A;  1I3Q I;  3VMH A;  2W0H A;  3I6T A;  4QTU A;  3TDH B;  1YIT Z;  1VQ9 1;  2OTL 1;  4GIR A;  3JAM b;  4A3G I;  4H50 A;  3RO6 A;  3I56 1;  3STP A;  1ML8 A;  3DJJ A;  3NVY B;  2V3B A;  3ZLF A;  1BWC A;  3Q6J A;  1JJ2 Y;  4RS4 A;  3UJE A;  1GRB A;  3DFY A;  3KLJ A;  2POD A;  3PFR A;  4A3R A;  1M1K 2;  1JEH A;  4NBB A;  2OVL A;  4GYP C;  5JCI A;  2GGJ A;  2HQM A;  2PA6 A;  3T9P A;  2K5R A;  3VA8 A;  2O53 A;  1EC8 A;  4EWJ A;  1N8R 2;  4M0X A;  3TW9 A;  1N61 C;  2PMZ A;  3GTG I;  1EBG A;  1VQ8 1;  2X99 A;  1FO4 A;  2YVJ A;  3SJN A;  3DH9 A;  4ADW A;  1TWG I;  2JS4 A;  3L5O A;  4X2P A;  3CC7 Z;  5JCL A;  3SN4 A;  1ZB8 A;  3VMG A;  2DW7 A;  3VC5 A;  2LEX A;  4MD9 A;  3GKQ A;  3HOY I;  2RHB A;  2GGG A;  5D1O A;  3GTK I;  3BOX A;  1KCZ A;  1NU5 A;  3DK9 A;  2BC1 A;  3MZK B;  4HPN A;  1V59 A;  5G5H B;  1VQ4 Z;  3RIT A;  3CD6 Z;  4FP1 A;  3URH A;  2R93 I;  2QDD A;  1PDZ A;  1FDI A;  2JA6 I;  2HU9 A;  2PGW A;  4M52 A;  3NO1 A;  4EMJ A;  2KPI A;  1JRO A;  5FLM I;  1WCM I;  1PDY A;  2QAE A;  4HGY A;  3J81 b;  1KC8 1;  3HOV I;  3UJR A;  5G5G B;  5IP7 I;  3S1M I;  1F3P A;  3G71 1;  3J80 b;  4EQW A;  1TWH I;  2NVY I;  1MOK A;  2CHR A;  3CCQ 1;  1K9M 1;  3B9J B;  3VFC A;  3S47 A;  4NBA A;  4KT2 A;  2NPX A;  4E2X A;  2EQ8 A;  3LXD A;  3IK4 A;  1Q1W A;  1Q81 1;  4H4Z A;  3V3W A;  1YJW Z;  3CXO A;  2GGH A;  2R9Z A;  1VQP Z;  3EED A;  2E2I I;  2WOW A;  1Y1V I;  3U9I A;  2AL2 A;  2XSX A;  1KD1 2;  3MZN A;  3CCL Z;  3I4K A;  2AL1 A;  4H4X A;  3RR1 A;  4E2Y A;  1RNI A;  3QPE A;  3AMZ A;  4KPL A;  2RAB A;  4IL2 A;  2OZK A;  4E2Z A;  2OQH A;  3R0K A;  2QRC B;  3GC2 A;  4H83 A;  1X3W A;  2X8C A;  1SFO I;  1R6W A;  3J7A 4;  1QVF Y;  3J80 f;  2YVG A;  1MDL A;  3DG7 A;  4EQX A;  3F3P C;  1NP6 A;  4QTT A;  1LPF A;  1SJB A;  3CC4 Z;  1VQK Z;  2QA4 Z;  1PFT A;  2POZ A;  1VQP 1;  2E5A A;  4AYB A;  2RDX A;  2OTJ Z;  1SJD A;  3FQQ A;  3KIH A;  1BQG A;  2TPR A;  5FJP A;  3IF8 A;  1VQ9 Z;  1Y8C A;  4NH1 C;  