3UGVA

Crystal structure of an enolase from alpha pretobacterium bal199 (efi target efi-501650) with bound mg
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
363
structure length
363
Chain Sequence
TLTFRKLTARPVLLKLQRPVTARIATIPDWPLILIDIETEEGVPGRAYLEPYVPKAMKYLVPALHDMSDMLAGQPLAPAEIYDKTRKSLHFVGYAGLSMIAASGVDMAVWDALARAANMPLCTLLGGTPGSVKAYNSNGLWLKSPAEVAAEAVELKAEGQGTGFKGLKLRMGRDDPAVDIETAEAVWDAVGRDTALMVDFNQGLDMAEAMHRTRQIDDLGLEWIEEPVVYDNFDGYAQLRHDLKTPLMIGENFYGPREMHQALQAGACDLVMPDFMRIGGVSGWMRAAGVAGAWGIPMSTHLYPEVGAHVMRVTETAHWLEWQSWADPILQEPYALSDGDLIVPDKPGLGLDWDEDVVAANLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enolase
publication title Crystal structure of an enolase from alpha pretobacterium bal199 (EFI TARGET EFI-501650) with bound MG
rcsb
source organism Alpha proteobacterium bal199
molecule tags Lyase
total genus 133
structure length 363
sequence length 363
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ugvA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ugvA01
2HXTA 3UCDA 3UXLA 2HZGA 3BOXA 3DG3A 2CHRA 1WUEA 4GFIA 2AL2A 3IJQA 3SQSA 1KD0A 4KPLA 5FJUA 3VCNA 3H8AA 4E5TA 3GY1A 2NQLA 4DN1A 3VCCA 3MKCA 4H1ZA 5ENLA 3RITA 2PP0A 1JDFA 1MDRA 2PODA 2PP1A 3ZVIA 2GGHA 2OQYA 4JN8A 3H7VA 3V3WA 3MZNA 4HCDA 4IT1A 3N6HA 2GGEA 3ES7A 2OO6A 2PCEA 4FP1A 1P43A 3P3BA 2XGZA 4KT2A 3RRAA 3I6EA 4X2PA 3EEZA 4G8TA 2PPGA 2DW6A 4KEMA 3GC2A 1XS2A 2GSHA 4JHMA 3UJFA 5IDZA 1FHVA 3IK4A 4J1OA 3Q4DA 2AKMA 4GGHA 3KUMA 3UGVA 3EKGA 3SBFA 2QJMA 4YWSA 1ECQA 1WUFA 3TWBA 2PP3A 3T8QA 3UJSA 3V5CA 2PGWA 3MY9A 5FJOA 4E4UA 1EBHA 2ZADA 3SN1A 3TOYA 2OKTA 4DWDA 4G7FA 5FJTA 1OEPA 2PU1A 3N6JA 3DG7A 3GO2A 3CXOA 3DIPA 7ENLA 3SJNA 1R0MA 3QN3A 3ES8A 3NXLA 4HNLA 1BKHA 3U9IA 1JPMA 3NZGA 1TZZA 2P8CA 2PU0A 3QKEA 1W6TA 2HXUA 2QGYA 3R0UA 2OZ8A 4M6UA 4HNCA 3DDMA 3VFCA 4MGGA 1TE6A 3UCCA 3DGBA 2PSNA 3GD6A 3PK7A 1R6WA 1NELA 2XH0A 3RO6A 3DG6A 4IL2A 3FXGA 4E6MA 3OP2A 3UJEA 3MQTA 4H83A 4Z17A 2P8BA 1MDLA 3T9PA 3UJ2A 3D47A 2GDQA 3OPSA 3SN4A 1IYXA 5J04A 3HPFA 3S47A 3DEQA 1KKRA 3TQPA 3QTPA 1YEYA 1JCTA 4GISA 1ONEA 4DXKA 1NU5A 4DX3A 4ENLA 5FJPA 3K1GA 4HPNA 1SJDA 3ZLGA 4MMWA 3DFYA 5EU9A 4GYPA 1KCZA 3T4WA 3DFHA 4K1WA 3VA8A 1SJBA 3N4EA 4Z1YA 1F9CA 2AKZA 4GMEA 3R0KA 4IP4A 3DERA 3UJRA 3VDGA 1TKKA 3FJ4A 1SJCA 4FI4A 2PMQA 2QDEA 3IJIA 4DHGA 2P88A 1MRAA 1KKOA 2OZ3A 4HCLA 4GYPC 3TTEA 4HYRA 1ELSA 6ENLA 4K2SA 3SSZA 1L8PA 2OPJA 3D46A 1EC9A 3S5SA 5BOEA 2PA6A 3B97A 4H2HA 1PDZA 4E8GA 3FV9A 2ONEA 1FHUA 5FJRA 3ZLHA 1E9IA 1BQGA 4J3ZA 4IL0A 2OX4A 2PTYA 2XSXA 3CYJA 3NFUA 2OG9A 2XH4A 3MUCA 1P48A 3BJSA 3DESA 4ZA0A 2QJJA 2DW7A 3CK5A 3OW1A 3H12A 4IHCA 2XH2A 3TW9A 2FKPA 1XPYA 4MKSA 2OVLA 3CT2A 2HNEA 1EC8A 1DTNA 3R11A 4ROPA 4GGBA 4K8GA 2FYMA 2PTZA 4KWSA 3PFRA 3N4FA 3TJ4A 4IZGA 3CAWA 3JZUA 4A35A 4E4FA 2XH7A 4HCHA 3PWGA 3MSYA 3VC6A 1PDYA 1MNSA 3BSMA 2GGJA 3TJIA 2MNRA 4A6GA 2RDXA 3JW7A 3R1ZA 4IP5A 3QLDA 2P3ZA 1RVKA 4F4RA 3UXKA 4EWJA 1MUCA 3IJLA 3OZYA 3ZVHB 2QVHA 3QPEA 4A3RA 3THUA 2OZTA 2PTWA 1JPDX 3FYYA 3R25A 2O56A 3U4FA 3RGTA 2P0IA 3ENLA 4GIRA 4JN7A 3V4BA 3I4KA 3STPA 2QQ6A 2POZA 3OTRA 4M0XA 3JVAA 4H19A 3FVDA 3TCSA 2OFJA 3P0WA 3P93A 3H70A 2GL5A 3NO1A 3R10A 4DYEA 2PTXA 2AL1A 3V5FA 2AL2B 1EBGA 3ZLFA 2PS2A 4HN8A 2PGEA 3T6CA 2GGIA 4ZCWA 3RCYA 2OQHA 2MUCA 3Q45A 3ZVHA 3CB3A 3VC5A 2ZC8A 5BOFA 3FCPA 2QDDA 3TWAA 3MWCA 2GGGA 2I5QA 1EC7A 2QJNA 3OZMA 3RR1A 3SN0A 3I6TA 3PWIA 2OLAA 1SJAA
chains in the Genus database with same CATH superfamily
1BTMA 4BF9A 1VYRA 3LYEA 1L2UA 3UXLA 3NO5A 1OX4A 3OG2A 4YS1A 3BLOA 3VDHA 3OO2A 1CI1A 1KFKA 1Q65A 3SY5A 4ZO6A 1E43A 3TN5A 2Y8UA 4K8EA 1YDOA 1GOMA 1XHCA 1F6PA 1X98A 2YDRA 3IJ6A 1I45A 4DI8A 1ME7A 5AFDA 4UQDA 4HGXA 4YHEA 3L2MA 1O1HA 4W5UA 4XB3A 2FFIA 1AJZA 4D8AA 3UPMA 2ZKMX 5H91A 3WD4A 4JNMA 3I3BA 4H6QA 4U4MA 5REQA 1F3PA 4XIMA 1B90A 2WMIA 3FJLA 1X96A 3LEPA 3KTCA 1C3FA 3AHXA 1O5KA 4LTSA 5JU6A 5DEZA 2AGKA 1UD6A 2PRHA 1TUFA 3RRAA 4LC8A 4OGZA 4G8TA 3TYDA 3MP3A 1JEHA 4JY9A 2BMBA 1ECEA 3SCNA 2BODX 4NZFA 3EWYA 2DV0A 1Z8AA 1MXGA 5U7SA 2R91A 3RX4A 3GDBA 4Z2GA 1UKSA 4DEFA 4EANA 1GUVA 3LTSA 4DXVA 2FMOA 3N2TA 3EA2A 3KVKA 5G1MA 3G1RA 3TWBA 3UJSA 1X38A 3U57A 1UHVA 1XIEA 1BQCA 1HXJA 4PMDA 3HPAA 1B31A 3DUGA 3LHVA 2X8CA 2YFOA 2J27A 2NVDA 3VM7A 1F07A 4FXJA 4C7DA 3MUY1 1XLGA 4LBSA 4GZJA 3U9IA 2WVUA 1SR0A 1PS9A 3NZGA 1OY0A 4UMCA 2P8CA 4IWWA 1LLZA 4RJEA 5DY3A 2FGLA 3WK3A 1V0LA 1U5JA 1QOXA 2PSNA 1C8XA 1ALDA 1H1ZA 1NEYA 4NNAA 3C0LA 2YXOA 3S3GA 4B5SA 1EDGA 2PDYA 4PTXA 1E6NA 3AU6A 3LCFA 1C93A 1EF2A 2NXIA 4XAPA 5GNZA 1JVNA 1ME8A 1YTKA 5HPOA 1RXOB 1JDDA 4GIYA 3AJXA 1HGYA 3VE9A 1RLDA 4XAGA 4MB4A 1KM1A 2EBNA 1EGVA 2P0OA 1G4EA 1E1EA 1NSJA 3ITCA 4S2CA 4O1FA 1J0HA 3GNNA 3HG5A 4JQ2A 1R85A 3HPFA 3AIQA 1VIWA 3S47A 5EMYA 4AMAA 4Y6GA 3VXGA 4ES4A 4NX5A 4MADA 2Z00A 2NT1A 1PKYA 1A5CA 1LQAA 1IEWA 1UG6A 1BXBA 3WK0A 1S5TA 4ROQA 1HJXA 3MVIA 1JZ8A 4JTHA 4DJDA 3PAJA 5ECVA 3RX2A 3OA5A 3G1XA 1WKFA 1RCOB 3HRDC 1X6NA 3EMQA 2CWXA 5AHEA 3BWWA 4AHQA 2QULA 1YTEA 1W17A 1VEOA 1MRAA 1KKOA 5HMSA 4AWEA 1DIOA 4B5VA 1QJWA 2BTMA 1E0TA 4PMNA 3EWBX 2YL6A 3QBUA 3CEPA 3KHJA 6XIMA 1X39A 1EC9A 3MCOA 3BVJA 6REQB 3KCOA 