3UGVA

Crystal structure of an enolase from alpha pretobacterium bal199 (efi target efi-501650) with bound mg
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
363
structure length
363
Chain Sequence
TLTFRKLTARPVLLKLQRPVTARIATIPDWPLILIDIETEEGVPGRAYLEPYVPKAMKYLVPALHDMSDMLAGQPLAPAEIYDKTRKSLHFVGYAGLSMIAASGVDMAVWDALARAANMPLCTLLGGTPGSVKAYNSNGLWLKSPAEVAAEAVELKAEGQGTGFKGLKLRMGRDDPAVDIETAEAVWDAVGRDTALMVDFNQGLDMAEAMHRTRQIDDLGLEWIEEPVVYDNFDGYAQLRHDLKTPLMIGENFYGPREMHQALQAGACDLVMPDFMRIGGVSGWMRAAGVAGAWGIPMSTHLYPEVGAHVMRVTETAHWLEWQSWADPILQEPYALSDGDLIVPDKPGLGLDWDEDVVAANLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an enolase from alpha pretobacterium bal199 (EFI TARGET EFI-501650) with bound MG
rcsb
source organism Alpha proteobacterium bal199
molecule tags Lyase
molecule keywords Enolase
total genus 133
structure length 363
sequence length 363
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ugvA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ugvA01
3RGTA 3R1ZA 2PP3A 3Q45A 3BSMA 4DHGA 3I6EA 6ENLA 2AL2A 1ELSA 3FXGA 1WUEA 2GL5A 2ONEA 2QDDA 2OX4A 2XH4A 3RR1A 2PP1A 2OKTA 3RRAA 1IYXA 4A6GA 3B97A 1W6TA 3DDMA 3DG7A 3N6JA 3SN4A 4IT1A 4DYEA 4IL0A 4E4FA 1MDLA 5FJUA 4H1ZA 3FCPA 4MMWA 3S5SA 4HPNA 1E9IA 4HN8A 3JZUA 3TCSA 2QJMA 3PWGA 2AL2B 2GSHA 1BKHA 4K8GA 4IHCA 2QQ6A 5FJRA 2OQYA 3CAWA 2PMQA 3OTRA 3UJ2A 1OEPA 1EC7A 2O56A 1RVKA 3DG6A 5IDZA 2ZC8A 3OPSA 1MRAA 3OZYA 2PTYA 3K1GA 2PSNA 2QGYA 2XGZA 1MUCA 2HXTA 1JCTA 3R11A 3VC6A 1F9CA 3NO1A 2OZTA 4DX3A 3OZMA 2P88A 3QN3A 4GYPA 1L8PA 4G7FA 3VDGA 3PK7A 4HCLA 3ZLHA 2PTWA 4A3RA 4HYRA 3ZLFA 2XH2A 3HPFA 3ES7A 3ZLGA 2OG9A 3I4KA 3NXLA 4ENLA 3GY1A 3CT2A 2OO6A 3UJEA 4F4RA 3GC2A 2NQLA 2P8BA 1TKKA 3DFYA 4GMEA 3FV9A 3MQTA 3N4FA 4IP5A 4JN7A 3N4EA 2XH0A 2PGWA 3VC5A 3MSYA 2PTXA 3TJIA 3OW1A 2FKPA 1XPYA 3OP2A 2GGGA 1SJDA 4IP4A 4HCDA 3V3WA 2ZADA 3H70A 2OFJA 1NELA 3V5CA 3UCDA 3JW7A 4A35A 3TW9A 2GGHA 2GDQA 3DERA 3CK5A 4E4UA 3TJ4A 2MUCA 2PP0A 3TWBA 3BOXA 2P3ZA 2RDXA 3P3BA 2XSXA 3TQPA 1SJBA 3MUCA 4H83A 3DIPA 2OZ8A 3T9PA 1KKOA 4M6UA 3ZVHA 4ZA0A 3R25A 3ES8A 3MKCA 3VCCA 3N6HA 3Q4DA 3CXOA 3EKGA 1PDZA 3MY9A 1XS2A 3U9IA 3MWCA 4FI4A 3DESA 3JVAA 3UJFA 5BOEA 3BJSA 4DWDA 3FYYA 4H2HA 3UJRA 4DXKA 4Z17A 1P43A 7ENLA 1KCZA 4FP1A 3SN0A 3GO2A 2AL1A 3D47A 5J04A 1KKRA 3U4FA 2OQHA 3NZGA 4EWJA 4E8GA 4X2PA 3T8QA 4H19A 2HZGA 1JPDX 4IZGA 4ROPA 4HCHA 4KT2A 4HNCA 2FYMA 3ZVHB 2OZ3A 4MGGA 2GGJA 3UXLA 3MZNA 1MDRA 4GIRA 1WUFA 3P0WA 5FJTA 1EC8A 4E6MA 3SN1A 3EEZA 4K1WA 1FHUA 1BQGA 3UJSA 3KUMA 3H8AA 4Z1YA 4J1OA 3QPEA 3STPA 2PU1A 5BOFA 3IJQA 3T4WA 2MNRA 2P8CA 1R0MA 4KWSA 2CHRA 4GISA 3ZVIA 4IL2A 3S47A 3NFUA 1PDYA 5FJOA 3TTEA 3RCYA 1P48A 3IJIA 2PCEA 3CYJA 5FJPA 2GGEA 2HXUA 3TWAA 2OLAA 1EBHA 3TOYA 3VCNA 3ENLA 3T6CA 3CB3A 1EC9A 4K2SA 1ECQA 2PA6A 2GGIA 5ENLA 3RO6A 4GFIA 4HNLA 3GD6A 1FHVA 2DW6A 2DW7A 4DN1A 3D46A 1ONEA 4J3ZA 3R0UA 3UGVA 3QKEA 3THUA 1YEYA 2AKMA 3PFRA 4JHMA 4GYPC 1DTNA 4MKSA 3DFHA 3P93A 2PU0A 3QLDA 3SBFA 2QDEA 4M0XA 3IJLA 3R10A 3DG3A 3PWIA 3UXKA 2POZA 3QTPA 1R6WA 1TZZA 2QVHA 2PS2A 4GGHA 3RITA 4KPLA 4YWSA 1SJAA 3IK4A 1NU5A 4ZCWA 3VA8A 3DGBA 4E5TA 2OPJA 3H7VA 3SSZA 3V5FA 2PGEA 3R0KA 2HNEA 2AKZA 3UCCA 4GGBA 4JN8A 5EU9A 1TE6A 3I6TA 1KD0A 2OVLA 3H12A 3VFCA 4KEMA 2PODA 1JPMA 3V4BA 3FJ4A 1JDFA 3FVDA 2QJJA 3SJNA 2PPGA 3SQSA 2QJNA 1MNSA 2I5QA 2P0IA 3DEQA 1EBGA 4G8TA 2XH7A 1SJCA 2PTZA
chains in the Genus database with same CATH superfamily
4GC3A 3BO9A 4DI8A 4FLOA 4Q32A 3MMTA 3VIHA 4J56A 4KRZA 1JCLA 3N2CA 4O4WA 3QQ0A 4JTEA 4JNZA 1TWDA 2DUXA 2XFRA 1FWCC 1TYTA 1LBLA 2XH4A 1GW9A 1WE5A 1ZRQA 1IYXA 3OG3A 3B8SA 3VGEA 1XIJA 1TELA 3MW7A 4ZFMA 3R13A 1RCQA 3O8AA 5E6ZA 5GJNA 2G5WA 4ECLA 1B54A 1ITCA 1RLCL 4H7CA 3GHRA 3F2DA 4NUWA 3GXMA 4E2BA 3NPWA 2NV9A 4O8RA 4LVAA 1W9UA 5JVLA 2QUNA 3QGKC 2Y85A 1J0ZA 3RRXA 2YR1A 1OYBA 3TMLA 5CBJA 4BHYA 1WB0A 4PRRA 2WBAA 2W0HA 4JTSA 4O12A 2YFOA 1XL9A 1L6SA 4JNMA 1GVIA 1XBYA 3D5HA 1Q8AA 1XISA 2XIBA 1XLDA 2CHOA 1JULA 3U4AA 4AD5A 1UZ4A 1F3TA 3V1PA 1U5HA 4QAIA 3NO1A 2UY3A 3THCA 4QP0A 3WFAA 2XM2A 2W9MA 4DX3A 3PB2A 4M8UA 4GYPA 1EYWA 1D8WA 2VR2A 4ICMA 3U2CA 1PX4A 1A4MA 2ZRVA 2CBUA 3BZJA 2DT0A 4NJKA 3L23A 3F2CA 5DLCA 4X60A 1U1UA 3VD3A 5DF0A 4LT9A 1YDYA 1VRXA 2FHBA 4Q6JA 1OY0A 3S2CA 4BV6A 1RLDA 3ES7A 4CEUC 4O16A 3NSNA 1S5WA 3LPGA 3G77A 2VFHA 2G97A 4B5TA 1GG0A 5G2WA 2TPRA 1N8FA 1JCJA 1OCNA 4LS1A 3FV9A 1TFVA 3M0VA 1UKQA 3LCLA 2ZUSA 4GG9A 1XM3A 4MNKA 1JGMA 3OW1A 2DPEA 5H1WA 5A6MA 2QCEA 1DV7A 3BGAA 3EB3A 4AB4A 3CHDA 4C6NA 1JDEA 3ZMRA 2ZZCA 5DMLA 1PTDA 4NSBA 4E4PA 1PVNA 3JR2A 4ZFCA 1OD8A 4GZIA 4ZE5A 1IIGA 3DI0A 3UYCA 2DVUA 2PE4A 3W01A 3CAKA 1CIUA 2R8WA 4H9TA 3M0JA 1KM6A 3MPGA 3EX6A 3NVYB 2W27A 2HVNA 4J7RA 2PDJA 3U2ZA 1KTNA 1Q63A 3HFTA 4IPJA 1PDZA 3K4WA 1XS2A 1T41A 4JIEA 1EX5A 3QR1A 3WMLA 1FWAC 4DJDD 2DT1A 1VFSA 4FI4A 1IWAA 3LTSA 1WQ5A 3W7CA 4KCWA 1W3JA 4PBGA 5BOEA 2VRKA 2QUVA 1DWIM 4RW3A 3H4GA 5IRPA 3PBMA 1HIZA 3WNLA 2F84A 3NZPA 4Z17A 2REQB 1CGUA 1MXGA 3WY1A 1AUSL 1GRGA 2CKRA 4OT7A 2MANA 2QCDA 1FHLA 4FLQA 3CZJA 1XPGA 3OBEA 2EPLX 2HZGA 2WVVA 1DVJA 4EAMA 3PAOA 1NHPA 3KLJA 2PI6A 1VCGA 1ME7A 3A3WA 