3UGVA

Crystal structure of an enolase from alpha pretobacterium bal199 (efi target efi-501650) with bound mg
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
363
structure length
363
Chain Sequence
b'TLTFRKLTARPVLLKLQRPVTARIATIPDWPLILIDIETEEGVPGRAYLEPYVPKAMKYLVPALHDMSDMLAGQPLAPAEIYDKTRKSLHFVGYAGLSMIAASGVDMAVWDALARAANMPLCTLLGGTPGSVKAYNSNGLWLKSPAEVAAEAVELKAEGQGTGFKGLKLRMGRDDPAVDIETAEAVWDAVGRDTALMVDFNQGLDMAEAMHRTRQIDDLGLEWIEEPVVYDNFDGYAQLRHDLKTPLMIGENFYGPREMHQALQAGACDLVMPDFMRIGGVSGWMRAAGVAGAWGIPMSTHLYPEVGAHVMRVTETAHWLEWQSWADPILQEPYALSDGDLIVPDKPGLGLDWDEDVVAANLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enolase
publication title Crystal structure of an enolase from alpha pretobacterium bal199 (EFI TARGET EFI-501650) with bound MG
rcsb
source organism Alpha proteobacterium bal199
molecule tags Lyase
total genus 133
structure length 363
sequence length 363
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ugvA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ugvA01
2POZA 4HPNA 2PU0A 3Q4DA 3OPSA 3SN0A 4GISA 4E4UA 3QN3A 2DW6A 3SSZA 2PTZA 3FCPA 3TJ4A 3DG7A 3N4FA 3P3BA 3IJLA 2CHRA 3THUA 3T6CA 1MDRA 4H83A 3QLDA 4GYPA 2PGWA 3TOYA 5IDZA 3KUMA 3UJFA 3UGVA 1P48A 3VCCA 3R10A 4H2HA 4ZA0A 1JCTA 1DTNA 3RR1A 2QVHA 1TKKA 2HNEA 2XGZA 4DX3A 3DEQA 5FJRA 1MRAA 3PWIA 4H19A 3CK5A 3U4FA 4JN7A 4HNLA 3MQTA 1EC7A 3ZVIA 3BSMA 3FJ4A 1IYXA 3T4WA 3MWCA 3S5SA 3DDMA 3T9PA 4A6GA 3TWBA 1SJDA 3N4EA 3DERA 1KCZA 3TCSA 4IT1A 4HCLA 4DYEA 2OVLA 2PSNA 1JPDX 4KWSA 2PS2A 4G8TA 2XH7A 3VCNA 4H1ZA 1SJCA 4IL2A 2AL2A 1NELA 1FHVA 3GY1A 3UCCA 2XH2A 3CT2A 3RITA 2OLAA 5BOEA 1SJAA 1OEPA 2RDXA 3QKEA 2MUCA 1EC9A 3JW7A 2OZ3A 4GIRA 4IZGA 2ZADA 4A35A 3TQPA 3VA8A 4HNCA 3JZUA 3QTPA 2GGGA 1W6TA 2FYMA 3R11A 2PMQA 4YWSA 2PGEA 3R25A 2QJJA 3FV9A 3IJIA 4KT2A 3MKCA 4HCDA 3TJIA 3ZLGA 3FXGA 3UJ2A 2OFJA 3T8QA 1EBHA 2GDQA 2DW7A 4IP5A 2GGIA 4K2SA 2OQYA 4K1WA 5FJUA 5FJPA 3UXLA 1F9CA 2AKZA 1ONEA 3H7VA 3HPFA 2HXTA 2FKPA 2QJNA 2QJMA 3RRAA 4A3RA 4M0XA 2PPGA 4EWJA 3SBFA 3UJSA 2PTXA 4DXKA 1JDFA 4GYPC 2OX4A 3OP2A 3DFHA 3SN1A 2PP0A 1TE6A 3CB3A 2P8CA 2PTWA 1MNSA 4JHMA 3UJEA 3I4KA 3R0KA 4GMEA 3SN4A 5FJTA 2PA6A 3CXOA 4Z17A 4MGGA 4ZCWA 3DG6A 4X2PA 2OG9A 1KD0A 1YEYA 3GO2A 3P0WA 2AKMA 2AL2B 2MNRA 2GGHA 3SQSA 2PTYA 3TW9A 1EC8A 4K8GA 3N6JA 2QQ6A 3NO1A 4E4FA 2P0IA 3NXLA 3ZVHA 3R1ZA 3P93A 3V4BA 3I6TA 3Q45A 3RCYA 1BQGA 3PWGA 2OO6A 4GGBA 3DESA 2GL5A 3R0UA 4KEMA 4J3ZA 4JN8A 4GGHA 3D47A 4J1OA 3STPA 1ELSA 3OW1A 1KKOA 4HCHA 2PCEA 2HZGA 3CAWA 3ZLFA 3H12A 1PDZA 3H70A 3N6HA 3V5CA 1SJBA 3DG3A 1RVKA 2AL1A 3DGBA 1E9IA 3JVAA 2OPJA 4IHCA 3UXKA 1NU5A 3EKGA 3V5FA 1MUCA 2XH4A 1BKHA 3PFRA 3I6EA 3IJQA 2OZ8A 1WUFA 4G7FA 3ES8A 3VFCA 3OTRA 1R0MA 3FYYA 4FI4A 3ES7A 2I5QA 2NQLA 1PDYA 3UCDA 1FHUA 4ENLA 1P43A 5BOFA 2OKTA 2XH0A 2O56A 3TWAA 4M6UA 3VC5A 3UJRA 2GGEA 1JPMA 4F4RA 4FP1A 4ROPA 2QDEA 1EBGA 1L8PA 5FJOA 3MSYA 3B97A 3RGTA 3MY9A 3MZNA 3DIPA 3ZVHB 3NFUA 4MMWA 2XSXA 4IL0A 3ENLA 2P3ZA 3D46A 2ZC8A 2PP1A 3CYJA 1KKRA 4KPLA 3FVDA 3PK7A 3BJSA 3GD6A 5EU9A 2HXUA 3OZYA 3V3WA 4IP4A 2GGJA 5ENLA 6ENLA 4E6MA 2P88A 4E5TA 4Z1YA 1XPYA 3TTEA 3QPEA 3GC2A 3EEZA 1MDLA 7ENLA 2OZTA 1R6WA 2ONEA 3BOXA 4GFIA 1XS2A 5J04A 4MKSA 3U9IA 3H8AA 3K1GA 3OZMA 4DWDA 4HYRA 3DFYA 4DN1A 1WUEA 2P8BA 4DHGA 3S47A 3SJNA 2QDDA 4HN8A 3IK4A 2PP3A 3VC6A 2PODA 3ZLHA 3NZGA 3MUCA 1TZZA 2OQHA 3VDGA 3RO6A 1ECQA 2QGYA 2GSHA 2PU1A 4E8GA
chains in the Genus database with same CATH superfamily
3KBVA 3QFAA 3IVTA 3FA5A 1AQMA 3ZOAA 3VD7A 4OUIA 9XIAA 2IPWA 4UFHA 1ZUAX 2PDJA 2V5JA 2EPHA 1OG0A 4JIQA 2MANA 1GEHA 1H0GA 5HATA 5HMDA 5U4NA 1TPUA 4JY8A 1FEAA 2AAAA 4P61A 1KM6A 3W2NA 1EBDA 4R53A 3ZT6A 1R9ZA 4PTXA 3GYEA 5GJPA 2YLAA 3RU8X 4B5UA 1QI2A 2ZZ7A 2GUYA 3LCLA 2I7GA 4KEUA 2XIQA 1ITCA 3UGVA 4XD3A 3LLFA 3MSRA 5DT7A 4AAJA 4PTMA 3CPGA 2E9BA 4O18A 2ZXBA 4F66A 5CEWA 3PNZA 3AOFA 3RU6A 2E68A 1YRRA 3S4TA 2Z26A 3H4XA 4DX3A 4QCEA 3TN5A 3TEVA 4YS1A 4C6EA 3EPMA 2B7QA 4KEVA 4XUGA 3QBUA 1V6YA 8RUCA 3VGEA 3NQEA 4AMCA 3WJXA 1U1JA 1UKOA 3N3MA 2VCCA 1KXQA 5AC8A 3Q94A 4ZFMA 3BAXA 4IG2B 1OCNA 4JPGA 1SYTA 3LSCA 4JKMA 2ZUTA 4A05A 3ITGA 3LLXA 5KITA 1M7JA 4J3XA 1AL8A 3LBCA 1RA0A 3C2VA 1U2YA 2FLIA 5HXMA 3FK4A 3W7JA 4HMDA 2QCEA 1E4MM 4A3QA 1UKPA 5CZJA 2W0UA 5FCZA 2OXNA 4HHHA 1LOLA 1KM0A 4W9TA 4I6KA 1Y5XA 1WDWA 2J8TA 4RL3A 4X60A 4BI6A 4H41A 3RF9A 3BG9A 5FSDC 1W8GA 4HSOA 4DZIA 2E6AA 3VYLA 3G1SA 2V5DA 2GGGA 3A47A 4BS0A 5GNXA 1SO4A 1T96A 4NNBA 2CLMA 4ALDA 1U83A 4UFJA 1B3WA 2VWSA 4O1EA 1KCKA 3AWOA 1NDAA 1CLVA 4LVBA 3O15A 5BRQA 3CV6A 4J4KA 4B4FA 1EP1A 5A95A 1WDQA 2WCSA 3MTWA 1UASA 4Y7EA 4LRSA 2GGIA 4PUUA 5CPQA 2H9AB 4EPDC 3KBSA 2R1LA 1VFTA 4C6DA 1POKA 3TN6A 3A6OA 3W88A 3UJSA 1BSIA 1PJ9A 5I2UA 1GRHA 3SN1A 3R8RA 3KOXA 2Z1BA 3KHDA 2Y7DA 4OV9A 2Q01A 4OQVA 3NQFA 3QF0A 2EO7A 2G97A 3SECA 4QX4A 5I3KA 3W83A 3K4AA 2W6RA 4QNEA 3AISA 2NVAA 3WLKX 3DG6A 4IM4A 1BWCA 3NYDA 4B3KA 2DT2A 2QPUA 4JTEA 3NQMA 3MCOA 1TA3B 1ZFJA 2O7QA 2YCJA 4AY7A 1J79A 3GUGA 2DJLA 2WOWA 3MPGA 3LXDA 2WWCA 3BW4A 1EGVA 2O4MA 3NM1A 4PE8A 5EMJA 1GVYA 4QFUA 2YZ5A 4E4FA 5HOSA 1UP0A 4EMIA 3NXLA 2A3HA 4BHYA 1B3VA 4GK8A 3N2MA 