1VFLA 1EHAA 4X9YA 4BEUA 1K8YA 1F3XA 2VRJA 3LNMA 2GQAA 1TTJA 2CBIA 3FV9A 3CV6A 5SWUA 1PZ1A 4FHAA 3WQ6A 3IIZA 1XLJA 1UUOA 3M0XA 1O5QA 3C2EA 3CUGA 1KFBA 1WZLA 1XLLA 3K30A 1GQJA 2VR4A 4PMOA 3TLQA 1EDQA 4BEQA 3T78A 4GY1A 4QG6A 4AB4A 3BJSA 2WNZA 2W92A 3KOFA 3UNTA 1TV8A 2DGAA 3LK6A 1PL9A 3K8KA 3DGHA 4MNJA 5BRBA 1C92A 3PB0A 1OK6A 1JXKA 3PZIA 3QGAC 1W54A 1Q2SA 4HPJA 4TX6A 5AECA 3CT2A 2V2CA 3VU2A 1RBOB 1Q6QA 2W9MA 1JIBA 4URIA 3PSVA 4PEEA 3DZ1A 3BZJA 3DH9A 4PUDA 2QUTA 4E2OA 4A35A 2VEPA 2BCPA 1XYFA 1E6PA 4HCHA 4TTGA 1TPB1 1JG9A 1MNSA 2GK1A 3TV8A 3LTYA 3NZQA 1W2PA 3PTDA 5BXTA 1L6WA 1PKLA 1HIZA 4Q8MA 5XIMA 2DZPA 3PBYA 3N2CA 4TO8A 3CASA 2X1UA 3EMZA 4Q32A 3LHUA 4J57A 3QKZA 3DKLA 1MUCA 1W5NA 2QVHA 1S38A 4N7QA 4IX2A 2A8XA 4IJBA 1NFBA 3R25A 1Z32X 1W1TA 4L9XA 3AIVA 4Z2IA 4GY7A 3ENLA 3IVTA 3OQ8A 4W4QA 5JQ9A 2I16A 4X9SA 3JVAA 3V0SA 4RL3A 3TEVA 3P93A 4LFYA 2YCKX 3ARZA 4Q6JA 3QLLA 1PV8A 3B8TA 1NQKA 1QT1A 3QQ0A 4PTDA 2EF9A 2PS2A 3T6CA 1QBAA 3BE7A 3TU9A 3EX1A 2OX1A 4FIRA 3WQ5A 3TNOA 4IQEA 1A0DA 3R8HA 3N19B 3PJWA 4DVOA 4C91A 2EJ1A 1OYAA 5FL1A 2F8QA 1O5XA 2F5ZA 2R1LA 3E3HA 2QDDA 2DORA 4FX9A 1IXPA 1M65A 2DP3A 1FWIC 2RDTA 4Y9NA 1V3JA 3BK0A 2I57A 1GG0A 4HU4A 3SN0A 3T0CA 5A6MA 2H9AB 4JHOA 3NPUA 5IXEA 1OYCA 1M7PA 1EH9A 3CNYA 1KQZA 1KFLA 3IRSA 4TX8A 4OOUA 2NWSA 8RUCA 3CLMA 2QT3A 4GO8A 2GSEA 4GI9A 6REQA 1KGWA 5D30A 3G0SA 1GETA 4QJ5B 4KEUA 4FMVA 3RM4A 4Y8FA 4R27A 4C6BA 3FAXA 1I1XA 1CCWB 1XSIA 1HO1A 1OT2A 2VDGA 5CBBA 1HFBA 7TIMA 1WZKA 3NL3A 4MJ4A 4CEXC 5TF0A 3RCMA 3ZVIA 5DT7A 2WQPA 3QF0A 3PF3A 1CLKA 2X0HA 3A3WA 3V3WA 1GZ1A 4G2DA 2I56A 4N9BA 3GXFA 3GLCA 4Q7IA 2GGEA 4O17A 5HWJA 3RRXA 4FP1A 3CGEA 3WH6A 3TW7A 3AFBA 1DPMA 4ZOEA 1Q63A 5I3JA 1S7MA 3T2QA 1G4SA 5C9XA 4MDOA 4QDMA 2RJGA 2Z28A 1FHVA 4J1OA 5DT5A 2F6XA 2H6RA 4EMJA 1FECA 2SFPA 1TG7A 3SBFA 1GVEA 3B4UA 1UJQA 4ICMA 2WV8A 3LLDA 1BZLA 3QY6A 3CJPA 4FIQA 4U31A 1GVOA 1H7NA 4AZIA 4OVXA 1UMLA 3H55A 3Q67A 2WW5A 4C1LA 4ZR8A 3KWXA 1OFDA 1W9PA 3W70A 3BW2A 1O5RA 3NXLA 2A6NA 2Q71A 3WY1A 3I3DA 1VPYA 2O55A 2DUZA 3QOKA 4XTDA 2ALRA 3UZXA 1A49A 3G2GA 2F6UA 1QUMA 3RIKA 1SSDA 2XG9A 2C16A 3BLEA 2OWXA 4RDYA 2DZAA 4Q8PA 3NQEA 3U6WA 3EDFA 4MZ8A 7A3HA 2J75A 3AROA 1H0IA 1F3TA 4K6AA 3IJ9A 1XBXA 4J27A 3RO6A 1XUZA 4NASA 2G3NA 4H4IA 4XTIA 1P6CA 5ABFB 1MQQA 3WD3A 4B2DA 1A5OC 3UJEA 3GUWA 3V1PA 6TIMA 1EQPA 3WLSA 1MFUA 1J10A 4P5UA 2CLIA 4Z17A 1STZA 3UWWA 1TSIA 4OV4A 3I65A 4RZ5A 2ZXDA 1DWGM 5LNWA 5C9RA 2VX4A 2ZA3A 4M51A 2VCAA 3SCWA 1NP0A 5L6UA 3TQVA 3NGJA 4X60A 2GVYA 1B3ZA 3D0CA 4WZHA 3NJ3A 1YXYA 3VMNA 4GZEA 4UTMA 4GCAA 3ZYZA 3KRZA 3EF6A 1HL9A 5FACA 5CGQA 4IICA 5D38A 4GYPA 5HNTA 3A4JA 3O15A 3A5FA 1KXHA 2H8XA 1AD1A 5CJMA 1Q1RA 4GMEA 3WFLA 4E2VA 3FEQA 1C90A 3TC3A 3T8LA 3T07A 2EPMX 3MBDA 4B15A 1NF7A 3DK9A 1DJHA 2YCJA 4H2CA 1D2KA 3ARPA 5J5DA 2ZRWA 3G24A 1XLAA 4AIEA 4XKYB 3P5ZA 3FLUA 1AH4A 3WJYA 1Q7ZA 2BY2A 4F9DA 3CUHA 3SSZA 4KF1A 2WVVB 3QFWA 3V1HA 1H2IA 3EXSA 3EOOA 3DHDA 3P5YA 4L1GA 4A8IA 4A2RA 4MOZA 4PMUA 4CU7A 1NP2A 4HMDA 1KGXA 4PSRA 3ZSTA 2PWDA 4FX6M 1XHGA 2OSXA 4GBUA 4LY8A 1TELA 4QNEA 5E70A 1OF6A 1SZRA 1K8CA 2INEA 3TOPA 4NI8A 4Q8QA 4JZ5A 2XSXA 1UR0A 4J3XA 1YKWA 2CIPA 5DO8A 4DBUA 1FWSA 1LBFA 4KGLA 1VQZA 3BGJA 1DL3A 4M80A 3W1AA 3B40A 1E1CB 3TTOA 2HS8A 2A3CA 2ATMA 4WGHA 2XH2A 2DIEA 2G41A 4JICA 4M6QA 5EA9A 4A4AA 4HBKA 3LPGA 2EQ7A 5KMYA 3UWZA 1MOKA 3B0XA 1S5NA 1YTDA 4DNAA 1IZKA 3BO9A 4GGBA 4LC6A 3W75A 2Z26A 3TJ4A 5JMUA 3BAWA 3CWHA 4JQ1A 3MSYA 1PDYA 3G1FA 1KRAC 2W79A 2OLSA 2ZZ1A 1Y0EA 4K8DA 1LVLA 4YTSA 1I60A 2OYLA 1OM0A 3RHGA 1UROA 5D32A 2PB1A 3QR1A 2XHYA 3IJLA 1Q8AA 3OZYA 4L4LA 3ZVHB 1GQIA 4AZHA 3OJGA 2DFAA 1XBVA 5DQPA 4ERGA 4CNUA 1E0XA 3AHTA 3KLJA 1GEHA 4WVXA 4LAMA 2O56A 3W7MA 2OODA 4H4XA 3QW4B 2UWFA 1QAPA 3BGGA 1UC5A 3GD3A 4R5EA 4AG0A 2R94A 1IZJA 2IQ0A 4U3AA 4D6HA 4S39A 3HJZA 4HJFA 2A3LA 1WDRA 2E3TA 4DYEA 2AL1A 2FZ9A 4R7JA 5GQBA 4M1BA 3LM3A 3NYZA 1QRQA 3Q94A 3E0VA 2EPKX 3CPGA 3AS0A 4N9EA 1XLHA 5LIWX 3O0HA 4YTUA 5HQLA 2NUWA 4BCEA 5ECUA 1JYXA 3CM4A 3DFQA 1ADSA 2XTKA 1A47A 3S46A 3UXIA 4EAMA 3I4EA 1OQFA 4GH3A 1EEPA 4EPKA 4JTSA 1J5TA 5G2HA 3S8HA 2ISSA 1T8QA 2TAAA 2A3HA 1ZHAA 4INFA 2W62A 3TE9A 1EOKA 4BF7A 4XKYA 2DJLA 3WH5A 2UV8G 2J88A 2GVGA 4UFLA 5FEWA 2D2OA 3ZQ9A 3G1YA 4MNKA 4L5ZA 3HMCA 2YVGA 1UP2A 4O1AA 2WVVA 3C2VA 4DUXA 3SQSA 1D3CA 4KIRA 3ARXA 3NVDA 1KRMA 1S5VA 4B3LA 3GNOA 2AMXA 4E5TA 4I9JA 4PE8A 1UD3A 4EF9A 2V3DA 2PWGA 2V3FA 1QXLA 4WQ6A 5F4SA 3VIOA 4JTEA 4TUFA 1U1JA 2WVTA 9CGTA 4X0VA 4O4VA 2NV1A 3NPWA 4K38A 1DEDA 2YAUA 3G6MA 2QNEA 3CGDA 5KSWA 4TMBA 2UY4A 4FNRA 3C8NA 4GX9A 1E1CA 3N6HA 4H9UA 2WPBA 1ZNNA 1BSLA 4KS0A 4WLCA 3VGHA 3R43A 2DT2A 4O8RA 3GXIA 1XL9A 2WC3A 4ZMGA 4TVDA 3NR0A 1XS2A 3R79A 3QFBA 1FA2A 1Q5MA 1ZAHA 5FEPA 2VI0A 3RLGA 1X8FA 3W38A 1RD6A 1QPRA 4KWOA 1T99A 1AMKA 2GR3A 4DWDA 2VQUA 2HS6A 3H7UA 3WELA 3FG2P 1LOSA 4TQTA 1UMYA 1LL4A 3LSBA 3VNJA 4PRWA 1IV8A 1TCDA 2J7DA 3N4AA 1MZRA 3BTNA 5LA2A 1FFVC 4MUZA 1KXVA 4EXBA 3LG3A 4W85A 3IPWA 1KR0A 3EDDA 3GAKA 1ME9A 3VGDA 4Q6XA 1PTAA 4LUIA 4ATDA 2W4XA 4H9XA 2QS8A 4AY7A 4YTRA 5A8GA 1R6WA 2C1GA 1TZ9A 2XM1A 3GU2A 3VABA 4KWWA 1XLEA 1V02A 4AD0A 2OMAA 5AHLA 2PDWA 3WDHA 