5A2Q b;  2OTL Z;  2WOI A;  3JAM f;  3M3Y I;  1ZDL A;  3D46 A;  3AN1 A;  5FJU A;  3CXB A;  1JCT A;  3FV9 A;  3MSY A;  4LA1 A;  1V97 A;  3RRA A;  4RVG A;  4YWO A;  4H4S A;  3SSZ A;  2P88 A;  3TJ4 A;  3CCE Z;  4EM3 A;  1KQS Z;  2GGE A;  3UJF A;  3DJG X;  2GTH A;  2RIQ A;  5T64 A;  3S1R I;  4A3C I;  3Q45 A;  4E4F A;  1N62 C;  2OOX B;  2R6M A;  3HW2 A;  3CXC Y;  3QLD A;  3GTL I;  3T6C A;  4E5T A;  3S16 I;  3CME Z;  3DGH A;  4MGG A;  5EU9 A;  1Z03 A;  1R9T I;  1N63 C;  2VPY A;  1DL6 A;  1ZX9 A;  4KPR A;  3CC2 Z;  4NBH A;  5FS8 A;  2QKD A;  2PP0 A;  3I07 A;  4APN A;  1NHQ A;  2AKZ A;  4HCH A;  1K9M 2;  3HKZ A;  2V8J A;  1SIW A;  3SQP A;  3TTE A;  1F8W A;  4IZG A;  4HCD A;  4H4R A;  4K2S A;  5BOF A;  2J6A A;  2NVQ I;  1ELS A;  2QJJ A;  3T4W A;  2F4M A;  3CMA 1;  5FS9 A;  5FJO A;  3MUC A;  1N60 C;  2P0I A;  5TR3 A;  2PM9 A;  1WUE A;  5C4J I;  3G6E Z;  2GGI A;  2MNR A;  3H70 A;  4H1Z A;  5FJR A;  1RLY A;  1VQM 1;  3PK7 A;  1FIQ B;  1N5X A;  3NS1 B;  4DN1 A;  2GR3 A;  4RVH A;  5A2Q f;  2JA8 I;  3DIP A;  3G71 Z;  3ZLH A;  1USP A;  1WUF A;  3N4F A;  4E31 A;  3OW2 Z;  3M4O I;  3CYJ A;  1GRA A;  2W55 A;  3BJS A;  3TWB A;  1K73 2;  3F3F C;  3RZO I;  5FMH A;  4E8G A;  2JIR A;  4RV9 A;  1NEL A;  1Z01 A;  2GDQ A;  1Q82 1;  4IP4 A;  3CCU Z;  3EER A;  1VQL 1;  2MUC A;  3CGB A;  1ZMD A;  2OZ3 A;  1GRF A;  3G4S Z;  1USP B;  3IR7 A;  2R92 I;  3GTP I;  4Y7N I;  2OX4 A;  3HPF A;  4XX2 A;  4JN7 A;  3HOW I;  3ETR B;  2XH7 A;  3S14 I;  1MUC A;  3CCS 1;  1YQZ A;  3EAO A;  1BKH A;  4IT1 A;  4KEM A;  4GGB A;  2NAP A;  2OZ8 A;  2AYD A;  4DHG A;  3R25 A;  2ZAD A;  4EWC A;  1VQ7 Z;  3GTO I;  1NDA A;  4H4W A;  1SJC A;  3NXL A;  3LUS A;  1D7Y A;  3FYY A;  4GYP A;  4EMI A;  2HNE A;  2VF1 A;  3DGB A;  2W03 A;  1M6I A;  1JOA A;  1H6V A;  5LL6 f;  2O56 A;  5KVI A;  3PWG A;  4DX3 A;  2WAQ A;  1GRE A;  2VPZ A;  3PO3 I;  1ZXI C;  2QEX Z;  3ESW A;  1DNC A;  4S1T A;  2C3D A;  1N2F A;  3CCS Z;  4DYE A;  1QVF Z;  2PU0 