3D9XA

Structure of the head of the bartonella adhesin bada
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
114
structure length
114
Chain Sequence
GGWNLTVNNDNNTVVSSGGALDLSSGSKNLKIVKDGKKNNVTFDVARDLTLKSIKLDGVTLNETGLFIANGPQITASGINAGSQKITGVAEGTDANDAVNFGQLKKIETEVKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the head of the Bartonella adhesin BadA
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Cell adhesion
molecule keywords Adhesin A
total genus 13
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05662 YadA_stalk Coiled stalk of trimeric autotransporter adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.490 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3d9xA01
3.30.390.90 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3d9xA02
1S7MA 3D9XA
chains in the Genus database with same CATH superfamily
1I50I 2IV2X 4GRTA 1K9M1 2EQ9A 4G8TA 2I5QA 2XH2A 3MY9A 3M3YI 4A3II 3GTKI 2PODA 2EQ8A 4YWOA 4NH1C 3OZMA 3V5CA 3Q45A 2RABA 1WIIA 2OZTA 3CC7Z 4EQRA 3D9XA 3CCE1 2V6OA 3S15I 3CXOA 2OTJ1 1N61C 5GRTA 1PFTA 3VC6A 3CGDA 3KIHA 4JN8A 1JRPA 4MKSA 2R6MA 1N5XA 2JIQA 2PP3A 4HYRA 3CCM1 3ZVIA 2W04A 2OVLA 2IZ4A 2AAQA 4FX9A 3IX0A 3CGBA 3NFZA 3GTMS 2NAPA 1XHCA 1ZDLA 3STPA 3H8AA 3RITA 3RGTA 4NBEA 1VQP1 3CCL1 5FS7A 3SN0A 2GU2A 3HOZI 5IP7I 1Q862 3B97A 1BZLA 1P9NA 3EERA 1N8R1 3CC41 3G4SZ 1M901 3S14I 2AKMA 2GR1A 2PP1A 2X8HA 4GYPA 4TVWA 2R93I 1E9IA 5G5GB 4H4ZA 3PO3S 1JROA 4H4SA 4K7ZA 2AL1A 2W0HA 4HNLA 4KPLA 1GESA 3KUMA 4G7FA 1L1OC 4J3ZA 4DQYB 4RV9A 3MQTA 3K7AI 1R0MA 2HQMA 4GFIA 4NOZA 2XH0A 4E30A 5C4JI 1TYPA 4H4UA 1X3WA 2VPWA 1JJ2Y 2X8GA 3I6TA 3IJQA 2NVYI 4GGHA 4DYEA 3GTPI 5JCKA 1JEHA 4A3KI 3OZYA 3U9IA 1X2HA 3SN1A 2Q4ZA 1RO4A 3DG6A 4A3EI 4BBSI 2W54A 1Z03A 1NHSA 1V97A 3F3PC 1VLAA 2R92I 3FXGA 3TOYA 1WJ2A 2NVXI 1LPFA 2V3BA 2ZZ0A 3SJNA 3VFCA 3I4MI 1EC8A 2P3ZA 1Q1WA 3R11A 3T8QA 3J81b 5FJUA 1NHQA 1YQZA 1S721 2WBAA 4RVFA 1K8A2 1FIQB 3G6EZ 2PTYA 5LL6f 3LXDA 4GIRA 4LIIA 2GTIA 4M0XA 1FDOA 2AKZA 2OX4A 1MUCA 4H4TA 3G4S1 1YJ91 2QVHA 4H50A 5FMHA 3CMAZ 3MUCA 4NBFA 1VQ81 3UJFA 1Y1VS 1VQ91 4A3DI 3CCQ1 2PCEA 3CK5A 2EGTA 4X6AI 1H2IA 3R10A 1YUAA 3I6EA 4GYPC 2QEXZ 3CXCY 1ZMCA 3SSZA 2BC1A 1DNCA 2WP5A 2MNRA 3GTJI 1KC81 3NDIA 1SJCA 2JMOA 4DGLA 1Q1RA 2PSNA 3V5FA 1X0TA 1K731 4FDCB 1MO9A 3HOYI 1X3ZA 2BC0A 3D47A 1V59A 4HCDA 3GRSA 1ZKQA 3DEQA 4E4UA 1ECQA 2BJOA 3NRZB 4MGGA 2RHBA 3JAMf 2OG9A 3PK7A 2X50A 2NPXA 1QVGZ 1MDRA 1YEYA 2OOYB 3Q4DA 3TCSA 4EMWA 4E5TA 3CMEZ 3ENLA 2XSXA 4IZGA 1KD0A 1MDLA 1YUKA 3TJIA 3EEZA 1VQN1 5D1OA 3CGCA 1KC82 3H3VJ 4HNCA 4JN7A 3VCCA 2QDEA 1MOKA 2LIYA 3S1QI 2PGWA 2GRTA 2QJMA 3T4NB 2O4HA 3S1NI 3H12A 3SN4A 3FYYA 4NEWA 3S1RI 1N62C 2ZADA 1NPXA 1NELA 1M1K1 3CCQZ 1EBGA 4J1OA 1Q861 2E5AA 4BV6A 2RIQA 4ROPA 1GETA 3THUA 4DXKA 4CL1A 1JDFA 2YU9I 1TWHI 4GR1A 3GC2A 1OEPA 1TWGI 4FI4A 1K732 1X2GA 2OZ8A 3HOVI 1VQM1 2J3NA 1FFUC 3CB3A 3V3WA 4BBRI 3HW2A 3CD6Z 1TYTA 4MXUA 1R6WA 2GGJA 3NH4A 2GGEA 1YIJZ 3G71Z 5FS9A 2PPGA 3GTMI 4Y7NI 2YADA 1NUIA 2Q51A 3UJSA 3GTGI 2EQ7A 2E2II 2KPIA 3CCJZ 4A3CI 3CCMZ 2W03A 1VQO1 1VQL1 3J7A4 2HZGA 3DG3A 4JHMA 3RO6A 2JNYA 2NVQI 1ZMDA 5U25A 4EWJA 3IJIA 2AL2A 3NVYB 4JQ9A 3DK8A 5T67A 3Q87A 2Y0SA 3II4A 3QFAA 3FKII 3VMIA 1JPMA 2PTWA 4X2PA 3TJ4A 2OQYA 2QRDB 3KIFA 3P5JB 1VQ7Z 3DFYA 4H4XA 4F4RA 5JCLA 3MZLB 3FQQA 4H1ZA 3MONA 2YQUA 3CPWZ 4J57A 1USPA 1R9TI 4NBBA 3LB8A 1WW9A 4KT2A 3SR6B 3VB9A 1M902 5TR3A 1Z01A 3GKQA 1VQ41 1N8R2 3UXLA 4E6MA 2P28A 3HOWI 1KD12 1GXFA 4DN1A 3NZGA 3P3BA 1XANA 2GH5A 3NXLA 3D46A 1YJN1 3NFUA 4K8DA 3DH9A 3H4KA 2QA41 2JA6I 2QQ6A 3PWIA 3NH8A 1TZZA 2TPRA 3N6HA 2W55A 3M4OI 4BY7I 1VQZA 1QVFY 4H4QA 2VF1A 2WP6A 3UJRA 