2CXEA 4IPPA 3OVGA 2ZCGA 4ZSUA 1N8FA 2QIWA 3DFSA 2EEXA 1GPFA 2YIHA 4XZMX 1UOZA 1UZHA 1LCOA 4KFPA 1KFCA 3W37A 2HPMA 4YPJA 2VGIA 2ZZ2A 5J04A 1XV8A 2J7FA 4K7ZA 1Q2RA 1Z44A 3BGAA 2E5DA 1H7WA 1OVDA 3DEQA 2ZWYA 1GV4A 4I6KA 4GZIA 1JCTA 4LUYA 1U33A 4DXXA 4DXKA 4XO7A 4DX3A 1S2UA 5FJJA 1OFOA 2AGTA 3E9AA 3B06A 4F2UA 2HJPA 3VKKA 3QR3A 3RO8A 2C8NA 2EKGA 3OC4A 3RX3A 2AKZA 1N2VA 3R0KA 4XG1A 3ARTA 3H24A 1K70A 2EXOA 2A21A 1S39A 2LLEA 2OYMA 3URNA 4LS2A 1JROA 3NL6A 1V5XA 1YNYA 4F0HA 3O16A 3FJ6A 1LWIA 3LNPA 4EE9A 1BPLB 3MDUA 3T1GA 3VIIA 2PDLA 1P0KA 3CH9A 2VX5A 2J78A 4EQWA 1RPXA 3ANUA 1VFOA 3GVVA 3ALFA 3CQIA 3KP1A 1OCNA 1XG4A 2WHMA 4RCXA 1ZCCA 1KBBA 3A4AA 4GIEA 8CGTA 2FVKA 1LLOA 1IEVA 1J0ZA 4PMVA 1XYMA 4JQAA 1NF0A 4CLMA 1G5AA 3NIYA 4G5DA 5TIMA 3RM9A 2C3CA 1C29A 1I2PA 2HK1A 1DJQA 2NVKX 4GWEA 3RNDA 4GABA 2GR2A 1D7YA 1DE6A 3MPGA 3CZ8A 3IC9A 3AXKA 1R87A 2XIJA 3GH5A 3MUXA 1TYPA 3PTKA 2DW7A 3UU0A 3F5KA 2WZIA 1PWLA 2HVMA 2VC6A 4Q4PA 1TV3A 4DJEC 4HOZA 4MFDA 3KL3A 1EIBA 3S9ZA 4BQ4A 3QHMA 4U5IA 3POHA 3W26A 3TVAA 4IFOA 1FCUA 2YBTA 3QV6A 4RK8A 1VBRA 2NPXA 5IFTA 4DB7A 3IS4A 4DAFA 3S2NA 3AUJA 3E38A 1I2QA 2C18A 4OT7A 4CD6A 1Q7MA 5TBOA 4Q4KA 3SGZA 1E6XM 1E5JA 3LXCA 3WQOA 3CL7A 3N13A 4FXSA 3W1NA 1X1OA 4S3CA 1HL2A 3S0CA 4HHPA 3AZTA 2QDGA 3FYYA 4F0MA 3TUUA 4G7EA 2P0IA 5LYRA 3QY8A 4XAFA 2ZX6A 1PBGA 2YB4A 2J4GA 5K9DA 3IUHA 3O2LA 2QIIA 4H6EA 4ORIA 3P0WA 3OZOA 4R3UA 3NVWB 4QBXA 2H3DA 3G8EA 3W1LA 5BNKA 2ZUWA 7CGTA 2QCNA 2X16A 2RUSA 2P53A 1UW9A 1XC6A 2FZBA 1KM5A 1GOIA 3EDEA 4MG4A 1DE5A 3CTLA 1MQRA 5FS9A 1X97A 1IGSA 4KKXA 1A5NC 3ARQA 2QDHA 2PDXA 4ZE5A 1P0BA 1SO4A 3W7KA 1OX5A 5BOFA 1DHPA 5FEXA 5EBAA 5BW6A 2WWDA 3BMWA 3MWCA 5LKYA 4JKMA 1E72M 4DLFA 4BV6A 1LOQA 3L4VA 4IFRA 3RMEA 4H7CA 1TRIA 2KAUC 3XIMA 3GS6A 2HVOA 5K9XA 3L5MA 2CESA 4A3UA 1EJVC 1A5MC 4LWWA 3CIWA 1XDMA 2Z27A 5JH1A 4GNVA 2VTFA 2J7HA 2FZMA 4GVHA 1GNXA 1GEQA 3GDRA 1YW1A 1O1ZA 2ISVA 2VMFA 3R6IA 5FJUA 3S83A 3SB0A 1OC7A 4FOUA 4MYXA 2QHAA 3LI0A 3S5YA 3RMJA 3IRDA 2OQYA 5LGZA 4I7UA 2YW3A 5HA7A 3PUOA 4BI5A 3T44A 1SU5A 2ZUUA 1QVBA 1NAL1 4IUOA 2XIQA 3QC3A 2FGBA 3TAOA 1HKWA 4X22A 1QMLA 2Z6JA 2YKKA 3OVPA 4AVFA 1GHSA 1KTNA 4H04A 1DIDA 1V03A 2WCGA 2WOWA 5C70A 3E2RA 4Q8VA 4U10A 1QNPA 1J01A 4WJXA 1A3HA 4QSHA 3BQ6A 4LBRA 3UGVA 5DXYA 4S2BA 2VJXA 1H61A 3DGRA 3MY9A 5E5CA 2QXWA 4P8UA 1BYAA 2DUAA 1OC6A 1UB3A 2EHHA 3IV3A 1HG3A 3ARVA 5FCZA 5K4XA 2Z1XA 2XVGA 1KBKA 3URHA 3DIPA 3E02A 3UP8A 3QQWA 3HW2A 1O4UA 2Q02A 2J6VA 1WZAA 2PU0A 3QKEA 4CVWA 3MYPA 1GONA 2VQTA 1IR1A 4JD4A 3BUVA 1TE6A 4JNZA 1IEXA 3GD6A 3INPA 4GUHA 2NQ9A 4AVOA 5KZEA 1TJ1A 3E5PA 1PE1A 1VQTA 5LGXA 5D09A 4HMCA 2VRQA 4DO5A 3DCPA 4H01A 3W29A 3DG6A 3U5UA 1EJSC 4OKDA 4DWSD 4PFMA 4K68A 1DJWA 3WF2A 4CN1A 1I9CB 4CQDA 5HR6A 2PC4A 4N4PA 3S1GA 1G69A 3CU2A 3ATZA 4KESA 2BWGA 5HNUA 4PBGA 4QFUA 1G9HA 2Z1KA 4JTAA 1LL6A 2BVWA 1B3YA 3AISA 3FSUA 4ZQMA 1CGVA 2RH9A 2VFFA 2ISFA 2E6YA 1IXQA 4ENLA 1JGIA 4C7FA 3PS7A 2XVPA 2OO0A 4FNSA 3C8FA 2PD5A 2E40A 4NF7A 1QNRA 1PPIA 3HQOA 1WOAA 2B7QA 5E9XA 3VDBA 1D8WA 1P0EA 1GESA 3C2FA 3AYTA 4IIGA 4UWMA 1UD4A 1XGDA 1FUYA 5CPQA 1FHLA 3DAQA 1BWVA 3IGHX 1KM3A 1LDCA 5G5HB 4W7VA 1BWKA 5CPTA 1V59A 1WXJA 3GTFA 4K2SA 1OFBA 4RE3A 3UERA 1WQ5A 3WQCA 5BOEA 3CUIA 4CNNA 3WUEA 2W3RA 4H2HA 1JDCA 2INZA 1FWDC 3S9YA 2ZQ0A 3HPZA 1W3IA 4LSBA 1V0MA 5FJRA 3FGCB 1PYMA 1NDZA 4XUYA 3WF0A 3PZMA 4KWUA 1AZ2A 1SW7A 1KLYA 4FO4A 1TV5A 2CLMA 3Q2DA 3P80A 3BG9A 4FS9A 4FDCB 1DORA 2Y5SA 5KVIA 2NSOA 1JZ3A 3ARUA 5HK4A 4WR3A 4MF4A 4LUSB 3WFZA 3BCJA 2D24A 4UR7A 1CX9A 2WBGA 2XSBA 1KW1A 2P1FA 1GTHA 3A22A 3KCLA 3W3OA 4LF2A 4IGNA 1CGTA 1CIUA 2RKXA 5JCKA 2FPYA 3ICJA 3ZT6A 2PWEA 1R2RA 2V5BA 3H54A 3VMPA 4ADSA 4QHRA 1EJRC 1O6IA 3MDWA 3WD0A 2FHCA 4C6JA 2TSYA 3R12A 2J24A 4HSNA 3EXRA 3QH2A 1Q6DA 1MEIA 3GTNA 3GD4A 2Y6ZA 1VBJA 1PWMA 4IP5A 4CD7A 3W1TA 4F4RA 2Y61A 3XINA 1DJYA 1QHPA 1H6VA 3U4AA 2XIOA 3WLTA 5E0KA 2A7NA 3OBAA 1J11A 3THUA 3YPIA 1HVQA 4GIRA 4YCPA 4O11A 4XZBA 2JFEX 3V0UA 3UVIA 1XIDA 1TQJA 3GNDA 4GYFA 1JZ7A 4M82A 3WLOA 3WD2A 2PDIA 1XYBA 2EPNA 1ONFA 2PTXA 4AZGA 5CG0A 1C9DA 2AAMA 2PGEA 3HN3A 3LCGA 1G7UA 2YXXA 1KRCC 3BMVA 3CT7A 1JJKA 3EWUA 4AC7C 1L2QA 4Q4RA 1UZ1A 5LSMA 3QRHA 3AIEA 3PPCA 1O66A 4W89A 1UZ4A 4LNYA 1ZJAA 3CH0A 3HG4A 1D3HA 4B5TA 2DY3A 4PULA 4MJMA 3KBJA 3W2MA 3GDMA 4GCXA 4XIAA 3KS5A 5F2LA 3T2PA 1RV8A 1XG3A 3DHPA 1DHKA 4XD5A 3KBNA 2PWVA 4US5D 3VIJA 4PTWA 3OVQA 4ZO8A 1WUEA 1YNQA 2AL2A 4MVAA 4BQ2A 5I3FA 3OG3A 2R8WA 1ITCA 3CXBA 3FVMA 4OECA 4LH8A 3LPPA 3FGCA 1QR7A 4LIIA 2C14A 3E6EA 1R9XA 1PCWA 3V36A 1U5VA 1W8SA 2YLAA 1JZ6A 4HU8A 3B0VC 1WCGA 1SMDA 2ZBTA 4LUSA 4ZXLA 1JOAA 2W3SA 3TDFA 2BDQA 4H4ZA 1BHGA 1TCMA 3QZAA 1PYFA 4NJHA 2YZRA 4PUNA 2GUYA 4S3DA 1FDYA 3LPFA 3SJ3A 3G3MA 2VZSA 1UWTA 4C6PA 2IKHA 5I09A 5JIWA 2JIWA 3MMWA 3SR7A 3W7NA 4CVUA 4E2DA 2ZZ5A 2H90A 4QGCA 3F2CA 3EKGA 2R9RA 1UD5A 4AIOA 1HVXA 4B5XA 2A85A 5FJOA 1OINA 3B9NA 3MMUA 2PLKA 3RM8A 4C90A 1VZWA 4AC1X 3BANA 4W7WA 3PPFA 1GVRA 5D33A 4AQLA 1TX2A 4UC5A 4KW2A 5I5RA 2ZICA 1VPXA 4LAZA 3CXOA 4Z2LA 3MO4A 3ES8A 2X7WA 2G96A 1W5PA 4PTMA 4F48A 4DZAA 2FB2A 1F5ZA 2NQJA 2PF0A 2V67A 1Z9AA 1TIWA 2VO5A 3DDMA 3QW3A 1P6WA 4AU0A 