5M17A 2ZCGA 3FSUA 5HMSA 4OUEA 3B9NA 5HNUA 2NLIA 1HZYA 4RKAA 1R3WA 2X2GA 5HBFA 3S2CA 4PMRA 1MI3A 3QOMA 2GJRA 2VHLA 1J10A 1QI5A 1JZ6A 2Z2UA 3P60A 3PJTA 4OZOA 4PSRA 2IKGA 2J24A 3PJXA 2C16A 1ELSA 3W3OA 1UYQA 2VNCA 4O1FA 4TMBA 3PAJA 1RR2A 3WQEA 5ABGA 3GNNA 3TN4A 4BZYA 2VRKA 2QMJA 1UWRA 5AC7A 3WBEA 3DGBA 1JRBA 5BXRA 3CUIA 1QNSA 1KQYA 1U1UA 2VR2A 2XH4A 3NIYA 3NYZA 3GWQA 3IJQA 1WUFA 1I0BA 1WZAA 3L2IA 3LB8A 4GH3A 3OLDA 1VJIA 4IFKB 4BQ2A 1PO9A 1CGYA 5D32A 1JVNA 3TKFA 3FJNA 3AJ7A 3OTRA 1E6RA 2I5QA 5C9RA 3LPOA 1GVEA 3A4WA 2INEA 3VUSA 4AVNA 2O56A 4HJWA 5JRBA 2PGRA 3USBA 5GPRA 2GSEA 4UQDA 1DE5A 2YVGA 2BHZA 4UTJA 2CZ5A 2XZ7A 1R8LA 2VC9A 4Z0JA 4M6VA 5FF4A 2YXXA 3MO4A 4DWSC 2WLYA 2Y85A 4ATDA 3FDGA 4NG3A 3WH7A 5FACA 1AQ0A 4PC8A 4EK7A 1S2WA 1UQZA 3GNRA 3LGGA 1SW7A 5REQB 4IMFA 2CBIA 4B5TA 2C6QA 3SUTA 3WKZA 3E5PA 1AL7A 3FYOA 1EPXA 5D9NA 4HU0A 3HBLA 2DJXA 4PMNA 2NV9A 3QMRA 2ASHA 1CENA 1G94A 4DO6A 6ENLA 2X8CA 3AU6A 3GC2A 3WH5A 1LLWA 3C3UA 4YWOA 1W5OA 2NQZA 1UH3A 2V68A 2OZTA 3MMUA 4CU8A 4D9PA 2A4AA 5B7ZA 4DN1A 1E15A 3ATZA 4GUIA 1N63C 1W9XA 3ZJ7A 1S1RA 3CZ8A 4HB7A 4CQ8A 4DHGA 1EJXC 3K30A 1IT8A 1MXGA 1XW8A 1GJWA 1YIXA 1I4NA 4XWUA 5AHEA 1V77A 2HBXA 3B9JB 3DENA 2GSHA 4IJBA 1FWSA 1XD0A 1OF8A 3SUUA 3W00A 3A13A 1Q4NX 3L21A 1WB0A 1P1XA 2YX0A 1JRCA 2FZNA 4PRWA 3F2CA 5BRBA 3MT1A 2I9EA 4PTDA 4A8RA 1V6UA 1XLBA 4XTIA 3DG7A 1BQCA 1JQXA 4DUWA 2CWXA 1GVFA 1QW8A 1W3TA 2W66A 1N8IA 1XG3A 2PGWA 4S3CA 1E3ZA 5CG0A 1XYZA 3TOYA 1NIUA 2G95A 1Q45A 1EJTC 2ZZBA 1QFEA 5KZDA 3AIWA 1UWAA 1VDVA 1IEXA 5KZ6A 4H2HA 4HPXA 4PFHA 3M5VA 5DT5A 2TSYA 1FX6A 1PIFA 2JF6A 1E3XA 1R85A 5I77A 3PBYA 4BJHA 3DU0A 4KWWA 4MG4A 4JD4A 2ACQA 1XYCA 1I2RA 1IV8A 2V0TA 5BWFA 4EMJA 1CXHA 2WSKA 3FXYA 4Q4OA 2RUSA 4IICA 1A0EA 3V0TA 3STGA 1K1DA 3CMFA 5G1YA 4K8EA 3TQVA 2PDGA 3XISA 5EMKA 3NR0A 2XFWA 4ZODA 3B8UA 2UWFA 3W37A 5F1VA 2V2CA 3TAOA 3ZO9A 1W37A 2XH7A 3S6OA 3VNJA 5EBUA 4S23A 4N4PA 4LF2A 4LBRA 4AZ6A 4CNPA 2OODA 3DOPA 3GNDA 3RPDA 3GC5A 4H2CA 2MUCA 1DHKA 1EC9A 4GPNA 5I3GA 1YE6A 1F3EA 2YCLA 3NA8A 5U7SA 1V3HA 4JQAA 4GQQA 4QM1A 3HV9A 1KM3A 1FWWA 4IPJA 4B9ZA 3LGDA 4JDYA 3VUPA 4ZO7A 4YWSA 2PGEA 4N02A 2Z27A 3DBPA 1K70A 2W27A 1IZJA 5ABFB 5JU6A 3GVWA 5EL1A 3W1LA 3PBVA 2J9YA 5JXQA 2OFJA 1SR9A 3KP1A 2OQYA 1B9ZA 4V1YA 3RJYA 3SCSA 1QRQA 3WDJA 3A3XA 3IIVA 2JBMA 3PZIA 2GQWA 1R46A 4V2XA 3B9AA 3HRDC 4KBXA 3S83A 3HOJA 4DB7A 3FIGA 4EWJA 2BODX 2PTXA 4NAEA 1ISYA 3EWUA 4K7ZA 3T0BA 3VOJA 5C0QA 3HG5A 3CB3A 2V6AA 2CXGA 3G8EA 5FEWA 4PMXA 4A4AA 1H50A 4IQJA 3H2NA 2PDFA 3B0UX 3ZIZA 1V79A 1V51A 3SN4A 2UV8G 4ZO6A 2O92A 3KBNA 4GLEA 1FUYA 5K3VA 5HUOA 3N2TA 4ICCX 3GO2A 4P2VA 2G3NA 4KH2A 2WPFA 3RK8A 1HKJA 3H2FA 1VFLA 2FHFA 3R89A 4WY0F 1I8JA 2XISA 2QQ6A 4NXKA 3LMZA 3GNPA 4U5KA 4N6EA 1KC7A 4B5NA 3VMPA 3MV01 1CB2A 1FBAA 3GR8A 2BP1A 2PDCA 2IMRA 5A2BA 3FA3A 3SI9A 3B9OA 1KR0A 2DSWA 4YNGA 4R9XA 5CXPA 2A8XA 1TZ7A 5C70A 3FEMA 4NL1A 1TCMA 2PCEA 3A9BA 1AJ2A 9CGTA 5IFPA 2J8FA 2E5DA 5C9WA 4FOJA 4QDMA 4NNAA 5HQEA 3LSBA 3DG3A 1MEIA 1UD5A 4FIRA 2Y8KA 1RP8A 4HGXA 1JPIA 2AL1A 1OC5A 2EPMX 2ZX7A 2CZEA 4LUIA 1GV4A 2B31A 5T8GA 3URBA 3W1XA 1BKHA 4YTRA 1VFMA 2W5FA 5LZLA 3PUOA 5KINA 4EXBA 3CS2A 3LMYA 2OSYA 2CEQA 1F73A 3JUGA 4QNWA 1ZJIA 4NVTA 3L9CA 4YXGA 4HT3A 2ZA1A 3A4XA 4H9MA 4RX0A 2ZA2A 3QTGA 2QCMA 3LNPA 3ES7A 4X22A 1CGUA 1TELA 5DX7A 1VFSA 5BOFA 4DM1A 2ICSA 1F8MA 3O6CA 2ZKMX 1K9FA 2BLEA 3TWAA 4ZO8A 5T26A 4QE5A 4E8DA 4IMGA 4M6UA 5CC7A 2XTKA 5G5IA 2J7HA 2QIIA 3H54A 3U0HA 1QPQA 3WCZA 1LP6A 1LTDA 1NWSA 3SAZA 5DQPA 5CPMA 2CLHA 3UPBA 1OX4A 2XM2A 1AH0A 3AS0A 2XVKA 2E5BA 2OSWA 4B15A 2ZZ1A 1FWIC 2QCFA 1I1WA 2ZC8A 5BOOA 2VCAA 4KMQA 3JZEA 2ZZ4A 1K6WA 2V2HA 3LB0A 1ZU8A 3M0VA 4JNZA 4AY1A 1EZWA 1E4LA 4QRNA 3E2RA 3TFCA 2HMCA 1HQTA 4NIRA 3FVMA 3PBGA 2BCPA 3SCTA 4HU4A 2X30A 3OYXA 5C7VA 1JULA 2YL8A 5DCBA 1W1YA 4JKKA 3HU7A 2YFOA 3GHSA 3AN1A 1NQ6A 2I1OA 1V0LA 4JFWA 2ONEA 3KVKA 5IRPA 3RM8A 3AIEA 1JPKA 8TIMA 3H8AA 1A3WA 1ZP3A 2PDYA 3SUWA 2X8HA 1F3XA 5A6LA 1DV7A 4FALA 4HN8A 4QBXA 4K68A 4GYKA 5BROA 4XVDA 2J62A 1UD6A 3CWHA 3WLRA 4B4HA 4MOZA 3ETRB 1EP3A 1LWIA 2VEGA 2BV9A 1W9PA 4MUZA 3W6LA 4AWTA 1EUAA 1E1EA 3H2CA 3BMWA 4HPNA 4KF1A 4Q4SA 3GDMA 3OLGA 1OYAA 1VFOA 4AD3A 1XRFA 5IHRA 3N04A 4H8VA 1GPWA 4RPQA 4JTAA 3WMLA 4URIA 3VGDA 1DE6A 3FY1A 4BURA 1TTQA 1Q3NA 1QI4A 4TX9A 4Z2JA 1N82A 2HNHA 3MP3A 2WM0A 2BASA 3K4DA 3L4TA 2AMXA 1V5XA 4TX8A 1XH2A 2AGTA 3KBMA 4W7VA 3O07A 3L0GA 1GKRA 3UXAA 2NT1A 2FZMA 3W87A 3WD2A 1DTNA 5IBXC 4M19A 4C5YA 4IIHA 2HISA 3IWPA 2PWDA 3DKLA 3KRBA 2QCDA 1EC7A 2H6RA 2VENA 4BF5A 3S1UA 1P6CA 1LQ2A 1VFUA 2V81A 4EIVA 3W28A 4A21A 3S5SA 1TPB1 4LB4A 1UH4A 3EOEA 3EDJA 4L4PA 4BK9A 3POHA 3KTXA 2AQWA 3AZRA 1EEXA 3UWEA 2GJXA 4CD6A 1AJZA 1B57A 4RXGA 1F61A 4HHLA 4IXXA 2FJKA 4S3BA 4L4LA 4B5SA 4LY4A 4FOUA 3CL7A 5AKQA 3NM3A 3WSUA 4UTKA 4YCOA 3C0QA 4IZGA 4XZ9A 1DWIM 4IP7A 2A7RA 4D1IA 1O1ZA 2XU2A 3BCFA 3A3HA 1EWEA 1GQLA 4KERA 3M7SA 1WOBA 2TPRA 1EYEA 4WJ8A 3BURA 3TQPA 1FP8A 3L5LA 3EDFA 3K4WA 3P61A 3B9DA 4CCEA 4C6QA 1F3WA 3WMSA 1YE4A 3WBYA 3S6DA 4WDWA 1A53A 2IUZA 1WNOA 4P8UA 3OVQA 2EPKX 2GK1A 3K5XA 4HCDA 2F6KA 2VGGA 3SRHA 3WQFA 4QLJA 2F9RA 3BSGA 2YB1A 