A;  3MZL B;  3S1Q I;  1XDI A;  3N4E A;  3CAW A;  2JA7 I;  3S5S A;  3CCJ Z;  1XS2 A;  2A8X A;  3UJ2 A;  2JUB A;  4EMW A;  2OLA A;  1QYP A;  3H7V A;  4A3M I;  4HNL A;  1LQL A;  2DE5 A;  5C44 I;  1VQ5 Z;  1VQN 1;  3CT2 A;  3OPS A;  4JHM A;  2QJM A;  1TFI A;  3ZLG A;  5BOE A;  2XH0 A;  3ZVH B;  2P28 A;  1YJN Z;  5JCK A;  3IFU A;  2YQU A;  3I4N I;  3PG6 A;  3MWC A;  3QFB A;  3CGC A;  3HOX I;  2I3C A;  2PSN A;  2DE7 A;  1GXF A;  2JMO A;  4FX9 A;  3SN0 A;  1WW9 A;  3DES A;  1M90 1;  1NJI 1;  1QXF A;  4NBE A;  1Q7Y 1;  3BG0 B;  1TWA I;  1M1K 1;  3CCJ 1;  3VMI A;  2HZG A;  4EQR A;  3N6J A;  3CCR 1;  3S2D I;  1JRP A;  3OW1 A;  2GH5 A;  1GEU A;  3ES8 A;  1GRH A;  3MQT A;  4A35 A;  3R11 A;  1RO4 A;  3GD4 A;  2W04 A;  3IJI A;  3NZG A;  3DFH A;  2V8K A;  2PPG A;  4KWS A;  3CCM 1;  4Z17 A;  2F4O A;  3NFU A;  3HRD C;  5IDZ A;  1NUI A;  3MKC A;  5D1O B;  4H19 A;  4GR1 A;  4ZCW A;  3S2H I;  4CL1 A;  1KC8 2;  3G6E 1;  1GV4 A;  3PO2 I;  2FYM A;  3CGE A;  1X0T A;  1YIJ 1;  2WOV A;  1LVL A;  2E3T A;  4IHC A;  3RCY A;  2E7Z A;  1Y1W I;  4DXK A;  4E30 A;  3CXC Z;  2FKP A;  3N6H A;  3FKI I;  3DEQ A;  3OTR A;  3ES7 A;  4J1O A;  4DWD A;  1YJN 1;  3OZY A;  2JK6 A;  1KQS Y;  1RQF A;  1Q86 1;  3GRT A;  3NDJ A;  1Q81 2;  5IT9 f;  3CCL 1;  2R7Z I;  2W3R A;  2AKL A;  1TWC I;  2Q51 A;  1FEC A;  2X8H A;  2RPR A;  2JIP A;  1JWH C;  3FQM A;  2OZT A;  4ROP A;  3UCC A;  3CCU 1;  2V45 A;  5D1P A;  1ZK7 A;  3CME 1;  1TKK A;  3GD3 A;  4F4R A;  3NH8 A;  2YVF A;  5IP9 I;  1AA6 A;  4EM4 A;  2DW6 A;  1ONE A;  4NBC A;  3GTM S;  3R0U A;  3CCR Z;  1STZ A;  2I5Q A;  1K8A 2;  2IZ4 A;  1MNS A;  2WP6 A;  4G8T A;  3VB9 A;  2RBL A;  3B97 A;  2BC0 A;  3QFA A;  1KRL A;  4H4T A;  2VPW A;  4ZA0 A;  4MXU A;  3A7A A;  3OW2 Y;  1S72 1;  2W3S A;  3SR6 B;  3S17 I;  3K1G A;  2V8I A;  3UJS A;  4A3D I;  2CDU A;  3HOU I;  4A3B I;  3I6E A;  5FJT A;  2KI7 B;  1XAN A;  2QR1 B;  2G2K A;  3TQP A;  1GSN A;  1ZMC A;  3EKG A;  3JVA A;  1X2H A;  3FG2 