3UGVA

Crystal structure of an enolase from alpha pretobacterium bal199 (efi target efi-501650) with bound mg
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
363
structure length
363
Chain Sequence
TLTFRKLTARPVLLKLQRPVTARIATIPDWPLILIDIETEEGVPGRAYLEPYVPKAMKYLVPALHDMSDMLAGQPLAPAEIYDKTRKSLHFVGYAGLSMIAASGVDMAVWDALARAANMPLCTLLGGTPGSVKAYNSNGLWLKSPAEVAAEAVELKAEGQGTGFKGLKLRMGRDDPAVDIETAEAVWDAVGRDTALMVDFNQGLDMAEAMHRTRQIDDLGLEWIEEPVVYDNFDGYAQLRHDLKTPLMIGENFYGPREMHQALQAGACDLVMPDFMRIGGVSGWMRAAGVAGAWGIPMSTHLYPEVGAHVMRVTETAHWLEWQSWADPILQEPYALSDGDLIVPDKPGLGLDWDEDVVAANLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Enolase
publication title Crystal structure of an enolase from alpha pretobacterium bal199 (EFI TARGET EFI-501650) with bound MG
rcsb
source organism Alpha proteobacterium bal199
total genus 133
structure length 363
sequence length 363
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ugvA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ugvA01
4E4FA 6ENLA 3QLDA 5FJUA 3GO2A 4A3RA 3MUCA 3VCCA 3MWCA 4H19A 3MQTA 3PK7A 3ES7A 2HXUA 3S47A 1SJCA 3TW9A 4DYEA 3U9IA 1MRAA 4Z17A 2PA6A 3ZLHA 2OZTA 3OP2A 3OW1A 1TKKA 4HPNA 1BQGA 3BJSA 2QDEA 2PTXA 3STPA 1KD0A 2FYMA 2PP0A 3FJ4A 3TJ4A 1TE6A 3NZGA 3QKEA 3N4FA 2I5QA 4H1ZA 2ZADA 2PCEA 1MDLA 2P3ZA 5ENLA 1DTNA 2GGEA 4IT1A 3CYJA 1FHVA 1KCZA 3UXLA 3V5FA 4HCHA 3RR1A 1SJBA 2CHRA 1EC9A 4Z1YA 3TCSA 2PTYA 3IK4A 2DW6A 1XPYA 3DG7A 3T4WA 4M6UA 3I6TA 3D47A 1KKOA 2OKTA 3JZUA 3VCNA 7ENLA 4G8TA 3FYYA 4HNCA 2QGYA 2MUCA 3P3BA 3D46A 4E6MA 1EC7A 3UJFA 2OPJA 4K2SA 3BSMA 4GMEA 3NXLA 3VC5A 4ZA0A 4HN8A 1MUCA 4GISA 2QVHA 2OVLA 4DX3A 3RGTA 3FV9A 3CT2A 3DFYA 1SJDA 1KKRA 4GFIA 4IHCA 2PODA 3IJIA 3Q45A 3MY9A 2PTWA 1JPMA 3UCDA 1R6WA 3OZMA 4KPLA 4MMWA 3VC6A 2QQ6A 3GC2A 3DDMA 3SJNA 3R1ZA 4GIRA 4HCDA 3SQSA 2PGWA 4J3ZA 3PWGA 2QJJA 3RO6A 2O56A 2QJNA 2GGHA 3FCPA 2GSHA 2GDQA 2NQLA 2GGJA 4KT2A 1YEYA 3HPFA 3CK5A 3ZVIA 3P93A 3BOXA 3T6CA 3THUA 3OPSA 5J04A 1MNSA 3ZLFA 3U4FA 3NO1A 2AL1A 4MKSA 4J1OA 4GGHA 3T8QA 4A35A 1TZZA 2FKPA 3QTPA 1MDRA 3IJQA 2OQHA 2OFJA 2XH0A 4F4RA 3DIPA 2PP1A 3DESA 3RRAA 3ZVHB 3N6HA 2ZC8A 3MKCA 3GD6A 2AKMA 3DERA 3UJSA 3FXGA 2PMQA 3QPEA 2HZGA 2MNRA 3H8AA 2XGZA 4K1WA 3N6JA 3SN0A 2PTZA 2PSNA 1W6TA 3FVDA 2PPGA 1P43A 4DN1A 2P8CA 1XS2A 3B97A 4JN7A 4JHMA 2QJMA 2XSXA 4GYPA 3ZVHA 4E8GA 4GGBA 4HYRA 5BOFA 3TTEA 3JW7A 3DEQA 3NFUA 1JDFA 3R0KA 3SSZA 2PGEA 4IL0A 3R11A 4EWJA 4FI4A 3V5CA 1IYXA 3TJIA 2XH4A 2AKZA 4K8GA 3VDGA 2OQYA 4GYPC 3OZYA 2AL2B 3UCCA 1EBGA 4IZGA 2OZ3A 1E9IA 1SJAA 3UXKA 3OTRA 1WUFA 3K1GA 2OLAA 3GY1A 4X2PA 1PDZA 2OX4A 2PU0A 3Q4DA 4JN8A 2OO6A 5FJTA 2P88A 3PFRA 4IP4A 3SN4A 4E4UA 4IL2A 3R25A 4E5TA 4MGGA 2RDXA 2GL5A 1ELSA 1OEPA 1PDYA 1FHUA 1NELA 2AL2A 1P48A 2OZ8A 1R0MA 3EEZA 4FP1A 3T9PA 3CXOA 3N4EA 4A6GA 1JPDX 1EBHA 3S5SA 4HNLA 1EC8A 4IP5A 3H7VA 3EKGA 1JCTA 2POZA 3QN3A 2ONEA 3CAWA 3PWIA 1F9CA 2P0IA 1RVKA 3H70A 5EU9A 3VA8A 3I6EA 4DXKA 3ENLA 4YWSA 5FJOA 2XH7A 2PS2A 2OG9A 4DHGA 5FJPA 4ENLA 3UGVA 3JVAA 3V4BA 4KEMA 3SBFA 3TOYA 3TQPA 3CB3A 1NU5A 2PP3A 3RCYA 4HCLA 3H12A 2HXTA 3I4KA 3P0WA 2HNEA 3IJLA 4DWDA 4M0XA 3ES8A 2PU1A 2GGGA 4H2HA 3R10A 2GGIA 1WUEA 3MZNA 3DFHA 1BKHA 5FJRA 2QDDA 3DG6A 3MSYA 4H83A 5IDZA 3DG3A 1ECQA 3V3WA 4KWSA 3TWAA 3UJEA 3UJ2A 4ROPA 1L8PA 2P8BA 5BOEA 1ONEA 3ZLGA 3VFCA 3DGBA 4ZCWA 3RITA 3UJRA 4G7FA 3KUMA 3SN1A 2XH2A 3R0UA 3TWBA 2DW7A
chains in the Genus database with same CATH superfamily
1E40A 3CGCA 1OD0A 1Z89A 4FHAA 1CPUA 2V5LA 5FL0A 1QFEA 2OCZA 3KBWA 4CQDA 3F2DA 2A7NA 3OLDA 3ARPA 3PJWA 4IPNB 2IW0A 4G6CA 4H8UA 3LOTA 5D2XA 2VWSA 3MWCA 1KXVA 4AIUA 3THCA 3HGOA 3E0LA 5EBAA 3DK8A 2IUZA 2GSJA 3VINA 3SCOA 4JNZA 4OWGA 3DBNA 1SFLA 3WLPA 3GBDA 1VYPX 2ZRYA 3VAVA 4HYVA 1MXGA 4H6KA 5EFDA 1BQGA 4QE4A 1IHIA 2QDEA 3NQVA 3TNBA 3STPA 1UBPC 2R1MA 3CUXA 3WENA 4Y9PA 3TA6A 3FJ4A 4EMWA 3QKZA 1EBDA 3MI3A 3S42A 1XLIA 5A1AA 1ML1A 3VMOA 4EACA 1RBLA 2EAWA 2PCEA 3TAOA 1Q7ZA 1DTNA 1BSIA 3TW6A 3AN1A 1Y5WA 3AHTA 4KWVA 4D6JA 3BUVA 5HPOA 1Q5MA 1XDLA 3QSTA 1TR9A 3DC0A 1L6SA 3ITLA 1I2QA 3UWUA 4MYAA 4MFEA 4CNUA 5EMUA 1BQCA 3BV4A 3M9YA 2V68A 4DAFA 4C6KA 4GO8A 3W84A 3D0CA 4E6MA 3WD1A 1KTBA 3LXAA 4IQEA 2C14A 3IJ8A 4HN8A 5BU6A 2HVOA 5I3FA 2DIJA 4XKYB 3QQWA 1KWGA 3RGTA 2FZDA 4HU8A 2P5NA 3M0KA 3WDJA 4E0CA 1JULA 3DFNA 5LIKX 1RD5A 2CU0A 4JKLA 4LXFA 5I79A 2ACRA 5FSDC 2C3ZA 1P0EA 5FACA 4H4TA 2VURA 1VHNA 3P62A 1X39A 1FH7A 3NJ3A 3KBVA 5AKQA 2DUAA 3VKKA 1XLKA 2QJNA 3Q94A 3MHFA 4Z1DA 4PMXA 4OVXA 4PUMA 2X99A 2VDIA 4LS1A 1OZQA 1OX4B 4RV3A 4F9JA 4MADA 4QP0A 1AUSL 1EWDA 4ASTA 3IAPA 1XL9A 2ZUMA 3BL3A 3O05A 4IISA 5FESA 4W9TA 1OWQA 4IX2A 5C7VA 3A6OA 1M53A 1BYDA 5EMLA 1PVNA 1M1BA 3W7NA 3MW7A 3HG5A 1DJGA 3EWUA 1MDRA 2HVNA 4GJIA 3PJUA 2OQHA 5CBIA 2XH0A 3VIGA 1HXJA 2PDIA 4NZJA 2D2OA 1AH3A 1OCJA 3QQ0A 1QNPA 3F4CA 3DK9A 1TJPA 2GSEA 1OFAA 3P80A 1JF5A 2P0OA 5CEWA 2A79A 3RLUA 1ONWA 3LSBA 4DJFA 3GAYA 3THQA 4WHBA 2WSRA 1KC7A 3USZA 3UR7A 3WBXA 1HJXA 4D72A 3QPEA 3UETA 4PL1A 3LSCA 2CLFA 3ZSTA 3CO4A 1EF2A 1W6TA 1PHQA 4C60A 4DN1A 1YMYA 2I7GA 1LQAA 1AK5A 1XS2A 4FSAA 1UR1A 3SFKA 1KTNA 1PV8A 2VFGA 1VFUA 5U7SA 1PYMA 3DGZA 