2GSHA 4DX3A 4K1WA 2YAUA 3S2DI 1JCTA 3RZDI 1PDZA 2P88A 3CCR1 2WOIA 3NDJA 3U50C 5EU9A 4A3MI 1GRTA 1EC9A 4AYBA 3ETRB 3ZLFA 2PU0A 2DW6A 1I3QI 3GTOI 2WPEA 2WB1A 3NVZB 2DE7A 1VQ6Z 2WOVA 5IT9b 3B9JB 3I561 1NDAA 1STZA 2G2KA 5FLMI 4BURA 3DGZA 2JIRA 4NFRA 3VMHA 3OPSA 3FQMA 4KWSA 4NBGA 3FJ4A 1DTNA 2ZZCA 3GD6A 3UJEA 3GTLI 1NJI2 2JIMA 4KPRA 1S72Z 1XPYA 3DERA 1GREA 5G5HB 4H83A 4EMIA 1SFOI 2OZKA 3IK4A 3D2LA 1NP6A 4RVGA 1XDIA 1ZX9A 1LQLA 4MD7A 2OQHA 3OP2A 5A2Qf 2GGHA 2QAEA 3T6CA 2RBLA 5JRBA 2KI7B 2ZZBA 3URHA 3GCFA 2OO6A 4K2SA 3GTQI 1RVKA 2JUBA 2P8CA 2RDXA 4J56A 1JWHC 5KVHA 1TWAI 1VDVA 4E31A 2XGZA 4IL2A 3LUSA 3VMGA 1SJAA 2W3RA 4NEVA 5C44I 2QEX1 4YWSA 2A8XA 3IFUA 2OTLZ 1XS2A 3FV9A 1GRBA 3MSYA 2V8KA 1YJW1 2OLAA 2PK7A 1Q7Y2 2JA5I 4Z1YA 2PS2A 1K4QA 3CCU1 5CM2M 2GTHA 3J80b 2C3CA 2QLVB 2QJNA 2F4MA 5FJPA 4LA1A 3DFHA 3TWAA 3DESA 1VQ61 1K83I 1Z02A 1Q7Y1 1W6TA 1H6VA 3DK9A 4ZOHB 2HF1A 2PMZA 4E2XA 4A3RA 5BOEA 1PDYA 3S2HI 2V3VA 3R07C 2PGEA 3RRAA 4NB9A 1I6HI 1KKOA 3HKZA 1SJDA 1BKHA 1SJBA 2POZA 5A2Qb 2GDQA 1BWCA 2LEXA 1LVLA 5T6BA 4M6UA 3ZVHA 1YHQZ 3BG0B 5U1OA 5D1PA 1JJ2Z 1SB3B 2X99A 4EWCA 3CC21 1GERA 1YI2Z 3EANA 3TTEA 4EQXA 3SQPA 1VQLZ 3TW9A 3A7UA 3VCNA 2V3AA 3OTRA 1KCZA 3BOXA 3MZNA 5IT9f 4H4RA 2E3TA 3R25A 1W2BZ 3CCVZ 4NBAA 2GR2A 2JIOA 2GQWA 2FYMA 3GO2A 2P3YA 1VQ71 3IJLA 1KD11 1RNIA 5FLXb 4A6GA 2HU9A 3HPFA 1WCMI 1KRLA 3GRTA 4EM4A 3S47A 5D1OB 3CGEA 1VQ9Z 2ONEA 2ZAEB 3QKEA 4A3FI 3AN1A 3P93A 1NHRA 3MWCA 1S7MA 2F5ZA 4NBDA 5JCNA 1T3QC 1WUEA 3DK4A 1Q812 3CCJ1 3NH5A 1Y1VI 2VPZA 1VQOZ 2HXTA 4Z17A 3GD3A 3CCEZ 3I551 2QREB 1IYXA 3UXKA 4QTUA 1Y1WI 1WYGA 2C3DA 1EBDA 1M1K2 2XH7A 3NVWB 5AN9F 1D7YA 2QRCB 4DNAA 4HN8A 4MH4A 4DHGA 3MKCA 3NVVB 1TKKA 2WPCA 2PTXA 3CQZI 3A7RA 2YVJA 1WZNA 2M48A 4HGZA 3VDGA 3VTNA 1RM6B 4EQSA 2K5RA 3F3FC 1L8PA 2I3CA 3CCV1 2VPXA 1F3PA 2IZ3A 2K3RA 2MUCA 2GR0A 1KQSZ 1NHPA 2P8BA 3ES7A 5ENLA 3DGBA 3T4WA 4H4PA 1NU5A 3N6JA 1W2BY 4IL0A 4A3GI 3S17I 4E33A 2QKDA 3OW2Z 2JIPA 1FHUA 4Y52I 3R0UA 3T9PA 2WOWA 3H7VA 3TDHB 2B63I 2EQ6A 1GSNA 2OZ3A 3NS1B 1JPDX 4APNA 5FJTA 1TWCI 2O56A 3UCDA 1Q16A 1USPB 3N4EA 2JR6A 3RR1A 2JK6A 3I4NI 3RZOI 3PWGA 3UJ2A 3TQPA 2BCPA 4IP4A 3I55Z 1YITZ 3PFRA 4HPNA 2E9HA 3EKGA 3IR7A 1DL6A 1VQKZ 1TE6A 2GR3A 3CXBA 3HOXI 3KLJA 3RCYA 4E2YA 4IP5A 1FECA 1FEAA 3ESWA 1YIJ1 3SBFA 1QF8A 4M52A 1WUFA 3I07A 5T64A 3OC4A 1F9CA 2H85A 3QWUA 3O0HA 3OW1A 4EMJA 1DXLA 1ZH1A 2QJJA 3FG2P 4MONA 3FVDA 4FP1A 1RLYA 2VUMI 5J04A 4K8GA 2PMQA 3IC9A 3CAWA 2E2JI 5FS6A 2OTJZ 3S1MI 1EC7A 3JAMb 1GRHA 5IP9I 5JCMA 1FDIA 3CCSZ 3HOUI 2DW7A 4ZCWA 4MD8A 3H70A 1YI21 1N63C 4GISA 4A93I 1FEBA 2W3SA 2CDUA 5BOFA 2V8IA 1NJI1 2R7ZI 3P0WA 3BG1B 3L8KA 2PU1A 3ES8A 2OTL1 2O53A 1N60C 2LFUA 1YJWZ 4BXXI 3EEDA 3PO2I 1KQSY 3S5SA 4E8GA 2OFJA 5C3EI 4GMEA 2RT9A 1Q811 3MZKB 1ZY8A 3CCUZ 3CCLZ 3JZUA 3K1GA 1FO4A 1OJTA 5C4XI 3OW2Y 1QXFA 4A3BI 4RVHA 1ZXIC 1JOAA 3A7AA 3BSMA 4TVYA 5FLXf 3DGHA 4ADWA 2PP0A 1M6IA 1MNSA 3DJGX 2CFYA 3CC4Z 3QPEA 2AYDA 3I4KA 2DE5A 2JA7I 1MRAA 4HCLA 2QA4Z 4ZA0A 5IDZA 2J6AA 1GRAA 1K8A1 1Q822 1VQK1 3ZVHB 3AM9A 3CC71 4NBHA 4DWDA 3D6WA 5ER0A 3CXCZ 3VA8A 2V8JA 1FFVC 3SQSA 3H0GI 3CCRZ 3UCCA 7ENLA 2PA6A 1GRFA 3CT2A 3CC2Z 1ELSA 3S16I 3PO3I 4H19A 1GV4A 2HNEA 3J81f 3I56Z 3CME1 2OKTA 1N5WC 2HXUA 2OPJA 2QDDA 1VQNZ 4IHCA 1VQ51 5KVIA 2PM9A 4KEMA 4A35A 3IF8A 3CCS1 4H4WA 3RNMA 2WPFA 1VQPZ 5FJRA 1Q821 2GGGA 2AKLA 2VUGA 4S1TA 2AL2B 3QN3A 3ZLGA 6ENLA 3DJJA 1QYPA 5EBKA 1RQFA 3HRDC 1AOGA 1EBHA 2QGYA 1ZB9A 3PG6A 3CPWY 3GD4A 4H2HA 4NBCA 2ZC8A 3EF6A 3V4BA 4NB8A 3J80f 4RVDA 1F8WA 1GRGA 2P0IA 3G6E1 4JDRA 4E2ZA 1P48A 3QLDA 4MMWA 3TE5B 2NVKX 1ONFA 1SIWA 4H4VA 4IT1A 4E32A 4HCHA 1Y8CA 2E7ZA 1YJ9Z 1VQMZ 1FHVA 