P;  4A3K I;  1P9N A;  2LIY A;  1Q7Y 2;  1QF8 A;  2VUM I;  1W6T A;  2QGY A;  1YHQ Z;  2PTY A;  3UXL A;  3CPW Z;  4NEW A;  1TZZ A;  3UCD A;  3P3B A;  2QA4 1;  4BUR A;  3VC6 A;  2YAU A;  2PTW A;  5AN9 F;  3R10 A;  3CQZ I;  1GRT A;  3NVV B;  3CPW Y;  1EBD A;  4H4V A;  1Y1V S;  2GSH A;  4MON A;  1VQ7 1;  1X3Z A;  1IYX A;  3ENL A;  3P93 A;  3K7A I;  2NVT I;  1RVK A;  3TOY A;  1ZY8 A;  1KD1 1;  3A7R A;  2H85 A;  3CCV 1;  3S1N I;  3VCN A;  1Q1R A;  2P3Y A;  1VQL Z;  1FFU C;  2OFJ A;  4TVY A;  1ZKQ A;  2X50 A;  3V5C A;  1TYP A;  1Q82 2;  6ENL A;  3DGZ A;  3ZVH A;  2XH2 A;  3L8K A;  2WPF A;  1VQ8 Z;  4H4Q A;  1XPY A;  1Z02 A;  3NRZ B;  1OEP A;  2AKM A;  3VCC A;  2EQ7 A;  2PU1 A;  2RT9 A;  2QQ6 A;  4FDC B;  1KN0 A;  2GU2 A;  3OP2 A;  3P0W A;  3T8Q A;  1NHS A;  3UGV A;  1WII A;  3CCE 1;  1M90 2;  3CCM Z;  2NVX I;  3QTP A;  4M6U A;  5J04 A;  2GRT A;  5T6B A;  1FHU A;  2NQL A;  1TWF I;  3BSM A;  2J3N A;  3QWU A;  1JPM A;  1YIJ Z;  3Q87 A;  3KIF A;  4RVD A;  1JPD X;  3V5F A;  3H0G I;  4BY7 I;  3G4S 1;  5C3E I;  2X8G A;  2K3R A;  3VTN A;  4A3I I;  1OJT A;  2PCE A;  1BZL A;  4K7Z A;  1VQO Z;  1VQN Z;  2E9H A;  2PGE A;  1FHV A;  1YUK A;  4HCL A;  3IJL A;  2PK7 A;  4MMW A;  3QN3 A;  2XGZ A;  4JN8 A;  3IJQ A;  2Y0S A;  3CCQ Z;  2YAD A;  2XH4 A;  3GY1 A;  4TVW A;  2JIM A;  2QEX 1;  7ENL A;  1YJ9 Z;  2JR6 A;  3CB3 A;  2IZ3 A;  3EEZ A;  1QVG Z;  1ZB9 A;  3EUB 3;  1RO0 A;  1VQ6 Z;  3NFZ A;  3NH4 A;  1FDO A;  3D9X A;  3H8A A;  3GCF A;  4BXX I;  3J81 f;  4JQ9 A;  4MD7 A;  3CMA Z;  2GQW A;  3DG6 A;  3GO2 A;  2ZAE B;  3PWI A;  3A7U A;  4H2H A; 
#chains in the Genus database with same CATH homology
 1YI2 1;  1GRG A;  1GET A;  4DNA A;  5JCN A;  1YIT 1;  4NBG A;  2GR1 A;  2LFU A;  3D6W A;  4LII A;  3RZD I;  1ONF A;  3CC7 1;  5FS7 A;  4A93 I;  4A3E I;  1YHQ 1;  3CC4 1;  1YJW 1;  5FLX b;  1TYT A;  4NBF A;  1FEB A;  4A3J I;  1K73 1;  2F5Z A;  1ZH1 A;  2AAQ A;  3NH5 A;  3I4M I;  1MO9 A;  4NB9 A;  2NVK X;  