1JFHA 1F3TA 4OJYA 5IXEA 4WQ6A 4LBUA 1OT2A 3HB9A 3TYZA 1WKEA 5ABEA 4UTIA 1FXQA 2WNQA 4H9XA 5D2YA 1XFBA 4M0XA 4GACA 3DYMA 3THDA 5LHEA 2G3FA 4K7YA 3OP2A 3NQVA 4O0KA 1J9YA 2Z2BA 4R3UA 1Q6QA 2HPMA 1MNSA 5CG7A 3U5YA 3CXBA 4US6A 3W53A 3GIPA 5L6UA 1PTAA 2PA6A 2EF9A 3V5OA 5HNTA 4LS2A 1MVYA 2VX6A 1XSKA 1KD0A 3WX7A 2ACSA 4Q8TA 4RCXA 4H50A 1FHLA 5ABHA 3P14A 4JCMA 2XN2A 3QMTA 5B7YA 1H09A 3E0WA 3RXZA 1YXYA 1X1NA 3NO1A 1J01A 1EXBA 4ATWA 1H49A 1J0IA 4GFSA 4XAFA 4F3HA 2OU4A 3T7VA 2B7NA 3Q45A 4F2UA 1W5PA 4YTSA 2OMAA 3PY2A 1EIXA 2CZDA 5E0FA 4IX0A 1H7NA 2YFNA 3OGSA 2GL5A 2NXHA 3N19B 4BF9A 3M9YA 3CGCA 3S6TA 4YIWA 1HL9A 2NV2A 3UP8A 1POJA 3KW3A 4ZE4A 5GVJA 2XSBA 2WNWA 4J1OA 3QFWA 2V5CA 1N55A 2GWGA 2GR3A 4FR6A 1XBZA 4H4YA 2E8YA 3VKJA 1CW2A 4PUKA 3W4RA 3ABZA 3G1DA 3GAYA 4PTNA 3QQWA 2V69A 4ML4A 1Y65A 3PVFA 4KRTA 4WXZA 1XH1A 1OT1A 5BMXA 1BRLB 1UKQA 2VQUA 3PSWA 8CGTA 1TMLA 3EPNA 4FB7A 1UHVA 4L9XA 4ECLA 4W86A 1QAPA 1XGZA 3UZXA 4AY8A 3D0CA 1Z48A 1PSCA 3EPOA 4I90A 4Z2GA 3OG2A 3MYOA 1FFQA 2NQLA 5LSMA 2XSAA 3B0VC 1YNYA 1RAKA 4ENLA 3ITOA 5AYZA 3PHAA 2QDGA 1PTGA 2IQDA 2R1KA 1VPXA 3NVVB 4O16A 1VEOA 3MHFA 3DGHA 4FP1A 3BAIA 4Q7NA 2QDEA 1GKQA 4UMCA 3BAYA 2WHLA 5FJOA 1JUBA 3CAQA 3APGA 3WQ6A 1N7KA 3RG6A 2ZYFA 3ENLA 3GTHA 3WL0A 2DSZA 3W1UA 4YYCA 1KO0A 3TR9A 1FKWA 2PDKA 3WUGA 4AEEA 1YLVA 4A2SA 1JXJA 2Y89A 1Z3NA 4KFNA 1Z9AA 1BVZA 2NZLA 3ARQA 2J66A 4ERIA 1EWDA 2HXUA 4N9DA 3U8GA 3UYCA 2IXVA 4INFA 3LM7A 1EO5A 3D6NA 3ARTA 1ODZA 4HJFA 4Q3MA 2D73A 1IT0A 4GY1A 1GYNA 3LPPA 4C6IA 3LQGA 4H04A 3W7KA 4H4SA 2F5ZA 3EXTA 4OECA 3FDKA 4BI7A 2YCIX 1E6PA 2G41A 2IPJA 3TNBA 4GUGA 1ZENA 1M3UA 1A5BA 3NS1B 1N2VA 1YTKA 3JU2A 1C90A 3WBXA 3C4UA 5G4HC 3S47A 1G1YA 3SRKA 1TV2A 4NAFA 1WKDA 3TQKA 4GIYA 3F4WA 1K9TA 1PCKA 5G2IA 2GQAA 1JF5A 3LCXA 1E1CB 3N4AA 1S2VA 2WMKA 4GVHA 4Y96A 3UXDA 4H9ZA 3U2ZA 1OY0A 1GORA 5D9MA 2YDQA 2OOGA 1JDCA 1CWYA 1BXCA 2DW6A 3UWWA 3CWOX 3SFKA 5LGZA 2I5GA 2WZIA 5D2WA 5E0KA 3W7GA 3EXRA 3FYPA 2PC4A 4MY9A 3I3DA 3QYSA 1J6OA 1IIGA 4D6JA 1T8XA 1EOMA 1VLWA 2NQ5A 5AVNA 4Q8WA 2ZZ3A 1ZLPA 4GYPA 4GKLA 3CGEA 4WSHA 4MAZA 2PWEA 4Q4KA 6REQB 3SRFA 1CGXA 3WF3A 2JIEA 3VIPA 3II4A 1J2WA 1Q65A 1UP3A 4EQXA 1EKOA 3GVVA 1SZNA 3KEHA 2V82A 4PBGA 2E5CA 1XFCA 4Z08A 3WQWA 2QW5A 3LGEA 2E67A 1XC4A 1KBLA 2FB2A 3MQTA 3M0LA 4XZWA 2QJHA 2VEKA 5LA0A 1UOZA 3B04A 1JEHA 4RK8A 4MZ1A 3M07A 4WKHA 3CGTA 3WEMA 1L6YA 4MLRA 2NXIA 1IXNA 1KFKA 1Q6EA 3DAQA 1TJ2A 3T9PA 4MKVA 1FWCC 1QHZA 1SJDA 4AIOA 1HJWA 3UY7A 1RA5A 4C65A 4O1BA 2XPKA 1LYXA 4GZJA 2XINA 2YDRA 3EOOA 1Q5MA 3W1NA 1NDZA 5FL1A 2BZNA 1TREA 4PUEA 5AVHA 1A5SA 4XZNX 2CKRA 1VCFA 2GZXA 5AB3A 1OEPA 3SQLA 4DUXA 4NZCA 1ODUA 1KFCA 1OFAA 3ORWA 4LUTA 2Z25A 4GBDA 3UGRA 3CGBA 4B91A 1Y0EA 1Q6OA 1P0DA 5BU6A 3VKAA 1HNYA 5HWNA 1TJPA 4AZHA 3HMCA 3GKFA 1BZLA 1XLMA 2J77A 2NW0A 3DFPA 4QEEA 4F0KA 2XJ7A 4YMZA 2CKSA 1WKFA 2CLFA 2DU2A 3MKCA 1G01A 2OOFA 4N2YA 2WJFA 3VD5A 5HMFA 4GX8A 1IZKA 4WHBA 1C7SA 3F4NA 3UZJA 4UNKA 3WDQA 1RSCA 2CLEA 4S2CA 2YCEA 1EZ2A 4B3ZA 4YHEA 2HXTA 2FKPA 3H4WA 1REQA 4IMDA 2W67A 5HNRA 2JQXA 3SBFA 4RNHA 1VGAA 5DY2A 2PLMA 3U48A 1BXBA 3GAKA 3AIUA 4RE0A 3S8HA 3UJEA 1M9HA 1SZRA 1TV4A 1H51A 1F6YA 3A24A 3KOWA 1AW2A 2FZBA 4JEQA 4E3TA 4MGGA 3C2OA 3VMNA 1NDVA 2OG9A 4S38A 1JQVA 5MF5A 1OC6A 2OEJA 1AVAA 3NO5A 4IQLA 2FTWA 3EUB3 1X98A 3BLFA 3TW9A 3U2OA 3FGCA 1QTWA 3O3RA 1TV8A 1UJPA 3OVPA 4RNJA 4H4QA 3FJ6A 3PUDA 3B8VA 4ICNA 3HJEA 3LM3A 3P93A 2GVLA 4JX5A 4FOKA 4HOZA 2XFYA 1W3NA 3BL3A 2VZSA 3LPGA 2VZUA 3NUKA 3KL5A 2QPSA 4QROA 3TUUA 4C6FA 3IIXA 2F38A 5D37A 1P0KA 3W85A 1H62A 3WNOA 1UZ4A 2PB1A 1CB7B 3PBWA 2FZ9A 2Z4GA 1Z44A 2J4GA 3SSJA 1OFBA 1MW3A 3E0LA 1UCWA 5HR6A 5I0DA 3M64A 4LWWA 4EANA 3SCPA 1B3YA 4JX6A 1A3HA 2QDHA 4C1KA 5MKGA 3CZEA 1LBMA 3CLMA 4JXCA 2BG5A 2P1FA 1K7EA 3PTKA 1ZJBA 4MZ8A 5I3JA 1HKVA 4BY3A 4QG6A 2E09A 5EMYA 2E5AA 1FCUA 2DH2A 1KCLA 1JGIA 2H8ZA 3MUIA 2A6LA 1C8VA 1R9YA 3KL3A 4PB5A 4PYSA 4HSNA 1AUSL 4H4IA 1Q6DA 1QHPA 4E38A 3G1VA 3ALGA 4IOTA 1IIHA 4HPHA 3XINA 2E7FA 3R6IA 5K9XA 1FO4A 5XIAA 1HJSA 5HWMA 2G3JA 1W91A 4AHPA 4M7SA 1TWIA 3CQ0A 1RK6A 2TODA 3PZVA 2VUNA 1W1A1 2W3RA 4B2DA 2YW3A 3ZT5A 1KM4A 1NM9A 1BFNA 1G0CA 1WDDA 4O52A 1HKKA 5HNNA 1WYGA 1XLFA 3IUIA 4JCLA 3UPWA 4HZ6A 2AQVA 2ZRXA 4AZGA 4EF8A 3NVDA 2FPVA 1NQKA 3TXVA 1SO5A 1C8YA 1CGWA 1XLDA 4G2DA 3CV1A 5HJXA 4ATLA 3PZGA 2CCRA 3FX4A 4G9PA 4GIEA 3N34A 1AZ1A 5D2VA 2IPFA 1TRDA 4BV6A 3AMKA 1VENA 4BI5A 4OBSA 3RLVA 3WH8A 4BQ4A 1VBJA 2VXNA 5LGXA 1KTBA 2XHYA 4LJ3A 4Y90A 3UG4A 2BFGA 3AM9A 1EGZA 4ZQMA 1HKIA 1VHCA 4FPSA 4PMDA 2PZ0A 1MEWA 3ZLHA 2WO5A 1EJVC 4AIBA 4QE4A 1NOUA 3D3FA 2X16A 1QPNA 3OIXA 2Y5SA 3ITTA 4Z2KA 2QKFA 3P5YA 4LXFA 2PDMA 1J12A 3Q4DA 3DHPA 1O6IA 3VO0A 3VKDA 1PYFA 5JUVA 1ZCCA 5CLTA 1GHRA 1YBQA 2A1YA 3GXFA 3BLPX 1UZDA 3I68A 5FD0A 1X8CA 4C91A 3W74A 1H11A 1TVLA 3EGJA 1XDJA 4LVGA 2ATMA 3DX5A 2WZTA 2R14A 3A5VA 3PTMA 4FNSA 1OFRA 5TAOA 4UOQA 1KRAC 1SMAA 2G4JA 3WQPA 1FEBA 5FA5A 1GQIA 2IW0A 3CAVA 3TSBA 3CPRA 1QT1A 4OT7A 4PCSA 4X63A 4RZ6A 3GR7A 4AUBA 1KFBA 3OVGA 1PTDA 1UBSA 1ZAIA 3S9YA 1R5YA 3CK5A 3DI0A 4KRUA 5A6JA 2Y61A 3M5YA 1X39A 3NGJA 4NP7A 3SCQA 1O5RA 3GUWA 3FFSA 4Q8UA 1KFWA 5HANA 7A3HA 