2VR2A 1O6IA 2WPCA 4H7VA 4I9TA 1E56A 3IIPA 3GTFA 1BWVA 3W7IA 4H9VA 4Q33A 2DT3A 1LBLA 1M6JA 4M6VA 1TYPA 3TJIA 1VFTA 1ZTVA 3BC9A 3Q58A 2BXZA 1TPH1 1GJPA 2FPTA 3W7QA 3D3AA 3LPFA 1FWJC 3RLVA 3VNLA 4HSOA 2YDSA 4EQWA 2BLEA 3JS3A 4KIEA 3RCNA 5BRBA 3C0JA 3ABSA 1V3JA 4MNJA 1BG4A 2DVUA 1BGAA 2YLAA 3PF3A 4A05A 1AODA 1B2YA 3ZM8A 2J7CA 4MGGA 1KXTA 2OYMA 1KRCC 1E70M 3V18A 1WDDA 4LCQA 1BVWA 2FDSA 4GUGA 3DHUA 2OU4A 3WN6A 3PJXA 2VELA 1BXBA 3MI6A 4GKTA 1R38A 2X7VA 4Z2IA 3EA1A 2WBAA 5DQPA 4CQAA 4BF7A 1FFQA 2GJRA 1DQUA 1F9CA 1V93A 3I3EA 3MMUA 4X2RA 2R1LA 1Q65A 2TPRA 3NIYA 1XD0A 3A47A 3C52A 3OGRA 3AWOA 2YPIA 3SRDA 2ABBA 1RR2A 4YYFA 4HD5A 3LERA 3GRIA 4RZBA 4AD3A 2HRWA 3LLDA 3TV8A 2ISSA 3S6DA 4KRUA 3TP4A 4O17A 3TOYA 1XPGA 4PZVA 3PN8A 1KA9F 4HA1A 1YXYA 1NWSA 4AW7A 3OQEA 4MWAD 4RE2A 5AECA 3NWRA 1XRVA 5E9AA 1EYEA 1X1OA 5EY5A 3GXIA 4GNVA 4NEWA 3F03K 3VXGA 3TQVA 3V5OA 5F2MA 1EYWA 1TV8A 4QEEA 1F6KA 4DO4A 4JIRA 2Y7FA 1TELA 5CBJA 4DNHA 3AIBA 4AUBA 3VE7A 4PB3A 1DE6A 3RPMA 4C6FA 3PZNA 3GYEA 4OKDA 4MM1A 1K7FA 4PH6A 1GRHA 3DN5A 3RITA 4DYJA 1OINA 2P50A 3L5MA 1SFJA 3ZO9A 2P3EA 4CEUC 5CLTA 4NZ1A 1WDQA 2WAGA 3VKJA 2ABAA 4A3RA 3W26A 1KTCA 4UTIA 1D3GA 3NGJA 2FHBA 4O19A 3VCCA 1NY1A 1O4UA 4ICCX 4KW2A 1XLBA 3VOCA 2HXUA 4DNAA 3KRUA 3W23A 1XLLA 4HNNA 1FWCC 1GOXA 4Q3MA 1X7FA 3L2LA 6TAAA 3HMJG 3KBMA 3EMQA 3G1SA 1UUMA 3R0DA 2P1FA 2G3IA 5CZKA 2PWVA 2DUXA 2PTXA 1ZS2A 4DXVA 3ARZA 2BCPA 5CBBA 2OYLA 1LL4A 1OT1A 1H5VA 2YR1A 2A85A 3QMTA 4V1XA 3AZSA 1Q63A 2HQAA 2VOTA 4UTLA 1DIDA 1V02E 5ENLA 1UYQA 2C0HA 4F0LA 3LENA 2GGEA 4ATWA 2IPGA 4IPIA 4IT1A 3V5FA 1JCYA 2OODA 3NOEA 4HYWA 4AEEA 1IGSA 1TIWA 3PANA 2DW6A 3MHUA 1ITUA 2PLJA 1UHVA 1AZ2A 4JHZA 2NVKX 1XKYA 3DHPA 4GUFA 2VDHA 4M1RA 2XINA 3KWSA 4OBRA 1GJWA 3PPGA 3II4A 4UTHA 2VZTA 3ZMRA 5D2WA 4H01A 4AX6A 5CC7A 3COTA 1EX1A 1MUWA 2J9XA 3DFSA 4QDMA 1D3HA 4H4YA 2C13A 3E9AA 5BNKA 2DP3A 5DO8A 2H9AB 2VHLA 1POJA 1XIHA 3VC6A 4UTUA 3S2NA 5A2BA 3WUEA 1H7RA 4ZE4A 1F76A 1H49A 4YHEA 2YL9A 2UWFA 1MZHA 5DX7A 4C6MA 3K1DA 3CL6A 4AC1X 3LDVA 1XDIA 4YYCA 5C70A 1YIXA 3LCGA 4JGDA 4XKYA 3LV6A 3GG1A 2NQLA 4JIPA 1CLVA 1H50A 1QXLA 2VFEA 1LORA 4DYKA 4K1GA 2QAFA 2QCDB 4Q22A 3D6NA 4LNYA 1UWSA 2EBNA 3THAA 1IIHA 3MBDA 3H7UA 3BICA 2B7OA 2V5DA 2ZXQA 2ZCGA 1S38A 5C7HA 4MNKA 2W3SA 2JK6A 3G1FA 3WLLA 3R5EA 3GUWA 2G3JA 3TTSA 4ILSA 2PP1A 3WNLA 1OX4A 4QJ4B 4M5PA 1MI3A 2CLEA 3E0WA 2WMFA 3QMRA 3AMZA 4O15A 3GD6A 1WAWA 3KM8A 4JQ9A 3FEMA 1L0PA 4LVAA 4W85A 3CS2A 3AS0A 4RDYA 3PG6A 1O1ZA 1RV8A 4LYPA 4MY1A 2HZGA 1H5YA 4RXGA 3CU2A 1PTAA 1DKWA 1K7XA 3CC1A 3VKDA 4XD6A 1P43A 3DC8A 2G5WA 1KFBA 1KBKA 4LB4A 3NYDA 4J35A 5LSMA 4XTIA 2GJPA 1OG6A 5AHFA 2GVEA 3MCNA 4LOCA 2Z1KA 3HU7A 4LAZA 2XN0A 1TVLA 2R8WA 2XISA 1EQCA 3KBNA 1JDEA 4YMZA 5TQLA 3N19B 3V5CA 3TFCA 2WYSA 3DFQA 3VNKA 1BWKA 2OQYA 1LPFA 2ATMA 3N04A 3WQVA 1EBGA 1XIBA 3PR2A 3AYTA 2C18A 2FTPA 4BI5A 1LQ2A 3QY8A 3BQ5A 4EIVA 2CZ5A 3BH4A 1OYAA 4GACA 4IMCA 3N14A 1YQZA 4K7YA 2FTWA 3RMJA 4PUUA 3WNPA 3VI2A 3I65A 2QNEA 1VGAA 1X6NA 4G56A 1FWWA 6CGTA 3W1MA 3OLGA 4UBPC 1PDYA 1I8JA 1R0MA 1NTHA 3I6RA 3EX6A 4IFKB 3Q6JA 4BK9A 3TN4A 1EC8A 3QC3A 2IPWA 1XYMA 5HQLA 4O1FA 4CQCA 2INZA 2YBVA 1NDZA 5EBUA 5B80A 1LUCA 3SCVA 1GRAA 4RW3A 1V77A 3UA3A 3TIMA 4UQAA 5TNVA 4LFYA 1UR0A 2P0IA 3VKBA 3A4XA 2E6YA 2NT1A 1PKLA 1HFBA 5C0QA 1OF6A 5BRPA 3K4AA 1SZGA 3E3HA 3W7OA 3SURA 3BLEA 2ALRA 2VC6A 1QHOA 1YXCA 3EA3A 3VDHA 1O5XA 2WJEA 2OZ0A 3BG3A 5EMMA 3QFAA 1YPIA 1XLAA 1XXXA 1CCWB 2C6QA 1QO2A 4WDUA 3RCYA 1XGZA 1R2RA 4OIFA 4LV4A 1OJXA 1ISWA 4N6EA 2BC1A 1WDPA 3B3DA 4CGTA 3IRDA 4CCZA 1DVJA 4P7QA 4KMQA 4GJJA 3UWQA 3C0SA 1TMHA 2GLKA 3S2MA 2PDLA 2A3AA 2ZUWA 3TJLA 2PRHA 4LAOA 4DXXA 2R6OA 3DG3A 2JE8A 4TXEA 3TWAA 3UVAA 1FDZA 1JD7A 4MPQA 3TN5A 1XICA 4ROPA 4JTLA 1QNQA 3AIRA 4GZ7A 5DMMA 3AUJA 4HQVA 3KVMA 4LV9A 3PUEA 2W54A 1HL8A 1A49A 5HNUA 2DU2A 2VFDA 2PD5A 3N6QA 3WH6A 4ADWA 4Y6GA 3RYSA 3ITGA 3W81A 1EP1A 3P67A 4IMAA 4WOQA 2J7DA 1CXLA 1Q3NA 1MW0A 5AHEA 1E6NA 1JI1A 3TN3A 2HV5A 1JG9A 2QAEA 3E0IA 3IIVA 1X2GA 1PL9A 2VGIA 1KFEA 2AAMA 3ID7A 2YFOA 6ALDA 3N13A 2ACQA 2GFTA 4AEFA 4J3UA 1C29A 4PMUA 2ZZ5A 2G37A 3CUFA 1U5HA 1MRAA 3PZTA 2Q3RA 3GNDA 2Y8UA 3OBEA 4E2OA 4O50A 3W2KA 2Z2UA 2J79A 1RBOB 1OB0A 3BLKA 4YN5A 3WMSA 2FYMA 3TJ4A 4HU3A 1ZP3A 3QW4B 2FH8A 3MVIA 4H6EA 2I5QA 1RY0A 2VENA 1W5QA 3GU9A 4AXKA 4XTDA 4DJDC 4XAGA 3HQNA 2E25A 1QNRA 3QGVA 2FZ8A 3CYJA 1SW3A 4MJZA 4YTSA 3DYPA 3GW0A 2ISWA 2I16A 1J0IA 3UT0A 2QCEA 3M16A 3WD3A 1R9YA 1NP2A 2Y8KA 3EX4A 4YVVA 4JX6A 1EXBA 4QSFA 1FWEC 3CZ8A 1PCKA 1ZL1A 1VLWA 1S2VA 1IXPA 4QDPA 4FB7A 2X42A 3FYYA 3S5ZA 5EYWA 2QPXA 1DXFA 3AYSA 2G4FA 1YDYA 3A5FA 4NUWA 4IPLA 2PDWA 3RDKA 2BVYA 3ITXA 4WDTA 2PDPA 1PAMA 4I90A 3G0SA 4Q7BA 4NZFA 1NWUA 2WJDA 4OE7A 5I3HA 4JEQA 4GY0A 4ICNA 4R7OA 2C1GA 1LBFA 2VUYA 4B90A 5PTDA 5AHLA 4TUFA 4AIEA 3G6MA 1UR4A 4LBRA 4AVOA 4YIWA 1XYLA 2TSYA 3TUUA 3IV3A 5H8MA 1XH2A 4KERA 4AH7A 1E0VA 2XFRA 1QHZA 4O54A 2BMBA 2GDQA 4MJMA 4YTUA 1SO6A 1A5AA 1W1YA 4D8AA 2D2HA 2Q71A 3D5HA 5D05A 1W91A 4D71A 2PWUA 3OPSA 5EFFA 1MNSA 3L68A 3BCJA 3NEVA 3SQPA 4MKSA 1J2WA 3K46A 3UR5A 3RPDA 4EAYA 1K02A 2IQ0A 2RGMA 4HB7A 4AWSA 4JL1A 1V7AA 4XAFA 