4RVF A;  4J56 A;  3GTJ I;  3PO3 S;  2EGT A;  4E32 A;  1H2I A;  1NPX A;  4NFR A;  4MRI A;  1VLA A;  1DXL A;  1JJ2 Z;  3EAN A;  4E2W A;  2M48 A;  2ZZB A;  3O0H A;  3DK4 A;  2GR2 A;  4DQY B;  4HH4 A;  4X6A I;  2O4H A;  2M6N A;  2OTJ 1;  3U50 C;  4H4P A;  4Y52 I;  1VQK 1;  3GTQ I;  4A3L I;  1VQM Z;  3LAD A;  4NBD A;  1K83 I;  4HGZ A;  5GRT A;  4E33 A;  2YU9 I;  4H4U A;  1NHP A;  2BJO A;  5JRB A;  2Q4Z A;  2B63 I;  1YJ9 1;  2ZZC A;  2WBA A;  1L1O C;  1S72 Z;  3HOZ I;  3DK8 A;  5IT9 b;  1XHC A;  5ER0 A;  3RNM A;  2ZZ0 A;  4NB8 A;  5C4X I;  4BV6 A;  3OC4 A;  2HF1 A;  2GTI A;  2WB1 A;  3NDI A;  1Q86 2;  1K4Q A;  2BCP A;  4BBR I;  3IX0 A;  5JCM A;  1VQ4 1;  3I55 Z;  1NJI 2;  4DK1 A;  1FEA A;  3MON A;  2JNY A;  4BBS I;  1N8R 1;  5KVH A;  1VQO 1;  2WP5 A;  1GER A;  2DE6 A;  4K8D A;  5U25 A;  3CC2 1;  4MH4 A;  3H4K A;  4JDR A;  1AOG A;  2JA5 I;  5CM2 M;  1I50 I;  3H3V J;  5T67 A;  1RO2 A;  2EQ6 A;  3TE5 B;  4A3F I;  1NHR A;  3LB8 A;  2E2H I;  5FS6 A;  3IC9 A;  1K8A 1;  4NOZ A;  3CGD A;  4MD8 A;  4J57 A;  2QLV B;  1W2B Y;  2WPC A;  2EQ9 A;  1YI2 Z;  1S7M A;  3GTM I;  4GRT A;  3S15 I;  4NEV A;  3CCV Z;  1QVG Y;  5FLX f;  3I56 Z;  1YUA A;  4TNU A;  1I6H I;  3BG1 B;  1VQ6 1;  4DGL A;  3II4 A;  2V3A A;  4H4Y A;  2VUG A;  5U1O A;  4EQS A;  2CFY A;  1W2B Z;  2C3C A;  2WPE A;  3EF6 A;  2GR0 A;  3T4N B;  3P5J B;  3I55 1;  3CD6 1;  3GRS A;  1VQ5 1;  4BY1 I;  5EBK A;  2QRD B;  1GES A;  2E2J I;  2QRE B;  2OOY B;  2V6O A;  1I3Q I;  3VMH A;  2W0H A;  4QTU A;  3TDH B;  1YIT Z;  1VQ9 1;  2OTL 1;  4H50 A;  3JAM b;  4A3G I;  3I56 1;  1ML8 A;  3DJJ A;  2V3B A;  1BWC A;  3Q6J A;  1JJ2 Y;  4RS4 A;  1GRB A;  3KLJ A;  1M1K 2;  1JEH A;  4NBB A;  5JCI A;  2HQM A;  2K5R A;  2O53 A;  1N8R 2;  2X99 A;  2PMZ A;  3GTG I;  1VQ8 1;  2YVJ A;  3DH9 A;  4ADW A;  1TWG I;  2JS4 A;  3L5O A;  3CC7 Z;  5JCL A;  1ZB8 A;  3VMG A;  4MD9 A;  3GKQ A;  3HOY I;  2RHB A;  5D1O A;  3GTK I;  3DK9 A;  2BC1 A;  3MZK B;  1V59 A;  1VQ4 