3KTSA 6XIMA 3SADA 1GOMA 4GI9A 3N4EA 4LAKA 3DERA 5EPDA 2H3DA 1IXQA 1GJUA 4KETA 5HUPA 1WO2A 4UFKA 4IT1A 4K6AA 3BZJA 5ECVA 3WD0A 4ILSA 3BGAA 2XFRA 3WLPA 2WSYA 3I10A 1SJCA 3BJFA 3S1VA 2NUWA 2O4QA 3RX2A 4JS3A 3UCCA 3S1GA 4I7UA 4WUIA 4JTSA 2J9XA 3A4JA 1EDTA 5E0CA 3A21A 1RQEA 3KWSA 3E9AA 5HPOA 1XQKA 2ZADA 5AC4A 3VA8A 4J2MA 3I7RA 3DH7A 3U2CA 2Y6ZA 3VOGA 1OF6A 3M1ZA 1F05A 3CZLA 5HR7A 5SWUA 3FAXA 3GKAA 3CZJA 1X7IA 5IM51 1N62C 2DZXA 1US0A 4O14A 1Q6GA 2TYSA 4O10A 3UG8A 2CDUA 2OSXA 4RV8A 3TROA 5A2AA 1O5QA 2P5NA 4IGHA 4WR3A 1J8VA 4GINA 1B31A 1XRVA 3G1HA 5DXYA 1F6KA 5FJPA 3O7UA 1VLIA 3SY8A 1F7BA 1YKWA 4S39A 3AS2A 1PV8A 3BLDA 3I3BA 3V0UA 1N8FA 4GNVA 2X0YA 3OBAA 1H61A 1WZLA 1FVPA 3RPMA 1T7LA 2OX4A 5C54A 3SB0A 3W23A 4ZFCA 4HYVA 5JCMA 1EJRC 1Z41A 2HROA 2Y8VA 2P8CA 3I4KA 5BWAA 1OFEA 1E1FA 1O7AA 4I5UA 4CCZA 1ZNNA 1S5TA 4E2BA 4D8LA 5A6AA 3L0NA 4BFAA 1OD8A 1MOKA 3EWWA 5EMLA 3B9EA 3U7VA 5AZ0A 3IUHA 4LNYA 2JK2A 1TPH1 3A23A 1QNVA 2HVOA 3N6JA 2R82A 2ZBTA 1A47A 3ZVHA 3P81A 4L64A 4XD6A 4LEQA 2VRQA 4XO7A 2YCLB 3BSHA 4DPQA 2Q8XA 3CNYA 3W73A 1STZA 2F8QA 2DT1A 5LHFA 3HURA 2VC7A 2OELA 2RGLA 2NXGA 3DESA 4IUOA 1KM1A 4EXAA 1MNZA 1XLEA 3L4VA 3O06A 2OT0A 4PMQA 4W8LA 3W2LA 1J0HA 2Y8UA 2FB3A 2HTMA 1TPEA 4JYDA 3IRSA 2GVJA 1Q7MA 1WA3A 3H2AA 4R5EA 2BGSA 2WVVA 1KN0A 1KKOA 1GESA 1CIUA 5LNUA 3WF0A 3HG4A 1V59A 1ZMCA 3ONBA 1SJBA 4Q7BA 4JTIA 3C0LA 2VC6A 4XZLX 4ICMA 1XIEA 4O0ZA 3LCIA 4H6QA 4WIWA 3SM0A 2QS8A 2QXWA 1TWWA 3NQAA 1GZGA 4AX7A 3BQ5A 2RDUA 4J3WA 4YLWA 1QCWA 4IH3A 1DP0A 1NOFA 1XYAA 2G5WA 2J8GA 3WUEA 2WNNA 3FLUA 1YQZA 2E0PA 4DVOA 3AHZA 4N0RA 3WK0A 3R7MA 4KCTA 4LCQA 5J5RA 2QYGA 4TV6A 2R9ZA 3Q2DA 2XIBA 3C3NA 4AIEA 5C7HA 4TO8A 3E1F1 2E6YA 1PIGA 5XIMA 1JPMA 2QF8A 4Q6XA 1J0JA 1HX0A 1X2HA 1VYSX 4U2ZA 3L65A 3MZNA 1S38A 1UWIA 1GKPA 1O1HA 2DVXA 3DK9A 2L5HA 3PWAA 5D09A 3AAMA 4RJEA 2GJNA 4O57A 5AYBA 3HG2A 4KPLA 3PK7A 4Q4PA 1JZ4A 1S2UA 5EU9A 1EJ7L 1SZGA 2Z29A 2DUZA 3NAVA 4CD5A 2CLOA 1I6NA 5J5DA 3ZFHA 2PGFA 3ITXA 2OZ0A 2EJAA 2C3ZA 1ZX9A 3QZAA 3VMOA 1T41A 1ONXA 4CEXC 3L68A 5J04A 4BWLA 1TO3A 4W84A 4TVYA 1CXIA 2BDQA 2R6OA 4GQGA 3UZYA 3HIJA 4X9YA 1UKTA 4GYFA 2YPIA 3CQIA 2WC4A 3VDGA 5HINA 1VCGA 3MKKA 1WXJA 1OQFA 2XIOA 2BXVA 4LVFA 1R3SA 2NWRA 1IGWA 1WX0A 3DKJA 2ZA3A 4O54A 1ZALA 4M52A 4V15A 4GQ0A 4C60A 4S3FA 4JICA 2BTMA 3GU2A 4TXEA 3WEOA 3T6CA 4WXYA 5E9XA 1OX4B 2Y62A 1XPGA 4NI3A 1MRQA 3VIFA 3WZ0E 3L4UA 1R47A 4UNLA 3BCDA 3VDBA 2Z00A 3MZ2A 1W17A 4GI6A 4Q8NA 4D6GA 5KETA 3V35A 2QNEA 3QRHA 4M81A 5C6MA 4ZBCA 4H4VA 2IKHA 1TKKA 1WZKA 3GFYA 3PZ9A 2YVFA 1GRFA 1E4NA 2P0OA 5FEXA 3AMCA 2OQLA 3ANVA 3U4FA 5E6YA 4OBRA 5CZTA 4EM4A 2ALDA 2ZX5A 3ZVIA 1HO4A 2D69A 2AOSA 3FJ4A 3UR7A 5BXPA 4CVWA 1VS1A 2Z1SA 4PB3A 1XP3A 5DMYA 2YSWA 4AF0A 3W7DA 5BCAA 2DZUA 4FS9A 4KCWA 1ZK7A 1QPOA 2ACUA 4Z2LA 3VD9A 4DYEA 1W1ZA 1JPDX 1A4LA 3WD3A 1PAMA 3SIMA 2PRLA 5I09A 2NUYA 1K03A 3P7YA 1NELA 1TX2A 2YDAA 4HHPA 3LN3A 1TIMA 2XIJA 2ZUSA 3KOZA 1FH9A 1HO1A 3PJUA 3W1TA 1G7UA 1ZAJA 2E1WA 3EDKA 1BHGA 2D24A 4JFTA 5D4YA 2A85A 2FTPA 5CJMA 1WXZA 3UZZA 3GH4A 2VOTA 2ESCA 3VM7A 1HL2A 1JF6A 3IJIA 4O53A 4EACA 3LV6A 1XJBA 2BNJA 3F03K 4NRRA 4B2DD 2ZRUA 1YDVA 3BUVA 2EQ9A 1N5WC 1VR6A 3G24A 1C91A 2W4XA 1EBHA 2VGIA 4ZOHB 1X7FA 2PAJA 4LU0A 1CLKA 3AXHA 1UBPC 5CLWA 3PC0A 1B30A 2OLHA 3K46A 3HPFA 5HDRA 3QV9A 3IARA 3UZWA 5LNWA 2QCDB 1VQTA 4P8VA 1VH7A 3N17A 1TV7A 3S2MA 4J7RA 2PTWA 2VMFA 3U2EA 3BJTA 1AK5A 2F6UA 3IIPA 1D8CA 4R88A 4Y9MA 2E77A 1XHCA 1ZBWA 2J47A 4ZSTA 3EA3A 2RFGA 4U33A 5D8WA 4LSBA 1TMHA 5HK4A 1DHPA 2R91A 2QIWA 4FNQA 5CPTA 2DZWA 2GJXB 5CBJA 4MY8A 3G1RA 4IPPA 3AIVA 2GWNA 3ZWSA 1S3HA 1JAKA 3KS6A 2ZC1A 1RJRA 3TMQA 4NX5A 3SQSA 3BH4A 4IMAA 1BG9A 4I5XA 3UXIA 1T5AA 1N8WA 1HP5A 4Q8OA 2I9UA 3PP7A 2DSVA 5FF0A 1RALA 4PMVA 1ZY9A 4JIEA 3V4BA 4NZ5A 3W81A 2WP6A 3ALFA 1MFUA 5KSWA 3NTYA 1A50A 1EQCA 3R0UA 3TC3A 2QV5A 1W9UA 2V2DA 5BXSA 1GEQA 3AZSA 4AEOA 3MP5A 3B4UA 2GK1B 3D9XA 5C5YA 1TVPA 4GVFA 2A7NA 2V3EA 1FWEC 3AHYA 1DXIA 3KDOA 1BYCA 5XINA 3L2MA 4O4VA 3HGSA 2QT3A 1NEYA 3BLEA 4NJIA 3WEZA 4MZYA 3ABRA 3ARWA 1JUEA 1B0IA 4UR7A 3SUSA 2HE8A 1R2TA 2YB4A 1S5WA 3I3EA 3I6EA 4J2PA 2OZ8A 2E25A 2EPLX 2W62A 3VILA 1XGEA 3BANA 5F4WA 3AMDA 4FX8A 4MM1A 1X8FA 3LRMA 1W31A 2YA1A 5F4SA 2PI6A 2WYSA 3WMBA 3PTQA 3LX9A 3QJAA 3CUHA 4KPRA 4HZ8A 3W27A 1Q7ZA 4HU3A 4ML9A 1CZ1A 2O9OA 5GJNA 3R8GA 1ISVA 1KFLA 4N7QA 2WLZA 4WCJA 2JE8A 2W9MA 2EG8A 1QK0A 2BXYA 1JZ8A 2IKIA 3OODA 4YTUA 4HU8A 3MSYA 1JXKA 3B8SA 3DIPA 3SJ3A 4TOQA 5B80A 3B0PA 4XQ6A 1JIBA 1L6SA 3OU8A 3OA5A 4C6NA 2WW5A 1DJNA 2UZ9A 2OWXA 5DMLA 3L5OA 2ACRA 4XZBA 3KOYA 3APTA 4PRTA 4ZVJA 1KRCC 2QCGA 2ZZ6A 1JYWA 2DZAA 3NO3A 1J0YA 1BEUA 5JBDA 2DEPA 1MO9A 4JR5A 3CMGA 4RZ5A 2I16A 1NDWA 1ESWA 3NQ2A 4GFIA 1XS2A 1RBLA 2PRMA 2Q8LA 3LCWA 2JGQA 5DMNA 3AIRA 5DRCA 2GLKA 3RM4A 1VEPA 4UQEA 4JFUA 1UUOA 5I79A 1YTDA 3EKLA 3GU1A 1RJQA 3H2OA 3C56A 1EF2A 2GOUA 4B9YA 3NPVA 3MUCA 1VEMA 1UC4A 4ACZA 3EWCA 2QGYA 4PN2A 4C6MA 1A5LC 3T2QA 2HQMA 1RY0A 4JYFA 3QN3A 5FI8A 1PKLA 3PUEA 4IX2A 1G5AA 2Q3OA 1M7OA 2A3BA 4CCDA 4MAVA 3CJPA 3UWZA 1XIGA 3P3BA 4ADWA 5EYWA 4I3GA 5CPOA 4WRHA 2JFEX 5CZKA 2ZDSA 5AZ1A 1J0ZA 3VDAA 3GRIA 4H4ZA 1TYGA 3G2GA 