1PZ2A 1E73M 4I6VA 4N9DA 4F40A 3AXXA 4PCFA 4D8ZA 3AALA 3R2GA 4Z2KA 5FA5A 3WQGA 4LJ3A 2PGFA 3KM8A 2DZSA 4PB4A 2PBGA 1K7XA 3RJYA 3WBYA 2PI6A 3BURA 1JD7A 5DY2A 1QFEA 1XCFA 2X2YA 4S3EA 5AN7A 4P8VA 1TVNA 2ZWZA 1VRDA 3TFXA 4HZMA 3BL3A 4NHVA 3CQHA 1XSJA 4GY0A 3M64A 1KLZA 4H9YA 1UZDA 1UIPA 4EXAA 3NS1B 3M0MA 1AA1B 3E2QA 2EQ8A 3EYPA 3CWOX 4O52A 1XJBA 1JCJA 2FMNA 3TQPA 3H4KA 4JIRA 1SR9A 2UBPC 1W5QA 3QOMA 3UBPC 4B91A 2B31A 4P7OA 3M41A 1L9WA 1FDJA 4EVZA 3ARWA 4OHQA 3ZR5A 4Z1YA 2CLEA 3DERA 1OX6A 1TR9A 4HQVA 2IKGA 3VDGA 1ZGDA 4GQRA 5AHIA 1EJTC 3IIVA 2GOUA 1E70M 4EPEC 4DHGA 4ZFMA 1RCXB 3WNLA 1QK2A 1R3QA 3NQMA 5FAGA 4DM1A 5JBDA 1X1ZA 1P0NA 2C1IA 1BXNA 1ELSA 3VIKA 4GINA 2D1ZA 4GQGA 2HEJA 3UZJA 4MB5A 1MFVA 3VNIA 2CZ5A 3W2JA 1L8PA 3RPTA 5HBFA 3S5SA 3ZSSA 2VCBA 3QZ6A 5JH2A 2ZDSA 3MBFA 3LHTA 4E8GA 5E6ZA 5HPCA 4J3WA 2V30A 2VNCA 3TX9A 4YYFA 5MKGB 3MUZ1 1TTQA 2PWHA 4WSKA 3W83A 5DANA 2O9PA 4CN4A 4OZOA 2Z7KA 2A6LA 3LCXA 1O7AA 1TWWA 1W9XA 3NCOA 1GRFA 2ZXBA 3G1SA 5JVLA 3T55A 2Y7GA 3W7IA 3RPMA 3FYOA 1WAUA 2ACQA 3W72A 5HXMA 3AIUA 3DI1A 1RK5A 1A5AA 3W82A 1KWKA 5H2ZA 2WANA 3CZGA 3N34A 4U28A 5F2MA 5GJMA 2HNEA 2WLZA 1JZ4A 1DTNA 5XIAA 2QKFA 3QYQA 1XICA 1QBBA 1HL8A 1D9EA 4AD4A 1EP2A 1AW1A 3EBVA 3R13A 1M41A 3DOPA 4NRSA 1FWCC 4C6MA 3R7MA 3CTTA 4CN6A 5AYYA 3U8GA 2WQDA 3NQ7A 5F2GA 4J3UA 1E4MM 1FIQB 4E4PA 4A2SA 3NQVA 4NL1A 3QLDA 3L4XA 1BYBA 2OCZA 4IPNB 2YCLB 2OT0A 5IHSA 3K8MA 3QY7A 4W88A 1VCGA 3GX9A 1AQMA 1K8XA 1J6OA 4WDWA 1UD8A 3APYA 1MI3A 3CL6A 3LGEA 1B3WA 1OWQA 2QEZA 1BG9A 2WSPA 3I4KA 4Z0SA 2C13A 3VILA 2QV5A 2OFJA 4UFKA 2DT3A 4JNYA 3UWVA 4UMAA 4DJFD 4IQJA 4ZB2A 2X8GA 5MHBA 1BG4A 1NTHA 4DBSA 2ABAA 1BLIA 3W7GA 1Q6FA 1NWSA 4XD3A 3PUGA 2ZX8A 2WSRA 1QU4A 3ELFA 4B3KA 2E67A 1B57A 2QUVA 4CU8A 4KFOA 1EBDA 4PMXA 4PCSA 2OQHA 4NJJA 4CNOA 1QPQA 4C6DA 4IH3A 2FHBA 2WVSA 4NT0A 3VKCA 1J93A 3BICA 3IUDA 1XBZA 1ITXA 3IACA 1BVWA 3AZRA 2ZXQA 1GT8A 3VTRA 3G1DA 4I9TA 4JX4A 3OHIA 4YVPA 3VD5A 3PG8A 1WZMA 1LPFA 5GNXA 1E6SM 1YXDA 4ZODA 4C5YA 2WPEA 3N11A 2VUNA 5EMUA 3MHGA 4DO7A 1Q3NA 1UR1A 2XVNA 5XINA 2GVJA 1WDSA 4R88A 2E9BA 1YMYA 3DFTA 1GRAA 3GY1A 3KP0A 4ZQOA 4K7YA 2WKLA 5IFPA 5MKGA 1KCXA 1ZJHA 3QSTA 4TV6A 3W1XA 2XFFA 2R1NA 3IIOA 1DJZA 1UWUA 2B7NA 3TNBA 1P7TB 1K02A 2X41A 3SRFA 3H7VA 3KL0A 4HA4A 2WLYA 4HCDA 3OGVA 2OO6A 2PCEA 3U7VA 1J79A 2VYOA 3EGJA 1BF6A 5E1QA 4XD4A 3L7RA 4GK8A 1TYTA 2PPGA 1TWDA 3I10A 1PZ3A 3PBVA 3M5ZA 1IGWA 2FDMA 2YBUA 1KGUA 2ZFAA 5C2GA 3ARRA 3VOJA 4XAYA 5I00A 1JI1A 4RE0A 2I5GA 1W5MA 4JCMA 3VVGA 3MCNA 4IQDA 2QJMA 1C8QA 1RBLA 3NYDA 4LANA 1UUQA 4P7RA 1K7EA 3TR9A 3QPZA 4QDWA 1U1HA 4O13A 4F79A 4JKKA 4BQ3A 4YTTA 1DJIA 2YCLA 1JUEA 3VD3A 1XIHA 4LS0A 1EIXA 1TPVA 4AD1A 1H49A 1V6YA 1UKTA 5B7YA 1WBHA 1LM1A 2XJ7A 2IPWA 2ZX5A 3LN3A 3E0LA 1DP0A 1Z42A 4WDUA 4A22A 2G3FA 2W61A 1TTIA 1NDAA 3M16A 4D6JA 3AJ7A 4XZHA 2ZA2A 3GR7A 4HMEA 1Q1WA 4LCRA 1AMYA 3BJFA 5A6BD 1SFJA 4AWSA 3CV7A 1V6XA 2E6DA 1F8WA 5ABGA 3SQLA 5H8MA 1QO2A 1CB2A 1E5NA 3U3HA 4E6MA 2I7GA 3U0HA 2GR0A 3DYPA 5BU9A 1R30A 1TE1A 3ABRA 3N3MA 1HUVA 4BFAA 1CENA 1EPXA 1SSGA 3UJ2A 4KEZA 1C8VA 4O0ZA 3EAUA 3OPSA 1J0IA 5I3HA 2EQ9A 3WLMA 4O53A 1GQNA 3LBOA 2X1IA 1YE4A 1YBQB 4FOKA 1KKRA 1W9BM 1NDVA 4O12A 1CW2A 3U2EA 1PAMA 4B16A 2DVUA 5FF4A 5FS7A 3W85A 3UWEA 4H41A 3VGGA 1T96A 3W27A 2WKGA 4JEJA 2ZRUA 4FF5A 3OLGA 1V0KA 3W6MA 3LV5A 2DT1A 1LUCB 2Z29A 5C9ZA 3RYSA 2D2GA 1G0CA 3AHZA 1VFTA 3NQFA 3ZT7A 2RFGA 4DRSA 4UMBA 4J3TA 4QE1A 3W73A 1QDSA 1YX1A 3PZOA 3W71A 3WYZA 4MAZA 1P7TA 4E38A 3VAVA 5AHMA 4DNMA 1VKFA 3TCEA 3TTEA 4UNLA 3ZOAA 2IUZA 3IGSA 1X2HA 3URQA 1JUBA 1OD0A 1E71M 3LHWA 5EFFA 3VFLA 3JRKA 4J35A 4C6EA 5LIYX 2ONEA 4WJEA 2ZA1A 4TTUA 2DH2A 3QEZA 5HATA 1RCQA 3W22A 2BC0A 1Q66A 2BZNA 4CD4A 1DQXA 4J3ZA 3QXBA 2V2HA 1JULA 3NVYB 5AZ0A 3K4WA 3OQEA 4QG9A 3LZ3A 4S3FA 5DXXA 4UR8A 1A80A 1HX0A 1QNVA 1VP5A 3F4VA 4Z0JA 4Q4QA 4GXPA 3GXPA 3GDLA 1IXOA 1MO0A 4PBEA 3L0KA 5TQLA 4YL2A 4RNJA 3LCHA 3U5YA 3VX1A 4GFSA 4YIWA 4GQQA 2OOFA 1E0VA 3NOYA 4IXHA 3H4WA 3LA4A 4PCNA 2H3BA 4ZOAA 2JE8A 1GKRA 4ADTA 1QWKA 1DV7A 3PFRA 3SURA 2PE4A 2XH7A 4D9PA 3O06A 1J5SA 4PUKA 3E1F1 2PZNA 1EXPA 3W87A 4LRSA 3H23A 1V02E 2BP1A 3DFNA 1K9EA 3NDOA 3LHYA 3NSXA 2XVKA 2Y0FA 3KVMA 2WMJA 3GG1A 4RW5A 2V8ZA 3EA3A 1EX5A 4MWAC 4GVIA 1K3UA 3AMCA 3MS8A 4N4QA 1MXDA 4E3VA 1ZJBA 4YU1A 3MT1A 4O10A 5CZ0A 4JFTA 3STGA 1UKQA 4TVWA 3CYVA 1IIHA 4IFKB 1VH7A 5CBJA 4P8XA 3WLHA 1ZMDA 1M04A 1ISVA 3PBMA 5LXXA 2DQXA 4G9PA 3PNZA 1KXTA 1AG1O 3NA8A 4X61A 4LAKA 3NG3A 1YBQA 2J77A 3NQDA 4ZO9A 2ZRVA 4RKAA 2JF6A 4HA1A 4MNLA 4DLMA 5T9CE 5A8MA 1BD0A 2ZRXA 1PZ0A 3KOYA 2XN0A 3MSGA 2OEMA 1E6QM 3CB3A 3VC5A 5HANA 4H9TA 1LUCA 3LBMA 1K77A 1F3EA 4DQWA 4AIUA 2BY0A 4GD0A 4J56A 1AVAA 5GJNA 3PZGA 3UNDA 3I6TA 4X63A 1KWGA 5A95A 1GEUA 3TP4A 3A13A 4ACZB 4WEVX 1VLIA 3BOXA 4OFCA 1DXEA 4RUBA 2VEMA 4GXMA 4QRNA 4U33A 5A3HA 2R24A 3KAOA 4PZVA 4FNQA 1RVGA 4LYQA 2CETA 4DJDD 2VZTA 4EQRA 1R3YA 3ONBA 3OB8A 3NDZA 5JCLA 4Q22A 3MVTA 1L6YA 2DDXA 3P7YA 3E74A 1FWGC 2PP0A 4GO9A 3TC7A 4R7WA 2QW5A 5AC4A 1ISZA 2FTPA 3B9AA 1HJWA 3LRLA 1NOUA 2J6XA 3G1AA 5CAKA 3L67A 1FHDA 1M1BA 4V2XA 2WM1A 3IAQA 1AJ0A 3W7OA 3W7PA 5H8UA 2QR6A 3K13A 