Z;  3URH A;  3CD6 Z;  2R93 I;  2JA6 I;  2HU9 A;  4M52 A;  4EMJ A;  2KPI A;  5FLM I;  1WCM I;  2QAE A;  4HGY A;  3J81 b;  1KC8 1;  3HOV I;  5IP7 I;  3S1M I;  1F3P A;  3G71 1;  3J80 b;  4EQW A;  1TWH I;  2NVY I;  1MOK A;  3CCQ 1;  1K9M 1;  4NBA A;  2NPX A;  4E2X A;  2EQ8 A;  3LXD A;  1Q1W A;  1Q81 1;  4H4Z A;  1YJW Z;  2R9Z A;  1VQP Z;  3EED A;  2E2I I;  2WOW A;  1Y1V I;  1KD1 2;  4H4X A;  3CCL Z;  4E2Y A;  1RNI A;  2RAB A;  2OZK A;  4E2Z A;  2QRC B;  1X3W A;  2X8C A;  1SFO I;  3J7A 4;  1QVF Y;  3J80 f;  2YVG A;  4EQX A;  3F3P C;  1NP6 A;  4QTT A;  1LPF A;  3CC4 Z;  1VQK Z;  2QA4 Z;  1PFT A;  1VQP 1;  4AYB A;  2OTJ Z;  3FQQ A;  3KIH A;  2TPR A;  3IF8 A;  1VQ9 Z;  2OTL Z;  4NH1 C;  5A2Q b;  2WOI A;  3JAM f;  3M3Y I;  1ZDL A;  4LA1 A;  4RVG A;  4YWO A;  4H4S A;  3CCE Z;  4EM3 A;  1KQS Z;  3DJG X;  2GTH A;  2RIQ A;  5T64 A;  3S1R I;  4A3C I;  2OOX B;  2R6M A;  3CXC Y;  3GTL I;  3S16 I;  3CME Z;  3DGH A;  1Z03 A;  1R9T I;  1DL6 A;  1ZX9 A;  4KPR A;  3CC2 Z;  4NBH A;  5FS8 A;  2QKD A;  3I07 A;  4APN A;  1NHQ A;  1K9M 2;  3HKZ A;  2V8J A;  3SQP A;  1F8W A;  4H4R A;  2J6A A;  2NVQ I;  2F4M A;  3CMA 1;  5FS9 A;  5TR3 A;  2PM9 A;  5C4J I;  3G6E Z;  1RLY A;  1VQM 1;  2GR3 A;  4RVH A;  5A2Q f;  2JA8 I;  3G71 Z;  1USP A;  4E31 A;  3OW2 Z;  3M4O I;  1GRA A;  1K73 2;  3F3F C;  3RZO I;  5FMH A;  4RV9 A;  1Z01 A;  1Q82 1;  3CCU Z;  3EER A;  1VQL 1;  3CGB A;  1ZMD A;  1GRF A;  3G4S Z;  1USP B;  2R92 I;  3GTP I;  4Y7N I;  4XX2 A;  3HOW I;  3S14 I;  3EAO A;  3CCS 1;  1YQZ A;  4H4W A;  4EWC A;  1VQ7 Z;  3GTO I;  1NDA A;  3LUS A;  1D7Y A;  4EMI A;  2VF1 A;  2W03 A;  1M6I A;  1JOA A;  1H6V A;  5LL6 f;  5KVI A;  2WAQ A;  1GRE A;  3PO3 I;  2QEX Z;  3ESW A;  1DNC A;  4S1T A;  2C3D A;  1N2F A;  3CCS Z;  1QVF Z;  3MZL B;  3S1Q I;  1XDI A;  2JA7 I;  3CCJ Z;  2A8X A;  2JUB A;  4EMW A;  1QYP A;  4A3M I;  1LQL A;  2DE5 A;  5C44 I;  1VQ5 Z;  1VQN 1;  1TFI A;  2P28 A;  1YJN Z;  5JCK A;  3IFU A;  2YQU A;  