1H5VA 1VRDA 1C92A 3MC5A 2WCAA 1GW1A 5LYRA 1GNXA 1KXVA 1IEIA 4I7VA 4A3UA 3HQ1A 2VX4A 1X1OA 1XLLA 3ZSSA 3GNXA 3L5MA 2J6XA 2XFFA 4R7OA 1E6NA 3GDRA 3PWIA 2DZTA 1EEPA 2PTDA 1A5OC 2QCHA 3WLNA 3ZJKA 5KEZA 2H3BA 4DUVA 3BSMA 3S2NA 4Z2IA 3T4WA 3LCGA 2VD8A 3MVIA 4K39A 3EX4A 2JALA 3RUBL 4F0SA 3V16A 1JZ3A 4WF7A 4DXVA 1O66A 1F4HA 3RM9A 2PWFA 1O12A 1BGAA 1ISWA 3UD6A 1P0EA 4FLQA 1ECEA 3C61A 4NAFB 3T55A 4AVFA 4KS0A 4AC7C 1QJWA 3REQA 2BVDA 4OVXA 2AL2A 3NNTA 2DV0A 5C2GA 4JIIX 3USZA 3KLKA 4TMCA 3EX6A 4JTGA 5JCNA 1UWUA 2HV5A 2OTDA 2QUUA 5FS9A 3UR2A 3TXZA 4UTHA 1EHNA 1FRBA 3LNMA 7REQA 1Q7QA 1GW9A 2CBUA 2Z24A 1GVQA 4W85A 3TYUA 1OZMA 1RP9A 1UG6A 1XDLA 4J35A 2ZICA 3URHA 1B4KA 3S1WA 2P50A 4O11A 2RKXA 1ZDLA 4FX7A 5FJIA 2DW7A 1HVQA 1S5VA 1UR1A 5T9BG 1R3TA 4RDZA 3S0CA 5TBOA 5DMMA 3F7JA 3F5LA 3R58A 1X38A 4A3RA 4AEFA 1OBAA 3S9IA 4QCFA 3N2BA 3DFHA 4IMCA 4I5RA 5HMEA 3WFZA 3KOFA 4D71A 3GG1A 4E2DA 3TX9A 1ZAHA 5EMUA 5FJTA 2X8GA 2Q6ZA 4MFDA 4HNNA 3NEVA 1EB3A 2D20A 2GQ3A 3N9KA 4ZXLA 3CUXA 4L9ZA 1E9ZB 2AKMA 2WANA 4POCA 4XAYA 2D2OA 3NXFA 5C55A 4IPNB 3CV2A 3GB6A 4IJRA 4AD4A 2PTYA 3QKZA 1OB0A 1TYTA 2YVJA 2DVUA 1DWAM 1VB9A 4LUTB 3LG3A 2XVGA 5JMUA 1EHAA 3TV8A 2ISDA 3TZNA 3WELA 4LCRA 4TTGA 1JCMP 3EX1A 4REQB 4TU1A 4QAIA 2J75A 1JL8A 1SW3A 2HPIA 4HA1A 1UQYA 3WF4A 1Q66A 2Q02A 3DGRA 3HPAA 1E6SM 3SW6A 2GVEA 4L65A 4ZOAA 4C7GA 1AJ0A 1WBHA 4DYJA 2BX7A 3QHMA 3TH6A 3WUFA 4D72A 4WGHA 2ZZ0A 4IQEA 3WLQA 3CWNA 2X1IA 4GUHA 1TIWA 1RCQA 3VNMA 1PDZA 1Y5VA 2V67A 5I7GA 3QSRA 1RVKA 1LQ0A 1NHRA 2OPJA 4XO6A 2WKJA 2X99A 3LHUA 2F2KA 1REQB 3PFRA 1DQWA 3NZ1A 1US3A 3G1YA 3H55A 2I57A 2VCBA 1ICSA 3SCRA 1WAWA 3VNZA 2GDUA 1M68A 1WDSA 1BXNA 2J7BA 4K38A 1P6BA 3L4WA 1C8QA 1KFJA 3G1XA 2OYMA 1P43A 1D8WA 2VDGA 4OHQA 4XTDA 1E72M 2OKTA 2BC0A 1L6FA 3T78A 1VF8A 4RLIA 4O8RA 3UJRA 4O19A 3QEZA 1EBGA 2FHCA 3NPXA 4Z1BA 3FGCB 3WLOA 4OE7A 3WLSA 1MMFA 3EYPA 5F4XA 3NDYA 3EA1A 3CL6A 1J93A 2PDPA 1GHSA 5G5GB 3T40A 1T0OA 4U3AA 3NWRA 1XR2A 3M6DA 1DIDA 2DORA 4MWAC 4A3YA 4G6CA 1O68A 3BICA 3CYVA 3T0TA 2F2HA 4HNVA 5HQLA 5DBTA 1V6XA 2Q3RA 2PDIA 4PUWA 3CEPA 2CYGA 3SEPA 4QLLA 5JCKA 5ENLA 4E2OA 1S3TC 4MJ4A 3PSVA 3VTRA 2Y70A 4CD4A 1L6WA 5GNZA 3UWUA 4Z1DA 4UXDA 1TSIA 1BYAA 1JR1A 3P67A 5D04C 2QV4A 3SQPA 5KVIA 1C93A 2J88A 5MKGB 3AIQA 3GHUA 2OYKA 3UR5A 3NVZB 4TVWA 1BPLB 2QDDA 1G4PA 4IGSA 1RJPA 2FPYA 1V3IA 4IGMA 2Z2AA 1DXFA 1TX0A 3CH0A 2V63A 1DWHM 2PEVA 1QDSA 4LV4A 8XIMA 4O8AA 1IWPA 1DWFM 3OZPA 2RJHA 3GXMA 1JYVA 1GSNA 3A7AA 4PA8A 2POZA 3TR2A 4GI8A 2PCQA 4AXNA 5JCIA 1GK8A 3BK0A 4LEFA 3SO7A 5D9OA 3ARXA 3IV8A 3MI6A 2VYOA 9RUBA 4AX6A 4IWWA 5M5DA 2RABA 4FXFA 2WQPA 1C8XA 2NX3A 1M01A 1FDZA 3PTDA 1LQAA 4H83A 3WNNA 3BCJA 3WDRA 3O05A 5G4WA 4O1AA 3RDKA 3BOLA 2ADAA 1XIIA 4DO5A 3R10A 1M65A 2ZUVA 3R07C 3DFNA 4ZA0A 3M5XA 1V4YA 4AD1A 4H6RA 3GH7A 2DFAA 1RHCA 3C86A 1XIHA 3L5AA 4Q7IA 1E5JA 1NVMA 1ONFA 4HNLA 1M7PA 5LIUX 1B3OA 1LORA 1GRGA 2V5LA 3PPFA 1J0KA 2GYIA 3SCVA 5AC6A 5CZSA 1XLHA 3TWBA 3W7OA 5T91A 3L12A 4GG9A 1Y5WA 5EA9A 1PX3A 3ZR6A 3GIQA 1PKMA 3UCQA 1XLAA 2EHHA 2EGZA 2J7GA 4B5XA 1DIKA 3NG3A 1RCXB 4G8TA 4JTFA 4FHAA 1ZPTA 1GJPA 4ZGYA 2CBJA 1WAUA 1D3GA 1TPVA 3CHVA 3G0SA 3LXBA 4F9JA 2RDXA 4M5PA 1Q6FA 2PBOA 1CCWB 1XC6A 1U5JA 1YBQB 2JEQA 5JBFA 3JZUA 4GRTA 3I7SA 1PB0A 4U31A 4QLKA 4MF4A 1R87A 1RD6A 4J5NA 4KWUA 5I23A 1GTHA 2Y88A 3W86A 3GHRA 1E71M 1SFSA 2PF8A 1ICPA 3RAOA 4HMCA 1V0KA 1JD7A 2J78A 3HGRA 4GO9A 2Z6IA 3F2DA 4QEHA 4I9TA 1WP6A 2HS8A 4U2YA 2BHYA 4RDWA 3HF3A 2PRHA 4MUPA 1M6IA 5A8MA 4YWIA 4Q4MA 3W26A 2WZEA 3O9NA 2W92A 1B4EA 2YLLA 1PE1A 4GYPC 4YTTA 2GPTA 3W70A 3DBNA 3B03A 2D2JA 2Z1WA 3DFSA 4Q32A 3E49A 4UTWC 1LRTA 2XVNA 2HVMA 1K8CA 3E0FA 5AHIA 1A3XA 2NQJA 2CC0A 3LHTA 3F5JA 4N6FA 1CYGA 4L4MA 4DM2A 1YEYA 1JNDA 4LUSA 4HBKA 5I6SA 4Y6GA 4GI4A 3STEA 2W91A 3K8MA 4PEEA 4UFMA 3WMCA 3CMJA 3TMLA 1QI3A 4EKJA 2Y7FA 5C9XA 2KAUC 4ZQRA 4WK9A 3DXIA 2BBFA 3I6TA 3UF9A 3L8KA 4ASTA 2FGBA 4IFRA 2FZ8A 3BO9A 1QOQA 1EUNA 2OX1A 3PZUA 4C6KA 4CNTA 5CGMA 1GRAA 2ZX9A 3URAA 5A6BA 4LY8A 1RBAA 4JTLA 3EXSA 3HPXA 4JL2A 3W75A 3KAOA 1U33A 1UKSA 2F6XA 1EX1A 1HL8A 3C2FA 3AUJA 4OIFA 1R30A 2OR2A 1P1MA 4FA3A 1NDYA 5D03A 2VFIA 2Z7GA 4NJJA 1GG1A 4QHRA 3MHGA 1XBYA 3THQA 1PHWA 1UUQA 1NY1A 3VKKA 4UIOA 1K3UA 4BEQA 1JDAA 1AW1A 2F84A 1R0MA 5JIPA 3UESA 1JCXA 2IS7A 4CNNA 4LAUA 3RRXA 4D6DA 3LXAA 3TLQA 1IQ8A 4UWMA 1CDGA 4H7ZA 3BLOA 2QF7A 2BOGX 3WBAA 2AGKA 2Z7KA 3DGZA 1XKJA 2HBVA 3WG6A 4W87A 2IPGA 3SUVA 3GG0A 4Y8EA 4LS1A 4F4RA 4P7OA 3OB8A 3VIGA 3FJLA 1U5VA 5DO8A 3MY9A 4PUMA 4MHBA 3GIYA 3T1GA 3ZVHB 1BYBA 1R3VA 3TDFA 5FAGA 1G9HA 3QC3A 5CCZA 3ARSA 4TVUA 3AXIA 3BLLA 2Y2WA 3UNDA 4C6OA 2JEPA 3GD6A 3OZYA 3W22A 5D9PA 3NVTA 2CESA 5TF0A 3L4YA 3IJDA 4E5TA 1GZ1A 2WVVB 4BKNA 1XPYA 3W29A 4GZIA 3OOQA 4Z2HA 1IEVA 3EEZA 3P5ZA 5A8QA 2GR2A 4LNCA 3NVYB 5FSEC 4PSPA 1RVGA 3NQGA 9XIMA 3IAQA 1LROA 2CZFA 1R9XA 5KTLA 3CC1A 3CLWA 1EDGA 4IIDA 1TWDA 4QQ3A 3E02A 2PWGA 2V3DA 3T81A 2PWUA 2WJEA 3M5ZA 2VQTA 3KM8A 4AD0A 1R7AA 2R1MA 2VDIA 1GERA 4ORIA 5ER0A 4LYRA 4DIAA 4DELA 1UD2A 2YYUA 2O7SA 1VCVA 3GSMA 3OQ8A 4GX9A 1GOXA 1FFUC 1U1HA 1GQNA 3OPSA 5FEZA 3E2QA 3MDUA 1FXPA 3MS8A 3RLGA 4HNUA 2QJIA 1LCOA 4J40A 