3QYSA 2F84A 2NUYA 3TA9A 4QIUA 4K37A 5C55A 3HU7A 3M0JA 1JXJA 2V3AA 3ZJ7A 4LOCA 3GHRA 4A05A 3T0AA 2YOCA 3EEZA 1J4EA 1E3ZA 4ILSA 1EA9C 4KEMA 5DMNA 2BV9A 4HZ8A 3WSUA 1H7XA 4LS1A 3KUMA 3NURA 3ITVA 1RJPA 3TAKA 1OFRA 3TYCA 3UPBA 4ADUA 3SN1A 9XIMA 2H8ZA 3B0PA 4PBFA 1VFMA 1FWJC 2QUUA 3AS3A 4ZBCA 1YDYA 1OEPA 2PU1A 1ZRQA 1JDEA 1I1WA 2ZYFA 1BVNP 4L6OA 1RY8A 2PD9A 1W1B1 2QCFA 1GJWA 4O50A 5TNVA 4JGDA 3B8WA 1XD0A 5K3VA 2GOKA 4D1IA 1H50A 3HG3A 4NZ3A 1TB3A 4IFKA 1W1YA 4BZYA 3A9BA 3FX4A 4PUWA 3SIMA 4MGGA 1LG2A 4MKVA 5A6LA 1YPXA 4JDYA 1EZ2A 4Z1CA 2F9RA 5U4NA 3OEXA 1ZPTA 3HGSA 1H11A 2W3ZA 4DF1A 3VKBA 1VDVA 4JFUA 4DUOA 3GZ3A 2V6AA 1EEXA 2CHOA 4FR6A 2E7FA 3IGXA 3KBMA 3AICA 4FEZA 1MDLA 1SZNA 5HINA 3M44A 2ACUA 5AY7A 4UOJA 2GDQA 3O07A 3KVLA 5M5DA 4TR9A 1I0BA 1ADOA 2R14A 4ZGYA 1VEMA 2UY3A 3GVWA 4JPGA 3M4HA 1TR1A 2OELA 2Z1VA 2FFCA 3NZPA 1RAKA 2V5KA 3CHFA 5A8QA 1BGGA 3T4WA 1UH2A 5F4WA 3KZPA 4K1WA 3ZM8A 4E8DA 1A0EA 3F4DA 1KRBC 1RQEA 3E49A 3W7DA 1NDYA 2D73A 3C86A 3H4XA 4J4KA 4LV4A 4JTFA 1KN0A 1JFXA 2ZTJA 2W91A 2X1SA 1L0PA 2YYUA 2QDEA 5BWAA 5K2ZA 3IJIA 1TWIA 3EA1A 3ZO9A 2DSVA 6ENLA 5D37A 2O7SA 5BXSA 3FHAA 2IS7A 1VCVA 3SW6A 3KTSA 2ESCA 3VGEA 1FKXA 5I24A 2PA6A 3B97A 1FH8A 4Q33A 1F61A 2E28A 1T41A 3W2KA 4JS3A 3I7QA 3IEBA 1Z69A 1VENA 1FTXA 1R7AA 2VENA 5T9BG 2C7FA 1Z7AA 3LBCA 3O6CA 5C71A 3N17A 4L64A 1Q6CA 2ZRYA 3F2BA 2J8TA 1F05A 3SZ8A 2YDSA 4MIMA 4PGLA 4LVFA 2V69A 1AK5A 2WNWA 3NUKA 2INFA 4QLLA 3RF9A 2E3ZA 1TPEA 1N8WA 4CD8A 3OW1A 2JALA 3O6DA 2QCLA 1KCLA 3AYVA 1XIGA 1GJPA 3PBUA 3GC5A 2OVLA 4FA3A 4ZOCA 3BSHA 3QFEA 3W2NA 2PFHA 3SUWA 3T0TA 1TWSA 5DFAA 2NLIA 2OJPA 1DVJA 2RHGA 4M56A 1VIZA 4W87A 4JL2A 4IX0A 5HNNA 3MSRA 4GRSA 2A1YA 1ICPA 2WZMA 5A69A 2PDKA 3N9RA 4L1WA 1B54A 3KDOA 2L5HA 3P2VA 2BG5A 3GC4A 2MNRA 1XH0A 2P3ZA 1EUAA 4O1EA 3BW4A 1WDWA 2Y63A 4C7GA 1VLWA 3QR0A 2CLFA 1CTNA 2OT1A 4KRZA 4QEEA 3LSCA 3HMJG 4O18A 5FF2A 1CPUA 1GJUA 1EWEA 3VZXA 4ATLA 3O05A 4FNPA 2IPFA 2PUZA 2GUBA 2Q09A 3A7RA 1XLBA 2CBVA 4LF1A 3TTQA 1F8IA 4LAOA 3EB2A 4H19A 1QI0A 3P14A 1SFLA 4O54A 4M7TA 3S9IA 3CLWA 1GQKA 3MV11 1G4PA 5A2AA 3AC0A 3ITOA 1EBGA 3SGUA 1VS1A 2CKSA 8TIMA 4F66A 4FLSA 1QOPA 3CUXA 2QCDA 2PDFA 3SQMA 4I3GA 4I5XA 5D2WA 4HA3A 1CDGA 1V4YA 3FCPA 1UWSA 3EEGA 3PTQA 3CUJA 3EWXA 2WJZA 3VIMA 2EG7A 2JF7A 3LY0A 2EPHA 1RALA 2E77A 1POKA 4OU1A 3V5CA 1NOFA 4Q7BA 4JBRA 2GDVA 2BHZA 3PAOA 4HVXA 4HNOA 3IVSA 1XF0A 2HXTA 1A3WA 1GW1A 2X0SA 3PBWA 3EX4A 2FHFA 1D3GA 2VC9A 3IJQA 4L9ZA 1TPC1 3LERA 1VC4A 4DNHA 1L6GA 1NPXA 4H4RA 4K8HA 4MSSA 2DQWA 5KETA 3G1VA 5I07A 1Q6GA 5C54A 4H50A 2XZ9A 1M7XA 4OJYA 4DUVA 2CFFA 2AQOA 4QG8A 2EQDA 2WMHA 4H4TA 4PUEA 1MDRA 3WQFA 1MUWA 4RX0A 2QCMA 3UXAA 1OD8A 3NQ6A 4HOWA 3H21A 4F2TA 2FZDA 4M7SA 3P8IA 1HGWA 5CC3A 2VDHA 1ZCOA 4J7RA 1QNQA 4KT2A 4P2VA 2VX6A 3TYEA 4GUIA 5DELA 3CIVA 1FWNA 3PHAA 1YXCA 5G4HC 3H4GA 3G22A 2OB3A 4Z1DA 5A1AA 2YX0A 2GQ3A 4XZNX 4BURA 4WIWA 3I68A 1P1MA 3NZ1A 3W7CA 1ZBKA 2XSAA 1H09A 5IM51 4AMCA 3LMYA 3G8RA 2VR5A 2BHYA 4PL2A 2G4FA 4W8LA 3URAA 3WBEA 4O8AA 4NNBA 2VWSA 1OFQA 4JAWA 3VDCA 1GERA 4AEEA 3R0DA 3DG7A 2CZEA 1HQTA 4LVBA 2ZUMA 4M19A 3GIQA 3S5ZA 5HNRA 5BWFA 4PCTA 3KDNA 1VCFA 3TYZA 4QDPA 4D1JA 1JPMA 1WDDA 4JFVA 1JCMP 3HGRA 4MAVA 1GPWA 5G4WA 4M6UA 4MWAB 2WJEA 4WKAA 1LWJA 2YFNA 1N61C 3UCCA 3TYBA 1KXQA 2GJLA 2AAAA 1F3WA 4XZ9A 2E09A 3ZIZA 4LAUA 3SFWA 1IEQA 1GVSA 1WXYA 2BVYA 3N29A 4MB1A 5T8GA 3TSDA 1U30A 2VDIA 3L65A 1CXIA 5JXQA 2EQ6A 3HPXA 4ERAA 4C5ZA 4F9JA 1GZGA 5LNSA 1GVFA 1O95A 1V7YA 1OF8A 1WNOA 2CXGA 2JEQA 2J74A 2ODOA 4RLIA 3E2VA 3H26A 1OJXA 1ENUA 1G1YA 2ACSA 3GH7A 1V6VA 2JGQA 1OIMA 5IRPA 2AOSA 3QFAA 5C5YA 1CWYA 5A2CA 3PBGA 1LLWA 3HFTA 4NZ1A 5F1UA 2NV9A 3SI9A 5CG7A 2HV5A 2EPLX 1US2A 2IKJA 1YE6A 1EJXC 4HNUA 3TZFA 4QR6A 7PTDA 1FQ0A 3KW3A 3M7SA 1AQHA 5LIKX 3EOUA 3VA8A 4J5NA 1OZQA 1W1VA 3TROA 5FL0A 1F9CA 1FWBC 1HW6A 1SO3A 2FVMA 3FDGA 3GXTA 1TKKA 1UR8A 1DWHM 1SYTA 1V3IA 3C6CA 4AZ5A 3PZTA 4R85A 5BXPA 4PCPA 1BF2A 4G1NA 3VOHA 3WNMA 4HCLA 3CZJA 5JIPA 4ORMA 1MEHA 3WCZA 3GG7A 2OSYA 1PVNA 1UD2A 1HKJA 2WO5A 5F7UA 2VFHA 3C5QA 3S42A 3FDKA 1B0IA 1H5YA 3WQWA 5HR7A 3WKZA 2A3EA 2VZOA 4GACA 3WK1A 4UFJA 1E6RA 3AYSA 3F5JA 2NX1A 1V3LA 3QVQA 2CLHA 1P4CA 3TMLA 1NHSA 1W9DM 2VURA 1V0NA 4NJIA 4L6DA 2RDUA 3VMOA 3CYJA 3NFUA 5I79A 5C2XA 2WBKA 1BXCA 3M5YA 2A5HA 1ZTVA 2XH4A 3MUCA 3VD7A 1R47A 1QNOA 3LTPA 5CXPA 5KEZA 3A3XA 2CFYA 5CKSA 3IAPA 2KZHA 5TD4A 3H12A 3OU8A 5I02A 4QTGA 3KEHA 4HPHA 1E9LA 3AOFA 2TRSA 1T0OA 1HN1A 4MKSA 1S1RA 1XQKA 4NAFB 2Y5JA 1EC8A 3VUSA 3HV9A 2V68A 2C19A 3LD5A 4K8GA 2ATSA 2WHLA 4MWAA 5CAHA 4ACYA 1N63C 4WHBA 3B9OA 7XIMA 3GFZA 4Y90A 4FXFA 4HK6A 4NUWA 3DFOA 5CPOA 3NNTA 1CXHA 2CITA 2XISA 5FS8A 4Y96A 2DZWA 2GVLA 2YA0A 5EBKA 4A3RA 2CC0A 2BY3A 4PUUA 1L6FA 3TSBA 5LA0A 2A7PA 1BWLA 2OGJA 4H4YA 2Z1BA 3LB8A 4QCEA 2PLJA 4JN7A 5JCNA 3BC9A 3LGGA 4WKFA 3LGDA 3N3TA 1EHNA 4F8XA 3AMGA 3L68A 3N18A 1OG0A 1WPCA 2YXGA 3NO1A 3R10A 1V7AA 2GJRA 1AD4A 3KWSA 1B30A 1RP9A 4L80A 3V5FA 4L65A 1JPHA 2GRTA 3GFXA 4DM2A 1DWJM 4JTLA 1JRCA 1VEPA 3QHOA 1GRHA 3VOIA 4WY0F 1MW1A 4LGXA 3WIJA 2RGLA 1CGUA 1GGOA 4LYPA 3WQ4A 2G37A 4H4QA 2ZC8A 3B8UA 4FAMA 2ZZ6A 4QM1A 3JZEA 3Q65A 4RPPA 