3VIKA 1FTXA 4DLFA 2W3ZA 2I1OA 1BRLA 2RDWA 3DESA 2WBKA 2OXNA 3WNMA 4L4OA 4WIWA 2CXEA 4PTNA 2HTMA 4UB9A 2BVDA 3LBMA 4F66A 2WC4A 3NUKA 1V6YA 1UD6A 1TV3A 4S3DA 2HVMA 3OVRA 1OFQA 3JR2A 4F0HA 3P84A 1S46A 2BASA 1AQFA 1RH9A 3U4AA 2PMQA 4BS0A 2XHYA 4FPSA 2Y8VA 4B9YA 2O0TA 1Y0EA 2J6VA 1Z41A 3BLFA 1BF6A 3PSVA 3LCIA 5D04C 1VFLA 3N4AA 3B97A 1ESWA 1YW1A 3F4DA 1QW7A 4UCFA 4HYRA 3VVGA 4Q7IA 1GUVA 1E72M 1P1XA 1XUUA 4GIAA 4LVBA 2NV9A 4H7ZA 4N9DA 3VYLA 1Q6QA 5LHFA 1R3YA 3OOQA 3R0KA 3PUOA 4XAZA 5I0DA 4L6DA 4Q4OA 3WF0A 3BK0A 3O2LA 2WZEA 2ZE3A 1UMLA 2GDUA 4LYRA 1R7AA 2DZSA 3ECQA 3KRBA 4XSLA 1NARA 2XH4A 3VIIA 3E2RA 1E9IA 1KFCA 3K1GA 1B5TA 3WF3A 3H4KA 4DJEA 5BXPA 1M65A 5IFPA 2ZX9A 1BZLA 1N82A 5CSRA 2Z7GA 5EMYA 2OB3A 2EKCA 3F5KA 3IGUA 5LNWA 4NZ3A 2R9RA 4ADSA 4XZ9A 2WVSA 4H8NA 1W3JA 1OZMA 1TMLA 4WY0B 4ZB0A 2Z4GA 4EQRA 3ARVA 1C3FA 1XLCA 1V6TA 3QBUA 3S9IA 3BE7A 3UESA 1XFCA 1ZP4A 1DWFM 3CASA 2ASHA 5D30A 1PZ0A 3H2AA 1WO2A 3W00A 3LCXA 2AOSA 2POZA 1W5NA 2VZOA 4V15A 4EPDC 2VQUA 2YLLA 3W83A 5ER0A 4NNBA 4UQCA 1U1HA 3LZ5A 3WJYA 4PTDA 2R91A 3WD2A 2DZPA 3RNDA 1F4AA 4TV6A 2TPSA 4ZOBA 4DXKA 4IFKA 3GDKA 1I60A 5AC5A 4IJCA 2E5AA 3CQHA 3EZ4A 4DY1A 3S9YA 3VILA 2VL4A 1GQLA 4M81A 1JYNA 3T2PA 3FY1A 3VK5A 3UZXA 3DI0A 4XKMA 2WZTA 5JCLA 2XTKA 3BGAA 1AA1B 4S3BA 2QMJA 3M6YA 2PU1A 3TLLA 4MZYA 4AD2A 1ZDLA 2CW6A 4JD4A 3WFZA 4FA3A 4LT9A 3B8TA 1QATA 3MZNA 5CCZA 1BKHA 4J3WA 4HPHA 4XISA 5LA1A 1ZKQA 1R46A 2CCRA 3ITOA 3UJEA 2X8RA 1FWFC 3ALFA 4LVDA 3T78A 3BCDA 3ZT5A 1GNXA 3R0UA 2PURA 3TWBA 1GPWA 1VFOA 1W1A1 4NNCA 1EGMA 5FA5A 1KM5A 1TSIA 3CV1A 3GO2A 5G1MA 3DGRA 2XFFA 5A8QA 3UXIA 1EJVC 5BCAA 5I3GA 2Z26A 3VX1A 7XIMA 1HP5A 4DJDA 2BG5A 3P74A 2OSYA 3CTTA 3G5EA 1XGDA 1RLCL 1XQLA 1TWSA 4LS0A 4HTBA 2HPIA 3WEOA 4KEVA 3FG2P 1NF0A 1C8YA 5HMEA 2AQWA 4YTRA 2FPYA 1SZFA 3EPMA 4UR7A 4B3KA 2VWTA 2ZRXA 1I6NA 2TYSA 1NH6A 2JK2A 2PWDA 4AQLA 5LA0A 1JNDA 4IM4A 4TIMA 4D6HA 5EPDA 1ZY8A 3PNZA 1N5XA 3FJNA 3G18A 1IE7C 4S23A 5L6UA 1UD5A 3TLQA 1QNSA 4GIYA 4TTGA 4XD3A 1KV5A 4KKXA 4PB5A 3U5YA 3B8WA 1C8QA 2BHUA 3EMCA 4O10A 3MYPA 5G4HC 4IWWA 4BJHA 1G4SA 1N8IA 4MPKA 2R1PA 3W7GA 4XB3A 2WMHA 1LF1A 5GQBA 1EPVA 1EA9C 1GVSA 5FAGA 3B9AA 1VBGA 2PDBA 1R3QA 4BI6A 1ZU8A 3NXLA 2MANA 4DO6A 1CGTA 4GQ0A 3GH5A 1LYXA 1ME9A 4DX3A 4O16A 8A3HA 3MY9A 5GJPA 1JPMA 3OZMA 3KHJA 5DBUA 4MMWA 3GZ3A 3ZQ9A 3A4WA 3NDZA 2VXNA 4LUJA 2BNJA 3MV11 1BFNA 5E0CA 3PZGA 4NZ4A 3WQCA 3GIYA 2R82A 1U1UA 3IGXA 4J57A 1W8GA 5REQB 4W88A 4PFMA 3EAOA 3VNZA 2E1WA 4IXXA 1FA2A 1K7EA 4R88A 1JCLA 2FJKA 2VFIA 1EDTA 4EPEC 5BYWA 4H41A 3S6OA 8XIAA 1XCWA 4OZOA 1P0KA 2RJGA 4O53A 3MS8A 3KCLA 5I3IA 8CGTA 4NRRA 2O9RA 4JFSA 2VT0A 4GLEA 5JU6A 1MEHA 3DHDA 1F6PA 3SAZA 3EPNA 4KWOA 3RX3A 1JZ2A 2YFNA 4Q8TA 3FX4A 3RRAA 2CPUA 3ABQA 3ERPA 3DHFA 3KL3A 1TWDA 3SI9A 4M82A 4RE4A 3MCMA 3WEZA 1B9ZA 3TYEA 3HPSA 2DQWA 4PUEA 2ZA2A 4G9PA 2GOUA 4BA0A 1T6MA 3HGRA 4OUEA 5CPOA 3H2MA 1TG7A 5HINA 1EIBA 3U5UA 3T08A 3NZ1A 3KXQA 1TPB1 2X16A 3T07A 1V0KA 2YBUA 2YVJA 1CEOA 3I68A 1TTJA 1XWYA 1EJUC 1JUBA 2WMKA 2LLEA 3O6YX 1US0A 4TVYA 3H24A 3MUAA 3T2OA 3AXXA 4DUOA 3VMNA 2O9PA 4B16A 4YTQA 2E3ZA 4WSJA 4NF7A 2BOFX 5TR3A 3IPWA 3C2VA 4JY8A 2AL2B 2EF9A 4L7ZA 4JTFA 2CZEA 2VR4A 3EWDA 3OG2A 3OTRA 3P2VA 5KZDA 2JIEA 2FMNA 9RUBA 4LJ3A 1UQYA 1Z44A 1K4GA 1G7VA 3MSGA 4ZFCA 4JTJA 1BVNP 3C2FA 3M1ZA 4Q7NA 1MFVA 3TDFA 3UWEA 4KCVA 2V2HA 3W1TA 1OEPA 1H2JA 5JBFA 3GB6A 2QLYA 3V36A 1TTPA 4J2PA 3EEZA 2WXDM 3WNNA 4TR9A 3VFLA 3EBVA 1S5VA 1SZRA 3TYDA 2DZWA 1V02A 2E40A 1AH4A 1TCMA 4O0KA 1LWIA 3N12A 4LAKA 4Y7EA 1M7PA 4YNGA 4DJFD 1VEMA 3URQA 4GI8A 3GWQA 2JEPA 4US6A 4H9UA 3CAWA 1GVOA 3KS5A 4WY0A 3O6AA 3S1VA 2ZBTA 4H4UA 3BW2A 4FLOA 1OFBA 3CJPA 2D22A 3ARYA 4Y90A 2YW4A 3L4YA 1OYBA 1ZSXA 3H2EA 2RKXA 5KZMA 1MZRA 2DSKA 2XH7A 1UA7A 4LC8A 3BLDA 1ME7A 4I6KA 1ENUA 1J5SA 3WBYA 3USBA 3KL0A 3NYZA 3TTOA 3OA5A 1GREA 4KCTA 1REQA 1L6GA 1KRBC 3C86A 3RG6A 3KBSA 3RMEA 3RAOA 1WOBA 4J56A 1G9HA 4HPJA 4JCMA 3ES8A 4B15A 1GRGA 1NDYA 1JYWA 2XVLA 2WWDA 4O18A 4DWSB 5IDZA 1BHGA 3MB9A 2QJIA 3H21A 3CQ0A 2Z6JA 5JCIA 4U31A 1L8PA 3OEXA 3M64A 3BARA 3ZLGA 2I57A 1UZ1A 3DGBA 4PC8A 4NT0A 2WJFA 3EPOA 1OT2A 4RE3A 4XO7A 1VB9A 4E4FA 1DXEA 2V9DA 4DI9A 3FAWA 4HK5A 2J7FA 3NPWA 3OGVA 4XSMA 2EJ1A 2JQXA 3KE0A 3QPZA 1W5OA 3M0LA 2XYLA 4GVGA 3II1A 3PK7A 3S47A 9CGTA 2QCLA 5EKYA 3ATYA 2PDXA 2CIPA 1S7MA 3UF9A 4DI8A 1RP9A 4D6DA 3UCQA 4XV0A 2NPXA 1RCXB 4Q6XA 2E28A 2VX6A 4DWSC 1BWCA 2ZUTA 2J74A 2NZLA 4IUOA 3ANYA 4R7WA 1GXFA 1W9PA 3H4WA 2FZ9A 1KM6A 1WXZA 4JQAA 3OJGA 2RUSA 2XIJA 1Q7MA 3H4XA 1J12A 4US5A 3H2OA 4MHBA 2OEKA 3CXBA 2FVLA 2CHNA 3L12A 1AVAA 4Z1CA 3TN6A 1PE1A 2BY0A 3EGJA 3PUGA 4LUTB 2GRTA 1XSJA 2FHCA 3B03A 2C3DA 3LXBA 2CHRA 5G1TA 3MP3A 3A12A 3L5OA 1JZ3A 3SR6B 3O6DA 5BW6A 4IF2A 2QPUA 2DJLA 4X61A 3KOZA 4KRZA 3HMCA 3CUIA 3PSWA 1EJRC 4O1DA 3GXNA 4MTVA 4GKLA 3DU0A 3N9KA 3WQOA 2V69A 2XN2A 3WDQA 3L5LA 2QVHA 3RM8A 2OVLA 1XQKA 2WHKA 3FV9A 1O5RA 3NL5A 4KH2A 2XVNA 4PEEA 4C7DA 5FIPA 3NS1B 5ABFB 1J93A 2A3CA 2YVGA 1JYVA 1UR2A 4HMDA 4CNPA 3NQBA 4QJ1A 4QAWA 5F7UA 3E5BA 3LBCA 4W8BA 1QHPA 1R5YA 1TZ7A 2GGHA 2WV8A 2GGJA 3AMLA 1CB7B 1S5WA 5LZLA 2R9ZA 2REQB 3WF1A 5GNXA 2IXVA 