3CMA1 3U4FA 3CD61 3AMZA 2NVTI 2YVGA 3CYJA 3TWBA 4DK1A 1RO2A 2JA8I 2CHRA 3G711 1ZK7A 2X8CA 3LADA 3QTPA 3ZLHA 4HH4A 3GY1A 4H4YA 4TNUA 4HGYA 3EUB3 2V45A 2R9ZA 2PTZA 3JW7A 3L5OA 4EQWA 1TFIA 3NO1A 3R1ZA 2M6NA 3JVAA 1VQ5Z 4E2WA 2FKPA 3QFBA 4EM3A 4QTTA 2VPYA 1ZB8A 1TWFI 3DDMA 1P43A 3DIPA 1QVFZ 1YHQ1 2NQLA 4MRIA 1AA6A 2F4OA 4A3LI 1K9M2 2YVFA 3N4FA 4BY1I 1VQ8Z 1N2FA 1GEUA 3EAOA 5FS8A 5FJOA 1VQ4Z 1RO0A 4XX2A 3R0KA 1KN0A 4A3JI 5JCIA 2GGIA 2DE6A 1ONEA 3VC5A 2E2HI 1YJNZ 2XH4A 4E4FA 1ML8A 2GL5A 2RPRA 4RS4A 1BQGA 1KKRA 3DG7A 4ENLA 2WAQA 3FCPA 4MD9A 1YIT1 2QR1B 3BJSA 3UGVA 4GGBA 1QVGY 3Q6JA 2OOXB 2JS4A
chains in the Genus database with same CATH topology
1I50I 4GRTA 1K9M1 2EQ9A 3M3YI 4A3II 3GTKI 2EQ8A 4YWOA 4NH1C 2RABA 1WIIA 3CC7Z 4EQRA 3D9XA 3CCE1 2V6OA 3S15I 2OTJ1 5GRTA 1PFTA 3CGDA 3KIHA 2R6MA 3CCM1 2W04A 2IZ4A 2AAQA 4FX9A 3IX0A 3CGBA 3NFZA 3GTMS 1XHCA 1ZDLA 4NBEA 1VQP1 3CCL1 5FS7A 2GU2A 3HOZI 5IP7I 1Q862 1BZLA 1P9NA 3EERA 1N8R1 3CC41 3G4SZ 1M901 3S14I 2GR1A 2X8HA 2R93I 4H4ZA 3PO3S 4H4SA 4K7ZA 2W0HA 1GESA 1L1OC 4DQYB 4RV9A 3K7AI 2HQMA 4NOZA 4E30A 5C4JI 1TYPA 4H4UA 1X3WA 1JJ2Y 2X8GA 2NVYI 3GTPI 5JCKA 1JEHA 4A3KI 2Q4ZA 1RO4A 4A3EI 4BBSI 1Z03A 1NHSA 3F3PC 1VLAA 2R92I 2V3BA 2NVXI 1LPFA 2ZZ0A 3I4MI 1Q1WA 3J81b 1NHQA 1YQZA 1S721 2WBAA 4RVFA 1K8A2 3G6EZ 5LL6f 3LXDA 4LIIA 2GTIA 4H4TA 3G4S1 1YJ91 4H50A 5FMHA 3CMAZ 4NBFA 1VQ81 1Y1VS 1VQ91 4A3DI 3CCQ1 2EGTA 4X6AI 1H2IA 1YUAA 2QEXZ 3CXCY 1ZMCA 2BC1A 1DNCA 2WP5A 3GTJI 1KC81 3NDIA 2JMOA 4DGLA 1Q1RA 1X0TA 1K731 4FDCB 1MO9A 3HOYI 1X3ZA 2BC0A 1V59A 3GRSA 1ZKQA 2BJOA 2RHBA 3JAMf 2X50A 2NPXA 1QVGZ 2OOYB 4EMWA 3CMEZ 1YUKA 1VQN1 5D1OA 3CGCA 1KC82 3H3VJ 1MOKA 2LIYA 3S1QI 2GRTA 3T4NB 2O4HA 3S1NI 4NEWA 3S1RI 1NPXA 1M1K1 3CCQZ 1Q861 4BV6A 2RIQA 1GETA 4CL1A 2YU9I 1TWHI 4GR1A 1TWGI 1K732 3HOVI 1VQM1 2J3NA 4BBRI 3CD6Z 1TYTA 4MXUA 3NH4A 1YIJZ 3G71Z 5FS9A 3GTMI 4Y7NI 2YADA 1NUIA 2Q51A 3GTGI 2EQ7A 2E2II 2KPIA 3CCJZ 4A3CI 3CCMZ 2W03A 1VQO1 1VQL1 3J7A4 2JNYA 2NVQI 1ZMDA 5U25A 4JQ9A 3DK8A 5T67A 3Q87A 2Y0SA 3II4A 3QFAA 3FKII 3VMIA 2QRDB 3KIFA 3P5JB 1VQ7Z 4H4XA 5JCLA 3MZLB 3FQQA 3MONA 2YQUA 3CPWZ 4J57A 1USPA 1R9TI 4NBBA 3LB8A 1WW9A 3VB9A 1M902 5TR3A 1Z01A 3GKQA 1VQ41 1N8R2 2P28A 3HOWI 1KD12 1GXFA 1XANA 2GH5A 4K8DA 1YJN1 3DH9A 3H4KA 2QA41 2JA6I 3NH8A 2TPRA 4H4QA 3M4OI 4BY7I 1QVFY 2VF1A 2WP6A 2YAUA 3S2DI 3RZDI 3CCR1 2WOIA 3NDJA 3U50C 4A3MI 1GRTA 4AYBA 1I3QI 3GTOI 2WPEA 2WB1A 2DE7A 1VQ6Z 2WOVA 5IT9b 3I561 1NDAA 2G2KA 5FLMI 4BURA 3DGZA 4NFRA 3VMHA 3FQMA 4NBGA 2ZZCA 3GTLI 1NJI2 4KPRA 1S72Z 4EMIA 1GREA 1SFOI 2OZKA 1NP6A 4RVGA 1XDIA 1ZX9A 1LQLA 4MD7A 5A2Qf 2QAEA 2RBLA 5JRBA 2KI7B 2ZZBA 3URHA 3GCFA 3GTQI 2JUBA 4J56A 1JWHC 5KVHA 1TWAI 4E31A 3LUSA 3VMGA 4NEVA 5C44I 2QEX1 2A8XA 3IFUA 2OTLZ 1GRBA 2V8KA 1YJW1 2PK7A 1Q7Y2 2JA5I 1K4QA 3CCU1 5CM2M 2GTHA 3J80b 2C3CA 2QLVB 2F4MA 4LA1A 1VQ61 1K83I 1Z02A 1Q7Y1 1H6VA 3DK9A 2HF1A 2PMZA 4E2XA 3S2HI 4NB9A 1I6HI 3HKZA 5A2Qb 1BWCA 1LVLA 5T6BA 1YHQZ 3BG0B 5U1OA 5D1PA 1JJ2Z 2X99A 4EWCA 3CC21 1GERA 1YI2Z 3EANA 4EQXA 3SQPA 1VQLZ 2V3AA 5IT9f 4H4RA 1W2BZ 3CCVZ 4NBAA 2GR2A 2GQWA 2P3YA 1VQ71 1KD11 1RNIA 5FLXb 2HU9A 1WCMI 1KRLA 3GRTA 4EM4A 5D1OB 3CGEA 1VQ9Z 2ZAEB 4A3FI 1NHRA 1S7MA 2F5ZA 4NBDA 5JCNA 3DK4A 1Q812 3CCJ1 3NH5A 1Y1VI 1VQOZ 3GD3A 3CCEZ 3I551 2QREB 1Y1WI 4QTUA 2C3DA 1EBDA 1M1K2 5AN9F 1D7YA 2QRCB 4DNAA 4MH4A 2WPCA 3CQZI 2YVJA 4HGZA 2M48A 3VTNA 4EQSA 2K5RA 3F3FC 2I3CA 3CCV1 1F3PA 2IZ3A 2K3RA 2GR0A 1KQSZ 1NHPA 4H4PA 1W2BY 4A3GI 3S17I 4E33A 2QKDA 3OW2Z 4Y52I 2WOWA 3TDHB 2B63I 2EQ6A 1GSNA 4APNA 1TWCI 1USPB 2JR6A 2JK6A 3I4NI 3RZOI 2BCPA 3I55Z 1YITZ 2E9HA 1DL6A 1VQKZ 2GR3A 3HOXI 3KLJA 4E2YA 1FECA 1FEAA 