3BGJA 3N4FA 4PB4A 1VHNA 1W56A 4YHGA 1OADA 4ZENA 3IIOA 1NHQA 1L6GA 5TQLA 4MJMA 1DWGM 3QLDA 4N42A 1SFLA 2D0HA 3CQKA 3H21A 1E5NA 2YCKX 1UIPA 4HNTA 3MA8A 1I45A 1LL7A 1LRNA 1SM9A 3UJFA 1GOQA 3QZ6A 2ZWZA 3VCCA 2CHNA 3HFTA 1OIMA 3GRTA 3PPGA 1YTEA 3WIJA 4S1FA 1MRAA 4GD0A 3NZPA 4TX6A 3QV7A 4OBTA 1W8SA 1IYXA 4JNYA 5BYWA 2PDXA 1JAEA 3OHMB 4D8ZA 3NRZB 2DDXA 2GQ9A 1D2KA 5CJNA 4TQTA 1DXLA 4XIAA 2QCNA 4L6HA 4OU1A 3VXGA 1KCZA 3BG3A 2XGBA 5AYXA 1YPIA 3G5EA 3CT7A 4EMWA 2QUTA 1UR0A 5JQ9A 1V6WA 3G77A 1JZ2A 2J25A 4HD5A 3HM7A 1V3KA 2Q71A 2OEKA 3AHTA 3AQUA 4M24A 4YVPA 2JGYA 1BD0A 2FGLA 1ITQA 3MI3A 4O50A 3GY1A 1H3GA 4KIRA 1AFSA 1SJAA 1QO2A 2ZTJA 1IXPA 3FA4A 4IUGA 2EEXA 3TE9A 3N25A 3NPWA 4U3CA 4PGLA 1Z42A 1K7XA 4LRTA 3LTPA 4MADA 5DRIA 1NJJA 3MP4A 1KRBC 1FCBA 1THFD 2RGMA 1Q8JA 3FNDA 1E9LA 4FO4A 4BQ3A 3W38A 3R25A 5CC3A 7TIMA 2CFFA 3RLHA 3PFMA 3GX9A 3IGUA 4AVOA 3KLJA 1LBFA 4WY0B 1KWGA 2GVYA 2WHJA 2WSPA 1X2GA 4KFPA 1F74A 3FXGA 1XANA 1U5HA 1FWRA 3MYPA 3VIKA 4K2SA 3KLLA 4DXXA 1LZOA 1XINA 5FF3A 1T3QC 3K8KA 1GZJA 2PDQA 2E8ZA 3QMSA 4LAZA 3EANA 1PEZA 3CUZA 4GXMA 1UWQA 4D6CA 3W7QA 3MO7A 3PUGA 2QJNA 1ZXIC 3UYIA 3PAOA 4W88A 6CGTA 4UTLA 1Z69A 3CTLA 3S1XA 3Q67A 4P7NA 1NWRA 2G37A 3XIMA 2G50A 5U25A 4AF0B 2VFDA 3WUBA 2WHMA 3NZRA 4HZMA 7XIMA 1J5SA 1TR9A 3TVAA 3M0ZA 5M1TA 1FWGC 2Y4SA 4E8CA 5CAKA 3GTXA 5A8GA 1E0WA 1CT5A 1I2QA 4UR8A 1RCOB 2XWEA 2MNRA 1IGSA 3ZQ9A 1QUMA 1RXOB 3NSXA 4NEVA 4FMVA 2C19A 1EC8A 4K8GA 2E40A 3LA4A 2P0IA 1FDJA 1J18A 2J7CA 2UY2A 4F48A 3B3DA 2BC1A 2TPSA 1PL9A 1M7XA 2CFYA 1TPC1 2ZUUA 4GGBA 4UQ9A 1SFJA 3KHJA 4AD2A 4RZBA 1NHPA 4HTYA 2RHGA 3NDOA 1UWSA 5BMWA 3TSDA 2E9MA 1KTCA 2J7EA 3N9SA 4IQDA 2H8XA 1BLIA 4J3ZA 1R38A 5A94A 2FQIA 1IF2A 2R1PA 3B8IA 3STPA 3B8TA 3E96A 4B90A 4JQ3A 4HCHA 3GTIA 3O2LA 4NKCA 3QR0A 5DY3A 1W1VA 1MWOA 3H70A 3RR4A 5H8MA 3HA1A 1TV5A 1JI1A 1ME7A 4YCPA 1MW2A 4FK9A 3FS2A 2IQTA 3VZYA 4RUBA 4G7EA 1GYLA 2UBPC 3C52A 4H4PA 3O0HA 3V5FA 3BQ6A 4LYPA 5CSUA 4IIEA 3NEHA 2VX5A 3ITVA 3AWNA 5DFAA 3SY5A 4CVUA 4R33A 5KVHA 3M0JA 4H9VA 1G4EA 1SUXA 1DQUA 3ARPA 3VFCA 3BV7A 1H60A 2CPUA 4TVDA 2ZZ5A 2KZHA 3PJWA 4PRRA 1PDYA 4I9MA 1QPRA 3EF6A 4U28A 5LA2A 4XAZA 3SCNA 4JQ1A 1QNPA 1ICQA 4LTSA 2AQOA 3QZEA 3LERA 4NX0A 4O28A 1QI0A 2YJQA 1LPFA 3W7CA 4R27A 3ECQA 3BC9A 4W5ZA 2NWSA 3O63A 4ROPA 3GR4A 4DJDA 4F40A 3T0DA 2WPBA 4FNRA 4LGXA 4GQRA 4ZB2A 3QHOA 4GOAA 1Q8AA 1TCDA 3WJYA 1WCGA 2WBKA 3PZTA 4MNJA 1J4EA 4W4QA 4ZQPA 1VPYA 1KKRA 4P7RA 4A8LA 3EA2A 2GR1A 3T0CA 2WCGA 2DZPA 5I3DA 1PX4A 2ZRZA 1UR2A 3VIOA 3NQ8A 1O60A 2INZA 4IP4A 2WMIA 3QQ0A 4GCAA 3U7BA 3QY6A 4DLMA 3TTEA 3NSMA 1IXOA 3WLLA 2HRWA 4N9EA 4C6CA 3BW2A 3GXDA 3KVMA 2RAGA 1CGVA 4PEKA 5FAJA 1M5WA 1FIQB 3CZKA 1S39A 2QVNA 3LRKA 4HYRA 3QLLA 3K8LA 1AG1O 3WLMA 3FKKA 5CJ5A 2PWVA 1TPFA 4KW2A 1JG9A 2R94A 2HQAA 4NI8A 1V03A 4M8UA 4KIEA 4MNLA 1ZGDA 1OIFA 3AYSA 2XN1A 5RUBA 2W0HA 1QVBA 2PP3A 2QGHA 4LFYA 3GZAA 2ZVIA 3UVAA 3NZGA 2CLKA 4IJCA 3KTCA 1Q6LA 1OM0A 1XG4A 4BF7A 4MSSA 1F3PA 1FH7A 2W54A 5CH9A 3RN6A 3LU2A 3SN0A 4LALA 4HIBA 3VKBA 3U3HA 3NL5A 2HK0A 2QCCA 2G0WA 3O6DA 3AS1A 5HJLA 1TPWA 1H41A 1W9DM 4LUYA 3WK2A 4LW7A 1QXLA 5T9CE 3STCA 2XVPA 3W25A 1CGTA 3WK3A 2FIQA 2QPXA 2YBUA 2CIPA 2JKEA 3P8JA 4WD0A 1KW1A 3DHFA 5A6BD 4GJIA 1W5NA 4JTQA 4E4PA 4ZTXA 2Y7EA 4C6PA 3PBMA 4JQ2A 4PMJA 1E43A 3C0JA 3G3DA 1DJZA 1QU4A 3VNLA 3C8FA 3GVQA 4KCUA 4HOXA 4U10A 2J7FA 3OO2A 1VD6A 2G3MA 1QASA 4UC5A 5DANA 4XSLA 2ZRVA 1RQHA 4AISA 3W2UA 2V6OA 2AMGA 4FLSA 3PPCA 3O6YX 1CEOA 1UROA 2Z0IA 2C13A 3M46A 3SR6B 4CUCA 2BVWA 4ERAA 2QAFA 5AOUA 1HW6A 1SB3B 3DJGX 1ZP4A 3BAKA 4ACZB 3P82A 4GVIA 1EIBA 4JFSA 2GVGA 1PHQA 3GD4A 1XICA 3ZWTA 2VO5A 3G3MA 3MMWA 3QY8A 4HTBA 3WK1A 2ZTKA 4AD5A 1TTPA 4BWLC 4GZ7A 4M6QA 3MV11 5FJJA 5D30A 1P5BA 1XXXA 4A35A 2W79A 2VZTA 3VGGA 3LHWA 4GC3A 3PZQA 1T40A 2REQA 4LYKA 2NV1A 1TR1A 1I2PA 1HJXA 3LOTA 3M0KA 3TAKA 3IAPA 3GD3A 3T05A 4TIMA 3PULA 3BPWA 2Y1HA 3PG9A 4JZ5A 1SSGA 3S2JA 5K4ZA 1C29A 2ISWA 4L7ZA 4XBJA 2YR1A 3A9IA 4JOMA 3GHTA 1B3ZA 4ZSUA 1FTXA 1E0XA 3R94A 3GXTA 1F76A 1AD4A 4EAMA 4K1WA 3TP4A 4DPPA 4XD4A 3FEQA 4NZ1A 3LXCA 3UXLA 3H23A 5I5RA 1XUZA 4I8YA 4B5WA 1UOKA 2OO0A 1JCYA 3R0DA 4H7VA 4GQBA 2X05A 3HMJG 2FPTA 1D3HA 1MZRA 5IDIA 4DXKA 2XIIA 1UMYA 4JHMA 2E3ZA 4H6KA 1RLCL 3TQ0A 1S2AA 1KBBA 3CXOA 5EFFA 1EOKA 3RNMA 3H22A 2YBTA 3VI2A 4J57A 3REQB 1FWHC 5CPLA 3AMGA 2AL2B 1OCJA 2NSXA 3VKCA 3II1A 1H1NA 4P8WA 1XWYA 1P7TA 4IPIA 1WOAA 3QM3A 4JTUA 2ZUMA 2VDHA 2PDLA 4FNTA 2YYTA 4KWVA 3W82A 2QUNA 3RFAA 7REQB 2FMOA 2OO6A 4W7UA 3LHYA 3OJGA 5CBIA 1EF3A 2EAWA 3M0YA 1RM6B 2C1IA 1O4UA 3ZR4A 4KEMA 1N5XA 4EF9A 2VGFA 3SGGA 4Q22A 4AZCA 5A6KA 4K8HA 2DP3A 5CZ0A 1VFFA 3H12A 3GG8A 1EX5A 3EX2A 1K8XA 1EO7A 2GDVA 5CQ1A 3WQDA 2DIEA 2VL4A 4S3EA 3K13A 4O1CA 2OKOA 1H2IA 1KBKA 4DJEA 3INPA 1ZL1A 3UQNA 5M3WA 4EWND 3NJ3A 1PKNA 4NT0A 4ACYA 4FX9A 2FH8A 4AWEA 1TFVA 5U1OA 2CW6A 1MUMA 2YAUA 3LEPA 3VOFA 4W93A 3QFBA 2GOKA 3CASA 1UP2A 4K1GA 2D2HA 1WPCA 2PWHA 3F5KA 5CC5A 1XLGA 4PCPA 3WD1A 1EJUC 1Q85A 1RK5A 4N9BA 2OWWA 5JVLA 2GRTA 6A3HA 1Q13A 1IR2A 2WXDM 1S7MA 4U4MA 4CD7A 4A29A 5DXXA 1A4MA 1K9EA 3GBDA 3UA3A 2JK6A 3TJLA 1IR1A 3DK8A 1CXFA 2V3FA 1CPUA 3DHDA 