4GQBA 5LNVA 3THUA 4EANA 5J04A 4NG3A 3NO1A 4PE8A 2YCJA 4A22A 3AS1A 3UXAA 4HZ6A 4R3UA 4LANA 4IQLA 3A13A 1WKEA 1XDMA 3R13A 3K2GA 4P5UA 1QW8A 1TWWA 3LTSA 3G1DA 1K8CA 4O13A 5D9PA 4N9CA 4QQUA 1OSEA 3CUJA 1VQZA 3TW7A 1Q7QA 4DVOA 1CLXA 3UR8A 1GKRA 2OT0A 3B9EA 3NAVA 2GJXB 1KXHA 5EB8A 3RCMA 3M0IA 3GK0A 4GH1A 1DJWA 4HVXA 1PBGA 4HZMA 5IM51 1OGSA 2XZ9A 1L6WA 4NI3A 4KWUA 2FB3A 1WA3A 4H9YA 3CAQA 1I75A 2E5BA 3NQ6A 5BU9A 1FHDA 1KXQA 2CKSA 4YCOA 2XUCA 3R2GA 1BKSA 4F9DA 1OK6A 4PUDA 1JDFA 3VZXA 2PDYA 3WH9A 2DVTA 3G1HA 5FD0A 6PTDA 2EJAA 4P61A 2WOQA 4TU1A 2I5IA 3UY7A 2FVMA 1CB2A 4UTJA 3BSHA 4ZB5A 4C6EA 4CQ9A 3VNJA 3S2LA 3QW3A 3SQMA 4HNOA 3SQLA 4GXPA 4R9XA 1CGVA 1HNYA 2W4XA 1V08A 1DL3A 1A4LA 2OGJA 2WO5A 3W7DA 2OX4A 3GIQA 4NEVA 1RJPA 2ZX8A 5BXTA 2EQDA 2JFEX 2BX7A 4LYKA 3PFRA 2NLIA 3KCJA 1QOQA 5CSSA 2IKHA 4S2CA 2PCQA 2HE8A 2AL2A 4HPGA 3LLXA 5ABTA 3BAKA 3BGJA 5TF0A 1QWGA 2YA0A 1NQ6A 4JNMA 4DBSA 3GFYA 3EXRA 4EXAA 2PDNA 1E43A 3NSXA 5FS6A 3O1NA 3W6MA 2BGQA 1ZMDA 5AVHA 4AYGA 1BG9A 2ONEA 2P53A 3ELFA 1WPCA 1QMLA 3EDEA 1EEXA 4Y8EA 3E6EA 2PDCA 4UIOA 3PAJA 3KVLA 5KITA 1F5ZA 3SGGA 2DT2A 2I9UA 5M1TA 2HK1A 3PB0A 4JIIX 1SYTA 4BWLC 2X09A 4GRTA 5D32A 3UG5A 2YB4A 1JNEA 4HJWA 1K6WA 5DCBA 2OG9A 3J7HA 3HPAA 4C6IA 3UYCA 4U28A 4JXCA 4ZL1A 4WVXA 1STZA 3MMWA 3FS2A 3LHVA 3HQOA 3D9XA 1SW7A 1G67A 3UEQA 2OEJA 3VIMA 2I56A 4AIBA 4AEOA 1LP6A 4LBUA 3WLRA 1Q2SA 3PPHA 1ZAJA 4N7QA 4ZO6A 2J24A 2WP5A 2PBGA 2D20A 2O55A 2NX3A 3R10A 1LROA 4QITA 1QOPA 4ZOAA 3VGFA 3WBAA 3V1PA 2GVYA 3GU1A 1VPYA 4FALA 2FGLA 3VD4A 3N9SA 4IH3A 3PHAA 3UJ2A 1VQTA 4JEJA 4D6FA 4CD4A 2XM1A 4GI6A 4G7FA 5JRBA 5FF2A 1FWAC 3B8UA 1M3UA 2QZRA 4GO9A 4JYDA 4GCAA 5C55A 3LM7A 2PWFA 1S2WA 3GUGA 1JZ7A 4XIMA 4DWSA 3CHFA 1P6BA 1MWOA 1IT7A 1TUFA 1BXNA 1E4MM 2VCAA 4PRWA 5D33A 2F9RA 3UZJA 5LNSA 4X9YA 5IRPA 1EPXA 3G8RA 3ABZA 3KHDA 1VPQA 1V03A 2QUMA 1ZENA 1QAPA 2OZTA 5A6SA 1JRPA 5HWJA 4C1NB 1XI3A 3QC0A 4D1IA 1IXNA 1PYFA 1FWSA 5DMNA 2EEXA 4WSKA 3VGDA 1YHTA 4S2BA 3EX3A 1DJQA 5LXEA 1GQNA 2QUUA 3MJMA 1GOOA 1JQXA 4V1YA 1E1EA 1JL8A 4LYQA 1RQHA 1VS1A 3NM1A 1VYRA 3VNYA 4UNIA 3W2NA 1CXHA 3FHAA 1NP0A 3S0CA 4HCHA 3AALA 2QV4A 1FWRA 3BANA 3NVZB 3ZJ7A 3WBEA 5AHNA 4XZHA 2B7PA 5FS8A 1ONFA 4O14A 1TO3A 5JMUA 3JZUA 1PB0A 2PZ0A 4KFOA 3VD3A 3NR0A 7ENLA 5A3HA 3SB0A 2JIWA 3W07A 4BHYA 1GORA 2OOFA 1QRQA 1E6QM 3KW3A 2XGBA 3A3HA 4A4AA 1HKVA 2VX7A 4GMEA 1VZWA 3M0XA 4GISA 5GNZA 3OA3A 3MKKA 2F5ZA 4F8XA 1XF0A 3ZSSA 5FOOA 4WRHA 4WQ6A 3Q2DA 2GWNA 2ZUSA 1KKRA 5AYBA 3IJIA 1HTIA 2XFWA 1F8IA 3ZR6A 2J7BA 4GX9A 2CBIA 3LQLA 3NPUA 4GABA 3LGGA 3FSUA 2Y7EA 4GZJA 3WUFA 3E96A 3PZIA 4HNTA 2H3BA 4GIRA 3P6LA 2TMDA 1KB3A 2XSAA 1N60C 2X0YA 2ZE0A 1VBUA 3DYOA 5FI8A 2V3GA 3G1RA 3RU6A 1UWIA 1U5VA 4BQ3A 4ML4A 4WGHA 3F2CA 4RZ5A 3FGCB 4Z2LA 5ABFA 4XZBA 1SO5A 4RDZA 3W1QA 3GIPA 4GZEA 1O1HA 3OBKA 2WVVB 4N0RA 4EMJA 3RF9A 2FKPA 1HJUA 5BROA 5JCNA 2J7GA 3SY8A 3GTNA 4F4RA 4M56A 3C5QA 3CPUA 4UFMA 2ZKMX 3VIHA 1UH4A 2QIWA 4Q4RA 3BJTA 3ZVHB 3CZEA 3MKCA 5DXXA 3DERA 3UFYA 3VKCA 5A8OA 2BDQA 1U33A 3FDKA 3VM7A 4U3AA 3MU7A 3WUBA 2EQ8A 5IDIA 3ICJA 3W1PA 4L1XA 2XPKA 3NNTA 4R5EA 5HWNA 1JFHA 3QFEA 5CC6A 3TROA 5CG0A 3G0XA 3CGDA 3F7JA 4YCPA 1VD6A 3CEUA 1C9WA 2HDJA 3GHUA 3ANUA 4LVGA 5D37A 1DWAM 2E6AA 3EB3A 4LB3A 1TPDA 3SCTA 1OGGA 1NHRA 1QR7A 3KTXA 2Y63A 2YQUA 3NQEA 3UP8A 3K8KA 3W24A 1ZBWA 1W3KA 2I17A 1PWLA 4XQ6A 5DLCA 4NP7A 3NVYB 1B3WA 3OZYA 2NVDA 1ZJIA 2P10A 3RK8A 3HO8A 2OZ3A 4Q4QA 1ZCCA 5CPTA 3M44A 1O7AA 1NEYA 1RCOB 1ICQA 5C54A 3R79A 3FK4A 2WMIB 2JKEA 4XUGA 3W27A 3WQ5A 4MSSA 3MHGA 1K77A 4WD0A 1FX6A 2P88A 2E7FA 3UG4A 4X9SA 3R25A 3S1XA 2Z1XA 4JN6A 3JZEA 1MXSA 1HQTA 1OVDA 5C2XA 1TVPA 1AW2A 5C9UA 1VJSA 3K4DA 5CPSA 1W0MA 4AZCB 2NWRA 1V3KA 2DSZA 3B4YA 4MOZA 3WO8A 4P8WA 4BWLA 3W7PA 2GR0A 1XRFA 3S5SA 5FSEC 2PWEA 1FRBA 1XV8A 3NPVA 3AJ7A 5JBEA 1T96A 5HULA 1DWJM 3DECA 4PMQA 2W92A 4FX6M 2OOGA 4HHHA 5IXEA 1RVKA 2CBUA 3AYVA 1Y7VA 1GW9A 5DY2A 1AW1A 1UD4A 3VA8A 4AVNA 3FVMA 1E6XM 4MWAB 4N9BA 3ENLA 1EDQA 1JXKA 4O1BA 4IIEA 2X8CA 3A7UA 2VD9A 2XVPA 1GOIA 3FKKA 4IQDA 3KEHA 2NQZA 1M04A 3O3RA 6REQB 2CDUA 4H4VA 4NAEB 1I2RA 2J8GA 3DH7A 3F4NA 2ZX7A 3L4TA 1XLFA 2O7QA 1E3XA 3MSRA 2A4AA 3POHA 3QSRA 1AZ1A 2GOKA 4DZAA 3R8HA 4J2MA 2X0SA 4GJ1A 4AFYA 1H09A 3DFHA 1CT5A 5FCZA 4H9ZA 1TV7A 3DG6A 3ARSA 4H83A 1H60A 1YKWA 2UY2A 1WKYA 3A4AA 2YVFA 3SCNA 3GBEA 3W3OA 1K03A 1UWQA 4C1KA 3A5VA 1V0LA 4ZODA 1QJWA 3H2CA 3WFAA 3FYPA 3LQGA 3LUTA 3P14A 3TC7A 1GKQA 2DJXA 2I5GA 3BMVA 3LCWA 2BS9A 3GVQA 2WSKA 4DM2A 1SUXA 1IF2A 3NG3A 2WHMA 1EEPA 3BOLA 3AOFA 5J5DA 3S5NA 5C9XA 1CX9A 1E0UA 3S2JA 3WQ8A 3CZKA 3MCOA 4MG4A 1E5NA 3U3HA 4BZYA 3OO2A 5JVLA 3T09A 5D09A 3NGFA 4K7VA 2G95A 3UNTA 3R89A 4P7RA 4RDVA 5JCKA 2VFFA 3XINA 1FY6A 5D03A 1GOQA 1J9YA 3VM5A 3GXPA 5E0FA 1KBLA 1AQMA 2WCAA 1LCOA 2PBOA 3SZ8A 7CGTA 2IKIA 2X41A 5A6LA 1KRAC 2YJQA 4H6RA 3CMFA 2EG6A 3FHQA 1FHVA 4I7VA 1TTIA 3NURA 3URBA 4I5XA 5LNUA 3ZOAA 1S39A 5HUPA 3DFTA 4PODA 2Y62A 4LGXA 1PUDA 4W86A 4YPJA 1AJZA 4C6DA 4KEZA 4PN2A 2V38A 1IEXA 4JTKA 4L6HA 3TAKA 3W0KA 3ME3A 4NNAA 1RXOB 4PRTA 2WZIA 3P3BA 3OVQA 3S1WA 4K2SA 2CLMA 1TR1A 4IGMA 2WKGA 2E6FA 1Q6FA 2RABA 3EDKA 4LW7A 3PWAA 1SJDA 