3ESWA 1YIJ1 1QF8A 4M52A 3OC4A 3I07A 5T64A 4EMJA 2H85A 3QWUA 3O0HA 1DXLA 1ZH1A 3FG2P 4MONA 1RLYA 2VUMI 3IC9A 2E2JI 5FS6A 2OTJZ 3S1MI 3JAMb 1GRHA 5IP9I 5JCMA 3CCSZ 3HOUI 4MD8A 1YI21 4A93I 1FEBA 2CDUA 2V8IA 1NJI1 2R7ZI 3BG1B 3L8KA 2OTL1 2O53A 2LFUA 1YJWZ 4BXXI 3EEDA 3PO2I 1KQSY 5C3EI 2RT9A 1Q811 3MZKB 1ZY8A 3CCUZ 3CCLZ 1OJTA 5C4XI 3OW2Y 4A3BI 4RVHA 1JOAA 5FLXf 3DGHA 4ADWA 1M6IA 3DJGX 2CFYA 3CC4Z 2DE5A 2JA7I 2QA4Z 2J6AA 1GRAA 1K8A1 1Q822 1VQK1 3CC71 4NBHA 3D6WA 5ER0A 3CXCZ 2V8JA 3H0GI 3CCRZ 1GRFA 3CC2Z 3S16I 3PO3I 1GV4A 3J81f 3I56Z 3CME1 1VQNZ 1VQ51 5KVIA 2PM9A 3IF8A 3CCS1 4H4WA 3RNMA 2WPFA 1VQPZ 1Q821 2AKLA 2VUGA 4S1TA 3DJJA 1QYPA 5EBKA 1RQFA 1AOGA 1ZB9A 3PG6A 3CPWY 3GD4A 4NBCA 3EF6A 4NB8A 3J80f 4RVDA 1F8WA 1GRGA 3G6E1 4JDRA 4E2ZA 3TE5B 2NVKX 1ONFA 4H4VA 4E32A 1YJ9Z 1VQMZ 3CMA1 3CD61 2NVTI 2YVGA 4DK1A 1RO2A 2JA8I 3G711 1ZK7A 2X8CA 3LADA 4HH4A 4H4YA 4TNUA 4HGYA 2R9ZA 4EQWA 3L5OA 1TFIA 2M6NA 1VQ5Z 4E2WA 3QFBA 4EM3A 4QTTA 1ZB8A 1TWFI 1QVFZ 1YHQ1 4MRIA 2F4OA 4A3LI 1K9M2 2YVFA 4BY1I 1VQ8Z 1N2FA 1GEUA 3EAOA 5FS8A 1VQ4Z 1RO0A 4XX2A 5JCIA 1KN0A 4A3JI 2DE6A 2E2HI 1YJNZ 1ML8A 2RPRA 4RS4A 2WAQA 4MD9A 1YIT1 2QR1B 1QVGY 3Q6JA 2OOXB 2JS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7M A;  3D9X A; 
#chains in the Genus database with same CATH topology
 1I50 I;  2IV2 X;  4GRT A;  1K9M 1;  2EQ9 A;  4G8T A;  2I5Q A;  2XH2 A;  3MY9 A;  3M3Y I;  4A3I I;  3GTK I;  2POD A;  2EQ8 A;  4YWO A;  4NH1 C;  3OZM A;  3V5C A;  3Q45 A;  2RAB A;  1WII A;  2OZT A;  3CC7 Z;  4EQR A;  3D9X A;  3CCE 1;  2V6O A;  3S15 I;  3CXO A;  2OTJ 1;  1N61 C;  5GRT A;  1PFT A;  3VC6 A;  3CGD A;  3KIH A;  4JN8 A;  1JRP A;  4MKS A;  2R6M A;  1N5X A;  2JIQ A;  2PP3 A;  4HYR A;  3CCM 1;  3ZVI A;  2W04 A;  2OVL A;  2IZ4 A;  2AAQ A;  4FX9 A;  3IX0 A;  3CGB A;  3NFZ A;  3GTM S;  2NAP A;  1XHC A;  1ZDL A;  3STP A;  3H8A A;  3RIT A;  3RGT A;  4NBE A;  1VQP 1;  3CCL 1;  5FS7 A;  3SN0 A;  2GU2 A;  3HOZ I;  5IP7 I;  1Q86 2;  3B97 A;  1BZL A;  1P9N A;  3EER A;  1N8R 1;  3CC4 1;  3G4S Z;  1M90 1;  3S14 I;  2AKM A;  2GR1 A;  2PP1 A;  2X8H A;  4GYP A;  4TVW A;  2R93 I;  1E9I A;  5G5G B;  4H4Z A;  3PO3 S;  1JRO A;  4H4S A;  4K7Z A;  2AL1 A;  2W0H A;  4HNL A;  4KPL A;  1GES A;  3KUM A;  4G7F A;  1L1O C;  4J3Z A;  4DQY B;  4RV9 A;  3MQT A;  3K7A I;  1R0M A;  2HQM A;  4GFI A;  4NOZ A;  2XH0 A;  4E30 A;  5C4J I;  1TYP A;  4H4U A;  1X3W A;  2VPW A;  1JJ2 Y;  2X8G A;  3I6T A;  3IJQ A;  2NVY I;  4GGH A;  4DYE A;  3GTP I;  5JCK A;  1JEH A;  4A3K I;  3OZY A;  3U9I A;  1X2H A;  3SN1 A;  2Q4Z A;  1RO4 A;  3DG6 A;  4A3E I;  4BBS I;  2W54 A;  1Z03 A;  1NHS A;  1V97 A;  3F3P C;  1VLA A;  2R92 I;  3FXG A;  3TOY A;  1WJ2 A;  2NVX I;  1LPF A;  2V3B A;  2ZZ0 A;  3SJN A;  3VFC A;  3I4M I;  1EC8 A;  2P3Z A;  1Q1W A;  3R11 A;  3T8Q A;  3J81 b;  5FJU A;  1NHQ A;  1YQZ A;  1S72 1;  2WBA A;  4RVF A;  1K8A 2;  1FIQ B;  3G6E Z;  2PTY A;  5LL6 f;  3LXD A;  4GIR A;  4LII A;  2GTI A;  4M0X A;  1FDO A;  2AKZ A;  2OX4 A;  1MUC A;  4H4T A;  3G4S 1;  1YJ9 1;  2QVH A;  4H50 A;  5FMH A;  3CMA Z;  3MUC A;  4NBF A;  1VQ8 1;  3UJF A;  1Y1V S;  1VQ9 1;  4A3D I;  3CCQ 1;  2PCE A;  3CK5 A;  2EGT A;  4X6A I;  1H2I A;  3R10 A;  1YUA A;  3I6E A;  4GYP C;  2QEX Z;  3CXC Y;  1ZMC A;  3SSZ A;  2BC1 A;  1DNC A;  2WP5 A;  2MNR A;  3GTJ I;  1KC8 1;  3NDI A;  1SJC A;  2JMO A;  4DGL A;  1Q1R A;  2PSN A;  3V5F A;  1X0T A;  1K73 1;  4FDC B;  1MO9 A;  3HOY I;  1X3Z A;  2BC0 A;  3D47 A;  1V59 A;  4HCD A;  3GRS A;  1ZKQ A;  3DEQ A;  4E4U A;  1ECQ A;  2BJO A;  3NRZ B;  4MGG A;  2RHB A;  3JAM f;  2OG9 A;  3PK7 A;  2X50 A;  2NPX A;  1QVG