1R38A 3CIVA 4XZIA 1XLHA 4LWWA 3HRDC 1YDOA 3LEPA 4MGGA 3M46A 1QOQA 5D37A 4CQAA 1AL7A 6TIMA 1UIPA 2RAGA 4I9TA 1V93A 4UQCA 1HL8A 4PGLA 1AQ0A 3HOJA 4FOKA 4LOCA 2C1GA 1V97A 2V5CA 3CHVA 2C3DA 5A6LA 2FH6A 3CXBA 2WJDA 2OSXA 2Z24A 1EP1A 3E5BA 4LEQA 2J8TA 2BWGA 2PZ0A 5KZMA 1NM9A 3MHUA 4MWAD 2O9OA 3BW4A 3MT1A 1K8XA 5I02A 1IXOA 2YCEA 3ITOA 4DJFA 2Y5EA 4QITA 3AISA 3EYPA 3DH9A 4QE4A 1KTCA 2GVJA 2WAGA 1XDJA 1F3XA 3QFBA 1PYFA 2X30A 4LUSB 1W0MA 2HXUA 4IH3A 5M17A 3CUHA 2DIKA 1LJYA 3W87A 1UYQA 1CI1A 1BYCA 1ECQA 2GGIA 1FWEC 4JHOA 2VX7A 1RBOB 1XCFA 1O68A 4WJEA 4LCRA 2CWXA 3LYEA 4YCOA 3W1AA 1SMAA 1UC4A 1QPOA 3LLFA 5DCBA 5KZEA 3N19B 3CQHA 4UTKA 4GI4A 4H00A 1DXIA 1Q4WA 3BMVA 1TJPA 4DF0A 4M0XA 2A3HA 3UESA 2VZUA 1R5YA 3DFSA 2POZA 2CERA 4JTKA 5B80A 2H9AB 2AAQA 4UBPC 4EX4A 4ZXOA 4JDBA 1V0LA 3P82A 3W25A 4H8UA 3MBDA 2VFDA 2ISWA 3MYOA 4YWSA 1PBGA 2BY2A 1UOKA 4AD2A 3BLDA 3WL0A 3BK0A 4D71A 3N9KA 4ZB2A 1EDGA 2EPOA 2VGIA 4ZO7A 3L4UA 2C3ZA 5BXSA 3UCCA 1R30A 3TMQA 1O5RA 5I23A 1IIHA 2ZZ7A 3T78A 3GDTA 2GJPA 3W24A 3B9OA 4B4HA 1V3HA 1UPPA 1UP2A 5AYZA 4FNQA 4UFKA 2XIOA 4XZHA 3C8FA 4FR6A 3INPA 5HJLA 3R8RA 3MI2A 3SQSA 4GOAA 4PUDA 3OLIA 3TN6A 2XH7A 3W2JA 1SJCA 1NWSA 3COTA 3NQBA 4ZVJA 2WP5A 1WKFA 4QJ1A 3TROA 1VBRA 2EGZA 3DN5A 3EB2A 4PMNA 1MQPA 4OKDA 3SRKA 3REQB 3PSVA 3EZ4A 3CMFA 2ONEA 3WUEA 3WMBA 2OKTA 1C9DA 2YDSA 1KM5A 3GZAA 1N5WC 4O15A 1UCWA 3GFZA 5EL1A 4LAMA 1A3WA 4IL0A 1UWAA 3CL7A 3EOOA 2VVNA 2VZOA 3L9CA 2YXGA 3NVTA 4AUBA 3FNDA 1HUVA 2QJMA 5FJIA 3IAPA 5FL1A 2YBVA 1B1YA 1OC6A 1IXPA 1PZ3A 1VFTA 3PR2A 5F1VA 3CL8A 2O4QA 3P8IA 1VYPX 4OWGA 4FB7A 3ARZA 1DIKA 3BCFA 1RVKA 4CQ9A 4FOJA 5C7HA 3IVSA 3Q58A 4BQ5A 1XFCA 1DL3A 4GXMA 3T2PA 4NIRA 1MOKA 3T07A 4NG3A 1MUCA 1V6UA 3UEQA 1S3TC 3F2BA 1CYGA 1OB0A 1J0HA 3KBWA 3QGVA 2WW5A 1UH4A 5K4ZA 2X8GA 4HNVA 2X09A 1PPIA 1W91A 3F5KA 3AHZA 5FD0A 3NEVA 1CWYA 4PCNA 4MUPA 4XD5A 2RDUA 1L6FA 2Y6ZA 5CPSA 5GJMA 1POKA 4HK5A 3W74A 4DNHA 2FVLA 1OIMA 4D6DA 1UHVA 1O94A 1B9BA 1VF8A 4QDMA 4TUFA 1C90A 1W5MA 4G1NA 3NQDA 3R43A 3MQTA 1NF0A 5D9PA 3AZSA 3L2IA 1K8ZA 2OGJA 3WH5A 1HKIA 1QATA 2W67A 2BVTA 1NY1A 5LXEA 1X2GA 3OP2A 3TN3A 4HCDA 1ZX9A 1QO2A 1WZAA 1RV8A 3QFAA 2FHFA 1VB9A 1LYXA 2HV5A 4DJEC 4MWAC 2EG8A 3AS2A 4L4OA 4CCEA 3GLCA 2E1WA 4JQ2A 5HANA 3CLWA 2PD9A 1P1XA 2ZKMX 9XIMA 1T8QA 1ZGDA 1EGZA 3CT7A 3TYZA 3H2NA 3ITVA 3NZQA 1WAWA 3G1AA 3WENA 1XLLA 6XIAA 4G7EA 1QBBA 4MYXA 2VL4A 2XYLA 4HA3A 3U2OA 2YCKX 5E5CA 2CHNA 1FWRA 1EP2A 2IMRA 1G69A 1IHIA 2OXNA 1ZPTA 9XIAA 1L6GA 3BLLA 4H4VA 4KWOA 3UJFA 5L9FA 3L7RA 2OOGA 4H2HA 4XAPA 1GKQA 4NEWA 4D1IA 3P0XA 4W88A 1KCZA 3SN0A 3PF3A 3S1GA 2FHCA 4EPDC 1CDGA 4P7OA 4B4FA 1JPDX 3KHDA 3EWYA 1MO9A 5GRTA 1G1YA 2WHMA 3EPMA 4PEEA 1M01A 1FWTA 4GKLA 3S2MA 5A6JA 3PZMA 4IGHA 3PTMA 3L2MA 3VNJA 1JPHA 3W1MA 4JDRA 1HXJA 5D2VA 3WLQA 2NUXA 4U2ZA 3CTLA 5CSRA 2BGSA 1XLAA 4D6CA 4D6GA 1GVQA 4OVXA 3UJSA 4JTCA 3OOQA 4MB1A 4OQVA 2PU1A 5BOFA 1W54A 4PMYA 3VZXA 4U2YA 1GOWA 3SCUA 2P8CA 4FK9A 3KTCA 8XIAA 1XYFA 1O1ZA 4PSRA 3E5PA 3T0CA 2FGLA 4K8HA 3N3MA 1DJYA 2WZEA 3P60A 3GVGA 4BR1A 3M0IA 4HA0A 5BMXA 1ZJAA 3UP8A 1SQ7A 3NQCA 3VCNA 4NAEB 2GDUA 3CB3A 3O05A 4CNUA 5FEPA 3L4XA 2NQJA 3SQPA 3KOFA 3CUFA 1EBDA 4HNLA 4WGHA 3N2BA 3VX0A 2ZC1A 2FJKA 3W2MA 1VZWA 4YTTA 2J3NA 2VDIA 4JR5A 2O92A 4M6VA 1QOPA 2CLMA 1W5PA 1RK6A 3THUA 1R2SA 4O1CA 1KWGA 5HR7A 3UG8A 3ZFHA 2C14A 5JIWA 2XU2A 4RDZA 1OZQA 3LSBA 1YPFA 3P74A 3IJLA 4V15A 1LQ2A 1FWIC 3ARSA 4MSSA 1LL4A 2NLYA 4PH6A 3CH0A 3NVVB 3ZJ8A 2ACQA 4BF7A 1X97A 5K3VA 3RCMA 1Y8BA 3FKRA 4HJFA 1TMLA 1WA3A 2PRMA 2Y61A 1NU5A 1ZLPA 2VC9A 1B3WA 3VABA 4LYQA 3AJ7A 1RM6B 3AIQA 3T7VA 4LYKA 1QK2A 2I5GA 4G5DA 5HWNA 3W1TA 4L64A 4ERAA 2VX4A 4CD8A 3BPWA 3V16A 1TB3A 4JN8A 3MO4A 2DSZA 1HJXA 1JGIA 1YPIA 3TXZA 3WF0A 2NSXA 5DY2A 3H23A 4FA3A 2V9DA 1ZMDA 3BAKA 3HJEA 1YTEA 3TN5A 5I0DA 1GRTA 1NDVA 3WQEA 3PTKA 4GIAA 5XIAA 4DXVA 3E9AA 2BVDA 1SR0A 2YOCA 2FZNA 2WMGA 5A6BA 1LT7A 1A80A 2BDQA 2WSQA 3NZ1A 3S1XA 3Q45A 3M0YA 4GD0A 1ESWA 2VFEA 4RE4A 4LAUA 1ELSA 5E9AA 5AVHA 2WM0A 3RHGA 3R2GA 1YKWA 4TVWA 2Y2WA 3DH7A 3B97A 4AZCA 3LHUA 4UNIA 3L68A 4DUVA 1CB7B 5GVJA 2YVFA 3AIUA 1XKYA 2UZ9A 3G3MA 2OWWA 2RJHA 2OLHA 2J9YA 4IQJA 1Q1RA 1CT5A 1T5AA 1W56A 3BURA 2NV2A 1PEZA 2OYLA 3NOYA 1U30A 1YNPA 1K9FA 5HWMA 1TUFA 3APTA 2GR3A 5HJXA 3GAYA 2OZ0A 1W32A 3PY2A 4KETA 3IIOA 3VK5A 4H9UA 1M5WA 3E74A 1XBZA 2BGNE 2V3FA 1KLYA 3LMYA 3QZAA 2J7FA 3MP4A 4BZYA 3BLPX 1BZLA 4PRTA 1UH3A 4GR1A 4FNRA 1IF2A 2OB3A 3WNMA 3LENA 3DZ1A 2BLEA 3IC9A 3ZLHA 5CAHA 2G8ZA 4H50A 1ML1A 5CC5A 4GK8A 1HT6A 4B3LA 5D02A 3ZLGA 1TRIA 4JKMA 3TAKA 3A13A 3WDPP 2X40A 5DMNA 2HTMA 1Q85A 1F8MA 1F07A 5CSSA 4JQ4A 3DKLA 2ZUMA 1B0IA 4QG6A 4AHQA 4CKQA 1J2BA 5JMUA 3A9IA 4JN7A 4PCTA 4TVUA 3UPMA 4E3VA 2J13A 3T2QA 3C0JA 1YTDA 2PTXA 3M0LA 3TJIA 3HPZA 1GTHA 1SJDA 3QQ1A 3EXRA 4OGZA 1OFOA 3VMPA 1XGZA 3FA4A 3GR4A 1K02A 3R4IA 4TQTA 2VCAA 1AL8A 4PCFA 1PIFA 3UU0A 4ZOCA 3SCRA 1M68A 1U22A 4JTJA 1GGOA 3IANA 3UWEA 4IMDA 5D8WA 3VTRA 1K9EA 4AY7A 5LIUX 2ZTJA 3AMDA 2GVYA 1DHKA 1OD0A 3GFXA 4K68A 4MVAA 3TSBA 4WKFA 3H53A 3PNUA 3BJFA 3NDOA 1KM0A 3TW6A 5CG7A 4O17A 2BOFX 1ZFJA 5T91A 3L4YA 4PMUA 4R5EA 4DQWA 4JS3A 3P61A 3N2XA 