1GJUA 1T0OA 4QX4A 3JRKA 4QHRA 3L2IA 4ZTYA 1M7OA 3LB0A 2XDFA 3LD5A 5A5WA 1T40A 1DHPA 2PTWA 3LGEA 4MAZA 1KGXA 2QULA 2WZHA 4UQEA 4O52A 4P8VA 1L2UA 1X98A 4ZZ9A 1WZKA 4Z2JA 3OIXA 3U2OA 3CGBA 3UWVA 4PMJA 2ON3A 4LUSB 2VD8A 3SJNA 2XIOA 3R1ZA 4UOZA 2H90A 1H51A 2X1TA 4LC6A 5SWUA 1JRCA 2CITA 1MQRA 5E93A 3STGA 3GU2A 4DJDD 1VFMA 4MIMA 1M9HA 1AL8A 4TV5A 2RAGA 3VKAA 1HG3A 3PTQA 2GWGA 4DF0A 4C6PA 1LG2A 3ORWA 2DT1A 2A6LA 1EXPA 1S1PA 4JL2A 5BZAA 4GCXA 3AFBA 2G0WA 3M6DA 4O0ZA 5K3VA 2QVNA 2G3MA 3IJQA 1NWTA 4Y9MA 3G1XA 1VJIA 4JIQA 2B7QA 3V0UA 4UOJA 4L4PA 1XG4A 1EHAA 1DNCA 3FGCA 1LM1A 1EJTC 3ITCA 5I3DA 1XBZA 1Q13A 3H54A 2FTYA 3FA4A 1V3HA 2BGSA 3SCPA 5AC6A 2D3NA 4P7OA 1W3HA 1TWIA 1Z32X 3TOPA 4MNMA 1FEAA 4M1BA 2EGZA 2O9TA 3CMGA 1P4CA 1UR8A 4UTKA 1DJNA 2PUZA 2WVVA 1B54A 1IT8A 4CU8A 1OM0A 4S3EA 4ERAA 3W1RA 1HKJA 1K9EA 5HXMA 4QAIA 1Q2RA 5JH1A 1GONA 3GH7A 3GR8A 4FLQA 4ERGA 1PX8A 5KINA 2QHAA 3EXTA 3FVDA 3HQPA 1UD8A 3PZMA 1AFSA 3ZVHA 2B7NA 5MHBA 3M07A 2Z0IA 1ODZA 2G8ZA 4Z42C 3AS2A 3LMYA 4YWOA 4GQGA 3N15A 4MB5A 3SCUA 2AQOA 4V27A 4PCFA 5DCDA 3B9JB 5E1QA 1SR0A 4DQWA 2HMCA 1UD3A 5FF7A 2QR6A 1XX1A 4FNTA 4DBEA 3WH7A 3KL5A 3A9IA 3WY1A 3CPGA 3C0QA 3E0FA 2WK2A 2ZZBA 1W1TA 5ABGA 3N17A 5F4XA 2V82A 3WQDA 2PWHA 3NL3A 2X2GA 2DZTA 4AY1A 4NAFB 1D7FA 2A3LA 4BEQA 3CWOX 4IL2A 5ECVA 2Q02A 3N18A 1YDVA 2YXXA 4D6IA 1C91A 2VCBA 1ELSA 3QHOA 3PPFA 2V0TA 1Q66A 1CXFA 4GVHA 4U3CA 2OZ8A 2C8NA 2QYGA 2EPNA 4WUIA 3A21A 3NQFA 2WMIA 4UXDA 3KAOA 5U4NA 2FFIA 1O66A 3RM9A 2GDVA 2SFPA 1N2VA 4GI4A 2R24A 1VBRA 5G4EA 1HJQA 3NZPA 3BLOA 3W2JA 4AZCA 2ZICA 2D2GA 1TPC1 3S2CA 1C7TA 4RDWA 3SIZA 3KOWA 4OJYA 3WCZA 3A22A 3KZSA 1XLJA 1P6WA 4IIFA 3UPWA 2J13A 3CEPA 1GERA 2BXVA 3KCOA 1V59A 3B05A 1G94A 2FMOA 3IUHA 2DY3A 2PP3A 2G3FA 1QU4A 3TTQA 4ZO7A 4R7JA 3EA2A 4Q8UA 5E6YA 4EOUA 3GXDA 4TX8A 1E51A 1GEQA 4NIRA 2HS8A 4A3YA 4QE5A 4M80A 4RPPA 4CU6A 2GPTA 1GZJA 1GW1A 3VZZA 3EOLA 2AGTA 1LZOA 1W9XA 4GX8A 4YWIA 2R1NA 5C2GA 6REQA 4NAEA 1UR3M 2ZX6A 3GDTA 2ZQ0A 1NOFA 1R7OA 4NZ5A 2P8BA 3BG5A 2G96A 1ONEA 1GVEA 3URHA 2PDQA 2EO7A 1G5AA 1ICPA 2DW7A 3BG9A 3DJJA 3SR7A 1A5NC 4PCNA 1ADSA 1WDWA 2Y24A 3UNDA 3MO4A 1NSJA 3KOYA 3DKLA 3IJ9A 1GZGA 3MUXA 4QNWA 2W0UA 1UKQA 2VTFA 2FJUB 1VKFA 1XSIA 2VC7A 4K8HA 4DO7A 4LRTA 4Z17A 4K3ZA 4HMCA 2OSXA 5CAKA 3OP2A 3MMTA 2J6XA 3QR3A 2CC0A 1R86A 2E09A 4U4MA 1CGYA 1RAKA 4Z08A 3SIMA 4QGCA 3BLIA 2VC5A 3F2BA 3AWNA 1TE6A 2Y5EA 3WBWA 3L0NA 3WELA 1IZCA 2OMAA 3AZRA 4AZ7A 4L64A 1R3TA 3BDKA 3PFMA 1TYGA 3BGGA 3LG3A 1FWGC 4XD4A 2Y70A 4GE8A 1BYCA 1MDLA 1JXJA 1VFSA 3LRMA 4N4QA 1V7YA 4MYXA 3MJYA 4UTWC 4L4LA 4ZXOA 2PTYA 1JCNA 2R94A 1IV8A 3IK4A 1B4EA 4J3VA 1MRQA 3MANA 4PYSA 4PMYA 4W89A 2Y88A 3I6TA 5JUVA 1Q4WA 1H4PA 1VHCA 1KKOA 4MY8A 4QLKA 3UU0A 4QROA 2Y0FA 3G0UA 4HNCA 4B3ZA 3SUSA 3W76A 2XIBA 3PNUA 2TODA 2V67A 4JFUA 1MUCA 5GPRA 4AISA 3LCLA 2ZIDA 4B5UA 1TB3A 4AZHA 2XGIA 3GG7A 1KCXA 1IEWA 4M24A 3LI0A 3W7RA 1U1JA 2J7HA 2VEGA 2VEMA 3A24A 1XJBA 4IOTA 4LPCA 5K9CA 5FMHA 1UASA 1GQKA 3DDMA 1QI4A 3GH4A 4PMOA 4QCEA 3SQSA 3LHYA 1XDJA 2J27A 3R07C 2BY3A 3GQYA 4KFPA 1WDSA 1I2PA 1FWNA 4RUBA 3MI2A 2NX9A 3RR4A 2XZ7A 3WK0A 2RFGA 2DH2A 1M41A 2J78A 4XIAA 5FKYA 1Y5VA 3QJAA 1GESA 3A7RA 3U4FA 2X50A 4QG6A 4LUSA 5LGXA 1DE5A 3NM3A 3KFTA 3AMDA 1V6WA 4TO8A 3S9ZA 4US5D 3WX7A 1ODUA 2YSWA 2NW0A 2OFJA 2NVAA 2VZSA 3T0BA 4JNYA 3U8GA 3WJWA 1DWHM 4RE0A 3TQKA 1QPNA 1RSCA 4AYSA 3XISA 2HPMA 1BD0A 3QZEA 4QR6A 3STEA 3BZGA 4HKPA 4DRSA 4GFSA 3U2CA 1YRRA 3CV6A 1FDYA 3WMLA 4L9ZA 4QS5A 3O0KA 3DI1A 3OGSA 1G1YA 2XGZA 4X3ZA 4K1WA 2C1HA 2WPFA 3HG2A 4MB3A 2ZUVA 5G5IA 2ZUNA 2BXYA 1NDAA 1TV5A 3GC5A 4F2UA 4XX6A 2P8CA 3C3UA 1P1MA 1Q6CA 3E02A 1C9DA 3WYZA 5FJJA 2XSXA 4ZQNA 4DBUA 4HK7A 3GYCA 3OVGA 3O6CA 1WCGA 3TTEA 1MFUA 1RK6A 9XIMA 3P5ZA 1GKPA 5C6MA 1E9LA 4CQBA 1FCQA 4O0QA 3IGHX 2YZRA 3VDAA 1YDOA 2OKOA 3WZ0E 4O1AA 1KGWA 4AF0A 2XVGA 4OTKA 2CLHA 4ZOEA 1E1CB 1DV7A 1I2NA 4H9XA 5FF3A 2XVKA 2GVJA 3PTKA 1UZ4A 3ARTA 2CLLA 1PEZA 3CIXA 2F7FA 3AHZA 3BURA 1HL9A 1GVYA 4GUIA 4S1FA 1K8XA 2E6DA 4GQQA 1HKIA 4GBDA 2VX4A 3HN3A 4PMRA 4NJIA 3WLNA 1DJYA 4L6OA 1YADA 3SN4A 3UD6A 1OFPA 4ONVA 3TKFA 1PHWA 3MWAA 4ECLA 1WX0A 2RGLA 4HP5A 3RXZA 2HBXA 4JY9A 3TR9A 1XFBA 4PMZA 4AWEA 1R3VA 5BXRA 1J96A 2CEQA 3HOJA 1ZJAA 2ZTJA 5I7GA 4Y9NA 3ABRA 3F4WA 1XH1A 1KN0A 1XIJA 2OJPA 3IK2A 4WCJA 4WZHA 3M41A 4NAFA 2ZZ4A 3RO8A 3T0DA 3H7VA 3W2MA 2BODX 5K7JA 1PTDA 3UZWA 2D3LA 3PWIA 3CH0A 5HATA 4Z2GA 3CQKA 1DWGM 1W8SA 4Q8PA 5B7YA 5FF0A 4QDWA 2PDGA 2F6KA 3DH9A 5CPQA 1Z9AA 3GVRA 4JTQA 3T0CA 1HZYA 3M0MA 4UZUA 1ZUAX 7REQB 1XW8A 1SMDA 4GNKB 4H4IA 4U10A 3SBFA 1GRBA 1UWUA 1RZMA 2Y2WA 3QVQA 3QLLA 4TX9A 4F3HA 2X7WA 3KDNA 4H8VA 1JAEA 1V0NA 2GQ8A 3GTHA 1XANA 3TMLA 5A95A 4RJEA 4Y8FA 2IS7A 1E15A 4M0XA 1JEHA 1ISYA 3UXDA 4H2HA 2GGIA 1F05A 4B92A 4K7ZA 1XIFA 2UZ9A 1KBJA 1XYCA 1Z6KA 1Y8BA 2IQTA 1OC6A 4FNUA 4Y9AA 3T0TA 1ZAHA 2PDMA 3UJRA 1HF6A 4PCPA 1DTUA 1QPRA 3LM3A 4GVFA 1J5TA 1J0ZA 3GZAA 1A5OC 3ZWTA 5CG7A 2BWGA 3H53A 1MMFA 4RXFA 4CVWA 4AY7A 3L4WA 1LG1A 4AX7A 3JU2A 3RM4A 3TVAA 2DIKA 5I78A 3QOKA 3L65A 5GJMA 1HJVA 2YW3A 5DFAA 4CKQA 3MQTA 3GX9A 5D2YA 5T26A 3FIGA 3SJ3A 4JYFA 1PPIA 1HO4A 3PP7A 5HJYA 