Z;  1MDR A;  1YEY A;  2OOY B;  3Q4D A;  3TCS A;  4EMW A;  4E5T A;  3CME Z;  3ENL A;  2XSX A;  4IZG A;  1KD0 A;  1MDL A;  1YUK A;  3TJI A;  3EEZ A;  1VQN 1;  5D1O A;  3CGC A;  1KC8 2;  3H3V J;  4HNC A;  4JN7 A;  3VCC A;  2QDE A;  1MOK A;  2LIY A;  3S1Q I;  2PGW A;  2GRT A;  2QJM A;  3T4N B;  2O4H A;  3S1N I;  3H12 A;  3SN4 A;  3FYY A;  4NEW A;  3S1R I;  1N62 C;  2ZAD A;  1NPX A;  1NEL A;  1M1K 1;  3CCQ Z;  1EBG A;  4J1O A;  1Q86 1;  2E5A A;  4BV6 A;  2RIQ A;  4ROP A;  1GET A;  3THU A;  4DXK A;  4CL1 A;  1JDF A;  2YU9 I;  1TWH I;  4GR1 A;  3GC2 A;  1OEP A;  1TWG I;  4FI4 A;  1K73 2;  1X2G A;  2OZ8 A;  3HOV I;  1VQM 1;  2J3N A;  1FFU C;  3CB3 A;  3V3W A;  4BBR I;  3HW2 A;  3CD6 Z;  1TYT A;  4MXU A;  1R6W A;  2GGJ A;  3NH4 A;  2GGE A;  1YIJ Z;  3G71 Z;  5FS9 A;  2PPG A;  3GTM I;  4Y7N I;  2YAD A;  1NUI A;  2Q51 A;  3UJS A;  3GTG I;  2EQ7 A;  2E2I I;  2KPI A;  3CCJ Z;  4A3C I;  3CCM Z;  2W03 A;  1VQO 1;  1VQL 1;  3J7A 4;  2HZG A;  3DG3 A;  4JHM A;  3RO6 A;  2JNY A;  2NVQ I;  1ZMD A;  5U25 A;  4EWJ A;  3IJI A;  2AL2 A;  3NVY B;  4JQ9 A;  3DK8 A;  5T67 A;  3Q87 A;  2Y0S A;  3II4 A;  3QFA A;  3FKI I;  3VMI A;  1JPM A;  2PTW A;  4X2P A;  3TJ4 A;  2OQY A;  2QRD B;  3KIF A;  3P5J B;  1VQ7 Z;  3DFY A;  4H4X A;  4F4R A;  5JCL A;  3MZL B;  3FQQ A;  4H1Z A;  3MON A;  2YQU A;  3CPW Z;  4J57 A;  1USP A;  1R9T I;  4NBB A;  3LB8 A;  1WW9 A;  4KT2 A;  3SR6 B;  3VB9 A;  1M90 2;  5TR3 A;  1Z01 A;  3GKQ A;  1VQ4 1;  1N8R 2;  3UXL A;  4E6M A;  2P28 A;  3HOW I;  1KD1 2;  1GXF A;  4DN1 A;  3NZG A;  3P3B A;  1XAN A;  2GH5 A;  3NXL A;  3D46 A;  1YJN 1;  3NFU A;  4K8D A;  3DH9 A;  3H4K A;  2QA4 1;  2JA6 I;  2QQ6 A;  3PWI A;  3NH8 A;  1TZZ A;  2TPR A;  3N6H A;  2W55 A;  3M4O I;  4BY7 I;  1VQZ A;  1QVF Y;  4H4Q A;  2VF1 A;  2WP6 A;  3UJR A;  2GSH A;  4DX3 A;  4K1W A;  2YAU A;  3S2D I;  1JCT A;  3RZD I;  1PDZ A;  2P88 A;  3CCR 1;  2WOI A;  3NDJ A;  3U50 C;  5EU9 A;  4A3M I;  1GRT A;  1EC9 A;  4AYB A;  3ETR B;  3ZLF A;  2PU0 A;  2DW6 A;  1I3Q I;  3GTO I;  2WPE A;  2WB1 A;  3NVZ B;  2DE7 A;  1VQ6 Z;  2WOV A;  5IT9 b;  3B9J B;  3I56 1;  1NDA A;  1STZ A;  2G2K A;  5FLM I;  4BUR A;  3DGZ A;  2JIR A;  4NFR A;  3VMH A;  3OPS A;  3FQM A;  4KWS A;  4NBG A;  3FJ4 A;  1DTN A;  2ZZC A;  3GD6 A;  3UJE A;  3GTL I;  1NJI 2;  2JIM A;  4KPR A;  1S72 Z;  1XPY A;  3DER A;  1GRE A;  5G5H B;  4H83 A;  4EMI A;  1SFO I;  2OZK A;  3IK4 A;  3D2L A;  1NP6 A;  4RVG A;  1XDI A;  1ZX9 A;  1LQL A;  4MD7 A;  2OQH A;  3OP2 A;  5A2Q f;  2GGH A;  2QAE A;  3T6C A;  2RBL A;  5JRB A;  2KI7 B;  2ZZB A;  3URH A;  3GCF A;  2OO6 A;  4K2S A;  3GTQ I;  1RVK A;  2JUB A;  2P8C A;  2RDX A;  4J56 A;  1JWH C;  5KVH A;  1TWA I;  1VDV A;  4E31 A;  2XGZ A;  4IL2 A;  3LUS A;  3VMG A;  1SJA A;  2W3R A;  4NEV A;  5C44 I;  2QEX 1;  4YWS A;  2A8X A;  3IFU A;  2OTL Z;  1XS2 A;  3FV9 A;  1GRB A;  3MSY A;  2V8K A;  1YJW 1;  2OLA A;  2PK7 A;  1Q7Y 2;  2JA5 I;  4Z1Y A;  2PS2 A;  1K4Q A;  3CCU 1;  5CM2 M;  2GTH A;  3J80 b;  2C3C A;  2QLV B;  2QJN A;  2F4M A;  5FJP A;  4LA1 A;  3DFH A;  3TWA A;  3DES A;  1VQ6 1;  1K83 I;  1Z02 A;  1Q7Y 1;  1W6T A;  1H6V A;  3DK9 A;  4ZOH B;  2HF1 A;  2PMZ A;  4E2X A;  4A3R A;  5BOE A;  1PDY A;  3S2H I;  2V3V A;  3R07 C;  2PGE A;  3RRA A;  4NB9 A;  1I6H I;  1KKO A;  3HKZ A;  1SJD A;  1BKH A;  1SJB A;  2POZ A;  5A2Q b;  2GDQ A;  1BWC A;  2LEX A;  1LVL A;  5T6B A;  4M6U A;  3ZVH A;  1YHQ Z;  3BG0 B;  5U1O A;  5D1P A;  1JJ2 Z;  1SB3 B;  2X99 A;  4EWC A;  3CC2 1;  1GER A;  1YI2 Z;  3EAN A;  3TTE A;  4EQX A;  3SQP A;  1VQL Z;  3TW9 A;  3A7U A;  3VCN A;  2V3A A;  3OTR A;  1KCZ A;  