1GEHA 4MWAE 4LCSA 3WUFA 3QC3A 4RZ6A 1WDSA 3TR9A 1A50A 3HQOA 4IPPA 3HV9A 5B7YA 2X0YA 3JVAA 1JCYA 3U2EA 3G22A 1HO1A 4JYFA 5CGQA 2H9AA 2WQDA 3R89A 3K30A 3VKJA 2BODX 1N2VA 3SY1A 2DVTA 2A3BA 4E8GA 2OX1A 1K1DA 1UKSA 3KP1A 3WF2A 3WF1A 4IZGA 2GOUA 1TRDA 1ZBCA 4CNPA 3CGCA 2QJIA 3CUIA 1FFVC 4IIGA 1F05A 2NSOA 4AIUA 3BTNA 3ABZA 3ITXA 3VDCA 2WKGA 2XGIA 5IFPA 4KEUA 3RX2A 1H1NA 3M43A 1QNSA 3NYDA 4NJGA 1CX9A 1WUFA 2Z1WA 1BLIA 2PDBA 3QYSA 3NG3A 2ZZ4A 2WVSA 3KCOA 1MZHA 1GONA 3BOFA 4L9XA 2G3JA 1YNYA 3AS1A 1FHDA 2DT2A 4QLKA 3HMJG 2CZFA 2V82A 1MEIA 1H0GA 4H7ZA 4B9YA 4C60A 1H60A 5CZJA 2DH2A 5JCNA 1XLBA 4N6EA 3ZVIA 3AXKA 5HK4A 4A21A 3Q6JA 1QHPA 5CGMA 4PCPA 1LWHA 5A8NA 3SCSA 2ZA1A 5FJPA 1IT0A 4J27A 3E0LA 3A23A 2QCCA 1EJVC 1CLKA 1SW7A 4NYUA 1N62C 3TTSA 5LZLA 1FIQB 3P7YA 1AODA 4D8AA 4DF1A 2D2JA 5TR3A 1W3IA 4JKLA 5E1QA 4J57A 1KXTA 1Z69A 4H6QA 5FJJA 3ATZA 2VFGA 4MY9A 2GR1A 1W8SA 1BTMA 3OBKA 2R6OA 1HKMA 3SCOA 1HKWA 2D2OA 2OR2A 4L1XA 1ZJHA 3B8IA 4NAEA 3SUUA 3KBVA 2Y7GA 3URNA 4ZTXA 3EWCA 3KW3A 3W7KA 3T81A 4IPNB 1WO2A 3UXKA 5BRPA 1LWIA 1W1IE 4IMEA 1LP6A 5KZ6A 1C3FA 1DP0A 3H2OA 3E0VA 4LIIA 1IR2A 1PS9A 4GCXA 5D2XA 1SO3A 3GZ3A 4MTVA 4WEVX 1QK0A 4DO7A 3CJPA 3S5YA 4A05A 1A47A 1JDCA 5M03A 4C6IA 3MBFA 4P8WA 5CSYA 3KL5A 4DJDC 1POJA 1C8VA 4C5ZA 1Z89A 1S5VA 3E02A 1UW9A 4O54A 4Y9NA 4UR7A 1QFEA 1XG4A 1X7FA 4KWWA 5JH1A 2X2YA 3N34A 1MXDA 2H3DA 1F3PA 1ZS2A 1RY8A 3FVDA 3USZA 1TV5A 5EFDA 2BOEX 3GTFA 1NFGA 4G8TA 2QGHA 1FXQA 3TE9A 4ACZB 1JYVA 3QVQA 3NRZB 4GO8A 1QPNA 3QR0A 1VC4A 1JZ8A 1H61A 1E0UA 1MW1A 3B9DA 4GY0A 4LF2A 3LHYA 4GQRA 4RZBA 3RLVA 4PBEA 2WHLA 2VEIA 3LPFA 4LBSA 1FA2A 3LY0A 5FF4A 1C7TA 5D09A 4J3WA 3AOFA 5HUPA 3PZTA 1WKYA 3W83A 1UWTA 4PMXA 3HB9A 3TJLA 3GNNA 4IQDA 3LRLA 4OUEA 4AZHA 3FIGA 1S2AA 4GJJA 1PKNA 2AQVA 2EAWA 3BARA 4L56A 5HDRA 3G1XA 2CCRA 3GYCA 4IMFA 1V4YA 5G5HB 4QJ3B 3V0TA 5AYBA 4IHCA 1V8EA 4C6MA 4AZ5A 4UIOA 2NVCA 4IQLA 3UJ2A 3UERA 1OEPA 3OHMB 5EPDA 3QPZA 4WUIA 1KO0A 2NX3A 4I5UA 4UC5A 1XLMA 4B91A 2IKHA 4N7QA 1FY6A 1VEPA 1MRAA 3PULA 4IG2B 2J8FA 4IX2A 4G7EB 2QGYA 1HNYA 2JIEA 3KRSA 2HXTA 3OGSA 5K9XA 5A8PA 2P50A 2WZMA 3QV6A 2PDMA 5REQA 2A85A 2TAAA 4UXDA 1H7RA 4K7VA 1GYMA 5LIWX 3UQNA 3USBA 3C2RA 1HJQA 2A3AA 4US5A 3EX3A 4NU7A 5KVIA 4MLJA 5C7VA 1XLIA 3GW3A 4F0LA 2XIJA 1WZLA 1MI3A 4ZQCA 4QTGA 2V30A 3DFQA 2Z7GA 2J8GA 3OA3A 1TMQA 2GDVA 3IIZA 1KRBC 5AYIA 4C1NB 5A6SA 2D73A 1K6WA 4BI6A 4NHVA 1IGWA 2CC0A 4IP5A 4LYRA 4KPRA 4HMEA 4XB3A 4XWUA 5AB3A 5DRIA 2ZVIA 3P5ZA 4GZ7A 2FKPA 1XPYA 1Z32X 2DQXA 2FMNA 4IP4A 4MNMA 2OFJA 1JZ3A 2IXUA 3PJWA 1Q7QA 1AD1A 1XRFA 3TW9A 2GGHA 4CN4A 3XIMA 4GI9A 5IHRA 1S2WA 4JTGA 4FNPA 3DK8A 5CQ1A 1ALDA 5CC6A 1KCLA 3ABXA 2GFTA 3E3HA 3FY1A 4M56A 5D04C 2WM1A 3EXTA 4JHZA 4M6UA 4LUYA 3KS5A 3W6YA 1OVDA 1GJWA 4P8XA 4CNSA 5HATA 3BICA 4W89A 2EF9A 3T0AA 1E4NA 4PR4A 3GX9A 3VCCA 2FFCA 1X38A 1DJNA 3LLXA 4EPBC 4PUJA 1S2UA 4NILA 2YCJA 3MTWA 3NO5A 1A5BA 4JCMA 1VCVA 1LBFA 3C3UA 3NL6A 4ZQOA 1O7AA 4CD6A 2D23A 4IXHA 4JTHA 5G4WA 5D30A 1D3GA 4UTWC 1TPWA 3GO2A 4M19A 5J04A 1W9PA 4C65A 5LHEA 4Y9MA 4RE2A 3WLOA 2A7PA 4B2DD 3QHMA 1G6CA 1XCXA 1E0TA 4IISA 4DLFA 2PDWA 2IQ0A 1P4CA 1MFUA 1TCMA 3N6QA 3POHA 1H49A 3W72A 3M16A 2GQ8A 2CEQA 2W61A 4F79A 4V2XA 3UXLA 1UA7A 1Y5WA 4RUBA 1L6WA 1WDQA 4WLCA 5CJ5A 5E0KA 2Z29A 3CLMA 4BURA 1TR9A 3NPVA 1EJUC 1EJRC 4C1LA 4MYAA 1TYPA 1FHUA 2VD9A 1FQ0A 3NPUA 2G96A 3QHNA 3TTQA 3PANA 4ORIA 4LS0A 1EO7A 2ABBA 1KM1A 1VGAA 4BEQA 1TIWA 1M9HA 3URHA 4F66A 4XBJA 2PDPA 2Y62A 3BMXA 4AG0A 5K2ZA 4ADWA 1P1MA 4JY9A 2AMGA 2WVTA 2HQMA 4AZBA 1H7NA 1GQIA 8RUCA 1EJTC 4Q4QA 3UFYA 5RUBA 3WK2A 4XD3A 1J01A 3WFLA 4AIBA 4HSOA 1X2HA 3OO2A 2CBVA 3UWQA 2ZYFA 4LXFA 3A3HA 3MANA 1HVQA 1EBHA 1BYAA 2QLYA 4MKVA 2J4GA 1P6CA 1LUCA 3UYIA 3PJUA 4ZQNA 4C90A 4Z0JA 4NF7A 2E9BA 1QVBA 3VNLA 1E71M 4QEEA 3PZQA 3LNMA 6REQB 4L7ZA 1BQCA 3RMEA 4IJRA 4EP8C 1UQYA 4ATWA 3AMKA 2EG6A 3EGJA 4W85A 4UQEA 2H6RA 3GRSA 2WYSA 1UZDA 2J79A 3K4AA 5E6YA 1PHQA 2JF7A 5EA9A 3N2MA 3IJ6A 3RAOA 1K4HA 2R1LA 2X1UA 1TZ9A 1N7KA 5F2GA 4UOJA 5I03A 1J8VA 3AU6A 3VFLA 1R6WA 1CXFA 3N14A 1B3VA 1QHOA 3P2VA 4WF7A 3I7QA 2EPNA 4I8DA 3W22A 2GUUA 3VDAA 3UF9A 3BSHA 4ZZ9A 1FXPA 2I7GA 2YW3A 4ZXLA 1OJXA 1XIEA 2OPJA 4GUGA 4A3UA 1A4LA 3GG1A 3RPDA 4V1YA 5LNVA 1VS1A 1ZALA 3LRMA 1M41A 4ACZA 1XG3A 1J5SA 4RDYA 2VR5A 4RJEA 3ZJ6A 4YTSA 4JTRA 1WDRA 1QR7A 4REQA 3MJYA 3VCRA 2YAUA 4J3SA 2INEA 3FGCA 4UTTA 2I5QA 2P0IA 4L1WA 3R94A 1ZDLA 4QQUA 2A4AA 3R1ZA 5A5WA 3H26A 2XDFA 1V03A 4UFMA 1NDAA 3MO7A 1P0BA 2AL2A 2A2IA 1NQ6A 2W0UA 5DCDA 2HMCA 4FAMA 1TQJA 1EL3A 2GJRA 4XUYA 1Q6LA 4MB5A 3H2AA 2WMJA 3EBVA 1HFBA 3EKLA 3M1ZA 2QAEA 4MMWA 4HPNA 3KLKA 4BEUA 1ZJBA 4X0NA 1ZAJA 4WDUA 4WQ6A 2AMXA 2W54A 3PPFA 4QSFA 3KVKA 1BD0A 3KE0A 3PWGA 3TYEA 4J2PA 2AAAA 1B9ZA 2DZAA 2OQYA 1T0OA 1F8IA 4JTAA 3T0BA 3JUGA 3PBUA 1KXQA 2WNZA 1AH3A 3UCQA 3PUDA 4RV8A 4DJEA 3V75A 4F40A 1DIEA 3KOWA 3LTYA 4JKKA 4C7GA 1LG1A 1BSLA 3OC4A 2CZEA 1H4PA 1TIMA 3IRSA 1GG1A 2XGZA 2OSWA 1XYMA 2CLFA 2IKJA 2E6DA 3WKZA 3AHTA 3B9EA 4PMOA 3W1XA 4DJED 3QN3A 3W2KA 2BC1A 2C0AA 3BGJA 2OEMA 4G7FA 2DJLA 4GXPA 4HD5A 4UB9A 2A7NA 1Q6FA 2TYSA 1DQUA 2E9MA 4Q4PA 2FJUB 3OGVA 4UOZA 1HP4A 