3IJ6A 5HNNA 1PCWA 1JVNA 6A3HA 2PI6A 1KFKA 4RNJA 1KD0A 3GFZA 1UKTA 4UTWA 3CUHA 2RH9A 5H2ZA 1Q45A 4EX4A 2XIMA 3UERA 1Q6LA 1W5PA 4ES4A 3QKEA 3EMZA 1DQXA 1S1RA 3PTDA 1SW0A 5A8GA 3CWHA 1F73A 1HX0A 5A6AA 2OX1A 3CM4A 4XZIA 3E38A 1D7YA 1EP2A 4JTTA 4PUJA 1JPIA 1YNYA 4JTIA 4JR5A 4G5DA 1W17A 2V6OA 3OC4A 1CXKA 3DBPA 4FK9A 5AYIA 4GZIA 1XCXA 1V0MA 3DJGX 4A3HA 2KAUC 4FNQA 3SRHA 3T44A 3HGJA 5A2AA 4K6AA 1AD1A 1QNOA 4N02A 1E4NA 3DAQA 1UZDA 2ZZ2A 2KX9A 1US2A 2OPJA 3LRKA 4BFAA 2AGKA 4MLJA 4H6QA 3PY2A 1FDJA 4S3FA 1P0DA 1QVBA 3GAKA 4PTXA 2OELA 1UA3A 2C15A 2XIQA 2ZZ1A 2PODA 1FWTA 4HA3A 3SO7A 3N2BA 4GQRA 4DWSD 2V5BA 4IMDA 2V3AA 1D7KA 2G50A 4H4QA 3ZS4A 1Z48A 4B5XA 1GVFA 2OSWA 4R33A 3W25A 3URAA 4P8XA 3TYAA 3GRTA 4MY9A 3SFWA 2CFFA 2WVUA 3CZLA 4C6OA 2PF8A 1E0WA 5KTLA 2JEQA 4NU7A 1YEYA 3BZJA 4QJ5B 5F4WA 4O12A 3W2UA 3PBVA 3W1LA 3ZT6A 1PJ9A 1VFHA 1J8VA 1GK8A 5A2CA 1EJWC 1F3EA 3UWZA 1GVQA 2WANA 4DJEC 3LPPA 3IUIA 1YQ2A 3T8QA 1W32A 4Z1AA 2OWXA 1AH0A 3OZOA 4D6GA 2B81A 2QEZA 2VUNA 1A5SA 3ARRA 2J47A 4A8NA 3W87A 1KGUA 2EKGA 5ECUA 4F79A 1UPMB 3CQJA 3WLMA 1O68A 5CSYA 1GG0A 3GR4A 2J66A 2ISFA 4NXSA 1YE6A 4JHOA 3LLFA 1TJ1A 4L4MA 4ZB2A 4LAMA 2O4MA 1A53A 1PXGA 3SN0A 4DF2A 1NVMA 4G7EB 3M5XA 1H2IA 5CGMA 3PC0A 2QUNA 4JTUA 2DZBA 2ZZ7A 1MQPA 1JUKA 4JDBA 2Z1BA 3LNMA 4U2YA 3CV2A 1QNVA 1MO9A 1UIOA 5BOFA 3REQB 5HUOA 1TUXA 1IIGA 3LZ3A 3NSNA 1SB3B 1UKOA 2ZXDA 4FXRA 1BXCA 4YXGA 3R11A 2V8ZA 1W3LA 4Z2KA 3NL6A 4OBSA 4F48A 1M03A 3G22A 2DIEA 3TMQA 1UROA 2Y4SA 3CUZA 1WYGA 3QY7A 3PUDA 1UW9A 4PEKA 4JS3A 4FNRA 5E09A 2VX5A 1WUFA 4QJ3B 4ZFMA 4H04A 1FIQB 5G1YA 4AAJA 3F5JA 3WLOA 3WQWA 3WMCA 2POTA 5FJTA 3DZ1A 4G1KA 3K4WA 3EKLA 1NHPA 1CECA 4POCA 1MSSA 4GYFA 3HIJA 1E1CA 4KCWA 3VNMA 3VOJA 3WDIA 1FHUA 3HW2A 3ITYA 4ORMA 4TMCA 3H6OA 1L6FA 3UG3A 2HEJA 5H1WA 1QI0A 4NJJA 3DX5A 4WK9A 1BF2A 2YXOA 2JF6A 1G4PA 2ZXBA 3WMBA 2J3NA 4IP5A 4TVCA 4O4WA 1UZHA 2W9MA 1OFEA 2Q8XA 1YYAA 1JIBA 3B0PA 4UNLA 1LT8A 1E0TA 4KWWA 1HIZA 4TVWA 3UPBA 4S3GA 1E9ZB 4JTHA 3C8FA 3B0YA 2PS2A 1EDGA 5HA7A 4DUXA 4FLSA 3GG8A 3VABA 1DHKA 1VFFA 5HANA 1E6PA 2CFYA 4H50A 3FSTA 4GHRA 4YTTA 3I7QA 5HAOA 7ODCA 5AOUA 2W91A 1OIMA 4IGHA 1ZXIC 3WLJA 5D2TA 1B31A 5FEPA 2HNEA 3IJLA 4ATLA 2TRSA 4W87A 1HJSA 3CAVA 4AHPA 5JIWA 5F2GA 1CGWA 4GIEA 1Y65A 4ZEPA 1B0IA 1AW5A 4UQ9A 1VEPA 1ZB5A 4Q8MA 4D1JA 3VZYA 4K68A 4AG0A 1NFGA 2HSAA 3S4TA 4S3JA 1MYRA 6XIAA 4EAMA 1PKMA 3U7VA 3EX2A 1K3UA 3WLKX 4JQ1A 2EHHA 3U2ZA 1Z8AA 1R8LA 2BVTA 5BOEA 3IIOA 5IHSA 1Y5XA 5CQ1A 2E5CA 4ACYA 1I0DA 1AMKA 2RDUA 4E3TA 3E12A 4JQ4A 1LQ0A 1EH9A 1KBBA 4YU1A 2D0GA 1J6OA 3CQIA 2QT3A 1XISA 3VMPA 3N11A 4LCRA 1ZRQA 4B9ZA 1KM2A 1R2TA 1WAUA 4WDWA 2IMRA 2WQPA 2ANUA 2VDGA 2WJZA 4ZMGA 4JQ2A 2ALDA 1K4QA 5CXPA 1LRNA 3VX0A 4NHVA 3I3DA 3ZIZA 2H9AA 3IC9A 1SFTA 5LGZA 3OW1A 3L4XA 4UZSA 3GLCA 4E4PA 1W1PA 3HBLA 5JCMA 2E9LA 2RHGA 3BSGA 1YTDA 4AZ6A 2E4TA 5AVNA 4MFDA 3E5PA 4K37A 5B7ZA 2QCDA 4URIA 5D9OA 1S2AA 2VMFA 2WOVA 1F74A 1XG3A 3PZQA 3ARQA 3HZ3A 1VEOA 5IBXC 5A8NA 1EC9A 1P0BA 4N9EA 1DIEA 1SPQA 3TEVA 2A6NA 3TXVA 4UR9A 3D47A 2G97A 1BWLA 3KLKA 1LJYA 3H23A 3NA8A 3W74A 3LMZA 2F8QA 3GXMA 1R85A 2ZA3A 7PTDA 2WSQA 4FDCB 5JH2A 4OV9A 4C6CA 2DSWA 3TU9A 1FVPA 3H22A 3EUB3 3W1XA 3TC3A 3NQ7A 3QYQA 2QJGA 3M0YA 1G6CA 2ISDA 4E2DA 2HCVA 1W3IA 2Y5JA 5K9XA 1RJRA 1TWZA 1DIOA 1JEZA 2PGWA 5D8WA 1J11A 4S3CA 4UMAA 5GVJA 1AG1O 1TE1A 3B9OA 4WR3A 2CESA 4A3QA 1N8WA 5BXSA 1JZ6A 1ZBKA 3VOIA 3GG0A 5DELA 3QR1A 3P93A 3MMDA 3SEPA 4V28A 5HPCA 1I1XA 3GNRA 3VIOA 1LWHA 2CXGA 4MNLA 4BURA 1PX3A 1XYZA 2QPSA 4PCTA 1KM1A 4L1GA 3C2RA 5LA2A 4GGHA 1MEIA 1FWBC 1WV2A 1G7UA 1BLIA 1B3VA 3BQ6A 5C8BB 4Q4MA 3NQGA 3UYIA 2VO5A 2NX1A 2ZWZA 1UP3A 2TAAA 1X8CA 1WZLA 2FZNA 2EG8A 1OCBA 3VNIA 1KO0A 4W8AA 4PB4A 4AC7C 3LHWA 3A64A 4H9MA 3UVIA 4FF5A 2CETA 1Q1WA 5HOSA 3F5LA 3N3TA 4ZO8A 3GTIA 1KM4A 2C7FA 2QUTA 4KQNA 3HQ1A 1W56A 4L1WA 2E0PA 4XBSA 4WEVX 3T81A 1B3ZA 4AXNA 4JTRA 1SSDA 2PC8A 3B0VC 4CN4A 1XRTA 2AQVA 1B30A 4PUNA 1E55A 1HKWA 3BLLA 4M8UA 3EEGA 4M19A 5EBKA 1QPOA 4C6QA 3JW7A 5LIXX 4GY1A 3SSZA 2INFA 3TCEA 3WF2A 4GD0A 1TA3B 4U5IA 2D0HA 1UOZA 4G7EA 2FGBA 3TSBA 1XSKA 2Q09A 3I3BA 3LTYA 2VFHA 3VDGA 3NEHA 1GRTA 3N2TA 4Z2HA 3SCWA 4XAPA 3N2CA 4MKVA 3KP0A 3QZAA 4Q32A 3QFBA 4JICA 2R1KA 1DPMA 1HGYA 3N9RA 3REQA 1Q8AA 5AZ0A 5I03A 2HJPA 3L4ZA 1OABA 3MSDA 3QY6A 2X2YA 5I02A 3AXIA 4ZENA 2A7PA 3NDOA 5G2IA 1D8WA 4EWND 2WLZA 4QE1A 1JZ4A 5H8UA 3AROA 3RJXA 2PLMA 3T4CA 2GL5A 1E6SM 1A0CA 2XIIA 2NUWA 3AZTA 3CIWA 4RL3A 4Y9OA 4HHMA 2IKJA 3LA4A 4OBTA 3RFAA 1TTQA 3GVWA 3E1F1 4FP1A 3M7SA 3CXOA 3N4EA 1T7LA 5CSUA 5DT5A 2YGYA 4HNLA 5LHEA 2WC3A 4E2VA 2QW5A 3AIQA 5D02A 5MKGB 3BLPX 4NY2A 4DNMA 1KCLA 3P8IA 1D9EA 2VJXA 4ZQMA 4I7WA 1G69A 4C6LA 4JKMA 3PBUA 1RPXA 4BEUA 1PO9A 5H91A 1SGJA 3ARWA 2DV0A 1E4IA 3G6LA 1H11A 5FS7A 4LRSA 3T8LA 1RQBA 4S3AA 3IVSA 5FJOA 1UBSA 3GFXA 4C6BA 1TPWA 4DHGA 3WK1A 3W85A 2GJNA 4IFOA 4XBKA 3HRDC 3N2OA 1NU5A 3TZNA 4EE9A 1HUVA 1XC4A 4B4FA 2DEPA 4ACZB 3LGDA 4LA1A 1TX2A 4LQ1A 4QRNA 1B57A 1H7OA 1H41A 3LXDA 4QS6A 2G4JA 4WGXA 2IQDA 3P0WA 4CD5A 2VYOA 2J8FA 3AU2A 3L4UA 1Q6OA 3QV9A 1JCJA 4PSRA 3ZJ6A 5FAJA 1OFRA 4F0SA 2PB1A 3NO3A 4QQ3A 5HMFA 1M5WA 3KX6A 