3D46A 3UU0A 3DECA 1XCFA 2YDSA 3B06A 3CYJA 4H8NA 3R2GA 4F2TA 1ZTVA 3BJSA 3WO8A 1DL3A 4P5UA 2WK2A 1YXCA 4PCTA 3SR7A 3A22A 1QNQA 3M6YA 3FG2P 1E56A 3A64A 3AIBA 2BS9A 1UC5A 3GXNA 1I9CB 3T08A 3QPEA 2HCVA 4J3SA 3UR8A 2QULA 5FOOA 3APYA 7ENLA 4QSFA 5LNSA 1E6QM 1XDMA 1Y8BA 2EBNA 1A49A 5H8UA 4AYGA 3EZ4A 1O5KA 4DNMA 4F79A 3DFYA 3TCEA 3LY0A 3AYVA 4F8XA 4JKLA 3EWZA 3NQ7A 1PVNA 3MVTA 1YYAA 4Z0SA 6PTDA 1I1XA 3M43A 3MW7A 5CC6A 1JD9A 3WENA 4HMEA 3GTFA 1UZ1A 2PODA 4JBRA 4MDOA 4MKNA 2OQHA 3GFZA 2A3EA 4FLOA 3AUOA 3A5FA 4REQA 3ZSTA 5CBBA 1X1ZA 4B3LA 3B0YA 2C0HA 4WDTA 3URQA 4ZB5A 3WFAA 3HGJA 2OEMA 4E2VA 5I3IA 7CGTA 4DLFA 2O0TA 3KP0A 2WBAA 4TUFA 2ZXQA 3NGFA 3ZT7A 2X1RA 2GH5A 1OJTA 4PMYA 5G2WA 2DSUA 4ZQOA 1F07A 1GTEA 1ITXA 4HQVA 5DELA 4L56A 3IGSA 1EYWA 2WNZA 1SO3A 3ITCA 4M29A 5IDZA 4GY0A 1SW0A 5H6HA 3QYQA 2C91A 5FS7A 1BWLA 1ZZMA 4O15A 2HS6A 3WF2A 3WLJA 1HT6A 1S46A 3GC4A 4DNAA 3B40A 3GBEA 4D8AA 1E0VA 3RR1A 1AA1B 3CHDA 3SCUA 4DO7A 2XGZA 1OCBA 3VM5A 5E9AA 1H1ZA 3ISIX 3VIMA 3QGKC 3G22A 1OABA 1A0CA 4JN7A 4QDPA 3IV3A 2GSJA 1UMLA 3UY8A 5BU9A 4CCCA 3COTA 3MJYA 1ZKQA 1C9WA 5A3HA 3WQ4A 4GJJA 1K4GA 3OGVA 4A8NA 4KKXA 1JCLA 5F2GA 3T2PA 2IQ0A 2XYLA 3N29A 4KWSA 1IE7C 4GABA 2PC8A 1PXGA 3MBDA 1LG2A 3I65A 1DTUA 3W1PA 4WJXA 3DK4A 5K9DA 3MUAA 3JW7A 3M44A 3AI0A 2CLIA 4I9JA 1GRTA 1VQZA 1GVIA 4JYEA 3QSTA 3UFYA 2POTA 2WKLA 4LT9A 4H4UA 1K7FA 2WM1A 1FWNA 4S3KA 4DJDD 3AJXA 1LT7A 2FH6A 2FGZA 1GETA 3GDBA 1Z7AA 2CITA 2A7PA 5A1AA 4JIHA 1GPFA 1V3LA 1GRBA 3E74A 1QHOA 4DI9A 4M7TA 1HP4A 4OV4A 3AYRA 4J27A 3ZLGA 2DZBA 3H2EA 4Q4RA 4HPJA 1WDRA 2GDQA 5GRTA 2G96A 3P0XA 3IK2A 2BVTA 3NZQA 1AMKA 3AXMA 3R43A 1NP2A 1F8IA 2X42A 5IOBA 3BZGA 2ZE3A 2V8ZA 4F2BA 2QJMA 3RRAA 1B1YA 7ODCA 4NYUA 1JGMA 1T99A 3RHGA 3AHVA 1PZ2A 1G4SA 1GVOA 4DJFA 3EB2A 2G4FA 2JKPA 1LWHA 3ITYA 1XBXA 2X40A 3UG3A 2BVYA 4KEZA 3OVRA 4NNCA 1LOSA 4RR4A 1UPMB 3TLLA 4RXFA 2XGIA 3MMTA 4X2PA 3WQGA 1CECA 1EH9A 1GT8A 5CGQA 3B4YA 1CLXA 1OGSA 3SY1A 4C7DA 1BYDA 2OWCA 1MEHA 5CPNA 1KWKA 3EEGA 2J3NA 2BGNE 1TTIA 4FXRA 3UEQA 3M0MA 3YPIA 4CNSA 1DVJA 4M80A 3QFEA 2QUMA 3T44A 4RE2A 1FH8A 1QNRA 2DH3A 2Y5JA 4F0RA 5HPCA 1N60C 2EPNA 4GIAA 2R24A 4JTKA 3IANA 1HN1A 3A7RA 2WMGA 1KQZA 4PUDA 1TUXA 3HO8A 2VZVA 3TNOA 3AU2A 4XISA 4HK5A 4RPPA 1GEUA 3AHXA 4Y2WA 4KFOA 3HPZA 4XKYA 1H7OA 2BOFX 4Q6JA 1K77A 2XZ9A 5A8PA 3ICJA 4L6OA 4Z1CA 1P6WA 3JVAA 1DXEA 4X9SA 2D3NA 4CU7A 1T8QA 4PUJA 4B5VA 2W3SA 3S3GA 3T07A 4FF7A 1E55A 2WV8A 1LL4A 4UTTA 3K2GA 4WJEA 5HQMA 1MQRA 5G1MA 5AYIA 3A7UA 2WMJA 3WQVA 1OYCA 1L0PA 4UCFA 4AW7A 4LVDA 1TE1A 3ABQA 2BHUA 4R7WA 1DJYA 4FI4A 5C8BB 1C7TA 5HULA 4JTCA 2JIWA 4UFIA 3CPUA 4L5ZA 1DOSA 2CXEA 3DC0A 1WYIA 1FCQA 1QK2A 4WOZA 2BY0A 3PG8A 1VKFA 4FLRA 3W0KA 4LUSB 1FWTA 1MUWA 4CNOA 1RY8A 3WL1A 3U5UA 3SCWA 3WQ8A 1UD8A 4ZZ9A 2DQWA 3SGUA 1ME8A 2XN0A 2O55A 4H4RA 2VI0A 3NFUA 4MMWA 2Y63A 4DZAA 4L1GA 1FP9A 1OGGA 3UNTA 1KXHA 1QMLA 4ERGA 2INFA 1RPKA 3FVDA 2V3GA 3IACA 3WNKA 3UETA 3VDHA 3OG3A 3W76A 3W9ZA 1LL6A 2VVNA 3CO4A 3CQJA 1RBOB 2D0FA 3TSMA 4Y9AA 1RV8A 3N1AA 3DN5A 5C2XA 1WBJA 3DC8A 4GR1A 1H63A 1B90A 4QXIA 1EJSC 4X0VA 3PS7A 3H4KA 3QVQA 2VOMA 4LPCA 3T42A 1V6VA 3OLEA 1QOPA 2B0MA 4GO8A 3DUGA 3H24A 3THAA 2ZIDA 5AHLA 2Z6JA 4EPBC 2P8BA 1SPQA 3L67A 1C3FA 4L9YA 1X6LA 1CXKA 2DVTA 1U22A 5C71A 4A22A 1N61C 3C2RA 1J6PA 2KX9A 4MY1A 3LADA 5AC5A 2VM8A 4WVXA 3SRDA 5C9UA 5I07A 1E51A 4AB4A 2PU1A 7TAAA 2PU0A 3PNUA 3HJZA 1M6JA 1ZCOA 4ZXOA 1KB3A 4CN6A 5E5CA 1DYSA 1FWFC 1DJWA 1MO0A 1X6NA 4IFOA 3HGOA 1V7YA 5JH2A 4A8IA 3WDIA 3MJMA 2UY5A 3CV7A 3TYDA 3GDLA 4PH6A 2BSLA 1TJ0A 1GQJA 4OTKA 1UB3A 1YHTA 2YBVA 3B0XA 4JTRA 4EQSA 4JHOA 1ISXA 4W5UA 1H7XA 1YPXA 3U6WA 1GG0A 4I7WA 2XDFA 6TAAA 2ISSA 3MSDA 2J27A 3G1AA 4YN5A 4S2BA 2QAEA 5AN7A 1JCTA 2QVHA 4PCFA 4AU0A 5F2MA 4LBSA 4LCSA 1KA9F 1R2RA 2VVSA 1CXLA 3DEQA 2CERA 4RNIA 5AHFA 1A0DA 4ROQA 3RO8A 4DF0A 3W01A 2VEFA 2C14A 2E3TA 4DAIA 4BEUA 4PUNA 1V8EA 1AH4A 4DZHA 4EXQA 4D6HA 1QWGA 3TCSA 1KR1A 1XCXA 4DJED 2X50A 1L8NA 3NQCA 2QAPA 1NH6A 1S1PA 2XUCA 1H1YA 4LC8A 2PS2A 3W7LA 1G67A 1IEWA 1FHVA 4BCEA 3HV8A 2EQ7A 2EG6A 3V75A 2P53A 3TYEA 1LLZA 5BXTA 1RQBA 1YPFA 3QKEA 2DUAA 2QLYA 3W7HA 4PODA 1HJUA 3VZXA 1Q6CA 3A12A 4RDYA 4LAMA 2FDMA 3W72A 3TONA 1GYMA 1JYXA 1BKSA 1YADA 3QTPA 4EX4A 1AW5A 5C9ZA 5D38A 4NU7A 4YL2A 4W8AA 1WXYA 2PE4A 1JCNA 4GNJA 5HJYA 1V93A 3SZ8A 2Y7GA 2ZRYA 3EOLA 3QGAC 4CGTA 1FHDA 1AOGA 3TN3A 1HKWA 3OLIA 2CBVA 3IGXA 1HJQA 4Q8QA 5A6TC 4IF2A 3ZS4A 4OGZA 1XYLA 1F4AA 1L9WA 4J28A 3MU7A 2XG9A 4QJ3B 5TNVA 2ISFA 2ABBA 5I03A 4KESA 4ONVA 4J3UA 3C0SA 4FX6M 2G8ZA 1ONEA 1VYRA 1WDPA 1LOQA 1JDDA 2VD9A 3IC9A 3BXWA 1DJIA 3KL0A 3OGRA 3CU2A 3GNOA 3MBFA 2DZSA 3GG7A 4PL1A 4HMNA 2A5HA 8XIAA 2ALRA 3L23A 3WNPA 3QR1A 1X96A 1ZBCA 4HKPA 4RE4A 2PZNA 2Z1XA 3R0KA 4G1NA 3VX1A 3TFXA 1OC7A 3WLTA 3CGDA 1I2NA 5LIWX 2B81A 4LH8A 4H9TA 4NJKA 2QHAA 3L66A 1M53A 2NLYA 4HYWA 3ITLA 5LXXA 4YJ5A 2Q09A 3VE9A 3P0WA 6XIAA 2VFEA 1W3JA 4WOQA 2VTFA 1ME9A 1TMQA 2F61A 1AD1A 3S5YA 1OD0A 3ERPA 1LWJA 3CB8A 3H53A 4LAOA 1LUCA 4QG8A 2F7FA 1TG7A 4YTQA 3E6EA 3PN8A 1FA2A 1XLKA 4JFVA 2YZRA 4R85A 2HDJA 3IJ9A 1XDIA 3VAVA 5DEZA 2D22A 5FMHA 3O6AA 3L4XA 4XD5A 4KCVA 1YW1A 3O16A 