2O7QA 4S3BA 4RDVA 3EF6A 1XIMA 1W9DM 1MW3A 4MNLA 3AIVA 1ICSA 3M5ZA 1TKKA 4GMEA 3IVTA 1IZKA 1LROA 2FB3A 4DXXA 3N4EA 3GBDA 3HN3A 3W7OA 4QCEA 5AC7A 1A5CA 2W4XA 4K39A 2ZADA 3RCNA 3W4RA 3EPNA 3IPWA 2A1YA 1JD7A 3GXTA 3DERA 5G4EA 1ZJIA 1XFBA 3N9RA 3S5NA 4AEEA 1EFZA 3AZRA 1G94A 1ZTVA 4R88A 4AAJA 5AOUA 3MSDA 2OEKA 4AZ6A 3MA8A 2J62A 5KITA 3DC8A 4JTIA 3WQVA 3B8UA 5HJYA 3E2VA 3KOYA 4NI8A 2WB5A 3TLQA 4Y8EA 4EMJA 4HHMA 5L6UA 3N6HA 3GR7A 3SUWA 3Q4DA 4K3ZA 4DBSA 4DBEA 2ATSA 1RA5A 4QM1A 2PDUA 4LY4A 3G5EA 5DQPA 4ZOAA 1XH1A 3OB8A 2ZZ1A 2WMIA 1BSIA 1TVPA 2GWGA 1HW6A 1Y5VA 1TA3B 3FYYA 2D3LA 3G0XA 4NZ3A 3AUJA 7ENLA 4JPGA 3U6WA 4XK2A 1WOBA 4TOQA 4NI3A 3W1NA 1A3HA 4H19A 3SIZA 5JRBA 4H7VA 3IUHA 4UZSA 3EOEA 2PC8A 4FMVA 1N5XA 1YPXA 1EJ7L 1RH9A 4B3ZA 1TJ2A 1JOAA 3IVUA 3L4ZA 4DYKA 3MZNA 3URQA 3DAQA 4REQB 5EYWA 4LB4A 4X2RA 3WMCA 1PWMA 1ICPA 5FJTA 4A4AA 3ZO9A 1XR2A 4D6EA 1JAKA 2V69A 4R9XA 2RKXA 5HQMA 3C3NA 4I5RA 1SO5A 3B40A 1S2CA 1J96A 1S46A 3RYSA 5JBEA 5FEXA 4QNEA 3VIKA 1U5JA 1O4UA 3OQ8A 3ZM8A 4KGLA 1OABA 1I9CB 1PWLA 3U5YA 4IL2A 2V5BA 1VFLA 5C71A 4N9BA 3PWAA 3CQIA 3PTDA 1F4HA 1WZKA 1ZHAA 1NWTA 4OOZA 1FDYA 3B8DA 3GC4A 1XWYA 3TWAA 1QO5A 3NSMA 3MV11 1A0CA 2RGMA 3WD0A 4K2SA 2ZRWA 3STEA 1CLXA 3TXVA 3H4WA 6REQA 1I1WA 3P8JA 4X9SA 4F0MA 5E70A 1JNDA 3UD6A 1GCYA 4W5ZA 3R0UA 2BV9A 1EOKA 1H3GA 2WMKA 1F8WA 3CB8A 1UB3A 2YIHA 1TVNA 2Q8XA 2ZUWA 4DM2A 4OE7A 3RXZA 3MUAA 5EY5A 4KKXA 1A5SA 1ZAIA 1T40A 3MDWA 4BJHA 4XO7A 3QTPA 3QSRA 2B0MA 2PWDA 3AJXA 4S1FA 1EO5A 1ITQA 3P80A 3TYAA 2FZ8A 1BXCA 1OC5A 5C6MA 4XQ6A 1TMHA 2VURA 4BF9A 4HHLA 4N6FA 3S6DA 4UQBA 3TVAA 3BLEA 3T0DA 4KF1A 4C1KA 4AXKA 3SSZA 3FAXA 5FACA 3E6EA 5HNTA 5ER0A 1DJWA 4A3HA 1V0MA 2DSKA 1UD8A 3N2TA 2ZX9A 1HGWA 2BNJA 2PB1A 3WD4A 3NXFA 3P14A 4Q4SA 2Z1SA 2R9RA 4Q4MA 1J0KA 2X7WA 4TV6A 1WBHA 4EQSA 5HNNA 2E6AA 1FP8A 5M2FX 2QJNA 4PUMA 3AI0A 3SI9A 1U33A 3Q37A 3M0HA 3S9IA 2QCMA 4NX0A 3QW4B 2VI0A 3E38A 2E40A 4O14A 2CLIA 1VRDA 3L4TA 3AC0A 2I9EA 3OVRA 1LOSA 3NQVA 5E9XA 3BSMA 3ZIZA 4JFVA 1K4GA 3TJXA 1O66A 4O52A 1TWZA 2E3TA 1W2VA 5DELA 2QHAA 1IZJA 1XD0A 4H2CA 2HBVA 4ICNA 1NJJA 1AJZA 3N6JA 4YVXA 3F5LA 9CGTA 2DZTA 3B0PA 4H1ZA 5M1TA 1FCBA 4PMRA 1AK5A 1JQXA 1ODUA 4XISA 3G2GA 4D1JA 1YLVA 2GSHA 4L4LA 3BLKA 1K03A 4AIOA 1XRVA 3MMDA 5BWAA 3SUSA 5LYRA 3G8RA 4X3ZA 3OVGA 2A3LA 3F4DA 3CV1A 1MRQA 4HU8A 2QUUA 5JU6A 1KTBA 1GKRA 2ZC8A 4Y9OA 1FWFC 3KDOA 3QH2A 1OFPA 3STFA 3RLGA 1OYAA 3IJ7A 1JCTA 1VEMA 3DENA 5AN7A 1B3YA 3MSRA 3MC5A 3MZ2A 3O15A 4MOZA 3PJTA 4QJ4B 2OZTA 1I2QA 2QV5A 1TZ7A 3NL5A 1QUMA 4C6KA 2JGQA 2I56A 1FRBA 1QWGA 3EA2A 3VE9A 1A5MC 2WXDM 3O0HA 2YA1A 1HKJA 2J24A 3AHVA 1W9BM 4LUTB 4PMVA 4GH3A 4O1FA 3PZIA 1GERA 3GY1A 1M53A 3PZGA 1BWCA 3EPOA 3DFOA 3PBYA 2V6OA 1FWSA 4NZFA 4AZCB 2ISSA 2D2GA 3QOMA 4MZ8A 5KTLA 2W5FA 3VE7A 5DO8A 5FS6A 1GREA 3N4AA 1B3XA 2IKGA 3V3WA 3WK0A 5HQEA 3LG3A 3WQPA 1RP8A 2F9RA 3WELA 1W5QA 1BFNA 5G5IA 1JRCA 1F73A 2QF7A 1OFRA 2P3ZA 4H6EA 1T3QC 1YMYA 1OM0A 2R24A 3WK1A 2ISFA 1SJBA 3DCPA 2PWFA 3G6LA 5DXXA 2OEJA 4FXJA 1NHSA 3HIJA 1MNZA 4NX5A 4BA0A 1RPKA 5TBOA 3VIPA 2GUBA 3JZEA 3KDNA 2GJXA 2QPSA 3MY9A 3APYA 4QXIA 3O16A 4QBXA 1M6JA 2CYGA 2X8HA 3DHFA 2DH3A 1VJIA 3ABOA 2F6KA 3HV8A 4WSKA 4M24A 2WCAA 4LU0A 3QW3A 4GX8A 3CUJA 3PZOA 4ADUA 1W5NA 5A8QA 3ABQA 5T26A 3CIXA 1FBAA 3EWDA 4FIQA 4YCPA 4W4QA 2VO5A 5AC6A 4YTRA 5FIPA 2NWSA 1IV8A 3UR5A 3NQ2A 4US6A 3TTOA 3WNNA 3UNDA 1XI3A 2R1PA 4YMZA 1DJQA 3CEPA 4OBRA 4ZBCA 3AMCA 1YNQA 1OX4A 4A8NA 2D0GA 5IHSA 3QV9A 3AIBA 3AN1A 2V6AA 3EEZA 4YVVA 4JIHA 3L5OA 3NM3A 4W8BA 3H54A 2WNNA 3H2FA 4LH8A 3H8AA 1JI2A 4KH2A 2QPXA 2D22A 3RM8A 3FLUA 2H8ZA 4HP5A 4EQWA 3MCNA 5HMDA 3FEMA 1PDYA 3DFPA 3TTEA 2YBUA 2R91A 2J7CA 2D3NA 3IJIA 4WX2A 2VCBA 3UNTA 3VNIA 1ISXA 4HMCA 3THAA 2ZDSA 3W1QA 3VOIA 1B90A 2XPKA 3WH7A 2OLAA 4C6EA 3CHEA 2VFFA 3R8HA 4OOUA 5CJMA 3VIOA 1SO4A 4GX9A 4WKAA 3ZSTA 2P76A 3T42A 2EKGA 4HSNA 1K7XA 5CH9A 3NVWB 1ONFA 4Y7EA 2QCDB 2JEPA 4C6OA 3AALA 3QZ6A 1R86A 2YDQA 5I3FA 1GEUA 1ADSA 4R33A 3AWNA 1SZFA 1Z7AA 4R3UA 2PZNA 2VZTA 1PZ1A 5DXYA 2GR2A 2WOWA 2BG5A 1XC4A 4HHPA 2ZZ6A 2PAJA 1UD6A 4C6LA 1X39A 1VPQA 3BW2A 2OYKA 3GKFA 1MFVA 2V8ZA 2EJAA 1UH2A 3G1RA 4GWEA 2XGBA 1RALA 4AVOA 2QVHA 2QEZA 1RQHA 1VQTA 2CFFA 3AXHA 1KM3A 2AQOA 3GM8A 3NQGA 4JEQA 2HNEA 1P0DA 1I1XA 1MVYA 4EVZA 4Q8OA 5CC3A 2ZBTA 1PX3A 4MUZA 3G1YA 1FFUC 4QGCA 3KRBA 4Q7BA 2F2KA 3NQEA 4AC1X 2E1DA 3WJZA 1VFMA 1MNSA 1B4EA 7XIMA 1IGSA 5C2XA 2R1KA 5AYYA 5DBTA 3W53A 1SU5A 2WCSA 2YJQA 3PZUA 3G1SA 2F6UA 2V3AA 4TX9A 1VHNA 3G0UA 1GOOA 3FA3A 1S2VA 3GH7A 3W84A 2GL5A 5U1OA 1T8XA 4MF4A 3VNZA 3SZ8A 2BGQA 2Y4SA 2Q3RA 4N0RA 1EOMA 3THDA 4POCA 4TVDA 2G4JA 2ZX5A 1M7PA 1D3CA 3CGTA 1ZP4A 3IV8A 1GQKA 3ZOAA 1AOGA 4JAWA 3CPRA 1EA9C 3PAJA 4IIDA 4MFEA 2WZTA 3NQMA 2HVOA 4IP7A 5C9ZA 1ZSXA 4IPLA 1XICA 1KGXA 2PMQA 3LHVA 2W79A 4MAZA 2INFA 3VD4A 1PTAA 3VUSA 4YYCA 1QWKA 1RD5A 2RHGA 3L0KA 3O1NA 1FEBA 2EPMX 2X0HA 3WL1A 4UZUA 1LQ0A 2BOGX 2C91A 4LEFA 4OU1A 1ENUA 1FCVA 1HJSA 3GNOA 1LUCB 4RV3A 1SZGA 3LZ5A 4UFJA 2W91A 4GNJA 5BNKA 4AEOA 3GS6A 4EXAA 4H4XA 2A3CA 2BMBA 5F4XA 2VC7A 1N63C 2ACUA 3PC0A 2PBOA 3CM4A 3H4KA 3EDEA 5A2CA 3UXDA 1BAGA 4L5ZA 3GFYA 5EMMA 