3BOX A;  3MZN A;  5IT9 f;  4H4R A;  2E3T A;  3R25 A;  1W2B Z;  3CCV Z;  4NBA A;  2GR2 A;  2JIO A;  2GQW A;  2FYM A;  3GO2 A;  2P3Y A;  1VQ7 1;  3IJL A;  1KD1 1;  1RNI A;  5FLX b;  4A6G A;  2HU9 A;  3HPF A;  1WCM I;  1KRL A;  3GRT A;  4EM4 A;  3S47 A;  5D1O B;  3CGE A;  1VQ9 Z;  2ONE A;  2ZAE B;  3QKE A;  4A3F I;  3AN1 A;  3P93 A;  1NHR A;  3MWC A;  1S7M A;  2F5Z A;  4NBD A;  5JCN A;  1T3Q C;  1WUE A;  3DK4 A;  1Q81 2;  3CCJ 1;  3NH5 A;  1Y1V I;  2VPZ A;  1VQO Z;  2HXT A;  4Z17 A;  3GD3 A;  3CCE Z;  3I55 1;  2QRE B;  1IYX A;  3UXK A;  4QTU A;  1Y1W I;  1WYG A;  2C3D A;  1EBD A;  1M1K 2;  2XH7 A;  3NVW B;  5AN9 F;  1D7Y A;  2QRC B;  4DNA A;  4HN8 A;  4MH4 A;  4DHG A;  3MKC A;  3NVV B;  1TKK A;  2WPC A;  2PTX A;  3CQZ I;  3A7R A;  2YVJ A;  1WZN A;  2M48 A;  4HGZ A;  3VDG A;  3VTN A;  1RM6 B;  4EQS A;  2K5R A;  3F3F C;  1L8P A;  2I3C A;  3CCV 1;  2VPX A;  1F3P A;  2IZ3 A;  2K3R A;  2MUC A;  2GR0 A;  1KQS Z;  1NHP A;  2P8B A;  3ES7 A;  5ENL A;  3DGB A;  3T4W A;  4H4P A;  1NU5 A;  3N6J A;  1W2B Y;  4IL0 A;  4A3G I;  3S17 I;  4E33 A;  2QKD A;  3OW2 Z;  2JIP A;  1FHU A;  4Y52 I;  3R0U A;  3T9P A;  2WOW A;  3H7V A;  3TDH B;  2B63 I;  2EQ6 A;  1GSN A;  2OZ3 A;  3NS1 B;  1JPD X;  4APN A;  5FJT A;  1TWC I;  2O56 A;  3UCD A;  1Q16 A;  1USP B;  3N4E A;  2JR6 A;  3RR1 A;  2JK6 A;  3I4N I;  3RZO I;  3PWG A;  3UJ2 A;  3TQP A;  2BCP A;  4IP4 A;  3I55 Z;  1YIT Z;  3PFR A;  4HPN A;  2E9H A;  3EKG A;  3IR7 A;  1DL6 A;  1VQK Z;  1TE6 A;  2GR3 A;  3CXB A;  3HOX I;  3KLJ A;  3RCY A;  4E2Y A;  4IP5 A;  1FEC A;  1FEA A;  3ESW A;  1YIJ 1;  3SBF A;  1QF8 A;  4M52 A;  1WUF A;  3I07 A;  5T64 A;  3OC4 A;  1F9C A;  2H85 A;  3QWU A;  3O0H A;  3OW1 A;  4EMJ A;  1DXL A;  1ZH1 A;  2QJJ A;  3FG2 P;  4MON A;  3FVD A;  4FP1 A;  1RLY A;  2VUM I;  5J04 A;  4K8G A;  2PMQ A;  3IC9 A;  3CAW A;  2E2J I;  5FS6 A;  2OTJ Z;  3S1M I;  1EC7 A;  3JAM b;  1GRH A;  5IP9 I;  5JCM A;  1FDI A;  3CCS Z;  3HOU I;  2DW7 A;  4ZCW A;  4MD8 A;  3H70 A;  1YI2 1;  1N63 C;  4GIS A;  4A93 I;  1FEB A;  2W3S A;  2CDU A;  5BOF A;  2V8I A;  1NJI 1;  2R7Z I;  3P0W A;  3BG1 B;  3L8K A;  2PU1 A;  3ES8 A;  2OTL 1;  2O53 A;  1N60 C;  2LFU A;  1YJW Z;  4BXX I;  3EED A;  3PO2 I;  1KQS Y;  3S5S A;  4E8G A;  2OFJ A;  5C3E I;  4GME A;  2RT9 A;  1Q81 1;  3MZK B;  1ZY8 A;  3CCU Z;  3CCL Z;  3JZU A;  3K1G A;  1FO4 A;  1OJT A;  5C4X I;  3OW2 Y;  1QXF A;  4A3B I;  4RVH A;  1ZXI C;  1JOA A;  3A7A A;  3BSM A;  4TVY A;  5FLX f;  3DGH A;  4ADW A;  2PP0 A;  1M6I A;  1MNS A;  3DJG X;  2CFY A;  3CC4 Z;  3QPE A;  2AYD A;  3I4K A;  2DE5 A;  2JA7 I;  1MRA A;  4HCL A;  2QA4 Z;  4ZA0 A;  5IDZ A;  2J6A A;  1GRA A;  1K8A 1;  1Q82 2;  1VQK 1;  3ZVH B;  3AM9 A;  3CC7 1;  4NBH A;  4DWD A;  3D6W A;  5ER0 A;  3CXC Z;  3VA8 A;  2V8J A;  1FFV C;  3SQS A;  3H0G I;  3CCR Z;  3UCC A;  7ENL A;  2PA6 A;  1GRF A;  3CT2 A;  3CC2 Z;  1ELS A;  3S16 I;  3PO3 I;  4H19 A;  1GV4 A;  2HNE A;  3J81 f;  3I56 Z;  3CME 1;  2OKT A;  1N5W C;  2HXU A;  2OPJ A;  2QDD A;  1VQN Z;  4IHC A;  1VQ5 1;  5KVI A;  2PM9 A;  4KEM A;  4A35 A;  3IF8 A;  3CCS 1;  4H4W A;  3RNM A;  2WPF A;  1VQP Z;  5FJR A;  1Q82 1;  2GGG A;  2AKL A;  2VUG A;  4S1T A;  2AL2 B;  3QN3 A;  3ZLG A;  6ENL A;  3DJJ A;  1QYP A;  5EBK A;  1RQF A;  3HRD C;  1AOG A;  1EBH A;  2QGY A;  1ZB9 A;  3PG6 A;  3CPW Y;  3GD4 A;  4H2H A;  4NBC A;  2ZC8 A;  3EF6 A;  3V4B A;  4NB8 A;  3J80 f;  4RVD A;  1F8W A;  1GRG A;  2P0I A;  3G6E 1;  4JDR A;  4E2Z A;  1P48 A;  3QLD A;  4MMW A;  3TE5 B;  2NVK X;  1ONF A;  1SIW A;  4H4V A;  4IT1 A;  4E32 A;  4HCH A;  1Y8C A;  2E7Z A;  1YJ9 Z;  1VQM Z;  1FHV A;  