3I4N I;  3PG6 A;  3QFB A;  3CGC A;  3HOX I;  2I3C A;  2DE7 A;  1GXF A;  2JMO A;  4FX9 A;  1WW9 A;  1M90 1;  1NJI 1;  4NBE A;  1Q7Y 1;  3BG0 B;  1TWA I;  1M1K 1;  3CCJ 1;  3VMI A;  4EQR A;  3CCR 1;  3S2D I;  2GH5 A;  1GEU A;  1GRH A;  1RO4 A;  3GD4 A;  2W04 A;  2V8K A;  3CCM 1;  2F4O A;  1NUI A;  5D1O B;  4GR1 A;  3S2H I;  4CL1 A;  1KC8 2;  3G6E 1;  1GV4 A;  3PO2 I;  3CGE A;  1X0T A;  1YIJ 1;  2WOV A;  1LVL A;  1Y1W I;  4E30 A;  3CXC Z;  3FKI I;  1YJN 1;  2JK6 A;  1KQS Y;  1RQF A;  1Q86 1;  3GRT A;  3NDJ A;  1Q81 2;  5IT9 f;  3CCL 1;  2R7Z I;  2AKL A;  1TWC I;  2Q51 A;  1FEC A;  2X8H A;  2RPR A;  1JWH C;  3FQM A;  3CCU 1;  5D1P A;  1ZK7 A;  3CME 1;  3GD3 A;  3NH8 A;  2YVF A;  5IP9 I;  4EM4 A;  4NBC A;  3GTM S;  3CCR Z;  1K8A 2;  2IZ4 A;  2WP6 A;  3VB9 A;  2RBL A;  3QFA A;  2BC0 A;  4H4T A;  1KRL A;  4MXU A;  3OW2 Y;  1S72 1;  3S17 I;  2V8I A;  4A3D I;  2CDU A;  3HOU I;  4A3B I;  2KI7 B;  1XAN A;  2QR1 B;  2G2K A;  1GSN A;  1ZMC A;  3FG2 P;  4A3K I;  1P9N A;  2LIY A;  1Q7Y 2;  1QF8 A;  2VUM I;  1YHQ Z;  4BUR A;  3CPW Z;  4NEW A;  2QA4 1;  2YAU A;  5AN9 F;  3CQZ I;  1GRT A;  3CPW Y;  1EBD A;  4H4V A;  1Y1V S;  4MON A;  1VQ7 1;  1X3Z A;  3K7A I;  2NVT I;  1ZY8 A;  1KD1 1;  2H85 A;  3CCV 1;  3S1N I;  1Q1R A;  2P3Y A;  1VQL Z;  1ZKQ A;  2X50 A;  1TYP A;  1Q82 2;  3DGZ A;  3L8K A;  2WPF A;  1VQ8 Z;  4H4Q A;  1Z02 A;  2EQ7 A;  2RT9 A;  4FDC B;  1KN0 A;  2GU2 A;  1NHS A;  1WII A;  3CCE 1;  1M90 2;  3CCM Z;  2NVX I;  2GRT A;  5T6B A;  1TWF I;  2J3N A;  3QWU A;  1YIJ Z;  3Q87 A;  3KIF A;  4RVD A;  3H0G I;  4BY7 I;  3G4S 1;  5C3E I;  2X8G A;  2K3R A;  3VTN A;  4A3I I;  1OJT A;  1BZL A;  4K7Z A;  1VQO Z;  1VQN Z;  2E9H A;  1YUK A;  2PK7 A;  2Y0S A;  3CCQ Z;  2YAD A;  2QEX 1;  1YJ9 Z;  2JR6 A;  2IZ3 A;  1QVG Z;  1ZB9 A;  1RO0 A;  1VQ6 Z;  3NFZ A;  3NH4 A;  3D9X A;  3GCF A;  4BXX I;  3J81 f;  4JQ9 A;  4MD7 A;  3CMA Z;  2GQW A;  2ZAE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...