2VC6A 1V6XA 2WLZA 2VEFA 4GFSA 3I4KA 4L6DA 1GYLA 1C9WA 2C19A 2DEPA 3F4VA 3NQ6A 4ENLA 3WH8A 4PMQA 1Q6DA 3QPYA 2VX6A 4RDWA 4QCFA 1FEAA 3LERA 1IZCA 4NNCA 3V7PA 4Z1DA 3P67A 3K2GA 4M81A 1XKJA 1RZMA 2DZBA 2FZ9A 4IIEA 4GZEA 1JF5A 2XVPA 1V08A 4UTWA 5BXTA 1N55A 2HS6A 1NEYA 1YYAA 1MEWA 1HL2A 5BCAA 5EMLA 3N9SA 1VEOA 4OHQA 2HROA 1V02E 1W3HA 4F2BA 1U83A 1R3YA 2GWNA 1DJHA 3M7SA 2B31A 3P3BA 1KM2A 3TQPA 5HINA 2PFHA 2QNEA 1AW1A 5I78A 1US3A 3I68A 3DIPA 1DNCA 3AM9A 4DWSB 3UXIA 4AF0A 1V6WA 4LALA 4M51A 4AHPA 4Q4KA 4D6HA 2G3MA 3BLIA 5DMYA 4D8ZA 4WHBA 4WZHA 3W7LA 3PG6A 2WP6A 4TV5A 5I5RA 3NL2A 5CPOA 4NT0A 2QR6A 1WOAA 3IJ8A 4DELA 3GIYA 3LADA 1YE4A 2ZXQA 2NXGA 3QYQA 1KGUA 4PL1A 5G2IA 1P43A 4LTSA 3LGEA 5FMHA 1L0PA 4XVEA 1RPXA 3IUDA 4PUKA 1G7UA 3NZGA 2FIQA 2GZXA 3VIJA 5F2MA 3WLJA 4R7WA 3OIXA 2XIMA 3QV8A 4V28A 1DWFM 1QRQA 3W23A 5HMFA 4ZOBA 2YL6A 2GQAA 3GXIA 3RLUA 1NFBA 2VD8A 2A0NA 1XGDA 3SGUA 4KCTA 4KESA 4P7NA 1AW2A 1TPUA 3WO8A 2QAPA 1S1PA 3LV5A 1GRHA 3KL3A 2HPMA 1EYEA 4UTJA 3W76A 1DPMA 4WDTA 2W6RA 4K1WA 4H4RA 2OMAA 4Z1AA 5KSWA 3QY6A 3KUMA 1HN1A 2WJEA 2FMOA 2R9ZA 2YLAA 4H4YA 5CBBA 1JROA 3V5OA 4J4KA 4GUJA 3O7UA 5A6AA 2E5DA 1XIGA 3CO4A 2CHRA 5BU9A 1UD3A 2EEXA 5FJOA 3B4UA 3U0HA 5HR6A 3RCYA 1P48A 3OLDA 4QEHA 3KVJA 4CVWA 4IOTA 4GZJA 5JBFA 5A8OA 2E77A 2ACRA 2CXGA 3C2VA 2CLOA 3UPBA 1I6NA 1I75A 1UKPA 3OQEA 1XRTA 3FVMA 5I77A 3GWQA 1TREA 3GQYA 2V81A 3W02A 1GTEA 2E7FA 2NQHA 1J0YA 5AC8A 2DSWA 1W17A 1M6IA 5U25A 2Z1KA 4B5VA 4ERIA 4UTTC 3P93A 2NZLA 2PLKA 4EF8A 5AY7A 1NHRA 3EOSA 4WY0F 1OHLA 1MZRA 2QDEA 3TA9A 2IPWA 2W3SA 1V6TA 2ALDA 3L0NA 4O13A 3VMNA 1FWGC 1VBJA 3DYMA 3B4YA 3GK0A 1ZBWA 2XN1A 1FH9A 1OK6A 4UTHA 4XBKA 3KZPA 2VRJA 3IV3A 1S38A 1IEVA 2GJLA 2PRHA 1UOZA 5EBKA 1UUMA 3GIPA 1R3TA 4B92A 3SIMA 1TWWA 3V5FA 3WF4A 1FO4A 3OVQA 4AEFA 4Q8QA 2W63A 3BWWA 4H9MA 2F2HA 4J3XA 2ZRYA 4K8EA 4X0VA 3I6TA 1B31A 5HA7A 4AMAA 4DLMA 3B05A 4F2UA 4C91A 4IMAA 3DEQA 1H7XA 1ECEA 4C7FA 1BF6A 4IUGA 1OG6A 2BHYA 1OF8A 3GTIA 4PUEA 3S83A 1E6RA 1N60C 1H6VA 1KXVA 4IMCA 4KRUA 2X7VA 4HA4A 4S3KA 4AD4A 2VC5A 2YW4A 4V27A 1DJIA 2YPIA 5M3WA 1TE1A 4FIRA 2TSYA 5AHIA 1MEHA 2WMFA 1AQFA 4YIWA 7REQB 4TMCA 4KEVA 1XINA 3MHFA 4TU1A 1JPIA 2FTPA 2POTA 2EG7A 1BYDA 4JFWA 2HS8A 1HG3A 3SQMA 4DYEA 4YWOA 1HL9A 2WANA 4IXXA 3PB0A 2C3CA 3CUZA 3S5SA 3ZS4A 3JZUA 1QNOA 2QYGA 4Q3MA 1BHGA 3B8VA 1ZKQA 3TW7A 4JICA 4D9PA 4D6IA 2CLHA 2CU0A 3WDHA 1BF2A 2V3EA 1EC7A 1UD2A 4BY3A 2VZSA 4UFLA 3LHZA 3KXQA 4BFAA 3KOZA 1C8QA 1F2JA 3FG2P 4M3PA 4RXGA 4NYYA 3EWXA 3OZYA 5FAGA 4GINA 2PSNA 1NOWA 1AD4A 2O7SA 4DNMA 5FS7A 4AIEA 3R11A 3L5MA 3M41A 4OV9A 3TN4A 1TYGA 3UG4A 2QJHA 2ZXAA 4ES4A 1J6PA 3BC9A 1KV8A 1JUKA 2FVMA 4IJCA 1BWVA 3TYBA 2NX1A 1ZZMA 3BQ5A 2UY5A 1PIGA 1Q6EA 3NAVA 3HTWA 3ZLFA 2XH2A 4R53A 3NNTA 1J5TA 4B5SA 2OG9A 1KFBA 3R8GA 3B0YA 1SFJA 3QRHA 1LZOA 4PULA 4AWSA 3GVRA 8XIMA 3ZZ1A 5FF0A 3GAKA 5ABHA 1PIIA 2P8BA 2VENA 1EIBA 4OV4A 2BFGA 4A2RA 3UWVA 2JKPA 3EB4A 3FN9A 2EQ7A 3L4VA 2GQ3A 4NY2A 1OCBA 3WBXA 3SJ3A 1XIHA 2J66A 2ZX7A 1JCXA 5IFTA 4O4VA 1OFEA 3REQA 2DIJA 4NXKA 3S5ZA 4O19A 3KAOA 1IXQA 1FWBC 1NDWA 3F4WA 1JD9A 2QV4A 5H91A 1DTUA 2XSAA 4HYVA 4H4WA 1XBVA 4L6OA 3RK8A 2X99A 1V5XA 1SB3B 2XN0A 4DNAA 2W66A 4EANA 1NOUA 3GXFA 2WK2A 5AC5A 1LOQA 3MKCA 2NT1A 1KBJA 4LRTA 1K6AA 2XG9A 1TPDA 2DGAA 4LNCA 1GOMA 1GVSA 3E49A 2EO7A 1ISVA 4JTUA 3N12A 3U9IA 5I2UA 4H01A 3WQ6A 2HE8A 3HMCA 2I57A 4MJZA 4GY1A 3AYSA 3O6YX 4JD4A 1JUEA 3MYPA 1Y65A 3WJXA 1G4EA 3DYPA 4AZ7A 3H24A 3URAA 3HQPA 3CQ0A 4WDXA 3QEZA 1L2UA 1XUUA 3BUVA 1KKRA 2V2DA 2OQHA 3LI1A 3NS1B 1SFSA 2I16A 5HMEA 3T8QA 3G1FA 2I17A 3ONCA 2PBGA 4X63A 1VFUA 3M5XA 3VGGA 2PWUA 3IIVA 2IPJA 3ZVHB 5C5YA 2GGJA 4KRTA 3TH6A 3R0DA 1XLJA 3LSCA 3N18A 4FOUA 2YZ5A 3ZYZA 4BQ4A 2JQXA 3F5JA 3WLLA 3K4DA 5F2IA 3WDRA 4E0CA 2X8RA 5HOSA 1CXKA 1E40A 3ATYA 1UWUA 5CXPA 3ARWA 4PB3A 2GQ9A 1J18A 4KS0A 1I0DA 3STPA 1DBTA 4FHAA 2C15A 3SR6B 3LLDA 2WC7A 5LHFA 4PB5A 1KB3A 3W85A 1UP3A 4RNIA 3AO0A 3MS8A 1OFBA 3HPSA 2QCFA 5DRCA 5C9WA 4NASA 5JXQA 3MVIA 3AUOA 3HU7A 1C29A 4TXEA 4CGTA 3W7RA 3A12A 1SMDA 3GNPA 3FFSA 2XIQA 3GXDA 1H50A 1GOXA 2F5ZA 4QS5A 1EC9A 4O0KA 1UR9A 1XDMA 1XLGA 1YBQB 4LANA 3OZPA 3T4CA 1FFRA 2OSYA 3ARYA 4Z0SA 3TNBA 3D46A 1PX8A 2VJXA 1W9XA 3OA5A 2NXIA 1V3MA 5I07A 1PKLA 1KFWA 2ON3A 3VM5A 3WDQA 2O9PA 1LF1A 1E6XM 3TKFA 2BP1A 4O1BA 2GK1A 3O9NA 3SCNA 1VR6A 4DJDA 2X42A 4Y96A 3VOGA 2Z2AA 4H8HA 4HK6A 2WSPA 3R10A 1CB2A 4YJ5A 1LG2A 4JQAA 4D2JA 4HPXA 1KC7A 1GRBA 3KP0A 2JFEX 3UR2A 4RNFA 2INZA 2Z27A 2FGBA 2EXOA 1W31A 4WY0A 2YCIX 3NM1A 3BH4A 3EAUA 2FDMA 4RXFA 3UPWA 1TPFA 3TQKA 2WOIA 2PS2A 3GDLA 3ZQ9A 2WMHA 2A6LA 1H41A 3WUBA 4M7TA 4XO6A 4HVXA 1E3ZA 4Z2HA 2X1IA 3TSDA 4MFDA 1E9LA 5LNRA 4U33A 4HZ8A 1DIDA 3FJ6A 3N3TA 1Q2RA 5D2WA 5EU9A 2HK1A 2Q09A 4AYGA 1H7OA 1CXIA 4F8XA 4DF2A 4GJIA 3B0VC 3IJDA 1E5JA 1A5LC 3ZR6A 2BVWA 3DYOA 4HYWA 2OT1A 3WLMA 1OINA 3I65A 1EBGA 4EM3A 2PTZA 3ZJKA 2PDNA 1TPH1 3GUGA 1WPCA 2WPCA 3GE7A 3TX9A 4HPHA 1JF6A 2ZXDA 3OLEA 1K9DA 1OJTA 4QRNA 4NKCA 3LRKA 2E5CA 4AXNA 1QI5A 1GQLA 4HTYA 1UQZA 3B0UX 1ZENA 3OIHA 5HNRA 1RHCA 1X7IA 3LV6A 2WSRA 1N8WA 3VO0A 1RXOB 2NXHA 4UR8A 1V59A 2HRWA 3E0WA 3W7PA 2VYOA 5BYWA 1YXCA 