1SW3A 4TVCA 2XFYA 3UGRA 1F4HA 1V6TA 5EMMA 3DX5A 1KTCA 4XWUA 3ZS4A 3NXFA 4AH7A 4YVVA 2OLAA 3L0NA 4F0SA 4C6CA 1RQHA 4RDWA 3GRSA 3R4IA 1RBAA 2UY2A 2CHRA 3VD4A 1V77A 1R7OA 4NI3A 1EF3A 1H1YA 5F2IA 3GYEA 1QATA 2HE8A 3BPWA 4ZEPA 4HSOA 2V3BA 3AIWA 3GSMA 1ZALA 2JKAA 4KPLA 5HJXA 5HMEA 3T08A 5I2UA 1IHIA 5FKYA 2D22A 2YVJA 1ESWA 3MKCA 5G2WA 4ZTXA 2WC4A 4JQ3A 1ZY9A 4ICNA 3F2DA 4KCUA 3WJXA 4J3VA 1UWAA 3M46A 4KWVA 2H9AA 2EJAA 3DK4A 5IBXC 4QLKA 2E9LA 4Q8TA 4IT1A 1XANA 1PKNA 5I77A 1WDQA 1LTDA 1KB3A 3MC5A 1XRVA 3N12A 2O0TA 4GPNA 4NAFA 1Y5VA 4JHMA 5IDZA 5IHRA 3W01A 3QM3A 3DYMA 1OBAA 1LT7A 3LQLA 1E4IA 2DZXA 1WUFA 3CPUA 2DEPA 2V5CA 2VFIA 2R1KA 2DSKA 1FY6A 2OSWA 1H1NA 4YTQA 3GXDA 4UTLA 1S3HA 3NM3A 1D7FA 4DYKA 4UFHA 3BLIA 3RCNA 4AZ7A 3CGTA 1K03A 3NGFA 2WPGA 4TX9A 1CXFA 2C15A 2B7PA 1BKHA 1FCVA 3GIPA 3UXDA 1FRBA 4HK7A 3L2IA 5FESA 4W5ZA 2VVNA 3ZMRA 3MV01 2Z1SA 3W84A 2V9DA 3AMKA 4HNCA 4O1DA 1EJWC 2NX3A 3ITYA 3CO8A 2J62A 4MY1A 1DYSA 3TK7A 2V2DA 5JCIA 1J9YA 4D8LA 4K1GA 3HA1A 5FEZA 2WKJA 2C3ZA 1V3KA 1B2YA 2BLEA 2OYKA 2P50A 4LV9A 3B8SA 2W54A 3S6OA 2PRMA 1C9WA 1E9ZB 2YL5A 3DGZA 4FOJA 5JBEA 2RAGA 3EANA 1MSSA 3EWDA 5EY5A 1R3WA 1VJSA 2G5WA 1YQZA 4S1FA 4U5KA 2HISA 3WEOA 1V3HA 2Q6ZA 3ARYA 4D6DA 1WP6A 4L56A 3JR2A 2EKCA 3SCOA 4QROA 2J8FA 4EP8C 2NSXA 3TFCA 5BRPA 1E0WA 3SADA 1JDAA 3BMXA 5FIPA 4UTKA 1JZ5A 4M1RA 4WD0A 3N2OA 1T40A 3FY1A 2NT0A 3P74A 3AWOA 3SCQA 3UY7A 2X40A 3NSNA 3GHUA 4FSAA 3DFYA 1XDJA 1TV4A 1YRRA 5A8PA 1FOBA 4KIEA 5ABFA 4NG3A 2BOGX 1LG1A 1WKEA 3UFYA 3MO7A 4GNKB 4WSJA 2FQIA 3WMSA 1TPH1 3UG3A 3DHFA 4JX5A 1AL8A 2I1OA 1U5HA 2HPIA 5CSSA 2Z24A 1XWYA 3S1UA 3JU2A 1PCKA 3S6DA 3B0UX 3CZLA 2WB5A 4XVEA 1DJXA 1BYDA 1TZ7A 4BK9A 1OB0A 4OUIA 3QMRA 3THAA 3AXIA 3RNMA 4O15A 3A4WA 1A5KC 3VDAA 1S2TA 1IZCA 4G56A 4QS5A 3UW6A 1ZBWA 2Q8XA 5EMJA 3RU6A 3FIGA 2E6AA 4NZ5A 1R38A 1XFCA 3NTYA 3O9NA 4J2MA 3ARSA 1VRXA 3S5OA 1W3JA 2PDNA 1LQ0A 3NVTA 4AHPA 1RHCA 4E0CA 4MJ2A 4DJFA 2I17A 4I5RA 3AIRA 4EPBC 4EWND 3GU9A 3WUBA 1VBGA 1TJ0A 3GVGA 2BVTA 1EYEA 3IARA 3CHEA 4H8VA 1FFRA 2V63A 4QNWA 2Y88A 5DBTA 1Q4WA 2PZ0A 8XIMA 3PJUA 2VGBA 7ODCA 4H9VA 3UESA 4BWLC 5E0FA 5D9NA 1W0MA 5EFDA 5AOUA 1TV2A 1KNWA 1XPYA 1N5WC 4PMJA 5EKYA 2ZTKA 4V1YA 3APTA 2CEQA 2OKOA 4AVNA 2VCCA 1OFEA 3G5EA 1JPKA 2PTZA 4LALA 1ZAJA 1JAEA 4KWSA 5A8NA 3PN8A 2X09A 3ABXA 3RUBL 4R9XA 2DT0A 1EFZA 4JL1A 2X05A 1XYZA 3FA4A 3W1PA 2DPEA 4CEUC 1RVKA 3UWQA 1Q85A 3MA8A 1GRTA 4LCSA 1NM9A 3EX6A 4REQB 4Y8EA 5CC6A 4Q3MA 3HM7A 1T8XA 1XYLA 3KCJA 1PHWA 4GQBA 3RJXA 1RP8A 4AF0B 3W7RA 2FB3A 3V4BA 3SQPA 1GYMA 5I3DA 4WF7A 3FVDA 3A7AA 1QHOA 4UQBA 5I0DA 3O1NA 1OX4B 1P0DA 5I78A 4HPXA 4UUIA 3F5LA 2HBXA 4GE8A 4LX4A 4Y7EA 3UCQA 1GWJA 1XR2A 2O7QA 4ML4A 4PRTA 4PUMA 3AN1A 1XI3A 2DSZA 5ABEA 4KPRA 4ZCWA 3IANA 3CHCA 4AFYA 3T0DA 4HJWA 4JTKA 3GTIA 3ZVHA 4HN4A 1WB0A 3VIGA 3EMCA 3SCTA 3GXMA 3AAMA 1J96A 4A3YA 1EJUC 3RR1A 1TJ2A 1AW5A 4L9YA 2A2IA 2Q8LA 2WMIB 1SJAA 4UR9A 2FZ8A 1CXLA 4JIIX 2Y5EA 1R3TA 2BXYA 3CC1A 4JDBA 3BAIA 4J9JA 4X3ZA 1G01A 4WY0B 4MJZA 2PC8A 4E8CA 1A4MA 2A0NA 3VKAA 5JRBA 3A47A 3LM7A 3RITA 1E6ZA 4QXIA 5CC5A 1OG6A 2BGSA 3MU7A 3WLJA 1SW0A 4UB9A 4RNHA 5D03A 5D2YA 5DMLA 4CD5A 3PANA 4M5PA 4L61A 2PDPA 3R5EA 2QPXA 1H2JA 3MZNA 3ETRB 1XX1A 2QCGA 5D2TA 3P3BA 2DSUA 1TPUA 1XD1A 2V81A 4P7NA 4ZTYA 2PCQA 3UG5A 1JYNA 3R8GA 1UWIA 4MDPA 1JEZA 3WMCA 4CNTA 4MLJA 1W32A 3C2YA 3VZYA 2VR2A 4Q4MA 4UZSA 5JCMA 2WPCA 3B0YA 3TOYA 1FEAA 4LEQA 4KRTA 4LVDA 5FSDC 5D9MA 3HPSA 2ADAA 1NWRA 2QF8A 3OGSA 3CS2A 4REQA 3QHNA 3PZVA 3GE7A 1CXEA 1OYBA 1TV7A 1Z3NA 3GRIA 3SJNA 1ZQ5A 4I8YA 1VHNA 3PPHA 1A5SA 4IMAA 5T26A 4AF0A 3GIYA 1N5XA 2Z7GA 3E12A 3B9JB 1W6TA 4IGSA 3W2LA 1YADA 3EPMA 2HXUA 4W93A 4CCZA 1EO7A 1PX3A 2ZZ3A 1VFSA 1L8NA 2DZTA 3MHFA 1WAWA 4XZWA 1W1ZA 5BCAA 2ZC1A 3USBA 5D9PA 5F4XA 4UTFA 1S5MA 1G94A 2YA1A 2YL9A 3PK7A 5DX7A 1O68A 1NWTA 2J66A 3EPNA 3H2CA 4RNIA 3TZNA 1M5WA 3ZR4A 3HQ1A 2R6OA 5KZMA 3QTGA 4TU1A 1PTDA 3NQAA 1A5BA 1ZFJA 4QSFA 1G7VA 2VUYA 3M7WA 5J8LA 4JYDA 2P8BA 4JTIA 2YSWA 3FXYA 2XINA 5BYWA 3Q37A 3CPRA 4EK7A 2P5NA 2XIIA 2VEIA 5DCBA 1UR4A 3SN4A 3KRSA 1IYXA 5D4YA 1Z6KA 4WCJA 1TMHA 5CLTA 3ME3A 5CQ1A 2PDQA 4V33A 3GUGA 1AJ2A 1TYGA 1GW9A 3MZ2A 2JKPA 1XIMA 2PRLA 4JN6A 1NHQA 5FJPA 2WSQA 4HYVA 3CB8A 3TR2A 3WUGA 5EU9A 2P10A 2WOVA 5FMHA 3BSGA 3L4TA 1SJBA 4WY0A 5HULA 3SM0A 3GXNA 4D6EA 4MY9A 3EAOA 5CH9A 1CT5A 3ZWSA 1B9BA 4MPKA 2Y8VA 1JPIA 4N2YA 4IXXA 1SVDA 4QS6A 1R3VA 2PMQA 3WQVA 1XIJA 5HWMA 1ITUA 1F2JA 4KH2A 4AX6A 4HNVA 4F2BA 1JR1A 4U2ZA 4HSHA 1H3GA 3NM1A 3DBPA 3G3DA 1AQFA 1LBLA 1ZZMA 5DMMA 1XYCA 2NVCA 3QMTA 2OPJA 3COTA 1KM6A 3D46A 4CKQA 3LCLA 4LT9A 3GTHA 1CECA 3WNNA 2GR1A 1PJ9A 3H2FA 3WDQA 3QMSA 3L5OA 5A8OA 1RY0A 2EGZA 1K6WA 4QEHA 3IJ7A 3TIMA 4S3AA 4FXRA 3AHVA 1THFD 1W1PA 3LI1A 2GK1B 3RLHA 1ZK7A 3MYOA 1IT7A 1HF6A 3BLPX 3BAXA 4QQUA 4N02A 4EAYA 4J40A 1G4TA 6ALDA 1XLIA 1EO5A 2X50A 1ZKQA 2V6OA 2OTDA 3L12A 1N62C 2RGMA 3WUFA 4WSHA 2F2HA 5C9UA 1DJNA 4NEWA 1IEIA 2NUXA 2GUUA 4JXCA 3VCRA 4QLJA 3R11A 3BG3A 1M6JA 1SM9A 4HNNA 3HFYA 4QCFA 4BI6A 1XLKA 1B5TA 1IE7C 4S23A 3OBEA 4UTUA 4BJHA 4PRRA 3CHDA 2ZOXA 3W0KA 2GGJA 4EIVA 2E25A 3FA3A 4H4VA 4PB5A 3MCMA 3QPEA 2POTA 3KXQA 