1K4HA 2E1DA 2VEPA 2ODOA 3SFWA 4UTUA 2FHBA 3ZYZA 3OYZA 3LLDA 1S2CA 3Q6JA 4XX6A 2XM1A 3BGGA 3E3HA 3UWQA 4Y9NA 1UA3A 3GXPA 3IVSA 4QQUA 1CX9A 1YNQA 4F0LA 1G69A 1WE5A 1XCWA 4MNKA 1HIZA 2WVUA 3E2VA 1NU5A 3T4CA 1KM5A 1PCWA 2DIKA 1NHSA 4U5IA 3PZMA 3KCLA 4L61A 3VGFA 3WJSA 3ES8A 4JQ4A 3CZGA 1V02A 3IJ7A 3KRSA 3EDDA 1PZ3A 1H5YA 3QH2A 3G6MA 2PD5A 1W2PA 1FHUA 1IWBA 2J9ZA 4XG1A 5DF0A 1DWJM 1Q63A 4D2JA 4XKMA 4MYAA 1V97A 4WY0A 3W02A 1GQKA 3FOKA 2DPEA 1U30A 2FTYA 1KV8A 5PTDA 4JIRA 4YVXA 5A8NA 2A2IA 2X0SA 3NQBA 1NWTA 1QWKA 1QW7A 1L8PA 4YVVA 4MWAA 2PLJA 3BVJA 3RGTA 3POCA 1FFVC 1AMYA 1LBLA 2XSXA 4WSJA 1F2JA 3QV8A 3GFXA 4OKDA 4ADUA 2OLSA 3MCMA 4MPQA 1VBGA 3URNA 5M2FX 1OK4A 3TJXA 3SQMA 3H6OA 3QHNA 3UERA 1ZJHA 2Y24A 4QE1A 3D5HA 3DYPA 1YDOA 5FS6A 3T0AA 2V3BA 3UZ5A 3WNLA 5G4EA 3GZ3A 2YKKA 3QGVA 2V5BA 1TPDA 3IPWA 1R6WA 3IEBA 1G7VA 3GVRA 2QZRA 3A3WA 1BTCA 5CKSA 3B05A 2D23A 3VGHA 4G7EB 1Q1WA 1RH9A 2ZUNA 4WZHA 2PLCA 1CXEA 2E6FA 1W54A 5LKYA 3MMDA 4S3AA 4JQ9A 3R79A 3M0XA 4H01A 1TYPA 3KBJA 3VC6A 1YMYA 3UA4A 3KRUA 4DJFD 2CETA 1F6PA 1TZZA 2D0GA 3KBWA 1YNPA 3EMCA 3AXKA 1ECQA 5H8PA 1KXTA 2WC3A 1BVNP 4LC6A 2GJPA 4PL2A 5EMMA 3VFLA 1GGOA 1GVRA 4GISA 3CH9A 4GHRA 3VX0A 4Z1AA 1F8WA 1V08A 1UR4A 2DIJA 3EKZA 4UOZA 1VIZA 3TJ4A 4JL1A 8A3HA 2EG7A 4KGJA 4AWSA 1TRIA 4AZBA 3UWVA 4D6FA 3TA6A 3HQPA 1EPVA 5FEPA 3ARZA 4E0CA 1JI2A 4GCXA 1XIDA 3FHQA 1UA7A 2O9PA 4O17A 1RPXA 4EQRA 3TZFA 4Y9PA 1EFZA 1HXJA 3VVGA 2CU0A 1P48A 1E6XM 1BF2A 4CQDA 3Q37A 3VPLA 1TZ9A 3BOFA 1US2A 1D9EA 2O9RA 4DQWA 2FVLA 3M7WA 3E38A 2PDBA 4UB9A 1D7KA 4IPLA 3N2CA 5F7UA 4IISA 2WMIB 4NJGA 4NJHA 1LRQA 3U4AA 3IIZA 1YDNA 4AH7A 4PZVA 5HWJA 1CBGA 1VJSA 4MPKA 3QR3A 3O1NA 5FF7A 2OJPA 2O9TA 4NQ1A 2FMNA 2WPGA 2VFGA 3DI1A 3VINA 3N73A 1AQFA 4HCLA 1ZMDA 2V3AA 3LHZA 1VIWA 2OYLA 1NP0A 4JTJA 3F4CA 2YIHA 4RDVA 1NFPA 3LBOA 1TVNA 4ES4A 1JZ5A 1HUVA 3VD3A 1R7OA 2TAAA 3FAWA 4H4WA 2V38A 1HFBA 5H1WA 4A2RA 3GW0A 3CUGA 4ZMGA 5GJMA 1DNCA 1VFHA 4JX4A 2IXUA 3LDVA 4AQLA 5AY7A 2ZRWA 3P6LA 4HHMA 4MJZA 4K36A 2G3IA 1W1B1 4YYFA 4UMAA 5I02A 1UWTA 1JROA 3H7RA 1A5AA 1OX5A 4C1NA 3IJ8A 1DJGA 5JIWA 3WBWA 1GOWA 3RIKA 3QY7A 1X97A 4CN1A 4L6DA 3TJIA 2WPCA 1H0IA 4TTUA 5FF2A 4F9DA 1ISZA 3N13A 5AHMA 3PR2A 5DLCA 3S2LA 3O8AA 1K6AA 1W1TA 3NURA 3ZJ8A 3KS5A 4I8DA 2E9LA 1E0TA 2VZOA 1YXDA 4Z42C 3H7VA 4GA8A 4UTWA 4JTHA 4EM3A 1KLZA 1VZWA 1XV8A 2BY2A 1JDFA 3AFBA 5I3FA 4UZSA 4LS0A 5AYYA 2X2YA 4DWSA 3RX3A 4FIQA 1GCYA 2BOEX 4NILA 4JY9A 1BF6A 4MDPA 3B8DA 2ABAA 3GYCA 5LXEA 3HTWA 1JOAA 2P3EA 5AHNA 2QR6A 1FKXA 1B9BA 4Z17A 2X7WA 3QOKA 3LZ3A 2WMHA 3OEXA 2R9RA 1OWQA 3T2OA 1OHLA 1CTNA 2V30A 4ZQCA 3WN6A 1SZFA 1NF0A 3VCRA 1OZQA 1IEQA 4XAGA 3QXBA 4O12A 3CHFA 3S9ZA 4C6JA 4EVZA 3R1ZA 3BAJA 3R4IA 4IIGA 3PB2A 5M03A 2GUBA 3UG5A 4QTGA 3WDHA 2REQB 4L4OA 4G56A 4WEVX 2VT0A 1B3XA 1LM1A 4HSHA 2VR4A 4Q4QA 4ADSA 2WOQA 2C0AA 1PBGA 5A2CA 6ALDA 1SGJA 4LV9A 3ZXWA 3DCPA 3N12A 3KXQA 1W3HA 2GQ8A 4JTDA 3EWYA 4FNPA 1RZMA 2DUXA 4HK6A 3DFQA 3CAWA 2W63A 3KX6A 3QQ1A 4NHVA 1R3YA 3BG5A 3TTQA 4HA4A 4GZEA 3IS4A 4CQCA 1PUDA 2CLPA 2CLLA 4AZ5A 2NQHA 2QUVA 3H2MA 2NVDA 1X6UA 5TIMA 3OHIA 2EQDA 1MW0A 4GXWA 1M04A 2HWGA 3W7EA 4NRSA 3G0UA 1GREA 2AAQA 1OJXA 1JEZA 1FWAC 3NSNA 2DT3A 1FECA 3J7HA 3T8LA 2E4TA 2VWTA 3UCDA 2A3CA 3RILA 5BW6A 2X7VA 4BR1A 3W7MA 3UBPC 5BRPA 4KWOA 1A5KC 4AIUA 3EWXA 2ZWYA 4XIMA 3W1RA 1VRXA 4QJ5B 4IGNA 2C1HA 1W9BM 2RJGA 1KGWA 1P7TB 1DQXA 4M56A 3EB4A 3RMJA 3N11A 1ZS2A 2QJGA 2JKAA 3VNIA 4W7WA 4CQAA 1MYRA 1Z89A 2WC7A 4P7LA 4NASA 1XRSA 3QC0A 5J8LA 1E40A 1VC4A 3PZNA 3IRDA 5CGTA 4QSHA 4DF2A 5F2IA 1KNWA 2ATSA 1QO5A 4H6EA 3V3WA 1ADSA 1KLYA 1VP5A 1W1PA 2DQXA 1KGXA 4O0QA 4E6MA 4AZCB 1GUVA 4J3TA 2WBGA 1MDLA 5GNYA 1M41A 6TIMA 3BOXA 3DZ1A 3W6MA 1TQXA 3U9IA 5TR3A 1KGUA 3K1GA 4IG2A 1EA0A 4GYJA 3RPTA 3F1QA 3WFLA 1WUEA 5IHSA 2PDHA 3WF1A 1IZCA 4FXJA 1MZHA 4CEUC 5CAHA 1XX1A 3IK4A 2YOCA 4MB5A 3CIVA 4M1RA 5DCEA 1OX6A 1SR0A 3MB9A 1S5NA 3SIZA 4GWEA 4UQBA 1BGGA 1L2QA 5KMYA 1KBJA 3WH6A 3WD4A 4I9AA 3C2YA 2WAGA 1EDQA 3RYSA 4E4UA 2PTZA 3OQEA 4NSBA 3ELFA 4ZR8A 4GE8A 3CHCA 2EPOA 3ME3A 3MUY1 1M1BA 3OBEA 3VE7A 1DJXA 2VP8A 4CU6A 3AMZA 2VX7A 1MXSA 5E09A 2CHRA 3THUA 3V0SA 1NTHA 4G5DA 1UW9A 3TC6A 1XIJA 4DBUA 4Q8VA 3FN9A 1OYBA 2WVTA 4H8HA 4C6LA 4TR9A 1BG4A 3EDEA 2GR0A 2C7FA 4XB3A 3OA3A 4H3DA 3AS3A 1SQ7A 2NVKX 3MUZ1 3TA9A 2H9AA 4L1XA 1XI3A 3P8IA 2FZDA 1A5NC 2HNEA 2ZOXA 3WH9A 1DBTA 2RDWA 4ZTYA 1R3QA 4EP8C 5K2ZA 2PBGA 3P62A 4DJDC 4UBPC 1AH3A 3CM4A 5E1QA 3WDPP 3Q65A 3BAWA 1K8ZA 2B7PA 1K8YA 1Q1RA 3DDMA 1P0NA 4FEZA 3OC4A 4WDXA 4BQ5A 3HW2A 3BLIA 4PULA 1E9YB 2DY3A 1MQPA 2EKGA 4DBDA 3NL2A 5DN1A 2QCLA 5CSSA 1XSIA 2PSNA 2Z1KA 3L0KA 4GJ1A 4JDRA 1Z6KA 1TA3A 3VCNA 1H2JA 4FXSA 4IL2A 4JDBA 1LG1A 4X0NA 4UQAA 1KFEA 2XH2A 2C3DA 1ZBVA 5CSYA 4ZO9A 2H90A 3RITA 4M82A 5D33A 1MW1A 3VDCA 3BDKA 4GBUA 2EQ6A 4LANA 4GIRA 1PYMA 1MQQA 3V18A 4J9JA 1QBBA 4XVEA 4P7QA 3JR2A 1IHIA 1G4TA 1NOWA 2OCZA 4HNCA 2I5IA 1OFQA 3KFTA 2ZXDA 1LLOA 3LTSA 2FYMA 3SCOA 4ZOCA 4MWAD 3UPMA 1FQ0A 2PMQA 4WSKA 1KCXA 4I6VA 2CZVA 3LI1A 3PANA 1XUUA 5A5WA 1QATA 4UCGA 2D2GA 3NQ6A 3RLUA 3VNYA 1Q6RA 1OG6A 3UJ2A 2YA2A 3T8QA 3H7UA 1V0NA 2AAMA 3PF3A 2C71A 4GRSA 4V27A