4CQCA 1BKSA 4HPGA 1EJSC 4WOZA 4JX6A 2P1FA 5GNXA 3OVPA 3ARVA 1XD1A 1VH7A 2ICSA 3UWYA 3A5FA 3H7UA 3WQ4A 4WY0B 4AMCA 1LQAA 3HJZA 2QDHA 2PWHA 4XUGA 2OCZA 2WBKA 2JKAA 1TR1A 1PJ9A 3ONBA 2PTYA 4HPJA 2IPFA 2B7OA 1FCQA 2Z28A 2H90A 1RP9A 4KWVA 4OTKA 1US0A 3GTNA 3HFYA 4DI9A 1U1HA 1UR8A 3EMCA 1GVRA 3WUGA 1L8PA 3GBEA 3VDGA 1EGVA 2P0OA 4A3RA 1UR1A 1UROA 1Q7ZA 1H5YA 2OELA 1WYGA 1ZCOA 2Y7FA 2YBTA 3WEMA 2Y5JA 4JQ1A 5GQBA 4PUUA 3SECA 1U5VA 5CPNA 1KCXA 2V63A 3KEHA 2G3NA 2D24A 3ANVA 4GYFA 4DO4A 3W86A 2IQTA 1PSCA 5SWUA 5C9XA 1EXPA 5FS9A 3FSUA 1SR9A 5LGXA 2DV0A 3AYVA 4LAKA 1LLWA 3STCA 1JXJA 3C61A 4LC8A 5JCKA 2JK6A 4PB4A 2QDGA 3O3RA 2W62A 2GGGA 3PUEA 4ZODA 4JEJA 1JG9A 3U3HA 1OADA 2NVDA 2E4TA 3UCDA 1KN0A 1K8YA 1M65A 2X2GA 1J0IA 4RZ5A 4E4UA 2DSVA 3II4A 1B3OA 1J11A 1XQLA 4I7WA 3WJSA 2PDLA 1AVAA 1JYNA 2IUZA 3V36A 3H22A 4JDYA 4DVOA 1VDVA 1FCUA 5IXEA 2R82A 1E1CB 1BVNP 2OZ8A 3LHTA 4GQBA 4HOWA 5DANA 5LA1A 1K77A 3FHQA 3K1DA 3ZVHA 2E3ZA 3GR8A 1DWGM 3KL0A 4P7RA 4ZA0A 1QCWA 3DECA 1RBLA 1E4LA 5GNZA 3CXOA 3BLFA 2XHYA 3WLSA 2Q8LA 4IICA 3BAWA 4CEXC 4WSJA 3MWCA 2J7BA 1E4MM 1FFQA 5C54A 4H8VA 3BQ6A 3UJRA 4JGDA 3U57A 1FVPA 1V6YA 3FA5A 4Z08A 1LWJA 1RVGA 1V3IA 2CBIA 3LCWA 3HG2A 4ZSTA 3WH6A 4G2DA 2WV8A 1R46A 4X2PA 3LDVA 2QCGA 5CLTA 4AWUA 1X1ZA 3M44A 3F4NA 4KT2A 3WQOA 5K9CA 3M07A 4LYPA 3HQ1A 4CU7A 1IEQA 1TWIA 3NQAA 2V5DA 6PTDA 3CPGA 3S1UA 1AG1O 3CUXA 1Z8AA 5MKGB 1IE7C 2VCCA 3I3DA 1Z48A 3W38A 2JE8A 1R3RA 2WJFA 4O1AA 2E28A 4GRSA 2IQDA 4Z1YA 1S5MA 3VKDA 4PTMA 1NSJA 1V3LA 1KXHA 1JVNA 1YX1A 2J47A 2CLKA 3AHYA 2GSEA 1V02A 1V6VA 1Q6RA 1ZL1A 3H2CA 2O55A 3KFTA 1KNWA 3GW0A 4GC4A 2GJXB 1ZUAX 4QSHA 4Q8TA 1D3HA 3LPPA 4DUOA 1VIZA 5H8MA 4DUXA 5B7ZA 1FP9A 1PKMA 3T6CA 1D7YA 2DY3A 4B5XA 2A7RA 3BV4A 1J93A 1QASA 5FSEC 3UVAA 4LFYA 2HISA 3EA3A 4TO8A 1UR0A 1A5NC 3KBJA 3ZXWA 1S5NA 3QFEA 3I3BA 2CZ5A 3CWHA 4NJIA 3VXGA 3GB6A 5A8MA 2GK1B 3V0SA 5JQ9A 3QLDA 3GG0A 1QNVA 3BG3A 5A2BA 5A1AA 1RCOB 3CL6A 1ZBVA 4MM1A 1PCWA 4BI5A 1TZZA 1R8LA 2P10A 1R3VA 2VUNA 1XDIA 1THFD 5D38A 4ASTA 2GVLA 3RITA 2X1TA 4HU3A 3TFCA 2GOKA 4H41A 4NRSA 2GVEA 4CNNA 3LCHA 4ZOHB 1QI4A 5ABFA 4ZSUA 1HJVA 2AKZA 1JR1A 5LNWA 2NUYA 1WP6A 3E0IA 1VJSA 1I0BA 5I3HA 5M5DA 2OKOA 5LSMA 4PSPA 4H4TA 4O50A 1XLFA 2NX9A 3B9AA 2V5LA 1WBJA 3AIRA 3UY8A 4LAZA 3TV8A 1VBUA 1E72M 1AJ2A 3CMJA 5HPCA 3RMJA 4A22A 1NAL1 2GUYA 1ICQA 4K36A 4S23A 1OIFA 3EWUA 4IGSA 1UA3A 3AICA 4NXSA 3UG5A 3SO7A 3N1AA 4MG4A 2QDDA 1Y0EA 4CCZA 2Y7DA 1XIIA 2CDUA 1C92A 1FH7A 4UMCA 1FWHC 1CGWA 3TP4A 2G3IA 5F4SA 5TD4A 3IEBA 4IT1A 3VOJA 5HQLA 2QMJA 5FJUA 1MW2A 1EXBA 1CENA 4XSLA 4XAFA 1R87A 2VZVA 4JOMA 4HN8A 3WQ5A 1EHAA 3FDKA 5ABGA 2E8YA 1OFAA 1BKHA 1IT8A 1JRPA 1BTCA 3G8EA 4LC6A 2VM8A 2RGLA 4PTXA 3ZT6A 1UZHA 1RQEA 3EX2A 1EA0A 4I3GA 1E51A 8CGTA 2WZIA 4ZGYA 1M03A 3LUTA 5D9NA 3TAOA 2WHJA 3W7DA 4W9TA 1XLEA 2V67A 1ADOA 5BU6A 3E1F1 4A2SA 2PCQA 4JIQA 2OT0A 3GVVA 2ZCGA 4YHEA 4O53A 3GUWA 3W29A 1PL9A 3L65A 2ZRUA 4GNKB 5H6HA 1RAKA 2XJ7A 3ZT7A 3ZJ7A 1CNVA 2DQWA 2PLJA 2PRLA 4ZE4A 2YB4A 2DJXA 5CZSA 4U4MA 1CCWB 2R1MA 2VEKA 1EKOA 4CQDA 5K9DA 2D20A 1VPYA 1I45A 1DEDA 5A95A 3A24A 1OT2A 1E1FA 3ARPA 3WQFA 4N9CA 2VMFA 3H6OA 3FEQA 1J6OA 1B57A 2XVKA 5XINA 2ATMA 3NGJA 4E2DA 3WZ0E 2WOQA 4EMIA 4FSAA 2VQUA 4ZL1A 3MSGA 4NJHA 3UJEA 3CO8A 4HNTA 3L66A 5FL0A 4UTFA 3TNOA 3GC2A 4YL2A 3VD9A 1XRSA 4S3DA 2VRQA 4M6PA 4S3FA 3L0GA 4D6FA 2QKFA 1RBAA 3VC5A 3DI1A 3W7IA 3CUGA 4MWAA 4L4MA 2ACSA 2A5HA 1OF6A 3W70A 5DBUA 4FF5A 3A5VA 3TR2A 3H70A 3QM3A 4LUJA 2XTKA 1VLIA 4DO5A 1EQCA 1OGBA 1Q45A 5EBAA 2F61A 2UBPC 4GI6A 3QKZA 3N04A 1Z42A 2WSKA 3R58A 3BW3A 3I3EA 3ZT5A 4MWAB 3WLTA 5LA0A 3A6OA 3DJJA 4RLIA 4P7LA 3VZYA 1D9EA 3P84A 3CU2A 1ADDA 3VI2A 3DBPA 5G1YA 3AAMA 2E67A 4BQ2A 1GUVA 2V3DA 4H6RA 3W7EA 3FYOA 1I2RA 4UUIA 4DZHA 2AAMA 4IIFA 3NQ8A 1JYWA 1QJWA 2NT0A 3HQNA 4OIFA 2Q01A 3ARXA 3LXDA 4Z2KA 1U2YA 1EB3A 4DWDA 3CBWA 3W2UA 3GG8A 3WNPA 4JFUA 4FNUA 2G41A 2GVGA 4DJFD 1TTQA 4FP1A 3MI6A 4Z2JA 3W1PA 2ZUNA 4HQVA 3D3FA 4YN5A 2FZBA 1VP5A 4HCHA 5MKGA 4HNCA 2YA0A 3ITTA 2F38A 4B16A 4S2BA 1UKTA 1QAPA 1UPMB 3EEGA 1E1EA 4EE9A 1MUWA 2C71A 3QY7A 4XBSA 2QIWA 3RPMA 2I5IA 4F9JA 4H4IA 1LRTA 1H62A 1JUBA 2Y8UA 2OODA 3ABRA 1ZB5A 1V7AA 1DJGA 4M29A 1RUSA 2G95A 2CZVA 3B8TA 1GETA 4Z2IA 3OEXA 1EF3A 4E8CA 4UNLA 1FOBA 3T08A 1WNOA 4PN2A 3T1GA 1JJKA 4PTWA 4ZO6A 3EA1A 4K38A 3W82A 3LQLA 5AVNA 3SCQA 3ZWTA 5EB8A 1MYRA 3WCZA 4E2VA 6XIMA 4JTFA 4WIWA 3C4UA 1VENA 4O1EA 3BAIA 4JCLA 3TOYA 3EXSA 3VU2A 1YDVA 2WJZA 3EDDA 4AZIA 2NQ5A 4AW7A 4YVPA 3TC3A 2PF8A 2XWDA 2PLCA 3TTYA 3NA8A 5JCLA 1H11A 2G3FA 4Q22A 3GD6A 3IJ9A 2LLEA 2W55A 1H0IA 2JF6A 3DFNA 1XUZA 1F76A 2Y7EA 4RE3A 3W6MA 3VGFA 4BS0A 1WXZA 2Z00A 3ZR5A 4QNWA 4J3VA 4ORMA 1LORA 4LJ3A 3IARA 1HQTA 5GPRA 1C7SA 1OK4A 3VD7A 3QMRA 1ODZA 2H3BA 1CBGA 3I4EA 3T44A 4J40A 1XYLA 4NRRA 3DG3A 3PWIA 5I6SA 1H5VA 1K4QA 4IUOA 3IACA 4GVGA 1TJRA 1UWIA 3GH5A 1ISZA 1OBAA 1Q7MA 3H21A 5LIYX 4KCUA 4AY1A 3D6NA 1LRQA 4I7VA 3CNYA 2ANUA 3PBWA 4KERA 3U7BA 4BI7A 2Q71A 3AIWA 3OGRA 4JTLA 3RF9A 5D9MA 2HBXA 3CMGA 3DGBA 4E5TA 1BVWA 1WDPA 3H7VA 1D2KA 3KS6A 4ATDA 2PGEA 3GKAA 3RNDA 3W37A 2E6YA 1VFHA 4HSHA 2BZNA 3THQA 4FEZA 3MVTA 4CUCA 