1XLEA 3DXIA 2EXOA 1DJHA 3BAIA 3UG8A 3ETRB 3QM3A 4ORIA 3E2SA 3NO5A 4AZBA 3S3GA 4JTSA 2FB2A 2J77A 1H7NA 1GTHA 1U22A 1DXIA 4QEHA 3W37A 3CV7A 2PDKA 3R8RA 2D23A 3I7SA 1QCWA 3L0GA 2WCGA 1HJWA 1UJPA 1XP3A 4JX5A 3BPWA 3QPYA 2QUVA 1GHSA 1LRTA 3FXYA 3SN1A 3OLEA 4XVEA 2XG9A 3AJXA 3LK6A 4EF8A 3T0AA 1LUCB 1NDWA 4ADUA 2WHJA 2BY1A 2IPFA 4JYEA 1C8XA 2IKGA 3FLUA 3KTSA 1J0HA 2C1IA 5LXXA 4YJ5A 5CZ0A 1RJQA 5CAHA 2FPVA 5CJNA 1BVZA 3T40A 2VGFA 4UMBA 5D4YA 2NWSA 1JZ5A 1SSGA 2WNQA 1US3A 1JI2A 4DYEA 3U9IA 4CCEA 4PTMA 2BBFA 1FHLA 4C90A 1HKKA 2FZMA 4IP7A 2VGGA 5IBXA 5I09A 5C5YA 2V5JA 1LLWA 3P82A 4XZLX 3M5VA 4XD5A 1XLHA 2X1RA 1X1NA 3W7KA 1FQ0A 2YDQA 3BJFA 4DEFA 3KP1A 2J8TA 3N4FA 4R27A 4JTDA 4H1ZA 3FKRA 1YTKA 3ITTA 1FP8A 4DF1A 3W53A 1OD8A 4YL2A 3GNXA 1U2YA 3GE7A 3WEMA 1SJBA 3IVTA 5CJ5A 3LEPA 4IMGA 2GUBA 2NQ9A 4J40A 2WC7A 3UR2A 2H8ZA 1A3HA 3LCFA 4K36A 1K8ZA 5EMKA 2A0NA 3WJSA 2V30A 4R34A 1OHLA 1UJQA 2GUYA 2QGHA 4MDPA 3UWWA 3W22A 1W1VA 1VRXA 3BSMA 1UKPA 2VRKA 3OU8A 7A3HA 2ZZ0A 1FWIC 2NUXA 1H1YA 3DFYA 4BQ2A 1KFJA 4GFIA 4MAVA 3Q45A 5DRIA 5TD4A 1R6WA 1RCQA 2JBMA 1RA0A 4AD4A 4LSBA 3GC2A 1JR1A 1W9UA 2OR2A 4JBRA 3UWYA 1YTEA 3U7BA 1QT1A 5BWAA 3ZWSA 4RCXA 2QJJA 2WNNA 1G4TA 3APYA 1XM3A 3FCPA 3A9BA 3B9DA 2GSHA 5M17A 1NOUA 3IJ7A 3AICA 3P0XA 3AQUA 2DPEA 3NZRA 4Z0SA 3ZLFA 4ZE5A 3W02A 2QAPA 4JIHA 4J1OA 4KS0A 3BAYA 3W4RA 2HE5A 5U1OA 2D0FA 4H8HA 3KOXA 1W2PA 1EUAA 4PL2A 3OODA 2ZUUA 4QSHA 4BF9A 1L6YA 1QI3A 3MPGA 4NVTA 3PM6A 4W93A 5T91A 3KVJA 2AMXA 4FXJA 5D9MA 3VIJA 4A8RA 4NYYA 3WJZA 3SADA 4NXKA 3N6HA 1UG6A 4DBWA 3O15A 3RX4A 1IZJA 5DN1A 4IMFA 1J0KA 3BO9A 1IXQA 3F1QA 5FEWA 2QCMA 3O63A 4D6CA 1TYTA 1L9WA 2A3BA 5IOBA 1C93A 3SUTA 4ZVJA 3RJYA 4AZ5A 1U30A 3OG3A 3NDYA 1B1YA 4XWUA 4MJ2A 3FA5A 1YE4A 1XINA 4F0MA 1H61A 3LTPA 4PBGA 3V35A 3EDFA 3MUY1 4BY3A 3NFUA 3GHTA 5I07A 4BCEA 4PGLA 5HMSA 3NQDA 3MDWA 4HOZA 3BMWA 1FFRA 3NTYA 5CLWA 5T8GA 4J4KA 5A94A 1I1WA 3XIMA 3L5AA 1FCVA 5KMYA 3WUGA 3PS7A 3CHVA 3W73A 4NZCA 1XYAA 2NUYA 2FHFA 2NV1A 3O8AA 3K13A 1VRDA 2OLAA 1UC4A 1UWRA 3VGGA 3NQ2A 3IVUA 4H9TA 4JN8A 1G4EA 1TA3A 1BRLB 2ZC1A 3JUGA 4E4UA 2D24A 4DBDA 4E5TA 3UPMA 2QF7A 4EKJA 2X05A 1VBHA 1VENA 3E49A 4FO4A 1NQKA 4XG1A 1JGMA 5RUBA 1EQPA 3VUPA 1SMAA 3PZOA 3FN9A 3T9PA 5GJNA 2F61A 4Q6JA 3PVFA 3K8MA 1PZ2A 2GH5A 2E3TA 2Y6ZA 1JGIA 5AC7A 2CZDA 1OFDA 3P81A 1CNVA 4TOQA 2PC4A 2Y7GA 1Q6DA 5LIUX 3RLGA 1GRFA 3QN3A 5G5HB 4IIDA 3OHIA 3EDJA 4CN6A 3WNKA 4CU7A 2Z25A 5GRTA 3LHZA 2D2JA 1TPUA 1AJ2A 2YL8A 3TSMA 2Z1SA 3BTNA 4FOUA 1OCNA 3U0HA 3BMXA 3EX1A 5FJPA 1KFLA 3UGVA 1JF6A 1LOSA 4UFHA 5MKGA 3GXTA 1SZEA 3MO7A 2ZA1A 2GR3A 3VUSA 2PE4A 2WPEA 1UH2A 1EA0A 1M6IA 3R6IA 3BW4A 4N2YA 4E2BA 4NQ1A 1IXOA 5BMXA 1M68A 4ZSTA 3WDRA 4LVFA 8TIMA 1CLKA 4PUWA 4HK6A 3S46A 3TQ0A 3PULA 2GQAA 1WUEA 3Q37A 4W7VA 5FJRA 3G3MA 4DPPA 1UB3A 4IGNA 4FXFA 1VDVA 4ACZA 4CLMA 4F0KA 1Q4NX 2YIHA 1K1DA 4OFCA 1TREA 1XHGA 1LVLA 1A3WA 2CLOA 2YBTA 1T99A 2XM2A 2QDHA 3EWCA 3LHUA 4MWAE 1V6UA 1XYFA 1P0NA 4IIBA 1ZZMA 3S83A 1RVGA 4C5ZA 3VGEA 4ERIA 1NIUA 3VIFA 2ZZ3A 3LRLA 3G77A 3WQPA 3RIKA 3VD9A 2ZRWA 3GHRA 4MKNA 6TIMA 4PR4A 1IR1A 4QG8A 2YCLB 3MP5A 3GNPA 3SUVA 5EA9A 3BOFA 3A7AA 4QCFA 1OCQA 1T3QC 2W62A 1CDGA 5I24A 2W3RA 4NX0A 5HNRA 3MUIA 1R2SA 1HL2A 3LN3A 5REQA 3OBAA 3AHYA 1C7SA 1NFPA 4X0VA 3IEBA 1FKWA 3W82A 3NVDA 3FDGA 1KCZA 1A47A 2VNCA 1VIWA 3Q65A 3W6LA 2PDFA 3AYRA 2PLKA 1GOMA 2VGBA 4JIEA 1H1NA 5CZJA 3TCSA 1ITXA 3LX9A 1DJZA 2GQWA 1H7XA 1YXDA 4J27A 1Q1RA 1TFVA 1FH8A 3T42A 1IR2A 2V3FA 3RILA 3D3FA 2FFCA 1HVQA 3K5XA 2ZWYA 3TXZA 1CTNA 3E74A 4IMEA 5DCEA 4HNUA 1KBIA 1HO1A 3IACA 2MUCA 4UFIA 2V6AA 3RPTA 5FS9A 2DH3A 1E1FA 4GC4A 3C2EA 3PAOA 4FX7A 1F3TA 1DBTA 4KEUA 3GDLA 1KWKA 2B31A 3EXSA 2BOGX 5K4ZA 2QIIA 4GNJA 1UMYA 3CTLA 1FCUA 3N29A 1K9FA 3BAJA 1XHCA 1F6YA 4HOXA 3N73A 1FXQA 1FFVC 2PDJA 4V33A 2A8XA 5FL1A 1E6RA 4DUWA 1GGOA 4KGJA 4S38A 4HT3A 1ADOA 1S5TA 3LCHA 4DPQA 3APTA 2JGYA 4H4WA 3W1AA 3MYOA 3U2EA 2CLIA 3QFWA 3LU2A 4WKAA 1EZ2A 2WM1A 3EB2A 3BOXA 2ZTKA 3T6CA 3T1GA 1B9BA 1GSNA 8XIMA 2Z2AA 1HP4A 1TX0A 4P7NA 4MB1A 3H4GA 2J88A 1L8NA 4LAUA 2AL1A 4IGSA 1G0CA 4GK8A 1W1ZA 3DCPA 1TZZA 3PBYA 4AZIA 3GVGA 2BP1A 5AYYA 2CKRA 5HWMA 1D2KA 3WLHA 1OGBA 5BRQA 4EVZA 4NRSA 2H6RA 1UCWA 2CHOA 4FEZA 4APNA 3S1UA 1RPKA 3QZ6A 1KLYA 1VH7A 1R3SA 1UD2A 1QK2A 4UCGA 3GD4A 2E68A 1K4HA 3EWZA 4A29A 2MNRA 3H8AA 2X1IA 4ICMA 3MUZ1 3LV5A 4V2XA 1QOXA 3WIJA 3A4JA 4BR1A 4JAWA 1QPKA 1B4KA 3AXKA 4LNCA 2XWEA 5D38A 3WQEA 5DF0A 4K38A 1A5CA 4IX0A 2XU2A 1ZBVA 4EPBC 4CNOA 4K8DA 3DK4A 2QXWA 1DP0A 4JX4A 2FVKA 4AHOA 4TVDA 3O0FA 2OO0A 5AHIA 3FJ6A 3S6TA 4B2DA 2Z7KA 2J4GA 1RM6B 5CPNA 2W79A 3N3MA 3P5YA 1XD1A 5HQMA 4IQJA 3QF0A 3WK2A 1R30A 3GTXA 2Z27A 3O9NA 1LWJA 5JIPA 2A3HA 2DZUA 1N62C 3H55A 2Z1VA 3FJLA 4I5UA 3UCCA 1QO5A 4IZGA 2VKZG 2UV8G 1EZWA 1KNWA 3TYZA 3EB4A 2NXIA 3NVWB 3GY1A 3NCOA 2ZZCA 1JROA 3HA1A 1LOQA 4IP4A 2HNHA 3M47A 4TMBA 5KVIA 3CWNA 2ISVA 4KIRA 1CI1A 1V51A 3NZQA 4O8RA 3QV7A 4F2TA 3QHMA 2OWWA 2ZRZA 4ZQRA 5A6KA 4U33A 3ZZ1A 3L21A 4IUGA 2V2DA 1JPDX 1X6LA 2NQHA 3WQ4A 1AMYA 2EPMX 1A80A 1KV8A 3ZJ8A 3QV6A 4IXHA 2GVLA 4LIIA 5GNYA 4FX8A 1O60A 1Q85A 3PB2A 4KBXA 2GYIA 2DZAA 4FIQA 4MVAA 3I6EA 