3CMA 1;  3U4F A;  3CD6 1;  3AMZ A;  2NVT I;  2YVG A;  3CYJ A;  3TWB A;  4DK1 A;  1RO2 A;  2JA8 I;  2CHR A;  3G71 1;  1ZK7 A;  2X8C A;  3LAD A;  3QTP A;  3ZLH A;  4HH4 A;  3GY1 A;  4H4Y A;  4TNU A;  4HGY A;  3EUB 3;  2V45 A;  2R9Z A;  2PTZ A;  3JW7 A;  3L5O A;  4EQW A;  1TFI A;  3NO1 A;  3R1Z A;  2M6N A;  3JVA A;  1VQ5 Z;  4E2W A;  2FKP A;  3QFB A;  4EM3 A;  4QTT A;  2VPY A;  1ZB8 A;  1TWF I;  3DDM A;  1P43 A;  3DIP A;  1QVF Z;  1YHQ 1;  2NQL A;  4MRI A;  1AA6 A;  2F4O A;  4A3L I;  1K9M 2;  2YVF A;  3N4F A;  4BY1 I;  1VQ8 Z;  1N2F A;  1GEU A;  3EAO A;  5FS8 A;  5FJO A;  1VQ4 Z;  1RO0 A;  4XX2 A;  3R0K A;  1KN0 A;  4A3J I;  5JCI A;  2GGI A;  2DE6 A;  1ONE A;  3VC5 A;  2E2H I;  1YJN Z;  2XH4 A;  4E4F A;  1ML8 A;  2GL5 A;  2RPR A;  4RS4 A;  1BQG A;  1KKR A;  3DG7 A;  4ENL A;  2WAQ A;  3FCP A;  4MD9 A;  1YIT 1;  2QR1 B;  3BJS A;  3UGV A;  4GGB A;  1QVG Y;  3Q6J A;  2OOX B;  2JS4 A; 
#chains in the Genus database with same CATH homology
 1I50 I;  4GRT A;  1K9M 1;  2EQ9 A;  3M3Y I;  4A3I I;  3GTK I;  2EQ8 A;  4YWO A;  4NH1 C;  2RAB A;  1WII A;  3CC7 Z;  4EQR A;  3D9X A;  3CCE 1;  2V6O A;  3S15 I;  2OTJ 1;  5GRT A;  1PFT A;  3CGD A;  3KIH A;  2R6M A;  3CCM 1;  2W04 A;  2IZ4 A;  2AAQ A;  4FX9 A;  3IX0 A;  3CGB A;  3NFZ A;  3GTM S;  1XHC A;  1ZDL A;  4NBE A;  1VQP 1;  3CCL 1;  5FS7 A;  2GU2 A;  3HOZ I;  5IP7 I;  1Q86 2;  1BZL A;  1P9N A;  3EER A;  1N8R 1;  3CC4 1;  3G4S Z;  1M90 1;  3S14 I;  2GR1 A;  2X8H A;  2R93 I;  4H4Z A;  3PO3 S;  4H4S A;  4K7Z A;  2W0H A;  1GES A;  1L1O C;  4DQY B;  4RV9 A;  3K7A I;  2HQM A;  4NOZ A;  4E30 A;  5C4J I;  1TYP A;  4H4U A;  1X3W A;  1JJ2 Y;  2X8G A;  2NVY I;  3GTP I;  5JCK A;  1JEH A;  4A3K I;  2Q4Z A;  1RO4 A;  4A3E I;  4BBS I;  1Z03 A;  1NHS A;  3F3P C;  1VLA A;  2R92 I;  2V3B A;  2NVX I;  1LPF A;  2ZZ0 A;  3I4M I;  1Q1W A;  3J81 b;  1NHQ A;  1YQZ A;  1S72 1;  2WBA A;  4RVF A;  1K8A 2;  3G6E Z;  5LL6 f;  3LXD A;  4LII A;  2GTI A;  4H4T A;  3G4S 1;  1YJ9 1;  4H50 A;  5FMH A;  3CMA Z;  4NBF A;  1VQ8 1;  1Y1V S;  1VQ9 1;  4A3D I;  3CCQ 1;  2EGT A;  4X6A I;  1H2I A;  1YUA A;  2QEX Z;  3CXC Y;  1ZMC A;  2BC1 A;  1DNC A;  2WP5 A;  3GTJ I;  1KC8 1;  3NDI A;  2JMO A;  4DGL A;  1Q1R A;  1X0T A;  1K73 1;  4FDC B;  1MO9 A;  3HOY I;  1X3Z A;  2BC0 A;  1V59 A;  3GRS A;  1ZKQ A;  2BJO A;  2RHB A;  3JAM f;  2X50 A;  2NPX A;  1QVG Z;  2OOY B;  4EMW A;  3CME Z;  1YUK A;  1VQN 1;  5D1O A;  3CGC A;  1KC8 2;  3H3V J;  1MOK A;  2LIY A;  3S1Q I;  2GRT A;  3T4N B;  2O4H A;  3S1N I;  4NEW A;  3S1R I;  1NPX A;  1M1K 1;  3CCQ Z;  1Q86 1;  4BV6 A;  2RIQ A;  1GET A;  4CL1 A;  2YU9 I;  1TWH I;  4GR1 A;  1TWG I;  1K73 2;  3HOV I;  1VQM 1;  2J3N A;  4BBR I;  3CD6 Z;  1TYT A;  4MXU A;  3NH4 A;  1YIJ Z;  3G71 Z;  5FS9 A;  3GTM I;  4Y7N I;  2YAD A;  1NUI A;  2Q51 A;  3GTG I;  2EQ7 A;  2E2I I;  2KPI A;  3CCJ Z;  4A3C I;  3CCM Z;  2W03 A;  1VQO 1;  1VQL 1;  3J7A 4;  2JNY A;  2NVQ I;  1ZMD A;  5U25 A;  4JQ9 A;  3DK8 A;  5T67 A;  3Q87 A;  2Y0S A;  3II4 A;  3QFA A;  3FKI I;  3VMI A;  2QRD B;  3KIF A;  3P5J B;  1VQ7 Z;  4H4X A;  5JCL A;  3MZL B;  3FQQ A;  3MON A;  2YQU A;  3CPW Z;  4J57 A;  1USP A;  1R9T I;  4NBB A;  3LB8 A;  1WW9 A;  3VB9 A;  1M90 2;  5TR3 A;  1Z01 A;  3GKQ A;  1VQ4 1;  1N8R 2;  2P28 A;  3HOW I;  1KD1 2;  1GXF A;  1XAN A;  2GH5 A;  4K8D A;  1YJN 1;  3DH9 A;  3H4K A;  2QA4 1;  2JA6 I;  3NH8 A;  2TPR A;  4H4Q A;  3M4O I;  4BY7 I;  1QVF Y;  2VF1 A;  2WP6 A;  2YAU A;  3S2D I;  3RZD I;  3CCR 1;  2WOI A;  3NDJ A;  3U50 C;  4A3M I;  1GRT A;  4AYB A;  1I3Q I;  3GTO I;  2WPE A;  2WB1 A;  2DE7 A;  1VQ6 Z;  2WOV A;  5IT9 