1PB0A 3LI0A 3BMWA 4GCAA 4BWLC 2I9UA 3FJ4A 3FAWA 3A21A 4LAOA 4L9YA 4HNOA 4EACA 2W3ZA 3K8MA 4HHHA 2AGTA 3BDKA 4N4PA 3KTXA 3L4WA 2DU2A 1G7VA 5LXXA 4ILSA 4BKNA 2W3RA 2FPVA 1JEHA 3PP7A 3PPCA 1PTGA 5EGRA 3HZ3A 2PP3A 4AHOA 2FQIA 3M7WA 2NLIA 1LM1A 1EPVA 4DHGA 4MB4A 1A5AA 4LX4A 3A4XA 3FXGA 2GLKA 3MCOA 3ANUA 3CGDA 4EOUA 4FXSA 1G67A 1J10A 1MMFA 4LV9A 1W6TA 4Q7IA 3BZGA 1QT1A 1DQWA 4IFKB 5FI8A 2NQ9A 2PDIA 2BHZA 1O6IA 1E9IA 1OGSA 1GHRA 4LNYA 4RPPA 2EQ9A 4QG8A 3WN6A 2PDCA 4PEKA 3TC6A 1NPXA 4K8GA 4P2VA 4XIMA 1ZMCA 3LXCA 1X8CA 1R9XA 1JPKA 1DQXA 1DXEA 1VFFA 3NGFA 3SFWA 2Z1BA 2YB1A 3ALGA 6CGTA 4LCQA 5HUOA 1F3WA 5IDZA 4JQ9A 3W3OA 2JIWA 1PUDA 4PZVA 2BXYA 1SUXA 1TO3A 1E3XA 1QU4A 4NVTA 2PC4A 4FZIA 3OODA 2ZVRA 4GYKA 1M7XA 1A0EA 5BMWA 3WLRA 3ORWA 4NZ1A 3PSWA 4XX6A 4HMDA 3B03A 4XZ9A 4GVIA 3LXBA 1PAMA 1FX6A 3ICJA 4G1KA 3W2LA 3W7QA 6TAAA 4HCLA 2PTWA 2ASHA 1JAEA 5JUVA 3U7VA 5C9UA 3S5OA 3SSJA 3QMTA 4NZJA 3UG3A 3CYVA 3RO8A 2YCLB 3NXLA 3MKKA 4LUSA 4GI8A 1VKFA 4F4RA 3A9BA 2AGKA 9RUBA 4NQ1A 4DWSD 4GVFA 3EOLA 3SRFA 3PPGA 3DFYA 3W6LA 3N4FA 5EKYA 1HKKA 1NQKA 1S1RA 2CFYA 2XFWA 5JIPA 2XVGA 2WPBA 4S2CA 2HEJA 1WKDA 2CESA 1PCKA 4GACA 4A8IA 1BYBA 3JW7A 4XZWA 3AZTA 3QTGA 2ZXBA 5KZDA 1IT7A 7TAAA 4TVYA 3M5VA 1DYSA 1CZ1A 4TVCA 2PP0A 5LKYA 1EZ2A 1E15A 2EQ8A 1I4NA 1CGTA 3UETA 1CW2A 2XIIA 3L21A 4LY8A 3UW6A 1EQPA 2PWEA 3DHPA 1F61A 2HQAA 3D0CA 5EFFA 1ZAHA 1KR0A 3S2JA 3NWRA 1SW0A 3VDBA 3VGHA 2XFFA 2WVUA 4DB7A 3NURA 3EANA 5CGTA 1GVYA 5DCEA 3WEZA 5AHNA 4ZMGA 1XYBA 2GJNA 2DORA 1EEXA 4I6VA 1HO4A 1TVLA 3HPAA 3A7RA 1QPQA 1BWLA 4YYFA 3TQVA 4GE8A 3DK9A 4MIMA 1ZK7A 4UCGA 4X22A 3T05A 3VM7A 1J4EA 2CETA 4M82A 2AL1A 4K8DA 4GPNA 4IFRA 1M1BA 4TTGA 4S38A 1PYMA 4ICCX 1SFTA 2QS8A 1F3EA 3RJXA 1ZNNA 3M5YA 5LNUA 4KIRA 2ADAA 2OWCA 3BVJA 3NIYA 2VQTA 3BAJA 3CAQA 4L61A 1P6BA 3O63A 5AZ0A 2OJPA 2OTDA 3QQWA 3QJAA 3RU6A 1V7YA 1EC8A 4MAVA 2C0HA 1Y5XA 4ALDA 1XSJA 3RU8X 3N73A 2ZA2A 1TV7A 4ATLA 2J27A 3FGCB 2G37A 1X8FA 1BG9A 1NP0A 1VD6A 1ONXA 4HGXA 2MNRA 3EDJA 3HG4A 4C6CA 4KWSA 4V1XA 1NDYA 1VPXA 2ZUVA 2Y70A 3NFUA 1W1A1 4EMWA 3N13A 3QBUA 2Z26A 1GW1A 3O0FA 1GNXA 5ABTA 3W1UA 3AHXA 1P7TB 5C9RA 3FSTA 4IM4A 3BAXA 2BY0A 3WNKA 3YPIA 3M4HA 2Y0FA 5CPMA 4W8LA 4YTQA 3MP5A 3W2NA 3S2LA 4GJ1A 4GFIA 3GC5A 4K6AA 4WKHA 1T96A 1B4KA 5CBIA 1XLCA 4RL3A 3C2EA 3L67A 2CNCA 3LHWA 2D2HA 3MUY1 1FECA 2DW7A 4WXZA 5DFAA 3SRHA 4GVHA 1UWSA 2HNHA 3CZEA 3QKEA 1YEYA 4E3TA 3PFRA 3GG7A 2J6VA 4WOQA 1Q8JA 1EJWC 3L8KA 1NDZA 5BROA 4Z2LA 4Q4OA 3M9YA 2YL9A 3N15A 2QULA 4UWMA 1CGYA 2A8XA 1UBPC 1BRLB 1IWBA 1EUNA 1W9VA 3PZVA 1JZ6A 2VT0A 1X1NA 2WKLA 3VNKA 1H7WA 1FWDC 4PYSA 1JQVA 4QIUA 3URBA 2E25A 2ESCA 1JXKA 2HJPA 1ME9A 4OJYA 4GUFA 4ZOEA 5IM51 4M52A 2BSLA 3DK4A 3BL3A 1F74A 4ZCWA 2P53A 3Q94A 4HB7A 5I24A 2Q6ZA 1I2NA 4OUIA 2JKEA 1OT1A 3R0KA 4Q6XA 4JYEA 2JALA 5I3GA 1TV3A 1PKYA 1JRBA 4RE0A 4EK7A 4GO9A 4QR6A 1WXYA 3E2RA 1KFLA 4KEMA 3WD2A 1Q5MA 1M04A 2ABAA 3HW2A 2XISA 1JDFA 1REQA 2TPSA 4FX6M 1W3NA 3AYTA 2XUCA 3BGGA 5C70A 3D9XA 4OFCA 3J7HA 4HA1A 1P6WA 5FESA 2GYIA 4PBFA 3GVQA 3KVLA 1OZMA 1Q6QA 2J9ZA 4C7DA 4GQQA 3W26A 1QW9A 3WBYA 2Y63A 3E2SA 6ENLA 2E5AA 1FUYA 1R3WA 1X6NA 3KBNA 1A5UA 4P5UA 2NW0A 4QAWA 2ALRA 4I9MA 2RDTA 2GSJA 3O2LA 1UUOA 1MW0A 3TONA 4N4QA 2E9LA 1X1OA 3S9YA 1A3XA 3C0SA 1F6PA 2NQZA 4LVFA 3SB0A 1DXFA 4QS6A 4H04A 1EDTA 3CQJA 5HPOA 3EMQA 4G56A 1SSGA 3QMSA 2NVAA 3DC0A 5CCZA 3ANYA 5TNVA 4AC7C 3UZYA 4R27A 3EWBX 4ZQPA 1JFHA 4H4SA 4Y9AA 1QNRA 3LD5A 1OSEA 3VZZA 2O56A 4FX7A 3M0KA 4ONVA 2PDFA 3DG6A 1VCFA 3AROA 3SGZA 2SFPA 3OU8A 4DBDA 4KQNA 4GH1A 2D69A 4P7QA 4BQ3A 3SCWA 5CAKA 1IEXA 5I09A 3B3DA 3WD1A 4K37A 5TIMA 4G9PA 1DJZA 5F4WA 1CPUA 2VX5A 1UC5A 4FALA 3GHTA 4TTUA 2ZTKA 1QI3A 1TPVA 3R6IA 4C1NA 5HXMA 1W8GA 1H63A 1OFQA 1G4TA 3WD3A 3AXMA 4FX8A 3A4AA 3PK7A 3RM9A 4UMAA 3PZNA 4B5NA 1J9YA 1C93A 3NQ7A 2VOTA 3LBOA 5DT7A 5HBFA 4MJ2A 3AU2A 5HMSA 2ZIDA 3A7UA 1W5OA 3KM8A 2C79A 7CGTA 3OYXA 1PXGA 3FDGA 1X98A 3APGA 2WC3A 1S7MA 2OO6A 3CGEA 2YSWA 5LNSA 3UZJA 4ROQA 4IGNA 3W7GA 2WC4A 3H7RA 3ME3A 4LQ1A 2ODOA 1RJRA 1R47A 3DOPA 2Z0IA 1IXNA 3RJYA 5JCIA 4Z42C 2YYUA 4Y8FA 3WLKX 3ARRA 1A49A 4FF7A 3GHUA 4JN6A 4N9EA 1KR1A 3JS3A 3QZEA 4F0SA 1E6QM 3VAVA 4OECA 2TRSA 2X16A 3RX3A 2QCHA 1MQRA 3CAVA 3WDJA 3TWBA 2WPFA 1CTNA 4AZGA 4DZIA 2XSXA 3UGRA 3GRIA 4JIRA 2VP8A 2W92A 2X1RA 1UKOA 1XH0A 2VNCA 1GPFA 1OC7A 1RK5A 1LL6A 1OYCA 5C2CA 3DJGX 2CLPA 1XH2A 3T8LA 1F5ZA 1SZRA 1KA9F 3VIFA 4RPQA 5CZTA 4RR4A 3HGRA 4WSHA 2Z1VA 3SM0A 4MADA 4PTVA 3VVGA 4H9ZA 4B3KA 1IWPA 3K8LA 1IEIA 1NH6A 4XSMA 3PTQA 5BXPA 4Y90A 1G5AA 4E2OA 1TA3A 1IR1A 2PD5A 1ONRA 1A53A 4O1DA 4KCVA 3AS3A 2Y8KA 4H9YA 4PUNA 4EWJA 2X50A 4BF5A 4LA1A 3C56A 1Q4NX 4LBUA 3S0CA 4X61A 4LW7A 3LCGA 5CJNA 4EAYA 1STZA 1FWNA 4RK8A 3VKBA 2OGYA 1K7EA 2OZ3A 3PBGA 4PFHA 1K7FA 2HWGA 4KFOA 3OLGA 1Q6CA 5CKSA 1ZU8A 2ZICA 1W2PA 3HO8A 5AZ1A 4AWEA 3P0WA 3WF3A 1JFXA 1HX0A 3DUGA 4B2DA 5U7SA 5I79A 4PMDA 1L9WA 3LBMA 3U5UA 4XAYA 4LVGA 4AQLA 2PTDA 4GYJA 2Q8ZA 4J1OA 4APNA 3NYZA 3A4WA 3AYRA 4O18A 4FXRA 1S39A 3CEUA 1TX0A 1QW8A 1TV8A 1QNPA 3EX1A 2BY3A 4N9DA 1E70M 2X1SA 4XAGA 1JZ5A 3V0UA 4DYJA 1XC6A 1AZ1A 1CXEA 3DHDA 2EPHA 7REQA 1W1VA 4I8YA 