2AAQA 4DLMA 1DEDA 3AM9A 4LUIA 2UY3A 3TX9A 2PEVA 5AHMA 1W9VA 5HDRA 4UR8A 2ZZ6A 3GDMA 3TQPA 3M0JA 3RU8X 4AWUA 4C65A 3H12A 3G24A 1O5QA 3BCFA 3POCA 3G1AA 1RHCA 4GG9A 2VEKA 3WD4A 3VOHA 2E5DA 1N8FA 1C92A 2BHZA 2J62A 2PAJA 3N1AA 3CYVA 4Q8OA 3AAMA 1ITCA 3AXMA 3R94A 4LUTA 5A6BA 3WSUA 2DSUA 3VO0A 3SCRA 3C61A 3MSYA 3EOUA 3ISIX 3NL2A 2HS6A 5AB3A 3L7RA 3H2FA 4AD5A 4OUIA 4HN4A 5F2LA 3KUMA 3MZ2A 4CN1A 1DORA 1AD4A 4EM4A 3T05A 5I2UA 3TK7A 1KR1A 6ENLA 1AQ0A 3L4VA 2ICSA 5DRCA 2F6UA 1W1IE 4FNSA 3GKFA 1S5MA 1YPFA 1W54A 2YX0A 3MUCA 1W3NA 5AYZA 4Q8QA 1R47A 4X22A 4EMIA 2Q8LA 2FH6A 3IGSA 3B8VA 1ISZA 3ANVA 3ES7A 5EMJA 4I7UA 3KRZA 5KSWA 1ZK7A 3HTWA 3QYSA 5I3KA 1CGUA 3ZLHA 1ECEA 1TV2A 4Y2WA 5XINA 1REQB 2PGFA 4HPNA 3KS6A 4CCCA 5AFDA 1O12A 1GEUA 5I06A 1FXPA 2YB1A 3CH9A 4DIAA 1RLDA 4GYKA 2WNZA 3UA4A 4FX9A 1ONXA 1CW2A 2REQA 5AYXA 1FFUC 4HSHA 1QUMA 1BYBA 3WG6A 2YCLA 3RNMA 1ZALA 1LTDA 2DZVA 3ZJKA 1X7IA 3KWXA 1PKYA 2NXGA 3IJDA 5H8PA 1W3TA 4X63A 4YS1A 1UUOA 1QTWA 4JTGA 3RR1A 4XZMX 1QASA 1DWIM 3LPGA 5JXQA 1X8FA 1EF3A 4Z1YA 3HJZA 1ZX9A 1XPYA 1ISXA 4OHQA 3T4WA 1KM0A 1WXYA 4R85A 1W2VA 3W7MA 4OGZA 2QDGA 4OV4A 1CWYA 1MW3A 1OX6A 4JTCA 2W67A 2B4GA 3VGBA 2F6XA 4DELA 4JDRA 1SQ7A 4C7FA 4QLJA 1EC7A 2VC9A 1S2UA 4DB7A 1RUSA 4F0RA 4RZ4A 1Q8JA 3C3NA 1KCKA 2GJXA 1X6UA 3QQ1A 3KRSA 3HV8A 4B5TA 3V1HA 1Q6GA 3CT2A 3AMGA 4TQTA 2Y85A 4IPJA 4W4QA 1E0XA 4IICA 3B04A 1ZBCA 3AIVA 1J0JA 5XIMA 1CZ1A 3BAXA 4LH8A 1RBAA 3SSJA 4MF4A 2DORA 5G2WA 3ZR4A 4B4HA 3QXBA 2JKAA 3PWGA 4JOMA 3RO6A 1FKXA 2YCIX 1M7XA 1XLMA 1KQYA 3HPFA 3BV7A 3EWBX 1QDSA 1XC6A 3U57A 2NV2A 3O16A 2GVGA 4A8LA 2AAAA 2VP8A 1PTGA 1U5JA 3KBJA 1N63C 3W72A 3LB8A 1V8EA 3L9CA 5A6TC 3K30A 2BTMA 3EWWA 2J9ZA 1ICSA 2W55A 2EQ7A 1XH0A 4UQBA 4AZGA 4OU1A 1V79A 3WNOA 1ZAIA 4G2DA 3W7CA 1N61C 3GC4A 3CAKA 1V5XA 1F61A 4CD7A 4QLLA 2BY2A 4INFA 3WH5A 4D2JA 2EG7A 2X1SA 5LKYA 1ALDA 4LALA 2AKMA 1UUQA 2FQIA 5LYRA 2Z2BA 2D73A 4IIHA 1HVXA 3TYBA 3RHGA 5C9ZA 2EPOA 3N6JA 7TAAA 3IUDA 3VU2A 4CQ8A 2ACSA 2GZXA 4RZ6A 1WOAA 1RD6A 2UY4A 2WZMA 1LT7A 2YA2A 3AHVA 3C2YA 5A6MA 1S2CA 2PF0A 3CMJA 4JHMA 2QJMA 3VDCA 2PDUA 3EANA 2W5FA 4E8GA 4C6JA 3DEQA 4LX4A 3QEZA 3M0HA 4FNPA 2VM8A 1V97A 2J9YA 1FP9A 5KZ6A 3OZPA 4IL0A 2WLYA 3W28A 2H3DA 2NSXA 4EPKA 4UOQA 1YPXA 1JDDA 1VR6A 2QF8A 1LL6A 1J18A 1HN1A 2YXGA 4MUPA 2AKZA 3L2MA 1OQFA 3B06A 4DZ5A 4Y96A 1OG0A 5DMLA 1TQXA 1EJ7L 4GY7A 4DJED 4O57A 3L67A 2GQ9A 2OYKA 1EP3A 4I8DA 1L2QA 1SJAA 3NQCA 2VZUA 4I9JA 4WXZA 2PLCA 4CNTA 4NYUA 4MWAC 1EWEA 1M01A 4AB4A 2PU0A 4FAMA 1TPVA 2PTDA 1PSCA 5MF5A 1E9YB 1XIGA 3DKJA 1SO4A 4WOZA 3QGKC 1NOWA 4B5WA 1EO5A 1A5KC 1S2TA 2WM0A 2DGAA 1JRBA 4LEQA 3ARXA 3OVPA 3NQAA 3SUUA 3ATZA 1V3IA 3C8NA 1Z69A 2VQTA 3HPXA 3N2XA 1A5UA 4GI9A 3SY1A 1B90A 1PS9A 3RLHA 3HM7A 1EB3A 3AIEA 3EKGA 1JCTA 3EOEA 5M03A 3DUGA 3P7YA 5G2HA 3A3XA 5C2CA 5CPLA 1FOBA 4BF5A 3H70A 4UTFA 1SZNA 5I77A 1NWRA 2Z6IA 2GR1A 3GS6A 2Q01A 4NILA 3CGTA 2CLKA 4JZ5A 3OQ8A 3CT7A 4Q4SA 3FEQA 4W8LA 4ENLA 1F3PA 3FA3A 2Q6ZA 4DZHA 5L9FA 3CLWA 4C1NA 2WPBA 4HU0A 1DIKA 2VCCA 1OADA 1NF7A 2J75A 2HXTA 1X2HA 4N6FA 2P76A 3CPRA 1V4YA 4HNVA 4TX6A 2G41A 3VIPA 5F1UA 2WOWA 2AMGA 1MNZA 3O06A 5E9XA 4H00A 1XIIA 3GRSA 1PIFA 3FNDA 3CHCA 1MXDA 1GV4A 2V3BA 2HROA 1J2BA 2E8YA 5CC3A 4EF9A 2ZRVA 1PWMA 2QDDA 5G4WA 5E5CA 3V7PA 1KW1A 1XCFA 4NL1A 3AI0A 2YZ5A 1WYIA 4Z1BA 2WSYA 1EHNA 2Y5SA 1DJIA 4UUIA 3W7EA 5BMWA 1K9DA 3V3WA 4GC3A 3L66A 1KQZA 1XYBA 1E4LA 5HBFA 1WNOA 2IPJA 3QOMA 4WLCA 4ZTXA 1JJKA 1LBMA 4BQ4A 4ZCWA 1RA5A 1CXIA 3HG3A 3WQFA 4F2BA 3MT1A 2VEIA 1KFWA 2GK1B 3QLDA 5HQEA 3S1GA 3UBPC 3LNPA 3RN6A 2DUZA 2PWGA 4X60A 5HNTA 2Z00A 2VI0A 2PRLA 3URNA 1PZ1A 2ACUA 3WLQA 2ADAA 9XIAA 1ZHAA 2ZDSA 4ZSUA 3FFSA 1AL7A 4W7UA 4MUZA 3ONBA 2JF7A 1DQWA 3LXCA 2OWCA 3V75A 2PA6A 2Z28A 2C0AA 1JFXA 2WBGA 3W38A 3WLIA 1YX1A 5EGRA 5HR7A 4CD6A 1JDAA 1PKNA 4HU4A 3IAQA 4KESA 5K4XA 3ZFHA 2CNCA 5J5RA 5AC4A 4TTUA 1N7KA 2V5KA 1GYMA 3GNOA 2RDTA 3WH8A 3DENA 4DO5A 3G1YA 3NZGA 5ABHA 1SVDA 4M7SA 1SU5A 2CERA 4O4VA 2CBJA 4B5SA 1F2JA 3TH6A 4S3KA 2PZNA 3TZFA 4ROQA 4KCUA 4UFLA 2NXHA 4ADTA 4C7GA 4M6QA 3W7JA 3OIHA 1BTMA 4RKAA 2WB5A 1GQJA 3IIXA 3ARUA 1GHRA 3EKZA 2D69A 2JGQA 4ZQOA 4HMEA 1QWKA 3EWXA 1MOKA 2VVSA 3ALGA 1TVNA 1UH3A 3VGHA 1P7TB 3WFLA 1FUYA 1S5NA 3B8SA 4PUKA 1B3YA 1XR2A 1GEHA 2YDRA 1G01A 3UY8A 5D2VA 3UCDA 3LY0A 4YHGA 3NVVB 1EOMA 1GOWA 2QMKA 4JFVA 1EFZA 5ABEA 1C8VA 2OGYA 3EWYA 4MZ1A 5A69A 1XUZA 2O56A 4GA8A 1XIEA 3WDPP 7TIMA 2F2HA 2A5HA 1F07A 4J5NA 1NAL1 4HA0A 1H6VA 1OFOA 3M46A 3SUWA 2ESCA 3M5YA 3STFA 4O1EA 2GUUA 3CK5A 3E0VA 1PZ3A 3ZVIA 4L80A 4IJBA 1XLDA 1O95A 5HMDA 3UW6A 2E9MA 2PRMA 2PDHA 1KM3A 5XIAA 3M7WA 1O5KA 4PCSA 3EF6A 1VCFA 5EL1A 4NX5A 3MV01 2W63A 1UPPA 3VOGA 3DIPA 5FF4A 1GYNA 1K6AA 2CBVA 3BAWA 3EAUA 3LI1A 3B8DA 2ZC8A 1OF8A 3HFTA 2O92A 3W9ZA 2OLHA 4PA8A 2CZVA 4ZO9A 4Q8WA 4Q8VA 4O11A 1V3LA 1S3TC 2OQLA 2WMJA 2YDAA 3R8GA 4HHLA 2V3EA 4QXIA 4WXYA 2F38A 8RUCA 3C0LA 4E8DA 5CGTA 4JN7A 1H62A 2J7EA 4BKNA 1WZMA 3PG9A 3UZ5A 1KLZA 3N34A 3E2VA 1UKSA 4GGBA 2I9EA 1XRSA 3ZYZA 2VVNA 2Q3OA 1W5MA 3CUGA 3HJEA 4H4PA 4MWAA 1FEBA 1HGWA 1QI5A 2X40A 4GXWA 4DM1A 4BI7A 4ALDA 1QK0A 1UC5A 4R9OA 3NPXA 2HBVA 4M29A