2I5IA 3KBVA 2OZTA 4XBJA 3V5OA 3L4ZA 2E8ZA 1DJGA 1JAKA 4WDXA 5LIXX 2TYSA 3EX3A 3F1QA 3THDA 5LA1A 3RN6A 1GRGA 1SZFA 1JCLA 2QCEA 4M0XA 2QCCA 2QAEA 4AAJA 1XCWA 3IK2A 2XU2A 2YBVA 3C56A 4MKNA 1NWUA 2R1PA 5C7HA 1BKSA 3N6QA 1WA3A 2C71A 4NEVA 4NQ1A 2GFTA 5EMKA 2YYTA 4GYKA 2ANUA 4FLOA 5I6SA 2QV4A 2NW0A 5B80A 1A5LC 3LOTA 4O1BA 3WJZA 3H7RA 3GKAA 4ZQNA 1W3LA 4QE5A 4OUEA 8A3HA 4B5UA 1UR9A 2NQZA 2CBJA 4DPQA 2I14A 1UR2A 3KZSA 4LXFA 3V0TA 2VOTA 3TW6A 3N2XA 1VBUA 4FLRA 4K3ZA 1YDVA 8XIAA 4AY8A 4EWJA 2HSAA 4O28A 6A3HA 1DTUA 1J18A 3L0GA 3R58A 3NAVA 5AYZA 3SIZA 4XV0A 3W7JA 5G5GB 3W1RA 1X6UA 3DYOA 5IBXA 4PL1A 1CZ1A 2NX9A 4A8RA 3AWNA 4V27A 3PSWA 2FH6A 4PTNA 3AIBA 3UR2A 4CNPA 1DQUA 3SUTA 2PLMA 1I6NA 3DC0A 4IMDA 1D7KA 1JDFA 1Q45A 4UCGA 4HP5A 3WH7A 1J0JA 2YLLA 4B4HA 3W7QA 3EDJA 4ZSTA 1P43A 1DXFA 2EG6A 3VOGA 3PR2A 1JZ2A 3M43A 4XZLX 2XGZA 5G5IA 3VINA 1ZU8A 3WLRA 4BQ5A 1SUXA 3PULA 1JQVA 3P0XA 2JK2A 2XIMA 5FJIA 2W5FA 3O7UA 4DJED 4JHZA 6CGTA 4O19A 2VOMA 2GWGA 4LBUA 5HOSA 1GCYA 2X30A 3TJXA 3IUIA 2YVFA 1A50A 3VUPA 2QMJA 2O92A 3B3DA 3B8VA 3T8QA 1OGSA 4NKCA 5C7VA 3P62A 3GU1A 3FS2A 1ZXIC 2D3NA 3W00A 4E2BA 3V7PA 1QO5A 2ZZ0A 4FZIA 3I3EA 3NEVA 3V75A 4OE7A 1YPIA 3AXHA 5CGTA 7ENLA 3QN3A 3BW3A 2BOFX 4EACA 4IPLA 4C1KA 1ZP3A 3LCIA 1UWQA 2XZ7A 4YN5A 1JYWA 2A4AA 5A6JA 5C6MA 4WOQA 5C2CA 3TMQA 4XBSA 2RDWA 3R0UA 3WFAA 2CZFA 4GUJA 3KX6A 5TAOA 3UT0A 3DGBA 3EZ4A 1PEZA 1NH6A 1PUDA 3H2MA 2V0TA 1C8YA 1DKWA 4ML9A 1GOQA 2CZVA 3TN6A 1K9DA 1Z48A 3WN6A 4AZCB 1IR2A 5ER0A 1TPWA 2Y7EA 1FCBA 1Q6EA 3CWNA 1G67A 1MYRA 1K4GA 2ZE3A 5KZDA 3NO3A 4IJRA 1OCQA 2CZDA 5D05A 4HHLA 4GIAA 2WYSA 4UXDA 2NQ5A 3M6YA 1XRTA 2E4TA 3FJNA 2A3BA 3TLLA 3KLLA 2PTDA 4XVDA 4G1KA 5BOOA 4U3CA 4GHRA 2CNCA 3DI0A 1QI2A 2HROA 2ZX7A 7TAAA 5CZJA 3A64A 2ZRZA 4S3JA 4PYSA 4AY1A 4UZUA 1NU5A 1E15A 4HPNA 4HTBA 3PUDA 1OGBA 2IQDA 1E51A 1UH3A 1F6KA 2YR1A 4IGMA 2GSJA 3W1UA 3WMBA 4YYCA 1XLDA 4IP4A 1CGYA 3UJRA 3LCWA 1TUXA 2FH8A 4IMGA 4IIEA 4D72A 2V3EA 3L4WA 1EKOA 3FFSA 1H0GA 3UZ5A 3SGGA 2Z25A 4JYEA 4B5NA 3M07A 4H4WA 4KERA 5AKQA 3C3UA 1MMFA 2HDJA 2MANA 2G3MA 2VRKA 2WNNA 1GZJA 1ZX9A 4HOXA 1OC5A 1POJA 5HMFA 3LZ5A 3QQ1A 5U25A 4PMRA 4B9ZA 5TR3A 2JGYA 4K36A 4XSMA 3UZYA 1GKQA 1TREA 4JTCA 1KO0A 3NPXA 1JRPA 4CQ8A 1W3TA 4BWLA 4NXSA 5A6AA 4U2YA 3QSRA 3TTSA 5CCZA 4ZZ9A 1HKIA 4NAEB 4YCOA 4KFNA 1A3XA 3W2UA 1W37A 4LA1A 3E0WA 5A5WA 3AXMA 3GRTA 4UFIA 1RQBA 1CNVA 2WP6A 2J8GA 5I3IA 4Z2JA 1SPQA 4UNIA 3HJEA 4F0LA 1GHRA 2XN2A 2YW4A 1WO2A 3U7BA 3V35A 3IV8A 3GDKA 4WGXA 2WMKA 2WZTA 2OEJA 5FF0A 3VK5A 3W24A 1EDTA 2NXGA 1GYNA 2FJKA 1LBMA 4KCWA 4DPPA 3LXDA 5I3GA 3CV2A 1OFAA 4RZ6A 2RDXA 3R1ZA 1S2VA 1KCKA 3L4UA 5LHEA 5AHFA 5EL1A 2CLPA 4AZCA 3DU0A 1XGZA 2PDHA 1ISWA 1O94A 4TOQA 4HHMA 4DBEA 1LP6A 4PH6A 1CLXA 2A7RA 1UH4A 4PMQA 3AMLA 4PMZA 2PBOA 3BQ5A 2WCAA 3BJTA 2J9YA 3SY8A 3KL5A 4JTQA 3A21A 1DXLA 3CMJA 4POCA 1EUNA 2P76A 2BVDA 1QPOA 4MZYA 1MZHA 3XISA 1FP9A 1YYAA 3BV7A 3MKKA 2WSKA 5ABHA 1MW0A 1XH2A 3LQGA 3IJ8A 4XUGA 3M0YA 2IXVA 1PHQA 3EXTA 2E1DA 5CZTA 3RCYA 2E6FA 2GLKA 4ZVJA 4CCCA 1E0UA 3TH6A 2NZLA 3S1VA 1FO4A 4Z42C 1M7JA 1QNSA 4L4OA 3IIPA 5A6KA 3OLDA 1QPNA 1PIIA 1LZOA 3EOEA 1PO9A 2FJUB 3OZMA 3IWPA 2WSYA 3SCVA 1I2OA 3TQ0A 3PWIA 5DRCA 1FWTA 5M17A 4GKTA 1V6UA 2PWUA 1I2RA 5FAJA 3LXAA 2HZGA 3LXBA 3CGBA 2GVEA 3FEMA 5C8BB 1S2AA 1UPMB 3UZZA 5CZKA 3VM5A 2QPSA 1QW7A 2WC7A 4R9OA 2VM8A 3ERPA 3EOSA 4NJKA 1E9YB 1X1NA 2WK2A 4TXEA 3KLKA 2NQLA 2WM0A 4H7ZA 3VCCA 2BGNE 4GI8A 4S3BA 2FPVA 1ICSA 4XZIA 2ZXAA 4JQ4A 4MM1A 2DIJA 1PB0A 2QVNA 3ZR6A 4AEOA 1ADDA 4TVUA 3TJLA 5AC7A 3II4A 5G1YA 3TQKA 3WLQA 4UQCA 1UBSA 4NY2A 5AB3A 4NAEA 1E40A 1W3NA 1XLCA 3LV6A 2YL8A 3ZFHA 4B90A 1B4KA 3SUVA 3UEQA 3MI2A 2W6RA 1FH7A 1XQLA 3NQBA 1BRLB 1Y5WA 2J9ZA 4X2PA 3CMFA 2QJIA 4TV5A 2AMGA 4N6FA 3UY8A 3ID7A 2B0MA 3PP7A 1K1DA 4MWAE 1LL7A 4WDTA 4FB7A 3F03K 1ZLPA 4YWIA 1ISYA 4P8WA 3E5BA 4ZENA 2GJPA 2DVXA 1XKYA 4E4UA 1EBHA 4RPQA 1DQWA 3UG8A 4CUCA 4AISA 3UF9A 5M2FX 4KQNA 1NOWA 2V5JA 1TPDA 5H8PA 1KC7A 2W27A 1DWIM 2CLOA 3PNUA 1J12A 2W66A 4X2RA 3EDKA 3PZQA 5LIUX 3RLUA 4N42A 4V1XA 1YDNA 2TMDA 1XRSA 1CEOA 2J7BA 1GORA 3VFCA 4ERIA 2ZUTA 4JOMA 2G97A 3RFAA 1M7OA 1X8CA 5FOOA 1B4EA 4JEQA 3C4UA 2D0GA 1UP3A 3F4NA 1X2GA 3W6YA 5DLCA 1NVMA 1LWHA 3BG5A 4ASTA 5D2XA 4C6FA 3GH4A 3OP2A 3WLPA 4R33A 3HOJA 1JI2A 4OIFA 4Y9PA 5LNRA 3D47A 2WAGA 2CCRA 5JUVA 3GVRA 4LUJA 4LB4A 1AUSL 2CWNA 1OCBA 1XCXA 3KOXA 2D2HA 3M0IA 5HQMA 1FH9A 1QTWA 1EJ7L 4RXGA 1W91A 1WYIA 3D3AA 1SJDA 4FNTA 3VOFA 4NNCA 1RD5A 1KCZA 3PJTA 2X8HA 3KE0A 1R86A 3FK4A 3LDVA 4HB7A 1ZDLA 1KBIA 3H2NA 3ZJKA 1MVYA 2XGIA 3T2OA 3TYAA 3URBA 3H2EA 1AODA 1GXFA 3P81A 3W4RA 1TVLA 1GQLA 2ISWA 3GM8A 1F4AA 3SCSA 2X1TA 4YLWA 4UTJA 3CAKA 3R94A 4CQ9A 1UCWA 3Q6JA 1LROA 3NL2A 2AQWA 3B8DA 2G50A 2Y85A 1VGAA 1BRLA 4GG9A 4XQ6A 2C91A 2BOEX 4QE4A 4H9MA 4GX8A 4ATWA 1FCQA 2YB1A 1N55A 4DO6A 3GW3A 4XAZA 5M3WA 4DELA 3CZEA 1XRFA 1QI5A 3GG0A 1S2CA 1FBAA 3L8KA 3ZLHA 2GWNA 1FWEC 1FFQA 5BMXA 2WJDA 1MW3A 2J25A 4V15A 3HB9A 1K9FA 4QAIA 5BZAA 3QV8A 3PM6A 2BNJA 2GDUA 1FVPA 1IT8A 4YMZA 1H51A 2J3NA 2VD8A 2OG9A 4E3TA 2WOIA 3DESA 1WE5A 2GQWA 3ABOA 3BCFA 4F0RA 5AC8A 1SMAA 4QJ3B 4B92A 1TFVA 2FKPA 