b;  3I56 1;  1NDA A;  2G2K A;  5FLM I;  4BUR A;  3DGZ A;  4NFR A;  3VMH A;  3FQM A;  4NBG A;  2ZZC A;  3GTL I;  1NJI 2;  4KPR A;  1S72 Z;  4EMI A;  1GRE A;  1SFO I;  2OZK A;  1NP6 A;  4RVG A;  1XDI A;  1ZX9 A;  1LQL A;  4MD7 A;  5A2Q f;  2QAE A;  2RBL A;  5JRB A;  2KI7 B;  2ZZB A;  3URH A;  3GCF A;  3GTQ I;  2JUB A;  4J56 A;  1JWH C;  5KVH A;  1TWA I;  4E31 A;  3LUS A;  3VMG A;  4NEV A;  5C44 I;  2QEX 1;  2A8X A;  3IFU A;  2OTL Z;  1GRB A;  2V8K A;  1YJW 1;  2PK7 A;  1Q7Y 2;  2JA5 I;  1K4Q A;  3CCU 1;  5CM2 M;  2GTH A;  3J80 b;  2C3C A;  2QLV B;  2F4M A;  4LA1 A;  1VQ6 1;  1K83 I;  1Z02 A;  1Q7Y 1;  1H6V A;  3DK9 A;  2HF1 A;  2PMZ A;  4E2X A;  3S2H I;  4NB9 A;  1I6H I;  3HKZ A;  5A2Q b;  1BWC A;  1LVL A;  5T6B A;  1YHQ Z;  3BG0 B;  5U1O A;  5D1P A;  1JJ2 Z;  2X99 A;  4EWC A;  3CC2 1;  1GER A;  1YI2 Z;  3EAN A;  4EQX A;  3SQP A;  1VQL Z;  2V3A A;  5IT9 f;  4H4R A;  1W2B Z;  3CCV Z;  4NBA A;  2GR2 A;  2GQW A;  2P3Y A;  1VQ7 1;  1KD1 1;  1RNI A;  5FLX b;  2HU9 A;  1WCM I;  1KRL A;  3GRT A;  4EM4 A;  5D1O B;  3CGE A;  1VQ9 Z;  2ZAE B;  4A3F I;  1NHR A;  1S7M A;  2F5Z A;  4NBD A;  5JCN A;  3DK4 A;  1Q81 2;  3CCJ 1;  3NH5 A;  1Y1V I;  1VQO Z;  3GD3 A;  3CCE Z;  3I55 1;  2QRE B;  1Y1W I;  4QTU A;  2C3D A;  1EBD A;  1M1K 2;  5AN9 F;  1D7Y A;  2QRC B;  4DNA A;  4MH4 A;  2WPC A;  3CQZ I;  2YVJ A;  4HGZ A;  2M48 A;  3VTN A;  4EQS A;  2K5R A;  3F3F C;  2I3C A;  3CCV 1;  1F3P A;  2IZ3 A;  2K3R A;  2GR0 A;  1KQS Z;  1NHP A;  4H4P A;  1W2B Y;  4A3G I;  3S17 I;  4E33 A;  2QKD A;  3OW2 Z;  4Y52 I;  2WOW A;  3TDH B;  2B63 I;  2EQ6 A;  1GSN A;  4APN A;  1TWC I;  1USP B;  2JR6 A;  2JK6 A;  3I4N I;  3RZO I;  2BCP A;  3I55 Z;  1YIT Z;  2E9H A;  1DL6 A;  1VQK Z;  2GR3 A;  3HOX I;  3KLJ A;  4E2Y A;  1FEC A;  1FEA A;  3ESW A;  1YIJ 1;  1QF8 A;  4M52 A;  3OC4 A;  3I07 A;  5T64 A;  4EMJ A;  2H85 A;  3QWU A;  3O0H A;  1DXL A;  1ZH1 A;  3FG2 P;  4MON A;  1RLY A;  2VUM I;  3IC9 A;  2E2J I;  5FS6 A;  2OTJ Z;  3S1M I;  3JAM b;  1GRH A;  5IP9 I;  5JCM A;  3CCS Z;  3HOU I;  4MD8 A;  1YI2 1;  4A93 I;  1FEB A;  2CDU A;  2V8I A;  1NJI 1;  2R7Z I;  3BG1 B;  3L8K A;  2OTL 1;  2O53 A;  2LFU A;  1YJW Z;  4BXX I;  3EED A;  3PO2 I;  1KQS Y;  5C3E I;  2RT9 A;  1Q81 1;  3MZK B;  1ZY8 A;  3CCU Z;  3CCL Z;  1OJT A;  5C4X I;  3OW2 Y;  4A3B I;  4RVH A;  1JOA A;  5FLX f;  3DGH A;  4ADW A;  1M6I A;  3DJG X;  2CFY A;  3CC4 Z;  2DE5 A;  2JA7 I;  2QA4 Z;  2J6A A;  1GRA A;  1K8A 1;  1Q82 2;  1VQK 1;  3CC7 1;  4NBH A;  3D6W A;  5ER0 A;  3CXC Z;  2V8J A;  3H0G I;  3CCR Z;  1GRF A;  3CC2 Z;  3S16 I;  3PO3 I;  1GV4 A;  3J81 f;  3I56 Z;  3CME 1;  1VQN Z;  1VQ5 1;  5KVI A;  2PM9 A;  3IF8 A;  3CCS 1;  4H4W A;  3RNM A;  2WPF A;  1VQP Z;  1Q82 1;  2AKL A;  2VUG A;  4S1T A;  3DJJ A;  1QYP A;  5EBK A;  1RQF A;  1AOG A;  1ZB9 A;  3PG6 A;  3CPW Y;  3GD4 A;  4NBC A;  3EF6 A;  4NB8 A;  3J80 f;  4RVD A;  1F8W A;  1GRG A;  3G6E 1;  4JDR A;  4E2Z A;  3TE5 B;  2NVK X;  1ONF A;  4H4V A;  4E32 A;  1YJ9 Z;  1VQM Z;  3CMA 1;  3CD6 1;  2NVT I;  2YVG A;  4DK1 A;  1RO2 A;  2JA8 I;  3G71 1;  1ZK7 A;  2X8C A;  3LAD A;  4HH4 A;  4H4Y A;  4TNU A;  4HGY A;  2R9Z A;  4EQW A;  3L5O A;  1TFI A;  2M6N A;  1VQ5 Z;  4E2W A;  3QFB A;  4EM3 A;  4QTT A;  1ZB8 A;  1TWF I;  1QVF Z;  1YHQ 1;  4MRI A;  2F4O A;  4A3L I;  1K9M 2;  2YVF A;  4BY1 I;  1VQ8 Z;  1N2F A;  1GEU A;  3EAO A;  5FS8 A;  1VQ4 Z;  1RO0 A;  4XX2 A;  5JCI A;  1KN0 A;  4A3J I;  2DE6 A;  2E2H I;  1YJN Z;  1ML8 A;  2RPR A;  4RS4 A;  2WAQ A;  4MD9 A;  1YIT 1;  2QR1 B;  1QVG Y;  3Q6J A;  2OOX B;  2JS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...