1TTPA 3NEHA 1EPXA 4H4ZA 1KV5A 4A3QA 3OBAA 1YHTA 2IS7A 1V0KA 4KIEA 2DFAA 2YFNA 3CHFA 4CD5A 2JGYA 3P62A 3BG5A 2H8XA 1H2JA 2FZDA 3V1HA 4UFIA 3W75A 4EQRA 1E9ZB 4NZ5A 3BAYA 1A5KC 4TX6A 2Z6IA 2YVGA 1C8YA 1Z6KA 1EH9A 3DGZA 2DZPA 4MKSA 1E6NA 1DWHM 4JYDA 2C18A 5DMMA 1OCQA 3F1QA 3TUUA 2WKJA 1UMLA 2HCVA 5LGZA 3A22A 4CD7A 4MLRA 1BWKA 3LM3A 2QIIA 4QDPA 1C91A 5CPTA 2VDHA 4FLRA 3FYPA 2A79A 2YQUA 3W1RA 4O0ZA 4C5YA 4YNGA 4JNYA 3T09A 4DWSA 2WNQA 2PDXA 3SUVA 1LT8A 1SJAA 3LN3A 3G24A 4C6JA 4JBRA 3VA8A 4RKAA 5A3HA 4WGXA 2HDJA 5F2LA 3CGBA 4K7ZA 4J3TA 1F7BA 3NJ3A 4HOXA 3HG3A 4DRSA 3HGOA 2VEGA 4CD4A 4XIAA 1Z9AA 2Q02A 1GWJA 1XGEA 1BGAA 1KFEA 2V2CA 1GRFA 1TE6A 1XDLA 3I7SA 3H12A 1REQB 1W1TA 3S1VA 4AX6A 3N2OA 1BXBA 1T99A 4MKNA 2BY1A 2DZSA 4HKPA 2FPTA 1PO9A 1EP3A 3WYZA 4KW2A 3V35A 3P6LA 1AW5A 4HT3A 1UWRA 5CSUA 3N25A 4R34A 3RGTA 3K13A 4XZLX 2ISVA 1G01A 2ZX8A 3ITYA 1RD6A 4L6HA 2YCLA 4NJJA 2YDAA 1GKPA 1GV4A 1G9HA 1KBLA 3ITGA 1GEQA 5EMUA 2G50A 4EF9A 3A47A 4A6GA 4DAIA 3DDMA 1J2WA 3SN4A 4H9XA 3T2OA 2J9XA 5D2TA 1K8CA 1S3HA 2CXEA 4OBSA 1D8CA 1D7FA 3CZGA 4FR1A 2QMKA 4DPPA 1V0NA 3HGSA 3PS7A 1F6YA 1FWJC 2UY4A 2C7FA 2EKCA 5E93A 3SR7A 3CHCA 1PE1A 4PTDA 3UA4A 5HWJA 4ACYA 3MB9A 1A5OC 4CN6A 5D05A 2WPEA 1VYSX 1VBGA 1KW1A 3RX4A 2YDRA 3LCFA 1W3KA 5DN1A 1UP0A 1GOQA 3F7JA 1VBHA 3K1GA 3PBVA 3T0TA 4CNTA 3EWZA 2IKIA 3LMZA 4IX0A 2ZUTA 3KZSA 2J7HA 1AA1B 3UA3A 3VIMA 1YQ2A 4LVDA 1ME8A 1TPB1 4I6KA 1AFSA 3B9NA 4I9AA 3QHOA 2FLIA 3UBPC 4J5NA 1UD4A 3O6AA 3CZ8A 3NVDA 3KRZA 2J7EA 5I3DA 1SW3A 4WK9A 3GU9A 4YWIA 2QPUA 1SSDA 3WNOA 2ZWZA 3EWWA 4NNAA 1P0KA 1JDAA 3PVFA 5E0CA 3SCVA 1JCNA 3CT2A 3TFXA 1GPWA 2OQLA 3CWNA 3RFAA 3DGHA 2UY2A 2QAFA 2NQLA 1S2TA 3DU0A 3ETRB 2YLLA 1WDWA 4O0QA 1E43A 2EQDA 1M7JA 2XH0A 4RW5A 4ML9A 3W1LA 2ZZ0A 3NSXA 1DJXA 1CGXA 1E1CA 3MSYA 4XD4A 2C8NA 3BE7A 2F6XA 4K1GA 1XHCA 1FH8A 1LTDA 3C8NA 1NELA 3V5CA 3LB8A 4H3DA 4P8UA 5A6TC 3WJYA 2YGYA 3UZ5A 3CK5A 2CLEA 3ISIX 1J0JA 3GXPA 3RDKA 3QC0A 1TJ1A 3A4JA 4CQ8A 4KGJA 4UQDA 3CASA 4JIIX 2B7QA 1QW7A 2XZ7A 4J2MA 4XZMX 4CVUA 3T9PA 3UZZA 5PTDA 4JX5A 1KKOA 3WDIA 1LLOA 1WYIA 1DWAM 1GZJA 3RR4A 1QOXA 1Q65A 1W3LA 4Q7NA 3IGXA 3QFWA 3G1VA 4W7WA 3VKCA 3W7NA 4B15A 3EKGA 2DZXA 3VGBA 1YXDA 4IF2A 4R9OA 3TSMA 4PTNA 1BG4A 1TG7A 1V51A 3HURA 3MKVA 1ZQ5A 5CPQA 3BG9A 1US2A 3W81A 1JZ4A 4Q4RA 5DX7A 3QXBA 1NWRA 1H7PA 4QE1A 4M7SA 2PGRA 4O10A 1QXLA 4JY8A 1MXSA 3LGGA 5G1MA 4U5IA 3WQGA 1EX1A 1Q2SA 4Q8MA 5D32A 4AD0A 3TYUA 5KINA 2PURA 2V5JA 3ZR4A 1LDCA 4NL1A 4BK9A 4KMQA 1PHWA 2HE5A 4LS2A 4MJMA 2WQPA 1LRNA 3MWAA 1TV4A 5HNUA 2E0PA 2NV1A 5CC7A 3G18A 3W7HA 5I00A 5JH2A 2C1HA 2VEPA 1M7OA 4NNBA 1LPFA 2VR4A 1WX0A 5AYXA 3AXXA 2VOMA 3Q65A 3H2MA 1NFPA 2PDGA 5C0QA 3L5AA 2YX0A 3T4WA 4MPQA 1YIXA 2O4MA 3WIJA 5D4YA 1R0MA 1GVEA 4BCEA 4ADSA 4GBDA 2WSYA 4GHRA 1VQZA 2VWSA 5BZAA 1SM9A 2CWNA 4IMGA 4NAFB 1HZYA 3AS0A 4IPIA 3VNDA 2EHHA 3TZNA 1H1YA 2GGEA 4DBUA 1JDDA 2VKZG 1TSIA 3WG6A 2PLMA 3ENLA 3MV01 3VKKA 5ENLA 3WQWA 2O9TA 4HBKA 6A3HA 4YXGA 1R2TA 1U1JA 4LB3A 4DBWA 4L9ZA 3SAZA 4HJWA 3QSTA 2REQA 3MDUA 1W37A 3TLLA 4TR9A 3NDYA 4LF1A 1AMYA 5EMKA 4H6KA 2FTWA 4AX7A 4GYPC 4UTIA 1TPC1 4MNJA 3WBEA 1KQYA 3O6DA 4PE8A 3UZXA 3PG8A 2XVLA 3CC1A 5FAJA 1OQFA 4PL2A 3HBLA 2ZQ0A 1EGMA 4NEVA 2VGGA 3C2YA 4H4PA 3II1A 4PA8A 3NVZB 1JNEA 3TYDA 5U4NA 3VKAA 1TQXA 2V5KA 4KPLA 3W00A 5CLWA 1WV2A 3WH9A 3IK4A 4B5WA 3W07A 4JQ3A 2WWDA 1E9YB 1B5TA 1LOLA 1OWQA 1SYTA 5D33A 2NWRA 4IFKA 5KVHA 4AVNA 3GIQA 3QF0A 3S1WA 1Q1WA 2DP3A 4LGXA 5FKYA 1EUAA 4XVDA 2OVLA 1FDJA 3PNZA 2A6NA 3G1DA 3VFCA 3UZWA 3T40A 2PODA 1H1ZA 1KLZA 1OX5A 1JPMA 1EHNA 3BCDA 2QJJA 1M3UA 5LA2A 3RLHA 3S3GA 1XLKA 2YXOA 4ZQRA 5T8GA 1CLVA 2DIEA 2FTYA 3ITCA 1GXFA 2D1ZA 4M6QA 4F48A 2X8CA 5A69A 4C6BA 2BXZA 3A3XA 2GR0A 4N42A 5AHMA 1WUEA 4UTUA 4MY1A 3RR1A 4IIHA 1KCKA 1XSIA 1DXLA 1TV2A 1OCJA 2PWGA 2RUSA 3BV7A 3E0FA 1MDLA 2ISDA 3VOFA 3VD5A 1PZ0A 3RPTA 4FPSA 4RZ4A 2DUZA 2B7NA 1GVOA 1X6LA 3JRKA 4DM1A 4XTIA 2C6QA 3U8GA 2AL2B 1GSNA 1W1PA 4M1BA 2J74A 2HVMA 4HZ7A 2VVSA 5IDIA 1E0WA 3M6YA 3MUXA 3OTRA 3PHAA 3ZWSA 4GIYA 1FKXA 1XBXA 2V0TA 3CH9A 3PPHA 4DWSC 3AMZA 3DBNA 5LIXX 1E6ZA 3VNYA 1QBAA 4FS9A 1RJPA 4XZBA 2PDYA 3T55A 1BEUA 2JK2A 3VGDA 1YBQA 3LK6A 3CPUA 5FA5A 2BCPA 1FKWA 2F8QA 3WFZA 1Q6OA 3RM4A 3SURA 5LIKX 2ZZ2A 5FOOA 4RNJA 3RNMA 1KQZA 3GU2A 2QVNA 1SFLA 5J8LA 4YS1A 1UR3M 2G4FA 3SEPA 4W8AA 3AXIA 1GQNA 4QJ5B 4CN1A 2P3EA 3DFTA 3OZMA 5G5GB 3WBAA 1ITXA 5JCMA 3GDMA 3QR3A 1EDQA 1UZ1A 1LBMA 4HZ6A 3KX6A 4FO4A 2DZUA 3GVWA 1RSCA 3HPFA 4XD6A 5K4XA 2I1OA 3GYEA 3NOEA 2ZRXA 4XTDA 4W7VA 3B9JB 2CLLA 2FB2A 2QXWA 3W9ZA 4UCFA 4UMBA 3LS9A 3WX7A 2X0SA 2HPIA 3D3AA 5GJPA 4BWLA 1VAHA 3A64A 3LU2A 3W0KA 1AH0A 3DXIA 3ZSSA 2AQWA 3W73A 1IQ8A 4LVBA 5A6BD 4CQBA 3K5XA 2ZDRA 4GLEA 4F0KA 3C86A 1N82A 3MCMA 2WZHA 5EMYA 3MI3A 1EWEA 4EKJA 4GBUA 5AHEA 2GDQA 3NO3A 4AH7A 1RR2A 3TJ4A 2V3BA 1S5TA 4MHBA 5BOOA 1J79A 1MUMA 3W88A 2IXVA 1P0EA 2WNWA 2FH8A 3SY8A 2FPYA 3MUCA 3M0XA 4H83A 5DT5A 4CCDA 3ALFA 1LL7A 2ZE0A 4D6JA 3CZKA 3R25A 1Y7VA 2Z25A 3R7MA 3EAOA 3UR8A 1XV8A 4UTMA 1GK8A 2RH9A 4TX8A 3S42A 4AFYA 4KFPA 3LX9A 1SO6A 3KLLA 4IFOA 3TZFA 2C1IA 3KBMA 4ZQMA 3C0QA 2OO0A 3N11A 2E68A 4D72A 2QZRA