2OWCA 4G7EB 3SRKA 2VL4A 2UY5A 3N15A 4IISA 5AVHA 2OXNA 3WH8A 1GG1A 4QP0A 1EP3A 4I5UA 2ZUSA 3NQGA 1UJPA 4CQBA 4J28A 1GKPA 5KZ6A 1OK4A 3NVVB 3A5VA 4MLRA 5FS6A 2X42A 3LADA 1A53A 3QGVA 5G1TA 2RABA 1JFHA 3BLLA 2VT0A 2W0UA 4A29A 4WUIA 1XPGA 4MZ1A 2VD9A 3VNYA 2G3IA 1I4NA 2ZX9A 4AIBA 2Q3OA 3OVRA 1WOBA 4CQAA 2Y4SA 3HGJA 3WLLA 3SFKA 2FGZA 5A6TC 1E4LA 3NQ8A 4O0QA 4AXKA 2JKEA 1JPDX 3N25A 1RA5A 5IOBA 3P61A 2NV2A 1W3HA 3W7EA 1QW9A 1NY1A 3LRKA 3GHTA 3BLKA 4LPCA 1H7RA 1JCNA 3MP4A 3TCSA 5FF3A 1WYGA 4Y2WA 3SECA 3H70A 2F38A 2GL5A 3PZUA 1AW2A 4NZCA 3KVJA 1GOWA 3ZLFA 4FNUA 3WK2A 2VGGA 4DWSC 3BZGA 3FN9A 4QX4A 3A24A 3C2OA 3BOFA 1TA3B 3TONA 3ABSA 4F3HA 1BWCA 5E6YA 1JF6A 2E5CA 4L6HA 4XK2A 3OOQA 1AFSA 3S2JA 3GG8A 5EPDA 4ZOBA 4S3KA 2QAPA 1KM4A 2PDGA 2X8RA 3AQUA 1FEBA 3TWAA 2HMCA 4ADWA 1W2VA 3SUSA 2GGGA 5A2BA 4KCVA 2G0WA 4RV3A 2QJNA 1E1FA 2ZE0A 4C6KA 3W07A 1KV8A 1OADA 3WBAA 2Z1WA 5HJLA 1C7TA 1NFGA 2REQB 5CPLA 3KOZA 5FI8A 1D8CA 1US3A 2QLYA 5CC7A 1TMQA 4LY4A 1UR3M 4W7UA 4S38A 3RK8A 1KFJA 3OYZA 5KVHA 3BLFA 1EZWA 5CPSA 1P6BA 3WZ0E 4RV8A 2QYGA 1QASA 3KTXA 4C6NA 4LCQA 3SRDA 3FSTA 5F1VA 1KFEA 1TJRA 2HRWA 2QF7A 4AYSA 3MSDA 3DN5A 3N2MA 1REQB 5FD0A 5T91A 3WL1A 3W1QA 5E09A 4N6EA 2O9OA 4A8NA 4H6RA 3G77A 2O9TA 1PKMA 2O9RA 4MUPA 5AHNA 3NWRA 4IPIA 3BV4A 3PFMA 1AQ0A 3WQ8A 2YDAA 3O0KA 4IIHA 4JN8A 4MYAA 5DN1A 5D04C 1GYLA 2Y2WA 4C6OA 3N2BA 5A6SA 4GC3A 1IF2A 2VEGA 1N8IA 1DOSA 4PB3A 2VELA 2PDBA 1IWBA 2E0PA 4NYYA 3G0XA 1UKPA 3GNXA 1UOKA 5AYXA 5KITA 4HZ7A 5CLWA 1B3XA 2E8YA 3IK4A 5G2IA 3GW0A 3W7LA 2J9XA 4GGHA 2VVSA 1HJQA 4AXNA 4GJIA 4JCLA 5HJYA 4GJ1A 1XGEA 1V08A 4M6VA 2PP3A 3RLVA 1JCYA 1HKVA 2X1RA 3M5VA 3VD9A 2W63A 2XVLA 1XDIA 2P3EA 5BU6A 4YNGA 2VGFA 5FJTA 1OHLA 3D6NA 5DMYA 3N6JA 4HHHA 3CBWA 1NARA 3GO2A 3HO8A 1Q8JA 3NOEA 4HNLA 1H4PA 1K4QA 4C6QA 3BH4A 2Y7FA 3A6OA 1N60C 1LRNA 1U1UA 2E5BA 1KV5A 4GBDA 3N73A 3W81A 9XIAA 1X6LA 4JYFA 3U48A 4R34A 3FKKA 1QWGA 3AI0A 4DZHA 4JTTA 1AH3A 1R2SA 5J5RA 1TA3A 1X7FA 4R7OA 4QAWA 2ZVRA 4JIEA 4O0KA 1J8VA 3C52A 1XDLA 1RK6A 3MJMA 3ZZ1A 3GYCA 2OLHA 4YXGA 3MQTA 3I7SA 3S5NA 4FK9A 1XISA 4FPSA 2R82A 4DI9A 1FXPA 1ZS2A 2OR2A 2GQ8A 1PTGA 4FR1A 1Q6LA 2REQA 3LMZA 1CGXA 3AS1A 3OYXA 4JIQA 4OBRA 4Q4OA 4AD2A 3W28A 2E1WA 2FLIA 2YPIA 2OWWA 4NX0A 2GPTA 4I9MA 3M0ZA 3TN4A 1REQA 3UR7A 3N4EA 4H00A 2BSLA 3K8LA 1BFNA 3PG9A 2NXHA 2QMKA 3UETA 1SGJA 1YHTA 5HDRA 1NHPA 1CYGA 4X0NA 4O4WA 3OIXA 3WH9A 4TIMA 4HYRA 4KCTA 2ASHA 1S3TC 1XBYA 3QGKC 1NHRA 4GR1A 3RG6A 5AC6A 5K4ZA 2IMRA 2PDCA 2DVTA 5DBUA 2DUXA 4JX6A 1V97A 2HCVA 2HK0A 1HTIA 1EL3A 2EAWA 3GNRA 3W53A 4M52A 3DHUA 4BI7A 3WENA 1V6WA 4IUGA 2WZHA 5M1TA 2WZEA 1ZP4A 2Y7DA 1XLMA 1EX1A 4CQCA 1VR6A 2WOQA 3A9IA 2TODA 3LPOA 1W8GA 3A23A 4PA8A 4LU0A 2QJJA 2D2JA 2QUNA 4O1CA 4DF0A 1Q13A 1HO4A 4K39A 1S46A 5K7JA 2DH3A 3CAQA 1TTPA 1KFWA 3CV1A 4O16A 3K1DA 3T4CA 1QHZA 4AZBA 3VNKA 2EO7A 3C2RA 4H7VA 1WKYA 2CHNA 3AHYA 2PEVA 4OBSA 1MEWA 4JFWA 2YZ5A 1V3MA 4IPJA 3CAWA 2Y89A 5KTLA 3CMGA 4E4FA 4Q8NA 1XP3A 2YCEA 2IPGA 5HWNA 4D2JA 4UBPC 4GC4A 2CW6A 1HNYA 4M3PA 4TMCA 1FXQA 2C79A 2PLCA 3UXKA 2XFWA 1ZMCA 4RDVA 2O4QA 3SRHA 4UTWC 1B3OA 1OGGA 3FOKA 2RJHA 2BY1A 2PF8A 4R53A 1V93A 3LLFA 3BOLA 4ZFCA 1JRBA 4D6CA 3U4FA 2QAFA 4MHBA 3PC0A 3KFTA 1Y5XA 3U2CA 1FFUC 3OTRA 5M03A 5C0QA 3WLIA 4FX7A 1C7SA 4HPGA 2J7CA 4IQLA 3R89A 4FX8A 3EB3A 2AL2B 1SFSA 1CLVA 1SO6A 2GGIA 2QZRA 4Z2HA 1OZMA 3VI2A 4OV9A 3STEA 4JTJA 2BGQA 4OQVA 4GVFA 4KMQA 3SO7A 3Q45A 2CLLA 2OGYA 1T7LA 2EPOA 2OU4A 3R07C 4M24A 1VD6A 4IMCA 3IGUA 3NZRA 1RM6B 1XINA 2CERA 5AYIA 1JQXA 1JNEA 2OEKA 3WDIA 3H53A 1QI3A 2WHJA 4Z1BA 3ANYA 4NU7A 4V28A 1LJYA 3UWUA 3W9ZA 1VHCA 3B8IA 2QJHA 3SCPA 1WBJA 2BFGA 1I8JA 3UCDA 2VFDA 4AYGA 2ON3A 4H3DA 1ICQA 4HZ6A 4GFIA 3T0BA 3L4YA 3FHQA 3REQB 3H2OA 4WOZA 1FX6A 1FWAC 1B1YA 2WWCA 4P61A 1CBGA 4O57A 1LYXA 2I9EA 1VJZA 4DN1A 2OOGA 1SQ7A 3NPVA 1HJUA 4DO4A 5AZ1A 4C65A 4NSBA 2XDFA 1G6CA 2DU2A 2JEPA 5DF0A 1YQ2A 4MFEA 3CQ0A 4IG2B 3WDRA 3THQA 1DBTA 1XUUA 3KRBA 2YJQA 1E55A 4BY3A 3EOLA 3P84A 4KEVA 3ZWTA 3ES7A 4ACZA 2D3LA 1J2WA 2Z2BA 4EQXA 1H41A 3GB6A 2J7GA 4AZ6A 3UYIA 4H4SA 3N1AA 3I6EA 2ZDRA 1XIBA 1S1PA 4HA0A 3I7RA 3TSMA 3DXIA 4I90A 3UJFA 3WNPA 3Q4DA 2AKMA 3GQYA 3PZNA 4UTTC 1ECQA 3OHMB 1HZYA 2ABBA 3UVAA 3B9DA 3KBSA 4K7VA 1ZL1A 3SR6B 3VKDA 4IM4A 1RJRA 1H7PA 2IQTA 2WMFA 1U83A 2HTMA 1I2NA 2VKZG 4D71A 3M47A 4OOZA 1W9UA 2XFRA 3LENA 3BAYA 2QUMA 2WXDM 3QV7A 4C6IA 2WMGA 5DCEA 2D0HA 1QK0A 1TZZA 5LNVA 4IIBA 4RXFA 3O63A 2D23A 2BC1A 4MWAD 3NQ2A 4GUFA 1K9TA 5AC5A 1YLVA 1NQ6A 1GK8A 3BCDA 4JR5A 4PR4A 3WBWA 3WD1A 4JTUA 3S2CA 3VNDA 3H2AA 3LB0A 4LQ1A 3BAJA 1HJSA 2DZBA 4GXWA 3GVQA 3DENA 3N04A 9RUBA 1IWPA 3FXGA 1GOXA 1ML1A 3K2GA 4DWSB 4JQ9A 3B03A 2IXUA 3RXZA 2AAQA 1E4NA 4ZO7A 4DJFC 4OTKA 1M01A 1UYQA 3II1A 1B3VA 2DSWA 3G6LA 3PY2A 4DBDA 4MTVA 4L7ZA 4ZB5A 3VGFA 4RDZA 4APNA 3UA3A 1KM0A 3UYCA 4I7WA 2V3GA 4RZ4A 4B5WA 2G8ZA 4UQAA 1P1XA 3QZEA 3E2SA 1ONEA 3REQA 2JBMA 3EB4A 1UIOA 3WLNA 3T81A 3GR4A 3DFHA 3T09A 4B9YA 3LRMA 1VFFA 1DWFM 2OZ0A 1BGAA 4UOZA 1XIIA 4WXYA 5EGRA 2PWFA 5GNYA 4MNMA 2XGBA 2GQ9A 3PWAA 3LX9A 2FTWA 3EWCA 3ZT5A 3C0JA 3ONCA 3CQJA 5LZLA 2BXVA 3M1ZA 1RR2A 3HF3A 4IG2A 3W76A 1PIF